1T03B

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibody/dna
molecule keywords Synthetic oligonucleotide template
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 96
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t03B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03B03
2ALZA 2IJNA 3IRXA 5HLFA 2RF2B 4ZP7A 2FVSA 4RW9A 3LP0B 3T5HA 4PUOA 1JXLA 4IH6A 4IOBA 2ASDA 1RA7A 3MEDA 3KK1B 1HQEB 2I5JA 1C1CB 3SFGA 2QV6A 2YKNB 1K1QA 3KHLA 1IKYA 1BQNB 3MEGA 3DLEB 5J2PA 1DLOA 4ZPCA 3BQ0A 2HWHA 3H4DA 4KKOA 5DQHA 2XCAA 4KSEB 2YNHA 3FRZA 4J9SA 4IG0A 4O44B 1FKPA 3JYTB 4IG3A 3KHGA 1EETA 1LWCB 3CDWA 3MR5A 4ED7A 3KJVB 5DQGA 5KG3A 3JSMB 4ED1A 4DL7A 1S1TA 3TQ1A 3DMJA 4ZPDA 2OPQA 2OPSA 5F8LA 2BR0A 2JEGA 1HYSA 4IH7A 1N4LA 2YNFB 2HMIB 2XC9A 5DLFA 5KFSA 5KFDA 1TKTA 4YR0A 4K4ZA 3RBDA 1QAJA 4WE1A 2BRKA 4ECVA 4H54A 3GYNA 3IS9A 4WFYA 4TXSA 1N56A 1S1VB 3MECA 3SFUA 4K4YA 2FLNA 2FJWA 1SV5A 3ISNC 5KFCA 4ED6A 1YVFA 4J9QA 3IGVA 1S49A 2HNYA 3H5SA 5I42A 2HNZA 1JLAB 2R2UA 2YNGB 1HNIB 5KFIA 3H4BA 2J6UA 5K14A 4RUCA 3FSIA 4ED2A 3BQ2A 3M9OB 4O3RA 3E51A 3C6UB 2W8KA 1RT4A 5KFHA 2C2EA 4PQUA 3BREA 3MFHA 5I3UA 2OPRA 4PWDB 2IMWP 4TYBA 5KFUA 3DOLB 4MFBB 4HKQA 2ATLA 1GX6A 4TQRA 3IRXB 5HLFB 3EPGA 3PW2A 1J5OB 4FS2A 4FBUA 5L1LA 1IKVA 4PUOB 4QPXA 3I0RB 4Q45A 4I2QA 2VA2A 5KG4A 2I5JB 1NHUA 2HNDB 1MU2A 3LP2A 3MEGB 5J2PB 1VRTA 3KLIA 5DLGA 3H40A 1RT2B 1HNVB 4Q0BB 4IH5A 4NLVA 2YNHB 1JLEA 4IG0B 1FK9A 3DDKA 1FKPB 3MFIA 3GIJA 5EWEA 5CYQB 2ZE2B 4MKBA 4JV1A 4NRTA 3LANA 3KK2A 2FJXA 4F4ZA 1HQUA 5HBMB 3H5YA 4J9PA 3DMJB 2OPPB 2OPQB 2OPSB 5D3GB 1S6PB 3PHEA 4TY8A 3BSAA 4KO0B 4WE1B 3H59A 4QWBA 2YKMB 4EO6A 5KFPA 4F4YA 1BQNA 2C2DA 2R2TA 5C25A 3ISND 4J9RA 3EZUA 5KFMA 1XR7A 1ZTTA 3BGRA 5I42B 1HPZA 2HNZB 3Q8RB 3MR3A 4ED0A 3KJVA 2WTFA 4IR1A 3LAMA 5K14B 3JSMA 1S4FA 3BQ1A 2ASLA 1BQMA 1RT4B 3QGGA 4PQUB 1S10A 1XR5A 1T94A 4TLRA 5I3UB 3CIZA 3MF5A 2OPRB 3QO9A 1JLGB 4IFVA 2HMIA 4TQSA 3NL0A 2ILYA 3NMAA 1RTJA 2FVRA 3KHHA 1SH2A 4K4WA 2AX0A 2GC8A 3DM2A 3IN5A 4MKAA 4KE5A 4NLQA 5KT3A 1IKVB 3Q8QB 4RUAA 4ZP8A 5C42B 3H5XA 4NLUA 4I2QB 1K1SA 2IA6A 2F8EX 4Q8FA 1MU2B 2WB4A 4K4XA 3LP2B 4QWCA 1VRTB 1HNIA 2W9CB 4DL2A 4ECUA 2XI2A 5KT4A 4MK9A 3UPFA 4J9LA 2R8GA 5F8NA 3UR0A 4NLYA 3KLFB 4O4GB 3PJWA 1JLEB 1RT7A 2R2RA 2JEFA 3KMSA 4PWDA 4M94A 4EO8A 4MFBA 3NAHA 3KK2B 1HQUB 5KFBA 1KLMB 3T1AA 4RNHA 5KFTA 2VA3A 1J5OA 1TKXA 2RDJA 1XR6A 4JUZA 5KFQA 5KFAA 1LW2B 2W9AA 3LALA 3I0RA 1EP4B 5KFGA 2WHOA 1WNEA 3H2LA 3G86A 3OSPA 2R8KA 4TY8B 2HNDA 2GIQA 4J9KA 4TYAA 2YNIA 4QW8A 3KMQA 5J2MA 5C25B 1IKXB 1RT2A 3KLVA 2AGQA 5F8JA 1HNVA 5KFLA 4Q0BA 2JLEA 3LP1B 3CJ3A 4ZVGA 5KFYA 1S9EB 1SH3A 5KG5A 3BGRB 1JLCA 5CYQA 2ZE2A 1HPZB 4H4MA 1QAIA 2V4QA 3E01A 4MIBA 3PZPA 1BQMB 5HBMA 2XI3A 2OPPA 5C5JA 4WXWA 1FKOB 5D3GA 3BJYA 4G1QA 3QO9B 4IFVB 2GIRA 5KG6A 5KFJA 1S6PA 1RTJB 3RB0A 4KO0A 4LSNB 2IM1A 2YKMA 4QW9A 3Q8PB 3DM2B 3QLHB 4RW8A 3KLGA 2I1RA 4RZRA 3QZ7A 2RDIA 4IRDA 3OL8A 2DPJA 4QWDA 1KHWA 3M8QA 4WFZA 2VG5B 2ZKUA 4NLDA 4ZPAA 4O3NA 1RAJA 1MMLA 5KFOA 4U6PA 1RT7B 3PW7A 4X2BA 1TP7A 3KLHA 3UQSA 1JLBA 1JLGA 4ED3A 1U09A 1RYRA 4NLPA 2V0NA 2WK4A 3NKYA 4K4UA 4RNNA 1CSJA 1QE1B 1TKXB 2HWIA 4KAIA 5F8GA 1RT6B 1T3NA 3HKWA 3BSOA 4YR3A 2BE2A 4ECWA 4XPEA 5C42A 3M8PA 2ZD1B 3HVWA 4I2PB 4LQ9A 2W9CA 1JLFB 2YNIB 3V4IA 5J2MB 4RW4B 2IM2A 3KLFA 5KT7A 4O4GA 3TAMA 3M9NB 4J9OA 4J9MA 3SI8A 5F8IA 1JLCB 2BANB 2IAJA 4EEYA 3KNAA 4TY9A 2UVVA 5KT5A 4H4MB 1C1BA 3E01B 3T5LA 3ITHB 4G3IA 4EBEA 1OS5A 1C0UA 1KLMA 2O5DA 3I5CA 1T05A 2UUTA 5KFXA 4K50A 5EWGA 1LW2A 2B6AA 4DG1B 2BRLA 4FBTA 4G1QB 2E9ZA 3QIDA 4GC7A 1EP4A 1JLQA 1S1WB 3UDLA 3QGHA 4DL6A 4ZVEA 1TVRA 2UVWA 4GC6A 3NAIA 4R8UA 1UWBB 1IKXA 3BSNA 4RW8B 3KLGB 2XGPA 3LP1A 4NLXA 1S9EA 5CYMA 4WFXA 4NLTA 3RB3A 4FS1A 3DI6B 3I0SA 4ZHRA 4OL8A 3T5JA 4R5PA 3M8QB 5F9NA 1S6QB 1ZTWA 3I5BA 2WRMA 1SUQA 4Y34A 4ZP9A 3DRSA 5KG0A 4O3PA 2W9BA 3PW0A 1TQLA 4KHRA 5KG2A 3H5UA 5J2QA 3HHKA 4NRUA 3G6VA 4JV0A 1FKOA 4J9NA 4ECZA 2W8LA 1RT5A 3C6TB 2C28A 3KLHB 2AGPA 3MTKA 1JLBB 5KFFA 5KT6A 3GIMA 2UVRA 3G6XA 2UUWA 2IC3B 4LSNA 3TVKA 3GILA 2R2SA 1DTQA 4ID5B 1HARA 4KHMA 3QLHA 1RTIA 3BSCA 4URGA 2BE2B 4IFYA 2IM3A 4MK8A 4XO0A 3M8PB 5JUMA 2JEIA 2VG5A 5KFRA 3V4IB 1TKZA 3KHRA 3RBEA 3DRRB 3TAMB 4IKAA 2RKIB 3MR2A 4EBCA 3CJ4A 3NBPB 2D7SA 3OL9A 5L1IA 5KG1A 2IAJB 4QWEA 2C22A 3CDEA 1C1BB 1D0EA 3KOAA 1TL1B 1C0UB 1LW0A 2ASJA 4ZVHA 2D41A 4ZVFA 1REVA 1QE1A 3T19A 4DEZA 1T05B 5KG7A 4U7CA 1RT6A 2R8IA 1S1XA 2B6AB 4ED8A 4DL3A 4DL4A 1S0NA 1RDRA 3FQKA 1JLQB 1RT1A 1QUVA 2AU0A 4XPCA 1TL3A 1TVRB 2ZD1A 4WYWA 4EYIB 2VG6B 2B5JA 4I2PA 4TN2A 4R8UB 1JLFA 5L1KA 3VQSA 1S0MA 4RW4A 2FVQA 3FQLA 5HP1A 1JKHA 4I7FB 3IGNA 3QGIA 4WYLA 5KFKA 4WXOA 3BR9A 3DRPA 2XWYA 3N6LA 5CYMB 1D1UA 2BANA 2WOMA 3I0SB 1C0TA 4ZHRB 4B3OA 1JIHA 4R5PB 4YR2A 3FDSA 5L1JA 2WONA 2FLPA 5FDLB 1SUQB 3QIPB 3ITHA 3DRSB 4NCGB 3V81B 5HROA 2FJVA 2W9BB 3DYAB 2R8HA 1RT3B 3DOKA 4MH8A 5J2QB 1LWFB 2JEJA 5J2NB 4DG1A 1RT5B 4Y2AA 3RAXA 2BQ3A 1HMVB 1S1WA 4R0EA 4KBIA 4LSLB 4KV8A 2AGOA 2B43A 2V4RA 3FFIA 1DTQB 1RTHB 4RW7A 1UWBA 