2LQ9A

Solution structure of the k60a mutant of atox1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
b'MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Solution structure of the K60A mutant of Atox1
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lq9A00
2EW9A 1SQEA 2XMUA 1TUVA 1W2IA 5T7LA 2AJ1A 2W4CA 2BJDA 1LQ9A 3HX9A 3HHLB 2AP6A 4A46A 4Y2MA 3HF5A 2LDIA 3E8OA 3QGPA 1N5VA 1P6TA 2XMWA 5B08A 2GGPA 5B0AA 3FRYA 2CRLA 4F67A 2FIUA 2K7JA 1K0VA 4OJ1A 3I9ZA 1IUJA 2GA7A 2HFOA 1Y9OA 1URRA 1Q53A 2BBEA 2GCFA 3LGNA 2BUNA 2BJEA 1OQ3A 2FB0A 3HHLC 1N5TA 4U9RA 3WDOA 4DPOA 5B0CA 2BYCA 5F0WA 5B0EA 1TZ0A 4DN9A 2HLUA 5B0DA 2KT3A 2LQBA 2QLWA 1FEEA 2OP5A 2K1RA 3FMBA 1GXTA 1KVIA 3BM7A 4OJ3A 3KG1A 3DCAA 3LGMA 1S6UA 2XMJA 2OAUA 1KQKA 4OIXA 2OD4A 5B0GA 1FVSA 1Q4RA 3BF4A 2XMKA 3MZIA 2ZDPA 5A6PA 3QMQA 1YJVA 2QIFA 4Y2IA 1FD8A 2FTRA 1Y0HA 2ZDOA 3TNVA 2OMOA 1Y3JA 2LXFA 1MWZA 4OJHA 2RMLA 3MCSA 4ZA1A 4HH0A 1R6YA 3HFKA 1OPZA 3KG0A 1X0PA 4A47A 1XBWA 2ASYA 3CJKA 3VTIA 2XMTA 2AW0A 2OD6A 3T9NA 3TRGA 4NPOA 2L3MA 1SB6A 2VH7A 1VQYA 2HLTA 2N7YA 2GFFA 3HDSA 4DL0C 1U7LA 4A48A 1RJJA 3HHLA 2VV5A 1V3ZA 2RU9A 1YRXA 2IYGA 2K1RB 4YDXA 3BDEA 1ULRA 2GV1A 2ROEA 4ZOSA 1JWWA 4Q2MA 2GO8A 1Q8BA 1N5QA 5T7LB 2RSQA 1SI9A 1FESA 2ROPA 2KYZA 3TOQA 2OFGX 1VQSA 2Q3PA 2QLXA 4HI1A 2XMMA 2OFHX 4EFAC 3IWXA 3UDCA 1QUPA 3KKFA 3DXSX 1JK9B 2GGPB 3IWLA 4FNHA 1OSDA 1FE4A 1S6OA 1APSA 1MWYA 1AFJA 4YEAA 4OJGA 2JDJA 2ACYA 1YJTA 1P8GA 2LQ9A 2RILA 2PGCA 5B0FA 1X7VA 2KKHA 2OKQA 4FNIA 4HI2A 4HH1A 3CJKB 1AW0A 2ROGA 2W4DA 2HFNA 5A6WA 3BGUA 1CC7A 2IFXA 3K7RA 5B0BA 5B09A 2QYCA 3F44A 4NL5A 2N4DA 3FGVA 3BN7A 2K7KA 1AFIA 3KNGA 1YJUA 1FVQA 1N5SA 1TL5A 4A4JA 1YG0A 3GZ7A 2KT2A 2K2PA 2XMVA 1FE0A 3BR8A 5IXUA 1X8DA 1OQ6A 1WD6A 2N4CA 3HHLD 1Y3KA 2FHMA 1TR0A 2G9OA 4Q2LA 1KVJA 2W4PA 1YJRA 1TL4A 2HQIA 2IYIA 1CPZA 2HIQA 4QOTA 3BB5A 4HL9A 5F0UA 1CC8A 1Q8LA 3LO3A 5KAKA 1GXUA 4Y2KA 5K9FA 2AJ0A 2PD1A
chains in the Genus database with same CATH superfamily
4LREA 3IWNC 2DR6A 4DQSA 3GSDA 5KG4A 4P2XA 4KGKA 1NU4A 2OPSB 1CQMA 2J6UA 2OUGA 1TKXB 1N52B 4OJ1A 4KHPF 2HFZA 1N5TA 2UV8G 3ULHA 1WC5A 4KHRA 3DI6B 2F5GA 1JLCA 3EJMA 1SC1B 4DPXA 4RNNA 3LGHA 1OYDA 3C15A 3QT7A 2A6OA 1N34F 1KOHA 3PR4A 3ONQA 1FRIA 3J7YU 2HVZA 4OX9J 3MM8A 1QAJA 2HBYB 3AJ1A 3NOCA 4Q0BA 3EVOA 2P2CB 1APSA 2HGMA 4J9RA 2CIMA 2LQ8A 5DO2A 3B78A 3M2UB 2ZH2A 3PFOA 4JV2A 3T9ZA 3Q8QB 3OLBA 1AT1B 5HMYA 1Q5YA 2UUBF 1ZM2A 1IKVA 5HLFA 1HQUB 2HQIA 2HWTA 5LMUF 1JB0C 1RT5B 2RJZA 1S9GB 2BKNA 1S7HA 2BUNA 4YB1P 2NSCA 3ENAA 1SJ4P 2Z2LA 1HHTP 2I5JA 5ETOA 4WU2A 1N32F 3P45B 2CPDA 2CQ1A 1NEEA 3N5BA 2GC8A 5ETVA 4CO3A 2LEBA 3JAMU 3UCGA 1NDKA 2YX7A 1T05B 4IH5A 1E6VB 1VIOA 3IAM9 1X4FA 2MKJA 1RI7A 3IP0A 5KT6A 3KLVA 1X7VA 1MLAA 2DNPA 2LEAA 4AQYJ 1WI6A 2M3DA 2NYIA 5DZ7A 2PE8A 4ELVA 4Y6IA 1NZ8A 2W1BA 1FNMA 3M8WA 3NRBA 1E6YB 1J2VA 3CC7S 5AE1A 2VPYB 2Q43A 4DUZF 1B3TA 3FRYA 4CZCA 2EWHA 4F4AA 3NGRA 4DEZA 2X1FA 3B4MA 3FZBA 3DOLB 1X9MA 1YKWA 3U7JA 1S6PB 5KT5A 2RUSA 1ZAWA 1SL1A 1HNVB 3NBPA 2JWNA 2BA9A 4CO4A 4N76A 1UEUA 1Z1ZA 1I3OB 1XMOJ 4WFNQ 4IFVB 2OJ3A 3CJQA 2I2YA 4DV6F 2RF2B 4FYXB 1NDLA 2CQDA 2IDLA 1RK8A 3IN5A 2QMWA 3OUYA 3JYTB 1T11A 4TYBA 3GJSB 3Q24A 1TUWA 4I6AA 4ED0A 2OSQA 2KT2A 1IJEB 2QT7A 5KFEA 2KJWA 3ZZ0A 1Q8LA 2KFZA 5EWGA 2CXEA 3R2CJ 4B9VA 1IN0A 3WBZA 2B43A 3GU0A 1XN9A 2DRBA 2BJDA 3CDWA 1BQMB 3EX7B 1P27B 2YKQA 4B3RJ 1RCOB 3HHLC 2XO6A 3RTVA 1PO6A 2FDNA 5K8NA 3SCJE 1ZETA 2DCUB 1SQFA 4L75A 2QL7B 2WTFA 2HHTA 2OO4A 4DCOB 3M1VA 1MWZA 2YQ0A 1L3KA 4KHPJ 1GAOA 2AW0A 1YJ9S 4KGVB 4LF6F 4LSNB 1S1TB 1S4EA 1X9SA 5J2PB 1S57A 1KHWA 2KYZA 2XULA 5IWAF 6FD1A 4LSZB 5HQLA 2EXUA 2BKOA 1EJ7L 1RGVA 2W2PP 1RWXB 1RWWB 4J90A 1XR6A 4K4TA 1G1XA 1JMTA 2FPHX 4ZVTB 1N34J 3D1QA 2F9DA 4IDKB 4TY8A 4LBIA 1FD2A 2IYIA 3MEEA 4JI1F 3W9HA 2LQ5A 3UCUP 1NK5A 4C3MA 1D9FA 9ATCB 1S1VA 4A46A 2DGWA 1CJUB 3T19A 5KFDA 2Z2ZA 2ZWOA 2UUBJ 1REVB 5LMUJ 4ZVGA 2DH8A 1JIHA 1S72S 2YWHA 2Z4PA 1I51B 4QWDA 4CH7A 1WHWA 2HNDA 2PI5A 3R5GA 4CYUA 1X5PA 4PAAA 4ZHRA 4C8YA 4I4BA 2E1MC 1DARA 3MMAB 3VAJA 4NLXA 4YHHF 3QT6A 4Y2AA 1L3VA 4GMKA 5KFYA 1DQAA 4ECTA 2OPRA 1N32J 2H9ZA 4YFUA 1C1CA 2GMLA 2CYYA 4B08A 2HVEA 1SUQB 1X4AA 2R2TA 3R5JB 4NI2A 4JI2F 4DR2F 2CPFA 4I7FA 1WKLA 4KFBA 1TK0A 1FFSB 2WCXA 1S0MA 1HW8A 3WX4A 2C2KB 5H1SV 1O0PA 4U6PA 4ECXA 1OPIA 1I94F 1SKSA 3KJNB 4RWWA 4ANDA 4DS4A 3CC4S 1VYAA 2GCFA 4C98A 1ZH5A 2O3DA 1OQ3A 5HMXA 5B0EA 2QLWA 7FD1A 3OSPA 2RE1A 3FFIB 2VD3A 4DUZJ 1ZM9A 1CJKB 1HWIA 3MUTP 4GVBB 4J9VA 2VH7A 3C16A 5IC6B 1U7LA 1RHQB 1FDBA 3CCMS 5HQMA 1VRUA 4ZVEA 1ZM3A 2VOOA 3FJ2A 3H7HB 1D09B 4PQAA 3ITHA 2W7OA 5KFAA 5THWA 2V8PA 4QWCA 3GFHA 1KNZA 1UJ4A 3NS6A 1IQZA 3PYEA 2BQUA 3GFYA 2VQFF 3RR7A 1FKOA 4DV6J 2DR5A 3BBFA 2MKHA 2XZTB 5CCMA 1SKRA 3AHPA 4DV2F 5GADU 4AE5A 4NZ7A 1WSRA 1N8RT 2KHCA 4HVZA 4F3OA 2HQDA 3PYFA 1VLOA 4EO6A 2X1BA 1YTYA 2XYHB 3VAMA 4OZ0A 3ZZRA 2E1RA 3Q83A 5D8HB 4K4WA 4U7UD 4NLYA 1F2GA 2ERRA 4URGA 2KN4A 1P9QC 4ICLA 2H3EB 1L5UA 3CJ3A 3H5SA 4L3KA 1S0VA 3L9ZA 2WVFA 1VCTA 2ASDA 1T9UA 3JQMA 3RW6A 2ZH4A 4IRDA 1KSPA 2CJYB 1NSKL 