1APSA

Three-dimensional structure of acylphosphatase. refinement and structure analysis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
b'STARPLKSVDYEVFGRVQGVCFRMYAEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSVRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYLPHOSPHATASE
publication title Three-dimensional structure of acylphosphatase. Refinement and structure analysis.
pubmed doi rcsb
source organism Equus caballus
molecule tags Hydrolase(acting on acid anhydrides)
total genus 27
structure length 98
sequence length 98
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 1991-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1apsA00
2ZDPA 2HIQA 2W4DA 1CPZA 1GXTA 1S6UA 2ROPA 1APSA 5B0EA 4Y2IA 1P6TA 2N4CA 2XMTA 1CC8A 1TL4A 1LQ9A 5A6WA 4HI2A 5T7LB 4FNHA 1ULRA 2KT3A 2HQIA 2K1RB 3CJKB 1AFJA 4A4JA 3LGNA 1U7LA 2QLWA 5KAKA 2BBEA 2XMVA 2HFOA 1KVJA 4YEAA 2BJEA 4OJ1A 3TOQA 4DPOA 1X0PA 5B0CA 1YJUA 2XMWA 1GXUA 2PGCA 1JK9B 4HH1A 4OIXA 1CC7A 1TL5A 5A6PA 1K0VA 1OSDA 3HHLC 1IUJA 5B0GA 2OFGX 2ASYA 2LDIA 2GFFA 3BM7A 3KNGA 2FIUA 3I9ZA 1MWYA 3KG1A 1SB6A 2OKQA 4Q2LA 1N5SA 2K2PA 5B0AA 1Y3KA 2HLTA 2JDJA 4DN9A 2XMJA 3IWXA 1W2IA 2KKHA 1RJJA 1FE0A 1YJTA 2GV1A 2OP5A 2HLUA 3F44A 4HH0A 1OQ6A 1TZ0A 1TR0A 3MCSA 2EW9A 5B09A 2FB0A 4ZA1A 4A48A 1R6YA 3BGUA 3QGPA 5T7LA 1FESA 1FD8A 2K1RA 2QYCA 1AW0A 3HDSA 1KQKA 1FE4A 4HI1A 5B08A 5B0DA 3IWLA 2BJDA 2G9OA 1Y0HA 2N4DA 3BN7A 3HF5A 3HHLB 3WDOA 2VH7A 2PD1A 5K9FA 4FNIA 2RSQA 5F0UA 4ZOSA 3HHLD 4A46A 1URRA 2FHMA 1JWWA 1V3ZA 2GO8A 2Q3PA 3LO3A 5F0WA 3LGMA 2RU9A 2GGPB 1P8GA 3FMBA 1YG0A 2AJ0A 3DXSX 3QMQA 4OJ3A 2LQBA 2OD6A 1Q8BA 4NL5A 4OJGA 1VQYA 2BUNA 2KYZA 1QUPA 2XMKA 3TNVA 2BYCA 5B0BA 3CJKA 1Y3JA 1YJVA 2LQ9A 2QIFA 4EFAC 3BR8A 2GA7A 2N7YA 1KVIA 1N5QA 2OD4A 2XMUA 3TRGA 3FGVA 1X7VA 2K7KA 2ROGA 3BDEA 3T9NA 2OFHX 1S6OA 3KG0A 4NPOA 5IXUA 1Q8LA 2AJ1A 1VQSA 2K7JA 4Q2MA 1OPZA 1SI9A 2KT2A 1XBWA 2GCFA 1N5TA 1YRXA 2ROEA 2VV5A 2XMMA 2IFXA 3FRYA 3UDCA 3VTIA 3KKFA 2CRLA 1FVQA 3MZIA 3K7RA 3HX9A 4Y2KA 4F67A 1YJRA 1WD6A 2RILA 2W4PA 2AW0A 2HFNA 2ZDOA 1N5VA 1Y9OA 4Y2MA 1Q4RA 4HL9A 2OAUA 2GGPA 5B0FA 1AFIA 3HFKA 2IYIA 1FVSA 3DCAA 4U9RA 1FEEA 3GZ7A 1TUVA 4A47A 1Q53A 3BB5A 2FTRA 2LXFA 3E8OA 2OMOA 4OJHA 2QLXA 2RMLA 2L3MA 3HHLA 1X8DA 2AP6A 2W4CA 2ACYA 3BF4A 4YDXA 1SQEA 1MWZA 4DL0C 2IYGA 1OQ3A 4QOTA
chains in the Genus database with same CATH superfamily
4CO2A 4USMA 1KEKA 1A0OB 3EE3A 4J9PA 4AXJA 4Q0BB 1VQPS 2HRTA 4TVAB 2DNMA 1QE1A 1Y00A 2Q43A 2CNNB 2AZ1A 2UV8G 5J2MA 2DR7A 2H5EA 2CJBA 1S7IA 3QT6A 2XM3A 3QIDA 2FQQB 3KUGA 1TL1B 2VL1A 3RBZA 1WNEA 2CQHA 4M94A 2ZFHA 4LR7A 2W01A 1M5VC 4CLSA 1EB0A 1RTHA 4RJVA 1HFEL 1JXVA 4RW7A 3OTBA 4IG3B 4J9OA 3CCRS 4DHVA 1K1QA 5J2MB 1SI9A 2G2ZA 4MKBA 4TXSA 3QRQA 4OZJA 2KRBA 2AJFE 1NJYA 1S97A 3M2UA 4FKYA 1KDNA 1QY7A 1QVFR 3NGKA 4HEA9 3K2YA 2ERRA 1HIYA 2HWIA 4EBCA 1QM9A 4EU0A 2NSBA 2X3DA 5IWAJ 3CD5A 5T14A 4ICLA 2HLUA 3FBBA 5I3QA 1FESA 2X3GA 3RRKA 2GMJA 3A3NB 3M2UB 5KFLA 4IRCA 1B0PA 4V19J 3FBFA 4OX7A 2A6MA 3FMWA 3PHTA 5LOQA 4B3OA 3K8WA 4TQRA 2AGQA 4L75A 1GTEA 3J81j 3M1VA 4N8NA 4QYRA 4CLFA 4OZ0A 1VR6A 1KBRA 1HLWA 1TKZA 1HNZF 1RTJA 3CCLS 2DGSA 4ZDNA 2FHJD 4ICLB 3MEDA 2CPDA 1PYOB 4L72B 4WYWA 4F3OA 1IBLF 4M5JA 2HPUA 3UR0A 2UUAJ 4O4RA 4IH5A 2FLPA 4A8QA 3G9CA 2YQ1A 1NKEA 4DSJA 2CNLB 2FHJA 4B3OB 4DS4A 2W4CA 3EVMA 3L09A 2AZ3A 3G8QA 4B3MF 3RAXA 1NJIT 4RLEA 1H2VZ 3M1VB 3BH6B 2UUWA 2I8EA 1TKZB 3I56S 3EPGA 3F56A 4M5MA 1IR1A 3MEDB 3N0VA 3MEEA 5DG8A 2IAJA 2DK2A 1BE4A 2YWKA 3FQLA 2RRBA 2M52A 1RQ0A 1DZ5A 2Y1LB 5K9FA 4DF4A 4QWCA 3D0IE 1IM4A 1TKDA 3CGIA 2W2NP 1ZBTA 1JKHA 1UJ5A 1E6YA 2IIHA 3OFFA 4FF4A 3TRGA 3MEEB 4NEZA 2KT2A 2IAJB 1N5TA 3K0JA 3MGJA 3LP0A 1IR2A 4KGVB 4DV7F 4WXOA 4U95A 3SCKE 2OAUA 2D69A 4BWJA 3WIVA 1NUEA 2MYFA 3PDNA 1IN0A 3PFEA 1YTYA 3NCRA 4CH1A 1SQEA 5EX3A 1JKHB 4QR1A 3H4DA 2RT3A 3M2VA 2QN6B 3HXMA 1PO6A 2RUGA 1ZH5A 2AF6A 3HHLC 1GFWB 2PO4A 3DDNA 2XZTB 4DPTA 7FD1A 1VRTB 4CO1A 4C3MA 1S1XA 1GXLA 1RLDA 1GT8A 2QYCA 2BKNA 4J9QA 3UO0A 4KY3A 3THVA 2ZZTA 2R4FA 4LVOP 1NK7A 1RABB 5KT2A 1QJHA 2HBRB 3LA0A 3M2VB 2CQDA 4QR2A 3TUZC 2XC9A 1VK3A 2BA9A 4RUAA 1KNZA 1N34F 2M5YA 4MTPA 4OI3A 3GYNA 2ATCB 1NJXA 1JQGA 1C2PA 1LW0A 5IZHA 3W9HA 4RWXA 4JI1J 5LSLA 3J80Y 1NDCA 2ASDA 1HNIA 1H7XA 1EKRA 2P6SA 1WWHA 1RWKB 1SJ3P 2OMOA 3T41A 2DBBA 4DV2F 1D8YA 5LXYA 4X64J 2N7CA 1IXKA 4GKJF 5HVHA 2GC8A 3VALA 2G1DA 3VAHA 3HMJG 5K5MA 3O44A 3TQEA 4QZVB 1TK5A 5SUHA 1A6LA 2ZC3A 2B6AA 1SJ4P 1F5CA 2ZJPQ 4K2JA 1Q0NA 1FJGF 3M6XA 4ED4A 1I5OB 4KJIA 1VQLS 2C2MB 4JB8B 2WSFC 4LF1A 5F9NA 4QIGA 3HHNB 3W3SA 2QGFB 3PW5A 1BWVA 3HJFA 2IY5B 3MFIA 2H51B 5KFZA 1WC0A 3QAUA 5F0UA 4QWEA 3GR0A 3C2PA 1Z2LA 3DDKA 2GGPB 1ZAWA 2FY8A 4DR5J 2BE9B 3G6YA 2VPYB 5LM7E 1VQNS 5HMWA 1YQHA 2B6AB 3B8HA 1OPIA 4ZN1A 3SYZA 3S8SA 4EO6A 5EGYA 1YDLA 1B64A 1YJWS 1G7CB 5D0EA 1HW9A 4PWUA 4M8LA 1U1NA 3SQGA 1S5ZA 2XS5A 1UZDA 2W2PP 4ZVEA 4IFYA 2FDNA 2ZWOA 5B0EA 3PFOA 4A8SA 3GR1A 3S7RA 3ZZTA 3TA2A 4JI5J 2J0XA 5GADI 4P2SA 3KDOA 1KOHA 4LFAF 2F65A 5KFPA 2V2VA 4HACA 1U6FA 2MY8A 2BANA 2VICA 4ELUA 1T95A 2V4QA 1RAGB 5EUHA 4F0MA 