2LQ9A

Solution structure of the k60a mutant of atox1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Copper transport protein ATOX1
publication title Solution structure of the K60A mutant of Atox1
rcsb
source organism Homo sapiens
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lq9A00
2HLTA 2ZDPA 3I9ZA 4QOTA 2XMJA 4OJ1A 2ROPA 1FE0A 4A46A 1XBWA 2K2PA 1APSA 4U9RA 1JK9B 2K7KA 3FRYA 1OSDA 1K0VA 2PD1A 1SI9A 2GGPA 1KVJA 1FVSA 2BYCA 4HL9A 2XMTA 1OQ6A 3UDCA 2GFFA 4F67A 5IXUA 2AJ1A 4NPOA 2FTRA 2BJEA 2KT3A 3BN7A 3HF5A 1CPZA 1Y9OA 4A4JA 3FGVA 3HHLC 3FMBA 2LXFA 2W4CA 2XMKA 2HFNA 2K1RA 2EW9A 5F0UA 2ZDOA 4A48A 1YJVA 2FHMA 2OP5A 4DN9A 2QYCA 2OD4A 3GZ7A 2N4CA 3HHLA 5KAKA 1TL4A 3QMQA 3BDEA 4HI2A 2RILA 2GO8A 1YJUA 2HIQA 2QLXA 2RSQA 2Q3PA 2BBEA 3HDSA 4Y2IA 1SQEA 2RMLA 2LQ9A 2OKQA 2OFHX 3E8OA 3LO3A 2IYGA 5A6WA 5T7LB 4DPOA 4HI1A 3F44A 3KG1A 1Q53A 1AFIA 1CC8A 1Q8LA 1Q8BA 1TZ0A 5B0GA 4YEAA 3CJKA 2N7YA 1N5SA 2OD6A 5B0BA 1LQ9A 2GA7A 3KKFA 4Y2MA 1AW0A 1JWWA 3HX9A 3WDOA 1P8GA 1GXTA 1FESA 1X0PA 2KT2A 3KNGA 1CC7A 2IFXA 1YG0A 2L3MA 2K7JA 2VH7A 1P6TA 3BF4A 5B0EA 5B0CA 5B08A 1X7VA 5B0AA 3BM7A 4HH0A 2LQBA 2XMUA 1FVQA 2KYZA 2N4DA 4NL5A 3LGNA 3TNVA 1U7LA 4OJ3A 5B0DA 1OQ3A 4Q2MA 1N5TA 3BB5A 3MZIA 1ULRA 2HFOA 4FNIA 3DXSX 2HLUA 1TL5A 1X8DA 2ACYA 2OFGX 2G9OA 3MCSA 1MWZA 1FEEA 1VQYA 3HHLD 1FE4A 1GXUA 1W2IA 4A47A 1N5VA 1KVIA 1RJJA 2QIFA 2XMWA 2KKHA 2HQIA 2W4DA 2QLWA 3LGMA 2VV5A 2PGCA 1Y3KA 5F0WA 1S6OA 2IYIA 2RU9A 3IWLA 2FB0A 2GCFA 5K9FA 2BJDA 2GV1A 2AJ0A 3IWXA 4OJHA 3T9NA 1N5QA 1SB6A 1QUPA 3HHLB 1FD8A 2ROEA 4ZA1A 1IUJA 4OIXA 1YJRA 1YJTA 2ROGA 2BUNA 5T7LA 1AFJA 1VQSA 2LDIA 2OMOA 2XMMA 4OJGA 3HFKA 4YDXA 2W4PA 5B09A 3KG0A 3QGPA 4HH1A 2CRLA 3VTIA 1WD6A 2GGPB 1KQKA 1V3ZA 1TR0A 2AW0A 1R6YA 1YRXA 2OAUA 1Q4RA 1Y0HA 3CJKB 3TOQA 4EFAC 1S6UA 5A6PA 3BR8A 4FNHA 3TRGA 2ASYA 1TUVA 1MWYA 1URRA 3BGUA 2AP6A 1OPZA 2JDJA 3K7RA 2XMVA 4Y2KA 4ZOSA 1Y3JA 5B0FA 4Q2LA 2FIUA 2K1RB 4DL0C 3DCAA
chains in the Genus database with same CATH superfamily
2XMJA 1RT1A 2NLWA 3FEYB 1IKWA 1HBNA 4DR1J 2ATCB 1F9HA 1S1UA 2XLKA 3QJJA 2KZZA 3NAHA 2D41A 3LGHA 1NJZA 2QN6B 2XMAA 3MPVA 1JKHA 4OHWA 1G4CA 3DRYA 1WC3A 1NJYA 4NLQA 5AXLA 1OWXA 2BMBA 1WF2A 2IRUA 1XNRF 1WEXA 3MPDA 1C0TB 2ZITA 4OYBA 4MFBA 4FVCA 2QLWA 3GB0A 3OSPA 3I0RB 1I3OB 2IJNA 2EK1A 2QJ3A 1HNIB 1FX2A 3NGKA 2HQFA 2OPRA 2ZH5A 2O01C 2XWXA 1HA1A 4QQBA 2D3ZA 3IR7B 1LEOA 2DNRA 1O8BA 2W2MP 3ZTRA 1N6QB 3RGIA 4ED7A 1WC1A 2BQUA 2HVZA 1Q8KA 2E9RX 1ZPWX 4J37A 1ZM3A 2VC1A 1X5TA 2LECA 2MZQA 3PR4A 3CCSS 3OR1A 4H4OA 1FF2A 4EZ6A 2YNIB 2POKA 4PYDA 4M5GA 2RF2B 1DJ0A 1SJ4P 5HQ8A 4ZHRA 3NXZA 1X4BA 4KFBA 2O67A 3R9LA 2Y8WA 1RWOB 3CC7S 2JFDA 1NCLA 2KYXA 4LSLA 2Z58B 4CT9A 1RTDB 4ECTA 4I0WA 1ZOTA 2NR0A 3IN5A 2KM8B 1BWEA 1WSRA 4C48A 1QTNB 1VLYA 1QSSA 1YZ6A 2EI5A 4F8RA 2GQCA 1QSLA 2HAIA 3DLGA 4QZVB 2KO1A 5GMDA 1PYSB 2DRAA 2EFGA 3GFXA 1DHMA 2KG1A 4WXOA 3MHYA 4YR3A 3CCZA 1S1TB 4IG0B 4KY3A 4IRDA 2QA4S 4YDXA 3F41A 3R2CJ 1U09A 2H1YA 5J2NB 5K8MA 2GGPB 4LF6F 4DR3F 1S1VA 1XERA 3J81Y 3L7UA 2JC1A 1WC5A 3NBPB 1D9FA 2EG1A 3OSNA 3A3OB 2F8HA 4NZ6A 3FQKA 2IY5B 3MI7X 2MLYA 2VBZA 5DDQC 1NJXA 1IBLJ 2V68A 4ELVA 4F7VA 2UUCJ 3AQPA 1HBOA 5HL7Q 4PXBA 2RMLA 1R6VA 5I42A 3OXFA 1MMDA 2CZVC 3IBCB 3DFEA 1JLFA 1JWWA 2ZC3A 5ETQA 2HNDB 1VRTA 3FQLA 4MMOA 3KLEB 2HK2A 4NLPA 4Y3CA 5DZ7A 1LKZA 2UVRA 1E6VA 4RW8B 2JRSA 4QIEA 3ULHA 1MU2A 3ILLA 4H4MB 5E3PA 1F2GA 4PUOA 5KFHA 2FVSA 3SFUA 3T9NA 3CWJA 1FD8A 3LPEA 5F8JA 1XJWB 4PG6A 1JLEB 3ZZ0A 3P5TL 3QNWB 3TZYA 4BHQA 2HZAA 5DRKA 5I3QA 3AHPA 3R6LB 2JSXA 3M2RB 2CPJA 3DYAA 1XIQA 3FCVA 2XHWA 1ZA1B 3LP2B 5LSRA 3AA9A 1GH8A 3DI6B 4KGXB 1BE4A 1NDPA 3O44A 3CO0P 4HTIA 4X84A 3R5JB 4DX5A 4DR5F 3HFVA 3MEEA 5J2QB 5K8OA 3NNCA 1YJUA 4KV8A 4RU9A 5J2PA 3I56S 1TU0B 2EFPA 2PA3A 1UCNA 4LREA 1NSQA 2YBVA 4DR6F 4HDHA 1GT8A 1H3DA 2ASDA 1U6ZA 2DHHA 3N6MA 1H2UX 4J9QA 3EXCX 3PJXA 1NPPA 1SV5B 4WCEQ 4XAKA 4FYYB 3KLIA 2B4PA 2B4VA 3QT6A 2J6SA 2XNRA 2P6TA 4U7UK 3HLUA 4DG1B 2QSWA 4TY8B 1IUJA 2CADA 1FNXH 1T9VA 2BEFA 2DNHA 2OAUA 2XB2D 1V3SA 2FC9A 4DR4F 5GAGI 2AGPA 2LP4A 3EUNA 4KYZA 1BQMB 2K1RB 2OI2A 2IA6A 2Z2MA 1RWPB 3BJYA 4CLSA 4UOGA 1CJTA 4DBQA 3TVKA 2F3JA 2YNHA 2DGQA 3S01A 3L7OA 1N88A 2MYFA 1EQMA 2BE2A 4J9RA 3TUJC 4DV7F 2ZDOA 4MIWA 1PIEA 1FKOB 4QU6A 4J9KA 3H90A 4BC7A 3MM9A 1H7XA 3P96A 3SCIE 3IBWA 2CKWA 3WZ0A 1YJWS 4ALZA 4KGVB 1UVLA 1LQ9A 2CWKA 2QT7A 2ZNZA 3B78A 1WJ9A 1AZSB 4KR0B 3N4WA 3US5A 8RUCA 2BZ2A 3KUEA 1ULRA 1HQUA 3FBCA 4I6AA 4ES2A 2U1AA 3MEDB 4QR0A 4E8UA 3PM9A 2J9DA 1UJ6A 4ANEA 3S6EA 4CTAB 5K8NA 4PABA 4F4WA 3L3CA 4DV3J 3QIPB 5DQHA 5IV3A 1JLCA 4NCGB 4BC9A 1VBZA 2ZJRQ 2IHR1 3VVUA 2Q43A 4ZJLA 1URRA 3AH6A 1RT6B 3TYTA 5C25A 1G3OA 2CZ4A 3MMCA 3NNAA 1LFWA 3ZFVA 2J76E 2NPIA 4JI6J 4DL4A 4A4JA 3NP5A 2DGWA 2E1MC 4NLUA 4I64A 1TV6A 3NCPA 2QV6A 3AAWB 3KLHA 1CJVA 4QR2A 4LJMA 3T5LA 3THTA 3K17A 3CDUA 3W9HA 3TI0A 4QIFA 1JLBB 3NLCA 1JLAB 4FYWB 2JZ5A 2PFDA 5KG7A 3IC1A 4C0BA 3TVYA 1MG7A 1N5QA 3SCJE 3R7BB 2QZ8A 5A76A 2OMOA 5KFJA 5M2UA 2VA2A 4ANDA 5E7OB 2FHJD 4I69A 1R6YA 5DG7A 3CJ2A 4DX7A 1FXDA 