3DI6B

Hiv-1 rt with pyridazinone non-nucleoside inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
424
structure length
400
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery and optimization of pyridazinone non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (hxb2 isolate)
molecule tags Transferase
total genus 119
structure length 400
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3di6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6B04
1JLGB 2HWHA 4RW8A 4PWDA 4WYWA 3C6UB 2ALZA 4K4VA 3LP0B 4ZPCA 2FVRA 5KT5A 3H59A 1S4FA 5F8GA 1LW0B 3RAQA 2IA6A 2XGQA 4KKOB 2YNHA 3MR6A 1HNIA 1IKWA 5I42A 4NLSA 3DYAA 1RT3A 1TKXB 4ECWA 1JLGA 4ED0A 2ILYA 3C6UA 3DRPB 1T03A 2WOMB 4K4ZA 1QUVA 2UVVA 3V6KA 3LP0A 1T05B 2CKWA 2OPPB 1LW0A 1RT2B 1HARA 3QIPB 4RW9B 2VA2A 2VG7B 3OL9A 5JUMA 4KSEB 4KKOA 4YMEA 1RT5A 3TAMA 5I3UB 1OS5A 4QW8A 5KFFA 3KHGA 3IS9B 2R2SA 2RDIA 4NLWA 3MEGB 2FVCA 5L1LA 4NLPA 3CJ3A 4EEYA 5C25B 2E9ZA 2YNIB 4ZP9A 1DTTA 2B6AA 2WOMA 3DRPA 2W8KA 1T05A 2ZE2A 3QIDA 1IKXB 1RT2A 4RW9A 3QIPA 1S6PB 2WHOA 4Y3CA 3BSNA 1MMLA 2VG7A 4Y34A 3H4BA 2R8GA 1TV6B 5KFBA 3LP1B 3IG1B 5I3UA 4O3NA 1TL1B 5KG5A 2BQRA 4KHMA 5F8HA 4RNOA 3IS9A 4DL7A 1JLCB 3MEGA 5C25A 3CDUA 2YNIA 4LSNB 3KK1B 4WFYA 4R5PB 4YR2A 3V6JA 4YR3A 3OHBA 3CWJA 4KFBB 4ECTA 3OSNA 1S6PA 3UPFA 5DLGA 5KFMA 3FRZA 3LP1A 3IG1A 3T1AA 5KFPA 4J9SA 4RW6B 1I6JA 4ZVFA 5KFQA 2EC0A 1JLCA 2UUTA 3UDLA 3H4DA 3KK1A 4LSNA 4R5PA 3M8QB 4IH7A 4RNMA 4KFBA 4Q0BB 4IDKB 2VA3A 3OL6A 5KFWA 5EWEA 4TY8B 1RT4B 5KG2A 2OPQB 4QWDA 3GILA 4X2BA 4O4GB 1LWEA 2J6SA 4K4SA 1JKHB 3EPIA 2XI2A 4RW6A 3CVKA 5KG3A 3N6NA 2BQ3A 2B5JB 1NHVA 5KFKA 3RB6A 3M8QA 2RKIB 3GV7B 3DOKB 4IDKA 4U6PA 2AGQA 2BQUA 4TY8A 1RT4A 3T5KA 2OPQA 1R0AB 1JKHA 4Q8FA 5KT7A 2RDJA 4IG3B 3KJVB 4WFXA 2B5JA 3HVWA 3MFIA 1TL3B 2W7OA 4NLXA 3QZ7A 4QWCA 2RKIA 3CJ5A 4QWEA 3MR3A 5J2MB 4MIBA 4IFYA 5HBMB 2E9RX 4QPXA 4KB7A 4IOBA 5F8LA 4URQU 4GC6A 4KHRA 1R0AA 4I7FB 4NLRA 3KK2B 2WONB 3KJVA 1RT7B 3CIZA 3MFHA 3G6YA 3KLHB 4J9NA 1JLQB 3EZUA 4O3PA 3OHAA 2XCPA 4F4WA 4I2QB 2JC0A 4NLYA 1VRTB 3QO9B 5J2MA 2R8HA 5HBMA 1FK9B 4XO0A 4R8UB 3Q8PB 2F8EX 2IAJB 4I7FA 3LANA 3KK2A 2WONA 1RT7A 5DG8A 5J2QB 5KFAA 1BQMB 1C2PA 2I5JB 2W9CB 1HMVA 2JC1A 5J2PB 4NCGB 1JLQA 2FVSA 2IM0A 2R8KA 1S48A 3DDKA 1S10A 4TN2A 4Y2AA 1HPZB 4I2QA 1VRTA 3QO9A 4O3RA 1N48A 5FDLB 3H5UA 1S1TA 1JLAB 1J5OA 2IAJA 4RNHA 4O3QA 4EO8A 3G6VA 4ECQA 2JLEA 4ECYA 4NLDA 4ZPBA 4TY9A 2HNYA 2FVQA 1BQMA 5DQHA 2I5JA 4URGA 2W9CA 5J2PA 4NCGA 3LAMA 4LSLB 1N6QB 4M95A 1XR7A 3DOLB 5FDLA 3FQLA 2JEGA 1JLEB 4O3SA 5JXSA 4ED7A 3PJXA 5DGBA 4B3OB 4IFVB 2FJVA 4DL3A 1TKZB 4PUOB 2UVUA 2D7SA 4ZVHA 4IRCA 5T14A 4ECSA 5C5JA 1JLBB 4KV8A 1ZETA 4NLGA 4KAIA 1HQUA 1N6QA 2FVPA 5KFHA 3NKYA 3Q8SB 4M94A 1NHUA 3KHRA 4J9RA 1FKOB 3SI8A 4O3OA 2C2RA 4IRKA 2BE2B 4B3OA 1SH0A 2WRMA 2ZKUA 1TKZA 3UR0A 3BQ2A 3DRRB 4ED6A 1JLFB 4PUOA 2OPRB 2XCAA 3RB3A 4ECRA 1EETB 1S1WB 5K14B 2IC3B 1HYSB 1GX6A 3FQKA 4ICLB 4GC7A 1TP7A 3Q8RB 4NRTA 5EWFA 1W25A 3RB0A 3ISNC 1TKXA 3DI6B 3LALA 4H4OB 2WK4A 3N6LA 1FKOA 5F9NA 1RDRA 2BE2A 3M9NB 5DLFA 3I5AA 3DRRA 4F50A 1JLFA 4YP3A 2OPPA 3OL7A 2W9BB 3DMJB 2YNFB 5KFTA 1S1WA 5K14A 2R2UA 2IC3A 1HYSA 3BREA 3T5LA 4ICLA 3I5BA 3PW5A 2FJXA 4DL6A 3N6MA 1HNVB 2YKNB 4TYBA 1C0UB 1KHWA 3GIIA 3DI6A 3DLEB 5CYQB 3M9OB 2AGPA 5KG1A 1N56A 2FLLA 4NLQA 3QZ8A 1S9GB 1RT1B 5F8JA 4NLTA 4TYAA 5DQIA 1UWBB 2UUWA 4ZP7A 2W9BA 3PVXA 1IKXA 3KK3B 2AX1A 1TKTB 3OLAA 4HYKA 3PW4A 1S1UB 5F9LA 1TV6A 1WNEA 3D5MA 1GX5A 1HNVA 1VRUB 1TL1A 1C0UA 2YKNA 4WE1B 2V0NA 4QWAA 3GIKA 5CYQA 3DLEA 4QW9A 1RT1A 3KOAA 4KE5A 4F4ZA 4IR1A 4URSA 1UWBA 4QWBA 5KFUA 3RB4A 3IN5A 2IM2A 4K4XA 3KK3A 1TKTA 3M8PB 1RA6A 2OPSB 3QYYA 1S1UA 1YVFA 5KFLA 1SUQB 4IH5A 4ZP6A 5KFZA 1K1SA 3PW2A 1TQLA 4J9OA 3I0RB 4ZP8A 1VRUA 4WE1A 4ZVEA 4XPCA 2GC8A 3CDWA 1QE1B 3HVAA 5C42B 5L9XA 3C6TB 5J1EB 4Q0BA 3JSMB 4YQWA 4WZQA 4ID5B 3BR9A 1RT6B 1C1BB 2WCXA 2OPSA 3I0SB 5CYMB 2HWIA 4MK7A 2XGPA 3OLBA 4IR9A 4XPEA 4K50A 4H4MB 4O4GA 2QE5A 3I0RA 2W9AA 1S0OA 1IKVB 3H5XA 1REVB 1XR6A 1JXLA 3ICLA 1QE1A 1ZTTA 1DLOB 5KT2A 3C6TA 5J1EA 3H2LA 3DM2B 1KLMB 3DOKA 3JSMA 4MKBA 4ID5A 3DLKB 1RT6A 1C1BA 2R2TA 3I0SA 4DL4A 5CYMA 3OSPA 2C2EA 2IM3A 5EDWA 3BGRB 2QV6A 2ASLA 2ILZA 4Q8EA 5D3GB 3NBPB 1LW2B 1CSJA 1IKVA 1REVA 4WZMA 2B43A 3M9MB 4IG3A 3MEDB 5KG6A 3DLGB 1HQEB 1DLOA 1TL3A 3V81B 2W7PA 3DM2A 4ED1A 3H98A 3DLKA 4WXOA 1RTHB 4NZ0A 2V4RA 3DRSB 5HP1B 3QGIA 3BGRA 1QAIA 3T19A 5D3GA 3E01B 3NBPA 1LW2A 3MECB 3GYNA 3PJWA 2VG5B 3G86A 2D3UA 1LWFB 1SV5B 4ECZA 5KFYA 3KLHA 5C24B 2FLPA 2VG6B 3V81A 1U09A 3V4IB 1S6QB 4G1QB 1C1CB 4IKAA 2D41A 1RTHA 5KG4A 4K4UA 5KT3A 1FK9A 4R8UA 3DRSA 5HP1A 2V4QA 5DGAA 3I5CA 3QGHA 4WXWA 3E01A 3MECA 3LAKA 2BRLA 4ECVA 2GIRA 3MF5A 1S1VB 5J2QA 1LWFA 1SV5A 2UVRA 4EBDA 5C24A 2VG6A 5KFVA 5KFIA 3NGDA 3QLHB 2E9TA 3MTKA 4EO6A 3BSOA 1HPZA 1DTQB 4G1QA 1C1CA 4RW4B 3JYTB 3V4IA 2BRKA 2I1RA 4RNFA 5KFCA 3GIJA 3BJYA 4IH6A 1N5YB 1JLAA 4IG0B 4H54A 1S1VA 2YNGB 1S0MA 2HAIA 1RAJA 3OL8A 5DG7A 3IGNA 2JEJA 3QLHA 3KLVA 4I2PB 4LSLA 2XC9A 3GV5B 4OL8A 3DOLA 4FS1A 3JYTA 5KFXA 3PZPA 