2LQ9A

Solution structure of the k60a mutant of atox1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Solution structure of the K60A mutant of Atox1
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lq9A00
2HFOA 2XMWA 2W4CA 1TL4A 5T7LB 2BJDA 2OFGX 3BN7A 1OQ3A 2FIUA 2GGPA 5B0EA 5B0DA 5K9FA 3E8OA 2GO8A 3LGNA 4NPOA 4A4JA 2OD6A 1XBWA 4DL0C 2GFFA 3BR8A 1FVSA 2AW0A 1Q8LA 3BM7A 3F44A 1VQSA 3MCSA 1AFIA 1YRXA 1CPZA 2HQIA 3HHLC 3BGUA 3HFKA 2FB0A 1GXTA 2LXFA 2OKQA 1N5TA 2OMOA 1CC8A 1N5SA 1YJRA 4Y2KA 2ACYA 2L3MA 1YJUA 2PD1A 5A6PA 5F0WA 3BDEA 1FE0A 2BUNA 3HHLA 5B0AA 3TRGA 4OIXA 3VTIA 4Y2IA 1QUPA 3DXSX 4DPOA 2ROPA 4DN9A 2FTRA 3BB5A 3FGVA 2LDIA 2N4CA 2LQ9A 4OJ3A 4OJGA 4QOTA 4HI1A 4FNHA 3T9NA 3WDOA 1AFJA 1Y3KA 1ULRA 1YJVA 2QYCA 2ROEA 2JDJA 1S6UA 2XMTA 1LQ9A 1YJTA 4HH1A 2OAUA 1TZ0A 1YG0A 5B0BA 1X8DA 5B08A 1SI9A 3FMBA 2XMMA 5A6WA 1FEEA 3KKFA 1R6YA 2PGCA 2ROGA 3CJKA 2QLXA 5F0UA 1S6OA 2AJ1A 2KKHA 3QMQA 1P8GA 4YDXA 5B0CA 5KAKA 3HDSA 1AW0A 1U7LA 2ASYA 1JK9B 2KT3A 3BF4A 4ZOSA 1W2IA 2EW9A 2CRLA 1OQ6A 2BJEA 3HF5A 1FESA 1Q53A 3KG0A 2HLUA 1N5QA 2RSQA 3LO3A 1URRA 5T7LA 4A47A 2GCFA 2BYCA 1IUJA 1JWWA 2K7JA 2XMVA 2G9OA 2IYIA 5B0GA 4HL9A 2N7YA 2VV5A 2K2PA 3DCAA 1Y9OA 3UDCA 1TL5A 4ZA1A 2N4DA 1TR0A 2AP6A 1FVQA 2RMLA 2HFNA 2Q3PA 3KG1A 3I9ZA 4OJ1A 4EFAC 4F67A 2XMJA 1OPZA 3TOQA 1SB6A 2RILA 2OFHX 1Y3JA 4OJHA 1WD6A 1X7VA 1KVJA 2OD4A 1FE4A 1SQEA 1P6TA 4NL5A 5IXUA 2IYGA 1KQKA 1CC7A 4Q2MA 4U9RA 4YEAA 2HLTA 5B0FA 2ZDPA 2K1RB 2RU9A 2W4PA 3HHLB 3MZIA 1Y0HA 2W4DA 2AJ0A 3KNGA 2QLWA 1GXUA 1FD8A 2ZDOA 3HX9A 1RJJA 2IFXA 2FHMA 1N5VA 2HIQA 1MWZA 4A46A 1V3ZA 2GGPB 2KT2A 3IWLA 1TUVA 4Q2LA 3LGMA 4HI2A 3TNVA 2GV1A 1OSDA 1VQYA 2KYZA 2BBEA 1KVIA 2OP5A 4Y2MA 1APSA 1Q4RA 2GA7A 3QGPA 2K7KA 2VH7A 3CJKB 1K0VA 1MWYA 3HHLD 2XMUA 2LQBA 3IWXA 3GZ7A 3FRYA 4FNIA 4A48A 1Q8BA 3K7RA 2K1RA 1X0PA 5B09A 2XMKA 2QIFA 4HH0A
chains in the Genus database with same CATH superfamily
2FJEB 1HYSB 1S5ZA 1WWHA 4ES2A 2DH7A 2FYXA 2QL7B 1N8RT 1NBEB 3M2UB 4BC9A 5M2RA 1GEHA 2APOA 1S1TB 2R2UA 1REVB 2GVDB 2OMLA 4QU7A 1RK8A 2OMOA 2HNDB 2B56A 3UWTA 2MSSA 3TJ9A 1NSKL 3I0RB 1UPMB 3PJWA 3MUMP 2J8SA 1QTNB 2OSQA 2ZBCA 4CT9A 2GIQA 1GMWD 3ISND 4WP8A 2I9SA 2MKIA 1YBAA 1AUSL 4MKYA 2R8KA 2A1BA 3MR6A 2JEJA 2AWZA 4JI3J 2JLGA 4Z2XA 2AX1A 1SQFA 1Y9OA 5F8NA 2XSFA 2YKQA 3HHKA 1RADB 2Q6CA 4O4GA 3MEKA 3VF0B 4FXDA 5AJ3F 4B9NA 3NRBA 2FZGB 5CCMA 4K4UA 5FJ4A 3UVJA 3ETMA 2KT5A 3LPEA 3IXQA 3L7PA 1U8SA 1VMBA 3E3XA 2LQBA 3JQMA 5E3AA 3H90A 2ZM6F 4OI3A 4J9KA 2B5JB 1GFWB 1UVJA 5H9FK 3RB4A 4ECZA 4WFYA 1Y00A 5AXNA 1YLXA 2C2OB 1YTYA 4UW2A 2CQ2A 4MFBA 4DUYJ 3G96A 2FHJD 3U7JA 3VGTA 4O4RA 1H3DA 3TA1A 4MK9A 4Y3CA 1ZM4A 4IUFA 1WOPA 2OJ3A 3H7HB 4DQIA 2ZH5A 3GIJA 5FIIA 3ZZ0A 2HZCA 3SYZA 2WONA 3AH6A 3GCWP 3P8BB 4A47A 1EIYB 3SQOP 3EGWB 4KO0B 3HKZD 2PI4A 4TLRA 2ZKUA 1F9HA 2XC9A 3VZHA 1RT3A 4EBDA 3DOLB 4ID5A 1S9GA 4JI1J 4C8KA 2E5GA 4B9TA 2HVZA 2OGUA 1KS2A 4OX8A 3DI6B 2HFSA 1PSDA 5I4MA 1XMQJ 3J7ZT 2KXHA 2CUYA 4HACA 3M30A 3HHEA 3VVUA 2P5VA 1JLBB 5JMNA 2ZEJA 1KP6A 1UVKA 3KJVA 3F44A 1RBAA 1KSPA 3QT7A 5ADZA 1PYOB 4ZVHA 2QMWA 1RT1A 2FJVA 3U02A 2E5LF 4MIAA 1EP4B 1EB0A 4AD6A 2XWYA 1HKAA 1LWFB 1O6XA 4QWEA 3TZZA 2YPZA 2G9OA 2XNQA 3GJRB 1TL1A 5K8OA 4XPCA 4KC5A 1FXRA 1WD6A 2C1EB 4I68A 2DPIA 4B17A 1WDDA 2NSBA 4OZ2A 4U7UD 4JB8B 3WIVA 3AOAA 3NGUA 1RZMA 3HKWA 2JEIA 4LSNB 2LCWA 4I2QB 2AD9A 2P6TA 3HJVA 5T7LB 5A8RA 2QL5B 2YWWA 1DBDA 2PMWA 3MM6B 3E8OA 4ZS6A 4HHUA 2ZBIA 3MEGB 4G1IA 4C8OA 4KV8B 3SI8A 5LJ3Y 4O3QA 2FVRA 2R2TA 2KDOA 2QX0A 1WC4A 4KYZA 1UVIA 3WQPA 4I6WA 5ETMA 1RT6B 2FJAB 3TEGA 4C0BA 1TKXA 3TR5A 3FKBA 4ZVEA 3BQ2A 3QAUA 1QSSA 4R8UB 1HWUA 5DM6Q 3AY0A 3TP2A 5E7OB 1HARA 3ILIA 1WSRA 1HWLA 4A8MP 3E01B 3DRXA 1BGXT 4IQMA 5HVFA 2BKOA 1FKPA 1FJ7A 1C4AA 1CC7A 2HAFA 1M1GA 4CLPA 2E7VA 5FDLA 4H4KC 2MZRA 4NYOA 2HGLA 4Y65A 4OLOA 1NK9A 5SUHA 4Q7AA 2DVIA 2KXFA 1PG5B 2XMWA 3G9CA 3R7BB 3M2RA 4MK8A 3M8PA 3MEEB 4JI6J 1XBWA 4M5GA 1UKUA 1HMVA 4OHYA 1FCAA 1RTZA 4J90A 4DV7F 4EU0A 1GMVA 5THWA 4V19X 3J7AN 1JLCB 2BX6A 2VJVA 2H9ZA 4ECXA 1KOOA 2YPYA 1N34J 4PYDA 1R6YA 9ATCB 4DPYA 4DUTA 2EWHA 1ZA2B 2OPSA 3BZQA 4F0MA 2DGQA 2WHOA 5FLXY 4LIWA 3EPGA 2HMIB 4CO3A 2HSEB 2IYIA 3E51A 3RRHA 4ZA1A 4LF9F 4QU6A 1N52B 1DTTB 2BABA 4CLSA 3BS9A 2JSXA 2ABYA 1JJ2R 1TK8A 2Q66A 3I6PA 2RDIA 1U1QA 1RHRB 2CPDA 3KUHA 3TNVA 4I69A 1WF1A 2DRDA 2NLWA 2B9EA 1S72S 2CJAA 3IR7B 1FRJA 1Y7PA 1RWWB 4C11A 1RWMB 2YH0A 5A8KA 1D9FA 2EFOA 2D3O1 3RTVA 3CJ5A 1WOOA 5D3GA 2B3TB 3H98A 1R0CB 2IMOA 2W2MP 3P5TL 3VAHA 3QSIA 3N01A 3N28A 4YN3B 2HFUA 3K57A 4X4OA 1HR0J 3NKYA 1FWPA 2W9CB 5GVQA 1OS5A 1TKTB 3C66A 1RDRA 3QIPB 1N0VC 1W25A 1TL7A 2QG9B 3OUYB 2RF2B 2CNNB 2LLZA 1IBMF 4ZVSB 4FF3A 5ETRA 1VFJA 2A10A 4A8WA 1FE4A 2OHDA 1HWIA 3NXZA 2K1RB 5L1LA 2CJBA 4GRSA 5E2QA 2VFTA 4ELTA 2J5AA 3KHHA 3O3LA 3DOKA 4W92B 4TU9A 3FRYA 1KVKA 3I32A 4RW8A 2XG8A 2CZVC 3AB4B 5AXMA 5JVGQ 4B9UA 1MG7A 3UDLA 1UZHA 1YJUA 2DT9A 4OIXA 3MR3A 2BXJA 5HL7Q 4ICLB 4C7QA 1M90T 3CPWR 3OFFA 4OV1A 3GTYX 4NRTA 5CD4H 5A2QY 1N5YA 4H4MB 3J7YI 3FDSA 5KG7A 2W9BA 3MI7X 