2LQ9A

Solution structure of the k60a mutant of atox1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the K60A mutant of Atox1
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Copper transport protein ATOX1
total genus 9
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lq9A00
1TR0A 2XMWA 5B0FA 2GV1A 1KVJA 2OFHX 2KYZA 2HIQA 5A6WA 1OPZA 1QUPA 1Y3KA 2FB0A 4NPOA 5T7LA 2BYCA 2FTRA 4DPOA 4HI2A 5B0DA 2CRLA 2AJ1A 3FMBA 2GGPA 2GGPB 2OKQA 3HHLC 5B0EA 2OD4A 2W4PA 3TNVA 4Q2MA 4QOTA 2OAUA 2K2PA 2RMLA 1VQSA 4Y2IA 1S6UA 2GO8A 2RU9A 4Y2MA 4YDXA 4OJ1A 5K9FA 1YJRA 2LXFA 1MWYA 2K7KA 2PGCA 2XMUA 3BDEA 1W2IA 4OJGA 4A48A 3E8OA 2L3MA 1YRXA 2W4CA 1X8DA 3HHLD 2XMKA 3BR8A 3LO3A 5T7LB 4EFAC 2Q3PA 1GXTA 2KT2A 2W4DA 3FGVA 2LQBA 3BB5A 2ROGA 2XMTA 2EW9A 3F44A 4NL5A 3UDCA 2GCFA 1N5VA 2QIFA 2ROEA 1LQ9A 1JWWA 1KVIA 2N4DA 2K1RA 2AW0A 2KT3A 2OFGX 4OJHA 1SQEA 1CC8A 2ACYA 2HQIA 4DL0C 2BUNA 3BF4A 1YJVA 2FIUA 3MCSA 3VTIA 3CJKB 4HH1A 1U7LA 2HLTA 2KKHA 3K7RA 4ZOSA 1N5SA 2ASYA 1OSDA 3HX9A 1X7VA 1AFJA 2OMOA 3WDOA 5KAKA 2XMMA 4F67A 5B08A 2BJEA 4HL9A 3QGPA 5F0WA 4A46A 1TL5A 2ZDPA 1CPZA 2RILA 1N5QA 1P6TA 3TRGA 3BM7A 1TL4A 1SB6A 2JDJA 1KQKA 2N7YA 2AJ0A 2QLWA 2K7JA 3T9NA 1CC7A 2IYGA 3DCAA 5B0CA 1FVSA 1WD6A 3FRYA 4A4JA 2FHMA 4FNHA 5B0GA 1IUJA 3KNGA 1FE4A 4HH0A 3IWLA 3HDSA 4ZA1A 2XMJA 1YG0A 3BN7A 1TUVA 1RJJA 2VV5A 4OIXA 2BBEA 2LQ9A 5IXUA 1JK9B 1OQ6A 1TZ0A 1FE0A 2OP5A 1AW0A 1YJUA 2LDIA 3HHLA 1V3ZA 1FVQA 2AP6A 3TOQA 2QYCA 1SI9A 3HF5A 3GZ7A 3QMQA 2ROPA 1URRA 3I9ZA 1R6YA 5B0AA 2QLXA 3HHLB 1P8GA 3LGNA 4A47A 4U9RA 5B09A 3LGMA 1APSA 1AFIA 1S6OA 3KKFA 2OD6A 1GXUA 2PD1A 2N4CA 2BJDA 2RSQA 2G9OA 2IFXA 1Q8LA 1ULRA 3MZIA 5F0UA 1Y3JA 3DXSX 3HFKA 2HFNA 1X0PA 3KG0A 1Q4RA 1Q8BA 2GA7A 5A6PA 1MWZA 2K1RB 2ZDOA 1FEEA 1FD8A 4Q2LA 4OJ3A 1XBWA 1FESA 3KG1A 2VH7A 4HI1A 2HLUA 1K0VA 2IYIA 4YEAA 3CJKA 1YJTA 2HFOA 1OQ3A 1Y9OA 4DN9A 4FNIA 3BGUA 4Y2KA 2GFFA 2XMVA 1N5TA 1VQYA 3IWXA 5B0BA 1Q53A 1Y0HA
chains in the Genus database with same CATH superfamily
4X66F 4I2PA 3ZZUA 1VIXA 3LPYA 1X4EA 3PFOA 1GX5A 4YQWA 1TUWA 5A6WA 3OVBA 2DT9A 3FBCA 3QSYB 2CZ4A 3PEJA 3K8VA 3OR2B 4L74A 3MXHP 3G8TA 4PPDA 5KG4A 4ZVTB 1TKXA 2YH1A 2ZC4A 1RU2A 4Q43A 4G1QA 2OGUA 4KO0A 2XI2A 5KFIA 1TVRA 3R1LA 1FTRA 4QOTA 1PKUA 5SZTA 2ZFHA 3MTKA 5L1KA 2DR9A 2AGQA 4NI2B 3O5TB 1JLFB 1SC1B 1EB0A 1YJRA 4IOBA 2VA2A 5K8NA 3DOKB 2AV5A 1T9TA 3L95X 1NH8A 3T6JA 3PIOQ 4OHVA 3NGRA 2Y9HA 4JV5F 2JC0A 3UN2A 3OR1B 4LFCF 2V4JB 5A8RB 3KUHA 2PEHA 1BXNA 1CBKA 1H0HB 1A0OB 2MJNA 3OFGA 4EBDA 3M4XA 2CNLB 4BLGA 4R8UB 5IS2A 2FVRA 3PV8A 1X9SA 3QJJA 1LXNA 2MZSA 2HHQA 3TANA 1NK0A 2HBYB 3TUZC 2HFUA 1NSAA 2QYGA 3BREA 4F7VA 1JQGA 1IM6A 2RQKA 3UI3A 4DZDA 3PX4A 3UWTA 1NEEA 2YKAA 5AE1A 4ILMA 4X62J 3MHYA 2HNDA 5HMXA 3V6DA 3P3DA 2DBBA 4PR6A 1CJVB 1GEHA 1WC1A 3RGIA 3SFUA 1S0MA 1WI6A 2V8VA 3KDOA 2HHTA 2GIQA 4LSNB 2OMOA 2V9KA 4NLYA 2EFQA 2QFIA 2XMMA 3ENAA 2RKIB 5LSRA 4JP8A 4B3TJ 4HL9A 1TL5A 3GQCA 4LR7A 2KVQE 1VC6A 4JI0J 1HYSB 3KLGA 2VASA 1ZPWX 3I9V9 5KG2A 1M1KT 1H2UX 1RTDA 2JEFA 4J9OA 2JDJA 1H74A 4KFBB 3W9IA 1T7PA 1GMVA 3KLIA 5HQMA 1NK5A 4M5DB 1QAIA 1GAOA 4RW9B 2YNFA 4DX8H 2Y0SD 2MQNA 3C8YA 2OPPB 1DHMA 3QT7A 2HNDB 3P96A 4FNHA 4KHMA 3M05A 4LJMA 5GVQA 3O1LA 4QW8A 3K17A 4ILLA 1H73A 1EETB 2KJVA 2Z2YB 2DPIA 4B3SF 3I56S 4OI3A 2BM1A 5KG5A 4TY8A 4USUA 2V2VA 2QN6B 5HI7A 1FFSB 1HBNA 4C11A 1K47A 1OQ6A 1O51A 3HZGA 2DHSA 1UWAA 1ITPA 4P7VA 3M8QB 1FO1A 1RAIB 2CNKB 2DGQA 3HSDA 3MM7A 4L3NA 4DV4F 4IKAA 3IMQJ 2OIHA 4DSKA 2PEBA 3J7YU 3CEDA 4P7TA 3ADAC 3AJ1A 2UV8A 5L9XA 5LJ5Y 3NGDA 2VG7A 3QYYA 3BYRA 3RRKA 3OBIA 5BYSA 3D68A 4L3KA 4WFNQ 4DR1F 3UPFA 5KT3A 1X4BA 2ZBRA 3BR9A 2UV8G 2D3ZA 2DNNA 4KH0B 3PW5A 3H42A 4LVNP 1LW0B 2GQCA 1C1CB 2CPJA 3CD0A 4M5GA 5HAOA 3PRVA 3MFHA 2VJVA 4LF7J 4FF1A 2IRXA 1S10A 3OTBA 4MFBB 5A6PA 4KQZA 1XNRJ 3OUYB 1RTZA 3AD8C 1FTCA 2CZVC 3GSDA 1BE4A 3MAAB 5E33A 1KNZA 2ILYA 2YNIA 2ZE2A 4URGA 2Q66A 4KH1B 3P5BP 1KLNA 3IA0A 2ZM6F 3SBMA 2W2QP 1VHIA 4J9MA 1FWPA 2DGOA 4YS2A 2FC9A 3VAGA 1VRTA 3BZQA 4DR1J 3QIPB 1SL0A 2FLPA 4PG6A 2KYXA 2ZHOA 2W8KA 1N34F 2V68A 5KFTA 2DO0A 2QL9B 5L9NA 1VJWA 1B0TA 4PWUA 3QLHA 2R2UA 1FRXA 3R7NB 1LFWA 5ETMA 3SSRA 2XLIA 2F65A 2CA9A 3ET6B 4EMDA 7AT1B 1HWIA 4M5JA 1AZSA 2L9WA 4FVMA 1VK8A 4KV8B 5K20B 3I96A 3ZTRA 3WZ0A 4DPOA 4XPCA 4YR0A 2ZM6J 2I2YA 4C8LA 2RHQB 4A8KA 2G1DA 1KD1T 4NLQA 3MWBA 4Q2MA 4TYAA 1U09A 1F3VA 3UDVA 5HMWA 4Y0FA 2MGZA 3ULHA 4ZS6A 2ZHAA 1TK0A 3GV7B 4FF4A 4Y2IA 4M1KA 3H2LA 1ZM3A 4DG1B 3VAMA 2QV6A 3CJ0A 2C42A 3TUJC 3CB4A 5ETTA 1MWYA 2DY9A 3ZZTA 3W9JA 2QC3A 1KP6A 3M8SA 4PXBA 5DGAA 1WI8A 2J0QD 2J6SA 1PCAA 2ASJA 3PW4A 3NCQA 1MNEA 3LO3A 2R4FA 1UEKA 4OLPA 3FGVA 4PG8A 3MM5A 3QJPA 2LQBA 2EFVA 2HGNA 2GZOA 1RDRA 1PC4A 2ROGA 3NGKA 3QGHA 4NLWA 4OZLA 5DJBA 4RNNA 4ECZA 1FXDA 2LXUA 3R5AA 3G6XA 2ZBIA 3QBCA 4C8KA 1IBMJ 2EXUA 1FNMA 1QY7A 4PCQA 3W2WA 3MAAA 4UZCA 2OJ3A 3NL0A 2QLBB 3TR5A 2CQ2A 3MF5A 4GVLA 3V6HA 2C2RA 4Q0BA 2KFZA 4IFYB 2ZKTA 3FEXB 3V4MA 2WSCC 2GAHC 4HH1A 3TAMB 1FXLA 4ZHRB 1SL2A 4KIAA 5BJRA 2LEPA 1FDNA 5KAKA 2CQ0A 3CJSA 1IBLJ 4YB1P 4DS5A 