1APSA

Three-dimensional structure of acylphosphatase. refinement and structure analysis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
STARPLKSVDYEVFGRVQGVCFRMYAEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of acylphosphatase. Refinement and structure analysis.
pubmed doi rcsb
molecule keywords ACYLPHOSPHATASE
molecule tags Hydrolase(acting on acid anhydrides)
source organism Equus caballus
total genus 27
structure length 98
sequence length 98
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 1991-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1apsA00
1S6OA 2XMVA 3KKFA 1QUPA 2GA7A 2GCFA 2LQBA 3LGMA 3HHLC 2ZDOA 3FMBA 1RJJA 1U7LA 2XMMA 5B0BA 2RU9A 1YJRA 1CC7A 3LGNA 1X0PA 2N4DA 2W4DA 4OIXA 4Y2IA 4A48A 1OQ6A 3HF5A 2AW0A 1Q4RA 2G9OA 2K7KA 2L3MA 5B0EA 1V3ZA 3HHLD 5B0FA 1K0VA 5B08A 3E8OA 1KQKA 4A46A 4Q2LA 4HL9A 3HDSA 1FVQA 3I9ZA 4ZOSA 2RILA 3LO3A 2PD1A 3BB5A 1Y3JA 1OSDA 1YJTA 2AP6A 2ROEA 3KNGA 1TL5A 2ASYA 2XMKA 4Q2MA 3CJKB 4A47A 3CJKA 3T9NA 2IYGA 2K2PA 2RSQA 4YDXA 5F0WA 3VTIA 1FD8A 2IFXA 1KVIA 1GXUA 3QGPA 2VV5A 1R6YA 3IWLA 1YRXA 2K7JA 2QLWA 1FEEA 1OPZA 2N7YA 1FE4A 2XMJA 1SQEA 3IWXA 1XBWA 5K9FA 1KVJA 4FNIA 4Y2KA 2HLUA 1X8DA 2ROGA 2OD4A 2FB0A 1N5SA 5A6PA 2W4CA 4HI1A 4DPOA 4HI2A 1FVSA 2BUNA 3K7RA 2CRLA 1URRA 1MWYA 1FE0A 2FTRA 2N4CA 2RMLA 2W4PA 3BGUA 3GZ7A 2ROPA 4OJHA 1Q8LA 2BJDA 2HIQA 2LQ9A 2GGPB 1YJUA 3HHLA 1P6TA 1VQSA 2GGPA 4A4JA 1AW0A 1SB6A 4F67A 2BYCA 4QOTA 2KKHA 2K1RA 2XMTA 5F0UA 2GO8A 1CPZA 1YG0A 2ACYA 4DN9A 2LDIA 2LXFA 2KT3A 3DXSX 1CC8A 2BJEA 1JK9B 4OJ1A 2Q3PA 2GFFA 2EW9A 1JWWA 3BDEA 5IXUA 1Q8BA 4U9RA 1GXTA 2XMUA 2XMWA 1X7VA 2QLXA 3BF4A 1TZ0A 1Y0HA 2BBEA 3BM7A 3HFKA 3TNVA 3TRGA 2GV1A 1FESA 3BN7A 5T7LA 5KAKA 1OQ3A 3F44A 2OKQA 4HH0A 1AFIA 4EFAC 1TUVA 4DL0C 5B0CA 2VH7A 3QMQA 3UDCA 4ZA1A 4OJ3A 1Y9OA 1TR0A 3BR8A 3HHLB 1MWZA 3TOQA 4NL5A 5B09A 2OMOA 2K1RB 2HFOA 5A6WA 1Q53A 4HH1A 1LQ9A 2OD6A 1AFJA 2HLTA 2IYIA 2AJ0A 4OJGA 1W2IA 3FRYA 2FIUA 2QYCA 1WD6A 2JDJA 2KYZA 1TL4A 2OFGX 2ZDPA 3DCAA 1P8GA 4NPOA 2KT2A 3WDOA 1N5QA 4YEAA 3KG1A 1N5TA 1VQYA 5B0DA 2OAUA 3MZIA 2PGCA 3KG0A 1YJVA 3MCSA 5B0AA 5T7LB 4Y2MA 2OFHX 1ULRA 1IUJA 1S6UA 1N5VA 2HQIA 2HFNA 2OP5A 3HX9A 2FHMA 4FNHA 1APSA 1SI9A 3FGVA 5B0GA 1Y3KA 2AJ1A 2QIFA
chains in the Genus database with same CATH superfamily
3POTA 2HWIA 1U02A 4OZ0A 4WE1A 5ETTA 3KLGA 2W2PP 4D3GA 4HR2A 1L3TA 4FS1A 1YQHA 1QM9A 3EZUA 4MJKA 1S59A 5KFLA 1Y3JA 4NCGB 4LF2A 3GYGA 3BGRB 4LRDA 4LF1A 2HHSA 1BXNA 2ASLA 2XWYA 2R7SA 1FE0A 3VAJA 2GGPA 5KOWA 2DGWA 2RNEA 4ZVTB 4CO4A 3F41A 3AJDA 4USWA 4EUVA 3AD7C 2V8VA 4ECUA 3CB4A 5KFQA 2J7KA 3U7JA 2YH0A 4ZK7M 3M05A 2MPUA 2BRKA 1CSJA 1SVDA 3R9LA 2EK1A 4ED6A 2CWXA 2DGQA 4ZHRA 3RBDA 3TI0A 4CO1A 1B0VA 4WYWA 2G13A 2FYXA 2H3EB 1NEEA 2OLWA 1RAFB 2YY3A 2B56A 5DDPC 1SKSA 4QIEA 3CO0P 3MM6A 2UXCF 2K2PA 1ZA2B 1KVIA 1PAUB 1RT6B 3M6UA 4L6V3 1R6YA 4EWTA 2H51B 3FNNA 4UW2A 1FFSB 9RUBA 3CD6S 4LF5F 4KGMA 5JMNA 2X7IA 3DC2A 3G87A 2GJFA 1RTDB 2QFJA 2CPZA 1WI8A 2HZCA 5HVFA 4UZCA 4KYZA 1RZMA 2ZBIA 1RT3B 2FUG9 1E6VA 1DHMA 4Q44A 1NDLA 4M95A 2UU9J 3BO4A 3OTOF 2XI2A 1UVLA 1IJEB 2EFQA 1K47A 1NSKL 1UW9A 1XJWB 2LLZA 1GTHA 3H20A 4OYXA 4NPOA 1HWKA 3R97A 3GJQB 4B3OA 1JKHB 4DR4J 3KJFB 3CD0A 1H2UX 3DOLB 2V4JA 1ZPVA 3ZNJ1 4ZS6A 4C11B 1RHQB 1HHQA 3GU0A 3KDOA 4UOGA 4OIXA 3GYXB 2YWKA 1V3ZA 1TV6B 4P74A 4M5DB 4FP9A 3CCSS 2Q43A 1RBAA 3DLEB 4QWEA 1DQAA 1KQSR 2VV5A 1T8EA 3Q24A 2BABA 1FRMA 2KO1A 3M4XA 1EQ0A 1E6YB 3EZOA 2YNFA 5AT1B 1HQEA 1NJYA 1N32F 1AUSL 3V6JA 4YR3A 5C7PA 2AGQA 4CI0B 1KLNA 5DLGA 2ZFHA 3PYDA 3PX4A 3OBIA 3SQGA 3QT8A 1T9UA 4ZITA 3VQSA 3CCMS 3MTJA 1YI2S 1HYSB 2MZQA 4MFBB 5D0RA 1HNIA 3GG0A 4DV4F 1GMWA 1RK8A 2XO7A 3R1LA 3AJ1A 3MZIA 3G6ES 4J9KA 3KK3B 4QWCA 3ZTRA 1IQZA 1FJGF 2L41A 5A2QY 4FYDA 2YWHA 3M6WA 3CJ8A 1L3KA 4WTYA 3SQOP 1IR1A 3BBFA 4YB7A 4RNMA 3HI9A 4DSLA 2LQBA 1FDBA 1RLCL 5CYQA 2QLBB 3V4MA 3W62A 2VQEF 4PG8A 1NBEB 2A2DA 3AXMA 5D77A 4R5PB 4ED4A 4C3LA 2C2ZB 2W9BB 1WC5A 1N48A 2DNRA 4EBEA 2RQCA 3LGHA 1HNWJ 5GVQA 5HVHA 4OHVA 4XDCA 2EKNA 4IDKA 3QSYB 3MECB 2C3YA 2HGMA 4OZNA 3E01A 4DHVA 2Q6CA 4WK3A 4OX6A 2VJVA 2B9WA 1UFKA 2AGOA 2DXDA 3F44A 2MXYA 4ELTA 4EI2A 4YR2A 3LP1A 4WPAA 5C2CA 2HLTA 2QG9B 1NDKA 2Y8YA 3R7NB 1B4SA 2C22A 3NXZA 3R5GA 2HVIA 2Y1LB 5L9XA 3DRSB 5L38A 1W7WA 3K59A 1FRXA 3P6YC 3IRXB 3LGMA 2QL9B 3LGNA 3MURP 4RW7B 3D54A 3EX7B 3L95X 5GAGI 1SH3A 1YJTA 1XNRJ 4QIVA 2BQ3A 2LXIA 2Y3YA 4K4UA 3O44A 2ROGA 1N5SA 3QNWB 1T95A 4H4OA 2W4PA 4KTQA 4ID5A 1LOUA 4X84A 1FNMA 3LPYA 4JI5F 1KHVA 3MPYA 1ROFA 5A8RB 2CPIA 4M5MA 3KNAA 3C6TB 2QLXA 4ECSA 1RI7A 1RWNB 2NSBA 3E51A 2HNDA 1BQNA 4B3SF 1YTYA 1MN7A 3OR1A 4DOZA 1H98A 3FRYA 1EP4B 5D78A 1XK8A 3GWCA 2DHSA 2C2KB 3MM7B 2HHHJ 1RT2B 2D9PA 2G0JA 2RJZA 4I67A 4NLSA 3PFOA 4KT0C 3QWPA 4KFBA 4F7VA 1S4EA 3BSNA 2M5YA 1H3DA 1G6BA 2Y1RI 2OPSB 3ET6B 1U24A 2LQ5A 1U1QA 4Y2CA 1RHMB 1RA7A 5F8IA 1URNA 3MOZA 2WSEC 5IM0B 3J7Z5 3QJLA 1Q1KA 4FDFA 3TVZA 2NS1B 2N7CA 1PYSB 1Q82T 4RW9B 5KFRA 5M2RA 3OVSA 3TVKA 3DLBA 2HSEB 2VKRA 4DR7F 2J7WA 1IBLJ 2KFYA 2B4PA 2JWNA 4RO0A 2BJ3A 2QLFB 5KFFA 3EPIA 3Q8QB 4NLGA 