2MZTA 4RWXA 1NJXA 4RW9A 1GFWB 4Q2MA 3NAHA 3LAKA 1VQSA 3J81U 3DLEA 3D28A 2CQIA 1G2EA 4XDDA 3V6KA 1JK9B 1DLOB 3ZFVA 3PV8A 3DLBA 2XI3A 4ZIVA 1NNDA 4LF6J 3MEGB 3L09A 2H5JB 1N5SA 2RHQB 4ILMA 5IXUA 4BS2A 3OTCA 3LUYA 5DGBA 1K9MT 2R7TA 4Q45A 2FY8A 1GTHA 1JQGA 2C28A 2J9EA 1MSWD 4ECSA 3MPYA 1S99A 4LT6A 4LF4F 4QIWD 4YB7A 2P6SA 2OPQA 2RS8A 1HD0A 1N5VA 5DQHA 1OSCA 3OTBA 4LUBA 5HSPA 2DGSA 1VQMS 4U9RA 3SFGA 4JI1J 4C11B 4PXBA 1SVDA 4OI3A 1WUUA 3GIRA 3CCVS 3RBXA 2W8KA 3EGZA 3EM1A 1B0TA 2RQCA 4F4ZA 4QYRA 2PI4A 3OXGA 3RUBL 3NNAA 4KC5A 3MEDA 2DVIA 1SJ1A 1F3VA 2VFSA 1RTHB 3KK3B 4ED6A 1UZDA 2E7VA 1FFGB 3C6UB 1CS4A 3CD0A 4FNIA 2JJ4D 5ETPA 3KNAA 4BCAA 3KYLA 4HTIA 2XM3A 2DGXA 4YHHJ 3OW2R 4KJIA 3OD2A 3BR8A 1HQ2A 3EDRB 5KFVA 1O5JA 2C1EB 3OR1B 3R5DA 4I2QB 1UWBB 2VG5A 4NA2A 4DX5A 4KPYA 1T03B 3R5AA 3P49B 2U2FA 4F26A 2IM1A 2NYHA 1M5VC 3SBMA 3D7SB 4BWMA 2M8DB 4DR2J 4JI2J 3S01A 3HVWA 4AUKA 4KIAA 3N6NA 4Q44A 2QA4G 3IS9B 3J7Z5 2DNMA 4BC9A 4ALZA 1I94J 4USWA 3CJTA 1FDDA 2WZ1A 3VVUA 1DQ9A 2CWKA 3HLUA 1NKCA 4NZ0A 4UOGA 1S12A 1X4EA 1JLCB 2F1FA 5EDWA 1FXLA 2L08A 4KO0B 3EZ5A 4LBHA 3TVKA 2IJNA 1RKIA 1S1UB 1PC5A 3IR5B 1RTIA 2KRBA 3GIMA 4MYUA 4NXMF 2X3DA 3RRKA 4ZP9A 4R5PB 4EI2A 1TR0A 3MM8B 1AB8A 4Q0BB 5ITHA 1UKUA 2CPJA 5F9NA 5CQGA 3HSGA 4PWDB 4EYIB 1U45A 5KT3A 2KJVA 3E3XA 3NGTA 3PRVA 3HJFA 3I0SA 1IR2A 3DMJB 2FHJD 4OX7A 4LIRA 3QGPA 4LF1A 2VQFJ 4XK8C 3W66A 1K0VA 2K3IA 3W9JA 3G6XA 1IKVB 5HLFB 2FB0A 2QX0A 1IWAA 4EK2A 1UVMA 4DV2J 1XMBA 3DM2A 2CQHA 5F8LA 1F60B 4P71A 5EWEA 2Y1JA 4MKBA 2J0XA 2DGVA 3OXFA 1S0NA 1B99A 2VPXB 1U6BA 2WSFC 3TEHB 2DO0A 1KLMA 4FVMA 3FNNA 3OHBA 4HT7A 3W65A 4PZVA 2I5JB 2VHGA 1R3NA 5I3UA 5M2UA 5E33A 4X84A 2MLXA 4WYLA 2ZJRQ 2Y8WA 2W4DA 3BSCA 3W7BA 2ZFHA 4RNOA 1SKWA 1OO0B 1ZS6A 2JVRA 4P10A 2LYVA 3ISND 1UFLA 1RAEB 3FCWA 1K0TA 4LF8F 4RJVA 2GHVC 4I0WA 1CVJA 3UE2A 4ZJOA 5I42A 4PYDA 2KI2A 1KD1T 3L7UA 3DN9A 4I68A 4LRDA 3HO1A 3SDEA 2NXNA 2YKPA 3W64A 3RR8A 3NWRA 2FVRA 4V1Ak 5KFHA 1RABB 3W2WB 3AD7C 3HSJA 2GIQA 4O4RA 1V9OA 4C2MA 3SQOP 4DL6A 4ZA1A 3MCSA 3KG0A 4NCBA 1WJ9A 1J27A 4XPCA 2V8DA 5HJYA 1S4FA 4FYVB 1NSPA 4AL6A 2IDEA 2OFGX 2ZM6F 3MD1A 2I1RA 4DCJB 3NBPB 1KKHA 1X5OA 2FHJA 4JI5J 4FF3A 3NGUA 3OV7A 1RT1B 3GWCA 2K7KA 3NL0A 3M8QA 4DFPA 4UW2A 2V68A 2AJQA 3M6XA 2M8HA 1YJRA 2CQCA 2NUHA 2PN6A 2DRDA 2C2OB 3SSQA 2UXBF 3SI8A 2NREA 4W98A 2CPHA 4E2FB 3LWLA 1GQEA 3QNWB 2EBEA 2XGPA 1RWUA 4OLOA 3MD3A 4P7TA 1RYRA 5HBMA 3I5CA 2K1RA 4EZ9A 2YWKA 5L1IA 1HBOA 1BQXA 5KG3A 3NOGA 2KVQE 4L3NA 1BWVA 3Q2SC 2DNHA 2F4VJ 7AT1B 1TAQA 1BLUA 5CYJA 3DRRA 1RJJA 3LP1A 4O3NA 2HAIA 2CVEA 3AB4B 4E8UA 3G8QA 5KG1A 3T5KA 4CLTA 1EZZB 5KG7A 1HNXF 2MKKA 3M1VB 2QSWA 1YJTA 3I5BA 3LP0A 2FZGB 5RUBA 5A2QU 3MMCA 5EX3A 2KXNB 1YI2S 1TL5A 4ZVRB 4XAKA 4GC6A 2R7QA 2DHHA 4QIGA 3M8RA 2MMYA 4KGZB 4WIIA 2V34A 4RZRA 1U25A 2HVDA 3KLIB 2VG6A 4NXMJ 5FLXY 3I96A 4NYOA 4CLLA 1TV6A 3CDEA 5IT9Y 3MEEB 4QZVB 2KFYA 3CJ5A 4G65A 4CI0B 2MZQA 1H6KX 1S1VB 3H5XA 4USTA 3PW4A 3BPDA 4CIOA 1FK9A 3MCNA 2HZVA 4P7VA 1D0EA 1SL2A 4YB6A 5K8OA 1ZPWX 3H98A 5JVGQ 3QRRA 4JB8B 3DLGB 4X4VA 4X4SA 4KV8A 4LFBJ 3ETMA 1FCAA 2Q3PA 1L3UA 5DG8A 3IRWP 2HNDB 4ZN1A 4G1QB 4ZHRB 2B6AA 3BN4A 1O8BA 1HNIA 1ZPVA 3ZXWA 2FQQB 2E66A 3KHHA 1FVQA 3W63A 2VIHA 2KU7A 2Y1RI 4PPZA 3Q8SB 3Q8YA 2OPRB 4KY3A 4LMZA 3DGVA 2BOAA 2UVVA 4OI1A 4OV1A 1C1CB 3A8EA 1S6QA 3DOMA 2M7SA 4XIUA 3IFEA 4NI2B 2V8HA 2RQMA 2EPIA 4OYXA 4IO9Q 4I7FB 1ZAVA 3ZTRA 2Q1LA 5FJ4A 3DYAB 4NLDA 4LF8J 1B70B 1U1RA 4DHVA 2YNIA 2Z2MA 1FF2A 2ZH6A 2F9JA 4DV1F 2FTRA 1X9WA 3Q8UA 4JI6J 2H51B 4IUFA 2KRRA 3UD5A 1V6HA 4B3MJ 1YLXA 4E98A 4M63A 3NY0A 3PX4A 2QTWA 2R7WA 1TK5A 4Y65A 4BLGA 1Q78A 2AEFA 4EEYA 4ZP8A 3BYRA 1VRUB 2VFTA 3BREA 4K2XA 3A3NB 2ZM6J 3DRPA 1F5CA 3ITHB 1LW2A 3OTOF 3RW7A 2MGZB 2VICA 5KT7A 2NZCA 3G6ES 3RAQA 1TUVA 1C1BA 2APOA 2VBWA 4B9TA 1P6TA 1FKOB 2W7PA 3G9CA 3PW0A 2M88A 2UXBJ 2B9EA 5DDQC 1KFDA 2GW8A 2DCLA 4FXWA 2V50A 1QVGR 3DRSA 4QPTA 1WC1A 1YJVA 3ZNJ1 4YP3A 2YBVA 3I0RB 2L9DA 1JLFA 1S76D 5B7WA 2DPJA 2HS4A 3IRXA 2CJAA 1VJQA 5GAEU 5ETQA 4ICLB 2B8QA 3RB6A 4X64F 3LOUA 4J91A 4LSLA 3M8PA 2QYCA 4OYBA 1FTRA 4DR1F 3MOJB 1VRQC 1CQNA 1DTTA 4OI2A 4WTOB 1WEXA 3DLEB 4DJBA 2R8GA 2EC0A 4F4KA 1RB0A 1HNXJ 4KT0C 4RW8A 5ETRA 2AQ4A 1EARA 3PYDA 2P6TA 3D0HE 1VFJA 2MHEA 4DUTA 4RU9A 3UDEA 2NR0A 3UDVA 2F7VA 2RQKA 2R7XA 1XK8A 4HHHA 3D5MA 2DEIA 4X4PA 2M9KA 4N56A 1UW4A 5HP1B 2WVEA 1VQ8S 1RWMB 5AXLA 5C24A 2E44A 5DM7Q 4C8NA 3O44A 5J2MA 1U1KA 3GFXA 1Q81T 4NMXA 3EUNA 1SC3B 4ILLA 3M2RA 2BQ3A 4O3OA 3EPGA 5BJRA 4WKYA 3ZZUA 4MFBA 4M5HA 1F1BB 4NX9A 4YR3A 3L3CA 1RBOB 4X4UA 4PWWA 3MEDB 2KG0A 1RU1A 1REGX 1RACB 1EX8A 2KHDA 3K8WA 3LO3A 4F4YA 3DLLQ 3W5XA 1VISA 5CYMA 2X51A 1SQEA 3QJLA 1HMVA 1AUSL 2DKOB 2MQOA 5D0RA 1CJTA 4R8UA 1PIEA 1WG4A 1TFYA 2CRLA 1Y9OA 2V9WA 2W2QP 1RLDA 5F0WA 4I2PA 3CMQA 3FZ2A 2VG5B 3V6JA 2M5YA 2I9SA 4O44A 3TVYA 3CMES 1H98A 5F3TA 1I1GA 4PCQA 2QIFA 3MF5A 1X0PA 3PW5A 2QL9B 3T9NA 4X62F 3R27A 3MPUB 1TVRA 1NM2A 2QGFB 3DGPA 2HBZB 2ZWPA 3KJVA 1F2HA 7FDRA 4MTPA 3OSNA 5IFMA 4WIQA 3NMRA 1U4BA 1VRTA 4DV1J 2C3MA 2ZZMA 1X4CA 2HMIB 4Y2CA 