5K9FA

Crystal structure of a nipsnap domain protein from burkholderia xenovorans
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
MLVEQRTYWLKPGSVSTFLSLYEAEGLAIQAGALGRLLGYYFSETGDLNRVIQLWGFDSFEDRTRRKAILSGNPQWKSFVGRAGSMIERQSTELLTPAPFSPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords NIPSNAP domain protein
publication title Crystal structure of a NIPSNAP domain protein from Burkholderia xenovorans
rcsb
source organism Burkholderia xenovorans (strain lb400)
total genus 33
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07978 NIPSNAP NIPSNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5k9fA00
1FD8A 1GXTA 3HDSA 2OP5A 3CJKB 1VQSA 2L3MA 4Q2LA 2BYCA 1RJJA 1XBWA 1MWYA 2AP6A 2KT2A 3HF5A 3BF4A 3HFKA 4FNIA 2Q3PA 1Y0HA 1FEEA 1LQ9A 4FNHA 2RMLA 1KVJA 1GXUA 3KKFA 2LDIA 2LXFA 1OPZA 3LGMA 1SB6A 2FTRA 2FHMA 3DXSX 1S6UA 1FESA 4OJ3A 1TUVA 3BN7A 2OMOA 2ZDOA 2W4PA 2K7KA 2W4DA 3KG1A 3WDOA 1AFJA 3HHLA 2GV1A 5KAKA 1Q4RA 2RILA 4HH0A 3FMBA 2K7JA 5B0DA 5B0GA 2GFFA 3BGUA 5T7LA 1YJRA 3MCSA 3CJKA 3HX9A 3FRYA 1TL5A 2N7YA 1AFIA 3HHLB 1AW0A 2QIFA 1OSDA 1FVSA 4DN9A 4NL5A 5F0WA 2PD1A 4YEAA 4A48A 5B0FA 2BJEA 4NPOA 1N5TA 1V3ZA 3LO3A 3MZIA 3FGVA 5B0EA 1K0VA 2KT3A 2OD6A 2XMUA 5B0AA 4U9RA 2ASYA 1MWZA 2K1RB 3I9ZA 2AJ0A 2AJ1A 1U7LA 1YJTA 2CRLA 1Y3JA 2KKHA 2OKQA 3BR8A 1Q53A 4Y2IA 2HFNA 4EFAC 2OFGX 1CC7A 5B0BA 1X0PA 1SI9A 2IYGA 4F67A 2ZDPA 4YDXA 2LQBA 2PGCA 1JK9B 3E8OA 4Q2MA 2GCFA 1YRXA 1YJVA 2ROPA 5F0UA 1Y9OA 2HIQA 3QMQA 2LQ9A 4HI2A 2ROGA 2HQIA 2RSQA 1S6OA 1APSA 4OJHA 1FE0A 2BJDA 2QLXA 1X7VA 1SQEA 2XMWA 4DPOA 1JWWA 4OIXA 4ZOSA 1OQ3A 1TZ0A 4Y2KA 3UDCA 1KVIA 2GA7A 3TNVA 1W2IA 2K1RA 2N4DA 2ACYA 2N4CA 5B09A 1R6YA 4A46A 2AW0A 1KQKA 5K9FA 4HL9A 2IFXA 1Q8BA 2RU9A 2XMMA 1WD6A 2JDJA 3IWLA 4DL0C 1ULRA 5A6PA 1TL4A 2GGPA 1IUJA 4A4JA 4HH1A 5A6WA 1YG0A 1P8GA 1Q8LA 3TOQA 2XMKA 1QUPA 2IYIA 4Y2MA 2HLUA 5IXUA 4OJ1A 1P6TA 2EW9A 3HHLC 1OQ6A 2GGPB 3HHLD 2GO8A 2FB0A 4HI1A 3BM7A 2XMJA 2XMTA 4OJGA 2BBEA 2W4CA 3VTIA 2QLWA 1FE4A 1N5VA 2HFOA 3IWXA 2HLTA 3GZ7A 1URRA 2VH7A 2K2PA 5B0CA 3F44A 1CC8A 3KG0A 4A47A 3T9NA 2OAUA 3KNGA 1N5SA 2XMVA 2QYCA 1YJUA 3QGPA 2VV5A 4ZA1A 1Y3KA 2OD4A 1N5QA 3BB5A 4QOTA 1TR0A 3LGNA 2FIUA 2KYZA 1VQYA 1FVQA 2ROEA 2OFHX 3DCAA 2BUNA 2G9OA 3K7RA 1CPZA 1X8DA 3TRGA 5B08A 3BDEA 5T7LB
chains in the Genus database with same CATH superfamily
3D67A 4Y28C 1ZM4A 3QT5A 4ZVSB 1NZ8A 2WTFA 2V4JB 3GB0A 3CCZA 1HR0F 4KPYA 4DG1B 4JV5F 3HX9A 5LXRA 3DOLB 3UCUP 3LAMA 4LFCF 2PD1A 3NEKA 1DQ8A 4NZ6A 2NSBA 3HHEA 1VIXA 1NK5A 3UDLA 1QE1B 1SVDA 2UZAA 2DGXA 2M4MA 4ENOA 3MM8A 2XZTB 1RHQB 3QIDA 3GILA 1CJTA 4NCGA 4OYMA 4WFNQ 4OYBA 5DG9A 4J9QA 3UDEA 2FJEB 3NWRA 2WVFA 2IBKA 1RHMB 4NA1A 3PYFA 1JXLA 1BWVA 4IG0A 2DVIA 3BGOP 1KQFB 3MM6A 2V67A 2BOAA 1XR5A 2B8PA 3C6TA 2BVZA 1IN0A 1LFPA 2ZH9A 4P2XA 1RBLA 2K2PA 3MPUB 4X66F 3OXFA 1UVJA 5IT0A 5GVQA 4U6PA 3PW5A 1FD8A 1HARA 1Q79A 2VFUA 4ECQA 3OTEA 2EPIA 3NNAA 1RWMB 4RBVA 4YS2A 4EGLA 4M63A 3DRSA 2RRNA 1NSPA 3MPWA 1FK9B 2J6SA 2A1BA 2I2YA 5KFXA 3AHPA 1I94F 3OHAA 4B3TF 2XLKA 1TKTB 2QEXS 3A4TA 1WF2A 1U2RA 4J9PA 5HATA 3ISZA 4NA2A 4DX8H 1LW0A 2NZCA 4WJBA 3O2IA 2YKNB 5KFOA 2E1MC 5KFWA 1WHVA 2JEIA 2V4RA 2CQ2A 4X4VA 1YG0A 3UD4P 3NCPA 3TX0A 5L1JA 2HHHF 2GO8A 1NBEB 3SQGB 3ETOA 2LLZA 5T14A 1HNWF 2QT7A 3M6UA 4PG6A 3BBBA 3K89A 4HHHA 1SIZA 2ROEA 1NK4A 3WC0A 2BABA 1X9MA 4K5SA 3D54A 3V6DA 3DLEB 3OD2A 3MTKA 2DT9A 1CULA 1JXVA 1VQPS 1TUVA 2VA2A 1KLNA 2GIFA 3GYXB 1FNMA 4Y2AA 1NK0A 1IKYB 1JLAA 1S1XA 1TUWA 4UOGA 1KOHA 1T9VA 3HT3A 4OHXA 2M88A 2ATCB 3VGTA 1TL7A 2E9RX 1R43A 1S0VA 1QSYA 3MM5B 4FYWB 3BJYA 3T1YJ 4WU3A 5D0HA 4FF3A 5A8KA 3O5TB 4OIXA 2F8MA 4MIAA 4ZVPB 3N9UC 1RYSA 3E2EA 4A4JA 3M8PA 4CTAA 2GHVC 5D4LA 2VPYB 2BKOA 4AXIA 1G7CB 4DV5J 5B0CA 4QR2A 4DX5A 5JMNA 3ITHB 2QG9B 1UMJA 4A8SA 4PXEA 1ZA2B 2ZH7A 2XULA 5A2QU 3KLEB 5IZHA 3A1YG 4LIWA 3GTYX 3KJQB 5C42B 4Q45A 1PO6A 2BMBA 1JNZB 2LXFA 1HBUA 3RB0A 2R7SA 1P1TA 1XNRJ 2XY7A 4JI4F 4FYVB 4QWBA 2O3DA 3EVWA 1Q8KA 3SXLA 3D3CJ 3P8BB 3CF5Q 2Z2MA 1X0PA 2Y0BB 1RTZA 2WW4A 1RABB 4KFBB 4HACA 4B9SA 3TEGA 3BQ2A 2DRBA 1F9FA 3ZZRA 3MTJA 3JSYA 2JDJA 1TL4A 3H98A 4H4KA 5ETLA 2LU2A 3NGKA 1FJEB 3FUYA 2B9YA 3GFZA 1GTHA 4QYRA 1O0PA 4DPXA 1EETB 4F3QA 4OZ0A 2QYCA 3H0PA 1J2VA 1MWQA 1TAQA 4LF6J 3HJFA 3PW4A 4CH0S 1C1BA 2XSJA 4ES2A 5KT6A 1PJ5A 3TAMB 5J1PA 2ZH8A 2NYIA 4KHPF 1RA6A 1AFJA 3SSQA 2C2EA 3WIVA 3UNGC 3PX0A 1HNIA 3H90A 2BJEA 5ETRA 3O6QA 4DL4A 1WC6A 2XS2A 2Y8WA 1FTCA 4B02A 2MPUA 1F3VA 3GMGA 1O8BA 2ZOGA 3GR1A 2NZ4A 1EAYC 3PFOA 2IRXA 1RT3B 4X65J 4F02A 4DXLA 3MHYA 4L3KA 1HLWA 2FZCB 4WTOB 1FFSB 4DSIA 2CDRB 3W2WA 1QUPA 2IYIA 4V1Ak 1RAEB 2X1BA 2AEJA 2GHPA 3RB3A 2F7VA 2MKJA 1D9AA 3D6MB 4L6V3 4IH5A 3KDNA 4L75A 2XLJA 3IBFB 4Q8EA 4C0HA 1H7WA 3DLHA 4QJVA 5KFHA 1TKZB 3LW5C 4O3QA 2WSFC 2AU0A 2GJ2A 3L09A 4MKVA 2WBMA 3SEOA 2L08A 3TJAA 4ZN3A 4MYTA 1HFEL 2H3EB 2VB6A 3ICLA 3OUYB 4K0KJ 3M8WA 2ZBQA 4LSLB 1CJKB 2AWZA 1QTMA 1OY9A 2OD6A 2EKNA 4DR2F 3EZ5A 4FDFA 3PEJA 2HQDA 3H2LA 5BXIA 4LR7A 3RB4A 4DV1F 2OPPA 3KK2A 3H5XA 2D3ZA 2XG8A 1S1TB 2AQ4A 3HVAA 2V34A 2N4DA 5ETSA 4A46A 2YQ3A 2VFSA 1JLGB 4WP9A 