2CDRB

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 SUBUNIT P17
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2cdrB00
2XYPB 1QDUB 4DCOB 1RHKB 5IC6B 3EDQB 4ZVRB 2H65B 1PAUB 1RHJB 5IC4B 3GJRB 2C2KB 3EDRB 2P2CB 1PYOB 2XZTB 3GJQB 3KJFB 3NS7B 4ZVQB 2CDRB 3KJQB 1SC3B 1RWNB 4ZVUB 4ZVTB 3SIPB 2QLBB 1RWWB 1RHRB 2C2MB 2CNKB 2QL9B 2H5IB 2CNOB 2QLJB 2HBYB 4DCJB 2C1EB 2HBRB 3D6HB 2HBZB 3IBFB 2Y0BB 2H5JB 2C2OB 3D6MB 1RE1B 1GFWB 5K20B 3P4UB 3D6FB 2CNNB 2H51B 3P45B 2H4WB 1RHQB 2XYGB 2H48B 2H54B 2QL7B 3R5JB 1ICEB 2QLFB 1RWXB 4JB8B 3R7SB 1BMQB 1RHMB 4ZVOB 2QL5B 2Y1LB 2DKOB 3R6LB 3GJSB 1I3OB 1RHUB 1RWOB 4ZVPB 2CJXB 1F9EB 3R7BB 3QNWB 1SC1B 3R7NB 1IBCB 1RWKB 2C2ZB 3R6GB 4LSZB 3GJTB 2FQQB 1RWPB 2H4YB 3RJMB 2CJYB 1SC4B 2XYHB 3KJNB 1NMEB 4ZVSB 3IBCB 1RWVB 2CNLB 2XZDB 4DCPB 1QTNB 1I51B 2HBQB 1RWMB
chains in the Genus database with same CATH superfamily
2VDIA 3H42A 4F67A 4J9RA 3LGNA 1HBOB 3GJRB 1WDTA 4ZPWR 3W7BA 3LA0A 2O66A 1VRUB 3U7JA 4CLTA 3BQ1A 2PFFB 2B3TB 4OI3A 5F8HA 4OV1A 1Y9OA 4YR2A 4NLUA 3M9MB 1MWZA 4EMDA 2A6OA 2R8KA 2DIVA 2IRYA 3ZTSA 2NR0A 4B9MA 2FVQA 1VHIA 1SQEA 4DF8A 2V63A 2QL7B 1NHUA 4OYMA 2VBXA 2ZBCA 5C5JA 1LK5A 2MZSA 3UFCX 2H4YB 3ZTQA 3K5OA 3IR5B 4J9SA 2UUCJ 3F56A 2CNLB 4QOTA 1VBKA 2CG8A 1EZZB 1PJ6A 1REVA 3MMCA 3DYAA 3KHLA 1N0VC 3CDWA 1KVKA 3DNCA 1N6QA 3N5FA 3P5TL 2ZH1A 4CO1A 2W2PP 4NA3A 4LSLA 3FNNA 4F3QA 2EFQA 3HHDA 5EDWA 5A2QU 2FJXA 2VF3A 3T9NA 4DQRA 1REVB 3MMCB 3DYAB 4QWCA 1HI8A 2AV5A 2K1RA 5HROA 1N6QB 1WSRA 1S1UA 1IKXA 2DT9A 5I3QA 4DPUA 1NJWA 2DR9A 5F9NA 4Y2IA 4LSLB 3Q8YA 5D3GA 4C9DA 3UR0A 1OY6A 4DBQA 2K1RB 3THTA 5HROB 1S1UB 1IKXB 1H2UX 2Y0SD 2CJYB 3A8KA 2J76E 2MYFA 5D3GB 4QZVB 3QT7A 1EHWA 2XSJA 5HLFA 1JXEA 2YPYA 1UZHA 2LA4A 4IOBA 1J2VA 3LGHA 4KJIA 2HRUA 4Y00A 2B9EA 1SL2A 3CJ2A 4B9LA 1HYSB 1IQZA 2KB2A 2WOMA 3OD2A 3EDRB 1VYAA 2Y1IA 3SFUA 3N6LA 5I3PA 5H1SV 5HLFB 3OVBA 1Q79A 3M1VA 3TUJC 2QYGA 3MEGA 4OI1A 2WK4A 5A6WA 2WOMB 2H5JB 3ZZRA 2RQ4A 1P1TA 4HH1A 1ZPVA 3MTJA 3C2PA 3OTCA 3M1VB 2ZUAA 1FRIA 3KLVA 4EFAC 3MEGB 4AL7A 1I5OB 1NPPA 2MKCA 4ZP8A 2QA4G 5EX0A 2AYEA 2CIMA 2Z8QA 1OY9A 1SXLA 2F65A 3G6VA 2EK1A 5KFXA 2IYIA 5KT6A 5ETNA 1Q8BA 1IQTA 2UXCF 1G2EA 2B9YA 4J9PA 4LF7F 2NXEA 1KHWA 1S6QA 2DNZA 4M5KA 4RBUA 2K2PA 4TXSA 2UVUA 2B4UA 1I94F 4U7UK 2IBOA 1WC1A 3MCMA 1TKDA 2RIJA 4XO0A 2EKNA 4ETXA 5F41A 3KJQB 4F4ZA 1OMSA 4BBYA 2ASJA 3K5PA 1S6QB 1ZM2A 4CNZA 4NLSA 4CO0A 4A46A 1T7PA 4J5OA 1RTHB 1G4CA 1NJIT 3HSGA 1UW4A 4I56A 1CC8A 1Q78A 2YQ1A 3GTYX 1LEOA 3RG6A 4K4UA 5B0BA 3JSRA 3C14A 4DHVA 4DMZA 2DR5A 3UNYA 2ZH8A 1KFSA 5L1LA 1AB8A 2DNQA 3GJSB 1ZETA 1X31C 1F60B 1XN9A 1FWPA 3R2CJ 5HI7A 4QWAA 2C42A 2ZH5A 1U02A 1RI7A 3H25A 3C14B 3ENWA 1EKSA 5JMNA 3TANA 1SH2A 2B7BB 2R7TA 4LF7J 3HK2A 1BLUA 1B7FA 4A8SA 2XMWA 5KFCA 1RT3A 4KAIA 4X66F 3VAHA 2DGXA 1VQ4S 4MK7A 2KZZA 4KGMA 1VQKS 1HWUA 3BSOA 1VIXA 1RT3B 1VJQA 2HHTA 1FDDA 1S5ZA 3I87A 3BGRA 3RB4A 2ZHOA 4FXWA 1JLGA 3H5YA 4BDPA 4NMXA 1JXVA 4DI6A 3L7UA 2CNNB 3FBBA 3OXLA 1H73A 2V2VA 3QWPA 2V4JA 3AXMA 4WFXA 3QJJA 4RW6A 3BGRB 4DV2F 5DLFA 1JLGB 3G6YA 1PCAA 2QL5B 2RU3A 3QZ8A 2LMIA 3CULA 3EJMA 4ID5A 2IDLA 5HVFA 2OMOA 2OUGA 4ED8A 4XPCA 2DB1A 2V4JB 5L39A 1S6OA 4RW9A 4RW6B 3WC2A 4TU8A 4O3NA 2CJ9A 4ID5B 2DR7A 1M5PC 3PXGa 2C2DA 1RK8A 2DTJA 2ZHAA 1X9WA 3BH7B 4X66J 2VASA 1OQ6A 5K8NA 3LWMA 3UCUP 4RW9B 1PJ5A 5E33A 2XHWA 4F0HA 2Q66A 2LDIA 2B56A 2IA0A 2O5DA 3OLAA 4TYBA 2YKQA 1TFWA 2BYCA 4RNHA 2DITA 4IR9A 4L76A 3JSBA 4JI3F 1NSAA 3P5BP 5D78A 5HJXA 3UVJA 3CO0P 4QYZK 1ITPA 1M1GA 1IM4A 1S10A 2KT2A 3I5CA 2ZM6J 3NG8A 1VQPS 3I4HX 1RYRA 4FF1A 4UOCA 1HI0P 3SI8A 3CIZA 4JP8A 1F2HA 2CVEA 3UVJB 4F3OA 1W2BR 4ZN1A 4J37A 3Q2TC 5J2MA 4CRJA 3IWLA 3PIOQ 4ER8A 1YX2A 4UY8T 3L09A 3Q83A 3NCQA 3RBXA 2ROPA 4ZJQA 1KWMA 3IM9A 3ZNUA 3M2RA 5J2MB 2BW7A 1X60A 1YJWS 5DDRC 4DZDA 2YWHA 4K50A 4FF2A 2BOAA 3GZ7A 3MF5A 4J9VA 3GG0A 2D9PA 4RKUC 4YHHJ 4YEAA 3R5AA 4LBHA 1HWIA 1ZTWA 4A8XA 3M2RB 2J6UA 2R7SA 4H4MA 2U2FA 4JI3J 2KVIA 4KSEB 4I4BA 1KONA 4TLRA 4DG1A 3KLEA 4F4KA 3B54A 3NCRA 1T94A 2K3IA 3AB2B 1UA1A 4P6QA 2I9SA 3B4DA 4H4MB 3CXCR 2IHR1 2YWWA 1KQKA 5B7WA 1FD2A 3EVMA 3KLEB 4DG1B 2GQCA 3PDNA 1U1OA 1LWEA 3M8ZA 1BWEA 2HFUA 5LT5A 1T9UA 2GAHC 4ZHRA 4JV5F 3K57A 2DEIA 3NMAA 2YPZA 5C2GA 1HWLA 2ZZTA 4O3SA 1RBOB 4NEYA 1LWEB 2HS3A 3QT6A 2RAQA 4ZLNA 3HFVA 3VHQA 2HURA 2DNGA 3IC1A 4LR8A 4EYHB 2P2CB 4HT5A 3DU5A 4RBTA 2DH9A 1XMOF 1YLXA 3CJ0A 3TUPA 2W4CA 1AXQA 4U96A 1ELOA 5IOLA 1NH7A 1QAJA 5LJ5Y 2OAUA 1X8DA 2FDNA 5K8OA 2DGWA 3KOAA 2HHQA 1CLFA 4LREA 3MM7A 4ECWA 2J8SA 2ZBPA 4LRAA 2AJ0A 4A8KA 1NAQA 2QEXS 3IG1A 5HJYA 1H38A 1WF0A 4FYYB 2NYIA 1VQSA 3KLGA 2PA8D 1S0OA 4J9UE 3MM7B 3BO4A 2W1BA 4DQPA 2YH1A 4BCAA 4DX8H 2J9CA 4JV5J 1W2IA 4CLKA 1NH8A 2HW3A 3R9LA 2P9CA 2OGUA 3IG1B 3G82A 2RUGA 5CHCB 5IT9U 3GG1A 1C4AA 4RLEA 1YRUA 3HFKA 3WBZA 3KLGB 5DLGA 4IO1A 1S1WA 4TQSA 1C4CA 4USWA 5MAOA 5K9FA 1APSA 3N6MA 2BQ3A 3UNGC 1FTRA 3AAWB 1DRZA 3T5KA 2ZOGA 5DQGA 3G8QA 1XMOJ 2W2NP 2MTLA 1S1WB 2YWEA 1NO8A 2GS8A 3M05A 4YS2A 5SZTA 3IA0A 3T41A 2YQ0A 4NA2A 2YVSA 3VVTA 2CQDA 3T3FA 1JLAA 2YY3A 2C3MA 2E44A 3FZ2A 3N9UC 2V5HG 2N3LA 1RT4A 3N0VA 2L9DA 3LPYA 3FJ2A 1QY7A 1X9SA 4OIXA 5KFJA 1H7WA 4WFAQ 2QRRA 1FO1A 4TVAB 4XDCA 2ZC3A 1RBLA 1QAXA 3K8WA 4O3QA 1ZH5A 3M2UA 4W90B 5HANA 2CZ4A 2JEIA 4ILMA 1PILA 5LMUF 1S97A 2J8AA 1RT4B 4LFBJ 4DCPB 2CRLA 1NHKL 4ED2A 1JJ4A 6FDRA 1HWJA 1PJ7A 5GADU 4DQSA 3DLEA 4JV2A 1TVRA 1DURA 2M8DB 5KFVA 4LF9J 2IJFA 2DHSA 4QPXA 1FWLA 1NDCA 1D8ZA 3QWUA 5A6PA 2DNKA 1VRQC 4DN0A 3O6QA 3DLEB 4FBTA 1IJFB 3AH6A 3MR5A 1K47A 1TVRB 4URSA 1M90T 1KOOA 4J9LA 3QAUA 2CVIA 2HWHA 3JTNA 2V2QA 2CQ1A 3MM9A 1NSKL 4TU9A 2HNYA 4KPCA 1ZM9A 1WNEA 5T41A 2XY6A 3TAQA 3HHEA 5EHHA 3POTA 1WC4A 5HQLA 1YBAA 1F9EB 1R0AA 4Z2XA 5BYQA 3MM9B 4KGVB 3D7SB 2HNYB 3UN2A 1Q8KA 2KT3A 5LMUJ 4CLLA 1U6ZA 2FB0A 3POTB 5GAGU 2VV5A 1HIYA 5KFWA 3PNIA 3DM2A 1R0AB 1RGVA 2H65B 2EW9A 2W7OA 3ENQA 3NS7B 4DR2F 3PW4A 1BQNA 3J7AN 4YOEA 3OLBA 4C0OC 3DM2B 2PO4A 1KTVA 5K14A 4GKKF 1GX6A 4A8MP 4ZCLA 1H72C 3FKBA 4PYDA 3NY0A 2NLWA 1BQNB 1ZOTA 4OJHA 2HVZA 1WSVA 2LA6A 4JBCA 4ECSA 3H4DA 2QE5A 2ZH7A 5K14B 5L9XA 1T9WA 2XS7A 5FD1A 4NE9C 4LF8F 2GZOA 1OY8A 2GC8A 4LFCJ 3QBCA 1VFJA 1QUVA 5I3UA 1WACA 5KG2A 1K8AT 4I1TA 5FDLA 4K2JA 2OJ3A 2KU7A 1FE0A 4DV7F 2RF2A 4HEA9 3A3PB 3TA1A 2I38A 2NUUG 1QSSA 1N5SA 2MY8A 5I3UB 1N33J 4ED5A 4USIA 5FDLB 2EG2A 4DR2J 3EE3A 2CAJA 5M2UA 2RF2B 3OTDA 1NCLA 1G6BA 2YNFA 4YFUA 4O4GA 5ETRA 3PRBA 4GKKJ 4UUXA 3ZZYA 4DFPA 1NJXA 2HNZA 1TL5A 4QQBA 3MR7A 3QT5A 4PAAA 5IV3A 2H4WB 2JLEA 1X5OA 5DRKA 1ZYQA 2YNFB 5RUBA 4OYBA 2ILZA 1FJGJ 4NX9A 4NYPA 1BMQB 4OHWA 3I9V9 1WDDA 3PO5A 2PDAA 2HNZB 2DRAA 3ISND 3HHLA 2RQCA 3UN5A 1P9YA 2VFRA 1RAGB 1C0TA 5D15A 5C24A 4DV6J 1B70B 1KLNA 3ILLA 3D4JA 3QLHA 4DR4J 2NQPA 2W7AA 4DV7J 4O3RA 4HTJA 2PA3A 2CPEA 3SQGA 2Y8WA 1YGYA 2AQ4A 1C0TB 3Q22A 4QR2A 2UUWA 1PC4A 3PRDA 1FX4A 5C24B 2GO8A 1UVMA 3MOZA 2MSSA 3QLHB 1FRXA 1HMVA 1VQYA 2PEBA 3PJXA 1QJHA 8AT1B 2OPQA 3DDIA 2JLFA 2HHVA 3M32A 3SQGB 1UTAA 4ES1A 1EQ0A 3JXOA 4KFBA 2G2OA 1FVQA 4RW7A 2NPFA 4X62J 1IKYA 4ZP7A 1HMVB 5B0DA 4F02A 1TUGB 4JI1F 3W5XA 2OPQB 2E1MC 3M32B 3BV8A 1YITS 3FBFA 5FJ4A 3R7SB 5D6GA 1OJ4A 4KFBB 2CWXA 5T14A 1UKUA 4CQ1A 5EWGA 4RW7B 4X4RA 1IKYB 3GWCA 2B43A 2MDAA 4RUAA 3RU0A 1TL7A 4AXJA 3RR8A 1QSYA 2BJ9A 2RNEA 3D2WA 3H8YA 4FNIA 4USKA 3GP9A 4K4ZA 4J9NA 1CPZA 2NXNA 4GRSA 1IKWA 5KFPA 4ECXA 3RAQA 2XCAA 1DTTA 3W63A 2M4MA 4YDXA 1B3TA 3EXYA 3ZZTA 1NZ8A 1U45A 4F3MA 3PW5A 2QSFA 4P2SA 3HSZA 1SJFA 1IKWB 1N32J 3BO2A 5KFAA 1DTTB 3DLGA 1VK8A 1TL3A 3T1AA 4OLOA 3CNQP 1U1RA 5C42A 4NRTA 1O51A 4LSNA 4Q8FA 4WZQA 2C28A 4ATNA 2JZ5A 2IFXA 4DF4A 3KNGA 2A18A 3DLGB 4U8YA 4Z7YA 2YQ3A 1TL3B 4USHA 2MZJA 2EXUA 5C42B 4NCGA 5JVHQ 4M5MA 4LSNB 3FUYA 3EPIA 3G87A 1HPZA 4EO6A 2AYGA 3RW6A 3JSMA 3PVXA 4QU6A 3JYTA 2VODA 2DGTA 3HZEA 1BC6A 1RT2A 3SCIE 1QTMA 4NCGB 4DL0C 1WG4A 3DGVA 4YMEA 2Z0GA 1HR0F 3U1LA 4Y2KA 1UL3A 1MG7A 3JSMB 2ZHBA 1OIAA 2YKMA 3F0NA 3FFIA 3BR9A 3JYTB 1YIJS 3CW2C 1HKAA 1RT2B 1TAUA 2HZAA 3VAIA 4DV1F 1S77D 2UP1A 5DG8A 3R5GA 4V19J 2ZDPA 3CJSA 1WOOA 4Y28C 1WTFA 4M5GA 3BGLA 3W66A 2E5IA 4NLOA 3W1YC 2YKMB 4ETZA 2ZEJA 4LR9A 1S0VA 2RH3A 2XYGB 4PYAA 3M6XA 4ZPAA 2XB2D 1PG5B 3EMTA 2E9RX 2HFSA 2GJFA 2CKWA 4XIUA 3UQSA 2VFSA 4C0BA 2FLPA 1FDAA 3OXFA 2CZVC 2BACA 2DEJA 1DTQA 2P6SA 2YH0A 3PR4A 2ADBA 2JHEA 4ZA1A 2ZDOA 2ZJQQ 3BJYA 5KG7A 2BRLA 3BM7A 2NS1B 2VFTA 3IAS9 2C2ZB 2HRTA 2D3O1 3CTRA 3Q8UA 4F25A 1DTQB 3FCHA 3MUVP 3MAAA 3MPUB 3GB0A 1N8RT 4IFVA 3P6YC 1FE4A 5AT1B 2ILYA 2ABYA 2P6TA 2ROEA 1N56A 3R5DA 5D4PA 4DV0J 4QIGA 4AQYJ 1LV5A 5B0EA 4OHZA 4IFVB 4K5RA 3UD4P 2F9JA 1V3ZA 2UU9F 4AD6A 2D3ZA 3OJUA 4A8FA 2OD6A 1S99A 1KOHA 5F3TA 4ZPTR 1WC3A 3MECA 3RB6A 1UVJA 1Q4RA 2O3DA 1AT1B 5L38A 2WVEA 1N36F 1RAAB 3MECB 3GILA 2XMAA 2AIRB 2XG8A 2R8GA 1ZA1B 1XC9A 5EGYA 4WP8A 2W9BA 4OX7A 3TZYA 4HHJA 2Z56B 3I0RA 1R27B 3JSYA 2R8IA 3VZIA 3HHLD 2ATCB 3VGUA 2FHMA 3GFXA 2VG6A 2MJNA 2X7IA 2Y1JA 3GYNA 2UVRA 2K8GA 2G2YA 3CMES 1JQGA 1DJ0A 2UU9J 3I0RB 1RKJA 2LP4A 3HKZD 3BZQA 4GKJF 3A12A 5AXMA 5EWFA 4YB5A 4HVZA 2R2RA 2B8QA 3KDOA 5ETKA 2VG6B 5HMXA 3D9BA 4ZK7M 4NXNF 3BREA 3OT9A 4WYWA 2VJVA 4JI0J 2JWNA 3F73A 3AOAA 1T9VA 2YKOA 4CZCA 3I82A 3AY0A 3FBCA 4CT8A 3BSCA 3I31A 1Y5LB 3OTOJ 4MT1A 5HL7Q 4Q2MA 4WF9Q 2IBKA 5BR8J 4J9MA 2CPIA 3OR1A 4DS5A 3Q8SB 2Z30B 1RWWB 2BV3A 4RR5A 4OYWA 4UF4A 4B9UA 3KUEA 4EYIB 2V8GA 4IH6A 3GMGA 4GKJJ 1S76D 4RNOA 1UMJA 3OR1B 3JQMA 4DR7F 4DR3F 1U24A 4ENOA 4X4SA 2A2CA 3MMAA 4NXNJ 1UP1A 1V5VA 2J7KA 4OJGA 1FXRA 1O0PA 1MSWD 4DR6J 4ID8A 2MZ1A 1SC1B 2GCFA 1X4CA 1U48A 4OHYA 3IXQA 1QSLA 2Q43A 4O3OA 1I1GA 1R3NA 1FJEB 2A0FB 3MMAB 2ZOFA 3T1YF 3NRBA 2WSCC 2YWGA 3TZXA 2HZCA 4ELVA 2VA2A 3GFYA 3DRPA 3SDEA 1SUQA 4OZ5A 1O6XA 1JLBA 2L3MA 2UV8A 1PBAA 3CJ4A 3QYYA 2DCUB 3M8PA 3MOJB 3BBBA 3UD3P 4OJ3A 4V1Ak 1R0BG 3AQPA 2EK6A 2FZCB 3HVAA 2MQ8A 2VZ9A 1BXNA 3DRPB 3SDEB 1SUQB 2QLJB 4FDFA 5L1IA 3ZXWA 4C11A 1JLBB 5KOXA 2VHGA 4P9SA 3M8PB 2IMOA 4JUZA 3R97A 2B4PA 1VQ9S 4DPOA 3KXDA 3NMRA 4X2BA 3M4XA 4WKRA 2DH8A 4URGA 3R5JB 4H4KA 4C11B 3MR2A 3AT1B 2KHCA 4NZ0A 2ZBIA 1T11A 4FXVA 3GPAA 3QGPA 1NRKA 1RWPB 4Y34A 3T1YJ 1GQEA 2V6AA 4LT6A 3CJTA 2HBQB 2RT3A 4NLTA 2UXBF 2GW8A 4AL6A 4PXEA 2HIYA 1RTIA 1PKUA 5KFNA 2FVCA 5DG9A 3RB3A 1YRXA 3OSPA 2ZZMA 1U2FA 2WB1D 2WW4A 5E5NA 3BKFA 3QMQA 4XTTA 3B78A 2MZQA 3D1HA 1F5BA 1RTIB 1LWCA 4OI4A 2XO7A 