1U1RA 5A8RA 4OX9F 3N5FA 2UV8G 2VODA 4ZPWR 3VAMA 4J91A 2DGOA 1A7GE 3EICA 2QA4G 4N8OA 2N4CA 5AXMA 2BX6A 1NM2A 1K0TA 2M3DA 2KI2A 2QE5A 1UETA 4MK9A 3GSIA 4A8OA 5D0HA 1QY7A 5KT3A 2PA8D 3V6JA 2GVZB 1NSKL 5B0CA 2KRRA 5F3ZA 5BYRA 1VISA 3PW4A 3U1MA 3C14B 1ZTTA 2DIUA 4DV2J 5BYQA 2DGXA 1SIZA 3C19A 4AT1B 1DBDA 3KLVA 2FY8A 4N7TA 2VDHA 4TU8A 2CJYB 1RAOA 4KTQA 2D9PA 1FRKA 5LMUJ 1PJ7A 1HYSA 2NYHA 1TR0A 4FBUA 2DNKA 4I2QA 4ZVSB 4ID8A 1G2EA 1YBAA 1RK8A 1YGYA 1F2HA 4NLTA 3M8RA 3ZTQA 5E3QA 1F9EB 5KFMA 1YJVA 4ID5A 1EQ0A 3WQPA 1FDAA 2FLLA 4KBIA 1PJ5A 1DRZA 5T7LB 2OH2A 1BUXA 4RKUC 1LWFB 2HFUA 3E01B 2J8AA 3QZ7A 1Q5VA 3DHXA 1G6BA 4TN2A 5CD4H 3GCWP 2H5IB 2ZBQA 3RZAA 1FNOA 3KTQA 2UXBF 2LEAA 2MKYA 1C2PA 2CQ0A 4K2JA 2HQIA 4ZVEA 3K2YA 4JB8B 4KKOA 3S8SA 5FLXU 3OTOJ 2HBZB 3A3NB 1S1WA 5F8MA 2D1CA 3UO0A 4DV0F 1CULB 5HP1A 4WKYA 4MK7A 4CM2A 4EFAC 1DLOA 1MWYA 5ETLA 2FJWA 1HQEA 3BBBA 1XQIA 2C3OA 3RAQA 1K1SA 2OPQA 2EFVA 1KNZA 2I5JB 1SUQA 1VIOA 2MZ1A 3EPIA 2CNLB 2XGQA 1R0AB 3HKWA 3G87A 2YNFA 1VQ9S 1RHQB 3Q24A 2HVIA 3ISND 3L9ZA 2HWIA 4YHHJ 2WONB 2ZKTA 4NE9C 1YG0A 1HHTP 4USTA 4TYBA 2GAGC 4USWA 1RWWB 5C7PA 3V6HA 1N5YA 2FZCB 1NPKA 3D6FB 3G96A 1FWPA 2JLEA 2OEJA 3GR0A 5HLFA 1YJTA 2BACA 1O5JA 2NUHA 2I6WA 5J1EB 4CH0S 1RWXB 2RDIA 5LJ5Y 1WD6A 4NA3A 5KFBA 3H7HB 1QTMA 4O0NA 3CD7A 1VQLS 4Y34A 3LF0A 4C3MA 5HBMA 3OLBA 2D69A 5A8WB 4OZNA 2L08A 1NEEA 4GKJJ 4ES1A 1XN9A 2HHWA 5KT4A 2YPYA 1MROB 2XMKA 2QLJB 3D6TB 3ETMA 4CM0A 3SSQA 4X4TA 1CLFA 4EK2A 2Y8YA 2JEFA 3HZGA 2OFHX 3OL6A 3QT7A 3MM8B 1EB0A 1D8ZA 2MLXA 5D3GB 2CPIA 2M2BA 1BD6A 4DUYF 3PHTA 1QUVA 2ZFHA 3HZEA 2CPDA 1REVA 4I4BA 3ZC4A 4ZVHA 5ETRA 3C6UA 5KT6A 5IT9U 3W2VA 1TP7A 2C1EB 3VAJA 4LUBA 4QPTA 4ZVFA 5JJBA 1VC5A 4PWDA 5C5JA 1MN9A 2VQFJ 3D9BA 1BQXA 2BQ3A 2DIVA 2AJQA 2HNYB 2P9GA 1L3UA 3MPUB 1T8EA 4Q43A 3LTOA 3NGUA 2LCWA 3DRPB 1U48A 5KT2A 3NMRA 4P52A 4QW8A 1ZAVA 5KFYA 2R8HA 2C2RA 3NOCA 5IZHA 4DSLA 1Y11A 2ZH8A 1X31C 3IM9A 3HCXA 4N77A 1M1HA 2O5DA 3RBXA 1YZ7A 5AJ3F 2Q66A 1WG1A 3Q8RB 1SKRA 4DV4F 2N3LA 3CJSA 3D5MA 3FBFA 5KG4A 4FF2A 2HGNA 3KMSA 4JV5J 1TL5A 1VJQA 1LWEB 3CT9A 4R8UB 3HVTB 1ZYQA 4JI3J 4OX6A 2DH7A 1KLNA 2LKZA 3R5AA 1AUSL 3H4BA 3FVYA 3LGMA 3IM8A 4C8OA 2YX7A 5IOLA 2DNLA 4F4KA 5AE3A 3OTBA 2GQQA 2ZH4A 2E5HA 1FDBA 2Z2ZA 2MY7A 3A1YG 2DNNA 2NXEA 3BR9A 5LT5A 1TUVA 2XHCA 1HNIA 4CLPA 3HVRA 2AX0A 4CRJA 1TMJA 2ZJQQ 3WC2A 2JEJA 2VUGA 2YKPA 4IRCA 1GTHA 2GMHA 2C2KB 1U0HB 3H8YA 2LQ5A 4DUZF 3N01A 1R27B 1RQ0A 4P75A 4DF8A 4LF8J 4FP9A 4F02A 3D1OA 3M8SA 2RF2A 2B56A 1REGX 3EMTA 2EPIA 2DRBA 2DJWA 1OIAA 3SQGB 4RO0A 2V4JB 4WP9A 2EFQA 2ZH6A 1ACMB 4ECWA 1X4AA 4RW9B 2MKCA 4KHPF 2PGCA 3W9JA 4LF7J 1L3SA 3G71S 4M5DB 3RB0A 4B9MA 4Q45A 3BGRA 5G4DA 3I4PA 1AT1B 3R5CA 1S6QB 3KHRA 3H2UB 2D3UA 5DQGA 2ASLA 4N41A 4GMKA 1GQEA 3BDPA 2KU7A 3G86A 5BR8J 4LRAA 4KH1B 2GGPA 4O3SA 3GV8B 2AF6A 4DXLA 3FSYA 3O2IA 3NBPA 3I32A 5KG6A 3ZZYA 3M30B 4MT1A 1I94F 2VPYB 4HHJA 3BGOP 1RUSA 3HJVA 3NRBA 3EYZA 4TVAB 4YR0A 2DHAA 2AYGA 1Q16B 3TUIC 4L3KA 3B82A 2V63A 3RAXA 3QRQA 1VQNS 1SBRA 2E5IA 3IGVA 2XMUA 2YWGA 1RAFB 1TKTB 1RAGB 3KUGA 1B64A 1OS5A 3UN5A 2XM3A 4RNHA 2EWHA 4GRSA 3A4TA 1LV5A 2HNDA 4J9PA 2NPFA 3WIUA 3N9UC 3LP0A 4DFPA 2HRTA 4DSFA 5D4LA 1ROFA 4OLPA 4H4MA 1UVKA 1FA0A 3G6YA 3QFHA 4ZP6A 2XWYA 5KTQA 2FDNA 2J8SA 3KYLA 1I6JA 1KHVA 3RBDA 2CQ2A 2FIUA 3D6HB 1JLEA 1DQ9A 4GVLA 3G6XA 3GILA 2FLOA 4DS4A 4K5RA 3R97A 3OL9A 3M2RA 1JLGB 2WB4A 3LP2A 2MSTA 1RZMA 3DM2B 3SMZA 2PEBA 2CPXA 1FJ7A 4ZPAA 3C6TA 1HBUB 3X3UA 3JQJA 2BJ8A 4WIIA 1N5SA 1U2RA 3I87A 1OMSA 3G6VA 1FD2A 5E41A 5LM7E 1RA7A 2HFOA 1NDKA 3DXSX 2GX8A 2WB1D 3HVAA 3CO9A 3JYTB 1VBYA 3W1YC 2V9WA 1S48A 3TEHB 5IT0A 2FC8A 1D0EA 2E1RA 3D0IE 3I6PA 1SH2A 2CJAA 4Q44A 2EKNA 2ZOFA 2HFZA 3GG0A 1IJEB 4PXDA 4C2MA 3BSCA 2ZH3A 1EP4B 1N4LA 3LWMA 4HHUA 3CCLS 1EJ7L 4DG1A 4F0MA 3I9ZA 4TY8A 2ASJA 2ZEJA 4PYAA 4X65F 1RWMB 4YFUA 2FTRA 2DB1A 3C46A 2BJ7A 3OFEA 2K1RA 2EW9A 4X4RA 3OW2R 2YVSA 2DNPA 1FJGJ 4MYUA 5LL6d 1KTVA 3NGTA 2NQPA 1D9DA 3AT1B 2XY5A 2LQ9A 3DOLB 4USMA 1HARA 3MCNA 1S6PB 2UXDJ 4JI5J 4DZDA 4UTGA 3CD6S 2H65B 3UDVA 3K5OA 2BM0A 3HM9A 2KG0A 3CMES 1Y5LB 1J5EJ 3QJLA 4M5NA 2QC3A 2UUAJ 1Y00A 2GZOA 1AZSA 5F0WA 3KLGB 2UUBF 1HR0J 1NHKL 3LW5C 2GJ2A 2XGPA 2W2OP 1WKKA 1X4GA 2AKWB 2G4BA 2RT3A 3MEDA 3EGWB 1BQNB 4KPCA 4B3RF 1FFWB 1JX4A 3J81j 2VJUA 4FNHA 4U8YA 2BW7A 3RYLA 3GONA 4ZCKA 3GQCA 4NCGA 1JLQB 5BXIA 1KWMA 4WFAQ 5L39A 3SQOP 1YX2A 2QA2A 4YB1P 2O66A 2ZOGA 1VRQC 1D1UA 2MQMA 1SL2A 4OX7A 1RABB 2J7WA 2N3OA 2XQCA 1SJ3P 2R2UA 2AYMA 4PXEA 5L1JA 3J80U 4RBTA 2V2KA 2QGFB 3TVZA 3IG1B 5IWAF 3PVXA 1UA1A 5GAHI 2NXNA 1B7FA 2GCFA 1I1GA 2HQ3A 4JI4J 2ZWPA 2PN6A 2VBWA 3NWGA 5KFKA 1JLBA 1JLAA 5EUHA 4OYXA 1PBAA 3UFCX 4A8SA 4CO5A 4OI0A 4ED0A 2R8GA 4OQJA 1TUWA 4WJBA 4F4AA 1S4FA 2CPHA 1NU4A 3UNGC 4WXWA 2HNZB 1TVRA 4TU7A 1FT8A 2XLIA 3M6WA 3MPWA 4AXJA 3UDCA 3T1YJ 4ZIVA 2QL9B 1S0VA 2FY1A 2CPZA 4EZ9A 3CULA 5U47A 3GIJA 1DZ5A 3HHNB 1Y10A 4N5SA 4A8XA 1QLNA 2GIFA 2HEKA 4PR6A 4PKDB 4E98A 1IKVB 4P72A 1JQGA 4M5LA 4U67Q 1IJFB 1HW8A 2JX2A 3TNVA 4UZBA 1RT1B 1CVJA 3Q8YA 4ZPCA 5AE1A 2QO3A 4PG7A 1HBNB 