1FE4A

Crystal structure of mercury-hah1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER TRANSPORT PROTEIN ATOX1
publication title Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 20
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fe4A00
3BDEA 2BJDA 4A4JA 2ACYA 1TL4A 1CPZA 3K7RA 3CJKA 2OKQA 2G9OA 1IUJA 3BM7A 4OJGA 2AP6A 4DPOA 1KVJA 1JK9B 2VV5A 1JWWA 3WDOA 1OQ6A 3KKFA 2L3MA 3BN7A 2XMJA 3MCSA 5F0UA 5B0CA 1SI9A 2OAUA 4ZOSA 1AFJA 2ROEA 2FTRA 1MWYA 2FHMA 2K2PA 2K7JA 1XBWA 4A48A 2GCFA 3HHLB 4Y2MA 1Y3KA 1K0VA 2IYGA 3UDCA 3HFKA 1TZ0A 1X8DA 2LQ9A 1TL5A 2RMLA 5F0WA 2KKHA 3HX9A 1YJUA 1FEEA 2KYZA 3FRYA 5A6PA 4Y2IA 2BJEA 3HHLD 2QYCA 4OJHA 2OFGX 3F44A 1URRA 1MWZA 2N4DA 2OD4A 2QLWA 2ASYA 3HHLA 2N4CA 2GFFA 4OJ1A 4Y2KA 2LQBA 3BB5A 3LO3A 2OMOA 1N5TA 2FIUA 2LXFA 2Q3PA 1AW0A 2VH7A 2OD6A 4A47A 4Q2MA 4HH0A 5A6WA 4HI1A 4U9RA 3TNVA 2GGPB 2ZDPA 5KAKA 2AJ0A 5B0FA 1YJRA 4DL0C 3IWLA 2AJ1A 1S6OA 2QLXA 3IWXA 1FD8A 1X0PA 2QIFA 2FB0A 3KG1A 1QUPA 1VQYA 2AW0A 1FE4A 2ZDOA 3BF4A 2PD1A 4ZA1A 2BUNA 2IYIA 5B09A 1N5VA 2OP5A 2GGPA 2K7KA 4YDXA 1Q8LA 5T7LB 4EFAC 5K9FA 5IXUA 2PGCA 3VTIA 4HL9A 2N7YA 3LGNA 1N5QA 2W4DA 1ULRA 3MZIA 3QMQA 4NPOA 1OSDA 5B0AA 2KT3A 5B0DA 2K1RB 1Q4RA 1S6UA 2GO8A 1TR0A 4A46A 4F67A 2RU9A 1KQKA 1AFIA 4Q2LA 5T7LA 2BBEA 3TOQA 2HQIA 2OFHX 1Q53A 1SB6A 3FGVA 1V3ZA 2RILA 2W4CA 1X7VA 2BYCA 3LGMA 3KG0A 3DXSX 5B0EA 1P8GA 1FVSA 2HFOA 2XMWA 1R6YA 2K1RA 4HI2A 2RSQA 3HDSA 1APSA 3E8OA 2XMMA 2LDIA 2XMKA 5B0GA 1Q8BA 1TUVA 1YG0A 2XMVA 2XMUA 3FMBA 5B0BA 1GXUA 1YRXA 1OQ3A 2XMTA 3BR8A 3HHLC 3T9NA 2W4PA 3HF5A 1U7LA 2HIQA 4DN9A 1Y3JA 4QOTA 1P6TA 4HH1A 2JDJA 2GA7A 3BGUA 1CC8A 3TRGA 1OPZA 1FE0A 2CRLA 3DCAA 1KVIA 5B08A 1WD6A 2GV1A 2HLTA 2EW9A 1Y0HA 3QGPA 1VQSA 1FESA 4NL5A 2HLUA 3CJKB 3I9ZA 1W2IA 4YEAA 1FVQA 1LQ9A 2HFNA 2ROPA 3KNGA 1Y9OA 2ROGA 3GZ7A 1GXTA 4FNIA 4OIXA 1SQEA 2KT2A 1N5SA 1CC7A 4FNHA 2IFXA 4OJ3A 1YJVA 1RJJA 1YJTA
chains in the Genus database with same CATH superfamily
1VBXA 1NHVA 1W26A 4ECWA 2Z30B 4J9KA 3DYAB 3DOMA 3HSJA 2O5DA 2R8GA 1WC4A 2KTQA 2HZVA 4IQXA 3MEEA 1RWOB 2OD4A 5EDWA 1Q1KA 3J7YI 2IA6A 1QUVA 3W63A 2MLZA 1I5OB 1UWBA 3PW0A 2VICA 3MURP 3P96A 5BJRA 1X31C 1AFIA 1RBAA 3PACA 4N47A 3BPDA 4TLRA 3FBEA 4Y6IA 2ZKUA 2B8PA 3CD7A 2HNZB 3GIMA 2BMBA 5I3QA 1F3VA 2CQHA 2OH2A 1EP4A 2XLIA 3K8WA 3CTRA 1J5EF 1RHJB 2BW7A 3SFGA 1ZS6A 2NLWA 2CYYA 4WF9Q 3PX6A 5IWAJ 5HROA 5E3PA 2HW3A 1MU2A 3D68A 3BSAA 3X1LB 4O0IA 4YFUA 3MTKA 2BDPA 5KFHA 3EPIA 4F4XA 4UF4A 1NO8A 1ZZNA 3HHLD 1EB0A 1HA1A 4PWUA 4PEOA 2E9RX 3M4XA 1KKHA 2BA9A 4ANEA 3IRXA 5B7WA 2JVOA 4MT1A 3V6KA 1S10A 2F4VF 2MEWA 1OYEA 3MR6A 2PIIA 1ZM2A 2LDYA 3A3OB 2JJ4D 1NHUA 1JLQA 1ZA1B 5IM0A 3TO8A 1NMEB 4K0KJ 5D0EA 3PW7A 2JNJA 2IDEA 2VDHA 1FRKA 4CH1A 2IC3A 3BYRA 1TVRB 4CT8A 2NPFA 4KGVB 3Q8RB 4ZCLA 4L3KA 2BR0A 3V6JA 4AUKA 3OFFA 2HK2A 1N8RT 3GWCA 4DCPB 1VK8A 1VQSA 4YS2A 1RU2A 2KJWA 1WJ9A 3KNGA 3W64A 1P27B 3R5BA 4J9SA 1YJVA 4AXJA 1S79A 2X7IA 3PY8A 4ZLNA 2DRDA 3OL9A 2N7CA 2CQGA 1IKVB 4QIVA 2XMJA 5D4LA 4USVA 3MPDA 4CO4A 2DGTA 2HBQB 2RQCA 1LKZA 3AA8A 3MR3A 2XM3A 1FF2A 2DNKA 3Q8VA 5GMDA 1JNRB 1N5TA 2FC9A 1N6QA 3NGDA 1X60A 2U1AA 3OTEA 3GJQB 3D7SB 2R7OA 3M6VA 1S99A 1HBMA 3NG8A 4G65A 1NDPA 2LEBA 4DR2J 1UZHA 4U6PA 2R7QA 2GVDB 3GIJA 2HFOA 2ZBIA 4QU7A 3PW5A 4DCOB 4NXMJ 3GFXA 4CZCA 4TY9A 4B9VA 4LJMA 2CAJA 4DLGA 3PFEA 1LWFA 1C1BB 1DTQA 2VF3A 2RKIB 3E01B 3CO0P 3CJ2A 3TI0A 4IRKA 3M8QA 4QR0A 1S77D 2IJFA 4J9NA 2JLEA 4JI3F 2L3MA 1F6TA 1ZBTA 1UEKA 3KLGA 4F3OA 2OPSA 2L41A 4F2SA 1HL6A 4Y2MA 1WC1A 4P71A 4RW7A 3W8PA 1Y10A 5A2QY 4I7FB 3QJLA 4OFZA 4O4RA 4RPFA 4L6V3 4JBCA 2Q3PA 4RW6A 4EGLA 3MECB 4WFNQ 3C3LA 1NKBA 3BS9A 3FCHA 1HI1A 2B6AA 4X62F 3B78A 5LJ5Y 4DSIA 2PD1A 1YJ9S 4J9OA 4DR3F 1L3SA 1TMMA 3KUEA 4R5PA 2ZWPA 2Z2MA 3M6XA 3R2DJ 3HT0A 2AGOA 1S6UA 3LW5C 3Q24A 5FJ4A 2E7VA 4NLXA 1CSJA 5K8PA 1FVSA 2FGCA 4YB1P 1IBMF 3KDNA 1GX5A 1PSDA 1NK9A 1WTFA 5IQ6A 4H4OB 3NMAA 3H4DA 2E66A 4OV6A 5K8OA 3C6TB 2MB0B 1TKXA 5CXTA 3FEXB 2B51A 2ZOGA 5GADI 1D9DA 3DLJA 3HD1A 4CI0B 1KVKA 7FDRA 1JMTA 2DPIA 2NS1B 4ZK7M 5I42B 1RACB 2AMCB 3MM5B 2X51A 4N77A 3C6UA 1RWWB 1LWCB 3SMZA 3C19A 4RBUA 3THVA 2KO1A 4Z7CA 2KYXA 5HQMA 1TKTA 3ZZZA 4KAIA 1KWMA 2KRRA 3EGNA 2QLXA 2E9ZA 4DQIA 1LEOA 2J6TA 3BH7B 1XERA 1HBNA 4FF1A 2A1BA 4DV1F 1Q16B 4BS2A 3NNCA 1VI7A 2C3UA 1HI8A 4F67A 1K9MT 3ICLA 4WFYA 3W5YA 3FRZA 2ZH8A 3RB6A 3UD3P 4AXIA 5J1NA 4MIWA 3HKWA 4TYAA 2K06A 2XWXA 2KZZA 4F4KA 5KFBA 3TUPA 2R4FA 1FJGF 2VFUA 4I1TA 2IRYA 3NP5A 2BANA 2J5AA 2UVWA 1BQNB 3ILJA 3HSGA 4F4WA 3OR1B 1YJTA 1Y11A 3V4IA 2LLZA 4AE5A 3C16B 3P6YC 2CADA 2VKZG 4KRWA 2BV3A 2V50A 1HQEA 2W2OP 4UZCA 1VCTA 1NDCA 5KAKA 3BSOA 1GT8A 4ID5B 1Q78A 3MAAB 1DY3A 1KTVA 2E5LF 1XMOJ 1EIYB 3IBCB 1VBZA 3TVYA 3MUMP 1Q81T 1R8AA 2RU9A 3RBDA 4Q2LA 5DG9A 2GNKA 2CG8A 4PG8A 3BO3A 1Q5VA 2XSFA 4H4KA 4ZITA 2OSRA 4E0DA 1PGZA 4M5IA 3RR7A 4B3OA 2DIVA 5ADZA 3PG9A 4LF1A 4PAAA 2HZAA 1T11A 1FESA 2JFDA 2EI5A 3IGVA 1B4SA 1GXTA 2YH1A 4KE5A 2IFXA 4J9PA 2IDLA 3CJKA 4K4SA 3K2YA 2XBPA 3H59A 5JXSA 2HEKA 2RDJA 5D0RA 3NS6A 2QA1A 1URRA 2RQMA 