1T11A 2ADBA 4LREA 4EI2A 2YWEA 4FYWB 5BR8J 3G6ES 3MM9A 4ES3A 3H5XA 3R5DA 3ZZUA 1RA6A 2I38A 4ED4A 4P71A 5JJBA 4FXWA 4X65J 3CJ8A 1FEHA 1KKHA 3M2VB 4CCHA 4EGLA 2AU0A 3AD7C 3NEKA 2DGOA 5IV3A 4TQRA 5B0EA 2JEFA 4Y34A 2HQIA 3DRRA 2MKKA 4WP9A 1J5EF 2FHJA 4EK2A 5BJRA 2DNLA 3CDUA 4IO1A 1LEOA 3MEDA 4LF5F 1OPIA 2RUGA 4ZP9A 5F9NA 5D8HB 2KT3A 3C15A 2YKOA 5IT9U 2VOOA 2YX1A 4HL9A 1DQ8A 4FYXB 5DETA 4JP8A 2V4RA 3BGRB 1YDLA 3I9ZA 1GH8A 2G2YA 1IKXB 2YQ3A 1RWKB 2EKYA 1VR6A 2VDIA 3K5PA 4USTA 5CZVA 5C2GA 1V3ZA 4F4XA 4CNZA 3W2WA 4Y2MA 3MM7A 5BYQA 1WEYA 1U0HA 1QSLA 1X0PA 4I64A 1NKCA 3BQ1A 3QGGA 5GAEI 1HNIA 3TO8A 4CP5A 5HSPA 1CULB 4NCGB 1FVSA 4DR2F 3KJFB 3CCZA 4C97A 3MTKA 2H3EB 4WK3A 1C0UB 2D1CA 1T05B 4XAKA 3LP2A 2XMTA 4HH1A 1YJTA 2V4QA 2DB1A 2DHSA 2QMXA 3EUNA 3G6VA 1U7LA 3EZUA 1NU4A 2F8EX 1I51B 2OPPA 2UU9F 3ITHB 1SPBP 3BGFA 4DHVA 3VGUA 1F5AA 3D66A 5HATA 1CQMA 3HMJG 3M6WA 3D68A 4NL5A 3W2VB 4KIAA 1F5BA 1S9FA 5AE3A 1RBOB 1FD8A 3B4DA 3G8TA 3GR0A 3EZ5A 3TVYA 1TUVA 5I42B 1TL3B 1IBCB 1MWYA 4TY8B 1FHTA 2J8AA 2UXCJ 4P2MA 4U7CA 3TRGA 2W9AA 4F0KA 4FKYA 5K8MA 5KFPA 1UL3A 2UUCJ 2RQCA 1LWXA 3PYEA 1HQUA 1U6FA 3PJ9A 4DR3F 2BKNA 2RE1A 4J9PA 4ED1A 2VFRA 1YJ9S 1VOMA 4NXMF 5J2MA 1UFWA 2IM0A 1WF0A 2LDIA 1N54B 2VF3A 3IN5A 1LQ9A 3O1LA 1JLFA 2M9KA 3QGIA 2ZHAA 2VIHA 2XO6A 1VQKS 4DUZJ 1RTIA 4ZMMA 5KFOA 2JFKA 3HDSA 4ANEA 4WIIA 3P45B 4TYAA 2RB7A 1UVLA 5C25B 4AT1B 1KFDA 3T5HA 3VV2B 2EK6A 4TXSA 4QZVB 1UVMA 2KZZA 3OQ2A 4LF1A 2HS3A 3N6NA 4JYAF 2OD4A 5KFLA 2QFJA 1HLWA 2DNRA 1NDCA 5IS2A 1IKVA 8ATCB 2P2CB 4R5PB 3M8YA 3PZPA 4YB5A 1XIQA 1F3FA 4X84A 2GA7A 1HNXF 4NI2A 2XZDB 2D3ZA 5K8PA 4X4PA 2NCKL 3L7UA 5HJYA 4DG1A 1CS4A 5IOLA 4LJMA 4NZ0A 4IRCA 4USJC 2KL8A 4IFVA 2DTJA 2KJVA 1BHNA 2QLFB 1H72C 1CPZA 3DFEA 2LXFA 4IFYA 2R7SA 4WFBQ 4ECRA 4DN9A 2IRXA 1E6YA 2W7OA 1WKLA 3DDKA 4F2SA 1IM4A 1D8ZA 4P2XA 3KK2B 4I1TA 2WAQD 1VRUB 3ZC4A 4BBYA 4NCAA 3W5YA 4XK8C 3IG1B 4ATNA 4QWCA 4LFCJ 3VAKA 3PHEA 2BR0A 3THVA 1MW7A 3A8JA 2I5JA 1HD0A 2CQGA 1TTHB 2E66A 3HSDA 3MZIA 3BBBA 4RL1A 2OIHA 4CRJA 3RG6A 5KG5A 1S79A 2CNLB 1A6LA 2A2DA 2QV6A 2XEXA 1RAGB 2BBEA 4OQJA 1XNQF 2AYEA 3RZAA 4ANCA 2Y9HA 5U47A 4A8YA 3CCRS 4EYIB 4I6YA 5LMUJ 4K50A 1V3RA 4X62F 4N41A 3QWUA 3D3BJ 3UR3C 3KDOA 2YBVA 4R0EA 2G2OA 4LQ9A 2NR0A 1HQEA 1CJKB 1VI7A 2C3YA 1CVJA 4KFBB 2ZKTA 4OX9F 5DGBA 3D4JA 3KLIB 3OTCA 1ULRA 2CQHA 2LEAA 2WBRA 5C42A 4OHZA 3T1YF 3DRPB 1U1LA 1ZA1B 2J0SD 1BQMA 3FVYA 3C6TB 3CJKA 1HBNB 2M5YA 4O44B 3LP0B 2BYCA 3IO1A 3TUJC 1X5OA 1FA0A 3LF0A 1CLFA 2FLNA 1EX8A 1XTZA 4M5KA 4W4MA 3JTNA 1XMOF 1UWAA 1HQ2A 4ANDA 2BE7D 3IR6B 3J7YU 2ZC3A 3HHLB 2EK1A 1CG2A 2W2QP 2U1AA 5DG9A 1RTDA 1RTJB 2RRAA 4WIQA 3CCJS 4WCEQ 2VFVA 3CNQP 4QJVA 5CYMA 4USMA 4NYZA 2HK2A 2YNHB 3KFWX 4C3KA 1GXTA 3V81B 1CJTB 2LQ5A 1A9NB 1V3SA 3SZ2A 5GADU 2GHPA 1K44A 5IT4A 1U1MA 1W2BR 2C2DA 3PO5A 3P6YC 1Q7YT 4C8ZA 1AW0A 1RU1A 3H2VE 3DRSB 3HVTA 3FK4A 1KLMA 2AMCB 1RCXB 3W3SA 3H4DA 2RMLA 4B3SJ 2V8HA 2QJ3A 2MQNA 2QA2A 4EBCA 1RAIB 2B6AB 5H9EJ 4DV3J 1WJ9A 1K8AT 2R8HA 3GJSB 5KOXA 5E3PA 3PR5B 1WI6A 1MWZA 2H54B 1G4CA 3FEXB 1PGZA 3H4BA 1F5CA 1Q78A 2V6AA 2MZTA 2JOQA 5IQQA 4B9SA 3KK1A 2AGOA 1JJ4A 1DQ9A 2KRBA 3Q23A 3BSCA 3UW1A 4WP3A 4DFMA 3I82A 1Z4UA 5GAEU 1R8CA 2C22A 3CO9A 2C2MB 3Q24A 2CADA 1VQ9S 3OSNA 3CD7A 3IR5B 4M8LA 4EO8A 2BJ1A 4TLQA 3KG0A 2FDNA 1XEZA 3OHAA 3AQOA 1TAQA 5KFIA 2CNOB 3NBPB 1RYSA 4UQTA 1IBLJ 1UWBB 2WK4A 3JSRA 3NAIA 1WG4A 1FTRA 1X4DA 2QA4S 1DLOA 1KHVA 3AJ2A 5J2PB 3WC2A 3A12A 1HNZF 2CQPA 3OL6A 1NEEA 4LF6J 5A0YA 2GMHA 2HHUA 2NXNA 1KBRA 3OFEA 1U1NA 3QRQA 3US5A 2CG4A 4FPRA 3PKMA 4PEOA 1B0VA 2DXDA 3LH2S 1HNVB 2LA4A 2ZE2A 4QWDA 3G2XA 2YNIB 2MY7A 2MZSA 2V94A 3AT1B 3ZO7A 3HHDA 4RW9B 2XGQA 1J5EJ 3ET6A 1SJ3P 4LF5J 2CPIA 1YJVA 4PPDA 5KFWA 1TZ0A 2AJFE 2J9EA 2MXYA 1PJ5A 4URSA 1NHVA 4KR0B 2WVDA 4KPYA 2PFFB 4LQ3A 1J2VA 1R27B 2YKNB 1HBUA 1SCJB 2UVUA 3V4IA 1DZ5A 1HYSA 2YXLA 4TU8A 4M5DB 2BE9B 4PAAA 3RAQA 3FCVA 2KB2A 1RHQB 4C6AA 3MFIA 1S1TA 3M8WA 2I8EA 1REVA 1N33J 4FF1A 5DS7A 5DZ6A 4IYQA 5CD4A 2HGNA 1VS3A 2HNDA 1T0TV 4B3MF 2BEFA 3TAQA 3BGOP 8AT1B 4KSEB 3I0RA 1SKUB 2CPEA 1M5SA 2QSFA 1NJXA 4AQYF 2E1RA 4RX6A 4XIUA 2ROGA 3J7Z5 4CO2A 3BN7A 3WX4A 2M4MA 4CLKA 4LVNP 4F4AA 3J80Y 4RR5A 4J9RA 4N5SA 2ILZA 4PPZA 2XCAA 1BQNA 2C3MA 3IM8A 2VHGA 3CCES 5LMNJ 3UN3A 3MMAB 4BHQA 2OTLS 2GW8A 3MMJA 4MMOA 4U6PA 2HHXA 5F0UA 5F3TA 2A18A 3DGPA 4WYLA 2FY1A 3FQLA 2Z2YB 3TJ8A 4ECVA 2B5JA 1HHSA 4N8NA 5D0GA 3ZXWA 1YITS 4PWDA 2NXEA 1PIEA 3RB3A 2DHHA 1LWCB 4ED8A 2AJ2A 2IVMA 4ZVTB 5HMXA 1ZM9A 2CQBA 1I94F 5MAOA 1QUVA 1RAOA 1VCTA 3POTB 1RA7A 4DX8H 2HIQA 1QAXA 5DZ7A 4ZITA 1OSDA 1MMNA 2XMUA 3HLUA 4LF4F 1F9EB 4Y0FA 4GKKJ 4KO0A 4DSJA 3OXFA 1TMJA 1RKIA 3NGTA 3K5OA 3RW6A 4ERDA 4LF7J 4DFKA 4NXMJ 1HA1A 2V4JB 3MECB 3PRDA 1PYTA 1P9YA 2AYMA 2PDAA 2JRSA 4R25A 3FGVA 4J7CA 3I31A 3WDOA 2ZWOA 4KRWA 3DI6A 4WPAA 1X9WA 3MR2A 2R7OA 3UI3A 3MURP 1CEZA 4B3OB 1S1WB 1OQ6A 1Z2LA 4P75A 4O3RA 1CJUA 2CQ1A 4F3MA 4Q44A 3G8SA 2BZ2A 4GVBA 1VIOA 5L46A 5KFTA 1H2VZ 4IRKA 1HPZB 2Q3PA 4CH7A 3ILOA 4DV5F 1U1RA 2QTWA 1RI7A 3P3DA 2M2BA 2E9ZA 2KYXA 1EP4A 