1FE4A

Crystal structure of mercury-hah1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords COPPER TRANSPORT PROTEIN ATOX1
total genus 20
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fe4A00
1V3ZA 1CC8A 1TR0A 4YEAA 1YJRA 3QMQA 5B0CA 1KVJA 1FE0A 1URRA 5B0FA 4ZOSA 1JWWA 3CJKB 1OQ6A 3HHLC 4Y2KA 2OD4A 1GXUA 2LDIA 3IWXA 4FNHA 1FESA 1FEEA 1MWZA 1KQKA 2BJDA 1R6YA 1VQYA 1Y9OA 4HL9A 2ACYA 2BYCA 1QUPA 3TRGA 1S6OA 2KKHA 1YJVA 2GCFA 2PGCA 2XMWA 3E8OA 2KT3A 2ASYA 1Q53A 4YDXA 5B0BA 4Y2MA 2LQBA 1X8DA 2IYGA 3HHLA 2XMKA 1Q4RA 3CJKA 2EW9A 3DCAA 2QLWA 4HI2A 2HFOA 1OSDA 2AJ1A 1N5VA 1IUJA 3VTIA 2OKQA 3I9ZA 3BGUA 2GV1A 2AJ0A 2K7JA 1GXTA 2GGPA 2LQ9A 4Q2MA 2FHMA 3LO3A 2OFHX 2K1RB 2N4DA 1TUVA 4OJ3A 4A48A 1AFJA 1XBWA 2FB0A 2HIQA 1SQEA 3LGMA 1JK9B 2OP5A 1YJTA 2IFXA 2W4DA 3HHLB 2Q3PA 1X0PA 2L3MA 3KG1A 3HFKA 3WDOA 3BN7A 2BJEA 2N4CA 1YG0A 3FRYA 3HX9A 4EFAC 2JDJA 1LQ9A 3IWLA 1YJUA 2KT2A 5T7LA 1U7LA 4DL0C 3BF4A 2HQIA 3BB5A 3KG0A 4HI1A 2RSQA 1OPZA 2AP6A 1Q8BA 4A46A 1AW0A 1N5TA 2GO8A 1AFIA 1FD8A 4DN9A 2GA7A 1N5QA 2ZDOA 1FVSA 4A47A 3K7RA 2PD1A 2XMJA 1ULRA 2HLUA 2OFGX 1FVQA 1MWYA 3HDSA 5F0WA 4OJ1A 1APSA 5KAKA 3BR8A 4QOTA 2BUNA 1WD6A 1Y3JA 3HF5A 2XMUA 2XMTA 2ZDPA 2W4PA 5K9FA 3BDEA 3F44A 1S6UA 2XMVA 2FTRA 4Y2IA 2RMLA 5B0DA 1TL4A 1TL5A 2VV5A 1P8GA 5IXUA 2LXFA 2OMOA 1RJJA 4HH0A 4U9RA 5A6WA 1Y0HA 4ZA1A 3TNVA 2BBEA 4NL5A 4OJHA 4F67A 2N7YA 1N5SA 1VQSA 1W2IA 2GGPB 2QYCA 5B0GA 2GFFA 2AW0A 3KNGA 2KYZA 3FGVA 5B08A 4OIXA 3LGNA 2RILA 2K7KA 2OD6A 5T7LB 1Y3KA 2RU9A 1CPZA 1KVIA 2XMMA 1K0VA 4A4JA 4HH1A 5F0UA 1Q8LA 3UDCA 1YRXA 2IYIA 4DPOA 2ROGA 2VH7A 3HHLD 4FNIA 2G9OA 2K1RA 2ROEA 1OQ3A 3DXSX 3TOQA 2HFNA 3QGPA 5A6PA 2QLXA 3T9NA 1P6TA 4NPOA 2QIFA 1CC7A 1SI9A 4Q2LA 5B0EA 3FMBA 3BM7A 2CRLA 2OAUA 4OJGA 5B0AA 3GZ7A 3MZIA 2W4CA 1X7VA 5B09A 2K2PA 1SB6A 1FE4A 2HLTA 1TZ0A 2ROPA 3KKFA 2FIUA 3MCSA
chains in the Genus database with same CATH superfamily
2HWIA 2ZD1B 3CIMA 3R97A 5DDOC 2ZUAA 3R5JB 1UEVA 3L09A 5C2CA 2UUCF 5D4NA 5D8HB 3FBCA 5E5NA 2LCWA 3GJRB 4DBQA 3V6HA 2HYIB 2XWXA 5LOQA 1G6BA 1XK8A 3HHLC 4OYZA 3X3UA 4L76A 3OFHA 1UCNA 4OZ0A 1X4GA 2LDIA 4R8UA 1KQKA 3PIOQ 3M8RA 2FC8A 1ZM9A 4RW8A 3HVWA 4MT1A 2AEJA 1R6YA 4CTAA 1GAOA 3K5PA 1X4BA 4KO0B 4XDCA 1YJNS 1NDPA 4RW4A 1FWKA 2NPIA 5EWGA 5L39A 2MZJA 3UWTA 4CO0A 1VOMA 2CPIA 2Z2ZA 2ILYA 1ROFA 2Y1RI 3QSIA 4CO5A 4RUHA 5KFHA 4B17A 2B4OA 3CCTA 4ZPDA 1TUGB 2KG1A 4C8OA 4KC5A 3UR3C 2RD5C 5ETOA 3JYTA 1CQMA 1GTHA 2DR8A 2FQQB 1HWKA 2HWTA 2HZVA 2MZSA 2VG6B 2QA4G 2OI2A 4LQ3A 1JKHA 1AUSL 1B64A 3K0JA 3GTYX 1RHRB 1VK3A 4HDHA 3RBXA 1B99A 2YNGA 2IM1A 2CPXA 2VFUA 1X5OA 3GWCA 3H7HB 3KJFB 4PPZA 3W63A 2Z2MA 4X4RA 2IJNA 3HM9A 1X9MA 1SV5A 3GIKA 2BJ8A 4OLPA 1H2VZ 2R7TA 4ZPCA 3QRQA 4X4SA 1SQEA 2MKSA 4D3HA 1S1UA 5M2PA 2VOPA 1VCTA 2YX1A 1JK9B 3BYRA 3E01B 3R5DA 2M2BA 4IO1A 1VJQA 2EVZA 2YKOA 4F36A 5HMXA 1O0PA 3U27A 3KLIA 3SFUA 1X9WA 4PG7A 1R6VA 3R5BA 5EX0A 2N4CA 4C8MA 5A76A 4C2MA 2UXBJ 2G0CA 2GAHC 5D4LA 4AXIA 3IWLA 2P5VA 4EBEA 4HHUA 2MYFA 2R7WA 1ZOTA 1DLOA 1N5TA 2QE5A 1FRKA 4JUZA 3DYAA 2P6TA 2MKYA 1WUUA 4O3NA 4M5DB 1KFSA 1IBCB 5GAEU 1F5CA 4RUBA 2XY5A 3POTA 1T8EA 3ISZA 3QYYA 1FVQA 1APSA 3BPSP 2VG5B 1IWAA 3ZNJ1 2IAJA 2XSJB 3DLHA 4ILLA 2ZFHA 2E9RX 1MU2A 1KOHA 2OUGA 4DUYF 2CVEA 3CCQS 1S6UA 1VISA 3MR7A 4TLRA 4NLWA 4DDFA 3TUZC 4UF4A 3Q24A 1SL2A 3NCQA 4KIAA 1IBKF 3MCNA 1TKXB 3BKFA 4R8UB 2VG7A 4R5PB 5KOXA 3RB0A 3DMJB 1YI2S 2F1FA 2HPUA 2ZWOA 3LF0A 1IM4A 2JC1A 4TU9A 4DQPA 3BR9A 5C24A 1WKLA 2VBXA 2ZZTA 3DU6A 1U1KA 1WSVA 2NXEA 5E3PA 2OEKA 2Y1IA 2FZCB 2FC9A 3DN9A 3D28A 4WFXA 1TFYA 3LP1B 5HANA 2RS2A 1XIQA 2Z56B 1Z2ZA 1LFWA 2OD6A 1CPZA 4H4OB 5E7OB 3AT1B 4QU6A 1X4EA 3UDLA 1U6BA 3I6PA 2DXFA 2ROEA 4IFVB 2VHGA 5A0YB 3RB3A 3QWUA 1WEXA 4YS2A 1HNVB 4LBIA 3EVMA 4OYWA 4MIWA 3T9NA 3UDVA 1P9YA 3N0VA 3CCVS 4H4KC 5F3ZA 1YJWS 3J7AN 3NGKA 2J6UA 4OJGA 4O0NA 3GZ7A 3R9LA 1MMDA 1C0TA 1Y4ZB 4KH0B 5D6GA 1T05B 2NS1B 2UUBF 2K2PA 1SB6A 3H98A 2KT5A 4LF9F 4U7UD 5HMYA 2H51B 3CJQA 2GS8A 1DQAA 2VB6A 1TR0A 2ZHOA 4XPCA 3BQ2A 1H72C 1DLOB 5IQ6A 4RW9B 4IRCA 2Y0BB 1NAQA 2VA2A 2ZZMA 3IBFB 1QM9A 3I96A 4ZPWR 4YMEA 4DUTA 1HWLA 2MLZA 2OHDA 5M2RA 5HJXA 4C98A 1YRUA 2GHWA 4RUAA 1CJVB 2BKOA 3CJSA 1KOOA 1H3DA 2J7WA 2VBYA 4DCPB 2VU5A 4DJBA 1KNZA 1S0MA 2HS4A 2JJ4D 4DXLA 5EDWA 4OI0A 3P49B 3L7OA 5KT5A 3THPA 3W62A 4DX7A 5C25B 1QVGR 1L3SA 3DRYA 4KYZA 4Y0FA 3Q2TC 3TA1A 2JEJA 2AV5A 5IWAF 3T6BA 3J7A1 3JS9A 3N4WA 4M8LA 1I5OB 2QLWA 5I3UA 2HEKA 2WHOA 3SSSA 1R0BG 3C14B 3KK3A 2PMWA 2CAJA 2EFVA 1HKAA 3WHIA 2DYAA 3DDIA 4G1PA 2XHCA 5KT6A 3PRVA 2ZM6F 2AMCB 3ILOA 4QWBA 4LF4F 3M30A 4ZVPB 4E0DA 1PO6A 2CZ4A 2W7PA 2FHJD 2DHAA 1PBUA 1K47A 3CCSS 2DNPA 2V94A 2CNKB 5JVHQ 4KHPJ 3OXFA 3M4XA 3CB4A 3PCOB 4N5SA 4JV5F 2GIFA 4RNFA 5K8MA 3KG1A 2WBMA 3HFKA 4B9VA 5ETLA 3IRXB 2M9KA 2YNIB 4F50A 4TN2A 2GX8A 3CJ8A 4O4GB 4RW7A 2KXNB 4B3RF 2HVIA 4PXDA 1SQFA 2AP6A 4ATNA 2NSBA 3TQEA 5J2NB 2G2YA 2MGZA 2W9AA 3VAJA 3DM2A 3BS9A 4ZDNA 2XS7A 3L3CA 1Y7PA 4I69A 3D2WA 1TL3A 2GW8A 2PO4A 3ELHA 4J9VA 5A8WA 4LFCF 3EPIA 5IWAJ 4O3SA 2E1MC 2M0GB 1HMVA 