2LQ9A

Solution structure of the k60a mutant of atox1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
b'MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
molecule tags Metal binding protein
source organism Homo sapiens
publication title Solution structure of the K60A mutant of Atox1
rcsb
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lq9A00
4NL5A 3HF5A 2GO8A 1TL5A 2VH7A 2OFGX 2QYCA 4Q2MA 3KG0A 3LGNA 5B0GA 2ROEA 3KNGA 1JWWA 3K7RA 4HH0A 4FNIA 3T9NA 2FIUA 3IWXA 2HIQA 1AFIA 1IUJA 2VV5A 2GV1A 1AW0A 4F67A 5B0CA 2XMKA 2Q3PA 1TL4A 4YEAA 2GFFA 1S6OA 5T7LA 4OJ1A 1Y9OA 4Y2MA 1URRA 2BYCA 5F0WA 5B0EA 5B0DA 2LQ9A 2AJ1A 1P8GA 1ULRA 2OD4A 3DCAA 4YDXA 4ZOSA 1FEEA 1CC7A 2HLTA 5B0FA 5A6WA 1SB6A 3BM7A 3HHLA 2N4CA 2GCFA 1FD8A 1YJVA 5K9FA 3VTIA 2K1RA 3HFKA 2AJ0A 3CJKB 3QGPA 1N5VA 1KVIA 3FRYA 4A46A 2BUNA 5T7LB 1Q8LA 2RU9A 1CPZA 3GZ7A 1GXUA 1OQ6A 2PGCA 5KAKA 2BJEA 2QIFA 3BR8A 4Y2KA 5B0BA 1Q53A 2XMJA 4DL0C 2ZDOA 2N4DA 4HH1A 4U9RA 2K1RB 1R6YA 3E8OA 2PD1A 1YJTA 4Q2LA 1OPZA 2K7JA 2G9OA 3I9ZA 4OJGA 1N5TA 1WD6A 2XMTA 3UDCA 1TUVA 3HDSA 1TZ0A 1MWYA 2ROPA 1VQYA 3CJKA 1X0PA 1S6UA 2FHMA 2QLWA 1Y3JA 2IFXA 3MZIA 2KT3A 2QLXA 2AP6A 2KYZA 1W2IA 2XMWA 2OAUA 4OJHA 5F0UA 4A4JA 5B09A 2BBEA 3FMBA 1YG0A 3WDOA 1X8DA 1X7VA 5B0AA 3BGUA 1YRXA 4ZA1A 4HI1A 1YJRA 1FESA 4DPOA 2HQIA 1SQEA 1QUPA 4A48A 2FB0A 4A47A 2GA7A 2IYIA 2LDIA 2OKQA 1Q4RA 1OQ3A 1JK9B 2HLUA 2LXFA 1YJUA 3BN7A 3HHLC 3MCSA 3HHLB 3HX9A 2OFHX 1RJJA 1N5SA 2HFNA 2ASYA 2XMMA 1APSA 1OSDA 2W4CA 2GGPB 2RSQA 2W4DA 1V3ZA 1TR0A 1MWZA 2OMOA 3BDEA 1K0VA 3LO3A 1GXTA 3FGVA 1P6TA 3LGMA 1FE0A 1VQSA 4HL9A 2XMVA 5B08A 2K7KA 1FVSA 1KQKA 2JDJA 4EFAC 3DXSX 2EW9A 1FVQA 3HHLD 2HFOA 3TOQA 5A6PA 3BF4A 4NPOA 2FTRA 2OD6A 2ZDPA 2CRLA 2K2PA 2KT2A 2LQBA 2XMUA 1Q8BA 4FNHA 2ROGA 1CC8A 3F44A 2IYGA 1SI9A 1U7LA 2KKHA 2RILA 5IXUA 3IWLA 4OJ3A 1XBWA 4QOTA 3TNVA 4HI2A 2ACYA 1Y3KA 3KG1A 4OIXA 1N5QA 1FE4A 2OP5A 2W4PA 1LQ9A 3QMQA 3TRGA 1Y0HA 2RMLA 2BJDA 2L3MA 3KKFA 4Y2IA 4DN9A 2N7YA 1AFJA 1KVJA 3BB5A 2AW0A 2GGPA
chains in the Genus database with same CATH superfamily
1BXNA 1EAYC 3QT5A 3IBWA 2VH7A 4WIQA 5G0RA 3DI6B 2WK4A 5DLGA 4QR2A 4C8LA 1BUXA 5HATA 2DEIA 4I2QA 3TUZC 2DHXA 1YJ7A 2KM8B 1IBLF 1WTBA 2ROEA 4LF2A 2RH3A 5F3TA 3AD9C 2B3TB 5A8WA 4QYRA 3BSOA 2HIQA 2JL9A 5LXYA 4CTAA 3KUEA 2MKHA 3EVWA 1UWBA 1N48A 1SL0A 3QO9B 1I6JA 3T9ZA 3R6GB 3SV4A 3ZZZA 3PW7A 2XS7A 4QIWD 1U26A 1F60B 4H4OA 1OYDA 2HGNA 2FJBB 2OPSB 4LRFA 1QDUB 3G6ES 1JLBA 2IBKA 3IN5A 2CNKB 5D4NA 3R9LA 4OLPA 2ZNZA 2XY6A 3L3CA 3BM7A 2MLXA 4K7QA 2GCFA 3BKTA 2VL1A 3D7SB 2XULA 3V6HA 1S1VA 5HP1B 1CJUB 3W9HA 2J6UA 2VODA 3W3SA 2B7CB 3MTJA 2MMYA 3HFZB 3TEHB 2AT1B 1RAEB 5I42A 2OLWA 2ZM6F 4IR9A 2RU9A 3U02A 1UAWA 2CFXA 2XCAA 1XNQF 1GXUA 1IM6A 1KS2A 1NSAA 2GMLA 4RL1A 5KT5A 1F2GA 2E5LJ 1XNRJ 3T1HF 1BMQB 2NSCA 3SQGA 4GVBB 3MR5A 3DMJB 1C2PA 1YI2S 2OH2A 2X1FA 2HZVA 4JV5J 2H51B 1TU0B 2CPJA 4LFAJ 4ECQA 1JMTA 1WC5A 3C2PA 1S6QB 3MEDB 3MHYA 4ZLLA 2Y1IA 1WDDA 2XMTA 1TUVA 3MDFA 3G6VA 1WI8A 3QFHA 4EO6A 4DR5F 5FLXY 1N8RT 1K1QA 1WKLA 3RJMB 2VJVA 2YQ0A 2MHNA 4ZJQA 1PAEX 3LPYA 2ZHOA 3T1YF 2XNRA 3FDSA 4PZVA 1R7IA 4Y6IA 2EK1A 3M8QA 4IG3B 5AE2A 3AODA 4WFZA 4PWDA 2V63A 1ITPA 1YJRA 3N5FA 2DO4A 5HI7A 4F04B 4ECYA 4B3OA 1FDDA 1FK9B 2R8KA 5KFMA 3HCXA 3KLHA 4V19J 4MYUA 1FJ7A 3D68A 1NDKA 1S1XB 1S99A 1HNIB 3FBCA 2DNMA 2HLUA 3CT9A 4QR0A 3SFGA 4ATNA 1SJQA 1KLMB 4ZIVA 1EHWA 4DFMA 4DPWA 1RCOB 2V8GA 2HZCA 4YY3F 1YZ6A 1REVA 1OSDA 1AA1B 1QM9A 2MEWA 1IVZA 2I38A 3UPFA 1LK5A 4O0IA 2OMOA 2YVSA 1U1LA 3TUIC 3EDRB 2G1DA 2MGZA 3LGMA 1URNA 5KFOA 2IY5B 3BGOP 1MWQA 3CVKA 1HBUA 4EUVA 2XCPA 5J2MA 3DXBA 3RB3A 3TVYA 4N7TA 3B6BA 3QGIA 2JC1A 3DXSX 2H4WB 3OTDA 1PSDA 1D1UA 1RAIB 3MM8B 3US5A 1FKPA 4TLRA 2XHCA 4N76A 2FHKA 6FDRA 3CJ3A 1G2EA 3RGIA 2ROGA 5BR8F 4JI7F 4TYAA 4ZVEA 4OJ3A 3A8IA 3TNVA 2JEGA 3CCES 3EUNA 2MZJA 3CC7S 5GADI 2YNHA 5IT4A 4DFJA 1N54B 4OV1A 2KHCA 1PBAA 2HURA 3EGWB 2BE2A 2JZ5A 1TL1B 3ZO7A 4OYZA 4U8YA 3OVSA 5MLCV 3MCMA 1MSWD 2LKZA 5D3GB 3QT6A 4DR2J 5EWEA 2DCLA 4ZVFA 3HJFA 4CYUA 4X64J 3HKZD 3QZ8A 1CJTA 4K4WA 3JYTB 1SKWA 4ECSA 4OZ3A 1R3NA 2IM2A 2V50A 2CQDA 4W98A 5A8KA 3BJYA 5K8NA 1NDPA 2UVVA 5A2QU 4QWDA 3BSCA 3DLGA 1SC1B 4ERDA 2V69A 1U6FA 4RWXA 1PIEA 2FLOA 3R2DJ 4HTJA 1S49A 3GG1A 3IO1A 2VU5A 1D9AA 3VHQA 5HMWA 3M05A 2YNIA 2JWNA 1HNVB 1RWUA 2Z2MA 3K5MA 1YBTA 4FDFA 5FJ4A 3DHXA 2E1CA 1ACMB 2K3IA 2X1GA 1MMDA 3T5HA 4OX6A 3MMBB 4BHQA 2K1RA 4CRJA 4ZIWA 3G82B 3ADAC 2KU7A 4HACA 2RRAA 4FXWA 2FZCB 4RU9A 5I3QA 4YS2A 1OJ4A 2YNGB 4NLQA 3IA0A 1NHVA 2PFDA 3ZTRA 4V19X 5D15A 3AHPA 3VGUA 3N5BA 3ZZ0A 3DM2A 4F25A 2IJNA 3H59A 2DR7A 1VIOA 3M6WA 3AT1B 4JI8F 3TJ8A 3KHGA 4ZDNA 4LFCJ 2QTWA 2QMUB 3EDQB 3HDSA 5KFFA 5ETQA 3G71S 2YKOA 1REGX 2LQ5A 2IVFB 1Q0NA 1R8CA 3M8PB 3UNGC 3MURP 5F8GA 2YPYA 4AL7A 2WAQD 2UUCJ 4CLUA 4JI1F 1NPRA 1LWEA 3M9OB 1WWHA 3BQ0A 1B70B 2B5JA 1NEEA 1U8WA 5HQLA 3K89A 2DNNA 2H54B 3ZNJ1 2GC8A 4XPCA 4I67A 5C2CA 2RKIB 4K4UA 2W9BA 3X3UA 2DBBA 2P6TA 1HNZJ 2GA7A 3LQVA 4G1QB 4DUYF 4HYKA 2HVZA 4YHHF 3PY8A 2HS4A 1TL1A 4LRCA 2KZZA 5AXNA 3PDNA 2HFNA 3FFIA 