1FRXA

Structure and properties of c20s fdi mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVSPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site-directed mutagenesis of Azotobacter vinelandii ferredoxin I: cysteine ligation of the [4Fe-4S] cluster with protein rearrangement is preferred over serine ligation.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 32
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frxA00
3MMCB 2FJEB 3MM9A 1JNZB 2ZVSA 3MM6B 2XSJB 1R27B 1AXQA 1FDAA 1RGVA 1H0HB 2V4JA 1Y5IB 1SIZA 1BLUA 3MMCA 1FTCA 1GTEA 1Y5NB 1FF2A 1FXDA 3MMBB 5E7OB 1FDDA 3OR2A 1FRMA 2C42A 3LW5C 4XDDA 2C3OA 1FRLA 3MM7B 1WTFA 1C4CA 1FRJA 5CH7B 5BYQA 3MM6A 1FRHA 2WSEC 1B0TA 1SJ1A 1F5BA 3MMBA 2UZAA 4ID8A 2VPWB 1JNRB 2C3PA 1BWEA 3MMAB 4Y28C 3EUNA 4DHVA 1FRXA 2Z8QA 4RKUC 1FRIA 1KQGB 2FJDB 1DAXA 1FERA 1DFDA 2FD2A 2PA8D 2FJBB 4KT0C 1KEKA 2VPYB 1Q16B 1BD6A 1FEHA 3EGWB 1BQXA 1XERA 1FXRA 1GT8A 1PC4A 3IR7B 2IVFB 3C8YA 1VJWA 3IR6B 2O01C 1FRKA 1PC5A 2XSJA 3MM7A 1F2GA 2FJAB 2VPZB 3MM9B 1CLFA 1SIWB 1H98A 2GMJA 2WSCC 1B0VA 1FDBA 4OV1A 2C3MA 4AYBD 1H7WA 1K0TA 1Y5LB 6FD1A 2PMZD 1FD2A 1G6BA 2PDAA 1B0PA 1A6LA 7FD1A 1DURA 4XK8C 1FDNA 2VKRA 3OR1B 1C4AA 3MM5A 2Y0SD 4L6V3 4XDCA 1H7XA 1GTHA 1ROFA 3EXYA 3MM5B 5L8RC 1HFEL 5BYSA 1FCAA 2WAQD 2C3YA 1KQFB 1F5CA 5FD1A 3OR2B 3MM8A 2C3UA 3HKZD 4OMFG 4CI0B 1G3OA 3MM8B 2V2KA 1Y4ZB 1BC6A 1D3WA 1JB0C 2FGOA 2V4JB 3PNIA 4YDDB 2VPXB 1GAOA 2WB1D 1IQZA 3OR1A 3MMAA 2GMHA 5CHCB 5BYRA 1IR0A 3GYXB 6FDRA 3IR5B 2FDNA 7FDRA 2WSFC
chains in the Genus database with same CATH superfamily
3T6BA 4DV6F 1H74A 1WDDA 2YH0A 5DQGA 2MLZA 1REVA 1IKYA 2ZVSA 3CDBA 1BQMA 4X4SA 4U7UK 2X1GA 4ZP8A 2HQCA 3LWMA 4NZ6A 1CJTA 2HVZA 2NLWA 2W9AA 4QR2A 3MOJB 2IA0A 2MZSA 3M8ZA 1T9WA 2WZ1A 4KGXB 1KHWA 1RB0A 1JLGA 2IDLA 3C16B 5E7OB 4EWTA 1FDDA 3DCAA 1AT1B 3SFUA 2LEBA 4QPXA 3OXLA 2VBWA 3UCGA 2Y3YA 5LMNF 1RT3B 1WDTA 2VDIA 2JJ4D 3HHLB 2E1PA 2C3OA 4N47A 3VR1A 2HBYB 4CLWA 3R5BA 1HPZA 3D68A 1BQNA 1NH8A 1PBAA 3D9BA 3GJSB 4NLOA 2J6TA 4PUOA 4QCLA 2WONA 3QFWA 3DMJA 2WSEC 3Q24A 3MEKA 5B0DA 1NXIA 2W2MP 1Q7YT 1ULRA 5AE1A 2DNQA 5GADU 1NLKL 5IS2A 1FXLA 2IRUA 3D1QA 5KFTA 5LJ5Y 3EZOA 1X5TA 3CC7S 2QIFA 3ISZA 3NCRA 1DRZA 3SBMA 4X4PA 1YJNS 3DOLA 4WYLA 1S48A 4DSKA 3S8SA 5HL7Q 4ED7A 3DDIA 4ZPCA 3IRWP 2E5HA 1IKVB 1NDPA 1UP1A 3GFYA 3CWJA 3DGVA 5KFZA 2RRAA 2E1CA 5J2NB 1CJVA 4FF2A 2XO6A 3VAGA 3OLAA 3M1VB 5KFYA 1NEEA 2BJ1A 5H9EJ 1MWQA 3TW0A 4IOCQ 2V34A 3UCUP 3N6MA 1HWUA 1RKJA 1S6QA 5RUBA 1TKTA 2HHHF 1Y0HA 2CQHA 3DGPA 2FLPA 2EXUA 1S10A 1TTHB 1FXRA 2N3LA 4P73A 1KHVA 3PR5B 3PX4A 1J5EF 4O4RA 4KPYA 3HLUA 4HYKA 5F8JA 5GAEU 1KR4A 1RQ0A 2EG2A 3Q22A 4QPTA 4CTAB 2R7WA 3KKFA 2VBXA 4NXNJ 4IR1A 1A7GE 3CD6S 1NK8A 2VPZB 1WTBA 1FJ7A 2L3MA 3ILIA 3N5FA 4NL5A 2HHHJ 4UZBA 3QZ8A 4JI7J 2QO3A 1X4FA 3LPYA 5BR8F 4FBTA 4Q44A 3OSNA 2VIHA 5HQLA 2C2RA 3MGJA 3R5DA 4OZ2A 2MZJA 3OXFA 2XYHB 2DYAA 3Q8PB 2OFHX 4LF6F 4G6VB 4DR1F 3RTVA 2HHXA 1AFJA 4CO3A 4CTAA 2UXBJ 4N5SA 1RACB 5J2PA 2ACMA 2HFOA 1T7PA 2VF3A 3E2EA 4K0KF 1RWPB 2DGXA 2E5IA 2HK2A 1VQ9S 2F8MA 3GCXP 2P8IA 3P96A 1RAOA 4MKBA 4O4GA 4WJBA 1R6VA 3GV8B 2OUGA 4EYHB 4UUWA 4F02A 2KKHA 5CD4H 3OV7A 4ZS6A 1HFEL 3RB4A 3BQ1A 5IM0B 3GE9A 4ICLA 4Y2KA 3VGTA 1SB6A 5M2UA 1HNZJ 2R7SA 4LFBJ 4KSEB 1PJ7A 1WG5A 5J2NA 3IAS9 3K5PA 3HKZD 1LWEA 5IXUA 3MAHA 4PCQA 3TX0A 4QYZK 3HULA 3QSIA 2I38A 2XCPA 3OL7A 4YDDB 2E5GA 5B0GA 4ECRA 4EZ6A 1S9EA 2J9CA 1GAOA 2B8PA 2AZ1A 3OR1A 1RCXB 4DZDA 4J9PA 5K20B 3JSMB 5ETPA 2LDIA 2PI5A 5D4LA 3M2RA 3B4MA 6FDRA 3BO3A 2X1FA 4HVZA 3CEDA 3FDSA 3R2CJ 3TUJC 4C97A 2KYXA 3EVMA 4NLTA 2HBQB 2NYHA 4DSLA 4ZHRB 4CZCA 2JRSA 3H90A 3OTEA 1NKCA 1WWHA 3MM6B 3BF4A 1S72S 1R27B 1AXQA 2ACYA 1VRQC 1ZTTA 1SJQA 2HRYA 1SKSA 2NZ4A 2ZD1B 3GSDA 1WKKA 1SC6A 4LFAF 1QSYA 1T02A 1JQGA 4I67A 1GX5A 4KGZB 1F0XA 1FXDA 3NP5A 4P2XA 4X65F 5J2QB 1JLGB 2Z4PA 3D28A 2GZOA 1KTVA 1T3NA 4WIIA 1UMJA 4NI2A 3CCWA 4N8NA 1QLNA 1UKUA 1QUVA 3CDUA 3HHLA 2PA3A 3LF0A 3QWPA 1UZDA 3W63A 2DNLA 3UPFA 4JI4F 5A76A 3UDVA 2H3EB 2FGCA 4CLLA 5DJBA 1DQ9A 3OT9A 1RBOB 2DEJA 4IFVA 1U2RA 2PIIA 3BEGB 2HGLA 4PXBA 5KFIA 3KK1A 5GADI 2XMMA 4X4OA 1M5PC 4DG1B 1UCNA 1WKJA 4NI2B 1C0TA 4OYBA 1FRIA 2OPSB 3AXMA 4RW8A 5A8WB 1TK8A 4E2FB 2UUCF 4JI4J 2GVZB 2R8GA 4M5DB 5HBMB 1WF1A 2Y8YA 3THVA 2QGFB 3MEEB 1HBMA 2FIUA 2HGNA 2PA8D 3A1YG 4LSNB 2R8KA 4ECXA 1VFJA 3W64A 1Y10A 1RZMA 1N34F 4DJBA 4Q0BB 5A2QY 2FUG9 4WXOA 3BQ0A 1BD6A 2ZJRQ 2ZBPA 1FO1A 1RAJA 2OSRA 4HI1A 1GX6A 2C1EB 3O44A 4NEYA 5D4NA 2ZE2A 3RRKA 2ZJPQ 3W60A 4DR5J 3ZZTA 1J2VA 4FNHA 3GFZA 4NCGB 2GA7A 3T6JA 4FS2A 2LECA 3UR3C 3ZZZA 5T14A 1SKRA 3RZAA 3MD1A 4DMZA 4LF8J 3DLKA 5K14A 1Q53A 1TL3A 1RUSA 4TY8B 2ZKUA 4NLYA 3D54A 3NGRA 3A8KA 2IDEA 3N4WA 2QYCA 2GFFA 2HNDB 2BV3A 4WPAA 2B51A 4XIUA 1R31A 3ENWA 1IKXA 1N5VA 2OPQA 2GHVC 3Q8YA 4LBIA 1K0VA 3MR3A 4DPTA 1ZTWA 2DISA 4CLZA 3IM9A 1SJRA 4ZJQA 1S1UA 2OD4A 2F9DA 1H72C 5G4DA 1SQGA 5KT4A 1TL1B 3ZZUA 5KFDA 1JLBB 4F25A 1T3OA 4K4WA 2DCUB 3Q89A 3OJUA 3CCVS 3BSNA 1V9OA 2JLEA 1T05B 2OEMA 3P4UB 1GQEA 4KFBB 1X9WA 3M8QB 4BC7A 4WTOB 4Z2XA 2ZH6A 3OD2A 