1T03B

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/antibody/dna
molecule keywords Synthetic oligonucleotide template
total genus 96
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t03B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03B03
2AX0A 1S1WB 3KHLA 4F4XA 1HQUA 3M8PB 2IMWP 1NNDA 4ZP9A 4Q43A 4K4TA 5C25B 2ILYA 2I5JA 1EETA 1S9GA 2XI3A 4URQU 3TQ1A 1SUQA 3DLEA 2WTFA 4F4ZA 3OSPA 2YNFA 3BGRB 2XGQA 1C0UB 3PVXA 1S1XA 1TKZA 1S1TB 4JV1A 5J2NB 1RTHB 4NYZA 5KFEA 4ED1A 3MTKA 2HNYB 3IG1A 3KK3A 3SFGA 4H4MA 4ZVHA 1DTQB 4KV8B 1IKXB 3MEGA 3H5UA 1FKOB 5EWEA 4TY9A 3CVKA 4ZP6A 1HQEB 3M9NB 4J9OA 4PQUB 2W8KA 1SV5A 4ZPCA 1MMLA 1LWCA 3ISNC 3KK2A 5D3GB 4OL8A 3M9MB 4IRCA 3FDSA 2JEFA 4RW7A 1R0AB 4M95A 3CJ3A 4RNMA 4TQRA 2XC9A 4EYIB 3MECA 2HAIA 1RT2A 1TKXA 1RTJA 1VRUA 4IH5A 5KG5A 5KFMA 5DG8A 3KLVA 5DLFA 4RW6B 2BE2A 1VRTB 3KJVB 3D5MA 5F8IA 5T14A 3RB6A 1JKHB 3MFHA 3PJWA 3NBPB 1S9EB 2D41A 4B3OB 4Y3CA 1IM4A 1J5OB 4MK7A 4MIBA 4LSLB 3DI6B 3OHBA 3V6JA 5HP1A 3QO9B 4KFBA 5J2MB 5HLFA 3H2LA 3QZ8A 3T5LA 1FKPB 4J9QA 2YNGB 2XCAA 3CDWA 2ASLA 2IJFA 1XR7A 4R8UB 5KFWA 5HROB 1TL1A 4DL2A 3SFUA 1S97A 2UVWA 3KLEB 1IKWB 2B5JB 3E01B 2BQRA 2VG6B 1QE1B 1S10A 4WE1B 4XPCA 4ECQA 3I0SA 1RTDB 4KO0B 2WB4A 3DOLB 2D3ZA 1N48A 4TXSA 4K4VA 4M94A 4IR1A 1U09A 3FQLA 3T5HA 4RW9A 2XCPA 4RUAA 1S9EA 3PZPA 2F8EX 1GX5A 5KT4A 4J9KA 4J9LA 4PUOA 1ZTWA 4DL5A 4Q8EA 2R2TA 2IA6A 1DLOA 3JSMB 2UVRA 1LW2A 4ECXA 5L1JA 2AQ4A 5KG3A 3CO9A 1HMVA 1S1VB 3KOAA 4U6PA 3KLFA 2HWIA 4K4WA 4ZHRA 1C0TA 3I5AA 2C28A 3V6HA 3IRXB 4ID5B 4O3QA 4IG3A 3H5YA 4H4OA 1C1CA 4DL4A 3FFIB 2VG6A 2FLPA 1N5YA 2E9TA 4R0EA 3KMSA 1ZETA 1RTDA 3FQKA 3HVWA 1S48A 2JC1A 4K50A 1TL3B 2VG5B 1JLAB 2ZD1B 3C6UB 5CYMA 5KT5A 3DRPA 2V0NA 5DQIA 4NLTA 1RAJA 2HNZA 5C5JA 4Y34A 3RB4A 1IKYB 1JLBB 1JLCA 1FK9A 2FJVA 2YKMA 3GV8B 1T05A 1S6PA 3BR9A 3G6XA 2GIQA 5J2PA 3M8PA 2UUWA 4IFVA 3QLHA 4HYKA 5KFIA 5DG7A 4ZP7A 2VG7B 5KFZA 2OH2A 3I0RB 5F8GA 2ASJA 4Q45A 2C2RA 4PWDA 2W9AA 2JLEA 1S1XB 2J6UA 2QE5A 4MK9A 2C2EA 1BQMB 1TKTB 5KFQA 3VQSA 4IDKA 1HPZB 1WNEA 1KLMA 1RT1A 4G1QA 3LP2B 3MFIA 2AGPA 2JEGA 3CDEA 2WOMA 3G86A 1FKOA 5KT6A 1NHVA 2W9CB 4O4RA 2R8JA 4RUCA 2RDJA 1TV6A 3DOKA 4PQUA 5KFGA 3PW4A 4YMEA 2EC0A 5J1EA 4DEZA 3MEEB 3KMQA 1IKVA 1C2PA 3IS9A 3CJ0A 2GC8A 4MFBB 4IKAA 5KFKA 3D28A 5FDLB 4NCGA 1T94A 4ZPBA 5HBMB 5KFXA 3MECB 2YKNA 2HMIA 5KFLA 3UQSA 4RNNA 4QWCA 5KFJA 2V9WA 2VA3A 4Y2AA 3QIDA 4EEYA 3DM2B 3MF5A 3QGHA 4B3OA 4FS2A 4ECSA 4NLPA 4ZVEA 3Q8SB 4YP3A 2W7OA 4RNHA 2RKIA 5I3UA 3Q8RB 3DRSB 1RT1B 4G1QB 3TAMA 4RNOA 3BSCA 1T03B 1N6QB 4TY8B 4QWAA 1UWBA 5L1KA 3SI8A 1JLGA 1S6QB 4R8UA 3MEDA 2W9CA 2RF2B 4FBTA 1JLFA 1W25A 5J1EB 4Q0BB 4O3NA 5DGAA 4J9NA 1RT4A 3GIMA 1QE1A 4IG0B 3N6MA 3EPIA 2R2SA 4LQ3A 1SV5B 3HVTB 4ED0A 4JUZA 4KO0A 2FVSA 2HMIB 5KFUA 5KFTA 4EBCA 1S1UA 3C6TB 2ZE2A 3ITHA 3H4BA 4WZMA 3DLKA 3LP1A 1EP4A 3ISND 1NHUA 1RT2B 1TKXB 1VRUB 3IN5A 1VRTA 3KLIB 3E01A 4NLUA 3HKWA 2BQ3A 5F9LA 1J5OA 2FLLA 3QIPB 3DRSA 4DG1B 2BANA 3OL6A 1HNIB 2BRKA 2D7SA 4MKBA 4KAIA 3QO9A 3DYAB 1ZTTA 5I42B 3MEDB 1S49A 4O3PA 3DMJB 1FKPA 3T1AA 3G6YA 1JX4A 2J6TA 3IRXA 4J9MA 3MR6A 4O4GA 5EWGA 4DL3A 1RTIA 1HNVB 2R8KA 4WZQA 5CYQA 5KFYA 5F8NA 2OPRA 4QW8A 4U7CA 3KK3B 5J2QB 4IH7A 3QGIA 3RAQA 1GX6A 2IC3A 3JYTA 4ZHRB 2YNIA 4QWBA 2OPQB 2R8HA 4RW4B 4ZPAA 4ECYA 1C0UA 2JC0A 4ECUA 4FS1A 2VA2A 4EYHB 2OPSA 2YNHB 1T05B 1HYSA 4WFXA 4YR0A 3E51A 1RT7B 4TYBA 5KFVA 2QV6A 3PR4A 1S0OA 2FLNA 2J6SA 2HNYA 3QIPA 5EWFA 5KG2A 3OL7A 1S1WA 4K4XA 4KKOA 4RW6A 2BR0A 3MEGB 1IKXA 1TVRB 4IH6A 5I42A 4ZP8A 2FJXA 5KG1A 1HMVB 5C25A 5JXSA 2IM3A 1S0MA 2R8IA 3PW0A 3H5SA 1JLEB 1JLQA 2WONA 5C24A 1C0TB 5C42B 4RW8A 2IM2A 4K4ZA 4ID5A 1REVB 4IFVB 3DLGA 1RT3B 2AWZA 4ZVFA 3BSOA 4ED6A 3GIKA 3V6KA 2C2DA 3IGVA 4WXOA 3NMAA 5JUMA 4MIAA 2BE2B 3KJVA 4NRUA 3I0RA 3GIIA 4G3IA 3BJYA 3NL0A 2ZD1A 2GIRA 5KG4A 2BRLA 3GV7B 3KK1B 1RT6A 4J9PA 3MR5A 4I2QB 2IAJB 3V4IB 1KHWA 4EBEA 3GYNA 3DRRA 1TKZB 3KK2B 5D3GA 4IFYA 1FK9B 5HLFB 2I1RA 4WFZA 5KG0A 3OL9A 2UUTA 3FSIA 4NLWA 5KT7A 2BQUA 3N6NA 4QPXA 4I2PB 1D0EA 1QAIA 1DTQA 4KV8A 3Q8QB 3OSNA 1DLOB 2DPIA 2AGOA 3IS9B 5L9XA 3T5KA 1YVFA 2E9RX 3TAMB 5HBMA 4TY8A 1MU2A 5KG7A 1RA7A 4KFBB 1S4FA 4GC6A 5F9NA 4GC7A 4MK8A 3RB0A 4URGA 3CWJA 4O44B 2AU0A 4IG0A 2R2RA 3NKYA 1RT5A 1RDRA 3M8QB 2VG5A 2XI2A 2HWHA 3DDKA 4ZVGA 3PW5A 1LWFB 4I7FA 5FDLA 3DLEB 5KFBA 4ZPDA 3M9OB 4JV2A 3BREA 4TN2A 1S1TA 3LAKA 3BQ0A 3V81B 4RW7B 1R0AA 4RW9B 2R2UA 4KE5A 5KFHA 3FFIA 4TQSA 4ZMMA 4URSA 3KLGB 2FVQA 1HARA 2BANB 4H4MB 1HQUB 4NLQA 5KFDA 1LW2B 2IJNA 3GQCA 3LP1B 4ICLB 1TKTA 2RDIA 4O3RA 3Q8PB 3CJ5A 1SH3A 3KLHA 3LANA 1RYSA 5J2NA 1RT5B 3OHAA 4DL6A 4H4OB 3PW2A 3EPGA 3OL8A 4KHMA 5DQGA 5DQHA 1K1QA 4F4WA 4H54A 3FRZA 4TYAA 1N56A 1OS5A 3HHKA 3KLEA 3H4DA 1KHVA 2OPPA 1BQNA 3V81A 2W9BA 2FVRA 3DI6A 4LSLA 3QZ7A 1JLCB 5F8HA 1DTTB 3LP0B 3GIJA 1QUVA 2D3UA 4KHRA 5KFOA 1N5YB 2XWYA 4IRDA 5EUHA 1RTJB 5K14A 3JYTB 2VG7A 3V6DB 5F8LA 2IM1A 4K4SA 1JLEA 4LSNA 3NBPA 3QGGA 3DMJA 1HQEA 2JEIA 2HNZB 5C42A 4WE1A 5L1IA 4MFBA 5F8MA 1LWCB 2B6AA 1S1VA 2WCXA 2YKNB 