1APSA

Three-dimensional structure of acylphosphatase. refinement and structure analysis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
STARPLKSVDYEVFGRVQGVCFRMYAEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of acylphosphatase. Refinement and structure analysis.
pubmed doi rcsb
source organism Equus caballus
molecule tags Hydrolase(acting on acid anhydrides)
molecule keywords ACYLPHOSPHATASE
total genus 27
structure length 98
sequence length 98
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 1991-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1apsA00
1R6YA 2KT3A 3HF5A 4HI1A 2RMLA 3LGMA 3KKFA 1FVSA 1YJVA 5B0DA 5T7LA 2QYCA 2BJDA 3BF4A 3LGNA 2FTRA 3FRYA 3K7RA 4A48A 2GO8A 4HH1A 2XMWA 1CC8A 4Y2MA 4HH0A 3WDOA 1VQSA 4NPOA 1APSA 2ASYA 2GFFA 2Q3PA 1TL5A 1TZ0A 2L3MA 2QLWA 5B0EA 2IYIA 2AJ0A 2PD1A 2ROEA 3HX9A 1JK9B 5B0GA 5B0AA 2LXFA 1Q4RA 1OPZA 2ROPA 4DPOA 1AFJA 1GXUA 1XBWA 1OQ6A 1U7LA 3MCSA 1KVIA 5F0WA 5B08A 1SI9A 2QLXA 1N5TA 1P6TA 2OMOA 4DL0C 2OD4A 3QMQA 1Q8LA 4DN9A 2VH7A 1YG0A 1SQEA 3HHLA 5B09A 2OAUA 2W4CA 4U9RA 3E8OA 1FVQA 3KNGA 5A6WA 2LQBA 3DCAA 2BUNA 1URRA 3F44A 2EW9A 1OQ3A 2RSQA 5T7LB 2K1RB 3CJKB 4HL9A 2XMMA 3UDCA 3HHLC 1X8DA 1X7VA 3LO3A 2N7YA 5KAKA 4OJ3A 2VV5A 2RILA 2CRLA 1FESA 3HFKA 4A46A 1FEEA 2JDJA 1WD6A 5B0FA 2HFOA 1RJJA 1CC7A 2ACYA 3IWLA 3BGUA 4OJGA 4QOTA 1Y0HA 2K7JA 3HHLD 4Q2LA 4OJ1A 4YEAA 2K7KA 3DXSX 3BDEA 4Y2KA 1TUVA 3BN7A 2ZDOA 4OIXA 4EFAC 4NL5A 1QUPA 2GA7A 2IYGA 3MZIA 4ZA1A 2N4DA 4A47A 5A6PA 1CPZA 2XMKA 1MWZA 2OP5A 1JWWA 2AJ1A 1P8GA 4ZOSA 1W2IA 2OD6A 3I9ZA 1N5SA 2GGPA 1V3ZA 2GV1A 1YJRA 2GCFA 2XMTA 3QGPA 4FNHA 1KVJA 2HLTA 2HLUA 3TNVA 5B0BA 2OFHX 3HDSA 1N5VA 2W4DA 2OFGX 1AW0A 2K2PA 1OSDA 1Y3KA 2FB0A 1ULRA 5IXUA 2BYCA 1AFIA 1MWYA 1TL4A 2XMVA 2QIFA 2BJEA 1YRXA 2W4PA 1TR0A 2ROGA 2BBEA 3TOQA 2XMJA 4F67A 3HHLB 2G9OA 2AP6A 1FD8A 3KG0A 1N5QA 1Q53A 1LQ9A 3FMBA 4HI2A 1YJTA 2FHMA 2HIQA 4FNIA 1GXTA 2AW0A 1Y9OA 1Q8BA 5K9FA 1S6OA 3BM7A 2LDIA 1K0VA 2KYZA 3IWXA 1KQKA 1VQYA 2N4CA 2KT2A 2HFNA 3FGVA 2KKHA 4YDXA 2PGCA 5F0UA 2OKQA 5B0CA 1FE4A 3VTIA 4Q2MA 3KG1A 4OJHA 2HQIA 3TRGA 3GZ7A 1FE0A 1SB6A 3BB5A 2IFXA 4A4JA 1IUJA 2RU9A 2XMUA 3CJKA 2LQ9A 2GGPB 1Y3JA 2K1RA 1S6UA 3BR8A 1YJUA 4Y2IA 2FIUA 3T9NA 1X0PA 2ZDPA
chains in the Genus database with same CATH superfamily
2UZAA 4IOBA 2E9ZA 2HHWA 3LGMA 1JLGA 4IG3B 4O3PA 2CQPA 4JI8J 2IM3A 2ZJPQ 1Q82T 4PAAA 2MKKA 1DQAA 1WHVA 4K4VA 3KHRA 3R5GA 1HNIA 3LGNA 3ONQA 4WFZA 2FVQA 5JJBA 1UFKA 2GMHA 3MD3A 2XMWA 3CMAS 1V5VA 1WEZA 4DU8A 1HNWJ 3TUPA 3QT6A 2NQPA 3PM9A 1TKTA 5J1NA 1N32F 5DZ7A 4OQJA 2XWYA 2N7CA 1XTZA 3K8VA 1MW7A 1OQ6A 3POTB 3I0RA 2IPOB 3QGHA 4DL0C 4QR1A 2KVIA 2ABYA 1I1GA 2FJBB 3W7BA 3THPA 4K4XA 1RXOB 3VGSA 1X4GA 2CQDA 2F1FA 1DFDA 4LSZB 4CO1A 3DCAA 3FBCA 3ZZ0A 3SCKE 3Q83A 2V8VA 4CYUB 3EX7B 3VAJA 4OI0A 3AJDA 3H5UA 5DG7A 1YJ9S 1WOSA 3NGDA 1NPKA 4RL1A 2ZZMA 2BACA 3PY8A 3OFGA 1TU0B 1H7XA 2R8HA 1H2VZ 2LEAA 5A8WB 3DLEB 2IA0A 1ZA2B 3MM8A 2Y0SD 4Q8FA 2QSWA 1UP1A 4IR9A 3CCSS 4O3SA 1RTDA 1B7YB 1K0TA 3JTNA 4HYKA 4QYZJ 2ALZA 2HFZA 4PRFA 2QFIA 1I6JA 1GNKA 2VODA 4YY3J 2HHQA 2NREA 4PXBA 4BS2A 1X9MA 2EBGA 1LW0B 2HWTA 4QOTA 2ZBIA 3CD7A 3ZZPA 2VQFJ 4KY3A 3FQKA 3E51A 1MLAA 1TKZA 2NS1B 3TI0A 4OX9F 1N8RT 3CULA 1IKYA 3NAIA 3Q8VA 2PSZA 2CA9A 2HS3A 1S6PB 3MI7X 3P5TL 2PDAA 1U45A 4B9UA 4QYZK 1RT7B 3D1OA 2O5DA 5E41A 4ZLNA 3C14A 3C16A 5D78A 4G6VB 4DV6J 4CCHA 1Q1KA 2AT1B 3W5XA 1FX2A 1U26A 2KN4A 5KFNA 4ZOSA 1W2IA 3D0IE 2P6TA 3OR1B 4ZVRB 2GMJA 1N5SA 3GJRB 4ZPWR 3SV3A 5AE3A 1EETB 3QGPA 1R8AA 3DGPB 4RNNA 2E44A 4MJKA 3TNVA 4M5GA 3D66A 1SJ3P 5BYQA 1N5VA 3O5TB 2VDHA 2NYIA 1RHRB 2VG6A 1N6QA 1NB2A 5KG0A 2HFSA 1MWYA 4CLZA 2U1AA 1LW2B 4DR6J 5ETVA 1PKUA 5DZ6A 2BXJA 2HAFA 5HLFB 1UPMB 1GFWB 1R8HA 2YKQA 2YWHA 3IR6B 4CO5A 4WFNQ 1VQKS 2EG2A 4ETZA 1U49A 3P8BB 4LF6F 2DHGA 5DQGA 2CQ2A 4F50A 1P1LA 2VOPA 2AW0A 2W7PA 5LL6d 3K5LA 4JYAJ 2ZKUA 3G82A 1ZAVA 1XNQJ 2KYZA 1FXRA 2UUWA 4ES1A 4J9MA 2ZE2A 4O3QA 5K20B 4DR6F 4F02A 3HVRA 1E6VA 1VLOA 3IS9B 3NOGA 1Z2ZA 5RUBA 5D3GB 3TRGA 2R3VA 1IXKA 2P2CB 3CDUA 4O4RA 5IV4A 1OIAA 2RU9A 3G86A 2EFPA 1U2RA 2KL8A 4PXEA 1UVMA 5F8IA 1B4SA 1AXQA 2JSXA 2C2RA 4KJIA 4RBVA 4DXLA 5AXLA 2HW3A 1EAYC 2ZDPA 2H3EB 1TVRB 5CYQB 2A6MA 4DX6A 5K8OA 2W9BB 4IRCA 3JTOA 3K8WA 1L3TA 2L08A 2DGVA 2OPRA 1JLAA 3HKWA 2MY8A 4MIAA 5B0DA 2CPFA 2CJKA 2FC9A 1S79A 4Q7AA 1S9EB 2J0XA 4JI4F 3I4PA 3K7RA 4FPRA 1N52B 1CBKA 5A8WA 4ZVFA 4X64J 1DURA 2B3TB 4AYBD 1R0CB 2FZCB 3GJQB 2W2PP 3D7SB 5CYMB 1U0HB 1WEYA 2L3MA 3GR1A 3HSZA 4EU0A 3TANA 2DR8A 1X5OA 2AJ0A 2UUCJ 2R8JA 3UDEA 3M32B 4IFVB 3L9ZA 4J9VA 3SFGA 3UPFA 4DG1B 2R7OA 1TL1A 2F9DA 4HR2A 3MCSA 5F3ZA 1N5YA 2B9WA 4DV0F 4ICLA 3M9NB 4PWUA 4FS2A 1HPZA 1SIZA 4ZVQB 1YX2A 4OHVA 3HSGA 4BC7A 3OTDA 4KHMA 4U9RA 4H4OA 5ETPA 5HQ8A 2IAJA 1R3NA 2XCAA 4UQTA 4NA3A 1RT1B 3M8RA 5H9FK 2EW9A 5KFGA 3HD2A 2J9DA 4CP5A 3CCMS 4F4KA 1T9TA 3ITHA 3V4IB 2O66A 2ZKTA 4QBUA 4KHPF 1AUSL 3AA8A 3GFHA 1GMUA 4NLDA 2W9BA 2XO7A 2HHVA 1IQTA 2E1PA 3HT3A 1FFGB 1M1HA 1ZAXA 1X9SA 4F04B 4KO0B 1N6QB 5EX0A 4DV3J 2GVDB 4DL3A 2I5JA 3TQ1A 4CLKA 4RNMA 1RJJA 2X1GA 