1T03B

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
429
structure length
429
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synthetic oligonucleotide template
molecule tags Transferase/antibody/dna
source organism Human immunodeficiency virus 1
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
total genus 96
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t03B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03B03
1HQEB 1S1VB 3KK1B 4PWDB 1NNDA 4I2QA 1RT2B 4ZPAA 2IJNA 5J2QA 3NGDA 2J6UA 3MR2A 2IM0A 5DLGA 5T14A 3OL6A 5I3UB 4WXWA 4MK8A 3MEDB 2UUWA 1C0TB 4IKAA 3V81A 4KHMA 4IFYA 4NZ0A 2ASLA 4NLVA 3T19A 3DYAA 1RT3A 3V6DA 1RT6A 4IQXA 4DG1B 5HP1B 3DDKA 2AGPA 1S9GB 2IMWP 1QAIA 1HNVB 4XPEA 5HLFA 2O5DA 3GYNA 3QYYA 4MIAA 5KFAA 3N6NA 4RNNA 1JLAA 1UWBA 3DRRA 3LP0A 3GIJA 1T94A 5KG4A 4F4YA 1S1XB 3KMSA 2BR0A 4Q45A 2B6AB 2XI3A 3ISND 1RA7A 2R8JA 4O3QA 1HYSA 2E9RX 4KKOB 1MU2B 1LWCA 2VG7B 2YNHB 2FVCA 2BRKA 3PJXA 3QZ8A 4Q0BA 4U6PA 1HMVB 3H98A 5KFFA 4B3OA 2ALZA 2YNGB 4MIBA 2VG6B 3KK1A 3H59A 5HROA 5KFEA 2ASJA 2CJQA 3V6HA 2C2RA 4LQ3A 5C25B 4O4GA 3KLFB 2OPPA 3FSIA 5KFKA 2E9TA 3CDEA 4NLUA 5KG6A 3DLGA 1N5YB 3H5UA 4YR0A 2UUTA 4IG0B 2W9CB 4IFYB 4ECXA 5C5JA 2HNZA 2QE5A 4ECYA 4WE1B 1T05B 4IH6A 4WZMA 1TL3B 2I5JB 3QLHB 3Q8RB 3M8QA 5K14B 3KLHA 4H4MA 2EC0A 2FVPA 4YR2A 2IC3A 5FDLA 1VRUA 4QWBA 1KHVA 5F8LA 3GIMA 4WYLA 5J2MA 1QAJA 4ZP9A 3PW7A 3OLBA 4LSLB 4ED1A 3E01A 2XI2A 3ITHA 4I2PA 4ZHRA 4RZRA 4Q0BB 2R2RA 4IH7A 4F4WA 2HNDA 4O3RA 2XC9A 3PW0A 5D3GA 2R2UA 1RYRA 4YQWA 1Z4UA 4GC7A 3PZPA 2W8LA 5J2NA 3HKWA 3IN5A 3QIPA 3KJVB 3MFIA 5KFSA 4DL3A 1S6PA 3CWJA 4NLQA 3BGRB 3HVTA 4KO0B 1N5YA 1S6QB 2VG5B 2YKMA 1KHWA 3CJ4A 5KT7A 5EDWA 4ECSA 4NLRA 4EO8A 2D3ZA 4Q8FA 2W7OA 3OHBA 4LSNB 3I5AA 3KHLA 3RAQA 5KT2A 2XCPA 4Y2CA 2FLNA 1S9FA 4EYHB 1QE1B 3NKYA 4MFBA 1RA6A 2C28A 4QWDA 3RB3A 4MK9A 1JKHB 3MEEA 2GIQA 1JLAB 3LP0B 4ED0A 1ZTWA 5KFWA 1DLOA 1TKXA 2RF2B 1S1XA 1JLGB 1JLFA 4NLGA 4X2BA 3MECA 1S0OA 4ZP6A 4ZVEA 2WTFA 3SI8A 3M9OB 2UVRA 4RW6B 5D3GB 1S1UB 1YVFA 4TYBA 3KK2A 2ZE2B 4ZPDA 5EWGA 1TV6A 1EP4A 1K1QA 5F8HA 4PUOB 1NHUA 2BQRA 1DTTA 2YNGA 4KFBB 5L1LA 3FDSA 3EPGA 2J6TA 1RT1A 4K4UA 4TY9A 5KG1A 3OSPA 1C1CA 3MEGB 1RTDA 4M95A 3FQKA 5C24A 1S48A 4O3NA 5J2PA 4TQSA 4RUAA 1REVB 4ECQA 5F8GA 4Q43A 3KLIB 1SUQA 4NYZA 5HLFB 5KG7A 4ZVFA 5KT6A 5L1IA 4ECVA 5CYQA 4ED3A 4O3SA 1UWBB 3G6YA 4J9LA 3CJ5A 4F50A 4RW8B 4KBIA 4NRUA 1LWEB 1JLBB 1FKOA 3M8PB 3HVAA 4KV8A 3I0SB 3IGVA 4KE5A 4IR1A 4K4VA 4OL8A 4YR3A 1IKXA 4RNOA 5DGAA 2R8KA 1S1TB 1S97A 2FLLA 4RU9A 1FKPA 4IFVA 4RW4A 1DLOB 5F8NA 2JEGA 5KFTA 3LP1A 4IRCA 4O44B 3MR3A 4F4ZA 3DMJA 5J1EB 2WK4A 2OPPB 5HBMB 4XO0A 2HMIA 5KFPA 1DTTB 3FFIB 4URQU 4DL7A 1IKWB 5F8JA 1S1WA 1SV5B 4RW7B 3LP2A 5KFBA 4J9SA 3I0RB 2RKIA 1BQMA 1S49A 2DPJA 1LWFB 2IAJB 2JC1A 2AX0A 1TQLA 4KO0A 5CYMB 5HP1A 3ICLA 3IGNA 3DLEB 3TAMB 3OL7A 4FS2A 3C6TA 1HNVA 4FS1A 4ED2A 3QO9B 1JX4A 5K14A 4F4XA 3EPIA 2W9AA 3LALA 4NLSA 1RT4A 4ID5B 1C0UA 5F8MA 2WONB 1S9EB 5KFGA 4EBEA 3KK3B 2D3UA 3TQ1A 5KFQA 1QE1A 1RTIB 3BREA 4ECUA 3RB0A 2B5JA 4MFBB 4JV1A 3ITHB 4ZHRB 4R5PB 3T1AA 3KLEA 3CVKA 3SFUA 3T5JA 2ASDA 2DPIA 1WNEA 3KLGA 3RB4A 5EWFA 3RBDA 3C6UB 3IRXA 2D41A 4MKAA 4U7CA 5DGBA 2VA3A 1LW0B 3G86A 3OL9A 1JLQA 1FK9B 1TKZA 2R8HA 5HBMA 2R2TA 2HMIB 4DL5A 3FFIA 3BGRA 3DLKA 4PQUA 4WFZA 2YKMB 4I2QB 3H5SA 3KK2B 3BSOA 2HNZB 2YNIA 1S10A 3I5BA 3BJYA 4TYAA 2RDJA 1RT5A 1CSJA 5KFVA 3C6TB 4IG0A 3LANA 5KG2A 3QO9A 3D5MA 4ED7A 4Y34A 1JLEA 4QWAA 4MK7A 2OPSB 4TY8B 1C1BB 1TKTA 5KFRA 1RT7B 4IDKA 3H5XA 1W25A 1N56A 4J9PA 3EZUA 4H4MB 4ZVHA 2B5JB 2IC3B 5FDLB 4R8UA 4R5PA 1VRUB 3GIIA 4I7FA 3H40A 2B6AA 3BSAA 3KLGB 5DG9A 1ZETA 1T03B 5KFLA 2V4RA 1RT2A 4ZVGA 1HYSB 2IA6A 4PWDA 3GILA 3N6MA 4ZP7A 2FJWA 1IM4A 1IKVB 4EBDA 5KT5A 4PUOA 3RB6A 3NBPB 1N6QB 3DLKB 4PQUB 4ECRA 4TXSA 1K1SA 1XR5A 1MMLA 2YNIB 3DYAB 4DG1A 4NCGB 1ZTTA 1OS5A 1RT3B 3V6DB 2JC0A 4O4RA 5KFZA 1IKWA 1N4LA 1XR6A 4ZP8A 5KG0A 3LP2B 2XCAA 2AWZA 3I0RA 4KSEB 1HQUA 1BQMB 2IM1A 4NLWA 3JYTB 1TL1B 2HWIA 3KLVA 1LW2A 5L9XA 1HPZB 4DL4A 3CIZA 3MF5A 4WXOA 4R0EA 2D7SA 4NLTA 2GIRA 5KFHA 2WOMA 3CDUA 2R8IA 1JLCB 4IOBA 2BANB 4RW6A 3DRSA 5I42B 3T5LA 1RTIA 2OPQB 3Q8QB 5KFJA 5KG3A 5JUMA 3NBPA 1N6QA 3G6VA 3MR6A 3PHEA 4KHRA 3DOLA 3IG1A 1S1WB 4RW7A 2OH2A 5J2NB 2RKIB 3BSNA 4ICLA 1REVA 2WCXA 4J9OA 3HVWA 3DRPA 1HNIB 1J5OA 1BQNB 4G1QB 4DL2A 3UR0A 1I6JA 3JYTA 3H2LA 3KHGA 4ED6A 3PR4A 2R8GA 3I0SA 3HHKA 2WONA 2FLPA 2YKNB 5KFXA 3DM2A 3JSMB 1JLEB 1XR7A 1VRTA 2ZD1B 3IS9B 5KFUA 5KFNA 1FKOB 1JLBA 2HNDB 1JKHA 4EEYA 3QGGA 1S1TA 5EUHA 5I3UA 1LWCB 2VG7A 4ZMMA 2VA2A 3DOKB 5KG5A 3MEDA 3M9MB 1TKZB 4WZQA 3H4DA 1SV5A 3N6LA 5C25A 2HNYB 4RW9B 4URSA 5KFCA 4QWEA 1TV6B 3DI6B 4H4OA 2XGPA 4K4SA 4WFYA 3DMJB 1R0AA 4NLOA 5KFDA 3QGHA 2BQ3A 4KFBA 1S0MA 3PW5A 1RAJA 1U09A 2B43A 4Y2AA 3KHHA 3DRPB 1RT5B 4FBUA 1IKYB 3GV7B 2C2DA 4JV2A 4O3OA 5DQHA 4J9MA 4EYIB 1T05A 4EO6A 3V6KA 4ID5A 4WE1A 3QLHA 3PW4A 4YP3A 1TL3A 2I5JA 4MH8A 3TAMA 4TQRA 2V0NA 3MEEB 3JSMA 2W9BB 1VRTB 2ZD1A 3IS9A 1D1UA 3OLAA 3Q8SB 3M8PA 3NAIA 5J2MB 3MECB 3MR5A 2VG6A 