1RTIB 2HAIA 1S1UA 4RW6B 4ZPBA 4ZMMA 4ECTA 4IFYB 2AQ4A 3OL7A 5C24A 5KFNA 3MEEB 4Y2CA 1N6QA 3DI6A 4ECRA 1W25A 5J1EA 3CVKA 1S6QA 1NNDA 2CJQA 3NGDA 3V6HA 3PVXA 1S0OA 3H98A 2DPIA 2J6TA 1TKZB 3RB4A 3MR6A 3CWJA 1IKWA 2IJFA 3KK3B 5DG9A 4IR9A 4M95A 3GV7B 5F8HA 3QYYA 4ICLA 4O4RA 3C6TA 4K4TA 4EYHB 3N6MA 2E9TA 3RAQA 1S9GA 3ICLA 2IC3A 1T03A 1I6JA 4DL5A 1LW0B 3DLKA 4O3OA 1JX4A 3LAKA 1REVB 2QE5A 4ID5A 4O3QA 4K4VA 3CDUA 2OH2A 1S1XB 4NLRA 1VRUA 2VG7B 4RNOA 1RT1B 1DTTA 3DLGA 5KFZA 1RTDB 5KFWA 3GV8B 3PW5A 1TL3B 3V6DA 3KLEA 2CKWA 4URSA 3OHBA 3IG1A 2B5JB 5EDWA 4F50A 3V6JA 2V9WA 3M9MB 5HP1B 1JKHB 3DRRA 5DG7A 3HVTB 5L9XA 4H4OA 2RKIA 3DRPB 2W7PA 3GIIA 5JXSA 3NBPA 2BQRA 2WOMB 4B3OB 1C0TB 1R0AA 4WZQA 4F4WA 2WONB 1TV6B 4WZMA 4EBDA 1TL1A 5HROB 1S48A 4F4XA 4KFBA 2WCXA 3DOKB 2W7OA 4RW9B 1LWEA 3GIKA 2J6SA 5DGAA 3MEDB 4Q8EA 4MK7A 2ILZA 3CO9A 3D28A 3N6NA 4Q44A 4ECXA 3V6KA 2XCPA 4KV8B 1IKYB 3OL6A 2VG6A 4YMEA 1DLOB 3G6YA 3FFIB 3OHAA 4RW7B 2EC0A 4O3SA 2IBKA 1N5YA 4URQU 1Z4UA 4KKOB 4I7FA 3OLBA 1S1UB 3T5KA 4NLSA 5C24B 4K4SA 4IG3B 4IDKA 2R8JA 1EETB 1N6QB 5J1EB 4RNFA 1N48A 4Y3CA 5FDLA 3QIPA 4NCGA 1S1TB 3V81A 2RF2A 3DYAA 1IKWB 1RT3A 4ECQA 4LQ3A 3D5MA 3LP0A 1LWFA 1HYSB 5J2NA 4ICLB 5DG8A 4Q43A 2D3UA 5KFVA 3EPIA 1HMVA 3KK1A 1HQEA 1TKTB 1NHVA 3PW4A 4IRCA 1S9GB 1C1CA 4LSLA 3HVAA 2YKNA 1T03B 4YP3A 3OLAA 3RB6A 3IS9B 3DLEA 3DLKB 1RA6A 4NLWA 4ZP6A 3MECB 1RTHA 3PR4A 1SV5B 3PJXA 1RYSA 1VRUB 4RW6A 4KB7A 5KFEA 2FLLA 4RNMA 1DTTB 3DLGB 3MEEA 4O44A 3JYTA 2HNYB 4NLOA 3CJ0A 1LWCA 3V6DB 1KHVA 3KLEB 4YQWA 1IM4A 3IG1B 2E9RX 4NZ0A 3QZ8A 1S9FA 3PR5B 1SH0A 4JV2A 2FVCA 4H4OB 3KK3A 2AX1A 2UVUA 4NYZA 2BQUA 2YNFA 1GX5A 1R0AB 5DGBA 3CJ2A 3GV5B 4KFBB 2FVPA 3I5AA 1S1VA 5DQIA 1LWEB 1C2PA 3GQCA 2IM0A 5EWFA 2C2RA 2VG7A 5F9LA 5F8MA 4NLGA 4MIAA 5KT2A 2D3ZA 1RTDA 4ECSA 4ECYA 2JC1A 4RU9A 2AWZA 2JC0A 1JLAA 2YNGA 3KLIB 3OSNA 5EUHA 3Q8SB 1N5YB 3C6UA 3HVTA 5T14A 1S97A 1FK9B 4IDKB 4QWAA 1ZETA 4HYKA 3DOLA 2XGQA 3CJ5A 1TV6A 4IQXA 4IRKA
chains in the Genus database with same CATH superfamily
2ALZA 3BZQA 3POTA 2R9LA 4RW9A 1T9YA 1REGX 5H9EJ 3W7BA 2XMVA 2Z30B 3GR0A 5CQGA 2JH3A 4KSEB 1FKPA 4IG3A 3CDBA 4F0HA 1IR0A 4B3MJ 2XNQA 1TKTA 3SV4A 3OJSA 1FO1A 1D3WA 4DZDA 3MECA 1RK8A 2RAQA 1M90T 1PC5A 3CCVS 4RUCA 1WORA 1HNZF 2OPRA 4B3SJ 3KDNA 3DOLB 1BMQB 3HSGA 3U27A 4FBUA 2CUYA 2XYPB 3NS5A 4OMFG 4DX5A 4I2QA 2HNDB 4EWTA 3MI7X 1FRKA 3MEGB 4NLVA 4YDXA 3SSSA 3GIJA 1JNRB 4MKBA 2EKYA 4JV1A 1UW9A 4J9PA 1HHSA 2BJ7A 5KFPA 3X1LB 2HIYA 4J91A 3FMWA 4DR7J 1S5ZA 3LAMA 1RT4B 4OZJA 3WZ0A 4N7TA 4TLRA 1M5HA 3CIZA 4V19X 1SJRA 1GMWD 4OX8A 3KHHA 2FGCA 2GC8A 2IRUA 5AT1B 4ZP8A 3H5XA 4GKKF 3PXGa 2W9CB 2XYHB 1Y0HA 3THPA 2JEFA 4ELVA 4MKVA 3L7UA 4LFBF 1HIYA 5KFAA 3T41A 4D3HA 3I56S 2CJBA 1M5PC 2YNIA 4NZ7A 4FF1A 5A8KA 4QIFA 3MCNA 2BVZA 2R3VA 4X4PA 3CDAA 3AHPA 1UKUA 3EXYA 1QAYA 4CH7A 2YKMA 2MHEA 3DM2B 5EX3A 5L8RC 1X9SA 1SBRA 4QWDA 5KFOA 2H4YB 3PW7A 4ILMA 3MOZA 2ZBQA 5LJ5Y 1JQGA 2J7WA 3FKBA 4KAIA 4U8VA 2CQ4A 1G7CB 5GADU 2MKHA 3W61A 2ZD1B 3N5BA 1FXDA 1QY7A 2FHMA 2IM2A 3TAMA 4DSEA 2IAJA 3QMQA 2QFIA 1TL7B 2OGUA 5ETRA 2B9WA 4CLYA 1UEKA 4NLTA 3D3CJ 5F9NA 3I5BA 1WACA 4KHRA 3EGZA 1WD6A 2YWHA 4DR4J 3C6TB 3QWPA 5KFFA 1FD2A 1S4EA 2IYGA 3I4PA 2HW3A 1V6HA 3TVKA 3DLJA 4KHMA 5A76A 4KPCA 2ZEJA 3BSCA 3UN5A 2CJ9A 2LP4A 1RAOA 3KHRA 2RKIB 4B08A 1N0VC 2QL5B 3IP0A 4OX9J 3FVYA 2HGNA 4OYXA 1XMOJ 3AODA 3K5PA 2ATCB 3SQGB 1K0VA 2XWYA 2V69A 2BANA 2WOMA 4B3OA 4ITSA 4USKA 1RHUB 1VIOA 1HMVB 2IVYA 2B43A 3FFIA 2HS3A 4DV3F 2HAIA 2VH7A 3DI6A 3ZFVA 3VAGA 4C97A 1PBAA 2OJ3A 3PNIA 2GVZA 4YDDB 1PILA 1UVKA 2OH2A 2ZH4A 1DTTA 3KLEA 1UZDA 1CPZA 1FVSA 2GA7A 3L9ZA 1PYSB 5HP1B 3HVTB 3A8IA 2DNKA 4LF4F 1ULRA 3A3NB 1U1QA 4BDPA 3S6EA 2J6SA 4C8LA 3D28A 2V5HG 4KV8B 2YWGA 2EC0A 2DGTA 1Z4UA 4KKOB 3T5KA 3M8YA 2DISA 4Y6IA 5IOLA 2KFNA 3KDOA 1NK8A 5A6WA 1B3TA 1UTAA 1RBLA 5KFVA 2C42A 1F3FA 1JJ4A 5FLXU 3DLKB 3F56A 1SJFA 2M9KA 4ZP6A 4RNMA 5MLCV 4H4OB 4LRCA 2BQUA 1HWJA 3CJ2A 4ZVUB 1YLXA 4HDHA 4NLGA 1RTDA 2H65B 2JC0A 2X1GA 1FDBA 3C14B 4IRKA 1LXJA 2RF2B 3KK1B 1K1QA 1UJ4A 3WC0A 2B56A 3T6JA 1RKJA 2MSSA 4DV1J 2RNEA 1TU0B 5D4NA 2CZVC 3VCDA 2ZOFA 4LF7J 3NGKA 3NNAA 3UN2A 1O0PA 4PYAA 3TUIC 4OYZA 2FLNA 1RAHB 4NASA 1S49A 1H2TZ 2CQ0A 4Z37A 4ED2A 1Q8BA 4B17A 2AT1B 2EBGA 2R7RA 4PWDB 3K8VA 5A2QU 2ATLA 5L1LA 1X4DA 3CNQP 2M5YA 5KG4A 4DN9A 3BYRA 1T0TV 4QJVA 4E2FB 3RAMA 4RKUC 3SZ2A 2QA2A 1NK6A 1FKPB 5CYQB 4NRTA 3KK2A 4OYAA 3T9ZA 4QWBA 2ZVSA 4E8UA 2R2TA 1KR4A 2RS8A 4RUHA 1ZTTA 3U7JA 3Q8RB 3K0JA 2DY9A 2P9GA 3NMRA 2N7CA 2I38A 3BKFA 4JI4F 1C4AA 2OPRB 4IFVA 2OUGA 1Y7PA 4DJBA 5B0GA 3IN5A 4MAKA 1RP5A 1N5SA 1GXTA 4I2QB 3ZZZA 2CG4A 1XNRF 2UZAA 1OSDA 2ZWPA 4LF9F 2R8GA 2A1BA 4MK9A 5GVQA 2UXCJ 1PCAA 3KMSA 3O44A 4EO8A 2VFSA 1WWHA 4ZITA 4X4TA 3VAIA 4OZLA 4GKJJ 4QW8A 2VFUA 4OFZA 2HQCA 3LP1B 3EVMA 2VOOA 4H4MA 1KD1T 4IUFA 5HBMA 2N7YA 5D3GA 3M1VB 3DXBA 2FJEB 2JSXA 2DXDA 4LRDA 2I1RA 4RZRA 3QZ7A 2AJFE 2HQGA 2DPJA 2H9ZA 3M7VA 3VALA 1P9QC 3TUJC 1Z2ZA 1CG2A 3KUHA 3NWRA 5BR8F 3MMCA 3KKFA 3I55S 1QE1B 5F8GA 2QRRA 3RTVA 3P49B 1HBOA 