4R5PA 4KQZA 1VQ6S 1S1UB 4ZMMA 4CYUB 1H98A 3C14A 1G7CB 3D68A 1H74A 3DNCA 3CCUS 3HT3A 3TJ8A 1JKHB 3Q2SC 3PYDA 1SKSA 1Q4RA 5K20B 1X4CA 5H1SV 2C3YA 3TR5A 2DTJA 3JSMB 2QMXA 2WW8A 1UFLA 3ZTPA 3AB4B 1S77D 3Q8PB 4KHRA 1EHWA 3C8YA 2BDPA 5HJYA 1S49A 2XO7A 2IM0A 2FPHX 2OPRB 1VOMA 1WC6A 3VAIA 1S10A 1KD1T 5C2CA 3FZBA 3CDAA 2YTCA 3FBEA 3D6MB 1FK9A 1M1KT 5F3TA 4HYKA 4Y2AA 2ACYA 1PJ6A 4FXVA 1IKYB 1S5ZA 4JI1F 4FS2A 4NXMJ 2KB2A 4QIGA 4F3MA 3RB6A 1OSCA 4KFBB 2DY9A 4LR8A 9RUBA 2G1HA 5ETTA 4LSLB 4X4QA 1S7HA 2AEMA 5K14B 1V6HA 1XMOJ 3KWMA 5A6WA 4X4UA 4PQUA 3LGNA 5BJRA 5KFGA 2B9WA 2Q79A 3EGVA 2JVOA 4O3NA 4C97A 2I8EA 3PYGA 3QBCA 2YWFA 4ICLA 4DHVA 4ED8A 1U1LA 2OD4A 1M5PC 3KHGA 2BM1A 2JHEA 2QL7B 4WK3A 5DQIA 3IBFB 3MR7A 4KC5A 4NYZA 2F7VA 3R1HA 2KT2A 1JJ2R 3PW2A 1A9NB 1WDDA 3FZ2A 2WSEC 5HMXA 4N56A 4Y2CA 5LSLA 4DV5J 4QYZJ 2EK6A 4S0MA 1MWZA 1R89A 2W24A 3LPYA 4D3HA 1VQMS 3A8KA 5EX0A 3OXGA 3ILJA 1X5OA 4OI6A 1SB6A 4OIXA 2HZVA 2WBRA 3ZXWA 2ZE2B 3KJFB 4EO6A 3NWRA 5LXRA 3BR8A 1C1BB 4F0HA 4L6V3 1TKZB 1WACA 3AJ2A 4Y2KA 1AUDA 5J1EA 2VBYA 3GYXB 3QJPA 2ERRA 2PC6A 2CG4A 5A8WA 2RAQA 4M5JA 4LF4F 5HO4A 5KFOA 3H2LA 5CYQA 2BOPA 1KONA 5I3UA 3NS5A 2Z4PA 3MM5A 1KRPA 1RBAA 4ITSA 1MROA 1BWVA 2Y9HA 1IR0A 3CCTA 2GHPA 1YTYA 1NMEB 3R5DA 2AJ2A 4J5OA 1WOSA 2IMWP 4YN3B 3DYAB 3BB5A 4WFXA 2VG5B 3GYNA 3MM8A 3FCHA 2HWHA 2VJVA 1RAAB 1XWLA 1VQKS 4ZDNA 2FLNA 3PG9A 1O6XA 1S57A 2GIRA 3MF5A 5M2PA 3MEEB 3KJVA 1T3OA 5L9NA 4KV8B 4X64F 1PG5B 2FHOB 4D3GA 2J7KA 5ETKA 2LDYA 1UWAA 4NI2B 2WSFC 2H5JB 1D9AA 4DQIA 4X66F 3IR6B 1XNRJ 2AJ4A 3DLEA 2AJ1A 3HF5A 2D74B 2LQ8A 3I82A 1N8RT 4H4KA 3JAMU 1ZBTA 3QMQA 2Z57B 4R25A 4ANCA 3MR2A 3DRPA 4NEYA 3MD1A 1HPZA 1VQPS 1DAXA 4B9SA 3WBZA 4FYDA 3DDKA 4M94A 4ECXA 1VS3A 4RL1A 4YQWA 5CH7B 3ZO7A 3GIKA 1KQFB 2XCPA 2V8VA 2ZUGA 1RTZA 1GFWB 2X3GA 3OHAA 1GXUA 3FJ2A 3AFGA 3TQEA 3BV8A 4DFMA 5HSPA 2MKHA 1UAWA 4TYAA 5DM7Q 5AXNA 1LWEA 2DR8A 3MM9B 1VQ7S 1QAIA 2P6SA 2X1FA 3CGIA 3H25A 4OJGA 4WU3A 2HHHF 3FEXB 2DNQA 4TNOA 4JBCA 1VQ5S 1RTJB 3IRXB 2JJ4D 1HQUB 1OSDA 1HWIA 1M5SA 3CIMA 1RBOB 3TA0A 2BJEA 1JJ4A 3NKYA 1NB7A 2K8GA 2HQDA 4GC7A 2YWHA 1S79A 1NB2A 3GG1A 1NKEA 2OSQA 3TZXA 3HT0A 1NK6A 4K4SA 5CXTA 3VVTA 1D3WA 1CQNA 3RBEA 4EWTA 4LF6J 2IM1A 1CC7A 4DR3J 3PX6A 3PCOB 3GV7B 3MMCB 2WZ1A 3GTYX 4K4YA 4YY3F 4ECRA 3GFHA 3P8BB 1RTHB 1S6OA 3QLHB 3T5HA 2BOAA 5ETNA 1UEKA 1TV6B 1WDTA 1BGXT 3KLHB 1CJVB 1LNQA 3BKTA 4FKYA 1AFJA 1J5EF 4A8QA 3HFKA 1Z2LA 2CVIA 2EC0A 1HI8A 2DGUA 4K0KF 4Q0BA 5B0FA 1KVIA 5A2QU 4OYPA 1APSA 4V1Ak 3HD1A 2BKOA 1VQ4S 2VOOA 2YNGB 1QVFR 2F40A 2IAJA 1T9TA 3AD8C 2LEPA 2VFRA 3RW7A 3GIMA 3BDEA 2NCKL 5BYSA 2GAHC 1WHWA 3ENVA 1G1XA 4URSA 3DRRA 4OI2A 1MNEA 4DPUA 2WW4A 4Y2MA 4YDDB 3KUHA 1N56A 4AL5A 2IRYA 2R3VA 2W2NP 3RUBL 1YRTA 2BA9A 5E3CA 3RB4A 1T0TV 3EVMA 1AB8A 4OV1A 2R2TA 4DV6F 3PKYA 1TKTA 4LVOP 2FB0A 1UJ5A 1ITPA 4DR5J 2BRKA 4QWDA 1SH0A 4MIBA 1WF1A 5MAOA 3FUYA 4QIWD 2YXLA 4UOFA 1NH8A 2IRXA 3M9NB 5KFZA 2CDQA 2HS0A 1RT7B 3THVA 4DR6J 4A46A 2EG2A 3IAM9 4Y00A 3BQ2A 3O1LA 4EYHB 2HVHA 1A6LA 5L46A 3RJMB 5L38A 3PJWA 5F0UA 4ED2A 3GZ7A 3HHLA 4U6PA 5GAGU 1YQHA 2HBQB 4U7UD 2C2EA 4NLSA 3LA0A 3A12A 2FJDB 1HKAA 1LWCB 1JLGA 1HYSB 1P8GA 3GCXP 4I2QB 3DM2A 4DR4J 2ZH1A 2F9JA 9ATCB 3G8SA 1WC4A 1J2VA 2K3KA 2ZUAA 1HBUA 1R7IA 2RDDA 3MCSA 4CO3A 4X62F 2IVYA 1VYAA 2PMZD 1RJJA 4ENOA 5EX3A 8ATCB 4PXCA 4CO4A 4DV7J 2KFYA 2Z2LA 4BWJA 4ID5B 1HQ2A 1UMJA 5HAOA 3B4DA 3J7A1 1B0PA 2MKIA 3JYTA 2G2YA 4XIUA 1TAQA 4KPYA 4HH1A 1U1KA 3O6QA 3HHKA 2YH0A 2RQCA 4G3IA 3D2WA 2YKQA 4F36A 1OY9A 2XYHB 2NS1B 2ZDPA 3DGPA 3IXQA 3MUTP 2RRBA 1B0TA 1HLWA 3KHHA 4U9RA 2QEXS 3OUYB 4QWBA 3UQSA 4WYWA 2FZKB 5IXUA 2MQOA 2X1GA 4IG3A 1PC4A 5EN1A 2F65A 4RNOA 2QYCA 3OV7A 1KKHA 2WTFA 3BKFA 4KKOB 3DMJB 2VDIA 2QLXA 3BS9A 1S1WB 4NLDA 5HP1B 1NJWA 2OLWA 1SJRA 2CQIA 4RUBA 4OI3A 1DLOB 1P1TA 1HQEB 2ALYB 2OPQB 2CJBA 4ILLA 3DOLA 4Q8FA 5HMYA 3SDEA 3N5BA 3I5CA 2RU9A 5DDOC 2DYAA 4DDFA 2JWNA 4DSJA 3FSXA 1R3NA 2YNFB 1MW7A 3KXDA 3GU0A 1VIXA 5KFCA 1IN0A 4DN0A 5B09A 4N76A 3WHIA 4C98A 1SQGA 2YKMA 3KLGA 2OPPA 3AD7C 4U8VA 4DCOB 2JLFA 3OLAA 2KVQE 2W8LA 1K8AT 4U7CA 3ZZUA 5M2RA 2NREA 4WP8A 2GHVC 1BQNA 2G1DA 1XR7A 2HURA 5G0RB 1XMOF 3DRSB 2V4RA 2CWXA 1GX5A 2W25A 1OYDA 1N5YB 2CAJA 3BYRA 4RPFA 1S99A 3ZZRA 1JLQA 3DLLQ 5MLCV 4HDGA 4EBEA 5HLFB 2CXEA 3MAHA 3S7RA 1Q53A 1BLUA 4YEAA 3W66A 2W2PP 1PAEX 2AEJA 5HBMB 5B0DA 4DZ6A 1X4EA 4OX9J 3LWLA 2HSEB 5DETA 2AHOB 3CCRS 3HD2A 4J7CA 1RTIA 5F8GA 4DR2J 1RWNB 4NRUA 1V9OA 4I68A 1X9SA 3IG1A 2KHCA 1H7WA 5CYMB 4RUHA 2YWEA 2GVDB 2FLPA 1H73A 3GIRA 5J1PA 4P6QA 1Y0HA 2ZJPQ 2IDLA 4HEA9 4LIRA 4MKAA 4M5HA 5ADZA 1REVB 2IVFB 2WSCC 3BPSP 5GMKa 3W60A 3DDNA 3SIPB 3C6UB 3W2VB 3PX4A 2HNZA 3OJUA 5ITHA 2OTJS 1HNZF 5H9EK 1T9YA 3DDIA 1T3NA 4C4WA 1RT5B 1CJKA 4PWDB 3DLKB 1NJIT 5KFEA 3M32B 3V81A 3NEKA 4M8LA 1M1GA 3X1LB 1H72C 4F0KA 1RCXB 3Q0AA 1W26A 3PTWA 4HT5A 2QFJA 1T02A 2OPSA 2PEHA 3M8PA 3BBCA 1RHRB 3QRPA 2BANA 2OGUA 4A8YA 3QSIA 1H2TZ 2ZD1A 4HKQA 4CYUA 5CABA 3C2PA 3J81U 5I4MA 4WK1A 5IM0B 1FCAA 1IVZA 4RW7B 2KN4A 2UVWA 2V6AA 2R7WA 1QDUB 2UXBJ 2MHEA 2WVDA 4BBYA 