2M8HA

Rrm domain of human rbm7
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
GSEFELRRQQALAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 7
publication title RNA binding properties of the human NEXT complex
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 13
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m8hA00
3ULHA 2LMIA 3CCRS 2UP1A 3ZZZA 3JB9k 1DHMA 4C0OC 2EK1A 4TLQA 2OTJS 2KI2A 4QPTA 5IQQA 2CPFA 3FEXB 2DNYA 3UD4P 2KYXA 2LA6A 4Z2XA 1KC8T 3HI9A 4PR6A 1S79A 1UW4A 2WBRA 1ZZFA 3MDFA 2RT3A 1X4EA 1VQOS 1BY9A 2DGUA 2LYVA 3UCGA 1D9AA 1JJ2R 2DHSA 2G1DA 1X4HA 3DLLQ 5DM7Q 5CA5A 2MXYA 1X4DA 2DNZA 4F02A 3SDEA 5EN1A 3HHNB 2G4BA 2DNPA 2L9WA 3CCSS 2EK6A 3L3CA 2ZJRQ 2KRRA 2EVZA 2B0GA 2CPDA 2DGVA 2AYMA 1P27B 2CQGA 1OWXA 3CCVS 2AYGA 1A9NB 2DO0A 1WF1A 2RS8A 2KM8B 1PO6A 4FXVA 2YH0A 3UWTA 4F25A 3VAKA 3PIOQ 1IQTA 3MUMP 3G71S 2MQOA 2RQCA 2FPHX 5CYJA 1WHXA 1K73T 1VQNS 3NS6A 3G4SS 3N9UC 1SJQA 5BJRA 2N7CA 4PRFA 3CCMS 2CQ4A 3MD1A 2DNHA 3CMES 1S72S 3B4DA 3MUVP 2LCWA 3EX7B 2MQNA 2MGZA 2MQMA 2HZCA 1URNA 1W2BR 2I2YA 2MZJA 1L3KA 1M5PC 2MSSA 1FJEB 3VALA 3B4MA 1FXLA 2AYEA 2XS2A 2M2BA 4CIOA 2ZJPQ 3BO4A 1H2UX 2MKIA 5DDPC 2LEBA 3I56S 3SDEB 3CCLS 2YWKA 2X1BA 1X4AA 2J76E 1QVFR 4TU9A 2KT5A 4V19X 2I38A 1YIJS 2MZQA 5D77A 1HA1A 2DGWA 3S8SA 2MQPA 2M4MA 3MUTP 2KH9A 4M5DB 2RRBA 2OSRA 2VODA 1YI2S 3G6ES 2E44A 4QQBA 3MXHP 2FHOB 2MB0B 1VBYA 1YHQS 1KOOA 2DH9A 2HGMA 5IM0A 3CMAS 2HGLA 1OO0B 1VQLS 2YTCA 1F9FA 3MOJB 5IFMA 2XNRA 2F3JA 2LKZA 4PKDB 1XN9A 2MZ1A 2CQPA 1VQ4S 3VF0B 1KOHA 4C4WA 2G0CA 2DNKA 2MQLA 2O3DA 3J7ZT 4WF9Q 2N3LA 1VC5A 2M7SA 4EGLA 2MY8A 1M1KT 1UFWA 1X5TA 2MMYA 5LSLA 1WG1A 1OPIA 4W92B 4P6QA 3IWNC 3R27A 1M5OC 2DNOA 2LQ5A 2KVIA 3CC2S 2JWNA 5GMKa 3CCUS 1H2VZ 1WWHA 2CQDA 5CXTA 1VQKS 3CD6S 1JJHA 3UE2A 1SJ3P 2DNMA 4ZKAA 5DDOC 3LPYA 4LJMA 1X4FA 2CQBA 2QA4S 1U6FA 3MI7X 1U1KA 4F26A 4OZ1A 2F9DA 2DGXA 2KG1A 1VQ8S 1RKJA 4IOAQ 3DXBA 5H1SV 4CH1A 1CVJA 1X4BA 5HL7Q 1HD0A 3VAJA 1SJ4P 1U1MA 5GAGU 1NJIT 1YWXA 4Y00A 4U67Q 4UY8T 2OJ3A 2M8DB 1D8ZA 1YJ9S 3BO2A 2KXHA 1JJ4A 2MKCA 2LXIA 2OIHA 2FC8A 3UCZP 5GADU 4TU7A 3BS9A 4RU2A 2NLWA 2ADCA 1WHVA 2M9KA 1DRZA 4ED5A 3H2UB 1FNXH 5LSOA 5JVHQ 1Q7YT 3PIPQ 2MPUA 2CQIA 2DK2A 3VAFA 3BO3A 2KXNB 2M52A 4C7QA 4WKRA 1VC0A 3NNCA 5JVGQ 2CJKA 1AUDA 2E5HA 1M5VC 2DH8A 2J8AA 3NMRA 2DHXA 3FEYB 2LXUA 1U1QA 2RQ4A 4CH0S 1WF2A 4OZ0A 3EGZA 2RUGA 2JVOA 3TO8A 2DITA 2DNQA 1U1RA 2MQQA 5ITHA 2N3OA 2FY1A 4IOCQ 5FJ4A 1YJWS 3RW7A 3NS5A 1VQ5S 1JMTA 2XS7A 2X1AA 1Q82T 2U2FA 1K8AT 3CC7S 2M70A 2A3JA 1H2TZ 3G8TA 3NNAA 1WI6A 1SXLA 2X1FA 2X1GA 1ZZNA 4TU8A 1SJRA 4CQ1A 3CC4S 2OSQA 3CCES 2YKAA 2K3KA 1U2FA 3OW2R 5GAEU 4YOEA 1WHYA 2QEXS 4WIIA 2CPIA 2CPHA 3Q2SC 1B7FA 2DGTA 2D9OA 3P5TL 1FJ7A 4WCEQ 2CPYA 3CUNA 1DBDA 2MYFA 3NNHA 1WTBA 3G96A 4LMZA 2BZ2A 1HL6A 4W90B 1FT8A 5DETA 2JVRA 2MHNA 1RK8A 5DM6Q 4Y0FA 2MZRA 1U1PA 1VBZA 1A7GE 2JRSA 2M88A 3CPWR 2HGNA 3J7YU 1FHTA 2VOOA 2D3OR 3U1MA 3CULA 2MGZB 3Q2TC 1R8HA 1WG4A 2DGOA 1X5SA 1H6KX 1NU4A 2YH1A 4WFAQ 2SXLA 1VQMS 4WFBQ 3CXCR 1WI8A 1X4CA 2CQ1A 5GAHU 2RU3A 2DIVA 2N82B 1UP1A 2DIUA 1DZ5A 2BOPA 2CQ0A 2DNLA 2E5IA 4QU6A 2DB1A 2ERRA 2DH7A 1QVGR 2E5JA 3VAGA 3P3DA 1VQ6S 3US5A 3SXLA 1KQSR 4YB1P 1OIAA 2DNNA 3MD3A 1N8RT 2CQCA 5GVQA 3CCJS 5LJ5Y 3G9CA 1M90T 2MZSA 2DGSA 5LXRA 2KXFA 2AYBA 2GHPA 5IM0B 2CQ2A 1WF0A 2GO9A 2V94A 1PGZA 1N88A 1WEZA 2AD9A 1U1LA 2PEHA 3THPA 2MJUA 4WFNQ 3S01A 5DDQC 2DO4A 2KG0A 5MLCV 3P49B 5D78A 3R1HA 2CQHA 2QFJA 2XSFA 2KHCA 1N52B 2CQ3A 2L08A 1ZH5A 1Q86T 2RNEA 3I55S 1X4GA 2HYIB 3TYTA 4A8XA 4LIRA 3CF5Q 2Q79A 2K8GA 2DNRA 3MURP 1YTYA 1WEYA 1U1NA 1FJCA 2MKJA 3LQVA 2L41A 2RRAA 2XS5A 2M0GB 1Q81T 1WHWA 3SMZA 2DHAA 4UQTA 1U1OA 3IRWP 2CPEA 2JX2A 2KU7A 2FC9A 1SJFA 2J0SD 3THTA 1R8PA 2CPJA 1VQ9S 3BEGB 3S6EA 2MKKA 4YUDA 2CPZA 3V4MA 2MSTA 2D9PA 2CPXA 2DGQA 2MKHA 2KFYA 2VOPA 4FXWA 1HD1A 2F9JA 2XB2D 5LXYA 1NO8A 2ZJQQ 2J0QD 3VAHA 3TP2A 2PE8A 3ZZYA 1YJNS 1U6BA 2DISA 3K0JA 4IUFA 2MJNA 2E5GA 3CTRA 2MZTA 2DNGA 1KD1T 3R1LA 1X5OA 2XNQA 3VAMA 1QM9A 2M8HA 3UCUP 3VAIA 1G2EA 2KN4A 3RW6A 2MKSA 2RS2A 2LEAA 3G8SA 2KRBA 4J5OA 2LA4A 2MY7A 3EGNA 2DHGA 1WG5A 1K9MT 3S7RA 1WELA 1UAWA 1YITS 1WEXA 1VC6A 4ERDA 3UD3P 1X0FA 1VQ7S 5DDRC 3CCQS 2LECA 1FO1A 3D2WA 1VBXA 1M5KC 3H2VE 2KM8C 2RVJA 1N54B 2OTLS 1P1TA 4BS2A 1O0PA 4QU7A 3P6YC 5LJ3Y 1VQPS 1X5PA 2ADBA 5HO4A 2VONA 2NZ4A 2HVZA 4IO9Q 2U1AA 3U1LA
chains in the Genus database with same CATH superfamily