2HHUA 4OHZA 3PRDA 4CP5A 4O4GA 2EFOA 3TJAA 4AFFA 2VBXA 3SSSA 1IBMF 1QSYA 5HL7Q 4N41A 2VKRA 4CWBA 1RTIB 4PQUA 4PG5A 3G86A 5L1JA 1JKHA 5LL6d 2IHR1 3CJ8A 2XEXA 3CD5A 4LVOP 1IBLF 1RHRB 2HGLA 2XHWA 2VA2A 3D3BJ 4ZCLA 3TI0A 1FKAF 3HVAA 2L48A 3OTOJ 5B0DA 4CLPA 2Z57B 2W2NP 3I0SB 3PRBA 4DF4A 3GIJA 2PFDA 3RBZA 3SV4A 2HLTA 2I0XA 3LANA 3PM9A 1DURA 3DM2B 5J1PA 1VHFA 5IZHA 3JXOA 3BO4A 2HS0A 3TYTA 3OPKA 4J9MA 3G71S 1JLEA 2EI5A 3W1YC 4ZDNA 3GIKA 1H74A 3HHEA 1KLMB 2C42A 3MPVA 3UQSA 1KR4A 3Q22A 1RT7A 4DUYF 2C3OA 1WD6A 3GLJA 3T3FA 3J7AN 5I3UB 3QSIA 4HHJA 1M1GA 1EQMA 4X64J 2E7XA 4RO0A 4FBUA 1D1UA 3G87A 4DFJA 4USKA 4F8RA 3RYLA 2B3TB 3E8OA 2VDHA 4DR1J 4LQ9A 4ER8A 1S1WA 1YZ6A 2B7CB 3U1LA 3HHNB 1FJEB 1NHVA 3UWTA 2UUWA 1OS5A 1PYSB 4L76A 3OXLA 1U2RA 1GXLA 3TZYA 4WU3A 5I42B 1WELA 2VFRA 2B9YA 1SB6A 4E0DA 3SDEB 2VJUA 1JJ4A 3KK1A 2AJFE 2OPSA 1QE1B 2NPFA 1TKXA 4WK3A 2RSQA 4WZQA 3US5A 4DX6A 1RT3B 2E7WA 2IA0A 5SZTA 1D9DA 1NDCA 4D3HA 3BH7B 4HI2A 3ILIA 1QJHA 1NHKL 4M95A 4TU7A 4ERDA 2Z2YB 1T9VA 1QLNA 1EP4A 1IKWA 1DY3A 4BWJA 3H20A 4M5KA 2H4WB 2GNKA 1HNZF 4B17A 5EN1A 3PVXA 2AYMA 1UETA 1HQEB 4DG1B 3M8QB 1T02A 2QL5B 2LMIA 2D3ZA 1URRA 2EG2A 4KPCA 1U1QA 5IQ6A 2J7UA 1H38A 5FLXU 1IBCB 1RKJA 2XO7A 4HDHA 4I1TA 4DX7A 4HH0A 4URSA 2HRTA 1RT5A 2XS7A 3MM5B 4A8SA 5KFNA 1RLCL 5HBMB 2K1RB 1JWWA 3SCKE 1HBOB 1T9YA 3BBCA 2J7WA 4HH1A 1J5OA 1NB2A 1NK7A 3NS7B 4X62J 4Y28C 3CGIA 3DRRB 3LP1B 4WWSA 2FHMA 4PRFA 1CPZA 4IOAQ 5F0UA 2EFPA 2H5IB 1T05A 1RBAA 5K9FA 3LP0B 2NCKL 4DOZA 3MMCB 5CD4H 3RAMA 5T41A 3KDOA 2YPYA 2AYGA 2JVOA 4UUWA 1RT6B 3W3SA 5A8KA 4DZDA 2DBBA 4KR0B 2P8IA 4LR9A 2FVQA 1FWLA 4N77A 3ZZYA 2VA3A 1S6UA 4NXNF 4CO0A 2XMKA 1Q79A 1HA1A 4TKTA 1MN9A 2GO9A 2ZDOA 1IBLJ 5I4MA 1TV6B 2R7RA 2YWWA 3R97A 1IKXA 2VV5A 1RHUB 2VFVA 2RU9A 2HGNA 3O2IA 2H54B 5DQGA 3UR0A 2UU9F 3M7VA 2HFVA 4DL7A 1KTVA 5F8HA 5HVHA 1DAXA 3C2PA 3MR6A 5G4DA 2C22A 3VGVA 4GKKJ 2AGOA 4KV8B 3TAQA 3QSYB 1DJ0A 1HNVA 4WE1A 3KK2A 3HKZD 3MAAA 2W8LA 1Z4UA 1HNIB 3I9V9 3V2UC 2FVPA 3EXCX 1UAWA 5B0AA 4M94A 1NAQA 2H1YA 4DUYJ 4C8KA 3JYTA 3G8TA 3DDIA 2W7AA 2CPYA 4Z7CA 3WX8A 4K5RA 1WDDA 1HD1A 1V3SA 3DOMB 2RNEA 1KQKA 4ZPCA 2FYXA 3O8WA 1UFKA 4UY85 4RNHA 2BXJA 5J1EA 4WPAA 3QZ8A 4KTQA 2BM0A 3MUVP 2CAJA 4ZK7M 3HULA 1S49A 3D6FB 3JQKA 4MIBA 2YNIB 1VBYA 1VK3A 3HHDA 2EBGA 2DGOA 5KFFA 2G2OA 5E3RA 4TN2A 5M2PA 3SXLA 2DB1A 1CLFA 2J8AA 2E29A 4IH6A 3PW7A 2E5HA 3NCPA 4Q7AA 1Y3KA 4N47A 1RADB 5ADZA 4KQZA 4LSNA 1KBRA 3HVRA 4ZLNA 1VQOS 1JLGA 5K8PA 2VOPA 3IBWA 2DH9A 4DQPA 5C42B 3OJSA 1HBUA 2HHSA 3BSAA 3W8GA 5D4OA 2V8VA 2WVDA 2GJIA 3K89A 3HVTA 3DRPB 4NLUA 1WKKA 1LW2B 1HNZJ 3GSIA 1R8BA 2BEFA 1N36J 3TQ1A 4DSJA 2A3JA 4MIWA 4N8OA 1C1BB 2F4FA 2BOPA 2UUAF 3I55S 2CQ3A 2UZAA 2BQRA 4U8YA 2AHOB 1UA1A 1ROFA 4OZ3A 2QC3A 1NB7A 3CDBA 3HT3A 3M8SA 2P9CA 3EZUA 1CJUA 2IAJB 4ZOSA 1RT2A 1ZAXA 4HEA9 1R7IA 4W90B 2JLFA 1JJCB 3DRSB 4CM0A 4OI0A 4C4WA 2PC6A 4P73A 3KKFA 2XY6A 1TKZA 3OVSA 5F3ZA 2QA1A 2V4JA 4FS1A 2FZKB 1JLFB 3R8YA 1YJUA 1H2TZ 2BJ8A 3IRXB 1RHMB 3A12A 2WB4A 2OH2A 3ZTSA 2D9PA 2HK3A 4M5GA 1RU2A 3JTPA 2CPXA 2EW9A 3M8PB 5IT0A 4ECWA 5L39A 2MQLA 3JSYA 2E1PA 1DTTB 3PNIA 2R3VA 4M5NA 1SCJB 3FEXB 1HNWF 1U8SA 2F63A 4CNZA 4C7QA 4PG4A 2DIVA 4RW8B 2E5GA 2D3OR 3PJXA 3V5RA 5KFUA 5DRKA 4TVAB 1RSCA 3A3OB 2LU2A 2AYBA 2EKYA 2D74B 4JOUA 1TL1B 1JNZB 3M32A 4QQBA 3DHWC 4QBUA 4QCLA 4K2JA 3E2EA 4DV3J 5FDLB 3KHGA 4NXNJ 4ZVPB 1UA0A 2VONA 5ETNA 2V6AA 2G13A 2VKZG 3KUHA 5K5MA 3H5UA 4F3QA 1H7WA 4RBVA 4YDDB 5EHHA 5C24B 1CC7A 3PO4A 4DPUA 1BGXT 4OYIA 1CSJA 4W4MA 3W62A 4JI0J 4CLKA 2M70A 1LEOA 1LXJA 3MM7B 4P74A 3O5TB 4KHMA 3M2RB 3BGRA 3DU5A 1QAXA 4MFBB 4C8OA 2ATCB 4L73A 4J5OA 1VQPS 3T5JA 3EZOA 2HFOA 3JTOA 2BJEA 4ECYA 3NMAA 2NPIA 3GV5B 3GFZA 3NAIA 1Z2LA 2LU1A 4PR6A 1VQLS 2W9BA 3WIUA 1UPPA 3DOKA 1XMQF 4OYOA 2DT9A 1HMVB 3I87A 1CJTB 2KXHA 1LWXA 3VVTA 3O3LA 3K2YA 1L3TA 2J0QD 3HDSA 3R1LA 3AOBA 2FGOA 2K3KA 2ROEA 2LDYA 4CCHA 2ALZA 5T7LB 2MLYA 3GR1A 2RDIA 3TOQA 2EFQA 4ED1A 2IMWP 2O1PA 3QGIA 4OL8A 1SJQA 5E41A 4CO5A 3FBCA 3H2VE 4IFYA 2BJ7A 2V0NA 3ETOA 1TVRB 1AFIA 3DGPB 2ZE2B 1WEZA 3KJVB 1NK8A 1URNA 3Q86A 1VRTB 5D15A 2DPIA 4C3KA 2NQPA 2C2EA 3GV7B 1B4SA 2BV3A 5EGYA 3BQ0A 4ZITA 2GIFA 3HF5A 2BE9B 2MY8A 3KUGA 4M5IA 2ZHBA 3DNCA 4O4GB 2CNKB 3MUMP 1SIWB 2QMUB 3PIOQ 5HO4A 2DTJA 3AAWB 3LPEA 4WFAQ 4C0HA 4ID5A 4PQUB 4K5SA 3VAHA 1QTNB 1UCNA 1FD8A 3F56A 2KZMA 1SBRA 5AJ3F 1K1QA 4RW6B 2MB0B 2AJ2A 1WNEA 4Q8FA 1WHVA 4KRWA 1TKDA 1SV5A 3J80Y 1TUGB 2YQ3A 2EFNA 2KM8B 2UUAJ 4C11A 3M6WA 2YPZA 4O3RA 1RAOA 2BMBA 2DNZA 1DTQA 3R7SB 3CNQP 2IFXA 5KFLA 1A9NB 2HVHA 1HYSB 2VPWB 4F0KA 4DSEA 1O51A 1JLEB 2G1DA 1UL3A 2MJNA 3BB5A 2HHQA 1WORA 4B3SF 2I8EA 1U1NA 1SJRA 4FBTA 5DLGA 1UVLA 3EVWA 3MHYA 4P2SA 3WQPA 4USHA 4ECQA 3T1YF 3KK3A 1RAAB 5B08A 3OFHA 1RT7B 4A8OA 3VAFA 4DL4A 5CCLA 5CABA 4XPEA 4NYPA 4FYDA 3W5YA 3J7ZT 4ZCKA 2OTLS 5D0GA 4OJ3A 1QD1A 3H59A 1N33F 2Y9HA 1PBAA 1FI4A 3QMQA 4I2QA 4YY3F 2KH9A 1UWBA 1S1WB 1R6YA 2VBYA 3FSIA 3UW1A 3DKDA 3M9OB 3GYXB 2BJ3A 2KO1A 3HSZA 5LSOA 1YRXA 2VASA 2ROPA 2XMMA 2CNLB 1T7PA 3IWXA 4RW4A 1VQ4S 1FE4A 1HKAA 1U48A 