5K9FA

Crystal structure of a nipsnap domain protein from burkholderia xenovorans
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
MLVEQRTYWLKPGSVSTFLSLYEAEGLAIQAGALGRLLGYYFSETGDLNRVIQLWGFDSFEDRTRRKAILSGNPQWKSFVGRAGSMIERQSTELLTPAPFSPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NIPSNAP domain protein
publication title Crystal structure of a NIPSNAP domain protein from Burkholderia xenovorans
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Structural genomics, unknown function
total genus 33
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07978 NIPSNAP NIPSNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k9fA00
2FTRA 1FVQA 1GXTA 4Q2MA 3BR8A 1W2IA 2HFOA 1S6UA 2QYCA 4OJ3A 1URRA 3HX9A 2FB0A 3FMBA 1FE4A 2LXFA 2Q3PA 5B0EA 1P6TA 2XMMA 3BN7A 3E8OA 3QGPA 2GGPB 3I9ZA 1SI9A 1OQ6A 4ZOSA 1K0VA 2ACYA 2K7JA 2XMWA 2OD6A 3KNGA 1CC8A 3KKFA 3HHLB 1N5SA 2QLXA 2GFFA 2L3MA 3MCSA 4Q2LA 5F0WA 2ZDPA 3K7RA 2XMJA 2ASYA 5B0GA 5B0AA 1Y3KA 4DPOA 1AW0A 2KT2A 1AFJA 1YJVA 2XMVA 1KVJA 3TRGA 1YJTA 2W4CA 2EW9A 3KG0A 5IXUA 2OD4A 2IFXA 3LO3A 3VTIA 3HHLD 1TL5A 3GZ7A 1OQ3A 2HLTA 2PD1A 4OIXA 4NL5A 2QIFA 4A46A 4HI1A 2N7YA 1KQKA 2K1RA 1Q8LA 1SB6A 2CRLA 1Y3JA 3BGUA 5B09A 3MZIA 1WD6A 1X7VA 4HL9A 1V3ZA 2OMOA 4HH0A 1TR0A 2RU9A 1JK9B 2RMLA 1P8GA 2HIQA 4ZA1A 2QLWA 1TUVA 2JDJA 2LDIA 3CJKB 1YRXA 2OFHX 1ULRA 4QOTA 1YJUA 4F67A 1QUPA 3QMQA 4HI2A 4A48A 1XBWA 2BBEA 2ZDOA 2FIUA 1Y9OA 3BF4A 2N4CA 2ROPA 2IYIA 1RJJA 1X8DA 1MWYA 1Q4RA 2HQIA 2ROGA 5B0FA 3UDCA 2FHMA 1X0PA 1Y0HA 2LQBA 3DXSX 2BYCA 3HHLC 2AP6A 1FD8A 4OJ1A 1IUJA 4YEAA 4DL0C 2AW0A 1R6YA 1Q53A 2GA7A 4DN9A 2GGPA 2BJDA 1Q8BA 2OKQA 3FRYA 1TZ0A 4OJGA 2IYGA 4A4JA 5B0CA 3HDSA 5F0UA 5A6PA 2K2PA 2G9OA 5T7LB 3HHLA 2XMUA 1VQYA 2N4DA 2GCFA 3HF5A 2KKHA 5A6WA 3IWLA 5B0BA 1YG0A 1FESA 1CC7A 1FEEA 1KVIA 2LQ9A 1N5QA 1S6OA 3LGMA 2GV1A 4Y2MA 2PGCA 2KYZA 2BUNA 2OFGX 4EFAC 1FVSA 2K7KA 3TOQA 3HFKA 2RILA 2VH7A 4FNHA 4FNIA 2KT3A 1VQSA 2OP5A 1JWWA 2XMKA 1FE0A 3FGVA 2K1RB 1SQEA 3F44A 5K9FA 2OAUA 3IWXA 3DCAA 4HH1A 1CPZA 1LQ9A 1N5VA 4NPOA 1APSA 1AFIA 1YJRA 2BJEA 2ROEA 5B0DA 5KAKA 3BB5A 2W4PA 2W4DA 1GXUA 2HLUA 2RSQA 3BM7A 1N5TA 4OJHA 3LGNA 4U9RA 4Y2KA 4YDXA 5T7LA 3CJKA 3T9NA 2AJ0A 1TL4A 2HFNA 2AJ1A 1MWZA 2VV5A 2XMTA 1OPZA 3TNVA 1OSDA 3BDEA 4Y2IA 5B08A 4A47A 1U7LA 3WDOA 2GO8A 3KG1A
chains in the Genus database with same CATH superfamily
3M8ZA 2XS7A 3NXZA 1HQEA 3OJSA 2Y0SD 3BGLA 4CM0A 4W4MA 3D4JA 2CJ9A 4J9KA 1F1BB 3KOAA 2VF3A 3AQPA 1BWEA 2VC1A 3PEHA 1ZZFA 1SBRA 3FBEA 3AJ2A 1SQFA 2L41A 4WFXA 3GYGA 4DV3F 4ER8A 3KUGA 4CRJA 4J37A 4TQRA 4MFBB 4CTAA 1FWPA 1RT7A 1U1QA 3Q23A 1FRJA 4TYBA 2HGNA 2BEFA 2K2PA 1QTMA 2J7WA 3D9BA 3KK3A 2YWHA 3W66A 4UQTA 4RR5A 5M2RA 3HFKA 5I3QA 2KT3A 2MJNA 1VQSA 2CQ4A 4O4RA 1NCLA 3IBFB 4AFFA 1HL6A 3DLKA 2GMJA 2GO8A 1BQNB 2VODA 1N33J 5DO2A 2XZWA 2PI5A 1KOHA 5ETKA 3L95X 9RUBA 3D66A 3HPOA 1VQ8S 4UQGA 3OUYA 1NEEA 3EDQB 5ETOA 2XZDB 3TA0A 3PFOA 3HHLD 1WKJA 1DAXA 2M8HA 4IRCA 2IJNA 1JMTA 4Y28C 2G13A 4JP8A 1I5OB 3U27A 2ZM6F 3C14A 1R8CA 4JOUA 2F65A 3FVYA 2XGPA 4DR2J 2FHJA 2QT7A 4TYAA 2OLWA 2JC1A 2UUWA 1XN9A 2DYAA 3P96A 1FJEB 2RDDA 1M1KT 4CLKA 1VQYA 5D4LA 4F26A 2HHUA 2F9DA 2XYPB 3PW0A 1KBRA 3HSGA 1DFDA 4PABA 2E7VA 4EK2A 2HLUA 3JTOA 5DGBA 4ECZA 2CVEA 3CCJS 1F9EB 3TUPA 1JKHA 1Z2ZA 4QIWD 4YR2A 4PG5A 2MHEA 3I9ZA 2JRSA 1BUXA 3BQ0A 3W5ZA 2W9AA 5T7LA 5KFWA 4HR2A 1RHQB 3VVTA 3U1NA 2FPHX 3E51A 1U0SA 4A8QA 4P2SA 2QV6A 1R3NA 4EUVA 2WW8A 4YR0A 1UL3A 5KT4A 1X7VA 1VQOS 4CLSA 3EVOA 2XYHB 1T02A 2BRKA 1IJEB 2VQFJ 4IFVA 4MK9A 2NUUG 5A2QU 4LR8A 2R7RA 3IGNA 3GFYA 1UFWA 3VQSA 3A12A 5M2PA 3LA0A 2XMUA 1LW0B 4Q45A 4TLRA 2LFVA 4TU7A 1SKWA 2MZQA 3JSRA 4F4YA 2KG0A 5FLXU 4JUZA 1U1OA 1U6BA 3CD7A 4MFBA 1UVIA 2AHOB 3NOGA 1B0PA 3ET6B 4RUHA 2ZH1A 2K3IA 3HP6A 1K1SA 3L7OA 3IS9B 1H7XA 3KKFA 4FF3A 4NLRA 2KXNB 5F0WA 3THPA 1YIJS 2EFNA 2ALYB 3FBBA 5HP1B 3EWGA 1NDCA 2VBZA 4LRFA 3DDIA 5DQGA 1EB0A 2CQIA 4AYBD 3QFHA 3UNYA 2QLWA 3IXQA 1NK0A 2F8MA 2BJ7A 4HTIA 5CYJA 4W90B 2VB6A 1WSRA 3JQJA 3S7RA 4KHPF 3OXGA 4F7VA 1BQNA 3CGIA 4LSLB 1GTHA 3QO9B 4IQXA 5E3PA 1Q8IA 1VBZA 4ED3A 3N79A 1X4DA 4YN3B 3EDRB 2BJ8A 1JLQB 3QT7A 1HNXF 1NK7A 2KRRA 2ZITA 4C3LA 1T05B 3CMQA 5GAEI 2RIJA 1J5EJ 5KG3A 1M1GA 2PMZD 1FE0A 4TLQA 2XMAA 5FDLB 1RBOB 1S5ZA 2B43A 3C2PA 4ZMMA 4IH7A 4OV1A 4I1TA 2QL9B 5HK4A 2XMTA 3THVA 2NYIA 4LF9J 4C8ZA 2C3UA 4OL8A 3G71S 5DDRC 5CD4A 3PRBA 4U8VA 2GIQA 3SSRA 3B82A 4R5PB 4DPWA 1F2GA 4HHJA 2R9LA 5DS7A 1RBLA 2OO4A 1JLGB 2VG7B 1HBUB 2R7SA 5HJYA 2FJWA 4MJKA 4ZA1A 4FBTA 4ZLPA 3KLEB 3WZ0A 4K4WA 1JLAB 2I6WA 1N0UA 1LOUA 2DK2A 3V6JA 1S1TB 1KHVA 2E1RA 5L1LA 1A6LA 3WX8A 1ZAVA 3W2VB 1FXDA 5K8NA 1YGYA 1LXJA 1SPBP 2ZH3A 1IQTA 3OHAA 2OP5A 3IAS9 5KFBA 1S57A 2ZBIA 2D3UA 1HWJA 3QSIA 4QZVB 4L75A 1WOPA 3BBFA 2PSZA 1KD1T 4LREA 4OJHA 3I0SB 1I94J 2P2CB 2KG1A 2HBZB 3HHDA 2DHGA 4YR3A 4L73A 3QBCA 3P5BP 3WC2A 2CG4A 2ZJPQ 2CYYA 3PKYA 4USWA 1RYRA 1LW0A 2XM3A 4ZIWA 3OXLA 1TVRB 1UMJA 2NPFA 4F4KA 4B9TA 2JJ4D 3BGRB 5LSRA 3T3FA 2X3DA 4M5LA 3NS6A 1Y3JA 2IA0A 5LJ3Y 1VRUB 2ACMA 4FN5A 1JNRB 1NU4A 3N0VA 2B7BB 3BKUA 5IWAJ 3LP0B 2HKEA 2A10A 