3F41A 2LA4A 4IQXA 1ACMB 2WVBA 4K0KJ 2DNGA 2HZCA 5HQ8A 2XMVA 1RA6A 5CYQA 3VALA 4DR1F 3NP5A 4NA2A 1FF2A 2H5EA 3MCOA 2YBVA 3DOLB 2OMOA 3BKUA 5L1LA 4RBTA 2ZC3A 4LSLA 4ZP6A 1FRLA 2VQEF 3BGLA 4A8SA 3H42A 4ID5B 5KT3A 3KJVA 2M4MA 1AXQA 1KDNA 3OW2R 4C8LA 4OHVA 2B8QA 2CJQA 3CD7A 3A8JA 3IBCB 2CG4A 1ZAXA 2MPUA 1F5AA 1TL7B 3FSYA 3KNGA 4P2FA 2MJNA 5KFFA 3DI6A 3O5TB 4O3PA 2P8IA 2HK3A 2RILA 2B9EA 3QO9A 1CVJA 2OPSA 1KVIA 2VOOA 4B3RJ 1CS4A 4A4JA 4URGA 1VQ9S 2Y3YA 3Q8QB 4LRDA 2C3UA 3H90A 4DPOA 2A3JA 2CNOB 4DZDA 1SH0A 2BE7D 2F63A 2GIRA 3G6ES 4NX9A 3CMAS 1Q81T 2YNFA 1RABB 1W26A 4GKKF 3W5XA 1GMWA 1S1VA 1SKUB 3EUNA 3HHLD 4FNIA 1ZETA 4ANEA 2L48A 2BJ3A 4J9MA 2VPYB 3MWBA 3NBPA 5KFVA 3DGVA 2RF2B 4EU0A 4LRCA 2DGUA 3LP1A 4DR4J 3MTKA 2YKPA 3BM7A 3RB4A 3G86A 5LM7E 1UVJA 2VQFJ 2DNRA 4EK2A 3FK4A 3LALA 1RTIA 2FJAB 1YRTA 1SUQA 2ROPA 3GFZA 2ZOFA 3IG1B 4I4BA 4LF2A 4UOFA 4DCJB 2D1CA 4NCBA 4YEAA 4ZPAA 4TQSA 2VASA 2AYBA 3D5MA 4OV1A 5LL6d 1HNXF 2MKJA 4RW8B 4FVCA 2UV8A 4CTAB 1KEKA 4TU8A 3Q8RB 2OTJS 3PACA 2OPRA 3DRXA 1NEEA 3I4HX 1JLBB 4DU8A 2OD4A 2RE1A 5L46A 4FNHA 3JSYA 3P5BP 4ZLLA 3ZZ0A 1KQSR 2RDIA 4HYKA 3HSGA 4DCOB 2ZH1A 4QYZJ 2VPZB 4P52A 3RAXA 1DFDA 2ACYA 1OS5A 4WF9Q 1HD0A 1KONA 1BHNA 3PHEA 1RTHA 4PAAA 1RT3A 1XNQJ 2ALYB 1TKDA 3ZTRA 1SQGA 2EFQA 3BBBA 3GR1A 5CQGA 3PW0A 2DR5A 3V81A 2ZZNA 1ZBTA 2OTLS 1E6YA 2MKKA 3MMJA 3UN3A 5IFMA 2DO0A 4EYIB 4A8YA 2G2ZA 3QWPA 1SJRA 3DC2A 3TZXA 2DTJA 3OHBA 4PWDA 2K06A 3CJ2A 3GJQB 3PJXA 5KG0A 1F2GA 4KGKA 1AUDA 2ZBIA 4FXWA 3ITHA 3CCMS 1GXTA 4A8OA 3J7YU 2VQFF 1G1XA 1FERA 3MMAB 3D9BA 3FBEA 1WACA 2HVZA 1NSAA 1DTQA 1S49A 1SBRA 2ZBRA 4OZLA 4YB1P 2XLKA 3IRWP 4V19X 1IKYA 5C42A 2NZ4A 2OP5A 2W4DA 3KUGA 2AEMA 1XMOJ 4NRUA 1M5OC 1OYEA 1WG1A 3RBZA 4ICLA 4PCQA 1TQLA 2WRMA 4YY3J 1ZM3A 2RU3A 4GVBA 3PR5B 2Z30B 3TEGA 2YQ3A 2NXUA 5L1KA 1U0HA 4MKAA 1FRMA 1RA7A 4U95A 3HJFA 3QZ8A 3ETOA 2QLJB 4CLFA 2XSFA 1IKWA 2CQ2A 2C3YA 2HLUA 3N5FA 5F0WA 2FGCA 5DETA 1NB2A 3BR8A 2HHXA 3G9CA 2ZH2A 2BJ9A 1XR6A 4O4GA 3MECA 2I8EA 1XTZA 1F5BA 3W1YC 2A0FB 5DDQC 4DR6F 3K58A 1WHXA 1WF2A 4FYYB 4RBUA 2VV5A 4JI7J 4C11B 5J2QA 2LFVA 4IOBA 1AB8A 4WP8A 1T9UA 3Q89A 5KFUA 3HVRA 2ZH3A 3TA0A 5EGYA 2IPOB 2MXYA 1REVA 4OJHA 4URQU 5KFJA 2CFXA 5KFNA 1Q86T 3UQSA 1VQSA 1R0AB 2GGPB 3P5TL 1BMQB 2E1CA 1A0OB 1T11A 1YTYA 4J37A 3JTPA 4X66J 2RU9A 3QGHA 4WZQA 4ZPBA 5IT4A 1HBOA 2XY6A 2ZBPA 3CC4S 1F9FA 1YRXA 2DXEA 2HFUA 2V8VA 1CG2A 2QGFB 1NZAA 5DS7A 5DZ7A 3M1VA 5GAGU 2LVWA 4QJVA 1EQMA 3W66A 4NZ6A 2E7XA 5EHHA 1V3RA 3AA9A 3V4IA 1C0TB 4F0MA 1S9EB 1VR6A 3M9OB 3EICA 1DQ8A 2CPJA 1Q0NA 2K3KA 3MOZA 4YB6A 3NLCA 3T1HF 2OAUA 4L75A 3KHGA 1N0UA 3IR5B 1P1LA 4KGZB 4Q7AA 5J1NA 1TL1B 4ES3A 5AE1A 3K59A 3GSDA 4NZ0A 2CJYB 2E29A 2L08A 1RP5A 1JB0C 1R0CB 1T05A 1RTDB 4PQUB 1UW4A 3CO0P 1UMJA 2PEBA 3KHRA 1VQOS 2AD9A 2B0GA 2MZQA 2QYGA 1HHTP 3E01A 2UXDF 4DLEA 2CPHA 4P10A 3AHPA 5HP1A 4RPFA 4A8QA 5K8PA 3GV8B 4OV6A 4ZPTR 3KHLA 3T9ZA 1UVLA 2CJKA 2GZOA 3TAPA 1KTQA 4WU3A 4DS5A 1ZPVA 1Y9OA 2H3EB 2DRBA 3N9UC 4F0KA 3C15A 3HHEA 3PFEA 2HG4A 4PG4A 4BLGA 5GADI 5CD4A 5E41A 5DGAA 2O01C 5KG7A 2XGPA 2V4JA 3A13A 4G3IA 1WOPA 1EARA 1WHWA 2CYYA 2ZITA 3AJDA 4PPDA 4WP9A 3RAQA 1PCAA 1TKXA 1X8DA 4ZVGA 2BM0A 5BYSA 4AL6A 4IKAA 1U0SA 3AQOA 1EIYB 2AJ2A 4NI2B 4B3SJ 5K20B 2OKQA 4M5HA 2RQCA 3I9ZA 3JSMB 2K7JA 2GV1A 2RKIB 3AODA 2EFPA 1QTNB 3DKDA 4EO8A 3FEYB 3VZHA 1PJ6A 3C14A 1TUVA 1HI1A 4Z2XA 4JI3J 4QR0A 3KTQA 3OVBA 3T5KA 2H48B 2CQPA 2C3OA 4AFFA 2C42A 2HHWA 3TZZA 4OYBA 2QT7A 2UVWA 3NGUA 3MM9A 3GIIA 4ECUA 3DDNA 1BXNA 4AUKA 2JEIA 3MPUB 5T7LA 1RCOB 3FC9A 3ITHB 2RSQA 4B9TA 3H20A 2HNZB 4F7VA 1VQ4S 2XNRA 1KVJA 2AJFE 1VHIA 3GMGA 3RU0A 4F2SA 5KFCA 1SJQA 5LMUF 4C8ZA 4OI2A 3ZZOA 3PO4A 8RUCA 3JYTB 5J2NA 1MWYA 2K8GA 2B6AB 2CNNB 2CZVC 3JSBA 4KSEB 4NLPA 4KPYA 2UXDJ 1HNVA 3KLHA 1LWCB 2ZWPA 4QPTA 4RUCA 4EZ6A 3HHKA 1NNDA 1Y5NB 2OO4A 2Z58B 4USJC 1H6KX 3MMBB 4P72A 2WSFC 2DH8A 4OI1A 3J81U 1HMVB 1TL5A 3PYDA 2CQCA 1BC6A 1P8GA 1F2HA 2CJBA 3OTEA 4HH0A 1RJJA 3PKYA 1VC0A 4RWWA 3C8YA 1SL0A 2CPFA 2DIVA 1GT8A 4WIIA 1S1UB 4ZJOA 5H1SV 1JX4A 2H5IB 3MURP 1UA0A 2HRYA 2DR7A 2B9XA 4F25A 4KY3A 3ENAA 5A8KA 1LFPA 1HNZF 1AA1B 2YTCA 2BRKA 3H2UB 2EBGA 3ZTSA 2AIRB 4MH8A 1NU4A 2W9BB 3UDCA 3J7Z5 4ZJQA 3OLAA 1AZSA 1XWLA 3TUJC 2YWKA 1RWOB 4ZVSB 3K5LA 2FVPA 3ZTOA 3OTOF 1VQKS 2DGOA 1CS4B 3CC7S 4DV1J 2W9CA 4J7CA 1F3VA 2DH9A 1GFWB 4IFYA 5KT7A 1IBKJ 4CT8A 4YOEA 5LMNJ 1RAGB 1NDKA 1C2PA 1U8WA 1PKUA 1R27B 1S6PA 3AOAA 2UP1A 1ELOA 4DOZA 2YQ1A 4G1QA 1TVRA 3HVTB 1TP7A 4DV3F 5J2QB 3GFXA 4NMXA 5CYMB 1FKAF 4AL7A 1FJGF 2BE2B 5CCMA 1VIOA 5JJBA 4DV2J 1S76D 1FNMA 1MU2B 3M2VA 2BV3A 3OLBA 2Y8YA 2PA8D 5CD4H 4QU7A 1C4CA 1FE0A 2DGXA 4Y00A 4LR7A 3J7YI 2M5YA 1TKTB 3VAKA 3VR1A 3W3SA 4B9UA 3QIDA 2BJDA 1FNXH 4WPAA 1F60B 1LWFB 1S0OA 5F8MA 1I3OB 1TTHB 1XN9A 1T9YA 3DLGA 3GONA 4OX9F 6FD1A 2VL1A 4QIWD 5B7WA 1SJFA 2MB0B 1SIZA 2D41A 3S8SA 2ZH6A 4ZS6A 1TUWA 1C1CB 2FHJA 3SEOA 1U1PA 1NJWA 2BX6A 2GJFA 4GO7X 1VRQC 4LVNP 4Y2MA 4ES1A 3G8SA 2YH1A 5DJBA 3NRBA 1NK7A 1EX8A 3HP6A 3BO4A 4JI1F 1RT3B 2IDEA 1JNZB 1Q4RA 1RYSA 1D8YA 3SCIE 