3W61A 1XQIA 2CPIA 3MI7X 4XDCA 1T8EA 4N41A 3C15A 2CPYA 2E1MC 1E6VB 3W5ZA 3KUEA 4O3PA 5D3GB 1RTJB 3OR2B 1YRTA 4PPDA 2UVUA 3MM8A 3M30B 4FYYB 2HBZB 2BRLA 4IDKA 2KM8C 2LU2A 2AMCB 2A6OA 3BREA 5J1NA 2C2EA 4PG7A 4DV0J 3V81B 2HWTA 4J9LA 5B08A 2LP4A 4ZIVA 1JB0C 4TN2A 5HO4A 4OYXA 2GIFA 2XULA 1U1MA 3KLVA 3R6GB 1T94A 3EPGA 3T41A 4TVAB 4FBUA 5IWAJ 3UD3P 3AB4B 1N5QA 3NGSA 3TAMA 5F8IA 1T0TV 3TUZC 2AJ4A 3VALA 4LF4F 2V8DA 4I68A 4J91A 2R8JA 3MM9A 4PXDA 1BGXT 2R7RA 2D1CA 1JNZB 4W4MA 1RLDA 5DLFA 3FCVA 3NKYA 4ECSA 2J7UA 3PTWA 3TRGA 3L9ZA 3LOUA 5L9XA 2CJBA 5DDOC 1ZETA 1K9MT 2C2ZB 3PM9A 5DGAA 4C8YA 1AW0A 2E29A 1FTCA 4B3MJ 3RAMA 4BWMA 4A8XA 3R7BB 4DR2J 2U1AA 3KHRA 1RK8A 5F0UA 4DR5F 3V6DA 3ILJA 2FYXA 3JSRA 3C14A 1YHQS 1S0OA 1OMSA 1S0NA 2GGPA 2Z58B 5L1KA 4OYAA 1YBUA 1WEXA 2DH7A 1URRA 2O1PA 2HW3A 3Q8RB 1CULA 4ZPVR 4I7FB 4PZVA 2I6WA 3HSDA 4OI2A 3VVTA 2E7VA 1ZBTA 2V50A 2AX0A 2Z0GA 4K4VA 4OZ3A 5SUHA 5D3GA 4URQU 2FHKA 2CQDA 2B7BB 2E66A 2FHOB 2JOQA 4KIAA 4TNOA 4Y28C 5ETOA 4O3NA 2IC3B 4UY8T 2XMVA 4C7QA 4FXWA 3M9NB 3P5TL 1WI8A 3W66A 2OD6A 2UP1A 3IC1A 4DQQA 3B8HA 1GMUA 2Y0BB 3KFWX 1JMTA 1YITS 2YNHA 5HN0A 1WC0A 1N34J 4PR6A 4IO9Q 4OZ5A 4LVOP 4FVMA 4OHYA 2EK6A 1E6YA 3PXGa 2OPQB 1SUQB 1TL7A 2KYZA 3PIOQ 4KTQA 2BEFA 4QW8A 4DSFA 1W25A 3A12A 2Q79A 2QX0A 3PYGA 3OHAA 2W9BA 1HBOB 5A8KA 3HXMA 4URGA 3H4BA 2I9SA 3PV8A 3JQMA 3LGNA 1HNIA 3ZO7A 6AT1B 3AA9A 1KDNA 3N6NA 3PFOA 4CLPA 4PG8A 1FRKA 2GO9A 2WBMA 3CDWA 1H2UX 3KG0A 1HI1A 1UTAA 4P75A 3ZFVA 2CQPA 3IP0A 3MUVP 4DF4A 4LF8F 3HK2A 3FNNA 1PO6A 1CLFA 4ZPAA 1WHXA 2CVEA 3NRBA 4HLBA 5L38A 3M2VA 3FFIB 4Z7YA 3CCQS 3SCJE 5IT4A 1Z2ZA 1HW9A 2UVRA 1S1XA 3VHQA 1U09A 1PYTA 2BMBA 4DSEA 1D1UA 1P6TA 3SYZA 5L9NA 1WOOA 4AFFA 2DVIA 4PG6A 4X65J 4DQRA 4LF7F 2JEFA 2MJUA 5EN1A 3B6BA 1DURA 1RU2A 3BKTA 4R25A 1KLMA 2HPUA 4DPWA 1V5IB 2A2CA 1EHWA 4RBUA 5AXNA 5KT3A 2VKRA 5GAHI 4D3HA 1RBLA 1WC4A 4RW8B 2ZM6J 3K8VA 1SXLA 2J6UA 3GU0A 3EGNA 3OFFA 4Z37A 5CCMA 3MM5A 4V19J 3RG6A 1XNRJ 1H7XA 4YOEA 2QG9B 3R5JB 4F67A 1KQFB 3QYYA 4YB1P 1RKIA 3T1AA 2Y1RI 1HWJA 1RHJB 4YDXA 2RRNA 4U7CA 1JXLA 5IT9Y 4XPCA 1G3OA 2NXEA 3RJMB 4KC5A 1JLEB 3H5XA 2B43A 1N5YA 2XZWA 2Y1LB 5B0CA 2YNGA 3QIPB 4HTJA 2IVYA 3ZTRA 2VUGA 2JC0A 4R5PA 3MMAA 4DL3A 2DHHA 1X5OA 4N8OA 5CHCB 1X4GA 2GJIA 2RKIB 4KRWA 4WK3A 3SV3A 4DQSA 4FVCA 3TANA 2DGTA 1X9MA 2XQCA 1TVRA 2GVZA 4DDFA 3AJ2A 1MN7A 3RUBL 4CH0S 1YRXA 1IM4A 4Q2MA 1NM2A 3WX4A 2EFPA 2E7XA 3NGKA 4P74A 3K5NA 2BUNA 2MZRA 4WE1A 2VODA 2UXDJ 4DR6F 1FDAA 5F3TA 3TQEA 3BQ2A 1XEZA 2OPPA 3I0SB 4B9UA 5BJRA 1U24A 1JXVA 3D4JA 1N33F 2RMLA 2UUAF 1Y5NB 1FF2A 1DHMA 4KY3A 5CAAA 1VBXA 5KG1A 4FF3A 4EO6A 2ZWOA 4Y3CA 2L9DA 2IM1A 3FZBA 1WELA 2MSTA 2DBBA 2W24A 2ZHOA 3IWLA 3FC9A 3M8WA 1HARA 3T19A 1LNQA 4LSZB 1FKPA 2AYEA 1SVDA 4K2XA 4OQJA 5BYQA 2J0WA 4K4YA 5F8LA 3AHPA 1QVGR 4C8LA 3LTOA 3PKYA 2QL5B 4HDHA 5HP1B 3BPDA 3ET6A 1LW0B 4LT6A 3N79A 2YWWA 1RWVB 4ID8A 2VPWB 4ED0A 4DR3J 4E0DA 3KXDA 2A1BA 2HQGA 1Q86T 2M8DB 4TU8A 1CULB 1HBUA 1NO8A 1SC4B 4Y2CA 5KG6A 3UN2A 3KLFB 4ILMA 4C3LA 2KTQA 2HZAA 1B7YB 1B64A 4RKUC 1KQGB 2M5YA 3ZTPA 2H5EA 4DL6A 1KVJA 1I3OB 3DLEB 3MECA 1SKWA 4E98A 5IQ6A 1M5HA 3VAFA 2AP6A 3GLJA 1T9XA 1QAYA 1CG2A 4RW4A 3TJ8A 3D6TB 4RW7A 2FJBB 2I5JB 3BKUA 4A46A 4ZMMA 4DV3F 3HSGA 1GXUA 2K2PA 3G9CA 1ZAWA 2F40A 4BCAA 2GCFA 3K89A 1QDUB 1NK4A 1L3UA 3IRXA 2GNKA 2YNFB 1TAQA 2GC8A 4I6AA 2DNYA 3LQVA 2PO4A 4NWBA 3MUTP 4DL2A 3FCHA 4CNZA 1ZYQA 1VQ4S 2P9CA 2MKKA 5IC4B 4AL6A 2KM8B 2CQ3A 2IAJB 1MWZA 1YGYA 4PAAA 1RT2A 1UA0A 2YY3A 1DLOB 2MYFA 3AH6A 3KLIB 4AQYJ 3EZUA 3N6LA 4G1IA 2WVEA 2HHWA 3BBFA 4CLUA 2E1AA 3W2VA 1D9AA 3LUYA 4KO0B 1UJ4A 5D0GA 3SSRA 4EGLA 5KT2A 2Q43A 3BDPA 2ERRA 3DOKA 4ED6A 3KUGA 1YJTA 5CXTA 2GMJA 5KG7A 1UWBB 3THTA 2XZDB 2PSZA 4IO1A 4RUCA 1H7WA 3RR8A 4XTTA 4ED5A 2WVDA 4NEZA 1K0TA 3FMBA 3LH2S 4GO7X 1PG5B 2KXFA 4DL5A 1HBUB 2G0IA 3P8BB 1RT7A 1M5VC 3ILLA 1UW9A 2OH2A 1VQ8S 4ES1A 1SQEA 3KMQA 2FVRA 5KFWA 4CDIA 3JYTA 2LEPA 3WZ0A 2DNKA 4KPCA 5GMDA 1KFDA 3IBFB 3LO3A 4DEZA 2KVIA 1GTHA 2P9GA 2ROEA 5HVHA 1RHQB 2OMOA 2DO0A 4O44B 1OY6A 3M8RA 5GMEA 2KN4A 4NLSA 4OLPA 5A8RB 2XB2D 1FWPA 2Z30B 3HO1A 4K0KJ 4X4UA 5HLFB 3MCNA 3M9OB 3ZTSA 1UW4A 2ABYA 1C1CA 1FKPB 1APSA 1RT4B 1IBLJ 4KGMA 2OAUA 4ANDA 3GTYX 1RHMB 3MCOA 2DGUA 2VG5B 5F9LA 4OX6A 3OSPA 3I87A 3KHGA 3O8WA 4R0EA 2FDNA 3W5XA 2DJWA 4A48A 1RTHA 1TP7A 2A0FB 4DR7F 4MTPA 5CYJA 4LQ9A 1XNQJ 2FJEB 2CWKA 2UXCF 5B0BA 1MN9A 2W9CB 1JKHA 4WE1B 2K06A 3AOCA 4RLEA 4ZITA 2E5LJ 1MROA 2MQMA 4U95A 1UZHA 4F3OA 1EJ7L 1Y00A 4J9UE 3W7BA 3POTA 2CA9A 2DEIA 2NR0A 1D9DA 2OFGX 1VK8A 5I3UB 2YKMB 2YKAA 5C2GA 2L41A 4J7CA 1O51A 2SXLA 3MM7B 4MKAA 4QWDA 1M1HA 4ETXA 1KONA 1IKXB 2O66A 3UWTA 3O3LA 5LOQA 5I42B 1IM6A 1DARA 2UZAA 4NXMJ 4ZVSB 2H5JB 2OHDA 2MQQA 2F1FA 2JNJA 4OYWA 4L73A 4DV7J 2B4UA 3VAHA 2PMWA 4RO0A 4OL8A 2LQ9A 4I1TA 4PWDB 2QMWA 3BM7A 1PGZA 2MY7A 2QTWA 1S1XB 3AA8A 3OUYA 3H5YA 5HROA 4OYZA 1S6UA 3LP2A 3H2LA 1ZS6A 2RDIA 3HD2A 3J7Z5 4USWA 3N5BA 2W2NP 3CVKA 5A2QU 3H4DA 5J2QA 2YX4A 4MIAA 2ZZTA 4DS5A 3RGIA 1W2BR 4JI8F 3CCZA 4OI6A 2N7YA 4X4QA 5DG9A 2XGPA 2F63A 2WVBA 2CQBA 5EUHA 5LM7E 