3F56A 4G65A 4OJGA 4DMZA 4BHQA 2PI4A 4N5SA 2CPHA 2Q6BA 2DHHA 5IWAJ 3FKBA 5CYMA 1IKWB 2ERRA 4F3QA 4RW4B 4LSNA 3AJ1A 4K0KF 2L41A 5T14A 2CJ9A 1YTYA 2IYGA 3HI9A 2XO6A 2CNNB 3M32A 4IFVA 4CWBA 1S7IA 4FF3A 2QMUB 4KR0B 2XS7A 1S1UB 1MWZA 3P49B 2LLZA 4L73A 1RHKB 1P8GA 1QAIA 2OD6A 2H54B 2V0NA 5DM6Q 4YP3A 1VS3A 9RUBA 1PBAA 1YJRA 1J5OA 2ADBA 2DNLA 1FDAA 3B4DA 3LPYA 2X51A 2OFHX 4LBIA 5LMUJ 1WTFA 5L46A 2GVZA 1UTAA 3QT8A 2BW2A 1WHWA 2CADA 2VJVA 4AD6A 4B3TF 4DX5A 2NPIA 1ZM3A 2BOAA 3H2LA 1U1QA 4C8ZA 1RT5B 4LQ3A 2V2KA 5FDLB 3VQTA 2EK6A 3W9HA 5C42A 3LH2S 3T6BA 3MR3A 4CLFA 2JOQA 3JSRA 1TVRA 4LBPA 5CYQA 3A13A 4ZPTR 3SBMA 3TUJC 2XZWA 3NEKA 3C8YA 2J7KA 4NRTA 5ETOA 3R8YA 3RBXA 5DLFA 3MCMA 2GAGC 2G1HA 2LXIA 2MKYA 3DMJA 3RB4A 4V19X 2DR6A 2XCPA 3S1TA 3JSMB 3Q22A 2C2ZB 3AXMA 3E3XA 1NK0A 2DO0A 3PG9A 5A8KA 3CJ8A 3ENVA 2ZHOA 2ZBCA 4PWWA 4N77A 3IXQA 1VIOA 4OI2A 3T41A 2PGCA 3ADAC 3A8EA 2OKQA 3GIRA 3U27A 1PYTA 1NSAA 3ZZOA 2A10A 8ATCB 3LP2B 3GYGA 2CIMA 1Q5VA 3HHDA 2HVHA 2DNYA 2J0QD 3EVMA 2ZD1A 4PYAA 3C6TB 4CYUA 1FJGJ 5L38A 3RAQA 2DGWA 3BJYA 2XEXA 1RTJA 2DTJA 2B4VA 2B51A 4LVOP 3Q0AA 1TFWA 2AJFE 2YWFA 3MECA 4FKYA 5EHHA 4Y0FA 2E5LF 3OPKA 5K8NA 2VG7B 4WU3A 1V3RA 2KT5A 3B54A 1RT5A 1OWXA 3MHYA 3NRBA 1WJ9A 3VWSA 3QZ8A 2J0SD 1X5TA 1IBKF 1CJTA 3DHXA 2Y1JA 1OO0B 1Z1ZA 2B7CB 2YH1A 1CC8A 3MR6A 3DRRA 3FVYA 2AX1A 4ED4A 4IO9Q 3OVSA 2YKNA 4K5RA 1JLQA 2MQLA 3KK1A 1IBLF 2WVCA 1VBZA 2UXCF 4WKYA 1LWFA 3D2WA 3I5AA 1Q4RA 2FLPA 3VF0B 2CZVC 2GO9A 1XBWA 2PMWA 1C1BB 2MKJA 2Y1LB 3K17A 4HHJA 4OV6A 2PO4A 4QZVB 1HR0J 1WUUA 1K47A 4PYDA 1YRTA 4P6QA 3GV7B 2AWZA 1SJ4P 4LF2A 1CSJA 2MKCA 1DTTA 2AGQA 4C8LA 3MEEA 1HW8A 2DR7A 2ZD1B 4UY8T 4F0MA 4NLPA 1RB0A 4U8YA 3MF5A 5T7LB 4XIUA 2LP4A 1YHQS 6FD1A 4B3SJ 3FRZA 1RTJB 2AEJA 5KT2A 1VC6A 1GMWD 1S7HA 3SI8A 3UFCX 5HLFA 1RTHA 1T9WA 3JXOA 4EBEA 4DS5A 1HNZJ 3C19A 3W5ZA 2J8AA 3CJQA 2GIRA 4LF7F 5GAHI 3HFKA 4KHPJ 1CS4B 4C11A 2VHGA 1M5PC 1JLBB 1VRTA 2WHOA 3D68A 2QL9B 4WK1A 5MLCV 1RAJA 3MUMP 2JL9A 2B56A 3AOCA 2C3OA 4OYZA 3RZAA 4HT7A 3PDNA 4DZDA 2EI5A 3W2VA 5GAGU 2XLJA 1QAXA 5LJ3Y 4YEAA 3PRDA 2QFJA 2V5HG 1MU2A 2MQPA 1EIYB 4OIXA 3CJ3A 1E6YA 3T1YJ 1IKVB 4OZ2A 4NL5A 2IC3A 1MN7A 3UN3A 3UD5A 4WF9Q 1WF0A 3D67A 2DRAA 4RNHA 4ZPCA 1N34F 3KLHB 3H7HB 1C1BA 3IA0A 4OI3A 1HIYA 4IG0A 2FLNA 2VFRA 2YX4A 2AJQA 3LF0A 4ECZA 4DF8A 1VGYA 1UKUA 3FDSA 4R8UA 1TELA 4GKJF 2DNQA 3DRYA 1XNRJ 1HFEL 2J5AA 4DSLA 2A18A 4YHHF 1JNRB 3GIJA 2QC3A 1VLYA 1WOPA 2FVRA 4PUOB 2XMVA 3G2XA 2CG4A 4FP9A 1TR0A 1G1XA 4DQPA 2YPYA 4USVA 2M70A 4AL6A 2BEFA 3A3NB 2N82B 1HBOB 5KFAA 2HGMA 4WE1B 1MWQA 2VG7A 4KIAA 3VAKA 2YBVA 1RU2A 2J6TA 4JI0J 1PC5A 3QJPA 4A8KA 4WP9A 2D9OA 4EWTA 3OV7A 2DGOA 1BMQB 4RJVA 2HFVA 1VQYA 2D7SA 1KHWA 5HVGA 2VICA 1F3FA 1MU2B 1S5ZA 4IQXA 4W90B 3W62A 3EGWB 1JLEB 1X5PA 2C42A 1HPZB 4NLTA 4I56A 4C8MA 1WHYA 3HVTB 1N32J 3RW6A 5HATA 2IAJB 2VKZG 3SSQA 4IG0B 1G3OA 1NK7A 3AHPA 2GGPB 2K1RA 5KG6A 3NMRA 1B64A 1WG4A 4MKAA 5L1JA 3ITHB 3V4IA 3G6YA 4DUYJ 3AB2B 4PQAA 5FIIA 3TA2A 4DLEA 3N5BA 2V69A 2WSEC 3ZZUA 3KTQA 1YSJA 2QV6A 3B6BA 5CD4H 1DQ8A 1LWXA 3FEZA 4ATNA 2DVIA 4C8OA 1NDLA 3VV2B 2HMIA 5T7LA 1TL3A 5J2NA 4M5NA 2GJIA 2I5JB 3BF4A 1K73T 1MMLA 2VASA 5IOLA 3LWMA 3FRYA 2UVWA 3BBCA 3DM2B 1LXJA 1HBOA 1B99A 3PW4A 1NJYA 1IBCB 2GO8A 4UOCA 4JI2F 5A8RB 5HSPA 2Q43A 4LFAF 3WDOA 1V9OA 4NPOA 2BQUA 2FJEB 2R2RA 2GFFA 3UCUP 2IDEA 4ZVHA 3A8IA 3GONA 1WACA 1HI0P 3LAKA 3IM9A 4KYZA 1Q95G 5K14A 1UFWA 4UZBA 4CRJA 2IIHA 2P6SA 2ZEJA 3SYZA 2V2QA 5BYRA 1QTMA 4IUFA 3A12A 4P2XA 2H9ZA 1UPPA 1UW4A 1NK5A 1YG0A 4Y65A 2VJUA 2XS2A 3G9CA 3HHEA 3KJVB 2UP1A 5A6WA 3MM6A 1BWEA 1ACMB 2HPUA 2B4OA 1H74A 1WOOA 4X65F 3PZPA 2Y8WA 3M2RA 2F9JA 3RB6A 2GIQA 2YKMA 1SXLA 3KLIB 2XMMA 4B02A 5IQ6A 2XY7A 5H9EJ 1NJXA 1GEHA 4LF4J 3QFWA 1RKJA 2C2EA 3CCLS 2CPYA 3BDPA 2F40A 5E3CA 3HSJA 3MMAA 3U1NA 2O1PA 2N3LA 1WKJA 4DR5F 1NZAA 2JDJA 2MY7A 3M8ZA 4PUOA 3KDNA 1UEUA 3PYFA 2ZNYA 1U6FA 2HQGA 2X7IA 3ZTQA 5D8HB 1WORA 3HJFA 4YR3A 1T03B 4RUCA 3KLFA 5LMNF 2CXEA 5AT1B 4OL8A 3MPDA 1RYSA 2K7KA 1R6VA 1A7GE 4FXVA 1TUVA 3ENAA 3MMCA 3U7JA 3LP2A 5A6PA 4NEYA 2YVSA 3GWCA 4P72A 5ETNA 3SQGB 1XMBA 3ILOA 4CI0B 4TQRA 5L1LA 3NMAA 1GK8A 3W3SA 4TLRA 3C6TA 1AB8A 2PI5A 3ZTOA 2FDNA 2F4VF 4F4WA 1OS5A 2DGQA 4MTPA 3IG1B 1U1KA 4M95A 4AXIA 1XIQA 1IBMJ 1NHKL 1S6QB 4ZN3A 1A9NB 4ZP8A 5DO2A 3WX4A 4NLVA 5HP1A 2F5GA 1NK4A 3PVXA 4DUZF 3PJWA 1U2FA 4JB8B 1U24A 4DSJA 4Y2CA 5EGYA 1KR4A 3EYZA 3SDEA 1Q7LB 5HK4A 1LFWA 1TKZB 4DPXA 4LJMA 2ZHAA 1NSKL 4CT8A 2F8HA 3UW1A 4J9OA 1NK8A 3MEDA 2QZ8A 4M1KA 2RQMA 1U1OA 1VBKA 4QIVA 3HD1A 3TX0A 3V81B 1FKAF 2UV8G 3MTKA 4OYIA 2JLFA 3PFEA 3H40A 3TUIC 5SZTA 1S6OA 3CD5A 1T0TV 2WSFC 4RU2A 4DR7F 1Q78A 1IR0A 2EFNA 2KJVA 1UFLA 2HBRB 2RHSB 1TP7A 1EP4A 3T1HF 3S01A 4J9UE 2IRYA 2BM0A 2KXFA 3D28A 4JV0A 3W64A 4NOHA 1HWIA 2E29A 2HQIA 3H2VE 3EDQB 1JXLA 4KPYA 1UVIA 1YIJS 1HWKA 1U8WA 2NXJA 3MEKA 1VFJA 3K2YA 4O3OA 2KRBA 3FUYA 2LEBA 2XWXA 3RJMB 1HQEB 1GAOA 5C24B 4OZ0A 3T9NA 2NZCA 3MPYA 4W4MA 1RWNB 4HI1A 3OR2A 1S0VA 1HA1A 3MEGB 3MM6B 3R7BB 4X4VA 1X31C 5E33A 2HYIB 4ZCMA 3M2RB 3Q86A 4OHXA 3W8PA 4EBCA 1NKCA 3AA9A 1BQNB 3OTEA 1RYRA 