1JX4A 4ZVGA 5KG0A 1N5YA 4IQXA 5F8NA 1JLEA 4RW7B 3PW7A 4IG0A 3FDSA 1S1XB 4IFVA 5DQGA 2UVWA 2YNGA 4Q43A 1HNIB 2R2RA 1S9EB 3RBDA 5EUHA 3DYAB 1JLBA 1C0TB 4I2PA 3IGVA 1T03B 5KT6A 4IRDA 4G3IA 5KFOA 4NLVA 2YKMB 4FBTA 3PHEA 2FJWA 4RW7A 3PR5B 3ISND 1S1XA 3BQ1A 4KBIA 3T5JA 2O5DA 3SFGA 1IKYB 2HMIB 2OPRA 1RT5B 3TAMB 1S9EA 3LP2B 3PR4A 2IJFA 4MKAA 1EETA 4YR0A 2R8JA 4KO0B 3FFIB 4DG1B 1C0TA 4ED8A 2GIQA 4MK9A 1DTTB 2B6AB 2W8LA 4J9LA 2YKMA 4H4OA 2JEIA 2ZE2B 4JV0A 5KG7A 1RA7A 4WYLA 1IKYA 5DG9A 2ASDA 2HMIA 2ATLA 3NMAA 3LP2A 3DMJA 4Q45A 2YNFA 2DPJA 2V9WA 4KO0A 3FFIA 4DG1A 2IMWP 3FSIA 1EP4B 4TQSA 4TQRA 2BANB 1RTDB 3BQ0A 4EYIB 3HVTB 1K1QA 3KLGB 4TLRA 5L1KA 5HLFB 3TVKA 1S9GA 2JEFA 2J6TA 1IM4A 2C28A 4F4YA 3HKWA 4ED2A 2D3ZA 1EP4A 4WFZA 4NRUA 2BANA 1RTDA 4K4TA 3HVTA 5KFNA 3KLGA 4J9PA 1NNDA 5KFRA 5HLFA 3UQSA 1LWCB 3SFUA 4O4RA 1RYRA 1QAJA 4EBCA 5HROB 1LWEB 2XI3A 1ZTWA 1XR5A 5KFSA 1S9FA 2OH2A 3M8PA 5KT4A 3KMQA 2ZD1B 4RUCA 1SUQA 2XWYA 2J6UA 3CJ0A 1BQNB 2CJQA 1TVRB 3KNAA 1T94A 4RZRA 3CJ4A 3GIMA 5L1JA 1RTIB 1S0NA 4FS2A 2WTFA 5C42A 1LWCA 3NAIA 5KFEA 5HROA 4O44B 4J9QA 2IJNA 4MH8A 3RAXA 2C2DA 3MEEB 2BR0A 2ZD1A 3NAHA 4MIAA 3CO9A 4H4MA 2IM1A 4ZPAA 1BQNA 3V6DB 1KHVA 1TVRA 4PQUB 3H40A 4Y2CA 1RTIA 3D28A 4JV2A 2HNDB 4IFYB 5F8MA 1RTJB 4ZHRB 3KHHA 1S49A 5KFGA 3VQSA 4O44A 4K4YA 1KLMA 3NL0A 3MEEA 3KLEB 4J9MA 1SH3A 3T5HA 3TQ1A 4DL5A 4ECUA 5KFDA 3V6DA 2HNZB 1SH2A 5L1IA 4PQUA 4Q44A 1D1UA 2RF2B 4TXSA 3MEDA 3Q8QB 2HNDA 3DLGA 1HQEA 1RTJA 4ZHRA 3KLFB 4DEZA 4ZMMA 3HHKA 3BSCA 3E51A 3G6XA 3KHLA 3RBEA 5KFJA 3KLEA 3BSAA 3CDEA 4ZPDA 5EWGA 3GQCA 3GV8B 3IRXB 4EYHB 3ITHB 4JV1A 1HMVB 4RUAA 2HNZA 4LQ9A 1S97A 2VG5A 3PW0A 2RF2A 4NLUA 4NLOA 3KLFA 1FKPB 5J2NB 4MK8A 3MR2A 3H5YA 4ECXA 1S1TB 4JUZA 1J5OB 3CJ2A 1S6QA 1D0EA 4F4XA 4R0EA 2AGOA 2HNYB 1MU2B 2AWZA 2AX0A 4DL2A 3IRXA 3ITHA 3QGGA 4U7CA 4HKQA 3KLIB 4MFBB 4RNNA 2WB4A 3EPGA 2C22A 1RYSA 2IBKA 1FKPA 5J2NA 2DPIA 1T3NA 4RW8B 4PWDB 4K4WA 4RU9A 4RW4A 1DTQA 1Z4UA 2FLNA 4FBUA 1MU2A 2ASJA 4LQ3A 4J9KA 1N4LA 2AQ4A 4KV8B 3V6HA 3KLIA 3KMSA 4EBEA 2YNHB 1HQUB 4MFBA 3H5SA 5I42B 1IKWB 4ED3A 2R8IA 1RT3B 3MR5A 5F8IA 2AU0A 1JIHA 4NYZA
chains in the Genus database with same CATH superfamily
4PWDA 3GR1A 2DH7A 3RAQA 3DC2A 3MR6A 3C15A 3W2VA 4J9UE 2H5EA 3FUYA 5H9EK 1ZYQA 1HNZJ 2VA2A 2QEXS 3K8VA 5I3UB 1OY9A 4X62J 2R2SA 4EK2A 1KVKA 1JJ2R 3DHXA 2M88A 1RTZA 4CLYA 1HWLA 3UFCX 2RRAA 1GMWD 2U2FA 4LRAA 4YR3A 4DV7J 2CQIA 2R7SA 4NEZA 2UUAF 2UUTA 1NK9A 1Y3KA 4IDKB 3A8EA 1YITS 4NA3A 1OQ6A 3WQPA 3PX4A 4K4SA 1NHVA 2X1BA 5KFKA 2KZZA 1ZM2A 2BYCA 2ZJQQ 3T5KA 2OPQA 4C3KA 2HQCA 4F67A 3HSDA 1GNKA 2UUCJ 3P96A 4KHRA 3KK2B 4FP9A 4P7TA 3TZXA 2BJ9A 2XMKA 4F4WA 2QL9B 2F4VJ 5M2UA 2DH8A 2KG1A 2MQLA 1BQMB 3UVJB 1KVIA 1JLQA 1NDKA 1GXUA 3Q83A 1N48A 4FYVB 4JI7F 3K5NA 2DEJA 3I87A 2JEGA 3IA0A 3SV3A 4AQYF 2UVUA 2CPIA 4KV8A 4KHPJ 3OUYB 2Z2YB 3NKYA 4CO5A 3A13A 4B3OA 3RB3A 4MTPA 3CGIA 5E0OA 1EETB 1S1WB 4IOCQ 4UZCA 3X3UA 3ISNC 3DI6B 5IM0B 3TZWA 1SJFA 3W60A 2KT5A 2WAQD 1RBAA 3R1LA 3DLEB 5KG1A 1FCAA 1K8AT 1Y5IB 5LSOA 4O0IA 2R7VA 4LRBA 2OFGX 4IR1A 4URSA 2ZOFA 3IN5A 3MM5A 3M8PB 2MY7A 2OSQA 1S1UA 2BJ1A 4YHHF 1FWLA 3HVAA 3K17A 1JNRB 3ISZA 3L7UA 4DUZJ 3OV7A 4YQWA 3DLJA 1X8DA 4NYZA 4O4GA 2MZSA 2GVZA 2KM8B 4UUWA 1DLOB 4GKJF 3DOKA 5E3PA 1YLXA 3POTA 2ILZA 1LW2B 4K2JA 2XHWA 2MPUA 2QTWA 2CQ2A 2M8HA 3MECB 3HSGA 3MURP 2ZWOA 3QGPA 2VG6B 4B3SJ 1MMDA 5KG4A 2ZH1A 3HHDA 4XDCA 4WXWA 8RUCA 2IJRA 3WX8A 1LWFA 1SV5A 1P1LA 1XTZA 2E9TA 3D66A 1DTQB 4G1QA 1GMUA 2ZITA 4IH6A 1N5YB 4B9SA 1WC5A 1OSCA 4IG0B 3M05A 4CH7A 3KWMA 4ZVGA 2GQQA 1Y00A 1O51A 1S12A 2CQPA 4IFVA 3PACA 5D0GA 1UVLA 1OY6A 3C16B 3NG8A 1S9EB 1ICEB 1KKHA 3IWXA 4X4QA 1LFWA 3MM6A 4U95A 1RT5B 2QMWA 3VTIA 4F36A 3B4DA 2HK3A 4H4OA 3SSSA 2GW8A 2BKOA 2LLZA 4FKXA 1YKWA 2CPJA 3TEHB 2YQ0A 2Z56B 4TQRA 4P52A 4EYIB 4NE9C 3EE3A 3OFHA 2HRYA 4M5DB 4LR8A 5B0FA 2CQGA 3B78A 2MGZA 2AZ3A 4N77A 4B9VA 5CA5A 5KFNA 3BM7A 1RYRA 3PDNA 1VK3A 4PKDB 4X66J 3KNAA 2VZ9A 1ZBTA 1SXLA 4RX6A 1WKJA 1BUXA 5LOQA 2IM1A 4NZ7A 3R6GB 2MKYA 1RTIA 4B9UA 2CQ3A 5KTQA 1NK0A 1RHKB 4O44A 4I0WA 3TO8A 1AA1B 1L3UA 3GQCA 2MQQA 1SIWB 1SIZA 2VG5A 3KLFA 4ZJQA 5IS2A 1D0EA 5L8RC 2OELA 4FNHA 2AWZA 1NSKL 3IRXA 1Y4ZB 3BGUA 3D0GE 2DPIA 2AT1B 3DKDA 1VOMA 1HQUB 4C7QA 2LDIA 4M5LA 2AU0A 1FJEB 1E6YB 2XSFA 4KPCA 4DS4A 1PC4A 3AQPA 4ZPCA 5KT5A 3MUVP 4KKOB 4OX6A 1NSPA 1RWNB 3U1MA 3EVMA 4CLUA 4JI8J 3FC9A 1OS5A 3UD5A 1PKUA 3R3TA 4EEYA 4RWXA 2WOMA 4PCQA 4NCAA 4RW9A 2KH9A 2ZOMA 1PSDA 3MPDA 1ROFA 4LF8F 1KQGB 3CCWA 1JLCB 2OMLA 5C25A 1PJ7A 2A0FB 1QTMA 4C11A 4N76A 2ZZNA 3IBCB 3LQVA 4ZLLA 3QQCD 4MYUA 4KFBA 4PZVA 2CQ4A 2Q66A 2XB2D 2XI2A 3BBBA 3N6NA 1QLNA 1B99A 3NLCA 3W66A 1VGYA 2JHEA 2JDJA 1NMEB 1R0AB 3G4SS 3TVZA 3HJVA 3MR3A 4MIBA 2XSJB 2O66A 1VC6A 1HHQA 5IWAF 2LECA 3EZUA 2SXLA 3BKTA 1HW9A 2VIHA 4WCEQ 1HMVA 2EC2A 4XIUA 1HPZB 4ZJOA 4HH1A 4RUBA 4EO8A 3G6VA 4CNZA 2RUSA 4CTAA 4LSLB 2YWEA 3FQLA 4Y2IA 3TA1A 2KHDA 4PUOB 1XERA 1KD1T 1PYTA 2E1MC 1N6QA 2GGPA 2UXCJ 2HS0A 2XS2A 2CNLB 2C1EB 4ILLA 4W90B 3H0PA 3I9ZA 1U02A 2XQCA 2JWNA 5B0GA 3LALA 2Q79A 2IYIA 