4P7VA 5JVHQ 2VFSA 4P52A 4HKQA 4C2MA 1CEZA 3AQOA 4G65A 4YMEA 1VC5A 2E7VA 2NXCA 5F8NA 2RQMA 5E33A 3OL8A 1NKEA 1ZM2A 3BO2A 1Z2LA 3DLBA 1BHNA 4K0KJ 2EWHA 2KT5A 1RK8A 2QLFB 5I3UB 4A8WA 1NLKL 1LWFB 1VQSA 1Q8KA 3UD4P 1JXVA 3M2RA 3V81A 2HFSA 1CJVA 3DDKA 1HW9A 3DRSB 1RHMB 3EM1A 3VGVA 3MAQA 5CXTA 2R7OA 4C6AA 3MECA 4NCGB 1U1RA 1F3FA 4ED4A 3MECB 4NCGA 1DJ0A 4DR7J 3H0PA 4MIWA 1F5AA 5GMDA 4XDDA 2WTFA 5A8RB 3PRBA 3W8PA 5IT0A 3I0SA 3BEGB 2ZZMA 3PJWA 2R7UA 4ES2A 3F44A 2PMHA 2RILA 2OTLS 2J0SD 1OS5A 3BO3A 3OFEA 4B08A 1BQNB 5D78A 4NWBA 4XO0A 3KK3B 2V2ZA 2GIFA 2A2DA 2QJ3A 2MZRA 3BPDA 1SKSA 3MM7A 1S1WB 1Q16B 4LSLB 2QA4S 1N36J 1K8AT 4C9DA 2BOAA 3UE2A 2QL9B 2H9ZA 2GO8A 1S5ZA 3C66A 2DNOA 3IFEA 1FRXA 1TVRA 1X4DA 4U7UD 4TU8A 1C1BB 4JOUA 5DO2A 3ZZOA 2Q43A 3I31A 4X65F 3CXCR 4DUZJ 1TFWA 1RBAA 1TMMA 4IOCQ 1YTYA 1AT1B 1KRPA 4ED6A 1HW8A 3GJTB 4ECRA 2E7XA 4FNIA 1NHKL 4M5HA 1TK5A 3JB9k 2B8PA 1NSPA 4IFVA 3DLKB 5L1JA 1VQNS 4FXDA 5J2NA 3M8ZA 1NH8A 3ZXWA 2Q3PA 4PEOA 2V4QA 3BH7B 1O0PA 2FPHX 3FRZA 1S1TA 4YEAA 1KTVA 4TY8A 2B43A 2ZKTA 3JTNA 4CO1A 4ZHRB 4PWWA 2NSBA 2WBMA 3I5BA 2NUHA 1U02A 1UZDA 1CBKA 2UUTA 5EX0A 1RCXB 2WZ1A 5E3PA 5B0FA 2W8LA 4K4SA 1KC8T 3H25A 3PYEA 3MEEB 4LSNA 4JI2J 3PR4A 1ZM3A 2LVWA 4X4SA 1RT7B 1IWGA 3B82A 4X62F 2RQ4A 3KLIA 4WP9A 5H9FJ 1EARA 2HK2A 3Q8VA 1XWLA 4OL8A 5AE3A 1RYRA 2RS8A 1NK5A 1Q7LB 1RAHB 3AB2B 2MZ1A 3CCRS 2DH7A 1JLEA 2IMOA 1S0OA 5KOWA 2X1AA 1IKYB 4Y2KA 2CQGA 3G87A 1VDHA 2FYXA 3IGVA 3NGDA 2A10A 2CPEA 3CD5A 5CCMA 1FDBA 1WG4A 5C24A 2CQ3A 4C98A 1DARA 5BJRA 2LEPA 3HVTB 1VISA 1AUDA 1YGYA 1K47A 1U48A 1WC0A 4F02A 4DCPB 1TZ0A 3C6UB 4WP3A 5EWFA 2Q66A 1CJUA 4LF8J 1XNQJ 5KFWA 4DV5J 2H4YB 3CCVS 3CO9A 1RTHA 3O2IA 2P9EA 1U6ZA 2QLXA 5IM0A 5BXIA 1GTEA 4OZ0A 3MM9A 4GRSA 3SQGB 3W66A 2HRTA 3TZYA 3D6TB 1IJEB 2C2ZB 4EYHB 1U4BA 3H2VE 1JX4A 1IBMF 4GKJF 3CWJA 1SQEA 4A48A 1T9XA 2ZH8A 2R7XA 4A47A 2VICA 2PEBA 4KQZA 4I7FB 4MKYA 1X4EA 1JKHB 2IYIA 1LFWA 2DITA 4PG4A 2R9LA 4KHPF 2EFVA 3T5LA 1XERA 2YWGA 4JI5F 1H2UX 2VZ9A 3EWGA 3R7SB 1FFWB 4OYOA 4CLKA 4NI2B 1APSA 2UXBF 2J7UA 3KJNB 4FF4A 3FCVA 2U2FA 3QJLA 2L9DA 2ZZTA 4LQ9A 4C11A 1P27B 4OHVA 3R27A 1NJIT 1W26A 3P3DA 1E6VA 2XEXA 2UVWA 4LIRA 2YWEA 3FNNA 4ZS6A 1Q5VA 2ZOGA 1HWJA 2D1CA 1P6TA 1RACB 4NLWA 1FE0A 1RA7A 2ZITA 1NJZA 2FJXA 4IFVB 1NKBA 3THPA 5BYSA 3G2XA 4B17A 4DF8A 1ZAVA 1Y5IB 4JV2A 2JJ4D 2GVDA 3PM9A 4LF9F 2KVQE 1IJFB 1SC3B 4A8FA 2Y8YA 2VFVA 2DK2A 3HD2A 4LR8A 4M5NA 1FKAF 3BSAA 4JI2F 4MK9A 3DOMA 3GIJA 4DSIA 2VG5B 3RB6A 4NLXA 1UPPA 2B6AA 4IQMA 5CYMB 3Q8YA 2YTCA 3D1HA 3SIPB 2IRXA 4CNZA 1NUEA 1UVIA 2FJEB 2W4PA 3GJSB 2LEAA 1RHUB 1IR2A 4QWBA 4P2XA 3UFCX 3JAMU 2CQ1A 2PA8D 4ID8A 5L38A 3EMTA 4AL6A 2HNYB 4IH6A 2RF2B 5FD1A 4H4KC 4A8SA 2LXIA 3CB4A 2AGQA 5F41A 4R5PB 4ZLPA 3ENWA 4DL3A 2HBYB 4ZK7M 1HNIA 1NBEB 1U1QA 2V6AA 4K2XA 1SJFA 1T95A 2VFUA 1WOOA 2CQ2A 2K06A 4EI2A 1VQ7S 3H4DA 2V34A 2OELA 3QSYB 4ELTA 2FVQA 3P96A 3CD6S 2HHWA 4WIIA 1FT8A 3IRWP 2FHOB 2GFFA 1NKCA 2HHPA 1RTHB 4URSA 2R2RA 3CCMS 5B0EA 1SQGA 2MQNA 1RAFB 1U09A 2EKNA 1RT5B 2W2PP 4KTQA 3MM9B 1U6BA 4ZOSA 2OIHA 2AZ3A 1UETA 4LSNB 3CO0P 4FS2A 4J9RA 4F7VA 5F9NA 1IKVA 2D3OR 1FKOB 4LSZB 1N88A 3OR2A 2LFVA 1J5EF 3GB0A 4N8NA 3KK2B 1RP5A 4JI3F 3TYTA 1VQ8S 2DNRA 4DR7F 2HVHA 4EMDA 1UEKA 3M8WA 3K5NA 1Q8LA 3R3TA 2KH9A 2XTJP 4KGZB 5LMNJ 1D09B 2MJNA 4EBEA 4IH7A 1OY9A 3CNQP 1JLAA 2QV6A 1H74A 4M5IA 1L3UA 1WEZA 1I51B 2K1RB 2FJDB 4U9RA 4K0KF 2R3VA 2DNQA 3KDOA 1WD6A 3H90A 4WBFA 4YDDB 4ZLNA 2W24A 1P9QC 1YVFA 1HHTP 3IGNA 1ZH5A 2ROPA 4F0HA 3N79A 4K4TA 1UFLA 2WW8A 3DFEA 5LJ3Y 3CUNA 1IBLJ 1HBOA 1S79A 4MYTA 4YHHJ 4OHYA 4FYWB 1W2IA 1WHXA 2XMWA 2MZTA 4O44A 3N28A 5A2QY 2E5GA 3D6MB 2ZZNA 5KG7A 3Q8UA 4L3NA 4O4GB 4CZCA 3KLGA 3WDOA 1WNEA 1KSPA 1WF1A 2JH3A 3ZZPA 5HROB 1RTIA 4ECUA 1IQTA 3DOMB 1T3NA 3H4BA 3DLKA 4IRCA 2CPXA 2DRDA 2YWHA 4OV6A 1FRLA 4CH1A 2AEMA 1XEZA 2UUCF 3P6YC 1Q4RA 4ZPCA 2G4BA 5KT4A 3RZAA 2XMAA 3A4TA 1YZ7A 3NS6A 3M2VB 4DR1J 1N5SA 2XMMA 3BQ1A 1WHWA 2XBPA 1JB0C 2DRBA 4EZ9A 2Q79A 3NGRA 3Q8QB 2BW7A 2XSFA 4CCHA 1FWKA 2BJ1A 2CDRB 3RBZA 2V2VA 1JXEA 3RAQA 1N52B 3N01A 1KVKA 3MOJB 2J6TA 1DQAA 4G6VB 3ITHB 3Q8RB 3PVXA 5GMEA 3BGRA 2ZD1A 4ZJOA 4WFBQ 1N32J 5K20B 5F8HA 1CLFA 4DS4A 2HMIB 4RW9B 4RUBA 4WFNQ 1B0VA 1VC0A 2HMIA 1HMVB 1HLWA 3RAMA 4O4RA 4GKKJ 2KXFA 4B9VA 3CDBA 4QYZJ 2QN6B 4RBVA 3H20A 4GC6A 5I3UA 3K5LA 4OX8A 2ABYA 3SDEB 1T03A 5J2MB 4X4NA 1VRTB 1P9YA 1VRTA 2EG2A 2CXEA 3THTA 2M3DA 3V4IB 2GAGC 3KKFA 4HDHA 1X60A 4TKTA 4Z37A 1LXNA 2AW0A 4C3KA 1HQUB 1KKHA 3T1HJ 1TMJA 3GU0A 4AT1B 2Z4PA 4U67Q 4Q8EA 3KLHB 1N56A 1X5PA 1CVJA 2GJ2A 5B0GA 3S8SA 3M8SA 3EX7B 4TVAB 3VVUA 3KNGA 3NCQA 1VQKS 4G1QA 4BS2A 1QAYA 4I7FA 3W64A 3OSPA 1HQEB 2C2NA 2VV5A 2XGQA 2KFYA 4PQUA 2NYHA 1CQNA 4DJBA 4CLYA 3TANA 2AX0A 3Q8PB 1S6OA 1R8PA 1FI4A 1E6YA 1T9UA 2DPJA 2BYCA 1QUVA 2ZHBA 4DQQA 3M9NB 1N33J 1J5OB 4M1KA 3MD1A 5AT1B 2RDIA 3N6MA 2DGQA 4BWMA 5CYJA 2ZH7A 5L1IA 4KGVB 1FD8A 2XY5A 4ZVGA 1IKXA 2ZBQA 5BR8J 2RE1A 1EETB 3CJKB 1RDRA 2OPPB 2HNDA 5AXLA 1NK8A 4O3SA 4OI1A 1VJQA 1WOSA 2AZ1A 2ZBCA 2EPIA 4J9VA 3C3LA 1G6BA 2XYPB 1WSVA 2XYHB 5LL6d 3SQOP 