1APSA

Three-dimensional structure of acylphosphatase. refinement and structure analysis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
STARPLKSVDYEVFGRVQGVCFRMYAEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of acylphosphatase. Refinement and structure analysis.
pubmed doi rcsb
source organism Equus caballus
molecule tags Hydrolase(acting on acid anhydrides)
molecule keywords ACYLPHOSPHATASE
total genus 27
structure length 98
sequence length 98
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 1991-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1apsA00
2XMTA 2HLTA 2ZDOA 2AP6A 2HLUA 2OD6A 1FE4A 1N5VA 1P8GA 1Y9OA 2JDJA 3FRYA 1FESA 2GA7A 2L3MA 1R6YA 3TOQA 1YG0A 5B0CA 1GXTA 3HHLC 2ZDPA 3BM7A 3BR8A 1U7LA 4Q2MA 3T9NA 1X0PA 1Y3KA 1SB6A 2PD1A 2VH7A 3GZ7A 4OIXA 4YEAA 2CRLA 2N7YA 5B0FA 4DL0C 4OJ3A 5IXUA 1CPZA 1TR0A 1GXUA 3HX9A 5B0BA 2W4DA 1TZ0A 1AFJA 1K0VA 3BGUA 4DN9A 2BJDA 4FNIA 1Q8BA 1JWWA 3MCSA 2GGPA 3HHLD 4A4JA 1LQ9A 2RILA 1Q53A 3K7RA 2KT2A 3WDOA 2K1RB 1AW0A 1Q4RA 2XMJA 4OJHA 3VTIA 2LDIA 1QUPA 2G9OA 2N4CA 4F67A 1OPZA 4Y2KA 1Q8LA 2XMVA 1FD8A 2OD4A 3BB5A 4A48A 2OKQA 2XMUA 2ACYA 4ZA1A 4A47A 2KT3A 1AFIA 3BDEA 2AJ0A 2K7KA 4Q2LA 3TRGA 1YJVA 2HFNA 3BF4A 1N5TA 3MZIA 1CC8A 2IYIA 5A6PA 3IWLA 4YDXA 3QGPA 1YJTA 1JK9B 1KVIA 2LQBA 2GO8A 1V3ZA 2GV1A 4NL5A 4HH1A 2K2PA 5KAKA 1URRA 2LXFA 2OAUA 1X7VA 2XMMA 4NPOA 4HI1A 1ULRA 1P6TA 2GGPB 2ASYA 2PGCA 2HQIA 2K1RA 2QIFA 3BN7A 3DCAA 5F0WA 5B0AA 1X8DA 1S6UA 4Y2MA 1KQKA 2AW0A 3HF5A 1VQSA 1RJJA 5B0EA 5B09A 2HFOA 3HFKA 2QLXA 1WD6A 1TL4A 3CJKA 1IUJA 2ROPA 2FB0A 1YRXA 3QMQA 3DXSX 1APSA 4EFAC 1OSDA 1Y3JA 2GCFA 2HIQA 1YJRA 3KG1A 4Y2IA 4DPOA 1SQEA 3I9ZA 2K7JA 5B0GA 2RU9A 2BUNA 2W4CA 1TUVA 3LO3A 5T7LB 4ZOSA 3KNGA 1TL5A 5B08A 3HHLA 4U9RA 2GFFA 4HL9A 2AJ1A 2OMOA 1N5SA 4HH0A 4FNHA 3KKFA 2BBEA 2KKHA 2IYGA 3F44A 3FGVA 3HDSA 2BJEA 2KYZA 3LGMA 1FEEA 2BYCA 1FVQA 2IFXA 1XBWA 2Q3PA 2FIUA 2EW9A 2ROEA 1OQ3A 2ROGA 3E8OA 2QYCA 2OP5A 1Y0HA 3LGNA 3KG0A 4OJ1A 2XMWA 3FMBA 3CJKB 4A46A 2XMKA 5A6WA 1MWYA 1CC7A 1KVJA 1FVSA 4QOTA 3UDCA 2FTRA 4OJGA 1FE0A 1SI9A 5K9FA 2LQ9A 2OFHX 1W2IA 1VQYA 2OFGX 2RSQA 1S6OA 5F0UA 4HI2A 3TNVA 2RMLA 2W4PA 2VV5A 1MWZA 3IWXA 1YJUA 5T7LA 5B0DA 1OQ6A 2QLWA 2N4DA 1N5QA 2FHMA 3HHLB
chains in the Genus database with same CATH superfamily
2L9DA 4EYIB 2KRBA 4XDCA 7FDRA 2HLUA 4DF4A 3PVXA 1Y9OA 5HQMA 2RVJA 1ZM4A 1UZDA 4DR7J 3CMAS 3J80Y 2MY8A 2BQRA 2XY7A 4F4YA 3HD2A 4GKJF 2E1AA 3GWCA 4OX7A 3KNAA 4JP8A 4NCAA 1PC5A 1CJKB 2AJ4A 1AUSL 1IKYA 3DM2B 2MQPA 2Z2ZA 1NPPA 5KFLA 4P6QA 2QJ3A 2ZJPQ 3AH6A 2HWHA 1TKXB 2OPSB 1DTQA 1GXUA 4BWMA 4U67Q 1VQ6S 1S1XA 1HQUB 2CQIA 2AEJA 2GJFA 3B82A 2VL1A 4FDFA 2V2VA 2QL5B 5KFYA 4F4KA 2W2OP 4QYZJ 1G6BA 2ATCB 2DH7A 3CDUA 3ETOA 5CZVA 4YHHJ 4ALZA 2KT2A 1O8BA 3OR2A 2UUTA 4P71A 1R6VA 1VIXA 4ZVTB 2IVYA 2GNKA 3MTJA 1I3OB 2WAQD 1HLWA 2OEMA 2N4CA 1BUXA 2IA0A 3THVA 1L5UA 2HNDA 2MQQA 3GJTB 1FJGJ 2ZZNA 2O67A 3ZXWA 1DFDA 2HK3A 3W9HA 2ACYA 3G4SS 2LXIA 5HLFA 2C28A 1HNWJ 2DISA 4JV0A 1C4AA 2AJ0A 2GS8A 4X66J 1VQMS 2K7KA 3WQPA 4OYBA 3MZIA 1B7YB 4HYKA 4RR5A 4TY8B 1WTBA 1CEZA 3AXMA 4I6AA 1U26A 3QGPA 4YDXA 3TUIC 3P5BP 5A8WB 2YKPA 2WZ1A 2Z0GA 4CO5A 2SXLA 5IM0B 4G1IA 2L9WA 4JBCA 3LQVA 4TYBA 2YKNB 5KT4A 2GVDB 3FCWA 3HLUA 2HZAA 1C1CA 4R0JA 1F5AA 3ZZTA 5CABA 3T5JA 1M5PC 3BN7A 3DCAA 2IMWP 1NSAA 2RD5C 5B0AA 2KT5A 1SJFA 2M70A 5J2MB 3FMWA 2RHSB 1NEEA 4C7QA 2X1GA 4PPDA 2EBGA 4ZJOA 5B0EA 2K3KA 1ZM2A 3M8RA 2Z57B 4KR0B 3QRRA 4HT5A 2R9LA 4ECTA 1VC0A 2BANA 1S1TB 3PG9A 4EWTA 1T95A 5KFZA 5HLFB 1U0SA 1APSA 2D41A 3BYRA 3D1QA 4X64J 3W5YA 4P2SA 4DR5F 5LMNF 1QLNA 1UEKA 1Y7PA 4LVNP 2ZH9A 1FRJA 1D9AA 3C16B 1FA0A 1HWIA 1CJVA 4OFZA 4B9MA 4USTA 2H48B 2OPPA 1HBMB 2EEYA 1D8ZA 2VG5A 1HHQA 5ADZA 4MFBA 2K8GA 4A8YA 2OSRA 4DX6A 5IM0A 3DGPB 3H4BA 1TFWA 2FLOA 3I0SA 3QIPB 4K59A 4NE9C 5HQ8A 3CDWA 2IPOB 5DGAA 3MM5A 3ADAC 3DDKA 2Z4PA 3NAIA 3HSJA 4IO1A 4ZP9A 4EU0A 2YWFA 1URNA 1UFLA 1JX4A 5KT2A 2ZITA 3OLAA 5JMNA 3EVWA 2XCAA 4CLWA 2DCLA 1ICEB 1LXNA 3K5PA 1F3FA 1PKUA 4JI3J 3JTPA 2J8AA 2F65A 1W26A 3BREA 1TKXA 2OPSA 4PG6A 5KT6A 3NRBA 3D68A 1MMNA 3P4UB 4QWEA 1DLOA 1FWPA 3IGNA 4BHQA 1BMQB 4OZ5A 1FE0A 5K9FA 4OX6A 4CNZA 1JMTA 3HPOA 1ZS6A 2MQLA 2OI2A 2HBZB 2X3GA 3ZTSA 4ZHRA 1J5OA 3C8YA 5D0EA 4R8UA 3W65A 2FHKA 3HVTB 3ZZZA 4F3QA 1DTTB 2VF3A 2W9BB 5D3GB 3MMBB 4ID5A 5T7LA 3PO5A 1Q95G 5A8KB 3OVBA 2MTLA 4K4SA 3HHLB 3W61A 3P96A 1FF2A 4PRFA 4J90A 1K1QA 1VMBA 3MCNA 2OTJS 3RG6A 1RISA 1T9TA 3CDBA 1Z2LA 4IFYA 1R0AA 2YKMA 3IC1A 1N0VC 3KLVA 3M05A 4O44A 4RO0A 2D9OA 2QMXA 2ZVSA 3D6FB 3LALA 4URQU 3W64A 2WVEA 4YN3B 1TK0A 2HHHF 4JI2J 2HZCA 1AXQA 4DL0C 4EO6A 2G1DA 3NCQA 3ZNJ1 2IJNA 5F8IA 3OFFA 1LNQA 3D6MB 4O4RA 3T41A 3VVTA 2NYHA 3R8YA 5L1LA 4NRUA 1KHWA 4DWIA 3MWBA 1NJWA 2I9SA 1RZMA 2YNHB 1KDNA 4WP8A 4Z37A 3KLHB 1SC6A 2NYIA 2V0NA 2WONA 2RILA 4USMA 3VAHA 2RB7A 1GMVA 4CNYA 1AT1B 1OWXA 2DR7A 4IFVB 3K0JA 3S7RA 2R2RA 4KH1B 5D78A 4U6PA 3POTB 2HRUA 2HVIA 4MIAA 3LW5C 1HWUA 3QSYB 2WW8A 3W5XA 1HQEA 2ZH8A 1WHWA 3RU0A 1K0VA 2B7BB 3TX0A 1X5PA 1GT8A 1YKWA 1NHVA 2ADCA 3DOLB 1Y00A 4LF7J 4N76A 3EE3A 