2FVQA 4J9KA 2JEFA 3OHAA 4H54A 4I2PB 3ISNC 1LW0A 4KAIA 4LSLA 2WOMB 1DTQA 1C2PA 2HWHA 3RAXA 4K50A 1GX6A 3T5HA 1S4FA 2YNFB 3H5YA 1S1VA 2FVSA 3TVKA 5KT4A 3PR5B 3D28A 2V4QA 4J9RA 1RT1B 3V4IB 5J2QB 3BSCA 1TP7A 5C24B 4DEZA 3KHRA 1C1CB 4RNFA 1JIHA 3GV5B 5DG7A 3PW2A 2ILZA 4JUZA 1S9GA 4DL6A 4IG3A 4QW9A 1RTHA 3NL0A 1IKYA 3KOAA 3DRRB 5DQGA 5L1JA 2UVWA 3Q8PB 1LWEA 1RT6B 4MKBA 2JEJA 4NRTA 5CYMA 4K4TA 3DLEA 4ECTA 4KV8B 1SH3A 4K4YA 1BQNA 4G1QA 2IM2A 3E01B 2JLEA 3OSNA 1HMVA 3MTKA 3PJWA 4I7FB 1T03A 5KFMA 2C22A 5KFYA 4WFXA 4KKOA 4O44A 5F9LA 3GIKA 5J1EA 2OPRB 4R8UB 1NHVA 4RUCA 1HQEA 4NLPA 2W9CA 2IM3A 4LQ9A 1KLMB 1S1UA 3BQ2A 4LSNA 2ZE2A 4RNMA 4O4GB 3KLFA 4NLYA 4RNHA 5JXSA 4XPCA 4J9QA 1IKVA 1S0NA 1QUVA 2F8EX 3V81B 2HAIA 4IG3B 5F9NA 1RTHB 3H4BA 3V6JA 5EWEA 3BQ1A 3KNAA 1HNIA 1J5OB 4URGA 1EETA 1RTJB 1RDRA 2AU0A 1LW2B 3QIDA 4YMEA 4K4XA 2AGOA 1TVRB 5KFIA 3M8QB 4ED8A 2V9WA 5C42B 3MFHA 3KK3A 3LAKA 1HQUB 2FJXA 2E9ZA 3UPFA 4WYWA 2XWYA 2OPSA 3FRZA 3PVXA 3KLEB 2QV6A 1C1BA 3CJ3A 4IDKB 2UVVA 4ZPBA 1MU2A 5DG8A 3SFGA 2OPQA 2XGQA 4IRDA 2BE2A 4K4ZA 1EP4B 1S6PB 4IFVB 2W9BA 2I1RA 3HVTB 2AX1A 1S6QA 2VG5A 3DOKA 3LP1B 4KB7A 1C0TA 5HROB 3DOLB 3IG1B 2C2EA 2BANA 1KLMA 2JEIA 4FBTA 2GC8A 2YNFA 3I5CA 2CKWA 3CDWA 4QPXA 3UDLA 4HKQA 5CYQB 1RTJA 4K4WA 4TY8A 4IRKA 4NCGA 4O3PA 3LAMA 1RT7A 1TVRA 3GV8B 1TKTB 1SH2A 4Q44A 3G6XA 2IBKA 5C42A 2R2SA 1SH0A 4EBCA 4ECWA 3CJ0A 2YNHA 1JLFB 1JLGA 4QW8A 4J9NA 3GQCA 2ATLA 2BRLA 1S9EA 1C0UB 3OL8A 4NLDA 1T3NA 1N48A 3KMQA 2FVRA 5KFOA 2BE2B 1TKXB 4GC6A 3DM2B 3CJ2A 3DLGB 3VQSA 5DLFA 3MEGA 1RTDB 4QWCA 3C6UA 3IRXB 3V4IA 2HNYA 4RW9A 1FK9A 4HYKA 1LWFA 3DI6A 1JLQB 4H4OB 5L1KA 4IR9A 2IAJA 3CO9A 4TN2A 1R0AB 2WRMA 3KLIA 1RYSA 1SUQB 2ILYA 4Y3CA 5F8IA 3KLHB 2RDIA 5DQIA 1GX5A 2BQUA 4Q8EA 2J6SA 5J2PB 3QGIA 1TL1A 1HPZA 1RT4B 4ICLB 4ZPCA 3BQ0A 2UVUA 3UQSA 2WB4A 2FJVA 3M9NB 5KT3A 4ECZA 4RW4B 1FKPB 1EETB 4JV0A 2IJFA 2AGQA 4RW8A 1HARA 3RBEA 1JLCA 1D0EA 3E51A 4NLXA 4G3IA 3NMAA 2AQ4A 3FQLA 3DRSB 5I42A 4IH5A 1IKXB 3QZ7A 2YKNA 2ZKUA 2W7PA 2WHOA 2RF2A 4TLRA 3QIPB 1DTQB 3KJVA 4M94A 3NAHA 2W8KA 1JXLA 3BR9A 3T5KA 4B3OB 2OPRA
chains in the Genus database with same CATH superfamily
3DCAA 1HQEB 1S1VB 3KK1B 5ETOA 3VWSA 2ADBA 4I2QA 4ZPAA 1RT2B 4CTAB 1K9MT 3NRBA 4ELTA 1KSPA 4OZNA 3RJMB 2AYMA 4NA3A 5DDPC 1RB0A 3NS7B 4E2FB 1ZH5A 3CD6S 1C0TB 2LECA 1TMMA 1VK8A 3GFXA 5CA5A 1X4FA 1FJCA 2RJZA 1WHVA 4NZ0A 1IR2A 2ASLA 3TNVA 2Z4PA 1IBCB 1FFWB 2HK2A 1G2EA 3T19A 5ETSA 5HJXA 3MGJA 3V6DA 3NEKA 1RBLA 4J5OA 4BS2A 2QLBB 4NXMJ 2H4YB 3AH6A 4HR2A 2O67A 3BH6B 4USHA 4RNNA 1PYOB 2M52A 2A10A 1W2BR 2IMWP 4B3MF 3RR8A 3LP0A 1UWBA 3DRRA 3H42A 5DDQC 3TZZA 2YBVA 5KG4A 4N56A 2ZHOA 4OMFG 1U1NA 2E7WA 3BB5A 4B3MJ 1W26A 2XI3A 4AFFA 4FDFA 1KRPA 1HYSA 5HL7Q 2DH7A 2BJ8A 3EXYA 2DGXA 2DGTA 1ZYQA 1LWCA 3HD2A 4W90B 2YPYA 5GMEA 3KKFA 1U0SA 2IRXA 2ZH9A 4CWBA 3RRGA 2YNGB 2I9SA 1F6TA 1Q5YA 4QYZK 3G8QA 3H59A 4M8LA 3EICA 5HROA 2FPHX 1HBUB 1Q1KA 1SVDA 5KFEA 4QIGA 2ASJA 3QRRA 5LMNF 5KFKA 1I3OB 4NLUA 5KG6A 4D3GA 3DLGA 2EFVA 4DSJA 4ED4A 3DLBA 2HBRB 2HLUA 1D9AA 1TL7A 2OELA 4CYUA 5HN0A 5C5JA 4YR0A 2CG4A 2W9CB 3FBBA 4DF4A 2HFSA 3B82A 3TAPA 4U7UK 2CJKA 2KFZA 4UF4A 5HQLA 2MPUA 5CABA 1TL3B 2I5JB 2HQFA 2ZBIA 2GQ2A 3MCOA 4O0NA 3PX4A 4GKKJ 1P9QC 3Q8RB 1CBKA 1HLWA 1LXNA 1YDLA 1KR4A 4FYDA 5FDLA 1R8HA 2OSRA 3CDBA 1VRUA 3IMQJ 4RL1A 1KHVA 1V5VA 3EXCX 3VCDA 5F8LA 2Y1IA 2BM0A 4AQYF 5J2MA 5D0RA 3UW1A 1NB7A 4NOHA 3RR7A 2XI2A 4ZHRA 4LT6A 4FNIA 3DRYA 5JMNA 4WP3A 2F65A 5KTQA 4FPIA 5B0AA 2HNDA 1RHRB 3MHYA 4OX9F 2XC9A 1RYRA 5D0HA 1N33F 2V8GA 3QIPA 2CG8A 3AOCA 3CPWR 3MMBA 4HTJA 1S6PA 3R7SB 5LL6d 3W5YA 1FVSA 5EDWA 3CJ4A 2HQDA 2O66A 1J2VA 3EGVA 3I55S 1HNZJ 1U2FA 4RX6A 2DR8A 4Q8FA 4NEYA 1EQMA 1VCTA 1SBRA 1TR0A 2KB2A 1WSRA 2GQQA 1SL2A 4FVCA 2VICA 2ZFHA 4OX7A 4Y2CA 2MQPA 2MKKA 2XYGB 1U1RA 3EZOA 2JWNA 1U6BA 1HWIA 5SZTA 1GMVA 3BN4A 2BOAA 3RW7A 5HJYA 1PCAA 3D66A 4MK9A 1SJ3P 1WKJA 5A8KB 1UZHA 3LP0B 1WF0A 2DR5A 5IT9U 3L4BC 1JLGB 4X84A 3C15B 3NOGA 3M9OB 2VKZG 2RQ4A 3G4SS 1IJEB 3DHWC 3LGHA 4TYBA 5D4NA 4CP5A 3EWGA 5EWGA 3CCES 2FTRA 1RAIB 3VAFA 2CPZA 3UWTA 3AD9C 1V3RA 5IT0A 1RKJA 3EGZA 2HBQB 2YNGA 2MMYA 3FDSA 2GNKA 5JJBA 1PYSB 2KM8B 3HHLB 3EPGA 3ONQA 2I8EA 1B99A 3OSPA 4K4UA 3O2IA 1C1CA 4ES1A 1NK8A 5C24A 3VAIA 1XMOF 5J2PA 1ZM4A 2CUYA 4RUAA 2KKHA 2CXEA 1R6VA 1VI7A 4TQSA 4DQRA 5F8GA 2CWKA 5HAOA 4AT1B 4CH1A 1RLDA 2YWWA 4JP8A 2L9NA 4Z7YA 4ED3A 3D1QA 4OZ3A 3BYPA 4B02A 4LF4F 2Y9HA 4KBIA 4LBHA 4NRUA 1LWEB 1FKOA 1SPBP 2YY3A 4KE5A 4KV8A 3I0SB 1Y00A 2ZC3A 1Z2LA 2LA6A 4OL8A 4P2SA 4ZPWR 5ETTA 4RNOA 1S4EA 2DNKA 3MMCB 1S1TB 1VISA 3D0IE 3FGVA 4ZIWA 2FLLA 3MZIA 4LF8F 3OTCA 5F8NA 1BWVA 2P6TA 5KFTA 3NCQA 5HQMA 4IRCA 5F3ZA 3IA0A 2DTJA 1VJQA 2M5YA 4DUTA 2KVIA 4NA2A 1C4AA 2HMIA 4DUYF 4KQZA 2N3OA 1F2HA 4URQU 5DDOC 2CPHA 1IKWB 4DL7A 1SV5B 4J9SA 3LP2A 1PYTA 2QSWA 1GTEA 4QWEA 1FXLA 1FI4A 2HRUA 2G1DA 4FVMA 1MW7A 2MQOA 4ETZA 5CYMB 4Q7AA 1KTVA 4BDPA 3ET6A 3DLEB 2VONA 2NYIA 2VL1A 4JI5J 1B0PA 2HYIB 5K14A 2FQQB 2HVEA 3PHTA 1RGVA 4E98A 1RI7A 4X66F 3ENWA 1OQ3A 2XNRA 1RT4A 2YQ0A 2UXBJ 