1FE4A

Crystal structure of mercury-hah1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords COPPER TRANSPORT PROTEIN ATOX1
publication title Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fe4A00
5B0GA 4HL9A 3HF5A 2W4DA 1OQ6A 1GXUA 3FMBA 2L3MA 3I9ZA 3CJKB 1Y0HA 3VTIA 2XMMA 4EFAC 3BR8A 3T9NA 2PD1A 5K9FA 1AW0A 2CRLA 2ZDOA 1SQEA 2XMTA 4YEAA 3TNVA 1YRXA 3K7RA 5B09A 3BM7A 3BF4A 3IWXA 3IWLA 2N4CA 1KQKA 1Q4RA 2EW9A 2KKHA 2OD4A 5B0AA 1GXTA 3HHLD 2OFGX 4FNHA 2OP5A 2LXFA 2FB0A 5F0WA 2GCFA 2BBEA 2QLXA 1URRA 2N4DA 5B0FA 3HHLA 1AFJA 5T7LA 2HFNA 1RJJA 2OD6A 2RSQA 1JWWA 2ZDPA 1YJUA 2IYIA 2LQBA 2OFHX 2RMLA 1P6TA 2AJ1A 3KKFA 2FIUA 2OAUA 2OKQA 2XMWA 1S6UA 2GGPB 3FGVA 1N5SA 1S6OA 3HX9A 2IFXA 2K2PA 2GFFA 2XMJA 3MZIA 5A6WA 5IXUA 1TR0A 2K1RA 4Q2LA 2VH7A 1KVJA 1YJRA 1Y3KA 2BUNA 1Q8BA 1VQYA 1CC7A 2QIFA 4OJGA 1MWYA 1CPZA 4NPOA 4HI2A 1Y9OA 2W4CA 1TUVA 3CJKA 1FE0A 2GV1A 1N5QA 3KG1A 2QLWA 2FTRA 2RU9A 4A48A 2JDJA 3HHLC 4A4JA 1FD8A 1MWZA 3LGMA 3MCSA 5B0EA 2AJ0A 2ROPA 1FE4A 1IUJA 4FNIA 4HH1A 3FRYA 5A6PA 1X0PA 1Q53A 3HHLB 1OSDA 1Y3JA 2HIQA 1YG0A 1V3ZA 1YJVA 2Q3PA 2W4PA 3BGUA 2ROGA 1N5TA 3DXSX 4NL5A 1TL5A 3E8OA 2GO8A 4Y2MA 4U9RA 2HFOA 1XBWA 2HQIA 1APSA 4DL0C 2HLUA 3DCAA 3UDCA 1R6YA 4Y2IA 1LQ9A 3LGNA 1AFIA 2LQ9A 3LO3A 4A47A 3GZ7A 2KT3A 2GA7A 2IYGA 1JK9B 2QYCA 3BN7A 1Q8LA 2G9OA 2HLTA 1SI9A 1OPZA 1SB6A 2KT2A 2BYCA 3KNGA 5KAKA 2AW0A 2GGPA 4OJ3A 2K7KA 4HH0A 2BJDA 3KG0A 2KYZA 1FESA 1KVIA 4ZA1A 2RILA 1X7VA 1VQSA 1FEEA 2OMOA 3TOQA 1ULRA 3BDEA 4OJHA 4DPOA 3F44A 5T7LB 5B0BA 2K7JA 2ACYA 2BJEA 2LDIA 1TZ0A 1YJTA 1W2IA 1FVQA 5B0CA 3WDOA 1FVSA 2N7YA 4QOTA 4HI1A 4Q2MA 1WD6A 3BB5A 2AP6A 2ROEA 2FHMA 5B0DA 4F67A 4Y2KA 1OQ3A 1U7LA 1TL4A 2VV5A 1N5VA 4YDXA 1QUPA 1CC8A 1P8GA 4OJ1A 4A46A 2XMVA 4DN9A 3QMQA 2ASYA 2XMKA 2K1RB 2PGCA 4OIXA 2XMUA 5B08A 3HDSA 3QGPA 5F0UA 1X8DA 3HFKA 4ZOSA 1K0VA 3TRGA
chains in the Genus database with same CATH superfamily
4J9QA 4P2XA 3UDEA 5KFOA 3FSYA 5AE1A 3H2UB 1HQUA 4ZHRB 4DZDA 4Q45A 3TVYA 4PABA 3KHLA 2IM3A 2ZOMA 2IA6A 2CPXA 1REVB 2R7UA 1HD1A 4E98A 3IN5A 5ETPA 2CQ1A 2V2QA 1S0VA 3QBCA 5KG2A 4F02A 4MMOA 4NLXA 3O5TB 4U8VA 3IAS9 1X60A 2AF6A 2VDHA 2F4VJ 4GKKJ 2VDIA 4YHHF 4Y28C 2GA7A 3PW4A 3I55S 2IC3A 1WORA 3ZXWA 1S5ZA 5IC6B 3O2IA 4CLZA 3TUPA 4OYWA 3Q22A 2YKMB 5DZ6A 1P1TA 2WONA 3MM8B 5GAHI 1S6PA 1NBEB 5CZVA 1QUPA 3P3DA 2OI2A 4U95A 2E44A 4ZS6A 3ETOA 3CSKA 2W4DA 3BO3A 4FPRA 1NJXA 2LP4A 4I6YA 1YRXA 2WVCA 4O44A 1X9SA 2R4FA 3CW2C 2DT9A 3ITHB 3NMAA 4FN5A 1TFWA 1XMOJ 2DR9A 2XMWA 1S6OA 3HX9A 3I96A 3MM7B 4J5OA 1XEZA 2BM1A 1DLOB 3GJSB 3H5SA 2KJVA 2Y8YA 2UXCJ 9ATCB 3H7HB 5KFPA 5EN1A 1A0OB 2D9PA 1CJKB 4JI5J 3D2WA 3M2VA 5KFCA 2HWTA 4A47A 5A8WB 1CJVB 1Z2ZA 5ADZA 4OZNA 4ZDNA 1NH7A 1SIWB 4PUOA 3SV4A 5E0OA 1WKJA 8AT1B 1B7FA 4DUYJ 3ISZA 2W2QP 3R3TA 1K47A 3M05A 1U45A 1VHIA 3EPIA 3U1NA 2Y1RI 4WK1A 2FVPA 2MDAA 5CCMA 2ZJPQ 1ROFA 5IT4A 2G1HA 2ZJRQ 5D78A 3OTDA 2XYPB 4PXBA 3C2PA 3D6FB 4USJC 3AB2B 1Q1KA 1PJ7A 2IJFA 5KOXA 2R8KA 3W64A 3DRRA 2C3YA 4LF9J 2NS1B 2OD6A 1KN6A 2OPQB 4LFCJ 1TP7A 3IGNA 1S97A 3SDEA 3TUIC 2DGUA 4TKTA 1PG5B 5FLXY 4TLQA 2Q6BA 1S6QB 2UUAF 5GMKa 4ECRA 2QLWA 2L9DA 4LRFA 3RJMB 3D66A 4ZPVR 5AJ3F 2QLFB 5J2PB 1H7WA 3R1HA 1X9WA 2J9EA 3VAFA 1TAUA 4F50A 3CC2S 4BLGA 2HG4A 1XIQA 4CQ1A 3OTEA 4QIVA 3IRXA 3IXQA 2HQ3A 2IVYA 1HI1A 2AEMA 2DNOA 3DC2A 4QCLA 3TI0A 2UUBJ 2HNYA 2QA4G 3C14B 1RWKB 1FEHA 2K1RB 4WF9Q 3T1HF 4USVA 2H65B 5F3ZA 1RTHA 2B9EA 2FVCA 5KFIA 1YLXA 5LJ3Y 4B17A 2PO4A 3D0IE 2ZBIA 4CZCA 1FK9B 1YWXA 4F4KA 1D0EA 4MIBA 2E1PA 3EDRB 3QT6A 2A6OA 1MROA 1AYEA 3CD6S 5CQGA 4ETZA 1N8RT 2VPWB 1I94F 1VQ7S 4V19X 4V1Ak 5D4OA 2BKOA 4P73A 2ZWPA 3FUYA 1JLCA 3CCSS 1U0SA 2K06A 3HSJA 1VYAA 4MK9A 1FCAA 2B5JB 3SCJE 3C6UA 1CULB 1NSKL 1F5BA 2LYVA 2KYZA 5BYRA 3Q8QB 1NB7A 2A0FB 1B64A 1Y4ZB 4A8SA 4IG0B 4UQTA 2KXFA 1T9XA 5B0DA 3MTJA 2MQNA 4C4WA 2VL1A 1RBAA 2J6TA 1UVJA 3I4HX 4LSLB 1QE1B 2AZ3A 2R7QA 1WOPA 4K0KJ 3Q8UA 4FS1A 3CJTA 1WJ9A 3RG6A 3R6GB 2ZH2A 4OHYA 4DR7J 2VBYA 4ZLNA 3MEEA 5F0WA 1KNZA 4J9NA 3C15A 3W5ZA 2ZDPA 2P9EA 4CTAA 3UW1A 1HD0A 3NXZA 5CD4H 2YKQA 2C2DA 3EGNA 3NGKA 4NA3A 2E5HA 3Q8SB 2CADA 3M30B 1N5QA 3WBZA 1FD8A 2BANA 3E51A 1Y3JA 2XYHB 5C25A 2J6SA 2BVZA 3GZ7A 3L7OA 4F25A 1IQZA 1U1MA 4X62F 2GGPA 2MY8A 2PT0A 1N0VC 3MR5A 5D15A 1ZM2A 2OUGA 5T7LB 2DJWA 1SJ1A 4USTA 3NBPA 1PJ5A 4LUBA 4DL4A 5B0GA 4IH6A 5EWFA 1UZDA 2DGXA 1Q8KA 2FD2A 1F9EB 3P45B 2IAJB 2LXFA 2GCFA 4OI6A 1TKTA 5KG6A 3GCWP 1IBMF 5BR8F 2CWXA 1S6UA 4DUTA 4JI4F 1WC0A 3MZIA 2VKZG 2JH3A 5KFTA 4NLVA 4ES1A 1Y3KA 2ZNZA 1DHMA 1SUQA 4U7UK 3H2VE 1IQTA 4TQSA 2WZ1A 4K4UA 1RT5B 3T19A 5CH7B 4J9OA 1JLQB 5LMUF 3UD3P 4QYZJ 4FZVA 3POTB 2CQCA 4TVAB 4KGMA 2W01A 3QJPA 3WIUA 1VFJA 1J5EJ 2L08A 4I6WA 2C2MB 2W7AA 3OHBA 4PQAA 1OY6A 1C4CA 3TZWA 4KV8A 1JIHA 3OFGA 2MHNA 4ZVEA 1VJQA 2GVZB 3G82B 3KK3A 3GG0A 4DN0A 1JLGA 2XQCA 2IVFB 1WHWA 4O3SA 5D6GA 1MU2B 3M8YA 1T9TA 2FZCB 4ZP9A 5K14A 4C0BA 2RNEA 3QO9B 3IWXA 2VG7B 4O4GA 4HHUA 1HIYA 1GXTA 1FO1A 3SIPB 2AD9A 2DNQA 3G71S 2KN4A 3PM9A 1UP1A 2RF2B 4LQ3A 2J9DA 2OLWA 3SZ2A 4F3MA 4KO0B 