2GGPA 3N6LA 4H4OA 2AF6A 3ZZUA 4DR1F 2DNPA 1RQ0A 4XAKA 4JI5F 4BCAA 1VBYA 4KGXB 3KOAA 3D9BA 5KFUA 5K14A 4B3MF 3MEDA 3VQTA 3BH7B 2FYXA 1OS5A 4RO0A 3NMRA 4NYPA 3CD6S 4KRWA 3C2PA 3WQPA 4WZQA 3QFWA 1V9OA 1OPZA 3MXHP 3DXSX 1FRJA 1ZTTA 1FXLA 1TV6B 2MKCA 4FYDA 2NUUG 1TKDA 3KJVA 3KLHB 2WONA 4QW9A 4LQ9A 2KFZA 2UUCF 2JNJA 1KC8T 4B3SF 3FNNA 2RAQA 1SJ4P 1P9YA 2DGQA 1YJVA 4HTJA 3PZPA 1S6OA 3FSYA 3OTDA 2QLFB 4MTPA 1Q16B 4ZCMA 4ICLB 1IWGA 1GMUA 3I5BA 4USJC 5LMNJ 1XK8A 4KR0B 5KFEA 5D8HB 2XYPB 4J5OA 1S76D 2QMUB 1NM2A 1QAYA 2QLWA 2VPWB 4G65A 2KJVA 5C7PA 3L7PA 3QGHA 2WVBA 1EJ7L 2DPIA 1SL2A 1YJUA 3R3TA 2YKQA 1GMWA 3NAIA 3CD0A 3MUMP 2IJNA 1YX2A 2RE1A 3C15A 3QIPA 5J2PB 3Q8VA 2UUBJ 3IRWP 1GXUA 2RHQB 2Q66A 2PFFB 3DRYA 1WOPA 1RTDA 1U1PA 4F8RA 3H42A 3VVTA 1HBOA 2MB0B 1IJFB 3SV3A 2ERRA 3WZ0A 3W63A 1UW4A 1DLOA 4UUXA 2W9BA 2KKHA 3BPSP 3RU0A 1R8CA 2OIHA 4J7CA 3D2WA 2HHWA 1RT2A 2G13A 1DBDA 4C8ZA 2FY8A 4ECYA 1TAUA 2GS8A 4IRKA 2FY1A 1ZZNA 1NLKL 2Y0SD 2MDAA 3ZTPA 4KGZB 1SUQA 4CDIA 2YKPA 4ZVEA 3I56S 4HR2A 3CUNA 2F4VF 4O3SA 1Q5YA 3T41A 2J5AA 5IFMA 3A8KA 1UFKA 3IS9B 2PO4A 5SUHA 3MWBA 3DDNA 5KFCA 3H7HB 5DLFA 2FPHX 1CQNA 5DG8A 3QJPA 2IY5B 3VZHA 3LQVA 3M9NB 3ADAC 1WELA 1S59A 1X4AA 2H9ZA 1K0VA 3IM8A 2LDYA 3BR8A 2D41A 2H5JB 3LA0A 1QTNB 5K8OA 3NG8A 3UNYA 2C2RA 4I6WA 4CLKA 3PJXA 3GIJA 3M8QB 3V2UC 4C7QA 2B4OA 4I2QA 1VK3A 3GFXA 1KQSR 2FGOA 3SDEB 4L76A 2DIVA 5GAGU 2JEGA 2JSXA 4I0WA 3RGIA 1UVKA 1RYRA 2G4BA 3TX8A 1WG5A 2J0XA 2MQQA 3RAMA 5F8MA 4LRDA 5J1NA 5HLFB 5BR8J 3FFIA 1CC8A 2VBXA 3CDWA 2IHR1 4TXSA 1Q7YT 3GCWP 5DQGA 2MQLA 1HMVB 3JAMY 4UZBA 1FCAA 2ZH4A 1WC0A 4KHRA 4P9SA 1RTHB 1YHQS 3KLGA 2KRRA 1HWLA 2B4UA 4BC9A 4F4AA 1NPRA 5GAEU 1RT6B 3MCNA 2FVCA 2R42A 2LQ5A 2B4VA 4DL2A 3JTNA 2VQFF 1U0SA 3HKZD 3TWZA 2V63A 2DO4A 4DV2J 4TVAB 2YWFA 2HVEA 1W2IA 3AOBA 3OW2R 1G1XA 5L1IA 1SC1B 1C4AA 2CPIA 3TZWA 2EKYA 4FYXB 1HD0A 4ZVRB 4WTYA 1RAGB 4O4GA 2X3GA 3FVYA 2KDOA 1RA7A 4UQGA 5F41A 1F60B 4LF2A 1B0PA 2YKMA 4OJGA 2BZ2A 3VAKA 3EM1A 1P9QC 1VQ6S 4JI8F 3MMAB 2NPIA 1CS4B 2OAUA 4N8OA 2HIYA 2XNQA 2V6AA 3HFZB 2M7SA 3E01B 2ILZA 5F3TA 3M05A 3IAM9 3N6NA 2PC6A 4H54A 2YWEA 2BM1A 1X4CA 3HZEA 1WWHA 2JHEA 3DLKA 3CDBA 4M5NA 3R27A 1XR7A 1WNEA 3DRRB 2K7JA 1C2PA 3BGUA 5HSPA 4OYWA 1Q86T 1FKOA 5HVGA 4CLPA 1D3WA 4X4RA 2ASLA 2K3KA 4C3KA 3K59A 1TP7A 1E6YA 1HWJA 3EX7B 4USHA 5CD4H 3AOAA 2LEBA 1SXLA 1KN6A 3GWCA 3VGVA 2E1PA 3SQOP 3T5LA 2M70A 3D6HB 2K1RA 4ER8A 1KOOA 2RB7A 2XZDB 2IM3A 3T19A 1XJWB 2DO0A 4H4MA 3MECB 4DR6J 1ZS6A 3KK3A 1QY7A 4CNYA 3M30B 4OHZA 2FB0A 3VTIA 2WOMA 1DY3A 1RT1A 1NCLA 4ZJLA 1HPZA 4QQBA 3QBCA 2NXUA 1B99A 3CCES 1JIHA 4ECTA 1RGVA 2G9OA 4ETZA 1LEOA 1JJ4A 3H4BA 5A8RB 4RBUA 2H4YB 4FS2A 1RAJA 4R8UB 4PWDB 1O6XA 2W2NP 3PFEA 3DLGB 4V19X 3GJTB 4R0JA 5D15A 2OLWA 1HWUA 3A8IA 2B6AB 4GKKJ 4NLOA 5D0RA 4A8YA 1IBKF 1XWLA 3GSDA 1ZAVA 2RDIA 2CZ9A 2XNRA 4D3GA 3CC7S 4PPDA 4DF8A 1RWNB 3JYTB 3I82A 1KQGB 2ALZA 2HBYB 3OFFA 3B8HA 4IQMA 3NWGA 1S7IA 1SPBP 2BE2A 5B09A 5F8JA 3M9MB 3RBXA 1Y7PA 4PEOA 4BWMA 3LAKA 3G6VA 1NHKL 2ZE2A 5AXKA 3VR1A 2HS4A 2IMWP 2RNEA 4KH0B 2CPJA 1LKZA 1NH8A 4DUYF 2HG4A 2KFNA 4DSFA 4RW8B 4C8LA 1U1KA 4MKAA 1UAWA 5CQGA 3D0HE 1S6QB 3MF5A 2R7XA 1XNQJ 3P49B 5KFGA 5HQ8A 5DDQC 3VAIA 3KG1A 1MU2B 3HHLA 4QIWD 2W7OA 1REGX 3NS5A 1VIOA 3OTBA 1J5OA 3V6KA 2LQJA 3IR5B 2WRMA 4U9RA 3WDOA 9RUBA 2IYGA 4NXNJ 5IWAJ 1IQZA 4KSEB 4KGVB 4V19J 4QR0A 1YZ6A 4RJVA 3H2VE 4TYBA 4USIA 2AJ4A 2VBWA 2ZHBA 4RNOA 2VOPA 1C0TA 4N7TA 1RUSA 4D3HA 1QSSA 4XPCA 4PG7A 4O3OA 1BLUA 1X4HA 4AXJA 2ZM6J 1F1BB 2XMKA 4NZ7A 4KQZA 1NSQA 2DNOA 1VC6A 5G0RB 4DV3J 2CPXA 2XWYA 3R2DJ 2GAHC 4DQSA 1S0NA 4NYOA 3H2UB 4JI1J 4JYAF 4QOTA 5AE1A 1RWVB 3UWTA 1WEZA 2BE7D 4ED8A 3J81U 3J80U 3V81A 2QFIA 4TKTA 2OSRA 3IBCB 1NPKA 3MFHA 4X4OA 3VCDA 1VI7A 1WEYA 4IQXA 2X3DA 4K4VA 2ZBPA 2NXEA 2N82B 5C2CA 4CLTA 2MQPA 5F8HA 3R9LA 5B0EA 1OY6A 1H7XA 3PY8A 1JK9B 3DMJB 2GVZB 3C3LA 5ETMA 3MMCB 1S57A 4K2XA 4NCGB 2N4CA 4RNNA 3IMQJ 1LWEA 3TUIC 2WK4A 3T5HA 1EQMA 2Z57B 3J7A1 3AODA 3D1HA 1PYOB 3FCWA 1S4FA 2WB4A 1NJYA 3NLCA 2GVDB 2DBBA 2NXCA 4DV5F 2QJ3A 3BQ1A 2OPQB 3TEHB 4W92B 2C3PA 3I0SB 5C2GA 1YK9A 1M5PC 2HNZA 5J2QB 2LVWA 1U02A 3DI6A 4ED2A 4CQ1A 2IA0A 3PG9A 3MUVP 2EFNA 3A12A 3OFGA 1XNRF 5E5NA 1NKCA 4F4YA 2J0SD 4DR7J 2IVMA 4CYUB 1EHWA 3D28A 4OZ5A 1TMJA 1T03A 2ABYA 1U0HA 2VJUA 4XK8C 4ITSA 4HVZA 4WFYA 2VBZA 3AB2B 5A2QY 3DHXA 3G6YA 4DX6A 2YWWA 2RQCA 4DJBA 4DDFA 1RAHB 4NX9A 1HW8A 1EARA 2BANB 1WKKA 3SSSA 2R8GA 2DR8A 3IAS9 4M94A 2Y3YA 2IC3B 1URRA 3MR6A 2GQCA 2PIIA 1PC5A 5ETVA 2EFOA 1RAIB 2IDEA 1O51A 3KG4A 1ZYQA 2QA1A 4PRFA 1UFLA 1HNZJ 2U1AA 3DU6A 1VISA 3ENQA 4ID5A 2KVIA 2XY5A 5E41A 3M32A 1YZ7A 2VU5A 4FF2A 4ZP6A 3FRYA 3B54A 1NPPA 1FVSA 5ETNA 4RW4A 3NGRA 1JLAB 2E9ZA 3BO3A 5IQQA 4C11A 3H40A 1DARA 1MWZA 4DN9A 1U7LA 2G1DA 1TL7B 1MLAA 3LWMA 1TK0A 2LU1A 5HJXA 4LF5J 3D66A 2FLOA 4KKOB 1FNOA 4F2SA 1WDDA 1DURA 1P6TA 1B7YB 3M8PB 1Z2LA 4E8UA 2VG5B 2VIHA 5KT2A 2J7WA 1WEXA 1S9GB 1G4CA 4ZITA 2FJBB 1VMBA 1U25A 3AD8C 3FEYB 1RI7A 3EVOA 4QIGA 5F8GA 4NLWA 2JEJA 5T7LB 2CNLB 5D0EA 3UCZP 4ZVUB 2BQRA 4DR4J 5D3GA 2L9WA 4MMOA 3KXDA 2EK1A 2DGUA 4CO3A 1LWCB 