3UR0A 3MXHP 3OT9A 2HS0A 2HRTA 2WB4A 3SDEB 3IM8A 2W2QP 3KJFB 3D0HE 3OTBA 2CPZA 2YNFA 4C2MA 4QW9A 3GIIA 4DFJA 2HHPA 3N01A 3NBPB 2A2CA 2FYXA 3MEDB 4O23A 4C6AA 7FDRA 1PIEA 2ASYA 3GPAA 4RBUA 3HM9A 2R2SA 1SPBP 2V6AA 3DI6B 2V94A 4QWBA 1YI2S 3RGIA 1WI8A 2DD8S 2WOMB 3CT9A 2HNYB 2LQJA 3FQLA 3OFHA 4K2JA 2CPEA 3KLEB 3HJVA 5F8JA 3KLFB 2HRYA 1XNRF 2Z57B 1U8SA 3NP5A 4YUDA 2QLXA 2FY8A 3N5FA 1WG1A 1HLWA 3DFEA 1KOHA 4IFYB 4NLRA 2V9WA 3RR7A 1P9QC 2DBBA 4R8UB 3LAMA 2QMWA 4OHYA 2DITA 1RWXB 3O8WA 1DY3A 1FVQA 1SV5B 4B3MF 2P8IA 4XDDA 1N56A 4C0HA 2E9RX 2RSQA 3RW7A 4HL9A 4HVZA 1PBUA 5HP1B 1W26A 3UDVA 3VAHA 1Y5LB 4ZLLA 4BBYA 3H8YA 4OJ3A 1SUQA 3OR2B 5HJXA 4A8SA 2OEJA 3OTOF 4WE1A 2PEBA 1Q0NA 1H7WA 2D69A 2EG1A 2R7VA 5F8NA 2H48B 2W24A 3RRKA 3N6LA 3PRBA 3ILLA 3BKUA 1R8BA 1ICEB 1X4HA 3GJSB 4P10A 3W63A 5C5JA 4ED1A 1TFYA 2H4WB 3KJQB 5B08A 4GC7A 2DEJA 3IC1A 1FJCA 4OJ1A 4CLSA 4IH5A 4Y2KA 2VU5A 4ZLJA 4C3KA 1RQ0A 3WIUA 4QWEA 2HNYA 1JNZB 4Z2XA 1KBRA 1RT4A 3UR3C 2UU9J 1JLFA 3H2UB 3POTA 3DLKB 2KM8B 3EPGA 2WVBA 1D8YA 2RRNA 3PW2A 5CD4A 1YJWS 2M8DB 2DH7A 3SCLE 5K8PA 4FNHA 2UUBJ 4U7UD 4YOEA 2HLUA 2M52A 3KMQA 5B0BA 2POKA 2U2FA 4PWDA 5L1KA 2XHCA 3UDLA 3R1HA 2FJWA 4FVCA 3J81U 1U02A 2XQCA 2KU7A 3T3FA 3Q2TC 1EHWA 3QNWB 3W1YC 4DN0A 1NSQA 4ECWA 1RABB 3G8TA 5DS7A 1HWLA 1VRUB 1U25A 4J9LA 1Q7YT 3CDBA 4F0KA 2D41A 2NYHA 4MK8A 2HMIB 3MEGA 3K89A 1N5QA 2P9GA 2FHMA 2JLEA 3DRPB 3MWBA 4KGKA 3M8SA 4DV7J 1RAIB 3GP9A 2IMWP 1XR5A 3PHTA 2BE2A 3DNCA 3G8SA 3AJ2A 5F8HA 3OHAA 1S0OA 1R27B 1LWCA 3KWMA 4O44B 3IAM9 5K14B 3ENQA 1S1UA 3T5JA 2D1CA 1EZZB 2V4JA 2Q66A 3VAGA 4ERDA 5IT0A 5J1EA 3NL0A 1J5OB 1G7CB 3UN2A 1HD1A 2YY3A 4BCAA 4U95A 3C16B 2WVEA 3AD8C 1FE0A 2XNQA 3OUYA 3J80Y 4LR8A 1VCTA 2NXUA 1HQUB 2QX0A 3DLKA 3QGIA 4ZDNA 4J9NA 3CJKA 4J5OA 4K4WA 4DL5A 1ZZNA 2HHHJ 3QAUA 4Q8EA 2MQNA 3A8KA 3HVAA 5FDLA 4K0KJ 1R0AA 1FEHA 4TU8A 1X0PA 2F7VA 1VJQA 5CYJA 2KG0A 2O01C 2RMLA 1OSCA 3TJ8A 2V68A 3TJ9A 3GV5B 2VG5B 4QU7A 4B9NA 4NCAA 2BRKA 1IM4A 1T94A 1WELA 2MJUA 1RBLA 2PT0A 3DMJB 4B08A 1Y5IB 3HPOA 2Y3YA 3E2EA 1SC1B 5A8KB 1RWPB 3BYPA 3RAMA 1HNWF 4RW6A 3WIVA 4FYVB 1NDKA 1HBMB 3FFIB 3NXZA 2RKIA 1QM9A 1T8EA 3DRSB 5KT3A 1L3SA 3O44A 2CWKA 3DOMA 1B3TA 4JI6J 2KTQA 4B3RF 3G82B 3HX9A 4YB7A 3A4TA 1PYSB 4DPOA 1JJ4A 2W1BA 4TQSA 3EICA 1R7IA 2A3JA 4X4UA 2DH8A 3OL8A 1Y11A 2QL7B 3NS7B 4MKBA 4Y6IA 1NZ8A 4ILLA 2OAUA 1S1VB 2OPPA 2GNKA 2MHNA 3KNGA 2BUNA 2DNHA 3DLHA 3QSIA 3V4MA 3CJKB 1H0HB 3UDCA 4YHHJ 4A8WA 2HHHF 2HS4A 2VFUA 3KUHA 1QE1A 5D4LA 1SJFA 4ZPVR 2VPWB 1KQGB 1X7VA 4QWCA 2FD2A 2OSQA 2KHCA 2ZC4A 3RUBL 3MR5A 2NZ4A 2W2OP 3PO4A 2YWKA 2MZJA 4FYYB 2QYGA 3MOZA 5E3PA 4DPWA 3NS6A 2K3KA 5HMZA 1RHMB 5D0EA 4DBQA 3MFIA 2QA1A 2YQ0A 5LOQA 3VALA 3Q23A 3C3LA 4OV1A 3TYTA 2IDLA 2IRXA 3GIMA 3W66A 1PO6A 2JEFA 1K1QA 5KTQA 4YR2A 3T1YF 3BYRA 3R5DA 1VQ4S 3L4BC 2EFOA 3D9BA 2H5JB 1PC4A 2CKWA 2MPUA 3D1HA 5ETSA 4C0OC 4XO0A 2LXUA 3FFIA 5DDOC 4ZIVA 1T3NA 4ELVA 1HI8A 2DHSA 1G4CA 1X60A 3R97A 5KFBA 4A8XA 4IRKA 4CO3A 1DTTB 3PR5B 2GA7A 1LWCB 4HDHA 3QJLA 2V50A 2AEFA 2V2VA 2LYVA 1EQMA 2CZ9A 3TAMB 5IZHA 2AJ1A 3BBFA 3DOKB 5LXYA 4ZJLA 1RLCL 1UEKA 2ZWOA 2UUCF 3BH6B 3JSBA 3U02A 2XY6A 2HQCA 4C8KA 1HQEA 5C24A 2Z0GA 3I55S 2ZOFA 2DGTA 2E1AA 2LFVA 4F4YA 4DL7A 1XNQF 3BKFA 2K2PA 2MQ8A 3M8PB 5IXUA 4QU6A 3DRXA 4DQRA 3K0JA 2YTCA 3CIZA 4QW8A 5H9FJ 3ZZYA 4DCJB 4LR7A 4ZVEA 5GMKa 1F9EB 2KZZA 4I4BA 2ILYA 1RAFB 2HHXA 1CLFA 1Z4UA 2J8SA 4MMOA 1F0XA 4LVNP 4L75A 1C4CA 4LF6J 1HR0F 1SH3A 5KFUA 2CAJA 4J7CA 4UOHA 3DI6A 4ID5A 3P6YC 1ZPWX 3FBBA 3CO0P 2WOMA 4QJVA 1REGX 4NLXA 4CT9A 2VC1A 3BSNA 3IMQJ 1U4BA 1SIWB 1M5HA 4TYAA 2BW7A 5E7OB 3GFYA 4EGLA 3P5BP 1IWGA 1TL7B 5GAHU 1UVKA 1QVGR 1IBKJ 1KHVA 3UCGA 2HVEA 3GZ7A 3WBZA 5AXNA 4X2BA 2AYGA 2NXEA 4JI3F 5J2PA 2HVIA 2J9DE 2XGQA 3OSPA 2EKYA 3MPUB 4ED7A 4WK3A 4Y2IA 2XY5A 3FZBA 2F4VJ 2XSJA 2XZTB 3HK2A 4N8NA 1TAUA 1GXLA 2PE8A 3M1VA 3PEHA 5D4PA 1N4LA 1S1VA 2OPPB 3NCPA 4K59A 1YLXA 2KRRA 2ZVSA 3GTYX 3M8QA 4URSA 2EBEA 5F41A 2N3OA 2H51B 3I5BA 4ZP7A 2MZQA 2AIRB 3I31A 4KT0C 4LT6A 2ZH9A 4L3KA 4QPXA 5C42B 5IQQA 3JB9k 3EUNA 4U96A 2ZUAA 3FBFA 3EXYA 2QTWA 3QIPA 3DLGB 3BKTA 3MUTP 1RTIA 3ILIA 3M9MB 5B0EA 4RNFA 4XPCA 4ENOA 4IKAA 2AYBA 1S6PA 2CQ3A 4CNYA 4PPDA 4NXNF 3R7NB 1VJWA 2RH3A 2V8DA 1IM6A 1U47A 2PC6A 2XULA 3QAEA 4D3HA 4LFCJ 4IDKA 3M7VA 4NZ7A 1HHQA 3X3UA 2DR5A 3CGIA 1U1MA 3R6GB 3BGFA 2VH7A 4LF4F 2PFDA 2PMZD 1R31A 2RE1A 1L3UA 1RA7A 3NCRA 2R8GA 1B70B 2LQBA 2FHKA 5J2PB 5KFFA 4QQBA 2OPRB 4DN9A 4FF4A 2E7WA 2OGUA 1X8DA 1WC6A 4CLYA 5U47A 5HJYA 1S9EA 2J7UA 4PG4A 1FXDA 1QLNA 3X1LB 2CJQA 3BSAA 5B7WA 2G2ZA 1URNA 2MSSA 1Z2LA 3H20A 3G6XA 1FNMA 2DHAA 1WD6A 3ZC4A 1NHUA 4M5KA 3VQSA 3BSCA 3IBCB 2GQCA 2V34A 3DLGA 3N6MA 2I2YA 2HAIA 1D3WA 3KLGB 2YXLA 5LSLA 4WFBQ 2WRMA 3BDEA 3BN7A 3O2IA 4XPEA 3G71S 4AFFA 3LOUA 1QUPA 1S1WB 1B0PA 1FTRA 3ET6B 2VUGA 3ETMA 4X65J 3AFGA 2J7WA 3QZ7A 4B9MA 3RTVA 4RUHA 3I32A 4WTOB 3BGRB 4M5JA 4RNOA 3KK2A 4EYIB 4H4KC 5HN0A 3HFVA 1NCLA 3W5YA 1H2UX 1RGVA 4TLQA 1RAOA 3NG8A 1M1GA 2DGUA 3ZZTA 1CJUA 3CCJS 3MEEB 2D3O1 2YNHA 4ANCA 2V63A 2W4DA 2CZ4A 4ZPDA 1OSDA 2WBMA 5IFMA 1ROFA 3H5YA 1YBUA 3DGVA 