2DISA 4KV8A 3BQ0A 1JQGA 2FYXA 2AYGA 4ED5A 2KDOA 3ZC4A 3AAWB 3BGUA 2OPQB 3GCXP 1N48A 1S0VA 3PFOA 2HWHA 1V9OA 1YX2A 2N4DA 1PJ5A 2I5JB 2YNGB 1C0UA 4PZVA 4RNMA 4DV3J 2FB0A 1NK6A 1MSWD 2E7WA 3AA8A 2G4BA 1HWJA 1S1WB 3OSPA 5IT9Y 3CDAA 3M2UA 5DZ6A 3QGGA 4ZCKA 1YZ7A 4C7QA 5F8JA 4QWAA 5DM6Q 2Y0SD 3BN7A 1S1VB 4ZCIA 4X62F 1Q95G 1N34J 2QJ3A 1X4FA 2C2MB 4MFBA 4WYWA 2W9CB 1JJ4A 1TFWA 1R7IA 4P75A 3VAGA 1B70B 2HQCA 1OPZA 2DNYA 3D0HE 4U8VA 5D77A 1NPRA 2J0QD 4DR3J 2HHVA 4F4XA 4GVBB 1H7WA 3EE3A 4PABA 2HBRB 2PN6A 2DEJA 3BSCA 4J9SA 2CZ9A 5E3RA 1RTIB 2MQLA 4O4RA 5HAOA 3I5CA 3RR7A 3ET6A 3RW6A 5THWA 3NKYA 3QQCD 5SZTA 1F0XA 4PG5A 4Y2CA 3EYZA 2J8AA 2MQ8A 5G0RA 2MTLA 2M88A 4QIVA 4I68A 2HNZA 1TL4A 2X3DA 5KT2A 1LW2B 3PW4A 4Q8FA 3GG0A 2HK2A 3TANA 5GMKa 2ZJPQ 5A6WA 3NS6A 1WHYA 2DCUB 3GQCA 2ZJRQ 5KOWA 2C22A 5DDPC 3NOGA 4DSKA 3C46A 3DLGB 4DSLA 2CNLB 1MMNA 3LTOA 1D9FA 2N7YA 2J0SD 1JXVA 4IG0A 3TJAA 2OEJA 3ZZTA 2FJWA 2N3LA 3KLHB 1GX6A 1JLBA 1Z4UA 2AW0A 1KHWA 2V5HG 2YNIA 2XM3A 1REVB 2F3JA 3JQKA 1NKCA 2QA4S 2YWFA 3M8PA 4YB7A 1S77D 3D3CJ 3Q2SC 4YHHF 2ZUGA 4PWDB 4HH1A 1WJ9A 1FRJA 3MEEA 1YWXA 3LUYA 1NZ8A 3W8GA 1X5TA 3IRXA 3EDRB 1FX4A 2GHPA 4OHZA 1OQ3A 2FD2A 3OPKA 1NBEB 4PYAA 2W7OA 3R1HA 1T3OA 2FY1A 4NPOA 2L9DA 4LREA 4CH7A 3NY0A 1N54B 2DO4A 4OZJA 2MGZB 2VODA 3I0RA 3T41A 2R8HA 4HVZA 4NOHA 2W9BA 2HGLA 1M1KT 2BQ3A 2XYHB 3MFIA 2UUAF 1M1GA 5DQGA 1T7PA 2CIMA 3G6YA 1CC8A 2BW7A 8AT1B 1IVZA 2HZAA 1ZA2B 2Z2LA 1HI8A 3QMQA 3AFGA 4R0EA 4DR5J 3C3LA 3U1MA 1U25A 2CJAA 2V63A 4MIBA 2EKYA 4KPCA 2JLGA 5IS2A 1VQ7S 2RHSB 3WZ0A 1NKEA 4Y65A 1CBKA 1FESA 1D1UA 2MLXA 1LXJA 1S1XA 4WFNQ 4ERDA 1M1HA 4K5RA 1HQ2A 4L73A 1RT5A 1S9GA 2GCFA 3TRGA 1RHQB 3M32B 4DUYJ 1VQPS 4PUOB 1VBKA 2B43A 4P2XA 1NH7A 4ZVHA 1S72S 3CD0A 3TP2A 2D3O1 2I38A 1TL7A 3H59A 4L74A 2WVEA 4YDXA 4FS1A 5FDLB 3T5JA 4V19J 1WI6A 1GMWD 3HHLA 4GC6A 1KKHA 4CH1A 1QSYA 1WKKA 1U1OA 2NXCA 3TVYA 9ATCB 2KM8B 3D6MB 2L41A 2MY8A 1LWFA 2IA6A 4OYXA 2XZTB 1X4AA 5L8RC 4A48A 2RDJA 3T5LA 4EZ9A 4DF4A 2HQ3A 4IG3B 2XO6A 3PVXA 3LGMA 3EZOA 4NLDA 1CULA 3K8VA 3DDKA 3TJ9A 1HBUA 4LF5F 1NKBA 3L7UA 3UNGC 1DRZA 4UOGA 2J0WA 4AD6A 4N56A 5HROB 2D74B 2ZH4A 4O0IA 4RL1A 2DY1A 5D3GB 2R7UA 3BKTA 2AYMA 3CTRA 3CWJA 2VFSA 4QIEA 1R89A 3KXDA 5E33A 4ZVUB 2RHQB 3MM9B 4UOHA 3GCWP 2VA3A 1SV5B 2ZC4A 4DR7F 2YWHA 3LP0B 1YBAA 5K5MA 4WCEQ 2XWYA 1HR0J 4RW7B 1LK7A 4JI2F 5CABA 1FDBA 2OPRB 4CO3A 4JV0A 3ZTPA 1N36F 4LF9J 5IC4B 3S01A 1TELA 1RCXB 1NJZA 2EG2A 1BGXT 1Y3JA 2VDIA 1JLQA 2FJBB 2H65B 4LSZB 4MFBB 4C9DA 2RUGA 3EVWA 3F44A 3NCPA 4DR2J 3E3XA 4K8RA 1S9FA 1RT4B 3HSZA 5KFBA 1YDLA 4QYZK 2ALZA 3PM9A 4UUXA 2DGSA 2IC3A 3OTOJ 1WTBA 2RH3A 4IR9A 2HQFA 4FXVA 1YGYA 4FS2A 1UTAA 4EBDA 2C1EB 1NPPA 3CD5A 5MLCV 1R8HA 5T14A 3MD1A 2B4VA 3ENQA 5EX3A 2CG8A 2UU9F 3EVOA 5BR8J 1E6VA 3BSNA 2UUCJ 2HW3A 3UN5A 3G8TA 1PBAA 1U1MA 3QIPB 1BWEA 1Y10A 4H54A 1Y3KA 1DAXA 2H4YB 2HVHA 1BLUA 2YNHB 3N5BA 3MR2A 1UAWA 1GQEA 3W61A 1YHQS 2C2ZB 2PFDA 2W2OP 1VC5A 2HHSA 4CLZA 3AXKA 1Y11A 3EGWB 1VJWA 1YBUA 2DB1A 2D3UA 4PXCA 5ETVA 3BEGB 3DRPB 2HFNA 2V8PA 5AXNA 3GU0A 4LRBA 2YKQA 2LQ5A 4LR8A 3SCKE 1U1LA 5CYMA 2BXJA 4ZHRB 5KFOA 3X1LB 2WVFA 3G8QA 1EZZB 1HBMB 1JLCB 3K5NA 2KFNA 1IBLJ 3BQ1A 2RQKA 1VQMS 3H4BA 1V5IB 1V5VA 4C3MA 2KZZA 2ACMA 3GJTB 2D3ZA 2M8HA 4TY8A 1FCAA 3HI9A 4USUA 4ZLNA 5KG5A 4PRFA 4JI1J 4C3KA 3OFGA 4KBIA 2V8HA 4IFVA 3ZZPA 4X64F 1FD2A 5A0YA 3OL8A 1SJ1A 1HHSA 2CPEA 2H1YA 2ZBQA 3A4TA 4HTJA 4I2PA 4UQTA 3CJKB 1IN0A 1UZHA 5KFLA 3WX8A 5BR8F 2F9JA 4NWBA 1FEEA 4F4WA 2QL5B 3VWSA 1ZZFA 2CQ0A 4IRDA 4FYXB 4HL9A 2BYCA 2APOA 5L9XA 1JLQB 2W8KA 3M30B 1TK5A 3QT5A 1WDDA 1KTVA 3M05A 2HNDB 2COLA 3DGPB 2GQ2A 4BC7A 3FJ2A 4DFPA 4LT6A 4DSEA 4LF5J 2ASDA 4DWIA 3QRRA 2EWHA 4KKOB 2JFDA 2XTJP 1RDRA 2Q79A 3DCAA 3W60A 1U1QA 4PKDB 3G71S 4W92B 1AW0A 4LSNA 5ETTA 4ITSA 3NWGA 4Y34A 4K4ZA 1IR2A 2XULA 2DBBA 3D7SB 4NLQA 3D4JA 1Y00A 5F9LA 2XO7A 1XBWA 2BJ1A 2GMJA 5MAOA 2R7VA 3S6EA 4K4XA 3TQ1A 2MQPA 3CPWR 5KFMA 3NAHA 1KLMA 1JJ2R 1CJKA 3R5CA 4M63A 3CCRS 1X0PA 2OIHA 1IQTA 4QYRA 2BJEA 2ZH5A 1HA1A 1WC5A 3FCHA 2XEXA 2KT2A 2XS2A 1P9QC 3KG0A 4FYDA 3RUBL 3IS9B 2Y1LB 1NPKA 3IR7B 4FYWB 1IBMJ 1X31C 2KB2A 3DHXA 3I87A 3MPWA 1RWXB 3PHTA 5J2PB 4KAIA 3SYZA 5FJ4A 2HS0A 2PD1A 3FMWA 1W25A 2OFGX 1L5UA 2SXLA 1UFLA 3MD3A 3CCZA 3SXLA 4FF4A 3NS7B 4QOTA 2BE2A 5EWFA 4LFAF 5G0RB 2R8KA 4LQ9A 4NA1A 1HPZA 1PJ7A 3MMCB 2GMLA 3DRRA 2W4PA 5A8RB 2OSRA 4K4WA 4HR2A 4NXMF 2CKWA 4TLQA 3D66A 3T1YJ 2H4WB 3A12A 3G87A 4NEZA 1QJHA 3PO5A 4X4UA 2V69A 5IXUA 4TVAB 4YN3B 1XMOF 2FJDB 3MECB 4ED7A 4BCAA 1RBLA 4GRSA 2AGOA 2MZRA 2AQ4A 4WK3A 4WXWA 1IXKA 1BQNB 3K5MA 4N7TA 1RT1B 2IM2A 1N5SA 3FDSA 1S6QB 3EZUA 1NXIA 3R7BB 4L3NA 3HSDA 2B8PA 2X1BA 5H9FK 2MHNA 4ER8A 4LF4J 1QLNA 1B0VA 2HMIB 4NASA 1DQ9A 4OIXA 1GH8A 5J2MA 4USTA 3C16A 1S12A 2VFTA 4IH5A 1KVKA 4OFZA 3BSAA 4AL5A 3HFVA 5AJ3J 4FKXA 4TY9A 4KGMA 2WTFA 1SIWB 4L3KA 1SXLA 2A1BA 4WFZA 2ZE2B 1U49A 4DV4F 2ROGA 2DRAA 1KSPA 3M2RB 1OWXA 3BV8A 4CT9A 1LW0B 1YQHA 2VF3A 2OELA 4FPRA 1LWXA 4WZMA 2E44A 4GO5X 2VBZA 3M2UB 4P71A 4H4MB 4MK9A 2PIIA 1FXDA 2F8EX 2RS8A 