2CDRB

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 SUBUNIT P17
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2cdrB00
2CJYB 2H5JB 3GJTB 3KJNB 2CJXB 2HBZB 4ZVTB 4ZVUB 3EDRB 5IC4B 2H4YB 2XYPB 2C2ZB 2H48B 3QNWB 3NS7B 3SIPB 2CNOB 3GJRB 4ZVSB 1RE1B 1RWWB 2XYHB 3D6MB 4ZVPB 1RWPB 1SC1B 3GJQB 2H5IB 2XZDB 1I3OB 1RHKB 2CNNB 2C2OB 4ZVQB 3EDQB 3RJMB 2DKOB 4DCOB 2P2CB 1I51B 2H65B 4LSZB 3R7NB 1QDUB 1RHMB 2QL7B 1GFWB 2QLFB 3R7BB 1SC4B 1RWOB 1RWKB 4ZVRB 2CNLB 2C2KB 1F9EB 2QLJB 1RWMB 2HBRB 1PYOB 4DCPB 2H4WB 5IC6B 3P4UB 3D6FB 3R6GB 3R6LB 2QL5B 2Y0BB 2C2MB 4JB8B 2FQQB 2XZTB 2Y1LB 3GJSB 4ZVOB 1SC3B 3KJQB 3KJFB 3P45B 3IBCB 1RWNB 2H51B 1RWXB 2XYGB 2QLBB 3D6HB 1RHJB 2CNKB 3R7SB 1IBCB 4DCJB 1QTNB 2C1EB 2HBQB 1RHQB 2HBYB 3R5JB 1BMQB 1RWVB 3IBFB 1PAUB 1RHRB 1ICEB 5K20B 2H54B 2CDRB 2QL9B 1RHUB 1NMEB
chains in the Genus database with same CATH superfamily
3Q8YA 1UVLA 1M5PC 1J27A 2IAJB 1ITPA 3BQ1A 3KOAA 4F7VA 4UY85 2HSEB 2D41A 1S99A 1CS4B 4DU7A 2DGQA 1FRKA 2RNEA 1TKXA 1W2BR 4OV1A 2IMOA 2AIRB 4X65J 1RHKB 2VG5B 4JI0F 3NCPA 2V4JB 1FT8A 5BR8J 1RAEB 1VLYA 4PUOB 2DO4A 4MAKA 3PTWA 4ZIVA 3UD4P 1YI2S 2AZ3A 5KFWA 1TK0A 2AJ1A 3ZTOA 4PQAA 4X4NA 5KFFA 3QT6A 4JYAJ 3D6FB 1MROA 2I5JB 4KPYA 1WD6A 1N32J 1JK9B 4FYYB 2M2BA 2NPFA 4OFZA 1UFKA 3UN5A 1JLGA 4G1QA 4Y2MA 4LFCJ 1WKKA 4X64F 2YVSA 2B43A 3EPIA 5HI7A 4DV6J 2FZKB 1RADB 2GVDA 1HNVA 3BH7B 1VMBA 2OFGX 2F3JA 2R7RA 2LQ9A 5IWAJ 4I56A 5U47A 2Q66A 3AFGA 2VIHA 1KLMA 3A8EA 3BR9A 4CDIA 4QWEA 1RGVA 3NG8A 1Q5VA 4DSJA 1BWVA 1WF0A 4TY9A 3JSYA 3HXMA 4A46A 4LFAF 3WBZA 4MJKA 4O4GA 4NMXA 1H98A 5GADI 3KJVA 4IG0B 1M1HA 1PG5B 2YQ3A 2MTLA 1IBKF 4NWBA 3DGPA 2EFQA 1Q8KA 4F2SA 2KT2A 1ZTTA 4QOTA 3J7YU 2VG6B 2CPHA 3TX8A 1X9SA 2MGZA 2CWXA 3N6LA 2E1CA 4QIFA 4FP9A 3M8SA 1LKZA 2BM0A 2HGMA 2VBZA 3CF5Q 1PYOB 3PJ9A 4Q0BB 1FJ7A 1NZAA 1VQPS 2R7OA 3KJQB 1TK8A 3KTQA 5L38A 3SMZA 4ANCA 2J9EA 3GYNA 2NR0A 1NH8A 1UA0A 4DL3A 4UOHA 2XMKA 1X4EA 2XTJP 4AE5A 3MUTP 1RYRA 4B3TF 4NLOA 2KKHA 5HP1A 1NLKL 3GR0A 3MUVP 4H4KC 3K57A 4LR9A 3FUYA 1FJEB 2K3KA 2BE7D 4XTTA 3S01A 4OX9J 5D6GA 4PYDA 1S59A 2EG1A 3D6MB 2RVJA 3EVWA 3QGGA 1T11A 4NPOA 1TMMA 4X4RA 2CQCA 2GV1A 1LXJA 1K0VA 1UL3A 1SJ4P 1LFPA 3SEOA 3S1TA 2AU0A 2MJUA 3DHXA 2KXFA 3Q8QB 1NPKA 3DOKB 4MKBA 1RT6B 4DX6A 3M8PB 3FK4A 4LF8F 1VOMA 2YH0A 2GNKA 4I64A 4Y6IA 3G8QA 3FNNA 3SZ2A 4ZK7M 4KIAA 4UQTA 1UETA 1H7WA 2MQLA 8RUCA 3P3DA 3PW5A 4YOEA 3FKBA 1EKSA 3L7PA 4DZDA 1V9OA 5MLCV 3AODA 4FXVA 2FY1A 4C97A 1UJ6A 3M8ZA 2W9BB 2CRLA 5I3UB 3SYZA 2KU7A 4KKOA 3QSYB 3ZNUA 4OLOA 2VC0A 4WCEQ 2ZH5A 3LOUA 4ED3A 3BS9A 4NLXA 2M8HA 3GFZA 2MKJA 3J80Y 1NM2A 4O3QA 3TNVA 4JP8A 1HNXJ 1U6BA 4ID8A 3N5FA 1EZZB 4DV7F 1Z4UA 1S4EA 4HT5A 2E7WA 4E98A 1REVA 1VQ5S 4URSA 4KR0B 4RU2A 3HT3A 4ZVOB 1MLAA 5K9FA 1UKUA 3MM6A 4Y2KA 2ZBRA 3F44A 2QIFA 1JLBA 1S6PA 2RHQB 3SFGA 2M7SA 1MWZA 1IKXA 4RBTA 3W8GA 2I5JA 3W8PA 4F04B 4CLSA 1DLOA 1DQ9A 2AEMA 3IBFB 4KGXB 3NGSA 4LF7J 3VAGA 2CDRB 4ECQA 2R8GA 2DHGA 2YXLA 4KTQA 4ED8A 1M1KT 5IC4B 4C6AA 1VCTA 3HD1A 3PIPQ 2KVQE 1AW0A 1HYSB 1OY6A 1YHQS 2CVIA 4LSLA 4PG6A 2RSQA 3RR8A 3SCIE 3CD7A 2NCKL 2CDQA 1I6JA 2FJXA 4ZVQB 3K8WA 1T05A 3HHDA 2A18A 5D4NA 2HQGA 2OUGA 4IG0A 3Q2SC 5ETQA 4TY8A 3HHLB 5HROB 4ZCLA 1H74A 5IV3A 1RWMB 3IM8A 1NJIT 2GQQA 1EAYC 2VG6A 2ZH4A 2ADBA 3A8KA 4OHVA 2XNRA 3A8JA 2DGTA 1SVDA 2RDDA 2V2QA 3DLEA 4DQPA 3M2RB 2O66A 2QC3A 5J2QB 1YGYA 4H54A 1NKBA 1G1XA 3JXOA 2FGCA 3IRXA 4BWJA 5AE2A 1QTNB 4L3KA 2HFNA 4PABA 1YX2A 2FDNA 3S6EA 2XM3A 3CJ5A 1A0OB 4CLYA 1JLQB 4OYIA 1F5CA 1EETB 3UWTA 1YBAA 2XYPB 4ZPDA 2HGNA 2NUHA 3GV8B 1HWIA 4DR2F 2UVVA 4FZVA 5GAHI 3H5XA 5KFLA 2RS8A 2AJQA 4LRFA 4EYHB 5KFIA 5K8NA 4DQRA 3MPVA 3LGNA 3OXGA 4HTIA 3I6PA 4LF5J 4CLTA 3SV3A 4IKAA 2C42A 1T02A 1FX2A 4K8RA 4NZ0A 2HZAA 1AFIA 4YB7A 2D3OR 2HQDA 3QZ7A 2IRXA 2XWYA 2XQCA 1TL4A 3N79A 2M52A 3KDOA 2ZVSA 2C2NA 1FE0A 3H4BA 2W01A 2CNKB 4XPCA 1HR0F 1V3SA 4OYBA 3EM1A 1ZETA 1R8AA 2RB7A 3MM7A 4HKQA 2DXFA 5EX0A 4GVBB 2HHQA 1WNEA 3EPGA 4XDCA 4C11A 1S5ZA 4NLWA 4PWWA 1YIJS 2ZEJA 3FRYA 2NQPA 5KFCA 2XMMA 1L3TA 2BE2B 4LRAA 2B9YA 3TZXA 3MEGA 2WZ1A 4IDKA 2H5IB 3M9OB 1RBLA 4GKKF 6FD1A 3MR5A 1S79A 2M3DA 3BV8A 2DT9A 2M8DB 2ATCB 2MQPA 2W9BA 1PBAA 1V5VA 4WK3A 2XY6A 4I68A 4C0BA 1MMLA 3G6ES 4DBQA 3O44A 3ENWA 2C22A 4R0JA 2Y0BB 2ZJQQ 4OHYA 2J6SA 4MYUA 3WIUA 2VICA 1CQNA 5ETSA 2YWHA 3T19A 4ED2A 1VBKA 1BD6A 2BRKA 1PO6A 2QSWA 4DCJB 1NK6A 3HD2A 1PYTA 3DRSA 2NXEA 2MXYA 3TYTA 2HYIB 1Y9OA 2VZ9A 3ZZYA 4OYWA 3F56A 3UFCX 4YFUA 3R9LA 2ZM6F 4U8VA 3DOLB 3NS7B 1KRPA 4PG7A 2X51A 2CPJA 3M4XA 3GG0A 3QLHB 3A1YG 5D0EA 3LP1B 3PYDA 1RTDA 1DJ0A 4J5OA 4CNYA 2J7WA 1BY9A 2GIRA 3NS5A 3PXGa 3MEDA 5A8WB 2JWNA 3BGRA 3CJ8A 1WHXA 5DQHA 3UD3P 2APOA 3NGKA 4NXNJ 4K5RA 3D3BJ 4U8YA 3DM2B 1NK8A 2FHJA 3HHLA 4CO4A 4ETZA 3IRWP 3CE8A 5HROA 5CYJA 3MMBB 1CJUA 4ZDNA 4LFBF 4BDPA 1PILA 2GJFA 1UVJA 2CFXA 3G86A 3KKFA 2FYXA 3HKZD 3MAAB 3CIZA 2UXCF 5G0RB 1RAHB 2RMLA 5J2QA 1X8DA 2I2YA 5D4OA 5KG1A 3IMQJ 4LT6A 3THVA 1ZPVA 2VOOA 3TQ1A 4JBCA 2BJDA 1CJTA 4ES2A 1EETA 4E0DA 4IR1A 1KTQA 2OLWA 1Q81T 1WTFA 3DDIA 1R89A 1HNIB 2EC0A 2OI2A 1F0XA 2OELA 1EP4A 3AB2B 4CH1A 5T7LB 3HVWA 2R2RA 2HMIB 5BJRA 1UW9A 2DHXA 5DJBA 3TZWA 4J9OA 1FNOA 2GO8A 1R43A 5KFXA 1WC0A 2RQMA 2HAFA 2BE9B 2B4UA 1E6VB 4P74A 5IT4A 3TW0A 1LNQA 4NEYA 1NEEA 4RW8A 4NLGA 4ZMMA 4F3MA 4UZBA 2DNYA 4ED6A 1LW0A 3EDRB 2ERRA 2OPPA 1SH2A 3TOQA 1RT7B 3AD8C 3ZTPA 2QFJA 3DXSX 1RDRA 1U1RA 4F25A 4J7CA 2N82B 1S6UA 3W63A 2F40A 4KHPF 3R5DA 3DDNA 3MR7A 1TMJA 2VHGA 4CT8A 1U6ZA 5IM0B 4I2QA 5KFDA 4RW9B 3A3NB 5DG8A 2VQEF 4C98A 4OI0A 1KWMA 3FMWA 2IA0A 1DRZA 4O44B 1VISA 3UR0A 1F9FA 3UDCA 3UCGA 4CRJA 4RR5A 2YKOA 2UVUA 5B0FA 1S0VA 3GTYX 5K5MA 4EO8A 4O3SA 3DYAB 4Y34A 4DPUA 1M5KC 3M8YA 3QFHA 1LK7A 2CIMA 4ECXA 4DG1B 1KEKA 3OFGA 2JEFA 3C6UB 4HYKA 1XIQA 2R2TA 3UI3A 1T9VA 4IO1A 2QT7A 2RE1A 5E5NA 4EU0A 3ULHA 4A8MP 2O3DA 2KDOA 1XR5A 2YKMB 3EVMA 4ED4A 2QE5A 2A0FB 5E0OA 4ZA1A 3M32B 5L9XA 4ATNA 2FLPA 3VCDA 1S57A 3CULA 2V8VA 2D9PA 4X65F 3U1NA 2RKIA 2LA6A 1MW7A 1LK5A 1TUVA 1JNRB 1U0HA 3IR5B 4OYZA 8AT1B 1DQ8A 1M5HA 2YWFA 3MAHA 2E44A 2FHOB 4KJIA 3KFWX 2UUBJ 5C2GA 4LR7A 4NRTA 5F8MA 3GIIA 2YKPA 3QGPA 1N32F 1C1CB 2VC1A 1AFJA 4LFCF 1FKOA 4ETXA 2VONA 4QYRA 2B6AB 5B08A 2O01C 3GYGA 2OTLS 2Q43A 3LP2A 5IOLA 4CO2A 3RBXA 3Q83A 5IWAF 3SCLE 1SIWB 2Z56B 4UTGA 1H2UX 5CYMB 1CLFA 1MMDA 5J1NA 3VZIA 2X1GA 1JJ2R 1WACA 2AEFA 5IT0A 1WF1A 2KG0A 1RWWB 1DTTB 2E5IA 1XJWB 4PAAA 5A8KA 1N36F 3QRQA 1VRQC 4ANDA 1YWXA 1U1LA 4RWXA 4MFBB 5D4LA 4Q7AA 3IG1A 4QR1A 2WTFA 5CZVA 2CJKA 2XI3A 2DGXA 3L09A 4IRDA 1IBLJ 1TL1B 4PWUA 4QQBA 3QGHA 3EE3A 4NZ6A 4RLEA 5B09A 2WK4A 2V6AA 3HSJA 3HM9A 1CJKA 5IC6B 6AT1B 5DZ6A 3W9HA 4FN5A 5KFOA 3Q86A 2OMOA 2OEJA 2QSFA 3SDEB 2VFSA 1X4GA 3ILLA 3UR3C 2EKYA 1KC8T 2HMIA 2G1DA 3M6VA 2DRAA 1IKWB 1QE1B 2ROGA 5SZTA 2X1FA 4URQU 1DARA 5T41A 3LQVA 3CCVS 4NA2A 1DTQB 2YKNB 3MCSA 1RA7A 1M5SA 1RT3B 4FPRA 3ELHA 3MCNA 3IBWA 2GX8A 4OX9F 1S10A 4UQGA 1S1TB 1YSJA 4RW6B 5KG2A 2K7KA 1XQIA 3VGTA 2PFFB 4FF4A 5HK4A 1F9HA 3CCQS 2CZ4A 1SL2A 3KLHB 3I5BA 1LW2B 1DHMA 4YHHJ 2FGOA 4OX8A 3M8RA 4KFBB 3GFYA 4ECZA 2XS7A 2RU9A 4KGZB 4FYDA 5IM0A 4U67Q 4CWBA 1YZ7A 4F0KA 2HNYA 4HVZA 2KHDA 1S9GB 4A8FA 4HTJA 3G6YA 5KFYA 1F3FA 1RT2A 1U1OA 4UOCA 5IS2A 2DGOA 2DYAA 2ACMA 4RL1A 2CQGA 4DR1J 1N88A 1H7XA 4DN9A 3PKYA 2FB0A 4ERDA 3PX4A 4BHQA 2OPSA 4QYZK 3IR7B 2XGPA 3NNHA 5DM7Q 3AJDA 3PIOQ 3NGUA 3CC2S 1A9NB 2FHMA 5F0WA 1QDUB 1IR0A 5K14B 1HNXF 2FZGB 1P1LA 3MMAB 3WZ0A 4Q43A 1W2IA 1S0NA 4FDFA 4HR2A 1GAOA 1UVKA 1UAWA 2CPDA 5J2NA 3MD3A 1IKVB 1Y5NB 1YVFA 2EXUA 1CSJA 5F8IA 2W1BA 5KG5A 1TK5A 4MK9A 