1WSRA 3QT8A 4IQXA 1N5TA 4DV7J 3W3SA 1RSCA 4J9RA 3H40A 3JTOA 1WHYA 2VG7A 3I5AA 2PI5A 4CH7A 2QG9B 2ZH5A 2VQFJ 4FXDA 6AT1B 1PC4A 2V4QA 2XULA 4DV5F 1X4AA 3W66A 4F4AA 2RDIA 1ZAXA 4OI6A 3R7NB 4F25A 3A13A 3MM5B 1ULRA 4NWBA 3MCOA 3ZTPA 3T6JA 2H9ZA 2K1RA 3CE8A 3HULA 2ZHBA 4IRCA 2R7VA 1VQ7S 3M8QB 3NP5A 3FKBA 2XLKA 2DIVA 3I87A 4ED0A 3KJNB 1OYDA 3D3CJ 5SUHA 2MSTA 3V6DB 5DLGA 2B5JB 2KRRA 3MR2A 4PG7A 5F8JA 2BE9B 5B09A 1EB0A 4IR9A 4ANEA 2YX1A 3RB3A 1YJ9S 1XNRF 2XZDB 2ROPA 1FTCA 4NMXA 3G8SA 1RT2B 4TXSA 2DNZA 1BQNB 3I4PA 4KT0C 2KXNB 2R8HA 2ASJA 1FRHA 1SQEA 5LJ3Y 5L39A 2W2NP 3GSDA 3SCKE 1U1OA 1NK6A 2KHDA 1P27B 4LR7A 2F9DA 2RU9A 4X4RA 2XZTB 1I1GA 3CJ5A 4P9SA 4U95A 4H4MB 3ZC4A 2L48A 3RYLA 2W8LA 3NMAA 4CTAA 1OJ4A 2YXLA 2Y9HA 3IR5B 2KJWA 2LLZA 2QZ8A 2R7OA 2OGUA 2RNEA 4WKRA 5HN0A 4Y3CA 1H98A 2RIJA 3AOAA 4DV0F 3I96A 1B0VA 4PYDA 1UVKA 3MM8B 1FRKA 1RHQB 3W9IA 4C3LA 3DGVA 2D69A 4Y6IA 2LA6A 2NXUA 2X51A 3PFOA 5DDRC 3CXCR 1ZH5A 4ELTA 2M8HA 4LRFA 4ILRA 3FEYB 1G4CA 2H5EA 3HVAA 3BO3A 3V6HA 1V3SA 3B8HA 4YHHF 4BS2A 1RT2A 2ZOMA 3DI6A 1RUSA 5CZXA 3L09A 3V4IA 3S01A 4V19J 2GJ2A 5J2NB 2NCKL 5CAAA 4LR9A 4OYWA 4LFAJ 1UEVA 3ULHA 4NI2B 1GX6A 2KM8C 4LF9J 4QIEA 1ZM9A 1FERA 3DLBA 5SZTA 4AL7A 4FBUA 1RT7A 4RW8B 1IXKA 1XNQF 2HS4A 3R3TA 4OHZA 5M2PA 3OFEA 2HHQA 1HNVB 2GMLA 3A8EA 3AAWB 4JOUA 3VF0B 4Q7AA 2ZDOA 3I0SB 3QIPA 1NSPA 4U8YA 2VA3A 2CQDA 1FESA 1VBXA 2R7TA 3MM9A 4ERDA 1RT6A 3KHHA 1SQGA 2AKWB 3CCLS 1RACB 1U7LA 3MFHA 5AXKA 1YGYA 2E5IA 4ZCIA 3KK3A 1Y5LB 3GZ7A 2E5HA 1U0HB 3BO4A 3QJJA 3BPDA 3SQGB 1JLBB 1G3OA 4ES3A 1J5EJ 4YOEA 3NAHA 2P5VA 3NXZA 5DDQC 3GIMA 3UDVA 3X3UA 3OR1B 3NMRA 3N0VA 5MLCV 3R5GA 2JX2A 2MSSA 2DY9A 4UQGA 4RUAA 4OI1A 2C22A 1CS4B 1FO1A 4H4KA 5HJYA 2GGPA 3RR7A 1K47A 2CPXA 5E3CA 2WB4A 1CJTB 1JJHA 1PJ5A 2C3OA 3BBCA 2CYYA 4FF1A 2KO1A 1QAYA 4EYHB 4ILMA 3SCJE 4DU7A 4ETZA 5DG8A 3NCPA 3T1AA 2IC3A 5ETQA 2O3DA 3VAMA 2APOA 1SC4B 1X4HA 1Q7YT 2V2QA 3CSKA 4X4SA 2EFGA 3J7Z5 3G87A 4DQSA 1IM4A 3KK2A 3B54A 1RAGB 2P6SA 4FBTA 2MB0B 2CQ1A 2UXDF 3EICA 1KWMA 3BF4A 4F0HA 5KFDA 3T1HF 2QYGA 3SSQA 5KFPA 3OUYB 2YNIB 3UWTA 2MZRA 3L7UA 1RWPB 2VG5B 1T9YA 1V3ZA 4FYDA 2FHJA 3HKZD 2GV1A 3BH6B 1S1XB 2PFDA 4F36A 3TAPA 3BSCA 4PQUB 4ECWA 2HPUA 2L08A 3L9ZA 1HBOB 5D4PA 5KT5A 1RT4A 1BLUA 4WE1A 3U1MA 1U45A 1S79A 2ASDA 3DDNA 5ETTA 1NBEB 3IMQJ 2BW2A 1LW2A 3E2EA 4RBVA 2NPIA 2XI2A 3GCWP 1UVNA 4H54A 2C3PA 3N6MA 1VQSA 3C66A 3HHKA 4K5RA 3P3DA 2HFOA 2G2ZA 4I2QA 2DEJA 1SCJB 1H2TZ 2NS1B 5FDLB 4F02A 1M0SA 4ES2A 1RHJB 5LXRA 4EFAC 1JLQA 3SFUA 1OSDA 1Y3JA 3Q8PB 3W8PA 3ETMA 1T3OA 1Q82T 1ZPWX 1S0OA 4JV5F 3C2PA 1FKOA 1NJYA 4A8OA 2W4CA 1X4FA 2HBYB 2KXHA 2JLFA 1T9UA 3H2UB 4NLVA 1KD1T 1N6QB 4MH8A 1RWUA 5KG1A 5KG5A 4HHHA 3GB0A 2DGWA 4KBIA 4F2RA 1TV6B 3LUYA 2Y0BB 4HH0A 3W7BA 4A8XA 4QW9A 4DS4A 4DQRA 2R4FA 5D6GA 4QYZK 1FX2A 3TZZA 3PY8A 3EM1A 1YK9A 1RWOB 4DPYA 3Q8SB 2CKWA 2ZM6F 3HXMA 3M8QA 2XO6A 2N3LA 3H0PA 1HPZA 3RAMA 2OJ3A 3D2WA 3HFVA 1G1XA 4XIUA 2IA6A 2G0CA 1AA1B 3RAXA 3AHPA 1YZ6A 2V4JB 2XO7A 4K0KF 3FMBA 3UN2A 1S0MA 3PHEA 2KVQE 5D0RA 3M8WA 2RAQA 4DR4J 2B4UA 4Y00A 3ZTQA 3FSXA 1O6XA 1UTAA 1V5IB 5HQLA 4DL6A 1NDKA 4ZPBA 4ZPAA 2RUGA 2J7KA 3LANA 4HI2A 3ZZUA 2EC2A 4Z7CA 4FS1A 3CJTA 2HHTA 2Q43A 3DKDA 3M4XA 4LREA 3RBZA 4CH0S 1N5QA 2ZE2B 2XMTA 3N01A 2DGTA 2HLTA 4ID8A 1BWVA 4UUWA 2R7QA 4F0KA 4NXNJ 3HT0A 3POTA 4I2PA 3MR3A 1MSWD 2ZKUA 4KYZA 3TUJC 3TJAA 4C8MA 1NJXA 2E1CA 4PWDA 5E3PA 2DNNA 3HHLC 4ZN1A 3QATA 1UVLA 4C0OC 2PMHA 1PJ6A 1SXLA 2YNFA 1LWFB 1WKJA 1LOUA 2F4FA 2EI5A 2XYHB 1KP6A 1VRUB 2BVZA 5BYSA 3QGHA 5GMDA 5C25A 4M95A 1QVFR 1RWVB 3AD9C 4B3OA 1NKCA 4USUA 1WEXA 1CJUB 3KLGA 4A8QA 1RE1B 3MUVP 1XMQF 2JC0A 5B0BA 1AUDA 3BR9A 4YR3A 3JQMA 1JLGB 3BGUA 4DN9A 2EFVA 4B9TA 1EQMA 2GIRA 2FJAB 3NWRA 3TZYA 4PABA 3MHYA 5D3GA 2DXFA 5KFGA 1REVB 1RT3B 1Q4RA 3NG8A 1MN7A 4I7FB 5C42A 1X9SA 1Q7LB 3MEEA 5KFUA 2XS5A 4C4WA 4ECRA 2E1MC 4O23A 3WIVA 3GILA 3UCZP 1QUPA 4OV1A 2D74B 4FXVA 1PBUA 3IBCB 1FXRA 4ED7A 3MPVA 5IT9Y 2YKMB 2XMUA 3QO9A 3GMGA 2ILYA 4DUZF 5C7PA 4DL5A 4MYUA 2BEFA 4LBIA 4F4WA 3K57A 3KHLA 4Q2LA 4CLZA 2B6AB 1D9FA 1D09B 2DY1A 2FVCA 5A6PA 3CJ8A 1LFPA 1HBMA 2J8SA 2N82B 5A2QY 4DS5A 3NBPB 3PX0A 5LSRA 2ZNZA 3HI9A 1JQGA 2KU7A 1S72S 4DFPA 3D0HE 2UV8G 3OTEA 2OO4A 1FKAF 3BH7B 2VFRA 4NLUA 5HROB 3GV7B 1Q16B 4ZP6A 5CYMB 2RDJA 1GAOA 4DR3F 3AB2B 4Q0BA 3TYTA 4CYUA 2YWKA 2XMAA 2PIIA 2LQ5A 4HDHA 2MJNA 3RAQA 1DZ5A 3US5A 1S6PB 3LPEA 1KONA 2IC3B 2V67A 4LRAA 1JLCB 4EO8A 1DARA 2A10A 4XPEA 3G8TA 1RWMB 4ZPCA 4EGLA 3OVSA 1QTNB 2WOMB 4CO3A 1E6YB 3QO9B 1SIWB 3UW1A 5DLFA 3TQ1A 1M5VC 2LCWA 2QA1A 4C97A 2JWNA 3KG1A 5HAOA 4USWA 2HHXA 1RHRB 1EARA 3HSGA 1R31A 1J5OB 4H4KC 2CG4A 1O51A 1V3RA 2FYXA 2MZTA 1U8WA 3N6LA 3P45B 3I56S 1SH3A 2DPIA 3NBPA 1K9MT 5I3UB 1OO0B 3RZAA 4N56A 4WIIA 3ZZ0A 3H7HB 4EEYA 2RF2B 2IRUA 5KFJA 4AXIA 2VODA 3RW7A 1M5KC 2R3VA 2IDEA 1UETA 3F44A 1HFEL 2RH3A 4JI7F 3GSIA 2V8DA 3PR5B 1RHUB 1ACMB 1FEEA 1RU1A 2HIYA 1TL3A 3VZIA 1WI6A 4UOGA 4OI2A 2AYGA 4EBEA 4WFXA 4F8RA 2XHCA 1S7HA 3NNHA 3UO0A 3T9ZA 3HMJG 3CVKA 1JLCA 2MKKA 3R5JB 3WIUA 1G2EA 3DLHA 3OSNA 2HQGA 2MZQA 3J81Y 2P8IA 3OR1A 2EK6A 4RW4B 