3DI6B

Hiv-1 rt with pyridazinone non-nucleoside inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
424
structure length
400
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery and optimization of pyridazinone non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (hxb2 isolate)
total genus 119
structure length 400
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3di6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6B04
5KFEA 2ZD1A 3G6YA 4O4GB 3MECB 3IS9B 4WYLA 4J9LA 5DLFA 3MR5A 1LWCA 3M8PA 5F9LA 1TL1B 1ZTWA 4JV0A 3N6NA 5KT2A 5F9NA 1EETB 2YNHB 1YVFA 4QW9A 4KFBA 4ZP9A 3DLGB 2IM3A 1C1CA 4WE1B 2GC8A 1N6QA 1RTDB 3BSAA 4O3SA 4RW6A 2FLPA 3H2LA 5J2MB 5JXSA 4TLRA 4LSLB 3ITHB 4O44A 2D41A 2UVWA 5F8IA 4O3RA 3PVXA 4KAIA 1DTQB 3MR6A 1C1BA 4I2PA 3N6LA 4NLQA 4K4TA 1T03B 2RKIA 2WOMA 4QWEA 2V4RA 4WZQA 4MIBA 3PR4A 5KT7A 3QLHB 5KFJA 1BQNB 4URSA 2ASLA 3KHRA 3V4IB 4ZVGA 1S97A 3DM2A 4KKOA 4RW9B 1RTIA 3EPIA 1WNEA 5KFZA 2WRMA 4KB7A 3T5KA 4TYBA 1RAJA 3KMSA 1S4FA 5J2PA 4J9SA 3V6DB 4NRUA 2JC0A 2W9CA 1JLFB 1TKTB 1RT7A 4RW8B 4PWDA 1HARA 2W7OA 3QGGA 4ED0A 4M95A 1NNDA 4ZPBA 2B6AB 2YNGA 4RUCA 4K4UA 3H4BA 3I5CA 4NLWA 2C2RA 4EO6A 2W8KA 1DTTB 3KK3B 4WZMA 3PW0A 3FQLA 1OS5A 3HHKA 4RW4B 5F8HA 4Y2AA 5KFDA 2YKMB 3E01A 3HVAA 5KT4A 4TY9A 2FJXA 5HBMA 4TXSA 4ZPCA 3NKYA 2FVPA 1HNIA 2IC3A 4URGA 2I5JB 3RB4A 4RW7A 2YKNA 2HNDB 3MEGA 4IFVA 4ZHRA 5I42B 4K4WA 4R8UA 3LAKA 4KHMA 3OL7A 2E9RX 4KV8A 2R8JA 1LW2B 4DEZA 3GYNA 5DLGA 1IKWA 1LWEA 1NHVA 4K4SA 1TVRA 1IM4A 3KHGA 3QO9B 2W9AA 1I6JA 3MTKA 3CO9A 1RT1B 2HNYA 1S0NA 4MK9A 1LW0B 4EBDA 2B5JB 3ISND 3QZ7A 3KJVB 1S1VA 5J2QB 5DQGA 2GIRA 3TQ1A 4NLDA 4ECVA 2IJFA 3FSIA 2HWHA 2XGQA 2VG5A 1SV5B 2WHOA 1HPZA 5L9XA 2HNZA 1S9GB 4KSEB 3EZUA 5KFYA 3HVTB 2VA2A 5F8NA 3Q8QB 1TKZA 1RT6A 2R2UA 4IFYA 1KLMA 3T1AA 1S1UA 3QGIA 4FS1A 4DL2A 4YMEA 4ECWA 4ZPDA 5F8GA 3KHLA 1QAJA 4IQXA 2VG7A 3FFIA 4NLUA 5J2NA 5EWFA 5I3UB 3GV7B 3DOKB 3NL0A 1N56A 5KG7A 3KLGA 1RA6A 5F8LA 1C0UB 4H4MB 3Q8SB 2ZD1B 4NLYA 2YNFB 4R5PA 3DDKA 1XR5A 3PZPA 4DG1A 5C25A 1LWCB 3M8PB 3KK1A 5KFTA 1BQMA 4TN2A 5DG9A 3Q8RB 1R0AA 4O3PA 4QWDA 1QAIA 2ILZA 4KFBB 5KFOA 1RT2A 2XC9A 4NLRA 1N6QB 1CSJA 3OLBA 4NCGB 4J9PA 3V6JA 1S0OA 5KG5A 5FDLA 3I0RA 4TQSA 3DLEA 4YR0A 4QWCA 3NAHA 2I1RA 3KLVA 1S6PA 4O44B 3MFHA 3PW4A 1IKXA 1ZETA 1J5OB 4EO8A 1C1BB 5HLFA 1JLEB 3DLKA 3I0SA 4I2PB 2IM2A 2RKIB 3JYTB 5HROA 2XI3A 3CDEA 3LP0A 4IRKA 4RZRA 1N48A 1TKXA 4Y2CA 2BRLA 5J1EA 3NBPB 2HAIA 4B3OA 2JEJA 3DM2B 4ICLA 2IAJB 4KKOB 3IRXB 1T05B 1RTIB 2R8HA 4J9RA 5T14A 2VG6A 3NMAA 2C2DA 4XPEA 2OPRA 1HQEA 1S48A 1S9EA 4ED7A 5J2PB 5DQIA 1JLQA 4PQUA 3BR9A 2RF2A 1RT7B 4PWDB 1XR6A 4LQ9A 2IJNA 3KOAA 3CWJA 3KNAA 2FVSA 1HNVB 4YR2A 2YNGB 1HYSA 3T5LA 1FKPB 1JLGA 4IG3B 4G3IA 4H54A 1QUVA 2ZE2A 2C28A 2UVUA 3KLIA 5HP1A 4I7FA 5C24A 1N5YA 3RB6A 2BQ3A 2BR0A 3DI6A 4EEYA 4K4VA 2E9TA 4U7CA 4JV1A 4WFYA 1HNIB 4WFXA 2IC3B 5KG3A 5KFQA 3I5BA 3QIPB 3KLFB 3MEGB 2WONA 4ZHRB 1S49A 5D3GA 3CJ5A 3T5JA 3JSMA 5C42A 3MEDA 4MK7A 2V9WA 5K14A 3PR5B 2R8IA 2BANA 3D5MA 4KV8B 5DG7A 2JEFA 2BE2B 3BGRA 1LWEB 2QV6A 2HMIA 4NLVA 4NLPA 2XGPA 1RTHA 2IM0A 3M9MB 2D7SA 3H40A 5L1KA 3RAQA 4IRCA 3LP2A 4H4OA 1K1SA 2V0NA 1EP4A 4QWBA 3DRRB 4J9NA 1TL3B 3CJ0A 3TVKA 5DGBA 2IA6A 3OSPA 4DL4A 4Y3CA 1RT5B 5KFMA 2HNZB 3IS9A 3MECA 4MKAA 4X2BA 1GX6A 3CIZA 2F8EX 2XWYA 2J6SA 1S9FA 1TL1A 3LAMA 2FJWA 3D28A 4G1QA 3UR0A 3NAIA 1SUQA 2C2EA 4MFBA 2DPJA 2R8KA 1HMVB 1TKZB 4IFYB 1KLMB 3GV5B 1REVA 2WTFA 3MR3A 3GQCA 3OL9A 4WE1A 3SFGA 1IKVA 4ID5A 2JLEA 1IKYA 2CKWA 3T19A 4Q0BB 2W7PA 4WXWA 3CJ3A 4WFZA 1D1UA 2OPQA 5J2NB 3H98A 3KK2B 4LSLA 3ITHA 4YQWA 3M8QA 2AWZA 3BQ0A 4WYWA 2OPSA 4WXOA 4QPXA 4JV2A 1DTQA 2EC0A 5KG0A 4TY8A 1FK9B 1T03A 5KFSA 3KMQA 1TV6B 4LSNB 5KFWA 4GC6A 4NLGA 1BQNA 4R5PB 5CYQB 4DG1B 2GIQA 3KK1B 2HWIA 3V4IA 3UDLA 5KFFA 4J9KA 1RTJA 1S6QA 4KO0A 1R0AB 2FVCA 3LALA 1RT2B 2OPPA 3OL8A 4HKQA 4ZVHA 3T5HA 3DOLB 1NHUA 4RNFA 3C6TB 5FDLB 2FVRA 1HQUA 3TAMB 3V6DA 3DLEB 1JLFA 1TKTA 1C2PA 1KHWA 3IGNA 4MK8A 2B43A 3UPFA 1S6PB 4RNNA 3V6HA 3DYAA 3RB3A 2C22A 4IDKB 1S1WB 4ZVFA 4ECXA 3FDSA 3QGHA 5HLFB 3DLKB 1RT3B 2YNIA 1KHVA 1W25A 2D3UA 3LP0B 1DLOB 4PUOB 1TKXB 5J1EB 2AQ4A 2O5DA 3C6UA 4B3OB 2R2TA 4XPCA 4KE5A 1S1TA 4LQ3A 5KT6A 1JLAA 2IM1A 1S1XA 3BSOA 1S10A 1S0MA 3VQSA 1MMLA 2VG6B 1D0EA 3V81A 3H59A 2AX0A 1HQEB 2WB4A 1UWBA 5DQHA 4URQU 5I42A 5EDWA 3GIJA 3QZ8A 1JLQB 1C1CB 4O3NA 5KFCA 5KT3A 1K1QA 3PJWA 2RF2B 2RDJA 2OH2A 5KG1A 4RW6B 3MF5A 3HKWA 5CYMA 4RU9A 2WK4A 4Q45A 2VA3A 1XR7A 3H5UA 2W8LA 4EYHB 2RDIA 3KLHA 4IR9A 1JLGB 3CVKA 4R0EA 3GILA 4J9QA 3NGDA 3BJYA 2B5JA 3KJVA 5J2QA 2R8GA 3MEEA 2ASJA 3GV8B 5EUHA 3KLIB 2WOMB 4I7FB 4ED1A 3DRPA 5KFUA 1SV5A 1T3NA 5KFPA 3E51A 1TQLA 3BSCA 4O4RA 2ALZA 4ZP8A 1QE1A 3MFIA 1JXLA 4NLSA 2XCPA 4ZMMA 4ECUA 5D3GB 4Q8EA 2BQRA 3PW2A 1T94A 1FKOA 3MEDB 1RA7A 4Y34A 5K14B 3IG1A 4Q8FA 2BANB 1C0TA 3BSNA 1MU2A 4IG0A 4EYIB 3BGRB 4ECTA 2IMWP 2W9CB 4J9MA 1VRUA 1RT4A 5I3UA 4H4OB 4IH5A 5F8MA 1RYSA 1JLCA 1EP4B 1JX4A 3SI8A 4KHRA 3N6MA 2W9BA 3KLEA 3FQKA 2AU0A 1TP7A 2XI2A 4QWAA 3CDUA 5DGAA 2AX1A 5KFHA 