1TV6A 4DFPA 1SC4B 5FD1A 4RU9A 3CNQP 1C4AA 3MURP 3H5XA 1AFIA 3CCTA 2E5GA 3I0SB 4AUKA 2DNKA 3EGNA 3C66A 3CDAA 3KG0A 4I2QA 4LFAJ 2B8PA 4CO4A 4JI2J 2IJNA 3KXDA 4L6V3 3LUYA 1ZH5A 1RTZA 1CS4A 3GJTB 1HBMA 2VC0A 2CJYB 4C11B 3KHLA 2R7WA 1H73A 4YB5A 1T9YA 2LECA 2DEIA 1X4BA 1HHTP 1WSVA 2PN6A 1K1SA 5DDRC 4LFBJ 1VC5A 3AT1B 1RCXB 3ZTPA 4KAIA 1S10A 3JYTB 4B9LA 3M8YA 1RTIB 1RA6A 5KFKA 1JIHA 4YDXA 2MZ1A 1LWEB 3SSSA 2HHSA 4OYBA 2HKEA 1IKVA 2M8HA 2BQ3A 1X9WA 1S6QA 2JRSA 4X84A 4OFZA 1NH8A 3PYEA 3EMTA 3KMSA 1WI6A 4TU7A 3H42A 1RHQB 1FO1A 1RSCA 3PX4A 3GE9A 4IDKB 1SL2A 1HQ2A 3PYGA 4HTJA 5KG1A 2Q79A 4FYXB 3QPIA 3OXGA 3L7PA 5BR8J 2YX1A 1FDBA 1Y10A 2CQ0A 3M4XA 3M2UA 5KFTA 4LF8J 2CJBA 4KRWA 3THVA 2I38A 4M94A 5KFWA 1FFSB 1TV6B 3MMJA 4X66J 2GHPA 2YKAA 2BM1A 2Q6CA 3LGHA 2A1BA 2BJDA 2QL5B 3T6JA 1RAAB 5BYSA 5E2QA 2KFZA 2C2NA 4LSLA 5IM0A 1XR7A 2BANB 1DTQB 4A48A 3L3CA 1WC4A 5JXSA 1TKXA 2NUHA 1W25A 1DRZA 3F0NA 1EP4B 1EJ7L 2Y1RI 4IOCQ 2QLWA 4ID8A 4ZJOA 3CE8A 3WZ0A 3S8SA 4ZMMA 2W9AA 1JK9B 2VBZA 2I8EA 2RVJA 4JYAF 4LF7J 3IO1A 2BE7D 3V2UC 3OL9A 3OVBA 2ROPA 4ANDA 4DR2J 2ZH4A 2HNZB 2OHDA 3DOKA 3MPVA 1OY8A 2IBOA 5L9XA 1N5TA 4HLBA 3WX8A 5C25B 2GS8A 2W7OA 1SQGA 1Q8LA 4XDCA 4DU7A 3HHLA 4CH7A 4G1IA 2W4CA 2L9DA 4DSIA 1Q5YA 4FBTA 4KV8B 1U2CA 1WKKA 4CLLA 7FD1A 2ATCB 3M9OB 1BQNA 3AY0A 5C2CA 3DGPA 3B82A 3M6WA 1FJ7A 4EO8A 4DV5F 3NGSA 3M2UB 2AGOA 3MAHA 2RILA 1X0FA 1ZZFA 2CPDA 1XK8A 2FGCA 3QFHA 3QO9A 2RD5C 4J90A 4LRBA 4DUZJ 1D9DA 2D3UA 3OFFA 1V3SA 1T9XA 3W65A 5F3TA 3C15A 2IMOA 1HD0A 3AOAA 1XERA 2ACYA 3IWLA 4TVAB 2BANA 4CM2A 1PYOB 2DNNA 5HMXA 3BO4A 2K7JA 1KONA 4DL6A 2Y9HA 1TKXB 4KKOA 3UI3A 3CSKA 3FEYB 3QQCD 1HNZF 4HHUA 3TP2A 4IFYA 4JI5F 2GJFA 4O0IA 2C3UA 1SCJB 2UUTA 1C0UB 1PG5B 2JX2A 4CQ1A 2R8IA 4I0WA 4USKA 1BQXA 2HNZA 3IP0A 4CTAA 4DHVA 1NJZA 4IO1A 2Q1LA 2E7VA 2I9SA 2HG4A 3GCXP 2GW8A 3CJ4A 3N0VA 4I69A 4L72B 4ZK7M 2ZHBA 1VOMA 3TWZA 3T1HJ 2HLTA 2B43A 5L1IA 3PIPQ 3LP0A 4TY8A 2RU3A 3FJ2A 5D0HA 1D0EA 4ES2A 4JV5J 4W92B 4F25A 1D09B 4USMA 2GHVC 4DSKA 2AYEA 1I94J 4I1TA 3VGTA 4OZJA 4ZN1A 2VBXA 4FPIA 2XMJA 2M88A 4LF1A 4F67A 2AP6A 2NLWA 4LR9A 1GT8A 3FMBA 5DGBA 2D3ZA 1VIXA 3LA0A 1RT6B 4HI2A 4ECTA 2FJVA 1HARA 2ADCA 1JJHA 4ELUA 3CXCR 4ZVUB 4ZVGA 1JWWA 2RJZA 4D3GA 4B3RJ 3LANA 1IR2A 4P74A 1AZSB 1MROB 3TAPA 3SXLA 3C2PA 2PEHA 3NCQA 1SC3B 2EEYA 4ITSA 4N47A 4O4GB 4L3NA 5DRKA 3W9IA 3WC2A 4USUA 4OX9J 3SZ2A 2LU1A 3I9V9 5EUHA 1KN6A 1N0UA 4Q0BB 2ASDA 4ED8A 3PR4A 2DRDA 4B3TJ 2KHDA 4X4PA 2AZ3A 2ZH8A 2VQEJ 1S97A 2XMUA 3S7RA 4YS2A 2ASLA 3BO2A 3VAFA 2K8GA 3ISZA 1VDHA 4I2PA 4RZRA 4LIWA 2QO3A 2G2OA 2X1AA 3HHLB 2KT3A 2DJWA 3BGOP 3G6ES 2M7SA 2BZ2A 1B7FA 3IN5A 3UNYA 1FVSA 3DRPA 3NWGA 1RCOB 3V6DB 2G1DA 3P4UB 4M5LA 2ZBQA 2EC0A 1VQOS 5E3AA 1RBOB 4O44A 2IJRA 3GIKA 3EGZA 1PAUB 1LXNA 3HULA 4WFYA 2YWWA 4JI6F 3HMJG 1T3OA 3CJSA 4KH0B 2JEGA 2QSFA 5J1EB 4Y3CA 3UCZP 1K9MT 4LQ9A 1WG5A 4ECRA 1S1TB 5THWA 1MMDA 1H98A 2ZH3A 2SXLA 3BH7B 1PJ6A 1NKBA 2HGNA 4KGXB 5CCLA 3O3LA 3T5LA 1KQFB 4OLOA 2A2DA 1Y4ZB 1J27A 4KKOB 1Q8IA 1GTEA 1X4CA 3CMQA 1BLUA 1SI9A 2DNOA 3KJNB 4WP3A 2OMOA 3NY0A 4N56A 3QMQA 3NNCA 1F9FA 1YGYA 4YB6A 2RHQB 1WNEA 4LSNB 5HQMA 4EZ6A 1NO8A 5EWFA 5LMNJ 4YDDB 2VA3A 1D9FA 1HW9A 3HVWA 5C7PA 3R5JB 5CHCB 2ILZA 2RAQA 5I3UB 1URRA 2ZJQQ 3I96A 3CMES 2FJXA 2XM3A 5J2NB 1HKAA 1RZMA 2VPXB 2VONA 3H4DA 1H72C 3SCJE 1VR6A 4DR5J 1WC3A 3MR2A 4UTGA 4CNZA 4JI7J 1FXLA 2JC0A 4WKRA 3O1LA 2VV5A 3W60A 3KK3B 4FS1A 4X4OA 4A46A 2MZTA 1FEEA 3DDIA 2AD9A 4PR6A 3E01A 2DO4A 5SUHA 4GKJJ 1CC7A 1Q16B 3V5RA 5H9EK 3VAMA 2B7BB 2ZWPA 3BGLA 3L95X 3JYTA 2X1BA 4KGMA 4ECVA 3DXSX 4GO7X 3I82A 5D4OA 4DJBA 2OTLS 3QRRA 3D54A 3GSIA 5DQHA 2AEMA 4NYOA 2BVZA 5AE1A 3M8WA 4ECUA 1G6BA 3J7AN 4R0JA 4Q43A 1YBTA 2NSBA 4N7TA 2ZBPA 3AQOA 4ECSA 2PFFB 2IHR1 4FVMA 1QE1B 3ZXWA 3QJJA 2GGPA 5GAGI 2GV1A 2ZOMA 4ALZA 4K2XA 3R27A 2L9WA 3W2WB 4LIRA 1I5OB 3CJTA 3I4HX 1NLKL 4Q0BA 3CJ0A 3ENWA 4ZP6A 2HVDA 2W01A 3IAS9 4R25A 5BJRA 4OZLA 2FB0A 3A3PB 4U67Q 4K4UA 4QCLA 3DOLA 1TL4A 2MXYA 2AV5A 1RE1B 3H98A 4QR0A 4YFUA 1TL3B 3QLHA 4MIWA 1YRXA 1VRQC 2W25A 4P52A 4EK2A 3FCVA 3J7Z5 3NGRA 1YKWA 2BBEA 3MECB 2MKSA 1Q53A 1LQ9A 2ZUGA 4MYTA 1QUVA 2RDIA 3DLBA 2HIQA 3QRPA 3V6DA 2R7TA 1XEZA 4IR1A 1LNQA 5A2QY 1QAJA 2JFDA 3H4BA 5ETQA 4HTIA 3KOAA 4F7VA 4EEYA 1S59A 2B9XA 3D3CJ 4USTA 1REVB 3EPIA 3PHEA 4DWIA 2VIHA 1J2VA 2KKHA 5C25A 3DRRB 3IG1A 4DQQA 3F73A 2EK1A 1VI7A 1OJ4A 2NUUG 4OJHA 3KK1B 4C0BA 1BQMB 4IRDA 2BJ8A 4DPUA 3HFZB 1O5JA 4DR3F 5DGAA 5K5MA 2PA3A 2HK2A 2UUAJ 2HQ3A 4NCGB 4I6WA 1U1PA 2KB2A 1S6UA 4NMLA 2AYMA 4A8MP 3NKYA 1SH2A 2WSCC 1VQPS 1EB0A 2M4MA 4FYWB 1JKHA 3VGUA 3HF5A 1WEXA 2BABA 3MMAB 2Y8YA 3OLAA 3TJAA 2GAHC 3T5HA 1VHFA 3DKDA 3FCWA 2FQQB 3TO8A 2W8LA 2MB0B 5HO4A 2BOPA 2XBPA 4C9DA 4MH8A 1C0TB 2XS5A 1UA0A 4UQGA 3OSNA 3KK3A 5D3GA 4HH0A 1U48A 1HNXJ 1HNXF 2R7SA 3G8QA 4GVBB 1TZ0A 1TL7A 4PXCA 2DIUA 1HNVB 3VCDA 5FJ4A 3H59A 3K5MA 4WZMA 5KFQA 3ETOA 2VB6A 1FRIA 3W61A 2V4JB 1JXVA 1NAQA 1OPZA 1T05A 4NCBA 4K50A 2ZVIA 1QD1A 3GV8B 3MM5A 4OZ3A 3HZGA 4DFMA 4PG6A 4M5DA 3PW5A 3NWRA 1DBDA 1JMTA 1S57A 4M8LA 3M8QB 1S9FA 4PABA 2F63A 1RAGB 1TTHB 2HWHA 3KLHA 