3K5MA 1NBEB 1OPIA 4O4GA 4RKUC 4HHHA 2VFSA 3NWRA 5A2QY 2CXEA 1S0VA 4NWBA 1FRIA 1SB6A 3PRDA 2QX0A 4IR9A 3K0JA 3IBFB 4PKDB 3ISNC 4YDDB 4C2MA 3G71S 2AEJA 3NLCA 4DR3J 4URQU 2D3OR 3HKWA 3W65A 2IA0A 4J9LA 4DPYA 1GH8A 4A8XA 3QT6A 4AXJA 4DXLA 3K2YA 3MI7X 2ZJRQ 3BH6B 3G6VA 2DD8S 4ZVEA 3PYDA 4QQBA 4RZRA 3SCIE 3PO5A 3CO0P 4OYPA 2HRYA 3ZZZA 5A8KB 4J9RA 2CVEA 5FLXY 3CDAA 4OV1A 5HROB 4F26A 4WYWA 5CAAA 1GT8A 3KYLA 3PX6A 5GAHU 2G4BA 3HHLA 3KJNB 3IM9A 3POTA 3V81B 2GJFA 2WVEA 3BKUA 3KLGB 2IY5B 1RP5A 3BBFA 3NGUA 1JLQB 2IBOA 3DDKA 4LF5F 5B0AA 1VBKA 3LW5C 3QFHA 1NZ8A 2QLXA 1XR6A 1HQ2A 3PYFA 1AROP 3IR7B 2E9RX 5CD4A 3MMBA 3RW6A 4FYXB 1XTZA 4KHRA 3J81U 4NASA 2XMAA 1TV6A 2DPJA 1WSVA 3I4PA 4U6PA 4TQRA 2H48B 2IRYA 2CJAA 3OTCA 2ZJQQ 5I3PA 1JXVA 3NS5A 3PIPQ 3PW2A 4HI1A 3GFHA 4LVOP 1NK9A 1FRKA 1EKSA 4DV5J 1YJTA 4R0EA 5IWAJ 4C9DA 2JRSA 2LLZA 2V8HA 3SQOP 2HK3A 1K1QA 3HFZB 4I6WA 4ZPAA 4JI4F 2IMOA 2MSTA 2DVIA 2JLGA 5KG3A 1C0UA 3DOLA 4ZPVR 4WKRA 4MK7A 1Q53A 1JLBA 4QYRA 5HK4A 4NX9A 2BABA 4E98A 2DNQA 1NU4A 2IDLA 1WKJA 2OPQA 4OHWA 3BN4A 2HQDA 4OV6A 2PO4A 2HNZA 2V9WA 5CHCB 4CO4A 1G2EA 1R3NA 2L08A 3A8IA 3GIJA 4DV4J 1UEUA 2KO1A 1XC9A 3PKMA 2NQPA 2QEXS 1KTVA 2AJ1A 4DMZA 3D0IE 1NSQA 3RAMA 2COLA 4S0MA 4ED4A 1CQMA 3PY8A 4RUHA 3TAQA 5DM6Q 1HI8A 3D1OA 2VU5A 4ZN1A 3H5UA 2E1MC 1UW9A 3L3CA 3CIMA 4CO3A 2HRUA 1X4HA 2W7PA 1YK9A 1KFSA 4YOEA 2BA9A 1UMJA 2A0FB 3CJ2A 3M8ZA 1YRXA 5KFVA 3D9BA 4FKXA 2H4WB 3D0GE 1SJRA 3FK4A 2U1AA 3W64A 3WIUA 4CH7A 1GXTA 1HWKA 2KT2A 4LF9J 3D3CJ 4QBUA 1VLYA 4USHA 1D3WA 2V8DA 1SKWA 1HD1A 2MZRA 3M2RB 1MLAA 4JI2J 1OMSA 3CDBA 3TAPA 4IQXA 4KFBA 2XBPA 3FCHA 4ZLJA 4PG4A 3U1MA 1GTEA 3T1HJ 1HL6A 2EVZA 3O2IA 1YJVA 2VG5B 2YKNB 1C1CA 3KG4A 1UETA 2GQQA 3DOKA 3T6BA 3VTIA 2VF3A 3GIKA 1ZH5A 3NRBA 2AJFE 5LJ3Y 1OSDA 1M5PC 2RQ4A 4M5IA 2VQFJ 4LSNA 1UVMA 3GWCA 1JXEA 1PILA 4G65A 1VMBA 4CLUA 2CZ9A 2Y0BB 4F67A 4CT9A 3JTPA 4MIAA 4C0HA 2ZZNA 5F0WA 1M1HA 4C97A 1R0AB 2G13A 2UP1A 1LWCB 5EUHA 2Z57B 1NPKA 3GFXA 1WHYA 2XSJA 3RBXA 5B0CA 4LUBA 4ZP8A 4K4SA 1WD6A 2Y8WA 1EARA 4AD6A 1Z2ZA 4IH6A 3AOBA 1IKVB 3PNIA 1IKXA 2BX6A 1Y4ZB 3D28A 3HD1A 4M5MA 3U1LA 5HP1A 2UXDJ 2YWKA 1GMUA 1UJ6A 4OI4A 2NCKL 3JAMY 2B0GA 3W1YC 1LXJA 5E7OB 1SKSA 3UCUP 3P8BB 1VQOS 3SV3A 1NPPA 2EG1A 2GHVC 4FXVA 5HVGA 5HMZA 3L9ZA 4DQRA 5J2MA 1EIYB 1IWAA 5KFHA 1S97A 1VC0A 1ZS6A 3VQTA 5CCLA 4ILRA 1FVQA 1T9VA 4OMFG 2HFSA 5J1PA 1U1LA 2EG2A 3QT5A 1YRUA 3BGLA 4UT4A 4TLRA 4ECVA 1SBRA 1U02A 2UXDF 2EKNA 3M2UB 5ETRA 3A3OB 1FERA 2D69A 2H65B 3HHLB 3POTB 3V81A 2C3MA 1R8PA 3HHKA 3EX7B 3D1HA 3TUIC 2X1AA 1VS3A 4I2PB 4WP9A 4ITSA 2G9OA 4UTGA 3KJVB 2PN6A 2PA3A 3UCGA 2YPYA 1J5OA 3M6XA 2HBRB 1NNDA 1RWOB 2AHOB 4X65J 3T5LA 2HVDA 4YR2A 3LP1B 4JI8F 2HVIA 3CCMS 2BQ3A 5CYQB 1CJUA 4MK9A 4R8UA 4MTPA 2RQMA 1J27A 4I69A 2VHGA 2DIUA 4PYAA 4UY85 1XNQJ 4IH7A 1UP1A 1T9XA 2ZOMA 1N5TA 1VQYA 3FQKA 3PDNA 3R9LA 4PWWA 1U1RA 5H9EJ 4W92B 3SCKE 7FDRA 2CIMA 1T03A 5KFMA 3M8RA 4GO7X 3GG1A 5FD1A 1PJ5A 3PRBA 2PMHA 1SIWB 2V94A 2ZD1A 2O5DA 1TKTB 1TVRB 1EP4A 2OPRB 3MMJA 4P6QA 4USTA 1WG1A 3OTOJ 3M9OB 4WJBA 4LF8J 5EWFA 3CE8A 2NXEA 1NHKL 1KRPA 2RAQA 1U48A 4DR5F 4DUYF 4EI2A 3FSIA 2R42A 2X3DA 3AY0A 4YDXA 1G4CA 2I38A 3KXDA 3UDLA 2ZWPA 1VQKS 2HHSA 3DDNA 1NB2A 2IM3A 1I5OB 2HQ3A 2HAIA 3G8QA 4CDIA 2XY6A 4DR4F 4UY8T 3J7AN 2PFFB 4WXOA 3CC2S 4QIVA 3R1HA 4WFXA 3LANA 1T8EA 1A9NB 4NCAA 4NLXA 2C2DA 5F8LA 2DHXA 1SC4B 5GAGI 1MWQA 1I6JA 3MGJA 2P9GA 4ZVUB 2DK2A 2C2OB 4WIIA 1BMQB 4WP3A 2MKKA 1R0BG 3A3PB 3S01A 1ZETA 1QUVA 3GV8B 3MAQA 2VC1A 5LM7E 4DV3J 2KT3A 2FJEB 2J8AA 1M5KC 2R7UA 2IBKA 4CLLA 5IQ6A 4I56A 1EQ0A 3BF4A 2C28A 1RACB 1MROB 1RBOB 4OX6A 1GNKA 2R7TA 1DTTA 2DXFA 2OPSA 4C0BA 3T1YF 3EPIA 2UZAA 2CJ9A 3AT1B 3IAS9 3NS6A 4N47A 4OYIA 3RU0A 2XGQA 4GC6A 2HHXA 3PO4A 3PTWA 4RUBA 4LF7F 1WACA 3P5TL 3N9UC 3HZEA 1X31C 2CQ3A 3KJFB 3CCVS 1FKOB 1AB8A 5CZXA 3OVSA 5HSPA 3M30B 4NZ6A 2B6AB 1JLAA 4LQ3A 1UZDA 2E66A 1VLOA 3FQLA 2KU7A 1NPRA 3EZOA 3DMJA 1MU2A 1NAQA 4A4JA 2NREA 4F8RA 5DQHA 2RU3A 2GHPA 5AJ3J 4FZVA 4MIWA 3JSMB 3L4BC 2ZZTA 1F60B 4P75A 2HQCA 2WW4A 1ZAXA 1KHWA 2XYGB 4G6VB 2IVYA 1QSSA 4PG5A 1BD6A 2B9EA 3AB4B 1Y10A 3MPWA 4BWJA 2UUAF 1N54B 4U7CA 5GADI 1WC0A 3KMSA 3SDEA 3CWJA 5KFXA 2W9BA 3MR5A 3ICLA 3K58A 1HQUB 3I31A 4QYZJ 1SXLA 3F41A 1HBNB 1SKRA 3TOQA 3PFEA 3RRGA 1JJHA 2QT7A 2OUGA 3HF5A 3QT8A 4USJC 4X4RA 3IRXB 2OEJA 3JAMU 3B78A 4ZVSB 4DPWA 4GC7A 1IN0A 2VUGA 3LGNA 3N01A 2Y1JA 1U1PA 2GQ2A 2KVIA 1D09B 2CAJA 2YNFB 2A6MA 4ID8A 4ES3A 5JJBA 2ZOGA 2A1BA 2VPZB 3MZIA 1S57A 2B4PA 2F7VA 1MW7A 4TLQA 2G2OA 3U27A 2FJWA 4Q8EA 4AL5A 1X4AA 1FD8A 1YSJA 1WHWA 2C2MB 1XBWA 3VGSA 1FESA 3CO9A 4EUVA 2H5IB 2VD3A 3Q86A 4W4MA 1VQLS 1FJGF 1K0VA 2FHJD 4YEAA 2P9EA 1NMEB 2Q6BA 5C24B 1FJCA 1X5PA 1CJVA 4PRFA 4ZN3A 1HARA 1U0SA 5BR8F 2MSSA 2CPIA 4USIA 5DG9A 2YX4A 2FVPA 1NJYA 3R3TA 3LA0A 3AOAA 2RRAA 1PC5A 1RT5A 3KLHA 2AGPA 1RWXB 3LP0A 1HW8A 2HWTA 1D8ZA 3IP0A 3DRSB 4PPZA 3THPA 2MYFA 1VBXA 1HNZF 1T9WA 1X5SA 4IG3B 2KXFA 2M7SA 3HXMA 1RHKB 2G0IA 2AX1A 2NXUA 2VA3A 2B8QA 2B3TB 1YHQS 1M0SA 3MEDA 3Q8UA 3SSSA 5DZ7A 3US5A 4Q7AA 2ZH9A 1WTBA 1NB7A 