2ZHBA 5KFSA 4QWBA 2FY8A 3ET6A 4ZP9A 3IS9A 4NE9C 5B0BA 1KVIA 1XR7A 4NRTA 2JLFA 4DR2F 2MLZA 3CC7S 2ZZNA 1SJ1A 5HP1A 1KQFB 2DISA 9ATCB 2GZOA 1VLYA 3A8KA 2Y3YA 5L9XA 2XZTB 1FKOB 4KPYA 3HXMA 2UVVA 2MZRA 2KHDA 4LSLA 4OJ3A 5BYQA 2Q3PA 3QO9A 1SIZA 4P9SA 1NJYA 2ZBRA 3MI7X 1L5UA 4I6YA 5HMYA 3NAIA 3DGVA 3GJRB 1IR1A 4OHVA 2UVRA 2XMJA 2IVMA 4CLTA 1J2VA 1T05A 3UDEA 1V5IB 1FA0A 1VQLS 1AROP 1NDLA 1HPZB 5FDLA 4CO5A 2V4QA 4D3HA 3NCRA 4LFAJ 1T8EA 5FD1A 1S59A 2YX7A 4DLEA 2DEIA 5EUHA 1OY8A 4UT4A 2Y8WA 3CSKA 3O1LA 4WFAQ 1D0EA 4DDFA 2AYMA 4P52A 5ETPA 4R5PA 4NCBA 2PN6A 5LM7E 3LWLA 3UR3C 3H0PA 4ZCMA 1DY3A 2XI2A 1JLGA 2VG7A 1HBUA 5ETLA 2HHWA 4RPFA 4K59A 4CT8A 3BB5A 4NI2B 3KLEA 1Y10A 2VV5A 1N4LA 2CNNB 1CULB 1G3OA 2HAFA 1FEHA 3QNWB 3FBFA 3GPAA 3BR8A 4DV0J 4UY8T 2XNRA 3C15B 1S1TA 1RBAA 2XTJP 3T41A 4JV5F 1AUSL 3TAQA 4CT9A 1UAWA 2ZBCA 2KVQE 1U47A 3DRRB 1W26A 3W2VA 2SXLA 4EZ6A 1RHKB 1KOOA 1JQGA 5C5JA 2JEJA 1NHUA 3DU5A 4DCPB 1SCJB 3OHBA 3JQMA 5KTQA 3RYLA 3E01B 3ZZ0A 3NEKA 2DXDA 1BE4A 3I0SA 2HQGA 3UDCA 2E1PA 3D6MB 4UUWA 3K5MA 1PJ6A 2A2CA 4AD6A 1RWNB 4C11B 2HW3A 1QE1B 2BZ2A 3I5AA 3V6HA 4A4JA 3PYEA 4ECYA 1R31A 4RJVA 1R43A 1RUSA 3OL8A 3VR1A 2DNPA 1TVRA 2ZH2A 4YUDA 2QEXS 2AZ3A 3BGRA 2H5IB 1IBCB 4DR7F 2ZZMA 2Y1LB 3QSYB 1AUDA 2XCPA 1VRUA 1J5EF 3I56S 1Y5LB 1UVLA 3HT3A 3LP0A 4OYWA 2KFZA 2QA4S 2CJAA 3J80Y 3LUYA 1URRA 5KT3A 3GSIA 4QIVA 2CQBA 4BDPA 3OJUA 1U1NA 3O44A 1FXRA 1SV5B 2H5EA 1X9MA 4JI7F 1RAFB 4ECXA 1DQ8A 3I9V9 3BDPA 1NLKL 2WSEC 3DRYA 2ADBA 3O3LA 4NXNJ 1KQKA 2VC0A 3BO2A 2XCAA 1VBKA 3PIPQ 4ELVA 2RAQA 2V63A 1FKOA 3MUTP 3BBCA 2AWZA 2LQBA 3HHLC 1N88A 1BXNA 4X64J 2H65B 3RBEA 2NPIA 1QY7A 3MEEB 4Q43A 4K2JA 5A6WA 3MTKA 3TR5A 4A8OA 4RKUC 3MPVA 1HPZA 2HSEB 3QFWA 1FKAF 2DNQA 3AA9A 5HROB 4PXBA 4I2PB 2UXCJ 3R6LB 3D6TB 1FJGJ 1M5SA 4ITSA 1GT8A 4IFYB 4G1IA 2C2MB 1U1LA 4RLEA 4ZPTR 2GGPB 3HSJA 4NX9A 3W1YC 3QYYA 1I94F 2K8GA 3ISZA 1CJTB 3H5SA 3W64A 4JI4J 4F0KA 1T9VA 4C8NA 2R8HA 1PAUB 2ZEJA 4LR7A 4FS2A 4QWEA 4NI2A 3BPDA 4IOBA 4NMXA 2AJQA 1CULA 3EGVA 1YJ9S 1RABB 4ED5A 3C15A 1F5AA 3HHKA 1N36J 2B9EA 2YX4A 2DRBA 1CEZA 1ZS6A 1TKZB 1RAGB 5LL6d 2KI2A 3DRRA 4Y2MA 3FDSA 1YDLA 2UU9F 4OX7A 3M8RA 3QJPA 4C0OC 4ZVGA 2XBPA 3E01A 3TAMB 1U4BA 3UR0A 2CZ9A 4B3TF 1MWZA 2Z2ZA 2YQ1A 4QIFA 4FP9A 2HFOA 3RGIA 3EGNA 2O67A 2QRRA 1KNZA 5KG4A 3A3OB 4X4PA 2WB1D 1SI9A 4C11A 1QE1A 2OD6A 3LP1B 1HWKA 2FQQB 3OQ2A 2J76E 1DBDA 1S97A 2G4BA 2DH7A 5HMXA 1TL5A 4CLPA 4EWTA 3EXYA 2VONA 4U8YA 3HI9A 3JSMB 5IS2A 2QL5B 4DL5A 3K5OA 4USIA 2DNGA 1PC4A 1WI8A 1MWYA 3RJMB 1ZZNA 3HHEA 4OX6A 2WVFA 1LK7A 2KO1A 3N6NA 1F3FA 4RBVA 3SCJE 4CLWA 4J9SA 1SV5A 3UDLA 1OYEA 3HF5A 5D78A 3VVUA 1IBMF 3KLIB 4NYZA 2BE7D 2VG6B 1U2CA 3UQSA 2EKNA 3NS5A 3KXDA 4WIQA 2MKKA 2GIFA 2W4DA 2GHVC 1YRUA 2FHKA 2DIUA 2YKPA 1ACMB 4LVOP 3E3XA 4QU7A 3CXCR 1T3OA 2QFIA 2MZ1A 3MEEA 2EC0A 4WU2A 2R8IA 4P71A 2M2BA 2WZ1A 4CQ1A 4X66F 1FNMA 1ZAXA 3TVYA 4Y6IA 2XMVA 2D7SA 4RNNA 4LMZA 2HHPA 1VDHA 1IM6A 1REVB 3M30B 2ZBPA 5HROA 4I2PA 5CQGA 1Y9OA 2J6TA 4ZPWR 3DRXA 5KFLA 5CH7B 4IFYA 2HS0A 1REGX 4ED0A 2GGPA 4J90A 3M8WA 4M5DB 2M8DB 2CQ2A 3R7SB 1CJTA 4RWWA 2VPZB 2Z0GA 3VGSA 1X5SA 4HACB 2RILA 5DM6Q 1RT6B 4HH1A 1R8PA 2IC3B 1IJFB 4Y65A 2BJEA 2J0WA 4EI2A 1WG5A 1ZM3A 2AMCB 4F4XA 1HBMB 2H4WB 4KO0B 3BGOP 4OX8A 4NLUA 4U7CA 3LPYA 3PX4A 3FMBA 2HVEA 3I4PA 2IY5B 2ACYA 2BR0A 3PKMA 1XK8A 4EYIB 2Z2YB 1TKZA 1S9GB 4XK8C 3CMAS 2IBKA 2V4RA 2J7KA 1OQ3A 1WHXA 4M5GA 4QCLA 5AJ3J 1LWEB 2CIMA 2WRMA 2W2PP 1KWMA 1U6ZA 4KGMA 1T03B 3TAMA 3BO4A 2HFSA 4NXNF 4KTQA 1NMEB 4C8OA 4DZ6A 1Q7YT 5MAOA 3LP1A 4C4WA 2N3OA 1N5QA 4F2RA 4X64F 3G86A 2ZUGA 3TO8A 1NH7A 5BYSA 3RW6A 4NMLA 1JXEA 4NPOA 3JSMA 1T95A 4OI3A 4E98A 3VZIA 3NWGA 1J5OB 2A0FB 3L7UA 4UF4A 3TQ1A 1VJWA 2XLKA 1OQ6A 4ZLJA 1NSPA 3EVWA 3KLIA 1XMBA 4RUCA 2VG6A 2YNIB 4TN2A 3AXKA 3HHNB 2J9DA 4PPZA 3X1LB 2DHHA 2RDIA 4XDDA 2EFGA 3OT9A 4DG1B 2J5AA 2WTFA 3PW5A 1XMOF 4JI4F 1C4CA 2KFNA 3EZUA 3R3TA 3CJRA 4FXDA 1Q8BA 4ANEA 4OI1A 5HVGA 3IG1B 1DTQB 3JSYA 1RYSA 4BCAA 4GKKJ 3RR8A 1ELOA 3IWNC 3J80U 2BKNA 2OEMA 1SJ4P 1WORA 4ID8A 4RW4B 2QN6B 1S9EB 4JI6J 3CCMS 1REVA 3M30A 4F8RA 1BGXT 2A3JA 4M5KA 3SXLA 2L9WA 5F8NA 4NA3A 3WX4A 3QGPA 1XWLA 3ENWA 4M5DA 3RR7A 8ATCB 2Z2LA 2VFSA 4L74A 4HACA 2QLFB 2CPZA 3R9LA 2IRYA 3VQTA 3MZIA 1RT6A 2IC3A 4DXLA 4KH1B 2DNKA 1ZA2B 4R25A 4HI2A 2LA4A 1WACA 1HBMA 2MHNA 4KO0A 2ROPA 1R0CB 2VQEJ 1HI0P 1ICEB 3Q8YA 3NLCA 1UA0A 3RBXA 3D7SB 3T1AA 1S9GA 4LF4J 2V34A 1FEEA 2VG5B 2UV8G 2A6OA 1SKUB 1EETB 1WC5A 1LWEA 4PCQA 2HNYB 2C2ZB 2B6AB 2R7TA 1T03A 2VKZG 2W25A 3ZNJ1 5F8HA 3WDOA 4M5JA 1L3SA 2UVWA 3FEYB 1VIXA 2E1CA 3S1TA 4RL1A 3CO0P 4URSA 2ASLA 2XMWA 2D41A 4ELUA 1U45A 2DR5A 3D0IE 2FVRA 2FZCB 5IXUA 3V6KA 2GO9A 2XNQA 2B0GA 3MFIA 1LK5A 4ILRA 4Q8EA 3CCUS 4D3GA 3R27A 3GIMA 4I7FB 3FSYA 1SJQA 2XC9A 3EZ5A 2B8PA 2ROGA 2OI2A 3MAQA 5GMEA 2XSJB 1Y0HA 2BMBA 1J5OA 2HHXA 4FF2A 4DL2A 2WSFC 4OYIA 2FGOA 5GADI 4DV2J 1ZTTA 4CO4A 4ETZA 4LFBF 1YJNS 1LWXA 3S01A 3UVJB 3RTVA 4PG7A 3I4HX 2K7KA 2BV3A 4DS5A 2YNIA 5KFIA 1NZ8A 1CPZA 4OHWA 1NZAA 1WG1A 4JV1A 4DSEA 5HL7Q 4DG1A 2IJRA 3NS7B 3DYAB 4MKBA 3PIOQ 2G0JA 4I0WA 3HZGA 2V8PA 1VBXA 1YZ7A 