3BO3A 3MMAB 2PA3A 3HFKA 2E1AA 1BMQB 3TQ1A 1KOOA 1GMUA 4I56A 2B5JA 1U6ZA 4M5DB 4R5PB 3KLEA 2CRLA 3CVKA 3SFUA 4X4TA 2DISA 2OMOA 4DR1J 3QFHA 3W66A 2Y1JA 3RB4A 1VQ8S 1IXKA 3R6LB 4BLGA 4U7CA 1B7YB 3MPWA 2Y0BB 5AXKA 3L7OA 3G86A 1NSQA 1JLQA 2MB0B 1MWYA 1Y5LB 2L9WA 2X7IA 1TKZA 2R8HA 2RRBA 4DL5A 4YUDA 3FFIA 3BGRA 2HIYA 5LMUF 3H5SA 4X4QA 2JVOA 3TEHB 2N7CA 2YNIA 1VC5A 3GMGA 4G65A 4U7UD 1OY6A 4Q5VA 2Z0GA 3IO1A 1XMQF 2F40A 2GX8A 1N5TA 2J9EA 3G2XA 1RT5A 2K1RB 3PV8A 2LYVA 4NYOA 2QT7A 1YK9A 1VQ9S 1T9WA 3GJSB 4MK7A 2N7YA 3WIUA 1Y5NB 2LCWA 1X5TA 2W2PP 3OXFA 2ZZTA 1FD8A 4B9VA 2J8AA 4ENOA 2ZDOA 1JXVA 4H4MB 4USVA 3FEYB 4L3KA 1UJ4A 5ETRA 2BKPA 4KH0B 3JTPA 5DG9A 2KG0A 2ROGA 2IA0A 4RBUA 2CVEA 2XBPA 2V4RA 1RWKB 1AYEA 1PSDA 2CAJA 4NMLA 5JVGQ 2QA1A 3B54A 1N34F 1NZ8A 5LXRA 3N6MA 4ZP7A 2FJWA 4ITSA 1IKVB 4LRBA 1SIZA 3U1MA 4UQGA 4PUOA 4EBDA 4PQUB 3CD5A 1K1SA 1XR5A 4ZCLA 4EUVA 5ETPA 2XM3A 3IWXA 1ZTTA 1OS5A 2Z8QA 3R3TA 1LK5A 4DJBA 2OLWA 5H1SV 4O4RA 3CE8A 1IKWA 4MYUA 3M05A 2QN6B 1VQOS 3LP2B 4KSEB 3FUYA 1SJRA 1WWHA 2G0JA 3E3XA 1KDNA 4DI6A 4C8OA 4U9RA 3KLVA 4WU2A 1YRTA 3AQPA 2LQBA 3N0VA 2JLGA 1HPZB 1FF2A 2B4OA 2GJIA 4A8MP 4TU9A 1RWUA 1YJRA 2BJ1A 2QLXA 4OYIA 2OFHX 4DV3J 1ZBTA 2VFSA 3MOZA 2ZM6J 1X4DA 2QFJA 5KFHA 2NR0A 2DHSA 4NEZA 2CDQA 4OHZA 3CDUA 2R8IA 2GZOA 2RQKA 3EE3A 4OJGA 4DWIA 4RLEA 4DF8A 4LIRA 3Q8QB 4G1IA 3VGUA 5JUMA 4WFAQ 1FA0A 1CPZA 4N8NA 5IC4B 3QT6A 3Q8UA 5C2CA 3M8ZA 5FIIA 4RW7A 2FHOB 2VASA 3T9ZA 2QYGA 3HZEA 2F63A 2XMJA 5HMXA 2N82B 4C98A 4DQSA 2OH2A 4FF3A 2DGOA 3BSNA 2XY7A 3VZIA 3ZNUA 1VLYA 1AW0A 2WCXA 1LFPA 2J0XA 1UKUA 3Q8VA 3DRPA 2HQ3A 2OAUA 1VC0A 3D0GE 1UW4A 3K5LA 3K58A 3A3PB 3K5NA 1JJ4A 2B4PA 3N5BA 3KHGA 5I4MA 1B4SA 1ZM3A 3O1LA 4ED6A 2NS1B 4GVBB 1GXLA 5CH7B 1VBZA 1EQ0A 1F5AA 2BKNA 2WONA 1K47A 4FYVB 2NSCA 4W92B 4YB1P 2NZ4A 3DXSX 2ZD1B 3IS9B 1RCOB 1ZM2A 4HLBA 4J37A 4MKYA 4ANCA 3AJ1A 4OYOA 1JLBA 2BJ3A 2IDEA 1LXJA 4WBFA 2DNGA 3QGGA 5DO2A 2B8QA 2F8HA 2MSTA 4FXWA 4NE9C 4OX8A 5EUHA 1KNZA 5I3UA 4ZMMA 2VQFF 2POKA 1U49A 3BPDA 3VGSA 4ZK7M 1JNZB 2LFVA 3ELHA 5LJ5Y 5M2UA 3CF5Q 4DSIA 1FESA 2HNYB 3C14A 2FY1A 1JQGA 3DMJB 2FZKB 3BGUA 3QGHA 2EFQA 4V19J 5IT9Y 3D9BA 2B43A 1U09A 3LPYA 3CCRS 1GK8A 4USUA 2G0IA 1IKYB 1EB0A 1NO8A 3CCWA 3TO8A 2C2OB 1JJHA 4ID5A 4WE1A 3C8YA 5A6WA 5GMDA 3EZ5A 3QFWA 4ZCIA 4DR2J 2V68A 3MXHP 1TTHB 4FPRA 4TQRA 4DQIA 2HURA 5AXLA 3MEEB 4YB5A 3K8WA 2R7QA 3HHEA 1VRTB 1D1UA 2E1RA 5CAAA 1O0PA 5L9NA 3Q8SB 2M8DB 5J2MB 4RU2A 3PRBA 2DH8A 4F67A 1U6FA 4CZCA 2JEFA 1HHSA 3LWMA 2OFGX 3SQOP 3W9HA 1I94J 1LW0A 4NXMF 4FXDA 2NXNA 2DT9A 1LFWA 1PBAA 1Q95G 2RSQA 2W7AA 2WAQD 4KGMA 4ZVRB 3MM5B 4X4OA 3T5HA 1S4FA 1XIQA 2NCKL 4LRCA 1Q81T 2Q6BA 2UP1A 3TVKA 3D28A 5IQQA 3W9IA 3V4IB 5J2QB 2HPUA 3MURP 1VQKS 2QIFA 1N32J 2BABA 2ILZA 4KR0B 1YRUA 3WZ0A 1XNQJ 2VH7A 1KQKA 1WEYA 2MQMA 3I56S 3HSGA 1KQFB 1J27A 2BE7D 2LQJA 4HT7A 4JI7F 3MM9A 3KOAA 3M2UA 2UVWA 3GFYA 3FZBA 3Q8PB 1UVLA 3K5OA 4DPWA 2JEJA 1XQIA 5GAHI 3G6ES 2CFXA 4ECTA 3AOAA 3W2WB 5B7WA 4N5SA 1UTAA 2JLEA 4I69A 3GR0A 5FD1A 4Q2LA 4DHVA 1ZPVA 4DDFA 3MM6B 5A6PA 4F4KA 1T03A 1GTHA 2EPIA 2RUSA 3R5AA 5KFYA 4NZ6A 1UVMA 1AA1B 2DHAA 1R6YA 4O44A 3H25A 1CJVA 3SQGB 5F9LA 5J1EA 1U7LA 2V69A 2WSFC 2ZBCA 3LF0A 3R5JB 1T02A 5G0RB 4I1TA 3VGTA 4R8UB 1WI8A 1YJWS 2KHDA 1SC4B 1X4GA 1F0XA 3F0NA 1JNRB 4LBIA 2JZ5A 3D67A 3FMWA 1X7VA 4QWCA 2F9DA 2C1EB 3P96A 1PC4A 1F9HA 1NPPA 3HFVA 3G96A 2EXUA 4AL5A 2VFUA 3GFHA 2F8EX 3V81B 2FHKA 2ZH7A 4OX9J 2N4DA 7FDRA 5F9NA 3PIPQ 3EUNA 1NKCA 3CJKB 1J5OB 3F44A 2VPWB 3ZZ0A 1YITS 3IWNC 1RDRA 4KGXB 1Q7YT 2H51B 4C8LA 3PEJA 4ZVPB 1TVRB 1TUVA 3D7SB 1S76D 3M8QB 4KYZA 4DV2F 3UCUP 1L3UA 2HEKA 4C8YA 3MFHA 3TZYA 2CPJA 2Y3YA 3LAKA 1P27B 5CZXA 2E9ZA 1KVKA 2VQEF 4BWJA 4CIOA 5LJ3Y 2OPSA 2QV6A 3BBCA 3GWCA 1KQSR 2IDLA 1NZAA 2DGVA 2J7WA 1WHWA 1R0CB 1UJ6A 1MU2A 1O8BA 3CO0P 2FJBB 2Z2ZA 4TVAB 4IFVB 2FJEB 2VBYA 3HVTB 3RBXA 2VG5A 3DOKA 2HVZA 5DM6Q 3R9LA 4KB7A 1Q16B 3M32B 4PG4A 4TU7A 1S12A 3TX0A 3GFZA 1WDTA 4OZ0A 4QCLA 3PYEA 3BH7B 3UNGC 1HNZF 4USKA 5E3QA 4CDIA 4F0KA 4QPXA 2E5JA 2ZNYA 1V6HA 1X9WA 1I51B 2KHCA 4LF8J 1BWEA 1ZAWA 2DRAA 3UE2A 1RBOB 3KDOA 3PFEA 4A4JA 3JAMY 1S99A 4K4WA 4TY8A 4DV4F 4IRKA 1WKLA 3AA8A 4O3PA 1IBKF 1RT7A 3A3NB 1F9EB 3QNWB 4F3MA 3IFEA 3B4MA 2DO0A 1NDPA 2IBKA 5C42A 1ZOTA 4OHXA 1SH0A 4DV4J 4ECWA 4DPTA 1VQLS 3M2UB 2YNHA 1JLFB 1YRXA 2RUGA 1NLKL 4W4MA 4ZVTB 4DPUA 2DXDA 4QPTA 3GQCA 3HXMA 1YZ6A 3DDNA 4DSEA 1C0UB 3QGPA 4X4RA 1WC3A 4NLDA 1T3NA 3NGUA 4GO7X 2M3DA 4Z2XA 2IVYA 1H7XA 1BY9A 5AXMA 3H7HB 3J80Y 2Y0SD 1WF2A 5DLFA 4U96A 1RISA 3MEGA 3VAGA 4NCBA 3C6UA 3IRXB 1ACMB 3R7NB 4WFBQ 1LWFA 3DI6A 5L1KA 2BOPA 4TN2A 4IUFA 4ZN1A 5CD4H 3KLIA 2G2OA 4CI0B 1KWMA 5GAEI 5F8IA 1D3WA 1YI2S 2RDIA 3CNQP 4XDDA 5HVGA 1F3FA 5CZVA 3W2VB 4DR1F 1GX5A 2E1PA 4K4SA 2MY8A 3QGIA 2QSFA 4DQQA 2I2YA 4ICLB 3W8GA 3BQ0A 2HAFA 1XNRF 1S72S 3TP2A 1RAGB 2WB4A 3QJLA 5D77A 2FJVA 4EK2A 3IWLA 5GAHU 2A6OA 4ECZA 4RW4B 4YDXA 4JYAJ 1FKAF 1NCLA 2CA9A 1RHMB 1CJKB 3JTOA 3P5TL 1JLCA 4NLXA 2XEXA 3LO3A 4PYDA 3K8VA 1X5PA 3FQLA 3L7PA 2FZCB 1IBLF 3K0JA 2YKNA 2P6SA 3D54A 3GZ7A 2W7PA 