2M8HA

Rrm domain of human rbm7
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
GSEFELRRQQALAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA binding properties of the human NEXT complex
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords RNA-binding protein 7
total genus 13
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2m8hA00
1NJIT 3EX7B 3NS6A 2MXYA 2ADBA 1VQ8S 5IM0A 1NO8A 3MDFA 5DDRC 3CF5Q 5D78A 2DNQA 2KFYA 1WHXA 1VBXA 5LXRA 2DNMA 2M0GB 2DNHA 3TO8A 1X4CA 1UAWA 2WBRA 3R27A 4C7QA 3D2WA 1X4FA 1WHVA 2KXFA 2MQLA 2MZTA 1FXLA 1JJHA 2M8DB 3MXHP 1HL6A 1K9MT 2E5IA 2F3JA 2JVRA 2CPXA 1SJQA 3VAKA 2MGZB 2O3DA 4A8XA 4YUDA 2NZ4A 1U1PA 1VQ7S 3CCRS 2J76E 2MQQA 2N82B 2J0QD 1WEXA 2X1FA 2GHPA 4TU9A 2G1DA 2XNQA 2KG0A 5CYJA 2DNLA 2RQCA 2J8AA 2I38A 1WEZA 2DH7A 4V19X 2CQ1A 1SJ3P 1SXLA 2DK2A 1O0PA 2ZJPQ 3RW7A 1HD0A 2LMIA 2KI2A 2M2BA 2MQMA 1M5VC 2LQ5A 1U2FA 3LQVA 2KXNB 2MHNA 3U1LA 3BEGB 3G71S 3H2UB 3RW6A 3IWNC 3G96A 3R1LA 1X4BA 2M9KA 4ZKAA 2MKIA 5LSOA 5CA5A 2F9DA 2M88A 2J0SD 1WG1A 1FO1A 2BOPA 2KVIA 1FNXH 4WKRA 4EGLA 1WI8A 4F02A 1WHYA 2LXIA 2AYMA 1F9FA 2DNYA 2Q79A 2RUGA 2XS2A 3CCJS 2DGXA 4CQ1A 3SMZA 2MZQA 2YKAA 2LEBA 1WG5A 3VAHA 5LJ5Y 1OO0B 2YH0A 2MY8A 2EVZA 3CCQS 2FHOB 1A9NB 4YB1P 2M52A 2JVOA 4W90B 1VQOS 1G2EA 1P1TA 2JX2A 2RS2A 3BO4A 2D9OA 3N9UC 2QEXS 1BY9A 4WFAQ 2LA6A 1S72S 4Y0FA 1U1NA 2D3OR 2DNPA 2ERRA 3R1HA 1WWHA 2DGUA 2MZSA 3THPA 5BJRA 2LKZA 4QU6A 2MSTA 2N7CA 3MD3A 5IQQA 3S7RA 2MB0B 2JWNA 4WIIA 3IRWP 1ZZFA 1M90T 3I55S 1QM9A 2CPJA 4PR6A 2AYEA 2DHAA 2LXUA 3UD4P 2DGWA 2MKCA 2MKKA 2DIUA 2CQGA 3CCSS 5GADU 3Q2SC 2KRRA 5GAHU 3CCVS 1X0FA 1U1KA 1VQNS 2EK1A 2HZCA 2ZJQQ 2M70A 5DM7Q 2FPHX 1N54B 2CPIA 3LPYA 4Y00A 2DNRA 3MD1A 1VC6A 3DLLQ 2OJ3A 4LJMA 2B0GA 3G9CA 2OSQA 4C4WA 2U2FA 1R8HA 2U1AA 3NS5A 3VAJA 2L9WA 1YITS 2DITA 3CC2S 3VF0B 2OTJS 1KD1T 3MUVP 1DZ5A 2UP1A 1M5KC 3U1MA 1P27B 3J7YU 2CQ2A 3UCUP 5DETA 1W2BR 5JVHQ 3S6EA 5D77A 2CQ3A 2DGQA 2HVZA 1FJCA 4CH0S 4TU7A 2MYFA 1X5TA 2VODA 4WCEQ 4UQTA 3CC7S 3G8SA 4IUFA 1RK8A 4W92B 3CCES 3HHNB 3FEYB 2DHXA 3PIPQ 2ZJRQ 2DGTA 2DHSA 2XSFA 3S01A 4F26A 2GO9A 2HGMA 1KQSR 1D8ZA 2M7SA 2K8GA 2LEAA 2MPUA 4CH1A 2KT5A 2E44A 1OIAA 4OZ0A 1WI6A 2I2YA 1WTBA 5CXTA 1VC0A 2EK6A 2MQPA 1H6KX 1X5OA 1HD1A 4OZ1A 1Q86T 5FJ4A 1YHQS 2RRBA 4ERDA 3CCUS 2ADCA 2CJKA 1H2VZ 4U67Q 2DISA 2KG1A 3UD3P 3CC4S 1DHMA 2MZRA 3NNCA 2LCWA 3ZZZA 4TU8A 3J7ZT 3EGZA 1UW4A 3OW2R 2OTLS 1SJRA 2MKSA 5GAEU 5LSLA 1X4EA 2MMYA 1U6FA 1WF2A 4F25A 2DGOA 2BZ2A 3HI9A 5LXYA 2CPDA 3P49B 3S8SA 2HYIB 3VALA 1AUDA 4YOEA 4ED5A 1N52B 3MI7X 1SJ4P 5ITHA 3G6ES 1N8RT 1OWXA 2CQ0A 1KC8T 1JMTA 3CCLS 3UCGA 2RVJA 4Z2XA 5IM0B 2XS5A 5DDOC 4WFBQ 2DNZA 2QFJA 3MOJB 2A3JA 3MUTP 3B4MA 5DDQC 5DDPC 2RT3A 1VQ4S 3CCMS 3MURP 2F9JA 1PGZA 2QA4S 2L41A 2VOOA 1U6BA 1VQKS 3EGNA 1UFWA 5HL7Q 3BO3A 3CMES 2YH1A 1Q81T 1FHTA 1VQ5S 2VONA 4WF9Q 3CPWR 2CQDA 3DXBA 5EN1A 2M8HA 2D9PA 1VQMS 3CUNA 2DIVA 2AD9A 2CQBA 2MKJA 1IQTA 2X1AA 3VAMA 4LIRA 2LECA 2X1BA 1L3KA 3ULHA 2X1GA 1ZH5A 1KOOA 2CQCA 3US5A 1WHWA 2CPYA 3NNAA 2DGSA 4IOCQ 4QU7A 2E5JA 3NNHA 2DB1A 1URNA 2CQHA 2KYXA 2DH9A 2KXHA 4WFNQ 1NU4A 1WF0A 3BS9A 4QPTA 3VAFA 3G8TA 2MY7A 2LYVA 2V94A 1X4GA 1YJ9S 5JVGQ 2MJUA 3G4SS 2G4BA 4J5OA 2MGZA 2OSRA 1VQLS 1YIJS 2NLWA 1VC5A 1B7FA 1XN9A 2KHCA 2RNEA 3VAGA 2XS7A 4PRFA 2RU3A 2K3KA 3CXCR 2XB2D 2RQ4A 2KH9A 4PKDB 1YJNS 4BS2A 1YJWS 4CIOA 1D9AA 1X4DA 1WF1A 2L08A 1YTYA 1M1KT 1VBZA 2DGVA 2FC8A 3SDEB 1JJ4A 2HGLA 2KM8C 2RRAA 2DNNA 1YI2S 1Q7YT 2E5HA 2YWKA 3UWTA 2AYBA 1JJ2R 2JRSA 1X5SA 3P5TL 2N3OA 1X4HA 2SXLA 2G0CA 2M4MA 1QVGR 1DRZA 5GMKa 4P6QA 2MKHA 3P3DA 1U1QA 2KN4A 1WELA 1M5PC 3SDEA 2DH8A 5GAGU 3CMAS 2MQNA 2E5GA 2KM8B 3FEXB 2MZ1A 2CPFA 4UY8T 4RU2A 3PIOQ 1UP1A 3Q2TC 5GVQA 3UE2A 2XNRA 3TYTA 3JB9k 2PE8A 3ZZYA 3L3CA 5H1SV 1WEYA 2CQIA 1S79A 1VBYA 3CULA 2DO4A 3H2VE 3CD6S 1M5OC 2DNGA 4C0OC 3MUMP 2CPEA 4IOAQ 4M5DB 2MQOA 3TP2A 2FY1A 1SJFA 2MZJA 1FJEB 3SXLA 1DBDA 1H2TZ 1X5PA 2LA4A 4LMZA 3THTA 1FT8A 1U1RA 1U1LA 3K0JA 2AYGA 1VQ6S 1YWXA 1X4AA 2CQ4A 1H2UX 3VAIA 1WG4A 2CPHA 3V4MA 1PO6A 3NMRA 2KRBA 1ZZNA 4IO9Q 1KOHA 2CPZA 3CTRA 1OPIA 1VQPS 2DNKA 1RKJA 1A7GE 2HGNA 5IFMA 1Q82T 5LJ3Y 5MLCV 3BO2A 1K73T 1U1OA 1U1MA 2MSSA 2RS8A 4FXVA 5DM6Q 2VOPA 4QQBA 3UCZP 4FXWA 2CQPA 1VQ9S 4TLQA 1K8AT 2PEHA 2DO0A 2N3LA 2YTCA 3P6YC 1N88A 3I56S 3B4DA 1FJ7A 1R8PA 2DNOA 1CVJA 2OIHA 2KU7A 2MJNA 1HA1A 5HO4A 2FC9A 1QVFR 2DHGA
chains in the Genus database with same CATH superfamily