2HS0A 4PWDA 4ZIWA 3EGWB 2KZZA 4M5GA 2VOPA 4C0OC 2V94A 5B0DA 2QA2A 5D0GA 4C8LA 3AQPA 1RKJA 3KUEA 2BACA 2FJAB 3FBFA 3OFEA 1PC5A 2NYIA 4CTAB 2M70A 4LIRA 2C2DA 4QU6A 3OBIA 3HZEA 1B0PA 3G4SS 4OI1A 4JOUA 2EFNA 1C4CA 1K1SA 2N3LA 4X66J 4GO7X 3V81B 4Z2XA 4Q5VA 1WJ9A 3R7NB 1Z2LA 2W24A 3FEYB 2XCPA 4DL7A 3D0IE 2V4RA 4QYZJ 1S9EA 5C24B 4NI2A 4CM0A 3HFZB 2FVQA 4K0KJ 5KFZA 1REGX 4ID5B 4ALZA 4BC7A 3Q24A 1KR4A 1JMTA 3TP2A 4N76A 3F41A 3PX6A 5E33A 1TL1A 2ADCA 5GADU 4CLZA 5IT9U 1FFGB 4UUXA 3KYLA 4F4ZA 1FNXH 1CPZA 3JSBA 1RTZA 1NSQA 4LF1A 4CM2A 2VBYA 1UWBB 3SDEA 1S1WA 3MXHP 1S9FA 1GX6A 2DH9A 4B02A 1FK9B 3O8WA 2VFRA 3W9JA 1FWPA 3FCWA 2H4YB 4UF4A 5DQGA 2WAQD 3W62A 4RPFA 2VG7B 5LJ3Y 4YB5A 2LDYA 2E5JA 2BA9A 2ZD1B 4DZ6A 5HSPA 2J0QD 2YNHB 4XIUA 4B9UA 3PACA 4DX8H 2KFNA 1YJVA 2YKNA 3THPA 2JSXA 3GYXB 1AUSL 4QJVA 4YR3A 2AV5A 3C66A 1RU2A 4J91A 4OYPA 3M8WA 1OY8A 2FLOA 1T9TA 2HBRB 3CDWA 1GH8A 3TRGA 4RW6A 3PKMA 1XN9A 1G4CA 3MMJA 3VVTA 4M5KA 1RAGB 3EGVA 3KXDA 3KLHA 1LW2A 1FHTA 4LBIA 1K9MT 3MPWA 4QPXA 1R31A 2ZH9A 2XS2A 4K4WA 1RTIA 3RZAA 2AYEA 2ZFHA 1JLFA 3CC4S 2GJIA 2QA1A 3K17A 1MU2B 5F9NA 1IXKA 1FXLA 3AB4B 4R25A 4OI4A 5LT5A 3T5LA 5HJYA 5BYRA 5CHCB 1FKAF 1EIYB 1F5AA 4RWWA 3BO3A 2BANA 1XNQJ 1PSDA 3A3PB 1AYEA 1BQMA 2DB1A 2FZCB 2CA9A 1SI9A 1YDLA 3IC1A 2JVOA 4USIA 3LTOA 5A8RB 2WOMB 3PCOB 1AZSA 2MZRA 5E2QA 4NL5A 2JJ4D 2D3ZA 3B82A 3UVJB 1UEKA 2I9SA 1UEUA 1SH3A 1Y4ZB 2KN4A 4JI1J 3BGLA 3JS9A 1ZH5A 1X5PA 1DY3A 1K1QA 4AXIA 5CZXA 4EBDA 1HQEB 3GJSB 1CULB 2F7VA 2XSJB 3ILOA 2AKWB 2IIHA 2OPQA 2MQQA 3J81j 3UNGC 4CP5A 4PG4A 4WU3A 2N7CA 4LREA 1MSWD 1KFDA 3NAIA 3M9NB 1FRXA 4RJVA 1RWVB 4DV1J 4B3MJ 3OD2A 1VI7A 5KT4A 1WTBA 5CCMA 5LJ5Y 3ZC4A 2PMHA 2P8IA 1JLAA 3TR5A 3VAIA 2C2ZB 4HHUA 2ZWPA 4NYOA 4M95A 5M2UA 4A8SA 3I5AA 2N4DA 2HNDB 1JLCB 2GVZB 2ZHOA 2JOQA 1T95A 4ZPCA 3I0RB 2MLZA 1VR6A 5LMUJ 1EHWA 1WHVA 2XMJA 1C1BB 1VQMS 1O8BA 3IO1A 1BQNB 1B7FA 3TARA 4CTAA 4I69A 4KSEB 3CDBA 2G0CA 4DWIA 4P10A 4DFPA 1LWEB 3CD0A 6FDRA 1DZ5A 5DS7A 5LSLA 2OAUA 2R4FA 2YBVA 2GFFA 1WUUA 4R8UA 4NXNF 3JAMU 2KFZA 3GIJA 1QAIA 1GMWA 3EX7B 2VV5A 2MY8A 1FXRA 3CIMA 1T3NA 1SV5B 3FZ2A 3IXQA 4ZPVR 4C8ZA 1H73A 5HATA 2ZHBA 3HO1A 1XWLA 2JX2A 2Z8QA 5CD4A 2B4PA 2DNMA 3IR6B 3FDSA 4DPOA 2FVSA 3CCLS 2XS5A 1ZM2A 4EEYA 5CXTA 2HBZB 4ZVUB 4GO5X 2OD4A 3PEHA 2ZHAA 3OXFA 4HEA9 5I3QA 2OPRA 1UWBA 3BDEA 1V5IB 3CTRA 4QZVB 3RAQA 2IRUA 2B51A 3BJYA 4O0IA 3Q22A 3CXCR 3BSCA 3TI0A 4LMZA 5IT9Y 3NBPA 2IC3A 4FXWA 1NK5A 1FCAA 4RX6A 2RF2A 5EWFA 2DITA 4OYOA 1X4FA 3UDVA 4H4KA 4DR5F 4NLDA 2OIHA 3H2VE 2HFOA 3NS6A 3KK2B 2UXDF 2CJAA 4B3SJ 3E01B 4JV0A 2PFDA 1RXOB 4ZP9A 1D1UA 2VPYB 2LVWA 4ES1A 3D0GE 3BGOP 1S6OA 3CMAS 2R8KA 1TKZB 1JWWA 3D6HB 4ED5A 2A2DA 1C0TA 1SQGA 3BQ2A 5J2PA 3SQGB 3RRKA 3TAQA 1FXDA 3L4BC 2HVHA 4KHMA 4QW8A 3H5YA 3V5RA 2BBEA 1FRHA 1NHUA 2HVDA 2XEXA 2B3TB 3W61A 4F4WA 2GHPA 4LQ9A 1EQMA 3LPYA 1TKDA 1N34J 2VB6A 2WVCA 4D3HA 3TJ9A 2K3IA 1FESA 2XSFA 3N6MA 3QAEA 3JTNA 5E3AA 3AJ2A 4C8NA 2GO9A 1K0TA 2DKOB 4ZVGA 2JLGA 5J1EB 4DPTA 2A6MA 4M94A 5HBMA 1H2VZ 1DURA 2LXFA 1GQEA 1B0VA 3PW0A 2LQBA 2BQUA 1LXNA 5ETRA 3PZPA 3QIPB 2ASDA 4L6V3 3FJ2A 2N4CA 2BX6A 4WXWA 3TVKA 1BGXT 2E1RA 2LDIA 2O67A 1F6TA 4EZ9A 2QV6A 2IFXA 1RHJB 5ITHA 3ZTSA 4IG3B 1DAXA 2VJVA 1CULA 1B0TA 5ETTA 2IRYA 2XY5A 3AOCA 4W90B 3TAMB 2IYIA 2YNGA 4QIWD 2RIJA 2DD8S 2WONA 3TWZA 3Q8RB 3E51A 1NK0A 3MM8B 2HHWA 1R8BA 1F5BA 1N52B 2RHSB 4ECSA 1TU0B 3KLEB 4B9VA 2ZZNA 4ICLA 5HMXA 1FA0A 4J90A 3HSGA 4KHRA 3E2EA 3DMJA 1HWKA 2IVFB 3MOJB 3MFHA 4NASA 3ITHB 4NE9C 4RO0A 4OJ3A 3HVTA 1WC1A 2XNQA 2GHWA 4K4VA 3DC2A 4USKA 3T6JA 3I0SB 1RYSA 3RAXA 2UUBF 1TKTB 4LSNB 2YX4A 1JJCB 1WWHA 1EX8A 3QJLA 3A3OB 2PE8A 2R7WA 2ALYB 3OPKA 2G13A 3TJAA 2X7IA 1VK8A 2ZOFA 1X4CA 4UW2A 3OVBA 4PXDA 1VQSA 2MZQA 4WP8A 2UXBF 4OJ1A 4ZJOA 1SQEA 2ZE2B 1TELA 4WFAQ 2XYHB 3H2LA 2QYGA 3JAMY 3G96A 2MKSA 1OWXA 3T9ZA 2CPXA 3LA0A 3VAKA 1RHMB 1EKRA 2G2YA 3OJSA 3ZZTA 1NJZA 4B9SA 2BXJA 4PR6A 2CG4A 4Y0FA 4MKYA 4KY3A 1MNEA 2X1BA 3MPUB 2NXUA 3P45B 2Q6BA 4TU8A 2OSQA 1NHKL 1U2RA 3KK2A 1KQFB 2ZUAA 2E66A 2J9CA 3BSOA 1WKLA 2CG8A 2FUG9 2O1PA 1N33J 1WF2A 4ZVFA 2OKQA 1X5SA 2YWGA 1X5TA 3MTJA 2IJNA 5T14A 4USHA 2DGUA 2IDLA 2ZJRQ 2QMXA 3IWXA 2HLTA 4K4YA 5THWA 4ED0A 1LWCA 2AWZA 3DRPB 3QATA 1FKPA 3TUIC 3HMJG 3O1LA 1UVNA 4ECUA 2L08A 2CYYA 2B5JB 5C7PA 2MMYA 5D8HB 2JC0A 1VQNS 2J6UA 3D1HA 3NMAA 2JHEA 1OMSA 4K50A 3TA0A 2E5LF 2DBBA 2ZNYA 2QLJB 3R27A 1U45A 1HL6A 3OHBA 2LFVA 4YHHF 3C16B 1HNWJ 3MPYA 4AFFA 2EK6A 3HPOA 3LWLA 2KHCA 4P52A 2MZ1A 3DLBA 3KG4A 5GMKa 1FD8A 3G6XA 1D8YA 2NXCA 1KFSA 1KQKA 1UEVA 2HBYB 2V9WA 2VFTA 2DCUB 3CO0P 1CJVA 2J5AA 1NBEB 3PYFA 1P27B 1U26A 3AXMA 3MDFA 3J7Z5 4NCBA 2Z2MA 3LGMA 4FVMA 4KE5A 3G8TA 3U27A 1AT1B 3DLGA 5B7WA 2IVMA 4XK8C 1JLEB 2HG4A 4CLWA 4DR1F 1C0UB 2LECA 4YB6A 3I56S 3G87A 2DO0A 3MECB 3KK1A 3K89A 2AGOA 2PN6A 4C3LA 3GV5B 4OZLA 4DL2A 2H5EA 2Z2ZA 2FC8A 4FKXA 4DOZA 3RR7A 2LEPA 1FJGJ 5KFEA 1OO0B 2E1MC 4AL7A 2WSCC 2BKPA 2BEFA 2FHKA 3R97A 2JRSA 3ITHA 1TKXB 4P9SA 3H5UA 5J1PA 3C46A 1U09A 3PFOA 1C4AA 4GC6A 2HBQB 2YKQA 3I96A 5M2RA 3QFWA 3DKDA 2P6SA 2DNQA 4RKUC 2BJ3A 3D9BA 2W2NP 5C42B 1DQAA 4P73A 4I6AA 3DRYA 2DGWA 3KDNA 4JI6J 1MROB 2KRRA 4B9NA 3VZHA 1LWXA 5EGYA 4L76A 1LEOA 5KFQA 3RRGA 4HHHA 4DI6A 3PR5B 4K7QA 4G1QB 4CLLA 5GAGI 5LXYA 1PGZA 4B9MA 2MSSA 4AT1B 2B4OA 2GVDB 5HN0A 2ZE2A 2P5VA 5FLXU 4WXOA 3VGSA 4TU7A 4X66F 1KLMB 1WG1A 4KH1B 5J2MB 2IBOA 2LCWA 2XHCA 5DG9A 3I55S 4CO5A 2XZTB 4K0KF 2JEGA 4O4GB 3KJVB 4QR0A 3PHTA 3MCMA 2FLLA 5CABA 3KLFB 1YRTA 2YNFB 3DGPB 1VHFA 4K2JA 1JKHA 1IBCB 1SL0A 2MKCA 3OW2R 2MGZB 2DIUA 2OEMA 4WFYA 1FDDA 3V6JA 1PJ5A 2KG1A 3RW7A 1UZHA 4FKYA 4OZ5A 2AD9A 2XO6A 3DFEA 4P2MA 4U7UK 1XR6A 2X3GA 1TFWA 3HHEA 1U1NA 3VWSA 3Q8VA 1VQKS 1NB7A 1FFWB 1KOHA 1R7IA 3DRPA 2AMCB 3SSRA 5HP1B 3R5CA 4RZRA 3VHQA 4LRCA 1F9EB 4LQ3A 1RU1A 1X60A 5AXLA 3FGVA 1T03A 5KT2A 1Q5YA 3LP0A 3H98A 2HS3A 2CQBA 4CYUA 1NH7A 1D8ZA 4NZ7A 1RBAA 3OFHA 5DO2A 1VQOS 2OO4A 3BBCA 1VIXA 4JI4J 2KTQA 1YQHA 1ICEB 2RJZA 4J9UE 3G9CA 3RBDA 1VIOA 2EW9A 3GCXP 3W64A 2P9GA 2RRNA 1U49A 3CJQA 5KT6A 5KT7A 1B99A 3CPWR 1NSKL 2J9DE 1IM6A 3DU5A 2AX1A 1KLNA 4USUA 4QPTA 5JJBA 4HI2A 1KQGB 2J7KA 3OHAA 4RW4A 1Y11A 1L3KA 3C8YA 1Y00A 3FFIA 3W9IA 2G0IA 3DI6A 4LF6J 1GTHA 2MEWA 3GPAA 2PI4A 2BUNA 3KHGA 4GKJJ 2C28A 1HBUA 5GVQA 4AL6A 4RBUA 5KOWA 1G3OA 1IN0A 3MMCA 2GAGC 2CPEA 5KG7A 3PNIA 2EC2A 4WTYA 4C8MA 2F8MA 1KVIA 4I6YA 4EGLA 1L3UA 5D3GB 4U6PA 5F41A 4AQYJ 2F9DA 2VA3A 1HWLA 1SXLA 5HQMA 2C2RA 1U4BA 4DV1F 4B3MF 4U95A 2JEJA 2BOAA 1ZM4A 2Q1LA 3OQ2A 4WFNQ 2H5JB 4JUZA 3GJTB 1LWFB 2HIYA 1REVB 4MK7A 3PEJA 2KT3A 2V2VA 4CI0B 3Q8SB 4LF4J 4DX7A 3PW2A 2CNOB 3HX9A 3QO9A 4OQJA 9RUBA 3MM6B 3VVUA 2QLXA 4I4BA 5C42A 1JLBB 1S6PB 3RB4A 2MB0B 2YPYA 5F0UA 1Y0HA 1IKXB 2PI5A 2DH7A 2HW3A 2Z2LA 4RUHA 1DLOB 4DR3J 5LMUF 2DNRA 2HHVA 4V1Ak 2Z0GA 4LSZB 2KO1A 4EFAC 2QG9B 2JFDA 1VBYA 3TUPA 3GSDA 1X9WA 2DR9A 3BDPA 3QWPA 2C2MB 2JL9A 4K4TA 4FF1A 3U02A 4UT4A 2D3UA 4BCAA 5EUHA 4LSLB 4K4ZA 5J2MA 3CMQA 5ETMA 3MEEA 1P6TA 3GU0A 4NLYA 3KNAA 1EARA 1T05B 2MHNA 2LQ8A 2W9CA 1CBKA 4ELUA 5AE3A 1T0TV 3ET6A 4X64J 5FLXY 4NA3A 1ZZFA 2VFUA 4TY8B 1RCOB 2HHPA 3EZ5A 4W98A 3KLFA 2YNFA 3G82A 1HLWA 1HBMA 1VYAA 4ZS6A 1U8SA 4A47A 2WVDA 4ECRA 2M4MA 3UCUP 2OSRA 4KH0B 3DLEB 1HWJA 3J7ZT 3ZZUA 3MWBA 5KFKA 3IRXB 4OJHA 3BPSP 1HBOA 2AEJA 3LO3A 3VGUA 4LRBA 1H2TZ 2MLYA 2YPZA 4OX7A 4O3OA 1YJNS 1IBKJ 4PXEA 4F4KA 2JC1A 3HK2A 3ZZ0A 4EO6A 4Z7CA 4FPIA 2DEIA 3MR2A 2ACYA 4C7QA 1T94A 4B3SF 4YQWA 2CPYA 1QJHA 4ZP6A 2KXHA 4EUVA 1K73T 3T5JA 3ZXWA 2L9WA 1X7VA 1ZAVA 3Q2TC 5L1IA 2MHEA 3Q0AA 4ECVA 2AQ4A 5CQGA 2RU3A 3C19A 