2ZUGA 3JXOA 1S1TA 4KGVB 4S0MA 3PEHA 1X31C 1M1GA 4KKOA 3K58A 1Q16B 2BANB 4A4JA 3OTOJ 1VQ6S 2DB1A 1KVIA 2B4PA 1OSCA 3C8YA 4WK1A 4C48A 5KOWA 4DS4A 2FJWA 1C0TB 4XO0A 1BE4A 1U0HA 4CYUB 3MXHP 2K7JA 4IG3B 3BZQA 5KG0A 4X66F 4IG0A 4JB8B 4U8VA 4O3OA 2NXCA 4QOTA 2AWZA 3MURP 1YJUA 4V1Ak 3CTRA 4ANCA 2BE2B 2XM3A 4OI0A 4URSA 1IBCB 3W9IA 2ZDOA 1RHUB 2DHXA 3R97A 3IG1A 1RJJA 1TV6A 4KQZA 3CMAS 1ZH5A 5C24A 5IV4A 3AQPA 3ZXWA 4WZQA 3CJSA 4OZ0A 3HHDA 4P7TA 5B0EA 4ZP6A 2XMAA 2VICA 4HHJA 3K57A 3O5TB 1QAJA 1N0VC 2RHSB 4ERDA 4DPOA 3SMZA 4WZMA 2DIVA 1NZAA 4QU6A 4OYOA 2YNHB 2GAHC 2HHPA 3HJFA 5KTQA 3CC2S 2DTJA 1X4AA 1LWEB 3FQKA 2YWHA 5C2CA 4WCEQ 4DXLA 2PT0A 1NSQA 1XR5A 2DGVA 3HCXA 3FKBA 4AD6A 3J7YI 1UAWA 4DSJA 1N54B 4I7FA 4ER8A 4YY3F 3M9MB 1S9FA 2LCWA 4JOUA 4JI3J 4QIVA 4FPRA 3PDNA 2ZFHA 1Q8LA 3CSKA 1X4EA 2A18A 4ZKAA 4FZVA 1A9NB 4JYAF 3GILA 4QWCA 3R8YA 3QT5A 4WFZA 2PEHA 4USIA 2HIYA 1WKLA 1CC7A 4OYMA 1NDLA 2FHJA 3V6HA 4OMFG 1YI2S 2MKHA 1NPPA 2PC6A 2ZKTA 2AZ3A 2V2KA 3TVKA 5J2PB 1R7IA 4QR0A 4TU9A 1OSDA 2OP5A 2R7UA 2ALYB 4L3KA 3W2VB 1LWFB 2HKEA 5DG8A 5DG7A 3HPOA 2BX6A 2YNIA 3KLFA 1M1KT 2UXBF 2R8HA 2XY5A 2UUCJ 3GIIA 2DXFA 1IBKF 2M2BA 2HRTA 2GV1A 2HHVA 3LP1A 4JBCA 3PRDA 1FNMA 2R3VA 7FDRA 4DV6J 4FF4A 2PFDA 1MNEA 2RVJA 5JVHQ 3CDEA 3QRQA 2XYPB 2RNEA 4ZP7A 1HWLA 1MW7A 1RYSA 1OYDA 1UEUA 1IR2A 1XK8A 2B4OA 5F8HA 2DPIA 1RAHB 4OZLA 2HWIA 2PGCA 5ETLA 3C19A 5LXYA 5CYMA 2GQCA 4CH1A 2X7IA 1RT5B 3I0RB 5L39A 2RS2A 2Q1LA 4RW4B 1EIYB 4ES2A 1GFWB 1JJCB 1D09B 3KLHA 3ZZYA 4TY8A 1U7LA 2X3GA 3PZPA 2K8GA 1NDCA 4ZVHA 1WF2A 2OSQA 2YNIB 2ZNZA 3LW5C 3Q2TC 2Y1IA 2DGOA 1KWMA 1JLQA 4DX5A 3M1VA 3ZTOA 4ZVEA 2F5GA 1YVFA 2V0NA 5C5JA 5J2MA 1DQAA 1O0PA 2CJAA 2MKYA 3ET6B 3L95X 4CRJA 3OL9A 3DRSB 2BXJA 3SIPB 1VK3A 4R5PB 3NNAA 1KOHA 3DLGA 3BPSP 3PY8A 3JAMY 1JLCA 2AHOB 2H51B 2HNYB 5DGBA 4QYZJ 2KHCA 2E9RX 1FEEA 2DGSA 2ZH1A 4RNOA 2YBVA 3GYGA 3KNGA 2HZCA 3M6VA 1S9GA 4Y2MA 4FDFA 3UE2A 3ZZPA 4ID5A 2XMKA 5J1EA 1U8WA 1KEKA 1YWXA 1CJTB 2XHWA 3VTIA 1UVIA 3OFGA 1XJWB 3TQ1A 1HNWJ 2HLUA 2MKJA 3U1MA 4LFBF 2HNDA 4RNFA 2AYMA 5ADZA 3T5LA 3M8PB 3FVYA 3JTNA 3C66A 5T7LA 3V6JA 2VASA 2NS1B 3H98A 1QTNB 1R0CB 1UFLA 4AQYF 1RWWB 2EW9A 2D3OR 1FFWB 3SQGB 5HVFA 3VAJA 3D0GE 5EHHA 3GV5B 2FVQA 4HHUA 4J9VA 3GCWP 3MM7A 3K59A 2BJ9A 2Z57B 4OZ1A 3VF0B 2E7WA 5FLXU 1UVKA 1ELOA 1F9FA 2BOAA 2CJQA 2VU5A 4RW9A 5HMYA 5I3UA 2RSQA 3MEEA 4M8LA 5D0EA 3A3PB 2DR7A 3C2PA 1RADB 2ROGA 1JLAA 1S4FA 3OL6A 1H98A 1H73A 1TMJA 3G87A 2IBKA 3KLGB 1NCLA 1FDBA 2V9KA 2B3TB 5E33A 5HROB 4AYBD 2CIMA 4YS2A 1Q0NA 4RNMA 2XLJA 4QU7A 3DXSX 2QYGA 2LEAA 4P9SA 5HJXA 1M5SA 4ED1A 1KC8T 4DR6J 4LIRA 3MPVA 3PJWA 3HVTB 4OJ1A 4WKYA 1H2VZ 1JLAB 2KFZA 3KUHA 1SL2A 3LP2B 2W9BB 1YX2A 1NRKA 3C46A 2FC9A 5EWFA 5KFPA 1YJ9S 3BGRB 2ZM6F 1JXEA 1U49A 4JI0J 3TUIC 3GIKA 2Y0SD 4HACB 1WUUA 1O8BA 2JH3A 3BN7A 1P1TA 2P2CB 3J80U 2VG7A 2C3YA 3F44A 1YKWA 4KYZA 3V4IA 3RW6A 2HHSA 4RNHA 1X7VA 1SC1B 1S9GB 3S01A 1T9YA 3EGVA 2QSFA 3NWGA 2V5HG 4DR1J 2CFXA 1NKBA 3BB5A 4N7TA 3G6ES 1HD1A 1KN6A 2Y8WA 3D3BJ 1NHUA 3LA0A 3LALA 1GH8A 1HIYA 4RBTA 5J2MB 3W3SA 3SCKE 4LF2A 1TR0A 1ZA1B 1X60A 1LK7A 4RWWA 2CPEA 4Y2IA 3JSMA 1S6PB 3KJFB 2CWXA 5KT5A 4WU2A 3UD4P 1XBWA 1R3NA 2LQ8A 3A13A 1YLXA 2HAFA 4EEYA 3IGVA 4NZ0A 1U1OA 3TYTA 4EI2A 4LRCA 2LQBA 1XR7A 3X3UA 4I4BA 4K4ZA 2MEWA 1EAYC 1X4BA 4J9NA 4LF9J 2BBEA 4X62F 3DI6A 3DRRA 3KJQB 2FLNA 2JWNA 5E3QA 5A8RA 3I0RA 2IJRA 2OI2A 4ZP9A 1VQOS 1S1WA 1SI9A 2AJ2A 4LBHA 4O0IA 2R2UA 2GO8A 2JX2A 3F73A 5LMUJ 1QTMA 5AJ3J 4OYIA 4QIEA 3TZYA 1FRHA 5J1EB 3L4BC 2J0SD 2ILZA 2DGWA 4OV6A 3MEDA 1UVJA 1WNEA 1GEHA 5HLFA 1F5BA 3OQ2A 3TNVA 4PWUA 3KNAA 1VC5A 1LWXA 2DR6A 3HT0A 5ITHA 2JFDA 3M7VA 2KL8A 4DV2J 3TX8A 1F6TA 5IM0A 2EC0A 3TUPA 2C22A 1T9TA 2K1RA 3ZZRA 4TXSA 2KT5A 3CIZA 4F4ZA 5C42B 2D3ZA 2BE9B 2H9ZA 4ZOSA 4A8MP 2XS2A 2GS8A 3V2UC 1TKXA 2PN6A 4GC6A 1W26A 4YFUA 3W9HA 5JUMA 1K8AT 4C3MA 3TZWA 1QJHA 2FD2A 3HHEA 2G0CA 2G2YA 2XTJP 3DDNA 5C42A 4ZVGA 2BM0A 2W7OA 2J6SA 5D0RA 1HQEA 2B6AB 1LKZA 3DM2A 1S5ZA 3DFEA 3DYAA 3D6MB 1WI6A 3MAQA 2BABA 3EGWB 3DRPB 3DOKB 1H3DA 2AT1B 1TKXB 4DUZJ 1N36F 1OS5A 1VJWA 3R2DJ 4UTGA 4C11B 3T1HJ 4CH7A 1XMOF 1BQNB 3RAQA 4NLQA 1C1BB 2ZBIA 1WOSA 1VGYA 1N52B 4WP8A 5EX0A 3QJJA 3CO9A 2N3OA 1FFGB 1FX4A 1REGX 1ZAVA 1Y3JA 2EC2A 5IWAF 3QJLA 3DI6B 2BW2A 3MEGA 3PVXA 1F2HA 1S7IA 1X4DA 2WSCC 1TV6B 3GWCA 1VQ5S 4EUVA 1RTJA 2YTCA 2YNFA 1HQ2A 3DLKB 3I0SA 1HQEB 1WHWA 3MCMA 2XLIA 3HSJA 3OBIA 4J90A 3MR7A 3CULA 3WDOA 2CNOB 2RU9A 3QQCD 1P1LA 1S6OA 3BGLA 4WYWA 3MPDA 4O3RA 3PW0A 1QE1B 1N33J 3F0NA 4M1KA 1N32J 3UDCA 1PAEX 3A8IA 3NEKA 2BANA 3J7AN 1EKRA 3NS6A 3NNCA 3OTBA 1ZM4A 1Q82T 1RHKB 3U02A 2FHJD 1S1UB 1ROFA 1OIAA 4Q0BA 3ITHA 3GONA 4ZN3A 2L08A 4KAIA 2N82B 2AW0A 2IA6A 5B7WA 2GIQA 1HR0F 4JI1F 3GG0A 1QVFR 1MU2A 1NJIT 3DMJB 2JEIA 5LSRA 1Y4ZB 4QW9A 2WTFA 1N32F 3UI3A 1HNXJ 4OHVA 1U25A 5JXSA 1FWLA 3BO2A 1IQTA 4U96A 3KDNA 5ETVA 3R7SB 4PG5A 2ZJQQ 3KDOA 1NJYA 4USJC 2WB1D 8AT1B 2C2OB 3NOGA 3C3LA 5JMNA 1K1SA 1IN0A 4BWJA 4EK2A 3FEYB 2DKOB 4DBQA 1TELA 5G0RA 4A47A 2QLBB 3C16A 2JZ5A 2MKCA 3CB4A 3VGUA 4WIQA 4YR2A 4USKA 3E01B 2WHOA 