1APSA

Three-dimensional structure of acylphosphatase. refinement and structure analysis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
STARPLKSVDYEVFGRVQGVCFRMYAEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYLPHOSPHATASE
publication title Three-dimensional structure of acylphosphatase. Refinement and structure analysis.
pubmed doi rcsb
source organism Equus caballus
molecule tags Hydrolase(acting on acid anhydrides)
total genus 27
structure length 98
sequence length 98
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 1991-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1apsA00
2OFHX 1FESA 2AW0A 2KYZA 2PD1A 1OQ3A 1XBWA 5T7LA 4DN9A 1W2IA 1MWZA 1GXUA 3HF5A 2GA7A 2ACYA 2OMOA 3DXSX 2XMVA 1YJTA 4DL0C 2BJDA 1X0PA 1FE0A 2XMKA 3FGVA 3TNVA 2FB0A 3E8OA 3VTIA 2PGCA 4OJGA 1TZ0A 4OJ3A 1CPZA 1TL4A 1URRA 2GGPA 5KAKA 5K9FA 1JK9B 1SI9A 1X8DA 2OFGX 3BF4A 5F0WA 1K0VA 4DPOA 2OD6A 3WDOA 2IFXA 3HHLD 4A46A 1Y3KA 4NPOA 2QLWA 5B09A 1FE4A 3IWLA 2XMJA 3MZIA 1AFJA 1Q8BA 2LQBA 1KVJA 2ROPA 3CJKB 3F44A 2XMTA 5B08A 1SB6A 2ZDOA 1S6OA 4A47A 2GFFA 4HI2A 5T7LB 4OIXA 2ZDPA 2HLUA 2ROEA 1VQYA 1SQEA 4Y2KA 3GZ7A 3TRGA 5IXUA 1TR0A 2W4CA 3MCSA 1CC8A 2BBEA 4HH0A 3T9NA 1KVIA 1MWYA 1OSDA 1Q4RA 1WD6A 4ZA1A 2IYGA 2XMWA 3KG0A 1KQKA 1P8GA 2JDJA 3BR8A 4A48A 1YJVA 3HHLC 2OAUA 4YDXA 1VQSA 1Y9OA 4F67A 2RSQA 3HDSA 3BDEA 5B0AA 3HHLA 3LGMA 2RU9A 4OJ1A 2W4PA 2QYCA 2HFOA 1QUPA 2BYCA 2K1RA 1FD8A 2ROGA 2BJEA 3HX9A 3LGNA 1YRXA 4Y2IA 2LQ9A 2OD4A 2RILA 3FMBA 2ASYA 5B0DA 2BUNA 1OPZA 1YJRA 3BN7A 1N5QA 2KKHA 2KT3A 3KNGA 1Y0HA 2AJ0A 5A6WA 1CC7A 1Q8LA 1X7VA 1N5SA 2LXFA 4ZOSA 1TUVA 3I9ZA 3HFKA 2GCFA 4NL5A 2VV5A 4HH1A 2GGPB 3QMQA 4EFAC 4OJHA 1APSA 2CRLA 5F0UA 4QOTA 1N5VA 2K2PA 4Y2MA 1OQ6A 2N4DA 3HHLB 2Q3PA 3IWXA 1Y3JA 3UDCA 3CJKA 5B0GA 4HI1A 2AJ1A 1V3ZA 2HLTA 2EW9A 2K1RB 2QIFA 3TOQA 1FVSA 1TL5A 1FEEA 3QGPA 3K7RA 2XMUA 4FNIA 1P6TA 4A4JA 3BM7A 1U7LA 4YEAA 1YG0A 5B0FA 2N7YA 2FIUA 5B0EA 2HIQA 2VH7A 3KG1A 2K7KA 2K7JA 4U9RA 5B0CA 4Q2MA 2OKQA 2GV1A 1LQ9A 3LO3A 1S6UA 2HQIA 3BGUA 5B0BA 1JWWA 1N5TA 1R6YA 3KKFA 2OP5A 1GXTA 2RMLA 1AFIA 1Q53A 1YJUA 2AP6A 1IUJA 1ULRA 2HFNA 2IYIA 2LDIA 3BB5A 4FNHA 5A6PA 2W4DA 4HL9A 2XMMA 1AW0A 1RJJA 2QLXA 3FRYA 2FHMA 2N4CA 4Q2LA 1FVQA 2GO8A 2G9OA 2L3MA 2KT2A 3DCAA 2FTRA
chains in the Genus database with same CATH superfamily
4RJVA 3BH6B 1TK5A 4WFNQ 2D7SA 1MMLA 1GQEA 5H1SV 4P9SA 2BJDA 1NLKL 2DK2A 2XLJA 1CJTA 1YI2S 1K0VA 1EETA 4C8NA 4DLEA 2W9CB 3GQCA 1PCAA 1E6YB 3DM2A 1YZ6A 2ROEA 2R2UA 1F0XA 3TAQA 1RB0A 1B7YB 1D0EA 4JV5J 4WFZA 1VBZA 5HATA 4I68A 1T02A 3S01A 1TKXA 4J90A 1TUWA 2ZH6A 1HW9A 3BGOP 5DGAA 4DS4A 3JSRA 5A8RA 4NLWA 1N32F 2CQPA 4FYVB 5K20B 1W26A 1S0NA 2R8GA 2H48B 3T19A 1VQ8S 1XMQF 3ZFVA 1H2TZ 3SDEB 4DL6A 2CDRB 3NY0A 2YNFA 1FWPA 2MJUA 4OYPA 1QAIA 2VFUA 3MF5A 1S1WB 3GCWP 1RAFB 4N56A 1N0VC 3S6EA 3ILIA 1VRTA 3I9V9 1VJQA 3OFEA 4M5GA 2Z2MA 4OHWA 1JK9B 4MTPA 2CQ0A 1LW2A 2OSQA 2MJNA 4ZS6A 5D3GB 1KN6A 3SMZA 4KC5A 2R4FA 2G0JA 2XGQA 4DU8A 2LDYA 2HPUA 1Q4RA 3D7SB 1F2GA 3TEHB 5KFBA 3CD0A 2PSZA 5KFPA 1CSJA 4O23A 4LFBF 2LEAA 4GC6A 2GQQA 3K5LA 5BYQA 2HAFA 4DS5A 2P9GA 5I42B 4RLEA 3PRBA 3ETOA 2I8EA 3E01B 1U1RA 4HYKA 3OVBA 4ZLJA 1L3SA 1P6TA 3P96A 3NG8A 2YY3A 2P6TA 2QL9B 3BO4A 4J9PA 2EKYA 3LO3A 1YQHA 1SJRA 4LF7J 4NRUA 1DZ5A 2W8KA 3GMGA 1JQGA 1QAJA 2DNRA 4H4OB 2PEBA 4AL6A 4DFJA 1RAJA 4DV2J 2RRNA 1GXUA 1SC6A 4ZPCA 4LR9A 2J7UA 3GG1A 1U47A 2DD8S 1RBLA 1BQMB 3W5ZA 5F0WA 4F4ZA 4A46A 3R2DJ 3P3DA 3RBDA 3ILOA 2C3YA 4Y65A 1MLAA 1UMJA 3C6UB 2KFNA 4KPCA 5A0YB 4Y6IA 3HFVA 2SXLA 4JI0F 1VRUA 1HD0A 1RKJA 4DR5J 1GTEA 4J9OA 1S1WA 1I5OB 1XK8A 3W66A 1Q0NA 3MMJA 2ZVIA 1WWHA 2YPYA 3PX4A 1V3SA 4J9UE 2I38A 3A3OB 3B6BA 1V5VA 2JFKA 5D3GA 3IAS9 3OXFA 2HFUA 4OV1A 1NO8A 5JUMA 2EFQA 5FLXY 3ELHA 5JJBA 2DNLA 4EBDA 1NMEB 2J0WA 4DR4F 5ETKA 2OFHX 4A8FA 1FFSB 4YS2A 1PBUA 1KFSA 1F1BB 3U7JA 1X0FA 4PAAA 4O44B 5D4LA 2AHOB 2J8SA 2QE5A 2W9BB 5I42A 3NCRA 4CH1A 1XN9A 3M6XA 2UUBJ 1RAAB 4ECUA 1T7PA 4HT7A 4RBVA 1SKWA 2CQBA 2G2OA 3CCJS 3MXHP 4DUTA 3CCZA 2J7WA 3R8YA 3ZZUA 3ZNUA 1FD8A 1Q8IA 2V67A 2RILA 5F3ZA 4LSNB 5KFXA 3M8QB 1NXIA 1X7VA 4K0KJ 4LQ3A 3PDNA 4ZJOA 3QMQA 2MQOA 2BEFA 2R9LA 1EQ0A 3UVJA 4NRTA 4X4UA 2W2PP 2HWTA 2APOA 3C6UA 1FTRA 3RYLA 3MGJA 1S6PB 3T1AA 5A0YA 2CQGA 2LDIA 1YRUA 1NK5A 3H42A 5EX3A 4OYAA 4QWCA 1GMWD 4YQWA 3VQSA 2CVIA 2DNMA 1HD1A 4I0WA 2A10A 5ETNA 5C25B 2MZQA 1UA1A 2KM8C 1URRA 5DZ7A 2BJ7A 2BJ1A 4RU9A 1B3TA 5J1NA 5IWAJ 1WF1A 3C6TB 2X7IA 4PEOA 3O8WA 3IM9A 3AA9A 3D0HE 4ZLPA 3BBBA 4TU7A 2KJWA 4DX7A 2AZ3A 4USJC 2NZCA 2RB7A 1IXKA 1HNWF 3RRKA 3K8VA 1Y11A 5LXYA 3MWBA 1HW8A 2DGVA 2ZITA 1HI1A 4A8WA 2EK1A 3MUMP 2R2TA 1UVIA 3CGIA 2R8KA 1C0UB 3SIPB 1YJUA 3ADAC 1KQFB 5HI7A 4DFPA 4PQAA 3MOJB 4AQYF 3D68A 8ATCB 2DPIA 4PUOB 1WJ9A 2PD1A 5F9NA 4KKOB 2B9EA 3M8QA 2GMHA 4LVOP 2EFVA 4BLGA 3D28A 5FD1A 1TMMA 3GFHA 4XDCA 1MG7A 1WEXA 3GZ7A 2ZZMA 3PRDA 5A8WB 4NCAA 3AOCA 2FJWA 4ZA1A 4G6VB 3S8SA 3DDIA 3IN5A 2L9WA 2WTFA 3RB3A 1JKHB 2A2CA 1SC4B 2Z4PA 3BGRB 2V94A 3C15B 5SUHA 4N47A 4AFFA 1CS4B 1FCAA 3CD6S 3T5LA 4F50A 1YGYA 1WG4A 1DARA 4KHPF 3GTYX 2VV5A 