1N5YA 2QLWA 1AZSA 2CPEA 1HWUA 2V4JB 4YMEA 3MD3A 2DGQA 1XNQJ 2XCAA 2EWHA 1VRUA 3CJRA 2DHXA 4FF3A 3R27A 1FRHA 1WHXA 1DBDA 2BE7D 1HBUB 3VZIA 2MQPA 1PCAA 3TZZA 4OX8A 4ECVA 2B4UA 4CO5A 3DXSX 3A13A 2HVIA 3K89A 2NSBA 2C3PA 2UU9F 4ZVEA 3T1HJ 1NXIA 5E3QA 3CCRS 1SKUB 5IC4B 3GFYA 5L1LA 4HTIA 5CQGA 5DS7A 3KJNB 5J2PA 3F0NA 4ES2A 1TTHB 4C98A 5KOWA 3AJDA 1UMJA 4DV5F 1UPMB 4CCHA 1PJ7A 1RHQB 4I68A 2XHCA 3H5YA 2YKOA 1XMBA 1IQTA 1UTAA 3M8WA 3CDAA 3D0HE 2HQDA 2XLKA 5GAHU 1FRIA 4QR1A 3SQGA 4DU8A 1WEXA 5JJBA 1NSPA 1FK9A 2JWNA 1OIAA 2K8GA 3M8PA 5KFCA 5KG6A 1TUGB 4ED2A 1H7WA 5B0DA 2GO8A 2FY8A 2DTJA 3EE3A 4C8OA 3CCVS 1ZM9A 2KVQE 2VASA 2HVEA 4YR2A 2BJ3A 4XPEA 2UP1A 4HEA9 4OHXA 4ZP6A 1VR6A 1TAUA 3GQCA 2IM0A 3GCXP 3LP2B 1RAEB 3Q0AA 1ROFA 4WE1B 3TX0A 2Q6CA 5AE2A 3D67A 1OS5A 1VMBA 3HZEA 4Z2XA 3J81U 4EZ6A 1T05B 3K7RA 2ZH2A 2FJVA 1RKIA 5D0GA 1HMVA 2E5GA 3JSMB 2H5IB 4ZP7A 4WJBA 4BCAA 1T02A 1RLDA 2ZHOA 2V8DA 2LA6A 4QIWD 1KRPA 2GJFA 2CNOB 4FYXB 3MR7A 3HHLA 4J9UE 1XNRF 1PJ6A 2C3YA 2RU3A 3VGSA 3KHHA 1F5AA 3EVWA 1K44A 5A6WA 4ITSA 1RTIB 3WHIA 5L38A 5KFMA 4I4BA 3MR2A 1SXLA 3EPGA 3EYZA 2VFTA 1S1UA 3KK3B 5DG8A 3E3XA 1RT4A 2J0XA 1YKWA 1R6YA 3N9UC 2XMVA 3BGOP 1U49A 3DRRB 1SPBP 1VQ9S 1FE0A 5A8RA 1J5OB 3ZZTA 4JI4F 3UD4P 5H9EJ 1H72C 5KFSA 2V2QA 2XGPA 4BC9A 4NXNF 4OYPA 2FHMA 4EK2A 3ITHA 1B0PA 3KJVB 1EJ7L 1CJUB 3ONQA 5KG4A 3F73A 1ZM4A 3VQSA 1VQOS 2ADCA 5H9FJ 5KFOA 4I0WA 4DL0C 4O44B 4K2XA 4M95A 1G2EA 1RHRB 3BKFA 1FJ7A 4OI1A 1VRTB 4G1QA 1LW2A 4WU2A 3GR0A 4NPOA 2P5VA 1XIQA 4ZVFA 1Q53A 4ZPWR 4PQUA 1Y7PA 4MFBB 3TX8A 1TKZB 2V8VA 5J2QA 4C3MA 2DRBA 3I0SA 3R2CJ 3OVAA 2QG9B 1AT1B 2PO4A 3ZTQA 1WF1A 1FX4A 4P2FA 3CCJS 3BR9A 2KM8C 1RXOB 4X65F 4KT0C 1UWAA 1I94J 4TVAB 1IUJA 2POKA 4LUBA 3I31A 1UFWA 1JLBA 3PJXA 1SL2A 3H5XA 4DR6F 1WF0A 2QGFB 1TZ0A 5HATA 4HR2A 1VBYA 5KFQA 2FLLA 4RWXA 4ED4A 2NZCA 3PX4A 4ED3A 2JEJA 2GGPB 3I87A 1FWPA 4E98A 1FFGB 4GO7X 1UFKA 3RYLA 3AB4B 1M5OC 1S7HA 3QSIA 5IZHA 2R7VA 2YNFA 1ZTWA 3LGHA 4ENOA 1X5TA 3LGNA 1TU0B 1U6BA 3QIDA 1HNVA 5KT4A 1N0VC 5HLFA 3VAJA 3OR2B 2OFHX 3WX4A 2L9WA 4B9NA 5HANA 5EGYA 1TFYA 4RW8A 2NXEA 1UJ5A 3AY0A 3I5CA 4C8LA 3KLHA 4P75A 1ZPWX 2AQ4A 1LW0B 4BBYA 2ZH5A 4H54A 3LP1A 4H4MA 2QLJB 4USIA 3DOKB 2L48A 2W9AA 2VFRA 2HNYA 3ZZUA 2BRLA 2QX0A 4DUYJ 5F8HA 5EX3A 3EXCX 3AA9A 1H73A 4YHHF 2YNGB 3SZ2A 3WDOA 1RA6A 3DNCA 3PIOQ 1YZ6A 4TY8B 1V3SA 1SI9A 1R8BA 4IG0B 3C66A 2PC6A 4DPXA 2DXEA 2AYMA 4NYPA 4OJHA 2QFIA 2H65B 1BGXT 2DISA 4ECZA 3HHDA 3ZO7A 3DFEA 2IVMA 3ZNJ1 3SIPB 3PCOB 4PR6A 1U4BA 1IM4A 2E1MC 3VTIA 3RZAA 2OTJS 1CQNA 1KLMA 1RKJA 3HK2A 3QRRA 1U6ZA 1KQKA 3QYYA 1PC5A 2LECA 2GW8A 3CJ5A 2VA3A 4HI2A 5ETVA 3MDFA 4C0HA 3J7ZT 1HQUB 4OX7A 5EWEA 3OJSA 4NLRA 1LWXA 3HHEA 3T5LA 3L7UA 3PXGa 2IJNA 2GV1A 2ZFHA 3AJ2A 1U0HA 4DHVA 2QE5A 4OJ3A 2VBXA 3FUYA 1VIOA 3AD7C 4DR5J 2CPYA 3GFHA 4EBCA 3K5MA 3T5HA 1WOOA 3UD5A 3QATA 3D66A 3CCTA 4ZVHA 1KOOA 4DI6A 3UDCA 3DHWC 1X4GA 2HQ3A 3B82A 2BACA 1HR0F 4OI4A 5FD1A 3M8SA 2NSCA 3OTOF 4QWCA 3TQEA 5B0FA 2HHQA 1TKDA 1D09B 1AROP 2V4QA 4FP9A 2ILYA 3CJ3A 4DR7J 3EZOA 3T1YJ 1Q8LA 2C2OB 2QA4S 3IAM9 3TAPA 4MYUA 2XSJB 3O6QA 1K47A 1PBAA 1QY7A 2B9XA 8RUCA 2HVHA 4K59A 5KFKA 1NLKL 1QAYA 1M1HA 1S1WB 1WHWA 4OZ5A 2YPZA 3KWMA 3FSXA 3KYLA 3LQVA 1RUSA 4CLTA 2ZBRA 3CSKA 4LFAJ 4NLQA 2AZ1A 1KVIA 3BGRB 1VBKA 2VG7B 1RAJA 1M0SA 3EVMA 2B9YA 1U8SA 4A4JA 4NEYA 1N34J 3M8YA 1HNWF 1FDAA 1KVJA 4DOZA 2DB1A 4DX5A 1Q8IA 2GQ2A 4C48A 3R5GA 4ZLJA 2HQFA 3SI8A 1RCXB 4G6VB 5K20B 1S1TA 1JXLA 1CULB 4LF7F 2MKIA 2F7VA 5G0RA 2Q1LA 2HAIA 5F8JA 2YX4A 4O23A 4B3TF 2Z2ZA 4QIEA 2WVBA 3W9JA 4UT4A 2YKNA 4DSJA 2HRTA 4DQQA 1ZA2B 2BQUA 4OMFG 1MMDA 1SV5B 2EBGA 3HVTB 1NK7A 1YBAA 3GSDA 4LF9F 2R42A 4JI0F 4HACA 2WCXA 3MMAB 3NGRA 1V3ZA 2HHHJ 2RQKA 4CTAA 1NRKA 4QQBA 3PZPA 3SSQA 2D69A 4NCGB 1PO6A 1PG5B 1FDDA 1ZETA 3ZTOA 2MZQA 3W65A 1N0UA 5AJ3F 1PAUB 4NEZA 5E3CA 3ZTSA 1O5JA 3TWZA 3SCIE 4PZVA 3DLHA 2B5JB 1IVZA 2DITA 4IFYA 2HMIB 1OO0B 2LQ5A 1VQNS 2M7SA 2GCFA 4K4XA 1JLCA 4FYVB 2RMLA 2YNHA 4Y2KA 1RWNB 1WSVA 3EDRB 1NJYA 2IRXA 3B8HA 2E29A 2XNRA 4MH8A 2Z0GA 3IG1A 4DG1A 5F41A 4CRJA 2DGUA 5HMYA 5J2MB 2OP5A 4KV8B 1F5CA 4WBFA 1CVJA 2F4VJ 4A46A 2BOAA 4TXSA 3MOJB 4LF4J 2HHUA 3SV4A 1JJHA 3V4MA 1QSLA 1T3NA 2N82B 1S9EB 1TUVA 3A8IA 4Y3CA 3FMBA 2UXDF 2UV8A 1MSWD 2C42A 1GTHA 1NCLA 1VJWA 3HVWA 3ZXWA 1FVQA 3AJ1A 2DGOA 1NEEA 5C5JA 4ZVQB 4UUWA 1URNA 3TEGA 3FEYB 1D0EA 1MWYA 2RDDA 3EDQB 2XMAA 2J8SA 2RKIA 1IBKJ 3LO3A 2QYGA 2FIUA 1PC4A 2QO3A 3VF0B 2EBEA 1GAOA 3NCRA 3G8QA 4KB7A 4DPUA 5IXUA 4DV0F 1FKPA 3OT9A 5GVQA 2BQRA 3VQTA 4B9MA 2DH8A 4CIOA 4CO1A 4MMOA 2VU5A 1KQGB 5LOQA 5D4OA 2DIUA 3ENQA 1CJVB 3AD9C 4IRCA 5D3GA 4RUHA 3G71S 4HVZA 1VYAA 3FNNA 4DUTA 2HRUA 3J81Y 1X0FA 4YR3A 4C4WA 2GIRA 2DEJA 4C9DA 2BJ7A 3TZYA 5B08A 3MMBB 4AL6A 3GYXB 1NPRA 1EQ0A 3GJRB 3C2PA 4OIXA 2C1EB 4CLUA 2EFOA 3MUTP 2GQQA 2IBOA 4JI6J 2QEXS 5B0CA 1GMVA 3V81A 4Q0BA 4ZJLA 4Y2AA 5CYMB 1BWEA 3MM9A 4OZLA 3H7HB 4KHPJ 1B3TA 4OX9J 4Y34A 1RT7B 2W7PA 4HI1A 4V19X 2UUAF 3CCZA 4DF8A 4ECRA 2Y8WA 4I67A 4RBVA 1G6BA 3A12A 4IYQA 3KK1B 2CDQA 4NRUA 2ATCB 5B0EA 3CJ8A 