5K9FA

Crystal structure of a nipsnap domain protein from burkholderia xenovorans
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
b'MLVEQRTYWLKPGSVSTFLSLYEAEGLAIQAGALGRLLGYYFSETGDLNRVIQLWGFDSFEDRTRRKAILSGNPQWKSFVGRAGSMIERQSTELLTPAPFSPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NIPSNAP domain protein
publication title Crystal structure of a NIPSNAP domain protein from Burkholderia xenovorans
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Structural genomics, unknown function
total genus 33
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07978 NIPSNAP NIPSNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k9fA00
1KQKA 2OD6A 4YDXA 2OKQA 1TR0A 1GXUA 1Q8BA 4HH1A 3BDEA 1VQYA 1S6OA 2XMTA 2ASYA 2K1RB 1KVJA 3HHLA 1X7VA 1YJUA 2G9OA 3IWXA 2ZDOA 5IXUA 4QOTA 1P8GA 2BUNA 2GGPA 1WD6A 2BBEA 2IYGA 3FRYA 3BGUA 5A6WA 1AFJA 3LGMA 1Q53A 1GXTA 5B0CA 2AW0A 5B0DA 2PGCA 1CC7A 2PD1A 2GGPB 1R6YA 4FNHA 1FEEA 1OPZA 1TUVA 2KT3A 1V3ZA 4YEAA 4EFAC 1AW0A 2N7YA 3WDOA 2GFFA 3F44A 5B0AA 2ROPA 4A4JA 2ROEA 3KG0A 4A46A 3MCSA 2HFNA 3KKFA 3MZIA 3TRGA 3KG1A 4F67A 3BB5A 3BR8A 2Q3PA 2VH7A 3DCAA 2LXFA 4A48A 4DPOA 1OQ6A 2IFXA 2HLUA 4OJ3A 3CJKB 5KAKA 1KVIA 3KNGA 4Y2IA 1S6UA 1ULRA 2BJDA 3HHLC 1JWWA 2KT2A 3BM7A 2QLXA 2XMVA 1XBWA 4FNIA 3GZ7A 5B0GA 2QLWA 3K7RA 1QUPA 1YJVA 2KYZA 3HHLB 4NPOA 1FVQA 1FESA 1VQSA 1CPZA 2L3MA 1JK9B 2HIQA 2W4DA 2RILA 4OJGA 2GA7A 4HI1A 3UDCA 2FHMA 1SB6A 2BYCA 1N5SA 1X0PA 3BF4A 1W2IA 4OJHA 2GV1A 2K7KA 2GO8A 2XMWA 1Y3KA 3BN7A 5F0UA 3FMBA 4HH0A 4DL0C 1Y9OA 1TL4A 1OQ3A 2LDIA 4HL9A 1YJTA 3FGVA 1AFIA 4DN9A 2OMOA 3T9NA 1CC8A 2W4PA 1U7LA 2KKHA 4ZOSA 2ACYA 5B0FA 3TNVA 5T7LA 3TOQA 2JDJA 1Q4RA 4Q2MA 2XMMA 5B08A 1Y3JA 1YRXA 2RSQA 2ROGA 2N4DA 2QIFA 4HI2A 5K9FA 4OIXA 1SI9A 4OJ1A 1TL5A 4Q2LA 2OFGX 3QMQA 4ZA1A 1P6TA 2AP6A 5B0EA 2EW9A 5T7LB 3QGPA 2XMUA 2AJ1A 1K0VA 1OSDA 1X8DA 2IYIA 2K2PA 3HDSA 2K7JA 5F0WA 2LQ9A 2BJEA 3HFKA 2HFOA 2FIUA 2XMJA 2VV5A 2RMLA 3LO3A 4Y2MA 4Y2KA 1N5QA 2OFHX 3DXSX 4U9RA 2N4CA 2OD4A 2RU9A 3HX9A 1LQ9A 5A6PA 2ZDPA 1YJRA 2OP5A 4NL5A 1N5TA 5B09A 1RJJA 2W4CA 1FE0A 5B0BA 2XMKA 1MWYA 3I9ZA 2CRLA 3LGNA 2LQBA 1IUJA 1YG0A 4A47A 3HHLD 2HQIA 1APSA 1FE4A 2FB0A 3IWLA 1FVSA 2FTRA 1FD8A 2AJ0A 1Q8LA 2GCFA 1MWZA 2OAUA 3VTIA 3CJKA 3HF5A 1URRA 1Y0HA 2HLTA 1SQEA 3E8OA 1N5VA 2QYCA 2K1RA 1TZ0A
chains in the Genus database with same CATH superfamily
3IG1B 2EFNA 2DR7A 2GIFA 1DFDA 1S0VA 1CJVA 1VK8A 1WF0A 3CDEA 2X3DA 5AXMA 3QAUA 5GMDA 4A46A 1BE4A 4LF6J 2RNEA 2GQ2A 4FYYB 2EKYA 1J5OB 2DH8A 1WC1A 4IFVA 4ENOA 1WKLA 5HMYA 3UO0A 2HAIA 2FVCA 3UDCA 2DY1A 2HG4A 2FVSA 2P9GA 4RU2A 3E2EA 1SV5A 2GW8A 1M5HA 2BM1A 2YKAA 3KJVA 2CQPA 1UVLA 1VIOA 4IH6A 2MQMA 2HRTA 3UN2A 4NEZA 1M90T 2ZZMA 4P10A 3HPOA 1JLQA 1VRTA 3MEEB 2EXUA 3TAPA 3S8SA 1WJ9A 3O2IA 4K4TA 3CF5Q 2KI2A 1GMWD 4R0JA 2UXBJ 4LF5J 4MKVA 1FEHA 2ADCA 4K4ZA 5GAGU 4IR1A 2PDAA 4E2FB 4FS1A 2LXUA 2AX0A 1RT1A 1VJQA 4FYVB 1KLMB 1VQYA 5F3ZA 2IMOA 3MR3A 2DEJA 1R43A 3PYFA 4MK7A 4F25A 2HHTA 1KC8T 2CAJA 1VRUA 3I32A 2V4JA 2B7BB 3Q8PB 2VF3A 2ZJPQ 3WX4A 4M5DA 3B6BA 2R7UA 1RWWB 1WORA 2GHWA 2MY8A 4NCGA 1RU1A 3PR5B 3KLEA 1TU0B 5HBMB 3BSNA 5HK4A 4I7FA 5HI7A 2RILA 2CJ9A 3OUYA 4IDKB 4QR2A 1ZTTA 2XEXA 1Y5IB 2J0QD 3OTEA 4AL7A 3RB3A 4MIWA 5DQIA 2D9OA 1Y3JA 4AD6A 1HI0P 4DUZF 3QMQA 3O3LA 3QGPA 4RW7B 3M8QB 5KG1A 3TJ8A 5AXNA 4KFBA 3EZOA 1PC4A 4B08A 2RD5C 4JV1A 3LPEA 2Z2YB 1N36J 5F3TA 3DU6A 3MD1A 2NXCA 3H2UB 4QR1A 4L3NA 3MFHA 2EPIA 2PN6A 1VBKA 2MKSA 2GAGC 1FX2A 3JSRA 2E66A 1D9FA 2C3MA 1EETB 4J5OA 5LSRA 5DG8A 2FLNA 3LP2A 2U1AA 2DGTA 2J9DE 3IGVA 2JEFA 2FZCB 1TMJA 1DRZA 5C24B 3K0JA 2UXCJ 1UPMB 3SCJE 1RKJA 4A8XA 4YDDB 5HATA 3DLKA 4DN0A 2CQGA 2F8MA 1YZ7A 1PG5B 1B64A 2F8EX 3GSIA 2V0NA 2JJ4D 2VHGA 3NBPA 4PQUA 1GXLA 4TKTA 4CO3A 1XJWB 1N33J 4K59A 2HFUA 1T7PA 3CXCR 2YWEA 1WF1A 4CO4A 2ZITA 1YRXA 1RE1B 4N76A 4WU2A 4I2PA 1RT5B 3GU0A 2WW8A 2LQ9A 5HMWA 4X4NA 2FIUA 2ZH2A 2WSFC 2M4MA 5AE2A 1HKAA 1HL6A 1HWIA 3QT6A 3DOLB 3JSBA 4OZ3A 3I56S 3FZBA 4DX7A 4OHXA 2FTRA 3OHBA 3NMAA 3V4IB 1FK9B 3GLJA 1Q0NA 3R3TA 2A18A 2ZD1A 1YX2A 4PAAA 4DG1B 2G9OA 4ES3A 3CD7A 1RISA 1S1XA 1RWMB 2E1MC 4OZ0A 4QIEA 2VG5B 2BE2B 4QYZJ 2NYHA 1D9DA 4J91A 4JI5J 2CNLB 3T1YF 2V50A 1QE1A 4GO5X 2VPWB 2ASLA 3CCQS 4UY8T 2F65A 3J7Z5 1FRHA 1A7GE 4NYOA 1ZBTA 4C4WA 2V34A 2VASA 1Y3KA 4UY85 1T9TA 3NGSA 1NK9A 3SFUA 4K7QA 5D0GA 3M2RA 2V2KA 1UJ4A 4CNYA 1M5KC 2R3VA 2P8IA 1SI9A 1UVJA 1F6TA 2D74B 1TKTB 1KS2A 4OQJA 2IYIA 4PRFA 1EB0A 4CM0A 1NEEA 3DXSX 2HRYA 4RUAA 3Q24A 2CVEA 3IBCB 3IM9A 2OPRB 2B3TB 1YJNS 3R1LA 4CRJA 3C15A 4JV0A 2DH9A 2B4PA 4DR7J 3KHHA 2E1CA 2QYCA 4H4OA 3N28A 3CNQP 3TVZA 1X7VA 5K14A 4UW2A 4OYOA 1QSLA 2PSZA 2UXDJ 5DDRC 2G2ZA 3JQKA 2KM8B 1QTMA 2DR8A 3DM2A 2DEIA 4LFBJ 3KK1A 2LXIA 3H59A 1TK0A 4JYAJ 2D3OR 1IBMJ 4KJIA 2R42A 2FHMA 2V2VA 2WB1D 1WC3A 3FMBA 4CO1A 3UNYA 3DRPB 3I4PA 1M1HA 2CJXB 4LF7F 4EBEA 3D68A 1D1UA 1JLBB 4F50A 1FHTA 3LOUA 4ITSA 3CWJA 1NPKA 4PXCA 5A0YB 4JOUA 2KZZA 1ZM3A 1FNXH 3BZQA 4ZJLA 5D3GB 3RTVA 5KFFA 1FFGB 5I3PA 3M8ZA 2X1BA 3R5DA 3ILJA 2KU7A 3EM1A 3C14A 4ZPWR 1KQKA 1Q8KA 1FXDA 1GQEA 1XIQA 5DZ7A 2VD3A 3IMQJ 