2K06A 1WORA 2V63A 3OR2A 1Q8IA 5K8OA 2RS2A 2UUAJ 2HURA 1JXLA 1YRUA 2B7CB 5F8GA 2KB2A 1RT1B 4ZPBA 4NLVA 1WSVA 2LXIA 4FYVB 3V6DA 2L3MA 1XBWA 3SSSA 1UCNA 4X4UA 3CJ3A 4GVLA 2A2CA 1N34F 2GGPB 3PFEA 4ZKAA 3JYTA 4WIIA 1B64A 2BOPA 2B4VA 3BM7A 2R2UA 3UNYA 1B4SA 1FRIA 1FE4A 3PR4A 4C4WA 3NMRA 3MM7B 1CC8A 5C5JA 1L3VA 3KLIA 2IYGA 1F2HA 1XMQJ 4C11B 2DPJA 2DGVA 4NA1A 2ZH6A 3CMES 3QPIA 1R27B 1P9YA 3MEGB 2DR5A 4IDKB 3MR3A 4PPDA 4DF8A 3MM9A 3NEKA 1IQZA 1HQUA 4W4MA 4F4AA 4DLEA 3L7OA 2DRBA 4ED7A 5KFAA 1J2VA 4V19X 3K5NA 1VRUA 5D3GA 2KL8A 2ZKUA 4J9KA 1FWKA 2NZ4A 4C3MA 4PRFA 3S8SA 4M5LA 3QSIA 2PMZD 3UD5A 1IBMF 2HVIA 2OMLA 3K5MA 1LWFA 3TJ8A 2JFKA 4KAIA 3HDSA 4IOBA 4WKYA 4YUDA 5LXRA 1EB0A 1M90T 3DRSB 2HHHJ 3EGZA 2CJQA 4TQRA 2G9OA 4W92B 1RWOB 3FC9A 4CLPA 3O5TB 3FCVA 2BW2A 1ZBTA 4J9MA 3HLUA 1N5YA 3N28A 3ETOA 2E5GA 4DV7J 4X2BA 1I1GA 5CD4H 2Y8YA 5DLFA 4ZP7A 2V67A 5IXUA 1Q16B 4ILRA 1RTDB 4QWAA 2B9XA 4QR2A 4X4QA 3VF0B 1BMQB 3W1YC 3MEDB 4ZCMA 4RUCA 3BGRB 4ZLNA 2BM1A 1HI8A 2Y1IA 1UPPA 1WHWA 2RRAA 2ZH7A 3PJWA 1J5OB 4J37A 4Y65A 3CT9A 2RH3A 3UQSA 4WPAA 2C2EA 2RAQA 4DV2F 1RK8A 4HLBA 2DCLA 1CJUB 5KG3A 2FD2A 4OI2A 2CNNB 3VTIA 3KLGA 1S1VA 4CO0A 4TVAB 3PX0A 3HSZA 2O5DA 2DHAA 3R7BB 4YP3A 2HVZA 4IRCA 5EWEA 1WOPA 1RUSA 2OEKA 1WHYA 5F8HA 2OGUA 1MMNA 3ONQA 1YBTA 3FVYA 1CJTB 1RWUA 2MQ8A 2Z4PA 4NLTA 3ENQA 1N33F 1IKYA 2VDIA 4QW9A 3H8YA 3MZIA 3BN4A 1EP4B 3W5XA 3HFKA 1S76D 2XCAA 4UY8T 2NSBA 2R8HA 2QA4G 2H1YA 3V4MA 4E8UA 2FY8A 1NPPA 1V3RA 1RT1A 3CDEA 4DPXA 3V6KA 4DR2J 4JI7F 4RW8B 4OHXA 3QRRA 2GGPA 1TV6A 2BQRA 2QJ3A 5L8RC 4ZVRB 1YJ9S 1LW0B 3D3CJ 1S1XA 1RP5A 4NLPA 2OPPB 3IAM9 1KS2A 2LP4A 3QAUA 3BF4A 4ZVHA 4YS2A 2U1AA 1O5JA 1NB2A 5B0BA 1HNWF 4RW7A 5DETA 2RQKA 1UW4A 3EICA 1Q53A 2H3EB 2F65A 1UVMA 5DG7A 2DNHA 3L7UA 3R5JB 1IR2A 1NHVA 4WWSA 3OSNA 1Q78A 1RJJA 1XK8A 3F73A 1O6XA 1LQ9A 4I2QB 5HANA 1EJ7L 4U9RA 3IM9A 3KMQA 2MLXA 4P2FA 5E3RA 1QSYA 4BS2A 2MZTA 3UN3A 1HQ2A 2ILZA 4JI3J 2HNZA 2ROEA 3KHRA 3JB9k 4M8LA 4DLGA 4DV0J 4C48A 5GAEI 1K44A 3D5MA 3DU6A 2HGLA 1OQ3A 4Z7YA 3OT9A 2F5GA 5CCLA 4JI5J 4CLUA 4P72A 4M1KA 4XO0A 4ZITA 1R0AA 3DHWC 3T1HJ 3CJKA 1T3OA 2VQFJ 2UUCJ 1FJGF 4IH6A 3OTEA 3OVSA 5KFMA 1N5SA 3DRXA 3THTA 2P6TA 3TUJC 3CUNA 4TYBA 2HHXA 3CSKA 5HVHA 2BYCA 2CQPA 4KGKA 3KJFB 4FF2A 2PGCA 2H51B 3SCJE 3AQOA 3AH6A 4JV5F 2CQ1A 4QU7A 2BW7A 4DFKA 3OUYA 4LUBA 3QGIA 5L46A 3V6HA 1LOUA 4DPWA 3HJFA 3KG1A 3RBEA 4ECTA 5DZ7A 2RKIB 4DUZF 2GAHC 4I1TA 3VR1A 8ATCB 3PDNA 3RUBL 1U0HB 3BSAA 2UVWA 1SCJB 4KRWA 2CKWA 5I42A 2W9AA 4A4JA 4JI6F 4FYWB 4X4OA 2EFOA 1HI0P 4WE1A 4NLQA 2M88A 2B8PA 1J5OA 3CJTA 1GMVA 3DOMB 1FKOB 2WVEA 4LR8A 3WX8A 2PA3A 3MOZA 4DR7F 2CPZA 3LP2B 3IN5A 2U2FA 3OTDA 2WSFC 2CQ0A 1X4BA 3W66A 1FRMA 4ER8A 1NJXA 2YWKA 4DL6A 5KFBA 3N4WA 2JLEA 2PA8D 3M2UB 1UFLA 1XTZA 5A8KB 2WCXA 2K2PA 1TVRA 3W5ZA 1KSPA 2J0XA 3IG1B 1RAAB 2WBMA 1RA6A 1WOOA 4Y2CA 3MAQA 1S0OA 2MKYA 5LOQA 4AD6A 1CJKB 3KUHA 2KJVA 2HZVA 2GJ2A 2V8PA 3I31A 2UXCJ 2XY7A 4ZLLA 3TUZC 1YRXA 3G6VA 3NOCA 4V19J 1T8EA 2AJFE 1I51B 3NOGA 3FEXB 1GMUA 5IQQA 1AROP 3GQCA 1OPZA 4JI8F 2E1PA 2DXDA 2ILYA 3R6LB 2C3MA 5EDWA 4TQSA 1UPMB 2BZ2A 4XPEA 2R8JA 1TUGB 2ZC4A 3BB5A 3L9ZA 3M30A 3W2VA 4RU9A 5DGBA 3JSMA 2Y1RI 2HWTA 1WC3A 3BKFA 1ZZNA 1CQMA 1WG5A 4NMLA 3D6TB 3RW6A 1FFSB 2NREA 4Y00A 4JI4F 1NUEA 4OZNA 5G4DA 3GP9A 2BQ3A 2IHR1 2XLIA 4Q8EA 3GONA 1ZTWA 2WVFA 2ZVIA 5DGAA 4CZCA 2AX0A 4YMEA 3SSQA 3TZYA 4DHVA 5CA5A 1XMBA 1TL3B 4IYQA 3AD9C 2D3O1 4TLQA 5L9NA 2XGQA 3M9MB 2BABA 2WB1D 3QIDA 2HNYB 1P8GA 4KC5A 2L48A 5HO4A 2LEBA 3N9UC 1YLXA 4J9RA 2P2CB 3PW4A 2VPWB 1PIEA 1RT2B 2DH8A 3M8QA 4IQXA 5E3PA 3ZZPA 4LF9J 2HWHA 2C2KB 4GKJF 3I87A 4WZQA 2FIUA 5BYSA 4ZJQA 4P2XA 3DDKA 2XYGB 2QLBB 2VQEJ 3LWMA 2FVCA 2N3OA 2XLKA 4KBIA 2OPSB 2EVZA 3O3LA 1JJHA 1OPIA 5ETLA 2W4DA 1WEXA 4ECYA 5K8PA 2KYZA 3GMGA 4F67A 2F8HA 1MWYA 3QJJA 4WYLA 3U7JA 1S4FA 1G6BA 2AJ2A 3RU0A 3PRDA 2M5YA 4HACA 3L3CA 4X84A 4M5HA 2XULA 4O0NA 3CJRA 3LANA 4M5DA 2HQCA 5BR8F 5J2NB 1CEZA 3RB6A 4LF4F 1T9WA 2MKIA 3CJ2A 1KP6A 4JYAF 3B4MA 4O3RA 2J8AA 1M1GA 3G2XA 1SC6A 2H65B 4FS2A 4PWDB 1KD1T 1SB6A 4KO0B 4DR3F 3E3XA 4ZPWR 2B9WA 4KV8A 3OL7A 3W2WA 1ELOA 2IDEA 2QLWA 1N6QA 1D09B 3DOMA 3C6TA 4DV6F 1QTMA 2F8EX 2FTRA 4NRUA 2GQ2A 3A12A 2E7XA 4ILLA 1RTHA 5GAGU 1URRA 5ETVA 1SL1A 4PQUA 2W8KA 1X4AA 3WIVA 3AHPA 4NOHA 3B78A 2ZBIA 3M2UA 5A6PA 1SUQA 4FVCA 2ZOMA 2BRLA 2UUWA 5KT5A 1S9EB 1S1UB 4ZVEA 4NI2B 4NEZA 1VHIA 2C3OA 3KJNB 2MPUA 4KYZA 2ZNZA 2OFHX 4HT7A 3CCES 4B3OB 3QNWB 2Z57B 4TYAA 1HHQA 1P9QC 4DJBA 3G71S 3K2YA 1XMOJ 3R8YA 1WG4A 2OP5A 1S12A 4URGA 3KNGA 2YH1A 1GNKA 5KFPA 1WSRA 2QMUB 1NNDA 1S1WB 4PCQA 3KK3B 1N36J 5C25A 3DGVA 2NSCA 5D78A 2VU5A 2GMJA 4ILMA 4JB8B 1D0EA 4D3GA 4F4XA 3DLKB 1HPZA 1Z2ZA 1U47A 3IAS9 1A7GE 2MY7A 4ANEA 2OD6A 1AXQA 4U7CA 1RAOA 2HQ3A 2DNKA 1QUVA 3RBZA 2FJBB 2UUAF 3AY0A 5HMYA 7AT1B 4LBHA 3QBCA 2LMIA 1U48A 4YR2A 4DQQA 3ADAC 1IQTA 2BJ1A 4IFYA 1RT5A 4B17A 1RTIB 3V4IA 2IJRA 2NUUG 1BC6A 1TL3A 1VQ4S 2AZ1A 2K1RA 1ZYQA 4MYTA 1JLFB 3AJ1A 3TX0A 3P5TL 4O3PA 1SC4B 3FBBA 2NZCA 1O51A 2QZ8A 1QAXA 4LVNP 2LU2A 2F4VJ 1XMQF 5AT1B 2EK1A 4BC9A 3OLBA 3PO4A 3MFIA 2BANB 3RAMA 1RWXB 4N8NA 1BQMB 1KQSR 2CQ4A 3BYPA 4OZ3A 3OL8A 4C8YA 3KUGA 2LEAA 3J81U 2FPHX 1AZSB 2HK3A 2R7TA 3UN2A 2B0GA 3R1HA 1R0BG 2AJ4A 4O3NA 4DL4A 3X3UA 3AOBA 3GSIA 4USWA 2DTJA 2DY1A 2YY3A 2V4QA 2OPQB 3CCSS 3ZTRA 3H59A 1U1PA 3D4JA 3GJQB 1H38A 2DXEA 4TLRA 3CCZA 3CO9A 4C8OA 3HJVA 5HMZA 2AF6A 1RQ0A 4QIGA 2BJ7A 2R7SA 3SFUA 1UZDA 2HHHF 4CO1A 1VQ9S 4CIOA 1JLAB 4N41A 2ZDOA 2IAJA 3BQ0A 5ADZA 2QL5B 4OHZA 5IQ6A 1CS4A 4Y3CA 2AYMA 1IJEB 4KO0A 1WOSA 3S7RA 2DNLA 2KH9A 2PDAA 4LF7F 1PKUA 2GS8A 4IOCQ 2MKHA 2VG5A 2V4JA 2GQCA 4OIXA 2VDHA 7FD1A 4PUOA 2UZAA 1S6QB 3AAWB 2QEXS 4F0MA 3OL6A 5D15A 5IV4A 2YQ1A 1RAJA 1NMEB 2HWIA 2HFVA 1A6LA 4F02A 2DK2A 1S48A 3NWRA 4R8UB 1RABB 5FDLB 3Q89A 1S7IA 1N5QA 1S1UA 1F60B 5LL6d 3FEZA 1FWLA 2QN6B 3VALA 4B3OA 3NGDA 4KB7A 3I5CA 5H9FK 4C2MA 1Q82T 3CCRS 2CZ9A 3O2IA 2XWXA 4DCPB 4CH7A 2OPRB 1RTJB 5KFGA 3W3SA 3KK3A 2ZH8A 2VJUA 1NRKA 2FHJD 5DDQC 1N48A 3HHLD 3NBPB 3SI8A 2IC3B 5B0AA 3H7HB 2RF2B 4ZCIA 4C8KA 2DISA 4QBUA 2LLZA 3DLKA 3FCHA 4N47A 3PV8A 3B4DA 4ELVA 1FDBA 4LIWA 2A6OA 4Y2IA 4Q0BA 1Q95G 2NXNA 4O4RA 4LF5F 1F2GA 3R3TA 5GMEA 1GXUA 4KQZA 1R0CB 3SV4A 4HDHA 1C0TB 2RDIA 3F0NA 5J2PB 3K58A 3BO2A 5JVHQ 2B8QA 2Z58B 2J8SA 1S49A 2DHSA 3W7BA 3AD7C 3OLAA 2KM8C 3D2WA 2AW0A 2ZC3A 2F63A 1M0SA 5H9FJ 1UP1A 4PXCA 4RUAA 1ZS6A 2JNJA 4WFZA 3HHKA 4G3IA 1RI7A 2XLJA 3CEDA 4GRSA 5SUHA 1WKJA 4OMFG 2MSTA 3EXCX 2Q6CA 5MAOA 4WFBQ 3MPDA 1UJ5A 4MTPA 1J5EJ 2XMVA 3BR8A 3NP5A 2PD1A 1IR1A 2B9EA 5HBMB 3H2UB 5FD1A 3OXLA 1SKUB 2MQMA 2XMAA 4X4VA 4JI2J 2VODA 5K8MA 2BJEA 4ZVTB 1FJCA 1MN9A 3DOKA 1RT6A 4TN2A 1QM9A 4PXBA 3M8PA 4JI3F 4TXSA 1OYEA 3RB3A 5KG6A 1Q86T 4J9NA 3HT0A 4DV0F 3CCMS 1KN6A 1UTAA 3MCOA 3H4DA 5KFNA 4USTA 2E5HA 1PC4A 1EQ0A 4JI5F 1SKSA 1R8PA 3J81Y 4QWCA 4K5SA 4J9SA 2HZCA 3I4HX 2CNLB 2YNGB 3T1HF 2R8IA 2VQFF 2WONB 5AXNA 2UUCF 2Y8WA 1SIZA 4N56A 2CZVC 3VAHA 1Y5LB 5BXIA 2YNIB 4OYAA 5I3UA 1ZA1B 1YTYA 1TAUA 3AOAA 4R0EA 5L1JA 2ASLA 1SPBP 4ZP8A 5LMNJ 4ICLB 1TR0A 3M7VA 3DMJB 4F3QA 2CADA 5DDPC 5AXKA 1RHRB 1RLDA 4DF4A 2JVRA 2NXJA 3HVTB 4QCLA 3TVZA 5KOXA 3NNCA 1QVFR 1S6QA 5KFTA 1Y7PA 2DY9A 2SXLA 1Q79A 2I6WA 2B7BB 4S0MA 3HSDA 3QWUA 2D9OA 4RNOA 3EJMA 4IOAQ 3PY8A 4M5NA 1E6YB 5A6WA 1YJUA 3GR1A 1FRLA 3EDQB 5KFRA 4F50A 5FDLA 3N01A 3Q8UA 1VQ8S 1SBRA 2E9RX 2ZBPA 2CQIA 3IP0A 4IO9Q 3D1OA 4G1PA 2HAIA 1HFEL 1YKWA 3GFXA 2W4PA 2QMWA 3MEKA 1HYSA 3ZZRA 1HMVB 3SQOP 2ZITA 3PHEA 1WC5A 3HULA 5E41A 4WBFA 4CLKA 2VF3A 1WDDA 1Q7YT 2CAJA 3K5LA 4ZOSA 1NXIA 1RTJA 