1UWBB 4LQ9A 3T5JA 4RU9A 2RF2A 2HNDB 5J2QA 3NGDA 4F50A 1TVRA 4YR3A 4J9SA 1LWEB 3IGNA 4IG3B 3H98A 2OPPB 3BSNA 2ILZA 1BQNB 2W9BB 3HVTA 4RW8B 3MEEA 5L1LA 1D1UA 2CJQA 4Y2CA 3H5XA 4IOBA 1REVA 3DLGB 5DG9A 5HP1B 1SUQB 4IDKB 1QAJA 3HVAA 5KG6A 2YNGA 2B43A 3I5CA 3G6VA 4EO8A 3BQ2A 5KT3A 2ASDA 3KK1A 5HROA 4MH8A 5KFPA 4WYWA 5J2PB 2UVVA 4RNFA 3RAXA 2WRMA 4TLRA 1C1BA 3I5BA 4QWEA 2RKIB 1LW0A 5I3UB 3I0SB 3PR5B 4F4YA 1S9FA 2I5JB 4WYLA 5DGBA 4R5PB 1XR6A 1S6QA 1JXLA 1IKYA 1JLBA 1SH0A 3BSAA 3CJ4A 4EO6A 1S6PB 3TVKA 3PHEA 2UVUA 3M8QA 3QYYA 3EZUA 3KHRA 2WK4A 5KFSA 3JSMA 1N4LA 1TV6B 3DOKB 4RW4A 1TQLA 1RYRA 1EETB 1S9GB 3CDUA 3KLFB 4IRKA 4JV0A 4O4GB 2YNFB 3BGRA 2ATLA 2V4QA 4NCGB 4WFYA 1HPZA 2V4RA 2ZKUA 1I6JA 3GILA 4FBUA 4KKOB 1C1BB 2DPJA 2IC3B 4ICLA 1JLAA 5CYMB 4K4YA 3UPFA 2ZE2B 2AX1A 2WHOA 4PWDB 4O3OA 1EP4B 3LAMA 1RT7A 4NLDA 4WXWA 4NZ0A 3KLGA 2E9ZA 4O44A 2YKMB 4ECVA 2R8GA 3KLIA 1Z4UA 3GV5B 2W7PA 3CJ2A 4ECTA 3LP2A 3UR0A 4RZRA 1JLFB 2WOMB 3KHGA 2C22A 3CIZA 4YR2A 4NLYA 1LWFA 4I7FB 1TL1B 4NLVA 1JKHA 3MR2A 1SH2A 4XO0A 4K4UA 3KLHB 1JIHA 3MR3A 3ICLA 5KFCA 4X2BA 2FJWA 4QW9A 1T03A 1N6QA 4J9RA 1RT3A 3DOLA 5EDWA 5J2MA 2O5DA 1KLMB 2CKWA 4KB7A 3RB3A 4Q0BA 4LSNB 1RT6B 4ED3A 3RBDA 2IBKA 2OPQA 4KBIA 3PW7A 1K1SA 3KHHA 2B6AB 1IKWA 2B5JA 3T19A 3H59A 3NAHA 1TL3A 4IR9A 3C6UA 2OPSB 1S1UB 3C6TA 3ITHB 4ED8A 3OLAA 4DL7A 4I2PA 1JLGB 1TP7A 5K14B 3V6DA 1RTIB 2FVCA 4ECZA 4NLXA 3OLBA 1XR5A 3DM2A 1CSJA 4NLRA 4YQWA 3H40A 3BQ1A 1C1CB 4KSEB 4ED2A 1RT4B 1RA6A 1S0NA 4PUOB 1JLQB 2IAJA 1HNIA 2WONB 4I2QA 1MU2B 5C24B 3V4IA 4HKQA 3NAIA 5KFAA 5DLGA 4Q8FA 1DTTA 3LP0A 2AGQA 3DRPB 3N6LA 4NRTA 5KFRA 3LALA 3RBEA 3DLKB 1BQMA 2YNHA 1HYSB 1HNVA 3PJXA 4NLGA 2FVPA 1T3NA 4XPEA 4NLSA 3UDLA 2OPRB 4MKAA 4Q44A 1RTHA 5KT2A 4IQXA 2JEJA 4ED7A 4NLOA 2IM0A 3QLHB 3KNAA 1LW0B 2W8LA 3IG1B 4DG1A 3DRRB 4EBDA 2YNIB 5KFNA 4IFYB 4R5PA 5KFFA 2XGPA 4ECRA 3DYAA 4O3SA 1IKVB 2HNDA 4ECWA 2ALZA 4QWDA 1LWEA 5F8JA 5CYQB
chains in the Genus database with same CATH superfamily
3EDRB 1PBAA 2ZJRQ 2M52A 3NY0A 3KHLA 2BJEA 4M5GA 1U0SA 2IMWP 2QA4G 2FHJA 4ECUA 3B78A 1WUUA 2EBEA 3TQ1A 3DFEA 2ZH3A 1GEHA 3F0NA 3PVXA 2M2BA 1S1TB 2V9KA 5L9NA 3W61A 1N88A 4NYZA 1X4BA 4OJHA 4QR2A 4MAKA 5HVGA 4LF7F 3IWLA 1FRIA 2VPYB 4DPUA 1X5PA 2LCWA 3BF4A 3SFGA 4H4MA 4F3MA 2DGTA 1L3VA 1RQ0A 2F9DA 4QZVB 2ZWOA 4M63A 4WCEQ 4PQUB 2W8KA 3CCQS 4BC9A 3GLJA 1MMLA 3F44A 3HD2A 3ZTRA 4RO0A 2VUGA 3BPDA 4OL8A 1PYSB 2F3JA 2G1HA 4IRCA 3FZ2A 1PJ6A 1R0AB 3CJ3A 2XC9A 4EYIB 3OW2R 1X4GA 2BXJA 3C46A 4ZKAA 4B3SF 2XG8A 3NGKA 3PXGa 2HAIA 3U7JA 4JV5J 5DG8A 1PO6A 4DX7A 1VRTB 1Q4RA 2YWHA 5F8IA 1GK8A 4YB1P 4RPFA 5IFMA 1S9EB 3U27A 4YEAA 4B3OB 2HHPA 1UJ6A 2GQCA 4NYOA 1J5OB 4RWWA 2CPXA 4J5OA 3ZZUA 2V8PA 2R3VA 1EQ0A 3DI6B 1Q53A 2Y8WA 5HP1A 3QO9B 3WZ0A 2Z0GA 4Z37A 4I0WA 5K8MA 3QZ8A 4I1TA 3FMBA 1B4SA 2V8HA 4J9QA 2YNGB 1JJHA 3AT1B 3ZZOA 1CULB 2CQ1A 2IJFA 5KFWA 2Z57B 2ASLA 1Y10A 1TL1A 5AXLA 5KOWA 4CWBA 1S97A 4JYAF 4L3NA 1MN9A 3KLEB 3VAHA 3E01B 2HQGA 3DOMA 2KKHA 2VG6B 2Q1LA 1IN0A 3M1VB 3CJ8A 1N34J 3MURP 5E3PA 2HLTA 2HW3A 7FD1A 1VIOA 4TXSA 1NK4A 1Y5NB 1WDTA 1S5ZA 2ACYA 4K4VA 2MGZA 2DGWA 2EFQA 4C8OA 4LF6F 2GQ2A 3US5A 4C9DA 3AHPA 1WSRA 3D9BA 3CNQP 1ZTWA 3RU0A 2G0JA 2FD2A 4X4TA 4DL5A 2IA6A 3JSMB 3DRYA 2UVRA 4ECXA 3TARA 2CQ3A 2WSCC 2AQ4A 3S7RA 1HMVA 1S1VB 2E29A 2NLWA 3O1LA 2FDNA 4U6PA 3Q22A 4ZHRA 1TK5A 5M2UA 5G4DA 1LXNA 3SCLE 4NI2B 3R7SB 5HMXA 4LF4F 4I67A 4O3QA 2W1BA 4H4OA 4DL4A 2VG6A 4R0EA 1DHMA 3FQKA 3H7HB 3JXOA 1HWLA 4DFJA 1TL3B 1JLAB 3C6UB 4D3HA 2JNJA 5T41A 3GB0A 2HNZA 3A8IA 2VB6A 3OPKA 1N34F 2RD5C 4Y34A 3RB4A 3J80U 3WC2A 4TLQA 1M1GA 3GV8B 2YKMA 2BBEA 3ILJA 4GO7X 1GT8A 1N0UA 1QTNB 3BR9A 2DK2A 1YHQS 1VBXA 1OQ3A 3W8GA 3FVYA 2DHAA 3QLHA 4ENOA 4HYKA 1E6YB 2O01C 1FXDA 2KN4A 1VJWA 2OGUA 4AT1B 2NXEA 5KFZA 5DG7A 1AXQA 1NJZA 1VBZA 2XB2D 4NPOA 1ITPA 4X66J 5H9EK 2AW0A 2ASJA 3D1QA 2RQ4A 2JLEA 3C15A 4ZA1A 2WZ1A 2QE5A 1NSQA 1BQMB 1U25A 1UW9A 3N0VA 4WP8A 1KQFB 4YDDB 3VQSA 4IDKA 1HPZB 3RUBL 2MY8A 5CQGA 1H72C 3LP2B 1KWMA 2JEGA 4QU7A 3CDEA 3PKMA 2HBQB 3W2WB 2WOMA 4L74A 1VI7A 2GS8A 3M8ZA 3QBCA 4RUCA 1U1QA 2HBYB 3R3TA 4KT0C 3PW4A 2EC0A 5A8WA 2RAQA 4DEZA 5DDOC 1IKVA 2HVZA 3M30B 5LMNF 5C2GA 2I2YA 3D28A 1T94A 2CG8A 4Z7YA 2V6AA 5HBMB 3PCOB 4ZPBA 2YKNA 5KFXA 2KO1A 2E1CA 2RJZA 5KFJA 1TKDA 5FLXU 4DUZJ 1HNXF 3RR7A 3ZZYA 1D9DA 3DM2B 3MF5A 2EFPA 4FS2A 2AHOB 4ECSA 4DV3F 1UL3A 1UFKA 2XO7A 4NLPA 4ZVEA 3QNWB 4X4QA 1V5VA 4YP3A 4N5SA 2E5LJ 3BPSP 2C2ZB 3KDOA 3PNIA 3OVBA 1ZYQA 1FRKA 3DRSB 1RT1B 4PRFA 3W62A 5L1KA 4HTJA 3SI8A 1SJRA 4PXEA 1AROP 2VBZA 1N5SA 2W9CA 1RISA 5EHHA 3AQPA 5T7LA 4JI6J 2LA4A 2VDIA 3TI0A 5J1EB 4Q0BB 3D6MB 3N28A 1Y00A 3NGRA 4ZPVR 3JSYA 2R2SA 3EPIA 1OSDA 2W7AA 3HVTB 1WEYA 2JOQA 2KVIA 1FD2A 2WVBA 5HANA 2K8GA 4DV3J 2HHXA 1X4DA 1WHVA 1OMSA 4WZMA 3LPEA 3Q83A 4OHWA 4Q5VA 1EP4A 2GVDA 4ATNA 1VRUB 3BYRA 3QT7A 4LF1A 3QGPA 1VRTA 4GVBB 5IOLA 2YH0A 1P27B 5HN0A 3MCNA 3MWBA 3E01A 1KS2A 4Y2IA 2Z56B 3HKWA 3PRDA 5D4LA 3G4SS 3CCVS 3DLHA 4B3TJ 2FLLA 1J5OA 2MHNA 3LO3A 2AF6A 2BJ3A 2D7SA 4MKBA 4ZIVA 5CYJA 