3UE2A 2UUAF 1FHTA 3BV8A 2GMLA 4PG5A 1O51A 1HHSA 4KQZA 5I3QA 3MAAB 2VL1A 4FN5A 4OYMA 3UQSA 4FYDA 5E3QA 1Q86T 4B3OB 2OUGA 3AB4B 2I0XA 4EUVA 3J7YI 3VZIA 3CTRA 5M2PA 2AKWB 2MSTA 2VQFF 2EWHA 3EE3A 1FESA 2CQGA 2CQ4A 4F2RA 2DGSA 4P2SA 4NA2A 4DV4F 2E1MC 2KVQE 1BC6A 3VAIA 2FGOA 1AUDA 4OLPA 4KFBB 4P2MA 2FC8A 1ZAWA 3ICLA 3PJ9A 1GQEA 4K4TA 1YVFA 3PV8A 3DRSA 2YH0A 3KLVA 5HI7A 3GU0A 4F4XA 3D6TB 1J5EF 4P7TA 5ETLA 3OBIA 1DZ5A 5CQGA 2OP5A 2BMBA 3K57A 1REVA 4BWJA 1OPIA 3SV4A 1JJ2R 2CJXB 2GCFA 4H4KA 4I2PB 2HGLA 3R5BA 4USJC 2CJAA 1SUQB 4ED0A 1IBMF 1M5KC 3DHWC 5DDPC 2FZKB 5A0YB 3MAQA 3DXBA 5K8MA 1RTDB 4G3IA 3NNHA 3EGVA 3IRWP 1H38A 2M2BA 4FXDA 3H5SA 1O0PA 3QSYB 2BJEA 2RT3A 3EZUA 1NEEA 2O3DA 5HMWA 2BDPA 3LP1B 4R5PB 2J9EA 2P9EA 4RR5A 2V4RA 4O0NA 2M3DA 5IC4B 2ZC3A 2KXNB 3C6UB 5GMDA 3I6PA 1S1TA 4NI2B 3QT7A 1KWMA 1IKXB 4ZHRA 2W2NP 3C14B 5A76A 4LF9F 3PACA 1FERA 1NBEB 3MM9B 5DETA 2LDIA 3PO5A 3TA0A 4TU9A 4LBHA 1RWKB 2KT2A 1D8ZA 2BV3A 5A8RA 3VVUA 3ZFVA 2FY1A 4PWDB 2JFKA 4A8QA 4K4YA 2IRUA 3Q2SC 3BR9A 2C3PA 2IJFA 4NLSA 4F36A 3GB0A 1CJUB 3D1QA 2YNHB 4NXNJ 2KO1A 1JX4A 4USHA 4B3SF 1SB6A 1JJCB 2IM1A 3FZ2A 2IFXA 3GG1A 3R7SB 3TAMA 4C8NA 1IUJA 1A0OB 1Q79A 2HQDA 2HEKA 4GVLA 4MFBA 2EFGA 3GQCA 1B0VA 3PW7A 3MTJA 4HACA 1K8AT 1MNEA 1PJ5A 1FNXH 2MQQA 4JI1F 5ETTA 1FCAA 2RB7A 5A0YA 3CCQS 3CDEA 3N4WA 4DZ6A 3M6UA 3KG4A 1VQ8S 5J2QA 2IA6A 2CFXA 1IWAA 2YKMB 3KLIA 5CAAA 3VR1A 4J9QA 2OSRA 4JI5J 5HROB 1FKPB 4AQYF 1CJKB 4WBFA 5G0RA 2FTRA 5J1PA 3KUEA 2FHJA 1F2GA 4UOFA 2CPJA 4Y2MA 1QY7A 1APSA 1RU1A 2B9YA 1AT1B 2C22A 3FMWA 1TL5A 4GKKF 1T02A 1T7PA 5CA5A 4J9KA 2OIHA 2H4YB 1NHVA 3FC9A 5L39A 2DB1A 3JQKA 2X1FA 1GH8A 1RT4B 1VBXA 1EQ0A 2RDDA 2QA4G 2C3MA 4IQMA 2UVRA 2JJ4D 1AA1B 2LEPA 2OPQB 1N36J 5D77A 3AODA 1P6TA 1NJIT 3F41A 1H2TZ 1RLDA 1U6ZA 1R0AB 3CCES 4DQSA 3OTCA 5HBMA 3FNNA 3MMCB 2CVEA 5JUMA 3FSXA 5M2RA 3SQGA 3OXFA 1HBUA 1XN9A 3EXCX 4HEA9 4MYUA 3K59A 4AXJA 3P96A 2DK2A 3JAMU 2DXFA 1CQMA 5IV3A 3LO3A 2VOOA 1RK8A 3HT0A 2CDQA 2W2MP 2B4UA 4TNOA 1ZYQA 3QWPA 4CM0A 1DTQA 1G2EA 4ZLPA 4H54A 3S6EA 3RG6A 4DUYF 4NLGA 5BXIA 5EWGA 3MD1A 2NR0A 3PTWA 1JQGA 1RWVB 1SBRA 1U0HA 2NXNA 3NGUA 2Z30B 1M5OC 2E1CA 5HROA 4TXSA 1WWHA 3D4JA 4F0HA 3HHLD 1S4FA 4Q2LA 4B3MJ 3ZZRA 2Z4PA 5EDWA 4X64F 1RDRA 1XJWB 3JQMA 2OPSA 2J6UA 4WXOA 2DHXA 3R6LB 4ZA1A 3TX8A 4DV6F 4H4OB 3Q8YA 4P73A 1R0BG 5GADU 4KV8A 1FRXA 5KG7A 4ECXA 1ZTTA 2LDYA 3CCWA 2C1EB 1RWMB 3M6VA 4DPYA 4Z37A 3JSYA 2W9CB 4JV5F 3TZXA 2F8MA 3SCIE 4CIOA 1KVJA 5HL7Q 2YNGB 4RW8B 3M6XA 3QBCA 4W98A 2WB1D 4X4TA 1ZTWA 2AZ1A 3MR7A 3DU5A 3SQOP 2WONA 4WFXA 1AW0A 1QVFR 2G4BA 4OI1A 2JHEA 2BJ1A 4BWMA 3PX6A 4I6AA 1YZ7A 2ZITA 2GVDA 2KH9A 1OY6A 5KFIA 5KFJA 1NUEA 2XYPB 4MT1A 2HWIA 1N0VC 1UJ6A 3IRXA 3N9UC 1FDDA 4V1Ak 4TKTA 1C0TA 3MPWA 1YJTA 2HVZA 3FSYA 3LPEA 4YQWA 3OJUA 4RBTA 2MLYA 5G4DA 3Q8RB 2COLA 2VBYA 4RW4A 2YKOA 1T11A 1Y5NB 2MDAA 3WHIA 3EZOA 3DOMB 1SL0A 4I7FB 4DR4F 1N33J 3Q8SB 5D0GA 3CVKA 3BM7A 4Y2AA 3MMBB 2R9LA 1F60B 1QSYA 1YBAA 1T05B 3R2DJ 1SVDA 1NPPA 1NPRA 1IKYB 3VVTA 3CIMA 3ISNC 4KBIA 3BZQA 1RBAA 1XR6A 3MM5B 2KJWA 2VFSA 3W8GA 2XB2D 1IN0A 2FZGB 1KLNA 5KFRA 1MN9A 2WBRA 3FCHA 1S99A 4FXWA 4OYOA 3UO0A 5J2MB 3MOJB 1IR1A 2XZDB 3BPSP 3BGRA 3UN5A 1UAWA 1RI7A 4F26A 3KLEA 4EYHB 4ER8A 3KNAA 2LQ9A 3I0RB 4PCQA 3VZHA 4WFAQ 4XAKA 4ED5A 4LMZA 1TUGB 5JVGQ 2WW8A 3M05A 4BLGA 2G13A 4WP8A 5KG4A 4YR0A 1L5UA 2PIIA 4N8OA 2CUYA 3RB3A 4DV1J 1XMOJ 4DL4A 4PQUA 1YJVA 1EKRA 1HBUB 4NLUA 2MZRA 4U7CA 4USWA 5GAEU 1UVLA 2RUSA 1OY9A 3LTOA 4QIGA 3FK4A 3T1AA 2CDRB 3JS9A 1JXEA 1TUWA 2NCKL 2Z8QA 3ZTSA 1M5SA 3GYXB 1HL6A 3JSMA 2JEJA 3LW5C 4KB7A 4DI6A 2ZNZA 1C1CB 1WDDA 3R2CJ 4KFBA 2DNGA 4NEZA 2KG1A 1CG2A 1KEKA 2QT7A 3TZWA 1VQSA 2ZH7A 3HSDA 1RHUB 1UA1A 5DLGA 3PKYA 2ZM6J 3MUVP 4M63A 1H3DA 1FRMA 2YWEA 2RDJA 1NKEA 4EZ9A 1PILA 4ZJQA 2XGPA 1FF2A 1AYEA 1GXUA 5ETKA 5HMYA 3J81j 3CCVS 4DV7F 3C46A 4URQU 3T19A 1FX4A 3LWLA 2OD4A 2DY1A 2XSJB 1E6VB 1PCAA 1RT2B 1X5SA 3DU6A 3IS9A 4OYPA 1TAQA 1FNOA 3GYNA 1WHXA 2L48A 3SMZA 1WTBA 4BC9A 2AGPA 1SL1A 3B4MA 1WKLA 2P9CA 2BE9B 4L74A 2MGZB 1FWPA 4RW7A 5ITHA 2HK3A 1BGXT 2N7YA 4MKVA 3PNIA 5KAKA 4YB1P 3OHBA 3UD4P 3DDNA 3QIPB 4J37A 4JI1J 3KFWX 2E66A 1YITS 2WONB 8AT1B 1Q8KA 4ES3A 2V2ZA 1FKOB 1T9UA 3TEGA 2AJ2A 2CNKB 3TARA 3CWJA 2O67A 3TR5A 2HZAA 2K06A 1SJRA 3H90A 3RBDA 4HKQA 4PG8A 1FRKA 1NNDA 1IKXA 1N88A 1SKUB 1FWKA 2QJ3A 3MGJA 4LSLB 4JI8F 5DDQC 5IM0B 2IVMA 3IRXB 4ILRA 1HWUA 4P71A 4QIFA 1QJHA 2QA2A 3QYYA 3TZYA 1Y7PA 4ECQA 2FLLA 4URGA 2R7XA 1S1XB 5IC6B 2D74B 1HI1A 1UJ5A 2W8KA 3J7ZT 5CCMA 3MCNA 4ILMA 3MZIA 2HBZB 2N4DA 1U1RA 2IVYA 2FUG9 4WTYA 4EBDA 1X4AA 5T41A 1WC1A 4EI2A 2RS2A 4HT5A 3W9JA 3ELHA 2ZE2B 1RT2A 3CPWR 3AOBA 2FHJD 4ZVPB 3UNGC 4DSFA 2GJ2A 2G0IA 3CEDA 4U7UK 3HDSA 5J2MA 4U6PA 3JAMY 5CZXA 1UZHA 4GO5X 2RQKA 2BYCA 3HZEA 4OYWA 3IWNC 5CXTA 4DEZA 1O6XA 4DR4J 5KFYA 4RW7B 5KFSA 1RAEB 2QIFA 1IQZA 3BREA 2XI2A 3JTPA 5H1SV 3BQ1A 3BQ0A 3KHHA 2JH3A 3RRHA 1CJKA 2CPIA 2V9KA 4NZ6A 4C97A 5F8LA 3K58A 3R5AA 4ZCIA 1N54B 1FKOA 3GFXA 4X62F 3JQJA 3PW0A 1NK9A 2DGXA 3ILJA 2VZ9A 3G6VA 4E2FB 5KT6A 3FEXB 1O8BA 1Y9OA 3DN9A 5I3PA 1BWVA 1Q8BA 1S1WA 