5K9FA

Crystal structure of a nipsnap domain protein from burkholderia xenovorans
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
MLVEQRTYWLKPGSVSTFLSLYEAEGLAIQAGALGRLLGYYFSETGDLNRVIQLWGFDSFEDRTRRKAILSGNPQWKSFVGRAGSMIERQSTELLTPAPFSPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a NIPSNAP domain protein from Burkholderia xenovorans
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Structural genomics, unknown function
molecule keywords NIPSNAP domain protein
total genus 33
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07978 NIPSNAP NIPSNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k9fA00
2OKQA 2KT2A 4Q2MA 2OFHX 1GXTA 2HLUA 1YJTA 5B09A 2XMUA 1R6YA 3HF5A 1FVSA 2ASYA 2FB0A 2QYCA 2GV1A 1FD8A 2XMTA 5B0CA 4OIXA 1TZ0A 5IXUA 1K0VA 2VH7A 1WD6A 5A6PA 1X8DA 1JK9B 2K1RB 2XMMA 4A48A 1TUVA 1KVIA 4HH1A 1SQEA 1Q53A 2XMJA 3BN7A 3BB5A 1YJVA 2KKHA 3CJKB 4Y2MA 1FVQA 3UDCA 2RMLA 1JWWA 4HH0A 1YRXA 2GA7A 1AFIA 5A6WA 2ZDPA 1N5QA 4F67A 1S6UA 1OSDA 2KYZA 2GO8A 2HFOA 4FNHA 2K7KA 1Q4RA 2LXFA 1X7VA 4A46A 3F44A 4YDXA 1Y9OA 4DL0C 5B08A 1TL4A 1URRA 2ACYA 2HIQA 2W4CA 3FRYA 3KG0A 3IWXA 3LGMA 2G9OA 3BDEA 1FEEA 3HDSA 1FE0A 2GGPB 1MWYA 2LQ9A 2XMKA 2L3MA 3KKFA 4NL5A 1IUJA 1VQSA 1S6OA 2K1RA 4OJGA 3TNVA 4FNIA 4ZOSA 1CC7A 4OJ3A 2N7YA 3DCAA 2OAUA 2GFFA 3K7RA 1FE4A 2VV5A 2PGCA 2IYGA 2BUNA 3LO3A 5B0EA 2LDIA 3BR8A 1AW0A 4OJ1A 5F0WA 3T9NA 2W4PA 1YJUA 2AP6A 2IYIA 3HHLA 5B0FA 5F0UA 2N4CA 2HQIA 2ROEA 2LQBA 2AJ0A 2BJDA 3E8OA 1CC8A 4Y2KA 2EW9A 4A4JA 3BGUA 1APSA 4NPOA 2HLTA 1Y0HA 1P8GA 2BJEA 1FESA 2GCFA 2RSQA 3GZ7A 1N5SA 3QMQA 4Q2LA 4Y2IA 2XMVA 3DXSX 3QGPA 4DPOA 1YG0A 2PD1A 2FHMA 1AFJA 3FMBA 2QLWA 2GGPA 1Y3KA 2OFGX 3IWLA 3TOQA 2N4DA 4U9RA 3TRGA 1U7LA 2KT3A 3MZIA 5B0BA 2FIUA 3BM7A 1MWZA 1KVJA 1CPZA 2K2PA 1SI9A 1SB6A 2HFNA 2QIFA 3HFKA 3KG1A 1ULRA 4HI1A 2IFXA 2Q3PA 1X0PA 4EFAC 1OPZA 1YJRA 2BYCA 3HX9A 4HL9A 3HHLB 4QOTA 4YEAA 2CRLA 5B0AA 4A47A 1OQ6A 4OJHA 5T7LB 1GXUA 1W2IA 3I9ZA 1VQYA 2ROGA 1P6TA 1XBWA 2RU9A 3LGNA 3FGVA 3WDOA 2OD6A 3VTIA 1OQ3A 3HHLD 3MCSA 3CJKA 1TR0A 1QUPA 5B0GA 1KQKA 2OP5A 2OD4A 3HHLC 5KAKA 5K9FA 1V3ZA 5B0DA 1LQ9A 1N5VA 2ZDOA 4HI2A 3KNGA 4DN9A 2RILA 2K7JA 1Q8BA 2ROPA 1RJJA 3BF4A 2BBEA 1N5TA 2OMOA 1TL5A 2AJ1A 2AW0A 2FTRA 2JDJA 2XMWA 5T7LA 1Q8LA 1Y3JA 2W4DA 2QLXA 4ZA1A
chains in the Genus database with same CATH superfamily
4TXSA 3H40A 5GAGU 2H5JB 3M1VA 2XSJA 1S6QB 1VBKA 1RWUA 2F5GA 4IQMA 4OYOA 5IQQA 4ZITA 2JEFA 2E5GA 1YX2A 2J6TA 5DS7A 1HBNA 2VF3A 2DT9A 3NBPB 3TZYA 2MQNA 3Q8VA 1KVJA 5HROB 1Q78A 2CPZA 4TNOA 1ZM4A 1WI8A 3V6DA 4CNZA 2EKNA 2WTFA 2KZZA 1MN9A 1YJ7A 3CEDA 3GV8B 3RRGA 3DYAB 2VJVA 4C3LA 2POKA 2OPRA 1JJ2R 2Y0SD 4M5GA 3J7YI 2JEJA 1K1SA 2HBRB 2I8EA 4EBDA 2OLWA 1U45A 2LP4A 1PBAA 4PKDB 3ENQA 1SJQA 1R8PA 3W60A 2CNKB 2BACA 4ECQA 3NWGA 3BDPA 3LW5C 3I0SA 4O3PA 1KLNA 4LSZB 8AT1B 1QSSA 4ZP8A 2DTJA 4ECWA 4IFVA 4F67A 2E1AA 2FLOA 2W2PP 3ENVA 4C97A 2PN6A 4IOBA 4YB7A 2DNGA 3MM7A 2PI5A 4RWXA 4DR6J 1WTFA 2M52A 3LOUA 1RUSA 5LM7E 2V2ZA 3FVYA 2HK3A 5A8RA 5CYMB 2IM1A 4RNMA 3BO2A 4DF4A 3CMES 2UUCJ 1XR7A 1J5OA 3M2RB 2O66A 4CLPA 1T03B 4ELUA 2DY1A 1H98A 2OTJS 2BXJA 1FA0A 3MR3A 2M5YA 5C25B 5EX3A 3K59A 4NYPA 2E9RX 1XEZA 1PILA 1IUJA 5A76A 1S6OA 4FZVA 4OJGA 5GMKa 2CADA 4PXBA 2I1RA 3HKZD 2V5HG 5B7WA 2UVVA 2ZJQQ 3QAEA 4DR4J 4X2BA 2R7UA 2AYGA 3K7RA 2IA0A 2IYGA 2MHNA 2V63A 4J9VA 1F9EB 4ZMMA 3OVSA 4LFBJ 4KFBB 1BD6A 2LU1A 2CNOB 3CXCR 3DHXA 5K14B 3BREA 3THPA 1LV5A 1IWAA 4RW6B 1U25A 3FZ2A 4C8LA 4OV1A 4HHJA 2DGXA 2IJFA 2K8GA 4GKJF 1PC4A 3KDNA 1CJUB 1H0HB 4OI0A 1Q0NA 3GZ7A 2RSQA 2PMHA 1RI7A 2YXLA 5BR8F 3HLUA 3OUYB 4NLQA 5J2NB 3SSQA 4NXNF 1TKTB 2PD1A 2DPJA 2LXIA 2NUHA 4O4GA 4U8YA 2YQ0A 4F0HA 4H4MB 2GHWA 3MM5B 1T9UA 4MMOA 2BE9B 2FIUA 2VA3A 1WOOA 2WVFA 1K9MT 1VCTA 1BGXT 4O44A 2QIFA 5LSLA 1RTHB 3MHYA 3G8SA 3GTYX 2IFXA 2Q3PA 5D15A 4IO9Q 1S9EA 2J9CA 3ELHA 3HHLB 4IRKA 2J6SA 1WHVA 2CRLA 2HG4A 1IBKF 4N7TA 4JYAJ 2BRLA 3M7VA 4O3QA 4IDKA 1W7WA 4GVBB 1P6TA 1V6HA 3PIPQ 5KFSA 5KFZA 1NK6A 1WHWA 3OT9A 1C1CB 1OYEA 3J7AN 2AEMA 1RAHB 3MMCA 1ZM3A 4GO5X 4FKXA 1XTZA 2QN6B 3VF0B 4YQWA 1HNWF 2CUYA 2F8MA 3CDUA 3MMJA 4HI2A 4USHA 2IC3B 3LWLA 2EPIA 3IG1B 2DHGA 1N5TA 2AGPA 2CQCA 4LF6J 2F9DA 2GMLA 1KHVA 3AFGA 3JSYA 3OL6A 2MQMA 5ITHA 4DR2J 1TK8A 3CNQP 2QLXA 4H4KC 4E8UA 4EK2A 4RW7A 4MKYA 4NCAA 4CLUA 4DCJB 2A2DA 4DQSA 5FLXY 3PJ9A 1KSPA 2BM0A 4USTA 3OFHA 2F8EX 5JJBA 4DFKA 4DV1F 4F3MA 3VHQA 2FVCA 4DQIA 1T11A 4X62J 4ZVQB 3VAFA 3HJFA 1FD8A 2LCWA 3I4HX 1MU2A 2GJFA 3J81j 4LRFA 3BYPA 4LSLB 3SIPB 2HMIA 3H8YA 2BZ2A 3OJUA 2F4VJ 3IR7B 2MJNA 2QL7B 4XDDA 3CJ3A 1VQ4S 3I87A 4R5PB 1OPIA 2BJ8A 4KQZA 2C2RA 2QX0A 1LW2A 3H5YA 1SXLA 2WVEA 2LQJA 3DRPB 2EWHA 1S1XA 3OTDA 2A6OA 2GIFA 4PPZA 5DM7Q 2ASLA 1TUGB 1NJYA 3G8TA 2HKEA 1XNQF 2ZDPA 3VZHA 2CJXB 4TN2A 5A8WA 2VOPA 1X4FA 2ZOFA 4F04B 3D1QA 3BGLA 3F44A 2J8SA 1Y9OA 4HTJA 5F9LA 2J9DA 1REVB 3Q89A 3OXGA 2XC9A 1F9FA 3F73A 3SI8A 2VKZG 4YP3A 2FJEB 2HEKA 2MHEA 4OYBA 1SJ3P 2LDYA 1XNQJ 1N0UA 2L9WA 3HULA 2X51A 5J2QA 4C6AA 2KU7A 3I32A 2VICA 3DM2B 1S1TB 2IAJB 3KLVA 3DOLB 2CZ9A 1M5SA 3K8WA 1T3NA 3HVTA 1ZA2B 1NZAA 