2YNFA 2R2SA 5KFLA 3E01B 3RAXA 4ED6A 2AGPA 2FJVA 3H5YA 5KT5A 4G1QB 5HBMB 2WCXA 1SUQB 5KFNA 4MFBB 3KHHA 3DMJA 2R2RA 2E9ZA 3BREA 4OL8A 5KFAA 1JLBA 1REVB 4RW7B 2YKNB 4IFVB 4IOBA 1VRTA 5KFXA 3G86A 4ECZA 3PW7A 3RBEA 1IKVB 4ID5B 4R8UB 1IKYB 4FS2A 4NCGA 4TYAA 3OHAA 2OPQB 4FBTA 5EWEA 2UUTA 1IKWB 1LWFA 1TVRB 3M8QB 2D3ZA 4RUAA 2OPSB 2HNYB 1J5OA 3CJ2A 3LP1A 4TQRA 3M9NB 3DRSA 1JLEA 4TY8B 1S1VB 3JYTA 4IH6A 3OL6A 4ECRA 4I2QA 3H5SA 1JKHA 2VG5B 5L1IA 3NBPA 2AGOA 2CJQA 1HPZB 4O4GA 4XO0A 4F4YA 1T05A 1RTJB 1S6QB 2IAJA 3IRXA 4KO0B 1N4LA 4M94A 5EWGA 4RNMA 3OLAA 4DL6A 4K50A 3HVWA 4F50A 2OPPB 4ECYA 1EETA 1RT6B 2YNHA 1U09A 1S1UB 3PHEA 3DLGA 1HQUB 4HYKA 3V6KA 1RTDA 4DL5A 3I5AA 1RDRA 4ED2A 2VG7B 3DYAB 3FFIB 1HNVA 5J2MA 5L1JA 1FKPA 4IG3A 2YNIB 4IRDA 4IR1A 5L1LA 5KFKA 3KLGB 4ECSA 3PW5A 3G6VA 5KFRA 3C6UB 4NLXA 3QLHA 4RNHA 4U6PA 4O3OA 2XCAA 2FVQA 5KFIA 4F4XA 1S1TB 1JLAB 5C25B 1S1XB 2ILYA 1BQMB 2FLNA 4EBCA 3H5XA 3M9OB 4RW9A 3GIIA 3V81B 3QIPA 3KLFA 2DPIA 4K4XA 3ISNC 1UWBB 4Q43A 3Q8PB 4ZVEA 3UQSA 5CYMB 3H4DA 3SFUA 2BE2A 3I0RB 2BRKA 4RW8A 1Z4UA 3GIMA 3KLHB 1SH0A 2ATLA 4NYZA 1IKXB 4YR3A 1ZTTA 2B6AA 3IN5A 3DRRA 3MEEB 5KFBA 1TL3A 3I0SB 5HROB 3DRPB 4ED8A 2ZKUA 3CDWA 2JEGA 4GC7A 4FBUA 4KBIA 1DTTA 3KK3A 3RBDA 1RT5A 4RW4A 3OHBA 3EPGA 1QE1B 2YKMA 3PJXA 4ICLB 5DG8A 5KG2A 4K4YA 4K4ZA 4O3QA 2UVRA 4ZP6A 1HMVA 1SH2A 3OSNA 2BQUA 4NLOA 2I5JA 1FKOB 1RYRA 2HNDA 2OPRB 3IG1B 4ZP7A 5JUMA 4Q44A 1C0TB 1S9EB 3QIDA 5F8JA 1MU2B 4IG0B 4Q0BA 4PQUB 4YP3A 1VRUB 1RT4B 5KG6A 1LW2A 3RB0A 3KK2A 1JLCB 1HYSB 3ICLA 4DL3A 3QO9A 4RNOA 1RT1A 2W9BB 4F4ZA 1LW0A 3KLEB 4NRTA 4JUZA 2FLLA 1FK9A 2ZE2B 2V4QA 4EBEA 3BQ2A 2ASDA 1TV6A 4LSNA 5HP1B 5C24B 1N5YB 3QYYA 3MR2A 4QW8A 5CYQA 3G6XA 2IBKA 3DI6B 1S9GA 4MIAA 4NLTA 2J6TA 3DMJB 2UUWA 1JLBB 4ZPAA 3HVTA 1VRTB 2WONB 1JIHA 3GIKA 5KFGA 3JSMB 4NZ0A 5C42B 3DOLA 3C6TA 2AGQA 5KFVA 3TAMA 3FRZA 4MKBA 4IH7A 5KG4A 4MH8A 3CJ4A 4IKAA 1GX5A 1LWFB 2JC1A 2HMIB 4DL7A 4F4WA 1RTHB 3LANA 4IDKA 1S1WA 2UVVA 3LP1B 3BQ1A 3DOKA 3DRSB 3LP2B 2QE5A 1RT3A 4ECQA 2J6UA 4I2QB 1SH3A 1DLOA 4PUOA 5C5JA 1C0UA 1JKHB 4ED3A 2JEIA 4H4MA 3IGVA 4J9OA
chains in the Genus database with same CATH superfamily
2B8QA 1XNRF 4M5DA 4CRJA 1ZTWA 1IBKF 1NMEB 3HD2A 4UOCA 4DFKA 1HNZJ 2FLPA 2VOOA 1Q82T 3W2VB 3MR6A 3MHYA 4PPZA 3BYPA 1QM9A 3HFKA 1N8RT 4N5SA 3GJRB 4UT4A 4J5OA 1EAYC 5DRKA 2PMWA 2FZCB 3GR0A 1FNOA 3OTDA 4EO6A 3FQLA 1OS5A 1UW4A 2PD1A 4TY9A 2ASYA 2IC3A 3C15A 4K4WA 4R8UA 2RAQA 2MJNA 2E9RX 1TL7A 1E6YA 1RT1B 1VQ9S 1S1VA 5J2QB 3JQJA 1WG4A 1NKBA 4YHHF 2ZFHA 1OIAA 1FRXA 5F8NA 3I96A 1RT6A 1MLAA 3BO3A 1ZA1B 2KKHA 5KG7A 2DXEA 1NB2A 3NS5A 5CA5A 4DHVA 4CIOA 4ZDNA 5KFTA 2QMWA 5ETSA 1RB0A 3Q8RB 1R0AA 1TL5A 4KFBB 2UXBF 2FLOA 4DN0A 3K8WA 3MCOA 5HROA 4NI2B 2XB2D 1UKUA 4KKOB 4J9RA 3GFYA 2XY5A 3P8BB 2YBVA 2RF2A 1VI7A 2HVHA 4K8RA 1AB8A 1CQMA 3M2RB 4RJVA 4YR2A 4UY85 3QAEA 1UEUA 5KAKA 4ATNA 4FYWB 2OHDA 5GADU 4U7CA 4UY8T 5KG3A 3J7AN 2Y0SD 1GK8A 2MZJA 3CJ5A 2R8IA 3CJTA 2RQKA 4LFBF 2ZEJA 3MM7B 3MD3A 4J9NA 1NCLA 4TU7A 3CGIA 1TL1A 1H2TZ 3HJVA 3N01A 4RBUA 1KR4A 1WC4A 1GXUA 1WG5A 5E3AA 2FGOA 1RQ0A 1XMQF 1YKWA 1D9DA 3KK1B 1Q8LA 1S6UA 2JFKA 2KZZA 2KYZA 1LXJA 2OPPA 4R0JA 1XN9A 1FCAA 2KFZA 5IV4A 3CO0P 4KR0B 3UPFA 4IDKB 4ECXA 3ZZTA 1RT3B 3IBFB 1TKXB 4FYXB 4M5KA 4NASA 3WHIA 1MMLA 1HL6A 4FPRA 3GONA 1FDBA 2JVOA 3HHDA 2RDIA 4IR9A 1JLGB 2O1PA 2LDIA 3P49B 1FWKA 1PAEX 4DZDA 3GV8B 3DRPA 3H25A 3P5TL 1Y5LB 4OZ2A 1D8ZA 1IWAA 3CUNA 4M5HA 4USKA 1IR0A 4U7UK 4CO1A 2CPFA 3MEDB 1UVMA 1OYEA 4ECTA 1U0HA 4DOZA 4DR6J 4Y6IA 2UXCJ 3ENVA 4LF7F 3KFWX 3TNVA 3RAXA 2MQOA 4JBCA 4CLWA 3UN5A 4MFBB 2X3GA 1REVB 4HTIA 4ECZA 1IKVB 4CT9A 4OHWA 2HNYB 3M05A 4QZVB 1X31C 1B0PA 3OL6A 1KFDA 2VG5B 3NBPA 2KXNB 5JVHQ 4ZN1A 5A6WA 1JJCB 1JNZB 3D7SB 4WBFA 2KT3A 4ED2A 3M2UA 3K5NA 4C0OC 2DGOA 2F4VJ 3BF4A 4AQYF 3TR5A 2FLNA 4RW9A 1AZSA 3T1YF 3IR5B 1KNZA 4LRDA 1WTBA 2KT5A 4NXMJ 4P9SA 2ATLA 4YR3A 3HHNB 3MEEB 3TZWA 2ZKUA 2CZ9A 2VFUA 3EPGA 4ICLB 3P45B 4BDPA 1QUPA 3DDIA 1FX4A 1Y3KA 3IA0A 5IT9U 2MGZB 1YBAA 2Z58B 2M4MA 3U1LA 4NRTA 4JUZA 2CQPA 3A8JA 4PWUA 1V5VA 2DHHA 2PDAA 3HX9A 1KKHA 3GLJA 5I3PA 3EICA 4WIIA 3I56S 2XNQA 3CJ4A 3QJLA 2JEIA 1JKHB 2HVZA 3IGVA 5CAAA 4J9OA 4CLZA 1F3FA 1BD6A 2B7CB 1M5PC 3M8PA 2CPZA 4JV0A 5ETOA 3ZTRA 2HIQA 2YNHB 4B3MJ 1MWQA 3DCAA 1U45A 2YX7A 1VFJA 3CCQS 2D41A 4UUXA 1FJCA 2PC6A 2CNNB 3AD7C 3HM9A 2ZH2A 4A8OA 3MMBB 3LGNA 2MB0B 4USVA 3E8OA 2ZH5A 1TKTB 1RT7A 5M2PA 1I3OB 3JSRA 1NNDA 2U1AA 5SUHA 4UZCA 2OD4A 1J2VA 3PW0A 2PN6A 3KUHA 4X4UA 4NXNJ 5HBMA 3KXDA 1L3VA 3NKYA 4DSJA 1S5ZA 3L7OA 2L9DA 1TVRA 1S0NA 1I6JA 3ISND 2CPXA 4IQMA 4ECVA 2XGQA 1WKKA 2CUYA 1HPZA 2XMMA 2ZBRA 3AAWB 3U27A 3J80Y 4OI2A 1RCXB 2V8DA 5A0YA 5I3UB 4RU2A 2VFVA 1EHWA 5K20B 4DXLA 1XR5A 2HQFA 4QWDA 2CQCA 3V2UC 4NLRA 3AJ2A 1AUDA 1IKXA 1IBMJ 4EO8A 3K17A 4I2PB 1WC6A 3G82B 4IRKA 4GRSA 3IBWA 1ZM9A 2ZJQQ 3NS7B 2XWXA 1RI7A 2VG6A 2XMKA 1S9EA 4ED7A 3HFVA 3M30A 1UCNA 1WC5A 3GP9A 2DIUA 4F4AA 4G3IA 3BGFA 2YX4A 3L9ZA 1QSLA 3M1VA 2DNRA 4K4VA 4ZHRB 4PKDB 3RUBL 5G0RB 5C42A 5K14A 4WPAA 3VVTA 3BGRA 2D69A 4NLPA 2IM0A 4JI4J 