2H65B 2K3KA 1SH3A 3ZTQA 1AA1B 2D9PA 4BLGA 2HNZA 4J37A 2R2SA 5E41A 4LVNP 4MFBB 1H0HB 2R7OA 2YNGB 3QIPA 2D3UA 3U1LA 4KHMA 1XMQF 3P49B 4B3MF 5LL6d 3K17A 4LSNA 3J81U 1TVRB 2NYIA 2IVMA 1FK9B 3QGGA 1N36J 4KKOB 2GQQA 2RQMA 4XPEA 4J9QA 3G86A 3PJ9A 3W62A 3ZNUA 3IS9B 2QA4S 2HLTA 1FRLA 1WORA 2WCXA 3GJTB 3NXZA 3SSQA 1RHRB 1JIHA 3KLEB 3I9ZA 1GMVA 3BGUA 5KFKA 4DPYA 3RBDA 1FK9A 3JTPA 4G65A 4LJMA 5F8NA 2ZH4A 2IYGA 2L48A 4CIOA 3EPIA 3KJNB 1JNRB 4DCPB 2XY7A 3TAPA 4LFCF 1GMWA 4ANEA 3HF5A 2VG7B 3V4IB 1U6FA 2ZC4A 3MCSA 4DG1A 2UXDF 4W92B 1T9UA 3KHLA 3M32A 2B7CB 3D0HE 4G1PA 1FESA 2CQ2A 4X84A 2O67A 1RTDB 1TUVA 2ZOFA 4YB5A 1SH2A 3T5KA 2BZ2A 3ICLA 3Q8UA 4B17A 4LRFA 5F8MA 1KTQA 2EBGA 4AT1B 1DFDA 2RILA 2H48B 2OTJS 5I3PA 4CCHA 2EFOA 3VZIA 3CDAA 1VRTB 1C1CB 1X5PA 2MQ8A 3D7SB 3RBXA 4DPUA 4O4GB 3FMWA 3CW2C 3FK4A 5D77A 4K7QA 1R43A 4DX8H 5KFCA 8RUCA 1NH7A 2FTRA 3GJQB 2RUSA 2IVFB 2MSSA 2MQNA 2OO4A 4F26A 4YHHF 1RU1A 2HFZA 4X64J 2EWHA 1MMNA 2ILYA 3D66A 3VV2B 1CQMA 2DNRA 2W9CA 3VVUA 4KBIA 1IBLF 4YUDA 2DK2A 3QAEA 1HW8A 1ZPWX 3L7PA 2VDHA 3QMQA 1RDRA 5I4MA 3VAKA 2W7AA 2WBRA 1YIJS 2Q66A 3DOMB 2ZHBA 1K1QA 5LJ3Y 1XNQF 1B0VA 2DNOA 1RTIA 1EX8A 3R5CA 1RWMB 4J9MA 5JVGQ 5FJ4A 4OFZA 2HHQA 3GSIA 4U67Q 3LANA 5HAOA 5LSOA 2I2YA 4ZPBA 4DPXA 6FD1A 2AQ4A 2BACA 2PDAA 3W8GA 4NLGA 3KLHB 3MEGB 7FD1A 1VQMS 3OTDA 4E8UA 1U45A 1LFWA 4MKYA 2B56A 5EDWA 2LDYA 4ICLB 3LGHA 2G9OA 4OIXA 2CDRB 3G8TA 4DV5J 2UXCJ 1U02A 1VJQA 3MD3A 2B9YA 1NHVA 2F9JA 4B3TJ 2HHTA 2WAQD 2VQEF 3DRSA 1VQPS 2AJ1A 3ONQA 2RHQB 2ZH8A 3VAMA 1VQKS 2JC1A 3MMJA 3V81A 3AJDA 2CYYA 3CCUS 3QBCA 5DLGA 4OHWA 3MM8B 2V4QA 2AF6A 4O0NA 1YDLA 3PRBA 2AYGA 4MJKA 1BC6A 1OJ4A 3NS5A 1PYSB 2BQUA 4LF5J 4HH1A 1WG1A 1F5AA 2N7CA 1EB0A 2KXHA 2K1RB 1V5VA 2BJDA 1WSRA 3GR0A 3QLHB 3OFEA 1FJCA 2W4PA 3M6UA 2VFSA 4JUZA 1EP4B 3DHWC 4JI6J 2GMLA 2AKWB 3TA1A 4KO0A 1UA1A 4KJIA 2NREA 1TKTB 2V67A 4TLQA 2DRAA 2QFJA 4C8KA 5KG3A 1YRUA 2JHEA 2EK1A 3UNGC 1P8GA 2CJXB 4KV8A 4I6YA 4ZA1A 3DXBA 4ZVUB 5KG5A 2UUAJ 5C25B 2VOPA 1FKOA 4ATNA 1GTEA 4Y2AA 2NPFA 3SDEB 4F04B 5F0WA 2ZBCA 2V8GA 3OR2A 1UJ5A 3H0PA 2J0QD 2UVVA 4MK9A 3RU0A 1Q78A 3CC4S 4A8YA 2V6AA 5K8OA 2MKIA 4NMXA 1KD1T 1C2PA 3KYLA 4DFMA 1C4CA 4RR5A 4JI8J 2RU3A 1TKDA 2XI2A 2I5JA 4WBFA 2YKNB 2DPJA 2R7VA 2AEMA 5K8PA 1CJVB 2LXFA 4ZLJA 1XN9A 2RT3A 2H4YB 2ZDPA 3SFGA 4GKKF 5FDLA 3JAMU 3GMGA 1N5TA 4LUBA 4DUYF 3QRRA 1BWEA 4CT8A 3VAIA 4NMLA 1HQUA 1TKZB 3MMAB 1T03B 4WP9A 1HPZB 3GIRA 4ZVOB 1MLAA 1X9SA 5DQHA 1U0HB 2JL9A 4CYUA 2LYVA 3NS7B 3TOQA 4EO8A 2FZGB 3PYEA 1Z2LA 3MFHA 4EBCA 1U1PA 4BDPA 4NCBA 3UR0A 1D8ZA 4YP3A 4AXIA 1O6XA 1P9QC 1DAXA 1T05A 4R8UA 2LA4A 1PIEA 4LBPA 1HD0A 1FD8A 1YBTA 1YG0A 3TEGA 4M5JA 4NA1A 2EFGA 2Z56B 4BBYA 2HFSA 3OJSA 1GMWD 3U1NA 3GIMA 1RTDA 1KBRA 4PUOB 4L74A 4QZVB 3SSSA 3CMQA 4MKVA 9RUBA 5EGYA 2P5VA 1T95A 1VR6A 4X4NA 4CLKA 4NCGA 2E44A 3CJ0A 1RWXB 5D4OA 1VBZA 4DSIA 1TMMA 2MZQA 4H4KA 1SL0A 3RBEA 1QAXA 4EU0A 4RUAA 1AZSA 3HDSA 5M2RA 3CO0P 1XMOJ 2OPPB 2HVHA 2W8KA 3BBBA 3D1HA 4I2PA 4LRAA 4KE5A 1YJWS 2YWKA 1KSPA 2RF2B 4ILLA 2XYGB 4NPOA 1CQNA 2J8AA 4J9KA 3PJXA 4YN3B 3FFIA 1OPZA 3TO8A 3W5YA 1LXJA 2RKIA 3UDLA 2EFVA 2O3DA 3HVTA 3IGNA 1D9FA 5H9EK 1RBAA 2K7KA 2ZD1A 4YB6A 2AGOA 3MPWA 4EBEA 1X0FA 2GIRA 4DUTA 2MZ1A 3IA0A 1EETB 3LPEA 4ES3A 5ETQA 3C6TA 4LR8A 2E5LF 4L76A 3R27A 2BKPA 1JLFA 1FD2A 2PMZD 5GAEI 4F4YA 2FVPA 2B0GA 5F8GA 3QZ7A 4ZVTB 3HZGA 1Q5VA 4PEOA 5FDLB 5B0AA 1RTHB 2ZH9A 3M8PA 3CF5Q 5MLCV 4DLGA 1RYRA 2QA2A 1ZM2A 2V8HA 3L3CA 3AJ1A 1RP5A 3OR1B 1C4AA 5KFLA 3PR4A 2G2ZA 3FQLA 4NYOA 4PPZA 3N01A 2FLOA 5E3AA 3UVJA 4U9RA 1I94F 2C28A 3VQSA 4JI1J 1F5CA 3BSAA 3L09A 1U8SA 1DBDA 5IFMA 5MAOA 1UEVA 1UJ6A 2YQ3A 2ZZNA 2GQ2A 2OELA 3JTOA 1WC6A 2M52A 2AU0A 5E3RA 4DR2F 3T1YF 3RW7A 2VQFF 1ZZNA 2DR8A 3S6EA 1NHKL 4ZLLA 3ETMA 2BKOA 3NAHA 3G4SS 2C2KB 1RE1B 2IM3A 3PX0A 4RJVA 2WK4A 4C6AA 4ECQA 1JJ4A 2YKMA 4O3SA 1VHFA 1XIQA 1QSSA 2OMLA 3Q8VA 3M2VB 3NGTA 2RQKA 1OY9A 3E51A 3IR5B 4TYAA 2I0XA 4ED4A 2QLFB 3O1LA 2CJ9A 3H40A 1EP4A 3D2WA 1DZ5A 3PO5A 3AB2B 1AFIA 2RUGA 3FEXB 1NK6A 2B8QA 3DYAB 3QLHA 1NSPA 5AXMA 5A0YB 5IQQA 3DRYA 1S12A 2CQIA 4RZRA 2JVRA 3SQGA 3M8SA 4K4SA 1HNIB 1NK5A 1KOOA 1Y11A 3QT6A 2QV6A 5HVGA 1NK0A 1VBKA 4FYDA 1HBOA 5A8KB 2OEJA 3GP9A 5KT7A 3TAQA 3K5OA 4LF9F 4DV0F 2UVWA 2ADCA 1TAUA 1P27B 4K4XA 4DCOB 2KZZA 4NA2A 2AYBA 3SXLA 2ADBA 3TP2A 4B3OB 3DDKA 2WVFA 4XDDA 5DZ6A 2GHWA 3BJYA 2COLA 3C6UB 3HFKA 4K5RA 1WC3A 1K47A 3TJ9A 1VOMA 1UEKA 3US5A 5HK4A 4DUYJ 3I4PA 2R2RA 1KKHA 2KFNA 3V4MA 2VV5A 3K5MA 4O44A 1S4EA 2UU9F 3ZC4A 3FEZA 2UU9J 3BV8A 1FRXA 2B5JA 3LP0B 1N5SA 2V63A 3JSYA 1B3TA 2M88A 4Z7CA 1XC9A 2V2ZA 1R8AA 4Q43A 1ICEB 5KFBA 3DRPA 5D0HA 2NXNA 5LMNJ 2DXDA 3QIDA 4TYBA 4ZVRB 2HZVA 3DLEA 3D5MA 3MECB 3LAKA 1E6VA 4BHQA 3KMSA 2KT2A 3SV4A 2XY6A 5BXIA 3QT8A 4GVLA 5K8NA 3A8JA 2KHDA 3J7ZT 4LFAJ 1WHYA 2RRBA 2C2DA 2LQ5A 2EEYA 3AOBA 4KH0B 4ZPTR 1NJXA 1SH0A 2BW7A 1MMLA 3EJMA 2KVQE 1HKAA 1RT5A 2X1AA 4PYAA 3D3CJ 4J9OA 2H1YA 1TL1A 1YJ7A 2O01C 5HATA 4DI6A 3LWLA 2IRYA 4UUXA 3BGFA 4ZJOA 3KLIA 5F3ZA 5J1PA 1CVJA 2U2FA 1KFSA 1LWCA 1NB2A 4UOHA 4ZCMA 2BM1A 2QLJB 4RW6B 5ETMA 