4LRFA 1S0MA 2K3IA 1UA0A 1KQFB 5CYQA 4J91A 3D2WA 2IAJB 1PILA 1G4CA 2WBRA 1VC6A 3R3TA 2RS2A 1S57A 2ZKTA 3VAHA 3I82A 1IBMJ 4F4AA 2KXHA 4YB5A 4RW9A 4AQYF 1NH8A 1NH7A 2FHKA 2MZ1A 5J1EB 4HKQA 4N8NA 3T41A 3N5FA 1SCJB 4ZPDA 2PT0A 2R7RA 1Q7YT 2W2MP 3NGUA 1WACA 4DQSA 2I5JB 4FN5A 2ABYA 2J7KA 1NK8A 3PW4A 3RRHA 4IH5A 2M4MA 2DNHA 1PJ5A 1T9XA 3HX9A 5I3PA 3R7SB 1BQNA 5DGAA 3OR1A 4ZS6A 5BR8J 4FBTA 1XMQF 1O8BA 3IN5A 4URQU 3LTOA 5KFEA 3QJJA 3KMQA 3RBXA 4IOAQ 3C16A 3MZIA 3QMQA 2FLOA 3R97A 4USWA 3OTBA 1JLGB 1RADB 3AXMA 2QT7A 2OSQA 4JI8J 3ETMA 4NLGA 3PKMA 3BO2A 3GTYX 2WAQD 2W7AA 2C22A 4KPCA 4PUOB 1FRMA 1QTMA 5HVHA 3WC0A 3OSNA 1R0BG 3NBPA 2JDJA 3LOUA 2YWHA 4U67Q 4ILLA 4K7QA 1V6HA 4YEAA 2W8LA 2HGNA 1WF2A 3FFIB 3Q8QB 2R2UA 3ET6B 2P8IA 3I55S 4DFJA 2G2ZA 1PKUA 4R0JA 2H5JB 2MHNA 1U0SA 2IM1A 4HT5A 3NL0A 2QRRA 5U47A 3DRPA 5CHCB 2OO4A 1CLFA 4UY85 2HFUA 2HVDA 3BN4A 1VS3A 1O51A 4BDPA 4EI2A 3C15B 4J90A 3I96A 3MEDB 5DO2A 1L3KA 5L46A 4C8KA 3AOCA 2ZD1A 1A6LA 4MKBA 5L1KA 1KHVA 1HQ2A 1KD1T 2JOQA 1F3FA 2KT3A 3EGVA 1SUQB 4OL8A 2FVPA 1IKYA 1Q0NA 1N32F 4DMZA 2AU0A 4HHHA 1RE1B 5E3AA 4J9VA 3DMJB 1M1KT 1VIXA 2BE2A 4FZVA 4IR9A 4K8RA 1OPZA 1HNZF 2HLTA 2WTFA 3J80Y 1RLCL 3MCOA 3DGPA 3IXQA 4DU7A 3EICA 2PA3A 4GKJJ 4NA3A 3QGIA 1AYEA 3M32A 4L75A 2LQ9A 2M2BA 3MM8A 2DGWA 2HFVA 4F3QA 5C24A 4NLSA 4ILRA 3PR4A 3LUYA 3D9BA 2D9OA 2YX1A 3BV8A 4M5DA 5DJBA 4DSEA 3R5JB 2R8JA 3EUNA 3A4TA 2O01C 3N6NA 2VB6A 1KEKA 4ZVRB 3ZTRA 2AGPA 2OPQA 3KFWX 4CLKA 3TJAA 1GX6A 1X5SA 3JQJA 3US5A 4K4WA 3H8YA 2HIYA 3I0RB 2VQFF 3RW6A 2HIQA 3QLHB 3EVOA 3T6BA 4ECQA 1KFDA 2V67A 3RBEA 2UU9J 4JI1F 4FNIA 3PHEA 4CM0A 1JIHA 4DV3F 5EX0A 4RL1A 1VISA 2V5HG 3AOAA 3P8BB 3S8SA 4ZCIA 2MY8A 2C2EA 4PPZA 2VUGA 4ES3A 1UAWA 4DDFA 1D1UA 1JX4A 4NLVA 2LQJA 3UPFA 4WP8A 2HKEA 4LR9A 4PWWA 2GMJA 3S7RA 3DC2A 4ZA1A 4FXDA 1O6XA 3CCSS 2XHWA 2CA9A 4DV6F 3H0PA 2HQIA 4DR1F 2BYCA 2YTCA 4NI2B 4CP5A 1MN7A 3IC1A 3G82B 3P3DA 2LEPA 3UNYA 1IWAA 2UUCF 3MEGB 1P1LA 3GU0A 3BZQA 4X4NA 4RNMA 2PSZA 1FTRA 3GV8B 3UR0A 5HBMA 4A8YA 3KK3A 4DL2A 4MYTA 1RT6B 1HYSB 3EMTA 4PYAA 4QU6A 1CPZA 5IT0A 3NLCA 1AXQA 4MK7A 2G1HA 5HP1A 3DU5A 2YY3A 5KFYA 2JSXA 1WORA 4LVOP 2X3GA 4RR5A 1Y5IB 4X66J 2XGQA 2YQ3A 4AT1B 4ZKAA 4ZIVA 1L3UA 5BYSA 3AT1B 1VDHA 8AT1B 3WIUA 4FKYA 2CUYA 5SZTA 2UVVA 3UVJA 3RJMB 3CO9A 3VAFA 3CIZA 1QM9A 2KFZA 5KG5A 4OHZA 2QJ3A 1A7GE 2NCKL 1TV6B 2XMKA 1OQ3A 4B9LA 2QL5B 3MXHP 4M5MA 3CCQS 4F8RA 3R6LB 1HNXF 1JLFA 4BHQA 4L3NA 3LP0B 1R0CB 4NL5A 3DU6A 3W2VB 5IV4A 2W24A 4I6AA 3M8ZA 4RNHA 2DEIA 3CGIA 4IH6A 1X4AA 1DURA 1S97A 1JWWA 1KHWA 1KSPA 4ZOSA 2FC8A 4GRSA 1REGX 3GCWP 5GAEI 3DM2B 1HWJA 4PG4A 2X1GA 1X8DA 2KYZA 1FXDA 2IPOB 2MLYA 3C14B 4OHYA 3DHXA 3WC2A 5I3UA 1UETA 2BKNA 5GADU 2GC8A 3KLIB 3BF4A 2H54B 1HNIA 2XY5A 4ETXA 2DH7A 3UR3C 3EGZA 4KYZA 2UXCJ 1P9QC 3DLKB 2MZSA 3S1TA 4X84A 1APSA 2BW2A 1CJKB 1DQ8A 2M8HA 1U45A 4PWDA 1YVFA 4CM2A 1CS4B 1IM6A 4NWBA 2EW9A 3QGPA 3GV7B 3F56A 4LBHA 3EJMA 1NK6A 3G86A 3MM7A 4RUCA 5HVGA 2QLFB 3QWPA 3CMAS 1EQMA 3B6BA 1DAXA 5ETOA 2YNIB 3QJPA 3A8KA 2B9EA 1WKKA 1BE4A 1XC9A 2M88A 4CLFA 1RT2A 3MOZA 1S6PA 2WVDA 4JOUA 2Y1LB 3Q8PB 1UJ6A 3D6FB 5D77A 3VR1A 3QT5A 4C11B 4K5RA 4X2BA 1Y5LB 2YKAA 1TFWA 3G96A 2ZC4A 1Z2LA 4O4GA 2CNKB 4NLOA 1TK0A 2H5EA 4P52A 1B70B 2RD5C 1FXRA 3Q83A 4ES1A 4N76A 4GVBB 3ZZRA 3MCNA 1U1KA 3M1VB 3W7BA 3MM6A 5F9LA 1E6VB 4I2PA 4BWMA 2MKSA 4LFBJ 2KHCA 1BUXA 3J81j 5F3TA 1EETA 4USUA 2C2MB 4UOCA 2NZ4A 3GIKA 3QSYB 4IFVB 2NXCA 4M1KA 1ZH5A 4ZN3A 4X4QA 4IG3A 1OQ6A 1RI7A 1C0UA 4DUZJ 1DLOA 4CO3A 3ZZYA 1OY6A 2K7JA 1E6YB 3LALA 4TYBA 2VODA 3OUYA 1CQMA 2OI2A 4KGXB 5IT9Y 1S4FA 3DLEA 3CDEA 3DI6B 3RTVA 2R8IA 2AJ0A 3AXKA 1HBOA 5HMXA 3G9CA 1T03B 3TAMB 4DSKA 2ASLA 2O67A 2MY7A 4IDKB 3H4BA 2UV8G 4JI5J 1SL0A 4DV4J 1IKWB 3QGHA 2CPDA 3PYDA 3MD1A 2M3DA 2WVEA 4QOTA 3ZZ0A 2FLPA 2QMWA 1LV5A 5LXRA 1LWEB 2IY5B 1Y4ZB 3QT6A 1NHKL 3IAS9 5HVFA 2HGLA 4TQSA 3MPYA 3G87A 4NLTA 3DOMB 5IWAF 1MMNA 2R2TA 1QVGR 1IR2A 2DGXA 3TVKA 3MEEB 4WP3A 3MCMA 3NAHA 1YITS 4TU9A 2ALZA 2ZH3A 4LF2A 1UWBB 3KMSA 4MKAA 1HR0J 4WPAA 3GIRA 3RAMA 2VPWB 4LIWA 2KVIA 3PJ9A 3ILOA 2GO9A 3PKYA 5B0AA 2CQ0A 4USHA 3O5TB 2I38A 1ZZFA 2C2KB 1EP4B 4HHJA 3FDSA 3W5ZA 2W4PA 1YBUA 2W7OA 2RF2A 2KFNA 2O1PA 1VQPS 4KO0A 5HROB 2PMHA 1MU2B 4XTTA 5C25B 2AD9A 3HHNB 3VALA 4U7UK 3Q8SB 3L09A 5JUMA 5EUHA 3S01A 2HWHA 2KJVA 3H25A 2B4VA 4ED6A 1XR6A 3IR5B 4NCGA 2YBVA 4X64J 1HNWJ 2LEAA 4WIIA 2HHSA 4ED1A 3IRXB 2FJWA 4E2FB 5MLCV 2LXFA 4ZJOA 4X4TA 4ED8A 3KJQB 1F9EB 3OFEA 2F8MA 2DNPA 1AUDA 1S6QA 1JLQB 5IM0B 3SQOP 1VQYA 4CLZA 3TAQA 2BUNA 2IYIA 2IIHA 3OXFA 4DL5A 1DZ5A 3UQSA 5C7PA 2J9CA 2I0XA 2IC3B 1VQLS 1TR0A 1ITPA 2CJXB 1FRXA 1XR7A 1RGVA 5D0HA 1WDDA 4LF9J 3NCQA 2KI2A 3UE2A 3CJTA 1ZOTA 3SDEA 4MAKA 2ZM6J 1U7LA 4PABA 4ZMMA 1NNDA 3D6TB 5KFRA 2ZEJA 4NXMF 4USTA 3GSIA 2FZKB 3SFUA 5THWA 4A8KA 3QIPA 1KQSR 2RS8A 2OKQA 5AJ3J 3I5AA 3K59A 2HAFA 3JS9A 3VGUA 3GV5B 2IA0A 3P49B 1TMJA 2C3OA 1RHUB 3WBZA 1N6QB 4Y2IA 1UEUA 4OJ1A 4A8SA 1S9GA 1HBMB 2BEFA 3KLFA 2DK2A 4LT6A 3W62A 1JNZB 2MSSA 5IOLA 1S1VA 1NJXA 3K8VA 3GLJA 3LH2S 3AQPA 3IWLA 1BD6A 