4F3OA 1WG5A 2MEWA 4M94A 1DTQB 4TLRA 1N0VC 5J1NA 2W8KA 3CUNA 1FE0A 2DIVA 1JXLA 4B3OB 1VBYA 2OPRA 2H5IB 3BZQA 3CXCR 2PIIA 7AT1B 4HACB 5B09A 1U1OA 1TUGB 2IM0A 3CCJS 2JDJA 1HD0A 1SKUB 3C66A 1U1MA 4PG6A 4DS4A 4JYAF 3UCZP 2KRBA 4IO1A 4ZCMA 1FRIA 2DY9A 2KL8A 2K3KA 1ULRA 3JSYA 1FRKA 2Q79A 4X65J 3VVTA 1NAQA 4DG1B 1QSYA 2OO4A 2ADCA 1S9GB 5HLFA 3OXLA 4UY8T 4OYBA 1AZSA 3ZZOA 4F04B 3GIJA 1HBNB 1H98A 1NDLA 4F4YA 3HSJA 3ZZUA 3D3CJ 5K8NA 2B6AB 4DU8A 1RA7A 1RWXB 4O3QA 2WBMA 3HVRA 4HI1A 1CC7A 3AA9A 5G4DA 2E9RX 3M4XA 1QSLA 2VG7B 2BM1A 2YNHB 4DMZA 1NK7A 3CT9A 4JV1A 4Q0BA 4PPZA 1HMVB 2C42A 2C2KB 2V34A 2X1BA 3V4MA 2KYXA 4DV5F 3J7ZT 4MIBA 1HHTP 2VG6B 4J9UE 3KK1A 1F1BB 2CNNB 2MYFA 2M4MA 1TUWA 2ZEJA 2WW8A 1OJ4A 5IT4A 3G87A 4O4GA 2ASYA 2DXEA 3HI9A 4ZOSA 2E9TA 2CQ2A 2K7JA 1WACA 5AE3A 2ZJRQ 3H5UA 1N5YB 2HGLA 2CJYB 1RWNB 2CQ0A 4IG0B 3GR1A 4BBYA 4LR7A 4N8OA 2QE5A 1Z2ZA 2C2NA 3FSYA 4ECYA 1UA0A 4WZMA 4IH6A 5HVHA 1G1XA 5EHHA 4XTTA 2XS5A 3AY0A 2M7SA 2C2ZB 2BX6A 2DHHA 2XHCA 4DFKA 2EC0A 1M5KC 2FVPA 2GVZA 5DZ6A 2M70A 5IZHA 1GAOA 2DGSA 2DYAA 1EKRA 3K5PA 1EZZB 3M30A 2EI5A 1XN9A 3UDCA 4M5KA 4CO4A 2YWHA 3ITHA 2Z56B 4RZRA 1TK5A 5B0GA 3G9CA 2R2RA 4F4WA 2Z2MA 4PG5A 2OJ3A 3FRYA 4O3RA 2L08A 2R2UA 2P5VA 3KNGA 5F0UA 4J9KA 4P73A 4GC7A 4ANEA 3PZPA 5J2NA 3IN5A 4LFBJ 4GKJJ 1RAFB 3MFIA 4YFUA 4DL3A 4HT5A 4ZS6A 2B7BB 4KO0B 1R3NA 1S6QB 4ECSA 4FF1A 2E5LF 2HW3A 1PKUA 1R0BG 4CYUB 4EO8A 2D3ZA 4TNOA 4P74A 4WU3A 4UTGA 1VQ7S 1H6KX 4ZJQA 1CJTB 4C8MA 3ZZPA 1H2UX 5KT2A 2XCPA 3ZZRA 1S9FA 3HT0A 1QTMA 4EYHB 1Q8KA 1L3KA 1UVIA 3NKYA 1WKKA 4K8RA 3CJSA 3EDRB 3TZWA 4U67Q 1UVKA 2LA4A 4A8SA 4N47A 4QWDA 1IBKJ 2CQBA 5AJ3F 4C8KA 4I0WA 3MEEA 1B70B 4CM2A 3QMQA 2U1AA 1DLOA 1TKXA 4FXVA 4PPDA 4X2BA 1FJEB 1R8PA 2HRTA 2MKSA 4LF6J 1S0OA 3T41A 2CZ9A 3S6EA 4RW6B 2D3OR 4ZPDA 2D9OA 4OYZA 3T3FA 3OUYA 1TV6A 1EP4A 3ILIA 1K1QA 3MMBB 1NHUA 4QYRA 3PO5A 4KRWA 1KFSA 4U8YA 2J6TA 1K0TA 4M5MA 4P2FA 2OTLS 1O5JA 1Y11A 3VAKA 4LUBA 1RTDA 2D1CA 2A18A 3FQKA 1S48A 2KN4A 3UO0A 2XQCA 4B9MA 2I6WA 1CS4B 4L74A 4Q43A 1RWMB 4NYZA 3DU5A 2W4CA 3BGOP 3DDIA 4O3SA 5CYQA 4OYPA 1H38A 3AB2B 3CJ5A 4NI2A 4F50A 4ILLA 3PYDA 2COLA 4K4VA 4IQMA 3BO2A 5DGAA 2R8KA 3N01A 2MQLA 3ZO7A 4WF9Q 1QVGR 4A8FA 2ZNZA 3EX7B 4ZLPA 3OFEA 3CJRA 3DNCA 3C15A 5FLXY 2IYIA 5DS7A 2E44A 3LP1A 4O44B 3GIRA 3LQVA 2DH9A 5SUHA 4DV6J 4QU7A 2KTQA 3E2EA 2VBWA 2WK4A 2OPPB 1HWJA 5HBMB 2XWXA 5KFPA 4DLEA 3UDVA 3LGMA 1KLNA 3O8WA 3PEHA 1I94F 1HFEL 5F8JA 1EJ7L 1BC6A 3I0RB 2FUG9 1YLXA 2VOOA 1FD2A 1WHYA 4OHWA 4UOFA 2IAJB 1CULB 2JC1A 4DS5A 2DHGA 2RS2A 1Q5VA 2CADA 4KO0A 2V2ZA 5HP1A 3ICLA 3NGKA 2PFDA 3TAMB 1IR0A 1FTRA 3OL7A 1HNVA 2YTCA 2QLJB 2HIQA 2R7UA 1HR0F 2QJ3A 2XZTB 3POTA 2V2KA 5K5MA 3OVAA 2GFFA 1QJHA 1B3TA 1S9EB 4DN9A 4EBEA 1HR0J 2PI4A 2RHQB 2YKOA 2B51A 4KH1B 2KT5A 2NLWA 4ECUA 2VFVA 3SIPB 2K7KA 3VALA 3GSDA 8AT1B 2E5GA 5I3QA 3OW2R 4DSFA 4DFJA 4M1KA 1HW9A 5EWFA 2ZVIA 2UUBF 5H9EJ 3LWLA 1FEEA 4MKAA 3Q0AA 3RBDA 5T7LA 3GB0A 3MUTP 3MUVP 1DQ8A 5B0BA 1WOSA 1WG4A 3TZXA 2HMIB 2EBEA 4P7VA 3HM9A 3M6WA 4KIAA 2YKQA 3IRWP 2FIUA 2YKMB 4I2QB 1CJUB 1F60B 1V3ZA 3SXLA 2VJUA 1UVNA 4KHPJ 2HNZB 3EVOA 3JTNA 2PGCA 4FYWB 3CTRA 5A0YA 3BJYA 5DJBA 2CQ1A 2RDJA 3HSZA 3ET6B 1CSJA 5KFVA 3KTQA 1TL7B 3LANA 4F3QA 1B0TA 3D5MA 1NKBA 2QEXS 2LU1A 4JI1F 4C4WA 2HFVA 1Q82T 5BR8F 2R7RA 2ZOFA 4USJC 3R1HA 1FTCA 1AT1B 1ROFA 4IDKA 2GCFA 1SKSA 3Q2SC 3B6BA 2EVZA 4ZVHA 2B5JB 5FDLB 1SQGA 4HHJA 4R5PA 1VRUB 1PAEX 4I7FA 2HFNA 1X4EA 1C4CA 3BSAA 4DR5F 3C3LA 1RT2A 1GXUA 1HYSB 1XJWB 3OV7A 3CC4S 1ZM9A 3NWGA 2CQCA 4PG7A 4DZ6A 1EAYC 2BJ9A 2PFFB 2ZUGA 1DAXA 5CCMA 3RB6A 3NBPB 1R43A 2J76E 1AB8A 2W1BA 3IC1A 1NKEA 4DV6F 2PI5A 4WWSA 1KVJA 1RADB 2H65B 2YNIB 5A8RA 1FVQA 1CC8A 4DZDA 4OYXA 4LFAF 1IVZA 1RE1B 3ZZZA 4X4VA 1WEXA 2NZCA 1N4LA 1W2IA 2IHR1 2MHNA 3AAWB 4ZP8A 5KFZA 3R7BB 3J81j 1FCAA 3I0RA 3W65A 2MZJA 2L9DA 1HQUA 3W2VA 1O6XA 2IM1A 4MAKA 4NLWA 3T5JA 1FRXA 2NSBA 2HWIA 1N88A 5BYRA 4GVLA 1LW2A 1DARA 5L9XA 2BA9A 3CIZA 2ZZNA 1NJIT 4WXOA 3SEOA 2GMJA 4NLTA 2BZ2A 2JHEA 2OUGA 2NQPA 2ZH3A 2WOMA 2LDIA 4IOAQ 4QR2A 1NXIA 3POTB 1N54B 4C3LA 1X9MA 2GAHC 2VODA 4L73A 4NX9A 1YBTA 5HQ8A 2EEYA 4P6QA 5E2QA 3D3BJ 1RHKB 3IAM9 3MDFA 3WX8A 2OPQB 1J5EJ 3M2VA 1R8CA 5KG3A 1NPRA 2Z58B 1M5SA 4PXBA 2KT2A 4ZCKA 4M5HA 4LR8A 4DX6A 1KKHA 2I0XA 3PHEA 4DXLA 3PX0A 4ZN3A 4B3TF 1S1WB 1LQ9A 1NH7A 2C3PA 2XMUA 5ADZA 4DSLA 1L3SA 2RKIB 1PJ6A 2AT1B 2YPZA 4DR7J 3CB4A 2KO1A 2QC3A 3BR8A 2MJUA 4LR9A 3J7A1 1REVA 2KJWA 5GMKa 4J9OA 2J9DE 3BF4A 4V19X 1HNIB 3HHLA 5F41A 4YOEA 4CNZA 3AXMA 1Q0NA 3UR0A 2YXLA 5C2GA 1UFWA 2RRAA 1FFGB 2R8GA 2UUCJ 5HMWA 3HHKA 3KUGA 3PYFA 1AZSB 2FLPA 5KFXA 5ETQA 3EVWA 3DM2A 1T11A 1P1TA 4P7TA 1U1QA 1NU4A 1CVJA 1SB6A 4DV0J 1FKOB 5B0DA 4G6VB 2BJ7A 4F0HA 5A8KA 2XZWA 4EEYA 2P8IA 2HHSA 1S1TA 1WC6A 3PRVA 2ZDPA 4C0OC 2VA2A 4YY3F 4A8OA 2W2QP 5H9FK 3SMZA 3MEDA 4CT9A 4DBQA 4USIA 3G82B 5BXIA 2HHHJ 1FXRA 4RW9B 1IWGA 4URSA 4OFZA 5KFCA 3BYRA 3OR2B 2PMHA 3AJ2A 2XGPA 4WFYA 3O44A 1R0AA 1HBMB 1RAJA 3DFEA 3MR7A 4Y2AA 3PKMA 2HHWA 3DRPB 3ISZA 4DR3J 3GV7B 4NWBA 5DQHA 4J9MA 3IR5B 2Z30B 4EYIB 3HF5A 