1F9HA 1UFKA 2QLBB 2OTJS 3F0NA 1FE4A 2DNYA 4J37A 4TQSA 1N33J 2VDHA 4PR6A 2E1CA 3R7SB 2XGPA 3Q8RB 2B7BB 2R2TA 4WU3A 1YDLA 4JI7J 1W26A 5BR8F 2B6AA 1XNRJ 3ZXWA 4URQU 4E2FB 4JB8B 4JI3F 2HLTA 1CQNA 4U7CA 1PYTA 3KJNB 4CM0A 4DL4A 1CJTA 3VTIA 5KFJA 3D1HA 1H3DA 4LF8J 2AKWB 1RHUB 1S72S 4ZPCA 3EX7B 5HI7A 2HZCA 2W4DA 3KK3B 4DF4A 3VALA 1FXLA 2KFNA 2WTFA 3NGDA 2NS1B 2VA2A 4RUAA 2BE2A 4NOHA 4WE1B 1XR6A 5KFBA 1MU2A 1RTDA 1WKJA 1TL3B 2XMMA 4DI6A 3TJAA 4PWWA 5CD4A 3A1YG 5D4LA 1AXQA 1KP6A 1DJ0A 3MXHP 3KLFB 4B3OB 1T3NA 3OR2B 2DVIA 3MEEB 5IFMA 3FRYA 1P6TA 2ZBQA 2NXJA 2ZH3A 4NE9C 1Q53A 1VIOA 4ZVUB 1Q79A 2GIQA 2KL8A 3N5BA 1O6XA 2FGCA 1XTZA 2QZ8A 3IGNA 3IWNC 1M5OC 3R5CA 2KVIA 2HFOA 3QWUA 1UA1A 1YRTA 1ZS6A 3JYTB 2R2SA 2DNMA 4HDHA 1DQ9A 3MI7X 1BXNA 1DLOB 4F0MA 4QR0A 5LMUF 2ZNZA 4OI1A 3UFCX 3PEJA 2BDPA 1T0TV 2HQ3A 4ZVPB 1ZTWA 1SJ4P 2MTLA 4N7TA 1JLGA 3KJQB 1K1QA 2MKCA 3PRBA 3UCZP 2QMWA 2NLWA 4PPZA 3C15A 3NWRA 1Q8KA 4K4XA 1G7CB 5B0FA 1WSRA 1R8CA 2QLFB 4UW2A 2CQIA 5E3CA 3FQKA 3TVZA 3KHGA 1SL1A 3EWGA 3LGNA 2FTRA 1MMDA 4EU0A 4B3MJ 3J7YI 4IQMA 1RI7A 2MDAA 3C14A 2J6SA 2XMUA 3ZZRA 3D3CJ 3CC7S 2YWFA 1ZZNA 4AT1B 3EUNA 4CLUA 1JLFA 2QEXS 4CNYA 2VV5A 4PEOA 1NK8A 2B8PA 3OT9A 3QRRA 4Y2KA 3GSDA 4KO0A 1Q8IA 2MHNA 4ZN1A 2YBVA 1NNDA 2AT1B 5L1KA 3U1MA 2RJZA 4PQUB 3CULA 2VG7A 4I69A 2AF6A 5LM7E 5L8RC 1TQLA 3ITHB 2CQ1A 4QR1A 2RAQA 4P2XA 4ECZA 4LF7F 1DZ5A 4P10A 2RILA 4KTQA 4O4RA 5F8HA 2W8KA 4WPAA 5EWFA 2Z2MA 3BGUA 4A46A 3M8RA 1XMBA 3O6QA 3TA0A 4LBIA 2J7UA 4LBHA 4KT0C 3W9HA 2HW3A 2MJUA 3PKMA 5MLCV 4RUHA 3DOKA 1ZAVA 4OYMA 1N52B 1YBAA 3JQKA 3C3LA 2K3IA 5E3RA 5CZVA 1NMEB 3PNIA 2FVQA 2J0XA 4JP8A 1S0OA 1LW0A 2W25A 1DARA 5DLGA 5AE3A 1Y0HA 2WB1D 3UDCA 3ZNJ1 4X4UA 1T11A 3JXOA 1C1CA 3ZZTA 4NXNJ 2MSTA 1NDKA 4EYIB 1LWEB 2J0QD 3Q23A 3K0JA 2VBYA 2E5GA 2VA3A 2YNIB 3KHRA 2M5YA 2M8HA 4M5HA 2C3UA 1TUWA 3OTOF 2IHR1 5L1JA 2GGPB 1EKSA 1R0BG 4NCAA 1FD8A 1NUEA 1N34F 4YEAA 2D3UA 1ZAXA 4AE5A 2HNDB 1ZPWX 5BXIA 1N0VC 2V2QA 3JTPA 3I0SA 2RF2A 3M9MB 2LMIA 4ELVA 4USJC 1DHMA 1UEVA 3JSYA 1SL0A 4QPTA 5IQQA 2XZDB 1D9FA 2LA6A 3PYFA 4Q8EA 5DO2A 1IM6A 3U02A 1KFSA 1Q1KA 4ECXA 1CULA 2DHSA 4NEYA 4DUTA 1UETA 4JV5J 1FNOA 3K2YA 1RTIA 2GAHC 3HZGA 3EDQB 3V6HA 4RJVA 1LW2B 4WP3A 2W9BA 4DR6J 5C2CA 3G71S 5F0UA 1R7IA 2OEMA 5KFWA 4NLYA 3DOLA 1ZM9A 3UVJA 4PRFA 5KFNA 3CCMS 3HD1A 5H9EJ 2AX1A 4PAAA 2Y0BB 2MQMA 3A3PB 3JSMB 3MCMA 1FJEB 2QX0A 3MOZA 4DR7F 2ZJPQ 1FD2A 1H2UX 4NXMF 3KLIB 3GP9A 1CS4B 3IA0A 2C3MA 1RT5B 1AUSL 4YN3B 1XMQF 2HVEA 1PYSB 3IN5A 3CB4A 3WX4A 2B51A 2DYAA 3MUTP 2RRBA 3NL0A 4F3QA 1Y9OA 4DHVA 4M8LA 1KLMB 3GV5B 3GR0A 1GNKA 3PX0A 4G3IA 3HHDA 1T9UA 5KFIA 3FFIB 3TEHB 2IVYA 2FLNA 1FTRA 3UR3C 2G0CA 3CJ8A 2YPZA 2XHWA 4ZN3A 2E7VA 1B0VA 4JI0F 4C9DA 2DNOA 1Y11A 3W8GA 1B0PA 3SSQA 2ZZNA 1VR6A 1RHMB 2GS8A 2YKNA 2LLZA 3LP0B 4IR1A 4LJMA 3MM7A 2Z58B 1VFJA 1SUQB 3FKBA 4CH1A 2BEFA 4C8MA 3PJXA 2ZDPA 2CJBA 2RMLA 1F1BB 1YJ9S 2H48B 4NRTA 4JV0A 1TKZB 2V9KA 3IC1A 2FDNA 2P9GA 2OD4A 3FJ2A 1SC4B 1T94A 1I94F 3GYGA 5JVGQ 4A8KA 1N32F 3CJ4A 3Q22A 2JEJA 2IJNA 1IJEB 2C42A 1FDNA 5KFQA 3BQ1A 1OPZA 3HHEA 2MQQA 3KK2A 5HN0A 4NPOA 4RWWA 2C2KB 2AGOA 2M70A 3TVKA 3JSBA 2WVCA 2F40A 1TMJA 3T5LA 1NLKL 2P6SA 4P71A 1RAFB 3DFEA 2WRMA 4HI2A 3KUGA 4CO1A 2MYFA 1CJTB 3IRXA 3F56A 3DLBA 4K4SA 1HWKA 3GYXB 4UUXA 4HH1A 3TX0A 5M2PA 1SQGA 1YJTA 4PPDA 2HGNA 3LP1A 1T8EA 1R8HA 1FA0A 2AX0A 2GJIA 3QIPB 3MPWA 3MECB 5GAHU 2BE2B 5A8KA 2J9CA 4RW9A 1MU2B 5CD4H 2DB1A 2ERRA 1W7WA 2E5JA 1VQ6S 5IQ6A 3US5A 1NK0A 3VVTA 2LDIA 2ZEJA 2CDRB 1G4CA 1NPRA 2CQCA 1IBCB 5J2PB 2IDEA 4ZVRB 3T41A 1YSJA 4P74A 2ZM6J 1OS5A 4ECUA 2UUTA 2OEKA 1AFJA 4U8VA 1U4BA 5DDQC 4DPUA 1O51A 3HO1A 1ZM4A 2ZWPA 2AJ4A 3DLKB 4TYBA 2XSFA 2LQBA 5H9FK 5KFZA 2XBPA 2O5DA 2B9YA 3T19A 1K1SA 4ZCLA 2R7XA 1EHWA 2B8QA 3BM7A 2Q79A 4GVBB 4MKYA 2V68A 3LQVA 4CT8A 3PHTA 1WSVA 3SQOP 4ZVOB 2D1CA 2LU2A 1SJFA 4CLFA 3MAQA 2H3EB 5LT5A 1AYEA 5HQ8A 4CDIA 2Y9HA 1XQIA 1TELA 4KB7A 1MN7A 1T03B 1YX2A 3CTRA 3R5JB 3EVMA 4LSZB 4MAKA 2LEAA 2XZTB 2DHGA 3GJSB 2HRUA 3TA2A 4XIUA 1SVDA 4Q2LA 4DFKA 4NLOA 4NA3A 3GPAA 3KHHA 1RCOB 1N54B 3C14B 3DGVA 5K9FA 3T5JA 4QU7A 5I42A 3P6YC 3HFZB 3BF4A 3PV8A 5D3GA 2HVZA 3DXSX 4IO9Q 2U1AA 4RUBA 3ULHA 3CCRS 2V9WA 5GADI 2OH2A 2G0JA 4RW6A 2QIFA 3SZ2A 3RAQA 4PWDA 5BYSA 3Q24A 4LF7J 3MDFA 1CC7A 2LYVA 1WC1A 4KO0B 1NK7A 2B3TB 2XLIA 1BD6A 3HPOA 3JTNA 1FNMA 2L9WA 4C6AA 3MPVA 2KRRA 2OHDA 2NR0A 3MMCA 5KT7A 4IFYB 1S57A 1KRPA 4ANCA 1VHFA 3G82A 4FXVA 4CLTA 2D3ZA 3GFYA 2PMZD 3TARA 4L75A 4NRUA 3O44A 1HBUA 2HS4A 3M8ZA 1R43A 2PC6A 4X4RA 2CQ4A 3PRDA 3MUVP 1VIXA 2PSZA 2BJDA 2HBQB 1FFWB 1NSAA 1S6OA 4JI4J 5KFUA 4CIOA 1VYAA 1RYSA 3I6PA 1Y00A 1HBOB 1SJ1A 3DOKB 2I38A 1YIJS 3I9ZA 4PQAA 2KH9A 1RTJA 2OMOA 3R9LA 4V1Ak 5A6WA 1KS2A 2YVSA 1BQXA 1OO0B 3DMJA 2GVDB 2Z57B 4ELTA 1F9FA 3TJ8A 1VOMA 4LSLA 2DR6A 5ETNA 3IM9A 4H4KA 5A0YA 2ZZTA 3M4XA 4CNZA 4C8NA 4ILLA 4QCLA 1X5TA 4WTOB 1IKVA 2HBYB 1CJKB 3PACA 2KYZA 1HPZB 3MR3A 5EGYA 5KG1A 1M5SA 2DRDA 4WJBA 2C3OA 4UZCA 2ASJA 1XBWA 3EGWB 1U45A 4RW8A 1P9QC 2M8DB 2ZH2A 2HK3A 2H1YA 2XMAA 3MCOA 3MM6A 4TU7A 1FJGF 2ADCA 1UFLA 4CO2A 2DR9A 1XK8A 1NKCA 4WKRA 3EXYA 4CI0B 5F8GA 1JLAB 4U95A 4J9QA 5ETTA 3CIMA 1K0VA 3H25A 5KFVA 3TO8A 2LU1A 1CULB 3OFGA 3RW7A 3CO9A 3NS5A 4F3MA 1GX5A 1ZTTA 2JFKA 3CEDA 4B3SJ 1MNEA 2A3JA 5DRKA 3H42A 2ROEA 2GMJA 3KDOA 2OSQA 4OHWA 2K7JA 1HNIA 2BJ8A 2R7SA 3GFHA 5KFTA 1RT7A 4DV1J 2FVCA 2J9DA 1IBKJ 4EZ6A 4PABA 4DX8H 1HW9A 1BWEA 1HBNA 4WCEQ 1DBDA 1C4AA 3G96A 4DR5J 3W3SA 4R5PA 3IO1A 5IWAF 3Q2TC 1H6KX 3SBMA 3D54A 3TW0A 1NU4A 4WFAQ 1EQ0A 1WI8A 1LFPA 1RBOB 3OFFA 5CYMA 4XPCA 2RU3A 2W7PA 5KG0A 4DSEA 5L46A 4I2QA 2XM3A 3M9OB 2EW9A 4QR2A 4KFBB 1TUGB 5LJ5Y 3W9IA 3BREA 3OL8A 4IRDA 2MZSA 3ONQA 2OPSA 1QAXA 2GO9A 