2BE2A 3I96A 5IC4B 1X0FA 3HVWA 1R8HA 2YNIB 2DJWA 3VQTA 4EUVA 3SI8A 1FDAA 1VOMA 5A8KB 5F8IA 4USTA 5A2QY 4M5DB 4EBEA 2O5DA 5DRKA 4M5KA 4R8UA 3PFOA 4OL8A 1X4CA 1S6QB 2V8DA 4MYUA 4ZP9A 2QEXS 1HWIA 3R97A 1AYEA 3SCJE 1FKOA 1ACMB 2AGPA 3CJSA 2UV8G 4DV4J 5A0YB 1DTQA 2PO4A 3MPDA 3QLHA 4MK8A 3TAMB 1MMNA 4EBCA 3TYTA 2IAJB 3CDEA 2XY7A 4DR1F 4DEZA 3SXLA 4DL3A 1ELOA 3QRRA 2NREA 1JLFA 3QJLA 1S0MA 1WOSA 2FVQA 2RS2A 5K9FA 1RWKB 4B9TA 3N6LA 1JIHA 2E5IA 2FLPA 1Y5IB 1RAIB 4MH8A 1OWXA 3ZZRA 2K2PA 3K58A 4TU8A 4AFFA 1TL4A 4DN0A 2AQ4A 2AW0A 3OL7A 5IT4A 2Q66A 5E5NA 3GJQB 1S0OA 3H98A 1UJ6A 3T6BA 1IKWA 2IJFA 1TFWA 2VF3A 3N6MA 4KHPF 4OYMA 1U1PA 4CO0A 2IDEA 2WOMB 4B3OB 4Z7YA 1EKSA 2E1AA 1FDNA 2XHCA 2YPYA 4I6YA 3FFIB 3QT5A 2UUCF 5GADI 3VGSA 2OLWA 1H73A 4DQIA 2GVZB 4Q43A 2F4VF 3KNAA 3ET6A 4LSLA 2MTLA 4NLWA 1T9XA 1NZ8A 2GAHC 3G8TA 1DTTB 2ZH2A 2R7VA 4LRFA 3KLEB 4DR6F 4DV7J 2DRAA 3R5BA 4F04B 5E0OA 4NYZA 1GX5A 4DSJA 3B54A 1YSJA 3I5AA 2F1FA 3R7BB 4OLPA 1WSVA 2NPFA 3L7OA 4ECYA 1WHYA 2P9CA 3OFEA 2FD2A 3A8KA 4QWAA 3TJAA 2W4PA 4X4NA 5L46A 2MSTA 2FVSA 1IM6A 1VQOS 4A8MP 4PUOA 3SFGA 4CO4A 3MURP 4LRAA 2NR0A 2CJAA 5D0GA 2MZTA 5DQGA 2F40A 3JSMB 4ZDNA 5F8LA 1N4LA 3S01A 1GXUA 2DGSA 4WTYA 4G6VB 4R0JA 5IQ6A 3IGVA 4FYWB 1HNIB 4DFMA 4B3MF 3IA0A 5KFHA 3RZAA 4USIA 4DFJA 2L08A 1XNQF 4KH1B 2GMJA 3EPGA 4DPOA 4OZ5A 5LT5A 3CD6S 3KLIA 3IMQJ 3C19A 2NSBA 5L9NA 4F4ZA 3H5YA 2VD3A 1OMSA 2CZ4A 4HH0A 4RUBA 3BGOP 1UEVA 5FD1A 3UE2A 2OMLA 2CPYA 5DZ7A 2QLFB 5BYSA 3HJFA 3KJVA 2WTFA 4DR2J 3QBCA 1M0SA 1XR5A 3MCMA 2HZVA 2CFXA 2M7SA 3CCRS 1HHTP 1SQFA 3OUYA 4K4XA 3Q24A 3TX0A 3OT9A 3PJWA 2FZGB 4HTIA 4ZLJA 2CPXA 1NAQA 3KK2B 1TKXA 4FF2A 3CIMA 3QJJA 4LUBA 1FESA 4KGKA 4P7VA 2DIVA 4M5IA 4DLEA 1H98A 2A2DA 5KFLA 5KFYA 1UCNA 1YX2A 1YJWS 4OX6A 4IFVB 4LSNB 2JJ4D 2AJ2A 2VKRA 2HQIA 4RW8A 2LYVA 4PQAA 3P45B 2R7WA 4ZPAA 3BF4A 2Q3PA 3VWSA 1QD1A 3MUMP 1TP7A 3KLHA 3OPKA 1CSJA 3ZTQA 1U4BA 5JVGQ 2M70A 4XPEA 4DSIA 3R2DJ 3CO0P 4PXBA 3J81j 4CYUA 2G1DA 1SIZA 1DQ9A 4DX7A 2XNRA 4J9MA 4X4QA 3KNGA 1S6UA 4H4MB 1H74A 2E44A 4JI6J 3FC9A 2ZH1A 2HVHA 4K50A 2B6AA 4DG1B 4GC7A 1JLQA 1S1WB 4DL6A 5M2PA 4DPWA 4WFXA 1FKAF 3EXCX 1UA0A 6FD1A 2YQ0A 3PG9A 2ZH8A 2DEJA 3MTKA 3GIMA 2MB0B 3GILA 3MUVP 2Z58B 1HBOB 2BE2B 2XZTB 2E5HA 5ETNA 3WX8A 4FYYB 2FHJA 5KFRA 4DR4F 2LDIA 1FE4A 2YXLA 2C22A 3N01A 2ASJA 3PM9A 2XMTA 1S0NA 1AFJA 1HW9A 4ZCLA 5HMXA 4F3OA 1R27B 2B5JA 1IR2A 4R8UB 3Q2SC 2BUNA 2DBBA 3FQLA 1NDCA 1JKHA 5E3RA 2ZBPA 1C0TA 1KTQA 1DJ0A 2CVIA 2BE7D 4NWBA 4OX9F 2FJVA 3QIPB 1U2RA 4CM0A 2EFOA 3RAXA 2DR5A 4OZ0A 2BQ3A 2P6SA 3OXLA 4DI6A 2XTJP 1DTQB 2DD8S 4PCQA 1S1UA 4RW6B 1UL3A 4KIAA 4Y2CA 3SCIE 4ECRA 5J1EA 1NK5A 4MJKA 3N4WA 1VQMS 2A2CA 3GV7B 2G0CA 2W7AA 2IC3A 3ENAA 1JX4A 4DQPA 4DF4A 3G2XA 1FTCA 1PBUA 2YQ3A 5EDWA 5DO2A 3TJ9A 3TEHB 2RUSA 1QUPA 1ZH5A 1R0AA 1O51A 4EBDA 4QU7A 1IKYB 4YMEA 3GZ7A 3S1TA 4FF3A 2XS2A 2KZZA 2R8JA 2CZ9A 4A8QA 2R7XA 3NLCA 4X65J 1OYEA 1RTZA 1IKWB 4FNHA 4HEA9 4YB1P 3RB6A 2YKNA 1NK4A 5IWAJ 4KB7A 1Q4RA 2IJRA 5HVGA 2C3PA 4HACB 3KK3A 2Z8QA 2BJ8A 3U1NA 3MM9A 4QIGA 4P2FA 1T02A 1YK9A 1YJNS 1JJCB 1ZA1B 2FZKB 3BEGB 1U47A 1S97A 2DGXA 3ULHA 3U1MA 4IQXA 1BY9A 3FBFA 2X51A 4ES1A 4IOBA 3CMAS 3NEKA 1QSSA 1FERA 1U1NA 2P9EA 4C9DA 1KQGB 2BKOA 5F0WA 3H4DA 1SB6A 4KGMA 3PEJA 4OV6A 3CDWA 3ILLA 4YHHJ 1Y00A 3CEDA 4NMXA 5DLFA 2Q43A 1PGZA 2WSFC 2WSEC 2X1BA 4K4YA 2WVEA 2IPOB 5KFIA 4WFNQ 4M5LA 3AD8C 4X4VA 3K59A 1SC4B 2L9DA 4PUOB 4QPXA 3C15A 3CCZA 2RQMA 4LFAJ 1X31C 3W5ZA 2MY7A 3RU0A 3H40A 1BGXT 2ZOGA 3F44A 1Q8KA 3DDKA 2BJ1A 1G4CA 2VDHA 3KJNB 4J9UE 2PEBA 3CD0A 4C8NA 2Y8YA 5CCLA 2OI2A 4KO0B 3R1LA 4PPZA 1Q95G 3ZO7A 5A8WA 4ED0A 2AP6A 2JLGA 1S4FA 3CCLS 4Q5VA 2LFVA 3MF5A 1YRTA 3H25A 2E7WA 1NXIA 1TAUA 2VBZA 5A8RA 4P9SA 1RISA 1GAOA 1OQ3A 2MQ8A 4ZCIA 3GIRA 2I0XA 1U48A 5ETQA 4C7QA 3AD9C 2J0XA 5KFGA 1IXKA 2EG1A 3KMQA 2HVZA 1R0CB 3T1YJ 2GMHA 2WAQD 2GO9A 1RHKB 5GAEI 2OPPA 2HBYB 3UCZP 4NL5A 4FVCA 2RILA 2O66A 1TK0A 4QW9A 3M8RA 4FXWA 3CJKA 1SL2A 3OUYB 5GMDA 4K7QA 4WFZA 4KPYA 3HVRA 3GCXP 2KYXA 1RAJA 4U6PA 1FD8A 4HR2A 3UQSA 3J7AN 1LNQA 4CLUA 3PYDA 1TKXB 1OY9A 1VQ6S 1RT6B 2YH0A 3WQPA 1DHMA 4UOFA 3RR7A 4TNOA 5RUBA 4RW4B 3KLFA 2EWHA 2WVFA 5AJ3J 2UVVA 2D1CA 1UFLA 2HFZA 2WVDA 2UUTA 2BRLA 3NAIA 4F2RA 1VHIA 4P72A 4RW8B 5CYMA 2WRMA 5L38A 3ZTPA 1T9WA 3G6VA 3KLHB 3HZEA 2W2QP 5E3PA 3KUGA 2HEKA 2MKCA 4UUXA 1WF0A 3L09A 4DV4F 3RBEA 4BCAA 1T3OA 2Q6BA 5KG1A 3QRPA 1GH8A 1FX4A 1YI2S 4OZ3A 4DPTA 1E6YA 2IY5B 4MT1A 4WU3A 1RAGB 2B6AB 4ES2A 1JLQB 8ATCB 1BXNA 2W1BA 2UUBJ 4EK2A 3MMJA 1UVIA 2LQ8A 1P27B 4C8OA 1RKIA 1RT3B 1W7WA 2PT0A 2HFOA 2YWKA 4HHUA 2MKJA 1XWLA 4ECTA 5C24A 2DR8A 5H1SV 2ZZTA 3NGDA 1BWEA 3MR6A 3OFHA 3QYYA 3VGVA 4C2MA 4EYHB 4O3OA 4ELTA 3LAKA 2QE5A 3IWXA 3RGIA 2B5JB 4DX8H 3V6JA 3SV3A 1JKHB 1C0TB 4GVBA 1FWLA 2MXYA 3RYLA 4ECXA 4I4BA 1S1UB 5U47A 1A7GE 5J1EB 4OI2A 2VPZB 3DYAA 2KJWA 1LWFA 1HYSB 2LEAA 5J2NA 2D3UA 5B0BA 3LF0A 1NHVA 4YOEA 3OLAA 1E6VB 3IM9A 1RYSA 3PJXA 1DURA 3BN7A 4L74A 4ZPTR 1X4EA 2E9RX 2JVOA 3MPUB 2FC9A 1U7LA 1FWKA 2UVUA 4M5HA 3CC2S 3ZZTA 4CZCA 1R0AB 4N77A 