2ZOMA 1L3VA 2FD2A 3A3NB 2NS1B 1VHFA 3OT9A 4IKAA 5JXSA 1U1KA 2IMWP 3VVTA 3BR8A 4OZJA 2DXEA 2JEJA 4Q0BA 1LWEB 4AYBD 5THWA 4AQYJ 2XMJA 4W92B 2YX7A 3TAQA 4USJC 3G82A 2DCUB 4HACB 4HHHA 2R2TA 3E8OA 2R8JA 1VR6A 2DGTA 4QIVA 4DQSA 5DDRC 1RT6B 1X5OA 2CZ4A 3ONQA 4I1TA 1CQMA 4NLUA 3NS5A 1LW0A 4CLPA 4YY3J 2R8HA 2ZH4A 3BKFA 4WYLA 1HBNB 1LW0B 2CUYA 5KFZA 5D77A 4B3RF 1KN6A 4ILMA 4ZVSB 5CD4A 2FHMA 1X31C 4QZVB 1C0TA 4QWAA 1KQSR 4CO4A 1HNWJ 1YKWA 2AP6A 3BO4A 4USKA 1JLBB 2BW2A 2WVFA 3T6BA 2E5HA 4O3PA 3ULHA 2R2UA 1U1OA 2FVRA 2GHPA 3D6FB 2YKNA 3OFFA 2OSQA 2HNZB 3GYGA 4Y2CA 1S7IA 4P72A 5KFBA 1S4FA 4HI1A 3K58A 1QUPA 4WJBA 4DPYA 1RWKB 5I42B 4OHXA 4MFBB 2F7VA 3Q86A 2XO7A 2BOPA 2GMHA 2ATCB 1YJUA 4CLZA 1AB8A 4OI3A 3MWBA 3NGKA 4S0MA 3GIMA 3MFIA 1MMLA 1FWPA 1RJJA 2BABA 2M0GB 1U25A 1UVKA 2L9NA 1R89A 2MGZB 1OY8A 3UWTA 2B7BB 1SC6A 4LFAF 1LWCA 4RNFA 1WC6A 2IVMA 1S7HA 5E3QA 1NK0A 3OTEA 3ZZTA 4YOEA 3CIMA 5L8RC 3THVA 3MM7B 2YWFA 4QQBA 5GAGI 4CLWA 1WUUA 3PXGa 1FJGF 2EFPA 2ZVSA 3CJ5A 3LP1A 1NK7A 1WACA 1UW9A 2EW9A 1FVQA 3L9ZA 2ZH2A 4LF8F 4ZJLA 5A6PA 5KFEA 2HPUA 3R6LB 5IC6B 1IBKF 3N9UC 1UL3A 3P5TL 1RBOB 2DO0A 2HWIA 2LQBA 1BY9A 2OGUA 3M32B 4NE9C 4YB7A 2QA1A 1CC8A 3H5UA 4ZP9A 5FIIA 2H5EA 4P6QA 4RX6A 3DRXA 1VBXA 1EIYB 1SI9A 3MPYA 4NMXA 2BE2B 3IWLA 1CJVB 2GAHC 2JVOA 4F0MA 4AL5A 3MUVP 1PC5A 3KJVB 4KGMA 3HK2A 2D3UA 2R8GA 1GXLA 4KR0B 4P73A 1HBOB 2DNLA 5IM0B 3GSIA 5D4PA 2PI4A 3L7OA 3DYAB 4L76A 4DZ6A 2ZE2A 2Y0BB 3PX0A 2MQPA 3J80U 5KFJA 3D1QA 1L3SA 3BKUA 3IWNC 3CCLS 1DAXA 3PW5A 3DGPB 3HSGA 2DHSA 2W25A 1TKZA 2VIHA 3RB0A 4PUOA 4DHVA 2RAQA 1GT8A 5KT3A 5JMNA 4OYXA 4DV4F 5J2QA 2C3OA 1R8AA 1JKHA 2WONB 2ZC4A 2O66A 4M5DB 5M2PA 3TAMB 3K2YA 3VAHA 1AFIA 1UP1A 5HJXA 5K8MA 2POKA 3MD3A 4B9LA 3W5YA 1SUQB 2YKQA 5B0CA 2BKPA 2VFRA 3S1TA 2UXDJ 1ZM4A 1T9VA 1LV5A 4PWUA 4PYAA 4RPFA 2UUAF 1AYEA 2M7SA 1NZ8A 2HHQA 3CJTA 4A8XA 4ILLA 3ILIA 3QBCA 3BN4A 4B9NA 1QE1B 1RSCA 1FEEA 4YDXA 5KFRA 3GP9A 4A8QA 3IM8A 3HT3A 1KR4A 1T02A 3FEYB 4ZPAA 1M1KT 4TQSA 5CA5A 2C2KB 1S1XA 3FCWA 4UY8T 2BXJA 1M5VC 3C6UA 2HAFA 1I5OB 4OZ2A 3OSNA 4M5MA 1S4EA 1X5TA 4DQRA 2C2DA 1KVIA 4DMZA 2UU9J 5IWAF 3NS7B 3QGHA 1H3DA 1RAOA 3HD1A 3NXZA 3QIPA 2QG9B 1DTTA 2W2OP 2BJEA 4NXNJ 1DTQB 1MG7A 1RT4A 2EEYA 4RW8A 4ZVPB 4FS1A 3AXKA 3MR7A 3J7A1 4NLPA 4ECZA 3MR2A 2BX6A 1EB0A 2C2OB 4LR9A 2F9DA 4HH1A 2QSWA 4F67A 4D3HA 1YJTA 2ZNYA 3FC9A 1TKXA 2G9OA 1PYTA 4NRTA 5AJ3F 3CPWR 1LK7A 3OUYA 2J9DE 3V6DA 2XM3A 2RHQB 3D67A 2OPPA 4OYPA 4F8RA 1X0PA 3IC1A 3DRPB 2LCWA 2I0XA 2RVJA 4DZDA 4DV7J 3RRHA 4OHZA 1Y5LB 2Z2ZA 3I0RB 1YIJS 4DL7A 4OJHA 4IO1A 1SJ1A 4UT4A 5KFKA 1BC6A 5MAOA 1R0AB 3BPSP 4AE5A 4C0BA 3C15A 4F4KA 3MPWA 4U95A 5DM7Q 2D7SA 2VBYA 2QC3A 3D1OA 5IOLA 2VUGA 4N47A 3K59A 3F0NA 3H2UB 1S0MA 3P4UB 2HRYA 5K14A 5DETA 4A8KA 2NPFA 1RADB 2R4FA 4ED0A 3VAJA 2HQGA 3GFZA 4DX5A 1FTRA 3M1VA 4Q8FA 3B8HA 3MR3A 1PG5B 1S9GA 3WZ0A 3RTVA 5HL7Q 1J5OA 3FBEA 4DSEA 1J27A 2V2KA 1U0HB 5KFNA 1I1GA 4XIUA 2GJIA 2D74B 1DZ5A 2E66A 1UKUA 3RG6A 1Q81T 2YNFB 2G13A 3TP2A 4IFYB 4MK7A 3UDEA 1AZSB 3IMQJ 2WSCC 3OFGA 2VQEJ 4J9LA 4BC7A 3MMCB 1S9EA 3FSIA 1EJ7L 3VF0B 2B9EA 4HLBA 2FZKB 2MLYA 2UUBF 3ZTQA 3SCLE 1MU2A 3M32A 3NCRA 2V9WA 4DV7F 1WDTA 4AXJA 3J7AN 2OPQB 4H4KA 3KDNA 2XMUA 4NZ7A 3OPKA 2D9OA 2VA2A 4O3QA 1LW2B 4TN2A 1NAQA 2DB1A 3M8RA 1XBWA 4M95A 3VWSA 5C25A 1RT3A 2LP4A 1B7FA 2EBEA 3HVWA 3LOUA 1N5QA 1RT3B 3U27A 4F4XA 2M2BA 2IHR1 3AJ2A 3AXMA 4DN9A 2E9ZA 1L3TA 3GYXB 1NCLA 1Q82T 3HF5A 1UEVA 4HTIA 4RO0A 3RW7A 5IWAJ 3CC4S 3HKWA 2UVUA 2OFGX 3G96A 1W7WA 3A12A 3CW2C 1DY3A 3LPEA 3HVTA 4OHWA 1WJ9A 4DU7A 1YJ9S 4KH1B 5G4DA 4KFBB 2W9AA 2F4VJ 2HEKA 3MF5A 1OSCA 4QIGA 1HARA 2HS3A 3T9NA 2VG7A 3D2WA 2H5IB 2DGXA 3S6EA 5A0YB 3V81B 4LF1A 3AY0A 1FTCA 2G0CA 1QD1A 2ZEJA 5D0HA 3WQPA 1H2TZ 1N36F 3UNYA 2UUAJ 2RB7A 4QPXA 2UXDF 1OIAA 2B5JB 2RQCA 4FVMA 2B4VA 3DRRA 3I32A 3OTOF 2QO3A 3AA9A 3IS9B 3QWPA 1TK0A 1K44A 3E01A 3LH2S 3LP2B 4OZ1A 4Y28C 4ZVUB 4QU7A 4B9MA 3NWGA 2BANB 2W01A 2UZAA 3IP0A 4F0KA 2N4CA 4WCEQ 3GILA 4DV4J 4QU6A 2Y1LB 2ZBIA 3HFKA 2DJWA 3QGPA 2VASA 1IBCB 1UJ6A 3DOKB 3QWUA 1FD2A 1KEKA 4X4TA 4ED5A 4WKRA 2ZH6A 2HHSA 2B9XA 3HO1A 2W7AA 1V3RA 1SUQA 1NZAA 4RBUA 2VBZA 2QIFA 4JUZA 2BQRA 3UCGA 2MSSA 3GR1A 4J90A 4W4MA 2BKOA 5U47A 2GVZA 3IG1A 3O6QA 3PJXA 1SKUB 3O44A 5HBMA 5C5JA 3K17A 2XB2D 1FKOA 3HP6A 4UUWA 4I2PA 4KIAA 1W2BR 1M5OC 4NLOA 1QLNA 3KNAA 4ZITA 2XSJA 2DTJA 1F3VA 1VC6A 4USUA 1MWYA 5KG0A 4EO8A 5IV4A 1VQLS 2FJWA 3DNCA 5GADU 1JQGA 3MCNA 1S6UA 1HNVA 1IBKJ 4B9TA 3HZEA 3SSQA 5HO4A 2WVBA 4DWIA 2KT3A 2EVZA 1FNMA 2Z2LA 4FYDA 2WBRA 1KNZA 4HT5A 3KK3A 2MB0B 1NHUA 1IXKA 1RLCL 3EZUA 3H42A 4N56A 4RW8B 1JNRB 3KUHA 2M4MA 3FZBA 2LXUA 5J2QB 2XHWA 3DN9A 2FHJD 1V5VA 4H4MA 2Y0SD 5H1SV 3OR1A 1BGXT 2HGMA 3M6XA 2RU3A 2DR9A 3DLLQ 1SH2A 2G2YA 2V94A 4DL6A 1X0FA 3QT8A 2L08A 2VBWA 4ZKAA 3FEZA 1JLCB 2QMXA 3HHEA 5L39A 3J7Z5 4M5LA 2XLKA 3TZWA 3UDVA 3ITHA 2MQLA 3AB4B 3LALA 2HQ3A 3HX9A 3TW0A 4ZMMA 2IC3B 4KO0B 5ADZA 3OLBA 3RR8A 3PHEA 4FPIA 4WTYA 1LWFA 2M8HA 3SCIE 5LMNF 5E7OB 2FHJA 3UCZP 4P9SA 4OYBA 1WSRA 2LEBA 2YNIB 3IAS9 1SXLA 3CJ4A 2CJKA 4DQPA 4USTA 