2AGOA 4OJHA 3TUPA 1WSRA 3NGRA 2NXCA 3UR0A 2FDNA 4A8QA 1VC6A 3C6TA 4RUAA 4GKKJ 2IAJB 1G4CA 5HP1B 1IUJA 3PRVA 3OL8A 2UV8A 1NJWA 2DR5A 4C8KA 2GO8A 3OR2A 5E5NA 5CZVA 1LEOA 5KT5A 4ZVFA 3BR9A 3G6ES 4OJ3A 4ZVGA 2YKQA 2XZDB 4NCGB 2CYYA 1Q8BA 1KQSR 2CQDA 2L08A 3DOKA 1C0UA 1U26A 3C19A 1H98A 4DL5A 3OUYB 4ZVHA 4P74A 2VB6A 3ZTPA 1N56A 3RRGA 1IQTA 4C48A 2QL7B 4YDXA 1RUSA 1H7XA 4G65A 4MAKA 2MSSA 5HMXA 2HNYB 1U6BA 4PUOA 4QU7A 3FMBA 3C16B 3BJYA 2C28A 3NBPB 2KFYA 3LP2B 2E5HA 1S9GB 5EHHA 1KTVA 3EGWB 3OL6A 1HIYA 4X65J 3UDEA 2V4QA 2BE2B 5E3RA 2MHEA 2U1AA 3KDNA 1DBDA 2VH7A 4FBUA 1S99A 1FRKA 1SQFA 3HCXA 4ES2A 2DR7A 4WBFA 2DB1A 2CWKA 1JKHA 1N32J 5D77A 4FN5A 3ZC4A 3VZHA 2CADA 2XS7A 3BGRA 1QAYA 1XMQJ 5F8NA 2ADCA 2XO7A 3GV7B 1QVGR 2ROPA 4ZP8A 4OZLA 4I2QB 3A8KA 4Y2KA 1OYEA 4ZJQA 4B9VA 5HP1A 2JH3A 4MFBB 2DO4A 1HWLA 1K1QA 3W5YA 4CO5A 5D4NA 1SKUB 3OL9A 1SXLA 2M9KA 1KDNA 4TN2A 4FKXA 1AZSB 1FXDA 1VHIA 4J9LA 2IMWP 2QA4S 1NSPA 2LYVA 1NK7A 5KFJA 3OVSA 4WKYA 3OLAA 3R6GB 3HI9A 2K1RB 3RW7A 1K47A 2DY9A 5ETQA 3DOLB 3LQVA 4LFBJ 2NYHA 3TQ1A 1HNZF 4YP3A 2Z56B 2IJRA 2BV3A 1GFWB 2HNYA 2HQ3A 2MQ8A 3D0IE 2I5JB 2WW4A 3R5JB 2R8IA 3RRHA 1L5UA 1ACMB 4DDFA 3PNIA 1UFKA 3GSDA 3D66A 2FB0A 3LP2A 4TVAB 3PR4A 3EVWA 2OSRA 2H5EA 1VQMS 3MM6A 1ZA1B 5E3CA 3SSQA 5AXNA 4DV0J 4FXDA 1NKBA 1D8YA 2XQCA 3M9OB 1IKWB 4DR3F 1OPZA 4F4XA 1LXJA 4MH8A 4X4RA 3HMJG 2LXFA 1VQ6S 2CNLB 2HVDA 3J81j 3NMRA 2XULA 3KUEA 4JI0J 2HVIA 2G4BA 4CM2A 2OO4A 4I2QA 2I1RA 1PJ7A 1CQMA 2DGUA 1MN9A 5LM7E 1ULRA 3CMQA 2DH9A 3ZZ0A 1HMVA 1QLNA 2W7AA 4Q7AA 2R7UA 3BBFA 3OTEA 4DI6A 4OV6A 3QT7A 2VF3A 1PJ5A 2XCPA 1SKSA 1FE0A 1VOMA 3K5PA 5EWGA 2VHGA 1S1VA 5CCMA 3CULA 2AF6A 3PHEA 3W64A 3R1LA 2B43A 2VJUA 4A8YA 2CUYA 2F9DA 3HO1A 4DR4J 1W2BR 4HVZA 1M5HA 2IY5B 2PMWA 2QA1A 1HQ2A 2LQ8A 3BPDA 2PI5A 1G7CB 2W2MP 3QJLA 2I5JA 3FDSA 1Q86T 1GK8A 2CVEA 3EYZA 5GMKa 1NM2A 4F3QA 3GU0A 3UN3A 1C0TB 2RE1A 2RUGA 3ZTOA 1FKOB 1F9EB 2HGMA 2QT7A 4I7FB 2RH3A 2JSXA 1FDDA 1TL7B 2D3ZA 4Y2MA 1RWNB 2BZ2A 4PG6A 2BX6A 3ZZYA 2R2SA 3MM7B 2BA9A 5D8HB 4B02A 4UOGA 1FDBA 1AW0A 1PAEX 1PO6A 4BDPA 2AKWB 3H20A 2ZEJA 1FESA 1IKWA 4UW2A 2FVPA 1A7GE 2B4OA 3Q89A 3EICA 2XZTB 3CCWA 2XNRA 4M5LA 3DFEA 3F56A 2WSCC 4DN0A 3CVKA 4OI6A 4LR7A 3I6PA 3HHNB 1FJEB 1JLFB 3DKDA 1VQ7S 2ILYA 3DU5A 2C2EA 1QE1B 4NEZA 4JB8B 2IMOA 1TELA 2RHQB 3D67A 2WBRA 1VR6A 3FBBA 1OO0B 2J9DE 1TVRB 1T94A 2G1HA 3D1OA 2DNHA 2YXLA 5DQIA 2E7VA 3MEGB 2VA3A 3SXLA 2B4PA 2AYBA 2VFRA 3PM9A 1N88A 5A8KB 1GX6A 5SZTA 2KZMA 1RWOB 5CQGA 4B9SA 4DSKA 3KHRA 2CQCA 1HNWJ 4H54A 1JJ4A 1WHVA 2GV1A 4C3KA 2R7QA 1NBEB 1ITPA 2A6MA 1NKCA 1RWMB 3DHWC 1OQ3A 1WF0A 1I94F 4X4NA 2GA7A 3PKMA 1FKOA 3RBEA 3MM8B 1CPZA 4XAKA 5EX0A 4B3MF 1NDPA 1TL7A 1I51B 4P75A 2RVJA 4ALZA 1KVJA 4C9DA 1RAHB 3MR6A 3MM7A 2FHKA 1VQYA 4QCLA 4K2JA 3GYNA 4IYQA 1NPKA 3EDQB 1SC1B 4HHJA 4IOBA 1J5OB 3N79A 1IWAA 1J5EF 3POTA 4C8LA 2CPJA 3TVZA 3GIKA 3TJAA 3OV7A 4OI4A 5KFEA 1UA0A 3H0PA 1U1LA 3NAHA 4FS1A 1HWJA 4U9RA 5DG8A 1HYSB 2KI2A 5C42B 1QE1A 2A2DA 1X60A 5KT4A 1F6TA 2KH9A 2KHDA 1RTIB 4NI2A 2QLJB 4LRDA 1X31C 2AJQA 4LBPA 4PYDA 4WIIA 3MEGA 4WF9Q 1SH3A 5H9EK 2OFGX 4MKYA 1PC5A 1O5JA 5A8KA 3V4IB 3MTKA 2FY1A 1N6QB 1BGXT 2GHVC 2GFFA 4IR9A 1K1SA 4BBYA 1CC8A 2D69A 4LQ9A 3ILJA 4O3OA 2JJ4D 2GX8A 1RISA 2LQ5A 3CC7S 2UU9F 4QR2A 1SV5B 4EK2A 4C0OC 4Q44A 3V2UC 2GQCA 4DFMA 3TZXA 3KUHA 1IBLF 2KN4A 1S48A 3H2LA 2KKHA 3M32B 2DTJA 2AQ4A 1HA1A 6FDRA 1FWLA 5HBMB 1HNXF 1J27A 1LNQA 3VAIA 3KJNB 1JJCB 2QIFA 2FUG9 5KT3A 3EGNA 4MIAA 2WVDA 2OKQA 1OJ4A 2F8HA 4HEA9 3TA0A 3BV8A 1YBAA 4DQQA 2V5HG 1XR7A 1UEUA 4P2MA 3EDRB 4DV3F 1Y7PA 1PC4A 1QDUB 3AJ1A 1IM4A 3SSSA 3LWLA 5J2NB 2XI2A 2QO3A 1XIQA 5I3UA 3TJ8A 4LSLB 5JMNA 2MY7A 3UE2A 1T0TV 2BXJA 2O1PA 3KK2B 2Z58B 3N6LA 3M2VB 4QWBA 2VL1A 3RAMA 4NPOA 3IWLA 2Y1RI 2LFVA 2PDAA 5DRKA 4QBUA 4X4PA 2ZDPA 1HYSA 1MU2B 1L3KA 3HKZD 3PYEA 4QIGA 3EPGA 1WD6A 2GNKA 5KG6A 5CYMB 3NCPA 4IRKA 3GG0A 5B0AA 5KG3A 5HQ8A 3PW7A 5HMWA 1UEKA 2JWNA 2IA0A 5KG2A 3EM1A 3LA0A 8RUCA 3G86A 1M1KT 2HRUA 4CH0S 4QIWD 1F9FA 4D3GA 4NLGA 4LFCF 1P9QC 4DQIA 1R27B 4DBQA 2CJYB 3NGUA 1N6QA 3FCVA 2ZC4A 1O0PA 1IJEB 2F63A 2HQCA 3ONQA 3FQLA 1JLBB 2RNEA 3QNWB 4B9TA 4DQRA 4KGKA 1HR0F 2LEPA 2KO1A 1SV5A 2NXJA 2L3MA 4ZVUB 4OI2A 4DN9A 2XY7A 1OSCA 3W8PA 3GJTB 4FPIA 1RCXB 3W9JA 5C24A 3WC2A 1HNZJ 3WDOA 1WHWA 1MROB 3QSIA 1GMWA 4IFYA 6AT1B 2OPRA 2VG5A 3HSZA 2N7CA 1WKLA 2ZKUA 4IO1A 3EUNA 3R5GA 5F8LA 3X1LB 3ZZOA 1D09B 2ZH5A 3QT8A 4MYUA 2B7BB 5ETSA 4YB7A 2GJIA 2FHJD 4LSLA 2CPEA 1S49A 2HS0A 4M5MA 4LIWA 3M2VA 4G1IA 4ICLB 3LWMA 5C2CA 4JBCA 1UVLA 3BKFA 4QYZJ 1N5YA 1U1QA 1R0BG 3QLHB 3MD3A 1RU2A 4DR3J 3RUBL 1WDTA 4ZIWA 3DRPB 2XY6A 3BB5A 5CYMA 5A6PA 4ZVRB 4IG0A 3HP6A 4ED8A 5CYJA 3RJMB 1T9TA 3NP5A 3THPA 3ZZPA 5GAHI 1JLEB 4C8YA 1UFLA 2JZ5A 3GILA 2PGCA 2ZOMA 3GB0A 5DLFA 1X8DA 1SVDA 1S9EB 3K5NA 2C22A 2IVYA 2ZBRA 3W60A 4IDKB 5AE2A 1Y4ZB 4L75A 3FZBA 3RBZA 5LSLA 3CMAS 2N3OA 3FSIA 3MR7A 2YX4A 2ZH9A 3BKTA 3LGMA 3PO5A 2RQCA 4NE9C 2HYIB 3BN7A 4LF5F 1SIZA 2HVHA 2ZBCA 4PXEA 3DRRB 3VQTA 4DPXA 3RAXA 3GIRA 2ZKTA 3BO3A 5B0GA 3AQPA 3NGKA 1H38A 5B0FA 1FJCA 2K3KA 3DLBA 3MD1A 2ZFHA 4NLOA 