3UDVA 3I31A 2F9DA 2D41A 2ZM6J 4IO1A 3MM5B 5F9NA 1T8EA 3DLHA 4CM2A 4ECUA 4RNHA 3K0JA 1IVZA 3SQGA 3LTOA 1SQFA 4KT0C 3R5JB 4NLRA 2FJXA 2RVJA 4OI3A 4DV7J 1YJVA 4Q0BB 4ZJLA 4AQYF 2DB1A 2MSSA 3K8VA 1RWPB 2XZWA 3I32A 1FWLA 3G6XA 4P6QA 3FRZA 3MMBB 4I68A 1DTQB 2PIIA 3QSIA 2HNZB 3BSCA 3QZ7A 2K7JA 4CI0B 1FNOA 4LQ9A 3SXLA 4K2JA 2XBPA 2KHCA 4PWDA 4M8LA 2LQ5A 2WRMA 3ZZRA 2FGCA 1I5OB 4XK8C 4I2PA 3DRXA 1BLUA 6FDRA 5E3RA 3KK2A 2Z2YB 4KY3A 2EG2A 4AT1B 4WYWA 4FVCA 3FEYB 4WTYA 1RHJB 4KBIA 4XDDA 4QU7A 1NHUA 5ETNA 3I82A 3T41A 4DCOB 2VBZA 5FDLB 1MWYA 2EK6A 2O67A 5HVGA 5D8HB 3LPYA 1S1UA 3DGVA 2IMWP 2FZKB 3ENWA 2R7SA 3N5BA 3NNCA 4F67A 4KGZB 2VKRA 2GO8A 5KFAA 1GAOA 1S9FA 2E5LJ 2EFVA 2M7SA 4ZVHA 2VZ9A 3MURP 4X65F 5C2CA 4ECYA 4JI8F 3PEJA 2KZZA 4L74A 5KFHA 1NJWA 4DFMA 4CO0A 1HBUA 3EMTA 3ZC4A 4NCAA 1BUXA 4DR2F 3THTA 2XWXA 3PVXA 3LW5C 4B3MF 4IRKA 4Y0FA 1UCNA 1GMWD 3PKMA 2A10A 4OIXA 1IBCB 3QPIA 3LQVA 3EZUA 2AJ2A 2DGSA 2ZDOA 1YQHA 3CO0P 1U49A 3IWLA 3DRSA 3D9BA 1JNRB 3QLHA 5A8KB 3MM6B 4NLUA 3Q8YA 1S7HA 1LW0B 1MLAA 3T6BA 1XNQF 3H5XA 2OGUA 1SBRA 2JFKA 2ZBRA 2DHSA 5A2QU 3C6TA 3QT8A 2ABYA 5AT1B 3KMQA 1YHQS 1FNMA 2BABA 4U8YA 1YG0A 2FZGB 1VS3A 2HFOA 3QRPA 1PJ6A 4LBHA 1XERA 4MFBA 2W9BB 4B3SJ 2GW8A 2UZAA 2NPFA 1H98A 3NEKA 2APOA 2FLPA 3RW6A 5DDPC 1MW7A 3RR8A 4FBTA 3PCOB 3R8YA 1MWQA 3J81Y 2DHGA 3EVMA 4QWCA 4ED3A 2VOPA 2KO1A 3C16B 1X4DA 2LA6A 4KE5A 3OFEA 3PEHA 4DR1F 2XMMA 2WSEC 1S79A 1Q16B 4CH1A 4DV4F 5HI7A 5KFRA 2Z8QA 4QIEA 4G3IA 7FD1A 3GR0A 1FRXA 5T14A 1H38A 2JWNA 2CKWA 2V8DA 3GU0A 4OYPA 2BMBA 2HBRB 3SMZA 3W62A 3CCMS 2F40A 1TVRB 5DM6Q 2NCKL 2YNGA 2MLXA 3MCSA 3DYAA 4F3QA 4IRCA 4URSA 4DSFA 4NEYA 5EX0A 1YZ6A 3H0PA 4B9UA 2IRXA 2VQFF 3KLEB 2DNRA 2IPOB 3H40A 1R43A 3US5A 1GTEA 4F2RA 1U1OA 4BS2A 2BM0A 3EZOA 2GX8A 1DQ9A 1G3OA 5MLCV 4I69A 4N56A 4DV1F 1UVNA 2I9SA 2C2KB 1X5PA 1BQMA 1K9MT 3CWJA 4NYPA 3I5CA 4JI1J 1BWEA 2R8JA 3MF5A 2V63A 3TANA 2GNKA 2CPHA 1HWJA 3PX4A 2M8DB 4OV1A 3CB4A 5K8NA 2Q1LA 5HK4A 2HFNA 2Y8WA 1U4BA 3DXBA 1VBYA 3H5UA 2M70A 5E7OB 2HGLA 4RU2A 4OYAA 3MGJA 4AUKA 1CC7A 4RW4A 2OPRB 1R8AA 4KFBB 2I5JB 3IMQJ 2AJ0A 4C8MA 2FLNA 4B3TJ 4FF2A 1RTJB 1IKWB 3BKFA 3L09A 2MMYA 3JTNA 2KT3A 2RHSB 1T7PA 2OSQA 4DX8H 4IOBA 2X7IA 4RPFA 4ILLA 4B9TA 1NJYA 3D0HE 4DX7A 4Q2MA 4JI7F 2AIRB 4DSEA 3JTPA 3BKUA 1FNXH 5I4MA 2E1CA 2C2RA 4A8OA 1RWUA 2PA3A 1LWFB 5LOQA 3OUYA 4M5LA 1XQIA 2GIFA 2VPXB 2NZCA 1FRKA 2QA2A 4KRWA 3AAWB 4H4OB 4W4MA 3MM9A 1MMLA 3H59A 5HP1A 4B9LA 1FT8A 5FIIA 1J2VA 1KRPA 2E5JA 4R5PB 3RRGA 3HJVA 4UZCA 2J8SA 2YWKA 4LF6J 1SJRA 2FJDB 4PQUA 1VC0A 3EDQB 3CCUS 3KJNB 4ZJOA 2RQCA 3M6VA 4DV6F 1WDDA 3UVJB 1Q53A 2EFNA 4Y2IA 3PYFA 3MCMA 3OXFA 2MKKA 2ZWOA 4I7FA 1TV6B 2F63A 1Z1ZA 4ZPAA 2YVSA 3A12A 3EZ5A 2NSCA 3V6HA 1TK5A 3N9UC 4ZVSB 4EO6A 2CQ3A 4I2QB 4CO1A 4ES2A 2D69A 1XTZA 4LRCA 1Y11A 3L4BC 2NR0A 1NU4A 3DGPB 2B8QA 1HPZB 2RD5C 5HVFA 4CNZA 4EFAC 3JQKA 2PMWA 3JSMA 3DRPB 5DGBA 5HL7Q 1TKZB 2LVWA 1BY9A 2OTJS 3BBCA 2W7OA 1IN0A 2KG1A 2R3VA 2BOAA 2CVIA 2FLLA 1TR0A 1VQ6S 2CA9A 1NKBA 5DDRC 4LR8A 1KLNA 1YTYA 5L46A 4K8RA 4G65A 4ZPWR 5KFYA 2KXNB 5A6PA 4ED2A 4L6V3 2G0CA 4ZIVA 4QIFA 3OL9A 2PMHA 3M2UA 2POKA 1IBKF 3FMWA 3HVRA 5A0YA 4G1PA 5T41A 4ZHRA 2B4PA 2OEKA 1PC4A 3JAMU 2CFXA 3M4XA 1WC5A 3Q0AA 1EP4A 2WOMB 1FRJA 3Q8RB 1VIOA 4DSKA 2FLOA 4OZLA 2CPZA 4IFVB 5J2NB 3HFZB 2V6AA 4NX9A 2DRDA 1C4AA 2JNJA 2ZFHA 3E3XA 4A8XA 2X1GA 1W25A 2C2OB 1UFKA 4WZMA 3RW7A 4RBUA 4RWXA 1NAQA 3SBMA 3IAM9 3UPFA 4BCAA 2AZ1A 2DPIA 3U1MA 2KL8A 3T5KA 4NA1A 3OR2B 1YVFA 4B02A 2NXUA 4KQZA 2YKMA 4GVLA 3VAGA 5D4NA 1VOMA 3G96A 4IH7A 5E3QA 1PAEX 1F60B 2CPJA 1O5JA 1UA1A 2YH1A 2CDQA 1LWEB 5DLFA 3C8YA 3B82A 2HRYA 1Q8LA 2MQOA 4KH1B 2DGQA 2X3GA 3KNGA 4L3KA 4HHHA 3CJ3A 5IOLA 5HBMB 4RWWA 2FJWA 4PG4A 4IRDA 1RLCL 2DH8A 3FBFA 3CCJS 2HKEA 4ANEA 5D0GA 3QFWA 4CCHA 4A8YA 4NE9C 3MM7A 4LREA 2P6TA 1DLOA 4RUBA 4LVOP 1L3SA 4CYUA 2FY8A 4N77A 3ENQA 3FZ2A 4KC5A 4NLQA 3MMCA 1RA7A 3PRDA 3NGSA 2YWGA 4J90A 5LM7E 1U09A 1EETA 3DFEA 1BD6A 5ITHA 3RAXA 2H3EB 2QMWA 2FUG9 4ID5B 1KHVA 3SEOA 1FE4A 4FKYA 1JLFB 3TWZA 2CPEA 3GWCA 2DCUB 5K8PA 3FEZA 1DFDA 3OFFA 1APSA 4DL0C 4OI0A 2ATLA 4JV1A 2EKNA 1CQMA 5KAKA 1CS4A 1OO0B 1Y5IB 3H90A 4IYQA 3ULHA 1SJ4P 4ZA1A 3CC7S 1NNDA 4R8UB 4O3OA 1C0UB 4DV0J 1RXOB 2BRKA 4O3QA 3J7Z5 1RA6A 4H4KA 1RTIA 3G4SS 3EE3A 1ACMB 3HFKA 1SL1A 1A6LA 4PZVA 3BGRA 3OVBA 2HAFA 3TQEA 1S6QA 2BOPA 1S1WA 1IBKJ 3JXOA 4W90B 5LXYA 4C0HA 5KFXA 1UWAA 3FKBA 4ANCA 2O1PA 2FVRA 3IGVA 3HO1A 2Q6CA 5D4LA 2AGOA 2ZNYA 1D1UA 1Q8BA 3E2EA 3RUBL 2ZOFA 3ILJA 3RZAA 4H4MB 1TU0B 1S9GB 2PA8D 1LK5A 1KVKA 2EKYA 4F36A 1R0AB 3V6JA 1CJTA 3C14A 3L7PA 5E2QA 1WELA 4C7QA 2ADBA 1KLMA 3BO4A 5AXLA 1JMTA 2IRYA 3MFIA 3VF0B 1RAGB 4B3RF 1FF2A 4CO2A 1VQPS 4ZVOB 4UW2A 4A8KA 1ELOA 1FK9A 4I1TA 1TL4A 4DN9A 5IM0B 2E66A 4FYWB 2XHCA 2M88A 4I64A 1SV5B 4ECVA 4UOHA 5GADI 2I0XA 1O8BA 5CD4A 4M95A 3CULA 4AYBD 2L9WA 4DR5F 3OV7A 4F3OA 1QLNA 3G87A 1PO6A 1UWBB 4HDHA 3D3CJ 3K8WA 3UO0A 1KS2A 1RI7A 3PV8A 5M2UA 2VODA 3LANA 1RKJA 1Q78A 3PW2A 4ECWA 1CULA 5KFGA 4KHPF 1N6QA 3KOAA 4YY3F 5C5JA 3PKYA 4JYAF 4DBQA 