3R5JB 1CC7A 2UV8A 3NGKA 1OIAA 1UWBB 2Y8WA 2MLXA 1WNEA 3GIKA 1F2GA 4MKYA 2CPXA 5DM6Q 3PEJA 5HJXA 5AE1A 1K1SA 5LMNJ 3BN7A 4WTOB 3SCJE 5CYMB 2YX1A 2XZWA 3A8JA 4F8RA 4UOHA 3ILIA 5J1EA 1KLMB 1NJWA 3JQMA 1PBUA 2CZ4A 5EDWA 3NBPB 2YKPA 3NCPA 4HH0A 2C3MA 1S76D 1HQEB 1HBMA 1RTHB 3QGIA 3QNWB 2FJDB 1KFDA 4UOFA 1YRTA 3W2WA 4W92B 1D09B 4N5SA 3QFWA 4ELTA 1Q81T 4IQXA 4Z7CA 5KFCA 3GIJA 4P2MA 3ONQA 3VVUA 4DQQA 4H54A 3LPYA 4N41A 1S0MA 4ZK7M 1RAJA 1UVIA 3GLJA 2FPHX 4NWBA 5BYQA 1H2VZ 2LU2A 5KG0A 2WVFA 3PW7A 4P75A 1S1XB 2P6TA 1CJUA 3RBDA 4DSIA 1RZMA 3W9JA 2EXUA 5AXMA 4FBTA 3C14B 3F44A 2CJAA 1YK9A 2LEPA 2OEMA 3SQGB 4RJVA 2IJFA 2MQMA 4PG4A 2V2QA 3T6JA 4C0BA 3ILLA 2VDIA 2BEFA 1RLDA 4YN3B 1KTQA 4OI4A 2IIHA 4CH0S 2AEFA 4QCLA 2R7QA 4GVBA 1AW0A 1IWAA 3HHLD 4WFZA 4K4TA 1NNDA 1KWMA 4I1TA 1S9FA 1XR5A 3QWPA 3CJ0A 2BM1A 1D8YA 1M1GA 1TVRB 4RZRA 3CJ4A 5L1JA 3EJMA 4MIAA 3PYFA 1BQNA 2PEHA 1NB7A 4C9DA 5B0EA 2MKJA 2FTRA 2RF2B 2MSTA 3TVYA 2HHPA 2B9XA 1RHJB 2HNZA 2XBPA 3ADAC 2QT7A 3PW0A 1AZSA 2IDEA 1P9QC 3BKFA 2GX8A 1R89A 3A8IA 5LSLA 2G0JA 2A3JA 5DS7A 2JL9A 2QYCA 3ILOA 4FBUA 3KLIA 1SJ1A 3OR2B 3WIUA 1D8ZA 3MAAA 1WHXA 2UU9J 2QA2A 1CJTB 2XMWA 1JLGA 2HFVA 3C6UA 4IQMA 3V6KA 3L9ZA 5JUMA 4LBPA 1P9YA 3MEGB 2E9ZA 2D1CA 2MLYA 4RR5A 1UW4A 3AB4B 1L3TA 2F63A 1RT2A 3QIPA 5HJYA 2VJUA 1IR1A 2L9WA 4CLSA 3OTDA 2W01A 3CDUA 4WFYA 2GAGC 2HBYB 1SKRA 2AV5A 3OSNA 2B7BB 2KHCA 1KSPA 2CWXA 3T1AA 2LXUA 3H4DA 1Q79A 4RNMA 3G96A 4J5OA 5ETKA 1JKHB 1WG5A 2AW0A 2KU7A 3AD7C 2X1FA 3QFHA 3K57A 3S1TA 1UFWA 1G6BA 4CCHA 1KTVA 4OV6A 1JB0C 3FSXA 1OPZA 3HVWA 1RAFB 4B02A 4DHVA 4DV3F 1R6VA 2ZJRQ 4AQYJ 1FJCA 3E8OA 5LMUF 4JI3F 4UOGA 1WOPA 3U1LA 2R7UA 3GFHA 3LANA 2ZBRA 4WFAQ 5DG8A 2W9CB 4BC7A 2HZCA 3MUTP 2V9KA 3EYZA 3T1HJ 5ETSA 2F9JA 3D7SB 2I5JA 4X4NA 2VB6A 3DOLB 4X64J 1ZAVA 1JLEB 1FEHA 3RU0A 3Q2SC 4DR2F 5ETRA 1YQHA 2KL8A 2BE2B 2ZH8A 2WRMA 1K47A 3TYTA 2XMJA 3CSKA 1WHVA 2J76E 3RB0A 2GHPA 3DLHA 4OZ3A 1VLOA 3R5CA 2W9BB 1L3VA 2IC3A 3QJLA 1HNVB 1YZ6A 1O8BA 1KHWA 4GKJJ 1TKTB 3PEHA 1D3WA 1L3SA 4QWAA 2PDAA 2UXDF 4QIWD 4NXMF 2BUNA 2E44A 5KFZA 1RK8A 5K8NA 2HLUA 4DR4J 1VRUA 3UI3A 2VODA 4KIAA 3JSMB 5A8RA 3BR9A 1RT6B 4FZVA 4H4MB 1N34F 2W9AA 1REVB 1XR6A 4Q7AA 3H2LA 4JI4J 4C4WA 2JLGA 2DNOA 2B43A 4OI6A 3L95X 5FIIA 6AT1B 3L4BC 3OTBA 4PG8A 3ZTSA 4ED1A 3BO4A 1BC6A 1XIQA 2WVDA 1SL1A 3AAWB 2HRTA 1KLNA 2YPYA 4DMZA 2NZCA 3HSZA 1C1CB 1K0VA 5KT3A 1FK9A 3TNVA 3DOMB 2E5IA 3T9ZA 2GIRA 1PJ5A 3VALA 1N0UA 4F3OA 2P9GA 2HS4A 4B9MA 5B0DA 2WSCC 1YIJS 2F40A 4M5KA 1WEXA 2CXEA 3GV5B 2JNJA 1CBKA 2HWTA 2J7KA 4YUDA 2KKHA 3CW2C 1Q82T 3IGVA 5KT6A 4O23A 2Z57B 5LSRA 2C3YA 4QIFA 4HACA 2CPZA 3TAMB 1UP1A 4N7TA 4S0MA 4YR0A 1Q8BA 4WJBA 3UDCA 2W8LA 2JEIA 2VU5A 4K59A 5DETA 1Y11A 1CVJA 1IKYA 2DD8S 2HMIA 5DJBA 2O3DA 4EWTA 3IC1A 1U0HB 4CDIA 4PXBA 3MUMP 2E1CA 3H20A 3MR7A 2MTLA 4AFFA 2IRUA 4P6QA 1F6TA 3M32A 5GAGI 3M1VA 1F9EB 3ENVA 5KFEA 5HROA 5E7OB 1ZS6A 1QSSA 2C2ZB 2QJ3A 5IT9Y 2PFDA 2K8GA 5D6GA 3H40A 2H48B 4K4YA 3UNYA 1H74A 2LQJA 2XG8A 3JTPA 1WDDA 4A47A 1NK4A 3MEDA 3Q8QB 2HNDA 2OIHA 1U6FA 1N33J 1HR0J 3UO0A 2UZAA 4HEA9 2CQHA 2GQCA 2IPOB 4KGMA 4ZDNA 2HNYB 1UVMA 3EPGA 1RYSA 2E1AA 4OYOA 2V2ZA 4JI1F 2KM8C 2FLNA 4ZJLA 4LQ3A 2HHSA 4OHZA 3H5SA 2QC3A 1FX4A 2B4OA 1FJ7A 2ZBIA 5DDOC 1JJ4A 5F8GA 1FHTA 5CXTA 4RU2A 4ECWA 1TFWA 3BGOP 4GMKA 1T05B 4A8WA 1X5SA 2N3LA 3H2UB 2GCFA 3HFVA 2NYHA 5I3UA 2QX0A 5HN0A 2R7TA 4DL7A 1YBUA 1CG2A 2B4VA 1JXVA 3KK1B 3V6JA 1HI8A 1C4AA 2GAHC 3AXMA 4USJC 3GMGA 2DHHA 1Y10A 2E5LF 3EM1A 4ER8A 5IWAJ 3F0NA 2DYAA 3V5RA 2BQ3A 2XLJA 4IDKA 3IM8A 4U6PA 1NHKL 3HM9A 4ZN1A 1F5AA 1HBOB 3N01A 2ZNZA 3C2PA 1FRJA 4CT8A 2PI4A 5ETVA 5E3QA 3OD2A 4QQBA 5D15A 1G7CB 3THTA 3QWUA 4PR6A 2R8HA 2MZ1A 3WHIA 3KK2A 2FJBB 4OZJA 1LFPA 5BJRA 1W7WA 2C3UA 4ECQA 2HVHA 4K2XA 1BQMA 2AD9A 4CLTA 4TU9A 4F0MA 3I56S 2LDYA 1WF1A 1JLBB 3EICA 4NLGA 1NHUA 1GMWA 4ED6A 4NASA 5A2QY 1FDBA 5LJ3Y 5IXUA 1FE0A 2AP6A 1S1WA 2VOPA 3SYZA 4DL6A 2DIUA 3DI6A 3M9OB 1N56A 3OJSA 1L5UA 4AE5A 1Q53A 2ZH7A 4WWSA 4HYKA 4DR1F 3BO3A 2G0IA 1TV6A 1TL1A 3DLEA 4FF3A 1YBTA 3QYYA 4U9RA 4M5NA 4PRFA 1JK9B 4Y6IA 1NPPA 3AJ1A 1G3OA 4K50A 4JI6F 2GHWA 1FRMA 1IKVB 3OQ2A 4P9SA 4MKBA 3J7Z5 2BABA 1QD1A 1AFJA 1DLOA 1TL3A 3V81B 4NZ0A 3FBCA 1R7IA 1LW2A 1MNEA 5KFYA 3V4IB 1KOOA 2XO6A 2KZMA 2MZJA 3MECA 3LAKA 2XMTA 2OP5A 2MKHA 3PYDA 2VG6A 1SJRA 4RNFA 3HP6A 3VAMA 3L7PA 1VC5A 1VQMS 2YNGB 2HQFA 4F0KA 1TMMA 1N5YA 4L73A 1M5PC 4IG0A 4X4UA 3C15B 1TAQA 2PSZA 2YKMB 4C3LA 4DUYJ 3C16A 1S9EA 1APSA 3WC0A 2OTJS 1YJNS 3BF4A 1HNWF 3HVTB 1RXOB 4K0KJ 4ZPVR 3NS7B 5ADZA 1SC3B 4A8OA 1RADB 2PIIA 3THPA 4ED2A 1WC1A 4LF6F 4EBCA 5KFSA 5L38A 5GAHI 3D67A 3RR7A 1FERA 4PG5A 3KDNA 5HAOA 2DISA 4OMFG 2RQMA 1IUJA 5G0RB 1N5VA 2VFVA 4UW2A 4A8MP 1EB0A 4E2FB 2WZ1A 3D2WA 4ECUA 5CYJA 2KFNA 1WJ9A 3PG9A 1IBLF 4DZDA 1B0TA 4O0NA 3CDEA 1JWWA 2F8HA 4ZA1A 4WIIA 1VBYA 2JJ4D 4R0EA 1IR2A 2AGOA 2DB1A 3K89A 4U7CA 3JAMU 2XLIA 4P2XA 1H7XA 1XWLA 4KV8B 2OD6A 2YKOA 2DXDA 4RBTA 1FRHA 3MAHA 2PEBA 6FD1A 1OWXA 3Q23A 4U96A 2KB2A 2V68A 3ZZPA 4CNYA 1Y7PA 2DTJA 2GZOA 3TUZC 1HHSA 3K0JA 1F9FA 4KKOA 2MKCA 4ETZA 