5CYMA 4WTYA 4X4SA 3IRXB 1C4AA 2HGLA 2NPIA 4M5LA 4OI3A 2QSWA 1WEXA 4P7TA 3K89A 4F0MA 2XY5A 4HHJA 1NK0A 2CYYA 5B0AA 2DNQA 1L5UA 1VGYA 3BS9A 1SXLA 3MM7A 2ADBA 3BBFA 5LXRA 2MDAA 2Z30B 3JTNA 3K7RA 1P9QC 1IKXA 2RVJA 1S6QB 4NXNF 1OWXA 3JAMY 4B3MF 5KG3A 2POKA 2DD8S 3J80Y 2LP4A 1JJHA 3CPWR 2XS7A 2DPIA 3QT7A 1LK5A 8AT1B 1ICEB 3SDEA 4L76A 4YHHF 2KYXA 4W4MA 5B0FA 1KTQA 3JQJA 5J2NA 1NK5A 3UD5A 3V6JA 5T41A 1NDCA 3IC1A 2OD4A 2CKWA 1RWUA 1H98A 3HVTA 2XMKA 2BKNA 1EAYC 5C25B 3ZZPA 1HI8A 3HCXA 2OEMA 3I9V9 4ZN1A 4BDPA 2FVQA 1RT7A 4F4YA 3JB9k 1BQMB 2BE9B 1S0MA 2QC3A 3MMAA 4OX8A 4WK3A 4B3RJ 2H51B 1TUGB 3D3BJ 2ZH3A 2B56A 1U2FA 2DNOA 3BR8A 3RU0A 2HNZB 2XLIA 3WC0A 2XCAA 1FCAA 4EWTA 3PO5A 2A2DA 3P49B 1FDDA 1LW0B 2VODA 1UA0A 3IN5A 1O51A 4R8UA 3EX7B 4HHHA 2H65B 2NPFA 2OMOA 4GVBB 1FNMA 3EGZA 1F9FA 3TOQA 2EC0A 4CTAB 3GJSB 2XYGB 3DDKA 4WZMA 4TYBA 4LFAJ 4NI2B 2VU5A 1B0PA 1MW7A 1GNKA 2R7QA 3M32B 3DGVA 1QAXA 3F0NA 1J5OA 1SUQB 5KFLA 4KPYA 3IWXA 4JI0J 2MZJA 3VAFA 3T1HF 2FPHX 4IOBA 4LF9J 3P5BP 4PKDB 2KT3A 2D7SA 3EPGA 4TQRA 1XR7A 4LFCF 3KNGA 3UWTA 3MEEA 5KFTA 4ELTA 2X1FA 3P96A 1WOOA 3BQ1A 1HW8A 3EDRB 4N47A 2GV1A 3UCUP 4DV4F 1LWCB 1PO6A 4GC6A 4DL5A 3NL0A 3MAAB 3OFHA 1Q4RA 3P6YC 5JMNA 4DFMA 3ZTOA 3JSMB 1KOOA 5IC6B 3CO0P 2K2PA 4LT6A 1BHNA 3O1LA 3MMBB 3AY0A 4OMFG 5AXKA 2R8KA 2RU3A 1FE0A 1HNZF 1QDUB 3GG1A 2YPZA 2ZH6A 4M95A 1RAJA 5AT1B 3C16B 3RB6A 1AROP 3MPWA 4URQU 1IBCB 2AYBA 4E8UA 1IQZA 3MI7X 1A9NB 3HHKA 2XULA 4DV0J 1V5VA 1TKZB 4M5NA 1BC6A 2GVZA 4X4OA 1NUEA 4PG4A 3M1VA 3WDOA 4X4QA 4A4JA 5H9FK 3DNCA 5L38A 3J7A1 3SCKE 2YKMA 1PBAA 3PRDA 4RW6A 1PBUA 2PE8A 8RUCA 4DV6F 1YJVA 2EWHA 3C8YA 4ED7A 3SFGA 5C2GA 2BEFA 1H2UX 2KN4A 3AXKA 5LM7E 2ALYB 2WBMA 3N6MA 2HFSA 3EXCX 1U26A 4Q43A 2W2MP 1CEZA 4FPIA 2F3JA 4UTGA 2IBKA 1Q82T 4PXEA 3G71S 2QG9B 4C3MA 3GTYX 2MQQA 5B0BA 3M2VA 5KT3A 2MLXA 3OLAA 3TANA 3ZXWA 5LOQA 5EWGA 1RT4A 4KB7A 4I69A 2VBXA 4J9MA 4DPUA 4ETXA 5A6WA 2G0CA 3FDSA 1S79A 5M2PA 1UP1A 2HFZA 1DQAA 4KH0B 2AGPA 1NK6A 3G86A 4YY3F 4P9SA 2BKPA 3TUIC 4P6QA 1UJ6A 3PW4A 2J6TA 3I0SA 1K1QA 2DYAA 2O1PA 3BBCA 2KH9A 3HHLB 3IBFB 3L7OA 2GQQA 4ED3A 3CD5A 3VF0B 2F4VF 3K59A 3PEJA 4UUXA 1TQLA 2RDIA 1AT1B 2ZOMA 2LDYA 2VG6A 2HS3A 1SPBP 4DG1A 4GKKJ 2GJ2A 4Y2MA 1HBMB 3AQOA 1Z2ZA 5AJ3J 1DTQA 4DI6A 3ZNJ1 3MWBA 3DRSB 4ZDNA 4XAKA 3IXQA 1JLEA 3UVJB 4OJ3A 5HMZA 3CULA 3KUEA 2G0IA 2MQ8A 2RE1A 3W62A 4RWXA 2BBEA 3MCNA 4N41A 1NJYA 2FQQB 4FNHA 1NRKA 3ADAC 5MLCV 2M52A 3BQ0A 4O4GB 4USJC 2YNFB 2W9BA 1KQGB 1VCTA 1TKTA 4ZHRB 1N5SA 2Y1JA 4LRDA 3SSSA 2BRKA 5L46A 3DFEA 1IQTA 3EE3A 3ZFVA 4HVZA 2NSCA 3A8IA 2GC8A 2BOPA 4X65F 2G1HA 1EKRA 1YRTA 1S97A 1YJWS 2MZTA 2BE7D 5HVGA 2DR9A 4A8WA 5DLGA 3KLFB 2RF2A 5CZXA 4FVMA 1UPPA 3KTQA 1REGX 1HD1A 2HQGA 3ULHA 2CQCA 1I51B 1PYTA 5KFAA 1NK8A 2VG7A 9RUBA 2Q66A 2MKCA 3H5UA 4D3GA 3DRPA 3ZNUA 5E3RA 3D0IE 1RBAA 1Q7LB 4JI6J 5LT5A 1AZSB 2KXFA 1FESA 4FPRA 1HNIA 3UFCX 2IA0A 3DRYA 2N7CA 2FJBB 3MM5A 3DI6A 2UXBF 2QLBB 3GJRB 3DLGB 1NHKL 3VVTA 4N7TA 3UCGA 1ZH5A 2PA8D 3DN9A 4I67A 2N82B 1FKOB 2OPPB 3HDSA 4BHQA 4CO5A 4I0WA 4IH7A 1DURA 3BO4A 4DR3F 4M5JA 1REVA 3M6UA 4OYBA 4ED0A 2B9XA 4ANEA 1XK8A 4NLTA 3NOCA 4RU9A 1HYSA 4LRFA 4ELUA 3KOAA 1L3SA 2DITA 1RA6A 3W63A 4NCAA 3NGUA 1IJEB 2M3DA 3DGPA 2XY6A 3NS7B 2AW0A 3AA8A 4ZN3A 2J6UA 1QM9A 4I1TA 4F4KA 4LQ9A 2QFJA 3RBZA 3VAHA 2DGSA 3ZZRA 3TUPA 3R5BA 3W5ZA 5F9NA 4QZVB 3CCMS 2ZH9A 1VQPS 1OS5A 4WTOB 4OYIA 1TL1B 1NK7A 1HWUA 1KHWA 1HWKA 2W8KA 5L1KA 5GAHU 2XSJB 4RW4A 4EK2A 1N36F 5C25A 2QEXS 4QIGA 3DLBA 1RWNB 2JDJA 3IA0A 1S59A 2HVEA 1TL5A 5B0EA 2DGUA 2QLFB 1BQMA 1S1VB 2DJWA 4LRCA 1Q78A 4DPYA 1D9AA 3BGRB 2HPUA 3Q0AA 2MZSA 2CXEA 2MSSA 4LBIA 1HNVB 1YG0A 2I5JB 2HNZA 3RAQA 2UXCF 4UOCA 1SH2A 2CNKB 1LW0A 3LWLA 3GE9A 2E44A 3CCRS 4PWUA 1VJWA 1PJ5A 1WHWA 1N34J 1Q81T 1RA7A 2GGPB 4P2FA 3PJXA 2NUHA 3CIZA 2LU2A 2KFYA 4PWDB 3UDEA 1WNEA 5RUBA 2CZ9A 2HZAA 4MK8A 1S1UB 3G8QA 4NI2A 2LEPA 2HNDB 2MSTA 7AT1B 1Q7YT 2HGNA 1IWGA 2LA4A 2FGOA 2YX7A 3M32A 2ZC3A 3N79A 2FHOB 1C0TB 3I5AA 3PDNA 1B0TA 3QFWA 5C2CA 1XNRJ 1NB2A 1F5CA 3AT1B 4WK1A 3PYDA 3AOCA 4FF1A 3QSIA 3G6XA 3CDAA 4QBUA 2VA3A 4JI5F 2OPQA 3HFZB 1RT6B 1UW4A 4FN5A 1MMLA 1I5OB 2PA3A 4DUTA 1T3NA 3J81U 4ZLPA 3B8HA 3GR1A 2C2EA 3KUGA 3LP0B 3R1HA 2FY1A 4NA2A 1BQNB 3A3PB 2OHDA 4H4KC 2CZVC 2WB4A 4O44A 2HFVA 1LWCA 1ZAXA 1V3ZA 3IR7B 1RTIA 3D9BA 4TU9A 3DCAA 2IFXA 4P2SA 4CLWA 4WFXA 3FBFA 2BJDA 2B6AB 1R27B 1FVQA 1XR5A 3AD9C 1KSPA 4NZ6A 3MAQA 3CCES 5J2QB 4Q8FA 1R0AB 2EFVA 4FBUA 2NUUG 1WC6A 3PNIA 4DR7F 3W64A 4FBTA 1YKWA 2ZH5A 4QPTA 2E9TA 2FLPA 3GIJA 3US5A 1TKZA 3HXMA 4U7UK 4JI1F 1LWEB 4KGVB 4LFBF 2FB0A 5F8HA 4WXWA 1L3KA 5CZVA 1MWZA 4JYAF 2GHVC 1D09B 1SCJB 1W26A 1IBMF 2OGUA 2CQ1A 3BR9A 4IOCQ 5EHHA 4DOZA 4X62J 2PI4A 2DK2A 3C6UB 1VBZA 2GFFA 5KFQA 1GMWA 2VQEJ 5E0OA 5F8MA 5J1EB 1DHMA 3OBIA 4OZ1A 1Q5YA 4UQTA 3KK3B 3G6ES 2QLWA 4G1PA 4WZQA 1TKDA 1T03B 3K57A 2UVUA 3C6TB 4ZP6A 1FKPB 1PGZA 2UUBJ 3VZHA 3OTOJ 2V9KA 1QSSA 3UE2A 3T9NA 4PEOA 3PKYA 2MB0B 1RZMA 3UCZP 4IRCA 3AJ2A 3H8YA 2IVMA 3PW0A 2FY8A 4IG0A 2YWHA 2A1BA 1OSDA 4OHVA 4RR5A 4ZVGA 4KPCA 4MH8A 2BXJA 3S7RA 2F63A 4X4TA 2VPXB 3DRRA 1OO0B 5IT0A 