2M8HA

Rrm domain of human rbm7
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
GSEFELRRQQALAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA-binding protein 7
publication title RNA binding properties of the human NEXT complex
rcsb
source organism Homo sapiens
total genus 13
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m8hA00
2RT3A 1U1NA 2KYXA 3NNCA 2U1AA 2DNLA 3ZZYA 5D78A 4TU9A 1WEYA 2DNKA 3UE2A 2DNGA 5GAGU 1SJ4P 1VC0A 2KG0A 1WTBA 3V4MA 3IWNC 2VODA 2KM8C 2ADCA 1P27B 2FC9A 1M1KT 3I56S 5DM7Q 2DGVA 2CQIA 1VQOS 1FNXH 2DNYA 5LJ3Y 2DO4A 2QEXS 3DLLQ 1DBDA 1WEXA 2MKHA 3UWTA 3SDEB 1X5OA 1KQSR 4TU7A 2CJKA 3P6YC 2FHOB 3EX7B 3CUNA 1KOHA 2FC8A 2ZJPQ 4QU7A 4F25A 1X4FA 3G6ES 2EK6A 2MJNA 2M9KA 2MMYA 4A8XA 3UCUP 2MKKA 1FHTA 2RNEA 5IQQA 2DITA 2OSRA 2JVRA 3CCJS 3PIPQ 1N88A 1R8HA 2PE8A 5JVHQ 3RW6A 2OSQA 4Y00A 2AD9A 2DIVA 1K8AT 2XNQA 1O0PA 3SDEA 5FJ4A 1X5PA 1U1RA 4OZ1A 2MQQA 2OIHA 2LEBA 2DNRA 2L08A 1WF1A 3MI7X 2RQ4A 2KH9A 3MUTP 2DNPA 3S01A 4WFAQ 3D2WA 2DGUA 2KM8B 4YOEA 1N52B 4TLQA 2D3OR 3UD4P 3MD1A 2KT5A 2N3OA 2DGOA 2ADBA 1Q7YT 2UP1A 4TU8A 3NNAA 2MKCA 1HA1A 2CPEA 2J0SD 2RRBA 1FJEB 2MQPA 3VALA 1U1OA 3S7RA 5GADU 2KU7A 1ZZNA 3B4MA 2KFYA 2KRRA 1U1MA 1Q82T 1M5PC 5H1SV 2CPHA 1AUDA 5JVGQ 2DGQA 2MQLA 2KG1A 2E5JA 2CQ2A 2ZJQQ 2LEAA 2MZRA 2EVZA 1X4HA 2CQHA 2DH9A 2K8GA 4C4WA 4IO9Q 1VQ5S 2HGLA 2BZ2A 2YH0A 4U67Q 2E44A 2RS8A 1VBYA 4UY8T 3U1LA 3MD3A 3G4SS 1X4CA 3S8SA 3HI9A 3CCUS 1JMTA 5CA5A 2F3JA 2DK2A 2KN4A 3RW7A 4Y0FA 1VQ6S 3THPA 1WHYA 2GHPA 2NZ4A 2LECA 2KVIA 5DDPC 1G2EA 3HHNB 3MOJB 3R1HA 1U6FA 1QM9A 1PO6A 4CQ1A 2ZJRQ 4WFNQ 4PR6A 3CCVS 5MLCV 5BJRA 3R27A 2DISA 2Q79A 2B0GA 5IFMA 1WEZA 2G4BA 1YTYA 4RU2A 2MKJA 4P6QA 2YWKA 3VAKA 4QQBA 2XS5A 2RUGA 2MPUA 1FT8A 1UFWA 2X1FA 4WFBQ 2AYBA 3BS9A 1N54B 3TYTA 1WG4A 1VQKS 5LSOA 4WCEQ 1YJWS 3BO2A 2DNHA 2PEHA 2D9OA 3PIOQ 2D9PA 2KRBA 1PGZA 3MXHP 1VQ8S 2MZQA 2E5IA 1OWXA 5DDRC 1X4BA 2RVJA 2YTCA 3CF5Q 5HL7Q 2M8DB 2OTJS 2MJUA 2I2YA 3NMRA 1SJQA 1WHXA 1N8RT 3H2VE 2CPZA 3THTA 3BEGB 1VBZA 2MY7A 1VQ9S 2CQPA 2MGZB 4W90B 2RU3A 1P1TA 1YIJS 2DGXA 5CXTA 2JWNA 3NS6A 4V19X 2DH8A 1D9AA 3MURP 1YWXA 2E5HA 3DXBA 2DNOA 1VC6A 3K0JA 1WHWA 3CD6S 3U1MA 3UCZP 2MZSA 1WG1A 2LQ5A 3VAHA 1OPIA 4IUFA 4YB1P 2CQCA 3R1LA 5EN1A 2N7CA 3UD3P 3VF0B 2DHXA 2MGZA 1Q86T 1U1KA 2J76E 1KC8T 2DB1A 1YHQS 1VC5A 1WG5A 4IOCQ 2LMIA 2DNMA 4ZKAA 5DDOC 3CCRS 1Q81T 2MSTA 1UP1A 3G96A 3CCLS 2VOOA 3CC7S 1YI2S 3LPYA 3L3CA 1VQ7S 2BOPA 2M8HA 1X5SA 5GMKa 1X5TA 5CYJA 1X0FA 2MB0B 1K73T 1U1QA 2CPXA 2DGWA 5LXRA 1DRZA 4QU6A 4C7QA 4M5DB 2M70A 2WBRA 1M5VC 2X1GA 2M7SA 4F02A 3S6EA 2DHGA 4WF9Q 4F26A 1M5OC 2L41A 2MQMA 2XSFA 3FEYB 1S79A 4EGLA 2NLWA 2CPDA 2XB2D 1VQMS 1VBXA 2HVZA 4FXWA 2DGSA 5IM0A 3J7ZT 1UAWA 4YUDA 3G8SA 1RKJA 1JJ2R 2CQ4A 2N82B 4Z2XA 1X4DA 3I55S 4ED5A 4W92B 2V94A 3VAJA 3CXCR 4LJMA 5HO4A 1B7FA 1WF0A 1HD0A 1OIAA 1M90T 2AYMA 3VAFA 2LA4A 2LYVA 1CVJA 1JJ4A 2DH7A 2KXNB 1VQ4S 1VQNS 1FJ7A 3SMZA 2GO9A 5GAEU 2MXYA 2LXIA 2RRAA 3LQVA 2CPJA 3CCQS 1FJCA 3P49B 1RK8A 3CMAS 3CC2S 3MUMP 3CC4S 4CH1A 2KXHA 2HGMA 2N3LA 3NS5A 4IOAQ 1X4AA 5DM6Q 2JRSA 3CCMS 1S72S 2I38A 1F9FA 3BO4A 1L3KA 4FXVA 4J5OA 3G8TA 4LIRA 3NNHA 2LA6A 1YJNS 3Q2TC 3VAIA 3VAGA 1HL6A 4BS2A 2G1DA 1OO0B 2LXUA 4PRFA 3SXLA 5GAHU 1ZZFA 1W2BR 4QPTA 1VQPS 2HZCA 1KOOA 3CCES 3US5A 3J7YU 2X1AA 3H2UB 2CQ3A 5DDQC 2XNRA 3EGZA 2K3KA 1H6KX 1WELA 3FEXB 2VONA 2RQCA 2YH1A 2DIUA 2AYEA 1ZH5A 1NJIT 1U1PA 3UCGA 3G9CA 2L9WA 1WHVA 2F9JA 3ULHA 2ERRA 1VQLS 2M2BA 2JVOA 3N9UC 2SXLA 2VOPA 3CPWR 1KD1T 3MDFA 2M88A 3JB9k 2EK1A 5GVQA 3VAMA 1X4GA 2CPFA 3Q2SC 1A9NB 2A3JA 2OTLS 2XS7A 3ZZZA 1YITS 1WI8A 4UQTA 1K9MT 1X4EA 3P5TL 2DHAA 2M52A 2MHNA 1SXLA 1M5KC 3CCSS 2KI2A 4WIIA 2QFJA 3CTRA 2DNQA 2LKZA 5IM0B 1U1LA 1JJHA 2FY1A 3IRWP 1DHMA 1WWHA 2RS2A 1H2UX 1IQTA 4CIOA 1QVGR 1U2FA 1A7GE 3MUVP 3P3DA 5DETA 2MZTA 1D8ZA 2M4MA 2E5GA 3TP2A 3CULA 2HYIB 1R8PA 2KHCA 2DGTA 2AYGA 1H2VZ 1HD1A 1NU4A 1XN9A 2CPYA 2DNZA 2YKAA 3BO3A 4C0OC 1SJRA 2CPIA 4CH0S 2U2FA 2OJ3A 1DZ5A 1SJ3P 4ERDA 4LMZA 5LXYA 2MY8A 2DO0A 2JX2A 1QVFR 2KXFA 1WI6A 3TO8A 2XS2A 1SJFA 1URNA 2CQDA 1BY9A 4OZ0A 5D77A 2CQGA 2J0QD 2O3DA 2DNNA 2FPHX 1FO1A 2X1BA 1UW4A 1WF2A 1YJ9S 2MZ1A 2CQ1A 2G0CA 2MKSA 5LSLA 2MKIA 5LJ5Y 2J8AA 3EGNA 4WKRA 2MYFA 1NO8A 2HGNA 5ITHA 3G71S 3OW2R 2M0GB 2MQOA 1U6BA 2CQ0A 3B4DA 2CQBA 2DHSA 2F9DA 2QA4S 3CMES 2MZJA 1FXLA 2MSSA 4PKDB 2LCWA 2MQNA 1H2TZ
chains in the Genus database with same CATH superfamily