3PHEA 2OTJS 3M6UA 1GAOA 1RXOB 2N7CA 2BDPA 1N54B 4RX6A 2DHXA 4OZJA 2R8JA 3IM8A 3NGUA 1U0HA 1TMMA 2SXLA 3UCGA 3HVWA 5A8KA 2GJ2A 3SCLE 4ZLLA 2HHHF 4P7VA 1LWCB 2HRYA 3SV3A 2K3KA 1VGYA 3WZ0A 2EBEA 1Z2ZA 1NSPA 2OFGX 2HLTA 1JWWA 3I56S 4QWEA 1U0HB 1SC4B 3LPEA 3ZZUA 4FKYA 3QZ7A 1WELA 1X5SA 1U4BA 1IVZA 5A8KB 2RDDA 4KQZA 2GMLA 2V68A 2YKAA 1NK7A 3OHAA 3R5CA 2JX2A 2UXBJ 2JLGA 3NWGA 4LJMA 5KG1A 1IBKJ 1R43A 4NLRA 1NU4A 2AU0A 4N76A 1L5UA 2HS0A 2ACYA 3H2LA 1X7VA 4O23A 1WG5A 2V94A 3P49B 2JEGA 2HEKA 4Y2AA 2PMHA 3HHKA 2HBZB 4FPIA 4CIOA 4KH1B 4WFNQ 1M5KC 2WVBA 2VG7A 4DFKA 4WTYA 4FXDA 1TUVA 4PZVA 3Q8QB 3R5BA 4OJ1A 4DSLA 1SKRA 4X4TA 4A8QA 3GV5B 4OZNA 2CPZA 1RAJA 5M2RA 4DSKA 1TTHB 2HHHJ 3GLJA 3DKDA 1TZ0A 2VD3A 1C1BA 4QW8A 2VG7B 1TELA 3MURP 2GHWA 5T7LA 3TWZA 3T6JA 4U95A 3QRQA 5KFYA 1Q0NA 1KC8T 2HAIA 4IH5A 1WI8A 1MMLA 1WJ9A 1H3DA 2D9OA 4QPTA 1C1BB 2DD8S 5HMWA 2W9CA 5T7LB 2XEXA 2AYBA 2E7WA 4N7TA 3OFHA 4ZVQB 5BJRA 3UDVA 3CD7A 4O0IA 2J0QD 2JFKA 3GIRA 2OH2A 2H5IB 3KLIA 2W9CB 1H98A 4HDGA 1RE1B 5B0GA 3OL7A 4MKBA 2RUSA 2D41A 1S9EA 3P45B 2PI4A 2DHGA 4CYUA 2W9AA 3CUNA 4WTOB 3KLIB 5KFIA 1REGX 4JB8B 3TUZC 1MWYA 5F0WA 3G8SA 2ROGA 4TY9A 1OS5A 5EX3A 3DGPA 1D9FA 1MU2A 1S9EB 1RISA 3Q23A 1L3SA 4CYUB 1TKZA 2BE9B 2DRDA 4TKTA 1F9FA 1IBMF 1MW7A 3JTOA 2KO1A 2MKJA 2EFNA 1BUXA 3NOGA 2YWKA 1P9QC 3DGPB 3FZBA 1MU2B 4OX6A 1WHWA 5J1PA 2JDJA 2RRNA 3VGSA 1TKZB 1T9YA 2M2BA 5IXUA 2I2YA 1YTYA 3MWBA 4DN9A 2BJ8A 3H0PA 5GMEA 4K4TA 3PKYA 3MCOA 3CCZA 4QCLA 1U1MA 3AOBA 4KYZA 4S0MA 4IDKA 4OX9F 4RWXA 3OR2A 2DISA 1RAHB 4RW4A 1ZM3A 2CQ4A 4MAKA 2JL9A 5LSRA 5D0HA 1TK5A 1ZA2B 4Z7CA 3RGIA 4IDKB 4C8LA 4X4NA 2J6SA 1IR2A 2DCLA 3OW2R 4OZ2A 3US5A 1FNOA 4RW4B 2G0CA 3GR1A 4KKOA 2KZMA 4LVOP 2LEAA 4M8LA 2J9DA 5E2QA 3BBCA 5GADI 1SL1A 4PCQA 3LOUA 3WQPA 1HNZF 1KD1T 3HLUA 2F8MA 3ZZOA 4TNOA 4PWUA 2BE7D 2AJQA 3BYRA 2XM3A 4KKOB 4X64J 3FQKA 4OL8A 3KG1A 1GMWD 3OXGA 2BE2A 1NSQA 2C22A 5IV4A 1RLCL 2YTCA 5BYRA 2MHNA 2I8EA 2C2OB 4DPWA 4PUOA 4CH0S 3OL9A 3W61A 3IR6B 4OX9J 3ENVA 1L3TA 1EARA 3ETMA 1RTDA 2BE2B 3ISNC 4JOUA 4AXIA 3WC0A 2LEBA 3M8SA 2VICA 2CJAA 1TU0B 2VFVA 4Q43A 1NZAA 1FNXH 4JI6F 1X4HA 1RTDB 1U1QA 3UE2A 4JI2F 4A8OA 4MFBA 4PG5A 2PSZA 2MEWA 4DU8A 5GAGI 4G6VB 3A8JA 2W2MP 3D1OA 1GXUA 2VL1A 2MLXA 1HNZJ 4I64A 1BE4A 2W4DA 3VALA 2KFYA 1IN0A 4MFBB 5A2QY 1SPBP 4Q8EA 5KFHA 2XSFA 2IJNA 2CYYA 1T03A 2YKNA 3UDCA 1WHVA 3LAKA 2NZCA 5ETOA 2LXFA 1KDNA 1G3OA 2O01C 1PGZA 3D6TB 2N3OA 4LF4F 3I4PA 4E98A 1T03B 2YKNB 5F8MA 3ELHA 1VBYA 4FS1A 4RNNA 1YHQS 3R6LB 1FKPA 1RHUB 3EX7B 2UVVA 4CM0A 3AXKA 2XYHB 2V0NA 3OFGA 4NYOA 2Z2ZA 3N79A 4I67A 5KFMA 1FKPB 1QE1A 1VQ8S 5KFRA 2KVQE 1ULRA 1YVFA 1BD6A 4LRBA 2IVFB 4OZ3A 2EVZA 2XMUA 4CO3A 4FVMA 2I0XA 1LOUA 3RAXA 1SC3B 2V69A 1RWNB 2DY9A 4JI8F 3BR8A 1SJ3P 4UOHA 3R8YA 1S12A 4MKVA 2PC6A 2E9ZA 1AYEA 2ZBQA 2VUGA 5CABA 2KDOA 4ECRA 4JV0A 4CTAA 1DQ9A 3M8RA 3TO8A 3QRRA 3NGSA 3R1HA 1BY9A 4ZLJA 4IOAQ 2RQMA 2UZAA 2A6MA 3KFWX 4LF4J 4FN5A 3B4MA 4CLZA 4C97A 3D0HE 4CTAB 2UUBF 4CH1A 2BJ3A 1M0SA 4R0JA 1DHMA 4MK8A 4Y3CA 1H6KX 4TYAA 3VAMA 2VC0A 2VJUA 1RWKB 1F3FA 2BKOA 5KFTA 4J9KA 1GTHA 2L9NA 3SSQA 1J5EF 1RCOB 1X4GA 1NB2A 3EVWA 4CWBA 3IBCB 3SSRA 4DR5F 3PHTA 3AQOA 4WPAA 2IC3A 2XYPB 1HL6A 3DMJA 2B5JA 1EJ7L 1FXLA 3E01A 2E7XA 2XI2A 3MD1A 3GSIA 3M8WA 4Y6IA 3HZGA 4JI8J 1Z2LA 2IC3B 4PQUA 4WZMA 4AUKA 3DMJB 2B5JB 3MEKA 3E01B 2Y0BB 1WEXA 4KTQA 2HHUA 4PQUB 1Q7LB 3AD8C 3PW2A 2E5JA 2IYGA 1DQAA 4DFMA 2AJ2A 4DR1J 4Q5VA 2Y1RI 1B0PA 2XS5A 4WWSA 5IT4A 2UUBJ 2LFVA 3V6KA 3CCUS 4ZCKA 4KV8A 4L3NA 1E6VA 3TVYA 2R7WA 3HSDA 2QA1A 2F4VF 1J5EJ 1F5CA 3CGIA 2FZKB 5KTQA 2G2ZA 4ZVSB 1RT6A 4DR5J 2FJBB 2J7WA 2FPHX 5ADZA 4KV8B 2WW8A 1E6VB 3CMAS 4DV4J 3EICA 1JJCB 3TW0A 4GC6A 2EC2A 2PD1A 4YQWA 1ZZFA 3BBFA 5D0GA 2VQEJ 3ZZPA 1RT6B 1JMTA 3D5MA 4P73A 1A0OB 3MAQA 1TL1A 2ZNZA 1LXJA 4I6AA 4NCBA 2BBEA 4L3KA 4F4XA 4DUZF 1NDLA 1TFYA 2XO6A 1UJ6A 2WCXA 3THVA 1IR0A 2AJ1A 3EZUA 4J9OA 3GCXP 4WU2A 4P7TA 1RHQB 2QO3A 2XBPA 1TL1B 2E5GA 2R2SA 2H54B 1IWGA 4QR0A 3OL6A 5ETQA 1RHMB 3TQEA 5DO2A 3UD5A 2P9EA 9ATCB 2JVOA 3TQ1A 2YWFA 3LALA 1NKCA 1RT5A 2F4VJ 3X1LB 3CIMA 1RB0A 4QWBA 2YBVA 2BKNA 4CCHA 3SV4A 5DGAA 1FRJA 4WKYA 4ZIWA 3K5NA 2R2TA 1GXTA 3RBEA 4IH7A 3TRGA 1RT5B 1HW9A 1VQOS 3DXSX 2F8HA 5KFDA 2AZ3A 1NHVA 2ZJRQ 3OSNA 2ACMA 1VBXA 4DV5J 2N4DA 4OI0A 3V81A 2L48A 4DUZJ 5IT0A 5K20B 4EI2A 5LJ3Y 4OYAA 3PM9A 4J7CA 2BJEA 1MROA 4N8OA 5AXLA 1GMVA 1HNIA 1DBDA 3CCSS 3NNAA 3V81B 2ZOMA 2XNRA 1DLOA 1YSJA 1S49A 5DZ7A 5E3QA 1MROB 2AMCB 4RL1A 3GIMA 1HNIB 4O4RA 1SQFA 4GC7A 2CA9A 3N4WA 1RT1A 4ES3A 1DLOB 2XSJB 2KYZA 3J7Z5 4IG0A 4ZCMA 1CVJA 3SMZA 1U2RA 3DLBA 4CLFA 1JLEA 1Q95G 1BQXA 2IY5B 4WP3A 4UZBA 1HLWA 1PYOB 2F8EX 2U1AA 1X4BA 2N4CA 5AJ3J 3MXHP 2RHQB 1RT1B 2GJIA 1SJQA 4CI0B 2KT5A 3ETOA 3AOCA 4IG0B 1JLEB 1UVLA 1VLOA 1YZ7A 3FEYB 5KAKA 2Q6CA 2XTJP 3OVAA 3PACA 4EBDA 3QJPA 1RDRA 3J81j 4WJBA 2WRMA 1H7XA 1FKOA 2R7QA 3D67A 3C16A 2EKYA 2QT7A 4UT4A 2FJWA 4YDDB 2B7CB 4F0MA 2DNPA 3W64A 3C66A 2OKQA 4L72B 4MJKA 4KO0A 1LW0A 4HL9A 1VDHA 1FKOB 1V6HA 1AW0A 2EEYA 2J0SD 3D0GE 1D8YA 4U6PA 2HHXA 4G65A 1QTNB 4KO0B 5DETA 4N8NA 5GAEI 2GMJA 1LW0B 4ECYA 1R8BA 2CPDA 2CQGA 2GQQA 1UVIA 5E3AA 4N41A 5IWAJ 4OYOA 4CLSA 3M8YA 1C0UA 4PABA 2OPRA 1YJRA 5J1EA 2BANA 2IMWP 2MXYA 2ZC4A 3ZTRA 3W8GA 3C8YA 2RMLA 2FLNA 2VPYB 1C0UB 2OPRB 5J1EB 2BANB 1VBZA 3FMBA 3BH6B 2C2RA 4MTPA 3V5RA 4USUA 3LP0A 3PX4A 3WX8A 3MMBA 2RE1A 5IT9Y 1SJ1A 4PXBA 5F3ZA 4DDFA 3O2IA 3K59A 3VWSA 2V8PA 2Z2MA 3M7VA 4F2RA 3OL8A 2XWYA 3A1YG 4USVA 4K7QA 2FHJD 3QFHA 5KG4A 3FRYA 1R0CB 3LP0B 4ZMMA 1S9GA 2DNHA 2RSQA 3MMBB 1RABB 5G0RA 4Y2MA 2OEMA 2EI5A 4Q2LA 2HG4A 1ZAXA 1S9GB 4B02A 4HH0A 3S7RA 2ZM6F 3CC7S 1KVIA 3E51A 2VFUA 5G0RB 2MQPA 2OLWA 2XY7A 4BS2A 4B08A 2O1PA 1F5AA 4I7FA 5KT5A 5DS7A 1RBAA 4USJC 3LF0A 3AD9C 3TVKA 3D6FB 2RS2A 1B0TA 4ZVFA 2P9GA 4JYAJ 4CLUA 5FLXY 3RYLA 1TQLA 3IWXA 4I7FB 1DARA 4F36A 4DQIA 2ADCA 1PIEA 3J7YI 1LNQA 3G71S 4M94A 3W65A 4QW9A 5CCLA 3TJ9A 2VU5A 2DR8A 3TA0A 1YK9A 1U26A 3H98A 1KEKA 2WBRA 3VR1A 4K0KJ 4YHHF 4A8WA 1OSDA 3ONQA 4LR7A 4EK2A 3G6ES 1WOSA 1V3SA 2VKRA 3SEOA 4TQRA 2XC9A 1KS2A 3L3CA 4ECVA 3HVRA 2DGUA 3RB0A 4MYUA 3RAMA 1VI7A 2IRUA 4N56A 3BGOP 3BO3A 3N28A 2KH9A 1T05A 1WORA 3GR0A 1VC6A 3V2UC 2FZGB 2DPJA 2P5VA 2JC1A 1U0SA 4WK3A 4ZDNA 3TOQA 3CF5Q 1T05B 3H2VE 4B3TF 1HNWJ 4F50A 5IFMA 3PW0A 3ILJA 1IR1A 1D3WA 4JI7J 4QIVA 2I5JA 5ETLA 1HNVA 4ERDA 4ZITA 3J80Y 1M5SA 2UXDF 4P2FA 4MK9A 3PFEA 2FHKA 1B99A 1SBRA 2YKPA 2VQFJ 5HN0A 3RJMB 2ZBRA 2MSTA 2NCKL 1FRMA 2I5JB 1HNVB 1M1KT 2G0JA 3QFWA 1RWMB 4NRUA 2RQKA 4RW8A 3TX8A 1Q16B 1R8HA 1KP6A 2BEFA 1AZSA 1UPPA 2QSWA 4K4VA 4G1QA 3QSYB 1GXLA 2PFDA 4QU7A 3QT8A 2CNKB 2QL9B 1UPMB 1SV5A 4RW8B 3M6WA 5H9EJ 3JB9k 1MMNA 4U9RA 2W7PA 1AZSB 1N5TA 5DQHA 3AA8A 1JIHA 3NOCA 1NPKA 4G1QB 4ALZA 2BJDA 2LQ8A 4B9SA 2NXCA 2FC8A 2E5LJ 3LQVA 2APOA 5C25A 4B3TJ 1JXLA 1SV5B 2Z4PA 4O44A 1OWXA 1URRA 4DUTA 4WCEQ 1CG2A 2UXDJ 5KFOA 2WAQD 1TK8A 4ZHRB 3L4BC 1HQ2A 5C25B 4NYZA 3TYTA 5CD4A 4KR0B 4O44B 1RWVB 4HLBA 2FVRA 3W9JA 1FHTA 4OZLA 2GMHA 2HHWA 3T5LA 2R42A 3T9ZA 1BWVA 3SSSA 2GVZA 4DZ6A 2CJQA 3LTOA 4ED1A 2J7UA 3G4SS 3NKYA 3V6DA 3DLHA 2GVZB 2KG1A 3VAKA 4ED3A 5AE1A 1FRHA 1RA6A 4ZCIA 4NZ6A 2M70A 3CC2S 3V6DB 2EBGA 2OPSA 2HYIB 2BUNA 4K5SA 4DUYJ 2BZ2A 1TK0A 2XGPA 4LFBF 1XEZA 2MMYA 1UEKA 5A0YA 4C48A 5F9LA 3W8PA 1S7HA 2OPSB 1PBUA 3G86A 1Y0HA 4OHVA 1N52B 2GGPA 3ENAA 1WTBA 4H4KC 2QMWA 3G82B 4LF9F 2HGNA 1UEUA 5A0YB 2B8PA 1S7IA 2AJ4A 1RAFB 1QDUB 3SYZA 4F2SA 4NCAA 2DR6A 2LECA 3AJ1A 2B51A 2GGPB 3V6HA 3MZIA 3FCVA 1XBWA 3H4BA 4IG3A 1R8CA 4U8VA 3EYZA 5A76A 3BDEA 3KKFA 5KFSA 7AT1B 1EIYB 3GSDA 2AP6A 1WG1A 4ZS6A 2GIQA 2XWXA 5KFFA 3IBFB 3H5XA 1N4LA 4ZP9A 4PXCA 4M63A 3I32A 4WXWA 5F8NA 1X5PA 3H5SA 4IG3B 5ETSA 9RUBA 2HFZA 1JLAB 3BS9A 1FT8A 3ZNJ1 4GMKA 3ADAC 2E5HA 3WDOA 2M3DA 2KL8A 1LQ9A 4LFAF 3C19A 4PQAA 2XCPA 4Y0FA 1ACMB 3C3LA 3MFHA 1VQ7S 5E3PA 1QLNA 1N5YA 1GH8A 4LUBA 5LM7E 3CJ3A 2GA7A 3DI6A 3FBEA 3M2UB 2VPWB 3ZTPA 1NJYA 2CQHA 2GHPA 1UETA 4Q45A 2LDYA 1IWAA 1I51B 2N82B 3M8QA 2VA3A 5E41A 4NOHA 1N5YB 3T5HA 2C3UA 3F44A 2DGSA 3D1QA 3UDLA 3DI6B 4CO4A 1FFWB 3IRXA 2BJ1A 1S1XA 2BRKA 1U09A 4CH7A 3TA2A 4FYVB 2HGMA 3UI3A 2UV8G 3M8QB 4QIWD 4DL4A 3TP2A 3AJ2A 3FGVA 4C3MA 1CS4A 5ETTA 1WEYA 3CDEA 1S1XB 3DU6A 2JNJA 3H2UB 1PC5A 4HHUA 1RP5A 2C2EA 1U1LA 4LFCF 4WU3A 1WHXA 4ICLA 4C8OA 2BM1A 1RTZA 3PEJA 1Q5YA 2KYXA 4A8YA 4LFAJ 2CQ0A 5KFKA 2DKOB 2WTFA 2CJXB 2BVZA 1S0NA 3Q8RB 1L3VA 4ICLB 2QV6A 3BKTA 1IM6A 2ZH9A 1N33F 2FUG9 1NJZA 1FESA 3MAHA 4FNHA 8ATCB 5HVHA 2WSFC 2M9KA 2XLJA 3DRYA 4P52A 4YB7A 4F26A 1TL4A 3JTPA 1OPIA 4PPZA 4OYZA 4R0EA 1H74A 2CWKA 2CDRB 2ZZNA 3K17A 5E3CA 2F1FA 2BQUA 4LQ3A 4MYTA 2EG1A 1U1PA 1IBLF 2DGOA 3B6BA 3V4IA 2VDHA 2AJFE 1WUUA 3AODA 5GAHU 4KC5A 1FJGF 4KHRA 2QMXA 1X0PA 1CQNA 3CB4A 3DXBA 5LMNJ 3P4UB 3I9ZA 3CDBA 3HXMA 2VBWA 4M5DA 5AXNA 3HD1A 2DNMA 2XI3A 4LMZA 2RILA 3S8SA 3V4IB 3CJRA 3U27A 2E1RA 4DV6F 2OHDA 2RRAA 2QJ3A 3HM9A 3DDNA 4DR4F 5IZHA 2D3UA 4MMOA 4PRFA 1SH0A 1XK8A 2DVIA 4M5DB 1X9MA 2VPXB 2V8HA 4EBEA 1MN9A 4NLDA 4PKDB 2BOPA 2X3GA 3B82A 2KHDA 3BN4A 2HWIA 1XJWB 4I2QA 4ILLA 2J9DE 3DCAA 3M2VA 3D3BJ 5KT7A 1O5JA 3BDPA 4ZVHA 3MUTP 5IC4B 3VGTA 1B0VA 4PPDA 2RHSB 2HVDA 1S59A 4X62F 1ZBTA 1SCJB 4YR3A 1FDBA 1LWXA 4I2QB 3K2YA 4DLGA 4B3MJ 3KLFA 4C4WA 1IBLJ 2MHEA 3M2VB 2JVRA 2DRBA 2DNNA 4O4GB 4W4MA 4YN3B 1Y7PA 2FD2A 5J2NA 2V50A 2C3YA 3LANA 2V8VA 4FBUA 3KLFB 4LF5F 2O67A 4M95A 2E1AA 1W25A 2QLFB 1LKZA 1N48A 1UVKA 2QLXA 2RJZA 1YBTA 5J2NB 1G7CB 3N5BA 2KJVA 4LBPA 3HHLB 4OV6A 4EGLA 1M5OC 1K9MT 4E0DA 4ZOSA 3VTIA 2KXHA 1KRPA 1FEEA 2DHAA 1HI1A 4I2PA 5F8GA 3LWLA 1A9NB 2CPHA 3J81U 5CYQA 1N32F 3CD0A 2ZFHA 2VC1A 3K58A 1HYSA 4KRWA 2R8HA 3TJAA 3A8EA 5I4MA 4IQMA 3BB5A 1YDLA 5HBMA 1VQ6S 3GQCA 2FJVA 4I2PB 2HS4A 4FF4A 4C3LA 2V34A 4YUDA 1X4FA 5CYQB 1UJ4A 3HT3A 4HACA 1YKWA 3GCWP 3NLCA 3EM1A 4OI2A 5HBMB 5KFQA 3DC2A 3KK1A 3CT9A 3TEGA 5AE2A 3CJ8A 2YX4A 2DNYA 3V6JA 4LF5J 2NXUA 4HACB 2XMTA 2XLIA 1AFJA 4O3PA 2GHVC 3MPWA 2R7UA 1I3OB 4LRDA 4UOGA 2Q79A 5LXRA 3BSNA 3KK1B 2MGZA 1TL7B 3S6EA 5KG0A 1QD1A 2HKEA 1WD6A 2ASLA 3PX0A 4F0KA 2RDJA 1SC6A 3HX9A 1Z1ZA 4ZN3A 2HK2A 1E6YA 3CSKA 2MQNA 5HK4A 5IC6B 4X65F 2MGZB 3BQ0A 1NK0A 3C15A 3VQSA 4YR0A 1S1TA 5K8PA 2AF6A 1X4DA 3IBWA 1JLCA 2IM1A 2ZKUA 4AT1B 1E6YB 4QIFA 4OYPA 2V9WA 4UW2A 1RTHA 5KFGA 3I96A 2WZ1A 1RSCA 3C15B 1YJVA 3GYGA 1AROP 1S1TB 3HFZB 5H9FK 