2L9NA 4I56A 4Y6IA 3W7BA 3B78A 4RU9A 4C8YA 2MZRA 1TMJA 3MAAA 2VV5A 3HHNB 1NRKA 3CJTA 4QIWD 1I1GA 3I9V9 4WFAQ 3UDVA 3FFIA 3AJDA 4JV5J 1PIEA 1I51B 2ROEA 4E98A 2GNKA 2I5JB 4QBUA 3PEJA 1FJGF 3QO9B 2KJWA 4B02A 3TQEA 1CC8A 4EGLA 1RT5B 3PKYA 1X5PA 4WXOA 2KHCA 4JI8J 2OMLA 2HVHA 3MGJA 1FEHA 4M5LA 2B9EA 1FJEB 2NREA 2R8JA 3MUMP 4DR4F 1B7YB 3HVAA 3DLGA 2OELA 2OEKA 4MFBB 4Q2LA 4C11B 3QSYB 4DSFA 3ENAA 3MEDA 3D0IE 2FHMA 1FKOA 2G2ZA 4WP3A 1WKKA 4HTIA 1ZPVA 2K06A 4KAIA 4WYWA 1KLMA 2HAIA 2OPQA 2DGUA 5A2QY 1N5YA 3PW0A 1RA7A 3SMZA 4B3SF 2OPPA 2HQDA 5C2GA 2N7CA 1HYSB 1D0EA 3AT1B 3L95X 4ZVGA 3VV2B 4B08A 3H2VE 1Q79A 3KJQB 5GADU 4F4XA 4YY3J 2ZH1A 3UD4P 1Q1KA 3LP1A 2L9DA 4K4SA 3FBEA 2IMOA 2E7XA 1S59A 3DDKA 3EUNA 4DHVA 1OPZA 2UZAA 2W2OP 4DI6A 5KFOA 5AJ3F 2OO4A 3W9JA 2E5LF 2DNPA 1S76D 1HBUA 1S4FA 3O8WA 1YRTA 3MECB 1W2IA 1QUVA 4KR0B 5CHCB 3RGIA 5DG9A 2WSCC 2UV8A 1DZ5A 4JV1A 2LQ5A 3C14B 4CTAA 3DRSB 1J5EF 3JB9k 2DJWA 1TR0A 2HNDB 2U1AA 2Y1RI 4USMA 2ZH2A 1XN9A 1W2BR 3KK2A 4OL8A 1T02A 2MQLA 2HHSA 1YSJA 2VUGA 5KFLA 3EYZA 1KN6A 3EZ5A 4OYPA 1U02A 4KHRA 2B51A 3ISNC 5E33A 5IM0B 2ZOGA 3HMJG 3TUPA 3A3NB 4KB7A 3UI3A 3PX0A 3OHBA 2JDJA 1RWOB 1RISA 4WKRA 1N52B 2VG7A 2HHPA 3M8PB 4WIQA 4A8OA 2O3DA 4X4TA 4JI7J 1RCXB 1DTQA 2ZWPA 1SUQB 4OHVA 1SC4B 3WZ0A 4DBQA 2VG5A 1FRJA 1NB2A 1RA6A 3D68A 2LQ8A 4JP8A 1TK5A 3GG1A 5BR8J 1VBZA 1X60A 4CO5A 3Q8SB 1G1XA 3HPOA 2B6AA 2DGQA 2QFJA 3HFZB 2B4UA 1DQ8A 2H1YA 2J76E 3K5LA 5DDPC 2BJ3A 4BHQA 1U1OA 4CWBA 4PRFA 1R89A 3P5BP 2W9BB 2FHKA 3BGRA 4ANEA 3DDNA 2XMMA 3PY8A 2HHWA 2AJ4A 2E5HA 1JQGA 1QTNB 1S7IA 3ICLA 1EP4A 5DG7A 1U49A 3J7A1 1UMJA 2EK1A 3FRZA 2BABA 4NLYA 3T19A 3KUGA 5I3UB 4TY9A 4X66F 5E7OB 2C28A 1FTRA 3W61A 1QY7A 3ZZ0A 4YFUA 3CPWR 1G7CB 1S99A 1AFIA 1GMUA 2MQOA 4FXWA 2CPJA 2DEJA 2KYZA 4ZVPB 1UW4A 2QSWA 3PW5A 4KGVB 3VAGA 2Y8YA 2UU9J 4DX5A 2QTWA 5IWAJ 1HPZB 2HZCA 1CBKA 4HHHA 3JQKA 3W66A 1DAXA 4F36A 1ZBTA 4ECTA 4W4MA 3D7SB 4CH0S 4ILMA 4K4ZA 2H3EB 2MKHA 3PHEA 1TKDA 1FE0A 2GGPB 2FQQB 2LQ9A 2RVJA 2VB6A 3LPEA 4NE9C 4F02A 7FD1A 2O67A 1T9VA 4J37A 4K2JA 4CP5A 2ZH3A 3A4TA 1RTJA 6AT1B 2YWFA 3DLLQ 1J5EJ 3DI6A 4CO2A 1RDRA 2RDDA 1HHSA 3KUEA 1XMQF 4P7TA 3RB0A 2Z58B 3G82B 4OX9F 4YS2A 3C15A 1EQMA 2ZZMA 3MEGA 4JI5F 4L3KA 4OJ1A 1RWXB 1SKSA 1H38A 4B3RF 5F8LA 4F0KA 2XNRA 1UVLA 1JJCB 4X65F 3DN9A 4X4VA 4YMEA 4K4WA 2HBYB 4RW9A 2EW9A 4ZCKA 3TWZA 2P5VA 3EDQB 1TKXB 3CJ4A 2CJYB 4WTYA 1APSA 4RBVA 1FRHA 2UXDJ 1HQ2A 3C6UA 3QMQA 5KT2A 4QPTA 4B3TF 3UDEA 5CYJA 3QIPA 4Q5VA 2V69A 3CE8A 2XGQA 3I5AA 2GAHC 2DRDA 2GW8A 3T41A 1F3FA 3KJVB 1C0UA 1NNDA 4DZDA 5KTQA 3ISND 2V2VA 4BWJA 4K50A 3KLGB 4ES1A 5U47A 4AQYF 1RT3A 3HD1A 4DSIA 1KNZA 2GJIA 4BC9A 3KHGA 3HKWA 5KFRA 1NK4A 2VIHA 3QJJA 2R4FA 2YQ1A 1FDNA 1T95A 4OI6A 3K0JA 2HW3A 3D54A 4AYBD 2P8IA 3K5NA 3E3XA 1WOSA 3KHLA 1FXRA 4XAKA 4UZBA 2KFZA 4NZ6A 3CCZA 3HHLD 4OZ3A 5EWGA 4ECUA 2RDIA 3PR4A 1JMTA 3GYXB 4V1Ak 1WI6A 3BZQA 3CWJA 3ZZRA 5T14A 1LQ9A 1K44A 3HVWA 4DN9A 2K7JA 4L76A 1UAWA 2MZJA 3A8KA 2XZTB 3KLHA 3GMGA 4ZPVR 4M5IA 1TP7A 2XZDB 4CQ1A 4ID5A 4ZHRA 2ZJRQ 1CULA 3T9NA 4BBYA 4IUFA 3LUYA 5C42A 2J0QD 4ZLPA 2NXJA 3RUBL 4B9NA 3EGZA 1CJKA 3MMBA 1YRUA 4IG0A 4ZCIA 4RNOA 4B3TJ 3M8RA 2BE7D 3LQVA 2HFUA 2HLUA 4N47A 4WP8A 4NCBA 2MLXA 4LSNA 2BE2B 1K1QA 2NUUG 3KUHA 4QR1A 4EWTA 1EHWA 1SH3A 3UD5A 3THVA 3C3LA 1FVSA 4DMZA 3AD9C 3WIUA 3UR3C 2QYCA 3W8GA 4TKTA 5DG8A 2M8DB 1TU0B 1K8AT 3OTCA 1ICEB 4OIXA 4ZVTB 3US5A 5IXUA 1HNZJ 3H4BA 1D8YA 1L5UA 2J6UA 4KO0B 4QJVA 1WACA 2ZKTA 1UPPA 4N56A 2KRBA 4R25A 2XY6A 2BVZA 4EZ6A 3IMQJ 4KKOA 2RB7A 4FBUA 2ZWOA 3RB4A 3FJ2A 2JVOA 2JHEA 3CJKB 2FHOB 1LOUA 4LJMA 2MTLA 1D09B 1FDBA 3QYYA 5CXTA 3G87A 1YRXA 5HQ8A 4F4ZA 4W92B 1EKSA 3C6TA 3CUNA 1GFWB 3VZIA 2BA9A 1CVJA 3KLIB 4NLUA 1KVKA 4J9LA 1Q4RA 3M32A 1X7VA 3PX6A 2BKOA 4DL0C 5J2MA 3JAMY 3A8EA 1FXDA 3PG9A 4MIAA 1WG5A 3GFYA 1ZYQA 2R7SA 4FKYA 2BV3A 2R8HA 1E6YA 1VFJA 2RF2A 4NLVA 3R3TA 2CXEA 2CPFA 2DK2A 2V4JB 3MPVA 3TEGA 4ECYA 1BQMA 3E51A 1ZETA 5IZHA 1SKWA 1HNWJ 1S79A 3OSPA 1FNMA 1WKLA 5L1IA 1S7HA 1HBOA 4P6QA 1RYSA 4DLEA 2IBKA 1KONA 2GHPA 2M2BA 3JSBA 3M30B 4QR2A 4OHZA 4ZDNA 3W5ZA 4CNYA 3UD3P 1B64A 4DFJA 2B9YA 2BUNA 3W63A 2WBRA 2R2TA 1RT1A 2F63A 3UCUP 3UW1A 4Q0BA 1RTZA 3NKYA 2CQHA 3RB3A 2X3GA 3FNNA 4CLWA 3Q8RB 3SV4A 3SCIE 4ATNA 3N4WA 1RADB 5LXYA 4A4JA 2JC0A 4UY85 3RU0A 1NK5A 2W24A 3R5BA 1JJHA 1MW7A 3RG6A 1WEXA 3KG4A 1Y0HA 1DHMA 2QLFB 1FESA 2YNFB 5HBMA 3MAHA 2R7RA 1RT4B 4O3SA 3DU6A 2AWZA 2V94A 2WCXA 4M1KA 1SIWB 1YG0A 5A0YA 2J7WA 3SYZA 2VFUA 2FJXA 4FYYB 3DRRB 4I6AA 1Y3KA 4CIOA 3QZ7A 2HWIA 4NI2A 1M5PC 3CC7S 2RS2A 4EBCA 3VAJA 3GIJA 1U7LA 4OI2A 1RAOA 2H54B 1BC6A 2FDNA 2PMZD 4U7UK 2DBBA 3WIVA 5CA5A 1TL1B 2CPDA 3HHDA 5L1JA 3NXZA 3WHIA 4ENOA 1RWKB 4EFAC 4F3OA 2F7VA 1UTAA 4DFPA 4KHPF 1RE1B 2HSEB 1HNXJ 3MM6A 1FNOA 3C19A 3CCMS 4ZP6A 1Q5YA 4C8NA 2FC9A 3VQSA 3LGNA 3H7HB 4MIBA 2AJ2A 3TUZC 4N5SA 3SZ2A 1UVIA 3UNYA 3GIRA 4AD6A 3N28A 4TYBA 3N01A 4M5JA 5L9XA 1V3ZA 2JLGA 2BOAA 2DNKA 3WC2A 4GRSA 1Q8BA 1H2UX 2QA1A 3NAHA 3NL0A 4LFAF 1HI8A 3IM9A 3TZZA 2HPUA 3M05A 2J9EA 3CJ8A 1P9QC 1S9GA 2UUAF 4FF3A 4XDCA 5F3ZA 5F8JA 2V8HA 4LBPA 2G1DA 2XWXA 