2M8HA

Rrm domain of human rbm7
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
b'GSEFELRRQQALAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 7
publication title RNA binding properties of the human NEXT complex
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 13
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m8hA00
1AUDA 2MSTA 2DNYA 1YTYA 2AYEA 2A3JA 5HO4A 2MKJA 2MYFA 4CIOA 2RQ4A 1HL6A 1H2VZ 2E5IA 2G1DA 2QFJA 1M1KT 2DO0A 3CXCR 2KHCA 4WCEQ 2OJ3A 2VODA 4CQ1A 5ITHA 4RU2A 3MOJB 1FHTA 3S6EA 5DETA 2KT5A 3I55S 3R1LA 3DXBA 3THTA 1URNA 2HYIB 2LXUA 5CXTA 2I38A 4ERDA 2DITA 1VQ5S 3CMAS 1U1RA 2DNPA 2LEBA 2BZ2A 2F3JA 2M0GB 1WHVA 4IOCQ 2DGTA 2JVOA 1FJEB 2DNRA 2CQ1A 1WG4A 3P5TL 2RS8A 3MDFA 5IFMA 2ZJQQ 1K8AT 3MURP 1FT8A 3U1LA 2DNLA 2K3KA 1X5PA 1K73T 1U2FA 3NS5A 5DM6Q 2MQPA 1SJ4P 1VC6A 1OWXA 3SMZA 3RW7A 3UCZP 2LYVA 1WG1A 1WF2A 3TO8A 2ZJRQ 1O0PA 5DDPC 1M90T 1IQTA 2JRSA 4U67Q 1WHYA 3VAJA 2QA4S 2FHOB 1U1LA 5DDQC 1WF1A 2NZ4A 5IQQA 3CCVS 4QQBA 3NNCA 1A7GE 2KRRA 3NS6A 2MKCA 2ERRA 3ZZYA 1KC8T 3B4DA 2MZSA 1WTBA 4A8XA 2CPIA 2F9DA 1JJHA 1Q81T 4W90B 3U1MA 1HD0A 3J7ZT 5LJ3Y 1JJ4A 1VBXA 4WKRA 1H2UX 1F9FA 1U1KA 2DGQA 2L41A 3LQVA 1YJWS 3CC2S 2DB1A 3CCMS 4YOEA 3G9CA 4LJMA 1SJ3P 2CPYA 2DNNA 2EVZA 1VC0A 3SXLA 2CQ3A 3OW2R 2LMIA 1U1NA 2LA6A 3R27A 3CD6S 1G2EA 3US5A 1YITS 1NO8A 2E44A 1JJ2R 1KD1T 4FXVA 1WELA 2RRAA 2EK6A 5GVQA 2Q79A 2LQ5A 2U2FA 3THPA 2MMYA 2XS2A 2DNOA 2FY1A 2DNZA 3G6ES 2M8DB 3BS9A 2CQHA 2AYMA 3SDEA 1M5PC 3RW6A 2KYXA 3ULHA 2DGOA 3CCQS 2MGZB 1N8RT 1K9MT 2XS7A 1X4CA 2GO9A 5MLCV 3G71S 2X1BA 1R8HA 2KFYA 1VQOS 2KXNB 5LXYA 4CH0S 2AYGA 1WG5A 2XS5A 2DGSA 2HGNA 3CCLS 1X4AA 2MQLA 3G8TA 2MY7A 1FJ7A 4PRFA 2DIUA 4EGLA 2OTLS 3CCJS 2V94A 2MKHA 1FXLA 2RNEA 1QVGR 2MZQA 2M2BA 3S01A 2DNMA 1WI8A 2DISA 1Q86T 3LPYA 4FXWA 3UWTA 1FNXH 4J5OA 1WEXA 2DHSA 2MZRA 2ADCA 4ZKAA 3CCRS 2DHAA 2LEAA 2UP1A 3VAMA 2GHPA 1UFWA 1X4DA 4IOAQ 2FC9A 3MD3A 1X4FA 1PGZA 1WHWA 2AD9A 2N3OA 2MKSA 2F9JA 1X5TA 1WEYA 1DHMA 1SXLA 2BOPA 2CPZA 2ZJPQ 4M5DB 3V4MA 5CYJA 3MD1A 3J7YU 2K8GA 3G96A 1NJIT 3FEYB 4ED5A 5GMKa 4BS2A 1OO0B 1WI6A 1D9AA 2KVIA 1X5OA 2PEHA 2MQNA 2MZ1A 2DHGA 2LKZA 2N82B 2LECA 1VQKS 5DM7Q 2B0GA 1DBDA 1N54B 2KM8C 2LA4A 2KG1A 2X1GA 3TP2A 1U1OA 4IO9Q 2D9OA 3IRWP 5D77A 4Y00A 1VQMS 3CC7S 2JVRA 2DH9A 3UCGA 3DLLQ 3HI9A 1VBZA 1CVJA 3NNAA 1M5OC 2HGMA 2M88A 2CJKA 2OIHA 2X1AA 1VQ9S 1U6FA 2DNGA 2MB0B 4OZ0A 2RUGA 1S72S 3CCES 2FPHX 1U1QA 1YI2S 3PIPQ 5LJ5Y 4PR6A 2N3LA 2G4BA 1R8PA 2J0QD 3MUMP 1FO1A 5GAHU 2XSFA 2MHNA 4Y0FA 2CPFA 2YH0A 1VC5A 2M8HA 3SDEB 1WWHA 1L3KA 2DGVA 3G4SS 1SJFA 2M9KA 2JWNA 4OZ1A 3CPWR 3K0JA 5DDOC 1WF0A 2CPEA 2DH7A 3VAIA 1X0FA 2N7CA 3MUTP 2CPHA 1X4GA 2YTCA 4F02A 1QVFR 2DIVA 4WFNQ 2E5JA 2J0SD 3NMRA 2YKAA 4P6QA 1X4EA 2KRBA 1KQSR 3MUVP 3VAGA 2M52A 2QEXS 1M5KC 2HZCA 3VAFA 2RVJA 2VOPA 2E5GA 5JVHQ 1OIAA 2G0CA 1VQLS 1HA1A 2KU7A 3VAHA 2AYBA 5IM0A 5EN1A 2MY8A 2ADBA 4TU7A 2CQBA 2MKIA 3CF5Q 3UD3P 2MSSA 3G8SA 5LXRA 5FJ4A 2M4MA 2CQ0A 1FJCA 1P1TA 2L9WA 2DO4A 4C7QA 4TU9A 4V19X 4CH1A 2CPXA 4F25A 1RK8A 2WBRA 2KN4A 2CQDA 2M7SA 1OPIA 3EX7B 2MXYA 2CQIA 4TLQA 2J8AA 2RT3A 1VQPS 3TYTA 3Q2TC 2XNRA 3B4MA 1D8ZA 2KM8B 4QPTA 2D3OR 2MZTA 2MQMA 2KXHA 4Z2XA 2OSQA 1VQ8S 1YIJS 4UY8T 2O3DA 3EGNA 1YWXA 3CULA 1N52B 5LSLA 5GAEU 4TU8A 2DNQA 5GAGU 1KOHA 1UP1A 2RU3A 1BY9A 3I56S 5GADU 1QM9A 1Q82T 1X4HA 2DGXA 2MQOA 4LIRA 5JVGQ 3CC4S 2YWKA 2E5HA 4QU6A 2D9PA 2DGUA 2DHXA 2MJNA 2DNHA 2J76E 1U1PA 1ZZNA 1H6KX 1ZH5A 4W92B 2LCWA 2MGZA 1XN9A 2L08A 2MKKA 3CCSS 3H2UB 5CA5A 3VF0B 2CQCA 1VBYA 3P49B 4LMZA 2VOOA 1M5VC 1H2TZ 3D2WA 3NNHA 4QU7A 1SJRA 3EGZA 4PKDB 3VALA 1Q7YT 1PO6A 3JB9k 3R1HA 4C4WA 2MJUA 2XB2D 1VQ4S 4F26A 3CTRA 3ZZZA 3CMES 1VQNS 2RQCA 4WFAQ 2HGLA 2CPDA 3BO3A 1S79A 2LXIA 3S7RA 1SJQA 2EK1A 2XNQA 3N9UC 2FC8A 1JMTA 2JX2A 2OSRA 2VONA 2DK2A 1RKJA 3FEXB 3HHNB 2CQPA 4IUFA 3UCUP 3BO4A 1U6BA 5H1SV 3PIOQ 1HD1A 4WFBQ 1UAWA 2KG0A 4UQTA 1DZ5A 3IWNC 2CQGA 1YJNS 5IM0B 4YB1P 2I2YA 1YJ9S 2KH9A 1VQ6S 2SXLA 2CQ2A 2MZJA 2M70A 3UD4P 1U1MA 2KXFA 3CCUS 3H2VE 3UE2A 3MI7X 1N88A 3CUNA 4YUDA 2DH8A 2CPJA 1B7FA 3BO2A 3Q2SC 5BJRA 1P27B 5D78A 2PE8A 1A9NB 3BEGB 4WF9Q 2NLWA 2U1AA 2OTJS 4WIIA 1NU4A 1X5SA 2CQ4A 1ZZFA 4C0OC 1KOOA 2DGWA 3P6YC 3P3DA 2MQQA 2RS2A 5HL7Q 2YH1A 1UW4A 2HVZA 3MXHP 3S8SA 3VAKA 2X1FA 2KI2A 1VQ7S 5DDRC 1WHXA 1DRZA 5LSOA 1YHQS 2RRBA 1W2BR 1WEZA 3L3CA 1X4BA 2DNKA 2MPUA
chains in the Genus database with same CATH superfamily