1U1NA 3Q8QB 1RHMB 1GXUA 5GAEU 3GJQB 4CLYA 3HHLA 4A8YA 3K5NA 2V8GA 3H90A 1HIYA 1CC7A 2MHNA 1VDHA 2RS2A 3EDQB 2WVFA 4ES2A 3FBBA 2BANA 3TVKA 2Y8YA 2GNKA 5JJBA 3CT9A 1ULRA 1B3TA 3BM7A 1SJQA 4P71A 3KHGA 3L7PA 1HBMA 4HLBA 1Y5NB 4WFNQ 3SYZA 1FWPA 2EG1A 4WPAA 1JLFB 1AFIA 1EARA 3D54A 2MKIA 1N5YA 2DRAA 4Q2LA 4KR0B 3A13A 4DBQA 4E98A 4J9KA 3ZTQA 2HWHA 4C0BA 3MTJA 3H5SA 2IHR1 5KFXA 1M5SA 4OHZA 3GYXB 4B3TJ 3OL8A 4C8NA 4O4GA 1RCOB 2OAUA 3HT0A 2YNFA 3VTIA 2EKNA 1KR4A 3HKZD 1TELA 3MM6B 3GCWP 3W9JA 2FYXA 4ZHRA 1S9EA 4EZ9A 3A4TA 3HD1A 2AJQA 3SI8A 2GX8A 3W2VB 4N8NA 2HFNA 2WSCC 3QJPA 2CADA 5F8LA 1T05B 3CEDA 4A48A 3KJNB 2H5JB 1NDKA 2IMWP 3T5JA 1TKXB 1PSDA 2XMVA 4TU7A 1JJCB 4LFAF 5ETQA 3RRKA 2VICA 3OR2B 2HWIA 2QZ8A 2HS4A 5GVQA 1N6QA 2PMZD 2N4DA 2C3YA 2C2DA 2B51A 5KFPA 2VFTA 4KTQA 2WZ1A 3RYLA 4TLQA 3MMCA 4JI0F 2Z2MA 1NJWA 4OX6A 2IRYA 4LF9F 1JKHB 3GB0A 3EZ5A 2KRRA 3CSKA 2OKQA 4NOHA 1N32J 4O3PA 5M2RA 1FF2A 1YHQS 4RNHA 4C0OC 4F2SA 3BH6B 5GADU 4WWSA 4C11A 1HBNB 1U1RA 4G65A 3Q8SB 3NAHA 4P72A 1QAJA 1WEZA 3CE8A 2YNGB 1NO8A 1MROA 2F5GA 4DSLA 1BMQB 1LV5A 2X1AA 4U96A 3OTDA 4ZPTR 2VFRA 2L3MA 1IWAA 3MM9B 3Q8UA 2E5JA 1ACMB 3NCRA 3D3CJ 2QFIA 4YR2A 3OXFA 3N9UC 4RUBA 1C1CA 4WJBA 2YXLA 2DIUA 5CHCB 1JIHA 1S4EA 3FFIB 1EP4B 2RDJA 2YQ1A 4AXJA 2KDOA 1R6VA 2A6OA 1M5VC 2EG2A 4MYUA 2HHPA 3KHRA 3D0HE 3RAMA 1T9UA 4DSKA 2LEAA 1E6VB 4DV2J 4C3KA 4DV0F 4WP3A 1D0EA 3Q2TC 1GAOA 2IJRA 1FT8A 3LWMA 2GCFA 2AZ1A 5F8IA 1N8RT 1S48A 2BACA 3OW2R 1OIAA 4KQZA 1TL1A 1WHVA 3DLLQ 2YX4A 3NKYA 4KV8B 5C42B 1GTEA 4KGZB 3OVAA 3TAMA 3KKFA 1NJZA 2KHDA 4M94A 2BR0A 2GZOA 2J7WA 2V5HG 2VC1A 1DTTA 4DPWA 4HTIA 3RAXA 5EUHA 3B4MA 1BWEA 1HNVA 2R2RA 3VCDA 3GR0A 5KFRA 2O5DA 4R0EA 3ELHA 1QAYA 2XMMA 1JLCA 4YMEA 5KFNA 2HFOA 4LR8A 3CC7S 2XMJA 3HX9A 1HI1A 5LSOA 2WVCA 5ETVA 1QUVA 3I96A 1MMDA 4WFYA 1ZOTA 5HROA 4YB7A 4AYBD 3MPDA 4EU0A 1HQEA 1RAGB 3KLGB 4IOAQ 4G6VB 2CPYA 5LMUJ 4GVLA 1RGVA 2IY5B 2ASDA 2UUAF 2HZVA 1G1XA 4K2JA 4MKYA 1OPZA 2C2MB 4RW9B 5BXIA 1C0TA 4F67A 2XS5A 2YQ3A 1LK7A 1LEOA 2A3JA 2V94A 3GCXP 4DX5A 4ECRA 2B4UA 2WTFA 4IUFA 4GKKF 2RRAA 1WOPA 2FLLA 2HQDA 4N5SA 4F3QA 5AJ3F 3MMJA 2KKHA 3MUTP 5T7LA 1RT6A 2M88A 2M8DB 2J9DA 4X4VA 4AXIA 3PO4A 4Q8EA 3Q83A 1S76D 3LP0A 1JLQB 1BQNA 1VRTB 4RW8B 4TVAB 3CO9A 2PMHA 2WOMA 3LGNA 3HP6A 3CDBA 1APSA 1GMVA 3KG4A 2HNYA 5KFMA 1SQEA 5ETRA 1PJ6A 3V81A 1RT1B 2B6AA 2BJ1A 2E7WA 2YWKA 4FXDA 3TUZC 3TW0A 1U09A 3CCTA 2QTWA 1R0AA 1F9HA 2VPYB 3D6TB 1PJ7A 3F44A 2Q6BA 1EIYB 1VRUB 4F3OA 3QRPA 1HHQA 4RWWA 5I42A 1JB0C 2BX6A 4CLPA 1ZA1B 3NWRA 2VJVA 2B9YA 3NAIA 2C2OB 3KLEB 1WC4A 4I7FB 3FSXA 5F0UA 5L1LA 1LWEA 3K8WA 3HD2A 3OUYB 1TAQA 4ZVUB 4DHVA 4IG3B 1RWOB 1RYRA 4ZVEA 2AHOB 4G1IA 1RBOB 4FXVA 1XMQJ 1QVFR 2DGXA 4U6PA 3UDVA 4KFBB 4J9PA 1MN9A 3TVYA 3C6UA 2VONA 1S77D 2YWWA 1X5OA 4I6AA 3QZ7A 3OJSA 2IRUA 2ZHOA 2VDIA 4JI6F 2VA2A 4CNZA 2B8QA 2F9JA 1WD6A 3U02A 3FRYA 5JUMA 4DS4A 2BQ3A 3C6TA 3TYTA 2LQ8A 4ED8A 2DXDA 2G0JA 5I3UA 3GG0A 1AW0A 3LP2B 3UD3P 2QMUB 2EI5A 3R27A 5DQHA 2R7XA 4DDFA 4DF8A 3TO8A 3CMES 4J9VA 2HGMA 2IIHA 3QJJA 5L39A 3DLKB 4XO0A 4LVNP 4HH0A 2H1YA 1M0SA 2KVQE 5BR8J 3DKDA 1CC8A 1FFSB 2DPJA 3DLHA 3NBPB 4PQUB 2AJ2A 2ROGA 3MTKA 1O6XA 1K1SA 4TU8A 1DQ9A 3QO9B 3GONA 4ZP7A 3D4JA 4NLPA 4OYAA 1FX4A 2M2BA 3LP1A 4F8RA 4C8ZA 1IUJA 4PUOB 2Y8WA 2W7OA 2DO4A 3N5FA 4AFFA 4M8LA 2IAJB 4UUWA 2EBGA 3ZZUA 1YITS 4Z2XA 4O3OA 3HVRA 1X4HA 2P2CB 4USHA 2ERRA 3SCLE 2ZD1B 1NJXA 2AYEA 4P2XA 4WFBQ 3NG8A 4ZK7M 1S1XB 3T1HJ 2OH2A 1X4BA 1TK5A 1W2BR 1GT8A 5HMXA 2BM0A 2KRBA 3MEGB 1HNWF 2B9WA 1NU4A 1QE1B 4J9QA 4KAIA 3M8WA 1QJHA 1DJ0A 3V6DB 2UUWA 4JI2J 2H3EB 2H4WB 2OSQA 3KUHA 2QA2A 4B3SJ 1TL7B 3RBXA 4W92B 2MZRA 3M8RA 3M2RB 3A3NB 3D0GE 2ZBIA 2EK6A 3PACA 5GAEI 4EI2A 5CQGA 2M8HA 3HFKA 1H38A 4MIBA 2GJIA 4USMA 1U1OA 2CFXA 3SQGB 1XEZA 3W2VA 5A76A 4K4SA 4P74A 1HNZJ 3SV4A 2BMBA 3SXLA 1FA0A 3MOZA 3QWUA 3C15B 4P7VA 3S6EA 2R7OA 3BBBA 4HT7A 4TXSA 1JLAB 3BO2A 5B0CA 3E01B 5K14B 2RT3A 4J9RA 2JFKA 1DQ8A 3NP5A 1SL1A 2YWFA 3OR2A 1WTBA 2PO4A 3PHTA 1KD1T 1FXRA 3KK1B 2DNHA 2NLWA 1WTFA 2KT2A 1XNRF 5A8WB 2E29A 1RWXB 4BC9A 4JB8B 5IT9U 4DV5J 1RHRB 4UT4A 2DBBA 1NXIA 2AJFE 4PYAA 4RNOA 3DLJA 3IS9B 1S72S 3NNAA 1JKHA 4F4AA 3WBZA 2DR6A 4YFUA 3BKUA 6AT1B 1F2HA 5HN0A 2OSRA 1NJIT 3NGTA 1HBNA 1Q8IA 4J7CA 4DQSA 5KT6A 2CPXA 2LEBA 1GEHA 4C3LA 1S10A 2YNGA 4NLDA 4V19X 2ZE2A 4AL6A 2HLTA 5IZHA 3W65A 1F0XA 3C14B 4O3SA 1QY7A 5F8JA 2ZVSA 2D9PA 1L3TA 1VRQC 5CYMB 2D1CA 1HBOA 3O5TB 3CCLS 4DR2J 2IJNA 1WACA 5I4MA 2VQFJ 1S1WB 1EP4A 3OV7A 3U7JA 2JSXA 3H40A 4KIAA 1OY8A 1U1PA 3MM7B 3HSDA 1CPZA 3V6KA 1X0PA 2B8PA 1IKXB 2PEHA 5J1PA 1NZ8A 1NSAA 2CA9A 2F4VJ 2B5JA 5EN1A 5B08A 3SDEB 4L72B 2E5IA 4WYWA 1C0UA 2EFQA 2HRUA 3VGTA 2F1FA 1NBEB 5J2NB 1O0PA 4N8OA 2UUCJ 5GADI 1PAEX 1LQ9A 4X62F 1UFLA 1B99A 1UEVA 3VR1A 4PR6A 2AJ0A 5HLFA 3G96A 1FJCA 4WFZA 3R7NB 2C3OA 1RABB 2B0GA 4KC5A 3BN4A 1RT7B 1X0FA 4B9LA 4ED4A 1RK8A 2JVOA 1LOUA 4KGKA 2ZM6J 2X7IA 2CQ0A 3VAGA 2X51A 2UUBF 1RTDA 1Y11A 3OTOF 3OFEA 3MMAB 2Q3PA 2R2TA 3G82B 1X4CA 1P1LA 5K8PA 4LF4J 2Z4PA 3CDUA 2LVWA 2BQRA 4DLGA 4DV1J 1Y4ZB 3NS5A 3QLHA 2YNHA 4NLGA 1XMOF 2YH0A 4BBYA 1HHTP 