3MM8B 3ZTOA 4DL2A 4XTTA 2LLZA 1RAAB 3O44A 1XQIA 2R7TA 1T9WA 2ZUAA 1YJTA 1WHYA 1VIOA 2XMUA 4TLRA 3V5RA 2DNHA 4GKJJ 3NCRA 2A1BA 4LF5J 3V6KA 1U1MA 1UZDA 4A8MP 2KVIA 2E1PA 2Z2ZA 3BKFA 3CW2C 3HSJA 3QT7A 2ZUGA 3IS9A 2MKJA 4DOZA 3BGOP 4ED4A 4UOGA 1XK8A 3PCOB 3H4DA 4HACA 1QTMA 4FBTA 1RTIB 2RQ4A 3W64A 4RBUA 1YZ6A 1FK9B 4FDFA 3WX4A 3T5HA 1FDAA 4MYUA 4USKA 4WE1A 3KHRA 4N8NA 4NLTA 3QRPA 1YJVA 2Z4PA 5D4OA 5HVGA 2H51B 4C3MA 2B4OA 3M8SA 3SDEB 4CYUB 4HH0A 3M1VB 2XSJB 4Y3CA 5G0RA 3RRKA 3T5LA 4Z7YA 3KMQA 4L72B 1V3SA 5GMDA 4G1IA 1RWWB 5A6WA 1N5QA 1EETB 4W90B 5C5JA 2ZD1B 2B5JB 3NWRA 3GCWP 5DZ6A 1B0TA 2LXFA 2E7WA 2DR7A 2MDAA 2IIHA 2O01C 4YDXA 2OSRA 1VRTA 3MF5A 4AFFA 3L3CA 4ED3A 2N3OA 4I69A 4LFAJ 5EWEA 3FRYA 2ACYA 3ILIA 3QFWA 3BGFA 3IWXA 4DSLA 3M9MB 2GQCA 4URQU 3KK3A 2GC8A 3BO4A 2W1BA 4YN3B 1DLOA 1WF0A 2V9WA 3QT6A 3M2VA 5AE3A 4WCEQ 2HQCA 3A13A 2AJFE 2GQQA 2FC8A 2L48A 1J2VA 2GFFA 3UVJB 4DXLA 2Y1IA 1ZM2A 3H25A 4F8RA 2HNZA 2IPOB 3LP0A 4NEYA 4J9KA 3DOKA 1X5OA 3C8YA 2EFQA 2IVMA 1HBMA 2AP6A 2DGOA 2OI2A 3D28A 3OR2A 4IH6A 5B0FA 5THWA 3R7NB 1T9TA 2DRAA 2ZVSA 3W2VA 4NCGA 2UP1A 1PG5B 1JLGA 2HFVA 3GJSB 1WJ9A 1PBUA 2H4YB 3KLFA 3LP2B 2F8HA 1RU2A 3FEZA 3DGPB 4DR5J 1NPPA 3FZBA 5LJ3Y 2QO3A 3NP5A 2JNJA 1RWPB 1FKPB 2VFSA 4Z37A 3X1LB 4Z7CA 1ZM9A 4ZVHA 1RBAA 3QGPA 5KOWA 5I42A 2ZZNA 3W1YC 4IOAQ 1AYEA 2QA2A 3SEOA 3M8QB 4NYOA 4FYDA 1AZSA 4CLFA 2HQFA 4C4WA 4KFBA 4DL4A 2VDHA 2DR6A 3MMAA 4UQGA 2JZ5A 3DOMB 2K2PA 4CH7A 4KGXB 1HA1A 1X4EA 2C2NA 5ETNA 3EZOA 4HLBA 3A8IA 3D0HE 2E1RA 4OZ1A 3G6VA 3WC0A 1X0PA 2AU0A 2BQUA 1F2GA 2G0JA 5K8PA 5IT0A 2XYGB 2UXCF 3GYGA 1PJ7A 4OJHA 1Q8KA 2MYFA 4QIGA 2X7IA 1BUXA 4KIAA 5F8MA 1XBWA 2MZSA 1R6VA 3K89A 3DGVA 4UOHA 3V4IB 2DKOB 2VPWB 3OUYA 3UCZP 2KJVA 3LTOA 4J5OA 5E41A 3IRXA 3K5OA 3QRQA 4O4GB 3D9BA 3ONQA 1N33F 2F9JA 2ZH7A 5A8KA 1FRMA 3JTOA 4P72A 3J7Z5 1HNIA 5DGAA 1WG1A 1R43A 4RLEA 3ZZUA 2WK4A 1LWFB 3M4XA 3U27A 2VQFF 2HGLA 4DV2J 3H5XA 4PG7A 4IYQA 3U1LA 3JQMA 2W2NP 2AZ3A 1SQGA 1V9OA 2DR5A 1RGVA 1FX4A 3K57A 4LUBA 3S8SA 4LIWA 3PYDA 4GMKA 1HQUA 4DV3F 2VC1A 2GMJA 3NNHA 4M95A 1BWEA 3MMCB 1LKZA 2ASYA 5E0OA 4LF1A 2N82B 1S77D 3OR1A 3C16A 4IH5A 1H7WA 4C0BA 1KDNA 2CQ1A 2QRRA 4QIEA 4NLDA 4DCOB 2BJ7A 9ATCB 3MPYA 2XGPA 5GVQA 1F1BB 4QR0A 1GTEA 1TUVA 2KT5A 5C24A 2A6MA 3PW2A 2J0WA 3HM9A 2FLPA 4RR5A 3K5PA 2UXDF 1TL7B 4CH1A 2JJ4D 2KKHA 3TI0A 2ZM6J 3TANA 1JLCA 4P73A 4IR9A 4WTOB 3UDLA 1VK8A 4K4YA 3O3LA 5EUHA 1NJXA 4HVZA 1R7IA 4NZ0A 2B0GA 1URNA 1X5TA 4L73A 1MU2B 2EFPA 2IM2A 4CM0A 4CRJA 3PNIA 1M5OC 4DPYA 1R0AB 3AA8A 5H9FK 2JC1A 2QGFB 3TARA 1OMSA 2AQ4A 1FEEA 1RT2A 2BM1A 3KK1B 5FDLA 5SZTA 1AT1B 2ABYA 3N0VA 3PACA 1R8HA 2UUWA 2CJ9A 2R7OA 5LSOA 2YNGB 1RBOB 1CC7A 3NG8A 3TAMA 3W65A 4DG1A 3M2UA 5BYSA 5IT4A 4DV5F 2HVEA 4KGZB 4GKKF 4ZJLA 5A8WB 3PO5A 1AROP 4OHXA 5FLXU 5D0HA 2XMAA 3ZTQA 1IBMJ 1IR1A 1X4HA 2LQBA 3W2WA 4C8OA 4KT0C 4MIWA 3VGVA 3S6EA 5LMUF 4M5HA 3TUJC 4MT1A 1WC5A 3P49B 2MKCA 1SBRA 1VS3A 4DSKA 2GCFA 3TR5A 1I94F 3PKMA 3R5DA 4ZVSB 1GX6A 3TEHB 2XLKA 4RW4B 4ED7A 2M8HA 3AQPA 3PYGA 1U47A 3IWLA 3TVZA 1FNXH 1DY3A 2G2OA 5K8OA 2MZ1A 1X4AA 2H65B 3P5TL 4I2PA 4TY8A 3LAMA 2OPSB 4KGKA 2V8VA 1RQ0A 1B7FA 1MSWD 1SI9A 4DUZJ 1HHQA 2FJAB 2I5JA 3ZZZA 2VU5A 4QOTA 3MPUB 3TVYA 1TKZA 3A3OB 2DGTA 1UKUA 4R8UA 1OQ6A 1L3KA 1LWEA 4DX8H 4YDDB 3TZXA 5KFNA 3CCLS 4DV7J 1S9FA 4NYZA 5KFYA 1BWVA 2IHR1 1JLFA 2VODA 5JVGQ 3MCNA 4DV6J 2OGUA 2H5EA 1VQOS 2AGQA 1U1PA 2GHVC 1FKOB 1QUPA 3DKDA 4RNFA 1X4BA 2YBVA 2ADBA 3T3FA 2HHVA 3FQKA 3ILLA 2AT1B 4DU8A 3CMAS 3PW7A 4JBCA 1SL0A 4EO8A 2BBEA 4ETXA 4OX9J 4ECRA 5L9NA 4YB6A 2EXUA 3G4SS 4DX7A 2WW8A 1ZOTA 5E2QA 5K5MA 2XS2A 1VI7A 3JXOA 4UT4A 2VKRA 2RUGA 4NXMF 3TQ1A 1KRPA 5JXSA 1VLOA 5L39A 4PUOB 4XO0A 4W98A 1RBLA 2NXNA 4CLLA 1DFDA 1J5OB 2DNQA 4LF7J 3KFWX 2ZH9A 2ZH4A 2R7WA 4J9PA 5EX0A 2VBZA 1XERA 5CH7B 5LOQA 2JSXA 3G96A 3I0RA 4ERDA 3SCJE 1U8SA 4WYLA 1S1WA 1IKWB 1N34J 1FWLA 1ZAWA 1K0VA 2VH7A 1PYTA 1S1VB 1VRUA 3MDFA 3FSXA 3PFEA 4QCLA 5MAOA 4PXCA 4ZVUB 4WFXA 4YR0A 1YVFA 2R9LA 1WORA 3BB5A 3BN7A 1YK9A 4WFBQ 3CTRA 3GWCA 3IRWP 3DRXA 1QVFR 4Y2MA 4JI1F 1FVQA 5D78A 1QVGR 1U6BA 2RE1A 2ZOMA 2YKMA 4RUAA 1DTQB 4K4XA 2WRMA 3BQ2A 3DMJA 2CVEA 4DPTA 3QGIA 3BH7B 4P52A 3RTVA 1B70B 1U09A 2PIIA 4RNHA 5H9EJ 1IBLJ 2B56A 1VK3A 3CCVS 3R2DJ 1T05B 4YOEA 1XJWB 4BLGA 4ED2A 1TV6A 4ZPAA 1CJUA 1K47A 3T9ZA 4Q45A 3CCJS 2BRKA 3ZZYA 1KOOA 3SSSA 2FVPA 2V68A 1IKYA 2LA6A 3FSYA 3FUYA 4NRTA 1M5HA 1UJ6A 2MSSA 1OIAA 3J7YU 3A12A 3V81B 1IQTA 1PC5A 1LFWA 2DHAA 1QE1A 1H2VZ 1RXOB 2Z2YB 1WC4A 5M2RA 3ZZTA 2XZWA 2L3MA 4PWWA 4DF8A 1FFGB 1RHUB 1KTQA 2YKNB 3MCOA 4H4MA 2CWXA 3CCWA 1BQXA 1MMLA 1SPBP 2AX1A 4OYXA 1MMNA 4LVOP 4P9SA 4TYAA 1FD2A 3ZNUA 3HP6A 1VBXA 4JI2J 4U7UD 4BWMA 5ETVA 4G1QA 1MLAA 1F5AA 3OFFA 4RUHA 1XWLA 4X4QA 3NMAA 5CZXA 3VVTA 1Q7LB 3M8ZA 3DLEA 3BR8A 3RW6A 1NSKL 2LA4A 2YNIB 1Y00A 2HS0A 2YWEA 3HHLA 3HSDA 3I96A 4WPAA 3GG0A 4UOFA 1IBMF 4B9UA 2E9ZA 3QQCD 4IDKB 3JYTA 2NZ4A 2PT0A 2WONB 4CM2A 4LIRA 2CQ0A 3LF0A 2IDLA 3H2UB 1NU4A 1C1CA 4K2XA 1U24A 2NZCA 5CYQB 4RX6A 1JX4A 2JX2A 1JLEA 5CZVA 4PWDB 2ZE2A 3BJYA 2JWNA 3D1HA 3W5XA 1CSJA 1NCLA 1OSCA 1Q95G 1OY8A 3O5TB 