1ZM4A 5AE1A 5D4PA 2UXCJ 5DM7Q 3PJXA 3AAWB 1Y4ZB 2IM2A 4B3SF 2ZM6J 2HURA 3T5HA 5J2MA 3AB4B 5CYMA 1XC9A 3GILA 4ZLNA 4F4YA 1KQSR 2XSJB 1SJ1A 3PFEA 2OPRB 1RTHB 4Y28C 4C3KA 4WXOA 4RNNA 1QSLA 1PYTA 1MLAA 1HNVB 2DIVA 3HVAA 1O0PA 1X60A 2C3YA 3OXFA 1YVFA 4I2PA 3ZTRA 2CDRB 5I3UB 3QLHA 2NXCA 3O8WA 2XMUA 5D3GA 3OFEA 4ECVA 4DR6F 1C1BB 3HD1A 2HAFA 3X1LB 1SKRA 2HLTA 3SZ2A 1X4HA 4ZJLA 1VQ5S 3OQ2A 2GW8A 4DFJA 4AD6A 1L3TA 3CCUS 2KN4A 3MM6B 3THPA 4J9MA 3RRKA 2LECA 1GTEA 2KVIA 3C19A 1JX4A 4N56A 5F8JA 2F4FA 4PWUA 4ZJOA 3MMJA 3MEDB 3N0VA 2VFSA 1S1VB 2H4YB 4ZPBA 2DRBA 2ZHAA 1XMQJ 1LWXA 2W4DA 3PYGA 3UVJB 2VL1A 4MK7A 5I4MA 3W63A 3QGHA 3HSDA 2PIIA 5KFHA 3TUJC 1S1XB 1AYEA 1CS4B 2BMBA 5IWAJ 4FF4A 1VIOA 3OVBA 4DN0A 4TKTA 2Z2MA 2W7PA 1M1HA 3KG0A 4MTPA 2JWNA 2KT3A 1UPMB 2IVFB 4N41A 1HNXF 4IFYB 3JTPA 4KYZA 1PAEX 3SCLE 4CT8A 1BHNA 4ED0A 2P5VA 2ZVIA 3T1YF 3UD3P 2PFDA 1CJTB 1U1KA 1X0PA 2IY5B 1D3WA 1YHQS 2DRAA 2LMIA 1S7IA 4PUOA 4H4OA 3G86A 5CYJA 2JHEA 4XIUA 1AZSB 3V6HA 4F67A 2DTJA 3ELHA 4UUWA 2C2MB 1HQUA 2XSFA 1RWMB 3DRPB 3CJRA 2V68A 4RW8A 2O66A 3R97A 3J7ZT 1B64A 2HNZB 2IRYA 2NCKL 1DTQA 4LJMA 5HO4A 1ELOA 2HFVA 2H5IB 1U7LA 3Q8RB 1X4AA 1U24A 4L74A 2FVQA 1S72S 3DXSX 3T5LA 5KG1A 1OYDA 1MW7A 2HHHJ 2LXUA 2WAQD 2FZKB 3MM7B 1NK5A 4DHVA 1W2BR 4DV4F 4U95A 3CCES 4BCAA 3L95X 1EKSA 4DSJA 4K8RA 2VONA 5E5NA 4LIWA 2B9WA 4G1IA 4JBCA 1FRJA 2F9JA 5FD1A 3MEEB 2SXLA 2R2SA 3QRQA 2BQRA 2QL5B 4FS1A 1WI8A 4PG4A 4DL3A 3J80U 4K0KF 1U1LA 3ZNUA 4DV0J 3C15A 3W5YA 2HBQB 1N34F 1TFWA 2E5GA 1QTNB 5LSRA 3ZXWA 4YR3A 3C6UB 1YRUA 3OL9A 1S9GA 2YKAA 4N7TA 1UVIA 1SJRA 2CPIA 2W9BB 3BBFA 1HBOB 3M6UA 3KUEA 1ZPWX 3QT7A 1F5CA 2DHHA 4TY8A 2QLBB 4ECWA 2PI5A 4ID8A 4OHZA 3SV3A 4L75A 1G6BA 1NJWA 1IBLF 4KHPF 2KVQE 1QAXA 2JLGA 3MM5A 2V8DA 3GFYA 4HTJA 3QWPA 5JXSA 2VODA 1S7HA 2JZ5A 2AJ0A 1IWAA 2QA2A 4LQ3A 4NWBA 5LT5A 5ETLA 3IWNC 2DPIA 4PPZA 1JXEA 3MMBB 1U47A 1H0HB 1RYSA 3R3TA 4P72A 1DBDA 1SH2A 1RU1A 1T05B 2PSZA 1RWPB 4RBTA 3KHHA 3E3XA 5DO2A 3P6YC 3KLGA 2YX4A 2CXEA 2Q6CA 3TUIC 1ZM2A 2OSRA 3TX8A 4RUAA 3PIPQ 1JLAB 1IVZA 5ETPA 4QYZK 2OPRA 2F8HA 3MI7X 2FJVA 5KG4A 1ZS6A 4DSFA 1SKUB 3CJ5A 4IRKA 4KHRA 4A8FA 2UUCJ 1N5YB 3UN2A 2ZUGA 3CVKA 3M8RA 2J0SD 4M5KA 1U1OA 3D68A 1HHSA 4P2MA 4NLXA 1CJVB 5I3UA 4NMLA 4PZVA 4ELUA 4KT0C 4CLSA 2IYIA 3U02A 2ZJQQ 4CNZA 2DH9A 4QR0A 2ZC4A 3FCHA 1LV5A 3MMCA 2FDNA 2YH0A 3B6BA 1JXVA 3M05A 2QMUB 2B6AB 1NEEA 2WONA 1HBMB 4DOZA 1WC4A 2A2DA 1NDCA 4CO3A 4A8WA 5MLCV 1FJGJ 2HHTA 3DOLA 2YWKA 4UZBA 4TQSA 2WVDA 2XY6A 2HBRB 3MM6A 1RHUB 1XNRF 2Z30B 3E2EA 4RW7B 3IS9B 2PC6A 5HMXA 1YJ7A 2V4JB 2IJFA 3MEDA 4XAKA 3A1YG 3VR1A 1GMVA 2QX0A 1REVB 1S1VA 3CJ3A 4KFBB 4O3SA 2B4PA 3QJLA 1K1SA 5DDRC 2A6OA 2XZTB 2MJUA 2R4FA 3H2VE 2UXCF 1WJ9A 3VGSA 1BQNB 3CCZA 2CQPA 2Z8QA 1NMEB 2ZM6F 1P1TA 4ES2A 1YIJS 3EZOA 5L1LA 4CM0A 3UCZP 3CNQP 4M94A 4IUFA 1HW9A 4XTTA 2Y8YA 3TAQA 4C6AA 1KQKA 1KVKA 4OIXA 4OX8A 4DV7F 2RQMA 1PJ6A 2NUHA 4WPAA 3ISND 2AJ2A 4F50A 4IFVB 1QAYA 4QU6A 3QPIA 1MN9A 2WBRA 2FJWA 3HJFA 2DHGA 3MCNA 3GG1A 3TUPA 3RTVA 3TANA 4DBQA 4DDFA 1WC3A 3LOUA 5KFIA 1G3OA 1X4DA 4OZ3A 1AZSA 3VAJA 1WF0A 2QLJB 5KFAA 4DQSA 3KK3B 2VICA 1RBAA 2KXNB 1FJ7A 1YX2A 1HNIB 3M2VA 3PY8A 1GFWB 4DPXA 2HNZA 2FD2A 4PXDA 8AT1B 4ZP9A 4ELTA 3H59A 1UEKA 3QT6A 2ZBIA 3CCMS 2OEMA 2I38A 2KB2A 2LA6A 4C11B 1NAQA 3QATA 1R8CA 1VK3A 4UF4A 4OI4A 2XMJA 1EX8A 3SCIE 3US5A 2X1AA 1HLWA 2JEFA 3T1AA 2GIFA 5RUBA 1U8SA 1G4CA 1WHVA 3DGVA 4I0WA 1RT3B 3TVZA 3GYGA 3MM7A 2M88A 3BYPA 4R8UB 2DCUB 2QFIA 5GADI 1HFEL 5D0EA 4DR1J 5A8WB 3QBCA 4OYOA 3OSPA 3C14A 4IRCA 1SKWA 2ZZNA 2ZKTA 1RAAB 2UV8A 1R8AA 3OR1B 3TOQA 4HH1A 1F5AA 3KG1A 4LF6J 1FERA 2PMHA 4J9SA 1NB7A 4B17A 2XG8A 2U2FA 1F9HA 1AW0A 3KJVB 2OEJA 3NAHA 2K06A 2UZAA 2XC9A 3A3OB 3H5XA 4BHQA 2C2KB 4HI2A 4CLZA 2W7OA 1UW4A 4CRJA 1WF2A 1RA7A 1LKZA 1NSAA 2Q6BA 2HHWA 1RHMB 1JNZB 2FLLA 4F0MA 3BH7B 3M1VB 3QRPA 5K9FA 2MQOA 1U6BA 2QA4S 3PM9A 4FVMA 4K59A 1N5VA 2BX6A 1RBOB 4EZ6A 4ICLB 5D78A 2YKNA 3UE2A 2AZ3A 5GAGU 4RNOA 1KQFB 1J5OB 4GVBB 1VQOS 4A8KA 4FYWB 1FF2A 5DRKA 5T7LB 1JLEB 2F1FA 1JWWA 3D0GE 2AEJA 3GR1A 4DV1J 5AJ3F 3GIIA 3D5MA 4JI7J 1IM4A 3IM9A 1AXQA 4A8XA 2RRNA 3IBFB 2MKKA 1JB0C 4P75A 4A47A 2FVCA 2PN6A 2DITA 2GMJA 3TAMB 2JVRA 2HK2A 1R8HA 4Y00A 1T05A 1NCLA 4C8KA 3HHLB 2OIHA 1FA0A 1U0HA 3TX0A 2RQ4A 1YBUA 3K7RA 1XNQJ 3FVYA 2WRMA 3FSYA 1OY6A 3MM9B 5B7WA 1FJEB 3R8YA 5DZ7A 4P7VA 4E8UA 3H4BA 4LFBJ 5AXKA 3CIZA 5JVGQ 4WZQA 4DUYJ 3RBDA 1N5YA 1UKUA 4HT7A 4DF8A 2RU9A 4X4NA 3ENAA 1OQ3A 5JUMA 4KY3A 2QG9B 1F2HA 1CJVA 4Y0FA 3NAIA 2HHUA 2W24A 4ES3A 2RKIB 1MSWD 1VIXA 5BJRA 2ZBPA 4MK9A 4JI8J 1B4SA 3K57A 1NPRA 4P6QA 4IOBA 1RXOB 4ZVHA 3OVAA 4C98A 2AYBA 3NXZA 4D3HA 3EVWA 1R0AA 3RRGA 3BO2A 5F8HA 2DNHA 2E9RX 1JIHA 1T94A 3DDNA 3H20A 3M32B 3UNGC 4ENOA 5H9EJ 5K5MA 1N8RT 3CJ8A 2XYHB 4RW7A 3J80Y 3IS9A 2HZVA 1RADB 4FDFA 2DGXA 2V4JA 3EGWB 3JTOA 1HWIA 1D9DA 4CDIA 5DQHA 2VA3A 1RKIA 1REVA 3TAPA 4OMFG 3HF5A 3MCSA 1GMUA 4Q5VA 4DX7A 5LM7E 1NSPA 1RBLA 1WC5A 1Y3JA 2UXBJ 5ETRA 1X9SA 4DV2F 3VQSA 1VC5A 1WG5A 2NYHA 3MCOA 5HATA 1LWCB 3IC1A 3V4IB 2FHJD 3R7SB 3I4PA 4MYUA 1NJYA 3S6EA 2UUTA 1M5OC 3D7SB 2DT9A 3TEGA 1P8GA 1NBEB 4DFMA 4MJKA 1RWOB 3MEGB 3GIKA 3D28A 2NSBA 4HEA9 2N82B 1MNEA 4ZJQA 2F65A 1OY8A 3L7OA 2LQJA 4DSKA 2KDOA 2OO4A 3KJNB 3PACA 1HD0A 1OIAA 3MAAB 2LA4A 1APSA 1CVJA 1NHUA 1EETA 4DL0C 3PX6A 1L3SA 3CMAS 3NEKA 3Q0AA 3GV8B 3BO4A 3E8OA 4DG1A 3CDAA 3C16B 3PJ9A 1N0UA 3AJ2A 4YB6A 9RUBA 1KOOA 3L7PA 3H2UB 4F4XA 1WOOA 5KFGA 4HH0A 2RQCA 3N6NA 3W9JA 4C11A 1N56A 1RT2B 3OLBA 1FNMA 3MPWA 1F0XA 3D66A 2GQ2A 2MLYA 4LR7A 3NY0A 4DV6J 4Y2CA 2HSEB 4DR2J 3V6JA 1PSDA 2R9LA 1SXLA 5IXUA 2UVRA 3T9ZA 5T41A 3Q83A 2DNQA 2BJDA 3C2PA 1NKBA 2HWIA 1T9VA 5LMNJ 4KH0B 4RNMA 4HDHA 3D0IE 4LF8J 