1FXRA 4RLEA 3DC2A 3PYGA 3U27A 1EAYC 4NLGA 2C2NA 2D3UA 1VQKS 3KK1B 1BQNA 1UMJA 2HWIA 1WHYA 5KT4A 1PSDA 2V4RA 1CC8A 5KFCA 1R0AA 4NLQA 1Q1KA 5LXRA 4URQU 2RT3A 5KG5A 4KO0A 1W26A 1EP4B 1FRMA 1IKWB 4PYAA 5HN0A 3QAEA 1S1UA 2WVCA 4F3MA 2HBQB 4OYPA 3EVMA 5DG9A 1VQ5S 3O6QA 4R5PA 2DXFA 3QAUA 2H65B 2HAFA 1VJWA 4OJHA 2R8HA 4PWDA 1SJFA 2WK4A 1TL3A 2PMZD 1QM9A 3DMJA 2MKIA 1ACMB 1JLBA 5LMNJ 2COLA 3TAMB 1Q8BA 1T9TA 1XMQJ 1RHKB 2JFDA 3E01A 4X4NA 4MK7A 3OL6A 5FIIA 3M9MB 1Q95G 1YIJS 1HW9A 2XY7A 5B0FA 4JI4F 4FXVA 2V2QA 5A6WA 5L1LA 3MPDA 1GX5A 2EVZA 5IV3A 2CZVC 4NA3A 4EO8A 1XR7A 4OZNA 4HACA 2XMAA 1J5OB 2HQFA 4OQJA 2QRRA 5KFZA 2MSSA 2GMHA 2IC3A 4DR7J 3M05A 3ISNC 2BANB 1SPBP 5KFMA 2OLWA 3RZAA 2LQBA 2BKPA 2OEMA 2AMCB 1IM6A 5KG2A 4HT5A 3D2WA 1NZAA 3ENVA 1T9WA 1NK0A 1AA1B 1QAYA 5L9NA 1WI8A 2POKA 3ZC4A 4NLVA 2N7YA 5A8KB 5F8IA 5KFQA 3IXQA 1Q82T 4MK8A 1KQSR 3NNCA 3UD3P 1Y4ZB 5D0EA 1C4AA 1FDNA 2ZH7A 4AXIA 1F6TA 3I5AA 2GZOA 5AJ3J 3VGSA 3W2WA 2FUG9 3TARA 3D0IE 5C7PA 4LF7F 1IKXB 3HD2A 2QV6A 2DR8A 2AYEA 4A8YA 2HHHF 2CQBA 1NLKL 4YN3B 2W4CA 4NLOA 5D4LA 1OJ4A 1XNQJ 3U02A 4YS2A 4O3QA 3LTOA 1IUJA 3PFEA 2JC0A 2CPIA 4WE1B 3KK2B 2F8EX 1RT1A 4DN9A 3MAAB 5G0RA 1K73T 2HLUA 4B3SJ 1FEEA 3MM6A 3FSYA 4NA1A 2CJKA 3QJJA 1VBKA 2XI2A 4ZVQB 3H8YA 3T1YJ 2XC9A 1F3FA 1M0SA 2ZITA 4FYYB 2OMOA 2PA8D 3BS9A 2HZCA 1ELOA 3UCZP 3ZTQA 4K4VA 1RXOB 2YH1A 2UV8A 2BM1A 1N33J 2M4MA 1VC6A 4X2BA 2O01C 3TEGA 1PBUA 4YY3J 2C2DA 2M2BA 5JJBA 5J1EB 5JUMA 3GPAA 4WP3A 3KNGA 2FLLA 1KN6A 3SSRA 1UW9A 2DNNA 2A2CA 2PMWA 4DL5A 4RPFA 1FRHA 3CMAS 1Y00A 2JEJA 4ZVOB 2DY9A 3S6EA 2WBMA 5E2QA 4WP8A 4C3LA 2AGQA 1FO1A 2L9NA 1NJIT 2CQPA 2PMHA 3FBBA 1JLGB 2V4QA 2XCPA 3BM7A 3I56S 2ZNZA 1ZA1B 3VZIA 2RIJA 4OIXA 4DLEA 2YKNB 1PG5B 3CJ4A 1HBUB 4NEYA 3BPSP 2YWGA 3KOAA 4UZCA 3KLIA 2FVSA 3HVTB 4KH1B 2DNGA 1V3ZA 4A8KA 2B4PA 3NNHA 5LOQA 2ZH8A 2UUCF 2J5AA 3QIPA 4WFZA 1S0OA 5HROB 1LWFA 2RHSB 2XSJB 1RWVB 3PZPA 4RUHA 2R42A 4HLBA 4JV5F 1RT2B 3G2XA 5E0OA 1N0UA 5KOXA 3FUYA 2B8PA 4QOTA 2QG9B 1YQHA 4DQRA 3GV8B 3FSXA 1TKZB 3NWGA 4F04B 5IQQA 3DLGA 2V4JB 4P9SA 4JI4J 3D6HB 1IR1A 4I6YA 2HFSA 2FLOA 4Y2MA 3M2VA 2QJ3A 4G1QA 3RB3A 3N0VA 1Q8IA 2VB6A 4ZPDA 1KRPA 2ZOMA 2K8GA 1DQ8A 1TKTA 2ZH9A 2FJBB 4HKQA 4FVCA 4MH8A 1U47A 1ZZFA 2P5VA 5F8GA 5MAOA 1WC6A 2V5HG 1EKSA 2JLGA 1VQ7S 1OPZA 4LVNP 3IC1A 4USVA 4USIA 3CJKA 1LFWA 2Y1LB 4NCAA 1N54B 3JAMY 1ZTWA 2LEPA 2Q6BA 3F41A 3MCOA 1TQLA 1T8EA 2IM0A 3GTYX 4FS2A 2GGPB 3DYAA 4YUDA 4UZBA 3HJVA 4DLGA 4UOFA 3M32B 4H4MA 4LRCA 5BXIA 2RKIA 1T3OA 1KQGB 1Q86T 2FGCA 3R7BB 3H2UB 2DNRA 4ZLLA 5GMKa 2AJ0A 4Y2KA 3MMBA 3THPA 1GMWD 4M5LA 3HHLB 4PG6A 2V2KA 3EWGA 2MYFA 3IG1A 4ED3A 1KOOA 3IBCB 4U67Q 4OFZA 2YVSA 2IMOA 2WW8A 2GIRA 4LF5F 1ZM4A 4HTJA 1GXTA 2LKZA 2VFUA 2HHHJ 3BGRB 5DJBA 2I38A 1FJGF 2WONA 1XC9A 5IC4B 2MGZA 4DL2A 5DG7A 1FWPA 4AD6A 4B9MA 2E9RX 2Z56B 2E5IA 2VG7A 1X4HA 5K14A 5BYQA 1N48A 4JI7F 2W9BB 2L41A 1D9AA 5KOWA 3DOKB 1HBMA 3PEJA 2DYAA 3H90A 3DDKA 2PT0A 8ATCB 1YZ7A 1LWCA 1TMMA 2UUTA 4M5DA 5H9FJ 1FWKA 2LXIA 1TP7A 2XYPB 2R8JA 1NK6A 3MGJA 2D69A 4FDFA 2ZEJA 3O1LA 3CUNA 2HNYB 2N4CA 3I0RA 3MECA 9RUBA 1H72C 3DRYA 3S7RA 4WFYA 2FJXA 2C2RA 1Q5VA 2B0GA 3P96A 3M30B 4IFYB 1GH8A 1LNQA 2CUYA 3H5YA 2GA7A 1EHWA 3QJPA 3D3CJ 2GHWA 3WDOA 1MG7A 3TJ9A 3BKUA 1HHQA 6FDRA 1JLQA 2DNLA 3K5LA 4R25A 4FF4A 2XYGB 3CCJS 4Y2IA 3CD6S 3VAIA 4M1KA 5C25B 4C48A 4TXSA 5J2NA 3CE8A 3CWJA 3EXYA 5M2RA 2CQGA 3ELHA 4A8XA 4ID5B 3AA9A 3LALA 2IY5B 3CD7A 3IGNA 5IWAJ 2MQNA 3UNGC 1GMWA 2GMJA 4PG8A 4USMA 5KFBA 4WFBQ 3VV2B 3H40A 1NH7A 1HL6A 3CW2C 4D3GA 4DU8A 4J9LA 4OHYA 3W5ZA 3PJWA 3D1HA 4N8NA 4TLQA 3M9NB 5HP1A 3P6YC 1SV5B 1FE0A 3W8PA 1NO8A 4J9NA 2DO4A 2UUCJ 4GKJF 2IBOA 1DTQB 4RX6A 3BSOA 4F0HA 2KM8C 3MMJA 5GMDA 3N01A 4JV5J 5ETLA 3Q2TC 4P2MA 1FRLA 3IA0A 3VZHA 1IKYB 5F41A 3AXMA 2DK2A 3W60A 4U95A 3AJ2A 3RJMB 1T0TV 4A47A 1RYSA 3CCQS 4BBYA 2B4UA 3L7OA 3RAXA 4BDPA 3MR7A 5DDOC 5A8RA 3FEYB 3SQGA 3M4XA 4F36A 2DITA 1YITS 2XY5A 3Q0AA 2W25A 3B54A 1Z2ZA 4QR2A 2QLJB 4DFMA 2HFNA 1BUXA 2CJBA 3NS5A 4KGMA 1ZTTA 1OQ6A 4UQGA 3FKBA 1B64A 3FBFA 4YR0A 1A0OB 4RW4B 5DM6Q 1NJYA 2D9OA 4H4KA 2PD1A 5H9FK 1HIYA 3G82A 4NLTA 2F65A 1MNEA 1F9FA 2XMWA 1BQNB 3PO5A 2QSFA 2AZ1A 4J7CA 2HMIA 1R0AB 1B0PA 4RNFA 4WBFA 5KFJA 1RZMA 3CO0P 2YKMA 4TNOA 3PG9A 4QW8A 3PHEA 3NXZA 2G2ZA 4DMZA 4LF5J 5A8WA 1RTJB 3CO9A 1FJGJ 3OFFA 3H0PA 2MKYA 4B02A 1YBUA 4IO1A 3ILOA 1S6OA 4YEAA 4ED8A 4K59A 1NXIA 1TL3B 4EYHB 3LA0A 2DNYA 1PKUA 1V3RA 1JLBB 2BE7D 2J9CA 2HIYA 2CDRB 2WOMA 4JI7J 2LVWA 3CJSA 4P52A 4UF4A 3E01B 2G1HA 3MAHA 4CLUA 4TU9A 3LH2S 3SMZA 1WC3A 2MEWA 3CJRA 1FHTA 3GG0A 4DV0F 2XG8A 3CVKA 1S97A 3GJRB 2HQGA 2QO3A 3AD9C 2CPZA 4QWEA 3DXBA 1SKUB 2BE2A 2J0SD 1NKBA 3N28A 2WW4A 2XNQA 4HACB 3NKYA 1LV5A 3QO9A 3HPOA 2ZH3A 5J2QA 3WHIA 5T14A 2DGUA 4IG0A 3FRZA 2QLFB 1FRJA 2IC3B 2PO4A 4F4WA 1XMOF 3EYZA 1W25A 1YSJA 3F0NA 3N6LA 4LJMA 1HWJA 2C3UA 2YNFA 2YXLA 2ROGA 2B51A 4ZS6A 2CJQA 3PTWA 3C14A 3ISZA 4Q2LA 4G3IA 3B82A 4DXLA 4FKXA 4RW7A 1RA7A 2V2VA 2MKCA 3VGUA 5E5NA 4FP9A 2HHPA 1OY9A 1QE1A 3OVAA 5LSLA 5DS7A 2RD5C 1N6QB 2PEHA 4LF4J 2W9CB 