1S12A 3G6ES 1NK8A 4DPOA 3PR5B 1FX2A 2Y1LB 5EGYA 2QA4S 2CNLB 4PEOA 2D9OA 4NMLA 3FMBA 4X4PA 1SCJB 2X1BA 1BY9A 3TOQA 2VJUA 1NJWA 1AFJA 1C4AA 3G82A 1QJHA 4K4TA 4LF9F 4OZ5A 2WOMB 2CQ4A 1D9AA 1WOPA 4X62F 1RK8A 3AH6A 3D6HB 1MWZA 1ZTWA 1TAQA 2X3DA 3AOBA 3HJVA 3SQGA 2V4RA 3KG1A 1TQLA 3NGUA 4M5DA 3NGRA 3WBZA 3HX9A 2BYCA 3M6VA 5F8NA 2ALYB 1LK7A 5T7LB 1X0FA 3CO0P 1E6VB 4PWUA 3HFVA 1YIJS 2ROGA 4RWWA 3R6GB 3MFHA 3LGHA 3W5YA 1KEKA 4E0DA 1LWCB 4U96A 5J1NA 4ZVFA 1QM9A 1S72S 1JB0C 1GMWA 2BJ9A 2ZFHA 3AD8C 1F2HA 4QIFA 3S01A 2FJDB 1MWQA 1R3NA 5K9FA 5B0DA 2CJAA 1LW2B 1NEEA 2MZQA 2ROPA 3CCTA 1S1XB 3PV8A 5KFUA 1NB7A 3NMRA 2KDOA 3EXCX 3GSIA 2AIRB 2HBQB 2BR0A 1NK0A 1JIHA 1WEZA 2CPEA 2VA2A 2YKPA 1S1UA 3QLHB 4EU0A 4LF8J 4R0JA 2AYMA 3N5BA 3NS7B 4PYAA 1LFPA 1S6PA 3BV8A 3FK4A 1PGZA 4PXEA 2BQ3A 4LMZA 1N36F 1U26A 2LEBA 1CS4A 3HF5A 1IM6A 1AXQA 8RUCA 1M1HA 1TL3B 4IFYA 2P9CA 1OY6A 2O1PA 2CQPA 4LBIA 4TU9A 1EJ7L 3T1YJ 2JRSA 4DQRA 5KT6A 3MEEB 5B0CA 1D3WA 2VFVA 3BBBA 1S1TA 1HW8A 1UFKA 4J9OA 2BOPA 2DRBA 1R0BG 1X8DA 3L7UA 4PQUB 2HWTA 2WB4A 4CLZA 2ZEJA 3IAM9 4A48A 4DSJA 3PJWA 2CJQA 3U02A 3PEHA 5AXNA 1C1BB 1CULB 1HARA 2G13A 4LRAA 2IRYA 2D1CA 3PZPA 3F0NA 4QIVA 1AA1B 3RJMB 5EHHA 1X9SA 1GNKA 4OZ2A 4RW6A 3MFIA 1LK5A 3HHEA 3ZTPA 1BXNA 1RB0A 1DQAA 1DTTB 3QT5A 3RR8A 2FLNA 4DJBA 3EICA 3BSNA 2K3IA 1DQ9A 2F4VF 1F5CA 4WBFA 2A18A 2V8DA 5KG5A 3QJLA 2KZMA 2F4FA 4HDGA 1M90T 5L8RC 4DR2F 2HNYA 2ZNZA 2C3MA 4LFCF 2HIQA 3O1LA 4MFBA 4AL6A 5BXIA 3SCKE 1HQEA 3AAWB 4P2FA 5M2PA 1QSYA 3MM5A 4Q8EA 4AXJA 3BDEA 2FHJA 1NKEA 3H90A 3PJXA 4J7CA 1IN0A 3KKFA 1HWJA 1KBRA 2PI4A 4GKKJ 4P2MA 1M5VC 3HD2A 2RQMA 2MPUA 1XMQJ 3AODA 2QFIA 4I7FB 4PABA 1ZPWX 2MLZA 4ZPWR 3LP1B 1WUUA 2C1EB 4UOCA 4LF6F 3GJRB 5LMUJ 3DLBA 5LXRA 1QAJA 2WBMA 2D41A 1EAYC 2W4PA 3KLEB 4K5SA 1U2FA 3IN5A 3EPGA 2ADCA 3E01B 5HLFB 2N4CA 3LH2S 3EZUA 3H59A 3G86A 1TVRB 5F3TA 2AJ0A 3HCXA 4I68A 4X84A 5G4DA 1B0VA 1JKHA 3OQ2A 3J80U 3KK2B 1S0NA 5D3GB 2QSFA 3ET6B 5ETPA 4HT5A 2E7VA 2XMVA 1BQNB 3IAS9 2ZHOA 3M30A 3GFZA 1SJRA 3MAQA 2Z30B 3BSOA 2C2EA 2HS3A 3NNCA 1CJTB 3B82A 2D9PA 1M0SA 1FFSB 1RT1B 2PEBA 3BSAA 4ECVA 4F2SA 4LFCJ 3MM9B 2XO6A 3K17A 3QPIA 5DDRC 1IKVB 4KYZA 1YLXA 3JSRA 3BBFA 3HXMA 2DH7A 4D3GA 4N76A 1QD1A 5B0AA 1PAUB 4AXIA 4DV4F 2Z56B 2IM0A 1SJ4P 1RT6B 2W01A 4JI1J 5KG4A 2B4VA 2YX1A 1CJVA 3P4UB 3ZO7A 4ECZA 3BGRB 4R5PA 3R1HA 1U1NA 1HHTP 3POTA 3VTIA 1VIXA 5MLCV 1N56A 1S0VA 3PW4A 3AJ1A 4DV4J 5C7PA 2RJZA 1IXKA 3UWTA 5KAKA 2BJ1A 2KL8A 3D1OA 5AXLA 1LXNA 4F26A 4NI2B 5KFKA 3OTOF 4JI7F 3IWNC 5D4NA 3KNGA 2W9CB 4B3OA 2HHTA 2RRNA 3T1YF 1HNVB 1M1GA 1UJ4A 3CB4A 5AT1B 3R5JB 3DYAA 2XMWA 3CJRA 1PKUA 3TW0A 5AE1A 1Y3JA 3Q8PB 1NDLA 2ATLA 4URSA 3CDAA 2KFNA 1I3OB 4R0EA 2CDRB 3GFHA 3D6FB 3CJ5A 3FCWA 4H4OA 2CQIA 2VG6A 3ZNJ1 3J7ZT 4AL7A 1T9YA 2AF6A 2EFOA 4IKAA 3L9ZA 4HT7A 3JAMU 4YR2A 4L74A 1XMOJ 2X1FA 5J2QB 4CO0A 1FWKA 1NJZA 4DU7A 3NGSA 3HHKA 3W9IA 4C8MA 2GV1A 1A0OB 2VQFJ 4WZMA 3CD5A 4K4VA 3AB2B 2DNNA 1UCNA 3MM7B 4P71A 3THTA 2RDJA 4PG6A 3MCMA 2K1RB 4L3NA 4N8OA 3ULHA 4ZP7A 1I6JA 3CULA 1FJGJ 4I64A 4OX6A 5CYMA 1VQ7S 3N9UC 1SQEA 2E66A 2YQ3A 3R5CA 4YB5A 4QW8A 4CO4A 4I2QB 2QG9B 1YHQS 2B43A 2HYIB 5CQGA 3QGHA 3UFCX 4U67Q 3W3SA 2UXBJ 4JI0J 2BDPA 3T1HF 4OI3A 3NBPA 4TQRA 5HROA 3D6MB 2XQCA 3NOGA 4ID8A 2BMBA 1HKAA 4FNHA 2OUGA 4KPCA 1RT7A 1SC3B 1Q5VA 2NLWA 4MK8A 2GZOA 1IVZA 2W7PA 3MEDB 2I9SA 1URRA 2YNHB 4V19J 5I4MA 5ETLA 2MY7A 2PDAA 4D3HA 4LF9J 4YR3A 4QPXA 3VAIA 4FVCA 1YJWS 2MY8A 4M5MA 2ZHBA 4JOUA 1HR0F 3H5SA 5FD1A 4ZPDA 4WXWA 2UVWA 1KQGB 2DNZA 2CQGA 2W2QP 4QWAA 1VQLS 1IBKJ 2M70A 1KR4A 3MECA 3PYEA 2LDIA 2ZC4A 3ENWA 5F0WA 4YHHJ 3UO0A 3FCVA 2F3JA 3N5FA 2G2YA 3SQOP 2HQIA 1YBAA 3FKBA 5DDQC 2KM8B 1WSVA 2DHXA 4KTQA 3E8OA 1LNQA 2DHHA 4F0MA 1U1RA 4O44B 1U6FA 2LU2A 4MAKA 3NCQA 1T0TV 4C48A 4ELVA 2EI5A 1JLAB 4WU2A 4JV2A 1XMOF 5EDWA 3M9OB 5SUHA 4RW8A 2XI2A 1O51A 5DLFA 4WU3A 1W25A 2AHOB 3ITHB 4CT9A 1FRLA 4ZVOB 4TVAB 4GVBA 5IC4B 3PFOA 4NEZA 5BYRA 2KXHA 5KG6A 3TJ8A 2CVIA 3VQTA 5HJYA 4XPEA 4F50A 4PYDA 2XY5A 1X31C 2A10A 1VLYA 2L08A 3RB6A 1SJFA 4WZQA 3CCSS 3F56A 4PQUA 3L7PA 2ZBQA 1HBMB 5B0BA 5HP1A 2V67A 5J1EA 4NCGB 1B4SA 4CLYA 2QL5B 5F8IA 4P10A 1IWGA 4FN5A 4NXNJ 2H9ZA 3ISZA 1HNZF 3GV7B 1U8WA 2HQ3A 4HL9A 4AUKA 3QNWB 1KHWA 4NLPA 1ZZNA 2ALZA 5J2NA 5IOLA 1UPMB 3EMTA 1WEYA 4WK3A 4F4KA 1FWPA 2RU9A 4NA2A 2KXFA 2BANA 1JLQB 2EK6A 1LW0B 3GB0A 5KFPA 1N0VC 2P2CB 2RH3A 4X64J 1XC9A 1MG7A 5E3CA 3NAIA 2RIJA 3SSRA 3T6JA 1RTDB 4N77A 4X65J 2DH8A 3Q83A 3AQOA 4A8KA 1DURA 1RWNB 1SKUB 2ZDOA 3GU0A 1HLWA 1ZZFA 1H73A 1RJJA 3H42A 1H3DA 1ZTTA 4RL1A 4OZNA 1HI1A 1IM4A 2IDEA 3OHAA 1RP5A 5HMYA 2ZITA 5GAEU 2FGCA 2FUG9 1N36J 3UN3A 3QFHA 3HI9A 4QW9A 2CKWA 2JFDA 2PFFB 2OFHX 2DNLA 2EC2A 2B9XA 3GJQB 3CDBA 3OTBA 5B09A 2CPHA 3CIMA 3MPWA 3QRRA 3DLKA 4KH0B 1SV5A 2GVZA 4C0OC 4IO1A 3CF5Q 5L38A 3IFEA 3I56S 2XMTA 1G6BA 1TZ0A 4ANCA 4U8VA 1WD6A 4DR6F 4LVNP 1Q16B 2A0FB 4OLOA 3M8WA 3SCLE 1P1TA 5I3PA 4QWBA 3JSMA 4B9MA 2XMJA 1N6QB 2ZH8A 3QGGA 1GEHA 2XNQA 2ZHAA 3IR5B 2E44A 2MGZA 2CQBA 1R0CB 5KT5A 3MR5A 3CT9A 1V3RA 2DNYA 3PM9A 4G6VB 5DZ7A 4JB8B 2MKYA 3Q8YA 1JLBB 2UVUA 1FHTA 1HQUB 