4H4KC 2MKSA 3CVKA 4F3OA 2R2SA 2YX4A 1VQOS 4F2SA 2FJXA 3QIDA 3LO3A 3JSMA 1YHQS 3ETOA 4DV0J 2DKOB 3PO4A 1L3TA 2KXHA 4YUDA 2F63A 2L41A 1KLMA 3OTCA 4QWAA 3K59A 3CF5Q 4PCQA 4P73A 2FZGB 2XS5A 2COLA 3M8WA 3ENWA 1TELA 1Q1KA 3VV2B 4WE1A 4LFCJ 4NXNF 3T6JA 4ZVTB 4OJHA 1SL0A 1WHXA 3D66A 1IKYA 3VAKA 1WI8A 4LQ9A 1XNQF 3SCLE 2BR0A 2LMIA 5FIIA 3PNIA 4FKXA 4F4YA 4CLUA 3TRGA 1MN7A 4X4VA 4TLQA 1HL6A 1Q8IA 1YRUA 2UP1A 1JMTA 2JH3A 5K14A 2G2ZA 2KFNA 2YKNA 2R7OA 2R7SA 2VKRA 1M0SA 1XR6A 4DN9A 1RWUA 5KT5A 2PMWA 1O0PA 2E44A 4WTOB 3GPAA 3BGRB 1M5VC 3M8YA 3EXYA 1FWLA 3E8OA 2M4MA 1ZM4A 4ETZA 4USHA 3A3PB 4DV1F 2PI4A 2G2OA 1NKBA 1IXKA 2FUG9 2X3DA 2DHSA 2IJRA 4WZMA 4ZPDA 4ED3A 1S76D 2B3TB 2XCAA 3P49B 1BXNA 2LFVA 4B02A 3RR7A 3PACA 3JTPA 2CYYA 1RE1B 2IYIA 4P10A 3OPKA 2HKEA 2MTLA 1RHKB 2VG6B 2IPOB 3PYEA 4X4NA 1KOHA 1ZS6A 3CXCR 3KK1A 2YH1A 4KJIA 4J90A 3I4HX 2BJ3A 4BDPA 1UPPA 4ZPBA 5DDPC 4I1TA 3QT5A 1DARA 2HHVA 3ITHB 4RUAA 1UFWA 2ABYA 4U95A 2A10A 4DL0C 3FK4A 1W25A 3NL0A 4DUYJ 4DL2A 2WVFA 1VQ8S 2ZE2A 2ZHOA 1N34F 1KVJA 1FVSA 3P45B 4YR2A 2DHGA 5F8NA 2M0GB 5LOQA 2KT3A 1U4BA 1C1BA 1TKZA 4YMEA 4NEZA 3ELHA 1MMLA 1CEZA 3LAKA 2LVWA 3LANA 3W63A 1ZZNA 2M70A 3LP0B 2GO8A 5ETOA 4FXWA 2B43A 3M8QA 2PDAA 1UWBA 2QTWA 2B8QA 4MK8A 2G0JA 1UKUA 3NNHA 3HHEA 2V5HG 3LAMA 3VF0B 3VWSA 4G65A 4C8KA 4I6YA 1Y7PA 3BO4A 1YJNS 2HVEA 1RI7A 1K47A 2JEIA 2I1RA 1NZAA 3ILOA 2F5GA 2VG5A 5GAEU 2KVIA 2BUNA 1H38A 4DL5A 2HHUA 3C6TB 1R0CB 3MD3A 4ZLJA 5KFRA 2RVJA 4F26A 2XZTB 5AJ3J 1U1PA 1YRXA 2VQEF 4LFBF 3GR1A 4DS5A 3QFWA 4LFAF 2JDJA 4DV4J 3T1HF 1F5CA 3EZUA 4NYPA 1JK9B 5KFWA 3CPWR 4NI2A 4KIAA 1VHFA 3HHLC 2AU0A 3POTB 2HIYA 1KEKA 5RUBA 4F04B 1VJWA 4RX6A 3G8TA 3M9OB 3QGHA 2R7QA 3FCWA 3IR5B 1I5OB 4WFYA 4FS1A 3PW5A 5LMNF 2I0XA 2R7TA 1LW0B 3TO8A 3PIPQ 3K5NA 2M9KA 1Z1ZA 2LYVA 3D0GE 2CQDA 3C66A 3KJNB 3N6NA 1TMMA 4P2MA 2RUSA 3UI3A 5D6GA 1IWAA 4QWCA 3MFIA 4B3SF 1XK8A 1TK0A 4ZA1A 1FTCA 2VASA 4RW6B 2J0SD 3NCQA 4DUZJ 2CRLA 4USKA 2L9NA 4NCAA 2M8DB 3I0SA 1RADB 1P1LA 1GK8A 4L73A 4GO5X 3Q8VA 2YWWA 3VZIA 4J9NA 4JI0F 3SBMA 1RTJA 3IRXA 1WOPA 3QZ8A 4B9NA 4KHPJ 3PY8A 3EZOA 3JTNA 2VD3A 2CA9A 3UDLA 2HAFA 4MKVA 4DPOA 3OVAA 4F2RA 2Y1IA 3IS9B 3V4MA 4LF5J 2A18A 2MPUA 2NYIA 5DLGA 1OQ3A 1SC6A 1MWQA 4O3OA 1RT2B 1Q86T 2OHDA 2C2ZB 4YB7A 1ZPVA 1TL1A 4IR9A 3MR6A 4ZN3A 1CJUB 1QUPA 1I94J 5E3AA 3UR0A 2Y0SD 1RTHA 2R8KA 5HMZA 1T11A 5IFMA 4E0DA 3QLHA 4X4OA 1OO0B 2AZ1A 2M5YA 1KFDA 4DOZA 1NHUA 1DTQA 2KDOA 1UZHA 4IFYB 2V67A 4PG5A 2DITA 3CJ4A 3BSAA 3BH7B 3J7YI 3BREA 4M63A 2D3O1 4MIAA 4EBCA 2A2CA 4K59A 2B9EA 1JXEA 2YNGA 1HNXF 2DXEA 1DY3A 4JI2J 2ZZNA 1Q81T 1NK8A 4WFBQ 5F8IA 1Q5YA 4P2FA 1KOOA 1WWHA 4FF1A 3OVSA 2R2RA 4W90B 3B6BA 2YQ1A 1RP5A 1CQMA 1TVRB 5T14A 2HS3A 4MKYA 4NLYA 4DSKA 3KK3B 4DU7A 4F4XA 2B6AA 3IO1A 1S12A 1FJEB 2GMLA 4M5IA 1EZZB 4YB5A 1Q7LB 3W62A 3SYZA 3QWPA 5HVGA 4EBDA 4ZP7A 4DR2F 5KFXA 2CIMA 2E7VA 2J0WA 2W9CA 4AYBD 2HLTA 1WHYA 2IIHA 4KH0B 3OL8A 1SCJB 1FKPA 2FGCA 1PAUB 3BYPA 1LK7A 2FVCA 2AJFE 4UQTA 3LQVA 1KQGB 3TUZC 4HACA 4AFFA 4DL7A 4ZCMA 4R5PB 2HFNA 2HRYA 4UQGA 1NBEB 1RT7A 4PQAA 1FRIA 1HNVA 2RRNA 4J9MA 3TJAA 1RBLA 2BBEA 5KOWA 2B8PA 2GIQA 5D8HB 1DQAA 4ELUA 1F9FA 2DCUB 2A1BA 3O5TB 1TUGB 5KFSA 4U96A 2XTJP 1HI0P 3NGRA 3PHEA 4X65J 4ES3A 2OFGX 4Y28C 4JYAF 1LWCA 4A47A 4L72B 1R8PA 2CJKA 3DOMA 2AGQA 2UVVA 2D9OA 2B5JA 2GQ2A 3GIIA 1U1MA 2BJDA 3IWXA 3DGVA 3W2WB 4P9SA 2B9YA 4O3QA 1BY9A 5IV4A 3PFOA 5L8RC 1TFWA 4W4MA 1PGZA 4NASA 4NLWA 3W61A 4C8LA 3MEGA 4FYXB 4EEYA 3HP6A 1TQLA 5IS2A 1SXLA 3MAAA 2WRMA 2AIRB 1FK9B 4LSZB 2GFFA 2F4VF 1NKCA 3GFYA 4IYQA 3G9CA 3NMAA 5A8KA 3E2EA 2UUBJ 1FDDA 2J9DE 3OUYA 2RHQB 3TA2A 3KDNA 2V0NA 4KO0A 1EAYC 3VGTA 3K5PA 5CD4A 2HHXA 3AXKA 4B3RJ 3DKDA 3DMJA 5E5NA 5L1KA 4PQUB 1IBMF 1RYRA 1HBMB 2XZDB 1TK8A 4M5MA 1OYEA 2XULA 2DVIA 3CSKA 1VHIA 2KH9A 2KJWA 4ICLB 3JS9A 2UU9F 4UY8T 2YQ0A 3L95X 4P2XA 2XC9A 1O51A 1WOOA 2Y1RI 1VQSA 2HVDA 4OZ2A 3ET6A 5DGBA 2FVRA 2RQMA 4HLBA 1KQKA 2UXCF 4LFCF 2ZBRA 3TAMB 2VFSA 4UUWA 5DGAA 1XMQF 3NY0A 5GAHU 1K1QA 2X1BA 3DU5A 2ZVIA 5IWAJ 2V4QA 3W9IA 3F56A 4LT6A 2G0CA 1NK4A 4ZVQB 3V6KA 5K8PA 2OO4A 4CH7A 4JOUA 3RAMA 1X0FA 3SEOA 1EKSA 2FVQA 1Q95G 1FFSB 5CCMA 2IA0A 3J7AN 5G0RA 2Z8QA 3DRSA 2BKNA 1FI4A 3HX9A 3EDRB 1DURA 3SXLA 3EPGA 4G6VB 3WX4A 2QSFA 3V2UC 1U2CA 3A13A 5CYQB 2DR6A 2IM2A 4IFVB 2GNKA 3DU6A 5I3UB 1YJRA 3MM5B 1CS4A 1BHNA 5CZVA 4BS2A 2MGZB 3TA1A 3M2UB 1S6UA 2RDJA 1DTTA 4DF4A 5KFPA 3OVBA 3KLFB 5CYMA 3VQSA 1OY6A 4IQXA 2GVDA 4X4SA 5C42A 4JI7F 1TL7B 1YSJA 3BN7A 3D28A 2FYXA 2A2DA 4EMDA 2VOPA 1Y5NB 3UD3P 1U45A 1NZ8A 4GVBB 3FMWA 3OQ2A 3KJVB 2Y1LB 3VALA 4AQYF 3M1VA 1QAYA 1WNEA 5CQGA 2IFXA 1SVDA 4O44B 1PYOB 4C11A 1U1OA 3QQCD 1RT5A 3DLKA 4OYMA 5D15A 3DLEB 3M32A 3NG8A 4LIWA 3MM6A 4B3MF 1Q78A 3CJ3A 3EGNA 1HPZB 2O1PA 2GO9A 2W9BB 4B3TF 2QMUB 4NA2A 2UV8A 3P5BP 4CLFA 1N36F 3TJ9A 2OSRA 2XYPB 1UEVA 1J5OA 1KQSR 1PILA 5HK4A 4RJVA 3MPYA 4C6AA 4JP8A 2HGMA 2V9KA 2CPFA 2LXUA 4LSNA 4WFZA 1YJ9S 3IP0A 4JI1J 2HQGA 5IM0A 2OEMA 4RW7A 1RLCL 1FKAF 3DN9A 2XYGB 2ZBPA 1ZH5A 4Z2XA 2E5LF 3R27A 4DI6A 5B0BA 4NRTA 2BV3A 4JV2A 3GJRB 3QAUA 