2RB7A 4HDGA 4ZP9A 2ZM6J 1TAQA 1XMQJ 4P2SA 1X9SA 2GAGC 2QL7B 3MEKA 1UWBA 3MPYA 1LNQA 2I5JA 3D0GE 4J9KA 3NGTA 1CEZA 3U02A 3B4MA 2Q1LA 2CDRB 3D6TB 2XI3A 4DFJA 5B0CA 3JB9k 2VICA 1U1NA 1I94J 4FF3A 5DO2A 3ZTQA 3PR4A 2PMZD 5BJRA 3P3DA 1SL1A 2YX7A 4ZOSA 1OQ6A 4M5DA 3KLIB 1FK9A 2W2NP 3V5RA 3CDWA 4LUBA 4O44B 5IV3A 2FVRA 4M95A 2R8GA 3R2CJ 3D1OA 1Q1KA 1R8PA 1T9VA 3K5OA 4OZ5A 3OR2A 3S7RA 2F9DA 2P6SA 2GVZA 2WBRA 2MEWA 3CMQA 3MEDB 5D0GA 2MZ1A 3OHAA 3R1LA 1FJ7A 4HLBA 2YQ0A 3FZ2A 3IP0A 2KXHA 4GVLA 3CEDA 4ZCMA 5HBMB 5HMWA 2RRNA 3SQGA 4LFCJ 3GFHA 5LJ5Y 2R7OA 1QE1A 3JQMA 2E5LJ 4NLUA 1EP4B 2EFGA 1DTTB 2BANB 1J5EJ 4OX6A 5HVGA 3ET6B 3GLJA 3VHQA 4IG3A 3UD3P 1TK8A 1Y5IB 3UVJA 5ETPA 3KLFA 1OJ4A 1IM6A 3MR6A 1JNRB 3R2DJ 5HSPA 1AFJA 1M5VC 1S7HA 4F3QA 2EK6A 2Z8QA 5D78A 1PYOB 1PC5A 4ZMMA 3BPDA 1HQUB 2QMXA 3CDEA 4I2QB 9RUBA 1WC0A 2A2CA 1S6PB 5KFSA 2M3DA 3OXGA 1YBTA 2VIHA 1IWGA 1EKRA 4ENOA 1KFDA 1Q7LB 5HI7A 1M0SA 4QR2A 4K59A 2VZ9A 2PC6A 2AJQA 4Q43A 2HKEA 3MEGA 3ZFVA 2BOAA 4DG1B 3KK1A 3T1YF 2BQRA 1URNA 1FNOA 1UETA 1PYTA 4BBYA 3RTVA 4MKBA 1HNIA 3MCMA 1QY7A 1FVSA 3N28A 4ECYA 3CDUA 2UXCJ 3KOAA 2J9DE 2XG8A 1T9XA 1H2UX 2IJRA 1ULRA 3TO8A 1NH8A 3PIPQ 2HFZA 4RO0A 2NLWA 2AGPA 2DGQA 3IWNC 3PRBA 2BUNA 3IBWA 4DV5J 2HRUA 1I1GA 2FJXA 4DR4F 2D3OR 1NDLA 2D7SA 1DJ0A 3N6LA 4I1TA 4OZ3A 1QDUB 4F0HA 5K9FA 1XNQF 3J7ZT 3EDQB 5C7PA 2BOPA 1RT2A 2M70A 2RUSA 5J1EA 3OVAA 4ECRA 1LWCA 4U7UK 5L38A 3PRDA 1CJVA 1U0HB 2FLLA 3I0SB 2XBPA 3LANA 1FTCA 4TKTA 4DV4J 3HKZD 4JB8B 2XI2A 1Y0HA 1ZTTA 3PYGA 2FJEB 5FIIA 1P1TA 1GNKA 3TNVA 1S1WA 5J2PA 2GVZB 1PILA 4RW9A 4ECTA 2V6AA 4X2BA 3ILJA 2JLEA 2QRRA 4GKJF 3UO0A 4XK8C 1NK9A 4B3TF 2GFFA 4FPIA 2KN4A 1HNXJ 1EHWA 3KUHA 1RU1A 4YB5A 2QO3A 3F0NA 1OMSA 3MR3A 3EJMA 2HSEB 1DTTA 2BANA 1K0TA 3OL6A 3N6MA 1IKVA 4WP3A 1A6LA 3ZXWA 3DYAB 2IYIA 2EKNA 3FEXB 3NXZA 4KE5A 5KFKA 2JH3A 3OL7A 3T5HA 1U48A 4B3MJ 4Q0BA 3IGVA 2J7KA 3VQTA 2Y8WA 2CXEA 1JLEA 1KP6A 1WHVA 1RK8A 2K1RA 4OHYA 1VDHA 4W4MA 3K57A 4B9LA 1ITPA 2KHDA 4ZVEA 1HBMA 4FBUA 1VRTB 2J7UA 3FMBA 1RAHB 3IM9A 4X84A 4HKQA 2Q43A 4IFYB 4PXEA 5B0AA 4JI6J 4W90B 1UFKA 2AF6A 4H4OA 2W4CA 5KT4A 3QFWA 3W2WA 4B9MA 2VFVA 1D8ZA 4RJVA 3NGRA 2KVIA 4X65F 2JNJA 3ISND 2M52A 4K4SA 3CUNA 1FFGB 2EI5A 2PT0A 2OH2A 5LMUJ 2KO1A 5KG2A 4RW4B 1DBDA 3H2VE 5T41A 3IO1A 2IBKA 4P9SA 1I6JA 2RKIA 8ATCB 3Q8PB 4JI8J 4QW9A 3IGNA 3DU5A 7FD1A 5DGBA 4F02A 2O67A 1UWBB 4CQ1A 2E9ZA 2UVRA 4HTIA 3FKBA 1O6XA 5LXYA 5DG9A 5DQHA 3M8QA 4PQAA 1N5YB 2AHOB 2HAIA 1KLNA 1IKXA 4HACA 5FD1A 2IC3B 2IRUA 5IT0A 1CJUB 3M7VA 3MAHA 2QA2A 7FDRA 5DDRC 3DGPA 1RISA 2V50A 2YY3A 2UUWA 1JLFA 2R7QA 5ETKA 3MUMP 1V6HA 3GFYA 1N88A 2YPYA 3W9IA 1SKWA 2IIHA 4KKOA 3CD6S 4WTOB 3CC2S 1XNRF 3JAMU 4RW6A 4DR5F 2YKNB 4JI2J 4M5KA 2RRBA 4FYVB 4HT5A 4XAKA 4C97A 5C25A 1N0VC 1G7CB 1D09B 2DR6A 4DR6J 3SQGB 4DS4A 3MHYA 1WWHA 4P2MA 2IFXA 1U24A 4DX8H 1ZPWX 2KVQE 3RAMA 4UT4A 5IC6B 2B51A 1LWEB 4M5IA 3DRSA 3AJ2A 1I51B 4MK8A 5AT1B 4CZCA 4ED3A 4DV1F 3LH2S 5DRKA 4EO6A 3JSMA 1NRKA 3BB5A 4N8OA 1LKZA 4ECQA 5GAEI 5K14B 3KK2A 4M94A 1UJ5A 2LXIA 2YNHA 4HT7A 3BGFA 4CLUA 1FD8A 3QT7A 3WC2A 1AFIA 3NS5A 4EI2A 3K7RA 3S1TA 4F2RA 2R4FA 5KG6A 2XC9A 4NLRA 4XDDA 1WG4A 3DRRB 5A8RA 1K44A 4E98A 5HVFA 3WC0A 4ZITA 1YVFA 4NYPA 3UI3A 4YFUA 2DY9A 1RT6B 1HQEA 3MDFA 3ZZUA 2F5GA 4TQRA 3DLEA 2W8LA 2XLJA 1DZ5A 1UPMB 3PXGa 1BE4A 5AXLA 2BRLA 3GIRA 3FCWA 5BXIA 5GADU 3Q8VA 1X0FA 1NK4A 3GP9A 2RMLA 5B0DA 3PEHA 3C6UB 1EQ0A 1Q7YT 3RZAA 1KBRA 2LKZA 1S7IA 4P7TA 4U9RA 3LWLA 4J91A 4EEYA 1NJYA 4IRKA 4OYPA 3AD8C 5KFZA 1U4BA 3GIMA 4NL5A 2GO9A 3UCGA 4QPXA 3I9V9 3PX4A 1QSLA 1G4CA 3H25A 3DMJA 4LMZA 2LEAA 3CULA 1W2IA 5B0GA 4IOAQ 4NLYA 3LWMA 2PFFB 2HHTA 4LRAA 3MMBA 2IM3A 3RR8A 1B0TA 1M90T 3SDEA 4CWBA 4O3RA 3KLEB 2X1GA 1NK8A 2CWXA 1LW0A 1N36J 2ZVSA 4WJBA 3H5YA 2J6TA 2Q6CA 3UD4P 3IAS9 2YWWA 3QT8A 4XPEA 5DG7A 2VKZG 2PEHA 3PY8A 4WKRA 5IM0A 5D3GA 4QWDA 3G6XA 3V6JA 4S0MA 1XEZA 2BDPA 5A6PA 2DNKA 4Q45A 3O2IA 1HYSA 2V2ZA 3GR0A 4MK7A 3SSRA 1UZDA 3RBDA 1CC7A 5GAHI 3LP0A 3BJYA 3B8HA 2CRLA 2W2QP 1Q82T 3IN5A 3QSYB 3H5UA 3MM5A 2F8HA 4LBPA 1PAUB 2F65A 3DRSB 4M5LA 4JI3F 3MMAA 3MCSA 2V8DA 2NYIA 2QSFA 3FUYA 2E1PA 3LGHA 3Q8YA 4Y28C 2HS3A 2E5LF 3W2VA 3THVA 1Q8IA 2EC2A 4F4YA 3VGTA 3CDBA 3EGVA 4DQSA 4G6VB 4Y2KA 3NCRA 4RX6A 5LSRA 2P9CA 3OUYA 2HHHJ 4TXSA 3VAFA 2QN6B 1WEZA 3ULHA 2NREA 1NCLA 4O44A 3HVTA 2KKHA 2XMWA 3QNWB 4CLLA 4CNYA 2FLPA 4OI4A 3BREA 3B6BA 3DOMB 4FVMA 2KT3A 5ETMA 5AXMA 2MY7A 4ZLPA 4E8UA 4DF8A 3WIVA 4P73A 2N3OA 1NK0A 4PG8A 2WB4A 3OFEA 2LQBA 2OLWA 4KRWA 5F9NA 2VPXB 1OO0B 3QBCA 4V1Ak 2HIYA 3EGZA 2XMKA 3NAIA 3J80Y 1L3KA 5DQIA 1VHFA 3CJ5A 1U02A 1N4LA 1EJ7L 1SC1B 1R8BA 3M6WA 2R2TA 3HZEA 4BHQA 2HNYB 2ZNYA 2JFKA 2LQ9A 2I2YA 3JXOA 3CMES 3J81Y 1SUQB 3IG1A 3VF0B 3CE8A 3HXMA 5J2MB 1VIXA 2KYXA 4IDKA 1RTJA 2F4VJ 3N01A 4OLOA 4QW8A 2VG5A 2DVIA 5KFGA 4RU9A 4JP8A 2ZE2A 1S6QA 1VQNS 2RDDA 4NXMJ 4DG1A 3KK1B 3ENWA 4CIOA 1YG0A 1Q78A 5L1JA 3DLKA 2XHWA 1H74A 2HHHF 1T94A 2XZWA 4HI1A 4A46A 4ECWA 2KG0A 4KHPF 2MZTA 1RHUB 2YH0A 2LMIA 1RAOA 3BH6B 4B9NA 5HVHA 3AD7C 2QLFB 1TMJA 4I2PB 