3HI9A 2NQPA 4DR4F 2D3O1 2K7KA 2C2RA 2VG7B 2HKEA 1KONA 3LA0A 4E0DA 2XYGB 3R5BA 1WC3A 1MU2B 3I96A 5DQIA 5E5NA 5KTQA 2HFOA 4N8OA 3CD7A 2FDNA 3LTOA 4NYOA 1HNWF 3ENQA 2K8GA 1WG1A 2VBXA 3AA8A 5DS7A 3JTOA 4B3RJ 2K2PA 2KT2A 3ILOA 4OX9J 4H4MB 4HDGA 5JVGQ 2BZ2A 2HSEB 3VV2B 3QT7A 3ENVA 2IYGA 3KJQB 4EK2A 4HHJA 3UDLA 2KFNA 2IM1A 2VPWB 3CIZA 4KB7A 5ETVA 2GHWA 1M90T 2AHOB 1UPMB 1C0UA 1IN0A 1FRMA 2GZOA 4PAAA 3UVJB 4KY3A 2J0XA 2AMCB 2VOOA 5I3PA 3NGSA 1NDLA 4JV1A 1PAUB 2RT3A 3MTKA 4C11B 1FA0A 1KLNA 1GNKA 5FLXU 1DBDA 3GMGA 2GQQA 4C0OC 3A3PB 3I82A 2BKNA 2XLJA 2I6WA 4WP8A 2QA4G 4ECTA 4B3OB 4UW2A 2APOA 4PG8A 1R8BA 2JEIA 5DDOC 4ED3A 3HSJA 2C2EA 1RI7A 4D3GA 1ZYQA 3V6JA 1TL4A 2JX2A 2HFVA 3EVMA 1QY7A 1Y11A 4FYYB 4OI0A 4IG0A 5F0WA 4O4GA 1RTZA 3KLGB 3K8VA 2GX8A 4QWCA 1OPIA 1TL3B 3AJDA 2F4VF 4LF4J 3A1YG 1RTDB 4RW7B 1CC7A 5A6WA 2HG4A 4DU8A 5HMXA 3V2UC 5F9LA 4X66F 2XO6A 2MZSA 3MR6A 4Y3CA 4Q7AA 2D69A 2PT0A 4QCLA 3M8PA 3LF0A 1U2FA 1XN9A 3GONA 3R5AA 4M5KA 2C3MA 4QIEA 5CZVA 5LSOA 3AD8C 2BEFA 2J0WA 1SPBP 1E6YB 1VHIA 6FD1A 4JP8A 4ED7A 3NEKA 4LRDA 4L75A 3EXCX 4XAKA 3R7NB 5DDPC 2PGCA 2MY8A 3K5OA 3G8TA 3EPIA 2GVZB 3IG1B 5HBMB 5DG7A 2MY7A 3L4BC 5KOXA 4JI6J 4K4ZA 4KPCA 1ZETA 3V4MA 1YSJA 1XMOF 2NPIA 2ZDOA 1H98A 1M5SA 1PBUA 3I9ZA 4OJGA 4RNHA 4YQWA 2HQFA 4OQJA 5KT7A 4F4YA 3PR5B 1VQ6S 3BGFA 1D8ZA 1Q78A 2ZE2B 2MQ8A 4DPXA 2IDEA 1T9TA 1Y7PA 1ZPVA 2CQHA 2CWKA 2QLWA 4IG0B 1H0HB 4YR3A 4DL4A 2VONA 1N32F 1MMNA 2B4PA 4ZPWR 1YLXA 1DURA 1TL3A 5CQGA 4F3MA 1Q8IA 1VMBA 3FMBA 4KPYA 3KFWX 4PQAA 4DSKA 1A9NB 4GO7X 5D0EA 4ZA1A 2FY8A 2JSXA 2P5VA 3PRDA 2AYGA 3KJFB 4NLRA 3NCPA 5J2PB 3SYZA 1GMWA 1KTQA 2DHGA 5A0YA 4ICLB 5LSRA 4XPEA 4FVCA 1PO6A 1QAXA 3KHRA 2UVRA 2HHTA 3MM8A 4J5OA 3SSSA 4IYQA 4ZN3A 3BN7A 3HHLC 4DR1F 1RXOB 3OL7A 3HVRA 4ID5B 3FVYA 1Q1KA 2RUSA 3BS9A 2ADBA 2GQCA 1NK4A 5SZTA 2WB1D 2CDQA 3KLFB 3KMSA 2XWYA 3KWMA 2J7WA 2ZWPA 2W7OA 1X5SA 2LECA 1F9HA 5J1EA 1RT2A 1VOMA 1TL7A 1RT2B 1S1TB 2F65A 2YWWA 3C8YA 2WOMA 5KFQA 4DV6F 3R1HA 1S72S 1T11A 2IRYA 4X62J 4O3RA 1UVMA 4LJMA 3QRRA 3FFIB 2BRKA 4K50A 1UVLA 4PPZA 1KQKA 2V8HA 3CCWA 4KV8B 3TJAA 4QYZK 4EFAC 1OYEA 4CNYA 4L72B 2CPZA 1N34J 3JYTA 1VRUA 3JTPA 1KFSA 1VRUB 1KQGB 1RE1B 1WKKA 1AXQA 2XNQA 3AOBA 3M2RB 2H3EB 3I5AA 1UCNA 3Q89A 5C7PA 3U1MA 1NB2A 2UUBJ 1QJHA 4ZVHA 1RTIB 2DIVA 5CD4H 2BMBA 3TJ9A 2W2QP 3ISZA 3OHAA 4ED2A 4JI0J 4NLGA 4UOHA 3UVJA 3A8KA 2KXHA 1RKIA 5J1NA 3V5RA 5KFAA 4CO0A 2OP5A 2PI5A 2JLGA 4UTGA 1AFJA 2X7IA 5FDLB 2PC6A 1U2CA 4J9NA 4KE5A 2RD5C 4X65J 3DC2A 3EGZA 2ERRA 4P75A 2HVIA 2VHGA 2BJ9A 2BM1A 1KHVA 4OMFG 4R25A 5E2QA 2XS2A 2O01C 4MFBA 4JI3J 3KG0A 1J5EJ 1BD6A 2HBQB 1VS3A 4FKYA 2AV5A 2B9YA 4EWTA 2R7RA 1RAAB 2CQ0A 2ZC3A 3OR1B 2XWXA 4IDKA 4DV0J 3RAXA 2DGSA 3AH6A 4P2MA 4J9KA 1CS4B 2W7PA 2A0FB 2BE7D 1X9SA 2PFFB 4DV0F 4NMLA 1HR0F 1FFSB 2EI5A 3W63A 1RB0A 1VYAA 2N7CA 2VPXB 4DCJB 2AJ1A 4ES1A 1P8GA 3FQKA 5F8JA 2V4JB 2DY1A 2HLTA 5ETPA 1JLFB 5KG4A 3GIKA 1FXDA 3VTIA 1IWAA 2GHVC 3IRXB 2AJQA 5L46A 4C3MA 1G1XA 1R43A 1N5VA 3OUYB 3ILLA 3UI3A 3V6DB 4MKAA 4YFUA 2B9WA 4JI0F 1Y5NB 1WI6A 2P6SA 1PYSB 1PJ7A 1OQ6A 2PO4A 4CLSA 1SKRA 3NP5A 2QGFB 3NOGA 4OZLA 4DDFA 2R42A 3KLEA 4WF9Q 1LOUA 3DHWC 2N82B 2EXUA 1U0SA 1N34F 4IDKB 3GJRB 1UTAA 2FC8A 1P1TA 2YNGA 3QGGA 3NGTA 2K7JA 1B64A 2HFUA 2VC1A 1C0TB 4TU7A 4ENOA 2J76E 3OVBA 1HNZF 3UW1A 1YBUA 2WW4A 4IRDA 2P9CA 5IQQA 2IA6A 3N4WA 2ZJQQ 5ETSA 2LQ8A 3IAM9 4DV6J 2E9TA 3D0IE 2WRMA 2AGOA 4LF9J 4LVNP 2YQ1A 4AUKA 5DLFA 4ETXA 1JIHA 4FKXA 1WORA 2C2MB 2ZUAA 4RUAA 6AT1B 1RTDA 4LRAA 3SDEA 5LXRA 1T03B 1T8EA 2VDIA 1S57A 4NA1A 2I2YA 3R97A 3CULA 3JXOA 3J81Y 3H7HB 3HFVA 3I56S 4WU3A 1HI0P 2MKJA 2ZH1A 3UN2A 2E7WA 2DVIA 3QAEA 5HK4A 2OKQA 1OQ3A 1ZOTA 2DGWA 1Q86T 2WSFC 3BR9A 1HHSA 1A7GE 2RS2A 1HPZB 4KHPJ 4C8KA 1ZZFA 3M30A 8AT1B 1QVFR 4MK8A 4U8VA 5HLFA 1BQNA 3JSYA 3L7UA 3QFWA 2CPFA 1S1WA 3VCDA 2OHDA 1BE4A 2V4RA 4NA2A 5KFLA 3LO3A 4LF5J 4HEA9 5AXKA 1V6HA 2MKCA 1T05A 1NJXA 2XMVA 4C0HA 8ATCB 1FRJA 4UY85 1FVSA 3PX6A 1U8SA 3R8YA 3M1VB 4R8UA 5K8PA 3VQTA 1VI7A 2ZKUA 1S9FA 1DQ8A 3BDPA 1YK9A 4M63A 4RWWA 5HAOA 5IZHA 2UV8A 4X84A 5GMKa 3LWLA 4J91A 2YH1A 2OD6A 4F2SA 5F3ZA 2JFDA 4JI6F 3MMJA 2X1BA 3QAUA 3IXQA 4RBTA 1SL2A 1I94J 3NMAA 3CGIA 1YBAA 4WE1B 4NZ0A 4WFAQ 4K4VA 2KTQA 1FFGB 1TL7B 2N3LA 5E0OA 2V5HG 3P49B 2HVDA 2MKSA 1H2VZ 4YB6A 2FQQB 2J5AA 3PNIA 4NCAA 1XQIA 3TRGA 2YBVA 4HT7A 1D9FA 1Y0HA 3TEGA 2BJDA 5T41A 1HPZA 4ZCLA 3WBZA 2N7YA 1LFPA 3S7RA 1TAQA 4CLFA 5GAHI 4X66J 2DNYA 2PE8A 4YUDA 1JXLA 4DR2F 4F2RA 4Q2MA 1H72C 1TKXB 1NK6A 2B4UA 1DQ9A 1RWPB 4MH8A 4URQU 2HYIB 1B3TA 1SQFA 1X4BA 2PEHA 3CCTA 1SH3A 4OYMA 1U2RA 3CDWA 3FMWA 2FLNA 2MXYA 1JJ2R 1SL1A 2IJRA 4RW4A 4J9QA 4DLEA 2BQUA 2XMKA 3GV5B 2XZDB 1YX2A 4L74A 3C6TA 2EC0A 2C3PA 1VFJA 2YKNB 4O3OA 5B0DA 3H2LA 1FERA 1GX6A 2AKWB 1NSQA 2W2NP 2YKMB 1GAOA 2I8EA 4C3LA 5DM6Q 3K57A 2J9DA 3G8SA 2ZJRQ 5HANA 3ISNC 3IRXA 1XIQA 2DY9A 3OXGA 1YRUA 4USMA 2HRUA 3BZQA 3I9V9 1GH8A 1B7YB 2Y1JA 2MHEA 4GVBA 4EU0A 4Q0BB 1WEYA 4A46A 1RKJA 1DLOA 3S01A 1R0CB 3HHKA 3SEOA 4WK3A 2LA6A 2J8SA 4QW8A 4J9SA 1VBKA 3NGUA 3FBBA 5KAKA 2KB2A 1EX8A 3QIDA 