4AL7A 5JUMA 4JV5J 3B4DA 3FRYA 1QVGR 1SC3B 1ZA2B 2ROGA 2AJQA 2DR6A 1FFGB 2QGFB 4N7TA 3R2CJ 4NWBA 2HFVA 3UN2A 4LSLA 1RT2B 3MR6A 3V6KA 1QE1A 3N6NA 1NDCA 3MHYA 3GV5B 2L41A 3HHNB 5D0EA 3NGDA 2E1RA 2YX1A 2ZZMA 2K7KA 3FCHA 1UVKA 3MPDA 3M8PB 2V5HG 3CD7A 3GJTB 1PAUB 3N01A 2V69A 4TU8A 2RQ4A 2DBBA 1KFSA 4LFAJ 4Y2KA 3KHRA 4P2SA 2AX1A 2JJ4D 3ILLA 2CG8A 3CF5Q 1VISA 1AUSL 3PX6A 1DZ5A 3BM7A 5HQ8A 4A8QA 3TZXA 2B9YA 1LEOA 1UKUA 2CIMA 1FJCA 4FXVA 3NGRA 2DO4A 1VQNS 4NXMJ 4DV3F 2AWZA 4N47A 3VAHA 4DR4F 2W25A 3BSOA 1JXLA 3W9HA 4FF1A 2H54B 3TA2A 2KFYA 1Q79A 2CXEA 2FJAB 4LR9A 4M5NA 1HNIB 3CIMA 4P2MA 4OYBA 5HROA 1S1XA 1PYOB 2YKNA 2AYGA 4F7VA 4OI4A 2RDIA 2B6AB 1K44A 4AL5A 2IAJA 2BA9A 3HM9A 3OXGA 4GVBB 3IR5B 4HI1A 1WG1A 3FBBA 4F4YA 4C6AA 4DR3F 5BYQA 3U7JA 1N54B 1RSCA 3ZO7A 1VLOA 2B7CB 4GC7A 1K0VA 2W8KA 2UXBJ 4RNFA 1V9OA 2MQLA 2DIUA 3MEKA 3OW2R 2DKOB 3POTA 4Y34A 2GC8A 4F0KA 3ZTPA 1DBDA 1PBAA 1TL1B 5IWAJ 3LP2A 3UR0A 4OMFG 1YZ7A 4XPEA 2KRBA 2RKIB 3KFWX 3HFVA 1AROP 3PZPA 5E3AA 3GYGA 2MGZB 2GVZA 1B7YB 1VCTA 3J7YI 3G82A 4UF4A 1FX2A 1RT4A 1VJWA 3OL7A 3KLGB 2YNIB 1UEUA 1O51A 2QT7A 1FDBA 2JEGA 3UN3A 3VHQA 4OLPA 1VQMS 4FPIA 3J7A1 2HVHA 1JJ4A 3M6WA 4W92B 3WC0A 3QO9A 1N34F 2VG7A 3AA8A 1PKUA 3IFEA 2QO3A 2H51B 2RU3A 1YDLA 1WI6A 2Q43A 4KO0A 3VVTA 3S1TA 1URNA 4AE5A 4QJVA 4OX9J 4UOFA 1HNXJ 5B09A 2R8HA 2VPZB 4KAIA 4EGLA 1KQKA 1QDUB 2EW9A 2EK1A 3O3LA 2YNHA 3Q8VA 5KFZA 1WKLA 3NWRA 1B4SA 4JI2J 4QWEA 1N5SA 4DSLA 4PEOA 4NYOA 3K17A 2VH7A 2XB2D 3IP0A 1DTQA 3ZZUA 1S10A 2HNZA 2OEMA 4PCQA 3SV3A 2DIVA 4M63A 5IT9U 5BYSA 2MTLA 2PFFB 3ET6B 2DNKA 2XEXA 2BE2A 2D9OA 5KFNA 2YWHA 2CDRB 3KUGA 2W9AA 2DNLA 4GO5X 3ZTRA 5GVQA 4PRFA 3VZHA 1WC1A 1UVLA 2H4WB 2B51A 2FHMA 2CJXB 3O8WA 3UD4P 3EGZA 4WYLA 1Q86T 4LFBJ 1N33J 2V68A 4PKDB 3G6YA 3VTIA 1R27B 3W2WB 5FDLA 2CRLA 4F8RA 3BF4A 3CCZA 2M52A 4YS2A 2EBEA 3A1YG 3FQLA 1SC4B 3THPA 2HZCA 2Z57B 5ETKA 1IKYB 2DEIA 1CG2A 4M5JA 3G8TA 4DXLA 2UVWA 1CPZA 1NUEA 1TUVA 5DQGA 4HH1A 1LWCB 3MPUB 4PR6A 5A8RB 4WWSA 4GRSA 4CLSA 5D3GB 5THWA 3T1AA 2GQ2A 1KQSR 3SSQA 1SB6A 2J0XA 2XGPA 2LQJA 4TYBA 2H5EA 1D9DA 1X7VA 3ILOA 1KEKA 1RAFB 1C2PA 3AT1B 5C24B 5KFBA 2KG0A 3F56A 3C19A 3QIDA 5H1SV 4NXNF 3KNAA 1XK8A 3LWMA 4Q44A 4ZVQB 2W7PA 2CUYA 2XZDB 2FGOA 1N32F 2Z2MA 3EX7B 3CTRA 4KH0B 3I9ZA 2IM2A 1AZSB 4UUXA 4RZRA 5H9EJ 4PAAA 2ADCA 4KYZA 3FSXA 4OFZA 2XY5A 1BQNA 2QL5B 1WOOA 3B4MA 1JWWA 2E9ZA 4NASA 3GSIA 5I42B 3JTOA 2XMAA 1YBTA 3RR7A 3VCDA 2HQFA 3Q23A 1EIYB 1FE0A 1ZAVA 2VC0A 3W8GA 5J2MB 4Z7YA 4P10A 2V4JB 4M5GA 2B56A 1V5IB 4PYDA 2IYGA 3CJ2A 2ZD1A 2GQQA 5KFWA 3D1QA 3VAJA 4IOAQ 1E6VB 3VGSA 4QYZK 3KK1B 4DQRA 3UNGC 2XLJA 4X66J 3J80Y 5ETTA 4FXWA 1HWKA 2UV8G 1X5TA 4JI0F 2CVEA 5DZ7A 2UUCJ 3BH7B 4CLFA 1TVRA 1KQGB 2HPUA 4FF3A 2PSZA 2OP5A 1BXNA 3A3PB 1FFWB 3Q86A 5IQ6A 4DG1B 2CQHA 2LXUA 2VQEJ 4MKVA 2HVDA 1S9EB 3KLEA 3IS9B 2JVOA 3QYYA 1TUWA 4OQJA 2CJAA 2PFDA 4K7QA 2W2OP 1NPRA 4PWUA 4ELUA 3CCTA 5BJRA 4X64F 4MYUA 5F8LA 1HBNA 1IKVB 3HVTA 4JUZA 4ZVPB 2XM3A 4N8OA 3BGUA 4HT5A 4JI3J 3AQOA 5DDQC 3MAHA 1GH8A 2ZEJA 2VJVA 1S7IA 4P7TA 2F8HA 2V8GA 1F2GA 3K58A 3DLGB 2HHUA 3ICLA 2N7YA 1FKAF 1YJNS 2C1EB 3SSSA 1NEEA 3VVUA 4FF4A 3VGTA 5B08A 5F8GA 1N52B 2AX0A 3EM1A 4ZVGA 2E7XA 2DK2A 5KG5A 4TY8A 4AD6A 1FFSB 3TAMA 1UJ6A 1EZZB 2OPRA 4DUZF 1PILA 1FJGJ 2I5JA 1T95A 5B0FA 5H9FJ 4GO7X 1RTJA 4OX7A 2ZHBA 4IO9Q 1RU1A 1TKDA 1LW2A 1PC5A 2ALZA 3VGVA 4WFNQ 4DL7A 3I4PA 4NRUA 4J91A 2BJ7A 2OHDA 2K2PA 3SCKE 4DPXA 4ZN1A 1JLBA 3JSRA 4M5HA 1QY7A 4YP3A 4YDDB 3N6LA 1TL3A 5KFDA 2ZH7A 3HHLC 3GFYA 3ZZZA 4JBCA 2V94A 1ZETA 2KI2A 1F9FA 4WE1A 2HBYB 5KFKA 4ICLB 2GJIA 1UA0A 2J6UA 4J37A 4C11B 3CCWA 4O3RA 2BQRA 4CWBA 2HVZA 4LF8J 2J7UA 3M8QB 2ILYA 4K2XA 3D3BJ 1RUSA 4RW6A 4ZLJA 2LKZA 4NLSA 3DI6A 2FJVA 3FMBA 5KT6A 4Y2CA 4PG5A 5DDOC 3CJRA 3TA1A 1JJ2R 2A1BA 4ILMA 4EZ6A 3W2VB 2V50A 1N36J 4UY85 1GNKA 1T03A 1CVJA 2HFUA 3BEGB 2IBKA 4YR3A 2E7WA 5EWEA 1TV6A 2XMJA 1O6XA 4DPWA 1BMQB 3H4DA 2K3IA 2DPJA 1SVDA 1UFWA 3HSDA 3QIPA 2VOOA 1TK8A 5ETOA 1ZH5A 1HA1A 1N5YB 4RBTA 4I2QA 3AD7C 1RWNB 1Y10A 3OTOJ 1ZYQA 1FRMA 5K5MA 3DGPA 1HQUB 4O0IA 3PW0A 5ETQA 4HH0A 2E1MC 3I0RB 2D3O1 2DNPA 2DNHA 4C3MA 2DNZA 1L3TA 2C2NA 2NUHA 3TJ8A 1IBLJ 1FVSA 4A8WA 4ZP8A 3TJ9A 2RQKA 4ED6A 1JLEA 1TKZA 2CQBA 2XMKA 3UWTA 2N3LA 3MPVA 4BWJA 4M5DA 3RBEA 3PFEA 1KWMA 2FJEB 2QSFA 4ECQA 1K1QA 2EFOA 3GYXB 3IBWA 4KJIA 4GKJF 1HL6A 1ZPVA 3QGGA 4WPAA 4O3PA 3OLAA 4XIUA 3MMAA 2IC3B 2V2VA 5CYQA 3UCGA 2G2OA 5DG9A 1AB8A 4NMLA 2WONB 3DLKA 2ASJA 1WACA 4DPUA 1S6PB 2P6SA 1WNEA 4TQRA 1RT1B 4YB5A 4N76A 3PYEA 3VAKA 3BSNA 5LJ5Y 2IVMA 3CO9A 1U02A 1VQ4S 4CH7A 2ASDA 5J2NA 3LOUA 4MKBA 3PXGa 3JSBA 4NLYA 3G8SA 3KG0A 4ELVA 3H5YA 1YJ7A 4I0WA 1XMQJ 1MG7A 3HSZA 3RAMA 5ETVA 4A46A 5JMNA 2W8LA 4USHA 4RBVA 3RBXA 1RHQB 3HF5A 4LF7J 4CLLA 4UQGA 2HQCA 5KFLA 3M2VB 5GAEU 2XC9A 2HRTA 3V2UC 1LWEA 4MJKA 3UCZP 2ZOGA 1IM6A 4XAKA 2PN6A 4ZVFA 4J9UE 2AEFA 4D3GA 4DR6J 3G9CA 4ZP7A 3SQOP 4LIRA 1S1VA 1FDNA 3M1VB 2B4OA 1UEKA 1HHSA 2LQ9A 1WC4A 4RW8A 2MZTA 3D0GE 3M7VA 3KLFA 2R2UA 3D1OA 2GHVC 3KUEA 3GE9A 2EEYA 4F4WA 3BDEA 4ZK7M 3DRRB 