4B9NA 4LQ3A 2LA6A 5AXLA 2VBZA 1SIWB 4MK8A 2IM0A 1I6JA 3UDEA 2MB0B 2CPXA 4LRBA 2X3DA 4B3RJ 3I9V9 1R0BG 5HMZA 3MAAA 1IR1A 1RSCA 1LXNA 4NA3A 3KJVA 1R6YA 4OV1A 3WC0A 1KRPA 2C3MA 4NLXA 4ED3A 4BS2A 2KZMA 4HR2A 1LWFA 2W1BA 4M5IA 1S1WB 3BDEA 5CA5A 3B78A 2Z2LA 4KGKA 5C24B 4XK8C 2Q3PA 2HQ3A 1F60B 1G4CA 3UO0A 4DFPA 5L46A 3CUNA 1V6HA 4FN5A 3KK2A 4ED2A 2EBEA 1K44A 4F2SA 1TFYA 1U1NA 3J7YU 1LQ9A 4OLOA 4IRKA 4JV0A 3HT3A 3SCLE 2EKNA 1S6PA 2MTLA 2MPUA 4EZ9A 1DTTB 4LF1A 1S97A 4KFBA 4L72B 5HI7A 2V68A 4NXMF 1FKAF 2KRBA 5DDRC 4LF7J 1FT8A 3K8WA 2VQFJ 1S1TB 2V2VA 2QE5A 3I56S 4DN9A 2R2TA 2Z2ZA 3F41A 2QN6B 4FKYA 4DX6A 1YBAA 2MGZA 5LMUF 2JLFA 5DM7Q 2KJVA 2W4DA 2KO1A 5KFNA 4B3SF 2R7XA 3VQTA 4B08A 2ZBRA 4WU3A 2QL9B 3I82A 3T5JA 2EG1A 3A3OB 2CZ4A 4HH0A 4PYDA 4UOCA 3G6XA 4CO0A 4HKQA 1XR6A 5K14B 3RYLA 1U6BA 5CYQB 4AE5A 4EMDA 2DY9A 3OUYB 5ETRA 3OVSA 4GKJJ 4AUKA 3G96A 1KLNA 5CD4A 2LXIA 1VDHA 4ZIWA 3CD7A 3B54A 3U27A 2B4VA 5B09A 1Z4UA 2ROPA 2XBPA 4NLUA 5F9NA 3MR5A 2POKA 3PFEA 1PBUA 3TA0A 4DFJA 3SI8A 3KTQA 4DR4J 2M3DA 3EZ5A 1GXTA 3NBPA 3H5SA 2JLGA 4B9MA 3TR5A 4YHHJ 1MSWD 4FP9A 1CJKB 2MHNA 3QO9A 2P9EA 3EE3A 5CH7B 3GB0A 3NGUA 1IXKA 2W4CA 3G82A 1KVKA 4U8YA 3AQOA 1DTQB 2RS8A 1IKWB 3E01A 1SJ1A 3PACA 5LXRA 4WFBQ 1HMVA 2CQGA 3UN3A 3D1OA 2F4VF 2XNRA 1TUWA 2DITA 1NAQA 3I5AA 2FB0A 3OVBA 3AD8C 3FRZA 3EDQB 4FPIA 2YX7A 2DY1A 3FRYA 2HNZB 3TA2A 2HRUA 4FYWB 3S7RA 1R0AB 1U2CA 1HBNA 2CQ4A 4H4OB 4ZVPB 2R7QA 3J81Y 4RX6A 1PCAA 2V8PA 4ALZA 2V4RA 2OGUA 1RTZA 5C25A 4RW6A 3AD9C 4DR3F 2K3IA 4KT0C 4LSLA 5CYMB 2MGZB 1AROP 1WSVA 1RA6A 2X1BA 2ZNYA 3RRHA 5FIIA 1Q5YA 2XC9A 2ZH3A 4ENOA 1R8BA 4F50A 2DCLA 1LK5A 1V3SA 4F4WA 2D7SA 4M94A 4DR4F 2AJQA 3HHLD 1FTRA 1QM9A 2DNZA 2GJFA 3D67A 5KFEA 1WC5A 2EVZA 3B82A 3J7A1 3PHEA 3GYNA 5AE3A 2IFXA 3IR6B 3DU5A 2ZH5A 4CO2A 4A8QA 2XSJA 5KFVA 2QLWA 4MIWA 4OHXA 2XG8A 1HHSA 4AXJA 4Q8FA 3WHIA 4NYZA 2FC8A 3TZXA 2VFRA 1ZM3A 4IQXA 1BXNA 2YQ1A 2J76E 3M2RB 1VQLS 1AUDA 4OJGA 2VFVA 1OWXA 5D4PA 4NLDA 3AOAA 2RDDA 3UNYA 2JFKA 2GGPB 3DKDA 4EBDA 1FJEB 3DLBA 2G4BA 2NQPA 2IMOA 1WF0A 4WP3A 3GFXA 3TZZA 5KT6A 4YR3A 4JV2A 1F9HA 1VQSA 2AEFA 4G1QB 3W2WB 3Q8SB 2HFUA 3CXCR 4GC7A 1UVLA 1B4SA 4PKDB 2IHR1 3PX6A 3WC2A 4X2BA 3H20A 3FSXA 1LV5A 4IFYB 3CNQP 4C2MA 4PWWA 4DV1J 5EWGA 4JI0F 2G13A 2A2DA 1SBRA 5KFQA 1J5OB 3CJ8A 5KFMA 2QEXS 1PKUA 1WG4A 2AIRB 2BJ3A 1X4CA 3O6QA 4UT4A 5EWEA 1L3TA 3EM1A 4F2RA 5LT5A 3K0JA 2G1DA 4YEAA 4DL7A 2DHSA 1RTIB 1IBMJ 1WOPA 2R4FA 2XZTB 3CJQA 4IFYA 4NYPA 3S1TA 1IJFB 2CDQA 3ZZOA 1SJFA 3DOMA 1I1GA 5ETNA 3QRPA 1LOUA 3TARA 4JV1A 1YJVA 3DM2B 4OZJA 1M5KC 4O23A 2M4MA 4C3KA 1URNA 1M5OC 4WFAQ 2E1RA 3AODA 4H54A 3JSBA 3T9NA 3CIMA 4UOGA 1YTYA 3TJAA 4JI5F 1IJEB 3LAMA 3TEHB 4NXNF 4DCJB 2EPIA 3GG1A 3H2UB 1VS3A 4M5HA 4F3MA 5HP1A 3Q83A 5IV3A 2GW8A 2D41A 2WB4A 4MH8A 3IM8A 1WACA 2VG6A 3MMCB 4HL9A 5DO2A 2DNMA 4DFKA 2XS7A 3OHBA 3MEDB 1ZAXA 1MMDA 2XSJB 4QWBA 1SC3B 1L3KA 1ACMB 1U1KA 4PXCA 1NNDA 2A3JA 3HKWA 1WEYA 2KG1A 2BR0A 3DRXA 2IBOA 1RXOB 3M8QA 1TL4A 4ZK7M 5IZHA 2NXUA 2YH1A 1N48A 1AUSL 1UWAA 5F41A 4ETZA 2J0XA 2QJ3A 3P3DA 4X4TA 4TQRA 2YPYA 4RNNA 2J9DE 3ISND 1JLBA 4CQ1A 4M5NA 1S1VB 2IJFA 4PQUB 4C98A 3I32A 2I8EA 1CC8A 4D3GA 2HQDA 3CJ5A 4B9LA 4F8RA 1FRJA 3PYDA 3T5HA 1PYOB 2OJ3A 2HYIB 2FVCA 4FNIA 1S79A 5GAGI 4QIGA 3M30A 1TL3B 2HWHA 2MZTA 4GKKJ 2YKPA 2YPZA 2OPRA 4TKTA 4CWBA 3BGOP 4ZJLA 3H8YA 2WRMA 3HJVA 2HFVA 2I1RA 3BYPA 4DHVA 1EETA 4CO1A 4F3QA 4F0MA 2Z8QA 2CPJA 2VC1A 5A0YA 3IS9A 1HLWA 2XWXA 1Y9OA 1S49A 2AV5A 3A3NB 4FXVA 3TVZA 1RWNB 4CLTA 4USMA 1N5YB 2DR5A 2JEGA 3AY0A 5K8MA 1K73T 4NLVA 2M0GB 3I31A 3NLCA 3CMES 2BKNA 3BSOA 1WC1A 1YZ7A 2UV8G 3PCOB 1T03A 4P72A 2D9OA 4KH1B 3KG4A 3KK3B 5EX3A 1HNVB 4FKXA 2AX1A 2RB7A 3HD1A 1NJZA 5H1SV 2BVZA 3MZIA 3GIJA 2ASYA 5CYQA 3ULHA 1HR0J 1TU0B 1FEHA 3I96A 3G6VA 3X1LB 1AZSB 2FZCB 1KLMB 5K9FA 3QWUA 1BWVA 1VYAA 2V94A 3IR7B 3Q86A 4KHRA 4MIBA 4RPFA 2RH3A 4TU7A 1FJGF 4DZ6A 4HTIA 1FJGJ 4K4TA 4O3QA 4DWIA 3R5AA 4WTYA 4H4MA 5GAGU 2KG0A 3KK3A 3MR2A 4QJVA 1FFSB 3CE8A 4ZVFA 3QNWB 4UF4A 2NUUG 4I69A 2KI2A 1HMVB 1Q79A 2XHCA 3QGHA 4R8UB 4DF8A 1KNZA 2M7SA 3A8EA 4A8OA 2F8HA 1JLFB 4ZN1A 3G82B 5DDPC 4DL4A 2Z2MA 1RWKB 2EFNA 1YQHA 3WX8A 2VA2A 2UUWA 4M63A 1RT1A 2W2OP 3OW2R 3K2YA 3W9JA 3PO4A 2F4FA 1B0PA 2DT9A 1FVQA 2DO4A 5DM6Q 3HHKA 1JK9B 1VRUA 2VKZG 2Y1JA 1SQFA 2ASJA 3RB0A 1Q4RA 1YZ6A 3FBFA 3W65A 1SUQA 1TL7B 1L5UA 1OYEA 2HGMA 2XS5A 2VHGA 3G6YA 3N9UC 3NY0A 3MM5B 2HMIA 3FSYA 3BSCA 4RUBA 4QQBA 1NPRA 2G2OA 2VQEJ 3UN5A 2DGQA 2NSCA 5FD1A 2FVSA 3AXKA 3BH6B 4IFVB 3KK1B 2CPHA 2YWFA 3FBCA 3GZ7A 1N6QB 2P6SA 3OL8A 2PFFB 2VFTA 3R3TA 1HNXF 3G71S 3T1YJ 3A4TA 3JQKA 1D3WA 3FCWA 1HI0P 3I5CA 1S9EB 3N28A 4LF6J 2YXLA 3DLGB 2VFUA 2DHAA 3GR1A 3IMQJ 5DZ7A 1RWUA 1FWKA 2HURA 3EWGA 4ID5B 5DS7A 1ZOTA 2W01A 2E9TA 1RAFB 1FNXH 3OXGA 4CO5A 1M90T 4N56A 2RDJA 4JI7F 1C0UB 2W2QP 2APOA 1FKOB 2WSFC 1Q7LB 2Y9HA 3EGZA 4I0WA 2HNYA 4C0BA 4YMEA 4ZLPA 5KAKA 3M05A 3BO4A 2JEJA 2VOOA 3G8QA 4HHHA 3T9ZA 3W2WA 4DV5F 4M95A 3FBEA 4J5OA 3W1YC 4HEA9 1U2FA 2MLYA 1HQUB 1TKZA 1YJRA 2ZVIA 2QMXA 3HFZB 4QR1A 2Z2YB 1SL1A 3M6WA 2RQ4A 4OYPA 4RU9A 