3C15A 1LW2A 5KFBA 4EGLA 3THTA 4MJKA 2R8HA 1SH3A 2QA4G 3DC2A 4FXDA 3R2DJ 4RW4A 3Q23A 3DMJB 2A3JA 2RU9A 3IG1A 3NGTA 4LBIA 5E41A 3MCNA 3H90A 6FDRA 4DV2F 2JNJA 4OJGA 4A8SA 2ZJPQ 2JC1A 3TI0A 4X62F 3TEHB 5DZ6A 2QG9B 3N6MA 2KXNB 1X8DA 3OL7A 3DLHA 2BXJA 1F5CA 2QMUB 3CJ3A 1MMDA 4V1Ak 4MIBA 2B4VA 2RKIA 2XSFA 1RWVB 4LREA 5DRKA 2VPYB 4OI0A 1WJ9A 3F44A 2HS4A 4NOHA 3UDCA 2F5GA 5RUBA 3VAJA 5DLFA 1S0OA 2QIFA 4LBHA 3HVRA 2I1RA 3GR0A 1NDCA 2BQRA 4LRDA 2GNKA 2MKYA 3H0PA 4LRBA 4NA2A 2ACYA 2B9YA 5KFEA 4TU7A 1K9MT 3MPVA 1NKCA 3DYAB 2XNRA 1U26A 4DQIA 2JL9A 5F9LA 2CUYA 1W25A 3NEKA 5ADZA 3PX0A 3OXLA 1CQNA 3OL9A 3TWZA 4ICLB 1AFJA 2D1CA 4WU3A 2RUGA 5GAEI 1RYRA 3UO0A 5C42A 4KY3A 3G6YA 3GIMA 4DUZF 2J5AA 2HYIB 1FNOA 3J7YI 1T0TV 3QGGA 4F4YA 1P6TA 3N6NA 1G3OA 4C48A 2XZWA 4EK2A 5BYQA 2CYYA 4MAKA 4JV0A 3Q8RB 3MD1A 1QVFR 1BQMA 2MKIA 1KSPA 2WOMB 3VVTA 4DR5J 3KK3B 4F0HA 3IS9B 3MPUB 5CYMA 5IWAF 3MPYA 4K4UA 4CO2A 1DLOA 4UOGA 1LOUA 3KNGA 1RTJB 4IFVA 1PJ6A 4CO1A 5A8KA 1D9DA 3Q8PB 1AA1B 1TL3B 2BACA 2NUHA 2KRBA 2P8IA 9RUBA 2ZH3A 2DH8A 2X1BA 4CLTA 1M5OC 4AYBD 1SC6A 3T19A 2K8GA 2BE2B 2KH9A 3IG1B 1HPZB 4YUDA 3K59A 1U47A 1J5EF 2IC3B 1F2HA 5IXUA 5DQIA 2B7BB 2A6OA 1DQ8A 5D15A 5E3QA 1QTMA 4NXMJ 1S1XA 2WVBA 1U1QA 2YKMB 3EGZA 4DV7F 2EEYA 2E9ZA 4J9QA 1X0FA 1IR0A 1B70B 2RT3A 2E29A 1S4FA 1KWMA 1U0HA 2MY8A 3LALA 3NP5A 3IR5B 1F2GA 4C7QA 4BS2A 3S7RA 1Y11A 4PAAA 1R6YA 1I94J 1M5VC 3BPSP 3F56A 3TQEA 2CJXB 1JNRB 2DO4A 2AEMA 3KHLA 3QZ8A 2BJ9A 3O6QA 4DU7A 2NSBA 1UA0A 2RSQA 3NBPB 2RUSA 1ULRA 3B54A 2Y8YA 3DLGA 3DXSX 2D3O1 4U7UD 1X0PA 2B4UA 3BO2A 1J5OB 3M6WA 2HEKA 4BBYA 5E3RA 3PR5B 5C24A 4UUXA 5ETLA 3W2WB 2EC0A 2AX0A 2DEIA 1BHNA 3RTVA 1ZAWA 2JFDA 4OJ3A 2V69A 5GAGU 4DQQA 3ISZA 2MQQA 4YFUA 1GK8A 4ANDA 1B0PA 4MKYA 2IYIA 1H7XA 1OQ3A 4KHPJ 4ECXA 1DTQB 2UU9J 1NK7A 1Z2LA 5J1EA 2XSJB 2XY5A 2L48A 4M8LA 1SH0A 2V6AA 3FFIA 1SQFA 2VKRA 5B0DA 3V4IA 5F8HA 1FXRA 1TR0A 4K8RA 5I3QA 5F41A 3SSQA 1SL1A 3MCMA 5AT1B 2YWHA 2CADA 4O44A 4DFMA 2YNIB 1S1UB 4CI0B 4LF4J 5D4PA 3H98A 3D54A 2RHSB 5DLGA 5CYJA 3HHNB 4O3RA 2OD4A 4RL1A 1JNZB 4KSEB 5HVFA 3LH2S 2LU1A 2R3VA 3TA1A 1F5AA 1VQSA 3EDQB 3AD7C 1S6UA 3NY0A 1U2CA 5LMUF 1RT4A 2VG6B 3DLEA 1XJWB 4LBPA 2CFXA 4ICLA 3VGTA 1X9WA 4ID5A 5HATA 2J0XA 2ADCA 1UTAA 4PQUB 2AYMA 3MR3A 4JUZA 3PYGA 2AU0A 4IOAQ 4P10A 4QR0A 5AE3A 3R5DA 5IOLA 1YITS 3QRRA 5DO2A 4EYIB 2RF2A 1T3OA 2VFRA 3NS7B 5A8WB 2NLWA 1W26A 1R89A 2E1AA 1O6XA 2HPUA 2R7QA 3MM7B 4J5OA 1JLAB 1WHVA 3A13A 2R2SA 3Q24A 1XMOJ 4P71A 5LMUJ 3FDSA 4ZPTR 3CCQS 1N33J 3BGRB 3UD4P 2PI4A 3D5MA 2DNYA 2VOPA 4LF1A 3MM6B 4DL0C 1R8BA 4J9PA 2FIUA 1LWEB 2FJDB 3H8YA 4GKKF 1QM9A 1REVA 1EETA 3D66A 2DXEA 2OPSB 3BQ2A 1S49A 3HD2A 2XS7A 3R5JB 1LWFB 1HNWF 3ZO7A 2JJ4D 2XTJP 2KG0A 1B7FA 4A8FA 1RLCL 4UQGA 1UFWA 2ZDPA 5LL6d 3AA9A 1N5QA 3PACA 5KTQA 3MECB 1IR2A 2B6AA 2VBWA 1PYSB 1AYEA 1T95A 5HJXA 4IRKA 2XO6A 1HI1A 1VRQC 3MFIA 4KRWA 2RQCA 5D3GB 3UQSA 3LAKA 4ED3A 3M1VA 4K4WA 1UKUA 4IG3A 3ITHB 1JIHA 2MKHA 1U6FA 1IBLF 2W2OP 4JI1F 3B8HA 2EFPA 4N7TA 1VQ7S 4C4WA 1RB0A 3MCOA 4ETZA 4IRDA 1ZPVA 3ENVA 1TZ0A 5LXRA 2E7XA 1C0TA 2ZNYA 4IUFA 2CQBA 4JYAF 4OZNA 4TVAB 1X4FA 2I5JB 2JFKA 3AA8A 5D0RA 1UVJA 1MSWD 2PE8A 3CMES 2Q6CA 2VODA 3OQ2A 2A18A 2ZUGA 2DRAA 2UXBJ 2A10A 1R27B 4IDKB 3X1LB 4ED7A 4PWDA 1UFLA 4DV5F 1RUSA 1P8GA 3KK3A 1APSA 4HLBA 3KK2B 1IKYA 2OMLA 4B9LA 1S9EB 1ZTWA 1G7CB 5D77A 5M2PA 1BQNB 1ZM4A 4WFAQ 1D1UA 1RAAB 2BJDA 3MOJB 5F0UA 3RJMB 4X64J 4GKJF 1CEZA 3DOMB 3GYXB 2PC6A 1SH2A 5E0OA 4DF4A 3FC9A 4PQUA 1MWZA 4F02A 1TAQA 1WORA 1PJ7A 4U96A 2M2BA 3V5RA 1GFWB 2WW8A 1KDNA 1ACMB 1JKHA 1VGYA 3JTNA 2Q43A 3R6LB 4OYAA 4DN9A 3KLFA 5JVHQ 1PBAA 4K4YA 2H3EB 1TU0B 3MM9B 5C7PA 1R8HA 3H5SA 2W24A 4Y2KA 2HG4A 4WF9Q 2BQUA 4NA3A 4RNFA 2XB2D 2ZNZA 1MG7A 3C6UA 3ZTOA 1T3NA 1S1TA 4OX8A 5B0BA 2DR7A 2QGFB 1RHQB 4NXNJ 3K5NA 2K7KA 5MAOA 1S1UA 1SJFA 1XMBA 2BVZA 2OI2A 2ZITA 2NS1B 3K5OA 3NOCA 1X4CA 2B5JA 2CNNB 4RW7A 3R8YA 1DBDA 3KLEB 3IRWP 3PHEA 1DFDA 1RAEB 3CULA 4F2SA 2YWWA 5KFSA 2H9ZA 3DXBA 3QAEA 1TKXB 2CPZA 2XYPB 3FEZA 2NYIA 3IAM9 4ZLNA 4J9NA 4N41A 1SKUB 4UQTA 4K4VA 3H20A 4OFZA 4Q0BB 1WC4A 3E3XA 2H54B 5F9NA 5AXLA 4KGKA 3J7ZT 3T5KA 4Y2MA 1EZZB 4DFJA 3FUYA 2CQDA 4WZQA 3BH7B 3T9ZA 1RT3B 1K44A 3O44A 3MR2A 2XZDB 5F3ZA 4ZPCA 3W8GA 3HHLD 2HZAA 1VCTA 1VBYA 2HMIA 3OFHA 3KK1A 4OI6A 4PZVA 5AE2A 2YBVA 2DEJA 4ZK7M 7FD1A 1RBAA 2MB0B 3BB5A 4OZ1A 1MMLA 5KFUA 4ZP7A 4EBCA 3K5LA 2J6TA 1N5VA 4B3RJ 1LWCA 1JWWA 3H5YA 1IXKA 4J9UE 3RB3A 3HI9A 2R8JA 4CYUA 1RHJB 3GMGA 4ZIVA 3KHRA 1Y5LB 3NGSA 2NR0A 1IKWB 4ZCKA 4Q44A 2ZC3A 1N34J 4B9MA 4BDPA 4XDDA 3NNAA 3M8PB 2KTQA 5C25A 3AAWB 5LT5A 2N3OA 2E1PA 2QA2A 4MKAA 4QZVB 3S6EA 3TVYA 3LOUA 2NSCA 3BBBA 1U8SA 3P4UB 3ET6A 1S1TB 1NKBA 3E01A 5B08A 1UEVA 2DCUB 3KWMA 5HMYA 1S4EA 5LSOA 1V3RA 8AT1B 4BCAA 3PHTA 3DHXA 1KQKA 1YLXA 3MM8A 2ZVSA 3QGIA 4L75A 4CLSA 2RF2B 2CJQA 3BKTA 2GC8A 4N8OA 1S9FA 2MPUA 4G3IA 1TKDA 3QRPA 3LWLA 1DLOB 1YBAA 2HQFA 6FD1A 2C3YA 3OHAA 5LMNJ 4A8MP 1UVKA 1T03B 2WSEC 3DLJA 4RUCA 4M5NA 2F8HA 4X4UA 4JI5J 1HQUA 3I6PA 2E5IA 4NYOA 2LQ9A 2CNOB 1S1VA 2X51A 4LIWA 4DS4A 