3SQGB 1BGXT 1BQXA 2PD1A 4IFYB 2O67A 5K20B 1RTDA 4QBUA 2MJNA 4USKA 1JJCB 3CJ8A 1N36J 4ZLNA 1RAHB 3HPOA 3EZOA 2IM1A 1REGX 4ES3A 2VJUA 5KFUA 2VFSA 4K0KF 2MMYA 2FJAB 4WP3A 1FF2A 1BD6A 1WC1A 2YXLA 1AFIA 1HI0P 2DPJA 3SQOP 1RU2A 2XSJB 3RB4A 3KLHB 1RTDB 3GFZA 4OX8A 1A9NB 2PA3A 5D78A 1NK9A 2SXLA 3QJJA 3AQOA 4FNHA 1H0HB 3NMRA 3ZC4A 6AT1B 1KTVA 1CJTA 3IR6B 3MM5A 4YB7A 2VB6A 4J90A 4RU9A 4EO8A 4GC7A 1J27A 2KH9A 2MJUA 2FZCB 4LF5F 3CCQS 2YNFA 1O8BA 2HNYB 2ZJRQ 4IYQA 3SXLA 1EJ7L 1NHVA 1ZAXA 4IQXA 3MTKA 5GMEA 3IBWA 4DPUA 1FNXH 4Z7CA 3Q24A 4JI2J 4LF2A 2DXDA 1CJTB 1X4CA 4PXBA 3MM5B 2DGUA 3RBXA 5KOXA 4DG1A 1FXLA 3FFIA 4ID5A 4KRWA 4ER8A 4ZVQB 1ITPA 1N48A 3PV8A 4B3SF 1FFWB 5BYRA 1NZ8A 4GC6A 1Q1KA 1HBMA 4CYUB 4ECXA 1YIJS 5E41A 2KJWA 1QLNA 1IKVA 1VLOA 3VR1A 2ADCA 5CYQA 1DQAA 2A6OA 2DHGA 2BW2A 2IYGA 5GAHI 3ZZ0A 3RAQA 3A3OB 4DG1B 2B0GA 3RJMB 4KTQA 4ID5B 1RWWB 2J9CA 2ZOMA 2WVBA 3MM6A 1TMJA 5IV4A 2KO1A 3CSKA 4JYAF 3EPIA 3FVYA 2R7SA 3BKUA 2GV1A 5BYSA 1HBMB 2D41A 2FHKA 3SFUA 1JLQA 1IKVB 3G86A 1NJWA 1Q7YT 2V94A 5CYQB 5CYMA 4K4UA 2DO4A 4WP8A 5KFOA 4U96A 3C46A 4O44A 5E3CA 4V1Ak 3KOAA 5IFMA 1P8GA 2O01C 5KTQA 1F5AA 1ZAVA 2RQCA 2KFYA 1RDRA 5LMUF 4TYBA 5IT0A 3NRBA 4DCOB 1OPZA 2XMMA 2R7QA 3AB4B 3KMQA 5BXIA 3HHKA 4C6AA 3HK2A 3CCZA 2JX2A 2RQMA 4NOHA 3BDPA 1KC8T 4O44B 1XR7A 2XLIA 2L3MA 2YNIB 2XI3A 3K89A 1CJKA 2VONA 5HP1A 5DLGA 4DU7A 2RAQA 5IS2A 2W4DA 1RKJA 2MQLA 2AEFA 2H5IB 1PJ7A 1G3OA 5CABA 5KOWA 2WVEA 4RUHA 4TU9A 2R8GA 1CC7A 2UUBJ 3DHWC 4WWSA 1NHUA 4OHXA 3T19A 3QGGA 4Y65A 4LR8A 1N5YB 3AA8A 4RUCA 2FJWA 4KHPF 4K59A 3I5AA 3OL8A 3N5BA 2VHGA 5HP1B 2A10A 3KHGA 1IKXA 3W8GA 3TX8A 3PZPA 4B9SA 5CA5A 5IQQA 3PO5A 3GYGA 4HDGA 4PG6A 1X4FA 3H40A 2MQMA 4OV1A 2E44A 4AXIA 4NLXA 1FT8A 2IBOA 5IOLA 3D1QA 1U1OA 2CDQA 1ZM4A 2NUUG 4OI2A 2NCKL 1IKXB 3CDWA 2R7VA 3HLUA 4FZVA 2ROPA 4BLGA 5CYJA 3D6MB 3V2UC 4DCPB 2U1AA 4I67A 1UAWA 4HH1A 4NEYA 1S6PA 3MCOA 3O1LA 1HWJA 1QUVA 1N5SA 2R8KA 2CNKB 4IRDA 5KFIA 5E3RA 1C0TA 1LXJA 2XSFA 4CP5A 1RWUA 1JLBA 2RJZA 2V50A 3L9ZA 1T8EA 4M63A 2CQ1A 2A2DA 1XMOJ 3F0NA 3FMBA 3QMQA 4WZQA 2IVFB 4M1KA 2AJ2A 1D8ZA 1ZA1B 1S6PB 5ETKA 1SPBP 2QE5A 1N33J 2PFFB 4ZCIA 5K8OA 2BR0A 4DN0A 4P10A 1C0TB 4HL9A 1XC9A 4MK7A 3BS9A 3DCAA 5HATA 2Y3YA 4ILLA 3ZZOA 3QZ8A 4TY8A 3OHBA 1CG2A 4F3QA 3ENQA 1WACA 1PC5A 2UU9F 3AD8C 1Q81T 1ZTWA 3A12A 4LSZB 1TKXA 1FRKA 4BDPA 1VISA 1F3VA 2ATLA 2ASJA 1HQEA 3K59A 4F4YA 5RUBA 4QCLA 2Q1LA 3E2EA 4HVZA 4WZMA 2HQDA 2DNQA 1Y5NB 3VCDA 4X66F 2EW9A 2FB0A 4ZA1A 1VBYA 3HD2A 4DR1J 3GV5B 1SH2A 1P9YA 1C4CA 4TY8B 3HF5A 3D28A 1ROFA 1URRA 1GEHA 3M8YA 4MH8A 2BQUA 2PMHA 4Q8EA 1TKXB 3PR4A 2DNRA 3G6ES 5KFQA 3BR8A 1HQEB 3GYXB 3M8PA 1CSJA 2K7KA 4FN5A 2ZE2A 2JSXA 2AGPA 4LF7F 3IAM9 2BEFA 1RLCL 1OYDA 3PKMA 2DNYA 2F63A 3KK1B 3N4WA 4YY3F 1SIWB 4PQUB 4MK8A 4L74A 1F60B 3ILOA 3LGHA 1VDHA 1TFWA 4ZJLA 4WP9A 5KT3A 1RE1B 3M8PB 1XTZA 3QZ7A 4DR7J 3ZZZA 3LP1A 1XEZA 3VGTA 4WFNQ 3US5A 1K0VA 4CO3A 2RHQB 2JRSA 2KHDA 3CW2C 4F4KA 1LV5A 2MY7A 2R8JA 3F44A 1T9WA 3PYDA 4DL7A 3TVYA 3AT1B 3HM9A 1KQKA 4OZ3A 5A8WA 1RB0A 1JLFB 1V5VA 3CE8A 3CJ4A 3RU0A 1KVKA 3MR5A 1R3NA 4NL5A 1MU2A 3ZTOA 3BV8A 4DDFA 4FPIA 5IWAF 3HVAA 3GIKA 1UP1A 1KONA 4NPOA 1RA7A 2RF2A 5DQHA 3OVSA 4ZK7M 3HX9A 4HTJA 2UXCJ 2R7TA 3CWJA 3HFVA 5A8WB 3MPUB 2LMIA 2YQ0A 1XIQA 4X62J 4WJBA 2KL8A 1H38A 2AP6A 2MXYA 2CPHA 1MU2B 2QL5B 3JSRA 5KFTA 3IGVA 1IWAA 2VFUA 2HRUA 1JXEA 4GVBA 2I1RA 2C2RA 5B0GA 2HQGA 2QG9B 1Y7PA 3K58A 2UUAF 1FE0A 5IC6B 1VQOS 5EN1A 3W62A 1QDUB 5CXTA 1N52B 2ZNYA 2DO0A 3H0PA 3PXGa 4CM0A 3W7BA 3F41A 4TKTA 1Q8IA 3MAAB 5LJ3Y 2HBQB 4LRFA 2ZITA 4UZBA 3IO1A 1QTNB 4GVBB 3P4UB 4D3GA 2V8DA 2DRDA 2OD4A 2MSSA 4KHRA 2VPZB 2MZSA 2RQ4A 5G0RB 1WI6A 5HK4A 4Z2XA 1XR6A 3R5BA 3W66A 2DT9A 2YPZA 3I55S 4UTGA 4ENOA 4NCAA 4M5DA 3TA0A 3BB5A 2QTWA 4YR0A 4X4PA 3SV4A 1RTIA 4NE9C 3LH2S 4F4ZA 1RT2A 3B4DA 3G6XA 1LQ9A 1NSQA 2E1MC 3IGNA 2W9CA 2UVWA 2Q66A 5LMNF 1UVJA 1X0PA 2HHUA 2V2KA 4OHVA 1W2BR 1J5OA 2GNKA 1S1VA 4M5DB 3F73A 2O66A 2B4PA 4OYOA 2L48A 3UN5A 3D7SB 4P7VA 1RTZA 3R3TA 4B08A 1RTIB 3MAQA 1YSJA 1R6VA 1RT2B 4YHHJ 3GTYX 3H2VE 4DV1J 2VQFF 4NX9A 2OHDA 2H5JB 1JB0C 1U1MA 3R5JB 5HBMB 1MMNA 3UCUP 1T9UA 1ZPVA 3Q8UA 1J5OB 2QMUB 3V4MA 2DXEA 1S1VB 1L3UA 2IRUA 4AQYJ 1TP7A 2C28A 4G3IA 4JI8J 1KQFB 3A8EA 1X5SA 4WE1A 1TU0B 4QIFA 5AXMA 3T1YJ 1N0UA 2W9BB 4OX6A 2HIQA 5CD4H 3IRWP 1V3RA 2QL7B 2J8AA 4GKKF 2HBYB 1FKOA 4YEAA 2OEJA 1HW8A 1WC4A 1JK9B 3I0RA 1L5UA 2XCAA 2CA9A 3KLIA 2VD3A 1S9GA 2BJ1A 1ZZFA 2QYGA 3KJFB 5L8RC 3DLLQ 4EZ6A 4X64F 4K50A 4WE1B 1FCAA 1B70B 3OTOF 2N4DA 2DGVA 2Q6CA 4CLKA 2VG7A 3QJLA 4YUDA 3L7UA 5AXKA 2PSZA 1FKOB 3I6PA 2AJ4A 2XMKA 3G87A 3TAMB 3VWSA 1IKWB 2IM0A 4IQMA 4F36A 3OT9A 3WC2A 4B17A 2D9PA 1S6OA 1WORA 4X4NA 3U02A 4RBUA 1HBUA 4YB1P 4ED7A 3V81A 3U7JA 1QSLA 2JC1A 4C2MA 3PX4A 4ZVGA 1RBOB 3VQTA 4FS2A 1IBMJ 3EVWA 4IG0A 1HWIA 4FPRA 2HZCA 5C5JA 2E1RA 1V9OA 2EG2A 2R7OA 4C0HA 3EICA 5LXRA 4KH0B 5FLXY 2Z57B 2X1AA 1ZM3A 3KK2B 5F8LA 2WRMA 2E5LF 3J7ZT 5AT1B 2QJ3A 4Q2LA 3V81B 2BQRA 3TANA 4WXWA 3J7A1 2CJYB 3V6KA 5KT5A 2UUCF 3D1OA 2UP1A 4OYXA 4IG0B 1NSKL 3PVXA 4ECQA 5EHHA 2IMOA 4FKXA 3J81U 2OEMA 1U2FA 2C2NA 