2ZUGA 5FLXY 4DN9A 2ZUAA 5DGBA 3CVKA 1GH8A 5LXYA 3FZ2A 5CD4A 4KT0C 3OXGA 4ECVA 2BJ9A 3BV8A 4QWCA 2PT0A 4X65J 3K17A 4ECXA 4LR9A 3SIPB 1LXJA 5IWAJ 2W4CA 2G13A 2LMIA 4RW9A 4B3OA 3M2UB 3GILA 1URRA 1YWXA 3P5TL 2SXLA 1TVRB 2HMIA 2F4FA 4DR1J 3Q86A 4F4WA 1KFDA 5J2MB 2LLZA 2BUNA 2K3IA 1VC5A 1ROFA 1S4FA 4LJMA 4NLUA 5A2QU 1TUVA 4OI2A 1CBKA 3LANA 4ECTA 4PPDA 5DM7Q 1K9MT 4N56A 1FTRA 2BKOA 5JXSA 4ED5A 4TYAA 1K8AT 3H98A 4UOHA 3KDNA 1H7WA 1EKSA 4RW8A 5KFHA 4C97A 2UVRA 1TL4A 3UW1A 2ATLA 1JMTA 4B3TF 4DPTA 4PXDA 3HULA 3PIPQ 2P9EA 2ZH4A 1VR6A 5KFEA 2XMUA 4N77A 4M5HA 1VMBA 1VIXA 1DAXA 2B9EA 1UVNA 3CJ5A 4Y6IA 3TWZA 2Z56B 3JYTA 4DR3J 1RT2A 3B78A 4QW9A 4DQPA 4M63A 1U6FA 2OMLA 3T19A 2FD2A 4YP3A 3RW6A 2Y3YA 3THTA 2BDPA 3RGIA 2J8SA 5L1IA 4HEA9 1AB8A 3BSAA 2HK2A 2CNNB 2DO0A 3D67A 1SQGA 2L9DA 4OV6A 1HHSA 3W9IA 1CG2A 2GVZB 1TTHB 1R8CA 3M1VB 4IG3A 4OX9F 3E51A 3BPDA 3KXDA 2B7CB 1E6YA 2YKMB 3ZZOA 4RW6B 3TA0A 3QGHA 2HQ3A 5IV3A 4UOFA 4MKAA 2LFVA 4L3KA 3UN5A 2F8HA 3LAKA 4QWAA 3MXHP 3K5LA 2LDIA 3FGVA 5ETTA 2W7AA 1FWLA 4ID5B 1KLNA 4XDCA 3W61A 3I31A 1OYDA 1S7IA 1ZAWA 4EYIB 4IQXA 2MQPA 5M2UA 5HANA 5IT9Y 2DVIA 1N32F 4FF2A 5IQQA 3FCHA 2D69A 2B4OA 2CVIA 3DHXA 1EZZB 4MYTA 3M2VB 2WAQD 4OI0A 5D6GA 3OTCA 4OYMA 2JVRA 4Y00A 2R2SA 1RT4B 4HYKA 4RZRA 1AUSL 3D6HB 5ETPA 3M8YA 4E0DA 3HMJG 1TK8A 2MMYA 1MSWD 1IKYA 2ATCB 4TY8A 1F3FA 3OJUA 2WCXA 2BW7A 3CJSA 2E5HA 4Y2IA 1QSYA 5DETA 2L48A 1G2EA 2PMWA 2HIYA 3QO9A 1QUPA 4OV1A 3QQCD 3RR8A 5BYSA 2PIIA 3DHWC 3I0SB 3GV5B 3RR7A 1JNZB 3KK2B 4DV2F 1R8BA 2OEJA 1UEKA 5ETOA 4PUOA 3IAM9 1BXNA 2FC9A 2ACYA 1XR6A 2IAJA 1RXOB 2NS1B 2YQ0A 1RTZA 3EVMA 1DZ5A 5LMNF 3MFIA 5CYQA 2VG6B 3N6LA 3I0RA 2KJVA 3HSJA 3GQCA 4YB5A 3M7VA 4Q45A 1DTQB 4KHPF 1A0OB 3MEGA 2FLOA 5ETLA 4FVCA 5LSLA 2RAQA 2L08A 4ZJOA 1JLEB 1T8EA 3J7ZT 1EHWA 3T6JA 3V6DA 1FRLA 2WVEA 4F4ZA 1BWVA 1BGXT 2MZQA 2AZ3A 2HVZA 2MZ1A 3X3UA 1TL7A 4ALZA 1GMUA 2RDDA 4KYZA 1FD2A 2W9BB 4K8RA 2E9RX 4NLQA 2I6WA 3Q8VA 1D3WA 3SQGA 1LNQA 2HVDA 4DUYJ 2J5AA 5D4OA 3AOBA 1VISA 3D7SB 2UU9J 2QO3A 4Q2MA 3EJMA 5DZ6A 4QYRA 1X4EA 4OZLA 5KFVA 1JXVA 4X4RA 2FJXA 5LMUF 5HQLA 3FEZA 1JLAA 2OLWA 1OY6A 4C8YA 2DXFA 3A12A 1V5IB 2YNIB 3E01A 3ILOA 4J9NA 4A8QA 4CH0S 1U1QA 4JI1J 3Q22A 2HK3A 2PFFB 1TFYA 1F60B 4U7UD 4P73A 5CA5A 1VQ9S 4PYDA 4URGA 1IM6A 2RF2B 4HT5A 5A8WA 4OLPA 3I87A 1LXNA 2WK4A 1XWLA 1KVJA 3N0VA 4XIUA 3WZ0A 4JI8J 3DYAA 2PD1A 2VG7B 4LBPA 2FJAB 3RBEA 2CQDA 4ELVA 3IS9A 1CJKB 3BSCA 3HT3A 5JVGQ 5DLFA 4K4XA 3CJKB 5KAKA 3PRVA 2DNMA 5HVHA 1RTJA 2K06A 1DY3A 1HNIB 4PG5A 2HHHF 3PHEA 4YR3A 1FJGF 4C6AA 3MM5B 3DI6B 2PEBA 1YK9A 1MG7A 1FRKA 3QT5A 1MU2B 5L9NA 2XLJA 2LQ5A 2ZHBA 4CDIA 3OPKA 1EJ7L 2HAFA 1NM2A 1ZPVA 1REVB 2V2QA 5A8KA 1S1WA 1M1KT 5ETSA 1U8WA 2C3PA 1XQIA 1HYSB 4I4BA 2ZZNA 2MKKA 3EUNA 3P45B 1VQ6S 3K5OA 1YZ6A 2ZZTA 2J9CA 5L9XA 5KFBA 1RT3A 5E3CA 3J7AN 4DL6A 2MQOA 3DGPB 1NPRA 2ZVIA 1RWKB 2XWYA 3NOGA 3HO1A 2CJQA 1NCLA 4DEZA 1NKCA 1V3SA 2GS8A 1X4AA 4LBHA 5H9FJ 1RB0A 1XMQF 1SB6A 1WG1A 2AU0A 2VOOA 2CWXA 3KLHA 3W5YA 2XNRA 1Z1ZA 3SV3A 3L7UA 1VC6A 4HKQA 4DS5A 3HFVA 2CJKA 1Z4UA 4RW4B 1SC1B 4YB1P 3WHIA 1UFWA 4DR6J 3D1QA 3OFFA 1JXLA 2HVHA 1N0VC 5B09A 1WI8A 2FGCA 3EWGA 5DS7A 2DGVA 3G82A 1T0TV 3LTOA 4C8LA 1X9SA 3EGWB 2ILZA 3I6PA 3T6BA 4F04B 5CH7B 4LSZB 4JI7J 2I8EA 4KKOA 1R6YA 5BR8F 2VH7A 3HKWA 2AYGA 2WVBA 3BYRA 1NDLA 3HHLC 1N54B 1RAOA 4DFKA 3TX8A 5DDQC 1H72C 1UWAA 2GA7A 3BQ2A 2VBYA 2XYHB 3X1LB 2L9WA 1RI7A 2E5GA 3G87A 4LSLB 1NHUA 4ZPBA 3M2UA 4ZOSA 4CLZA 1TVRA 5GMEA 1X8DA 3RJMB 1U49A 2EFOA 1WHYA 4CH1A 5J2MA 4JI3J 2MKHA 3CJRA 1UEUA 2VPZB 1S0OA 4QR0A 1F5BA 1SBRA 3D5MA 3AQPA 4DV7F 4OYWA 1S5ZA 4XDDA 4WP8A 3GIRA 3R5CA 3PW5A 3QIPA 2LKZA 3RB4A 3UNGC 4DSFA 4LIRA 2LCWA 4ZLLA 1SKSA 2K1RA 3N4WA 1XNQJ 2OPQB 4A8SA 3VAMA 1G7CB 3IGNA 3PY8A 4DMZA 3R97A 2PFDA 4HR2A 3T5LA 4RNMA 4H4KA 4JI2F 3LGMA 1XN9A 4X4UA 2Y9HA 1U24A 4O44B 2R2UA 4M5KA 5T14A 1VFJA 5IC4B 2YVSA 3JXOA 4B3SF 1RAIB 1RTIB 5DDPC 2ZBQA 3CDWA 2QA4G 4ZCLA 1ITPA 3TA2A 3EVOA 3TZWA 2RHQB 1JK9B 1U02A 4RUHA 5I3QA 5KFIA 2AQ4A 3DLEB 2V8HA 4ES1A 4MTPA 2W4PA 4LQ3A 4RUCA 4KE5A 4CLFA 3M9MB 3T41A 1RKIA 2J7UA 2ZNZA 4A8OA 4UF4A 1FWKA 1VQ4S 5KFZA 2JC1A 3DMJB 2GVDB 3LPYA 2P6TA 2COLA 3BEGB 2VV5A 4DR4J 4EGLA 3QT8A 4WP9A 1WF2A 5FD1A 5HVFA 1VLOA 4CT9A 1VK3A 4MFBA 5IV4A 4DV5F 2DGWA 2AYMA 3TAQA 3BREA 1VQOS 2YH1A 1H74A 1UFKA 4ID5A 4QQBA 3R5GA 3MAHA 2V2ZA 5IQ6A 3BF4A 4OI1A 1RAFB 4LR7A 1U6BA 3K5MA 2V68A 1YJTA 2EEYA 3TEGA 3TNVA 2C2NA 2R7SA 4AQYJ 4DSIA 3THVA 4U95A 4RLEA 2MJNA 3W2WB 4EMDA 3FQLA 4X84A 4IG0B 2DNLA 2IC3B 1G4CA 4DZDA 3GV7B 1R7IA 2HHWA 2GIRA 3M30B 2CZ4A 2XHWA 2E1RA 3VV2B 3LGHA 4DR2F 6FDRA 4CLKA 1B4SA 2IA6A 2VQFF 3DRRB 3CJTA 3VGVA 1S6OA 1UZDA 5KFJA 2UUAJ 2HBYB 3KK2A 3VZIA 2IM1A 2VBZA 4CO0A 4NA1A 2ZKTA 3KG0A 1TL3A 1CJUA 4K2XA 2BANB 2LQJA 3MECB 4HACA 3MD3A 1S7HA 3MM8A 3DU5A 1BLUA 3DOMB 3OVBA 4UOGA 4AL5A 2UUCF 5DQGA 2K3KA 3IAS9 3MURP 4LSNB 3PVXA 3GYGA 2E5LJ 2YWGA 1VHFA 1SJ4P 2MGZB 1VOMA 4DV3J 1CULA 4YB6A 2V4QA 4C98A 1N5YB 3CCUS 4JI4J 4ZCIA 2HBQB 1HBUA 1FRMA 3ISNC 2XYPB 2ZM6F 3W60A 3J81j 3P8BB 1OMSA 3KLIA 2YTCA 4DQQA 2XQCA 4CLLA 1VQNS 3E8OA 3V6HA 4QCLA 4LF4F 