1NJYA 4F26A 2C3PA 2R2SA 1NU4A 2BJ8A 1IVZA 2W7PA 3QQCD 2Q79A 1VJWA 1NJWA 2R42A 3SXLA 1NZ8A 5LM7E 1N0UA 2ASJA 1X4HA 3CD6S 4CO3A 4K4UA 4B9TA 4L74A 4NLSA 4WJBA 1NDLA 4ZLJA 3M2RA 2F4FA 3RTVA 2UU9J 3DCAA 3D68A 4FF3A 3NGTA 1ZM3A 2Z2YB 2OJ3A 2IVYA 1W26A 1ZM9A 2QL7B 3R5BA 4EBCA 1Q4RA 3FQLA 3BSNA 2AP6A 1JLQA 1U1KA 3HI9A 3P6YC 3E8OA 2FLNA 1LWCB 4DR5J 4DSFA 1KONA 2HEKA 1TQLA 3LF0A 1FKPB 4FYXB 3WX4A 2DNNA 2UXDJ 3OVAA 3R1LA 1RSCA 1RWNB 2IA6A 1RZMA 1BUXA 3CJ4A 5HLFB 5JUMA 3JTPA 2KFYA 3MF5A 3GIRA 4Q2MA 1L3SA 1HNZJ 1YITS 4FBUA 1PAUB 2DNGA 3VV2B 1VLOA 1QSSA 1N56A 4I0WA 3VAJA 3KWMA 2JLFA 1M5OC 2V0NA 2HRYA 2W2OP 3NKYA 2XC9A 3PG9A 1NDPA 1Q8BA 3M1VB 2WVBA 2ZWOA 3FSYA 4DDFA 1BE4A 2PMWA 4USMA 1BHNA 1HWUA 2V69A 2PT0A 2GA7A 4GVBA 3UW1A 1CJVB 5CH7B 5H1SV 4IFVB 2X3DA 3N5BA 2LXUA 4Y2AA 2VFVA 4QWBA 3ZZOA 7FDRA 4LF9F 3DLGB 2HRUA 3JQKA 5F3TA 2BE2A 2IM0A 5DQIA 3LGHA 4L75A 5CAAA 1OIAA 3KK1B 4DFMA 3R2DJ 1KVKA 5GAEU 2ZJPQ 1TP7A 2DPIA 4PYAA 5LSRA 1W7WA 1VC6A 1BWEA 1R6YA 1GX5A 2ZH1A 4CT9A 2YNIA 3NWGA 4C3KA 1GEHA 2KYXA 4IRKA 4RNFA 1WELA 4U7UD 4DUYJ 5KG4A 1UJ4A 1S0MA 3IA0A 1BQXA 4ZJLA 2BMBA 3ILJA 3OSPA 3K0JA 2Y3YA 2XZWA 4N8OA 2XG8A 2V2KA 4WTOB 3D54A 3RG6A 3ISND 4L73A 4OLPA 5E3QA 4EWTA 2E7VA 4K59A 1FF2A 3TEGA 1HHTP 2J7UA 3OFFA 5L1LA 1WEYA 2LYVA 3H90A 1E6YA 2H4WB 1VBXA 5ETNA 1S97A 3DOLA 1R6VA 1KOOA 4B08A 2VBWA 3QLHA 3LP1A 4OHWA 1SKWA 1L5UA 2DHHA 3PM9A 4F8RA 5I4MA 2R9LA 4WP9A 1RHQB 3VAFA 1WC4A 1HMVA 5A8WA 4BWMA 3OTOJ 4ZCKA 3DLLQ 3I4PA 2DIVA 3EZOA 1NK4A 4DSEA 1FRJA 2PSZA 1NO8A 4I67A 4IUFA 3DRRB 3ENAA 3M6WA 2QTWA 1D3WA 4FXDA 1RB0A 2HK2A 1R3NA 2Z30B 2VKZG 3DM2A 4U96A 1W25A 1ZPWX 1Q8LA 1IBLF 3HVAA 1SC1B 3MMBA 1XMOF 2DRDA 2UXBJ 1WI8A 2G2OA 1O0PA 4OJGA 1YJRA 1JKHB 1RAFB 2WHOA 1VBZA 3M2VB 4DV5J 3MAAA 5G0RA 4DFJA 3UCZP 1NKEA 2BR0A 1N4LA 3RB0A 3I32A 4RNHA 3IFEA 4LJMA 5FIIA 3DLJA 5D0HA 4WU2A 1IJFB 3BH6B 2CJBA 1VGYA 1K47A 3BGFA 2DR8A 1XEZA 1Y3KA 4I2PB 4UUWA 2ZBCA 1RCXB 3HZGA 4Z37A 2HHUA 2HFUA 3ZZZA 1X9MA 4UZCA 4P7VA 2KT5A 1T7PA 3FBEA 2E1AA 1HNIA 1LFWA 1HBNB 1QVGR 2CXEA 2KRBA 1V6HA 2R3VA 5HLFA 5T7LA 3DNCA 2CQ2A 1PAEX 1GTEA 4DR4J 1T03B 2VH7A 3LP0B 3NL0A 1XERA 4MIBA 2B56A 4CYUB 3GV7B 4DMZA 1E6VA 5HL7Q 4IH5A 1U24A 5AE1A 3T1YJ 3M1VA 4RUBA 5HMWA 3QYYA 4NYPA 2VUGA 2D69A 2NYHA 3I82A 1VRTB 2QX0A 2J0WA 4K2XA 2F4VF 1ZAXA 3D1QA 2WW4A 1RT7A 2E5LJ 2FJVA 4IFVA 3CB4A 2G1HA 5DDOC 4F4YA 3SBMA 2MKKA 5IFMA 4RW4B 3FFIB 4OI3A 1VDHA 1KNZA 3DI6B 3K59A 2Q3PA 3Q8PB 1BLUA 2Y0SD 2OTJS 2DJWA 4M5IA 4NCGB 1HBUB 3B6BA 2YX7A 1PJ6A 4RW9A 3D67A 1R8HA 1VFJA 1DBDA 3TEHB 3MMCB 2X1AA 2HLUA 4B3RJ 3UPFA 4O44A 1Z1ZA 4HHJA 3MR6A 3D0HE 3EZUA 4TU9A 1Y3JA 3EUNA 3DYAA 3WC2A 3R5AA 1I3OB 4FNIA 1FEEA 4MMOA 4DR6J 4A48A 4DG1A 4BLGA 3C6UA 4DEZA 4WF9Q 2V8DA 3T41A 2EBGA 1I94J 2IM2A 4G6VB 5F9LA 1JX4A 3LW5C 3JQMA 3J7A1 2Y1LB 1YK9A 2YKMA 3QO9B 5EHHA 3KMSA 3TAPA 2ALZA 4NXMJ 5A2QU 3PJXA 3M32A 2KXNB 4YY3J 4JV2A 4OZ1A 2W2MP 2W25A 2C1EB 2QFIA 4XDDA 2EWHA 2CJYB 3LAMA 4WIQA 3NCRA 3FSXA 1U6FA 3OV7A 4YEAA 4P2SA 2IY5B 3M6UA 1U0SA 1F1BB 3OTCA 2AHOB 4ZVSB 2NLWA 1I5OB 3FSIA 2YQ0A 1RLCL 1U2FA 4KPCA 4XAKA 3EYZA 1C1CA 1SJ3P 1KHWA 1U1QA 3DRRA 3MEEB 3QRPA 4HI1A 2L41A 1HD0A 2B6AA 3N6NA 2W9CB 3H5SA 3ET6B 4WFXA 1RWKB 5CYMA 3K5PA 3G82B 3A4TA 3BEGB 2FQQB 1HBMB 3M2VA 1PBUA 5F3ZA 4NYZA 2Y1JA 3AXKA 1AA1B 1DTTA 1GMWD 5E3CA 4ECWA 1RACB 4MFBA 1HBOB 4ZN3A 3J7YI 1QY7A 2HRTA 1JXEA 2L9DA 3P49B 4M5JA 2VKRA 1VS3A 5K20B 4I2PA 2XBPA 1FVSA 3U1LA 3BGUA 4M63A 2DVIA 4MK8A 3TANA 4DX5A 3NRBA 3FRZA 1QAJA 4OZ2A 3P8BB 3VQSA 4A8QA 1U1MA 2XMUA 2LA4A 3ISZA 4F3OA 3LAKA 5LSOA 3FBCA 3T9NA 1HBNA 2V5HG 4DPYA 2AGQA 3GILA 3X1LB 4J9QA 1TZ0A 1C2PA 4N77A 2FVRA 1S7HA 1V3ZA 3NY0A 3OR2B 1KTVA 1G2EA 4LBPA 2HHTA 1IKWA 4PEOA 1QE1A 3MGJA 2KZMA 2QGFB 4CQ1A 3J7AN 4IQMA 3D66A 1SH0A 3OJUA 3P96A 1DTQA 1T9UA 3K7RA 3V6DB 4I7FB 1TL7B 1GXLA 1RT3A 2JZ5A 1P1TA 3T5HA 3JYTB 5L1KA 2BV3A 3UDLA 3MI7X 1S1TA 5M2PA 1VRTA 2AGPA 3HCXA 1J5EF 3R2CJ 1VQ6S 1SJ1A 1X0PA 3GIKA 2W7AA 3KLIB 3DN9A 2J0SD 3AA8A 4K4SA 1XNQF 2E9ZA 5AJ3J 1X31C 4YDDB 2V8GA 4HH1A 4KFBA 4JI2F 2C3YA 1URNA 3CWJA 3GJRB 4NCGA 3RYLA 3CC7S 1QLNA 2WSEC 3TA2A 1D9AA 1U7LA 2ASYA 2VPXB 4DS5A 3MM9B 1S9GA 1UWAA 1HQUB 4JI1F 4DV3J 3M6XA 3EXYA 2ATLA 3IGNA 5KT3A 1MN7A 1D9DA 4MKAA 2D74B 3JSRA 1UFWA 1VRUB 5DRKA 4GC7A 2CQHA 2BKNA 2EEYA 4X62J 3ZTQA 4P75A 1XNRJ 1DFDA 2DR6A 4MIAA 5ETOA 3EGNA 1Y5IB 2K8GA 2GIQA 1CC7A 4Y28C 4LRDA 1IUJA 3IS9B 1OSCA 4MIWA 4DV4J 2N7YA 3V2UC 5LMNF 1RKIA 1APSA 3CCWA 2RQ4A 2XB2D 5K14A 4OV6A 3MMAA 3TZZA 4EK2A 3BKUA 4DL0C 2K7JA 3ICLA 1N5YB 4HDGA 3LPEA 1HIYA 5KFVA 1B3TA 1NCLA 4X4PA 1IKVA 4HL9A 3PO5A 3NNAA 2ZZMA 4JI0J 5JVGQ 3BO4A 1YZ6A 5A2QY 1H72C 4N5SA 1H0HB 4ENOA 1B70B 2MJNA 5HVFA 3ZFVA 1YJTA 4JV1A 3I9ZA 3H25A 2XO7A 2IM3A 4B9LA 1K8AT 3EWGA 3CW2C 2G2ZA 3R6GB 3NGRA 2E29A 2GW8A 2BVZA 4PPZA 2BKOA 2KJWA 5FJ4A 4C9DA 3KLGB 1G7CB 4AXJA 2C3UA 3M05A 3V81A 1S1VB 4F36A 4OZ0A 2IMWP 2QA4S 1N5VA 2PO4A 4OZJA 4KT0C 4J9LA 5C24A 4Q2LA 2CJXB 4LFAJ 2PC6A 5A0YB 3T3FA 3GG1A 4ID5A 3RRHA 3KHHA 4DL5A 3WHIA 1U8WA 4F0HA 4UOGA 2D7SA 2DGSA 2IJFA 5EX3A 2HFZA 1Q1KA 4WK1A 3BKTA 3HHLC 4PG8A 4OYXA 4DU8A 1NAQA 2UU9F 1RBOB 5ETPA 1NK7A 1NDKA 4TNOA 2HVEA 1IKYB 3HP6A 4DN0A 2CUYA 4YR0A 1FK9A 2UUTA 2FJDB 5D0RA 4AL5A 3CDUA 1YJ7A 2KM8B 2VG7A 5B0EA 1FVQA 1XR7A 2ZD1A 1S77D 3IWLA 1UVIA 1JXVA 2XMWA 3TO8A 2YNHA 1FERA 2UV8G 3PYGA 4B3TJ 4I7FA 3VQTA 3NCQA 1MG7A 1TL7A 1VQ7S 1TV6B 1HNZF 5GAHU 5DM6Q 2PEBA 2EPIA 1KKHA 1HHSA 1S1XB 4ZHRB 3MD1A 2RILA 2WB4A 2GMHA 4M5MA 1VK3A 2H48B 4MH8A 1SJQA 2R7VA 1HD1A 5RUBA 4CCHA 3BBBA 3NAHA 4I6WA 4RW7B 4IH7A 3US5A 5KTQA 1YBUA 4L72B 1SQFA 3CNQP 9ATCB 2A3JA 1FX4A 3GCWP 1ROFA 3BBFA 3B54A 1AUDA 1MU2A 2NPIA 1VJQA 5KG0A 4H4OB 3ZO7A 1MWQA 4WYWA 5KFSA 2WBRA 2V2ZA 3FMBA 3T6BA 4LF8J 1ZOTA 5F8NA 4WP3A 1OY9A 3AT1B 2HNZB 3H20A 2EBEA 2QRRA 5H9EK 3GFHA 4UOFA 1HI1A 3FZBA 2GZOA 2A10A 4P6QA 1JB0C 2HFSA 4EI2A 1X4DA 5JMNA 3MM5B 3WC0A 1FEHA 1NSAA 5A8RA 4DQSA 2WOMA 2YTCA 1N54B 3CD5A 3QMQA 1R0AB 2CJ9A 1U2CA 3IWNC 3CJKB 3UVJA 1KBRA 3IS9A 2MZSA 3MURP 4DUYF 2MZJA 1HQEA 2XSJA 1ACMB 2W4CA 5HQLA 3EVOA 4MKVA 2JDJA 3R5GA 2CVEA 5AXMA 3KLVA 2XZDB 2R7QA 3OUYB 1IM4A 4IR9A 4Q45A 4TKTA 3B8HA 4YB1P 2R7XA 2AYGA 1IBMJ 4DXLA 1WC6A 3UDEA 2QYCA 4ED1A 3GZ7A 4NX9A 4USVA 2OH2A 5I42B 3D7SB 3DXBA 1NSPA 2GCFA 1FI4A 5L39A 3QT7A 2HNDA 4RBVA 1JLCA 2GVZA 1SJRA 2P9CA 4EYIB 4WE1B 3EMTA 3I0RA 1JJ4A 4F2RA 5EWGA 3R7SB 1GXTA 1UA1A 4X4TA 1SKRA 4QIVA 1C1BA 1BQNA 5H9EJ 1B7YB 2JEIA 2L9NA 3C14B 3QJPA 1RT4B 4YDXA 2I0XA 2QL9B 3OTOF 1LWEA 2J76E 2OHDA 3DLHA 1ZA2B 5A76A 3CGIA 1NPRA 4LF2A 2W2QP 3PRVA 1FTRA 4R5PB 3CJ0A 4DSKA 4A8XA 1N0VC 1ULRA 5A0YA 2XI2A 1TVRB 3W65A 3JTOA 1SV5A 1RISA 2F9JA 4DV2J 4HH0A 3LH2S 3BZQA 4P71A 2ZH2A 3I9V9 2UP1A 4RNNA 4DV5F 1JQGA 4CH0S 1KHVA 1TAQA 2I8EA 3QZ8A 1VC0A 3TVYA 5IZHA 5CYQB 2CWKA 3NLCA 2RDJA 4G1IA 2MDAA 4EZ6A 3BPDA 5KFHA 4KGMA 2RQCA 3PVXA 3GIMA 2LQ5A 3UE2A 4NLRA 2HKEA 1CVJA 1Q7LB 2W8LA 2AT1B 2JH3A 1AB8A 5JXSA 2HPUA 4MT1A 3HF5A 5C2CA 3POTB 3CCJS 2IPOB 3E01A 4X4SA 2COLA 3VAMA 2MQOA 2M0GB 1PYSB 2GC8A 2PIIA 1KVJA 1H3DA 3SIPB 5KFJA 1TTHB 4WZMA 1TKZA 1QSLA 4DR4F 4YN3B 3M30B 4ZHRA 3W2VB 2DNZA 3TQEA 1FO1A 1QD1A 2GIFA 3MTKA 3GLJA 3SQGA 3JSMB 4OI6A 3C2PA 4FNHA 2G0JA 3BREA 2ZOGA 4H4MB 1GFWB 3SCKE 3T1YF 1WEZA 2V34A 1JNZB 4ZPAA 2CQDA 5HVGA 3IGVA 2KVIA 4JI7J 4Q44A 1RAIB 2LQJA 3ENVA 3VGVA 1WI6A 2I1RA 5B0GA 4FS1A 1PJ7A 1T9YA 2CQ3A 1NK9A 1ZAWA 1WDTA 1HR0J 4H4OA 4ZLPA 4DSLA 2IBKA 2V8HA 2HQFA 3CCTA 2UVRA 2UV8A 1OYDA 3KG0A 5J1EA 3M8QB 1TFYA 3CVKA 3OTBA 4NCAA 3QT5A 1IWAA 2EKNA 2DR7A 4DQIA 3MM5A 3QIPA 2NS1B 1OQ6A 5ETKA 2YWEA 4B3RF 3W60A 