2R8KA 1R27B 2ZHAA 1XWLA 2ZHBA 4ED5A 5K9FA 5DM7Q 1TQLA 2DNYA 2ZE2A 2PMWA 2MGZA 4M5KA 2VC0A 4JUZA 5HO4A 2ZNZA 5L39A 2I2YA 1M5PC 3I4HX 2L9DA 5LT5A 3TW0A 4JV5F 3CCMS 1S76D 1WG4A 2MQ8A 1LWFB 1RAHB 1DTQB 5IS2A 2ALYB 3Q23A 1HKAA 1NDKA 4ZVGA 2CQ3A 4ICLB 3M8QB 2OHDA 4Y0FA 4AL5A 1W7WA 1BQXA 2KXFA 1SQEA 2IM2A 3JQKA 2GS8A 2GX8A 4DPWA 5E5NA 2OPSB 3NMRA 4RW7B 3JB9k 1DTTA 1HHQA 1GMUA 1UW4A 1SKRA 1FI4A 4RX6A 3L3CA 2D3OR 4ZPAA 4O3PA 4U7CA 4RW6B 2RHSB 3ZFVA 2Q6BA 1UP1A 2B6AB 3R8YA 2DXDA 3CWJA 5HAOA 3GONA 1X9SA 3SBMA 4RW4B 2VIHA 2ZJRQ 2MQQA 2V2KA 1VHFA 1RT1A 4YDDB 4KGKA 2QA2A 2CPXA 1EKSA 3D6MB 1TKXB 4ERDA 2A2DA 1YRXA 2COLA 3W61A 4J7CA 2AJFE 2PA8D 1K1QA 1CC8A 2WOMA 4ZVOB 2E1RA 2A0FB 1FJEB 1FNOA 4PCQA 3U02A 1FO1A 2CVEA 2DNQA 8ATCB 3C6UB 4N8OA 2W9BA 3N79A 1TL4A 2MYFA 2Z58B 4P2MA 3FQLA 4Q8EA 1TKTB 1U09A 1NK0A 3DXBA 1SL1A 3K58A 3W8GA 1VQKS 3U1NA 5GMEA 1WWHA 4A8MP 1M1GA 5AXMA 2ZWOA 3PNIA 1X5PA 3VZHA 3NNAA 3NAIA 1KC8T 1KOHA 1NKEA 1AW0A 4J9RA 3IS9A 3L95X 1HBNB 1RT5A 4LSLA 9ATCB 5A8KA 1NDLA 3IRWP 2YQ1A 2YKQA 1N5VA 1EHWA 1FT8A 4P2SA 1Z4UA 2FD2A 1XMOF 3JYTA 2ZOFA 2G4BA 4QIFA 3IR7B 2XS7A 1M5VC 5MAOA 1GXUA 3A8EA 3W3SA 1UPPA 3RW7A 2CG4A 4Z7YA 1P6TA 3OW2R 4DX8H 2BANB 5L9XA 2JFKA 4WTOB 3DN9A 5RUBA 1TL1A 3GZ7A 1JLGA 3V4IB 1W25A 2DHHA 4AQYJ 4QPTA 4C8MA 2BX6A 3BBCA 2XO6A 2KG1A 2DRAA 1FD2A 4OQJA 4YB7A 2GIFA 1K1SA 5LXYA 4HDGA 4Q7AA 2JEGA 1T9YA 4C0BA 1HQEB 1B7FA 2W9CA 2BJEA 2XEXA 2E1AA 5FDLA 3I32A 4WXWA 5A0YA 2BJ1A 4USJC 3CD6S 1ZAWA 4MKVA 1VRQC 1V5IB 3CD5A 2J0QD 2FB0A 4JYAF 2HS0A 2G0IA 5DG7A 3CD0A 1XMQJ 1XNQF 4GKKJ 3DLLQ 3KLEA 2N3LA 4NMXA 2BM0A 4LQ9A 3ENVA 3TYTA 5F3ZA 3H2UB 2R7XA 4MIBA 2W2NP 3CC2S 4M8LA 2LVWA 2XZDB 4B3OB 3CEDA 3JTOA 5KT2A 5KFPA 1DARA 3BGUA 3GPAA 3G6ES 3GP9A 3PTWA 2RIJA 1WI6A 3CJKB 1MROA 4NCAA 1PYOB 2CNNB 4CO0A 2VOOA 5LSLA 1SUQA 1RTHB 3QWUA 1Q8KA 1H6KX 3CW2C 4WFBQ 3BN7A 5ETQA 2YX7A 3DMJA 1U02A 4B3RJ 4KGZB 1N5YB 1AZSB 1SJFA 1LK5A 4LSNA 3UN5A 5FLXY 4K5SA 4F02A 3HXMA 2ASYA 1OY8A 3DDIA 1VRUB 2LQ8A 3H5UA 2Z2YB 2D74B 3CCES 1YLXA 2UUBF 2RB7A 1PBUA 2FY1A 2KZMA 4WZQA 2BE9B 4YB6A 4V19J 5M2UA 5EWGA 3THTA 3QRQA 4WFAQ 2DNMA 2OELA 4OYZA 3OD2A 2DVIA 3I6PA 4YY3F 4KKOA 3RRKA 5T7LA 1BQMA 3LPYA 2EC0A 3PRBA 3LGMA 2EKYA 4UOFA 3W2WA 3HDSA 2FVSA 5B0GA 3DOLA 5D4PA 4A8WA 3BR8A 1N32J 4HTJA 1RWKB 5J2PB 3IBFB 5F8IA 4WK1A 4CLLA 1JKHA 2EKNA 1TUWA 2OEJA 2B4OA 1LQ9A 4ED0A 2VDIA 2OIHA 1RAIB 4B3SF 3ILLA 3PX0A 3VHQA 4QWDA 1RWVB 2G9OA 3BM7A 1RHKB 4ECYA 1FNMA 3SEOA 2ZZNA 3TJ9A 3BO4A 5IFMA 2XTJP 5DDOC 3N4WA 2YKMA 3GB0A 2UVUA 1D3WA 4M5GA 3SQGB 1RTDA 3U1MA 1FK9B 3M8PB 2OMLA 3MHYA 2PEHA 4EO6A 3JSYA 3FK4A 2OPPA 4NCBA 4QJVA 2QSFA 2IJRA 4Q44A 1N4LA 3VAMA 2R7UA 4YDXA 1BC6A 5CZXA 3T6JA 1Q4RA 2YH0A 5C2GA 2F65A 2DT9A 3MMCA 3G8TA 2RSQA 3TANA 2FJXA 3FMWA 2HSEB 1O0PA 1QAXA 1FWLA 3TZWA 4AYBD 4DBQA 2F8EX 2VQFJ 1WEZA 3CJQA 4LQ3A 3IO1A 1N33F 4PQAA 1HMVB 2ACYA 4CLYA 3M2RA 2AGQA 1JK9B 1GK8A 3CT9A 4YUDA 5HQ8A 2VBZA 3MPVA 3PIPQ 3HHLB 4DV3J 4LF6F 2ATLA 4PXDA 2VJVA 1F9HA 3BREA 4ZJQA 1IXKA 2W2QP 2OMOA 3FBFA 4DX6A 4DQPA 4ECXA 5D78A 4QW9A 4EBDA 2HBYB 4EU0A 1RISA 1S1UB 4I2QA 3EGWB 1RT4B 1K73T 4CO2A 3K0JA 2RUGA 3GFZA 3ETOA 3QZ7A 1RAAB 4Y00A 3V5RA 4U95A 4N5SA 2OUGA 3RG6A 3PVXA 3L9ZA 5A8RB 2GJIA 5KFJA 3ZNUA 3R9LA 4G3IA 5M2PA 2IMWP 3LF0A 1ZPVA 4LREA 1WHYA 3E2EA 2F1FA 2UUCJ 5HL7Q 2RAQA 4F26A 2XG8A 2B56A 3ITHB 3ZZPA 1QVFR 1D9AA 3O3LA 4FXVA 5KFTA 1VLYA 1RT3A 5F0WA 4KHRA 3ULHA 3TQ1A 2AT1B 4X4VA 4OLOA 2YWKA 3OLBA 4KFBA 2YKPA 3CCUS 1LFPA 2A6MA 4G1QB 1LW2B 4KIAA 2EFQA 3GMGA 3KHRA 2HWTA 1NK4A 1C0TA 5E3RA 2XYHB 2ZITA 4PQUB 2WSEC 1ZAVA 4UUXA 5J2QB 3I0SB 2DR9A 3PRDA 2XMWA 2K1RA 4DX7A 5E7OB 1N48A 4K4ZA 2MPUA 3N28A 3RAXA 3QO9A 5H9EK 2R9LA 3V6DA 1R0AB 3TUJC 1HPZA 4B02A 4X4UA 2Z56B 1HNXJ 4WP9A 4LFCJ 1U2CA 1JLBB 1R8CA 1DFDA 6AT1B 3J7A1 3DLGA 1R3NA 1FX2A 3MCSA 4DUYF 1CJKA 2E1CA 2QLBB 4CYUA 2V63A 3I9V9 3TR5A 3UNGC 2JZ5A 2LKZA 5H9FK 1YIJS 2W25A 5ETLA 2P6SA 3P45B 2VQEF 4IOBA 4P9SA 2BRKA 3G6VA 4KGMA 4GO5X 2MZTA 2YNFB 3M30A 3PYFA 1H38A 4TNOA 3MAHA 4EMDA 4M5JA 4NZ0A 2FVRA 2CPJA 1IKXA 5LMUJ 3PRVA 1X0PA 4UOGA 2DKOB 5HLFB 4LR8A 3TUIC 4CQ1A 4YOEA 5KT6A 1LFWA 3FSIA 2ZZMA 5J2NB 3KHLA 2GIQA 4RW8B 3H5SA 2XULA 3TA1A 2MJNA 1IBLF 5T14A 2AEJA 3LP1B 2GHPA 4H4MB 1JLAA 1VK3A 2XMTA 3RAQA 3M2VA 2PFDA 4DV7F 1SQGA 2OPRA 2HNYB 1FDNA 3VGTA 1QE1A 4K4UA 3RBZA 1FKOA 4EWTA 3BDEA 4R8UB 2BOPA 3K5PA 3VV2B 4GVBA 4I69A 1M5HA 2VG5B 3H90A 4P2XA 4LF8J 3MPWA 1HWIA 2HNDB 5KFAA 3P5BP 2ZUGA 4DR5F 1K0VA 4R0EA 3HFKA 3FRYA 3N6LA 1RWXB 3AHPA 4Q8FA 1NU4A 2Z2LA 3GYNA 1R43A 3POTA 5KFUA 4A47A 1XN9A 1KLMB 2GHWA 4IFVA 4ELVA 3KK2A 1BXNA 1JLEA 4P73A 1ELOA 1QJHA 1WUUA 1U2FA 3T1YF 3R5DA 2SXLA 4IOCQ 1TL7A 1G7CB 2CDRB 4JV2A 4IR1A 3R5CA 3OVSA 4BWJA 4ZPBA 5DQHA 2UXBF 1D8ZA 1U0HB 4F36A 3BQ2A 4KR0B 3CDUA 1C4CA 3RU0A 5JVGQ 4LFAF 1W2IA 2P2CB 2DNOA 3DDNA 3NOCA 4LSZB 1GMWD 3DRSA 2GVZA 2ZH9A 2XC9A 1N34F 1NJZA 1TK8A 3CC7S 3CDBA 5A8WA 2LQBA 2IM3A 4F7VA 5K14A 4NX9A 5F8MA 1PYTA 1FE4A 3SCKE 2M0GB 4DL7A 2E5JA 3MFIA 5HN0A 2YWFA 2JEIA 1X4EA 2I6WA 3M9NB 5DQGA 1Z1ZA 3AD8C 4DSFA 4N41A 