3HHDA 2W7OA 1GAOA 3ZZOA 1YWXA 2ZH2A 2OUGA 4UUXA 4JV1A 4Y6IA 2OIHA 4O4GB 2IMOA 1N33F 4CWBA 1YJ7A 7AT1B 1EKRA 2RS8A 3NCRA 2VV5A 2LU2A 1X9MA 2B4UA 3T41A 1QJHA 2H48B 3TWZA 4FPIA 2C2NA 5GMEA 3HO1A 2HBRB 1M90T 4ILMA 4LR9A 2PFFB 2DNYA 1WEZA 3TARA 2VPZB 3GJSB 3D3BJ 1SKUB 1VBKA 2L9DA 2HZCA 4KGKA 3MXHP 3FGVA 5KFFA 4CLZA 1QM9A 4MYTA 2RU3A 3H42A 4ZP8A 1RT4B 1Z2ZA 4HI2A 2V50A 4PWUA 3I5AA 1U8SA 4L3NA 3U02A 4TLRA 4NLOA 2DO4A 4TQSA 2BJ9A 1N32F 3CJKA 4WBFA 3WX8A 1GEHA 3EZ5A 2RH3A 4Q0BB 3C16A 5CAAA 2WVBA 1RHMB 1VLOA 3NAIA 7FD1A 1H0HB 4MH8A 3UW1A 1A0OB 3MECB 3T6BA 2IAJB 3B4MA 4LF5F 4RW4B 4LF4J 2ADBA 1FRLA 4ZKAA 3DLJA 1JIHA 3Q22A 3T9ZA 2BABA 2I38A 2MDAA 1RCOB 2HGLA 2XBPA 3DRRB 3CJ0A 2VG6A 4EO8A 1ICEB 2MHNA 4ZK7M 2HRUA 1SJQA 4E2FB 5AT1B 3D1QA 4I2PA 1M5HA 3ITHA 1D8YA 1HFEL 1F5AA 3FMBA 4LVNP 3ENQA 4I7FB 3VZHA 3PRVA 3K8VA 2E1AA 3DOKB 4P7TA 4ZS6A 1UW9A 4OZLA 4YP3A 3BH6B 1SQEA 2KFZA 3ADAC 4X64J 1NO8A 4CLWA 4OYIA 3CJTA 4RBVA 2CQ3A 1NH7A 2FGOA 2VFUA 4OX8A 4CNYA 3G6ES 4IOCQ 4X66J 4DMZA 2DR7A 2JLGA 1K44A 4JI2F 4F3QA 3D7SB 5C24A 4W98A 4B9UA 4JI8J 1TKXA 1LW2A 1XTZA 3HHLB 1U6FA 1U1QA 2L48A 2QRRA 2ROGA 2HFSA 1NUEA 1VRUB 3VTIA 2MEWA 4ZP9A 4XK8C 1FX4A 1NK7A 4MJKA 2DXFA 1KN6A 4B3OB 2K2PA 2LLZA 3DLBA 4BLGA 4ERDA 2HBYB 3W64A 4UZCA 1JNZB 3AJDA 4KSEB 4B9VA 1F0XA 5CYJA 1UVIA 3AODA 2AGOA 2CJXB 1PBUA 1WF0A 4FPRA 1FRJA 6FD1A 3KG1A 2W2QP 4OZJA 2HHHJ 1AW0A 4XTTA 2HWTA 1QE1A 3POTA 4OFZA 5B08A 3QO9B 3FBBA 1X5PA 4LF9F 5D0RA 3DGPB 3QWUA 3B54A 2LQJA 1M5OC 3K58A 4J9VA 4IG3B 3I55S 4QYRA 1LW0A 1RGVA 1T9UA 5F8HA 1X9WA 4TU9A 4Y0FA 3CUNA 1IWGA 3UN3A 2AEFA 1DFDA 1S9GA 2SXLA 2P8IA 5IC6B 2GJFA 2VFTA 5ETPA 1B99A 4OZ1A 2F8MA 2DD8S 4RW6A 2APOA 1KHWA 3PEHA 5ETVA 1JXLA 4YY3J 4RU2A 3L4BC 2NZ4A 3SDEB 5CHCB 5LJ3Y 1IQZA 2E1CA 2B7BB 2JOQA 4B9LA 4R0EA 3HK2A 4IH5A 3EM1A 1VMBA 2WBMA 1NSPA 2UUWA 1Q8BA 5B0GA 3SCKE 2YKMB 4K0KJ 1HNWJ 3MAQA 2OPPB 3H59A 4CLYA 4ZITA 5E2QA 5CA5A 1PC5A 1NRKA 2R8IA 2O3DA 1U1NA 5J1NA 2OEKA 4GKKF 1R31A 5HVFA 1KSPA 3IS9A 5LXYA 5K9FA 3EE3A 3EX7B 1IBKF 3M6XA 2ZVSA 4KRWA 4DCPB 1RT2A 1WG4A 2HS4A 2J5AA 1N0VC 2PIIA 4F50A 3OR2B 3UWTA 3IWNC 2NZCA 1UVJA 3TZZA 2MXYA 2ASYA 1CJUA 1FRMA 5ETMA 2RNEA 4NOHA 1HWUA 4W92B 4LF2A 1HWJA 2WOMA 1OQ6A 2OELA 2DGVA 5I3PA 2DNMA 1Y9OA 2CQBA 2EBEA 1RTIB 4DV6J 2OP5A 5FDLA 1S9EB 3W8PA 4ZN1A 6FDRA 4IFYA 3VQTA 3AD9C 2J0QD 2IVMA 4I67A 2MSSA 4XO0A 4OI1A 1SL1A 1EETA 4A8MP 4CT8A 2VH7A 1P6TA 3VR1A 4NL5A 3TX0A 2FJBB 2A3JA 1JNRB 1RLDA 5KFIA 3BPDA 1VK8A 1W2IA 2VFVA 1NPRA 2KKHA 5DS7A 3CCQS 1U24A 1T94A 1R0BG 3LH2S 3KK3A 3MMBA 4URQU 2P9EA 1K9MT 1CJKB 3ZZPA 3ZTSA 5CCLA 3K7RA 2P5VA 3G82A 4ATNA 3JSBA 2NSBA 3G8QA 5D77A 3V81B 3R7SB 4FZVA 3UCZP 2K7KA 3JXOA 2MKKA 1MMNA 3J7ZT 4X62J 4YOEA 1QAJA 4NPOA 5HVHA 2V8HA 2H3EB 4DPXA 1NK5A 4P71A 2ZC4A 2OPSB 3M8PB 3JSYA 3SSSA 3CJQA 5KFQA 4C7QA 1UTAA 5DZ6A 2HIQA 1YKWA 1WORA 4HI1A 2BANB 4DQQA 1CC8A 4IOAQ 4OYOA 2ZM6F 1UVNA 3CC2S 2ZD1B 4NLVA 2M8HA 1YITS 1Q7YT 3CC4S 2YX1A 2VF3A 1GMWD 4AD6A 1FNMA 4RZRA 4WTYA 2DXDA 3MR3A 4ZLNA 4EYIB 2PMHA 4JUZA 3FSIA 2IJFA 3H2VE 4PPDA 3FFIB 4NZ0A 2AZ3A 2Z56B 1HHQA 1HD0A 2J7UA 4O23A 1C1CB 2HW3A 3V4IA 4IDKA 2ADCA 3D1HA 3F0NA 4LBPA 2LU1A 1Y3JA 3W2WA 3SZ2A 2BE7D 1E6YA 1KLMB 1XBWA 1L5UA 1RAEB 2E7XA 4A48A 4WE1B 2ZZMA 3JB9k 2FHMA 1LFPA 4DR7F 1XR5A 1NAQA 4XPCA 3UE2A 3A8IA 1IBCB 5B0EA 2AWZA 3MOZA 2MJNA 1T05A 3MOJB 2XI3A 3M2VA 3GMGA 4CNZA 3R3TA 2FD2A 4DR1F 1LXJA 1VFJA 5GADI 2Y0BB 2W4DA 4NMLA 2V8DA 2YKNB 1AA1B 4NA1A 1IM4A 1HBMA 1TFYA 2A6MA 1T9XA 1KP6A 3KK2A 4Q8EA 2H4WB 5IC4B 3QGPA 2HMIA 4WFNQ 1FDNA 3CEDA 2DH8A 4QW9A 4LRBA 1RU1A 1UZDA 3QGGA 4RWXA 2JL9A 3HULA 3LALA 1LWXA 2PD1A 2GS8A 3C15A 5D0EA 2MQNA 3TAMA 2NSCA 1YK9A 3H4DA 3PRBA 1IKXB 3K5LA 4UY85 3AA8A 3FKBA 3TW0A 1TL4A 3AXMA 3GWCA 2RILA 4C3LA 1CSJA 1AYEA 3GV5B 3VGVA 3KK1B 2ZZTA 3MCOA 1V3RA 3PV8A 2QLBB 3M4XA 2AQ4A 2N7YA 2XI2A 2OD6A 2VBXA 1YLXA 4C3KA 4QR1A 1CG2A 1N54B 4IO9Q 2HLUA 3ENAA 3HI9A 2G9OA 3BBFA 1WI6A 4DL6A 4WF9Q 1RT3A 1RWVB 3IWLA 1JJHA 1HNZJ 4V19X 3OHBA 3MCMA 3M8QB 1UWBB 3MMAA 3H40A 2UVUA 2GJIA 4C8ZA 3Q89A 1VDHA 4NLRA 1OPZA 4DSEA 2PT0A 4IFVA 3CCES 3TEGA 1PO6A 3U7JA 2MGZA 2Q6CA 1VI7A 2XSJB 3OTEA 3M2UA 1C0UB 2KZMA 1GNKA 2Y1JA 4N47A 3KLFA 1J27A 2LXFA 3HPOA 2HQCA 4NZ7A 2E66A 3M05A 3SV4A 2G13A 2V2ZA 5EHHA 2Q3PA 4WP3A 2CVEA 4HTJA 1TL7A 3CNQP 5J2MB 1RDRA 2F8EX 3TAQA 5F8LA 3K0JA 4ZVRB 2MY8A 4GVBA 4DLEA 3MZIA 4FNIA 2FHJA 3VAGA 3HHLD 2CJQA 4ED1A 2IC3B 5F9NA 1IR2A 3HSJA 1WG5A 4O44A 1IBLF 4B08A 2EXUA 2QX0A 5FLXY 2ACMA 2UUCF 3R5BA 1T7PA 3CW2C 1GTEA 2C28A 2DHXA 2H9ZA 2HG4A 2WVCA 3HSDA 2GHWA 3DRXA 1GMWA 1ZETA 4JI8F 2Z2YB 3W5YA 2U2FA 4BCAA 2W9BA 2R9LA 2AD9A 1BMQB 2BYCA 4HL9A 3GE9A 1FXLA 5HI7A 1LOUA 3T5KA 1U6BA 2RKIB 4K4ZA 4NXNJ 3N6LA 1HD1A 4G1QA 4ECVA 2N7CA 1AXQA 2V8GA 3UCUP 2VG7A 2E9TA 1XNQJ 1EARA 4I56A 4HHHA 1ZTWA 5DLFA 5KFVA 1RSCA 3ZTOA 3I0SB 4Q2MA 4LMZA 3L09A 3ZZZA 1HI1A 1S1XB 1NK9A 4AL7A 3CB4A 3OFFA 1GMVA 2Y3YA 3OL7A 1QSYA 1FRXA 4QYZK 3V6DB 4L74A 3TX8A 5GAEI 4O4GA 3NGSA 1H2VZ 3TZWA 2V34A 1NNDA 3VGUA 4UF4A 1M5KC 1YBUA 1GMUA 4DV1J 5THWA 4USIA 3IRWP 5KG5A 1BC6A 4CDIA 