1E6VA 1S1TA 5KFHA 1VCTA 4QU6A 2W4DA 1JIHA 2H51B 1GH8A 1TL3A 2VQEF 3UD4P 3TA1A 1T03B 2KJVA 4NLUA 1KLMB 3FGVA 4KT0C 5J1EB 3AFGA 2MGZB 1X4CA 2YKMB 4ICLA 2AV5A 5KFRA 4L6V3 1FF2A 3RR7A 2VU5A 1O8BA 3D4JA 1FRXA 2XYPB 5DDOC 2B6AB 1WOPA 2M8HA 2DGWA 3M8PB 3K58A 1S6QA 3DRPA 1RTDB 1FA0A 2V2KA 4B3SF 2V4JB 1JXVA 3PTWA 4TY8B 2AX0A 3W2VA 5ETMA 3HX9A 4C0HA 1YRTA 2GZOA 3VAHA 3TQEA 1VYAA 1JLEA 1R8PA 5HO4A 2Y3YA 5D6GA 4B9NA 2NSCA 1QTNB 2ZOGA 2XC9A 4R8UB 2F4VF 5GADU 4M8LA 1AXQA 1SL2A 5H9FK 2K06A 1RDRA 3HHLB 3TX8A 5DDRC 2VOPA 2AJ1A 2XMUA 1LXNA 2NXEA 3G8TA 2QG9B 2NXUA 4OYBA 2RS2A 3S7RA 1RLDA 3DYAB 4KSEB 4FS2A 3FC9A 4OI1A 4C3MA 3M1VB 2XYHB 4UOFA 1S0OA 4DR1F 3HT3A 3UPFA 2VBXA 5KFKA 1RT2B 3MMAB 1RWKB 1DRZA 5HJXA 2FVRA 2NLWA 3JYTB 1YWXA 3EX7B 4IO9Q 1RBOB 4OZJA 4EYHB 1H2UX 2AYGA 5T7LB 4MKAA 2PN6A 3A1YG 1I94J 1YKWA 1TFYA 3FJ2A 4YB6A 4PQUB 3BQ0A 4OI0A 4NA1A 2RSQA 3DRXA 1GXLA 4B3MJ 2L41A 2CG4A 4FXWA 1N36F 1BQXA 4NLYA 1SJ4P 4NLDA 5HROB 2F9JA 4J91A 2QA2A 3I31A 3J80U 5F0UA 5KFGA 3ZZTA 3EXYA 3T1YJ 1FEEA 4K4YA 3M8PA 2VQFF 1Q7LB 3MPVA 1X9SA 1EKSA 4TXSA 1J5EJ 1F9HA 4CLPA 3TARA 4GMKA 2R7WA 2KFZA 2V4JA 2RF2B 2BR0A 1N4LA 3CJ5A 1YJ7A 1QSSA 1QSLA 3OLBA 3I5AA 1QSYA 3MUTP 4U67Q 1XMBA 1S1XB 5IT9Y 3GIIA 3IRXB 1YDLA 3L95X 2LU2A 4KPYA 2BKPA 5A76A 2B9XA 2HS4A 4ZITA 2L48A 2VPZB 3NWGA 4X84A 3VR1A 4USMA 1FKAF 2EVZA 2ZNYA 3P6YC 4LF6F 4B3TF 2FZKB 3CO0P 4F4KA 3MR5A 3HSJA 3R5BA 4ZN3A 3FFIB 2UXDF 3ET6B 3M1VA 4K4XA 3MEDA 5L1KA 4Y2IA 1ZZNA 1PYOB 2ATCB 3EGZA 4KQZA 5HVFA 1RT2A 3MMAA 2UZAA 2GCFA 4IFVA 4ZCIA 4DUYF 4HH1A 3CDEA 3Q86A 3JYTA 4L72B 4CO4A 2IBKA 4P2FA 2UU9J 3C8YA 1NB7A 1X4AA 2E9RX 2NZ4A 1S7HA 1GXTA 4PYAA 1KC8T 1MN7A 4ZP7A 2HKEA 2IJFA 3AD8C 1F5AA 3G82B 2CA9A 4KO0B 5A2QY 1P9YA 1XBWA 1OY9A 2NREA 2V6AA 3DXSX 3DMJB 1HI0P 3D6TB 1SIWB 3KXDA 5KFSA 3NS7B 5G0RB 1VHFA 1U8SA 1U1NA 2F8MA 2ZBPA 2AT1B 3M2RB 2MLXA 5IXUA 5IQ6A 2J0QD 5I3PA 2HEKA 2VDHA 1UVNA 4I2PB 4GVLA 4KGXB 3VHQA 4BWJA 1SUQB 1Q5VA 1S1XA 2RDJA 4J5OA 3NS6A 3IRXA 1LWXA 4LF9F 1TUVA 1G2EA 2VA2A 2E5LF 5F9LA 5BXIA 4CLSA 1NRKA 2BOAA 3AH6A 3BYPA 2FVSA 4O3QA 3BGLA 3QSYB 1N34F 4NXNF 2MKSA 4F36A 1R6YA 3QQCD 1VQ9S 3TVKA 1X4HA 3DGVA 2B3TB 5K8NA 1JLQA 4DQPA 2RJZA 4CTAA 3FFIA 4LFCJ 5KFYA 2BANA 5BR8F 2IDLA 1FKPA 1OPIA 3SV4A 1K9MT 4V19X 1IKVB 1KRPA 1KLNA 5HMZA 2ZH2A 4PWDA 4Q45A 1W7WA 1Y3KA 2KVQE 3J7AN 4A47A 2LXUA 2HLUA 3T3FA 2BACA 2J8AA 2FJBB 4MKBA 1C1BA 1ZM4A 2UVVA 3RR8A 3DGPB 2DBBA 3GIMA 4MIBA 3UN5A 3I5BA 2O67A 5GMDA 2DHHA 1IBMF 3J81Y 1XR5A 4M95A 3IC1A 2C2NA 1Q78A 1N5QA 4KR0B 2QYGA 3CIMA 1Y0HA 2YWFA 2AIRB 3BQ2A 1RHUB 2H65B 1ZTTA 5G0RA 4N77A 1Q8KA 4ECRA 1Q7YT 2DR9A 2A1BA 3B8HA 4OFZA 2VDIA 3M2RA 1VGYA 1YG0A 1S10A 5J2QB 4OZ0A 2DRAA 4R5PA 2EPIA 4Y0FA 5ETLA 4WK1A 1NCLA 4I2PA 1HFEL 4A8XA 4F4YA 1T05B 2CNOB 4JI8J 5DZ6A 3NEKA 4EZ6A 2B0GA 2RRBA 2GS8A 4IRCA 1IBKF 4CIOA 3CXCR 3ITHA 3HVTA 3KJVB 4USHA 4QIFA 4P6QA 1TL1A 3A3NB 5IZHA 2MZSA 2V2QA 1WHYA 4ID8A 2IM3A 2JRSA 2HBZB 4AXIA 4W90B 1NU4A 4EWTA 5GMEA 4WWSA 1RWXB 2ZH4A 4QW8A 2XM3A 3BR8A 2ATLA 2VBZA 5KFZA 3VAJA 4ZVEA 2F4FA 3VAKA 3IBWA 5G4DA 5ITHA 4LRCA 2DNGA 3L4BC 3BN4A 4DPWA 4TQRA 4P73A 3M6VA 4DCJB 1IKVA 2HHPA 5KG1A 2J0SD 4NLPA 3RW6A 3T9ZA 1OMSA 2C2OB 1JLCA 4NYOA 3D54A 3W9HA 4XPEA 4DJBA 1GAOA 2ZHOA 2J7KA 2F1FA 3DGPA 3ZNJ1 3MPDA 3FEZA 4MIWA 5IQQA 2PE8A 4B17A 5HVGA 4K50A 3MR2A 2XBPA 3CSKA 3QGGA 4ED0A 2HHHF 4DV4F 2B9YA 2HFZA 3E8OA 2ZE2B 1KOOA 4F26A 2H5JB 1HBOA 3AJDA 1XEZA 4CRJA 2HAIA 1WUUA 2VFVA 4WKRA 1DQ8A 2VQEJ 2OHDA 3LH2S 4KYZA 1TMJA 2H4YB 4YR2A 2W2QP 1REVB 2UVRA 3T6BA 3LW5C 2POKA 3CC2S 4HKQA 1X9MA 4FYDA 1TV6B 5K5MA 1XMOJ 4N8OA 2LQ9A 4NA2A 3R5CA 1HNIB 1SQGA 3UD5A 5L46A 3LP1B 3CCLS 3BSOA 3PW4A 4EFAC 1APSA 4MMOA 3TJ9A 3GV8B 2UXBJ 2HLTA 3NAIA 2W2OP 3H2UB 2PMZD 3KG1A 3N5FA 4C8MA 3CPWR 1KHWA 5E33A 2AP6A 1ZBTA 1SJQA 4I6YA 3UDVA 1IR2A 4ZCMA 4LF4F 1TKTA 4LF8J 4MKVA 3M8RA 4A8OA 2ZZNA 2Z2YB 4HTIA 2KZZA 1U45A 2OEJA 3LGHA 2W2NP 4MT1A 1AFJA 3HD2A 1T11A 2W9AA 3G9CA 3IBFB 4DR1J 3QZ7A 2BBEA 1R0AA 1ZETA 1YJVA 4DQSA 2CJ9A 3A12A 2AJ2A 4WIQA 4DR2F 5E41A 2JLGA 4GVBB 4ZCKA 4ZOSA 3PVXA 3DRSB 1BUXA 2ZE2A 1Z1ZA 2HWHA 3DN9A 2HBQB 2UUWA 1RYRA 2DNOA 4JI6F 1BWVA 4HACB 4KTQA 5B0EA 3QATA 4KRWA 3BZQA 1N5TA 4B3OB 1N36J 1REVA 1T3NA 3CCVS 5D4PA 3KLHA 3G8SA 4DCOB 1W2IA 3ZZZA 1R6VA 1HNIA 4I64A 3LP1A 3CDWA 4P7VA 2Q1LA 2VQFJ 4M5HA 2HHUA 4CLZA 4F02A 3CB4A 3MFIA 2MKCA 5KFUA 5B08A 3G6XA 1WC4A 4F0KA 3OBIA 3C14B 3QJPA 2EFNA 3TAMA 4OZ3A 2EFPA 2XCAA 2HK2A 1H0HB 1Y9OA 4E2FB 4JI1F 1RQ0A 2MYFA 1FJGF 4LRBA 9ATCB 2UUCF 2Q6BA 4B3TJ 2G2ZA 2WVEA 4QOTA 1Y3JA 3EZ5A 1RTHA 2YNHB 1RGVA 2EW9A 1HBUB 1FI4A 3QGPA 5F8IA 3W2WB 2R8HA 2EEYA 5J2PB 2K7JA 5HQMA 1IR1A 4PR6A 3KKFA 1GTHA 3LUYA 3H2VE 4WK3A 4RR5A 4F3MA 3O1LA 1C2PA 4QIEA 4DUYJ 1MNEA 4DX6A 4USWA 2ABYA 4Q2LA 2CPYA 1IVZA 4I6AA 1V6HA 5K8MA 4JV2A 1CULB 5AXMA 3H4BA 4OZ2A 2HURA 2FQQB 2FVCA 1TL4A 4RW4B 3RZAA 3I0RA 1T9UA 3CJ0A 1VLYA 3GPAA 2FY8A 4HACA 1FTCA 3CTRA 2V2VA 3VAFA 4ECWA 4PG5A 2P5VA 1CJTB 3ZZRA 3FRZA 2EC0A 1UTAA 4KB7A 4DSIA 5C7PA 4DFKA 4DMZA 2CAJA 4F8RA 3PYGA 1S97A 1VQLS 5DLGA 2IPOB 1HKAA 1U6FA 4PG4A 4O3PA 1U0HA 4FYWB 2A3JA 3TOQA 5D78A 