3RRKA 4YR0A 5B0CA 4TXSA 2RE1A 4JUZA 3ZTOA 4X4QA 2QA1A 3BGLA 2JNJA 3AODA 1SKWA 1ITPA 5I3PA 5EWEA 2AHOB 1X60A 4G6VB 4YDXA 3VZHA 2K8GA 1N6QB 2V67A 2YKNB 3PYEA 3G6VA 2L41A 3FMBA 4DU8A 4DCPB 4HH0A 1T02A 1FK9A 3GIMA 5LL6d 3PM9A 3W1YC 3CJQA 2ZBIA 1S9FA 2QV6A 2CPJA 2AZ1A 4DZ6A 4F4WA 4IFVA 4EBDA 1JXLA 2Z0GA 1HNXJ 2UXDF 3TQEA 3M30A 4WZMA 5I3QA 2KFYA 4OZ2A 2CZVC 3O8WA 2HEKA 3K5LA 2DR8A 3G6YA 3NLCA 2P5VA 2MZTA 1KD1T 1KN6A 3VAMA 4PXBA 2F4FA 4M5LA 3M6WA 3EGNA 1K9MT 1NZ8A 3K57A 4OX7A 4BS2A 1FEEA 3ZFVA 3KK2B 2HQDA 2R8JA 5GAGI 1VQPS 3UI3A 2VONA 4QPXA 3V4IA 5ETVA 5F9LA 3OSNA 1WUUA 3A8IA 2CPFA 2ATCB 1LWXA 3UD4P 3GV7B 2ZHBA 2VC0A 3GLJA 5CYQA 1RLDA 2RT3A 3UCGA 1JJ2R 3IRXB 3EXCX 2OPPB 1GX6A 1FTCA 1L3VA 4ED4A 2QYGA 5F8NA 3LP1B 4X62J 3FUYA 3GE9A 4DDFA 3L3CA 4HHUA 5G0RB 1OWXA 3D67A 4JI5J 1LQ9A 2EI5A 2HAIA 3RAMA 3VV2B 5A8KB 2RDJA 1RP5A 4RW9B 3MM9A 3TJ9A 2O01C 1LXNA 1F5AA 3ELHA 1U26A 1BMQB 1GMWD 3PX4A 5HMXA 3HXMA 3OVAA 4DV3F 2HWHA 3R5BA 3BBCA 4IH7A 4LVNP 2JEFA 1T9XA 3DI6B 4F4YA 2AYEA 3QATA 5DDPC 4LT6A 3LAMA 3UN2A 1A0OB 1QVFR 2ZH7A 2KT5A 1EARA 2E5LJ 4B3TJ 3D1QA 3W64A 4NLRA 3KUEA 3LH2S 5KFFA 3KKFA 1KOOA 3IBWA 2VFUA 2QA4G 2MHEA 4F0HA 3CWJA 2F3JA 4C11A 1HQUB 4YHHF 2VBZA 5E5NA 1M1KT 1UFWA 2AQ4A 4DQIA 4A8QA 2MLXA 3VGSA 2HMIA 5M2UA 4Y2MA 3RU0A 1XJWB 2DCLA 5GMKa 3CE8A 2HZAA 3BGFA 4LREA 5DDOC 1TR0A 5ETSA 1VQ8S 2RKIA 1JQGA 1U1MA 1DTTB 1NJIT 4U67Q 4DR2F 3BN7A 4OLPA 2OIHA 3OTBA 4S0MA 1RAOA 3QGHA 3D3BJ 3MAHA 2HNZA 1S99A 3T5KA 1SBRA 3MEDA 3Q8YA 2WAQD 3IR7B 2ZD1B 4JV2A 3ICLA 2RUGA 2VPWB 4QJVA 4X66J 4ZPVR 4IOCQ 1TL1A 4OI3A 4FYWB 5EX0A 3QGPA 2VFRA 4YY3F 5AE2A 2R7UA 4ZLLA 3CC4S 3KLEA 3C46A 1SV5A 2ILYA 2GFFA 4OZ5A 4CLKA 5HMYA 4YOEA 1RAEB 1ZM2A 3AJ1A 3G82B 1F2GA 4NZ7A 2VL1A 4QIFA 2X51A 4GKJJ 3BGOP 1RT4A 4OX6A 1HBUB 2JLGA 2BM0A 2R7WA 2IY5B 2V8PA 4QWBA 1GMVA 5KFMA 3M6UA 3RRGA 4IR9A 3VGUA 3GWCA 2DIVA 2CQ0A 3QAEA 2R7OA 1WTFA 1H7XA 2DH7A 3VAGA 2UVVA 3FSIA 1FWKA 2B7CB 4FBTA 3TOQA 1S9GB 1F9EB 2EFQA 4F7VA 2QGFB 3FCVA 1BC6A 3KJVA 1RWMB 3H98A 4KRWA 1RE1B 4TQRA 4UF4A 2DO4A 1RHRB 2C2RA 2DRAA 4C2MA 4I68A 1VRUA 3R6GB 4JOUA 3NGSA 4C3KA 3QLHA 2RRAA 3IG1B 2K2PA 4LUBA 2CPEA 4L73A 3GSIA 1J2VA 2V69A 5E3AA 2HVDA 4MKVA 5J2MA 2CPZA 3V4MA 5DG8A 2FYXA 2JHEA 2UU9J 3QYYA 2UUCJ 2MLYA 2XYPB 2NYHA 3C16A 3H0PA 1QAYA 3LF0A 2CZ4A 3S7RA 1WEXA 4AL6A 4OZ3A 3UD3P 3GIRA 2VASA 2N4DA 3NP5A 3EDRB 2OUGA 2DT9A 3PY8A 3MWBA 2YQ1A 5H9FJ 2G1HA 2PGCA 4EFAC 7FDRA 4PXDA 5B0BA 1HNIB 1WDTA 3P45B 3CNQP 3M1VB 3ETOA 1RT7B 4MK8A 3PW2A 4FYDA 5KTQA 3M9NB 4ZCMA 1VQOS 3FZ2A 3MFIA 4X65F 4ZCIA 1PYOB 3FVYA 2G4BA 2KT2A 1P27B 1H73A 4X4VA 1KVJA 5CYMB 5CQGA 3GIKA 3VAKA 2B4VA 3B8HA 5D8HB 4FP9A 1CC8A 3A12A 2Z4PA 2ZFHA 3P5BP 5CYJA 3KLVA 2BYCA 1JJCB 4ID8A 2N7CA 3F73A 3TAPA 3OFHA 4F4AA 2ZBCA 2HIYA 3N5FA 4NA1A 1Q16B 1PCAA 5ETQA 5JXSA 1JLQA 4DL2A 4Q0BA 4LSNA 1R31A 3J7AN 2WCXA 3IWXA 4U7UK 4KSEB 2BRLA 8RUCA 1MROA 1AB8A 4TN2A 2J5AA 3OTEA 4J90A 2HHHJ 2XCAA 3HHLC 2VICA 2ZHAA 1CEZA 4USUA 4QQBA 4E0DA 1QAIA 2VZ9A 2QL5B 1Q95G 5E33A 2HGMA 2Y1JA 1HI8A 1JLEA 2HGLA 5K5MA 4AQYJ 3QSIA 1TZ0A 4DF8A 5F8JA 2MQLA 4IFVB 1GK8A 2VG5A 1G1XA 5LSLA 4F2RA 3CD7A 1UZHA 3M30B 1RA7A 4LF9F 2LQ5A 4KHPJ 1VS3A 5KFRA 1LKZA 3ENVA 4LFAJ 2DEJA 4YFUA 4AFFA 2KG1A 3HF5A 1OQ3A 1S97A 1S48A 4OJGA 1K47A 2LQ8A 5E7OB 5FIIA 1S6QB 5HANA 2L9NA 1T7PA 4NLQA 1OY9A 2HNYA 4MJKA 4CLYA 5GADU 4GO5X 4DR4F 3MAAA 1FVQA 4ZVQB 3D0IE 5LSOA 2EC0A 2HG4A 3AOBA 3NNCA 2CJKA 1RT6A 2J8AA 2EKYA 4MK7A 5CCLA 3M8YA 2E9ZA 3HCXA 3OLBA 4IRKA 2F1FA 1U0SA 5ITHA 4O23A 4D3HA 4RW7A 1N0UA 3W5ZA 5IT0A 4G1QB 4Q45A 3KLGA 3EZOA 5G4DA 4ZLPA 3CCES 2XG8A 3Q8QB 4Q44A 1NB2A 3PW5A 2H54B 2LFVA 3TAMB 4CRJA 3P8BB 1FFSB 1H72C 2CPHA 3Q2SC 2BE7D 4NMXA 3DU6A 3SCLE 4IDKA 3PO5A 2PMHA 3DM2A 3AFGA 4USVA 3BDEA 2D3OR 1U02A 3D7SB 1XR7A 2GMHA 3EPGA 1VQMS 3WC2A 5KOWA 4H4MA 4P2FA 4NLWA 3KTQA 2X3GA 2LP4A 2ASDA 2OEJA 1KQSR 3QJJA 4PXCA 1FX2A 3OHAA 1HNWF 1BHNA 1M90T 1AA1B 3HT0A 1TK8A 1TL4A 2F7VA 4DPXA 4KE5A 3OXFA 4NI2A 2BMBA 4B9TA 2Z2LA 2L08A 3LAKA 4M5DA 2HMIB 1WC0A 3QFWA 4G1PA 4DR2J 3J81U 3DLEA 3MURP 3ZTPA 4K5RA 4KJIA 3I4HX 4KC5A 4B9VA 3PW7A 1U1OA 2NXEA 1L3SA 1XNQJ 2GA7A 2EFOA 2GQ2A 1S1XA 4ED3A 1YVFA 5EWGA 2UXCF 2DR7A 5EHHA 1MSWD 3VQTA 4GKKJ 3AT1B 5SZTA 3ZTSA 4RNNA 4ID5B 2HNZB 3CJ5A 3MEDB 3MMBB 2MKSA 2NUUG 2MY7A 4P7VA 4ERDA 1UVJA 2YX1A 1VBXA 4UTGA 3H2VE 3AJ2A 3ZNUA 4B9UA 1S1WA 2V8HA 1TL1B 5J2NA 4B9MA 2VFSA 2V50A 2J0WA 5HROB 5D4PA 2F5GA 5KFDA 2ZOFA 3KLEB 3R3TA 1F3VA 4KH0B 5KT5A 3Q8SB 2CZ9A 2BANB 2P9CA 3HI9A 1XERA 3OTDA 4OI0A 1IBMF 4DUZF 2PA8D 2BOAA 2CWXA 4I2PA 1WOSA 4OYOA 1X9WA 3SDEA 2BVZA 2QRRA 4KGKA 1T9YA 4C8ZA 1JLCA 4K4ZA 4F4KA 3I31A 4WTYA 2EVZA 2DGVA 1KHVA 3BH6B 3PFEA 5DZ7A 4A8OA 1N36F 1IQTA 3W5YA 3R5GA 3FBCA 1KKHA 5CAAA 3MD1A 1AFIA 3CMES 4OYXA 3L09A 1W2BR 1L3KA 4XO0A 3EJMA 2IJRA 2C2DA 3BYPA 4ZDNA 4GO7X 4DSJA 5C42B 2J76E 1R27B 1N5QA 1RU2A 2VJUA 3ILJA 4J9UE 3G6ES 2Q6BA 2IFXA 2HRYA 3SIPB 1AT1B 3JAMU 1EQMA 5D0GA 4DR1F 1HNZF 1S76D 1Q78A 4EI2A 4O3PA 3BH7B 3QAUA 2LKZA 2CADA 3VF0B 1KOHA 3J7A1 3T1YF 5KFYA 1SB6A 2CAJA 1QSYA 2QG9B 1WG1A 2GX8A 3D28A 3ZTQA 