1HBUB 3MCSA 4FP9A 4CLWA 5DDRC 1N54B 1VCTA 5AJ3J 4K0KF 3QJLA 3FBCA 4CO0A 5KFAA 4EO6A 4LF8J 4WKYA 4KT0C 4G1IA 5J2NA 1AZSA 4U7CA 1NZAA 4NLGA 5I3UA 2LEPA 4P2SA 2MKYA 3G9CA 5LXYA 3T5JA 1FA0A 5CA5A 3T6BA 4QPTA 1N36J 1NU4A 2A2CA 3T1HJ 4HH1A 4NLXA 1JLCA 3W64A 1VK8A 2G0IA 1Y4ZB 3PX4A 5HI7A 5KTQA 2D3OR 4KH1B 4U7UK 2L48A 4CO4A 3EDRB 4ZCIA 4GVBA 2B0GA 1IM4A 1RHJB 4P73A 2NREA 1TFWA 2WHOA 2P6SA 2IMOA 3QAUA 1LV5A 1HQEA 3C14B 2H5IB 2DKOB 3M2VA 3GPAA 3U02A 5H9EK 4ZVOB 4DV6J 2MQ8A 3AY0A 3QSIA 5KT5A 2HWHA 1WHWA 2ZNYA 3TUJC 4HT7A 3OXGA 3C66A 2HFNA 4RNHA 4LF9J 4O23A 3U1NA 5A76A 1N56A 4KV8A 1OY8A 1JWWA 4YY3J 3G96A 4F0HA 2DRDA 4NYZA 2GZOA 4WU2A 5BYSA 1VQKS 1Q8BA 5LMNF 4HTIA 2CWXA 3FJ2A 2RQ4A 3RAXA 3QZ8A 1SH0A 3TQEA 4OI4A 4M5DA 4ZMMA 2KM8B 1BQMA 3B78A 3WX4A 2W4CA 4LUBA 4PKDB 2F8EX 3NMAA 4Q0BB 3KG0A 4UOHA 5HANA 1WG4A 2UV8G 3AD7C 3NOCA 1BC6A 4OX9J 2ZKTA 3MUTP 3ILJA 3CO9A 3BDEA 5KFYA 1R0BG 1HHQA 2AP6A 2UXCJ 3WX8A 3POTB 1ITPA 4M5HA 2Y1IA 2VKRA 4LSZB 1SJFA 4U8VA 2QLJB 4HH0A 5B0DA 1FWKA 4IFVA 1NHUA 1KSPA 2CZVC 1FKPB 1S1WA 2FJAB 2QLBB 2HNDA 5KG3A 1EP4A 1G6BA 4UT4A 3G6XA 4OX7A 2DY9A 3EPGA 3HSGA 2M8HA 1S1VA 4QBUA 2FZKB 3GJQB 2CIMA 4F50A 1SKUB 4K4ZA 3LUYA 1XTZA 3C6UB 3N28A 2FDNA 2R2SA 2HGMA 3ZZYA 4RPFA 4NLUA 5HAOA 2GGPB 4H4OB 3LWLA 1R7IA 5C25A 4ALZA 5M2UA 3QO9B 3KNGA 4OL8A 2FHOB 4RW7B 4ILMA 2E29A 2BUNA 3MEDB 2DCUB 4BLGA 3CCSS 3BZQA 2HWIA 4E0DA 4M8LA 4OYPA 2HVZA 1S1UB 2XSFA 3CDUA 4QIVA 4C8OA 3CJ3A 2Y8YA 2VFVA 3NGDA 1YRUA 3OXLA 2X1AA 1PAUB 1TL1A 1HI8A 1HQUA 3RW7A 2E1AA 4H4KC 2WONB 4MJKA 3MEGB 3OR2A 3OTOJ 1A0OB 5L1KA 4PXBA 2UUWA 4YB5A 4C8MA 1UJ4A 2ZZTA 2HPUA 4N77A 5KFZA 2ACYA 4DCPB 3ONQA 2NCKL 2DB1A 2MKHA 5E3QA 2MKIA 2DHAA 5EDWA 1OSCA 4F26A 3CEDA 1Q8LA 2OUGA 1IKVB 5BR8F 1N5VA 1IBMF 1NEEA 1MNEA 1HNVB 4GRSA 2DXFA 2RQKA 2BRKA 1M5KC 1B64A 2J6TA 2B7BB 4LRCA 4NA3A 4DPWA 3HF5A 3LALA 4LREA 1Y0HA 3OLBA 3ULHA 3KLIA 5EHHA 5J1EB 3M1VB 2KL8A 3F73A 1HL6A 3HVTB 2GV1A 3R7NB 3CJ2A 3GU0A 1RDRA 2HS3A 3GYNA 2KM8C 2BX6A 2FC9A 4EEYA 2ZD1A 2I5JA 3QAEA 1WC1A 1QSLA 2OKQA 1T11A 5K20B 4DQRA 1S0MA 1WOSA 3TR5A 4ECXA 1H72C 3UR0A 3SMZA 1W25A 3D1QA 2W2MP 1DRZA 1RT2B 2HBQB 3DU5A 3UVJB 2QO3A 2MSTA 3A3NB 1XMBA 2BQUA 5KFLA 4CWBA 1UWAA 4KYZA 4RR5A 3MR5A 8AT1B 4P7TA 2JH3A 2ZBCA 4KO0B 4HDHA 2CQ0A 3IXQA 2XMTA 1SUQB 2AZ1A 1TL3A 3R5DA 3MAAB 2BJ7A 1S10A 1F0XA 3RG6A 4ZA1A 1M1HA 3W3SA 1QVGR 4ZLJA 1VC5A 3A8JA 1RT5B 2DNHA 2B51A 3OL8A 2YNHA 1WTFA 3PRVA 2X51A 2Z58B 2KXNB 3Q8PB 2MY8A 2V8GA 1F6TA 2PI5A 5KAKA 1WSVA 1JLFB 3AD9C 4LF4J 1YJRA 1IBLJ 3I55S 3MEEA 2CQPA 4X62J 4RL1A 4M1KA 4Y2IA 2JC0A 1X5TA 1U2CA 1V5IB 3P45B 3ILLA 2HHUA 1U8WA 2KI2A 3F41A 1TZ0A 3RBEA 1BGXT 2CADA 3D6TB 1R89A 1T9UA 4I2QB 4ZPTR 3ZNJ1 4O44A 2R4FA 2G1HA 3CCVS 3DYAB 4DR6F 1TVRA 5C24B 1NNDA 8ATCB 2G2ZA 3DN9A 2DY1A 3CPWR 5JJBA 2W7AA 4DN0A 1FJ7A 2DXDA 1Q81T 3P96A 1Q1KA 3TI0A 1CJVB 3VAFA 4IO1A 4RNFA 2ZC3A 1Z1ZA 3BB5A 2IA6A 3PO4A 3AJ1A 5D0GA 2HVIA 3MAQA 2KT2A 1XBWA 4I2PB 1JJ2R 5H9FK 5SZTA 4KTQA 4C0OC 1QM9A 3DOMA 3KLGB 5E3AA 4ECWA 3LP0A 5F0WA 4GKKF 2OH2A 1ACMB 2HQFA 5CH7B 4NE9C 4U7UD 4XDDA 2KB2A 3M2RA 2P6TA 4RLEA 3BN4A 1LXJA 2ZDPA 3W2VA 2GCFA 2VG7B 1S6PB 3DLJA 1XMOJ 2MEWA 2CQBA 4QWCA 4X84A 2Z56B 2L41A 2W2QP 2CPYA 4DPUA 2B56A 1M5VC 1B7FA 1R8AA 2RH3A 4HI1A 2D3O1 3QJJA 1UJ5A 1H74A 3GIKA 3DHWC 4ELVA 2D9OA 1MMDA 2KYZA 2CYYA 1RTJB 6AT1B 2DCLA 4HEA9 1WUUA 3D1OA 3O8WA 1Z2ZA 2LDIA 2V69A 2DIUA 1VHFA 3J7YI 4UUWA 3U7JA 4G1QA 1YIJS 2X1FA 5D4NA 3SSRA 2RU3A 3US5A 4PUOB 2QSFA 4R5PB 1LW2A 3G2XA 2CQIA 4NXNF 4IDKA 1E6YB 1FTRA 4KGMA 2CJAA 5IWAF 5AXLA 5HROA 1IVZA 1Y9OA 1RP5A 3V4IB 3M6XA 2DH8A 1WHXA 3R6LB 5K9FA 3BPDA 4LR8A 2IAJB 4YR2A 3Q89A 2FHKA 2ZM6F 2PE8A 2B8QA 4DV3F 4H4MB 3CGIA 4RW9A 1KNZA 1VYAA 2I0XA 2M9KA 3IWXA 4DQIA 1U6BA 1RT1B 4JV1A 4DU8A 2FJVA 1F9EB 3R5AA 3JSBA 1EX8A 2E9TA 1YLXA 3UN2A 5EN1A 1PIEA 2Q3PA 3ZNUA 2UV8A 3FSIA 3PRDA 1FESA 4W90B 4NEZA 1DAXA 4KE5A 2V8DA 2D9PA 3K2YA 4EI2A 3E51A 3NGSA 3CXCR 2XY6A 1GX5A 5KFTA 3KYLA 2V4JA 2VFTA 4TYAA 5CYMB 1KHVA 4MKYA 3Q8SB 2ZBIA 3A3OB 4NLPA 3J81Y 3J80Y 1RHRB 4CO5A 1UEUA 1QE1A 5CYQA 2MJNA 3FMWA 2Z30B 2BE2B 2J9DA 1D8ZA 3BKTA 2D3UA 1J5EJ 3MFIA 2V94A 3W1YC 4HYKA 4DSJA 4IO9Q 3PYGA 2DR7A 3GYGA 3ENAA 4WF9Q 1VQLS 4NI2B 4EBEA 3MMJA 5CZXA 3CCJS 4DI6A 5ETKA 1FO1A 5AT1B 5LM7E 1K1QA 1GH8A 4Y2CA 3R8YA 4GKJJ 2IM2A 2EEYA 4DR7F 3MCOA 4ED7A 3HHLB 1T3NA 2WBRA 3IGNA 2CWKA 5HBMB 4DSKA 3GV8B 3MZIA 4Q44A 2YY3A 3SBMA 1J5OB 4JI2J 4N5SA 2AYMA 2KH9A 2HEKA 1K47A 1YQHA 2PGCA 4DV0J 3HMJG 1FK9A 4J9OA 4M5GA 2YVSA 2BJDA 3EVMA 4GMKA 3Q2SC 4WFAQ 1PKUA 5LJ3Y 1N0VC 2HAIA 1TKTA 3W5XA 2ZH6A 1E6VB 1ULRA 1OIAA 3FZ2A 4TU8A 2HNYB 3OJSA 3TJ9A 1QAXA 3I4PA 5FDLB 3GZ7A 2CJKA 2X7IA 3J7Z5 4ZPVR 4LRFA 3HVWA 2CPHA 3ZTQA 3WHIA 1F9HA 1IKWA 3SQGA 3W9HA 1BY9A 3EPIA 1VQSA 3TA2A 3UN3A 3K5MA 2AX0A 4YP3A 1Q95G 5F8IA 4DR3J 1R0AB 1SQGA 2OMOA 2WCXA 4LF7J 3KHGA 5JVGQ 3MURP 3DLEA 4N47A 2WVDA 2I38A 2O67A 1N33J 4MK9A 2HBZB 3RTVA 2XCAA 4OQJA 3W61A 5I4MA 1TELA 3VV2B 3BBCA 3UPFA 2AIRB 4QPXA 4IKAA 2RJZA 4LF5F 4OI2A 1U1MA 2KN4A 2XZWA 3TARA 4LFCJ 4ZLLA 2CXEA 2RT3A 5C5JA 3MM5A 1PCAA 5KFNA 4B9VA 3ZTOA 2G2YA 2MKSA 4BWJA 