4KIAA 3CJSA 4J9LA 2ZITA 3DOKA 1SQGA 2ZH8A 2O01C 2UXDJ 2YY3A 2JL9A 5KFUA 1YITS 2WAQD 4XTTA 3T9NA 2DR8A 4MK8A 4KHMA 1IR2A 2D7SA 2OFGX 4HT7A 1T9YA 4C3LA 3KLVA 5F9LA 4NCBA 5DG7A 2EBGA 1RP5A 3CCLS 5LSRA 2WCXA 2G2YA 3IRXB 3MWBA 3T1YF 4RW9B 4NI2A 2VUGA 4PWWA 3OSNA 5CYJA 2MZRA 3BYPA 3TZYA 1YRTA 5I3UA 3GB0A 4R8UA 1VI7A 4C8YA 2HNYB 1R31A 3HZEA 3LGHA 2XTJP 4FNIA 1RHMB 4RW7B 4QWDA 2GJFA 2WVDA 5I3PA 1X5OA 2MKIA 3DOLA 3OVSA 3PW7A 3DRYA 3PNIA 2HS0A 5GAEI 2YNFA 4ZCLA 2LU1A 2GO9A 1KQFB 9RUBA 2RJZA 1VRQC 4I56A 3HDSA 3QGPA 2NXCA 1M5KC 5HMYA 4KGXB 3M9NB 3FZBA 3PHTA 2LEPA 3BJYA 3VAIA 1E6YA 2M3DA 3AXMA 1CJUA 7FDRA 2CJBA 1JLCB 5L1LA 1MMDA 3NCQA 1S9GA 3W3SA 3J7AN 1R0AA 3JYTA 4AL6A 4C97A 1QAYA 3THVA 2AJ1A 2K8GA 1FERA 4QBUA 1FWKA 1P1LA 2FC8A 2KDOA 2H48B 4LBIA 5L1IA 3M6XA 1B99A 2QZ8A 5DETA 4IFYA 3RU0A 4NZ7A 1XR7A 1DARA 1X0PA 3A3NB 3HHLB 1RQ0A 1RT3B 4DV5J 5ETSA 1OYDA 2MQMA 4IQMA 1AXQA 5IM0A 1VQLS 4Q8EA 1ZAWA 2HS4A 5HMWA 3M8SA 1WG4A 4OHVA 1J27A 3GJQB 1RAJA 3F0NA 3MEEB 2RIJA 1F0XA 4L72B 3M6UA 3BGLA 2A18A 3F44A 4O4RA 8ATCB 3C15B 4CTAB 3IM9A 1G2EA 2MJUA 2ZHOA 4RKUC 1UL3A 1UWBA 4K4VA 4X2BA 1XNRF 5JVGQ 2I6WA 2R7TA 4E0DA 2KU7A 2PE8A 1SPBP 4DV2J 3PACA 5CCLA 2OD4A 2C2ZB 2CJYB 5C25B 3HHLD 2J8AA 3FFIA 4MKAA 2M2BA 3MUTP 2HHHJ 2ZUAA 2CPDA 7AT1B 2J9CA 1HFEL 5J1EA 1QTNB 2GGPB 1RT2A 4ZP6A 5J2QB 2C3OA 4DU8A 2WHOA 3K5OA 3OBIA 4FYVB 2QJ3A 3CVKA 2VFUA 3MD1A 2FY1A 2B3TB 3M8PA 4P52A 3QZ8A 2I38A 2ZBCA 3I56S 2KFZA 1N48A 4EK2A 2LXIA 4U9RA 2YQ3A 1R6YA 3W5YA 1R7IA 3H4BA 3HVWA 2NLWA 4LF4F 2ZH5A 1HNZF 4USMA 4IOCQ 4P71A 4YR2A 2BW7A 3W8PA 2DGOA 1EQMA 2YH0A 4YHHJ 3DU5A 2ZH1A 3P4UB 3HSGA 3D4JA 2ASYA 1G1XA 1M0SA 1RAEB 2V8PA 1I3OB 1YBAA 3TA0A 1SUQB 4NMXA 2HBQB 4OYXA 1VR6A 2AGQA 3CCRS 4DF8A 2LQ8A 3MMJA 2ALYB 5DG8A 4ZMMA 1ZBTA 1RJJA 3GILA 2NQPA 3LA0A 4FBUA 2IFXA 3L9ZA 3M8RA 3G6VA 2HMIB 1J5OA 1YJRA 3NL0A 4KV8B 1DTTA 4ZIWA 3KK3B 4A4JA 3Q89A 4O3NA 4CT9A 4GVBA 3MR2A 4JOUA 1D9AA 4DSJA 3FBCA 4J9MA 3KHGA 5K14B 1JK9B 2GHPA 2HIYA 5E3CA 5IT0A 2MSTA 1LK7A 1QAJA 3DM2B 2BJDA 3K89A 5GMDA 3NS7B 1S0OA 3MEGA 3TUJC 2AT1B 4GC6A 1HNWF 5LMNF 3QJJA 2LU2A 4W98A 4DL3A 2OJ3A 4ES3A 4P2FA 2JHEA 3FC9A 3SQGB 3CDWA 2RRNA 1F2HA 4LF5F 5HMZA 3IG1A 1RLDA 1C1BA 4R0EA 1CQNA 1D8ZA 3IA0A 4HEA9 1ZAXA 3W9JA 2QSWA 2RKIA 5KG7A 3ZNJ1 4Y2AA 2PEHA 1DQ8A 2HFZA 3UI3A 2QL9B 4ZPDA 1NKCA 2JX2A 4HKQA 4X4QA 2GVDB 2BJ3A 5M2RA 4ALZA 4DLGA 4B9NA 3NAHA 2VB6A 2ZHAA 1UZHA 4NLGA 4PWDB 4HHJA 4FP9A 3DLEA 3NGUA 2AQ4A 2V2KA 4RUHA 3AOBA 2IHR1 2UUAJ 3NWGA 3SI8A 2XY7A 3AB4B 3IBCB 3ZFVA 2DITA 1HKAA 5E3PA 3HLUA 3V6DA 1KVIA 5AJ3J 2OMOA 2WVFA 1BWVA 4YMEA 2Z58B 1NK5A 2IM0A 2AYBA 1BE4A 4RX6A 2VBWA 4TN2A 5F0UA 1IKXA 3N28A 3GSDA 4OHWA 3TRGA 5HJYA 3OR1A 1RDRA 1S1UB 1Y0HA 5DQHA 4NEZA 1Q4RA 4PYAA 2MPUA 3PR5B 3QRQA 3T1HJ 4OYIA 3TYTA 2CQDA 2BJ9A 2IYIA 3ET6A 3MTKA 1HBUB 1ZZFA 3O44A 4WCEQ 1C0TA 1G6BA 2VG6B 2IA0A 1NZAA 3KXDA 1QSLA 1EB0A 2XI3A 5A2QY 3Q83A 3EYZA 3T5LA 3PIPQ 1V3RA 1TL5A 2HQIA 2FPHX 4DI6A 2YKOA 3QJLA 3I6PA 2QYGA 3PHEA 3GP9A 2XG8A 1WOSA 2P9CA 1I94J 2MEWA 2XULA 1NPPA 2AW0A 3DRSB 2Z30B 4HTIA 2ASLA 3W2WA 4ANDA 2J0WA 3OSPA 2F3JA 2JLEA 1TTHB 1NCLA 3WC2A 2AP6A 4XPCA 1H2UX 1S99A 2DGTA 3FK4A 2BACA 3W63A 3C6TB 3D6HB 3HHKA 3GV8B 2WTFA 1M5SA 1RADB 1KSPA 4KKOA 2C3MA 4ECTA 2QLXA 2CQIA 4LF2A 1M1KT 2J0QD 5EWGA 3KJVB 5KOWA 3MAAB 5KG1A 3CDEA 5F8JA 1FRLA 2U1AA 1WKKA 4DX6A 3V4IA 1PCAA 3C66A 1HWUA 2OPSA 2DXDA 2MKSA 2ZH6A 2NXJA 1ZTWA 1T9VA 2MQPA 2E29A 1QAXA 2V9WA 3CUNA 1V3SA 1PGZA 3H25A 2HVEA 3NOCA 5GMEA 1HNVA 1UETA 1GFWB 3BS9A 1HR0F 1FKPB 2R9LA 3GCXP 3TR5A 1W2IA 5AE3A 4QOTA 1ZM3A 4FS2A 2GMLA 3CJ0A 3I5BA 4X62J 2XLKA 4WFZA 1P8GA 3QMQA 2KRRA 4KTQA 3H2LA 4ZVTB 3PJ9A 2YNGB 4OI1A 2BJ1A 3IRWP 3DYAB 5ETRA 2UU9F 2Y9HA 2NPIA 1RACB 4OZJA 3AD9C 4DWIA 3EXCX 4A8MP 2NXNA 2CQ2A 4K4WA 2QG9B 4R25A 5J2MA 4WFYA 1MN9A 3H98A 2KVIA 2VBXA 2V4JA 1U1RA 4C8NA 1UFLA 4CDIA 1G7CB 3TQ1A 4C9DA 1FDAA 4OJGA 1RT7B 4FVMA 3CJKA 2N82B 2KXHA 1IBMJ 5BR8J 3O6QA 4JI4J 1E6VA 2XS2A 1RKIA 1BQMB 3K57A 1F3FA 2KJWA 1QD1A 4NA2A 1F6TA 2P8IA 4J9PA 1K0TA 4AXJA 4M94A 4F0MA 4HACB 2WBRA 3T5HA 1QVFR 3MCNA 2J5AA 5LMUJ 2GZOA 2PDAA 3DDNA 4OJHA 2LLZA 3CPWR 3WHIA 2FC9A 1TL7A 2HQGA 4DG1A 3ISNC 1ZPWX 1LWXA 1N5VA 4YDXA 2VHGA 4G1QB 2MQ8A 3DDIA 3GTYX 4RW4B 5GAGU 3QWPA 3A3OB 1U2CA 2GAHC 2HHXA 4USKA 1CEZA 4PG6A 1RWMB 3OJSA 3K5NA 5M2PA 2DH9A 2OTLS 3CEDA 3ILIA 2QTWA 2FVQA 4GKKF 4U6PA 3Q24A 2F7VA 2HBZB 2BW2A 2B8PA 2E5IA 4G1IA 3U27A 3CD0A 1OSDA 3LPEA 3BN4A 2F4FA 3KWMA 1VQKS 3OL6A 2HLTA 2ZZNA 3OUYB 2WK4A 2XSJA 4K4XA 2NYHA 3KLHA 4AQYJ 5A76A 2HZVA 2RDDA 5HP1B 2M0GB 2EI5A 3UR3C 1QAIA 3Q2SC 1FKOA 2CQ0A 1NMEB 3GFXA 1GT8A 4PQUB 2A3JA 2MJNA 2W9CA 3MXHP 4U67Q 1YBUA 2A2CA 4IG3A 2W2PP 4QPTA 2NSBA 4ICLA 2B4UA 1VQ9S 1NK4A 4GMKA 2JC0A 2UXCF 4EO8A 4KSEB 1X5SA 4WIIA 4ZPCA 5A6WA 1L5UA 4JI5F 5U47A 2F1FA 2HS3A 1HQEA 3M8QA 1OWXA 3PTWA 5GAHU 2JVRA 4IH5A 4ETXA 3SCIE 2LEAA 2HLUA 3TX8A 1TKXA 4DUYF 4PPZA 3MDFA 4IKAA 4F4XA 5SUHA 3JSMB 5KT3A 3WQPA 2VF3A 1XN9A 3D68A 1H2VZ 3C46A 3W1YC 2D1CA 1TFYA 4X65J 4DEZA 4JI8J 5I3QA 2G4BA 3JAMY 2E9TA 4L75A 