2CDQA 1C2PA 4DV7F 1WEXA 3FEYB 2MPUA 2HHSA 4CLSA 1N88A 2Y0SD 4M8LA 4JI0J 1ZETA 4ANCA 1AT1B 4OYIA 3IRXA 3M6XA 1JXLA 3OD2A 1N5VA 4I6WA 1GNKA 2I5JA 2YKNB 3M32B 1WEZA 2KT2A 1DLOA 1IN0A 1HWUA 2IYIA 1NU4A 1ZBTA 3H8YA 5HATA 4ALZA 2MQLA 3DMJA 2NUUG 1NK7A 1ZAVA 3A12A 1S12A 1FNOA 3MM9B 2HYIB 1X9WA 3S7RA 4HL9A 2GCFA 2W8KA 1RBAA 2BABA 2CQ3A 1GX6A 4PG5A 1S7IA 1S0VA 2GGPB 1T95A 5HJYA 1VRTA 5DLGA 1IUJA 4Q0BB 3TOQA 3AAWB 1FK9A 3DLLQ 5EN1A 2OAUA 3LANA 1UWAA 1HR0J 3BKTA 3N28A 4FZVA 1RZMA 2KXFA 4EO6A 4IO9Q 3EVWA 4KC5A 4DUZF 1JWWA 3CCWA 3DN9A 2FZCB 3WHIA 5I4MA 2IDLA 4HI2A 3MWBA 2VKZG 1JLGB 3VAJA 2PC6A 4FPIA 2KVIA 3C15B 2FDNA 1X8DA 4OI4A 2Z0GA 4O4GB 1U25A 4DFPA 2Y1RI 1JNZB 1M5OC 1IBCB 2VA3A 3CULA 2HS4A 1EP4B 1SL1A 4F2SA 5AE1A 1TELA 1U0HB 1RT2A 2ABYA 3HHEA 2NXCA 4RWXA 5A8WB 1IJEB 2W2NP 4CM2A 4G1QA 1FTRA 2VODA 4BHQA 4DUYJ 2LQ9A 3QT7A 5A8RB 3BDEA 1UVNA 3PRDA 5F41A 4ED3A 1U09A 2B8PA 2HWIA 1V9OA 5C42A 4HT5A 5HANA 2CJXB 2CADA 3VR1A 3Q8VA 3TRGA 4YEAA 4X4UA 3MAAA 3TZXA 4C8ZA 4G3IA 1OS5A 2PN6A 1N32J 3NGUA 1NSPA 3CJKB 1IKXA 3MGJA 3UCUP 1S9EA 1NJWA 1OJ4A 4Y34A 4HLBA 4ZVOB 3PYEA 1WC4A 3MZIA 5B0AA 4ID5B 3C3LA 3ZNUA 3D0HE 3W9JA 2H3EB 4DWIA 3Q8UA 3M05A 2MQNA 1TKZA 4EZ6A 4IKAA 4L72B 3KWMA 5M2RA 4QWEA 3RW7A 3KOAA 4NX9A 3VVUA 2V8GA 4K59A 1S1XA 1Q5VA 1FJGJ 2E1PA 1G6BA 1QUVA 2Z2MA 4K0KJ 4DPYA 2F65A 4ENOA 3HI9A 4TN2A 4USUA 3CC4S 4NYPA 4M5GA 5KFKA 1VQ5S 5CYMB 3GYGA 3K8WA 4OJ1A 4F0KA 3M2VA 4NCBA 3DOKA 4EU0A 4Y2AA 3W2VA 3J7Z5 4R0EA 1U1MA 2GJ2A 1LQ9A 2H5IB 4ZPBA 1R7IA 3MEEB 2R7UA 2AYMA 1SKUB 1NNDA 3PVXA 3MUTP 4MTPA 1FXRA 1E6YB 2PDAA 4F02A 3HFKA 4RPFA 3RUBL 3JXOA 4URSA 4LF5J 2V9WA 3O6QA 1X0PA 3R1HA 4WZQA 1LK5A 1VQYA 4WZMA 3OJUA 3CUNA 3GTYX 4ZKAA 2JDJA 2ILZA 3HHLA 2DGUA 3C46A 3NP5A 4I7FA 5DETA 2FY1A 4C4WA 5C24B 2Z4PA 4DV0J 3DLBA 1S79A 2H4WB 4CTAA 1VQSA 2H48B 2JL9A 1ZOTA 5GAHU 3UWTA 4KRWA 1IBLJ 4OYOA 4ZS6A 1SV5B 4HHHA 1IWGA 4LBPA 3NRBA 4NZ0A 1WOOA 1EJ7L 4YY3J 1KFSA 2A6MA 5IWAF 3OTOF 5CYJA 3VGUA 1XC9A 2EK1A 1EHWA 4X62F 1T8EA 2NZ4A 5F9LA 3MD1A 1DY3A 2FY8A 3GG0A 2JNJA 3W3SA 1UMJA 1TV6A 4ZP7A 1M5KC 4IH6A 2EW9A 1RA7A 3MEDA 2QV6A 2MHNA 2I8EA 2MKYA 2HWHA 5CD4H 2XCAA 4FPRA 4IG0A 4UOGA 1RB0A 3WX4A 5EX0A 1S1TA 3BH7B 4ZPDA 4WP3A 3SDEB 2BM1A 3QNWB 4OJ3A 2XM3A 4C48A 5EHHA 2XULA 1CBKA 4YHHF 4ZJLA 5I42A 2YTCA 3TVYA 2IRXA 3HDSA 2NLWA 6AT1B 3IRXB 1VQ7S 3EM1A 3Q2TC 4CLWA 3CCUS 2I5JB 1MU2A 1WF1A 4QZVB 1LKZA 2ZC4A 3DMJB 4GMKA 1M1KT 2XG8A 2E5LF 2LECA 2W2MP 1N36J 2HFVA 2RRNA 3ISND 1TMMA 2DRDA 3M30A 5KFMA 1XR7A 2MZRA 1ZA2B 4B3RJ 5M2UA 5HO4A 3TAQA 2CWKA 1T94A 2BM0A 2HK2A 3NMAA 3SCKE 4J37A 4K4WA 4KE5A 1WG5A 2N3LA 2ZDOA 3LPEA 4OZ2A 2ZJRQ 1VRTB 3NS6A 4ED5A 3MXHP 3ETOA 5LM7E 6FDRA 2C3UA 4ZIVA 4JI1F 1Q16B 1RQ0A 2RDJA 3JTPA 1AXQA 1A9NB 4LR8A 4J9KA 4P10A 3W66A 5F8JA 5J2MA 2D74B 3CJ3A 1SH3A 4AL7A 2ZE2A 4UZCA 1VQLS 3ZTRA 1JJHA 2V4QA 4MIBA 3UN3A 2LMIA 1EQ0A 3Q23A 1VI7A 2GV1A 1S6PA 5GAGI 1WJ9A 3T1YF 4KGVB 3OL8A 3SIPB 4XAKA 1UVJA 3W60A 4X2BA 4IYQA 3M6UA 3UO0A 2U2FA 4Z2XA 2OIHA 2QT7A 4HVZA 3HD1A 4ECWA 3M8PA 2WBRA 4LQ9A 4LBHA 4DV2J 4NOHA 2HBRB 2AV5A 3TZWA 1GTEA 4ERDA 5J1NA 5LXYA 4G1QB 3P5TL 3BPSP 2EK6A 5AJ3F 1OYDA 2VPYB 5HL7Q 2VBXA 2V34A 3BO3A 2NXJA 2HHPA 3LWLA 3PW0A 5HQ8A 2CNLB 3H5UA 3O2IA 2H5JB 2HHQA 1X5PA 3MM8A 3P8BB 1SC6A 2LDYA 8AT1B 1K8AT 3MAAB 1KTVA 2JLFA 1LW0A 1TZ0A 1VK8A 2R8IA 3T1HF 3T19A 1RWVB 3W5XA 1U6ZA 3J7A1 2Y1JA 1TL3A 1FA0A 4EYIB 4DPUA 3QGIA 2KXHA 2HHWA 4PWUA 4NCGB 3ZZUA 2B8QA 1FXLA 3LGMA 2UUBF 1UJ5A 2F9DA 2JEJA 1FI4A 2RVJA 4RW7A 1UWBA 2H5EA 4ATNA 4P52A 2BJ9A 2V8PA 1NBEB 1TKZB 4LMZA 3D0IE 1VHFA 3ICLA 2GFFA 1FNXH 3CJTA 1S1XB 2B9EA 5KFZA 2HHHF 3TA2A 3DRRA 5JXSA 2BQRA 1K44A 1YTYA 5ETOA 1AUDA 3TA0A 1TL1A 3M2VB 4YN3B 3DOKB 3MM7A 3NCPA 3UD5A 3W2VB 4C8MA 1IWAA 2AJ4A 2XO6A 4EGLA 2X7IA 2ZFHA 1TK8A 5HI7A 1OPZA 2YKAA 2N4DA 1HQEA 2CPEA 1YBUA 3N5FA 2B4VA 1RHMB 1UW4A 2MZQA 1LWCA 4ZLPA 4YQWA 4IO1A 4F4AA 1SH0A 1S72S 2APOA 4QQBA 1AA1B 3OTBA 3H0PA 1X7VA 2FVPA 1WC1A 3D1OA 3IAS9 2XYGB 2OP5A 1UPMB 2JC1A 3HHLB 3MMAA 3OVBA 2RD5C 1VC0A 3OV7A 1RADB 4USMA 3C6UA 1F9FA 5T14A 2HRTA 2MLXA 4DL0C 4LIWA 2YWFA 5IT9Y 2BJEA 1BQNB 3D9BA 1F60B 2YNHA 1NH8A 3KHGA 2YH1A 1EETA 3WBZA 4ED7A 3S8SA 2BJDA 1B0VA 2X3DA 2HMIB 3RBDA 3Q83A 1JXEA 2K06A 5B0DA 3ISZA 1L3VA 1KVKA 4ED6A 1KSPA 4QYRA 2HNZA 1PC4A 4EI2A 1YJUA 3GPAA 3VAKA 1AROP 5IM0A 4CP5A 4ZN1A 1EIYB 4Y2MA 3I0RB 2YBVA 3ILJA 1KLNA 4IH5A 5CCMA 4IG0B 1QSYA 4GO5X 2FJXA 3D3BJ 3VAMA 2QLXA 2DB1A 1TMJA 2V8VA 3C16B 4EFAC 2KTQA 4B3TJ 1WUUA 5I42B 1RWPB 1JB0C 3Q0AA 4LF8J 3RRGA 3Q22A 4GO7X 2BJ3A 3R5DA 1K9MT 3Q8YA 2FVRA 4CH1A 2PMHA 2CPJA 1WHXA 2J8AA 3V2UC 1NKEA 5E33A 5GAHI 1MU2B 1O6XA 2DNZA 2VBWA 2VV5A 2R2RA 1F6TA 4MFBA 2VC0A 3NAHA 2XQCA 2MYFA 3RRKA 2KM8B 4CLFA 3ENQA 5KFQA 4P71A 3TEGA 2R8KA 4PG6A 4BC7A 2AGQA 4A46A 4V19J 3GCWP 1VDHA 1JLCA 1CJUB 3B78A 2E1MC 3PO4A 2DH9A 2DXFA 2VICA 3AQOA 3IC1A 1KQFB 3KLGA 1N33J 2Y1IA 2RDIA 2V2KA 4UUWA 4JI2J 2AKWB 3VAFA 3Q86A 4PRFA 2HS0A 2F63A 4DUYF 4BWJA 2WK4A 2ZNZA 4RNNA 1GTHA 4YR3A 4C8YA 3MMBA 3V4IA 3VZHA 5J2MB 4J9OA 4YUDA 2W2OP 4UT4A 