1CLFA 5HVHA 1C2PA 5DZ6A 4O3SA 3OL7A 1WWHA 4IG0A 1VQKS 2E1MC 3LPYA 2CQBA 3ZZ0A 4OZ1A 1V6HA 3W62A 2R8GA 5C25A 2YQ0A 2JZ5A 3BKUA 4URSA 2R8HA 1FERA 4K4TA 4DJBA 3HHLB 5GAGU 4K4UA 1FXRA 1S10A 4AYBD 3K8WA 3QMQA 3I32A 3C66A 3ISND 1WNEA 4YS2A 3H2UB 3I82A 3MM8B 4A48A 1EB0A 5KFEA 1IJFB 3ISZA 5IXUA 1B4SA 2VPZB 3TAQA 2QYCA 4OZ0A 1OJ4A 4DPTA 4UZBA 4OI6A 1YJ7A 5M2RA 3RJMB 1Z4UA 1H2TZ 3G8TA 4QIVA 1ZA2B 5I4MA 3WDOA 1S1VA 2YNFA 2DRBA 4WP9A 4EK2A 5I3UB 1RT1A 2CPIA 1JNRB 1HR0J 2IBOA 1UA0A 3PW4A 2R3VA 4HHJA 5FDLA 4OYWA 3BR8A 4ZCKA 4ZIVA 2CVIA 2NREA 4ICLB 1EIYB 3LWMA 4Q0BB 4NCBA 3AB4B 3QJPA 4HACA 2Y1RI 4JV1A 3FEZA 2V63A 4LQ3A 2IRUA 3OJUA 2ZKUA 2N82B 3DOMB 2RHSB 1IXKA 2HHQA 4QWDA 2W2QP 2R7VA 4DR3J 1KNZA 4M63A 1OIAA 4ZVSB 4LF9J 1AZSB 5KG7A 2QLWA 2D69A 4PYAA 2DGSA 2UXBF 2OELA 1JLEB 2C3YA 3HHKA 2UUAF 1R6YA 3S01A 2B5JA 3TUJC 3D68A 5D78A 1I6JA 5A76A 3GZ7A 4DEZA 2VG5B 5A8RA 3ZC4A 1T05B 2Y8WA 1PIEA 4USIA 4DX6A 1RWWB 1PBUA 4ZVEA 3MGJA 3CCZA 4DCOB 5KFCA 1HYSA 3V6DA 2EFVA 1IN0A 2EFPA 2B56A 4ZK7M 4LRAA 4WZQA 2HNYB 4KGXB 2RD5C 2JEIA 4O0NA 3K59A 4DV4J 2AEJA 2YXLA 1C1BA 5D15A 1VQ7S 4KQZA 1TU0B 4KV8A 4ZITA 4IH6A 3S1TA 2XSJA 6FD1A 2A10A 1X5PA 1IKXA 5J1EB 1BE4A 5IOLA 3BPDA 4OYPA 2A2CA 3M7VA 2IBKA 4Z2XA 4QYZK 4DOZA 2VQFF 4DV2F 3LP2B 1UKUA 1I1GA 2B4UA 2IMOA 3H4DA 5ETMA 1IKWB 8ATCB 5HQMA 1HMVB 1KSPA 5L39A 1D0EA 2M3DA 5IC4B 5F8LA 2FZGB 4YR2A 1IBLJ 4P2SA 2CJ9A 2GHWA 1XC9A 4X2BA 3TQ1A 2EC2A 2YWEA 3QO9B 4H54A 1VRTA 2F8MA 3H2LA 2AWZA 4KAIA 2WONA 2KZMA 3KMQA 2Y0SD 4ANDA 2ILZA 4CO0A 2ZDOA 5HK4A 4NLPA 3I56S 3DDIA 1Z1ZA 3BN4A 3E8OA 1B0TA 1HQEB 4KR0B 4ZIWA 4K8RA 1TK0A 2BBEA 3RGIA 5DQHA 1QAJA 1Y5IB 2M4MA 1LWFB 4M5DB 5KG4A 2VODA 4ZHRB 1JLBB 1F2HA 1HQ2A 1PKUA 3HDSA 2AEFA 1YRXA 5K8OA 1RGVA 2HRTA 3W60A 2IA6A 3DCAA 4YDDB 3K7RA 2F4VF 1S1XB 4W92B 4CWBA 2Q3PA 3OHBA 2VPXB 4EBEA 1LWCB 1GQEA 3FZBA 1NAQA 2JWNA 2WOMA 1Y3KA 5A8WB 2XEXA 3CD6S 4IG3A 2OPRA 4ZKAA 2VKZG 4OJ1A 4CP5A 4A8MP 2V2KA 4HEA9 5IT4A 1X4BA 1PJ5A 3CDAA 4N41A 4Y00A 4QW8A 5J2NB 4N8OA 1VRQC 3MEGA 4CYUB 1TL7B 5KG6A 2GJFA 2MPUA 3G86A 3VAFA 4X64F 4TNOA 1IKYA 4BWMA 3NMRA 2YY3A 2YNGA 3UNGC 4CH0S 2JC1A 5KFPA 3TRGA 2N3OA 2GC8A 1ZBTA 2ACMA 3NY0A 2HBZB 1SJRA 3CCWA 4WP8A 4J9LA 1VHIA 2DXEA 3DLGB 2PA3A 2AV5A 1NK4A 2ZC4A 5IZHA 2GMLA 2NYIA 4LMZA 2BZ2A 2LDYA 2OFHX 2HQCA 4CH7A 1B99A 5DM6Q 4HT7A 2MZRA 4P73A 1JIHA 1YGYA 2CJQA 4C8OA 2ZWOA 1FKAF 1UEUA 2DGOA 2Z2ZA 4TY8A 1RBAA 3KJFB 2WSFC 1PILA 4FVMA 4MKBA 2I8EA 2V2VA 2DIUA 1QSLA 3T1HJ 2VIHA 3A8EA 4O4GA 5AJ3F 2X7IA 2V4QA 1EP4A 2DNNA 1N8RT 2E29A 3TNVA 4USTA 2A6MA 3OL9A 4ATNA 5LXRA 2KXFA 3D0HE 2GIFA 3T1AA 5AE1A 1QUPA 4EO8A 4J9MA 1ZETA 1L3UA 2G13A 3ILIA 2JC0A 1S59A 1KQKA 4LQ9A 3KK1A 7FD1A 5KOXA 4OYAA 3CF5Q 1S1TB 4IG0B 4CLLA 1QLNA 3FQLA 4MFBA 2J0SD 5C25B 2XWXA 1BQMB 1NPKA 3HVTA 1IR2A 2MKKA 4LRCA 2E1AA 4YB6A 1NDLA 2DGQA 4WYLA 8AT1B 1YBUA 4DV5J 4U9RA 4JYAF 2CXEA 5B08A 2PE8A 5IT9U 2PN6A 1SIZA 3AA8A 1E6YB 1U0HA 2IC3B 3M2UB 2ZUAA 1WG5A 4N8NA 4PWUA 2CWKA 1FKPA 3N6LA 5CH7B 1ZOTA 1CJVB 2QLXA 2FLPA 3D6MB 2OTLS 3P4UB 4NLSA 4J91A 4F50A 4MKAA 3ZTRA 3ILLA 1QE1B 2W4CA 4JI8J 1U24A 4DSFA 2UP1A 4Q8FA 2RSQA 2KI2A 2XY5A 1S1VB 5AT1B 3PFOA 1RAIB 3BSAA 1RT1B 1VGYA 1UW4A 1XMOJ 4H4OA 5KT6A 3C8YA 3C6UB 4O3QA 3BGRA 4F02A 4LFBF 3DHXA 4AL5A 3BV8A 1N5YA 1UWBA 3W61A 2B9EA 1V5IB 3LO3A 1Y5NB 1NSPA 2CPDA 4DG1A 3POTA 2HHPA 1A9NB 1RADB 4DV7F 3HJFA 1WC5A 1S4EA 1RWXB 2UVUA 3HULA 5AXKA 4WFZA 1VQNS 3NS6A 4LF6F 1EETB 1LK7A 1MG7A 1F60B 1UVKA 3ET6A 2FJEB 2KJVA 3QZ8A 4CTAB 1S7HA 2OFGX 2M2BA 1DQAA 3GCWP 4OX9F 3M6VA 2HKEA 3I96A 5A8RB 3K5OA 3JTOA 1YI2S 2DY1A 2RUSA 2PD1A 2DY9A 1TKTA 3CMAS 3FRZA 1X9SA 3PW0A 2YPYA 3I0RA 1RWVB 5FLXY 5B0AA 3QGIA 2YWHA 4ECVA 4C4WA 2G2OA 3WZ0A 1Q5VA 2QJ3A 4EYHB 2W8LA 4I64A 1HHSA 3FMWA 1FX4A 3GTYX 3CSKA 1VI7A 4BBYA 3CCUS 5CCMA 3M2RA 1R3NA 2HHXA 4QIEA 3KLHA 3UN3A 2WW4A 2XMWA 3HP6A 5H1SV 5HL7Q 1HD0A 4OQJA 2VQEF 3IP0A 2OJ3A 4KKOA 1I3OB 3QT7A 4Y2AA 3DU5A 1S9EA 4LR8A 3DC2A 1RWNB 1IKXB 1UJ6A 1OYDA 1ROFA 2M9KA 2OAUA 4QIGA 4ED5A 4RW4A 3MTKA 2AIRB 4OHXA 3BO3A 2M52A 3CVKA 2ZH5A 2UZAA 2C28A 3CDUA 1TV6B 2DITA 4KGZB 1YJWS 1JMTA 4DXLA 1F6TA 2HIQA 2X1AA 1Q82T 3QWPA 5HLFA 4C8LA 3NNAA 4FS2A 3JQMA 1FKOA 4DV0J 4NZ6A 3CCTA 4Y3CA 1FWLA 4ZA1A 2L48A 2BQ3A 3M2VB 4Y65A 4ETZA 2UUBJ 5ETPA 2YNHA 1UJ4A 4DV6F 2JVRA 3H4BA 3L4BC 3CPWR 2GVZA 3M8PA 2WONB 4OJHA 1M1GA 3W2VA 3QRPA 3GQCA 4HVZA 4NX9A 4GRSA 2VG6A 1J5EJ 4FKYA 4PCQA 4I0WA 3BBFA 4QU6A 2OPQA 1MWYA 2QTWA 1XIQA 3MF5A 1I5OB 4WBFA 3N0VA 4LF4F 3W65A 6AT1B 1J5OA 5GVQA 3CCJS 3MM5A 1OMSA 3PG9A 4R8UB 5C24A 1WKKA 3M32B 4LFCF 5KT4A 3IXQA 2AD9A 3IM8A 4OLOA 1TMMA 1EZZB 4DPOA 3OUYB 4EZ9A 2W2MP 2QSWA 1H38A 1B7YB 4O0IA 4ZJQA 1ZH5A 3W2WA 1X4GA 4PUOB 3D6HB 2V4JB 1NSKL 2EWHA 2HS3A 2WOMB 2MKJA 3DRSA 3HSJA 4IG3B 4JI6F 5KT2A 2JX2A 3L9ZA 4ZLNA 4Z7CA 4ZMMA 3GJQB 4C0BA 1S49A 1V3RA 3R2CJ 1EAYC 3DRRA 5JJBA 2CIMA 3TP2A 3MEGB 4WYWA 4ZPTR 3Q0AA 1QM9A 3GG1A 5L1IA 1RWPB 4ILRA 2UVRA 2VJVA 2XLKA 2YNGB 2GAGC 2QT7A 3CCQS 1FDAA 1FO1A 4U7UD 3QT8A 5EUHA 3AD7C 1K44A 5HBMB 1VJQA 2XY7A 1WOPA 5HO4A 5J1NA 1LXJA 1DY3A 2NZ4A 3CD0A 3R7NB 