1C0TA 5D0GA 2XMTA 2I9SA 2VONA 2VA3A 3I0RA 1FXRA 3OFHA 2EFOA 2DEJA 3UCGA 4C9DA 1ZM9A 3GLJA 4WU2A 1TL1B 3MR5A 3N28A 1X4HA 2RSQA 3MWBA 1FJCA 1C4AA 2IYGA 1N6QA 2EBGA 3Q83A 4KB7A 5L1IA 2AYEA 4TY9A 3CTRA 5AXKA 3WDOA 1Q82T 3BF4A 2K7JA 4FYVB 1VGYA 1RT4A 1Z4UA 1TL3B 1X7VA 1ZA2B 3O8WA 4UOHA 3I31A 1DTQB 3AOBA 1N34J 3Q8UA 2KXFA 1S7IA 2YNIA 1VC6A 3EDQB 1HNWF 1I51B 1VBXA 2M7SA 4URGA 3Q86A 5IT9Y 3PFEA 1U26A 3CMAS 2CQ4A 2VIHA 2IBOA 3G4SS 4MAKA 1RXOB 1GXLA 3LOUA 2PO4A 2E5GA 3EJMA 3R5GA 3OJSA 3MECA 1RTDA 3PZPA 5KG2A 4R0JA 4RW4A 1GX6A 3S1TA 4ZJQA 1AROP 2AP6A 5JUMA 2KJVA 3A8JA 4XDDA 4OYZA 2RE1A 2V94A 1JB0C 4OHVA 3CMQA 1U25A 2B6AB 1HW9A 6AT1B 1S1TA 4IG0A 4CQ1A 4DV3F 4KAIA 3M9MB 3H5UA 2B9XA 2V8PA 4EUVA 5J2NA 1TTHB 4UOCA 4IQMA 2P2CB 4I7FA 2VQEJ 3SFGA 4LFBJ 2QL5B 3DOKA 4LFAJ 3VHQA 2W9CB 2GW8A 4ED5A 5HANA 2ZOMA 3T1HJ 5FJ4A 1FRHA 2B7CB 1RAIB 2VPWB 4JI6F 2AT1B 5D78A 1FEEA 1VQYA 1FKPB 1YVFA 3MEKA 3K5MA 4K4TA 3NOGA 4HACB 2OMLA 3D0HE 5HMWA 4Z37A 2JNJA 5KG0A 3CJRA 1HNVB 3RR8A 7FDRA 1FWKA 1F5BA 2C3MA 5JMNA 1X4DA 4CO0A 1P27B 2EC2A 3DXBA 3KLEA 3BGUA 5LMNJ 2WCXA 2WVEA 4Q2LA 2JC0A 4OJ1A 3ZNUA 4CP5A 1ZZFA 4RW8A 1VRUA 1SI9A 4EI2A 1HWLA 3K57A 4CH1A 3PW7A 2E29A 1H6KX 4OL8A 3DOMB 3T5JA 3EVWA 2WHOA 3CE8A 2B5JB 4B3OA 3AB2B 2ZBCA 2DPJA 4B3SJ 4ZJOA 2RUGA 3M8ZA 2HHSA 4UW2A 5EWFA 5JVHQ 4M95A 4J9LA 3OFGA 2FJAB 2V2QA 2L3MA 5EGYA 3QSYB 3MEGB 2RRAA 5E33A 4NCBA 2Q6BA 3DI6A 1SC4B 3MAAB 2XS2A 2DNZA 2DO0A 4JI0J 3QO9A 2MQ8A 5J2QA 2F4FA 5A8KB 2ZH7A 4ZLPA 1LXNA 1Y5IB 5F41A 5T41A 3VGSA 3BKUA 3RRKA 1SIWB 4LQ3A 2W4PA 3RU0A 4KO0B 4F25A 2NUUG 3IMQJ 3B8HA 1TKDA 4G1PA 2VB6A 3CD5A 3DCAA 2ROPA 3HMJG 4DV2F 4C0OC 4P2SA 4AUKA 5F9LA 5A0YB 5JVGQ 1S9FA 1SV5A 4DQRA 2LEBA 3CDEA 4ZVPB 3R2DJ 5LMUF 3HDSA 2X1AA 3W7BA 2KT5A 2DY1A 3ET6B 3GP9A 4EGLA 3TUPA 4O0IA 3H5YA 1BQMA 4OYAA 5DM6Q 2W7PA 1VC0A 4OJ3A 3MM7B 3J7YU 1NDCA 1T03B 1TK5A 4DX6A 3BGFA 1RACB 2FJEB 3H20A 4K2XA 3M7VA 2DK2A 1FKOA 5LSOA 2GV1A 2R42A 3LP1B 2DISA 1RAJA 4PAAA 3KMQA 3ISZA 4ECSA 1HNXJ 4OZ3A 1WHVA 4ECQA 2MJUA 3UVJB 5HROB 3OXLA 1RISA 4LR7A 3AY0A 4DU8A 3C3LA 3HVWA 4EU0A 3BN4A 2H54B 4Q7AA 2B4OA 1L3KA 2ZWOA 1WEYA 1IR1A 3FRYA 3OR2A 1PCAA 2V69A 2XEXA 1FFGB 1HMVB 1V5IB 3D4JA 2QFIA 3Q8SB 3OTOF 5DG9A 4CTAA 5H9FK 2ALZA 1WTBA 1B3TA 3QIPA 4LBIA 4KGMA 3MMJA 3P3DA 4K7QA 3AQOA 2QMWA 1FTRA 3UDEA 1CS4B 5HQMA 4FF4A 3N0VA 3UN2A 3MDFA 4B17A 3M6VA 4DUTA 1RT6A 1S9EA 4YS2A 1DTTB 4K4XA 4ZLLA 4CIOA 4FDFA 3TP2A 2CNNB 2M88A 1SKWA 4TKTA 5C42B 4M5KA 2KXNB 4ZVUB 2VHGA 1OPIA 3BQ1A 4A8FA 4KE5A 2DR5A 2LDIA 2RQKA 5C2GA 1F60B 4YHHF 5DDRC 3QRRA 3M1VB 1PYTA 2G0IA 8AT1B 1K73T 3CIZA 4C11B 2KRBA 2Z0GA 4LBHA 4JYAJ 2RJZA 1UPMB 3KJQB 4N8NA 3OD2A 1ZM2A 4DPTA 4BWMA 3W65A 3HJFA 3MM6B 2HPUA 2CQHA 4K4WA 5D4PA 5KG1A 4FBTA 3WC0A 4PRFA 3KNGA 1UFKA 1J5OB 1S0MA 3I5BA 3J7Z5 4ZPVR 4GKJF 3PR5B 3H0PA 2BRLA 1C4CA 4FN5A 3HSZA 2F4VJ 1YDLA 4LSNB 4OZ0A 2XZWA 3UD4P 2R7XA 1Y3KA 3FNNA 3BZQA 3EWGA 4X4PA 2BKPA 4ETXA 2DR9A 1CBKA 3PO5A 1IKWB 2DNGA 3OTDA 2GVZA 3PEJA 4M1KA 2YKOA 3FFIA 1MLAA 2FVPA 5CZXA 2XY6A 2FJVA 3BO2A 1S59A 1IBMJ 3P4UB 4ECUA 4LRCA 1WKJA 1C1CA 4ECYA 4LRFA 4USUA 2Z30B 1CPZA 2MQPA 3M6UA 3R8YA 4IH6A 3RG6A 1P9QC 2L9WA 2UU9J 5E0OA 2LA4A 3MFHA 4RNNA 3W3SA 2VQFF 3UPFA 2UXCJ 3BEGB 1NLKL 1KS2A 5KFLA 4MFBB 1ZAWA 1UJ4A 5L1LA 1XMQJ 2DEIA 3J80Y 4FVMA 2HK3A 1X8DA 3BQ0A 2BQRA 4IUFA 1N5VA 4OV6A 2RD5C 1KFSA 3HFZB 3DHWC 5KFNA 2MQQA 2H4YB 1S0NA 1FO1A 4KHMA 3LUYA 4WPAA 5T7LA 3I96A 3MURP 1LWFA 3E01A 1B4SA 2UZAA 1WKLA 2FHKA 3OR1B 3CJKB 3U1LA 4H4OB 4JV0A 5A6PA 3HKZD 1XC9A 3KG4A 2F1FA 3C16B 4DX8H 4DLGA 4ZCIA 4JV5F 4ZHRB 2JFKA 2MZTA 2GC8A 1WC0A 2C3PA 1KVKA 2RIJA 4JI3F 4RWWA 4IR1A 4OMFG 5KFTA 2ZH9A 2VC0A 5KOXA 4OLOA 2I2YA 4WWSA 1RU2A 4Y2IA 2OKQA 1CULA 5GVQA 2J9EA 2CNKB 4IH7A 2DGSA 1IKXA 3DLGB 2LXIA 3KKFA 5E3RA 4J9UE 1OJ4A 5DO2A 4QU7A 2DNOA 2M52A 4JI7J 2RB7A 4OHYA 2I5JA 4I2PB 3QAEA 1KTQA 2W7AA 2XMWA 4QCLA 3THPA 1R0AA 3MUMP 1S1VB 3BSOA 1KBRA 2XMMA 4CZCA 4LF8F 2PE8A 2WONA 4RNMA 1V3ZA 2KM8C 3ICLA 3ISNC 4AQYJ 3H98A 3OBIA 4MKBA 2BVZA 2KL8A 5KFUA 3DLHA 4QJVA 2A6OA 1HBOB 2HHQA 4HT7A 4K5SA 2WK4A 1SH3A 5I42B 1JLFB 4RNFA 2VL1A 4V19J 5C24B 1TAUA 4LF7F 1VRTB 1Y4ZB 4QPXA 4TQRA 2R7UA 1TKXB 4KT0C 4B3MJ 1LW2B 1ELOA 2XSJA 3MTJA 1C0UA 4Z7CA 4USVA 1E6VB 1Q8LA 4B3TJ 1MU2B 4CLKA 2ATLA 4AE5A 4C8YA 2VPXB 2CZ9A 1N36J 4O3PA 3NGDA 4PUOB 1PSDA 1S97A 3Q2TC 5BR8F 5J2MA 3AOCA 3IFEA 1FEHA 2LA6A 3RB3A 3QT8A 4PEOA 3BSNA 1YIJS 2K3IA 2J0XA 4PG4A 2JVRA 2ROEA 2ILYA 5HJXA 4OHXA 4PG8A 1S0OA 2E5LJ 2IC3A 1NXIA 2V2VA 5D3GA 4I6WA 2DGTA 4DPWA 2ZNYA 1X60A 2XMVA 3HXMA 1QE1B 2ZHBA 2H51B 2XLJA 4O3RA 3QPIA 3F73A 1N33J 5J2PB 4NYOA 3T3FA 3IAS9 2MZSA 1HHSA 2NXUA 4DQSA 3SV3A 2KHDA 3QGIA 2XO6A 2P9CA 2XY7A 1S9GB 5IQQA 3FDSA 2GMJA 2RKIA 3V5RA 2MLZA 2YQ3A 3VAHA 1R8HA 2HNYA 2MZRA 1FVQA 1U7LA 2CDRB 3KLIB 2W1BA 1DQ8A 5DJBA 4HR2A 2OJ3A 2IBKA 3I9V9 3W5XA 4NMXA 2ILZA 5HQLA 4RBUA 1UVMA 4C8MA 2J6UA 1S1XA 4KGZB 1F3VA 2PSZA 2QA1A 3PDNA 1T9WA 1CJTB 1HWKA 4ZPTR 2EEYA 2YNHB 3E51A 1SC3B 1N32J 1U47A 3TOQA 2BE2B 3V6DA 2E1PA 5K5MA 3U27A 3WIVA 4ZCLA 4ECZA 2BE9B 5KT7A 2C22A 2EVZA 