4ANEA 3H20A 1JLCB 4OQJA 1KFDA 1U8SA 3MM6A 5KT4A 1FDNA 1X4AA 3KK2A 2ASYA 3DHWC 3QIPA 4RBVA 2G1DA 2GX8A 3AFGA 4QR1A 3EZ5A 1J27A 5MLCV 4JI4F 2AEJA 5CA5A 2HZVA 2IRXA 3MM6B 2PGCA 3OBIA 3H90A 3KK2B 1HPZB 1TMJA 2DGVA 2FQQB 3QIPB 3R27A 3Q8VA 5IQQA 4DV0F 1RU1A 4AQYF 2LQBA 5A8RA 2J5AA 3PR5B 1YJNS 4QYZJ 3FSYA 3MGJA 4X65J 1D1UA 3TVZA 2UXCJ 2KM8B 2FJDB 2AT1B 2ASDA 1QAYA 1VOMA 4C8NA 1TKTA 1NK9A 3FFIB 3K0JA 5A8RB 2KRRA 3K5LA 1I94J 3G6XA 2ATLA 3QPIA 1P1LA 2DO0A 1F2GA 4MKYA 1SKSA 1CULA 2QMUB 2IPOB 1TKTB 1F9HA 1PYSB 4B9TA 1HW8A 1VJWA 4LRCA 3JQKA 1DQ8A 3ZZ0A 1GNKA 3W2WA 1W26A 4ZPBA 1CULB 3MFIA 4DFJA 2PEHA 4KE5A 4JI4J 3KG4A 2BABA 2H3EB 4EZ6A 3W9IA 1RU2A 4ZVGA 3R7NB 1Y4ZB 3MI7X 3W5ZA 1UAWA 2YNGA 2W2OP 2FGCA 2HVHA 2HFOA 3P96A 4EO8A 4OMFG 3NGTA 7FDRA 3W2WB 1S4FA 1MN7A 3WIUA 5M2PA 2HWTA 3DFEA 3MEEA 3MAAB 1RAEB 3QGGA 4DCOB 5HMZA 3I0SA 4M5NA 2M0GB 2YNGB 3GE9A 1HBNA 2XZTB 2AEMA 2E29A 5F0UA 2W4PA 2E1PA 2K7JA 3VZHA 2DIUA 4KH0B 2WVCA 3MEEB 3IP0A 4PG8A 4XK8C 4C8ZA 3I0SB 2QTWA 3DOKA 2K7KA 3MM5A 1HBNB 3GFZA 3GYXB 2MQQA 1Y5IB 3HKWA 4JI0F 2XQCA 1R89A 2EWHA 3Q2SC 3QRPA 1FK9A 3RBZA 2LU2A 3DOKB 4G3IA 3MM5B 2B9XA 3MD3A 3OTOF 4P10A 4NXMF 1FEHA 2CG4A 4OX8A 5HP1A 2OELA 5GAEU 2X1FA 3NEKA 1NM2A 3NS5A 1FK9B 5B08A 5BR8F 4ZJOA 5D8HB 4DV2J 1EB0A 3M30A 2W9BB 3CJ5A 1F1BB 2JOQA 5HP1B 2QX0A 4IYQA 3C46A 3CD5A 5LL6d 1ZTTA 1MWQA 2V2ZA 1T3NA 2XULA 5E3RA 2ZH3A 3GV7B 4P2MA 3DRRA 3L7PA 1R31A 2R4FA 5HQMA 1P27B 4ZVTB 3SIPB 3M30B 1OO0B 1U2CA 1L3UA 3ZO7A 3OTEA 3VCDA 3OTBA 3LAMA 3DN9A 1VQMS 2CQCA 4DR6F 3DRRB 1H2VZ 4B3OA 1VS3A 4CNYA 1UWAA 3IWNC 4PG7A 4ZKAA 4MIAA 3CC4S 3HD2A 4DXLA 4NXMJ 4B3OB 1S57A 4DX6A 2M88A 4W98A 3AJDA 4UQGA 3E3XA 4A4JA 4G1IA 5I42A 4PWWA 2ZKTA 3GJTB 4EUVA 4E8UA 2FLLA 3W60A 4ANDA 4UY85 5KG3A 3L7OA 5IQ6A 3TUIC 2PT0A 2LXUA 5CAAA 2CQBA 5I42B 4RNFA 1C1CA 4RZRA 3GJQB 2UUTA 4FKXA 1SVDA 1EETA 2POKA 4R8UA 4FS2A 1GT8A 2X1BA 2OSQA 3LGMA 2D74B 4HKQA 4ELTA 4HYKA 2GIRA 3ZC4A 1URNA 1SH3A 3NAHA 4FVCA 3FVYA 2HBRB 4PEOA 2VBYA 3CCWA 1C1CB 2BMBA 4ILRA 1EETB 4R8UB 3J7YU 4DPTA 1U47A 5KFEA 5ETMA 5DM6Q 1KBRA 1Q53A 2KXFA 5F8LA 1VRTA 2D3OR 2DXFA 2KRBA 1RAIB 5KT3A 2HQFA 4TU7A 2CQ3A 2HSEB 1S4EA 2EFOA 4DS4A 2HAFA 5KT2A 4P72A 2LKZA 2KG0A 1NMEB 2CPYA 1VRTB 3C6TA 2R7RA 2MLZA 2RDIA 4XDDA 2IIHA 2XZWA 2FYXA 3RRKA 2E9TA 3BKUA 2LYVA 2AGQA 1RKIA 4ECQA 3MPYA 2YNIA 2HQGA 4I0WA 3C6TB 1LFPA 3MEDA 4Y65A 2PMWA 3DDKA 5L9NA 1HA1A 4YY3F 1WI6A 4ED0A 1VCTA 2UUAF 2YX7A 1DY3A 1SB6A 1RTJA 2YNIB 2C3OA 3HF5A 4KBIA 1W7WA 3DOMA 2OI2A 3MEDB 3O3LA 1GMWA 1KVJA 4MIBA 4AYBD 4TN2A 1KKHA 1NEEA 3IRWP 4FP9A 3TI0A 1RTJB 2W01A 1XQIA 2JEFA 1Y3JA 1FTCA 2ALYB 4OHXA 3EGWB 3E2EA 3DOMB 2CQ2A 4URQU 3PZPA 4BWMA 1UZDA 3G8TA 1IBKF 1S72S 3R1LA 2AGPA 2GVDA 3FSXA 2RB7A 2ZITA 3PIPQ 4ZLPA 4BLGA 2FC9A 5LSOA 2ZVIA 3TNVA 5FLXU 3EDQB 1FRKA 4OZ1A 1HQUA 2JRSA 2C2KB 4GO5X 1EP4A 2GVDB 2B4OA 1AA1B 5HAOA 1X0FA 3SQOP 2QLBB 1IJEB 2DNOA 3KHHA 4YY3J 3QSIA 3IFEA 2EPIA 3A3OB 1Y00A 1FD8A 1NBEB 4RWWA 5ETPA 1HQUB 2LEPA 4FYWB 5CZXA 2UUAJ 1EP4B 4LQ9A 2A1BA 4V19X 4UZCA 1ROFA 2VIHA 4IO9Q 1N88A 3CWJA 4K8RA 4RPFA 2DBBA 4USMA 2QIFA 2VOPA 3CCRS 2CJBA 1GK8A 3NGDA 4FPRA 4B17A 7FD1A 2Q1LA 2YX1A 5HVGA 3FC9A 1GEHA 2G0IA 3D68A 1S1VA 4NLQA 2GIFA 2GFFA 3SCJE 4R5PA 1XNQF 1CJKA 1P8GA 2DO4A 1U6FA 3S01A 3TZWA 4K4YA 4X4OA 1FF2A 3TX0A 4C2MA 5GMDA 3J80U 4ZVUB 1T02A 4GO7X 1S1VB 2DXDA 1LWFA 3JAMY 3KK3A 4R5PB 1CJKB 2KFZA 1RYSA 4CM2A 3NAIA 4DLEA 1N5VA 3LO3A 1JJHA 2RD5C 4DL3A 2HFVA 4NEZA 3HDSA 4LIWA 1LWFB 3KK3B 3OFEA 4JI5F 3NP5A 6FD1A 1NUEA 1OSCA 3VAFA 4CLPA 4N5SA 4PWDA 2OMLA 4KGZB 3I6PA 2DNRA 1A6LA 5L8RC 3ET6A 1JK9B 3BEGB 3VAJA 2D1CA 4NLGA 3DLJA 3UO0A 1AFIA 1CC7A 3D0IE 4CLWA 4PWDB 4NL5A 1XR7A 3UDEA 1S48A 2QLWA 4IQXA 1NK6A 3KUGA 1NKBA 4DPXA 3QGHA 1IKVA 3ET6B 1R8PA 3U02A 2ZWPA 4KB7A 1XNQJ 3SBMA 3LP2A 1FFSB 5DGBA 3SCKE 5IS2A 1YQHA 1EQMA 2Z2LA 2FHOB 4K2XA 5JUMA 1IKVB 4KT0C 3BYPA 1YG0A 2XGQA 3HT0A 1WC6A 3LP2B 4NLXA 5L1JA 3VV2B 2NSCA 2MKSA 2QGFB 4C3KA 5AXKA 5CD4H 1U1KA 1WHYA 2OIHA 1OPZA 2JEJA 2V2KA 4JI5J 4USTA 1U8WA 1EKRA 1JB0C 2ZD1A 4LRFA 1NNDA 2XLKA 3KWMA 3W62A 3TZZA 2GAGC 1VLYA 3ITHA 5CH7B 3NCPA 3QNWB 4NMLA 3BSAA 5EWEA 2ZD1B 5D4OA 4WIIA 4X64F 1N34F 4AE5A 3OJSA 1XNRF 5KFUA 1Q8IA 4KGXB 4LF8J 4KIAA 3T6BA 3ITHB 3N6NA 2IDEA 1HHTP 3OQ2A 1IUJA 4ED6A 2R7VA 1SL0A 4QWDA 4ZPVR 5DM7Q 1U25A 1SIWB 4CLYA 1Q7YT 2KTQA 5H9FJ 4H54A 4D3GA 1NK4A 2KKHA 3AD7C 4KHMA 2Z57B 1WKLA 4YB6A 4UUWA 5DDPC 4ED7A 2VG5A 3BPDA 3OR2B 3KMQA 1RACB 4Y2CA 4OZ0A 1FRLA 2EFPA 1TUWA 3BF4A 4LBIA 4ZVOB 5JXSA 1DZ5A 1Q86T 3AB4B 2M52A 2VG5B 3E8OA 3LH2S 4UTGA 3UWTA 2MLYA 4C8YA 4BC7A 1HBUA 2RRBA 2OD4A 4LSZB 1FA0A 4PG4A 4ZVEA 3W2VA 3TAMA 1N34J 5DZ6A 3MPVA 1XNRJ 2MQMA 2IM0A 1FCAA 2CFXA 1YBUA 4X84A 3BQ2A 1HBUB 3CCTA 4P2XA 3HHNB 1EX8A 3GIJA 1KQSR 1JNZB 4P71A 2BR0A 3W2VB 4WXOA 3TAMB 2Y9HA 2F40A 2DH7A 1RAOA 2L41A 1RHRB 2PIIA 4PUOB 1N0UA 3VAGA 3CPWR 4F4WA 1GMUA 2DXEA 1F0XA 1K44A 2BM0A 3H40A 3VGVA 4MKAA 2X1GA 2GV1A 3G96A 3JS9A 3LP1A 1VHFA 2DHHA 3PFOA 1HHQA 4NLYA 3OVSA 5G4DA 4HDHA 2XMJA 2G9OA 1FJ7A 4IUFA 3HJFA 2OEKA 1RWOB 5THWA 4F4AA 1VISA 4JI1J 4I68A 3LP1B 1LXNA 4TLQA 2H9ZA 3BN7A 2ZE2A 2AEFA 3RR7A 5BXIA 1HNXF 2LU1A 1HARA 1M1HA 4OYIA 1GX5A 2W25A 1FX2A 1PO6A 3MMJA 4B3RF 4WFZA 4C8KA 3O8WA 1VC5A 1PAEX 4F7VA 2ZE2B 4M1KA 3OUYA 1SQGA 2V4QA 1TP7A 5GAHI 2X3DA 2HBYB 1FNMA 5JVGQ 3D6HB 4HTIA 3NXZA 1S0MA 5DDQC 4QJVA 3FEZA 5IM0A 4Q0BA 3OUYB 1VR6A 4N77A 5DQIA 1MLAA 1Z4UA 3VF0B 3PYGA 4N47A 2VKZG 3JQJA 3NGKA 4DOZA 1CQMA 2ZH6A 4FZVA 1YZ6A 1UFLA 5IM0B 1Y5NB 3RZAA 1Q8LA 4Q0BB 3M9OB 2YNHA 4C6AA 2ZH2A 1IBCB 5J1NA 3SZ2A 2IVMA 4WP9A 3UW1A 3M9NB 4I6YA 2NSBA 3FCWA 1AUDA 1HNXJ 1OQ3A 1EAYC 1QE1B 2HQIA 4NLPA 5KG6A 1UJ5A 3Q24A 2YNHB 2IA6A 4LF1A 4B3RJ 5FIIA 4KPYA 3CE8A 1LW2A 4KHPF 4K4SA 2WVFA 1VK3A 2LLZA 3GIIA 3PG9A 4DWIA 4RU9A 3DLKA 3VQTA 1V9OA 3R2DJ 2CNOB 4O0NA 4ED4A 4DR1F 1VQNS 3PYFA 4A47A 1HR0J 2V8DA 5C2CA 4IKAA 2QZ8A 1RCXB 1WKJA 1NXIA 1LW2B 4L74A 2WONA 2F5GA 3CCVS 2OFHX 3NS6A 3DLKB 3ILOA 4DV1J 4M5HA 2MKKA 3PY8A 3NWRA 3NBPA 4Q7AA 4C98A 4LVNP 2ZVSA 2PN6A 4OI6A 4HT7A 2E1CA 2WONB 4NWBA 4DV4F 4NPOA 1WWHA 4F04B 3QATA 4PXDA 5F8IA 3MHYA 2R9LA 2VQEF 1DFDA 3V4MA 2XS2A 2VONA 3DLLQ 1H0HB 3NBPB 2DY1A 2C3PA 1B7YB 3B8HA 1RHKB 1KNZA 3EUNA 5ITHA 2FJAB 4G1PA 2KJWA 2FHJA 3FQLA 3KHRA 4KHPJ 1RUSA 3O1LA 2WBMA 3KG0A 2WB4A 1FWKA 2F3JA 4DSFA 4F4YA 3IN5A 2NZ4A 5KFLA 4RO0A 1TR0A 2AWZA 3NGRA 1OYDA 3UN3A 2Z58B 1KQGB 4F8RA 4RUBA 1UA0A 1HD0A 2OO4A 2ALZA 1A7GE 3L9ZA 1U6BA 2DK2A 1KSPA 1T9XA 1D9DA 5AE3A 3PCOB 4J9QA 4NZ7A 5K5MA 3PKMA 3EZOA 1SKWA 2IJRA 1RA7A 3FDSA 5ETVA 4DV3F 3IGNA 3MUMP 4PG6A 4A48A 1WF2A 4YP3A 3QGIA 2XZDB 2P8IA 5KFBA 2FTRA 1FJCA 1U1NA 4DV5F 4NLWA 1N36J 6AT1B 1TAQA 1XMBA 4FYDA 1K73T 1UCNA 5KFZA 3ISZA 3FSIA 4I69A 3P8BB 1CJTA 3KHGA 3W3SA 1KHVA 2HIQA 5E7OB 4OLPA 5CXTA 2BXJA 1OYEA 2QFIA 3KJVA 1FXDA 3MCNA 2L08A 1GFWB 3IS9A 4L73A 1CSJA 4MIWA 1T95A 1S79A 1CJTB 1YI2S 2NUHA 3I5BA 3K89A 1SIZA 4DL2A 3KJVB 3G2XA 2GQ2A 3MR6A 3T1HF 2Y1LB 3IS9B 4U67Q 2MY7A 2COLA 2M5YA 2V9KA 4U7CA 1CJVA 3A8IA 3FEXB 3HHLC 2A3JA 4I6WA 2XY5A 5LSLA 3SXLA 3HMJG 4LF6F 3R6GB 5HQ8A 2HHSA 4WFBQ 4DV3J 5AJ3F 5D4NA 1FERA 1R7IA 1R8AA 2QC3A 3J7ZT 3L95X 4K59A 2K06A 1S6UA 4U7UD 1CJVB 4EU0A 1RHJB 2EFVA 3MTKA 2W8LA 2MKHA 3KNAA 3TARA 1Y11A 4DX5A 4C0HA 3CCMS 4DL7A 4DPYA 1X4EA 2BQRA 3WHIA 2LVWA 4R25A 1IXKA 2LQ9A 3DRXA 3MCSA 5SUHA 1F3VA 2WVDA 2QA4S 5HATA 2CDQA 4HR2A 2B4VA 2J0WA 3RRGA 1HHSA 2AHOB 1ZPWX 2J0XA 1HFEL 3LW5C 2R7XA 3RRHA 1YWXA 1L3KA 2XHCA 3T1HJ 2Q3PA 1UEVA 2AW0A 3HVTA 4DR7J 3G9CA 3EWGA 2N7YA 1RWUA 3LUYA 2HVIA 3CEDA 3PEHA 1WEZA 4LF6J 4DR3J 5IWAF 1RQ0A 2X51A 2WSEC 2KXNB 1UFWA 1KLMA 2AZ1A 2B6AA 5GMKa 2DNLA 2D7SA 3HVTB 4EEYA 1PAUB 3WX4A 3ULHA 4ZJLA 4CO2A 2RKIA 4L6V3 3NNHA 1KLMB 3KLHA 5HMYA 2B6AB 2ZNYA 3P3DA 2MJUA 4CO5A 1BGXT 1KR4A 2RVJA 3K5MA 2HPUA 3T5JA 2BW2A 2FJEB 2RKIB 4X4UA 2GNKA 2H1YA 4NA1A 3HSJA 3CD6S 3KYLA 3C16B 3EGZA 3KLHB 2WHOA 1G1XA 3PJWA 1I6JA 3D66A 2F63A 1JKHA 4DQQA 5U47A 3S1TA 3QAEA 2QA2A 2F4FA 4WBFA 3O44A 2HNDA 4UQTA 3H59A 3KJNB 1JKHB 1QVGR 3U1MA 3CVKA 3QJLA 3GFHA 3THPA 2OSRA 2Y3YA 1DAXA 1T9TA 1RLDA 2MQOA 1CEZA 4ZIVA 4QYRA 5CZVA 2HNDB 2KM8C 2B0GA 4CT9A 1NPRA 3PRVA 4JYAF 1AUSL 5F8JA 1YJTA 2UVWA 2AKWB 3KUHA 1CJUA 2C1EB 1VIOA 5J2QA 4B9VA 2G1HA 1NK8A 1NLKL 3D6MB 4Q44A 2CQPA 2X1AA 2G4BA 3H7HB 1WKKA 3EPGA 3NL0A 2A10A 2NPIA 2NREA 4EWTA 3HJVA 1CJUB 1RWXB 5J2QB 4ES2A 1D09B 4K0KF 1HD1A 2CPXA 3J7A1 2QG9B 2CQIA 2EC0A 3MDFA 4MH8A 3RUBL 2IM3A 3DRSA 2HK3A 4W92B 3ILIA 3X3UA 3PYEA 2L9WA 3UR3C 2MQLA 3CDAA 3OHBA 1UVNA 3I55S 2CADA 2FVSA 1YJ9S 5C7PA 3BGUA 2LQJA 3K8VA 4ANCA 5HSPA 5B09A 1TV6A 2HQ3A 3D28A 4OYXA 4DL5A 1WC0A 3DRSB 4HI2A 1LK7A 2VH7A 5DG7A 3KJFB 2BX6A 5B0FA 1RZMA 1PSDA 2OEJA 5D0EA 3FRZA 1NB7A 3FMWA 2JFDA 3CJQA 1TV6B 3GONA 1HNWF 5B0CA 2E7VA 4JI7F 1SJRA 1X5TA 2BKPA 5L46A 4KY3A 3QO9A 4ZPCA 1JJ2R 4E2FB 4DL6A 2DGQA 4FF3A 1FFGB 2PI5A 1Q1KA 4K4WA 1Y10A 2KFNA 4WFYA 3W9HA 1VQLS 2KI2A 2VQFF 1D9AA 3Q89A 5A8WA 1U7LA 3TJ8A 3CO9A 2AYMA 1R6YA 2XMMA 4DJBA 3WIVA 4RJVA 3QO9B 4XAKA 3CMQA 4BC9A 3EGVA 3CJKA 2QN6B 2OP5A 2PMZD 2BA9A 2RS8A 2R3VA 4ITSA 2FY8A 1M5VC 5A8WB 1K0VA 5CYMA 1XWLA 2LQ5A 1JLQA 2FGOA 2I1RA 4H4OA 3R3TA 1B4SA 3CJKB 5CQGA 4ECUA 4ZVRB 1QM9A 5CCMA 4C7QA 1ZS6A 3GV8B 4RU2A 4L75A 1XR6A 4PR6A 1WF1A 4RNMA 3KTQA 2JC0A 5CYMB 1JLQB 1P6TA 1SJ4P 2DYAA 2MB0B 2V4RA 1V5IB 4H4OB 2E5LF 3IGVA 1JLFA 2ZUGA 1WC5A 1ZM4A 1UW9A 2E66A 3VVUA 1N5QA 1HBMA 4DSIA 4ELUA 2W24A 1FI4A 2Z2YB 2H48B 1JLFB 3OFFA 3PYDA 2ZJPQ 3IO1A 3Q86A 2AX1A 3Q0AA 2FY1A 4RUHA 3KDNA 1HBMB 3F41A 4QBUA 2W2QP 2D69A 4Z37A 1GTEA 2I6WA 2HQDA 3D54A 3PX6A 2VB6A 1S9FA 4NASA 5D4LA 1YJUA 4P75A 3C6UA 1SI9A 5E0OA 5K8MA 4M5LA 3ZTOA 3PV8A 3PJ9A 2MPUA 3D3CJ 2LCWA 1IBMJ 4JV1A 4YB1P 4D3HA 3C6UB 2C2MB 3A13A 2RU9A 4QIEA 3AHPA 4LF2A 1XIQA 3MPDA 2FLOA 4DUYF 2F9DA 2CXEA 2IVYA 4CP5A 3RBDA 2AGOA 3TEHB 2XMKA 4IR1A 5BYSA 2M8HA 1MMDA 2H51B 2DJWA 3RTVA 4IRCA 4ECTA 3SFGA 4OFZA 3IAM9 3ICLA 4DEZA 5L1KA 1ICEB 2MZRA 2HLUA 3BGFA 4P74A 4ZVPB 4WYLA 4WE1A 3R7BB 3CCES 1Y3KA 3ZFVA 5J2PA 4KGKA 3HPOA 1HWKA 1XMQF 3M6VA 3OPKA 2HHPA 2CZ9A 4EZ9A 2MKYA 1RADB 2Y8YA 4WE1B 5D0RA 3ZZZA 4X4QA 3HO1A 3QIDA 5J2PB 1K0TA 1QUPA 5B0AA 4WIQA 2AD9A 2HMIA 4IRKA 1KQFB 3CCQS 1MNEA 1B64A 3AA9A 2CPJA 1ZAVA 2IAJA 4B3SF 4TY8A 3N01A 4X4VA 4DCJB 1K1SA 2F7VA 3K7RA 4M5IA 1UFKA 5LXYA 1C2PA 1PYTA 4WK1A 1FKAF 8RUCA 5CYJA 3DHXA 1UWBA 2HMIB 3EXCX 4GVBA 3U1NA 2LXIA 2IAJB 5D77A 4TY8B 4BWJA 4DSEA 3PO4A 4IRDA 3HULA 1H2TZ 1RJJA 3BPSP 1JX4A 1NK5A 2VBZA 1LFWA 2OPPA 2QFJA 2CPFA 3OV7A 4J90A 3JAMU 1JNRB 5H9EK 1UWBB 5EUHA 3J81Y 2HQCA 4GVBB 5LOQA 1RT7A 1K1QA 4UOFA 1T3OA 2GO9A 2PE8A 4M5JA 1Q5VA 1M5HA 1XMQJ 2OPPB 1HQEA 2YXLA 2EFGA 3IMQJ 2ZH4A 3RW7A 4JI6J 2HFNA 3GIKA 1RT7B 4JI2J 1CBKA 2HVEA 4IOCQ 4GVLA 2VPZB 3HI9A 1HQEB 1R6VA 4DSJA 3TAPA 4B3SJ 3W5YA 1D0EA 1Q81T 3GU0A 3I5AA 2A2DA 2V67A 3A3NB 1NDKA 2W8KA 1VQ5S 2ERRA 3DOLA 2B9WA 3PTWA 3UPFA 4BHQA 1SKUB 1VMBA 3PW7A 1FVSA 2J9EA 4ECZA 3HCXA 3MM8A 4K4XA 2H5EA 4DU7A 5EN1A 2BJ7A 5HO4A 3A4TA 1TKXA 3HP6A 2AX0A 3DOLB 1O8BA 2FVPA 2NXJA 4IFYA 4HI1A 3FK4A 3MM8B 5JJBA 4B9NA 1XR5A 1BQMA 4X4PA 3TR5A 3H5UA 2M7SA 3Q8PB 1TKXB 1ZAWA 2R2UA 2CJKA 4AL5A 4HHHA 2KN4A 3UCZP 1KN6A 4LIRA 4ZPDA 1NKEA 5LMNF 3IRXB 4IFYB 2QYCA 4EBCA 2HGLA 1BQMB 1V3RA 4CDIA 3MR3A 2XMVA 3KMSA 5DDOC 3IR7B 4RUCA 1YJ7A 4DX7A 2MZTA 3QQCD 1S6PA 1J5OA 2C2NA 2FIUA 4NI2A 1ZZNA 1CS4B 1U49A 1XERA 4AFFA 1T0TV 2DPIA 1QVFR 2JH3A 5GVQA 1VC0A 1NDPA 3CCLS 1Q82T 1F6TA 4XPEA 1T8EA 2OTLS 2Q6BA 3CDUA 1XTZA 2IM2A 3EVOA 2VOOA 1BHNA 4FYXB 1S6PB 1J5OB 2G13A 4NI2B 2NYHA 4NLVA 3NNCA 4ZP6A 4C8MA 2MKIA 2JJ4D 2R7OA 5KOWA 1HBOA 2ZWOA 2JSXA 1QAIA 5KG5A 1WOPA 3CCJS 1KTQA 2UUCF 3O5TB 2CUYA 4J91A 3EGNA 2XNQA 3T19A 1VRUA 1YRTA 4B3MF 2J6TA 5DJBA