4OX9F 3T6JA 5T14A 2R7WA 4X2BA 2EFOA 3DLGB 5B0BA 2DISA 1F0XA 3KLIB 1EKSA 1GMWD 1ZM9A 1TTHB 2R8IA 3POTA 3VAIA 2N4DA 4PXDA 4B9SA 3LAMA 4Q2LA 2PD1A 1C1CA 2CKWA 3Q22A 1N5TA 1JLFA 1HWLA 4N41A 3D6HB 1K1SA 1UW4A 1IKWB 3OFHA 2XC9A 3CCUS 4IQXA 1IKWA 4DEZA 4ZLJA 1Y3JA 4F4ZA 1BQMB 5KT2A 1XMBA 4ZCMA 1VLOA 1W25A 1P1LA 5F0UA 4A4JA 3VAFA 2BJ7A 1YJNS 4KJIA 4LMZA 3CCQS 4IOBA 4NX9A 3T41A 1SJ3P 2MQQA 3CCSS 1CJKA 2OPRA 3BGUA 3CMQA 3GR0A 1ZS6A 1NH7A 1RLDA 2HQIA 1C4CA 3C16B 3EPGA 3ELHA 2IIHA 3UQSA 3CJ0A 4BLGA 3T3FA 3R2CJ 5A8RA 2DGOA 3W62A 1LNQA 3TUPA 1RTJA 3CMAS 1VJWA 4KT0C 2HW3A 3IR7B 3PZPA 2CQPA 4JV5F 1TKZB 4PUOB 2E9RX 3O3LA 3H40A 2ADCA 4IR1A 1JLGB 1FRIA 4CLLA 2E1MC 1PCAA 4RW7A 2KN4A 2YNFA 2HHUA 3BBFA 4I6AA 2W4DA 4MIBA 3LUYA 4NRUA 2ZUGA 4H4OB 1V3ZA 5CYMA 5D6GA 2J9CA 2PDAA 2CPDA 4FBTA 3BDEA 2CJAA 3UD3P 2CJYB 2NREA 3FGVA 4NEZA 1U1NA 5F8LA 3OD2A 2WVDA 2I9SA 1KP6A 1X4AA 3IR6B 5DDQC 4P10A 4X4OA 4JI1J 4ID5A 4E8UA 2AGPA 5C2GA 4P74A 3NBPB 4FBUA 1FXRA 3PACA 3MAAA 4R0EA 2AQ4A 5KG1A 3Q0AA 3DOLB 3I55S 3H98A 4FNHA 3N0VA 3C16A 1T3OA 2DEJA 2PA3A 3EXYA 1ZAWA 4KGKA 1SJRA 4LBHA 3DYAA 4MIAA 1S1UA 4OYAA 3TWZA 4DI6A 1XMQJ 4C8OA 3BBBA 4HI2A 2DR5A 4JI8J 2QX0A 3M6UA 3A8EA 1FF2A 2ALYB 3QMQA 1JNZB 3A8JA 4CM0A 4CT8A 8RUCA 2KVIA 1FXLA 5DGBA 1V9OA 4R0JA 3BYPA 1TL5A 4K8RA 3MEGA 3UR3C 3RBEA 4FF2A 5HVFA 2HBZB 2M52A 3CD0A 4ICLA 3QYYA 1O51A 4ECXA 2KRRA 4I2PB 7FD1A 2CNLB 3D0GE 1U1PA 2PN6A 3Q83A 2KL8A 5HJYA 3NAIA 4EBCA 2QA2A 1UVJA 2DXFA 4IO9Q 3MMCA 1S59A 3P45B 3MM6A 5LM7E 3RB4A 4J9OA 5IC4B 1RU2A 1IR1A 3CEDA 1TK8A 1X4HA 3MM5A 1V3SA 3C15B 4A8YA 2WSEC 1YQHA 2HHHF 2GQ2A 4BDPA 2Q6BA 4ZPDA 1KD1T 1PJ5A 1ELOA 1ULRA 2JVRA 3B78A 1CULB 4DUTA 3EZOA 4QPTA 2NCKL 1RT6A 2QLBB 2AYBA 4QIFA 2JC0A 3BBCA 5KFGA 2DHHA 2RJZA 4Y65A 1RT5A 4KH0B 3DMJA 3G8QA 4DN0A 4X64F 3E51A 4TU9A 3G6YA 1N0VC 3D66A 4C4WA 1PKUA 3QATA 2CJXB 4QBUA 4KC5A 4MKBA 1J2VA 1KFDA 3GZ7A 4CIOA 1UWBB 1OWXA 3EVOA 4V1Ak 3O1LA 5ITHA 1WTFA 3KK2A 1JLEB 1UJ5A 4X4RA 1B0PA 1NXIA 4LF6J 4Q45A 5KFTA 4J9MA 1SVDA 1Y10A 2ACMA 2E29A 3UDCA 2RDDA 3I0RA 4ITSA 3D3CJ 1D0EA 4ZP8A 1QSSA 1RT1A 3W7BA 5IV3A 1S48A 2OUGA 1Y4ZB 1VQYA 1S1VB 2VQEF 1RT1B 2Z2YB 3N6NA 4WXOA 5HP1A 5EGYA 5KT6A 3QNWB 2M70A 3C14A 1U45A 1RYSA 3E01B 2DYAA 3LP2A 1KOOA 1HD1A 1SV5A 2N3OA 3A13A 3DRRB 1ZBTA 3NMRA 1CS4A 1XR5A 1X8DA 3PV8A 1X7VA 2FLLA 2H65B 2AYEA 3U7JA 5AE1A 2DD8S 2IM0A 4DR6J 2CADA 4B3MF 1PC4A 2F8EX 1WEXA 2V2QA 3GTYX 3M7VA 1ZTWA 1FX4A 2VB6A 4FN5A 4DSLA 3SCJE 3CTRA 4RW6A 2CJ9A 3FUYA 2Z57B 3SCKE 4CO5A 3QJJA 3PHTA 3KK1B 2WVEA 1UMJA 2V8PA 1GQEA 2DKOB 2V4JA 4NLYA 3AJ1A 4X4PA 2W4CA 2GGPB 2XQCA 3ZZRA 2AJFE 4BBYA 4LFBJ 2XGPA 1CSJA 3AAWB 3JQKA 5BYQA 1T9WA 3Q8SB 5CZXA 1WC1A 4LF6F 3HSZA 3J81U 2YPZA 2QE5A 4J37A 2A18A 1RWMB 4K4YA 1O5JA 1HD0A 1NK9A 3MMAA 2CJBA 2F5GA 4LT6A 3B4MA 4WPAA 3NBPA 5EDWA 4K5RA 2YX4A 5AJ3J 2XY7A 2QT7A 1H6KX 2KI2A 3HHLD 3NAHA 3I0SB 1M5HA 4I64A 2LYVA 4CM2A 3DOLA 5I4MA 4NPOA 3Q23A 3CCJS 3IBFB 2DR8A 3OL9A 4QR1A 1RWOB 2GNKA 4UQGA 3EZ5A 4C8YA 4NXNF 1XR7A 3PG9A 4KHRA 2FUG9 1UEUA 4PXCA 4GC7A 2A6OA 2GIRA 3DLJA 1B4SA 3KG1A 2HHHJ 4KHMA 1NM2A 4OLOA 1AW0A 2E5LF 1XNRF 2IM3A 2IC3A 4ILRA 3OVAA 3PW4A 4CT9A 3OBIA 4X4UA 4Y0FA 4I4BA 1VK3A 1ZAXA 5SUHA 1F6TA 2QLJB 1T9YA 5KFUA 1HBMA 2YH0A 3W9JA 5ETLA 3MAHA 2E5IA 3NOCA 1M1HA 3M2UA 2MKIA 5J1PA 1DFDA 3QQCD 4FP9A 5D4LA 2RIJA 5KFDA 2MDAA 3WX8A 4ANCA 4F26A 3TX8A 1FCAA 4QJVA 4DPUA 2IA0A 2CAJA 1R0AA 3SXLA 4CP5A 3EE3A 4I6YA 4WTOB 5LT5A 4OYIA 3SV3A 3GPAA 1F5BA 4ER8A 4DR3J 5D0RA 2C1EB 1SCJB 3C14B 2KO1A 2R7TA 4TYBA 4Z7CA 1TP7A 3JSRA 2LQ9A 1UWAA 1SV5B 3VGSA 1PJ6A 3EICA 3PFOA 3PO4A 4ANEA 2EKYA 3H8YA 1XMQF 1QTMA 2NXEA 2G2OA 4NLTA 1Z2ZA 2QEXS 4X4VA 2PMWA 4OX7A 4I68A 3PYDA 2OEMA 5M2RA 4DL5A 1N6QB 1QAJA 2H5JB 2OPSA 3TQEA 3MUTP 4OI6A 2VDHA 4F4WA 4DFKA 3OTBA 2NXUA 3QLHA 4LVOP 3C6TB 1FK9A 3VZHA 4URGA 1TUGB 1SJ4P 2JOQA 1Q7YT 2P8IA 3MPVA 3CC2S 3DRYA 5J2NB 3TA2A 1TV6B 2BVZA 1CPZA 3BQ2A 2KYXA 2J0QD 2CVEA 2VKZG 2W8KA 4K59A 2G0JA 3JQMA 2Z8QA 3H5SA 2A3JA 4KFBA 3TO8A 1VBZA 3OV7A 4ELUA 1IM4A 2OMLA 3JQJA 4I2QB 4KAIA 1Q5YA 4LIWA 2M9KA 2ZJPQ 2A6MA 2V9KA 3HSDA 3GIIA 1FJGJ 2CQCA 5HQMA 1HNXF 4ALZA 5ETKA 4EBDA 1LKZA 1ROFA 1D8YA 1RHQB 2Q6CA 5HVHA 1S6QA 1XJWB 5L9NA 3DLHA 3OXLA 2KYZA 4MT1A 3SFUA 3QO9A 4Y00A 3ZZUA 5LMUF 3W2WB 4BC9A 2BBEA 5C25B 3W61A 5EHHA 2ZH5A 2DPIA 1UFWA 2E1PA 4PKDB 4M5DA 3GIRA 1SH0A 3D3BJ 1RGVA 3NL0A 1FESA 2Y1RI 2VC0A 2J8AA 4G1PA 5D4OA 1QVGR 4PQUB 2CPIA 2A1BA 3TZZA 1H38A 3D54A 1WG5A 4DPTA 2LDIA 4NLVA 3FSXA 5IQ6A 2UXCJ 1Q79A 1TQLA 3MOZA 2VG6B 2ILYA 4ES3A 1SBRA 1KBRA 2V67A 1FWLA 3CE8A 1FRKA 3I5CA 3MMBA 3OJSA 3MFHA 3LWMA 1TKDA 2CG8A 2MPUA 3DI6A 1NJYA 4Y2AA 3TZXA 4UOGA 3KJVA 1VQ5S 2DIUA 5H9EK 4RJVA 2R2SA 1TR0A 1RHKB 2AD9A 1D9DA 4DV3J 1B99A 4WE1A 3QJPA 3MCOA 2V8VA 2BDPA 2AJ4A 1REVB 4DG1A 4NASA 4KSEB 2ILZA 1S9GB 2HZAA 4GVLA 2DGVA 2FC9A 5ETOA 1T0TV 4CH7A 4CTAB 1UA1A 3D5MA 5L9XA 2NZ4A 4USHA 2HFZA 2MJUA 3F41A 4N5SA 2CVIA 3GFYA 2J6SA 4AQYF 2O1PA 5EUHA 4OYWA 2M88A 2CRLA 2ZDPA 1KHWA 4QW9A 5KFHA 3HXMA 3PKMA 1QTNB 2KM8C 2XS5A 5E3RA 2UV8G 3NNAA 3G86A 3V4IA 2C42A 1SIZA 2NXNA 