3W61A 1B4SA 2HNZA 1U26A 1YBTA 2MPUA 2QIFA 3MMBA 2C1EB 1UPPA 2CZ9A 3MEKA 4F3MA 2XEXA 1FRHA 1YK9A 4KIAA 1KR4A 3CJTA 3ITHA 4NLPA 2QA1A 4FP9A 1BQMA 2RILA 2W4PA 2C2ZB 1CQNA 1O0PA 3POTA 2A0FB 1HWUA 2EK1A 5L46A 2J6SA 5HAOA 2R3VA 4YDXA 2HNZB 2E5HA 4MK9A 1CPZA 2GJ2A 1NH8A 4BWMA 2IBKA 3MMBB 4A4JA 3FEZA 5MAOA 3M9OB 2B51A 3HSZA 3TX0A 4FYXB 1BQMB 1J2VA 3POTB 4RO0A 3OLBA 1LXNA 1GX5A 3MMCA 4KGZB 3QJPA 4LF9F 2PMWA 1DBDA 5B08A 2D3UA 4ZJQA 1T9VA 2L08A 1FFSB 1T0TV 3AJDA 3OXGA 4DZDA 2H3EB 1RZMA 2DNOA 4NI2B 2LXIA 1WUUA 1Y3JA 2KB2A 1SJFA 2AEJA 3DLBA 3M9MB 2CQGA 3KG0A 2V67A 2VQEJ 1D0EA 3KKFA 3MMCB 3DFEA 2V8VA 2AW0A 2ZDOA 5K8NA 4L3KA 1WHVA 2RS2A 5IC4B 4HR2A 4JV5J 2UXBJ 1PCAA 4B3TJ 4P2XA 4V19X 4TN2A 1QD1A 4JI2F 1TAUA 1E6VA 4DQIA 1HHTP 2PDAA 5EX0A 3PM9A 4MT1A 1U25A 1LNQA 3UNGC 5IT9U 3OXFA 1TK0A 2BJEA 3NNCA 1M5HA 5E7OB 4ANDA 2HHPA 4ED2A 1RI7A 1RT4A 3S01A 2HLTA 3OFGA 2I38A 3P8BB 1S4FA 4C8OA 1S49A 4ZITA 4FYYB 3DC2A 2JWNA 3JYTB 4P73A 4X4TA 1E6VB 1RWMB 4W92B 2NPFA 2HW3A 1IBKF 2VG5A 1B7YB 2F5GA 2IMWP 2FJXA 3RW6A 1RT4B 1RWOB 1JJ2R 1VRQC 4FYWB 2BKPA 3ZFVA 3UDCA 1FJCA 4USWA 2RD5C 1WD6A 1SC6A 2GIQA 1VQ9S 1BQNA 1KLNA 1NH7A 1A7GE 3VQSA 4DOZA 1NJZA 5M2RA 4YS2A 3BBCA 1UEKA 3MPVA 4PZVA 1EAYC 5HANA 5HLFA 2VG5B 2AYBA 4NLRA 4LFBJ 1WG4A 3TZXA 2WONA 3OBIA 2KXNB 1VQ5S 4PEOA 3GIJA 2ZZNA 2CZVC 2OEKA 4AL6A 4A8KA 4QW9A 4ECVA 4ECTA 3KNGA 4A8WA 1GH8A 4PG5A 3HSJA 5ETPA 4DR3J 4HH0A 2PMZD 2GJIA 3M2RA 3C6TB 4FYDA 1YRTA 1BHNA 2WONB 1X5OA 4XDDA 2FLNA 4Y6IA 2NZCA 2F7VA 1AUDA 4LF4J 1GNKA 3AOCA 3KHHA 3DMJA 1RSCA 1WG5A 3A8IA 3PO4A 1RACB 3MPYA 2ROGA 3CC2S 2BZ2A 2VZ9A 4CLZA 3S1TA 3M2RB 5KG1A 2WK4A 3CT9A 4U7UD 4Q45A 3HFKA 2YX1A 2YKAA 1QTMA 3RB0A 4OQJA 3KYLA 4F4WA 4KE5A 1AZSB 2ZUGA 3OV7A 5C24A 2KDOA 4KGKA 3OVBA 2PC6A 5CCMA 3DMJB 1RWNB 3BJYA 3QPIA 1CJVA 2V69A 2HGNA 1S99A 4YQWA 2EC2A 4FF2A 2A2CA 2JDJA 3DRPA 4ZPBA 1T3NA 1TQLA 3R7SB 3QGPA 2YWFA 4ES2A 2MKHA 5C24B 4XAKA 3DOKA 2CQBA 4ZPWR 3TI0A 2AJ0A 1TL7A 4USUA 1KQSR 1Q79A 3UWTA 1HNWF 4G1IA 1H98A 2JHEA 3T9NA 1KSPA 3MDFA 3G2XA 1TAQA 4K4YA 2JC0A 3DRPB 4KR0B 4FBUA 4PKDB 3JB9k 2CJQA 5DG7A 3RUBL 3OL6A 3J80U 3DHXA 4IO9Q 1H2UX 2NXJA 1Q53A 1XMOF 1K0TA 3DOKB 3Q89A 2EBGA 4ZVHA 1TL7B 2BM1A 4EZ9A 4NLVA 5T7LB 4TU7A 4YMEA 1N33F 3FCHA 4DSFA 4RW4A 1YRUA 3BH7B 5A6PA 4ZVPB 2IRXA 1TVRA 1F2GA 5SZTA 4C98A 5BR8J 4CM2A 2MHEA 3TUIC 3PYEA 4L3NA 2L41A 4DSEA 2H48B 5HVFA 1QAYA 5D4NA 2ZEJA 3TARA 4WKRA 2KG0A 2J9DA 3MM9B 2OSRA 3ZTQA 4ZHRA 1HQ2A 1N32J 1M5OC 4RW4B 3LF0A 3CMAS 5L9XA 1T7PA 3P5TL 1VQSA 1PYSB 4DR1F 2X7IA 3HP6A 2APOA 2YKOA 2MQOA 3UN3A 1FWPA 4I6WA 3M4XA 1V6HA 2AYGA 2IJFA 2H4YB 3EYZA 4ZHRB 3B4MA 4LREA 4RKUC 3R1LA 1YVFA 4LFCF 1JJHA 2J7WA 2BRLA 3W1YC 1ZETA 3C6UA 3C8YA 1EP4A 3I5CA 1D1UA 3QT7A 4FYVB 3BO4A 4CLLA 1S0OA 1S6QB 2ZOFA 2W8LA 5BJRA 2DGOA 3HVWA 2HVHA 3I4HX 3J7AN 3NY0A 1AW0A 1NHKL 3E51A 2WSEC 1T03A 3CDEA 1FKPA 4G1QA 3O5TB 4DR7F 4C8LA 1BUXA 2XMAA 4WFZA 3C6UB 1EP4B 1H73A 5A2QU 2R2UA 1DARA 1FTRA 4KC5A 3Q8RB 3W2WA 5KFEA 1WSRA 4B9NA 1Q8KA 3CJ3A 2CRLA 3R8YA 2F40A 1KP6A 1K8AT 2RB7A 1LFPA 2AU0A 1T03B 5K8MA 2C2OB 2BVZA 4DV5J 1S12A 1FKPB 4G1QB 4F04B 1UEUA 4DSLA 1UJ6A 3A3PB 4KB7A 1TL4A 4HI2A 3DI6A 3W2WB 2RDDA 4YN3B 4MYTA 4C8KA 1TUGB 2VDHA 3R6GB 1FKAF 3MEGA 2JJ4D 1VLYA 4R25A 2WZ1A 4X62F 2MKJA 1ZTTA 3EM1A 2DHXA 5IV3A 3OR1A 1VQ4S 3EXCX 3IC1A 2D9OA 3BQ2A 1Y10A 3L3CA 3LO3A 2IPOB 2BE2A 5D77A 3DI6B 5D0HA 5D4OA 4QPTA 1N54B 2V63A 2N7YA 1NDPA 4QIVA 1RGVA 4GMKA 2V68A 2DHSA 4MIBA 3FDSA 3MEGB 2XI2A 2DNGA 4X4VA 5FIIA 1UVLA 2RRAA 1SUQA 4MFBA 4NMLA 4X4SA 3OR1B 2XS7A 2H9ZA 1RT6A 2QLXA 3AA9A 4URQU 1U48A 4JI6F 2BE2B 1MNEA 2HSEB 3C66A 3VVUA 2VUGA 2PI4A 5F41A 1CULA 1HBOB 1YZ6A 1YJUA 3VAJA 2ZD1A 2IVYA 4MFBB 4JI0F 2GIFA 1C0UA 3QWPA 3D6FB 3L4BC 3H98A 3VAGA 4Q43A 3V6DA 1RT6B 3VV2B 4WBFA 4DFPA 1N56A 1M0SA 1CJUA 1S59A 2XHCA 4DSKA 3JSMB 1B0TA 3H5YA 5DZ7A 1L3TA 4DL5A 1Q8BA 2JVOA 4NLDA 3QQCD 2EKNA 1UVMA 9RUBA 2ZD1B 2CQ2A 3IFEA 5EWFA 3PNIA 4ES1A 1U0SA 3T1HJ 1C0UB 4I68A 1F0XA 1XWLA 3HSGA 3V6DB 3UD3P 1H3DA 3QO9A 4I6YA 1R8HA 3HT0A 5GAGU 3K5PA 2OMLA 1GMUA 2UVVA 3DOMA 4ZP9A 2GHVC 4QOTA 1HPZA 4J9VA 2M9KA 3IS9A 1APSA 2HG4A 3DLGA 2GQQA 5HL7Q 4M5GA 2HNDB 4X4OA 1GXUA 3D9BA 2XLKA 1X4BA 2LDIA 3BM7A 5HMXA 3N6MA 1S1UB 2HBZB 1NCLA 4JI8F 1WI8A 1X4HA 1LWCA 1X0FA 3OL7A 1S1WA 2ASLA 4FXDA 3QO9B 1RAFB 3KLGA 3LW5C 5L1JA 4RNNA 4FXWA 2FVCA 1BY9A 3UW1A 2IA6A 3I4PA 3WX8A 1HPZB 1WOOA 3ILIA 3IS9B 1D9FA 3MR7A 3DLGB 2ZWPA 4FVCA 1H74A 4N56A 2C3YA 1KTQA 5I4MA 4ZPCA 1KLMA 3Q23A 2Q6BA 4IH6A 3KG4A 2FGOA 4USVA 3CVKA 3FK4A 4X4UA 3V6HA 1CS4A 1S1WB 2UVRA 2LEPA 1RAJA 4ZVOB 5GAEI 3MTJA 3GJTB 1LFWA 2IYIA 2DH9A 2YNGA 4LIRA 3CUNA 4PG7A 4B02A 3MUTP 4DFJA 3KLVA 3C3LA 1NDLA 3WQPA 4LR9A 2K1RB 2FJVA 4R5PA 2RRNA 5IT4A 3PACA 2FD2A 2XS2A 1CS4B 4DV6J 1HMVB 1Q5YA 3ENWA 2ZH2A 2MKIA 4ECYA 3DM2B 4HHUA 2RKIA 1IBMF 2HEKA 3HHDA 1TZ0A 2VFRA 2VKZG 4P72A 2ILYA 2YNGB 3W63A 5H9EJ 2BJDA 3DN9A 3WDOA 2HFUA 2E5IA 3HHLD 3D5MA 2XULA 2MQPA 5J2NA 4ZLLA 4R5PB 3CD6S 2OI2A 1PG5B 2I5JB 2R8IA 4X2BA 1M5PC 2XMUA 2YH0A 5H9FK 4C8MA 4RW9A 1MW7A 2EI5A 2RKIB 4B3RJ 2V8PA 2CPIA 4OFZA 2VFTA 4USTA 3ILLA 2DITA 3C15A 4NXMF 