5CHCB 2K8GA 1Z2ZA 2BE2B 3VAIA 2AQ4A 1NRKA 1RWXB 5HP1B 4NLXA 5DLFA 1LWFA 3U27A 3DLHA 3CJSA 3TVZA 3PX0A 1B0TA 5L8RC 1NJIT 3EE3A 1T7PA 2E9TA 2R8JA 3DLGA 2HRTA 1DRZA 4ED3A 2NREA 4DR6F 4PXBA 2IM2A 3DM2A 2V9KA 3R5AA 1BXNA 1JLAB 2RKIA 4DSFA 1JJHA 3KKFA 3QJPA 4F4WA 4LSNA 2KFYA 4FYVB 5KFZA 1PCAA 3CWJA 3S6EA 2LP4A 4NOHA 4NLWA 2NUHA 3OPKA 5T7LA 3Q2SC 1W26A 9RUBA 1N32J 2XB2D 4KJIA 2V8DA 3HD1A 3MEGA 4KV8A 3A4TA 2RILA 3R27A 3RJMB 2VB6A 3K5NA 2ZC4A 1WELA 4I6AA 3SSRA 4ZVUB 1N4LA 1TV6A 2GGPB 2KT2A 2VBWA 2E1PA 1D9DA 1KQGB 2XYGB 2CNKB 2OTJS 3MR7A 4R8UA 5JVHQ 5E3CA 2VPYB 2ZZTA 3I87A 2AJQA 3E01A 4BCAA 1VQ4S 1G2EA 3QBCA 2DITA 2Y3YA 7AT1B 4JI4F 1RP5A 3MHYA 4Y2IA 2V69A 5E3QA 3V6JA 4DOZA 2XYPB 1VC0A 1NKEA 4YOEA 2LQJA 2JVOA 3PM9A 1YRUA 3HVAA 4ZOSA 1AA1B 3MTJA 2RDDA 3VGSA 1UAWA 2RNEA 1O51A 5IWAJ 3MEEA 2R3VA 1WTFA 2CQCA 2XZWA 3VAGA 4J9QA 2FLLA 3M8QB 2VUGA 3R5CA 3ZZYA 2AJ0A 3QO9B 1JLCA 2K06A 2MEWA 1RTHB 4YDDB 1WSVA 2D41A 3I5CA 1H7WA 4OZ0A 3DMJB 4ZCMA 4B3TJ 1QDUB 1JB0C 1I1GA 2HMIA 1OQ3A 3CCQS 2H5EA 5KFJA 4WYWA 1XR5A 3DYAB 3AJDA 4NPOA 3QZ7A 1DTTA 3BM7A 2P9EA 1RSCA 1EKRA 3PTWA 1FE0A 2DY9A 2A3JA 2MKJA 3VAJA 2CPZA 2LQ9A 1N56A 2HNYB 2ROEA 1TFYA 3B54A 3AFGA 2AJ1A 2LXUA 3PHTA 1JK9B 3FJ2A 2B0GA 2CRLA 3WBZA 2XNRA 3GR1A 4M63A 2DNMA 2UUBF 4FDFA 4PXCA 1QVGR 1GQEA 1YKWA 3BR9A 4JI8F 3RYLA 2MLYA 3QGHA 1DARA 4TNOA 1KQKA 5DG7A 4JV5J 2AX0A 4QOTA 2KH9A 4K0KJ 2CXEA 3AD8C 2JLFA 3M1VB 1FJEB 4W98A 1WKJA 2ZOMA 4CT8A 2W9CA 1H98A 3J81j 3M4XA 4FNIA 3UR0A 3OUYA 2ZJQQ 5B09A 4I67A 2V68A 3EDRB 4YR3A 2D9PA 2GJ2A 1E6VA 4ILMA 3CEDA 2Z56B 2GJIA 2DY1A 2E44A 4RUAA 1PC4A 2XY5A 4LBPA 7FD1A 4CLYA 2C3PA 4YS2A 1RHUB 2Y8YA 5CABA 4JI0J 2MKYA 2HQDA 4JI3F 1HI0P 1VGYA 4I2PA 4LR8A 3I0SA 2EBGA 3T1HJ 2OAUA 2W1BA 3NCPA 1X8DA 4HVZA 4J37A 1F6TA 1R89A 2B9YA 4OYWA 2E9RX 5M2PA 4PKDB 3MF5A 3TWZA 2W2NP 4PG8A 4J9NA 1ZH5A 4F4ZA 3M8RA 1B7YB 4LBHA 2HKEA 1X4CA 3FRZA 4UUXA 2CIMA 4Z37A 2E7WA 1SQEA 5IXUA 5L9NA 2W8KA 2DGWA 3KUGA 2W4DA 4JBCA 3HX9A 4USUA 2DHAA 2KO1A 1WHWA 4A8SA 2MLXA 4DUYF 2H1YA 1G1XA 4H4MA 4DV2J 3M9NB 2EVZA 5GAGI 2F8HA 1IQZA 4DR5F 5B0DA 4B9LA 1Q8LA 1AFIA 3BYPA 3LQVA 1UPPA 2YY3A 4Y2KA 4OHWA 2XSJA 2G1HA 1KQSR 2UVRA 4HTIA 3KUEA 3GIIA 3JSMB 1RT2B 3DGVA 2IRUA 2VD3A 4IG0A 4Y2AA 3IA0A 5L1JA 1X5PA 2UVVA 4NRUA 3M2VA 3NGRA 1LK7A 1Y10A 4ECSA 3DU5A 4JI1F 3H25A 1R8HA 5K8NA 1U1OA 1H2TZ 5RUBA 4H4KA 2CPYA 1HBOA 1SB6A 4DQPA 3WC0A 3GILA 4B3MJ 1O8BA 1XMQF 1U24A 2QLJB 1FWKA 2J76E 1TP7A 3G86A 5IZHA 1S57A 1OO0B 2DEIA 2X1FA 4NEZA 1CBKA 2DR5A 3D5MA 2IPOB 1NMEB 1N6QA 1FVQA 4MH8A 4CLUA 2QIFA 1PBAA 3RAMA 1S97A 5DQGA 2GMJA 2OD6A 3BGRA 1TFWA 2MTLA 1RT5B 5EWGA 1CC8A 3K58A 4X4RA 4DPOA 3PR4A 3FFIB 3GYXB 4ZP6A 1Y3KA 3TANA 3U1MA 3NCRA 4ZHRA 4NE9C 2XMAA 1UEUA 3R5BA 2N7CA 3D0GE 2MY8A 1X60A 3HSGA 1P1LA 2F8MA 1PILA 2HW3A 3M32B 2BJ9A 5DGAA 1CULA 4EFAC 5I3UB 4NCGA 4O3SA 1Y3JA 2XS2A 5L1KA 2BV3A 2DO4A 4P9SA 1C0UA 1XR6A 1PBUA 4U9RA 5HLFB 2DCLA 3VZIA 4EO6A 3TJAA 3Q8QB 2YVSA 3JTOA 4K4VA 4B3RJ 2IM3A 3CDWA 3KG4A 5J1PA 2RT3A 2HQ3A 2HBQB 2NPFA 2LVWA 3ITHA 1VQ5S 4OX7A 2WOMB 3VAFA 4OLPA 5IT9Y 5D0EA 4ZVFA 3OSPA 4BLGA 3D54A 1NO8A 3NY0A 3W2VA 4IH7A 3FEZA 2Q43A 2JH3A 1UA1A 1V9OA 5B7WA 2WVEA 5I42A 5I3PA 1SI9A 4LRAA 2R7VA 1G7CB 4TY8A 1MMDA 4O4GB 4Q8FA 1ZETA 4PQUB 4IOAQ 3BYRA 3C16B 3KJQB 4DV5J 1XWLA 3S7RA 3EVOA 1S6QB 3TARA 4NLDA 3Q8PB 1BD6A 2EG1A 4HYKA 1HI1A 1LK5A 1ZM2A 3OR1B 1S1VA 5HAOA 3IWLA 4QW8A 2ZVIA 4KH0B 2HS4A 2VDHA 5GMDA 2LFVA 4MFBB 4ENOA 4JI7J 2CYYA 4K7QA 4IR1A 4LF8J 1FXLA 2LXIA 3JXOA 4OI6A 4YHHJ 4QPTA 1FTCA 1S0NA 4TU7A 3KHGA 4L73A 1Q95G 3LGNA 3KLGA 4H4OB 1N34F 2WONB 1G3OA 5GAHI 2RRBA 3C19A 2XI3A 4RUHA 5D6GA 4U8VA 2XI2A 4ZLLA 2CWKA 3LP1B 3UO0A 4LSLA 4R5PA 5G0RB 4DQRA 4DV1J 3CJ4A 1H0HB 3GP9A 1T03A 4PG5A 3NOGA 4F50A 1T8EA 3BSAA 1ZS6A 4ID5B 2LECA 2DYAA 4C4WA 5KFMA 2RH3A 1NK6A 2B51A 2FLPA 1NK7A 3RU0A 5EUHA 4DQSA 2F4FA 4AL7A 2NQPA 3KNGA 4BS2A 1D09B 3HSZA 5A76A 2ADCA 3KWMA 2WW4A 2VZ9A 4Q2LA 4EYHB 3LUYA 3KJVB 1KC8T 5LSOA 1DTQA 5KFCA 4WBFA 1VRUA 4OZ3A 2HFZA 2RS2A 2BRKA 3T5KA 2CQ3A 1B99A 4IQXA 2SXLA 1HR0F 2DPJA 2CVEA 2QGFB 2BQ3A 2DK2A 2BM1A 1N36J 3SXLA 3SEOA 1H6KX 2DNHA 1VJQA 5EHHA 2P9GA 4E8UA 1DURA 1YGYA 3V6DB 5HO4A 1NDKA 3OLAA 3WX8A 2VOPA 3CTRA 2HURA 2DISA 4MKVA 4A8KA 1HI8A 2UXBJ 1O0PA 2FGOA 4K4XA 4NLOA 2ZNYA 3PFEA 3R6LB 4DR4J 4PG7A 3L09A 2C3OA 1WEZA 4FPIA 4ZPDA 4XPEA 3MGJA 1PO6A 5KFHA 2OI2A 4QIWD 2N4DA 3FCHA 1S10A 5EX0A 2OFHX 2FY8A 4KFBA 2RQMA 5A8RB 2RU3A 2F9DA 1WG5A 3AQPA 3HPOA 4P52A 2BJ3A 5HROA 1GT8A 3C6TA 4QCLA 2B43A 4O44A 2O3DA 3UPFA 4Y28C 4CH1A 4WFAQ 2BJ7A 3PCOB 3M7VA 4WE1B 1TKXB 4LVOP 5IFMA 2J9CA 3PRVA 4J9VA 4IRDA 4ITSA 2UUTA 3W66A 1S48A 5GAGU 5C2CA 2Y0BB 3H42A 3HHLA 1XC9A 4HT5A 3SMZA 2DXEA 1K0TA 1RTJA 2RS8A 5A6WA 3V4MA 3OTEA 5CAAA 5BR8F 3FSYA 1SL1A 3LA0A 4UY8T 1KFSA 4G1QB 2QA1A 4RW4A 2HVHA 2BACA 5FDLB 3O44A 4F0HA 2YX4A 2YNHA 4GMKA 3AHPA 2MZJA 2DHXA 2QRRA 2R9LA 4X65F 2W7PA 1HBMB 2WBMA 3V81A 2BW2A 4Q2MA 2HHTA 2MMYA 2VC0A 1NK4A 2KRRA 1TQLA 2LU2A 4NLSA 3M8PB 4WU3A 3BO4A 2DNZA 2UXDJ 2MLZA 2LA6A 2Y0SD 3IRXA 1WHVA 3GQCA 1F3VA 3DRSA 