4R8UA 2X7IA 3HVTA 3KDOA 2J6TA 1IM6A 1URNA 2CQ1A 1N48A 4C0HA 2XS7A 3T1AA 5KAKA 2B51A 3VAFA 1OY8A 2R8JA 2B0GA 2CQPA 2WAQD 2BXJA 4ELTA 4DEZA 3AJ1A 3RW6A 3FRZA 4XDCA 4RLEA 2F9DA 4NX9A 5B0AA 4IKAA 2KYZA 1WTFA 3JSRA 3T19A 1U02A 4ER8A 3TAPA 4A8KA 1KR4A 4NLXA 2MQLA 2WOMB 1JLCB 2AMCB 1TL3A 1RWKB 1QVGR 2E9ZA 2VZ9A 1FJGF 1X4FA 1RYSA 5FDLB 5AE2A 1QD1A 1Q79A 4K4UA 1U0HA 1NHVA 3D3CJ 5C25B 4DFKA 1B7YB 3DC2A 3RTVA 4WYLA 4WZQA 1QAXA 4ED6A 2XG8A 4MTPA 3UNYA 2DRDA 2UXDF 1EETB 1RAHB 4JI5F 4ZOSA 1NSAA 1RKIA 1U49A 2BW2A 4QWEA 1RB0A 1XMBA 1SPBP 4PWWA 3SQGA 2V4JA 2JEGA 4CLTA 3CJ8A 3RBZA 3SI8A 1VR6A 3Q8QB 1R43A 1R8BA 4RW9A 2UUAF 4X2BA 3ONQA 2D3OR 1HR0F 2XNQA 3KFWX 4M5DA 3BGLA 4CLLA 2E5JA 3JAMY 1S6QA 2J9CA 3MMBB 2DT9A 1FERA 3G82B 2N4DA 3IA0A 2C42A 3R1LA 3ILIA 1UEUA 2W01A 3CCWA 3CDBA 4DFJA 1EX8A 1U8WA 2ZHAA 1T95A 4DL3A 3M30A 3NS6A 2CJ9A 4IRKA 2HFVA 3A8EA 5A8RB 5FD1A 1SC1B 2QYGA 2CUYA 2QG9B 4IOBA 2W9AA 2AW0A 4K8RA 5SUHA 3W5ZA 3GJQB 3H5SA 2C2OB 4LF9J 2C3UA 3MUVP 2DBBA 1HIYA 2AV5A 3FC9A 1EIYB 2XSFA 3PX0A 1WUUA 2HHPA 4DSIA 2W4CA 3D67A 4OI4A 2VICA 2W8KA 4USJC 3QYYA 4JI4F 3O3LA 3CCMS 2CQCA 4RUCA 3HSGA 5H9FJ 3K89A 4YB6A 4ZIWA 3F44A 1X5SA 3SSRA 3VCDA 1TZ0A 4IO1A 1FESA 3V4IB 4IDKB 4XPEA 1IQTA 2CG8A 5EWGA 4AXIA 2CFXA 3U1NA 4OZ5A 4CO1A 3EGZA 1E6YB 2CNOB 3T1YF 3OT9A 5D4NA 2MMYA 3Q23A 3UD5A 1B70B 4K4VA 3PJ9A 2N82B 2AJ0A 3JQKA 2R4FA 4B9TA 4ED4A 3CCVS 1L3VA 4J9OA 2A0FB 4Y65A 1F6TA 4DPYA 4PPZA 3W8GA 4HVZA 5EDWA 1U2FA 3N79A 3RRHA 2VU5A 2D7SA 5KFDA 2EKYA 3PW0A 1UA0A 3TQ1A 4ZVGA 3R7NB 5JXSA 5D4OA 3L7PA 4FXDA 4NLGA 3ZZTA 5A2QY 1T05B 3M2VB 5H9EJ 4F67A 4GKKJ 1SJ1A 4Q5VA 3PKMA 1D09B 4CO2A 2HYIB 1IBKJ 1R8CA 2C2MB 1SQFA 1EP4A 4Z7YA 5A0YA 4DCJB 3JTOA 3KK2B 2YY3A 2HMIB 1RHUB 1JXVA 1NDLA 2YKAA 2K06A 4O4RA 2Q1LA 2LQBA 4ZVOB 2DH9A 3JQMA 4RR5A 2ZKUA 1FE4A 5EWEA 5KFAA 2VKZG 3C15B 1KC8T 2E7WA 3MM7A 4GO7X 3FEZA 1T03A 1SJFA 3MTKA 1S4EA 1WSVA 4P7VA 5HN0A 5HATA 1S6PA 1KDNA 2NXJA 1Q0NA 1SUQB 4L76A 1N52B 3LP1A 2NXCA 4NWBA 2IDEA 4QOTA 4QIVA 1V5VA 3KNAA 1RA6A 4QBUA 3UVJA 2YPZA 3K8WA 1PKUA 5HROA 3PYFA 3RRGA 3EVOA 4NXMF 4DQPA 1RT3B 2DPIA 2CPYA 4DJBA 3PXGa 4CCHA 4PZVA 2R7VA 3KHLA 3IGNA 1HMVA 4P74A 4L75A 1AFIA 3G2XA 3MMAB 2MZJA 4HH0A 4LF1A 1N5TA 1FHTA 2HHTA 1VK3A 2RS2A 2YWKA 1NK0A 3D54A 2QIFA 5IQ6A 3KOAA 2MB0B 3P6YC 1ZAXA 2CPEA 3GFZA 4WKRA 1P9YA 3R6GB 1F1BB 2RHSB 2MKJA 1S72S 3CCJS 3KG0A 4G1IA 4K50A 2KTQA 1MSWD 2ZM6J 5IT4A 2UUTA 3QATA 2H5EA 1R8AA 5B7WA 2R7RA 2ZBIA 5DG8A 4DV5F 1FE0A 2RQ4A 1K0VA 4TXSA 2CQGA 3GJTB 2AYBA 3E3XA 5L9XA 4OHZA 1LK5A 1N0UA 2DCLA 2AX1A 1RKJA 3NS7B 1YI2S 1JJCB 4OYWA 1WELA 4F4ZA 4WIQA 2IM3A 5ETSA 3CD0A 2GA7A 1UL3A 1X0PA 1GXTA 1W2BR 5SZTA 3TANA 3BO3A 3BM7A 4FF3A 4GC6A 2FQQB 4ILRA 1B0VA 2X51A 3PRDA 4C8NA 4DWIA 3GYGA 4CI0B 1XEZA 2PI5A 1U0SA 1VCTA 4UT4A 2BJ1A 4H54A 4LRDA 2C2DA 3H5XA 3MGJA 1UW4A 3CDWA 4G1QB 2QLFB 3PIOQ 1YBTA 2OTLS 4AL6A 4DR7J 1IKVA 3UR3C 1W7WA 2VG7B 5KG3A 3CJ5A 1RHJB 1UP1A 3AOAA 3ZNJ1 1F3FA 5GADU 4J9SA 2EFNA 4A8WA 3GSDA
chains in the Genus database with same CATH topology
1BC6A 1KFDA 2XMJA 4WXWA 4DOZA 1NHUA 2HNZB 1RT1A 1TVRA 4TU7A 1DTQA 1FT8A 2NLWA 2XLIA 3M6WA 3FEYB 1C0TA 1IKWA 1HBNA 2KDOA 3MPWA 4AXJA 4IFYB 2XMTA 2I9SA 4PG5A 2DITA 3UDCA 2VONA 3CJ4A 1S1UA 2XLKA 2VA3A 3I0RA 3QJJA 1FXRA 1S0VA 3OFHA 2FY1A 2EFOA 2CPZA 3BSAA 3UCGA 4EZ9A 3CULA 3NAHA 4C9DA 2KZZA 2D41A 1ZM9A 4WU2A 3J7YI 3BREA 4M63A 5U47A 3GIJA 1DZ5A 3HHNB 1TL1B 3MR5A 1NJZA 4MIAA 3N28A 4EBCA 1X4HA 4N5SA 4A8XA 3MPVA 2A2CA 2RSQA 3MWBA 1QLNA 4K59A 1JKHA 4PR6A 1JXEA 1FJCA 2YNGA 4PKDB 1HNXF 1C4AA 4E98A 2IYGA 4OHWA 1IKVB 1N6QA 2EBGA 2ZZNA 4KB7A 1Q81T 3DRYA 5L1IA 1NK8A 2AYEA 4TY9A 4U67Q 3CTRA 5AXKA 3WDOA 5F8IA 4WFBQ 1IJFB 1Q82T 1KOOA 1NJYA 1WWHA 1HW8A 2JX2A 2K7JA 3BF4A 4NLQA 4FF1A 1VGYA 1RT4A 1Z4UA 3OVSA 1TL3B 1X7VA 2R2RA 5AXLA 3TNVA 4W90B 1OWXA 1WF2A 3O8WA 2IRUA 1RP5A 1XNRF 1CQMA 1RT1B 1TVRB 1WEXA 3I31A 5T14A 1CVJA 1DTQB 2HS3A 4ZPCA 4MKYA 4NLYA 1C0TB 5AE1A 2QO3A 4DSKA 4PG7A 1HBNB 2KXFA 3KK3B 4R5PA 4F4XA 4KQZA 2B6AA 3IO1A 2ZITA 2YNIA 1VC6A 1HNWF 4MFBA 4FVCA 1VBXA 1VQ6S 2QLWA 1S1UB 3GB0A 2M7SA 3I0RB 4ZMMA 4URGA 3OSPA 1FJEB 2GMLA 5IT9Y 3PFEA 1U26A 3CMAS 4YB5A 2CQ4A 2IJNA 2EK1A 1Q7LB 1HNIB 3SYZA 3NGKA 1H98A 1G7CB 2IBOA 2OPRA 2ZH5A 3QWPA 2O01C 3G4SS 4ZP7A 4EBDA 2XWXA 3DNCA 3CCUS 1HA1A 4MAKA 3HT3A 4QQBA 1JKHB 3Q2SC 2D3ZA 3IR7B 1GXLA 2DNRA 3LOUA 2PO4A 2E5GA 3OJSA 1SKSA 1RTDA 1O8BA 3MECA 4DR2F 3PZPA 1N6QB 5KG2A 5KFXA 4R0JA 4RW4A 2CIMA 1Q4RA 4ED7A 2BQUA 1GX6A 2HVZA 3S1TA 2J0WA 2E9RX 2W9CA 1AROP 1ZPWX 2AP6A 1X4CA 4J37A 4AYBD 2KJVA 5JUMA 2HLTA 1ZM3A 1WHYA 4XDDA 2RE1A 5H1SV 2V94A 2VC1A 2C3YA 3TR5A 3OL8A 1X5TA 2LECA 1JB0C 2MZQA 2DTJA 1FKPA 2FGCA 3PR4A 3CCSS 1LK7A 2FVCA 2AJFE 4UQTA 3LQVA 3OR1A 4OHVA 4H4OA 1KQGB 3JSMB 2QMXA 3TUZC 2WW8A 4AFFA 1UFLA 4DL7A 4ZCMA 4R5PB 1U25A 1FF2A 3AB4B 2B6AB 1S77D 2HFNA 1HW9A 3Q8PB 4KHRA 2HRYA 2YNIB 4UQGA 4EZ6A 2POKA 3C8YA 1RT7A 4PQAA 1FRIA 2RF2B 2BDPA 1DJ0A 1HNVA 1SJ4P 5HQ8A 4ZHRA 1X4BA 4KFBA 1S1TA 4IG0A 1S49A 2O67A 2RRNA 2XO7A 4J9MA 2IM0A 4CQ1A 4DV3F 2FPHX 2BBEA 4KAIA 2OPRB 