5F8JA 3EICA 3I5BA 1S99A 3IG1A 4WP8A 1DTQA 1RLDA 1U8WA 3BN4A 2HZVA 1M5VC 4RW4A 3WHIA 1S9EA 4B3OB 5KFFA 1YSJA 2AX0A 5KG2A 2FD2A 4ZVEA 2EKYA 5EHHA 4UOCA 4YEAA 3ZZZA 2H5JB 1JJ4A 1Q53A 1YX2A 2DHXA 1BQMB 2X1FA 2UXBJ 4ZPAA 2ZC4A 4WFNQ 1RAEB 2CQHA 2KZMA 2K1RB 2Z8QA 2D1CA 4DUYJ 3M8YA 2IDEA 3M6VA 5F8LA 3OPKA 3R6GB 2CJBA 4J9UE 4DR4J 4URGA 1Q95G 3OVBA 4UOHA 4Q8FA 4K4XA 3NY0A 3UWTA 4HT7A 3ZTQA 1F5CA 4FDFA 2VJVA 2X51A 4MKYA 4DR6F 3GLJA 4JV0A 5J1EB 4W92B 4Q2LA 5B0AA 3O8WA 4DPOA 5C2GA 1ZTWA 4B3RF 2VG5A 1IR0A 1XIQA 4X4OA 2W01A 4NL5A 3Q22A 1EETA 4HDGA 4ECTA 2HNYA 3BSNA 2W9BB 1NRKA 2B6AA 2IYIA 4HLBA 3CJ0A 1NJWA 1R8BA 2PA8D 4ZVRB 4OJ1A 1QSSA 4DX5A 3CDUA 4YB7A 1VIOA 2BJDA 1W7WA 4ZN3A 3BV8A 3WQPA 2OEKA 3Q8RB 1NKBA 1KQSR 2V9KA 5AXMA 5LXYA 3GIIA 4NLSA 1U24A 1EP4B 1HIYA 3T5KA 2KU7A 2R2SA 4XPEA 4I7FA 5DRKA 5JVHQ 1VK3A 3BJYA 4J9NA 3LF0A 2XSJA 3MCOA 5KG6A 2UUCJ 3C16B 4DF4A 4ZN1A 3AOAA 1VISA 3TVKA 3HSDA 3UVJA 2O3DA 4KE5A 5JVGQ 1TK5A 4X84A 4YB6A 2BQ3A 1GMVA 4DZDA 1JNZB 1Y00A 4ANDA 4S0MA 3UD4P 3M1VB 1UVMA 4MAKA 1M5PC 3K58A 2FVSA 5DDQC 4ECSA 5IV3A 4OYZA 3DYAA 3CWJA 3CCLS 1P27B 2E5LF 2IRXA 2E7XA 4DU8A 5C25B 1FXLA 4QWAA 4NRUA 5D77A 1NSKL 4PXEA 1SL2A 2KM8C 1PSDA 5F8GA 4H4MB 1TV6B 4PG4A 1KONA 5E5NA 4B3OA 2KFYA 2XO6A 3DNCA 3PZPA 2FLNA 2EBGA 4YB5A 2VA2A 3FBCA 2AYEA 4Y2IA 2GC8A 1RGVA 2JZ5A 3W62A 1E6VB 3TJAA 2DEJA 1AT1B 1VJQA 3E8OA 4CCHA 2LYVA 1YJ7A 1S48A 2DHSA 3HHLB 4CLZA 1AW0A 4ED6A 1BQMA 1YJVA 2R8KA 1VQ6S 3JYTB 2RE1A 2K1RA 2Y1IA 4ID5B 1X4GA 3MAHA 3NGTA 3M9NB 4TY8B 1X8DA 2BXJA 2JEFA 5F3TA 2FVQA 1P1LA 4JI2J 3QLHB 3MR5A 1NKCA 5J1EA 4BC9A 3OLBA 1WWHA 5K8OA 2N3LA 2Q6CA 4LSNB 1GNKA 4P73A 1E6YB 3MM7B 1MWQA 1F5BA 2LQ5A 4WPAA 2Q6BA 4XTTA 2GHWA 2UV8A 1N5VA 4G1PA 3TEGA 3Q8QB 1WUUA 2W9BA 1RKIA 1IKXB 1RACB 4PRFA 3FMWA 3CJQA 5D0EA 1RE1B 1VC5A 2B9WA 4F36A 2Y8YA 1G2EA 3G2XA 3TW0A 2M7SA 2RT3A 2I38A 1SC1B 3A4TA 2KN4A 4DPXA 4IKAA 2FC8A 1RT4B 3K7RA 2RU3A 1N32J 1MROB 5B0GA 1MW7A 3G8QA 5J2NB 4Z7YA 1QAJA 4Y3CA 3EGZA 1XNRJ 2K3KA 2NCKL 5GAGU 4PXCA 4J9MA 2XWXA 3T6BA 1HWLA 2EEYA 1L3VA 4GKJJ 4N5SA 3GV7B 1U48A 5KG5A 2GQ2A 3WBZA 1HWUA 2V69A 3AOCA 2OPRB 3C16A 5LMNJ 4DBQA 2OEJA 5HATA 3BSOA 3CCWA 3MURP 4JI1J 2IYGA 2NXJA 3IBWA 1YG0A 3PXGa 5KG0A 2LQ9A 2PEHA 3L7PA 2PGCA 2OH2A 3H2UB 1XJWB 1SQEA 4K5SA 5K9FA 4CNYA 3M1VA 2DR8A 1NHVA 2IVFB 4DJBA 3CEDA 1S76D 1U7LA 2ILZA 3CPWR 2FVCA 3PR4A 1C4AA 4LRBA 1NBEB 2FB0A 5F8IA 5C25A 2V8DA 5KT6A 2K06A 4P75A 2DGQA 1ZH5A 2MKHA 1GTEA 2A1BA 2JLEA 3NOCA 1UWBB 1S0NA 4H4MA 3NNAA 1TV6A 1SJFA 2OSQA 1NSQA 4IH6A 1EQ0A 1OMSA 1B3TA 2I8EA 4F04B 5AE3A 2LKZA 1S7HA 5KOWA 4MKVA 4LF7J 3DLLQ 5KFXA 4M1KA 1HLWA 3MD3A 4KQZA 1YITS 1E6VA 3WIUA 4LR9A 4PYAA 1G6BA 3JTNA 4USTA 3IAM9 1DQAA 3HHLA 2M4MA 4IYQA 2F8HA 2VA3A 1X31C 2C42A 4B9MA 2UZAA 4JI5J 5BYRA 2J6UA 1CLFA 1S9FA 3JYTA 2VBWA 4CH7A 2XS2A 2V8GA 4CH1A 4QW8A 4ID5A 4Q5VA 1TL3B 4PKDB 4TY8A 1RCOB 2NUHA 3QLHA 3QZ7A 4LF1A 3GR0A 1FTCA 4OLPA 5L1IA 4KH0B 4AXIA 4O0IA 4LSNA 4NZ6A 1RU2A 2PA3A 1E6YA 3MM7A 1TKXB 4UTGA 5ETTA 1PC5A 1EIYB 2FZGB 1P8GA 1T0TV 1IKXA 4ATNA 2GVDB 1UCNA 5D8HB 2YKNB 2J0QD 2M52A 4DL0C 1ZOTA 2L9DA 4DN9A 2LMIA 1RADB 4LFCF 1RT4A 2N4DA 3MMCB 4FPRA 2CWKA 1MROA 5J2NA 3NKYA 4DPTA 2Q43A 3I0RB 4YFUA 2DB1A 1YJWS 1SH2A 4YMEA 4LIWA 3W8PA 5KFKA 4WKYA 1DZ5A 2MMYA 2HQCA 1O0PA 2RVJA 3AAWB 1L3TA 2Q1LA 3P8BB 2OPRA 2E9TA 2V8VA 5D4NA 2R7XA 2JL9A 4A8YA 2JWNA 4LBPA 1NK5A 2J7UA 3UPFA 2DNNA 1Y7PA 4WE1B 3P5TL 2LU1A 2Y0BB 1XMQJ 2Z57B 3VCDA 3R5GA 4UZCA 1R89A 2ZH5A 3I31A 1Y5IB 2LDIA 1S0MA 2WOMB 4EO6A 1WTFA 5E2QA 1I3OB 2NXUA 2UUBJ 3P3DA 2XHWA 4O3RA 2BE2B 1S4FA 4ES2A 1S77D 2ZH7A 3LOUA 3M2RB 5A6PA 3KUEA 1S7IA 4ICLB 2HVHA 3ZZRA 2EPIA 1UWBA 1B4SA 3W60A 1FDDA 5J2PB 3NMRA 3CDWA 2MXYA 2I5JB 3N9UC 3CCRS 2A2DA 2NXEA 1N5TA 5AXKA 4MIWA 2ZH6A 3MAAB 4BBYA 3W2WB 4OZ5A 3PHTA 3UCZP 3CJSA 1F0XA 1RISA 3OR2B 4NEZA 1WEXA 3TZWA 1EHWA 3VTIA 2HBQB 3ONQA 4I4BA 1N34J 5GVQA 3POTB 1D09B 5DM7Q 4HL9A 2HVDA 4X62F 2W2OP 1T11A 3F73A 3D6HB 2CJQA 2E1MC 4K4YA 3F0NA 1PO6A 2GJ2A 5A8KB 1OY9A 4BHQA 1VR6A 3MEKA 2HIYA 3D0GE 2FVPA 3ZZTA 1HR0J 2PFDA 1FD2A 3NRBA 4QR1A 4P72A 2ATLA 3PV8A 1TKXA 4JI1F 5CD4H 4YOEA 2PFFB 1NJZA 2V5HG 2EWHA 4DFPA 2IVYA 4C48A 3J7ZT 1Y4ZB 3G6YA 1U1PA 2GVDA 4EO8A 4AT1B 1S6UA 1K9MT 2YKNA 1FE4A 4DV5F 4USHA 4H4KC 3AH6A 5T41A 2B3TB 2MSSA 3MMCA 3R1HA 4MKAA 2OD4A 4DV1J 2CNLB 4Y34A 2GJFA 3I0RA 3CJ3A 3CCQS 2XLIA 5DG8A 1PG5B 1OY6A 2Z58B 2XY6A 2B8QA 4KAIA 1T9TA 4DOZA 3KTQA 1HNZF 4LRCA 4URQU 3D68A 4DQIA 4AQYJ 2YQ3A 3QRPA 3JQKA 1RWXB 2MB0B 1MNEA 1RZMA 1FO1A 4TKTA 5K8PA 3T5LA 1H2TZ 2QA4G 5FJ4A 3AA8A 3DLHA 4WE1A 2AEFA 4KJIA 3PO4A 1LQ9A 2F5GA 4YY3F 4NXMF 2JLGA 2E44A 3TX0A 4QU6A 2E5JA 4B3SJ 3VALA 4NA1A 2WOMA 2F4VF 3G9CA 4JI5F 2H1YA 3EYZA 1GXTA 4K4ZA 3DLBA 3C6TB 5KFYA 1WEYA 2ASJA 1A9NB 2BE2A 3SCIE 4A8WA 1Z2LA 3QIDA 1CC8A 5DGAA 3M2RA 2WVDA 1HNIB 4CLFA 4ICLA 2A18A 1CS4B 4KC5A 1HNVB 3OTOJ 2E9ZA 4M5HA 4YDDB 5E0OA 3ZZPA 5J2PA 5LSLA 1SKSA 2I5JA 3DGPB 3OV7A 2HK3A 4WWSA 1VBYA 2HHVA 5I42B 4DPUA 1RTDB 4RU9A 3MAAA 4HYKA 2UUAJ 5IOLA 2AP6A 3W2WA 2AW0A 3MECB 1NDPA 5D3GB 2RUGA 5CZVA 4F2SA 2XULA 4UW2A 2CJXB 4GVBB 3KUHA 3OR2A 3AD9C 5EWEA 