5K5MA 2HMIB 1QE1A 1U26A 1RT7B 1AB8A 3IWNC 1E6YB 2RAQA 3SZ2A 4WF9Q 5D78A 2CG4A 1OY8A 2AJ0A 3EYZA 1N8RT 1DJ0A 1X4HA 4OX9F 2AGQA 2ZC3A 3KJVB 2EFQA 1J5OA 3GV7B 1UL3A 2QT7A 4JYAJ 1VCTA 2MHEA 4DOZA 4LFCJ 5H9FJ 2OKQA 4K5SA 4DV4J 4Y00A 3DGPB 2UUBF 4MAKA 4ELUA 4N76A 4ZHRA 2IC3A 2HBRB 2ZEJA 3CJ2A 2B5JB 3EUNA 4KR0B 5AXKA 4X64F 3H59A 3ETOA 1TK5A 2PD1A 2VONA 1RAGB 1RT2B 1WHVA 2W8LA 2R8IA 3CCJS 4ECUA 1X0PA 2FJDB 3T3FA 1RISA 1RI7A 2IPOB 4IOAQ 1UFWA 3R5GA 1FERA 1F1BB 3IG1B 3MHYA 1HHTP 3C6UA 4G1QA 4H4KC 2VPYB 3DHXA 4NE9C 2ZZMA 3CPWR 4B9SA 1NU4A 4CM0A 4IG3A 2VJVA 4ILRA 2CZVC 1HL6A 3C14B 3ENQA 3HVRA 2CJKA 1RAAB 2LFVA 4USTA 1P9YA 1IUJA 4LRDA 1U1QA 4Q45A 4DV7F 4AL7A 1W7WA 1XERA 3CJRA 4Q8EA 1S57A 2DNNA 1GT8A 4CLSA 4IR9A 1F3VA 1LW2B 1VLOA 3DOLB 4HT7A 4MK7A 1KQSR 1RT6A 4C8OA 1PC5A 3EXCX 3V6KA 2CJYB 3ENVA 1JJHA 2FJAB 3MM9B 2ATLA 1S0VA 3MOZA 2CKWA 2EKYA 4LIWA 1U1LA 1Y7PA 2KT3A 2LLZA 3JS9A 3EVOA 4M5MA 3ENAA 2JDJA 4NZ7A 2KXNB 5BR8J 3EDRB 3L7UA 3Q23A 1UVNA 1WD6A 1YK9A 2WONB 5KFGA 4DN0A 1VMBA 4F4KA 4GVBB 3QT7A 4A8WA 1BY9A 3HMJG 1BHNA 3PIPQ 1NSKL 3PHTA 2CQ1A 1AYEA 4Y0FA 1Y5LB 1TZ0A 1RABB 3H7HB 3QAUA 3BGRA 1HNWF 3OTOF 2Q6BA 2DXEA 1J5EJ 4IDKB 1HYSA 1KP6A 1VRUB 1U47A 4DR7J 2GJ2A 4UY85 1PILA 3I5BA 2J9EA 1SKUB 3HHLC 3GFHA 5IT0A 2RQCA 1BQMB 3QO9B 9ATCB 2JVOA 4RWXA 4FYVB 1I94J 5FLXY 4Y34A 3CD5A 4OX8A 1JX4A 1VQ7S 3MDFA 2L9WA 3JB9k 3F56A 4ZLNA 2BOPA 2C2NA 1VLYA 3POTB 2CNLB 4TY9A 2X51A 4PQAA 1S77D 1DTQA 3OPKA 1RAEB 1HI8A 1NZ8A 3PEJA 5CABA 2BE7D 2OPSA 5A8WA 2V4JB 3AT1B 3HFVA 1NDKA 2CRLA 2HQIA 2VPXB 2YVSA 1R8CA 1XTZA 3P45B 2CUYA 4NRUA 4USVA 3KOAA 4OI1A 1RT3A 1VIXA 1SV5B 2GMHA 1HBMB 1N0UA 3IWXA 4ZVQB 4J9RA 4IOBA 1LEOA 3ILOA 2YX1A 2DHGA 1H6KX 4IQMA 5G0RB 3TI0A 3P6YC 4PG4A 3K5LA 3IBCB 3NOCA 2PE8A 4MFBA 4UOFA 1EQMA 2Q6CA 4ZCLA 5THWA 4JI3F 4HACA 4U6PA 3CCLS 2HVDA 1RA7A 3H2VE 2FHMA 4LR9A 4USUA 1D0EA 2V4JA 2DRBA 1NK9A 3OLBA 3OVAA 3M8YA 2J8SA 2CQ0A 1BLUA 4L3NA 5KFAA 3TVYA 4F4AA 1JWWA 3M6XA 1XWLA 2GHPA 3IXQA 3MMBB 1U0SA 7AT1B 1HYSB 4Y6IA 4F36A 4PWDA 1NPKA 1KQKA 3THPA 1ZM9A 2J9DA 2CQCA 4DUZF 2YKOA 1LWCB 2QLXA 3DLJA 3KLEA 1I5OB 3HHNB 3ITHB 3D6HB 3M2UA 4ECVA 3NMAA 1CSJA 2CPZA 2NZCA 4XAKA 3R7NB 4PABA 4MYUA 3MM6A 1TK0A 3E8OA 3RAXA 5KFUA 5KG2A 3KLGA 1B0TA 1MU2B 1U48A 3L7OA 2V8VA 4OX7A 4PRFA 2M70A 2RIJA 3SQOP 1Z1ZA 5KFHA 4JI2J 3EX7B 3K7RA 1CS4A 3UQSA 3IBWA 2HS0A 3NGDA 2RD5C 1FE4A 3AAWB 3AD7C 3CCSS 2MQLA 3T1HF 2BDPA 4KHPF 4X4VA 3PKMA 1FHTA 3CCMS 5CCLA 1J27A 5U47A 2LXUA 3E3XA 3ZZ0A 1FI4A 1UWBA 2DNGA 2DNHA 2BJ8A 3IFEA 5T7LB 1X8DA 3PW2A 2QRRA 3G8SA 4FYXB 1N4LA 2FJVA 4KV8B 3DN9A 2VB6A 1S99A 5HJYA 3GQCA 3LP0A 4EYIB 3R1LA 1SJ4P 4B3TF 4AL5A 2D69A 2QA4G 3DLHA 4JV5J 4K50A 2F8EX 3BR9A 1S1VA 1Q8BA 2HVEA 2IYIA 2QC3A 3VWSA 4I56A 1M0SA 3TWZA 5HQ8A 3JYTB 2IAJA 5A6PA 5ETSA 5C7PA 4WKRA 3TAMB 1OPIA 4B9TA 2VZ9A 4G3IA 2KFYA 2BQ3A 1S0MA 4CM2A 1KS2A 2XLKA 2BYCA 1C1BA 2DRDA 1YSJA 3WIVA 1RT6B 1N88A 4WFXA 4Y65A 4JI5J 2HVIA 2UUTA 2YQ0A 2MXYA 2XO7A 1U4BA 5LSLA 4A8FA 3I4HX 3JQJA 1SCJB 4NASA 4B3RF 4OI4A 1S7HA 4IUFA 1B70B 2AD9A 2YKNA 3KG1A 2B6AA 3CCES 4WWSA 5DETA 4F0HA 2KRRA 2XMWA 2WW4A 4NLPA 5I3QA 1RAIB 2KU7A 3QPIA 2OEKA 2CAJA 4C0HA 5HSPA 1XMQJ 3WBZA 1HHQA 2E5JA 1T9VA 1G6BA 2BA9A 2LKZA 2NPIA 5KFRA 3V6DB 4LMZA 3QFHA 2LQJA 2BJEA 5KFXA 2NCKL 3MTJA 4R0JA 2H54B 3OTCA 4K8RA 4ECTA 1A0OB 1IWGA 4X66J 1S6QB 2W7PA 4J9SA 3HVAA 3IRXB 3PW5A 4B9VA 3NNHA 3MUMP 2CZ9A 3DU6A 3G2XA 2L9NA 1R8HA 2QZ8A 4IH7A 4QIWD 3R9LA 2MKSA 1RWOB 2DD8S 1IBKJ 5IC6B 2ATCB 5CQGA 4ZCIA 5KFJA 2XNQA 3EVWA 5GAHU 4X4RA 5E3CA 2LMIA 3GJRB 3R1HA 2C3UA 4C4WA 3NL0A 1BUXA 2BRKA 4GO5X 2P6TA 2WOMB 1NUEA 4ZPWR 1HBNB 2FGOA 2BE2A 4H4OA 1G7CB 1X5SA 2IRXA 2QSWA 1F9EB 2ASLA 2PMHA 1UPPA 2FLLA 2W2PP 3FSIA 3RRGA 2XCAA 3FBBA 4RW7B 2ZOGA 2DH8A 1WEZA 3DRRB 2MMYA 3CT9A 1DQ8A 3PW4A 1TUGB 2ZE2B 4PXEA 3J80Y 4P2MA 4UW2A 1IKVA 5KG4A 4YY3J 1Y3KA 2H5IB 4DV2F 1F3FA 4Q5VA 4F4XA 2AEJA 2J7KA 2R42A 3W8PA 1CJKA 2PEBA 4C0OC 1Y5IB 2FQQB 3FJ2A 4IH5A 1Q81T 1BMQB 1W2IA 1VQYA 2HSEB 2KH9A 2XMTA 1LW0A 2VD3A 3CJ4A 4K2JA 4IYQA 2R9LA 4I6WA 4F0KA 2GAGC 1FRMA 2C42A 3UVJB 4CT9A 2N4CA 1WTFA 3AFGA 3M2UB 3M32B 4P2FA 1VC0A 2OIHA 2V9WA 4LSLB 4I2PB 3B4DA 3UD5A 1HNZF 3CCTA 2VH7A 3NCPA 4ECYA 5KOXA 1CEZA 1PJ5A 5DQIA 3MMBA 3RR7A 1S76D 5H9FK 4P2SA 1VBYA 5CZXA 1GNKA 3CJ3A 2C3PA 4ZPDA 4C8MA 1OO0B 1OQ3A 2F7VA 4JI2F 3CJKA 4QBUA 5I42A 1CPZA 3BKFA 4UQGA 2FZKB 2ZH7A 4W98A 1RT1B 4CNYA 5ETKA 2ZHAA 1REVB 4MYTA 4ECWA 2XSFA 1CS4B 4CLYA 4ED8A 1SPBP 1PAUB 1XMBA 3CGIA 2CADA 3M4XA 2IM2A 3EMTA 1GXLA 2GVDA 4M5DA 3LGMA 3HP6A 1IKWA 2DH9A 4RW9B 1SV5A 1S59A 1B7FA 3KWMA 3C6TB 4GRSA 4P52A 4RUHA 5KFOA 4JV5F 3BS9A 3QGIA 1VRTA 3I55S 5AT1B 3BBCA 3PW7A 3RBZA 2FJXA 1CJUB 1VIOA 1Q95G 2IJNA 1HWKA 3V5RA 2VL1A 2NUHA 2QMUB 2GVDB 2DIUA 1TL5A 3D6FB 1BQXA 4OJHA 4P71A 5HBMA 3CJKB 3VCDA 5HQMA 4WFNQ 1PC4A 1D8YA 3VZHA 2DNPA 3U7JA 4MMOA 2B9EA 3I6PA 2CXEA 4UQTA 1FE0A 2RF2A 4CLFA 4H4MB 3CD0A 3MWBA 4ECZA 4KB7A 5JJBA 4ELTA 2HS4A 1QUPA 2D74B 2QL7B 4N77A 2MQPA 4DLEA 1R89A 3NAIA 4JI6F 4OJ3A 4USHA 3Q0AA 3UFCX 1DTTA 2MY8A 1MWYA 3QGPA 1CJUA 2ZITA 2C2MB 1N6QA 1HNVA 