4UZBA 3UCUP 1FE4A 1WOPA 1BQMA 4ETZA 1KVJA 4DSJA 4NXMJ 5GVQA 3JSMA 2KRBA 3GG0A 3W2VB 4RZRA 3GE9A 4IUFA 4F3QA 3ICLA 4RUHA 1YDLA 2ZBPA 3WC2A 1N33F 5L1KA 2LU2A 2QFJA 3FJ2A 2Y9HA 3RRGA 1FRHA 1K73T 1VGYA 3LGNA 3H5YA 3DU5A 4OZNA 2YWKA 1F5CA 2GVDB 3DKDA 3BGRB 4IOAQ 5CHCB 1H73A 3DM2B 4TNOA 4PXBA 4HH0A 5K14B 5A76A 4M94A 5EN1A 3RUBL 3PYFA 2ASLA 4WFXA 2M8DB 2GV1A 3EJMA 5EWGA 1HWUA 1U24A 3R7BB 5ETMA 5T7LA 1MW7A 4OJ1A 2C22A 1Y9OA 3CJRA 1URRA 2Z0GA 3O8WA 3W2WA 2LMIA 4GMKA 1VQMS 2BRLA 2OI2A 2OD4A 3R5GA 1S10A 1K9MT 1S0VA 3VZIA 3M2VA 1HIYA 1SB6A 2DH8A 3GCXP 4JB8B 1C1CB 5K9FA 5DQGA 3PKYA 3DRPA 3KLVA 5CH7B 4BWJA 4A8MP 3RYLA 4B3TF 2GO9A 5RUBA 1NMEB 2RHSB 3JSBA 5E3CA 2P9GA 2CA9A 2YQ3A 1ZPWX 1HKAA 2BUNA 2W9BB 2QMWA 1TV6A 2R7SA 1TUWA 2YXLA 3SMZA 2F3JA 4OZ5A 1RBLA 2IAJB 1NDCA 1A6LA 2GJFA 4GKKF 3JS9A 2PMZD 3FEXB 4KRWA 2HAIA 2GW8A 1Q53A 3QIPB 4LF5F 3L95X 4KYZA 4RNNA 4G1IA 2Q1LA 4DS5A 1CJTB 4NEYA 2WCXA 1IQZA 2YKAA 4WFYA 4ZP6A 4DF4A 3CSKA 1OMSA 4ZVRB 4RNOA 2W9CB 2BQ3A 4YB1P 3TA1A 1IKVB 1JJHA 1UJ4A 2B51A 2W9CA 2VPYB 4H54A 2RDJA 2UP1A 4I69A 3MZIA 2MKKA 1TAUA 3OQ2A 2BM0A 3POTB 1X4CA 1DRZA 3MM6B 1IKYA 3W9IA 1YRXA 3M6VA 3BSNA 4AD6A 3NKYA 3OXFA 4J7CA 3GWCA 3W60A 1WHVA 4U7CA 3PYGA 2WHOA 2KG0A 2FB0A 2KHDA 3Q24A 3A3OB 5KG2A 3G9CA 4DV1F 5KG3A 1VRQC 5K8OA 2DT9A 2L9WA 2W1BA 2F40A 1M1GA 3LGHA 4PG5A 2F1FA 3MEEA 3VAKA 1HYSB 4Z7YA 2AJ2A 3MCSA 1CG2A 2QSFA 4CO2A 2VFTA 3WIUA 1C4AA 2E1AA 2X51A 4Q44A 5D3GA 2RSQA 3QPIA 5DRKA 4PG7A 1MWZA 4HVZA 4L73A 1MLAA 3AFGA 3GSDA 5CYQB 4PCQA 1Q95G 4UUXA 1GXTA 3NG8A 3GJQB 4F3OA 3UR0A 3CJ8A 2K3KA 2AYMA 3R1LA 1EZZB 4RUCA 3KOAA 3FSYA 4RW9A 1BWVA 2YY3A 3SBMA 3KK1A 2VD3A 1TKTA 2VQFF 1HQ2A 4B9UA 5HN0A 3CDUA 3RRKA 3TOQA 3KHHA 1LWXA 3LP1B 1SIWB 1MROA 1S9EB 4Z2XA 2V0NA 1JLQA 1HBUB 3W65A 4YR2A 4JI4F 1MROB 4NYPA 4DBQA 3CMES 4WZQA 5KG5A 3ET6B 5J2PA 1Q8BA 2KJWA 2LLZA 2YKPA 4DX6A 5IS2A 2HNYA 2F4FA 4RKUC 4UF4A 5FDLA 4PWDB 2FVPA 1E6VB 1AROP 1NPKA 2BJ8A 3U1LA 4DL2A 1L3KA 1Y3KA 4JYAJ 2E5JA 2L48A 3ETOA 2QZ8A 1YJWS 2L3MA 4Y2IA 4XDCA 4DX7A 1GEHA 5CAAA 1HR0J 3I87A 4F50A 1HBNA 1PGZA 2UUWA 4I0WA 4DV2J 1VQ4S 2HK3A 4OFZA 3M30B 4AXIA 2FY1A 5ETNA 3GLJA 2OJ3A 3OLAA 2MSTA 5KFVA 4DLGA 4NCBA 1F9FA 3IM9A 1PILA 4LF7F 4XTTA 4U6PA 4RW6B 4P7TA 1RABB 3GV8B 1YHQS 2HS0A 2B0GA 2CZVC 5HROA 4R8UB 4JYAF 2FIUA 3IWXA 3DGVA 3UD5A 3M8QB 4J9UE 4RU2A 3TA0A 4ELVA 3J7YI 4G3IA 3MI7X 2F9JA 4KGXB 4Y2MA 2Z58B 4K2JA 1WKJA 4JI4J 3IBCB 4ZCKA 2JFKA 3DCAA 1EETA 3FZ2A 4FF3A 4CQ1A 2NLWA 1YWXA 5HSPA 2VQFJ 2I1RA 3HHLA 4TQRA 1KLMA 5LSLA 3DDNA 1QE1A 2MTLA 1MN7A 2CIMA 4N77A 5ETTA 3EGVA 2SXLA 3B54A 1RTJB 3VR1A 4QWEA 1JLAB 3F73A 1U49A 4LBPA 3KLEB 1IR0A 3GV7B 1B0TA 3ILJA 2IAJA 1S12A 1FJEB 4P2FA 4CDIA 1FEHA 4NOHA 4TXSA 7FDRA 3E2EA 3M9MB 3H5XA 3B4DA 1WF0A 1HQEA 1U1MA 2AEFA 3TAMA 1QAIA 3DOKA 3HMJG 1DTTB 3GYNA 3KYLA 1RAGB 3MPUB 4B02A 7AT1B 2L41A 2J9EA 4DQIA 4NLDA 2Y8WA 5IXUA 2KDOA 4QOTA 2DRAA 2NZCA 4NZ6A 1EQMA 2EFQA 1EQ0A 1VQPS 1S97A 4EYIB 4Q43A 1TVRB 2HBRB 2XZTB 3MEGB 1H7XA 1NO8A 4K5SA 3WHIA 3W2VA 2XSJB 2QFIA 3TUJC 4K4XA 3KMQA 3IR5B 1MN9A 2CPHA 2VF3A 3N6LA 2VPZB 1RHJB 1VLYA 2DGUA 1RA6A 4UZCA 4B3SF 1GMUA 2YKMA 1X9MA 2CNNB 3KHLA 5KG6A 1WC4A 4ZHRA 1YG0A 1NB7A 2UXBJ 3JAMY 2FJAB 2WB4A 4OI2A 2XI3A 4JI5J 1I94F 2HWTA 1R8HA 2H48B 4KKOA 1N6QA 4FZVA 3TVKA 4WZMA 2FGOA 2O3DA 2AX1A 3DGPA 2HWHA 3HT0A 2MYFA 3OTCA 1FNOA 1RT7A 2OSRA 1S6PA 2LXFA 2JNJA 3I6PA 1IBMJ 4GKJJ 5JUMA 1NNDA 2RQKA 2BANA 1R0BG 2OFHX 3BREA 3HLUA 2F8HA 2VKRA 3HULA 3I4PA 3LAKA 1T05B 3F56A 5E41A 5HMZA 2RF2A 1HWIA 3PJ9A 3PIPQ 4ANDA 9RUBA 1L5UA 3SSRA 1K0VA 3OL6A 1FNXH 1U0HA 1C0UB 2CZ9A 1XMOJ 4DV5F 3GCWP 5D0GA 2V8DA 4IH5A 5B08A 3D9BA 4L3KA 4LSLA 2H1YA 3GFHA 2DHAA 2J7KA 3KUGA 3LW5C 3MAAB 4X4QA 1FO1A 3D4JA 5DZ7A 4B3TJ 4B3SJ 5DG9A 2OEJA 2V68A 2JDJA 3RR7A 4DOZA 3PO5A 1R6VA 4YP3A 3C19A 3J7YU 2KJVA 1N5YB 3DRSA 3RBDA 2FTRA 4CH0S 5G0RB 2B8QA 4PPDA 3UO0A 4KKOB 4OI4A 2CNOB 1HQUA 2G1HA 3CCZA 2KKHA 1BQXA 3ZZYA 1H7WA 4L6V3 3TQ1A 1Y00A 3G4SS 4LF4F 2DH9A 1XK8A 2ACYA 3FKBA 1RZMA 3HZGA 2U1AA 4MTPA 2CJQA 2Z56B 4O23A 4DG1B 4OIXA 1NJWA 2FVSA 3KTQA 2RMLA 1BWEA 1JLGA 4NA3A 5C42B 5GAGU 3BB5A 4DX8H 1SC4B 3ZTOA 5GAEI 3EYZA 1ICEB 1XR6A 2Y3YA 2I5JB 1R31A 2JLEA 1GX5A 2JHEA 2EK6A 2QYCA 1S76D 1Z1ZA 1JLQB 2GIQA 3AQPA 3TR5A 4NXMF 5JJBA 3BH6B 3FCHA 5K5MA 3CDAA 5HVGA 1JLCA 1BLUA 1JWWA 3K7RA 4LRBA 4RR5A 2KZMA 4ZVTB 3M4XA 5HMYA 3DLEA 4LR7A 4WWSA 4ED8A 3TAPA 1HHQA 2ZVIA 1S77D 4FPRA 4EGLA 1R27B 2ZFHA 1VK8A 3VQSA 2AIRB 3W5XA 1CJKB 2G0IA 2OPRB 4USVA 2RNEA 4EEYA 3D0HE 2ASJA 4USWA 2FJVA 1D3WA 4DFPA 5J1EB 4DUZF 1GTHA 1GMVA 4ZN1A 4TLQA 3ZC4A 3RW6A 1X4GA 4F36A 2HVEA 2R7QA 4YR0A 1XTZA 3EGNA 2O5DA 1NSKL 3MEDA 4HHUA 3QZ7A 1YJVA 2E1RA 4NLSA 5BYRA 4MAKA 4UOFA 4C48A 4F4AA 4WKYA 2HHVA 1K0TA 2QL7B 1DTQA 5T7LB 4DV2F 5AXMA 4A8OA 2ALZA 1DHMA 1G7CB 1RWVB 1G3OA 3PEJA 4M8LA 4UQTA 4ZVOB 4W90B 3HHDA 4C8MA 2JLFA 2OO4A 4C97A 1EP4A 1Z4UA 2JRSA 4IG3A 3DDIA 3K8WA 3KXDA 4DR4J 1T94A 3CJQA 4CWBA 4DL0C 3P5BP 3PIOQ 2DNZA 1ZZNA 1QSLA 4B3MJ 5GAEU 4YN3B 1OPZA 2AF6A 2OEKA 2QYGA 3FK4A 5ETRA 4C7QA 2UXCF 3ENAA 4R5PA 3J80Y 2JEFA 5DQHA 