1LWEB 1S0OA 4QW8A 3MPDA 4IFYB 2KZMA 4LF1A 5CYJA 2BM0A 4AYBD 3QSYB 1X5PA 3AJDA 4DFKA 2VL1A 3UD5A 4B9MA 4PQUA 1VRQC 3QGIA 3DI6B 3ITHA 3BGRB 4K8RA 1K73T 3GE9A 4QYZJ 4X66J 3ZXWA 1Q4RA 3KLEA 3W5ZA 1W2BR 5C42A 3LF0A 1VQOS 1RU1A 5AJ3F 4J37A 2LA6A 4M5MA 3AXKA 2YQ0A 4C4WA 4O3RA 5H1SV 1N5TA 2CQ3A 2CPDA 2GNKA 1T03B 4LF8F 1WF0A 1PJ7A 1AYEA 1U49A 2RF2B 1S49A 4FF4A 4DLGA 3TVKA 3KK1B 2DHSA 1GMWD 3PW7A 2ZHAA 5DS7A 3KLFB 2AGOA 1X5OA 2NYHA 5DZ7A 1R6YA 1LWFB 1RB0A 4WPAA 1X31C 4OHVA 1I94J 4EZ6A 1SJ1A 1YBUA 2GQQA 2M0GB 1D09B 4OJ1A 3HHLC 1GFWB 1YDLA 1MSWD 4I7FB 5IM0B 2YXLA 1ROFA 4FXVA 2GC8A 5IC4B 1KR4A 1YBAA 2DNNA 4ZCLA 4K4WA 1PILA 2DEIA 1Z4UA 3HDSA 4NMLA 1EETA 2H5EA 4YOEA 2NS1B 4I69A 3H5YA 4B9UA 3EMTA 4WK3A 4DV6F 2ALYB 2R8IA 3FQKA 3GR0A 2OHDA 3RAQA 3TAMA 3BKFA 4C48A 2CAJA 4RW4B 2U2FA 1OWXA 4N76A 1XQIA 3ETMA 3Q0AA 4C11B 4N56A 1SC3B 1XERA 2KU7A 1RADB 1APSA 4I67A 4YY3F 2RUSA 1N6QA 1ZH5A 3KJFB 2ASDA 4C3LA 4FS1A 2AW0A 4Y00A 3DRPB 5KFFA 4L3NA 4CH1A 4EUVA 3CCQS 1WD6A 3AOCA 1WC4A 4CT9A 4F4WA 2M5YA 1PSDA 1RT3A 4IR1A 1AROP 2JX2A 2ZHOA 1KHWA 2POKA 2WB1D 5HQMA 2D1CA 1YGYA 4ZDNA 3UQSA 3J81j 2E7VA 2K8GA 4B9NA 4ZJOA 1O5JA 4P2MA 2KHDA 2UXCF 3K5PA 1R27B 3P6YC 4DV4F 1NDPA 4JI6J 5GMDA 1W7WA 4NCAA 5KFVA 3C16B 1JJCB 1HWIA 4OLOA 5HK4A 4FBTA 4U96A 1V5VA 1F2GA 2G0CA 3QYYA 4F4ZA 1HHTP 3N4WA 1VQ8S 1T8EA 4QWDA 4F4KA 5KFPA 3HD2A 1T9YA 3OUYA 4JI4J 4LSLA 1CJKA 4OI1A 2XC9A 4USWA 2YNIB 3ELHA 2PMHA 3W9JA 4HL9A 1QAIA 3GFHA 1CSJA 2H1YA 4CLSA 4XO0A 1MG7A 2XB2D 1S1TA 1GNKA 4TY8B 4KIAA 2XBPA 4DQQA 5GADI 2MMYA 1S97A 1CVJA 4LRAA 1JKHB 1VQ5S 2GJFA 4DR5J 1X4GA 1TKXA 3M6WA 1UCNA 2G0JA 4DPTA 2XO7A 5KOXA 2M2BA 5DQHA 1XMQJ 4LFBJ 1HQEB 3ZZTA 1DTQB 2UXBF 1VDHA 5LSRA 2OPSB 5DGBA 3KFWX 2HQGA 4ID8A 4DSLA 5E2QA 3B4MA 4OYXA 1AW0A 3PM9A 4K59A 5HO4A 5LSLA 1JB0C 1F5CA 3OTCA 3ZFVA 2FLLA 3IG1B 1FWPA 1TV6A 4CZCA 3OTOF 3NL0A 4KHPJ 1IQTA 2A2DA 1RU2A 2W2PP 2ZJQQ 1XEZA 4X4TA 4P72A 4WCEQ 4DUTA 3VGUA 3Q23A 4JOUA 2W7PA 3R1LA 3MR7A 1KONA 3TA1A 2C2NA 3I87A 2J0QD 4G3IA 3KUGA 4ICLA 2DJWA 4LFAF 4EBCA 2BJ1A 1ZZFA 2L9NA 3HHKA 1OO0B 3PO5A 4Z7CA 3U1LA 3U27A 2HURA 4HHJA 2DGTA 1FVQA 4PZVA 3K5LA 5L1LA 4WWSA 5KT7A 3PIOQ 1PYSB 1IKXB 2O5DA 2YWKA 5HMZA 1GEHA 5J2PA 4YUDA 4FPIA 3CW2C 3TZYA 4K4YA 3MPVA 1KFSA 1SH2A 2SXLA 2QZ8A 4I6YA 4C9DA 1NAQA 2C2ZB 1F2HA 1RKIA 4CLLA 3TP2A 3QLHB 2EK6A 4TLQA 2HHVA 3DOKB 1UVLA 3EICA 4LR9A 4EK2A 2DH9A 4ZKAA 1HNXJ 3CULA 4DR2J 2XMMA 4ED3A 2DR9A 1C0UB 1UWBB 4DV1J 1WI8A 2FQQB 1VFJA 4J90A 5CD4A 2N3LA 4A47A 2XMVA 3Q83A 3HK2A 2Z2LA 1TR0A 4DPYA 5RUBA 2LA4A 3IP0A 4OFZA 2AV5A 1NK6A 2WSCC 4ETXA 4LSNB 5IC6B 1LQ9A 2AEFA 2XGPA 3CTRA 2BW7A 1S7HA 3IS9A 5B0GA 3RYLA 5FIIA 3SI8A 2XHCA 4X62F 2MKKA 5D77A 3CJ8A 2CVEA 1RT7B 3MM7B 4JUZA 4UOFA 2PMWA 4AFFA 1DTTB 1KRPA 2W24A 2GQ2A 2PI4A 4NLRA 3WBZA 1JQGA 1UL3A 4DPOA 1C1CB 5A0YB 2V50A 1D9FA 3LOUA 3LANA 1QD1A 2UUCJ 4B3SJ 3M8QA 5KG1A 5L38A 2DD8S 3OV7A 3R6GB 2GAGC 2EC2A 5IXUA 4HT5A 3HHLD 3SDEA 2V4QA 1LK7A 7FDRA 1FKAF 2G2OA 4P7VA 4CLZA 3QWUA 2HWTA 5HMYA 1KKHA 3M8SA 4DLEA 5F9NA 3TO8A 2F9JA 2JRSA 1UVNA 1RLDA 5HLFA 1Y11A 3GIIA 1RWWB 1N34J 2XWXA 1FRXA 2XHWA 4NLDA 4EO8A 4LBPA 2FTRA 2HMIB 2LKZA 2EI5A 3KLIB 3QZ7A 3OL7A 2YX1A 5BYQA 1HMVA 4AD6A 7FD1A 1ICEB 2YKAA 1RTHA 2RDJA 2W9AA 1UW9A 2I5JB 3OFHA 1VLOA 5JUMA 1YJNS 1V3SA 3V5RA 2Z0GA 2LEAA 5THWA 2FHJD 1AUDA 2OGUA 1P27B 2COLA 2RKIB 1Q78A 1FFWB 1OQ6A 2J0WA 2XLIA 3M8RA 2XMJA 3OPKA 2VFRA 3E3XA 4N8NA 4DOZA 4J9UE 1T02A 2CFXA 5E3RA 4ED1A 1IR0A 5MLCV 1XN9A 4P74A 2LXIA 4OZ2A 2J9EA 3CJKB 3MMAA 2CNKB 4JI7J 3THTA 1FEEA 2YNHB 1CS4A 1UA1A 4JI3F 1REVB 1RWPB 1X4EA 5F8LA 4OYIA 3E01A 4XPEA 2RDDA 3G4SS 1ZETA 4FF1A 2V2KA 2NXNA 2IJFA 5GMEA 4KPCA 3DRRA 1JNRB 2YKOA 1KLMA 2HZCA 4RW6B 3GFYA 1VS3A 3OSNA 1Q8IA 3W9IA 3BO4A 3UDCA 2R8JA 4ZVHA 3D6FB 4NASA 1T7PA 1RWKB 4IG3B 4LT6A 3PYEA 3L95X 4DFJA 2V9WA 3N5BA 2MGZA 2DPJA 3BEGB 1VQNS 1DQAA 4RWWA 3PXGa 5M2PA 4DCOB 1MMLA 3HD1A 3MECA 2VG6B 3N0VA 4A8OA 3M30A 2CNNB 3MMBB 5I42B 2DNQA 3HCXA 1X8DA 4NEYA 2BKPA 3ZC4A 3QFHA 2R2TA 2E7WA 1BD6A 5KFBA 3OVAA 1NMEB 3ZO7A 3O3LA 2I9SA 2QFJA 3I96A 4HLBA 2EG2A 2BV3A 3RBDA 1OPIA 4BHQA 1U6FA 1TK8A 2ZDOA 5K8NA 1UEKA 2FJWA 1WF1A 2JLFA 2HAFA 5A8RA 2ZOMA 1MW7A 4C98A 1IXKA 3IWNC 4R8UA 2UVVA 5A8WB 2KVQE 3C46A 1Y5LB 1FRKA 3K5OA 1SJ3P 3UW1A 4PWDA 1ELOA 3O1LA 1CJUB 3R5JB 1Q5VA 3DLGA 1NHVA 2B5JA 2B6AA 4ZP8A 1OQ3A 4Y2KA 3CO0P 4BS2A 4C0BA 4DV7J 3M7VA 3JYTA 2VQFJ 1J5EF 1FI4A 2UUAJ 3DGPA 1R31A 3DFEA 3P5TL 1JLQB 5FJ4A 4WFXA 3CE8A 4KGKA 2AYGA 2W8LA 1VHIA 2JFKA 5JXSA 1KS2A 5CCMA 5CXTA 2Q6CA 2DITA 5ETPA 4RUBA 1H0HB 2LFVA 4RW8A 4NLYA 2ZUGA 1SB6A 4GKJF 1VBXA 5KG5A 1S6QA 3NBPB 5J2MA 2MZ1A 4PG5A 4X64F 4NL5A 2J9DE 5T41A 2JWNA 4G1QB 4JI2F 4ECVA 2Y1JA 1MU2A 2JJ4D 4OI3A 5CHCB 4CO1A 4DV0F 1LW2B 4N41A 3GG1A 1AA1B 4R25A 1PG5B 2B9EA 4IDKB 2DHHA 3I4HX 5HP1B 3FSXA 1BQNB 2DXEA 3EXYA 2VQEJ 2DTJA 2F5GA 2HFZA 4KC5A 3M8YA 2MXYA 2W9CA 5A6PA 2VOOA 4DEZA 1LK5A 2WVEA 5ETTA 1EKSA 5ITHA 1EIYB 5AE3A 3TUPA 3FDSA 1CQMA 1HYSA 2KRBA 3DM2B 1JLBB 2R9LA 1T0TV 1M5OC 2A6OA 3CDEA 3HLUA 2EFPA 2QN6B 3H5UA 4WE1B 3G8TA 1DJ0A 3ENWA 4A8WA 4FNIA 4DR3F 4URSA 3SV4A 3OHBA 3RR8A 