3D3BJ 4ELUA 3CTRA 3RTVA 1VC5A 3TA0A 2N3OA 3CJ2A 3KHGA 3PW7A 1T94A 4WCEQ 1AYEA 2HQDA 1RDRA 2WONB 5H9FK 3MEKA 3QFWA 1ZPVA 2YWEA 1N32J 2ERRA 1HI0P 4QWDA 3GJRB 4DPTA 2V63A 2AP6A 3UVJA 2FZKB 1BWEA 1B0TA 2HNDB 1TVRB 1F9HA 3W8GA 3AB4B 1UKUA 1R6YA 2IMOA 3SFGA 3Q83A 2DHHA 4EBDA 2Z56B 2CFXA 3QZ8A 3VCDA 4OI0A 5KG2A 4BC9A 1RI7A 1YJWS 3TZWA 2MQ8A 2UXDJ 2AMCB 1X5OA 5EUHA 4DL2A 2CRLA 4IH5A 4WF9Q 3F56A 2VQEJ 3ENQA 2WK4A 1VBKA 5E7OB 5DDOC 2W4DA 4LFBF 1SV5B 1AFJA 4LF6F 4KHMA 3MR6A 2QE5A 4WFNQ 4RNMA 2MQMA 3JS9A 1Q53A 2KYXA 3CJQA 4J9VA 1LW2B 1P1LA 3NGRA 4ZJQA 3RBDA 2ALZA 2XMJA 5D4OA 2VU5A 1HBNB 2J7WA 4ZVFA 3EX7B 1X4CA 3RRHA 1KRPA 3IS9A 2PSZA 1YTYA 2QEXS 1HI1A 1SQFA 1NM2A 3MM6A 1QY7A 2HGLA 2ZBCA 2FZGB 3GP9A 1EAYC 4ZVQB 2F63A 4C8KA 4IFYB 3VGTA 1H2UX 2WOMA 5G4DA 1AFIA 4CQ1A 2F7VA 2KT3A 1VIOA 4XK8C 1E6VA 5EHHA 4RZRA 3D7SB 4CLYA 2VA2A 1IWGA 3OTBA 3OQ2A 4KSEB 5DQGA 1VRUA 2CZ4A 3MAHA 4OHXA 3ZTRA 4YS2A 4JI3F 4NMLA 2OPPB 4QIGA 4X4TA 4FPRA 2FJEB 4DR7F 3M30A 5ETRA 3VAIA 3FQLA 4URSA 1HR0F 4LF4J 4YP3A 1XIQA 2RF2A 4AT1B 1TV6A 2LEPA 4Q5VA 1NLKL 1H74A 3ELHA 4DMZA 1CQMA 1U47A 1UP1A 3EVMA 1WOSA 2GVZA 2YWHA 3HSZA 2IM1A 4DSKA 4X65J 1U1LA 1FWKA 2BJ3A 4C8OA 1U6BA 4TN2A 2U1AA 3CCMS 3D1OA 2J0WA 3Q8RB 1YJNS 2ZBQA 3IA0A 3O5TB 3SV3A 2F8HA 3T6BA 4YY3J 2PEHA 5C5JA 1NAQA 2DGVA 2QX0A 3QIDA 2J9DA 3ZFVA 1T0TV 3JB9k 2CA9A 1XN9A 1XJWB 1ZZFA 5AJ3F 2A3JA 3R6LB 2UUBJ 1KNZA 3Q2TC 2B6AA 2J5AA 4OZLA 3BKUA 1CVJA 3EZ5A 2XS7A 2K7JA 2VASA 2YNGA 3HT3A 2VG7B 3CMES 1C1BA 3T19A 1TUVA 4NA3A 3KNGA 1RU2A 4LIRA 1NPRA 4USJC 3GG0A 3ILOA 5B08A 1U4BA 4M94A 4ZN3A 9RUBA 3C14B 3LAMA 3CCVS 2AX1A 3GTYX 4C11B 2KZMA 1ITPA 2MPUA 4DXLA 3TW0A 2CNKB 3RB0A 1KVIA 1DY3A 4DQPA 1A0OB 1VOMA 2KKHA 2LMIA 1DJ0A 3FGVA 2C2RA 2MZSA 2QSWA 3IR6B 3PRDA 1RWWB 2AWZA 4C8ZA 4GC7A 1NSQA 1OYEA 4WKYA 3Q8QB 2EW9A 1RBAA 2R42A 2RDDA 1RHMB 3BS9A 5HBMA 3ILJA 3EZUA 3IXQA 3I82A 4NLDA 2FC8A 1CJUA 5IS2A 1YIJS 4W90B 1HWKA 3QBCA 5DQHA 1BQMA 1SJ3P 3OL6A 3KJQB 1SV5A 3R5AA 5GAGI 5A8RA 2IRXA 4DV1J 1SI9A 2Q66A 1RA6A 2U2FA 1HHSA 5KFXA 1CS4A 4NLPA 4LF9F 4OX8A 2RSQA 3MPYA 4YMEA 2RQCA 3CCRS 2CPJA 2BA9A 3QFHA 2DRDA 4LSLA 3CCQS 2BQ3A 2VOOA 3B4DA 5HMYA 3UD3P 5J2PA 3GFXA 2C1EB 3MM6B 3QYYA 4I64A 3FRYA 3PJ9A 1YX2A 2J9EA 4NOHA 4KPCA 4JI5F 1X0FA 4KHPF 3GIJA 3ISNC 1RLCL 4N8OA 4MAKA 2JNJA 1SB6A 1YSJA 4JI7J 3HHEA 3RRKA 1VRTB 1VK3A 3I5CA 4YR2A 3DOKB 1MMDA 2FLNA 4CP5A 5IXUA 3H5SA 2ZD1B 3G6VA 1TR0A 2DGOA 4C9DA 2H1YA 4PWUA 1U8SA 4TLQA 3TQEA 2VG6A 1VBZA 4GKJJ 1F1BB 5HP1B 1WTFA 3EVOA 4ED4A 3IGVA 5KFKA 2HAIA 2RT3A 3QJLA 2CQ4A 3E01B 2RRNA 4X4NA 3WDOA 2C2NA 2K1RB 4ENOA 2QTWA 1WSVA 4Y34A 4Y2CA 4J9PA 5JVGQ 4DN0A 3P6YC 2MQNA 2FJXA 2EFQA 2QLJB 2XEXA 3DLEB 3FSIA 3TP2A 1FNOA 1XMBA 3L7PA 4OQJA 3MMAA 3ISND 3JXOA 4ICLA 3HJVA 3M2VA 3RUBL 1VC6A 4PWWA 2HS0A 2DITA 2XC9A 4DV4F 1JLAB 2DNYA 2ZBIA 4K2JA 1LWXA 4F50A 1C0UB 1UJ4A 2VC1A 4JI0J 3IR7B 3IRXA 3QPIA 3FK4A 3EPIA 3DLGB 2YNGB 2IAJA 4M5DB 2KN4A 1TKZB 4JV5J 3AOCA 1VS3A 3AJDA 1OMSA 4IOBA 3QQCD 1WEZA 4CO0A 1YI2S 3QRPA 1WG5A 1LKZA 2HMIB 1JNRB 2YNHA 2MHEA 2V4RA 2FPHX 3M6VA 3BDPA 2F9JA 2IJFA 1UEUA 4KGMA 1QSLA 2H5JB 2ZH1A 5KFBA 1OPIA 1HHTP 2AIRB 1VQNS 2AYEA 1WG1A 2JVRA 3MEEB 3KFWX 3LP1A 4QW8A 1PYOB 3J80U 2AW0A 4C8LA 2MGZA 3DU6A 4J9MA 3UNYA 4ZVHA 3N5FA 2R7SA 3O6QA 2IVFB 1P1TA 3MPDA 1SKRA 1U1RA 2ZFHA 3IM9A 3U7JA 5C2GA 1SC1B 1SKSA 1K8AT 1D0EA 4LFCF 2DRAA 5D8HB 2HG4A 2UUWA 2V8PA 3U27A 4CIOA 1H72C 2I2YA 1H2VZ 2HKEA 4Y2IA 1F60B 2ZH6A 3I9ZA 1DQ9A 1FDAA 2ZKTA 3MPWA 3OBIA 2O66A 5EWFA 5LMUJ 5JUMA 5B0GA 1UA0A 2BUNA 4FP9A 3WBZA 3MMBA 4ID5B 3VHQA 3K89A 4NZ7A 5KG3A 4D3HA 4HT7A 4MK8A 2HVDA 4IH6A 4LF8F 1RT4B 4OYMA 4YB6A 2HRYA 2CPYA 2MLXA 4LRDA 2FJBB 4JI2F 2H51B 4CO4A 4KC5A 1NK4A 4UY85 1QM9A 1FXLA 4C0HA 1IN0A 1UVIA 1SKUB 4DPUA 4U7CA 1VQKS 5IT9U 1FVQA 2MEWA 1XR5A 1A9NB 1VHFA 3MF5A 2HYIB 3MEDB 2G13A 2GAGC 4K2XA 4QU7A 2HSEB 4WPAA 4NLXA 1HI8A 2F8MA 4I67A 5IOLA 4PKDB 3V4MA 1RAHB 5LT5A 3HM9A 4X4QA 3CC2S 5D77A 3J7YI 4PQAA 4ZP7A 1ZZNA 4LFBJ 3CJ0A 2OFHX 1W2IA 1VI7A 2FHJD 1X4BA 3PHTA 4NCGB 4RBTA 4DI6A 3K5LA 1UZHA 1YJ7A 1MWZA 5FLXY 1YJUA 4I7FA 1GXLA 2V2ZA 4WXOA 1T9VA 4O3QA 3SDEB 4GMKA 5I3UA 3T5LA 2MMYA 1NJIT 3D0GE 1WKLA 4I6WA 3QGIA 3QRQA 1FE4A 1N5VA 2ZNYA 4PAAA 2JDJA 4FYWB 2WVFA 3KWMA 4EBCA 3TOQA 2ZWPA 4B3TF 2CJAA 4KGZB 1UCNA 2HZVA 2KFNA 3BR8A 2VHGA 4Q2MA 3WC2A 2XB2D 1YWXA 1Q79A 4LRBA 2GHPA 1TP7A 5BR8F 3CULA 1H3DA 1IVZA 4KAIA 4LJMA 1N5YB 2QA2A 3PIPQ 3BJYA 2B9WA 4A8WA 3CJSA 2MKHA 1TELA 2BXJA 2PA8D 1QUVA 1TKZA 1FJ7A 1NK0A 1J2VA 2JZ5A 5A0YA 4TKTA 1TZ0A 2ILZA 3OHAA 4ZMMA 4MKBA 2YH0A 3S8SA 4LFAF 1H6KX 3BGLA 4V19X 3ILIA 2DNHA 4WFAQ 2E7VA 3DDIA 4DR5J 2RJZA 4DV3F 4PR6A 2NSCA 1EHWA 3OJSA 1JNZB 3UD5A 1JLFB 3V6DA 2X1FA 1IJEB 1ZAWA 3MXHP 2P6TA 4KJIA 3F73A 5HVGA 1HNZF 1SUQA 5AE3A 5IT0A 2FJWA 3MECA 5K14A 2BANB 1UWBB 1HBUB 2RS2A 1UWAA 2C3YA 3G71S 3V6JA 5E3QA 1N0UA 2J0SD 2L41A 3PZPA 3BDEA 3G8QA 3EZOA 5HSPA 4AQYF 1S4EA 1TK5A 3KUGA 2ACMA 3TAQA 2Z2LA 3K5NA 1S1UA 1RAIB 2FY8A 1R0BG 2Z30B 5ETSA 4RUCA 5IWAF 3V5RA 4X62J 2DNMA 2ZD1A 8ATCB 5EDWA 2BDPA 5G0RA 3PKMA 2CWXA 4ZVUB 3GIRA 1RTHB 1S9EB 1UMJA 2FZCB 2CVIA 