2O66A 1TKXB 3DLGA 3K2YA 3FBCA 4U6PA 3C14A 3MMBB 3ZTRA 2CPHA 2R42A 5A8RB 4LF9J 2E5LJ 5KTQA 4RW8B 1RE1B 1U0SA 3B4DA 5FJ4A 2E5GA 1NK6A 5EWFA 1V5IB 4NXNJ 3SQGB 2COLA 3UNGC 2IFXA 2DNQA 4ES1A 2MQMA 1HBUA 3MAQA 4WE1A 2Q6CA 3W2WA 4GC7A 5D15A 2WZ1A 5J2PA 1OIAA 4ECXA 4UUWA 2OPSA 3HHDA 4YB1P 3ZXWA 1LW2B 1FNMA 4ZPVR 2RU9A 3QAUA 3JSBA 4CT9A 1NJXA 3HSGA 1QUVA 2KTQA 1CJVB 1VQPS 1CULA 5U47A 2LECA 1HBNB 4YUDA 4RW4A 4WXOA 2HWIA 4RZRA 4GO5X 4DX8H 1LK7A 4A4JA 2ALYB 1IBMJ 3O2IA 4UZCA 1JNZB 1FK9A 3TEGA 2RMLA 4JYAF 3I56S 4RU2A 1S0VA 2QLXA 4EI2A 4GKJF 2YTCA 5LMNF 1EB0A 4KIAA 1WC0A 2CQ4A 3DU6A 3OQ2A 4DUZF 4P71A 2YWKA 4S0MA 4DV7F 3K59A 2NCKL 2FYXA 3JQJA 3MMBA 1M5KC 1KEKA 4DG1A 2W4CA 3ZTQA 5M2RA 4X66F 1IBKJ 2D41A 4KBIA 2ZWOA 3JSYA 2F7VA 1RSCA 4RW8A 1HQEB 3SSRA 1S76D 4P2SA 4DOZA 4X62F 3SQGA 2I2YA 1VRUB 4R0EA 3KJFB 1T9WA 2ZUAA 1A0OB 3K7RA 2LQJA 3L7OA 3OTDA 1XERA 1S6UA 1RZMA 3JQKA 4IRDA 4O0NA 2WCXA 1PSDA 3FMWA 2XSFA 2KVIA 4OZ5A 1XWLA 2UUTA 1CJVA 3EJMA 1HBNA 1P1LA 3GCXP 2NPIA 3R27A 3LALA 4H4KC 2XMJA 4YY3F 4DU7A 1FXLA 4DF4A 2XY5A 2ZH7A 2HQFA 1DTTB 3P5TL 4J37A 4PG7A 3Q8RB 2HHHJ 4DV4J 1DHMA 4PKDB 2XLKA 1OY8A 3NL0A 3CF5Q 4L73A 3B82A 3OFHA 3JQMA 2GHWA 4X64F 1RT7A 2Z2LA 1N5SA 2BDPA 2KT5A 3IR5B 3GV5B 3HM9A 4Q0BB 3DRYA 2QEXS 3G87A 4HI1A 1H6KX 2VD3A 3CCES 4TYBA 1LW0B 3RG6A 2CJBA 1U49A 5C5JA 1VBKA 1TKZB 1BWEA 3OTBA 2QGFB 2HNZA 3UVJB 1WC3A 2UXCF 3JAMY 1HQEA 1PYTA 3MPWA 2FLPA 1VIOA 1FERA 2HQGA 4ZVQB 2DCUB 1FDAA 4YR3A 1X5SA 3DLJA 3NGTA 3U02A 4RBUA 4FF2A 2DY1A 4ZCLA 1NKEA 3ILLA 4LF4J 2WONA 4TKTA 1AT1B 4QPTA 1Q82T 2LA6A 2DEIA 1RT6B 3KNAA 1RHJB 3JTNA 4ZPBA 1ZAXA 5KG0A 2QV6A 3FQKA 3PYDA 3MURP 4JI7J 1LFPA 1WEZA 1C4CA 4NLQA 2BYCA 2JHEA 1PGZA 1RCOB 2DNNA 2ASJA 2HBYB 3WX4A 1XR6A 2JLEA 3OVAA 2WB1D 4EZ9A 1OYDA 3R5DA 2CQIA 3MECB 3MCOA 3TP2A 3HVAA 2V9KA 3BGFA 1DTTA 4DR2J 3DLLQ 3NGSA 1FFWB 4HT5A 3KG4A 4NEYA 4ILMA 1BQNA 3UQSA 2LA4A 2MQPA 4RKUC 3CMES 5AXLA 1K73T 1SPBP 3HK2A 2QTWA 4JI6J 3AOBA 3B4MA 2DNKA 1UVMA 3GYGA 1LOUA 3VWSA 5AJ3F 4E0DA 1BY9A 4Q0BA 2BW7A 2EFOA 4HHUA 4DL7A 4OQJA 2GQ2A 1LW0A 3I82A 2GJ2A 3CJ8A 5GADI 3BQ1A 3VVUA 4DSFA 1S0MA 1DLOB 1TKZA 1TQLA 2ZNZA 4K4SA 2DGXA 1YBUA 2XB2D 4NX9A 3W8GA 3QAEA 2OD4A 5B0DA 1RTJA 4CM0A 2WBMA 3BS9A 4I6WA 1CQNA 4NMXA 1N5VA 1WC5A 2QA4G 3X3UA 3RB6A 2LMIA 4JI1J 4PWUA 2I0XA 1RACB 3H25A 5HL7Q 4OYIA 1RT6A 2J0XA 3IAM9 3M8YA 4EO8A 2UUCJ 2YKNB 1S59A 1ZM3A 4LVNP 1BHNA 4Q5VA 2KYZA 1RK8A 4ZVSB 1R8CA 3IS9B 1GT8A 5HJYA 3M30B 4AXJA 3OTOF 4J9VA 2V68A 3RGIA 3MECA 3OR2B 3TYTA 3H7HB 1U1PA 2B5JA 3ENQA 3W7BA 3CCTA 3HFZB 3LP0B 3QWUA 2GVDA 1IKXB 2ZH8A 4DLGA 3D6FB 2VPWB 1D8ZA 1V3RA 5AE1A 3BYRA 5FLXU 3I4PA 3DOKB 1FWKA 3UCUP 2DIVA 4CWBA 2DR8A 1KKHA 2KB2A 2Y0BB 3UWTA 4FYXB 1X9WA 2MTLA 2N4DA 2OMLA 2CPIA 4ATNA 4C2MA 1ZOTA 3KLIA 4LMZA 1UL3A 4PXBA 4DR7F 4UF4A 2ZD1A 1DLOA 2QMWA 4WCEQ 1SC3B 4EU0A 5KFIA 5J1PA 2EK6A 4KY3A 1JXEA 1ZM9A 4RX6A 1YJ9S 3H40A 2M7SA 3LAMA 2FD2A 2CDQA 4QWEA 2LP4A 5DGBA 2RT3A 1WDDA 5BJRA 4J9MA 1AYEA 1A6LA 2DXFA 5E0OA 1RP5A 4ETXA 1WORA 3LF0A 3FK4A 4HH0A 2W1BA 1CJUB 3PEHA 3Q8PB 2YKNA 2A18A 3W9IA 4CI0B 2HFOA 1UPMB 2R7OA 3VVTA 3NNAA 3IS9A 1TAUA 8AT1B 3A8EA 2VICA 3M30A 4KFBA 2YVSA 1GX5A 3H59A 3OSNA 4OL8A 4IKAA 2DKOB 1YBTA 5DG7A 1ZAWA 2MQLA 3DNCA 5RUBA 1HBMA 1RBAA 4QZVB 3LP0A 5KFLA 2Y1IA 1IKXA 1H3DA 4U95A 3PW5A 1H7WA 1DFDA 3QT6A 4EBCA 1WOOA 4WTYA 2V2ZA 4P7TA 4DV1F 2HHSA 2AYEA 4JYAJ 1KD1T 1Q1KA 5HMYA 3PW0A 1Y5IB 2A0FB 3QGIA 4GKJJ 2VASA 4HI2A 5LMNJ 1G3OA 1XNQF 4DZ6A 2HQDA 4U96A 2ZHBA 4DUZJ 1G6BA 5K14A 3FSXA 3IFEA 4URGA 4DV7J 2R7SA 2ERRA 5MAOA 3MM6B 4F7VA 4U7UD 4N8NA 2VG7B 3K89A 2DR6A 4X66J 1TAQA 4F25A 1UW9A 3SFUA 4ZJLA 1FVSA 1RT1B 2MKYA 4CNZA 4KAIA 1CJUA 5DDQC 2MZJA 1HWUA 2VFSA 1KVKA 4P72A 1FJ7A 2YH0A 3AQOA 2J6SA 4JI4F 4BHQA 4ID5B 4DL4A 4CP5A 3RTVA 3L7UA 3TNVA 3AODA 2PMHA 1IKYA 2KRRA 1HMVB 1EKRA 2UUBF 3R6LB 2CJAA 1FFGB 4UY8T 4K4VA 3VGTA 2CQ3A 1F5CA 5L1JA 1WNEA 5LSRA 1YJWS 2CPDA 2ZJPQ 3I0SB 3E3XA 3G71S 4YFUA 4DHVA 4N7TA 1S1VB 3AA8A 4L74A 3Q8YA 4YY3J 2V9WA 2WOMA 3Q24A 4C98A 4NXMF 4JV0A 5LMUF 1U25A 1RXOB 2XHWA 4FZVA 4I69A 1F2HA 3SZ2A 1ROFA 2MLYA 5KFMA 2UVWA 4WTOB 4X64J 2YKPA 5KT6A 2W24A 3E51A 3JS9A 4OLOA 3WZ0A 2YKAA 3C46A 2CNKB 5T41A 3GONA 1FT8A 4P10A 1NNDA 2VG7A 1FHTA 2HHWA 4RW9B 5B09A 2JC0A 2ZDOA 2B7CB 1I6JA 2UXCJ 1RT1A 2EC2A 3AHPA 5GVQA 1KOHA 1Y10A 2B51A 5HSPA 3QGHA 3HT0A 2VONA 4ID5A 3BDEA 3PFEA 3G8QA 1Q79A 5AXKA 3I96A 5THWA 4E98A 2YPZA 1PILA 2F65A 4NZ7A 1YIJS 2EG1A 1KHVA 4KGVB 4K7QA 4FNIA 1TK0A 2RS8A 4I67A 3I0SA 4PABA 2FLLA 4M5NA 3CJQA 1YSJA 4CLFA 2BOPA 2F40A 3CCUS 3ULHA 1U09A 4CO3A 2KXFA 2X3GA 3CWJA 1HNVA 5DS7A 4ELVA 2P9CA 3MEEA 2D1CA 1UP1A 1SI9A 2GMJA 3NKYA 4WYLA 4H4KA 4ZPTR 1U24A 4LRFA 1SQEA 3FKBA 3VGUA 2BW2A 3H4DA 5K8PA 2WK4A 5AJ3J 5HVHA 2DHGA 1MMDA 1NSQA 2BJEA 4FKYA 4ES3A 2E7WA 1R8BA 5CYQB 3HFKA 2ZJQQ 4RW9A 4LFAF 1OQ6A 2ZJRQ 3KDOA 1U1KA 4GKKF 3POTB 5BYSA 3FBEA 2K7KA 3J7YI 2HZVA 5B0BA 2MY8A 1B0VA 4DV5F 1D9AA 2OI2A 3MR3A 2DT9A 2MEWA 1OS5A 3V81A 5M2UA 5HK4A 4FBTA 3D3BJ 2BMBA 3DLKA 5HAOA 4W98A 2KYXA 4BS2A 2VBWA 4F2SA 4LR8A 3CW2C 3HD1A 3K8WA 3PW2A 2IHR1 1PKUA 2QLWA 1FNOA 2XNQA 