5CH7B 1TL1A 4XIUA 3F56A 1Y5LB 4NE9C 3MR5A 4ECZA 4O3QA 4USMA 4AQYF 3TZYA 2BA9A 1DARA 1NB7A 1RWVB 5CYQB 1XMBA 3PZPA 4UZCA 4JI4F 2AJ4A 1RWMB 2HBQB 2YWGA 1UKUA 3CCWA 4M5GA 3DLJA 4OYOA 3U1NA 4EUVA 3C6TB 5CCLA 2E5IA 4K7QA 1HBNB 2LXFA 2KI2A 3BYPA 5U47A 3W65A 5F8LA 3UCUP 1RBOB 3PX0A 2O3DA 4GKKJ 2W01A 2FPHX 5F41A 1K8AT 1V3SA 4WXOA 2ZH9A 3FZBA 3MEDA 1MN9A 5DM7Q 1NHKL 4K0KF 4DFKA 1GEHA 4F3MA 1BWVA 2XMAA 3CJRA 4ZPVR 2EEYA 3LA0A 2DHXA 4LSLB 4DV2F 1UEUA 2VONA 2GJIA 3TARA 3FGVA 4IH6A 1FT8A 4ECSA 3LGNA 2K7KA 2I6WA 3CCLS 4WYLA 2XMMA 1GXLA 2E1AA 1XR5A 1JIHA 1C1BA 1RI7A 4Q8EA 5CHCB 5HMZA 4C11A 3G4SS 1MN7A 2P2CB 3GG1A 2H9ZA 4QIGA 2BACA 4RWXA 4URSA 4NCAA 3P45B 3PW7A 1WSRA 3PEJA 4O23A 3NNAA 4I6AA 4C3LA 4LF7J 3BN4A 4UY8T 4NLOA 1U47A 3OT9A 2JL9A 2Z0GA 3R6LB 3KK3B 3ISNC 2WSCC 1G3OA 2EFNA 3KJQB 2DNNA 3NBPB 5C5JA 5FLXY 3QZ7A 3BDPA 2QL9B 3OXLA 1FE4A 4C8YA 3TX0A 1Q5VA 2JC0A 3KKFA 3M32A 4DUZF 2FVSA 3EWGA 1V3ZA 3QGIA 5LSLA 1PGZA 3FEZA 3DOKB 4UY85 2IMWP 1J5EF 5KFTA 2GMHA 4C4WA 2U1AA 1URRA 3G6VA 2ZHBA 1R8CA 1YJ9S 5I42A 3LAMA 4YUDA 2JVOA 1JLGA 3L9ZA 1GXUA 2WVDA 4AXJA 3TX8A 1GX5A 4X65J 2KH9A 3WIUA 1IQZA 1XJWB 2AZ3A 1TKZB 3W5ZA 4NXNJ 4FKYA 3KLVA 3B4DA 3SSQA 1QUPA 1BQNA 1T9WA 4LJMA 1FFWB 1LK5A 3V2UC 4ANDA 4WIQA 2KJWA 4C6AA 3QT6A 2WONA 4BC9A 5IZHA 5A2QY 4JV1A 3SBMA 4ZP7A 2F4VF 3CO9A 2J76E 4U7CA 1RXOB 1S9EA 4IH7A 3KMSA 3HHDA 2ZEJA 3MTJA 4DL5A 1FX2A 3FVYA 5E3CA 1RE1B 2BE9B 3BZQA 2GC8A 3AQPA 2JWNA 3AXMA 3EM1A 3QATA 3RRHA 1WORA 3D6HB 3GYGA 3HJVA 1UW9A 2A18A 3KLGA 4OHXA 2ADBA 4DHVA 2EC0A 4RBVA 3OBIA 3KYLA 2FHMA 4J9PA 4EYHB 1R8AA 2XNQA 4OJ3A 2YVSA 4DL4A 4LF6J 3LPEA 2C2EA 1FXLA 4Q5VA 4RR5A 3CW2C 1LWEA 2IJFA 2YKNA 4N76A 3O8WA 1YJTA 4WFAQ 2DKOB 2NXNA 2GVDB 1O51A 2Q3PA 2U2FA 3D68A 4DPXA 2WOMB 3CCES 4PWUA 4JI4J 1VQ8S 4A8KA 3UN2A 1U2RA 5A8KB 5EUHA 4DPYA 4B08A 5HLFA 4DL2A 2HNYA 1GMVA 1QAYA 3CJ4A 2G0JA 3OTBA 4KGXB 1KHVA 3UCZP 2OJ3A 2XB2D 3IC1A 4A47A 4AE5A 2YNFB 1WF1A 2NZCA 2AKWB 3HDSA 2HHPA 5F8GA 4DSFA 1T03A 4DSJA 1WD6A 2RF2A 2LQ8A 3DOKA 4MKVA 3MOJB 3HF5A 4W98A 1NHVA 1ZM2A 1EETB 4NI2A 3BDEA 4RKUC 1SVDA 2B5JA 2WK4A 2MKHA 4MYTA 3TZWA 3JAMY 5GMDA 2C3MA 2JEGA 3DLBA 3PW2A 3THTA 4I7FA 2KZMA 1OY6A 2LU1A 1FFSB 2MHEA 3PYFA 4CO4A 1U8SA 2B9YA 3F73A 5H9EK 4P74A 5GAHU 4ZCLA 5I3UB 1OIAA 1F9HA 4I56A 4DMZA 1FRXA 4DX5A 1KRPA 3A3PB 3CGIA 3D0IE 5ETSA 3ZO7A 3LP2B 5KFWA 2LQJA 2N7CA 1W2BR 4KTQA 4JYAJ 3AD9C 2IVFB 2RRAA 2A2DA 2VBWA 4QZVB 4U6PA 4M5MA 5LXRA 2W24A 2CDQA 2RAQA 1J27A 3IAM9 2F7VA 1K0VA 2LYVA 4KV8B 3L7PA 4U67Q 1FKPB 2BVZA 3Q8UA 4LBHA 1HBNA 3CCJS 4UTGA 3KLGB 3KDOA 5CA5A 4XTTA 1C1CA 2G1HA 1L3UA 3AY0A 3FBBA 3IXQA 4ILRA 2ILZA 1WC4A 4LFBF 5KFIA 4CLPA 1FJEB 1FRHA 1T0TV 2CJ9A 3QGPA 2WB1D 2RJZA 2QLXA 2QMWA 1P6TA 3I5BA 1W7WA 2OPPB 4TNOA 1L3TA 3UDEA 1HD1A 2PMHA 3MF5A 2V2VA 4RNHA 1ZS6A 4ED0A 3P96A 3NWRA 2CQHA 1TL3B 1WTFA 2FGOA 4USWA 4Y2AA 4ZLJA 2HFVA 1GTEA 2BEFA 2FVCA 3SCLE 4YR0A 1MROA 1VBYA 1LV5A 3VAMA 3LOUA 3VGSA 1SC6A 1FDNA 2YWEA 4B3TJ 2O5DA 1RKJA 1X5SA 4CLYA 2GIQA 3R27A 2V68A 2CQ1A 3NNCA 1RT2B 1F6TA 3DRPA 3G2XA 2AGQA 1JWWA 2WSEC 2J8SA 1RAFB 3BBCA 3MM7A 4NCGA 5D0RA 4NLXA 2LEBA 5KG4A 3T1HJ 2JRSA 2GJ2A 1YKWA 2V4JB 3MUTP 4P7VA 1T03B 2CUYA 3ICLA 4K2XA 2LU2A 4DV6F 2E66A 4IR1A 4NYZA 3HULA 3C2PA 3JTOA 1N8RT 1EETA 3D1QA 3PG9A 1NSQA 1JXEA 2Z57B 5KFDA 2BW2A 3K17A 4ZVRB 2VJVA 1UJ6A 1JLAB 1Q53A 2CPDA 5D0HA 4J9NA 3NGSA 1D0EA 4CNZA 4I6WA 5CXTA 2IYGA 1HNWJ 1PG5B 1U45A 2DCLA 4CLTA 3O44A 4DV7F 2V8GA 5CZVA 1Q5YA 3DLEB 2ERRA 5AXKA 1NJXA 3VTIA 4CM2A 1PIEA 2P9GA 1J2VA 2AJ0A 4KO0A 2EK1A 2YKMB 2UUBJ 2JZ5A 2OFHX 2K1RB 3C6UA 3LO3A 4KQZA 4NMLA 3OL9A 2LP4A 1S57A 3A3OB 4DL6A 2J9DA 1FO1A 1HWIA 2B3TB 4DSIA 3Q23A 2NQPA 3H5XA 1FKPA 1PAEX 3GE9A 3I31A 3WBZA 4GKJJ 3A8IA 1BQXA 4JI8F 3WDOA 5KFEA 4EBCA 2KFZA 1HQUA 4I2QA 2ASLA 1NSPA 1RWKB 4TYBA 2MSTA 5CAAA 2DJWA 1HL6A 2V34A 1WDTA 3MI7X 4M5NA 4PEOA 4CO1A 2DGWA 3R7NB 4ALZA 4YP3A 3TEHB 1B3TA 2V9WA 3KUEA 3PV8A 2V0NA 4FXDA 5EWEA 1VC6A 2ZVIA 2UUTA 1KR4A 3MM5B 4ZKAA 1WC6A 4RNOA 4OYIA 2DH7A 2V2QA 4YHHJ 5L1IA 4F26A 1IKXB 4LIRA 2LECA 1KLMB 5KAKA 3EPGA 1HNWF 1R0AA 2MMYA 3OR1A 2C28A 1OY9A 2E7VA 5F3TA 3C6TA 2ZH8A 2XMUA 4YY3F 1NO8A 4DQIA 5CZXA 1RTHB 2DHSA 3WQPA 4IYQA 4ED4A 1PYSB 2QSWA 4K4TA 1XMQF 1CLFA 4RW6B 1WG5A 5AE2A 4DV0F 1E6YB 1MW7A 3DFEA 2F4FA 4C0HA 3BGRA 1BQMA 5J1EB 3W9JA 2F8MA 1S1TA 4CYUB 4ELUA 1JLFB 1S10A 1RAJA 1KQGB 4UZBA 4PUOA 5ETNA 4ILMA 4Z37A 1D9DA 1SCJB 2XYGB 2BKPA 2HHQA 2VC1A 3JQJA 1FWLA 4CH0S 1XR7A 1FRIA 1HHQA 3GSIA 4KB7A 1H38A 2QMUB 2M7SA 2B5JB 1NK5A 5D4OA 3D67A 2H54B 3J81j 2AZ1A 4Y6IA 3C15B 1VQ5S 1BUXA 2I0XA 1RHMB 2VG7B 3ETMA 4Q44A 4R5PA 1VYAA 1OSCA 1WKJA 4FP9A 1S99A 4P6QA 3K89A 1N6QB 1X4CA 4KHRA 1KD1T 4DPTA 3DNCA 2MKIA 1IKWB 1JJHA 4ICLB 2HGNA 4X4NA 4LF1A 2B4UA 2CQGA 2A10A 4KFBA 2CQ4A 2R2UA 1J5OA 1QTMA 4Q0BB 2IA0A 3RG6A 1HQEB 3KK2B 1O8BA 2RNEA 3HMJG 3H40A 4JI7F 1YSJA 4FDFA 3RJMB 2ADCA 3W7BA 1RYRA 5C2GA 2ZD1A 1RWPB 4DZ6A 4DV6J 4J9QA 4ED6A 3FBFA 4OMFG 2KFYA 2HLTA 4LRFA 3GIJA 1YIJS 1SKSA 2FIUA 2V2KA 3CVKA 2PSZA 3HD1A 1R31A 1RT6A 2FUG9 1YJRA 1Z2LA 3HFZB 