2H4YB 3NBPB 3T6JA 4CO5A 4X4OA 2KT3A 4K4YA 3UD5A 4WFYA 1ZZFA 3RTVA 4DQQA 5D0HA 1BY9A 1REVA 4K5SA 3BR9A 3KK3A 2YWWA 1UTAA 3DLLQ 4J9OA 2DNZA 4ES1A 3CJ0A 3DYAB 2N4CA 5JMNA 2RB7A 3CCSS 1FI4A 4TY8B 1TL3A 2F63A 4DPYA 2GHVC 4BC9A 4EMDA 5KAKA 4LF8F 5JUMA 1N56A 3J7Z5 3HJVA 1PO6A 1VK3A 4B3OA 1KVIA 4B9NA 3OR2A 5BR8J 4O4GB 3H90A 2OP5A 4CZCA 3O5TB 4JI3J 2HQFA 4ZJLA 1RAGB 4X4SA 1OQ6A 1O8BA 4ETXA 3H5YA 2XQCA 2KKHA 4BHQA 5EX3A 3OXLA 4I6YA 3WHIA 5E0OA 4DL0C 1YLXA 2F8HA 4OX8A 4HTIA 3JYTA 4CLWA 4FNHA 2B6AB 4IKAA 1DFDA 2MZQA 1DLOA 5HATA 2OSRA 1RWOB 2FHOB 4JYAJ 3OL6A 3N28A 4J9PA 4DSLA 4MFBB 3PHEA 1JKHA 4P7TA 3W5XA 2RIJA 1VDHA 2O3DA 3HVAA 4M5KA 2DCUB 3CC2S 4DCJB 2W4PA 4C97A 5A6PA 3K5MA 1URRA 2WHOA 4PG4A 1RTDB 4UOGA 4Q7AA 4LBPA 2CKWA 2F9DA 4FYXB 3SFUA 3BBBA 1FEHA 3OQ2A 1NH8A 2E1RA 4MYUA 5LMNF 1DTQA 3NGKA 1KEKA 1AROP 2NXNA 2JSXA 3JS9A 4C48A 2C2MB 1JJ4A 3IAM9 1TFWA 4B3MF 5LMUJ 3M8SA 1DRZA 4KIAA 3R2DJ 1HW8A 5HSPA 3GU0A 1RB0A 1VC0A 3SCJE 2D74B 2DHXA 4B17A 4DN0A 3VGVA 1WF2A 4PG8A 2PFFB 4ALZA 3ITHA 1VQ5S 4ANEA 5KFAA 1Y7PA 3VWSA 2QN6B 2CYYA 2X1FA 1RWUA 1KFDA 1JLGB 4DG1B 3POTB 5L1LA 1D1UA 4XDCA 4HKQA 4DFPA 4L3NA 2BW7A 1B7FA 1FJ7A 3C15B 3CUNA 4OX9J 4K50A 1WTBA 3LALA 2QLJB 4P52A 1HL6A 3NS7B 4NYPA 3AA9A 3N4WA 3VVUA 4IYQA 5K20B 2FB0A 3QJLA 1HFEL 1RHQB 4NYOA 2SXLA 4WFBQ 3HKWA 2CJAA 3FGVA 3GONA 1BQNA 4F67A 1YZ6A 3N79A 3DN9A 1GT8A 3K17A 1FESA 1VK8A 3SXLA 4C8YA 1NBEB 1JLFB 4K59A 4LR9A 4WU2A 1HLWA 3A8KA 4MYTA 3NEKA 3AOCA 2BJEA 1U6ZA 2WK4A 2V94A 4TVAB 3LGHA 3I0RB 2G2ZA 3OD2A 3G2XA 1LWEA 5KFXA 3P49B 3RBXA 2QFJA 1NEEA 2KHCA 2VG7B 2YNIA 1SKRA 1YBTA 3K8VA 1VQYA 2VQEJ 1U7LA 4I4BA 3KDNA 2GGPA 4YQWA 4DUYF 4V19J 5K14A 4NXNF 3SMZA 4UQTA 1TL5A 2HNDA 2AJFE 2BJ3A 1S5ZA 4F04B 2FUG9 5MAOA 2BABA 1VLYA 2G2YA 3CJSA 4KKOB 2HS0A 1S9EB 2KHDA 5LXYA 2IYGA 4JBCA 3VGTA 3L7OA 4RW4B 2BX6A 2A2DA 4WXWA 3PKYA 3ETMA 3TZXA 5DDRC 4ZPAA 4RNHA 5DS7A 2PT0A 2KM8C 2C2ZB 1LW2A 1LW0B 1RLCL 4RX6A 1JB0C 1N4LA 2R9LA 4XPEA 2LVWA 1D09B 3OTOJ 1AW0A 3NGUA 1C1CB 1PSDA 3JB9k 1FKOB 3HVWA 1N34J 2W9CA 1FWPA 4ZOSA 4QWCA 1SKSA 3FSYA 3QSYB 1NXIA 5CA5A 3KLIA 4DR6F 3CO0P 4ZVFA 3MMAA 1CS4A 2L9DA 2GVZB 3SV3A 1FRIA 1U49A 3CIZA 2A1BA 3W2VB 3H40A 2FZCB 2B0GA 2V8VA 2OGUA 2AYMA 2HFUA 2HURA 1V5VA 2VG6B 1KLMA 2YH0A 3I0SB 2RF2B 3FK4A 3OR1A 2VFVA 2FPHX 3MR2A 4ILMA 3G4SS 4J9KA 3MM5B 3RRHA 3MCSA 3HFVA 3H7HB 3NRBA 1K0TA 2YWKA 2BA9A 1LOUA 2EXUA 2X1BA 1RT2A 3NG8A 2R7RA 1RTIB 1SC3B 1YG0A 3G8QA 1SUQA 2W9BB 4DR7J 4NXMJ 2DR5A 3MPUB 2K1RA 2DH9A 1BWVA 3IFEA 1XMQJ 5T7LA 3DOLB 4OJ3A 3UVJB 4ED2A 1XN9A 1TKZA 3J7ZT 1TFYA 4ZPBA 4ZS6A 5L9XA 2N7YA 3DRRB 4M1KA 2O67A 4P6QA 1H74A 3R27A 2Z56B 1NK6A 4GC7A 1H2VZ 3D0GE 3UE2A 3MR6A 4F26A 4IOAQ 4JI0J 2ZKTA 4MIBA 3SI8A 4N77A 1WDDA 2EFGA 3PR5B 1ELOA 2ZH9A 4E98A 4RU2A 1WHVA 3BJYA 1L3TA 2ZH6A 5JVHQ 2DTJA 1Q7YT 4HYKA 3PCOB 1IWGA 1HI0P 5C5JA 3FEYB 2NXUA 4FZVA 2RQ4A 3DNCA 1REVB 1IUJA 4DFJA 4DSIA 1UJ5A 3MM7B 3QIPA 3SSSA 3MECA 4AXJA 3B82A 5KG2A 4F3OA 4BC7A 1I94J 2NSBA 2G0IA 3SV4A 2CUYA 4CT9A 1N32J 2EG2A 1CQMA 3DKDA 2FVSA 1HNVA 3R97A 2O1PA 3W7BA 4FPIA 4HDGA 2OMLA 1TTHB 2VBWA 5SUHA 5J2PA 3HSDA 3EVOA 1S6PA 4DLEA 5B09A 3J7YU 2HAFA 3DLKA 3D6FB 1WG4A 4UQGA 3OTCA 3QFHA 3A13A 1WC3A 3AHPA 2I6WA 4FPRA 3MPYA 1UP1A 3AJDA 4GVBA 2DNLA 3GG0A 4Y6IA 2JLFA 2ZM6F 2W2NP 1S77D 3UQSA 5HJYA 5T14A 4F8RA 3G9CA 1F5CA 1HWUA 3CMQA 4YB5A 4W98A 4LIWA 4A8WA 2CQ2A 4M5JA 3KG1A 3PVXA 1PGZA 2ALZA 4ZVGA 3MTJA 1RTZA 1JKHB 4EO6A 1T03A 5LMNJ 3JSRA 2RRNA 2RNEA 4ZP7A 4YR3A 2GO8A 3KG0A 2CVEA 3B78A 4A8XA 2IAJA 1DQ8A 1Q81T 1KHWA 2I0XA 2IM2A 3FCHA 1S4FA 2FJVA 1UEKA 3THTA 4WKYA 3H5UA 2X3DA 1DTQB 3UO0A 4Y2IA 4DQPA 4MK9A 2ZBRA 3CJ3A 1GMUA 3FBFA 2CNNB 4C3LA 2F9JA 2MJNA 3NWGA 2O66A 3R1LA 3PR4A 1B3TA 4I56A 4PZVA 1IR0A 1UAWA 1VC6A 3PJ9A 2AW0A 7AT1B 3RUBL 5ETRA 2LECA 3MCNA 1X8DA 2YKOA 1RISA 4IFYA 1OY6A 2R8IA 3SEOA 2JL9A 2V34A 3A3OB 1Q4RA 3ZZZA 4C0OC 3L95X 3EZ5A 3IS9A 3QBCA 4RZRA 3IGVA 4P9SA 3KNAA 2VDIA 1YRUA 2WVFA 1D9AA 3R5DA 1XR5A 1X4HA 3MHYA 1NPPA 5J2QA 3HHNB 2XULA 3NCRA 1HBOA 1SH0A 3UDVA 1PC5A 3KOAA 1NDCA 1V3ZA 3RB4A 1OSDA 1V3SA 4CM2A 2YWGA 5I42B 2KM8B 2HVIA 1BQNB 3GFXA 5D3GB 2CJXB 4JI4F 3MUMP 2RQCA 2GVDA 1WHXA 3VCDA 3KYLA 4RW6B 3N9UC 5F3ZA 1QDUB 4I67A 4P75A 3QRQA 4PWDB 2CJYB 3HX9A 4F36A 4DUYJ 2MZJA 1NKEA 1CJKA 2HHTA 2MSSA 2Z2YB 2JH3A 2EPIA 4MT1A 2HWTA 1CJUA 1HPZA 4ZP9A 3CCLS 4XTTA 1Q8BA 1LK5A 4UY85 5D77A 2ASLA 1ZYQA 3AQOA 2J6TA 2L3MA 1N5TA 3MMCB 1UZDA 3RYLA 2E44A 5K14B 2VHGA 1FRJA 4NZ0A 2IVMA 4DMZA 5HMWA 2ROGA 3RBZA 2D7SA 1VQ4S 3T6BA 5CABA 1IQZA 4BCAA 1KR4A 2VB6A 1HHTP 5K8PA 2HBRB 1JLAA 1SIWB 4ITSA 4DPWA 2VF3A 4N5SA 4L3KA 1U2RA 1RTJB 1RKJA 2PO4A 1CVJA 2B43A 2VC1A 3W9JA 4L76A 4CLSA 2XCPA 4UOHA 1YWXA 3DMJB 1GH8A 3SYZA 1D8ZA 3TWZA 5AXMA 4LSLB 5A0YB 1L5UA 4WXOA 4HI1A 2FHMA 2WSCC 1N5VA 4K2JA 1D9DA 1IKVB 3FDSA 2DK2A 1S0NA 4B3SF 4TYAA 2W9CB 2E5HA 2C2OB 2KVQE 4NMLA 5DLFA 1FJGJ 1FRLA 5BYRA 2A18A 2EFNA 4DV1F 3LUYA 1IBKF 2I9SA 5D4NA 3MMAB 5E3QA 2JLEA 4DR5F 1WI6A 1SXLA 4TU8A 4RW8B 1O5JA 2GCFA 3TUIC 4KFBA 5KT3A 2WW8A 5GMDA 3OW2R 3R5AA 4OHZA 5F9NA 1WACA 2D9OA 2UV8A 