2YKAA 4DR2J 1NDPA 4YFUA 3CJQA 1JLAA 1FRHA 2RUGA 4LF9F 4WIQA 1GXUA 4B3MJ 5IV4A 2PMZD 3LP0A 4LFCF 4YOEA 1OS5A 2MLZA 1Q82T 4B08A 1FRIA 4CLYA 3EPGA 2ZE2A 3M2UB 1VQ5S 2RSQA 4EUVA 1IR0A 1ZM9A 3R7BB 2KH9A 3M9MB 4ED1A 5A0YB 5H9EK 4DQSA 3BO2A 4G6VB 5L39A 3IR6B 3X1LB 4OZ5A 3I0RA 2ZH9A 1EP4B 1WSVA 2X1AA 2UP1A 2MB0B 3MOZA 3FEXB 1IUJA 2KB2A 2RS8A 2BQ3A 1XNQJ 2J7WA 1DRZA 2MKYA 4QW9A 2CPFA 2J76E 2HHTA 4YB6A 3G8QA 2UUBF 4LIWA 2IDLA 1U0HA 1SJQA 3PIOQ 2W2NP 2DTJA 2EFQA 2BKPA 4ZITA 4RJVA 4O23A 4DS5A 2XLIA 2JRSA 3N0VA 5D0RA 4X4VA 5G0RA 4EBEA 1C1CA 2EWHA 2RB7A 3MUMP 3UCUP 1XC9A 2ZBPA 3R27A 1RT1A 5IQQA 1WEZA 4WKRA 4TYAA 2AJ4A 4DR1J 2VU5A 2YPZA 4DV4J 1DURA 3PW5A 2QMUB 2GAGC 4DFJA 4Q2LA 2YXLA 1VRTB 3QSYB 3VQTA 2HZAA 3MUVP 1KKHA 2NXEA 3W5XA 3K5LA 3DNCA 3S7RA 4QIGA 3DDKA 1RT6A 3LP1A 3KLIB 1WF1A 1JKHB 3QQCD 3D54A 1ZA1B 1HW9A 2EFGA 3EVWA 2OIHA 4LSNB 3P5BP 4Y3CA 4OZ1A 2L48A 3GJRB 2DY1A 4CYUB 3OT9A 3LALA 1T9WA 5HQLA 4K0KF 2BJEA 5C42A 2VQFJ 5B0CA 3MMCB 4UUWA 3AJ1A 2HGMA 5HLFA 1EETB 4DR7F 1D09B 2AJFE 2M8HA 3R5GA 1WF2A 4DV1J 1K73T 2PD1A 1RABB 3PDNA 1XJWB 3M1VA 4C98A 2IRUA 1YRUA 4DOZA 2ZVIA 3DLLQ 2RRBA 1CS4B 1H6KX 3EJMA 1NLKL 1OY9A 3K5PA 3V81A 2W4CA 3CIZA 5AE2A 5H9FK 1RTIB 3VV2B 3ZZYA 3GQCA 2HIQA 2F8MA 4LR7A 2M4MA 1REVA 3BGRB 4ER8A 4K5RA 1YX2A 3L3CA 3FVYA 1UTAA 3VZIA 4OJ3A 2DNGA 2H4YB 1S59A 1U1PA 3D6MB 1S1WB 1HHTP 3KJFB 4WJBA 2QN6B 2AYEA 3CMQA 2QA1A 1KR4A 3RB6A 4CO3A 4EI2A 2Y3YA 1OPIA 1G4CA 5JXSA 3OTCA 3S8SA 3KUHA 4RW9A 1H74A 3DOMB 4JI7J 5EGYA 1X4BA 2M5YA 2DNMA 1FTCA 1CJTB 2XY6A 1S1TB 1EAYC 1RBOB 1U1LA 3MM8A 4RW7A 3OD2A 1KLMB 4ID8A 3ZZTA 2Q79A 3GIRA 4LT6A 2UVVA 2FYXA 3GFZA 1J5EF 1TMJA 3DU6A 1U26A 2JSXA 4WK3A 1QTMA 1V3ZA 3E01B 1S49A 3ISND 2QC3A 3M32B 1Q7LB 2JC1A 1BHNA 1IJEB 3ITHA 4J9RA 4DV6J 2RILA 1KTQA 2BX6A 5F8MA 2R7RA 3CD5A 2E5GA 4R0JA 4C8KA 1IR1A 3K5MA 3PG9A 2Y0SD 2DR5A 3EICA 2GJ2A 1GX5A 5F8IA 1NM2A 1HQ2A 2VASA 5JVHQ 3CDAA 3NS5A 4NZ0A 3Q2TC 3W7BA 2FJBB 3NCRA 1CJKA 3BV8A 1N6QB 4K4ZA 2L3MA 5A8WA 1CJVA 2ZM6F 4RNMA 4OYZA 4WXWA 2FB0A 2JZ5A 4C0OC 2FQQB 1XWLA 2OO4A 3HHLA 1RT3A 3BDPA 2CJ9A 3GG1A 3O1LA 2JEIA 2XI2A 1T05B 1T94A 3ZTQA 4DV7F 2X1BA 2WW4A 3LAKA 4ENOA 4XDCA 4OYMA 3QRRA 4ED4A 4Z2XA 1WDTA 4U7UD 3OLBA 4Y2MA 2XO6A 1LFPA 2OPQA 2DHXA 4J9SA 5KT4A 1WI8A 2V4RA 2B43A 1VDHA 2HW3A 2V8VA 3TP2A 4OI2A 1RTDB 1UAWA 2KT5A 5CXTA 2BXJA 2V34A 4CRJA 5J2PA 2KFNA 5J2QA 5E5NA 1QM9A 2COLA 3BR8A 5EX3A 1HW8A 3MFHA 3TARA 3GMGA 2XS5A 2W2MP 1U48A 1O0PA 3HHDA 2IY5B 1JB0C 3TAQA 2AYMA 3RTVA 2QE5A 3TZZA 2ZC4A 1NDLA 5HROB 1RZMA 1R8CA 1S1XB 3NG8A 2YKNB 3OHAA 2AHOB 4YB7A 5FLXU 2K1RA 1Q5VA 3CJ4A 2E5LF 1D8YA 3JSYA 3NNHA 3GPAA 3GYNA 4WBFA 1S77D 1OIAA 4Q7AA 3HJFA 5FJ4A 4ZJQA 2V4QA 4EZ9A 1MN7A 2EG1A 2B0GA 1S72S 2J7KA 1JX4A 3HP6A 5D77A 3MPYA 1RAIB 2SXLA 3TOQA 1ULRA 4EMDA 2BE9B 1LFWA 1SH2A 3B54A 1NHKL 4M1KA 4B3OB 5CYMB 1JQGA 1FD2A 1VRUB 4DFPA 3LP2B 3RB3A 2HMIA 3MECB 2B5JA 1IXKA 3CMAS 5HO4A 1LXNA 5KT5A 5KT2A 1RT4B 2WB4A 2C2EA 3R5DA 3AD8C 4IG0A 1M5PC 2OPPB 3G86A 1NSAA 3T3FA 3VGUA 2P5VA 2B9XA 3DM2A 1RWXB 3R5BA 4MKYA 2L9NA 4B3SF 2BZ2A 2G0JA 2M9KA 1N0UA 5IT9Y 3I9V9 3TO8A 1SKUB 4WU2A 1RBLA 4UT4A 3J81j 2P2CB 2RUSA 1VK8A 4CM0A 4ATNA 4DU7A 2GQCA 4LRDA 2NZ4A 5LSOA 1U24A 2YNHB 1RHKB 3A8JA 4ITSA 2KHDA 3M30A 2Z4PA 5HMXA 3DMJB 4DMZA 4NLWA 4OX6A 4DFKA 2GVDA 2MKCA 4KPYA 2XMTA 2BQUA 4MH8A 2VA3A 1EKSA 4P72A 1QSSA 2ZC3A 4H54A 1U25A 2HURA 5T7LA 1JNZB 3BPDA 4NLPA 2BE2B 1S76D 4QWAA 2Y1JA 1I51B 1H3DA 5HJXA 2Q66A 4HI2A 4N5SA 2CNLB 4M5KA 4NOHA 3QAEA 4EWTA 5IZHA 4Q43A 5KFFA 1GX6A 3TEGA 3FSIA 3LGNA 3LO3A 1OY8A 1UVMA 3IC1A 4OZ3A 4NLDA 4JI1F 1P27B 3ZNUA 3ZZPA 2DGVA 2OEJA 2HNDB 4DJBA 3D67A 1RT5A 1NJZA 3IWNC 1JLQA 4ZOSA 4UY8T 1RCOB 4B3RJ 3BREA 3C3LA 3PFOA 2VG6A 2MKJA 4ED0A 1X4AA 3K2YA 3FCVA 1SH0A 4ZVUB 1IJFB 2ZBQA 1KONA 2G0IA 3P5TL 1HBOB 1AFJA 1YJUA 3ZZ0A 4MIAA 3R9LA 4B3TF 1TUGB 2QA4S 2V2ZA 4DR5J 3ADAC 1MU2A 3CGIA 3HD1A 1Y00A 4URQU 2GV1A 1DQAA 1MWZA 1GMUA 1SL2A 1X0FA 1OJ4A 2GS8A 3TAPA 1UVIA 3MEDB 3V5RA 5AXMA 3DCAA 4KHPJ 1BQXA 3LUYA 5DJBA 3AOAA 4K4TA 4YY3J 2RF2A 1S48A 4JYAJ 2V0NA 4C2MA 1HMVB 1IM4A 4ECXA 3OFHA 3MM5A 2IJRA 3MR3A 1BQNB 2ACYA 4F2SA 4NZ6A 1R6VA 2XO7A 1WD6A 2VFSA 2ROEA 4USWA 2RHQB 3NAIA 1A7GE 5K8MA 3A8KA 3KJVA 4Q0BA 3MAAA 2YPYA 3S01A 2X51A 1R8PA 4E2FB 3B6BA 3GONA 3I87A 1VBKA 3W65A 3MMBA 4DL5A 3HHEA 3M2RB 2VD3A 4LF6F 3QT5A 1H2TZ 2C3UA 3LH2S 3A8IA 1YSJA 3I5AA 2ZD1B 2Y1IA 3MR7A 1HYSB 4YUDA 2DO0A 4F0HA 1HLWA 1U8WA 3D5MA 3SFGA 5IXUA 2DRBA 5DS7A 4DPTA 4QIWD 4NYZA 3QFHA 3AJ2A 3KG1A 2RU9A 1FKPA 4DV3J 3GV7B 3TNVA 5EHHA 5AXNA 2W4PA 1N5TA 4TY9A 4RO0A 1N4LA 1H72C 3KTQA 4DR4J 1D9FA 3SYZA 1GMWA 2Z56B 1VQSA 2C42A 2F5GA 4BBYA 1EHWA 5E33A 1BC6A 2AU0A 3CT9A 4URGA 4RR5A 2XMUA 3T6JA 1X8DA 1Z2LA 3CNQP 3X3UA 1H0HB 1HBNB 3HVTB 3I0SB 5L9XA 4FDFA 1PSDA 1L3KA 1RYRA 2K3KA 4DR3J 1RT7A 1R0CB 3SFUA 2CPYA 3GR1A 2G1DA 3H42A 2LECA 3GFHA 2FDNA 3AH6A 2D3OR 4WXOA 2XSFA 2OKQA 5CHCB 1PIEA 1ZS6A 2AMCB 2CNKB 3CC4S 3VALA 4HACA 4L76A 2VG5B 1Y9OA 1R89A 3HMJG 3RGIA 1EX8A 1WHVA 1XBWA 5F8NA 5A8KA 3HZGA 4G1QA 2VIHA 3MM6A 4TY8B 3TAMB 4QYRA 