1RE1B 3LTOA 4QWBA 2UUCJ 3OBIA 3ZTSA 2V2QA 5KFMA 2KT2A 1FFWB 1HW9A 3L7UA 3O2IA 3Q8VA 1EB0A 1AA1B 2K3IA 2Y9HA 2JLEA 4Q0BB 2B9XA 1KTQA 3TAQA 2YVSA 3G9CA 4WXOA 5HO4A 3M32A 4KH1B 1Q8IA 1VISA 4NYOA 5IM0A 1X9MA 1MSWD 2QLFB 1YZ6A 4RNFA 3TAMB 3Q0AA 3QGHA 2ZHAA 2H4YB 1W25A 2MTLA 3CSKA 4C6AA 3MMCB 5CQGA 4DV4F 4LRFA 3H59A 5T7LA 1VQLS 1HLWA 5LXYA 3ENWA 3PJWA 5CHCB 5KG1A 2VA3A 2MZTA 4JI3F 2OD6A 3X1LB 4DS5A 2R8GA 4OMFG 4ED1A 5E3RA 1U1PA 4Z7YA 1U8SA 3FEXB 1FE0A 2LXFA 3ETMA 2F8MA 3RYLA 1FI4A 1WKLA 3MAHA 2OO4A 1UPPA 5F8MA 3GWCA 4K7QA 3SEOA 1MN7A 2JSXA 1UETA 3CDUA 1NSKL 2O01C 3BREA 1NUEA 3PW7A 2B51A 3BYRA 3CCMS 2AEMA 1J5OA 2L9NA 4IH6A 3C14A 4DF8A 3AT1B 1BMQB 4HLBA 2CG8A 4KQZA 3I5AA 3ZZ0A 5J2MA 2YNIB 3UNYA 4IR1A 4IRDA 5KFKA 3R6GB 5B0GA 3N4WA 5KFRA 4X62F 3CC4S 3ISNC 2NSBA 2ZH8A 3Q8PB 2D74B 5DDPC 1UVNA 3MI7X 2BRKA 4P10A 4D3HA 2HHPA 5KFBA 1ZBTA 2EFGA 2UVRA 4OYBA 2BW7A 2FC8A 1A0OB 3AHPA 5ETMA 2RDDA 3SIPB 4YB6A 5D4LA 2NREA 2Q6CA 1TAQA 1Y00A 1SIZA 3LWMA 3LO3A 2F9JA 2CNKB 3OXGA 4PXDA 1S9GA 3PACA 5JMNA 4K59A 3IXQA 2WONB 4UOFA 4NZ0A 3PXGa 5KFVA 3D54A 1A7GE 4F4WA 2HZCA 3LPYA 1RWMB 1FEEA 1NSPA 1LWCA 2IIHA 1XQIA 4WE1B 2VQFF 4O3SA 2ZVSA 2BUNA 1X5PA 4LSLB 2WOMA 2HPUA 1ZA2B 4YEAA 2YKPA 1U1RA 2CADA 2W2NP 1KBRA 4GVBB 1UJ4A 4PYDA 2Y0BB 3FNNA 4CI0B 1BUXA 4PWDA 2GQ2A 5B7WA 1Q95G 4K4UA 3HHEA 4NLWA 1U7LA 2K06A 5GAEI 4A8YA 7FDRA 1VC5A 2CQBA 4Y2AA 3VGVA 2PEBA 4WK1A 1OY6A 2XZTB 2OMOA 1FTRA 4DV3F 4Z37A 4RW7A 4XDCA 4N7TA 5DM7Q 2DR5A 3CJKB 3NNCA 1IKWA 2GJ2A 3KHGA 1RADB 3QZ7A 3LA0A 2W24A 4DBQA 5ADZA 3EZUA 4B3SJ 1TFWA 2ZZMA 2MJUA 3T1AA 1S1UA 1G1XA 1UTAA 1UVKA 1WOOA 3DC2A 3KLGA 2CNOB 4M1KA 3Q8SB 3HXMA 4M5DB 2R42A 1HD0A 4MTPA 2D9OA 3D3CJ 5KFOA 4OYAA 3BBBA 2F5GA 1F9HA 2DGSA 3KLVA 2PMZD 1S6PA 2GQQA 3JSBA 1XMOF 2GMLA 3CJQA 3VQSA 4RZRA 2HAIA 3TEGA 2R8HA 5A6PA 4G1PA 4JI1F 2NLWA 1DFDA 1VJQA 4CM0A 1D09B 2BEFA 3AB4B 1CULA 3FMWA 4ANEA 4P2MA 4QQBA 2P9EA 2IC3B 3C16A 3I5BA 3KLFB 2JLGA 3TWZA 2P6SA 4FXVA 2BANA 4ZKAA 1J5EJ 1KS2A 1RTHA 1RBLA 4EFAC 4DL4A 1CPZA 2HYIB 3CD6S 1EZZB 1IKYA 1KTVA 2YWWA 4QIEA 4CQ1A 1FRKA 3IWNC 3CDAA 1CS4A 3BQ0A 4JV2A 2AYMA 1N88A 3KMQA 4GC6A 4F3OA 1I1GA 2HGLA 4DQPA 1R0AB 3TJ8A 2RHQB 2JWNA 1QSYA 4ZVHA 5ETVA 3OFHA 2FZKB 1C2PA 1SCJB 4MK8A 1YJ9S 3U1MA 4CP5A 2GHPA 1FWPA 2Z8QA 2VKZG 4KE5A 1RJJA 5KT6A 1JLAA 3VAGA 3J81U 2A10A 3DLHA 3V81A 2RU3A 5HJYA 3GIJA 5KT3A 2RF2B 1QSSA 1PAUB 4Q2LA 2B5JA 1HBMB 4ERDA 1PG5B 1F2GA 4F04B 3HVRA 2CPJA 2YKAA 3U02A 3R97A 4U8VA 2W9BA 4X4SA 1UW9A 5KT5A 5KFNA 5BR8J 2HFUA 3NGTA 2J9EA 2QC3A 2E1CA 1RAEB 1Z2ZA 1S7HA 5B0EA 4L3KA 1VIXA 2EPIA 5HQLA 4DR7F 4CLYA 2OPPB 3WIUA 2YQ3A 1JJ2R 4LR9A 2VG7B 2BJ7A 4ECSA 1ZH5A 8AT1B 3CCJS 2ILYA 1KRPA 3QFWA 4PEOA 1QD1A 2D3OR 4DR3J 4RL1A 3MTJA 1N54B 3KUEA 1NXIA 2MHNA 3DRPB 4GC7A 1GMWD 2DH8A 1S4EA 3D9BA 2WSFC 4OYMA 4P73A 4X4RA 4YP3A 1U0HB 1NDCA 1F60B 1HYSB 2UXDJ 4ZIVA 4I64A 2ZE2B 3BQ2A 4DPTA 2I6WA 3DLJA 1BE4A 4QU6A 3JAMU 2EBEA 4ZPAA 1JIHA 3D3BJ 3PX6A 4FZVA 1GX5A 1RBAA 4NL5A 2AD9A 1SBRA 3G4SS 3D1QA 5KT2A 4HTJA 4DX7A 2ZOGA 1C1CA 3BSAA 3H2LA 3M2UB 2H51B 1R6YA 1DTQB 2QL9B 1IBLJ 3FSYA 2BYCA 4RW9B 1AZSB 4OZ5A 1U02A 5E33A 3AB2B 1PKUA 3OFEA 4JV5F 3V6DB 2W9CA 5G4DA 1U24A 4EMDA 2J9DA 1CJTA 1TTHB 2Z4PA 2CJKA 1RAAB 4BCAA 3EUNA 1KN6A 2FJXA 2FVPA 2BOAA 4DR2F 5DM6Q 2BV3A 4ES1A 4KHMA 2Z57B 2I38A 2R8JA 4DEZA 1Q79A 2ZHBA 3KJVB 4EWTA 3TQ1A 4KGMA 1VMBA 5K8MA 5KFYA 2JHEA 2V68A 4DL2A 1C4AA 3KHLA 5EWFA 3GV7B 3NL0A 3QFHA 1G3OA 1FJGJ 3M8PB 4TN2A 3K57A 1QAIA 2XC9A 1CSJA 4OZJA 3V6JA 4LF8F 3I55S 1WELA 3MPWA 2LFVA 2NSCA 2RB7A 2MY7A 5AJ3J 2BRLA 3W8PA 4BBYA 2JEJA 4CYUA 1MN9A 3PYEA 5BYSA 5T14A 4RR5A 1Q78A 4PQUA 1RT7B 3CWJA 3KNAA 3I87A 1VHFA 4M63A 1FVSA 4DUYJ 2HHTA 2AZ1A 1M5KC 2XSJB 4Y28C 4OHYA 4IO1A 1CC7A 4PAAA 1NRKA 5GAEU 3T5JA 3MPDA 4MK7A 2QV6A 4IRCA 1GMUA 2V0NA 3DRRB 4B3TJ 3TVKA 2GGPA 4I0WA 1RT5B 3B4MA 4G1QA 3MR3A 4PABA 1PJ7A 5D4NA 5A0YB 3J7YU 3ZZRA 5DZ6A 2NYIA 3CW2C 3P5BP 1ZPWX 1B3TA 2HBYB 1VHIA 2IJRA 2Z0GA 1BC6A 3UDLA 2Z2MA 3J80U 3OTCA 3LALA 1IM6A 1UWAA 3T5HA 3SCLE 4ETZA 2QJ3A 3PO4A 2D3UA 4C2MA 1IR1A 2O66A 1P27B 2VG6B 5B0DA 2AX0A 4TU8A 4YY3F 3PFOA 4C4WA 3M30B 4AFFA 3QSIA 4HT7A 3ELHA 2EVZA 4ED5A 3BGUA 3SXLA 1NEEA 3M1VB 2B4OA 1QE1A 4L73A 1SJFA 5FLXU 3SCKE 2NR0A 1RA7A 5K14B 3IG1A 2XYHB 5IOLA 2B9YA 3BGRB 4J9MA 2V63A 2OIHA 1RT4A 1JLCA 2HBRB 4WKRA 2ZH1A 3P4UB 3OR1A 3R7SB 5KFHA 2C2NA 3GIRA 3LOUA 3MGJA 2E5LJ 2VICA 1VC0A 5EWEA 2DBBA 1U25A 2D3ZA 3OT9A 2GO9A 3CJ2A 4TQRA 4LF6J 1JLEA 2K1RA 1XIQA 3M32B 1LEOA 5IM0B 4LREA 2CPEA 1U09A 2PEHA 1RTDA 2XS7A 4A47A 4USIA 5L39A 4KGXB 1B7YB 3QLHA 2FVQA 4ENOA 2AT1B 2NXJA 5T7LB 1FXRA 2DT9A 4DCOB 3CJRA 3CD5A 3M2VB 3I0SB 2IHR1 2X7IA 1KEKA 3CB4A 2FY1A 4K4YA 1OJ4A 2CQ3A 4USHA 5D78A 4G65A 1JQGA 3WX4A 3MM5A 4FXWA 1R3NA 2AJ4A 2Z2LA 5C24B 4A8MP 5ETKA 1RWXB 5KFGA 1S6OA 4RKUC 3TJAA 1X4HA 2EXUA 2MYFA 3EGWB 1CJUB 5C2GA 3C14B 4M95A 3M8RA 2J7WA 1CQNA 1VLOA 4ZLJA 3VAKA 3M8YA 3HT3A 3MDFA 2NUUG 5J2MB 1SKSA 2L41A 2LLZA 3CTRA 1Q81T 2R4FA 1UAWA 1CJKA 2HS3A 1C1BA 4DV7F 3PX4A 2ZZNA 3NGRA 5DZ7A 5KFZA 4WU2A 4K2XA 3TRGA 3MD1A 3MAAA 