4ALZA 3VAIA 2KHCA 2ZJQQ 3POTA 5KT7A 4ELTA 2W4PA 2YNHB 2HQ3A 4OZ3A 4BS2A 2DT9A 5LMUF 1F9HA 4WYLA 2CQCA 1ZPVA 4NLDA 3TRGA 2DRAA 3RAXA 2M3DA 1PAEX 2R42A 1V6HA 1X4CA 3FCHA 3CD6S 3SYZA 3V5RA 4FPIA 1XR5A 4E0DA 3QMQA 4NZ7A 2PEBA 4USUA 3FZ2A 2XS5A 2DO0A 3AB4B 3CTRA 2HYIB 2BOPA 3UCUP 4K4SA 4OJGA 4OZ1A 2VPYB 1S1XB 3VGUA 1WOOA 1RAAB 3MCNA 1IWAA 1YKWA 2HVIA 4L3NA 3GQCA 1K44A 2MPUA 4KFBB 2ZUAA 2V94A 1EX8A 2W7AA 1HBNB 3I55S 1RHMB 2DGOA 2YWGA 1QSLA 4X65F 4DSFA 2HHHF 5KOXA 1R7IA 5ITHA 1QAYA 3OVAA 2GMHA 3KWMA 4F3QA 3JS9A 2XMMA 5JUMA 1D9AA 3D1QA 3K5LA 4DV7F 1UA1A 4RNOA 2P9CA 1RB0A 3AOBA 3HT0A 3PCOB 1R27B 4I56A 2MDAA 4F3OA 5DQHA 1ITPA 1JK9B 1UFKA 1ULRA 3NBPB 1YJUA 3K89A 3U7JA 1NHKL 3T1HJ 4GRSA 2MKYA 2Q79A 2CPJA 4DCJB 3TX8A 4DV6J 3C6TA 3T1YF 3NP5A 4JI3F 3LPEA 2C2KB 5HO4A 2CPHA 4V19J 2R7UA 1HNIA 2Y9HA 3JTPA 1CS4A 4RBUA 1HNVA 3TWZA 5EGYA 4FNIA 2UXDF 3DGPA 2OPPB 2POKA 1WF1A 1N52B 3G8SA 5B0DA 4WFZA 2RSQA 2XY5A 2U1AA 1H2VZ 5I42A 2MY8A 4XIUA 1NUEA 3GYNA 3KG1A 1RTDA 4P7TA 1NK8A 2GVZB 3MECA 5D3GA 4HDHA 3OL9A 2K7JA 3G6VA 1HNWJ 2G2OA 2QZ8A 3DOKB 1O6XA 4GVBA 2H51B 8AT1B 3BS9A 2C22A 5MLCV 4DU7A 4DUZF 1D3WA 2OJ3A 2MGZB 3CDBA 1X4AA 1VQ9S 2KM8B 1NPPA 4Y2AA 4LT6A 5IQ6A 1OWXA 2W1BA 4IUFA 5SZTA 4JI8J 4K0KJ 4DV1F 5RUBA 1LW2B 4OX9J 1RJJA 1FK9B 2YNHA 2AJ2A 3CW2C 1RWPB 4C8KA 1ZA1B 1MSWD 1Q7LB 3PO5A 2G1HA 4P10A 4HVZA 3M8PB 3MEGB 3QT6A 3IR6B 1LNQA 2QC3A 1LWFB 3RUBL 4LF5J 3ELHA 3BH6B 2QA2A 4AQYF 1IN0A 3Q86A 1DHMA 4KYZA 4ILLA 3GYXB 3U1MA 4NLVA 3DHXA 1YHQS 5C24B 3VZHA 2W7PA 5L1JA 4OMFG 3S8SA 2P8IA 3M32B 2DY9A 1X9SA 2HNDB 1UW9A 2HWHA 3DDKA 4QWCA 2HBRB 3ENQA 2PO4A 3HFZB 4DQSA 4NYOA 2I9SA 1RHUB 3A3PB 2DGUA 3Q8UA 1S1XA 3IN5A 2C3MA 4ZDNA 2GQCA 5K5MA 2XO7A 4NLQA 5DDOC 4YHHJ 1RT2B 3FK4A 1D1UA 2O01C 3PY8A 4KFBA 4ENOA 2F63A 4YB1P 1S1VB 1HBNA 1Q4RA 3R5BA 5KFCA 2JX2A 1Z4UA 5DG9A 1BQXA 3BZQA 4ZS6A 3EMTA 3TQEA 3R5DA 2LVWA 3P4UB 5EN1A 2ZFHA 5F8MA 2VH7A 1TU0B 3DM2B 3I5CA 2BJ3A 2R4FA 5ETRA 4DUTA 4CZCA 2ROEA 3NBPA 1WG4A 4DV4J 1WC0A 1N48A 4EGLA 1VQKS 1VYAA 5THWA 2NYHA 4I6WA 2ZWPA 5HQ8A 1U1RA 1IBKJ 3RBZA 3HKZD 1X60A 3LGHA 2QGFB 1SVDA 4FVCA 4H54A 4X4TA 1GXLA 2XEXA 4IG0B 1AZSB 2OPPA 4PAAA 2GX8A 1TMMA 3GE9A 3SCKE 3ZZOA 1R0BG 4ZVUB 4ECRA 1BD6A 3DN9A 3PFEA 3H90A 4L76A 1EAYC 2GVZA 4WP9A 4B9SA 2WB4A 4P2XA 1QAIA 4F25A 1NB7A 1UZHA 4OV6A 1PJ5A 3EM1A 4C0HA 3SIPB 3DOKA 1H3DA 1SC4B 4NLTA 2FZKB 5K8MA 2GV1A 4OZ2A 1N56A 2J9CA 2DTJA 3NGUA 2BA9A 2WAQD 2MGZA 2ZOGA 3TA2A 2LCWA 3DKDA 2HWTA 1YK9A 2IM0A 1N33F 1CQMA 3GFHA 4OLOA 4OYOA 1BWVA 2PI4A 1LW2A 4JYAJ 1FK9A 4LF6J 2IM1A 4PQUB 2ERRA 2DR7A 2B4OA 3H4DA 3D1HA 4QIGA 2AX1A 1VCTA 2FJDB 2D3O1 3Q8VA 3MEGA 3US5A 1XQIA 2YX1A 1TAUA 4CNZA 5H1SV 2LQJA 4QW9A 3LO3A 3N5FA 4ZPBA 1B70B 1BLUA 1LWFA 4C97A 1BHNA 3QGHA 8RUCA 1GH8A 2PMWA 3MGJA 4WFBQ 2RU9A 4RUAA 5D4PA 5D0RA 3RAQA 1GX5A 3D3BJ 5C24A 4WZQA 1N5YB 3M32A 4Q7AA 2HNDA 3OSPA 1RWKB 4F0HA 1HARA 2F4FA 1V3SA 2H9ZA 2U2FA 4PZVA 2J8SA 3A8IA 2MZTA 3T1HF 3TEHB 4F02A 1UPMB 3M9OB 4DV6F 1RT2A 3M7VA 4WCEQ 1GX6A 1JWWA 2CPYA 1HA1A 4ZVPB 4WYWA 1QVGR 1KR4A 5HLFB 1SH0A 1JLQA 4PWDB 3LP2B 4ZHRB 2PIIA 3ZTRA 1RSCA 1W2IA 1NNDA 4OYAA 5B0EA 3HVWA 1WC3A 1YBTA 2HMIB 1URNA 5DJBA 3H2LA 3Q83A 2HLTA 2PD1A 2WVBA 4A8KA 1FNXH 3QJLA 3HCXA 1KFDA 3DM2A 1NDKA 3IMQJ 3T5HA 2DGVA 1FDNA 2H4YB 1FRKA 4ZPDA 1X4BA 4WKRA 2DNZA 2VQFF 4Z7CA 1TUVA 3CJKB 2VBYA 5DLFA 1HKAA 4DV3J 3I96A 1X0PA 4DI6A 4OI6A 3DLEB 4IG3B 3PJWA 4KT0C 2QSFA 3BGFA 3CMES 2ZJRQ 1Y5NB 2G9OA 4WP3A 1JLAA 1H6KX 3MM5B 4H4OB 1KQGB 3CVKA 2XMKA 4CYUB 3RW7A 2HK2A 1FHTA 3AD7C 4IG0A 3HMJG 1AZSA 1KP6A 2FLOA 4A8XA 4RBTA 4M94A 1HW8A 1KRPA 2DBBA 4C0BA 4LF5F 3AFGA 4LF2A 1WELA 5A2QY 3BKTA 2EXUA 3JB9k 4ANCA 4G6VB 1YLXA 1FRLA 1AFJA 2MQMA 2IJFA 2KRBA 2R7WA 2AIRB 3UFCX 2QMWA 3QWUA 1TP7A 1SB6A 1S6QB 2CNOB 1JB0C 2HQIA 2FHMA 5FLXY 1UFLA 2R7QA 3RAMA 4PQUA 1WKKA 1BMQB 1TK0A 4QR2A 3HZEA 3RRKA 5CCMA 2YBVA 2MZJA 3KMQA 3W5YA 4JBCA 4GO5X 4I67A 3MR6A 2B5JB 2CXEA 1TL1B 3B78A 1EQMA 3BO3A 1MN9A 3K2YA 4LF9F 1GEHA 2CKWA 2ILYA 1N5YA 4U95A 2OHDA 2OTLS 1P9YA 3ILOA 3T19A 4U6PA 3K8WA 4DV4F 3LALA 3GFXA 5L1KA 4NLYA 1SQGA 3D2WA 2UUTA 2B56A 4CM2A 2QMXA 1IKYB 2KVIA 4FYWB 3Q2SC 2AEJA 2VASA 4CO0A 3KJVB 1O8BA 3MOJB 3D0HE 2FJAB 2RMLA 3ADAC 5HLFA 1RKJA 1U2RA 2KT5A 4PWDA 2ZDOA 3LP2A 4ZHRA 3GSDA 3TUJC 1EKSA 2FJEB 3BSAA 4ETXA 3MTJA 2XYGB 3H2VE 2VICA 3K57A 1SH3A 1R0AB 3B4DA 5LT5A 2HMIA 2HFZA 3MPUB 1XR6A 3IWLA 4RW6B 4L72B 2ZNZA 2YNFB 5JJBA 1DRZA 1JLCB 1OO0B 1RWMB 4AUKA 1X4FA 3M9MB 3GU0A 4R0JA 1VOMA 3CJKA 4ECQA 2RS8A 4USMA 4NCGB 1N6QB 2FTRA 4NLOA 3GILA 4Y0FA 3DLEA 4IG3A 3H5YA 3J7YU 1RLCL 1K0VA 3R2DJ 3W9JA 2Y1JA 4WU3A 2QTWA 1TKDA 4JYAF 1NJXA 4I2QB 3IFEA 2G0IA 3ZNUA 3MM5A 3MF5A 1FFWB 4H4OA 4GVLA 1W2BR 1UJ5A 3V2UC 4CYUA 3ZTPA 1CBKA 1V3ZA 5IWAF 3PEJA 1VS3A 1UEUA 3KHGA 4EU0A 1C1CB 3ZFVA 4GO7X 2AEMA 2V50A 4J9PA 2GW8A 3AJDA 2NQPA 2ZZTA 5G4DA 4CWBA 4KHPJ 2GA7A 2ZBQA 1IQZA 3FRYA 3D1OA 3HDSA 4MIAA 1HNXJ 1RTHB 3A8JA 2DGSA 3R7NB 2JOQA 3W9HA 1FVSA 3G87A 3PW7A 2GQQA 1RDRA 3HVRA 4J9QA 1APSA 1S6QA 3RU0A 3K0JA 2BKPA 1FTRA 2CG8A 3MUMP 4DQQA 3A8EA 2RRNA 2QSWA 1LV5A 2PT0A 3DXBA 3PYDA 2Z2MA 2MKJA 3G96A 