3NWRA 2BJ3A 4NI2B 1WI8A 4RL1A 3MI7X 3MHYA 2WSFC 2HGLA 3JSMA 1NH8A 5KFNA 2W7OA 2BM0A 2KM8B 3OTOJ 3HULA 2Z8QA 3CJTA 3L09A 4J9QA 5FDLB 4OZNA 2IBOA 1UVKA 4Z2XA 3OXGA 2BKNA 2Y1LB 1X4BA 4X65F 4QJVA 4DZDA 1B99A 2VBYA 1F3FA 2HRYA 1YJNS 1WKJA 4NZ6A 3AXMA 4V1Ak 4MJKA 5DO2A 3T6JA 1Q16B 1VLOA 2IVMA 4F4AA 4AQYJ 1HLWA 2C2RA 2I9SA 5CYQA 3AXKA 3MPUB 2HNDB 2QL5B 2JOQA 4DR7J 1VQKS 1LKZA 2XSJA 2J5AA 4U7UK 2IIHA 5IT0A 1IM6A 2NUUG 5I3UB 3D6HB 3QIDA 3RBXA 1RHQB 1FO1A 3KOAA 5ETOA 1N8RT 1U6ZA 4O4GA 3IWNC 2BRKA 4BCAA 2BJ8A 2B56A 3SCLE 2HG4A 3CC4S 3PV8A 1WHXA 3ZO7A 4OYZA 3BREA 2V63A 4Y34A 3MDFA 2WVBA 3IRWP 3WHIA 2YBVA 4Q43A 5CABA 1WC6A 4KHPJ 2CXEA 4OHVA 4UT4A 5IC6B 2YQ3A 2IC3B 5GAHU 2X1BA 2WW8A 3OT9A 1V3ZA 3BM7A 2MSTA 2QMUB 3LPYA 2PA3A 2WVFA 4Y28C 3D1QA 1EAYC 4ECYA 4JUZA 3VTIA 2IA6A 2IM1A 1YHQS 2W9CA 4R0JA 1E6YA 2HHTA 2FVQA 5FDLA 3TZZA 2HFVA 1ZZFA 2HHVA 2FGCA 5JVHQ 3WQPA 2V8GA 1TZ0A 3CE8A 1QTMA 2XTJP 2GVZB 1X5OA 2OD6A 2ALZA 3F44A 5ETVA 1WACA 3HPOA 2CQ2A 2E5IA 2MZ1A 4N76A 4DV0F 5C24B 4DV1J 3EPIA 2LLZA 2CG8A 3N01A 3UDLA 3AJ2A 1NK4A 2HW3A 4RWXA 3VAMA 3IG1B 4IFYB 2NXNA 3GE9A 3SDEA 3LTOA 1S12A 2KT3A 4FPRA 2OPRB 2VG5B 4EUVA 3I9ZA 2HNDA 1XNQJ 2PC6A 5BYRA 4KH1B 3U27A 2JX2A 2DGQA 4AD6A 2M4MA 3I4HX 2V34A 2D74B 3D0GE 3PR5B 4L3NA 1OWXA 3EGVA 2Z2ZA 2X1GA 3PG9A 2HFNA 3M8ZA 4IH6A 3NOGA 1N5YB 1UWBB 1HHQA 2N82B 1VMBA 2JL9A 1M0SA 3KK1B 5KOWA 4NCBA 1U1MA 2ACMA 3PXGa 3BF4A 1A9NB 4IG0B 2IC3A 5E3QA 4JI4J 1TKDA 3KTQA 3CJ4A 2XWXA 3IGNA 1Y00A 2MZTA 3N6MA 3DI6B 4NWBA 4B9LA 3BBCA 2FPHX 2WSEC 3CDUA 4ZPWR 2AMCB 2VPYB 2WAQD 2OTLS 3HDSA 2CZ4A 3E01A 4XDDA 4OHZA 3PIOQ 4Y3CA 4C3LA 5D4OA 4PZVA 1B0TA 3EXCX 2R3VA 1Z4UA 3A4TA 4RNOA 1TP7A 2GVZA 2FGOA 3UO0A 5IM0B 4H4OA 1UJ6A 3K5MA 2BQ3A 2QN6B 4V19J 3Q8VA 2DNPA 2ZH3A 1RA6A 2DGTA 5HQLA 1M5OC 4NXMJ 2XZWA 2IYIA 4G1PA 4KGMA 4ZKAA 1BQMA 5LMUJ 1LV5A 5HN0A 5L1LA 3IG1A 4M5KA 4L76A 1JXLA 5DETA 2HVZA 4UOCA 3IA0A 1UCNA 5E3AA 4FF4A 1E6VB 1S1TB 2VJVA 2YQ1A 4C8ZA 1TL3B 2JEJA 3PCOB 2XS2A 4UQGA 1VI7A 2MMYA 2W8LA 3T9NA 2ASLA 2GJFA 2HGNA 4X4QA 2H9ZA 2H54B 3N9UC 5KFAA 1RLCL 1KONA 5KOXA 1UWBA 4QWAA 2EWHA 1S6QB 3KK1A 1CC7A 4ZLLA 1EX8A 5CCLA 3PEJA 1R31A 2ZOFA 2CNNB 4WFXA 2G2YA 4DR6F 4DX5A 4ELUA 3IWXA 2RDDA 3W2VB 4HHHA 3J7ZT 5EWEA 3G6VA 3CCMS 1F3VA 1RAOA 2UUAF 4O44A 3DI6A 1YITS 4RNNA 1D3WA 2KXHA 2AYMA 1W25A 2W9BA 2D3OR 1NJYA 3PO4A 2V8HA 1ZH5A 2YNGB 1WTFA 2KT2A 3DCAA 1M5PC 3U1LA 3AOAA 5LXRA 4CNYA 3UNYA 3SQOP 3HVRA 2MKKA 3NRBA 2ZVSA 4NZ0A 5KFVA 5IM0A 4X4OA 1UKUA 2XMTA 3N4WA 3K0JA 2DO0A 4LSNA 1TR0A 1HQUB 1KQGB 1L3VA 1RI7A 2YWGA 4OX7A 4F4WA 2OIHA 2HIYA 1T9VA 2RQ4A 1T8EA 2CJKA 2BVZA 5ETTA 1AUSL 3MMCB 3QWPA 3NNCA 1YRXA 4OLPA 1RU1A 1S4FA 1S6PA 1VQ5S 3VALA 3WC0A 3NCQA 2MKHA 3D6MB 2AX1A 3KJQB 5F8JA 3MCNA 4UUXA 2RIJA 3M9MB 3O44A 1WSVA 2HQIA 2LXIA 2HHQA 2VFTA 1CLFA 5C25A 3QIPB 2OGUA 2PT0A 6FD1A 2PI4A 1KBRA 2M88A 3AY0A 4LFAJ 3KUGA 2BM1A 1B4SA 2J6TA 3T5HA 1QVFR 3O6QA 4CLLA 2MLZA 4OYXA 1TU0B 4DV5J 3KK3B 4ED4A 4ZVPB 3QO9B 2XWYA 4CLWA 2U2FA 4F2RA 2D9PA 2VC0A 1C1CB 2XEXA 5F8HA 3OHBA 1RWUA 2YX1A 3GSIA 3SEOA 3Q22A 2YNGA 4TQSA 2QSWA 4QQBA 1M1GA 1Q95G 1XTZA 3ENWA 3W61A 2QFJA 2W01A 1TFWA 1I3OB 3HJFA 4PXDA 2UP1A 4RWWA 1N33F 3MEDB 5L9XA 3R1HA 3KLFB 5DQGA 3I32A 4KKOA 1R8AA 3IMQJ 1HQUA 2DIUA 3BSNA 2AEFA 2YNIB 4IFVB 4QR1A 2V50A 3PZPA 2NPFA 2C3MA 1S9FA 4Z7YA 2RRAA 2KG1A 2LCWA 3MMCA 3Q8SB 4QYZK 5A8WA 4M1KA 4NLXA 2PFDA 4Y2CA 4YHHF 2E29A 2FLNA 3UD3P 1Z2LA 2FJAB 1SH0A 3C15A 3KFWX 3MM5B 1CS4A 3BSAA 2Q66A 3QIPA 1NZ8A 4OHYA 2MB0B 2BQRA 2NR0A 1ELOA 3W62A 4TU8A 2K8GA 1KR4A 1ZPVA 5A6WA 3Q8UA 5T14A 3PJXA 2M0GB 3EZUA 2IAJA 2PFFB 3VGSA 3KYLA 4NL5A 3R2CJ 2GGPB 4TLRA 3KK3A 5GAGU 2HZAA 3DDKA 3QO9A 4ZN1A 1KSPA 2IJNA 3GFXA 1DJ0A 1C1CA 5HLFB 4KHRA 1GMVA 5DDPC 2GHPA 1YTYA 1VS3A 1P27B 4NCGA 3M7VA 2G9OA 2DVIA 3PJWA 3N0VA 3FEXB 3OUYA 3PFOA 4USKA 3DLHA 4DCPB 4OJGA 1NAQA 4RPFA 4XTTA 4AL7A 1SJ3P 1JLQB 3VGVA 4CTAB 3HHLD 4N5SA 4LT6A 4ILRA 2BANB 4UOHA 3KLFA 2OH2A 4RW6B 1FKPB 1IQZA 3M05A 3C16A 2KXNB 2E1MC 2WVCA 5KT2A 1NPRA 3NBPA 3DXBA 5ETPA 2YNIA 1WC1A 3BEGB 1U2CA 5DM7Q 4PWDB 1S9GA 4TU9A 2QSFA 2QRRA 4F67A 4KE5A 2BE2A 4URSA 2ZH1A 1IBLJ 1B0PA 2J9EA 1C1BB 4EMDA 2M8DB 2OELA 4PXCA 5EN1A 5CAAA 3NOCA 4YMEA 1HNXJ 3MM9B 4ZHRB 2AZ1A 5F3TA 4CLKA 3HZEA 2DNZA 1EQMA 2AGQA 1HI8A 1Q5YA 3T1HF 4ZLNA 3MM5A 3TO8A 3RB4A 3OPKA 4IUFA 3IR6B 2DITA 2OJ3A 1WKKA 1RWVB 1REGX 4DV3J 2QLBB 4JI5F 2KDOA 2AW0A 1S4EA 4R5PB 2JC1A 2QMXA 3TW0A 1F60B 3V4MA 4DSLA 2GGPA 4MFBA 1SH2A 2V8PA 1HWIA 2PA8D 3UCGA 1UEVA 1JX4A 2V8DA 4NLRA 5HLFA 1RAIB 1AZSA 3UFCX 2UVUA 2HFSA 1X4DA 3ITHB 4IR1A 1VJWA 4NOHA 3HVTB 2JEGA 4RNHA 2XS5A 1TL1B 4JI2F 3CUNA 2XI3A 3HJVA 4ED3A 2K1RA 1B7FA 3DOLA 3SI8A 3MTJA 3QZ8A 1IJFB 4ELTA 2ZM6F 1CEZA 3HZGA 1RA7A 1NSKL 2VUGA 2WB4A 2GIRA 5IT9U 3PKYA 4ZP9A 1YX2A 2CIMA 4ED7A 4O0IA 2NQPA 1LWCB 4NLVA 2J76E 5HANA 4AL5A 3M8SA 4RW6A 1X4EA 2B8PA 4Q8FA 5H9EJ 2Z0GA 3QRPA 4FF3A 1T3OA 1RJJA 1HR0J 4I4BA 1JLCB 2LKZA 3T5KA 4USUA 2ACYA 3CD7A 2J9DA 1YJTA 2MKIA 4QWDA 3C3LA 2C3PA 1DAXA 4EGLA 2JVOA 5I3QA 5L8RC 3MM9A 4QPXA 4ZHRA 4TYAA 4GRSA 1SB6A 4CZCA 2J9CA 3IGVA 4CO1A 4AUKA 5E3PA 3HHLC 5MLCV 