3ILOA 3R7BB 4DL5A 2F4FA 3JTPA 4LF7F 4B9TA 1OSDA 4QIFA 4EYHB 1N33F 4A48A 1L3VA 5KFQA 4O0IA 2GIRA 5DO2A 2AJ1A 5L9XA 1L3KA 3BSNA 4HKQA 2Y1LB 4KAIA 2F63A 3AQPA 4IOBA 2XM3A 3NRBA 1NDLA 3NXZA 1JLEA 2R8HA 1SV5B 3IM9A 4IOCQ 1UETA 3DMJA 5CYQB 2YNFA 1IBKJ 2GVZA 4ECSA 4ZHRA 1N5YB 3MMCA 3RR7A 3W8PA 5K8PA 4ILLA 2R7TA 3G82B 5KG4A 2PFDA 1NO8A 1U1RA 4C3MA 1QDUB 1H73A 3LP1B 7AT1B 1V3RA 2GVDA 1RK8A 2QMWA 4TQSA 4DUYJ 4DF4A 2CKWA 2JVOA 2OPQA 3PYDA 3IRXA 3I0SA 1R3NA 4E98A 3RRGA 3EGVA 5J2QA 3RW6A 1ZBTA 3Q8RB 2NPFA 1S48A 5D78A 2KHCA 2YWHA 2ZOFA 3PNIA 4DZDA 2HVDA 4KB7A 4RBTA 2UVUA 1VRTB 4RX6A 1VQ9S 3THVA 2OFGX 4NMXA 4YDXA 1GAOA 3KMQA 4NRUA 1U6ZA 4CYUA 3QRRA 2FVRA 3NKYA 1HIYA 2VASA 4HDGA 1T95A 3CSKA 4J91A 3BV8A 2MSSA 5MAOA 2IRUA 1S9EA 5KT3A 2QL9B 2DK2A 2H54B 4BC7A 2CA9A 2MQNA 2MLZA 2VH7A 3D0IE 4KJIA 2BANA 4F04B 4ED0A 3JSMB 2ZWPA 3EE3A 2AJFE 2CJXB 1EQ0A 5E3CA 4DL3A 1B4SA 3LGHA 1RHUB 4GVLA 2IC3A 3QT8A 1IKWB 2BYCA 1JX4A 1VJWA 2DR6A 1NJZA 4FNHA 2AEMA 4ZN1A 2FJXA 3L4BC 2ZWOA 2ZC4A 5L9NA 3HO1A 1BQXA 2V2VA 1LFWA 4JYAJ 4PXCA 3G8QA 2CPZA 2EVZA 3WIUA 1NH7A 1KDNA 3K57A 4CT8A 1ZAWA 3HKWA 4QWEA 2ROPA 2ROGA 4ZPAA 2AMCB 2YNGA 2RRBA 3NNHA 2MQMA 3ZZOA 3P5BP 4ZOSA 3TAPA 3I0RB 4OI6A 3F56A 3W65A 2E7XA 1U8SA 3BREA 2DGSA 4E2FB 4ZP7A 4IRCA 4NOHA 4TU7A 1CLFA 1SH3A 2AD9A 4YQWA 2MJUA 2HHXA 4CRJA 3R97A 3MDFA 3PHTA 3ZZPA 4O0NA 4XDCA 2YX7A 3FBFA 4KKOA 1Q0NA 3RB6A 2E1CA 3GP9A 2J7UA 3OFEA 3VHQA 4IOAQ 2VG5A 1FD2A 1U45A 2Z4PA 1WHYA 1S9GA 4PQUB 2CZ4A 2XEXA 1M90T 2KT5A 4JI6F 3RRHA 3MEKA 2PSZA 1H98A 2LXUA 3MOZA 4ZLNA 2FHMA 3T1YF 3TVYA 2RUGA 3PR5B 2ZNZA 5T7LA 4OI0A 4ZIWA 3MM8B 4M5IA 4OX8A 3CJQA 1CJTB 4B08A 4OV6A 1YKWA 2ADBA 1LWCA 3FQLA 1AT1B 1Y3JA 3D68A 2CNOB 1Y5NB 3CMAS 4WFZA 4IG0B 2HIQA 1C4CA 3H5SA 1F5BA 2J7KA 3MM6B 2V8HA 2XMWA 3R1HA 3IBWA 3ISNC 4ZVQB 3C6TB 4USMA 4LVOP 2PA3A 3FBEA 5F3ZA 3M4XA 3IWLA 2DGOA 4F2RA 2VJVA 2B7CB 1M5HA 2AZ3A 3Q86A 2C3YA 1OYDA 1AB8A 1FE4A 3NGUA 2EBGA 1IR1A 2WZ1A 1VRUA 2O66A 1N5SA 4DR5F 1WOOA 2OD4A 1HI0P 3CT9A 4NLVA 2OJ3A 1JXEA 3DRSB 1QAJA 1XMQF 2VF3A 4LFBF 2V9KA 1QVFR 4J9SA 4Z37A 2O01C 3ET6A 3VAJA 2JZ5A 3P3DA 2XI3A 2K7KA 4PYDA 2UU9J 4IH6A 3TQ1A 1GMVA 2JOQA 3C14A 1BWEA 3N79A 2OPRA 2XTJP 1F3FA 2Q1LA 2F65A 2UXDJ 1LW0B 4GO7X 4OX6A 5HJYA 4WIQA 4MFBA 2BDPA 3HZGA 4NLQA 3VVUA 2RSQA 2W25A 1I6JA 1SQEA 3BSAA 2HFSA 3IGVA 4FVMA 1HI1A 1N6QB 4FYYB 3KJNB 4ANEA 1R8PA 4LF6F 1UZDA 4EWTA 1IUJA 2ZITA 5IQ6A 3TVZA 3I5AA 3G86A 3MGJA 4NCBA 3UO0A 3KTQA 2FUG9 2AYBA 3V6DB 4F7VA 5KG0A 4O3PA 1CULB 5EUHA 5DQIA 4GO5X 1XR6A 2F1FA 2L3MA 4Q0BA 1S1XB 1RSCA 1HBNA 4K7QA 1L3SA 3OR1A 2XS7A 3B82A 4DL6A 4LBHA 3HPOA 1H38A 3JSRA 1Y00A 2QX0A 4I1TA 2VZ9A 4USUA 5KFDA 2RS8A 3KWMA 5DJBA 3AH6A 2DYAA 3POTA 4K4UA 4U67Q 1FRIA 2MZJA 5A8KB 5D4OA 4X65F 1M1KT 3R5CA 5JVHQ 2VPXB 3LO3A 2BA9A 2GMLA 2ADCA 3Q22A 2R2UA 1RWUA 5F0UA 1FKPA 4RU9A 3QQCD 4OZ3A 3HP6A 4CTAB 5KOWA 2QMXA 1ZM9A 2BW2A 3G87A 1HNXF 3OT9A 4CCHA 3T3FA 3K8VA 2R7VA 5LSOA 1WJ9A 2W01A 1RBOB 4Y0FA 2C3OA 3C6UA 2FVPA 1ZM2A 2HFOA 2CQCA 5IT9U 1PGZA 3UR3C 3UI3A 1T05A 1U1LA 4URQU 1JMTA 2OP5A 1TKXB 4Q2LA 2NQPA 5LJ5Y 2ZVSA 3QO9A 3DGVA 1VLYA 4RW7A 1EB0A 2DNLA 1TUGB 4P2FA 3FEXB 1EKRA 3MI7X 1AFIA 4ZVTB 5KFSA 1Q82T 1S1UA 2XMUA 2DISA 2ASYA 4HACB 3Q8YA 1K1SA 1FRMA 1EZZB 3R5GA 4IH7A 4F67A 3QMQA 3MD1A 4OHYA 1H2VZ 3JS9A 2V2ZA 3MEGA 5KFKA 3L7OA 4B17A 2GO9A 3EUNA 3H4DA 4LIRA 2MZSA 2VD3A 2R7RA 1QLNA 5GAGI 3HI9A 4Y2MA 2V0NA 2ZZMA 2FZGB 3DNCA 3TW0A 1C1BB 2ZVIA 2QYGA 2XSJB 5EX3A 1FWLA 4EMDA 4YDDB 1H2TZ 5LMUJ 4NRTA 4RUAA 3CJ5A 1NJIT 2C2OB 3CCMS 2KXFA 3BYRA 3LGNA 2R2RA 1YI2S 5EGYA 1M5SA 2HYIB 1IKVA 1GK8A 4PABA 1M0SA 2GX8A 3S7RA 2E5HA 1N34F 4A8MP 1HNVA 1D0EA 1HNIB 3CJ0A 2RS2A 2Z2YB 4TLRA 4AQYJ 1JJHA 3KDOA 1V6HA 4ZS6A 2W8KA 1HBMA 3T1AA 5GAEI 5J1EA 3TZZA 3Q24A 4RUCA 3M1VA 5DDOC 3PCOB 3G71S 3HVTA 1RACB 2FLPA 2HQ3A 3O44A 1VR6A 4PR6A 5E33A 3HVRA 2HRTA 1I1GA 3AA8A 3W2WB 2RHSB 4NXMJ 3S6EA 3TAQA 3RUBL 3H25A 4I4BA 4G6VB 3NS6A 1ZM3A 3U1MA 5HMWA 3D0GE 4DL0C 4EZ9A 1MROA 2V2QA 3UVJA 2UUBF 5B7WA 3D3BJ 5FLXU 1OJ4A 1I51B 2CUYA 2RRAA 3T9NA 4OYOA 5HN0A 3FRZA 3RZAA 3AA9A 4DFMA 3ZTRA 4KO0A 4UTGA 4ANDA 2HZAA 2P5VA 5B08A 4TQRA 4ZPCA 4JI7F 4MYUA 2IM0A 2VONA 3HFKA 3MAAA 1U1NA 4OV1A 3GONA 4CM0A 1RT5A 4BBYA 2OPPB 2EG1A 3KK2B 4X4QA 4P75A 3K5NA 2LECA 5B0AA 2H48B 5HL7Q 1JLFA 2CJ9A 4HI2A 1BUXA 4QZVB 4CP5A 3ISND 5E3PA 3LP2A 1QJHA 4G1PA 1RAFB 1DHMA 2E1RA 3HHDA 4YB7A 3NCRA 4M5KA 4JBCA 5K14B 3TJ8A 4DUZJ 2FVQA 2NUHA 2HKEA 2IBOA 5EWEA 2JC1A 1GXLA 2CG8A 3DYAA 3CB4A 5C24A 1RTIA 3L9ZA 5ADZA 4K4TA 3J7AN 4DU7A 5ETQA 4I64A 3QNWB 2CJBA 4OZLA 2ACMA 3KJVB 1CJVA 1X4FA 4DCJB 2J6UA 2Z8QA 5BYRA 1NDCA 1IBMJ 2HQCA 1SBRA 3LTOA 2BE9B 1SC6A 1WSRA 3IO1A 3AXMA 4I2PA 4Q8FA 3T5KA 2BRLA 4J9NA 1U2FA 1FDAA 1VGYA 4JI0J 3WC2A 1PYTA 4K4SA 1YJTA 1FHTA 1N88A 1S4EA 5IS2A 3D7SB 2PEBA 3BR9A 2JL9A 3DDIA 4ECUA 4A8KA 1RKJA 4J9LA 5G4DA 4K5RA 4ZPDA 4CNZA 1RWOB 2UVWA 4DV7F 2P9GA 2VG7A 1S6PA 1Y5IB 2UUAF 3MCMA 3FC9A 3HHNB 4USKA 1NK9A 3BM7A 4B3RJ 3PACA 3C15B 3QIPB 3DLLQ 4DZ6A 4AL7A 1GX6A 3K7RA 1B3TA 1RTDB 3QGGA 1HBOB 4USVA 1A9NB 4UQTA 1KVJA 3LGMA 1FDBA 1B70B 1DLOB 1RTJA 3BSOA 2W4DA 2W9BB 