1DURA 4P52A 2V2KA 4B3TF 3DGVA 3V5RA 5LMNJ 2ADBA 5ETPA 1NZAA 1VRUB 1NO8A 4LIWA 3FCWA 4A8WA 3ZXWA 4DFKA 3A3OB 3J7AN 5F3ZA 2C3YA 3T1HF 1YJRA 4Z7YA 2OPSA 2OHDA 2J6TA 3T6JA 1Q8LA 2HFZA 3LGMA 3N79A 3O2IA 2Y1IA 1C4AA 4ZP9A 1UAWA 2WBMA 3D5MA 3R27A 4BBYA 4L72B 2ZHOA 3JQKA 1X4FA 4N77A 2KXFA 3KLIA 1FXLA 1AB8A 1WC6A 8RUCA 3MXHP 4WJBA 3TJ8A 3WHIA 2M8DB 3MOJB 5KFBA 3VAKA 3FBBA 3DMJB 2YX7A 4YUDA 1GXTA 1HWLA 2R7RA 3QWPA 2EPIA 1PSDA 4LR7A 3K5NA 2MQQA 1E6VA 3LW5C 2LP4A 4Q44A 1C0TB 2ZH2A 4EWTA 2GHPA 2YNGB 2YWHA 2ZH3A 1IM6A 4JI0F 5F8GA 3BH6B 2VHGA 2D3O1 2ZDPA 1VOMA 2OGUA 2H48B 2V2QA 3GB0A 5MAOA 5ADZA 1NJXA 1KR4A 2I38A 2DH7A 2CQ1A 1FF2A 2AP6A 3QO9A 2CG4A 3M8PA 1Y5NB 3L09A 4KH0B 4RW9A 2DK2A 4ZVPB 1IBLF 1RWNB 4AQYJ 2X7IA 3EGWB 4CH7A 2R7XA 1W2IA 1S0MA 1RAFB 4DBQA 1XJWB 4LR9A 1HD0A 1S9GA 5IC4B 3RW7A 2M2BA 4A8OA 4NLWA 2HAIA 2V69A 3MM6A 3OL9A 2UZAA 3FRYA 1HQEA 4YP3A 1ZM9A 3CO0P 2HK3A 2VFTA 1IBMF 2LVWA 3PACA 2VASA 4UTGA 2QL5B 4OZNA 2A6OA 3ADAC 1RWKB 1FNMA 3CD5A 3CGIA 3I0RA 4M63A 3U1LA 3OD2A 4ED0A 1PG5B 4LUBA 1YX2A 5T7LB 1BC6A 3WBZA 3OL8A 2O66A 3IWNC 5L1KA 2XI3A 3R1LA 2R7UA 2JLEA 4TVAB 2DR7A 2QMXA 1S6UA 1BMQB 4IDKB 4OZLA 1IXKA 1VYAA 5HLFB 4RW4A 2F9DA 4WIQA 4A8MP 4UOFA 1X9WA 1WG1A 3A3PB 2PT0A 3BPSP 2HHUA 4X4QA 4EMDA 2W9CB 1PJ6A 3UN5A 2RDDA 1IKXB 2HHQA 4U8VA 1MSWD 5GMDA 1WHYA 3POTA 4DR6F 2FB0A 4DFPA 5E3CA 2Q3PA 3HFVA 2BJ3A 4NLSA 2YNGA 4IRDA 2VG6B 4OYIA 1FI4A 1E6VB 4AXJA 3CCJS 4DR5J 2DGXA 2ZH7A 4DUZJ 3M2VB 2P8IA 1Y3KA 3MEGB 2IM2A 5EWEA 2CJ9A 2YKAA 1CC8A 4I6WA 3CIMA 4WK1A 5LJ5Y 3FMWA 5B0DA 4JI3F 3GQCA 4M5IA 1ZM3A 3C6UB 4ED1A 4LRBA 4ZVEA 2MY8A 3TAPA 3GFHA 1RYRA 5HJYA 2VH7A 2YBVA 2HQCA 4RWWA 5KFEA 2AGQA 3JSRA 3QGHA 3T1HJ 5IT4A 4QYZJ 1MMLA 3M32B 3ILOA 2VF3A 3VCDA 4W90B 2A10A 1VQOS 1P1TA 2ASYA 2GZOA 3MTJA 3F44A 2N7YA 2XLJA 3A8EA 3N9UC 3KHRA 2XEXA 1BY9A 1Q8BA 3V4IA 1VRUA 2L9DA 3HD2A 1CJVB 1Y5LB 2EBGA 2DNPA 4ZN1A 3D68A 5KT5A 4C8KA 4J9VA 4ECXA 2DXEA 4NXMF 2QGFB 5KT7A 3GYNA 1T0TV 1XEZA 1YK9A 3HLUA 3CJKA 4C0BA 4RBVA 5HP1B 3TAQA 4FS1A 2MZSA 3I0SA 3L95X 4M5HA 1JLGB 5KG4A 2ZFHA 3OR1B 2MSTA 2N7CA 2CWKA 4X66F 1RT5A 3I96A 4WIIA 1LEOA 2DCLA 3SI8A 5CZXA 1EP4B 1HHQA 1DTTA 5KFYA 1I51B 2F5GA 2AYEA 4GVBA 5HATA 2LXUA 3GIRA 4L6V3 4F7VA 4M5JA 2PIIA 1QAXA 4NCGA 2R7SA 1U49A 5FDLA 3FVYA 4OYMA 3RAXA 3RB3A 4DL7A 1TL5A 5GADU 2XWYA 4MFBA 4RW8B 5AE3A 3OHAA 2LEPA 4JI4J 3Q2SC 3W9HA 1HR0J 1KLMA 4H4KA 1U2CA 1JLBA 1S99A 2EK1A 3GPAA 4H4MB 4WE1B 2ZJQQ 2M70A 5LT5A 5DM7Q 4AD6A 5JUMA 1N54B 2YWEA 1KWMA 3PHEA 1FRXA 3E2EA 3CCWA 3MD1A 3UPFA 2DCUB 2YWWA 4LJMA 4C4WA 2OSQA 1ROFA 1SIZA 2U2FA 3BYRA 3VAJA 3IS9A 2EEYA 3KXDA 4F04B 1B4SA 1RCXB 2YKQA 2OTJS 1RWWB 1YJ7A 3D0IE 3MUVP 2WOMA 1DZ5A 2UP1A 5J1EB 3T41A 1QAYA 2WSCC 1P27B 3EPIA 1LV5A 1SKSA 2VQFJ 1S4EA 4KRWA 3IBWA 4IFVA 1D3WA 3C3LA 3GFXA 3OJUA 1PILA 3KWMA 1RHJB 4YHHJ 2FDNA 4M5DA 5HVFA 2CQ3A 3UFCX 2HVZA 2D74B 1GMVA 5HROB 4LFBF 1HBMA 4CH0S 1TV6B 4YB5A 2IC3B 3ISZA 4C3LA 4AT1B 3QT6A 1KKHA 1V3ZA 5A8RA 1Y4ZB 1DY3A 2W2QP 4LF2A 4EBDA 2XY6A 3MM8A 1JKHB 1HNVB 2GJFA 2DVIA 2F4VF 2ACMA 2IRXA 3TWZA 4LVOP 4NX9A 3Q8PB 3THVA 2I9SA 2RD5C 3QATA 5H9FJ 1DTQB 1S7HA 9RUBA 1NPPA 5KAKA 4DG1B 4LRFA 4JV0A 1RWOB 2W9BA 1VI7A 4HH1A 1J5EF 1BGXT 1IKYA 1ZPVA 4N7TA 4RJVA 4A8QA 3PIPQ 1FESA 1JLCA 3EVWA 1C1BB 3S01A 1NJZA 4DCJB 2E29A 2GO9A 3K17A 4OI2A 5D4NA 2WVCA 4BC9A 4N5SA 2K8GA 4B9TA 1WC3A 4C8YA 5C24B 4CRJA 4LSLA 2LU1A 1Z1ZA 4NZ6A 1WSRA 4ZPWR 4NA1A 4YFUA 2B4PA 5ETRA 1WTBA 5CXTA 5D3GA 2XQCA 2VKZG 1JLEB 4HI2A 4JI8F 2MQPA 3WC2A 2UXBJ 3M2UB 1E6YB 4OZ1A 1Q86T 2IDEA 4IR9A 2RRBA 4ERDA 3OXLA 4RKUC 4I0WA 2GNKA 4F2SA 4U8YA 1RA7A 3IFEA 3CDEA 1FX4A 2CNOB 1FJGF 4ALZA 2E66A 4HDGA 5HN0A 1ZYQA 2DR8A 2RSQA 1RT7A 4B3OA 3MHYA 3M6XA 2FJWA 4GKJJ 5AE1A 2MKSA 5U47A 2B3TB 5E5NA 2PMHA 3JSMA 1DAXA 1QSLA 2UUCJ 3MCNA 3ZNJ1 2R8HA 2ZOMA 3HHLA 2BJ8A 4MKBA 4YN3B 5K9FA 1VISA 5GAEU 2ZH5A 4FBUA 2OO4A 1WF2A 4G1IA 4J9UE 4M1KA 2EFOA 3TZYA 4F25A 2DGOA 2BZ2A 2K1RA 1OYEA 3P49B 1OPZA 2DT9A 2IVMA 3DOMB 3CIZA 2J9DA 3OR2B 4ZPVR 3VALA 1AUDA 1KFSA 1V9OA 4PQUB 2X51A 1NH8A 1N52B 1IR0A 1T95A 1OSDA 1SQGA 2BE9B 2QL9B 3MI7X 2XI2A 5ITHA 2XCAA 3G6ES 1HHTP 5KOWA 3QSIA 4FP9A 1RWPB 3BGLA 4CM0A 4LF9J 3QGPA 3SIPB 3EWGA 3M6UA 1GXUA 1SC6A 3K7RA 1HI8A 1XR7A 4RUBA 3UCGA 1HWUA 2R8GA 6FDRA 5IM0B 2BR0A 1VMBA 4MKYA 4DWIA 4P73A 4QZVB 4CLFA 1K1QA 2NSCA 3T1YF 1J2VA 4F4XA 1RT7B 4B3OB 1U2RA 4N76A 2B9XA 2QG9B 1F1BB 1CG2A 1AUSL 3VHQA 4X4PA 3GIIA 3Q0AA 2CDQA 1OJ4A 1FRHA 2G13A 2HURA 1ZPWX 3IC1A 3PG9A 4CTAA 3VVUA 3BQ1A 2OH2A 1AROP 2AU0A 4JYAF 2NQPA 1U7LA 2KFNA 1UA1A 1BD6A 1SIWB 3OTEA 4ANEA 4AL7A 2QA4S 4HKQA 3AA8A 2XO6A 3AB4B 4V1Ak 1ZTTA 4OV6A 3CJ4A 3L7PA 4K4TA 2ALZA 1TKXA 1FHTA 2BM1A 4X4TA 1ZAVA 3M8YA 3GJRB 1A0OB 4GMKA 2R8KA 3DXBA 2RHQB 3MPVA 4I6AA 1NRKA 2M8HA 2VONA 5RUBA 1RU1A 2D9PA 4S0MA 3CT9A 4O3QA 4J9LA 1HNWF 2HQ3A 4QR1A 3CUNA 1RDRA 1SPBP 2QV6A 4P74A 4NYZA 1R43A 4ZVOB 4RX6A 4JI8J 2NCKL 3VAMA 4DV5F 3Q24A 2E1CA 2DR6A 4LIRA 4O4GA 5J2QA 1S77D 5JJBA 4B3MJ 4HR2A 1HWKA 1IKYB 2FYXA 2Q6BA 4J91A 4N56A 2FLPA 3NGSA 4L73A 2KT3A 2UVVA 4MTPA 3MTKA 1RT4B 4DR2F 4DG1A 1ZH5A 1OQ3A 2ZBRA 4FZVA 1S76D 3BGFA 2JEFA 1HNVA 3NNAA 3MM8B 4M5NA 2P9GA 2NUHA 4KHMA 4EU0A 3DOKB 4HH0A 4KFBB 2Z56B 2K7KA 4F3OA 1U47A 3WZ0A 1UZDA 1HBMB 1RCOB 3J80U 4IYQA 5CYQA 1NU4A 1PIEA 4FKYA 1NKBA 1YLXA 2A0FB 5F0UA 5KG7A 4K0KF 3R5GA 4QPTA 3L9ZA 2QYCA 4CZCA 4IFVB 1EKSA 2HBQB 4X62J 4X4OA 3H4BA 3BDPA 1QLNA 3DLEA 4J9NA 4PPDA 2W2NP 3NWRA 4XIUA 1YJ9S 5THWA 4Z7CA 5JVGQ 3OL6A 3DLBA 4B9MA 5J1EA 5ETMA 5KFFA 2DEIA 1LKZA 2FHJD 1F60B 3NCQA 1S57A 1TL1B 1VC5A 2HMIB 4FNIA 3IS9B 5IT0A 4CLPA 3HKWA 4ZP8A 4PRFA 2RU3A 4DV3J 4K50A 5D0HA 1S9FA 4GKKF 2ZD1A 3QQCD 5IOLA 3NCPA 3AFGA 4PKDB 2IYIA 3EGVA 1RISA 1AT1B 