3G6XA 3E2EA 2EBEA 3ILJA 3C66A 2PDAA 2QLJB 5GAHU 4RO0A 3BPSP 3LANA 3QIPB 2JHEA 2RB7A 2RF2B 5HQLA 4LFAF 2B5JA 2CRLA 4NCAA 1U02A 4MYUA 3ICLA 3RB0A 1TL1A 2WCXA 2W2NP 1Y11A 1S0OA 5I3PA 2F8EX 3MFHA 2WW4A 2YVSA 1RHJB 2BJ1A 3G4SS 1ZPWX 4XAKA 1NH8A 3CJTA 1HBOB 2HRUA 4IOCQ 1FESA 3F56A 3QQCD 2LEPA 3N5BA 4L6V3 5JMNA 1KN6A 2AYBA 1IKYA 5KFOA 4P7VA 3KJVA 2DO4A 4X2BA 2GNKA 1QAXA 4DV0F 1VFJA 5KFHA 2HQDA 4C98A 2LDYA 2BX6A 5GAGI 1F2HA 2MQPA 2OMLA 4DWIA 3B6BA 4LVNP 1R0AA 4QPXA 1SKRA 1HWIA 4IRDA 4RW6A 2YNFA 4H4KA 3IRWP 1VMBA 1JLCA 1SC3B 2HHTA 4ZLLA 2DVIA 5D6GA 3GIJA 3IR7B 3AJ1A 4DX7A 2DH8A 2HZCA 2QLBB 2GAHC 3SDEB 4M8LA 2LU2A 3W7BA 4NCGA 1N6QA 3TZZA 4QBUA 3VGVA 4ZPVR 4NYPA 2C2DA 4L3KA 2MKSA 1S4EA 4ZPCA 4P2MA 1KLNA 4I2QA 4QPTA 1S6OA 4EEYA 4CI0B 1NO8A 4FNHA 1Q16B 4O3PA 4PUOB 3FUYA 1OJ4A 3IWXA 3PX6A 2W9CB 3X3UA 1S72S 4C6AA 5IT4A 3IO1A 4LSZB 5KAKA 2AZ1A 4YDXA 1C1CA 2F3JA 3VV2B 2HVZA 4OHYA 3GG1A 4J7CA 2V0NA 4ES1A 4MIBA 1IVZA 3CC2S 1HI8A 3QJJA 5D15A 1XERA 3H5UA 2AF6A 4DS4A 2HURA 1YBAA 1FERA 3KG0A 1GMWA 2I1RA 1RTHA 3FC9A 2IFXA 3VAKA 2NSCA 1PGZA 3DC2A 3MDFA 4K8RA 4GC7A 1LFPA 3VF0B 1Z1ZA 4CH0S 4MH8A 1LFWA 2FJBB 2IAJB 1M5KC 3QRRA 3CJ4A 1NM2A 3FFIB 1CJKB 3HULA 3SEOA 1C1BB 2YKOA 2H3EB 2MY7A 2XWYA 2EG2A 1FJ7A 2GCFA 4BC7A 1X5PA 4ED8A 1WEZA 2YTCA 4ECUA 3QIPA 1M0SA 3MMAB 2RF2A 1QLNA 3P6YC 2CQ3A 2UXCF 3TANA 4ZP6A 1FF2A 1FJGF 3V81B 1RT3B 3RB6A 4KKOB 1FRIA 4DL4A 5KFDA 3C8YA 3KK2B 2AQ4A 2R3VA 3CNQP 3VWSA 5IV4A 3FNNA 2WVEA 3J7Z5 3R2CJ 1M1HA 5H9FJ 4O3OA 4DF8A 4HT5A 1RK8A 1HBOA 2RQCA 4JV5J 2E66A 2EW9A 3A3NB 4P6QA 1PILA 3M6UA 4KRWA 3Q2TC 4OZ0A 3CCTA 1UVJA 5AXLA 3BGUA 1ROFA 1KHWA 2CQDA 1N54B 1PKUA 1YBUA 4QYRA 3KK1B 2IA6A 4UZBA 3DOMB 2IPOB 4G65A 5A76A 1D8ZA 3BR9A 2EFVA 1N36F 2KJWA 2HNZB 1O51A 4DFKA 2QO3A 3TA1A 2HG4A 4DSKA 1C0TB 1EJ7L 1I6JA 1V9OA 4TU8A 5KFMA 3J81Y 1YRTA 3L9ZA 2DHAA 3QATA 1ZETA 4WJBA 4DR7J 3MPWA 5DG7A 3SDEA 2Z30B 3TNVA 2EG1A 4DQPA 1QVFR 4FZVA 1U6FA 3C3LA 2YH0A 1U2FA 3SQOP 2IHR1 2XY7A 1TUWA 3OFHA 2BJ9A 1H38A 3GV5B 2RJZA 1AXQA 1VQNS 3MXHP 3HD2A 1CJVB 3SFUA 1EKRA 1G7CB 2CPIA 3ENVA 4JI7J 2ZC3A 4PUOA 1JLFB 3BREA 4PWUA 5B09A 2MSTA 2W9CA 3NL0A 2CVIA 3QT5A 4F67A 1SL0A 3CD0A 2QE5A 3KHHA 3HJVA 5GMDA 2DCLA 1RHRB 4MT1A 2HGLA 3KYLA 4O23A 2H54B 1U8SA 1CG2A 3CO9A 3ZZUA 7AT1B 2ADCA 4FBUA 4GC6A 3J7AN 2R2RA 3RB4A 3ITHB 2M0GB 1FKPB 2EFPA 4W98A 4DMZA 1VK8A 3LWMA 4DPYA 3NCQA 4K2XA 1OPZA 5CYQB 2V2ZA 3LAMA 3D3CJ 2IAJA 6FDRA 2E5GA 5H9FK 2C2RA 3FFIA 1A0OB 4A8FA 2KJVA 1CJKA 2MZSA 2HEKA 4F4ZA 3JAMY 1C1BA 2G2ZA 1UKUA 3PX0A 3I87A 3KJFB 1FNOA 3QT8A 1YJTA 2VDHA 3MMAA 4OIXA 2IIHA 1QM9A 3MPYA 5A0YB 4DCOB 4OHZA 3V81A 3UO0A 1RT3A 4KKOA 2LEBA 1V5VA 2E29A 1S49A 3KK2A 2CPXA 2G0CA 4WBFA 3UDVA 5IC4B 4NLWA 1TMJA 3DMJB 5E33A 1UETA 1H74A 1VQ4S 3VAHA 2MQNA 1LEOA 3FCVA 4NLXA 2UU9J 3QPIA 2B4UA 2HHSA 1B7YB 1RA7A 3LAKA 1M5OC 1RWVB 5LXRA 2JH3A 2VD3A 2DXEA 7FD1A 2YKAA 4FS1A 3KK1A 3DOMA 2C3OA 2MJUA 4F3MA 4B3TJ 3AB2B 5CYMB 2HNZA 4K4UA 3PW2A 4KSEB 1N5SA 4B17A 1C0TA 2C28A 1GMUA 2QJ3A 4GMKA 5AJ3F 3MM9B 2CZ4A 4Q0BB 2F1FA 2DNYA 1CJUB 2QIFA 2DCUB 2B4VA 5J1NA 3NNHA 2IMOA 2KDOA 3HVAA 5KFTA 2J8AA 2C3YA 2JFKA 1Q1KA 1T3NA 3PNIA 2CFXA 2DD8S 3GFZA 5A8RB 3OSNA 1W25A 3QZ8A 1PCAA 3H40A 5DZ6A 1Q86T 4ED7A 4C2MA 3KJQB 3B4MA 5HBMB 4ZVFA 1CJVA 2PC6A 1JLBB 3N01A 1IBMJ 3L09A 1BC6A 1JLFA 4RWXA 2EK1A 4AE5A 1AFIA 1GXUA 3T9NA 4NLPA 1PYSB 3M2VB 2YKQA 1TKTB 4J5OA 1IBLJ 3MD1A 2VOOA 4BWJA 1PBUA 3K17A 2L3MA 3O5TB 2NLWA 6AT1B 4QJVA 5KG1A 4X66J 2GJIA 3NGDA 3UW1A 3ITHA 1FKPA 3BH7B 3TJ9A 3Q8PB 3TYTA 4B02A 1QUPA 1Q5VA 2LP4A 4FF1A 4WIIA 5CYQA 5HMWA 3KFWX 1C0UB 3U02A 4TQSA 3BBBA 4A8MP 1YQHA 1HQUB 3DLGB 4USKA 4I68A 2W7OA 4YP3A 5KFNA 1JXLA 4GKKF 1KLMB 2OKQA 1WI6A 4ECVA 2X7IA 2QX0A 3AT1B 2DNHA 5IT0A 4JI6F 3FSIA 1AA1B 3EPIA 1RA6A 5A0YA 2P6SA 3K5NA 3QGGA 3PRVA 2DY1A 3KNAA 1FVQA 4F4WA 2JSXA 2CQPA 4RW9B 1KKHA 3GB0A 4PEOA 1PYTA 1BY9A 3KHLA 1TTHB 2RS2A 1U1MA 2YWEA 2FHJD 3KNGA 3TUIC 3ZZYA 1OSCA 5BJRA 3T5JA 2KT2A 3DMJA 4USVA 4QYZJ 5HAOA 4FYYB 3KDNA 2AGPA 4LQ3A 2N7CA 1VQPS 2P6TA 1IKVB 2XI3A 5KFQA 2VQEF 2JDJA 2MQOA 2BOAA 2ZVSA 4FYDA 4WK1A 4OZJA 4ZVTB 4OHXA 2ZOFA 4DX8H 2BYCA 3J7A1 5U47A 4X4RA 2DKOB 2EVZA 2GIRA 3D5MA 2BE9B 5CYMA 2W2MP 4LF4F 3BQ2A 2O66A 3BEGB 1IXKA 2KKHA 3LGMA 3MM9A 1RAIB 4R0EA 5L39A 4Q0BA 1CJUA 3HSZA 3FGVA 1T9UA 2BANB 2AGOA 1DARA 4OYPA 3EZOA 1VQMS 2AJ0A 1TL4A 1VLOA 2HFNA 3H42A 2VJUA 3QRQA 5D0GA 3R5JB 3CDAA 3SBMA 1FWLA 1TQLA 3DU6A 3DRPB 3TARA 1MN7A 5A8RA 1U26A 3H4BA 4O3NA 1UTAA 5HBMA 4KHRA 3W5XA 5CHCB 1JLBA 3R8YA 1WHYA 3HJFA 2F40A 1M5HA 1VC0A 3KLVA 4E8UA 4HTJA 2MQLA 2B9YA 4FF4A 3KLGB 2CNKB 1WTBA 1RWUA 2COLA 5CZXA 3OFGA 4OI0A 3J81U 1SUQB 3M2VA 4DV2F 2JEIA 4PQAA 5ADZA 1XMOJ 1TKTA 2HHQA 5B7WA 4U67Q 4DR3J 4ZP7A 4KGZB 1TK8A 2RD5C 4K5RA 5KFJA 2BM1A 2MYFA 3CUNA 3UI3A 2C2NA 1C0UA 1HQUA 2HRYA 5HJXA 1EP4A 3DLGA 2W24A 3SI8A 4QYZK 4ZOSA 1KLMA 1Q8KA 2MLXA 1P9QC 4IDKB 4KY3A 3BQ1A 2W8LA 1JJHA 5DDPC 5K14B 2IRUA 2WVCA 3OTCA 2HBYB 1MU2B 2AD9A 2M70A 4WF9Q 4A46A 1SL1A 2N7YA 1MMNA 1VGYA 5FIIA 2X1BA 5HANA 2BABA 3UN2A 1WF0A 1PIEA 5EWGA 3MR2A 4ZJQA 2DJWA 3P45B 4CO3A 1FFSB 1UW4A 4OZNA 2LQ8A 4C3KA 