4X2BA 1AZSB 3KK2A 3NMAA 4OJ3A 1SJFA 1REVB 1CS4A 1KQGB 4I7FB 2R8JA 4GVBB 5ETPA 4FYWB 1DZ5A 1HNXF 1HWJA 5H9FK 3T41A 3W3SA 1N34J 3SCIE 1N36J 2CIMA 1VQOS 4BDPA 5T7LB 2GAHC 3N9UC 5C25B 1VIOA 3OR2B 2ZBQA 2R7VA 2IRUA 5ETOA 3X1LB 4JI6F 4DCJB 2GHWA 1Z4UA 4CP5A 1CJTA 4KV8A 1RAAB 4M94A 4ZP8A 3QT7A 2AW0A 2F1FA 2FHJA 3TQEA 1NK5A 4ZJOA 3UE2A 1SJ3P 3DOMB 3M8WA 2EKYA 2K3IA 1U6BA 1CEZA 1R3NA 2CJAA 1NO8A 3GE9A 2LCWA 1QSYA 4KY3A 4Y2AA 3DRYA 4M1KA 5IC6B 4HTJA 2B9XA 4RX6A 3OVBA 1TVRB 5ETVA 2JOQA 4KKOB 2K1RA 2GVZA 3WHIA 1GT8A 1A6LA 1UVNA 3OSNA 3TUPA 3BF4A 3TO8A 4QW8A 3PR4A 4WTOB 3ISZA 2JX2A 2OSQA 3ZZZA 4MKAA 4YN3B 1N33J 2XZWA 3ILLA 3A8JA 2HK3A 1FKOA 1ZTWA 2NUUG 2J8SA 3H4DA 3UCZP 1Q7LB 1C0UB 3BS9A 2ZWPA 1ZPWX 4O4GA 3Q23A 1FNXH 2DH9A 5E2QA 2R7TA 1D3WA 1YJNS 1NNDA 2ROEA 1WUUA 2QV6A 2HNYB 2L9NA 2QLWA 1FEEA 3T5KA 3BKFA 2HKEA 2IC3B 2OHDA 3CCLS 2DY9A 3GZ7A 2RMLA 2UUCJ 3J81j 4QCLA 1H74A 3SEOA 1HBMB 3GIJA 5F8HA 4FYVB 2BJEA 4ECWA 4DWIA 2HHXA 3FZ2A 4FYYB 1T0TV 3LP2B 4R8UB 3N5BA 5GAHU 2IVMA 3AD9C 3ZTQA 4DL0C 4PRFA 3R2CJ 1CJUB 1QUVA 2IJFA 9ATCB 2V6AA 2UU9F 4B3MJ 3NS5A 3DLKB 2QRRA 3AQOA 1ZZNA 3HJFA 1N5VA 5KFHA 4YR0A 3KLEA 4K4SA 2J9CA 4Q8FA 3T1HJ 1LW0A 4DR4F 1EQMA 1GK8A 2UUWA 3FEZA 3MPUB 4KB7A 2ZZNA 2DB1A 3CJKA 3G8QA 2BOPA 6FDRA 2CKWA 2N7YA 5A76A 3JSRA 2R7RA 4Z2XA 4XIUA 1WF2A 4ELVA 1DJ0A 4C48A 4DV0F 1L5UA 3TEGA 4ZJLA 1RTHB 3SI8A 5L39A 2RS2A 1RWUA 4OHZA 4K0KJ 3ETMA 2FLLA 4BWJA 2M8DB 2B6AA 1B99A 4NYOA 2OTLS 4CLPA 2KZZA 2DJWA 3SCLE 4IUFA 5CAAA 2JVOA 2BACA 5EWFA 1RT4B 3OSPA 1N5TA 2KN4A 3H0PA 5IQ6A 4FNHA 4C8MA 4DX8H 1AXQA 5HVGA 3HHDA 2LMIA 2CQPA 2YQ1A 4GC6A 4Y65A 1BQMB 4IH7A 2NZ4A 3V6DB 3BDPA 3MFHA 2XSJB 1FJ7A 4KHPF 5IT9U 4DR5J 2J5AA 3G71S 2HG4A 5AJ3J 3RB6A 1DLOB 2OEJA 3BBCA 2H5IB 4ANCA 3M1VA 1OS5A 3BR9A 5B7WA 2QN6B 1HNWF 4X4RA 1J27A 1P6TA 1U0HB 1BLUA 1XMQJ 1YRTA 1RADB 4HVZA 4ED7A 1C1BA 3QRPA 3SFUA 1A9NB 1HFEL 1N5YB 4KE5A 3MUTP 4USJC 3EWGA 5A8KA 2BKPA 4YB1P 1X0FA 5HJYA 2D9OA 5F8NA 5A6WA 1F5AA 2GVDB 2OEKA 4OYBA 4LFAF 2R2TA 2YTCA 1U26A 1JLFB 1RYRA 2B5JA 4X4VA 2WBRA 3KYLA 1DY3A 3MCMA 3GR0A 3CD7A 4ED8A 3UWTA 2Q79A 1YJRA 1F5CA 5CZXA 4NCBA 4CYUB 2YPZA 4RBVA 2AZ3A 4IG3B 1HI1A 3CEDA 4X4NA 4YFUA 3NRBA 5KG7A 3PY8A 5L8RC 2Z56B 2WW8A 1JLEB 2IMWP 1XNRF 5LM7E 2V9KA 1S1UB 2NR0A 4Q8EA 2NSCA 3RB3A 2J76E 3U1LA 4HT5A 2HIQA 3FMWA 2J8AA 4DSJA 1T02A 3I32A 1DFDA 2ADBA 3WC2A 2DHAA 4PUOB 2XGPA 3HCXA 5G0RA 3AFGA 2FPHX 2OPQA 5DGAA 2IRYA 3DMJA 3IS9B 1L3VA 1DURA 1CULA 2FLPA 3R2DJ 1J5OB 2ZBCA 4DFKA 3OLAA 3H59A 4DPWA 2FGOA 4DS5A 4DU8A 4F25A 2HHHF 5E5NA 3GCWP 1HMVA 3MEEB 3TJ8A 2IAJA 2GW8A 3X3UA 1NJIT 1V5IB 2ASYA 5KFTA 1R0CB 3GFXA 4URSA 2RSQA 5DRKA 2BANB 4DR1J 5FLXY 2CJXB 3CC2S 4B17A 1I1GA 4EZ6A 3KLHB 5KOXA 1KVJA 3DOKB 2XY5A 5A0YB 2CPHA 4EYHB 1TP7A 2WVDA 2DGUA 2R9LA 1SBRA 2WB4A 4LFBJ 1NKBA 2YKMB 1CPZA 4PABA 3QO9B 2YKQA 4MK7A 3MR5A 4X4PA 2H4YB 1FK9A 4DR3J 1XN9A 4DV5J 3TZYA 5HAOA 2R2RA 1LQ9A 3K5LA 2MJUA 3MPVA 3JQKA 1T9YA 1WC1A 2JFKA 4ANDA 2ZZMA 4OHXA 2IHR1 2A6OA 2OFHX 1M1KT 2DHGA 4NCGA 1N34F 3C6UB 3GP9A 1N36F 2VQFJ 2JZ5A 1D0EA 4YY3F 3HKZD 2DPJA 4M63A 3AT1B 1K1QA 4N47A 3Q8RB 2R4FA 3VGSA 4DQRA 2ZITA 4CO2A 3M32B 4OYOA 3HMJG 2CQGA 2BRLA 4CRJA 2M3DA 4IFVB 3QIDA 2B4VA 3BJYA 2HWHA 3VALA 4TQRA 1KOHA 2IA6A 5DS7A 2WCXA 4EK2A 1WDTA 2HMIB 4MIBA 3BSAA 1UWAA 3H2UB 1WKKA 2CZVC 2DEIA 5LMUJ 3FBEA 1UFWA 2E5JA 4WP8A 4AT1B 1Y5NB 1QAJA 4BHQA 4LT6A 3UDVA 5I3QA 1J2VA 4WJBA 1NK7A 2J0WA 3CJ0A 1YZ7A 2LA4A 4HHHA 2MKKA 3W9HA 5CYJA 4ITSA 4QIFA 4FBUA 2OELA 4W4MA 1O8BA 2RHQB 2JDJA 4ZPBA 1IR2A 4LJMA 2EG2A 1N33F 1OYEA 3LAKA 1SC4B 2ZH6A 1KC8T 2WRMA 2QMUB 3OFFA 3KK1B 3D66A 4JV5J 2XEXA 2F8EX 4I69A 1RT6A 4P2SA 1IR0A 1WC0A 4P6QA 1IN0A 5D0EA 1U6FA 4K2XA 1RABB 4CO0A 2X3GA 1VQLS 2DH7A 3I0RB 4B9NA 1RTDA 2PMZD 3WBZA 3BSOA 1RT3A 2QSWA 2XQCA 3P5BP 2DR8A 3O8WA 4UUXA 4LUBA 2JJ4D 3HK2A 4JI2F 2ZOGA 2QYGA 2E9ZA 1KLMB 2QFIA 1X4CA 2OUGA 1M5KC 5LSOA 5DQHA 2JSXA 2IA0A 2MLZA 3BKTA 5GAGU 1VIXA 1JKHA 3ZZRA 1CJKB 2V2ZA 3PEJA 2GX8A 2HVZA 1SV5B 3CJ5A 1WI6A 4C11A 4FF4A 2KT5A 2UVRA 1F3FA 5KG4A 1ZTTA 4C8YA 1XERA 4KGVB 5CYMB 4RBTA 1TV6A 2BE9B 3MM8B 2ERRA 2A3JA 4B3MF 2PA3A 2Z57B 3DLEA 2LU2A 1VHFA 5J1EB 1AT1B 3JSBA 3DRPB 2BQRA 1JLBB 5GMEA 3CCVS 1E6YA 1XMOJ 4CZCA 5I42B 4FVMA 2J6UA 3T1HF 1UVJA 1SQGA 1T9TA 1F1BB 3DI6B 5MAOA 2FD2A 4I6WA 4JI1J 4NX9A 4NASA 2V68A 4DL6A 3NCPA 1UJ5A 3UO0A 4LF8J 4GMKA 4JV2A 1HYSA 5ETRA 4ZPWR 4MFBA 1ZYQA 3FBBA 3OLBA 2MHEA 1JWWA 2EEYA 1XIQA 1RAJA 2DT9A 1RHJB 2V4RA 4ECTA 2HNZB 5KT3A 3IAS9 1NH7A 1Y9OA 3NGSA 3ZXWA 2PI5A 1S72S 4NLTA 3UNGC 1I5OB 3BH6B 2HQGA 1MROB 2PGCA 2BJ7A 3N79A 4YP3A 3JSMB 1U48A 2B3TB 2MKIA 1PYOB 2DXEA 2W9BA 4I2PB 3GYNA 4N5SA 4WE1B 4CWBA 2QC3A 4ZVOB 1K1SA 3Q8UA 2Z2YB 3NAHA 3GR1A 5KFJA 4DBQA 2IJNA 3SDEB 1BWVA 3MECA 3I9V9 4C98A 1S49A 1MMNA 2V2QA 2VG6B 2PFFB 3K58A 3M7VA 3CPWR 4LRFA 4NLDA 3N5FA 2ZVSA 2CPJA 4IH5A 3EVOA 1NM2A 3O2IA 5AJ3F 1NK9A 2GGPB 1VQSA 1VFJA 4QOTA 3M9OB 1N56A 1O6XA 3NKYA 3K0JA 2U1AA 4CT9A 4WFYA 3FZBA 3RB4A 3MMAB 4EBCA 5E3QA 1M1GA 4U7CA 3OTBA 1XMQF 3M8PB 3DRSA 2QT7A 2E9RX 4DV6J 4ER8A 3IRXA 4DF4A 4X62J 1NDPA 4RW7A 2APOA 5B0DA 4JYAJ 