4WK1A 1RT3A 2X1GA 1S59A 1XTZA 1TZ0A 1WACA 5HAOA 4KH0B 2IM3A 3D0GE 4GKJJ 3AB2B 5L9XA 2HS3A 2XMJA 1M1HA 2N3OA 4A8FA 2XS5A 1M5PC 2QFIA 4YMEA 1IM4A 1KC8T 3V81A 1N4LA 3AQPA 4CO1A 3JSRA 2BJ1A 4K4UA 5G0RB 2XLIA 1HQEA 4DG1A 1RTDA 1BE4A 3MM6B 3T5HA 1CEZA 4C97A 3KLHB 4OV6A 3BEGB 3K17A 2MQ8A 2XZWA 4ECVA 3FDSA 3D6TB 2KDOA 4DBQA 2R2UA 4WKRA 3MURP 1F5BA 2AGPA 2GJ2A 3MM5A 3R9LA 3X1LB 2Z0GA 1FX4A 3ZZOA 2CKWA 4DR5F 3A8IA 4DFKA 1KLNA 3FCHA 2UXCF 2FJVA 3ZZPA 2GQQA 1Q16B 3CSKA 3M6VA 3C3LA 2HURA 3CCTA 1U0HA 1RBLA 1LXNA 3CT9A 4AL5A 2JEGA 4USUA 2J6SA 2LXFA 2RMLA 1PAEX 4AYBD 1XBWA 2LQJA 2OD6A 2ZD1A 2ZKTA 3MI7X 2KYXA 4ED2A 3BDEA 1ULRA 4G1PA 2I6WA 2YNGA 1N5YA 4O3PA 1RT6A 2F8HA 5CH7B 1MWYA 3BO2A 1VI7A 1NSAA 4IR1A 3IR7B 4WJBA 1VQ6S 2YY3A 3GYNA 2JRSA 2OSRA 3A1YG 4QR0A 3ET6B 5C5JA 2CA9A 4HL9A 2AX0A 3TQEA 3QIPB 5KFRA 3DLKA 4LF2A 1HI0P 3N9UC 1LWFB 1H2UX 4MAKA 2AEMA 2ZBRA 1XEZA 1NMEB 2FLNA 1ZOTA 2XQCA 2IA6A 3HFVA 4NLRA 3KHLA 2EG1A 1G3OA 2DNQA 3Q8PB 1FJ7A 4UY8T 1FVSA 1RISA 5A6PA 2HWHA 3M2VB 4DV0J 3TA2A 3LP2A 1R27B 2XMTA 3BDPA 4LBPA 3ZTPA 1UZHA 4RR5A 2YWEA 1XJWB 3OL9A 1TKTB 3PY8A 5CZVA 1EIYB 2QA4S 4CLFA 4C8LA 4DSIA 5AE2A 1UVIA 3CJKB 1VIXA 2DY1A 1YRUA 4ZMMA 3MAQA 5JVHQ 1NJZA 4ZPWR 4FZVA 4A8MP 1T3NA 3ILJA 4QU7A 3UN2A 4MKYA 2Y3YA 3Q8VA 4MKAA 3THTA 2VC1A 3PHTA 3PIPQ 3PKYA 3LW5C 4UOHA 2JEFA 1LK5A 1R0CB 4H4MB 2LDIA 4F67A 3HKWA 1Q8KA 1SIZA 2Z58B 1CULA 2RKIB 1FEHA 1BC6A 4G1IA 5CZXA 5IV4A 3P5BP 4IOBA 1FX2A 3MMBB 4DCPB 1VBZA 3LAMA 4OMFG 3GP9A 3MR3A 5SUHA 2ZDPA 3NEKA 3IG1B 4NMLA 3CC2S 3R2DJ 5EUHA 2DHAA 3PR5B 4CLWA 2B5JB 5C42A 4LFAF 1NUEA 4YDXA 1K47A 2WONB 3KUEA 3RRHA 3R5BA 4WP9A 1KHVA 2D7SA 2RILA 2BRLA 2ZJQQ 5HMZA 2GVDB 4IR9A 4NL5A 2JH3A 4UT4A 2VG7B 1XNRF 5K14B 2YX4A 1SH2A 4CTAA 4ZIWA 2HHXA 1OY6A 2HKEA 5CYQA 4KKOA 1HBMB 4Y3CA 4PG7A 1LWCB 2IAJA 2WVBA 1X60A 4M5DB 4QR1A 2DR7A 2ACMA 4L74A 2RDJA 2CQ0A 2L9WA 4RU2A 3CCWA 5E7OB 4WFXA 2GAHC 1NBEB 3Q8RB 1FTCA 3VGTA 3DLHA 2LA6A 3MECB 5ETKA 1SC6A 3P5TL 4PXCA 1EQ0A 1X5SA 5D3GA 2BRKA 3TANA 1G4CA 4QIEA 1HI1A 4DWIA 2AF6A 2VQEF 3Q23A 4DR5J 4ZJLA 1WC0A 1PCAA 3KMSA 4KBIA 4IRCA 2UXCJ 3ZZZA 2AKWB 4L72B 4DL0C 4QPXA 1DZ5A 4RUBA 1JLQB 5GAGU 1JJHA 5KG6A 1VK8A 3GONA 2QA2A 3AXKA 1R6VA 3JB9k 4K0KF 3VCDA 2Y0SD 1JX4A 3UPFA 1Q7LB 1X0FA 2NS1B 4ZP6A 2IJFA 5J2NB 3R3TA 1KS2A 4NASA 3G6VA 2N4DA 1S9FA 1WTFA 5A2QY 2CFXA 4A4JA 1IWGA 2EEYA 5CA5A 2XMVA 3SZ2A 3CF5Q 1LWEB 1TL1A 1SH0A 2EKNA 1YRTA 2PDAA 1GEHA 2WSEC 5FDLA 1U1MA 5HVFA 3HX9A 2LA4A 4J9PA 3BZQA 1RAHB 2BBEA 4UOCA 2HRUA 1M90T 3FCVA 4ED7A 4UTGA 4P2FA 1RHJB 2YTCA 1OY8A 1YWXA 2HQ3A 3CCZA 2OD4A 3MM7A 4H4OA 1WOOA 4IG3A 2MLZA 6AT1B 3WC2A 2OI2A 2XWXA 2AZ3A 4NRUA 2NXUA 4LQ3A 4O23A 4DR6F 3UDCA 5KFWA 4FNHA 4X66F 3HK2A 2XS2A 2XB2D 3DDNA 1FRXA 1DHMA 1G6BA 2DXEA 1JXLA 1U2CA 2R8IA 4K8RA 5AXNA 4WXOA 5A8RB 3SQGB 1XWLA 3OQ2A 1KTQA 1C2PA 1U49A 2DH7A 1BMQB 4OI6A 3MM9A 5T7LA 5K20B 3KLEB 3R6GB 3MR5A 4EBDA 1FNXH 1M1KT 3UI3A 3NP5A 2UVWA 2O67A 4DV5F 3TUZC 1NPRA 1EETA 4OZ1A 1RT4A 2ZE2A 3G82B 5CHCB 4IYQA 4ATNA 3HCXA 3JSMA 1RWNB 3JSBA 3AQOA 4K4XA 2VBZA 3DU6A 3TA0A 1U0SA 4U7CA 2ZVSA 2E9TA 2ABYA 2YKMB 3EGWB 1R43A 4PXDA 2FJDB 3AOCA 3OT9A 3EMTA 1YJNS 4F2SA 5IS2A 2CG8A 1TL7A 4OHWA 1FT8A 3POTB 4LFAJ 1GK8A 1B7FA 5A8WB 3AOAA 1R0BG 5HK4A 5D6GA 1SC4B 4RW6A 3VAKA 5L8RC 5KFGA 2VODA 2MSTA 3N4WA 2H5EA 3MXHP 1FXDA 4GC7A 5KFTA 2FJEB 1DRZA 2YQ1A 1XNRJ 5CXTA 1XERA 2WOMB 4RBTA 1MROA 2AD9A 2RS2A 5I3QA 4J9SA 4MJKA 4YB5A 2BYCA 3H25A 2IBKA 4OZLA 1BXNA 1HYSA 3X3UA 1K8AT 2QYGA 1FKPA 2XGQA 3FVYA 3MCMA 4FKYA 1JLAB 2AT1B 2C2ZB 1ITPA 2FJWA 3OJUA 4CO2A 4DQQA 3IGVA 4EWTA 3BJYA 1RAIB 4NWBA 5GMEA 4X65F 4S0MA 3C6TB 4MIAA 4CM2A 2BE2B 2VPZB 2QLBB 3QWUA 3QO9B 1LOUA 2QZ8A 5J2QB 2VQEJ 4IG0B 4JI5F 2IIHA 4V19X 2XWYA 2DHSA 3RGIA 3IM9A 1ZYQA 1MMLA 3RB4A 2GVZA 3NLCA 1UTAA 2CQ4A 4C0OC 1W7WA 4K0KJ 1R89A 5GAHI 2IJRA 2JOQA 2YNFB 3MDFA 3TUJC 3D66A 1J5EF 4NCGB 2B9XA 2PFFB 1RAJA 3OTDA 2JX2A 2W2MP 2OHDA 4DSKA 4PWUA 3C14B 1P1LA 4RW7B 2DEJA 4GRSA 5D78A 3IO1A 1NPPA 2HQCA 3ZZTA 4UUXA 3SV3A 1S10A 3HFZB 3LF0A 1M5SA 3QYYA 4ZVHA 2F4VF 2ZZTA 3D67A 2O66A 3JS9A 3VTIA 4GO7X 3GJTB 4FPRA 2ZVIA 4OYAA 2ZC4A 4J9KA 3GB0A 2CADA 2XLJA 5D4PA 4OHVA 4OYWA 3V81B 1FERA 2FC8A 2PGCA 2OKQA 4ETXA 4ENOA 3MFHA 4LRFA 4QYZJ 1S77D 1RTDB 4B9NA 5DETA 5KTQA 2G9OA 4CNYA 3K59A 3AY0A 4UQTA 4CH1A 4DR6J 2ZZNA 2WHOA 3C15B 4X66J 3A4TA 3GE9A 2MZRA 3TAMA 4NYZA 3BQ1A 3KLFA 3CJ2A 1XQIA 4BHQA 3F73A 4ILRA 4C6AA 4EUVA 3WC0A 5IT9U 2SXLA 5E3QA 4P75A 1BWEA 3FMWA 2XCAA 1C0TA 1WDTA 3J7YI 1HBNA 1IR0A 4M5JA 2EFGA 4NE9C 1M5HA 4IH7A 3GMGA 4BC7A 2WSCC 1Y5NB 1FNOA 2E9ZA 3CIMA 4DV5J 2L3MA 2JEIA 3T6JA 2HBRB 3T1AA 2ZJPQ 5C2CA 4LFBF 2R2SA 3D1OA 1IVZA 1ZA2B 3BKFA 4H54A 2MZJA 1TMJA 1K1SA 1U0HB 4CT8A 3G6YA 4ANCA 4PUOA 2BANA 2AU0A 2XTJP 2ZOGA 3C66A 1W2BR 1C0UA 3K57A 1PILA 3QT8A 2ZD1B 2GS8A 2V63A 3LWMA 3HI9A 3HXMA 2VL1A 3TZWA 2YNGB 1N5YB 2DGQA 3GILA 1IBMJ 5KAKA 1HI8A 1LKZA 5L46A 2ZKUA 3CTRA 1TELA 2JHEA 2VUGA 4PXEA 2YX1A 2K7JA 1BHNA 2ZUGA 1R8CA 2V9KA 2PSZA 4FYWB 3A13A 3DLKB 3I4HX 4QIFA 4EGLA 3PX0A 3QFHA 4TU8A 3CXCR 3KJQB 4JI6F 1VR6A 