2DNYA 1SQGA 3H8YA 5HO4A 3AHPA 5AXLA 3C19A 3O44A 3HXMA 2AEJA 1KRPA 3TZXA 2QLBB 4AXIA 3GILA 3DXBA 3TJAA 1GXLA 4DLEA 4RL1A 1PC4A 1CG2A 3EZOA 1IR0A 3IBCB 5KT5A 2DNPA 1RAFB 2LQ8A 2M0GB 1WHVA 2E1CA 2FLPA 5L9NA 4UTGA 3NAIA 2PDAA 3N28A 3QJPA 3KG1A 1X5PA 5B0FA 3SSRA 3UCZP 5KFEA 2MHEA 5J2NA 1IQTA 3KJVB 1UPPA 1YRTA 2HIQA 4CLFA 5DLFA 1RAHB 3K89A 1KC8T 3MPVA 4DV6F 5AXKA 1I51B 3M32A 1HD0A 4ED4A 3D3CJ 3I5BA 1IWGA 3EGWB 5ETNA 3MR2A 4DV4J 4G1QA 3EVMA 1NB2A 2EFOA 4PXBA 2FIUA 3GJTB 2UUTA 3THPA 4CZCA 1S6OA 1GXUA 1HQ2A 3SDEA 4OI3A 5H9FK 3HM9A 2NREA 1N8RT 5CAAA 3H7HB 1F3VA 3SBMA 3QGGA 2W4CA 3DLKB 1HPZB 3PR4A 4C8YA 1RHMB 3KYLA 2MQLA 4ZLLA 4EUVA 4EGLA 1DAXA 1RACB 2V94A 2WONB 1R43A 4FXWA 2L9DA 3RAMA 4LBPA 2F63A 2ZOFA 3MTKA 3ISNC 3BPSP 1AB8A 2BV3A 1NNDA 1WHWA 4GVBB 4WBFA 2LFVA 1HQEB 2Z8QA 4JV5J 4OHVA 2D3ZA 3TA0A 3TAPA 2R7VA 3DRRA 2LECA 3T19A 2ZVIA 2DXFA 2CAJA 2DR5A 3GFYA 3KJQB 1ZS6A 4NLUA 3CC7S 3DLLQ 2HGMA 3BBFA 4HT5A 1H7WA 1Q5YA 4ZLPA 3UQSA 1FD8A 3TWZA 2EW9A 2G4BA 2QMUB 3NY0A 3MUMP 2CDRB 1ZM3A 1BWVA 4DFKA 1NK5A 1L3KA 1TL1B 2OEKA 3K0JA 1DQ8A 1X0PA 5DDOC 2YTCA 3Q83A 4QOTA 1RCOB 3R7BB 1CJTA 4J91A 3KLIB 3W5YA 4DV0F 1FNMA 4MTPA 2XZDB 1XQIA 1J27A 4YB6A 3OVAA 5DZ7A 5EN1A 3UNGC 2MSSA 3GSDA 2CQ0A 1K1QA 3MM5B 3OTDA 4O4GB 3GQCA 4FS2A 3T1HJ 4DR7J 3BBCA 3ILLA 3F41A 1V3ZA 3BDPA 4Q45A 1LKZA 1YWXA 3LWLA 1IKYB 5LSLA 3W9HA 2K7KA 1VBKA 4X66F 5L8RC 1REVB 3M6WA 1IJFB 1IUJA 1KONA 2QRRA 3O6QA 3DRYA 4RUAA 1PC5A 3EPGA 3AJDA 4A8WA 2GGPB 3CMES 3SQGB 2E1RA 2IJRA 2FJBB 5KFMA 5FD1A 2XNQA 3N9UC 3HT3A 2MKYA 4Q2MA 4X4QA 2XY6A 4RW9A 1HD1A 4MFBB 1MN9A 3JXOA 1QDUB 3VR1A 1NDKA 2CQGA 3QO9A 3FDSA 3OTEA 1X9SA 4OX8A 3R97A 4B3TJ 3OL8A 4RBVA 1IBKF 5EWFA 4Q2LA 1WKKA 4J9NA 2EBEA 2R4FA 1LW0B 3HHLD 3MAAB 4P7VA 1KBRA 2PMWA 1X31C 2R8KA 3QRQA 4N5SA 1S1VB 3AA8A 4PUOA 3NS7B 3NXZA 2ZOMA 5I3PA 5HI7A 3RB0A 1VQ7S 4YY3F 7FD1A 5KFAA 3H5SA 3PYDA 5CD4H 1HMVA 2WZ1A 2A3JA 3D0HE 4A8OA 5KG0A 2KHCA 1YJTA 3HPOA 2B4VA 2IDLA 4K50A 1S0VA 2HYIB 1WDTA 1H7XA 3Q8QB 3RB3A 4W98A 4JUZA 4UOHA 4AXJA 4UY85 1T7PA 4IO1A 1WACA 3LANA 4CLSA 4DN0A 2HHSA 3ENVA 1MSWD 3TO8A 1Y4ZB 1R3NA 2QMXA 4F4XA 3MHYA 1N5TA 1SB6A 2UUBJ 1WF1A 1U0HA 3HX9A 2QYCA 1RABB 3ISZA 4UUWA 2RQKA 3NNCA 5A8KA 5JJBA 1XERA 3V81A 1JLEB 2A0FB 1M1GA 2ZBCA 4ZCMA 2IYIA 2J8SA 4CWBA 4C8LA 1KHVA 1TFYA 2XCPA 2C2NA 3K5NA 1JLFB 3OBIA 3SXLA 2R8IA 4ZIWA 2ZVSA 3R27A 3QGHA 4RUHA 5IXUA 1HBMA 4P52A 3D66A 5CCMA 4QPXA 1FVSA 1KQKA 2M8DB 2C2MB 2ZHOA 5KFSA 5BR8F 2BJEA 4V19J 2XMAA 1K9MT 2IAJA 3G71S 1HWLA 3QBCA 2L3MA 1U0SA 3CCLS 3DI6A 3OXLA 1BE4A 2VUGA 2AEFA 1XK8A 3G8TA 3CCJS 2FLNA 2R3VA 2MZQA 3T9ZA 3EZUA 4KGZB 4KO0A 3A8KA 3AJ2A 5LMUF 1QY7A 4MKVA 2JLEA 4A8MP 1ZBTA 2NS1B 1TKZB 5HQLA 1F5CA 1RYRA 3GCWP 2KZZA 3M32B 2XM3A 1WC1A 1MN7A 1H98A 1JB0C 5A2QU 1Q1KA 2BJ1A 2B0GA 1VQYA 2NXCA 2D9OA 5KFXA 1RHUB 3IG1B 2ZBPA 3M6UA 4JBCA 3UPFA 1R8AA 3GR0A 4PR6A 2DY1A 1I94F 2RIJA 2CNNB 3A1YG 1TL3A 4Y0FA 2WBMA 1SC1B 5DQGA 3I9V9 3SDEB 2YKOA 1RB0A 2H3EB 4CI0B 4HL9A 4LR9A 3MM7B 1RHRB 4C98A 4C2MA 4DR6F 3NKYA 2CPHA 3CMQA 3N6MA 2DIVA 2E5JA 3LGMA 2ZDOA 4HH1A 1S1XA 3GE9A 4NL5A 5T41A 3A4TA 4YHHF 1CJKA 4OJ1A 3DLHA 3FFIB 4UZCA 1RYSA 3O1LA 1N56A 5CZVA 2NQPA 2QTWA 2G2ZA 3HHLC 3QZ8A 4B9MA 3OLAA 2WB4A 3AOAA 2BXJA 1MG7A 1N32J 4KRWA 1HQUB 2AGQA 1UVNA 3MEGA 2KJWA 2NCKL 1F2HA 3I5CA 4ZP6A 4NCGA 3RAXA 3K5PA 1AUSL 3DRRB 1T94A 4TU8A 2RU3A 1Q82T 3DRXA 3A8IA 2H65B 4H4KA 4DFPA 3RBZA 1S49A 2P9EA 3CJ4A 2Z0GA 3LP0B 3MEKA 4L74A 2AX0A 4XO0A 2V8GA 4OV6A 4HVZA 4DPTA 2BM0A 3D6TB 2Z58B 3C8YA 3ZTOA 2YX7A 2CQPA 1W25A 2HNZA 4IUFA 2ZWOA 1YBUA 2OP5A 2DKOB 5M2UA 4JV1A 2GMJA 3FGVA 2C3YA 5KFZA 3D0IE 4LT6A 4CM0A 1SUQA 1LWFA 2VFSA 3T1AA 3OJSA 3LP2B 2AHOB 3P3DA 4O44A 2XMWA 4DV7J 3MR5A 1GEHA 1YHQS 3AAWB 2BJ8A 4M63A 3CD0A 1VC5A 1DY3A 5F3TA 3TOQA 3D6MB 2DO0A 2ZH7A 4WCEQ 1O51A 3NGUA 4CQ1A 3PYFA 1VCTA 4HHHA 1H74A 4ZPBA 3V6KA 3P8BB 4JI8J 9RUBA 1VRTB 3DDKA 3EGVA 5IS2A 2BZ2A 2KDOA 4FYVB 1JXEA 4RW9B 3KLFB 3AFGA 3HVWA 3HVAA 2HK3A 5E3CA 5AJ3J 3QO9B 7AT1B 3M9MB 4MKYA 1WG1A 1RHQB 5LM7E 1WSVA 5G0RA 3VAJA 4I2PA 3V6JA 2W9BA 5IQQA 3TZWA 2R7QA 3M2RA 2GQ2A 2V0NA 4X4PA 3QGIA 2MKCA 4ZP8A 1KVKA 1WTBA 2YNIA 1R8CA 2FUG9 1RAOA 4P2MA 4B3MF 5LMNF 3DGVA 3J7ZT 5EWEA 3IA0A 3D6HB 2HQFA 3G9CA 3GYNA 3K5LA 5A8RA 1K0TA 3TRGA 1Y5LB 1B99A 2QA4G 3LH2S 3HFZB 1RA6A 3K8VA 3MPWA 1I94J 2VA2A 4JI2F 2EFNA 3RW6A 1AZSA 3KNGA 1I3OB 4F3MA 1Q4RA 3MMAB 3NCPA 4DG1B 4DR1F 2DRBA 2UXDF 4ZMMA 1D9DA 4MT1A 2AQ4A 4ED0A 1KNZA 2LU1A 4PRFA 3I9ZA 2W4DA 5GAGI 1QVGR 2XI3A 3PX4A 1QAYA 4CTAA 2V50A 3KG0A 4HHJA 4ZKAA 5A8KB 1X4DA 4ECYA 3UR3C 3X1LB 1V9OA 2FVPA 2VU5A 2ZUGA 3MD1A 1Y5IB 2V8PA 2JDJA 3MR7A 2HFZA 1JWWA 5KFVA 2E9ZA 4DPWA 1QUPA 5HQMA 2KM8C 3C46A 3BSNA 4X4VA 1QAXA 2Y9HA 2DH9A 3D1OA 3UCGA 1RU2A 2IBKA 1XNQJ 3BH6B 3KUGA 1S9GB 1T03B 1RAAB 4Q8FA 2FPHX 3CIMA 5LJ5Y 1HBMB 5GAHU 4B9VA 5IOLA 4IR1A 2A18A 3CCWA 3VVTA 3H90A 1SJFA 2FHMA 4L75A 2IM3A 4YN3B 3OHBA 2IAJB 4EFAC 1LK5A 5L1IA 2KRBA 3DI6B 5SUHA 2BE2A 4R8UB 8ATCB 4Q5VA 2VF3A 4NZ6A 1TTHB 1LQ9A 3HKWA 2KU7A 1XMQF 5DS7A 4NEYA 2GJ2A 2ASLA 4ILMA 1X60A 1QE1B 4C7QA 2QJ3A 3QMQA 3NMAA 4DSLA 2GX8A 1UEUA 5E0OA 2EEYA 3FZ2A 4TLQA 1CS4B 2XO6A 4R0JA 3B4MA 3HHKA 3T5LA 4ZPAA 2KXHA 4MYUA 3W1YC 4URSA 4YR0A 4ZPCA 3X3UA 3GIMA 2OKQA 2DR8A 2VBZA 4KPYA 3I56S 4P74A 3F73A 2J7UA 1FRHA 2V34A 5KFQA 3CDUA 2V4QA 2LCWA 2UUAJ 2GMHA 2BKPA 4WTOB 2VIHA 1VIOA 1FFSB 1LEOA 1SJRA 3VALA 3JB9k 2XB2D 4NXNJ 4F26A 1NAQA 1HWUA 1KLNA 2HGLA 4P2SA 2ATCB 3IR7B 4B3SJ 5C42B 1YJ7A 2XI2A 1N34J 2W2OP 1CJKB 2FLLA 3M2UA 2V68A 4M5DA 3MCMA 2SXLA 4X4NA 1Y7PA 3BJYA 5KAKA 4UW2A 1A9NB 3EJMA 3IM9A 4NCGB 4DZDA 1HHTP 2YH1A 3FCWA 2R8GA 3KXDA 3AJ1A 1E6YB 4B3MJ 1VRQC 3H5UA 3UNYA 3OSNA 5D3GA 5LMNJ 1U45A 2ZH4A 1W2BR 1NPRA 1XMOF 