1DHMA 1FKAF 2VFRA 2C2RA 2W8KA 4WZMA 5HI7A 1XNRJ 2XO7A 3CF5Q 1IBKJ 4MJKA 2HZAA 2Y1JA 3IO1A 1MWYA 1Y3JA 4OHZA 2GAGC 2HNZA 1S9GB 3BPDA 2GJFA 3NG8A 1NK5A 4H4KA 3QGIA 4DPOA 2DHGA 3W63A 1T9WA 2Q79A 2KI2A 4LBPA 1LWCB 2OMLA 1RT2A 1T8EA 1VJWA 1BGXT 4B9UA 5FDLA 3DLEA 2QA1A 1YDLA 5HLFA 2VKRA 3MAQA 1MROA 4YHHJ 4OYXA 4P72A 4X4QA 2HK2A 3N28A 1WOSA 2V5HG 3S1TA 4E98A 1JLQA 2QSWA 2RS8A 4PWDB 3KOAA 2HG4A 2C28A 2OUGA 2BQ3A 3T1HF 3DI6A 1K8AT 4USMA 2UU9J 4LRBA 1FHTA 2BE2B 2UXBJ 5D15A 1H7XA 3LP2A 2KDOA 4U96A 5DGBA 4F67A 1F1BB 2DPJA 1T11A 4UQTA 4TVAB 2HFNA 3T19A 4WFZA 2QT7A 2AWZA 5GMKa 1R8CA 5CXTA 4ZCIA 2RHSB 3LW5C 2LU2A 3Q83A 4LF1A 1VQKS 4O23A 1S76D 1NB7A 2F40A 1M5OC 2PGCA 2Y1IA 4N8NA 2HLTA 1S6PB 3D66A 4BS2A 3RB3A 1S1WB 2J8SA 2PE8A 4DFJA 2R2TA 1VR6A 4ZN3A 1NJZA 2OH2A 1PC4A 1AFIA 3AY0A 3MURP 5CCLA 1CULB 5J2QA 3KJNB 2HWTA 4P52A 5EUHA 3E3XA 4QYZJ 4NLSA 3C16B 2LEPA 2K3KA 5A8RA 1XMQJ 1U6ZA 2BANB 3I31A 3TO8A 4IG0A 2ATCB 1UL3A 2VC0A 2ERRA 3ZNUA 4FF1A 3FEZA 1L3TA 4KHRA 3G8TA 3FQKA 4I6AA 3E01B 1V6HA 3R5DA 2YKOA 5KFAA 4IOBA 1VRTA 2XTJP 1IKYB 3QSYB 3UVJA 1OYDA 4WCEQ 2DHSA 3LP1A 2E1PA 3TW0A 2WVBA 4NI2A 2BACA 3C8YA 4O4GA 1G4CA 2BZ2A 4F4YA 3AQPA 4Y0FA 4ILRA 3HVWA 1SIWB 4F50A 5GVQA 2COLA 2MQNA 3MMAA 2VBXA 5KTQA 4F4XA 4U6PA 2XNRA 2MSTA 1JLAB 4DUTA 4LF7J 3V81B 1U0SA 4WIQA 2FUG9 2QMXA 3UQSA 3H4DA 4MMOA 3I0RB 5GAHU 2M52A 1RWWB 4J9VA 3PY8A 1YJRA 4K4ZA 3HLUA 4NLOA 3CCSS 5D4OA 3BDPA 2IDLA 2W9BB 3F44A 1URNA 1D3WA 4EBEA 2BJ9A 2H9ZA 3LQVA 2E1MC 2VDHA 4DLGA 2HVEA 2J6TA 4AQYJ 3NWGA 4K5SA 3EDQB 3B4DA 3GIKA 4HI1A 3T1YJ 2VONA 4IDKA 3DOKA 4OJ1A 1RT3A 2MKYA 3SQOP 3RBXA 3TUJC 1IXKA 2ZD1A 5F9LA 1KWMA 4DV5F 2ZDPA 1R8PA 3SCJE 2W2OP 4O3RA 3OD2A 3PR4A 3HI9A 2D1CA 3ENAA 1PGZA 4BC7A 5ETLA 1ZAXA 4ZITA 2YWFA 2JC0A 1HARA 1RXOB 1NDKA 4CNYA 2HLUA 1U1MA 1A9NB 3A8EA 2PFFB 2KG1A 3RB4A 3O3LA 5I42B 2J8AA 3W65A 4YFUA 2FHJA 1YRUA 2V67A 2ZBCA 2HNYA 1BWVA 2F3JA 4OHXA 2HQ3A 1VQ4S 2VG5A 2LQ8A 2RUGA 1HBOB 4WWSA 2A2DA 4AYBD 5F8GA 1PILA 2KJVA 2HRTA 3LUYA 1YJNS 1OQ3A 4XDDA 2EC2A 1NSAA 4F26A 2WBMA 1P8GA 3IAM9 4R5PA 1AUSL 1VBYA 2EG1A 2HRUA 3X3UA 2CQ0A 4KRWA 5ITHA 2VASA 2RQ4A 1GAOA 1K47A 4J9PA 4ITSA 4QWCA 3GFHA 5IT9Y 3AA8A 1ZETA 1F0XA 2NCKL 4LIRA 2ZC3A 1ITPA 4ICLA 3IRXB 1NK4A 2PA8D 4DS4A 3PG9A 2VPWB 3HSZA 2OFGX 3PV8A 3TA0A 1CJTB 1P9YA 4IG3B 2HIYA 2DNMA 1OSDA 2WVFA 3KLIA 1KLNA 4CLTA 1Q5YA 1T3OA 5KFQA 1WHYA 4NA2A 1OPZA 3UCZP 2IY5B 2BABA 1FXLA 3RW7A 2D7SA 4A4JA 3KTQA 1RISA 4DDFA 4W98A 1TL3B 3P96A 5K9FA 1JK9B 4MKAA 1GX6A 1VQPS 4C8KA 2FJWA 2JRSA 1SUQA 2R8KA 1HMVB 2ROPA 5L38A 4WXWA 4QBUA 4PG5A 1XK8A 4P75A 5LMUF 3B6BA 1FK9B 3H0PA 2MZQA 4O0NA 4YB7A 4ZLNA 1I5OB 2FIUA 4WP8A 4LR7A 2HWIA 5KFFA 4KO0A 2FVCA 1FXDA 2XO6A 3MWBA 3KKFA 3DOLB 3G2XA 3S8SA 2KVQE 1HQUA 1F5CA 1SJQA 1TKTA 5HVFA 3IGNA 2B43A 4B17A 2C22A 1SJ4P 1NKEA 5CZVA 2N4CA 1X8DA 2CJBA 3C6UA 2UV8A 2XM3A 1S1TA 4CYUB 1S0MA 2DNYA 1SPBP 3PIPQ 1U2CA 2AV5A 5DQHA 5CYJA 3BPSP 2LQ9A 2GHVC 1L5UA 2DGTA 4ED4A 5DDOC 1T3NA 1Y9OA 2POKA 4O4RA 4ZP8A 3R5CA 4ZMMA 3K5OA 1X5TA 1FKOA 1ACMB 2CQ2A 2IMWP 3QRRA 4M5LA 5I3UA 1N33F 2YKQA 1RYSA 2C2OB 2AU0A 1TP7A 2XI2A 3K2YA 2GGPB 5DGAA 2R2SA 1SC1B 4G1QB 2F65A 4IFVB 4DV4J 2HVDA 3GYGA 4QOTA 2NZCA 4FBTA 2R7SA 3SSSA 4OX6A 1SKWA 4ECRA 2MKKA 1SQGA 1I94F 4JYAF 1LKZA 3SMZA 3WC2A 2WBRA 1ZAWA 1FDAA 4IUFA 1BQMB 2HHHF 3H5XA 3KG0A 2C2ZB 2CPHA 4ZVSB 5G0RA 4UTGA 2GVDB 4OYZA 5ETNA 1RWPB 3IN5A 3ZZPA 2A18A 3DNCA 2YWKA 3EGNA 3KK3A 4JI5F 1QE1B 3O5TB 4FDFA 1MG7A 1O5JA 2QRRA 3IG1B 1WF0A 4Q0BA 3TX8A 5HAOA 1RT4B 4HR2A 2FJAB 1JLCB 2V4QA 3AQOA 5HP1B 3OR1B 4CH1A 1N5YB 3ILJA 4MIAA 3GJSB 2UUWA 4X62J 3IM9A 2O3DA 4C0BA 3TAMA 2QL5B 2OSQA 3A4TA 4I69A 2K1RB 3MOZA 1JXEA 5C5JA 3A3PB 3D1OA 1HHQA 3Q8YA 2CZVC 3KJFB 4FYYB 3NXZA 3N6NA 2PO4A 3W62A 4LFAF 1N6QA 1RTDB 2QLWA 2QA2A 2CQ4A 1H38A 2XZDB 2E66A 1HWLA 3Q22A 1V3SA 4KAIA 4CLFA 4ZLPA 3QLHB 3HULA 4DCJB 4WKYA 3QRQA 3V4IB 1PJ6A 5E7OB 1YBTA 3EPIA 5HQMA 2XY6A 1H7WA 2ZH6A 2IPOB 3EGZA 3ZXWA 2YNGA 1FRHA 2MDAA 2E1RA 2HK3A 1WC1A 1UVIA 1VBZA 4X4VA 5CZXA 1PBUA 3IAS9 1JJ4A 2CQHA 4DFPA 3T9ZA 4K4SA 1LWEA 3MM5B 2W9AA 2VQFJ 3IWLA 3FZBA 2RRAA 3EGVA 2FHMA 2WHOA 1O6XA 5L9XA 4C98A 8RUCA 2ZOFA 3DGVA 3EJMA 2MZRA 4YMEA 4ZPDA 2OAUA 4I4BA 4NLUA 4DN9A 3W60A 2SXLA 2PA3A 3N5BA 4MIWA 2JLFA 1TMMA 2V2ZA 3RR7A 2KRBA 3QWPA 4DV3J 4TQSA 3G96A 4A8QA 3IRWP 1C1BB 5H1SV 4JOUA 3ZNJ1 4LUBA 3JQMA 4B9TA 2YWEA 4UOHA 4XPEA 4X65F 2Y1LB 3S01A 2V50A 5DQIA 5D0GA 4UW2A 3D0GE 4QU7A 2WSEC 1WF2A 3MAAB 1FD2A 4G6VB 1WHVA 1GEHA 4KPYA 2KTQA 5BYRA 3QIPB 2WONA 1WI8A 3GG1A 1U1LA 2GZOA 5GAGU 1WSVA 4H4OA 3WZ0A 1WC3A 1XMOJ 2ABYA 3TZXA 2HNZB 2Z2ZA 2ZH3A 1RBOB 4WE1A 3SFGA 2HEKA 4JI1J 1D1UA 4QCLA 3MUTP 3FCWA 1V3RA 4LSLA 3BN4A 3MCSA 1TK5A 2KM8C 1S77D 1TV6B 4HH1A 3GU0A 1TZ0A 3FBFA 2HVIA 3TJ9A 1RT2B 2G4BA 3UCGA 2AJ1A 5FDLB 1HWIA 2CNLB 3DLEB 3V6HA 1SB6A 5HLFB 3OVAA 5IT0A 2LCWA 2AQ4A 2BA9A 4C8NA 1D0EA 2RUSA 1SVDA 5H9FJ 1RU2A 4URQU 1JLQB 1K1QA 3MPVA 5F0UA 3KLHA 4J9QA 3BJYA 2CQ1A 2EFNA 4ECUA 1SC3B 4KGZB 3GB0A 1KOOA 3DLBA 4CO3A 3BGLA 5M2UA 3CCES 3SZ2A 2CVIA 2EG2A 2D9PA 5B0CA 1G7CB 1NPKA 2KHDA 