2M88A 4DX7A 4CTAB 1RTDB 3Q8UA 2XMMA 3HD1A 4LQ3A 1IBKF 1YQHA 4IG0B 3R6GB 5AT1B 3OR2B 3Q0AA 4QIVA 4X66F 4GKKJ 2JOQA 4F3MA 3PDNA 3CUNA 3AODA 1RT5A 2DNKA 5K5MA 3W63A 3UN5A 3NGDA 1YDLA 2BE2A 4UW2A 4W92B 2WRMA 1IR1A 2DB1A 3OSPA 4DEZA 2VPXB 4ECZA 1RJJA 3FEXB 1NNDA 4TU7A 4I0WA 2VIHA 2R8JA 1B7FA 1U02A 1UWBA 4CO1A 1OS5A 3BV8A 5GMKa 3KJVB 4NLWA 2CDQA 3N28A 3DXSX 4FN5A 3QWPA 1E6VB 2GCFA 2HIQA 4NLYA 4AFFA 4DLGA 3E3XA 4ECSA 3GLJA 3W2WA 3DLGA 4DSJA 1GFWB 1PIEA 4DV5J 4ZIWA 2YNIA 2YX7A 4DBQA 3G6XA 4MKAA 4G1QA 2UVWA 4WZMA 1VQ8S 2ABYA 3TI0A 3QLHA 4GRSA 4K4ZA 2FJDB 1ZM3A 1QAIA 2GMHA 3KMQA 1CLFA 1T11A 2AJ1A 4GO5X 4LF7F 4U7UD 3M32A 3ZO7A 2ZUAA 1Y11A 2M52A 4L3KA 4RW9B 4N47A 4ECYA 3GYNA 2POKA 5CYMA 4QIFA 2VBWA 5DQIA 1TKTA 1PYSB 3CCWA 1QJHA 2R7WA 1NB2A 4FF2A 3P49B 1IKYB 1KFSA 5J2QB 4G3IA 1RA7A 3CJKB 5M2RA 1Y5NB 4AQYJ 4WK1A 2E9ZA 1PILA 1GEHA 5GAEI 3QT5A 2NUUG 3DMJA 4U96A 3D9BA 1LW0B 1N36J 2BACA 2W4PA 1QSSA 1FRXA 3T5KA 2KB2A 4HTJA 1WC3A 3OJUA 3UD4P 3OHBA 5J1PA 4Y0FA 4WU3A 4ECVA 1MROB 1WKKA 4CDIA 2HHHJ 3R9LA 2AD9A 2CQ0A 1L3KA 2NPFA 5KFWA 4DV6F 4IG3B 2B7CB 2JHEA 3MDFA 4NCBA 1SJ4P 3HSDA 1K0TA 3FJ2A 1MWQA 4DL4A 4FZVA 4UF4A 1MLAA 3A3PB 1RB0A 2C2KB 2XBPA 2CUYA 4USVA 2B9XA 2MHNA 1HNIB 2AEMA 2AEFA 1TKTB 2PD1A 3R27A 1NJZA 2ZZMA 4C8NA 3IAM9 4WK3A 1FDBA 3A4TA 4OHYA 1NZ8A 3MOZA 4RL1A 3OUYA 2CJKA 1U25A 3GJSB 3PEHA 2AGPA 5BR8J 3W9JA 1K44A 1RTIA 4DF8A 1TAUA 1NU4A 1KLMA 2YPYA 3CNQP 4ED8A 5J1EB 4W4MA 1ZTTA 1NMEB 2YX4A 2ZBRA 3HKWA 1LQ9A 3L4BC 2MKIA 4M5IA 3VAGA 4M5HA 5D4NA 2V34A 4CYUB 3MAAB 1PJ7A 4V1Ak 1Q5VA 3CCSS 5HI7A 4ZVRB 1MNEA 4QWCA 1ZTWA 5B7WA 2E5JA 5ETNA 1UFKA 2XNRA 4HHUA 2XMVA 2JH3A 2IHR1 4LUBA 5D15A 2W25A 1SKWA 1B3TA 4ZA1A 1WUUA 2PI4A 1RADB 2C2ZB 1AB8A 1HNIA 2CQGA 3KJFB 5CH7B 1L3TA 1VQ4S 3B4MA 2IRYA 2PN6A 3TRGA 2BM1A 3KK3B 1EX8A 2W01A 3DM2A 3HCXA 1U0HA 1S59A 4KHPJ 4JYAJ 3LTOA 4QQBA 5D4LA 2HBQB 3LF0A 4NYPA 4OZ0A 1TQLA 3R5BA 1F3VA 1RTIB 2B4VA 4GVBB 3OL7A 2UU9F 5HP1A 3TWZA 2LXFA 4NPOA 1JJCB 2GGPB 2PGCA 1YRUA 1U6ZA 3A12A 4PXCA 4DV7F 3DLLQ 1XMOJ 1GTHA 2EK1A 1GK8A 2Q6BA 1CG2A 4KV8B 4TU9A 2QLBB 3NS7B 1WF2A 3VGVA 4JV2A 1M5OC 1XNRJ 4O3PA 2QA4G 1GH8A 2QGFB 2O01C 2RQKA 3BN4A 4P74A 2VPYB 4PXDA 5CA5A 3VAFA 2HQFA 5HBMB 3QSIA 3PCOB 3CJ3A 5FIIA 1MG7A 5GAEU 3NKYA 5K14B 5KFQA 2RU3A 1SL0A 1T05A 1JLEB 1GNKA 3IG1B 3DI6B 5F8MA 2P9EA 2KG0A 3T3FA 2ZC3A 2VUGA 2W7AA 3C6UA 3U02A 2G0IA 2R7RA 2NSBA 1R0CB 4NLRA 4W98A 2G1HA 4PZVA 2E29A 2FUG9 3HFZB 5HVFA 3TEGA 5KOXA 3QJPA 5G0RB 1WHVA 3WX8A 1RYSA 3GYXB 3HHLA 3MUMP 1QE1B 2AJFE 2PMZD 2QL9B 3CD7A 4HL9A 4Z7YA 3RBXA 3Q23A 2BX6A 1RCXB 2DYAA 1GQEA 2B4OA 3ISZA 3KLFA 2AGOA 3KLEA 4Q0BB 4B3RF 4RU2A 4J9UE 3SMZA 4CI0B 3DRSA 2Q3PA 2UXCF 2DNRA 4ETXA 4N8NA 1RXOB 3BSNA 1V9OA 2Z58B 5KFRA 2EFOA 1RAOA 2HBRB 2VFUA 3KG0A 5C25B 4C8YA 1JLBA 2CDRB 2XHWA 2HNYA 1KOOA 1F9EB 3Q89A 1R43A 1DAXA 4OYAA 3PRBA 4ZPVR 4J9KA 3CIZA 1UA1A 2XS2A 1FI4A 3GQCA 2DXEA 3EYZA 2HURA 4E0DA 3GJQB 4WYLA 2B9EA 4X65F 5DZ6A 1T8EA 4L75A 2W2QP 1U1MA 3CB4A 2B8PA 3I31A 2IBOA 2N4DA 3AOBA 4H4MA 3IS9B 4MTPA 2V94A 4WU2A 2CADA 2XQCA 2MKJA 4OZJA 1SIZA 2WTFA 1WC5A 2DO0A 4IOAQ 1SPBP 1S99A 3WZ0A 4F4XA 1S4FA 2ZDPA 3BM7A 3C3LA 4NYZA 1Y3KA 3NNAA 1LWCB 3GONA 2DNQA 3MTKA 2QV6A 4TY8A 4KRWA 5B0FA 2LECA 5J2QA 4OHWA 5K20B 1F2GA 5HMZA 2HVZA 1CPZA 2EXUA 3D6HB 5AE2A 4P2MA 5GVQA 5DDPC 4J9SA 3NEKA 1SH2A 2JJ4D 2XY5A 1R8CA 1IR0A 3QNWB 3VALA 1F9FA 2FGOA 2IM3A 3PKYA 1HNZJ 4NCGA 2G2OA 1QAJA 2UXBJ 1XC9A 4U7UK 4C48A 4A4JA 1JKHA 1C1CB 1RLDA 2BJ8A 2CZVC 2DBBA 2X3DA 1EETB 3CIMA 5FD1A 2W8KA 4NXNF 1AW0A 2ZVIA 5H9FJ 2F3JA 3TA1A 1UL3A 1RHKB 3OXGA 3NLCA 1KVKA 3BSAA 4JI4J 3VQSA 4LF6J 1H7WA 3KXDA 2HHPA 5AE1A 1RT1B 4JI1F 2HHUA 5DS7A 4F26A 3RGIA 2OKQA 4TY9A 2VQEF 2J7UA 3CDEA 4NLSA 1V6HA 4WZQA 4LT6A 5CD4H 1NDPA 1PYTA 2HGMA 2MJUA 3FCVA 3P8BB 3N5BA 2FVQA 1NK5A 2ALYB 2E7WA 1NRKA 5JJBA 1CSJA 4EMDA 1MN9A 3MEGB 4B3TJ 3NY0A 3LAKA 4X4VA 2GHWA 4NA1A 2D3ZA 2VBXA 3P5TL 2YBVA 5KFTA 1KBRA 2V69A 2X1BA 1T9WA 3M9NB 4LBPA 5IWAJ 1URRA 4X62F 1I94J 2K3IA 2Y3YA 4OI4A 4ZLLA 2WCXA 3IBWA 4L76A 3EXCX 1S6UA 2HVEA 4Y2MA 2OTLS 3ENAA 4QR0A 4FF4A 2BZ2A 3KOAA 3H59A 2H54B 2EFNA 4OYIA 2I5JA 3UFCX 4IO9Q 5ETPA 4ZPDA 3HFKA 4XTTA 3AD7C 1R8HA 3H42A 3PIOQ 1N48A 3T5HA 1ROFA 4DUTA 4JI6J 3ENWA 3QMQA 2BJ7A 3FFIB 2D3OR 1HMVA 1DLOB 3DOLA 1VYAA 5A8RB 3MAQA 4X2BA 3KLIA 4DL7A 4LSNB 3JSMB 1BY9A 1YLXA 1Z2ZA 3JSBA 3NL0A 3K59A 2UXBF 4F4ZA 3GCXP 4ZP8A 1IBMJ 1WOPA 4LSLB 2VBZA 4X4PA 3ZZRA 1NDCA 3R2CJ 1RTDA 2QA4S 1RQ0A 1OSCA 1RBOB 2GVDA 3H98A 3ET6B 3FBCA 4CLUA 4YQWA 1C0TA 1J27A 1WOOA 3TANA 4HTIA 2XNQA 3O3LA 4ZK7M 1GTEA 1OY6A 4YDDB 3LGMA 4ED1A 4P7VA 5CYQB 2YH1A 1N8RT 3AT1B 3BGOP 1IBLF 4CWBA 2LDYA 5LMUF 2DHSA 4Y28C 2D3O1 4J91A 1BC6A 1RGVA 1NXIA 2VFSA 3CJRA 2NXNA 1RAFB 2PC6A 3PRVA 9ATCB 2XY6A 1S5ZA 3MMCB 4Y2AA 3IWNC 2VOPA 3PJWA 3O44A 5KFOA 2CIMA 3A1YG 4LFCJ 4CRJA 2GQ2A 5EN1A 1UW4A 3CO0P 3G82A 5ITHA 3PYFA 3S1TA 2V9WA 3HZEA 4RNOA 4YFUA 2DR6A 3D5MA 3NNCA 2RMLA 4DR3J 3MM7B 4DZDA 1D3WA 3MCSA 4LVOP 1GX5A 2OEKA 1S1WA 2CXEA 3DRRB 4NZ0A 2AF6A 2WSFC 4FPIA 5IV3A 5H9EJ 1KC8T 1S0VA 1HQEB 2CVEA 2DHXA 3BKFA 1GMWA 2HVHA 1JLAA 4NZ6A 