4EBEA 2F1FA 2LKZA 4GKKJ 2QO3A 4LVOP 2RT3A 3Q23A 1NKCA 4WKRA 1X5OA 2J9DA 3K8VA 4N7TA 3L95X 4O23A 4BBYA 4IG3A 2C2OB 2HS4A 2BJ9A 3CDAA 1TL5A 4DR6F 3C15B 2HQIA 1YG0A 3HFVA 2VBXA 1JIHA 4PKDB 4A8WA 3TAMA 5KAKA 2ZUGA 4HACB 2BDPA 3C3LA 2WRMA 3OR1B 4OX6A 1I94F 3MM8A 1SC3B 1HW8A 1U02A 2YWWA 5DLGA 4M5DB 2EFPA 1Y10A 2YX1A 2EFVA 2MYFA 3AA9A 5F8JA 4FBTA 3KLEA 3WDOA 4NXMF 5KFUA 2R7UA 2ROPA 1M5VC 2DEJA 3U1MA 2FJEB 3ISNC 4YY3F 2POKA 1OJ4A 1HW9A 4A8OA 1QUPA 2AJ0A 1F3VA 4JV5J 5EN1A 2H54B 3JQJA 2IM1A 2W7OA 2XMTA 2ZKTA 1RHUB 4KV8B 3W2WB 1U25A 1VC5A 1VQYA 2ZM6J 4CLFA 4KGVB 1N6QB 4NLUA 3LALA 3C6TB 4DS4A 4PZVA 3HVRA 4DUZJ 3H0PA 4OL8A 1VQLS 3I0SA 2V9KA 3C14A 1RT4A 1TKTA 4LSNA 2VD3A 1NDCA 4ZVPB 1RTHB 1RWPB 2V68A 4GMKA 3A8IA 2FC9A 2RRBA 4PG5A 4PQUB 2GHVC 2MQNA 1GK8A 3UO0A 2E9TA 3PW7A 1SUQB 1S72S 4R5PA 2WW8A 4AUKA 3H42A 2QLFB 1JLGB 1R8CA 3CCUS 3P4UB 3K5OA 5I3PA 2ZH3A 2YKAA 2ZBQA 4DR7J 1XC9A 3ZNJ1 1HNVB 4RNMA 1FNMA 1UMJA 5B0CA 4P7TA 1X0FA 2CPIA 3O6QA 3P5BP 4LFBJ 2VPZB 5F8LA 3TA1A 3MUMP 4J9PA 4EMDA 1QAYA 5CYQA 3N0VA 2EFGA 1N5TA 5HAOA 3GWCA 3LUYA 5D4PA 4ELTA 1FDNA 5HJXA 4A8KA 5C25B 2RUSA 1LV5A 1IWGA 4DSIA 5D77A 1T9XA 3H40A 4ZN1A 3BYRA 2FVPA 3OL9A 1PCAA 3NXZA 3A13A 1HPZB 1RE1B 3POTA 4ITSA 1YJWS 3T5KA 2HHSA 2FJWA 3KHLA 3RJMB 4DCOB 3G8SA 3MHYA 4CNZA 1FDAA 2RUGA 1Q0NA 1HA1A 2Y9HA 4DUTA 1SJFA 1OS5A 2DNPA 2A1BA 4ZPTR 3W5YA 2DNOA 4JI8J 1N8RT 1FD2A 4H4MA 2ZDPA 1H6KX 1TUWA 4A8YA 2GMLA 4ES3A 2VASA 1GT8A 2M9KA 4IFYB 1RT5B 2B5JA 3V4IB 1OSDA 4Q8FA 4QIEA 2K1RB 1BXNA 3RGIA 5E7OB 2D1CA 5DDRC 2CPFA 2PEHA 3WQPA 2KI2A 1HKAA 2LU1A 4QWDA 5AJ3F 3PYEA 2EI5A 2VL1A 3C16A 2V50A 3BN7A 4LF6F 2G4BA 3QT8A 4KHPJ 3GE9A 1CG2A 3T1AA 3FQKA 2VA2A 1FTCA 3D28A 2P9EA 4G65A 1HARA 2I38A 4DV3F 3CJSA 5BYQA 2W2PP 5GMDA 4J9VA 3PRBA 5HQ8A 2XHWA 3HHNB 2HIQA 3GB0A 1JLEA 3C15A 2ZZTA 4X62F 1C0UA 4USJC 2H9ZA 3ILIA 4C0HA 4AQYF 3IBCB 1XNRF 3MECA 4K4XA 1D9FA 3J80U 4E2FB 2EG2A 4AYBD 2AYBA 1KDNA 3OR1A 2ABYA 2RD5C 4DV4F 3HKWA 2J6TA 3ETMA 4L3NA 4OYMA 4KKOB
chains in the Genus database with same CATH topology
2CJYB 2H5JB 3GJTB 3KJNB 2CJXB 2HBZB 4ZVTB 4ZVUB 3EDRB 5IC4B 2H4YB 2XYPB 2C2ZB 2H48B 3QNWB 3NS7B 3SIPB 2CNOB 3GJRB 4ZVSB 1RE1B 1RWWB 2XYHB 3D6MB 4ZVPB 1RWPB 1SC1B 3GJQB 2H5IB 2XZDB 1I3OB 1RHKB 2CNNB 2C2OB 4ZVQB 3EDQB 3RJMB 2DKOB 4DCOB 2P2CB 1I51B 2H65B 4LSZB 3R7NB 1QDUB 1RHMB 2QL7B 1GFWB 2QLFB 3R7BB 1SC4B 1RWOB 1RWKB 4ZVRB 2CNLB 2C2KB 1F9EB 2QLJB 1RWMB 2HBRB 1PYOB 4DCPB 2H4WB 5IC6B 3P4UB 3D6FB 3R6GB 3R6LB 2QL5B 2Y0BB 2C2MB 4JB8B 2FQQB 2XZTB 2Y1LB 3GJSB 4ZVOB 1SC3B 3KJQB 3KJFB 3P45B 3IBCB 1RWNB 2H51B 1RWXB 2XYGB 2QLBB 3D6HB 1RHJB 2CNKB 3R7SB 1IBCB 4DCJB 1QTNB 2C1EB 2HBQB 1RHQB 2HBYB 3R5JB 1BMQB 1RWVB 3IBFB 1PAUB 1RHRB 1ICEB 5K20B 2H54B 2CDRB 2QL9B 1RHUB 1NMEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJY B;  2H5J B;  3GJT B;  3KJN B;  2CJX B;  2HBZ B;  4ZVT B;  4ZVU B;  3EDR B;  5IC4 B;  2H4Y B;  2XYP B;  2C2Z B;  2H48 B;  3QNW B;  3NS7 B;  3SIP B;  2CNO B;  3GJR B;  4ZVS B;  1RE1 B;  1RWW B;  2XYH B;  3D6M B;  4ZVP B;  1RWP B;  1SC1 B;  3GJQ B;  2H5I B;  2XZD B;  1I3O B;  1RHK B;  2CNN B;  2C2O B;  4ZVQ B;  3EDQ B;  3RJM B;  2DKO B;  4DCO B;  2P2C B;  1I51 B;  2H65 B;  4LSZ B;  3R7N B;  1QDU B;  1RHM B;  2QL7 B;  1GFW B;  2QLF B;  3R7B B;  1SC4 B;  1RWO B;  1RWK B;  4ZVR B;  2CNL B;  2C2K B;  1F9E B;  2QLJ B;  1RWM B;  2HBR B;  1PYO B;  4DCP B;  2H4W B;  5IC6 B;  3P4U B;  3D6F B;  3R6G B;  3R6L B;  2QL5 B;  2Y0B B;  2C2M B;  4JB8 B;  2FQQ B;  2XZT B;  2Y1L B;  3GJS B;  4ZVO B;  1SC3 B;  3KJQ B;  3KJF B;  3P45 B;  3IBC B;  1RWN B;  2H51 B;  1RWX B;  2XYG B;  2QLB B;  3D6H B;  1RHJ B;  2CNK B;  3R7S B;  1IBC B;  4DCJ B;  1QTN B;  2C1E B;  2HBQ B;  1RHQ B;  2HBY B;  3R5J B;  1BMQ B;  1RWV B;  3IBF B;  1PAU B;  1RHR B;  1ICE B;  5K20 B;  2H54 B;  2CDR B;  2QL9 B;  1RHU B;  1NME B; 
#chains in the Genus database with same CATH topology
 3Q8Y A;  1UVL A;  1M5P C;  1J27 A;  2IAJ B;  1ITP A;  3BQ1 A;  3KOA A;  4F7V A;  4UY8 5;  2HSE B;  2D41 A;  1S99 A;  1CS4 B;  4DU7 A;  2DGQ A;  1FRK A;  2RNE A;  1TKX A;  1W2B R;  4OV1 A;  2IMO A;  2AIR B;  4X65 J;  1RHK B;  2VG5 B;  4JI0 F;  3NCP A;  2V4J B;  1FT8 A;  5BR8 J;  1RAE B;  1VLY A;  4PUO B;  2DO4 A;  4MAK A;  3PTW A;  4ZIV A;  3UD4 P;  1YI2 S;  2AZ3 A;  5KFW A;  1TK0 A;  2AJ1 A;  3ZTO A;  4PQA A;  4X4N A;  5KFF A;  3QT6 A;  4JYA J;  3D6F B;  1MRO A;  2I5J B;  4KPY A;  1WD6 A;  1N32 J;  1JK9 B;  4FYY B;  2M2B A;  2NPF A;  4OFZ A;  1UFK A;  3UN5 A;  1JLG A;  4G1Q A;  4Y2M A;  4LFC J;  1WKK A;  4X64 F;  2YVS A;  2B43 A;  3EPI A;  5HI7 A;  4DV6 J;  2FZK B;  1RAD B;  2GVD A;  1HNV A;  3BH7 B;  1VMB A;  2OFG X;  2F3J A;  2R7R A;  2LQ9 A;  5IWA J;  4I56 A;  5U47 A;  2Q66 A;  3AFG A;  2VIH A;  1KLM A;  3A8E A;  3BR9 A;  4CDI A;  4QWE A;  1RGV A;  3NG8 A;  1Q5V A;  4DSJ A;  1BWV A;  1WF0 A;  4TY9 A;  3JSY A;  3HXM A;  4A46 A;  4LFA F;  3WBZ A;  4MJK A;  4O4G A;  4NMX A;  1H98 A;  5GAD I;  3KJV A;  4IG0 B;  1M1H A;  1PG5 B;  2YQ3 A;  2MTL A;  1IBK F;  4NWB A;  3DGP A;  2EFQ A;  1Q8K A;  4F2S A;  2KT2 A;  1ZTT A;  4QOT A;  3J7Y U;  2VG6 B;  2CPH A;  3TX8 A;  1X9S A;  2MGZ A;  2CWX A;  3N6L A;  2E1C A;  4QIF A;  4FP9 A;  3M8S A;  1LKZ A;  2BM0 A;  2HGM A;  2VBZ A;  3CF5 Q;  1PYO B;  3PJ9 A;  4Q0B B;  1FJ7 A;  1NZA A;  1VQP S;  2R7O A;  3KJQ B;  1TK8 A;  3KTQ A;  5L38 A;  3SMZ A;  4ANC A;  2J9E A;  3GYN A;  2NR0 A;  1NH8 A;  1UA0 A;  4DL3 A;  4UOH A;  2XMK A;  1X4E A;  2XTJ P;  4AE5 A;  3MUT P;  1RYR A;  4B3T F;  4NLO A;  2KKH A;  5HP1 A;  1NLK L;  3GR0 A;  3MUV P;  4H4K C;  3K57 A;  4LR9 A;  3FUY A;  1FJE B;  2K3K A;  2BE7 D;  4XTT A;  3S01 A;  4OX9 J;  5D6G A;  4PYD A;  1S59 A;  2EG1 A;  3D6M B;  2RVJ A;  3EVW A;  3QGG A;  1T11 A;  4NPO A;  1TMM A;  4X4R A;  2CQC A;  2GV1 A;  1LXJ A;  1K0V A;  1UL3 A;  1SJ4 P;  1LFP A;  3SEO A;  3S1T A;  2AU0 A;  2MJU A;  3DHX A;  2KXF A;  3Q8Q B;  1NPK A;  3DOK B;  4MKB A;  1RT6 B;  4DX6 A;  3M8P B;  3FK4 A;  4LF8 F;  1VOM A;  2YH0 A;  2GNK A;  4I64 A;  4Y6I A;  3G8Q A;  3FNN A;  3SZ2 A;  4ZK7 M;  4KIA A;  4UQT A;  1UET A;  1H7W A;  2MQL A;  8RUC A;  3P3D A;  3PW5 A;  4YOE A;  3FKB A;  1EKS A;  3L7P A;  4DZD A;  1V9O A;  5MLC V;  3AOD A;  4FXV A;  2FY1 A;  4C97 A;  1UJ6 A;  3M8Z A;  2W9B B;  2CRL A;  5I3U B;  3SYZ A;  2KU7 A;  4KKO A;  3QSY B;  3ZNU A;  4OLO A;  2VC0 A;  4WCE Q;  2ZH5 A;  3LOU A;  4ED3 A;  3BS9 A;  4NLX A;  2M8H A;  3GFZ A;  2MKJ A;  3J80 Y;  1NM2 A;  4O3Q A;  3TNV A;  4JP8 A;  1HNX J;  1U6B A;  4ID8 A;  3N5F A;  1EZZ B;  4DV7 F;  1Z4U A;  1S4E A;  4HT5 A;  2E7W A;  4E98 A;  1REV A;  1VQ5 S;  4URS A;  4KR0 B;  4RU2 A;  3HT3 A;  4ZVO B;  1MLA A;  5K9F A;  1UKU A;  3MM6 A;  4Y2K A;  2ZBR A;  3F44 A;  2QIF A;  1JLB A;  1S6P A;  2RHQ B;  3SFG A;  2M7S A;  1MWZ A;  1IKX A;  4RBT A;  3W8G A;  2I5J A;  3W8P A;  4F04 B;  4CLS A;  1DLO A;  1DQ9 A;  2AEM A;  3IBF B;  4KGX B;  3NGS A;  4LF7 J;  3VAG A;  2CDR B;  4ECQ A;  2R8G A;  2DHG A;  2YXL A;  4KTQ A;  4ED8 A;  1M1K T;  5IC4 B;  4C6A A;  1VCT A;  3HD1 A;  3PIP Q;  2KVQ E;  1AW0 A;  1HYS B;  1OY6 A;  1YHQ S;  2CVI A;  4LSL A;  4PG6 A;  2RSQ A;  3RR8 A;  3SCI E;  3CD7 A;  2NCK L;  2CDQ A;  1I6J A;  2FJX A;  4ZVQ B;  3K8W A;  1T05 A;  3HHD A;  2A18 A;  5D4N A;  2HQG A;  2OUG A;  4IG0 A;  3Q2S C;  5ETQ A;  4TY8 A;  3HHL B;  5HRO B;  4ZCL A;  1H74 A;  5IV3 A;  1RWM B;  3IM8 A;  1NJI T;  2GQQ A;  1EAY C;  2VG6 A;  2ZH4 A;  2ADB A;  3A8K A;  4OHV A;  2XNR A;  3A8J A;  2DGT A;  1SVD A;  