1UFKA 3IS9A 3CJKA 3T1AA 3ZFVA 1RWXB 2EG1A 4ZPVR 4AFFA 3PW0A 3QRPA 3AOCA 1JJCB 4I56A 3TARA 5DG8A 4DSFA 1RU1A 2D41A 2PIIA 4P71A 3E3XA 4RLEA 2YNHB 2CQ4A 1WELA 3FQLA 3HJVA 3QSIA 2W2MP 5LMUJ 3HVAA 1KDNA 5DGAA 2IJFA 1S1UB 2C3UA 5L1LA 2DNHA 2NXJA 4U7UK 4Y34A 2COLA 2VG5A 4ZPBA 1S0NA 1M5KC 2BV3A 3PFEA 1HMVA 1WF2A 1OY6A 2HGLA 1DLOB 1LXJA 4LBIA 2VOPA 4DUYJ 4CO3A 1C1BA 3M8YA 1FX2A 2MLZA 5A8WB 2EFNA 2WONA 2BE9B 4NYZA 4PR6A 5A8KB 2ZBRA 1KQFB 1U47A 3NNCA 1ZA2B 1NPPA 2FZGB 3UN3A 5C42A 4LREA 1HBMB 4YB5A 1KOHA 2ASYA 4HR2A 4IFYA 1AUSL 2I5JA 3I4HX 5LJ5Y 4DV1J 3T5JA 1HL6A 1M5PC 1MNEA 2F63A 4ECVA 3ETMA 2NYIA 2KXNB 4TY8B 3ZTSA 2NUUG 3ZTPA 2B4OA 5EX3A 4LUBA 4RNMA 3R5DA 3W8GA 2OPQA 4FXVA 3UN5A 2LU1A 5CCLA 2KG1A 3WX4A 3OHBA 1FJCA 3QRQA 2CG4A 1HYSA 3AD7C 2CQIA 4WXWA 5KFXA 2MQMA 5LOQA 3BF4A 4LFCF 1FHTA 5KFPA 4P2SA 4U96A 1TELA 4CYUB 2FVCA 3HM9A 5M2UA 1PYOB 2ZHAA 3NRBA 3VAMA 4DR3F 3PRVA 2RUGA 3NLCA 5CYQA 2X3DA 5HQ8A 4E98A 5CABA 1A0OB 2XZWA 4I6WA 3OTOJ 4LQ3A 4CI0B 2B56A 2Z30B 3P8BB 1LQ9A 1LEOA 2VJUA 2B6AB 2AWZA 3NY0A 2GS8A 5IT9U 3L7PA 3D28A 4NL5A 4PABA 3VGTA 5KFIA 2ZH9A 1X4FA 3ET6A 1JJ4A 2RRBA 2C3YA 4NI2A 2ZWOA 3KG4A 3RBXA 1VIXA 5H9EJ 3MEKA 5DJBA 4USIA 4DCOB 1RHRB 1N5YA 1T7PA 4PYDA 1HI1A 2FGCA 2VG6A 2MQOA 1I3OB 4WU2A 3C46A 3NNHA 3TVZA 2PSZA 3LANA 9ATCB 2EFGA 3BGLA 3MMAB 3AOAA 3MPDA 3CDEA 3TX0A 1IUJA 1EKRA 2RKIA 1VQOS 1HA1A 3VAGA 2HHXA 1F1BB 1RWNB 3CJSA 2DNGA 3R5JB 2M5YA 4PG6A 1LWCB 2P2CB 3K0JA 1QSYA 1F9EB 3HPOA 3K5PA 2OTJS 4O44B 4ZPTR 2DNKA 4FYVB 5E3AA 2EC2A 4CLTA 2ZH3A 4KO0A 2XG8A 1RISA 3NWRA 3SZ2A 4MMOA 3ISND 3CJ2A 2AJ0A 3WIVA 5C24B 3X1LB 3Q2SC 3RU0A 4C8ZA 1KWMA 2WVCA 3FRYA 1UA0A 1RUSA 2DXDA 2D3ZA 2YX1A 2ZOFA 3L09A 1NU4A 2CWXA 1VCTA 2A2CA 2EBGA 2LQJA 4O0NA 2BR0A 1NRKA 4JI7J 1WHYA 3DU6A 1GFWB 4LFBF 2CPYA 3MXHP 3BV8A 5IT9Y 1VBYA 2E44A 2IDLA 1OO0B 5D8HB 2NR0A 2GMJA 2MZQA 1R6YA 3J7ZT 2BA9A 1GK8A 3U1NA 5H9FK 5DZ6A 2MKYA 5KFSA 5KFYA 4DR6F 2HQCA 3PCOB 2BJ3A 2HIYA 2RRNA 2IFXA 4WYWA 1CULA 3OJUA 4ZP7A 3MUMP 2OAUA 1O6XA 4ZVQB 1RAJA 2BACA 3MGJA 4E2FB 5B09A 1G4CA 1N0UA 4PXEA 4XK8C 1YRTA 5KFCA 2QRRA 3HHNB 2ASDA 1EP4B 1RT4B 2LA4A 4ED1A 4MKVA 5B0AA 4ECWA 4KBIA 4J9PA 4DPOA 5B7WA 4DV3F 3G6XA 4RW4B 3J81j 4LF7J 1V5IB 3DLEB 2XI2A 3QLHB 5F8MA 2VA3A 4M5JA 4Q5VA 3PEHA 3V6KA 1VQ9S 1ZTTA 2KFZA 3OR2B 1ZA1B 1O8BA 2HNDB 2XLIA 1JK9B 1TKTB 1IKXB 3M2UB 2ATLA 3HHLB 3LP0B 2DNPA 3GQCA 1AZSA 1RQ0A 1M0SA 3O5TB 4FF1A 3W5ZA 2IRUA 3CF5Q 2CQBA 2FLPA 4PRFA 2WOMB 2DR6A 4C8NA 3T19A 3OW2R 3MM5B 3T1YJ 1FDAA 1HWKA 2R7VA 4MJKA 1YITS 4HL9A 1UVNA 4O3NA 2HQDA 2X3GA 3GFXA 4M5GA 4DR5J 1XC9A 1F2HA 5GAHU 4IRKA 3PW2A 1LW2A 3Q2TC 1S6PB 1RWWB 2QL5B 2O67A 2UU9F 3T5KA 4KV8A 2CYYA 2D9PA 1HFEL 2F8MA 4TY9A 5IFMA 3VALA 1FKPB 1UZHA 3PX4A 1HNXJ 4EZ6A 1X9WA 2IBOA 2LDYA 2ZD1B 4ZCIA 2AEJA 2IPOB 3TI0A 3SI8A 1U7LA 1N4LA 2HNZA 3JSMB 2C28A 4JV0A 4WK1A 3ZNUA 2ZM6J 1TFYA 4GO5X 4BCAA 4DXLA 3FBFA 4JBCA 3PTWA 3KLFA 5HLFB 4UOCA 1HI8A 1FDNA 3WC0A 2G2ZA 3BYRA 3LP0A 2AU0A 3R5CA 4FYXB 3W1YC 2IVYA 5F8IA 2GGPA
chains in the Genus database with same CATH topology
3IBWA 2VH7A 5G0RA 3DI6B 2WK4A 5DLGA 4QR2A 4C8LA 4I2QA 3TUZC 2DHXA 2KM8B 1IBLF 1WTBA 2ROEA 2RH3A 5F3TA 2B3TB 5A8WA 4QYRA 3BSOA 2HIQA 2JL9A 5LXYA 4CTAA 1N48A 2MKHA 1UWBA 1SL0A 3QO9B 1I6JA 3T9ZA 3SV4A 3ZZZA 3PW7A 2XS7A 4QIWD 1U26A 1F60B 4H4OA 2HGNA 2FJBB 2OPSB 3G6ES 1JLBA 2IBKA 3IN5A 5D4NA 4OLPA 2ZNZA 2XY6A 3L3CA 3BM7A 2GCFA 2VL1A 2XULA 3V6HA 1S1VA 5HP1B 2VODA 3W3SA 2B7CB 3MTJA 2MMYA 5I42A 2OLWA 2ZM6F 4IR9A 2RU9A 1UAWA 2CFXA 2XCAA 1GXUA 1KS2A 2GMLA 5KT5A 1F2GA 3SQGA 2NSCA 3MR5A 3DMJB 1C2PA 1YI2S 2OH2A 2X1FA 2CPJA 4ECQA 1JMTA 3C2PA 1S6QB 3MEDB 3MHYA 2Y1IA 2XMTA 3MDFA 1TUVA 3G6VA 1WI8A 4EO6A 4DR5F 1N8RT 5FLXY 1K1QA 2MHNA 3LPYA 3T1YF 2ZHOA 2XNRA 3FDSA 1R7IA 4Y6IA 2EK1A 3M8QA 4IG3B 5AE2A 4WFZA 4PWDA 1YJRA 3N5FA 2DO4A 5HI7A 4ECYA 4B3OA 1FDDA 1FK9B 2R8KA 5KFMA 3KLHA 4V19J 4MYUA 1FJ7A 4QR0A 4EEYA 1S1XB 1S99A 1HNIB 4ATNA 2DNMA 2HLUA 3CT9A 3SFGA 1SJQA 1KLMB 4DFMA 2V8GA 2HZCA 4YY3F 1REVA 1OSDA 1QM9A 2I38A 3UPFA 1LK5A 4O0IA 2OMOA 2YVSA 1U1LA 3TUIC 2G1DA 2MGZA 3LGMA 1URNA 5KFOA 3CVKA 1HBUA 4EUVA 2XCPA 5J2MA 3DXBA 3RB3A 3TVYA 3QGIA 2JC1A 3DXSX 3OTDA 1PSDA 1D1UA 3MM8B 3US5A 1FKPA 4TLRA 4N76A 2FHKA 6FDRA 3CJ3A 1G2EA 2ROGA 5BR8F 4JI7F 4TYAA 4ZVEA 4OJ3A 3TNVA 2JEGA 3CC7S 3CCES 3EUNA 2MZJA 5GADI 2YNHA 5IT4A 4DFJA 1N54B 4OV1A 2KHCA 3EGWB 2BE2A 2JZ5A 1TL1B 3OVSA 1MSWD 5MLCV 2LKZA 5D3GB 5EWEA 2DCLA 4ZVFA 3HJFA 3HKZD 3QZ8A 4K4WA 3JYTB 4ECSA 1R3NA 2IM2A 3BJYA 2CQDA 5A8KA 5K8NA 2UVVA 4QWDA 3BSCA 3DLGA 4ERDA 1U6FA 4RWXA 2FLOA 4HTJA 1S49A 3GG1A 3IO1A 1D9AA 5HMWA 3M05A 2YNIA 2JWNA 1HNVB 1RWUA 2Z2MA 3K5MA 5FJ4A 3DHXA 2E1CA 2X1GA 2K3IA 1MMDA 3T5HA 4OX6A 3MMBB 4BHQA 2K1RA 2KU7A 2RRAA 4FXWA 4RU9A 5I3QA 2YNGB 4NLQA 3IA0A 1NHVA 4V19X 3AHPA 3N5BA 3ZZ0A 3DM2A 4F25A 2IJNA 3H59A 2DR7A 1VIOA 3M6WA 4JI8F 3KHGA 4ZDNA 5KFFA 3HDSA 3G71S 2YKOA 2LQ5A 2IVFB 1R8CA 3M8PB 3UNGC 3MURP 5F8GA 4AL7A 2WAQD 4JI1F 1LWEA 3M9OB 1WWHA 3BQ0A 2B5JA 1NEEA 2DNNA 2GC8A 4XPCA 4I67A 4K4UA 2RKIB 2W9BA 3X3UA 2DBBA 2P6TA 2GA7A 3LQVA 4G1QB 