5D6GA 5J2NB 1U2RA 3R27A 2GQCA 2J6TA 4M5HA 5KFBA 2NYIA 4ZPDA 2IC3B 4P74A 4ZKAA 1UVKA 1G1XA 2BBEA 1FA0A 4RW9B 1WOPA 3FSIA 4L76A 2PEHA 1UL3A 1NK6A 4LSNA 2KU7A 4IOBA 4RW6A 3M9NB 2AKWB 1DHMA 3J7Z5 1WEZA 2IJRA 4CO0A 1WSVA 1YBUA 2WCXA 5C7PA 4Q0BA 2RSQA 5CCLA 2KT5A 1EETA 2NXUA 1AYEA 4DR4F 1ZM9A 4PPZA 4DR6J 3QWUA 3WIUA 1L3SA 1R0CB 2FJBB 4J9UE 6FD1A 2FZGB 2GA7A 1LW2B 3BGOP 4LSNB 4RW6B 1MMDA 5F8MA 3TEHB 3J7YU 4ED8A 1FNOA 4BHQA 4XTTA 5ETVA 3NMAA 2OGUA 2NSCA 3OQ2A 3CCSS 2DCUB 4X4QA 3PJWA 1EETB 5AE2A 2V4JB 4IG3A 2NYHA 4RL1A 4PG4A 2BJ9A 1NSAA 3GSDA 3I87A 2DHHA 2VG6A 2GVZB 2DR6A 3T9ZA 1Y5LB 3IBFB 2VQEF 3QT8A 4E2FB 3UFCX 4JP8A 1O6XA 4USJC 4DLEA 1GAOA 3QGHA 3AY0A 3QSYB 2P2CB 1UTAA 2HHHF 2ZH3A 2UXBF 4B3TF 2DH7A 1EHWA 1HQUB 1L3KA 1SCJB 4KGXB 2E29A 2Q3PA 3W8PA 2VG6B 1M90T 4DU8A 2QZ8A 3RTVA 3K8VA 3LWMA 2V9WA 2WB4A 1PJ5A 2GW8A 4DPXA 1FDBA 1SC3B 4OZLA 2Z2ZA 4Q2MA 2ROEA 1UW4A 2B7BB 1S0VA 5I3UA 1Y9OA 1R89A 2M7SA 3H5UA 5KFGA 1UWBB 1H6KX 1NXIA 4TU8A 1HR0J 4GRSA 1KHWA 2I6WA 6FDRA 2P9EA 5L38A 3QLHA 2J5AA 1OY9A 2L9NA 1NK0A 2LDYA 4EYIB 2G4BA 4N77A 4J9SA 5H9EK 5M2UA 4A8MP 5B0CA 1WHWA 4HDHA 3KNAA 3PW4A 1N4LA 3AB2B 5I3UB 2CJXB 4M5IA 4DLGA 1QSYA 2DCLA 4ECZA 3GFYA 2JEFA 2CIMA 3FEYB 4CLUA 2ZH1A 3BSOA 1RT5A 5D15A 1S4EA 2G9OA 3OUYB 1NNDA 1YGYA 4A46A 4F0HA 3MD1A 3QLHB 2ZKTA 3NKYA 2ZBCA 2LA6A 2VODA 2EFNA 2O1PA 4ECUA 3H59A 4OJGA 3TEGA 4IFVB 3M30A 2Y1JA 3KWMA 3CCES 3N9UC 4ED1A 3LPEA 4QWAA 3BYRA 3OJUA 4K4WA 2ZOGA 4ZVTB 2HRYA 2EFGA 4IH7A 3R7NB 1RT5B 1KD1T 3EZUA 3GZ7A 4WF9Q 2UV8A 4B3MJ 3DLKB 2GZOA 4S0MA 4KKOB 4LF4F 1RISA 1ZYQA 4OHZA 2ZDPA 3RYLA 2B9XA 2N4CA 3M30B 3GCWP 2ZHBA 4DEZA 2OPRB 4NCGA 3MM7A 2QMXA 1WKKA 1OWXA 3H25A 4JBCA 3WHIA 5HROA 1F6TA 3QFHA 1W25A 3U27A 3IBCB 3NLCA 1NK4A 3HD1A 1JWWA 3TVZA 3GIRA 4RNFA 4DL4A 1VRTA 1U09A 3SCJE 1GX6A 2LQBA 3NGRA 3PEJA 4ZVFA 4X84A 1LWFA 2CQCA 3D54A 3CJKA 4DL3A 4NCGB 3FUYA 2H65B 2AYMA 3FZBA 3MM7B 2W25A 1H7WA 4DV7J 3G71S 4NA2A 2G0IA 1ZOTA 4QJVA 3KHRA 5HROB 3T3FA 2K06A 2DD8S 3Q8SB 2OTLS 2H1YA 5DQIA 5D0GA 1OJ4A 1I94J 2MLXA 1NB2A 1MG7A 2VF3A 4K5SA 1YJ9S 2XMTA 4N8OA 1LWFB 3CJKB 3NBPB 4P6QA 3MPDA 4DUZJ 4IOAQ 1FRIA 3CJ5A 1M5KC 3IM8A 3LWLA 4HLBA 4CI0B 2KZZA 4P9SA 3G4SS 2KHCA 4IKAA 3DRSA 2XHWA 1N34J 3OD2A 1JJ4A 4NRTA 4TLRA 3DXSX 5KG7A 2KYZA 2HQ3A 1MMLA 4H4MA 1IWGA 3AAWB 2E1CA 4C0BA 2BM0A 5HJXA 1RKIA 1F9EB 3DXBA 3HCXA 5KFKA 4Y2MA 4DV2J 2GGPA 5F8GA 1AXQA 4NA1A 2IVMA 2JFKA 2FC9A 3DRSB 3EMTA 5U47A 4M5NA 1QAJA 5DGBA 5HMYA 4F7VA 2EFOA 3X1LB 3AOBA 4ZCMA 4H4MB 4WIIA 4BBYA 1FJGJ 2VA2A 1S7HA 4OZNA 1WEXA 4ECWA 2J76E 1FHTA 1RUSA 3VAMA 1TL3B 2V34A 3BGLA 4DL6A 3HDSA 1PAEX 2J9EA 1FRXA 1XMQJ 3T6BA 2F4VF 3FBCA 4QQBA 1OY6A 3NS6A 4I2PA 3IR5B 1T11A 2RE1A 3CTRA 3SSQA 3B6BA 1Q8LA 3M32B 3MR6A 3P6YC 1YJRA 2FZKB 3VHQA 1P1TA 1OS5A 3MOJB 4C8YA 1TFYA 3EGWB 1RBAA 2UXDJ 2KZMA 4DX6A 1S72S 3D2WA 2MZJA 2ZH4A 4W4MA 4I2PB 4FS1A 1WOSA 1F9FA 5C2GA 4LFAJ 3KDNA 1KVJA 5DDPC 2DY1A 5I42A 2XSJA 2HWTA 4USHA 2DNHA 3KLHA 2BJ3A 4DL2A 5ETOA 3B54A 1SL0A 4WU2A 4FF3A 2HHQA 3BKFA 4AL7A 3EGVA 1FJ7A 5ITHA 4NXNJ 1BXNA 2MZQA 3MECA 4H54A 1PBUA 4C3KA 4O23A 3GPAA 4W98A 2V0NA 5I42B 4ZLJA 2XZDB 4K0KJ 3KFWX 2HNYA 2XYHB 2DJWA 1S57A 3TAPA 4Z7YA 4QIEA 5KG2A 1RYSA 1WC6A 2X51A 1Q4RA 1U8WA 4F2SA 3W60A 3IWNC 2C42A 4DQQA 3SFGA 3DRRA 4LRBA 1FEEA 1XJWB 1QSSA 2MQNA 3MECB 2C3MA 4OYWA 3GV7B 4AE5A 3MXHP 2O3DA 3AD7C 1NM2A 1X4EA 3CC4S 4CDIA 1CC8A 3R5AA 1G6BA 1SKUB 4NZ6A 3NGTA 2RU3A 2MLZA 3FCWA 4CYUA 2DNZA 4PCQA 4K4TA 4DV0J 4LF5J 3CXCR 3HI9A 1GTHA 2NREA 1PSDA 3Q2TC 2B7CB 2ZHOA 3DRRB 3D68A 4NYZA 5HQLA 3BR9A 1CVJA 1Q78A 2FVSA 3R1HA 3M8SA 1YITS 2HHSA 3ZZYA 1RHMB 3ZTRA 4ECRA 2CJAA 4MMOA 2DNNA 4O0NA 3EZ5A 1GMWA 3TJAA 1YJNS 1Q86T 1HWLA 4M5KA 4YP3A 3C19A 4LF6J 3ISZA 3GP9A 3GILA 1RCXB 2DRBA 3JTOA 3DLHA 2DIVA 3GJRB 2W7PA 3D66A 5GVQA 4YR3A 2L9DA 5KFCA 1ELOA 4CRJA 4KT0C 3GJQB 3PYFA 1PGZA 2P6TA 3W65A 2XYGB 4NLUA 4RR5A 2LQJA 3PYGA 2U2FA 2OH2A 4OX9F 1FK9A 1XNQF 2GIRA 4ID8A 3RAMA 3NAIA 1SB6A 2NXEA 2YNIA 2B56A 1OO0B 2HHWA 3ICLA 3OXLA 1RXOB 2V6AA 3EUNA 5HQ8A 1WEYA 3AD9C 1NAQA 3I0SA 4C11A 4YB5A 2HYIB 3SI8A 3P96A 2XGQA 4L6V3 4RUBA 1BWEA 2XLJA 4IR9A 2RDIA 4X4RA 2XBPA 4WCEQ 1FK9B 2ZH9A 2BYCA 1N5YA 5A8RB 2P5VA 5CH7B 4C48A 1X7VA 3EDQB 2XZWA 1FWLA 1Z2ZA 3RR7A 1XBWA 3GFXA 2HAIA 1TK8A 1SKWA 3I0SB 4C11B 1U1RA 1RHRB 2EG1A 3KUHA 4TYAA 3PRDA 1M1HA 2QFJA 3TJ9A 3UCGA 3GFHA 3TQ1A 3U1MA 2QO3A 1GXTA 4R0EA 1C4AA 4Y2IA 4PXDA 4RW8B 4I56A 2DEIA 3NOCA 1JMTA 3VGSA 2W2OP 2MHNA 1FJEB 4JI7F 4F02A 4USIA 1T94A 2GX8A 4F25A 5CD4A 2B5JA 1XNRJ 1JIHA 3JS9A 3CF5Q 2HMIA 3U1NA 1FD8A 1Y11A 5ETMA 1Y0HA 2PN6A 2F4FA 1R8BA 1RT1B 2XWYA 4DX7A 4DF8A 2CKWA 3D6HB 2E9ZA 5GADU 2LU2A 4C7QA 2QLFB 4C8NA 2B5JB 2BW7A 5E33A 2QT7A 1VRUA 2HMIB 2B4OA 3G96A 1MN7A 4JI3J 2MKCA 4F8RA 3M8ZA 2HVZA 3LP2A 4DS5A 1RT7B 4DL0C 2O5DA 1LEOA 3ET6A 2Z4PA 5A6WA 3R2DJ 1SKRA 2VIHA 2AGOA 4B3RF 3ETOA 1RBLA 5KFAA 3X3UA 1X4GA 4NMXA 5A0YA 3FCVA 1VRUB 2OKQA 4WFBQ 1FEHA 1J5EF 3D3BJ 4ITSA 3PJ9A 4JI4F 2HFVA 3LP2B 4W90B 2AQ4A 3BN7A 1VHIA 3ET6B 4IR1A 4LF8F 1SL1A 2DB1A 1RHKB 1P9QC 2WHOA 5FD1A 2CQ0A 5B0BA 1SC1B 2DNLA 1AA1B 2IM2A 5A0YB 3FGVA 3J81Y 