4XTTA 3OVBA 1CJVA 1AXQA 2DNOA 3CPWR 1U1OA 1LW0A 4B3MF 1F5AA 3VR1A 3A8KA 4DX8H 1OSDA 1M5OC 2BR0A 3LP2B 1AW0A 1XIQA 4ID8A 2ZH1A 4X65J 1UEKA 5AXMA 3D68A 4LIWA 3PXGa 2KT5A 4QU6A 1JXVA 1KVJA 2NXCA 4IQXA 1VLYA 2C2MB 3BO3A 2AP6A 4ITSA 2NXJA 5D4NA 4QYZK 2FIUA 2MHNA 3ZO7A 3GIIA 3D6MB 3OUYB 2OP5A 3G8SA 1J5EJ 4ED4A 3AODA 3EGVA 2OELA 1CULB 2R7UA 4ZVFA 3U1MA 1RCXB 3FQKA 1LK7A 3BGFA 1C4CA 4Q5VA 2R2RA 1FESA 4LF9F 4ZVUB 3D54A 1PJ5A 4I67A 3K5PA 1GTEA 2CDQA 2ZBCA 1RWPB 2LQ9A 3L7PA 2GJFA 1RP5A 2YKNA 1Y5IB 1GMUA 4I69A 3HHLD 1IQTA 2HRYA 2JL9A 4ELTA 2W01A 3V6HA 2V69A 4PKDB 1GXUA 2JC1A 2J8SA 2XMUA 3R1HA 2VU5A 2AWZA 2AJ1A 3ADAC 2LXUA 3V4IA 2IM2A 2HYIB 1T95A 2FD2A 2FC9A 4CTAB 2MZSA 5CYQB 5HROA 4KKOB 2EK6A 3UDLA 2XSFA 2XSJA 1CBKA 3W2VA 4PPDA 3UN3A 3BGOP 4OX6A 2DHXA 1PJ7A 5DDRC 3TNVA 4F7VA 4TYAA 2BJ9A 4TY8B 3EPIA 2ASYA 3J81j 1NH8A 2GQ2A 3N79A 2D1CA 2DHGA 4JV1A 1HWKA 5D3GB 4YQWA 3IMQJ 3E51A 4GVLA 3EE3A 2WRMA 4JI8F 3DRXA 3T5LA 1QUPA 3VQTA 1BY9A 3DXSX 2RUGA 1OMSA 4NLWA 3N5FA 4XDCA 1UJ5A 1V5VA 1NDPA 2YNHA 5KG0A 2QEXS 5BR8F 2AJ4A 3CCUS 5LXYA 4ZJQA 1H2VZ 1U8WA 3MR2A 2IVFB 2OGUA 3R6LB 4CYUB 4F25A 3TUIC 3EICA 1NJWA 2OIHA 2D41A 2DISA 4JBCA 1KP6A 4WZMA 3P3DA 4K4ZA 2CJ9A 2GGPA 3WZ0A 2Q79A 2PIIA 2B9WA 2NUUG 1H73A 2AIRB 4DPOA 2RAQA 3BR9A 2J7KA 3OR2A 4B3OA 5K8MA 2G4BA 3ILLA 2U1AA 2WBRA 3DCAA 3LGMA 3TJ8A 4C0BA 4Y00A 4I6WA 4ETZA 4KE5A 4WXWA 4OYZA 2V67A 3NGDA 5GVQA 4KFBB 2GFFA 3QFWA 3HHLA 2E1CA 3MEKA 5DZ6A 2GV1A 3M8ZA 2JFKA 3TX0A 3CCSS 1H3DA 1YHQS 2B4VA 4H4OB 3HSDA 5E3AA 2UU9J 4LFCF 4XO0A 3RB0A 4EZ6A 4IG3B 2ZOFA 3FGVA 2HNZA 3GZ7A 1X8DA 3AFGA 2HIQA 4J9OA 3KFWX 1RA6A 3MFIA 1G7CB 3KJFB 2DGTA 3C16B 3MOZA 4WF9Q 2K06A 1IJFB 2NXEA 1U6FA 2E1AA 1KQFB 3SEOA 5ETSA 5KFIA 4YR2A 2ADBA 3UVJA 4Y0FA 2KXFA 2QN6B 5D77A 2KVIA 3FMBA 2VF3A 1FFWB 2HNYA 3MM9B 2RRNA 5MLCV 2IPOB 5A0YA 3M30A 4NPOA 1GNKA 3KLGA 1EETB 3QPIA 1RT4B 3DHXA 2YKAA 2ADCA 2FHKA 5GADI 1YX2A 4AXJA 5EWFA 5DQIA 4H4KC 2R8KA 2JDJA 4EBEA 3JSMB 3T6BA 4ZPBA 3QGGA 3K7RA 4AL7A 3NG8A 1MMNA 3TA1A 5F8NA 1RTZA 1UP1A 2IVMA 5C25A 4LF9J 2W4PA 2LP4A 3V4MA 2QE5A 1YJ7A 2MTLA 2OMLA 1HWUA 4J37A 4ZPAA 1KDNA 3I32A 2KFNA 2QFJA 1TL7B 1B7YB 3BQ2A 1JNRB 1KVKA 4RW9B 2WB1D 2MQPA 3HHKA 2GX8A 3QLHA 1KWMA 3KDNA 4HHUA 3SIPB 3VAGA 4MMOA 8RUCA 2NZ4A 2MY7A 2A6MA 2VZ9A 2Y0BB 1X31C 2A0FB 2F40A 2W2OP 3V6DA 1MW7A 1ZBTA 3THVA 1MROB 2MKSA 5DDPC 4DF8A 4MK9A 1TTHB 3UNYA 2GHPA 1SH3A 3WIVA 1D8YA 2VJVA 4IQMA 1XR5A 1WG5A 2DNKA 3NGKA 2ZH5A 3HZGA 1FKPB 5L1KA 4J9QA 1Y11A 4R0JA 2OPQB 3FK4A 4DS5A 2RQ4A 1IKYA 1VMBA 4K4YA 3IAS9 1WC4A 2R4FA 4KGXB 2PA3A 3SFUA 4JI8J 2CPEA 2ILYA 3C8YA 3BYPA 5LT5A 1M5KC 1TK8A 1UVJA 1AUDA 2QMXA 2ASLA 5BR8J 3BSNA 2LCWA 4Z37A 2GVZB 5DGAA 3VWSA 4WYWA 2RU3A 1HNWJ 2KT3A 1CS4B 4NRTA 3KG1A 3TO8A 2DRAA 1HR0F 3GCXP 3TUPA 2LFVA 4QW9A 3R7NB 4K50A 2KL8A 3K0JA 4W92B 2BX6A 5IM0A 2AX1A 5C2GA 2W24A 2C3YA 3GJQB 1QAIA 2OPPA 3SCIE 1AZSA 4F4XA 1WEYA 5KFPA 2Z30B 4PABA 3A3PB 2B4OA 2D3O1 4F2RA 2X7IA 2W9AA 4LR8A 2ZC3A 1VGYA 2A2DA 1U1PA 2FJAB 3NCRA 1YBAA 4LFCJ 5LSRA 1SJ3P 4F0MA 1VQNS 1RTJA 2JNJA 5L38A 1LQ9A 3VHQA 3TW0A 1RE1B 2IRXA 4N7TA 1MMDA 2P9GA 4HYKA 1UVNA 4AT1B 4OYMA 1LFPA 4CH0S 3NCQA 3TZZA 2XNRA 4IKAA 3KTQA 4MYTA 4OI4A 2H4YB 3KLFB 3B8HA 3PKMA 1EKRA 3GYGA 4DI6A 5ETMA 3CIZA 3SCLE 1DBDA 4FN5A 1C0TB 2CZ9A 1UPMB 2UVRA 1HBNB 2ZNYA 2AEJA 4QJVA 5F9LA 4HI1A 4CRJA 3D9BA 1H7XA 4IRKA 3IR6B 5D0HA 3RRGA 2ZUAA 4B9LA 3CB4A 4GKKF 1N0VC 5AT1B 4ZLJA 2K2PA 2A18A 4I64A 4DU7A 5IT4A 4PUOB 3K5MA 1MU2A 3AH6A 2MXYA 1C0UB 3DLJA 1S9EA 1W2IA 1VDHA 4RL1A 3OTEA 1HPZA 5JMNA 4X4QA 4DPTA 5EX0A 2RB7A 1GX6A 3RU0A 1L3SA 2MZ1A 1S5ZA 1UVKA 2ZBIA 2B56A 4I56A 5HATA 2YKOA 5B0GA 4K4SA 2XZDB 1Y0HA 3CDUA 1WOPA 3GR0A 4JP8A 4ELUA 2J9DE 1H0HB 2DJWA 3ICLA 1WSVA 3KG4A 4RUAA 1TAUA 1N6QA 1SXLA 2M52A 4QWBA 2W9CA 1S1XA 2H48B 4DQIA 2HHVA 2QLXA 3JQJA 2ZBPA 2OFHX 1HFEL 5HVGA 4QIVA 1N88A 3U1NA 5I3PA 1BD6A 1CJVB 1QUVA 1JXEA 1LW0B 3ZTOA 3KWMA 3W9IA 4DR4F 4ZPVR 4O0NA 1UFWA 2MJUA 1TL4A 3K8VA 3TAPA 3DI6A 3I4PA 1RAFB 3PJ9A 5KT2A 1WF2A 4DSFA 2G0CA 1ICEB 3KLHA 1B0VA 2NLWA 4KSEB 4Z7YA 3UFCX 1Q53A 4DV4F 4MT1A 2P9EA 3TWZA 1DFDA 2ASJA 3FC9A 2ALYB 2BABA 3VQSA 1N36F 3EDQB 3IM8A 3H4BA 1PYTA 1F9EB 1Q4RA 3OL7A 3PEHA 2CZ4A 3HFKA 3M2UA 4ECZA 3TRGA 2LECA 1O6XA 3GQCA 2DIUA 2Z8QA 2IYGA 1T94A 5F8JA 1N5QA 2MQQA 1HQUA 3PX6A 1HR0J 2RRAA 3RG6A 4OZJA 2HG4A 1HWLA 1Y7PA 1PYOB 2CWXA 1U1LA 3AD8C 2B7BB 1NK9A 2E5JA 3MTKA 1FRKA 1S9GA 1WKJA 1VHIA 3H4DA 4B3TF 2F3JA 3QIDA 4RUCA 1GMVA 3S8SA 2MDAA 2G0JA 3AT1B 3HMJG 2KG1A 4JYAF 4ECRA 1EB0A 5ETTA 4ZCIA 2V8GA 4ES1A 2OTJS 1D3WA 3G96A 4QWAA 1F9HA 1QTMA 1E6VA 5HI7A 3QGHA 4LRBA 3ET6A 3Q89A 3BF4A 3BKTA 4DZ6A 3V4IB 3C19A 1YGYA 2BW2A 3K58A 2EFVA 2ZBQA 4M5MA 5AE3A 4N5SA 2PEBA 2X3GA 2R9LA 3W2VB 5HQ8A 4DV3F 3BH6B 2VG6B 4U7UK 3QT5A 4ED5A 5LM7E 1RUSA 2HHWA 4DR3F 3IWLA 1IXKA 4ZLPA 1E6YA 3T41A 1U2FA 3LQVA 1YJWS 1VC0A 3QZ7A 4RBUA 3I31A 4JI0F 1YG0A 3B4DA 4ZN3A 2JSXA 4OZ5A 2UP1A 1FK9B 4O3SA 3DOLA 2YNHB 1R31A 1S6PA 2J6TA 3TZXA 4JI3F 3L95X 2R7SA 2CNOB 2FY1A 3P8BB 4A8QA 4LRAA 3J7A1 1A7GE 4IFVA 2B6AB 1UWAA 2RF2A 5DLFA 