1HBOA 3NCRA 1Q86T 3MEDB 1S59A 7FDRA 3T1AA 4YHHF 2Z2ZA 1RAAB 3TP2A 5C7PA 1PJ5A 2DO0A 4PABA 2A10A 1BD6A 1NSKL 4DL3A 1XMQJ 2ZH4A 5HMWA 2KZZA 3QT6A 2XSJA 2OPRA 2O67A 1FJEB 4IH7A 4DV4J 3T6JA 2XMVA 4C3KA 3MPWA 2FJBB 2WBMA 3R5GA 1RLDA 1Q8IA 2UU9J 3A8KA 4CO5A 1M5PC 2V2VA 1XJWB 3DC2A 2R8HA 2OPQB 2JDJA 4RW4B 4LR8A 1NDPA 4ECYA 2QT7A 3KXDA 2WVEA 1QVGR 4L75A 2AJ4A 5ITHA 2AJ1A 5HI7A 2M5YA 3NGUA 2HS3A 2WVFA 3DLBA 2R7SA 3OFHA 4TYBA 2SXLA 1QSYA 1BGXT 4X65J 3PR4A 2HNYA 3IRWP 4OV1A 3QIPA 2CZVC 4KGZB 5EWFA 1XBWA 2ZJQQ 4K4XA 3SV3A 4RW6A 4EGLA 4LSZB 4C2MA 4LF7J 3W63A 5H1SV 1UVMA 2FJXA 3NNHA 4RL1A 2IM3A 2V50A 2ZOGA 4FXDA 2YBVA 9ATCB 2MXYA 2QLWA 1VC0A 3ENQA 3Q8YA 4RW8A 2IM2A 4XK8C 3K2YA 2DCUB 4WWSA 2RH3A 3QATA 1UP1A 1Q7LB 4IFVB 1G2EA 1VCTA 2CJBA 3R5AA 1F1BB 1WELA 5HVHA 5LOQA 2K2PA 4B9TA 1YITS 3I0RA 1HQ2A 3AH6A 2WVCA 2BRLA 3AD8C 2V8VA 3KK1B 3GV7B 4DPYA 1EZZB 4I2QB 2CYYA 4WFZA 2I1RA 3KK2B 4C0HA 4IFYA 2WW8A 3F56A 2Z2LA 5E3CA 3BGLA 3BO3A 5KT7A 2QFJA 3J7Z5 3GJTB 1JNRB 3N6NA 1VQ6S 1WORA 2C3OA 1E6VB 4KV8A 1KQGB 3D54A 4M5HA 1HHSA 4RU2A 2L9NA 1RWNB 1U8SA 2MEWA 2UXBF 3ONQA 4JBCA 1U48A 4WKRA 2VKZG 2YWGA 2NR0A 1I94F 2YX7A 3CGIA 3FSYA 4P2MA 4TY8A 4JYAJ 3U1LA 4OI6A 3CJTA 2DR8A 4EZ9A 3D3CJ 4USJC 2CDRB 4MK8A 1P6TA 4E0DA 4URGA 4HLBA 2MQPA 3FBEA 1N32J 2ZBQA 3IWXA 4JI4J 3NKYA 1RT5A 1RDRA 3VZHA 1Y5IB 1U02A 1JJCB 2CPYA 2XI2A 1FTRA 1WG5A 2UXBJ 2F65A 4LF6J 3DDKA 2XSFA 1FWKA 4ZVGA 3PW5A 1LWFB 4I7FA 2ZNZA 1YI2S 4JV2A 2DY1A 1HWJA 2C3UA 4JI3F 3BREA 4CRJA 3V81B 3WBZA 4OHYA 1R0AA 3DHWC 5KFHA 1R89A 4DQPA 1N33J 1IVZA 3R5DA 4ZMMA 3KLGB 3VF0B 4CI0B 4EI2A 1CC8A 1HARA 3PO4A 4PQAA 4F0MA 4CT8A 1XTZA 2VQEF 4NLQA 1LW2B 1N5VA 2BDPA 3CCRS 2IJNA 1QVFR 1TMMA 3OT9A 3VGVA 6AT1B 1TKTA 3ZZ0A 1GTHA 1KKHA 2VFTA 2VH7A 3QJJA 1RE1B 2OFHX 1SH3A 4DFKA 3LANA 1RYSA 4N8OA 3G9CA 3OHAA 1UZDA 3QMQA 1J27A 1B0TA 2Q79A 2VL1A 5IZHA 1SKSA 4KHMA 1K1QA 2DBBA 4OX6A 5HMZA 2MSSA 3W3SA 1Q0NA 1KVKA 3EUNA 2Y1IA 4MT1A 2CNOB 5ETMA 2X7IA 4X4SA 1KHVA 3H4DA 5B09A 2FVRA 2BKNA 2UV8A 5DDQC 1EKSA 1YBTA 3CD7A 2H5EA 2K1RB 5F8HA 1GXUA 4GVBA 2IRYA 3UR3C 3GIJA 1HD1A 2RMLA 1ZM9A 5M2RA 3PEJA 5EX0A 5KFOA 2XWYA 1EKRA 1ZBTA 4N56A 4M5JA 4V19X 5K14A 3PTWA 2MB0B 2ACMA 1GNKA 1WG4A 3ILIA 3AD9C 3CEDA 4CH1A 1JLEA 2ZZTA 1U2RA 1R8BA 3J7ZT 2IY5B 4B9MA 2HNZB 4WE1A 3IR7B 5F8MA 4AYBD 5EGYA 5E5NA 2DRDA 2YKNB 1UWBB 2YY3A 3SZ2A 2L9DA 3CUNA 2Y9HA 1WOOA 3O3LA 2ZDPA 2LVWA 1JJ4A 4F25A 4J9SA 5CD4H 4PG6A 2GO8A 4OI1A 4CO4A 4U95A 2ILZA 4KH0B 1BQNB 1KTQA 4JP8A 2W9BB 3MXHP 1IQTA 2H1YA 2NYHA 3HVTA 1H7XA 3DOMB 3M1VA 4KH1B 4Y2CA 1RZMA 5FLXY 3H5XA 4QIEA 5SZTA 3P5BP 1SC1B 3BYPA 2GV1A 1SUQB 4IDKB 1Y11A 2GGPB 4OI2A 3WIUA 2E5LF 2HHWA 2IVYA 1D9AA 4ZLLA 2GA7A 4LR7A 5LJ5Y 3GR0A 2YNGA 2B43A 2K3IA 1S7HA 4J9UE 4EO8A 3BQ2A 1F5AA 4DQIA 1FRJA 4OZ5A 3GFZA 5KFPA 2P6TA 1SIZA 1U1KA 3P4UB 3VWSA 4RNFA 4FYWB 2HBZB 1FJGF 1C1BA 5SUHA 2RKIB 3M2RB 2H65B 4WYLA 2IHR1 1DRZA 1T95A 4KHPF 1WHYA 1JXLA 1JLBA 4NX9A 2QL9B 2ZC3A 1J5EJ 2J0XA 2DGQA 2P6SA 3POTB 1S6PB 2KXFA 3T1YJ 1YZ7A 4WFNQ 1APSA 4HR2A 2WK4A 5HSPA 3T41A 3J7YI 1KFDA 3IBCB 4I6YA 1NSPA 3A13A 3MAHA 4FDFA 4RW4A 2A2DA 4ZOSA 1KBRA 4DX8H 2ZH8A 1N36F 4JV0A 2K7JA 5E2QA 2YNFB 2KT3A 1RHKB 2XMKA 4HT5A 5A0YA 4WKYA 2RU3A 2V4QA 3LWMA 1HPZA 3OFFA 2DRBA 2ZKUA 5C2CA 2A3JA 3BKFA 2ZH5A 4WU3A 1I6JA 3GILA 2B4PA 3RAMA 1XNQF 1IR1A 2Z30B 3NGTA 2CPFA 4DCJB 4ICLA 1JLAA 2EVZA 1HBOB 3UPFA 2DB1A 2AX1A 2WHOA 1NK7A 2OELA 3EYZA 3HHLC 1RT7A 1S77D 1K8AT 1U0HB 3AA9A 3RGIA 3FNNA 4DV6F 3VGTA 2YKMB 4L73A 1RADB 3LP2A 2JLGA 3CJRA 5CCLA 4RZRA 1JLFB 1FDBA 7AT1B 2MZTA 2M8HA 4X65F 2AJ2A 4UOHA 2G2ZA 3CIZA 3O2IA 1IWGA 4NLYA 2CQBA 2XLJA 1TL1B 1WI8A 1UETA 1XWLA 1JMTA 2GMJA 3MR2A 3DLLQ 4XO0A 1UTAA 3D3BJ 5HMYA 3MR3A 1JIHA 4X4NA 1P9YA 1NO8A 3HF5A 4DU8A 1T03A 1P1LA 4FYVB 1MNEA 4Y2MA 3CJKA 5GADI 2CJKA 1VK3A 3DOLA 2GAGC 5DO2A 3QAEA 5LMUJ 1Q78A 3I32A 4EU0A 2J9EA 1M5OC 1S12A 5EX3A 4WF9Q 3J7A1 2JFDA 4DSEA 4BS2A 4P72A 2A0FB 3BV8A 1GAOA 4KBIA 2CQHA 2QN6B 4DN9A 3KHHA 4QOTA 1A6LA 3GIRA 3OTEA 1R8CA 3TUIC 3TZYA 4ZDNA 2GNKA 2HK3A 3C6UA 3OQ2A 4IR9A 1EX8A 2AKWB 1U2CA 2NCKL 2CQPA 1RB0A 3MM9A 4CLKA 3QSYB 3RB3A 1XNRF 3OLAA 4W98A 2FPHX 3QJPA 1HD0A 5K14B 2CPIA 1M5HA 2FVCA 3EZ5A 4ECZA 3PHTA 1U24A 1Q8BA 2LYVA 3VAGA 4YQWA 1FNXH 3H40A 1C1CB 3GJQB 4QIGA 1ULRA 1VQ4S 1FEEA 2XQCA 4P9SA 2IAJA 3V4IA 3K8WA 5KFNA 2GHVC 4HKQA 5DLGA 3H8YA 5AXMA 2MY7A 1DTTA 4A46A 3MD3A 4DR4F 3KWMA 3LALA 2LDYA 1VQ8S 4DSLA 4G65A 1F5BA 1WF2A 2F8MA 2B4UA 3AB2B 3ZTSA 3HULA 1OQ6A 1U1LA 1IJEB 1RTHA 5KT2A 3IA0A 4B9LA 2H48B 3QRRA 2RT3A 3HFKA 3C8YA 2IM0A 1UVIA 1WKLA 3KG0A 1HNWF 3GP9A 3IG1B 3N9UC 2JSXA 3KNAA 4UQGA 2KYXA 4NASA 1N32F 4IFYB 4R5PA 4NZ6A 2HQDA 5KFFA 3DYAA 3VVUA 1NPKA 2BVZA 4O3SA 1IKVB 3K8VA 4EFAC 3G82B 1X4FA 3MPYA 2F4VF 1LWEA 2DIUA 4ID8A 1LFPA 2PDAA 2YWKA 1L3KA 4X4OA 4DV5J 4ANDA 1OPIA 3PX6A 1ZS6A 3NGSA 1RP5A 4LBIA 1HQUA 3GZ7A 1NNDA 2FHKA 4Q43A 4RWXA 2ILYA 2QJ3A 1XMBA 1EETA 1S9GA 1ZAVA 2KHCA 2DH9A 2M88A 2XI3A 5HQLA 4F4ZA 2XLKA 2YNFA 5A0YB 4A8FA 2VIHA 2OSQA 1C0UB 2V2QA 2EKNA 4CM0A 4KRWA 1NZ8A 3QSIA 4CTAA 