3VAKA 3NOGA 4OZ3A 2UXCJ 1GXTA 3DRPA 4UUXA 3UDEA 1HNXF 3KG4A 4QR1A 3SZ2A 4B3RJ 2VH7A 4RWXA 1T03A 2DH8A 2YWWA 3I55S 2WW4A 3B6BA 2CQPA 3M8SA 4JI0F 1L3VA 2N7YA 3F41A 1SBRA 5LJ5Y 3MEGA 1WC1A 3IRWP 1NPKA 2MDAA 3FZ2A 4DV4J 1S97A 4FYVB 1U24A 4CLTA 2BW7A 2DGQA 4CLLA 2VB6A 4J9NA 1HBOA 4G65A 4ZVOB 4F7VA 5IT4A 4DFKA 1M1GA 1UPPA 3MD3A 1LWEA 5I42B 3CCUS 1YHQS 2FLPA 3EDQB 1KEKA 2LFVA 3LOUA 2NREA 2FGCA 3OLBA 3C15A 2OSQA 5J2MA 3RR8A 4JI8J 1MROA 1IKVA 2ADBA 2BM0A 5CYJA 1IM6A 1MW7A 1B4SA 4F67A 3DRRA 1IBLJ 2R7XA 1U09A 1TVRA 4OLOA 4QPTA 2W7OA 2PA3A 2PMWA 5E33A 4QYRA 1W7WA 5A2QU 3CW2C 1KLNA 2HK2A 2HNZA 2PEBA 2B0GA 2XSFA 2ZOGA 4HACA 3OV7A 4DPXA 1N54B 5BJRA 5H9EK 3M2UA 1LWCA 3KLIB 2VFTA 3THPA 5ETLA 1Q1KA 2CJXB 3SXLA 4O0IA 2R2TA 3AQOA 3PYEA 4QIWD 4RJVA 3NWGA 3EGVA 5DG9A 1UPMB 1IBMF 5KFSA 4QWAA 1S48A 3I0RB 4CM2A 5RUBA 4DFMA 2LA4A 3ITHB 2G0JA 5KTQA 1I6JA 4JB8B 1R8BA 2EBEA 3AD8C 2K2PA 4HH1A 4ZITA 1JXLA 1JLGA 4KTQA 1EP4B 2IJRA 3CO9A 4YB1P 3FBBA 2HW3A 3ET6A 2XGPA 3LH2S 3B78A 3L7OA 1RP5A 5HANA 3KLFB 2N7CA 4WJBA 2HQIA 3JAMY 4O0NA 4HHJA 1FX4A 1Q78A 3MAAA 1TL3B 2KL8A 4JI6F 1NDLA 3FUYA 4G1PA 2Z8QA 5K8NA 3HF5A 1S6QB 4DR4F 1UFWA 4P2XA 4N41A 3M2VB 3MMCA 3TVYA 2E66A 2HNYB 2VDHA 2HWTA 3RBEA 4QU6A 2FB0A 2AJQA 4ITSA 4RW4A 2PT0A 1FFSB 2WVBA 4HEA9 4DX5A 4M63A 8AT1B 1F2HA 4DV2F 1A7GE 2W2MP 1HARA 5KT7A 2FVSA 4HKQA 1FDDA 3FC9A 4RW6B 3JYTA 1KQSR 1IKXB 2CPIA 3DLKA 1JXEA 2AGQA 1NHKL 2JEFA 2LU2A 2RQMA 4LIWA 1U2FA 2GZOA 3VVUA 3WHIA 1SL2A 5DJBA 4OX9J 4AL5A 4IG0A 2BBEA 5FJ4A 3MM9B 3VAJA 2IVMA 4PWDB 3ZNUA 4IYQA 1FRMA 5IC4B 1VRQC 3E8OA 1R8PA 2YTCA 2M5YA 4KGVB 1BGXT 2A1BA 1O5JA 2MLZA 2RRBA 5ETOA 3OTOF 1RCOB 3Q24A 4ED3A 4OJ1A 2XMWA 2DNOA 2ZZTA 1RAJA 2LVWA 4ANDA 3KJVA 1X5TA 2J6TA 1WF0A 2J0QD 2FTRA 2NZCA 3L95X 5H1SV 4DSFA 2A0FB 4C3MA 4PCQA 3ZZPA 1U6FA 1S6OA 5T14A 1JJ2R 1FKOB 3TNVA 3LPYA 4DV1F 3V81B 2BKNA 1U49A 1IR2A 2PO4A 3M2RA 4O4GA 4FKYA 3CCZA 4ZJLA 3MURP 1CBKA 1FHTA 4DUYF 1PBAA 3PR4A 1ZA2B 4CH1A 1PAEX 5J1NA 1KN6A 4ZPWR 4LF5J 1MMLA 2I6WA 3KK2B 4IDKA 1TL7B 4M5NA 4PEOA 4CT9A 5HVHA 1FKPB 3TJ8A 3TAMB 1N33F 1NK9A 1U1KA 3JSYA 4X84A 2C3MA 3PNIA 2IBKA 1WJ9A 1U1NA 1HKAA 1WG4A 2FHOB 3KDNA 5KFHA 2DNGA 4I4BA 2JFDA 3J7A1 4FVMA 2AYMA 4ATNA 2WSCC 2QC3A 5CCMA 3EMTA 4KKOB 4WTOB 4OLPA 1A6LA 3KDOA 1WDDA 1XEZA 1FT8A 2DKOB 1S49A 3AA9A 4KIAA 2BRKA 2G4BA 3DYAB 3LP0A 1SJQA 4UOCA 4B9LA 1S1WB 2G9OA 3OPKA 1FD2A 2GC8A 5KFEA 1FRIA 3EUNA 4L6V3 3G2XA 2DR5A 1HW8A 1VCTA 4K4VA 5FDLA 2VKZG 3K17A 5AXNA 1J5EF 4DOZA 4EUVA 4DR6J 3QGGA 3O1LA 2M7SA 2IDLA 1FTRA 2RHQB 3NOCA 2COLA 3UNGC 5KG7A 4J9OA 3LWLA 3EGWB 1SH0A 4PXEA 2R2UA 1YJTA 3PXGa 3LWMA 4DSLA 1DTQB 4DDFA 5GADI 1EJ7L 4UT4A 5DO2A 4D3GA 3I9V9 4DG1B 1KS2A 4DLEA 4ECUA 3C14A 1X7VA 4DCOB 2VBYA 2WB1D 4HI1A 3MR7A 3E01A 2PFFB 4B02A 5DZ7A 3UI3A 1N32F 1CQNA 2F1FA 3W5ZA 3SEOA 3SCLE 3MM8A 3KTQA 1IKVB 3PEJA 4R25A 1LV5A 3IM8A 4UQTA 5E3RA 3GFYA 1DHMA 2DIUA 5E3AA 4HLBA 5LSLA 2HEKA 1TKDA 4F2SA 4F04B 5KFCA 1XQIA 2QLXA 2DTJA 5CQGA 3M6UA 3CJKA 1MU2A 3IP0A 2RE1A 3AXKA 3D66A 5L38A 1C0UA 4RUBA 2QN6B 4X64F 4F3OA 4DV3J 2DNLA 4WBFA 1TFYA 1ZETA 4B3SJ 3L3CA 4KPYA 3F0NA 4RBUA 4E98A 2QO3A 1BQXA 3I0RA 2FVRA 3W2VB 2NZ4A 3R5CA 5ETMA 4OX9F 4USIA 5LL6d 4DG1A 1RTHA 4MJKA 3M7VA 2VD3A 4IG3A 3I32A 1I51B 1BE4A 2F8EX 2DRBA 4UTGA 2E5LJ 4FNHA 2EPIA 2WVCA 1RBLA 2IYGA 2LU1A 3EGZA 2HFSA 3G6ES 5L46A 3DRPB 4LF1A 1XBWA 5F8LA 2VDIA 3RB4A 1LWFA 2A18A 3Q86A 2XSJB 1Q5YA 1S6PA 4QPXA 2R2SA 2OMLA 5KFNA 1N5YA 1VRTA 4LMZA 1Y0HA 1U1PA 2QMUB 3BKTA 4N77A 4OYPA 2H3EB 3K8WA 4CM0A 5BYQA 2B56A 4KB7A 2J0XA 3DU5A 3J81j 1HMVB 2BOAA 1S1VB 2DO4A 2VJVA 2QSFA 2HFVA 4OJGA 4QJVA 3H8YA 2MQOA 4JV1A 4NRTA 3JSMA 5LM7E 4KKOA 4K8RA 3KUHA 1P9QC 1FJGF 1KR4A 2MYFA 3M8ZA 1VR6A 3UCGA 1REVA 3IWXA 3FRZA 2CPHA 3W2VA 4B17A 5B0DA 2OH2A 4FS2A 1VGYA 2QLWA 4HDGA 2L9NA 1JXVA 2F40A 3DLEA 1IQZA 5BYRA 4JUZA 3ZZOA 2KXFA 4J9LA 2FVPA 4B9SA 2O1PA 2ZEJA 1RT1A 1BXNA 3DRYA 2OLWA 3NGTA 3KLEB 4JI5J 4NLGA 2ZH2A 5K8MA 4PG4A 2EVZA 2ASLA 1H73A 1NO8A 3IAS9 2M8DB 1TU0B 4BBYA 4USKA 2ZH4A 4NLQA 4PUOA 2NR0A 2AX0A 4OHVA 1QVGR 3ZTOA 3D28A 4K4WA 4R5PA 4OIXA 4ILLA 2JEIA 4QZVB 3DFEA 1V5VA 5A8WA 2MZ1A 3ITHA 1N36F 2W2PP 3HX9A 5THWA 1FFWB 1I5OB 4OZ1A 4RW7B 3G82B 2DCUB 3LGHA 1NH8A 2KG1A 1VBYA 2Y1JA 3HHNB 2IIHA 4DUYJ 4UZCA 1D1UA 2YKQA 1AZSB 2EKYA 1YBAA 2QL7B 5U47A 3TEHB 5L8RC 3SDEA 4KO0A 3H20A 3VTIA 2E1PA 2NLWA 5IZHA 3BZQA 2BE2B 3DN9A 4TYAA 2QT7A 3J81U 2XI3A 1T7PA 3JSRA 3OVAA 3PO4A 3MOJB 4M5MA 1X4DA 3BGFA 3CC7S 1RAAB 2DJWA 4KGXB 2VONA 2CNOB 4O3RA 1WF1A 2VZ9A 3DHXA 4A47A 2XCPA 5L1JA 4BC7A 3JQKA 1B70B 1NSKL 5KFAA 3OTCA 4DU8A 1YJVA 4UY8T 2VKRA 1HYSB 5EWGA 4DR1F 4DSEA 3MMJA 3JYTB 2LQBA 2GO8A 1XERA 3A3OB 4K4YA 1U1QA 2GQQA 2Y1LB 3TVKA 3X1LB 2OAUA 2VICA 4NLOA 5AJ3J 1F5BA 3M32B 3OFGA 5JXSA 2ASYA 2GAHC 4YY3F 4PG8A 3TZXA 2E7XA 1QD1A 4RU9A 2JRSA 2QIFA 2A2CA 2XTJP 1DQAA 5F0WA 5CYQA 3DRSB 2M2BA 1FRLA 4KHRA 1NKBA 3NS5A 1FK9A 3BO2A 2JEGA 3TA2A 4DCJB 2LP4A 4CLFA 1SC3B 3PW0A 1B99A 5GADU 3CD5A 1VLYA 1TL4A 5LSOA 4OZNA 2OPQB 4K0KJ 3BGRA 2P2CB 2C2EA 1EKRA 1LXJA 2M9KA 4YUDA 4K4TA 1XTZA 3DNCA 2FDNA 2ZC4A 4I69A 4A8KA 1REGX 5HL7Q 