3IS9B 4DZ6A 5L1LA 2C42A 1A0OB 2YNIB 2ZBCA 1C4CA 1VISA 2K7KA 4F25A 4C8NA 4XTTA 4ZKAA 1H6KX 4DV3J 1JLCA 2DHXA 4O4GB 4DSJA 4DV1F 4DSFA 3AOCA 2RKIB 3DOKB 1HWKA 2F4FA 4W98A 5GMKa 3HI9A 4NLXA 4QWCA 3KTQA 2GNKA 5D4LA 3LGNA 1R0AA 2J7WA 2RB7A 4WP9A 3CIZA 2DGUA 3MCOA 3LPEA 1AUSL 3KUGA 2NPFA 4DR3F 1ZPVA 1KP6A 3PXGa 2ZUGA 3C8YA 2CA9A 5MLCV 2YVSA 2FVSA 4NCGB 2VL1A 2EK1A 4ELVA 1FDNA 2XEXA 2QO3A 3G8TA 2G1HA 2OFHX 4FF4A 1IBMF 2B3TB 4URGA 2BVZA 3VQTA 2JZ5A 5BXIA 2RU9A 2HBQB 1ULRA 4IFVB 4I68A 2VJVA 5T14A 1I94F 1KEKA 4EZ9A 3FEXB 2PD1A 1FKOB 2JLFA 2DNZA 2UXDJ 3DRRB 4PUOA 1W2IA 4NXMJ 2VH7A 1ELOA 1RAIB 4H4OB 4DV0F 4DI6A 2R2UA 2ZC3A 1M5OC 4NLQA 3VVTA 3KK3B 5LT5A 1BMQB 3GG1A 5D0RA 3AA8A 1XMOF 2VBXA 1UWBA 4CZCA 2QA4G 3AXKA 3TAPA 2AIRB 4ZVEA 4D3GA 1UFLA 2HVDA 1S6UA 4JV5F 2OHDA 4MAKA 3IP0A 3QATA 1VHIA 1DAXA 5CYMA 2EG2A 4KGZB 3BGRB 1SB6A 4M5JA 4CO2A 3MDFA 3AY0A 4X65F 4QIVA 3H98A 3MPWA 2V4RA 3LUYA 1RWKB 3NBPA 2VG5B 3TR5A 3KLHA 1FRXA 1TMJA 3KFWX 1RTHA 1J2VA 4DPOA 3MMBB 4ECVA 4EBDA 3GPAA 4ILMA 2RH3A 4CLFA 4PG7A 1CJVB 4C8MA 2QRRA 5DG7A 2DH9A 1D9DA 2JEJA 3GYXB 1UL3A 4FS1A 1B3TA 1R8CA 4BBYA 4LF9J 4ZOSA 3I31A 3DGPB 3PHEA 1S1XA 2MXYA 1VJQA 3F41A 1IBKJ 3RTVA 1U8SA 3C14A 2JVOA 3WBZA 4A8YA 4TQSA 2HK2A 5DDRC 4ZPWR 4NPOA 2CDRB 3CEDA 3J81U 3CC4S 3HKWA 3JQKA 2YWWA 2UUBJ 3G87A 2NR0A 3Q24A 3CCUS 2XWYA 2A2DA 3EX7B 2RD5C 1HNZF 2XNQA 4X62F 3SDEA 2MZTA 2HHUA 3V6DB 1TVRA 4A4JA 4PAAA 4ZHRB 2VICA 1U0SA 2XYHB 3NL0A 3KLEB 5FJ4A 4I56A 4DV7F 1N5SA 1RISA 4H4KC 3RW7A 2KG0A 2X3GA 3MEKA 2J9EA 2OD4A 3GV8B 3ITHB 1HMVB 4JB8B 2HHHF 2RF2A 3O2IA 4HI2A 2L3MA 1ACMB 5E2QA 4LF7F 1MU2B 4HKQA 1OQ3A 2Z30B 4DFKA 4RW8B 1RWVB 3M8SA 2AJ1A 3UD3P 2LXFA 2XYGB 2FY1A 3NOGA 2AJ0A 2UUCF 4C98A 4OYPA 4ZLJA 1GMVA 4V19X 4OYZA 1LW0B 4HTJA 2HFOA 1S57A 4NLSA 4DFMA 3HHLA 3OR2A 5KAKA 2E5LJ 2XLKA 2V8PA 4YMEA 1CJTA 3KHGA 2ZJPQ 5A8WB 1N0VC 2DHSA 2B9EA 1X4GA 2GS8A 4BLGA 2AEJA 3FNNA 3MEGA 1XMQF 1RWWB 4KHPF 3MHYA 4NYPA 1XBWA 2LQ5A 1X4DA 4M5GA 2RS8A 3BZQA 1RWMB 1T02A 2R9LA 2PC6A 3OL6A 3RYLA 2ACYA 3F56A 2XY7A 2RRNA 2OEJA 1T11A 3HFZB 3EXYA 2VKRA 1JKHA 3QRPA 1FNXH 2N7YA 4LFBF 2W7OA 3QZ7A 3DXSX 4HHUA 3RBXA 1HBMB 2HAFA 2DR5A 1Q8LA 4QZVB 2E9RX 5HBMB 3CULA 5BYRA 3RUBL 4J9NA 2VONA 2YWKA 2E7XA 2W2QP 2JC0A 3MCNA 4TKTA 1SI9A 1RCOB 5J2PB 2IM0A 1NB2A 2MJUA 3MM9B 1S1TA 1UVJA 4RNHA 1GXLA 1D9AA 2JLEA 4A48A 4OX9F 2W9CA 4X4SA 2NSCA 1QUPA 1YGYA 2XHCA 4WP8A 1YHQS 4O3SA 2YX7A 4F04B 4ZVHA 4DX6A 4CM2A 4DR1J 4V1Ak 1U25A 2D9OA 1U6ZA 4J9RA 2FJEB 5D77A 4B3TF 4U7UK 5B0BA 2WVCA 3CJ8A 3CJTA 3ZZYA 2WK4A 4ZS6A 2BE2A 1FD2A 1S7HA 3I5AA 5CQGA 2FYXA 2YKNB 4QIEA 1RQ0A 2FLLA 4GVBB 3QZ8A 2HHWA 3CD5A 2FHJD 2DRDA 2JRSA 3MI7X 2POKA 3OXFA 5F8JA 2DNQA 2UUWA 3PHTA 2W9BA 4ZVSB 4ATNA 2ERRA 1HNVA 2LEAA 4B17A 1KR4A 2HYIB 4K4XA 5IT4A 1TKTA 3PW2A 1CJKA 4H4KA 4J90A 1Y3JA 1NJYA 2LA6A 4YY3F 1HWUA 3V2UC 2XTJP 2F65A 3W64A 4I67A 3CCVS 4LT6A 3JSMA 1RT6A 4QR0A 5D4NA 2J0QD 3VGSA 1REVA 3US5A 1VRQC 2DITA 2CJXB 4MJKA 1PYSB 1AZSB 3M2VA 5EHHA 1HIYA 3VAIA 2CVEA 1OYEA 3DU6A 2GJFA 2W24A 4X66F 2EFGA 5ETPA 4AXIA 2FHKA 5KFVA 4OHYA 3MTKA 2DKOB 1C1CA 3JYTB 3BJYA 3O6QA 2MSSA 3DOMA 5A6PA 1RKJA 3TUPA 1HNWJ 1V9OA 3CMQA 4Q43A 1UW9A 5F3ZA 2MKKA 2HIQA 3HXMA 4ZIVA 2J0SD 1M1HA 3PR5B 4LF6J 2W4CA 2FZCB 2R8JA 4RUHA 3EGWB 1NJZA 2YNFA 3MD1A 1U6BA 2QN6B 5C7PA 4XAKA 4J91A 4MYTA 1VQ7S 3M6UA 1S9GA 2AYEA 1QAXA 1LNQA 3MGJA 1IM6A 3R5AA 4HVZA 1U0HA 4OLPA 2PFFB 4YDDB 3BGFA 2DGSA 4NI2B 3ELHA 3NEKA 3Q8UA 1X4HA 3Q0AA 4OI0A 2BR0A 2CJ9A 2YWGA 4CLKA 1KHVA 1VIOA 1QSLA 1HBNB 2H5IB 1RTJB 1AT1B 5KFGA 1UPPA 4ZLPA 1NK7A 2Z2ZA 3Q2TC 3LWLA 2LFVA 3O8WA 1UJ6A 2V5HG 3WX4A 2KDOA 3OXGA 3BS9A 4USMA 1NO8A 5MAOA 4LQ9A 1MMNA 4K8RA 4NZ6A 2G0CA 2K06A 2I2YA 3BYPA 3VAHA 5B08A 4DV6F 1QVGR 3N9UC 3QGGA 5CH7B 4NCBA 3TJ9A 4OYBA 4NA1A 2IBKA 1T3NA 2MQ8A 2M2BA 1RABB 1K9MT 1IKWB 1TL4A 2HWHA 4OZ1A 5E3AA 2C2OB 4K4VA 2GV1A 2ILYA 3JS9A 1P27B 2MKIA 1GT8A 2L08A 2ZBQA 1T05A 2PMWA 1S6PB 2YTCA 1MN9A 5AJ3F 4P73A 3OTOJ 3SIPB 5J1PA 3GR0A 3PTWA 4OLOA 1JQGA 3SCIE 2UXCF 3C46A 1FT8A 2IRXA 4RW6B 2RMLA 1F60B 1HBUA 1U4BA 3UDLA 3KK1A 2KFZA 2KJWA 4GKKF 2J6SA 4QR1A 3VHQA 4CLWA 4DV2J 2OO4A 1RHMB 1R0CB 1NUEA 2ASYA 3ENAA 2Y1IA 2H51B 2QMUB 3MXHP 2AGQA 4LIWA 2EFPA 3HPOA 2CVIA 2Z2LA 4KR0B 4KB7A 2P8IA 3TJ8A 1HBOA 3W7BA 5HQ8A 4G65A 3MFHA 5ETOA 4I6AA 3MAQA 4I2QB 4GVLA 1FK9B 2JOQA 5LMNF 3NNCA 3JTOA 3H25A 2R7RA 5L39A 3G2XA 1SJ4P 2BM0A 4DV0J 1J5OA 2EFNA 5M2PA 4M95A 5SUHA 4TNOA 1CQNA 2VOOA 4DL3A 3RRGA 3KG4A 1T9XA 1Q1KA 3BGLA 1Q7YT 2DY9A 1ZETA 3KHRA 4O3OA 3BQ2A 2ZKUA 4Z7YA 1S7IA 2L9NA 1JLFB 1NDCA 2A6MA 1GX6A 3CCMS 3L7OA 1KQFB 3Q8RB 2IDLA 3M9NB 4PXCA 2A6OA 2RU3A 3MD3A 2Z8QA 2AX1A 1Q7LB 1U47A 4LIRA 1RA6A 3GTYX 1TUGB 3QPIA 1B64A 5L9XA 3DDIA 4Q0BA 5JMNA 4IR9A 2CIMA 1UMJA 3GJQB 1RSCA 2LXIA 2R2TA 1PIEA 1GQEA 3R97A 2QV6A 4C0OC 1IKVA 3MEDB 5KG6A 4ES1A 2HQDA 1WWHA 2YX4A 5E3RA 4ES2A 3CD7A 3DRSB 3TRGA 7AT1B 3IRWP 1WC3A 3X1LB 1RU1A 5C24B 3V81A 3IWNC 1Y5LB 1WSRA 4R8UA 4A8SA 3MPVA 1P1TA 3AQOA 5AXLA 5J2QA 1VMBA 5KFIA 1URNA 3TA2A 3V4IA 2B51A 2BRKA 4OI2A 1SJQA 4QR2A 3I82A 1JLAA 4J9VA 4PWWA 