3MM6B 3OR1B 2NPFA 5KFSA 3X1LB 4L74A 4UT4A 2FLLA 4Y28C 3K89A 1ZA1B 2E66A 4Q5VA 1VMBA 1WJ9A 1J27A 1N6QA 3SFGA 1RT2B 5IWAJ 2GIRA 4ZJOA 3U27A 2QMXA 3CGIA 4HT5A 4ED1A 4I6AA 2DBBA 4DBQA 1NJYA 5DQIA 2CG8A 4LF5F 2K1RB 2NCKL 1HBNB 2H65B 2W2PP 1BUXA 5T7LB 2LEPA 2UUWA 4R5PB 3I5CA 4R0EA 1NJZA 4OIXA 4URGA 5LOQA 3F44A 1FVSA 3PDNA 3FC9A 2BQUA 4O3NA 3KNGA 3TUPA 3W63A 3R7BB 3GR1A 3I4PA 1HNXF 3VZIA 1WEYA 1PAUB 3OVSA 1MN9A 4I2QB 4PG7A 1LEOA 1R8PA 1RHKB 5KG3A 3D9BA 2FHJD 4G65A 4ZP8A 4UOFA 4P72A 2OPSB 1B64A 2BKNA 5DGAA 4DL6A 2CPXA 1HWLA 1WOOA 2ZHOA 2DNGA 1X5OA 2OPPA 2KN4A 3Q89A 2W01A 4J5OA 2UXDJ 1QY7A 3B54A 4QOTA 2QC3A 2IM3A 3T9NA 4KH1B 4Q43A 5G0RA 3D5MA 3WIUA 2V8GA 1FK9B 4TLRA 3V6KA 2IDLA 2BM1A 3CDBA 1ZAWA 1M1HA 2POKA 1S0MA 1GTHA 3AOAA 4J9NA 1HNVB 4TLQA 3FEXB 3L7PA 4X62F 2GV1A 3CJTA 3KXDA 3Q8UA 4M95A 4FS1A 4ED8A 3LTOA 3DI6A 4JI5F 4ECQA 3OV7A 1Y3JA 1FRHA 1S6PB 4EBCA 5DM7Q 2MXYA 2NUHA 2WVBA 3HMJG 5EN1A 1FFGB 3A4TA 2DNPA 1XEZA 3CDEA 3K58A 1H7WA 4IH5A 2CQGA 5IS2A 4NLTA 2AYGA 1KQFB 4NLUA 2DO0A 4KGMA 4CLZA 2OO4A 1S0VA 5IC6B 3V4IB 4F25A 5GAEI 1RU1A 2ZE2A 5F3TA 1LFWA 3LANA 3M8WA 1SJQA 2AP6A 1HQUA 1BGXT 4NLVA 4LRFA 2DNHA 2E5LF 4B3TF 1MW7A 1Y5LB 5CYQB 3PYDA 4EUVA 2B4PA 1HIYA 1RAAB 3GJTB 1UMJA 4DV3J 4XAKA 1X0PA 3F41A 3I5AA 2HHVA 4YMEA 3ADAC 2J9DE 4HLBA 3ENAA 1VBYA 2IAJB 3MM9B 1DTTA 5IM0A 2PI5A 3IWLA 1KTQA 1VQLS 2YTCA 2HVHA 1YQHA 4AXIA 2AZ3A 1F5BA 1Q8LA 4AUKA 2XHCA 5KFKA 1NK5A 2VBXA 4C0HA 5B7WA 2PMWA 2ZD1A 3AD9C 3W66A 1JJHA 4YHHJ 1RT3A 1HBMA 1X4FA 1R6VA 4KGVB 1SKUB 1HKAA 1MMNA 2EBGA 3PTWA 2ZH8A 3UPFA 4ZVHA 4IOBA 4UY8T 4USWA 2KXHA 4C11B 5ETKA 5KFGA 5IV4A 4X66F 2DKOB 1S7IA 3IS9B 2KXNB 1NB7A 2V6AA 1GFWB 1KDNA 1SC1B 1MWQA 1TKXA 5J1PA 2ZBPA 2LXUA 5DJBA 3FBBA 2A0FB 2EBEA 2XMTA 5D0RA 1QUVA 5J2QB 2XS7A 2RKIB 5KG5A 4GKJF 4J7CA 2K3KA 4UOCA 2XY6A 1S9GA 3CDWA 3CJKA 3GMGA 2FHJA 3E01A 3NNHA 4I1TA 4YY3J 1RA6A 3R6LB 4GVLA 4DWIA 1RK8A 1A7GE 4RPFA 1Z2ZA 2KZZA 4NCGA 1SC6A 2YH1A 2FVPA 4KPYA 3UNYA 2HQIA 3V5RA 1CJUB 5ETLA 4N76A 2G9OA 4Y2CA 1U48A 4RUCA 1NJWA 3DDKA 2YKMA 3IG1A 2AMCB 4RWXA 1SV5B 3D1OA 2JOQA 3AXMA 1UVLA 4RBUA 4USMA 2COLA 4USHA 2P9EA 2GHPA 1NZAA 1RT4B 2XTJP 5F8MA 1N88A 1WEZA 1A6LA 4WFNQ 3RR7A 4A4JA 1KTVA 4ECSA 4ED0A 2CQ3A 3MFHA 3NGRA 2KFZA 2HYIB 1C0TA 1YJUA 4LIRA 1RAHB 4QBUA 1WORA 2M0GB 5HAOA 2FIUA 3FCWA 3IRWP 1W2IA 1SPBP 2MKYA 4NA2A 2UU9F 2EG1A 5RUBA 2UUCF 2NZCA 5THWA 3S6EA 4OZJA 3KJVB 2CNOB 1NHKL 3M1VA 4XDDA 1EJ7L 1R8AA 2MKHA 4N47A 2BXJA 2XZWA 3AH6A 2DISA 1D8YA 3DDNA 1VRUB 1KONA 1UPPA 1UVIA 2LA4A 3AB2B 3QLHB 1RYRA 2VD3A 1X0FA 1B70B 1M5KC 3OXGA 4NLXA 4OYZA 4B08A 3D4JA 2BACA 3EPIA 2PI4A 4J9SA 3ZO7A 5J2MB 3DRXA 1S79A 1GXLA 3MR5A 3I87A 4Z37A 2I1RA 3C16B 4OHVA 4FYYB 2G1DA 4B3RF 2H9ZA 4RNFA 4B02A 4LF5J 4OL8A 2V8DA 3CCVS 3I9V9 3RB0A 2BRKA 4F4ZA 1QTNB 4X65J 5U47A 1UVMA 5HVGA 1K73T 1Q7LB 3LGMA 5BJRA 2OLWA 2JJ4D 3E3XA 1RACB 2MGZA 4ECYA 2HHHF 2DD8S 3MPDA 4A8FA 1R0CB 2H5EA 4K0KF 4KY3A 1X4AA 4AQYF 3HFKA 4V19X 4OI4A 4CO4A 3S8SA 2WB4A 2NSCA 2OD6A 4C3MA 4DSKA 1YHQS 1PG5B 1S6QA 4KHPF 1ZPVA 4DZDA 2XYHB 2C2EA 3DRPA 4M5GA 1MWZA 1VQSA 4LFAF 2DNKA 2IIHA 4M5MA 3C19A 2YX4A 2HHWA 1JLQB 3LOUA 2MMYA 4LSNB 1QJHA 3KWMA 2CQDA 1NDPA 5HMZA 2DXFA 5B0GA 1MROB 2IVFB 2QA4S 1U6FA 1U1KA 4KHMA 2DGXA 1YKWA 4G1QA 3Q83A 4QYRA 1NRKA 3TAMA 1U09A 3JQJA 1PJ6A 1DAXA 1IR1A 2QSFA 4A8YA 4USKA 4C7QA 3LPEA 3GIIA 3IAS9 2ZVIA 1M5VC 1YJVA 2CFXA 1HI1A 3VQSA 3BB5A 3HM9A 1U1QA 5IV3A 3J80Y 2B4OA 2MEWA 4DR4J 3TZZA 3HT3A 5D0EA 2R2UA 3EICA 3E2EA 5F8IA 4RU9A 2U2FA 4ER8A 4DL5A 3HHLD 3U7JA 1FCAA 2I5JA 3SSRA 1GXTA 5BYQA 4LVOP 3TVYA 2YKAA 2AJQA 5K8MA 4FNIA 1WHYA 4WIIA 3P5TL 3MAAB 2ZE2B 4NYZA 1FE0A 5KFOA 2HK2A 3A3NB 1FT8A 3WQPA 1RSCA 1VBZA 3WC0A 1RT6B 3RZAA 5A2QY 3RR8A 3SQGA 1DURA 1RUSA 3T3FA 4X84A 2LQJA 4RW7B 3AAWB 1X4CA 4J9VA 1TP7A 3KLGB 1PJ7A 2NPIA 1W25A 2C22A 2CG4A 1QVGR 4DFMA 1JWWA 3GB0A 3I5BA 1NM2A 2C1EB 1N48A 5IM0B 4IDKB 4CLPA 3DM2B 3AXKA 2RQMA 1RQ0A 4QZVB 1CSJA 4OYBA 3R1HA 4O44A 4LRDA 1HNWJ 3NCQA 4ID5A 4FF4A 4OMFG 3V81A 3I55S 2ASYA 3MMBA 1Y10A 2ABYA 1XNQF 3V6JA 3PXGa 1YJRA 1JXVA 4TKTA 1UWAA 4H4MB 2Y1LB 4OV6A 1FJCA 2XO6A 5E41A 1RT3B 1NHVA 1HBMB 1WHWA 4UUWA 1TAQA 3IBFB 4GKKF 4ELUA 5HROA 2H51B 2HHUA 5DG7A 2PDAA 4K4VA 2RQKA 2B9WA 2BANA 4JI2F 3EMTA 2ALYB 4DL3A 2RDIA 4NI2B 3X3UA 9ATCB 2XNQA 2UV8G 3VAIA 1G2EA 4I7FA 2KRBA 3QNWB 2E9TA 2GW8A 1YITS 1TKXB 1TAUA 1RZMA 2R42A 2YQ3A 3DLEB 2UXCJ 4DU7A 2R7TA 3HK2A 4DS4A 2P8IA 2DPJA 2PEBA 1P1LA 2QA2A 2VFTA 1NSQA 1TUVA 1PC4A 4ZPWR 1HD1A 3G6XA 1KWMA 4DLGA 3BQ2A 3CJ2A 1RXOB 3PJWA 1UVNA 5HJXA 2KYXA 2W1BA 3K5PA 3CJKB 3E01B 1JXEA 2V2ZA 3ENWA 1QTMA 1RBLA 2LXFA 2HLUA 5C42A 4DS5A 5C7PA 3DHWC 4NCGB 2KJWA 4FDFA 3BSCA 1GTEA 2OI2A 1IBMJ 4DUZJ 1S1WB 1WF1A 2BJ9A 2RS8A 4OI2A 2HFVA 2YKMB 3PIOQ 4RBTA 1SQFA 4E8UA 1CG2A 1FDBA 3ISNC 3O3LA 2BR0A 4IRCA 4HHHA 4CO3A 1URNA 1Z2LA 3HZEA 3C6TA 2K7KA 1N36J 4M5NA 4I2PB 1GMWA 3BO4A 2MKIA 3SDEB 5HP1A 2D3O1 1JLCB 3EVWA 4TU9A 2PIIA 2MQPA 2FJDB 3GILA 2VH7A 2MQ8A 4FXDA 1RHJB 1C0TB 3ZZUA 5AXNA 3J81Y 2FQQB 3T9ZA 3HHLA 3PO4A 4OFZA 2R2RA 1HWIA 4WF9Q 4RKUC 5L9NA 4ZVTB 4F2SA 