1JLGB 4PQUB 2GIQA 2I5JA 1E6VB 1K44A 2H51B 4XDCA 2H48B 4HR2A 4ZVRB 1PAEX 4J9KA 1FHTA 3S6EA 4X4TA 3THTA 3OL6A 4L3KA 2VQEF 1NJXA 1V5VA 2CVIA 5I3UA 4LSLB 2CZ9A 2V8VA 1WC3A 1RT6A 2DNRA 4Q44A 4QIFA 4TVAB 5DGAA 5FDLA 3UVJB 2CRLA 3U1LA 2UXDJ 2OPSA 3OQ2A 2XEXA 4OX9J 1Q8LA 1V3RA 1KQFB 2LYVA 4ANEA 4KGKA 4XAKA 1O0PA 2GS8A 1M90T 1LNQA 1Y9OA 3FZBA 2VH7A 3W60A 2ASJA 1LWFB 3LP1A 4NOHA 3I96A 2BRLA 3AB2B 1ICEB 3AD8C 3NS6A 2FVRA 2HVIA 5CYQB 3SCLE 1ZM2A 4OI2A 4DI6A 3PHEA 3FBBA 4O44B 4HACB 3KTQA 3IWLA 4UT4A 4PYAA 4FVCA 1FE0A 2PI5A 4GKKJ 3UN5A 5BYSA 4B9NA 2X51A 3I82A 5ETVA 4M5NA 4I2QA 4K5SA 3NOCA 4RR5A 3TW0A 3H25A 2ZE2A 4U95A 8AT1B 4KHMA 5T14A 1XNRF 2VG6A 3VZIA 4YMEA 1QSYA 1DFDA 1CSJA 4CT8A 1RT7A 2AYMA 2W01A 4C8MA 3CCQS 3ZZUA 1ZETA 1AFJA 2BJDA 4MYTA 4ES2A 3DOMB 1Y3KA 3K5MA 2R7TA 1UKUA 1EETB 1HR0F 3KK3A 4DF8A 4OHWA 1UL3A 4XK8C 2W9BB 3F44A 3M2RB 1OPZA 1XMQJ 2UP1A 5D4NA 2HQ3A 4QWDA 2Y8WA 1RT2B 1D9AA 5DO2A 2KVIA 2C2DA 5K20B 2HHPA 3MM8A 4DFJA 3Q23A 1RGVA 1NUEA 3PW5A 4QZVB 3HI9A 5D4LA 4XDDA 1BUXA 5C25A 3JQMA 4NPOA 1C4CA 3CCES 3W63A 1JQGA 2B4PA 4KH1B 2J0QD 2W1BA 3R3TA 1VI7A 2MHNA 3CNQP 5HMZA 3G4SS 1LK7A 1PJ7A 4OZ1A 3MCSA 1XR6A 2XMTA 1S1WA 4V1Ak 4LF4J 2V63A 1P6TA 4DQPA 3E01B 6FDRA 1YKWA 3VZHA 2OUGA 4NE9C 2QMWA 3QNWB 1VLOA 2AJ0A 4CTAB 3CGIA 4QCLA 4P7TA 2HG4A 2CQBA 2MKIA 5AT1B 1JXLA 2FGCA 3MR6A 4ZVGA 2XLJA 2UXBF 3EX7B 4CLTA 1L3TA 2PN6A 5F9LA 2XNRA 4LFCF 3LOUA 2MDAA 4KHPJ 2UXCF 2VL1A 3PO4A 2DPIA 2JFDA 1NHUA 2C3OA 2FLOA 2ACMA 5JVGQ 1HNIB 1H72C 3C16B 1H3DA 1U1PA 1IBMF 2QLFB 1F60B 2MGZA 3OJUA 3RTVA 1G7CB 5CA5A 3Q22A 2CQCA 1Q95G 3A3NB 1FNOA 3H40A 3EGZA 1FK9B 1SH3A 1GMWA 1VQ4S 2VBXA 1RA7A 1KDNA 4DR4F 5A0YA 1U2RA 1B70B 2W8KA 2VQEJ 2X7IA 2BE2B 2VONA 1TUWA 1BD6A 4OJHA 3DDNA 4RW4B 1OY6A 1A6LA 4FKYA 1HNZF 3JSBA 4XPEA 2J9DE 3BSOA 5KFUA 1EARA 1RBAA 2I2YA 3ZTPA 1RTJB 3H2VE 2IFXA 2B4OA 1CC7A 5K8PA 3FRZA 3KWMA 2HHTA 3MFHA 4WXOA 1VK8A 4WIIA 3H4DA 3PM9A 4U7CA 2HVZA 4K4TA 3CJ3A 3UFCX 5J2QB 3HZGA 4PCQA 4WFYA 1SL0A 1AUDA 3I5AA 1QSLA 3ZTQA 1S4EA 3TEGA 2E5IA 2G1DA 2QFJA 2MLZA 4M5LA 3ILIA 4GRSA 2XCAA 2DRDA 2YNGB 3PX6A 2OEMA 3EXYA 4OV1A 3PHTA 2LXUA 2VFRA 1UFLA 2XYGB 4PG7A 2AJ2A 1VQ5S 2A1BA 2HNDB 1ZM4A 2L48A 2YBVA 4OX6A 2R7RA 4EWTA 4WE1B 4ZOSA 2OMOA 4YDXA 1K8AT 2ROEA 2K3KA 1U2FA 3ETMA 4ELTA 3BB5A 4IYQA 2BDPA 2E1PA 1G6BA 3J81j 2XMMA 2HHVA 2LQJA 3W64A 4U7UD 4QQBA 1A7GE 3JAMU 4MKAA 2LVWA 4N8NA 3OVBA 2VPXB 1OSCA 1C1BA 1UCNA 2AZ3A 1GXTA 5E3AA 1NK4A 1S5ZA 4HTJA 1JJ4A 3I0RB 3RBXA 5D3GB 4WKRA 3OTBA 2B5JA 2DTJA 4O3OA 4FBUA 3SCIE 4DV5F 5E3QA 3OFHA 3MM6B 2I5JB 5KFOA 1G4CA 2CWXA 4N76A 2BUNA 1KFDA 4MAKA 1JJ2R 2ZZNA 4EBEA 3U7JA 1S9FA 2C3MA 4ZK7M 2V4JA 4A47A 4ZJOA 1FJGF 1SH0A 5T7LA 2XQCA 1RT6B 1BXNA 2B51A 4NCAA 5J2MB 2KFYA 1TZ0A 2Q43A 3C66A 2VZ9A 2OPSB 2ZH2A 1GX5A 4W4MA 1F1BB 4P2FA 5H9EJ 3K59A 2XMJA 5A8WA 2GJFA 3LP1B 3M8QB 4DSIA 3HF5A 4J5OA 4F3OA 5F8GA 3P4UB 1Q78A 2MKSA 3UR0A 1SXLA 3OD2A 3RYLA 2CPZA 4DEZA 4OYXA 3FC9A 4KY3A 4PXDA 1QJHA 2CYYA 2P9GA 4ZN1A 3PW7A 4ECXA 1X5OA 1JLCB 3ENQA 3OTCA 3BGRB 1R0AA 4F3QA 1N54B 3WHIA 3W7BA 2N7YA 3T3FA 3CDEA 3MMBA 3R2CJ 2BBEA 1EHWA 1M5HA 5D77A 2YKQA 3TUJC 1PBUA 2XBPA 2XHCA 3ICLA 2AV5A 4PG5A 2YNHB 1DJ0A 1LW2B 2VG6B 1YI2S 3HHDA 3C2PA 3QLHB 3AT1B 1JK9B 5JUMA 2BQRA 1RT7B 4DFMA 1WSRA 2M9KA 1MLAA 3QATA 5B7WA 3OFGA 3BQ0A 1T3OA 3SZ2A 2K2PA 4QWBA 3CJKA 4IRKA 2DCLA 1OMSA 4ETXA 1DARA 5ETRA 3RRGA 1M1HA 1M5KC 1NMEB 4PZVA 2VOPA 1CQNA 5D6GA 2BA9A 3ZZ0A 5F0UA 1MROB 4AE5A 2AYBA 2MY8A 2ADBA 4B9TA 3UD3P 3IXQA 4GKJF 2CPXA 2KN4A 4JI1F 4IKAA 1OPIA 4C11A 1U49A 2NR0A 4IFYA 2RT3A 1VQPS 4LRBA 4TKTA 4IH5A 3EM1A 3SFUA 3OHAA 1YIJS 1YSJA 1ULRA 3MM8B 4B02A 4QR1A 3CULA 4ICLA 1VRUB 4N41A 1NZ8A 5C25B 4NZ7A 2DGXA 1WJ9A 4UOFA 4DQQA 3JTNA 4YQWA 2HHUA 3OFFA 3CD7A 1H6KX 3UDCA 4XTTA 2VG5B 3WZ0A 4BCAA 5FIIA 3ZZRA 2H9ZA 4R5PA 2DEIA 4NMXA 4Y2MA 4NXMJ 2RQCA 1QTMA 3V4IA 2FC8A 3CE8A 2P6TA 5HN0A 3MOZA 2IY5B 2P8IA 2KG0A 3IWNC 2Y1RI 4OZ2A 4EYHB 3M8SA 4DCJB 2OHDA 4LFBJ 1ZPVA 1N88A 5HVHA 4IDKA 3BKTA 2C3UA 4WXWA 3KDNA 5KFDA 4C0OC 4Y28C 2BX6A 4OJGA 4NLQA 1S0MA 1HYSA 6FD1A 4JYAF 1PYSB 2RMLA 4U9RA 2KB2A 3KK2A 2AX1A 2MKJA 1UVLA 3DLEA 2EWHA 2QG9B 4MIAA 3AXMA 4QYZJ 2YNFB 4K4ZA 4NLDA 1KVIA 2YWFA 3AD7C 3N01A 1EP4A 3PXGa 5E41A 1FJGJ 2DITA 5A0YB 1T8EA 3T5JA 1RTIB 4CO5A 4I4BA 1Y3JA 1FJEB 4BBYA 2HVHA 3Q86A 1MNEA 2CQ1A 3MURP 2ASYA 3DFEA 1RLDA 1SJ4P 2QL7B 1YLXA 1DQ9A 3TA1A 5HP1B 2IYGA 4JI3F 5DDQC 2CJBA 4MMOA 1IBLF 4CNYA 4DR2J 3KNAA 3NWRA 2DPJA 2D69A 1D0EA 3Q8SB 3SSSA 3VQSA 2YQ3A 1YJWS 2H4WB 1KLMB 2VQFJ 2EVZA 5B0GA 3OTOF 4ETZA 1HI0P 1NO8A 2XLIA 5MAOA 3KK1A 4X84A 3IP0A 3G6VA 1SKWA 1Q53A 8RUCA 1TFWA 2W8LA 4OMFG 3PY8A 2FQQB 4BLGA 1KTVA 3BR8A 1RTHB 2R2SA 4DR5J 2BW2A 2WW8A 2KXNB 3DLGA 2AYGA 5A6WA 3N6LA 2XS5A 2KFZA 1TU0B 2AP6A 1SKUB 2GJIA 2LEPA 3VGTA 1FXLA 5GADI 4FNHA 1O6XA 2V8DA 3LPYA 1Z2ZA 2F4VF 5AXMA 2EFVA 2YX4A 2ADCA 4JOUA 1GMUA 2VKRA 2N3OA 1UVKA 4GKJJ 3TJ8A 2BOPA 2ZBRA 2G13A 1CC8A 1M0SA 2MQ8A 4C3MA 4CLWA 4OYAA 2B5JB 2LKZA 1CBKA 2LA4A 3AA9A 4Y00A 3BYRA 2VPWB 1T0TV 1TAUA 4ECQA 2HHHJ 2X1AA 4FNIA 5F8NA 2V4JB 1VJQA 1U7LA 1R7IA 