5HAOA 4CZCA 3T5KA 1W2BR 5K9FA 2CQCA 2E5IA 1BHNA 3BSOA 3EJMA 1C1CA 3KK2B 3IGNA 3BN4A 1R89A 2HFNA 1IKWA 2OPQA 4RWWA 4Q5VA 3IBFB 5KFMA 3OJSA 1ZPVA 2RKIB 2IM2A 4NRUA 5B0CA 1S4EA 3VTIA 4DOZA 3KG1A 1LOUA 4NLYA 3UVJA 4DX8H 2KXHA 1LV5A 2UXDJ 5EN1A 1F2HA 2RRBA 1WDTA 3R5CA 3OTOJ 2ZOGA 2XLKA 3AQPA 5KFPA 4KGVB 3PXGa 4UOGA 3FGVA 4OX7A 3EVWA 3PIOQ 1VISA 1BXNA 5IT9Y 2HIYA 1GX6A 1NH7A 3GFZA 2YQ3A 3KKFA 2ZFHA 1VQ7S 3D6FB 1W7WA 5LSOA 3BEGB 5GVQA 1M5VC 1VQNS 4RUAA 2V8GA 1N33F 3O6QA 4K7QA 3I56S 1FJEB 1HBNA 2QYCA 3LQVA 4WJBA 1X4EA 1GX5A 3K5OA 1FWLA 1U09A 1S9GB 3QIDA 5KT4A 1XC9A 3NNAA 2WCXA 4HH1A 6AT1B 3RAXA 1IJEB 1BY9A 3CD0A 1LKZA 1SC6A 2Y1IA 1LWEA 1PJ7A 4DR1F 3KLGA 4OMFG 1JLEA 1L3KA 4S0MA 2DPIA 1ZM4A 2KFNA 3NS5A 4LRAA 3G4SS 1VQ5S 2DCLA 2DXDA 2PD1A 1BQMA 1YWXA 4Q45A 1N34J 4CLUA 1AZSA 1MROA 2GQQA 2LXFA 2V4QA 3OW2R 4P75A 3EDRB 4NCGA 3OR1A 5CABA 2C28A 4OZ1A 2XNRA 2IY5B 1X4FA 2CQ1A 3HKZD 1EETA 2HRUA 3KDOA 4RX6A 4EMDA 4X4RA 4J9SA 1SQEA 2HZVA 4NWBA 4JI4J 2HHTA 4F3OA 1PAEX 3E8OA 2M0GB 2DT9A 3Q8UA 2R2TA 4OHZA 3CCUS 1VQ6S 1B0TA 3J81Y 2VG6B 1OQ3A 2UV8A 2JZ5A 2CQIA 3AD9C 5F9LA 3KUGA 2J6SA 4GKKJ 1YQHA 1KLMA 1FK9B 5AJ3J 3OFEA 2KDOA 2PA8D 1ELOA 3I0SA 4UUWA 1P27B 5D15A 1I3OB 4ED6A 4F2SA 4FDFA 4DV5J 4YMEA 3M8PA 4R0EA 2Z58B 4CH1A 1QSLA 4GVBA 1QTNB 1HBNB 4PEOA 2BJ9A 2EXUA 2GHWA 2Z2ZA 4I7FA 2KZMA 1S9GA 5LM7E 1SH0A 1NRKA 4NMXA 3CJ2A 3QT5A 5E3RA 1UL3A 4RW9A 1XMQJ 2CWXA 2OH2A 3K5NA 4OI4A 4AQYJ 1UVJA 2BKNA 1SKRA 1JLQB 2R7QA 2QE5A 3ULHA 3AD7C 3MFHA 4CDIA 1OYEA 1KFSA 2NSCA 2HQFA 2KYXA 1KS2A 1YRUA 3N6NA 1KD1T 3HXMA 3I87A 2AJ4A 3Q8QB 1VC0A 3PJXA 1RWUA 1UCNA 4I6YA 4JUZA 4ZPAA 2XMTA 3OLBA 1CJVB 2XHWA 2HBQB 2H1YA 4B9VA 2OEMA 4LF5F 2P5VA 3B78A 2YWGA 4KHRA 2PMHA 1ULRA 4PQUB 2DISA 1U6BA 4LRFA 2WTFA 3PCOB 4WYLA 4DF4A 3OL7A 4HHHA 5IT4A 2XYHB 2Z2MA 3C15B 5F9NA 1FFWB 2ROGA 3DYAB 3P45B 1FT8A 5KOXA 3M1VB 2E1RA 5D6GA 2G9OA 1VQMS 1RWWB 5KG2A 2UXBF 2FVSA 2ATLA 4I64A 2CYYA 1JLBA 1XQIA 4K4ZA 3E01B 4ED2A 1HNIB 1NK6A 1SKWA 1UWBB 2H65B 4MKYA 3EZ5A 4E0DA 2YX7A 4V19J 1K0VA 3IWXA 3T9ZA 1NB7A 3P3DA 4G1QB 2QGFB 2V8HA 3KHGA 5KFCA 4I68A 4ICLB 1RP5A 2IBKA 1IVZA 5E5NA 1VHIA 3DLLQ 4O3NA 2BKPA 2EKNA 2QG9B 1R8CA 3B8HA 2RS8A 4FZVA 4Q2MA 4RO0A 5AXMA 2UVUA 3BB5A 4ZP9A 2R4FA 4J91A 1NJWA 4WYWA 1FDNA 1J5EJ 1TK8A 3RBZA 3BR8A 4B9SA 2FIUA 1WSRA 5HANA 1KDNA 1P9YA 2JVRA 3L09A 3LP1A 3TVZA 4R5PA 4ECYA 3HP6A 1RT6A 4M5HA 2IM0A 3J80U 3AXKA 3DOLB 4UY85 2G0JA 4WU2A 1A6LA 3V81A 2E7XA 4LF9J 1S76D 1UEVA 3IR5B 4OYAA 2DIVA 4DV2F 5KT7A 1WC5A 3A8JA 2E5JA 2H5EA 3CC2S 3PEJA 2LA6A 4NYPA 3J7A1 1K44A 3PX0A 4FKXA 5LT5A 3CO9A 2V67A 3TVKA 2JLGA 4WIIA 2B5JB 1VRTB 2XYGB 2XI3A 3D0GE 3WC0A 2E5HA 4QIWD 5A2QU 4Q44A 3SFUA 1LW0A 5KFDA 1KKHA 1S12A 5B0AA 1YJNS 3CW2C 3MCOA 2BKOA 3W2VB 1F3VA 5L9NA 5LMUF 4CTAB 1RT3B 2H5IB 4CH0S 3D6MB 8RUCA 1ZA1B 3UD3P 2EVZA 2L9NA 4X4SA 2UUBF 1VK3A 3J7YU 1E6YB 1UJ4A 2KFYA 2Z2YB 5B09A 5DM7Q 2WAQD 4LFCF 3OVAA 3M30A 3TZZA 3ET6A 3WQPA 2GVZB 1VYAA 3DLJA 4JV2A 2Y0BB 2UU9F 1BD6A 3F44A 5D0RA 4LRDA 5J2QB 2GX8A 2K1RB 2VQEF 2VPYB 1CULA 2DXEA 4MK9A 1FKPA 5MAOA 1F5CA 3GR0A 3GMGA 2YNFB 1XMQF 1WC0A 2OTJS 4WCEQ 2C3YA 4L76A 2CRLA 2BJ7A 2UXCJ 2YNIB 1QDUB 2MEWA 3BO3A 4TN2A 2ACMA 5B0FA 1LW2A 4J9RA 4DV4J 3NGTA 1TMMA 4UUXA 2OI2A 2VF3A 4UW2A 3BBBA 3DM2A 4WXWA 3BS9A 3LALA 4ZS6A 3FSIA 4B9TA 1MG7A 4I2QB 2B4PA 4LFBF 2HURA 4WPAA 3PYDA 2J76E 4O4GA 3G96A 1HNVA 5FLXY 1T9VA 1VK8A 2WW4A 2B5JA 1VQLS 2M9KA 4CO2A 5AE2A 3U1MA 3EWGA 1CPZA 3UVJB 3MM7B 1OYDA 3AH6A 3V6HA 3UWTA 2F8EX 2YKPA 2K3IA 3NOCA 3QGGA 4JI0F 1RT3A 2MHEA 2RIJA 2W7AA 4AT1B 1LK7A 5ADZA 2BA9A 1DHMA 1V3ZA 3PFOA 3KYLA 4DCOB 4M5DB 4OZ5A 4A8YA 3SSRA 2DNZA 3M30B 4M5IA 3KJVA 3HVTA 2ZJRQ 3A1YG 2OFGX 1DLOB 2FHOB 2VFVA 3R3TA 3THTA 2EC2A 2V8PA 3HO1A 2MJNA 1N48A 2YPZA 2QEXS 1HYSA 2W4PA 2EFQA 4CLWA 4DR1J 3D6HB 3IBWA 4PPZA 3OD2A 3ZTRA 4DQIA 5L8RC 1YDLA 5DQIA 2YNIA 3CJRA 4ZPBA 4RUBA 2OPSB 1N36F 4FNIA 1RKIA 2C2OB 2NXCA 2DY9A 4Z7CA 1SKSA 2B6AA 3U1LA 3ZNUA 2Z2LA 1KSPA 1T03A 3TEHB 1KQKA 3ISND 3ZZZA 2N4CA 2W9CA 4X4NA 5KFOA 5D4NA 4C3LA 1F6TA 4KGZB 1KP6A 2XSFA 4DFKA 2OJ3A 4PXDA 2RNEA 3A3OB 4DDFA 1FE4A 3RU0A 1PSDA 3CC7S 4OZNA 3MM7A 4DR3J 2VA2A 2LU2A 4C98A 1NMEB 1TL1B 1N5YB 4YN3B 3BPDA 4GMKA 3QLHB 2AMCB 2CNOB 2JC1A 4ELTA 1VRUA 2LMIA 1KLMB 1R43A 1FK9A 1BE4A 1HMVA 1RTHB 5KG3A 1LK5A 2J0WA 5C2GA 2I6WA 1WF1A 2C2KB 1UW9A 4IH6A 1EX8A 1KVKA 4DLGA 4LF5J 4NZ0A 2QA4S 1RT1A 3TAQA 4NXMJ 3V6KA 4NX9A 1HYSB 4IH7A 2MLZA 3CB4A 4B17A 4JBCA 3CC4S 1V6HA 4MIBA 3MMBA 1I51B 2J9CA 1Q81T 4FF2A 1IJFB 2GQ2A 1CVJA 2OMLA 4C48A 2JVOA 5HQLA 2OEKA 4KO0A 3QO9B 4DX7A 2R2UA 2FVCA 1D1UA 1FJGF 5EWEA 1KC8T 5KT5A 5DJBA 3CCZA 3I5CA 2DYAA 1QSSA 2RF2A 1IBLJ 2IC3B 4F4ZA 3MM9A 3BQ2A 4DUTA 1KRPA 2FJDB 4AE5A 3AAWB 1FD2A 1U7LA 4X66F 2UXBJ 1KVIA 5F0WA 5KFHA 1DJ0A 4Y34A 2F65A 2HHUA 3DC2A 1JKHB 5CZVA 4GC6A 4MAKA 1C0UA 1R8PA 3H25A 2ZBRA 2DNRA 4DS4A 4MFBB 3R1LA 1OMSA 7AT1B 2YQ1A 4HACB 4PG7A 4OX8A 1S0MA 1RWOB 4OHWA 2G2YA 2ZH5A 1P1TA 2CNLB 2VPZB 4KC5A 1S77D 3DYAA 2ZH2A 5DG9A 3GG0A 4MK7A 2DNPA 1JLGB 4IG3A 4ZKAA 1Y00A 3LP0B 2LA4A 4OI6A 4P7VA 4TY8B 4USIA 2DRBA 2VDIA 1NDCA 2WVFA 2MZSA 