4DUYF 4HYKA 2HVZA 4YHHF 3PY8A 2HS4A 1TL1A 2KZZA 5AXNA 3PDNA 2HFNA 3FFIA 4P7VA 5JVHQ 2VFSA 4HKQA 4C2MA 1CEZA 3AQOA 4YMEA 1VC5A 5F8NA 2RQMA 5E33A 3OL8A 1NKEA 1ZM2A 3BO2A 1Z2LA 3DLBA 2EWHA 2KT5A 1RK8A 5I3UB 4A8WA 1LWFB 1VQSA 3UD4P 3M2RA 3V81A 3DDKA 3DRSB 1HW9A 5CXTA 3MAQA 2R7OA 1U1RA 3MECA 4NCGB 3MECB 4NCGA 1DJ0A 4MIWA 1F5AA 2WTFA 4XDDA 5A8RB 3PRBA 5IT0A 3I0SA 3BEGB 2ZZMA 3PJWA 2R7UA 4ES2A 3F44A 2PMHA 2RILA 2J0SD 1OS5A 3BO3A 3OFEA 4B08A 1BQNB 5D78A 4NWBA 4XO0A 3KK3B 2A2DA 2MZRA 1SKSA 3MM7A 1S1WB 1Q16B 4LSLB 2QA4S 1K8AT 4C9DA 3UE2A 2H9ZA 2GO8A 3C66A 2DNOA 3IFEA 1FRXA 1TVRA 1X4DA 4TU8A 1C1BB 4JOUA 5DO2A 3ZZOA 2Q43A 3I31A 4X65F 3CXCR 1TFWA 4IOCQ 1YTYA 1KRPA 4ED6A 1HW8A 4ECRA 2E7XA 4FNIA 1TK5A 3JB9k 1VQNS 4IFVA 5L1JA 3DLKB 4FXDA 5J2NA 1NH8A 2Q3PA 2V4QA 3FRZA 1O0PA 2FPHX 4YEAA 1S1TA 3U02A 1KTVA 4TY8A 2B43A 2ZKTA 3JTNA 4CO1A 4ZHRB 3TQ1A 2NSBA 2WBMA 3I5BA 2NUHA 1S97A 2UUTA 5EX0A 5E3PA 2W8LA 5B0FA 4K4SA 1KC8T 3H25A 3MEEB 4LSNA 3PR4A 1ZM3A 2LVWA 1RT7B 3B82A 4X62F 2RQ4A 3KLIA 5H9FJ 1XWLA 4OL8A 5AE3A 1RYRA 2RS8A 1NK5A 1Q7LB 3AB2B 2MZ1A 3CCRS 1S0OA 2DH7A 1JLEA 2IMOA 5KOWA 2X1AA 1IKYB 4Y2KA 2CQGA 3IGVA 3NGDA 2A10A 2CPEA 3CD5A 5CCMA 1FDBA 1WG4A 5C24A 2CQ3A 4C98A 1DARA 5BJRA 2LEPA 3HVTB 1AUDA 1YGYA 1U48A 4F02A 1TZ0A 3C6UB 5EWFA 2Q66A 5KFWA 3CCVS 3CO9A 1RTHA 3O2IA 2P9EA 1U6ZA 2QLXA 5IM0A 1GTEA 4OZ0A 3MM9A 3SQGB 4EYHB 1U4BA 1IJEB 3H2VE 1IBMF 4GKJF 3CWJA 1SQEA 4A48A 2ZH8A 2R7XA 4A47A 4KQZA 4I7FB 4MKYA 1X4EA 1JKHB 2IYIA 1LFWA 2DITA 4PG4A 2R9LA 4KHPF 2EFVA 3T5LA 1XERA 2YWGA 4JI5F 1H2UX 2VZ9A 1APSA 2UXBF 2J7UA 4FF4A 2U2FA 3QJLA 2L9DA 4C11A 4LQ9A 1P27B 4OHVA 3R27A 1NJIT 3P3DA 2UVWA 1E6VA 2XEXA 4LIRA 2YWEA 3FNNA 4ZS6A 2ZOGA 4NLWA 1HWJA 2D1CA 1P6TA 1NJZA 1FE0A 1RA7A 2ZITA 4IFVB 1NKBA 3THPA 5BYSA 4B17A 4DF8A 1ZAVA 1Y5IB 4JV2A 2JJ4D 4LF9F 3PM9A 1IJFB 4A8FA 2VFVA 2DK2A 1FKAF 3BSAA 4JI2F 4MK9A 3DOMA 3GIJA 4DSIA 2VG5B 3RB6A 4NLXA 2B6AA 4IQMA 5CYMB 2YTCA 3D1HA 4CNZA 2IRXA 1UVIA 2FJEB 2W4PA 2LEAA 4QWBA 3UFCX 2CQ1A 2PA8D 4ID8A 5L38A 4AL6A 2HNYB 4IH6A 2RF2B 5FD1A 4H4KC 4A8SA 2LXIA 3CB4A 2AGQA 5F41A 4R5PB 4ZLPA 3ENWA 4DL3A 4ZK7M 1HNIA 1U1QA 1SJFA 4K2XA 1T95A 2VFUA 1VQ7S 2CQ2A 3H4DA 4ELTA 2HHWA 2FVQA 3P96A 3CD6S 4WIIA 1FT8A 3IRWP 2FHOB 2GFFA 1NKCA 2HHPA 1RTHB 4URSA 2R2RA 3CCMS 5B0EA 2MQNA 1U09A 1RT5B 4KTQA 3MM9B 1U6BA 4ZOSA 2OIHA 4LSNB 1UETA 4FS2A 4J9RA 5F9NA 1IKVA 1FKOB 1N88A 3OR2A 1J5EF 3GB0A 4N8NA 3KK2B 1RP5A 4JI3F 3TYTA 1VQ8S 2DNRA 4DR7F 2HVHA 3K5NA 1Q8LA 3R3TA 2KH9A 2MJNA 4EBEA 4IH7A 1JLAA 2QV6A 1L3UA 1WEZA 4U9RA 2K1RB 2FJDB 4K0KF 2DNQA 1WD6A 4YDDB 2W24A 1P9QC 1YVFA 1HHTP 3IGNA 1ZH5A 2ROPA 3N79A 4K4TA 1UFLA 2WW8A 3DFEA 5LJ3Y 3CUNA 1HBOA 1S79A 4MYTA 4OHYA 2XMWA 1W2IA 1WHXA 2MZTA 4O44A 3N28A 5A2QY 2E5GA 5KG7A 4CZCA 4L3NA 4O4GB 3KLGA 1WNEA 3WDOA 1KSPA 1WF1A 2JH3A 3ZZPA 5HROB 1RTIA 4ECUA 1IQTA 1T3NA 3H4BA 3DLKA 4IRCA 2CPXA 2YWHA 1FRLA 4CH1A 2UUCF 1XEZA 3P6YC 1Q4RA 4ZPCA 2G4BA 5KT4A 3RZAA 3NS6A 3M2VB 1N5SA 2XMMA 3BQ1A 1WHWA 2XBPA 1JB0C 2DRBA 4EZ9A 2Q79A 3Q8QB 2XSFA 4CCHA 1JXEA 3RAQA 1N52B 3N01A 3MOJB 2J6TA 1DQAA 4G6VB 3ITHB 3Q8RB 3PVXA 3BGRA 2ZD1A 4WFBQ 5F8HA 1CLFA 4DS4A 2HMIB 4RW9B 4WFNQ 1B0VA 1VC0A 2HMIA 1HMVB 3RAMA 4O4RA 2KXFA 4B9VA 3CDBA 4QYZJ 4GC6A 4RBVA 3H20A 5I3UA 3K5LA 4OX8A 2ABYA 3SDEB 1T03A 5J2MB 4X4NA 1VRTB 1VRTA 2EG2A 3THTA 2R8JA 2M3DA 3V4IB 3KKFA 4HDHA 4TKTA 4Z37A 1LXNA 2AW0A 4C3KA 1HQUB 2Z4PA 4U67Q 4Q8EA 3KLHB 1N56A 1X5PA 1CVJA 2GJ2A 5B0GA 3S8SA 3M8SA 3EX7B 1VQKS 3KNGA 3NCQA 4G1QA 4BS2A 1QAYA 4I7FA 3OSPA 1HQEB 2VV5A 2XGQA 2KFYA 4PQUA 1CQNA 4DJBA 3TANA 2AX0A 3Q8PB 1S6OA 1R8PA 1E6YA 2DPJA 2BYCA 1QUVA 2ZHBA 4DQQA 3M9NB 1J5OB 4M1KA 3MD1A 4BWMA 2RDIA 3N6MA 2DGQA 5CYJA 2ZH7A 5L1IA 1FD8A 2XY5A 4ZVGA 1IKXA 2RE1A 1EETB 3CJKB 1RDRA 2OPPB 2HNDA 5AXLA 1NK8A 4O3SA 4OI1A 2ZBCA 2EPIA 3C3LA 1G6BA 5LL6d 1L3VA 2ZOMA 2FD2A 2NS1B 1VHFA 4IKAA 5JXSA 1U1KA 2IMWP 3BR8A 4OZJA 2JEJA 4Q0BA 1LWEB 4AYBD 5THWA 4W92B 2XMJA 2YX7A 3TAQA 4USJC 2DCUB 2R2TA 3E8OA 2DGTA 4QIVA 4DQSA 5DDRC 1RT6B 1X5OA 2CZ4A 3ONQA 4I1TA 1CQMA 4NLUA 3NS5A 1LW0A 2R8HA 2ZH4A 2J6UA 4WYLA 4B3RF 1HBNB 1LW0B 5KFZA 1KN6A 5D77A 4ILMA 1KQSR 2FHMA 4QZVB 1C0TA 4QWAA 4CO4A 2AP6A 3BO4A 1JLBB 2BW2A 3T6BA 2E5HA 4O3PA 3ULHA 2R2UA 1U1OA 2FVRA 2GHPA 3OFFA 2YKNA 2OSQA 2HNZB 4Y2CA 5KFBA 1S4FA 4HI1A 1QUPA 4WJBA 5I42B 4OHXA 4MFBB 2F7VA 2XO7A 2BOPA 2GMHA 1YJUA 4OI3A 3MWBA 3NGKA 3GIMA 3MFIA 1MMLA 2BABA 1RJJA 2M0GB 1U25A 1UVKA 2L9NA 1R89A 2MGZB 3UWTA 2B7BB 1SC6A 4LFAF 1LWCA 4RNFA 5E3QA 2IVMA 1S7HA 1NK0A 3OTEA 3ZZTA 4YOEA 3CIMA 5L8RC 3THVA 2YWFA 4QQBA 5GAGI 3PXGa 1FJGF 2EFPA 2ZVSA 3CJ5A 3LP1A 1NK7A 1WACA 2EW9A 1FVQA 2ZH2A 5A6PA 5KFEA 2HPUA 1IBKF 3N9UC 1UL3A 3P5TL 3M32B 2DO0A 2HWIA 2LQBA 1BY9A 4YB7A 4ZP9A 2D3OR 1NB7A 2QA1A 1CC8A 3H5UA 5FIIA 1T7PA 2H5EA 4P6QA 4RX6A 3DRXA 1VBXA 1SI9A 3MPYA 2BE2B 3IWLA 2JVOA 4AL5A 3MUVP 1PC5A 3KJVB 4KGMA 3HK2A 2D3UA 2R8GA 1GXLA 4KR0B 5IM0B 1HBOB 2DNLA 5D4PA 2PI4A 3L7OA 3DYAB 2ZE2A 3PX0A 2MQPA 5KFJA 3D1QA 1L3SA 3IWNC 1DAXA 3PW5A 2DHSA 2W25A 1TKZA 4PUOA 3RB0A 4DHVA 1GT8A 5KT3A 4DV4F 5J2QA 2ZC4A