1KONA 3V6KA 2RQMA 2A3JA 3PW4A 2HKEA 2LP4A 3FEZA 3FMBA 3SBMA 2MLXA 3MMJA 4MH8A 1UAWA 4NMXA 5IXUA 3T6JA 4F25A 2V9KA 3ADAC 3HJVA 5LXYA 2ZD1A 3IS9A 4QU6A 1CG2A 3A8JA 1T7PA 3Q2TC 1UEUA 4YN3B 1XMOJ 1YJ9S 4H54A 4QIEA 4P2XA 1X31C 4TKTA 3ISNC 5E3AA 3SDEB 4WFNQ 4LSLA 2WOMB 2HWHA 2ZITA 1VQNS 5LMNJ 1GX6A 2GGPA 3I9ZA 3L09A 3FNNA 1DHMA 1S79A 1WELA 5CYJA 3SYZA 1S1VA 2W2MP 2X3GA 1LEOA 2VJVA 4ER8A 3PY8A 4C9DA 3TEGA 2H48B 3BSCA 3UNYA 5C24B 2V6AA 1N0UA 4CLKA 3NNAA 4RNFA 1WORA 2KFNA 2ZBQA 1IN0A 2XS2A 3GV5B 2O1PA 2V50A 1RHQB 2M2BA 4ATNA 4UOGA 4JUZA 4DV5J 3PW2A 5DG7A 2VPZB 4DL6A 4IG3A 3DGPB 4OI2A 4WK1A 1RTHA 1NK9A 2V4JA 2FJDB 1IKYA 2YVSA 3GPAA 4OI1A 6FD1A 5DQGA 4DUZJ 2V8DA 2E29A 1LWEA 5AJ3J 4MKBA 4FF2A 2M0GB 5CYMA 4DV2J 2HHQA 3DLEA 4L76A 1YJVA 2HZCA 1S0VA 2EK1A 2IM2A 3E01B 1RBAA 3DOMA 1VQPS 4JI1J 4DR6F 3A8IA 2MKYA 2JH3A 1S5ZA 1MLAA 3UDEA 1NSPA 1ZA1B 2CPFA 5HVFA 3R97A 2AJ0A 4DR3F 1U45A 3CMES 2UU9J 2AYEA 4WFXA 2BW7A 2ZH4A 2CPIA 1GT8A 4B9LA 4KHPF 3AJDA 2KT3A 1NHVA 3MM5A 1HQEA 2OI2A 2DVIA 1WHXA 5E3RA 3NCPA 4LQ9A 1O51A 1KLMB 2E1MC 1S1UA 3VAJA 4LSNA 2VOPA 2ZE2A 1X5OA 2CJBA 4RNMA 1UJ5A 1OMSA 3OPKA 1IKVA 3HHLC 1DQAA 2HAIA 5BYQA 5LOQA 2BBEA 3WHIA 4EZ9A 3H4BA 4H4KC 3V6JA 2XY6A 1EETA 1QY7A 2DCUB 3H90A 2YWKA 3OVSA 2QRRA 3NS5A 1NUEA 4OZJA 2N3LA 2LLZA 4YR3A 3PNIA 3KK3A 3GG0A 2CWXA 2H3EB 2IMOA 2CNOB 3BKFA 1YJNS 4CO3A 2CNKB 3QWUA 1VQ5S 3NXZA 3K5MA 3CJ3A 2VBXA 1NSKL 2QA4G 4ZA1A 2DD8S 1E6YA 2IIHA 1OSDA 3LOUA 1NJWA 5DG8A 3SFGA 4XIUA 3ZZYA 2XMAA 2XGQA 2RE1A 2RRNA 4X4UA 1OYEA 3TI0A 1JWWA 3BDEA 2JLFA 2AX1A 2CPDA 4P2MA 4JI0F 2MQ8A 3LP1B 2CPEA 2RB7A 1RACB 5ETVA 2DGQA 5HROB 1UZDA 3DOLB 3IG1B 1Q8LA 2ZKTA 2C2EA 3WC2A 1N33J 2JL9A 2E7XA 2NUUG 3BKTA 2XS7A 1U0HB 2ZHBA 3I5CA 2CKWA 2LMIA 2QL7B 1AROP 4CT8A 4HKQA 2HVDA 3EYZA 1NK0A 4ZDNA 3OJSA 1GNKA 4UUXA 3CCVS 3LAMA 3H20A 1TVRA 1OPZA 2Q3PA 4C11B 3G6XA 1YSJA 4P72A 2PT0A 2LVWA 1TELA 2RILA 3N4WA 3UFCX 2BMBA 4CLYA 3Q8YA 4X62F 2P2CB 4MKVA 2WSCC 1RK8A 3R8YA 4A48A 1YQHA 2ATLA 2BRLA 1LV5A 4F2RA 3MWBA 5DRKA 1S9EA 1RAAB 2L3MA 5U47A 1WI6A 5DETA 3OL8A 1N48A 3P3DA 3TA1A 2N4CA 4KGKA 2FVRA 1WG1A 2GHVC 3ETOA 4OYAA 5KFOA 1R27B 3DXBA 4WP9A 1UVJA 5K9FA 1XWLA 4JI2F 3VQSA 3OFGA 4WTYA 3TAQA 2D9PA 2GJ2A 2YH0A 4ZPVR 1BUXA 4GMKA 3TUZC 4H4OB 3J80U 4IR9A 2X51A 3FJ2A 2WRMA 4YY3J 2AJFE 1X4BA 1VLOA 1G7CB 1SUQB 4Y3CA 3W62A 3OXGA 4BCAA 5DQIA 3K2YA 3L7UA 2J6SA 5J2PB 3SSQA 1TL1A 1HPZA 2FHMA 2AKWB 5IM0B 3OTBA 1IBMF 1YJ7A 3AD8C 1M90T 3R2DJ 3M8YA 2BACA 3M9NB 1HW8A 1FKPB 3SV4A 1EETB 2Q66A 2IJFA 3KJNB 4LF7F 4HH0A 5J1PA 4JB8B 1WJ9A 1NRKA 1HARA 1FWKA 1YKWA 1FRMA 3B78A 4GVBA 4M5LA 4G3IA 3NMAA 2ACYA 2BUNA 4IH5A 3A4TA 3QZ7A 2ZKUA 2EKNA 2LQ9A 3M6UA 1OPIA 2EC2A 2GS8A 2LKZA 3T5KA 3EGWB 2ZH6A 5B0EA 4I6AA 1B7FA 1NNDA 2QO3A 2IJNA 4NA1A 1Q79A 3NGDA 4RBVA 2XNQA 5LSLA 1U2RA 5DLGA 5T14A 3Q24A 5I3UB 4C3MA 2H5EA 3PTWA 1SJ1A 4OQJA 4PWWA 4WPAA 1VS3A 3W7BA 1U26A 3R5GA 1BLUA 1P1LA 2CZ4A 4IFYA 1NDKA 2PN6A 4YDDB 2HSEB 4KJIA 2IYGA 1WD6A 4Q2MA 4NLVA 2LU2A 4U8VA 4LRFA 1P9YA 1VHFA 3DYAA 2G4BA 1RT6A 2RH3A 1PIEA 3VAHA 2NXEA 4IQXA 1UP1A 3DDKA 3W63A 2YKPA 3P49B 1QAIA 1VMBA 4XPEA 3EMTA 4X62J 3DN9A 3TVYA 3A3OB 1DBDA 2GQCA 4K59A 1IQZA 4JI4J 1U02A 1MNEA 3PIOQ 2KG1A 2R8JA 2HHTA 1M0SA 1UCNA 1HIYA 4KKOB 1G6BA 3PXGa 3RRKA 2AZ1A 2B9YA 2VB6A 2CZVC 2B9XA 2FVCA 2BRKA 4OYMA 1FO1A 2Y1RI 3S01A 2BE9B 3E8OA 3H98A 4B3OA 3US5A 3UVJB 1RWPB 2ZJQQ 1Q8IA 3CCTA 4A8WA 2DO4A 3HHLD 2ROPA 3SCIE 2PO4A 3M2VB 2CJQA 3P8BB 1QAXA 3JQMA 3V6HA 5C25B 3KLFB 3ENQA 3FSIA 2C2RA 2HGMA 4UZBA 3QWPA 3J7YI 3RTVA 3HZGA 4I4BA 3RRHA 1XEZA 1DFDA 2UUTA 2XYHB 2HHPA 1NK5A 4PAAA 2YX1A 1EIYB 2F1FA 4WE1B 1T05B 2OSQA 2R3VA 3BKUA 3IBFB 3M7VA 4JI8J 2RQCA 3MD3A 2YX7A 1B0VA 2DB1A 3I6PA 5K14B 2X1AA 3C46A 4HHHA 3FSXA 3W61A 2IC3A 4QJVA 1UFKA 4QWBA 1MG7A 1JMTA 3GIMA 3AD7C 3MOJB 1H72C 1M5VC 4ZP9A 1QAJA 3W2WA 4DQPA 1X8DA 3OLBA 4I6YA 4ED5A 3PDNA 4ED1A 4M5DA 4CLWA 4LF5J 3QT5A 4Q0BB 2YWEA 1HWUA 4IH7A 3MM6A 2G0CA 4Y28C 4FKYA 2F4VF 2NPIA 3PW0A 5D3GA 4RUBA 2EFPA 1N8RT 4YQWA 1Z4UA 4UY85 3Q83A 2W8LA 3ZC4A 4LIWA 1N34J 3CWJA 2QFIA 4NLQA 3BGRB 3HVTA 9RUBA 2VQFJ 1N5YA 2VG5B 1KHWA 5KT7A 3AHPA 3I32A 4OLOA 2RIJA 4UZCA 4B3RJ 2DNNA 2VUGA 4NLRA 2BJEA 3OJUA 3NNHA 2W7OA 3OHBA 3I5AA 3FKBA 5K20B 3KHLA 2XMKA 2UUBJ 4C8ZA 3RAQA 2O3DA 1AFIA 1HBMA 3MI7X 2GO8A 1FNOA 1HI0P 2NXUA 1R8AA 1T3OA 4K5SA 4OV1A 3CCLS 4DV7J 2IRYA 3H2UB 1D9DA 3FCHA 1QE1B 2PMWA 2VDIA 4OJHA 2GVZB 4MFBA 3MM7A 3TQEA 2R7WA 1XMBA 1D09B 3GSIA 2JRSA 4YS2A 1H2TZ 2C28A 4QOTA 3ZTRA 1JKHB 1MROB 4WP8A 1F5BA 4C6AA 5KFWA 1T95A 1VK3A 2RF2B 4K5RA 5C7PA 1JLFA 2DEJA 5BJRA 4NZ7A 4PRFA 4ZP6A 2B4VA 3ILJA 3SI8A 3KFWX 3UR3C 2ZWPA 4LFCF 2R7XA 1IWAA 1Q4RA 2HGNA 4GKJF 2C2MB 2GGPB 1JJ2R 3LTOA 5F8HA 4PUOB 1S57A 2AW0A 3KJQB 3KUEA 4NYPA 4C3KA 1DTTA 2BQRA 4KFBB 3DLHA 2PC6A 2ZOMA 5M2RA 1N5QA 1REGX 4JI2J 1QD1A 3MEGB 2WVEA 2XLKA 1EKSA 1KC8T 2FB0A 3HHNB 2LXFA 5A2QU 3DC2A 4DX5A 5D8HB 1Y3KA 1Q7LB 5I3PA 1FE4A 3KLIB 2KYZA 1HWLA 3N28A 4OI6A 2E1CA 1EX8A 2OD6A 3W60A 3CDAA 4X66J 1UWBB 3HKZD 3G6YA 4J9LA 4FKXA 4RW8B 3FEXB 2B0GA 2FLOA 3IGVA 3M8PB 4JI8F 