2DEJA 3KOAA 4LREA 2VFSA 2Z2LA 3SZ2A 4P75A 3R8YA 1TKZB 3MXHP 4G1QA 3BH7B 2W4DA 3OL8A 5AE3A 2ZNZA 4ZCMA 2HZVA 3MM6B 1KP6A 2CYYA 2I0XA 3BYRA 1XQIA 4F4AA 1KTVA 3HVRA 3GSDA 1T11A 2P6SA 1VRUB 2K7JA 1S9FA 1WF0A 5A8RA 3VAFA 3HSGA 1JLGB 3C6TA 2F9DA 1NMEB 2CQ2A 1RTJB 2N4CA 5HATA 3IXQA 5ETNA 3CSKA 3GIMA 3LALA 4U96A 3PW7A 4EO6A 2GNKA 1SPBP 2F5GA 1VOMA 3PACA 5LT5A 1OQ3A 3KFWX 3MM7A 4MAKA 1RT2A 3GSIA 1HR0F 2DNPA 1XR6A 3I87A 3RRGA 4ED5A 2FY8A 1IM4A 2BV3A 2Y8WA 2OPSA 3ET6A 2HHWA 4F0KA 4DUZJ 3DN9A 1HBOB 2RHSB 2D3UA 2YKPA 3NNCA 4A8OA 2OH2A 5IM0A 3QAEA 2CQ3A 3HKWA 4AUKA 4NLPA 4RW9A 2GHPA 4LIWA 2NXNA 3CCWA 2QSFA 4PR6A 3GPAA 2YX7A 2D3OR 3P4UB 5KT6A 4QYRA 2VFTA 3J7ZT 1Q8IA 5IOLA 1DBDA 4DR1F 1U0SA 1AZSA 1DQ9A 1I94J 4M5NA 1REVA 3MEGB 4I7FA 5DDQC 4GVBA 1OMSA 3NWRA 2W7OA 2KG1A 3G86A 5IXUA 4LFBF 2UP1A 3TRGA 5T7LA 2C3OA 3VGUA 5C25A 3OR2A 1VQ5S 5D4LA 5J2QB 4UTGA 5KFOA 5HL7Q 1D9FA 1FI4A 3KUEA 4KPCA 4DR3F 4L72B 4DV5F 3MEDB 4TU8A 3GJRB 1LXJA 3ZZUA 1LK7A 3VR1A 2R2SA 2PC6A 4LRCA 4NI2B 4N76A 4YDDB 3TP2A 1X5OA 5FJ4A 3DOMA 4C9DA 4TY8B 3PJWA 3D0GE 1O5JA 3SV4A 2HHTA 5KFPA 3ENQA 1HWUA 4DL4A 2VQFF 3EMTA 3H42A 3CDEA 1VQPS 5FDLB 8ATCB 1TVRA 4KKOA 3RR7A 4J9MA 2LQ8A 5HQLA 5KFBA 2YQ0A 3W9IA 1FXRA 3B8HA 3WX4A 4UOFA 5BYQA 2CQ0A 1S1XB 4KH1B 2BUNA 5KFGA 4J9UE 3QSIA 8RUCA 1LV5A 3SSSA 1S6QB 1HKAA 2XNRA 3N28A 4A8SA 4GKKJ 3LP0B 1D1UA 2IRXA 3FCHA 1S10A 2CPXA 4K4XA 4B02A 5LMUF 1NB2A 3KLFB 2H1YA 4IRKA 1HA1A 5K5MA 1X5PA 4NZ7A 3KJNB 1WNEA 2KB2A 1DAXA 3A4TA 2PE8A 2YNIB 1N8RT 3NS6A 2LECA 1BY9A 1AFJA 5HMXA 1C0UA 3THVA 4CLYA 1HPZA 4CIOA 2AEMA 4DDFA 3OV7A 1ITPA 3DLHA 3CJRA 3QAUA 3MD1A 5ETQA 3NNAA 2ASJA 4CLKA 2HNYA 1L3UA 4X4OA 2XG8A 3GV7B 2ZC3A 3MMCA 1LK5A 3SBMA 2IC3A 4JV5F 3UR3C 2DGOA 4Q2MA 1HBMA 1RWPB 2YXLA 3AB4B 1NRKA 1MN9A 4LMZA 2BXJA 1FDAA 4OYMA 3UVJB 3UPFA 2BW7A 1CJUA 4JI3F 5KG3A 1LEOA 5F0UA 4F36A 4ZN1A 3HSDA 1I51B 5T14A 3DLKA 5HN0A 2YWFA 2LVWA 3NCRA 4L3NA 3IWNC 1RACB 3BSCA 4F0HA 2GMJA 2IBKA 2V63A 3EGVA 3HFZB 1NHVA 5D0HA 4OZJA 1T3NA 3G8SA 3EJMA 1UVKA 1B64A 5B0AA 2PA8D 4JI8J 1TL1B 1JJHA 3DXBA 3T19A 1IBKJ 4Y6IA 2QO3A 1S0MA 1ZBTA 4NE9C 4QWBA 3DU5A 3HO1A 2KFNA 1UL3A 3P45B 2IBOA 2FC8A 4ZIVA 2DNMA 3OQ2A 1X4BA 4USUA 4ZVRB 3JTNA 4FN5A 4USVA 1JLCB 4CH1A 1YZ6A 1XMOF 1RTHA 1TKXB 3H8YA 4LRBA 1PCAA 3NEKA 2RF2B 1P1LA 5C42B 4DI6A 1WJ9A 5L1JA 2C28A 5CD4H 2YQ3A 1Q8LA 4JI1F 1Q86T 3FEYB 2CQIA 2P6TA 3RAMA 4LF8F 2FQQB 6AT1B 1WHXA 3BDEA 2IVYA 1RT4A 3JYTB 1R7IA 2ZKTA 1B7FA 1Q5YA 1S6PA 1AFIA 4EFAC 4QU7A 4IO9Q 3BGLA 3HM9A 4W98A 1QAIA 5E3RA 1WSRA 4YOEA 2C2EA 4FPIA 3CW2C 3CXCR 1BQMA 3IM9A 1PIEA 1LXNA 2F4VJ 3V6DA 2OEMA 3P49B 3HLUA 3K5OA 2XSJA 4P2FA 5EGYA 3VVTA 4P71A 4RL1A 4RR5A 2X3DA 4ES3A 2AJ4A 1EARA 1RT7B 2JL9A 2WSFC 1NK8A 1CJTB 4KV8B 1DLOA 2DISA 2CJ9A 1PJ7A 3UD3P 5GADI 2ZOMA 2IMOA 2PI4A 3IR5B 2Y1JA 1V6HA 3CTRA 1U0HA 4MH8A 1R43A 2W7PA 2BEFA 1PKUA 1FRIA 2RUSA 2W4CA 2FJXA 2VUGA 2LEAA 1UA1A 2O67A 1AW0A 2RT3A 1U1PA 2GVZB 4OI2A 2EFOA 4X66F 3JSYA 2UUAJ 3PHEA 1FA0A 1LFWA 2GFFA 3OUYB 2VOOA 3UD4P 1HW8A 4HLBA 3DFEA 5CCMA 5KFIA 2I8EA 1YSJA 1RXOB 3R7BB 1N88A 1NSAA 3OD2A 2VPZB 2PMHA 2XLJA 4NZ6A 4LFCF 5KT5A 4CYUA 2FZKB 2RVJA 2E7XA 4DV6F 2VFUA 4IG3A 1FKOB 2MTLA 2DGTA 5B0GA 1ZH5A 4O0NA 3L09A 2XWXA 4JYAF 3RAQA 3PDNA 1C0TB 1JLEA 2JC0A 4K4ZA 1QSLA 1S1UA 2FLNA 3B4MA 4A46A 4B3RJ 4IG0B 4KIAA 4B9LA 4OI0A 3ISND 1WHVA 4C8LA 4X4SA 1R8BA 2BJ1A 1C4AA 4WFAQ 4L74A 2AJ2A 2XMJA 3CMQA 4FKXA 4V19J 2M70A 1X9MA 1S4FA 1DRZA 4RU2A 2P2CB 1WG4A 4DLEA 3IS9A 2UVWA 2ZUAA 1FT8A 4F67A 3PW5A 4L73A 2FHJD 2HFSA 1HW9A 3N6MA 1B0TA 1J5OA 5GAEI 2DH8A 2DR7A 2DHXA 1TUVA 2UUBF 4DQQA 4ZN3A 1G3OA 3MMJA 5FIIA 3M8ZA 3I6PA 1Q5VA 3MEEA 4O3OA 3ZNUA 2CZ9A 2DIVA 2WZ1A 2DRAA 2ZBPA 1U09A 3VV2B 3B78A 3G82A 2BANA 4DUZF 2QLJB 3KLHA 4TU9A 2NYIA 2G9OA 4NXMF 5A0YA 3GIIA 4CLTA 2ALYB 2Z4PA 1U1RA 1OSDA 1FX2A 3CJKB 2W2OP 2YKMA 2O3DA 1NCLA 4ES2A 5D0GA 2KI2A 3MTKA 3QO9A 2RRBA 3QZ8A 3KUHA 2QE5A 3PIPQ 3NWGA 1NUEA 1FJCA 2J6TA 2VDHA 2HPUA 1X4FA 4NCAA 3ONQA 4FKYA 1WC6A 3BBBA 2HAIA 3VAIA 1HD1A 2LP4A 1I94F 4UQTA 4DV3J 4OX9J 4OZ1A 2OTJS 2FHOB 3CIZA 3ZTOA 3C6UA 4I6AA 3CDAA 2JEFA 3D0HE 1N52B 3AA9A 3TR5A 2JLEA 2HBRB 1KR4A 1RE1B 3SSQA 3LAMA 4ECZA 3LANA 1TFYA 5CCLA 2E9TA 4DX6A 4IFVA 2NXJA 1NK6A 1CQNA 3GJTB 2FJAB 3NGRA 2YNGB 4F26A 5DQIA 1N0UA 2HMIA 2DK2A 4K50A 5CH7B 2RILA 2KHCA 3PKMA 3BYPA 1SUQB 3TYTA 3B6BA 2JC1A 2YKOA 4KGXB 1VYAA 4P7VA 4QIGA 2ALZA 5BYSA 5D8HB 1YJUA 4A4JA 5E0OA 4F2RA 3W2VB 1TMMA 4ENOA 3MI7X 4DN9A 2OJ3A 2CQDA 2VONA 3KMSA 4NL5A 2V34A 4IQMA 1RTIB 3E2EA 5D6GA 2CQHA 4OI1A 1OJ4A 3MR6A 3KK1A 4MT1A 2HGNA 4MIAA 3MAAB 3NBPB 4HYKA 3C19A 2RH3A 5GAHI 2HVDA 2B5JB 1S57A 3I0RA 3QJPA 5A8WB 2C2MB 1QDUB 1WHYA 2NREA 1APSA 2YVSA 4FBTA 2QL5B 2I1RA 2ZOFA 1QUPA 3S8SA 2XO6A 4USMA 1FDDA 2D3ZA 2UUTA 3W61A 1PSDA 4CTAB 2WVEA 3TZWA 2VDIA 2GAGC 1PC5A 4DV2J 3PX6A 3T9ZA 2C1EB 2GQQA 1Q79A 1R0BG 1QE1B 4TXSA 2E66A 1GX5A 4WKRA 3FDSA 5DZ7A 1ICEB 3BQ2A 3LW5C 1UKUA 1URRA 3D6MB 1R31A 3QPIA 3BPDA 2UXDF 2ACYA 4EO8A 2KG0A 1F6TA 5CYMA 3TNVA 2EBEA 5CA5A 3MM8A 5J2MB 1SKWA 1AB8A 3SCJE 2AWZA 1OIAA 3UQSA 3WX8A 5J1EA 3DRPA 1TK5A 1JLBA 1SJRA 4USIA 