1EARA 3FRYA 5G4DA 3JSBA 2Z56B 3ZTPA 5L1IA 2LXFA 4DR6F 2FVQA 3RRGA 4ZVUB 2ZHAA 1U1LA 5HJYA 2HVEA 4KGMA 4F4AA 2K8GA 5KT4A 3KK1A 4X66J 3DRYA 4DUTA 3CNQP 4PQUA 4RNMA 4I69A 3VAFA 4O3OA 1T05A 1WDDA 1AROP 3IWXA 3MCSA 2E9RX 4MKAA 1FRLA 2Z58B 5B0DA 4IUFA 5GAHU 2BX6A 2Y0SD 3OR2B 1D9DA 3E01A 1IM6A 2CPJA 4A8YA 4DV3J 2AWZA 3TNVA 2BJ8A 4LF7J 2Z8QA 3HULA 1VQKS 3CCMS 1JLFA 4O4GA 1T05B 3KJVA 1VBZA 5D0RA 1LWEB 2DNKA 2XO6A 1UEVA 3BBBA 4NLQA 3K7RA 4YY3J 5DG9A 2WW4A 2V2ZA 3VAKA 1VIXA 2YX4A 3NP5A 1QE1B 1RAEB 2ZH8A 1YHQS 3C14A 3BQ0A 3E01B 3QT5A 3BPSP 3HVRA 3R97A 3HSDA 4OZ1A 2AJQA 1D9AA 2HGMA 2YWWA 1WC5A 2JLEA 4O4GB 2AIRB 3KJVB 4CTAA 1F3FA 4ZPTR 2JFDA 2Y8WA 3ZZPA 5FDLA 4DSIA 5IT9Y 4YB6A 3HKWA 1RTHB 1HR0F 3PRBA 4LBIA 4RW7B 2G2OA 2CQIA 2C2DA 1U49A 3C14B 1K1SA 1UMJA 2WVFA 3MHYA 3LANA 4IRKA 4C4WA 4LQ9A 4C8ZA 5D4PA 3GQCA 2K3KA 3DOLA 1JLEA 1SXLA 2W9AA 1KVIA 3LOUA 2HK2A 4CTAB 3JQJA 2JEIA 3AJ1A 3MAAA 1S9EA 5FDLB 4MJKA 2A18A 1FDNA 4OYZA 2UZAA 2FJEB 2WBRA 4G6VB 4PRFA 2HAFA 2WSCC 2J6UA 2J0QD 4OJHA 3MCMA 3HO1A 3RZAA 8ATCB 1JLGA 1VQ7S 5G0RA 1MWZA 2OO4A 3OPKA 1HBNA 3DOLB 1JLEB 1KKHA 2BXJA 3W64A 4ZN3A 2CQ3A 2XMWA 3DU5A 1S9EB 3KTQA 1JNZB 1Q7LB 4GVLA 1RK8A 1V5IB 3VZHA 5KG3A 2CPFA 4UOFA 3G8SA 1RTJB 3DGVA 3H8YA 1WTFA 4NLTA 1JLGB 3KUEA 3CMES 4PYDA 2LQ5A 3NEKA 1HBNB 1XK8A 2EFVA 1NPRA 2DR9A 3PRVA 2PE8A 5EDWA 1SQFA 1VJQA 5ETRA 3CDUA 2Y1RI 2GMLA 1VBXA 1PILA 4NRUA 3CO9A 1AB8A 1U0HA 1UKUA 5KFVA 2VC0A 4I1TA 4KQZA 4PAAA 3GONA 3TW0A 5J1NA 3CCWA 2KM8B 3LAKA 1F9HA 5KFNA 4ERDA 2ZBIA 2MSTA 3MM8A 5HBMA 2RMLA 3VZIA 2MTLA 5DLFA 1Y5IB 5CZXA 4J9KA 5D4LA 2MKKA 2L9WA 5LMNJ 2WB1D 2XQCA 2CPEA 2COLA 2QLWA 5L9NA 4UOHA 2VDIA 1U0HB 1T9XA 3AHPA 2IJNA 2AD9A 2YVSA 1RADB 3JSYA 4OI0A 2DEJA 1X60A 2W9BA 4N7TA 1E6YB 1I94F 2H54B 1PAUB 5E5NA 4ATNA 3MM8B 3BZQA 1FE4A 2VQFJ 5ETQA 1NMEB 2J0WA 4MIWA 2NXCA 3LP0B 5ADZA 5HO4A 2IA0A 4Y0FA 1M5SA 1JXLA 2XWXA 2HHTA 5F9LA 2V9KA 4DUZF 5JVHQ 2VPXB 5KG6A 3MAHA 4IOCQ 4A8XA 2D3OR 4OHYA 2EBEA 1VGYA 1YRXA 3DDIA 2JEJA 2IDEA 5EWGA 3CDBA 4JI1F 3TAMA 1UVIA 1IKWA 1UVNA 4MYUA 5KFSA 1U1KA 4GKKJ 3BF4A 2HHXA 5DQGA 2D7SA 5CAAA 4UT4A 1U6ZA 4YOEA 1S1XB 2R2TA 1KFSA 2CPZA 3IM9A 3M8RA 2ZH6A 2DXFA 3IR7B 3M6WA 3W9IA 1OIAA 1U24A 3I9ZA 2QA4G 4EBEA 2R2RA 3OTOJ 4Y28C 2MKSA 4KYZA 5F8IA 3IWLA 1LW0B 2VFVA 4DBQA 3KK2A 3GWCA 2DYAA 3SMZA 3AQPA 1HNIB 5KFHA 1KN6A 1Y4ZB 4I2QA 4RNOA 5D8HB 4MKYA 4WFXA 1NBEB 5J2PA 2J9DE 2GAGC 1FI4A 5B0FA 4DR5F 1VQ6S 4DQPA 4NZ0A 4PR6A 1VHFA 3UDVA 1XMQF 2K3IA 4OYPA 1S77D 1I6JA 1T02A 4Q44A 2AT1B 1FERA 4CLWA 1U02A 1UFLA 4I2QB 3HZEA 2B8PA 1DTTA 2E5LJ 1ULRA 2VBXA 4ZLPA 5J2PB 3EGZA 4OIXA 5EWEA 5JMNA 3B82A 2OTJS 2ZC4A 2UUCJ 3TZWA 3K17A 1HD0A 2QFIA 3ENVA 1MN9A 3H4BA 2DHAA 4JI5F 1W2IA 2UXDF 5B09A 5KFDA 4QYZJ 3BGUA 3HFZB 1O51A 3CD0A 3IRXA 1NLKL 2HVDA 1OMSA 4Q7AA 1DTTB 1UCNA 3QYYA 1OY8A 3AH6A 4OV6A 4NASA 3ISND 5L1LA 3GG1A 2RS8A 3IXQA 4KO0A 1WJ9A 5A2QY 1N36F 3RGIA 2YTCA 3NXZA 4NXNF 1RAAB 2ZBPA 4NI2A 3DLEA 3IRXB 5KFMA 2E1AA 1RU1A 1X5PA 4K4XA 1VQ8S 4HACB 3CULA 2BANB 2GHPA 3N01A 2QLBB 4FVMA 3MR3A 2JVRA 2ILZA 2YH1A 3HT3A 4KO0B 5HVGA 1RA6A 4LF9J 1B0VA 5JXSA 1XN9A 5AJ3J 1TR0A 3DLEB 3GV8B 2RVJA 4ZJOA 4P71A 3OSPA 4B9TA 1IJEB 3W9JA 5F0WA 4CZCA 3TR5A 3TUPA 4ZMMA 4XO0A 1PIEA 5AXNA 3AJ2A 2M3DA 2M4MA 2ZH5A 4DV0F 5ETNA 2KM8C 4ZVSB 3GLJA 3WBZA 3NGSA 1W26A 3JYTA 4QU7A 3RB6A 2C2KB 1KQGB 2OLWA 2GCFA 1HKAA 1HNVA 2IFXA 4Y2KA 2KFNA 4F67A 5L39A 2PT0A 2WBMA 1SV5A 4CIOA 1G2EA 4ZIVA 3H42A 3IG1A 2DR8A 3T5JA 3SCLE 2J7KA 2YNFB 4LUBA 4LF6F 4PUOA 2WOMA 2YNHA 4NCBA 1NO8A 2E7VA 1TTHB 1HNVB 1FRMA 3UPFA 4ANEA 4OMFG 3N28A 4UOGA 1SV5B 1VI7A 1YJTA 3T5KA 1ZS6A 3FFIB 1IBKJ 3GMGA 3IG1B 3D1HA 2QEXS 2QA4S 5KFFA 3BSAA 1NK5A 3Q8YA 4F50A 1H2TZ 5C42A 3LGMA 4PUOB 2P9GA 2I9SA 3TWZA 2WOMB 1ZZNA 2YNHB 4JV1A 4HHHA 3C6TA 4BCAA 3PIOQ 4J9LA 4OL8A 2N82B 3QFWA 2KVIA 1SC4B 1WHYA 4ED5A 2NZ4A 1EKSA 3A4TA 1FVSA 3MM6B 4P2MA 1TUVA 1RT3A 5E3QA 2B8QA 3K5NA 4P2FA 4R8UA 3O2IA 1NKBA 2NXNA 4Q5VA 2DR5A 3O8WA 5C42B 4N47A 3I31A 4QYZK 2QC3A 3BEGB 1JLQB 2KT3A 1NZAA 5CYMB 4Z37A 2F9DA 2ZH7A 3UN2A 2LYVA 4UOCA 2Y0BB 2OUGA 4DUYJ 4FBTA 5DRKA 1P1LA 1TUWA 4OI1A 1AZSA 2D3O1 4GO7X 3EX7B 5KG0A 4M5LA 2UUBF 1RT3B 4MKVA 4KV8A 4LRAA 2WW8A 2YPYA 2KI2A 2LXUA 2E66A 3CJRA 3R5CA 4R8UB 1VC6A 4R0JA 3R6LB 4Y00A 4KH1B 3E3XA 4ZP7A 3UE2A 1NK8A 5T41A 2HFSA 3T1AA 2V8GA 4O3SA 2EVZA 1XNRF 1CJKB 4ZIWA 2H4WB 1LWXA 4K4VA 1PYTA 2LCWA 3CIZA 4KV8B 2Y9HA 5HMZA 3OTCA 2BDPA 2HGLA 3JTNA 5DM6Q 1FWKA 1T9TA 4UQGA 4EBDA 4UY8T 2RH3A 4U67Q 3HKZD 4E0DA 1VOMA 4JI3F 1FXRA 3FZ2A 2XMJA 1VC5A 2QX0A 3KHLA 4LT6A 3VGVA 5T7LA 2CZ4A 1HD1A 2ZBQA 3TJ8A 3P3DA 1IQTA 3JAMY 2VU5A 2CDRB 1FDAA 2BKOA 4EGLA 2BV3A 1FRJA 1HNWJ 2DGWA 3UDLA 1S1TA 4K7QA 3CC7S 2GHWA 1NEEA 4WFAQ 4PQAA 3IA0A 4ILMA 2FGCA 1REVA 2AYEA 3MM9A 3OL9A 2LU1A 1VIOA 3LUYA 4F4XA 5LJ5Y 2N3LA 2AMCB 3LTOA 2RUSA 1MSWD 2QMWA 5B7WA 4DCJB 4XPEA 2OSQA 2Z0GA 4WTYA 4LIWA 3Q8PB 4J5OA 2MZTA 1S1TB 3CIMA 3ZTSA 2HKEA 4WU3A 1JLBB 3ISNC 3QRRA 2M2BA 4RX6A 3CJQA 4J7CA 2W1BA 1SVDA 3M6VA 4LMZA 2KFZA 1REVB 3RB3A 3ETMA 4WIQA 2OFGX 2XO7A 1WDTA 3KJNB 3M05A 2XNQA 4DQRA 4K5RA 3NGDA 1LK7A 3R9LA 2JLGA 1WELA 3FKBA 