1CULB 5KTQA 1S0NA 1ZAVA 2KU7A 3VVTA 5I3QA 3Q86A 2UVVA 1WI8A 1EP4A 3HT0A 4LR9A 1N32J 3KWMA 2UXCF 3PYEA 4K5SA 3OFFA 4NEYA 3IWXA 1M5SA 4DUZJ 4JOUA 3KMQA 4ZIVA 2WONB 1QUVA 2CVIA 3R5GA 4ID8A 3RYLA 3SIPB 3U7JA 4OYAA 3QJJA 3NMRA 1FJCA 4DN0A 1Q16B 2IHR1 3E8OA 1CQNA 4N47A 4ED2A 1HLWA 2E9TA 1QAJA 1F9EB 3GB0A 2UXBF 1FXRA 1H7XA 3M1VB 2FZKB 1BY9A 2JLFA 4PXBA 4USHA 3TW0A 5LT5A 1U6ZA 4LFAJ 4WFBQ 3RRKA 4UUWA 2KXFA 2QC3A 2ATLA 4M5JA 3NL0A 4ZK7M 3HHNB 1FK9B 2HQDA 1HBOB 3G82A 3LQVA 1TV6A 1GMUA 2DNMA 1RTZA 1U2CA 1CJUA 3VV2B 1REGX 4JI5J 1S1XB 1TAUA 2PI4A 1HFEL 4A8FA 2HAFA 2XZDB 4FF2A 3V6DB 2FLNA 3MFHA 1N34F 5E3AA 3IMQJ 3AOCA 1HYSB 4LF8F 2JVRA 2IBOA 3O6QA 4X4OA 1VK8A 1ZYQA 2C2KB 1U2FA 2R2SA 1FKOB 5G4DA 4FF1A 5A2QU 1MNEA 2DXDA 3HHLB 5IV4A 4ZN3A 3P4UB 2VDHA 1VI7A 1SH3A 2W1BA 4RZRA 2HHUA 5J1PA 4BS2A 4R0JA 3FFIA 4ETZA 1R43A 3WX4A 2RIJA 1UEKA 4N41A 2DHHA 2POKA 2R7SA 2AEFA 3UVJB 2HQIA 2C2NA 1TK0A 3GYXB 4WKYA 3QAEA 1C1BB 2GO8A 1I94F 1AZSB 3DOMA 5IOLA 1N5QA 2ZDOA 1SJ4P 4MMOA 1RWNB 5K8NA 2Q66A 1RBAA 2DNQA 2GHVC 1WF0A 2DNHA 3Q83A 4MYUA 2WCXA 4ZVQB 2M8DB 4DI6A 3CIZA 4K4VA 2CQ3A 2B56A 4WBFA 2Y9HA 1M5PC 2XMTA 4PYDA 2GNKA 2JSXA 1VLYA 2J9EA 1B7FA 4Z7YA 4BDPA 3M6VA 4MKYA 2OPSB 3QLHB 5IQQA 2C3PA 4IOCQ 1DURA 1JMTA 1EKSA 3PJ9A 3I5AA 4LFBJ 2EPIA 4I0WA 3D6FB 3MAAB 4EWTA 2CQBA 2XQCA 4ECXA 3K8WA 4DL7A 1T9TA 4UW2A 3CCUS 5HATA 2B9WA 5KFQA 3O1LA 2CWKA 2PA3A 3K2YA 1YK9A 4AT1B 4YDDB 3OSNA 4ED1A 3GYNA 3MM6B 5JVGQ 1S4EA 5HROA 2DITA 2KYZA 5HK4A 5B08A 2QA1A 3HVAA 4KT0C 1H98A 3MEEB 3FQLA 4ZVFA 5T7LB 4IG0B 4DX6A 4H4KA 1DHMA 1JKHB 2C2RA 4G1QB 5KFAA 4O3OA 4YR3A 2MQOA 2IDLA 1Q79A 2D69A 2VKRA 3CJ3A 4LVOP 4N77A 5GVQA 2WAQD 1RACB 4EGLA 2RVJA 2R8IA 4JYAF 5DLFA 1AT1B 2G13A 2QFIA 3EXCX 3H5SA 3M8WA 3UFCX 1WOSA 3KLEA 2G9OA 2VPWB 2O1PA 5D0EA 2D9PA 4KH1B 4OZNA 4X4PA 4KGVB 5KG1A 3TOQA 1TKTA 4ELVA 1IR1A 5IM0B 1VQLS 2K3IA 2HRTA 1E6VB 1OYDA 3KG4A 5B0EA 4LSNB 1NDCA 2BR0A 1QVFR 1VMBA 3DHWC 4QCLA 3TA2A 2DGTA 2QX0A 3NNHA 3IR6B 2J5AA 5E0OA 4JI0F 1RADB 2ATCB 1VBZA 2R9LA 3ZNUA 4B3OA 3ILLA 4ZIWA 1N6QA 1U6FA 3HT3A 4ELTA 1N5YA 1T95A 2ZKTA 1KQFB 3M8YA 1IJFB 2IMOA 4UQGA 4X66F 1QAXA 3H8YA 2CA9A 1J5OB 2UUAJ 2C2OB 2WOMA 3A3NB 3HD2A 3QJPA 4GMKA 2MKCA 4DEZA 4NLGA 3MPDA 3ZZYA 1H0HB 3SCJE 4FBTA 1JLAA 3N79A 4AYBD 3B54A 3W2WB 5ADZA 1S6OA 1HPZB 1YJVA 3MMCA 4CLSA 1C0UB 4J9RA 4LF8J 2CPYA 2R3VA 2NR0A 1VGYA 3R8YA 2NUUG 3PKMA 4G1IA 4TY8B 5KFYA 2HQGA 1H2TZ 5C42B 4UOCA 4CRJA 1HW8A 1WC3A 4TYAA 2J0XA 3CJKA 3SFGA 1P27B 3W64A 4E2FB 4A8MP 2W25A 1N56A 2HFOA 4C8NA 4DFMA 3VQSA 1N5VA 2CJXB 2EBEA 2W2PP 3JSRA 5K14A 2AYEA 1X60A 2N82B 5LSOA 4F8RA 5HQLA 3HK2A 2KTQA 2HIQA 4I64A 2P9EA 1C4AA 3IFEA 4ZN1A 2LA6A 4BWJA 5GAGI 1VRUB 3I56S 3V81B 4DR7J 1UVKA 5ETQA 4JI6F 3HPOA 3SI8A 1B7YB 1RAEB 1S79A 3NG8A 3V6KA 2JHEA 4J5OA 1SKRA 2FHOB 5AE3A 1UVIA 1YLXA 3FRYA 4K4UA 3GV5B 2FHKA 3R6GB 3R3TA 3C19A 1AYEA 3B82A 3AB2B 3CNQP 1TKZA 1RLDA 3BF4A 4HHHA 4R25A 3M2VB 4CM0A 4YR2A 2VD3A 1S5ZA 3VCDA 1LW2A 3TAMA 2B7CB 3DLKB 4DQRA 5A8WB 1VFJA 1RWWB 1PC4A 2DGVA 2X51A 5E3QA 5I42B 4A8WA 4LF6F 1UL3A 2EFOA 4CLKA 1TU0B 4WWSA 2LLZA 4B3SF 2RT3A 3ILIA 2QG9B 3QRPA 3W9HA 5I4MA 3OJSA 2BQUA 1CJKB 3EMTA 1HWUA 3UD5A 4NRTA 2I1RA 4X4TA 4B9SA 4OYMA 2LDYA 3LAKA 2IRXA 1UJ4A 1RQ0A 4X62J 2UVUA 2Y1JA 4IUFA 2CQIA 2FTRA 2IY5B 2UV8G 3N6NA 3MXHP 1NSKL 2DNOA 2NUHA 3CJTA 1ZAWA 4G65A 1QD1A 3L4BC 2MSSA 1KS2A 3B78A 2KHCA 3JTNA 1RT4A 2OMLA 2V4RA 4D3GA 1MLAA 4WFYA 4DLGA 3DI6B 3KNAA 4JV2A 4WU2A 3R7SB 3I32A 1UVNA 1N33F 3O3LA 3BO3A 3FSIA 2C2DA 2J6SA 4DR3F 3UR0A 5HLFB 3QFHA 3HCXA 1FDAA 1YITS 3CJ0A 2G2OA 3P6YC 2DIUA 3UNYA 2XCPA 1F1BB 3CSKA 1FA0A 2QTWA 2V67A 4M1KA 2GVDA 3UW1A 2ZOMA 2UU9J 3KLFB 5F8HA 2VH7A 2FDNA 2QV6A 4N8NA 3OJUA 3POTB 3TI0A 5KG3A 2MQMA 3W2VB 4MJKA 1RT1A 4ANCA 3DXSX 1QE1B 1RAIB 1U26A 2BJ7A 4K2JA 4RLEA 2R7XA 3AB4B 2A6OA 3T1AA 3MM6A 1HI0P 2O66A 1VRUA 4Q2LA 4NLSA 4ZVOB 3PTWA 2NYHA 3A8EA 5M2UA 2EXUA 4CP5A 2XCAA 3LPYA 1XNRJ 1FHTA 2RQ4A 1X7VA 3Q22A 2PI5A 3TUIC 2OEMA 1Q8KA 1UP1A 3H2LA 4PG6A 4QR1A 1X5PA 2Z4PA 3I55S 1MWQA 3BBFA 5K8OA 4DV7J 1HBUB 2V4QA 1HNZJ 5LJ3Y 1M5KC 4ED8A 2AWZA 5FLXU 3ZZZA 3V4IB 1YJ7A 5E2QA 1IJEB 2ZBCA 3GJSB 4NLVA 3SV3A 2XY7A 3U1LA 1IBLF 2XS5A 2FY8A 2I9SA 4I7FB 1HIYA 3NOCA 1MWZA 4OX7A 4WTYA 3J80U 2DPJA 1VQYA 4KR0B 2GQCA 1ZZNA 2DNLA 3EGNA 3OD2A 4F4ZA 1LXNA 2X3GA 1JLGB 4OI6A 3VGUA 2MJUA 2PGCA 3US5A 1OPIA 1TMMA 1WOOA 5GMEA 2V9KA 4CCHA 3TVZA 4LF7F 5LMNF 4GC7A 2ASYA 1G2EA 1N32F 5H9EJ 4K4YA 4JV5J 1RTJB 2CADA 5B0BA 2AX1A 4CO2A 2QFJA 3I0SA 4EMDA 4NA3A 3GILA 1RB0A 4KHMA 3L95X 2J9CA 2EW9A 3QPIA 1S1TB 1S48A 2DHGA 2IM0A 2L9WA 5KFXA 4CYUA 4WK1A 1OSDA 3EX7B 3BSOA 2GQQA 3PW5A 2QEXS 3I0RB 1FI4A 1IUJA 2AT1B 1CJTB 2VG6A 4H4MA 2ZHAA 4Y3CA 1NJIT 2DPIA 5L9NA 1WNEA 3TR5A 3TVKA 2X1AA 4Q2MA 1A9NB 5D4PA 1RHKB 3M8ZA 5JUMA 4CDIA 3BGRB 1NM2A 3CT9A 3FCVA 3MM8B 1K9MT 2HBZB 4NYOA 3V6DA 3W5YA 4X4VA 3RGIA 2BKNA 2B6AA 5F8NA 1X4DA 4NXNF 1SC4B 5ITHA 1N33J 1EB0A 4OX9J 3MM7B 1ZA1B 4NCGB 2UZAA 4A8XA 3M9NB 1PSDA 1CSJA 2JDJA 3HKWA 2VJUA 3VAIA 3M6UA 1YJUA 4MAKA 4DR1J 3RB6A 1U7LA 4DL0C 1B0PA 