chains in the Genus database with same CATH topology
2XYPB 1QDUB 4DCOB 1RHKB 5IC6B 3EDQB 4ZVRB 2H65B 1PAUB 1RHJB 5IC4B 3GJRB 2C2KB 3EDRB 2P2CB 1PYOB 2XZTB 3GJQB 3KJFB 3NS7B 4ZVQB 2CDRB 3KJQB 1SC3B 1RWNB 4ZVUB 4ZVTB 3SIPB 2QLBB 1RWWB 1RHRB 2C2MB 2CNKB 2QL9B 2H5IB 2CNOB 2QLJB 2HBYB 4DCJB 2C1EB 2HBRB 3D6HB 2HBZB 3IBFB 2Y0BB 2H5JB 2C2OB 3D6MB 1RE1B 1GFWB 5K20B 3P4UB 3D6FB 2CNNB 2H51B 3P45B 2H4WB 1RHQB 2XYGB 2H48B 2H54B 2QL7B 3R5JB 1ICEB 2QLFB 1RWXB 4JB8B 3R7SB 1BMQB 1RHMB 4ZVOB 2QL5B 2Y1LB 2DKOB 3R6LB 3GJSB 1I3OB 1RHUB 1RWOB 4ZVPB 2CJXB 1F9EB 3R7BB 3QNWB 1SC1B 3R7NB 1IBCB 1RWKB 2C2ZB 3R6GB 4LSZB 3GJTB 2FQQB 1RWPB 2H4YB 3RJMB 2CJYB 1SC4B 2XYHB 3KJNB 1NMEB 4ZVSB 3IBCB 1RWVB 2CNLB 2XZDB 4DCPB 1QTNB 1I51B 2HBQB 1RWMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYP B;  1QDU B;  4DCO B;  1RHK B;  5IC6 B;  3EDQ B;  4ZVR B;  2H65 B;  1PAU B;  1RHJ B;  5IC4 B;  3GJR B;  2C2K B;  3EDR B;  2P2C B;  1PYO B;  2XZT B;  3GJQ B;  3KJF B;  3NS7 B;  4ZVQ B;  2CDR B;  3KJQ B;  1SC3 B;  1RWN B;  4ZVU B;  4ZVT B;  3SIP B;  2QLB B;  1RWW B;  1RHR B;  2C2M B;  2CNK B;  2QL9 B;  2H5I B;  2CNO B;  2QLJ B;  2HBY B;  4DCJ B;  2C1E B;  2HBR B;  3D6H B;  2HBZ B;  3IBF B;  2Y0B B;  2H5J B;  2C2O B;  3D6M B;  1RE1 B;  1GFW B;  5K20 B;  3P4U B;  3D6F B;  2CNN B;  2H51 B;  3P45 B;  2H4W B;  1RHQ B;  2XYG B;  2H48 B;  2H54 B;  2QL7 B;  3R5J B;  1ICE B;  2QLF B;  1RWX B;  4JB8 B;  3R7S B;  1BMQ B;  1RHM B;  4ZVO B;  2QL5 B;  2Y1L B;  2DKO B;  3R6L B;  3GJS B;  1I3O B;  1RHU B;  1RWO B;  4ZVP B;  2CJX B;  1F9E B;  3R7B B;  3QNW B;  1SC1 B;  3R7N B;  1IBC B;  1RWK B;  2C2Z B;  3R6G B;  4LSZ B;  3GJT B;  2FQQ B;  1RWP B;  2H4Y B;  3RJM B;  2CJY B;  1SC4 B;  2XYH B;  3KJN B;  1NME B;  4ZVS B;  3IBC B;  1RWV B;  2CNL B;  2XZD B;  4DCP B;  1QTN B;  1I51 B;  2HBQ B;  1RWM B; 
#chains in the Genus database with same CATH topology
 2VDI A;  3H42 A;  4F67 A;  4J9R A;  3LGN A;  1HBO B;  3GJR B;  1WDT A;  4ZPW R;  3W7B A;  3LA0 A;  2O66 A;  1VRU B;  3U7J A;  4CLT A;  3BQ1 A;  2PFF B;  2B3T B;  4OI3 A;  5F8H A;  4OV1 A;  1Y9O A;  4YR2 A;  4NLU A;  3M9M B;  1MWZ A;  4EMD A;  2A6O A;  2R8K A;  2DIV A;  2IRY A;  3ZTS A;  2NR0 A;  4B9M A;  2FVQ A;  1VHI A;  1SQE A;  4DF8 A;  2V63 A;  2QL7 B;  1NHU A;  4OYM A;  2VBX A;  2ZBC A;  5C5J A;  1LK5 A;  2MZS A;  3UFC X;  2H4Y B;  3ZTQ A;  3K5O A;  3IR5 B;  4J9S A;  2UUC J;  3F56 A;  2CNL B;  4QOT A;  1VBK A;  2CG8 A;  1EZZ B;  1PJ6 A;  1REV A;  3MMC A;  3DYA A;  3KHL A;  1N0V C;  3CDW A;  1KVK A;  3DNC A;  1N6Q A;  3N5F A;  3P5T L;  2ZH1 A;  4CO1 A;  2W2P P;  4NA3 A;  4LSL A;  3FNN A;  4F3Q A;  2EFQ A;  3HHD A;  5EDW A;  5A2Q U;  2FJX A;  2VF3 A;  3T9N A;  4DQR A;  1REV B;  3MMC B;  3DYA B;  4QWC A;  1HI8 A;  2AV5 A;  2K1R A;  5HRO A;  1N6Q B;  1WSR A;  1S1U A;  1IKX A;  2DT9 A;  5I3Q A;  4DPU A;  1NJW A;  2DR9 A;  5F9N A;  4Y2I A;  4LSL B;  3Q8Y A;  5D3G A;  4C9D A;  3UR0 A;  1OY6 A;  4DBQ A;  2K1R B;  3THT A;  5HRO B;  1S1U B;  1IKX B;  1H2U X;  2Y0S D;  2CJY B;  3A8K A;  2J76 E;  2MYF A;  5D3G B;  4QZV B;  3QT7 A;  1EHW A;  2XSJ A;  5HLF A;  1JXE A;  2YPY A;  1UZH A;  2LA4 A;  4IOB A;  1J2V A;  3LGH A;  4KJI A;  2HRU A;  4Y00 A;  2B9E A;  1SL2 A;  3CJ2 A;  4B9L A;  1HYS B;  1IQZ A;  2KB2 A;  2WOM A;  3OD2 A;  3EDR B;  1VYA A;  2Y1I A;  3SFU A;  3N6L A;  5I3P A;  5H1S V;  5HLF B;  3OVB A;  1Q79 A;  3M1V A;  3TUJ C;  2QYG A;  3MEG A;  4OI1 A;  2WK4 A;  5A6W A;  2WOM B;  2H5J B;  3ZZR A;  2RQ4 A;  1P1T A;  4HH1 A;  1ZPV A;  3MTJ A;  3C2P A;  3OTC A;  3M1V B;  2ZUA A;  1FRI A;  3KLV A;  4EFA C;  3MEG B;  4AL7 A;  1I5O B;  1NPP A;  2MKC A;  4ZP8 A;  2QA4 G;  5EX0 A;  2AYE A;  2CIM A;  2Z8Q A;  1OY9 A;  1SXL A;  2F65 A;  3G6V A;  2EK1 A;  5KFX A;  2IYI A;  5KT6 A;  5ETN A;  1Q8B A;  1IQT A;  2UXC F;  1G2E A;  2B9Y A;  4J9P A;  4LF7 F;  2NXE A;  1KHW A;  1S6Q A;  2DNZ A;  4M5K A;  4RBU A;  2K2P A;  4TXS A;  2UVU A;  2B4U A;  1I94 F;  4U7U K;  2IBO A;  1WC1 A;  3MCM A;  1TKD A;  2RIJ A;  4XO0 A;  2EKN A;  4ETX A;  5F41 A;  3KJQ B;  4F4Z A;  1OMS A;  4BBY A;  2ASJ A;  3K5P A;  1S6Q B;  1ZM2 A;  4CNZ A;  4NLS A;  4CO0 A;  4A46 A;  1T7P A;  4J5O A;  1RTH B;  1G4C A;  1NJI T;  3HSG A;  1UW4 A;  4I56 A;  1CC8 A;  1Q78 A;  2YQ1 A;  3GTY X;  1LEO A;  3RG6 A;  4K4U A;  5B0B A;  3JSR A;  3C14 A;  4DHV A;  4DMZ A;  2DR5 A;  3UNY A;  2ZH8 A;  1KFS A;  5L1L A;  1AB8 A;  2DNQ A;  3GJS B;  1ZET A;  1X31 C;  1F60 B;  1XN9 A;  1FWP A;  3R2C J;  5HI7 A;  4QWA A;  2C42 A;  2ZH5 A;  1U02 A;  1RI7 A;  3H25 A;  3C14 B;  3ENW A;  1EKS A;  5JMN A;  3TAN A;  1SH2 A;  2B7B B;  2R7T A;  4LF7 J;  3HK2 A;  1BLU A;  1B7F A;  4A8S A;  2XMW A;  5KFC A;  1RT3 A;  4KAI A;  4X66 F;  3VAH A;  2DGX A;  1VQ4 S;  4MK7 A;  2KZZ A;  4KGM A;  1VQK S;  1HWU A;  3BSO A;  1VIX A;  1RT3 B;  1VJQ A;  2HHT A;  1FDD A;  1S5Z A;  3I87 A;  3BGR A;  3RB4 A;  2ZHO A;  4FXW A;  1JLG A;  3H5Y A;  4BDP A;  4NMX A;  1JXV A;  4DI6 A;  3L7U A;  2CNN B;  3FBB A;  3OXL A;  1H73 A;  2V2V A;  3QWP A;  2V4J A;  3AXM A;  4WFX A;  3QJJ A;  4RW6 A;  3BGR B;  4DV2 F;  5DLF A;  1JLG B;  3G6Y A;  1PCA A;  2QL5 B;  2RU3 A;  3QZ8 A;  2LMI A;  3CUL A;  3EJM A;  4ID5 A;  2IDL A;  5HVF A;  2OMO A;  2OUG A;  4ED8 A;  4XPC A;  2DB1 A;  2V4J B;  5L39 A;  1S6O A;  4RW9 A;  4RW6 B;  3WC2 A;  4TU8 A;  4O3N A;  2CJ9 A;  4ID5 B;  2DR7 A;  1M5P C;  3PXG a;  2C2D A;  1RK8 A;  2DTJ A;  2ZHA A;  1X9W A;  3BH7 B;  4X66 J;  2VAS A;  1OQ6 A;  5K8N A;  3LWM A;  3UCU P;  4RW9 B;  1PJ5 A;  5E33 A;  2XHW A;  4F0H A;  2Q66 A;  2LDI A;  2B56 A;  2IA0 A;  2O5D A;  3OLA A;  4TYB A;  2YKQ A;  1TFW A;  2BYC A;  4RNH A;  2DIT A;  4IR9 A;  4L76 A;  3JSB A;  4JI3 F;  1NSA A;  3P5B P;  5D78 A;  5HJX A;  3UVJ A;  3CO0 P;  4QYZ K;  1ITP A;  1M1G A;  1IM4 A;  1S10 A;  2KT2 A;  3I5C A;  2ZM6 J;  3NG8 A;  1VQP S;  3I4H X;  1RYR A;  4FF1 A;  4UOC A;  1HI0 P;  3SI8 A;  3CIZ A;  4JP8 A;  1F2H A;  2CVE A;  3UVJ B;  4F3O A;  1W2B R;  4ZN1 A;  4J37 A;  3Q2T C;  5J2M A;  4CRJ A;  3IWL A;  3PIO Q;  4ER8 A;  1YX2 A;  4UY8 T;  3L09 A;  3Q83 A;  3NCQ A;  3RBX A;  2ROP A;  4ZJQ A;  1KWM A;  3IM9 A;  3ZNU A;  3M2R A;  5J2M B;  2BW7 A;  1X60 A;  1YJW S;  5DDR C;  4DZD A;  2YWH A;  4K50 A;  4FF2 A;  2BOA A;  3GZ7 A;  3MF5 A;  4J9V A;  3GG0 A;  2D9P A;  4RKU C;  4YHH J;  4YEA A;  3R5A A;  4LBH A;  1HWI A;  1ZTW A;  4A8X A;  3M2R B;  2J6U A;  2R7S A;  4H4M A;  2U2F A;  4JI3 J;  2KVI A;  4KSE B;  4I4B A;  1KON A;  4TLR A;  4DG1 A;  3KLE A;  4F4K A;  3B54 A;  3NCR A;  1T94 A;  2K3I A;  3AB2 B;  1UA1 A;  4P6Q A;  2I9S A;  3B4D A;  4H4M B;  3CXC R;  2IHR 1;  2YWW A;  1KQK A;  5B7W A;  1FD2 A;  3EVM A;  3KLE B;  4DG1 B;  2GQC A;  3PDN A;  1U1O A;  1LWE A;  3M8Z A;  1BWE A;  2HFU A;  5LT5 A;  1T9U A;  2GAH C;  4ZHR A;  4JV5 F;  3K57 A;  2DEI A;  3NMA A;  2YPZ A;  5C2G A;  1HWL A;  2ZZT A;  4O3S A;  1RBO B;  4NEY A;  1LWE B;  2HS3 A;  3QT6 A;  2RAQ A;  4ZLN A;  3HFV A;  3VHQ A;  2HUR A;  2DNG A;  3IC1 A;  4LR8 A;  4EYH B;  2P2C B;  4HT5 A;  3DU5 A;  4RBT A;  2DH9 A;  1XMO F;  1YLX A;  3CJ0 A;  3TUP A;  2W4C A;  1AXQ A;  4U96 A;  1ELO A;  5IOL A;  1NH7 A;  1QAJ A;  5LJ5 Y;  2OAU A;  1X8D A;  2FDN A;  5K8O A;  2DGW A;  3KOA A;  2HHQ A;  1CLF A;  4LRE A;  3MM7 A;  4ECW A;  2J8S A;  2ZBP A;  4LRA A;  2AJ0 A;  4A8K A;  1NAQ A;  2QEX S;  3IG1 A;  5HJY A;  1H38 A;  1WF0 A;  4FYY B;  2NYI A;  1VQS A;  3KLG A;  2PA8 D;  1S0O A;  4J9U E;  3MM7 B;  3BO4 A;  2W1B A;  4DQP A;  2YH1 A;  4BCA A;  4DX8 H;  2J9C A;  4JV5 J;  1W2I A;  4CLK A;  1NH8 A;  2HW3 A;  3R9L A;  2P9C A;  2OGU A;  3IG1 B;  3G82 A;  2RUG A;  5CHC B;  5IT9 U;  3GG1 A;  1C4A A;  4RLE A;  1YRU A;  3HFK A;  3WBZ A;  3KLG B;  5DLG A;  4IO1 A;  1S1W A;  4TQS A;  1C4C A;  4USW A;  5MAO A;  5K9F A;  1APS A;  3N6M A;  2BQ3 A;  3UNG C;  1FTR A;  3AAW B;  1DRZ A;  3T5K A;  2ZOG A;  5DQG A;  3G8Q A;  1XMO J;  2W2N P;  2MTL A;  1S1W B;  2YWE A;  1NO8 A;  2GS8 A;  3M05 A;  4YS2 A;  5SZT A;  3IA0 A;  3T41 A;  2YQ0 A;  4NA2 A;  2YVS A;  3VVT A;  2CQD A;  3T3F A;  1JLA A;  2YY3 A;  2C3M A;  2E44 A;  3FZ2 A;  3N9U C;  2V5H G;  2N3L A;  1RT4 A;  3N0V A;  2L9D A;  3LPY A;  3FJ2 A;  1QY7 A;  1X9S A;  4OIX A;  5KFJ A;  1H7W A;  4WFA Q;  2QRR A;  1FO1 A;  4TVA B;  4XDC A;  2ZC3 A;  1RBL A;  1QAX A;  3K8W A;  4O3Q A;  1ZH5 A;  3M2U A;  4W90 B;  5HAN A;  2CZ4 A;  2JEI A;  4ILM A;  1PIL A;  5LMU F;  1S97 A;  2J8A A;  1RT4 B;  4LFB J;  4DCP B;  2CRL A;  1NHK L;  4ED2 A;  1JJ4 A;  6FDR A;  1HWJ A;  1PJ7 A;  5GAD U;  4DQS A;  3DLE A;  4JV2 A;  1TVR A;  1DUR A;  2M8D B;  5KFV A;  4LF9 J;  2IJF A;  2DHS A;  4QPX A;  1FWL A;  1NDC A;  1D8Z A;  3QWU A;  5A6P A;  2DNK A;  1VRQ C;  4DN0 A;  3O6Q A;  3DLE B;  4FBT A;  1IJF B;  3AH6 A;  3MR5 A;  1K47 A;  1TVR B;  4URS A;  1M90 T;  1KOO A;  4J9L A;  3QAU A;  2CVI A;  2HWH