1UWBB 2NLWA 3H2VE 1OWXA 3W9JA 3ZZOA 5I42A 2BDPA 2DCUB 2CUYA 4GKJJ 4JI8F 3DI6A 3MPWA 1BWEA 2RU9A 2G1HA 2J9DA 2MZJA 1FF2A 5KT2A 2XM3A 1Q4RA 3J81Y 4DR2F 3L9ZA 4HACB 4JI7J 4ZPTR 1VGYA 2E7VA 4NLVA 3M2RB 2R8IA 4TLRA 1LWCB 2B9YA 3K17A 2XULA 1D9AA 2BJ8A 3G6VA 1PC4A 4PAAA 3KG4A 3G8TA 4I1TA 4ZPDA 1WEZA 3MR2A 1F2GA 3IBFB 1T94A 3CWJA 1Y4ZB 1X7VA 1MROA 4O3PA 1X4AA 4MK8A 3JSMA 5IT4A 3NOGA 4M5LA 3HHLB 4X4TA 3HHKA 3I5BA 4I2PA 3L4BC 4ES1A 4GO5X 2RD5C 2Z2ZA 4C8KA 3PTWA 3AD8C 1S1WB 4AFFA 4DFMA 1F9EB 2Y0BB 3SDEA 4HHUA 4OZ5A 2WW4A 2VG6A 1TK8A 2F4VF 4P2MA 4ILMA 2DRDA 1EJ7L 1UETA 1RAHB 3MDFA 3GCXP 1H72C 1TTHB 4EBDA 1NK0A 2F40A 4AE5A 4M5KA 4I64A 4OMFG 3TJ9A 3NL0A 1XC9A 2CPYA 2KM8B 5L46A 2IY5B 2PEBA 5ITHA 3MMAA 4DXLA 4WU3A 2Y0SD 4IFYA 3W65A 4WFZA 4F04B 1X31C 4LSNB 3M8PA 2VBXA 1Q16B 1H7XA 1RWXB 4LF6J 2HFUA 1TUGB 3V4IB 3W1YC 2EI5A 5DETA 3TZXA 3UDCA 1U25A 4ZVHA 2WAQD 3B4DA 4DV1J 3EZ5A 1TKZA 1Q53A 1XWLA 2HAFA 4ILRA 1TL4A 2OFGX 3R5JB 1XR5A 5AE1A 4QU6A 3LF0A 3G6YA 3PW0A 3EXCX 4BBYA 1UMJA 3FCVA 2XCPA 2HS0A 2IPOB 1VRUA 3CDBA 1JLGA 4IYQA 2ZHBA 3HHLD 4OHWA 4MK9A 1RTJA 3RU0A 2HGLA 5A2QU 3D6HB 3KNGA 2E5IA 3VTIA 4QYZJ 4F4KA 2POKA 4F02A 5HMZA 3CGIA 2XI3A 3IWLA 5C5JA 1Q81T 4E98A 4ECVA 4TY9A 4RJVA 1NJWA 3UDLA 4FF2A 2BJ9A 3TAPA 4QZVB 4N56A 1WACA 1HBOA 4DSIA 2ASDA 3IFEA 2DNOA 2ILZA 2I5JB 4P73A 3M6XA 1YHQS 1WTFA 4DUYJ 1NHKL 1VCTA 2M88A 3PIOQ 2V9WA 3G9CA 1OY8A 5BXIA 5LL6d 1SI9A 2C2OB 4NA2A 4K2JA 2HFZA 2XMVA 2V2VA 3Q0AA 1VLOA 1PYTA 1WC3A 1N6QB 3CCJS 2B4UA 3HDSA 3FBFA 2RDDA 5KFCA 2IM2A 3MEGA 2IYGA 1GNKA 3A3PB 3QZ7A 3FQLA 3QIPB 5EUHA 4ZKAA 1G1XA 4OHYA 3V2UC 1QD1A 5J2QA 4WYLA 4U7UD 5KG5A 2H5EA 4UF4A 3G2XA 4TYAA 3MEDA 3UDEA 2CQBA 2H9ZA 3EUNA 4OYAA 1NB7A 2XNQA 1IBMJ 4NI2A 3THTA 4K4WA 3RYLA 3PG9A 5HI7A 4DV3F 4CNYA 4PQUB 4PXBA 4OX9F 5JJBA 4MTPA 2BE7D 4HHJA 5ETKA 4TY8A 3PO4A 4XTTA 4KHMA 4CH0S 4DX5A 5DM6Q 1T7PA 2R8HA 7FDRA 3DDIA 1VQYA 4AL6A 1YJVA 2HYIB 4G65A 5FDLA 2XZTB 5ETMA 4ZLJA 2EXUA 2WONB 3RRHA 2XMMA 4F50A 1TL3B 4USHA 3IGNA 2L3MA 1S1XA 4MKBA 3LO3A 1S6QA 3KMQA 1GQEA 3LP0A 1CJVB 2FDNA 1S0VA 1X4EA 3T5JA 3KLFA 2XCAA 4KBIA 2AX0A 4ECXA 4HI2A 1FFGB 3NGKA 2R3VA 1RCOB 2YNIA 4LF4J 2AD9A 4RNNA 3Q83A 1H2TZ 2KZMA 3AA8A 4MMOA 2LYVA 1R8AA 4CT8A 5IS2A 5H9EK 2C2RA 5GADU 2VHGA 2XMAA 4QJVA 2GV1A 5I3UB 4NA3A 3FSXA 4LBHA 4A8WA 4DFJA 2DGSA 3GIRA 2G1DA 1TL7A 2ZDPA 3LWLA 4H54A 2NZCA 3LA0A 1GXLA 3EPGA 2HS3A 1Y10A 3T5LA 2A2CA 3QATA 4YB6A 3BZQA 3AOBA 3PYFA 4G1QB 1ZS6A 2V67A 1NU4A 3PVXA 1SKRA 3SFGA 3UVJA 4ZOSA 3IAM9 3KLVA 3OHAA 4A8FA 3MFIA 4NLQA 3E3XA 4KGZB 4IOBA 2WOMB 2VJUA 2FVSA 4X65F 2ZH1A 4FNIA 2ZBRA 3RZAA 1U49A 3AOAA 1U1OA 1MWYA 1QTNB 4I4BA 5KFVA 4PG5A 4W92B 2MQPA 4X4UA 3VGTA 3SIPB 1IKXB 3C3LA 2XMUA 5K8OA 3EICA 1T05B 2BBEA 3RGIA 3ZFVA 4O3QA 1M1HA 4ZCKA 1TL1A 2D69A 3RTVA 2HWTA 3HHNB 4YHHJ 2FJEB 3JTPA 4DCOB 1HWLA 4WP3A 5KFSA 1VQ8S 4ZVFA 3QFHA 2AX1A 3KG1A 1V3SA 3H40A 1SH0A 2ABYA 2FJVA 4C8OA 3PRVA 3C66A 3IC1A 1JLCA 3AHPA 1TKXA 3TX0A 1RA6A 3EVMA 2XY6A 2IIHA 2FJWA 1BE4A 3VGVA 2H54B 3AQPA 3CCZA 5HO4A 2RF2A 5C42A 5GAEU 4QWDA 4HL9A 4O0IA 2Q66A 4GKJF 1U1MA 1SL0A 1HNVB 3C16B 2W8LA 5IWAJ 1TELA 4CO3A 2N3LA 3QGPA 2VBYA 1DTQB 4CM2A 1OPZA 4AQYF 2W8KA 4DSKA 2XBPA 3CC4S 3JYTA 1LNQA 2UXCJ 3VVUA 4DPOA 3NCQA 1FRHA 2FTRA 4DL7A 2HVHA 1RDRA 3R27A 3GLJA 3F73A 2HBYB 1WORA 4I2QB 1RWVB 4ED2A 4DQSA 3G4SS 1A7GE 4JOUA 5HLFB 1BGXT 5ADZA 4RZRA 4NMXA 3FJ2A 1KKHA 1I3OB 4V1Ak 4KSEB 1NAQA 3RRKA 4FVCA 1YJ7A 4DV7J 2D41A 2R7WA 1RT7A 2ZVIA 3ENAA 2VZ9A 2GJIA 1JLAB 4ZP9A 4EGLA 3HVWA 3OTEA 1PAEX 2MQLA 2W01A 3D9BA 4XK8C 4PG7A 4ED3A 2M52A 3TW0A 4J9SA 4DPTA 4C97A 5HROA 5CXTA 1RHKB 3I96A 2AEFA 1R0AB 1X0PA 2AU0A 4JI4J 4AL7A 3M8SA 1OSCA 3AAWB 2PD1A 1H0HB 3TEHB 2UV8G 2EC2A 5KT7A 1IQTA 1N0VC 2CVIA 2Q1LA 3OUYA 1F5BA 1PJ6A 4DG1B 2E1RA 2W2MP 1FVSA 1S97A 1C4CA 3DU6A 2R42A 4GC7A 1FNOA 2VG7B 3OXLA 3R3TA 2DY1A 3OL7A 4QW9A 5EHHA 2GHVC 4CM0A 4N8OA 1VRTB 2MZ1A 1FWKA 2EFNA 4LF6F 4J9RA 2BX6A 1WSVA 3B82A 4LVOP 5J2PB 1V5VA 2B7BB 4IO1A 2OMOA 2FJDB 2E1CA 3T3FA 4P7TA 1H6KX 3DHXA 5L1IA 1C0TA 1HPZB 2RKIA 1B0PA 1KQFB 2AYMA 2JEIA 3KG0A 2O66A 4IG0A 3CCUS 3KXDA 4DV4J 3GJSB 1LW2B 4CLLA 2AJ1A 2B43A 4USKA 2DKOB 3K8WA 3MMCB 3VAKA 3KUGA 4C0BA 3CJSA 1NLKL 3JAMU 4F3OA 3VCDA 3I31A 2VQEJ 1SIZA 4Q5VA 4GRSA 4RNOA 1FEHA 1M5SA 3Q22A 4YMEA 4Z7CA 3DKDA 3WC0A 4NZ0A 3DLLQ 2CXEA 3UCGA 1YBTA 1JJ2R 3KWMA 1SQFA 2LQJA 2RRNA 2V94A 1HD0A 3GQCA 4F4YA 3UR0A 4OZLA 4XAKA 4AD6A 4F2SA 2JEJA 3UN5A 4QR1A 3UCUP 3CJ2A 1JB0C 4OYIA 1FESA 2OPRB 2BZ2A 5J1PA 3HT0A 1VJQA 1QY7A 1WOOA 1AA1B 1H38A 5F9LA 2QX0A 3T6JA 2F3JA 2VL1A 2AJ0A 3D28A 4N77A 4J9VA 3H98A 1T9WA 3FCWA 1TKTB 3D0IE 2ZC4A 4PPZA 2XC9A 4U95A 2QEXS 3VHQA 5DG9A 1JQGA 3M9MB 1F3VA 4YUDA 4EYIB 2LXUA 3IA0A 5HJXA 4DQPA 2AJFE 1ZAXA 4K4TA 3TWZA 2FVRA 4A47A 4A8QA 5K14B 1GXUA 3P3DA 1YRXA 4C2MA 1KONA 2KH9A 2MEWA 1Q95G 1BD6A 3M2UA 2CNOB 1JLQB 4Y34A 2LQ9A 3K5MA 3HPOA 1UFLA 1G7CB 3RW7A 1X9SA 1S9GB 3Q2TC 2ZEJA 1TZ0A 2QTWA 4K4VA 3JAMY 1S6PB 4JI5J 1AUDA 1GMUA 3BR8A 1MWZA 1REGX 1IBCB 1YJWS 2AMCB 2F8HA 3DRXA 2YNGA 4UUWA 2KT2A 1UCNA 4B3SJ 4ATNA 2E29A 3HD2A 4N8NA 4CLZA 1UZDA 1SUQA 1UPMB 