4P6QA 4LF5F 4OZNA 3O2IA 2UV8A 3UCZP 4CO4A 3H42A 4FXDA 1CBKA 3HX9A 4JP8A 1QSLA 5L1IA 2H4WB 2VBYA 3BH7B 3NWRA 2ZH2A 1EQ0A 2N4DA 4DV1F 1MROB 3BN4A 1QD1A 1VC6A 2XEXA 4DU8A 2XMJA 4L6V3 4MT1A 5L8RC 2DR9A 1LW2A 2HK3A 4YB7A 5IOLA 2F4VJ 4Q7AA 3KK2B 2OPRB 3NMRA 1VHIA 1TFWA 2YWEA 1V3RA 3SEOA 1FVSA 3HSZA 4F7VA 4QYRA 2G1HA 5E2QA 5E3PA 4CI0B 2JSXA 3BR8A 5KFSA 4X62J 1U1RA 2VG5A 3Q8QB 3MPUB 3NG8A 4V19X 3DNCA 1RT4A 3CCRS 1L3SA 2OLWA 2CPFA 2ZBQA 4PQUA 4GVBA 2HHUA 3CJTA 1EKSA 1I51B 2F65A 2WOMA 4C11A 3R6LB 3MAAB 4QWAA 3IN5A 2F3JA 5D6GA 1UVMA 2HAIA 4M5LA 5D15A 1IBMF 3SDEA 2MQOA 2IMWP 3FUYA 3WIUA 3Q2SC 3LP1B 4HDGA 3UW1A 5KFFA 4GKJF 1UPMB 3IO1A 1JLCB 1RCOB 4RBVA 3RB3A 1XNRF 5IT9U 4EFAC 1U6ZA 5AJ3F 1NK7A 1JJ2R 1QY7A 1RGVA 1FNOA 3GPAA 2HG4A 4B02A 1MG7A 2HFNA 4NCAA 1H2TZ 1SIZA 2J7WA 2V69A 2VG6B 2ZOMA 3ELHA 2XWYA 3MMCA 3OFHA 4CP5A 5AE2A 3HM9A 5M2PA 4FF1A 4HT5A 1EZZB 3H25A 4C8NA 3MFIA 2V2QA 2D3O1 1TQLA 1JLQB 2FY1A 2YWGA 2HEKA 5E0OA 3QSYB 4ZCKA 4I2QA 4ITSA 3VGSA 1GK8A 4DL0C 2J5AA 1VI7A 1NMEB 2IIHA 4OI3A 3QJPA 1C0UA 2RE1A 4WFYA 5DRKA 4K59A 4DV4F 5B0FA 4TQSA 2BQRA 4LF4J 1ZZFA 4A8KA 1G2EA 4DU7A 2FPHX 4A8SA 4OHZA 2IY5B 1PJ6A 1EARA 4C8ZA 3DC2A 2R7TA 1DLOA 2LVWA 2B9WA 2AJFE 2M9KA 3HI9A 3KHHA 4HI2A 1FX2A 2XI3A 1Q1KA 5SZTA 4Q2LA 3ISNC 3H5UA 2MJNA 3N0VA 5HMXA 2CNKB 5GMKa 2HS3A 4YQWA 1L3VA 1QAIA 1NJWA 2AGPA 2B9XA 4TLRA 4I2QB 1Q8KA 4DX7A 4YR0A 4FS1A 5CZVA 4IG0B 1RLCL 2LU1A 2VC0A 3FGVA 2VJUA 1NB7A 4B3OA 2GX8A 4QIFA 3ZNJ1 1ITPA 1IWAA 4LR7A 3RB6A 3QATA 1NBEB 3IAM9 2VA3A 2CG8A 1VQNS 3C15B 1LFPA 2ALZA 4NOHA 1G1XA 1VISA 2ZWPA 3EICA 4B3SJ 4L75A 1WJ9A 3SCIE 1F2GA 4M5GA 3NBPB 5E5NA 4C9DA 2ZUAA 4K4UA 1UETA 1V3ZA 2A10A 3MTKA 4IRCA 4RU2A 4NLWA 2CPDA 2A6MA 2CNNB 3PG9A 4IKAA 4NX9A 1R0AA 3DLLQ 4DQIA 2G0JA 2KB2A 3J81j 4ZDNA 2KDOA 3MR6A 5HMWA 3HZEA 1IVZA 4IRDA 1R8PA 5DDQC 4W90B 1O5JA 4DQPA 1A6LA 5ETTA 2W25A 2QA1A 2M8HA 1DY3A 1T11A 1SJ3P 1FDNA 3FZ2A 3P5BP 2YKQA 4NLRA 2ASDA 4ELVA 2MLXA 2XMUA 1OQ6A 2HQFA 3BYRA 2CVIA 4DV3J 3MF5A 1ZA2B 2WW8A 4GMKA 3PYFA 4P7VA 3EXYA 1HWIA 5GVQA 5A6WA 1IKYB 3NCQA 2KJWA 1FCAA 1UFKA 1ZPVA 5BYSA 5D8HB 2RJZA 4M5KA 4RL1A 3D0IE 8ATCB 4BC9A 3ADAC 5L1JA 1HA1A 3PRVA 4UZCA 2QFIA 4WXWA 2PI4A 1NKEA 3WQPA 4LREA 3VGVA 5L1LA 1FA0A 1NSAA 1PSDA 1Q8IA 2O5DA 2WVCA 3MPYA 4QWEA 2UUBJ 4U7UD 3PNIA 4P10A 2OTLS 2NSBA 5HANA 1B99A 2HIQA 4NRTA 4IH6A 4KHPJ 2MDAA 1JKHB 1N56A 1IQZA 2EI5A 4OX9J 1JLEA 2BJ7A 1H38A 2NXJA 5BYRA 2XGQA 2E9ZA 1IR0A 3GYXB 4I64A 3HVWA 2FY8A 5T41A
chains in the Genus database with same CATH topology
3T6BA 4DV6F 2YH0A 5DQGA 1REVA 1IKYA 2ZVSA 3CDBA 1BQMA 4U7UK 2X1GA 4ZP8A 3LWMA 4NZ6A 2HVZA 2NLWA 2W9AA 3MOJB 4QR2A 2IA0A 2MZSA 1KHWA 5E7OB 1JLGA 4EWTA 1FDDA 3DCAA 3SFUA 2LEBA 4QPXA 3OXLA 2VBWA 3UCGA 5LMNF 1RT3B 2JJ4D 3HHLB 2C3OA 3VR1A 4N47A 3R5BA 1HPZA 4PUOA 1BQNA 1NH8A 2J6TA 4NLOA 4QCLA 2WONA 3Q24A 3DMJA 2WSEC 3MEKA 5B0DA 1Q7YT 1ULRA 5AE1A 2DNQA 5GADU 5IS2A 2IRUA 3D1QA 5KFTA 5LJ5Y 1X5TA 3CC7S 2QIFA 3ISZA 3NCRA 1DRZA 4X4PA 1YJNS 3DOLA 4WYLA 1S48A 4DSKA 3S8SA 5HL7Q 4ED7A 4ZPCA 3IRWP 2E5HA 1IKVB 1UP1A 3GFYA 2RRAA 3CWJA 5KFZA 2E1CA 5J2NB 4FF2A 3VAGA 3OLAA 3M1VB 5KFYA 1NEEA 5H9EJ 3TW0A 4IOCQ 3UCUP 3N6MA 1HWUA 1RKJA 1S6QA 2HHHF 1TKTA 1Y0HA 2CQHA 3DGPA 2FLPA 1S10A 1FXRA 2N3LA 3PR5B 1KHVA 3PX4A 1J5EF 4KPYA 4O4RA 3HLUA 4HYKA 5F8JA 5GAEU 1KR4A 1RQ0A 2EG2A 3Q22A 4QPTA 4CTAB 2R7WA 3KKFA 2VBXA 4IR1A 1A7GE 3CD6S 1NK8A 2VPZB 1WTBA 1FJ7A 2L3MA 3N5FA 4NL5A 3QZ8A 2QO3A 1X4FA 3LPYA 5BR8F 4Q44A 3OSNA 2C2RA 3MGJA 3R5DA 2MZJA 3OXFA 3Q8PB 2OFHX 4LF6F 4G6VB 4DR1F 3RTVA 2HHXA 1AFJA 4CO3A 4CTAA 4N5SA 5J2PA 1T7PA 2HFOA 3E2EA 4K0KF 2DGXA 2E5IA 1VQ9S 2F8MA 3P96A 4MKBA 4O4GA 4WJBA 4EYHB 3GV8B 4UUWA 4F02A 2KKHA 5CD4H 3OV7A 4ZS6A 1HFEL 3RB4A 3BQ1A 5IM0B 3GE9A 4ICLA 4Y2KA 2R7SA 1SB6A 5M2UA 4KSEB 1WG5A 5J2NA 3IAS9 3K5PA 3HKZD 1LWEA 5IXUA 3MAHA 4PCQA 2I38A 2XCPA 3OL7A 4YDDB 2E5GA 5B0GA 4EZ6A 1S9EA 2J9CA 1GAOA 3OR1A 4J9PA 3JSMB 2LDIA 2PI5A 5D4LA 3M2RA 3B4MA 6FDRA 3BO3A 2X1FA 4HVZA 3CEDA 3FDSA 3TUJC 4C97A 2KYXA 4NLTA 4DSLA 4ZHRB 4CZCA 2JRSA 3OTEA 1NKCA 1WWHA 3MM6B 3BF4A 1S72S 1R27B 1AXQA 2ACYA 1ZTTA 1SJQA 2HRYA 1SKSA 2NZ4A 2ZD1B 3GSDA 4LFAF 1SC6A 1QSYA 1T02A 4I67A 1GX5A 1F0XA 1FXDA 3NP5A 4X65F 5J2QB 1JLGB 2Z4PA 3D28A 1KTVA 1T3NA 4WIIA 1UMJA 3CCWA 4N8NA 1QLNA 1UKUA 1QUVA 3CDUA 3HHLA 2PA3A 3LF0A 3QWPA 4JI5F 3UPFA 2DNLA 4JI4F 2FGCA 5DJBA 1DQ9A 4IFVA 1U2RA 2PIIA 3BEGB 2HGLA 4PXBA 5KFIA 5GADI 2XMMA 4X4OA 1M5PC 4DG1B 1C0TA 2UUCF 1FRIA 2OPSB 4RW8A 5A8WB 1TK8A 2R8GA 4M5DB 5HBMB 1WF1A 3THVA 3MEEB 1HBMA 2FIUA 2HGNA 2PA8D 3A1YG 4LSNB 2R8KA 4ECXA 1VFJA 1N34F 4Q0BB 4DJBA 5A2QY 2FUG9 4WXOA 3BQ0A 1BD6A 2ZJRQ 1FO1A 1RAJA 2OSRA 4HI1A 1GX6A 3O44A 5D4NA 3RRKA 2ZE2A 2ZJPQ 3ZZTA 1J2VA 4FNHA 3GFZA 4NCGB 2GA7A 3T6JA 4FS2A 2LECA 3UR3C 3ZZZA 5T14A 1SKRA 3RZAA 3MD1A 4DMZA 3DLKA 5K14A 1Q53A 1TL3A 4TY8B 2ZKUA 4NLYA 3D54A 3N4WA 2QYCA 2GFFA 2HNDB 2BV3A 4XIUA 2B51A 1R31A 3ENWA 1IKXA 1N5VA 2OPQA 2GHVC 1K0VA 3MR3A 1ZTWA 2DISA 1SJRA 1S1UA 2OD4A 2F9DA 5G4DA 5KT4A 1TL1B 3ZZUA 5KFDA 1JLBB 4F25A 1T3OA 4K4WA 2DCUB 3OJUA 3CCVS 3BSNA 1V9OA 