2VPZB 4HH0A 3PYDA 4ZPBA 1KTQA 4KT0C 1V5IB 2R7QA 1SKSA 3KLEA 3AAWB 4MYTA 5J1EA 2GNKA 2KI2A 4NZ6A 4CLZA 1RAJA 3MCSA 2KG0A 3W64A 3M6UA 3I96A 3IGVA 2ZH7A 5HANA 3BKTA 1JNRB 4MAKA 3MFHA 2FZCB 2M7SA 3LPYA 4KPCA 1U6BA 5DDOC 3R5GA 3C14A 3SFGA 4Z7CA 1K9MT 3RBDA 4B9MA 3GPAA 1FRHA 4WFNQ 3GFYA 3EWGA 3JB9k 2CJXB 5BYRA 3TQEA 3QLHA 1REGX 2YX7A 3G4SS 5LOQA 2RQ4A 4ALZA 1NB7A 3BPDA 1GXUA 2HNZA 5HMWA 4ECWA 2A6MA 4C11B 2FJBB 2Z2LA 4UZCA 4RWWA 2J6SA 1IWAA 1GX6A 4BDPA 3QT8A 3ULHA 3OJUA 3TZWA 3OXLA 4DR5J 5GMEA 2Y1LB 3B8HA 3DLEB 4RNFA 3NBPA 4G6VB 1C1CB 5HQ8A 4ZDNA 5H9EK 2DXFA 1UWBA 2HK3A 2RRNA 3A13A 5KFFA 3PIOQ 3CC7S 1FX4A 1VLOA 2PA3A 1NJWA 5J2PA 4ZPTR 2ZBRA 5EWFA 3VAMA 1RB0A 3AD9C 3B78A 3MOZA 4QYRA 5ETPA 4OZJA 1ROFA 3VWSA 4L74A 4WK1A 3GMGA 5HQLA 1FRIA 3FSXA 1HNVA 5KTQA 2AEJA 3CMAS 2JEGA 4EZ6A 4EEYA 2VQFJ 4ZVQB 2OEMA 4UF4A 3T3FA 1CJVB 4RW8B 2UXCF 2U2FA 1QAIA 2V9WA 2CQIA 3W1YC 4PR6A 5L38A 2HAIA 3GYGA 2UUCF 2BW7A 2Q6BA 4YY3J 2D7SA 1SJFA 2YKNA 3JYTA 3PO4A 4M5DA 5K5MA 4RPFA 3CDBA 3CJ0A 3GWCA 3KLHB 3MM8B 1SV5B 1RLCL 2DNOA 3RW7A 3KOAA 4DUZF 1N5YB 1EAYC 2PD1A 3DXSX 4RNMA 2O5DA 2M52A 3HFVA 1UEKA 2LKZA 4J5OA 2K3KA 4WFZA 1RYRA 1BLUA 2IVFB 1VIXA 2KXNB 2DBBA 5GAHU 3GFZA 3KMSA 3NGSA 2X3GA 2N3LA 3BF4A 1B4SA 1W2IA 3GJTB 1JXVA 4URGA 3MPDA 1RHKB 1NSAA 3KMQA 1MMLA 3VR1A 4YQWA 4YP3A 1HW9A 3TUIC 3O5TB 1R8BA 1A0OB 2I2YA 3C6UA 4NZ7A 1DQAA 2KU7A 4DBQA 3CCVS 4G3IA 3DOMA 4F3QA 4OL8A 1U2FA 3BSNA 3W9HA 5DDRC 1NZAA 3HZEA 3ZTRA 2HZVA 2OEJA 1LWCA 2V34A 5KFDA 1OJ4A 3BH7B 3IBWA 2HHPA 1UA0A 3C15B 2ZUAA 2ZWPA 3POTA 4ZP8A 3Q8YA 3ILJA 2DR7A 4LFCF 2L48A 4ED0A 1WHXA 1XJWB 3K2YA 4CDIA 5CA5A 3NGKA 4DL2A 3CJ3A 4ZIVA 2B9WA 1B0PA 1NK0A 1FESA 2FVSA 2NPIA 1C1BA 4G65A 4C98A 4F4YA 3D2WA 2BJ8A 4DPWA 3R8YA 3JSYA 1NLKL 1S59A 4ZVPB 2R4FA 1U1KA 1U8WA 5LL6d 4ECUA 2ZDPA 3MECA 4ILRA 1XQIA 3CCTA 2VA3A 5LMUF 3L95X 4UOFA 3MPYA 1SIZA 1VQYA 2EKNA 3BKFA 5IC4B 1S1WA 4B3OA 4DFJA 1KEKA 2JL9A 3W61A 3EICA 1OMSA 1HPZA 5KT3A 5HN0A 3IRWP 1PAEX 2V8GA 2IMWP 4Q0BB 1IBKF 4ECTA 1U48A 3S01A 3PKYA 4KH1B 2FC8A 2F4VF 4IOCQ 2BE2A 3LOUA 1LW0B 1RWNB 4X64J 2AYBA 2KJWA 1FK9A 2WSEC 4QWBA 4WU2A 3MAHA 1NHKL 2IJFA 2ASYA 1WEXA 4JOUA 3BEGB 4DPUA 1FX2A 2F1FA 3FZ2A 2PEBA 1ITPA 4NYPA 1R43A 3IAM9 4ZCKA 2W25A 4ZK7M 2IBKA 4PRFA 4JI2J 3D67A 2YH1A 2ASJA 2AGQA 3V6HA 4RUBA 4IG3B 5IM0A 2ALYB 3OVBA 1Q5YA 2UUWA 6FD1A 2ZD1A 3I4PA 1U02A 2GHWA 1EETB 1IKYA 3KDNA 1HQUB 3UN5A 2F7VA 1SJQA 1H7XA 3CD5A 1U47A 2W4CA 5KOWA 4C3LA 3AXMA 2GFFA 2ZBQA 3BR8A 1RTIB 2X1GA 2I1RA 2FC9A 3BDEA 4UUWA 5AXLA 3H2UB 3TA0A 4OI0A 1HHQA 1UW4A 4GVLA 3I55S 3WZ0A 3PACA 4B3SF 4ED7A 2QEXS 3QMQA 2AIRB 3CW2C 4FN5A 4RZRA 2B4PA 5D15A 2ATLA 4DV3F 2VC1A 2DH8A 1UCNA 1NKBA 1AZSB 3EGVA 5D0RA 3FSIA 4NI2B 4KGKA 3N9UC 3VCDA 2W4PA 4J9MA 4DS5A 2FPHX 1CS4B 1RWUA 2IC3B 3OVAA 2E1CA 3PXGa 2RUSA 4JV2A 1IQTA 1QAJA 1UMJA 1E6YB 5DQHA 3ZTOA 1IKWB 2AF6A 2DO0A 2HQCA 1EARA 4K4WA 3M8QA 5D4PA 4M5LA 1MROB 1R8AA 3QO9A 2HRUA 2NSCA 4HI1A 2XM3A 1WTBA 3ZZPA 1RTHA 4NA2A 4X4TA 2W8LA 2DR9A 2DNKA 1RLDA 4PG4A 4USHA 1NJZA 1IBLF 2XO7A 2YWHA 3LO3A 2BJEA 4D3HA 4O0IA 2KN4A 4DLGA 3DYAA 3TEHB 2B9XA 4QR0A 4LF6F 1M5PC 1YHQS 4HKQA 3W7BA 3NNAA 1S76D 3PEHA 4FBTA 2OUGA 1ZPWX 3L9ZA 5HBMB 2B8PA 4DR1J 5GADI 4N7TA 5J2QA 3HP6A 4L3NA 2KFNA 1VJWA 1KVIA 4C48A 1HNWJ 4GO7X 4DL6A 3N6LA 4DCJB 1Q8BA 5KG6A 1HQEB 2V63A 4M5JA 3PDNA 3TAMA 4KKOA 2YKPA 3D9BA 1ZTWA 2GAGC 4ZPCA 3UCUP 1R0AA 2W01A 2VG6B 3P4UB 2BANB 1MN9A 2QLBB 2YNFA 4DPXA 1QUPA 5T14A 2FJXA 1ACMB 2UZAA 3D0HE 3M1VA 3Q22A 3IC1A 1RWVB 4DX6A 2NZCA 5DRKA 1N33F 5B0CA 1HFEL 3GCXP 2NYIA 3K8WA 5F8HA 2GVZB 5LSRA 2GJFA 5F8GA 4FS2A 4C0HA 1FERA 2R2RA 1GTEA 4F67A 1YQHA 2V50A 5F9LA 1YBTA 2DNYA 2F5GA 4LBIA 5CYMB 2JLEA 4HT7A 2OPRB 2HPUA 4LFBJ 3TI0A 4ZP7A 2CZ4A 1VC5A 3NCQA 1YI2S 1OSCA 3LGMA 4GKJJ 4J9LA 1GAOA 4DR7J 1QAYA 5BXIA 2OSRA 5T41A 3QT6A 5LMNF 3TA2A 1FRXA 2ASLA 4TKTA 2VG5A 1URNA 3HHLC 2G0CA 1L3TA 1M1HA 3G6YA 2CPFA 5F0WA 3K89A 3MMCB 1F9FA 1YZ6A 3HVTB 1KLMB 1BQXA 2OLWA 2MHNA 4OYXA 2KZMA 3THPA 3OL8A 3BN4A 5F8LA 4O3NA 2YWGA 3KHLA 1U45A 3LWMA 3ZNJ1 1QSYA 2IJRA 4OHVA 4M5NA 2FD2A 5KFNA 3MXHP 1JMTA 1R3NA 4ER8A 1X4FA 2HZAA 1N88A 5L1IA 4QIFA 2IJNA 4I56A 4D3GA 2BM0A 5HK4A 2KTQA 3HULA 4KHMA 4FVCA 5HQMA 1EHWA 3KK1B 3MOJB 3M9OB 1WOSA 1JQGA 2DIVA 4GKKF 1RT2A 3A8EA 2XQCA 1LXNA 3EYZA 1TAUA 2VONA 1LFPA 3H5YA 4LF7F 3LAMA 2XLJA 4N56A 2BKPA 1VDHA 2V2VA 3SCJE 1IWGA 3DRYA 2RHSB 4NLVA 2WVFA 1R8PA 5AXKA 1YWXA 1DHMA 5F8MA 1D3WA 2LYVA 3RRGA 2Z4PA 4PUOB 1NK5A 3BBCA 4O0NA 1I3OB 4RW7A 1U6ZA 4X4NA 4HHHA 4RJVA 1D9AA 2YKAA 4HHJA 2QT7A 2DRBA 2K7JA 2MKCA 3WIUA 3E2EA 4LRBA 2HVIA 1MN7A 3DDIA 5A0YB 2QFIA 1KDNA 4ED2A 4CM0A 2J9DA 2L9DA 3W9JA 5KFKA 4MIWA 4QIEA 4RLEA 1SQGA 3R3TA 4F3OA 3L7OA 2XS5A 3FFIA 3HVWA 4A46A 1JLEB 2ZE2B 1IVZA 2IM1A 1K0VA 1WC1A 1VBXA 2JNJA 3ET6B 4NMLA 1H73A 1DY3A 3F56A 3JQJA 3M32A 3IS9A 2ALZA 1KTVA 5C24A 5I3UA 1M5OC 2V0NA 1YRXA 2XLIA 4NX9A 5HLFA 4NLGA 2MQLA 1HBUB 4RWXA 1Q81T 3V4IB 3MAAA 4OJGA 2R7RA 4NLRA 4J9SA 5JXSA 1VK3A 5CCLA 1N32F 3G82B 3I4HX 3X3UA 1CSJA 1FFGB 2MGZB 3DLKA 2KM8B 1U2CA 1UJ5A 3B82A 