1WOOA 4LF4J 2KXNB 4UUXA 4C8LA 5KFXA 4TU7A 1U8WA 2YNGA 3FRYA 2HFUA 2CQCA 3N5FA 2ZH4A 1PBAA 3LP2B 2OI2A 4DDFA 3FFIB 4DG1B 1DQAA 5IZHA 3W9IA 2YKMA 1UEVA 1RA7A 5ETQA 4DU7A 4J37A 2MDAA 2KI2A 1RTDB 1FTRA 5L1KA 2M9KA 4F4AA 1S77D 3HVTA 4B9TA 1GTHA 2UU9F 2F1FA 4OX8A 4ED5A 1NJIT 1RWPB 1T7PA 1V5IB 2CJQA 5A2QU 2HHHJ 1S0NA 1BD6A 2WTFA 2HPUA 2F8MA 4J9QA 2C2DA 4F02A 4LF7J 2H4YB 2K1RB 2RQCA 3K5MA 1EX8A 5G0RA 3ZXWA 2CJBA 5LXYA 1FA0A 2XNRA 5DZ7A 2R4FA 2KVIA 1WC4A 2ZNYA 2CQ0A 2QA4S 4KC5A 4UZBA 3CJRA 4LRDA 4NA2A 4FPIA 5J2NB 3ZZRA 3H5YA 1S6QA 1WI8A 4OJ3A 2R42A 1OPIA 4RL1A 3GONA 4RU9A 1SC4B 4DXLA 1NLKL 4KQZA 4DQRA 1YBAA 2DNLA 5F8IA 1XMQJ 3H59A 4E0DA 2DCLA 1FE4A 1S99A 3W3SA 2KYXA 4K5SA 5C2CA 3CUNA 1NXIA 3FCVA 2DNKA 2DNHA 2ABYA 3T1HF 4NLPA 1TUWA 5GAGU 2NZ4A 2RDDA 1F2HA 1TV6B 1WTFA 5KFBA 4X64F 1X60A 1TL1B 2BW7A 4E8UA 3IS9A 2YNIA 4LFBJ 2Y1JA 4ECTA 3TQEA 1I6JA 4WU2A 3LH2S 3W8GA 2LQ9A 3G82B 4YS2A 4QWDA 1OSDA 2PA3A 3H42A 5JJBA 3LTOA 3JAMY 1RGVA 4A8QA 1IN0A 1JJCB 4OX9J 1TL3B 3HMJG 2RKIA 1QDUB 3KG0A 3ZTRA 5F8LA 4WK1A 1KRPA 4NLRA 2ADCA 3PYGA 4PXEA 2FLOA 2BBEA 4DR4F 2F8EX 1Y0HA 1VYAA 4B3TJ 1NKEA 3DDKA 3KUHA 3J81j 4JI4F 4NCGA 1WHWA 1FJGJ 1O6XA 3Q89A 4B3RF 1DURA 3QT6A 1RACB 3E3XA 4USTA 4LF2A 4G1IA 2HGLA 1EHWA 1SH0A 3KKFA 4OHXA 4JI2J 2ZZTA 5D0HA 4ICLB 3O1LA 4DSKA 3NCRA 2VFTA 2ACMA 3FJ2A 1FKOA 3R2CJ 3DRRA 4F50A 1CEZA 4YP3A 2CQBA 4P10A 4YY3J 3FMBA 2GFFA 1T9TA 3D3BJ 1VCTA 3C66A 3PM9A 4WE1B 2V0NA 3KYLA 4KYZA 2QFJA 2ZDPA 2MYFA 4WK3A 1RE1B 3KK3A 4ANCA 1NZ8A 1VQYA 1H38A 1NM2A 4DOZA 2ROGA 4ID5B 1C1BB 4Y28C 4XPEA 4TU8A 2U1AA 1PILA 4DV4F 3HZEA 3OFFA 1SQFA 5D3GB 4CT9A 2IYGA 2ATCB 5H9FK 2W7PA 2LA4A 2OSRA 3BGRA 4N8OA 4DCJB 3G86A 3MMJA 4W4MA 1U09A 1T8EA 1S59A 3QAEA 3OW2R 2UV8G 3V4MA 2DK2A 5A0YB 3MMBA 3OL8A 1Q95G 5HATA 1JX4A 4BC9A 1CJVA 1IQTA 4A8KA 1U1NA 2R2RA 2DVIA 2VHGA 1N33F 1HR0F 2XWXA 4EFAC 5EGYA 3RJMB 2RSQA 1FXLA 1R8AA 3SFGA 3T41A 4KO0B 3VCDA 4ED8A 2NCKL 3JSBA 3DGPA 4JV0A 1EZZB 3I4PA 2NXEA 1NSAA 1TUVA 1EP4B 5H9EJ 4OHWA 1K1QA 2J6TA 1YRUA 1WG1A 2E5GA 4OZ5A 2EG1A 3JSRA 4J9PA 1LWCB 2V8HA 4CO1A 4CM0A 2ZD1B 1W2BR 3CMES 1KQKA 1T94A 3MCMA 1ZM4A 2ZH9A 4MH8A 3RAXA 3CO9A 4DV6J 2KXHA 1NKCA 1F3FA 4HR2A 3D28A 4UF4A 3KHHA 1CULA 4J9MA 2ZEJA 7FDRA 3AFGA 3V6DA 4TXSA 4USHA 3A1YG 4ZHRA 4DEZA 3KLEA 5GMEA 4AD6A 1FKPB 4L6V3 2H54B 2O01C 3MM8B 3ITHA 3CCSS 4RNNA 2WB4A 5LXRA 5HO4A 1MU2A 3R2DJ 2MHNA 2AQ4A 4RBVA 2KT2A 5IFMA 2YNHB 5AJ3J 3IO1A 4N8NA 4A8XA 4RW8A 3J81Y 2HS3A 3LP0B 3L3CA 4LF5J 2V2VA 3NWGA 3DYAA 1BHNA 4K4ZA 2WSEC 1S0VA 3U02A 1LW0A 3ET6B 4GKKJ 2HFNA 1S79A 5GAHU 1H3DA 3DCAA 4Y3CA 2R8GA 1U2CA 1TTHB 4K5RA 2BQRA 2QZ8A 5A8WA 4YR2A 2VBZA 3A3OB 1EAYC 3W62A 3TZYA 2BE9B 1FFGB 5KFPA 1LWXA 1RAAB 4K7QA 4ERDA 5C2GA 2Y9HA 1KOHA 3GILA 3EPIA 2Z4PA 4DN9A 1EKRA 2VQEJ 3F73A 2DR9A 1UCNA 2LP4A 1JXEA 5AE3A 1YJ9S 2I0XA 5ITHA 2LKZA 2B4UA 1M1KT 4QU6A 1BWVA 3QSIA 3NGUA 1FFSB 1HD0A 2VKZG 3VZHA 1RT7B 3G6YA 3KLHB 3HKZD 5HBMA 3QAUA 1W26A 5T7LA 1Z2ZA 3QT7A 2HVIA 1C2PA 4USKA 1WORA 3W1YC 3MOJB 4Y2AA 2NPIA 3H5UA 2Y0SD 1UFKA 2ZDOA 3UDEA 5J2PA 1QAYA 3MM9A 2FJVA 2B4PA 2HVEA 2D7SA 5C5JA 3PNIA 3R9LA 8ATCB 4DR6J 4YB1P 3SI8A 4M8LA 5D8HB 3DGVA 3OJUA 1NK6A 1YI2S 3BBFA 1NKBA 4NRTA 1TKXA 2HHVA 1VJWA 5F9NA 3HO1A 3OVBA 3T5LA 1F1BB 4TYBA 1C0UB 3RR8A 4AT1B 2L41A 2DR6A 1Q8IA 4ETXA 2YKNA 1Y9OA 1M5VC 2H3EB 2OUGA 1FXRA 2IBOA 4DUYF 1OY8A 4FVMA 1KBRA 1SJ3P 2KRBA 2M8DB 3SDEB 2HWIA 3R7NB 4DQIA 2E29A 3GE9A 3K5LA 1U1QA 2FGCA 2FZKB 3EDRB 3ZO7A 1ZTTA 4LFCF 5KT2A 2CPYA 3PCOB 2MKSA 3A3PB 2ASLA 2D74B 4K0KF 4HTIA 4CLPA 1U49A 3ENWA 3HD2A 2BJ8A 3N4WA 2V2KA 4ECZA 3TANA 1B7YB 4ENOA 5E5NA 1RB0A 1R0BG 5DGAA 3QGHA 3MMAB 1SQEA 3U7JA 1PG5B 3MM7B 1VHFA 4BWJA 3BSOA 4DL5A 4DV5F 2WSFC 3KG1A 2IVFB 5EX0A 4CH1A 1FESA 3HLUA 1ZH5A 3JYTA 3TUJC 2FHJA 1XNRJ 4F2RA 2QFIA 2MMYA 2GMLA 2DNRA 3HHLB 2VQFJ 1U1KA 1NK5A 2H4WB 2E1PA 2H5JB 2O5DA 2OPRA 4MKAA 2DHAA 3W8PA 1X4CA 2MLZA 4Q2MA 3SEOA 3MWBA 1Q8KA 1WTBA 1FDAA 1PAEX 5JVGQ 3DNCA 2JVRA 5B09A 2L48A 2GQ2A 4ELUA 2PGCA 3QT8A 1ZAXA 4CYUB 4F0HA 2VF3A 1NK8A 1P6TA 4KJIA 4RUCA 5IC6B 1FO1A 2VFSA 3J7YU 4FS2A 2V8GA 1U45A 3VAJA 3MEEB 4XDDA 2YH1A 5A8KA 1NSQA 4NI2A 4Y2CA 1KONA 5ETLA 3K58A 5E3CA 4EI2A 3CJKA 3KJNB 1H73A 4PWUA 4ZVPB 1HBNA 5KOWA 1RTJA 2GIFA 5D78A 3BSAA 1O5JA 5EWGA 1U1MA 4DR7F 3NWRA 2EVZA 1H72C 2WBRA 1S1TB 4OX7A 4F4XA 2AHOB 3ZZZA 4MFBB 4AUKA 3PV8A 2ASJA 3J7A1 3KMSA 5I42B 1V6HA 3MR5A 1JIHA 1UEUA 4DS5A 4I6YA 1R6YA 3K5OA 1S4FA 1V3SA 5AXNA 5LM7E 1K0TA 1IKWA 4ALZA 2NXNA 3HT3A 4JI5F 3DRPB 3W5ZA 1TELA 3W65A 4KSEB 2W25A 5KFFA 4QW8A 1N36J 2M3DA 3GJTB 2GVDB 5BR8J 2ZE2A 3QIDA 5IT0A 3BSNA 4O3NA 3IG1B 7FD1A 5F8HA 3EGZA 1X4FA 5H1SV 3OHBA 2K7JA 4U8YA 1S6PA 1TL7B 4Q5VA 2KTQA 1LOUA 1CJKB 3FBFA 2RIJA 1VQ5S 4MKVA 3CPWR 1N5TA 2LCWA 4KT0C 4ED4A 1IWGA 4TY8B 1VDHA 2XS5A 4RW6A 3CVKA 1NH7A 3ETMA 2B5JB 5DM7Q 2DNNA 2NXJA 1F5CA 2HURA 4USVA 1V3RA 1F3VA 2ZVIA 3ZC4A 1BXNA 2DR8A 4IOBA 4URQU 4B3RJ 3M2VB 5DRKA 2F5GA 1T0TV 4YB6A 3QO9B 1HNXF 2LEBA 5KFAA 4I2QA 1GH8A 4O3RA 3ENQA 1VS3A 3QRQA 4ZPBA 2FVQA 2A2CA 5DQHA 3M2RB 2VFRA 3UN3A 2ZZMA 3FEZA 1R8BA 3SSRA 