3NCQA 2B43A 2IDLA 2UUTA 4Z2XA 2ZH5A 4DV2F 4JV2A 4C8YA 4WYWA 2MHEA 3GCXP 2CVIA 3I31A 2HHSA 4DBQA 1NUEA 8RUCA 2YX4A 2E5JA 3PVXA 4ZPBA 2EFVA 1FEHA 2MLYA 1KLMB 4PUOA 4FBUA 4R5PA 2VQEF 2HFVA 3PW0A 4OYAA 3KUHA 2YBVA 3VGSA 2IIHA 1H3DA 4LJMA 4FXWA 2JVRA 4I6AA 2QL5B 4DFPA 4ZVGA 3MM9A 3V4IA 4O3NA 1FJGJ 2KO1A 4PQAA 1MN7A 1HW9A 2IAJA 2MGZB 3AJ2A 3CJ4A 3HJVA 2MY7A 4FXDA 1YTYA 2KTQA 5K5MA 4I68A 3OBIA 2MZQA 2NSCA 5KFIA 1S9FA 3TRGA 2AGQA 3IR6B 2HS0A 5IOLA 3BH6B 2J8AA 2CJYB 3MR2A 2A3JA 3OVSA 1SIWB 2GFFA 3BBFA 3JQKA 3ENVA 3PKYA 2MZTA 2OEKA 2IPOB 9ATCB 2AJ2A 5B0FA 1FERA 2E5GA 3AQOA 3IFEA 3SCKE 1G3OA 4Q2MA 4MK8A 2ZEJA 2DNYA 2VDIA 3IC1A 1YJWS 3MD3A 3W7BA 1S12A 2YQ1A 5CYMA 2B5JB 4RWXA 2MLXA 2IVYA 3AB4B 1X9WA 3R2CJ 2BXJA 3FFIB 2CPFA 3MR3A 3M8ZA 5A6WA 4ES3A 2F40A 2E5LJ 1X60A 4ZVFA 2EFQA 1UJ6A 3DGPB 2AHOB 4ERDA 1VQ7S 2A0FB 3QGPA 2CDQA 2YH0A 3FKBA 2JLEA 4WP3A 3PJ9A 2BACA 2CJQA 4WZMA 3CIZA 1HD1A 1BHNA 2GHWA 3SZ2A 3TA0A 3DKDA 3VAGA 4NI2A 2ZKUA 4JV0A 4AUKA 3K8WA 2CQHA 1RCOB 2MHNA 3LH2S 1OMSA 5J2MB 2W2OP 1ZA1B 4QR1A 3GSIA 2IRYA 1CC7A 3OL6A 4O4GB 3Q8UA 2FGCA 5HBMA 5KG7A 3JQMA 6FD1A 2OEJA 2YKMB 4L74A 2C22A 1ZPWX 1KD1T 2RVJA 3GQCA 2WW8A 2ATLA 2DHGA 4URGA 1ZTWA 2W9CB 1T94A 4P10A 3M2UA 2GJIA 1XNQF 2FJDB 4PYAA 1RISA 1X0FA 1E6VA 1SKWA 3BGFA 1SKRA 1BXNA 2HNYA 5KG2A 1CBKA 2DGVA 4K4XA 2FIUA 2M3DA 3DLKB 3N5FA 1XC9A 1HYSB 2B9WA 4XTTA 2VUGA 3THPA 1QUVA 1FKOB 1SL1A 5FDLA 1UA0A 3PR4A 3CD7A 3JQJA 4NLTA 4C6AA 3NAHA 4OZNA 1VBKA 1RT4A 2RD5C 4J9MA 1HWKA 1R0AA 3FCHA 2Q43A 5F8NA 2RQMA 3NOGA 2PMZD 2R8KA 2FHJA 2K1RB 5KG6A 1T3OA 2AGPA 4S0MA 2F9DA 4Y65A 3CDAA 4EU0A 1B0TA 3J7ZT 1VQ4S 3BDPA 4CLFA 2AT1B 4IRDA 3KK3B 3W62A 3CMQA 3VZIA 1UP1A 3KUEA 4JI1F 1JLEB 2WOMB 3I9V9 4PAAA 1NRKA 5D4PA 1NK8A 3CJSA 5DGAA 1HPZB 3PIPQ 2KXHA 2YNFB 5IV4A 1SCJB 4ZHRB 4ECRA 1NKBA 2HLTA 4B3OA 2C1EB 5L8RC 3UD3P 5LOQA 3CD5A 3EGNA 1YITS 4IFYA 1F5AA 1YWXA 2A18A 4BDPA 1I3OB 1L3TA 4FVCA 1RJJA 3NS7B 5DETA 4ANCA 2HVHA 2RMLA 4RZRA 2I6WA 2GMHA 2C42A 4DG1A 3QATA 1NKEA 3DOLA 2XCPA 3QT6A 3IRXB 2HSEB 2CG4A 3BGRA 4X4PA 1N32J 4CIOA 2AJ0A 5I3QA 5AXNA 4F25A 1WI6A 2ZE2B 3S1TA 2C28A 1J27A 2GA7A 2OO4A 2JEFA 4F36A 2RF2A 1TQLA 4ECZA 4OZ1A 3KK1A 3UDVA 2KJWA 1VBZA 4O4RA 3KLFA 3BSCA 3RJMB 1S9EB 1LWFA 2N3OA 2B3TB 1KBRA 3D4JA 1Q7LB 3N6MA 3UN5A 3FK4A 1L5UA 2UP1A 4ELTA 3C8YA 3TANA 4LMZA 4I7FA 5IM0A 3TUZC 1ZOTA 2R3VA 3PV8A 3Q8QB 3KNAA 3KKFA 1RXOB 3J7YU 3IR7B 5H9EJ 3BN7A 2UU9F 4YHHJ 3DRXA 1RHKB 2P2CB 2NR0A 2LQ8A 4AT1B 2MQOA 2UXDF 5L39A 1V3ZA 3TZXA 2X1GA 1U48A 1FDDA 3V6JA 4TY9A 4LVNP 1C0TB 2VA3A 4C8NA 4ZIVA 1WTBA 2QC3A 4AL6A 2IM1A 2LYVA 5CCLA 4OJHA 1K9MT 2XO6A 2YKNA 4FPRA 3CCWA 3TNVA 2VKZG 2VC0A 2YNGB 2M8DB 3K0JA 2CQGA 1WC5A 1MN9A 4LRBA 1FT8A 1LOUA 4QU6A 1IWAA 4IYQA 2N7CA 1P8GA 1TMMA 1H2UX 2C2MB 1HNZF 1NJXA 4F3MA 3DRPA 4KY3A 4CLYA 3V81B 3JXOA 4IR9A 2DHXA 1SL0A 4WYLA 3W8GA 3CNQP 2Y9HA 4QCLA 5DM6Q 2D7SA 3K17A 3VWSA 2FC8A 3W66A 1XIQA 4F0KA 1IKYA 3HM9A 1GQEA 1HR0J 4JV5J 4RNMA 4UW2A 3HSZA 2KT3A 1IM6A 3C16A 2YH1A 5B0BA 2OMLA 1X9SA 1N0UA 1NB7A 2DNZA 2K3IA 1HKAA 4X4UA 1KVIA 1BE4A 4OZJA 3AFGA 5M2RA 1NXIA 3PHEA 4MIBA 4WFBQ 2RU9A 1FX4A 1MMNA 2HLUA 4DR4F 5I3PA 2HNZB 2YNIA 1PAEX 4NWBA 3BS9A 2F8HA 4ZLPA 5HVFA 4ED4A 1FJCA 4TY8A 1G2EA 1VRUB 3SCLE 4YN3B 1RZMA 3BQ0A 4AL5A 1JKHA 3CWJA 4PWUA 3NY0A 2OTJS 2MYFA 2WVCA 4FZVA 2D74B 1MWYA 2OELA 3VAHA 3M6VA 1CG2A 2HHPA 3GIMA 1U4BA 5AE2A 1U0HB 3ET6B 2C2DA 2P8IA 4ILRA 2QIFA 3EJMA 3ZZZA 3HFVA 1DTQA 4NPOA 2OPSA 2OPRB 2V8PA 2HGLA 1UKUA 1N36F 4LQ3A 3QWPA 4B3TJ 5IT9Y 5KFJA 3T1HF 2FLNA 3BGLA 2BJ9A 4KFBA 1DFDA 2BQ3A 3FCVA 1VQMS 2Z2ZA 3IG1A 4MFBB 2HK3A 3W5YA 1U26A 4Y34A 3NGTA 2XGQA 4MIWA 4ZP9A 1TFYA 1WACA 1S5ZA 2YWGA 3BYPA 2GIQA 1UPMB 2HHHJ 1LXNA 5LMUF 4L72B 1NK7A 3DC2A 1HNWJ 3GJRB 5GAHU 4LBIA 2CPEA 2YTCA 4ID5B 3DCAA 2HRUA 3M32B 1GXTA 2JLGA 5CABA 2GW8A 4L73A 5HQLA 4ZCKA 3G6ES 1VJQA 3KHLA 3EZUA 3H8YA 1CEZA 1WORA 3QRQA 1PJ6A 2VICA 4LF9F 1HBNB 5K8MA 4AQYF 3OR1B 5EWGA 3CJTA 1RCXB 2RILA 1WKJA 2ZUAA 3PW2A 1KTQA 3A13A 1K0TA 3GG0A 1YSJA 3CMES 1IKXA 2HK2A 4RKUC 2KZZA 3EGZA 4DV4J 1SQFA 2OTLS 1SI9A 2L9DA 2DNGA 1FNXH 2AX1A 2VPZB 4NXMF 3GJSB 2NXJA 4J9VA 2BR0A 1FFGB 3SFGA 3GIRA 3CIMA 4OX9F 2E5IA 3RBZA 2A10A 3QLHA 3SFUA 1LNQA 3DOKA 3H59A 4YB1P 2Y1RI 4ZPWR 2UVRA 2MTLA 4FN5A 2ASJA 3PKMA 1M1GA 2CQ1A 1A6LA 3SCJE 5D3GB 1UVMA 3P4UB 2ZH3A 1FX2A 1HQ2A 2HGNA 1DZ5A 2XQCA 1C0UA 1UWBA 1N5QA 1S72S 4U8YA 4Y3CA 5HVHA 5BJRA 3PTWA 2QV6A 1TKZA 2MZRA 1T05B 4F0MA 3GLJA 3BF4A 4Q43A 1UZHA 4WP8A 4OJ3A 4QYZK 4F3OA 3IN5A 2DEJA 3JTOA 5J2NB 2RIJA 5DZ6A 4LSNA 1AZSB 1NDKA 1KFDA 5I3UB 4GC7A 2DNRA 5FLXY 3NNCA 2A6MA 2ZJRQ 5F9LA 2H65B 3CCRS 4DS5A 2ZBRA 4CM2A 2Q6BA 2UXBJ 1U24A 4UF4A 4KBIA 3TYTA 4MKBA 1PC4A 3V6HA 1JLCB 1UTAA 2XMAA 1RT7A 3MM7A 1H6KX 2E66A 1RWXB 5DRKA 1JLGA 2ZJPQ 4CLUA 1DTTA 4DHVA 4OHWA 4C2MA 4ZK7M 1NSAA 1OYEA 1N4LA 4DUZF 2IJRA 4GVBB 2HHTA 3SIPB 5KFRA 1C1CA 2BJ3A 2VDHA 2AKWB 4YFUA 5A0YA 3EDQB 4Q7AA 1AUSL 4YB6A 2NLWA 4CI0B 3M2VB 1Y3KA 2QRRA 2J8SA 1R8BA 4UY8T 2QE5A 2ZH2A 1D1UA 1SC4B 2BJ8A 5H9FJ 1BMQB 4LFAJ 4AE5A 3RRKA 2DR5A 2FD2A 4K2JA 1RLCL 1U09A 2QGFB 3KLHA 3FMBA 5LT5A 3EXCX 4Q5VA 