1BUXA 1AT1B 1PAUB 2M0GB 3OT9A 1ZZFA 2WOMA 1L3UA 2VQEJ 3QRPA 1TL5A 1C2PA 3OD2A 1LWEA 1UEVA 2GC8A 3KK3B 5DDPC 4FZVA 1PJ6A 2PMHA 2PN6A 1OY9A 2G0JA 3R1LA 3MD1A 4DV0J 3GLJA 1FKAF 4LF2A 4O23A 3OTBA 2FHMA 3R2DJ 3QIDA 4RBTA 1OIAA 2COLA 2L41A 1S9EA 3BKUA 4BC7A 4WFXA 3D0IE 1BQNB 4PQUA 2B7CB 2VG7B 2F9JA 1X31C 3C16A 2MQOA 2IY5B 5KFRA 4A4JA 2ACMA 2DGXA 3OFGA 4XDDA 1S6QA 5DM7Q 3F41A 1IBKJ 5ETLA 3KTQA 3AB2B 3DGPB 3GB0A 1N5SA 2MPUA 5MLCV 2F4VJ 1T3OA 2L08A 3OR1A 4NLPA 5LXYA 3OHBA 3EGZA 2JJ4D 1FKOB 2JDJA 1S6UA 1NM2A 4PWDB 5IWAF 1U09A 2IBOA 5CYJA 1RISA 3BPSP 1VBKA 4KBIA 4P73A 1FRLA 1ICEB 1N5QA 1URRA 2OO4A 4AXIA 1WDTA 3NLCA 3HT0A 1RE1B 1IR2A 2RHQB 5K20B 1WUUA 1X4HA 2ZOGA 1WC3A 4H4OA 2DCUB 4M5MA 4NLTA 4WTYA 3DLJA 4RBVA 1LW2B 4B3TF 3G8QA 3PW2A 1SKWA 1M0SA 1YJWS 1RT7A 1AB8A 3LP1A 1KRPA 3TUPA 1NSPA 3NWGA 1S1XA 5G0RA 4ZVOB 2R7XA 4ELVA 2GMLA 3QGPA 1NDLA 3HZGA 3ZTPA 1ZPVA 3CULA 1RCOB 2O1PA 4DZ6A 3IMQJ 2G1DA 2BOAA 2FVQA 2HIYA 1S7HA 2EFGA 4UQGA 4MT1A 3MD3A 2GS8A 2OKQA 2W24A 3Q8SB 1CJUB 5CYQA 1EKSA 4GVBB 4FVMA 3PG9A 2Z2ZA 4I7FA 2HVEA 1VRTA 3Q86A 4QYZJ 2MB0B 2CQ0A 4JV5F 4K0KF 3RBEA 1OY8A 3CIMA 4UY85 1LFWA 4RKUC 4QQBA 2V5HG 4RNNA 5ETKA 4KHPJ 3R5JB 1AUDA 4NXNJ 2YKMB 3MCOA 5AT1B 3HT3A 5B0FA 3V6DA 5D77A 4V1Ak 5K14A 4OYPA 3IBCB 4A8FA 2IFXA 1FRKA 2DEJA 4ZN1A 1X4AA 3DLGB 4U8YA 3N5FA 2B4VA 3H5UA 1RBLA 4DXLA 2BMBA 2PI5A 1F2GA 3J7A1 4WWSA 4MTPA 1R6VA 3DM2B 1S0VA 2J9DE 3A1YG 4JI0F 1ZOTA 2RKIB 1S6PB 3T1HF 5LT5A 1N5TA 3ICLA 4DV4J 4K4TA 1IN0A 4JI5J 2FTRA 1Y5NB 5KG0A 4YMEA 5A8WB 4USWA 1V5VA 1MNEA 4Y6IA 1VBYA 2D3OR 4USIA 3OJSA 1XK8A 5DDQC 2HLUA 4U96A 3EM1A 3NS6A 3L3CA 4R0JA 3T6BA 3W62A 2VV5A 5D4LA 3NGDA 4Q45A 1TV6B 2FHKA 3M6VA 1FD2A 1X4BA 4WE1A 4P6QA 4PXDA 4RU2A 3ONQA 2MZ1A 2MKSA 3PY8A 4KTQA 2OPQA 2XS7A 4DV2F 3I5AA 4I4BA 3GIMA 2DNGA 2A6OA 1YBUA 3M9MB 1Q86T 1FJGJ 4F02A 3HHNB 4EWTA 1ZZNA 5F3ZA 1T95A 4G1QA 3T5LA 4WTOB 3W60A 2D74B 3BO3A 1S0OA 1RWOB 1S4FA 1M1KT 3J81U 4Y00A 4OI2A 1HBMA 1NNDA 2H5IB 2JX2A 3QPIA 2AJ4A 1HHTP 4ILLA 3M2UA 5AE2A 5KG2A 1TKZB 1A7GE 1HD1A 2JWNA 2GVDA 2NXUA 5ETTA 1TK0A 1Q53A 4WXWA 3I5BA 3CXCR 1D0EA 4J91A 2V2QA 4C2MA 2AT1B 1Z1ZA 2R8IA 2UUAF 1AXQA 3LALA 1WKKA 3UNYA 2HHHJ 4OJHA 3Q0AA 2IYGA 2E1MC 1H2UX 3KYLA 4E2FB 1VQOS 3ENAA 1UFLA 4PWUA 4ZIWA 2K7KA 4A48A 4FF4A 2ERRA 3M05A 3U1NA 3QYYA 3PX6A 4CTAB 3QFWA 2WSCC 3L4BC 4OZLA 3N0VA 4X66F 1ELOA 3MAQA 1NUEA 3IM9A 5HVGA 5IQ6A 4YFUA 4NEYA 2VASA 3FNNA 3VGVA 4DSIA 3NS7B 3RAXA 3VALA 1N48A 4U7UK 3H40A 1IXKA 3CD6S 3CB4A 3DLEA 3NMRA 3MMBB 2C28A 1QE1B 5B0GA 2EEYA 3R97A 3W5XA 2IDLA 3GONA 1C1CA 4TN2A 4B3RF 4FXVA 4Q8EA 3BGLA 2HLTA 4MKBA 1Q8IA 1RHJB 1L3VA 2DGTA 1E6VB 3MWBA 4CO5A 4CO1A 4DCPB 2YQ0A 4KB7A 2EI5A 4OYMA 3OTDA 3HI9A 4C9DA 1T9YA 4X4UA 3DOLA 1MU2B 3HVRA 4OI1A 4Z7YA 1YJNS 4I2PB 3I0SB 4ID8A 4CZCA 1DFDA 3IBFB 4RNHA 2DR6A 2XLKA 2ATCB 2F65A 1R31A 4ELUA 1RAEB 4L75A 4KGXB 1X9MA 1CJVA 4E0DA 1CQNA 3QJLA 1ZYQA 2M3DA 1J5OB 3B4MA 1WNEA 4RW6B 2GIRA 1JLBA 3CGIA 5L9XA 4DL5A 1D8YA 4ZCLA 4Q5VA 3CJRA 5D78A 6AT1B 2EFVA 1IR0A 2POKA 5KAKA 3QQCD 1WI8A 2ZBPA 8RUCA 4P74A 2PC6A 4URQU 2Q79A 2XMVA 1NPPA 2ILYA 1QD1A 4LFAJ 3DCAA 5DQIA 4USVA 5J2NB 3KLHA 3THTA 3LW5C 3MM8A 1SV5A 2XMJA 5E41A 2VBXA 3QNWB 4JI7F 4IDKB 4DV6J 1GMWA 4LF8F 2DGUA 4YB1P 4QWAA 1X0FA 2ZVSA 2B7BB 4YHHF 3CT9A 5EN1A 2LDYA 1XNRJ 3PRBA 2HYIB 2JHEA 1YX2A 3IWXA 2XCPA 2Z30B 1X9SA 1RGVA 1RQ0A 4EUVA 2YNGB 2XSJB 3VQTA 4PABA 3RB6A 4F25A 3P5BP 2ZFHA 3A3OB 2HHVA 3MPUB 4WZMA 2VICA 4IG0B 4DV1F 3BGUA 4HR2A 4I2QA 2HHSA 2NZ4A 3K0JA 2WB4A 1PKUA 2ROPA 1DAXA 3MM6A 4LR7A 2FGCA 3A8KA 4DCOB 2XMMA 1LOUA 1N0UA 4OYBA 3H0PA 1HBOB 4ETXA 3PW0A 1F0XA 1P9QC 2YWFA 3AOCA 1EQ0A 1RT6A 3D1QA 3ZTQA 1SC3B 5EGYA 3EVWA 3SCIE 4YB6A 2BQUA 3CE8A 3DDNA 4DZDA 3GFHA 4I0WA 4ECQA 1HL6A 3UE2A 1UJ4A 3PNIA 4F36A 1N6QB 4OV6A 4K5RA 4KGVB 1FDDA 3SCLE 2IRYA 3R9LA 1HIYA 2AHOB 1UFKA 3HJFA 5AJ3J 1N36F 1ZM3A 1K1SA 2GZOA 4OHXA 3UD5A 4ZHRB 2E1AA 2UXBF 1VQSA 4UOCA 1I6JA 5F8IA 4DR4F 3HCXA 4USKA 2ZM6J 2NS1B 3GV5B 1P27B 2MSTA 2ACYA 1IM6A 1NPRA 2IAJB 3JAMU 3VTIA 3CF5Q 2X1BA 3F73A 2R42A 1S6OA 1D1UA 1OY6A 3QAEA 4DU7A 2C2RA 4ZPVR 2EW9A 1JLQB 3HF5A 2XBPA 1JWWA 5D4OA 4JUZA 2FVPA 1FFSB 3IFEA 4M1KA 1QM9A 5HMYA 4Q0BA 4ZLJA 2P9CA 4HLBA 3N5BA 1O5JA 2J6TA 1FXDA 3CSKA 1LW0A 1SVDA 1SH0A 5KFAA 5D4NA 3OR2B 3SCKE 1L3SA 2IVYA 5ETQA 2MJUA 3AODA 3MM5B 3PYFA 4MJKA 2XHCA 1B7FA 3H5SA 1WC0A 3PV8A 4IG3A 2Y1JA 3SV4A 2ZJPQ 3MUVP 4KE5A 1QY7A 4ETZA 1Y5LB 2Z0GA 1AFJA 5DO2A 2IA6A 2H4YB 3TUZC 1EETA 3Q2TC 2EFPA 1T9XA 2M8HA 3QRRA 2F3JA 2E5LJ 1X4EA 1S1VB 1S1UB 3CCUS 2N3OA 2WW8A 4FYDA 1TKTA 3GU0A 1UZDA 3QIPA 1OPZA 3D7SB 4KQZA 2X7IA 2UXDF 1S4EA 3DC2A 5KFEA 2AKWB 2RVJA 1MWQA 4DQQA 2RF2A 4K59A 2BRLA 3HXMA 1TVRB 1U25A 3HFZB 3GIRA 2C42A 3SDEB 3A3NB 3AA9A 3SSQA 3GV8B 3KLGB 4PCQA 3T41A 3HHLD 3G87A 5M2UA 3PX4A 2BDPA 1JLGB 2K1RA 4LR9A 3D6FB 2O01C 1JIHA 1AZSA 2B4OA 5KG4A 4LSLB 4B02A 1GNKA 1G6BA 2JC1A 1XN9A 3PIPQ 3BV8A 3NS5A 3MPVA 1SUQB 3KLFB 1T03B 1NPKA 2MKHA 3CJQA 2E5HA 2KG1A 3UCZP 2KVQE 4FNHA 2P6SA 2IC3A 2Z8QA 5B0BA 1LV5A 2KKHA 4UOHA 1LNQA 3TX8A 3GJQB 2GCFA 3NL0A 