2AGQA 3OVBA 2F7VA 4F02A 4M5IA 5HSPA 1IKXA 3QSYB 5IV4A 4A8QA 1S97A 2UZAA 2VFRA 4RU9A 4RW4A 4IFVA 2DNZA 1DLOB 4HL9A 4ZLJA 4DR4F 2MDAA 3G71S 5F0WA 1FX4A 2MGZA 2HHUA 3MR3A 1SI9A 4F4ZA 5IFMA 2AD9A 1NSAA 2FGOA 1FRJA 3CD7A 2M8HA 2AMCB 3EDQB 4JI6F 3ILOA 2KFYA 1F3VA 4RW7B 3KYLA 4A47A 3BBFA 4J9VA 1S49A 2DPJA 1LWFB 4DPYA 3C16A 3FBEA 2B3TB 2AX0A 3CC2S 3MTJA 2UU9F 1HNXJ 1N52B 1TAUA 2DGWA 3C6TA 4ED2A 1JX4A 3QO9B 2OGUA 2RHSB 2V63A 5BR8J 3EPIA 1S77D 2W9AA 5JVHQ 4ZVQB 3K17A 4NLSA 3W5ZA 2H4WB 4ID5B 2CYYA 1C0UA 2ZOGA 1HKAA 4DV7F 2WONB 4F8RA 3KK3B 1D8YA 4L72B 4X65F 3BS9A 3RB0A 1QE1A 2DBBA 3BREA 1SKRA 4MFBB 3MM7B 5D0GA 4ZHRB 3DLLQ 4KGZB 3T1AA 1FX2A 2ZBPA 2QMWA 3BO4A 3KLGA 4DFPA 4CO0A 2BXJA 2V8HA 1LWXA 3C6UB 3IRXA 4FP9A 3F41A 1HBUA 2B9WA 2P9GA 1LW0B 2R42A 4P9SA 4EU0A 3OL9A 2MY7A 1FK9B 2NYHA 4NPOA 2FC8A 3HULA 1VQ4S 5HBMA 2R2TA 3I96A 4DUYJ 1KFDA 4N41A 3DLKA 1PAUB 1SC1B 3BSOA 1X4CA 1UPMB 2VZ9A 2A1BA 2PEHA 3GCXP 2QG9B 3HK2A 1U0HA 2B7CB 4ANDA 2DKOB 2MJNA 3IXQA 4UOHA 1S10A 1IBLJ 1YBAA 2K2PA 1KS2A 1BQXA 5L46A 1D9FA 2DR7A 2W4DA 4PG8A 5KG2A 4IG0A 4C7QA 3HMJG 2V67A 4ED7A 4M63A 2AHOB 1SIWB 2CJXB 4I64A 4Y34A 4YHHJ 3C2PA 1TL4A 2A2DA 4HEA9 1BD6A 1C1BB 5KFRA 4C11A 4F36A 2ZC4A 4D3HA 1UMJA 3H5XA 3CJ8A 2GMLA 1N56A 4PR6A 1F5CA 3HX9A 2XLIA 1VQMS 4UOCA 3H40A 3J81U 3S7RA 1MMNA 3GIIA 3SV3A 3HHDA 2B6AA 3VZHA 3CULA 4DR7F 3JB9k 1T03B 5KFLA 2IA6A 2OTJS 4ZVGA 3U27A 3UI3A 4PWDA 1U2CA 4FN5A 5LSRA 2YH1A 4LRDA 3GILA 2HVIA 2ZUAA 4M5NA 2VBZA 1YTYA 4L6V3 1N6QB 3FCWA 3RZAA 4C48A 3BBBA 4EFAC 3RAXA 2LQ5A 1K44A 3NGTA 5B08A 2NREA 4ETXA 2IPOB 1H3DA 1RLCL 4AD6A 4DG1A 4NCGB 1BXNA 1RT3B 1Q8BA 1QM9A 1SQFA 3RU0A 5HMYA 4AQYJ 1XR6A 2EK6A 2FC9A 2XCAA 4DV0F 1M1HA 4DN0A 1VBKA 3JYTB 1TL1B 4LF2A 4J91A 1A6LA 2GO9A 2U2FA 3GONA 3IM9A 4GKKF 3MF5A 1Y7PA 4OYWA 3P6YC 2D7SA 1JK9B 1ITPA 2GIRA 3J7AN 1UEVA 2XHWA 5EX0A 1K0VA 2WBRA 5THWA 4YB6A 1T9YA 3T6BA 3MPYA 3GCWP 1RUSA 2PSZA 1RQ0A 3S1TA 3NOCA 3BGLA 2BANB 3GYGA 3DRSA 5I42B 3QATA 4ID8A 4AXIA 5A76A 2PA8D 2UV8A 2AYBA 4LFAJ 1G3OA 3H0PA 3RBZA 5ETLA 2HHHF 2G2ZA 3NBPA 1RHJB 4YEAA 4JI0J 2J9CA 3W1YC 3G6VA 4KHRA 2F9JA 3D1OA 3J7YU 3C19A 4LF6F 1SXLA 3D0HE 5J2NB 3I82A 5H9EK 2CPXA 4ZVUB 3QJPA 2EKYA 3M1VA 1S59A 1VYAA 1RJJA 4J7CA 4RJVA 2VPYB 3QJJA 3HVWA 2GHWA 3A12A 1J5OA 3TUJC 3I4HX 1BQNB 1S7HA 3ULHA 2HVHA 2AYGA 4I67A 3MAAA 4BHQA 4A8YA 1OIAA 1PG5B 1WUUA 4B9UA 3TWZA 2KVQE 2FJAB 3CMQA 3H2LA 3LA0A 3PR4A 4DSKA 1QDUB 4CLPA 1PO6A 3I0SA 2HQIA 4MIWA 1RWVB 3TJ8A 1XR7A 3JSMB 5AT1B 4O0IA 3MCNA 4LVOP 1I5OB 1VJWA 4ILRA 1QSSA 2CPYA 1HNXF 4X4NA 3A1YG 1WOOA 3I87A 3U1NA 1FRHA 3M6VA 3UVJA 3T1YF 1LWCB 3OR1B 3DOKB 1TKZB 3QQCD 1HI8A 2AEJA 4RBTA 2DY1A 4Y2MA 1S6OA 1SV5A 2GVDA 4EI2A 4PYAA 2J5AA 2W25A 5C25A 3KG4A 1CJTA 1TV6B 3DI6B 1RZMA 1WC0A 4MT1A 2MXYA 4F4AA 3QAUA 2BW2A 2DJWA 4OJ3A 4Y0FA 2BQ3A 3AODA 1T8EA 1S0MA 4OHYA 4XDCA 2CNLB 1RT5B 3LPEA 2C2DA 1ZS6A 4JV2A 4LRAA 4USWA 3GJQB 2CDRB 1T05A 4EO6A 1EARA 5E33A 1XERA 3LGNA 2ABYA 3RYLA 4DV1J 2KRRA 4MTPA 4F0MA 1F2GA 3L9ZA 1TL3A 2I5JA 3TAMA 3M8WA 2ZVSA 4C0BA 2V0NA 4LF4J 3SSRA 2UV8G 4CRJA 3QT8A 4J90A 2H9ZA 4PQAA 4RWXA 3OLAA 2XYPB 2RNEA 2W9BB 1WTBA 2NXJA 3MECB 3OD2A 3R6GB 2AJ4A 1SCJB 2JOQA 1RTZA 1DTQA 2Q43A 3DLJA 3CCUS 2ZH5A 1AXQA 3AT1B 2L41A 2YNFB 4AL7A 3RW6A 2FVSA 2G9OA 4LF1A 1RT1B 1VDHA 4RR5A 3GG1A 1TP7A 2XMVA 4PZVA 1JIHA 1Q86T 3K89A 4DLGA 3I9V9 4ZVOB 3B4DA 3EGNA 4ZIVA 3MCSA 4XK8C 3I4PA 3D6FB 2W2OP 3GTYX 4M5GA 3P4UB 3GLJA 1RU1A 3DRRB 1IJFB 1A7GE 1U24A 5L1JA 2IY5B 3DGVA 3NY0A 4NI2B 4OZLA 4R0JA 1WC1A 3U7JA 4E8UA 1BE4A 4LF9F 4K4TA 1OQ6A 1KOHA 1BQNA 2WVFA 3D6MB 2HFZA 3MAAB 2VV5A 2D74B 5HO4A 1QTNB 5FJ4A 5KFMA 2C22A 3CC7S 3M6XA 3W9JA 2F4FA 2G13A 4PXEA 4EWTA 4CLFA 1RHUB 4S0MA 3TX8A 2QZ8A 3GIKA 2VIHA 2PDAA 2OPRB 4FYXB 1KEKA 2HZAA 4CLUA 1FXDA 3H2VE 4NLPA 2W9CA 1U47A 4ELUA 2IM3A 2R9LA 3CIMA 1U4BA 2MZQA 3BQ2A 2E5IA 4EZ6A 2AV5A 4O4GB 4J9QA 3OR1A 2QX0A 3KG1A 5JXSA 3ZTSA 4NXNF 5E3CA 1S0NA 2IFXA 4IG3B 3DGPA 5H9FJ 1RTHB 1PC5A 1WDDA 5EWEA 2VFTA 2ZH8A 1FT8A 4URGA 3BQ1A 4JI3J 3KNAA 3OTDA 2DK2A 1RTJB 3T1HF 3CJQA 4QIFA 2V8PA 2AU0A 1PILA 3QIDA 2UXCF 3HP6A 4K4XA 3PKYA 2C3MA 4LREA 1RXOB 1H0HB 1HQUB 5K8OA 3M8RA 2FJXA 3Q23A 3UPFA 4WYWA 2KZMA 3PRDA 3FRZA 1BHNA 3CCSS 4V1Ak 1VQYA 3VV2B 2X3DA 4IDKB 3BPSP 4C2MA 1AUDA 1FJGF 1FERA 4PXCA 2BE2A 2E5LJ 1S6PB 2W9BA 8ATCB 3F56A 2HG4A 1Y9OA 2MGZB 2DXFA 1Y0HA 4DU7A 1CEZA 1KLMA 1WC5A 3TA0A 3D2WA 1MSWD 2QMXA 1E6VB 1U48A 1XBWA 4BWMA 3HLUA 1QVFR 2YNFA 2HS4A 4KY3A 4YB7A 5KOWA 3Q22A 1XC9A 3KUHA 3C16B 3RUBL 4QQBA 3OT9A 1EHWA 2J7KA 2BKOA 2MLYA 3DKDA 3IM8A 4G1PA 2B56A 3GV8B 1TKTB 2QLFB 4Q44A 4WKRA 2HBYB 1B64A 3MMCA 4R25A 1FDBA 1OY9A 4CLSA 5CCLA 2X1GA 4DUZF 1JLGA 2HHVA 1APSA 3MCMA 2QL5B 1HA1A 2AEFA 1X0FA 2BYCA 7FD1A 3NGRA 2OP5A 3HPOA 4X64J 3CD0A 5ITHA 3KMQA 2JFKA 4K2XA 2BEFA 5B0FA 2ACMA 4L3NA 4ALZA 1TKXB 4WCEQ 3DM2B 3CJ2A 2AF6A 2ZWOA 4B9NA 3TUPA 2HQCA 2OHDA 3OQ2A 5HATA 2FY8A 4CTAA 5AE1A 2CQHA 4HYKA 3V4IA 2HNYA 1HL6A 1FK9A 5D15A 4CO2A 1QUPA 2HFOA 1JLQB 2HS3A 1N36J 5L39A 3CO9A 2DIUA 1F9FA 4DR4J 1NMEB 1TZ0A 3ZZTA 3UD4P 4QYZJ 3H8YA 3KLHB 4A46A 