5KFOA 1X4BA 2XBPA 1A6LA 1AROP 1MWQA 3BGLA 4GO5X 1NK4A 3K5OA 1PAUB 5KFSA 1VQYA 3UD4P 4KYZA 2A10A 5KFXA 3OR2B 4B3OB 1NPKA 1S6QB 1VOMA 1OIAA 3CEDA 5A76A 2FZCB 3TVZA 1NCLA 2Q66A 3SYZA 1WHXA 1YVFA 2J0WA 1SL0A 1SQGA 2VC0A 2Y8YA 2IVYA 4TLRA 2C3PA 3BN7A 1BQMA 2MQMA 4LF7J 4HDGA 3H42A 2UXDF 2CNNB 3OFEA 2B5JA 1U26A 3QATA 1MN7A 3B6BA 4EBCA 2FVCA 3KXDA 5J1NA 4Q43A 2ZHOA 4ECUA 2HNZB 2RVJA 1QY7A 4CLZA 1VC5A 1HARA 2CVIA 4YOEA 1QDUB 4JV0A 4DR4J 5CD4A 2GVDA 1S1TA 1KFSA 3GG1A 2E5LF 5J2PA 3AJDA 2BVZA 2GQCA 3MZIA 2EK1A 4DPWA 3OBIA 4Y34A 5BYSA 4DV4J 2A1BA 3J80U 3UVJB 2M0GB 4A48A 4MKVA 1FA0A 4DSLA 4IDKA 2BACA 4O0IA 1I6JA 5HJXA 3UR3C 1FDAA 3ENWA 3QRQA 3I82A 4OJGA 3A8JA 3RBDA 2KKHA 1Q7YT 4FPIA 4DDFA 1FJCA 2N3LA 5A0YB 2F8MA 4X4OA 3S1TA 3KLGB 1IBKF 2J76E 3TX8A 1GT8A 2ATLA 4A8WA 4KAIA 2G2YA 4J9UE 1REVA 5H9EJ 4OX8A 1HLWA 3K5NA 1CG2A 4ZPTR 4PEOA 1PC4A 1YBTA 3HD1A 2OEJA 3OLAA 2OEKA 1U02A 3I9ZA 4B3TJ 1WF1A 3MMAA 4WCEQ 3FBEA 2ILZA 3D4JA 3IBFB 3QBCA 4HR2A 4NEZA 1TFWA 4X4RA 5GAEI 4LSLB 3NGSA 3CCLS 4CT9A 2DD8S 1VS3A 4JYAJ 1LWEA 4C8MA 2J9DA 2R7VA 2DXDA 2IRUA 3CJ0A 4ZVSB 2CG4A 3VALA 3QLHB 4C9DA 5GAGI 1YDLA 2YWFA 2VDIA 1SUQA 1WG1A 1AYEA 5CAAA 3MTJA 4DPYA 3T1HF 2JZ5A 3RBEA 4Z2XA 3CCRS 2WAQD 2CJXB 1U6ZA 3AA8A 3V6DB 3PCOB 4DV7F 1Q0NA 4EMDA 5E3CA 4L6V3 3P4UB 1V5IB 1PGZA 1R8PA 2IRYA 5IOLA 1OWXA 3PACA 1RWKB 2V94A 1S48A 1RQ0A 2RRBA 4K7QA 4DR3J 1P1TA 4RKUC 4R0EA 3FFIA 2KTQA 2Y1IA 1CJKA 4X4TA 2N7CA 5J2MB 3KMQA 4V19J 4GVBA 5AXKA 4P72A 2FLPA 3GCWP 5LJ5Y 1UEVA 3CDAA 4OX9F 2BW7A 2OAUA 4OLPA 2NSBA 4JI3J 1NKEA 1U24A 2AV5A 3R5CA 3TP2A 4EU0A 1VQ9S 3BV8A 4M8LA 3KLEA 5LMNF 2O5DA 3HM9A 5CYMB 2KB2A 3KHRA 1U09A 3CCES 4EFAC 4R8UB 2DR9A 3L4BC 1S7IA 1P8GA 1X4GA 4ES2A 3DFEA 3H2LA 1R8AA 3HP6A 5B09A 3F44A 4I2PB 5IM0B 4ZKAA 4O44B 3M6UA 1VBXA 2OPPB 1AZSB 3MPWA 3FEZA 2FHOB 3PDNA 4NOHA 4FF1A 4DR7F 4CDIA 3OL8A 3QQCD 2BDPA 1RDRA 3MWBA 2UXDJ 4JUZA 5U47A 5H9EK 3CULA 3POTA 1KONA 1WOSA 3N6MA 1RAGB 1QSLA 1NRKA 4ZCMA 3JTNA 2N82B 1NSQA 1Y5LB 1QVFR 1DLOA 2YH0A 4NZ6A 4C8ZA 1X5TA 1T9XA 4WTYA 4AQYF 1NHUA 3MEGA 4KB7A 2XLKA 3FQLA 2HEKA 4ES3A 4RNMA 2UVUA 2EC2A 2E5LJ 4IOCQ 5F8MA 2GO8A 1SI9A 3ZNUA 1R8HA 5HANA 1JKHB 4NLPA 2BZ2A 4CLYA 2HPUA 2KZZA 1OYEA 1AFJA 2HFUA 3OFGA 2ACYA 3VF0B 5LJ3Y 4OHXA 5B0BA 5KFKA 4G6VB 2X1AA 1UJ6A 4DN0A 4FXDA 3TR5A 1JLAA 2GAGC 3G4SS 2ZHAA 1N56A 1HHSA 3M8YA 1WTBA 2RDDA 2G0IA 2RH3A 4U96A 3EGNA 3C6TA 3LPYA 1PJ6A 4B9UA 5FD1A 2HW3A 2HSEB 4CQ1A 2HK2A 4TQSA 1XNQF 3OHAA 4TQRA 4B9SA 1IBKJ 3QWPA 8AT1B 2R7OA 1K44A 3LGNA 4LR7A 3W61A 1KEKA 5B0CA 3PW2A 1WWHA 1Y10A 1KVIA 2Q6CA 5JXSA 1MU2B 5GAHU 1S9EB 4OZ2A 1WF0A 2V2ZA 1RTHA 1HPZB 4CLSA 3I6PA 2XHCA 1JJ2R 1Y3JA 3J81Y 2LLZA 1P9YA 4USJC 3C6UA 4F50A 1X4DA 3HZEA 4FF2A 1YK9A 3BBBA 4NCGA 3UO0A 3QRPA 4NLSA 2HZAA 5E3PA 3UN5A 3OR1A 4F02A 4Q8EA 4DL3A 4P6QA 2HVIA 1QSSA 5BYRA 4ZP7A 3HT0A 1T03A 3C46A 1D8ZA 4U8VA 3BGUA 1RWOB 2CQ2A 5HMWA 1S1XB 3T1HJ 4B3RF 1TU0B 2MPUA 1I5OB 4DV7J 1ZZNA 4ANEA 3ENQA 1S79A 1F0XA 4TY9A 2JLEA 3IS9A
chains in the Genus database with same CATH topology
3THPA 1SQEA 3IWNC 4DQSA 3QJLA 3GSDA 1HMVA 5KG4A 3BO3A 2MQOA 3HHLB 4PG6A 2V2KA 2AP6A 1NU4A 2OPSB 4ITSA 4KGKA 5D4NA 2MYFA 4R8UA 1TFYA 1WG4A 3IG1A 1CQMA 4ED3A 2J6UA 2CRLA 1TKXB 2FIUA 1N52B 1KOOA 4OJ1A 4KHPF 1Y9OA 2HFZA 4U67Q 2MHNA 4OFZA 2YVSA 2IMOA 2V9WA 1N5TA 2WW8A 2UV8G 3ULHA 5F0WA 2GIRA 4I2PA 4KHRA 3GIIA 4LF5F 3DI6B 3FZ2A 1D8YA 2VG5B 3OUYB 1ZM4A 3V6JA 2OP5A 3G8SA 4HTJA 1GXTA 2LKZA 2VFUA 1JLCA 3BGRB 5DJBA 2I38A 2M5YA 2I9SA 4O44A 3TVYA 3CMES 1FJGF 2WONA 1XC9A 1H98A 5F3TA 1I1GA 4PCQA 2QIFA 3MF5A 4RNNA 2MGZA 4DL2A 5DG7A 1X0PA 2R7UA 4ZVFA 3PW5A 1N34F 3U1MA 4B9MA 3T9NA 4X62F 3R27A 1KOHA 2E9RX 2E5IA 1TVRA 3PR4A 3FQKA 3DGPA 2VG7A 1X4HA 1LK7A 3BGFA 1C4CA 5K14A 5BYQA 3ONQA 1N48A 4JI7F 1FRIA 3KJVA 2W9BB 4Q5VA 2L41A 3J7YU 2R2RA 2HVZA 1D9AA 7FDRA 4MTPA 3DOKB 5KOWA 1FESA 3OSNA 4LF9F 3MM8A 1QAJA 3D54A 1HBMA 3PEJA 3AJ1A 5IFMA 4Q0BA 4I67A 3NMRA 1U4BA 1VRTA 3K5PA 1APSA 2HGMA 1GTEA 2CDQA 2PT0A 2ZBCA 3DDKA 4J9RA 2CIMA 1LWCA 2LQ9A 5DO2A 3B78A 3L7PA 3M2UB 2UUTA 4M5DA 2C3MA 5H9FJ 2ZZMA 2ZH2A 2LXIA 1TP7A 3PFOA 4JV2A 1X4CA 2HMIB 4Y2CA 3T9ZA 2HHUA 3Q8QB 2R8JA 4OHZA 3OLBA 1RP5A 1NK6A 2YKNA 3MGJA 5HMYA 3PRDA 1Y5IB 3O1LA 3CUNA 2UUBF 2HNYB 4O4GA 1ZM2A 2EFOA 2N4CA 2HRYA 3HHLD 3I0RA 3MECA 4I69A 1IQTA 4AFFA 1IKVA 5HLFA 3DRYA 2JL9A 2VBXA 1HQUB 2HQIA 2HWTA 3S7RA 4ELTA 3V6HA 3SSSA 4WFYA 5LMUF 2FJXA 2C2RA 1IBMF 1QSYA 4PKDB 1JB0C 2AJ0A 2B0GA 1GXUA 3P96A 5HL7Q 2JC1A 4N41A 1RT5B 2VKRA 3M30B 1RTIB 2XMUA 4IFYB 4PQUA 4PG5A 3G86A 3R1HA 5L1JA 2RJZA 2AWZA 2AJ1A 1GH8A 1JKHA 5LL6d 2IHR1 2LXUA 2XEXA 3V4IA 2IM2A 3CD5A 4LVOP 2HYIB 1S9GB 1IBLF 1T95A 2FD2A 2HGLA 2FC9A 4CTAB 2XHWA 2VA2A 3H5YA 2GA7A 1S7HA 2MZSA 5CYQB 5HROA 3QJPA 4ZCLA 2BUNA 4KKOB 2EK6A 2GHWA 3TI0A 3UDLA 3WDOA 2XSFA 4YB1P 1FKAF 3HVAA 2NSCA 2XSJA 6FDRA 1JLQA 2DNLA 2L48A 3W2VA 3K5LA 4R25A 5B0DA 1SJ4P 4PPDA 2Z2LA 1HHTP 2I5JA 4OX6A 2DHXA 4FF4A 3I0SB 3PRBA 4WU2A 1N32F 4DF4A 2CPDA 5DDRC 3GIJA 2CQ1A 1NEEA 3CCJS 4Y2IA 3TNVA 3N5BA 3CD6S 3VAIA 4TYAA 2GC8A 4TY8B 4M1KA 5C25B 4CO3A 