5DM7Q 1ZA1B 3W5XA 4WZQA 4DU7A 2COLA 3W2VA 2W7AA 1U6ZA 1EB0A 2J9DE 2HHUA 4FF3A 3AB2B 2U2FA 4U8VA 1UVMA 3Q89A 3QT5A 1RTIA 2CNNB 2XSFA 3HXMA 5FLXU 3DGPB 2A18A 1Z2ZA 4IQXA 3MAAA 4MYUA 3NBPA 1NPPA 3IG1B 1GXTA 1YBAA 4LF4F 3OFEA 5A8WA 2K8GA 3A8EA 1VDHA 3DHWC 3TOQA 4BS2A 2KXHA 5DLFA 4DZ6A 4IOCQ 3PR5B 1I6JA 2ZM6J 3US5A 2HZAA 1SKUB 4L75A 4CTAA 1XTZA 1OYDA 4ELUA 4N7TA 2NXUA 5LOQA 4QIWD 3JS9A 5G4DA 3UFCX 3H5XA 1QE1A 3EXYA 5ETSA 5H9EJ 3LOUA 4R25A 1SXLA 3AODA 2F7VA 2VOPA 1O0PA 4QQBA 2QA1A 2FLOA 5B0EA 4EU0A 5CZVA 2F65A 4FS2A 2VB6A 1WDDA 1ZOTA 3L7PA 4C0OC 3EDQB 1MU2B 3DGVA 1JIHA 1B3TA 1DTTB 1WEYA 3WQPA 4QPXA 2DNNA 4RPFA 5J2MA 3QT6A 1SC1B 4UY85 3R6GB 4K5RA 3D6FB 3BN4A 3F56A 3H90A 4URQU 4KR0B 4O44B 3DXSX 2HRYA 3MM5B 4DJBA 2CPEA 3OL9A 4OV1A 2X1BA 1UWBA 3NGTA 1U1KA 3TAMB 1IWAA 3C46A 4DX7A 5DDRC 3MCNA 2XS7A 5DJBA 4YHHF 5LJ5Y 1KD1T 2DIUA 4HACA 4DPXA 2WTFA 3V81B 1HHSA 3G82B 4PG4A 3M2RA 3IR7B 5DGBA 5K8PA 1RT1B 4NLUA 1RISA 1LWCA 1FCAA 3H5YA 3J80U 2DNKA 1WKJA 1YRUA 2XTJP 2VBZA 1NZAA 2ZH5A 3MF5A 4RUCA 2VA3A 1RSCA 2I9SA 1XNQJ 3ZTSA 3PJ9A 4K5SA 2CADA 1IBLF 3W5ZA 3BQ1A 3AOCA 2PFDA 5A6PA 4PYAA 2J0QD 5IWAF 2A1BA 3OTCA 4BC9A 1RU2A 1FKPB 4Y28C 3HHLA 4YQWA 4U7UK 5HP1B 4MKVA 3HSJA 4Z37A 1S1WA 3J7A1 4HH0A 5KFEA 3TX8A 5IT0A 1PBAA 2CJKA 1RT5B 2OPPB 4D3HA 1KRPA 4UOCA 3FVYA 3DCAA 1G4CA 4ZPVR 3R1HA 3MPDA 2H5JB 1S5ZA 4DV7F 1RKJA 3QGHA 1QVFR 2GIQA 4AYBD 2LDYA 2AQ4A 2MQQA 4KGKA 2JVRA 2V8DA 3ENVA 1VC0A 1GFWB 2EFVA 4BLGA 4H4MB 1VR6A 4LSNA 3BB5A 3VZIA 2AP6A 1SC6A 4JI4F 1FO1A 1GTEA 1R27B 1FD8A 3PKYA 3MAHA 3V4IA 4O3RA 1CG2A 2BKNA 4RBUA 2E44A 2V69A 3BGUA 4OLPA 2M2BA 2MLXA 2KKHA 3K57A 3HT3A 2JNJA 1IXKA 1FHTA 4H4KA 3G6XA 3N01A 2B9EA 3HFKA 4DV0J 2M4MA 3OPKA 1UEKA 2RQ4A 3J80Y 1RAGB 3NG8A 5B0CA 4LQ3A 3ZZPA 2VC0A 2AKWB 3UD5A 1U1LA 1NPKA 2AJQA 3SV3A 3RAXA 3ILIA 1EHWA 1GMVA 4DSEA 2PEHA 4I0WA 4JP8A 3CCTA 3C14B 1NSQA 4KH0B 3I0SA 4U67Q 3FMBA 3V6HA 2N4DA 1RLDA 3FKBA 4PZVA 5T41A 3CIMA 3IBWA 2MHNA 4LIRA 1HI0P 1FVQA 4RW6B 2RRAA 3VAHA 1VK8A 4A8XA 2JEGA 5KFWA 4DPYA 3IN5A 2UUCF 2W25A 2FGCA 4KHPJ 1JNRB 2J0SD 3TVYA 4RU9A 4JB8B 4BCAA 3MAQA 2VIHA 3ETOA 1RWMB 2JLGA 2I5JA 2KU7A 4FXWA 3RR8A 2ZE2B 3FSIA 1ZM9A 1IKYB 5E3AA 2OI2A 4AL5A 3PJXA 1TKDA 4C3MA 4ZA1A 1BQXA 4I56A 2F9JA 1HBNB 2IYIA 2VICA 3L7UA 1VC6A 5D4PA 5E3CA 4NLWA 1N6QA 3C15B 1L3SA 1HIYA 3WIVA 1VI7A 4KO0B 2FHKA 3T1YJ 4NEZA 2IDLA 4HT7A 4LFAJ 4P9SA 3CMES 4NXNJ 3D5MA 1YDLA 2AEJA 2GCFA 3QIPA 2YNHB 2MJNA 2ZWOA 1U2RA 1KBRA 5B08A 3W2WB 2NPFA 3AY0A 4DSFA 3MM9B 1K0TA 4DZDA 3I5CA 2SXLA 1S48A 3H5SA 2HLUA 3HVTB 5D3GB 3CCRS 2PO4A 2LEBA 3QWUA 1NH8A 4WFBQ 3U02A 4C8NA 4PQUA 4K0KF 1Y11A 1CC8A 1Z2LA 3H7HB 3JQMA 2P5VA 3R5AA 2GMLA 5EX0A 1WC4A 1IWGA 2MKYA 3P8BB 2ZZTA 2FVPA 2CG8A 3PO5A 2WONA 2R8KA 1TL3A 1U2FA 2VC1A 4FF1A 3LPEA 2DR9A 5F8GA 3RBZA 3OT9A 2DD8S 1WELA 1NKCA 2MZSA 2Y9HA 1C1CB 1CJVA 1Y3KA 2ZH8A 2IM3A 3IRWP 4OL8A 4XPEA 4DR5F 2FZCB 2DPIA 3ZTPA 2NYHA 1X4DA 2X1AA 3KLIA 2I6WA 5F3ZA 3CMAS 3CT9A 1TUWA 2J7UA 3ITHB 2G4BA 1SQEA 4K4YA 4Y2KA 1VRQC 4IFYB 3BEGB 5I3UA 4XPCA 1D09B 3KHGA 1S7IA 4OZ3A 1FXDA 4ICLB 4ETZA 2L08A 3ZZYA 2Z58B 4HDHA 2EW9A 1Y7PA 2M8HA 5JUMA 3RB0A 1FRKA 3EGZA 2DNLA 2MMYA 2Y1IA 1RYSA 1T9XA 4IR1A 2HQCA 2HRTA 1YWXA 1J5EJ 2VF3A 2H48B 1RAIB 3DLJA 4YEAA 5KT4A 3M30B 2ZM6F 1ULRA 3S6EA 3HSZA 3CJTA 2QIFA 2WOMA 2Z30B 4ZLLA 2K3KA 5E33A 1K44A 2AYEA 4A48A 2R7OA 3ISNC 4IR9A 2J6SA 3E8OA 4YY3J 3VWSA 4J91A 2C3MA 1YIJS 5BYRA 4OX7A 2MSSA 2BM0A 1V9OA 1IKXA 5HSPA 3WIUA 4ECRA 3MCOA 1T05A 4HI1A 4DMZA 1S0OA 2HW3A 3A3NB 1VK3A 1U8WA 2DNHA 4B9UA 5MLCV 4ZLPA 4LF9J 2DR5A 1UPPA 4LF7J 2ZHOA 4FYXB 4IOAQ 4KHRA 3Q2SC 1U2CA 3TUZC 2Z2MA 4ZVSB 2GQ2A 4E8UA 3FQKA 5KFKA 2VH7A 3OL6A 4DEZA 1S1TB 2BKOA 2JRSA 1RB0A 2GIFA 4Q0BA 2MKJA 3ELHA 2MKHA 2J0XA 4CNZA 1WG1A 1U8SA 4NEYA 4EEYA 4DFPA 5E41A 5KG0A 4RW4B 5JVHQ 4Y2MA 1VMBA 2ZKUA 5KFYA 1RWKB 4ZJQA 1HNVA 2EVZA 3C16A 3FGVA 2BOAA 1QLNA 3QLHB 1X4GA 1KEKA 3BPSP 1DTQA 1RJJA 1SL2A 3H25A 1R6VA 1EX8A 2KXNB 2XYPB 5LXYA 3Q8YA 4I2QA 3TQ1A 4P72A 5THWA 4HKQA 1K73T 1TAQA 5HLFA 2NXCA 2YKNB 2W9CB 4O23A 2B51A 5F3TA 2RQMA 3H2LA 1XNQF 2BYCA 2CG4A 4J5OA 3GB0A 1N54B 5LSLA 3I82A 5C24A 1MG7A 4DQIA 3CJ4A 1JLAA 4KQZA 4I68A 4V19X 1T9VA 3I4HX 4JI2J 2G0IA 4RNHA 1VQ4S 2YPYA 4J9NA 3HD1A 2WB1D 4M5HA 3CCES 3D1HA 4B08A 1R0AA 1LWFB 4UQGA 4WXWA 1VQMS 4HTIA 1JJCB 1S6UA 2LEPA 2VG5B 4QPTA 2ZH4A 1RUSA 3MOJB 2X1FA 2JLFA 4RW8B 2O5DA 4DG1A 3R6LB 5B0FA 3IMQJ 1S9EB 2WSCC 2VG7A 1KHWA 1IKVB 3W8PA 3PNIA 4J9PA 5KG1A 1VRTA 3K5NA 5EN1A 2MZTA 4FXVA 2XGQA 7FD1A 2VD3A 3I5AA 5J2PA 1RHRB 5AXNA 1KSPA 4PWDB 1SH2A 2CVEA 5EDWA 4M5JA 3ADAC 2OO4A 3D4JA 4U9RA 1WF1A 3RG6A 2QGFB 2M7SA 5C2GA 7AT1B 3BREA 1LW2A 2GZOA 2RE1A 5HBMB 4LR8A 1LKZA 1TL7B 4CQ1A 1WKLA 4U6PA 5HQ8A 2HURA 4F4ZA 1QJHA 2MGZB 2HQIA 2YBVA 4URGA 3KJVB 4WK1A 2P8IA 1YITS 3CE8A 1PJ5A 4Y2IA 3U1MA 4ZIWA 2V5HG 3GILA 2JHEA 2VODA 4EMDA 2RB7A 1P9QC 5BJRA 4WP9A 3AJ2A 5M2PA 2ZJRQ 4C8ZA 3NLCA 2BM1A 1W2BR 2OPRA 4B3TJ 4B9SA 4OJHA 4L3KA 1T03B 4LSLB 5CQGA 2YWEA 3PYEA 2BMBA 3BQ0A 1FJEB 2LXFA 3ILJA 2EPIA 5DG8A 4TLQA 2J9EA 2F8MA 1NXIA 4W90B 2RU3A 2E5LJ 1UJ6A 1TKTA 3W8GA 3MWBA 2F4FA 