A;  3JTN A;  2V2Q A;  2CQ1 A;  3MM9 A;  1NSK L;  4TU9 A;  2HNY A;  4KPC A;  1ZM9 A;  1WNE A;  5T41 A;  2XY6 A;  3TAQ A;  3HHE A;  5EHH A;  3POT A;  1WC4 A;  5HQL A;  1YBA A;  1F9E B;  1R0A A;  4Z2X A;  5BYQ A;  3MM9 B;  4KGV B;  3D7S B;  2HNY B;  3UN2 A;  1Q8K A;  2KT3 A;  5LMU J;  4CLL A;  1U6Z A;  2FB0 A;  3POT B;  5GAG U;  2VV5 A;  1HIY A;  5KFW A;  3PNI A;  3DM2 A;  1R0A B;  1RGV A;  2H65 B;  2EW9 A;  2W7O A;  3ENQ A;  3NS7 B;  4DR2 F;  3PW4 A;  1BQN A;  3J7A N;  4YOE A;  3OLB A;  4C0O C;  3DM2 B;  2PO4 A;  1KTV A;  5K14 A;  4GKK F;  1GX6 A;  4A8M P;  4ZCL A;  1H72 C;  3FKB A;  4PYD A;  3NY0 A;  2NLW A;  1BQN B;  1ZOT A;  4OJH A;  2HVZ A;  1WSV A;  2LA6 A;  4JBC A;  4ECS A;  3H4D A;  2QE5 A;  2ZH7 A;  5K14 B;  5L9X A;  1T9W A;  2XS7 A;  5FD1 A;  4NE9 C;  4LF8 F;  2GZO A;  1OY8 A;  2GC8 A;  4LFC J;  3QBC A;  1VFJ A;  1QUV A;  5I3U A;  1WAC A;  5KG2 A;  1K8A T;  4I1T A;  5FDL A;  4K2J A;  2OJ3 A;  2KU7 A;  1FE0 A;  4DV7 F;  2RF2 A;  4HEA 9;  3A3P B;  3TA1 A;  2I38 A;  2NUU G;  1QSS A;  1N5S A;  2MY8 A;  5I3U B;  1N33 J;  4ED5 A;  4USI A;  5FDL B;  2EG2 A;  4DR2 J;  3EE3 A;  2CAJ A;  5M2U A;  2RF2 B;  3OTD A;  1NCL A;  1G6B A;  2YNF A;  4YFU A;  4O4G A;  5ETR A;  3PRB A;  4GKK J;  4UUX A;  3ZZY A;  4DFP A;  1NJX A;  2HNZ A;  1TL5 A;  4QQB A;  3MR7 A;  3QT5 A;  4PAA A;  5IV3 A;  2H4W B;  2JLE A;  1X5O A;  5DRK A;  1ZYQ A;  2YNF B;  5RUB A;  4OYB A;  2ILZ A;  1FJG J;  4NX9 A;  4NYP A;  1BMQ B;  4OHW A;  3I9V 9;  1WDD A;  3PO5 A;  2PDA A;  2HNZ B;  2DRA A;  3ISN D;  3HHL A;  2RQC A;  3UN5 A;  1P9Y A;  2VFR A;  1RAG B;  1C0T A;  5D15 A;  5C24 A;  4DV6 J;  1B70 B;  1KLN A;  3ILL A;  3D4J A;  3QLH A;  4DR4 J;  2NQP A;  2W7A A;  4DV7 J;  4O3R A;  4HTJ A;  2PA3 A;  2CPE A;  3SQG A;  2Y8W A;  1YGY A;  2AQ4 A;  1C0T B;  3Q22 A;  4QR2 A;  2UUW A;  1PC4 A;  3PRD A;  1FX4 A;  5C24 B;  2GO8 A;  1UVM A;  3MOZ A;  2MSS A;  3QLH B;  1FRX A;  1HMV A;  1VQY A;  2PEB A;  3PJX A;  1QJH A;  8AT1 B;  2OPQ A;  3DDI A;  2JLF A;  2HHV A;  3M32 A;  3SQG B;  1UTA A;  4ES1 A;  1EQ0 A;  3JXO A;  4KFB A;  2G2O A;  1FVQ A;  4RW7 A;  2NPF A;  4X62 J;  1IKY A;  4ZP7 A;  1HMV B;  5B0D A;  4F02 A;  1TUG B;  4JI1 F;  3W5X A;  2OPQ B;  2E1M C;  3M32 B;  3BV8 A;  1YIT S;  3FBF A;  5FJ4 A;  3R7S B;  5D6G A;  1OJ4 A;  4KFB B;  2CWX A;  5T14 A;  1UKU A;  4CQ1 A;  5EWG A;  4RW7 B;  4X4R A;  1IKY B;  3GWC A;  2B43 A;  2MDA A;  4RUA A;  3RU0 A;  1TL7 A;  4AXJ A;  3RR8 A;  1QSY A;  2BJ9 A;  2RNE A;  3D2W A;  3H8Y A;  4FNI A;  4USK A;  3GP9 A;  4K4Z A;  4J9N A;  1CPZ A;  2NXN A;  4GRS A;  1IKW A;  5KFP A;  4ECX A;  3RAQ A;  2XCA A;  1DTT A;  3W63 A;  2M4M A;  4YDX A;  1B3T A;  3EXY A;  3ZZT A;  1NZ8 A;  1U45 A;  4F3M A;  3PW5 A;  2QSF A;  4P2S A;  3HSZ A;  1SJF A;  1IKW B;  1N32 J;  3BO2 A;  5KFA A;  1DTT B;  3DLG A;  1VK8 A;  1TL3 A;  3T1A A;  4OLO A;  3CNQ P;  1U1R A;  5C42 A;  4NRT A;  1O51 A;  4LSN A;  4Q8F A;  4WZQ A;  2C28 A;  4ATN A;  2JZ5 A;  2IFX A;  4DF4 A;  3KNG A;  2A18 A;  3DLG B;  4U8Y A;  4Z7Y A;  2YQ3 A;  1TL3 B;  4USH A;  2MZJ A;  2EXU A;  5C42 B;  4NCG A;  5JVH Q;  4M5M A;  4LSN B;  3FUY A;  3EPI A;  3G87 A;  1HPZ A;  4EO6 A;  2AYG A;  3RW6 A;  3JSM A;  3PVX A;  4QU6 A;  3JYT A;  2VOD A;  2DGT A;  3HZE A;  1BC6 A;  1RT2 A;  3SCI E;  1QTM A;  4NCG B;  4DL0 C;  1WG4 A;  3DGV A;  4YME A;  2Z0G A;  1HR0 F;  3U1L A;  4Y2K A;  1UL3 A;  1MG7 A;  3JSM B;  2ZHB A;  1OIA A;  2YKM A;  3F0N A;  3FFI A;  3BR9 A;  3JYT B;  1YIJ S;  3CW2 C;  1HKA A;  1RT2 B;  1TAU A;  2HZA A;  3VAI A;  4DV1 F;  1S77 D;  2UP1 A;  5DG8 A;  3R5G A;  4V19 J;  2ZDP A;  3CJS A;  1WOO A;  4Y28 C;  1WTF A;  4M5G A;  3BGL A;  3W66 A;  2E5I A;  4NLO A;  3W1Y C;  2YKM B;  4ETZ A;  2ZEJ A;  4LR9 A;  1S0V A;  2RH3 A;  2XYG B;  4PYA A;  3M6X A;  4ZPA A;  2XB2 D;  1PG5 B;  3EMT A;  2E9R X;  2HFS A;  2GJF A;  2CKW A;  4XIU A;  3UQS A;  2VFS A;  4C0B A;  2FLP A;  1FDA A;  3OXF A;  2CZV C;  2BAC A;  2DEJ A;  1DTQ A;  2P6S A;  2YH0 A;  3PR4 A;  2ADB A;  2JHE A;  4ZA1 A;  2ZDO A;  2ZJQ Q;  3BJY A;  5KG7 A;  2BRL A;  3BM7 A;  2NS1 B;  2VFT A;  3IAS 9;  2C2Z B;  2HRT A;  2D3O 1;  3CTR A;  3Q8U A;  4F25 A;  1DTQ B;  3FCH A;  3MUV P;  3MAA A;  3MPU B;  3GB0 A;  1N8R T;  4IFV A;  3P6Y C;  1FE4 A;  5AT1 B;  2ILY A;  2ABY A;  2P6T A;  2ROE A;  1N56 A;  3R5D A;  5D4P A;  4DV0 J;  4QIG A;  4AQY J;  1LV5 A;  5B0E A;  4OHZ A;  4IFV B;  4K5R A;  3UD4 P;  2F9J A;  1V3Z A;  2UU9 F;  4AD6 A;  2D3Z A;  3OJU A;  4A8F A;  2OD6 A;  1S99 A;  1KOH A;  5F3T A;  4ZPT R;  1WC3 A;  3MEC A;  3RB6 A;  1UVJ A;  1Q4R A;  2O3D A;  1AT1 B;  5L38 A;  2WVE A;  1N36 F;  1RAA B;  3MEC B;  3GIL A;  2XMA A;  2AIR B;  2XG8 A;  2R8G A;  1ZA1 B;  1XC9 A;  5EGY A;  4WP8 A;  2W9B A;  4OX7 A;  3TZY A;  4HHJ A;  2Z56 B;  3I0R A;  1R27 B;  3JSY A;  2R8I A;  3VZI A;  3HHL D;  2ATC B;  3VGU A;  2FHM A;  3GFX A;  2VG6 A;  2MJN A;  2X7I A;  2Y1J A;  3GYN A;  2UVR A;  2K8G A;  2G2Y A;  3CME S;  1JQG A;  1DJ0 A;  2UU9 J;  3I0R B;  1RKJ A;  2LP4 A;  3HKZ D;  3BZQ A;  4GKJ F;  3A12 A;  5AXM A;  5EWF A;  4YB5 A;  4HVZ A;  2R2R A;  2B8Q A;  3KDO A;  5ETK A;  2VG6 B;  5HMX A;  3D9B A;  4ZK7 M;  4NXN F;  3BRE A;  3OT9 A;  4WYW A;  2VJV A;  4JI0 J;  2JWN A;  3F73 A;  3AOA A;  1T9V A;  2YKO A;  4CZC A;  3I82 A;  3AY0 A;  3FBC A;  4CT8 A;  3BSC A;  3I31 A;  1Y5L B;  3OTO J;  4MT1 A;  5HL7 Q;  4Q2M A;  4WF9 Q;  2IBK A;  5BR8 J;  4J9M A;  2CPI A;  3OR1 A;  4DS5 A;  3Q8S B;  2Z30 B;  1RWW B;  2BV3 A;  4RR5 A;  4OYW A;  4UF4 A;  4B9U A;  3KUE A;  4EYI B;  2V8G A;  4IH6 A;  3GMG A;  4GKJ J;  1S76 D;  4RNO A;  1UMJ A;  3OR1 B;  3JQM A;  4DR7 F;  4DR3 F;  1U24 A;  4ENO A;  4X4S A;  2A2C A;  3MMA A;  4NXN J;  1UP1 A;  1V5V A;  2J7K A;  4OJG A;  1FXR A;  1O0P A;  1MSW D;  4DR6 J;  4ID8 A;  2MZ1 A;  1SC1 B;  2GCF A;  1X4C A;  1U48 A;  4OHY A;  3IXQ A;  1QSL A;  2Q43 A;  4O3O A;  1I1G A;  1R3N A;  1FJE B;  2A0F B;  3MMA B;  2ZOF A;  3T1Y F;  3NRB A;  2WSC C;  2YWG A;  3TZX A;  2HZC A;  4ELV A;  2VA2 A;  3GFY A;  3DRP A;  3SDE A;  1SUQ A;  4OZ5 A;  1O6X A;  1JLB A;  2L3M A;  2UV8 A;  1PBA A;  3CJ4 A;  3QYY A;  2DCU B;  3M8P A;  3MOJ B;  3BBB A;  3UD3 P;  4OJ3 A;  4V1A k;  1R0B G;  3AQP A;  2EK6 A;  2FZC B;  3HVA A;  2MQ8 A;  2VZ9 A;  1BXN A;  3DRP B;  3SDE B;  1SUQ B;  2QLJ B;  4FDF A;  5L1I A;  3ZXW A;  4C11 A;  1JLB B;  5KOX A;  2VHG A;  4P9S A;  3M8P B;  2IMO A;  4JUZ A;  3R97 A;  2B4P A;  1VQ9 S;  4DPO A;  3KXD A;  3NMR A;  4X2B A;  3M4X A;  4WKR A;  2DH8 A;  4URG A;  3R5J B;  4H4K A;  4C11 B;  3MR2 A;  3AT1 B;  2KHC A;  4NZ0 A;  2ZBI A;  1T11 A;  4FXV A;  3GPA A;  3QGP A;  1NRK A;  1RWP B;  4Y34 A;  3T1Y J;  1GQE A;  2V6A A;  4LT6 A;  3CJT A;  2HBQ B;  2RT3 A;  4NLT A;  2UXB F;  2GW8 A;  4AL6 A;  4PXE A;  2HIY A;  1RTI A;  1PKU A;  5KFN A;  2FVC A;  5DG9 A;  3RB3 A;  1YRX A;  3OSP A;  2ZZM A;  1U2F A;  2WB1 D;  2WW4 A;  5E5N A;  3BKF A;  3QMQ A;  4XTT A;  3B78 A;  2MZQ A;  3D1H A;  1F5B A;  1RTI B;  1LWC A;  4OI4 A;  2XO7 A;  3PHE A;  2OTJ S;  3M6U A;  1GAO A;  1RXO B;  2N7C A;  2BDP A;  1N54 B;  4RX6 A;  2DHX A;  4OZJ A;  2R8J A;  3IM8 A;  3NGU A;  1U0H A;  1TMM A;  2SXL A;  3UCG A;  3HVW A;  5A8K A;  2GJ2 A;  3SCL E;  4ZLL A;  2HHH F;  4P7V A;  1LWC B;  2HRY A;  3SV3 A;  2K3K A;  1VGY A;  3WZ0 A;  2EBE A;  1Z2Z A;  1NSP A;  2OFG X;  2HLT A;  1JWW A;  3I56 S;  4QWE A;  1U0H B;  1SC4 B;  3LPE A;  3ZZU A;  4FKY A;  3QZ7 A;  1WEL A;  1X5S A;  1U4B A;  1IVZ A;  5A8K B;  2RDD A;  4KQZ A;  2GML A;  2V68 A;  2YKA A;  1NK7 A;  3OHA A;  3R5C A;  2JX2 A;  2UXB J;  2JLG A;  3NWG A;  4LJM A;  5KG1 A;  1IBK J;  1R43 A;  4NLR A;  1NU4 A;  2AU0 A;  4N76 A;  1L5U A;  2HS0 A;  2ACY A;  3H2L A;  1X7V A;  4O23 A;  1WG5 A;  2V94 A;  3P49 B;  2JEG A;  2HEK A;  4Y2A A;  2PMH A;  3HHK A;  2HBZ B;  4FPI A;  4CIO A;  4KH1 B;  4WFN Q;  1M5K C;  2WVB A;  2VG7 A;  4DFK A;  4WTY A;  4FXD A;  1TUV A;  4PZV A;  3Q8Q B;  3R5B A;  4OJ1 A;  4DSL A;  1SKR A;  4X4T A;  4A8Q A;  3GV5 B;  4OZN A;  2CPZ A;  1RAJ A;  5M2R A;  4DSK A;  1TTH B;  2HHH J;  3GLJ A;  3DKD A;  1TZ0 A;  2VD3 A;  1C1B A;  4QW8 A;  2VG7 B;  1TEL A;  3MUR P;  2GHW A;  5T7L A;  3TWZ A;  3T6J A;  4U95 A;  3QRQ A;  5KFY A;  1Q0N A;  1KC8 T;  2HAI A;  4IH5 A;  1WI8 A;  1MML A;  1WJ9 A;  1H3D A;  2D9O A;  4QPT A;  1C1B B;  2DD8 S;  5HMW A;  2W9C A;  5T7L B;  2XEX A;  2AYB A;  2E7W A;  4N7T A;  3OFH A;  4ZVQ B;  5BJR A;  3UDV A;  3CD7 A;  4O0I A;  2J0Q D;  2JFK A;  3GIR A;  2OH2 A;  2H5I B;  3KLI A;  2W9C B;  1H98 A;  4HDG A;  1RE1 B;  5B0G A;  3OL7 A;  4MKB A;  2RUS A;  2D41 A;  1S9E A;  3P45 B;  2PI4 A;  2DHG A;  4CYU A;  2W9A A;  3CUN A;  4WTO B;  3KLI B;  5KFI A;  1REG X;  4JB8 B;  3TUZ C;  1MWY A;  5F0W A;  3G8S A;  2ROG A;  4TY9 A;  1OS5 A;  5EX3 A;  3DGP A;  1D9F A;  1MU2 A;  1S9E B;  1RIS A;  3Q23 A;  1L3S A;  4CYU B;  1TKZ A;  2BE9 B;  2DRD A;  4TKT A;  1F9F A;  1IBM F;  1MW7 A;  3JTO A;  2KO1 A;  2MKJ A;  2EFN A;  1BUX A;  3NOG A;  2YWK A;  1P9Q C;  3DGP B;  3FZB A;  1MU2 B;  4OX6 A;  1WHW A;  5J1P A;  2JDJ A;  2RRN A;  3VGS A;  1TKZ B;  1T9Y A;  2M2B A;  5IXU A;  2I2Y A;  1YTY A;  3MWB A;  4DN9 A;  2BJ8 A;  3H0P A;  5GME A;  4K4T A;  3PKY A;  3MCO A;  3CCZ A;  4QCL A;  1U1M A;  3AOB A;  4KYZ A;  4S0M A;  4IDK A;  4OX9 F;  4RWX A;  3OR2 A;  2DIS A;  1RAH B;  4RW4 A;  1ZM3 A;  2CQ4 A;  4MAK A;  2JL9 A;  5LSR A;  5D0H A;  1TK5 A;  1ZA2 B;  4Z7C A;  3RGI A;  4IDK B;  4C8L A;  4X4N A;  2J6S A;  1IR2 A;  2DCL A;  3OW2 R;  4OZ2 A;  3US5 A;  1FNO A;  4RW4 B;  2G0C A;  3GR1 A;  4KKO A;  2KZM A;  4LVO P;  2LEA A;  4M8L A;  2J9D A;  5E2Q A;  3BBC A;  5GAD I;  1SL1 A;  4PCQ A;  3LOU A;  3WQP A;  1HNZ F;  1KD1 T;  3HLU A;  2F8M A;  3ZZO A;  4TNO A;  4PWU A;  2BE7 D;  2AJQ A;  3BYR A;  2XM3 A;  4KKO B;  4X64 J;  3FQK A;  4OL8 A;  3KG1 A;  1GMW D;  3OXG A;  2BE2 A;  1NSQ A;  2C22 A;  5IV4 A;  1RLC L;  2YTC A;  5BYR A;  2MHN A;  2I8E A;  2C2O B;  4DPW A;  4PUO A;  4CH0 S;  3OL9 A;  3W61 A;  3IR6 B;  4OX9 J;  3ENV A;  1L3T A;  1EAR A;  3ETM A;  1RTD A;  2BE2 B;  3ISN C;  4JOU A;  4AXI A;  3WC0 A;  2LEB A;  3M8S A;  2VIC A;  2CJA A;  1TU0 B;  2VFV A;  4Q43 A;  1NZA A;  1FNX H;  4JI6 F;  1X4H