3EPIA 2ASYA 2LEBA 3UCGA 3SV4A 4TXSA 5J2NA 1NH8A 2GQ2A 3N79A 2D1CA 3CE8A 3CWJA 3EXYA 5M2RA 2DHGA 2HLTA 2I0XA 3LANA 4JV1A 2YX7A 1HWKA 5D3GB 2CQGA 4YQWA 3PM9A 3E51A 1T05B 1DURA 4IH5A 3DM2B 5J1PA 1E6VB 1VIOA 1VHFA 5IZHA 4A8XA 3BO4A 2WRMA 2HS0A 4ID5B 3AA9A 3IAM9 4JI8F 3LALA 3TYTA 3OPKA 1X4FA 2MKJA 3CD7A 3DRXA 4J9MA 1RI7A 1JLEA 3G71S 3IGNA 3T5LA 1QUPA 5KT6A 3VQTA 2MQNA 1BY9A 2EI5A 3DXSX 3UNGC 2RUGA 3KLVA 4ZDNA 3GIKA 4NLWA 2GMJA 3N5FA 4PG8A 1X7VA 1UJ5A 4XDCA 2YNHA 5KG0A 5KFBA 4WFBQ 3HHEA 3H40A 2QEXS 1KLMB 1NH7A 1HL6A 2C42A 2DNPA 3MPVA 2AJ4A 3UQSA 5BR8F 2LEAA 4D3GA 1KR4A 3CCUS 3Q22A 5LXYA 1WI6A 2M3DA 4J9LA 1H2VZ 2NYIA 4OHYA 3PJWA 3D1HA 4N8NA 2PE8A 4TLQA 3M9NB 5HP1A 1RT7A 1SV5B 4Y6IA 4DUYF 4ELVA 1FE0A 2IVFB 3MR2A 2C3OA 1NO8A 1WD6A 3T3FA 5I3UB 4J9NA 1FNMA 2DO4A 4HHJA 3NRBA 2E7XA 4F25A 3TUIC 4GKJF 1E6YB 1J2VA 1NJWA 3CC7S 2OIHA 2IBOA 4FBUA 1DTQB 2D41A 4RX6A 5AE1A 3BSOA 2VPYB 1D1UA 2DISA 4DFJA 4JBCA 2KM8C 4F8RA 3MMJA 2Q43A 4DUZF 3RYLA 2B3TB 4WZMA 3E8OA 3P3DA 4K4ZA 2CJ9A 2GGPA 3N01A 3FRYA 4LQ9A 1S1WA 3WZ0A 2B7CB 2Q79A 3Q2TC 2PIIA 4CZCA 2EWHA 1FRLA 2B9WA 2NUUG 3P6YC 3IA0A 4DPOA 3U1LA 3HHNB 1FJEB 3VZHA 1NHVA 3UWTA 3BR9A 2J7KA 2UUWA 3OR2A 1IKYB 4B3OA 4DEZA 1OS5A 2X1FA 5K8MA 3B4MA 2G4BA 3FZBA 3DOLB 2U1AA 3OXLA 2WBRA 5F41A 3DCAA 3LGMA 1X9MA 3U7JA 1S6PB 1U2RA 2DK2A 4C0BA 1GXLA 4Y00A 4I6WA 4ETZA 5KT5A 4KE5A 1ZAWA 4WXWA 3AJ2A 4WU3A 5I42B 1WELA 1SL1A 1HNVB 4A47A 1RYSA 3NBPA 3CCQS 2VFRA 3NGDA 2B9YA 2JWNA 2BA9A 4CO4A 5GVQA 1SB6A 4KFBB 4E0DA 2GFFA 3SDEB 4BBYA 1JJ4A 2B4UA 3L7OA 1UEUA 4N76A 1Z1ZA 3HHLA 3KK1A 3MEKA 4WFNQ 4IFVB 2AJFE 2OPSA 2E1CA 1QE1B 3RAXA 4BDPA 2OJ3A 2NPFA 5DDOC 5A8RA 2I2YA 3FEYB 2GV1A 3CCSS 2JFKA 3SQGA 4DV6F 1TKXA 3M4XA 1H3DA 1YHQS 4WK3A 2DITA 2RF2B 2RSQA 4WZQA 2B4VA 3US5A 4H4OB 1RT3B 2CQDA 2E7WA 1YITS 2IA0A 1RK8A 2XY5A 5E3AA 5SZTA 1D9DA 3Q0AA 4LFCF 4D3HA 2W25A 4XO0A 3IN5A 2QMWA 1Z2ZA 3OUYA 3JYTB 3RB0A 4QR2A 4HI2A 4TYBA 1QJHA 4EZ6A 4DFMA 3Q24A 2HFNA 4IG3B 2CJBA 2ZOFA 3NS5A 4KGMA 3FGVA 2HNZA 4TU7A 4M95A 4I6AA 4ERDA 1ZTTA 4ED0A 1QLNA 3GZ7A 2OSQA 1EP4A 2KT2A 1IKWA 4BWJA 1X8DA 3H20A 1OQ6A 4UQGA 1IJEB 1B64A 2QT7A 5KFEA 2HIQA 4YR0A 2KJWA 4J9OA 4RW4B 3KFWX 1RA6A 2GNKA 5DM6Q 1NJYA 1HNZF 3MFIA 3ZZ0A 1Q8LA 2KFZA 2D9OA 1G7CB 5EWGA 4H4KA 2DGTA 4B9VA 1IN0A 2PD1A 3WBZA 4B17A 5EN1A 3PVXA 2AYMA 4NLTA 2B43A 3MOZA 1UETA 1XN9A 2DRBA 2BJDA 4WF9Q 3CDWA 1BQMB 1HQEB 1IJFB 4DG1B 3EX7B 3M8QB 1MNEA 1F9FA 1P27B 1T02A 2XMWA 2YKQA 1U6FA 1BQNB 2E1AA 2LMIA 1KQFB 3SEOA 4YR2A 5KFIA 2D3ZA 3PO5A 2QSFA 1URRA 3HHLC 3RTVA 1PO6A 2FDNA 2ADBA 2HMIA 4Y0FA 1R0AB 1B0PA 2KXFA 5K8NA 2EG2A 1U1QA 5D77A 2KVIA 4RNFA 5IQ6A 2J7UA 3FMBA 3SCJE 1H38A 1ZETA 5KFJA 2HNYA 2DCUB 3MM9B 2RRNA 1RKJA 2YKMA 4TNOA 2XO7A 4HDHA 2WTFA 2HHTA 2OO4A 4I1TA 3M1VA 1MWZA 5MLCV 4HH0A 4URSA 1L3KA 1GAOA 1RT5A 4QW8A 5A0YA 2AW0A 3M30A 2XS7A 4NPOA 1GNKA 1YJ9S 3MM5B 4LF6F 4LSNB 3PHEA 1S1TB 3KLGA 1EETB 4DMZA 4A8SA 5KFNA 3QPIA 1RT4B 5A8WA 3DHXA 1X9SA 5HBMB 2K1RB 5J2PB 2YKAA 1JWWA 3SCKE 1RTJB 3CO9A 1HBOB 1KHWA 2KYZA 2FHKA 2XULA 2ADCA 5IWAF 3OFFA 6FD1A 5GADI 4AXJA 5EWFA 5DQIA 4B02A 1RGVA 4H4KC 2J7WA 4IO1A 1S6OA 4YEAA 2R8KA 2JDJA 4EBEA 4ED8A 1XR6A 3JSMB 4K59A 4HH1A 4K4TA 1JMTA 1G1XA 1J5OA 3T6BA 1TL3B 2FPHX 4ZPBA 3QGGA 3K7RA 1NK7A 4EYHB 4AL7A 3D1QA 4Y28C 2F9DA 3CGIA 3DRRB 3LP1B 2DNYA 3NG8A 1V3RA 1JLBB 2J9CA 1MMNA 2WOMA 3TA1A 4IDKB 5F8NA 2LVWA 1UP1A 2IVMA 4TY8A 2FHMA 5C25A 4PRFA 1FD2A 2W4PA 3V4MA 2IYIA 3E01B 3MEEA 4JI1F 4IOAQ 1CPZA 3MAHA 2QE5A 2LQ5A 5F0UA 4TU9A 3UCUP 1NK5A 3LH2S 2EFPA 2OMLA 1HWUA 3SMZA 4C3MA 4J37A 4ZPAA 1T05A 5K9FA 1D9FA 3LP0B 1FHTA 3I32A 4DOZA 2KFNA 2QFJA 3MMCB 5CD4H 3BQ2A 1S1VA 3GG0A 3RAMA 1JNRB 5T41A 4A46A 2DGWA 3T19A 4RW9B 5KFDA 4DV0F 2WB1D 2XG8A 3CVKA 2MQPA 3HHKA 2AYGA 1S97A 2JVOA 2GX8A 3QLHA 2QO3A 4UUWA 1RT6B 1REVB 2CPZA 3W3SA 4QWEA 5A8KA 3DXBA 2DBBA 2BE2A 4KR0B 2J0SD 1NKBA 3N28A 4ZVGA 2DH8A 2XNQA 2FVQA 3NKYA 1JIHA 3VAGA 1LV5A 4N77A 2YWHA 2Z4PA 4MMOA 3ZZYA 1S72S 1S6UA 2MY7A 2VA3A 2NZ4A 4NXNF 3QO9A 2VZ9A 4QWDA 4CH7A 3HPOA 2ZH3A 4CO0A 5J2QA 1WHWA 2F40A 5T14A 2HNDA 2XMKA 2DGUA 1MW7A 1ZBTA 1Q79A 3V6DA 1HA1A 3FRZA 4IG0A 4TKTA 2PI5A 2GO9A 2ZDOA 1X5PA 3THVA 1FRJA 2IC3B 4ZHRA 4C8YA 2PO4A 4I4BA 2E1MC 1MROB 5I4MA 1TV6B 2MKSA 5DDPC 4DF8A 4MK9A 1DARA 3MMAB 2R7RA 4F4WA 2GHPA 1SH3A 1XMOF 3VAJA 3EYZA 4NLXA 4YHHF 1IKXA 1W25A 2VV5A 4Y2AA 2VFVA 2RU9A 1L3VA 4IQMA 1XR5A 1YSJA 2HGNA 3O2IA 1WG5A 2DNKA 4GMKA 3NGKA 5KFYA 1DQAA 5DQGA 2ZH5A 4ECTA 3HZGA 1FKPB 5L1KA 4J9QA 3UR0A 4R0JA 2UU9F 2OPRA 2OPQB 4DL7A 2H9ZA 1KTVA 4YFUA 1C1CA 2GMLA 4DS5A 2RQ4A 5F8HA 3N6LA 1IKYA 1VMBA 4LJMA 1HWJA 1DAXA 2C3UA 2YNFA 2CYYA 4K4YA 3C2PA 3IAS9 4B08A 2ROGA 2B51A 4ZS6A 3MR6A 5G4DA 1SUQB 1X4AA 2R2TA 2R4FA 2C22A 2CJQA 4JI2F 4DR2F 2AGOA 4KV8B 2PA3A 3TAQA 3SFUA 1DJ0A 3ISZA 1HNVA 4Q2LA 2CPFA 4I7FA 4G3IA 2CPEA 3B82A 4WE1A 3KK2A 4RW7A 1RA7A 2ILYA 2MKCA 3C8YA 3HKZD 4KFBA 1TK0A 5E5NA 2W8LA 4FP9A 2HHPA 2WCXA 1S0MA 1HW8A 3WX4A 5LT5A 1QE1A 5H1SV 1M5KC 1TK8A 3OVAA 1UVJA 1AUDA 1Z4UA 1HNIB 2QMXA 5LSLA 5DS7A 2RD5C 2ASLA 1O0PA 2PEHA 3I9V9 1N6QB