1CPZA 3CT9A 1HHQA 3HK2A 2AT1B 3HVRA 2BW7A 1RCXB 1PC4A 2GJFA 1HWKA 5F3ZA 2DNNA 5B0BA 3GIJA 4OQJA 2OPQB 1FTCA 1GX6A 3LUYA 1D09B 4J91A 2HFNA 3T19A 3KJVA 3KWMA 3CMES 3QIPB 2ZJPQ 2VASA 3ZO7A 4NRUA 2KYXA 1QAJA 4R5PB 3G6VA 3M6WA 3OLAA 2BRKA 4RPFA 3V4MA 3V6KA 2W2MP 4FZVA 2FC9A 3HZGA 2ZH1A 3ZZTA 2EW9A 3W2WB 2VFVA 4GO5X 3M1VA 3O1LA 2VC1A 3PR5B 4JI4J 2BJ9A 4I56A 2PT0A 2B51A 4ICLA 4O0IA 1KOHA 1Y5NB 3CD5A 1J5OA 4N76A 2Y1RI 2VQFJ 1FRHA 3GJTB 5HBMB 1JLEA 1FXRA 4Q2MA 3GONA 4ED3A 3EVOA 3DRRB 4B3RJ 2L08A 3KLHA 4ZA1A 4WFAQ 3GYNA 2BABA 4USUA 4KPCA 2RF2B 4AQYJ 2P2CB 3TAMA 3RR7A 4Y6IA 1PKUA 5B0DA 3VALA 3HHLA 3DOMA 3BSAA 1JLQA 1SC3B 3DHXA 5H1SV 4F2SA 2XWYA 2DGQA 2KG1A 1IBMJ 1TKTB 5BXIA 4I69A 2MTLA 3MM9A 5KFUA 2HGLA 2V6AA 3NP5A 4LF6F 1BQXA 3V81A 1CQNA 2G0JA 3LP2A 3H5YA 1QUVA 2COLA 1IBKJ 5EGYA 4WFNQ 3Q8SB 3OXLA 3JYTB 2DISA 2R2TA 2HLUA 4RWWA 5H9FJ 1RYRA 2OH2A 4MIBA 4QQBA 4AT1B 2H4WB 2YWGA 4DL7A 1O8BA 1WG4A 4YHHF 4DUZF 2Q3PA 4DPWA 3TA1A 2PEHA 2D9PA 1OWXA 3HCXA 3VCDA 1NJZA 4QWBA 4B9SA 1S5ZA 4HACB 2KZZA 4CO2A 1A6LA 6FDRA 2J8SA 4FYVB 4KBIA 4LF4J 3M8QB 4J9QA 1TAUA 3B82A 1LFWA 2C2ZB 3M32A 3ZFVA 5ETOA 1YBAA 3NKYA 5HQ8A 1U45A 1GAOA 4JI7F 4M8LA 4RUCA 2AGOA 1F3VA 3UFCX 4ZP8A 2DB1A 1OQ6A 1OS5A 5CCLA 4C8OA 2AF6A 1Q81T 3ZTSA 2R7VA 4UOGA 2ZZMA 1HMVB 5HP1B 1I6JA 4USJC 1VGYA 3PRDA 3GB0A 1Q5YA 2MB0B 1K73T 4DS5A 2HK3A 5CAAA 1XNQF 2X1GA 1WACA 2VPXB 1RDRA 1DLOB 1S79A 3MAQA 1UCNA 4UUXA 4DX6A 4FXWA 1HBUB 2AP6A 2BKNA 1JJ2R 4O44A 1N33J 4LFBF 4KSEB 1U0SA 2V94A 2WW4A 1M90T 1VQYA 2CJQA 3PKMA 3P45B 2RUSA 1S1WA 2UUWA 1VQNS 2ZH9A 2QLXA 3MEGA 4MKYA 1Y10A 2A1BA 1U2RA 4OI2A 3BV8A 1YBTA 3ILJA 3RRHA 3QMQA 3CJSA 3M30A 1L3KA 4LF7J 2YPYA 5KOWA 3VAIA 5K8NA 4JI3F 2GMHA 3POTA 4ZVOB 4DXLA 2XMWA 2B9YA 2Z2LA 2FY8A 5ETTA 2GC8A 2A2CA 1WELA 2XMVA 5C25B 2DIUA 2ZBRA 4RUBA 2L9WA 3L4BC 1V3ZA 1NHVA 3KDNA 2V8PA 1HBNA 1VRQC 4ZPVR 5E7OB 5GVQA 1TL7B 1VYAA 1U49A 5E3PA 3KLIB 3OFGA 1ZAXA 2HS0A 3P5TL 1FWPA 2IFXA 2Z2YB 4TYAA 2LKZA 2JEJA 3IGNA 3F56A 4M5IA 3W2VA 3BGOP 1H2UX 4I6AA 3G87A 3CULA 1ZAVA 4MKBA 3PJWA 3PEJA 3R6GB 4A4JA 3BZQA 5D0RA 4JI5J 2KXFA 1CC8A 2YQ3A 1NK6A 2CQDA 3O3LA 1RB0A 3B8HA 4QIFA 5LSLA 4WKRA 2MYFA 1B99A 3BR8A 3I5CA 2GS8A 4F0KA 4URSA 1S0VA 2IAJB 1M5HA 3NG8A 2R8IA 1UWAA 2OPQA 5HJYA 2RHSB 1VDHA 3Q8QB 2HQCA 3DLLQ 1Q5VA 2RDDA 2IM0A 2HS4A 1PILA 2QIFA 4LRDA 3AH6A 4B9VA 3SSRA 1Y5LB 2D74B 1DAXA 3K5MA 2VG6B 1W2IA 2H5JB 4UZCA 2PD1A 4MT1A 3W2WA 4NCGB 1DQAA 4C2MA 4A8YA 4WP8A 5FJ4A 4J9NA 2Y3YA 2VPWB 4B9MA 3DYAB 4O3NA 3M8PB 5A8RA 2HKEA 4Y65A 1RAJA 4EK2A 4V19J 2DEIA 4DR2F 1RT4A 4F36A 2HRTA 4X4TA 2HZAA 1IM6A 4LFCJ 2EXUA 3VQTA 4KPYA 4LF9F 2LQ8A 1SC4B 4C4WA 4TYBA 5AXLA 5KFRA 5J1NA 4ZS6A 1DTTA 1QTMA 3GE9A 3FFIA 2GGPA 2Y1LB 3K8WA 2YKQA 2X3DA 3R5GA 4WU2A 1QSYA 4YB5A 1K44A 2DYAA 3CCWA 4C9DA 1HI1A 1BGXT 2MLXA 5F8LA 2LQ9A 1HI8A 1PCAA 4IG3A 3OPKA 2H1YA 1CBKA 3F73A 1RWNB 3NGSA 2R8KA 2C2NA 1CULB 2V63A 2HWTA 2KJWA 1EJ7L 1R6YA 3I82A 2MZQA 3JYTA 1FNOA 4AXIA 4PG6A 1X4BA 2PDAA 1KHWA 4YEAA 4OYPA 4CO1A 3VHQA 1VBZA 4K4XA 4GC6A 4OFZA 1T3OA 2WK4A 2YBVA 1GX5A 2QMWA 2HMIB 1M1GA 1VC6A 2I5JB 2UU9F 4ZVRB 2W2OP 2VFTA 2DVIA 1OPIA 1SH3A 4YDXA 3M8QA 4JB8B 4IOCQ 1UZHA 2DRDA 3CMQA 4LRBA 4DX5A 2M8HA 1X0FA 4RW4B 3MFIA 4YFUA 2CPXA 1DRZA 4M5DB 4DPOA 4F02A 4DCJB 1KR4A 2LVWA 1U2CA 2UXDF 3CDWA 4OYBA 2B4UA 3KK2A 4ZCLA 2UV8G 3HVTB 4E0DA 4OHWA 1FVQA 1S4EA 2WOMB 1B7FA 1CQMA 2W4CA 3M2RA 3BSCA 3IBCB 4G1QB 3K59A 1S4FA 3MZIA 4U7CA 2FUG9 5BYRA 3CE8A 3HT3A 3AOAA 2N3LA 2CG8A 5C42A 3AD9C 1IBKF 3TJAA 3TARA 4NI2A 2CWXA 2FVPA 2YWWA 3IRXB 1HR0J 1T9WA 1FRXA 1D1UA 1ACMB 1SCJB 1I1GA 5HMZA 1TUGB 2MDAA 2E1MC 3H90A 1ZH5A 2GX8A 2VQEJ 3G9CA 1NHKL 2ERRA 1HWLA 3QAUA 4KR0B 4MFBA 4DR3J 5M2PA 4H4MB 3KKFA 1RI7A 2O5DA 1NK7A 4A46A 3TQEA 2CPFA 3Q2SC 2UVVA 2FGOA 3N5BA 5C2GA 3ZZZA 5C25A 3G8QA 2W1BA 2M52A 4FP9A 4Q0BA 4FYXB 1TQLA 4ZVSB 5ETKA 4Q44A 1JJHA 1WWHA 3F44A 3CSKA 1EP4A 2O01C 4K4YA 4O4GB 5L9XA 4P52A 2OEKA 2HHQA 3DKDA 1AT1B 1XN9A 1NDLA 4CH0S 3WC2A 1SJ3P 3CCTA 2IYGA 4DLGA 1IQZA 3JXOA 1N32J 1WI6A 1RWUA 5EUHA 1K0TA 4DR7F 4OHYA 2HIYA 1Z4UA 4A8OA 2CZ4A 5HROA 1LWEA 1KNZA 4CO5A 2MKSA 2J8AA 3EGNA 3J7A1 3HHLD 2CQBA 1RACB 2P6TA 1TELA 3Q23A 4ZLJA 2J7WA 2KM8C 4Y34A 4FF1A 4DR4J 3MECB 2DGVA 4ED1A 2V50A 3NOGA 5K20B 5LOQA 2IAJA 1CC7A 5F0WA 3DLBA 3ZZOA 1NH8A 3KXDA 2E9TA 4DSEA 1X7VA 2FHOB 5K8MA 4OYXA 2ZWPA 1PAUB 2EK6A 1XMBA 1UPPA 1TK0A 1UEUA 3HULA 3KNAA 4LFAJ 2RSQA 4CLFA 4WTOB 5KFEA 4LRFA 3PV8A 2LP4A 5J2PB 2DY9A 1C1CB 5L1JA 2LEBA 5GMEA 3VZHA 1RCOB 1HWJA 4V1Ak 2WW8A 2HFOA 4ZHRA 4AUKA 2WVBA 4KO0A 1QD1A 3HHKA 1IXKA 1XERA 2C2EA 2VBWA 3OTCA 1FRIA 1VRUB 4IQXA 4WU3A 4NLSA 2C42A 1G7CB 3D9BA 2G13A 3DI6B 1FEHA 2HQGA 4GKKJ 3DDIA 1UA1A 1TL3A 2VV5A 4DV3J 3EJMA 2BQUA 2EBGA 3OHAA 2DK2A 4S0MA 2F4VJ 1WHYA 2GQQA 4JI5F 2R7XA 5IOLA 5C24B 1PO6A 1PIEA 2ROGA 3JTNA 5IFMA 1WEZA 4HTIA 1RTDB 1UFWA 2LXFA 4URGA 4I4BA 4WP3A 2ZWOA 3P8BB 2HPUA 4F0HA 3PX0A 2KRBA 4QIGA 4X66F 1VOMA 3AT1B 2C2RA 4BLGA 2D3O1 4EYHB 1S59A 2BJ3A 4D3GA 1QUPA 3PRBA 3BEGB 1TVRA 3HXMA 3NS6A 3KLEB 1EB0A 2DH8A 3PFOA 2EBEA 4U6PA 4FNIA 3UDEA 5D0GA 3P4UB 