3QT5A 3GSIA 3I96A 4RLEA 3NGRA 2I38A 4OV1A 4L72B 3HVRA 1WACA 3T9NA 1ZZNA 5A6WA 1HYSB 3FQKA 1QTNB 5EWFA 4ZCKA 1JLFA 1WUUA 2OPPA 2P9CA 4ZCMA 2YNFB 2FJXA 4OYAA 4DV4J 1S9GB 3LGMA 4ZVUB 4CRJA 2W4PA 2V67A 1VQKS 4QW9A 3AT1B 5K8MA 4KE5A 1KC8T 3AOAA 4LF9F 4LF1A 2COLA 5KFLA 2OPSB 1H7WA 1UPMB 3H90A 1SKWA 1GTEA 2EWHA 2HFZA 1BY9A 1IBKF 2XGPA 1B7FA 3FCHA 3KUEA 4QBUA 1G4CA 3DM2B 5RUBA 3DLKB 3WZ0A 3AD9C 3D0IE 1TFYA 4IG3A 1U2RA 4OHVA 3BN4A 1E6VB 3E01B 2UUBF 4MT1A 1Q0NA 4QYRA 2K3IA 2N82B 2HW3A 4Z37A 4QYZK 5HVGA 4K4UA 2G2OA 3DRSA 2V4QA 3I55S 2D3OR 3RG6A 1S1VB 5C24A 3BKUA 4MIWA 1TK0A 2I1RA 2CWKA 3EWGA 2GA7A 4GRSA 3DDNA 4D3HA 1XJWB 2A18A 3S7RA 4DF4A 2BMBA 2ZOGA 4FYDA 3KXDA 3EZOA 3D1HA 3D1QA 2EPIA 4LR7A 4PYDA 4WTYA 3ZTQA 1SBRA 5IV3A 2CUYA 4OZNA 5L46A 3CNQP 1IQZA 2ASDA 1M5SA 1VBZA 3LP2A 3DMJA 1I5OB 2VUGA 4RWWA 2V9WA 3FFIA 4DG1A 4XK8C 3GG0A 3KLGB 3PIPQ 1KDNA 4F4YA 1HBUB 1RTDA 1U1LA 5KFRA 2DNYA 2R3VA 3M2UB 2DGVA 3KMQA 3BH7B 3BO2A 4KY3A 2W2NP 2QLXA 1WC0A 2B9WA 5C42A 3Q22A 3PRBA 5THWA 2WW4A 3OFEA 4FVCA 3WC2A 3VF0B 2RT3A 1NAQA 1ZPWX 1I1GA 1SH3A 4UY85 2K1RA 1QM9A 3CJSA 2DNPA 5KFJA 2AEMA 1YZ7A 4FXWA 2RHQB 4ZPDA 2V4JA 5ETTA 1GXTA 4NLOA 1J5OB 1NBEB 5J2NA 4RW4A 4IUFA 4ANDA 3K5PA 5BYSA 2BXJA 4DQSA 2QLWA 1ZA1B 3PO5A 2EK6A 2D69A 3M8RA 5DDPC 2A1BA 1H0HB 2FVRA 4C48A 5M2RA 2XGQA 1EQMA 2K3KA 5D0EA 2QGFB 2DXEA 2YPZA 1T03A 1WDTA 1NJXA 4AL5A 1EKSA 1HWIA 1RBOB 2B6AA 4B3MF 4KGVB 1MMLA 4KGKA 3Q8VA 3ZTPA 2BA9A 5A76A 3AH6A 4KHMA 2Q3PA 2RE1A 3PYEA 3UE2A 2HG4A 2IMOA 2CQDA 1RP5A 3FRZA 5HQLA 2KO1A 1TK5A 2FIUA 1HQ2A 3M8QB 2FD2A 4Q0BB 4UY8T 5F0UA 2HIYA 5KFWA 1BWEA 1RT4B 1LWEA 4PG6A 4YDXA 4M5MA 1NEEA 3KJFB 1WKKA 3GV7B 3G82A 2DO4A 2YWHA 1ZZFA 4Q8FA 5KT7A 1NDLA 2HFSA 1X0PA 4WFXA 4Y0FA 1DBDA 1U1PA 3CJ5A 2BZ2A 4LSZB 4WKYA 4QPXA 4GC6A 1SPBP 3N5BA 1RUSA 2XCPA 5CCLA 2BE7D 4R8UB 2HBRB 5GVQA 1IBCB 5J2QB 2HZVA 2XULA 1S48A 1S10A 4F3MA 1PAUB 1VQ8S 3MZIA 1JLAB 3NMRA 3BDEA 1DRZA 1XR7A 4BHQA 3AA9A 3PJXA 1FD8A 1PGZA 1TKZB 1GFWB 4WU3A 3W61A 1X9SA 1HA1A 5FD1A 2MJNA 3D54A 3IXQA 1ITPA 1NU4A 1ZA2B 2HLTA 2BJ7A 4ECRA 1XEZA 4BDPA 3I9V9 1OO0B 3NS6A 3SBMA 3OL7A 4FYYB 2MQNA 1WEYA 4ZLNA 4ICLA 4WFNQ 5CYQB 3R5DA 4N47A 1FWPA 2CRLA 4LFCJ 4EZ6A 1IKXA 1UTAA 8AT1B 1S72S 1LK7A 3CDBA 4HT7A 3P5TL 3KOAA 5KFUA 1XMBA 2IM2A 4IO1A 5IQ6A 1YVFA 5EX3A 2MHEA 2DXFA 1TQLA 1YJUA 3I0RB 3DLBA 4WE1A 3CO0P 3J7ZT 1YWXA 4HHHA 4NXNJ 1T3OA 1U1OA 1VBKA 3NGTA 2QE5A 4QU7A 1WOSA 3VGTA 3G8SA 4CIOA 4ITSA 4ID5A 3OSPA 1C1BA 4DV5J 2IM3A 1XNQJ 1HLWA 1CSJA 4G1PA 4M5HA 3ZZUA 2X1AA 4RBUA 4FYXB 3KJQB 2P6SA 2G1DA 2Q6BA 3D3CJ 3FZBA 5D3GA 3GYNA 2VASA 2J0XA 2BKNA 4M1KA 3IFEA 4P2SA 3PO4A 1T95A 1S6QB 3MCSA 1FVSA 1X5TA 1WI6A 4OZLA 4DQPA 2CYYA 1M5HA 1TK8A 1YDLA 4OZ0A 4QYZJ 4ZVQB 3A8KA 3LWMA 1MLAA 4ANEA 3AJ2A 4X4OA 2DT9A 1HL6A 2VC1A 2E5JA 4LJMA 2UXBJ 2BOAA 5AT1B 5A0YA 1VQSA 3TI0A 3OTEA 2ZFHA 5E41A 2BX6A 4DUTA 2PN6A 3U1NA 5EUHA 5AXKA 1MSWD 2YH0A 1TU0B 4G3IA 1M5KC 1UKUA 2PO4A 1MWYA 2XS7A 3P5BP 3P4UB 2B7CB 2Y8YA 2QIFA 3TUIC 1QVFR 1WHYA 2FZGB 3CIMA 4KO0A 2RJZA 2BANB 3TVKA 3UCZP 3ILJA 1IM4A 4USIA 1UA1A 3N0VA 1EP4A 2DNGA 1N5QA 4WFBQ 1YRXA 1YX2A 5DZ6A 3SFUA 3PKYA 2FB0A 3SZ2A 4DR7J 5GAEI 4CP5A 1YJ7A 2Y1LB 1LWCA 3T1YJ 3O5TB 2ZD1A 4DL0C 3TJAA 4UTGA 2MZQA 2W4DA 2XZDB 3OTOF 1S5ZA 3TWZA 3TQ1A 4Q44A 3P6YC 2OGUA 3SCKE 2IVYA 3PFEA 4DSEA 2DBBA 3LA0A 1NH8A 5GADI 4MK8A 4DV2F 3H8YA 1HW8A 1UVNA 4JI5J 1S6OA 2CPEA 4DL2A 2J8AA 2IVMA 2MQPA 3SXLA 1FKPA 3MPYA 1Z4UA 3MM8A 2BJ3A 1UZHA 4NMXA 1T9YA 1RT3B 5I4MA 2HVZA 1H2TZ 2JSXA 4OYMA 1UETA 2IA6A 1ZOTA 2YNHA 1HNIA 4X4PA 1SVDA 4JYAJ 2GMJA 2I9SA 3LP0A 2CKWA 4F7VA 2VG7B 3IM9A 1DTTA 4ZP9A 1LEOA 3OTCA 3NOCA 3CCQS 4Y34A 3H4BA 3MOZA 1YSJA 3LP1B 1XK8A 3IBFB 3ET6A 4JI0F 2FY8A 2BOPA 2NSBA 4LVOP 1RAOA 1B0VA 4AYBD 5KFMA 3FMWA 1QJHA 4M63A 4P71A 5HK4A 4CWBA 3HHLC 1FX2A 5EWEA 1GEHA 3UCGA 2BDPA 1HNXJ 4LFAJ 2B0GA 3W5XA 5K20B 1MROA 2J0WA 3OXLA 2AJFE 3NCQA 2FGOA 2YXLA 3DRYA 3CF5Q 1YJTA 5CABA 4DX7A 3NNHA 4IFYA 1Q5VA 4I7FB 2WONB 1DZ5A 1HI1A 4XO0A 3E2EA 4NYOA 1VQNS 3B8HA 2G2YA 2M70A 3J7YI 3RRKA 1IVZA 1RT7A 2RS2A 2AYBA 1JNZB 1R3NA 4KH0B 1IXKA 5FDLB 2G2ZA 4O3QA 4NLDA 4LBHA 2DGXA 3GJSB 3BPSP 5F3TA 5DGBA 3HDSA 1J5EF 1G1XA 1Z2LA 2DRBA 1MWZA 3JXOA 4HLBA 4IRKA 2UUAJ 2WVEA 3S6EA 4Z2XA 1I3OB 5K14B 1TP7A 1R31A 1WD6A 2WBMA 1MG7A 3W63A 3N6MA 2ZUAA 1RT1B 2HQGA 2AJ2A 2OTLS 1AUDA 4ZP7A 3PVXA 4LF4F 1KS2A 3TZZA 1C0UA 5CAAA 3DU5A 3QJPA 4B9NA 3W5YA 3RB4A 1V3ZA 4GO5X 3HULA 1QE1B 3NXZA 3GWCA 3C6TB 2CAJA 3FZ2A 2RHSB 2QL7B 2PE8A 4JI7J 1CULB 2C2EA 3FGVA 1CQMA 4Q8EA 5HMWA 3GP9A 3M9MB 1RWUA 2CNKB 1OMSA 5HP1B 4UQTA 2XMAA 2AZ1A 4R0JA 1UAWA 4FN5A 3OFGA 4FDFA 5F0WA 3GFZA 1REGX 4ID8A 5B0CA 1LK5A 2ZHAA 1TL5A 3QLHB 4UT4A 2HZAA 3UR3C 2ZH5A 3G71S 3VWSA 1GAOA 2ZH6A 3MMAA 4C2MA 3MM7A 1FNMA 5HANA 4RW7B 2HGMA 2JH3A 3MMCB 2EFOA 3DYAB 4YB7A 1SL0A 1C0TB 1VI7A 4NLVA 4YHHJ 3IR6B 4KBIA 4ZCLA 2J8SA 1YTYA 5D4OA 4DPWA 5DG9A 3GFXA 2QYGA 4DFPA 2IMWP 1J27A 4LVNP 5HLFB 1PYOB 3TEGA 2CJKA 3B82A 2FUG9 2KFYA 2RQKA 4F26A 1X5PA 2YQ1A 4EMDA 4P74A 2Y1RI 1SUQA 3B4MA 1N88A 3UW1A 2DR7A 4CYUA 4C8OA 1HHTP 1TAUA 4ZPAA 