3NP5A 1LW0A 2DVIA 4DPOA 1NSQA 4EBDA 1LW2B 4QR2A 1OMSA 5ETLA 3CDBA 2GIQA 2O5DA 4EEYA 4ZPTR 2X1FA 1H7XA 3FBEA 5KFJA 1JLBB 2YBVA 1N34J 1VLYA 4DS4A 1K8AT 1TL3B 2ZJQQ 2W9BA 2JEJA 4WE1B 1AT1B 1NO8A 2HHPA 1W7WA 3F41A 3CE8A 4RLEA 4OZ2A 5DQIA 1V5VA 4X4UA 1T9UA 3VWSA 3BQ0A 3KKFA 1KOHA 2CAJA 2U2FA 3M9OB 1F1BB 2GFFA 3P8BB 3WX8A 3C16A 4C3KA 4JV0A 3HKWA 1RCXB 5KFMA 1RWOB 4RW6B 3B78A 1W26A 1TK0A 3DI6B 1FWPA 2XS7A 1T0TV 1SC1B 4AFFA 5RUBA 4HR2A 1FHTA 4LRAA 4U96A 4L73A 5FD1A 2JOQA 4A8FA 3J81U 3CMES 4OL8A 2YKPA 1T03B 1DJ0A 1S0NA 1Y5LB 1X4EA 4IDKB 1SXLA 4XO0A 4BWMA 3WZ0A 3AJDA 4MAKA 2EC0A 3QIPB 4HVZA 2OH2A 1GMVA 5L1JA 3RB0A 4CO4A 4X4NA 2CZ4A 4YR0A 2BJ8A 3PX0A 2CNOB 1T3NA 4DQQA 1CSJA 1Q7YT 4M5MA 2XZTB 2KZMA 3M8ZA 3PYGA 2ZKTA 1LXJA 1JLEB 3OL8A 2R2SA 5HN0A 1F5CA 1RAHB 2R8IA 5L38A 2KYXA 2HWHA 2IBOA 3ENVA 2GMJA 4DV0F 1AFIA 2FVSA 4CLWA 2QV6A 2Z0GA 4M5DB 1RK8A 3AY0A 3SCLE 1WEYA 4QPXA 1HBMB 1M90T 2QRRA 1YJTA 3MMAB 1GXLA 4KFBA 5CYQB 5L9NA 2BRLA 3G6ES 2WSCC 4KB7A 1SL0A 1NK6A 3NKYA 3NCPA 2C28A 2XMVA 1NKEA 4P74A 2ZZTA 4HLBA 1IKWA 3DLKB 4MIWA 4ILRA 2B4VA 4KGKA 1U1NA 4ZVRB 3HI9A 2ZKUA 4NXNJ 3BSAA 1RB0A 2JFDA 4LSZB 2QFJA 2KKHA 1XR5A 1N32J 4DCJB 1SIZA 4NCGB 5EDWA 2I8EA 2HEKA 2WBMA 2P9GA 1PYTA 2DXFA 2E7VA 2LEBA 2OFHX 5L8RC 2BR0A 4WFAQ 3ZTSA 2QFIA 2VC1A 2DH7A 4OX8A 3KDNA 1NB2A 3BPSP 1R8HA 4KR0B 4QWBA 4YB1P 3MCOA 1LWFA 2HHSA 2HAIA 2HK3A 3PJXA 1RISA 3CDUA 3D1HA 1NZ8A 1DAXA 3GIKA 4DSIA 2UUTA 4K5SA 1WUUA 1X4FA 4H4OA 4TU7A 3IR7B 3P6YC 4UZBA 4R5PA 3OJUA 4D3HA 1M5OC 3MOJB 3PR4A 2LDIA 3MI7X 4WP8A 5G4DA 3WIVA 2R2RA 4ZLPA 5IFMA 2VV5A 4QZVB 3JQJA 3UVJA 4P7VA 3LF0A 2WSFC 3MPWA 2QMXA 1VQOS 1JJHA 1S1VB 1VRTA 1KOOA 3R5CA 3UN5A 3AODA 3DLJA 3G2XA 2HGNA 3ZZOA 2N4DA 2DCLA 4USIA 3KLIA 4EYHB 1JKHA 1SH3A 3CJ5A 4RW8B 4JI0J 1U2RA 2LQBA 2VJUA 3KLFB 4JV5F 4X4SA 2A2DA 4K59A 1U8SA 4LSNA 1KP6A 4RUAA 1HPZA 4I6AA 1R0BG 1ITPA 2MY7A 3DOKB 1FI4A 2XCAA 3OVAA 1GTHA 1V6HA 3N5FA 2UVRA 3NNAA 2F8EX 4J9KA 3UE2A 3DRPA 1N88A 4X64J 5KFSA 2FHJD 4WFBQ 4LFAF 2KTQA 5GADU 1FESA 2D74B 2IM1A 1WF0A 4LMZA 4ZCMA 1UEVA 2MYFA 2WB1D 4N8NA 2N7CA 2VPYB 1EJ7L 2NUUG 3GLJA 4JV2A 4NI2B 3AA9A 1S4EA 1UPMB 3DHWC 4HL9A 5I3UB 1S57A 1U1QA 4NXMF 1Y7PA 4FYYB 1ICEB 4FNHA 1L3UA 1S12A 2HRUA 2RMLA 4L3NA 5MAOA 2WOMA 4B9SA 3FGVA 4PG8A 3OQ2A 3DOLB 4DUZJ 1Q8IA 4IFVA 3EVOA 2EVZA 2YNFB 4DDFA 1YK9A 1NK7A 4DL2A 1TMMA 2IDEA 1NRKA 3W66A 4A48A 2FTRA 4O44B 3HKZD 3JB9k 1Q0NA 1RAOA 2OMLA 3UDCA 2BV3A 5HVHA 4Y00A 1FXLA 1E6YB 1FDDA 2BYCA 4UOGA 3ONQA 1CJUB 2W1BA 1F3VA 2LMIA 1R8BA 3DOMA 3OR2A 4O0NA 2LCWA 4IQXA 2YX7A 3IM8A 2UXBF 4MK7A 3JYTB 5KTQA 2YTCA 1S1TA 2OSRA 1YGYA 1X4GA 5F41A 1XMBA 3KHHA 3P96A 1SCJB 4IFYB 1U2FA 4PUOB 2UV8A 1Q81T 4F4AA 2JEFA 2ZUGA 1SJ3P 5HBMA 3W9IA 5IWAF 3HXMA 1SC6A 2R7XA 3E01A 2XCPA 5KFQA 3ZTOA 2XYGB 3M32A 1S0MA 1P6TA 2NYIA 3WX4A 3PO4A 4UOCA 2RT3A 3OXLA 1KBRA 4NLTA 2QIFA 4Y65A 1WSRA 4NPOA 2C22A 1NXIA 2MZQA 4K4SA 2Q3PA 4OHZA 4QR0A 1X9MA 3LAMA 1X4HA 3SDEB 1KC8T 2MQQA 1BGXT 2DGWA 3FFIB 4ID5A 5K8OA 4X4OA 1MSWD 4OX9F 5J1EB 1HNXF 4ECZA 1U7LA 3PJWA 1KD1T 2EPIA 3RB4A 1JLFA 4OLOA 2EXUA 2IIHA 1T05A 4K4YA 2H9ZA 3TUZC 1UW9A 3ETMA 3GIMA 2B9WA 1AW0A 4JI2F 4Z37A 2XNQA 3R7SB 1HARA 2RDJA 2WVBA 4LJMA 4EYIB 2HVIA 1FJ7A 3QNWB 1URRA 4USUA 3J7YU 1C0UA 5DM7Q 5F8HA 3W61A 2VFTA 5DRKA 3V4MA 1PBUA 1U1KA 1VBXA 3D7SB 1RTHB 5CZXA 4TXSA 4GKJJ 3R2DJ 1K1SA 5SZTA 4LRBA 4IR1A 3FQKA 3EXYA 3AQPA 2ZVSA 4ZPBA 1RTDA 1U47A 1MROB 4Q5VA 3A4TA 2LA4A 1VQ8S 3CXCR 3K59A 4LFBF 3GIJA 2AKWB 1N33F 1HWIA 3A8EA 3NGTA 2N3OA 2HHQA 3WDOA 3SSRA 3PYDA 4F4ZA 4H4MA 1VK3A 3KYLA 5LSLA 5J1NA 5IC4B 1CBKA 1VC5A 3EUNA 3NS6A 1AUDA 1J5OB 5D4PA 1R3NA 3N4WA 2VICA 2R42A 3C6UB 1XR6A 5EUHA 1DTTB 1HWLA 1REGX 3HCXA 2YX4A 2DNYA 2CQPA 3R1LA 1LNQA 2CPIA 4LVNP 1GK8A 3OPKA 2DR7A 1P9YA 2H5JB 4X4TA 3F73A 3N6MA 4F26A 4RU9A 2I1RA 3BBBA 4EBCA 3BZQA 4KPCA 2J0SD 3MEGB 1WTFA 3Q8PB 2GIRA 3R6LB 4RUCA 2Z2ZA 2FHOB 1SV5A 5CA5A 1VBZA 4ED7A 3HULA 5KFVA 4MYTA 4IR9A 2DD8S 2NREA 8RUCA 1VC6A 4B3OA 5CYMA 1VRUA 4ZCKA 3IG1B 1VMBA 1C1BB 4BC7A 2QLBB 2G9OA 4Z7CA 5IS2A 4J7CA 5KG3A 3MECA 3KJQB 2IJNA 3T9ZA 2H1YA 3LWLA 2HYIB 3UD5A 2BANB 4ZLLA 4N41A 4ELTA 4WP9A 3S6EA 2CYYA 2XNRA 3NOGA 2OPPA 2CZVC 2MHEA 2CJKA 4UTGA 2RH3A 3HD2A 1TELA 4X84A 1JXVA 1N56A 2R8GA 4LF1A 4OV6A 3DLEB 1WWHA 1NK0A 4C8LA 1S4FA 1ZOTA 3BQ1A 2IMOA 1NJIT 3VR1A 1EQ0A 3NBPB 4WP3A 1WC6A 3V6DB 3BR9A 4DL6A 3KDOA 4BC9A 1LKZA 2BUNA 2D3ZA 1WHYA 2DYAA 4ED8A 5B0EA 2ROPA 2V67A 1FTRA 3HT0A 2QEXS 1TKTB 1IKXB 3T1YJ 3DMJA 3OR1B 3EWGA 1M1GA 3EGVA 3R97A 4X66F 3D28A 1U6FA 4HYKA 1AA1B 3HT3A 3RAQA 2EC2A 2BKNA 2HHVA 2UUCF 4WKYA 1YJWS 2XHWA 2MZSA 2PI5A 1C0TB 2LFVA 2G13A 3HK2A 1OYEA 1HNIA 1UJ5A 2VQEF 1OSCA 1NPKA 3CCVS 5LT5A 1WHXA 4AXIA 3QAUA 2H5IB 2B6AA 2EFPA 2DHAA 2DISA 2W24A 1B0VA 1JLGB 5C2GA 1UW4A 2HFSA 1F9HA 1PYSB 4JI3F 4YQWA 1MNEA 5KG0A 3FDSA 5HQMA 5D0HA 4P75A 4DCPB 4O4GB 3R7NB 2JDJA 3NY0A 1SKWA 2CJQA 3LGMA 1QJHA 5C7PA 3AHPA 5DGAA 1RGVA 2HNDA 1HI0P 4DQPA 2CNNB 1X31C 4C48A 3ENAA 4KKOB 2ATCB 3FNNA 3DKDA 4ZN3A 5BXIA 2AV5A 2X3DA 1TL1A 1HBOA 3FJ2A 1OQ3A 2XWYA 1FJGF 