3EPGA 4RW9A 1CSJA 1DURA 3N28A 3GMGA 4EBEA 1WHVA 2APOA 4MMOA 5KFGA 4B9LA 2UXBF 3FEXB 3T6JA 1H72C 2C2EA 1RAOA 2DITA 2PE8A 4U96A 4N41A 3KMSA 5LSOA 5E3QA 4DUYF 3PM9A 4LJMA 3JAMU 1SXLA 1CQNA 2BQUA 1XC9A 2X1AA 3SSQA 3ILLA 4DR4F 1IKVA 1YJRA 1ZM2A 1N8RT 1WF2A 2P9EA 3R5CA 4U9RA 3LGNA 4B9NA 4WFYA 2V67A 2VOPA 5L38A 4NOHA 4IO1A 2HZAA 3GWCA 4CO2A 2VZ9A 3MM6B 1T9YA 1VHIA 1GFWB 2JVRA 4UUXA 4B08A 4MYTA 3C46A 5KFZA 4TU9A 3NWRA 2ZOMA 4PYDA 3OL6A 2DR6A 3SFGA 1IBLF 2RH3A 3ETMA 3VAMA 1D9DA 2BANA 3IC1A 1ZAWA 2QFJA 2CQ1A 1FT8A 2KH9A 1T94A 4N77A 3NCPA 1OPIA 4PG8A 3DRPA 2KB2A 1UJ4A 4ZIVA 4UOFA 2AV5A 2W2QP 1B99A 4LFBJ 1CC7A 3AHPA 1U09A 1J27A 3MUVP 3W3SA 1HFEL 4JI0J 4KIAA 1VQ7S 5BR8J 2GMLA 3OTEA 1FCAA 1C2PA 3KLGA 3CCSS 2E5IA 1Q0NA 2UUCF 5H9EJ 1SUQA 4RUBA 5BXIA 2QYCA 4C8YA 2J9EA 5DZ7A 1UPPA 3BN7A 5EWFA 2MQQA 3TP2A 2QL7B 2CQ0A 5AXNA 1Q82T 1F60B 1TL7B 4RNMA 1YI2S 4LQ9A 2ZHAA 2EFQA 2MTLA 1R6VA 4HI1A 4WK3A 3ZO7A 5HI7A 4Y2CA 4KBIA 5D4OA 3IA0A 1YZ6A 5DETA 2L48A 2ZKUA 3MR7A 2FJVA 1RTIB 3RRGA 5E3RA 4O0NA 4J9VA 1X5OA 4I69A 2QA1A 1LWCB 2M9KA 4ZVSB 3W8GA 2R8GA 1NKEA 4IDKA 5L46A 2EFOA 3FCWA 2R7VA 3HM9A 4AL6A 5K14A 1S6PB 3FEZA 4ED1A 3H59A 1MU2A 3MEDB 2CPEA 2WSCC 3SQGB 2E5HA 2O5DA 2B9XA 2DPJA 5C42B 5GAEU 2BW7A 4DL6A 1N0VC 5E3CA 2MEWA 4HHHA 2VU5A 2DGWA 7FDRA 4FVMA 2N82B 3UE2A 2YKMB 4WXOA 4DR6J 1M90T 1IM4A 4E2FB 3FKBA 2XQCA 4B3RJ 1R8AA 5ETSA 4KV8B 4IH5A 1NSAA 1XTZA 2VL1A 2D9OA 1UWAA 1MLAA 1ZM9A 3LQVA 3GIRA 3QAEA 5B0FA 4JI2F 4RNHA 2WBMA 1WDDA 4J9OA 3M6WA 2IMWP 4V1Ak 2BRLA 1T9WA 3MM6A 3D67A 3PDNA 5IT9Y 2H48B 4EFAC 3LH2S 3ETOA 4DR5J 3NGKA 1CVJA 1KEKA 4DR3F 2J6SA 2FC9A 5H9EK 2ZD1B 3CJ8A 1G1XA 1X4EA 2AU0A 4ZLNA 5J1PA 3UD3P 1N32F 4ZCKA 3MCSA 1XNRF 1S79A 1TL3A 1ZYQA 1RTZA 1Q79A 3TUZC 3PR5B 2ZH8A 2OPSB 2DNLA 4GKJF 3W9IA 3EGWB 1HHQA 3KHRA 2CPDA 3CB4A 1SJRA 4HEA9 3PJ9A 5ETNA 1FFGB 5L9NA 4DR1J 3IM8A 5IQQA 3OTBA 2VFUA 2RQMA 4Z37A 5LMNF 4ZKAA 2DNOA 2ZH4A 3ISND 2FHOB 2E5LJ 2RHSB 1GK8A 1RWOB 3W65A 3SZ2A 1JJ2R 1S1UB 2LECA 3Q24A 3I32A 2RUSA 1TL7A 4F4AA 4LIRA 4CLLA 4NWBA 3HKWA 3CJ5A 1EARA 1HD0A 2C2OB 5HVHA 3F44A 3DI6B 3C19A 3D6FB 1L3KA 2A6MA 3PACA 3MOZA 1RTIA 2NZCA 3MPDA 5KG7A 2OGUA 3RG6A 2DPIA 1LWCA 1B0TA 1FWKA 3CULA 1KSPA 2DR9A 1VQ5S 4LBIA 3KLFB 3ULHA 3I6PA 1S6PA 4CLYA 4KGXB 3FSXA 3L3CA 3BYPA 4B9VA 3OTDA 3MEDA 1H7WA 1RT5B 5F9LA 2AGQA 1KFSA 4NLGA 1DJ0A 4LF7F 2HIQA 3GP9A 3SQGA 1XBWA 1KTVA 2AJ4A 3MWBA 3CCVS 5C42A 4N76A 1IUJA 4F50A 1NJIT 3EXCX 2DH9A 1NK9A 5CA5A 2WBRA 2YKMA 2KTQA 2V4JB 2R8JA 4KV8A 1HMVB 5C7PA 2HGMA 3OVSA 2OAUA 2LXIA 5CAAA 1HQ2A 1UZDA 3GG0A 4RW8B 1UEVA 3R97A 1LXNA 2V2QA 3CT9A 5I3UB 3EX7B 2C3PA 3RRHA 1HHTP 2L08A 4JI0F 4WTYA 5BR8F 2L9NA 3CJ2A 3RB3A 3H98A 2GFFA 5KFRA 2LXUA 5F41A 4ZVOB 4R8UB 2W4CA 3CE8A 4O44B 3WC0A 4QIEA 1DQ9A 4TXSA 2ZD1A 4CIOA 2R7OA 2W8KA 1K8AT 1NK4A 3P49B 1X9WA 4PWWA 1FJCA 3B54A 1SC6A 1FD8A 4DHVA 2DGXA 3M6XA 4QR0A 1KTQA 1MMDA 3GONA 2C1EB 2IDLA 4RU2A 5A8KA 2AT1B 2KYZA 4J91A 5IM0B 1XNQJ 2ZKTA 5HVFA 2OPSA 3J7YI 1IR2A 3PJXA 4ILMA 2NREA 5ETVA 2B4PA 4DQRA 3G82B 1JXVA 1RAHB 3BDEA 1A7GE 4HHUA 2DGTA 4J9RA 1GAOA 5HSPA 1QTNB 4A8SA 2E7WA 2EI5A 5HN0A 2VPXB 3BKFA 3ZTOA 1YWXA 1S1UA 2FGCA 4OFZA 1NPKA 2EK6A 1XMQF 2CWXA 4Z2XA 4K7QA 3GZ7A 4PPDA 2V6AA 4XPCA 4KHMA 3KJNB 4Y00A 3GR1A 3DHWC 3DI6A 4TY9A 1Q5YA 5G0RB 2BQRA 2LA6A 2VDIA 5ETQA 2IM2A 2UUBF 1TAQA 4CLUA 3DFEA 3CDEA 3DOLB 3K59A 1UVKA 1RTJB 1D8YA 3PYFA 1IKWB 1TFYA 1X0FA 4NASA 3EVMA 1WC1A 3KLFA 3F41A 4RX6A 5K20B 3UNGC 5SUHA 4ZVQB 3MMBB 4PXDA 1QSYA 4IR1A 1WKLA 1RT5A 1YTYA 2NZ4A 5GAHI 2QG9B 3SSSA 2BACA 1L3UA 3VAFA 2CA9A 2DRDA 4DR5F 2FJXA 2MKCA 2YPZA 4Q2MA 1MMLA 2D9PA 2R2TA 2BKOA 4EBDA 1AYEA 4M63A 3SV3A 4LUBA 2XGQA 5DLGA 4C3MA 2QLXA 3UCGA 2B7CB 2KL8A 3FQLA 3PRDA 1N34F 2AJFE 2V4JA 5KFEA 1HMVA 1HD1A 2P5VA 4EZ9A 4RW8A 1S12A 4JV2A 3BF4A 5I3UA 2JVOA 2UVUA 2HQFA 4ED4A 4YS2A 2E1AA 2RHQB 4ZITA 3UN3A 1AB8A 2E9RX 1HR0F 2ASDA 3D54A 4FKYA 3W63A 4DR1F 5C2CA 3BSCA 4B9UA 3CIZA 1FX4A 4LFCJ 4R8UA 1QDUB 4N47A 4C8MA 2G2YA 4TVAB 1G4CA 4O44A 4P74A 2MKIA 1IWGA 1PYOB 4LRDA 1H2UX 2WK4A 4IO9Q 2HAIA 2RNEA 3CC4S 4X4VA 1WJ9A 1VI7A 5KFPA 3U1LA 5KFAA 2DNMA 4IQMA 1GMWD 4RW7B 4TNOA 4MTPA 3IP0A 2OPQB 2CQGA 3ENAA 4ERDA 1F6TA 2FDNA 3EUNA 3ZC4A 4C7QA 5IM0A 2CDRB 4OZLA 2NXNA 3H8YA 2NR0A 2Z56B 3M4XA 1HYSB 5IT9U 4O3SA 2DNRA 3HFVA 1VRTB 1ZBTA 2V9WA 4ZJLA 5CCLA 2BDPA 3G82A 2N4CA 5AE2A 5GMKa 3M8SA 4B3MJ 3TAPA 2PMHA 2X1GA 3HD1A 4KPCA 2LEAA 1RT1B 4N8OA 4LF8J 3KG4A 3OLAA 4MK8A 2P9GA 3CIMA 2OIHA 4AL5A 3TI0A 1FRHA 3Q89A 2YQ0A 1UEKA 2WONB 4EBCA 2DXFA 1FRXA 4B3SF 2VKRA 5G0RA 3OR1B 4CDIA 1U25A 4NEYA 2VUGA 3DOLA 5E3AA 3A13A 3GCWP 3B8HA 1WSVA 2QYGA 3FQKA 1RTJA 2KXHA 2Z4PA 1FDBA 1IKWA 1ZM4A 4IOAQ 5F9NA 3OTOF 2YWFA 2ASYA 4OYMA 2RKIB 1KVJA 2ATCB 2V2VA 1RWWB 3PHEA 1O5JA 3MMBA 2XLJA 2HPUA 3SMZA 3NAHA 4G1QB 3VAGA 3VAJA 3A1YG 2YY3A 4U7UK 2OFHX 4QOTA 4A48A 4X62J 1DTTB 2UUAF 2ZHOA 4KGVB 2EC2A 1MG7A 2NS1B 2ZH9A 3LW5C 3N6MA 1UP1A 3CCES 3KDOA 5EDWA 3EE3A 2I0XA 3GCXP 1WOSA 2VFRA 2GHPA 1JIHA 3VHQA 3PVXA 2O1PA 3H5XA 4FXVA 1K1QA 1RXOB 1XEZA 3MM8B 4ED2A 2AJ1A 1XNQF 2J0SD 4KR0B 4ZK7M 1SIWB 1B7FA 2ABYA 2CDQA 4DV5J 2F7VA 3MCMA 