3HMJG 4K4TA 3FBBA 3DRYA 4ZP9A 2VBWA 2BJ8A 1MW7A 2WVCA 5E33A 3UCGA 2HHHF 5DRKA 3OL7A 1DHMA 4XDDA 2QN6B 2V8GA 3M2UA 1VQ8S 3AOBA 3D3BJ 2D41A 4DR4F 3BBFA 2Q43A 4NRTA 5DM6Q 1S1TB 3NXZA 5G0RB 2WONA 1FRJA 5DGBA 1VFJA 1XBWA 1RCOB 3C8YA 1RAGB 4XIUA 3S6EA 2YKNB 5C25A 2E1PA 1X4DA 3OQ2A 3CE8A 2OGUA 3TARA 1UW9A 3A8JA 1IJEB 5HI7A 4ZHRA 4FPIA 1S9FA 1BLUA 4HACB 4FS2A 1LXNA 2W4DA 4K2JA 5ETPA 2NYHA 3SCLE 4CTAB 2HURA 1Q82T 2CJKA 1X7VA 4K4VA 2X1FA 3NGSA 2HHTA 1N36F 1XTZA 3PYEA 2KB2A 4LF4F 2VG6A 2W8KA 3H40A 1F60B 3I56S 3G6XA 5C42A 2VJUA 5A76A 1UKUA 2YWEA 4IFYB 3HP6A 2IHR1 1CC7A 2B9WA 4TQRA 1REVA 1NK5A 5F8GA 4ALZA 1JLCB 5CCMA 3JQMA 4QR2A 4NLUA 3W9IA 2OAUA 2YNHB 4ZVSB 2V9KA 4W92B 3T5KA 5KFLA 1WNEA 4ED7A 3U27A 2CQBA 3UW1A 2JC0A 3KNAA 1WC3A 1AB8A 2A18A 3DYAA 1R8HA 1N88A 3IG1B 3FKBA 1AA1B 4DG1B 2F5GA 2WB4A 2C2RA 2DXFA 5KG3A 1IBKF 2BKPA 3QAEA 4HYKA 1I6JA 4X4RA 2Y1JA 3QGGA 4O3NA 4M63A 2JLGA 1T7PA 1YBTA 1T95A 5KT3A 2HFSA 2AIRB 3VVUA 1MN9A 4NA2A 3LA0A 1HD1A 1QD1A 2FHJD 2D3UA 4O3RA 2VZ9A 4KH0B 2ADBA 4DN9A 4CLWA 2I8EA 2HNZA 2CJYB 2HHVA 3W5XA 3NY0A 4AL7A 1NKCA 2KT2A 2IMOA 4B17A 4EUVA 1PIEA 1U1QA 4IKAA 2ZJPQ 2RRBA 3NS7B 2ZJQQ 4JI6F 2YPYA 4ZPTR 4ICLA 4CLSA 2CPZA 1KBRA 5KT5A 3OVBA 4QBUA 2FGOA 4KHPF 4OX9F 2EG2A 2FQQB 1FKPB 1S6OA 2G2OA 3Q86A 4WFZA 2Y0SD 3NWGA 2YWGA 2K7KA 4BC7A 2J7UA 1OSDA 6FDRA 1FWKA 4GC6A 4OLPA 5D3GB 1SB6A 2CJAA 2ZUAA 2MKKA 5GAEU 4C3LA 1J5EJ 2FLNA 1GTEA 3GJSB 3HF5A 1TVRA 4JV5J 4RW4A 3UDEA 2CFXA 2OEKA 3J7AN 2DPJA 1B0TA 2AJ4A 2E9TA 1Y5NB 3V81B 1RU1A 4Q0BB 1WEYA 4GMKA 4NLYA 4FVMA 4DFPA 1H2VZ 3MM9B 3H98A 4URSA 1T0TV 1P9YA 2W2PP 3MEKA 4LRAA 1IKVA 2N3OA 1U6FA 3HVRA 1FEEA 3UFCX 1WOPA 2GFFA 3CJSA 1I3OB 2VPZB 3IMQJ 2ZBCA 3P4UB 1HHSA 3Q8YA 2CJ9A 4HH0A 3PEHA 3VGVA 3FQKA 2J9DA 3ADAC 5LSRA 2KHDA 1RDRA 1HFEL 2YVSA 2FZGB 5BR8F 3T19A 1NJIT 1UVNA 2EEYA 2G0JA 5CYQB 1IWGA 2WRMA 4RLEA 3K5OA 1U2RA 3BPSP 1WC6A 3E8OA 1RZMA 3B54A 3VCDA 2GVDA 3Q2SC 1DJ0A 2MDAA 4JI8F 4DPYA 4RW9B 2MQMA 1J27A 3TA0A 1QLNA 3M6UA 2XS5A 4X4PA 2AEMA 4FYYB 1UL3A 2D9PA 3CCWA 2XB2D 1WC5A 1C1BA 1RJJA 3I4PA 2BZ2A 3E01A 4ATNA 3NWRA 4QWAA 4UOHA 3T5JA 2RE1A 2E44A 2K3KA 4B08A 4ETZA 2J76E 1MWZA 1OJ4A 3LAMA 1CEZA 5KFXA 4DPTA 1JXVA 3K57A 4DFKA 4K4YA 1IR0A 1VOMA 4I7FA 3BGFA 2BXJA 3MECA 4ZVPB 3CC4S 4OZ0A 2V2VA 1WDTA 3FGVA 3Q89A 1TK5A 3ELHA 2H1YA 4C0OC 4J5OA 3NBPB 4JV0A 1NPPA 2F3JA 1YRTA 2DR8A 3QQCD 4DN0A 5ETTA 4OYXA 3NEKA 4H4OA 4IUFA 4TN2A 4Y28C 3C6TA 4JI3J 1N5SA 4RWWA 3FVYA 5KFVA 4QIGA 3V2UC 4YP3A 1Q86T 1RK8A 2H9ZA 4DS5A 2DGVA 3LWMA 4OYIA 3DRPB 3G8SA 5I42A 3MM5A 5ITHA 1S0VA 4CWBA 1NB2A 4RNNA 4GKJF 1LWCA 1HARA 2XYPB 2EFGA 4DF4A 2LA4A 4OZ3A 4X62J 1NPKA 2V94A 3PW2A 2ZD1B 1RTHA 4DR3J 2ZZTA 3TNVA 3QFWA 5HJXA 3RR8A 4P72A 3IWXA 4DL4A 2FPHX 2HZCA 1IKYB 4S0MA 4RJVA 5DDPC 4OZNA 3W9HA 4JYAJ 4NYZA 1N54B 5L1IA 2PI5A 2PE8A 4LBPA 4I6YA 2BE2B 3AH6A 1R31A 2ERRA 4F2RA 4MIAA 2B8QA 2P6TA 2B7BB 2HS3A 5GAGU 1GXLA 1K0TA 4DEZA 1KN6A 2AHOB 4WZMA 4C8YA 2P9EA 4JI7F 5CD4A 1XJWB 2KXNB 3DGPB 1FEHA 4K50A 1HWKA 3R5AA 2LXIA 5L9NA 3DDKA 3DRXA 3M32B 1KS2A 2V69A 1GMWA 1S48A 3BJYA 3MM8B 2FTRA 2FVQA 5C24B 4U7UD 4R25A 1JJ2R 1QTNB 1NAQA 2MHEA 2DHSA 1ZM3A 4LF5F 3MTJA 2UVRA 1S7IA 2V8PA 4M5DB 3ISZA 4W90B 2NREA 3OBIA 3QT8A 4DV1J 5KFWA 2IVFB 1X4BA 3GJTB 1X4CA 2APOA 2I9SA 2UUBJ 1S4EA 2OPQB 4PXCA 1SC6A 4ID5A 2VC1A 5K8NA 3MAAA 1RYRA 3NNHA 1SJ4P 4ELUA 2RDIA 3CIMA 4W4MA 1P8GA 4YY3J 2WVFA 2VBYA 3RGIA 1FJGJ 2XNQA 3ISNC 5KG7A 1Y3JA 3N01A 3QRPA 4CT9A 1CJTB 3WX8A 3BSCA 3DCAA 1WD6A 1HW8A 1KDNA 1EKRA 1S59A 2CPFA 3R1HA 3I9ZA 3N6MA 2L9NA 2QA4G 2VH7A 1TELA 1WELA 4EYIB 2HFZA 5HQLA 3BDPA 2FJBB 2AX1A 5BYRA 4P74A 1UZDA 5DLFA 1VQ6S 2YWWA 1RHMB 4B3SJ 3NS5A 4FF2A 3MF5A 1Y3KA 1OWXA 3IM8A 1UA1A 4J37A 3L4BC 2QMXA 4M94A 3BSNA 3HPOA 3EZUA 4HDHA 1H2TZ 4RU9A 4D3GA 1SC3B 3PEJA 2E5LJ 1L3TA 3H42A 2ZDPA 4X66F 1YJRA 2V4JA 3IBWA 2VOPA 4KPYA 4B3MF 1Q5YA 3K5LA 3PO5A 2PGCA 2XI3A 3R1LA 4JI2F 2DHGA 4FYDA 2LMIA 1MG7A 5ETSA 3OTDA 1RTJB 4OYWA 4WKYA 2MLXA 3TOQA 2WBMA 1HBUA 2A10A 2PEBA 4LBIA 5LJ3Y 5IQQA 4DSLA 4PRFA 3J7Z5 5KFNA 3T9NA 2BJ9A 4NYOA 1OY9A 3CNQP 5HBMB 4PXBA 5JVHQ 4DLEA 4M5LA 1LXJA 1Z2ZA 2VPYB 3WIVA 3SXLA 2KN4A 3OV7A 2CXEA 5HP1B 2Q66A 4KH1B 2I1RA 4A8FA 5H1SV 1YX2A 3CB4A 4NZ7A 3HJVA 2RRNA 4M5NA 4DS4A 1N33J 4KBIA 3KKFA 5F0UA 3H2LA 2J8AA 2R2SA 3DKDA 2AYEA 4H4KC 4MJKA 2VFVA 2D3ZA 3D5MA 2XO7A 5HJYA 4Z37A 3IR6B 3FC9A 4LF6J 3A3PB 2ZBQA 3TUZC 4FF4A 2ZVIA 3UVJB 2FHOB 4CH7A 4ZLLA 4TLQA 5HSPA 3M7VA 2V68A 3SYZA 4OI6A 1VLOA 2MKHA 2ZC3A 4P6QA 1YI2S 1SKWA 9RUBA 3OL6A 3HFVA 3AAWB 4O3QA 2GHVC 1TL3B 2FHJA 1JLFB 2UXCF 4C2MA 1VC0A 1YSJA 4HH1A 3IA0A 4WCEQ 4DV5J 4B9UA 4ECUA 5KFDA 4C3KA 3KJFB 3LP2A 2XQCA 3HFZB 3A1YG 4ZCMA 4WE1A 5LMNF 1FXLA 2EXUA 7AT1B 3HHKA 1T9VA 1B0VA 1T05A 1SH0A 4DV2F 4G1PA 1CG2A 4IRDA 2C2DA 4ECTA 2JEFA 2DY1A 2KG0A 2Q79A 3JSMA 1R0AA 2QC3A 2QYCA 5I3UB 1HLWA 2GMHA 1SJ3P 2V4RA 2V34A 3AODA 5LM7E 3D0IE 1HNIB 1VJQA 2WHOA 2QIFA 4TKTA 2JHEA 1RTIA 2E7XA 4NLPA 2BABA 3PYGA 3UO0A 4O3OA 4NA1A 2ZBPA 3DGVA 2HRYA 2FJAB 3ZTPA 1GNKA 1RB0A 4PWDB 3IGNA 2H4YB 3QBCA 1FKAF 1U26A 5B0BA 2V2ZA 