2PGCA 3A13A 1KTVA 1ZTTA 1SJFA 2MGZA 4B9MA 3DLBA 3V4IB 2UVUA 3FCWA 3NLCA 1YJ9S 2OPSB 1RTZA 1JJCB 3KLGA 2YNIA 4J9VA 2FHKA 3DHXA 2WW8A 4ERDA 1B0TA 3K7RA 4OZ0A 2J9DE 1B70B 1TQLA 2RS2A 1XNRJ 4DZ6A 2BBEA 2YQ0A 2WVEA 1B0PA 5HANA 3UFCX 4Y6IA 2CWKA 3MEDA 1GQEA 2V8HA 3AFGA 4I2PB 1HNVB 1HMVA 3AXKA 1HI8A 3CCES 3TJAA 3KK2B 1D3WA 2YQ1A 3PY8A 1FXRA 4LF8F 1VHFA 4QU6A 2UUWA 3E8OA 3L95X 4NLOA 4QR1A 3TVKA 3QGIA 1IWAA 2Y0BB 1RE1B 4ZCIA 4FXDA 3TVZA 5J1PA 4JB8B 2KM8C 2GMHA 4PXEA 4CH0S 2BEFA 3M2RA 3HVAA 2O3DA 4PXCA 2R2TA 4PG7A 1RHRB 4LF4J 3CCQS 1EARA 1HNZJ 3TX0A 3BYRA 4DX5A 2O66A 1HYSA 4FYDA 5ETMA 3VAMA 1N36F 4IUFA 3NMRA 1U6ZA 3CJKB 2DY9A 3T5JA 5K9FA 4DLEA 1NK9A 1SQEA 4YEAA 1T02A 1T11A 5B0AA 5AXKA 4HTJA 4PPDA 1Y5NB 5L1KA 1RU2A 3JQMA 4F04B 2MXYA 3UNYA 1FJEB 1EKRA 3W60A 3JS9A 4LBPA 2A6MA 3BGOP 1VIXA 2BDPA 3OTOF 1H73A 1TL7B 5LXRA 3QLHB 3IBFB 4DHVA 2D3UA 5CAAA 2HK2A 1T3OA 2RE1A 2DXEA 5CABA 1LQ9A 4CT8A 1IBLF 2DEJA 2QYCA 4QW8A 3VQSA 2KT2A 5LL6d 1IKYA 4DPYA 1WTBA 3BGFA 3I0SA 2RRAA 5HAOA 3D6TB 1ZZNA 2AEJA 4C8OA 3MAQA 5DLGA 1X4CA 5HATA 4CLPA 1LWCA 5A8RA 2ERRA 4MFBB 4RL1A 1KHWA 4CNYA 2HHWA 5D3GA 1HNWJ 2VG5A 5LMNJ 4JI6F 1I1GA 4OYOA 3RBDA 1NDKA 4MTPA 4WFXA 1MMNA 5C24A 3KG4A 4LF5J 4E8UA 3QWUA 2XSJB 2XGQA 2DHHA 2CZ9A 4CO5A 3KLHB 2GHWA 2JLGA 2C3PA 3EGWB 3MD3A 1VQYA 1NSPA 1NH8A 3H20A 2VFRA 1DY3A 1AZSA 4TU9A 5JJBA 1FKOB 2RQMA 4PXDA 4U7CA 4QQBA 1XMQF 2W9CB 4FKXA 4KGVB 1OPZA 1Q95G 5I42A 4IG3B 3U02A 5B0BA 2ACMA 2KVQE 3RYLA 6FD1A 4LF7F 5IV3A 4FYXB 3GIIA 4DQIA 1L3VA 2JLFA 4Q8FA 1HQEB 2F65A 4CLTA 2R7VA 4X4RA 3H8YA 4TNOA 1YIJS 1M5VC 2HWIA 1ZM4A 4H4KC 4S0MA 1YI2S 1FX4A 1TKXB 4DR6F 1RWVB 5HSPA 3KK1A 3TEHB 2MZJA 2OAUA 2DNNA 3M8WA 3AOCA 4NRTA 5E41A 1RHUB 1P9QC 1FXDA 3N79A 4WTOB 2MLYA 4KHRA 2B7BB 4C8ZA 2E1AA 3DXSX 2E9RX 4IDKA 1JLAB 2ILZA 2ZH3A 2AGPA 1KFDA 4CIOA 3LP0B 3RBZA 1S9EA 5KT7A 3IS9A 2UXDF 2YWEA 1FEEA 2ZE2B 4K50A 1Z4UA 1TZ0A 3QATA 4ZKAA 5B7WA 1RYSA 1UJ4A 3J80U 1IKVA 4X4PA 1CC8A 1YKWA 1GEHA 1I6JA 4I4BA 1U6BA 4OHXA 3HPOA 1LOUA 2RAQA 2PEBA 4DF4A 2I2YA 2F4VF 2Z2LA 6AT1B 2QL7B 4WU3A 1UMJA 3DLGA 3RRKA 4BHQA 2VA2A 2VFVA 4TLRA 3PRBA 1F5AA 1RAAB 4JP8A 1U0HB 2FIUA 3BQ2A 4RNOA 4MT1A 1TAQA 4YN3B 3J7ZT 1WC3A 2PC6A 3QGHA 1HBMA 3IO1A 3L7UA 1VGYA 3PO5A 2HSEB 4CLKA 3MM9B 4NL5A 4JI6J 5G0RB 3BH6B 2VONA 1C1CB 3TW0A 3BN7A 1LV5A 1QUVA 1WEXA 4M5IA 3UQSA 4RNNA 1Q5YA 4ECSA 1CLFA 4P9SA 1XMOF 3BBFA 3R5AA 4BDPA 2CQGA 3P49B 4NCGA 3U1LA 3BB5A 4HDGA 3PRVA 1NK8A 2QLJB 2G2ZA 3KMSA 3ELHA 4V19J 2F9JA 1M5HA 4I7FB 2R7WA 1HR0J 5K20B 1OQ6A 1M1HA 3QT7A 4C11A 2PI4A 2QX0A 2N4CA 3LP1B 1RT6B 1QSYA 2YWWA 1IWGA 3B8HA 3BKTA 5F3TA 2V9KA 1JXEA 2UU9J 2CG4A 4DV5F 1FA0A 5GAGI 1KVJA 1RWWB 2LDYA 5C42B 1WG5A 4I67A 2ZH4A 2HQDA 5HLFB 5DO2A 2MZ1A 1B3TA 2DRAA 5KFEA 2MKHA 3W2VA 2CQ4A 1SI9A 4ED5A 2FHJA 5KG4A 4WZQA 1SKSA 1NHVA 1KDNA 2OELA 2KM8B 1UPPA 2R7OA 2BE7D 1FVQA 3CJ8A 3DN9A 4DV2F 2Y1LB 3UDLA 4EU0A 4B9VA 3NRBA 1N5YA 1W2BR 1SKRA 4CLUA 4OJ1A 1A9NB 4CP5A 2YWFA 3V81B 3OTBA 3RRHA 2HHHF 1HHQA
chains in the Genus database with same CATH topology
3OR1A 4J9QA 1K8AT 1RDRA 1TL3B 2M88A 4I64A 1S1UB 5KFOA 2ZJQQ 1Y0HA 3FSYA 5AE1A 5DQHA 3H2UB 1SV5B 1HQUA 2W9BA 2JEJA 4ZHRB 4ECVA 5GADI 2I0XA 1O8BA 4WE1B 1Q4RA 4M95A 4Q45A 1NO8A 2HHPA 3TVYA 3CULA 4AYBD 3F41A 3KHLA 2IM3A 2MPUA 3CE8A 2ZOMA 4RLEA 3PR5B 2L9WA 5DQIA 4DR5F 3OV7A 3TYTA 2IA6A 2CPXA 2CQDA 4F3OA 1PO6A 1UWBB 1QLNA 4X4UA 1REVB 4HDHA 3K8WA 3VWSA 2IYIA 1KS2A 2R7UA 4E98A 3BQ0A 1HD1A 3KKFA 1RI7A 3IN5A 3PV8A 3MTKA 1KOHA 1HBUB 1ZZFA 5M2UA 2VODA 3LANA 3O44A 1RKJA 2U2FA 3M9OB 1Q78A 2GFFA 2CQ1A 3PW2A 4ECWA 1S0VA 5KFGA 4WCEQ 1C0TA 1G6BA 2VG6B 2IA0A 5KG2A 4KHPF 1NZAA 1N6QA 3KOAA 4F02A 4C3KA 4YY3F 5C5JA 3PKYA 4JV0A 1QSLA 3HKWA 4JYAF 4DBQA 5KFMA 2XI3A 4MMOA 4NLXA 5A2QY 3O5TB 4AL7A 5JUMA 4RW6B 3B4DA 3FRYA 3IAS9 3EYZA 1QVGR 3B78A 2AF6A 3T5LA 2ROGA 3PIPQ 1V3RA 1TK0A 1TL5A 3DI6B 2AJQA 2HQIA 4YHHF 2XS7A 2FPHX 4NWBA 2YKOA 3QJLA 4LSLA 3I6PA 4AFFA 1RT2B 4Y28C 3MR6A 1QE1A 3N6NA 3PHEA 3V6KA 2GA7A 2XG8A 3MHYA 3I55S 3GV5B 3PW4A 1FHTA 2IC3A 2P9CA 2L41A 3HHNB 2XULA 2AW0A 3NGDA 2E1RA 2YX1A 3DRSB 2ZZMA 2K7KA 3FCHA 4HTIA 2ASLA 3O2IA 3W2WA 3Q22A 2J0WA 5FD1A 2YKMB 1UVKA 2F3JA 2JLEA 3OSPA 3M8PB 1P1TA 2V5HG 3CD7A 2JOQA 2WONA 4A8FA 3MM8B 3CMES 3WC2A 5GAHI 4OL8A 2YKPA 1T03B 1DJ0A 3N01A 1S0NA 4TU8A 1S6PA 2RQ4A 2AP6A 2DBBA 4XPCA 1Y5LB 1X4EA 1KFSA 3KHRA 1H2UX 4Y2KA 4IDKB 5CZVA 1SXLA 4P2SA 1QUPA 1S99A 2AX1A 2JJ4D 3P3DA 2DGTA 4XO0A 2E44A 4ZS6A 4BWMA 3WZ0A 3ETOA 3CF5Q 2BACA 3C6TB 3CSKA 2W4DA 3BO3A 4FPRA 4MAKA 1NJXA 2EC0A 3HHKA 3QIPB 4HVZA 4I6YA 5L1JA 3PX6A 2OH2A 3GV8B 2WTFA 1M5SA 1YRXA 1DZ5A 3BM7A 5HQ8A 4A8QA 3RB0A 1KSPA 4KKOA 2B9YA 4O44A 1X9SA 2C3MA 1UKUA 2CIMA 1FJCA 4CO4A 4FXVA 4ECTA 2QLXA 2R4FA 2DT9A 2DO4A 2CQIA 1M1KT 3ITHB 3NMAA 4FN5A 1VQNS 4X4NA 1TFWA 2J0QD 2CZ4A 4YR0A 5EWGA 3PX0A 2DR9A 4DV3F 2XMWA 2AWZA 3KJVB 5KOWA 5KG1A 1S6OA 3CDEA 3HX9A 4N47A 1T3NA 3I96A 4DQQA 1CSJA 1Q7YT 5F8JA 3MM7B 1FRLA 2U1AA 4J5OA 3V4IA 3C66A 1XEZA 3VAHA 1HWUA 2KZMA 2OPSA 2BM1A 1DLOB 2ZKTA 4DR4F 3H5SA 2KJVA 2W25A 1LXJA 