1U0HB 3NNCA 2CAJA 5T14A 2ALZA 3QGIA 3UD5A 1K47A 1T7PA 3DRSB 3M8QB 4FXWA 1RAJA 1Q8LA 3FJ2A 1B0VA 4MK7A 3RBDA 3H7HB 4HH0A 4EYHB 3OD2A 1NAQA 1Q78A 4M5NA 5M2UA 5AT1B 2YNGB 3M2UB 1H0HB 5E7OB 3C6UB 3K8VA 2GAGC 4CO1A 3IGVA 1S0VA 2FLPA 1QD1A 4NZ0A 1R6YA 3PG9A 4RW7A 4OYBA 3PW4A 3QWPA 3GV8B 2OPQA 1HNZJ 3V4MA 3THTA 3NGRA 1KS2A 2BUNA 2ZE2B 4IRKA 3OXFA 5J2MB 1QUVA 4V19X 4DSIA 4DL3A 1HYSA 2RQKA 2D74B 3ISNC 4X4NA 2BM0A 4FYVB 4RZRA 1K73T 2NSBA 3TVZA 3M8PA 4DFMA 1VRTA 3DLJA 2HRTA 4YY3J 2OSRA 4NXMJ 2DIVA 4CP5A 2ZWOA 1WHWA 4DSJA 3MR3A 2F4VJ 3DDNA 3HX9A 3D28A 5IZHA 1FX2A 1RT1A 1RU1A 3OBIA 4DFJA 1X4HA 1OS5A 3OW2R 2ZVIA 3HO1A 5HMZA 5E41A 1JJCB 4IR9A 1OIAA 3O6QA 1YVFA 2WONA 4X4SA 1DLOB 3NMAA 5D0HA 1WC6A 3OR1A 5KFUA 2BBEA 2FIUA 1JLEB 3J81j 1LKZA 3QAUA 4UY85 1UJ6A 3GTYX 3IRXB 1PBAA 3V4IB 4WXWA 4KGKA 3Q8SB 2YWWA 2KZZA 1S1VA 2G1DA 2RRBA 1HW9A 2RKIA 3O2IA 1TFWA 2RRAA 2IM3A 3TOQA 1I1GA 4DSLA 4G1QA 3FZBA 1RQ0A 2WHOA 2HS3A 1FI4A 4NA2A 3R5AA 4OYXA 3RZAA 4WTOB 3V6DB 1KDNA 4QQBA 3BM7A 1SJ3P 2GS8A 4DX6A 1DTTA 1OSDA 4OI2A 1RP5A 4OQJA 2R2UA 1HNWF 2LXFA 2CUYA 1P6TA 2YPYA 2I2YA 3SV4A 4DEZA 3S6EA 5LMUJ 4YQWA 4O4GB 1EZZB 2MLYA 5DQIA 2ZDPA 4N7TA 3KLHB 2IBOA 3AODA 4X4UA 2D3ZA 2CJKA 2FLLA 4JI8F 4K0KF 2HS4A 4PR6A 4OX9F 1H73A 3K5PA 3MM8A 4AL7A 3AXMA 5KFVA 4N8NA 1WDTA 4C8LA 3CCZA 5LOQA 2XG8A 3HVTB 5J2QB 3CF5Q 2X3GA 5JXSA 1KC8T 2XHCA 1X5TA 2HFUA 1U0HA 4I6AA 5I4MA 3MHYA 3FRZA 1WNEA 4B3MF 2VFTA 2JEGA 1GQEA 1V3RA 4ZJOA 3DRSA 3SCLE 2J0XA 4LF8F 3M8QA 4LRAA 2ZNYA 2NXCA 2YWKA 2OELA 5A8WB 1PJ7A 3L4BC 4O3QA 3OL7A 5B08A 4A47A 2YNGA 3M2UA 3C6UA 3IR5B 4X65J 2M5YA 4ZCLA 2HHHJ 2CJYB 3PYGA 2FYXA 3ZTSA 4YHHF 4DV7J 1Y3KA 3T9ZA 2Y1RI 5ETMA 2ZM6J 3H25A 2BVZA 3VGTA 2FUG9 1OYDA 2OTJS 2ZE2A 3NG8A 2CADA 2AYGA 2HWIA 4ES3A 5J2MA 2VBXA 3G8TA 1I51B 2F9JA 2XSFA 2OMOA 1TR0A 2VPWB 3TJ8A 2YXLA 1YRXA 1TUGB 2KXFA 1S1WB 4K4TA 1NPRA 3DXSX 4C9DA 1HQEB 2OUGA 2V68A 3UN5A 1D9FA 5LJ5Y 1HHSA 1F3VA 1U1KA 3T1YJ 4PG6A 4JI3J 1NB2A 2VIHA 4FKXA 1S10A 6FD1A 4U7UD 2BW2A 2D3OR 2KYXA 2JC0A 2RDJA 3DCAA 2V2KA 5GADU 4OI4A 2JNJA 1DLOA 2UXDJ 1JLEA 4CTAB 1RT7B 1QJHA 4FYXB 3WIVA 2D69A 3N4WA 3MMJA 3IRXA 4XO0A 2YH1A 2QMUB 3V4IA 4UOGA 3R1LA 5IFMA 1IBKF 4DN0A 4ECWA 1RI7A 3GIKA 3KK3B 3Q0AA 4X4QA 3AQOA 4USJC 1KVKA 3TZYA 2J9DE 5KT2A 4M5MA 3IM9A 4WZMA 1NXIA 4DUZJ 1WD6A 4DL7A 5CXTA 3ILIA 3DLKB 3V6DA 3PTWA 1R8HA 1FDAA 1FRMA 1Q81T 3H20A 4I64A 1JX4A 1RCXB 1TELA 3CD5A 5B0CA 3NGSA 5F0UA 4O4GA 3OUYB 5L8RC 3LTOA 2VFVA 3M05A 1K0TA 3KLHA 2Q66A 4ZP8A 1WC4A 4Q44A 3JSBA 2FY1A 4XDCA 2CPFA 3I82A 3R7BB 1HI1A 4LF6F 3C14B 4Y2KA 2VHGA 3TZXA 1B64A 3HK2A 4M5IA 1U49A 3AD8C 3HVTA 5J2QA 3JXOA 3AY0A 3W61A 1F9FA 2M88A 4LBHA 1T9XA 2LLZA 5EX0A 4JB8B 1H98A 5KT5A 3OFFA 2XB2D 3OFEA 2CZVC 2HFVA 5HQMA 4AXJA 4ZCIA 1UVNA 4EMDA 1VC6A 4DLGA 2B51A 3IBCB 4BLGA 4RNFA 5A8WA 1VHFA 4QWDA 3HLUA 2V8HA 4G3IA 5IC6B 4KB7A 1JKHB 4F0MA 3EJMA 3GJQB 3ZXWA 2JFDA 1P1TA 2RQ4A 1VRQC 4ZVHA 1TZ0A 5F3ZA 4M95A 4P2FA 3GJSB 5AE1A 5CABA 5T7LB 2UP1A 4K50A 2OFGX 2AKWB 1NK6A 3N6LA 2MQ8A 4HKQA 3GJTB 3BYRA 4K4VA 4J9LA 1S1WA 3G6ES 4BWMA 4IFVB 4N56A 5EX3A
chains in the Genus database with same CATH topology
4MKBA 3PIOQ 2IM1A 2XS7A 4PQUB 4I0WA 4IO1A 1HQEA 2ERRA 2DR7A 3HZGA 1VBXA 3OJSA 2Y0SD 3BGLA 5F8JA 3GWCA 2B4OA 2VZ9A 3MM6B 4CO2A 2CJ9A 3H4DA 3I5BA 4J9KA 1S99A 3KOAA 3D1HA 3AQPA 1BWEA 2JVRA 2AX1A 3IG1A 4QIGA 1DTQA 4UUXA 2VC1A 2FJDB 3PEHA 1ZZFA 3MEGA 4B08A 4MYTA 3C46A 5KFZA 3US5A 4TU9A 1SBRA 2YX1A 1TAUA 2ZOMA 4CNZA 5H1SV 2LQJA 3AJ2A 4QW9A 3OL6A 3LO3A 3BN4A 3SFGA 1M5VC 3N5FA 4RW4A 4ZPBA 1BLUA 1LWFA 4C97A 1IBLF 1S9EA 2RH3A 4B3OB 2L41A 4WFXA 3QGHA 5KFFA 3VAMA 1D9DA 1YSJA 1GH8A 2AX0A 3MGJA 4WFBQ 2RU9A 4DV3F 5KG2A 4RUAA 2BANA 2FD2A 5D4PA 4ZVEA 3IC1A 3RAQA 1GX5A 2EKYA 4J37A 5C24A 4TQRA 5EHHA 4WZQA 1ZAWA 4MFBB 2QFJA 4CTAA 1N5YB 1RT7A 2CQ1A 1FT8A 2KH9A 1U1QA 3M32A 1T94A 4Q7AA 2HNDA 4N77A 3OSPA 3NCPA 1OPIA 4PG8A 4UOCA 3DRPA 4YEAA 3ZZZA 1JJ4A 2KB2A 1UJ4A 1Q53A 1HARA 2AV5A 3Q23A 1FRJA 1V3SA 2H9ZA 4TYBA 2HGNA 2U2FA 2MZTA 2K2PA 3T1HF 1QTMA 2DHXA 4F02A 1BQMB 1CC7A 2J7WA 3M9OB 3KK3A 2YWHA 3AHPA 2X1FA 1U09A 4UQTA 4DV6F 1RT2A 5M2RA 3HFKA 5I3QA 4ZPAA 4WCEQ 3MUVP 2KT3A 2MJNA 1GX6A 1VQSA 1JWWA 3W3SA 2ZC4A 2CPYA 1HA1A 2CQ4A 4O4RA 2CQHA 1HFEL 4WFNQ 2KZMA 2K1RB 2Z8QA 2D1CA 4KIAA 1VQ7S 4AFFA 4WYWA 2GMLA 3M6VA 1HL6A 5F8LA 1QVGR 1KR4A 5HLFB 1SH0A 3OPKA 3OTEA 1JLQA 1FCAA 1C2PA 3DLKA 2CJBA 2GMJA 4PWDB 3LP2B 3KLGA 3CCSS 2E5IA 4ZHRB 2UUCF 2PIIA 2GO8A 5H9EJ 4URGA 1BQNB 2VODA 5DO2A 2XZWA 3OVBA 2PI5A 1SUQA 1W2IA 1NNDA 2QYCA 4Q8FA 4K4XA 4C8YA 3UWTA 1KOHA 2J9EA 5B0EA 4HT7A 3HVWA 3BN7A 3L95X 5EWFA 1F5CA 3HPOA 2MQQA 3TP2A 2X51A 4MKYA 4DR6F 2CQ0A 2HMIB 5AXNA 1Q82T 4JV0A 5J1EB 1F60B 1URNA 5DJBA 4W92B 3H2LA 1VQ8S 4UQGA 3OUYA 1NEEA 4Q2LA 4RNMA 5B0AA 3O8WA 4DPOA 1YI2S 1ZTWA 4B3RF 2VG5A 1IR0A 4LQ9A 4X4OA 2ZHAA 3TA0A 2EFQA 3HHLD 3PFOA 2HLTA 2PD1A 4A8KA 1FNXH 3QJLA 1DAXA 4NL5A 3Q22A 1KFDA 3DM2A 1EETA 2M8HA 4HI1A 2IJNA 3T5HA 4IRCA 1JMTA 2DGVA 4HDGA 4Y28C 4WK3A 4ECTA 1FDNA 2G13A 5HI7A 1FRKA 2HNYA 4ZPDA 1X4BA 4WKRA 2DNZA 4Y2CA 3BSNA 2VQFF 4KBIA 5D4OA 1TUVA 3U27A 3CJKB 3IA0A 1NRKA 