2NUHA 1FJCA 2HFUA 4J9QA 3HVTA 4P7TA 2W9BA 3ONQA 2LEBA 3RRGA 3GE9A 2WHOA 3M2RB 1LFWA 2LQ8A 3R5DA 2ZJRQ 1R3NA 4E8UA 1JJ4A 4PQUA 1M5HA 2E5LF 3G96A 1KTQA 2J6UA 3DOMB 2OHDA 2H4WB 5T41A 1RKJA 5L9XA 3H4DA 2Q6CA 2XM3A 5HROA 1VDHA 2ZHOA 1UJ5A 2KYZA 2MY7A 4KV8A 2XGQA 2FY1A 1HQ2A 2W1BA 2DK2A 4K4UA 2B4PA 2YNFB 5ETKA 1NKEA 4XDDA 4RLEA 2A6MA 1IKWA 2I5JB 2MKSA 4GVLA 4MK9A 3CT9A 2CJ9A 3SQGA 3V2UC 2BJ9A 4I56A 4NXMF 4A46A 3D67A 2C3UA 5A6WA 1MWYA 3J7ZT 3DXBA 4LF5F 5HATA 1CC7A 5A0YB 3BGRB 4WFBQ 1VLOA 1F5CA 1FVSA 1L3UA 1RTZA 3FDSA 3GG1A 3BQ1A 1BQNA 1RAEB 1Y4ZB 2BV3A 3C19A 4LSNA 1N88A 3CGIA 1WC6A 3VWSA 1D9DA 2RS8A 3ZZYA 2JVOA 3IN5A 2VV5A 4ER8A 4WFYA 5CD4A 4Y2KA 3CC4S 2DNPA 3D6TB 1CULB 4H4OB 2E44A 4IUFA 1SVDA 1I94F 5F8HA 1C0TB 4WWSA 5EX3A 3SCIE 2QMWA 2HNZB 2ZH3A 1YG0A 5B0CA 2EG2A 3DC2A 1T3NA 4BCAA 2QFJA 3WX4A 4IOCQ 3N4WA 1S57A 1WI8A 2IM2A 2R8GA 1YVFA 3UCUP 2XLIA 1IKWB 1NH7A 1FWLA 4P73A 2YKOA 3C6TA 2V4JA 1S1UB 2XYGB 2H65B 4YEAA 1XMOF 4ANCA 2B9YA 3DLJA 2ZJQQ 2FJVA 4YR0A 5EX0A 1WHXA 1L3SA 3WC0A 2CG8A 4KY3A 4WFZA 3EPGA 2GIQA 5KFMA 2C2OB 2LQJA 4NASA 3K5OA 4NI2A 4J37A 3HHLD 1PGZA 4B9NA 1X5SA 4Q45A 1WWHA 3OXLA 2Z2YB 4WXWA 3H25A 1DURA 1DBDA 5CHCB 4ZS6A 2GVZB 1TL1B 1VJQA 3I4HX 4OJHA 4B08A 3PYGA 4Z2XA 2Z2MA 2ZE2A 2NXEA 2CZ9A 2MGZB 3HVRA 4J7CA 1SJRA 1S6QA 4A8MP 2AQ4A 1OPZA 1WDTA 4NEYA 2YPZA 3R97A 3VGSA 4ZIVA 5IV4A 3H5YA 1Q8LA 1S9GA 2OPRA 2AYBA 1S1TA 2OD4A 4WIQA 1KQGB 1RT6B 4A48A 3GU0A 3OL9A 1YBTA 2UP1A 4OYOA 5KFIA 3OFHA 4PUOB 1FNMA 2XZWA 3UR3C 2WBRA 2BMBA 1VQ9S 4O3SA 2I1RA 4R5PB 5AXMA 3EXYA 1WORA 3DOKA 5E5NA 3FSYA 2UVUA 2W9AA 4HVZA 2EFPA 2OEJA 2QFIA 1NCLA 1VQLS 2OELA 1X31C 1P9YA 3DOMA 2MLYA 3M9OB 3KHRA 1M1KT 1VHIA 3T1HJ 4NA2A 2DD8S 3SIPB 5KG4A 3GIIA 3MD1A 3OL8A 4YB5A 2KFYA 1XNQJ 1YZ7A 4DR6F 1ZYQA 1X8DA 2HAFA 4KO0B 4LR8A 3EGNA 3THTA 4DCPB 1GMWD 4MIBA 1UVJA 2C2MB 3MECB 1WD6A 4KGKA 1FXDA 2W24A 4BWJA 3KK1B 4S0MA 3Q22A 2AHOB 1YRXA 3JTNA 1B64A 5E41A 3GFHA 1KOHA 5F8NA 4FVCA 7AT1B 4FXWA 2CPDA 3NGKA 5HMWA 4ECXA 3K8VA 4Y65A 4AD6A 1F6TA 4R8UB 4ED5A 1VFJA 3CDAA 1TMJA 3LO3A 1PO6A 4ZOSA 1HNVA 4DR1J 2JSXA 4WTYA 4KQZA 5HJXA 4TQRA 2GJIA 1EKSA 2M3DA 3FEZA 2CQCA 4NLTA 5E2QA 5F41A 2VFVA 3OXFA 4WP9A 4E2FB 1IQTA 2HQ3A 2RQ4A 4TVAB 2IFXA 2V5HG 1H0HB 2V68A 4O44B 1X60A 1OQ3A 2YKAA 4I6YA 2B5JA 5L9NA 4CLKA 2J9CA 2OP5A 2VC0A 1FEHA 2LYVA 3AJ2A 3LGNA 2CPZA 2GHVC 1WNEA 3M8PB 3QZ7A 3UR0A 4DR2J 2XMKA 1T9XA 3KK1A 2BKOA 2OPQA 2RKIA 3SYZA 4B9UA 2J76E 3NS6A 3VZHA 6FDRA 4L72B 2CWKA 1UVMA 3C6UB 5KG6A 3D0IE 4ZDNA 1LWEB 1JKHB 1CJVB 3KYLA 2A2DA 1CJTA 3CEDA 3DLKB 1TL1A 4RWWA 2YQ3A 3HHDA 2LXUA 1N6QA 2FHMA 4UZBA 3SI8A 2BR0A 4RX6A 4ES1A 2D9PA 2OD6A 1P8GA 4C11A 4X4OA 1Z4UA 4IH7A 5DETA 1Q81T 2UU9J 1S12A 3IO1A 5LOQA 4AL6A 5F3TA 4TU8A 2HHSA 3PTWA 2VQFF 3HP6A 1M5SA 4KFBA 3GYGA 4ELVA 1HPZB 2J9DE 6FD1A 1X0PA 3IRXB 5M2UA 3AA8A 2CPEA 3CCTA 4LQ9A 4OI3A 2CAJA 4CT8A 2IAJB 3MGJA 3M8PA 2GIFA 4OJ3A 4P10A 3PACA 1TUGB 1BQMB 1W25A 1U48A 3CCES 3FZBA 2VPWB 3FQKA 3VQTA 3O8WA 4FNIA 4WE1B 4ZHRB 2E9RX 3PW5A 3O2IA 4DV2J 1DQ8A 1WC4A 3PW4A 1VQ5S 3UE2A 2UUCF 3U1NA 2KM8B 4DR2F 1EZZB 4EI2A 5IFMA 1N34J 4ZCLA 5L1IA 2QRRA 3J7AN 4Q44A 3QWUA 2EKNA 4L74A 2PDAA 1HD1A 1ZAVA 3NGSA 3PM9A 3BB5A 2BRLA 1R0AB 1E6YA 1PG5B 5DGBA 1NB7A 2DPJA 4PXBA 1D8YA 1TL7A 5DM6Q 5F8GA 1WACA 2XG8A 4AYBD 3T1YF 3V6KA 1H38A 5K8PA 2RUSA 1PSDA 2KDOA 3C6TB 4ZKAA 1JK9B 4G1QB 4MKVA 4IQMA 1Q8KA 4MFBB 4DPWA 2IY5B 5KAKA 2OUGA 4FYYB 1K1SA 3K2YA 2P9GA 5GMEA 2R7UA 1DRZA 1FCAA 3N79A 4B3MJ 3S6EA 3JAMU 1N4LA 4R0EA 3QT7A 4TQSA 2OIHA 1U2CA 4FYXB 4MIWA 3DYAA 3LP0B 1KQKA 3U1LA 2JLGA 1IBCB 4I68A 4M8LA 4GO7X 3R1LA 3AJ1A 1NK7A 1ZBTA 4QWBA 4CLPA 4UOFA 2DGSA 4ICLB 4TNOA 3CPWR 3A3NB 1S7IA 1UW9A 3D4JA 1OY8A 1IUJA 4L73A 4RKUC 4BLGA 4OMFG 1HR0J 3R7BB 4LF4F 1NHUA 4RPFA 3DMJB 1WELA 3EWGA 4DPOA 1N52B 2O5DA 1UJ6A 3K5MA 2I8EA 2I38A 5C24B 4L3NA 2D1CA 4DJBA 4ECQA 4ZVSB 4ZCKA 1VQPS 4FKXA 5CXTA 3AFGA 3OT9A 4QCLA 5A8KA 2K06A 4K5SA 3K58A 2ZBPA 3TUPA 2LKZA 1S9EA 2V8GA 4U9RA 3TX8A 2GFFA 2Q79A 3PJXA 1BHNA 3M8YA 3SQOP 3TJ9A 4DL3A 3CJ4A 3I5BA 4I2PB 4NEZA 2KZZA 4WYWA 3KKFA 1QDUB 2NXJA 3M1VA 2B3TB 1H7XA 5EGYA 4CZCA 2QLFB 3IFEA 3TR5A 1LEOA 4KE5A 3DRXA 1UAWA 3W62A 1LK7A 4RUHA 2ROEA 2ROGA 1T03B 5LMNJ 2XYPB 4OL8A 3TAMA 2R8KA 1FFGB 4MK7A 3TO8A 5KT3A 3DHWC 5GAHU 4RNNA 2XWYA 4OYZA 1RKIA 3JQJA 4Q8EA 1OIAA 2Y8YA 4IKAA 2Y0SD 2KI2A 3R7SB 3VR1A 3BEGB 1W2BR 4M1KA 4RW7A 4IRDA 4M5JA 3GR1A 1ZA1B 2LQ9A 3N6NA 5KFVA 1FDNA 3W2WB 2FC9A 4EK2A 1VQYA 3J7YU 2HWIA 5I42A 3C16A 1RWNB 5I3PA 2WVDA 3HVWA 4BDPA 1IKXA 2M0GB 2ZWOA 3W60A 2UZAA 2GO9A 3OW2R 1HBNA 1OQ6A 2ATLA 1KQFB 2V6AA 1IBKJ 1QTMA 1R7IA 2JLEA 1XK8A 5DM7Q 1U2RA 1S10A 2UUCJ 1HL6A 4RW9A 2GA7A 4Q43A 2E9TA 2L3MA 1S9GB 2OPRB 1FNXH 2NXCA 3NGUA 2B43A 1S0NA 2HHVA 3UN3A 2UV8A 3PX4A 2KTQA 3CCJS 2DGUA 5D0HA 2DR8A 2CJYB 2XSJA 4N7TA 5IQ6A 1HWJA 1HYSA 1FJEB 3GV8B 3PX6A 4LSZB 2CNNB 4MYTA 2WBMA 1HD0A 3SSRA 5L1KA 3M30B 4JI1J 3FBEA 3RB6A 1M90T 5ETVA 2VPZB 2BJDA 4P2FA 2CPFA 2V2KA 3SBMA 4B3SF 4KH0B 5KG0A 1NZAA 1YBUA 2MZJA 3K7RA 2UVVA 2HS3A 1RT7B 4RW8A 4DHVA 2E1RA 1DTTA 8RUCA 3E51A 5I3QA 3W1YC 5AXLA 4ZCMA 3V81A 1SL1A 