2GW8A 1GX6A 5THWA 5KFZA 4AXIA 5DDQC 3HFVA 5KFAA 4Y6IA 2W9CB 2MZQA 1RHRB 1Y7PA 2AIRB 4RWXA 3DI6B 2KZMA 3DRPB 4JI7F 4B08A 1RADB 4U67Q 3GR1A 2MZTA 2V8GA 3KUGA 4MK8A 3JSMA 3Q0AA 3CCSS 3C14A 1H98A 1S0NA 4MYTA 2V50A 4Y3CA 3UVJB 1JLBB 3FBEA 4DV2J 1ZYQA 3D3BJ 1VQ8S 4V19J 1NHUA 3GJTB 3QWPA 1Q8LA 2DISA 3DGVA 1Y3JA 1Q16B 1TP7A 1REGX 1XN9A 3ZC4A 2FDNA 3KHGA 4AL6A 3PZPA 1KHVA 1Q8BA 2GA7A 5E2QA 1QSLA 2K1RB 1YZ7A 2B56A 1VR6A 1FDAA 1FEEA 3CD5A 2PFDA 3EZUA 4H4OA 4Q2LA 3LF0A 5ETQA 1V5IB 4O3QA 1WC3A 2I5JA 2VH7A 3Q83A 3GV5B 1NJIT 1UFKA 3MAHA 2MQ8A 3L09A 4L73A 2PMWA 4N8NA 3SCLE 4FYVB 4LF8F 4DUTA 3G87A 4FNIA 4I1TA 3KFWX 2AWZA 4X4PA 3E2EA 2DNLA 4CYUB 4LR8A 5KT2A 2WAQD 3IWXA 3J81j 4JI1J 1QJHA 2V0NA 4YHHJ 1SJ3P 3D6TB 3CCZA 1UPMB 4HKQA 1IKXB 5HP1B 1FK9A 1RGVA 3JSBA 2FVQA 2B4OA 2J76E 1G1XA 5D8HB 4DL2A 1VQ4S 2AT1B 2HVZA 1H2VZ 1H7WA 2DKOB 3GG0A 3NKYA 1WSRA 4OYXA 3R5BA 1S79A 3ZZYA 5GAHI 1T94A 3HSJA 3HSZA 3I32A 4JOUA 5DS7A 2UVRA 1S1XB 3UNGC 1OJ4A 1JLEA 3T5HA 3V6JA 1DARA 1URNA 1K1SA 2DB1A 2ASDA 5F3TA 2VPWB 3EICA 3NAIA 3MMBB 1R8AA 3CJ4A 4CWBA 2O01C 2DGTA 4JV1A 3DDIA 4OLOA 4Z2XA 3F73A 3QSIA 4PABA 3FEYB 3ILLA 3LTOA 1TK5A 2BJ3A 2W4DA 4KGXB 5MLCV 2IVMA 3EZ5A 2G2ZA 4ECRA 1RISA 2P9CA 4DSFA 4DUYJ 4X4NA 1IJFB 2ROEA 2G2YA 3AB2B 4OZ2A 5J2NB 2YQ1A 4F3QA 2WSFC 3Q89A 5G4DA 4Y00A 1IBKF 4DCOB 1H6KX 1ZZFA 2HIYA 2Z2LA 2VG7B 3Q22A 1RCOB 4G1QB 3K7RA 3IBWA 4P72A 3JSYA 4QWEA 5AJ3F 2E44A 2HGLA 1UA1A 4ZLLA 4HTIA 5HANA 2KHDA 2ZH7A 2C22A 5G0RB 1NUEA 4AL7A 4DX6A 2R7RA 5IC4B 5J2PA 3HHDA 3ETMA 4A46A 2DHGA 3UR0A 4KR0B 1NK6A 2F4VF 3KJVA 2WRMA 2RS2A 1XNRF 3QJLA 4CTAB 3KUEA 2LQ8A 1G6BA 4ALZA 4TY9A 4CNZA 1O5JA 1P1TA 2HBQB 5IT9U 3ZNJ1 3EE3A 3O8WA 4B9VA 3W3SA 4AFFA 1NJZA 3CD6S 2BR0A 4YY3J 3PEHA 5CH7B 3T1AA 3HDSA 3RRHA 1BWEA 2XMJA 1WOOA 3CJ5A 3NG8A 1HR0J 2W9AA 3RR8A 1Q95G 2D41A 3FFIB 3M6UA 2VV5A 1RE1B 4NLUA 5A0YA 2R7OA 2V4RA 4M63A 2OEMA 3ILJA 3QO9A 4Z7YA 4OI1A 1N6QB 5IV3A 5KFNA 4DFKA 1YI2S 3TVZA 1AW0A 2F1FA 2XS5A 1RA6A 4ED5A 4DPTA 5EN1A 3IBCB 1FWKA 2YY3A 1B3TA 2IM0A 2BJ7A 1IWGA 1YZ6A 3CIZA 3FVYA 4KV8A 2VZ9A 3HPOA 1CULA 2UUWA 1WELA 1SUQA 4OZ3A 2JH3A 5D3GA 2BOPA 4NLTA 1SV5A 2E1RA 2F3JA 1SCJB 4QWCA 4OYWA 1NO8A 3WBZA 3I55S 5L1LA 2L9DA 4NCGB 2NXJA 4IOCQ 3C46A 4NMLA 3HMJG 1S6QA 1Z4UA 4RW8A 1QE1B 1U24A 1DZ5A 4U7UK 1C4AA 2WB1D 1NM2A 5KFJA 4F50A 2J9DA 2IAJA 1WDDA 2HFNA 1SPBP 4ZDNA 4X66J 5I3UA 4N76A 1VFJA 4O3OA 4WYLA 1AUDA 1QAJA 4JBCA 1YJWS 1WKKA 2WOMA 3HJVA 3B82A 2QL5B 3ELHA 2BOAA 4KAIA 2QL7B 1J2VA 1U6ZA 2NYHA 3R27A 4L76A 5KOWA 4NZ0A 5LMNF 2ZVIA 3VAHA 2BE2A 4DF8A 2XGPA 5F8GA 1Y0HA 2ROPA 2IIHA 3AXKA 5U47A 3UE2A 4ED1A 5EWEA 4M94A 4P9SA 2HIQA 3SMZA 1Y3KA 2FB0A 1CJTA 2AJQA 2RRNA 4YN3B 3MEKA 5I4MA 1V5VA 4CTAA 2GGPB 2P6TA 2VG6A 3O3LA 4MFBA 3RB6A 5L1IA 1OY8A 2LA6A 2K3KA 4CH0S 3MURP 1IM4A 2QSFA 2Z0GA 1TK8A 1RT1A 4DN0A 1T05A 5G0RA 4CM0A 2KXHA 1IBCB 3M7VA 3JSRA 1NK4A 2WHOA 5HL7Q 1E6VB 4LF2A 1WG4A 1RAGB 3DU5A 3I5CA 3H5XA 2XHCA 1JLGA 2IJFA 2Y3YA 1FJEB 2LVWA 2FGCA 2V2QA 4LSLB 4UOHA 2XHWA 2IVFB 1BY9A 1X5OA 3CGIA 1RLDA 4JI8J 1QAXA 4L6V3 1P9YA 1ZA1B 2DNOA 1TUGB 3W5XA 4A8WA 4DL7A 3A12A 4B3TF 1BLUA 4X2BA 4DCPB 4NYPA 1KVIA 1AUSL 4OHYA 3DM2A 5F8JA 3AFGA 1HNXJ 4OJHA 1T02A 4H4MA 3W63A 2BW7A 2PT0A 1N56A 1YDLA 1XERA 2BUNA 4P73A 2KM8C 2E7WA 4YHHF 1KQFB 3D6MB 3IO1A 2C2NA 2APOA 4DV0F 1WNEA 1X7VA 4M5HA 2MMYA 1Y00A 1S76D 5D4LA 3WDOA 3IN5A 1TELA 1RT5B 1F1BB 1S99A 3F0NA 3GJSB 3OT9A 4IG0B 1RK8A 1U49A 1EHWA 1RAJA 3OTDA 3QGPA 4Z37A 3BV8A 4USKA 2R7SA 4IQMA 5JVGQ 3CTRA 3D2WA 3BM7A 2BM0A 2XCPA 3FJ2A 2DNGA 2VQEF 3M32A 4DX5A 4LRAA 4QYZK 4CM2A 1D8YA 3MEDB 3CCLS 4NA1A 3GB0A 1JLQA 4DR6J 3G6ES 2AMCB 4QIEA 2FQQB 3IWLA 4X4TA 2IJNA 1HNWJ 4ZA1A 1KTQA 4DX7A 1HNIB 1UWBA 4NRUA 3JS9A 4DZ6A 2GMHA 1WF0A 3MOZA 3KLHB 4E0DA 4TN2A 4NI2A 4UW2A 3OL6A 3CC7S 3PXGa 3G9CA 3GYNA 1Z1ZA 1R0AA 4F04B 1FRHA 3LP2B 3LP2A 2QMWA 5AXMA 1VQMS 1VQPS 1HHSA 2GMJA 3MM8B 4CP5A 5I42A 1U1MA 4G1IA 4MMOA 1CSJA 3DI6A 4ZVOB 4DV3F 4ED6A 1UVNA 5ETSA 4ZCLA 3AOCA 4C3LA 1IBKJ 4DR6F 4M5KA 3VV2B 3GZ7A 2J9CA 3PJWA 1XK8A 3HVTB 4C98A 1U2FA 2QMXA 4C8MA 1PAEX 3AJ2A 3CMAS 2UU9F 5L8RC 5CCMA 1RWKB 2OD6A 3KKFA 2RDJA 3N5BA 5IT9Y 2N4CA 2GVZB 1RTHB 5C25B 4C3MA 3H59A 1FD2A 4NLGA 3BO4A 1JLGB 2OH2A 3GCXP 1CJTB 4KO0B 2R2TA 3W66A 3WC2A 3DGPA 2F9DA 4RW8B 3HJFA 2QFJA 1L3TA 3FZ2A 1TMJA 5IQQA 2Q79A 1FX4A 1RI7A 4HTJA 3T41A 2DH7A 3TAMA 5B7WA 2WONB 3JYTB 1LNQA 2U2FA 4I7FB 4NEZA 1LWXA 1Q7YT 5J1EB 1S77D 1MN7A 4A8YA 2DH9A 3U02A 2HMIB 4X4VA 1WWHA 4C3KA 1PIEA 2W2MP 4RU9A 2B8PA 1C1BB 2HAFA 2YKPA 2G0JA 3LGMA 4NLDA 1HIYA 1KOOA 1TL1A 5HQ8A 3JB9k 2UXCF 2VFUA 1QDUB 2DGSA 4DL3A 1NZAA 1HPZA 4CCHA 4IYQA 2MXYA 2G0CA 3V6DB 3UCZP 4ECQA 2XYHB 1VQNS 3C66A 3TNVA 3OLBA 3UD5A 5IFMA 4OZ5A 1ZBTA 1RCXB 3TUPA 4Y2AA 5C5JA 1DQ9A 2RMLA 2EK6A 4AQYJ 2MKJA 2RS8A 3OPKA 4U95A 2GO8A 1I3OB 1FKPB 2CG8A 2GHWA 2MQPA 1HBOB 2W1BA 1C1BA 1YRTA 2NPIA 3JQJA 1A7GE 3AD9C 4O3PA 1DTTB 2J9DE 4MKBA 2FHJA 3BGOP 1UJ4A 4HT7A 5I3UB 2PA8D 4GO5X 4UOFA 1I1GA 2J7WA 4NRTA 2HFZA 1FWLA 1KS2A 2W2NP 1YKWA 5J2PB 1W2BR 2J0WA 4DEZA 1TFWA 2GVDB 3OL8A 4MH8A 2CQGA 1FJGJ 