1SCJB 1N0VC 4F4YA 4MFBB 4RW8A 3BREA 2POKA 4DPOA 1EX8A 3WIUA 2UUAJ 1FA0A 1YTYA 1M1KT 5HMZA 4X2BA 3SBMA 2B4UA 4XPEA 5KFAA 1N36F 1KBRA 4I56A 2RRAA 5EX3A 2KM8C 1T03A 3ZTPA 1Q0NA 1UZHA 3FFIA 4GVBB 4ANDA 4RO0A 1XNQF 3H25A 3BKTA 3EPGA 4B3SJ 1XTZA 4R5PA 3CCMS 3BPDA 3G2XA 3H42A 4Q2MA 5KG0A 1XMBA 3V6HA 1RT5B 1HQ2A 3R5AA 2JRSA 2MQ8A 3OR1A 1HLWA 1X4HA 4USIA 1DRZA 1CBKA 3FBFA 3MAHA 4WP9A 2CXEA 1TELA 3OFFA 4P6QA 1IQZA 2IIHA 5GMKa 1S7IA 3KK1A 2MKHA 5HP1A 4CO0A 2QFIA 2CNKB 1UVNA 1M5PC 1VHFA 1B3TA 4RW6B 1J5OB 1XMQJ 3RRGA 5GAGU 3CMAS 1O6XA 2GFFA 1RLCL 1S5ZA 1ZA1B 2PA3A 2BJEA 3ILLA 1NK7A 1IWAA 4WFYA 2B43A 4NZ0A 4X4NA 3PKYA 1LFWA 3B78A 2I8EA 3V6DA 2XMWA 3DN9A 2LDIA 3M32A 2CJYB 3AQPA 4ZVRB 5I3QA 1UP1A 3PO5A 4UY8T 3UE2A 3Q2TC 4OQJA 1NSPA 1UEKA 1WC0A 2GAHC 3EJMA 3GIJA 1DLOA 3DHWC 2PE8A 3QYYA 3ZZYA 3TRGA 4OFZA 4B3MF 3R2CJ 1S79A 2XYHB 5K5MA 3CULA 2DO4A 5IS2A 3Q8UA 3IXQA 4M8LA 4X62F 4OZ5A 1HMVA 3H2VE 4C98A 4ECZA 2MLYA 2E9ZA 2IJFA 4JI7F 1RXOB 5BYRA 1SVDA 2J7WA 2L3MA 3MEGA 2VDHA 4W98A 4QWBA 4IOAQ 3M9NB 1VRTA 2WVEA 3LP1B 2MQOA 1O51A 2FY1A 3EXYA 3TAMB 5L9XA 5KFMA 1S6PB 3PFEA 1DBDA 1RT2A 3KK3A 2FZKB 1H2TZ 1L3VA 3IAM9 4ED7A 4CNYA 1NPKA 3G6XA 3H90A 3HT0A 4NRUA 4P2MA 2AYGA 3QRRA 1YWXA 1S6QA 2W9CA 4I67A 4K0KJ 3BF4A 2H1YA 3ENAA 2RU9A 4KH1B 4NCAA 3NMRA 2JC0A 2JLFA 2IJRA 4G1QB 4URSA 4Y6IA 4ZITA 1AYEA 1FWLA 4NRTA 1XC9A 1L5UA 2W24A 2DRBA 1OPIA 2MEWA 4PWDA 5L8RC 2IDLA 5F8MA 1M0SA 3J7YI 1FWKA 3KUHA 3PW5A 2ASDA 1RKJA 1TAUA 2R7VA 5T7LA 2RQMA 3O6QA 2P6SA 2G0IA 3I0RB 3Q86A 4WU2A 5B0AA 4UF4A 3PXGa 3MAQA 4DUYF 3KTQA 2RDIA 2IMWP 4LFAF 1HFEL 2M5YA 3R5CA 1K73T 4C8NA 3GU0A 1ZAXA 5D4LA 4K4ZA 4KJIA 2F40A 3WX8A 3M2RB 4TY8A 4K4WA 2AJQA 4NEYA 1S9GB 3CD0A 2RS8A 1CS4B 2BACA 4UOGA 3EVMA 4QQBA 4ECWA 3I4HX 3TI0A 4FXWA 3MEDA 4TKTA 3QO9B 2BVZA 2CQPA 2FLNA 2DO0A 3P6YC 3HJVA 1R31A 2XHWA 4J9MA 4U6PA 3WDOA 3HPOA 4OV1A 1D9FA 4LF4J 1R8PA 1VLYA 4K2JA 4A47A 4O0IA 2QC3A 1YBAA 2OIHA 2MJNA 2XWXA 4DCOB 4ETZA 5HO4A 2QYGA 4AL6A 2W01A 4PZVA 5KFIA 3CJ8A 1AXQA 3EX7B 3VWSA 3KJNB 2OFGX 4PXBA 6AT1B 3DRSB 2UV8G 2XM3A 4NXMJ 4DDFA 3LANA 3CW2C 1YRTA 2J0XA 3UN3A 2Y1JA 2B8PA 4JI6J 4WYLA 1SL2A 3H2LA 3IM9A 2AEMA 5SUHA 2RKIB 2DNMA 2M0GB 5HQMA 5IQ6A 1R0AA 2DNHA 1X4CA 2KB2A 3KLIB 1U02A 4DU8A 3IN5A 5F8JA 3ZFVA 3D2WA 2IRYA 3CJ0A 4J9QA 1WHVA 3D1OA 2FVSA 2XMJA 2E5IA 3RBDA 3ZZPA 3QJPA 3LO3A 2CPXA 4ILLA 1N32F 2VFUA 4DV6F 2HFNA 3GR1A 2K2PA 4OYBA 2VJUA 2IA6A 2O3DA 5LM7E 3TOQA 4A8XA 2EWHA 2P9CA 1F3FA 4P7TA 2D1CA 3G6VA 1U1PA 4NLRA 1JIHA 1X60A 4MIBA 4C8OA 1RTHA 3QT7A 2J76E 1MROB 4NE9C 3N6NA 2J0QD 2ZH4A 3PM9A 3FC9A 1TAQA 4TU9A 2XNQA 2I5JB 1MN9A 5DGAA 2OKQA 1SC3B 3ZZTA 1W26A 2AX0A 2BJ1A 3DLKB 4OYOA 5DGBA 1TK0A 2RQCA 1K0VA 5EWFA 2LDYA 2QMUB 3FCVA 4E8UA 3KLFB 2GMLA 2F4FA 4KE5A 1SJ3P 3J7A1 1GMWD 1QY7A 2JDJA 4QW8A 1IR2A 1O0PA 3QZ8A 1S9EA 2DPJA 2FTRA 1DQ9A 1H73A 4BCAA 3C16A 3D6MB 2MQMA 1M5VC 2O01C 4LRAA 3HSDA 1HARA 7FDRA 4DV0J 2LQ5A 4NLUA 5DQHA 3DKDA 2BANA 4DSIA 5I3UA 3ZTRA 4QIGA 2BRLA 1GMUA 3IWXA 3TZWA 5J2NB 2CUYA 2KXNB 5KFUA 5DQIA 2HVDA 3FBCA 3G71S 4WTOB 1N0UA 2W8KA 3RUBL 4I1TA 5KFGA 1TVRB 2B5JA 4P72A 4DUYJ 4ZKAA 3W62A 4MIWA 3O8WA 1N5SA 2V8PA 4O44B 3RBXA 4X65J 4DF8A 4QW9A 3BQ2A 3GYGA 2CJXB 3MAAA 4DXLA 5C7PA 4YY3J 1FNXH 3MR2A 3KLGA 2N4CA 2YNFB 1NJYA 4P71A 5CCMA 2LXIA 2VBYA 5GAHI 1F9FA 4DF4A 3ILIA 1JLQA 4PUOA 4URQU 2ZWOA 5KFZA 4ZDNA 3ICLA 3MPDA 3M8RA 1D8YA 1U0HA 2BKOA 1ZAWA 2L9NA 2YWGA 3HHEA 3OFGA 4R0JA 1NNDA 3MM7B 3NBPB 2V4JB 4I6YA 3NRBA 4CQ1A 3OLBA 2PN6A 1M1HA 2R9LA 2HAFA 3PDNA 3DDNA 5DJBA 2CWXA 4CWBA 4DR4J 1OS5A 2BXJA 2MZQA 4NWBA 2XZDB 3CB4A 5LMUF 3D7SB 1Z2ZA 2LEBA 4JUZA 1WG5A 5B08A 3PVXA 1DARA 4KGKA 2AGOA 4CLWA 2V4QA 1T8EA 4JI5J 1LWXA 4ICLB 3GCXP 4LSNA 1HIYA 3EDRB 3MMCB 5A0YB 3M1VB 3M30A 3CCQS 1HNZF 4DV4J 3ZO7A 3MOZA 4USTA 2M52A 3OT9A 1CLFA 3JQJA 1SL1A 2JVOA 4OHYA 1YQHA 4DUTA 2EG2A 3J81U 1QAIA 1G2EA 2Z58B 3OBIA 5E0OA 2RS2A 1HNXJ 4OX8A 3BO4A 5IC6B 4J9RA 2ALYB 3HP6A 4DCPB 4XAKA 4WFAQ 3TA2A 5CD4H 3LP0B 2HFSA 1S6OA 2LA6A 3W2VA 4DR5F 3MZIA 5J2PB 1HWJA 4N47A 1PBUA 4ECUA 4ED3A 2UXCJ 1NHVA 1P6TA 3KG0A 2BJ7A 2C2NA 4PYAA 1ELOA 4ZVHA 3TA1A 2IPOB 2DGUA 4CDIA 4TQSA 2LKZA 4F4AA 2ZH8A 4UY85 1BLUA 4GRSA 2MB0B 3D6HB 4QU6A 5H9EJ 3H5SA 2UVUA 1L3UA 1ZZFA 2N4DA 2W2MP 1Y5IB 3NOGA 2HHHJ 4OI4A 1QM9A 7AT1B 3KLHA 2YNHA 8AT1B 1ACMB 1WKLA 3DRRA 4LF6F 2KFZA 4R0EA 2IY5B 4P9SA 2HBZB 4FYWB 2FJDB 5J2PA 2CQGA 2YWFA 3CCSS 1DFDA 1SUQB 3ILJA 1RAIB 1TZ0A 2QSWA 5IT9Y 3SSSA 4J9KA 5E2QA 3QGGA 1KHVA 2C2MB 2KRRA 2XG8A 4RL1A 4PXDA 5HVHA 4ZVSB 1X0FA 3EDQB 1NK8A 2OELA 3BKFA 1HPZB 2HZCA 5FIIA 1QE1B 1PC5A 2NZCA 2FPHX 1WORA 4LFCF 4NA3A 3RBZA 2J6SA 4DV7F 5A0YA 3G9CA 5K8OA 4RNMA 1S97A 3QAEA 4JV5J 3HHLD 3WC0A 4F2RA 1YITS 2DY1A 5KOXA 3DLHA 2IA0A 1QTNB 2DITA 3ET6B 4WFZA 4ZLNA 1KEKA 2GHWA 1VCTA 3VQSA 4MK9A 5ETSA 1TFYA 1OMSA 2ILYA 3TX8A 1JLFB 2HVEA 1M5KC 4MIAA 1OY9A 2GIRA 3AHPA 3QLHB 3U1MA 3HHLC 4ES3A 5DG7A 5D4PA 5T41A 1C0UB 1D09B 2OP5A 2OEJA 4KGVB 1TL3B 3KLVA 5I42A 4C9DA 3GLJA 4ZHRA 4DX6A 3RR8A 1WTFA 3UCUP 4JI5F 1B99A 5K20B 1MWZA 4KYZA 5DETA 1U0HB 1QAJA 1TL7B 3N6LA 5D77A 4PQAA 