3OTEA 2QA4G 3DMJA 1P1LA 1O51A 2BBEA 5EHHA 1X5OA 3VZIA 2UUTA 3NEKA 3B54A 5K8NA 3Q86A 2ACMA 1F5BA 3F73A 3RR8A 4R25A 3CD7A 4W92B 1DJ0A 2QLJB 3UE2A 3BB5A 4LT6A 2JNJA 5C25B 3EE3A 1YJTA 1O0PA 3KLFA 4X66J 2EFOA 2M7SA 4CNZA 2H54B 1KQGB 2VFSA 9ATCB 4GKJF 1RK8A 2B6AA 1SQFA 1WORA 2ZNYA 3CDWA 3N5FA 3HFZB 4DR7J 5A8RB 2Q1LA 2HNDA 4LBHA 5F8JA 3THVA 4IG0B 2BMBA 1P6TA 2KG0A 3R2CJ 1OQ6A 3ICLA 2R7OA 4E8UA 4ZJLA 3EYZA 1MWZA 3G6XA 3MR2A 4DR4F 4K2JA 2I8EA 4ALZA 4FF3A 4E0DA 3J81Y 1VRTB 3VAHA 3UVJB 1X9WA 1SI9A 3FCHA 2KN4A 1DQ9A 3LP1B 4EGLA 5I4MA 4NEYA 1K0TA 3US5A 4O4GB 4J9LA 4JI7F 4FVMA 3D2WA 5EN1A 2F9DA 3FZ2A 4CLLA 5IFMA 3CCRS 1AT1B 1FT8A 3RRHA 2KU7A 2EK1A 5A2QY 3MMAB 1FEHA 1HBMA 1HFEL 4OI1A 2LP4A 4K4TA 3BN7A 4FPIA 2KXHA 4ZVGA 3DM2A 2C1EB 1WNEA 2Z30B 4KB7A 3M4XA 4HT5A 2XMJA 2CRLA 1RAIB 2A3JA 3HHKA 1KVKA 1HI1A 3EM1A 2NQPA 5KFDA 2AW0A 3W8GA 3TP2A 1L3KA 2MQPA 4CTAA 4ZCKA 2LEBA 2DD8S 5LXRA 3MEGA 5ETPA 3GFXA 1NHVA 3MTKA 4OJHA 1RAGB 3FSIA 1S12A 3VAMA 4LBIA 2DGQA 1KLMA 4FP9A 3UO0A 4ZA1A 1U48A 3K0JA 4UUWA 3I32A 2DYAA 1QAJA 2VG7A 4JV5J 3DOKB 1WWHA 2ZD1B 3OJSA 3R27A 1B4SA 1NHKL 2FJDB 2JX2A 4C3LA 3AJ1A 3OLBA 4DR2J 4NCGB 1X7VA 2V34A 2AYBA 2I1RA 4Y00A 5AXNA 3A3NB 3DLKA 3JYTB 2HS0A 3LP0A 1UMJA 4OHVA 5IXUA 4QIFA 4GO5X 2J76E 2B9EA 3JAMY 2AF6A 3CMES 2EK6A 1APSA 1VQOS 1HW8A 2GJIA 5KOWA 1F3VA 3BR9A 1XR6A 3SSRA 1HNVB 1HYSA 3W61A 2ZE2A 3R5BA 3I4HX 2XMUA 4I7FA 3FBEA 2I9SA 2E5HA 4X4TA 3K5LA 4DR1F 2NXCA 3QGPA 5RUBA 1HWKA 4DX8H 2VPXB 2KZMA 3W9JA 4M8LA 3HT0A 5IWAF 4LF8J 4QR1A 2IA6A 5SZTA 4CM2A 2HFSA 3UR0A 2RJZA 3UW1A 3AOBA 3VWSA 2VL1A 2RVJA 2W7PA 1YJ7A 3FK4A 3KK2B 3CIMA 3M8QA 4QPXA 4KH0B 1DTQA 3FVYA 1P1TA 2LECA 2AHOB 2DISA 4R5PB 2VDIA 2EFQA 2HHWA 3W3SA 4IOCQ 2PI5A 4MYUA 1N34F 5E5NA 2A2CA 2MSSA 2IFXA 5IT4A 3V6DA 4MKVA 3ZTOA 2KHCA 3DYAA 4ZVFA 1REGX 4D3GA 2LVWA 2V4JA 1DLOB 4PUOB 2VBYA 3GZ7A 1KQKA 4IOAQ 3QZ8A 1R8BA 5ETRA 3MF5A 4LMZA 2WK4A 1RAFB 2ZBPA 1XR7A 3KJVA 3QRPA 3POTA 3KLIB 3AXKA 2ALZA 3SYZA 2C3PA 4OIXA 1JXLA 3MFIA 3AD8C 3CC7S 1R0CB 4B9LA 1IQZA 3WIVA 2R7XA 1RKIA 4LJMA 1MU2A 3M6UA 3KG1A 2ZZTA 2JDJA 3SI8A 3R1HA 2QZ8A 5HQ8A 1U6BA 2AGPA 4FS1A 3J7Z5 2ZJPQ 1SUQB 4OL8A 2YKNB 1X9SA 3G86A 2Y8WA 3OV7A 1DZ5A 4YY3J 2CJXB 1VLYA 4I2QA 2AGOA 4XO0A 4KO0B 3SQGB 4QR0A 1HQUB 5CABA 3CCZA 4PXEA 3GSIA 3PW5A 4M5JA 3C6UB 2XSJA 4USTA 2X1AA 2YY3A 1S1TB 5D6GA 2RT3A 4M5GA 2DPIA 1RAHB 3A1YG 4L72B 2VIHA 3SFUA 1QVGR 2OP5A 1AXQA 3DRRA 4CLPA 5GMDA 1RT5A 3OHBA 1AROP 2G2ZA 3HDSA 1FKOB 3QIDA 3UN2A 3W9HA 4G1IA 1HD1A 2OKQA 4YOEA 4LF2A 4OX7A 4XK8C 3K7RA 1RHKB 2CDRB 4B9NA 1TR0A 3CCVS 3HVTA 4CT8A 3OTOF 5ETQA 2LMIA 4MKBA 4IH7A 3NRBA 3Q23A 3HZGA 3I9ZA 4DV1F 2VPYB 3DDNA 2W2QP 2HHQA 4H4MA 5KFEA 1N36F 3PEHA 2VB6A 3BH7B 4DJBA 5FLXY 3FRYA 4I6YA 1U2FA 1JNRB 4DLEA 1PBAA 1YQHA 1X4CA 3EXCX 3PVXA 3N6LA 4DV0F 1ICEB 2AIRB 1U6FA 4RPFA 5IQQA 1EQ0A 2C3UA 1N0UA 1EARA 4TYBA 1FFSB 4HH0A 4RBTA 4USJC 3OTBA 3KK3B 2DNKA 3WDOA 1SKRA 4TXSA 1FESA 2VODA 3KWMA 2VBZA 2DH7A 2A1BA 2KYXA 2HURA 2CG4A 5LJ3Y 1RCOB 3GYNA 3OJUA 2DGXA 3DFEA 4DL0C 1T02A 3A8KA 3CEDA 2DK2A 1WF1A 1Y5NB 2QFIA 3VQTA 4P7VA 3H20A 4DV7J 1BLUA 4JI8F 5HSPA 3K89A 2K2PA 2CQDA 2ZUAA 3TARA 5BJRA 2QYCA 4WTOB 4F0MA 1N56A 2A6MA 2GCFA 4ZS6A 3LPEA 2GW8A 4NOHA 5H9EK 3I82A 4TLQA 1N6QB 1G6BA 3M2VA 2DB1A 4B08A 3H2VE 1GNKA 5FJ4A 3I0SA 3PDNA 2UV8G 3GJTB 3R2DJ 3PJ9A 2IAJB 1CC8A 2YNGB 3HD1A 4H54A 1QUVA 4ZVPB 1GT8A 2UVUA 5C24A 2DNZA 4EEYA 3QT5A 3S6EA 1F6TA 4MYTA 5DG7A 1LWEB 2XGPA 1CJUA 5GADI 2XLJA 4JI6F 1RUSA 4X2BA 5B0AA 1RP5A 4NZ7A 2K8GA 3IP0A 2AP6A 3AD9C 1PYSB 3KDOA 3PX0A 4LFCF 1VQYA 4NLGA 2GIQA 5CD4A 3UR3C 1RTJA 3T1HJ 4LF9F 4HKQA 4HI2A 4QPTA 1NHUA 1HA1A 4B9SA 3PYGA 3AFGA 1WG1A 3BS9A 2DVIA 2G2OA 1TAUA 4DUZF 1M5HA 4WTYA 5H9EJ 2IM1A 1TUGB 2BVZA 4RW6B 4RU9A 5LJ5Y 4CO2A 7FD1A 1LV5A 2E5JA 2W01A 1DAXA 4L74A 4EU0A 3BGOP 4EYIB 2JZ5A 2J9DE 5HATA 4H4OB 1QAXA 4QIWD 1YG0A 1H2UX 1FD8A 5J1PA 1NDPA 1SL0A 4PPDA 3MZIA 4ED6A 3H5YA 2WCXA 3KDNA 2G1DA 2OI2A 1H73A 4U9RA 3DLLQ 2RRNA 3NNAA 3OHAA 5HJXA 3DRSA 2QN6B 4I56A 4OYIA 4K0KF 1YITS 4DV2F 4OZLA 3O6QA 3L95X 2XMAA 4J9UE 2QIFA 4ZPWR 3NGKA 3OR2A 3A12A 1ROFA 2PT0A 4FN5A 4P2FA 2RMLA 3Q24A 2QSFA 2QA4S 2XZWA 2W2PP 1G2EA 3VAFA 2BE2A 1VDHA 3UNGC 4RW8A 1Z4UA 1M1HA 3KLHB 1NU4A 4BWJA 1QLNA 3R3TA 4NWBA 2YKMA 2WAQD 2CWXA 2XEXA 4C8MA 3OSNA 2VQEF 2ZITA 2GQCA 5DS7A 3QO9A 4RNOA 2G1HA 1TK8A 3IBCB 3RRKA 1C4CA 5LL6d 1U4BA 2WZ1A 2A6OA 5L8RC 3DMJB 5D4PA 3JSMB 4LVNP 1FO1A 3HSJA 3H2UB 2DR9A 1S1WA 1FTCA 3MCMA 4ECQA 1RHQB 5A8KB 4AXJA 4ED3A 2F8HA 3MECB 3IS9B 1DQAA 2VV5A 1QDUB 3HCXA 1NLKL 3ZTQA 2LQJA 3GMGA 2RRBA 1XNQF 5JXSA 1KP6A 1X4FA 1UJ6A 4M5IA 2X1GA 1BQNB 4HVZA 2ADCA 3D6TB 1RAJA 4J9SA 2EI5A 3MUMP 2J0QD 3TUIC 1U1QA 4NA3A 3P6YC 2B6AB 3HHLA 1N52B 1S57A 1FDNA 3E01A 1B0TA 4F36A 2HNDB 1ZM3A 3LAKA 1EX8A 4DV5J 4F8RA 4KV8A 4MK9A 4KT0C 3M8WA 2GIRA 4QJVA 3BO2A 1NO8A 2R7TA 2PSZA 2OTJS 4F7VA 3JXOA 4RUBA 2PI4A 4F0HA 4QIGA 1KSPA 3C2PA 4GKKJ 1YHQS 1ZZFA 4X4OA 2YNFB 4F4KA 4ES2A 4P71A 3F41A 1FJEB 3FJ2A 3WQPA 4NX9A 2IRYA 2FC9A 1X4BA 1Q4RA 2IDEA 5A76A 3THTA 3I0RA 2V8VA 1Y11A 3MM8B 4KPCA 2QMUB 