3CJ3A 4WWSA 3QBCA 3NY0A 5K8MA 4PKDB 2FC9A 3CDWA 2CAJA 2CWKA 2RS8A 2WK4A 3ZZ0A 2QZ8A 3BO3A 1WEXA 1WD6A 2XB2D 3WDOA 4XDDA 2IJRA 1VQNS 3K89A 2PIIA 4CLSA 2HRUA 5K14A 3O3LA 5KTQA 2CNLB 3T1YF 3F0NA 3LQVA 1M90T 2C3UA 2V50A 3OFGA 4NXNF 2AGPA 1KQKA 1TQLA 1QAYA 1K8AT 2D3O1 4DL2A 1JLQA 1D8YA 4DN0A 2IFXA 4J90A 2I38A 4ZVEA 1S9GA 4GVLA 4ZPCA 4EZ9A 1WOSA 4M5GA 1MNEA 2C3PA 1ZM4A 2OMLA 3IBCB 3IP0A 5ETLA 5KG6A 3NMRA 3Q86A 1XR7A 2XMTA 1HNZJ 2HEKA 2KT3A 1XEZA 1RHUB 3JB9k 5D4OA 1LWEA 5DO2A 1Y0HA 2UV8A 4DS4A 1WTBA 4JV0A 2HQFA 1HBUB 3EGNA 2AHOB 5EWEA 2QMXA 2DR6A 2W24A 1TK0A 5K20B 1HR0J 5DQGA 3JQJA 1Q78A 3M8QB 4C3KA 2XZDB 4TKTA 3N6NA 1RAOA 1VLYA 1RP5A 2B8PA 5IZHA 5HROB 5IT9Y 3KKFA 1PO6A 2DO0A 4PYDA 2WBMA 2CFXA 3A12A 1N4LA 3OVAA 1EETB 3L3CA 5EX3A 2BE2A 2AZ1A 3DGPA 4C6AA 1IJFB 4YDXA 2LA6A 3MR3A 4K59A 1MW7A 3IG1A 5E7OB 4WKYA 1BUXA 1S79A 1ELOA 2DITA 2HQ3A 2NUHA 2VPYB 3BKUA 2XHWA 3DLGA 4O3NA 2DGVA 2CDQA 3CULA 3D1OA 3IR6B 4QYZK 1JK9B 4KRWA 5I4MA 1UA0A 3RUBL 4DUTA 4DCPB 5F8LA 3VQTA 3R7SB 5J2NB 4C7QA 5KAKA 5CHCB 2CDRB 1HQ2A 4X62F 3OXGA 1YJ9S 3P5TL 4CO5A 2IM0A 2QYCA 2DNGA 1YKWA 3CJQA 3KJQB 2RKIB 3DM2B 3BGOP 4ZP7A 3CO9A 1M5PC 1UW4A 1J5EF 1AROP 4WFXA 2ATCB 4S0MA 3RBEA 3HHLC 1MU2A 2UXBJ 1EAYC 3TZZA 3D6TB 4OI6A 2IDEA 1DTTA 2QMWA 1FKAF 5M2UA 2DXFA 1HQUB 2ATLA 1OO0B 3QGIA 4ZVPB 3M2VB 5F0WA 4ZPAA 2HBZB 3BGRA 4O44A 3MM5A 2A10A 3IWXA 1XMBA 1S1VB 3N6LA 1XBWA 2GS8A 2I2YA 4ERDA 4ANEA 3QJJA 1VBZA 4ZLNA 2VA2A 3C2PA 4C4WA 3TAMA 5H9FJ 2HK2A 1TMJA 4UY8T 5KFDA 3DYAB 3A8IA 2KM8C 3BM7A 4LF9F 4LSZB 4ALZA 4LF7F 1BHNA 1RCXB 6FD1A 2CPFA 2NQPA 3V81A 2YWGA 1TR0A 3I4PA 2DCLA 1RT1A 2H4WB 1N5QA 1R8HA 2OAUA 2D1CA 4KAIA 2HFNA 3BGFA 2ZH2A 2KL8A 2ZD1B 1B70B 3CVKA 4G6VB 3CCQS 4H4KC 5F9NA 1FKPA 5IC4B 4JUZA 5J1NA 4LBIA 2VPWB 1GAOA 1M5OC 5HP1A 3QQCD 2B8QA 1FE4A 2HVEA 2YKAA 5GMKa 4JI0J 2JFDA 3M2UB 2R7XA 1FTCA 4OI3A 4J7CA 3SSRA 1SL1A 1RT5A 4B9VA 2OPPA 2E1MC 2XS2A 3EYZA 5JXSA 2CJYB 3FUYA 4JI3J 4NA1A 5HK4A 2OKQA 1SJ1A 2GQCA 2AIRB 3VAMA 3SCKE 1R89A 3GG1A 1ZZFA 4IKAA 3MMBB 1DQ8A 2OD6A 2ZUGA 1P8GA 1YK9A 3DRRB 4H4MA 3FK4A 2ZHAA 2V4QA 1G2EA 3DOLA 1S6OA 2LFVA 4FXDA 3CC7S 2B4OA 1RQ0A 1UTAA 2ZJQQ 1NHUA 1SJQA 1F2HA 1JMTA 3PRBA 2HFVA 4PWUA 4M5DA 2DBBA 2PSZA 4HEA9 4DR6J 3ZO7A 2Q6BA 2BA9A 1KFDA 3R5BA 1VQ9S 3TANA 3J81U 4GKKF 1S7HA 2K06A 3W63A 1FWLA 4ZP6A 2DVIA 3ILOA 2HBQB 4NLRA 4K8RA 2EK6A 1O51A 3W64A 2RUGA 3J7YI 1IKWB 4ECYA 3EGWB 4AXIA 2XMWA 4TVAB 4X64J 5LMNJ 2HHVA 3C14A 3PW2A 1YVFA 2RDIA 2PT0A 4USTA 4OYZA 1PILA 3W5YA 4A8YA 3Q8PB 3QGGA 1SC3B 5I3PA 3M9NB 4RW6A 4B9TA 3KK3A 2OP5A 1ZM2A 3VZHA 1Y00A 4TYBA 1FTRA 4YB5A 2F63A 3D1QA 5BR8J 3O5TB 1JXEA 3K2YA 2N3OA 1TAUA 3QYYA 1QSSA 3CDUA 2L9WA 3HF5A 3LTOA 4R5PA 1T3OA 5KG2A 3FFIB 2DYAA 4WCEQ 1FXLA 3POTB 2A0FB 1KNZA 3KLGB 2ZE2A 3LUYA 1Q8KA 2DHHA 2FB0A 3TA0A 4PCQA 1IKYA 4G3IA 2CRLA 1BC6A 4M5IA 3A13A 4ETXA 4PPDA 4ED0A 1EZZB 4WF9Q 1HBNA 5K8NA 4CH7A 4HDGA 1YG0A 3CF5Q 1FFWB 2A6MA 1F9HA 2W2NP 4B3TF 3HZEA 3C15A 3HVAA 5KFAA 1VBYA 4KO0A 1S12A 4X66J 1YBUA 3MR7A 4P2XA 2G2OA 3PYGA 2E5LF 2D74B 4RWWA 5IV4A 3AXKA 4NOHA 1W2IA 2YNHA 2C2NA 2EC0A 1IBKF 4Q43A 4ZMMA 1X60A 4OFZA 3W2WA 3VF0B 3MM9A 5IFMA 4LFCJ 4NRUA 2KJWA 2GA7A 2VPXB 1NK4A 2QL7B 5LJ3Y 3HVTA 5D3GA 4ZHRB 4WFNQ 4DL5A 5K9FA 1UEUA 4A8KA 1FRJA 2CQ4A 2V0NA 4CLWA 4DF8A 3TARA 1H2VZ 4I6YA 1A0OB 2R2UA 2VKZG 3DDKA 3PW4A 1ZAVA 1HNZF 3GIKA 1FX4A 2AV5A 4NLXA 1ACMB 3CD5A 1C1CA 3S1TA 3SYZA 2M9KA 2XY7A 5KFNA 5B09A 2MY8A 4LVNP 5KFZA 4OJGA 2KYZA 5KFXA 2UUBJ 2RIJA 1E6VB 3FEXB 1EP4A 3FSYA 3HZGA 4ZCLA 2IM1A 3ZZTA 3HX9A 1NPRA 3D2WA 1TU0B 2OIHA 3ITHA 4N41A 2NXEA 1NKEA 1CLFA 1EIYB 1OQ6A 2FY1A 3W60A 4B3OB 1VHIA 2KFZA 3LH2S 4L76A 1U1NA 3CUNA 4ICLA 2V4JB 3R5CA 4NXMJ 1VQKS 3EE3A 1HHTP 2XLIA 1F0XA 2WVBA 4UT4A 2KHDA 1GX6A 3QRQA 2PN6A 2UUAF 1EKRA 1R8PA 3NNHA 4ECQA 4PXDA 1RKIA 2GJ2A 2Q3PA 2NPIA 2X1GA 2MQOA 2FVQA 1X5SA 5EWGA 3M30A 3BN7A 3UN3A 2JH3A 2FJBB 2YNFB 3V5RA 1YLXA 1HQEB 4ID8A 4TU7A 4NLYA 5D4NA 3A8KA 1Y5LB 2WVCA 3U1NA 5E3PA 3UW1A 3NOCA 2QA4G 2FIUA 3OFHA 5KFMA 4U8YA 3L7OA 3MHYA 2W2QP 4NMLA 3N0VA 3PCOB 2KRBA 3SQGB 2GO9A 3FBCA 4LR7A 3I55S 4B3RF 3I0SB 1VQ6S 2CJBA 1HNIB 1U47A 3UN2A 2CQCA 1ZAWA 4F3MA 3QRRA 4DLGA 4PEOA 4TNOA 2AF6A 4LRAA 2UXBF 5CABA 4OV6A 1PBUA 3RBXA 1KFSA 2E7WA 2VASA 5CYQB 1X8DA 1R8CA 1RBLA 4E0DA 2ZH7A 1S1TA 3IGVA 2XS5A 1K9MT 1RAEB 3R5DA 3NGDA 2XYHB 4Q7AA 2AT1B 2KRRA 4RW4A 4IDKB 4MYTA 3SXLA 3QLHA 3E01B 4O4RA 1JX4A 3PV8A 4NRTA 1BMQB 4IH6A 1M0SA 1D8ZA 1FERA 4J9LA 2CQ1A 5F41A 3EM1A 3LP1B 3KHHA 2V8PA 4ZVUB 2DTJA 1F60B 1UZHA 2YKNA 1U7LA 2W9CA 1NZ8A 4Q45A 4Q2LA 1M5VC 3I9ZA 1VISA 1S77D 3LWMA 1LFPA 2QA2A 1S0NA 2HHPA 4F4XA 1P9YA 1GH8A 4BWMA 2MKSA 3JTOA 1JNZB 3C8YA 2FVCA 4X4QA 3TUJC 2G2ZA 4PXEA 1UVIA 1CBKA 1FD2A 3FC9A 1HWIA 3W66A 4RWXA 1SB6A 4JI0F 1GMWD 1EKSA 2GO8A 2VBWA 1LWFA 1H73A 4OZ2A 4PXCA 1RU1A 3PXGa 2LKZA 2MQNA 2UXDJ 3LP2A 4R8UA 4XO0A 2C2DA 4H4OB 5IV3A 2W9AA 3QMQA 4ID5B 2VG5A 4MKYA 5H1SV 4KPYA 2DNZA 4RW8A 4ZVGA 3K5PA 4B9MA 4BC7A 3TA1A 4G1PA 4PG6A 1S9EA 2X51A 3RJMB 1QAXA 2HNDB 1UP1A 1IKVA 1BQNB 4JV1A 2CJQA 4FZVA 3OR1B 3HP6A 1VC5A 5B0BA 1U4BA 3HHEA 2DO4A 3GFYA 5HANA 