2A6OA 3TNVA 5J2NB 2HGLA 2ZUGA 1RTHB 4I6AA 2MKIA 1UZHA 2KJVA 2B8QA 2UV8G 4U7UK 4NA2A 5K8PA 2QEXS 2HIYA 2MKJA 1Z1ZA 3IG1A 3KK3A 2QA1A 2YXLA 5CZXA 3HVRA 4OX7A 1DTQB 4OFZA 1GMUA 4LF5F 2F9JA 4U7UD 8ATCB 3MEGA 1MSWD 4TY9A 4KGVB 1HQEB 3R5BA 4PG5A 5ETSA 3T3FA 2ADBA 1RWOB 2OO4A 5B0DA 2OLWA 1LWCA 2HRUA 1HR0J 1M5KC 5D3GB 3D66A 1FWLA 3M9MB 4DR3J 2ABYA 3IMQJ 2OEJA 4DR7J 1LK5A 4CH7A 2MJUA 4M95A 1FD8A 2BW2A 4ED4A 1C4AA 4DV2F 2PI5A 5IC4B 2HHTA 2V8DA 1RAHB 1JWWA 3NNAA 4IH5A 1RT2A 1TKXA 1RTJA 2AEFA 4DHVA 4DJBA 1QTMA 2WAQD 3UI3A 2MGZB 2BE2A 1R8HA 1TUGB 2HK2A 2R7QA 3C19A 1CJKB 1JKHB 1SI9A 2R4FA 3OTOF 3NBPB 1CJUB 3IBFB 2PMZD 3FCWA 3AD7C 1IM4A 3TYTA 3K57A 3K5MA 2VD3A 2KG0A 3E3XA 4LSLB 2HVEA 2AT1B 5J2MB 2M9KA 4Z7CA 2N7CA 1PJ7A 2JVRA 5DS7A 2BJDA 3UD3P 1WI6A 1FFGB 1DJ0A 1H98A 3A8JA 3M4XA 1YQHA 4DQQA 2MKHA 1XR7A 1M0SA 5HROB 1U26A 1TK8A 2OD4A 2EKYA 3PYEA 4J37A 4OHXA 2OAUA 2B5JB 1SIWB 3HSZA 3GG0A 1QE1B 3I4PA 3JQMA 4XPCA 2MZRA 4ECQA 1RTDB 2FHOB 4KO0B 3DOLB 1XQIA 3DNCA 3RJMB 1RWMB 4USTA 4M94A 2LEPA 3V2UC 4IR1A 1HHQA 4LF8F 1U09A 5LSLA 1HBNA 1S79A 2DHXA 2XCPA 2JZ5A 5BJRA 1TTHB 1WHWA 2CA9A 1I1GA 4RUAA 4QU6A 3GSDA 1GX5A 5KT4A 4J9LA 4LT6A 4PUOA 4JV5F 3EDQB 3MMBB 4DR2J 2J7KA 3I9ZA 1HA1A 5L1JA 2ZM6J 2HZVA 3TW0A 5MAOA 2RUSA 3TEGA 4XIUA 4OYOA 2RB7A 5BYQA 4S0MA 4F3QA 2YX1A 4YS2A 2DTJA 1T9XA 4U8YA 4ID5B 1UAWA 1Q95G 4KHPJ 1NRKA 1NB7A 1T9TA 3A3OB 2W2PP 1PCAA 1N5YA 1SB6A 1V9OA 1VJQA 2JC1A 3GG1A 3GSIA 4K50A 5CYMA 5KT5A 2XZWA 3NNCA 4L3KA 4P7VA 2PA3A 1RAJA 3OXGA 2F1FA 1JQGA 5C5JA 3ILOA 1WOSA 3LGMA 4M5IA 4G1PA 1FXRA 5A8WB 2XS7A 1LKZA 1LNQA 1JLCA 1FK9A 4KY3A 5AT1B 4HL9A 4OYZA 1IM6A 1S6PA 1N36J 2NZCA 2AZ1A 3M8PA 2QC3A 4J91A 3CD5A 5KFIA 2VG7B 1HI8A 2HQ3A 1X9MA 2OH2A 3N79A 3CCJS 5IV4A 1VIXA 3DCAA 1TFWA 3M2RA 4KC5A 4Q45A 4OJGA 4CT9A 3L3CA 5E7OB 1H38A 4KTQA 1TKTB 1L3UA 4USIA 2CWKA 2N3OA 3JSRA 1F9HA 1FJCA 1WNEA 2XZTB 4C7QA 1KLMA 4G1QA 5E41A 3MFIA 1UVLA 2D74B 3J81Y 4YUDA 2OUGA 3BS9A 2J9CA 1IWAA 1T0TV 3G86A 5HVFA 2W25A 2FGCA 5LXRA 2W9CB 2R8JA 3HD1A 3NG8A 2ZOMA 3NS5A 4AXIA 2ZNYA 2JFKA 4OX8A 1NCLA 2Y8YA 3ZZTA 2DR6A 3IS9A 3M2VB 4IKAA 2IMOA 2HIQA 4Z2XA 5IT0A 1RWPB 1IBCB 1DFDA 4LF2A 2GGPA 4J9VA 4N77A 3MECB 2XHWA 1WF0A 4E8UA 3UQSA 4O23A 4RNNA 4QWCA 4LF4J 2XM3A 3MM7B 1H74A 1QAXA 1WF1A 3FEYB 5MLCV 3OJSA 1K0VA 2QA2A 4C8KA 4N8NA 1I5OB 1PAEX 4NA3A 3Q8SB 4KJIA 3NWGA 1BWEA 4RNHA 5I3UA 2KT2A 3Q8RB 1BE4A 3K5NA 4G1QB 2CIMA 4RNOA 3BSCA 1T03B 4TY8B 1UWBA 3AY0A 3MM5A 1NPRA 1JLGA 1S6QB 1PBUA 3MOZA 1O8BA 2KI2A 2UUCJ 1RWXB 2CNKB 5F0WA 3D1OA 1NDKA 3CMAS 2VQEJ 2ZH1A 1V3SA 4O3NA 2DITA 1KP6A 4TKTA 4EUVA 2IBOA 4BLGA 3AA8A 1RT4A 3UCZP 2VQFF 4IG0B 1OJ4A 2C2MB 3N6MA 4F0HA 3M8WA 4ED0A 4F2SA 5ADZA 2LA6A 4JI2J 2FVSA 4F8RA 5KFUA 5G0RA 5KFTA 4WTYA 4YDXA 2ZE2A 3CJKB 4DL0C 4DX6A 2KH9A 3DLKA 2B7CB 4FZVA 2FC9A 3AQOA 1RT2B 1TKXB 3FCHA 3DXBA 3MEKA 3MI7X 3KLIB 1NB2A 4NZ7A 4B3MJ 4DR4J 1RWVB 2EW9A 3MM6A 4NLUA 4OZJA 1SC3B 1U6FA 3QIPB 3MOJB 3OL6A 1HNIB 2CQCA 5D0RA 2VPXB 5DDPC 3QO9A 2UUAJ 2YQ1A 3Q89A 2LXUA 5JVGQ 3DMJB 2HFSA 3B6BA 4P10A 4PG7A 4YB6A 3UFCX 4HDHA 2FYXA 1UWAA 1VS3A 1RTIA 1HNVB 4LF9J 4NMXA 2ZH2A 1RHQB 1IJFB 2QYCA 4U7CA 2ZH6A 3LPYA 3PY8A 5J2QB 3DKDA 1URNA 3R5CA 4A8MP 1NAQA 1X4HA 1S6OA 3RAQA 3ZZZA 2VASA 4U96A 3I96A 3JYTA 4ZHRB 4M5LA 2VOPA 2DGXA 4ZPAA 1T9WA 1CJVB 2POKA 1X5SA 3ET6A 1V5IB 3TJAA 3RTVA 3G8SA 2VA2A 3MPDA 2OPSA 1EAYC 4DUYJ 1B0PA 5HJXA 3E51A 4JI6F 1H6KX 5KFVA 2QV6A 3W5ZA 3Q86A 3JTNA 3ZXWA 2J6SA 1SJQA 3K7RA 4N41A 2CPEA 4W92B 4IH6A 5I42A 2YKOA 3IBWA 3QFHA 1HMVB 2EK1A 4ZP8A 4C8NA 5JXSA 5KG1A 1S0MA 3PW0A 3JAMU 1VBYA 2GW8A 2WONA 2DCLA 2I0XA 1FX2A 4X4VA 2FZCB 3HLUA 4PPDA 2ZWPA 1ZA1B 4ZVFA 1BLUA 1R27B 1UEVA 3V6KA 3BSOA 2FZKB 2MYFA 3IGVA 3NRBA 4WXOA 3TZZA 2C2DA 1FT8A 3KJVA 4MIAA 4G3IA 4FKYA 1CQNA 3CCTA 3RYLA 3BJYA 2ZC4A 3HM9A 2GIRA 1X4AA 3HSDA 2M3DA 4J9PA 1HW8A 2IAJB 3V4IB 2AZ3A 4GKKF 2NXUA 1FA0A 2UUBJ 3DRRA 2I38A 4CTAB 3CCLS 1SJFA 2UUTA 1CJTA 4CYUB 2PO4A 1SXLA 4NLWA 3TZXA 4DR5F 2BQUA 3HFZB 1T9VA 4C0BA 2C42A 1H3DA 3HZEA 3CXCR 4CO1A 2J0WA 2HRTA 2V4JA 3OSNA 3HT3A 1BHNA 4YB7A 4CCHA 2NUUG 1X7VA 4DLGA 3FC9A 2FTRA 3HHEA 4G6VB 3IS9B 3T5KA 1NU4A 5CAAA 2E9RX 3TAMB 2J7UA 5HBMA 1RWUA 1MU2A 5E3QA 1RA7A 4IQMA 4K8RA 3UW1A 4A47A 4OZ1A 1S4FA 2DR5A 3IR5B 4HEA9 2CVIA 3GFXA 3RB0A 4J7CA 1F9FA 5KAKA 5HL7Q 4O44B 5IT9Y 2IFXA 4IG0A 2BMBA 2XMTA 4TU7A 1SQEA 2YKAA 2J9DE 1RBLA 4C11A 2ROEA 4L6V3 2HWHA 2GHPA 3RBZA 4U8VA 5KFBA 3QWUA 2HPUA 4NCAA 4E98A 3GU0A 2G4BA 4MKYA 2FZGB 2NYIA 2Z2MA 1NH7A 4FXVA 2M7SA 4GO5X 5A2QY 4DR6J 4RW9B 2R2UA 3KJNB 2LU2A 3DGPB 3EVOA 2QG9B 4ERDA 3M6XA 1LEOA 1E6YA 2IYIA 4H4MB 4DSIA 2D1CA 3EM1A 1HQUB 5D4OA 5KFDA 3OXLA 4USHA 4A8KA 2YKQA 3H25A 2CJ9A 3VVTA 4ICLB 3BZQA 1HWKA 1GTEA 2C2OB 2EPIA 1D3WA 2RHQB 3U02A 4O3RA 2HVHA 3Q8PB 3BBFA 1B70B 1LXJA 3KLHA 3KUHA 2ZUAA 2KFZA 3M05A 2HFUA 2XZDB 3J7YU 3PW2A 3EGVA 1Y3JA 4TU8A 4OV6A 1P9QC 3TANA 2E5IA 3W9IA 5DQGA 2HG4A 5DETA 1KRPA 2GVZA 3FRZA 1AUDA 3TAQA 1F3FA 2PD1A 1HL6A 4P71A 4TYAA 4TVAB 4CNZA 1I94J 4ES2A 4U67Q 2HHVA 2HLUA 3V81A 2PMHA 1Q1KA 1YBUA 5CHCB 