4CH7A 5LSOA 4U8YA 1HBNA 3DM2B 1T05B 3QNWB 4NMLA 2NPIA 1Y0HA 3BBCA 2MQMA 1UPMB 5F3TA 5A2QU 4BLGA 4OZ0A 4I67A 1HHSA 4CTAB 4WFXA 4P6QA 1Q7YT 3I6PA 3MEGB 5D3GA 5B09A 3D5MA 4DQQA 5LM7E 5D0EA 3H40A 1H74A 4OLPA 2PIIA 2CPDA 1KLMB 5HMZA 2I0XA 2CKWA 3GCWP 2OPQA 2QTWA 2YTCA 4L75A 2VPZB 2GFFA 2C2MB 4TY8A 2VUGA 3NY0A 2CVEA 1OY8A 3C6TB 1H98A 4FVCA 3UDVA 5K8PA 1F9FA 2B3TB 4C97A 5LSRA 3MM9B 3DLKB 1YBUA 3T3FA 3LP0B 3ILOA 3R8YA 2UU9F 2APOA 1S1XA 3GG0A 3W66A 4DSEA 3OQ2A 2WB4A 5I42A 4EK2A 3HKWA 1VRQC 3CULA 2R7QA 5LMUJ 4I7FB 1I51B 2B7BB 1HBOA 2DY9A 3HK2A 3G8SA 3FMBA 3OVBA 4N76A 3PCOB 4KTQA 1U1OA 3BSNA 1FRJA 3R5JB 2XS5A 4KC5A 2Q3PA 4RX6A 1JX4A 3SDEA 2KL8A 1DQ8A 4I68A 4S0MA 2FJVA 2GMJA 4DI6A 3BZQA 2BOPA 3QPIA 1U8WA 3SV4A 4W90B 3M8QB 4JI2F 4RUAA 4DQIA 3SBMA 4LVOP 3PM9A 3VTIA 2E7XA 3H5SA 5BYQA 5D77A 3IRXA 2MHEA 4DL6A 3GTYX 2QGFB 3M6VA 4A8FA 3R5AA 1F5AA 2QX0A 4PXCA 3DYAB 3FFIB 4IG3A 4PRFA 1CJVB 2V4JB 3MMJA 1N33J 2XHCA 3DGPB 1RHUB 5A8WA 2Q43A 1FDDA 1NZAA 4EBCA 3AXMA 4OZNA 4A8KA 3BV8A 4KYZA 1AFJA 1JXVA 2DHAA 2QL7B 1YI2S 1TELA 1ZTTA 3ILIA 1LXNA 2E1AA 3POTB 1TL3A 5F41A 4ED8A 5MLCV 4RW4A 2MKCA 5DG8A 3QBCA 4ZP6A 1HMVA 5GMEA 2ZH4A 3TA1A 1RYRA 2ZNZA 2OPRB 1MU2B 1WSRA 2FB0A 1I94J 2RQMA 4JYAJ 1MW7A 2Z56B 1FK9A 3CCUS 3AOAA 3JS9A 1RHJB 1UEVA 4FYDA 5CD4H 1ELOA 3SSQA 2HHHJ 3DOLA 3PRBA 2HMIB 4I2QB 4GO7X 1C0UA 2OLWA 1TFYA 4JI5J 2ZWPA 1N5VA 3BKFA 4U7UD 2XBPA 3V4MA 1VBKA 1WHWA 3QJJA 5DJBA 2DHXA 1H3DA 1T03B 4XAKA 2VBWA 2V4RA 1N0VC 4MIBA 1RABB 1S97A 3KMSA 4LF5F 4LF4F 2HFVA 1D9FA 3OW2R 3GCXP 2HQIA 3I5CA 2M70A 4N8OA 4C0HA 4X64F 2JH3A 4BC9A 1HBUA 2ZH9A 1HNIA 4IFVA 4PYAA 5EX3A 4OV1A 2W1BA 4V19J 1N32F 1IM4A 4LFAJ 3CO9A 5D0HA 2RNEA 3ONQA 1FNMA 2DY1A 3I9V9 3HVTB 4L3NA 1QJHA 3QAUA 1GH8A 4V1Ak 4BHQA 1MMNA 1DRZA 2YH0A 2WVEA 4H4MB 2U2FA 2B8PA 2UUBF 4X84A 1BQMA 5IC4B 1RU1A 3PTWA 3VV2B 1XJWB 2GVDA 2H3EB 1NAQA 2DNQA 4N41A 2XULA 4F2SA 3AODA 1FX2A 2IM2A 1BQXA 1VQ5S 1WDDA 2EKYA 4LRAA 4RWXA 1M1KT 4DCPB 1YJWS 2EW9A 1UA1A 2IJNA 1FKPB 1NPPA 1NPRA 2DNOA 3NMRA 5EX0A 1B7FA 5HP1A 3NNHA 1N5YA 3HJFA 1LFPA 4LSZB 4NPOA 2LU1A 3DOMA 3LGMA 4F02A 3TZYA 2V9KA 3DRYA 4NZ6A 3RAQA 5L1KA 4BWMA 2CFXA 2G0CA 3FBCA 2CPIA 2DRBA 3QATA 2CA9A 3CIZA 2XWYA 1S9FA 2C2EA 1VBXA 5AXLA 2EBGA 2ZKTA 3GQCA 4ID5A 2N7YA 3QT6A 4F3QA 1X0FA 1WKJA 4X65J 3H98A 4QIVA 4DPWA 1T9UA 2XYGB 5KG0A 4A8WA 4LSNB 4J90A 4MAKA 3PHTA 3V4IA 4J9KA 1T9TA 1OO0B 1CEZA 1QVFR 2GV1A 4ZK7M 1W2IA 1RSCA 4H4KC 2BJ1A 2UUAF 1KQFB 3QQCD 2HAFA 1OMSA 1V3ZA 3ISZA 1RWNB 1S0VA 4O0IA 4O3NA 4DSLA 2ZM6F 4C3MA 4Q45A 3R6LB 2DR7A 5K5MA 4DZ6A 2ASJA 5FIIA 3BSCA 3SCIE 1HNWF 1VCTA 1C0TA 2MEWA 5MAOA 3KJQB 4CH0S 3N6MA 4OV6A 4DX6A 4Z7CA 5D8HB 3KHHA 2R2RA 3HPOA 5KFXA 4JP8A 2BJDA 2KVIA 4ELTA 3A13A 4DV6F 3NWRA 3WBZA 2QEXS 2G0JA 1RTJB 2DH9A 5EWGA 2JL9A 3L4BC 4WU3A 1Z1ZA 3DLGA 3H7HB 3HKZD 2YQ1A 5E2QA 2CWKA 1EKSA 1VQNS 1IUJA 5LMNJ 2GVZA 4RNHA 2XCAA 1K44A 5KFIA 3W2WB 4HHHA 3GIIA 3QIPA 2FHJD 3UFCX 2PMHA 4ZVEA 1IN0A 3H90A 1T7PA 3MOJB 1KC8T 3GIMA 4ID8A 4CLKA 2HRYA 3PYFA 1U26A 3GJQB 3W9IA 2C3OA 1GTEA 4C8LA 3JTPA 1SH2A 5IC6B 5HANA 1U1KA 1WEZA 1K9MT 3UWTA 2V6AA 1YSJA 1NH7A 4DQRA 1TV6A 2L08A 3HSGA 2V2KA 2X51A 4OX9F 3M8SA 3ZC4A 1HNXF 2XYPB 5HMYA 3TVYA 2UVVA 3DRSB 2YWHA 4GKJJ 4XIUA 2IVYA 2XSFA 1VGYA 4WYLA 4CLSA 1IWGA 4A46A 1EJ7L 1S7IA 1YVFA 1Q16B 4A8XA 3FC9A 4B3RF 2M5YA 2DEIA 2JOQA 4TLRA 4EZ6A 3ITHB 3OR2B 4DU8A 2P8IA 4KGVB 2RS2A 4WZQA 3ULHA 3MM6B 2WVDA 1RTIA 1U49A 4DR4J 3NOGA 1CG2A 1JLFB 3PIOQ 4RW8B 4C8YA 4C7QA 5F8HA 4LR8A 4F3MA 3L3CA 2YKMB 1Q0NA 1B99A 4CO4A 2R7WA 1IQTA 5AXKA 3PYDA 4JI7J 1W7WA 2HBQB 2RSQA 1PO6A 3LF0A 3QO9B 4Q2MA 3CT9A 4NLDA 3UCUP 1IJEB 1SV5B 2FQQB 2M88A 4CDIA 2YPZA 2AYEA 3ZTPA 3G8QA 1TKZA 2Q6BA 2DGUA 4IQXA 1WEYA 3CMQA 2XLKA 4LFBJ 1RA6A 1DURA 4A8SA 4V19X 2GAHC 5C25A 1BY9A 3CJSA 5DG9A 2K7JA 4PZVA 3T9NA 3OXFA 3LGHA 1GMVA 2R3VA 1SC4B 2HHVA 1QTNB 3MFHA 1HR0F 3ZZZA 3UD5A 4CO0A 1QAYA 2XI3A 2G0IA 3UDCA 3BEGB 2DR8A 4JI0F 2VOPA 1YRTA 2DGVA 3VHQA 3NMAA 4I6WA 3BKTA 1FERA 1X4AA 4LQ9A 3KG4A 2CYYA 3WC0A 3HHLB 2BX6A 2BR0A 4JV1A 1JWWA 1GTHA 2V9WA 4OYPA 3RAMA 4C11A 4KV8B 3VGTA 2MKIA 1M1GA 4OLOA 1WTFA 2MKSA 3OSPA 1R0BG 5E0OA 1PIEA 2F8EX 3IM8A 3D28A 2ROEA 3NAIA 2BW2A 1XTZA 1VC6A 3RG6A 3OUYB 3CJ3A 1OY9A 3EVWA 3QWUA 2MKHA 1BWEA 2FHOB 5CYQB 2KRRA 1K73T 1GXLA 4DR1J 4FF4A 3NCPA 3J7YI 2KB2A 6FD1A 3B82A 1YX2A 1YWXA 1NJXA 2VU5A 4TNOA 1HBNB 5IWAJ 4U67Q 4DPYA 2YWGA 3TI0A 4DR5F 1NK9A 3JB9k 3PKYA 4LQ3A 4CZCA 5EDWA 3DU6A 3TAPA 3ENQA 2QG9B 1T95A 4EYHB 3CVKA 4R0EA 2HGMA 5L9NA 4YS2A 2H1YA 2LKZA 6AT1B 2AKWB 2DXFA 3O8WA 5D3GB 2Y8YA 3PW2A 1T94A 2ADBA 1M90T 1N34J 4QYRA 2UP1A 2LA4A 2LYVA 2F4FA 4LIWA 2E9ZA 3C15B 1JMTA 3RBEA 4R8UB 3MUVP 4NCGA 2KM8B 2OPQB 1TL7B 1LWFA 1E6YB 3D67A 4TY8B 1S1VB 3JYTA 2QYGA 4KHPF 1W2BR 2CJQA 1VK8A 4P2XA 4RNMA 4M94A 2LEAA 4DQSA 1EETA 1RT6B 4HYKA 4DL5A 1NJYA 1H6KX 1HNVA 2HQGA 1BHNA 5L1LA 3G6VA 5HMWA 4HDHA 1S1XB 2V8HA 2ZHOA 2AJQA 1UFLA 3NOCA 3O1LA 5AE1A 5HROB 3ZO7A 1DTTA 4OZ1A 4B9VA 2IBOA 1HNZF 2HGNA 2J7UA 3RB0A 3KK2A 2GS8A 2E44A 4DL3A 1VS3A 3AJDA 2MKJA 3SDEB 4L76A 2ASDA 2CDQA 3QYYA 