3BSOA 1JXLA 2MKSA 2ZH6A 1ZTWA 1JLEB 4FF1A 5KFPA 3TA2A 3OL8A 2KFYA 2R2SA 5HN0A 2MQPA 1Q79A 1F5CA 5EN1A 2FJAB 2D9PA 2R8IA 5L38A 2KYXA 2HWHA 2E29A 2IBOA 1QAXA 2V9WA 3ENVA 3D2WA 2GMJA 3M2VA 1HNIB 4DV0F 1AFIA 5KFCA 2FVSA 3CUNA 2HWTA 4A47A 5A8WB 2QV6A 2Z0GA 1V3SA 3CIMA 1RK8A 4M5DB 1PGZA 1Z2ZA 3H25A 5HROA 5ADZA 4OZNA 3AY0A 3SCLE 1S1XA 2YKNA 2AYGA 1WEYA 4ZDNA 4OI4A 4QPXA 1HBMB 1HNVA 1NH7A 1SIWB 2RDIA 4PUOA 3SV4A 1UETA 2QRRA 1M90T 2B6AB 5E0OA 3BS9A 1HR0F 1FKPB 1B7FA 2R9LA 3ISZA 1YJTA 3TR5A 4AL5A 1W2IA 2IAJA 2BA9A 3MMAB 3OXGA 5AE3A 1GXLA 3HM9A 3IR5B 4KFBA 4QOTA 1ZM3A 3R3TA 4HI1A 5CYQB 5L9NA 2BRLA 4FS2A 3M05A 2GMLA 2WSCC 1WG1A 4KB7A 3CJ0A 3G6ES 1U45A 1SL0A 1NK6A 3I5BA 3NKYA 3EPIA 4F4YA 4DR3F 3U1NA 2XLKA 5BYQA 3NCPA 4WFZA 3U7JA 2C28A 1P8GA 1N54B 2XMVA 2Y1RI 3QMQA 2MDAA 4WK1A 2FVPA 1NKEA 5CCMA 2KRRA 2B7CB 2ZJPQ 4GC7A 1ROFA 4HLBA 1K0VA 1IKWA 5IT4A 4KTQA 3DLKB 2W8KA 4MIWA 3H2LA 4ILRA 2ZJRQ 2B4VA 5D78A 3OTDA 4KGKA 4PXBA 4RNFA 1U1NA 1V9OA 3HI9A 3C2PA 2YNGB 2ZKUA 4OI1A 3BSAA 3DYAB 2MQLA 3IRWP 2UU9F 2DIUA 3MEKA 2JFDA 4USJC 2NPIA 3AB2B 4OZJA 2QFJA 1Q1KA 2KKHA 3EXCX 4DWIA 2IJFA 4A8MP 5KOXA 1XR5A 3OW2R 2R8KA 2CQ2A 1SIZA 4NCGB 5EDWA 2I8EA 4K4WA 3DRRA 2WBMA 2P9GA 4R25A 2C3YA 5J2MA 2NS1B 4WFYA 3H98A 2LEBA 2KVIA 2OD6A 2OFHX 1KN6A 2OPQB 2VBXA 3POTA 2V4JA 5L8RC 2BR0A 4Y34A 2GC8A 4WFAQ 1TP7A 3IGNA 1U1RA 1DBDA 2VC1A 2DH7A 4C8NA 1S97A 1UFLA 3SDEA 1G7CB 4OX8A 1TL1B 3TQ1A 3TUIC 4C9DA 1FDAA 1R8HA 2DGUA 3LP2A 4OMFG 4OJGA 4KR0B 4TKTA 4QWBA 3UR0A 4TLQA 5FLXY 2Q6BA 4YB1P 4XPEA 1RT7B 1S6QB 2UUAF 4FVMA 3CJKA 1LWFA 2KRBA 2RKIB 2KXHA 3KFWX 5GMKa 2N82B 2QLWA 4ECRA 2HHSA 3O6QA 2HAIA 2L9DA 1AROP 3PJXA 3PZPA 4ZPVR 1E6VA 2XS2A 1RKIA 5E3AA 1BQMB 5AJ3F 1RISA 2MGZB 3K57A 3CDUA 3D1HA 3J7YI 5J2PB 1DAXA 2KJWA 3GIKA 1H7WA 3R1HA 4DSIA 1X9WA 2J9EA 3VAFA 1RT4A 1VJWA 2UUTA 1X4FA 4K5SA 3OL7A 4NA2A 1TAUA 4F50A 3KLGB 4H4OA 2YNIB 4J9PA 3CC2S 1UEUA 4TU7A 1O51A 2QT7A 3IR7B 2HG4A 1K0TA 4AXJA 1FDBA 2JEGA 4M94A 4OLPA 3P6YC 4CQ1A 2WBRA 1VQMS 3J7A1 3OTEA 3T5HA 1QVFR 4R5PA 1JJ4A 3M6WA 3OJUA 2HVHA 4QIVA 4W92B 3IRXA 3IXQA 2HQ3A 3QO9A 3WC0A 2J5AA 1N34F 4D3HA 2IVYA 1HI1A 2PDAA 3DDNA 1M5OC 2DNOA 2LLZA 2VG7A 4OJHA 3AA8A 3DC2A 3CPWR 3MOJB 4QCLA 3PR4A 2LDIA 3MI7X 2FC9A 3IFEA 3TI0A 5G4DA 2QO3A 4DG1A 2R2RA 3ISNC 4ZLPA 2RU3A 1ZPWX 5IFMA 2HNYA 2VV5A 1N5VA 4YDXA 2QA4G 4QZVB 4G1QB 1FEHA 1WI6A 2K1RB 4P7VA 2Q43A 4WF9Q 4KO0A 3T1HF 3LF0A 2WSFC 3S1TA 4RW4B 1URNA 3MPWA 5GAGU 4AE5A 5F3ZA 3QWPA 2QMXA 1VQOS 1JJHA 1S1VB 1RTHA 4QJVA 1VRTA 1KOOA 2FVCA 5B09A 5KFIA 2VPZB 3R5CA 2R8HA 4KAIA 4EGLA 1KQKA 2EW9A 5LJ3Y 2HHXA 4B17A 2PO4A 3D0IE 1CEZA 2EK1A 3DLJA 4PG6A 3O3LA 2HGNA 3ZZOA 2N4DA 2DCLA 2ZBIA 2YNHA 1FK9B 1YWXA 4USIA 4CZCA 5M2PA 2DH9A 3OJSA 3KLIA 3K5NA 4EYHB 1JKHA 2OTLS 5KFZA 1SH3A 3CJ5A 4F4KA 1D0EA 3CEDA 4RW8B 4MIBA 1U2RA 2LQBA 3KLFB 4JV5F 4QWEA 4X4SA 1N5SA 4DSLA 1MROA 2A2DA 4K59A 3CD6S 2FVQA 4GKKF 4NYOA 1U8SA 5CQGA 4LSNA 4RUAA 2VH7A 4ETZA 2XB2D 1DTQA 1HPZA 4U6PA 3ZZUA 3Q24A 2F7VA 4I6AA 1S10A 1N8RT 2VPWB 2HNZA 1I94F 2MY7A 1VQ7S 3DOKB 4V19X 5D4OA 2XCAA 4PCQA 2BW2A 3SV3A 2E5IA 3OVAA 2DIVA 4G1IA 4M63A 3U27A 3CD0A 1GTHA 1OSDA 1V6HA 3N5FA 5BYSA 1JLCA 3CCSS 2UVRA 3NNAA 2PFFB 2F8EX 3BN4A 3KWMA 4MK9A 1FCAA 4J9KA 2B5JB 3SCJE 3DRPA 3UE2A 1VQKS 1N88A 3OL6A 2DNKA 2FHJD 5KFSA 2XEXA 2BE2A 2D9OA 4WFBQ 2HLTA 5KFNA 2ZZNA 3C6UA 3OUYB 4LFAF 2WK4A 2YWHA 2KTQA 1F5BA 2LYVA 2XSJA 2KYZA 5BYRA 2W9AA 5GADU 3Q8QB 1FESA 4K4XA 2DNLA 4GO5X 2D74B 2IM1A 3KLHA 1NB7A 5GVQA 1B64A 1Y4ZB 4A8SA 1WF0A 4PRFA 4LMZA 5HP1B 4ZCMA 4IG0B 4UQTA 1UEVA 2M0GB 2MYFA 3VZHA 2EI5A 1UVLA 2KXFA 2WB1D 4N8NA 3UR3C 1QAIA 2N7CA 2B51A 2FHMA 2VPYB 3MTJA 3Q2SC 5B0DA 2MQNA 3O8WA 2NUUG 4C4WA 3UD4P 3EGZA 2VL1A 2J6TA 1UVJA 4JV2A 3I4HX 4LSLB 4WYLA 1Q86T 1FKOA 1QE1B 2CQ0A 3AA9A 2R7QA 3GFXA 1GT8A 3DHWC 4PQUB 4FS1A 2A3JA 4HL9A 5I3UB 4PKDB 3G6YA 2MJNA 3VTIA 1R27B 3W2WB 2W9CA 5FDLA 1U1QA 4NXMF 2CRLA 4F8RA 3MXHP 2ZH2A 4U67Q 3BF4A 4OHYA 3CCZA 1Y7PA 2A2CA 2M52A 4IG3A 4FNHA 2VBYA 3MEEA 5F0WA 1KNZA 1L3UA 4QPTA 4J9NA 2HRUA 2NSBA 4ICLA 2EBEA 2B4UA 1VQ9S 1NK4A 3A1YG 2ZDPA 2RMLA 3FQLA 4GMKA 2JC0A 2P9EA 4CTAA 4EO8A 4L3NA 2UXCF 3UW1A 1HD0A 3THPA 5MAOA 2WOMA 4B9SA 2HZCA 4KSEB 1X5SA 5CD4H 3FGVA 4WIIA 1IKYB 3OQ2A 4PG8A 2YKQA 1CG2A 2C2DA 3DOLB 3EGNA 4ZPCA 5A6WA 1L5UA 3NGKA 1Q8IA 4IFVA 4NA3A 4JI5F 2E5HA 2F1FA 2EVZA 5U47A 2HS3A 3G8TA 2UVWA 3Q8SB 1CPZA 2YNFB 4DDFA 1NK7A 1HQEA 1TUVA 4DL2A 3M30B 3M8QA 5DQGA 1NRKA 1N5QA 1OWXA 4A48A 2FTRA 4O44B 5GAHU 3WBZA 1FD8A 2BANA 3HKZD 2JVRA 3JB9k 3E51A 4HH1A 1LWCB 4IH5A 4PR6A 1Y3JA 5A8RB 2OMLA 4ETXA 5C25A 1S76D 3SCIE 2LEAA 2HLUA 3TX8A 3UDCA 1TKXA 4DUYF 2BV3A 4PPZA 2BVZA 2J6SA 3MDFA 4Y00A 3GZ7A 4IKAA 1FXLA 5D3GB 4F4XA 3L7OA 5THWA 3T1AA 1IQZA 4F25A 2GQ2A 5SUHA 1KQSR 3SSQA 1SB6A 4X62F 1U1MA 1E6YB 1FDDA 2J0XA 2BYCA 2LQJA 5KT3A 2XGPA 3JSMB 2GGPA 2MY8A 2PT0A 4TYBA 2H5EA 1D9DA 3ONQA 1N0VC 1XN9A 2LMIA 1R8BA 1X7VA 3DOMA 3MR5A 1ZM2A 3OR2A 2LCWA 1KEKA 4IQXA 5T7LB 2YX7A 1C2PA 1H2VZ 3C46A 5C24B 5KFBA 2UXBF 4MK7A 2KG0A 3F56A 3JYTB 2D1CA 5KTQA 2DJWA 1TFYA