1HBOB 2HS3A 2ZZTA 1T9YA 5KFQA 1NJZA 7AT1B 3BSCA 2YWHA 4C7QA 3M9NB 3CD5A 5A2QU 5L9NA 4WPAA 4KH0B 2V69A 3NNHA 3LAKA 2MPUA 3GLJA 3V6DB 5D0RA 4ZVTB 4B3RF 1X5TA 2CQ1A 3AD9C 3HXMA 2FZGB 1BMQB 5B0CA 3EWGA 1Q81T 4ED2A 3M6UA 4WZMA 4I56A 2X1AA 2AD9A 2ZHAA 3FRYA 1T9XA 4DR6J 2MXYA 4ECZA 2XMVA 4RNFA 2UUAJ 1DTQB 2GMLA 2CPFA 3NLCA 2IRUA 4A8MP 4RUHA 2BRLA 1LWCA 5GAEU 5KFWA 1TKTB 3TVYA 3CCQS 1GEHA 4OYOA 1C0TA 3CJSA 4B9MA 2BE9B 4DL2A 3DOMB 4I7FA 3M6WA 3QFWA 5ADZA 3CT9A 4NLSA 2QYCA 1XJWB 4CDIA 1CVJA 4OZ1A 4OX9F 5KFCA 4LF5J 1R0AB 3Q83A 2E7XA 1AUDA 4K8RA 1CJKB 4K59A 3MAHA 3T1YF 5KG5A 1RHMB 2N7YA 4FVMA 2AJ4A 4YB5A 5C2GA 1DURA 2VG6B 2B8QA 1H73A 4MK8A 2N4CA 2JVRA 1FRMA 1PJ6A 4FVCA 3IR7B 3K57A 1JLFA 1HL6A 3O5TB 4M5DB 3J81U 2B4UA 2Y1JA 3OFFA 5KAKA 3KLHB 3LPEA 4W4MA 3V6DA 4WP3A 3CJKB 2V8VA 3CDAA 1FXRA 3QT5A 4EBEA 4JP8A 1TVRA 2P2CB 3OTCA 2ASDA 2BE7D 3W1YC 3NXZA 4M5IA 1OSDA 4K4ZA 4B3SJ 1VQSA 4USVA 3QPIA 4QIVA 1H2VZ 4AYBD 3CEDA 3R7BB 7FD1A 5L1IA 4TY9A 2GO9A 4EEYA 1VQ4S 3FVYA 1SL0A 3AAWB 4C8OA 1HHSA 1DTQA 4ETZA 3TAMB 2MDAA 4ANDA 2F4VJ 2K2PA 4DPUA 4ZVOB 1FRJA 1RT4B 1JJ2R 3E2EA 5F41A 5CD4H 1VQNS 1LQ9A 2ZUGA 2KG0A 1MWQA 2DRBA 4PG8A 3DOMA 2JNJA 2ZBQA 3MM8A 2E9TA 3IO1A 2CWXA 2V0NA 1RTHB 4E8UA 3FCWA 3GFZA 3W63A 1N33J 4D3HA 2OMOA 3HLUA 1FNXH 5AE3A 2XLIA 4TLQA 1R89A 3G6YA 5D0GA 1CJKA 3ENVA 1NB2A 1BD6A 3GR0A 1JLAB 2NS1B 2C2KB 1ZS6A 1J5OA 4ZMMA 4C11B 4DF8A 2IDEA 4LREA 3BO2A 2H4WB 3G2XA 2VG6A 3CJ3A 3KG0A 3I0RB 4NYPA 2VIHA 1N0UA 1RYSA 2F8EX 3KWMA 4YHHJ 2J6UA 4X4TA 2P8IA 2H1YA 2ASYA 4WP8A 4M5DA 1VK8A 2G1DA 2C2MB 2WHOA 3IM8A 5C42A 2R8JA 5LSOA 4UQTA 3CDBA 4RUCA 1ZYQA 1JB0C 1BLUA 3H98A 3CJKA 4LF1A 3KHHA 1RTIA 1LWEB 2R2RA 2AEJA 1L3UA 2NYIA 1LWFB 4LSZB 3V4IA 2FLOA 1U0HB 4RBTA 1N54B 3DLGB 2AWZA 4CLTA 4IOAQ 1YK9A 5IT4A 5DJBA 5K9FA 4BC7A 1UW4A 3OL7A 5L38A 1RT4A 1FEHA 1UFWA 4NA3A 2DEJA 3H5XA 3M32A 2QZ8A 4LF6J 5HBMA 2CJXB 5H9FJ 2OAUA 3H5YA 3UI3A 4MK9A 2UXDJ 1NHKL 4WE1B 3HVWA 3KHGA 1U02A 4F04B 4DV6F 1UWAA 2ZWPA 2E1RA 4LRAA 2OPSB 4ITSA 3AB4B 4LJMA 3BKUA 2OPQB 3I5CA 1S5ZA 1JLAA 3R7SB 2DNYA 2FJEB 3A8IA 4C11A 3B78A 2LVWA 5J2NA 1UZDA 3TZYA 1U4BA 2O3DA 2OP5A 3KK2A 2FJXA 3NS5A 1WOSA 4WFYA 3W5XA 3EVOA 4JI8F 2D3UA 2M5YA 4QYRA 3W3SA 2CZVC 2FHOB 1MU2A 1FK9B 3T1HJ 4DPTA 4OHXA 4UY85 4RW7B 1BC6A 4DPOA 4ZK7M 2F3JA 1WG5A 3SCKE 1B64A 1LWEA 4ZIVA 4WP9A 4WFBQ 3TR5A 4JI5J 3V6HA 2OEKA 1LWFA 1KVIA 4A48A 2UV8G 4CLUA 3QFHA 1JJHA 4P52A 3OFGA 3N28A 4ZDNA 2CPXA 3DC2A 4DG1B 1JLBA 2HMIB 3M2UB 2VPXB 3QYYA 2RAQA 4EYIB 2RUSA 2L9NA 4JI2J 1L3TA 3EMTA 5B7WA 2HSEB 1N34J 4HDHA 1IBCB 4FP9A 1VBYA 3FZ2A 2ZM6J 4ZPDA 4RNMA 4H4MB 2NUHA 2AEMA 3GIJA 4AT1B 3BDPA 1MROA 3THVA 5BR8J 3ZTSA 1EIYB 3CCRS 4CYUB 3AT1B 1X5PA 3J80Y 2A6OA 2XMKA 1DQ9A 1JLGB 3M8WA 2CJQA 4K4TA 1EARA 2OPQA 4GO7X 2AJFE 1VC5A 1U48A 3MZIA 4QR0A 3RAQA 3R5AA 1S7IA 5D0EA 4M94A 4OMFG 2M52A 5JVGQ 4PPZA 5F8GA 3R97A 1ZA2B 1NDLA 4WJBA 2Z57B 4WZQA 1XMOF 1VQOS 2D3O1 3QLHA 1NSAA 3IP0A 1FRLA 4TNOA 3TUIC 4RW7A 1B70B 1IR0A 4OX8A 2UXBF 5ETRA 4WXWA 2E1CA 1O6XA 4J9RA 1CBKA 1RT7B 2VC1A 4N41A 3JTPA 5LT5A 1S9EA 2Y8WA 4PRFA 3WBZA 4LF8F 3JXOA 4B3RJ 3L9ZA 3H8YA 2BABA 4IDKA 4KHMA 3S1TA 3HF5A 2KL8A 3V5RA 1VDHA 2HMIA 3R3TA 3M2UA 1M5VC 2EFGA 3TAPA 3V6KA 2KHCA 5KG7A 2HNZB 4CO0A 2DHSA 3AD7C 5LJ3Y 4LUBA 2L9DA 4CH7A 3MFHA 4B08A 4OI3A 3N6NA 5DM6Q 3HHKA 3MUVP 3L7PA 3SYZA 3DRRA 4H4MA 2C3UA 2G0CA 4FYYB 3TA2A 1UVJA 1CG2A 3KMSA 2MZRA 2ADBA 2WONB 1QUPA 2FC8A 4DL3A 1I1GA 4CYUA 2JFDA 4WFAQ 2RQKA 1OY6A 1JLGA 2EBGA 2RKIB 1SKRA 5CA5A 4ENOA 4JI3F 4DEZA 3PACA 5IS2A 3V6JA 2IM2A 2E1AA 2HIQA 2LU1A 1T03A 1RKIA 2CZ9A 3BGUA 3FBFA 1VIXA 1UPPA 1JWWA 4OX9J 1KLMA 4CQ1A 2YWWA 5J1EA 4C0BA 3MPYA 3DLEB 2MGZA 2YKMA 2XHCA 3DHXA 2B4VA 2VZ9A 1UETA 3TX0A 3EVMA 2M3DA 3LANA 1MWZA 2B6AA 1UJ5A 4DL0C 1X0PA 1SBRA 1EJ7L 4DPYA 3H5SA 1RTDA 1PG5B 3RU0A 1BQNB 4TY8A 5KFOA 1GMUA 4FDFA 2YKOA 2DHXA 1AROP 1S6OA 3UW1A 1NK0A 3KLVA 3PJ9A 4A8KA 1WI6A 3K5OA 1R43A 2RU3A 3GFYA 1MW7A 3OD2A 2YWEA 1LFWA 3CJ2A 4MK7A 4R8UA 2P6SA 3MOZA 1N48A 3HHLA 1Y5LB 5DQHA 1R8HA 1KTQA 2CFXA 2BUNA 1YJRA 3M4XA 2AJ0A 2BKOA 3TZWA 3DYAA 1RWPB 2Y0SD 5E2QA 5CH7B 1RAGB 2F5GA 1QAXA 2M2BA 2MKJA 2EI5A 3CIZA 3P4UB 3ICLA 4NYZA 1RTJB 4YEAA 4PCQA 4ECTA 1XNRF 3CCSS 4CT8A 2O01C 4G1QB 4U7CA 1S1UB 3FUYA 5M2PA 2C3OA 5AT1B 1PBAA 3A8JA 2I6WA 3VAGA 1NDCA 5T7LA 1Y5NB 2W25A 1YLXA 1S79A 3B54A 1RWWB 2MQNA 2RKIA 4PQUA 2IM0A 3H5UA 5KFTA 3VCDA 3CJRA 4KJIA 3OSPA 4B9UA 4EO6A 1VISA 2HK3A 3TRGA 3MCSA 5DG9A 4ZPAA 5IV3A 1NZAA 4ECQA 1MWYA 2HHXA 5HROA 1QJHA 4L3KA 3DLEA 2DHAA 1HARA 5EDWA 3G96A 1X4GA 2W4PA 4KV8B 2XYGB 5L39A 2B5JB 2P9EA 2GVDB 1X4FA 4XIUA 4X2BA 4M5JA 3Q2SC 2RF2A 5LJ5Y 2IRYA 1WG1A 1NK8A 2H5IB 1XQIA 5EGYA 3WX8A 5J2MB 1U7LA 3BH7B 4LBHA 4AE5A 2C1EB 1WELA 3F41A 1M1HA 2HZCA 5D0HA 4HL9A 2PEHA 1IWGA 1ICEB 1NH7A 1FX4A 2C42A 1XC9A 3EE3A 1V9OA 3US5A 3KLIB 2GAHC 1QM9A 2EG2A 1TK8A 4XK8C 3TANA 2ZD1B 2R7XA 1PAUB 3VF0B 3TUJC 3OJSA 4LF2A 5I4MA 3ET6A 4K2XA 1P1TA 3TUZC 1DQAA 4J9SA 4G1QA 2OLWA 1P8GA 1S1UA 4K4UA 4RUBA 3VV2B 2VKZG 4OJ1A 3MAAB 2EKNA 2BJ9A 5LOQA 2ROGA 3SCIE 2QLFB 2PIIA 1FJGJ 1K44A 3WIUA 2RD5C 3JAMU 2KU7A 5IFMA 