5HMXA 1LOUA 1YZ7A 2FTRA 2UZAA 2AGQA 1BXNA 2I2YA 2JC1A 4FKYA 4FNIA 3T6BA 2VH7A 1SH3A 1DLOA 4PUOA 2KXFA 3EWGA 3G6YA 3M7VA 5DLFA 4PG8A 4X66F 3MR5A 1TL1B 1ZS6A 2YPYA 5AE3A 1Y10A 2GC8A 2WVCA 2HFZA 1RWVB 2C2KB 4O44A 2UVWA 4FF2A 5A8WB 5KT7A 1KONA 4NYPA 2HSEB 2YQ0A 2HZVA 3HF5A 2R7RA 2W7AA 2RE1A 4DSIA 1YK9A 1S4FA 5J2PA 3OTOJ 5DO2A 2W7OA 4ED0A 4ZPBA 2J7KA 4RUCA 4HACA 1XERA 4DV1J 4RW4B 2CXEA 2G13A 2ZH7A 2LQBA 1N36J 2BKNA 3TVZA 1IBCB 2YKNA 1R6VA 2DO4A 4FXDA 3OL7A 3PNIA 3IWXA 5E3PA 3R5GA 4UZBA 2DJWA 2M2BA 3K59A 2LDYA 2V8GA 2Y1RI 2ZBQA 3D6HB 1SJ3P 4KSEB 4DV0J 2VZ9A 3SQGA 3CCLS 2W2MP 4PG4A 1YIJS 4ZPTR 5J2NA 2C42A 1NZ8A 3TUZC 3W64A 1C0UB 2AZ3A 3MEKA 1ZOTA 3DDKA 3PZPA 4DG1A 1DY3A 3VALA 1URRA 2ILZA 2DNLA 2XMVA 4MT1A 2P9GA 3PW4A 4UOGA 4F2RA 3NBPB 1IVZA 2MPUA 2D3O1 2V94A 2EFPA 2C2DA 5EGYA 1TMJA 4JI8J 1ULRA 1Q53A 1D9AA 3T5LA 3AA9A 1VQ7S 1HBUB 2E9TA 3D0HE 1HNIB 4ZVRB 1S49A 1RLDA 4AT1B 1S59A 3ZZUA 2VF3A 3I4PA 4E2FB 1KOHA 1W26A 1NK0A 3BO4A 1EP4A 2X1FA 2CIMA 4JI3J 1VIOA 2W4DA 1ZPVA 3L09A 5HVGA 4OI3A 3GV5B 3NCQA 3KYLA 2R7VA 2DTJA 3T6JA 4C3KA 1NK6A 3RBZA 1S72S 1ZYQA 4AXIA 4DR6F 5JJBA 2RD5C 2UXCF 4RNNA 3FDSA 2NS1B 4GVLA 2EKNA 4DU7A 1KHVA 2XG8A 1Y7PA 2DO0A 4XPCA 1FE4A 2PFDA 3BSOA 4JI6J 5DETA 2IYGA 4AL6A 5KFCA 4MKYA 6FDRA 3EX7B 5M2RA 3CCWA 3GILA 2NYHA 2W25A 1H0HB 4ILMA 1UZHA 5KFUA 3UN3A 4LFCJ 1TQLA 2BJ8A 1TKDA 2OTLS 4UQGA 3DOMB 3Q2TC 4Q8EA 2G9OA 3N0VA 4LF9J 2F4VF 4AUKA 1WC0A 3FEYB 2EFVA 4ER8A 2E7WA 4QWAA 1B64A 1VQ8S 1AW0A 4Y2MA 4DUZJ 4YN3B 2ZUGA 5KFLA 2XLIA 2ACYA 5HBMB 3W1YC 1KVIA 1R43A 2J0SD 4ID5B 3Q8UA 4NXMF 1RTZA 2J0XA 3W5ZA 3BH6B 1TVRB 3M9NB 4N77A 2AJFE 5E3QA 3D6MB 1HPZB 2IAJA 4C8OA 2OEJA 4ECYA 3AH6A 5L1JA 2ROGA 1TL4A 3CCTA 2FJEB 5ETTA 4NLXA 4O3OA 3TA2A 3VCDA 3F56A 4AL7A 4USUA 3GR1A 4NYZA 1IKXB 4F25A 4KJIA 4WJBA 1X4GA 2JEGA 1FRMA 4B3MF 4K0KJ 3GYXB 4OQJA 1XWLA 2I5JA 5GAHI 3JSYA 4ZP7A 4DV2J 1C0TB 1S9EB 2F1FA 2DKOB 5KG6A 1LW2A 1LQ9A 1RGVA 4ZPVR 1XBWA 1RAOA 4F4ZA 1LW0A 4OJ3A 4ELVA 5U47A 5C42B 4EZ9A 3FRZA 1HWUA 2MY8A 4DL7A 1V9OA 3RZAA 4ZCLA 1WUUA 2ALYB 3FGVA 2FY8A 2GA7A 4NXNF 3DHXA 3GPAA 2B56A 1GXTA 2V2VA 5LT5A 5F9NA 4QW9A 1R89A 3DLGB 3MPYA 3JQKA 2GNKA 1HHTP 4RW6A 2VQEJ 4ZVTB 1NM2A 2VD3A 2DGWA 4NLQA 1HKAA 2RKIA 3W5YA 5IZHA 2GVZB 4URSA 3KHRA 4NA1A 1EKRA 1S99A 2DCUB 3HP6A 2WRMA 2P2CB 5I3QA 4Y65A 3V5RA 3H42A 4NRUA 1KQSR 3QGGA 2FZGB 2C3MA 3H4BA 5IV3A 3HVAA 3KUGA 5KT4A 4ZPCA 2DCLA 1R8HA 4W4MA 3G87A 1IBMF 4C8ZA 1XNQJ 5DQGA 1YTYA 3JTOA 2HWHA 4TKTA 3MPUB 1VQMS 1GMWA 4IFYA 2OEKA 4ECWA 1L3SA 1JJHA 2XY7A 3C66A 2NUHA 4K5RA 3EXYA 4NLYA 2ZWOA 2MQLA 3C46A 4O3PA 1DARA 4JI4F 3CD0A 5KG5A 4YR0A 2UUCF 4FKXA 4ZIWA 1J5OB 3CDEA 4A48A 1ZM2A 1N48A 4Y2CA 1VQSA 4HHUA 5J1EA 2V69A 2CZ4A 4B3OA 2VJUA 1RTIB 3ZFVA 3W7BA 2BE9B 3IR6B 1HQEA 1B70B 2GO8A 3B78A 1VQ6S 1N5SA 4YDDB 1X4DA 1HI8A 3RB6A 4J37A 1YJVA 2RIJA 4L6V3 1MNEA 3JSMA 3IFEA 1RWUA 2P5VA 2CJYB 2G2YA 5A8KA 3N79A 3DN9A 3MECA 3IS9A 3FUYA 4M5NA 4X4PA 1RWKB 1P9QC 1TKZB 3OL9A 4DFMA 2W4CA 5B08A 2OPSA 1T9XA 3N9UC 3JTNA 5KFWA 1BQNA 2OELA 4HL9A 4RO0A 4NE9C 3DRXA 1S6QA 4EI2A 1XMBA 2GHWA 3OXLA 3UI3A 3O44A 1E6VA 2A0FB 2L9WA 4OI4A 3EDRB 4PXBA 1T9VA 1CBKA 3M8ZA 1UWBA 2LXUA 2QO3A 5CYMA 1TU0B 3ET6A 1OSCA 3S7RA 1R31A 3R7BB 4Q5VA 1ZAVA 2O67A 2WOMB 1ZZNA 2X1BA 3E51A 2WW4A 5L46A 1N5QA 1FNXH 3ETOA 4QYZK 4Q8FA 4C11B 3NGSA 1FWLA 1VRUA 2HHUA 3FBBA 2DEJA 4WFBQ 2HHXA 3KLEA 1X0PA 2YNFA 2XHWA 1JLBA 4RW7B 4Q7AA 4I1TA 4FS2A 5T41A 3OFFA 4KGKA 3MM8A 7AT1B 1TK0A 1IKWB 3U7JA 3ZZYA 1FF2A 1Q8KA 2JFDA 2H5IB 5L1IA 1R7IA 4DPUA 1M5SA 1T05A 3OPKA 3OLAA 3NLCA 4K50A 4PR6A 1HQ2A 2P6TA 1HWJA 1S1UB 3PO5A 3R9LA 3V6KA 5THWA 1KD1T 3EZ5A 1SJRA 3KLGB 3W2VA 4ZJOA 4HHJA 3NCRA 4N47A 1N5TA 1Q7LB 1RHRB 2MLZA 4Y2IA 5IQ6A 4NCAA 2JVRA 3OFGA 1HI0P 1Y4ZB 4PCQA 2XMTA 4JI2J 4FBUA 4NCBA 4HEA9 4PG6A 5D0RA 3PEJA 2VFTA 2ZOMA 5KG2A 4O3QA 2J5AA 3K5MA 2BQUA 1SL2A 5JUMA 1M0SA 5B0FA 1RT1A 4DSFA 2FYXA 1A6LA 1R27B 2KFYA 2H65B 2CAJA 1DBDA 4NLTA 1PCAA 5LSLA 3BR8A 3C6TA 1K0VA 1LWFB 3UD4P 3M6XA 1RTHB 4KIAA 3BQ1A 3MM9A 3CJ8A 1RHMB 3NGUA 1UVLA 5J1NA 4OI6A 2N3OA 1EETB 3ILLA 4KFBA 4ZP9A 2CQIA 1CS4B 3NS6A 5KFJA 4B3SF 3VAJA 2ASLA 2LQ5A 4KKOA 4LRCA 1NSQA 2RQCA 3T5KA 2MZ1A 1NKCA 1GQEA 2MQ8A 2AEJA 3M2RA 5DDQC 5F0WA 1SL1A 2DRAA 2AEFA 4FNHA 2BJEA 1DTTB 1T0TV 1SC6A 4NMXA 4DWIA 3ZZOA 1LWXA 4WK3A 4URGA 1X5SA 4ANDA 2B9WA 5DLGA 1FRLA 2DR6A 4RWWA 3Q2SC 4ZVOB 4M5MA 4ES3A 2B5JB 3MM7A 3EVOA 8ATCB 4X4NA 2KH9A 3TOQA 1PYOB 1WD6A 3CDBA 3J81j 3VAIA 3VGUA 3MR7A 3HO1A 3RRGA 3FFIA 4LF5J 1CJVA 4LF4J 5BXIA 5F8LA 3CC2S 3LH2S 3DGPA 2DITA 1M5VC 3KK1A 3UDEA 4X64J 1J5EF 2AJ0A 2NXEA 1S0OA 1VYAA 2CJ9A 3VZHA 4O44B 4DPXA 1RWOB 1RLCL 1XEZA 1N32J 3K8VA 4ZCMA 1TKXA 3Q89A 2B4UA 1VOMA 3WX8A 2QFJA 2OPRA 1S48A 5J2PB 2DIVA 2FDNA 2GMHA 2IRXA 1XC9A 1B0VA 3IMQJ 2FVSA 4DX5A 4HACB 2WSCC 1JLGA 2BE7D 2HQCA 2J9CA 3VVUA 3ADAC 3A3OB 3RGIA 5E41A 3QT8A 2UUBJ 3B8HA 3CPWR 3EZOA 3THPA 3MEDA 3PR5B 3TX0A 1SJ1A 1RACB 1EQMA 3J7ZT 2HMIA 3M9MB 1YRXA 3FCVA 1NJWA 2E5IA 1K1SA 4AL5A 4GKKF 2H48B 3HSDA 4WP3A 1UVJA 2BM0A 3CJ0A 2F63A 3BBFA 4Y3CA 2NXUA 1U47A 1UJ5A 3LAMA 