2B9YA 1ZPWX 3HHLA 1RBOB 4M5DB 3ELHA 3LP0B 3ZZPA 4X64F 2HYIB 3HCXA 1QUVA 2D3UA 4PXBA 4O0NA 4DXLA 1GXTA 8RUCA 2LU1A 2XYPB 4IRDA 3AXKA 1F2HA 1RLCL 2VG7A 1UJ5A 2DH8A 2IM1A 1KEKA 4K4SA 4CH0S 1VHFA 3NBPA 1CJUA 3QGGA 3EE3A 4OI3A 1FVQA 4CLUA 4U9RA 4B08A 5L1IA 3BBBA 4X66F 2G13A 2E44A 2HWTA 5THWA 1RHMB 2J8AA 1HHTP 1SL0A 2DISA 1YTYA 2C3PA 4YR3A 3DU5A 3C16B 1RKIA 4OZNA 4IG3B 5LXYA 3H98A 2OPPB 1O0PA 3BSNA 4WP3A 1CJVA 1H73A 2ROPA 5HQ8A 2VBWA 2DNKA 3MUMP 1PSDA 2VHGA 2DNLA 3ZFVA 4GKJJ 1QUPA 5HP1B 4KPCA 1LQ9A 3THVA 2ZBIA 3GJRB 5KG6A 3FUYA 4DN0A 2HHUA 3G6VA 1NK9A 2NXJA 3RRHA 2N4DA 1BC6A 1VLOA 5KT3A 3KK1A 1SBRA 1XERA 2YQ0A 4KGXB 1TAQA 1L5UA 2FY1A 2HFNA 2VPZB 2R7TA 4WIIA 2ZZNA 2XHCA 4NE9C 3MAAB 2Y0SD 4USVA 5B0CA 3E2EA 3I5BA 2F40A 2V67A 3L7UA 1YGYA 3ZC4A 3I0SB 3FSXA 3O8WA 3PR5B 3HJVA 1D8ZA 3BO4A 4F4YA 2ZZMA 1KVJA 3TOQA 2QLXA 5IT9U 3S6EA 1IKYA 2M8DB 1SH0A 3CJ4A 1WWHA 2FHJD 4EO6A 1MMNA 3TVKA 5GAHU 3DU6A 3SMZA 3VR1A 3TUPA 1NJIT 3GJSB 3VAJA 1NEEA 3KFWX 3I56S 2PN6A 1HR0F 1N4LA 3LGHA 5J1NA 1TV6B 5GADU 2FJEB 2CJXB 2MDAA 2VFRA 1EETB 1S9GB 4IRKA 2P8IA 2DRAA 1EQMA 1VQLS 2J0QD 2GHWA 2R42A 1R6YA 2B4OA 3BH7B 3D0GE 4PPZA 4QIWD 3J80Y 2XLIA 4NCGB 3OR2B 2Z58B 2V4RA 4WP9A 2QSFA 1WEZA 2YQ3A 1VQYA 2CVEA 1R7IA 4KKOB 1C1BB 4PR6A 2DPJA 2PI4A 2IC3B 3EZOA 1MG7A 2FJAB 4AQYF 4K4YA 2B7BB 1Q82T 2ZE2B 1ZZNA 3G8QA 4PWDB 1EP4B 3LAMA 2ROGA 4WXWA 4DV0F 1AYEA 2CFXA 3KLGA 2HZCA 3MR7A 4B02A 2R8GA 1TFYA 1FXLA 3CO0P 3IAM9 2AMCB 4ITSA 3TEHB 3PIOQ 1RAGB 2LDIA 3CJ2A 3MM8B 4RJVA 1KC8T 1S76D 4B3RJ 2E5HA 3UR0A 5KTQA 3GYGA 4LFCJ 1NK6A 2BJ9A 2C22A 3TX0A 1TELA 3JAMY 1LWFA 4I7FB 2LQJA 3D0IE 5B0GA 4NLVA 1JKHA 1SH2A 2VPWB 1SJ4P 3NWRA 1WTFA 4I4BA 5KFCA 4ZJLA 2D3O1 4LF8J 1YX2A 5HQMA 1RT3A 4DCPB 4LUBA 1KLMB 2YX4A 3R6LB 3JSBA 2H3EB 1VHIA 2LP4A 2P2CB 4ED3A 1RABB 4OX9F 4EK2A 3RBDA 3A4TA 5H9EJ 2B6AB 3T19A 2G2YA 2XEXA 2BX6A 2P9CA 2ZVSA 3H59A 3HHLB 5CA5A 2OPSB 2B3TB 3C6TA 3ITHB 1VMBA 1UJ4A 2NSCA 4ILMA 4C97A 5DM7Q 2L41A 1HKAA 3CCZA 3MDFA 3OD2A 2BOAA 2Z2YB 1RTIB 2QL7B 3TO8A 3UD5A 1UMJA 4NXMF 3OLBA 2HGNA 2BABA 1SKWA 2OTJS 3DM2A 1CSJA 1K9MT 1S0NA 4NXNF 4KSEB 1RA6A 2CJAA 2FUG9 1N8RT 1JLQB 4I2QA 1HNIA 1HW9A 2XO6A 1MU2B 2G0CA 3VQTA 1U1MA 1H7WA 2HFZA 4CLPA 2CQGA 2ZJPQ 3KTQA 4JI0J 3N6LA 4NRTA 4RKUC 2W2MP 1BQMA 2P9GA 1B0VA 2ASYA 3PJXA 4NLGA 2FVPA 2CQDA 1R8PA 3N5BA 1PYOB 4XPEA 3Q0AA 1WC6A 1VQMS 4MIWA 2DNRA 3B4DA 1FWPA 2ZBCA 2Q43A 4DPWA 2JEJA 3BH6B 4JI3J 4FP9A 4NLOA 3QLHB 1LW0B 4WK1A 2XMUA 5DZ7A 4DG1A 2VICA 3DRRB 4EBDA 2YNIB 4XDCA 1G1XA 5F8NA 3ZNJ1 2XGPA 3ETOA 1M5VC 3MMJA 3S01A 1FX4A 2HNDA 2WSFC 1QJHA 3NCQA 4CNYA 2ALZA 1UVJA 4QWDA 3C16A 2HQIA 2DNOA 3CW2C 3MD1A 4JI0F 1YJUA 2GIFA 2C2NA 4CIOA 2XTJP 4BDPA 3GR1A 1S1WB 1FEHA 4OJ3A 4F4XA 4OQJA 1NK5A 2HFOA 1ZZFA 1M1HA 2CPHA 1VDHA 5C25B 2HKEA 2I5JA 4M5NA 4URQU 5D4NA 3T1HJ 1TAUA 3CC4S 3DLEA 1O6XA 2WTFA 3OSPA 4PWWA 4AUKA 3FEXB 2XGQA 1VQNS 3RG6A 1XNRJ 1S1XA 3V5RA 4I68A 4UOCA 4JV1A 1FE4A 5HO4A 3PKYA 4QR1A 5KFEA 4ED1A 3MTKA 4F67A 1MN7A 2AEJA 5AE2A 1Y4ZB 3GWCA 4WFBQ 3K59A 4ZVHA 1UA0A 4NCBA 1IKXB 1P1TA 3H5UA 3P49B 1FKOB 2QMWA 3VHQA 2CXEA 3HJFA 1AA1B 3CVKA 1CLFA 4OYIA 3M9NB 4J9OA 2HHQA 1GMWA 3C66A 3ET6B 1FO1A 4KQZA 2OD6A 4RBVA 2C1EB 2F8HA 2KU7A 5GMDA 4LRDA 2KXNB 5E33A 3FDSA 5ETPA 4RW7A 4RBUA 4YOEA 2HVDA 3FZBA 1Y9OA 1VRUA 1MWZA 2MJNA 3L9ZA 5GAHI 1NDLA 3KLVA 4RW6B 3KJVB 3D5MA 3R2CJ 3RB6A 5CABA 3MFHA 3PJWA 2D41A 2ALYB 2RHSB 5K20B 2ZDOA 3GONA 3PV8A 4JI7F 3H2LA 5HLFA 1DBDA 3T5LA 1FKPB 1OO0B 1H0HB 3PX0A 3W2VA 4OI0A 4DOZA 4UW2A 3CDWA 2E1MC 3I4HX 3M7VA 2EFVA 4CLTA 1V3RA 3VAMA 1YDLA 2OIHA 3QFWA 1YJWS 4DL2A 3SFUA 3A3NB 1VC6A 3SV4A 4KGMA 1CEZA 2QTWA 1IKWB 1OWXA 4C98A 2HS0A 3HP6A 4XAKA 4WFAQ 2G0IA 3EXCX 3UDCA 4WE1B 2DY9A 3W7BA 3L7OA 1GH8A 2WB4A 1XEZA 2D3ZA 1N48A 4LF9F 3W60A 1PKUA 5D0GA 5K8NA 3ULHA 2JVOA 4MJKA 3G8TA 1BXNA 1NKEA 3RR8A 3T5HA 2KXHA 4JI7J 1YBAA 3WC0A 3CC7S 1S9EA 3PZPA 1NSAA 2F8EX 4JB8B 4K5RA 4J9KA 4Q8EA 3NMRA 3TZWA 1TL7B 1DLOA 2NREA 4M8LA 1LW2A 1M1KT 2DKOB 3H42A 2RNEA 3CO9A 4OYPA 5KG3A 1J5EF 3DHXA 1XK8A 2HWIA 3QRPA 1FRXA 4K4WA 3LF0A 2PE8A 2E7VA 4K2XA 1AW0A 2CNLB 1C0TA 3I5AA 3MUVP 3V6HA 3EXYA 3JQKA 1FDAA 3HHDA 3J7AN 3HO1A 2J0SD 3R2DJ 2MMYA 2E9TA 2KJWA 1ZETA 5AE3A 1RTDA 3K5OA 2BE7D 1S48A 1N5QA 1PC4A 4Q2LA 1XN9A 1OIAA 5DDRC 2ZD1B 3Q8VA 1NBEB 2WSEC 4L76A 4OYBA 5DQIA 4NLTA 1Q5VA 4QPTA 3CD6S 2MHEA 2PA8D 2EEYA 4JOUA 1FJGJ 2X51A 1S99A 3FMWA 4PXDA 1IKYB 2FJVA 3GPAA 2NPIA 2JLFA 3OR1B 1T05A 3G6XA 2UUWA 5J2PA 2BKOA 1KONA 2LEBA 3CMES 1LV5A 3L09A 2GX8A 4ZP7A 2KG1A 1KD1T 5A8RB 2DVIA 5F8GA 2NUHA 4DR2F 5IQQA 4PWDA 2RE1A 2J6UA 3GCXP 4KR0B 3UNYA 3T9NA 2XYGB 3ZZRA 5KFQA 1RAEB 3H2UB 4OZ3A 4UZBA 2APOA 3I9V9 1B64A 1W7WA 2Z4PA 3OUYB 1RT1A 4P6QA 2AGPA 2OFGX 1HFEL 1SKUB 2OHDA 4UUWA 3SQGA 4ELVA 2WB1D 3KNGA 4P74A 4DSKA 1U49A 5KT6A 1FKOA 3TA2A 2FGOA 2EFNA 3EGNA 4O4RA 4A4JA 3ZTPA 1U1NA 2NQPA 3DOKA 2YWEA 5E0OA 4YMEA 2G2OA 5J1EA 3I55S 4K7QA 2DXEA 3D1HA 2NS1B 3LUYA 5GAEU 3R1LA 1U1RA 3CJ0A 5KFKA 4DFMA 4MFBB 3OBIA 3PFOA 5KOXA 5FDLB 4NCGA 3OR2A 2OEMA 3MHYA 5IM0B 5KFLA 4EBEA 1HNZF 