5F9NA 3FCWA 1NZAA 4Y2CA 2CPHA 5I4MA 1U1OA 1T8EA 3DRRA 4KSEB 2FVCA 3MM7B 2PN6A 5J2NA 4LFBF 1J5OA 4I56A 3JAMU 5FIIA 1S72S 4ELTA 2AYBA 2UZAA 2AP6A 4ZLPA 5HMWA 2WK4A 5ETRA 4C8NA 2R7WA 1XNRJ 1YHQS 1RT2B 4FYWB 3PFOA 1S6PB 4DUZF 2HHPA 2OFGX 3BKTA 4UY8T 5E0OA 4NOHA 3KJVA 1CJUA 3JTNA 3N5BA 1F1BB 4R8UA 3J80U 2VQEJ 4O4GB 3D1HA 1YRUA 2VG5A 4OI2A 2AW0A 3NOGA 4FBUA 1C4AA 4MK8A 2HNDA 4TU8A 4O44A 1ULRA 3LANA 1MNEA 5LSOA 2CKWA 2CVIA 2EK6A 1VRTA 2UUWA 3NGKA 3KLVA 3MM6B 2DO0A 3B4MA 1HIYA 4LRDA 1X4HA 2KT5A 4I2PB 2QZ8A 2LU2A 2J9DE 2BKOA 4MFBA 1SC1B 3HHLC 1TKZA 1H0HB 1IJFB 4JI4J 1IBLJ 3L7PA 4JI5F 1U25A 4DV4F 3V6HA 1EETB 2V0NA 1D9FA 2VA2A 5SUHA 4OZ1A 2RQ4A 3ZZOA 1N52B 4NXNJ 4IQMA 2XYGB 2GQCA 2O3DA 4DV7J 4IG3B 1C0UB 3CDWA 4Q43A 1T9WA 3CMQA 1DLOB 4WKRA 1SJ1A 2E5HA 1HWLA 2JH3A 3OUYB 2VONA 5LL6d 3HJFA 1S0OA 4A48A 5HMZA 2NXNA 3DLEB 3HO1A 1C1CB 3M6WA 2G1DA 1HBOB 2NUUG 2Z8QA 3EWGA 1KLNA 2MQOA 1VQMS 2ZH7A 4MTPA 3KOAA 1M5KC 3KG1A 3GG0A 4OYOA 1UVJA 5B09A 2GGPA 2PFFB 2R8HA 1CBKA 3FCVA 2ZNYA 3JXOA 3VVTA 2M52A 1D8YA 3OR2A 2DNGA 1S1XB 2AZ3A 4X65J 2NQPA 2R7TA 3CCLS 2X3DA 3JTPA 1YDLA 2CZVC 1PAEX 2IRUA 1BWVA 1FA0A 1X9MA 1LW0A 4HT7A 1EARA 2BVZA 2UXBJ 3DOKA 5CYJA 1MWQA 1U8WA 4DR6J 2P9CA 2AF6A 2ROEA 2K2PA 2YNGA 4TY8A 4IG0A 2HS4A 4BLGA 4OV1A 2HVZA 1T9UA 2N4DA 1ZAXA 4X64F 1F9FA 1JB0C 3IM9A 2MMYA 1ZYQA 3C46A 3FEZA 1FDBA 5E2QA 1GQEA 2DR6A 1N56A 2ACMA 5JMNA 3TA2A 3JSBA 1ZTTA 3D1QA 3W66A 4LRBA 2RF2B 1VHIA 4P10A 1Q8BA 2CPIA 3CXCR 4KO0B 1RA7A 2Y1IA 5BYQA 2MSTA 2C3MA 1HQUA 3M05A 2A6OA 4YHHJ 3NCPA 2ZM6F 3PR5B 2ROGA 3BYPA 2EK1A 4NMLA 2RJZA 2NPIA 4F0MA 1P1TA 3HLUA 2CQIA 4DR4J 2HQCA 2RH3A 2HGMA 3QT7A 1XEZA 2CWXA 1U1PA 2IYGA 4C8ZA 4KC5A 1NSKL 1Q7LB 1S6QB 3BB5A 1F0XA 4F4YA 5KFIA 5AE1A 3GILA 4OZJA 1WG5A 1WC0A 3MFHA 4HHUA 2CJBA 4FKXA 3RUBL 1U1NA 2XY6A 5D4NA 2N7YA 3Q22A 3HI9A 1SIZA 2NXUA 2RHQB 2CZ9A 3E51A 2QTWA 2MKCA 3SDEB 2XSJA 2XS2A 5ETMA 2KRBA 2EPIA 1S1WA 1HD0A 1Y00A 2G13A 1R7IA 1N36J 1VGYA 3TRGA 2J7WA 3QIPB 4ZP8A 2OJ3A 1QSSA 4YN3B 3VAKA 3HKZD 1HW9A 2KU7A 3SSSA 1TAQA 4ER8A 4OZ2A 3OXGA 3D28A 2D3O1 1RBOB 2DR7A 3BGRA 5GAGI 2VG7A 1B64A 1M90T 2H51B 4M5HA 1FCAA 2V6AA 4I6WA 4QCLA 2E7WA 1WKJA 1NB7A 3OTOJ 1S9GB 2QL7B 1J2VA 3KLFB 1UFLA 2V8HA 1S1VB 4QZVB 1V5VA 4DWIA 1CULA 4L74A 4DCJB 2NXJA 4A8XA 2ZE2B 4F50A 2MGZB 1W2BR 4K0KF 2DR5A 2VFSA 4MK9A 2JLFA 2O66A 2DNLA 3MUVP 1I51B 1SV5A 3HVTA 2FJEB 2RILA 1RABB 2ILZA 3MMAA 5KT7A 1SBRA 1NSQA 2M9KA 2CQCA 2CIMA 2AV5A 3UCUP 5AXLA 2Y8YA 4MKYA 2H3EB 1WKLA 4LR7A 1Y0HA 3CF5Q 1WTBA 3A3NB 5EN1A 1SVDA 5GAHI 5K5MA 3TJ8A 3GIIA 2FZCB 2GAGC 1OMSA 3MMJA 3LPEA 2XI2A 1DTTB 2MZRA 1M5SA 4L72B 4U8VA 2XY7A 3KUHA 4LF7J 1OPIA 1QSYA 2Y1RI 1YK9A 4RZRA 2B5JA 4U8YA 2HMIA 4B3TJ 2MZJA 2WZ1A 2N4CA 2PDAA 2KFYA 4DZDA 3IFEA 4DR2F 1V3RA 4U9RA 4QPXA 3UI3A 4JI0J 1RTZA 2LYVA 4I64A 2B3TB 1RT1B 2CQ2A 1C2PA 1NSAA 2GJ2A 3G4SS 4YR0A 2CNLB 2JVRA 2LU1A 4EEYA 4C97A 5J2MA 2GMLA 3QZ8A 4KV8A 3EXYA 4PKDB 3EM1A 1F2HA 4LRCA 4NLDA 2X1AA 5KFZA 4OYMA 2WOMB 2JRSA 2BM1A 1BY9A 5IT9U 2X1BA 4EZ9A 1S9EA 4JP8A 3G2XA 3MR5A 2W9BB 4KY3A 1NBEB 2HFNA 1GEHA 2WW8A 1Y9OA 3MGJA 3Q2TC 5EWFA 2RUSA 1G1XA 5ETKA 4HLBA 3M9MB 1RWPB 4ZDNA 3K5NA 3CMES 2ASJA 3N0VA 1UEVA 2CZ4A 1HI0P 5F8NA 3IS9B 3F44A 1FERA 1U1LA 4LVNP 1RT5B 4LSLB 1FRLA 4NASA 5A8KB 2OTLS 4ZN1A 4USMA 3CVKA 2DNZA 5EHHA 3OSPA 5CAAA 3PO4A 3D6HB 4KHMA 4URGA 1A0OB 1VC5A 2NUHA 2Y9HA 4WYWA 5K8MA 1PYSB 3T1AA 1S12A 4IH7A 4FVCA 3JYTB 1VQ7S 5CA5A 3OTCA 2UXDJ 3BQ0A 4GKKF 5CH7B 2U2FA 1FTCA 2AJ2A 2M5YA 4DXLA 2BQ3A 3KLGB 4X4SA 1CJVA 1H98A 1TL1B 4F3MA 2J0WA 2ROPA 4RBTA 3ENAA 4FNHA 3MMBA 3CUNA 5KTQA 3D4JA 4DFMA 4OX6A 1ICEB 3FZ2A 1SIWB 2VL1A 3CULA 2W9CB 4R5PB 5FDLB 5CZVA 1S49A 4DQRA 5AXNA 2VKRA 5DETA 4F0HA 5D6GA 3VWSA 5A0YB 2MXYA 2CQPA 3SSRA 4B3RF 4J9QA 5KG1A 1IBCB 5CYMA 2YXLA 3L7OA 1UVMA 5T41A 4DV0J 3BKUA 4XK8C 1LK7A 3D3CJ 3KLEB 4FDFA 1RT7A 2AJ1A 4CNYA 3AFGA 3D0GE 1QUPA 3QNWB 3IP0A 3B4DA 2HG4A 1SQFA 4HL9A 1NJWA 4L76A 3TEHB 4ANCA 2VHGA 3RB4A 4EO8A 3OFHA 3EZ5A 2PMZD 1WOSA 2EC2A 2PI4A 2XZWA 3KK1A 4KQZA 4F04B 3JAMY 4RUAA 3FJ2A 3T9ZA 1MROB 4DL3A 3VAGA 2IAJA 1X9WA 2H48B 2R7SA 3GE9A 1Q79A 4N56A 3THPA 3R7NB 1RAOA 5J1EA 3ILIA 4OI0A 2AWZA 2B4PA 2EFVA 2EFNA 1WG1A 3U7JA 1Q95G 4LMZA 1AUSL 4LSNB 1H7XA 3J7YU 1FHTA 4JB8B 3F41A 4UQTA 2I5JA 3WZ0A 2MQLA 2DHAA 3PM9A 2QFJA 3HCXA 1RP5A 1I1GA 4QYZK 2UUAJ 4IO1A 3T3FA 4C6AA 4XO0A 3EX7B 4B9SA 4CLPA 4PYDA 1KONA 1YZ7A 4KKOB 3X3UA 5T7LB 1BQMB 1LNQA 2XWYA 1KR4A 3W2WB 1KNZA 2BBEA 3DOLB 1UVLA 3ZC4A 3M9OB 4FXWA 3DLBA 2XMUA 1GH8A 1JKHB 3GYGA 1WSRA 2MTLA 4YQWA 3HULA 5DDRC 1R6VA 2CRLA 4PUOA 2F40A 2HBZB 1SJQA 2MQNA 3OFGA 3VAIA 4KJIA 1RQ0A 2ZH6A 2RVJA 3Q8UA 4JI7J 1R89A 3FSYA 1K8AT 2HHWA 4WTYA 2FYXA 3FFIA 7FD1A 4OYBA 2DY9A 2YKMB 1AFJA 5KG2A 4QYZJ 3ET6A 3HT3A 1CJTA 4J9MA 1RTDB 6FD1A 4CH0S 2DYAA 1U1RA 1RWUA 1NZ8A 2OPPB 2F63A 5CCLA 4LF5J 3HVAA 1KFSA 2J0SD 2CQ4A 2MJUA 3C15A 5KG0A 1WHVA 2M70A 1VQ5S 2DCUB 4U96A 3PJWA 3MEDA 1QDUB 3MMCB 3D1OA 3MI7X 5DZ6A 4A8OA 2JC1A 4KTQA 3NRBA 3MAQA 2WSCC 3T1HF 2R3VA 3O8WA 1T9TA 4GVLA 1H2UX 3MPUB 2R2RA 1OYDA 3CJ0A 2W1BA 