1Q8BA 3OFEA 5KG3A 3NGRA 4QWCA 2XSFA 1MMDA 2P6SA 3GPAA 1PBAA 3TQ1A 4RO0A 4UF4A 3QT8A 9ATCB 2X3DA 4NA2A 4WWSA 5E7OB 2B4UA 3J80U 1R0BG 2Y1LB 2M52A 4U96A 5C24B 2QT7A 4ZP7A 2HVDA 4JV0A 2HHXA 1S12A 1NH7A 3BKFA 1HIYA 3VV2B 5AE1A 1QSSA 5LXRA 4JI4J 2R7XA 2POKA 4U8VA 2AJ4A 4X62J 2WBRA 2WOMB 4Q0BB 5RUBA 4Q7AA 2VPZB 4TN2A 5ETKA 5BYRA 2DD8S 1LWEA 2C28A 4DV1F 4B9SA 5D0RA 1R8BA 4B3OA 1N5VA 4RBTA 3QWPA 4UY8T 3G8QA 1BQNB 3G86A 4Z7YA 4WJBA 2CJXB 4C8ZA 2NYHA 2IA0A 2J6UA 4LIRA 1ZAWA 1YJVA 2DHXA 4BC9A 2V8HA 1F6TA 1SC3B 4OZJA 2J7KA 1UJ6A 3H2UB 4DR3J 1FRIA 5DJBA 4LF7F 3DLKA 1IR1A 1FKPA 3TUZC 3OL7A 1TVRB 2ALZA 3F0NA 3DRPA 3CTRA 4OYMA 4NLWA 4ED8A 4U8YA 3CCZA 2EK1A 4KHRA 5F8JA 1S57A 3ZO7A 1ROFA 1J5EF 1FFGB 4OX7A 2GQQA 4ES1A 4GVBA 4DV3J 3GJQB 7FDRA 1IM4A 3Q24A 3D54A 3FJ2A 4H54A 1P27B 4RU9A 4IFYB 4WF9Q 1YG0A 1HNWF 2BOAA 4JI3J 1X5SA 3S1TA 3K57A 5I4MA 1IBLJ 5HL7Q 1N5YA 3S8SA 4ICLB 5D0HA 5K9FA 2VKZG 1S6PB 4OQJA 4HI2A 3L3CA 3HVRA 5EGYA 1SIZA 1TL1A 4N8OA 3NAHA 1EB0A 5CD4A 1KWMA 2L9NA 3C14B 5I42B 4R5PB 2DR7A 1O5JA 2JNJA 2VB6A 3DOLA 1URNA 2ABYA 4DPUA 4A48A 1U1RA 3J81U 3V4IB 2HFUA 4LQ9A 2LEBA 1S4FA 1DTQB 1KN6A 3MM5A 2C2ZB 4O4GA 4PG8A 5DG9A 3ZZOA 3T1YF 4ID8A 3SMZA 4HEA9 2HQGA 3SV3A 4I69A 2PD1A 4KYZA 4IDKB 3TEHB 2R2UA 1U1LA 3SCKE 3CWJA 4K4YA 5IC4B 4OZ5A 2F4VJ 2C2RA 1RWVB 1RT1B 4GC7A 1TL4A 1TP7A 1CQMA 4NYPA 4O23A 1REVA 2CPIA 1Q81T 2OD4A 2PT0A 3MF5A 3V6DA 4AL7A 1S77D 2UVWA 4YOEA 3TA2A 3FK4A 1SL2A 2ZC3A 2QN6B 4EEYA 2RKIA 3DLEB 1HBNB 2GGPA 3HJFA 3SQGA 4JI7F 2GFFA 2U2FA 1EP4B 2OH2A 1JKHB 4IG0A 1TAQA 4D3HA 3VVUA 4OZLA 3GIRA 1UWBA 2KYXA 1OQ6A 3RG6A 1Z4UA 2BABA 2HSEB 1SVDA 3QPIA 1YJUA 1X4CA 2QA1A 1B64A 4J9MA 2KJVA 1VQOS 4PWDA 4PQAA 3MAAA 3OUYA 2KO1A 2ZHBA 3NGDA 1VS3A 2RH3A 3KOAA 3QFHA 1S1VA 3CEDA 5ETOA 2ZOGA 3KDOA 4N7TA 1TK0A 1V3SA 2LEAA 2PFFB 2VJVA 4H4OA 3J80Y 3QZ7A 4ZVPB 4AUKA 2WTFA 1NJIT 4GC6A 3JSYA 5J1EB 3W3SA 4A8QA 4Q8EA 4KGVB 2FZCB 3H5XA 4WP3A 4NX9A 2IVYA 2CA9A 3SEOA 1X8DA 1M5OC 3PYGA 2CJKA 1B0TA 4HKQA 2RUGA 5KFKA 3DU6A 3CJRA 1VFJA 1N33J 2K3IA 2ZZTA 3R9LA 2XG8A 5DG8A 2YH0A 1AXQA 2M8HA 2DGVA 2G0IA 4LF6F 4ZVTB 3MEEA 4KIAA 1VHFA 3CO0P 3DLGB 3VAGA 2I1RA 3NBPA 5L1LA 1SPBP 3Q8RB 1PIEA 2VFVA 2C2OB 2PMHA 1J5EJ 3W61A 2DXDA 4K0KF 1UZHA 3GFXA 4RBUA 3KHGA 2N4DA 3D6FB 3MPUB 3RRHA 1OY9A 4F25A 2B9YA 1RK8A 5EHHA 2HVEA 5ETTA 1JLFA 1SBRA 2W4PA 4NWBA 4JI0J 5ETQA 1EQMA 2VDHA 3QT7A 4USVA 1YX2A 3EGNA 4OYZA 5KT2A 4DSEA 5HMYA 1ZM9A 4MH8A 3V6HA 1U26A 3MEDB 2MJNA 1FDNA 3OV7A 2F40A 3TUIC 2L08A 1S7HA 1C2PA 2HW3A 1YZ6A 3HP6A 2K7JA 4KQZA 4PKDB 1PO6A 1VQNS 2BRKA 2M3DA 1F9HA 5K14B 3PO5A 2JX2A 4K4XA 3HHNB 1U6BA 4CNZA 3ZFVA 2RDDA 4C8KA 1JNZB 1TKZA 2UU9J 4A8SA 3HHEA 3HHLB 3A8EA 1DTTB 3IAM9 4L73A 3D5MA 2B8QA 3J7Z5 3J81Y 4MK7A 2CPJA 3Q2SC 1RHJB 1YRUA 4CO4A 4LRFA 5LSRA 3IG1A 4P73A 1LWEB 2CQ4A 1RISA 1PKUA 5THWA 2IM1A 4OLOA 3P6YC 4B3OB 4ZVSB 3GMGA 2ZM6J 2A6MA 4IFVB 2PEBA 1N36J 1WKJA 2Z2MA 3L95X 3M8YA 1X4BA 1WUUA 4LBHA 1YTYA 2AYEA 4ENOA 1LV5A 5L39A 3MM7A 3GIKA 1HARA 3HSDA 2QLXA 1KFSA 2OJ3A 5ITHA 1FKPB 4JI7J 1OS5A 4IOBA 3DRPB 2HS4A 2ATLA 4Y2AA 3FFIA 5DGBA 4ZA1A 2WRMA 2XY5A 2ZD1A 2BR0A 2C2KB 5GMDA 1ITPA 2JLFA 1RTDA 2OGUA 4H4KC 5KOXA 4AT1B 3VHQA 3H59A 4OI6A 4BC7A 3KG4A 1S0OA 1HQUA 2MQPA 4C97A 3RW7A 3HZEA 1WF2A 1RTZA 3PNIA 5DDPC 4FP9A 1S9EB 3WX8A 2FHOB 1NK8A 4JI6J 1G1XA 3PYEA 5HMXA 1Q16B 2ERRA 3FEZA 4LR7A 1T9WA 4F2SA 4FYYB 2F9DA 4DL3A 1N5YB 2KTQA 4NEZA 3BGUA 4QR2A 4NLRA 1QD1A 1VBXA 4F2RA 1K47A 4IG3A 1H2UX 2DGQA 1TELA 3LQVA 1FERA 3CCMS 1LXJA 2AWZA 3IS9B 2UVVA 4EYIB 1L5UA 2CZ4A 3LP0A 2DNNA 4FYDA 1YRXA 3ETOA 3O5TB 4FXDA 2E44A 2RUSA 4Y6IA 2NSCA 4GMKA 3RGIA 1HWJA 1IKXB 2Q79A 2FDNA 3I4PA 3DOLB 2MMYA 1CJVA 2BVZA 4DUYJ 1RU1A 5KFGA 3ZZPA 2C42A 5HBMA 3CO9A 3B54A 2HURA 1AT1B 4WZMA 5LOQA 4RNHA 1ZA1B 2RD5C 4YDDB 4K7QA 5B08A 2ZZMA 3LP2A 2DISA 1H0HB 3KUHA 3W2VB 1U48A 1WEXA 2DHSA 3VAMA 2GHPA 4URQU 2H5IB 1UFWA 3MD3A 3BV8A 5C5JA 3EVWA 3BN7A 5CYJA 1AFIA 3V6DB 2Z2YB 1OY8A 2DHGA 1FXDA 5U47A 3TP2A 4CYUB 2UVRA 4O3RA 1MU2A 2BJ3A 2RKIB 3WX4A 4MKBA 4X4RA 1VRTA 5J1PA 1Y0HA 1U1QA 4FKXA 4DQSA 2I8EA 1R8PA 5AXNA 4IG0B 3CJ0A 3KLFA 1NHVA 4AYBD 1TMMA 1UWBB 1NSPA 2FB0A 3VAIA 1YZ7A 4E98A 2PA8D 1NK7A 2LP4A 4PWDB 4YR3A 1XR5A 2OMLA 1U25A 4LRCA 3OUYB 5DG7A 3D7SB 4GO7X 2JH3A 4AQYF 2HRTA 2JEIA 4OFZA 4WZQA 3EE3A 4DV6J 1EKRA 5BXIA 1Q0NA 4H4OB 1FJCA 2L9WA 4FPRA 2DO4A 2I9SA 4V19X 2E5LF 1RADB 2DEJA 2CQDA 2MXYA 3EDQB 3AY0A 4RW6B 4MK8A 2KM8B 2D7SA 2OPPB 1KP6A 2YY3A 4LFAF 3D0GE 4CLZA 5IWAF 4G6VB 4QR0A 1OYEA 2BJ9A 1C0UB 3MECA 3LAKA 3G82A 3UDVA 3PZPA 3CC4S 1UETA 1JLBA 2D9PA 4OYBA 1NHKL 1IKVB 2DNHA 1U09A 1WC5A 4NRUA 2V2VA 4PG4A 4KJIA 1GH8A 3CCSS 3MMAA 2O66A 3DLJA 5L9XA 4DG1A 2XHWA 3MEEB 1HW9A 2MJUA 4DUZF 4F36A 5IV3A 3CVKA 4KB7A 3C6UB 3S7RA 1FE4A 3TVYA 1RT3A 3NBPB 4X65F 2CJAA 3BO4A 2FHJA 1SQEA 2NPFA 2CG8A 4TY9A 1U2CA 2M70A 2PIIA 4F0MA 3MI7X 4Y34A 3CJTA 2WSFC 3BO2A 2HMIB 3W9JA 1EJ7L 2NLWA 1ZZFA 1TKXA 1PYOB 1KOOA 2N4CA 2D3O1 1Q5VA 3CJ2A 2EC0A 2HKEA 1S9GA 1T03A 2I6WA 1T95A 4P75A 3GV7B 4DSFA 2BANA 4ZJLA 3QSYB 1QM9A 3RBEA 5BYQA 4Y3CA 4RUBA 1F2GA 2RDJA 