4W98A 2ZZNA 3FEZA 2PN6A 4QIEA 4KV8B 4PXDA 4JI0F 4ED6A 2HMIA 1HBMB 2M52A 2EWHA 2DNKA 1URNA 4K50A 2J76E 4A8XA 3UE2A 4U95A 2V68A 3T9ZA 4YR3A 4M5DB 2XYHB 4CO2A 1BQMB 1KQKA 2QA4G 2KG0A 1P1LA 4NLSA 3GV5B 2Q79A 4X4SA 3JB9k 3B4DA 1S79A 4CH7A 4ES1A 1FRLA 1MROB 2ZFHA 4P71A 4B3RF 4EBDA 4UOCA 3LPEA 3F0NA 4M95A 1Y10A 1S77D 2RKIA 4IFVB 1WC3A 3ZTSA 4P6QA 1YRTA 2DH7A 1S1WB 4W4MA 3OSPA 2HNDB 2WSEC 4WXWA 2B9XA 1EP4B 1L3UA 2B4PA 3QT7A 4RU2A 1D8YA 2VBYA 3CJKA 2VHGA 2QL7B 4IUFA 1S1VB 3KMSA 3PX6A 4MAKA 4YEAA 5DDPC 3CCLS 1REVA 4WXOA 4YR0A 1X4DA 2OEMA 3FGVA 3G8SA 1YRXA 5DLGA 3S01A 4DX7A 1U1OA 3KHHA 4FKYA 2HBRB 1NB2A 3T6JA 3LP2B 4RW6A 5C25B 5DM7Q 1K8AT 1S99A 5U47A 5GADU 2JFDA 3AAWB 2PT0A 3UFCX 2AJQA 1D9DA 1FJGF 1FRHA 4DR1J 2LCWA 4J9KA 4JI5J 1NJWA 4X2BA 4IG3A 4DL7A 2K06A 3CC4S 4LF4F 3PDNA 4MK7A 4B3MJ 3FZBA 1IBLF 4XIUA 1RTIB 2VC1A 5E7OB 3OLAA 3MOJB 2HFUA 4RUHA 2CQ4A 5D6GA 1YJ9S 1TL1B 2VG6A 1HQUB 4ZJQA 2H51B 3I5CA 4UY85 4DWIA 2J9CA 3MMBA 1T9XA 4PG8A 5I42A 2C3MA 4A8QA 2IVFB 4PG4A 3OR2B 5LL6d 3OJUA 1R8HA 3V4MA 4M5LA 2F3JA 2HHQA 2VODA 1Q53A 4DQPA 4EFAC 4TNOA 4JB8B 3ILIA 1UPPA 2LQ9A 3GV7B 5GMKa 5A8WA 2QLXA 2C2KB 2E44A 1WDTA 1RE1B 1CJUA 3FBBA 1KWMA 1VOMA 3KHRA 2HW3A 4NZ0A 1AXQA 2E5LF 2R7WA 3TOQA 2XYGB 1K44A 1DQ9A 2D69A 3NP5A 3VAMA 1VC0A 2YPYA 3IA0A 2YPZA 2KG1A 2VV5A 3HT0A 3R7SB 2PDAA 1GTEA 1KVKA 2ZH1A 2OFHX 4ED5A 1JLQA 4QWAA 1WG1A 4USTA 4Y6IA 5KFMA 1UEVA 5CAAA 5FD1A 4J9RA 2R7QA 2W1BA 4X4NA 2ZD1B 2W4PA 3BO2A 1RT6A 1XMOF 1N8RT 3CC2S 3L7UA 4A8FA 4MH8A 3QPIA 2R7UA 1U1QA 2BEFA 4JI3J 3NBPA 1HA1A 3AT1B 2LQBA 1SKSA 1TK5A 5ETOA 3OQ2A 4UZCA 3OL9A 3KLVA 2XS5A 2QTWA 2IFXA 2R7OA 1TL3B 1GT8A 3X3UA 3D5MA 3VQSA 5CZVA 3N01A 4P52A 3I32A 5HP1A 1TTHB 4WBFA 1BQNA 2KFYA 3MM9B 4JP8A 2QSWA 2F4VJ 2APOA 4WK1A 2QA4S 3Q2TC 4TU9A 3MPYA 2P9CA 3MEEB 1IJEB 2LMIA 3UCGA 3DM2A 1JLBA 3I6PA 1W26A 5EX0A 3S8SA 4F4XA 3VF0B 1IBCB 4WE1A 2DRAA 2V8VA 1TL5A 2N7YA 4C8KA 2P9EA 4ATNA 1IR2A 2EXUA 1KTVA 2CRLA 3SYZA 4PCQA 1PBAA 1FXDA 4O44B 4ELUA 1TVRB 3CJRA 1FE0A 2FVSA 3C19A 1X5SA 3SCIE 1A7GE 1X4BA 3JAMU 4DSEA 4PWWA 1PBUA 2KYXA 1R6VA 2EBEA 3H20A 2EC0A 2O1PA 1SJQA 2EFGA 1I5OB 1ZPVA 2EW9A 1SV5A 2OI2A 3QRPA 3F44A 1RAAB 1YJ7A 1N5YA 3G82A 3A3PB 3HXMA 3B6BA 3DOMB 1T9TA 3L3CA 5AXMA 3PEHA 3LP0B 3LP1A 3R5BA 2AYEA 2DGWA 1WKLA 3HSJA 3M2RB 4C97A 1ZAXA 5L46A 3M9OB 2HRYA 3LPYA 3W2VB 2OSQA 3EZOA 1FDNA 6FDRA 1B0VA 1N32F 3A8EA 3I9ZA 2BKNA 4MT1A 3EWGA 5DG7A 1RBAA 3CVKA 4OYZA 3MAHA 2HQIA 4GC6A 4R0EA 1T9WA 1X7VA 1UVIA 3HSDA 2LP4A 4X64J 1VRTA 3PJWA 1FXRA 1HHSA 3CCTA 3EGWB 2I8EA 2CQDA 2QA2A 4B9LA 1TU0B 4KHMA 2BBEA 2WAQD 2GMJA 1UFWA 1KEKA 3BKUA 3M2UB 4JI8J 3VALA 1R0CB 1YBTA 3OVBA 4PPZA 1SJRA 4WKRA 1VQYA 4QU7A 2PEHA 4M5JA 1LWXA 2ILYA 4DMZA 2H4WB 2V5HG 4I56A 3JSMA 1S6UA 4YMEA 3HULA 3PRBA 1N52B 4YHHF 3DXBA 2I1RA 4WIIA 3DDKA 5GAHI 5HROB 3EYZA 2BOPA 1U47A 1RT4B 2PA8D 4DS4A 4HHUA 5IT4A 4FKXA 1FF2A 5IV3A 2XI2A 4OMFG 2HZVA 3E8OA 5KT4A 2C3UA 3ZZ0A 4OLPA 2DNMA 4RW9B 3DLBA 3CCUS 5E0OA 4Z7YA 5G0RA 1YVFA 3I0RA 5HMXA 3K58A 1NSKL 3W60A 5EWFA 4B3OB 1RAOA 1KP6A 4EYIB 1CPZA 3X1LB 1N48A 4TN2A
chains in the Genus database with same CATH topology
2WSCC 2AGQA 4ETXA 3UCZP 3IR6B 4Y28C 2BQRA 2HS0A 4LSNB 1ZM4A 5D3GA 1LQ9A 2L9WA 4MMOA 2J8AA 2XGPA 2WTFA 2V4JB 3CTRA 2EK1A 2DGUA 4CO3A 3MR2A 1LWCB 2A3JA 3OVSA 1SIWB 3CCZA 3GB0A 1X9MA 1S7HA 3IS9A 4DG1B 1HR0F 1HBUB 2GFFA 5B0GA 4KPYA 4JV5F 3MCSA 4FP9A 3ENVA 3HX9A 3RYLA 5LXRA 3PKYA 3DOLB 2MZTA 5DDRC 3UCUP 1N54B 3LAMA 5FIIA 4LFCF 4K0KF 3SI8A 2PD1A 1DQ8A 5B0FA 4NZ6A 2NSBA 3HHEA 1VIXA 4X62F 3QJLA 2MKKA 4CO0A 5D77A 2CVEA 1RT7B 5KFAA 1NK5A 3MM7B 1FERA 2E5GA 3AQOA 4JUZA 3UDLA 4EO6A 1QE1B 2UZAA 2DGXA 2M4MA 3IFEA 3MM8A 3SCKE 4AFFA 4WKYA 1DTTB 4KT0C 1G3OA 4G1IA 4Q2MA 5J2NA 4MK8A 1KRPA 2W24A 3QIDA 2GQ2A 2PI4A 3GILA 4NLRA 2DNYA 4NCGA 1UL3A 3WBZA 4U7CA 1NZAA 3IC1A 4WFNQ 2LEPA 5I3UA 1YJWS 4DPOA 4NLGA 3MD3A 5DG9A 4P2SA 3W7BA 4J9QA 1C1CB 5CYMA 3G9CA 2FJEB 2B5JB 4RWXA 5LXYA 5A0YB 3T5JA 2IBKA 3AB4B 2IVYA 1D9FA 3LOUA 1X9WA 3LANA 4NA1A 1FA0A 5CA5A 1JXLA 3T6BA 4QPTA 1NU4A 4IG0A 2A2CA 2BXJA 2DVIA 3FFIB 1KQFB 2CPFA 3M8QA 3MR3A 5KG1A 5L38A 2DD8S 3MM6A 3OV7A 4HH1A 5A6WA 4NLXA 1XR5A 4ES3A 1JLCA 2F40A 3C6TA 5IXUA 1VK8A 4HT5A 3HHLD 2BVZA 4ZVFA 3SDEA 2EFQA 2V4QA 1Y4ZB 1UJ6A 1LK7A 1IN0A 1LFPA 5HI7A 5KTQA 2ZH9A 3PX4A 4U7UK 7FDRA 2D3OR 1FKAF 2L48A 4P7VA 4CO4A 4ERDA 2K2PA 3QWUA 1VQ7S 4X66F 3OXFA 2HWTA 4ZCIA 5HMYA 1UVJA 5IT0A 2B0GA 3QGPA 1IM4A 3M8SA 4DLEA 5F9NA 3TO8A 5GVQA 2F9JA 2NREA 2CDQA 1TFWA 2WHOA 2P6SA 2YH0A 4U6PA 2JRSA 2IMOA 2JLEA 1UVNA 3QAUA 3PW5A 2BACA 1LV5A 1FD8A 1HARA 1HQEA 5HLFA 1Q79A 2CJQA 4WZMA 2VFUA 4ECQA 3CIZA 1HD1A 3GIIA 2GHWA 3OTEA 2XWXA 1FRXA 2XHWA 4NLDA 4EO8A 3M2VA 2FTRA 3U02A 2EPIA 2HMIB 2LKZA 3SZ2A 3TA0A 3NNAA 2EI5A 4RBVA 4EGLA 3KLIB 3QZ7A 3VAGA 3OL7A 4M63A 3AY0A 3DRSA 2ZKUA 4JV0A 2RRNA 4AUKA 3K8WA 2CQHA 2YX1A 5KT5A 3MPWA 2HWHA 1WHWA 2MHNA 5BYQA 1HMVA 3LH2S 1FK9B 2ZNYA 2J6SA 7FD1A 3TUJC 5J2MB 2A1BA 2I2YA 2YKAA 5KFXA 1RTHA 4QR1A 2RDJA 3AHPA 4HT7A 1I94F 3OHAA 4B3TF 2XLKA 3OXGA 1TKTB 2W9AA 3C66A 2HFNA 2IRYA 2QEXS 1CC7A 4RNHA 3OL6A 2I5JB 1WF2A 3OFHA 1U2RA 