3KJQB 4FF1A 1RGVA 1N0VC 2J7WA 3CDAA 3WIVA 4Y2AA 2V9WA 4FF2A 3TUJC 5I3QA 2CPDA 1MWYA 2BJ1A 3QIDA 1WEXA 2MQOA 4EEYA 3QGHA 2LQ9A 4BC7A 4B3OA 3CCMS 1NK0A 1HWUA 2W7OA 3CF5Q 1YK9A 2KYZA 3DRXA 4DV1J 1U4BA 1GFWB 5L39A 3TAMA 1N6QB 1WC0A 2W2OP 1CVJA 2IDEA 2NZ4A 1KTVA 3W9HA 1CBKA 1CULA 4HI1A 3HFVA 2RF2B 3PJ9A 6FDRA 1D8YA 4DWIA 3IFEA 4FBTA 1JLFA 2MLYA 2R7VA 1UW4A 3I6PA 2IJRA 2QFIA 4HH0A 3GIMA 1YRUA 4WK3A 4LQ3A 2XNRA 1SV5B 3KUGA 3THTA 4JUZA 3C2PA 4KO0A 1ZOTA 3AB4B 2MLZA 4MTPA 5ETKA 2HMIB 1S4EA 2L08A 2RIJA 4ZVTB 1S1UA 4EBCA 5IT4A 1SJ3P 3B8HA 1VQ5S 1KNZA 3K17A 4DF8A 3LP1A 1KOHA 3AAWB 2IA0A 1YLXA 4LIRA 1NHUA 3Q2TC 1ZH5A 3B82A 4ZVPB 5B0FA 2V34A 3R1HA 5DJBA 3DGVA 4FPRA 1OYEA 3EVWA 2GJFA 5K5MA 1EHWA 4Y6IA 4DG1B 2BANA 4ILRA 1IUJA 3FBFA 3KKFA 4A8XA 4A8SA 3DYAB 1YJ7A 2J6TA 1CC7A 1JX4A 1FKPA 3G6YA 1UFLA 2NSBA 4J9MA 4RLEA 3UD4P 4DFPA 2DNYA 2R8KA 2M4MA 4WZQA 5CYQA 5KFYA 2A6MA 5AXNA 1GMWD 3ZTOA 4TU9A 2A1BA 3MMBA 4QW8A 3T9ZA 3VAFA 4EMDA 4DF4A 2JHEA 3FCVA 5D0EA 3RRGA 4LFAJ 1FDDA 3N01A 4USKA 1UA1A 3ENVA 3IR6B 1LOUA 1GX6A 3QT5A 2KM8B 2EG2A 5ETQA 2FJDB 2JC0A 1WG1A 2R7WA 3BEGB 4A8WA 2HHHJ 3DLJA 4QCLA 3OFEA 1W2BR 1HYSA 1T05B 4WFXA 3EVMA 2MQNA 3UO0A 4YR0A 2UVVA 4M5DA 2CRLA 5HAOA 4LRCA 1WTBA 1OY9A 3OL7A 1S1WA 1TL7A 3D6TB 2BR0A 1IKXA 2B9XA 1TVRB 2YVSA 4IYQA 4ZN3A 2VQFJ 4A8YA 3K5LA 1NKBA 3JQJA 2GAHC 5C25A 3CDBA 1A9NB 4I6WA 2B8PA 2CQ4A 4F26A 2R8IA 5K8OA 3H5SA 4LBHA 1JLEB 5C24A 2ZVIA 4CZCA 1IR0A 4DV7J 3UWTA 4K4ZA 1WC1A 3SIPB 2OMOA 1X31C 3UDEA 4FXWA 5BR8F 4ED6A 2AWZA 3GE9A 4CDIA 2YWWA 3H20A 3GIKA 2Y3YA 4LJMA 1ZA2B 4NRUA 2BE2B 5A6PA 2FY8A 5JUMA 3GIIA 4QYZJ 2FIUA 3NL0A 3X1LB 5L8RC 4C0OC 2ZD1A 4V1Ak 5KG4A 1URRA 3LOUA 2FLOA 1RT6A 1JXVA 3BN7A 3O44A 2UUAF 3UE2A 3OTBA 1RACB 2C3YA 2EFOA 4Q2MA 2E1PA 3ZNUA 4DPOA 3IAS9 3JS9A 5D3GA 3FEZA 4MKVA 1FK9B 5HLFB 4PCQA 4UOGA 4CP5A 3AOBA 1R0CB 5GMEA 1FE0A 2GO9A 2CWXA 1RAIB 3W66A 4QPXA 4I2PB 3CCES 3K89A 1D0EA 1QAIA 1DTQA 1YJRA 4ZVOB 3OXFA 1RXOB 2W01A 1KR4A 3C3LA 2V2ZA 2GZOA 1YZ6A 1DLOB 3DGPA 4KIAA 5CH7B 2AGOA 2DPIA 5L9XA 1T9UA 4QYZK 1WC5A 1VR6A 4OYXA 1IBKF 3BGUA 5KG7A 3PYGA 2GCFA 4F4AA 4KFBB 2LXIA 2OI2A 4G1IA 3WX8A 4GC6A 2RVJA 1U47A 1WC4A 4GC7A 1VC5A 1RCXB 2V2KA 4F4KA 4HTIA 4GKKJ 4DZDA 3W2WA 3FBBA 3HX9A 3GTYX 4MYUA 5K9FA 2ZM6F 1GQEA 1RTZA 1NHKL 3QQCD 3CCUS 3BGOP 4F02A 2U1AA 1FRLA 2NXNA 1F3VA 1SCJB 2P9EA 1R0BG 2BM0A 1JK9B 3P8BB 4UQTA 3M9OB 2D3OR 2MZSA 3PRBA 4MYTA 4ZCLA 4TN2A 3RBXA 1S1TA 3W2VB 3BQ0A 1TZ0A 1UEKA 1PYTA 4RW7B 5ETOA 3AODA 2NPFA 1S72S 3SYZA 3FFIA 2HGMA 4I64A 2MKSA 4ZS6A 2OTLS 2MTLA 3BR8A 4DQSA 2JRSA 2BANB 4PYAA 4BWMA 3CCSS 1UKUA 2XY5A 2IVFB 5AJ3J 1VLYA 1O5JA 2I6WA 3P96A 4K5SA 4F3OA 2UUBF 3GQCA 3JTPA 2GQQA 2IDLA 3MM5B 2H51B 3J81j 4ZVUB 1O51A 2VFUA 2RDIA 3I87A 1L3SA 2MZQA 3VV2B 2HQCA 2IVMA 2JL9A 4DX5A 2QYGA 4ZPWR 4USMA 1RT5B 1RI7A 3HPOA 4DL6A 1YJNS 4H4OB 2B4VA 2FQQB 3BKUA 1X4EA 4ZLNA 2KM8C 1XC9A 3EPGA 3OL8A 4KPYA 3KDNA 4C48A 2MLXA 3IXQA 5F3ZA 5DQHA 4CLSA 4QIVA 4DUTA 4H54A 1Q7YT 1H2TZ 2R7XA 3NEKA 2BZ2A 3KLEA 1X8DA 3W65A 2C2KB 4C8MA 3ISZA 4PWUA 4LSLA 1MWQA 2EG1A 2UU9F 2MPUA 1WHXA 2L9WA 4WPAA 2I9SA 1OSCA 1N5YB 2BJ7A 2PT0A 4CM2A 3CC2S 1RTJB 3V6DB 3JYTB 5IWAF 1LWXA 1QM9A 2DH7A 3IWNC 3MCMA 2GJIA 3TJ9A 1YJTA 1QLNA 4R0JA 3DMJA 2JEIA 5C42A 1XMOF 2MSTA 4OLOA 1ZM2A 2KT5A 1LWCB 1FF2A 2DGOA 3PACA 3P45B 4AL6A 5B08A 4DZ6A 1X0FA 1REGX 2RF2A 2HNDB 3NGDA 1YG0A 3G6ES 4X4PA 4F50A 1C4CA 2QRRA 1LWEB 1RAFB 1X0PA 2MQLA 3BBCA 3HI9A 4RW8B 3MEEA 5L1LA 2CJQA 1VQKS 2BJ8A 1REVA 3DLGB 1FRHA 5DG9A 2K3KA 4MMOA 2E7XA 3CULA 1IQZA 3QWPA 3MPUB 1RUSA 3OTCA 4IOCQ 5A2QU 2K06A 1WDDA 3D67A 1KQSR 5HROA 4WYWA 4B9SA 2KVQE 3EICA 2KFNA 3BB5A 1TL5A 2J5AA 2WRMA 2H5JB 4QWEA 5I3UB 1LW0A 3O5TB 3J81U 2QZ8A 2Q66A 5FJ4A 4R5PB 1QY7A 4DV5F 1T8EA 3PG9A 1XR6A 1RK8A 1S6QA 2XMWA 2H4WB 3TAPA 1K44A 1Z2ZA 2V8GA 2UVUA 3QYYA 3TVYA 3PFEA 3W8PA 1SVDA 2B56A 1OPZA 5JMNA 5E3RA 5KFSA 2F7VA 3Q24A 3JSMA 2X1GA 3DOKB 1TQLA 3QT8A 2R9LA 4DQRA 2BOPA 5EN1A 3CJQA 1OYDA 3KLFB 1NH8A 1R8AA 1SJ1A 4O4GB 2DGSA 2L48A 2ZITA 3P3DA 3BGRA 1FERA 4FNHA 5B0EA 2LLZA 4JI2F 3R7NB 3W5YA 4C3MA 2N3LA 1ZAXA 2HHSA 3D6HB 1A0OB 1YWXA 2QL5B 3OR1A 4FKXA 4AXJA 2ZHAA 4DSFA 2O66A 4FBUA 3ADAC 5IC6B 1VISA 3M2UA 5ETTA 2YPYA 4HHUA 2XMAA 4CLLA 2AYGA 5A6WA 4B9UA 1ZM3A 2CZ4A 2OP5A 3FJ2A 3N5FA 4HT7A 2BA9A 2X1AA 1LK7A 1DQ8A 4LFAF 1X5OA 2D9PA 3CCWA 1HBUA 2R7OA 4JI5J 2AIRB 4NLDA 2E9ZA 2BM1A 4ES3A 3G87A 3AXMA 4NL5A 1WKKA 4ZCIA 2PEBA 1UPMB 1ICEB 1Z4UA 2CNNB 3UCGA 2W7PA 2RRAA 2DNQA 4B9NA 4ECTA 3CT9A 4X62F 4DSJA 3LH2S 2A2CA 2XULA 4K59A 4P7TA 3BDPA 2LQBA 2CPJA 5HATA 3D2WA 4OYAA 2XWXA 2B9WA 4PYDA 1VOMA 2V69A 4DPTA 5L46A 4K4UA 3KLHB 1ACMB 3ICLA 4ZVRB 4J9RA 2HFVA 5J2MA 3UN2A 3B4MA 1Y5LB 2HSEB 4DUYF 3SDEA 2CPZA 2DIVA 2H54B 1YKWA 2WBRA 3EGWB 2GMLA 3SCKE 2QO3A 4YY3F 4LSNB 3NCPA 5F3TA 4LFBJ 1S6UA 1YJ9S 2OPQA 2WW4A 2YKPA 1K1SA 2W2NP 1IKWA 1T02A 2K1RA 1QD1A 3NAHA 1TL3A 4P2XA 5F41A 1NJXA 1NLKL 1S1UB 1DAXA 1FKAF 4ZVQB 4ED8A 2B51A 1W2IA 4RUBA 1BQXA 1UEUA 4LR9A 5U47A 3VGUA 2XBPA 4NEYA 4DL7A 1A7GE 1TP7A 3V6DA 1RU1A 4ILLA 1VFJA 