A;  1RTD B;  1U1Q A;  3UE2 A;  4JI2 F;  4A8O A;  4MFB A;  4PG5 A;  2PSZ A;  2MEW A;  4DU8 A;  5GAG I;  4G6V B;  3A8J A;  2W2M P;  3D1O A;  1GXU A;  2VL1 A;  2MLX A;  1HNZ J;  4I64 A;  1BE4 A;  2W4D A;  3VAL A;  2KFY A;  1IN0 A;  4MFB B;  5A2Q Y;  1SPB P;  4Q8E A;  5KFH A;  2XSF A;  2IJN A;  2CYY A;  1T03 A;  2YKN A;  3UDC A;  1WHV A;  3LAK A;  2NZC A;  5ETO A;  2LXF A;  1KDN A;  1G3O A;  2O01 C;  1PGZ A;  3D6T B;  2N3O A;  4LF4 F;  3I4P A;  4E98 A;  1T03 B;  2YKN B;  5F8M A;  3ELH A;  1VBY A;  4FS1 A;  4RNN A;  1YHQ S;  3R6L B;  1FKP A;  1RHU B;  3EX7 B;  2UVV A;  4CM0 A;  3AXK A;  2XYH B;  2V0N A;  3OFG A;  4NYO A;  2Z2Z A;  3N79 A;  4I67 A;  5KFM A;  1FKP B;  1QE1 A;  1VQ8 S;  5KFR A;  2KVQ E;  1ULR A;  1YVF A;  1BD6 A;  4LRB A;  2IVF B;  4OZ3 A;  2EVZ A;  2XMU A;  4CO3 A;  4FVM A;  2I0X A;  1LOU A;  3RAX A;  1SC3 B;  2V69 A;  1RWN B;  2DY9 A;  4JI8 F;  3BR8 A;  1SJ3 P;  4UOH A;  3R8Y A;  1S12 A;  4MKV A;  2PC6 A;  2E9Z A;  1AYE A;  2ZBQ A;  2VUG A;  5CAB A;  2KDO A;  4ECR A;  4JV0 A;  4CTA A;  1DQ9 A;  3M8R A;  3TO8 A;  3QRR A;  3NGS A;  3R1H A;  1BY9 A;  4ZLJ A;  4IOA Q;  2RQM A;  2UZA A;  2A6M A;  3KFW X;  4LF4 J;  4FN5 A;  3B4M A;  4CLZ A;  4C97 A;  3D0H E;  4CTA B;  2UUB F;  4CH1 A;  2BJ3 A;  1M0S A;  4R0J A;  1DHM A;  4MK8 A;  4Y3C A;  1H6K X;  4TYA A;  3VAM A;  2VC0 A;  2VJU A;  1RWK B;  1F3F A;  2BKO A;  5KFT A;  4J9K A;  1GTH A;  2L9N A;  3SSQ A;  1J5E F;  1RCO B;  1X4G A;  1NB2 A;  3EVW A;  4CWB A;  3IBC B;  3SSR A;  4DR5 F;  3PHT A;  3AQO A;  4WPA A;  2IC3 A;  2XYP B;  1HL6 A;  3DMJ A;  2B5J A;  1EJ7 L;  1FXL A;  3E01 A;  2E7X A;  2XI2 A;  3MD1 A;  3GSI A;  3M8W A;  4Y6I A;  3HZG A;  4JI8 J;  1Z2L A;  2IC3 B;  4PQU A;  4WZM A;  4AUK A;  3DMJ B;  2B5J B;  3MEK A;  3E01 B;  2Y0B B;  1WEX A;  4KTQ A;  2HHU A;  4PQU B;  1Q7L B;  3AD8 C;  3PW2 A;  2E5J A;  2IYG A;  1DQA A;  4DFM A;  2AJ2 A;  4DR1 J;  4Q5V A;  2Y1R I;  1B0P A;  2XS5 A;  4WWS A;  5IT4 A;  2UUB J;  2LFV A;  3V6K A;  3CCU S;  4ZCK A;  4KV8 A;  4L3N A;  1E6V A;  3TVY A;  2R7W A;  3HSD A;  2QA1 A;  2F4V F;  1J5E J;  1F5C A;  3CGI A;  2FZK B;  5KTQ A;  2G2Z A;  4ZVS B;  1RT6 A;  4DR5 J;  2FJB B;  2J7W A;  2FPH X;  5ADZ A;  4KV8 B;  2WW8 A;  1E6V B;  3CMA S;  4DV4 J;  3EIC A;  1JJC B;  3TW0 A;  4GC6 A;  2EC2 A;  2PD1 A;  4YQW A;  1ZZF A;  3BBF A;  5D0G A;  2VQE J;  3ZZP A;  1RT6 B;  1JMT A;  3D5M A;  4P73 A;  1A0O B;  3MAQ A;  1TL1 A;  2ZNZ A;  1LXJ A;  4I6A A;  4NCB A;  2BBE A;  4L3K A;  4F4X A;  4DUZ F;  1NDL A;  1TFY A;  2XO6 A;  1UJ6 A;  2WCX A;  3THV A;  1IR0 A;  2AJ1 A;  3EZU A;  4J9O A;  3GCX P;  4WU2 A;  4P7T A;  1RHQ B;  2QO3 A;  2XBP A;  1TL1 B;  2E5G A;  2R2S A;  2H54 B;  1IWG A;  4QR0 A;  3OL6 A;  5ETQ A;  1RHM B;  3TQE A;  5DO2 A;  3UD5 A;  2P9E A;  9ATC B;  2JVO A;  3TQ1 A;  2YWF A;  3LAL A;  1NKC A;  1RT5 A;  2F4V J;  3X1L B;  3CIM A;  1RB0 A;  4QWB A;  2YBV A;  2BKN A;  4CCH A;  3SV4 A;  5DGA A;  1FRJ A;  4WKY A;  4ZIW A;  3K5N A;  2R2T A;  1GXT A;  3RBE A;  4IH7 A;  3TRG A;  1RT5 B;  1HW9 A;  1VQO S;  3DXS X;  2F8H A;  5KFD A;  2AZ3 A;  1NHV A;  2ZJR Q;  3OSN A;  2ACM A;  1VBX A;  4DV5 J;  2N4D A;  4OI0 A;  3V81 A;  2L48 A;  4DUZ J;  5IT0 A;  5K20 B;  4EI2 A;  5LJ3 Y;  4OYA A;  3PM9 A;  4J7C A;  2BJE A;  1MRO A;  4N8O A;  5AXL A;  1GMV A;  1HNI A;  1DBD A;  3CCS S;  3NNA A;  3V81 B;  2ZOM A;  2XNR A;  1DLO A;  1YSJ A;  1S49 A;  5DZ7 A;  5E3Q A;  1MRO B;  2AMC B;  4RL1 A;  3GIM A;  1HNI B;  4O4R A;  1SQF A;  4GC7 A;  2CA9 A;  3N4W A;  1RT1 A;  4ES3 A;  1DLO B;  2XSJ B;  2KYZ A;  3J7Z 5;  4IG0 A;  4ZCM A;  1CVJ A;  3SMZ A;  1U2R A;  3DLB A;  4CLF A;  1JLE A;  1Q95 G;  1BQX A;  2IY5 B;  4WP3 A;  4UZB A;  1HLW A;  1PYO B;  2F8E X;  2U1A A;  1X4B A;  2N4C A;  5AJ3 J;  3MXH P;  2RHQ B;  1RT1 B;  2GJI A;  1SJQ A;  4CI0 B;  2KT5 A;  3ETO A;  3AOC A;  4IG0 B;  1JLE B;  1UVL A;  1VLO A;  1YZ7 A;  3FEY B;  5KAK A;  2Q6C A;  2XTJ P;  3OVA A;  3PAC A;  4EBD A;  3QJP A;  1RDR A;  3J81 j;  4WJB A;  2WRM A;  1H7X A;  1FKO A;  2R7Q A;  3D67 A;  3C16 A;  2EKY A;  2QT7 A;  4UT4 A;  2FJW A;  4YDD B;  2B7C B;  4F0M A;  2DNP A;  3W64 A;  3C66 A;  2OKQ A;  4L72 B;  4MJK A;  4KO0 A;  1LW0 A;  4HL9 A;  1VDH A;  1FKO B;  1V6H A;  1AW0 A;  2EEY A;  2J0S D;  3D0G E;  1D8Y A;  4U6P A;  2HHX A;  4G65 A;  1QTN B;  4KO0 B;  5DET A;  4N8N A;  5GAE I;  2GMJ A;  1LW0 B;  4ECY A;  1R8B A;  2CPD A;  2CQG A;  2GQQ A;  1UVI A;  5E3A A;  4N41 A;  5IWA J;  4OYO A;  4CLS A;  3M8Y A;  1C0U A;  4PAB A;  2OPR A;  1YJR A;  5J1E A;  2BAN A;  2IMW P;  2MXY A;  2ZC4 A;  3ZTR A;  3W8G A;  3C8Y A;  2RML A;  2FLN A;  2VPY B;  1C0U B;  2OPR B;  5J1E B;  2BAN B;  1VBZ A;  3FMB A;  3BH6 B;  2C2R A;  4MTP A;  3V5R A;  4USU A;  3LP0 A;  3PX4 A;  3WX8 A;  3MMB A;  2RE1 A;  5IT9 Y;  1SJ1 A;  4PXB A;  5F3Z A;  4DDF A;  3O2I A;  3K59 A;  3VWS A;  2V8P A;  2Z2M A;  3M7V A;  4F2R A;  3OL8 A;  2XWY A;  3A1Y G;  4USV A;  4K7Q A;  2FHJ D;  3QFH A;  5KG4 A;  3FRY A;  1R0C B;  3LP0 B;  4ZMM A;  1S9G A;  2DNH A;  2RSQ A;  3MMB B;  1RAB B;  5G0R A;  4Y2M A;  2OEM A;  2EI5 A;  4Q2L A;  2HG4 A;  1ZAX A;  1S9G B;  4B02 A;  4HH0 A;  3S7R A;  2ZM6 F;  3CC7 S;  1KVI A;  3E51 A;  2VFU A;  5G0R B;  2MQP A;  2OLW A;  2XY7 A;  4BS2 A;  4B08 A;  2O1P A;  1F5A A;  4I7F A;  5KT5 A;  5DS7 A;  1RBA A;  4USJ C;  3LF0 A;  3AD9 C;  3TVK A;  3D6F B;  2RS2 A;  1B0T A;  4ZVF A;  2P9G A;  4JYA J;  4CLU A;  5FLX Y;  3RYL A;  1TQL A;  3IWX A;  4I7F B;  1DAR A;  4F36 A;  4DQI A;  2ADC A;  1PIE A;  3J7Y I;  1LNQ A;  3G71 S;  4M94 A;  3W65 A;  4QW9 A;  5CCL A;  3TJ9 A;  2VU5 A;  2DR8 A;  3TA0 A;  1YK9 A;  1U26 A;  3H98 A;  1KEK A;  2WBR A;  3VR1 A;  4K0K J;  4YHH F;  4A8W A;  1OSD A;  3ONQ A;  4LR7 A;  4EK2 A;  3G6E S;  1WOS A;  1V3S A;  2VKR A;  3SEO A;  4TQR A;  2XC9 A;  1KS2 A;  3L3C A;  4ECV A;  3HVR A;  2DGU A;  3RB0 A;  4MYU A;  3RAM A;  1VI7 A;  2IRU A;  4N56 A;  3BGO P;  3BO3 A;  3N28 A;  2KH9 A;  1T05 A;  1WOR A;  3GR0 A;  1VC6 A;  3V2U C;  2FZG B;  2DPJ A;  2P5V A;  2JC1 A;  1U0S A;  4WK3 A;  4ZDN A;  3TOQ A;  3CF5 Q;  1T05 B;  3H2V E;  4B3T F;  1HNW J;  4F50 A;  5IFM A;  3PW0 A;  3ILJ A;  1IR1 A;  1D3W A;  4JI7 J;  4QIV A;  2I5J A;  5ETL A;  1HNV A;  4ERD A;  4ZIT A;  3J80 Y;  1M5S A;  2UXD F;  4P2F A;  4MK9 A;  3PFE A;  2FHK A;  1B99 A;  1SBR A;  2YKP A;  2VQF J;  5HN0 A;  3RJM B;  2ZBR A;  2MST A;  2NCK L;  1FRM A;  2I5J B;  1HNV B;  1M1K T;  2G0J A;  3QFW A;  1RWM B;  4NRU A;  2RQK A;  4RW8 A;  3TX8 A;  1Q16 B;  1R8H A;  1KP6 A;  2BEF A;  1AZS A;  1UPP A;  2QSW A;  4K4V A;  4G1Q A;  3QSY B;  1GXL A;  2PFD A;  4QU7 A;  3QT8 A;  2CNK B;  2QL9 B;  1UPM B;  1SV5 A;  4RW8 B;  3M6W A;  5H9E J;  3JB9 k;  1MMN A;  4U9R A;  2W7P A;  1AZS B;  1N5T A;  5DQH A;  3AA8 A;  1JIH A;  3NOC A;  1NPK A;  4G1Q B;  4ALZ A;  2BJD A;  2LQ8 A;  4B9S A;  2NXC A;  2FC8 A;  2E5L J;  3LQV A;  2APO A;  5C25 A;  4B3T J;  1JXL A;  1SV5 B;  2Z4P A;  4O44 A;  1OWX A;  1URR A;  4DUT A;  4WCE Q;  1CG2 A;  2UXD J;  5KFO A;  2WAQ D;  1TK8 A;  4ZHR B;  3L4B C;  1HQ2 A;  5C25 B;  4NYZ A;  3TYT A;  5CD4 A;  4KR0 B;  4O44 B;  1RWV B;  4HLB A;  2FVR A;  3W9J A;  1FHT A;  4OZL A;  2GMH A;  2HHW A;  3T5L A;  2R42 A;  3T9Z A;  1BWV A;  3SSS A;  2GVZ A;  4DZ6 A;  2CJQ A;  3LTO A;  4ED1 A;  2J7U A;  3G4S S;  3NKY A;  3V6D A;  3DLH A;  2GVZ B;  2KG1 A;  3VAK A;  4ED3 A;  5AE1 A;  1FRH A;  1RA6 A;  4ZCI A;  4NZ6 A;  2M70 A;  3CC2 S;  3V6D B;  2EBG A;  2OPS A;  2HYI B;  2BUN A;  4K5S A;  4DUY J;  2BZ2 A;  1TK0 A;  2XGP A;  4LFB F;  1XEZ A;  2MMY A;  1UEK A;  5A0Y A;  4C48 A;  5F9L A;  3W8P A;  1S7H A;  2OPS B;  1PBU A;  3G86 A;  1Y0H A;  4OHV A;  1N52 B;  2GGP A;  3ENA A;  1WTB A;  4H4K C;  2QMW A;  3G82 B;  4LF9 F;  2HGN A;  1UEU A;  5A0Y B;  2B8P A;  1S7I A;  2AJ4 A;  1RAF B;  1QDU B;  3SYZ A;  4F2S A;  4NCA A;  2DR6 A;  2LEC A;  3AJ1 A;  2B51 A;  2GGP B;  3V6H A;  3MZI A;  3FCV A;  1XBW A;  3H4B A;  4IG3 A;  1R8C A;  4U8V A;  3EYZ A;  5A76 A;  3BDE A;  3KKF A;  5KFS A;  7AT1 B;  1EIY B;  3GSD A;  2AP6 A;  1WG1 A;  4ZS6 A;  2GIQ A;  2XWX A;  5KFF A;  3IBF B;  3H5X A;  1N4L A;  4ZP9 A;  4PXC A;  4M63 A;  3I32 A;  4WXW A;  5F8N A;  1X5P A;  3H5S A;  4IG3 B;  5ETS A;  9RUB A;  2HFZ A;  1JLA B;  3BS9 A;  1FT8 A;  3ZNJ 1;  4GMK A;  3ADA C;  2E5H A;  3WDO A;  2M3D A;  2KL8 A;  1LQ9 A;  4LFA F;  3C19 A;  4PQA A;  2XCP A;  4Y0F A;  1ACM B;  3C3L A;  3MFH A;  1VQ7 S;  5E3P A;  1QLN A;  1N5Y A;  1GH8 A;  4LUB A;  5LM7 E;  3CJ3 A;  2GA7 A;  3DI6 A;  3FBE A;  3M2U B;  2VPW B;  3ZTP A;  1NJY A;  2CQH A;  2GHP A;  1UET A;  4Q45 A;  2LDY A;  1IWA A;  1I51 B;  2N82 B;  3M8Q A;  2VA3 A;  5E41 A;  4NOH A;  1N5Y B;  3T5H A;  2C3U A;  3F44 A;  2DGS A;  3D1Q A;  3UDL A;  3DI6 B;  4CO4 A;  1FFW B;  3IRX A;  2BJ1 A;  1S1X A;  2BRK A;  1U09 A;  4CH7 A;  3TA2 A;  4FYV B;  2HGM A;  3UI3 A;  2UV8 G;  3M8Q B;  4QIW D;  4DL4 A;  3TP2 A;  3AJ2 A;  3FGV A;  4C3M A;  1CS4 A;  5ETT A;  1WEY A;  3CDE A;  1S1X B;  3DU6 A;  2JNJ A;  3H2U B;  1PC5 A;  4HHU A;  1RP5 A;  2C2E A;  1U1L A;  4LFC F;  4WU3 A;  1WHX A;  4ICL A;  4C8O A;  2BM1 A;  1RTZ A;  3PEJ A;  1Q5Y A;  2KYX A;  4A8Y A;  4LFA J;  2CQ0 A;  5KFK A;  2DKO B;  2WTF A;  2CJX B;  2BVZ A;  1S0N A;  3Q8R B;  1L3V A;  4ICL B;  2QV6 A;  3BKT A;  1IM6 A;  2ZH9 A;  1N33 F;  2FUG 9;  1NJZ A;  1FES A;  3MAH A;  4FNH A;  8ATC B;  5HVH A;  2WSF C;  2M9K A;  2XLJ A;  3DRY A;  4P52 A;  4YB7 A;  4F26 A;  1TL4 A;  3JTP A;  1OPI A;  4PPZ A;  4OYZ A;  4R0E A;  1H74 A;  2CWK A;  2CDR B;  2ZZN A;  3K17 A;  5E3C A;  2F1F A;  2BQU A;  4LQ3 A;  4MYT A;  2EG1 A;  1U1P A;  1IBL F;  2DGO A;  3B6B A;  3V4I A;  2VDH A;  2AJF E;  1WUU A;  3AOD A;  5GAH U;  4KC5 A;  1FJG F;  4KHR A;  2QMX A;  1X0P A;  1CQN A;  3CB4 A;  3DXB A;  5LMN J;  3P4U B;  3I9Z A;  3CDB A;  3HXM A;  2VBW A;  4M5D A;  5AXN A;  3HD1 A;  2DNM A;  2XI3 A;  4LMZ A;  2RIL A;  3S8S A;  3V4I B;  3CJR A;  3U27 A;  2E1R A;  4DV6 F;  2OHD A;  2RRA A;  2QJ3 A;  3HM9 A;  3DDN A;  4DR4 F;  5IZH A;  2D3U A;  4MMO A;  4PRF A;  1SH0 A;  1XK8 A;  2DVI A;  4M5D B;  1X9M A;  2VPX B;  2V8H A;  4EBE A;  1MN9 A;  4NLD A;  4PKD B;  2BOP A;  2X3G A;  3B82 A;  2KHD A;  