1RAEB 2V2VA 1KC8T 4ED6A 2Q1LA 4DR6J 2BKPA 4ZKAA 2HMIA 3I5BA 2XCPA 2CZVC 2BOPA 2I5JA 3DOKB 3B78A 1H74A 4DI6A 3ISNC 4N8OA 5F3TA 1M5VC 3DRSA 2IMWP 3DLHA 2L41A 2WB1D 2RILA 3NCQA 2W8KA 2XB2D 2N4CA 2P9EA 3QFWA 1MWQA 3ITHA 1UAWA 2HNDB 3GU0A 1GXUA 1SQGA 4J9KA 3Q8YA 2AYMA 3PW4A 4LQ9A 4C8YA 2DBBA 3KHLA 5G4DA 5JJBA 4L76A 3DHWC 2F40A 4WWSA 2FQQB 5M2UA 3MUMP 3MEKA 3HKZD 2LQBA 1JLCB 2E5LF 2R42A 4ITSA 3I0SB 4K2XA 4BS2A 2CAJA 1OO0B 3D3CJ 3V6DB 2BJEA 4ED2A 2QSWA 2EFNA 1V5VA 2YNFA 5K14B 1Q8LA 1LWFA 3N9UC 4P10A 4FXDA 3UR3C 3OJSA 3T1YJ 3IRXA 3KK1B 3C46A 1IKXB 2FB0A 3MCMA 4EZ9A 2ZNZA 3PHEA 3NWGA 4JOUA 4BBYA 1KRPA 4I2QA 1JKHB 1KLMB 3DU6A 2V34A 3MUVP 5B0FA 2Y8WA 3D4JA 2HS3A 5L46A 1FFGB 3EVMA 4OLOA 1C0TB 3BO3A 1IKVB 3LAKA 2HEKA 3I0RB 2ACMA 3MF5A 2AEFA 2NS1B 1U25A 5AT1B 2RDJA 2HQ3A 1BY9A 5HQLA 1KSPA 3DNCA 1IKWA 2V0NA 3FDSA 3UNYA 1GMWA 4CLWA 5HLFB 1YJ9S 2ATLA 4O3PA 3CJ4A 3A13A 3PW7A 2J0WA 2PMZD 3W62A 4GRSA 1F5BA 4RW9A 3NGRA 1YK9A 1W26A 3ETOA 3DLEB 2R7QA 2HNYB 2MZJA 3CO0P 2MQNA 3CDUA 1SQEA 2RT3A 3CJKB 1RTJB 2ZH5A 4DV4J 2DNLA 1IWGA 2DNKA 1SJ4P 1ZYQA 2EFGA 2W9CA 1CEZA 3TEHB 1LW0A 4FF2A 5DGAA 4IH5A 4F4AA 2BA9A 2UVWA 1NK8A 2DPJA 2PA3A 2GAHC 1WSRA 5B0EA 3PKYA 4RX6A 2BBEA 1HR0F 1Q16B 4IR9A 1XQIA 1KVIA 4DQPA 5CQGA 1T0TV 2D3UA 2BE9B 1K8AT 3SBMA 1WUUA 5KG3A 1FKOB 1N34J 2DNPA 2AV5A 5HVFA 3MD1A 1F2GA 3QSIA 2VZ9A 1C0UA 3M2UB 4DR5J 5IV3A 4NA2A 2F8EX 3HKWA 4ZVEA 3UDLA 4RUHA 1R3NA 4CH7A 4MIAA 3GSIA 5KFLA 2X7IA 3FGVA 5K8OA 2LEAA 4WYLA 2EVZA 1QSSA 3KFWX 3GSDA 3H2LA 1L5UA 2BZ2A 7FD1A 5KT5A 1EHWA 3EMTA 1IBLJ 5A2QU 2F3JA 2KFZA 1W25A 4CTAA 3OL6A 5KOXA 3DI6A 4PR6A 3CCVS 1GK8A 3J7YI 1FXDA 1Z2LA 1TKXA 1T9TA 3QT5A 3TWZA 3LA0A 2V4RA 5C24A 3QZ8A 3R5BA 2W2QP 2FZCB 4ZIVA 1S99A 4MIWA 4OI0A 3I4HX 2CJXB 4NYOA 2XQCA 1N5SA 4XPEA 1RT1B 1RWWB 2RU3A 3DLKA 2BJ7A 3RBZA 3KLFA 3UN5A 1FRLA 3QQCD 4OV6A 2R2RA 3AODA 1UJ5A 4CLLA 3OTBA 4CLYA 1S1TA 4R0JA 1GQEA 3T6JA 1EIYB 3EM1A 2BYCA 3I87A 3DGPB 4Y3CA 4ECRA 2VPYB 1UP1A 2E7WA 1Q8KA 4GO7X 1AROP 1U1QA 4LRCA 1GTHA 2J6TA 3NBPB 5KFYA 4J9OA 2EC2A 1ZAWA 5KT4A 3R5AA 1O5JA 3DOKA 2HAIA 2RDIA 3BBBA 4Z2XA 4AL6A 4NA1A 2AGPA 2B4VA 4TY9A 3GR0A 3VAFA 1O51A 3F41A 3E01A 2CIMA 2MKYA 4FYYB 2E1RA 1XNRJ 4IG0B 4GKKF 4BWMA 3R9LA 1FDDA 2OPSA 2V69A 4U8VA 1ZPVA 4J5OA 2XI2A 3Q2TC 1PYSB 3VWSA 4USKA 4PRFA 1Y00A 3C66A 2W01A 2XGPA 1EZZB 3UR0A 2HZCA 3CO9A 5IS2A 2K2PA 2CQ3A 2HRUA 3M8YA 4H54A 4LF5F 3FEXB 1JLCA 4EEYA 4J9UE 3I0SA 3AJDA 3HDSA 2JVOA 2IBKA 1U4BA 2I8EA 1QLNA 5E0OA 5J2QB 4CYUB 4JI1F 3IAS9 5A0YB 1TKZA 4ZVGA 3VAMA 1TU0B 5IT0A 1R43A 3RB0A 4L3NA 2HFZA 4UQTA 4DV7J 5L8RC 4Y2AA 2GHWA 1CJUB 2QFJA 4E98A 1L3UA 5IM0B 2EI5A 1IKXA 1Q8BA 1A7GE 4B3OA 5KG7A 3I5AA 1FESA 3VV2B 3IG1B 2FVRA 4I6WA 2DGTA 2AYGA 1H2VZ 4DWIA 2GNKA 4C0BA 3SCJE 4C0OC 4MKVA 1JKHA 1OMSA 4B3MF 1J5EF 2OJ3A 5CYQA 3GPAA 2ASJA 4JI0J 4LT6A 5D4OA 1C0TA 3OV7A 4C0HA 4WXWA 1ZA2B 2QGFB 4LSZB 3OW2R 1VLOA 2F9DA 4PKDB 1Q82T 2N7YA 3G82B 3G6XA 2R7RA 1U1NA 1X9MA 1S9FA 1WTBA 1EKRA 1KEKA 3IR6B 4O0NA 1RT5A 4UOCA 1FNXH 3TJ9A 2DNYA 3ILIA 5CABA 3IR7B 2BDPA 2MKHA 3DLEA 2YX7A 4ANDA 2ZOFA 2GAGC 1S0NA 1RTJA 3KNGA 4OZNA 4HHHA 2XMAA 4K4VA 3M8WA 3ZTOA 2EC0A 2Y0SD 1HPZB 3UCUP 4ECSA 4UW2A 5HI7A 2NR0A 3SI8A 1VRTA 1Y7PA 4H4KA 2PE8A 4LF1A 3BGFA 4FKXA 1U1RA 4OZ1A 2MQQA 4AL5A 2AX0A 1B0TA 4QW9A 3S01A 3LGHA 2DGUA 1S6QB 1FDBA 1KDNA 3THVA 4NE9C 1FX2A 3DM2A 2Z4PA 4DZ6A 3VGTA 5GADU 2KYZA 2B7CB 3GV7B 4USMA 5F8GA 3ENWA 4BWJA 3C6TB 1UETA 3M2UA 4C8LA 2L48A 3PW2A 2QT7A 4ZMMA 5LMUF 1VBYA 5ADZA 5HMYA 4Y2MA 3EDQB 3LWLA 3HI9A 1WC1A 3HHNB 4F4ZA 1XTZA 3BGRB 2FLPA 3M6XA 4O23A 2IM1A 3KG4A 5IV4A 4OX7A 1F3FA 5EX0A 4FVCA 1S57A 1PBAA 3W61A 5L39A 2FHKA 2J9EA 2VDHA 4ZCIA 1YJWS 1HYSA 5THWA 5AJ3J 1KS2A 2D69A 1T8EA 5D8HB 5E3QA 2R7TA 3DFEA 3Q8PB 2RVJA 2UUAJ 3OHBA 1C4CA 1NH7A 4PXEA 1OPZA 1YJUA 2FHJA 4EWTA 3HO1A 3KOAA 3GFZA 1QJHA 4NXMJ 1YWXA 3B54A 3DXBA 3CD6S 2MZSA 2QYCA 3OFHA 2K7JA 3HMJG 3D6TB 2ZITA 2DHXA 2V2ZA 4PQUA 2IDEA 1Q86T 1Q7LB 1RLCL 2ASYA 2GV1A 3SFGA 4JV5F 2DNMA 5A8KB 4TXSA 1SL1A 4RU9A 3RZAA 2CNKB 1X5SA 2XMMA 1UTAA 1TTHB 1L3VA 4C7QA 5EWFA 2ATCB 1N6QA 4KH1B 4ZVQB 3GG0A 1ZETA 4GKJF 1CLFA 4DR5F 3DGPA 1TL1B 4CM2A 3ISZA 2KFNA 1Q53A 3MPDA 2HVZA 1NJXA 3S1TA 2GZOA 3R6LB 1LW2B 3HHDA 5M2RA 3IMQJ 3OR2A 1Y0HA 1VISA 3VGUA 3OUYB 3ENQA 2CPJA 1OY9A 4IOAQ 1H7XA 2MEWA 3DC2A 3G8TA 3NNHA 2OHDA 4OYMA 4BC7A 5J1EA 3Q86A 1UA0A 4IG0A 2A18A 4KV8B 3SCKE 4EU0A 1B7YB 2ZE2B 5A6WA 1RTIA 2RHQB 3BKUA 1GMWD 3AXKA 4LF2A 3UCGA 1MROB 2XCAA 2QA4G 3GFHA 5J1PA 3MPUB 2AHOB 2DXFA 3U27A 2K1RB 4KGZB 1GXLA 1Q95G 3Q89A 4DV2J 4X4PA 2CRLA 1BWEA 2MHNA 2XSJA 2KI2A 1FDNA 5J2QA 1RTHA 1RT7B 1FDAA 2IRXA 1U2FA 3TVYA 5A2QY 3ZZUA 2JFKA 3TP2A 1HNVA 4NZ7A 2H65B 1RGVA 5DS7A 4AXJA 1S10A 1SUQB 3DRYA 4B08A 1SJFA 1I94J 3H42A 4OZ0A 5KG0A 5KFWA 1J2VA 1WDDA 2CADA 2CVEA 1C1BA 1IBCB 4MKAA 2WSEC 4X4RA 5DQGA 4PPDA 3K5NA 4NA3A 1TUWA 3MTKA 4Z37A 5ETVA 4Q8FA 2MSSA 1AA1B 2U1AA 8ATCB 1LK5A 1V3RA 3AA8A 1T9UA 2B4OA 2L9DA 4DU8A 2VU5A 2KJVA 2AX1A 2DO4A 3OTOJ 3JQKA 4LVOP 1WEXA 3JAMU 3SDEB 3G82A 4OJHA 2LU1A 1JNRB 2C2DA 4F4WA 3RAQA 2XI3A 4IH7A 