3MM8A 1OPIA 2HHSA 1HNZJ 4DR1J 2JEGA 4WK1A 3Q8PB 3J80U 4CCHA 1SJ3P 1UPMB 1X31C 3M8QA 3T1YJ 1G3OA 1OSCA 1YK9A 3DXBA 1S6UA 4MMOA 2XLJA 3RG6A 1FF2A 2W2OP 5KFHA 4EWTA 4A8SA 2QMUB 5DQGA 2LXIA 1S12A 5I3UA 4B3RJ 2OKQA 4IQXA 4TY9A 4FYVB 5ETOA 3PX6A 2C3PA 3PIPQ 3MEKA 2XI2A 5A2QU 4IO1A 3R8YA 4LR7A 4PYDA 2KO1A 1F0XA 4QWEA 4ICLA 3EGZA 1VLOA 4FVCA 1U1RA 2DNQA 2YX7A 2AJ1A 1ACMB 2NXCA 1HR0F 3DOMA 2QE5A 4NASA 1K8AT 4ZLJA 3WBZA 4CQ1A 2AEMA 3IBCB 1KLNA 2R7QA 1U2FA 5GAEU 1AZSA 2WZ1A 2Z8QA 4K0KJ 3SCKE 2Q66A 2ZOMA 4NLGA 2EEYA 2WVDA 3EZUA 2E9RX 3U1NA 3LA0A 4Y0FA 1U1PA 2JRSA 3H8YA 2VOOA 1VISA 3IMQJ 2MGZB 4DR3F 1G6BA 4RNOA 3FNNA 1T05A 2J7KA 4ZPDA 2FGOA 2BOPA 3Q86A 4KBIA 2E5IA 2H5IB 4B9LA 1RJJA 4YP3A 3NAIA 3AD8C 1TVRA 4FBUA 4DQRA 2YNFB 4RNMA 2HWIA 4BLGA 4C8KA 2AYBA 3JAMY 5FDLB 5AXLA 3DRPB 3MR7A 1FRXA 1P8GA 3V2UC 2CQHA 2A6OA 4HACB 1QSSA 2UXBJ 3FBEA 3IR6B 3PRVA 2KB2A 2UUAJ 3AQPA 1N5SA 2GJ2A 1NJXA 1SH2A 2DHAA 5T41A 2KU7A 2IJFA 3O2IA 5J1EA 4KHRA 4DV4F 2RH3A 2AJ0A 4W4MA 3C2PA 2QL7B 2ZH4A 1RAJA 1NO8A 2B5JB 3OBIA 1NCLA 3ZZYA 2XC9A 2HSEB 3LP2A 1EKRA 3O1LA 3RW6A 3G8SA 2BV3A 4MTPA 4LF2A 1WELA 4X4TA 1IKWA 4FF2A 1D3WA 1HMVA 2XMKA 2BKOA 1HYSB 3V6DB 1FDDA 3NCPA 1O0PA 3NAHA 5LJ3Y 2I5JB 2ZH1A 1LV5A 1S1UA 3QO9A 1XWLA 2ACYA 3HKZD 1UW9A 2VKRA 1KC8T 3HSGA 5C2GA 2Q6CA 2ZOGA 2FVRA 2WBRA 1VCTA 4NWBA 1CPZA 2DGUA 6FDRA 1E6VA 1C0UA 1IBLF 1RTHA 1C1BB 2QO3A 1X4DA 2ZVSA 1GEHA 2P2CB 2HFZA 1HQEA 2FY8A 3SQGB 4ES3A 3OFEA 3CD5A 2EK6A 2ZJRQ 2VQFJ 4KV8B 1WC4A 1Y4ZB 1LWFA 4DV2J 2Q43A 4DN9A 2XSJB 3DRYA 4ZHRA 4ECRA 1R0AA 3UWTA 1JLBA 1WKLA 3RBEA 2MQOA 2H4WB 2HQGA 3GV8B 4RL1A 1U8WA 1T9VA 3H59A 3GIJA 3RB3A 3B4DA 2LCWA 4J9RA 2DJWA 2XYGB 2I2YA 1M5PC 3HD2A 3B4MA 1LWCA 3TEGA 3OJSA 3N01A 5A8WA 4O44B 1UCNA 2DGWA 3UN5A 3V81B 3DGPA 4QW9A 1H98A 3TR5A 4JI2J 3PYGA 2XMVA 1VRTB 5DG9A 4PKDB 3A8JA 3ENQA 3UR0A 2KDOA 4CYUA 1TL7A 2N3LA 2J9EA 2M7SA 2MY8A 1C4CA 4RBVA 1ZM3A 2Q1LA 1U25A 2IRXA 4N56A 5F0WA 3RBDA 2ZNYA 4OYIA 1NKBA 3B6BA 3J81j 2W9AA 4I7FB 3D66A 4WWSA 2F4VJ 2W24A 5D6GA 4AD6A 3PZPA 2ZUGA 3VAJA 4LF1A 3SCIE 3TA1A 3TX8A 4RR5A 3KHLA 4QWAA 4OZNA 3DLGA 2FD2A 1CBKA 4X4PA 4ECTA 5DGBA 5LSRA 1FNXH 5FD1A 2J7WA 2FHKA 1FXDA 4I6WA 1U8SA 4L72B 1AUDA 2DH8A 1VBKA 2LQ9A 1ULRA 4F4XA 2DPIA 1IM4A 2OPRB 2Y8YA 2JVOA 4ECWA 2XI3A 4PG6A 3TZYA 2Z30B 4G1IA 1X9MA 5KFLA 1QD1A 4X64J 3THVA 2X1GA 1REGX 4K4WA 2DEIA 4MIAA 1U47A 2KTQA 3NXZA 1Q5YA 2DGTA 1BLUA 1HWJA 4KYZA 4NL5A 1JK9B 2IPOB 3LWLA 4W90B 1R89A 4DX7A 2M88A 2AGPA 3T1HF 4JI1F 4FN5A 1FHTA 1IKYB 3OPKA 4BWJA 2FJXA 2J6UA 2IYIA 3C6TB 1X5SA 1RABB 3CXCR 1N33F 4O3RA 5HP1B 5HQLA 3TANA 3H5XA 1Q0NA 1S1TA 2D41A 4C98A 2B9XA 4DQSA 3FSXA 3P3DA 4JI7F 3HVRA 1OY8A 4YB1P 2BQRA 4KPCA 1BQMA 1XNRF 2HPUA 1SCJB 1WC6A 1WF0A 4U8YA 1YZ7A 1GXUA 5L38A 5AJ3J 2PEHA 1SQEA 9RUBA 2CA9A 3ILOA 4WE1A 1T9WA 5CHCB 2V5HG 1E6YA 4WK3A 2IC3A 4U96A 4X4NA 5E3PA 3M2UA 3BSOA 4FF3A 3TYTA 5B0EA 3EE3A 1HARA 3KLFA 2DNRA 2JDJA 1YTYA 2VUGA 2FLOA 3ZZOA 2XS5A 1CJVA 3MEEA 3M8QB 4ENOA 5FLXU 1TK5A 4DV5F 1EP4B 4ZP6A 2AJ2A 2J8SA 2IM1A 2E7XA 2AU0A 1QE1A 3OSPA 2BE9B 1VQ9S 2FJWA 1VJWA 3RB6A 4U6PA 2GNKA 5D4OA 5B0DA 1NH7A 2DXDA 4YUDA 3QGGA 2D9PA 2XWYA 3HLUA 4FXWA 2XB2D 3WIVA 3UDEA 2ZJQQ 4ED6A 1T9TA 1U6BA 3BZQA 2CRLA 3HSZA 4IUFA 4QYZJ 2DHHA 4FKXA 3C6UA 3GFZA 4Z7YA 1WD6A 3KUHA 4BDPA 2QL9B 4JI8F 3GCXP 3KK1B 4Y34A 2HFSA 5GMEA 1NK9A 2ZC3A 3H5SA 3D2WA 1RCXB 5K8NA 4HR2A 3E51A 1P1TA 5EDWA 5H9EK 1XMOF 2F65A 2IRYA 1KVKA 3NOCA 2NQPA 3HVTB 2ATLA 2EK1A 3BDPA 1EETA 4HTJA 3VR1A 2IM0A 1X4EA 4A47A 4CTAA 4NLDA 1U0HB 3BKFA 4FF1A 5ADZA 3EM1A 3NMAA 1FKPB 3KG4A 4O3OA 4PG5A 3KMSA 2FZKB 2BJ7A 1RWKB 4GC6A 2MLZA 3QIDA 2XO7A 2P6TA 4LFBJ 2YKQA 1APSA 1M5HA 1TVRB 1UL3A 1I51B 2R4FA 3DLJA 4DV7J 2AGQA 4PQUA 2MQNA 4H4OB 4RO0A 4XK8C 3BQ0A 3M05A 3QZ7A 4L6V3 2XS2A 3BSNA 3BGRB 3CT9A 2Y3YA 2LEBA 4EEYA 2PFDA 4LF6J 1N5YB 1UWBB 1IWAA 5GAHI 1HA1A 3MMJA 2F8EX 4DX5A 2RU9A 2RHQB 2MB0B 4LRBA 2V0NA 4NEZA 4WIQA 4M94A 3CJRA 3MOJB 2XNRA 3GJRB 3TZWA 1GAOA 2MZ1A 2CQPA 1FRKA 4F0KA 1VC5A 2WVEA 1PBAA 4EGLA 3ET6B 1OYEA 2ZZMA 2RDDA 4R0JA 1T3OA 3QT6A 2FJBB 2BUNA 3QT5A 5E2QA 2VU5A 5CXTA 3W8PA 2BW2A 1H0HB 5IT9Y 1TV6A 2EKNA 3PEHA 3RAXA 4OZLA 3WX8A 2WSEC 2CNLB 2C2NA 4R25A 5CZXA 1X7VA 2CNKB 3G87A 3NOGA 1TKTB 3H20A 3NKYA 3BO2A 3D6TB 3ZZPA 2FC8A 5HVFA 3EYZA 3BS9A 4B9SA 3M2VA 3KFWX 1S1UB 4MIWA 3NGTA 1V9OA 3N6NA 3MZIA 3VHQA 3IR5B 4DV0F 3P96A 3M2RB 4ES2A 2FJAB 1SL2A 2FY1A 1E6VB 3KLHB 4OV1A 1C0UB 1RTHB 5FJ4A 1R8BA 2R8KA 2QFIA 4ED7A 2APOA 2BKPA 2GZOA 2UUBF 2ROPA 3BKTA 2CDQA 1ICEB 4PXEA 2HZVA 1R0AB 2YKPA 4R8UA 1KQGB 2UVWA 2CPYA 1FRMA 3M32A 1MLAA 1J5EF 1JNZB 5DETA 1TKDA 3OUYA 2XMJA 4PUOA 2V4RA 2V4JA 2VPYB 1NHUA 2GQCA 2ZITA 4P2MA 4Q2MA 2IMWP 4DV6J 3UDLA 2Y1IA 5HLFB 3Q8VA 3TI0A 4K2XA 3L7UA 1LNQA 3DGPB 2WBMA 1U2CA 4JV5F 3BPSP 1F3FA 3MD3A 4K7QA 3GYNA 3JSMA 4M5IA 4AL7A 1HHQA 2YNHB 2JFDA 2E7WA 3QQCD 1U1LA 1M0SA 4OHYA 3THPA 3CW2C 2KG0A 1RT5A 3M8PB 4LF4J 3N6MA 1SH3A 3AY0A 1Q86T 1RDRA 1RKIA 4LFCJ 2H5JB 2GQQA 1KBRA 1U1NA 4QIWD 1IVZA 4RLEA 3OLAA 1EX8A 2OPQB 2IA0A 5HBMA 3FFIA 2K06A 3UW1A 4HL9A 2FC9A 3EGVA 1JX4A 2E1PA 1J5OB 5F41A 3BEGB 4DL7A 5C24B 4GMKA 3OVBA 3NBPA 4JI6J 3QPIA 1MMLA 2VOPA 3T5HA 2W7AA 3VAHA 1P9YA 1YJNS 3M6XA 1SI9A 3LP0A 3UCUP 3W2WB 4WFXA 3LW5C 2RS2A 3TUZC 3K5NA 2W7OA 3DYAA 1T95A 3DLHA 4YB7A 3DRSB 4MH8A 2BJ1A 2RVJA 2XGQA 3BYRA 4H4KC 4D3GA 2HFNA 2ADBA 1PAEX 3U1LA 4JI1J