2GCFA 1LQ9A 1Y5NB 5LXYA 3AH6A 4F4KA 4DQPA 1YGYA 3DGPB 3EUNA 1TL3A 2M3DA 5BR8J 3CC4S 3BSNA 5DG7A 1S9GB 2MJUA 4FS1A 1RWWB 2B51A 1HLWA 2Z8QA 3D7SB 4LFAF 2UXCJ 2YWFA 2HLTA 4WTYA 4CLWA 1FRMA 4ETXA 3Q2SC 2ATCB 2DITA 2O3DA 2MQMA 4DR7J 2LXIA 3G82B 3G82A 5IT0A 2JVOA 3X3UA 2R8IA 2KI2A 2HSEB 3DRRA 4DQSA 4LRFA 2BV3A 2KM8B 4UUWA 2VB6A 3CSKA 4ZJOA 1Q5YA 2EK1A 1OYEA 4DI6A 3LAMA 3TRGA 3FBBA 3SV4A 1NDLA 1TL4A 3MM9A 2YKOA 1KC8T 4I64A 3D67A 2B7CB 1DURA 2CWKA 2WBRA 3DCAA 5D6GA 3T5JA 2HNYA 3MMCB 3BO3A 1FFGB 1X9MA 3PKYA 1ZM2A 5B0GA 2HURA 3QZ7A 4LMZA 4F3MA 2XWYA 1Q8KA 1JLCA 1S6PB 4FKYA 1PGZA 3ISND 1NCLA 3CCES 3J81Y 3H4BA 5FDLB 4FF2A 3BYPA 4QR2A 1IQTA 4HHUA 3EJMA 4ZP9A 2E7VA 1YX2A 2FJVA 1HBOA 2YPZA 4KE5A 1CJKB 1VHFA 4OYOA 4J9KA 4XPEA 2E5GA 1V6HA 2XM3A 2CPHA 4IO9Q 1N6QA 2JLEA 2YNHA 2DGUA 2ADBA 2F4VJ 2BMBA 2ALYB 3NNHA 3ILOA 2KL8A 3GCWP 2JEJA 2F8EX 1V9OA 2LDIA 3DHWC 4N77A 1ELOA 4ZVQB 2EI5A 2K3IA 2W7AA 3QAUA 3ZZ0A 2BANB 2CQHA 4ES1A 2XI3A 5EWGA 1EJ7L 4UOCA 2OPPA 2DYAA 4DR2F 5J2NA 1S1WB 2QSWA 4M5DA 4WIQA 1IKYB 3TZYA 4KPYA 5IM0A 2MLXA 4WFBQ 3RAXA 2D9PA 1KFDA 2PD1A 1WC6A 2D3UA 1U45A 5DGBA 1REVB 3HP6A 3M9MB 2D7SA 1TL7B 2CPDA 5D0EA 4NXNF 4ZKAA 2LECA 1N48A 1H72C 2DCLA 5JXSA 1VQ6S 2H4YB 2KN4A 3EXCX 3E51A 2IA6A 2VBXA 3GJRB 3Q2TC 2DJWA 2OSQA 3MMAA 5KOXA 1EAYC 3M6VA 3QPIA 3W61A 3J7A1 1DY3A 1ROFA 2WVCA 2HWHA 4LIRA 2JHEA 1U4BA 2FGOA 2H1YA 4U8YA 1D9FA 2JEGA 3ZFVA 1E6VA 4P2FA 5D4NA 2GVZA 4TQSA 3A8EA 1NHVA 2BW2A 1YIJS 2AZ3A 1WDTA 4NXMF 1OPZA 2QTWA 4B9NA 2POKA 2RIJA 4YP3A 2YXLA 3GLJA 4F4WA 1VI7A 3QATA 4KC5A 4C0OC 2GGPA 1JJ4A 4WE1B 3Q8VA 3M2RA 1UJ5A 2E5JA 2YVSA 3NCRA 4Y65A 1SJQA 2CQPA 3GFZA 5KFCA 4B3OA 3KHHA 2OAUA 3QIPA 4RJVA 5EDWA 1KONA 4X4SA 2FHOB 4R5PB 4R5PA 2YNGA 1MU2B 1PAUB 4NYZA 3IRXA 1WEZA 3W2VA 3WHIA 3RBDA 3T1HF 5HLFA 4ENOA 4KGVB 2W4CA 2H51B 1UPPA 3OUYA 2DR5A 2VIHA 2M4MA 1RT4B 3DLEB 3EMTA 2VQFF 2ZZMA 4FVCA 4ERDA 3L7PA 4LQ9A 5HBMA 3SDEB 4E2FB 1EX8A 5E5NA 2FJBB 1S48A 1FRLA 5DDOC 2V63A 3M32B 4PG7A 2X3GA 2LP4A 4K5RA 4RNMA 3V6KA 2FLNA 1UAWA 2BANA 2C3PA 2HZVA 1RAHB 2R8GA 1IJEB 1IKWA 1BGXT 4B3MF 1B99A 3NNCA 4H54A 1RTHA 2LKZA 3CJKB 1U7LA 1PYTA 2KKHA 2V34A 5D0HA 3R7SB 1N5SA 2MHNA 3HX9A 3SIPB 3VCDA 5CD4H 2Y1LB 1HBMA 4CLFA 4QPXA 2L41A 4ANCA 3TX0A 4DU8A 3DOLB 4H4OB 3SEOA 2MDAA 1XR7A 2Z2ZA 2EFNA 5GMKa 3OSPA 2DGWA 2YX1A 1Q7LB 2OTLS 1NSKL 3A8JA 4EEYA 1ZZNA 5KFKA 1JJ2R 1KLMB 2YWEA 2AD9A 2GS8A 2HWIA 4DL4A 3H7HB 3M8PA 4FYYB 1GMWA 2AF6A 3ZTPA 4HH0A 3FNNA 4DFPA 3JQMA 3CMQA 5CXTA 2D9OA 4HT5A 1UWBB 1HNIA 3D4JA 5JMNA 2EPIA 3NCPA 2UVVA 2R7VA 1FHTA 5T14A 2LFVA 1JMTA 1TL7A 1VK3A 3DRRB 4WP8A 1JK9B 5A76A 3C6TA 4RW7B 1Q79A 1X4DA 2RDDA 4I67A 2C1EB 2R2RA 1XMOF 1YJUA 1M90T 4ECSA 2CG4A 2C3UA 2Z2MA 1NSPA 1RABB 5H9FJ 4CO5A 3M9NB 4F4XA 4F4AA 5KFQA 3SI8A 3DLBA 3C6UB 3MDFA 3TA0A 2UVUA 4KGMA 3UNYA 1QLNA 2FZGB 1S6QB 1JXLA 3I9ZA 1WEXA 4DL6A 2X1GA 3HLUA 3IXQA 4PYDA 3SQGB 5HJYA 1SIZA 2HNYB 1S6OA 1VISA 1XNQF 2H5EA 1SV5B 2O1PA 5D0GA 3ZZRA 4WZMA 1ICEB 2BJ1A 4AE5A 4LFCJ 2VOOA 1Q4RA 5EHHA 4ZVHA 2OSRA 2ZD1B 3OD2A 3CJ8A 4QJVA 2ZDOA 2FVSA 1KKHA 1PSDA 3IFEA 2ZE2B 3EXYA 4DV1J 4OYZA 1L3UA 5M2RA 3QO9B 4FBTA 2DNZA 4DBQA 3OW2R 2D74B 4YB6A 3L7OA 1JJCB 2DNHA 4DPUA 4IDKA 1IR1A 4YMEA 2CJBA 2MKCA 2KRRA 3KLFB 3SZ2A 2XWXA 1GTHA 2HBZB 2SXLA 1XR5A 3AXMA 3JTOA 4KYZA 4USVA 4BC9A 3I4HX 2YNHB 3VR1A 1C0TB 2J7UA 2VL1A 1QUPA 2KHCA 4RBTA 4DV1F 3EGWB 2WCXA 4P2XA 2FLLA 2FY1A 2RNEA 4RW6B 4ZVFA 2R7WA 1CULB 3K89A 4RNOA 2OKQA 3TO8A 2VFVA 2UXBF 1VRUB 3H2VE 3Q8YA 1HNVA 4KKOB 1WTFA 3ITHA 4AUKA 3JYTA 4LF5J 2Z4PA 4RU2A 3BKFA 3KK2A 4EYHB 4DR2J 3CDUA 1R43A 3UD3P 1RT2A 1NJWA 1F5BA 1UZHA 4CH1A 4FDFA 1N0UA 3PW7A 4PUOA 1XWLA 1LK7A 5AXKA 1RZMA 3OFEA 1S7HA 4A48A 3MR6A 1NJXA 4QIGA 4PXDA 2HHHF 3LP0B 3E8OA 4ZHRA 1UL3A 2M70A 2MEWA 4GKJJ 2RDIA 5ETVA 1FDBA 2DNRA 2JLFA 3DOMA 4K7QA 4FN5A 3BR8A 1PYOB 3EWGA 3RYLA 3OTOF 3EPGA 5J2QA 4K2JA 2R7XA 4FPIA 3M2VB 2Y1IA 3PVXA 3RG6A 3VF0B 4ZVRB 3KLEA 4IH5A 2GJ2A 1N8RT 3NOGA 1KLMA 4OYBA 2DGXA 4J90A 3RZAA 4ZMMA 2AW0A 3W62A 2Q1LA 1CC8A 5CABA 1VBZA 1RXOB 1S9GA 2HQIA 4MYUA 4C8NA 2MQOA 4O3SA 4DR4J 3R2CJ 1N36F 3TVKA 1QE1A 1ZA2B 5KT7A 3UN5A 2IRUA 3SYZA 2ASYA 2LU2A 4JB8B 1RU1A 3DU6A 4J7CA 1QVGR 2MHEA 3HVAA 3I87A 2ABYA 3UVJA 4WTOB 1YJNS 3G96A 4ED8A 2VC0A 2DGVA 1N52B 2JSXA 3A4TA 2CPFA 2I6WA 2ZOFA 4CRJA 1VDHA 4J9SA 4MKVA 3K5PA 2ZBPA 2RILA 3TQ1A 1CPZA 3JXOA 4JI3F 4K2XA 1O8BA 4X84A 3KOAA 5A2QU 5GADU 2FLOA 3EYZA 3P49B 4DPXA 2FHMA 1TAUA 1R7IA 1LWEA 3J80Y 3T3FA 1S5ZA 3DRSA 4PQAA 2UUCJ 1FDDA 4PWDB 3QWUA 2YH0A 9ATCB 5KFFA 3IWNC 2RH3A 3ZNUA 4WBFA 2ZBCA 4QW9A 4URSA 4WK1A 3CUNA 3A3NB 1R8CA 4OIXA 1EKRA 3U1NA 2BBEA 3HSGA 3WX8A 3VAIA 1YJ9S 2NXCA 2QE5A 2PI5A 4JI3J 2DR6A 4WWSA 4CLPA 8RUCA 4QU7A 3MPDA 2MKSA 3BS9A 4XO0A 1QTNB 1FT8A 4CT8A 5FLXU 2CJYB 3H25A 4FF3A 1UVLA 2NZ4A 3ZZPA 2HQGA 2ZH1A 2XEXA 2UUCF 3FSXA 5H9FK 1Q5VA 3KTQA 1YVFA 2BKPA 2B43A 2M5YA 2W25A 3M8QA 1CS4A 1URRA 4I2QA 4I7FA 2WVFA 4F36A 5L39A 4DLEA 5L46A 3TZZA 4K4ZA 1HBMB 2B9XA 2CKWA 3VGUA 4CLYA 5K14A 1KN6A 3OTEA 1K0TA 2BKOA 2AYBA 4R25A 2IFXA 1MROA 5E3CA 4CLZA 1GXLA 4C8YA 