1X4FA 4NXNF 3UVJA 3UPFA 3IBWA 3AQPA 4JV0A 1N88A 3RW6A 2DR5A 2AD9A 1WC6A 2ZD1B 2ROEA 1S1XA 2RD5C 1CS4A 2R8HA 1DQ9A 2PEBA 2D3OR 1HPZA 2N3OA 3CJ0A 2IHR1 2DGOA 4DQRA 3FJ2A 3QYYA 2XY5A 4CI0B 4ANCA 4Q2LA 3FK4A 3EYZA 4LBPA 4ZPWR 2KU7A 4YDDB 4IFYA 4UTGA 3H7HB 1U1MA 2YWHA 3UW1A 2CPHA 2M5YA 2MQLA 1RWVB 4DQIA 2NXJA 3H0PA 1T3NA 4AL7A 1S6QA 1CJTA 2GJIA 4M5LA 4U67Q 1KQGB 2RS8A 2B9EA 2PI4A 3C3LA 1XIQA 1WOPA 4EYIB 1IN0A 2J6UA 4NZ6A 3UI3A 3ZTPA 1NDPA 1U6ZA 4OX9F 3O2IA 2V2KA 2V5HG 3W9HA 3SV4A 2ROPA 1Q4RA 4CLUA 4Q7AA 3DRPA 3TJ8A 2ASDA 4JI0F 1TAQA 4YY3J 1FFSB 4RKUC 2XS5A 4M5GA 4PG5A 4XPCA 5BYQA 2EFOA 4WCEQ 3BGRA 3BQ2A 4QJVA 2D7SA 3QGGA 2HHSA 3GWCA 2WVFA 3SSQA 4I2PB 3U7JA 2CVIA 2I2YA 2V9WA 1SJQA 5E33A 3QLHB 3EWGA 1FX4A 2ZDPA 1C2PA 5MAOA 2NZCA 4EUVA 5AXMA 2QL9B 5F8IA 1SVDA 3U1MA 2UUBF 1WG1A 3R1LA 2XGQA 2LU2A 4LBHA 3MEEA 5KFCA 1N48A 2CDQA 2GIRA 4J37A 4EBEA 1R89A 1N5TA 1FRMA 1QY7A 4Z7CA 4CCHA 1WORA 2OELA 3LGNA 1XEZA 3FCWA 2R3VA 1SQFA 1T9YA 4ZPDA 3JQMA 2YQ1A 1LXJA 3I9ZA 3I55S 3BDPA 2XHWA 4PXBA 1D9FA 3C6UA 2LYVA 4F4KA 2JJ4D 4NLRA 2J9CA 2CKWA 3RUBL 2W9BA 4YHHJ 5C7PA 4DUZJ 4WTYA 5F9NA 3T3FA 1HBOA 1JLFB 3TR5A 2B3TB 2V9KA 2HGMA 3DLJA 4UQGA 1UWBB 3IM8A 5FDLB 3A3NB 4X62F 5E3AA 2AZ1A 3JS9A 5KT3A 4ZDNA 1FRKA 3PR4A 1UJ6A 5B09A 5KG5A 2K3KA 1ICEB 2G2YA 3P5BP 4QR2A 4PUOB 1F60B 1YKWA 4H4OB 3MMBA 4KV8A 2XO6A 2ZZTA 2ZE2A 5JMNA 2UUAF 1N36F 2JLEA 4A8QA 4K50A 4F3OA 1HQUB 3LPEA 4RW8B 2DXDA 1EAYC 3H40A 4NXMF 2FY1A 2ZVSA 2K1RA 4U7UK 1QVGR 4HKQA 2ACYA 1H3DA 1P9YA 1VS3A 1DTQB 3IN5A 1JLAA 2CA9A 1Y9OA 3BPSP 3VTIA 3W3SA 4YP3A 4IH6A 3DRXA 4Y2IA 3WX8A 1PG5B 4W98A 1RT7A 3K17A 1MG7A 3ADAC 2BQ3A 3AD7C 4TLRA 2CQGA 2XZWA 2O3DA 5H9EK 3T6BA 4LUBA 1TMJA 2H54B 3AFGA 2GVZB 1Z1ZA 1NO8A 1SUQA 1S48A 3TW0A 4FPRA 3D1HA 1HIYA 4JI3J 3HHLC 3R5DA 1RP5A 1FXLA 3MPVA 1PC5A 5BR8J 2HHVA 2H9ZA 4DCOB 4G1PA 2LEPA 2B6AA 5KFTA 4NLYA 1GH8A 2CQIA 1HBMA 2POKA 4C8MA 1S6PB 3ZTQA 4ZVTB 4QU7A 4OI6A 4WE1B 1MMDA 3GYXB 4NLWA 4BC9A 4EO8A 4KHMA 3CW2C 3OL7A 4RO0A 2KL8A 2HRYA 3OSNA 3SDEA 3D54A 4KFBA 1S9GB 3ZZRA 1SC6A 3WDOA 2CJYB 1K47A 5IT4A 2KT5A 1BQNA 4X65F 5HN0A 1NPPA 4HHUA 2UP1A 2RRBA 4TY8B 2MQPA 3IWLA 2ZD1A 3A3PB 3B4MA 2C3OA 3AA9A 3VZIA 1M5PC 4ECYA 3W66A 1V3SA 1RSCA 5D4NA 2GVDB 5GAEI 4IO9Q 4U96A 4YQWA 1S77D 3FNNA 3PW5A 1UW9A 3BBCA 3QGPA 4IFVA 2EWHA 2NZ4A 1G2EA 3MOJB 3BQ0A 1QM9A 5IZHA 4CO0A 3PW0A 1YRTA 1I94F 1CJKB 4QW8A 2RIJA 2Q79A 2G4BA 4J90A 1LEOA 3KLGB 3VAKA 4NYPA 2V4QA 3W8PA 1F6TA 3H5UA 2YPZA 2BE2B 3KYLA 1RQ0A 1UFKA 3FRZA 3KK3A 3FMBA 2GMLA 2DR6A 2GQCA 5HL7Q 2F63A 1HNIA 1NK4A 1HARA 1ZA1B 5HANA 4ELVA 4R0EA 3EUNA 4URQU 3CJTA 2R7SA 2AW0A 3WC0A 3OTOF 5CXTA 2JFDA 3K0JA 3T1HF 2RMLA 1PJ5A 1UVNA 4P2SA 3D67A 1YDLA 3MMCB 2MSTA 1RT3A 3CCLS 2R8JA 2IMOA 3CC7S 1UEVA 2OMOA 2ZBQA 1X5TA 4R8UA 4LF9J 2XTJP 4DEZA 2WONB 4N8NA 3R2DJ 5IC6B 3SFUA 4PYDA 4WF9Q 4F26A 3NMAA 1RABB 2OD6A 4KKOB 2J5AA 2IA0A 3FZ2A 5A8WA 1FI4A 3DOLB 4QCLA 1FEEA 1VQMS 4KGVB 1BD6A 3J7Z5 2C28A 1NSQA 5ETNA 3OR1A 4W92B 2JDJA 1WKLA 4K4SA 3IFEA 3W5XA 4WZMA 4NZ0A 2QSFA 2XBPA 2GO9A 4QBUA 4FS2A 3K5PA 3FMWA 3JAMY 3LQVA 4JI6J 2OI2A 2KXHA 3NS5A 3H98A 1JJCB 2WSCC 4C97A 2ZH3A 5KFNA 1HL6A 5IT9U 2ZFHA 4WFYA 2HBYB 4NRTA 4YY3F 1JLFA 1B0PA 5KG6A 3J81j 4BDPA 3AB2B 1UWBA 1NJIT 5FDLA 4HR2A 5G0RB 2UU9J 5CZXA 2VOPA 3NGTA 3SSSA 4GVBA 3GZ7A 1ITPA 2YQ0A 4I6YA 3JQJA 5T7LA 5HAOA 3DMJB 1A9NB 4ZVUB 1JQGA 3D3BJ 4K2JA 2OTLS 3QAEA 1HQEB 2B5JB 1M5KC 4MAKA 5DQIA 2QE5A 4JV1A 4CIOA 3N5FA 1Q79A 2UXDJ 4UOHA 2G2ZA 5H9FK 2FZGB 2N4DA 3VGVA 4M5HA 1IJEB 2RJZA 3M2VB 1QVFR 2X3GA 3J81U 1NNDA 1XMOF 3N01A 2FYXA 1ZM3A 5EX3A 2WSFC 2EKYA 2VC0A 2MKIA 4FBUA 2WTFA 3Q8UA 1M5SA 4JI2F 2ZH4A 2HGNA 3M6VA 3MR5A 4KGKA 1ZM9A 2YNIB 2IPOB 1SPBP 3GP9A 3ZZYA 1UVKA 2DNGA 1S9EB 4RNFA 1U8WA 2GVZA 3RBXA 4NCBA 2RKIA 3RU0A 5E41A 4DLEA 1EARA 4F04B 4W4MA 3EE3A 4X4VA 3HSZA 1IR1A 2CJKA 2BVZA 4TU7A 2HQFA 1NKCA 3EX7B 3C14B 4J9VA 1HWUA 1R8BA 2MJNA 2UVUA 5B0GA 2FTRA 5IQQA 2JSXA 1D0EA 1S6PA 4WK3A 2BE7D 2GA7A 3U1NA 5C2CA 2KH9A 3MUTP 5B0CA 1RAHB 4WE1A 5KG2A 4YS2A 3T5KA 4TU8A 3NNAA 1YZ6A 1ZZNA 2XMKA 3NLCA 1TP7A 3FZBA 4X4QA 4ATNA 4DR7J 5KFVA 4M1KA 1D8YA 3AOCA 2HFUA 2W4PA 2CG4A 3PVXA 2ZH6A 1E6VB 1DY3A 2WVEA 1VBKA 2YKNB 1PYOB 3S8SA 1LWCA 3V4IA 2DY1A 5U47A 4CQ1A 1OYEA 2ZJRQ 5GAHI 1NSKL 2GVDA 3R27A 1R6VA 3ZNJ1 4RU2A 1F1BB 1FKAF 3LALA 4ZPAA 1T7PA 4DQQA 2R7UA 3NGDA 2GFFA 2YKMB 2FIUA 2EG2A 3MAAA 2XYPB 3MOZA 1CJKA 4HYKA 5BR8F 3G6YA 1U0HB 1P9QC 3RR8A 2OTJS 1F9EB 2YKOA 4ZCKA 2DD8S 2A6MA 2CPZA 2BE2A 1VQ9S 2HHXA 2EFPA 4XO0A 3IXQA 2OGUA 2G2OA 4V19X 3C16A 3GV5B 2EKNA 1WHWA 3WX4A 1REGX 3VAHA 2CQCA 1FKPB 1S0MA 3LO3A 4KIAA 4RLEA 2BR0A 3CD7A 3MGJA 2E29A 1X9WA 5CH7B 3CCRS 4NLQA 3KMQA 3L3CA 1RT2A 4DS4A 5IQ6A 4PYAA 2DGWA 2ZH2A 3PO5A 3IA0A 3CD0A 2NLWA 2YXLA 3KHGA 2QYGA 3FKBA 1ZBTA 3P96A 1XBWA 4ETZA 3JSMB 4QYZJ 2VFUA 2NPFA 4DU7A 2BOAA 4Q43A 1HNZJ 2E66A 2FJDB 3PDNA 1R0AB 1RUSA 3ILOA 2HQIA 2BRLA 4KKOA 2YWFA 4RBUA 3ENVA 1VQ4S 3SMZA 4GC7A 3PNIA 2LXIA 3HJVA 3CC4S 4CH1A 4X66J 1IKYB 1F9FA 4FXVA 2Y1IA 1B0VA 1R7IA 2FJXA 3MM8B 2H5EA 4YMEA 1WOSA 2VKRA 3GIRA 2VA2A 2BKOA 5KTQA 