3BN4 A;  2HWI A;  1XJW B;  4I2Q A;  4ILL A;  2J9D E;  3DCA A;  3M2V A;  3D3B J;  5KT7 A;  1O5J A;  3BDP A;  4ZVH A;  3MUT P;  5IC4 B;  3VGT A;  1B0V A;  4PPD A;  2RHS B;  2HVD A;  1S59 A;  4X62 F;  1ZBT A;  1SCJ B;  4YR3 A;  1FDB A;  1LWX A;  4I2Q B;  3K2Y A;  4DLG A;  4B3M J;  3KLF A;  4C4W A;  1IBL J;  2MHE A;  3M2V B;  2JVR A;  2DRB A;  2DNN A;  4O4G B;  4W4M A;  4YN3 B;  1Y7P A;  2FD2 A;  5J2N A;  2V50 A;  2C3Y A;  3LAN A;  2V8V A;  4FBU A;  3KLF B;  4LF5 F;  2O67 A;  4M95 A;  2E1A A;  1W25 A;  2QLF B;  1LKZ A;  1N48 A;  1UVK A;  2QLX A;  2RJZ A;  1YBT A;  5J2N B;  1G7C B;  3N5B A;  2KJV A;  4LBP A;  3HHL B;  4OV6 A;  4EGL A;  1M5O C;  1K9M T;  4E0D A;  4ZOS A;  3VTI A;  2KXH A;  1KRP A;  1FEE A;  2DHA A;  1HI1 A;  4I2P A;  5F8G A;  3LWL A;  1A9N B;  2CPH A;  3J81 U;  5CYQ A;  1N32 F;  3CD0 A;  2ZFH A;  2VC1 A;  3K58 A;  1HYS A;  4KRW A;  2R8H A;  3TJA A;  3A8E A;  5I4M A;  4IQM A;  3BB5 A;  1YDL A;  5HBM A;  1VQ6 S;  3GQC A;  2FJV A;  4I2P B;  2HS4 A;  4FF4 A;  4C3L A;  2V34 A;  4YUD A;  1X4F A;  5CYQ B;  1UJ4 A;  3HT3 A;  4HAC A;  1YKW A;  3GCW P;  3NLC A;  3EM1 A;  4OI2 A;  5HBM B;  5KFQ A;  3DC2 A;  3KK1 A;  3CT9 A;  3TEG A;  5AE2 A;  3CJ8 A;  2YX4 A;  2DNY A;  3V6J A;  4LF5 J;  2NXU A;  4HAC B;  2XMT A;  2XLI A;  1AFJ A;  4O3P A;  2GHV C;  3MPW A;  2R7U A;  1I3O B;  4LRD A;  4UOG A;  2Q79 A;  5LXR A;  3BSN A;  3KK1 B;  2MGZ A;  1TL7 B;  3S6E A;  5KG0 A;  1QD1 A;  2HKE A;  1WD6 A;  2ASL A;  3PX0 A;  4F0K A;  2RDJ A;  1SC6 A;  3HX9 A;  1Z1Z A;  4ZN3 A;  2HK2 A;  1E6Y A;  3CSK A;  2MQN A;  5HK4 A;  5IC6 B;  4X65 F;  2MGZ B;  3BQ0 A;  1NK0 A;  3C15 A;  3VQS A;  4YR0 A;  1S1T A;  5K8P A;  2AF6 A;  1X4D A;  3IBW A;  1JLC A;  2IM1 A;  2ZKU A;  4AT1 B;  1E6Y B;  4QIF A;  4OYP A;  2V9W A;  4UW2 A;  1RTH A;  5KFG A;  3I96 A;  2WZ1 A;  1RSC A;  3C15 B;  1YJV A;  3GYG A;  1ARO P;  1S1T B;  3HFZ B;  5H9F K;  4ANE A;  3H20 A;  1JLC B;  4OQJ A;  1KFD A;  1U8S A;  3MM6 A;  5KT4 A;  1FDN A;  1X4A A;  3KK2 A;  2ASY A;  3DHW C;  3QIP A;  4RBV A;  2G1D A;  2GX8 A;  3AFG A;  4QR1 A;  3EZ5 A;  1J27 A;  5MLC V;  4JI4 F;  2AEJ A;  5CA5 A;  2HZV A;  2IRX A;  3MM6 B;  2PGC A;  3OBI A;  3H90 A;  3KK2 B;  1HPZ B;  1TMJ A;  2DGV A;  2FQQ B;  3QIP B;  3R27 A;  3Q8V A;  5IQQ A;  4DV0 F;  1RU1 A;  4AQY F;  2LQB A;  5A8R A;  2J5A A;  3PR5 B;  1YJN S;  4QYZ J;  3FSY A;  3MGJ A;  4X65 J;  1D1U A;  3TVZ A;  2UXC J;  2KM8 B;  2FJD B;  2AT1 B;  2ASD A;  1QAY A;  1VOM A;  4C8N A;  1TKT A;  1NK9 A;  3FFI B;  3K0J A;  5A8R B;  2KRR A;  3K5L A;  1I94 J;  3G6X A;  2ATL A;  3QPI A;  1P1L A;  2DO0 A;  1F2G A;  4MKY A;  1SKS A;  1CUL A;  2QMU B;  2IPO B;  1TKT B;  1F9H A;  1PYS B;  4B9T A;  1HW8 A;  1VJW A;  4LRC A;  3JQK A;  1DQ8 A;  3ZZ0 A;  1GNK A;  3W2W A;  1W26 A;  4ZPB A;  1CUL B;  3MFI A;  4DFJ A;  2PEH A;  4KE5 A;  4JI4 J;  3KG4 A;  2BAB A;  2H3E B;  4EZ6 A;  3W9I A;  1RU2 A;  4ZVG A;  3R7N B;  1Y4Z B;  3MI7 X;  3W5Z A;  1UAW A;  2YNG A;  2W2O P;  2FGC A;  2HVH A;  2HFO A;  3P96 A;  4EO8 A;  4OMF G;  3NGT A;  7FDR A;  3W2W B;  1S4F A;  1MN7 A;  3WIU A;  5M2P A;  2HWT A;  3DFE A;  3MEE A;  3MAA B;  1RAE B;  3QGG A;  4DCO B;  5HMZ A;  3I0S A;  4M5N A;  2M0G B;  2YNG B;  3GE9 A;  1HBN A;  2XZT B;  2AEM A;  2E29 A;  5F0U A;  2W4P A;  2E1P A;  2K7J A;  3VZH A;  2DIU A;  4KH0 B;  2WVC A;  3MEE B;  3IP0 A;  4PG8 A;  4XK8 C;  4C8Z A;  3I0S B;  2QTW A;  3DOK A;  2K7K A;  3MM5 A;  1HBN B;  3GFZ A;  3GYX B;  2MQQ A;  1Y5I B;  3HKW A;  4JI0 F;  2XQC A;  1R89 A;  2EWH A;  3Q2S C;  3QRP A;  1FK9 A;  3RBZ A;  2LU2 A;  3DOK B;  4G3I A;  3MM5 B;  2B9X A;  3MD3 A;  3OTO F;  4P10 A;  4NXM F;  1FEH A;  2CG4 A;  4OX8 A;  5HP1 A;  2OEL A;  5GAE U;  2X1F A;  3NEK A;  1NM2 A;  3NS5 A;  1FK9 B;  5B08 A;  5BR8 F;  4ZJO A;  5D8H B;  4DV2 J;  1EB0 A;  3M30 A;  2W9B B;  3CJ5 A;  1F1B B;  2JOQ A;  5HP1 B;  2QX0 A;  4IYQ A;  3C46 A;  3CD5 A;  5LL6 d;  1ZTT A;  1MWQ A;  2V2Z A;  1T3N A;  2XUL A;  5E3R A;  2ZH3 A;  3GV7 B;  4P2M A;  3DRR A;  3L7P A;  1R31 A;  2R4F A;  5HQM A;  1P27 B;  4ZVT B;  3SIP B;  3M30 B;  1OO0 B;  1U2C A;  1L3U A;  3ZO7 A;  3OTE A;  3VCD A;  3OTB A;  3LAM A;  3DN9 A;  1VQM S;  2CQC A;  4DR6 F;  3DRR B;  1H2V Z;  4B3O A;  1VS3 A;  4CNY A;  1UWA A;  3IWN C;  4PG7 A;  4ZKA A;  4MIA A;  3CC4 S;  3HD2 A;  4DXL A;  4NXM J;  4B3O B;  1S57 A;  4DX6 A;  2M88 A;  4W98 A;  3AJD A;  4UQG A;  3E3X A;  4A4J A;  4G1I A;  5I42 A;  4PWW A;  2ZKT A;  3GJT B;  4EUV A;  4E8U A;  2FLL A;  3W60 A;  4AND A;  4UY8 5;  5KG3 A;  3L7O A;  5IQ6 A;  3TUI C;  2PT0 A;  2LXU A;  5CAA A;  2CQB A;  5I42 B;  4RNF A;  1C1C A;  4RZR A;  3GJQ B;  2UUT A;  4FKX A;  1SVD A;  1EET A;  2POK A;  4R8U A;  4FS2 A;  1GT8 A;  2X1B A;  2OSQ A;  3LGM A;  2D74 B;  4HKQ A;  4ELT A;  4HYK A;  2GIR A;  3ZC4 A;  1URN A;  1SH3 A;  3NAH A;  4FVC A;  3FVY A;  2HBR B;  4PEO A;  2VBY A;  3CCW A;  1C1C B;  2BMB A;  4ILR A;  1EET B;  4R8U B;  3J7Y U;  4DPT A;  1U47 A;  5KFE A;  5ETM A;  5DM6 Q;  1KBR A;  1Q53 A;  2KXF A;  5F8L A;  1VRT A;  2D3O R;  2DXF A;  2KRB A;  1RAI B;  5KT3 A;  2HQF A;  4TU7 A;  2CQ3 A;  2HSE B;  1S4E A;  2EFO A;  4DS4 A;  2HAF A;  5KT2 A;  4P72 A;  2LKZ A;  2KG0 A;  1NME B;  2CPY A;  1VRT B;  3C6T A;  2R7R A;  2MLZ A;  2RDI A;  4XDD A;  2IIH A;  2XZW A;  2FYX A;  3RRK A;  2E9T A;  3BKU A;  2LYV A;  2AGQ A;  1RKI A;  4ECQ A;  3MPY A;  2YNI A;  2HQG A;  4I0W A;  3C6T B;  1LFP A;  3MED A;  4Y65 A;  2PMW A;  3DDK A;  5L9N A;  1HA1 A;  4YY3 F;  1WI6 A;  4ED0 A;  1VCT A;  2UUA F;  2YX7 A;  1DY3 A;  1SB6 A;  1RTJ A;  2YNI B;  2C3O A;  3HF5 A;  4KBI A;  1W7W A;  3DOM A;  2OI2 A;  3MED B;  3O3L A;  1GMW A;  1KVJ A;  4MIB A;  4AYB D;  4TN2 A;  1KKH A;  1NEE A;  3IRW P;  4FP9 A;  3TI0 A;  1RTJ B;  2W01 A;  1XQI A;  2JEF A;  1Y3J A;  1FTC A;  2ALY B;  4OHX A;  3EGW B;  3E2E A;  3DOM B;  2CQ2 A;  4URQ U;  3PZP A;  4BWM A;  1UZD A;  3G8T A;  1IBK F;  1S72 S;  3R1L A;  2AGP A;  2GVD A;  3FSX A;  2RB7 A;  2ZIT A;  3PIP Q;  4ZLP A;  4BLG A;  2FC9 A;  5LSO A;  2ZVI A;  3TNV A;  5FLX U;  3EDQ B;  1FRK A;  4OZ1 A;  1HQU A;  2JRS A;  2C2K B;  4GO5 X;  1EP4 A;  2GVD B;  2B4O A;  1AA1 B;  5HAO A;  1X0F A;  3SQO P;  2QLB B;  1IJE B;  2DNO A;  3KHH A;  4YY3 J;  3QSI A;  3IFE A;  2EPI A;  3A3O B;  1Y00 A;  1FD8 A;  1NBE B;  4RWW A;  5ETP A;  1HQU B;  2LEP A;  4FYW B;  5CZX A;  2UUA J;  1EP4 B;  4LQ9 A;  2A1B A;  4V19 X;  4UZC A;  1ROF A;  2VIH A;  4IO9 Q;  1N88 A;  3CWJ A;  4K8R A;  4RPF A;  2DBB A;  4USM A;  2QIF A;  2VOP A;  3CCR S;  2CJB A;  1GK8 A;  3NGD A;  4FPR A;  4B17 A;  7FD1 A;  2Q1L A;  2YX1 A;  5HVG A;  3FC9 A;  1GEH A;  2G0I A;  3D68 A;  1S1V A;  4NLQ A;  2GIF A;  2GFF A;  3SCJ E;  4R5P A;  1XNQ F;  1CJK A;  1P8G A;  2DO4 A;  1U6F A;  3S01 A;  3TZW A;  4K4Y A;  4X4O A;  1FF2 A;  3TX0 A;  4C2M A;  5GMD A;  3J80 U;  4ZVU B;  1T02 A;  4GO7 X;  1S1V B;  2DXD A;  1LWF A;  3JAM Y;  3KK3 A;  4R5P B;  1CJK B;  2KFZ A;  1RYS A;  4CM2 A;  3NAI A;  4DLE A;  1N5V A;  3LO3 A;  1JJH A;  2RD5 C;  4DL3 A;  2HFV A;  4NEZ A;  3HDS A;  4LIW A;  1LWF B;  3KK3 B;  3OFE A;  4JI5 F;  3NP5 A;  6FD1 A;  1NUE A;  1OSC A;  3VAF A;  4CLP A;  4N5S A;  4PWD A;  2OML A;  4KGZ B;  3I6P A;  2DNR A;  1A6L A;  5L8R C;  3ET6 A;  1JK9 B;  3BEG B;  3VAJ A;  2D1C A;  4NLG A;  3DLJ A;  3UO0 A;  1AFI A;  1CC7 A;  3D0I E;  4CLW A;  4PWD B;  4NL5 A;  1XR7 A;  3UDE A;  1S48 A;  2QLW A;  4IQX A;  1NK6 A;  3KUG A;  1NKB A;  4DPX A;  3QGH A;  1IKV A;  3ET6 B;  1R8P A;  3U02 A;  2ZWP A;  4KB7 A;  1XNQ J;  3SBM A;  3LP2 A;  1FFS B;  5DGB A;  3SCK E;  5IS2 A;  1YQH A;  1EQM A;  2Z2L A;  2FHO B;  4K2X A;  5JUM A;  1IKV B;  4KT0 C;  3BYP A;  1YG0 A;  2XGQ A;  3HT0 A;  1WC6 A;  3LP2 B;  4NLX A;  5L1J A;  3VV2 B;  2NSC A;  2MKS A;  2QGF B;  4C3K A;  5AXK A;  5CD4 H;  1U1K A;  1WHY A;  2OIH A;  1OPZ A;  2JEJ A;  2V2K A;  4JI5 J;  4UST A;  1U8W A;  1EKR A;  1JB0 C;  2ZD1 A;  4LRF A;  1NND A;  2XLK A;  3KWM A;  3W62 A;  3TZZ A;  2GAG C;  1VLY A;  3ITH A;  5CH7 B;  3NCP A;  3QNW B;  4NML A;  3BSA A;  5EWE A;  2ZD1 B;  5D4O A;  4WII A;  4X64 F;  1N34 F;  4AE5 A;  3OJS A;  1XNR F;  5KFU A;  1Q8I A;  4KGX B;  4LF8 J;  4KIA A;  3T6B A;  3ITH B;  3N6N A;  2IDE A;  1HHT P;  3OQ2 A;  1IUJ A;  4ED6 A;  2R7V A;  1SL0 A;  4QWD A;  4ZPV R;  5DM7 Q;  1U25 A;  1SIW B;  4CLY A;  1Q7Y T;  2KTQ A;  5H9F J;  4H54 A;  4D3G A;  1NK4 A;  2KKH A;  3AD7 C;  4KHM A;  2Z57 B;  1WKL A;  4YB6 A;  4UUW A;  5DDP C;  4ED7 A;  2VG5 A;  3BPD A;  3OR2 B;  3KMQ A;  1RAC B;  4Y2C A;  4OZ0 A;  1FRL A;  2EFP A;  1TUW A;  3BF4 A;  4LBI A;  4ZVO B;  5JXS A;  1DZ5 A;  1Q86 T;  3AB4 B;  2M52 A;  2VG5 B;  3E8O A;  3LH2 S;  4UTG A;  3UWT A;  2MLY A;  4C8Y A;  4BC7 A;  1HBU A;  2RRB A;  2OD4 A;  4LSZ B;  1FA0 A;  4PG4 A;  4ZVE A;  3W2V A;  3TAM A;  1N34 J;  5DZ6 A;  3MPV A;  1XNR J;  2MQM A;  2IM0 A;  1FCA A;  2CFX A;  1YBU A;  4X84 A;  3BQ2 A;  1HBU B;  3CCT A;  4P2X A;  3HHN B;  1EX8 A;  3GIJ A;  1KQS R;  1JNZ B;  4P71 A;  2BR0 A;  3W2V B;  4WXO A;  3TAM B;  2Y9H A;  2F40 A;  2DH7 A;  1RAO A;  2L41 A;  1RHR B;  2PII A;  4PUO B;  1N0U A;  3VAG A;  3CPW R;  4F4W A;  1GMU A;  2DXE A;  1F0X A;  1K44 A;  2BM0 A;  3H40 A;  3VGV A;  4MKA A;  2X1G A;  2GV1 A;  3G96 A;  3JS9 A;  3LP1 A;  1VHF A;  2DHH A;  3PFO A;  1HHQ A;  4NLY A;  3OVS A;  5G4D A;  4HDH A;  2XMJ A;  2G9O A;  1FJ7 A;  4IUF A;  3HJF A;  2OEK A;  1RWO B;  5THW A;  4F4A A;  1VIS A;  4JI1 J;  4I68 A;  3LP1 B;  1LXN A;  4TLQ A;  2H9Z A;  3BN7 A;  2ZE2 A;  2AEF A;  3RR7 A;  5BXI A;  1HNX F;  2LU1 A;  1HAR A;  1M1H A;  4OYI A;  1GX5 A;  2W25 A;  1FX2 A;  1PO6 A;  3MMJ A;  4B3R F;  4WFZ A;  4C8K A;  3O8W A;  1VC5 A;  1PAE X;  4F7V A;  2ZE2 B;  4M1K A;  3OUY A;  1SQG A;  2V4Q A;  1TP7 A;  5GAH I;  2X3D A;  2HBY B;  1FNM A;  5JVG Q;  3D6H B;  4HTI A;  3NXZ A;  1S0M A;  5DDQ C;  4QJV A;  3FEZ A;  5IM0 A;  4Q0B A;  3OUY B;  1VR6 A;  4N77 A;  5DQI A;  1MLA A;  1Z4U A;  3VF0 B;  3PYG A;  4N47 A;  2VKZ G;  3JQJ A;  3NGK A;  4DOZ A;  1CQM A;  2ZH6 A;  4FZV A;  1YZ6 A;  1UFL A;  5IM0 B;  1Y5N B;  3RZA A;  1Q8L A;  4Q0B B;  3M9O B;  2YNH A;  4C6A A;  2ZH2 A;  1IBC B;  5J1N A;  3SZ2 A;  2IVM A;  4WP9 A;  3UW1 A;  