1HHQA 4ZITA 1HNZJ 2OO4A 4ID5B 3KG0A 4KGZB 3HULA 3EGNA 2HNZB 1NLKL 4IO1A 4KTQA 1IQZA 3OJSA 1UCNA 4WFZA 2CWXA 1LWFA 1VOMA 4RW9A 2W9CA 1RQ0A 5GMEA 4LF6J 3KLIB 2HLUA 3MMAB 3TW0A 2LCWA 3BSCA 1IBMF 3N79A 3V4IB 4P74A 1NH7A 3M30A 1CS4B 1GQEA 2G1HA 4NLVA 4EU0A 1RAFB 4PXEA 3TA2A 3TEGA 2N82B 3W7BA 4W90B 3HT0A 3MM6A 2F40A 2FZKB 4ED2A 4RR5A 4TY8B 3BGRA 4YB7A 4C11B 1RT7B 2B9WA 4LR9A 3W2VB 4DSJA 4DR7F 2MZJA 4TYBA 5KFLA 2FD2A 2GV1A 3ILIA 5DG8A 1B0VA 3GU0A 2ZH2A 1KVJA 1U6BA 4QR1A 4FP9A 2KYZA 2HKEA 1HBUB 1HBUA 4LF6F 4NPOA 4D3HA 3PR4A 1WOSA 5E3PA 2ASLA 1FX2A 2K06A 3DNCA 4CLKA 2OTJS 1YJ7A 3AODA 5DDRC 4ZVPB 4NE9C 1Q0NA 1HMVB 2W2PP 2W4PA 1NK8A 1ZM9A 5ETKA 1MMNA 4U8VA 3C3LA 1VQ9S 1TMMA 1L5UA 2O67A 4B9TA 4GMKA 1HNXF 2DHAA 2YQ3A 3I0SA 4DWIA 1YQHA 4ELVA 5H9EK 4IRCA 3VGVA 3G4SS 2LXFA 1S1VB 3LGHA 4Y34A 3DLLQ 3B4MA 1U1OA 3M2VA 4C8ZA 2HVHA 1S1WA 2ZEJA 4OX9F 2NZCA 4OHZA 3DLGB 2JZ5A 2HGMA 4K4TA 2IHR1 1WC5A 3CDWA 4LSLA 3VZHA 2Q3PA 1Q8IA 2ILZA 1RHUB 2VDIA 4IG0A 5EX0A 2UUBF 1CLFA 5LSLA 2V2ZA 4X4OA 3ZZOA 2E5LF 3N4WA 2I9SA 1LEOA 3MMCA 4K0KJ 2AZ1A 2CQ4A 2F9JA 2IPOB 5CYQA 1HQEA 3KNAA 4FYDA 2ZH5A 5EGYA 3KJQB 2CPXA 3GILA 3AQPA 4F0KA 3DYAA 3Q8QB 1F9EB 1HA1A 2QA1A 5FDLA 2V2KA 4JV5J 2BRLA 1RT3A 4OX9J 5DETA 1M1GA 5IM0B 2XQCA 1B64A 4JV2A 5AXNA 5E3AA 2FJAB 5FIIA 4RO0A 1WF2A 3EGVA 1LKZA 4KPCA 1RHMB 4EWTA 1KQSR 2MTLA 2GIFA 1RWPB 4NLOA 1J5EJ 4I6AA 3CCUS 3H2UB 2I0XA 4O23A 1D0EA 1HQEB 1L3VA 2C2KB 3CPWR 3MEGA 1HKAA 2N7YA 1RYSA 1TTHB 2CDRB 2IYGA 2YQ0A 2ERRA 2LYVA 3FRYA 3IS9A 5CYMB 1RT2B 3M8WA 4FYWB 3C16A 3D0HE 5I42B 1X5TA 3IM8A 2MQLA 2QA4S 2VICA 4ECYA 1L3KA 2XNQA 4K5SA 4V19X 2ZHBA 2HHUA 1YG0A 4J91A 4P2SA 2BJ8A 1I94F 1TKZA 1AXQA 1X60A 3BN7A 4ANEA 1TUVA 1RJJA 3QNWB 4JI0F 3NMRA 3RW7A 4L72B 1T9YA 3CD7A 4OQJA 1JKHB 2IM2A 4LRCA 2RE1A 5KG1A 5HVHA 2EWHA 2VPXB 1KBRA 4JI6J 1B7YB 4KT0C 3CVKA 3J80U 1H3DA 1HHTP 1DJ0A 1Q1KA 4A8OA 2DR8A 4EZ6A 1BWVA 3MUTP 4F0MA 2XC9A 1YTYA 3LUYA 4WCEQ 3BSOA 1VRTB 4RPFA 4CQ1A 2VKZG 4YB5A 4DHVA 5KT5A 4EZ9A 3R5CA 2XLJA 3WX4A 3I0SB 1U1NA 4NZ7A 1PO6A 5F8NA 3VVUA 3G8SA 2LA4A 2KJWA 3HFKA 3UDEA 1S59A 3RUBL 2NPFA 4ZVGA 1B4SA 1HMVA 4DV7J 5K8PA 5KG0A 4LF9F 3GP9A 1OIAA 4UZBA 5M2UA 2RVJA 1LV5A 2CJKA 5C42B 4K59A 4F4ZA 1MN9A 2BEFA 3AQOA 4RW4B 3U7JA 4JI2F 3GSIA 3N28A 2AQ4A 1RWMB 1YWXA 4H4KA 1Y9OA 2E9TA 2AJ2A 1RWNB 2V4QA 3BGUA 1RTIA 1VYAA 2R8KA 4CIOA 2DIVA 4C8OA 4NCBA 1F0XA 4I0WA 4Y2CA 4DLGA 2OLWA 4QIFA 4ER8A 1UW4A 3DKDA 4OZJA 3AHPA 5K14B 1VJQA 2AYGA 2UUAJ 3W8PA 5B0FA 1KOHA 3TZWA 4FBUA 1FK9B 2BE9B 4D3GA 5KFDA 3THVA 2V4JA 5A8RA 3KLVA 1PG5B 1WOPA 1U8WA 3D1QA 5T7LA 3OV7A 2P6SA 2J9EA 3KDNA 1SQGA 2FTRA 3CT9A 4HI2A 5KFGA 5B0EA 3BEGB 2QLJB 2R9LA 4P2MA 2VBZA 1P1LA 1JB0C 3FRZA 2FY8A 4WPAA 5BYRA 1FA0A 5KT4A 4QWAA 4ATNA 2K2PA 4MT1A 4LSZB 3FKBA 4WXWA 5SUHA 1BUXA 2M8HA 2QLFB 5KFPA 5K9FA 4A8QA 2PGCA 1LW2B 1W2IA 3CF5Q 1TQLA 3RB0A 4GKKJ 4HACB 2L3MA 1OO0B 2HFVA 2LQJA 3CJQA 4XAKA 4XDCA 2EBEA 5HN0A 4HYKA 1RTDB 5T7LB 4EFAC 4DV6J 1U2RA 3RBZA 2EW9A 2M0GB 5A8WA 4OYMA 1E6YA 3CDEA 3HK2A 2MY7A 3Q8SB 4TNOA 1SQEA 2KFYA 4B3OB 1RWUA 2GMLA 3DRPA 4ECUA 2QRRA 4WE1A 1RKIA 1RBLA 3S8SA 4TU9A 3GJQB 1CG2A 3MD3A 2RD5C 2JEIA 2X7IA 1T9UA 3PJXA 4I6YA 1XEZA 3GIIA 4B17A 5FJ4A 1RA7A 2ALZA 2WTFA 3CJTA 1N0VC 2DXDA 3C6TB 1WKLA 2EBGA 3LQVA 3N0VA 4HVZA 3FZBA 1DRZA 1RAOA 2ZH8A 1HWUA 2VONA 1H38A 3DLKB 4N56A 3P6YC 1N33F 3CJRA 2LMIA 3OHBA 4LFAJ 3RR7A 3OXGA 1FVSA 1HD0A 2IMWP 1LFPA 4LT6A 3VQSA 2N3LA 3PG9A 4M5LA 3PW0A 2GO9A 2QJ3A 4RBVA 2PSZA 1FF2A 4ZPDA 1Q82T 3EVMA 3FBFA 1FFWB 3GE9A 2IM1A 3MR7A 4RUAA 3W5YA 4OL8A 4WFYA 2LEAA 4IFVB 2UUBJ 2GJIA 1WG5A 2F8MA 1K73T 1FEHA 1D9AA 1F3FA 3TP2A 3TJ8A 2UVWA 2W9BB 3GYGA 1WHXA 5IZHA 4X64F 2HHWA 5ETOA 3QQCD 4DR3F 4RBUA 3GFYA 2W7OA 1KQGB 2AP6A 3G86A 3QRQA 4FPRA 2ACMA 2BE7D 2FPHX 2DY1A 4NMXA 4DCJB 3M8YA 3I82A 3QMQA 3C16B 3UR3C 3WC0A 3OLAA 4H4KC 1F9FA 4CO0A 3H4DA 2JVRA 3R7BB 4ZPWR 4A47A 5B09A 4DV0J 3K57A 2ZUAA 2ZKUA 5LOQA 4PEOA 4JI4J 2MLYA 1KVKA 4ES2A 2RRBA 5KG6A 2EFGA 1CJKA 2A2DA 2HZCA 3C19A 4HHJA 4TKTA 4ZP6A 2XG8A 1TKTA 1S7IA 1VRUA 2EC2A 2NXNA 4KKOA 4G1PA 4ZJLA 5KT6A 2C2EA 4R0JA 1N88A 2HS3A 4RW6A 2VQEJ 3NWGA 3QFWA 3J7Z5 2OHDA 3B4DA 2C3OA 5KG7A 2FZCB 3ENWA 2XCAA 2AEFA 1CVJA 2LQ5A 4XTTA 2DNPA 3W9HA 4DL5A 4F3OA 3BJYA 4QCLA 3BDPA 1EP4B 2OPRA 1OWXA 4WU2A 2VFTA 3CCWA 1XMQJ 3SQGA 4NLPA 1ZOTA 2CVIA 2OFHX 3EVWA 5J2MB 2J6UA 1N5YA 1BQMB 3OXFA 4QIWD 1Y5IB 2BYCA 2F63A 4HR2A 4C6AA 1XIQA 5EX3A 2HVEA 4AT1B 4UF4A 2ATLA 3VHQA 3HHLC 4FS2A 2CQCA 2DRDA 2IDEA 4EBEA 2WVDA 2XO7A 5C2GA 4KJIA 1RTIB 3A1YG 2XLKA 4ECTA 2E1CA 1CJUB 5HO4A 4FXWA 3TJ9A 4OJ1A 5GAEU 5D78A 1OS5A 2RB7A 2XMUA 2Z30B 3A8KA 4YY3F 2HK2A 3CXCR 1S72S 1HR0F 3R97A 3V2UC 4E8UA 4LFBF 2XULA 4CNYA 3KK1B 3UN3A 2KDOA 5CZVA 1BQNA 3G2XA 4P52A 4QWBA 1DAXA 4RNHA 3MTJA 2XMTA 2FC8A 3FCWA 5J1NA 3DLKA 1RT6A 1RT6B 3BQ0A 4Q8FA 1SVDA 1LK5A 2Y1RI 4Q5VA 4KB7A 2HW3A 4N5SA 4GVBB 4J37A 2EFOA 4RX6A 3W60A 3CCRS 3SCJE 3CCJS 4IR1A 3NBPA 3EM1A 1KR4A 1KEKA 4ZOSA 3MEEB 2M8DB 3ZTSA 5BXIA 4NCGA 3QLHB 2WZ1A 4DG1A 1SJ1A 1V3SA 2FVCA 4TXSA 4K4XA 1N4LA 1C2PA 3I0RA 2MZ1A 2H5JB 1R31A 