2NQPA 4ZVPB 5DJBA 4FF3A 3BM7A 2JC0A 1NK0A 2KKHA 4IRDA 1H6KX 3QIPA 1U1PA 3TNVA 3R5JB 2JLFA 4R5PA 1KD1T 3MWBA 3HM9A 4RR5A 2DHAA 1KVJA 1HI0P 4G65A 1E6YB 5IC4B 1ZTWA 5F0UA 3CCSS 5G0RA 3N28A 1H98A 2RS2A 2KTQA 1IQTA 4X4OA 2Y0BB 5I3PA 5DETA 4NASA 5HBMA 2QMXA 3DMJA 1QDUB 2E7VA 1HQEA 2QO3A 3A8JA 1HD1A 2B5JA 1NU4A 4P2XA 1T03B 3DRRA 2W2PP 1EETB 3QZ7A 2OD4A 1VFJA 5LXYA 2FLNA 4J9PA 3TVKA 2BM1A 3W9IA 2RF2A 2YKPA 1P1LA 1KFDA 4DG1B 2QV6A 4UY85 3ICLA 2CQ1A 2H48B 2RB7A 1FD8A 5LJ5Y 3BKFA 5EWEA 3D1QA 3QRRA 2E5LJ 4X64J 2V8GA 1TKTA 4ZIWA 1RZMA 1RWKB 2M0GB 2CQ0A 4JYAJ 3ILLA 4ILMA 5SZTA 1H2TZ 4TU9A 4CO4A 4AE5A 4O3QA 3UN3A 3I96A 3M9NB 1B3TA 5HK4A 1KKHA 3BPDA 3FQLA 4DV5J 1XMQF 2LLZA 2DJWA 1YGYA 4JI6F 4OX6A 2KZMA 2KO1A 1YZ7A 2YNIA 4KGXB 4NEZA 1OSCA 2FC8A 1S9EA 4ETXA 5HQMA 2QJ3A 3WIVA 1BXNA 2EG1A 2M9KA 2MMYA 6AT1B 4UOFA 3DN9A 5IWAF 4N47A 3CCJS 5JVHQ 3PTWA 2XNQA 2M3DA 4LR8A 3QFHA 1Z2ZA 4LVNP 4HACA 4YOEA 1N52B 4KJIA 1TMMA 3BF4A 4KRWA 4ZK7M 1BC6A 2MKCA 4PQAA 2IDLA 2AEMA 1HA1A 2JL9A 3X3UA 5DG9A 2B56A 2KRRA 5AE2A 4P71A 4DJBA 4ZP7A 2ZDOA 2O1PA 2CQ2A 5KFJA 4ILRA 1YQHA 4QPXA 4UY8T 4LSLB 5KAKA 1HMVA 5HP1A 1X4CA 3EGVA 1JMTA 1K1QA 2NXEA 2F7VA 3CEDA 4ZN1A 3R1HA 1YRXA 5ETMA 3OXGA 5IT9Y 1U6FA 3HSGA 1DLOA 1E6VA 4I67A 2B0GA 2W2NP 3PRVA 5KFDA 2CYYA 3M9OB 2J0XA 1HBUA 4FKYA 1FT8A 2X1FA 4WFBQ 3BS9A 2CWKA 3W60A 4NCAA 4QWDA 1JK9B 2Z58B 2D9OA 4ILLA 3FBEA 2XEXA 1TL5A 1RU2A 1VHIA 2YTCA 4OJ1A 1TV6B 5EWGA 3KLHB 2HHHF 2R7OA 3NMRA 4ZITA 3RAMA 4EO6A 2DXEA 2YKMA 3BDEA 1J27A 1ZTTA 1RT6B 2LFVA 2EEYA 3CJ2A 3ZZPA 4USHA 3DOMB 1JLQB 2VB6A 3R7BB 2VFRA 1BUXA 1EQMA 2Z57B 4FPIA 4TQRA 3TZXA 2DR9A 1V5IB 4MYTA 3A8IA 2E9ZA 1VI7A 3G96A 2GIQA 3J81Y 3V81B 3BGLA 4M5NA 4B9TA 4O3OA 3LP2B 3N79A 2ZHBA 1TL7A 1FKPA 1XR5A 4DL4A 4DV0F 4B9UA 3KLIA 1W7WA 5I42B 1KN6A 1SB6A 2XWXA 5DZ6A 2CQ4A 1RA6A 2VJVA 4ZVFA 1SIWB 3KTQA 3AQOA 2FJEB 3O44A 3CB4A 3GCXP 2PFFB 2D1CA 2J9DE 2VUGA 2MXYA 2XLIA 2QLFB 3JSMA 2YVSA 5KT6A 4L3KA 3CC2S 3QO9B 5D15A 2G9OA 3OFFA 5CHCB 3D1OA 2YNGB 1S6UA 4IYQA 3LP0B 2NXUA 3J7YU 1T02A 3HP6A 1MWZA 3UDCA 4DPUA 5KFOA 1U02A 1IKYA 1T95A 2QA1A 3M9MB 3ET6B 4F8RA 3D6MB 3MM8A 1KONA 3MDFA 2ZNYA 3MMAB 1X4GA 1URRA 1YJTA 2WBMA 2A3JA 1X4EA 3BJYA 2BM0A 4ES1A 4ZLLA 3D6HB 3KHRA 3PZPA 3R2CJ 3RJMB 1XJWB 2VG6A 4O44B 3WZ0A 4TVAB 4X84A 4J9RA 4NCGA 2M4MA 2AGQA 4ECXA 2UUCF 1E6YA 1S1WB 1DFDA 4ZP6A 1RAGB 4J7CA 3DYAA 2DO0A 3M8PA 3LW5C 3TO8A 2XS2A 3M30B 3W65A 2ZHOA 2ALZA 1FO1A 3SEOA 1T03A 2BJ8A 1LQ9A 4NLGA 3POTB 2MZ1A 2DR8A 5KFFA 4OYIA 1TK5A 1VLYA 3NGUA 5LL6d 4DFPA 3HX9A 2I1RA 2NUUG 2O67A 1GXTA 4ED4A 1HNZF 2WVCA 1MN7A 5I3QA 4DPYA 3NNCA 3N6MA 4LRAA 4OL8A 4ID5B 1HBNB 1FJGF 1VC0A 2RQKA 5ETQA 2GHVC 3I56S 5DG7A 4LF5J 2LDYA 1NLKL 1SKSA 4LSNB 2BACA 4Q45A 5CZVA 5F8MA 1Q78A 1WKJA 4JI1J 4WP9A 4F25A 1KP6A 3RB3A 2VD3A 3W2VB 1CULA 3OBIA 2BV3A 4JUZA 1N0VC 3BGUA 2NYIA 4PABA 2IA6A 2QZ8A 1X5PA 2VIHA 2P9GA 2DNRA 1AFIA 1JXLA 1S49A 1Q7YT 3WBZA 3GTYX 1MWYA 2AJFE 4OV1A 2CPEA 4B3MJ 3AJ1A 1MMNA 1J5EJ 2XHCA 4C3MA 2OP5A 1RAOA 4NYZA 3W7BA 3Q8VA 2Z0GA 4GVLA 4Q8EA 1X8DA 2R2UA 3N4WA 3KMSA 2AJ4A 2ILZA 2D41A 5BYSA 3U1LA 4HI1A 4HDGA 2MQ8A 4RW4A 3Q22A 8RUCA 3DLGB 4M5DA 4RJVA 1B70B 3K5OA 1H73A 1VMBA 3R5CA 4F7VA 4LSLA 4NMXA 1FWLA 2MPUA 4K4WA 3HVTA 2MLZA 3LP1B 1R0BG 4U9RA 3HFZB 2EFQA 3FBCA 3GQCA 2IBOA 1S76D 2FLOA 4X64F 3BN4A 2WOMA 2IM3A 3AY0A 4G1QA 4JYAF 1QAIA 3J7AN 4LREA 4WYWA 5A8RB 4DV5F 3PYEA 2L3MA 1DJ0A 3SYZA 1RT4B 1D9AA 4DSLA 5L1KA 1TV6A 2XO7A 5A76A 5KT7A 3VF0B 4IDKB 1RT6A 1XK8A 1T9XA 1DTTB 2HHPA 3FFIB 4DR1F 4H4MA 4OYWA 1TKDA 1KFSA 3HFVA 2GGPB 5F41A 2CNNB 3QT8A 3TA2A 5LXRA 1RHRB 5KFSA 1S6OA 3L7UA 3MR7A 5LMUJ 2IC3B 4QIEA 3EPGA 1GNKA 3FQKA 4G6VB 1V9OA 4K5RA 1TZ0A 1DQ8A 4F2RA 2DGSA 3M8SA 4B3TJ 3HVWA 4KTQA 4YUDA 4IG3B 4O4GA 4RZRA 3CWJA 3OL8A 2DEJA 2BW2A 5GAGI 1V6HA 5I42A 4MK8A 3GJRB 3QWUA 2Y9HA 3TQ1A 3H5SA 3T9NA 1UVMA 1PJ7A 5EHHA 3CCQS 5L9NA 2JRSA 5DM6Q 4JP8A 3RG6A 2E1PA 5DG8A 1TK8A 1Y11A 4E2FB 2G1DA 1LOUA 2XZDB 5CD4A 1ZZFA 2C22A 3QO9A 2HVEA 2CUYA 4QR1A 4G3IA 4IQMA 3GFXA 3OTDA 1UMJA 3LWMA 3ULHA 1BE4A 2ZH8A 2BUNA 5E2QA 4OHVA 2YNGA 4DV1F 3NS7B 3KDOA 4YN3B 3LP0A 3MECA 3AHPA 4JV5J 2C3PA 1FE0A 2XS7A 1K9MT 3ET6A 3LANA 4EBDA 3KK2B 3CTRA 4ANEA 3T5JA 3OD2A 3P3DA 3MMAA 1D8ZA 4GKJJ 1U26A 5K8PA 3M2RB 1OJ4A 2ZUAA 5KFXA 5J2PA 2DNZA 1C1CA 4OZLA 1O6XA 2G0IA 1A0OB 2QRRA 2NSCA 4ED7A 4H4KC 1R27B 5C42B 4WKYA 4WFXA 1JLBB 3W1YC 4DUYF 2FPHX 2NXNA 2X1BA 4NI2B 1VRUA 5DGBA 5EDWA 1Q1KA 4PXCA 4AYBD 4F3MA 2G0CA 1HNWJ 4HVZA 4FBTA 2KHDA 3D0HE 1HKAA 4ECUA 3R7NB 2DHSA 5GMDA 1WDTA 1NB2A 3VVTA 4JV2A 5FIIA 3I6PA 2E7XA 4MFBB 4JI8F 1M1KT 1T11A 1FWKA 2DKOB 4A48A 4I64A 2HVHA 1VQSA 4ZOSA 3UWTA 3RAXA 2OAUA 4Q0BB 4ID5A 1RTDA 4ECTA 1AB8A 1YSJA 1WC0A 1EP4B 1S1UB 4LSNA 2VG5B 4CLPA 2OSQA 3IR5B 4DZDA 1WF1A 3D2WA 1JLGB 1EQ0A 3M7VA 4OZ5A 4TLQA 3JSYA 4HLBA 4IKAA 4P73A 2ADBA 4AFFA 1U09A 1KTVA 3HSJA 3FSIA 2RE1A 2J9DA 2CFXA 2UXBF 4WJBA 3KLEA 3S7RA 5HROB 5HMWA 1LWEB 2HIQA 2KFYA 2A0FB 2ALYB 3AOBA 2WHOA 1FE4A 4XDCA 2MHEA 1KWMA 4DSIA 3K2YA 1TL4A 1KLNA 2BANB 3W8GA 4K4UA 4NLDA 1S97A 4DL5A 3QGIA 4NLTA 3RB6A 3RYLA 