4CT8A 3MFHA 1CBKA 2HURA 1HARA 4ZP8A 3LALA 2M70A 3T5LA 4ALZA 4DX8H 1S6QA 4FDFA 2CXEA 2ZKUA 4CWBA 4K2XA 2RQKA 5JUMA 2W2MP 2DH8A 1RCOB 2VKRA 4C3LA 3M8QA 4OI4A 4LRDA 2C2EA 3P45B 3Q0AA 1M1KT 2JLFA 4NYPA 2PIIA 1N5VA 2ACMA 5HQMA 1R0AA 2BE7D 2F8MA 4XIUA 4G65A 5HI7A 4LFCJ 3ONQA 3R5GA 2LA4A 2X1GA 5K14A 2HHVA 5A76A 5E0OA 4DV3F 3CO0P 2VH7A 4EUVA 3CCJS 3M8QB 5KAKA 2Q79A 3HJVA 2AX0A 5E3AA 3EDRB 4ZVRB 2B4VA 4P7TA 3CB4A 2FIUA 5KT6A 1MWYA 1JLCA 2DNPA 4EMDA 1R0AB 3D0HE 3QRPA 2X1FA 5K14B 2HQFA 1B3TA 2ZE2B 4ZOSA 2KJVA 2B9WA 1V3ZA 1QVGR 2IDLA 5F3ZA 3CCTA 4K8RA 1R8AA 3DYAA 3MUVP 3SSRA 2MDAA 3IMQJ 4F2RA 2LQ8A 2YKMA 3PW0A 1R27B 4EFAC 3RR8A 1SJ1A 1JLCB 1Z4UA 2CG8A 4GO5X 3SSSA 4E8UA 4DPWA 2QL9B 3LGNA 3MD3A 2V5HG 2JNJA 3IP0A 4XK8C 1MLAA 3L7PA 4RWWA 2A3JA 3LP1B 1DY3A 2CFXA 3BO3A 3I96A 2FLLA 3BQ1A 2CG4A 3N6LA 3E8OA 2UXCF 5AXLA 4U7CA 3H90A 4U7UK 2OIHA 3DYAB 2YKMB 4EEYA 2YWGA 1WC3A 2D1CA 3NAHA 1Q95G 1NB7A 2HFOA 1HNXJ 1S48A 1HA1A 4P75A 3DRXA 3Q86A 3OW2R 1OYEA 1K44A 2HS3A 3S6EA 1LOUA 5CQGA 2N3OA 2D3ZA 4ZPAA 3D6TB 3A8KA 1HWKA 2VJVA 2VOOA 1HBOA 3PY8A 2RF2B 1FO1A 3FBEA 4DZ6A 4WPAA 2I2YA 4LBHA 1X31C 4I4BA 4DMZA 2OD6A 1VQYA 1UW9A 1S9FA 3DGPA 1S10A 1WKLA 2VASA 2EC0A 3ELHA 4ECSA 2AJ1A 2LLZA 2JEGA 3JSMA 2NPIA 5DDQC 5KG4A 2ZVSA 4JI6J 2BMBA 4X65J 5D3GA 3NOGA 2ALYB 4O3NA 4O3PA 1XMBA 1BC6A 3KLFA 3AOAA 2QRRA 3QIPA 2I0XA 2XYPB 2CPYA 2VBYA 3DGPB 3DLJA 1URNA 5A8KA 4BS2A 4JI0J 2PGCA 4LJMA 5AE1A 1U45A 2DRAA 1CQMA 1WF1A 3ZZRA 4NLYA 1ZA2B 4WKYA 5D3GB 3TO8A 2LECA 3MCNA 2OPQA 1FX4A 4QU6A 2QA2A 3NG8A 3PCOB 2HNDA 2ZM6J 4AYBD 1UA1A 1D09B 4OYAA 3KLFB 4B9MA 3QIPB 1S1UA 2OPSA 2RU9A 2V2QA 3K5LA 1EX8A 5F3TA 5A8KB 2QSFA 2DTJA 5ETLA 1NRKA 5HN0A 4YHHF 2W2QP 2FHOB 4DV1F 3GJSB 3H2LA 2OFHX 2OPPA 3ULHA 1FX2A 2F8HA 3LAMA 2KG1A 2BACA 1VBKA 3PTWA 3TVKA 2OPQB 4H4KA 3KXDA 2W9CB 3K57A 4A47A 2C3OA 4CH0S 2ZUAA 4AQYF 3ZO7A 1YLXA 4M95A 3ZXWA 4DX5A 5KT7A 4TQSA 2Z2YB 1WG1A 2OPSB 3W5ZA 1CEZA 3CCVS 1PC4A 3T1YF 1U1PA 2Z2LA 2OPPB 5JJBA 4LVNP 1TL5A 1RAOA 1IUJA 1DJ0A 5IM0A 4BC7A 2B43A 3NNAA 5KFYA 4AT1B 1K73T 1UFKA 1NPKA 2F3JA 2OP5A 4OHWA 3BGRA 4KHMA 1JX4A 2K1RA 4JV0A 5C2CA 3OTEA 4WYLA 4ELVA 1U1QA 2KN4A 1TMMA 2DIUA 1HMVA 2C3PA 3P49B 3BKTA 4BC9A 3DM2A 1SL2A 1H72C 3EVOA 2R7XA 5IQ6A 4J9MA 4PYAA 4DR2J 2LQ9A 5IM0B 4RU2A 4HHJA 4N5SA 3FC9A 1DLOA 1FVQA 3BGRB 3QBCA 3FJ2A 3FNNA 2J8SA 4LQ3A 2I5JA 1NDKA 4EK2A 3I0RB 4NLGA 2YKPA 2XTJP 3KLIB 3PW7A 1S9GB 1MWQA 2CWXA 3TYTA 4K4ZA 1EQ0A 2BABA 2HZAA 2CJ9A 2OJ3A 1IQZA 1R43A 5LT5A 4RBTA 5DJBA 1YZ7A 2VG7B 1DLOB 2R7UA 1FXDA 5B0AA 1U4BA 4ZP6A 3MUMP 1B99A 2KKHA 3H5SA 2Y1IA 2ZBRA 3PEHA 2GMHA 1FNMA 4YR2A 2FVPA 1XQIA 2IC3A 4KPYA 1DQ9A 1I3OB 1HBUB 3CMQA 2BOAA 3GE9A 1F2HA 2AHOB 3T5HA 1SKSA 2NR0A 4QPXA 3ILJA 4C97A 3I32A 2P8IA 4Y2CA 4D3HA 1FDDA 2J7UA 2K7JA 3B78A 3BSNA 2DISA 4NXMJ 1I1GA 4NLSA 2HFNA 3PR5B 1X5TA 4DV4J 2VA3A 7FDRA 4CO4A 3GSIA 2UVUA 3H20A 4DQSA 3H7HB 2M0GB 3TAQA 3WC0A 4OLOA 1LW2A 5ETSA 1LK5A 2WTFA 1EIYB 1X4DA 4URSA 3D67A 5C25A 3UDEA 1P6TA 2YX7A 1AFJA 1N8RT 3Q2SC 5F8HA 1ZM2A 3NCPA 1VYAA 3R2CJ 4E98A 3GCXP 1N88A 2V4JA 3L7OA 3MOZA 1Y3KA 3QSIA 4PWWA 3QNWB 1OQ6A 2R2SA 3CJSA 1R6YA 4OYBA 2GVZA 2XNRA 4DR4J 1G4CA 4DJBA 3AODA 3ITHB 5FJ4A 5C25B 3VF0B 4CQ1A 2KRRA 4TLQA 1YG0A 2WVDA 2EEYA 5F8NA 1K47A 1S79A 1TV6A 2FYXA 9ATCB 5AJ3F 2W8KA 2GQ2A 1HQUA 4QR0A 3UI3A 2VV5A 3FSXA 7AT1B 1HL6A 2DVIA 4DFKA 4NA3A 4DPYA 1FFGB 2ZZMA 1N6QA 2KXHA 3TA1A 1HYSA 1B7FA 2M8HA 1HI1A 4C0OC 1YI2S 2ACYA 4G1PA 3T6JA 4YFUA 1OQ3A 2NUHA 4I6AA 3GB0A 4JV5F 2JZ5A 1UA0A 1KFDA 4PXCA 1GMVA 1TV6B 2G0CA 1C1CA 2HHHJ 2Z2MA 5DETA 1UWBA 3JQKA 4KPCA 5E3PA 4B9VA 3UR3C 1N6QB 1HYSB 4KSEB 4CO5A 3SIPB 4TY9A 4OYIA 2X1BA 2CAJA 1KRPA 2FHMA 3UVJA 2QSWA 2KVQE 1C1CB 2W7AA 2BUNA 3Q22A 1RHJB 3OTDA 3ZZUA 4TNOA 3OUYA 5F8JA 1S0NA 2CUYA 4OI6A 5E2QA 2YQ3A 4IFVA 3PG9A 2YKNA 3UVJB 3A13A 2FLOA 4H4KC 1X4AA 3D0GE 4OLPA 4EYHB 3DU6A 1BLUA 3VAIA 4NZ7A 1QAIA 2KXFA 4LFBF 3DLKA 1D3WA 2MLYA 2GFFA 2KTQA 3I82A 4KKOA 4CH7A 5GAEU 2EFQA 3MMAA 3V6JA 3UNYA 1HNZJ 1NU4A 3SZ2A 4HT5A 2YKNB 4ZS6A 2MB0B 2E7WA 4WK1A 4HI1A 2DKOB 3OFHA 4DR3F 4ED0A 1YWXA 2OPRA 4JUZA 1IBLJ 2CVIA 3SV3A 4ELTA 4ETZA 1JNRB 5DZ6A 1BQNB 4DUYF 3UQSA 4LBPA 2CPXA 4CT9A 3BPDA 2XY6A 3NGUA 3NWGA 5HLFB 3MMAB 1T9YA 3K5MA 1DRZA 2GS8A 1PKUA 1ICEB 1VCTA 1DQ8A 2WVCA 3AFGA 2EFPA 3EXYA 4Y3CA 4OZ5A 2XGPA 5I3PA 4AL5A 2C3UA 2MGZA 1U7LA 1R0BG 5MLCV 3TOQA 2OELA 3MURP 1DFDA 4CNZA 1OSDA 1PJ6A 3MF5A 3M7VA 2Y8YA 2HIYA 3WZ0A 1JLAA 4A48A 1VQMS 2LP4A 1U2CA 3NBPA 1RP5A 4WK3A 2FUG9 3QAEA 2B9YA 8RUCA 3ADAC 2RIJA 1W7WA 3U1LA 1VK8A 1M1GA 4C9DA 2BRKA 3CJ2A 2MGZB 2CJKA 5M2PA 2XB2D 3FRZA 1VS3A 3CEDA 3ENAA 2HZVA 2VBWA 3A1YG 1HI8A 3V4IA 1VJWA 3P5BP 4PABA 5KFXA 2GJFA 5DM7Q 1JLAB 4B9UA 3TZYA 4MIAA 1U47A 3BBFA 2G0JA 1CJVB 2HVIA 1ZPWX 4Y34A 4QIWD 5KG5A 1WKJA 2GVDA 4LRCA 4F26A 3L95X 2VOPA 3RRHA 2J0SD 1Q82T 3UCZP 5LSRA 4DPOA 3V4IB 2AV5A 3ZNUA 4UY85 2G13A 1IBCB 2KYXA 4ANCA 2B3TB 1L3VA 2B4UA 1U6BA 2GVDB 3M8WA 5BR8F 4RZRA 2CYYA 1PBAA 1DURA 5GAGI 4ETXA 3K5OA 2F9JA 2HS0A 3KK3A 3I5BA 3PJXA 4DFMA 1RWVB 2QV6A 1QAXA 3IN5A 1TL3A 3R5DA 4GKJJ 1N32F 4EI2A 2GAHC 3NS5A 1S0MA 1RWXB 4XPCA 2F8EX 