1K0VA 3FRZA 4CDIA 2G0CA 3UI3A 4OI4A 2QA4S 1OY6A 1YGYA 4P10A 3T9NA 3KLIB 2DRBA 4PWDA 1FWPA 4DR2J 4QWAA 4Y0FA 4KFBB 1FDNA 2O1PA 4DR6F 1X9WA 3O6QA 1RWOB 3DNCA 5HBMA 2GIRA 2LDIA 4OJ1A 1KWMA 1WOPA 4ZVQB 4RLEA 1GEHA 3PHTA 2MSTA 5D15A 4CLUA 2E5GA 3DDNA 2MGZA 3IO1A 3KJVA 1QTMA 5AE2A 2N82B 3THPA 3PFEA 2R8GA 2VU5A 5FD1A 4X64F 2AYBA 3Q8SB 2CNKB 5LMNF 4Y00A 3GMGA 2RDJA 3TUIC 1UEVA 3MCSA 3WZ0A 1HI8A 3KK2B 2Z0GA 3ENWA 1CS4B 4G1IA 2MY7A 3ICLA 1OY9A 4DV2F 2C42A 4F0MA 1HL6A 2MQ8A 1KDNA 1CVJA 2CPDA 1KOOA 5BR8F 4CCHA 2MYFA 4F8RA 1TL5A 5U47A 1T03A 4LSLA 4IRCA 1DARA 2EFPA 2EWHA 2MZRA 5LSRA 1IVZA 3ZC4A 2KDOA 1NSPA 3S7RA 5DDOC 1VS3A 4R0JA 1WG5A 2ZJPQ 3A3OB 3OTDA 2EFGA 4OLOA 3NP5A 2E1PA 2KVQE 1N5YA 5HQMA 2KTQA 1UJ4A 5KFUA 2LU1A 1NJXA 1Z1ZA 4PWWA 2MQMA 2K1RB 2XHCA 3T1AA 4Q0BB 2MLYA 2EBGA 3OHBA 2MDAA 2O01C 4QR0A 2GVDA 2VFRA 3MGJA 3D68A 1F9FA 5SZTA 1CQMA 4ZCIA 1IM6A 3D3BJ 2V2KA 1JLFA 1NDCA 1KS2A 4JI7F 4A8MP 1C2PA 4OX8A 2R7UA 4OYPA 5HMYA 3GV8B 3OXFA 2YX4A 2MKCA 3MD3A 2B7CB 4OYWA 2BW2A 3HJVA 3D7SB 4LF5J 4GO7X 1Y5IB 4O4GB 2V8GA 3AH6A 5L9NA 1HBUA 3GONA 4J9QA 4LR9A 3MUVP 2ZNYA 3OTOJ 5C24B 3D3CJ 3M8YA 4PUOA 1YX2A 1P27B 1MLAA 3O1LA 3NS7B 3M8QA 4TQSA 1V3RA 2IVFB 4R0EA 2OGUA 3VAGA 2H65B 3PEHA 2DNYA 4RUBA 2XLKA 4UZBA 5HMWA 3NGUA 1EETA 3TA2A 4JBCA 1WWHA 2BVZA 2FHMA 2PMWA 3HFVA 4MIWA 4K7QA 2PDAA 3QFWA 2ZH3A 1ZETA 4QR2A 2L9DA 1RTZA 4Z7YA 4NYZA 5CD4A 4J37A 3JXOA 2OSRA 4DL3A 3KLEB 2E5HA 5L1KA 3I56S 1AYEA 1N32J 4ZDNA 1LW0B 5AXLA 1SCJB 2CA9A 5J2NA 3DOKA 1KVKA 3GFHA 2BJDA 2RQKA 3U27A 1MSWD 4LQ9A 5IQQA 3H5UA 3EVWA 3W7BA 1KN6A 1S99A 1M5HA 4FPRA 2KYXA 5DG7A 1Q8BA 3DM2A 4DV1F 1P1TA 1Q7YT 3OJUA 2UVVA 4RNFA 2YH1A 1FRLA 2HFOA 2P9GA 4WU2A 1FJGJ 1X4HA 2D7SA 2ZH9A 1MMDA 5L1LA 4F4WA 3GTYX 2B6AB 1NJZA 3Q8VA 1HQUA 1WHWA 3M2VA 3PRDA 3N4WA 1PG5B 3GV5B 1S1VA 1CC7A 3J7YU 2DGXA 1VBKA 1JXVA 3M32A 4NLOA 2UVUA 1OPIA 3RW6A 2ADCA 3T5HA 2KXFA 4WBFA 3GFZA 4CLFA 4UOHA 3DYAA 1B7YB 4J9OA 1H7WA 2AYGA 1MWQA 2M0GB 3BO2A 2WHOA 5AXMA 3TAQA 2B0GA 1JJ4A 3M1VB 3EDRB 2KVIA 4QBUA 2ACMA 5AXKA 2ZD1A 4DUYF 4HH1A 3CNQP 2XYGB 1C1BB 4ILLA 4LBPA 2RAQA 2VFVA 2NCKL 2EG1A 3MEKA 4M8LA 3A1YG 5A8KB 3M6VA 2YWWA 2FZGB 2DNQA 4NWBA 5SUHA 2BQUA 2W1BA 3PX0A 2GC8A 3ULHA 2K7KA 1KTQA 4KC5A 3S01A 1ZM3A 4YS2A 2XMKA 1RBOB 1HLWA 2GMHA 3K8VA 4ED1A 3P96A 3B54A 5F8JA 2R7QA 2ROPA 4X65J 3KHLA 3MMBA 1IBMF 1RGVA 5LXRA 4F3QA 3IM8A 5RUBA 1S76D 4WZMA 1MMLA 1LWEB 4TN2A 2MB0B 4E2FB 1KLMA 3DRRA 4C0HA 2UZAA 2QJ3A 4WIIA 1X5TA 3TJAA 1CJKA 1JXLA 1HARA 1SV5A 1LWXA 4NYPA 2ILYA 3KDNA 3J7AN 5G0RB 2P9EA 8AT1B 1VJWA 4PQAA 4O3SA 2OPQB 1IUJA 1PGZA 4RKUC 3T6BA 3DMJB 3PZPA 3OW2R 2E1AA 2WVFA 2CZ4A 3D67A 2P9CA 2ZDOA 1UAWA 2YX1A 4RUHA 3H4BA 1W25A 1CULB 2G2YA 4P52A 1RWWB 3V6KA 1SJ4P 2BE2B 1W26A 4IRDA 4OQJA 2HHQA 2HIYA 4KJIA 2HQDA 1TFWA 2KJVA 4DR7J 2Z8QA 1SIWB 1HMVB 1IKWA 2HS4A 1U45A 2OD4A 1Q0NA 3K7RA 2IAJB 4DPUA 4WXOA 3DLGB 1QVGR 4AQYJ 1VQ7S 5DZ6A 3BV8A 3NAIA 5JVGQ 3UNYA 5GMDA 4RUAA 4AXJA 1VBXA 3PM9A 5F8MA 1HNXJ 2HNZA 1D9DA 2V8HA 2L48A 3MUMP 3HULA 3G96A 3KTQA 3KHRA 4JI6J 1FK9B 3M8RA 4Y3CA 3OJSA 2BR0A 4WIQA 3SMZA 3FFIA
chains in the Genus database with same CATH topology
5HROB 5IT9Y 3MXHP 3AHPA 3KKFA 3POTA 1TKXA 1RA6A 2HWIA 4G1QA 1PO6A 2XY6A 2DO0A 4OZ0A 4WE1A 2FJWA 3KLGA 2WBMA 2W4DA 4D3GA 2CFXA 3AQPA 3OL8A 1L3TA 3CCZA 5HO4A 5AE3A 2ZNZA 2RF2A 4FS1A 5C42A 1N4LA 3OVAA 1YQHA 1EETB 1QM9A 5GAEU 4HL9A 4ZCMA 3EZUA 4O0IA 4QWDA 4DQIA 2Q66A 4GKJF 4MJKA 3L3CA 1U1MA 5EX3A 3MM6B 5KFLA 1Y3JA 2CYYA 4NCGB 2BE2A 2I0XA 1SL0A 1HNVB 3DGPA 2W8LA 1IJFB 4YDXA 2LA6A 3MR3A 1KTVA 4CO3A 2N3LA 3HVRA 3GSDA 3BGRB 3QGPA 4K59A 2VBYA 2P6SA 1VRUB 1DTQB 1MW7A 2K7JA 1S9FA 1WF0A 5A8RA 3VAFA 1OPZA 2HHSA 3IG1A 5E7OB 4AQYF 2W8KA 4WKYA 4DSKA 1JLGB 1S79A 2XBPA 3C6TA 1ELOA 2DITA 2F9DA 2HQ3A 2NUHA 3JYTA 3CC4S 4DPOA 2CQ2A 2ASLA 2VPYB 1RTJB 2XWYA 2R7SA 3NCQA 2XHWA 1FRHA 1FE0A 2FTRA 2N4CA 4DL7A 3VAJA 2HVHA 1RDRA 3IXQA 3R27A 3DLGA 4O3NA 3F73A 2GGPA 5KOWA 3CSKA 3GIMA 2DGVA 2DGWA 3LALA 2CDQA 3CULA 4I2QB 3PW7A 4EO6A 4ED2A 3D1OA 4DQSA 2RNEA 2GNKA 3G4SS 3IR6B 1A7GE 4JOUA 1JK9B 3F41A 4KRWA 4CO4A 5I4MA 5HLFB 1UA0A 1BGXT 5ADZA 5F8LA 3VQTA 4EUVA 4RZRA 1VOMA 3FJ2A 5J2NB 3PACA 2V8VA 4C7QA 4KSEB 5KAKA 4ECUA 3CB4A 1NAQA 5LT5A 1OQ3A 5CHCB 5KFQA 3KFWX 3MM7A 4MAKA 1RT2A 2J7KA 3RRKA 4X62F 3U7JA 2YH0A 4FVCA 1HR0F 2DNPA 1XR6A 3OXGA 4ZK7M 1YJ9S 3M05A 3I87A 3P5TL 2D41A 2R7WA 1RT7A 4CO5A 3RRGA 4ED5A 2MPUA 2VZ9A 2BRKA 2IM0A 2GJIA 1CSJA 1IM4A 2QYCA 1JLAB 2DNGA 4ZP9A 2EK1A 4EGLA 2BV3A 3HVWA 2RKIB 3DM2B 4ZP7A 3CO9A 1M5PC 2OPSA 4ED6A 2HHWA 3OTEA 2MQLA 3DN9A 1UW4A 1HBOB 2DGQA 2D3UA 4ZHRA 2YKPA 3NNCA 3RBDA 4XK8C 4PG7A 3TI0A 1J5EF 4CO1A 4A8OA 1AROP 4ED3A 2M52A 4WFXA 1B0VA 2OH2A 5IM0A 3TW0A 4J9SA 4C97A 3QAEA 4WYWA 2G13A 2CQ3A 3HKWA 5HROA 3RBEA 3HHLC 4AUKA 1MU2A 1NEEA 5CXTA 3I96A 1R0AB 4OI6A 1X0PA 2OLWA 4NLPA 4RW9A 2AU0A 4AL7A 2YY3A 1DTTA 2B56A 5DDPC 2GHPA 2QMWA 3M8SA 1OSCA 4LIWA 1SKSA 1FKAF 5M2UA 3AAWB 4QIEA 3CCWA 2PD1A 1HQUB 1H0HB 3MM6A 2ATLA 1OO0B 2UV8G 3QGIA 5KT7A 1IQTA 2UXCF 2QSFA 2K2PA 4PR6A 3M2VB 5F0WA 1KVIA 4ZPAA 1RT6B 1N0VC 2CVIA 2YX7A 3M6UA 4L6V3 