4PG6A 4RJVA 3T5KA 4A8KA 1IVZA 6FD1A 4P2MA 4DV1F 2ZOFA 1UAWA 3HVAA 1RHJB 1CQNA 1S9EB 4DU8A 3BSOA 3ET6A 2CQ4A 1FI4A 3PX4A 3B54A 5H9EK 1B0VA 4DF4A 2XNQA 4GO7X 4ZVFA 2YNIA 4DJBA 4F2RA 5E3AA 1DLOA 1W2IA 2K7KA 2YBVA 5IWAF 3T1AA 4MKBA 1OQ3A 1ZA2B 4DL3A 3RW7A 5IS2A 2CQ3A 1SJ1A 2FVRA 3RZAA 1WG5A 3CB4A 2KZMA 2JWNA 2L9NA 3B82A 1N6QB 4NX9A 1NSPA 4TN2A 4QPXA 7FDRA 4DR1F 2HHSA 3CUNA 3HM9A 3RG6A 5KFSA 3MMCB 3M6VA 3C66A 2CQ2A 3W8GA 1SKUB 2ZOGA 1CJKA 1Q8LA 2FC8A 4F3MA 3M9OB 4ZIVA 2V8PA 3CJKA 3HF5A 3O8WA 4IR9A 3FMWA 4O0IA 4I6YA 2KFNA 3HHEA 2RUSA 2RRBA 4X64J 4GKJJ 2H48B 1SQFA 4PG8A 2XO7A 1KVKA 1S1TA 5D0EA 3KJQB 2MQLA 2ZH8A 4H4MB 4H54A 4C11B 2M5YA 1QVGR 4MMOA 3FVYA 4WXOA 2PC6A 2DXEA 1H2TZ 4KRWA 4MJKA 1MU2A 1YBUA 1J2VA 2GJFA 1MROB 1UKUA 5J1NA 5FDLA 1OJ4A 3JAMU 2W4DA 4C8KA 1SH3A 3H4DA 2W2NP 3J80U 3JTPA 1YRUA 1B70B 4L75A 2V4RA 5J2PB 5E2QA 1UZHA 3PIOQ 2XZTB 1H73A 4J9SA 4C0HA 1C1CB 3QYYA 2DB1A 1X4GA 1FRIA 1VYAA 5KG0A 2UZAA 2K7JA 1M5OC 4DCPB 1RLDA 1S6PA 2AX1A 3IR6B 3VQTA 2WSEC 3K5PA 1WELA 3UQSA 3R5AA 3HHLD 3CJQA 4IO1A 3HSZA 2DT9A 2J7KA 2P5VA 4DPXA 3ILIA 4HH1A 4USTA 1BUXA 3H4BA 2B43A 2H5IB 3HJVA 4FKXA 4CCHA 3MCMA 5E33A 2YY3A 2GMHA 2LA6A 1PAUB 4RBUA 4KHMA 1FFWB 5H1SV 3TAMB 2HLUA 2KG1A 1C2PA 1HNWJ 2RQ4A 1P27B 1U0SA 2UUTA 1HARA 3M6XA 4Y0FA 1FJ7A 2R8IA 2QT7A 2RJZA 1DTTB 5ITHA 1K0TA 4C8OA 5K8MA 1YJ9S 3FSYA 4HTJA 3IBWA 3U1NA 1YDLA 3FCWA 4ZP8A 5CCMA 1IJFB 3GIKA 3PG9A 3GJTB 5F8GA 1JLCB 2FVPA 5D4PA 1UWBA 2VJUA 2V67A 1X5SA 4NWBA 2CPIA 3O44A 2DGQA 1NDPA 1FDNA 1U47A 5HROB 3GFXA 2ROEA 4QU7A 1HQEB 4KBIA 5SZTA 4CP5A 5HQMA 2J8AA 4J9OA 1SVDA 2VUGA 3TQEA 4KH1B 1ZTWA 4LSLA 2ZH1A 2Q79A 1K73T 1CLFA 4OLOA 3CW2C 4BLGA 3RBDA 2C2KB 2DKOB 3MPYA 4FNIA 1I94J 3RB0A 1HR0J 3LUYA 3QIDA 2R8GA 4DL0C 2MHEA 1JXEA 1SL2A 2W2QP 1ZYQA 3KWMA 3G4SS 1NKBA 2BABA 4NLYA 5T7LB 1VBXA 4DQRA 1T94A 2RMLA 3GYNA 5KOXA 4UZBA 2DHSA 1WG4A 4KO0A 4OYPA 5KFUA 2DRBA 4A8FA 4Y28C 4Q44A 1MWQA 2WOMB 3CD0A 2MY7A 1KFSA 1U48A 2HNYB 4J9UE 2V8DA 2ZDOA 2HHUA 3V81B 2JX2A 3BGUA 3D1OA 4NLWA 3Q8RB 2R8HA 4LRBA 3NLCA 3G8SA 1RU2A 2C42A 3DLEA 4DUYF 2NXJA 1N88A 4QWBA 4O4RA 2UU9F 4O3RA 2QGFB 5IOLA 3RUBL 3EGVA 5I42B 3DMJA 2ZJRQ 2GVDA 2NZ4A 4NASA 3OL6A 1N4LA 5DJBA 1VQSA 3QGIA 2QX0A 2QMXA 2BQUA 1QLNA 2WBRA 5ADZA 3H5XA 1CSJA 1WSVA 2LYVA 3QJLA 1KKHA 3ZTPA 1HW9A 3NNCA 1RACB 4G3IA 2CNOB 5K9FA 3OQ2A 3OXLA 4OZ5A 2YPYA 5EDWA 1AYEA 3GFYA 3H7HB 1JJ4A 1KN6A 4JI8F 4I2QB 2DNPA 4NZ7A 2IM0A 3H2LA 1F1BB 1ZM2A 4F4XA 1Y0HA 4CYUA 4ILRA 3A8KA 3LW5C 3NRBA 2VFVA 3CD6S 3TI0A 3QRRA 4KY3A 1P8GA 1WOSA 5G4DA 4J9LA 2V63A 1JLGA 1IKVA 2OEKA 1LW2A 3ONQA 4ANDA 3L4BC 4Y2AA 4EO6A 3CIMA 5I3UB 1VQ5S 2JHEA 4ED2A 3AOAA 4HDHA 4K0KF 3GSDA 3W2WA 3EZUA 3GZ7A 3ISND 2KYZA 2AT1B 4OZJA 1NZAA 2IC3A 4HI1A 1UVMA 4DWIA 3A8EA 1NH8A 2XS2A 3M30A 1XMOJ 1S12A 1FKAF 5DRKA 1RLCL 4M5MA 2OFGX 2EW9A 4NE9C 4AT1B 5HQ8A 5THWA 3OLBA 2OFHX 3C46A 1CS4B 4NL5A 3BH7B 2OPSB 2JFDA 1FRXA 3GP9A 1VBYA 1Z2LA 3LP1B 3MECA 3IO1A 4QIVA 4QYZK 3DOMA 3ICLA 4ZKAA 4X4PA 5U47A 3G9CA 3HHNB 4R25A 3HZGA 1WC5A 2DISA 1KEKA 4EO8A 1FXLA 5L1JA 2Z0GA 3ETOA 5G0RA 4LSNA 2C3UA 4FKYA 1UW9A 3CJ3A 2CDRB 2J0WA 5ETKA 2MGZA 4ZIWA 1D8ZA 1Y10A 4Y65A 4CM2A 1NHVA 3WIVA 5DDOC 4DR6F 4PCQA 4ILMA 2BRLA 1U45A 1Y9OA 5F8NA 4ID8A 1S9GA 1W7WA 4IKAA 1Y5LB 1FTCA 4BWJA 1RADB 5EWEA 1VQLS 3W5XA 1VHIA 2V8VA 1T02A 1U2CA 4Y2KA 4CZCA 4JI7F 2WONA 3QATA 3M8SA 1ZZNA 2QV6A 1FVSA 2Z2ZA 3BKFA 4TNOA 1Q16B 3IG1A 4C2MA 1UETA 1PIEA 2QSFA 4RBTA 3R5JB 2VFSA 5EX3A 1TUWA 3QAEA 2F7VA 1HA1A 1ZAVA 2ZNYA 3MEKA 3TJ9A 5EWFA 2KVIA 5D0RA 2ACMA 1XC9A 1RWPB 4NLOA 2YKNB 2MLYA 4OX9J 2DNKA 2MQNA 1N0UA 1IR0A 4NRTA 3ZC4A 2JLFA 4JI3F 2XWXA 3VGUA 2W1BA 2W2OP 1O5JA 1QD1A 5AE3A 2IM2A 4U67Q 4HI2A 3R9LA 3JSYA 3CJ0A 4AE5A 2R9LA 1XNQF 1FDBA 4U9RA 2EVZA 3KHLA 1H3DA 3MDFA 1S57A 4F02A 4H4MA 4NXMJ 4ICLB 1S49A 3SZ2A 1MWYA 2Y1RI 4DXLA 2QJ3A 1R0BG 2KJWA 1KLMA 4NMLA 4KGXB 2D3UA 3RRGA 4JV5J 2ZE2B 1ELOA 3HZEA 3J81Y 2CJYB 2YKPA 5K5MA 5IT4A 4ZPVR 3HSGA 1XERA 3W8PA 4XPEA 5J2PA 2GMJA 2RKIB 3VALA 1HBOB 3KG1A 2Y0BB 3E3XA 1I1GA 5HBMA 1KVIA 4JBCA 1O8BA 3F73A 3UR3C 4IDKA 4O3NA 4YOEA 2XZWA 1URNA 1KQSR 4RKUC 4NLXA 3OTBA 4DR4F 3ILLA 4JP8A 4WU3A 2ALZA 4RW7A 3M8QA 2B5JB 2P6SA 2R4FA 5FIIA 4OIXA 1ZZFA 2UP1A 2GHPA 1C0UB 2MXYA 2W9CB 5LMNJ 2WVDA 3IR5B 5GAGI 2OP5A 3LAMA 3UDLA 3FQKA 2DTJA 2JRSA 4ZVQB 1G3OA 3I9ZA 2CRLA 2YKQA 3IWLA 4B9UA 1EQMA 2X1GA 4KHPJ 3HJFA 3FEYB 3QRQA 3V2UC 4TLRA 4OHWA 1EETA 4OZNA 1Q1KA 5E7OB 5HLFB 5F41A 3ZZYA 1WI6A 4K4WA 4USUA 4DSEA 3PKMA 5B0DA 2KXNB 3TZXA 2AEJA 2M0GB 5C24A 3T5HA 1U1LA 1VQMS 3MCSA 3IWNC 3S1TA 4RX6A 2AIRB 3EMTA 3VQSA 1RTDB 3PTWA 4I68A 3VHQA 3AB2B 4AQYF 1S6UA 4PZVA 4I56A 2WHOA 4ZVOB 3GPAA 2ZC4A 5F9LA 2AMCB 2MJUA 2AD9A 4DR5J 3BKTA 3KYLA 1EQ0A 1U2RA 3CJ4A 3QLHB 5HSPA 2YNHB 3PJ9A 4JUZA 4CLSA 5HP1B 1SJRA 1RT5A 5KFYA 1VQ7S 3LALA 3NWGA 2C1EB 2HVIA 2DHGA 2H9ZA 3CMQA 3LA0A 4ZLJA 1A6LA 3DOLA 2NXEA 3L09A 2FHJD 1LWFB 5DG7A 3MGJA 3KNAA 4URSA 3V4IA 1FK9A 2UVWA 2BJ3A 1FE4A 2HZCA 3F41A 2VKZG 3AB4B 1IM4A 4OFZA 4B3OB 4QIFA 2VG5A 2ASYA 1SC3B 2BE2A 3R6LB 2CPDA 2HMIB 3PV8A 3ZTRA 2VOPA 3CCSS 4NA3A 2C22A 1J5EF 2NXUA 2XC9A 1IBLJ 1WWHA 