5GADU 2V2QA 1Z1ZA 2ROEA 3R27A 3K7RA 4F2SA 1RT4B 2UVUA 3MMAA 4B08A 3UQSA 3F73A 5L38A 4DPOA 5KT3A 1M5PC 4CLZA 1YGYA 1PJ7A 1TK0A 1RU2A 4UW2A 3T1HJ 3CEDA 1X4HA 4DPXA 3QT7A 3RBEA 4UT4A 3E51A 1IBMJ 5ETNA 4CLLA 5HMZA 1SJQA 4CLTA 4ILMA 2WHOA 2V2VA 1GXTA 3KJVA 2CQPA 3NAHA 2PMZD 2IRUA 3FVYA 4NXNJ 2KI2A 3KWMA 5G0RA 3MAHA 2Q1LA 1KN6A 2BVZA 3RAMA 4PWDB 5CQGA 3O5TB 1W7WA 2J6UA 5J2QA 3GP9A 2VD3A 3MR2A 3I31A 3OL6A 2FD2A 4U95A 2DNPA 4RUHA 4WXWA 1SJ4P 1RABB 2V5HG 4MK8A 3MEDB 2GMHA 3ETMA 3U1LA 2UUWA 4K0KJ 2YX4A 1UPPA 2QGFB 4IKAA 3V81A 4KHMA 4ZVSB 2WVCA 2MLZA 2R4FA 5EX3A 3MM9B 1ZAVA 3W8PA 5LT5A 1RT3A 3NCRA 4HVZA 2M88A 5HP1B 2KXNB 4RO0A 2AGPA 3ZFVA 3ILLA 1HNVB 1UFLA 2O5DA 3GYNA 5KFAA 3QYYA 2V4JB 3L95X 3N6NA 4MIAA 1JLAA 3RG6A 2J8SA 3TW0A 1T94A 1X9SA 3NNCA 1S1XB 3KMSA 2BR0A 4Q45A 4DFMA 5L8RC 1Y4ZB 3ISND 2H5JB 2LXIA 2MKCA 2XSFA 3Q89A 4OZ1A 4QIWD 4JV5F 3IBWA 3WIVA 1CJVB 1MU2B 3SQGA 4BC9A 3PJXA 3HT3A 4QR0A 4FNHA 5KOXA 1P8GA 3BM7A 3ZNJ1 5KFFA 4U6PA 1ZA2B 3QZ8A 2FYXA 1WTFA 2ALZA 3QPIA 2YKAA 3R5CA 4KTQA 1MN7A 5HANA 1OSCA 3X1LB 4OZ5A 1TU0B 4LQ3A 1X4AA 2OPPA 3OFFA 1J5EF 3UD5A 3CDEA 4B3SJ 2K06A 5IQ6A 4AE5A 2WZ1A 3D6TB 4QBUA 3VQTA 3EM1A 2K1RA 2R7OA 4IFYB 4OI0A 2HQGA 1FJGJ 2HNZA 9ATCB 2EWHA 3UCGA 1KD1T 1RAOA 4ZJLA 3THPA 3VF0B 5AXNA 3UD3P 2EBGA 1VFJA 2NUHA 1AUSL 3NWRA 3QLHB 2YWGA 4KC5A 5F3TA 2HK3A 2OMLA 2CJAA 3M8QA 1DRZA 1URNA 2OEJA 3KLHA 3O6QA 4H4MA 2VC1A 3SCLE 4ZKAA 2GAGC 3D1HA 4YR2A 3MAQA 1NK6A 2R7VA 2EG1A 2UUCF 2F3JA 2IVFB 3WBZA 1NHKL 4WYLA 4LSZB 1T9VA 3PW7A 3SDEA 1XNRJ 5LM7E 1CQMA 4LSLB 3E01A 2MZTA 3DOMB 4I2PA 1YX2A 3PFOA 2XMWA 2RT3A 4FZVA 5T41A 2DNYA 4CO1A 4NASA 4PWUA 3WDOA 1SJFA 1KP6A 2XZDB 2ZZMA 2Z57B 3M8SA 2ATCB 2JSXA 3KJVB 1S6UA 2LEAA 3HKWA 3PYGA 5KFSA 2X1FA 1N36F 2PEBA 2KXHA 4Y65A 1HD1A 2YKMA 1CJUA 2HLTA 3D68A 2NXCA 2DNQA 2A2CA 3D4JA 3MPDA 3PM9A 2RU9A 4UQTA 5FLXU 4LSNB 5GVQA 4JI5F 1CLFA 3C14B 2OIHA 1BGXT 4WIIA 3W3SA 2FLNA 1L5UA 1VIXA 4RKUC 1DURA 4N7TA 4YHHF 1NJXA 2DR9A 2UXDF 3SCJE 1H2VZ 4B9SA 4IO9Q 1RA6A 2HFUA 1CJKA 3RB3A 4JBCA 4CCHA 2YQ1A 1G4CA 3AXKA 1NB2A 4Y2KA 2GIQA 1JLAB 1U8SA 2MSSA 1ZTWA 4OLPA 1GFWB 3K59A 4ED0A 1UA1A 1SL0A 1S1XA 4NLGA 3MECA 1H7WA 4M5JA 1V5IB 4ZVEA 2WTFA 3M2RA 1M1KT 2UVRA 4EMDA 3JQKA 5D3GB 1VBXA 1S1UB 1YVFA 3KK2A 2ZE2B 2E66A 3DU6A 5KFJA 2IJRA 4WTOB 3DHXA 5L1LA 1HHQA 1X0PA 2AEMA 1RT1A 4TY9A 5KG1A 1GEHA 2IBOA 2P9CA 5GAGU 3BEGB 1GH8A 2R7SA 4M95A 4DX7A 4LF5F 1DY3A 3TYTA 4Z7CA 4O3NA 4Y00A 3J81Y 2DEIA 4HHUA 1P6TA 1X60A 1FNMA 1FDDA 1REVB 4ECQA 1HBOB 2G1HA 3FC9A 3PJ9A 2MZ1A 3CCMS 2E5HA 3IAS9 1SUQA 3N79A 3FK4A 2RAQA 5HLFB 4DOZA 5KG7A 4ZVFA 5KT6A 2ZH2A 2K3IA 2VQEJ 5L1IA 4DR2F 2LDYA 4ECVA 1H74A 3KJFB 1N5SA 2QMUB 2WVDA 4IOCQ 2EW9A 3HVAA 1JLBB 2F5GA 3ZXWA 3B8HA 4WIQA 4IR1A 1ELOA 1E6YB 5D4PA 2CVIA 4AUKA 2XO7A 2XSJA 2W01A 1K73T 1FKPA 1XNQF 5HI7A 5E0OA 2E7VA 2JEGA 3AQOA 3MM8A 3GYXB 4N76A 3SCKE 1OWXA 2AP6A 1WC4A 4LVNP 2LEBA 3DMJA 5J1EB 3HD1A 1VGYA 4MYTA 3VR1A 4XO0A 1WEZA 1DTTB 3FFIB 1XTZA 2KU7A 1S1WA 1R7IA 4C0HA 8RUCA 5KFBA 4TU8A 1MWZA 2RKIA 2RVJA 1BQMA 1MWQA 4RWWA 3JS9A 5HK4A 1N5VA 1ICEB 1U25A 3LH2S 4JV5J 2CQGA 1TQLA 1V3SA 3IGNA 4KGVB 4DCPB 2M9KA 5D0EA 2G2YA 1KBRA 4OI3A 4EGLA 3OTOJ 4FS2A 2QA4S 4FS1A 2YWFA 1YHQS 5IOLA 1SKWA 5CD4A 3HFZB 1ZZFA 2OD4A 3TUIC 4F4XA 1FEHA 3LALA 3MPVA 4DCOB 4DV1F 2EFNA 5E7OB 5IM0A 2UUAJ 3PG9A 5F8MA 3TJ9A 1M5HA 5KFGA 4CM0A 1TFYA 1FJ7A 2B8PA 2D3UA 1XMQJ 1URRA 2LEPA 1NPKA 4ZITA 1RTIB 5KFQA 4A8KA 5A2QY 3TOQA 3ITHB 1VIOA 3GJRB 3KDNA 4MMOA 3HSDA 3THTA 2EFGA 1SL1A 2DPIA 1WNEA 1VC6A 1HNWJ 1YG0A 5E3PA 2VA3A 2D41A 2CQIA 3TVZA 4AYBD 5DGBA 5GAGI 4O23A 1JJCB 1NM2A 5E5NA 1HQ2A 3V2UC 4WKYA 1UW9A 2EFOA 1R8BA 1WF1A 4PQUA 2Y1LB 3G82A 3M2RB 4WFZA 2SXLA 3CJKA 3KK2B 1E6VA 2WSEC 3Q86A 2H54B 4OJ1A 3D6HB 1RP5A 2FGCA 1R31A 3I5BA 3AFGA 4OX6A 4TYAA 4LBPA 3UN3A 5D78A 3X3UA 4DR6J 1QAYA 3C6TB 2GIFA 4KT0C 2NPFA 3QO9A 1IM6A 2DNLA 3GU0A 4OZ2A 1JLEA 1RAHB 1XK8A 2APOA 4QWAA 2UXDJ 3BV8A 2QL9B 2OPSB 2HWTA 3IP0A 4TY8B 6AT1B 2D3O1 1TK8A 1TKTA 2XB2D 1HBOA 1R89A 4XAKA 1RT7B 4LF9J 3ZTPA 3R5BA 3O3LA 1W25A 4J9PA 1TL5A 3EZUA 3W5XA 4C97A 2KJVA 2PD1A 3K57A 3OTOF 2IC3B 2QA2A 4C8NA 4R8UA 3THVA 4JI4F 2KZZA 5D6GA 1LOUA 1ZETA 3KLGB 3AB4B 1UEKA 3LUYA 4JI6J 4KPYA 2AJ1A 3SZ2A 1L3VA 3OUYB 1IM4A 1HI1A 2Y8YA 2J0SD 5KT5A 4FF4A 1U1PA 3MM8B 3DLKB 2C3OA 4ECRA 2DRBA 1YJTA 4TXSA 1QLNA 2L48A 2XULA 3TANA 1MMLA 2VHGA 2QLWA 3P5BP 3S8SA 3DYAB 1PBUA 3T1YJ 3V6DB 4MJKA 4ECXA 5KG0A 1OO0B 2LQ8A 2ASDA 2W24A 2AWZA 2W2NP 2QYCA 4TLQA 1BQMB 4HH1A 2O01C 2DNMA 1VOMA 1NJYA 1T0TV 4OHVA 1GMWD 5KFNA 4X4PA 2VDHA 2MKIA 4DL4A 2MHEA 4R0EA 4I6WA 2GA7A 4LJMA 3VHQA 3CJTA 2AZ3A 3MD1A 4PABA 4AXJA 5A8WB 1SC6A 1NJZA 2AJ2A 1GQEA 1JLCB 4IOBA 2DGUA 5LSOA 4RW6A 3T5LA 3BN7A 1K8AT 4K0KF 1RTIA 2YQ3A 4PCQA 2RU3A 3GE9A 1VR6A 3BGFA 5LMUJ 1ZZNA 3CCQS 1N6QA 1MMDA 3MR6A 3DOLA 3IG1A 3N5FA 4GRSA 5ETKA 4CNYA 4LFBF 1KTQA 5K8MA 1X5SA 1IR1A 1KQGB 2Q6CA 3SSSA 3A8KA 1Y10A 4ICLA 3DRXA 1FNXH 4B9TA 5ETMA 1TMJA 1NEEA 1S7IA 4G1QB 1LKZA 5K8PA 4DL2A 1DQ9A 1LNQA 1I6JA 1DJ0A 3JYTA 2XMMA 1IQTA 2RD5C 2KDOA 1HWKA 2DR6A 3OBIA 5IC6B 