3TW0A 4ICLA 2KHDA 3BO2A 2RQKA 3SSSA 1BC6A 3LGHA 3EGNA 1JKHB 2C2EA 1TUWA 2K3IA 4F2RA 1IKWA 5DG8A 1RAFB 3QZ8A 4RU9A 1DTQB 2NYHA 1MROA 2RU9A 2NXJA 2CQDA 3KNAA 2CPJA 2PO4A 1N5VA 2VBZA 4S0MA 4LRDA 1KONA 4IOBA 4DDFA 1K1QA 3MUTP 2CPXA 4E98A 1Q16B 4X2BA 2GX8A 4IKAA 4N8OA 2E29A 2X51A 4K4SA 4CLTA 1VQ8S 1NZ8A 4CYUB 2HHWA 5HBMA 2ZH2A 5DLGA 2ZH9A 2CKWA 1R7IA 2AZ1A 2CWXA 2AYGA 1GTHA 2MQPA 2MYFA 4TVAB 3ENQA 1FFWB 4DV7J 4F7VA 2VQFF 4L3KA 3LWLA 5KG3A 2DKOB 3CC2S 2UUAJ 1HWJA 2HBRB 5I3QA 2VG6A 5HROB 2ZUGA 2O66A 5ITHA 2BANA 3QT5A 3ZZRA 1VHFA 3BDPA 4YEAA 4YY3F 4UZBA 1KOHA 4LF9J 1VC6A 1MSWD 2UVWA 5JUMA 1U2RA 3SQGB 1ZAXA 2EC0A 4DX5A 4A8XA 2WZ1A 3PW7A 1IKXA 3FMWA 1RT4B 1C0TB 4P72A 5KFYA 1T94A 1RAHB 4DL7A 3ZTSA 2GVZA 3GV7B 5K9FA 4X66J 1Q79A 3DLBA 5KFXA 4P7VA 1YJRA 2L3MA 2OPRA 1Y5IB 2N4CA 4RW4B 3OW2R 2UV8G 4ZVRB 3ILLA 4M5IA 5LM7E 1SJRA 3OTOF 4N47A 1T05A 3ZZOA 3UNGC 1RKJA 2IDEA 1UP1A 2YQ1A 3CDAA 2KVIA 2N7YA 5KFQA 2K2PA 2E7XA 1WHYA 5H9FJ 5ETOA 2HWTA 3CCSS 4OJ1A 1WG1A 3TYTA 2XHWA 1U49A 3IRXB 3P96A 3C3LA 3QJJA 1YRTA 5F41A 3Q8VA 4OYOA 2VFSA 3MMCA 4KAIA 1IBMJ 4Y2CA 5ETSA 1RJJA 3PJXA 1KHWA 1SH3A 2I6WA 3KLEB 1S77D 2HQFA 5J1EB 4XDCA 3EXCX 3OBIA 5KT6A 3NP5A 3GZ7A 2AEMA 2B4UA 4KY3A 3UFCX 1Q1KA 3W9IA 1VQNS 4DN0A 1V6HA 1U4BA 2R7UA 1TL3A 3NAHA 1S7IA 2GO8A 2WB1D 4KHRA 1UVNA 1VQ7S 2V67A 3C14B 3N79A 2QE5A 4GC7A 1FNXH 2VJUA 4MYUA 1W7WA 3UVJB 4QBUA 3FC9A 2AEFA 2IIHA 3IP0A 5B08A 1VQLS 1VK8A 3QLHB 1ZAWA 4LT6A 4K5SA 1P8GA 1XERA 2DGVA 3TZYA 1YIJS 2FLOA 2DNQA 2EFQA 3JTPA 4YB7A 2HNZB 4DSEA 3QFHA 1XMBA 2WTFA 2DNNA 1X7VA 1BWVA 2BA9A 4KGMA 5C25A 3UQSA 3OL9A 4PUOA 4HTJA 5HI7A 4FF2A 4J9OA 3CJTA 1SJ4P 2DIUA 2MQMA 4CH0S 2JVRA 1U1PA 2JZ5A 2AGPA 3K7RA 2HFOA 4RBUA 5HJXA 3NG8A 2RAQA 3NNHA 1C4CA 3G71S 4X64F 1OWXA 2HBYB 2PMZD 4CLLA 2G4BA 1RT3B 3VQSA 4MKAA 1S9GB 4HDGA 3LANA 2L9NA 1RXOB 4DLEA 3ELHA 3S1TA 3T9NA 3ZZTA 3NWRA 1JLEA 3JQKA 3UN2A 4JI2F 4HACB 4QW9A 3M30B 2ZZNA 4P2SA 1X5TA 3V5RA 1PC5A 2FVCA 5DJBA 3EPIA 4ZCIA 1S99A 3ENVA 3LAKA 4DF8A 1SL2A 1BE4A 2V8VA 4F26A 4IH6A 3KK2A 2XTJP 1RT1B 3JYTB 2QLWA 2XWXA 3DXBA 4UT4A 3IG1A 1GK8A 4BWJA 2ASDA 3G82A 4PZVA 4MIBA 4NCBA 2MGZA 3AOBA 3BSOA 4C8YA 2OEKA 3IAS9 1TL1B 2CPHA 3R1HA 4JV1A 2E5IA 3GYNA 2XGPA 4BWMA 3KK3A 2ZH8A 2Q1LA 2OH2A 1NH7A 1RHMB 4K8RA 1TK5A 3DHWC 3R7SB 1VQ6S 1R0BG 4DR2J 1BY9A 3SIPB 1T9TA 3JSBA 3JS9A 1CJKA 2CA9A 1FDAA 2HHQA 1YVFA 2R7WA 2VG7A 3KLIA 3KJNB 4PXEA 4ZKAA 2J0XA 3DRPA 2XYHB 4QR2A 4ED5A 2AP6A 3C6UB 2XZTB 2HFNA 3TVKA 1JNZB 4QIVA 1HBNA 2RDJA 3ISNC 4HDHA 3GE9A 3DOMB 2HS0A 3HD2A 3PVXA 2UU9J 3LP0A 4OZ5A 4KGZB 1KQFB 3MCNA 4DMZA 5KT5A 1FKOA 1ZBTA 3OV7A 4JV0A 4P2FA 4FYYB 5FLXU 4CIOA 4N76A 4M5HA 3RUBL 4LUBA 2VU5A 1NAQA 1YSJA 2PFDA 4DL0C 5KFSA 1FKPB 1IJEB 1LW2A 2AV5A 4OZNA 1C1BB 4OJ3A 1GX5A 2DHGA 4EBEA 4DR3J 4K2XA 2Y8WA 1CJTA 4P10A 1RWPB 1FF2A 3OLBA 4K4YA 2VPWB 4DR1F 5EWEA 3M2RB 5D0HA 3T19A 1NHUA 1TR0A 5IT0A 4WF9Q 4OI4A 2F40A 1VRQC 3TOQA 1HMVB 1HNWF 4DL3A 3CIZA 2CAJA 3Q8UA 2Z2MA 4OFZA 2NUUG 1EZZB 4NA1A 2GQCA 2OP5A 1F1BB 4JYAJ 2B6AA 4B08A 2CFXA 2VBYA 3UDEA 2NXCA 2G13A 2OPSB 2F63A 3CC4S 1KR4A 4CQ1A 3PEJA 2BJDA 1TUGB 2PT0A 3TX0A 1TMMA 3BBFA 2JC0A 1KN6A 2DH9A 1Q8KA 1YJ7A 1FK9B 1QTMA 1HNXJ 1WF2A 2YKMA 4P7TA 3IWNC 1J27A 2H51B 3KHRA 3O8WA 2W7AA 3MR5A 4LIRA 4IO9Q 3V6KA 2FUG9 4C0OC 4RO0A 2PGCA 1IR1A 2YWKA 2D9OA 3ISZA 3HK2A 3FBBA 5IM0B 7FDRA 4AL5A 3LTOA 4LFBF 5A8KB 3AJ1A 1S6PA 2UP1A 1HWKA 2ZD1B 5D3GB 2ZH3A 4GKJF 3C8YA 2Z57B 1IKYB 4IH5A 4A8QA 2LMIA 3P49B 4FBUA 4X4QA 3Q8RB 4DR7F 3PYGA 1LKZA 2RJZA 5A2QU 5A8WA 2JFDA 2QMUB 1HW8A 5KFGA 3AA8A 1NJYA 5IV4A 2H5JB 4QYZK 1TL7B 5CQGA 4ED6A 2W2OP 3BQ0A 1GXLA 4LRCA 2FZKB 3G6XA 2FIUA 4CLWA 2XULA 2D69A 1XNQJ 3RBZA 3RR7A 3FZBA 3MDFA 3WHIA 2H4WB 4PQAA 2BUNA 4X62J 2QA4G 1EQMA 4TQSA 1FNMA 4XO0A 4ECYA 2YNIA 3DOKB 3HM9A 2Y1IA 4RW9A 3FUYA 3CMES 4OX9J 1SC4B 1T9UA 2G2ZA 5AE1A 3CCLS 3T1YJ 3OFHA 4YR2A 3GIKA 5E33A 4C3MA 1DJ0A 3C2PA 3D6HB 2QO3A 4ZJOA 3UD3P 3ZZZA 4ZJLA 4LMZA 1KLNA 2ZJRQ 4ZPAA 1KWMA 1U26A 3D6MB 1QJHA 4C8MA 1TKZA 1XMOJ 2ZITA 4PYAA 1Q4RA 3CMQA 4AUKA 1RABB 3DN9A 4QR1A 2W9BB 3H2LA 2Z58B 2QZ8A 4AYBD 2WSFC 3AXKA 3CCWA 1NXIA 4L6V3 3MM9B 2L9WA 4ZPWR 2O67A 3BB5A 2FHOB 4UTGA 1RU2A 2J0QD 1VYAA 3OTOJ 2HQGA 1B3TA 2J6UA 5BYSA 5G4DA 1H38A 1Y11A 2RSQA 2CQ4A 1P1TA 5GMKa 1IUJA 3MPWA 3K5MA 3U1LA 2HWHA 2LQ8A 4CTAA 5J2QB 4EMDA 3MMAA 3QSYB 2HFVA 1T9WA 1LXJA 3NMAA 1VQMS 3DRRB 5KFUA 2G0IA 5J1NA 3BH6B 3T5JA 3V2UC 3F0NA 3TAMB 3EZOA 2CJQA 3DU6A 3J81Y 4KKOB 3RRKA 1JXEA 3MEDB 4CI0B 1R0AB 1S0MA 4DPTA 4DL4A 2VH7A 4ZLNA 1SXLA 2WCXA 2RIJA 1YK9A 4F04B 2M8DB 3OVSA 1QVFR 3FBCA 3PW5A 2YNFB 1BMQB 3MMBA 3EDQB 1QE1A 5ETVA 3W8GA 2GHVC 5E5NA 2CDRB 4OYZA 5EX3A 1SH2A 3K8VA 2AW0A 1JJCB 4DJBA 2FB0A 4ZVGA 1TKDA 4J9UE 3B6BA 2J7KA 4FS1A 3GG1A 2PE8A 4NLQA 2E5JA 2VQEF 1MLAA 3W2WB 5C7PA 3MM7B 5KFBA 5KT4A 1U0HB 2V4JA 3T1AA 4RNOA 3ZFVA 4CWBA 1MU2A 4DV0F 4V19J 2QC3A 1HNIB 3FQKA 2V2ZA 3KG1A 1JX4A 2ZZMA 4TY9A 3QWPA 2GAHC 2VL1A 1YZ7A 1SC6A 1FDNA 4WKRA 1J5OA 2ZDOA 3T6JA 4RW6A 1T9VA 3EXYA 1WC5A 3FEYB 3LP2B 4OYAA 2X3DA 5CH7B 4DU8A 1ZTTA 4WJBA 2ZHBA 