3AB4B 2JL9A 4ZIVA 3B54A 3R8YA 4ZPCA 1H74A 1SIZA 3TX0A 2VONA 3ETMA 4ER8A 2IVYA 4LSLA 3C16B 4UUWA 3H20A 4AQYJ 4M8LA 5CD4H 2RRBA 3MUTP 3FFIB 2G9OA 1NHKL 3ZFVA 3SBMA 4B9TA 3DRPA 2CPIA 1FDDA 1HMVA 2NXCA 3HDSA 2YWWA 3OBIA 2DY9A 2HGMA 5C24B 1SC6A 1TL7A 4I1TA 2XS5A 4B9LA 4UQTA 5JVHQ 2C22A 1GMVA 3DCAA 1PJ5A 1WWHA 2R42A 2CQ3A 3N6LA 4FP9A 4KC5A 3KJFB 2OHDA 4C11A 2AD9A 2VZ9A 2HWHA 4OYZA 3GCXP 1YJUA 2KI2A 3EVWA 2M9KA 1CLFA 2P9GA 2C42A 1NPKA 3G8QA 1GH8A 2MZTA 2BKNA 3HZGA 1N5YB 3WX8A 2WHOA 3FQLA 1O0PA 4DR1F 4DS4A 1R0AA 1WC0A 3AD7C 1FKAF 3TO8A 4IOCQ 2IAJA 1FERA 4DV5J 4G1PA 3J81U 3NS6A 1NUEA 5EWFA 3KDOA 3ILJA 4S0MA 4PPDA 3MAAB 2C2DA 4DDFA 2QLBB 1DJ0A 5C42B 2YNGA 4RPFA 4QYRA 5A8RB 1X9MA 2ZBIA 4DZ6A 2XTJP 3BPDA 4NMXA 1HD0A 4U9RA 1NPRA 3JTPA 1WC6A 1RHMB 2H4WB 4UY8T 3MM8A 1HNXF 1N32J 3MR7A 1U2CA 2Z57B 2E1CA 2DXDA 2LECA 1ULRA 1CQNA 1F60B 3VWSA 5GAHI 1JJ4A 2DGSA 4OLPA 5IFMA 2D74B 3DLGB 2EKYA 5K8NA 1FI4A 5LL6d 1VGYA 5KFCA 1AUDA 1ACMB 4WKYA 1U1QA 3T5KA 2G1HA 4OYAA 2B4PA 3IC1A 3M8PA 1XMBA 4PG8A 1NK9A 1VC0A 1NXIA 1PJ6A 5KFXA 3CJKA 1FK9A 4FYXB 1UVJA 4B17A 4USIA 5B0GA 1R8CA 3HT0A 2ZBRA 3HHLC 3JS9A 1L3TA 4LBHA 2HHXA 1YITS 5FJ4A 2DXFA 4ZLNA 4TLQA 2B6AB 4CCHA 3C6TB 3A3PB 4CYUA 4IG3A 3E2EA 1GAOA 4JV0A 4ZN3A 4J90A 2YKAA 1Y5IB 2FTRA 3M32B 4EYIB 2RRAA 4ZCMA 1ELOA 1HBUB 1F6TA 2V2KA 2PA8D 2WSFC 2EG2A 1EETA 2XBPA 1NO8A 3CVKA 4GVLA 2OKQA 4NASA 3GFXA 5J1PA 4B3MJ 3CD0A 3QAUA 3OJSA 2DR8A 4K4UA 4R8UB 5KFJA 4CTAB 2FVQA 1R27B 3Q2SC 2J5AA 4LF8F 1VRTB 2XSFA 1SL1A 4ZS6A 2W8KA 1NMEB 3O6QA 3R1LA 5K8MA 5KT3A 5KFEA 1HBOB 2B9WA 1GQEA 5IM0A 5ETKA 1K0TA 3GIMA 4DV2F 2RNEA 5HVHA 3IA0A 3HO1A 4ZVRB 2YVSA 4P7VA 5JUMA 3BQ0A 3R9LA 2GVDA 2VG7B 5AE2A 3MR2A 4Q0BB 1OS5A 5KFBA 2IRUA 4GC6A 1NLKL 1UVKA 1CG2A 2HFZA 5M2UA 3TP2A 1HWIA 3OR2B 1VQ5S 2NPIA 1ZA1B 2R8KA 4DL5A 2BW2A 4USVA 4F25A 4DL3A 4JI5J 1U0HA 2DIUA 4KRWA 2QT7A 1TFYA 2YY3A 4QWCA 1RTJB 4I6YA 2RQCA 3I6PA 2HBZB 5J2PB 2GO8A 2EBEA 1B0PA 2K7KA 3DDIA 3I0RB 5D4PA 4DUZF 1YBTA 3DGPA 3NOCA 5HMWA 3GV5B 2MEWA 4USUA 1VQNS 2HVDA 4RW7B 3FEXB 4F4YA 1TAUA 2YWGA 2MKSA 3IBWA 4MK9A 1C4CA 2DPIA 2E5IA 3V6DB 2P9EA 1PYOB 1IBLF 4HKQA 1Y10A 4NL5A 1TL1A 1GXLA 3OTEA 3OL8A 4ED5A 4ICLA 2OEMA 3U1NA 3GR1A 3A1YG 3MM6B 3OPKA 4GC7A 3LO3A 3FBBA 3AXKA 4P2XA 2QA4G 5CCMA 1A6LA 2DITA 4DSEA 1NDKA 2XS7A 3Q2TC 3AJ2A 4DFMA 1AW0A 3P8BB 5ETTA 2B7CB 2D7SA 3D6TB 2B7BB 3J81Y 4NXMJ 5F0UA 4WFZA 2WVCA 3MURP 1MMDA 4M5NA 4IFVB 3EX7B 1VJWA 1UEVA 1RCOB 3V81A 4RO0A 1O6XA 2MJUA 2NR0A 3IRXB 1QE1B 4NPOA 4DR7J 3TYTA 4IQXA 2BJEA 4J91A 2YKNA 3O2IA 3TUIC 5ETSA 3M2RA 4Y2IA 3P45B 5LT5A 2KFYA 2CG8A 3P96A 1U4BA 1IKXB 4LRCA 3DC2A 1T03A 4LF5F 2QLWA 2FJBB 2PEHA 4NLRA 5C25A 3MTKA 4WK1A 2DCUB 2RHQB 5LMNF 2OH2A 3DLHA 3UPFA 2D69A 3EM1A 1RAGB 4LREA 2FZGB 1CPZA 4J9NA 4OV6A 3IS9B 1N33J 1YJRA 3C6UB 1QAXA 4ELTA 1UJ5A 5E3QA 4X66J 4ZHRB 3K5MA 2APOA 5K14A 3DNCA 2D3OR 4B3MF 4FF1A 1VHIA 1MROA 4UZCA 2CDQA 1CJKB 1NAQA 3MMBB 4F2RA 1C0UB 1R8BA 5E3PA 3UQSA 2CQDA 4Q43A 4JI3F 1A7GE 4OQJA 4F3QA 2BE2A 3GE9A 2XHCA 3CJ2A 1N5VA 1JLCB 4RJVA 4URGA 2AGOA 4ILRA 1SH0A 4JI4J 2ZD1A 1NKBA 1T7PA 3CO9A 3T6BA 3TVKA 2NSBA 4LR9A 3ILOA 2XULA 3PTWA 4KO0A 4X4OA 5K20B 4IR1A 2QE5A 3HK2A 2Y9HA 4QU6A 4LT6A 5KFHA 2JLFA 1GXTA 2RQKA 4KV8B 1E6VA 2W8LA 5DQGA 4B3RJ 1CEZA 1KLMB 2OPQB 4BCAA 1I94J 2RT3A 1UWBA 2OPPB 1DLOB 2HVZA 1F3VA 2LKZA 1Q86T 2VPZB 5ADZA 1VRQC 3M9NB 1VISA 2FB0A 4DPWA 4O3OA 1NM2A 1YZ7A 4YUDA 3OD2A 3KK1A 3G9CA 3T5JA 2HURA 1LWXA 2K3KA 3KLIA 2HGNA 2KO1A 2RKIA 2QL9B 1JK9B 2RUSA 4PG4A 1RKIA 2P6TA 2OTLS 4A8FA 1HWUA 3DHWC 5HL7Q 1XNRJ 1UWAA 1KQSR 4BS2A 1E6YB 2RF2B 3OFGA 4P75A 3VCDA 5L1LA 1EKRA 3VAMA 3OFEA 4LSNB 2C2OB 4ZPTR 3IG1A 1SC1B 3W62A 4EI2A 5IV3A 5L46A 4WWSA 4A8WA 2GA7A 3LP2A 5AJ3J 1S6UA 1TUWA 1U2RA 1Z2LA 1FKPA 1Y7PA 3N79A 3PRVA 1RKJA 1S97A 2HZVA 1TL3A 4A46A 5LJ5Y 3GONA 2ZM6F 1VHFA 5HO4A 1Q81T 4OI4A 5B08A 4B3SJ 2XY7A 3FDSA 2F1FA 4JI4F 2W4CA 2ASJA 4G65A 4C3KA 1VQKS 2QEXS 1R31A 2I2YA 1RHJB 4RW4A 4F4WA 2OEJA 2VG5B 4UTGA 3MUVP 4Z2XA 5H9EK 2MSTA 2AJQA 2OJ3A 1U0SA 4RUCA 4H54A 2JH3A 1V5VA 1VQSA 1GK8A 2CAJA 5KFFA 3TNVA 4I0WA 4A8YA 4X64F 1L3SA 5ETMA 4DR5F 1GX5A 1S0OA 2HMIB 2YNFA 2OAUA 1H7XA 1RT4A 3CD7A 1C0TB 1RWVB 2PGCA 1VQ8S 5HN0A 1H72C 2VASA 2X1GA 1L3VA 4ECSA 4EUVA 1VR6A 4LRDA 2DGWA 3PHTA 3QWUA 3W8PA 4CO3A 4ZK7M 2VPXB 1PSDA 3EGNA 4ITSA 2MKIA 3EWGA 3P3DA 2Q1LA 4N41A 3FMWA 1UEKA 2XYPB 1HNIB 3KTQA 2A2CA 3TZWA 2CWKA 2ASDA 1M5KC 2ZNYA 1REVA 1P8GA 3BEGB 1LEOA 4JYAF 1O8BA 2C3PA 5T41A 1NSPA 2DO4A 4NX9A 3K2YA 4P74A 5F8GA 5L1KA 2KG1A 1WKJA 5F9NA 2EFNA 5IC6B 5GMEA 2YWHA 4Y2AA 2UUAJ 3DM2A 1F5BA 2KT3A 3MZIA 4RZRA 3HVTB 4CZCA 3VGUA 5BJRA 5HLFA 1SVDA 2UU9F 3KMSA 3EGVA 4YB1P 3MD3A 3EE3A 2PSZA 1VOMA 4WIIA 3DI6B 3OTOJ 5HBMB 3B8HA 2J9DE 1WNEA 3CDWA 1FRKA 2M7SA 4CLTA 1S6QA 1IQZA 3I9ZA 4EYHB 1S1WB 1VQYA 4LF2A 3GLJA 1RHRB 3MEGB 4NRUA 2MMYA 1KOHA 3QO9A 3S7RA 1S1VA 1VRUB 2AKWB 3L4BC 1RT5A 1O5JA 2OD6A 2QV6A 3SFGA 1HBNB 4QYZK 4QWDA 3OSNA 2WB1D 4NLGA 5KT7A 5HVFA 1KQKA 2LMIA 3H98A 1Q8IA 1X4CA 1OY9A 2B8PA 4K0KF 2GJ2A 4FF4A 2OPRB 4FPIA 2FJWA 4A8XA 1ZS6A 2OMOA 2Q6CA 4HR2A 3TA2A 1WDDA 2AJ1A 2AW0A 4WP9A 1RTIA 