3FBFA 4O4GB 1RT5B 1R89A 3D54A 3LP1B 3Q8VA 3OTOJ 4CCHA 3NCRA 2H4YB 5J2PB 1QSYA 5KFFA 3A8IA 4EZ6A 2EWHA 3MI7X 4AXJA 3BQ2A 4DV0J 2BKPA 3BYPA 1FD8A 1KHVA 3FFIA 4IDKB 2B8QA 2YQ0A 5MAOA 3M9MB 5DG7A 2F4VJ 3HK2A 1IJFB 5K8OA 5CCLA 4FF3A 1Q8IA 4ED6A 4PYAA 1CC8A 4LF2A 2IYIA 2B51A 3PYDA 4C6AA 2YWGA 1S9FA 2W9CB 4K4XA 3C46A 2DGXA 1HQUA 3QLHB 3ILLA 3UQSA 4HR2A 2DEIA 2HQCA 3MUTP 3N9UC 4URGA 3KLHA 3M1VB 5GAHI 1EETA 5C2CA 2ZOFA 3HZGA 1RT3A 3GFZA 4LBHA 5C42B 3BBFA 2CJQA 3G86A 1BD6A 1JLFA 4A8SA 4B9VA 2A6OA 3MEDA 2CQ3A 3HO1A 3CWJA 5FLXU 1SUQB 1RABB 3CF5Q 3MFIA 5LXYA 3G9CA 3ENVA 3OTDA 2DHAA 4G6VB 4HACB 2HGNA 4ZVPB 4XO0A 3A8JA 2UUBF 1OY9A 4MT1A 1YJRA 1Y5IB 4CO2A 1WEYA 2R8IA 2KJVA 5J2NA 4DFJA 2GMJA 2ZH7A 5DRKA 1KKHA 1X4EA 3H90A 5F9NA 2W9CA 4DX8H 5T7LB 2X7IA 4GVBA 4GC6A 2AV5A 4P75A 1R27B 1PAUB 5IQQA 1JIHA 2HMIA 3UVJB 1EP4A 4K7QA 4LF8J 4GKKF 1C4CA 1IWAA 2OMOA 4DQIA 1EQ0A 1Z1ZA 2C2DA 1N33J 3QAEA 1WC0A 4AUKA 3HDSA 1LK5A 4OZ2A 2EG1A 3PW2A 2JFKA 4NX9A 5I4MA 5EWEA 2FIUA 1FK9B 4C98A 3EJMA 4TLRA 3TUZC 2Y1RI 2XWXA 4JI8F 2XLJA 2JL9A 3IBFB 1HA1A 3KLGB 1X9MA 1MU2B 2KHCA 3LA0A 2CNLB 1M1HA 2V9KA 4UOHA 2J6SA 4DSIA 1KSPA 2OFGX 1HWLA 4J5OA 3PFEA 1XMQJ 3QT6A 2HHWA 1K73T 1RK8A 2ZHAA 1G7CB 3QAUA 4O3OA 2UVRA 2KFZA 4WP3A 3TVZA 1X9WA 3R2DJ 2CQHA 1NUEA 4IFVA 2P9CA 3MR5A 5BXIA 2IM0A 1QE1A 3FVYA 2M4MA 5IC6B 3MMAB 2KH9A 2AU0A 4ZVGA 3Q8YA 5A76A 2UUAJ 2DVIA 1ELOA 1HBUA 2JC1A 2WSEC 2YVSA 3KMSA 3G6YA 1NK8A 4P52A 3T9NA 2DR9A 1JB0C 4I1TA 3AQPA 4LRCA 4N5SA 4A8FA 7FD1A 3T1YJ 4RNFA 1EIYB 4U8VA 4QBUA 1RWKB 4RNHA 5E0OA 5HMXA 2RKIB 3H2LA 3GPAA 1RTJA 1S1VA 2DH9A 2MXYA 1T02A 1N56A 3H5XA 1VJWA 1Y10A 3HJFA 2JEJA 5HO4A 2BQUA 2YKNA 3CD0A 1PCAA 1Q8BA 1JWWA 1LW0A 2BJ1A 4ZLPA 3SV4A 1N34F 3MM7A 2BABA 2I0XA 1F0XA 1VQOS 2AZ1A 4M5LA 2F5GA 1C2PA 5HK4A 2X1AA 2D3UA 2Q1LA 2LDIA 1CULA 4H4OA 1XR7A 3FNNA 3MCMA 3OD2A 2ZM6J 3GV5B 3VV2B 5JVHQ 2YQ1A 4C0BA 3CMQA 1T05B 4YB7A 2AZ3A 4M5GA 1HW9A 3UDLA 2PE8A 3PV8A 5KOWA 2G2YA 2HFNA 4CLSA 1FKPA 1CJKA 4ZPTR 4NXMJ 1YRTA 3BBBA 3BPSP 3EDRB 4NYOA 3IWLA 4B3OB 4RW6A 4PPZA 1KTVA 1C1BB 1VISA 1TUWA 4OYXA 4O3NA 1S76D 4F0MA 5D0GA 4NL5A 3MPUB 1RTJB 2VG6B 4M5KA 2H5IB 3DGPA 4JYAF 4DV6J 3TARA 1KLMB 2C42A 2ZUGA 4C3KA 1P6TA 2V8HA 4XAKA 3R1HA 2Y1IA 1TMMA 2AJ2A 2DXDA 3AY0A 3D1HA 2V50A 1AZSA 1VK8A 1RWXB 1XR6A 1RYRA 1O0PA 4OV6A 1X4GA 2V8VA 2HRTA 3H2VE 1TTHB 2E5GA 4EZ9A 1SJ1A 2D7SA 3CD6S 2RRAA 4MKYA 1Q86T 5GAGU 3V4IB 4IR1A 4Q8FA 1S77D 4AE5A 2CQ2A 2YY3A 1R8AA 3H5UA 3SSSA 2HFZA 1XWLA 3M2UB 2AT1B 4PG5A 3M6XA 4QR2A 2DHGA 3GR0A 2GQCA 2LEAA 4IRKA 4M5DA 1ZOTA 2BOPA 4ZVEA 1TL5A 1GMUA 3LP2A 4USHA 3BQ0A 3BSOA 4XPCA 2MKYA 1N5SA 2VJUA 2FLLA 4B3MF 1HNWF 1Q0NA 2CQBA 3I6PA 1TAQA 3RJMB 2KVIA 2BJEA 3A8KA 4KFBB 1HNXJ 2MKCA 1KFDA 2BYCA 1HIYA 3M6WA 2CJBA 3ICLA 2W7PA 4JI4F 2UUAF 2GX8A 2QYCA 3UPFA 2DT9A 1YITS 3FCHA 4I2QB 2FD2A 4P72A 2F4VF 3KUEA 2FQQB 4DZ6A 4ZLJA 1JLEA 3IG1A 4C2MA 4QOTA 5F3ZA 1JLQB 4ED2A 2Y8WA 4DUZJ 3UDCA 1KVJA 1AROP 4MMOA 4DQQA 2EC0A 3VGUA 4X4UA 5J1EA 1TK8A 1QAXA 2BE7D 3Q2SC 5C24A 2NQPA 5F0UA 4K50A 1B0PA 3RW6A 3GIKA 5F9LA 3C15B 4ZLNA 3LP2B 2GW8A
chains in the Genus database with same CATH topology
2L9DA 4EYIB 2KRBA 4XDCA 7FDRA 2HLUA 4DF4A 3PVXA 1Y9OA 2RVJA 1ZM4A 3CMAS 3J80Y 2MY8A 2BQRA 2XY7A 4F4YA 4GKJF 2E1AA 3GWCA 4OX7A 3KNAA 4NCAA 1PC5A 2AJ4A 1IKYA 3DM2B 2MQPA 5KFLA 4P6QA 2ZJPQ 3AH6A 2HWHA 1TKXB 2OPSB 1DTQA 1GXUA 4BWMA 4U67Q 1VQ6S 1S1XA 1HQUB 2CQIA 3B82A 2VL1A 5KFYA 4F4KA 4QYZJ 1G6BA 2DH7A 3CDUA 3ETOA 5CZVA 4ALZA 2KT2A 1O8BA 3OR2A 2UUTA 1VIXA 2IVYA 2GNKA 3MTJA 2WAQD 2N4CA 2IA0A 1L5UA 2ZZNA 2HNDA 2MQQA 2O67A 1DFDA 2ACYA 3G4SS 2LXIA 5HLFA 2C28A 2DISA 4JV0A 1C4AA 2AJ0A 1VQMS 2K7KA 3MZIA 4HYKA 4TY8B 1WTBA 1CEZA 4I6AA 1U26A 3QGPA 4YDXA 3TUIC 5A8WB 2YKPA 2Z0GA 4CO5A 5IM0B 2SXLA 4G1IA 2L9WA 4JBCA 3LQVA 4TYBA 2YKNB 5KT4A 3HLUA 1C1CA 4R0JA 1F5AA 3ZZTA 3T5JA 2IMWP 1M5PC 3BN7A 3DCAA 2R7TA 2RD5C 5B0AA 2KT5A 1SJFA 2M70A 5J2MB 3FMWA 1NEEA 4C7QA 2X1GA 4PPDA 2EBGA 5B0EA 2K3KA 1ZM2A 3M8RA 4KR0B 4HT5A 2R9LA 4ECTA 1VC0A 2BANA 1S1TB 4EWTA 1T95A 5KFZA 5HLFB 1APSA 2D41A 3D1QA 4P2SA 4DR5F 5LMNF 1QLNA 1Y7PA 4LVNP 2ZH9A 1FRJA 1D9AA 4OFZA 1FA0A 1HWIA 4B9MA 2OPPA 1HBMB 1D8ZA 2VG5A 5ADZA 4MFBA 2K8GA 4A8YA 2OSRA 5IM0A 3H4BA 1TFWA 2FLOA 3I0SA 3QIPB 4K59A 5HQ8A 5DGAA 3CDWA 3MM5A 3DDKA 2Z4PA 3NAIA 4IO1A 4ZP9A 4EU0A 2YWFA 1URNA 1UFLA 1JX4A 5KT2A 2ZITA 3OLAA 2XCAA 2DCLA 3K5PA 1LXNA 3JTPA 2J8AA 3BREA 5KT6A 1TKXA 2OPSA 4PG6A 4QWEA 3NRBA 3V4IA 1MMNA 1DLOA 3IGNA 4BHQA 4OZ5A 1FE0A 5K9FA 4OX6A 4CNZA 1JMTA 3HPOA 2MQLA 4ZHRA 2X3GA 1J5OA 3C8YA 4R8UA 3ZZZA 5D3GB 2FHKA 3HVTB 4F3QA 2W9BB 1DTTB 3MMBB 4ID5A 5T7LA 3PO5A 5A8KB 3OVBA 4K4SA 3HHLB 3P96A 1FF2A 4PRFA 1K1QA 1VMBA 2OTJS 1RISA 3CDBA 1Z2LA 4IFYA 1R0AA 2YKMA 3IC1A 1N0VC 3KLVA 3M05A 4O44A 2D9OA 2QMXA 2ZVSA 3LALA 4URQU 2HHHF 1TK0A 2HZCA 1AXQA 4DL0C 4EO6A 2G1DA 3NCQA 2IJNA 5F8IA 3OFFA 4O4RA 5L1LA 4NRUA 1KHWA 4DWIA 3MWBA 1NJWA 2I9SA 2YNHB 4Z37A 3KLHB 1SC6A 2NYIA 2V0NA 2WONA 2RILA 3VAHA 2RB7A 4CNYA 1OWXA 2DR7A 4IFVB 3K0JA 3S7RA 2R2RA 5D78A 4U6PA 3POTB 2HRUA 2HVIA 4MIAA 3LW5C 1HWUA 2WW8A 1HQEA 2ZH8A 1WHWA 