3OT9A 1BMQB 4EO6A 1M1KT 3GFHA 2EG1A 5KOWA 4R8UA 4DV0J 2C1EB 5HSPA 5CXTA 3CMAS 1VR6A 2O5DA 2QA2A 2Z30B 3J7YI 4XPCA 2XO7A 1QE1A 1AW0A 1NDPA 2VHGA 2OAUA 5KG4A 3OR1B 1FT8A 2XGPA 4HT7A 1K73T 2HRUA 1VC6A 4M5MA 1CS4A 3IRXA 1CULB 3OXGA 3DLBA 1J5OB 4DCPB 2FHKA 2KT3A 4CRJA 1WHYA 3FMBA 3MZIA 4TQRA 3BF4A 2C22A 4IRDA 4E8UA 4X66J 4N77A 5M2RA 2W9CB 2I0XA 5KT7A 3GV5B 3CC2S 4C3LA 3B82A 3GB0A 2A10A 2VDIA 3MAHA 5F8IA 2CQ3A 4FYXB 1U1NA 1JIHA 1D3WA 1JLQB 4LF1A 4USHA 3GSIA 5GVQA 5C42A 2QZ8A 2ZH1A 2FY1A 2CZVC 3G6ES 3VGVA 4HYKA 1XIQA 2IIHA 3MAQA 2ZD1B 2CADA 3QAUA 1LWCB 4B3RF 3PR5B 3G87A 4X4OA 1RTDB 1S10A 2B9WA 3FNNA 2CDQA 1GNKA 4G65A 4LBIA 3OPKA 1IBKJ 2BE7D 3S01A 1WDDA 4LSZB 1Q86T 1IR2A 2MZRA 3M30B 3LUYA 4WYWA 4AQYJ 1E6YA 5CCLA 4J9SA 1GMWD 4WYLA 2FJDB 1VLYA 1WEYA 1DHMA 1JLGA 3UD5A 4YY3J 2CNOB 4PQUA 2K8GA 1RAIB 3T9NA 1E6VA 3NOGA 1ZYQA 3SIPB 1EKSA 4IG3B 4ZJQA 2GHVC 3I0SB 1DBDA 3POTA 3C15A 1BQMB 2G9OA 2DYAA 2DY9A 3CJ5A 3QIDA 3N5BA 1LFWA 1F3FA 4LSLA 1C1CA 2QSWA 4ES3A 1CJVB 2IHR1 4DCOB 2F8HA 4YEAA 1REGX 4B08A 1WWHA 3UVJA 2CPEA 4J9LA 5HBMB 2VC0A 2HLUA 3M2VB 2W7PA 4ZDNA 2HK2A 2VICA 3IBWA 1KQSR 3PJXA 4DOZA 4G1PA 2HZCA 2XMKA 2WCXA 4A8FA 2F5GA 2PGCA 4EU0A 1OIAA 1FFWB 5CYQA 3R5CA 3BQ1A 3PEHA 3RUBL 4HACA 2EC2A 3TNVA 4KKOA 4LF8F 1Z1ZA 3BQ2A 3QT6A 4CH1A 2A2DA 4KFBA 2ZH5A 4J9VA 3CDWA 2MZTA 2MQMA 4B9UA 1DQAA 3IMQJ 4PPZA 3L7UA 1QTNB 5IT0A 3JS9A 1AYEA 1MU2B 2E1AA 5SZTA 5GAGU 4WKYA 2WAQD 1RXOB 4CLPA 3HO1A 4DV4F 1GTEA 4JV2A 4B17A 1XN9A 2AJQA 5BR8J 1H2TZ 4LRAA 2OPRB 3DOMA 2AJ1A 1EETA 2JJ4D 2FYXA 1WOSA 5ETPA 1JLAA 3I6PA 3UDLA 2J6TA 4L6V3 4OIXA 1FXRA 5KG1A 3W2WA 2Z57B 3UCUP 5LMUJ 2E1MC 4K4WA 4WFBQ 1DZ5A 2BQUA 3D68A 1NZAA 1YJNS 3HFKA 4CO0A 2DVIA 4F4YA 4FF1A 4IR9A 3UE2A 1RT2A 2Q1LA 3KFWX 4YUDA 5K5MA 2LDIA 2ILZA 4ZPDA 4DSJA 4X64F 5A76A 3OR2B 4ED1A 4QIEA 3D28A 2RS2A 1UVIA 3NG8A 3TUPA 4ED7A 1PJ5A 4LVNP 1S59A 3QT5A 3MECB 1DRZA 3G82B 3L4BC 1Q79A 2WVFA 4JV5F 4K2XA 2DNKA 1YJRA 3ISND 1JLBB 2MSTA 5B0EA 3FBEA 3D1HA 1IBCB 5AE3A 3AH6A 4WP9A 3CXCR 4DR6J 2YPZA 3L9ZA 2KT5A 2JOQA 3E01A 4QIWD 2CJ9A 3ENAA 3N5FA 4YB5A 4ERDA 2VD3A 2ZNZA 1WKLA 4YHHJ 1RT3B 1VISA 1YGYA 2CNKB 3ADAC 3BGLA 4HTIA 1UMJA 3T6JA 1RE1B 2C3PA 4PXEA 5KG7A 4C3KA 4NYZA 4AD6A 4I64A 3LAMA 3AOBA 3TR5A 1KTQA 3CCVS 3PJ9A 3TARA 1S99A 2R7OA 4EO8A 1TKXB 2CIMA 3TANA 3E2EA 1HNIA 5F0WA 3C16A 1IKWB 2JHEA 4KC5A 2JFKA 3G6XA 3MM9A 4KT0C 3SI8A 4WFZA 4UUXA 4HH0A 2BANB 3T1HF 2YQ1A 4DR7F 5F9NA 1R31A 1VC0A 1FK9A 2DR9A 2V9WA 5DLGA 1SH2A 4K4SA 2EK6A 1C0TA 2FJEB 4F4AA 1NM2A 1CJUA 2LQ5A 4Y2IA 4RW4A 2MLYA 2YWGA 2XS2A 5KFTA 3H2LA 3GJRB 3W62A 3DHXA 2B6AB 1HWIA 2V9KA 1RTJA 5MLCV 3L09A 1YBAA 4CH0S 1WG5A 2EPIA 4RX6A 1N5SA 3KLEA 1FD2A 1HW8A 2J6SA 3G6YA 4X4SA 5GAEI 3IRXB 2FVQA 2OTLS 3C6TA 4DXLA 1UJ4A 3NGTA 3GONA 1OJ4A 2HQIA 2BE9B 1MWZA 5J2QA 1XEZA 1R6VA 3G96A 4LF8J 4ZHRA 2G0JA 3EDRB 4B3TF 4ED5A 5GMKa 1K1SA 4BS2A 1S6UA 2WW4A 4CM2A 3QWUA 3QJLA 3JSMA 2DHHA 1VQKS 3FSIA 2X1GA 1U1OA 1VQSA 2ALYB 2YNGA 3UI3A 3MMCB 4QYZK 1CPZA 3DHWC 4OZ0A 1IXKA 1XJWB 2HNDA 3IWXA 4USTA 4H4MA 1FO1A 4ED2A 4WE1A 1CLFA 2PMZD 4FF4A 2HIYA 1UJ5A 1NCLA 1WF0A 3E3XA 3BN4A 4N56A 2OD6A 4J37A 1ZPWX 5J1NA 3VAFA 2CJQA 3HJVA 4CP5A 4NA1A 3EYZA 5KFYA 2HBYB 3TX0A 5IM0A 1SKSA 1FESA 3H98A 4E0DA 1P1LA 3DDIA 3I0RA 2FZGB 1NKBA 5KFPA 1FF2A 3RR7A 4NLYA 4LREA 2J8AA 3MM6A 3DN9A 1NSQA 2UUBF 4NCBA 2XMVA 4QPTA 4X64J 1RAJA 2R7UA 3POTB 2CWKA 1HHQA 3C15B 3T41A 1HFEL 1VHIA 2VA3A 1FX4A 2VPYB 1RP5A 2YWKA 4DDFA 2ZITA 2BW7A 1C1CB 1U8SA 1GK8A 4JI2J 3VF0B 5J2MA 1VBYA 2W24A 4UOCA 2J9EA 3EMTA 4DR1J 1Q7YT 1F5BA 4FF3A 1HBUA 1VGYA 2LXIA 3Q0AA 3M8QA 3CD5A 3VGUA 4EI2A 1HBOA 3GR1A 2AF6A 3IGNA 4ECRA 4UQTA 3KLHB 2PO4A 4O0IA 1HNXF 2Q6BA 4RW7B 2GA7A 5D0GA 2ZC4A 1FX2A 4OYOA 1D9FA 2Y0BB 4M8LA 4KKOB 1C4AA 1JLCA 1TL5A 1B7FA 3BGRA 4OZ3A 4KFBB 4BWJA 5L46A 4YR2A 4QW8A 2QSFA 1B0VA 4UOGA 3DRSA 2OTJS 2NUUG 1B0PA 3ONQA 2MQQA 3SQOP 2YNHA 3HD1A 1LW2A 4C48A 3VAKA 5DRKA 3QLHA 3DM2B 4YP3A 3PW0A 4L76A 2HZVA 3FQLA 5ETLA 2Y8YA 2XWXA 1U6ZA 1SC4B 3EZ5A 2GVZA 4ANCA 4E2FB 3RBDA 3OVSA 3FCVA 2YXLA 4KE5A 2VODA 4RU2A 5DETA 3AODA 2AJFE 2KVQE 3I55S 1U02A 3R5DA 4USWA 2OELA 2PI4A 5HMWA 1JLAB 3D1QA 1MROA 4IQMA 3W2WB 3SSQA 3ZC4A 5KFNA 3HVTA 5IFMA 1JJCB 5B0CA 4RWWA 4PWWA 1OWXA 1N0VC 1R89A 2FJVA 1TR0A 2AZ1A 4ED6A 2QLJB 2KRRA 1VRUA 5F41A 4I6AA 1MWQA 3NLCA 3P45B 2VBWA 2IVMA 2HHWA 4W90B 1N32F 1XBWA 3RJMB 1KQGB 2VG5A 1GTHA 1SJ3P 2JEGA 2ZUAA 3JYTA 2YPYA 5CABA 3I31A 4M5IA 1KD1T 4DU8A 2YWEA 4Q43A 2P2CB 4ILRA 3IN5A 4F04B 1XC9A 2HZAA 2F8EX 2W25A 5HROB 2HWHA 3QYYA 1UTAA 2GW8A 2DGSA 1VDHA 3ITHA 2QYGA 2RSQA 3FUYA 2MY7A 3UN2A 4HI1A 3KMQA 4TY8A 2MKHA 5I3QA 4LVOP 2DNMA 4UZBA 4TYAA 2HPUA 2DHAA 1P9QC 1MMNA 4GO5X 2RILA 1L3VA 3ZTRA 1R0CB 1NKEA 1UVMA 3V4MA 4ELVA 1XMOJ 4RW8A 4MK9A 3MM9B 1SC6A 4ECWA 4F4WA 3N4WA 4FBTA 3IR6B 2OPQA 2MZ1A 2N82B 3CDBA 1TK5A 2YNFA 4CO3A 3VQTA 2BYCA 4IO9Q 1BHNA 2VBYA 1SI9A 3IGVA 3BSAA 2NXUA 3IR5B 2M88A 2OIHA 1W2IA 4DV7F 1NRKA 2W2QP 2V4RA 3HKZD 1C0TB 4A46A 1CJUB 1RTIA 2R7SA 1ZOTA 5F8MA 3A12A 3NGKA 2K1RA 1WC6A 3NWGA 3EUNA 2MLXA 2AT1B 2WVEA 4DL4A 3TAMA 2JWNA 