2LEAA 3TAPA 3CD6S 2R8GA 2JFKA 3QIPB 1A9NB 5DQHA 1YJNS 5DO2A 2DYAA 4ALZA 3V6JA 2SXLA 3BYRA 3I0SB 1ZAXA 2KVQE 2MLYA 2G0CA 2QZ8A 2J8AA 3B6BA 4DV0J 1IKYB 1BHNA 1FCAA 1UZHA 2YH0A 4WFYA 2Z2LA 1SKRA 2C3OA 4FYWB 1IR2A 3SXLA 2KRRA 4JI6J 1RU1A 4LQ9A 2HRTA 2V6AA 2CYYA 2XYHB 4UW2A 2FD2A 2QMXA 4OZLA 2KG0A 1NHVA 4BC7A 3VAKA 3I5CA 1W26A 2F40A 2Y3YA 1HWKA 4MTPA 4YHHF 1HNVA 5HANA 3QZ8A 2VFRA 4JI6F 2YH1A 3GJTB 2GIQA 4DR3F 1VQMS 3IGVA 2WVDA 2HHQA 5DM6Q 1U6ZA 3UDCA 3BBCA 5JMNA 2RMLA 1S57A 2LFVA 2VG6B 2B8QA 2DGVA 3L7OA 3M2VB 4NWBA 3JYTB 1JXVA 1NSAA 4ED1A 2NYHA 1T8EA 1H6KX 2XI3A 3DLJA 3PYFA 2KYXA 3LAKA 2O5DA 4XK8C 1FT8A 1JXLA 3Q8UA 2UXBF 4HACB 4NLXA 1NDCA 4I4BA 2CPXA 3RBXA 4WFNQ 1KC8T 2CZ4A 5AXMA 1JLEB 5KT4A 1SUQA 5ETOA 3ZTRA 4EMDA 2DNMA 4RU2A 4U7CA 1TFWA 3CGIA 5DRKA 2DEIA 3UR0A 1VC5A 3TJAA 2D3O1 4DV0F 4B9VA 2ZVIA 1MWYA 5D77A 3NEKA 4I2QA 5G0RB 1OYDA 3V2UC 5DGBA 3OV7A 2W9BA 1KQFB 2FVSA 4K5RA 5KOXA 1TKTA 1NSQA 2B5JA 5I3QA 3PX4A 1TKZB 1EP4B 5B0EA 1FE4A 3D66A 2IM3A 2IJNA 4Y65A 2RD5C 1OO0B 1KWMA 3WQPA 6FD1A 4XIUA 3PXGa 4ZLLA 3G6XA 3IP0A 4JV5F 1JLFB 4KKOB 1XR6A 1SL2A 3MR6A 1AZSB 1KD1T 3BSCA 1RTHA 5ETQA 4LFBF 1LWCA 3PIOQ 3DOMA 1S9EB 3D5MA 3HZEA 4RBTA 3BS9A 4DEZA 5KG2A 3EPIA 2VQEF 3RBEA 2ZH5A 2Q6BA 3D67A 2HHHF 2LVWA 1TELA 3OLAA 5H9FJ 4LF7F 3UVJA 3NY0A 2Q66A 4RNNA 1NKCA 3NGDA 4KY3A 2JOQA 3RAXA 1RLDA 2GIRA 3DOKB 1RHKB 2ZJPQ 2OIHA 2GGPA 5F41A 2BW7A 2FGOA 3HT3A 2JEIA 4OX8A 2AYEA 3RW7A 2VQEJ 2DB1A 3VALA 2EC0A 2GMHA 2IC3A 3UCGA 4DR1J 2V8PA 2KHDA 3QBCA 1HI0P 1UETA 1SB6A 3H5UA 4P2SA 1YI2S 4DQPA 3DFEA 3KYLA 4J9UE 4M94A 3MEKA 5E3RA 4PXDA 3C15B 1CS4B 4CO1A 4F7VA 1RACB 2VHGA 1EIYB 1D9FA 4LF4F 4OZJA 3CJSA 4DWIA 1GXUA 2BKPA 2C2KB 4UF4A 2DO0A 3RYLA 3NGKA 4DV6F 3C46A 3JTNA 3ZC4A 1NH8A 1HFEL 1WC3A 4DUTA 2KB2A 3ITHA 1R8AA 2UXCJ 2Z2MA 5HI7A 4ZJOA 2IMWP 2C3YA 4V19X 3S1TA 2OP5A 2YKMB 4KHMA 5HJXA 2FYXA 1YTYA 3DMJB 3PRBA 2CIMA 2XCPA 4FVMA 3CCUS 1FRIA 1D8ZA 2LEPA 3BF4A 4JI3J 3AOAA 2HAFA 2Q79A 1TL5A 2ILYA 2MQ8A 2VBXA 4USJC 5HATA 2VOOA 3MOZA 1YKWA 2HZAA 3SFUA 3V4IA 2KT2A 4KGMA 4K8RA 3OLBA 4L6V3 2VBYA 2YKQA 3EVOA 1RT3B 2N3LA 4Y34A 1P1LA 1WSRA 1VDHA 1Y5LB 2AEJA 4ES2A 2M4MA 3Q22A 5KFAA 4JI0F 1LW0A 2A3JA 4NLSA 1EX8A 5GADI 5CD4A 3BO3A 1S4EA 4XPCA 2FY1A 1Z1ZA 2DXEA 2C3UA 3PRDA 3F41A 5HMZA 4O3RA 2MXYA 4QYZJ 4X4NA 4FXVA 2R2RA 5A6PA 1UL3A 2RS8A 4USWA 3HVRA 3Q8QB 1FFWB 5D0RA 1Q53A 3R7BB 1LXJA 3FBCA 4FYVB 2R2SA 2QJ3A 3QATA 1QSLA 4DPXA 1RT2B 2Q43A 3DOLA 2HVIA 4DR3J 2R7XA 5KFVA 5KG7A 2DIVA 2M3DA 3CJ0A 5DQIA 2Z8QA 3AY0A 3EDRB 1PO6A 1XNRF 4KHPJ 4ID5B 4O4RA 2E5LJ 5D0EA 4PWDA 2HS4A 1RSCA 3DLKB 1N54B 1OSDA 1WELA 1Y5NB 2NQPA 4FPRA 4IG0B 7AT1B 3GP9A 3PVXA 1FRXA 3CCES 2MKKA 3T1AA 4KH1B 2KM8C 3R97A 3ZXWA 2YPZA 1S5ZA 4LR8A 3U1MA 4A8QA 4QWEA 2R2UA 4K0KJ 2IA6A 1SJ1A 2V34A 1CQMA 2V2QA 2WOMA 5D4LA 3KNAA 1HW9A 4IH7A 1FTCA 4BDPA 3L09A 3IR6B 1CJTA 4TU7A 5E3AA 1QDUB 3M6XA 3NCPA 2GAGC 5DETA 4ETZA 1NJIT 8ATCB 1Z4UA 4ZOSA 4OJ3A 2N7YA 2J7KA 2XB2D 3N6NA 4JI8F 1QAYA 1GMWD 2AMCB 1KP6A 3I31A 2IYIA 1HYSA 1G4CA 2FHJD 2ZBCA 3UE2A 1BMQB 2L41A 1RT6A 2I0XA 4ED8A 1N4LA 4PZVA 3LPYA 2NXUA 2OPSA 3MPDA 3RBZA 3SDEA 2DHSA 1MN7A 2DD8S 3BH6B 1B3TA 2YKOA 2M0GB 1X4GA 4DV3J 2WZ1A 1HMVB 1RZMA 2JEGA 4H4KA 3CC2S 2ATCB 1N8RT 1JNRB 3TAMB 4DG1B 3RAQA 1UVMA 3P6YC 2DCLA 2W9CA 2AEFA 2VC0A 4OMFG 2WSEC 3C14A 1NDPA 1S10A 1LWEB 1SH2A 3DRSA 3DXSX 3LALA 4OI1A 2DR9A 2V4JA 2HNDA 3ADAC 4ZCLA 5HK4A 6FDRA 1BQMB 1OJ4A 4MJKA 2X1AA 3UN5A 2N4DA 1WF2A 4DLGA 3UNGC 4DL7A 4OZ0A 3KK3B 2M88A 2KH9A 3OVBA 2WVBA 4OFZA 4U6PA 2FVRA 1ITPA 2W2MP 1Q82T 1RHQB 1S0MA 1T9XA 2FY8A 2HFNA 1IR0A 2ZZTA 1JNZB 5J2MB 1IBCB 2F65A 4J9RA 1UA0A 2V50A 4ZPBA 1H2TZ 4C8ZA 2MB0B 2UUBJ 2I38A 1BE4A 2FZKB 3LWMA 4X4RA 2HRUA 3JQJA 2COLA 4PR6A 2CJBA 4MKAA 2KXNB 3FCHA 1HL6A 1KFDA 3FGVA 3M6UA 4HEA9 4ZJQA 2IBOA 2HRYA 1UP1A 3BKUA 4JI2F 2AZ1A 1FJ7A 3W2VB 5KG3A 3GSDA 2VDIA 4HHUA 3C66A 5KFTA 3NRBA 3IO1A 1DTTA 3CIZA 4NA3A 4ZKAA 5IS2A 5IQ6A 3U7JA 4CDIA 3KLFB 1M1KT 4OYMA 1VYAA 4Q8FA 3GILA 3NNAA 2DNOA 2J0XA 1WG4A 3FBFA 4M5KA 3DRRA 4C98A 4NZ7A 1REGX 3IBFB 3M6WA 1Q8LA 4C0HA 4CLKA 2GQ2A 1F0XA 3CMQA 3R27A 2XM3A 2R8IA 3OW2R 3QWPA 2JLEA 4X4UA 2VL1A 4Q7AA 4O3NA 1VQPS 2ERRA 3KOAA 2BQRA 5I3UA 5EN1A 1AB8A 4WJBA 3K58A 2YNHA 3FEYB 2E5JA 1R6YA 3C2PA 1RAJA 4PCQA 1EB0A 3LA0A 3VGTA 2YTCA 4OHYA 4Y2CA 3MOJB 4X4SA 1P9YA 2PMWA 2AYBA 1HPZA 1T05A 3OVAA 2XG8A 3H0PA 7FDRA 5KFQA 3AHPA 1GTHA 4TU8A 4J9QA 5DLGA 2RU3A 1UEUA 2H48B 4HH1A 1KVIA 3X3UA 3I4PA 3VAHA 2ZBPA 2B3TB 1RYRA 2R7QA 3QSIA 2AX0A 2EVZA 1T94A 2R7VA 2EEYA 4M63A 2UUBF 4B9SA 2W25A 5KG0A 5A8KB 4ZIWA 5LSRA 1JKHB 4DX6A 1IKWA 1LWFA 3GIIA 3ET6A 2D3UA 4NLWA 5HQLA 3IBCB 1VC6A 1F9HA 5ETRA 2NPFA 5HSPA 2ACMA 3DLEB 3I82A 4K7QA 5CABA 4I6WA 1FF2A 1FO1A 3KG0A 4RW8B 4RW9B 1RAFB 4MKVA 1TTHB 3OXLA 2WONA 1TKXA 4Q44A 2XMKA 5KFIA 1YJ9S 4ES3A 1NZ8A 2UUTA 3CDEA 1UA1A 1DBDA 3BN4A 2QYGA 1IKVA 2AV5A 2XLJA 1RAIB 5HP1B 4FNIA 2CG4A 2RHSB 1ROFA 1I5OB 5HQMA 1VJQA 5KG1A 1SQFA 4CT8A 1YGYA 3CC4S 1TV6B 4OYIA 2E29A 4OYWA 2NCKL 5IV4A 2DH9A 2VPYB 3KJVA 3V6HA 4EZ9A 1HD1A 4C7QA 1T3OA 2QMUB 3QT8A 4RUBA 2D3ZA 4KBIA 5BYQA 9RUBA 2RAQA 3KLGA 