2DGQA 4CM2A 1FJCA 1RAJA 4ZHRB 1JLQB 4DR2J 2Y8YA 1TL3A 2M3DA 4QR2A 3R7BB 4IG0A 4PQUA 3QLHA 3KLGB 3LP2A 2G2OA 1JLFA 2ZVIA 4DPYA 4TU7A 2HVIA 4AL5A 1HBOA 4WCEQ 4K7QA 2QLJB 3TARA 3D9BA 1S59A 3SEOA 2Y1LB 3MR3A 3G8SA 4IUFA 1TVRA 3TQ1A 2VL1A 3ENWA 4O3RA 4YR0A 2CJAA 2NXNA 3CCES 4W92B 1S1WB 3OHBA 1PAEX 4CYUA 4DL4A 3MR7A 4ECVA 5A8WB 2XSFA 4F26A 2B6AA 3CDBA 5ETOA 4CO3A 1EQMA 1D8ZA 1KQSR 1NBEB 1EETB 3M4XA 4DV4F 5IT9U 4DPWA 9ATCB 4YHHF 4CH1A 3LH2S 2YXLA 3AD9C 4A8SA 1M5OC 4NLPA 2JLGA 1PJ5A 1OIAA 4OZ0A 1PYSB 1WI6A 4C48A 4FYYB 2W7OA 4JI1F 2D41A 4WXWA 2H5IB 4M95A 1N5QA 4OJ1A 1S1XA 2DD8S 1X5OA 2MKYA 5D0RA 5E3PA 3TQEA 1S0NA 3D6TB 4FF4A 2ZVSA 4NLTA 3K89A 1IVZA 2KZZA 3HHDA 5CH7B 2ADCA 4FVCA 1H2VZ 3HSZA 1WOSA 3KK2B 2DISA 3UQSA 1U26A 1R6VA 2F1FA 3ONQA 4R25A 1UWAA 5HK4A 1TR0A 4Y28C 3FK4A 2GW8A 3BM7A 2OMOA 2ZH1A 2LCWA 3ZZZA 3UR0A 3BDEA 3NNCA 2C42A 4A48A 3EGZA 1SJRA 1VBKA 4B9UA 1NK4A 1IWGA 2HHHF 3W2VB 1G7CB 5AXLA 2A1BA 5KFQA 4ECTA 1ZETA 2BV3A 1RTDB 4JI2J 5LSLA 2B8QA 1PC4A 1U6FA 1FTCA 2MMYA 3M8QB 3ZZUA 4PEOA 4UZCA 3DFEA 1F3VA 3KJVA 1XNQJ 5EHHA 3HI9A 3GP9A 2IVFB 4B02A 1FDDA 4IOBA 4K5RA 3UDCA 3W5XA 5IZHA 2HYIB 4YOEA 4I2QA 3M30B 3M1VA 4I7FA 2BEFA 3BKUA 3MMCA 2XCPA 1CEZA 3PJ9A 3MR6A 5DLGA 2XTJP 4ICLA 1W25A 5HQLA 2RKIA 3TR5A 4WKYA 4AQYF 2AJ2A 2FGOA 1U0SA 4CLZA 2FHJA 2CQ0A 3BJYA 3AJDA 1JMTA 2VA3A 4NASA 3GJQB 2VA2A 1F5AA 2RVJA 5L1IA 3GWCA 4PXCA 2OFHX 3DRSA 2IBOA 5DDOC 1RWVB 2FJXA 2GQQA 1O8BA 1UFLA 1YJVA 3B4MA 3BGOP 3MM7A 1PJ7A 5KG3A 2QMWA 1JB0C 1R7IA 3MURP 3TVZA 2PFFB 1UW9A 2KL8A 3R5JB 4N8OA 4LQ3A 4U9RA 1PGZA 4PUOB 2OPRB 2L41A 2R42A 3QBCA 2AJ0A 3EGNA 1GX6A 1T02A 1UFWA 2JJ4D 3CMES 3MMJA 3H20A 3MECB 1Q81T 1XNRF 2R3VA 5CYMA 4RWXA 3QJJA 4ZA1A 4KAIA 3CPWR 2CQDA 3CCZA 3J81j 2RUSA 2EG1A 5EN1A 2D69A 1RTZA 2HHVA 4XTTA 3UDLA 2C2EA 2JNJA 3W61A 5DZ7A 3P4UB 1XR6A 4O3OA 4DR6J 3SV3A 2AD9A 5D0GA 1N5TA 2HQDA 3PFOA 5IV4A 2GA7A 2ABYA 5J2NA 2X3DA 2E1MC 2HNYB 3H5UA 1V6HA 2X1BA 3GCWP 4LT6A 3BBFA 1NHUA 3D28A 4JB8B 5D15A 5H9EK 4ILMA 4USJC 4P7VA 3HVRA 3C16B 2XYPB 4I2PB 4B3TJ 1F6TA 2KYZA 1WHWA 3B54A 1LNQA 1RBOB 2CPYA 3E3XA 3VZIA 2PI5A 1RACB 2HHPA 3JSBA 2A2CA 1Q5YA 3PRBA 4LBIA 3TNVA 1NMEB 2J7KA 4LR8A 4OYWA 3C46A 3KLFA 1LW2B 3NNHA 5T14A 1MWYA 1QUVA 3IRXA 4JI1J 2DB1A 4YDDB 4LF8F 2YQ1A 1UPPA 2CYYA 4BDPA 2QA2A 3QRQA 2KXHA 2AKWB 4TXSA 5KFTA 3KK3B 1KVJA 1TP7A 4WP8A 3CWJA 3OFHA 1S6PA 1WF0A 3X3UA 4RW7A 1F5BA 3TAMA 1MROA 2ROPA 2OPQB 2BUNA 1RTHB 3LP1A 3VAFA 1BWEA 2KHDA 1FWPA 3F41A 3VGUA 2MY7A 2NYIA 3SFUA 2PD1A 1P1LA 2ZBPA 3D0HE 1EIYB 3HVTB 1B0TA 2WVBA 1HMVB 4IRKA 3NP5A 1T9TA 2ZOFA 1Q1KA 3AD8C 1FDAA 3W66A 2NLWA 3IMQJ 4D3HA 2GVZA 5B0BA 1EAYC 1B7FA 4QIEA 1LWCB 3VAGA 1RT3B 1DLOB 1VIOA 3SSRA 5GADI 3UDVA 3UD5A 4PWDB 1C1CA 2V8GA 4ZP7A 3JTPA 2KH9A 1N33J 2ZM6F 3GIKA 2VV5A 3T5JA 3V6DB 1Q7LB 2VFRA 3NAIA 3IP0A 1UCNA 4IKAA 3VTIA 4OJ3A 1YJWS 2QT7A 3IA0A 1D9AA 1YSJA 2GIQA 2UUCF 2GC8A 2YKOA 3HD1A 1FRLA 4XPCA 4LF5F 2OLWA 1J5OA 2Q66A 3NAHA 1VBZA 1NSQA 3WQPA 2DGVA 2FC8A 1JJ4A 4MYTA 2UUBJ 2AJ1A 4RNHA 4KHPF 1VK3A 5KFLA 3HO1A 5HBMB 1Q7YT 2C2KB 4ZPDA 4Q45A 2YWKA 3MF5A 2APOA 3UWTA 1WC5A 3E01B 3MFHA 2E9TA 3TA0A 4F0HA 1N4LA 1JJ2R 4R5PB 1IBKJ 1OSCA 3KFWX 4B17A 2SXLA 3HVWA 2M4MA 3MEKA 5IV3A 1QVGR 3FGVA 3MEDB 4YQWA 2XSJB 5KFOA 4DV3F 3T5KA 3FFIB 4DV6J 4NI2A 3PO4A 5A8KB 1T03B 1C4CA 2FLLA 2LU2A 2EBEA 2HVHA 2C28A 3M2RA 4TY8B 3ZC4A 2DH8A 3JQMA 4DX8H 3PHTA 4Q8FA 1OY8A 1SKUB 2ACYA 3EMTA 1RTIB 1CQMA 1ZTWA 5GAEI 2MZ1A 3KMSA 3SQGB 2FJVA 1RQ0A 5F41A 4YB7A 3HFZB 4DQRA 3DRYA 1YJTA 4JOUA 4YR3A 2JZ5A 3PIOQ 4RU2A 5GVQA 3R5BA 1KRPA 2X1FA 1SI9A 2DRDA 3DNCA 2AEFA 2HHXA 1RE1B 1TMMA 3LALA 3IGVA 4LBHA 3TYTA 3JTNA 2DRAA 4IO1A 5KFCA 1IM4A 3FMBA 4DUZF 5CD4A 2HNZB 1WEYA 3WX4A 3DGPA 3CJ3A 1F2HA 2W2OP 2PMWA 2WW8A 3I6PA 4ZJQA 1H7XA 3TUPA 1S6QB 4ZPTR 3GG0A 4DR3J 3MM9A 3BZQA 4JI3J 3DLEB 2DNGA 1I1GA 2CPEA 4ZVFA 4DSKA 1YRXA 1RT2B 2OD6A 1U8WA 4Y2CA 2ZITA 2V8DA 5E3QA 4K2XA 1FJEB 4QCLA 4Y2KA 2JC1A 2EFNA 4EYIB 4KPYA 1NLKL 5CYQB 4OYAA 1N36J 1X5PA 2K7JA 4ZCKA 2BJDA 5ETKA 3W1YC 3C6TA 4IH5A 3M6WA 3G87A 3K8VA 4TLRA 4FF3A 2ATCB 1CULA 1S1VA 1R89A 1CC7A 3DOKA 1H2UX 1Y10A 2V68A 3LAKA 1WG4A 4KIAA 1UMJA 1G6BA 4ANCA 4DQIA 2H4YB 1VQSA 2WONB 3MM5A 2AWZA 2KRBA 4EBEA 3CO9A 5SZTA 2BYCA 3W64A 1KOHA 4DV1J 4IO9Q 3JS9A 2Q43A 2G2ZA 2DNKA 2WB1D 1VQPS 1H7WA 2WHOA 3T6BA 1FKPB 2HNDB 3AY0A 1XMQF 5E33A 3GR0A 1X31C 2LFVA 3CJ5A 3I5CA 2FZCB 4QYRA 1S1UB 5AXKA 4O4GB 4A46A 1J27A 5DG8A 3J80Y 5LJ3Y 4DSEA 2XC9A 1FRIA 1H0HB 4NL5A 3OXGA 1TKDA 3ZTOA 3K8WA 2V5HG 2QE5A 2Z4PA 4DL0C 4DOZA 4RW6A 3BN4A 2ZNZA 5DM6Q 4QWCA 4DR1F 1IJFB 1JXEA 4DR7J 1TKXB 2ZZTA 1VQ9S 3GV8B 3KDNA 1F0XA 1FEHA 1JLAA 2COLA 3W8PA 4C11B 4KPCA 4QBUA 3BSAA 2NUUG 5F9LA 2NXCA 3AJ1A 4QWDA 3I56S 2BKNA 1N34F 2DNOA 1H72C 2RAQA 2V50A 2ASLA 5H9FK 2EKYA 2WK4A 3O1LA 3KLEB 2UU9J 2OEMA 1NDPA 1RP5A 1QVFR 3OJSA 2MXYA 4WYWA 1VQ8S 4NA2A 1RI7A 4LFAJ 5IM0A 4LF7F 5D78A 1BHNA 3PRDA 2DNQA 2KVQE 3BB5A 3ZTSA 2KFYA 5LOQA 2RB7A 2W25A 4A8FA 2WSEC 3RG6A 4OZ2A 3DI6A 3TUJC 1VBXA 3PKMA 2ZD1B 5B0FA 2YPYA 1UVLA 2H4WB 4DPTA 4ZPAA 2H9ZA 3DLJA 4OX6A 1N5VA 2VPWB 