3RU0A 1K0VA 2B7BB 1X5PA 1GT8A 4N76A 1NHVA 2ADCA 3DOLB 1Y00A 4IQXA 1N5TA 3W3SA 4J9RA 3H40A 3JTOA 1WHYA 2VG7A 3I5AA 2PI5A 4CH7A 2ZH5A 4FXDA 4DV5F 1PC4A 2V4QA 2XULA 1X4AA 2RDIA 1ZAXA 4OI6A 4F25A 3MM5B 1ULRA 4NWBA 3T6JA 2H9ZA 2K1RA 3CE8A 4IRCA 2ZHBA 2R7VA 1VQ7S 3M8QB 3NP5A 2XLKA 2DIVA 3I87A 4ED0A 3V6DB 5SUHA 2MSTA 5DLGA 2B5JB 2KRRA 3MR2A 4PG7A 5F8JA 5B09A 4IR9A 2YX1A 3RB3A 1YJ9S 1XNRF 2ROPA 1FTCA 3G8SA 1RT2B 4TXSA 2DNZA 1BQNB 3I4PA 4KT0C 2KXNB 2R8HA 2ASJA 1FRHA 1SQEA 5LJ3Y 5L39A 3GSDA 1U1OA 3SCKE 1NK6A 2KHDA 1P27B 2F9DA 2RU9A 4X4RA 1I1GA 3CJ5A 4H4MB 3ZC4A 2L48A 3RYLA 2W8LA 3NMAA 4CTAA 3IR5B 2KJWA 2LLZA 2QZ8A 2R7OA 2RNEA 4WKRA 5HN0A 4Y3CA 1H98A 2RIJA 4DV0F 3I96A 1B0VA 1UVKA 3MM8B 1FRKA 5DDRC 4C3LA 3CXCR 4Y6IA 2LA6A 2NXUA 2X51A 3PFOA 1ZH5A 4ELTA 2M8HA 4ILRA 3FEYB 2H5EA 3HVAA 3BO3A 3V6HA 1V3SA 3B8HA 4YHHF 4BS2A 1RT2A 2ZOMA 3DI6A 5CZXA 4V19J 3L09A 3S01A 2GJ2A 5J2NB 2C2EA 1UEVA 3ULHA 2KM8C 1GX6A 4QIEA 1ZM9A 1FERA 3DLBA 5SZTA 4AL7A 4FBUA 1RT7A 4RW8B 1IXKA 1XNQF 2HS4A 3R3TA 4OHZA 5M2PA 3OFEA 2HHQA 1HNVB 2GMLA 3A8EA 3AAWB 4JOUA 3VF0B 4Q7AA 2ZDOA 3I0SB 3QIPA 2VA3A 2CQDA 1FESA 1VBXA 3MM9A 4ERDA 1RT6A 3KHHA 1U7LA 3MFHA 5AXKA 1YGYA 2E5IA 4ZCIA 3KK3A 1Y5LB 3GZ7A 2E5HA 3QJJA 3BO4A 3SQGB 1JLBB 1G3OA 4ES3A 4YOEA 3NAHA 2P5VA 5DDQC 3GIMA 3X3UA 3OR1B 3NMRA 3N0VA 5MLCV 2JX2A 2MSSA 4UQGA 4RUAA 4OI1A 2C22A 1FO1A 4H4KA 2GGPA 3RR7A 2CPXA 5E3CA 2WB4A 1JJHA 2C3OA 2CYYA 4FF1A 2KO1A 1QAYA 4EYHB 4ILMA 3SCJE 4ETZA 5DG8A 3NCPA 3T1AA 2IC3A 2O3DA 3VAMA 2APOA 1X4HA 1Q7YT 3CSKA 4X4SA 2EFGA 3J7Z5 4DQSA 1IM4A 3KK2A 2P6SA 4FBTA 2MB0B 2CQ1A 2UXDF 3BF4A 5KFDA 3T1HF 3SSQA 5KFPA 3OUYB 2YNIB 3UWTA 2MZRA 2VG5B 1V3ZA 4FYDA 2FHJA 3HKZD 2GV1A 3TAPA 1S1XB 4PQUB 3BSCA 4ECWA 2HPUA 2L08A 1HBOB 5D4PA 5KT5A 1RT4A 1BLUA 4WE1A 3U1MA 1U45A 1S79A 2ASDA 3DDNA 2BW2A 1LW2A 3E2EA 4RBVA 2NPIA 2XI2A 1UVNA 4H54A 2C3PA 3N6MA 1VQSA 3C66A 3HHKA 4K5RA 3P3DA 2HFOA 4I2QA 1H2TZ 2NS1B 5FDLB 4F02A 1M0SA 4ES2A 5LXRA 4EFAC 1JLQA 3SFUA 1OSDA 1Y3JA 3Q8PB 1T3OA 1Q82T 1ZPWX 1S0OA 4JV5F 3C2PA 1FKOA 1NJYA 4A8OA 2W4CA 1X4FA 2KXHA 2JLFA 3H2UB 4NLVA 1KD1T 1N6QB 4MH8A 1RWUA 5KG1A 5KG5A 3GB0A 2DGWA 4KBIA 4F2RA 1TV6B 3LUYA 4A8XA 4HH0A 3W7BA 4QW9A 4DS4A 4DQRA 2R4FA 5D6GA 3PY8A 3Q8SB 2CKWA 2ZM6F 3HXMA 3M8QA 2N3LA 1HPZA 3RAMA 2OJ3A 3D2WA 1G1XA 4XIUA 2IA6A 2G0CA 3RAXA 3AHPA 2V4JB 2XO7A 4K0KF 3FMBA 1S0MA 3PHEA 2B4UA 4Y00A 3FSXA 4DL6A 4ZPBA 4ZPAA 2RUGA 2J7KA 3LANA 4HI2A 3ZZUA 1D8YA 4FS1A 2HHTA 2Q43A 3M4XA 4CH0S 1N5QA 2ZE2B 2XMTA 3N01A 2DGTA 2HLTA 4ID8A 4UUWA 1MSWD 2R7QA 4I2PA 3POTA 3MR3A 2ZKUA 3TUJC 4C8MA 1NJXA 2E1CA 4PWDA 5E3PA 2DNNA 3HHLC 1UVLA 4C0OC 2PMHA 1SXLA 2YNFA 1LWFB 1LOUA 2EI5A 5BYSA 1VRUB 2BVZA 4M95A 1QVFR 3QGHA 4B3OA 5C25A 1NKCA 4A8QA 1WEXA 3KLGA 1XMQF 3MUVP 2JC0A 5B0BA 1AUDA 3BR9A 4YR3A 1JLGB 3BGUA 4DN9A 2EFVA 4B9TA 2GIRA 2FJAB 3MHYA 5D3GA 5KFGA 1REVB 1RT3B 1Q4RA 3NG8A 5C42A 4I7FB 2XS5A 1X9SA 1Q7LB 3MEEA 5KFUA 4C4WA 4ECRA 2E1MC 4O23A 3GILA 3UCZP 1QUPA 4OV1A 2D74B 4FXVA 4ED7A 1FXRA 3MPVA 5IT9Y 2YKMB 2XMUA 3QO9A 3GMGA 2ILYA 4DUZF 4DL5A 4MYUA 1D9FA 4F4WA 3K57A 3KHLA 4Q2LA 2B6AB 2FVCA 5A6PA 1LFPA 1HBMA 2N82B 5A2QY 4DS5A 3NBPB 3PX0A 5LSRA 2ZNZA 3HI9A 2KU7A 1S72S 4DFPA 3D0HE 2UV8G 3OTEA 2OO4A 1FKAF 4NLUA 2VFRA 5HROB 3WC2A 3GV7B 1Q16B 4ZP6A 5CYMB 2RDJA 1GAOA 4DR3F 3AB2B 4Q0BA 3TYTA 2YWKA 2PIIA 2LQ5A 4HDHA 2MJNA 3RAQA 1DZ5A 3US5A 1S6PB 1KONA 2IC3B 1JLCB 4EO8A 1DARA 2A10A 4XPEA 3G8TA 4EGLA 4ZPCA 3OVSA 1KNZA 2WOMB 4CO3A 1E6YB 3QO9B 1SIWB 3UW1A 5DLFA 3TQ1A 1M5VC 2LCWA 2QA1A 4C97A 2JWNA 3KG1A 2HHXA 1R31A 1J5OB 4H4KC 2CG4A 1O51A 1V3RA 3N6LA 2MZTA 3I56S 1SH3A 2DPIA 3NBPA 5I3UB 1OO0B 3RZAA 4N56A 4WIIA 3ZZ0A 4EEYA 2RF2B 2IRUA 5KFJA 4AXIA 2VODA 3RW7A 1M5KC 1UETA 3F44A 1HFEL 2RH3A 4JI7F 2V8DA 3PR5B 1FEEA 3VZIA 1TL3A 1WI6A 4OI2A 2AYGA 4EBEA 4WFXA 4F8RA 3NNHA 1S7HA 3T9ZA 3HMJG 3CVKA 1JLCA 2MKKA 1G2EA 3DLHA 3OSNA 2MZQA 3J81Y 3OR1A 2EK6A 4RW4B 3CTRA 3RTVA 1VC5A 3TA0A 2N3OA 3CJ2A 3KHGA 3PW7A 1T94A 4WCEQ 1RDRA 2WONB 3MEKA 1ZPVA 2YWEA 2ERRA 1HI0P 4QWDA 2AP6A 1BWEA 1B0TA 2HNDB 1TVRB 3AB4B 1UKUA 1R6YA 2IMOA 3SFGA 4EBDA 2CFXA 3QZ8A 3VCDA 4OI0A 5KG2A 4BC9A 1RI7A 1YJWS 1X5OA 5EUHA 4DL2A 2CRLA 4IH5A 4WF9Q 3F56A 3ENQA 2WK4A 5E7OB 5DDOC 2W4DA 4LFBF 1SV5B 1AFJA 4LF6F 4KHMA 3MR6A 2QE5A 4WFNQ 4RNMA 2MQMA 1Q53A 2KYXA 1LW2B 1P1LA 3RBDA 2ALZA 2XMJA 5D4OA 1HBNB 2J7WA 4ZVFA 3EX7B 1X4CA 3RRHA 1KRPA 3IS9A 2PSZA 1YTYA 2QEXS 1HI1A 3MM6A 1QY7A 2HGLA 2ZBCA 4C8KA 4IFYB 1H2UX 2WOMA 5G4DA 1AFIA 4CQ1A 2F7VA 2KT3A 1VIOA 4XK8C 1E6VA 5EHHA 4RZRA 2VA2A 3OTBA 3OQ2A 4KSEB 5DQGA 1VRUA 2CZ4A 3MAHA 4OHXA 4JI3F 4NMLA 2OPPB 4QIGA 4X4TA 4FPRA 2FJEB 4DR7F 3M30A 3VAIA 3FQLA 4URSA 1HR0F 4YP3A 2RF2A 1TV6A 2LEPA 4Q5VA 4DMZA 1CQMA 1U47A 1UP1A 2YWHA 2IM1A 4DSKA 1U1LA 4C8OA 1U6BA 4TN2A 2U1AA 3CCMS 3D1OA 2J0WA 3Q8RB 1YJNS 3IA0A 3O5TB 3SV3A 2F8HA 3T6BA 5C5JA 2PEHA 3L3CA 1NAQA 2DGVA 3QIDA 3ZFVA 2J9DA 3JB9k 1U4BA 1K9MT 1XN9A 1ZZFA 5AJ3F 3Q2TC 2A3JA 2B6AA 2J5AA 4OZLA 1CVJA 2XS7A 3EZ5A 2K7JA 2VASA 2YNGA 3HT3A 2VG7B 3CMES 1C1BA 3T19A 1TUVA 4NA3A 3KNGA 4LIRA 4USJC 3GG0A 5B08A 4M94A 3LAMA 3CCVS 2AX1A