4DPUA 2HHUA 4FS1A 2BANB 2BJDA 3UN2A 3R5AA 4CI0B 5A2QU 1N32F 1Z2ZA 3BGUA 5D6GA 3KHHA 1YBUA 3A8JA 5LMNJ 3I5BA 4ZVEA 1RTDA 2IY5B 2XHWA 3CSKA 1AUSL 2DISA 1D1UA 2NYIA 2V9KA 2CQ2A 4M5DB 1U48A 1X5SA 3TA0A 3EVMA 1N5SA 1X9WA 1DRZA 2C2MB 3NGTA 4EEYA 5KFDA 1N48A 3ETOA 3NS5A 4ICLB 1FJCA 2YNIA 1Q7YT 4DR7F 1TMMA 2QC3A 4Y0FA 1N34F 3TRGA 3EXYA 3ZTSA 3EGWB 4CLSA 4QU7A 2NSCA 2UUCF 3NLCA 3KLHB 4RKUC 5CYQA 3M8YA 1XIQA 3RRHA 4WF9Q 4HI1A 4DS5A 2HNZB 3LP0B 2ZE2B 2CNNB 3GQCA 1Y4ZB 1IJEB 2GVZB 5GAEI 3M2UB 2Y1JA 3RZAA 1NHUA 2EFVA 3RBDA 1PAEX 3FC9A 3N6MA 2PFDA 2Y8WA 4AE5A 1JLGB 2CA9A 4DV7F 1G2EA 5IT9Y 2WW4A 2LYVA 2CZVC 1IKXA 1OQ3A 3MCSA 4HDHA 3Q24A 4J9MA 1G3OA 1PCAA 1N6QA 2XO7A 3TX8A 3SQGB 2PA3A 3TAQA 3SV3A 3PDNA 3IM8A 4YY3F 4ED0A 1HR0J 4AL5A 2RILA 4EBEA 3DXBA 2V0NA 3BPSP 5I42B 3HSZA 1D9DA 1VMBA 2LXUA 3MEEA 1RT7B 4LRBA 4ILLA 3M8QA 3CJQA 3D4JA 5T7LA 4NOHA 1EARA 1HWLA 2QMWA 4UUXA 1K73T 4IRCA 4ZA1A 4ZP9A 2E1MC 4Q2MA 3QIDA 1BLUA 2OSQA 3MMAB 4EO6A 1C1BA 1YWXA 3GYNA 4G3IA 4I2PB 1X4DA 2PO4A 1MROB 4NA1A 4TY8B 5CAAA 3FSIA 3RR7A 3B4MA 5HAOA 4O0IA 1UFLA 4NLOA 3DRYA 3T1HJ 3DU5A 2H5IB 1RLCL 1KS2A 3ZZOA 4E2FB 3GIKA 4C8KA 1NK7A 2KN4A 2XCAA 2PE8A 3AXMA 3Q0AA 4LF4J 3R6LB 1V5IB 3D2WA 4HYKA 1YQHA 1KKHA 1S1UB 1YDLA 2YX4A 3QLHA 4PAAA 5KFGA 4DCPB 1KTVA 1NH7A 4LQ3A 2VFTA 1P27B 1JXEA 1S6PB 1WHXA 1C2PA 3GPAA 4DL6A 3D0GE 1DARA 5D8HB 5E5NA 3G2XA 1L3UA 2YPYA 1WDTA 3D3BJ 2CJKA 4IRDA 1JWWA 2BEFA 2HFSA 3IXQA 4KV8A 2W7AA 4KSEB 4MH8A 3MXHP 2YWKA 3MD1A 4Y28C 3VR1A 4IFYB 4GO7X 1VQ6S 3OL9A 1UWBB 1JLAA 2J7UA 3B4DA 3PO4A 2J0SD 2DNRA 3OXFA 2GO9A 2HFOA 2G0IA 3D3CJ 2NS1B 4ZN1A 3CCQS 2ZKUA 5DDOC 4A8SA 1TK0A 1ZH5A 4PQAA 4L75A 4DN0A 1TL4A 2FJVA 2XEXA 3KLEA 5IWAF 3LGMA 2RKIB 3H2LA 2UVRA 1PYSB 4PUOA 4QQBA 4DQQA 4OX7A 3OR1B 3QJPA 1HIYA 2CFXA 3KJNB 2I6WA 3V4MA 4ANDA 2W9AA 5J1EB 1WC1A 3R2CJ 1U1LA 2R3VA 5AXKA 2FLLA 5A0YB 2HHHJ 4DV1J 1IJFB 5D3GA 3R7SB 1S48A 1XR5A 2EBGA 2IRXA 4O0NA 2FZCB 1RWMB 3K8VA 4QZVB 5C2CA 3Q23A 4DUYJ 4KJIA 2BX6A 2HNYB 4ZLJA 4MYTA 1OWXA 1JLQA 1UFWA 1VQ9S 2DVIA 4C9DA 1HQEB 3KXDA 3G71S 1ZAVA 1U1KA 3Q86A 5FIIA 1J27A 4AT1B 2IVFB 4JUZA 1GT8A 2HIYA 4LR7A 2XWYA 4Y2KA 2W7OA 2JVRA 2HK2A 3MM9A 2QLJB 4Y00A 2V4QA 4C2MA 4DUYF 1UW9A 3VGSA 2E9TA 4FS2A 2FPHX 2HLTA 2MQPA 4I7FA 2ZC3A 2U2FA 3AA9A 1MNEA 2UV8G 5F8HA 5DJBA 5KFWA 1QAIA 3AOCA 2ZH6A 4IG3B 2EG1A 4MK7A 5KFMA 1CJVB 3LANA 2OFGX 5FDLB 4I67A 3E01A 1C0TA 2PC6A 3POTB 2HQGA 2NXEA 4J9SA 1Y11A 1TVRA 2IJRA 3GR0A 3KWMA 3TA1A 3BM7A 4MKBA 3VVUA 2GX8A 1RABB 2Z0GA 5HMXA 1WTBA 2WAQD 2MQQA 1VBYA 1SV5B 1RAEB 2ILZA 3HFKA 4PG5A 4ECXA 1KFSA 4B3OB 1S9GB 3CCRS 4K59A 4O23A 3IGNA 2YX7A 3MWBA 3ZZPA 1QLNA 4A47A 5GAGI 4G1QB 4YEAA 2P6SA 1N88A 3TJ9A 1BQNA 1UVNA 3BR9A 3R5GA 3RAMA 3W9HA 3JSMB 2V8GA 4KPYA 3W2WB 4OHWA 4H4OB 1WF1A 3WDOA 5RUBA 3G6YA 2CPYA 2EFGA 1EZZB 2GVDB 2MGZB 3HSGA 3I55S 2GS8A 2Y0BB 3MTJA 4ED6A 2OD4A 1FXLA 2G4BA 1B99A 3J80Y 4FXDA 1JLBA 2VBWA 1S49A 4F4AA 1NBEB 4TQSA 5D0GA 3BKTA 3BQ1A 2KTQA 5IT9U 2VD3A 5CCLA 5H1SV 3EJMA 4U95A 2XLIA 2C2ZB 3MI7X 4KE5A 5GAHU 1U0HB 4FF2A 4WE1B 3OL7A 2K1RA 2W4DA 5J2PA 1EQ0A
chains in the Genus database with same CATH topology
4TXSA 3H40A 5IQQA 3M1VA 2XSJA 1S6QB 4IQMA 1RWUA 2JEFA 2E5GA 2J6TA 5DS7A 1HBNA 2DT9A 3NBPB 2MQNA 5HROB 1Q78A 2CPZA 4TNOA 1ZM4A 1WI8A 3V6DA 4CNZA 2WTFA 2KZZA 3CEDA 3GV8B 3RRGA 3DYAB 4C3LA 2POKA 2OPRA 1JJ2R 2Y0SD 3J7YI 2JEJA 1K1SA 2I8EA 4EBDA 1U45A 2OLWA 4PKDB 3ENQA 1SJQA 1R8PA 4ECQA 2BACA 3NWGA 3LW5C 3I0SA 4O3PA 1KLNA 1QSSA 4ZP8A 2DTJA 4ECWA 4IFVA 4F67A 2E1AA 2FLOA 3ENVA 4C97A 2PN6A 4IOBA 4YB7A 2DNGA 3MM7A 2PI5A 4RWXA 1WTFA 2M52A 3LOUA 3FVYA 5A8RA 3BO2A 5CYMB 2IM1A 4RNMA 4DF4A 3CMES 1XR7A 1J5OA 3M2RB 2O66A 1T03B 4ELUA 1H98A 2OTJS 2BXJA 1FA0A 3MR3A 2M5YA 5C25B 5EX3A 3K59A 4NYPA 2E9RX 1XEZA 1PILA 1IUJA 5GMKa 1S6OA 4FZVA 4OJGA 2UVVA 4PXBA 5B7WA 2I1RA 3HKZD 2V5HG 2ZJQQ 3QAEA 2R7UA 2AYGA 3K7RA 2IA0A 2IYGA 2MHNA 4ZMMA 3OVSA 4KFBB 1BD6A 2LU1A 3CXCR 3DHXA 5K14B 3BREA 3THPA 1LV5A 4RW6B 1U25A 3FZ2A 4C8LA 4OV1A 4HHJA 2DGXA 2IJFA 2K8GA 4GKJF 1PC4A 4OI0A 1H0HB 3GZ7A 2RSQA 2PMHA 1RI7A 5BR8F 3HLUA 3OUYB 4NLQA 5J2NB 3SSQA 4NXNF 1TKTB 2PD1A 2DPJA 2LXIA 2NUHA 4O4GA 4H4MB 2GHWA 3MM5B 4MMOA 2FIUA 2VA3A 1K9MT 4O44A 1BGXT 2QIFA 5LSLA 1RTHB 3MHYA 3G8SA 4IO9Q 2IFXA 2Q3PA 1S9EA 2J9CA 4IRKA 3HHLB 2J6SA 1WHVA 2CRLA 2HG4A 1IBKF 2BRLA 4O3QA 4IDKA 1NK6A 1P6TA 1V6HA 3PIPQ 5KFSA 5KFZA 1WHWA 1C1CB 3MMCA 1ZM3A 4GO5X 1XTZA 3VF0B 4YQWA 1HNWF 2F8MA 3CDUA 3MMJA 4HI2A 4USHA 2IC3B 3LWLA 2EPIA 3IG1B 2DHGA 1N5TA 2AGPA 2CQCA 2F9DA 2GMLA 1KHVA 3JSYA 3OL6A 2MQMA 5ITHA 1TK8A 2QLXA 4H4KC 4E8UA 4MKYA 4RW7A 4NCAA 2A2DA 4DQSA 5FLXY 1KSPA 2BM0A 4DFKA 3OFHA 2F8EX 5JJBA 4DV1F 4F3MA 2FVCA 4DQIA 3VAFA 3HJFA 1FD8A 2LCWA 3I4HX 1MU2A 4LSLB 2HMIA 3H8YA 2BZ2A 3OJUA 3IR7B 2MJNA 4XDDA 3CJ3A 1VQ4S 3I87A 4R5PB 1OPIA 4KQZA 2C2RA 1LW2A 3H5YA 1SXLA 2LQJA 3DRPB 2EWHA 1S1XA 3OTDA 5DM7Q 4PPZA 2ASLA 1NJYA 3G8TA 1XNQF 2ZDPA 3VZHA 4TN2A 5A8WA 2VOPA 1X4FA 2ZOFA 3D1QA 3BGLA 3F44A 4HTJA 1Y9OA 5F9LA 2J9DA 1REVB 3OXGA 2XC9A 1F9FA 3F73A 3SI8A 2VKZG 4YP3A 2FJEB 2MHEA 1SJ3P 2LDYA 1N0UA 2L9WA 2X51A 5J2QA 2KU7A 