5A2QY 2QLFB 4O4RA 2MZTA 4GO7X 3DOMA 3OR2A 4ZVQB 1JJHA 1K9MT 2D7SA 1B70B 1HNIA 2F3JA 3D67A 5E7OB 2HMIA 1MMNA 1SJQA 4GVLA 3PW4A 4KTQA 2QSFA 3BYPA 3OTOF 4O23A 2PC6A 2DR5A 3DLGA 1APSA 3FUYA 4OHZA 3SFGA 4CNZA 1VR6A 3VR1A 2GAGC 1T3NA 2H51B 5B7WA 1X0PA 3TJ9A 4YDXA 3CCRS 1SKRA 4J7CA 1X7VA 3KHLA 2Z2ZA 1LOUA 2QX0A 1NPRA 4ZP6A 1WEXA 3CDWA 2B4VA 3HSGA 4PG7A 4UQGA 3CVKA 1BE4A 2VB6A 2G1DA 3MCOA 2EW9A 1LK5A 3M8ZA 1RHQB 3MMBB 5ETQA 2KG0A 4C3MA 3BQ0A 1GT8A 3BGRB 3IBCB 2DNLA 3N6MA 2J8AA 3I5AA 2CNNB 4GKKJ 4KFBA 4DN0A 4V19X 3M2UA 1GTHA 3R9LA 3DXSX 5CZVA 4IQXA 1SJ1A 1GH8A 2AJFE 2XHCA 4ID5A 3QGIA 4OI3A 4JI0J 2WZ1A 2CJBA 1YZ7A 4DSJA 4L75A 2LMIA 2D3UA 2KI2A 3A3NB 4KSEB 1RT4A 4IG3B 4KO0A 4F3MA 4E0DA 1T94A 5G0RA 1U2FA 1FD2A 1ZOTA 2IAJA 5CQGA 3V81A 2Y0BB 3LQVA 1RWMB 4K4YA 4PPZA 1OQ6A 1JLCB 2MHNA 2VFVA 3H2UB 3V81B 3BH7B 3N5FA 2K3IA 1QSSA 1S4FA 4IG3A 4KO0B 1REGX 3NWGA 1P9QC 1X4BA 2M9KA 2HWTA 2VBZA 2E1RA 2L48A 4ID5B 1FKOB 5CA5A 4OYZA 1NAQA 2M88A 2J0SD 2WVDA 1FO1A 2BOPA 1N5YA 5L1LA 4AXIA 4F02A 4P10A 3ZZRA 3HHKA 4WZMA 1YKWA 3BSCA 3ZZOA 2Q79A 2DNYA 2DXDA 4IR1A 2GQ2A 1HBNB 3QIPB 4TNOA 4EZ9A 2GQCA 2RUGA 3I87A 4N41A 3OTBA 4DR7F 1CPZA 1JXVA 1VGYA 2EXUA 4NLYA 1CJKA 3FDSA 2KKHA 3RYLA 4RUAA 1X8DA 1H38A 4ZCIA 3PRVA 2O1PA 4ZIVA 2MLXA 2F63A 2NXUA 2RIJA 2VZ9A 2I1RA 1S49A 3DOLB 3OXFA 2XY5A 2WRMA 4FPRA 4C8MA 3EICA 4ECSA 1SQFA 4B9SA 1JWWA 3VAHA 4AYBD 3AQOA 1HYSA 1OO0B 2Y3YA 2YH0A 3TUIC 1REVB 2F7VA 4GO5X 2BX6A 4EK2A 1NK6A 3EVOA 2FVCA 2KZMA 4FF1A 4NPOA 3IAS9 3HM9A 4PG4A 1RSCA 3I9V9 1A9NB 5I3PA 1U6ZA 2UXDF 1RB0A 3BGUA 4DV2J 3HULA 4RNFA 5E3AA 4DFJA 1WC1A 1JLBB 4H4MA 4ED2A 1GTEA 1KLMB 4HACA 1PKUA 1PYOB 1T3OA 1XR5A 5KT3A 4L76A 2IBKA 2D9OA 4Y2IA 4USMA 2ZE2A 5J2MA 1NSAA 2QEXS 1S1TB 4C2MA 1U1NA 3KYLA 4NCGB 4K4SA 1B64A 3N5BA 4A4JA 5KFDA 2ERRA 1H3DA 2CVIA 3DC2A 3RBEA 2XZWA 1B7YB 3KLEA 3RB4A 5D6GA 3THPA 3AXMA 3NOCA 1RAGB 2BJ9A 2QZ8A 4EBCA 2VIHA 3MD3A 3S7RA 3NEKA 4NLGA 1IKWA 5BYQA 4DZ6A 2QLBB 3IRWP 3EZ5A 3DRPA 1KONA 1E6YA 3EUNA 1JLGA 2FIUA 2CPJA 2PO4A 5F9NA 3MR5A 2ASJA 2YX4A 1NB2A 4RLEA 2DHAA 3CJKB 2RF2B 1MG7A 1RLDA 4EFAC 4NMXA 2EI5A 1YVFA 3SZ2A 2MKCA 2UXBF 2DIUA 2HBRB 4KR0B 4LSLB 2B7CB 1IBCB 1V3SA 1SH2A 1CJVA 3CJ2A 3FZ2A 5C24A 3TVKA 1Y11A 3OSNA 4BHQA 2R7TA 4Q0BA 2Z30B 1Y00A 3C19A 4H4KC 4ZJOA 4C97A 5DG9A 4B9LA 4B3RF 3ETMA 4I68A 4NLQA 4QIFA 1C1BA 4KKOB 1S1UA 2FQQB 4CO4A 3OVSA 1FERA 2UXCF 3M8WA 2HNDA 1FKPA 3K5MA 1Y0HA 1KQFB 2CPIA 2LQ8A 4Y00A 1VC6A 3DLLQ 3R8YA 1DTQA 2B0GA 2VUGA 2LQBA 1KVKA 1XBWA 2VPXB 3NS5A 2U1AA 3PNIA 1XNRJ 3MM5B 4YB6A 3LWMA 1NK9A 4J37A 3RJMB 1HNZJ 3LTOA 3VF0B 2CADA 2UUTA 4KQZA 2J6UA 1KD1T 3GYXB 1S1VB 2AV5A 3KNGA 5D8HB 4B08A 2V0NA 3J7YU 1H98A 2C2DA 2IC3A 1TV6A 2CQ2A 1LWFB 3M2VA 4HTJA 4USKA 3KHHA 2HZAA 2IM3A 2VJVA 2ZWPA 3HF5A 2HFVA 3QPIA 1K44A 2CG8A 3R2DJ 3W9JA 4DZDA 2E7WA 1L3TA 2HS3A 4O3SA 1QSYA 2UXDJ 1G3OA 2Y1RI 2QJ3A 3MM9B 1TKZB 3KHGA 3RRHA 4JV2A 3K57A 2V67A 2MYFA 4J90A 5HMWA 2J9CA 3DGPB 2CAJA 1Q5VA 2FGCA 2HNZA 1WOPA 3T5LA 2E5LJ 4FYDA 2YKPA 5HLFA 4LFBJ 4XK8C 1KS2A 1MLAA 2CNLB 3HX9A 2Y0SD 4ELTA 4ETXA 3MCSA 1BQXA 4PABA 1UJ4A 4X64F 4NMLA 2ZC4A 3E8OA 2FY8A 3TW0A 4HEA9 5HMXA 3OVAA 2DHXA 3GMGA 4OYXA 1EB0A 3PJXA 4WE1A 3SQGA 2DGTA 3U1NA 2F4VJ 3T19A 5AT1B 3R5DA 1RTIA 2HS4A 2HGMA 2ZBQA 3QMQA 3WIVA 1HQEB 4ATNA 5EWGA 2MPUA 3MM6B 1WUUA 4M5LA 5FDLB 3IG1B 2KT5A 4ED4A 5HVGA 4DV2F 2C3OA 4NYPA 2E44A 1J5EJ 1B0PA 1RAHB 2FZGB 3ELHA 2I2YA 1FJGJ 5HSPA 4NI2B 3DHXA 3AB2B 3ZNUA 1DTTB 1NZ8A 3M8PB 1EP4A 4RW9B 1VDHA 5FJ4A 4KT0C 3LOUA 3CCUS 3E01A 2JEIA 4U67Q 3NY0A 2UV8A 3S1TA 2HWIA 2KG1A 1PYTA 5HBMA 3UD3P 4UUXA 3I0SB 3HSJA 4Q8EA 1C0TA 2MZRA 4F50A 1U25A 3QFHA 4P2SA 1UW4A 3OW2R 2OTLS 3PEHA 3CMQA 1Q79A 1SBRA 4USUA 3W60A 2VQEF 3V4IB 2EFPA 2AIRB 1VRQC 4Y2MA 2VBWA 3ETOA 3PCOB 4X4UA 1UVKA 4DQSA 1SL0A 2H65B 1DQAA 1FCAA 2C3UA 5LXYA 2B4OA 2CPDA 2PA8D 4BLGA 2JEJA 3PYDA 3S8SA 1C1CB 3FRZA 3NGDA 2QRRA 2V8HA 2WB4A 3A13A 4Q43A 4B3RJ 3NG8A 4DL2A 1UETA 1R6YA 1RT3A 3C6UA 3K5OA 3QT8A 3K5PA 1LWCA 3W65A 3KJFB 2GVZB 1U09A 1W7WA 1OWXA 5K8PA 1JQGA 3ENVA 4QYZK 3FNNA 2FVRA 3TUZC 1C2PA 2XMMA 1KC8T 1KVIA 3CCLS 1AFJA 2GX8A 3SCKE 3HVTA 1WACA 2W9AA 4JYAJ 1UKUA 4Z2XA 4DV0F 2XS5A 1NDLA 4ZCMA 4WFBQ 3IO1A 3L7OA 4FKXA 4UUWA 2HWHA 3MUTP 3LWLA 2QFJA 1WDDA 4PAAA 1Q78A 1NB7A 2XLKA 4MJKA 2RE1A 1NDCA 2Q6CA 4RW7B 5DDPC 4ER8A 5L46A 2VG6A 5CAAA 1U24A 3NMAA 2VDIA 1HI0P 3POTB 5L1JA 3C8YA 3IRXB 3C66A 3CDAA 1GXLA 1IKXA 2H5EA 1GAOA 3KUEA 4UW2A 5JMNA 3UVJA 1U6BA 1OYDA 1VS3A 2A2DA 2CVEA 4OMFG 5HL7Q 3JAMU 3BO3A 3P45B 2YH1A 1UVIA 1FRJA 2O5DA 2ZZMA 1D9DA 4RW4B 1GX5A 5CHCB 3W5YA 3QSYB 4IDKA 4I2PA 1SC4B 2HFOA 4ZVGA 4WK3A 4R8UA 3D1HA 3IG1A 5KG6A 3Q23A 1K47A 4OYPA 2JSXA 5ETNA 4I64A 5KFXA 1HW9A 4F3QA 4W4MA 2CQBA 2H5JB 2MKJA 4I4BA 1IQTA 2X1AA 3LAMA 4PWWA 4ID8A 4DR4F 3ULHA 2HRTA 2BQUA 2MTLA 2X1GA 1R27B 3LGHA 1QUPA 2IFXA 1M5HA 3V6JA 2CQCA 3W9IA 2VC0A 2ZUAA 2HQGA 3US5A 3CJTA 1KQGB 1LXJA 2PMZD 1HI1A 5F8NA 2HSEB 4EI2A 1FXRA 2Z2YB 4JI4F 1TKZA 2P2CB 3R7NB 1YDLA 2OPRA 2LXFA 3CEDA 1HR0F 1HW8A 1URNA 5M2UA 1KDNA 3GFZA 2CQHA 2KYXA 2DH9A 3H8YA 4HVZA 5KFWA 2W8LA 