3MZIA 2E1PA 1Z1ZA 4CNYA 3D3CJ 4PG8A 3VGUA 3JQMA 3OVAA 2F1FA 1U8SA 5FLXU 3BGFA 2ALZA 1RAIB 1TVRB 3KK3B 3RBEA 2ZJQQ 3OHAA 2FY1A 3TP2A 3M32A 3SDEA 3PX6A 2E9TA 4N76A 2LEAA 3MPWA 2RDJA 1EQMA 2FJDB 2G2YA 2HQCA 3CCUS 2EKYA 1WHXA 5CHCB 2MKYA 2FPHX 2K2PA 3MR2A 4O3QA 1NKCA 3VVTA 2AX1A 2F4VJ 4DI6A 4O3RA 3SCIE 5ETTA 3N79A 4ZPVR 4PXEA 1AT1B 4FNIA 3SDEB 3FQKA 3SBMA 1R8PA 2IRYA 4IDKA 2PFDA 4CLYA 2EPIA 3Q8VA 3SEOA 1T3OA 1UWAA 4J9NA 1YX2A 1YJVA 4UUWA 3NWRA 2BOPA 1KS2A 5IXUA 3DKDA 2CNOB 4UQTA 1P27B 4CLTA 1RHUB 1X9MA 1WF2A 3BO2A 2AEMA 1NSPA 1Q16B 2FVRA 4DWIA 8AT1B 4HYKA 2HK3A 4IDKB 4HTIA 1FD2A 2UUTA 5CZVA 2E5JA 4NLWA 4DV5F 3EGNA 2PA8D 2DPIA 1R7IA 1SJRA 4NWBA 4FF1A 2ASYA 2G1HA 3CJ0A 1RHQB 2MQ8A 3Q8QB 3PHEA 2NS1B 3NNHA 3JXOA 5DO2A 3THPA 2M8DB 2RHSB 4I64A 2V8HA 4MAKA 3KLEA 1AUSL 5DGAA 3CDAA 1BMQB 3C16A 1HNXF 4Y2AA 4AD6A 4OJ3A 1VC0A 3DNCA 3GG0A 4Q8FA 1RYRA 4ZCKA 2ZVIA 3KMSA 4KAIA 3QATA 3W5XA 3W5YA 4WTOB 3N5FA 4UUXA 4RNHA 1KWMA 1VFJA 3PX0A 2RNEA 5GMKa 5LL6d 1K9MT 2HS4A 3KLEB 1UJ4A 2YY3A 4A8FA 2VBZA 3C16B 4KBIA 2MQQA 1GMWD 2E7XA 2IM3A 2P9CA 2ABYA 1RWPB 1NPPA 2W24A 2PI5A 3CD7A 3LQVA 1SQGA 3LPYA 4ILRA 3EJMA 3O3LA 3Q83A 5H9FJ 4X65F 4ED6A 4DN9A 3J7YI 5BYQA 4B3SJ 1SH0A 1YJ7A 3HZGA 4UW2A 2FC8A 2R42A 1C1BA 1SUQB 1UETA 1F5BA 1XR5A 2EWHA 5H1SV 4I7FA 4H4OA 3HHEA 2YBVA 2R7RA 1IR0A 3G82A 3BDEA 2V4RA 1YKWA 1X9WA 3VTIA 3RBDA 3O6QA 4RPFA 4B9LA 4URGA 2LKZA 2ZM6F 1IKYA 4JV2A 1CULB 5GMDA 4JYAJ 3T1HF 2VPWB 2LFVA 1F1BB 5A8RA 4CLPA 2DY9A 1R8CA 1SIZA 3JTPA 1C1BB 4OX9J 1MROA 1YBAA 1XNQJ 2EK6A 1XERA 4I7FB 4H4OB 2XG8A 2DGQA 2LVWA 3G82B 1KHVA 5LSOA 1S76D 2NQPA 3HVTA 1CJUB 2MZRA 3OLAA 4KFBA 2YKQA 3UD5A 1IKYB 4ED3A 5LMUJ 2GO9A 4AFFA 3NL0A 3QGIA 4P52A 4RW8A 3GIIA 2JH3A 2WAQD 3EWGA 2XCPA 4YDDB 1MROB 2PEBA 2JOQA 3BYPA 3PW2A 3R7BB 2ZNZA 1UFWA 2R9LA 1HHSA 2B9EA 3HVTB 3H2UB 3TZZA 5DS7A 4U6PA 1N5QA 3AXKA 3DOMB 4RBVA 4KFBB 1N0VC 2DGXA 1RT1A 4F0KA 4HKQA 1O5JA 1GQEA 5DDRC 4LSLA 1WTBA 2XY5A 3W2VA 1ACMB 4ZCLA 3FEXB 5KFJA 4J91A 4UF4A 4QWDA 1SJQA 2CQ4A 5KFRA 3RW7A 1X8DA 1LWCB 4KHPJ 4DR2F 3BN4A 3KLGB 1IJFB 1GK8A 4JI7J 3FSYA 2IHR1 2CWKA 4CCHA 4OJ1A 4PPDA 3M6UA 1R31A 4XDCA 2R7WA 1LKZA 1TELA 1RT7A 3ZNJ1 3I9V9 3KG1A 2D74B 5J1EA 2Z30B 3A8JA 4DXLA 1RJJA 1VMBA 1KLMB 4DV6F 4WFYA 4LSLB 3W2VB 5DDOC 2XY7A 3WX4A 2BJ7A 3JAMU 3NCQA 2MEWA 2GO8A 2CVEA 3RG6A 2M88A 1V3SA 1I51B 3UD4P 3BREA 2VC1A 4A8OA 5J1EB 3H5XA 1WF0A 3CPWR 2NLWA 4L73A 1DTQA 5THWA 3KJQB 5HSPA 3GIMA 3V5RA 2W7OA 4U9RA 3G8TA 5KFWA 4NLOA 4HT7A 1SBRA 1Q5VA 5J1PA 2DGTA 3OFEA 3HHLA 3N6NA 1S6UA 3IAS9 1SH3A 2HQIA 3OSNA 2XMVA 1UPMB 1J5EJ 3D4JA 1KOOA 1DTQB 4DV4F 2ADBA 3G6VA 5J2QA 4JI4J 4O0IA 3MI7X 4OYMA 2MZ1A 2POKA 3PKYA 1TKTA 4PWDA 5JVGQ 3OJSA 4U8VA 4LF8J 2YWEA 2A1BA 3MWBA 4UZCA 2CADA 3HHLB 3THTA 3PIPQ 1CLFA 5L1KA 2QLJB 4QWBA 4U8YA 2HFZA 4AUKA 4EWTA 4IO1A 4J9RA 3BSCA 4N41A 1QUPA 3C15B 3NS7B 5AE3A 2UU9J 3GU0A 3AXMA 1OSCA 2BQ3A 4NYOA 5J2QB 4QW8A 2CQPA 4I0WA 1X9SA 4OZ2A 1EZZB 1IVZA 1TKTB 4PWDB 1FTCA 4J37A 4FXVA 2EXUA 2LEBA 1HHQA 3TUJC 3OR2A 2JL9A 2E5GA 1DAXA 4K4SA 2HWHA 2C22A 2FTRA 3MMJA 4JOUA 5K8PA 1UZHA 2R8HA 1LWEA 1TL1A 2YWHA
chains in the Genus database with same CATH topology
4EUVA 1CPZA 2GJ2A 4FS1A 1F9FA 4CO2A 1NH8A 4BWMA 2IBKA 3CCJS 3MMBB 4A4JA 3M8QB 1KEKA 5KAKA 3FEZA 2Q79A 5MAOA 3M9OB 1KVJA 2AX0A 5E3AA 5DDPC 4J9PA 4AXJA 4Q0BB 2B51A 5I42A 2XSJA 2B4VA 2HWTA 4USHA 2DNHA 4P7TA 3CB4A 1VQPS 3KLHA 2DNMA 2FIUA 1BQMB 1MWYA 1JLCA 5KT6A 1QE1A 2DNPA 1Y00A 2Q43A 4DL2A 1J2VA 2UV8G 3POTB 5J2MA 3OLBA 1LXNA 1R0AB 3D0HE 2DR7A 1GX5A 3MMCA 2H5EA 1SL0A 4WU2A 4FF3A 2HHQA 2CJBA 3QJPA 4LF9F 4AL7A 2X1FA 1DBDA 5K14B 1FJ7A 5B08A 3QIDA 2D3UA 5ITHA 2L08A 1TL1B 2MZQA 2KJVA 2ZE2B 3MECA 2E5HA 4ZOSA 2B9WA 4H54A 2VL1A 1V3ZA 3OXGA 1WNEA 2CQHA 4C3KA 1QVGR 4O23A 5F3ZA 2DNOA 3CCTA 4M94A 2ZFHA 1R8AA 3DYAA 3MUVP 3SSRA 2MDAA 2LXIA 1M5VC 2V0NA 4F2RA 2YKMA 5I42B 1RTHA 1Y3JA 3PW0A 1R27B 2KB2A 4EFAC 3KFWX 2HNYA 1HFEL 3RR8A 1SJFA 4RW7A 3OTBA 3DLBA 4IG3B 4J9OA 1SJ1A 3CCRS 1JLCB 1Z4UA 4GO5X 4DHVA 3SSSA 3M9MB 2CQGA 3KG0A 4E8UA 2DJWA 1K1QA 3TAPA 5J2MB 1SI9A 3LGNA 1D0EA 4QIEA 5KG2A 3KKFA 3MMCB 3MD3A 3DFEA 1RYSA 2V5HG 2V8VA 2AW0A 2ZDOA 4MKBA 5K8NA 2X51A 1Q4RA 4XK8C 4TXSA 4F2SA 1WHVA 3L7PA 4RWWA 2RS2A 2A3JA 3LP1B 2C42A 3IWNC 4DQQA 3SFGA 4OZJA 3DRRA 1FEEA 2CFXA 3BO3A 3I96A 2KRBA 1QSSA 2FLLA 2AJFE 2MQNA 3MECB 4V19X 2C3MA 2CG4A 3BQ1A 3N6LA 3E8OA 1NJYA 1S97A 3M2UA 4TN2A 2UXCF 5AXLA 3GV7B 4AE5A 4U7CA 3MXHP 4JI2F 2O3DA 1QY7A 1TAUA 1E6VA 4DQIA 1HHTP 1QVFR 4U7UK 2OIHA 2PDAA 1X4EA 3DYAB 5EX0A 3CC4S 3PM9A 1CC8A 3NGKA 2YKMB 4EEYA 1U25A 3R5AA 1G6BA 4HEA9 4NZ6A 2YWGA 3UNGC 2D1CA 3OXFA 3NAHA 1NB7A 1TK0A 2HFOA 2BJEA 3K2YA 2RU3A 1S48A 2ERRA 1HA1A 3NNCA 2DNZA 2HWIA 1M5HA 4EBCA 1QM9A 5E7OB 4PCQA 4EU0A 2HHPA 4K4TA 2NSBA 4ED2A 1RI7A 3DRXA 3CXCR 1RT4A 3OW2R 3HI9A 3S01A 2HLTA 2HS3A 3OFGA 3S6EA 1LOUA 2I38A 1S4FA 1GTHA 2NREA 4C8OA 3CD5A 1PSDA 3Q2TC 1S49A 5T14A 4ICLA 2HLUA 2B7CB 2ZHOA 3DRRB 4NYZA 5I3QA 3DC2A 2JWNA 5CQGA 1FESA 2N3OA 2X3GA 2D3ZA 4ZPAA 3RRKA 3BR9A 1CVJA 2GMJA 3M2UB 3JYTB 1Q78A 2FVSA 1HWKA 3R1HA 2VOOA 3M8SA 1HBOA 5KFLA 3PY8A 4X4TA 