2RDD A;  2V2Q A;  3DLE A;  4DQP A;  3M2R B;  2O66 A;  2QC3 A;  5J2Q B;  1YGY A;  4H54 A;  1NKB A;  1G1X A;  3JXO A;  2FGC A;  3IRX A;  4BWJ A;  5AE2 A;  1QTN B;  4L3K A;  2HFN A;  4PAB A;  1YX2 A;  2FDN A;  3S6E A;  2XM3 A;  3CJ5 A;  1A0O B;  4CLY A;  1JLQ B;  4OYI A;  1F5C A;  1EET B;  3UWT A;  1YBA A;  2XYP B;  4ZPD A;  2HGN A;  2NUH A;  3GV8 B;  1HWI A;  4DR2 F;  2UVV A;  4FZV A;  5GAH I;  3H5X A;  5KFL A;  2RS8 A;  2AJQ A;  4LRF A;  4EYH B;  5KFI A;  5K8N A;  4DQR A;  3MPV A;  3LGN A;  3OXG A;  4HTI A;  3I6P A;  4LF5 J;  4CLT A;  3SV3 A;  4IKA A;  2C42 A;  1T02 A;  1FX2 A;  4K8R A;  4NZ0 A;  2HZA A;  1AFI A;  4YB7 A;  2D3O R;  2HQD A;  3QZ7 A;  2IRX A;  2XWY A;  2XQC A;  1TL4 A;  3N79 A;  2M52 A;  3KDO A;  2ZVS A;  2C2N A;  1FE0 A;  3H4B A;  2W01 A;  2CNK B;  4XPC A;  1HR0 F;  1V3S A;  4OYB A;  3EM1 A;  1ZET A;  1R8A A;  2RB7 A;  3MM7 A;  4HKQ A;  2DXF A;  5EX0 A;  4GVB B;  2HHQ A;  1WNE A;  3EPG A;  4XDC A;  4C11 A;  1S5Z A;  4NLW A;  4PWW A;  1YIJ S;  2ZEJ A;  3FRY A;  2NQP A;  5KFC A;  2XMM A;  1L3T A;  2BE2 B;  4LRA A;  2B9Y A;  3TZX A;  3MEG A;  2WZ1 A;  4IDK A;  2H5I B;  3M9O B;  1RBL A;  4GKK F;  6FD1 A;  3MR5 A;  1S79 A;  2M3D A;  3BV8 A;  2DT9 A;  2M8D B;  2ATC B;  2MQP A;  2W9B A;  1PBA A;  1V5V A;  4WK3 A;  2XY6 A;  4I68 A;  4C0B A;  1MML A;  3G6E S;  4DBQ A;  3O44 A;  3ENW A;  2C22 A;  4R0J A;  2Y0B B;  2ZJQ Q;  4OHY A;  2J6S A;  4MYU A;  3WIU A;  2VIC A;  1CQN A;  5ETS A;  2YWH A;  3T19 A;  4ED2 A;  1VBK A;  1BD6 A;  2BRK A;  1PO6 A;  2QSW A;  4DCJ B;  1NK6 A;  3HD2 A;  1PYT A;  3DRS A;  2NXE A;  2MXY A;  3TYT A;  2HYI B;  1Y9O A;  2VZ9 A;  3ZZY A;  4OYW A;  3F56 A;  3UFC X;  4YFU A;  3R9L A;  2ZM6 F;  4U8V A;  3DOL B;  3NS7 B;  1KRP A;  4PG7 A;  2X51 A;  2CPJ A;  3M4X A;  3GG0 A;  3QLH B;  3A1Y G;  5D0E A;  3LP1 B;  3PYD A;  1RTD A;  1DJ0 A;  4J5O A;  4CNY A;  2J7W A;  1BY9 A;  2GIR A;  3NS5 A;  3PXG a;  3MED A;  5A8W B;  2JWN A;  3BGR A;  3CJ8 A;  1WHX A;  5DQH A;  3UD3 P;  2APO A;  3NGK A;  4NXN J;  4K5R A;  3D3B J;  4U8Y A;  3DM2 B;  1NK8 A;  2FHJ A;  3HHL A;  4CO4 A;  4ETZ A;  3IRW P;  3CE8 A;  5HRO A;  5CYJ A;  3MMB B;  1CJU A;  4ZDN A;  4LFB F;  4BDP A;  1PIL A;  2GJF A;  1UVJ A;  2CFX A;  3G86 A;  3KKF A;  2FYX A;  3HKZ D;  3MAA B;  3CIZ A;  2UXC F;  5G0R B;  1RAH B;  2RML A;  5J2Q A;  1X8D A;  2I2Y A;  5D4O A;  5KG1 A;  3IMQ J;  4LT6 A;  3THV A;  1ZPV A;  2VOO A;  3TQ1 A;  4JBC A;  2BJD A;  1CJT A;  4ES2 A;  1EET A;  4E0D A;  4IR1 A;  1KTQ A;  2OLW A;  1Q81 T;  1WTF A;  3DDI A;  1R89 A;  1HNI B;  2EC0 A;  2OI2 A;  1F0X A;  2OEL A;  1EP4 A;  3AB2 B;  4CH1 A;  5T7L B;  3HVW A;  2R2R A;  2HMI B;  5BJR A;  1UW9 A;  2DHX A;  5DJB A;  3TZW A;  4J9O A;  1FNO A;  2GO8 A;  1R43 A;  5KFX A;  1WC0 A;  2RQM A;  2HAF A;  2BE9 B;  2B4U A;  1E6V B;  4P74 A;  5IT4 A;  3TW0 A;  1LNQ A;  4NEY A;  1NEE A;  4RW8 A;  4NLG A;  4ZMM A;  4F3M A;  4UZB A;  2DNY A;  4ED6 A;  1LW0 A;  3EDR B;  2ERR A;  2OPP A;  1SH2 A;  3TOQ A;  1RT7 B;  3AD8 C;  3ZTP A;  2QFJ A;  3DXS X;  1RDR A;  1U1R A;  4F25 A;  4J7C A;  2N82 B;  1S6U A;  3W63 A;  2F40 A;  4KHP F;  3R5D A;  3DDN A;  3MR7 A;  1TMJ A;  2VHG A;  4CT8 A;  1U6Z A;  5IM0 B;  4I2Q A;  5KFD A;  4RW9 B;  3A3N B;  5DG8 A;  2VQE F;  4C98 A;  4OI0 A;  1KWM A;  3FMW A;  2IA0 A;  1DRZ A;  4O44 B;  1VIS A;  3UR0 A;  1F9F A;  3UDC A;  3UCG A;  4CRJ A;  4RR5 A;  2YKO A;  2UVU A;  5B0F A;  1S0V A;  3GTY X;  5K5M A;  4EO8 A;  4O3S A;  3DYA B;  4Y34 A;  4DPU A;  1M5K C;  3M8Y A;  3QFH A;  1LK7 A;  2CIM A;  4ECX A;  4DG1 B;  1KEK A;  3OFG A;  2JEF A;  3C6U B;  4HYK A;  1XIQ A;  2R2T A;  3UI3 A;  1T9V A;  4IO1 A;  2QT7 A;  2RE1 A;  5E5N A;  4EU0 A;  3ULH A;  4A8M P;  2O3D A;  2KDO A;  1XR5 A;  2YKM B;  3EVM A;  4ED4 A;  2QE5 A;  2A0F B;  5E0O A;  4ZA1 A;  3M32 B;  5L9X A;  4ATN A;  2FLP A;  3VCD A;  1S57 A;  3CUL A;  2V8V A;  2D9P A;  4X65 F;  3U1N A;  2RKI A;  2LA6 A;  1MW7 A;  1LK5 A;  1TUV A;  1JNR B;  1U0H A;  3IR5 B;  4OYZ A;  8AT1 B;  1DQ8 A;  1M5H A;  2YWF A;  3MAH A;  2E44 A;  2FHO B;  4KJI A;  3KFW X;  2UUB J;  5C2G A;  4LR7 A;  4NRT A;  5F8M A;  3GII A;  2YKP A;  3QGP A;  1N32 F;  1C1C B;  2VC1 A;  1AFJ A;  4LFC F;  1FKO A;  4ETX A;  2VON A;  4QYR A;  2B6A B;  5B08 A;  2O01 C;  3GYG A;  2OTL S;  2Q43 A;  3LP2 A;  5IOL A;  4CO2 A;  3RBX A;  3Q83 A;  5IWA F;  3SCL E;  1SIW B;  2Z56 B;  4UTG A;  1H2U X;  5CYM B;  1CLF A;  1MMD A;  5J1N A;  3VZI A;  2X1G A;  1JJ2 R;  1WAC A;  2AEF A;  5IT0 A;  1WF1 A;  2KG0 A;  1RWW B;  1DTT B;  2E5I A;  1XJW B;  4PAA A;  5A8K A;  1N36 F;  3QRQ A;  1VRQ C;  4AND A;  1YWX A;  1U1L A;  4RWX A;  4MFB B;  5D4L A;  4Q7A A;  3IG1 A;  4QR1 A;  2WTF A;  5CZV A;  2CJK A;  2XI3 A;  2DGX A;  3L09 A;  4IRD A;  1IBL J;  1TL1 B;  4PWU A;  4QQB A;  3QGH A;  3EE3 A;  4NZ6 A;  4RLE A;  5B09 A;  2WK4 A;  2V6A A;  3HSJ A;  3HM9 A;  1CJK A;  5IC6 B;  6AT1 B;  5DZ6 A;  3W9H A;  4FN5 A;  5KFO A;  3Q86 A;  2OMO A;  2OEJ A;  2QSF A;  3SDE B;  2VFS A;  1X4G A;  3ILL A;  3UR3 C;  2EKY A;  1KC8 T;  2HMI A;  2G1D A;  3M6V A;  2DRA A;  1IKW B;  1QE1 B;  2ROG A;  5SZT A;  2X1F A;  4URQ U;  1DAR A;  5T41 A;  3LQV A;  3CCV S;  4NA2 A;  1DTQ B;  2YKN B;  3MCS A;  1RA7 A;  1M5S A;  1RT3 B;  4FPR A;  3ELH A;  3MCN A;  3IBW A;  2GX8 A;  4OX9 F;  1S10 A;  4UQG A;  1S1T B;  1YSJ A;  4RW6 B;  5KG2 A;  2K7K A;  1XQI A;  3VGT A;  2PFF B;  4FF4 A;  5HK4 A;  1F9H A;  3CCQ S;  2CZ4 A;  1SL2 A;  3KLH B;  3I5B A;  1LW2 B;  1DHM A;  4YHH J;  2FGO A;  4OX8 A;  3M8R A;  4KFB B;  3GFY A;  4ECZ A;  2XS7 A;  2RU9 A;  4KGZ B;  4FYD A;  5IM0 A;  4U67 Q;  4CWB A;  1YZ7 A;  4F0K A;  2HNY A;  4HVZ A;  2KHD A;  1S9G B;  4A8F A;  4HTJ A;  3G6Y A;  5KFY A;  1F3F A;  1RT2 A;  1U1O A;  4UOC A;  5IS2 A;  2DGO A;  2DYA A;  2ACM A;  4RL1 A;  2CQG A;  4DR1 J;  1N88 A;  1H7X A;  4DN9 A;  3PKY A;  2FB0 A;  4ERD A;  3PX4 A;  4BHQ A;  2OPS A;  4QYZ K;  3IR7 B;  2XGP A;  3NNH A;  5DM7 Q;  3AJD A;  3PIO Q;  3NGU A;  3CC2 S;  1A9N B;  2FHM A;  5F0W A;  1QDU B;  1IR0 A;  5K14 B;  1HNX F;  2FZG B;  1P1L A;  3MMA B;  3WZ0 A;  4Q43 A;  1W2I A;  1S0N A;  4FDF A;  4HR2 A;  1GAO A;  1UVK A;  1UAW A;  2CPD A;  5J2N A;  3MD3 A;  1IKV B;  1Y5N B;  1YVF A;  2EXU A;  1CSJ A;  5F8I A;  2W1B A;  5KG5 A;  1TK5 A;  4MK9 A;  2HS0 A;  4PWD A;  4ZIW A;  3EGW B;  2KZZ A;  4M5G A;  2VOP A;  4C0O C;  2V94 A;  5B0D A;  2QA2 A;  5D0G A;  4C8L A;  3AQP A;  1RKJ A;  3KUE A;  2BAC A;  2FJA B;  3FBF A;  3OFE A;  1PC5 A;  2NYI A;  4CTA B;  2M70 A;  4LIR A;  2C2D A;  4QU6 A;  3OBI A;  3HZE A;  1B0P A;  3G4S S;  4OI1 A;  4JOU A;  2EFN A;  1C4C A;  1K1S A;  2N3L A;  4X66 J;  4GO7 X;  3V81 B;  4Z2X A;  4Q5V A;  1WJ9 A;  3R7N B;  1Z2L A;  2W24 A;  3FEY B;  2XCP A;  4DL7 A;  3D0I E;  2V4R A;  4QYZ J;  1S9E A;  5C24 B;  4NI2 A;  4CM0 A;  3HFZ B;  2FVQ A;  4K0K J;  5KFZ A;  1REG X;  4ID5 B;  4ALZ A;  4BC7 A;  3Q24 A;  1KR4 A;  1JMT A;  3TP2 A;  4N76 A;  3F41 A;  3PX6 A;  5E33 A;  1TL1 A;  2ADC A;  5GAD U;  4CLZ A;  5IT9 U;  1FFG B;  4UUX A;  3KYL A;  4F4Z A;  1FNX H;  1CPZ A;  3JSB A;  1RTZ A;  1NSQ A;  4LF1 A;  4CM2 A;  2VBY A;  1UWB B;  3SDE A;  1S1W A;  3MXH P;  1S9F A;  1GX6 A;  2DH9 A;  4B02 A;  1FK9 B;  3O8W A;  2VFR A;  3W9J A;  1FWP A;  3FCW A;  2H4Y B;  4UF4 A;  5DQG A;  2WAQ D;  3W62 A;  4RPF A;  2VG7 B;  5LJ3 Y;  4YB5 A;  2LDY A;  2E5J A;  2BA9 A;  2ZD1 B;  4DZ6 A;  5HSP A;  2J0Q D;  2YNH B;  4XIU A;  4B9U A;  3PAC A;  4DX8 H;  2KFN A;  1YJV A;  2YKN A;  