2OEJA 1D1UA 1MMLA 5K8MA 1X0FA 1S76D 3A8JA 4P9SA 1RT5A 2FY8A 1D8YA 3LTOA 3UO0A 3NMRA 4XIUA 3KLEB 4KTQA 2ROGA 4JI8F 5HP1A 3IBFB 2QEXS 2E5GA 2VFTA 1NBEB 3C6TB 5CYMA 3VAHA 3R5AA 5EX0A 3CCTA 3TZZA 2ZHAA 3U1NA 1NPPA 1X7VA 1HNXJ 5AJ3F 4DF4A 1T3NA 3NRBA 1S1TA 1P1TA 2M7SA 4ZHRB 1L3SA 1KLMA 1U4BA 1WTFA 5J2NB 4Z2XA 2D74B 3JSMB 2ZKTA 4P72A 2Z4PA 1FWKA 4FYWB 2QX0A 1XNRJ 1P9YA 3M4XA 4ZVEA 1V6HA 3WIVA 2GV1A 2HFNA 4H4MB 1RTHA 1NSAA 4DN9A 2MKKA 1RJJA 4G1QB 4QWEA 4JI5F 2IMOA 1M5VC 4QU7A 4A4JA 3R1HA 4C4WA 2V67A 1HR0J 3FMWA 1BWEA 3M6XA 3OSPA 1S79A 4CLLA 5CH7B 2OSRA 2DK2A 2R7WA 1RSCA 1VIXA 2RB7A 4WPAA 3AD9C 1LOUA 3PVXA 3PFEA 5IM0B 4YB1P 2CQ2A 1U1MA 3CCUS 2RF2A 4DU7A 2DH8A 2OLWA 1BC6A 1RHKB 5BJRA 2ZBQA 1VOMA 1NPKA 4ZVOB 2KZMA 3C3LA 2ACYA 3TZYA 2CG4A 3PX0A 3LA0A 4Y2CA 3B8HA 3CB4A 1NKCA 1FTCA 4DX8H 3ILOA 4I0WA 2MYFA 2BEFA 3E51A 1F0XA 3PW2A 2J0WA 2QV6A 1XNQF 2IRUA 1GX6A 1EZZB 1RWKB 5C24A 4K4VA 3FSXA 4DZ6A 1HBUB 2I38A 2MTLA 1I5OB 2F3JA 2KKHA 2W7OA 2QE5A 1HBOB 5IT9U 3MMJA 1WG4A 4RZRA 4ZPVR 2WSEC 4OI1A 2WOMA 2RHQB 4Q0BA 3O3LA 3DCAA 5DM6Q 2UXBJ 3FVYA 2G2OA 1XR7A 1CJTB 4PG6A 2RHSB 4U67Q 1LXNA 4PAAA 4LFCJ 3GV8B 1SL1A 1BQNA 3DRSB 2UXCJ 4ZLNA 3B4DA 4DWIA 5L1JA 3HSZA 1T9YA 2X3GA 3U1MA 3F56A 2L41A 2DB1A 3H0PA 1IBMJ 4MJKA 5EDWA 2F65A 4R0EA 1RQ0A 1TVRA 2LMIA 2GVZB 3CD6S 2OFHX 1G2EA 1RAEB 3ZNJ1 3G2XA 4DR4J 5E3PA 2DNZA 4ZVUB 2CQHA 5C2GA 2UUAF 1S0NA 1HNZJ 2IVFB 3DKDA 2GO9A 3MPYA 3HVTB 4NXNF 2W2NP 4OYPA 4B3SF 5C2CA 4RNMA 1RWNB 1N34F 4O0NA 3LGHA 1F9EB 2ROPA 2IMWP 3L7OA 2ZH3A 3LALA 4DBQA 4USMA 3GG1A 3DOKA 1W26A 1S6PA 2ZJPQ 3SFGA 4I68A 3GCXP 5DQHA 1B7YB 1FDDA 4ECZA 6AT1B 3C14A 2F4FA 4DL6A 5I42A 3JYTB 2HQCA 3L7PA 4AL5A 3HULA 1VQMS 1RBOB 3FRYA 2YVSA 4PUOB 2NYIA 5K8NA 4WK3A 2HBRB 5KFRA 3U02A 1DTQA 1K0VA 2OI2A 1NK9A 2YX1A 3PW4A 2HAIA 1HMVB 3JQJA 4TQSA 5HJXA 1S6QA 4JI5J 2KFNA 3BYPA 3DGPA 1KKHA 4C0HA 3MUTP 2V6AA 2XYPB 3PDNA 2J0SD 5HJYA 1X4EA 3ITHB 5A2QY 1B3TA 2E66A 4TY8B 2B7BB 1RT1A 5B09A 2G0CA 1HA1A 2E7WA 3U27A 3W8PA 4TU7A 1QAJA 1RLCL 3CJ8A 1AROP 3CDAA 1F5AA 4TU9A 4OX9F 1SV5A 3WIUA 4KV8A 1UEVA 4RW8B 3TYTA 4DV5J 1HBNA 2OPQB 2OSQA 3Q89A 3MWBA 2R8HA 1U0HB 4U7UK 3WDOA 2DJWA 1N52B 2Q6CA 5EWGA 4IH7A 5GADU 1H73A 1JKHA 3W66A 3V81B 1T02A 1HI1A 3QSIA 4DX5A 2DGUA 3DMJA 3EICA 3KMSA 4GKKF 2GCFA 3LPEA 2QC3A 4RNOA 2K1RB 2FGOA 1PSDA 3JTOA 4YS2A 3D2WA 3TAMB 3M8PA 4RNFA 2UVUA 3R8YA 4FPIA 2ZNYA 2EFQA 4I67A 1RT5B 4RNNA 4C6AA 2CPDA 3BO3A 2BM1A 3KUEA 4J9UE 3K8WA 5H9FJ 4RJVA 3ET6A 4NA3A 5CHCB 4YB7A 1UAWA 5CYMB 4F67A 2VASA 2NZCA 4ZS6A 3BGFA 5IZHA 1RZMA 3MCOA 5J1EA 3UD4P 2KXFA 2WVBA 4FZVA 1S1TB 4ZCIA 2LLZA 4NLSA 1D09B 2RU9A 3BGOP 3Q8PB 1NB7A 2JSXA 5IT9Y 3BEGB 4G3IA 2U1AA 2BKNA 4F0HA 1BGXT 2WHOA 1KR4A 1RWWB 2IJFA 4KO0B 3IFEA 1RWMB 4C0BA 3JQKA 1O8BA 2KI2A 4F8RA 3R5GA 1PILA 3H42A 5D8HB 2IM0A 2XMUA 3DYAA 4KR0B 3R2DJ 1IVZA 3BBBA 1HL6A 4IH6A 2J7WA 5HQ8A 3MOJB 3DNCA 3R1LA 3BH7B 1Q8KA 2V2KA 2UUWA 2VG7A 1UA1A 3M6VA 1R27B 4IOCQ 2XLKA 3ZNUA 1TL3B 3TI0A 2JL9A 5FLXU 3P5TL 1T05A 2RS8A 3MDFA 5EX3A 4K59A 2JEFA 2ZJQQ 3GYXB 4NLOA 4LF4F 3NS5A 2AEMA 2A2CA 1GMVA 4JI1J 1XTZA 4UQGA 2RF2B 4TNOA 1S1XB 2QA4S 4NLXA 3W8GA 2MEWA 4FS1A 3MTJA 5KG2A 3BDEA 1WORA 4ZP9A 2K06A 3CT9A 4OI4A 5GAHI 2HEKA 2QL5B 4RKUC 3ZZYA 4OLPA 3M7VA 2IJNA 3WC2A 4IQXA 1BQXA 1QUVA 3MEDA 1NDCA 5LJ3Y 2W7AA 1MWYA 1TKTA 2HBZB 1EQ0A 1WC4A 4J90A 3MEGB 1TMJA 4KHPF 3OW2R 2H5EA 1XMBA 2J9CA 1HWKA 5K14A 3QJJA 4CO2A 4P10A 2ASDA 1H38A 3HHLA 1W7WA 3ULHA 2DGOA 1DTTA 2HNYA 1RWOB 1NJWA 1YDLA 2XS7A 2M5YA 5LXYA 3RB6A 4ZPWR 4S0MA 1TUGB 1RT4A 2B43A 2GIRA 4HLBA 4AFFA 2M2BA 1TKDA 3W5XA 1WI8A 2P5VA 2HNZB 2ZH6A 2ZBIA 4DS4A 2CVEA 3P5BP 4IFVA 4TXSA 1PJ6A 1WC0A 1ZA2B 4DUTA 3FEYB 3KHHA 3RR8A 4JYAJ 5JMNA 1OO0B 1FEHA 1S1UA 2MQNA 2FHJD 3QRPA 1SUQB 2G1HA 4ZVHA 4DQIA 4ID5A 4ATNA 2VV5A 3DC2A 3V2UC 2GZOA 4C8NA 3NNAA 2JVRA 2H4YB 1B4SA 1SKRA 2R2TA 1IM6A 4WP8A 1U6FA 2DNGA 1KSPA 3O2IA 3PIPQ 2B8PA 1SQFA 5CQGA 3NP5A 4NZ0A 2AKWB 2GC8A 3PJWA 3CPWR 2ZDPA 4NI2A 1X4GA 3HSJA 4FN5A 1S9EA 3MUVP 4LUBA 4RPFA 5KG5A 3M1VA 5ADZA 4DS5A 2RVJA 4M1KA 3ILJA 4QW9A 3NCQA 3CF5Q 3PFOA 3G8SA 3WQPA 1N48A 1GT8A 2XY7A 2JC0A 3DOKB 2Y1IA 2P9CA 1JX4A 2HFVA 3IS9A 3MR3A 2H54B 4O3SA 5DQIA 3PACA 5G0RB 3PG9A 5KT3A 3OTOJ 1VQ8S 2FJXA 4I7FA 4I2PB 5HAOA 2BQ3A 2YWHA 1IKXA 1APSA 2DNQA 4F7VA 1UP1A 1V5IB 3MCNA 5E5NA 2DRAA 1X4HA 2YNIB 3AQOA 2GVDA 4X2BA 2VFUA 2XTJP 2ZKUA 2OO4A 1ZZNA 1ZH5A 3A3OB 1EAYC 2F8MA 3LF0A 2NSBA 1S6QB 4M5KA 3DGPB 5A8RB 3R6LB 3GJSB 1FRLA 3FQKA 3PKYA 1XWLA 1SJQA 2Y3YA 3W2VA 4URGA 2AU0A 5KG6A 5G4DA 3BR9A 1T9VA 3KLGA 1AZSB 1PAUB 2XC9A 2HWTA 3M05A 4HDHA 1RBLA 4J9PA 4F50A 1OSDA 3HDSA 1SV5B 2HRYA 2V69A 4NLTA 4KV8B 4WTYA 5D78A 3BKUA 2PE8A 2HHQA 4CYUA 5FLXY 4PWUA 2EKNA 2DGWA 2QFIA 3EPIA 3M8ZA 1UW4A 2LXFA 3NEKA 1HLWA 2GAGC 2ILYA 2RRBA 2IRYA 3P96A 1DURA 4I56A 3DMJB 4QJVA 2QIFA 2RQ4A 4NYOA 3Q8UA 4BHQA 4ZITA 3HT0A 5F8HA 3FKBA 3M8PB 5A6PA 1IN0A 2EFPA 1U24A 2QGFB 1OQ3A 2CKWA 1Q8IA 4LR8A 3ET6B 1JXVA 1TL7A 2E29A 1FA0A 1X9WA 1PG5B 4RW6A 1WD6A 3BPDA 4MIBA 2OPPA 2IA6A 4DV1J 3KKFA 5EUHA 5GMEA 1FDBA 4DJBA 1C0UA 2LDYA 5L1KA 