3BGFA 4U7CA 4IRDA 5HJXA 3OVSA 4U8YA 2E5LF 2HQCA 4LF1A 3OL7A 3I55S 4DV3F 1WC0A 1PC5A 2FZKB 5HJYA 2BV3A 1UVKA 1GFWB 1F3VA 2AEFA 1X9WA 4JI4F 2XM3A 2IM3A 3Q89A 2FUG9 2HHHJ 4HL9A 1FJGJ 3SBMA 5EGYA 1PKUA 3OHAA 2BJEA 4FF4A 2DHAA 3VAIA 4RPFA 3CCZA 2OPRA 2BW2A 5ETNA 4ECWA 1BY9A 1NB7A 3KJFB 3R7SB 4ZPDA 2LQBA 3JYTB 4BCAA 1RT2B 3K58A 1Y00A 3D2WA 2W8LA 4RL1A 2XMAA 1N48A 2MPUA 2GAHC 4ECZA 1TZ0A 1IXKA 3DC2A 1WSRA 2DNRA 1Q79A 4W90B 1MLAA 2MTLA 3GFZA 1WDDA 3ISZA 4LF6F 2I1RA 1WEYA 2B4VA 2NR0A 4FP9A 2JEGA 2C28A 5AE1A 4ZLNA 2M7SA 4TQSA 1N56A 3GMGA 1E6YB 2P9CA 3AHPA 1T9YA 2D3O1 3GWCA 1V9OA 1QTNB 3PJWA 4ZMMA 5C7PA 4I2QA 4IO9Q 1JNRB 2NYIA 1HQUB 1H7XA 3OR1B 4FYXB 1R8AA 2J0SD 1JLBA 5D8HB 1RP5A 1NAQA 3VAJA 5A0YA 5KG7A 5K8OA 3MEDB 3FKBA 4DSJA 4ERDA 3R6GB 5D3GA 4X64F 4GKJF 4LF5F 1N5TA 2RRNA 3N01A 1YGYA 3OSNA 2EBEA 1CVJA 1T9VA 2DH7A 3IRXA 1Q8BA 1SKWA 4ZCMA 1WKJA 2XMTA 3SSQA 2H54B 5HO4A 4NLVA 5HAOA 1IR1A 4ZPCA 2CDQA 2ZFHA 5KG5A 2RUGA 4MIAA 1HD0A 2APOA 2FJWA 4LF8J 3BB5A 2JLEA 3TARA 1IKYB 2CG4A 4TY8B 2VIHA 1S6QA 4UZCA 1FERA 2XO6A 2C2RA 2L41A 1ZS6A 1CS4A 4S0MA 2OPSA 5E3PA 4F7VA 3PW2A 1QAIA 2N3LA 3PYGA 3EVWA 3H20A 4MAKA 2CQIA 3CGIA 3H42A 1RCXB 1SJ3P 4Y34A 2O66A 2FJEB 5IM0B 5CYQB 3I0RB 4OI6A 4DV7J 2R7RA 4WKYA 3S01A 4Q5VA 4RBVA 2ZBPA 4M1KA 2DR5A 2XHCA 1OY9A 3G8TA 5IXUA 1I3OB 1NH7A 4RO0A 3VGSA 2QYGA 3DDIA 2ZWOA 5LJ5Y 2HHXA 3THPA 2DHHA 2G1DA 2W25A 1M1GA 2LECA 4WE1B 4OL8A 5CAAA 4ZVSB 4ER8A 1IBKJ 2QN6B 3BGOP 3GFHA 2JZ5A 2FDNA 2HIQA 2VB6A 4OJGA 2DHXA 3KLVA 2K8GA 3BN7A 2VBWA 4GVBA 2VDHA 1SKRA 4CTAA 1N33F 1IR2A 5CABA 3N6NA 4CT8A 4DCJB 1P6TA 2A6MA 1S99A 1F2GA 4WIQA 5AXLA 3PFEA 4PWWA 1R0CB 4RNNA 2IBOA 7FD1A 1RUSA 4A47A 3NMRA 1UVIA 2QA4S 3C3LA 2RHSB 5EX0A 1PYSB 1U25A 1SUQA 3ITHB 2YKNA 3GIMA 3MR6A 4WIIA 4LREA 1UL3A 1YSJA 2VFUA 1I94F 1U1MA 4DL2A 2IYGA 1HR0F 3DOKB 2OELA 1HNXJ 4KGMA 5D4LA 3DYAB 1UJ5A 2NXNA 3UI3A 2N3OA 3OFGA 4LF2A 2W7PA 1KP6A 4ZVHA 5KFOA 3AJDA 3MHYA 2XG8A 4DQIA 1VI7A 2BYCA 3PYEA 3PX0A 1MMNA 3MAAA 1IKWB 3CJ8A 4ICLA 1RTJB 1HMVB 1SIWB 3JSMA 5BYRA 2FHKA 4Z37A 3MMBA 3TA1A 1D8YA 2A10A 3T3FA 2CPJA 2BA9A 1YIJS 2EC2A 5KTQA 4ZJQA 2AWZA 3C16A 2RKIA 3AA9A 5IFMA 4WCEQ 3FK4A 3PW7A 1B7FA 3D28A 5A8KB 2OD6A 1V6HA 4ED1A 4ANCA 2UXDF 5FJ4A 2W9AA 4G1QB 3DDNA 2PGCA 2NSBA 4CO2A 5KFWA 1TAUA 1RT3B 4Y2CA 2U2FA 3UD4P 3D1HA 1EX8A 4IRKA 3BO3A 3D6MB 3NCPA 5B0GA 2DNZA 3MPVA 3W3SA 1HQ2A 2W9CA 5DO2A 3VAKA 4QU6A 2BZ2A 2GIQA 2EFGA 3L95X 3PXGa 1MNEA 1ZM9A 3CC4S 4OJHA 2GO8A 3QZ8A 2MKJA 1X4DA 5BYQA 3KLHB 1H2VZ 2CUYA 3TJAA 3U1MA 1L3VA 2XI3A 4ZVRB 4UQGA 2IDEA 4DLEA 2XZDB 1CJTB 1YLXA 1TV6B 4FYWB 1YJRA 3FRZA 3MUMP 2ZWPA 2QL5B 3KDOA 3O6QA 3ZZZA 4R5PB 1C4CA 1NKEA 4K5RA 1LWXA 3U1LA 1JQGA 2KB2A 1AFJA 2HHVA 2IJFA 3AXMA 4KKOB 2Z57B 1RAAB 5HP1A 1YTYA 4X66J 3F56A 3FEXB 3ETMA 5D15A 4OYZA 1NNDA 4W98A 3FBEA 3SCIE 4NPOA 1FNOA 1LWFA 4FS2A 1S9FA 2AGQA 4P75A 2JEJA 1F9EB 1P9YA 3PR4A 1U4BA 5C5JA 4LVOP 2UVVA 1N52B 4OJ1A 4PXBA 4USKA 2MYFA 3G6YA 1VQKS 4K4UA 5D78A 4USVA 3ENWA 5F0WA 1L3UA 3M8PB 2JC0A 1HPZB 4K50A 3HLUA 3DRSA 4LRAA 1RJJA 4EBCA 2CQHA 4ED6A 1FDAA 4IFYB 4USIA 2V69A 2PI5A 2X3GA 3UVJA 4QWDA 3SMZA 2CJBA 5E3QA 3QIPB 4YDXA 1TR0A 2XCPA 2Z8QA 3NXZA 2O3DA 2K1RB 4K4VA 4Z7CA 3UN3A 3QWPA 3HK2A 2KT5A 4B3RF 1U8SA 5KFDA 5CCLA 3EPIA 4ZP9A 3I82A 3NGDA 4EFAC 2IVYA 3TQ1A 3TZZA 3MR2A 2BJ7A 4NRUA 2ZKUA 3NGRA 4NZ0A 1KBRA 2RQCA 3SEOA 1H0HB 3NNHA 3PEHA 3KFWX 1VQ8S 3LQVA 2E9ZA 4WKRA 2AGOA 4NEYA 1MN7A 2RB7A 2E1AA 1T11A 1K44A 4IH5A 2CPEA 3BDPA 1T3OA 2ZEJA 4WYLA 1OPIA 4EBDA 1WUUA 3J7YU 1N5QA 2RU9A 5A6PA 2KM8C 2DCUB 3KLFA 2AF6A 3POTB 9ATCB 2HQIA 2AV5A 2J9EA 3M4XA 4DUZJ 2GO9A 3W66A 1RHQB 1F5AA 2V6AA 3JS9A 2MLZA 3I4HX 4DCOB 1KTVA 3AH6A 1M5PC 1XMBA 4ZCKA 3AJ1A 1PCAA 1RQ0A 4MFBB 3MR7A 1HQUA 3OR1A 3VWSA 1K47A 1AZSA 1DBDA 2DNYA 1Q86T 2ZBRA 3TEHB 4L74A 3MF5A 3U27A 1U0HB 3MEDA 4DL4A 2XGPA 1X5TA 3EXYA 4XTTA 2J0XA 3JTOA 5K8NA 2OUGA 5LL6d 3DLGA 4OYXA 3MPUB 4V1Ak 3PFOA 3P4UB 2I2YA 3H25A 4PG7A 4NXMF 3P3DA 3LF0A 3UPFA 3MR5A 4ATNA 4D3HA 1C1BB 1FKOA 2OPPA 4M5GA 1NSQA 2DGOA 3FBCA 1ZM4A 3SQOP 4TY9A 4JV5F 3M9NB 2J76E 3R8YA 5E5NA 2I38A 3PCOB 4B9TA 2DIVA 1UTAA 2OI2A 2HSEB 4CIOA 3QGGA 4FF3A 4ECYA 1AXQA 3ENQA 3A8JA 2XSFA 1R8HA 2R7WA 1G6BA 4Q0BB 4MT1A 1H6KX 4ZITA 3AODA 5MAOA 1AUDA 3FCVA 4NLRA 1R3NA 5KT5A 2JOQA 8ATCB 3HI9A 4ZVTB 1KRPA 4QWEA 3OD2A 5DM6Q 3A1YG 1TL3B 4OZ2A 3ZTSA 2NZCA 3LH2S 1CJUB 4HACB 3V4MA 3R2CJ 3KMQA 2W2PP 3MM8B 3OT9A 5A8RB 2AKWB 3EGNA 3QSYB 2XSJA 5IM0A 2BVZA 4Q7AA 2XMWA 4C48A 1PYOB 2I0XA 3T1YJ 4L73A 1LKZA 1S0NA 1S1VA 2RSQA 4O23A 4OX7A 4ZA1A 2Z58B 3BGRA 1RWVB 1CQMA 1CULB 1U1KA 2R8JA 2NCKL 3AD7C 4ECQA 1TMMA 2OIHA 2E7VA 3TZYA 4OI4A 2I5JA 4M5IA 1HBUB 2DNNA 2HURA 3BGLA 4WE1A 3TR5A 5GMKa 2VC0A 3KLIB 1KDNA 4KSEB 4YUDA 2HBRB 4DFJA 2XB2D 3WC2A 2GGPA 2HBZB 1RTHB 4DZ6A 4ETZA 4DR5F 3CCVS 1ZETA 4PWDA 5B7WA 2E1PA 1T9XA 2VKRA 4EEYA 4YN3B 3MZIA 3PZPA 1S1UA 1NSKL 1JJ2R 2HWTA 5D4NA 2KG0A 2HNDA 3ET6B 1Q5VA 5BJRA 4C8MA 2R7VA 5GAHI 1VC0A 2F40A 2VZ9A 2KFZA 4WFAQ 4ZPAA 1CJVB 2EFPA 1DLOB 2Y1IA 1RAHB 3NS6A 3ITHA 4BWMA 2QIFA 2W24A 2Q6CA 5KOWA 4O3QA 1SC4B 2Q43A 1K0VA 2VL1A 2JNJA 3RRHA 4IQMA 2FZGB 