1X5TA 2P8IA 1LW2A 4C3MA 3TQEA 1B99A 3K89A 1ZTWA 1N32F 4Y00A 3CCQS 1SXLA 3I31A 2M4MA 1J5EJ 4URGA 1CS4A 3M8PB 2V63A 1MLAA 3IR5B 4RU2A 5SUHA 2KJVA 2A18A 1FEEA 1WKLA 1U6FA 1RT1A 2VG6B 2GHPA 2HQFA 3VQSA 2OSRA 1HBMA 2VQEJ 4A8OA 3CC7S 3OBIA 5I3PA 1FJGF 4NXNF 2K1RB 4K0KF 1YBTA 2ZWOA 1IVZA 3AT1B 3ZZYA 2Y9HA 4FYXB 4FDFA 1RTHB 3F73A 4ZMMA 3V6HA 2B51A 1Q7YT 1SVDA 3PEHA 2QA4G 4JI7F 1LW0B 4DPXA 2W25A 4EMDA 2D3O1 4NLRA 2VG7B 3DLGA 2J0WA 1TL3B 2RHQB 1DQ8A 1OIAA 1F2HA 3IG1A 3QPIA 5J1PA 3G96A 4DR3J 3MAQA 1WKKA 2RHSB 1SJ3P 4HHJA 2W7OA 7FDRA 4LF5F 5G4DA 1NUEA 4Q8EA 1CJVB 1ZM3A 3OHAA 4RW7B 4O3SA 1KS2A 1X4HA 3V81A 1HD1A 2OFGX 1B4SA 4B02A 1K73T 3TANA 3FGVA 4B9MA 1VR6A 1RA6A 3CSKA 4DV0F 3P96A 2V4JA 1NDKA 1KHVA 4ZJOA 2OD6A 5HQMA 5D77A 2FVCA 1IBLF 2YNFA 4CWBA 4DBQA 1P9YA 1PYOB 1VBXA 3W65A 2C3YA 3DHXA 4YY3F 4C11A 4JYAJ 2ZDPA 2PFDA 3SCLE 3EE3A 3JTNA 1H7WA 1NPKA 5E3CA 1T7PA 3CMQA 2ASDA 1HQEB 3KHLA 5E3QA 5J2PA 2QSFA 2HURA 4WPAA 1LWCB 3MR5A 1IBKF 4I1TA 4YB5A 4DL7A 2ASYA 4ILLA 5CABA 3SFUA 2Y1LB 4J9QA 2HNYA 2QLBB 2J9DA 3E51A 3C6UB 3DCAA 4PQUA 3IR6B 4LR9A 5HVHA 1L3TA 4HKQA 3UI3A 3J7YI 5KOXA 1J5OB 2ZZNA 3KG4A 2DCLA 4L3KA 1HNVB 2YNHB 2CQGA 4KH0B 2DT9A 3W8GA 4PEOA 2GVDB 1FF2A 5F0UA 4XDCA 1F5BA 3IWLA 2MKIA 1HPZA 2HNZB 2DGQA 1HD0A 1MWZA 1N36F 1YG0A 1I1GA 3QO9A 1HI1A 3TX8A 4AXJA 3DXSX 2B9YA 1SH2A 2B4PA 5KT3A 3NGRA 2F7VA 2BACA 4OYPA 1R31A 2D69A 4ES3A 3QRQA 1KLMB 1SL0A 1TFYA 1H2VZ 1R8CA 4LJMA 3WC2A 1NRKA 3O1LA 5BJRA 2MEWA 4UOHA 5ETTA 3E01A 4KJIA 1HBUA 2V2ZA 2W2PP 4ID8A 2F8HA 1S99A 1FE0A 3W2WB 3BJYA 3IBCB 1A6LA 2CQPA 5KFJA 5KG6A 5DJBA 2QA1A 3FCVA 1KEKA 3BR8A 4O0IA 1PAEX 2VG5B 1SJ4P 3FSYA 4M5MA 2V0NA 4W4MA 4JI5F 1OY8A 3KG0A 3HKWA 2V68A 1NO8A 3PX4A 1JXVA 2XMJA 1HQ2A 3EMTA 2F9JA 2OTJS 1JLCB 2QLWA 2RDDA 1VQKS 4A8YA 5KFXA 4I68A 1ZM2A 3Q89A 3KLGB 3JSYA 1W2BR 4Z7CA 2W9BA 2MZ1A 1RT5A 3G6ES 1NM2A 1HKAA 2QN6B 2Z2ZA 1RTIA 3MDFA 3MMBB 3PDNA 5LL6d 3V4IB 2ZITA 3NBPB 1ZYQA 2QSWA 4RL1A 2MZJA 2D9OA 4V1Ak 3PKYA 1VIXA 1AW0A 1MROA 4I2PA 2VZ9A 4LFCF 1RABB 1YQHA 4WXOA 3RBZA 3ITHA 1K0TA 2IHR1 2R7SA 3EDRB 3OVSA 3IO1A 2QO3A 4WKRA 2QZ8A 3G4SS 2RJZA 1Q79A 2W4DA 4WIIA 1CS4B 1NHKL 3ZZ0A 3CVKA 2HHTA 2HFSA 4DSKA 4WK1A 3CJQA 4JBCA 1T03A 1WC3A 2AEJA 2C2ZB 1LWXA 1RT1B 2YX4A 2CKWA 3ZTSA 1FJ7A 2YQ1A 4ZIWA 2KZMA 1QLNA 2M8HA 2EI5A 3GIIA 5CXTA 3MR7A 4A8XA 2K7JA 3POTB 4RW9B 1LWEA 2HZAA 3TI0A 2DHGA 3OL6A 3C66A 2HPUA 2B9XA 3OFFA 3RJMB 2V67A 1U02A 1U2CA 4IG3B 3IAM9 1BUXA 5FDLA 2CPZA 1XERA 2DNGA 3U1LA 2L9WA 3W64A 5DG8A 2XSFA 1TKTB 3D2WA 4B9VA 5CZVA 1L5UA 4J90A 3MECB 2EG2A 4N76A 3D4JA 2M3DA 2IIHA 2XY5A 3DLGB 3CJ0A 5ETLA 5E2QA 3IG1B 1S9FA 1JK9B 3PR5B 5KTQA 3PX0A 5DGBA 2K7KA 3NOGA 2VQFJ 4USVA 1S1VA 3BGLA 3DGVA 3H90A 4MIAA 4NA2A 2YNGA 2ZBIA 4P75A 1Q0NA 4TU7A 2XGQA 5CD4A 4DZ6A 4RR5A 2CPFA 3SMZA 2M8DB 4LVNP 1HNWF 3FRZA 3B4DA 1N5TA 2V4JB 4C0OC 4DSLA 5KG3A 4CDIA 3TQ1A 2HZCA 2BR0A 3JQMA 2YNFB 3FNNA 2XC9A 5KFSA 2EXUA 4K4ZA 5FIIA 3IS9A 3R9LA 4X64F 5LOQA 5B0CA 3J81U 4L6V3 2BDPA 3H5SA 2RSQA 1XBWA 4C11B 2DNHA 1P1LA 5D0EA 4ZVTB 2DNQA 1WC6A 4JP8A 1TTHB 4KGZB 1RAEB 1LV5A 3VF0B 1IKVA 3UD4P 1B0TA 2VOPA 3LA0A 5J2PB 2UP1A 3I32A 1JLEA 1HLWA 3ZNJ1 1HQUA 3W9IA 1FHTA 4IOAQ 2POKA 1FRIA 2NQPA 3PHEA 4F4YA 2YKMB 4CQ1A 2W01A 3CD5A 3L95X 5BYRA 3AXKA 4C3KA 4M5NA 2HIQA 2BKPA 3AB2B 4PQUB 1SJ1A 4LF2A 3E8OA 2QL9B 3ZZOA 3K57A 1VJQA 4LF8F 4RUAA 3QWUA 2DNLA 2F8EX 3GSIA 3FBBA 3LOUA 4QWCA 3KJFB 3UR0A 4NLYA 5AE2A 4NMLA 1WEYA 3KUEA 1V5VA 4RNHA 4KQZA 1S7HA 3J7ZT 3P5BP 2UUAJ 2HNDA 1B0PA 4AE5A 2CXEA 5LSOA 2JLEA 1T11A 1HPZB 1N8RT 3FSXA 3PZPA 3GG1A 2XI3A 1GEHA 4N8NA 1UPPA 3QO9B 2YWEA 3H20A 3O3LA 2JRSA 1APSA 2GO8A 2LVWA 1PSDA 4DR5J 2OD4A 4O3NA 2ROEA 4OI1A 4ZVPB 2GS8A 3HMJG 2HRYA 3PO5A 3PKMA 3J81Y 4JI2F 1KFDA 3R5CA 4ZCKA 2W9CA 1IBMF 1P6TA 3OFGA 1CEZA 3J80Y 2BANB 4K5SA 1CQMA 3DNCA 4TY9A 1C1BA 3E01B 1HBUB 4UZBA 5EGYA 4PABA 3T9NA 3DHWC 4ZVEA 4X4SA 3CE8A 3HHNB 3MAHA 1UFKA 4FS1A 3DI6B 3I0SA 5T41A 4F3QA 2EPIA 4JI3F 4NRUA 4ECZA 2C28A 2HHVA 3GFZA 2X3GA 2DO0A 2PD1A 2QIFA 2GJIA 2L48A 3CJ8A 4IFYA 3QATA 3MHYA 1SKWA 2MZSA 2VFTA 3QSIA 1Y3KA 3ETMA 1D0EA 2UU9F 1REVA 4ZPWR 2FUG9 2CQBA 2ZD1A 2R7QA 2BW7A 2OMOA 5GAEU 2VPWB 1WELA 1Y4ZB 2IBOA 2W9BB 1TL7A 3A13A 3PY8A 3NGSA 1EB0A 1RT5B 1Q1KA 2FHJD 1RTIB 3QFHA 1FCAA 2CJQA 3RB4A 3CWJA 3E2EA 5DG9A 4U7UD 5T7LA 3C6TA 3KYLA 5E41A 1I6JA 3GR1A 4K4VA 3BBFA 1HFEL 1RTDB 2KRRA 2BYCA 1URRA 2RKIA 2AD9A 3GJTB 3QT8A 1SJQA 4JB8B 4UY85 1ROFA 2CG8A 4E98A 2V50A 2XCPA 1B7FA 4HH1A 1VC5A 4B3SF 2LQ5A 1D9AA 1B70B 1EQMA 1GT8A 3K5MA 4W98A 1ZPVA 2FQQB 3FEZA 4ZCMA 1RU2A 1RAFB 1HMVA 3PW4A 1X5SA 3HVAA 4YP3A 1T03B 1LFPA 2HKEA 5KFEA 4DR1J 3RRHA 1KOHA 1R8BA 3IFEA 2N4CA 1FNMA 2CA9A 2MQPA 1LWEB 4DR7F 2RH3A 2XS7A 5EUHA 3KJQB 3Q8SB 1U0SA 3HVTA 3LWMA 3GMGA 5E7OB 1UFWA 3OQ2A 4A8FA 4ZPVR 4JYAF 5ETVA 3BKUA 3W8PA 4KHPJ 2Z57B 4KKOA 2ZNYA 2C2MB 1TR0A 3FRYA 1D9FA 4F36A 3JB9k 2OPSA 1H2UX 5KFDA 4YR0A 1QAJA 4H4KA 4H54A 4WFYA 4B9SA 1S1VB 2Q6CA 2FJWA 3ISNC 5KFCA 2B0GA 2R2UA 2YNGB 2J6UA 3BQ2A 2DO4A 3BREA 5KFUA 3FZBA 4TQRA 2UUCJ 3JAMU 2NUHA 2DITA 1X5OA 