2R7RA 1WC1A 2E5GA 1UFWA 1VRTA 4X4QA 4L72B 2IAJB 2XSJA 1K73T 3VZIA 3FQKA 2XMJA 2MDAA 5FDLA 2BABA 1FWPA 5IT9U 4K50A 2KJVA 3HZGA 4WE1A 1FJGJ 4OZ1A 2HVDA 4IO9Q 4DQQA 4ZP8A 2G0IA 1RT5B 1S9GB 2ZDPA 2YKAA 3SQOP 3QIPA 4ZJLA 4MTPA 5F8IA 1T02A 3ADAC 3LW5C 5JXSA 3W8PA 1JLCA 2FLOA 3KDNA 4OQJA 3V4MA 1QAIA 2BMBA 4C0BA 1R3NA 3NMAA 3IA0A 1JJCB 5SUHA 1ZM4A 1SH2A 4ZA1A 1O5JA 2ZOGA 3OTDA 3P8BB 1RAAB 3QLHA 2VFRA 2L9NA 3R5AA 3DLLQ 4I67A 3CXCR 4BWMA 3GV7B 2IVMA 3PJWA 2ABYA 3MAAA 2YKMA 2OSQA 4PWWA 2JX2A 2B4PA 3M8QB 4DPWA 3EZ5A 4Z7CA 4DPUA 1S4FA 1VS3A 3LP2A 4LIWA 2BZ2A 1VBXA 1HR0F 1UWAA 3Q8SB 4MIAA 1TVRB 3M2RA 7AT1B 3A1YG 4J90A 4OZ2A 1Q8LA 4NLTA 5F0UA 3VGVA 2VUGA 3DM2B 3NEKA 3ZZRA 2Q6BA 4DU7A 2LEPA 1CJTA 2DR9A 3KFWX 3H0PA 2HNDA 1D3WA 1RU2A 2G1DA 4OI3A 5KFRA 2ZH7A 1BD6A 2HGMA 1RSCA 2QZ8A 2KL8A 2NCKL 4CI0B 2PE8A 2MQQA 3MUVP 1EAYC 4KJIA 4OL8A 1IR0A 2VQEJ 2EG1A 1ICEB 2R8JA 3KJNB 2ZKUA 1UVMA 1RWUA 1UA1A 1MMLA 3MZIA 1RUSA 1S97A 3FFIB 5I3PA 3MAQA 1T3NA 1X4HA 1LEOA 5CYJA 3HO1A 1N52B 1VQ6S 2B7BB 5HJYA 1RKIA 4F04B 4USVA 1FDDA 2KRBA 1IKYB 2E5HA 2Z2YB 4ID5A 3TWZA 5RUBA 2WVCA 1MROB 4ETXA 2D9OA 1NLKL 2QLBB 3MPVA 1RLCL 5B0FA 3E2EA 4B3OB 4U96A 2VC0A 3IM8A 2AX0A 2JEFA 3TUPA 3OV7A 1H73A 2E5JA 3DOLA 5HL7Q 4QBUA 1SC3B 2OPQA 3HLUA 1S59A 3CF5Q 1U1RA 3FSXA 2WZ1A 2HVEA 3A8KA 5BYRA 3KJVB 2R2RA 2X1FA 3DXBA 4ZVTB 3OR2B 3SV4A 1JLEB 2WW4A 4QWCA 3M9MB 4AQYJ 5DLGA 4X64J 5HBMA 2OGUA 4HI2A 1RT7A 4FZVA 3QJLA 2AJ1A 1XC9A 1FTRA 4ZHRA 3SZ2A 2R42A 5HO4A 2NSCA 4CLWA 2GGPA 3BO2A 3IS9A 3RW7A 1QSSA 1RZMA 2HFSA 3E51A 2FJVA 4U8YA 3T6JA 4F4AA 1GK8A 5D15A 3D1HA 4FN5A 4QWEA 5KFPA 2FVQA 1DY3A 3AJ1A 4HACB 3FNNA 1FEHA 4J9LA 1LOUA 2L3MA 4NZ7A 1HARA 3RRGA 1K1QA 3HX9A 1XERA 1KWMA 3M8SA 2IVYA 4EFAC 2HMIA 2DEIA 1HNIB 3OTCA 3PNIA 1LQ9A 1VLOA 5BYQA 2JOQA 4PR6A 3VAHA 3AOBA 2YXLA 3ONQA 1RGVA 1Q8BA 2PDAA 5H9FJ 2ZNZA 2MQNA 2W2MP 4JBCA 4DL3A 2DRDA 4DN9A 2GA7A 3MEGB 1WEYA 4RU2A 2NXJA 3OQ2A 4F3OA 3OVSA 3H4DA 3MM8A 5C24B 3TYTA 1NUEA 1JXLA 4I6YA 2XYPB 3Q0AA 3GPAA 3TAMB 1L3VA 2DT9A 4J9UE 4OJ1A 4IQMA 5DG8A 2AU0A 4JI5F 6AT1B 1WELA 5HN0A 3RBEA 4C0OC 3G82B 5ETRA 4B02A 3G96A 4ES2A 1M5HA 2F40A 3ENVA 3M8PB 3C16B 4HHJA 3UPFA 5HP1B 2MLYA 2X7IA 3OR1B 3UE2A 5EN1A 4Y2IA 3SMZA 1YZ6A 2LXUA 2XLIA 1SJ3P 3OUYB 2YPZA 3I4PA 2KRRA 3AH6A 3HSJA 2H5JB 1DTQB 2E1RA 4DV5F 1RTDA 1XQIA 4PQUA 2BBEA 4C48A 1FKOA 1SPBP 3TJ8A 2ASJA 1ZTWA 1TV6B 4XO0A 3NGDA 4F67A 1AROP 4RNNA 4OHWA 3D54A 1ZH5A 3T19A 2A6MA 3QO9B 4WE1B 5JMNA 3TAQA 1BQMB 4B3MF 2QYCA 4F4KA 2OPPA 1KC8T 1B4SA 1IKVB 3MGJA 1IBMF 4C8KA 2HBYB 4JI0J 4QIFA 3KHHA 4USKA 2YX4A 1RT7B 3PDNA 4YQWA 1KN6A 4TU7A 1NMEB 1OY8A 1MG7A 1K1SA 3EXYA 2FZGB 1RHJB 3D3BJ 2DK2A 3PX6A 1HW9A 2HURA 2CQDA 2IRYA 2RQMA 2WW8A 3BH7B 1D9AA 3C66A 3FRZA 3M6XA 4HEA9 4L6V3 1U09A 4QQBA 1NHUA 4DR2F 4USIA 2ZJQQ 3I82A 6FDRA 2BM1A 1UPPA 1A7GE 1F3FA 2DD8S 2QIFA 2NPFA 4DV0J 3BGOP 1Z1ZA 1SI9A 4IDKB 4J9OA 4ECVA 4KFBB 2DNZA 2XGQA 3SDEB 5B09A 2W7AA 3VVUA 5AJ3F 2CPZA 1TZ0A 4OX8A 5HQMA 2KM8C 3QAUA 3T3FA
chains in the Genus database with same CATH topology
2HWIA 2ZD1B 3CIMA 5DDOC 1UEVA 3L09A 2UUCF 5D4NA 5D8HB 5E5NA 2LCWA 4DBQA 3V6HA 2HYIB 2XWXA 1G6BA 1XK8A 3HHLC 3X3UA 4OZ0A 3OFHA 3PIOQ 1X4GA 2LDIA 4R8UA 1KQKA 3M8RA 2FC8A 1ZM9A 4RW8A 3HVWA 4CTAA 3CUNA 1R6YA 2AYBA 1GAOA 3K5PA 1X4BA 4KO0B 4XDCA 1YJNS 4RW4A 2NPIA 5EWGA 2MZJA 3UWTA 4CO0A 1VOMA 2CPIA 2ILYA 1ROFA 2Y1RI 4RUHA 4CO5A 5KFHA 3V6JA 4B17A 2B4OA 3CCTA 4ZPDA 2KG1A 4C8OA 4KC5A 3UR3C 2RD5C 3JYTA 1CQMA 1GTHA 2DR8A 2HWTA 1HWKA 2MZSA 2VG6B 2QA4G 4LQ3A 1B64A 1JKHA 3K0JA 1VK3A 4HDHA 2YNGA 3GWCA 2IM1A 2CPXA 2VFUA 1X5OA 4PPZA 4X4RA 2E9ZA 2Z2MA 3HM9A 2IJNA 1X9MA 1SV5A 3GIKA 4OLPA 1H2VZ 2R7TA 4ZPCA 4X4SA 1SQEA 2MKSA 4D3HA 1S1UA 5M2PA 2VOPA 3R5DA 2YX1A 1JK9B 3E01B 4QWDA 4IO1A 2M2BA 5HMXA 2EVZA 2YKOA 1O0PA 3U27A 3KLIA 3SFUA 1X9WA 4PG7A 3R5BA 5EX0A 4C8MA 2N4CA 4C2MA 2G0CA 5D4LA 4AXIA 3IWLA 2P5VA 4EBEA 2MYFA 2R7WA 1ZOTA 1DLOA 1N5TA 2QE5A 1FRKA 4JUZA 3DYAA 2P6TA 4O3NA 4M5DB 1KFSA 5GAEU 1F5CA 2XY5A 3POTA 1T8EA 3ISZA 3QYYA 1FVQA 1APSA 4ILLA 2VG5B 3DLHA 2IAJA 2XSJB 2ZFHA 2E9RX 1MU2A 1KOHA 4DUYF 2CVEA 3CCQS 1S6UA 4TLRA 3TUZC 4DDFA 4NLWA 3Q24A 1SL2A 1IBKF 3NCQA 4KIAA 1TKXB 4R8UB 2VG7A 4R5PB 5KOXA 3RB0A 3DMJB 1YI2S 2F1FA 2HPUA 3LF0A 1IM4A 2JC1A 4TU9A 4DQPA 3BR9A 5C24A 2VBXA 3DU6A 1U1KA 5E3PA 2Y1IA 2FC9A 3DN9A 3D28A 4WFXA 1TFYA 3LP1B 2RS2A 1Z2ZA 1LFWA 2OD6A 1CPZA 4H4OB 5E7OB 4QU6A 1X4EA 3UDLA 1U6BA 3I6PA 2ROEA 4IFVB 5A0YB 3RB3A 3QWUA 1WEXA 1HNVB 3T9NA 4MIWA 3N0VA 3CCVS 4H4KC 5F3ZA 1YJWS 3NGKA 2J6UA 4OJGA 3GZ7A 5D6GA 1MMDA 1C0TA 1Y4ZB 1T05B 2NS1B 2UUBF 2K2PA 1SB6A 3H98A 2KT5A 4LF9F 5HMYA 1DQAA 2VB6A 1TR0A 2ZHOA 4XPCA 3BQ2A 1DLOB 5IQ6A 4RW9B 4IRCA 1NAQA 2VA2A 2ZZMA 1QM9A 3I96A 4ZPWR 4YMEA 1HWLA 4RUAA 5M2RA 4C98A 1YRUA 2GHWA 1KOOA 1H3DA 2J7WA 2VBYA 4DJBA 1KNZA 1S0MA 2HS4A 2JJ4D 5EDWA 4OI0A 3P49B 3L7OA 5KT5A 3THPA 5C25B 1QVGR 1L3SA 3DRYA 4Y0FA 3TA1A 2JEJA 2AV5A 5IWAF 3T6BA 3J7A1 3N4WA 4M8LA 2QLWA 5I3UA 2WHOA 3SSSA 3KK3A 2EFVA 4G1PA 5KT6A 2ZM6F 4LF4F 4QWBA 3M30A 4E0DA 1PO6A 2CZ4A 2W7PA 