chains in the Genus database with same CATH topology
2PI4A 1HNIB 2OTJS 4J9SA 3NBPB 3T6JA 5J2MB 4CO5A 3M1VB 3ETOA 1FE4A 4X4OA 2DNYA 3DRXA 2KT3A 4J37A 1RT7B 4TQSA 4MK8A 3PW2A 4PR6A 1S79A 4K4YA 2E1CA 4WFYA 1GXLA 1ZZFA 3RTVA 4FYDA 4DQQA 5KTQA 3M9NB 4ZCMA 1VQOS 3MR5A 1BY9A 1REVA 3I87A 2XGPA 3FZ2A 3MFIA 4K5SA 3BR9A 3KK3A 4X65F 4Z37A 3Q8RB 2B7BB 2I1RA 4OHVA 4ZCIA 2R2TA 2G1DA 4WU3A 3DLLQ 4B3RF 4J9OA 2DNZA 2H9ZA 4ES1A 3CJ0A 3DYAB 5BR8F 3FVYA 2G4BA 4RNFA 2N4CA 4B02A 2B6AA 2RB7A 3CCSS 4TY8B 1TL3A 4OL8A 2GHVC 2KT2A 4URQU 2V8DA 4BC9A 1P27B 5KAKA 4LF8F 4JI3F 3CCVS 3I9V9 3RB0A 4X4VA 2BRKA 2HLTA 5JUMA 4F4ZA 1KVJA 1CQNA 4U7CA 1N56A 5CYMB 3J7Z5 5CQGA 5U47A 1PO6A 1UVMA 1VK3A 3GIKA 3VAKA 2B4VA 3B8HA 4B3OA 1KVIA 5D8HB 4B9NA 4FP9A 1CC8A 3OR2A 2Z4PA 2ZFHA 5CYJA 4O4GB 4DL4A 3KLVA 3VTIA 2BYCA 1K73T 4ID8A 1Q7LB 3LGMA 5KFJA 3D1HA 1H3DA 5BJRA 2N7CA 2OLWA 2OP5A 4CZCA 3F73A 3TAPA 3OFHA 3O5TB 2ZBCA 3N5FA 1S72S 4ZPCA 2JJ4D 4NA1A 1Q16B 3EX7B 4X4SA 3E3XA 5JXSA 1OQ6A 1O8BA 2MGZA 5HI7A 1JLQA 2HZCA 2W4DA 4ECYA 4DL2A 2HHHF 4Q0BA 4LSNA 4ETXA 2DD8S 3H5YA 3KK3B 1R31A 2KKHA 3VALA 4DF4A 4BHQA 4A8FA 5EX3A 2WCXA 3OXLA 1FXLA 2KFNA 2WTFA 3NGDA 4I6YA 2H5EA 4K0KF 2NS1B 3IWXA 2VA2A 5E0OA 4U7UK 4DL0C 4KSEB 2F8HA 4RUAA 2BE2A 4NOHA 1X4AA 4WE1B 1XR6A 4HTIA 4OX8A 3JYTA 4AQYF 5KFBA 1MU2A 4FNHA 2BRLA 1RTDA 2B6AB 1MROA 3HFKA 4IKAA 4V19X 1DFDA 4OI4A 2MZQA 1TL3B 2XMMA 2J5AA 4TN2A 4CO4A 3S8SA 3OTEA 2WB4A 1DLOA 2NSCA 2XCAA 2OSRA 3A1YG 3HHLC 5D4LA 1AXQA 2ZHAA 1CEZA 1DJ0A 2OD6A 4C3MA 4QQBA 3MXHP 4E0DA 3KLFB 4DSKA 1QAIA 2FHOB 1YHQS 2VZ9A 1S6QA 4B3OB 5E33A 2HGMA 2Y1JA 1T3NA 1HI8A 4KHPF 1JLEA 2HGLA 3OR2B 2DVIA 3MEEB 5K5MA 3OL6A 1ZPVA 3N28A 4J9PA 4DSLA 5IFMA 2C2EA 4MFBB 3PHEA 3DRPA 1TZ0A 3FRYA 1P6TA 1JKHA 1MWZA 1VQSA 4P7TA 2ZH3A 1Q53A 1VIOA 4DF8A 5F8JA 2RIJA 4LFAF 2DNKA 1Q79A 2GIQA 2MQLA 2O3DA 4IFVB 3HVAA 3N5BA 2YX4A 2VG5A 2HHWA 1JLQB 3LOUA 1G1XA 2MMYA 2FGCA 1XTZA 4LSNB 5LSLA 4F2RA 2QZ8A 3CD7A 2DCUB 3IGNA 1QJHA 3M30B 1RA7A 4LF9F 3IWNC 1M5OC 2LQ5A 3R5CA 1VS3A 2KVIA 5KFRA 3KWMA 2HFOA 3CC2S 1LKZA 2W4PA 4C97A 3QWUA 5A6PA 3K5MA 1UA1A 1URRA 2WHOA 2CQDA 3ENVA 1YRTA 4PG4A 5HMZA 3JYTB 1RTDB 5B0GA 2R2SA 1MROB 2DNMA 4HDHA 2IVFB 4Q7AA 1DQ9A 1U6FA 2QA4S 3MI7X 4YFUA 4AFFA 1U1KA 1DLOB 2CKWA 2F9DA 4KHMA 2DGXA 4QR0A 2ZNZA 2KG1A 5LMUF 4OI1A 3HF5A 3SFUA 1OQ3A 3UFCX 1S97A 1FEHA 1S48A 3OQ2A 3PEJA 1NH8A 4OJGA 2E1RA 4G1QA 4MYUA 5LMNF 2BDPA 2HQ3A 1ZTWA 1DTQA 3NGKA 1SJ4P 5E7OB 5FIIA 1S6QB 1KEKA 1AROP 2L9NA 1JLGA 1T7PA 4NLQA 2JSXA 2HNYA 4QYRA 1K1QA 1NRKA 1JJ4A 2MKCA 3TAMA 4MJKA 1U09A 3IAM9 3PRBA 1TFWA 4B3MF 3UCZP 5GADU 4GO5X 1DAXA 2QMWA 3M8SA 4DR4F 2NLWA 4PPZA 1DRZA 1FVQA 4K4XA 4KIAA 1G7CB 5B0FA 1R8CA 1HW8A 3D0IE 2UVWA 5LSOA 2EC0A 4UW2A 2HG4A 2QSFA 4A8YA 2CQIA 5E3CA 3FQKA 4C7QA 3TVZA 1VC0A 3NNCA 3KHGA 2CJKA 1SL1A 1RT6A 3IAS9 3SCJE 3GIIA 2D74B 2J8AA 2EKYA 1M5VC 1YJVA 2CFXA 3LGNA 2FTRA 1HI1A 4MK7A 3VQSA 5CCLA 3BB5A 2DHXA 1MMDA 4B17A 4DN0A 4EU0A 3HM9A 1U1QA 3J7YI 2E9ZA 4IQMA 3OLBA 1WF2A 3J80Y 2B4OA 4PG8A 4IRKA 3HT3A 2PFFB 2F1FA 1RI7A 2MDAA 5ITHA 4O23A 4ALZA 2R2UA 4D3HA 3ITHA 3E2EA 4RW7A 1VQ5S 1N0UA 2J6SA 5F8IA 4RU9A 5KFAA 5IT0A 2XMUA 2U2FA 3ZZRA 1Y7PA 4G1QB 4Q45A 4DL5A 3KLGA 3CC7S 3VWSA 3HHLD 5G4DA 1FCAA 2I5JA 3U7JA 3SSRA 2CYYA 2YWFA 2X1FA 1GXTA 4ZLPA 1ZZNA 1RWUA 1KFDA 3EUNA 1JLGB 5BYQA 4LVOP 2XG8A 3TVYA 2YKAA 4Q44A 4DG1B 3Q8QB 2AJQA 3POTB 5L1LA 5K8MA 1JLFA 4FNIA 3PW5A 1D1UA 4XDCA 4HKQA 4DFPA 4L3NA 1WHYA 3TAMB 4WIIA 2QEXS 4CNYA 2VV5A 2CPHA 3Q2SC 1NK8A 1B7FA 3P5TL 1FJ7A 4Y2KA 2ZE2B 4NYZA 3CUNA 4K50A 3DU6A 1FE0A 3SCLE 3LALA 3GSDA 5KFOA 4KO0A 1WTBA 4IDKA 3PO5A 1HL6A 1Q8IA 1FT8A 2PMHA 2MHNA 4NYPA 3AA9A 3DM2A 3N4WA 1VBZA 3WC0A 4IYQA 1RT6B 3RZAA 3BDEA 1NNDA 2FB0A 5L1KA 5A2QY 3RR8A 2D3OR 3SQGA 3U1MA 2RJZA 3QJLA 1HFEL 3CULA 4PQUB 2VG7A 1DURA 3T3FA 4I69A 1XR7A 2AF6A 4NYOA 2GMHA 4X84A 2LQJA 2SXLA 3EPGA 1VQMS 4WFBQ 3HKWA 1TQLA 3ITHB 2CJAA 3AAWB 3FGVA 4RW7B 5L8RC 1X4CA 2CQ1A 4QR1A 3WC2A 4ECZA 4LF7F 1TP7A 5KOWA 4H4MA 1BQNA 1DZ5A 4F67A 3N79A 3KLGB 2NPIA 2RILA 1W25A 4NLWA 2CG4A 3DN9A 1GT8A 2X3GA 2C22A 4O4RA 3KTQA 4KTQA 1QVGR 1FESA 5F8HA 2ASDA 2W8KA 4DFMA 1VK8A 1JWWA 3SXLA 1KQSR 3QJJA 4PXCA 4C8YA 5EWFA 1JLFB 2Z2MA 3GB0A 3I5BA 4K59A 3BGUA 4A46A 3M8RA 3OHAA 1HNWF 4WU2A 1M90T 1N48A 1XMBA 4MYTA 1TK8A 1TL4A 5IM0B 2F7VA 2BJEA 1U6ZA 2WK4A 3O6QA 2V94A 3TA0A 3I0RB 4IDKB 2J7UA 4KT0C 3DM2B 4KE5A 2HW3A 2MJUA 1LWEA 2RQMA 1RQ0A 4QZVB 1CSJA 3PKMA 5KFXA 3OXFA 5MLCV 3P49B 3R1HA 4RUHA 3DOKA 4O44A 2QFJA 4B9TA 1ZAVA 1NEEA 2KHCA 1N52B 2VG7B 2YNIA 2Z2LA 2L08A 1YBAA 3NCQA 4ID5A 4FF4A 1SKRA 4OMFG 3C3LA 3V81A 2K3IA 3K8VA 2ASYA 3MMBA 2ABYA 5E3RA 3LAKA 3I55S 4M5DA 1VQYA 3V6JA 1XNQF 1U7LA 4I4BA 3PXGa 2HMIB 5CZVA 4G1PA 2GGPA 3PNIA 2FVQA 2J0XA 4YQWA 1YJRA 4TKTA 4DUYF 5K14A 4V19J 3DLEA</