2VUGA 3EVOA 4DOZA 3LP2A 1Q7LB 2F4VJ 5EWEA 2HGMA 1B7YB 5HBMB 3TR5A 2C2NA 3OTCA 5D3GB 2OTLS 1PJ5A 2HBZB 3H59A 4C6AA 2LXUA 4FNIA 4OYBA 3RW6A 3BQ1A 2HGLA 1VBYA 4DMZA 2P6TA 4G65A 5K8PA 3DKDA 5DM6Q 3NL0A 3MMCB 4TQSA 4WF9Q 1ZS6A 3R6LB 2AF6A 4LREA 1IKVB 3UFCX 1Y9OA 1N34J 5IQQA 4DL2A 1R8AA 3AB4B 3P6YC 4DU8A 3AH6A 5AXKA 1JLEB 4PWDA 4PWWA 1HQUB 3B6BA 4JUZA 2W9AA 3IXQA 2WHOA 3C8YA 2CNOB 4UQTA 4QR0A 3E3XA 4ZVGA 3W62A 1S57A 5CYQA 1RACB 3AFGA 1QAIA 1XMOF 1KDNA 1FKOB 2N3OA 3RB0A 3HPOA 1FFGB 1FFWB 2ZHAA 1XNQJ 3QLHB 1ZM4A 2M52A 3QAUA 1YITS 4A8WA 1R89A 3CJRA 2BV3A 3GSDA 2XHWA 3MPWA 4MYTA 1NJIT 1RYRA 1ZPWX 2HG4A 2HLUA 3FCWA 3O8WA 2OFHX 2JX2A 5B0FA 1JLFB 5KT7A 2HVIA 3M9NB 5ETMA 1UA1A 3JAMY 1EZZB 1ZZNA 3AQPA 4PPDA 3QGHA 4NPOA 4GC6A 4KY3A 3LP1A 3RB3A 1F5CA 2R42A 4WP9A 1TQLA 4JV0A 3KTQA 3FUYA 3HHDA 5KT6A 3M1VA 2UUWA 3QAEA 2WSCC 2IM3A 3NXZA 2LQBA 1Q5YA 5KAKA 4U9RA 3HKZD 4B9LA 2LA4A 2D3OR 1SPBP 4LIRA 1C1BB 1VCTA 3ZC4A 1F5AA 3DOMA 4DV6J 4CCHA 4ZVFA 1QE1A 4U7CA 5ETPA 5F3ZA 1RDRA 4XPCA 4AUKA 1U1RA 2ZJPQ 2AEMA 1AFIA 2DCUB 4F0MA 4C0HA 3TVZA 5CA5A 1ZAXA 1RE1B 3I0SB 4X84A 4M5DA 1OQ6A 5L1JA 2WONA 3EZ5A 1Q82T 2Z2LA 1OPIA 3IWNC 4K2XA 3EWGA 3ET6B 4LSLB 3K7RA 2XZDB 4P7TA 3BPDA 2EFVA 1V3SA 3H42A 4IFYB 1T9VA 2YY3A 3BYPA 3FBCA 4NCAA 2G4BA 1S6QA 4H4KC 2J6TA 3OVAA 3M6WA 3HT3A 5A0YA 3MTJA 2YVSA 3THTA 2UXBJ 4KT0C 4DV1F 1QVFR 1REVB 4RNOA 1L3SA 3OHBA 2RT3A 4LF7F 4JI8J 2HFUA 4F50A 2QL7B 1K47A 3OR1A 4OHYA 4F4WA 2DNMA 5H9FK 4P2MA 4DF8A 2WCXA 1CJTA 1I94J 2VDIA 2I2YA 3G6YA 2BA9A 2OSQA 2QG9B 1OSCA 2ADBA 4WU2A 1KBRA 4OJHA 4LQ3A 3LP0A 5T7LB 3A4TA 2BE9B 5IC6B 3TAPA 4W90B 3DLEA 1WI6A 3VAHA 4CRJA 3G82A 4OI6A 1CJKA 4LF6J 3ONQA 2RQ4A 2PMZD 3EJMA 3GFHA 4NYOA 2VB6A 5A6PA 1TL5A 1AUSL 5DQIA 5IFMA 5F8MA 1WF2A 3GLJA 2D3ZA 2WZ1A 1JLAA 3KLIB 2KRBA 2J5AA 3SBMA 4PKDB 2VQFF 5HSPA 3OTEA 4YB6A 1WC5A 4CT9A 4ANEA 1W26A 3CB4A 2NXEA 2UXCF 1EX8A 1VMBA 2JFKA 2FPHX 1ITPA 4DFKA 2BMBA 4DV5J 3QFWA 3CCMS 3KJVB 4D3GA 5HMWA 1NKBA 2W24A 1PJ7A 3I9ZA 2JEGA 2DIUA 4GKJF 3K5NA 2ACMA 3ILOA 4WE1A 2BRKA 4ECVA 4PG4A 4QIEA 4WIQA 1YVFA 3I82A 2C3MA 2CJKA 5K14A 3MCSA 1VQ8S 2AIRB 5I3UA 1VQ9S 3CCJS 2ZH5A 1GMWA 2HHXA 2KYZA 1RWUA 4N5SA 3WIUA 2GMLA 2OEMA 2YWWA 2E5GA 4JV5J 3CTRA 5HJXA 2VFRA 2OPSB 2A10A 1G1XA 3BSAA 2C2DA 2L41A 4N47A 4OQJA 4J9RA 1RWNB 1RAAB 2EFNA 4IR1A 3JSMA 4PYDA 4DU7A 1W2IA 2ILYA 3L7PA 3WIVA 2C3OA 4Q8FA 2E66A 3LP2B 1HNIA 5KT4A 5F8NA 4CYUB 1PG5B 2VJUA 3BBBA 3T3FA 4G1IA 3X3UA 1EARA 1YJ7A 5I3QA 1H6KX 3H2LA 5C2GA 3PACA 3BO4A 3SYZA 4KYZA 2DH7A 1F0XA 2UUAF 4WXWA 3LH2S 2JHEA 1XMBA 2DHSA 4N41A 1FDDA 3A8JA 1U1OA 2WVCA 1U8SA 1KHWA 5LJ3Y 1GMVA 4NLDA 3BN4A 2LQJA 2IRYA 3EUNA 2V8HA 1JLBA 2EFPA 2XZWA 2JFDA 4DR5F 1U6BA 3MOJB 1Y11A 2H51B 2BOAA 1I51B 3GFXA 4OHVA 3I5CA 3R7NB 1T05A 3TZYA 2GNKA 2FLOA 3H2UB 3AD7C 3BSNA 2DNNA 4AT1B 1N5QA 3HM9A 5D4OA 4R5PA 4L76A 2IC3B 2KHDA 5FLXY 4LSNA 2EBEA 3AOAA 3HZGA 3LGNA 2R2SA 4OZNA 2JWNA 4QBUA 4DCOB 4QOTA 4A48A 2KG0A 1KRPA 3MR2A 3M4XA 1LXNA 1LFWA 4N8OA 2X1AA 4ZVHA 1NJXA 2H1YA 4DL4A 1FWPA 1RJJA 4WYWA 2DGVA 2HQDA 3DRPA 2DXEA 1D1UA 3H2VE 5GAGU 7FD1A 2QYGA 1BD6A 5BYQA 4DG1A 1S59A 4F25A 3DU5A 1S1WA 5SZTA 3R6GB 4L3NA 4USHA 2XB2D 3B8HA 3KK3B 4M95A 3UCGA 1BHNA 1VLOA 4RBUA 3ADAC 2Z56B 3DOMB 2O1PA 2F8MA 5L39A 4P2SA 1VRUA 3NNCA 5D0RA 3B82A 4I56A 2W4CA 2KH9A 1V3ZA 2XS5A 2ZH6A 2WONB 3FJ2A 1WC0A 5IT0A 1S48A 4DS5A 5DGAA 2RQKA 3CXCR 3CO9A 3UD3P 2IBKA 1N5YA 1FRLA 4O23A 1PIEA 4IDKA 1R3NA 3QIPA 2YPZA 4MKYA 4ECQA 3K5OA 3EPIA 3CCSS 1R6YA 2B4OA 3N0VA 1NDPA 4RW6A 1TKDA 1RLCL 4YS2A 1IM4A 5H9FJ 1F1BB 3K17A 1PAUB 3OR1B 4USWA 3FK4A 3HHLD 2ZHBA 3GQCA 2QLJB 4DR2F 1CJTB 1QTNB 3L3CA 2AWZA 1S6OA 3RR8A 2H54B 4NE9C 1MNEA 2PA8D 4G1PA 4HYKA 3HFVA 2ZC3A 5HLFA 3LP0B 1U8WA 2P5VA 2J7KA 2O67A 3BBCA 1IKYA 2J8SA 3DLEB 1MW7A 1MSWD 5GMEA 3G82B 5DQHA 1CJKB 4P73A 4QIVA 3M2UA 3C2PA 2DVIA 4CLZA 5IS2A 4NA3A 1N0UA 2MKKA 2FC8A 1H0HB 2E1CA 4Y2IA 1JLAB 4HACA 2DRBA 3DGPA 3M9OB 4RO0A 1WDTA 2IMWP 2KKHA 2F4FA 2DNRA 4B9UA 2XLIA 4I67A 2IFXA 2G2YA 1NHUA 4DS4A 4Q2MA 2CRLA 3DDNA 3OTDA 3EZOA 3TUPA 3EGWB 2OPPB 3MM6A 1QSLA 3JS9A 4Y28C 2OO4A 4WE1B 2DKOB 4JI6F 3W63A 5F3TA 5K14B 1GK8A 2JVRA 1IQTA 2NPIA 3FEXB 5I3UB 4ZLLA 4QIWD 3HF5A 2AX0A 4MKAA 5ETSA 5D4PA 1Q81T 4DQSA 1K1SA 1U45A 1U49A 3ZTOA 3KLFB 2DHHA 4P6QA 2HRUA 4WTOB 3R5GA 1N34F 2WW8A 3PRVA 2PE8A 4CO2A 3SEOA 3KLVA 1YRUA 2AZ3A 1HL6A 3HP6A 2XWXA 3M2RA 2R7TA 4NXMJ 2HVEA 3P4UB 2XLKA 2CNKB 3HSDA 4KO0A 5AXNA 3G71S 2G1HA 4M63A 3TO8A 1NSKL 3PFEA 2NSCA 3FBEA 1DQAA 3M8QA 2ZKUA 1YJVA 3D54A 5HN0A 4USJC 3LO3A 1O5JA 4NLPA 4YB7A 2MGZA 2AJ0A 3EYZA 4X4OA 4IOCQ 3B4MA 1XEZA 1S76D 2C2KB 2FTRA 2LEPA 2SXLA 4EEYA 4DUZJ 4FXDA 2NYIA 5KT5A 3R5AA 3V4MA 5K8MA 2ZBCA 4A47A 1TVRA 4E0DA 4OZ1A 2AYBA 1LOUA 1RGVA 2BXJA 1SUQA 2ZBRA 1N52B 5J2QA 4AD6A 1JLBB 1YDLA 1DRZA 3HO1A 5B0EA 5E3AA 5CH7B 4X65F 1CVJA 1P8GA 3D66A 2VPXB 3D67A 3CJ4A 2DR9A 3OL9A 4GVBB 4FYVB 2D41A 1T05B 1RT6A 4RWWA 3FQKA 3CPWR 2AU0A 2CIMA 2CAJA 2LU2A 1KWMA 4RW4A 1IR1A 4DV6F 3UW1A 4R5PB 1NZAA 4F3MA 4DDFA 3V5RA 1D9DA 3DYAB 1XK8A 2R8HA 4OHZA 2COLA 1LWFB 