2F4FA 2V4JB 2IRUA 3Q2SC 5B0BA 2I8EA 1HBNB 3HSGA 3JB9k 1FDNA 4NLRA 2QMXA 4GMKA 3BQ1A 4OZ0A 4C6AA 3VAKA 1RT4B 2V94A 4AQYJ 4PG8A 4PUOB 1RHJB 1TMJA 5C24B 3PYDA 3R8YA 4RUHA 4Q8FA 3LP0A 2NXCA 2AGQA 4DV0J 1M90T 3DRPB 5KFRA 3DLKB 5HK4A 2YNHA 2VODA 1HNVA 1FNMA 4TNOA 4CO0A 4C3LA 4NLSA 1KOOA 3UDLA 1SPBP 2OPRB 1WC3A 4MKAA 4BBYA 4Q44A 4DI6A 1UVKA 3M6VA 3OUYA 4IQXA 2PFFB 2ZH9A 4ED7A 1U45A 2W8LA 4JI1F 3A8EA 2FB0A 3TA0A 2ADCA 2RRBA 2DXFA 4Y0FA 2LMIA 4ECRA 1B7YB 2CUYA 2PIIA 1CJTB 2V5HG 4CYUA 5BXIA 4ANCA 4J90A 2DNNA 5D77A 1E6VA 5F8JA 3OTDA 1V6HA 4FVCA 4AL5A 5CYQB 4YHHJ 3D4JA 2AX0A 4DS5A 2EXUA 3AFGA 1FFWB 3M8PB 3SQGB 2XS2A 2VJVA 2IYGA 2Y1RI 4ZP9A 5DM6Q 1K73T 3W1YC 3FRYA 3OVSA 1GMVA 4M5KA 1SUQA 2DNPA 3DN9A 3BGRB 3MPVA 2WVDA 1TKZA 1VQOS 4A48A 3BM7A 4FPIA 2J9DA 3M2VA 3GFYA 3HDSA 3UVJA 4NXMJ 2LEAA 4C8LA 3LQVA 2HNYB 4OIXA 4OI4A 4HH1A 2ZBRA 5CZVA 1X5TA 2DXDA 1EARA 4KV8B 1SC4B 4ZVSB 5T7LB 3HHNB 3X3UA 5CD4A 2YWFA 1F2GA 5EWEA 1VQPS 1TK0A 1U6BA 5A8KB 4ZP6A 4YB5A 3I31A 2DNGA 1SV5A 3R6GB 3ISNC 4ZPCA 3K58A 4DLEA 1NJWA 3KK2A 2KDOA 2ZOFA 2M70A 4P2SA 4YN3B 2RQCA 2JEFA 1RCOB 3M30A 1NPPA 4RNMA 4ETZA 4TQRA 3EX7B 3MECA 4NMLA 5KG5A 6FD1A 5DLFA 5KFMA 4ZPTR 5A76A 5T14A 1RHRB 4PZVA 1AFJA 1WOPA 4F7VA 8AT1B 4Y3CA 5F0UA 2EI5A 1WKJA 2AYMA 2M0GB 4MIBA 4MK7A 5IWAJ 3UCUP 4ZCMA 1G3OA 3OHBA 3NP5A 2Q6CA 5ETNA 3V6JA 1S0VA 4KFBA 3FKBA 1HBMB 3R5JB 2VC0A 2X3DA 3MZIA 3ZO7A 1F0XA 4IO9Q 2VV5A 5D78A 1PGZA 3SDEB 1XMOJ 2XCAA 3KJFB 4R8UB 1BUXA 3UN5A 2XS5A 1N5TA 3CD0A 1NJYA 1P8GA 2O3DA 3L4BC 2UVWA 4GKJF 5J1PA 2N82B 5LJ3Y 4ER8A 3PIPQ 2BQRA 2PEHA 3CB4A 4HACA 3IO1A 1S10A 2XY6A 3I0SA 4Y65A 2E5GA 1IBMJ 1N33F 1Q79A 1RU2A 4I69A 1F9EB 1RBAA 4NEZA 3MMAA 2YPZA 3FQLA 1QSLA 4RW9A 2VU5A 1TU0B 1S57A 2MKKA 1FFSB 1JXEA 1Y7PA 3MCSA 2XSJB 4HVZA 2R2TA 2JWNA 4AFFA 3S8SA 2D69A 2RQKA 4QJVA 4A8OA 1S7IA 2BE9B 4DR1J 3KOAA 2COLA 3KLFA 2QMUB 5A8RA 1X9WA 3F41A 1UFWA 2XNQA 5LMNJ 2C28A 2HS4A 4FF4A 3IRXB 1YRTA 3CSKA 1EB0A 4IG3A 3KUEA 3H5YA 3VGSA 1C1CA 3FFIB 2Q6BA 4DUZF 1Q5YA 4P2FA 3TJ8A 2FLPA 2V68A 3R27A 3THPA 4DBQA 3KMSA 1HI1A 1MLAA 3HVWA 5D15A 2VZ9A 2VG5B 1X9SA 2Y1LB 3DRPA 2V0NA 4WU2A 2E5JA 4RR5A 3SSSA 4WBFA 1L3TA 2BYCA 2BACA 4DR1F 3K0JA 1JLBB 3TX8A 4DV7F 3E8OA 4EZ6A 2DJWA 2QX0A 3D68A 1Q16B 2KRBA 4WJBA 2X1BA 1G6BA 2GIQA 3HK2A 3KYLA 4IFVA 4BHQA 4HI2A 1T11A 1TUVA 5GAGU 4P52A 2HEKA 3M32A 4ZCKA 2MZ1A 3TWZA 3C14A 2GVZB 3I0RB 1ZAWA 5I3PA 2CADA 2E66A 2N7YA 2DNZA 9RUBA 3HMJG 2C2RA 4FVMA 2W9AA 1HI0P 1B99A 1S1XB 4ZLJA 4WIQA 4FF3A 4MK9A 4DMZA 4F04B 2PC6A 2C2EA 2ZKTA 4B3RF 4M1KA 3FK4A 1OY6A 4FN5A 4LFCF 4X84A 4QYRA 2VC1A 3G2XA 4ED5A 3MCOA 1F5CA 2LQ8A 1NHVA 4P73A 1IBKJ 2RDJA 1TV6A 4PQUA 5KFGA 3Q8UA 1VK8A 4USUA 3MEEB 4C11B 4DR5J 4LF5J 3KMQA 1I51B 2QSWA 1C2PA 3UNGC 4P75A 2GC8A 3NOCA 2VFSA 3SXLA 3MR6A 1QDUB 2CZ9A 3WDOA 2HMIA 1AUSL 2VA3A 4OX9J 2ERRA 1NUEA 2JJ4D 4DCOB 3C14B 4GRSA 4OMFG 1SL1A 3UDVA 3POTA 2DHHA 3ZTQA 3MAAA 3IM8A 3MM6B 1JNZB 4OLPA 3P6YC 2L3MA 2RKIA 3MM9B 3PYFA 4X4UA 1FVSA 5GAGI 1XMQF 4QWAA 1Y0HA 1YIJS 2G1DA 5GAEI 1MROA 5GMKa 4R8UA 1HWIA 3MEDA 3F73A 4DS4A 1ELOA 3N4WA 1TR0A 4LRAA 1W25A 2HQFA 2LQ5A 5LL6d 5AJ3F 3M8RA 4M5MA 3TA1A 4QBUA 3CTRA 4J9NA 5DGAA 1VQ9S 1QE1A 2E1AA 1RHUB 4NA1A 1VYAA 4ZIWA 3DDIA 2J76E 1VGYA 1PAUB 3SSRA 4DR6F 3C6TB 3ITHA 3H4BA 1KFSA 2A18A 2LXFA 1F60B 2W4DA 3ISND 3LGNA 3ETMA 3IN5A 3L95X 3MMCA 1XNQJ 1HNZJ 4ANEA 4FNIA 1FRMA 1NM2A 2X3GA 2VONA 2K7KA 5ETRA 2BQ3A 2O1PA 4I56A 5F9LA 3MAQA 1KSPA 3DRSA 4OYMA 2J8SA 2BRKA 4CO2A 1SQFA 4KAIA 1FNOA 3M6WA 2DEJA 1ZTTA 5I42B 1RAOA 1S49A 4K2JA 4O3PA 3SSQA 3VZIA 4F0KA 4NXNJ 3IRXA 1HBUB 4DV1F 4HDGA 4O4GA 1VQ7S 5EWGA 1SC6A 3UVJB 4UTGA 5L38A 1M5SA 1DURA 4B9VA 1EIYB 3KK3B 1UVNA 1RSCA 3QGIA 4AD6A 5IXUA 2DHSA 2OEKA 4NOHA 1KQKA 4ZITA 2IC3A 4QWBA 5ETVA 2YNIA 2F5GA 3OV7A 3OVAA 1C0UA 1N52B 4X64J 1F6TA 4FS1A 4EYHB 1U1OA 1SKRA 5CXTA 3NS7B 3MGJA 2B9EA 2YNHB 1WACA 1RT7B 1S0OA 2FLNA 4Y28C 2VFVA 2AD9A 1IBLF 1HLWA 1UCNA 4CO3A 2H9ZA 3M6UA 5KG2A 3LWLA 2LECA 4KKOA 2KL8A 3MEGB 4OJ1A 4EWTA 4DV6J 2P5VA 5FIIA 4V19J 2MKCA 4K0KF 1IXKA 5DZ6A 2GFFA 4C4WA 1JLQA 3PEHA 4UT4A 2UXCJ 3DXSX 1C0TB 5C42B 1PILA 2ATCB 4RX6A 3T1HF 4ID5A 2W4PA 2N4CA 4YFUA 1REVB 3DLGA 1R43A 1RT3B 2ZEJA 3GYXB 1U1PA 3NMAA 1AT1B 2IRXA 4JI4F 3TQEA 2PGCA 3SCJE 3U1MA 1VQSA 2KB2A 1IBLJ 2XYHB 1AZSB 2RU9A 2VBYA 2PMWA 2Y1JA 2UP1A 3PO5A 3LA0A 2BV3A 4LRFA 5D6GA 3MR5A 1KHWA 1FHTA 3GYNA 1TKZB 2AEMA 2RRNA 4K0KJ 5KG0A 2UZAA 2HHHF 3SEOA 3OL9A 4N7TA 3M8YA 3FSIA 4FYDA 4CLFA 5BYSA 4DPXA 2ZFHA 2H4YB 5AXKA 5H9FK 1HNWJ 2W2QP 2QLBB 1YSJA 3Q8QB 3OFGA 2KFYA 4FYYB 3H2VE 3PM9A 3TUZC 1NDCA 2FC8A 3EWGA 4UZCA 2HZAA 3EGZA 1R3NA 1YVFA 2W4CA 1Q81T 2RSQA 4ZK7M 4NYPA 1KLNA 1CS4B 1WD6A 4N76A 5IV3A 3PRVA 4LVNP 5F9NA 2LKZA 5BYRA 2JX2A 1IBMF 1EJ7L 2ZBPA 3WHIA 5LSRA 2B0GA 2XMJA 3CWJA 3FBCA 4A8QA 2AU0A 5M2PA 2R2RA 3AOAA 3G96A 3M8QB 2C3MA 2G9OA 2DR9A 2VG5A 2DGVA 1CQMA 3L7PA 3A3PB 1H2VZ 3AJ1A 5FDLA 3DLEB 1MROB 2BUNA 3HKZD 4ZPDA 3W5XA 3HXMA 2VBXA 3HHLD 3TR5A 2XMMA 2R7UA 3PDNA 3MMCB 3LAKA 2V63A 3I82A 2VDHA 4XTTA 3MMAB 4UY85 2AP6A 4KE5A 4TQSA 