2GIQA 3PX6A 2R7VA 1MMNA 2ZC3A 3R7NB 2CKWA 2Q3PA 4NMLA 1RT5B 2FC9A 3G82A 2EBEA 2DPJA 4KO0A 3P45B 3JTOA 3DMJA 3PIPQ 3PX0A 4UZBA 2YQ0A 4DV6J 2DXEA 4KFBB 4O3NA 1EHWA 1ZPWX 4ERDA 4YDDB 2VODA 1TUGB 7FDRA 2FHMA 1FX2A 4C6AA 2FZCB 4KV8A 5KT7A 2HBRB 1VC0A 1HBMB 1NPPA 4JV5F 4LBIA 4CO2A 1EZZB 1EP4B 4ZP6A 2DCLA 4XO0A 1RABB 3OHAA 5J2MA 3WIVA 1SUQA 5GAGI 1RT3B 3D3CJ 4ECVA 1AA1B 3QJJA 2YH1A 3D2WA 1DY3A 1PYSB 3FSYA 1TTHB 2R7TA 2G13A 4OYMA 5IOLA 3P5BP 4P2XA 1UZHA 3PHTA 4HLBA 2FJVA 4IH5A 5CZXA 1U1OA 3OJUA 2W7PA 3FEYB 5K14B 3UN2A 1D1UA 2N3LA 3QBCA 4J7CA 3NGDA 4UTGA 2OUGA 4F0HA 1QY7A 3ENAA 5FIIA 3FNNA 4Q2MA 1Q53A 4G3IA 4DWIA 2H3EB 3GWCA 3KMQA 1FRHA 2M70A 3BPSP 3MAAA 2E1PA 2DRDA 2WRMA 4FF1A 2FJDB 3OXLA 2X1FA 1VBXA 2E5JA 5KFDA 3GJQB 4X4SA 1FDNA 2EXUA 4K5SA 1RT5A 2LQBA 4HR2A 4IG3B 1LK5A 4BWMA 2XG8A 4OIXA 2X3DA 1WTBA 1NHVA 2DH8A 4FXVA 1IKYB 1YVFA 1UJ4A 2CPZA 2O5DA 2OPPB 1FRIA 4ED5A 3D5MA 3C66A 4LF7F 4OX6A 1RHRB 5J2QA 2C2ZB 4ANEA 4WU3A 4USIA 3J7Z5 2JLFA 2K3IA 1EP4A 3RB0A 2CRLA 1GNKA 4ANCA 5KFFA 1T05A 4DV2F 3A3PB 4DSJA 2DISA 2WOMB 1ZAVA 2DXDA 1RT3A 3ISND 9RUBA 5CXTA 4XPCA 3P8BB 3T41A 4NLTA 2AU0A 2MHNA 4R25A 3KJVA 2QC3A 3EZOA 2Y9HA 1VK3A 4CLYA 3IBCB 1D9DA 3HSDA 4DR5F 1Z2ZA 2KRBA 2D9OA 3A13A 1G1XA 2HVEA 4J9NA 1HWKA 3U1NA 1RHKB 3JB9k 3P49B 1M90T 3GJRB 4NASA 1KFDA 3AB2B 1PIEA 1SJFA 3KLGB 3I55S 2ZBIA 1R7IA 4JI7F 3K17A 3J7YU 3QRQA 2BQUA 1R3NA 3Q8QB 1S72S 4Y00A 3KNGA 4Z37A 1Q8LA 1ZTWA 2Q79A 1K0TA 4X62J 1R0CB 4MYTA 2CQHA 4URQU 3CO9A 3F73A 4IG3A 3GP9A 1NEEA 3THTA 3GYXB 2B9WA 1NDKA 3UCZP 2R7RA 5LL6d 4JV1A 3OR1B 3GJSB 2OTJS 1FVQA 2OPPA 2FTRA 5KG4A 1NJIT 4JI3J 5IC4B 1HPZB 1U2RA 1IN0A 3TI0A 1BE4A 4KGZB 1UAWA 1JNRB 1F5BA 1HHTP 4ECSA 3DDNA 2DGOA 3SBMA 4C97A 4F0MA 2DH7A 4Z7CA 1FE4A 1TV6A 1QD1A 5IV4A 4HTJA 1HNVB 4IOCQ 3T5JA 3SFGA 4ED6A 4K0KF 4JOUA 1JMTA 3MEEB 2HRTA 4O3SA 1M5SA 4W92B 4A8SA 5CHCB 2JDJA 3FCHA 1SCJB 2E66A 1YZ7A 1SL1A 3VZIA 1BXNA 1N52B 4OYWA 1MSWD 4Q8EA 1K8AT 3KLEB 3TWZA 1RTZA 2C2DA 1J2VA 1KP6A 1S77D 3ISZA 1U8WA 3H90A 1TL5A 2AGPA 2RHSB 1VFJA 2YX7A 3C2PA 2QFIA 3Q23A 1O51A 4J9KA 2IRXA 5GAEI 3N5BA 3KLGA 3I87A 5IWAF 4HDGA 3Q0AA 2ILZA 4O4RA 3ETMA 1ZM2A 3D9BA 2GAGC 1H72C 3ISNC 3HKWA 2E44A 3GR1A 4IH7A 2FHJA 1XNRJ 5E7OB 1NUEA 4YOEA 3UR3C 3SCJE 3V81B 1KS2A 4BC9A 3DLKB 2GW8A 4GVBA 3O3LA 2OEMA 3G4SS 2VKRA 4IQMA 3DRSA 1D9FA 2IYGA 2XMWA 3OR1A 4C4WA 1KNZA 3MEKA 4YR0A 4F3OA 4PWWA 2QJ3A 1HPZA 1RADB 3LGNA 3Q2TC 4I1TA 2GIFA 1WF2A 4K5RA 4WU2A 2XO6A 1AB8A 2DJWA 2G0IA 3JSMB 1RAEB 2VOOA 3J7A1 4B3OA 3F0NA 5K8OA 2PO4A 5JXSA 4IQXA 1SJ1A 2E9ZA 1EETB 2Z30B 3IXQA 2JEIA 4WYWA 3DM2B 4QW9A 4YN3B 3D1HA 4CCHA 3QRRA 4U8YA 4K4WA 1VRQC 2RDIA 1NHUA 2XMMA 1WEYA 4USTA 3L3CA 5EUHA 3PYFA 3HHEA 4X4VA 2V4RA 3KLEA 4RO0A 3NMAA 3KHLA 2GC8A 2DGSA 2DYAA 1H74A 4DXLA 2MQQA 1T95A 4PPDA 1FD2A 4ED1A 3W65A 2NSBA 2YNFB 3R9LA 2Q43A 3SV3A 2RQMA 1KQKA 3PY8A 2XSJB 4DSEA 2YNHA 1VRTB 1C4AA 5CD4A 4Y2AA 1KWMA 4LIRA 3MCMA 3U1MA 3OW2R 4ER8A 4O4GB 3UDCA 3CNQP 2XMAA 1NK9A 4ILLA 2LEBA 2FIUA 1AFIA 2X51A 3LOUA 2QX0A 2XGPA 1URNA 4FNHA 5F8MA 4O3RA 2Y8YA 2IVFB 1S57A 1U2FA 2JEFA 4M63A 4U8VA
chains in the Genus database with same CATH topology
2MXYA 1ZM9A 1TK5A 4RX6A 4WFNQ 2D7SA 3UD4P 1MMLA 3TA1A 1YJ9S 4ECZA 3H40A 1GQEA 2M7SA 5H1SV 1T03B 2XMVA 2KJVA 3LAMA 4RNFA 2BJDA 2FD2A 4NLUA 2CDQA 4QWEA 1KLMB 3FGVA 2DK2A 1DTQB 2GMLA 4KT0C 5DGBA 2CPFA 3NLCA 2RT3A 5J1EB 2XLJA 2MGZB 1X4CA 2IRUA 4A8MP 4RUHA 1YI2S 1K0VA 2YKMB 4ICLA 5BJRA 2BRLA 2AV5A 5KFRA 1LWCA 1EETA 1FF2A 4L6V3 3RR7A 5GAEU 1O8BA 4C8NA 5KFWA 4J9MA 1A6LA 1FRXA 1TKTB 4DLEA 2W9CB 3GQCA 1E6YB 5E0OA 3TVYA 3CCQS 3DM2A 1RP5A 4ETXA 5DDOC 2B6AB 2M8HA 2DGWA 2ROEA 3M8PB 2R2UA 1F0XA 3TAQA 3K58A 3LF0A 1C0TA 1S6QA 4HH0A 4B9MA 1D0EA 3DRPA 1RTDB 1FA0A 2V2KA 4DL2A 4B3SF 2V4JB 3PEHA 4I7FA 3M6WA 4WFZA 3Q8PB 4TY8B 2YKNA 1VBZA 2A18A 4CI0B 4I68A 3CT9A 5ADZA 1T02A 4NLSA 3S01A 2AX0A 2QYCA 3W2VA 2HFOA 1CVJA 3HX9A 1TKXA 4C0HA 1YRTA 2R7OA 4OZ1A 3VAHA 4OX9F 3NNAA 3IS9A 5KFCA 1TAUA 1JLEA 1R8PA 3A8EA 5HO4A 1R0AB 5D6GA 4B9NA 2E7XA 2ZH6A 3M30A 2NSCA 1HW9A 5DGAA 1AUDA 4DS4A 2ZOGA 4KFBA 2YVSA 3JSRA 5A8RA 2XC9A 4R8UB 2F4VF 5GADU 4NLWA 1N32F 1GX5A 2CQPA 4M8LA 1AXQA 3H59A 4K59A 1SL2A 3MAHA 1S0NA 1RDRA 3HHLB 3TX8A 3OSNA 3T19A 2R8GA 4OL8A 4IKAA 1VQ8S 3T1YF 5DDRC 2VOPA 2AJ1A 1XMQF 3ZFVA 2XMUA 5KG5A 5DG7A 1LXNA 1H2TZ 3SDEB 1ZAWA 2MQLA 2N7YA 3G8TA 4DL6A 4FVMA 2YNFA 2AJ4A 3DNCA 1HBMA 2NXUA 4QZVB 3LP0A 2MJUA 2RS2A 3S7RA 5KFLA 4YB5A 2Y1IA 3DYAB 1IKXA 1DURA 2VG6B 1H3DA 4KSEB 4FS2A 1QAIA 4OI1A 2VFUA 3PW5A 4MK8A 3MF5A 1S1WB 1H7WA 2N4CA 4C3MA 4EBCA 1DFDA 4N56A 2JVRA 1N0VC 3S6EA 4WTYA 1FRMA 3M1VB 1VRTA 3I9V9 1S0OA 3OFEA 4FVCA 3IR7B 4DR1F 4P7TA 3K57A 3HT3A 1JLFA 3UPFA 1HL6A 2VBXA 3O5TB 4M5DB 2B4UA 5KFKA 4DV1F 1RT2B 2Z2MA 2Y1JA 3MMAB 4OHWA 2HHSA 3OFFA 2AYEA 5KAKA 3KLHB 1JK9B 4MTPA 1KD1T 1DRZA 2FVRA 2NLWA 3V6DA 1Q1KA 2CQ0A 5HMYA 1LW2A 2OSQA 3PW0A 2MJNA 4ZS6A 3JYTB 5D3GB 1Y5IB 1YWXA 3CJKB 3EX7B 4IO9Q 2V8VA 3QGIA 3CDAA 4OZJA 1H2UX 4EYHB 1FXRA 1KN6A 2VASA 4HI2A 3SMZA 2AYGA 5T7LB 4EBEA 4KC5A 2R4FA 4MKAA 1TVRA 2PN6A 3OTCA 3A1YG 2ASDA 1G3OA 2XGQA 1XNQF 2LDYA 