3IP0A 4IFVB 4CWBA 2F9DA 4LMZA 1KQFB 3W1YC 3DOKA 4FXWA 3CTRA 1SV5B 4L6V3 3KJVB 4LF7J 1X4FA 1UA1A 3PRBA 1IBLF 4DX8H 2WW4A 1YQHA 1WDTA 4DU7A 3W7BA 1KONA 2UV8G 2ASJA 4GMKA 4HHUA 2CG8A 4X2BA 3BJYA 4B9SA 3Q8YA 1GXTA 1LFWA 4XK8C 1IKWA 2KL8A 4I6WA 1HMVA 1S1TB 4F36A 5A2QY 2IRXA 1X31C 1FO1A 4PPZA 4NYPA 3QPIA 3DRXA 3H5YA 3N5BA 3GV8B 2JEIA 4K0KJ 5J2QA 2I9SA 3NGKA 4QJVA 2UV8A 2BOAA 5FDLB 4NCBA 2OTJS 2V4JB 2JLGA 4CQ1A 1VLYA 4M5DB 2OJ3A 1R8PA 4NCGB 2KTQA 1NMEB 1TFWA 4FYDA 4K5SA 5JVHQ 1V3RA 4NXNJ 5KT2A 5SUHA 4G1QA 4B3MJ 2CQBA 3LO3A 2RS8A 3QBCA 2H5EA 1SL0A 4BC7A 4DL7A 1RHKB 5D0HA 1S6PB 3HHDA 4YHHJ 4CLTA 2A2CA 1FD8A 4FZVA 5D77A 2HHQA 3NCQA 2AEMA 2CIMA 3Q2SC 1NPPA 2C2ZB 4EUVA 3CCWA 2JL9A 2XLKA 3NEKA 2OO4A 1R89A 3WX8A 1HFEL 4ECUA 2XI2A 4YS2A 5J1EA 4YEAA 3TRGA 2YX1A 2R7TA 3KK3A 4DPOA 4FDFA 1JWWA 2HKEA 2RH3A 1T03A 3ZZTA 2QL7B 1YBAA 5KG4A 2G2YA 1FKPA 1Y7PA 1CJTA 4Z7YA 2J6SA 1TV6A 1ZPWX 4RNFA 5FLXU 2EK1A 4XPCA 3SSRA 4PQAA 1NK4A 3OSPA 4CH7A 1U7LA 4R5PA 4I64A 1RSCA 2OTLS 1JX4A 5CXTA 2RQKA 4YQWA 3V5RA 3DXBA 3ENVA 3C2PA 2WRMA 2W01A 3WQPA 2FJVA 2ZJQQ 3OL9A 3T9ZA 4DX6A 1UWBB 2CPFA 2MEWA 4LF8F 2ZDPA 2CPHA 3JQMA 1WHXA 2JH3A 3K8VA 3MUVP 4I2PB 3L3CA 1X5PA 4CLUA 1SC6A 4WBFA 3BPSP 3MCOA 1RYSA 2O01C 1FJEB 3ZZ0A 2RIJA 2KO1A 3L9ZA 2XBPA 3AAWB 3C19A 1KOHA 1YBTA 2HYIB 2D3ZA 3FSIA 4EZ6A 3IFEA 5LJ3Y 2QMWA 3M8PA 1IN0A 2DCLA 1HPZA 1JLFA 1VS3A 5KG2A 2HQFA 4NMXA 1OYEA 4IFYA 1X60A 1GX5A 1PILA 4LFCJ 4J37A 2CJAA 4DFPA 3NY0A 1YVFA 4QIWD 3I5BA 3G2XA 1RAEB 4BS2A 1X9MA 4PABA 1BD6A 3CMAS 3BYPA 3CJ2A 3KMSA 1TP7A 2N4CA 4DV4J 2H4YB 2QA1A 3HVWA 2XGQA 4P52A 3MM6A 4KO0B 1RHUB 3D66A 1W25A 1IBKF 3FJ2A 4NLSA 2MKYA 2Y0SD 4QOTA 3TUJC 5KFGA 2V9WA 5KT7A 1N34F 4MK9A 1T05A 2FHJA 4F26A 1TKXA 2LXFA 2A0FB 1GK8A 1J27A 4U8VA 4H4OB 2ABYA 2HS0A 1FRJA 3M6WA 4C7QA 1BQXA 2LU1A 3IRWP 2O67A 3FC9A 5K20B 5H9EJ 3DM2B 5CYJA 3POTA 1AA1B 1HLWA 2HW3A 3TP2A 4GC7A 2IPOB 2AJ1A 4DV6J 1DARA 2KXHA 3H2VE 3FUYA 2CPZA 1LFPA 2XY7A 3VVUA 1YJ7A 1HNXF 2CWKA 2FJDB 1Q95G 5E41A 2BJ8A 4YR0A 1SH0A 3B4DA 1RBLA 1U0HA 4A8MP 3G6VA 2ZBCA 3BDEA 4CYUB 2DY9A 1YJUA 1KWMA 5DGAA 1Q53A 1I6JA 3ENAA 4ECSA 3W9HA 1FEEA 3MOJB 3PM9A 1JLGB 1IKVB 1GTHA 5L8RC 1YI2S 1LW2B 4LIWA 2Q1LA 1C1BA 5CD4H 1OQ6A 1HWJA 4USWA 2RQMA 2QLXA 1XBWA 4IYQA 2D41A 1RDRA 3MM9A 3R7BB 1P1TA 2QLJB 3J7YI 2DNGA 4ZS6A 2M70A 4J90A 5KFCA 3FFIA 5KT4A 3M05A 2IVFB 4YY3J 4AUKA 4C9DA 4OHYA 3CCJS 4KHRA 2KHCA 2GMLA 2AP6A 1NLKL 4F0KA 3TX0A 2XTJP 1XTZA 4Q0BA 1E6VA 3GIIA 1WKKA 2QRRA 2G4BA 3AD8C 2YKOA 3I5CA 3UR0A 2HEKA 2Y1LB 5DG9A 2QL9B 4K4YA 3FNNA 4EYHB 1UMJA 4V19J 5KG6A 1KNZA 3CC2S 2Z2LA 2NREA 4B9NA 4B17A 5A8RA 4KV8A 5C42A 4QW8A 5ETMA 4ILLA 5KFKA 3QFHA 5HL7Q 2ZH7A 3HVTB 3ZO7A 1SJFA 2N7YA 2AJ4A 2ROPA 2VQEF 1J5EJ 4F0HA 5G0RB 4HDGA 4B9VA 1T95A 1OSCA 3QNWB 1GX6A 4NYZA 1HWLA 4CI0B 3H0PA 4B9MA 2E7XA 2NQPA 4Y3CA 2ZHAA 3IM8A 2QE5A 2G2OA 2IDLA 2ILYA 3R2DJ 3WIUA 1U6ZA 4B02A 3EYZA 1S9GB 2DRDA 3AFGA 1B7YB 3Q23A 3A3OB 1T9WA 3EICA 3K2YA 1SIZA 3PX6A 1RTHA 2M9KA 1UCNA 4JV2A 3D6FB 4LUBA 3KLGA 2GQCA 4WF9Q 1R31A 4O0NA 4R8UB 2WONB 1KHVA 4ZVPB 4X66F 1N5VA 4GRSA
chains in the Genus database with same CATH topology
3Q8QB 3DC2A 1HYSB 1GXUA 2DNRA 1Q79A 4I4BA 2ZZNA 5GAEU 3IG1B 2MKKA 2EFNA 2DR7A 4W90B 3HHLA 4A8YA 3EUNA 3K5NA 1DFDA 1VQ6S 2V8GA 3K5OA 1S0VA 2J9CA 3GFZA 1VK8A 1CC7A 1WF0A 1RT3A 2MHNA 3CDEA 5E3CA 5L9XA 5KFBA 2RS2A 4DL6A 2MQOA 4ES2A 5AXMA 2BANA 3ISZA 3QAUA 4LF6F 4A46A 2I1RA 1WEYA 3TVKA 2B4VA 2NR0A 4FP9A 2XWYA 2JEGA 2RNEA 2GNKA 5JJBA 2GQ2A 3CT9A 3HO1A 2C28A 2CJQA 1ULRA 2EKYA 4DEZA 5AE1A 1NKCA 2DH8A 1V3SA 3BM7A 1J5OB 2M7SA 1X4AA 4TQSA 1SJQA 4IFVA 1N56A 3GMGA 5H9FJ 3KHGA 5HMYA 1E6YB 3L7PA 2P9CA 2HAIA 1HBMA 3AHPA 1XMQF 2FVCA 3UDCA 2HG4A 2FVSA 1SB6A 1WG1A 2P9GA 4RU2A 4HLBA 2AU0A 1Y5NB 3E2EA 4WFNQ 3GWCA 1V9OA 3SYZA 1SV5A 2GW8A 2VOOA 3PJWA 4ZMMA 3KLHA 1M5HA 2BM1A 2EG1A 2YKAA 4I2QA 2XNRA 1Z1ZA 3KJVA 4IO9Q 3SV3A 1JLFB 2CQPA 1AFIA 1JNRB 2NYIA 1VC6A 1UVLA 1HQUB 1VIOA 4IH6A 4DS5A 4HKQA 1H7XA 2MQMA 3OR1B 1R8AA 3D54A 2CJKA 2J0SD 1JLBA 1Z4UA 4RW4B 5D8HB 2MKIA 1RP5A 1N5YA 1NAQA 3VAJA 1M90T 2ZZMA 3HPOA 2DRAA 1JLQA 4Q2LA 4KR0B 5A0YA 4DBQA 1VRTA 4YB1P 3MEEB 5KG7A 5K8OA 3MEDB 3TAPA 1UFWA 3S8SA 4E98A 4J9KA 3D1QA 2HWHA 4C0BA 3MTJA 3OFFA 4DSJA 4ERDA 3O2IA 3H5SA 4K4TA 5D3GA 4X64F 4GKJF 3CF5Q 2KI2A 1JXLA 2IHR1 4R0JA 5KFXA 4LF5F 2HVHA 1M5SA 1N5TA 2RRNA 3N01A 1N0VC 5B09A 1FEHA 4OHZA 1YGYA 3GYXB 2ADCA 4K4ZA 1WI8A 2FGCA 5DS7A 3OL8A 3OSNA 5GAGU 4IR1A 4C8NA 2EBEA 2DGVA 1CVJA 4O4GA 2PDAA 2OAUA 4FS1A 2YNFA 3VTIA 2LXUA 1KR4A 2AX0A 3HKZD 2DH7A 1RT1A 3MM6B 4C8LA 1X9SA 3IRXA 1Q8BA 1SKWA 4ZCMA 1KLMB 1VQYA 3EGWB 2ILZA 5F3ZA 2XMTA 3SSQA 2IMOA 5HO4A 3I6PA 3MR3A 3T6BA 4NLVA 1R43A 4MK7A 5CH7B 4ZHRA 4F25A 1S9EA 2HHTA 1KC8T 4EZ9A 2I8EA 4ZPCA 2CDQA 4KKOA 1VRUA 2AJQA 3I32A 1R6YA 2ZFHA 5KG5A 2V4JA 3SI8A 2RUGA 2GX8A 3W2VB 4MIAA 2B7BB 4N8NA 3Q8PB 1HD0A 5BR8F 2APOA 2HFNA 2ZJPQ 3WX4A 4M5DA 2FJWA 3BB5A 2R7UA 2VH7A 2WSCC 3HKWA 2JLEA 3TARA 5F8LA 1IKYB 3CEDA 1T05B 2AYGA 2GHWA 4NCGA 2MY8A 4A48A 2CG4A 4TY8B 3PR5B 2IMWP 3T5JA 3HHLC 3KLEA 1TKXB 1N54B 1S6QA 1PSDA 2XMVA 5HBMB 1FERA 4TU7A 4DFKA 