3M9N B;  4I6Y A;  2NSB A;  3FCW A;  1AUD A;  1HNX J;  1OQ3 A;  1EAY C;  1QE1 B;  2HQI A;  4NLP A;  5KG6 A;  1UJ5 A;  3Q24 A;  2YNH B;  2IA6 A;  4LF1 A;  4B3R J;  5FII A;  4KPY A;  3CE8 A;  1LW2 A;  4KHP F;  4K4S A;  2WVF A;  1VK3 A;  2LLZ A;  3GII A;  3PG9 A;  4DWI A;  4RU9 A;  3DLK A;  3VQT A;  1V9O A;  3R2D J;  2CNO B;  4O0N A;  4ED4 A;  4DR1 F;  1VQN S;  3PYF A;  4A47 A;  1HR0 J;  2V8D A;  5C2C A;  4IKA A;  2QZ8 A;  1RCX B;  1WKJ A;  1NXI A;  1LW2 B;  4L74 A;  2WON A;  2F5G A;  3CCV S;  2OFH X;  3NS6 A;  3DLK B;  3ILO A;  4DV1 J;  4M5H A;  2MKK A;  3PY8 A;  3NWR A;  3NBP A;  4Q7A A;  4C98 A;  4LVN P;  2ZVS A;  2PN6 A;  4OI6 A;  4HT7 A;  2E1C A;  2WON B;  4NWB A;  4DV4 F;  4NPO A;  1WWH A;  4F04 B;  3QAT A;  4PXD A;  5F8I A;  3MHY A;  2R9L A;  2VQE F;  1DFD A;  3V4M A;  2XS2 A;  2VON A;  3DLL Q;  1H0H B;  3NBP B;  2DY1 A;  2C3P A;  1B7Y B;  3B8H A;  1RHK B;  1KNZ A;  3EUN A;  5ITH A;  2FJA B;  4G1P A;  2KJW A;  2FHJ A;  3FQL A;  3KHR A;  4KHP J;  1RUS A;  3O1L A;  2WBM A;  3KG0 A;  2WB4 A;  1FWK A;  2F3J A;  4DSF A;  4F4Y A;  3IN5 A;  2NZ4 A;  5KFL A;  4RO0 A;  1TR0 A;  2AWZ A;  3NGR A;  1OYD A;  3UN3 A;  2Z58 B;  1KQG B;  4F8R A;  4RUB A;  1UA0 A;  1HD0 A;  2OO4 A;  2ALZ A;  1A7G E;  3L9Z A;  1U6B A;  2DK2 A;  1KSP A;  1T9X A;  1D9D A;  5AE3 A;  3PCO B;  4J9Q A;  4NZ7 A;  5K5M A;  3PKM A;  3EZO A;  1SKW A;  2IJR A;  1RA7 A;  3FDS A;  5ETV A;  4DV3 F;  3IGN A;  3MUM P;  4PG6 A;  4A48 A;  1WF2 A;  4YP3 A;  3QGI A;  2XZD B;  2P8I A;  5KFB A;  2FTR A;  1FJC A;  1U1N A;  4DV5 F;  4NLW A;  1N36 J;  6AT1 B;  1TAQ A;  1XMB A;  4FYD A;  1K73 T;  1UCN A;  5KFZ A;  3ISZ A;  3FSI A;  4I69 A;  3P8B B;  1CJT A;  3KHG A;  3W3S A;  1KHV A;  2HIQ A;  5E7O B;  4OLP A;  5CXT A;  2BXJ A;  1OYE A;  2QFI A;  3KJV A;  1FXD A;  3MCN A;  2L08 A;  1GFW B;  3IS9 A;  4L73 A;  1CSJ A;  4MIW A;  1T95 A;  1S79 A;  1CJT B;  1YI2 S;  2NUH A;  3I5B A;  3K89 A;  1SIZ A;  4DL2 A;  3KJV B;  3G2X A;  2GQ2 A;  3MR6 A;  3T1H F;  2Y1L B;  3IS9 B;  4U67 Q;  2MY7 A;  2COL A;  2M5Y A;  2V9K A;  4U7C A;  1CJV A;  3A8I A;  3FEX B;  3HHL C;  2A3J A;  4I6W A;  2XY5 A;  5LSL A;  3SXL A;  3HMJ G;  4LF6 F;  3R6G B;  5HQ8 A;  2HHS A;  4WFB Q;  4DV3 J;  5AJ3 F;  5D4N A;  1FER A;  1R7I A;  1R8A A;  2QC3 A;  3J7Z T;  3L95 X;  4K59 A;  2K06 A;  1S6U A;  4U7U D;  1CJV B;  4EU0 A;  1RHJ B;  2EFV A;  3MTK A;  2W8L A;  2MKH A;  3KNA A;  3TAR A;  1Y11 A;  4DX5 A;  4C0H A;  3CCM S;  4DL7 A;  4DPY A;  1X4E A;  2BQR A;  3WHI A;  2LVW A;  4R25 A;  1IXK A;  2LQ9 A;  3DRX A;  3MCS A;  5SUH A;  1F3V A;  2WVD A;  2QA4 S;  5HAT A;  2CDQ A;  4HR2 A;  2B4V A;  2J0W A;  3RRG A;  1HHS A;  2AHO B;  1ZPW X;  2J0X A;  1HFE L;  3LW5 C;  2R7X A;  3RRH A;  1YWX A;  1L3K A;  2XHC A;  3T1H J;  2Q3P A;  1UEV A;  2AW0 A;  3HVT A;  4DR7 J;  3G9C A;  3EWG A;  2N7Y A;  1RWU A;  3LUY A;  2HVI A;  3CED A;  3PEH A;  1WEZ A;  4LF6 J;  4DR3 J;  5IWA F;  1RQ0 A;  2X51 A;  2WSE C;  2KXN B;  1UFW A;  1KLM A;  2AZ1 A;  2B6A A;  5GMK a;  2DNL A;  2D7S A;  3HVT B;  4EEY A;  1PAU B;  3WX4 A;  3ULH A;  4ZJL A;  4CO2 A;  2RKI A;  4L6V 3;  3NNH A;  1KLM B;  3KLH A;  5HMY A;  2B6A B;  2ZNY A;  3P3D A;  2MJU A;  4CO5 A;  1BGX T;  1KR4 A;  2RVJ A;  3K5M A;  2HPU A;  3T5J A;  2BW2 A;  2FJE B;  2RKI B;  4X4U A;  2GNK A;  2H1Y A;  4NA1 A;  3HSJ A;  3CD6 S;  3KYL A;  3C16 B;  3EGZ A;  3KLH B;  2WHO A;  1G1X A;  3PJW A;  1I6J A;  3D66 A;  2F63 A;  1JKH A;  4DQQ A;  5U47 A;  3S1T A;  3QAE A;  2QA2 A;  2F4F A;  4WBF A;  3O44 A;  2HND A;  4UQT A;  3H59 A;  3KJN B;  1JKH B;  1QVG R;  3U1M A;  3CVK A;  3QJL A;  3GFH A;  3THP A;  2OSR A;  2Y3Y A;  1DAX A;  1T9T A;  1RLD A;  2MQO A;  1CEZ A;  4ZIV A;  4QYR A;  5CZV A;  2HND B;  2KM8 C;  2B0G A;  4CT9 A;  1NPR A;  3PRV A;  4JYA F;  1AUS L;  5F8J A;  1YJT A;  2UVW A;  2AKW B;  3KUH A;  1CJU A;  2C1E B;  1VIO A;  5J2Q A;  4B9V A;  2G1H A;  1NK8 A;  1NLK L;  3D6M B;  4Q44 A;  2CQP A;  2X1A A;  2G4B A;  3H7H B;  1WKK A;  3EPG A;  3NL0 A;  2A10 A;  2NPI A;  2NRE A;  4EWT A;  3HJV A;  1CJU B;  1RWX B;  5J2Q B;  4ES2 A;  1D09 B;  4K0K F;  1HD1 A;  2CPX A;  3J7A 1;  2QG9 B;  2CQI A;  2EC0 A;  3MDF A;  4MH8 A;  3RUB L;  2IM3 A;  3DRS A;  2HK3 A;  4W92 B;  3ILI A;  3X3U A;  3PYE A;  2L9W A;  3UR3 C;  2MQL A;  3CDA A;  3OHB A;  1UVN A;  3I55 S;  2CAD A;  2FVS A;  1YJ9 S;  5C7P A;  3BGU A;  2LQJ A;  3K8V A;  4ANC A;  5HSP A;  5B09 A;  1TV6 A;  2HQ3 A;  3D28 A;  4OYX A;  4DL5 A;  1WC0 A;  3DRS B;  4HI2 A;  1LK7 A;  2VH7 A;  5DG7 A;  3KJF B;  2BX6 A;  5B0F A;  1RZM A;  1PSD A;  2OEJ A;  5D0E A;  3FRZ A;  1NB7 A;  3FMW A;  2JFD A;  3CJQ A;  1TV6 B;  3GON A;  1HNW F;  5B0C A;  2E7V A;  4JI7 F;  1SJR A;  1X5T A;  2BKP A;  5L46 A;  4KY3 A;  3QO9 A;  4ZPC A;  1JJ2 R;  4E2F B;  4DL6 A;  2DGQ A;  4FF3 A;  1FFG B;  2PI5 A;  1Q1K A;  4K4W A;  1Y10 A;  2KFN A;  4WFY A;  3W9H A;  1VQL S;  2KI2 A;  2VQF F;  1D9A A;  3Q89 A;  5A8W A;  1U7L A;  3TJ8 A;  3CO9 A;  2AYM A;  1R6Y A;  2XMM A;  4DJB A;  3WIV A;  4RJV A;  3QO9 B;  4XAK A;  3CMQ A;  4BC9 A;  3EGV A;  3CJK A;  2QN6 B;  2OP5 A;  2PMZ D;  2BA9 A;  2RS8 A;  2R3V A;  4ITS A;  2FY8 A;  1M5V C;  5A8W B;  1K0V A;  5CYM A;  1XWL A;  2LQ5 A;  1JLQ A;  2FGO A;  2I1R A;  4H4O A;  3R3T A;  1B4S A;  3CJK B;  5CQG A;  4ECU A;  4ZVR B;  1QM9 A;  5CCM A;  4C7Q A;  1ZS6 A;  3GV8 B;  4RU2 A;  4L75 A;  1XR6 A;  4PR6 A;  1WF1 A;  4RNM A;  3KTQ A;  2JC0 A;  5CYM B;  1JLQ B;  1P6T A;  1SJ4 P;  2DYA A;  2MB0 B;  2V4R A;  1V5I B;  4H4O B;  2E5L F;  3IGV A;  1JLF A;  2ZUG A;  1WC5 A;  1ZM4 A;  1UW9 A;  2E66 A;  3VVU A;  1N5Q A;  1HBM A;  4DSI A;  4ELU A;  2W24 A;  1FI4 A;  2Z2Y B;  2H48 B;  1JLF B;  3OFF A;  3PYD A;  2ZJP Q;  3IO1 A;  3Q86 A;  2AX1 A;  3Q0A A;  2FY1 A;  4RUH A;  3KDN A;  1HBM B;  3F41 A;  4QBU A;  2W2Q P;  2D69 A;  4Z37 A;  1GTE A;  2I6W A;  2HQD A;  3D54 A;  3PX6 A;  2VB6 A;  1S9F A;  4NAS A;  5D4L A;  1YJU A;  4P75 A;  3C6U A;  1SI9 A;  5E0O A;  5K8M A;  4M5L A;  3ZTO A;  3PV8 A;  3PJ9 A;  2MPU A;  3D3C J;  2LCW A;  1IBM J;  4JV1 A;  4YB1 P;  4D3H A;  3C6U B;  2C2M B;  3A13 A;  2RU9 A;  4QIE A;  3AHP A;  4LF2 A;  1XIQ A;  3MPD A;  2FLO A;  4DUY F;  2F9D A;  2CXE A;  2IVY A;  4CP5 A;  3RBD A;  2AGO A;  3TEH B;  2XMK A;  4IR1 A;  5BYS A;  2M8H A;  1MMD A;  2H51 B;  2DJW A;  3RTV A;  4IRC A;  4ECT A;  3SFG A;  4OFZ A;  3IAM 9;  3ICL A;  4DEZ A;  5L1K A;  1ICE B;  2MZR A;  2HLU A;  3BGF A;  4P74 A;  4ZVP B;  4WYL A;  4WE1 A;  3R7B B;  3CCE S;  1Y3K A;  3ZFV A;  5J2P A;  4KGK A;  3HPO A;  1HWK A;  1XMQ F;  3M6V A;  3OPK A;  2HHP A;  2CZ9 A;  4EZ9 A;  2MKY A;  1RAD B;  2Y8Y A;  4WE1 B;  5D0R A;  3ZZZ A;  4X4Q A;  3HO1 A;  3QID A;  5J2P B;  1K0T A;  1QUP A;  5B0A A;  4WIQ A;  2AD9 A;  2HMI A;  4IRK A;  1KQF B;  3CCQ S;  1MNE A;  1B64 A;  3AA9 A;  2CPJ A;  1ZAV A;  2IAJ A;  4B3S F;  4TY8 A;  3N01 A;  4X4V A;  4DCJ B;  1K1S A;  2F7V A;  3K7R A;  4M5I A;  1UFK A;  5LXY A;  1C2P A;  1PYT A;  4WK1 A;  1FKA F;  8RUC A;  5CYJ A;  3DHX A;  1UWB A;  2HMI B;  3EXC X;  4GVB A;  3U1N A;  2LXI A;  2IAJ B;  5D77 A;  4TY8 B;  4BWJ A;  4DSE A;  3PO4 A;  4IRD A;  3HUL A;  1H2T Z;  1RJJ A;  3BPS P;  1JX4 A;  1NK5 A;  2VBZ A;  1LFW A;  2OPP A;  2QFJ A;  2CPF A;  3OV7 A;  4J90 A;  3JAM U;  1JNR B;  5H9E K;  1UWB B;  5EUH A;  3J81 Y;  2HQC A;  4GVB B;  5LOQ A;  1RT7 A;  1K1Q A;  4UOF A;  1T3O A;  2GO9 A;  2PE8 A;  4M5J A;  1Q5V A;  1M5H A;  1XMQ J;  2OPP B;  1HQE A;  2YXL A;  2EFG A;  3IMQ J;  2ZH4 A;  3RW7 A;  4JI6 J;  2HFN A;  3GIK A;  1RT7 B;  4JI2 J;  1CBK A;  2HVE A;  4IOC Q;  4GVL A;  2VPZ B;  3HI9 A;  1HQE B;  1R6V A;  4DSJ A;  3TAP A;  4B3S J;  3W5Y A;  1D0E A;  1Q81 T;  3GU0 A;  3I5A A;  2A2D A;  2V67 A;  3A3N B;  1NDK A;  2W8K A;  1VQ5 S;  2ERR A;  3DOL A;  2B9W A;  3PTW A;  3UPF A;  4BHQ A;  1SKU B;  1VMB A;  3PW7 A;  1FVS A;  2J9E A;  4ECZ A;  3HCX A;  3MM8 A;  4K4X A;  2H5E A;  4DU7 A;  5EN1 A;  2BJ7 A;  5HO4 A;  3A4T A;  1TKX A;  3HP6 A;  2AX0 A;  3DOL B;  1O8B A;  2FVP A;  2NXJ A;  4IFY A;  4HI1 A;  3FK4 A;  3MM8 B;  5JJB A;  4B9N A;  1XR5 A;  1BQM A;  4X4P A;  3TR5 A;  3H5U A;  2M7S A;  3Q8P B;  1TKX B;  1ZAW A;  2R2U A;  2CJK A;  4AL5 A;  4HHH A;  2KN4 A;  3UCZ P;  1KN6 A;  4LIR A;  4ZPD A;  1NKE A;  5LMN F;  3IRX B;  4IFY B;  2QYC A;  4EBC A;  2HGL A;  1BQM B;  1V3R A;  4CDI A;  3MR3 A;  2XMV A;  3KMS A;  5DDO C;  3IR7 B;  4RUC A;  1YJ7 A;  4DX7 A;  2MZT A;  3QQC D;  1S6P A;  1J5O A;  2C2N A;  2FIU A;  4NI2 A;  1ZZN A;  1CS4 B;  1U49 A;  1XER A;  4AFF A;  1T0T V;  2DPI A;  1QVF R;  2JH3 A;  5GVQ A;  1VC0 A;  1NDP A;  3CCL S;  1Q82 T;  1F6T A;  4XPE A;  1T8E A;  2OTL S;  2Q6B A;  3CDU A;  1XTZ A;  2IM2 A;  3EVO A;  2VOO A;  1BHN A;  4FYX B;  1S6P B;  1J5O B;  2G13 A;  4NI2 B;  2NYH A;  4NLV A;  3NNC A;  4ZP6 A;  4C8M A;  2MKI A;  2JJ4 D;  2R7O A;  5KOW A;  1HBO A;  2ZWO A;  2JSX A;  1QAI A;  5KG5 A;  1WOP A;  3CCJ S;  1KTQ A;  2UUC F;  3O5T B;  2CUY A;  4J91 A;  3EGN A;  2XNQ A;  3T19 A;  1VRU A;  1YRT A;  4B3M F;  2J6T A;  5DJB A; 
#chains in the Genus database with same CATH homology
 2XYP B;  1QDU B;  4DCO B;  1RHK B;  5IC6 B;  3EDQ B;  4ZVR B;  2H65 B;  1PAU B;  1RHJ B;  5IC4 B;  3GJR B;  2C2K B;  3EDR B;  2P2C B;  1PYO B;  2XZT B;  3GJQ B;  3KJF B;  3NS7 B;  4ZVQ B;  2CDR B;  3KJQ B;  1SC3 B;  1RWN B;  4ZVU B;  4ZVT B;  3SIP B;  2QLB B;  1RWW B;  1RHR B;  2C2M B;  2CNK B;  2QL9 B;  2H5I B;  2CNO B;  2QLJ B;  2HBY B;  4DCJ B;  2C1E B;  2HBR B;  3D6H B;  2HBZ B;  3IBF B;  2Y0B B;  2H5J B;  2C2O B;  3D6M B;  1RE1 B;  1GFW B;  5K20 B;  3P4U B;  3D6F B;  2CNN B;  2H51 B;  3P45 B;  2H4W B;  1RHQ B;  2XYG B;  2H48 B;  2H54 B;  2QL7 B;  3R5J B;  1ICE B;  2QLF B;  1RWX B;  4JB8 B;  3R7S B;  1BMQ B;  1RHM B;  4ZVO B;  2QL5 B;  2Y1L B;  2DKO B;  3R6L B;  3GJS B;  1I3O B;  1RHU B;  1RWO B;  4ZVP B;  2CJX B;  1F9E B;  3R7B B;  3QNW B;  1SC1 B;  3R7N B;  1IBC B;  1RWK B;  2C2Z B;  3R6G B;  4LSZ B;  3GJT B;  2FQQ B;  1RWP B;  2H4Y B;  3RJM B;  2CJY B;  1SC4 B;  2XYH B;  3KJN B;  1NME B;  4ZVS B;  3IBC B;  1RWV B;  2CNL B;  2XZD B;  4DCP B;  1QTN B;  1I51 B;  2HBQ B;  1RWM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...