1UFKA 2V6AA 4ELUA 3FJ2A 2B9EA 1FK9B 4LVNP 3BS9A 3ISND 1NUEA 1JJCB 3FQKA 3G8TA 2YQ0A 2LYVA 2ZHAA 4DFMA 3D1QA 4N8NA 1LWFA 3LGNA 3MPUB 1CJUA 1JXLA 2A6MA 1X4GA 4G6VB 1N32J 2AEJA 4CP5A 4WZQA 4G3IA 3OPKA 3GJTB 3DMJA 2NPFA 2BA9A 3G4SS 2NREA 3PTWA 3H40A 1RT6A 1YIJS 4RZRA 3AD7C 1KTVA 4DLEA 1VQLS 3C2PA 2NPIA 1SH3A 3PX0A 2IJNA 2DYAA 3I5BA 2KHCA 2RNEA 3QZ7A 1T9WA 2ZH6A 4DS5A 4F4KA 3UO0A 4I2QB 2J9DE 4HL9A 2PFDA 1O5JA 1Q8IA 2QA1A 4I7FB 4KGZB 5AJ3J 1X9MA 1V5VA 2RQ4A 5ETVA 3SSQA 1NHKL 1R0CB 3K2YA 3MGJA 4E2FB 5L38A 4E98A 1R8AA 4KKOA 4QIVA 2OPSB 1ICEB 3KJVB 1YBTA 3T9NA 3H4DA 3W2WB 1YJNS 3M8QA 2RQKA 5M2PA 1WF1A 1RTDA 4Q0BB 2H54B 4MKAA 4NLDA 4Y3CA 2L08A 1FVQA 2AHOB 5A6WA 4O3NA 4DU7A 4OX9J 1IJEB 3IBFB 5M2RA 3AOAA 1X9SA 1UTAA 1P9YA 2G1HA 2HGLA 1Y3JA 1RUSA 2MDAA 1MU2A 2RF2A 3H7HB 3HFKA 3HVAA 4KV8A 3FSYA 5DLFA 5B0CA 4OHWA 4HT5A 4DS4A 3PX4A 1YI2S 4FF2A 4GC7A 3DRPB 1S12A 3KK2A 1VFJA 2E5HA 3UR3C 2XO7A 3IWLA 2R2UA 1IKWB 1JK9B 2AYBA 2HHTA 1LW0A 1WDTA 1X5SA 2BW2A 3P5TL 2N3OA 1TFWA 1R3NA 2G0CA 3NXZA 2NYHA 4TYAA 5A6PA 2XYGB 5KFPA 4JP8A 4A8KA 2Z0GA 3HCXA 2BDPA 4OL8A 1U1QA 3DYAA 1WELA 2AJ4A 3SDEA 4ECYA 2ZM6J 2VG5A 4EEYA 4B3SF 3Q22A 1RWUA 1V5IB 4H4OA 2R2RA 1T11A 4NXNF 1S1TA 3N0VA 3CD7A 4OI1A 5J2MB 1CQNA 2ZE2B 4JV1A 2FJBB 4V19J 4CO2A 2E5GA 2JH3A 3D6FB 3UI3A 3FEXB 1F9HA 2CIMA 2DY9A 4HACB 2ROEA 4HHUA 1G4CA 2XGPA 1ITPA 1SV5A 1T9VA 4CYUB 1R8CA 2CPFA 2EFQA 3MEEA 3D4JA 1S1WA 1I94J 4UZBA 1K1SA 3IR6B 4K8RA 7FD1A 2V9WA 4X4RA 2J5AA 4BC7A 3JB9k 2GMJA 2JEGA 1YRUA 4LRDA 5H1SV 3OTDA 1REVA 1CJTA 3LUYA 3NGTA 3EYZA 2KJVA 1HYSB 2VBXA 3RTVA 3P8BB 1BQNB 5KFNA 2V2ZA 3B8HA 2J9EA 3DM2B 3ITHA 5C2GA 2V8VA 4IG0B 5L9NA 2HRYA 3OQ2A 4ZLPA 4C0OC 3DOLA 4QWEA 3OFEA 3MUMP 1FDBA 1RAEB 3TP2A 4O0NA 1TL7A 1CJKB 2Z57B 3Q8YA 2UUBF 1RHUB 3QIDA 2GMHA 4LMZA 1HBNA 3QIPA 1FT8A 3D3BJ 2LLZA 1U1RA 1KTQA 3GZ7A 4ITSA 1U1LA 2DJWA 1HNXF 2W2PP 5KT2A 1FKAF 2G9OA 1Y7PA 1VQ6S 3Q8VA 1X4AA 2CQ4A 4WXOA 2RH3A 5L39A 2C22A 1N5YB 3CJSA 2ZH9A 2PEBA 2CPHA 3ET6A 1FFSB 1M5SA 3U27A 5BR8F 1FKOA 1NCLA 2XMKA 3W7BA 1ZZNA 4MMOA 2XMVA 1RT1A 2R2TA 1S48A 2H3EB 2CPZA 4FDFA 5KTQA 3CTRA 3RZAA 2Q1LA 1RYSA 1HBUA 4PXEA 1A7GE 2BOAA 2VQFF 4ECQA 2KT2A 1TK5A 2ZKUA 3H5XA 4U96A 4DSLA 3C15A 1RABB 3N28A 3TZXA 5LMNF 1Q82T 3MPYA 2WAQD 2BQ3A 5HANA 1VJWA 5MLCV 1KLNA 2EKNA 2IAJB 3CD6S 5G0RB 2E9RX 1SUQA 4KC5A 2XMUA 2PDAA 5I4MA 5F8IA 1AFIA 2MSSA 3NCRA 5B09A 1I3OB 5J1PA 3HDSA 4ES2A 4IQMA 2VOPA 5EUHA 3UCZP 2PGCA 3NGKA 3KLHB 1NKEA 3IGNA 2P5VA 4TLQA 1LQ9A 2PSZA 1K8AT 1YBUA 2N3LA 2E7XA 4HHJA 3BGRA 1IBLJ 4LF9F 4EZ6A 1FJ7A 1RA6A 3B4DA 4MKVA 5EGYA 4CO1A 1CVJA 1HQUA 1RU2A 3MMBA 1BXNA 2FLOA 2ILZA 4YMEA 2KU7A 4RUHA 4DV7J 4JBCA 2FC9A 5KFSA 2DHGA 1NJIT 3SCJE 4JV5F 3NS6A 3BN7A 3PW0A 4FNHA 3BV8A 2BE2B 4Q5VA 2HS0A 3MDFA 5DDRC 3DLGB 3L4BC 3Q8QB 3CF5Q 2FVQA 5IWAJ 3G82A 4LF4F 1EQ0A 3KOAA 1WHXA 1RBAA 2ZC3A 5D4OA 4ED8A 4C8LA 2VG7B 1HNIB 5LXRA 2VC1A 3C14A 3MMAB 3TO8A 4NXNJ 3O44A 2WBRA 4C7QA 4DL5A 3G8QA 2C2OB 2IMOA 3FQLA 2MQLA 5J1NA 3PJWA 3U02A 3CDUA 1WNEA 5HQ8A 1HL6A 2B9WA 4RR5A 3DI6B 2JVRA 1DQ8A 2YKNA 3FBEA 3DRXA 3GTYX 2E7VA 4X84A 3VGSA 1N34J 3GFYA 4LSZB 2MGZB 2RHSB 5KG1A 1RAOA 3JYTB 1URRA 4UOCA 2UU9F 4XO0A 2YKMB 1S0VA 3JTOA 5C25B 2NZ4A 1VQ7S 3KMQA 2IM0A 5KG5A 2V4JA 3NGRA 5BR8J 1UJ6A 3CJRA 3X1LB 2N82B 4LF7J 2W4CA 1VIXA 1NSKL 2FD2A 2FJAB 2YVSA 4HI1A 1T05B 3RB6A 1I6JA 4OI0A 5LL6d 4ZS6A 4OZ3A 3H5YA 2HG4A 4HLBA 3ZTQA 3W8GA 5CYJA 1KFDA 2G2YA 1JLAB 1WEZA 1RTJA 2E1PA 4QR0A 4C11A 4URGA 1FVSA 5AXNA 3MAAB 1SXLA 2O67A 2YNIB 1R0BG 1XWLA 4EUVA 2WW4A 1CSJA 1FFWB 3U7JA 4ZLLA 2ZJPQ 4USWA 3J81Y 4PG8A 3QAUA 1LK7A 5F0WA 4OLPA 2B5JB 2ZUGA 2GGPA 2OUGA 1KN6A 3RRKA 4OHVA 4YS2A 4CO5A 3OTOJ 4DQPA 4CLYA 5KFJA 3CNQP 4X65F 3VZHA 5HAOA 2R7WA 2QL7B 1EKRA 1RBLA 4CLUA 3BEGB 1LFPA 2IRUA 4RPFA 1U48A 2BANB 3RW6A 5JXSA 3R97A 1BQMA 2AT1B 2BMBA 3M7VA 1SH0A 1LWEA 1KSPA 4OJGA 2OMLA 3G96A 2F65A 3R7SB 2MKIA 2GCFA 2NXJA 1U45A 1S10A 1S9EB 3AT1B 1ULRA 5LSOA 2WONA 4NYOA 1TK8A 2ZZNA 2KVIA 2NR0A 4L3NA 2VPZB 4P2XA 4DMZA 4EGLA 1CULB 1WI8A 4QWAA 3AODA 4WKRA 2QO3A 5HI7A 3GJSB 3C6TB 1TUWA 4X64J 2AYMA 1WKKA 3ISNC 1UA0A 2DHHA 2GVDA 1GQEA 2B9YA 2WSFC 2I5JA 1WC4A 1QJHA 1UWBB 1L3SA 2HIQA 1MMDA 5K14B 4WBFA 4CT8A 3H59A 1SB6A 4PG5A 4U95A 1TL4A 1XMOF 2HZVA 3UN2A 2OPPB 3PV8A 3KUGA 2AZ1A 2VU5A 3SMZA 4K4VA 3QRPA 1TKTB 2AZ3A 2BABA 2EFGA 4USVA 1GFWB 4DR3F 3OUYA 5C42A 2HHWA 2HHSA 4X66J 3I82A 2LQ9A 3QT5A 1F2GA 3PYEA 2Y9HA 4WPAA 1NK0A 4HT7A 3EZOA 4I69A 2EVZA 5IWAF 4L3KA 4LF1A 1UJ5A 3PW7A 5BXIA 2QLWA 1IR1A 4ZK7M 5CCLA 4NLVA 5D0EA 4ED6A 1R8BA 2FHOB 2W7PA 5LMUJ 3L7UA 1RHRB 4YB1P 1N6QB 1R0AB 3KG4A 3RGIA 3PX6A 4MK7A 2JX2A 4P75A 1SKWA 3M05A 2CA9A 1AW0A 1FNOA 1UPMB 4WU3A 1TQLA 4TN2A 2GS8A 1B0VA 3DU5A 4IFYA 3D0GE 3UNYA 4QPXA 3HMJG 4Y0FA 1S72S 2D3OR 2Z8QA 1T9XA 2CZVC 2RILA 3N01A 1JX4A 2F8EX 2UVWA 3R1HA 1FEEA 1WJ9A 2NS1B 5A8KA 2EC2A 5C2CA 1IKVA 1WWHA 2XSJA 3CSKA 2C2ZB 2VD3A 4F0KA 2ZNYA 5BJRA 4U7UD 2BW7A 5B0GA 4WWSA 1ZBTA 5IQQA 2XLIA 4DLGA 1Q16B 3PY8A 1TMJA 4M94A 3EM1A 2JWNA 3VVTA 1IN0A 3A8JA 8ATCB 1M90T 3JSYA 3I55S 4OHXA 3AA9A 4PCQA 1AA1B 4PR6A 