2BJEA 2UUTA 1QSYA 1VC5A 4PXCA 3HT3A 3UW1A 1HWJA 1HNVB 1Q86T 1PBUA 1P27B 1HFEL 2ZH4A 2QO3A 2M88A 2YKMA 3M1VB 4B3MJ 2QLWA 4ZLPA 2K7JA 2C2ZB 1S6PA 1CC7A 2V67A 2YX7A 3T9NA 5CA5A 4HEA9 6AT1B 1S9EA 2HHPA 2V5HG 4CZCA 5K8OA 4I2QB 4EO8A 4WKYA 2VG5A 2YKNA 5IV4A 5DDPC 1IUJA 5A0YB 1FE4A 1N32F 4USWA 2AKWB 4DSEA 1IVZA 3EVOA 4BWMA 3IGNA 3WQPA 3C2PA 3ENQA 2BRKA 2PDAA 3IGVA 2M52A 4NLSA 3SFGA 1FCAA 5IC6B 2AYEA 1FI4A 4OZ0A 2B5JB 1FE0A 2GAGC 1H2TZ 3KMQA 3FSYA 2OPQB 4J9VA 1U1KA 1JLEB 4EO6A 3P45B 4O0IA 2P2CB 5HBMB 2QYCA 1FKOA 2XS2A 1WUUA 1N32J 2KB2A 5K5MA 2BKNA 2WONA 2M9KA 2HS0A 1AFIA 4BHQA 4U9RA 4ELTA 5IT4A 4WK3A 5ETNA 1GXUA 2YNGB 3DN9A 5F8IA 3ZTQA 2GVDA 3GTYX 4NLRA 2F4FA 3HCXA 3BPDA 2I8EA 1X4GA 3MECA 3TX8A 4ZJQA 4XIUA 2AGOA 5K8MA 4JI7J 1TV6B 4GRSA 2E5LJ 3HHEA 1M5SA 4ECWA 3KG1A 4ZCIA 5KFOA 5KFWA 4K0KF 2KT5A 3LPEA 4B02A 3N5FA 3D6HB 4XK8C 3LWMA 2HFOA 2OEKA 2J0SD 2EKYA 2JWNA 1QD1A 3K8WA 3MUMP 1ZTTA 3ONQA 3ETOA 2YKQA 2XMVA 3OR1A 4GVBA 3I5AA 3SXLA 1OY6A 4OI2A 4ED0A 2O66A 3HKZD 1UVIA 2CDQA 3B6BA 1WF1A 5L1JA 2XMWA 5C2CA 4X65F 3GONA 1YBTA 3UFCX 2HHHJ 5HROA 1NKEA 1FNXH 2GX8A 4DUZJ 4B9SA 1JX4A 4QU6A 1BC6A 1C4CA 4JYAJ 1GMWD 3TZXA 2VJUA 2RJZA 3H40A 4OHXA 2CRLA 2XZTB 3FMBA 3PJ9A 1AT1B 1P9QC 1HYSA 4X4QA 3BBCA 4O4RA 2Z58B 5KFYA 1DTQA 2DTJA 3OR2A 4H4MB 1DQAA 5JUMA 1I51B 3HVWA 1HI0P 2CQIA 2HHVA 5F8MA 2JX2A 3R6GB 3OJUA 2FHKA 3RAQA 3BDEA 1F9HA 3GPAA 4B3SJ 1SJ4P 4HACA 3C14B 1EQMA 4W98A 3HO1A 2XMKA 2N7CA 1JLFA 2VBYA 1FRJA 4USMA 8ATCB 4RWWA 1YBUA 1R6VA 2DNMA 4O44B 1A6LA 1U25A 3BQ1A 3BSAA 4NL5A 4I68A 3R5GA 5D4OA 3MEGB 2KG1A 1E6YB 3PM9A 4JI6F 1HW9A 3L7UA 3ZXWA 3MEEA 2N4DA 2K1RA 2OFGX 1OY9A 4QPTA 3IR6B 2XY7A 2DRBA 1C0UB 2J7KA 2YWGA 4IFYA 3HVTA 5KFRA 3RBEA 2ZH6A 3MCSA 4K50A 2HRTA 2J8SA 3DM2B 3E01B 4HDHA 4Z7CA 1JLCB 3HM9A 5DQGA 4I4BA 5HLFB 2KZZA 1XMQF 1NXIA 2MLZA 2AJ4A 3MUVP 1RKJA 4O3NA 2IC3A 3MM5B 1F6TA 4DSIA 3VAFA 5GMDA 4O4GB 4BC7A 1O0PA 2OELA 4PUOB 1WEYA 3NXZA 3I5BA 1OYDA 2DHHA 3I0RB 2PIIA 4O0NA 1RTJA 2AJ0A 2PMZD 4F2RA 2NUUG 2YTCA 3BGFA 3TARA 1N36J 2ZWOA 4DOZA 2A2CA 2CPEA 2E5HA 2Z56B 3CCTA 1T05B 1SC3B 4KHPF 3T1YJ 4KBIA 1FJ7A 4DDFA 2LDYA 4ZCMA 5H1SV 1RSCA 4ZPBA 3FMWA 5ETPA 1L3SA 3DFEA 5HQLA 4LFBJ 3FCVA 1FKPA 2BDPA 1QAYA 1IKVA 2L9NA 2FYXA 5ITHA 3RB4A 4M95A 4DJBA 2CPYA 2OP5A 3D6FB 2FJXA 4ELUA 2CQ1A 2DNKA 2WB4A 4Y28C 4QWDA 4LF4F 3NMAA 4B3RF 2QZ8A 1V3ZA 1T11A 3CW2C 4RLEA 1K8AT 3WIVA 2X1FA 1SI9A 4DSLA 3GIRA 2WK4A 1SUQB 3VAKA 3IC1A 3AJDA 3VZIA 1NDKA 1S12A 1Q78A 3N6LA 1W7WA 1TL1B 2JOQA 2WBMA 3W5ZA 4AQYF 3OFFA 3DRYA 1XQIA 2ZBQA 2V8PA 5DM7Q 4Q45A 1RT7A 4YR3A 1M5HA 1TKZB 2W01A 3M2UA 1NRKA 3PYEA 3CNQP 3S1TA 3TJAA 1FKAF 4B9UA 2IAJB 3OVAA 1BQXA 2GIRA 2P5VA 3NAHA 2BZ2A 4OX7A 4DV6F 5J2QB 1N5YB 3JQKA 2LEBA 1HWLA 1LW0A 1Q81T 2W8LA 3VWSA 1R0CB 3OSNA 1ZAVA 1VQ5S 1TFYA 3QIDA 4F25A 3CJKA 3TYTA 1OSCA 2IJRA 2VDHA 3PCOB 2MGZB 1NDPA 3C15B 3DRXA 3LP1A 5T41A 4HDGA 5CQGA 2KFNA 1RT1B 4NEYA 2GFFA 1VIOA 4TU8A 1U0HB 2FUG9 3EDRB 3VALA 5L38A 4JI5F 1AZSB 4ZIWA
chains in the Genus database with same CATH topology
4X66F 4I2PA 3ZZUA 1VIXA 3LPYA 1X4EA 3PFOA 1GX5A 4YQWA 3OVBA 5A6WA 2DT9A 2CZ4A 3PEJA 3K8VA 3OR2B 3MXHP 3G8TA 4PPDA 5KG4A 2YH1A 1TKXA 2ZC4A 4Q43A 4G1QA 4KO0A 2XI2A 5KFIA 1TVRA 3R1LA 1FTRA 4QOTA 5SZTA 2ZFHA 3MTKA 5L1KA 2DR9A 2AGQA 3O5TB 1JLFB 2VA2A 4IOBA 1YJRA 5K8NA 3DOKB 2AV5A 3PIOQ 3L95X 1NH8A 3T6JA 4OHVA 4JV5F 2JC0A 3OR1B 4LFCF 2V4JB 5A8RB 2PEHA 1H0HB 2MJNA 3OFGA 4EBDA 3M4XA 4R8UB 5IS2A 2FVRA 3PV8A 1X9SA 3QJJA 1LXNA 2MZSA 2HHQA 3TANA 1NK0A 3TUZC 3BREA 2RQKA 3PX4A 3UI3A 3UWTA 1NEEA 2YKAA 5AE1A 4ILMA 3MHYA 2HNDA 5HMXA 3P3DA 2DBBA 4PR6A 3SFUA 1S0MA 1WI6A 2V8VA 2HHTA 2GIQA 4LSNB 2OMOA 2V9KA 4NLYA 2EFQA 5LSRA 2XMMA 2RKIB 4HL9A 1TL5A 3GQCA 1VC6A 1HYSB 3KLGA 2VASA 1ZPWX 3I9V9 5KG2A 1M1KT 1H2UX 1RTDA 2JEFA 4J9OA 2JDJA 4KFBB 1T7PA 1NK5A 3KLIA 1QAIA 4M5DB 1GAOA 4RW9B 2YNFA 4DX8H 2Y0SD 2MQNA 3C8YA 2OPPB 1DHMA 4FNHA 2HNDB 3P96A 4KHMA 5GVQA 3M05A 4LJMA 3O1LA 4QW8A 4ILLA 1EETB 2KJVA 2DPIA 4B3SF 3I56S 4OI3A 2BM1A 5KG5A 4TY8A 5HI7A 4C11A 1HBNA 1OQ6A 1O51A 3HZGA 2DHSA 4P7VA 3M8QB 1FO1A 2DGQA 3MM7A 4L3NA 4DV4F 4DSKA 4IKAA 2OIHA 3J7YU 3CEDA 4P7TA 3AJ1A 2UV8A 5L9XA 5LJ5Y 3NGDA 2VG7A 3QYYA 3RRKA 3OBIA 5BYSA 4WFNQ 4DR1F 3UPFA 5KT3A 1X4BA 3BR9A 2UV8G 2D3ZA 2DNNA 3PW5A 4LVNP 1LW0B 2GQCA 1C1CB 2CPJA 3CD0A 3MFHA 4FF1A 2IRXA 1S10A 3OTBA 4MFBB 5A6PA 4KQZA 3OUYB 5E33A 1FTCA 2CZVC 3GSDA 1KNZA 2ILYA 2YNIA 2ZE2A 4URGA 2Q66A 1KLNA 3IA0A 2ZM6F 4FF4A 4J9MA 2DGOA 3VAGA 2FC9A 1VRTA 3BZQA 3QIPB 1SL0A 2FLPA 4PG6A 2KYXA 2ZHOA 2W8KA 1N34F 5KFTA 2DO0A 5L9NA 1VJWA 1B0TA 4PWUA 3QLHA 2R2UA 1FRXA 1LFWA 3SSRA 1HWIA 2L9WA 4FVMA 1VK8A 4KV8B 3I96A 4DPOA 3WZ0A 4XPCA 4YR0A 2I2YA 4C8LA 1KD1T 4A8KA 2G1DA 4NLQA 3MWBA 4Q2MA 4TYAA 1U09A 2ZHAA 5HMWA 4Y0FA 2MGZA 3ULHA 4ZS6A 1TK0A 3GV7B 4Y2IA 4M1KA 3H2LA 1ZM3A 4DG1B 3VAMA 2QV6A 3CJ0A 2C42A 3TUJC 3CB4A 1MWYA 3ZZTA 3M8SA 4PXBA 5DGAA 1WI8A 2J0QD 2J6SA 2ASJA 3PW4A 3NCQA 1MNEA 3LO3A 2R4FA 4OLPA 3FGVA 4PG8A 3MM5A 3QJPA 2LQBA 2EFVA 2HGNA 1RDRA 1PC4A 2ROGA 3NGKA 3QGHA 4NLWA 4OZLA 5DJBA 4RNNA 