2HPUA 1TFYA 1OSDA 1Q4RA 3FJ2A 4YB6A 1F2GA 4PQUB 2ZHBA 3BQ0A 5KFBA 4K4ZA 1G6BA 3CD0A 1VQSA 2PSZA 3FSXA 5K14A 4OI0A 3QPIA 4NA1A 3IFEA 4QIVA 2RSQA 4URGA 3DRXA 1GXLA 1H2VZ 5KFPA 2R7SA 4AYBD 1CSJA 3CEDA 7FD1A 4O23A 5L1IA 2L41A 2ERRA 5MAOA 4TY9A 4LFBF 2GO9A 4EEYA 2LEAA 2CG4A 4GC6A 1VQ4S 4FXWA 3MM6B 2GQQA 3FVYA 1SL0A 3K5LA 1N36F 1BQXA 4NLYA 1SJ4P 3AAWB 4N8NA 4C8OA 1HHSA 1DTQA 4NLDA 5BYQA 4ETZA 3TAMB 2MDAA 2VG7B 5HROB 2F9JA 2QA2A 4DS5A 2P9GA 5I42B 4RLEA 3I31A 3PRBA 3ETOA 1TAQA 4F25A 5F0UA 5KFGA 2K2PA 2I8EA 3E01B 3SFUA 1U1RA 3ZZTA 4HYKA 1FRJA 3OVBA 1L3SA 1FVSA 3EXYA 1FEEA 1P6TA 1RT4B 3P96A 3NG8A 1RT1B 1JJ2R 2YY3A 4K4YA 3M8PA 2P6TA 5F41A 3E2EA 5CD4H 3BO4A 2VQFF 1Q7LB 1VQNS 4J9PA 2EKYA 3MPVA 3LO3A 1LQ9A 1X9SA 4TXSA 1YQHA 1SJRA 4CNZA 2ZUGA 4KAIA 4NRUA 2KG0A 5DDQC 3TARA 1DZ5A 2MZJA 4GMKA 2W8KA 1HWUA 2R7WA 2VFSA 3DOMA 3GMGA 4PG8A 3MM8A 2V4JA 2RF2B 2YH0A 2BR0A 1N4LA 3CJ5A 3AQOA 1QAJA 2DNRA 2J6SA 4H4OB 4BHQA 4JI4F 4AL6A 4ID5B 1QSSA 2E9TA 3IO1A 1QSLA 2V0NA 4DL4A 1RTHB 3OLBA 4E8UA 4DFJA 1RAJA 3GFZA 3I5AA 1QSYA 2RRNA 3MUTP 4U67Q 4D3HA 1GXUA 1SC6A 2OMOA 1XMBA 1S1XB 4ZPCA 3RTVA 5IT9Y 3HLUA 3GIIA 3IRXB 2J7UA 1FNXH 3TNVA 5AE3A 2PMHA 3L95X 2XLIA 4TLQA 1R89A 3GG1A 1IKYA 2DD8S 2LU2A 1U47A 3G6YA 2KRRA 4KPYA 1BQMB 5F0WA 1HMVB 2B9XA 2HS4A 3ENVA 4F4ZA 4A46A 2L48A 1BD6A 2VPZB 3NWGA 3P3DA 3GR0A 4X84A 3RBDA 1JLAB 2UUBF 3VR1A 2NS1B 2CJAA 2C3YA 1J5OA 4Y65A 4UY8T 1FKAF 4ZMMA 1UMJA 4C11B 2EVZA 4K4VA 4DF8A 2CQ3A 1F5CA 5L1JA 2ZNYA 3BO2A 1WNEA 3C6UB 5LSRA 3P6YC 1YJWS 2CPDA 2ZJPQ 4LF6F 2KFNA 4B3TF 3I0SB 2VG6A 3E3XA 4YFUA 3CJ3A 3G71S 5A0YB 3KG0A 4Y6IA 4DHVA 3I0RB 2SXLA 4JI0F 4F4KA 1VRUA 1HD0A 1S1VB 1N0UA 4NYPA 3MR5A 1RKJA 1RYSA 1GTEA 4J9OA 3R5BA 2F8EX 3AA8A 1S1WA 3KWMA 3FFIB 2UXDF 2J6UA 1XK8A 3M1VA 4K4XA 4X4TA 3MEDA 5L1KA 4Y2IA 2V9WA 3MMJA 2ASYA 2WOMA 1WWHA 3Q24A 1ZZNA 4C98A 4NXMF 4M5DA 1VK8A 4JV0A 3EGZA 3PX4A 2G1DA 4KQZA 1RT2A 3MMAA 1V3SA 2UZAA 2GCFA 2WHOA 4IFVA 5C42A 5LMUF 1U25A 2I38A 2R8JA 4ZCIA 5LSOA 4DUYF 4UQTA 2XHWA 4HH1A 3CDBA 3CDEA 4RUCA 4FZVA 4I69A 2JFKA 3SZ2A 1ZYQA 3JYTA 4L72B 1JB0C 1BLUA 1ROFA 4CO4A 3H98A 3CJKA 2IBKA 3IAS9 5D3GA 3C8YA 3OXFA 3KHHA 5KFMA 1RTIA 1LWEB 1NB7A 2R2RA 2UVWA 1X4AA 4OV1A 2E9RX 2NZ4A 2YKPA 5KT6A 2W24A 1NO8A 5JUMA 1S7HA 2EFQA 3E51A 5FLXY 1L3UA 1GXTA 5JJBA 2NYIA 4OLOA 1LWFB 3WZ0A 1KC8T 4ZP7A 2DNLA 2IJFA 4EBDA 1F5AA 2YKAA 3V4IA 3C46A 2FLOA 2J0WA 4DR4F 2OFHX 4A8FA 4KO0B 5A2QY 2DRBA 4RBTA 5T41A 1N54B 1XBWA 3DLGB 1KFSA 2NREA 2AWZA 3U7JA 3DXSX 1X0FA 4O44B 3DMJB 5D4LA 1FT8A 1HI0P 4IOAQ 1NNDA 5IT4A 1SIWB 2QE5A 2VG7A 2W9BB 5KFSA 5G0RB 1FHTA 1VHFA 5I42A 3NCRA 5DJBA 5K9FA 4CH1A 1U8SA 2HHWA 4RW9B 1U1NA 4BC7A 2F8MA 5B09A 1XN9A 1UW4A 3M6XA 2JC0A 2ZDOA 2B7CB 3M2RB 3OL7A 1I6JA 5L38A 1RT4A 1FEHA 4ECUA 1T7PA 1RT1A 4HT7A 4RBVA 3AHPA 1UFWA 5GVQA 4NA3A 1SKWA 3H5XA 1KOHA 2CQBA 5IQ6A 5IXUA 3M32A 2B51A 2QZ8A 2J0QD 5I3PA 3QGHA 3CCJS 1UVNA 5HBMA 5H9FJ 4I2PB 2VONA 2OAUA 3H5YA 3UI3A 4ID5A 3MXHP 4MK9A 3BDEA 3CCZA 3PFEA 2J7WA 3G8QA 3ZZUA 1Q79A 4WE1B 3HVWA 1FD8A 3KHGA 1Q8IA 5AXKA 4BWJA 3I96A 2RILA 1SUQB 5THWA 5F3ZA 4DV6F 4E98A 1S1XA 4LSNB 5KFXA 2E1RA 3M8QB 4J5OA 3NS6A 2RDJA 1X7VA 3IRXA 1PILA 4LF9F 2OPSB 1TUVA 4ITSA 4LQ3A 1G2EA 3PDNA 3AB4B 4LJMA 2VA2A 3QMQA 2E5LF 5F9LA 4NZ7A 1YIJS 2MQOA 2OPQB 1NRKA 2R9LA 3I5CA 4NRTA 1JLAA 2EG1A 2DNYA 1KHVA 3AH6A 2FJEB 4FNIA 1TK0A 2RS8A 4X4UA 4C11A 3B78A 2LVWA 2HWTA 5J2NA 2FVSA 4I67A 4O3QA 3BGLA 1N34F 1U4BA 4NXNF 2APOA 2MKSA 3C6UA 1FTRA 2O3DA 1R6YA 3I0SA 2OP5A 1VQ9S 3RYLA 3TVKA 2FLLA 3MGJA 1S6PB 3T1AA 1X4HA 5A0YA 3KK2A 1YSJA 2B3TB 2CQGA 2LDIA 2BOPA 2FJXA 1YRUA 3NS5A 5K8NA 1NK5A 2F40A 4WFYA 1JLQA 3CCUS 2RJZA 5EX3A 4CTAA 4DQPA 3ULHA 1U09A 3FFIA 4QWCA 4CO3A 4JI8F 2D3UA 2KXFA 5KFYA 2BANA 5BR8F 4YQWA 2X3GA 3CWJA 2M5YA 1HNVA 4QYRA 5DS7A 3VQSA 2CZVC 3W3SA 2CVIA 2FHOB 2DNMA 1FKPA 4ELVA 1OPIA 3SV4A 1MU2A 1FK9B 1HD1A 1K9MT 2P9CA 3MEEA 4V19X 4OHXA 4I0WA 2D1CA 1IKVB 2A10A 1KRPA 4UY85 5C25B 2MZQA 1UA1A 2KM8C 1KLNA 1URRA 5HMZA 2ZH2A 1UP1A 1SI9A 4PWDA 4RW7B 1BC6A 4DPOA 4RU9A 4Q45A 4ZK7M 2GMJA 1Y3KA 5J1NA 2F3JA 3NKYA 1WG5A 4WYLA 3SCKE 1WF1A 1B64A 4H4KA 3C6TB 1LWEA 4A47A 4ZPTR 4WFBQ 3O8WA 3TR5A 1U24A 2LXUA 3AA9A 3V6HA 2HLUA 1SQEA 3T3FA 2BACA 2J8AA 3D0HE 2FJBB 4MKBA 1C1BA 4ZLPA 1ZM4A 2BW2A 3H4DA 4TU7A 2UVVA 1LWFA 1KVIA 3RR8A 2KJWA 5K8PA 4A48A 2WK4A 2UV8G 4USJC 2DBBA 3GIMA 4MIBA 2DHGA 3I5BA 2O67A 2RB7A 1MMDA 1IXKA 1IBMF 3J81Y 1XR5A 4M95A 3IC1A 1HNWF 1JJHA 2BJEA 3RRKA 3K8VA 3OFGA 4ES3A 3N28A 1Q78A 2E7WA 1N5QA 4KR0B 4ZDNA 5LXYA 3CIMA 1Y0HA 2CPXA 1HW8A 1R8BA 2YWFA 3DC2A 3MWBA 5CYQB 4DG1B 1JLBA 2DGVA 3BQ2A 2ZITA 2HMIB 3HFKA 1ZTTA 2ZJQQ 3M2UB 5G0RA 1HI1A 4N77A 4RW9A 4A8WA 2EK1A 4ECRA 1Q7YT 2DR9A 3MUMP 2VPXB 2A1BA 1OQ6A 3QYYA 4LFAF 2ZJRQ 4EYIB 3B8HA 4OFZA 2R2TA 1UVIA 3M2RA 2L9NA 1VGYA 1U1KA 3CGIA 4GKKF 1L3TA 2R8KA 1YG0A 3POTB 1C0UB 5B7WA 5BYSA 2K7KA 1S10A 3J7YI 5J2QB 4OZ0A 2DRAA 4R5PA 5B0BA 2EPIA 2MY8A 4HDHA 4Y0FA 1B0VA 4FP9A 4DV5F 1D9AA 1YJUA 1VBYA 3FZ2A 4WK1A 4ZPDA 4I2PA 3MR3A 2DT9A 4RNMA 1HFEL 4H4MB 1KQFB 2NUHA 5HI7A 5J1PA 4DFPA 3GIJA 4A8XA 4PQAA 4F4YA 1T05B 3MOJB 4AQYF 1OS5