2LQ8A 2JWNA 4NA1A 4DV2J 4N41A 2HFOA 3Q8PB 4AL5A 4DR7J 5G0RB 4UZCA 3BGUA 3Q89A 2MQOA 1UWBA 1Y0HA 4RPFA 2B0GA 1DQ9A 3NBPA 5LSRA 4DL2A 4QR2A 2FVPA 1EKSA 2AX0A 4G1QA 1ZBTA 1D9AA 4X62J 2R8KA 4PZVA 1TKTB 1RHJB 4DPTA 3PKMA 2CVIA 2GC8A 2ZDOA 5AXKA 2D9PA 4EFAC 5GAEI 4AL7A 2WK4A 3IFEA 1KOOA 3TVYA 4GRSA 2C2MB 2QLBB 1RADB 2XMKA 1T95A 4DV1F 1NM2A 3HCXA 2ASJA 1XMOF 2XTJP 4DV3F 1KFDA 2LCWA 4JOUA 2ZZNA 1L3VA 4RLEA 4NLQA 1TK5A 3EM1A 2LKZA 3MAAA 1UZDA 1SJQA 1U0SA 2RQCA 1TMJA 4B3OA 3M2VA 3MDFA 1ITPA 2XG8A 1Y3KA 5KFXA 1NDPA 5GMEA 2CPXA 1FTCA 1EARA 1V5IB 3D3BJ 3G87A 5F8MA 2ZM6F 2WVDA 1RISA 2FJAB 2FPHX 3TQEA 1M90T 2GIFA 3ZNJ1 4F8RA 2HSEB 2CQBA 3TOQA 5AJ3F 3OL6A 2OELA 2KM8C 4CLTA 2JNJA 1KNZA 3VHQA 4Y28C 2EFVA 1XWLA 1S1XA 4UF4A 5JVHQ 2GZOA 3NAHA 3HHKA 1GXTA 4K8RA 3OQ2A 4NYZA 3CCRS 3RRGA 1UWAA 4J9PA 2I1RA 2HBYB 3GSDA 1U1NA 3GILA 1CJTB 5HVHA 5M2UA 1U1LA 1F5AA 5FLXU 4DV0J 3K5PA 5IWAF 1UMJA 2AU0A 3EVOA 1FRJA 2BQRA 3TUZC 1HWJA 5F0UA 2YKNB 4LUBA 5IT9U 3CUNA 1RT7A 2DCUB 5ETRA 2MTLA 2RUGA 2BX6A 3HLUA 3SEOA 1H6KX 4Y00A 1LWFB 1WF2A 4EO6A 2BR0A 3QRQA 2R42A 2F4FA 3H0PA 3N28A 4P9SA 2AHOB 1RUSA 1TKDA 2A0FB 3DDKA 2HNDA 1CULB 5LJ5Y 2YNGA 4RW8A 4I67A 1R6YA 2B8QA 3ZO7A 3Q24A 1UETA 4ZVSB 2HZCA 4FF1A 4Z7YA 4TYBA 5I3UA 4WZQA 4N76A 3FBEA 4ZIWA 4JI3J 4NI2A 4TY9A 2ALYB 4ID5B 3R9LA 4H4MB 1ZS6A 2HFUA 3IGVA 4CO0A 4XTTA 2MYFA 2X3GA 2AF6A 2DKOB 1AROP 1YZ6A 3L7UA 3QWUA 4M5MA 4NLOA 2CG8A 2KI2A 4ZVOB 4ETXA 3L7OA 5JMNA 2D3OR 1MSWD 1JB0C 4IOAQ 4IYQA 1DARA 2EPIA 2Q3PA 2X3DA 1I94F 3RYLA 2APOA 3CDWA 2IYIA 2AQ4A 4UT4A 2VBWA 1ZETA 2ROEA 5B0GA 4O3RA 2MKHA 5I42B 2FLOA 1AFJA 1C2PA 2B9EA 9ATCB 4NXMF 1LFPA 4NE9C 5EX3A 2LQ5A 3US5A 2M5YA 5GADI 3RBEA 2OLWA 5HVFA 4C7QA 1DAXA 4RKUC 2XLIA 1PGZA 4OX6A 4KPCA 1KTVA 2MQMA 3TA1A 1FRHA 1RAHB 1VBYA 5KOWA 5I4MA 1HQUA 2Z56B 1JLFB 1MMNA 4KTQA 1GMVA 1DLOA 1X4DA 4RWXA 4FBUA 2HNDB 5ETMA 4PKDB 3HHLC 4F3MA 4JP8A 3GLJA 3W2WA 2VFTA 4A8OA 2RQ4A 1GMWA 4ZCLA 3M2VB 2XMAA 2DPJA 1ZOTA 5KFLA 4ZVTB 2NPFA 1JLAB 1S72S 4NLWA 3C6UA 2ZH6A 2BJ3A 2QN6B 4ZHRB 2MKIA 2B6AB 5KFZA 1UVNA 2JEIA 2MMYA 3VGVA 4QYRA 4CLPA 2E9TA 4QWDA 3IR7B 4LREA 1S0NA 4RW6B 1NSPA 1CQNA 1JLCA 4KSEB 4QWAA 2BE2B 3TW0A 5KG5A 4A8FA 2ZZTA 1BUXA 1GTHA 4A47A 2R7UA 2QLFB 4WWSA 4ZITA 4YY3F 1F9HA 1SJ1A 5E0OA 4QPTA 2IVFB 4DG1A 5KFEA 2UXDF 4ANEA 2LVWA 4WIQA 5CH7B 1M1KT 2E5LJ 2RRAA 3I9ZA 1FI4A 1ZM2A 1NXIA 2F3JA 4BDPA 2QRRA 1F1BB 3DLEA 3MM8B 1HMVB 2CQHA 4JV1A 1M0SA 4DR2F 3N79A 3OUYB 1YK9A 1S48A 2MGZA 6FDRA 1CEZA 4LRCA 1S49A 1VQ9S 4C4WA 2A6OA 2G0CA 4K5SA 3CF5Q 2OO4A 4E8UA 2QLJB 2C2DA 4JI7F 4U8VA 1FRLA 1FD8A 4DCPB 4E98A 2WZ1A 4RW9B 1KTQA 1F5BA 5BR8F 2VG5A 4LF8F 4QIEA 3D5MA 4KH1B 5IS2A 3QATA 1VMBA 4DSEA 1TK0A 4OYXA 4H4MA 2MLXA 5DG8A 2ZH1A 1SQFA 3PRVA 2RF2B 4ED3A 1QAYA 5I42A 4KE5A 2DR9A 3HHNB 3OXLA 3GCWP 4K4SA 2XC9A 1JLCB 3RR8A 3NGKA 4G1PA 1NU4A 2DH9A 2QMXA 2VD3A 5KFVA 4F4AA 4P2FA 1CJVA 3RB0A 5LXRA 1RACB 1YJ7A 2DNMA 3NLCA 1TQLA 2VKRA 1FA0A 1ZM9A 4XK8C 4ZCKA 5HBMB 4X4QA 3CD6S 2R7RA 4C8YA 3V6JA 1SV5A 4A4JA 4NASA 1KQSR 1LEOA 5F8GA 1Y3JA 2UVVA 4C3MA 3CJ5A 1YJUA 3SIPB 2BRLA 4HDGA
chains in the Genus database with same CATH topology
2UZAA 4IOBA 2E9ZA 2HHWA 3LGMA 1JLGA 4IG3B 4O3PA 2CQPA 2IM3A 2ZJPQ 1Q82T 2MKKA 1DQAA 1WHVA 4K4VA 3KHRA 1HNIA 3LGNA 3ONQA 4WFZA 2FVQA 5JJBA 2GMHA 3MD3A 2XMWA 3CMAS 1WEZA 2NQPA 3PM9A 1TKTA 5J1NA 1N32F 4OQJA 2XWYA 2N7CA 1XTZA 3K8VA 1MW7A 1OQ6A 3POTB 3I0RA 3QGHA 4DL0C 4QR1A 2KVIA 2ABYA 1I1GA 2FJBB 3W7BA 3THPA 4K4XA 1DFDA 1X4GA 2CQDA 2F1FA 4CO1A 3DCAA 3ZZ0A 3SCKE 2V8VA 3EX7B 3VAJA 4OI0A 3H5UA 5DG7A 1YJ9S 3NGDA 2ZZMA 2BACA 3PY8A 3OFGA 1H7XA 1H2VZ 2LEAA 5A8WB 3DLEB 2IA0A 3MM8A 2Y0SD 4Q8FA 2QSWA 1UP1A 4IR9A 3CCSS 4O3SA 1RTDA 1K0TA 3JTNA 4HYKA 4QYZJ 2ALZA 2HFZA 4PRFA 1I6JA 2VODA 1GNKA 2HHQA 2NREA 4PXBA 4BS2A 1X9MA 2EBGA 1LW0B 2HWTA 4QOTA 2ZBIA 3CD7A 3ZZPA 3FQKA 3E51A 3TI0A 1TKZA 2NS1B 1N8RT 4OX9F 3CULA 1IKYA 3NAIA 2PSZA 2HS3A 1S6PB 3MI7X 3P5TL 2PDAA 1U45A 4B9UA 1RT7B 3D1OA 2O5DA 5E41A 4CCHA 5D78A 4G6VB 1Q1KA 5KFNA 1U26A 2KN4A 4ZOSA 1W2IA 3D0IE 2P6TA 3OR1B 3SV3A 2GMJA 1N5SA 4ZPWR 5AE3A 1EETB 3QGPA 1R8AA 4RNNA 2E44A 4MJKA 3TNVA 1SJ3P 5BYQA 1N5VA 3O5TB 2NYIA 2VG6A 1N6QA 5KG0A 1MWYA 2U1AA 1LW2B 2BXJA 5HLFB 2YKQA 1R8HA 2YWHA 3IR6B 4CO5A 4WFNQ 1VQKS 4LF6F 2EG2A 4ETZA 1U49A 2DHGA 5DQGA 2CQ2A 4F50A 1P1LA 2VOPA 2AW0A 5LL6d 3K5LA 2ZKUA 1ZAVA 2KYZA 1FXRA 2UUWA 4ES1A 4J9MA 2ZE2A 4O3QA 4DR6F 4F02A 3HVRA 1E6VA 3IS9B 5D3GB 1Z2ZA 3TRGA 1IXKA 4O4RA 3CDUA 1OIAA 2RU9A 3G86A 2EFPA 1U2RA 1UVMA 4PXEA 5F8IA 4KJIA 1AXQA 2JSXA 2C2RA 4RBVA 5AXLA 2HW3A 2W9BB 2ZDPA 1TVRB 5CYQB 5K8OA 4IRCA 3JTOA 3K8WA 1L3TA 2L08A 2DGVA 2OPRA 1JLAA 3HKWA 2MY8A 4MIAA 5B0DA 2CPFA 2CJKA 2FC9A 1S79A 4Q7AA 1S9EB 2J0XA 4JI4F 3I4PA 3K7RA 4FPRA 1N52B 5A8WA 4ZVFA 1DURA 2B3TB 4AYBD 5CYMB 3GR1A 1WEYA 2L3MA 3TANA 4EU0A 2DR8A 1X5OA 2AJ0A 2R8JA 3UPFA 3M32B 4IFVB 3SFGA 4DG1B 2R7OA 1TL1A 2F9DA 5F3ZA 3MCSA 1N5YA 2B9WA 4DV0F 4ICLA 3M9NB 4PWUA 4FS2A 1HPZA 1SIZA 4OHVA 4BC7A 3OTDA 4KHMA 4U9RA 4H4OA 5HQ8A 2IAJA 1R3NA 2XCAA 4UQTA 4NA3A 1RT1B 3M8RA 2EW9A 5KFGA 2J9DA 4F4KA 3CCMS 3ITHA 3V4IB 2O66A 