4CQ1A 4PQUB 5HSPA 1RBLA 5K5MA 1BLUA 3MEEA 3FCWA 2HRUA 3D0HE 4R25A 3GB0A 1DARA 3DLGA 1FF2A 1UVKA 4ZMMA 3HHKA 2FHMA 3W9HA 1X9WA 5T7LB 1VK8A 5LJ5Y 3PIOQ 1RJJA 2HBZB 1YJVA 2ZM6F 4OZ2A 1X5OA 3CJ2A 3M6WA 3QSYB 2NUUG 3Q86A 3FKBA 2IY5B 4C8ZA 4B3MJ 1UEKA 4MFBA 4DCPB 5CHCB 4HDHA 3ZZTA 2HKEA 2PMZD 1Q4RA 2EI5A 5B7WA 3R1HA 5I42A 1N32F 3CB4A 1TKXB 1SKUB 3CMAS 4RPFA 4OYXA 4DF8A 3CJ3A 5IQQA 3VAFA 3DRPA 2W8KA 1JJHA 1VR6A 1LXJA 4HI1A 2CADA 1FJGF 5KG5A 1KFSA 3QRRA 1CPZA 4LSNB 4R5PB 2GVDA 3CWJA 5KOXA 1PC5A 3IG1A 4ZVFA 5HI7A 4C8KA 2E7VA 2M4MA 4JI2F 3M8ZA 4L76A 4ZVOB 3A3NB 1TL7A 1VQPS 4ZCIA 5HQMA 5KG3A 2NS1B 2X7IA 3M30A 2X51A 2VV5A 4TY8A 3K2YA 3KJVB 2B5JA 3VAKA 3MFIA 2AF6A 3M4XA 4DCOB 5J2MB 1X9MA 2ZVSA 3BEGB 2BJEA 4O3PA 3JQJA 2G13A 1VRTB 2V34A 1U48A 3OR1B 4BS2A 4AL6A 2IAJB 2H65B 3FK4A 1U7LA 5J1NA 1X31C 4FXVA 2HQ3A 1FTCA 6FDRA 3QO9A 2YY3A 1CS4A 4DBQA 4ILRA 2LYVA 1H2UX 3LAMA 1UJ4A 1S4EA 4LF8J 1AROP 4ED7A 1RI7A 1EARA 2VPZB 4FKYA 3PX0A 3M2RA 2FVPA 4C0HA 1AXQA 4KPYA 1PJ6A 4KGXB 2OPRB 4N56A 3J7AN 3RGIA 1WG4A 4GC7A 1G2EA 3K59A 4DR5F 1U2FA 3ZNUA 5HL7Q 1HYSA 3BREA 3I5BA 1WSVA 3CXCR 1KQSR 2I6WA 3S8SA 2DGOA 4CI0B 3PW4A 2GO8A 3R27A 4AL7A 3J80U 2M7SA 3DRXA 4F4ZA 2KRRA 3OT9A 4G6VB 1M90T 2WVBA 5FLXY 1UZDA 2GC8A 4QPTA 1IR0A 2L9DA 2OPSA 3I0SB 2WCXA 3OBIA 3RBZA 2J9CA 5A8KB 1JXLA 3ICLA 2B56A 3CJKB 2XM3A 1MWQA 2AJQA 4DN0A 3MPUB 2HQIA 3DM2A 3DLKA 4WXOA 3U27A 4KTQA 2KT3A 2D3UA 3DFEA 3H7HB 3EGNA 1E6VA 2AMCB 1FI4A 3DHWC 3I5CA 1RAGB 2EKNA 2ZHOA 3E01A 2N4DA 2EBEA 3UVJA 3CCRS 1SC6A 4DLEA 2R7OA 1AYEA 1S1VA 2DGWA 2HAIA 2X1GA 3KDOA 2XO7A 3KLVA 4I2PB 2XC9A 1VQLS 5I3QA 4ZVTB 2RAQA 4B9LA 3RW6A 3R7SB 4ZIWA 3NP5A 3OUYA 2H1YA 1A9NB 3LW5C 3HHNB 1A6LA 1YJRA 1EETA 3GCWP 2RILA 1WKLA 4PEOA 5L9NA 1LV5A 3HCXA 2ZE2B 5IM0A 3UWTA 1GK8A 4HT5A 2ATLA 2DPJA 3OVAA 3EDQB 5G4DA 4KH1B 4LUBA 4TLRA 5HMXA 1MW7A 2EEYA 2C28A 2QSFA 3UN2A 2PT0A 2OKQA 4DPYA 4NRUA 2PI5A 3KLGA 2GJ2A 4LF5F 2V50A 3A12A 2CJYB 1WELA 3M8PA 2VD3A 2J6UA 2QA1A 1NZAA 3GIMA 1DY3A 3GYGA 3NAIA 3D4JA 2C2KB 3M2UA 2ZH3A 2XY5A 3NY0A 2E66A 5F8MA 1S49A 4FF1A 3O3LA 3MTJA 2V6AA 5KFDA 1CC8A 1RAEB 1RHRB 3KHLA 4EUVA 2V63A 3D6MB 3MR2A 2GJIA 2DHGA 3R7BB 3CT9A 4M5IA 2VQEF 3CC2S 4C8YA 3HFKA 2C22A 5IC4B 4PWDB 1VLYA 2ALYB 1DTQA 2KYZA 3VR1A 1AB8A 2CZ9A 3V6HA 1R27B 3W2VB 4JI0J 3ZTOA 2UP1A 1QY7A 3RRHA 3VZIA 2PA8D 4ED0A 1HKAA 4OYWA 1QUVA 2UVVA 2OPPB 2O1PA 4Y00A 4MMOA 4FXDA 2RUGA 4DU8A 1ZM9A 4EGLA 1RT5A 4JOUA 4NLWA 3DLLQ 2FVCA 3IMQJ 5CZXA 4PXDA 2OMOA 1T9VA 2NYIA 1SC1B 5U47A 4DPTA 5DLGA 4M5DA 2HHTA 3CCLS 4J9SA 4DR6F 2D3O1 3BPDA 3I6PA 4IO9Q 5KG2A 2OPQB 3TX8A 3RB6A 2LMIA 3M8QA 1Y5NB 3Q8YA 2B9YA 2BQUA 5ETNA 1RT4A 3IWLA 4IG3B 5T41A 4L75A 3EVWA 2IRYA 1SKSA 2F9DA 2HSEB 1JLQB 1J5EJ 2QMXA 5IV4A 4ZPTR 4LREA 1FRIA 4DPXA 2R8KA 3M6XA 2CNOB 5K8PA 4J7CA 1SL2A 3M7VA 2BJDA 1P8GA 1FEEA 4WP3A 4BWMA 4B3OB 1B0PA 2HGNA 4IRCA 2J9DE 4KAIA 1HQUA 1WF2A 3D9BA 3R5BA 1E6YA 3UR0A 1TKZA 2XCAA 2DJWA 4NX9A 4QJVA 1VBXA 2BW2A 1F0XA 4USWA 3UCUP 3SCLE 3HD1A 3N6LA 4NMLA 4WIQA 5DLFA 3DMJB 4GO7X 1RLCL 2AGPA 1FVQA 4ES3A 2ADBA 1WF0A 4V19J 2V94A 3MM5B 1S1UB 4JBCA 5CYQA 1D9FA 1XNRF 2R7XA 2GMHA 5LMUJ 4JI3J 2VQFF 4ZP6A 1VQ9S 2ZHBA 4ZP8A 4PABA 2GVZB 4KRWA 5C42B 4EU0A 2CZVC 3ZZOA 3POTB 3I0RA 1S0OA 3H5XA 3T6BA 2CPDA 3UD4P 3TP2A 4WZMA 3D6FB 2NXCA 2Z0GA 1O0PA 2LQ8A 3HK2A 4DR2J 3FEYB 1AFIA 4ZVRB 2XSJA 3JTNA 3QJJA 3T19A 3PJWA 2V4JB 3THVA 2OJ3A 1KN6A 1LWFB 1SV5B 3GJRB 4G1QB 4OQJA 2D41A 2EKYA 1VQ6S 9ATCB 3BH6B 2BRLA 2DCUB 3MF5A 3EVOA 3NGDA 5EN1A 1HPZA 4RW4B 2J5AA 3TA0A 3BR8A 2P2CB 4DLGA 2XMMA 2OLWA 3EXCX 2BACA 4LSLA 1FRKA 3PZPA 2AYMA 3FDSA 3MM6B 2QL5B 5DQGA 2NXUA 2UVWA 4E98A 3LOUA 1T03B 4IRDA 5KFOA 2C2NA 3ISND 2C3PA 1RKIA 4ZITA 2Z2MA 4PQAA 4MK9A 2B6AB 1N34J 3SV4A 4WF9Q 2LQBA 3B54A 5KG7A 4WYLA 2NQPA 1WEZA 3NMAA 4FPRA 2MGZB 3TAQA 4PPZA 2R7WA 1ZM3A 1DJ0A 2B8QA 2BANA 4PYAA 1X4BA 1X4EA 1QAJA 1NRKA 1LWEB 3L09A 1ZTWA 2OH2A 4IOAQ 5KT4A 1DHMA 2J7UA 1RTIB 2ZM6J 1N36F 2MEWA 4A8FA 4O44B 4LBIA 2HHXA 5BR8F 2G9OA 3P8BB 1KLMA 4YOEA 4HHJA 4WKRA 1SH2A 1X4AA 3VV2B 4QOTA 1HQEA 3KLFB 2EFQA 3G6XA 3BSCA 3E51A 2BKPA 4EYHB 3IRXB 4JV1A 3C3LA 1H98A 3P49B 1N32J 3G6ES 4ECXA 2QLJB 2AX0A 1U26A 2FJAB 3ULHA 2FC9A 3I4HX 3NRBA 2AKWB 1UWAA 2CFXA 4K4WA 4DX8H 2B8PA 3IAM9 2X3DA 1XN9A 3KNGA 3BBCA 4DX5A 2HHQA 2MQOA 2ALZA 2QLFB 3M8WA 1RT3A 1YG0A 2RQ4A 4YEAA 3CCES 2WOMB 1T9WA 2OEKA 4RW9B 4IYQA 5K9FA 3SQGA 2CPHA 2H9ZA 2RDIA 4Y2KA 1EJ7L 5C25B 1RHUB 3TARA 2XZTB 4C11B 4ECSA 1IKXB 2WHOA 2VG7A 3M8YA 4RNOA 2ZKTA 3AHPA 3NNAA 4KFBB 4OJ1A 3LP1A 2KJVA 4NL5A 2E1RA 5F41A 2EC0A 3CE8A 3CCJS 2KN4A 4IH7A 4OYIA 1BQXA 5I3PA 2MB0B 3OVSA 2Y3YA 3R5GA 1T9UA 2O67A 1RWOB 5DO2A 4JI1J 1RAHB 2AJ4A 4A46A 4QWEA 1HD1A 1F5BA 1TR0A 1YJWS 3HHEA 4FF2A 3IAS9 2DGTA 4NLYA 3Q8PB 4I7FA 3IBWA 2WONA 1B70B 4CTAB 4OFZA 4RO0A 4DR5J 2Z58B 1K44A 4ECYA 4X84A 2W2OP 1RHQB 3CCZA 3PFOA 1NDPA 2LU1A 1N6QB 2GGPB 1R43A 3A4TA 2ROPA 2EFVA 4TLQA 5FDLA 1UA0A 2IHR1 2MY8A 4PPDA 3Q8SB 3EZ5A 2F4VF 4OJHA 2RRBA 2E7WA 1N8RT 3R8YA 1KNZA 3FBBA 4NOHA 1Q16B 5CD4A 3DXBA 2DIVA 5KFTA 5K14A 3PW5A 3JSYA 1SQGA 2P9EA 