3H5UA 2JFDA 3M9MB 3CC7S 2B9XA 2KYXA 4LSLA 5KOWA 2GIQA 4EUVA 5D8HB 5J2NA 1DQAA 4UOCA 1F9FA 4ELUA 1VOMA 2DCUB 4IQMA 3VAIA 4I7FA 4CT9A 2A1BA 1RTDB 3O5TB 4ECTA 1S10A 3SFGA 1KD1T 4I0WA 5KFSA 1ZOTA 2NR0A 3DOKA 3FZBA 3CDAA 2W9CB 2GW8A 2YTCA 3IN5A 1FK9A 2KM8B 1HI0P 4ED5A 1BWEA 1M1KT 5F3TA 2ZOMA 5FJ4A 1VLYA 4HYKA 4Y2AA 1QSSA 1FRHA 2EI5A 3PHEA 4ES3A 2ACYA 2OFGX 2B7CB 4JI6F 2VPWB 4FXVA 4F8RA 2GQCA 4Y28C 5D78A 1FEEA 1VQYA 1IKYB 1QSLA 2HAIA 3DLGA 4QZVB 4JYAF 1FKPB 1LWCA 4A47A 1YVFA 2KO1A 4L72B 1R8PA 2CJKA 2DRAA 3DOMA 2EFGA 3MEKA 3K5MA 4K4TA 2AGQA 4JI1F 4FS2A 3GFXA 2KB2A 2D9OA 4QIGA 2UVVA 2B5JA 2GQ2A 1DHMA 2KG1A 2OMLA 4WXOA 3D0HE 3GIIA 1U1MA 5HMWA 2BJDA 4F3MA 4Z37A 3MHYA 4YR3A 3IWXA 5KG0A 3CCZA 1HNVB 3RB6A 1OSCA 4KFBB 3W2WB 1S1TB 4IG0B 4IRDA 3RR8A 2B9YA 7FDRA 4O3QA 1F5BA 2C3MA 2QA4S 4YDXA 4LSLB 4X4QA 1X4DA 3F41A 1BY9A 1U09A 5J2NB 5K8MA 2GGPB 3PFOA 4CO0A 1S7HA 5K14B 1P27B 5L8RC 1TFWA 1V6HA 4LF6F 1PGZA 3KWMA 4DR3F 3DXBA 3KLEA 4NLWA 5A6WA 3BGUA 4X4UA 1S1VA 2WCXA 4C8LA 4PQUA 3MEGA 4Q2LA 1XERA 3LGNA 5KFGA 2B9WA 5BJRA 2JC1A 3J81Y 2JC0A 3NBPB 4OJ1A 1TQLA 3HP6A 4EEYA 5IS2A 1SXLA 2Q79A 2WRMA 2JVOA 1FK9B 1D9FA 1ZZFA 2EG1A 4RW8A 3OSNA 2F8HA 1VRUA 1SI9A 1HWLA 3K57A 4CH1A 2GFFA 4NZ6A 2F4VF 3PW7A 1NKCA 3FQKA 3GFYA 4IYQA 4O3NA 2E29A 3MI7X 4C97A 1H6KX 2I8EA 2VBZA 5DDQC 3T5JA 4OL8A 2YWFA 4ICLA 4DHVA 4ED8A 1U1LA 3G9CA 2WHOA 1NJXA 3NMAA 5A8KA 3CE8A 2B5JB 2OD4A 3E2EA 1M5PC 4B3OA 3AB2B 2ZBCA 2DPJA 1FDDA 2J9DE 4ELVA 3OUYA 2RUGA 3KHGA 2BM1A 2HHSA 2JHEA 3AQPA 1HBOA 4UW2A 5HL7Q 4PXBA 5EWFA 2RMLA 5JVHQ 3TA2A 4WK3A 5DQIA 4M95A 2V0NA 4KO0A 5I42A 3OXFA 1MMDA 2CZVC 4J9LA 3DFEA 1JLFA 3K5PA 3OFGA 2HHXA 4KC5A 4NYZA 1JWWA 2ZC3A 2F7VA 2FJAB 3R1HA 2KT2A 2HNDB 1VRTA 1JJ2R 2L3MA 3FQLA 4MMOA 5EGYA 3PW2A 1A9NB 3DMJA 3FZ2A 2WSEC 3KLEB 5E5NA 4NLPA 5L1KA 4Y3CA 4PQUB 5HMXA 3MEGB 2RRAA 1RYRA 1IBMF 4N56A 4Y2CA 5E33A 4NCBA 5LSLA 1HBMB 2Q6BA 3DI6A 1LKZA 2EK6A 4QYZJ 2UVRA 1E6VA 4RW8B 1MWZA 2JRSA 4QIEA 1TK8A 3ULHA 1R89A 2XS2A 1MU2A 2W24A 2DNZA 3LPYA 4H4MB 4D3HA 2XULA 1VQMS 2DVIA 2DO0A 5E3PA 3CSKA 4PUOA 5KFHA 1F2GA 3QO9A 5EX0A 2FVSA 2KH9A 2KJWA 3OXGA 4ICLB 3SFUA 5J2QA 1X5OA 2UU9F 5A8KB 4OI6A 3T9NA 4UY8T 3CWJA 1SB6A 3L95X 2ZH7A 1FD8A 4ZLPA 1LXNA 2XC9A 1Y5IB 5F8JA 4OIXA 5F41A 4PG6A 5T41A 1O51A 1JLEB 2WBRA 3ZZ0A 2Y1RI 1VQSA 3P5TL 3RRKA 1SIWB 2ZE2B 5DGBA 2W4PA 4LQ3A 4BHQA 3RU0A 2FVRA 2RQMA 4KO0B 4F25A 4EO6A 4HLBA 1KQKA 2UXCF 4LFCF 2NUUG 5DRKA 5I3QA 3AHPA 3B8HA 3TAMB 2VFSA 4G1PA 3BR8A 4UUWA 1C1BB 5LXRA 1TKDA 4L6V3 1TKZB 1WACA 2JSXA 3M2RB 2CPJA 2VB6A 3AJ2A 4Y2KA 5DGAA 1AUDA 1XMQF 3DYAA 3CD5A 3DCAA 2XHWA 3LP2B 2ROPA 5GAHU 1K1QA 2X1BA 3DU5A 5J1EA 5LSRA 3AA9A 3HMJG 2VBYA 3DI6B 1GH8A 3GYXB 3QJPA 2V4QA 4DV2F 4C0OC 4P2SA 2ERRA 4AUKA 3F56A 4LT6A 5F9LA 2G0CA 3O44A 5A0YB 4HTIA 5JVGQ 1NK4A 2PC6A 4X84A 1S9FA 2CG4A 1SV5A 3V6KA 5K8PA 4DQRA 5A8WA 2OO4A 4LF4F 4CH7A 5HO4A 3H2LA 5KFOA 4JOUA 5CYQA 3RAMA 2LEBA 1X0FA 2BOPA 4DR5F 3SEOA 3MEEA 5J2QB 5K8OA 3CDEA 1KONA 5I3UA 2FVQA 3NS5A 2Z4PA 3MM5A 3NNCA 5CCMA 1YJUA 1KRPA 4KV8A 2IA0A 5LMUF 3HDSA 4RU9A 5J2PA 2X1AA 5G0RA 2Z8QA 3W7BA 2KT5A 4ITSA 3I56S 1MROA 3DRSA 2EFPA 2PA3A 1IR0A 4EGLA 3HX9A 3CCTA 4O0IA 3H5YA 2GHPA 1BQMA 1YTYA 1DURA 3SXLA 3EPGA 3R5DA 4J5OA 5DM6Q 2W7PA 2IMWP 1VC0A 4OJ3A 4HDHA 4DR6F 3DYAB 3BB5A 3MM7B 4G6VB 3J7YU 3WX4A 1GT8A 1H3DA 4WFXA 1T03B 2ASDA 2VG5B 3GYNA 1U6ZA 1TK5A 2QSFA 3V2UC 3MM8A 3FCHA 3N6MA 3BGFA 2HWHA 1H2UX 4J9QA 3EXCX 2FJEB 1XWLA 3PJXA 3H20A 4K2XA 4ZDNA 1VQKS 2FLNA 2DK2A 1FKOA 5LSOA 1SV5B 4WCEQ 4XAKA 2GV1A 3KLIA 2B4PA 2B4VA 2GIRA 5CYQB 3LP1B 2J6SA 2DISA 2P6TA 2XNRA 3MF5A 4U7UK 5M2PA 2IM2A 3HLUA 4DG1B 3MEEB 4IFVB 1RAJA 2GNKA 2QSWA 1IUJA 1T3OA 3DU6A 4TY8B 1YJRA 5L9NA 5I3UB 3KJVA 3MM5B 3KMQA 3ISZA 4KV8B 4ECSA 4X64F 5CZVA 4BS2A 1FNXH 2FHOB 2MGZB 1WHVA 4D3GA 3TA1A 4ECQA 2MJUA 2J7KA 3M2UB 2DNHA 2OAUA 2LDYA 5HROB 2WSFC 2XB2D 1S6UA 1V3SA 1RISA 2FC9A 1DTTA 3OXLA 2RDJA 5KFPA 3AY0A 4DF4A 5GAGI 3KLFB 2AGPA 3OVBA 3C3LA 4DR4F 3EUNA 1BQMB 5CYMA 2K1RB 3HVWA 2IA6A 4EU0A 1D9AA 2Z2MA 3BN4A 3VQSA 4DQIA 4IQXA 4Q7AA 2B4OA 3BJYA 1L3KA 4X66F 1WEYA 4X4SA 3IR6B 4DBQA 3TVKA 5C42A 4JI7F 3FRYA 2F3JA 2YNHA 3OR2A 2DGQA 3S01A 2AJ4A 3L7OA 1N88A 2MYFA 3DLEA 2AJ1A 2XEXA 2BE2A 4J9RA 1HMVB 1YSJA 3BN7A 3HF5A 2D74B 3I82A 3TUJC 3D28A 4DV7F 1N8RT 2ZDOA 2A2DA 4H4KA 3Q8SB 4MIWA 2VOPA 1Y5NB 3OTOF 5DG9A 4CTAA 1FKOB 4QU6A 4J9KA 2ALZA 3UD3P 1ZBTA 4BC7A 3QMQA 4R25A 1WTBA 3MM9A 3QIPA 1H7XA 1U45A 3FMWA 3P96A 4KGMA 3OQ2A 3MMJA 3SCIE 3DRPA 2CKWA 3IBWA 3MD1A 3P3DA 3MR2A 3AQOA 2QMWA 1FTRA 1HPZA 3KJVB 1VQPS 1DAXA 3WZ0A 1YJWS 4B9SA 4ALZA 3VALA 4FF4A 1UVLA 3N0VA 3MDFA 4B17A 4AQYF 1LQ9A 3M1VA 3WBZA 1QAYA 3M6VA 4FYDA 3DDKA 5CQGA 2QT7A 2ZNZA 3B78A 4M94A 1WNEA 2IFXA 4ECXA 1RT6A 1S9EA 1VS3A 1DTTB 4K4XA 4KR0B 3N4WA 4O44B 3US5A 4YQWA 5CH7B 2BZ2A 4C11A 1U1OA 1ULRA 4CIOA 1KQFB 1HQUA 1RT5A 2V8VA 2ZUGA 2XCPA 3GIKA 3TP2A 3DLKA 2M88A 2X3GA 1SKWA 3OHAA 4TKTA 4I6AA 5C42B 1GXUA 3FJ2A 4ES2A 2U1AA 2KXNB 3MEDB 4DFMA 3DLEB 3M32A 4QR0A 3NG8A 2MKHA 4E8UA 1UAWA 4TYAA 5DM7Q 3PM9A 2J9DA 1OPIA 4LIWA 1UJ6A 3MM6A <