4ECZA 1FXDA 2LXUA 3R5AA 3G6XA 2ZBIA 4C8KA 4PCQA 1FNMA 1QY7A 3W2WA 3NL0A 2OJ3A 3V6HA 3TR5A 2CQ2A 3MF5A 4Q0BA 2C2RA 2KFZA 4IFYB 2ZKTA 3FEXB 3V4MA 2WSCC 3TAMB 4HH1A 1FXLA 4ZHRB 1SL2A 4KIAA 5BJRA 2LEPA 1FDNA 5KAKA 2CQ0A 4YB1P 4DS5A 3K5MA 1OPIA 4O4GA 4RKUC 5A2QY 2VFSA 1S0VA 4NWBA 1FRIA 1SB6A 3PRDA 4IR9A 3K0JA 4PKDB 3ISNC 4YDDB 4C2MA 3G71S 3NLCA 4URQU 2D3OR 3HKWA 2IA0A 4J9LA 1GH8A 4A8XA 4AXJA 3K2YA 3MI7X 2ZJRQ 3G6VA 2DD8S 4ZVEA 4QQBA 4RZRA 3PO5A 3SCIE 3ZZZA 2HRYA 5A8KB 4J9RA 2CVEA 5FLXY 3CDAA 4OV1A 5HROB 4F26A 4WYWA 1GT8A 3KYLA 3PX6A 5GAHU 2G4BA 3HHLA 3POTA 3V81B 3KLGB 1RP5A 4LF5F 1JLQB 2IBOA 3DDKA 5B0AA 3LW5C 2QLXA 1XR6A 1AROP 3IR7B 2E9RX 3MMBA 3RW6A 1XTZA 4KHRA 1TV6A 2DPJA 4U6PA 3I4PA 4TQRA 2IRYA 2CJAA 3OTCA 2ZJQQ 5I3PA 3NS5A 3PIPQ 4HI1A 3GFHA 4LVOP 1NK9A 1FRKA 1YJTA 4R0EA 4C9DA 2JRSA 2LLZA 2V8HA 1K1QA 4ZPAA 4I6WA 4JI4F 2IMOA 2MSTA 2DVIA 2JLGA 5KG3A 1C0UA 3DOLA 4ZPVR 4WKRA 4MK7A 1Q53A 1JLBA 4QYRA 4NX9A 2BABA 4E98A 2DNQA 1NU4A 2OPQA 4OHWA 3BN4A 2PO4A 2HNZA 2V9WA 5CHCB 4CO4A 1G2EA 1R3NA 2L08A 3GIJA 1UEUA 2KO1A 1XC9A 3PKMA 2NQPA 1KTVA 2AJ1A 4DMZA 3D0IE 3RAMA 2COLA 1CQMA 3PY8A 4RUHA 3TAQA 5DM6Q 1HI8A 3D1OA 3H5UA 2E1MC 3L3CA 3CIMA 4CO3A 2HRUA 1X4HA 2W7PA 1KFSA 2BA9A 1UMJA 3CJ2A 1YRXA 5KFVA 3D0GE 1SJRA 2U1AA 4CH7A 1GXTA 1HWKA 2KT2A 4QBUA 1VLYA 4USHA 1D3WA 2V8DA 1SKWA 1HD1A 2MZRA 3M2RB 3CDBA 3TAPA 4IQXA 4KFBA 2XBPA 3FCHA 4PG4A 3U1MA 1GTEA 1HL6A 2EVZA 3O2IA 1YJVA 2VG5B 2YKNB 1C1CA 3KG4A 1UETA 2GQQA 3DOKA 3T6BA 3VTIA 3GIKA 1ZH5A 3NRBA 2AJFE 5LJ3Y 1OSDA 1M5PC 2RQ4A 4LSNA 1UVMA 3GWCA 1JXEA 1PILA 1VMBA 4F67A 4CT9A 3JTPA 4MIAA 4C0HA 2ZZNA 5F0WA 4C97A 1R0AB 2G13A 2UP1A 1LWCB 5EUHA 3GFXA 1WHYA 2XSJA 5B0CA 4LUBA 4ZP8A 4K4SA 1WD6A 1Z2ZA 4IH6A 1IKVB 3PNIA 1IKXA 5HP1A 1Y4ZB 3D28A 3U1LA 2YWKA 4OI4A 1UJ6A 3JAMY 2B0GA 1SKSA 1LXJA 5E7OB 3UCUP 1VQOS 3SV3A 2EG1A 2GHVC 4FXVA 5HMZA 4DQRA 5J2MA 5KFHA 1S97A 1VC0A 3VQTA 5CCLA 4ILRA 1FVQA 4OMFG 5J1PA 4PUOA 1U1LA 2EG2A 4ECVA 1YRUA 3BGLA 4TLRA 1SBRA 2UXDF 3M2UB 1FERA 3HHLB 3POTB 3V81A 2C3MA 1R8PA 3HHKA 3EX7B 3D1HA 3TUIC 2X1AA 1VS3A 4I2PB 4ITSA 2G9OA 3KJVB 2PN6A 2PA3A 3UCGA 1J5OA 3M6XA 1NNDA 3T5LA 4YR2A 3LP1B 4JI8F 2HVIA 3CCMS 2BQ3A 5CYQB 4MK9A 4R8UA 4MTPA 2RQMA 4I69A 2DIUA 4UY85 4IH7A 1UP1A 2ZOMA 1N5TA 1VQYA 3FQKA 3PDNA 1U1RA 4W92B 5H9EJ 3SCKE 7FDRA 2CIMA 1T03A 5KFMA 3M8RA 4GO7X 3GG1A 5FD1A 3PRBA 2V94A 2ZD1A 2PMHA 1SIWB 2O5DA 1TKTB 1TVRB 1EP4A 2OPRB 3MMJA 4P6QA 3M9OB 1WG1A 4WJBA 5EWFA 3CE8A 1KRPA 1U48A 4DR5F 4DUYF 3FSIA 3AY0A 4YDXA 2I38A 3UDLA 2HHSA 1VQKS 3DDNA 2IM3A 2XY6A 2HQ3A 2HAIA 3G8QA 4DR4F 4UY8T 2PFFB 4WXOA 3CC2S 4QIVA 3R1HA 4WFXA 3LANA 1T8EA 1A9NB 4NCAA 4NLXA 2C2DA 5F8LA 2DHXA 5GAGI 1I6JA 3MGJA 2P9GA 2DK2A 4WIIA 2MKKA 1ZETA 3S01A 1QUVA 3GV8B 3MAQA 2VC1A 2KT3A 2FJEB 2J8AA 1M5KC 2R7UA 2IBKA 5IQ6A 4I56A 3BF4A 2C28A 4OX6A 1MROB 2R7TA 1GNKA 1DTTA 2OPSA 4C0BA 3T1YF 3EPIA 2UZAA 2CJ9A 3IAS9 4N47A 3NS6A 3RU0A 2XGQA 4GC6A 2HHXA 3PO4A 4LF7F 1WACA 3P5TL 3N9UC 3HZEA 2CQ3A 3CCVS 1FKOB 5CZXA 4LQ3A 3OVSA 3M30B 4NZ6A 2B6AB 1JLAA 2E66A 3FQLA 2KU7A 3DMJA 1MU2A 1NAQA 4A4JA 2NREA 5DQHA 2RU3A 2GHPA 3JSMB 4FZVA 4MIWA 1F60B 1ZAXA 1KHWA 4G6VB 2IVYA 1QSSA 4PG5A 1BD6A 3AB4B 3MPWA 4BWJA 2UUAF 1N54B 4U7CA 5GADI 3KMSA 3SDEA 3CWJA 5KFXA 2W9BA 3MR5A 3ICLA 3K58A 1HQUB 3I31A 4QYZJ 1SXLA 3F41A 1HBNB 1SKRA 3TOQA 3PFEA 3RRGA 1JJHA 2QT7A 3HF5A 4USJC 4X4RA 3IRXB 2Y1JA 3B78A 4GC7A 1IN0A 2VUGA 3LGNA 3N01A 1U1PA 2GQ2A 2KVIA 2YNFB 4ID8A 4ES3A 5JJBA 2ZOGA 2A1BA 2VPZB 3MZIA 2F7VA 2B4PA 1MW7A 4TLQA 2FJWA 3U27A 4Q8EA 4AL5A 1X4AA 1FD8A 1YSJA 1WHWA 1XBWA 1FESA 3CO9A 4EUVA 2VD3A 1FJGF 1VQLS 1K0VA 2FHJD 4YEAA 2P9EA 2Q6BA 5C24B 1FJCA 1X5PA 4PRFA 1HARA 5BR8F 2MSSA 2CPIA 4USIA 5DG9A 2YX4A 2FVPA 1NJYA 3R3TA 2RRAA 1PC5A 1RT5A 3KLHA 2AGPA 3LP0A 1HW8A 2HWTA 1D8ZA 4PPZA 3DRSB 1VBXA 3THPA 2MYFA 1HNZF 1X5SA 4IG3B 2KXFA 2M7SA 3HXMA 2AX1A 2NXUA 2VA3A 2B3TB 1YHQS 1M0SA 3MEDA 3SSSA 3US5A 4Q7AA 2ZH9A 1WTBA 1NB7A 1LW2A 5KFBA 4EGLA 3THTA 4MJKA 2R8HA 1SH3A 2QA4G 3DC2A 4FXDA 4RW4A 3Q23A 3DMJB 2A3JA 2RU9A 3IG1A 5E41A 4DV2F 6FDRA 4A8SA 4OJGA 2ZJPQ 2JC1A 3TI0A 4X62F 3N6MA 2KXNB 1X8DA 3OL7A 3DLHA 2BXJA 1F5CA 3CJ3A 1MMDA 4MIBA 2B4VA 2RKIA 2XSFA 5DRKA 2VPYB 4OI0A 3UDCA 3F44A 2HS4A 4NOHA 5DLFA 1S0OA 2F4VF 3VAJA 2QIFA 3HVRA 2I1RA 3GR0A 2BQRA 2GNKA 1K9MT 4TU7A 4NA2A 2ACYA 2B9YA 5KFEA 3MPVA 1NKCA 3DYAB 2XNRA 1U26A 4DQIA 2JL9A 5F9LA 1W25A 5ADZA 3PX0A 3OXLA 1CQNA 3OL9A 4ICLB 1AFJA 2D1CA 4WU3A 2RUGA 5GAEI 1RYRA 5C42A 3G6YA 4DUZF 3GIMA 2HYIB 2J5AA 1FNOA 3J7YI 3QGGA 4F4YA 1P6TA 3N6NA 1G3OA 2XZWA 1QVFR 5BYQA 2CYYA 4MAKA 4JV0A 3Q8RB 3MD1A 1BQMA 2MKIA 1KSPA 2WOMB 3KK3B 3IS9B 5CYMA 4K4UA 5IWAF 3MPYA 4CO2A 1DLOA 1LOUA 3KNGA 1RTJB 4IFVA 4CO1A 5A8KA 1D9DA 3Q8PB 1TL3B 2BACA 2NUHA 2KRBA 2ZH3A 1M5OC 2X1BA 2DH8A 4AYBD 1SC6A 3T19A 2K8GA 2BE2B 2KH9A 3IG1B 1HPZB 4YUDA 3K59A 1U47A 1J5EF 2IC3B 5IXUA 5DQIA 2B7BB 1DQ8A 5E3QA 1QTMA 1S1XA 1U1QA 2YKMB 3EGZA 4DV7F 2E9ZA 4J9QA 1X0FA 1IR0A 2RT3A 3LALA 2E29A 1S4FA 2MY8A 1F2GA 3NP5A 3IR5B 4C7QA 4BS2A 3S7RA 1R6YA 1M5VC 3F56A 1JNRB 2DO4A 3KHLA 3QZ8A