5A76A 4U7CA 3UD4P 2XY7A 4ELVA 1CS4A 1RKIA 2DGWA 2MKKA 2GJIA 4DSFA 1G1XA 5DO2A 4F67A 1SC1B 2A18A 2C3PA 1XK8A 2RRNA 3B82A 3I31A 3OLAA 4CT9A 2MHEA 3OL7A 1AZSB 3CJQA 4ES1A 5GAHU 3EZUA 4F8RA 2EFVA 1XIQA 4RBUA 3CCVS 1U1KA 1VQNS 4OZJA 3P96A 2OD4A 5IXUA 4RNNA 3RB0A 3OSPA 4AFFA 2CKWA 2BQRA 1VHIA 4K4XA 1N6QA 3LPYA 1NM2A 3PYFA 1I5OB 2DNRA 4ZPCA 3ZZ0A 3R6LB 4DPXA 1T9UA 1RADB 5BYSA 2OJ3A 1JNZB 3HK2A 3GIMA 2HRUA 1R8HA 3TX0A 1YJUA 4G1QA 2L9WA 4OX7A 3IR7B 3UNGC 4CI0B 5DS7A 3CC2S 1UEUA 3HT3A 5C42B 1RJJA 2HBYB 1QTMA 2P9EA 4MYUA 4DV1F 5F8HA 2R7QA 3GV7B 3NL0A 1F9EB 3O5TB 2XS2A 3KJQB 2V63A 5KFVA 4XDCA 4ZN3A 2B51A 1KQKA 2KTQA 1HWIA 2RMLA 2YY3A 2JOQA 2OPQA 2MLZA 4USHA 5K14A 1W2BR 4J9SA 1YZ6A 3S6EA 1UWBA 4NOHA 1VRTB 4ZOSA 5JVHQ 2I6WA 3EE3A 2CZ4A 5EX0A 2GVDB 1HHSA 4NCBA 2DR9A 2W7AA 2DKOB 2X3GA 2OI2A 4LRCA 4TYBA 3O3LA 4NEZA 1LW2A 3BSNA 1X5TA 5E3RA 3UDEA 1XMOJ 2VODA 4XDDA 4FPIA 3RAQA 4UQTA 1QD1A 3MFIA 5EDWA 2OEKA 3CC7S 1ZA2B 4KHPJ 4JI7J 1FDNA 1LWEB 4ZJLA 2J0WA 1RK8A 4NZ7A 5F3TA 4FS2A 4CCHA 2B7BB 2JFDA 1IUJA 2QTWA 3FCHA 1Y9OA 3P5BP 3FEYB 2HNYA 2WCXA 2YPZA 4M5KA 2ZJRQ 4GKJF 1FRMA 1Q53A 1XQIA 3PYGA 4H54A 4K59A 4AUKA 2DHSA 6FD1A 4RU9A 1UVJA 2JHEA 2BKPA 1IBKF 1AZSA 1TUGB 2BM0A 4EO8A 2M7SA 2LEAA 2Z2LA 3AXKA 2V4RA 4CLTA 1VLOA 3LPEA 3Q8SB 4OIXA 2R8IA 2UVRA 2FJEB 3W5ZA 1MWQA 1U8SA 1UEVA 2FUG9 3DCAA 4KHRA 4OLOA 1HNWJ 3KK1B 4C8ZA 1Q4RA 3FKBA 5CYMB 2EK6A 1VC0A 3MECA 1H6KX 3TEHB 3W63A 2QLXA 3PR5B 2CZ9A 1RAAB 4K5SA 3A1YG 1HD1A 1FX2A 1RTJB 4ZIWA 3Q89A 1WKJA 1YG0A 5GMEA 1YHQS 2K06A 3BSOA 4HDHA 2CJKA 3NS7B 2E5LF 2JFKA 4HTIA 4QJVA 5K8MA 3I9ZA 2V34A 1GMWA 4WTYA 3CC4S 1IKVB 1DHMA 2FHKA 3QFWA 4TU8A 1RHKB 3T5HA 1ZS6A 3J7ZT 2XS7A 1NXIA 4DL6A 4ZVUB 4M5GA 2YQ3A 2YKMA 3PR4A 3FSIA 1SQEA 4IFYB 2DBBA 1FE0A 2W4DA 1X4EA 3D66A 2ZHBA 2AQ4A 1F5CA 1RZMA 3KG1A 4C6AA 4DX7A 1FE4A 3GONA 2UUWA 3NGUA 2QIFA 4ED5A 2VPYB 4JI2F 2IHR1 1Z4UA 1SJ4P 1N8RT 3JXOA 2GO8A 2XBPA 1TL1A 2VG7A 5DRKA 3OUYB 2ZDOA 3IR5B 4ILRA 1QDUB 1S0OA 4MH8A 4ENOA 3FZBA 3LF0A 4RBTA 2CDRB 5FLXU 1FD8A 1TKTA 1LXNA 3HKZD 3KKFA 5KT4A 4DV5J 3TZZA 5KFKA 3SV4A 2DNZA 2OPPA 2A3JA 3NLCA 3H0PA 4MK8A 3Q8RB 3SYZA 1U4BA 3GSDA 1EARA 5DDQC 4ZMMA 3T9ZA 2RT3A 1VQ4S 2HEKA 4JI6F 4A8YA 1YGYA 2R7OA 1HQUB 1M1GA 2WVFA 2F9JA 4U7UK 3M8SA 3SCLE 5KFRA 4DJBA 2DTJA 4EO6A 2FVPA 1NKCA 2VOOA 3VGTA 3VQTA 2YX1A 1VQKS 1FRKA 4P2FA 4LF8J 3CCTA 1S1XB 5HMYA 2F8HA 2RJZA 4F0MA 3G86A 4BWJA 3A8IA 1VQ5S 2XULA 3I32A 3D54A 4WF9Q 4X4VA 2B56A 4CLSA 2C2RA 2NXEA 1WD6A 1EHWA 4TQRA 5KFHA 1NH7A 1VQMS 3RR7A 1BQMB 2DIVA 1TUVA 3HZEA 5E41A 1EETA 1GK8A 2HLTA 4IH6A 4L74A 1BUXA 2FHMA 5AE2A 2B6AB 2F8MA 5A8WA 1GEHA 5J2QB 1ZM4A 2R4FA 1P8GA 5AXMA 2HLUA 2LECA 2UUAF 3A4TA 1Z2LA 3A12A 4C3KA 1L3KA 4DQQA 1TU0B 4QIWD 2LQJA 2GGPB 3N4WA 4CLLA 4LF6J 1KOOA 3UW1A 3GE9A 4KB7A 3OTCA 1RT1B 1NK5A 2R8JA 2VFSA 4IRCA 3AOBA 2YNIA 1HBOB 2XZTB 2DGSA 3DU6A 4DEZA 3TEGA 4IOCQ 2W4PA 4QU7A 2E5JA 3LP2B 4MT1A 2HK2A 1VQYA 2ZBCA 3IM8A 5CABA 4K4UA 2HQFA 4QOTA 1MN7A 2IYGA 2W1BA 3GSIA 2NSBA 4TY9A 3DDKA 4WFNQ 1T05A 3SQOP 4CTAB 3M9MB 2V9KA 3PZPA 1H74A 3BR8A 4Z37A 4IH7A 1KP6A 4LQ9A 3LA0A 4FYVB 3EXCX 4WFXA 4PG6A 2V94A 5C25A 3HXMA 2ZKTA 4G65A 5I42B 3TANA 1C0UA 4ZVTB 3TVYA 3JYTA 2MJUA 5FD1A 4ZCLA 4FN5A 2G4BA 4J5OA 2MGZA 1N33F 1BQNA 2OSRA 2YKNB 4Q2LA 4B9VA 3QJLA 1NJWA 3MWBA 1CJTB 1D0EA 1DJ0A 1XN9A 2EC0A 4NLXA 4YEAA 3OVBA 4YY3F 3J7Z5 3NKYA 2GJ2A 4Q7AA 2XMAA 1NEEA 3GILA 5GAGI 1WSVA 2V2VA 2DXFA 2K3KA 3MCMA 3VGVA 4LF5J 3CXCR 2XB2D 3C14B 3MMAA 1QE1A 2K1RB 3V2UC 4F4WA 1HPZA 3RAMA 2HKEA 1FXDA 2AX1A 2P6TA 4BS2A 4CIOA 3G82B 1X4DA 5HJXA 3HHLB 4X4SA 2HQIA 4LREA 4F4ZA 2BE2A 3BBBA 3JSMB 1RHMB 1KNZA 2VG5B 3FSXA 5DZ6A 3SDEB 4F36A 3DYAB 5KT6A 2OAUA 3DRRB 2DNNA 3D3CJ 2YNHB 2AW0A 4GC6A 1D1UA 2D3ZA 1ZM2A 2ZBIA 1T7PA 4AE5A 4D3GA 2IM1A 5A2QU 3PW2A 1JLEA 2JL9A 4KV8B 4CLKA 5AJ3F 5D3GB 1WOOA 5C5JA 3P3DA 2HPUA 2KN4A 4BWMA 1FTRA 1JNRB 3AJ2A 5FLXY 1MW7A 3F0NA 4DL3A 2CRLA 3TJAA 2VICA 3VV2B 3LP0A 3V6KA 4Y65A 2MQNA 2AGPA 2QN6B 3RU0A 3W2WA 5F8LA 2KM8B 3T1YJ 2KDOA 4DPUA 2Z2MA 3C15B 4DHVA 1MNEA 2CJQA 3ENQA 3F73A 2Y8WA 1EZZB 2HIYA 2BBEA 3R6GB 2W9BB 2XNRA 4MAKA 1HBUB 2DPIA 1K0TA 3HZGA 2IVYA 2AF6A 3L3CA 2RDJA 3CE8A 4PWUA 4LSNB 3F56A 3QNWB 4HYKA 4Y2AA 1JKHA 4KGXB 2CQIA 1FFGB 2CFXA 2G0JA 3JAMY 2XMTA 1RT6B 2BRKA 3G6YA 1VBYA 1NDKA 4FXDA 2GV1A 3I4PA 5A8RB 1Q95G 1Q8KA 2E1AA 3B6BA 3Q83A 2GIFA 3AOCA 3K5LA 4J9OA 2ATLA 1CJUB 3AAWB 3KDOA 3M6VA 3R3TA 4OJHA 3OV7A 3GV5B 3K59A 5HROA 4FVMA 3H98A 4M5DB 3NBPA 5LSRA 1V3RA 1FK9A 4OX9F 1T9YA 2MZJA 3A8KA 3SXLA 1SJFA 4ZLJA 1BWVA 2AMCB 3K58A 2LA4A 1VK8A 3THTA 4FBTA 3HHNB 3M9OB 3PEJA 2ZEJA 2WTFA 4LFCJ 2HFUA 2YNFA 4YR2A 3K0JA 3DM2A 3ITHB 2HW3A 1RGVA 4DI6A 3GG1A 2WOMB 1A6LA 3VAIA 4DX5A 1PAUB 1XERA 3T3FA 3V4MA 2J8SA 1PO6A 4O44A 4UT4A 4DN9A 4KY3A 1TTHB 4FYXB 4G1PA 4WP3A 5K8NA 3W3SA 5KG2A 2HGNA 1HKAA 1PBAA 1VJQA 2ROGA 5ETLA 4KBIA 3SCIE 5IFMA 5DQGA 3HJFA 3MEEB 1GNKA 1SV5B 3KNAA 4KGMA 4DR1J 2GHVC 4ZPBA 3BO2A 3T1AA 2KJWA 5I3UB 1UL3A 3AH6A 4C0HA 2VQEJ 4ECRA 1U1OA 5G4DA 1I94F 4H4OB 2J7UA 3QWUA 1U1MA 4R8UB 4UOHA 2QA4G 1OY6A 3FEZA 4FXVA 4Y34A 2C1EB 1N56A 2PI4A 1PCAA 3DDIA 1RWXB 4B9NA 4O3PA 4NLOA 1IBMJ 1UVMA 5ETTA 4EYHB 2DEJA 3UVJB 1LW0B 2XGQA 1N48A 1EJ7L 2PEHA 4LBPA 4PYDA 2C3MA 2KO1A 2YTCA 2BE7D 5B0EA 1KHWA 2ZOGA 3E51A 4HHHA 4RNOA 3DLKA 1N88A 4M5MA 4OI6A 2I0XA 2R2SA 3BR9A 4J9PA 1MU2B 2VKRA 1HA1A 3MPWA 3BBCA 4RUCA