3DLLQ 4NLYA 2VG5B 1TU0B 2BQRA 2J7UA 1IJFB 2MQ8A 4WXOA 2OPPB 1HNZJ 3I9V9 5J2NA 2A2CA 4ES1A 3BJYA 5HP1A 4IDKA 1NK8A 3R2CJ 2KHCA 4B9VA 3CCMS 3DKDA 2DNPA 2GO9A 3D6TB 4DWIA 4O3PA 3D1HA 1SL0A 4C8LA 4YDXA 5CXTA 4ZLPA 3H20A 3FCWA 3IGNA 3R7NB 3PFOA 3ETOA 4K4ZA 1JLAA 1KNZA 3SFUA 3TAPA 4X4VA 4CNYA 2HRYA 2YNGA 5L39A 2BOPA 2CJKA 1I5OB 2CVIA 5FD1A 4O3OA 2MQQA 4RUCA 2AZ3A 4OX6A 1NDPA 2M88A 2C2NA 2A0FB 5E3RA 1L5UA 1K73T 2PSZA 5J2MB 3CD0A 4ZN3A 3KLVA 4HI2A 1JLFB 1SIWB 3Q83A 1NSQA 1B64A 2WRMA 3CO0P 1L3KA 4CM2A 1TELA 3D28A 2FJDB 2CG8A 1S49A 4AQYJ 2GGPA 5KFVA 1EJ7L 2VPXB 2EBEA 4RW7B 1WACA 1K47A 4UOGA 2C2KB 3HFKA 1ZAVA 5B0AA 4TYBA 3EX7B 5HMZA 2VKZG 1IKVB 2J7WA 4F8RA 3H59A 4G1PA 1T3NA 3FMBA 2HG4A 2QLXA 4KHPF 3K59A 2IHR1 3K17A 3UDVA 2BVZA 4NXNF 2R2SA 4LRFA 3N4WA 3ENWA 4DI6A 4DG1B 1PJ7A 1Q5VA 5C5JA 3EVMA 2B8QA 2GQ2A 3UDCA 4IFVB 4IR9A 1VHIA 4HEA9 4DFPA 3X1LB 2CJYB 1NCLA 1KVJA 4OMFG 4IFYB 2VKRA 2EC2A 4DS4A 2IAJA 3SBMA 1U0SA 3A8IA 1OYEA 3Q89A 2C2ZB 3IS9B 3N6MA 2GV1A 5C24B 3VVTA 3CVKA 4K2JA 1APSA 2GQQA 2MDAA 4GC6A 4L76A 4NMXA 1I94J 5IC6B 2PIIA 1JLQA 4DV4F 2C3UA 5LJ5Y 2H65B 2OFGX 2I0XA 4JI5F 4H54A 4PG6A 3MAAB 3UD4P 3RB0A 4U67Q 2DD8S 4AE5A 2WVBA 3W65A 2I5JB 3DMJA 4YR0A 4CO4A 3DLKB 4LF4J 2DRAA 5LSLA 1SC1B 1UJ6A 2PA8D 2XY7A 1AROP 1F60B 2N82B 3RGIA 4ZJQA 3M8SA 1FEEA 4AL6A 3DHXA 1LWEB 3OR2A 3EJMA 1Q0NA 3C46A 1SKRA 2HNYA 3MM5A 1FJGF 3SV3A 1S9EB 2UV8A 3O6QA 3HSJA 3RBXA 3S8SA 3CUNA 2H48B 1FWLA 3QATA 1WORA 4C8NA 5C42B 3CDEA 3JAMY 4Q43A 2KM8C 5SZTA 1RAAB 4LSZB 1BQMB 2QN6B 3CJKB 5H1SV 4CLFA 4A8OA 3H8YA 1BWEA 1F2HA 1S12A 2J0WA 1FDBA 2FQQB 1S1UA 5E0OA 4X4SA 4GO5X 2D3UA 4JI6F 2V8PA 3GSIA 1JXLA 4NWBA 2DR8A 1QLNA 2EFNA 3W5ZA 3R6GB 1TVRA 1RTDB 4WZQA 1RUSA 3SDEA 5ETNA 3BREA 4N77A 3PW4A 4DF4A 3A3PB 2HHHF 4DR6J 1M5HA 1PYSB 1JLGA 4M94A 2QL9B 1Q82T 1RT7B 2QYGA 2LU1A 2VFUA 1S1XB 4EZ9A 1X4GA 3K5LA 4OYIA 2HGMA 1SUQA 2MZQA 3KLFA 4CO0A 1M5KC 1VQPS 2ZH1A 1Y0HA 3UCGA 2DGSA 2V2KA 4DX7A 2LEPA 1VBZA 1RACB 1FJCA 4M95A 5CZXA 2VA2A 3TZXA 5LXRA 1UW9A 3TQ1A 4W90B 2WVCA 1TL4A 1AYEA 5CYQB 4DEZA 2R7TA 1SJ1A 3MCMA 1JKHA 1KD1T 3T9ZA 1Y4ZB 2RD5C 3EMTA 5F8JA 3FBEA 2VODA 4I7FB 5EDWA 1WC6A 1VLYA 2MJNA 4U95A 1VRTB 5KT7A 4NA3A 3M8ZA 2XY6A 3NNCA 1XR7A 5KT2A 1YG0A 5HVHA 4XTTA 1GMUA 3ZNUA 1M5VC 4JI4J 2HEKA 1NH8A 1SBRA 5K14B 2ZH4A 3W63A 4L72B 2HWIA 1FT8A 2ZH6A 3JSMA 3OXGA 5KG1A 2EPIA 4AXJA 4NLUA 2ZHOA 2M70A 4F4KA 4CYUA 4AFFA 2HVDA 2Y1RI 2DJWA 3ADAC 3CJ2A 2CZ9A 1Q7LB 4FKXA 2ZOFA 2XMKA 4YUDA 3NOCA 4WKYA 3GSDA 1X5SA 2MHEA 3VHQA 1UETA 3D3CJ 1VISA 1FI4A 3D1OA 2ZNZA 1T02A 3KXDA 2FJWA 3DNCA 3GG0A 2X1AA 5A6PA 4MK7A 3OL7A 2EG2A 1DLOB 2PEHA 2EXUA 4FP9A 2IA0A 4QPXA 2QYCA 4LFAF 2R8GA 1FRMA 2GIFA 1FNOA 2YTCA 3SQGA 2QSWA 1H74A 1UTAA 4NASA 3I56S 2CDQA 4QIGA 1RT4A 1RT5A 1C0TA 2OELA 1FO1A 3J80U 2W2PP 2OPQB 4DV6F 1B70B 4PWWA 6FDRA 1XNRF 3O2IA 1P6TA 2UUBJ 3HO1A 2HBZB 3W8PA 3M6XA 4JI8J 3FBFA 2CJ9A 2KYZA 2LEBA 1OYDA 3GFXA 3RR8A 1NB2A 4DSLA 4DSKA 2P8IA 2KFZA 4OZ1A
chains in the Genus database with same CATH topology
2FJEB 1HYSB 2W4CA 1WWHA 2GX8A 5KOWA 4ES2A 4Y0FA 2DH7A 4C3LA 1N8RT 4IKAA 4N8OA 2E29A 4KO0A 3M2UB 3OXFA 4DSJA 4BC9A 5M2RA 2APOA 2X51A 1S1TB 2R2UA 2GFFA 3BR8A 1RKIA 1REVB 4K4SA 3K5OA 3RW6A 4ERDA 2OMLA 4QU7A 1RTIB 4DFKA 1VQ8S 1RK8A 2OMOA 2X1GA 2HNDB 1HA1A 2B56A 2I1RA 2V4JB 2FC9A 2HHWA 3BDEA 3UWTA 3MECB 2MSSA 5HBMA 2ZH2A 3PRDA 5DLGA 2AYMA 2PDAA 2JRSA 2CKWA 1R7IA 4R25A 3FGVA 3H2UB 4UUWA 5AXLA 2ZH9A 3TA0A 4OI0A 3I0RB 2AYGA 3I31A 3WDOA 1UW4A 3PJWA 3MUMP 1GTHA 3I55S 4KRWA 3WZ0A 3DI6A 3PACA 2OSQA 2ZBCA 1X9WA 2MQPA 4CT9A 3MR2A 4B3SF 2GIQA 4ED7A 2MYFA 2R7OA 2QEXS 3QMQA 3UI3A 3ISND 3ENQA 4FN5A 4RZRA 2I9SA 2B4PA 2MKIA 3MURP 1YBAA 2VQFF 4MKYA 2ATLA 1CEZA 4B3OB 1S1WB 1OQ6A 1Z2LA 2R8KA 4O3RA 2A1BA 4DV3F 2CQ1A 3MR6A 4F3MA 4Q44A 2JEJA 3LWLA 5KG3A 3G8SA 2BZ2A 2VC1A 2AWZA 3CC2S 1HWJA 2DH8A 2JLGA 4Z2XA 1NKBA 2AX1A 1VIOA 1Y9OA 5I3QA 5KFTA 5F8NA 1H2VZ 2XSFA 4IRKA 1HPZB 2YKQA 2Q3PA 4CH7A 3HHKA 4DV5F 2VG6A 5HROB 1U1RA 2ZUGA 2Q6CA 3FSIA 2O66A 4O4GA 1RI7A 5ITHA 3MEKA 3VF0B 2BANA 4KGKA 3ZZRA 4FXDA 5AJ3F 4B9NA 1VHFA 3N9UC 4YEAA 3NRBA 4YY3F 3BDPA 3P3DA 3VCDA 2M2BA 2W4PA 5CCMA 2E9ZA 4J9MA 4DS5A 4K4UA 5FJ4A 2KYXA 1EP4A 2FPHX 2K8GA 1Z2ZA 5CHCB 1KOHA 2BE2B 1VC6A 1MSWD 2KT5A 1RWUA 2UVWA 3IXQA 3L7PA 2IC3B 3VAIA 3OVAA 5JUMA 1U2RA 1U8SA 3SQGB 1ZAXA 2EC0A 2AQ4A 1NRKA 1VMBA 4A8XA 3E3XA 3PW7A 5HP1B 2LQBA 1IKXA 5E3AA 2E1CA 4NLXA 3FMWA 1RT4B 1C0TB 5DLFA 1LWFA 5KFYA 1T94A 3U27A 2ZM6F 3DLHA 4OI3A 4J9KA 3TVZA 2B5JB 3PX0A 1UVJA 1B0TA 3PXGa 4DL7A 4JV2A 1IQTA 3RB4A 4ECZA 1QAJA 1UMJA 1E6YB 4WFYA 1Y00A 5L8RC 3GV7B 5K9FA 5AXNA 1NJIT 1Q79A 5DQHA 1T7PA 2E9TA 3DLBA 1YTYA 2R8JA 5KFXA 3DLGA 4P7VA 4UW2A 2CQ2A 4MFBA 3G96A 4ED3A 1DRZA 1IKWB 2AF6A 2NREA 2FHJD 3U7JA 4DR6F 2DO0A 4PXBA 4O4RA 1H3DA 2IM2A 1YJRA 3M8QA 5D4PA 2L3MA 3DM2A 4MK9A 3TA1A 2V9KA 4K4WA 1MROB 4Y3CA 1R8AA 1ZM4A 3R5AA 3QO9A 2HRUA 2OPRA 1JLAB 1Y5IB 4IUFA 2N4CA 2NSCA 4HI1A 4RW4B 3OW2R 2OJ3A 1WTBA 2UV8G 3ZZPA 1RTHA 4DQIA 2RKIA 4NA2A 4X4TA 2ZH5A 4DSFA 2W8LA 3GIJA 2DR9A 5FIIA 2DNKA 1JJHA 