3GIIA 2V8VA 5HMZA 2DEIA 2W1BA 2KXFA 3OLAA 5K8OA 1GX5A 3AD8C 3EMTA 1JMTA 4FNIA 1RT1A 4QWBA 1OYDA 3BQ0A 4IH5A 2YBVA 4Q2LA 2DRAA 4XPCA 4HL9A 4P72A 1R8PA 2YKQA 1N52B 3G8QA 5J1EB 1VFJA 4WZQA 4MK7A 3OLBA 3QMQA 2QSWA 1QE1A 2K2PA 4BCAA 3C6TA 4OI3A 2DY1A 3ETOA 5DDQC 3FSYA 2N4CA 3W2WB 2M52A 3LF0A 4DWIA 1FNOA 4LR9A 2W2PP 3TX0A 4DUZF 4X4RA 2ZWPA 3S01A 4F4KA 5HP1A 3O44A 1L3KA 2IFXA 4I69A 4OI1A 3QBCA 3TW0A 2UVRA 4EO6A 1VC0A 2XMUA 2VDHA 1CJUB 4WPAA 3IGNA 4UOCA 3QLHA 4OL8A 3DOLA 5F8NA 4P7VA 1JLEA 5HVFA 1Z1ZA 1HNIB 4B3SF 3P3DA 3HZGA 4RW7A 3BQ1A 3T5JA 1DQ9A 3MMCA 1V5VA 2PMHA 3BYRA 3GCXP 2G4BA 1C0TA 2GIQA 1DTTB 4JI6J 4ZN3A 2YQ3A 2ZC4A 1X0FA 4DFJA 2C3OA 4Q45A 4F2SA 3FSIA 3R6LB 1LKZA 4P2FA 1IJFB 4L3KA 4U7UD 2JEFA 3WDOA 4Y65A 3T3FA 2VPXB 4CLZA 4RKUC 5HLFA 3PRVA 3G9CA 2VFUA 4L74A 1QSYA 3ZNJ1 2E5HA 2CNNB 1BQNB 4C3MA 2CQ1A 1MROB 2ROEA 2I8EA 2A10A 4H4MA 4YFUA 1HWJA 3CDAA 3JB9k 4YB5A 3AODA 4JV2A 4IFYB 4B08A 4LRFA 1FKAF 3VQSA 2XMVA 3PX6A 2N7CA 2CPFA 2HNZB 2OAUA 4PQUA 1D1UA 3RBEA 3FVYA 3D68A 1LXNA 5AE2A 4JUZA 2W2MP 4I6WA 3KLIB 1URRA 1VIXA 5CZVA 3MAAB 4J9KA 2NREA 2DGQA 1JLGB 4WYWA 3C6UB 4FYWB 3HF5A 2AYGA 4OIXA 1Q5YA 2N3OA 3CD6S 4U8VA 1N54B 2XY6A 4LMZA 2GHVC 3RAMA 1RT2B 1FWKA 1HARA 3QIPB 3VGVA 3OL9A 1MN7A 2LVWA 4LRCA 5IOLA 3TAMA 2V69A 2JX2A 1SCJB 4F3QA 5GAEU 3UDVA 2NUHA 2IA0A 5E33A 3UPFA 1IBLJ 5KFQA 1B4SA 4LSNA 2MZRA 4R5PA 1BGXT 1IJEB 2VA3A 3EGVA 3PKMA 4WBFA 4X2BA 4JI8F 5JVHQ 3IR5B 1XQIA 3UN5A 1DQ8A 5GADU 3VAGA 2RDJA 9RUBA 3DN9A 2F7VA 2FDNA 3M6VA 2XYPB 3KJVA 3UNGC 2YWFA 3OPKA 3OHAA 3GFYA 5J2MA 1Q78A 1EIYB 4NXNF 5H9FJ 2I5JB 2JC1A 2GO9A 4TN2A 1WC6A 1VRTA 3GU0A 1PCAA 3OR1A 1VQ4S 2IAJA 1X7VA 4TY9A 2HNYA 1R8HA 3SMZA 5D4PA 1XNQF 5JXSA 3HSJA 3I32A 2F3JA 2DO0A 2P5VA 4X4VA 2CG4A 5KFHA 4M94A 2APOA 2C2RA 4HDGA 2IC3B 1PO6A 1M0SA 2M0GB 3PJ9A 3WIVA 3N79A 1FRLA 1W25A 4U67Q 3GSDA 4DV1J 3AOBA 1RDRA 4DSLA 2C2MB 2KVQE 1NPRA 4JP8A 1FFWB 1TZ0A 4NLTA 4OJGA 4TYAA 5DQIA 1KVJA 1OJ4A 2Q6CA 2Q43A 2V8DA 5F9LA 3AJDA 3D5MA 1FXDA 2RVJA 2UXBF 1VRUB 5CD4H 5A8RB 1SUQB 4DR3J 1K73T 4J9OA 3K8WA 3NS5A 3CDWA 5HMYA 2QG9B 5ETMA 3CJQA 4L3NA 1ZAWA 2BV3A 3PY8A 1IBMJ 4DL4A 3I0SA 3AB2B 5SZTA 3C19A 3DLGB 1I94J 3CC7S 1A7GE 2CG8A 1NCLA 2JFKA 1QAIA 3RZAA 3NGSA 1NPKA 2FLPA 4DJBA 4IKAA 4I4BA 4TVAB 2EBGA 2J9DA 4Y2MA 1LQ9A 2ZH2A 3T1YF 2W7AA 3P45B 5B0AA 4X4TA 5IT9U 1RWXB 2VPYB 3GZ7A 4UQGA 4USUA 1VQOS 1CLFA 1RU2A 2EW9A 2JFDA 1UJ5A 1HI0P 1XMOJ 3BV8A 2ZBPA 2YKAA 2WB1D 4HACB 3J80Y 1FDDA 3VGUA 1JLBA 1DFDA 1F9HA 4NEYA 2FQQB 4I2PA 2Q1LA 2M5YA 1HFEL 2HEKA 2FJWA 5GMDA 1IKYB 2HMIB 3PR4A 4CO3A 3B6BA 3N28A 4JV5J 4J9LA 3ZFVA 3LO3A 1U1RA 3HJFA 3K7RA 5CCMA 3D1OA 2FC8A 2WW8A 3ZZ0A 3CTRA 1U24A 2FHOB 4X65J 3HX9A 2D3ZA 2QLBB 3M32B 3FBEA 4AXJA 2VPWB 3M1VB 4QIGA 2NLWA 3UQSA 4O4RA 5HROB 2XI3A 3SQOP 4JYAF 3TOQA 2VBWA 3M30B 2D9PA 3IR7B 3H2VE 3CD0A 1EQ0A 2IJNA 3D6HB 3NAHA 2Y0BB 1Q86T 2RNEA 5LL6d 2HNDB 3EUNA 3T5HA 5L1IA 3CCTA 2DNMA 3D6TB 4C6AA 4DPUA 4RUAA 1S97A 4CLLA 5FLXU 4NLUA 1CS4B 4CO0A 3GIRA 4LFAF 3SSQA 4CO4A 1XC9A 3BDPA 5HVHA 1I51B 3LGHA 1TKDA 4I64A 2CDQA 2VC0A 3PRDA 2VBYA 1N4LA 1RCXB 4EBEA 1BE4A 3BB5A 3HT0A 4ED3A 2R8IA 4C97A
chains in the Genus database with same CATH topology
4HDHA 4RW8A 4PWDA 3ZZTA 3GR1A 1FRHA 3MAHA 3J81Y 2HS3A 3LP0B 2DH7A 6FD1A 1OWXA 3Q23A 2PMZD 3L3CA 3RAQA 2KB2A 1Q4RA 2EI5A 5B7WA 3ZZPA 3NWGA 4CNYA 3DC2A 3MR6A 3R1HA 5I42A 1Y7PA 1N32F 2DTJA 3W2VA 3DYAA 3CB4A 1TKXB 3TUZC 1HHSA 4K4ZA 2WSEC 2H5EA 1ZYQA 3U02A 1S0VA 1F9FA 3CMAS 3K0JA 1LW0A 2VA2A 4KKOA 2MKCA 3K8VA 2QEXS 4ETZA 5I3UB 4DF8A 3IS9B 2R2SA 5L1LA 2C42A 1JJ2R 3CJ3A 5IQQA 3DHXA 3VAFA 2YNIB 2M88A 2HFNA 3DRPA 1S79A 5GAHU 2W8KA 2ZBCA 1JJHA 1H3DA 3DCAA 1C4CA 4Y3CA 1LXJA 2R8GA 4HI1A 1FJGF 1HWLA 2K7KA 3UFCX 4F25A 5KG5A 4K5RA 2BQRA 2RRAA 1KFSA 2QZ8A 2U2FA 4C8NA 4LSNB 5A8WA 4ZKAA 1CPZA 4R5PB 1H6KX 4YR2A 2VBZA 4YR3A 3CWJA 2CQIA 5KOXA 1PC5A 2R7SA 3IG1A 5KFPA 4ZVFA 5HI7A 1JLCA 4C8KA 2UUAF 2DHXA 2UUTA 4ERDA 2M4MA 4JI2F 1NK9A 1Y3KA 4IDKB 3A8EA 1KOHA 1YITS 4NA3A 1OQ6A 3GILA 4O4GB 4ZCIA 1VQPS 3PX4A 4K4SA 3EPIA 4DSJA 4DV1F 2Z4PA 5KG3A 4DN9A 4DSFA 1NHVA 2NS1B 2X1BA 5KFKA 3F73A 2KZZA 3M30A 2X51A 2RKIB 2DR9A 3DOKB 1HWKA 1ZM2A 2VV5A 2BYCA 1JXEA 2ZJQQ 4TY8A 3T5KA 2OPQA 3K2YA 5AE3A 1YJ9S 2I0XA 5ITHA 2LKZA 5GMKa 3KJVB 2B4UA 4C3KA 2B5JA 3HI9A 1M1KT 3VAKA 3MFIA 4NLXA 4QU6A 4QWCA 3KTQA 2AF6A 4F67A 2GNKA 1GNKA 3M4XA 5J2MB 1X9MA 5D4LA 3LGNA 3P96A 4KHRA 1R0AA 2J7WA 2ZVSA 2RB7A 1HD0A 2VKZG 3KK2B 3BEGB 3VZHA 1RT7B 2BJEA 2DGUA 3CIZA 4FP9A 4P7TA 3G6YA 3KLHB 3HKZD 4O3PA 2NPFA 2XMKA 4F4WA 2G13A 4A8XA 1VRTB 4DR3F 1U48A 1ZPVA 5HBMA 3PXGa 3OR1B 3QAUA 5M2UA 4AL6A 4BS2A 2IAJB 2ZUGA 5T7LA 2DH8A 2KG1A 1U7LA 3C8YA 1Z2ZA 2MQLA 5J1NA 2HVIA 1BQMB 1C2PA 5MLCV 2YVSA 2FVSA 4NCGB 1JLQA 2VL1A 4FXVA 1KVIA 2EK1A 3MOJB 4ELVA 4Y2AA 1FDNA 1FTCA 2HQ3A 6FDRA 3QO9A 1GXUA 2YY3A 2XEXA 1N48A 2QO3A 2NPIA 3H5UA 4DBQA 3G8TA 4ILRA 2OFHX 4FF4A 2LYVA 4JI7F 2Y0SD 1IBMF 2ZDOA 2B3TB 4URGA 1H2UX 2BVZA 5J2PA 3VQTA 3K5NA 3LAMA 1QAYA 1UJ4A 2JZ5A 3I87A 1AROP 2RU9A 3MM9A 2JEGA 4ED7A 1RI7A 1ULRA 4IFVB 2FJVA 2B4PA 3IA0A 4I68A