chains in the Genus database with same CATH topology
1DURA 4B3TF 2V2KA 3V5RA 2ADBA 1NZAA 1VRUB 1NO8A 4LIWA 4A8WA 4DFKA 5F3ZA 2C3YA 3T1HF 1YJRA 2OPSA 2J6TA 3T6JA 1Q8LA 2HFZA 3LGMA 3N79A 3O2IA 2Y1IA 1C4AA 4ZP9A 1UAWA 2WBMA 3D5MA 3R27A 4BBYA 4L72B 2ZHOA 1X4FA 4N77A 2KXFA 3KLIA 1FXLA 3MXHP 4WJBA 2M8DB 5KFBA 3VAKA 3DMJB 2YX7A 4YUDA 1GXTA 1HWLA 2R7RA 3QWPA 2EPIA 1PSDA 3K5NA 2MQQA 1E6VA 3LW5C 4Q44A 1C0TB 2ZH2A 4EWTA 2GHPA 2YNGB 2YWHA 2ZH3A 4JI0F 5F8GA 2ZDPA 1VOMA 3GB0A 5MAOA 1NJXA 5ADZA 1KR4A 2I38A 2DH7A 2CQ1A 1FF2A 2AP6A 3QO9A 2CG4A 3M8PA 1Y5NB 3L09A 4RW9A 1IBLF 2DK2A 1QAJA 2R7XA 3EGWB 4CH7A 1W2IA 1S0MA 4DBQA 3RW7A 1HD0A 1S9GA 2M2BA 4A8OA 4NLWA 2HAIA 3MM6A 3OL9A 2UZAA 3FRYA 1HQEA 4YP3A 1ZM9A 2VFTA 1IBMF 2LVWA 3PACA 2VASA 4OZNA 3U1LA 1FNMA 3CD5A 3CGIA 3I0RA 4M63A 4ED0A 4LUBA 5T7LB 3WBZA 3OL8A 2O66A 3IWNC 5L1KA 2XI3A 3R1LA 2R7UA 2JLEA 2DR7A 2QMXA 1S6UA 4IDKB 4OZLA 5HLFB 1IXKA 4C8LA 4RW4A 2F9DA 4A8MP 1X9WA 1WG1A 2PT0A 2HHUA 4X4QA 2W9CB 2HHQA 1IKXB 1MSWD 1WHYA 3POTA 4DR6F 2FB0A 4DFPA 5E3CA 2Q3PA 4NLSA 2YNGA 4IRDA 2VG6B 1E6VB 4AXJA 3CCJS 2DGXA 2ZH7A 3M2VB 1Y3KA 3MEGB 2IM2A 5EWEA 2CJ9A 2YKAA 1CC8A 4I6WA 3CIMA 4WK1A 5LJ5Y 3FMWA 5B0DA 4JI3F 3GQCA 1ZM3A 3C6UB 4ED1A 4ZVEA 2MY8A 3GFHA 1RYRA 2VH7A 4RWWA 5KFEA 2AGQA 3JSRA 3QGHA 5IT4A 4QYZJ 1MMLA 3M32B 3VCDA 4W90B 2A10A 1VQOS 1P1TA 2ASYA 3MTJA 3F44A 2N7YA 2XLJA 3A8EA 3N9UC 3KHRA 2XEXA 1BY9A 1Q8BA 3V4IA 1VRUA 2L9DA 1Y5LB 2EBGA 2DNPA 5KT5A 4C8KA 4ECXA 4NXMF 5KT7A 3GYNA 3HLUA 1XEZA 3CJKA 4C0BA 5HP1B 3TAQA 4RBVA 4FS1A 2MZSA 3I0SA 3L95X 1JLGB 5KG4A 2ZFHA 3OR1B 2MSTA 2N7CA 4X66F 1RT5A 3I96A 4WIIA 2DCLA 3SI8A 5CZXA 1EP4B 1DTTA 5KFYA 2AYEA 2LXUA 4L6V3 2PIIA 1QAXA 4NCGA 2R7SA 1U49A 5FDLA 3FVYA 3RAXA 3RB3A 4DL7A 1TL5A 5GADU 2XWYA 4MFBA 4RW8B 5AE3A 3OHAA 2LEPA 3Q2SC 1KLMA 4H4KA 4WE1B 1JLBA 1S99A 2EK1A 4H4MB 2ZJQQ 2M70A 5LT5A 5DM7Q 5JUMA 1N54B 2YWEA 3PHEA 1FRXA 3E2EA 3CCWA 3MD1A 3UPFA 2DCUB 4LJMA 4C4WA 2OSQA 1ROFA 1SIZA 2U2FA 3VAJA 3IS9A 2YKQA 2OTJS 1DZ5A 3D0IE 3MUVP 2WOMA 2UP1A 5J1EB 1QAYA 2WSCC 1P27B 3EPIA 1LV5A 1SKSA 4KRWA 3IBWA 4IFVA 1D3WA 3C3LA 3GFXA 3OJUA 1PILA 3KWMA 2FDNA 4M5DA 3UFCX 2CQ3A 4LFBF 2D74B 2HVZA 5HROB 1HBMA 4CH0S 1TV6B 4YB5A 2IC3B 3ISZA 4C3LA 1V3ZA 5A8RA 1Y4ZB 4EBDA 2XY6A 3MM8A 1JKHB 1HNVB 2DVIA 2F4VF 2IRXA 4LVOP 4NX9A 3Q8PB 3THVA 2I9SA 2RD5C 5H9FJ 1DTQB 1S7HA 5KAKA 4DG1B 4JV0A 2W9BA 1VI7A 4HH1A 1J5EF 1BGXT 1IKYA 1ZPVA 4A8QA 3PIPQ 1FESA 1JLCA 1C1BB 3S01A 1NJZA 2E29A 2GO9A 4OI2A 4BC9A 4N5SA 2K8GA 4C8YA 5C24B 4LSLA 2LU1A 1Z1ZA 4NZ6A 4ZPWR 4NA1A 4YFUA 2B4PA 1WTBA 5CXTA 5D3GA 2VKZG 1JLEB 4HI2A 4JI8F 2MQPA 3WC2A 3M2UB 1E6YB 4OZ1A 1Q86T 4IR9A 2RRBA 4ERDA 3OXLA 4RKUC 4I0WA 2GNKA 4F2SA 1RA7A 3IFEA 3CDEA 1FJGF 4ALZA 2E66A 4HDGA 5HN0A 1ZYQA 2DR8A 2RSQA 1RT7A 4B3OA 3MHYA 3M6XA 2FJWA 5AE1A 2MKSA 5U47A 2B3TB 5E5NA 2PMHA 3JSMA 1DAXA 1QSLA 1UVJA 2R8HA 2ZOMA 3HHLA 4MKBA 5K9FA 5GAEU 2ZH5A 4FBUA 2OO4A 1WF2A 4G1IA 4M1KA 2EFOA 4F25A 2DGOA 2BZ2A 2K1RA 3P49B 1OPZA 2DT9A 2IVMA 3OR2B 3CIZA 2J9DA 3VALA 4ZPVR 1AUDA 1KFSA 1V9OA 2X51A 1NH8A 1N52B 1IR0A 1T95A 1OSDA 3MI7X 2XCAA 1HHTP 2XI2A 5ITHA 3G6ES 5KOWA 4FP9A 3BGLA 3QGPA 3M6UA 1GXUA 1SC6A 3K7RA 1HI8A 1XR7A 3UCGA 2R8GA 1HWUA 6FDRA 5IM0B 2BR0A 1VMBA 4MKYA 4DWIA 4QZVB 3T1YF 1K1QA 2NSCA 1J2VA 4F4XA 1RT7B 4B3OB 1U2RA 4N76A 2B9XA 1CG2A 3Q0AA 3CCMS 4X4PA 3GIIA 3PX4A 2CDQA 2G13A 1FRHA 3IC1A 4CTAA 1ZPWX 3BQ1A 2OH2A 2NQPA 1AROP 2AU0A 4JYAF 1U7LA 2KFNA 1UA1A 1BD6A 1SIWB 3OTEA 4AL7A 4HKQA 2QA4S 3AA8A 3AB4B 1ZTTA 3CJ4A 3L7PA 4K4TA 2ALZA 1TKXA 1FHTA 2BM1A 4X4TA 1ZAVA 4GMKA 2VONA 2R8KA 3DXBA 4I6AA 3MPVA 1NRKA 2M8HA 2D9PA 4O3QA 4J9LA 3CT9A 1HNWF 2HQ3A 4QR1A 3CUNA 1RDRA 2QV6A 4NYZA 1R43A 4RX6A 4DV5F 3VAMA 3Q24A 2E1CA 4LIRA 4O4GA 5J2QA 1S77D 5JJBA 1HWKA 1IKYB 2Q6BA 2FLPA 4N56A 2KT3A 2UVVA 4MTPA 3MTKA 1RT4B 4DR2F 4DG1A 1ZH5A 1OQ3A 4FZVA 1S76D 3BGFA 2JEFA 1HNVA 3NNAA 3MM8B 2P9GA 2NUHA 4KHMA 4EU0A 3DOKB 4HH0A 4KFBB 2K7KA 4F3OA 1U47A 3WZ0A 1HBMB 4IYQA 5CYQA 1NU4A 1NKBA 5F0UA 5KG7A 4K0KF 4QPTA 2QYCA 4CZCA 4IFVB 3BDPA 3H4BA 4X4OA 1QLNA 3DLEA 4J9NA 4PPDA 4XIUA 1YJ9S 4AL5A 5THWA 5JVGQ 3OL6A 3DLBA 4B9MA 5J1EA 5KFFA 1LKZA 2FHJD 1F60B 3NCQA 1TL1B 2HMIB 1VC5A 4FNIA 3IS9B 5IT0A 3HKWA 4ZP8A 4PRFA 2RU3A 4K50A 1S9FA 2ZD1A 3NCPA 4PKDB 2IYIA 1RISA 4F4YA 1N0VC 4MFBB 4RW8A 3BREA 2POKA 4DPOA 1FA0A 1YTYA 1M1KT 5HMZA 4X2BA 2B4UA 4XPEA 5KFAA 1N36F 4I56A 2RRAA 5EX3A 2KM8C 1T03A 3FFIA 1XNQF 3H25A 3EPGA 1XTZA 4R5PA 4Q2MA 5KG0A 1XMBA 3V6HA 1RT5B 3R5AA 2JRSA 3OR1A 1X4HA 4USIA 1DRZA 3MAHA 5GMKa 3OFFA 4P6QA 1IQZA 3KK1A 2MKHA 5HP1A 4CO0A 1UVNA 1M5PC 1VHFA 4RW6B 1J5OB 3RRGA 5GAGU 3CMAS 2GFFA 2PA3A 2BJEA 1NK7A 4WFYA 2B43A 4NZ0A 4X4NA 3PKYA 1LFWA 3B78A 2I8EA 3V6DA 2XMWA 3DN9A 2LDIA 3M32A 3AQPA 5I3QA 3PO5A 4UY8T 1UP1A 3Q2TC 3UE2A 4OQJA