4AE5A 4BCAA 4K4TA 2RDDA 4URSA 4JI8F 2FVQA 3QJLA 4DDFA 2HURA 1BMQB 1PIEA 4HACB 1CJKA 3VTIA 2DNHA 5E3AA 1X60A 2GMHA 2KZMA 3K5PA 3LP1B 2DNMA 2HBRB 4F36A 5ETLA 2ZHBA 2KHDA 4OYWA 2DGUA 2MQMA 3GCWP 3P5TL 3R7BB 1Q8KA 3SQOP 2RS2A 3CJ5A 5J2NA 2PFDA 1U0HA 2CQ2A 4KYZA 2MKYA 2MQ8A 5B7WA 3OTOJ 3HZGA 3EMTA 3A12A 2HAFA 3W9JA 4F4WA 2CG4A 1B7FA 3RW6A 2UXDJ 4JI8J 2BW7A 1N56A 1OS5A 2HRYA 3HHKA 2AYBA 2OPPA 1JB0C 1BQNA 4Q7AA 2W9BA 4B3SJ 1NKCA 3DI6A 3QZ7A 2GJ2A 2AV5A 1CG2A 1Q8LA 2RS8A 1JLCB 1DTTB 3FGVA 3Q23A 1MW7A 1BY9A 3R9LA 1XIQA 4KHRA 3V4MA 3BN4A 5JJBA 2MZJA 4W4MA 2OSRA 3NS6A 2VKRA 1Y3KA 5EUHA 3SBMA 4B17A 3M32B 5F8LA 2F4VJ 3KG4A 3OJUA 1K0TA 4LSNA 5A8KA 3MTJA 1HQEA 3SCIE 1J2VA 1T3OA 2UXDF 4MFBA 1IR2A 3G71S 2B6AA 1S1VA 2OMLA 3LTOA 4LRBA 2WCXA 4LQ9A 4HHJA 3BDEA 5D0HA 3T5JA 5JVHQ 4RU9A 5IS2A 3T1YF 2X1FA 3JTOA 1AFIA 5J2QA 2CQ0A 2EWHA 4ELTA 1TVRA 4Y2KA 4O0IA 3AOCA 3S1TA 1K47A 3IGNA 1G7CB 3QPIA 4PG4A 2DR7A 1HIYA 1I3OB 3TRGA 3H0PA 3TVZA 4JI1J 2DHGA 2OKQA 2EBGA 3M8SA 4FYXB 2KTQA 1D1UA 4H4KA 1D9FA 1U8WA 4IOBA 2HVIA 3H90A 1QAJA 2IIHA 1U7LA 2VF3A 2DYAA 2GVDB 3HVAA 2E7WA 1RWKB 1YRXA 4H4KC 4F2RA 4LVOP 4ZJOA 3I5CA 4QR0A 4C8YA 4OHZA 2QIFA 2VOOA 1NMEB 3G82A 3BKTA 1VBKA 4MH8A 2ASDA 2BKPA 5J2PB 1NXIA 3PX4A 3GMGA 1D09B 2Q3PA 1YJVA 4LFBF 3RAXA 4TLRA 3W64A 3M2UB 5RUBA 2Y0BB 3NXZA 5G0RB 4PKDB 1S9FA 3BO2A 2I5JB 2AYEA 5DGBA 2MQQA 2YH1A 1MMDA 4IO1A 3MM7A 1H2UX 3BSAA 1RKJA 2CDQA 4CLYA 4ZLPA 3PHEA 4LIWA 4ETXA 3M8QA 2YTCA 3EZUA 1KDNA 2U2FA 5B0AA 3R97A 3CE8A 3KHRA 4OZLA 3VCDA 3MM8A 4R25A 4NWBA 4UOFA 1WJ9A 2QLFB 1RYRA 4IUFA 4UY8T 1U2FA 3CDUA 3CMQA 2DD8S 4CLZA 2R7RA 1B3TA 2ATLA 3ENAA 2IPOB 3T6BA 4NI2A 3EJMA 4WFYA 5LMUF 3LW5C 1T9YA 2RQMA 2OJ3A 4IOAQ 1R6VA 4ZJQA 2RILA 4LMZA 2QGFB 3HSJA 2LFVA 1ROFA 3CPWR 3GFHA 2RUGA 1DARA 1T7PA 5CYMB 1CS4A 3WQPA 1WSVA 3DDNA 4O3OA 2KRRA 4LREA 4WTOB 1VRQC 2VJUA 2QLJB 3B54A 3ILLA 3A1YG 4NZ0A 3D0HE 4USWA 4O44A 4QIFA 4ECVA 3KLIA 1TUWA 3GV5B 1HBMA 1KVIA 3ENWA 5IQ6A 1AZSA 3D7SB 1U6ZA 5D4PA 2WOMB 4GVLA 3WX4A 2EC2A 3KHGA 3RW7A 4L72B 4YR2A 1R31A 4PAAA 3IC1A 1JJ2R 1RWWB 2E1RA 3NOGA 1W26A 1FCAA 5FD1A 3UN3A 1BWVA 5GVQA 1SL2A 3D6FB 2ZHOA 5H9FJ 2CJYB 4X2BA 2FJWA 4XDDA 4QW9A 1N6QA 4LBPA 1HNXJ 1ZM4A 5EDWA 2O5DA 2UXCF 2CKWA 4KB7A 4KGKA 2DO4A 4CLWA 3IM9A 4Q0BA 1DQAA 1QAYA 3CIMA 5LM7E 4ALZA 5CCMA 1RT6B 3O6QA 1KN6A 2IBKA 4Y00A 1V3ZA 3PW7A 5AE1A 4HHHA 1NK8A 2B5JA 3QRQA 1ZPVA 1AB8A 1SQGA 1N54B 2PSZA 2AJFE 4DU7A 1FI4A 5IM0A 5DRKA 2QA4S 1DZ5A 4PEOA 2CAJA 4UUXA 4I2PA 1JLGB 1DQ9A 3HT0A 4RBTA 4NLXA 4PXCA 5LT5A 3KG1A 1XR5A 5BR8J 3VALA 4QQBA 3AJ2A 4ED2A 1GXLA 4X62J 1TL4A 2AJ0A 4ELUA 4W90B 1FESA 2EFGA 2UUCF 1PG5B 1PC5A 2WONB 5KFAA 3U1NA 4ZN1A 3NAIA 5I4MA 1DY3A 2CQIA 4D3GA 2D9OA 3RZAA 4JI5F 1QSSA 5LSOA 4UF4A 3BGFA 4OZ2A 4E2FB 3RBEA 1LFWA 4ES1A 4X4RA 2DEIA 4AL7A 1HYSB 1G4CA 3NLCA 2ZH7A 2XY7A 4B3TF 4DV2J 1FTCA 1T3NA 5HJYA 1Z2LA 2AJQA 4BWJA 4CQ1A 2DT9A 1UPPA 2FHMA 4OHVA 4C8ZA 4YY3J 3VAIA 1OY8A 3CJSA 2EK6A 4B3MF 4N47A 5D8HB 3AJDA 2W24A 4DR3F 4DR7F 3QAUA 3IP0A 1X4CA 4ECWA 3C15B 2JH3A 4DV4F 1CPZA 3RRKA 2Z8QA 2BEFA 1RJJA 2F63A 1NZAA 2H5IB 1FJ7A 3MUTP
chains in the Genus database with same CATH topology
2ZJRQ 2M52A 3KHLA 2BJEA 2IMWP 2QA4G 2FHJA 4ECUA 3B78A 2EBEA 3TQ1A 3DFEA 2ZH3A 3PVXA 2M2BA 1S1TB 2V9KA 5L9NA 1N88A 4NYZA 1X4BA 4OJHA 4QR2A 4MAKA 4LF7F 3IWLA 1FRIA 2VPYB 1X5PA 2LCWA 3BF4A 3SFGA 4H4MA 4F3MA 2DGTA 1L3VA 1RQ0A 2F9DA 4QZVB 4M63A 4WCEQ 4PQUB 2W8KA 3CCQS 4BC9A 1MMLA 3F44A 2VUGA 4IRCA 4OL8A 2F3JA 3FZ2A 1R0AB 3CJ3A 2XC9A 4EYIB 3OW2R 1X4GA 2BXJA 3C46A 4ZKAA 4B3SF 2XG8A 3NGKA 3PXGa 2HAIA 3U7JA 5DG8A 1PO6A 1VRTB 1Q4RA 2YWHA 5F8IA 4YB1P 3HJFA 5IFMA 1S9EB 3U27A 4YEAA 4B3OB 2HHPA 1UJ6A 2GQCA 4NYOA 1J5OB 4RWWA 2CPXA 4J5OA 3ZZUA 3DI6B 1Q53A 5HP1A 3QO9B 3WZ0A 2Z0GA 4Z37A 4I0WA 5K8MA 3QZ8A 4I1TA 3FMBA 2V8HA 4J9QA 2YNGB 1JJHA 3ZZOA 2IJFA 2CQ1A 5KFWA 2ASLA 1TL1A 5AXLA 5KOWA 1S97A 4JYAF 4L3NA 3KLEB 3VAHA 3E01B 3DOMA 2KKHA 2VG6B 2Q1LA 1IN0A 3M1VB 3MURP 5E3PA 2HLTA 2HW3A 7FD1A 1VIOA 4TXSA 1NK4A 1Y5NB 2ACYA 4K4VA 2MGZA 2DGWA 2EFQA 4C8OA 4LF6F 2GQ2A 3US5A 4C9DA 3AHPA 4DL5A 1ZTWA 3RU0A 2FD2A 4X4TA 2IA6A 3JSMB 3DRYA 2UVRA 4ECXA 3TARA 2CQ3A 2WSCC 2AQ4A 3S7RA 1HMVA 1S1VB 2E29A 2NLWA 3O1LA 2FDNA 4U6PA 3Q22A 4ZHRA 1TK5A 5M2UA 5G4DA 1LXNA 3SCLE 5HMXA 4LF4F 4I67A 4O3QA 4H4OA 4DL4A 2VG6A 4R0EA 1DHMA 3FQKA 1HWLA 4DFJA 1TL3B 1JLAB 3C6UB 4D3HA 5T41A 3GB0A 2HNZA 2VB6A 3OPKA 2RD5C 4Y34A 3RB4A 4TLQA 3GV8B 2YKMA 2BBEA 4GO7X 1GT8A 1N0UA 3BR9A 2DK2A 1YHQS 1VBXA 1OQ3A 3FVYA 2DHAA 3QLHA 4HYKA 1E6YB 2O01C 1FXDA 2KN4A 1VJWA 5DG7A 1NJZA 1VBZA 5KFZA 2XB2D 1AXQA 4NPOA 2AW0A 2ASJA 3D1QA 2RQ4A 2JLEA 4ZA1A 2QE5A 1BQMB 1U25A 3N0VA 4YDDB 1KQFB 3VQSA 4IDKA 1HPZB 2MY8A 5CQGA 2JEGA 3LP2B 4QU7A 3CDEA 3PKMA 3W2WB 2WOMA 1VI7A 4RUCA 1U1QA 4KT0C 3R3TA 3PW4A 2EC0A 5A8WA 4DEZA 5DDOC 1IKVA 2HVZA 3M30B 5LMNF 2I2YA 3D28A 1T94A 4ZPBA 5KFXA 5ITHA 5HBMB 2YKNA 2E1CA 2KO1A 2RJZA 5KFJA 1TKDA 1HNXF 3RR7A 3ZZYA 1D9DA 3DM2B 3MF5A 2EFPA 4FS2A 4ECSA 4DV3F 1UL3A 2XO7A 4NLPA 4ZVEA 4X4QA 4YP3A 4N5SA 3OVBA 3PNIA