2ZM6F 2W9BB 2B6AA 2VBYA 5DETA 1R8CA 5DLFA 2L48A 2ZKUA 2FJVA 2IYIA 1RTIB 3RRGA 4HLBA 3I96A 3CJ0A 1NJWA 1X0PA 5E3RA 4JOUA 4OI6A 1R8BA 1X5OA 2PA8D 3DLEB 3FVYA 4I69A 2XGPA 4OJ1A 2FHJA 2QA1A 2QT7A 4IG3B 4TYAA 1QSSA 1LWCB 2M9KA 3PJWA 4KT0C 3CDUA 2OLWA 2JC1A 2QSFA 2UUWA 3BGFA 1XN9A 4YB7A 1VIOA 3P96A 1FJEB 2BJDA 1M1KT 3CMES 2ZJRQ 2R8GA 1Y5NB 1NKEA 4IDKA 2EFOA 2G9OA 2R7VA 1VQYA 3HM9A 4AL6A 1JLAA 5D4LA 5K14A 1H6KX 3MM5B 3Q8RB 1NKBA 1S6PB 3FEZA 4F26A 1KQSR 2HHUA 4ED1A 4H4OB 3H59A 1KQGB 1MU2A 2V9KA 5AXMA 5LXYA 3MEDB 3CVKA 3GIIA 2F9DA 3PW0A 2XMKA 4NLSA 1U24A 1EP4B 3RW7A 2CPEA 2WSCC 1FHTA 4IG0A 3T5KA 3HMJG 1DFDA 2KU7A 2R2SA 2FLOA 4XPEA 4A8XA 4RBTA 2HLUA 3SQGB 3JTOA 2E5HA 4I7FA 4M94A 2O5DA 5DRKA 5DGBA 1HW8A 5JVHQ 4ECZA 1KRPA 1VK3A 2CVEA 3BJYA 3CCJS 2B9XA 4J9NA 3LF0A 2DBBA 4C0BA 2XSJA 2DPJA 1JKHA 1Z2ZA 5C42B 5GAEU 4LF5F 4QIWD 5KG6A 4YR2A 4DL6A 1WELA 1N0VC 4DF4A 4PG5A 5E3CA 2MHEA 4DQQA 3I9ZA 5A2QY 2DGWA 2JRSA 7FDRA 4FVMA 2N82B 3BQ0A 3JB9k 3TVKA 3UE2A 2W9AA 5T7LA 5KFWA 4G6VB 2YKMB 4WXOA 1FRLA 3U1NA 1M90T 2O3DA 2FPHX 3E51A 4KE5A 5JVGQ 1AFJA 1IM4A 1TK5A 2MQMA 4X84A 4YB6A 2IJFA 4A8QA 4P2SA 2BQ3A 2QV6A 2KRBA 2R7WA 1R8AA 1R3NA 4IH5A 4KV8B 3UFCX 1JNZB 2QMWA 4EUVA 3QWUA 1Y00A 2WW8A 1TP7A 1XTZA 1SB6A 2VL1A 4YR0A 1UL3A 5KT4A 3UD4P 2D9OA 1X7VA 3M1VB 1UVMA 1VQOS 1S6QB 4MAKA 1M5PC 1ZM9A 1JB0C 3K58A 2FVSA 1T02A 2BRKA 3LQVA 5DDQC 4ECSA 1IJEB 2HQIA 3QAEA 5B0FA 4IFVA 4JI2F 2FHMA 4RNHA 5FLXY 1UFLA 3DYAA 4MK9A 2R7QA 2WBMA 3CWJA 3RAMA 4PQUA 2NUUG 3CCLS 1P27B 2E5LF 2IRXA 2E7XA 4J9OA 3M6WA 2IMWP 5C25B 2R7RA 1FXLA 3IGNA 3GFYA 1TK0A 2BRLA 3MM6A 4QR2A 4QWAA 1UFWA 3PDNA 3VQSA 3HZEA 3RRKA 5IT9Y 5CCMA 5M2PA 4NRUA 2MZJA 2XMUA 1LW0B 5D77A 4Q45A 4PXEA 1SL2A 2KM8C 3KMQA 1PSDA 5F8GA 4JBCA 4TLRA 4GO5X 4H4MB 4EFAC 4TU7A 1SKWA 4I67A 1TV6B 4PG4A 2MZQA 3ETOA 3LH2S 1KONA 3JSRA 3MR6A 3NGKA 1CVJA 5E5NA 1KEKA 4B3OA 2KFYA 4DR3F 2B5JB 2J6SA 2FC9A 4F4YA 1TL1B 2ZD1B 3B78A 2KG0A 3DNCA 3BO3A 3PZPA 3K2YA 2FLNA 1G1XA 2EBGA 4YB5A 4LF9F 4JUZA 1U1OA 1U6BA 2CKWA 2ILYA 1X4EA 2VA2A 3CD7A 2AU0A 2AYEA 4MFBA 4Y2IA 2GC8A 1RGVA 1N5YA 1UVIA 2JZ5A 2OTLS 1B0PA 1E6VB 3T19A 4U6PA 5J1PA 4RUHA 3UD3P 2ZH1A 2K3IA 3E8OA 3K8WA 2LYVA 4CCHA 1S48A 3HP6A 2DHSA 1N32F 1K1SA 3L7OA 3IS9B 1H7XA 3KKFA 4FF3A 3HHLB 4ZCKA 3LALA 4DV4F 3MCSA 3GFXA 4NLRA 2KXNB 5L1KA 5F0WA 1XNRF 1S79A 1TL3A 4NLYA 3THPA 1YIJS 1ZYQA 1AW0A 3D2WA 4ED6A 1BQMA 1YJVA 2R8KA 2EFNA 1VQ6S 1Q79A 2UUTA 3TUZC 2B56A 3PR5B 2QMXA 5HP1B 2ZH8A 2OPSB 2VBZA 2DNLA 4GKJF 3EGWB 3JYTB 3KHRA 2RE1A 1IKYB 2KVIA 5DQGA 2K1RA 3Q2SC 2VASA 2CPDA 3CB4A 2CQIA 4CO0A 3KJVB 1O8BA 1SJRA 3MOJB 4HEA9 3D0HE 4AYBD 2FJAB 2RMLA 5HLFA 2Y1IA 2QLWA 3IXQA 1RKJA 1NK0A 1U2RA 4ID5B 2KT5A 5L9NA 1X4GA 2F8MA 3MAHA 4PWDA 2ZDOA 3LP2A 5IQQA 3M9NB 4TY8B 3OTBA 2VFUA 2RQMA 1X8DA 4HTIA 4ZHRA 2BXJA 2VB6A 5CYJA 3GSDA 4W90B 3S7RA 4KHPF 3OXGA 3TUJC 4Z37A 5LMNF 2JEFA 5F3TA 1BQNA 3CGIA 4LSLB 2FVQA 1GTHA 4ZKAA 2FJEB 1P1LA 3BSAA 4ETXA 3MTJA 3H2VE 2DNOA 3QLHB 3QO9B 4IQXA 2ZH4A 5E3PA 3MR5A 3ISND 2FHOB 3K57A 1SH3A 1Q8IA 1VBZA 3SZ2A 1JJ2R 4ED3A 1R0AB 3B4DA 3N79A 1X4DA 5LT5A 2HMIA 1S1UB 3Q24A 1JLQB 2HFZA 5J1EA 2LECA 4BC9A 3OLBA 1NK7A 3I32A 1WWHA 2KRRA 1XR6A 2ZITA 3IWLA 4RW6B 4L72B 2ZNZA 2YNFB 4C3LA 1T05B 5K8OA 2N3LA 5GAEI 2RIJA 5JJBA 2Q6CA 4LSNB 1DRZA 1GNKA 5KG3A 1JLCB 4LIRA 1OO0B 1E6YB 3MM7B 4AUKA 1X4FA 4NWBA 1F5BA 3HKWA 2PMZD 1FE0A 2LQ5A 1HD0A 3CJ5A 4TLQA 5FDLB 3M9MB 3F44A 2Q6BA 2GHWA 2UV8A 3DI6B 1N5VA 2B43A 1L3KA 3C2PA 4R0JA 4ZMMA 4G1PA 3PACA 3Q8QB 4IH7A 1VOMA 4OV1A 4I1TA 3MOZA 3CJKA 2W9BA 4ECQA 1RKIA 1IKXB 2RS8A 2XMTA 4NCGB 4PRFA 3FMWA 1RTIA 3THVA 1N6QB 2NYIA 1VC5A 4C8ZA 2B9WA 2C3UA 2FTRA 4OL8A 4NLOA 3GILA 3G71S 1G2EA 4Y0FA 3DLEA 5KG7A 5DDRC 3TW0A 2M7SA 2RT3A 4IG3A 3H5YA 2DPIA 1LWCA 3J7YU 1B0TA 2I38A 3PRBA 3CULA 2GIQA 1KSPA 1K0VA 2DR9A 2Y1JA 3SSRA 1VQ5S 2KN4A 3B82A 4WU3A 4IKAA 2FC8A 1RT4B 1TKDA 3KLFB 4JYAF 3ULHA 4R5PB 3K7RA 2RU3A 1NJXA 1MROB 4I2QB 5B0GA 1MW7A 3G8QA 3I6PA 3IFEA 5J2NB 1QAJA 3MM5A 4Y3CA 1S6PA 3MF5A 3EGZA 3FSXA 3L3CA 1F2GA 4B9VA 4H4OA 4HHJA 2R9LA 3OTDA 2K3KA 3MEDA 5DS7A 1W2BR 5GAGU 1UJ5A 2OO4A 4PXCA 1JLGB 3V2UC 4J9MA 1H7WA 2VG7B 2XWXA 1HBUB 3T6BA 1HWLA 1RT5B 5F9LA 2R7SA 2AGQA 2FJWA 1KFSA 1L3VA 4NLGA 1DJ0A 1V3ZA 4MJKA 4LF7F 2HIQA 4ZA1A 5IWAF 4N5SA 4ZLPA 4FBTA 3KLEB 3PEJA 1VS3A 1UEUA 3WZ0A 4K4WA 3KHGA 4EU0A 3GV7B 3SQGA 1U48A 1C1CB 1XBWA 1KTVA 3ZFVA 4GO7X 1JLAB 2AJ4A 3MWBA 3CCVS 5KG5A 2GQ2A 1N0UA 1LOUA 3WBZA 5C42A 2DK2A 1HWUA 4J9PA 3V6JA 4N76A 2GW8A 1S1TB 2OPRB 2NQPA 1IUJA 5G4DA 4F50A 1KHVA 2E1RA 1NJIT 2GA7A 4DBQA 1IQZA 3BSOA 3CCWA 3EXCX 3FRYA 3MURP 5L1LA 1A6LA 3D1OA 2IYGA 3HDSA 3IBWA 2DH9A 1NK9A 1ZAVA 5CA5A 2WBRA 2YKMA 1YG0A 3PXGa 5KG0A 4MIAA 3W2VB 2LQ9A 1FXDA 5K8NA 1KNZA 1YGYA 1LXJA 2ZH3A 2PEHA 3L7PA 1RTHB 1IQTA 2DGSA 2PGCA 2KTQA 2JOQA 2OH2A 1FVSA 3OHAA 3H2UB 3PW7A 2V4JB 2OP5A 2R8JA 4KV8A 1HMVB 2HGMA 1SQEA 3OVSA 3IAS9 4K5SA 2OAUA 2GQQA 2LXIA 1RDRA 5K9FA 4CNYA 5KFBA 2ZBIA 3HVRA 2D3UA 4J9QA 1HWJA 3M1VA 4QZVB 1APSA 1KD1T 2PSZA 3GG0A 4RW8B 1S6QA 1UEVA 4OJHA 2DR8A 3RU0A 3K0JA 1NHVA 1LXNA 2IVFB 3I0SB 3CT9A 4DJBA 5I3UB 3EX7B 1FTRA 3CEDA