2ZKTA 4QBUA 4KHPF 3AA8A 3GFHA 4NLDA 2W9BA 2HHVA 1IQTA 2XO7A 3HT3A 1ZAXA 1X9SA 1N6QB 4KO0B 5EX0A 4DL3A 2I5JA 3TQ1A 4RNMA 1RJJA 2X1GA 3F56A 4OJGA 4DMZA 4BHQA 2PI4A 4N5SA 2CPHA 2Q6BA 5CYMA 1IKWB 2ERRA 4F3QA 4RW4B 4LSNA 3AJ1A 4K0KF 2L41A 5T14A 2CJ9A 1YTYA 2IYGA 3HI9A 2XS7A 3M32A 4IFVA 4FF3A 4KR0B 3P49B 1S1UB 1MWZA 2LLZA 1P8GA 1QAIA 2OD6A 2V0NA 5DM6Q 4YP3A 1VS3A 1J5OA 1YJRA 2ADBA 3B4DA 2DNLA 1FDAA 3LPYA 2X51A 2OFHX 1WTFA 2BW2A 1WHWA 4B3TF 2NPIA 1ZM3A 3H2LA 1U1QA 4C8ZA 1RT5B 4LQ3A 2V2KA 5FDLB 3VQTA 2EK6A 5C42A 3LH2S 3T6BA 3MR3A 2JOQA 3JSRA 1TVRA 5CYQA 4ZPTR 3TUJC 2XZWA 3C8YA 2J7KA 4NRTA 5DLFA 2LXIA 3DMJA 3RB4A 4V19X 3Q22A 2XCPA 3S1TA 3JSMB 3E3XA 1NK0A 2DO0A 5A8KA 3ENVA 2ZHOA 2ZBCA 4N77A 3IXQA 1VIOA 4OI2A 2PGCA 3A8EA 2OKQA 3U27A 3ZZOA 2A10A 3LP2B 3HHDA 2CIMA 2HVHA 2DNYA 2J0QD 2ZD1A 3C6TB 5L38A 3RAQA 2DGWA 3BJYA 2XEXA 1RTJA 2DTJA 2B4VA 2B51A 4LVOP 3Q0AA 2AJFE 2YWFA 3MECA 5EHHA 4Y0FA 2E5LF 3OPKA 5K8NA 2VG7B 4WU3A 1V3RA 2KT5A 1RT5A 1OWXA 3MHYA 3NRBA 3VWSA 3QZ8A 2J0SD 1X5TA 1IBKF 3DHXA 2Y1JA 1OO0B 1Z1ZA 2B7CB 2YH1A 1CC8A 3MR6A 3DRRA 3FVYA 2AX1A 4IO9Q 3OVSA 2YKNA 4K5RA 1JLQA 2MQLA 3KK1A 1IBLF 1VBZA 2UXCF 4WKYA 1LWFA 3D2WA 3I5AA 1Q4RA 2FLPA 3VF0B 2CZVC 2GO9A 1XBWA 4HHJA 1C1BB 2MKJA 3MUTP 4QZVB 2PO4A 1YRTA 4P6QA 3GV7B 2AWZA 1SJ4P 1CSJA 2MKCA 1DTTA 2AGQA 4C8LA 3MEEA 1HW8A 2DR7A 2ZD1B 4UY8T 4NLPA 3MF5A 5T7LB 4XIUA 1YHQS 6FD1A 3FRZA 1RTJB 5KT2A 1VC6A 1S7HA 3SI8A 3UFCX 5HLFA 1RTHA 4EBEA 4DS5A 2J8AA 4LF7F 2GIRA 5GAHI 3HFKA 4C11A 1M5PC 1JLBB 1VRTA 2WHOA 4WK1A 5MLCV 1RAJA 3MUMP 2JL9A 2B56A 2C3OA 3RZAA 5GAGU 4HT7A 3PDNA 2EI5A 3W2VA 2XLJA 1QAXA 5LJ3Y 4YEAA 3PRDA 2QFJA 2V5HG 1MU2A 2MQPA 4OIXA 3CJ3A 1E6YA 1IKVB 4NL5A 2IC3A 4WF9Q 1WF0A 2DRAA 4RNHA 4ZPCA 1N34F 3KLHB 3IA0A 1C1BA 4OI3A 4IG0A 2FLNA 2VFRA 2YX4A 2AJQA 3LF0A 4ECZA 4DF8A 1VGYA 1UKUA 3FDSA 4R8UA 4GKJF 2DNQA 3DRYA 1HFEL 2J5AA 4DSLA 2A18A 4YHHF 1JNRB 3GIJA 1VLYA 2FVRA 4PUOB 2XMVA 2CG4A 4FP9A 1TR0A 1G1XA 4DQPA 2M70A 4AL6A 2N82B 1HBOB 5KFAA 2HGMA 4WE1B 2VG7A 4KIAA 3VAKA 2J6TA 1PC5A 3QJPA 4A8KA 2D9OA 4EWTA 3OV7A 2DGOA 1VQYA 2D7SA 1KHWA 1MU2B 4IQXA 4W90B 3EGWB 1JLEB 1X5PA 2C42A 1HPZB 4NLTA 4I56A 4C8MA 1WHYA 3HVTB 3RW6A 2IAJB 2VKZG 3SSQA 4IG0B 1G3OA 1NK7A 3AHPA 2GGPB 2K1RA 5KG6A 3NMRA 1B64A 1WG4A 4MKAA 5L1JA 3ITHB 3V4IA 3G6YA 3AB2B 4PQAA 5FIIA 3TA2A 4DLEA 3N5BA 2WSEC 3ZZUA 3KTQA 1YSJA 2QV6A 5CD4H 1DQ8A 2DVIA 3FEZA 4ATNA 4C8OA 2HMIA 5T7LA 1TL3A 5J2NA 2GJIA 2I5JB 3BF4A 1K73T 1MMLA 2VASA 3LWMA 3FRYA 2UVWA 3DM2B 3PW4A 1LXJA 1HBOA 1NJYA 4JI2F 2GO8A 4UOCA 5A8RB 4LFAF 2Q43A 3WDOA 1V9OA 4NPOA 2BQUA 2FJEB 2R2RA 2GFFA 3UCUP 4ZVHA 1WACA 1HI0P 3LAKA 5K14A 1UFWA 3SYZA 2P6SA 4IUFA 5BYRA 1QTMA 2H9ZA 1UW4A 1NK5A 1YG0A 4Y65A 3G9CA 2XS2A 3HHEA 3KJVB 2UP1A 5A6WA 3MM6A 1BWEA 2HPUA 3PZPA 2B4OA 4X65F 3M2RA 2F9JA 3RB6A 2GIQA 2YKMA 1SXLA 3KLIB 2XMMA 4B02A 5IQ6A 2XY7A 5H9EJ 1NJXA 1RKJA 2C2EA 3CCLS 2CPYA 3BDPA 2F40A 5E3CA 3U1NA 3MMAA 2O1PA 2N3LA 4DR5F 1NZAA 2JDJA 2MY7A 4PUOA 1UEUA 2ZNYA 1U6FA 5D8HB 3HJFA 4YR3A 1T03B 4RUCA 3KLFA 5LMNF 4OL8A 1RYSA 2K7KA 1A7GE 4FXVA 1TUVA 3U7JA 3MMCA 3LP2A 5A6PA 2YVSA 3GWCA 3SQGB 1XMBA 5L1LA 4CI0B 4TQRA 3NMAA 3W3SA 4TLRA 3C6TA 2PI5A 2FDNA 2F4VF 4F4WA 1OS5A 2DGQA 4MTPA 3IG1B 1U1KA 4M95A 4AXIA 1A9NB 1S6QB 4ZP8A 5DO2A 3WX4A 4NLVA 1NK4A 3PVXA 4DUZF 3PJWA 1U2FA 1U24A 4DSJA 4Y2CA 5EGYA 1KR4A 3EYZA 3SDEA 1Q7LB 1LFWA 1TKZB 4LJMA 2ZHAA 4CT8A 2F8HA 3UW1A 4J9OA 1NK8A 3MEDA 2QZ8A 4M1KA 2RQMA 1U1OA 4QIVA 3V81B 1FKAF 2UV8G 3MTKA 2JLFA 3PFEA 3H40A 3TUIC 5SZTA 1S6OA 3CD5A 2WSFC 4RU2A 4DR7F 1Q78A 1IR0A 2EFNA 2KJVA 1UFLA 1TP7A 1EP4A 3T1HF 3S01A 2IRYA 2BM0A 2KXFA 3D28A 4JV0A 4NOHA 1HWIA 2E29A 2HQIA 3H2VE 4KPYA 1JXLA 1UVIA 1YIJS 1HWKA 3MEKA 1VFJA 3K2YA 4O3OA 2KRBA 2LEBA 2XWXA 1HQEB 1GAOA 5C24B 4OZ0A 3T9NA 3MPYA 4HI1A 3OR2A 1S0VA 1HA1A 3MEGB 3MM6B 4X4VA 5E33A 2HYIB 4ZCMA 3M2RB 4OHXA 4EBCA 1NKCA 3AA9A 1BQNB 3OTEA 1RYRA 3UR0A 3MXHP 3SDEB 2HS0A 2WB4A 4CQ1A 3OTBA 4QW9A 3D0HE 4C2MA 2CPZA 2YNFA 3GIIA 4DFJA 2HHPA 3N01A 3NBPB 2A2CA 3MEDB 4O23A 7FDRA 2ASYA 3HM9A 2R2SA 3DI6B 2V94A 4QWBA 1YI2S 1WI8A 2DD8S 2WOMB 3CT9A 2HNYB 2LQJA 3FQLA 3OFHA 2CPEA 3KLEB 5F8JA 3KLFB 2HRYA 1XNRF 1U8SA 3NP5A 4YUDA 2QLXA 5B08A 3N5FA 1WG1A 2KFYA 3DFEA 1KOHA 4IFYB 4NLRA 2V9WA 3RR7A 1P9QC 2DBBA 4R8UB 3LAMA 2QMWA 4OHYA 2DITA 3O8WA 1FVQA 4B3MF 1SV5B 4XDDA 1N56A 4C0HA 2E9RX 2RSQA 3RW7A 4HL9A 4HVZA 5HP1B 3VAHA 1Y5LB 4BBYA 3H8YA 4OJ3A 1SUQA 3OR2B 4A8SA 3OTOF 4WE1A 1H7WA 2EG1A 2R7VA 5F8NA 2W24A 3RRKA 3N6LA 3PRBA 1R8BA 1X4HA 5C5JA 4ED1A 1TFYA 4GC7A 1FJCA 3IC1A 4OJ1A 4IH5A 4Y2KA 4C3KA 1RQ0A 4QWEA 2HNYA 1JNZB 4Z2XA 1RT4A 3UR3C 1JLFA 3H2UB 3POTA 3DLKB 2KM8B 3EPGA 1D8YA 2RRNA 3PW2A 2M8DB 2DH7A 3SCLE 5K8PA 4FNHA 4YOEA 2HLUA 2M52A 3KMQA 5B0BA 2POKA 2U2FA 5L1KA 3UDLA 3R1HA 2FJWA 4FVCA 3T3FA 2KU7A 3Q2TC 4ECWA 4DN0A 3G8TA 4J9LA 5DS7A 1HWLA 1VRUB 1U25A 1Q7YT 3CDBA 2D41A 4MK8A 3MEGA 1N5QA 2P9GA 2FHMA 2JLEA 3DRPB 3MWBA 4KGKA 3M8SA 2IMWP 1XR5A 1S0OA 2BE2A 3DNCA 3G8SA 3AJ2A 5F8HA 3OHAA 1R27B 1LWCA 3KWMA 4O44B 3IAM9 5K14B 3ENQA 1S1UA 3T5JA 2D1CA 2V4JA 2Q66A 3VAGA 4ERDA 5IT0A 5J1EA 3NL0A