3THP A;  2JSX A;  3GYX B;  1AUS L;  4QJV A;  4YR3 A;  2AV5 A;  3C66 A;  1RU2 A;  4J91 A;  4OYP A;  3M8W A;  1OY8 A;  2FLO A;  1T9T A;  2HBR B;  3CDW A;  1GH8 A;  3TRG A;  4RW6 A;  3PKM A;  1XN9 A;  1G4C A;  3MMJ A;  3VVT A;  4M5K A;  1RAG B;  3EGV A;  3KXD A;  3KLH A;  1LW2 A;  1FHT A;  4LBI A;  1K9M T;  3MPW A;  4QPX A;  1R31 A;  2ZH9 A;  2XS2 A;  4K4W A;  1RTI A;  3RZA A;  2AYE A;  2ZFH A;  1JLF A;  3CC4 S;  2GJI A;  2QA1 A;  3K17 A;  1MU2 B;  5F9N A;  1IXK A;  1FXL A;  3AB4 B;  4R25 A;  4OI4 A;  5LT5 A;  3T5L A;  5HJY A;  5BYR A;  5CHC B;  1FKA F;  1EIY B;  1F5A A;  4RWW A;  3BO3 A;  2BAN A;  1XNQ J;  1PSD A;  3A3P B;  1AYE A;  1BQM A;  2DB1 A;  2FZC B;  2CA9 A;  1SI9 A;  1YDL A;  3IC1 A;  2JVO A;  4USI A;  3LTO A;  5A8R B;  2WOM B;  3PCO B;  1AZS A;  2MZR A;  5E2Q A;  4NL5 A;  2JJ4 D;  2D3Z A;  3B82 A;  3UVJ B;  1UEK A;  2I9S A;  1UEU A;  1SH3 A;  1Y4Z B;  2KN4 A;  4JI1 J;  3BGL A;  3JS9 A;  1ZH5 A;  1X5P A;  1DY3 A;  1K1Q A;  4AXI A;  5CZX A;  4EBD A;  1HQE B;  3GJS B;  1CUL B;  2F7V A;  2XSJ B;  3ILO A;  2AKW B;  2IIH A;  2OPQ A;  2MQQ A;  3J81 j;  3UNG C;  4CP5 A;  4PG4 A;  4WU3 A;  2N7C A;  4LRE A;  1MSW D;  1KFD A;  3NAI A;  3M9N B;  1FRX A;  4RJV A;  1RWV B;  4DV1 J;  4B3M J;  3OD2 A;  1VI7 A;  5KT4 A;  1WTB A;  5CCM A;  5LJ5 Y;  3ZC4 A;  2PMH A;  2P8I A;  1JLA A;  3TR5 A;  3VAI A;  2C2Z B;  4HHU A;  2ZWP A;  4NYO A;  4M95 A;  5M2U A;  4A8S A;  3I5A A;  2N4D A;  2HND B;  1JLC B;  2GVZ B;  2ZHO A;  2JOQ A;  1T95 A;  4ZPC A;  3I0R B;  2MLZ A;  1VR6 A;  5LMU J;  1EHW A;  1WHV A;  2XMJ A;  1C1B B;  1VQM S;  1O8B A;  3IO1 A;  1BQN B;  1B7F A;  3TAR A;  4CTA A;  4I69 A;  4KSE B;  3CDB A;  2G0C A;  4DWI A;  4P10 A;  4DFP A;  1LWE B;  3CD0 A;  6FDR A;  1DZ5 A;  5DS7 A;  5LSL A;  2OAU A;  2R4F A;  2YBV A;  2GFF A;  1WUU A;  4R8U A;  4NXN F;  3JAM U;  2KFZ A;  3GIJ A;  1QAI A;  1GMW A;  3EX7 B;  2VV5 A;  2MY8 A;  1FXR A;  3CIM A;  1T3N A;  1SV5 B;  3FZ2 A;  3IXQ A;  4ZPV R;  4C8Z A;  1H73 A;  5HAT A;  2ZHB A;  3HO1 A;  1XWL A;  2JX2 A;  2Z8Q A;  5CD4 A;  2B4P A;  2DNM A;  3IR6 B;  3FDS A;  4DPO A;  2FVS A;  3CCL S;  2XS5 A;  1ZM2 A;  4EEY A;  5CXT A;  2HBZ B;  4ZVU B;  4GO5 X;  2OD4 A;  3PEH A;  2ZHA A;  3OXF A;  4HEA 9;  5I3Q A;  2OPR A;  1UWB A;  3BDE A;  1V5I B;  3CTR A;  4QZV B;  3RAQ A;  2IRU A;  2B51 A;  3BJY A;  4O0I A;  3Q22 A;  3CXC R;  3BSC A;  3TI0 A;  4LMZ A;  5IT9 Y;  3NBP A;  2IC3 A;  4FXW A;  1NK5 A;  1FCA A;  4RX6 A;  2RF2 A;  5EWF A;  2DIT A;  4OYO A;  1X4F A;  3UDV A;  4H4K A;  4DR5 F;  4NLD A;  2OIH A;  3H2V E;  2HFO A;  3NS6 A;  3KK2 B;  2UXD F;  2CJA A;  4B3S J;  3E01 B;  4JV0 A;  2PFD A;  1RXO B;  4ZP9 A;  1D1U A;  2VPY B;  2LVW A;  4ES1 A;  3D0G E;  3BGO P;  1S6O A;  3CMA S;  2R8K A;  1TKZ B;  1JWW A;  3D6H B;  4ED5 A;  2A2D A;  1C0T A;  1SQG A;  3BQ2 A;  5J2P A;  3SQG B;  3RRK A;  3TAQ A;  1FXD A;  3L4B C;  2HVH A;  4KHM A;  4QW8 A;  3H5Y A;  3V5R A;  2BBE A;  1FRH A;  1NHU A;  2HVD A;  2XEX A;  2B3T B;  3W61 A;  4F4W A;  2GHP A;  4LQ9 A;  1EQM A;  3LPY A;  1TKD A;  1N34 J;  2VB6 A;  2WVC A;  4D3H A;  3TJ9 A;  2K3I A;  1FES A;  2XSF A;  3N6M A;  3QAE A;  3JTN A;  5E3A A;  3AJ2 A;  4C8N A;  2GO9 A;  1K0T A;  2DKO B;  4ZVG A;  2JLG A;  5J1E B;  4DPT A;  2A6M A;  4M94 A;  5HBM A;  1H2V Z;  1DUR A;  2LXF A;  1GQE A;  1B0V A;  3PW0 A;  2LQB A;  2BQU A;  1LXN A;  5ETR A;  3PZP A;  3QIP B;  2ASD A;  4L6V 3;  3FJ2 A;  2N4C A;  2BX6 A;  4WXW A;  3TVK A;  1BGX T;  2E1R A;  2LDI A;  2O67 A;  1F6T A;  4EZ9 A;  2QV6 A;  2IFX A;  1RHJ B;  5ITH A;  3ZTS A;  4IG3 B;  1DAX A;  2VJV A;  1CUL A;  1B0T A;  5ETT A;  2IRY A;  2XY5 A;  3AOC A;  4W90 B;  3TAM B;  2IYI A;  2YNG A;  4QIW D;  2RIJ A;  2DD8 S;  2WON A;  3TWZ A;  3Q8R B;  3E51 A;  1NK0 A;  3MM8 B;  2HHW A;  1R8B A;  1F5B A;  1N52 B;  2RHS B;  4ECS A;  1TU0 B;  3KLE B;  4B9V A;  2ZZN A;  4ICL A;  5HMX A;  1FA0 A;  4J90 A;  3HSG A;  4KHR A;  3E2E A;  3DMJ A;  1HWK A;  2IVF B;  3MOJ B;  3MFH A;  4NAS A;  3ITH B;  4NE9 C;  4RO0 A;  4OJ3 A;  3HVT A;  1WC1 A;  2XNQ A;  2GHW A;  4K4V A;  3DC2 A;  4USK A;  3T6J A;  3I0S B;  1RYS A;  3RAX A;  2UUB F;  1TKT B;  4LSN B;  2YX4 A;  1JJC B;  1WWH A;  1EX8 A;  3QJL A;  3A3O B;  2PE8 A;  2R7W A;  2ALY B;  3OPK A;  2G13 A;  3TJA A;  2X7I A;  1VK8 A;  2ZOF A;  1X4C A;  4UW2 A;  3OVB A;  4PXD A;  1VQS A;  2MZQ A;  4WP8 A;  2UXB F;  4OJ1 A;  4ZJO A;  1SQE A;  2ZE2 B;  1TEL A;  4WFA Q;  2XYH B;  3H2L A;  2QYG A;  3JAM Y;  3G96 A;  2MKS A;  1OWX A;  3T9Z A;  2CPX A;  3LA0 A;  3VAK A;  1RHM B;  1EKR A;  2G2Y A;  3OJS A;  3ZZT A;  1NJZ A;  4B9S A;  2BXJ A;  4PR6 A;  2CG4 A;  4Y0F A;  4MKY A;  4KY3 A;  1MNE A;  2X1B A;  3MPU B;  2NXU A;  3P45 B;  2Q6B A;  4TU8 A;  2OSQ A;  1NHK L;  1U2R A;  3KK2 A;  1KQF B;  2ZUA A;  2E66 A;  2J9C A;  3BSO A;  1WKL A;  2CG8 A;  2FUG 9;  2O1P A;  1N33 J;  1WF2 A;  4ZVF A;  2OKQ A;  1X5S A;  2YWG A;  1X5T A;  3MTJ A;  2IJN A;  5T14 A;  4USH A;  2DGU A;  2IDL A;  2ZJR Q;  2QMX A;  3IWX A;  2HLT A;  4K4Y A;  5THW A;  4ED0 A;  1LWC A;  2AWZ A;  3DRP B;  3QAT A;  1FKP A;  3TUI C;  3HMJ G;  3O1L A;  1UVN A;  4ECU A;  2L08 A;  2CYY A;  2B5J B;  5C7P A;  2MMY A;  5D8H B;  2JC0 A;  1VQN S;  2J6U A;  3D1H A;  3NMA A;  2JHE A;  1OMS A;  4K50 A;  3TA0 A;  2E5L F;  2DBB A;  2ZNY A;  2QLJ B;  3R27 A;  1U45 A;  1HL6 A;  3OHB A;  2LFV A;  4YHH F;  3C16 B;  1HNW J;  3MPY A;  4AFF A;  2EK6 A;  3HPO A;  3LWL A;  2KHC A;  4P52 A;  2MZ1 A;  3DLB A;  3KG4 A;  5GMK a;  1FD8 A;  3G6X A;  1D8Y A;  2NXC A;  1KFS A;  1KQK A;  1UEV A;  2HBY B;  2V9W A;  2VFT A;  2DCU B;  3CO0 P;  1CJV A;  2J5A A;  1NBE B;  3PYF A;  1P27 B;  1U26 A;  3AXM A;  3MDF A;  3J7Z 5;  4NCB A;  2Z2M A;  3LGM A;  4FVM A;  4KE5 A;  3G8T A;  3U27 A;  1AT1 B;  3DLG A;  5B7W A;  2IVM A;  4XK8 C;  1JLE B;  2HG4 A;  4CLW A;  4DR1 F;  1C0U B;  2LEC A;  4YB6 A;  3I56 S;  3G87 A;  2DO0 A;  3MEC B;  3KK1 A;  3K89 A;  2AGO A;  2PN6 A;  4C3L A;  3GV5 B;  4OZL A;  4DL2 A;  2H5E A;  2Z2Z A;  2FC8 A;  4FKX A;  4DOZ A;  3RR7 A;  2LEP A;  1FJG J;  5KFE A;  1OO0 B;  2E1M C;  4AL7 A;  2WSC C;  2BKP A;  2BEF A;  2FHK A;  3R97 A;  2JRS A;  3ITH A;  1TKX B;  4P9S A;  3H5U A;  5J1P A;  3C46 A;  1U09 A;  3PFO A;  1C4A A;  4GC6 A;  2HBQ B;  2YKQ A;  3I96 A;  5M2R A;  3QFW A;  3DKD A;  2P6S A;  2DNQ A;  4RKU C;  2BJ3 A;  3D9B A;  2W2N P;  5C42 B;  1DQA A;  4P73 A;  4I6A A;  3DRY A;  2DGW A;  3KDN A;  4JI6 J;  1MRO B;  2KRR A;  4B9N A;  3VZH A;  1LWX A;  5EGY A;  4L76 A;  1LEO A;  5KFQ A;  3RRG A;  4HHH A;  4DI6 A;  3PR5 B;  4K7Q A;  4G1Q B;  4CLL A;  5GAG I;  5LXY A;  1PGZ A;  4B9M A;  2MSS A;  4AT1 B;  2B4O A;  2GVD B;  5HN0 A;  2ZE2 A;  2P5V A;  5FLX U;  4WXO A;  3VGS A;  4TU7 A;  4X66 F;  1KLM B;  1WG1 A;  4KH1 B;  5J2M B;  2IBO A;  2LCW A;  2XHC A;  5DG9 A;  3I55 S;  4CO5 A;  2XZT B;  4K0K F;  2JEG A;  4O4G B;  3KJV B;  4QR0 A;  3PHT A;  3MCM A;  2FLL A;  5CAB A;  3KLF B;  1YRT A;  2YNF B;  3DGP B;  1VHF A;  4K2J A;  1JKH A;  1IBC B;  1SL0 A;  2MKC A;  3OW2 R;  2MGZ B;  2DIU A;  2OEM A;  4WFY A;  1FDD A;  3V6J A;  1PJ5 A;  2KG1 A;  3RW7 A;  1UZH A;  4FKY A;  4OZ5 A;  2AD9 A;  2XO6 A;  3DFE A;  4P2M A;  4U7U K;  1XR6 A;  2X3G A;  1TFW A;  3HHE A;  1U1N A;  3VWS A;  3Q8V A;  1VQK S;  1NB7 A;  1FFW B;  1KOH A;  1R7I A;  3DRP A;  2AMC B;  3SSR A;  5HP1 B;  3R5C A;  4RZR A;  3VHQ A;  4LRC A;  1F9E B;  4LQ3 A;  1RU1 A;  1X60 A;  5AXL A;  3FGV A;  1T03 A;  5KT2 A;  1Q5Y A;  3LP0 A;  3H98 A;  