2FHJD 2DHAA 3CCSS 5JVHQ 2DNPA 2V94A 3OXFA 3M4XA 3CB4A 4N5SA 4JV5F 4RNFA 5K8MA 3KG1A 2WBMA 3HFKA 4B9VA 3IRXB 2M9KA 2YNIB 4F50A 4TN2A 2GX8A 4O4GB 4RW7A 2KXNB 4B3RF 2HVIA 4PXDA 2AP6A 4ATNA 2NSBA 5J2NB 2MGZA 2W9AA 3VAJA 3DM2A 3BS9A 4ZDNA 2XS7A 3L3CA 1Y7PA 4I69A 3D2WA 1TL3A 2GW8A 2PO4A 4LFCF 4O3SA 5A8WA 3EPIA 2E1MC 2M0GB 1HMVA 3F41A 2LA4A 4IQXA 2DNGA 2HZCA 5HQ8A 2XMVA 1RA6A 5CYQA 3VALA 4DR1F 3NP5A 4NA2A 1FF2A 2H5EA 3DOLB 2OMOA 5L1LA 4RBTA 2ZC3A 4LSLA 4ZP6A 1FRLA 2VQEF 3BGLA 4A8SA 4ID5B 5KT3A 3KJVA 2M4MA 1AXQA 3OW2R 4C8LA 4OHVA 2CJQA 3CD7A 2CG4A 1ZAXA 2MPUA 1F5AA 5KFFA 3FSYA 3KNGA 2MJNA 3DI6A 3O5TB 4O3PA 2RILA 3QO9A 1CVJA 2OPSA 1KVIA 2VOOA 4A4JA 4URGA 1VQ9S 3Q8QB 2C3UA 4DPOA 2A3JA 3CMAS 1SH0A 2GIRA 3G6ES 4NX9A 1Q81T 2YNFA 4GKKF 1S1VA 3EUNA 3HHLD 4FNIA 1ZETA 2L48A 4J9MA 2VPYB 3MWBA 3NBPA 5KFVA 2RF2B 4EU0A 2DGUA 3LP1A 3MTKA 2YKPA 3BM7A 3RB4A 3G86A 1UVJA 2DNRA 3LALA 1RTIA 2FJAB 1YRTA 1SUQA 2ROPA 3GFZA 2ZOFA 3IG1B 4I4BA 2D1CA 4NCBA 4YEAA 4ZPAA 4TQSA 2VASA 3D5MA 4OV1A 5LL6d 1HNXF 2MKJA 4RW8B 4FVCA 2UV8A 4CTAB 1KEKA 4TU8A 3Q8RB 2OTJS 3PACA 2OPRA 3DRXA 1NEEA 3I4HX 1JLBB 2OD4A 2RE1A 4FNHA 3JSYA 1KQSR 3ZZ0A 2RDIA 4HYKA 2ZH1A 4QYZJ 2VPZB 1DFDA 3RAXA 2ACYA 1OS5A 4WF9Q 1HD0A 1KONA 3PHEA 1RTHA 1RT3A 1TKDA 5CQGA 2EFQA 2DR5A 3GR1A 3PW0A 3V81A 2ZZNA 1ZBTA 2OTLS 1E6YA 2MKKA 3MMJA 5IFMA 2DO0A 4EYIB 4A8YA 3QWPA 3DC2A 1SJRA 2DTJA 3OHBA 4PWDA 3CJ2A 3PJXA 5KG0A 1F2GA 4KGKA 1AUDA 2ZBIA 4FXWA 3ITHA 3CCMS 1GXTA 4A8OA 3J7YU 2VQFF 1G1XA 1FERA 3MMAB 1WACA 2HVZA 1DTQA 1S49A 1SBRA 4OZLA 4YB1P 2XLKA 3IRWP 4V19X 1IKYA 5C42A 2NZ4A 2OP5A 2W4DA 4NRUA 1M5OC 1WG1A 4ICLA 4PCQA 1TQLA 2WRMA 2RU3A 1ZM3A 3PR5B 2YQ3A 2NXUA 5L1KA 4MKAA 1FRMA 1RA7A 3HJFA 3QZ8A 3ETOA 2XSFA 1IKWA 2CQ2A 2C3YA 2HLUA 3N5FA 5F0WA 2FGCA 5DETA 3BR8A 2HHXA 3G9CA 2ZH2A 1XR6A 4O4GA 3MECA 2I8EA 1XTZA 1F5BA 5DDQC 4DR6F 3K58A 1WHXA 1WF2A 4RBUA 2VV5A 4C11B 5J2QA 4IOBA 5KFUA 3HVRA 2ZH3A 3TA0A 5EGYA 2MXYA 1REVA 4OJHA 4URQU 5KFJA 2CFXA 5KFNA 1Q86T 3UQSA 1VQSA 1R0AB 2GGPB 3P5TL 2E1CA 1YTYA 4J37A 3JTPA 4WZQA 2RU9A 3QGHA 4ZPBA 5IT4A 1HBOA 2XY6A 3CC4S 1F9FA 1YRXA 2V8VA 1CG2A 1NZAA 5DS7A 3M1VA 5GAGU 2LVWA 4QJVA 4NZ6A 2E7XA 5EHHA 1V3RA 3AA9A 3V4IA 1C0TB 1S9EB 3M9OB 1DQ8A 2CPJA 2K3KA 3MOZA 4YB6A 3T1HF 3NLCA 2OAUA 3KHGA 1N0UA 3IR5B 1P1LA 4Q7AA 4ES3A 5J1NA 1TL1B 5AE1A 3K59A 3GSDA 4NZ0A 2E29A 2L08A 1RP5A 1JB0C 1RTDB 1T05A 4PQUB 1UW4A 1UMJA 3KHRA 1VQOS 2AD9A 2B0GA 2MZQA 1HHTP 3E01A 4DLEA 2CPHA 3AHPA 5HP1A 4A8QA 5K8PA 3GV8B 4ZPTR 3KHLA 3T9ZA 1UVLA 2CJKA 3TAPA 1KTQA 4WU3A 4DS5A 1ZPVA 1Y9OA 2DRBA 3N9UC 5GADI 3HHEA 3PFEA 2HG4A 4PG4A 5E41A 5DGAA 2O01C 5KG7A 2XGPA 2V4JA 4G3IA 1WHWA 2CYYA 2ZITA 4PPDA 3RAQA 1TKXA 1X8DA 4ZVGA 2BM0A 5BYSA 4AL6A 4IKAA 3AQOA 2OKQA 2RQCA 3I9ZA 3JSMB 2GV1A 2K7JA 2RKIB 2EFPA 4EO8A 3FEYB 3VZHA 1TUVA 1HI1A 4Z2XA 4QR0A 3KTQA 3OVBA 3T5KA 2CQPA 2C3OA 4AFFA 2C42A 2HHWA 2QT7A 2UVWA 3MM9A 3GIIA 4ECUA 3DDNA 4AUKA 2JEIA 5T7LA 3ITHB 2RSQA 4B9TA 3H20A 2HNZB 1VQ4S 2XNRA 2AJFE 3GMGA 3RU0A 4F2SA 5KFCA 1SJQA 5LMUF 4C8ZA 4OI2A 3ZZOA 3PO4A 3JYTB 5J2NA 1MWYA 2K8GA 2B6AB 4KSEB 2CZVC 3JSBA 4NLPA 4KPYA 1HNVA 3KLHA 1LWCB 4QPTA 4RUCA 4EZ6A 3HHKA 1NNDA 1Y5NB 2OO4A 4USJC 1H6KX 3MMBB 2WSFC 2DH8A 4OI1A 1HMVB 1TL5A 2CQCA 1BC6A 1P8GA 2KFZA 2CJBA 3OTEA 4HH0A 1RJJA 3PKYA 1VC0A 4RWWA 3C8YA 1SL0A 2CPFA 2DIVA 1GT8A 4WIIA 1S1UB 5H1SV 1JX4A 3MURP 1UA0A 2HRYA 2DR7A 2B9XA 4F25A 5A8KA 1LFPA 1HNZF 2YTCA 2BRKA 3H2UB 2EBGA 4MH8A 2W9BB 1NU4A 3UDCA 3J7Z5 3OLAA 1XWLA 3TUJC 2YWKA 3K5LA 2FVPA 1VQKS 3OTOF 2DGOA 3CC7S 2W9CA 2DH9A 4IFYA 5KT7A 4YOEA 4CT8A 1C2PA 1R27B 1S6PA 2UP1A 1ELOA 4DOZA 4G1QA 1TVRA 3HVTB 1TP7A 4DV3F 5J2QB 3GFXA 5CYMB 1FKAF 4AL7A 1FJGF 2BE2B 5CCMA 1VIOA 5JJBA 1S76D 1FNMA 1MU2B 3M2VA 2BV3A 3OLBA 2PA8D 5CD4H 4QU7A 1C4CA 1FE0A 2DGXA 4Y00A 3J7YI 2M5YA 1TKTB 3VAKA 3VR1A 3W3SA 4B9UA 3QIDA 2BJDA 1FNXH 1S0OA 1F60B 1LWFB 5F8MA 1XN9A 3DLGA 4OX9F 6FD1A 2VL1A 4QIWD 5B7WA 1SJFA 2MB0B 1SIZA 2D41A 3S8SA 2ZH6A 4ZS6A 3SEOA 1C1CB 2FHJA 1U1PA 1NJWA 4LVNP 4GO7X 3G8SA 4Y2MA 2YH1A 4ES1A 5DJBA 3NRBA 1NK7A 4JI1F 3HP6A 3BO4A 1RT3B 1JNZB 1Q4RA 1RYSA 1D8YA 3SCIE 2DISA 4KV8A 3BQ0A 2AYGA 4ED5A 2KDOA 3AAWB 3BGUA 2OPQB 1N48A 1S0VA 3PFOA 2HWHA 1V9OA 2N4DA 2YNGB 2I5JB 4RNMA 1C0UA 1NK6A 1MSWD 2FB0A 2E7WA 3AA8A 2G4BA 1HWJA 1S1WB 3OSPA 5IT9Y 3CDAA 3M2UA 4ZCKA 3QGGA 4C7QA 5F8JA 4QWAA 5DM6Q 2Y0SD 3BN7A 1S1VB 4ZCIA 4X62F 1JJ4A 4MFBA 1X4FA 4WYWA 2W9CB 1TFWA 2KTQA 1R7IA 3VAGA 5D77A 1OPZA 2DNYA 3D0HE 2J0QD 2HHVA 4F4XA 1H7WA 2PN6A 3BSCA 4J9SA 5E3RA 1RTIB 2MQLA 4O4RA 3I5CA 3RR7A 3RW6A 5THWA 3NKYA 5SZTA 1F0XA 4PG5A 4Y2CA 3EYZA 2J8AA 5G0RA 2M88A 4QIVA 4I68A 2HNZA 1TL4A 5KT2A 3PW4A 1LW2B 4Q8FA 3GG0A 3TANA 5GMKa 2ZJPQ 5A6WA 3NS6A 1WHYA 2DCUB 3GQCA 2ZJRQ 5KOWA 2C22A 5DDPC 4DSKA 3C46A 3DLGB 4DSLA 2J0SD 1MMNA 1D9FA 2N7YA 4IG0A 3ZZTA 2FJWA 2N3LA 3KLHB 1GX6A 1JLBA 1Z4UA 2AW0A 1KHWA 2V5HG 2YNIA 1NKCA 1REVB 2F3JA 2QA4S 2YWFA 3M8PA 4YB7A 3Q2SC 4YHHF 2ZUGA 4PWDB 4HH1A 1FRJA 3MEEA 1YWXA 3LUYA 1X5TA 3IRXA 2GHPA 4OHZA 1OQ3A 2FD2A 3OPKA 2W7OA 3R1HA 1T3OA 2FY1A