4I1TA 1YJRA 3HPOA 2W7AA 1RLDA 3RW7A 1VQ6S 4YR2A 3NCRA 1BWVA 3KJFB 3KLVA 3PYDA 5E3CA 4DMZA 2HVIA 2V8HA 5CCMA 4NEYA 1YTYA 4WBFA 3L09A 4NOHA 2HNDA 2RUGA 1KBRA 4YB7A 2FVSA 2VDIA 1N54B 2VBXA 3DLGA 1NRKA 4OI3A 4Z7YA 3MAHA 2IRUA 4CLTA 5A6PA 2PA8D 1IUJA 1VJWA 4NXNJ 2NPIA 2M8DB 1WHXA 4ZHRB 2QLWA 3LP1A 1TUVA 4KO0B 2XULA 3EZUA 2F5GA 4M5JA 3RGIA 4KC5A 4W90B 1NUEA 5B08A 1SL0A 3F0NA 5KFMA 4QZVB 2EFVA 4ER8A 3AD8C 4USWA 2R7WA 3LF0A 1NKEA 2LQ5A 1NK9A 3DU5A 4OJ3A 2KT2A 4J9LA 1LXNA 3MHYA 2OMLA 3V6DA 2GO8A 5KFKA 5EN1A 2N7CA 3KJQB 4ZLPA 4DV6F 4NLOA 5K14A 5DDOC 1NDKA 1DARA 1TL3B 2E1AA 1Y5IB 1I3OB 1IR0A 1CG2A 2XYGB 3KK1A 1VCTA 4K4TA 2M7SA 4IDKA 3PG9A 1XR6A 4KB7A 2AU0A 4USVA 1TFYA 1ROFA 4KGMA 3CJQA 3FRYA 2OKQA 1KLMA 3O6QA 5LMNF 3G8SA 4OX9J 1RKJA 3KUHA 5HJXA 3BSOA 4OLPA 4OYZA 3UD5A 4LF8F 5B0AA 4PG8A 4RNHA 2IC3A 3BN7A 1IKVA 4RWXA 3I0RA 3TUZC 2H3EB 2WZ1A 1FJCA 3OVSA 4IO1A 1YJVA 2C3MA 1TVRB 4OHXA 4NLVA 2VBYA 1HQ2A 2B9XA 1TR0A 3FBFA 3SQOP 3K89A 3BSNA 1BQMB 2B43A 4UT4A 4LR9A 1UJ4A 3UO0A 4K5SA 3HLUA 2VHGA 2FJAB 5HLFA 2Z2ZA 3NRBA 5DDQC 2YH1A 2HNYA 1GEHA 3CJKA 3ETMA 3RB4A 2M2BA 2UUBJ 2ILYA 4JI4F 3ZZ0A 4EI2A 3JB9k 2EK1A 3OT9A 2E1CA 3PO4A 3DRSB 2ZOMA 1NM2A 3BH6B 2Y1JA 2VQFF 3EXYA 4YR0A 3TI0A 2VG7B 1Y3KA 4WIIA 5HVGA 4LBIA 3ITHB 4B3RF 4DUTA 1DHMA 2A10A 2HFSA 4AQYF 1UVJA 1R8PA 4X4SA 5KFBA 1FKOA 2BXJA 2GCFA 4XDDA 2K3IA 4RL1A 1UL3A 1FK9B 4MMOA 1WSVA 1IBMF 5D77A 4A8MP 2J0QD 1KHVA 3BKTA 4QYRA 3NCPA 4DL6A 3T41A 3TZZA 1IR2A 3HD2A 4QWCA 4B3TF 2FHMA 1SH0A 3G71S 4B9LA 3M4XA 5F9LA 3O5TB 3NL0A 2I9SA 4X62J 1JLBA 2LCWA 2YNFB 3LH2S 3MFHA 1RJJA 3UDVA 1LWFB 1CSJA 1WEYA 4DL2A 2ADCA 1P27B 2ZBCA 2ZOGA 4P74A 3QSYB 4K7QA 2QEXS 2AMCB 3K58A 5L1IA 3C8YA 4OI1A 1X5OA 1N5QA 1QE1B 4I2QB 4ALZA 3CUNA 4QIWD 1S12A 5D0HA 3G6ES 1N36J 3FBBA 1FHTA 3A12A 4K4ZA 2C1EB 3QIDA 5T14A 2PO4A 3D6FB 4LF4F 5C5JA 3IO1A 4ZPCA 1RAIB 4QWAA 4Y2KA 4O4RA 5FLXU 2KM8B 2WB4A 3GJSB 1S1UA 2VG5A 1RT1A 2XLJA 4ECQA 2RAQA 4PWDB 2CNLB 1IKWB 1MU2B 2AJQA 3MTJA 4DX8H 1JLGA 1AUSL 3GJQB 1AUDA 4PEOA 4X2BA 6FD1A 4RW9B 2ZH7A 1RHKB 2E44A 1ULRA 2V2QA 3I32A 3PEHA 1WTFA 2W9CB 5CA5A 1LW0B 1C4AA 3OJUA 4EBCA 2GHPA 5HVHA 3MR3A 2OUGA 1RE1B 2BANA 1N33F 4CWBA 3NBPA 1K0VA 4L72B 1X31C 3ZC4A 1FFWB 2P9CA 2MKJA 1U48A 5KFZA 5SUHA 4QIVA 3TYTA 3EPIA 1HNWF 1MMLA 2Q66A 1VQKS 4P9SA 5LSOA 2HW3A 2CJAA 5KFPA 4GMKA 3EZ5A 1PGZA 1RHQB 2E5IA 4LF7F 3W5ZA 3PXGa 2W9AA 4ECZA 2L9NA 2RH3A 2HWHA 3EICA 2MGZB 2QC3A 4OZ2A 2HQDA 1C0UB 4DCPB 1HW8A 3HT0A 3BREA 3SQGB 3MURP 4PAAA 3CDBA 5ETSA 3CGIA 4X65J 1RTZA 4X4UA 1GT8A 3MPYA 2X51A 3PCOB 4RW6B 1YI2S 2XMTA 4NPOA 2D3ZA 4CYUA 1VQ7S 3I9V9 1WKKA 5A0YA 5GMKa 4QWEA 4HT5A 4CTAB 2M70A 5AE3A 3UQSA 3V5RA 3FEYB 2JH3A 4EGLA 1CJUA 2CPDA 4NX9A 1SL2A 3DCAA 2EPIA 1WNEA 3I31A 5IM0A 3L9ZA 1TKXB 3GIMA 2DR7A 4OJGA 1VJQA 2OPPB 3CXCR 3IG1A 3N6LA 3VVUA 1G1XA 5GAEU 2F8MA 4B3SJ 2XM3A 2DCLA 4P7TA 3TA0A 2JC1A 3DLKB 1YJNS 2AKWB 2AIRB 3KLFB 1ZOTA 3FCVA 2IVMA 3SXLA 1NXIA 2AWZA 1VQPS 1S1TB 3EXCX 3DDKA 1YLXA 4I7FB 4QOTA 2AYEA 1BQMA 1VQLS 3GCWP 2ASLA 4C48A 3CPWR 1UFLA 3BYRA 7AT1B 3T1HJ 5HSPA 1VHFA 3LGMA 1KTQA 2C2OB 4WFZA 1FCAA 1YITS 1AFJA 4NLUA 5D6GA 1I51B 2CJ9A 4L73A 2YNHB 3PHTA 2QTWA 2MZTA 1SV5B 4CLKA 2HYIB 2ZKUA 4IR1A 3E01B 2CPYA 2VG7A 3Q24A 1LK7A 2B8QA 3LTOA 4F3QA 2ZC3A 4U8YA 2VPZB 1R31A 4ERDA 4LMZA 4B02A 5AXNA 3HZEA 2JX2A 3QJPA 2OPSB 5J2NB 1YG0A 4LFCF 2I0XA 4ZCMA 3PX4A 2J6SA 2B8PA 1FK9A 3G2XA 3SIPB 3B4DA 2VF3A 3MR2A 3C6TA 5J2MB 5CYMB 2HG4A 4P2FA 4ZPTR 2XLKA 3IGVA 2KG0A 2JEIA 1TKZB 3FUYA 5LJ3Y 4EFAC 2C3UA 1NPKA 2Q43A 1HNXJ 4HL9A 1VK8A 2H51B 3M8ZA 2VKZG 4HHJA 1UZDA 4DF4A 1H38A 3TZWA 4CP5A 3A4TA 4B9NA 4B3OB 2RNEA 5D3GB 1N4LA 1DURA 4KE5A 2P8IA 1QE1A 1SBRA 3BR9A 5CYQB 3CDEA 5L38A 2HBZB 3K5LA 3UD4P 1SC1B 4XK8C 1FVSA 2B7BB 4WK1A 1M0SA 4ED8A 4PG7A 4MH8A 4O3RA 2W8LA 3TZYA 2QN6B 2E5JA 2MZRA 2QL7B 1XMOJ 2CQHA 3W64A 3WHIA 2K8GA 3QJJA 4PWDA 2JEGA 3JSRA 5A8KA 1MU2A 3MD3A 3G4SS 2G1HA 4JI2J 1RT5B 3FC9A 5DDPC 3QNWB 2J7KA 2CJBA 5DLGA 4NLPA 2VH7A 1TL1A 2CZ9A 1RHJB 3MR6A 2P6SA 3FSXA 2AJ1A 3HHEA 1VRTB 3PIOQ 2OLWA 1OSDA 2VBZA 3MXHP 1LW2A 1VQ8S 4WIQA 1FD2A 3CF5Q 3OUYA 1RWXB 3K8VA 4KAIA 2CNOB 4OYAA 3THTA 2MY7A 3NGKA 4FYDA 2V67A 1H72C 2NREA 3EDRB 1SI9A 3DM2B 2ZEJA 4USTA 3NWRA 4K0KJ 3BB5A 2VQEF 2E5HA 4M63A 2DNOA 1LFPA 1RAFB 3H8YA 4FN5A 4DR3F 4DPTA 2FJBB 4YB1P 2FGCA 3E51A 2MGZA 2J76E 2APOA 1MROA 3CIMA 2VOOA 3SQGA 3V2UC 3LPYA 1BMQB 3NOCA 5F8NA 5KT2A 2YWEA 2YY3A 3HFKA 4OZJA 4TNOA 2MQMA 2V8VA 3PYFA 3BQ1A 4RW6A 1VBXA 4N5SA 4KHPJ 1WD6A 2I6WA 3GMGA 1NZ8A 4ED5A 1HYSB 1N32F 4M5MA 4NL5A 1I5OB 2BEFA 3LAMA 1JJ4A 4DFKA 2DH7A 3H25A 5CD4H 3OTEA 3RBEA 2RRAA 3P49B 1RK8A 2GJ2A 4CZCA 5DLFA 2JNJA 1PBUA 1P6TA 2OFHX 2OPPA 4LIRA 1H7WA 3VAGA 2IJRA 4CT9A 1RISA 4PWWA 1Q0NA 5GAHU 4FNHA 1BLUA 3IWXA 4QPTA 2R8GA 2BJ1A 4C3LA 1IJFB 1LNQA 4C8NA 2PMWA 4DR4F 2XNRA 3AXMA 3ONQA 3EGZA 4PQUB 2WCXA 4CNYA 4A8SA 2VJUA 2W25A 5FLXY 4KQZA 3H4DA 1FTRA 4L6V3 2PGCA 3A8KA 3WIUA 3C15B 1XWLA 4RBVA 7FDRA 2YX1A 3GLJA 1N6QB 4I68A 4I7FA 1UVLA 5KFQA 4LFAF 3KUGA 2HVDA 2XY7A 2LDIA 2Z56B 2IIHA 1NZAA 3TRGA 3IRWP 4R25A 1Q8IA 2IJNA 3IP0A 4DN9A 2KHCA 1R0CB 4N77A 3OR2B 5E3RA 1DZ5A 2IVYA 2MY8A 2JOQA 4ZN3A 2YNHA 3MM5B 9ATCB 4U7UD 1VR6A 4USIA 3FEZA 1URNA 1SV5A 4EMDA 3IAM9 3A8EA 1SIZA 5J1EB 2J7UA 4PCQA 3WQPA 2ABYA 2K7KA 4DV3F 1S0OA 2AQ4A 5D4LA 1RTIB 2OFGX 4M95A 5ITHA 1XR7A 2F4VF 5J2NA 4TN2A 4C8ZA 3JSBA 1HHTP