1YITS 2RF2B 1B0PA 3ZZYA 1FO1A 4IRCA 1E6VB 4V19J 2HHSA 4W92B 4OX7A 2NPFA 2I2YA 3FMWA 4ECRA 2CJAA 2HW3A 1IBKF 4B3OA 4MMOA 2DNNA 3K8WA 2VG5A 3EZ5A 1YJNS 4I4BA 4DMZA 4TQRA 2OD6A 2AGQA 1Q86T 1VQYA 1HWLA 1S9FA 1GTEA 3DGPA 3M1VA 4N8NA 4QYRA 1S10A 2IMWP 2FJXA 4YP3A 2VASA 3RW6A 4OZ0A 2EC0A 4ECSA 1RT4B 1JJ2R 1TKZA 3ISZA 1RTJA 1HNZF 3CCLS 2DGSA 2AJ1A 2LLZA 4ZDNA 2FHJD 3GILA 3ZFVA 3UDCA 2DRBA 2JEGA 3JSMA 4ICLB 3JTOA 3MEDA 1FJCA 2NPIA 2RD5C 2DIVA 3DLHA 1WD6A 5DDQC 5KG4A 2W7PA 2CPDA 1SC6A 2GIQA 2ZVSA 1VQ9S 5GVQA 1BQNA 4L72B 4WYWA 4YR3A 4F3OA 5D3GA 2L9DA 1IBLF 1KLNA 1NH7A 2HPUA 3UR0A 1ELOA 5KFCA 1A7GE 4O4RA 3VQSA 4IH5A 4O3NA 4DOZA 1NJZA 2FLPA 4A8QA 3G9CA 5M2RA 4KT0C 1NKEA 3MPVA 4DSJA 4O3PA 1PGZA 2P6TA 2FHJA 4B3OB 4DS4A 1XMBA 2W4CA 5HLFA 3L09A 2VG5B 1BC6A 2AYBA 4NLRA 4NLUA 3KLFA 1WG4A 3G8QA 4B3MF 2WONA 3OBIA 3RAXA 2QRRA 3QIPA 2LQJA 1NJIT 2I0XA 4RLEA 2CPYA 2VBYA 1H2VZ 3M1VB 2KXNB 3DLJA 2UUWA 1VQ5S 1URNA 2I8EA 5A8KA 2U2FA 3GIJA 2OH2A 4OX9F 1TKZB 1FK9A 4BS2A 2ZZNA 2CZVC 1XNQF 2GIRA 2PGCA 4ID8A 3RAMA 3I56S 3EPGA 4AL6A 3F56A 4LJMA 3NAIA 4A8KA 4QW9A 4ECVA 5AE1A 3MEDB 1U45A 4ECTA 2DRAA 3KNGA 1CQMA 1WF1A 3N0VA 3ZZRA 1SB6A 2YNIA 4NLYA 2B56A 1OO0B 3MEEA 5DG8A 4A8WA 2HHWA 3ICLA 3OXLA 2IAJA 1GH8A 4PG5A 4WKYA 4HH0A 2PMZD 3EUNA 5D3GB 5HQ8A 2GJIA 3TO8A 1WEYA 2DK2A 3M2RA 2LECA 1NAQA 2YWKA 3FQLA 2OPQA 3I0SA 2RRBA 2M52A 2QA2A 3NG8A 5J2QB 4QU6A 1RQ0A 3C6TB 4C11A 4YB5A 2HYIB 2HNDA 3SI8A 4FYDA 4AYBD 1YRTA 3P96A 2XGQA 4L6V3 1DZ5A 5K9FA 1UA1A 1BWEA 2XLJA 4DF4A 4QWCA 3KLFB 2WONB 4B9MA 3D0IE 4IR9A 1IM4A 2RDIA 3QIPB 1TKDA 1S1UA 2OPSA 3CGIA 1X5OA 4XDDA 1ZBTA 2RU9A 3K5LA 2FLNA 5F3TA 1JKHA 1UJ5A 4Y6IA 5A8KB 4X4RA 2XBPA 2QSFA 1E6YA 4WCEQ 2F7VA 1AUDA 1FK9B 2DTJA 2ZH9A 1GNKA 2BYCA 3KHHA 3DMJA 1N5YA 1NRKA 5HN0A 5A8RB 4YHHF 2P5VA 2FHOB 4DV1F 5CH7B 3OFFA 1WG5A 3PO4A 4FF4A 3TRGA 3H2LA 3MPYA 1X7VA 2ROGA 2XZWA 2OFHX 1Z2ZA 2OPPA 3ULHA 2BZ2A 3CC2S 2VZ9A 3MEEB 2KT2A 1XBWA 2IAJB 1N5TA 3RR7A 2F8HA 3K0JA 3GFXA 3MGJA 2HAIA 3LAMA 3LP0A 2KG1A 2BACA 1TK8A 3TVKA 3S1TA 3M2RB 5KG1A 1SKWA 4DV7F 2OPQB 2WK4A 4H4KA 4WXOA 3I0SB 2OAUA 3CT9A 3SCKE 4Q45A 2W9CB 3HFKA 4C11B 4BWJA 3K57A 2YX1A 2MYFA 2YKAA 1U1RA 1QTMA 2EG1A 4A47A 3RB0A 4OQJA 2C3OA 4CH0S 4AQYF 3KYLA 4M95A 4F4WA 4TYAA 4KE5A 3PDNA 1IN0A 3PRDA 2ZUGA 5KT7A 4TQSA 3PFEA 2QFJA 1YTYA 1WG1A 2OPSB 3NCRA 3UCGA 3OV7A 3GFHA 4CH1A 3TQ1A 1SQEA 5C24A 2KDOA 1CEZA 5EX3A 3CCVS 3U1MA 1JKHB 4KGKA 4QR1A 3OVBA 2QO3A 1GXTA 1PC4A 4R0EA 1C4AA 2PC6A 4Y2IA 2RT3A 3H4DA 4PXDA 5CCMA 3DMJB 4RW8B 3M2VA 3BJYA 3T1YF 4I56A 3HXMA 2Z2LA 1U1PA 3QPIA 1PO6A 2RUGA 2HGNA 1ZH5A 1JMTA 1S99A 2OPPB 5JJBA 2AF6A 4LVNP 1TL5A 4YQWA 3HHLC 1IUJA 4FF2A 2MHNA 2A2CA 1DJ0A 1FJEB 5IM0A 4BC7A 4JI7F 2PO4A 2B43A 3DDNA 4F02A 4USIA 1T94A 3NNAA 2GX8A 5KFYA 7FD1A 4F25A 1VRTB 4CO1A 1K73T 2JDJA 3DRPA 2B5JA 4ZPBA 2F3JA 4C3MA 1JIHA 2OP5A 4OHWA 1T3NA 1TQLA 3CF5Q 3BGRA 2HMIA 3U1NA 3QGPA 1S1XA 2YWFA 1FD8A 1GXLA 4KHMA 2K1RA 1JX4A 4JV0A 1GT8A 2QYCA 4J9QA 3OTEA 4WYLA 4ES2A 4ELVA 1U1QA 1Y0HA 2KN4A 3THVA 2PN6A 2MKHA 1R8BA 2R4FA 5C24B 2DIUA 4LVOP 1RT1B 4XAKA 1HMVA 3DOKA 1NK7A 2C3PA 3P49B 2CQBA 2XWYA 5KT2A 1QJHA 4BC9A 4ZPWR 3DM2A 4DF8A 1SL2A 3TI0A 2CKWA 2CQDA 3M2VB 2AJ0A 4QR2A 2R7XA 5IQ6A 3TUZC 4J9MA 2E9ZA 2XC9A 1Q79A 1KQSR 1VK3A 2BA9A 4RUAA 1KNZA 3UWTA 5GADU 1N34F 2LQ9A 2M5YA 4G1IA 4MTPA 1HNWF 4OI3A 2LU2A 4C7QA 3GYNA 1H98A 5IM0B 4RU2A 2JHEA 4HHJA 1NJXA 3T9NA 1KSPA 3MDFA 4C8NA 1C2PA 1TAQA 2JC0A 4K4YA 1LW0A 2B5JB 3DRPB 4KR0B 5IZHA 4N5SA 4FBUA 4RWXA 5E33A 2QT7A 1DLOA 1FVQA 4PKDB 5LSLA 3JB9k 3BGRB 1VRUA 3J80Y 3FJ2A 3FNNA 2HMIB 2B4OA 3G96A 2CJQA 5DG7A 2ASDA 4LQ3A 1HNIA 1H7XA 3OL6A 2MKCA 3DHXA 4IO9Q 4F8RA 1H2UX 2P6SA 1WWHA 2I5JA 1Q53A 1SJ3P 3I0RB 4NLGA 1XMOF 1K0TA 2YKPA 3DOKB 2HVZA 3LP2A 2OMOA 2DBBA 4DV2F 1RT7B 2EBGA 3KLIB 4DS5A 3PW7A 1D8YA 1S9GB 5LXYA 2N7CA 4DL0C 2O5DA 4ZVHA 2BM1A 1IXKA 4EZ9A 2Z4PA 4GKJF 3TYTA 4NLVA 5A6WA 2GC8A 5T7LB 2G1DA 4YMEA 4TU7A 3VALA 3VAHA 4K4ZA 1SKRA 3HMJG 2AGOA 1N33F 5K5MA 3FCHA 4DSFA 4RW4A 3O44A 2BABA 4QZVB 4B3RF 3ETOA 5KFAA 2CJ9A 2OJ3A 1IQZA 1R43A 1YRUA 1TK5A 5SUHA 5LT5A 4RBTA 1A6LA 3X3UA 5A6PA 2ZC3A 5DJBA 2VG7B 1X4GA 1DLOB 2IRXA 5A0YA 1VRUB 2B6AA 2OKQA 1TVRA 1FXDA 1F5CA 5B0AA 2ZJPQ 1SJ4P 1U4BA 1FJGF 4WFBQ 2R7UA 1F2GA 3M6XA 1FEHA 5SZTA 1J5EF 4ZP6A 4C98A 2KKHA 3MUMP 4KJIA 3H5SA 1VQLS 2Y1IA 2WSFC 2GMHA 2MHEA 3PEHA 1FNMA 4QIGA 3TUIC 5F9NA 4YR2A 3HHNB 4L3NA 2L41A 4DSEA 2FVPA 3PW5A 3W3SA 4ITSA 1QAYA 2IC3A 4JI4F 3HJFA 5D4NA 3TARA 3LP2B 3MFIA 5KFZA 4WKRA 4W90B 4KPYA 1DQ9A 2AQ4A 3BN7A 2KG0A 3QAUA 2J9DA 3MM9B 5F0UA 4QWEA 1HBUB 3GR0A 2OSRA 3GE9A 3C2PA 4IR1A 1Z2LA 4LF8F 4ZHRA 1SL1A 2DB1A 3T5HA 1P9QC 2WHOA 5FD1A 3DDKA 2GGPB 1SKSA 2CQ0A 1M5OC 2NR0A 4QPXA 4RW4B 3LF0A 1ZAWA 4C97A 5B0BA 3CMAS 3I32A 5L9XA 3G6YA 2DNLA 1T7PA 4Y2CA 2VPYB 4D3HA 1VQNS 1FDDA 2J7UA 2IM2A 5A0YB 3FGVA 5HMWA 3J81Y 1YQHA 2B6AB 3B8HA 3P5TL 1OPIA 1VQSA 2K7JA 3B78A 3SYZA 3FRYA 2DISA 3BSNA 3S8SA 4DR1F 4EO6A 3HP6A 1I1GA 4NLSA 2APOA 2YKOA 5G4DA 3JSBA 2HFNA 3PR5B 1X5TA 5EGYA 2MQOA 2VA3A 7FDRA 4I6WA 4CO4A 3M4XA 1B64A 5L1IA 2UVUA 1YJWS 3H20A 1V6HA 1G7CB 4DQSA 2AYGA 2IJFA <