1Q86T 5J2NB 1FVQA 2E5JA 4CLTA 2F3JA 5KFNA 1N6QA 1W25A 4OJGA 2R7OA 5F8HA 4ICLA 2PSZA 1RXOB 1DFDA 4BBYA 3GV8B 2KN4A 1HI8A 3BB5A 4W92B 1GFWB 3M9MB 1YIJS 5L9XA 1VQPS 3DRPB 2A0FB 1G3OA 2UXBF 5LMUJ 4AL5A 2ZUGA 4JI8F 4MK7A 3N6NA 1DLOB 2UXDJ 5HAOA 2V6AA 1QVGR 3G8QA 4PXCA 2VONA 4K4SA 2K8GA 4I69A 2M0GB 2HWTA 1UAWA 1I94F 1RT3A 4LFAF 4DQQA 4RBVA 4CO1A 1C1CA 2EEYA 1VRUB 4TVAB 4DX6A 4O44A 4LSZB 4HDGA 5D78A 1NEEA 3TW0A 5LXRA 5DDOC 2B7BB 3UDEA 1NJYA 4LF6F 3HX9A 2QMUB 4RU9A 2MJNA 1N5YB 1SQEA 5FJ4A 1FK9B 4IDKB 1KP6A 4FXVA 5LSLA 5CZXA 1PO6A 1WOPA 1NLKL 2IVMA 2HK3A 2CQIA 3HJVA 3QT6A 5GMKa 1HYSA 3GYNA 1E6VA 4OLOA 4DV5F 1V5IB 4DCPB 1U26A 2DY1A 2KFZA 3FSIA 1J27A 4C3LA 2J7UA 3MPVA 5AXMA 3MFHA 4TYBA 5IV3A 1P1TA 5HLFB 3PW2A 1R8PA 4ZLNA 1D8YA 3G87A 2VA2A 1RT2B 2CWXA 3MFIA 2M2BA 3BDPA 5IZHA 2IVFB 3N9UC 1WG1A 3M2UB 5B7WA 1Y10A 1VFJA 2NYHA 3R27A 3M32A 2ZM6J 3A3PB 4I6AA 4JV5F 2I6WA 5C25A 3OTOJ 3EZUA 4X62J 3DGPB 2MQQA 2LEBA 2AZ1A 4KGXB 3TA1A 2NS1B 5C42B 3BGFA 2WB4A 1U1KA 2J0QD 4J9LA 5JJBA 3LTOA 4WFAQ 3W5YA 4ZVRB 2ZZMA 5KFTA 2AJ1A 5IT9U 3MM6B 2FIUA 3ZZPA 3LALA 2GGPA 3GB0A 3HD2A 3ZXWA 4TYAA 1URNA 1IKXB 5D15A 3EDQB 4Q0BA 1NSQA 1S9EB 4X4RA 1KC8T 1RCOB 2ERRA 2QMXA 5DZ6A 1UZHA 1VRQC 4ZVQB 3M6VA 4PG8A 4ILRA 3Q8PB 3J7YU 3UDCA 2GW8A 2LKZA 1SIWB 4L75A 1YJ9S 2MKSA 1RBOB 2HAFA 1JLGA 3H7HB 4K4UA 2E7XA 1UVLA 4UY8T 5DDPC 1T3NA 4XIUA 2E5LJ 1XMQJ 1SC1B 4O4GA 4C98A 3M2RB 2FHOB 4DLGA 2GQCA 1VGYA 2YKOA 4FBTA 5CAAA 1HHQA 1EP4A 1RHQB 1XIQA 4LF1A 9ATCB 1U0HA 3LGHA 1ICEB 2GJFA 2XGPA 1YZ7A 2Y0BB 3ENVA 4NLXA 4ZHRA 3M8QB 2N82B 3VZIA 3DRSA 5KG0A 4O3PA 3PTWA 5KG2A 4F4KA 2V2QA 4J9NA 4FF4A 1FJEB 4K5RA 3VTIA 1FT8A 3DDIA 2MGZB 1YZ6A 4OI3A 1DARA 4JI1J 4XO0A 2MDAA 2JEIA 3PYGA 2KI2A 2GHWA 2XSJA 2BOPA 2XY6A 5L1IA 4ETZA 1NH7A 1MN9A 1TVRB 5L1KA 2HSEB 4I7FB 3BR9A 4YR2A 4CI0B 1XQIA 1SUQB 1U2FA 5JVHQ 5CHCB 1XTZA 4CTAB 5J2QB 3KG1A 1Y3JA 1FEHA 4KBIA 4JI0F 2V4RA 4DUTA 1FRMA 9RUBA 3D6MB 2PI4A 4HT7A 2AYEA 1X4FA 1C4CA 1RUSA 4O4RA 1VBZA 3RAQA 4ID5A 4O3QA 3CDUA 4DQRA 3ENWA 3V6DA 3UVJA 3QGPA 4ZA1A 5DG7A 4OX7A 2QTWA 2CQHA 5AE3A 1TV6B 3QQCD 4KFBA 4QPTA 2ZH7A 3HSJA 3KXDA 1NMEB 1WHVA 3MEDB 2FJDB 5G0RA 5BXIA 4URQU 2HQ3A 5DDQC 4NLSA 1N6QB 1HWKA 2FB0A 1S1TB 2EC2A 3CMES 1QDUB 3HK2A 2WW4A 4ICLB 1YGYA 3LQVA 1IJFB 3DFEA 4PAAA 1ZAWA 4NI2A 2VBYA 1HR0F 2FLLA 4KTQA 3MEEA 4NLOA 4FKXA 4Y2KA 3T1HJ 3NY0A 4J5OA 4EZ9A 2MLZA 1M5SA 3NWGA 2KXNB 2QX0A 4Y0FA 3D6HB 3GV5B 2YKPA 3AJ1A 4WBFA 4K2JA 3NGTA 3OSNA 1NJZA 4OYWA 2DTJA 2WB1D 3FMBA 4NZ6A 3PIPQ 1D8ZA 4NEZA 4S0MA 4AL6A 4UF4A 2HHUA 3FZ2A 3HULA 3T5HA 2KT3A 1C1CB 2BKNA 2DNOA 4F7VA 3BO2A 4ZPCA 3BQ0A 3M30B 2BZ2A 4O44B 3TJ8A 1QAXA 3O5TB 1WHWA 3PHTA 2HHHJ 2OPQA 4U67Q 2QJ3A 3GU0A 1DBDA 4BWMA 1VBKA 4I64A 1SV5A 2E29A 2ZJQQ 4UW2A 1XN9A 3H4BA 2OELA 2QC3A 2XMKA 4UQGA 2C2EA 1RWMB 2J9EA 4R25A 2RQCA 2G9OA 4F67A 4FS2A 4IQMA 2FHKA 1MMDA 4Q45A 1CLFA 3M8WA 1MWQA 1QTMA 4RBTA 3AOCA 4CH0S 2BEFA 2ZE2B 3AJ2A 3I9V9 1Q53A 4C0BA 3NCQA 3CF5Q 1S6PB 4TY8A 1MN7A 4U8YA 4WJBA 1NKCA 5HK4A 3BGRA 3MR3A 3LUYA 4CLLA 1BQMA 5HMYA 1S10A 3SDEA 1RTJA 1RWWB 4GVLA 4NLUA 2AEFA 1F3VA 2XI2A 4P74A 4F26A 5HVFA 1HNXJ 4M94A 2QGFB 3GJSB 1VQNS 3T1AA 1XR6A 5K8OA 2CPIA 4F8RA 3G86A 2MQOA 5C25B 1RHRB 2Y3YA 2G2OA 2Z2YB 1M1HA 3PJ9A 5C5JA 2AHOB 2HFNA 3HT0A 4ZN3A 1NPRA 3MM8B 4NXMF 3MEKA 4A4JA 1FRJA 3IR7B 2J9DE 3L4BC 1WTBA 2KDOA 4OHWA 1RSCA 2FYXA 4Y65A 3I87A 4CLPA 3BSOA 3GYXB 4A8KA 5LMNJ 3CGIA 4X66J 4O0NA 4U96A 4TU9A 1C0UA 3VGTA 3QIDA 2LU1A 2UVWA 2EFGA 3D68A 1UWBB 3MM5A 4CT8A 2NXNA 1U24A 2OEKA 3AA8A 3R5JB 2RIJA 2RRBA 4WFBQ 5K8NA 3A8EA 1LEOA 4ELUA 1B64A 1EKRA 1UETA 2ZHOA 3DRRB 2KO1A 1KQSR 4TKTA 3TNVA 1X60A 3IBWA 1TL1B 2ROPA 3BH6B 3MM7B 2EVZA 3ELHA 2FJBB 3D1QA 5HQLA 3IGNA 4WYLA 2VFVA 3P3DA 4NA1A 4PG7A 4ZHRB 5MAOA 3FDSA 1UVMA 2KVQE 3DRSB 1H72C 2CQCA 4JOUA 5THWA 2E1RA 3AJDA 3QSYB 3QJPA 2RE1A 2CVEA 2KFYA 3NOCA 2DPIA 2XSJB 1RWOB 2DR6A 2XEXA 4LVOP 1ZM9A 4K4TA 1RWXB 5KFWA 3MMAB 2NZCA 1JMTA 4PZVA 3GFYA 1Y5NB 2NXUA 5DS7A 3G8SA 4I0WA 1TUVA 1NK9A 2RU3A 1HBNA 1FJCA 4AQYJ 3GJRB 5C2CA 2LCWA 4Q44A 3UDVA 2XMMA 1YJTA 5LMUF 3OLBA 4AXIA 1EETB 2C1EB 2NCKL 4QYZK 4WCEQ 4NCGA 4WWSA 3M8ZA 4ZVSB 2UXDF 4IRCA 4XTTA 1R6VA 5AXLA 2G13A 3JYTA 3V6DB 3UVJB 3QZ8A 3CCTA 4JV2A 1L3KA 1KVJA 1ZZFA 5IM0B 4KFBB 1Z1ZA 5EWFA 4B3RF 2WVBA 4NXNJ 3A1YG 3GWCA 5G0RB 1DZ5A 2B7CB 1DAXA 2X1FA 2UV8A 1UP1A 5D6GA 8RUCA 3D1HA 2IJNA 2KU7A 1HA1A 1Q8IA 3FCHA 3K5LA 3AA9A 2QMWA 3GE9A 4J9VA 4JI7J 4NI2B 2BW2A 1HI0P 2G2ZA 2KT5A 5ITHA 1WSRA 2RUGA 3PX6A 3UNYA 2OKQA 1EAYC 3JQJA 4TXSA 1HNZJ 3KFWX 4PXEA 2A3JA 4QU6A 4L73A 1CC7A 1F9HA 2YX1A 2OHDA 2J9CA 4NEYA 4B9NA 1FFSB 1VS3A 3LPYA 3THVA 4MFBB 1JJ2R 2V2VA 3AOBA 1Q78A 1HW8A 1BWVA 5IXUA 4FP9A 4UTGA 2ZOMA 5HMZA 3PV8A 2ZH3A 2OPQB 3EGVA 3TARA 3TZZA 2G0IA 4DV2F 4XDDA 1BQNA 2F5GA 1A0OB 2RRAA 1BE4A 2EFQA 2CQ1A 2ASLA 4XK8C 4KR0B 4GKKJ 3QGGA 4GRSA 3K2YA 2ZM6F 1NSAA 5KOWA 2HMIA 2XBPA 3Q8QB 1TUGB 5ADZA 4LFBJ 1AZSA 4CLKA 4ECUA 3UPFA 4LRBA 7AT1B 4A8SA 4CNYA 2DGWA 1RT7A 1QJHA 3TP2A 1I5OB 3R7SB 2IMOA 1IBKJ 1LW2B 3I0RA 4PR6A 3OSPA 1OY6A 4TY8B 1L3UA 