2DRDA 3FBFA 2YKNB 4JI3F 1JLEB 1Y5IB 2V94A 1ZPWX 4P10A 1VRTA 1I1GA 3JAMU 2K8GA 2AIRB 2FHJA 3OTEA 5MLCV 1VQ6S 3R5DA 4K7QA 5KFUA 2JVRA 2MZRA 1RWWB 3ENVA 2HNDB 5CHCB 4DL0C 1JKHA 4IYQA 4NL5A 5IWAJ 1Q78A 4Y6IA 2VG7A 3PX6A 5KG5A 3M9MB 4WZQA 2JJ4D 5MAOA 3IR7B 3H4DA 4ZPTR 4NCAA 5IWAF 4OV6A 4USTA 2DITA 3QBCA 3N6LA 2GW8A 1FDNA 2P9EA 5EGYA 2MKJA 2FHJD 3TJAA 4H4OA 5IS2A 4QIVA 4ES3A 3NP5A 4NLOA 3QAEA 5KFDA 4JI7J 4KFBA 1YBUA 2OEMA 3LW5C 3PW5A 4X64F 3KHHA 2VC0A 4F7VA 2HRYA 4FBUA 2XO6A 4O3OA 1YWXA 2GJFA 2FZGB 1HBNA 2A0FB 1WSVA 3HCXA 4CQ1A 2UXBF 3TR5A 4DV3F 3QLHA 4YP3A 1RSCA 1AFJA 1A9NB 1FWPA 2R7TA 3PCOB 3JSMA 2OKQA 3CW2C 1UWAA 3T9NA 3M8PA 3NAIA 3MR5A 3QRQA 3RGIA 2VG6A 2FVQA 2J7UA 3M30B 1T9XA 2JX2A 1RAEB 3P45B 4FYYB 3TA2A 3U02A 5T7LB 5GADI 4I2PB 2ZBRA 3OHAA 1RKIA 2IVMA 1C2PA 1ZAXA 3NG8A 4KAIA 5A8WA 4K50A 4B3SF 3H5YA 2BDPA 4DCJB 2DHXA 3JXOA 4A8XA 5KT4A 3PR5B 2V4QA 2GVDB 4PEOA 4J9RA 3KHRA 4ELVA 4DEZA 1C1CB 4ZLNA 1IUJA 1LK7A 5A0YB 1JXEA 1RCXB 1S9GA 3MUMP 2RDDA 4QW9A 4LMZA 3NL0A 4JOUA 3VAMA 2B9EA 3ZTQA 1KVIA 2XY5A 3NMRA 3TRGA 4PKDB 2DNRA 1YJUA 5BYSA 1RT6B 1FDAA 4KPCA 4NRTA 3TARA 2DCLA 4ZJOA 6FDRA 3HJFA 4KV8B 1SH3A 3FZ2A 3VTIA 2D69A 4G1QA 5D4OA 5IV3A 4K4YA 2HHXA 2A6MA 1TAQA 3NLCA 3OSNA 1HMVA 3MTKA 2I38A 3PJWA 3QRPA 2AJQA 4I7FB 2B4UA 5EN1A 1VHIA 5AE2A 3ENAA 2WVBA 4KKOA 2BV3A 4CH0S 4N77A 4GO5X 4H4KA 2VU5A 2GV1A 3QSIA 5D4LA 2VKRA 2Z2YB 4RUCA 2MZSA 4HI2A 1RWOB 3M32A 2C3YA 4LFCJ 1U1LA 3UN2A 3KLFA 2VF3A 5A8RB 4NLYA 4RNHA 3ZTOA 4XPCA 4P71A 3R1LA 3CSKA 4B17A 1QUVA 1M1GA 2CQ4A 3CCZA 2MQQA 1HNIA 3JQJA 3L3CA 1PGZA 1FHTA 2CQDA 2MKHA 2DNOA 3J7Z5 1LW2B 4YMEA 5RUBA 4I68A 2AGOA 3JSBA 2ALYB 5KFIA 2ZH1A 4ED8A 2V9WA 3CMAS 5C42B 1VQSA 3KXDA 5E41A 1A0OB 2Y8WA 2VPXB 2RMLA 2XWYA 4F26A 1PJ5A 3KLEB 2BJDA 2CIMA 1C1BA 5DZ7A 4X4SA 3PVXA 1V9OA 2WB1D 3OFHA 4OIXA 3GJTB 1YIJS 2J0QD 2XSJB 4P52A 4ZPBA 3V5RA 2UVVA 1VRQC 4IRDA 4ERDA 2OPQA 2JFDA 4B3RF 4K4ZA 1EP4B 5B0CA 2I1RA 2CJ9A 4P75A 1S6QA 4B3TJ 1C0TA 2W4PA 4USMA 2BANA 1NK4A 1OYDA 2MQNA 2JEIA 4FBTA 2F4VJ 2DNHA 2GC8A 1HNWF 2J9DA 2XG8A 4AL6A 1FRLA 3UN5A 1L3TA 3CDWA 4DR5J 1MN9A 1Q53A 1JB0C 3UDLA 2ZM6F 3VVUA 5CYQB 1RTJA 1D8ZA 2OEKA 3JSRA 4NCGA 2QTWA 2HS0A 1UETA 4HDGA 4W98A 3M1VB 1TFWA 5GAEU 3A13A 3HDSA 4ZLLA 1SH2A 3EJMA 3PACA 2R2SA 2XTJP 4EBCA 4PXDA 3CJ0A 3N9UC 4QW8A 3VGVA 4J9NA 1OY8A 2XMTA 2KH9A 3G8SA 1T9UA 5DDRC 2ZJPQ 1TKDA 4ES2A 1N32F 2Z2LA 3FCVA 3A8EA 2H1YA 1U8WA 3KG0A 2BE2B 3PO4A 4GC6A 1YZ7A 5M2PA 1DZ5A 4OI4A 2LXUA 3DLGB 3FBCA 2V8VA 4HTIA 3WC0A 3HO1A 1T9TA 2WW4A 2ERRA 2FDNA 2EG2A 2HBZB 1RTDB 4HACA 4WK3A 2RS8A 4DX8H 1NDCA 4RW9A 3NS6A 1WOPA 3AOBA 4L75A 4LF7J 3OR2A 1M5OC 2IAJA 1CS4A 1CULA 1FWLA 4Z37A 1R0AB 2HZVA 3MPUB 1GMWA 2ZHAA 1RYSA 5CXTA 4RPFA 2ILYA 3EVMA 2PE8A 3BDPA 4CH7A 4HDHA 5DM7Q 4QZVB 2BQUA 4K2JA 5KAKA 4Q8EA 1Y3JA 2MTLA 4ZPCA 1FFSB 2F8MA 4E0DA 1NBEB 3CGIA 2UUAF 4CO5A 4Y2IA 2JNJA 3WQPA 3IR6B 3IBCB 1SC3B 3MEKA 4JV0A 3W64A 3G8TA 1UL3A 3NGSA 4BC7A 2C3UA 4RW8A 2UXCJ 2GHPA 1D0EA 2CQ3A 1NH8A 1U1KA 4QR1A 1H73A 2XLJA 2AQ4A 3DRSB 5I42A 1IKXB 1MROA 2KM8C 1SQEA 2J0WA 3R2CJ 3WX4A 2RF2A 4WJBA 3QIPB 1CQNA 3BR9A 2JC0A 4UUWA 2KXFA
chains in the Genus database with same CATH topology
3DCAA 1HQEB 1S1VB 3KK1B 3VWSA 2ADBA 1K9MT 4I2QA 4ZPAA 1RT2B 4CTAB 1HNZF 3NRBA 4ELTA 1KSPA 4OZNA 2AYMA 4NA3A 5DDPC 1ZH5A 3CD6S 1C0TB 2LECA 1VK8A 3GFXA 1FJCA 5CA5A 1X4FA 2RJZA 1WHVA 4NZ0A 2ASLA 3TNVA 2Z4PA 1G2EA 3T19A 3MGJA 3V6DA 4J5OA 4BS2A 3AH6A 1W2BR 2O67A 4USHA 2IMWP 4RNNA 2M52A 4B3MF 2A10A 3RR8A 3LP0A 1UWBA 3DRRA 5DDQC 5KG4A 4N56A 2ZHOA 4OMFG 1U1NA 2E7WA 3BB5A 2XI3A 4AFFA 1KRPA 1HYSA 5HL7Q 2DH7A 3EXYA 2DGXA 2DGTA 1ZYQA 1LWCA 4W90B 3KKFA 2IRXA 2ZH9A 2YNGB 2I9SA 3G8QA 3H59A 4M8LA 5HROA 2FPHX 1HBUB 1Q1KA 5KFEA 2ASJA 4QIGA 5LMNF 5KFKA 4NLUA 5KG6A 4D3GA 3DLGA 2EFVA 4DSJA 3DLBA 4YR0A 2HLUA 1D9AA 2W9CB 4ECXA 5HN0A 5C5JA 4DF4A 3TAPA 2CG4A 3B82A 4U7UK 2KFZA 2MPUA 1TL3B 2I5JB 2ZBIA 3PX4A 2GQ2A 1P9QC 3Q8RB 1LXNA 1KR4A 4FYDA 5FDLA 1R8HA 2OSRA 3CDBA 1VRUA 1KHVA 3EXCX 3VCDA 5F8LA 2Y1IA 2BM0A 4AQYF 5J2MA 3UW1A 1NB7A 4NOHA 3RR7A 2XI2A 4ZHRA 4LT6A 4FNIA 3DRYA 5KTQA 5B0AA 2HNDA 3MHYA 4OX9F 2XC9A 1RYRA 1N33F 2V8GA 3QIPA 3CPWR 3MMBA 4HTJA 1S6PA 5LL6d 1FVSA 5EDWA 3CJ4A 2O66A 3I55S 1J2VA 1U2FA 4RX6A 2DR8A 4Q8FA 1SBRA 1TR0A 2KB2A 2GQQA 1SL2A 4FVCA 2ZFHA 4OX7A 4Y2CA 2MQPA 2MKKA 1U1RA 2JWNA 1U6BA 1HWIA 5SZTA 3BN4A 3RW7A 4MK9A 1SJ3P 5A8KB 3LP0B 1WF0A 2DR5A 1JLGB 4X84A 3M9OB 2VKZG 2RQ4A 3G4SS 1IJEB 3DHWC 5D4NA 4TYBA 3CCES 5EWGA 3VAFA 2G4BA 1RKJA 2FTRA 2CPZA 3UWTA 5IT0A 1V3RA 3EGZA 2YNGA 2MMYA 3FDSA 2GNKA 5JJBA 2KM8B 3EPGA 3HHLB 4LFAF 3ONQA 2I8EA 3OSPA 4K4UA 3O2IA 1C1CA 4ES1A 1NK8A 5C24A 3VAIA 1XMOF 5J2PA 1ZM4A 4RUAA 4TQSA 2KKHA 4DQRA 1VI7A 5F8GA 4CH1A 2L9NA 4ED3A 4LF4F 3D1QA 3PKMA 4B02A 4KBIA 4NRUA 4Q5VA 1LWEB 1FKOA 2YY3A 4KE5A 4P2SA 4KV8A 3I0SB 1Y00A 2ZC3A 1Z2LA 2LA6A 4OL8A 4ZPWR 4RNOA 4YHHF 4YR3A 2DNKA 3MMCB 1S1TB 3D0IE 3FGVA 2FLLA 4LF8F 3MZIA 3OTCA 5F8NA 2P6TA 5KFTA 3NCQA 4IRCA 5F3ZA 3IA0A 2DTJA 2M5YA 2KVIA 4NA2A 1C4AA 2HMIA 4DUYF 4KQZA 2N3OA 4URQU 5DDOC 4DL7A 1IKWB