chains in the Genus database with same CATH topology
1ZM4A 3NNCA 3N6MA 5AE1A 5D4PA 2U1AA 3NG8A 2R8IA 4OL8A 2OPQA 4ID5B 1LK5A 1V3RA 3AA8A 1HBNB 1FJGF 1VC0A 2B4OA 2L9DA 2RQKA 2GHVC 3I56S 5DM7Q 3PJXA 5DG7A 3AAWB 2LDYA 1Y4ZB 2IM2A 4B3SF 3Q8QB 1SKSA 2KJVA 2AX1A 2DO4A 4LSNB 3DLLQ 2BACA 4Q45A 2IM0A 4LVOP 2HS4A 1WEXA 1PILA 5CZVA 3T5HA 5F8MA 2QIFA 5J2MA 3AB4B 5CYMA 3SDEB 1XC9A 4OJHA 3GILA 2LU1A 1Q78A 3AH6A 4F4YA 1KQSR 4B9VA 2XSJB 3SSRA 1JNRB 1SJ1A 3PFEA 2C2DA 4F4WA 2OPRB 1Y5LB 3RAQA 2XI3A 4IH7A 2D74B 1DAXA 1RTHB 4F25A 3K5MA 3RB3A 1X4FA 4Y28C 2VD3A 4C3KA 4WXOA 3W2VB 4RNNA 2VG6B 1W2IA 4NXNF 3UPFA 2PD1A 3W2WA 3IBWA 3OBIA 4NCGB 1DQAA 2BV3A 4JUZA 3AQPA 1N0VC 1QSLA 4JV0A 1N88A 4C2MA 3BGUA 2NYIA 4A8YA 3RW6A 1HNVB 2DR5A 2AD9A 2IA6A 2DIVA 3HVAA 1O0PA 2QZ8A 5FJ4A 1X5PA 2ZD1B 2ROEA 2C3YA 3OXFA 1S1XA 2P9GA 2RD5C 1YVFA 4I2PA 2DNRA 2R8HA 1DQ9A 4J9NA 2VPWB 5I3UB 4B9MA 3DYAB 4O3NA 3QLHA 3M8PB 2D3OR 1AFIA 1HPZA 5A8RA 1JXLA 2N3OA 3CJ0A 1S49A 2IHR1 2DGOA 4Y65A 3O8WA 3WBZA 1Q7YT 2XMUA 1RAJA 4DQRA 3FJ2A 5D3GA 3QYYA 2XY5A 4CI0B 1MWYA 3OFEA 2AJFE 4OV1A 2CPEA 4V19J 4Q2LA 3EYZA 4DR2F 3AJ1A 4ZPWR 1MMNA 1RT4A 2KU7A 4YDDB 4IFYA 4ECVA 4DR6F 1C1BB 4C3MA 1U1MA 2YWHA 1Q82T 4X4TA 3UW1A 2CPHA 2OP5A 2M5YA 2MQLA 3X1LB 4NYZA 4DQIA 3W7BA 1SKRA 2HLTA 3VQTA 2Z0GA 1T3NA 3SZ2A 4KPYA 4AL7A 4LF9F 1S6QA 1X4HA 4Q8EA 1X8DA 2R2UA 3N4WA 3KMSA 4C4WA 2AJ4A 4TYBA 2ILZA 5AXLA 2GJIA 5KFRA 5J1NA 1VQ5S 4ZS6A 4U67Q 1KQGB 2D41A 2RS8A 1DTTA 3OQ2A 1QTMA 2GW8A 5BYSA 3GE9A 2PI4A 4DFJA 3C3LA 3U1LA 3FFIA 1L3TA 4EYIB 1IN0A 2J6UA 4NZ6A 4HI1A 4HDGA 3CCUS 2KN4A 2GGPA 4RW4A 3MM6B 3THPA 3Q22A 3UI3A 4J9MA 3DLGB 3RRKA 1GTEA 2LECA 2KVIA 4M5DA 1U6ZA 3K8WA 4OX9F 2YKQA 3O2IA 2V2KA 1JX4A 3K5OA 2V5HG 4N56A 4WU2A 2ROPA 3SV4A 5F8JA 4PWUA 1QSYA 4YB5A 1Q4RA 1VMBA 3MMJA 3MEDB 3N0VA 4Q7AA 2VFSA 3DRPA 3R5CA 1S1VB 2ASDA 3CCWA 4C9DA 1HI1A 4JI0F 1TAQA 4LSLA 1BGXT 4RKUC 4ZPBA 5F8LA 2DRBA 2LQ9A 2XS5A 2ZHAA 1HI8A 4IG3A 2MPUA 4K4WA 3OPKA 3HVTA 4PG5A 3LP1B 4U9RA 2W4DA 4XPCA 5BYQA 3F73A 2EFQA 2EFOA 3GQCA 2IBOA 2VL1A 4MK7A 2FLOA 5I4MA 4WCEQ 2R8KA 1S76D 3BGRA 2HWTA 4X64F 3BN4A 3BQ2A 2WOMA 3QGHA 2KJWA 2IM3A 4QJVA 1R6YA 3AY0A 2D7SA 4G1QA 3QGGA 3I82A 2MZQA 4JYAF 2HHSA 1QAIA 2PIIA 3JYTA 5KFHA 1FNOA 3GWCA 3TUJC 1S1XB 4AXIA 4PG6A 1X4BA 3SSQA 4I2PB 3U7JA 2CVIA 2I2YA 2V9WA 4FF4A 1SJQA 1VIOA 5E33A 2PDAA 3QLHB 3OVBA 1KHWA 4DN0A 4WYWA 4TKTA 4YEAA 4CO1A 2Z2MA 5A8RB 1VBZA 2ZDPA 4K4XA 2W7PA 4GC6A 4OFZA 1C2PA 3KG0A 4MTPA 4DV5F 5MAOA 2JWNA 2KT3A 1T3OA 2L3MA 2WK4A 2IVFB 1DJ0A 4N41A 3SYZA 4EUVA 1HNXF 1RT4B 1D9AA 1GX5A 2QMWA 2HMIB 4IFYB 3JTPA 5AXMA 3SCLE 4CT8A 5F8IA 1VC6A 4DSLA 3U1MA 5L1KA 2I5JB 2UU9F 4ED0A 2UUBF 1WG1A 1TV6A 2XO7A 2VFTA 2DVIA 2P5VA 1OPIA 5KT7A 1SH3A 3T1YF 3R1LA 3UD3P 3VF0B 4IDKB 4YDXA 1U1KA 1RT6A 1X0PA 1D3WA 3M8QA 1YHQS 2XGQA 1XK8A 2DRAA 4IOCQ 2LU2A 2LMIA 4PUOA 3MEEA 5KFCA 1N48A 2CDQA 1DTTB 2GIRA 2HHPA 4H4OA 3G86A 4J37A 3FFIB 4DR1F 4EBEA 1R89A 4H4MA 2M8HA 1TKDA 1KFSA 5CYJA 1X0FA 2GGPB 5F41A 3TA2A 4RW4B 1N5TA 1FRMA 1QY7A 3MFIA 2JHEA 4YFUA 4XIUA 2CPXA 1DRZA 5LXRA 5KFSA 1S6OA 4M5DB 3V6HA 4DPOA 4CCHA 4F67A 4F02A 2DTJA 2IC3B 3LGNA 1KR4A 4UUWA 4QIEA 1XEZA 2LVWA 1HQUA 2XSFA 3EPGA 2UXDF 1GNKA 3DRPB 3CDWA 3FQKA 4G6VB 4ZPDA 4RW8A 1V9OA 4K5RA 1TZ0A 2O66A 1DQ8A 4F2RA 2DGSA 2B4UA 3KK2A 4ZCLA 3M8SA 3HVWA 4KTQA 3J7ZT 2UV8G 1B64A 4YUDA 4IG3B 3HVTB 2HNZB 4E0DA 2IRYA 1LXJA 1FVQA 3I9ZA 4O4GA 4OHWA 4RZRA 3I55S 3CWJA 3BDPA 3OL8A 1DTQA 4LJMA 5HO4A 2WOMB 1ELOA 1B7FA 2BW2A 2XHWA 5GAGI 1V6HA 1CQMA 2W4CA 3M2RA 3BSCA 4PXBA 1D9FA 3C6UA 2LYVA 4G1QB 5I42A 4F4KA 2JJ4D 4NLRA 2J9CA 4MK8A 3QWUA 3K59A 2CKWA 1S4FA 3TQ1A 3H5SA 2W9BA 3MZIA 4U7CA 3T9NA 2FUG9 1UVMA 1U7LA 5BYRA 3CE8A 3HT3A 4WTYA 5F9NA 3T3FA 5EHHA 1HBOA 1JLFB 3TR5A 3CCQS 2B3TB 2V9KA 2HGMA 2N3LA 3Q8RB 1X4AA 3DLJA 1U24A 5L9NA 2JRSA 5C42A 5DM6Q 1S72S 4UQGA 2FVQA 3DXSX 1UWBB 3T5LA 5KG1A 1IBKF 5FDLB 3TARA 5DG8A 1TK8A 1MW7A 4X62F 2FVPA 2G1DA 1LOUA 2LXUA 2WAQD 5E3AA 3IRXB 3MM7B 5KT3A 1NK5A 1ZZFA 4DHVA 4DV4F 1W2BR 1FRXA 4ZDNA 1D1UA 3CCES 1FRKA 3PR4A 4BCAA 1I1GA 5HMZA 1UJ6A 5B09A 3L95X 5KG5A 2C22A 3QO9A 2MDAA 4DSJA 2E1MC 2K3KA 4QR1A 4G3IA 2VONA 4IQMA 5E5NA 3GFXA 1ZH5A 3OTDA 2GX8A 4LIWA 3G9CA 1UMJA 4QR2A 2B9WA 3LWMA 4G1IA 4JBCA 1FRJA 2F9JA 3ULHA 2ERRA 1HWLA 4PUOB 5FD1A 3MEEB 3QAUA 1F60B 2ZH8A 2SXLA 4H4OB 4KR0B 2BUNA 4MFBA 5E2QA 4OHVA 5M2PA 2YNGA 4DV1F 4H4MB 3KKFA 1RI7A 3MMBA 2R2SA 3LP0A 3MECA 4KV8A 2O5DA 1NK7A 2ZE2A 3AHPA 4A46A 2BQRA 2UUAF 1N36F 2CPFA 2JLEA 3Q2SC 4A8QA 2UVVA 2FGOA 2C3PA 1FE0A 3N5BA 2XS7A 4FS1A 3ZZZA 4K50A 5C25A 1WI8A 4F3OA 1K9MT 1HQUB 4PG4A 3G8QA 2M52A 4FP9A 3LANA 4RW8B 4DL3A 4Q0BA 4EBDA 4K0KF 3KK2B 1TQLA 3CTRA 3H40A 4NXMF 1U1LA 4Q44A 3T5JA 1JJHA 2FY1A 2ZVSA 1WWHA 3F44A 3CSKA 1EP4A 1N34F 2K1RA 2O01C 4U7UK 1QVGR </