2HYIB 4RO0A 4N7TA 2D7SA 4PG6A 1U48A 3ENWA 2DH9A 3R6GB 3OJUA 3M2RB 2KDOA 5IV3A 1FJCA 2DJWA 1RTJA 3HZGA 2F9JA 4OJGA 1A9NB 1UVIA 4G1IA 5E41A 3W60A 3OPKA 5GMKa 1IN0A 5KOXA 3U1LA 2CJQA 4X4OA 2LXUA 5A6PA 5IT4A 4PG5A 2KM8B 1JJ4A 4I2QB 3H20A 5AT1B 2F9DA 1FD8A 2F4FA 2ZDOA 4ZCKA 5J1PA 1JXEA 3SCJE 4USKA 4NZ6A 2LP4A 4B3MJ 1H3DA 5IC6B 4IO9Q 4WWSA 3KG0A 2A3JA 4WK3A 4JI2J 2LCWA 2GZOA 4W98A 1HNZJ 2JL9A 3HSZA 2AJQA 3K17A 4LIRA 5G4DA 1JQGA 2W01A 3P5TL 3I0RA 5D15A 2V9WA 1RBLA 2G2YA 1H74A 3QLHA 4FPRA 3KG4A 2AKWB 2FDNA 2P9GA 4UW2A 2OEMA 4LFCF 1RT3B 1TL3A 4FS1A 4L73A 2RNEA 5D8HB 2VPXB 1KTQA 4KFBB 3IWNC 1S0NA 1XQIA 4PG7A 1F2GA 1UCNA 4P7VA 4QWEA 4RNFA 1C0TB 4XPCA 1XR5A 2EG1A 2RRAA 2Z57B 2QL9B 5M2RA 4B9TA 1U24A 2ZVSA 3GR1A 4QWBA 4TU7A 5A2QU 4DJBA 5LMUF 2K1RB 4UZBA 2JX2A 3FZBA 2J9EA 5F8LA 4RNOA 1NUEA 3QO9B 4OYAA 4ID8A 2M8DB 3CPWR 2GAHC 3V6DB 5BXIA 2FJDB 2C2NA 1HPZB 4F25A 4OHWA 1JJCB 4JI1J 3I5BA 4EBEA 4NI2A 1DRZA 1FFWB 3AQOA 5KFGA 3G82A 3H2VE 4ZPVR 1MLAA 3OHBA 3PHTA 2HK3A 3DLGB 3MEGA 1YWXA 4E8UA 3TVZA 4EYHB 2AYGA 2CQ1A 1B7YB 4CYUB 4F0KA 1RT6A 2QV6A 3O44A 1HYSA 1IQZA 4Q45A 4AFFA 2EFPA 4O3SA 1U47A 4D3HA 5LMNJ 2RT3A 1BMQB 2CQDA 1SJRA 4LF8F 1HHTP 3M30B 5ETNA 5L1JA 4DV2J 1IKXB 4DL6A 2E5IA 4ZPCA 3WQPA 1YJ7A 2CWKA 1G3OA 2DD8S 3PDNA 3RB3A 3O2IA 1YQHA 4DV6J 3CJ4A 3KTQA 4DR1J 1DQAA 2B0GA 2HBRB 4C7QA 4PPDA 1JLAB 2XZTB 3HSDA 2DNNA 3G6YA 3QPIA 3HM9A 1SH3A 3M2VB 5FLXU 4WU3A 4OI3A 2OPRB 1U1MA 4UTGA 4UQGA 1QE1B 1TV6A 1FKOB 3BEGB 1X4FA 1I94F 3UDLA 1XK8A 2ZH4A 5C2CA 2D1CA 5DLGA 4ZVUB 2Z4PA 2G0CA 1QAJA 3LP0A 4ZVTB 3KHGA 3W2VA 1FFSB 2HQGA 1YJWS 2ZOMA 2MKJA 2VD3A 5CD4H 2AX0A 1RAFB 3W1YC 1YJUA 5AXKA 3POTB 3UDVA 3FBCA 4RUBA 4CNZA 3ISND 2C2ZB 3DM2A 1RYSA 1BHNA 2J6SA 4OHVA 2MKYA 3KK2B 2OD6A 1JLEB 3LAKA 4Q2MA 2IVYA 4QYRA 3C14A 1X5OA 1WI8A 2F8HA 2DGSA 5KFFA 2WW4A 3UWTA 2YQ0A 3KLIA 1IR1A 1L3VA 1TL7B 4XAKA 3JSRA 3D54A 1C1CA 1YJNS 5DZ7A 3TP2A 1V9OA 3QAUA 4WYLA 3DLKA 2Y3YA 3PV8A 4V1Ak 1MMLA 3NKYA 3HD2A 4P7TA 2HPUA 2B7CB 4NE9C 2H4WB 1CS4A 2DCLA 1NM2A 3DRSB 2BJDA 4ZIWA 4F4ZA 3KDOA 2GVZB 3RRGA 2L08A 4AD6A 4DPOA 2VV5A 1S1XA 2AEFA 5A8WB 2FUG9 1HNVB 1R8PA 2QSWA 4WIQA 3UN3A 4WFXA 5K14B 2YNIA 1QAIA 3BH6B 3BQ1A 4Y65A 1ACMB 3KLHB 5HK4A 4NLWA 1RWMB 3QFHA 3KUGA 4ILMA 1SC4B 4WXOA 2XLJA 1DQ9A 1YTYA 1N5QA 3BGLA 1TP7A 4C11A 1RSCA 2QMUB 2ZH1A 4GC7A 2Y0BB 1T94A 2DO4A 2A2CA 2XCPA 4A8QA 2KH9A 4CDIA 5AE3A 2W4CA 4JV1A 1EX8A 2WB1D 2HWIA 2XMMA 1YG0A 3UN2A 2DNRA 3OL8A 3M2UB 4RU2A 2GA7A 1LOUA 3M1VA 1YGYA 2HHXA 1E6VA 2NYIA 2HLUA 1F5BA 2J6UA 3MWBA 2UUTA 2WONB 3O1LA 4RKUC 4DZ6A 3LWLA 1FNXH 4Q5VA 4QW8A 1GFWB 2ASDA 4ANDA 1SKSA 1VQ4S 1UVKA 4J9LA 1TL5A 2KKHA 1E6YA 1UJ4A 3M8RA 4ZHRB 3NGTA 4DR7F 1KP6A 3OXLA 3KXDA 1S5ZA 5DDQC 4PXEA 4O0NA 1T3OA 2IBKA 2C28A 3DI6A 1OSCA 4EFAC 1SH2A 4XDCA 3R7BB 5DQIA 4ECSA 3SV3A 2OLWA 1T03A 3TAMA 5L8RC 1B99A 2WSFC 2EVZA 2VG6B 3RB0A 3TZXA 2KL8A 4IDKA 2LDIA 3BBBA 3OLAA 5CABA 5C42B 2NR0A 2DBBA 1IKWA 1L5UA 2B43A 3GG1A 1EAYC 1REVB 3UCZP 1EZZB 3AB2B 3OHAA 1LWEA 2LFVA
chains in the Genus database with same CATH topology
5FIIA 4B3SF 1S72S 4ELTA 1VBXA 1NHVA 3PX0A 2AYBA 2EFOA 3MUTP 2GQQA 2IBOA 2UZAA 2G9OA 3BM7A 4QWDA 4ECYA 2AP6A 4ECWA 1FNMA 3SEOA 4ZLPA 4J9KA 2QEXS 2ZZNA 5B0CA 5HMWA 2WK4A 3V81A 4Q0BA 4C8NA 2R7WA 3BO4A 5IFMA 4Y2AA 3DYAB 5CYMB 1YHQS 1RT2B 1BWEA 3PFOA 3DOMA 3MM9A 5DDOC 4OZLA 3N4WA 2O5DA 2YKMA 1S6PB 3GB0A 2UVUA 4DUZF 2R8GA 2HHPA 2KTQA 1D3WA 2OFGX 4IQXA 3MEEA 4Y34A 4UY8T 2OD4A 3SQGB 5E0OA 4NOHA 3KJVA 1RT7B 1RTDA 5EDWA 2W7PA 1Q1KA 3N5BA 3JTNA 3U1MA 3J7YI 1FK9B 2IA6A 1QUVA 3M8PB 2OMLA 4HI1A 3MHYA 4R8UA 2PEHA 4V19X 4EO6A 3JSYA 2OPPA 4O4GB 3D1HA 2UUAF 4NCBA 4QJVA 3CCZA 2QSFA 1YRUA 4DF8A 4Q44A 2VG5A 4OI2A 4ECRA 2AW0A 4FBUA 1N4LA 1UWBA 3VAMA 2R7UA 4YDXA 4I67A 1C4AA 4MK8A 4RBVA 2HNDA 3PW0A 4TU8A 1BC6A 4O44A 1G6BA 3MURP 3P96A 1ULRA 5CZXA 3LANA 3T6JA 4IYQA 3KK1B 2CDQA 1MNEA 5BJRA 5LSOA 1Q4RA 2CKWA 2CVIA 2EK6A 1VRTA 1AFIA 2YH0A 2UUWA 3PACA 3NGKA 4N47A 4NRUA 3KLVA 3MM6B 2DO0A 2DT9A 3B4MA 3MMCA 5B0EA 3G8TA 1S0MA 1X4HA 2KT5A 4I2PB 2QZ8A 4TLRA 2K3IA 4Y6IA 2ZKUA 1KQFB 2RSQA 5CYQA 3TANA 1UA0A 2FJXA 3CD7A 2HNZB 3D2WA 2LU2A 3FMWA 2J9DE 2IAJB 1PILA 3GIMA 5I3QA 1O0PA 2WBRA 4MFBA 1QAXA 3HHLC 1TKZA 1H0HB 1IJFB 3L7PA 1VC6A 3R3TA 4JI5F 2RS2A 2CQHA 2OH2A 1EP4A 2ZKTA 2XLIA 1U25A 3VAHA 3K8WA 3CTRA 3I82A 1J5EF 4DV4F 3V6HA 1EETB 2V0NA 4AYBD 1D9FA 3SFGA 5SUHA 4DBQA 2VA2A 2KXHA 2F8EX 2RQ4A 4OZ1A 1NH8A 4RW9A 4YB5A 1WEZA 3ZZOA 4AQYF 1NH7A 1N52B 2FHKA 2MZ1A 5J1EB 4HKQA 4LQ3A 4IQMA 2NLWA 3IO1A 1N33F 2CYYA 4PQAA 4N8NA 4WF9Q 3PX6A 2GQCA 2O3DA 5HROA 3N5FA 5E3PA 2HW3A 1MU2A 4IG3B 4ZPDA 2PT0A 2R7RA 1C0UB 3CDWA 1HMVB 4Q43A 1Q7YT 2ACYA 3BSAA 1DLOB 1WACA 3M2RA 4WKRA 4DQSA 2I5JB 3X1LB 2AGQA 1SJ1A 4O0IA 1JK9B 4FN5A 2E5HA 1HWLA 2ABYA 3CT9A 4YUDA 2J7KA 5HQ8A 2JH3A 2VBZA 4YFUA 3OUYB 1NK8A 2VONA 3MTKA 5LL6d 3HJFA 3PW4A 3MPVA 2BDPA 1S0OA 5KFHA 3RRHA 4IH5A 2M4MA 4A48A 3PIPQ 2DNHA 3HHLB 5HMZA 3EPIA 4F4XA 1NO8A 4LF6F 2ATLA 4PXDA 3DLEB 3HX9A 1ZZNA 3HO1A 3HHLD 1HA1A 5I3PA 4PWUA 2E9RX 1C1CB 3BREA 3M6WA 3M4XA 2G1DA 