4MFBA 2R7UA 2N7CA 1REVA 2WTFA 1T9YA 5GAGI 1IKVA 4ILLA 1JB0C 5J2NB 2F7VA 4WYWA 1T03A 5KFSA 4OX8A 1YLXA 1OPIA 5C7PA 4DG1B 1UFWA 1H72C 2L48A 4JB8B 2YH1A 1X4EA 3QMQA 1KHWA 1Q5VA 2J0WA 4OJGA 3VGSA 1X60A 4OYWA 5BR8F 2LXIA 1CVJA 1S10A 4DMZA 3J7A1 1NDLA 4PWWA 3TUPA 3TQEA 1C1CB 3NP5A 4N56A 3H5UA 1UZDA 1U1NA 2IA0A 3MEEA 4WFAQ 3D1HA 1F9EB 2BKOA 3MXHP 2JJ4D 4Y34A 3MCNA 3VR1A 2W9CB 2KFNA 1PC5A 3CE8A 3FKBA 2EEYA 2MGZA 3SV3A 1Y5IB 1EP4B 1WI6A 4B02A 3RJMB 1NBEB 4Z2XA 2M3DA 1UP1A 2BXJA 2UUAJ 1KDNA 2M0GB 2B4VA 5HVHA 2N82B 1RKJA 4NEZA 4DR3F 3H8YA 1WEXA 3TYTA 3PKMA 4TYAA 2HHSA 2ZM6J 1JKHA 1LK5A 2FHKA 2OGUA 3PRVA 2ZC4A 2L3MA 4CCHA 2YNHA 1RZMA 2YX1A 4ZOSA 4DF4A 3EMTA 4WFNQ 1HNWJ 2UXDF 1MMDA 1RDRA 3HHLD 1FKPA 2RU9A 4ETXA 2IVMA 2OEMA 4P7TA 5LOQA 3D68A 2DNGA 2MLXA 2N3LA 3M9OB 3AOCA 3MMBA 1H2VZ 4Q43A 3RW6A 1NH8A 3BDEA 5AXMA 2VHGA 2M9KA 4DV6J 2HBZB 3PJXA 3HMJG 3KNGA 2H5EA 3QT7A 4PQUB 1V5IB 2R9LA 1IR2A 1IBLF 5DDRC 1KFSA 2CPYA 3DHWC 2FLLA 4CWBA 4LSNA 4QW8A 2IBKA 1QTMA 2ZDOA 3IC1A 4IKAA 1R8AA 3LANA 2QE5A 3U1NA 4CO5A 2J6UA 1Q1KA 2BJ3A 1Q86T 1PSDA 4USWA 2E7VA 4Y2KA 3GSDA 5KOXA 5IS2A 2IM3A 3FSXA 3E2EA 5K8OA 5F8IA 1OWXA 4I2PA 3G82A 4QWEA 1HIYA 2H5JB 1S79A 1NJIT 3L7PA 2NPFA 3D6FB 2WW8A 4EUVA 4OX9J 2WB1D 1NK8A 2FPHX 5B0BA 1HNXJ 1PYTA 2FD2A 2XS2A 4B9MA 4OI0A 1FJGF 4AE5A 2H4WB 4YB1P 4J91A 1WDTA 4FYVB 2I5JB 2AJ2A 4ZHRA 3TZZA 2KJWA 3EVMA 1LW2B 3VF0B 4B3RJ 2OJ3A 5AJ3F 1LW0B 4EBDA 3G71S 4AD6A 1IJFB 1WHXA 3TANA 2IJFA 1SXLA 2X3DA 4OFZA 4ZVUB 2VJVA 3GE9A 1UA0A 3R1LA 2VA2A 5JVGQ 3CNQP 3Q8QB 3RTVA 2R2UA 2KO1A 3BM7A 3D4JA 4DUYF 5HN0A 3QJPA 2GIFA 2DRDA 1WOPA 3W2WA 2HFOA 1FJ7A 1GFWB 2Q66A 1SQEA 3PRDA 1TUWA 2B4PA 1O8BA 2CQGA 1D8YA 4B3TF 3NAHA 2QLBB 2OFHX 3OVSA 1JLEB 4F0KA 2RKIB 4DSKA 2YXLA 1YGYA 3MMCA 2E5GA 4RLEA 2E29A 1KVJA 4TU9A 1TUVA 3TEHB 2MQQA 4PG7A 1ZM4A 1CLFA 1LFWA 1EIYB 1FRIA 4RUHA 3DU5A 1UFKA 2Y3YA 4WFYA 2DNNA 4HDGA 4YDXA 2VC1A 2HS4A 2MLYA 2OSRA 2JEFA 2MMYA 2RILA 4P2SA 4NLVA 5F3ZA 5E3CA 1Z2LA 1HR0J 4UF4A 1LK7A 4ANCA 3W5XA 2Z2YB 3IR7B 3A8IA 2J6SA 3HHLC 4JI0J 3M6WA 4IFYB 2MXYA 2CJAA 3DXBA 3UD3P 1QY7A 1L3UA 4CLUA 3G6ES 3ITHA 4YQWA 2IVFB 2EC0A 3BKUA 4XTTA 2HW3A 2W4PA 3MM6A 3OL8A 2FVRA 2C3YA 1JLFA 2M8DB 2IRUA 2YNIA 1NK7A 5J1EB 2O5DA 4B3OB 2B0GA 2HKEA 3LWLA 1VK3A 3C19A 4IO9Q 2E5LF 1PJ5A 3R7NB 1Q8BA 1HQEB 2RDJA 2HQDA 4LF6F 2W8LA 2RH3A 5H9FK 4KY3A 4ZVQB 3NGDA 1CJKB 1UEKA 4J7CA 2AMCB 1SV5A 5KFPA 1FFGB 1F2HA 2XCPA 2BQRA 2XMWA 2FGCA 4OZ3A 4IH5A 3D0IE 3GFZA 2LA6A 1U2RA 2GX8A 2AX1A 9RUBA 3CMAS 5FD1A 4DR5J 3P3DA 2EWHA 2K7KA 4PQAA 3K5PA 4C9DA 1LNQA 2DNPA 4RBVA 2IMOA 2OPSB 5CCMA 1SKUB 4GMKA 2V8PA 2XQCA 3T41A 2N4DA 2P9CA 4OYOA 1N4LA 1S6QB 2AYGA 2DXDA 2BDPA 5AT1B 2M8HA 4QR2A 3PHEA 3C3LA 1E6VB 4YUDA 1WJ9A 3PFEA 3DXSX 2MZSA 4WF9Q 4P74A 3F0NA 4IYQA 4K4XA 1UWBB 4GVBA 5C2CA 5CYMB 3ET6B 4ELUA 4WP9A 4U95A 1SH0A 2BM1A 4KBIA 3RBDA 1J27A 5HL7Q 2ZJRQ 1MROB 1FVQA 4KHPJ 3K58A 2IYIA 5HK4A 3OUYA 4Q44A 2ZVIA 4C48A 3CJKA 1YJUA 1VRUB 3CXCR 4YB5A 2BKPA 2FJBB 3KLEB 2DNHA 5AE2A 2NZ4A 3HZEA 5CYQA 3DI6B 3DKDA 2NXNA 1FA0A 1JLBB 1AYEA 2QLXA 4ZJQA 5KG4A 4MH8A 3RU0A 1WACA 4ZLLA 3LP2B 5LMNF 2ZBIA 5CH7B
chains in the Genus database with same CATH topology
2J7WA 5KFEA 3G6YA 1N36F 1XNRF 4M5DA 1CQNA 5DLFA 4PG8A 4X66F 3MR5A 1TL1B 1ZTWA 3PEHA 3VAKA 1IBKF 2VB6A 3HT3A 4DJBA 4UOCA 5FLXY 5AE3A 2GC8A 3FRYA 3MDFA 4I6YA 1U2FA 1JNRB 4DLEA 4DFKA 2NUUG 2HFZA 2FLPA 1YQHA 5J2MB 1X4CA 2VOOA 1SKSA 2L41A 2LLZA 3CTRA 4O44A 2UVWA 1Q81T 3EXCX 2R4FA 1Q82T 1UAWA 4FF2A 3W2VB 3PVXA 3MR6A 2HS3A 3MHYA 1C1BA 4PPZA 3N6LA 4DV0F 4DV7F 5A8WB 1QM9A 5KT7A 1KONA 3PX4A 4NYPA 1U6FA 3HFKA 2ZZNA 5IQQA 1N8RT 4N5SA 2C3UA 3HF5A 5KFZA 4WU2A 1N0UA 2R7RA 4J5OA 2W7AA 2RE1A 4DSIA 4TYBA 4K2XA 1S4FA 5J2PA 5DRKA 4HH0A 5DO2A 4RBTA 2W7OA 3TRGA 4ED0A 4USJC 3GR0A 1FNOA 2J7KA 3MD1A 4ZPBA 4RUCA 3OTBA 1DHMA 1FKAF 2VFRA 3OTDA 2C2RA 4EO6A 2W8KA 4WZMA 3KK3B 1XERA 3FQLA 1OS5A 2DNKA 4RW4B 3WDOA 1SKRA 1UW4A 2PD1A 2G13A 4TY9A 2ASYA 4TXSA 1FESA 2ZH7A 2LQBA 5HI7A 2VODA 2IC3A 3TVZA 3KWMA 2XO7A 2YKNA 2VBZA 3CF5Q 2DH7A 4K4WA 4R8UA 2A1BA 2KYXA 2DO4A 4MJKA 4FXDA 2MJNA 3OL7A 2CG4A 5LJ3Y 3PNIA 3IWXA 2E9RX 3GYNA 3OJUA 2Y1JA 2DGXA 3DFEA 1E6YA 3IO1A 1RT1B 5E3PA 1MWYA 4DL0C 1T02A 1VQ9S 3CEDA 1S1VA 5J2QB 1WF1A 1Y3JA 2DJWA 2DK2A 2M2BA 4OHZA 1WG4A 3K59A 1NKBA 4YHHF 1Y5NB 2ZFHA 2LDYA 2V8GA 2Y1RI 1SJ3P 1OIAA 2HNZA 1S9GB 4KSEB 1FRXA 3VQTA 4P7VA 3H20A 1BLUA 4JI8F 2VZ9A 3NG8A 5F8NA 3SQGA 3I96A 3CCLS 1NK5A 1RT6A 2K2PA 4H4KA 2CQDA 3TARA 3QGIA 5BJRA 4PG4A 4DPOA 1YIJS 2QYCA 4ZPTR 5J2NA 2C42A 3BO3A 2KKHA 1N56A 3TUZC 5KG7A 2DHGA 1C0UB 2GCFA 3NS5A 5CA5A 4DHVA 4CIOA 4ZS6A 4ZDNA 3MEKA 1ZOTA 2Q79A 2KI2A 3DDKA 3PZPA 4DG1A 5KFTA 1LWCB 2OMLA 2QMWA 2GW8A 4NOHA 3Q8RB 1R0AA 3I82A 4TLQA 1TL5A 3VALA 1URRA 4KFBB 2ILZA 1RT2A 1T8EA 2DNLA 2UXBF 1N6QB 1VJWA 1G6BA 3M2VA 1BGXT 2FLOA 4B9UA 4DN0A 5FDLA 2XMVA 3DLEA 2QA1A 3K8WA 2DB1A 4B08A 2P9GA 3PW4A 3H2VE 1GNKA 5FJ4A 5HLFA 3I0SA 5HROA 2UV8G 3PDNA 2XB2D 2VKRA 3MAQA 3NBPB 1MROA 1UKUA 4F2RA 4KKOB 2IAJB 2MPUA 4X4QA 4J9RA 3GFYA 2XY5A 2V94A 1CC8A 3N28A 2EFPA 2C2DA