3KKFA 3QJPA 3ZZ0A 2HZCA 4PG4A 4F4WA 4USHA 3SYZA 1NJZA 2WONA 4LSNA 1IBLF 3AH6A 2KFYA 1SJRA 3OTOF 2XO7A 4N47A 5KFZA 1T05A 3CWJA 3S6EA 2YWHA 4NLWA 4NOHA 3UNGC 3ZZOA 2NUHA 1RKJA 3LO3A 2BJEA 3OPKA 1UP1A 5T7LA 4A47A 3Q2SC 3CDAA 4D3HA 4O0IA 2KVIA 2KN4A 2N7YA 5KFQA 2XB2D 4KJIA 2K2PA 2V8DA 2E7XA 4DLGA 1WHYA 3EGWB 5H9FJ 3DYAA 3HKZD 4KO0B 2PI4A 2B9XA 2HWTA 4QR0A 4TLRA 3CCSS 2ZKUA 3MEGA 4LF6F 4OJ1A 1WG1A 3TYTA 1M5PC 2XC9A 4KV8A 3VZHA 1YHQS 2RILA 2XHWA 3R27A 1U49A 4HKQA 3W7BA 3NNAA 1RT3A 1S76D 3IRXB 3P96A 3C3LA 3QJJA 4EBDA 1YRTA 3PEHA 4FBTA 1ZPWX 5F41A 3DOLB 4ID5A 1S9GA 2VFSA 2VB6A 3MMCA 5HBMB 3K5NA 4KAIA 4C8KA 2ZC4A 4Y2CA 5GADI 1WELA 5J2QA 2E5GA 1RJJA 4I6AA 3PJXA 3HP6A 4B9TA 3SSRA 1N4LA 2HVZA 4L3NA 1KHWA 1SH3A 1TV6A 3KLEB 1S77D 2GGPB 1KS2A 2KFNA 2KT2A 2VBWA 4OX8A 5J1EB 1VJWA 3DI6B 4XDCA 1KVIA 4GO7X 3EXCX 1D9DA 3OBIA 5KT6A 1PSDA 3NP5A 5I4MA 4DL6A 3N6LA 3GZ7A 1KQGB 3J7ZT 2KXHA 1Q8BA 5KG6A 2B4UA 1HQEB 3M30A 3PDNA 2OTJS 3TAMA 4R8UA 3UFCX 4KKOA 2YKPA 3HHEA 1ZTWA 1Q1KA 5JVHQ 4ZPCA 5E3CA 1VQNS 3UCUP 4DN0A 2P5VA 1V6HA 2VPYB 1R0AA 1JLBB 1U4BA 2R7UA 1TL3A 3NAHA 2GO8A 3I87A 2AJQA 2WB1D 4KHRA 1UVNA 3E01A 2VG6B 4BCAA 1UVKA 3KJVA 3F44A 1VQ7S 1VQ4S 3N79A 2BANB 2QE5A 4GC7A 1G2EA 1KSPA 1FNXH 2DITA 5ADZA 4ZVHA 2QMWA 4JI4F 1RP5A 1RT1A 4MYUA 2YNFA 2FJVA 3MHYA 4Y2IA 1QUPA 5T14A 3U02A 2UZAA 2FJXA 5E3QA 4QBUA 3D0HE 2E5LF 4MIAA 1EP4B 3M1VA 3V6JA 3Q22A 3IC1A 4DOZA 5B08A 5DRKA 1VC0A 2XWYA 1VQLS 1VK8A 3QLHB 1NKEA 1ZAWA 4YOEA 2LQJA 4LT6A 2JVOA 4K5SA 1P8GA 1N33F 3PM9A 1XERA 5B0CA 1YRUA 3HVAA 2DGVA 1YIJS 1HFEL 2FLOA 1LWFB 4ZOSA 4QWEA 2DNQA 3MTJA 2NYIA 3K8WA 1UAWA 2EFQA 3JTPA 4YB7A 2G9OA 5F8HA 2HNZB 2RNEA 2XNQA 1TL1A 5K8OA 4XPCA 1O51A 4KC5A 5LSRA 5F8GA 4DSEA 4FS2A 4C0HA 1FERA 3MEEA 1FXRA 1XMBA 1GTEA 2WTFA 2R2RA 1WTFA 2DNNA 4F67A 2CQCA 1YQHA 2XZWA 5F9LA 1WD6A 1X7VA 4I68A 3VAGA 4J9QA 2DNYA 2DPIA 4B17A 2FLLA 3M8QB 2VUGA 5CYMB 2JLEA 2BA9A 2NSBA 4HT7A 3R5CA 3ZZYA 2AJ0A 3QO9B 4KGMA 5C25A 2OPRB 2HPUA 1JLCA 3UQSA 3OL9A 3TI0A 4ZP7A 4PUOA 2CZ4A 1VC5A 1RTHB 3NCQA 4HTJA 5HI7A 4YDDB 1YI2S 4FF2A 1OSCA 2D41A 3LGMA 4J9OA 1SJ4P 3I5CA 3HKWA 2JEIA 1H7WA 2DIUA 2MQMA 4LSNB 4J9LA 2LCWA 4CH0S 4OZ0A 2JVRA 3DMJB 1GAOA 1U1PA 4ZCMA 2JZ5A 4I2QB 2AGPA 2AD9A 2P6TA 1QAYA 3K7RA 5T7LB 1JB0C 5A8RA 2HFOA 4RBUA 2OSRA 1I1GA 2HMIA 3NG8A 5T41A 1OQ3A 1DBDA 3CCQS 2H5EA 3MM6B 5KFJA 4WYWA 1XR5A 3NNHA 3DYAB 5LMNF 1C4CA 3E8OA 4ZS6A 3TA2A 3G71S 1FRXA 2ZBIA 4NPOA 3MEGB 4X64F 3QZ7A 2ASLA 1OWXA 4TKTA 4G1IA 4C8OA 1DTTA 2PMZD 2VG5A 3BM7A 4KV8B 1URNA 3SI8A 2P9EA 5LJ3Y 2G4BA 3HHLC 1RT3B 3VQSA 4MKAA 4O3QA 2G0CA 2FVRA 1L3TA 3G6YA 2R2TA 2KDOA 2CPFA 5F0WA 1FE0A 2A3JA 1S9GB 1UVIA 2MKJA 3MMCB 3VAJA 4HDGA 2CPZA 3LANA 1F9FA 2L9NA 3HVTB 1KLMB 4DLEA 2LQ9A 4I6WA 1N56A 1BQXA 3S1TA 1RT6B 3T9NA 2HNYB 3ZZTA 2ROEA 1JLEA 2FJAB 4C0BA 2OLWA 1TFYA 2MHNA 2KZMA 1TKXA 3TR5A 4ZVEA 3THPA 3BQ2A 2AJ1A 2LXUA 3OL8A 4JI2F 3BN4A 5F8LA 4O3NA 2YWGA 1JK9B 3FJ2A 3KHLA 1U45A 4QW9A 2B0GA 2CRLA 3WBZA 3M30B 3LWMA 3QAUA 3GR1A 4M63A 1QSYA 1QSSA 2DNMA 4OHVA 2UUBF 4P2SA 4R8UB 1HWUA 5DM6Q 2FD2A 3AY0A 1X5TA 3TP2A 5E7OB 3V5RA 5KFNA 4PXCA 1PC5A 2FVCA 5DJBA 1QVGR 1GQEA 3BR9A 1HARA 3EPIA 1HWLA 3MXHP 1JMTA 4ZCIA 4JI8F 1S99A 3ENVA 3RYLA 4A8MP 1R3NA 3E01B 3DRXA 1BGXT 3LAKA 4IQMA 1X4FA 4DF8A 1SL2A 3QGHA 2V8VA 1DARA 1FKPA 4TNOA 4F26A 1N88A 5L1IA 1KQKA 5DG7A 1C4AA 4IH6A 1CC7A 3KK2A 1FJ7A 4QIFA 2IJNA 4I56A 2AX0A 4QOTA 2BM0A 1RT1B 4D3GA 2KH9A 3JYTB 2KTQA 2QLWA 2XWXA 3DXBA 4KHMA 4FVCA 3IG1A 2JLFA 5FDLA 3KK1B 3M1VB 1FJEB 3MOJB 4H4KC 4CT8A 2ZOMA 3M9OB 4BWJA 2DIVA 2MZRA 4GKKF 2W9CA 4NYOA 1RT2A 1H98A 2HGLA 3A8EA 2ASDA 4Y65A 4OLOA 4MIBA 1NK9A 5SUHA 1LXNA 3EYZA 1TAUA 4NCBA 2MGZA 2VONA 3BSOA 1LFPA 4C8YA 3H5YA 3M4XA 4Q7AA 2DVIA 4FNIA 3UR0A 4LF7F 3LAMA 2KXFA 3IAS9 2XLJA 4N56A 3OUYA 2ZJQQ 5B09A 1D8YA 4I67A 2XMWA 3G9CA 4YR3A 2D9PA 3SCJE 1TL1B 3M2RA 2GJ2A 1E6VA 3DRYA 4MK8A 4ILMA 2CPHA 3CEDA 3M8PA 3R1HA 3MEEB 4JV1A 4NLVA 2GJIA 2E5IA 2E44A 1XBWA 3GYNA 4RUAA 2XGPA 4BWMA 1PC4A 1UKUA 2XY5A 1HMVA 3KK3A 2ZH8A 2Q1LA 7FD1A 2OH2A 1NH7A 1R8PA 4OHYA 1FCAA 4DV7F 4EU0A 5AXKA 5THWA 4V19X 2C3PA 1YWXA 1TK5A 3DHWC 1DHMA 1JLCB 5F8MA 1D3WA 1VQ6S 4K4ZA 2LYVA 3RRGA 4JI3F 2H9ZA 2Z4PA 4ECXA 1VGYA 1KOOA 1NK5A 1HI0P 4PUOB 4I2PA 3I0SA 2EBGA 2OAUA 3NCPA 1X8DA 4RW7A 4HVZA 4J37A 1R6YA 1BY9A 1U6ZA 2EWHA 1R89A 3JSBA 2B9YA 4X4NA 2OPSA 3BZQA 1D9AA 1FDAA 2E9RX 2DGQA 5M2PA 2HHQA 2YKAA 4PKDB 4HHJA 3MF5A 2QT7A 2WHOA 2DRBA 1YVFA 2R7WA 2K7JA 5FLXY 2VG7A 2MKCA 3KLIA 4LIWA 4PG8A 4CO3A 3EPGA 4J9NA 2HMIB 1ZH5A 2IYIA 3E51A 4F4ZA 4PXEA 4ZKAA 3M8RA 3RRHA 3E2EA 2HVIA 2J0XA 3DRPA 4QR2A 4ZA1A 4ED5A 4LF9F 2AP6A 3C6UB 5A0YB 2HFNA 3TVKA 1N52B 1X4CA 1JNZB 4ED2A 2J9DA 2L9DA 3FRZA 4QU6A 4QIVA 1DTTB 4UUXA 5KFKA 1HBNA 2BABA 2CIMA 4Z37A 2RDJA 4MIWA 3ISNC 2E7WA 4HDHA 3GE9A 4QIEA 1SQEA 5IXUA 2HS0A 4RLEA 3BS9A 5L9NA 3R3TA 3PVXA 4F3OA 2JSXA 3LP0A 2W8KA 2DGWA 4OZ5A 2W4DA 2ABYA 1KQFB 4JBCA 3L7OA 1JJ2R 1TK8A 3HX9A 3FFIA 3I6PA 4DMZA 2Q66A 2DHAA 3HVWA 5KT5A 2XS5A 1FKOA 2RDIA 1U1QA 2KO1A 4A46A 1WHWA 1ZBTA 2CPDA 3OV7A 1JLEB 4JV0A