2JLEA 1T05B 4KFBB 1GQEA 1X9WA 3M8QB 4BC7A 4Z2XA 2ZH6A 2CPIA 4XDCA 3MI7X 1T8EA 4N41A 2CPYA 2E1MC 1E6VB 5D3GB 4O3PA 1RTJB 3OR2B 1YRTA 4PPDA 4UY8T 3MM8A 3M30B 2KM8C 4IDKA 2BRLA 2C2EA 1W2BR 2LU2A 1QTMA 3BREA 5J1NA 4PG7A 3V81B 2HWTA 4J9LA 5B08A 5HO4A 1JB0C 4TN2A 2XULA 1U1MA 3KLVA 3EPGA 1T94A 4FBUA 3UD3P 3AB4B 1N5QA 3TAMA 5F8IA 3TUZC 2AJ4A 3VALA 4LF4F 2V8DA 4I68A 2R8JA 3MM9A 4PXDA 1BGXT 2R7RA 2D1CA 1JNZB 5DLFA 3NKYA 4ECSA 2J7UA 3TRGA 3LOUA 5L9XA 2CJBA 5DDOC 1ZETA 1K9MT 3PM9A 5DGAA 4C8YA 1AW0A 2E29A 1FTCA 3RAMA 4BWMA 4A8XA 2U1AA 3KHRA 1RK8A 5F0UA 4DR5F 3V6DA 3JSRA 1YHQS 1S0OA 1S0NA 2GGPA 5L1KA 1WEXA 2DH7A 1URRA 2O1PA 2HW3A 3Q8RB 4ZPVR 4I7FB 4OI2A 1ZBTA 2AX0A 2Z0GA 4K4VA 5SUHA 5D3GA 4URQU 2FHKA 2CQDA 2B7BB 2E66A 2FHOB 2JOQA 4KIAA 4TNOA 4Y28C 4O3NA 2IC3B 2XMVA 4C7QA 4FXWA 3M9NB 3P5TL 1WI8A 2OD6A 2UP1A 3IC1A 4DQQA 3B8HA 3KFWX 1JMTA 1YITS 2YNHA 5HN0A 4PR6A 4IO9Q 4OZ5A 4LVOP 4FVMA 4OHYA 2EK6A 1E6YA 3PXGa 2OPQB 1SUQB 2KYZA 3PIOQ 4KTQA 4QW8A 4DSFA 1W25A 2Q79A 3OHAA 3HXMA 3PV8A 2W9BA 1HBOB 5A8KA 4URGA 3H4BA 2I9SA 3LGNA 1HNIA 3AA9A 3N6NA 4PG8A 3PFOA 1FRKA 2GO9A 2WBMA 3CDWA 1H2UX 3KG0A 1HI1A 3ZFVA 4LF8F 3HK2A 2CQPA 3MUVP 4DF4A 3FNNA 1PO6A 1CLFA 4ZPAA 1WHXA 2CVEA 3NRBA 4HLBA 5L38A 3M2VA 3FFIB 3CCQS 3SCJE 5IT4A 1Z2ZA 1HW9A 2UVRA 1S1XA 1U09A 4DSEA 1D1UA 1P6TA 3SYZA 5L9NA 4AFFA 2DVIA 4PG6A 4DQRA 4LF7F 2JEFA 2MJUA 5EN1A 1DURA 3KK1A 4R25A 5AXNA 1KLMA 2HPUA 3NNAA 2A2CA 4RBUA 5KT3A 5GAHI 2VKRA 4D3HA 4RW8B 3K8VA 1SXLA 2J6UA 4Z37A 3EGNA 3OFFA 5CCMA 3MM5A 4V19J 1H7XA 4YOEA 4F67A 1KQFB 3QYYA 4YB1P 1RKIA 3T1AA 2Y1RI 1HWJA 4YDXA 2RRNA 4U7CA 1JXLA 5IT9Y 4XPCA 1G3OA 4KC5A 1JLEB 3H5XA 2B43A 1N5YA 2XZWA 5B0CA 2YNGA 3QIPB 4HTJA 2IVYA 2VUGA 2JC0A 4R5PA 3MMAA 4DL3A 4N8OA 1X5OA 5CHCB 1X4GA 2GJIA 2RKIB 4KRWA 4WK3A 3SV3A 4DQSA 4FVCA 3TANA 2DGTA 1X9MA 1TVRA 4DDFA 3AJ2A 4CH0S 1YRXA 1IM4A 4Q2MA 3WX4A 2E7XA 2EFPA 3NGKA 3K5NA 2BUNA 2MZRA 4WE1A 2VODA 4DR6F 1FDAA 5F3TA 3BQ2A 1XEZA 2OPPA 3I0SB 4B9UA 5BJRA 1U24A 1N33F 2RMLA 2UUAF 1Y5NB 1FF2A 1DHMA 1VBXA 4FF3A 5KG1A 4EO6A 4Y3CA 2L9DA 2IM1A 3FZBA 1WELA 2MSTA 2DBBA 2W24A 2ZHOA 3IWLA 1HARA 3T19A 1FKPA 2AYEA 4K2XA 4OQJA 5BYQA 2J0WA 4K4YA 5F8LA 3AHPA 1QVGR 4C8LA 3PKYA 4HDHA 5HP1B 1LW0B 4LT6A 3N79A 4ED0A 4ID8A 2VPWB 4E0DA 2A1BA 1Q86T 2M8DB 4TU8A 1HBUA 1NO8A 5KG6A 4Y2CA 4ILMA 3KLFB 4C3LA 1B64A 4RKUC 1KQGB 2M5YA 2H5EA 4DL6A 1KVJA 3DLEB 3MECA 1SKWA 4E98A 5IQ6A 1M5HA 3VAFA 2AP6A 1QAYA 1CG2A 4RW4A 4RW7A 4A46A 2FJBB 2I5JB 4ZMMA 4DV3F 1GXUA 2K2PA 3G9CA 1ZAWA 2F40A 4BCAA 2GCFA 1NK4A 1L3UA 3IRXA 2GNKA 2YNFB 1TAQA 2GC8A 4I6AA 2DNYA 3LQVA 2PO4A 4NWBA 3MUTP 3FCHA 4CNZA 1ZYQA 1VQ4S 2P9CA 2MKKA 4AL6A 2KM8B 2CQ3A 2IAJB 1MWZA 1YGYA 1RT2A 1UA0A 2YY3A 1DLOB 2MYFA 3AH6A 3KLIB 3EZUA 3N6LA 4G1IA 2HHWA 2E1AA 3W2VA 1D9AA 3LUYA 4KO0B 1UJ4A 3SSRA 4EGLA 5KT2A 2Q43A 3BDPA 2ERRA 3DOKA 4ED6A 5CXTA 1YJTA 2GMJA 5KG7A 1UWBB 3THTA 2PSZA 4IO1A 4RUCA 1H7WA 3RR8A 4ED5A 1K0TA 3FMBA 3LH2S 4GO7X 4DL5A 2KXFA 1AUDA 1HBUB 1RT7A 1M5VC 2OH2A 1VQ8S 4ES1A 1SQEA 3KMQA 2FVRA 5KFWA 3JYTA 2LEPA 3WZ0A 2DNKA 1KFDA 3LO3A 4DEZA 2KVIA 1GTHA 2P9GA 2ROEA 2OMOA 2DO0A 4O44B 3M8RA 2KN4A 4NLSA 4OLPA 5A8RB 2XB2D 4X4UA 5HLFB 3M9OB 1UW4A 2ABYA 1C1CA 1FKPB 1APSA 1RT4B 4KGMA 2OAUA 2DGUA 2VG5B 5F9LA 4OX6A 3OSPA 3I87A 3KHGA 3O8WA 4R0EA 2FDNA 2DJWA 4A48A 1RTHA 1TP7A 4DR7F 4MTPA 5CYJA 4LQ9A 2FJEB 2UXCF 5B0BA 2W9CB 1JKHA 4WE1B 4RLEA 1MROA 2MQMA 4F3OA 1Y00A 3W7BA 3POTA 2NR0A 1D9DA 2OFGX 1VK8A 5I3UB 2YKMB 2YKAA 2L41A 1O51A 2SXLA 3MM7B 4MKAA 4QWDA 4ETXA 1KONA 1IKXB 2O66A 3UWTA 3O3LA 5I42B 1DARA 2UZAA 2MQQA 2F1FA 2B4UA 3VAHA 4OL8A 2LQ9A 4I1TA 4PWDB 2QMWA 3BM7A 2MY7A 1S1XB 3AA8A 3OUYA 3H5YA 5HROA 1S6UA 3LP2A 3H2LA 2RDIA 4DL2A 3J7Z5 5J2QA 3N5BA 3CVKA 3H4DA 2YX4A 4MIAA 4DS5A 4JI8F 3CCZA 4OI6A 2N7YA 4X4QA 5DG9A 2XGPA 5EUHA 5JUMA 2CQBA 1T03A 2ZUGA 1S1TA 3K58A 4ECRA 3PEHA 1VQ6S 4KKOA 1KVIA 1Q16B 2BANB 4A4JA 2DB1A 2B4PA 1OSCA 3C8YA 4WK1A 5KOWA 4DS4A 2FJWA 1C0TB 4XO0A 3MXHP 2K7JA 4IG3B 3BZQA 5KG0A 4X66F 4IG0A 3MURP 4O3OA 4QOTA 2AWZA 4OI0A 1YJUA 3CTRA 2BE2B 4URSA 2ZDOA 2DHXA 3IG1A 1RJJA 1TV6A 4KQZA 3CMAS 1ZH5A 5C24A 3AQPA 4WZQA 4OZ0A 4P7TA 3HHDA 5B0EA 4ZP6A 4HHJA 3K57A 3O5TB 1QAJA 1N0VC 4ERDA 4WZMA 4DPOA 3SMZA 2DIVA 1NZAA 4QU6A 2YNHB 2HHPA 3HJFA 5KTQA 3CC2S 2DTJA 1X4AA 1LWEB 3FQKA 2YWHA 4WCEQ 2PT0A 1XR5A 2DGVA 3J7YI 4DSJA 1UAWA 1N54B 4I7FA 4YY3F 3M9MB 1S9FA 2LCWA 4JOUA 4QIVA 4FPRA 3PDNA 2ZFHA 1Q8LA 3CSKA 1X4EA 2A18A 4ZKAA 4FZVA 1A9NB 4JYAF 3GILA 4QWCA 4WFZA 2PEHA 4USIA 1YI2S 1CC7A 2FHJA 3V6HA 4OMFG 2MKHA 2PC6A 2ZKTA 3TVKA 2V2KA 5J2PB 4X4SA 4TU9A 1R7IA 4QR0A 1OSDA 2OP5A 2R7UA 3W2VB 1LWFB 5DG8A 5DG7A 3HPOA 2YNIA 3KLFA 1M1KT 2UXBF 2R8HA 2XY5A 3GIIA 1IBKF 2M2BA 2GV1A 2HHVA 3LP1A 4JBCA 3PRDA 1FNMA 7FDRA 4FF4A 2RVJA 1MNEA 5JVHQ 3CDEA 1FXLA 4ZP7A 2RNEA 1RYSA 1HWLA 1MW7A 3RW6A 2B4OA 1UEUA 1XK8A 2DPIA 5F8HA 4OZLA 2HWIA 2PGCA 5LXYA 5CYMA 2GQCA 4CH1A 3I0RB 1RT5B 5L39A 2RS2A 2Q1LA 4RW4B 4ES2A 3KLHA 3ZZYA 4TY8A 1U7LA 2X3GA 3PZPA 2K8GA 4ZVHA 1WF2A 2OSQA 2YNIB 2ZNZA 3LW5C 3Q2TC 2Y1IA 2DGOA 1JLQA 3M1VA 4ZVEA 1YVFA 2V0NA 5C5JA