4B9LA 2MZSA 4A8XA 2YKNA 3B78A 2O01C 1IKVA 4O3QA 2W2PP 4CLYA 3FBCA 2GQCA 3LWMA 2FD2A 3DYAB 2R8JA 4OHYA 2LQBA 4CH7A 4DL5A 4LF7J 1JNRB 5IQ6A 1FVQA 1FWPA 2DCUB 4ZLJA 3C6UA 3THVA 4WIQA 2RRNA 4IRCA 2PA3A 2WB1D 2VG7B 3PTWA 2ZH9A 2DT9A 2NXEA 3IM8A 4RWXA 3VWSA 1EX8A 3GFZA 4AL6A 2CXEA 1KS2A 2Y1JA 1RWUA 2DXEA 5KFHA 2XULA 2X1BA 1T05B 2J9DA 4DSKA 1R8HA 4M5HA 4Z37A 2HMIA 4K2JA 1UPMB 4NXMF 2RJZA 3N6NA 1R6YA 3KLVA 4P71A 3QRRA 1AA1B 5F3ZA 3IAS9 5E33A 4KSEB 5K8OA 4WU2A 1HNWJ 5KT4A 1FCAA 1FNXH 3A13A 1L3UA 4L72B 4FF2A 4IOAQ 3TVKA 3K58A 2F9JA 3M2UB 1X5TA 4M5DB 4LFBF 2FVCA 4DV2F 4OYIA 1URRA 1NJZA 3R7SB 4PXCA 1NSKL 1TKTB 1FKOA 4JB8B 5DM7Q 1KHWA 5B0DA 3BM7A 2JZ5A 1CVJA 2Q3PA 1VQ9S 3N79A 4OI0A 1S72S 1G3OA 2J5AA 2ZH8A 1GFWB 2Q66A 3BREA 4KPCA 3IC1A 3M8WA 2DR6A 4USUA 3RRKA 3SYZA 4C8OA 1DLOA 4PABA 2PC6A 3OR1A 2HNYB 2RE1A 2DH7A 3PRBA 2CFXA 2GNKA 2N7CA 4OJ3A 1VK3A 1CULA 3ENWA 4F02A 1TK8A 3GLJA 1J5OA 1QVFR 3T1YJ 2CNLB 2V2QA 2YKAA 1RT4B 4ECSA 4O3PA 2IRXA 3KHLA 1VJWA 2UV8A 5KFCA 2YKMA 5I3UB 2AGPA 1VQLS 1UEKA 2HS3A 4ITSA 2EKYA 5FJ4A 2W9CA 2M4MA 3N0VA 5FDLB 4USIA 3HFVA 3KJFB 2HAFA 4ER8A 4PPDA 5HK4A 2J0XA 2COLA 3Q2TC 1S1UB 5IC6B 4DPYA 4ZVQB 1JLQA 3HLUA 3I87A 4I6YA 4ID5B 2O3DA 2V5HG 4DR2F 3WBZA 4OL8A 1T9TA 5HATA 4F4ZA 3FSYA 2NXNA 2MQOA 2E5HA 4QU6A 4OHZA 2JEJA 1Y11A 2E9RX 1LWCA 3HMJG 3PCOB 2VQFF 4QYRA 4TLRA 1HI8A 4I2QB 4NI2B 4OHXA 1N5QA 4L3NA 2ZE2B 3ZZZA 1HKAA 5KFJA 1FRKA 2D3UA 4WFAQ 1NDLA 4U6PA 3M1VB 1RKJA 3FEXB 2XGQA 3M30A 2AMCB 3PIOQ 4A8KA 3QFWA 4DR5F 5IT4A 1YJ9S 2QLWA 5J2PA 3R5JB 4LF9F 3LW5C 4O3NA 3I0SA 5M2PA 3D4JA 4ZCKA 3KK3B 2NXJA 1BQMA 3NCRA 4R25A 1NU4A 3TAQA 4F0KA 3PEJA 2KT2A 4I7FB 2ZFHA 4DL0C 1QLNA 1FRMA 2X1FA 3H20A 3D9BA 2D1CA 5D15A 1CEZA 4I1TA 2GVDB 2V2ZA 1A0OB 3NGSA 4CIOA 1HNVA 5CZXA 2WSCC 4LF6J 5HLFA 1GAOA 3KJNB 3M2VA 4GVLA 3IO1A 2UUCF 2HHHF 1FWLA 2KHDA 4K8RA 4QBUA 4J9RA 1RAGB 3RB4A 3MFIA 5D0EA 5E3RA 1EIYB 2DGTA 2JVOA 4OYWA 4K0KJ 2GMLA 1UWAA 3KLGB 2DNLA 4JP8A 4NLVA 1S1WB 2ZJRQ 5KFBA 3EWGA 3W9IA 2HWIA 2NZ4A 3HK2A 1FRJA 3GYGA 2EBGA 1FEEA 4M94A 3K5OA 5HVFA 3TJ9A 4EMDA 4JI4F 4Y65A 1T9UA 1JJHA 3TVZA 1UA0A 4X62F 4DV2J 1U1KA 3ZXWA 2GO8A 4D3GA 3ZTSA 2APOA 4LJMA 2OPRA 5B0AA 5KFLA 3D3BJ 4P2XA 2LA6A 2BMBA 3HSGA 4FXVA 5D4PA 2RRAA 2W9AA 2WK4A 4DQRA 1WOPA 3QIPA 1Y10A 5HVGA 3BS9A 2FTRA 1M5PC 1LWXA 3JAMY 3LO3A 3PKMA 3GZ7A 2O1PA 4DR3F 2MGZB 1IQZA 1T9XA 1NEEA 4NASA 3GIJA 2B56A 1TL7B 3HCXA 1GQEA 4FVMA 4ANDA 4Z7CA 1NK0A 2DIUA 2IC3A 2RNEA 3OR2A 1N0UA 3Q8YA 4DV3F 2FC9A 2YKPA 2DBBA 3WC0A 4WK1A 1PGZA 2AD9A 2XSJA 2QO3A 1NLKL 2YKNB 2FZKB 2AW0A 3J7YU 3H5YA 5B0BA 1RUSA 4ZPTR 4MIWA 2PEHA 3OL9A 3CW2C 5KT6A 2ZEJA 4USJC 1N6QA 1I6JA 1FTRA 1VBZA 2FJWA 3QQCD 3R7NB 1UFKA 3UDEA 3PRVA 1RCXB 3TQEA 2RAQA 3CJSA 4DPXA 2H1YA 1X9MA 4K5RA 2EFGA 2R42A 3DU5A 4HHUA 4C9DA 1Z2LA 2QL9B 2CPFA 2ZWPA 4ECUA 1PCAA 3T6BA 2EI5A 2Z56B 4WFNQ 3GG0A 1VYAA 3TX8A 3VCDA 3AXKA 2B9XA 4I6WA 2GIFA 2NUHA 3V5RA 2KL8A 4EK2A 4BWMA 1FKAF 1IKWA 3M9NB 4EBDA 2YWWA 3MGJA 3R6GB 5C7PA 4KGMA 4LSNA 2HLTA 4DL7A 4TYBA 4NLGA 4LF9J 4WFXA 2R2RA 5KTQA 2D3OR 5L38A 1FKOB 2BJ7A 3RAQA 2D41A 2IDEA 1TV6A 3O8WA 5KFFA 2BACA 4LQ3A 1C1BB 3M9OB 5IV4A 2AGOA 2B6AA 4KGXB 3D67A 4PYDA 5KFWA 2GAHC 4LMZA 2VOOA 4CLUA 1DLOB 3NNHA 4ECTA 4M5GA 4EBCA 2UUCJ 2C2EA 3K17A 4ZVFA 3ELHA 3RZAA 3MPDA 2KYZA 2YQ0A 1Q7LB 5T7LB 2XYHB 2YKMB 2KH9A 2MZJA 3GU0A 1RWPB 5LL6d 1SJ1A 4LF5F 3GIIA 4ELUA 3KJVA 4ZCLA 1SCJB 4RUCA 3MMCA 4YFUA 1T11A 5A8WB 1PYTA 1UW9A 3J7A1 1S97A 3QAEA 3A3PB 2BKOA 5DDRC 1WHXA 5LSOA 4BDPA 3B6BA 5JXSA 2XZWA 2MPUA 3AOCA 2HFOA 1H2VZ 1TUVA 1R0AB 4CLKA 4USKA 3I32A 4FDFA 3JTPA 3ZZTA 4DX7A 3MMBB 2UV8G 4J9QA 2RDIA 1U47A 5D4OA 4QIVA 1N33F 2B3TB 2NPIA 3FCHA 1NJYA 5F8LA 2WVCA 3HD2A 3CIZA 2JC1A 1HPZA 4HDGA 2JLGA 4KAIA 2E7VA 3JSRA 2E5LJ 3CJKB 2WONA 3R5BA 5J2PB 2E9TA 2E7XA 2G2YA 5AE2A 1S48A 2JRSA 4DHVA 1I1GA 4LFAJ 5DZ6A 5IWAJ 2HBQB 1Y5NB 2HFSA 4G1IA 1HQEA 4DMZA 4PEOA 1F9FA 4KBIA 3GP9A 4C11B 2IPOB 1FI4A 2CPYA 3DXSX 3SV4A 4JI0F 1HNVB 4F4KA 1IJEB 4QIGA 3US5A 1YITS 4CCHA 5HLFB 4O4RA 3FBFA 1WELA 1Y00A 4DUZJ 2EG2A 2UZAA 3T5KA 2DNOA 5HANA 4X65J 1U8WA 1MW7A 3KLHA 4ALZA 1OYDA 4RW7A 4EZ6A 2AIRB 3T5HA 1YVFA 4CO1A 4DL2A 2CUYA 1KEKA 2IM2A 4A8YA 3GTYX 4M5JA 2HGNA 1X4AA 4Y2KA 3KLIA 3BZQA 1FJ7A 2LQ9A 1HHSA 3RU0A 4QWAA 2FVSA 4J9OA 2H5JB 3UWTA 4NRTA 4NMLA 4LF2A 2UU9F 3CCRS 2RQMA 2PSZA 1YK9A 3DM2A 1X4FA 4EZ9A 3KHRA 5E2QA 2B7CB 4K4UA 4KH0B 1LFPA 1WI6A 3Q8VA 3EXCX 1NXIA 2XWYA 3AB4B 4WU3A 2KG1A 1IKYA 3IRWP 1P8GA 1RWXB 2ZM6F 4ED3A 2MB0B 5ETSA 2F1FA 1RDRA 2N3LA 1N36F 1HYSB 3QIPB 5H9EK 3SCJE 1RKIA 1SIWB 3BSCA 3KK2B 1RI7A 1ACMB 3PRDA 1YQHA 1FRXA 3K7RA 3UW1A 4P6QA 3EVOA 1S7IA 2VC1A 4ILLA 2IC3B 4DLGA 4ECVA 2XZTB 5JVHQ 1TQLA 4MFBA 3J7AN 2EXUA 4LIWA 4LRDA 2PFDA 1KVJA 1UZDA 2XSJB 4RLEA 3I4HX 3K2YA 3VTIA 4LF5J 1LW0A 2CQIA 1ZTTA 1D8ZA 2F7VA 3H4BA 4JI6F 3QGPA 1N6QB 2Z2ZA 3LGNA 1BLUA 1NH8A 1NK6A 1WOOA 4DPOA 5GAEU 1KOHA 2Z2LA 4OZNA 2W2MP 1BY9A 2VJUA 1YBTA 2B9EA 3M8RA 4N47A 4M95A 4ZN3A 5HROA 3OLBA 2J76E 2Y0SD 1M5SA 3E8OA 4W92B 3W65A 3CSKA 2FJAB 3P49B 4B3RJ 1ZAXA 2IBOA 1QAIA 1UVJA 3AQPA 4DX6A 2R9LA 2HQDA 3KK1B 4CDIA 3W5ZA 2WVDA 1JMTA 4ZIVA 5ETMA 2CJYB 1ZAVA 4DUYF 3PV8A 4NLPA 5H1SV 1ZTWA 1WNEA 3NL0A 2LU2A 1VQ6S 4CT9A 1N4LA 1VMBA 3OXFA 3CUNA 4LSNB 3UN3A 1FDAA 3VGSA 4J7CA 2O67A 4X4UA 1J2VA 1JLEA 1IWAA 2HS0A 2A6OA 3MXHP 1TV6B 5KFIA 1ELOA 2OFGX 3CJQA 5LT5A 3GWCA 1WEZA 2GHWA