1IXKA 2OMOA 1HBOB 4DQPA 1BQNA 2NUUG 2Z8QA 4ECXA 5DGAA 3OR1A 5D78A 4ZS6A 2BA9A 4QW9A 4FBTA 1XMQF 1KLNA 2MQOA 1O8BA 3IRXA 5B7WA 3IN5A 4EBDA 1VQMS 2JVOA 4URQU 2ZH7A 4MTPA 3V6KA 1S10A 4EU0A 2F4VF 3KOAA 1RISA 3MR6A 1M5KC 2PIIA 1S1UB 1ZM2A 3KG1A 4I2QA 3EGWB 2LDYA 3GG0A 5KFEA 3QJJA 1UVJA 5B09A 1RT4B 3KMQA 2GGPA 2JJ4D 1NHUA 2PFFB 2R8HA 4IOAQ 1JLQA 2ZNYA 1K73T 4CO2A 3K0JA 2RUGA 3MZIA 3QMQA 5IM0A 2FLOA 3GFZA 3TO8A 3ETOA 3QZ7A 3PW7A 3OTBA 1JLGB 4Y00A 3V5RA 2QT7A 2OSQA 4NLGA 1FRKA 4N5SA 3PKMA 4CH1A 3BO2A 2M52A 2IC3A 1D8YA 2WAQD 2W7AA 3OR2A 1TVRB 4CT8A 2C22A 2DNGA 1S1XB 2NPFA 3PVXA 5A8RB 4PUOB 1FRMA 1QTMA 2GJIA 5KFJA 3Q8RB 4ZCLA 2BR0A 3V6JA 4AUKA 3WC0A 3OFFA 3OSNA 4G3IA 5M2PA 2NQPA 2R7TA 3CCLS 3NBPA 2JDJA 3LOUA 2YWHA 4U67Q 3JTPA 2IMWP 2CZVC 3LF0A 2IRUA 1N8RT 3GWCA 4ILLA 1VK8A 1FA0A 1X9MA 1LW0A 1VQSA 4HT7A 1ZPVA 1V6HA 1WHYA 3E2EA 4YEAA 2W8LA 2KJWA 2BVZA 3KNGA 2F1FA 1P27B 3R5BA 2HGNA 3DOKA 1WF2A 5CYJA 3FFIB 1YJVA 4J9SA 4AXJA 1S79A 5HL7Q 3Q8QB 4F26A 2XG8A 3PY8A 2R2UA 2B56A 3ITHB 3ZZPA 3OL9A 1QVFR 3I55S 2N7CA 2CQGA 1IKVB 2P9CA 4QIVA 2XMJA 5D4LA 1D9AA 3O3LA 4DFJA 2AF6A 2ROEA 2K2PA 2YNGA 4CO4A 4FXVA 2DGTA 4R0JA 2MHNA 5KFTA 2IM1A 2RQCA 4HT5A 1VLYA 1LKZA 3NL0A 1RT3A 4TY8A 3AA8A 2QRRA 5F0WA 5U47A 3DRPA 4IG0A 4KHRA 3MR3A 5CHCB 2OO4A 1CLFA 3ULHA 2HS4A 3TQ1A 4UY85 1FF2A 4OV1A 2HVZA 2N4DA 2DNKA 4X4VA 3BN4A 1JNRB 4OLOA 1VS3A 1N5TA 1O51A 1ZAXA 2YWKA 4X64F 3OLBA 4KFBA 4BDPA 1F9FA 2YKPA 3CCUS 1JB0C 1LFPA 2FC9A 1N6QA 3NGDA 2U1AA 3I96A 1LW2B 4G1QB 4KIAA 3OTEA 2MMYA 2EFQA 3GMGA 3KHRA 3MEDB 5DO2A 1ZYQA 2R7OA 3M6VA 3C46A 1L3KA 1HBMA 1S99A 2HWTA 1NK4A 1C0TA 3FEZA 4C8KA 2ZD1A 1A6LA 3NG8A 1FDBA 2LEBA 5E3RA 5E2QA 1GQEA 4MKBA 2ZITA 5L1KA 4PQUB 1KHVA 1N56A 2WSEC 1KD1T 2JOQA 3TA2A 2KT3A 1SUQB 1ZAVA 4UUXA 4U6PA 3JSBA 4OL8A 1ZTTA 2R7QA 2FVPA 5J2QB 3D1QA 1IKYA 3I0SB 1N32F 3GIJA 4DMZA 2AU0A 2DR9A 2HFOA 2ZBIA 4QU7A 3PRDA 2XMWA 2K1RA 2RF2B 3PW5A 5E3AA 5E7OB 1Q8BA 2CPIA 3DMJB 1M1KT 3CXCR 4KO0B 1RA7A 2Y1IA 1N48A 1VIXA 2BE2A 4FZVA 4K4ZA 4IR9A 2MPUA 3GFXA 3N28A 4CZCA 3RAXA 3QO9A 4TY9A 5BYQA 4B9VA 2MSTA 2C3MA 4LJMA 1OPZA 1HQUA 3M05A 2R9LA 3PFEA 1LWFA 4DLGA 1C1BB 1DTQA 3V6DA 3TUJC 1R0AB 1HNZF 2HLTA 2WTFA 1HPZA 3NCPA 2RKIB 2ZM6F 3J80Y 3PR5B 2ROGA 4B02A 3E01B 4X4UA 3CJ2A 2EK1A 4NMLA 3TI0A 4IRKA 2RJZA 2NPIA 3M8QA 4QR0A 3DGPA 1JLBB 1S77D 3IXQA 1R8CA 1DFDA 2IJFA 1P1TA 4J9NA 2JLEA 3J7A1 3DLGA 3HLUA 1R3NA 2PA3A 4JI3F 2CQIA 2L3MA 3MCSA 4NA3A 4DUYF 2RH3A 2E1CA 1ZBTA 3QGIA 3KLGA 4F3OA 2OPSA 2L41A 2HGMA 4F2SA 1HL6A 4Y2MA 1XEZA 3M32A 3I9V9 1U1PA 3TR5A 3UNGC 2IYGA 2JZ5A 4RW7A 2LKZA 2LQ9A 2M2BA 4C8ZA 4KC5A 1YIJS 3MM8A 2W25A 2DGWA 4F3QA 2P6SA 5C24A 4NLSA 1Q7LB 4ILRA 2VQEF 1S6QB 5A2QY 4IOBA 4I7FB 3QJLA 4OFZA 3BB5A 1F0XA 4O4RA 2BRKA 4L6V3 3G6VA 4JBCA 4F4YA 4KGMA 2Q3PA 4GO5X 3PR4A 2MZTA 3LUYA 5KFIA 5AE1A 4RW6A 4EGLA 2YNFB 3M30A 3MECB 1H38A 2D9OA 4TNOA 3GILA 3MAHA 4OZJA 2YX1A 4WFNQ 3C3LA 4NZ0A 1NKBA 2FVRA 1WG5A 3MFHA 2CPJA 1IKXA 3BS9A 3FCHA 2CJBA 1HI1A 2B6AA 4M5DA 5DJBA 4X62F 4DSEA 1X0PA 2R8JA 3B78A 5LJ5Y 5HLFB 3TUIC 2PD1A 4DSIA 4CQ1A 3EUNA 1YJ9S 1U1NA 2XY6A 4J9OA 4DR3F 5D4NA 1L3SA 4YOEA 5KT6A 2N7YA 2O01C 3N6NA 1LFWA 4R5PA 2VB6A 3FSIA 3Q22A 1KEKA 2ZZMA 3HI9A 2Z2MA 3M6XA 5J2NB 3KHLA 2AGOA 2GIQA 4RW8B 1S6UA 1SIZA 2NXUA 3H5SA 3LW5C 2XULA 3Q24A 2AGPA 5FJ4A 2OPQA 3E51A 3TA1A 3KFWX 4NLXA 1GX6A 2MJNA 1CSJA 1X5SA 2MKCA 5K8PA 1IBLF 5T14A 3SDEB 1FVSA 3US5A 4K4WA 2FGCA 2XSJA 4YB1P 3LP1B 3H8YA 2XS2A 2GHPA 4H4MB 1IBMF 1JLAA 1GX5A 1PSDA 1NK9A 1WTFA 2KRBA 1VK3A 3I0RB 2VQFF 2XMTA 2EPIA 5IQ6A 1S1WA 4H4OB 3RW6A 2HIQA 1HD0A 3NMAA 1Y00A 2G13A 2E66A 3QLHB 3H4DA 3M2VA 5K8OA 3RAQA 1R7IA 3C6TB 1VGYA 2MB0B 3T6BA 3TRGA 4DV7F 1TKXA 2J7WA 2OPRA 2HNYB 4ECQA 3QIPB 1FDNA 4ZP8A 2OJ3A 5CXTA 1KFDA 3FEXB 1QSSA 3RBEA 1QE1A 4K4UA 2B51A 2ZOGA 3VAKA 3HKZD 1HW9A 2KU7A 5GADI 3DLJA 1D9DA 4JI1F 4CI0B 1FKOA 4FNIA 3PHEA 3SSSA 4EWTA 1TAQA 7FDRA 1JMTA 2DPIA 3BDEA 2NS1B 3OXGA 3D28A 4ZK7M 4R8UB 2BOPA 5I42B 2DR7A 3K5PA 1JIHA 3MM5B 3BGRA 2X51A 5GAGI 4DV3F 4I69A 4N77A 2VG7A 3C6UA 1M5HA 1B64A 2VG5B 1M90T 1LWCB 3MPWA 1HWIA 1FCAA 2HNDB 5EX0A 4QCLA 4I6WA 5KFAA 2E7WA 3SMZA 2V5HG 1NB7A 4RBUA 2ZUGA 4DR5F 3THVA 3S8SA 2KO1A 4ZCIA 1K0VA 4R0EA 1S9GB 1J2VA 2MY8A 2KYXA 3HFKA 3KLFB 1UFLA 2C2EA 3FRYA 3N6LA 2V8HA 4PPZA 3AHPA 1S1VB 1TKTA 2VUGA 4Q8FA 4QZVB 4ES3A 1NU4A 1UAWA 4DWIA 4DDFA 2Z2LA 1D1UA 3GYNA 1R43A 3ZZZA 1JX4A 4NLVA 2LQJA 3UPFA 4KAIA 3POTA 5KFUA 4A47A 1XN9A 2KRRA 1KLMB 3EGNA 4A8XA 2ZE2B 4F50A 2GHWA 2GMJA 4IFVA 2QLXA 2MGZB 1W2BR 4K0KF 2DR5A 2VFSA 4MK9A 4ELVA 3KK2A 3S7RA 2JLFA 3DC2A 1JLEA 2E9ZA 4ZA1A 4DQIA 2O66A 2DNLA 2J6TA 1ELOA 4FXDA 1XERA 1HBNA 4FF1A 2A1BA 4DV1F 1Q16B 4BS2A 3CCSS 3NNCA 3MUVP 1QJHA 1VI7A 1SV5A 2XHWA 2C3UA 1HI8A 4F67A 1K9MT 3ICLA 4DV6F 1U2FA 3HVTA 2FJEB 2HQIA 4DR1F 4WFYA 3T1YF 2RILA 3R5DA 2BYCA 2SXLA 2ILZA 3FRZA 2YTCA 2ZH8A 3RB6A 3UD3P 4AXIA 4IOCQ 3MMAA 1G7CB 5J1NA 5KT7A 3IC1A 4MIWA 3HKWA 3P3DA 4TYAA 4JV2A 2LEPA 3R5CA 4IR1A 1SBRA 3OVSA 4BWJA 4JI7F 4ZPBA 2XWXA 5DQHA 2M9KA 2KZZA 2UXBF 1D8ZA 2CQCA 3BQ2A 4F4KA 2UUCF