3DLHA 3BGRB 3DRXA 1CQNA 4CIOA 2KB2A 1BQMB 1KOOA 3CD7A 3W9HA 3RG6A 1RTJB 3C16A 2XO7A 4QR2A 2IM1A 1SCJB 2O01C 1TK5A 4DCJB 4FVMA 3M8SA 1SKRA 3JTOA 4ZOSA 2R4FA 3NKYA 1GQEA 1M5VC 2HLTA 3DC2A 1VQ4S 2CDRB 5LSRA 2GAGC 2Q1LA 3IM8A 3OW2R 2JOQA 1D09B 1HBMB 3T5LA 1Q8LA 2FGOA 2QFJA 2I9SA 2DNPA 2VIHA 2E9ZA 1XMQF 4LR7A 1CC8A 3A3OB 2DNYA 2ZVIA 4FYDA 5DDRC 1KKHA 1SKSA 4M1KA 1CJUA 1X4GA 3SSRA 4J7CA 1RU1A 4ZK7M 1VK3A 1YBAA 1LK7A 3G6XA 1FRXA 2XMAA 3CW2C 1HARA 2OEJA 3BM7A 2CPHA 5JUMA 3EICA 1WTFA 4TLQA 2CNNB 1VISA 2AYGA 4Q2LA 1SC3B 2LXFA 1T9TA 3AXMA 1C0UB 1I3OB 1KN6A 1UEUA 5KG7A 3NNHA 2VHGA 2L3MA 4DSFA 3MM5B 2GQ2A 2VC1A 3NCRA 4DV3J 4YFUA 2MQMA 3PYFA 1PJ6A 3V81B 5HROA 2KG1A 1F2GA 4HI1A 4WP8A 4DHVA 3BV8A 2AGOA 2MJUA 2C2OB 1KVIA 4JI5J 4K8RA 2O3DA 3OR2A 1CULA 2RU9A 4BLGA 1KNZA 2PIIA 2E9TA 1S9GA 3ILIA 4DL5A 4LF4J 1WI8A 3SQOP 4RJVA 3PW5A 3J80U 4AYBD 1YHQS 4BS2A 2W7PA 1V3RA 1BLUA 3U02A 1NB7A 3HHLC 3EX7B 4HTJA 1WKJA 1NPPA 2P2CB 3OXFA 5B09A 4CO5A 1NCLA 4OIXA 2VG6A 5D4LA 2LLZA 1FRHA 4LBIA 4RNFA 5C7PA 3RBXA 2U1AA 3BGUA 2K1RA 3D5MA 2BBEA 2VU5A 2G0JA 2VJVA 2HVDA 2PMWA 1RTHA 4WK3A 3JQKA 3CCES 1TAQA 2KL8A 2HNYB 5H9EK 5IV4A 2JZ5A 2DH8A 4LFCJ 4B3TF 1HBNB 2C2RA 2VG7A 1H38A 3R3TA 1KONA 1WG4A 4ECSA 4QYZJ 1KQKA 5JMNA 3DOLA 4PXDA 1U1LA 1FX2A 1BQXA 1M1GA 1MWYA 3WDOA 1Y5LB 1O8BA 3TWZA 1CJVA 3MEGA 1NK0A 1YRXA 5ETKA 2XMWA 4ETXA 4J9SA 4BC9A 3JYTB 4ED1A 2DEIA 3MPYA 2LXIA 1VJWA 4IH7A 4LT6A 3W1YC 1N56A 1SQGA 2RB7A 2DHXA 1RLDA 3OXGA 3DRYA 2A6OA 2XLJA 4O3RA 3G9CA 1RT4A 2YX7A 4RX6A 1N33F 4ANDA 2K3KA 2J76E 3DU6A 3PCOB 2GQQA 1VC6A 3JSRA 2B3TB 5DM7Q 2KM8C 2IA0A 2CQ2A 2K3IA 4CNZA 3GONA 2PA3A 1TUWA 4ED4A 3D6FB 4DXLA 4JI4J 1SI9A 4U7UK 1R0BG 1F9EB 1H3DA 2V94A 2GX8A 4Q7AA 3MCOA 2PI5A 2ZKTA 1XNRJ 4LF9J 2WBMA 3MD3A 2DHAA 3I4HX 3LW5C 4P2XA 3DM2A 3AY0A 4NLQA 1J2VA 3UNGC 2IA6A 1YKWA 3VVTA 2CYYA 1J5EF 1HNWJ 5KFBA 1J5OA 1RCXB 3HLUA 3HCXA 1WNEA 4QCLA 2GIQA 1HNXF 3F0NA 1HNVA 5B08A 5KG5A 4X64J 2Y8WA 1MG7A 2GVDA 2GIRA 1WDDA 2VL1A 1GMUA 3HXMA 5BR8J 2VQEF 4MIWA 4IRDA 3NS7B 1AZSB 4WKYA 1X9MA 1AB8A 1MMLA 2KHCA 1RT7B 1VYAA 1Z2LA 4FN5A 2QA4S 4FKYA 2ACYA 2MY8A 4UOCA 3UR3C 3F41A 2E7VA 4MMOA 1MROB 2BX6A 4I2PB 4RLEA 2D9PA 4ER8A 3ITHB 1G2EA 1KLMA 2M88A 5EWGA 1IQZA 5LMNF 4DR3F 3IRWP 3UDLA 4X66F 3D0GE 2Q79A 2LA6A 3PIOQ 1YWXA 2MLYA 2CPDA 3SQGA 3N79A 3T5JA 2VASA 3CT9A 3HFZB 1HWLA 2FJAB 3HHKA 3W2WA 2W8LA 2UVRA 2RMLA 1X4BA 2DYAA 2VG5A 3TUZC 3IBFB 2GZOA 2D7SA 2DGOA 1H7XA 3D6TB 4U95A 3GP9A 4ED8A 1XJWB 1R43A 1X4AA 2PEHA 5HP1A 2J0SD 2AJQA 4OHXA 3R8YA 2DK2A 5FDLB 3NG8A 4KV8A 2DR7A 3BS9A 2GHVC 1GXLA 1RHJB 1NDLA 4IR9A 1IBMJ 2ZUAA 2ROGA 4N56A 3EGNA 3DLKA 3VHQA 1NB2A 5D8HB 2HBQB 1VLYA 4H4OA 1PYTA 5K5MA 3NBPA 1OO0B 2PFFB 1BC6A 1N54B 5HROB 4F4XA 2QYCA 3GIKA 4JI3J 3V6KA 2V9KA 3HSZA 3JSBA 1QM9A 3SSQA 1T9UA 2B4UA 2L9NA 3C14A 4AQYF 1N48A 4Y3CA 2CQDA 3OR2B 1CULB 4CO3A 1S77D 2RF2A 4DR6J 2XMUA 3KK1A 1S9GB 3IS9B 2YKQA 3VV2B 4ZJQA 2ZH9A 3PR4A 3US5A 2UU9J 2EKNA 3I6PA 2AMCB 3PRBA 2AX1A 2PGCA 1YJRA 4OV1A 2CJYB 3R2CJ 4QR1A 5D0HA 2IM0A 5KT2A 5K20B 1RI7A 2ADCA 3D7SB 2GIFA 2ALYB 4OI0A 2MMYA 4M5JA 1PKUA 4C8KA 3CJ5A
chains in the Genus database with same CATH topology
2ALZA 3BZQA 3IRXA 3M6XA 3POTA 2R9LA 4RW9A 1JXLA 2CPFA 1N5VA 4FXVA 5H9EJ 4I6WA 3W7BA 5LSLA 1GNKA 2I5JA 3SMZA 2M8DB 5CZXA 2YKNB 3M32B 2XMVA 1WEZA 2KT2A 1PO6A 1DLOA 4LVNP 2IVMA 3GR0A 5CQGA 1IN0A 2JH3A 2CQIA 1HNWF 4KSEB 3FRZA 3B4DA 1HWUA 1FKPA 1N5TA 4IG3A 2V4JB 3CDBA 4C0OC 4DSLA 2IYIA 1NU4A 1ZBTA 3H8YA 5KG3A 4ALZA 2MQLA 3TQ1A 3DMJA 2NUUG 2HZCA 2BR0A 5GMKa 1NK7A 1ZAVA 1HYSA 1IR0A 2YNFB 3FNNA 2XC9A 5KFSA 2XNQA 1TKTA 5FIIA 3SV4A 3OJSA 4K4ZA 1FO1A 1D3WA 1FNOA 3GYNA 3IS9A 1E6VA 3MM9B 2HYIB 4OLOA 3MECA 1RK8A 4DV5F 4X64F 1X9WA 3S7RA 5B0CA 4HL9A 4L6V3 1U26A 2BDPA 3H5SA 1M90T 2RSQA 1XBWA 1PC5A 4C11B 3CCVS 2GCFA 2DNHA 3FSIA 4RUCA 2KFZA 4C3LA 2W8KA 2J7UA 3MPVA 2BABA 5AXMA 1P1LA 3MFHA 1FJGF 1HNZF 2OPRA 2CQ3A 4TYBA 3DOLB 2DNQA 1GX6A 1P1TA 5HLFB 3PW2A 4PG5A 3U27A 1LV5A 3VF0B 4FBUA 1S0VA 1IKVA 1R8PA 2GGPB 3UD4P 1B0TA 3NS5A 4OMFG 2VOPA 1T95A 1D8YA 4I2QA 2VA2A 2HNDB 4EWTA 3MI7X 1FRKA 3MEGB 5J2PB 1VRTA 2UP1A 5DLGA 1IUJA 1RT2B 4Q0BB 3I32A 3TOQA 4NLVA 3AAWB 4YDXA 1JLEA 3SSSA 1FK9A 3MFIA 3GIJA 3DLLQ 5EN1A 1JNRB 2OAUA 4MKBA 2EKYA 2M2BA 5IZHA 2IVFB 3BDPA 4JV1A 3LANA 3N28A 3N9UC 1WG1A 1HQUA 3M2UB 5B7WA 4J9PA 1FHTA 1VFJA 4FZVA 4IOAQ 2POKA 1FRIA 2NQPA 3R27A 1HHSA 2KXFA 3PHEA 4F4YA 4EO6A 5KFPA 4IO9Q 2YKMB 3M32A 4CQ1A 3X1LB 4I6AA 4KC5A 4JV5F 5C25A 4DUZF 3CD5A 1JWWA 3CCWA 3DN9A 3EZUA 3L95X 5BYRA 5I4MA 3FMWA 4C3KA 3LAMA 2HIQA 2MQQA 4HI2A 3MWBA 2VKZG 1RT4B 4OZJA 3AB2B 3WZ0A 4PQUB 1SJ1A 3E8OA 4TLRA 1M5HA 3CIZA 4V19X 1SJRA 2LEBA 1JLGB 3ZZOA 3K57A 3VAJA 2PC6A 4OX8A 3KHHA 2FGCA 2GC8A 3TA1A 2IRUA 2KVIA 2NS1B 4RUAA 4LF8F 3QWUA 4ZP8A 5C42B 3H5XA 2DNLA 2F8EX 2FDNA 3BGFA 4GKKF 3PXGa 1X8DA 2WB4A 4OI4A 1U1KA 4QWCA 2Z0GA 3LOUA 2W9CB 2J0QD 4J9LA 5JJBA 3UR0A 4NLYA 4O4GB 5AE2A 1U25A 4DFPA 4WFAQ 2Y1RI 1JNZB 1Y0HA 3THPA 2JEFA 4ELVA 4NMLA 1WEYA 2ZZMA 1M5OC 4RNHA 5KFTA 2VA3A 2AJ1A 4LFBF 5KFAA 2HS4A