3BGRA 2D3OR 4O44A 1R6YA 3MM5A 4EWTA 5KT6A 2A10A 2Q1LA 3IWXA 3FNNA 1XMBA 1S1VB 3N6LA 1F5BA 3OUYA 1XBWA 4UW2A 4DG1B 4QYRA 2I2YA 2E1RA 2VFTA 3CD6S 3J7ZT 1Q8IA 4ERDA 1DBDA 3QJJA 1FVSA 4DR1F 1VBZA 4LF5F 2VA2A 3C2PA 4C4WA 1S97A 1C4CA 1DQ9A 4KGMA 3DU6A 1REVA 3TAMA 4GC7A 1FNOA 3DC2A 3MEGB 4I7FA 2VG7B 5DDQC 1RTDB 3OXLA 2QFJA 3R3TA 2CPZA 1WI8A 5H9FJ 2HZCA 3OL7A 4QW9A 2W7OA 2ZBIA 5EHHA 2KG1A 4UY8T 5KFDA 2GHVC 3DYAB 1RT3B 3G86A 2FUG9 1E6VA 5IXUA 2KM8C 1DHMA 3BM7A 4N8OA 4Q44A 4LF9F 1VRTB 4M95A 4LFBF 2MZ1A 2UP1A 3TRGA 4ALZA 2EFNA 5T7LA 4LF7F 3BO4A 3OTOF 2C3OA 2XI2A 4LF6F 5C25A 4J9RA 6FD1A 2CPFA 1UVLA 2NQPA 3OR2A 1VQ5S 1IJEB 5D4LA 5J2QB 2EFQA 3B82A 4LVOP 3V81A 2YWGA 1TR0A 5J2PB 5KFOA 3I4PA 2B7BB 4IO1A 5HL7Q 1D9FA 2OMOA 2DCLA 4DR3F 2LLZA 1GTHA 2FJDB 3H20A 2E1CA 4L72B 1RT1A 4DV5F 3T3FA 4P7TA 1H6KX 3DHXA 5L1IA 3MEDB 1C0TA 4TU8A 1LXJA 4NPOA 1HWKA 1HPZB 3ZZUA 1LK7A 2RKIA 1N5QA 3VR1A 1B0PA 1R8HA 2R2SA 1KQFB 2AYMA 2JEIA 2OAUA 3KG0A 4B3OA 2PC6A 2O66A 4IG0A 2D1CA 3CCUS 4N76A 4YDDB 4KAIA 2HFNA 1JKHB 3BGFA 3TP2A 2ZH2A 1LW2B 1X5OA 3CD0A 1H2UX 2AJ1A 2B43A 2V4JA 2ZD1B 3CVKA 1ZPVA 3DOMA 3DOLB 5FJ4A 4ZS6A 4C11B 4C9DA 3K8WA 4TY8B 3PJWA 3D0GE 1O5JA 3SV4A 2HHTA 5KFPA 3MMCB 3VAKA 3ENQA 4C0BA 1HWUA 4OIXA 4DL4A 2VQFF 3GYXB 4G6VB 3VCDA 2YWKA 4F3OA 1V3ZA 1TV6B 3CCQS 4H4KC 5F9NA 4M5DB 3I31A 4FP9A 3CCSS 3CDEA 1FKPA 2Q43A 4JUZA 1VQPS 5J1NA 5FDLB 1SIZA 1TVRA 4KKOA 2VPWB 3DLEB 4Q5VA 1GAOA 4QWEA 1M5OC 5HP1A 3RR7A 1DQAA 4RNOA 4J9MA 1KQSR 2VV5A 1T8EA 3Q24A 1FEHA 2BABA 5KFBA 1FRMA 1M5SA 1FE4A 1FXRA 3Q22A 4YMEA 3B8HA 3WX4A 2YKAA 2KO1A 3M4XA 5GMKa 3WC0A 5BYQA 2CQ0A 1S1XB 2JFDA 3M2UB 2BUNA 2R7XA 1E6YB 4NZ0A 5KFGA 1FTCA 2YNFA 4OI3A 3DLLQ 1HQEA 1NJYA 1N32F 1LV5A 3SSSA 1S6QB 3SSRA 2XNRA 1SL1A 3N28A 4A8SA 1RT5A 4B9VA 3UCGA 3V6JA 3LP0B 2OPPA 1JJ2R 4YR3A 1D1UA 2E1MC 2XS2A 2AGQA 3EYZA 3KWMA 2LQJA 2RRNA 4CI0B 2V94A 1KLNA 2IRXA 1HD0A 5JXSA 3GQCA 4F4YA 3UR0A 4OZLA 3FCHA 1S10A 4XAKA 2CPXA 5DLGA 4K4XA 4F2SA 4B02A 2JEJA 5LMUF 3KLFB 2ZFHA 4QR1A 3UCUP 4IRKA 3PX4A 4NA1A 1HA1A 3CJ2A 5K5MA 1JB0C 1X5PA 1FESA 4NZ7A 1WNEA 2OPRB 2BZ2A 2KB2A 3OBIA 3SQGA 2OKQA 1SJ1A 2GQCA 5J1PA 1DAXA 3VAMA 3SCKE 1QY7A 2PE8A 3VQSA 1R89A 1H38A 2YNIB 1ZZFA 3GG1A 5F9LA 3CCMS 4IKAA 3MTJA 1YI2S 1N8RT 3T6JA 2F3JA 3MMBB 2MZQA 1HYSB 3NS6A 2LECA 1DQ8A 4MFBB 2OD6A 1HNIA 1BY9A 2VL1A 3GG0A 5HMXA 2AJ0A 1AFJA 1C0UA 4DV4F 3D28A 2ZUGA 4N77A 1RK8A 1P8GA 3THVA 3H98A 1HPZA 2XO7A 4CIOA 4DDFA 3DRRB 3AJ1A 3MZIA 4H4MA 3R1LA 3G6ES 1TKTB 3KK3B 4QWCA 3OV7A 3D0IE 2ZC4A 4PPZA 2ZHAA 4J9KA 3DLHA 2XC9A 1IQZA 1FJGF 3QAUA 2V4QA 2QEXS 3MD1A 2L41A 5A2QY 1G2EA 5DG9A 2YWHA 3M6WA 4FYDA 3NNAA 1L3KA 4WTYA 3M9MB 2ASJA 3DOLA 2HNYA 1L3UA 1S6OA 4X4OA 4YB7A 2XG8A 4RNMA 3HI9A 4DSLA 2LQBA 1FDBA 3GV7B 4YUDA 5CYQA 4EYIB 4FXDA 2ZC3A 2B4OA 2LXUA 3CC7S 3V4MA 3MMCA 2VQEF 4PG8A 1LK5A 1RQ0A 2IC3A 4JV5F 2A2DA 3UR3C 3IA0A 1NHUA 1SJQA 2ZJQQ 4DQPA 2AJFE 1ZAXA 5D77A 1JMTA 3PRBA 4PWUA 4R5PB 4M5DA 2DBBA 2DGOA 2PSZA 4HEA9 4K4TA 4C3LA 4Q2MA 2FVRA 4A47A 4A8QA 2Q6BA 1HBMA 2BA9A 2W9BB 1KFDA 3R5BA 5K14B 1GXUA 1N48A 2DNRA 3P3DA 4EBEA 2RQCA 1YRXA 1VQ9S 3AB4B 4C2MA 1KONA 3TANA 5GVQA 4GKKF 1S7HA 1NRKA 2KH9A 4LMZA 2BXJA 1BD6A 3M2UA 4OHVA 4XDCA 4ZP6A 1FDAA 4IDKA 3UPFA 2DVIA 1JLQB 3MECB 4Y34A 2LQ9A 2C3YA 3K5MA 2HGMA 4JI3F 4NLRA 4OZNA 3HPOA 1UFLA 1G7CB 3E01A 3RW7A 1X9SA 5KG3A 4DHVA 5F0UA 1S9GB 2EK6A 1O51A 3Q2TC 2Q6CA 4WK3A 4OX6A 2RUGA 3J7YI 1IKWB 4ECYA 3EGWB 4AXIA 2B9WA 2XMWA 5T14A 1TZ0A 3DLKA 5HN0A 2YWFA 2LVWA 3NCRA 2AGOA 4K4VA 3JAMY 1S6PB 3F44A 4L3NA 2MXYA 3IWNC 1AUDA 4ELTA 3BSCA 3BR8A 2HHVA 1MWZA 4YR2A 3PW2A 3LP1A 1YJWS 2F8HA 1YVFA 3DRXA 2GMJA 2IBKA 2RDIA 2HLTA 2YNGA 1NHVA 2PT0A 4OZJA 4UUWA 1T3NA 3G8SA 1PILA 4A8YA 2KT2A 1UVKA 3Q8PB 3QGGA 5I3PA 3M9NB 4ATNA 2E29A 1B64A 2C22A 5B0AA 4RW6A 2PA8D 1TL1B 4B9TA 1JJHA 3KK3A 3DXBA 2HVIA 2OP5A 5L9XA 3DRSB 1ZM2A 3VZHA 1Y00A 5L38A 4N8NA 4TYBA 1FTRA 3T19A 4YB5A 4Y6IA 2QO3A 1S0MA 1SUQA 3K59A 3D1QA 1FRXA 1ZBTA 3P6YC 3O5TB 4QWBA 3IRXB 3DU5A 3LGMA 3HO1A 2KFNA 1JXEA 1UL3A 3K2YA 3LGNA 2IBOA 2FC8A 2N3OA 1TAUA 3QYYA 1QSSA 3CDUA 2L9WA 5DM7Q 3MURP 3HF5A 4RW7B 2DNMA 3D54A 3EX7B 3L95X 3OQ2A 1X4BA 5GAGI 4R5PA 1SH3A 1T3OA 5KG2A 1YJTA 4WZQA 3JTNA 2COLA 4FN5A 3W2VA 2W7AA 3FFIB 1JLCB 4QIVA 4WCEQ 4CH1A 1U6ZA 2J9DE 2HHUA 4FF3A 3AB2B 1FXLA 1XMOF 1RTHA 2U2FA 1TKXB 3POTB 2BQ3A 2LXIA 4K4UA 1KNZA 3H8YA 3KLGB 1UVMA 2ZE2A 3O44A 3LUYA 2ROGA 2FB0A 1N5SA 3TA0A 2RF2B 1P1LA 4PCQA 1IKYA 5C42B 4G3IA 5L1JA 1RTIA 1T95A 2C28A 2CRLA 4H4OA 5CD4H 1BC6A 2W4PA 2YQ3A 4KTQA 1Q8LA 2XSFA 4ID5A 4ETXA 4JI1F 4PPDA 3HXMA 4ED0A 1LOUA 4X84A 4WF9Q 2A18A 1Z2ZA 1FNMA 1HBNA 3FEYB 3LPYA 5K8NA 1Q86T 4JI5F 4CH7A 1KHVA 1YG0A 3MPYA 4HDGA 3CF5Q 2CQIA 4IQXA 1ROFA 4MYUA 2P6TA 3RAMA 4LF8F 4B3TF 5A8RB 3NBPA 3HZEA 2CPIA 1WHXA 3BDEA 3IG1B 2IVYA 1GXTA 1RT4A 1YBAA 3C6TB 2QLXA 3HVAA 5KFAA 1R7IA 2ZKTA 3JYTB 4ECSA 4LF4F 1B7FA 1VBYA 4KO0A 1S6PA 1AFIA 1RI7A 4EFAC 4QU7A 3OFEA 5A8WA 2K8GA 3A8EA 4IO9Q 2NSBA 3BGLA 3E51A 2HNDA 3DHWC 3TOQA 4BS2A 2KXHA 5DLFA 1BQNA 4B3SF 3HM9A 1QAIA 5E3RA 4IOCQ 1YTYA 2E5LF 3PR5B 2D74B 4RWWA 1I6JA 3OR1A 2C2EA 4DOZA