3BSNA 4I7FA 3TX8A 5DDQC 5HI7A 2C2RA 4LFAF 2RILA 2L41A 2GA7A 2CJ9A 3OUYA 4IDKB 3BQ2A 2VBYA 4QR2A 1TZ0A 2OPSA 5E3PA 1ZTTA 2XEXA 3X1LB 1Y5IB 3RRKA 2J0QD 2L9WA 3OTEA 1RI7A 2E5GA 4LSLB 4AL7A 3PW2A 3RB3A 1QAIA 1NHUA 3OR2B 4ZPBA 2N3LA 2HWIA 3M2UA 4ZOSA 2QZ8A 4MIWA 3H20A 5DQIA 4MAKA 2HS4A 2D9OA 5GVQA 1N6QA 1Y3JA 2PMZD 2N4DA 2C3YA 2C2DA 1HI0P 2CQIA 4DUZF 3QMQA 2B51A 3CGIA 3O3LA 5KFPA 1TVRA 3QGPA 2VFTA 4RW7B 4KTQA 3M8QB 5KG1A 1X8DA 5AXNA 4KFBA 1U49A 2EFOA 3RYLA 1WHYA 1PC4A 4CH1A 4B08A 2MKHA 5J2MA 4TLQA 1SJ3P 2RD5C 3MMCA 4Y34A 1UEUA 2O66A 4JV1A 2VPZB 1S0OA 4QR0A 2FJEB 4JI0F 5IM0B 1F5BA 1SBRA 2Z2MA 1NJWA 3D5MA 3AQPA 5CYQB 4DV7F 4OX6A 5F3TA 2IRYA 4LF9F 3I0RB 3DU6A 4OI6A 4XDDA 3R5CA 2R7RA 3PW5A 3QIPA 3MD1A 2LKZA 4WKYA 3RB4A 3UNGC 3H2UB 1JKHB 3S01A 4QR1A 4LIRA 2LCWA 3GB0A 4DSFA 4IRDA 4L3NA 3MFHA 2EPIA 4RBVA 4Q5VA 2PN6A 3EZ5A 1SKSA 2KRRA 2K1RA 3N4WA 2MKSA 2OPQB 3CSKA 4M1KA 1G7CB 2OKQA 3IGNA 3VAMA 4A8SA 2DR5A 3PY8A 4DMZA 4NOHA 4O3PA 3JSRA 5M2RA 2E66A 1FF2A 1D9FA 3G8TA 1YHQS 5IXUA 2C3MA 4RNMA 3T5LA 1EETB 1NH7A 4J5OA 4RNHA 4C0OC 4F2SA 4H4KA 5LSRA 4JI2F 3LGMA 5DG8A 2FLNA 3LP2A 5GADU 2U1AA 4C11A 2DGTA 1HBNB 1XN9A 2J9DE 4X4UA 3IGVA 1U1RA 3Q8SB 3NAHA 1QAJA 5LJ5Y 2JEFA 2HHXA 3THPA 1U24A 2G1DA 4O44B 1WEZA 2W25A 3CE8A 2R2UA 1DRZA 2LECA 4WE1B 5T14A 2YNGB 1VFJA 5C24B 4OL8A 2YVSA 3K0JA 1NO8A 4B3SF 1RTIB 1MROA 5DDPC 3SCJE 4DSLA 3CDWA 4A8XA 2QA4G 1RKJA 4ZCLA 4YDDB 3TA2A 3GFHA 1LV5A 3DLKA 2X1AA 4DN0A 2CQGA 2F8MA 2JZ5A 3OTDA 4ZPTR 2VFRA 1B64A 2FDNA 1JK9B 2HIQA 2L3MA 2F8EX 2VB6A 4OJGA 3MM9B 2DHXA 2E5JA 4RUHA 3KLVA 2K8GA 3BN7A 5I3QA 2V0NA 2VBWA 3NCRA 5KFIA 2JJ4D 2AQ4A 1SKRA 3NBPA 3DLEB 4CTAA 1N33F 4PQUA 2V8HA 4YR2A 1GXLA 4TKTA 4ES1A 3OXFA 4CO3A 3N9UC 4MTPA 4K59A 3N6NA 2W4PA 1C1CA 1T7PA 3CXCR 2YWEA 4WJBA 1WF1A 2DIUA 4LQ3A 5CHCB 4CO4A 1JIHA 2ZITA 4RUCA 4KE5A 3FFIB 1YRXA 3M9MB 1EP4B 2RDJA 4CT8A 1RKIA 2J7UA 4AXJA 1P6TA 2ZNZA 4A8OA 4N76A 4WU2A 2KDOA 4I2PA 1VQ4S 1RT5B 5KFZA 2JC1A 1S99A 1M5VC 1F2GA 2WW8A 3DMJB 2EG2A 2LQ9A 4MYUA 3LPYA 2P6TA 5HMWA 4X4NA 2HHPA 2FIUA 2ZH2A 2COLA 3BEGB 2VV5A 2WSFC 3D0HE 3RAMA 3KHRA 2M4MA 5AXLA 3PFEA 5AE2A 1HL6A 4DSKA 1HWIA 2LEAA 1E6VB 4C3KA 3DOLB 3JSBA 4DV0F 1D0EA 4RNNA 2IBOA 4EGLA 3I56S 7FD1A 3FZBA 3Q2TC 4A47A 1GAOA 3NMRA 4OHXA 1UVIA 1WF2A 2QA4S 3C3LA 5FD1A 1FT8A 3LWMA 2FTRA 2GCFA 3OHBA 3QJPA 3NMAA 5EX0A 3V4IB 1U25A 1SUQA 1FK9B 3ITHB 5F8IA 1N8RT 2YKNA 3GIMA 3R3TA 2A18A 4CT9A 2ZD1A 3MR6A 1S48A 2BACA 4WIIA 1UL3A 1YSJA 4DG1B 3OW2R 2VFUA 2G9OA 1VK3A 1I94F 1OIAA 4ES3A 4KQZA 1TL1A 3CD7A 4DL2A 1RISA 1WHVA 4MFBA 1S1XA 2IYGA 2E1MC 4OZ0A 4QIEA 1HR0F 3DLLQ 2VG5B 2YX4A 3DOKB 3NKYA 4KV8B 2BE2B 5C42B 4DV5F 2DGWA 2AYMA 3TAQA 1GTEA 3BREA 4QYZJ 1D9DA 4KGMA 3OVAA 3TAMA 5D4LA 1VQOS 3DYAB 1UJ5A 2YH1A 3T1YF 4ID5A 3KKFA 1NJZA 4QQBA 3UI3A 2N3OA 4GO5X 1QE1A 2VPWB 2KHDA 3OFGA 4M94A 2W7PA 3MAHA 2ASLA 2BR0A 4ZVHA 5KFOA 3MHYA 3CCQS 2J7WA 4UY8T 2V5HG 2VC1A 2XG8A 4DQIA 1DTTA 1VI7A 3J7Z5 5IQ6A 1FRHA 1A7GE 2BYCA 3BF4A 1ZBTA 4NYOA 4OI1A 4HTIA 3PX0A 4C4WA 1MMNA 3RAXA 1IXKA 2VASA 1Y3KA 4UY85 5EUHA 3K5MA 1IKWB 1U6BA 4ICLA 3B4MA 1RTJB 1NK9A 1BWEA 1HMVB 3SFUA 1HNVA 1YJTA 1SIWB 3M2RA 2R2RA 3VCDA 3JSMA 3TNVA 2V2KA 1UJ4A 3GR0A 2O5DA 5KFRA 4CNYA 4R0EA 2R7SA 1QAYA 2XMMA 1M5KC 4DSIA 5BYRA 3THVA 1SI9A 1JLCA 4RLEA 4YMEA 2MJNA 2FHKA 1UVJA 4Z37A 2D74B 3MMBA 1TKTB 1KS2A 4OQJA 3W2WB 2IYIA 5KFNA 4PRFA 3FQLA 4X84A 2HFOA 3TA1A 1NEEA 1D8YA 3CC7S 2XMJA 2A10A 4IG0B 2DNLA 2IC3B 3DXSX 2HRYA 3HX9A 1HI1A 5LSOA 1QUVA 3GV7B 1R7IA 3I96A 4RUAA 1MMDA 2CVEA 3Q24A 3T3FA 2HHWA 2CPJA 2GIRA 2BA9A 3M30B 4WFYA 1YIJS 5KTQA 2OPRB 2CZ4A 2B3TB 1YJNS 2XHWA 3R1LA 2E1RA 2AWZA 1ZOTA 5HROA 2RKIA 4YB7A 4JV0A 3AA9A 4AYBD 6FDRA 4DR2F 2DH9A 5IFMA 2B4PA 4EU0A 1HQEA 3KLGB 4WCEQ 3PW7A 1B7FA 3D28A 4IOAQ 3KHHA 2E1CA 2IA6A 5A8KB 2QYCA 4G6VB 2VQFF 3DRRB 2CPYA 2OD6A 1V6HA 4H4OA 3N28A 4ED1A 1S6OA 3TVZA 1RGVA 2UXDF 5KFJA 5FJ4A 1X7VA 5K14A 4UW2A 2ASDA 2UUAF 1QSLA 2PSZA 2W9AA 1G1XA 4G1QB 3DDNA 5DDRC 4MKYA 2PGCA 2NSBA 4CO2A 2KM8B 5KFWA 3KK2A 3VZIA 1QTMA 2IM1A 2DR8A 2VBZA 3DM2A 1OPZA 4CO0A 4RW9B 4NA1A 3KK1A 2ZKTA 1TAUA 1C0TA 3KG0A 2LXIA 3H59A 1RT3B 1TL3A 1TK0A 4Y2CA 4F67A 2U2FA 2D3OR 2XS5A 4K2XA 2BANB 2LQJA 3MECB 3UD4P 3D1HA 3MD3A 2YQ3A 1LK7A 4IRKA 1S7HA 3MM8A 3DU5A 3BO3A 2A3JA 1BLUA 2V94A 3NCPA 5B0GA 4KJIA 2DNZA 3MPVA 3OVBA 4ECRA 3W3SA 2B4UA 2W9CA 5DO2A 2WTFA 4AL5A 3VAKA 4QU6A 2UUCF 2BZ2A 2GIQA 2EFGA 4IUFA 3L95X 4GKKF 2FHMA 3PXGa 1MNEA 1ZM9A 3CC4S 4OJHA 5DQGA 2WB1D 2GO8A 3FMBA 2K3KA 2RRAA 3IAS9 2FLLA 3QZ8A 2MKJA 4N5SA 4F3QA 4CO1A 3MURP 4LSNB 5AJ3F 1X4DA 3DRPB 3PVXA 3I4PA 3MMJA 4LF7F 5BYQA 3KLHB 2KKHA 3MUTP 4EBEA 5T7LA 1RT6A 1H2VZ 2YWGA 1VHFA 1D1UA 2M88A 1SJ4P 2M8DB 2MGZB 1VOMA 2J9DA 4X4VA 1JLBB 4YB6A 4AXIA 2V4QA 4F50A 3PO4A 3U1MA 4C98A 3LOUA 4ITSA 2XI3A 1N5YB 1L3VA 4Q8EA 1S76D 3CWJA 4UQGA 4PXCA 3LP0A 1JLQB 4DLEA 5A0YB 1BQNA 1VRTB 4JOUA 3CCUS 4ZCIA 1TV6B 4RW8B 1HBUA 2KZZA 1ZM3A 1YJRA 3CO9A 3FRZA 2PMHA 3MUMP 1FRMA 1FNXH 3BZQA 3ISNC 5D3GB 3RTVA 5KFFA 2ZM6F 2WOMA 3LGNA 3HP6A 3CDBA 1APSA 3O6QA 3KLIA 2YTCA 5I3PA 4DQQA 3KG4A 2X1BA 3R5DA 3ZZZA 4R5PB 2KU7A 1C4CA 1VQNS