4O23A 3U1NA 4J9PA 1N56A 4O4GB 4KV8A 2FGCA 5HBMA 5KG7A 5JUMA 3ISZA 4NA2A 1JWWA 4DX8H 1LW0A 3G96A 1YJNS 4NYZA 1V3SA 4WJBA 6FD1A 3O2IA 2Z0GA 3V5RA 4WU2A 2YKNB 5BYSA 5KFOA 2YKMB 2E1MC 5KFWA 1VQKS 2LEAA 2C22A 1ZPWX 1WHVA 2JEIA 2V4RA 1Q8BA 5THWA 5LMNF 1KD1T 2RVJA 4HTIA 3GQCA 2WW8A 2ATLA 2CQ2A 2DHGA 2FHJD 4URGA 4X4VA 3FJ2A 2RQ4A 1AUDA 1YG0A 3UD4P 3NCPA 1P27B 2COLA 3RAXA 1ZTWA 5L1JA 2W9CB 3QZ8A 2RKIB 1SH0A 1Q78A 1T94A 1OQ6A 2HHHF 2GO8A 4OI4A 2J0WA 2XLIA 4M5DA 2XMJA 3M2UA 3OPKA 1BQMA 4ZMMA 3B78A 2KM8B 3M8RA 3WX4A 2VFRA 2W4CA 3E3XA 3SQGB 2GJIA 3ETOA 4LUBA 4N8NA 2LLZA 4PKDB 1XNQF 2FJDB 4DOZA 2F8EX 1T02A 2CFXA 5E3RA 1RISA 5T14A 1HNWF 3NMAA 4Q0BB 1X0FA 1E6VA 4ED1A 2QT7A 1SKWA 3KG0A 3M6UA 3BGFA 4PG6A 1SKRA 2HNYA 5KG2A 1WG4A 2UV8G 1IR0A 2DGVA 4K4XA 5MLCV 1SIZA 1XN9A 2FIUA 2M3DA 3DLKB 3N5FA 1BC6A 1XC9A 1HYSB 2ROEA 2B9WA 2VUGA 2ZKTA 2LXIA 3MUTP 1NK4A 3THPA 1QUVA 3WC0A 3CO9A 2BABA 3BDEA 2J9EA 3CJKB 1FKOB 4K5SA 1SL1A 3D54A 5FDLA 3MMAA 2AP6A 5KFYA 3V6DA 3DLEB 1UA0A 3PR4A 3THTA 1FEEA 3MTKA 2YNHB 3CD7A 2DT9A 4NLTA 3POTB 2Y1IA 1UA1A 4JI3F 3NAHA 1REVB 4OZNA 1X4EA 2VKRA 1VQPS 5F8LA 1TUVA 1SJFA 2VA2A 1KLNA 3E01A 4HH0A 4XPEA 1RT4A 3GYXB 5B0DA 2RD5C 4IFVA 1NHUA 1KSPA 3G4SS 1FNMA 4Y2AA 1ZETA 1NK0A 1IKYB 1JLAA 1S1XA 2CZVC 1KOHA 4FF1A 1FKPB 4J9MA 1S1WA 1HWKA 2FJAB 3HT3A 4OHXA 2V2KA 2HNDA 1R0AA 3FCHA 2M88A 2Q43A 5F8NA 5KG3A 2IJFA 2RQMA 2PMZD 1EP4A 1G6BA 2R8KA 2E9RX 2FHJA 3G6XA 2K1RB 3DRRA 4OX7A 1JNRB 5KG6A 1T3OA 1R43A 2AGPA 1S0VA 1QSYA 2F9DA 4Y65A 2YKOA 3CDAA 3MM5B 3EPGA 4EU0A 1KLMA 2HZCA 2M8HA 4RW6B 3BJYA 1S1VA 4QBUA 1B0TA 3GFYA 4WU3A 3J7ZT 1VQ4S 3BDPA 1VS3A 2CIMA 4FF3A 5A8KA 5T7LB 3OSNA 1Q8IA 3O5TB 4F50A 3KK3B 4IRDA 4OIXA 3BO4A 3UDCA 2F8MA 4MIAA 4K4ZA 3VZIA 1UP1A 3LUYA 2R8JA 4ZVHA 1XTZA 3C6UB 4JI1F 3N9UC 1JLEB 1RYSA 1T7PA 4LT6A 4IG3B 2WOMB 3I9V9 3L95X 1NRKA 5D4PA 1NK8A 5DGAA 3N28A 3E2EA 2FDNA 2R2SA 4DFJA 2HGMA 3ZZYA 1HPZB 4NLUA 4A4JA 3PIPQ 3M8PA 4CTAA 2KXHA 2YNFB 2V9WA 3N5BA 2GGPB 4H4OB 2GHVC 4ZHRB 2MGZA 2DPJA 5D4LA 3BEGB 3LWLA 1VQNS 1DQAA 4RWWA 3PXGa 5M2PA 4ECRA 1MMLA 2VPYB 1R7IA 5C25A 1NKBA 2HLTA 4B3OA 4AXIA 1G7CB 5B0CA 5L8RC 3UD3P 4QR2A 4ALZA 5M2UA 3ITHB 3MECA 3CD5A 3EGNA 2VG6B 3N0VA 3QO9B 1YITS 4A8OA 1UMJA 3KNGA 4IFYA 4OL8A 2FHOB 4RW7B 4A8SA 4PXEA 4ILMA 1F5AA 2E29A 3M30A 3MMBB 2BUNA 2ZH7A 3MEDB 5I42B 2XULA 2DNQA 1YWXA 3KLEB 1X8DA 2DCUB 2A18A 5IZHA 3ZC4A 3A1YG 3BZQA 4LIWA 3CCSS 4BDPA 5C42B 1L3TA 2R2TA 2E7WA 2HWIA 1BD6A 1RJJA 4FVCA 5KFBA 4Q45A 3OVAA 4E0DA 4M8LA 5DETA 1PO6A 3O3LA 2I9SA 2QFJA 2HVHA 2RMLA 1JNZB 4RZRA 3I96A 2LXFA 2HVZA 1S1UB 4HLBA 2EG2A 2GMHA 2C42A 2BV3A 2XSFA 1HBUA 4DG1A 3CDUA 3RBDA 1OPIA 4BHQA 1U6FA 4QIVA 3RB0A 1P1TA 2R7SA 1TK8A 2ZDOA 5K8NA 2FJWA 1WF1A 1NKEA 4C8OA 3DOLA 3CJ3A 2XY7A 2XCPA 2JLFA 2VFVA 3NGDA 1YRUA 4JI4F 3IRXB 5A8RA 3OXLA 2ZOMA 4QWBA 1MW7A 2O3DA 2X1AA 2CG4A 3SXLA 1TL1A 4C98A 1IXKA 3IWNC 1HI8A 1HQUA 3BGRA 4R8UA 4X4PA 2UVVA 5A8WB 4CIOA 3RW7A 2E1AA 3CF5Q 4H4KC 3C46A 1Y5LB 2WONB 1FRKA 3K5OA 1SJ3P 4MJKA 3UW1A 4PWDA 2AJ0A 1ELOA 3MEGB 5I3QA 2Z2MA 3O1LA 3OR2A 1X0PA 5AXNA 4F25A 3DLGA 5L1KA 1WI6A 2ZE2B 2UUWA 4PXBA 1NHVA 3S1TA 4YB5A 2B5JA 2B6AA 4C8MA 4ZP8A 2C28A 4KFBB 1UJ4A 1OQ3A 4Y2KA 2GA7A 2OO4A 2HPUA 4N77A 5KFZA 2ACYA 2JEFA 3ONQA 4B9SA 4BS2A 2DB1A 4C0BA 2MKHA 2RF2A 5E3QA 3BQ2A 1F9FA 1TQLA 2DRBA 3ZZRA 3JYTA 4ECZA 2MKIA 2DHAA 3MTJA 3JSYA 2JDJA 5EDWA 4OZ1A 1OSCA 1TL4A 3KK1A 4F26A 3H98A 3CEDA 2KJWA 1J5EF 1Q8LA 1VBZA 3DGPA 4H4KA 4O4RA 3KLFA 3BSCA 1R31A 2LU2A 3DFEA 3P5TL 3NGKA 1FJEB 1JLQB 1S9EB 1LWFA 2N3OA 1IKVB 2B9YA 5BR8F 3GFZA 5FJ4A 2B3TB 1GTHA 1N5VA 4WFXA 4QYRA 1IBMF 1O0PA 1Q7LB 1NEEA 3CE8A 3N6MA 1EETB 1MNEA 4F3QA 1HNVB 4KGKA 4OZ0A 2AYGA 2QYCA 2W8LA 2RQKA 2BRKA 1J2VA 2JFKA 5JXSA 1KS2A 1L5UA 1M5KC 1TAQA 2UP1A 4ELTA 3C8YA 5CCMA 3TANA 2J6TA 1B64A 3HJFA 5CXTA 2B7BB 2Q6CA 4LMZA 3PW4A 2DITA 4I7FA 4CH0S 1C1BA 4NA3A 2XSJA 5IM0A 4ES2A 3TUZC 5KT6A 1H0HB 1ZOTA 3HF5A 3LALA 4RW8A 4NLYA 1Y0HA 3OLBA 3PV8A 3TAMB 5J1PA 2ZUGA 3Q8QB 2ZH8A 3KNAA 2NYIA 3KKFA 1SB6A 4GKJF 3ULHA 3KLIA 5EHHA 3J7YU 5J1EB 3IR7B 1RA6A 4KHPF 3M1VB 3BN7A 5H9EJ 2UU9F 3F73A 1HL6A 1VBXA 1AFJA 3HVTB 2GV1A 5KG5A 3SSQA 1S6QA 3CJ2A 3NBPB 3DRXA 2C2EA 5J2MA 2MZ1A 3UNGC 2NR0A 4PG5A 3PX0A 4X64F 4NL5A 2J9DE 1HNIA 1RDRA 2MQOA 5T41A 2HS3A 2JWNA 3GYNA 2KM8C 2UXDF 2BJEA 5L39A 1V3ZA 3O6QA 2FC9A 4G1QB 4EEYA 2X1GA 4DL4A 4JI2F 2ZD1A 1U48A 4ECVA 2Y1JA 2I5JA 1MU2A 3QAEA 2JJ4D 1FDDA 4OI3A 2XS2A 3V6JA 2OKQA 4TY9A 1QSLA 4LVNP 1FTCA 4B02A 4DQRA 5CHCB 4CO1A 1S0MA 2MPUA 1C0TB 4DV0F 1LW2B 3GMGA 4N41A 3GG1A 1O8BA 2VA3A 4C8NA 3TR5A 2ZOGA 4ECXA 1WTBA 4R25A 3UR0A 3SMZA 1W25A 4AL6A 2IM1A 2LYVA 4IDKB 5CCLA 4OJHA 3D1QA 3GR1A 1K9MT 3I4HX 2NZ4A 5HP1B 2YKNA 1DRZA 1RT2B 4FPRA 3DU5A 3CCWA 3FSXA 3TNVA 1BQNB 2VKZG 3PFOA 2IRXA 2QO3A 2MSTA 2VC0A 3EXYA 2YNGB 1RT3B 2DTJA 2M8DB 4F02A 3K0JA 1XMBA 2CQGA 1FT8A 2BQUA 2HFZA 3MHYA 4KC5A 5KFLA 1LOUA 2MXYA 2W9CA 4QU6A 5A6PA 2VOOA 4IYQA 4DSIA 4DEZA 1LK5A 3W2WA 4K4UA 2N7CA 1P8GA 3MR5A 1QUPA 2IYIA 1H2UX 4P7TA 2JH3A 2ZBCA 4KO0B 1HNZF 2X1BA 1NJXA 4HDHA 2CQ0A 3IXQA 2XMTA 5ITHA 5AE3A 1SUQB 4F3MA 2GHPA 3RB3A 3DRPA