chains in the Genus database with same CATH topology
4KR0B 1SL0A 1AUDA 2DNYA 5BYQA 3H8YA 4Y3CA 5HO4A 1F2GA 3I5AA 1QSLA 2RDJA 3AHPA 5AXLA 1HL6A 2E5IA 2G1DA 3O44A 4EO6A 3HXMA 2QFJA 1M1KT 4IH6A 3GFHA 1KRPA 2XCAA 2EG1A 2J7WA 5HQ8A 5KOWA 3MOJB 4AXIA 3DNCA 3GILA 2YNGB 4R8UA 3R1LA 3PX6A 3EXYA 3DXBA 1GXLA 4DLEA 4OV1A 2V2KA 2LXUA 1PC4A 2VFRA 1UFLA 1CG2A 4PG7A 5CXTA 2UUWA 2VG7A 1UA1A 1VQ5S 3CMAS 1IR0A 2A1BA 2HNDB 1ZM4A 2L48A 2DNPA 2O5DA 2QA2A 5KT5A 3J7YI 3M6VA 2M0GB 4OX6A 1R27B 4XPCA 1WHVA 2E1CA 4IOCQ 2XLKA 2R7RA 1TL3B 4EWTA 2XO7A 2FLPA 5L9NA 1QE1A 4WE1B 3NAIA 2PDAA 2JL9A 3TI0A 1AW0A 3N28A 3P5TL 1T05A 2RS8A 3MDFA 4ZOSA 5EX3A 2OMOA 3QJPA 2OAUA 4K59A 2JEFA 3KG1A 4YDXA 2ZJQQ 1K8AT 3GYXB 2ROEA 5KG4A 3OR1B 4NLOA 1FT8A 2XGPA 2K3KA 4HT7A 1X5PA 5B0FA 2HRUA 1U2FA 3NS5A 3SSRA 1K73T 1VC6A 2A2CA 4LF4F 3IRXA 3UCZP 1XTZA 5KFEA 4UQGA 3OXGA 3DLBA 4ELTA 3BB5A 2RF2B 4IYQA 1J5OB 2FHKA 2BDPA 2MHEA 5J2NA 2KT3A 1IQTA 3KJVB 1G6BA 1YRTA 2HIQA 4TNOA 1WHYA 2XMMA 1S1XB 2QA4S 4NLXA 3FMBA 3MZIA 2HHVA 4FS1A 2LQJA 3MTJA 3BF4A 5KG2A 3BDEA 4TQRA 4QQBA 5DLFA 4ZP9A 1A7GE 2C22A 4IRDA 3CT9A 4OI4A 4MKAA 5GAHI 2LVWA 4N8NA 4RKUC 3OVBA 2VPXB 3ZZYA 1KC8T 1OSCA 4OLPA 3MPVA 1C1BA 4DV6F 2IJNA 3WC2A 5AXKA 4IQXA 1BQXA 1GXTA 3M32A 4E8UA 1QUVA 4N77A 3MEDA 1HD0A 5M2RA 2W9CB 2I0XA 5E3AA 5KT7A 1NK4A 5LJ3Y 4HTJA 1JJ4A 3I0RB 2W7AA 1MWYA 3I5BA 5D3GB 4WKRA 3OTBA 1TKTA 3GV5B 2B5JA 3EGWB 3CC2S 3MR2A 2DTJA 4G1QA 4O3OA 4FBUA 4C3LA 3B82A 3SCIE 3GB0A 4DV5F 2A10A 5E3QA 3OFHA 3MAHA 3MM6B 2I5JB 3MEGB 5KFOA 2EFOA 5F8IA 2CQ3A 4KHPF 3OW2R 2H5EA 4N76A 1XMBA 4PXBA 1U1NA 2BUNA 1JIHA 2J9CA 1KFDA 1D3WA 1JLQB 4MAKA 1JJ2R 2ZZNA 4EBEA 1HWKA 3U7JA 5K14A 1S9FA 2C3MA 4USHA 4ZK7M 2V4JA 4A47A 2FIUA 3QJJA 5GVQA 4CO2A 5C42A 2UUTA 2ASDA 3THPA 1FJGF 2QZ8A 2ZH1A 2FY1A 1SH0A 2CZVC 4CZCA 3G6ES 1S6OA 5T7LA 1GXUA 4HYKA 3SDEA 3MAQA 1H38A 4OI3A 3HHLA 2ZD1B 3HM9A 3ULHA 1RT6B 2DGOA 3QAUA 1DTTA 1LWCB 2HNYA 4B3RF 2NREA 3PR5B 2B51A 1N8RT 4X4OA 1NJWA 4NCAA 1RTDB 1S10A 2XS7A 2M5YA 5J2MB 2KFYA 5LXYA 3QGGA 3RB6A 2B9WA 2W4CA 1TZ0A 3FNNA 2Q43A 3DLKB 4ZPWR 3C66A 1HPZB 1GNKA 2CDQA 3PR4A 2VZ9A 4C8YA 3OPKA 3KYLA 2OPSB 2MQLA 2ZH2A 1RT4A 1GX5A 4EUVA 4EGLA 1DAXA 2V94A 2B43A 2GIRA 2WONB 4HLBA 5H9EJ 3K59A 4AFFA 2M2BA 1TKDA 2XMJA 5A8WA 3S01A 1WI8A 1R43A 1Q86T 2P5VA 4FXWA 2L9DA 3LP1B 3M8QB 4DSIA 3HF5A 4J5OA 3RAMA 2MZRA 2HNZB 4F3OA 3M30B 2ZH6A 3LUYA 4WYWA 2ZOFA 3MTKA 2ZBIA 5F8GA 4DS4A 3ISNC 2BV3A 2CVEA 1E6YA 5CCLA 4J9SA 1Q78A 4IFVA 1NNDA 4TXSA 1WHWA 4WYLA 2FJDB 2MKSA 1VLYA 1WEYA 1DHMA 1SXLA 3UR0A 3RYLA 2CPZA 1JLGA 4PQUA 2K8GA 4DEZA 3FEYB 1HQEB 3T9NA 3KHHA 4PXDA 3RR8A 1E6VA 2Z8QA 1ZYQA 1QJHA 2P9GA 1OO0B 2CYYA 1FEHA 4OHVA 2D3ZA 3PW7A 4IG3B 4ECXA 1S1UA 3TA0A 1X5OA 3TAPA 1JLCB 2MQNA 2FHJD 3ENQA 3OTCA 2R7VA 3DRRA 3BGRB 2LECA 2GHVC 1SUQB 3T19A 1R0AA 3I0SB 4ZVHA 4F3QA 1DBDA 1N54B 3POTA 3W7BA 4DQIA 4ID5A 2N7YA 3T3FA 3CDEA 2DR5A 3MMBA 2BBEA 3GFYA 4ATNA 1BQMB 2VV5A 3DC2A 4C8NA 1M5HA 2G9OA 5D77A 3V2UC 4NLUA 2YKQA 3CC7S 2JVRA 3DLLQ 3NNAA 3TUJC 3CJ5A 2HGMA 2XBPA 3QIDA 3ICLA 1SKRA 3N5BA 1H7WA 2AV5A 1LFWA 4HT5A 4PG5A 2R2TA 2YNHB 4ZLPA 1U6FA 2DNGA 1DJ0A 1KSPA 1LW2B 3O2IA 3UQSA 1FD8A 4LSLA 1C1CA 2VG6B 3PIPQ 3HHDA 1YI2S 2QSWA 2EW9A 2G4BA 3C2PA 4ES3A 3QLHB 3MUMP 5CQGA 2IHR1 1JK9B 1ZM3A 2F8HA 3NP5A 4NZ0A 5JUMA 4DFKA 4YEAA 2BQRA 1RT7B 2GC8A 1NK5A 4DFMA 4B08A 3PJWA 1WWHA 1L3KA 2M9KA 3CPWR 1TL1B 5B7WA 2ZDPA 3K0JA 1DQ8A 1X0PA 3OFGA 5DDOC 3BQ0A 1T3OA 2CPEA 3SZ2A 4J9LA 5HBMB 2VC0A 2HLUA 2K2PA 4QWBA 1X4GA 2YTCA 3CJKA 3M2VB 4QOTA 4IRKA 2DCLA 4FN5A 2W7PA 4ZDNA 1S9EA 4ETXA 3IBWA 1KQSR 3MUVP 3PJXA 4LUBA 4DOZA 3KLIB 5KG5A 4DV0F 1DARA 3M1VA 5ADZA 4G1PA 4DS5A 3RRGA 1FNMA 1M5KC 2HZCA 2XMKA 2RVJA 2WCXA 4MTPA 4A8FA 2VOPA 1CQNA 4M1KA 2PGCA 5D6GA 4EU0A 2BA9A 4YB6A 1OIAA 3ZZ0A 3OVAA 5F0UA 5CYQA 1MROB 3R5CA 4AE5A 4QW9A 2AYBA 3BQ1A 5EN1A 3NCQA 2MY8A 2ADBA 4B9TA 3PEHA 3UNGC 3CF5Q 3PFOA 3UD3P 2MSSA 3IXQA 3G8SA 4GKJF 3GSDA 3TNVA 1N48A 4KKOA 2CQ0A 1K1QA 1GT8A 3MM5B 3OTDA 2XY7A 2JC0A 4LF8F 1Z1ZA 3BQ2A 4CH1A 2CPXA 3DOKB 2Y1IA 2A2DA 2P9CA 2KN4A 4O4GB 3GQCA 1JX4A 4IKAA 1OPIA 4JI1F 4KFBA 4C11A 4FS2A 3IS9A 1U49A 2NR0A 4IFYA 3MR3A 2RT3A 4O3SA 1VQPS 5DQIA 2ZH5A 3PACA 4TKTA 4IH5A 5G0RB 3CDWA 2MZTA 2MQMA 5KT3A 3F41A 3SFUA 1VQ8S 3OHAA 4I7FA 2FJXA 4B9UA 1V3ZA 1YIJS 1DQAA 1YSJA 4I2PB 3BDPA 1ULRA 3MM8B 4PPZA 4B02A 4Q45A 5IT0A 1LKZA 4QR1A 2BQ3A 1YWXA 3LWLA 1IKYB 3CULA 1MU2B 2YWHA 4ICLA 1IKXA 5LSLA 2E1AA 5SZTA 1APSA 2DNQA 1VRUB 2K7KA 5GAGU 1UP1A 4N41A 5E5NA 2DRAA 4WKYA 4X66F 2WAQD 5C25B 4NZ7A 1X4HA 2DGXA 2YNIB 5L8RC 3AQOA 1REVB 3M6WA 4X2BA 4DQQA 2VFUA 3JTNA 4YQWA 1IJFB 3HO1A 2ZKUA 4DV4F 2HHUA 2OO4A 3OFFA 1GTEA 1IUJA 1H6KX 3CD7A 1ZZNA 3UDCA 4JV2A 1KONA 4B17A 1ZH5A 1XN9A 2QRRA 3O6QA 2AJQA 2VG5B 3WZ0A 4BCAA 3DRYA 4RUAA 5FIIA 3ZZ