3I32A 3DM2B 1S1TB 2IAJB 3KLVA 3DOLB 3K8WA 1M5SA 1T3NA 3HVTA 4Y6IA 1NZAA 2L9NA 4I56A 3W7BA 4RU9A 3B78A 4C8YA 2MZRA 2VV5A 3HHNB 1NRKA 4QIWD 1I1GA 3I9V9 4WFAQ 3FFIA 2ROEA 4E98A 2GNKA 2I5JB 4QBUA 3PEJA 1FJGF 3QO9B 2KJWA 4B02A 1CC8A 4EGLA 1RT5B 3PKYA 1X5PA 4WXOA 2KHCA 2OMLA 2HVHA 3MGJA 1FEHA 1FJEB 2NREA 2R8JA 3MUMP 3HVAA 3DLGA 4C11B 4MFBB 4Q2LA 4DSFA 3MEDA 3D0IE 2FHMA 1FKOA 4HTIA 1ZPVA 4KAIA 4WYWA 1KLMA 2HAIA 2OPQA 2DGUA 5A2QY 1N5YA 3PW0A 1RA7A 3SMZA 4B3SF 2OPPA 1HYSB 2N7CA 1D0EA 3L95X 4ZVGA 4F4XA 4B08A 3H2VE 1Q79A 5GADU 2ZH1A 3UD4P 4K4SA 1Q1KA 3LP1A 2L9DA 2IMOA 2E7XA 5KFOA 3DDKA 3EUNA 4DHVA 1OPZA 2UZAA 5AJ3F 1S76D 2E5LF 2OO4A 2DNPA 1HBUA 1S4FA 3O8WA 1YRTA 3MECB 1W2IA 1QUVA 4KR0B 5CHCB 5DG9A 2WSCC 2UV8A 1DZ5A 4JV1A 2LQ5A 4CTAA 3DRSB 1J5EF 3JB9k 2DJWA 1TR0A 2HNDB 2U1AA 2Y1RI 2ZH2A 1XN9A 1W2BR 3KK2A 4OL8A 1T02A 2MQLA 2HHSA 1YSJA 2VUGA 5KFLA 3EYZA 1KN6A 3EZ5A 4KHRA 5IM0B 2B51A 3ISNC 5E33A 3HMJG 2ZOGA 4KB7A 3UI3A 3PX0A 3OHBA 2JDJA 1RISA 4WKRA 1N52B 2VG7A 2HHPA 3M8PB 4X4TA 4A8OA 2O3DA 1DTQA 1SUQB 4OHVA 3WZ0A 4DBQA 2VG5A 1FRJA 1RA6A 1TK5A 3GG1A 1VBZA 4CO5A 3Q8SB 1G1XA 3HPOA 2B6AA 2DGQA 2QFJA 2B4UA 1DQ8A 2J76E 3K5LA 5DDPC 4BHQA 1U1OA 4PRFA 1R89A 2W9BB 2FHKA 3BGRA 3DDNA 2XMMA 2HHWA 2AJ4A 2E5HA 3ICLA 5DG7A 1EP4A 3J7A1 1UMJA 2EK1A 3FRZA 2BABA 4NLYA 3T19A 5I3UB 4TY9A 4X66F 5E7OB 2C28A 1FTRA 4YFUA 1QY7A 3ZZ0A 3CPWR 1AFIA 1G7CB 1S99A 2MQOA 4FXWA 2CPJA 1L3VA 2KYZA 4FF3A 1UW4A 2QSWA 3PW5A 3VAGA 1HPZB 2HZCA 1DAXA 4ECTA 1ZBTA 4ILMA 4CH0S 2MKHA 3PHEA 1TKDA 1FE0A 2GGPB 2LQ9A 2RVJA 2VB6A 4F02A 7FD1A 2O67A 4J37A 3DLLQ 2ZH3A 1RTJA 2YWFA 3DI6A 4CO2A 1RDRA 1HHSA 1XMQF 4P7TA 3RB0A 4OX9F 2ZZMA 3MEGA 4JI5F 4OJ1A 1H38A 1SKSA 4B3RF 5F8LA 2XNRA 1UVLA 4X65F 3DN9A 4X4VA 4YMEA 4K4WA 4RW9A 2EW9A 4ZCKA 2P5VA 1TKXB 3CJ4A 4WTYA 1APSA 4RBVA 1FRHA 3C6UA 3QMQA 5KT2A 4QPTA 4B3TF 4Q5VA 3QIPA 3CE8A 2XGQA 3I5AA 2GW8A 3KJVB 1C0UA 1NNDA 5KTQA 3ISND 4BWJA 4K50A 3KLGB 4ES1A 5U47A 4AQYF 1RT3A 4DSIA 1KNZA 2GJIA 4BC9A 3KHGA 3HKWA 5KFRA 1NK4A 3QJJA 2R4FA 1FDNA 1T95A 4OI6A 3K0JA 2HW3A 3D54A 4AYBD 3K5NA 3E3XA 3KHLA 1FXRA 4XAKA 2KFZA 4NZ6A 3CCZA 3HHLD 5EWGA 4ECUA 2RDIA 3PR4A 1JMTA 3GYXB 1WI6A 3BZQA 3CWJA 3ZZRA 5T14A 1LQ9A 3HVWA 4DN9A 2K7JA 1UAWA 2MZJA 3KLHA 3GMGA 4ZPVR 4CQ1A 1TP7A 2ZJRQ 4ID5A 4ZHRA 3T9NA 4BBYA 4IUFA 3LUYA 5C42A 2J0QD 4ZLPA 3EGZA 4B9NA 3MMBA 4IG0A 1YRUA 4ZCIA 4RNOA 3M8RA 3LQVA 2HLUA 4N47A 4NCBA 4LSNA 2BE2B 1K1QA 2NUUG 4QR1A 4EWTA 1SH3A 3THVA 1FVSA 4DMZA 3UR3C 2QYCA 4TKTA 5DG8A 2M8DB 1K8AT 3OTCA 4OIXA 5IXUA 1D8YA 3US5A 2J6UA 3H4BA 1L5UA 4KO0B 4QJVA 1WACA 2ZKTA 2XY6A 4N56A 2KRBA 4R25A 4EZ6A 2BVZA 4KKOA 2RB7A 4FBUA 3RB4A 3FJ2A 2JVOA 2JHEA 3CJKB 2FHOB 1LOUA 4LJMA 3QYYA 1FDBA 5CXTA 1YRXA 5HQ8A 4F4ZA 4W92B 3C6TA 3CUNA 3VZIA 2BA9A 1CVJA 3KLIB 4NLUA 4J9LA 3PX6A 1Q4RA 3M32A 1X7VA 4DL0C 5J2MA 3JAMY 3A8EA 1FXDA 2R7SA 4MIAA 1WG5A 3GFYA 1ZYQA 2BV3A 2R8HA 1E6YA 1VFJA 2RF2A 4NLVA 3R3TA 4ECYA 2CPFA 2DK2A 2V4JB 3MPVA 1BQMA 3E51A 1ZETA 5IZHA 1SKWA 1S79A 3OSPA 1FNMA 5L1IA 1S7HA 1HBOA 4P6QA 1RYSA 4DLEA 2IBKA 1KONA 2GHPA 2M2BA 3JSBA 3M30B 4QR2A 4OHZA 4ZDNA 4CNYA 3UD3P 1B64A 4DFJA 2B9YA 2BUNA 2WBRA 2R2TA 1RT1A 3UCUP 3UW1A 4Q0BA 3NKYA 2CQHA 3RB3A 2X3GA 3FNNA 3Q8RB 3SV4A 3SCIE 4ATNA 3N4WA 5LXYA 4A4JA 2JC0A 4UY85 3RU0A 1NK5A 2W24A 3R5BA 1JJHA 1MW7A 1WEXA 3KG4A 1Y0HA 1DHMA 2YNFB 1FESA 5HBMA 2R7RA 3MAHA 1RT4B 4O3SA 3DU6A 2AWZA 2V94A 2WCXA 4M1KA 1SIWB 1YG0A 5A0YA 2J7WA 3SYZA 2VFUA 2FJXA 4I6AA 3DRRB 1Y3KA 4CIOA 3QZ7A 2HWIA 1M5PC 3CC7S 2RS2A 4EBCA 3VAJA 3GIJA 1U7LA 4OI2A 1BC6A 2FDNA 2PMZD 4U7UK 2DBBA 5CA5A 1TL1B 2CPDA 3HHDA 5L1JA 4EFAC 4F3OA 2F7VA 4DFPA 4KHPF 3MM6A 1FNOA 3CCMS 4ZP6A 4C8NA 2FC9A 3VQSA 3LGNA 4MIBA 3TUZC 4N5SA 3SZ2A 1UVIA 3N28A 4TYBA 3N01A 5L9XA 3WC2A 1V3ZA 2JLGA 2DNKA 1Q8BA 1H2UX 2QA1A 3NAHA 3NL0A 4LFAF 1HI8A 2HPUA 3M05A 2J9EA 1P9QC 1S9GA 2UUAF 4XDCA 5F3ZA 5F8JA 2V8HA 2G1DA 2XWXA 3MM8B 4DL2A 2LLZA 3O44A 2R7TA 1YJTA 1WHYA 1VIOA 2XMUA 4TLRA 3V5RA 2DNHA 3NCRA 2A1BA 3V6KA 1U1MA 4A8MP 2KVIA 3PY8A 2ZUGA 3IS9A 2MKJA 4DOZA 3H4DA 1XK8A 1QTMA 4FBTA 1RTIB 2RQ4A 4RBUA 1FK9B 3WX4A 3T5HA 1FDAA 4MYUA 3KHRA 4WE1A 4N8NA 4NLTA 1YJVA 2Z4PA 5D4OA 4C3MA 2B4OA 3M8SA 3SDEB 4HH0A 3M1VB 2XSJB 4Y3CA 5G0RA 3RRKA 3T5LA 3KMQA 4L72B 1V3SA 4G1IA 5A6WA 1N5QA 1EETB 4W90B 5C5JA 2ZD1B 2B5JB 2DR7A 1B0TA 2LXFA 2E7WA 2MDAA 4YDXA 2O01C 4AFFA 2OSRA 1VRTA 3MF5A 3L3CA 4ED3A 4X2BA 2N3OA 4I69A 5EWEA 3FRYA 2ACYA 3BGFA 3IWXA 4DSLA 3M9MB 2GQCA 4URQU 3KK3A 2GC8A 3BO4A 1DLOA 1WF0A 2V9WA 5AE3A 3M2VA 4WCEQ 2AJFE 2GQQA 2FC8A 2L48A 1J2VA 2GFFA 2Y1IA 1ZM2A 3H25A 4F8RA 2HNZA 3LP0A 4J9KA 4PQUB 3DOKA 1X5OA 3C8YA 2EFQA 2IVMA 1HBMA 2AP6A 2DGOA 3D28A 3OR2A 4IH6A 5B0FA 5THWA 2DRAA 2ZVSA 3W2VA 4NCGA 2UP1A 1JLGA 3KLFA 3LP2B 2F8HA 3FEZA 3FZBA 5LJ3Y 2QO3A 3NP5A 1FKPB 2VFSA 4Z37A 3X1LB 1ZM9A 4ZVHA 4IOAQ 3QGPA 5KOWA 5I42A 2ZZNA 2QA2A 3SEOA 3M8QB 4NYOA 4FYDA 4C4WA 4KFBA 4DL4A 3MMAA 4UQGA 3CCVS 2JZ5A 2K2PA 4CH7A 3R1HA 1HA1A 1X4EA 4HLBA 3D0HE 2E1RA 4OZ1A 3G6VA 3WC0A 1X0PA 2AU0A 2BQUA 1F2GA 5K8PA 5IT0A 2UXCF 4OJHA 2MYFA 4QIGA 4KIAA 5F8MA 1XBWA 2MZSA 3V4IB 3OUYA 2VPWB 3UCZP 2KJVA