2HS3 A;  2CQB A;  4CYU A;  1NH7 A;  1D8Z A;  4NZ7 A;  1RBA A;  3OFH A;  5DO2 A;  1VQO S;  2OO4 A;  3BBC A;  1VIX A;  4JI4 J;  2KTQ A;  1YQH A;  1ICE B;  2RJZ A;  4J9U E;  3G9C A;  3RBD A;  1VIO A;  2EW9 A;  3GCX P;  3W64 A;  2P9G A;  2RRN A;  1U49 A;  3CJQ A;  5KT6 A;  5KT7 A;  1B99 A;  3CPW R;  1NSK L;  2J9D E;  1IM6 A;  3DU5 A;  2AX1 A;  1KLN A;  4USU A;  4QPT A;  5JJB A;  4HI2 A;  1KQG B;  2J7K A;  3OHA A;  4RW4 A;  1Y11 A;  1L3K A;  3C8Y A;  1Y00 A;  3FFI A;  3W9I A;  2G0I A;  3DI6 A;  4LF6 J;  1GTH A;  2MEW A;  3GPA A;  2PI4 A;  2BUN A;  3KHG A;  4GKJ J;  2C28 A;  1HBU A;  5GVQ A;  4AL6 A;  4RBU A;  5KOW A;  1G3O A;  1IN0 A;  3MMC A;  2GAG C;  2CPE A;  5KG7 A;  3PNI A;  2EC2 A;  4WTY A;  4C8M A;  2F8M A;  1KVI A;  4I6Y A;  4EGL A;  1L3U A;  5D3G B;  4U6P A;  5F41 A;  4AQY J;  2F9D A;  2VA3 A;  1HWL A;  1SXL A;  5HQM A;  2C2R A;  1U4B A;  4DV1 F;  4B3M F;  4U95 A;  2JEJ A;  2BOA A;  1ZM4 A;  2Q1L A;  3OQ2 A;  4WFN Q;  2H5J B;  4JUZ A;  3GJT B;  1LWF B;  2HIY A;  1REV B;  4MK7 A;  3PEJ A;  2KT3 A;  2V2V A;  4CI0 B;  3Q8S B;  4LF4 J;  4DX7 A;  3PW2 A;  2CNO B;  3HX9 A;  3QO9 A;  4OQJ A;  9RUB A;  3MM6 B;  3VVU A;  2QLX A;  4I4B A;  5C42 A;  1JLB B;  1S6P B;  3RB4 A;  2MB0 B;  2YPY A;  5F0U A;  1Y0H A;  1IKX B;  2PI5 A;  2DH7 A;  2HW3 A;  2Z2L A;  4RUH A;  1DLO B;  4DR3 J;  5LMU F;  2DNR A;  2HHV A;  4V1A k;  2Z0G A;  4LSZ B;  2KO1 A;  4EFA C;  2QG9 B;  2JFD A;  1VBY A;  3TUP A;  3GSD A;  1X9W A;  2DR9 A;  3BDP A;  3QWP A;  2C2M B;  2JL9 A;  4K4T A;  4FF1 A;  3U02 A;  4UT4 A;  2D3U A;  4BCA A;  5EUH A;  4LSL B;  4K4Z A;  5J2M A;  3CMQ A;  5ETM A;  3MEE A;  1P6T A;  3GU0 A;  4NLY A;  3KNA A;  1EAR A;  1T05 B;  2MHN A;  2LQ8 A;  2W9C A;  1CBK A;  4ELU A;  5AE3 A;  1T0T V;  3ET6 A;  4X64 J;  5FLX Y;  4NA3 A;  1ZZF A;  2VFU A;  4TY8 B;  1RCO B;  2HHP A;  3EZ5 A;  4W98 A;  3KLF A;  2YNF A;  3G82 A;  1HLW A;  1HBM A;  1VYA A;  4ZS6 A;  1U8S A;  4A47 A;  2WVD A;  4ECR A;  2M4M A;  3UCU P;  2OSR A;  4KH0 B;  3DLE B;  1HWJ A;  3J7Z T;  3ZZU A;  3MWB A;  5KFK A;  3IRX B;  4OJH A;  3BPS P;  1HBO A;  2AEJ A;  3LO3 A;  3VGU A;  4LRB A;  1H2T Z;  2MLY A;  2YPZ A;  4OX7 A;  4O3O A;  1YJN S;  1IBK J;  4PXE A;  4F4K A;  2JC1 A;  3HK2 A;  3ZZ0 A;  4EO6 A;  4Z7C A;  4FPI A;  2DEI A;  3MR2 A;  2ACY A;  4C7Q A;  1T94 A;  4B3S F;  4YQW A;  2CPY A;  1QJH A;  4ZP6 A;  2KXH A;  4EUV A;  1K73 T;  3T5J A;  3ZXW A;  2L9W A;  1X7V A;  1ZAV A;  3Q2T C;  5L1I A;  2MHE A;  3Q0A A;  4ECV A;  2AQ4 A;  5CQG A;  2RU3 A;  3C19 A;  2K06 A;  1WOR A;  2V63 A;  3OR2 A;  1Q8I A;  5K8O A;  2RS2 A;  2UUA J;  2HUR A;  1JXL A;  1YRU A;  2B7C B;  5F8G A;  2KB2 A;  1RT1 B;  4ZPB A;  4NLV A;  1WSV A;  2LXI A;  4FYV B;  3V6D A;  2L3M A;  1XBW A;  3SSS A;  1UCN A;  4X4U A;  3CJ3 A;  4GVL A;  2A2C A;  1N34 F;  2GGP B;  3PFE A;  4ZKA A;  3JYT A;  4WII A;  1B64 A;  2BOP A;  2B4V A;  3BM7 A;  2R2U A;  3UNY A;  1B4S A;  1FRI A;  1FE4 A;  3PR4 A;  4C4W A;  3NMR A;  3MM7 B;  1CC8 A;  5C5J A;  1L3V A;  3KLI A;  2IYG A;  1F2H A;  1XMQ J;  4C11 B;  2DPJ A;  2DGV A;  4NA1 A;  2ZH6 A;  3CME S;  3QPI A;  1R27 B;  1P9Y A;  3MEG B;  2DR5 A;  4IDK B;  3MR3 A;  4PPD A;  4DF8 A;  3MM9 A;  3NEK A;  1IQZ A;  1HQU A;  4W4M A;  4F4A A;  4DLE A;  3L7O A;  2DRB A;  4ED7 A;  5KFA A;  1J2V A;  4V19 X;  3K5N A;  1VRU A;  5D3G A;  2KL8 A;  2ZKU A;  4J9K A;  1FWK A;  2NZ4 A;  4C3M A;  4PRF A;  3S8S A;  4M5L A;  3QSI A;  2PMZ D;  3UD5 A;  1IBM F;  2HVI A;  2OML A;  3K5M A;  1LWF A;  3TJ8 A;  2JFK A;  4KAI A;  3HDS A;  4IOB A;  4WKY A;  4YUD A;  5LXR A;  1EB0 A;  1M90 T;  3DRS B;  2HHH J;  3EGZ A;  2CJQ A;  4TQR A;  2G9O A;  4W92 B;  1RWO B;  3FC9 A;  4CLP A;  3O5T B;  3FCV A;  2BW2 A;  1ZBT A;  4J9M A;  3HLU A;  1N5Y A;  3N28 A;  3ETO A;  2E5G A;  4DV7 J;  4X2B A;  1I1G A;  5CD4 H;  2Y8Y A;  5DLF A;  4ZP7 A;  2V67 A;  5IXU A;  1Q16 B;  4ILR A;  1RTD B;  4QWA A;  2B9X A;  4QR2 A;  4X4Q A;  3VF0 B;  1BMQ B;  3W1Y C;  3MED B;  4ZCM A;  4RUC A;  3BGR B;  4ZLN A;  2BM1 A;  1HI8 A;  2Y1I A;  1UPP A;  1WHW A;  2RRA A;  2ZH7 A;  3PJW A;  1J5O B;  4J37 A;  4Y65 A;  3CT9 A;  2RH3 A;  3UQS A;  4WPA A;  2C2E A;  2RAQ A;  4DV2 F;  1RK8 A;  4HLB A;  2DCL A;  1CJU B;  5KG3 A;  2FD2 A;  4OI2 A;  2CNN B;  3VTI A;  3KLG A;  1S1V A;  4CO0 A;  4TVA B;  3PX0 A;  3HSZ A;  2O5D A;  2DHA A;  3R7B B;  4YP3 A;  2HVZ A;  4IRC A;  5EWE A;  1WOP A;  1RUS A;  2OEK A;  1WHY A;  5F8H A;  2OGU A;  1MMN A;  3ONQ A;  1YBT A;  3FVY A;  1CJT B;  1RWU A;  2MQ8 A;  2Z4P A;  4NLT A;  3ENQ A;  1N33 F;  1IKY A;  2VDI A;  4QW9 A;  3H8Y A;  3MZI A;  3BN4 A;  1EP4 B;  3W5X A;  3HFK A;  1S76 D;  2XCA A;  4UY8 T;  2NSB A;  2R8H A;  2QA4 G;  2H1Y A;  3V4M A;  4E8U A;  2FY8 A;  1NPP A;  1V3R A;  1RT1 A;  3CDE A;  4DPX A;  3V6K A;  4DR2 J;  4JI7 F;  4RW8 B;  4OHX A;  3QRR A;  2GGP A;  1TV6 A;  2BQR A;  2QJ3 A;  5L8R C;  4ZVR B;  1YJ9 S;  1LW0 B;  3D3C J;  1S1X A;  1RP5 A;  4NLP A;  2OPP B;  3IAM 9;  1KS2 A;  2LP4 A;  3QAU A;  3BF4 A;  4ZVH A;  4YS2 A;  2U1A A;  1O5J A;  1NB2 A;  5B0B A;  1HNW F;  4RW7 A;  5DET A;  2RQK A;  1UW4 A;  3EIC A;  1Q53 A;  2H3E B;  2F65 A;  1UVM A;  5DG7 A;  2DNH A;  3L7U A;  3R5J B;  1IR2 A;  1NHV A;  4WWS A;  3OSN A;  1Q78 A;  1RJJ A;  1XK8 A;  3F73 A;  1O6X A;  1LQ9 A;  4I2Q B;  5HAN A;  1EJ7 L;  4U9R A;  3IM9 A;  3KMQ A;  2MLX A;  4P2F A;  5E3R A;  1QSY A;  4BS2 A;  2MZT A;  3UN3 A;  1HQ2 A;  2ILZ A;  4JI3 J;  2HNZ A;  2ROE A;  3KHR A;  3JB9 k;  4M8L A;  4DLG A;  4DV0 J;  4C48 A;  5GAE I;  1K44 A;  3D5M A;  3DU6 A;  2HGL A;  1OQ3 A;  4Z7Y A;  3OT9 A;  2F5G A;  5CCL A;  4JI5 J;  4CLU A;  4P72 A;  4M1K A;  4XO0 A;  4ZIT A;  1R0A A;  3DHW C;  3T1H J;  3CJK A;  1T3O A;  2VQF J;  2UUC J;  1FJG F;  4IH6 A;  3OTE A;  3OVS A;  5KFM A;  1N5S A;  3DRX A;  3THT A;  2P6T A;  3TUJ C;  3CUN A;  4TYB A;  2HHX A;  3CSK A;  5HVH A;  2BYC A;  2CQP A;  4KGK A;  3KJF B;  4FF2 A;  2PGC A;  2H51 B;  3SCJ E;  3AQO A;  3AH6 A;  4JV5 F;  2CQ1 A;  4QU7 A;  2BW7 A;  4DFK A;  3OUY A;  4LUB A;  3QGI A;  5L46 A;  3V6H A;  1LOU A;  4DPW A;  3HJF A;  3KG1 A;  3RBE A;  4ECT A;  5DZ7 A;  2RKI B;  4DUZ F;  2GAH C;  4I1T A;  3VR1 A;  8ATC B;  3PDN A;  3RUB L;  1U0H B;  3BSA A;  2UVW A;  1SCJ B;  4KRW A;  2CKW A;  5I42 A;  2W9A A;  4A4J A;  4JI6 F;  4FYW B;  4X4O A;  2EFO A;  1HI0 P;  4WE1 A;  4NLQ A;  2M88 A;  2B8P A;  1J5O A;  3CJT A;  1GMV A;  3DOM B;  1FKO B;  2WVE A;  4LR8 A;  3WX8 A;  2PA3 A;  3MOZ A;  4DR7 F;  2CPZ A;  3LP2 B;  3IN5 A;  2U2F A;  3OTD A;  2WSF C;  2CQ0 A;  1X4B A;  3W66 A;  1FRM A;  4ER8 A;  1NJX A;  2YWK A;  4DL6 A;  5KFB A;  3N4W A;  2JLE A;  2PA8 D;  3M2U B;  1UFL A;  1XTZ A;  5A8K B;  2WCX A;  2K2P A;  1TVR A;  3W5Z A;  1KSP A;  2J0X A;  3IG1 B;  1RAA B;  2WBM A;  1RA6 A;  1WOO A;  4Y2C A;  3MAQ A;  1S0O A;  2MKY A;  5LOQ A;  4AD6 A;  1CJK B;  3KUH A;  2KJV A;  2HZV A;  2GJ2 A;  2V8P A;  3I31 A;  2UXC J;  2XY7 A;  4ZLL A;  3TUZ C;  1YRX A;  3G6V A;  3NOC A;  4V19 J;  1T8E A;  2AJF E;  1I51 B;  3NOG A;  3FEX B;  1GMU A;  5IQQ A;  1ARO P;  3GQC A;  1OPZ A;  4JI8 F;  2E1P A;  2DXD A;  2ILY A;  3R6L B;  2C3M A;  5EDW A;  4TQS A;  1UPM B;  2BZ2 A;  4XPE A;  2R8J A;  1TUG B;  2ZC4 A;  3BB5 A;  3L9Z A;  3M30 A;  3W2V A;  4RU9 A;  5DGB A;  3JSM A;  2Y1R I;  2HWT A;  1WC3 A;  3BKF A;  1ZZN A;  1CQM A;  1WG5 A;  4NML A;  3D6T B;  3RW6 A;  1FFS B;  2NRE A;  4Y00 A;  4JI4 F;  1NUE A;  4OZN A;  5G4D A;  3GP9 A;  2BQ3 A;  2IHR 1;  2XLI A;  4Q8E A;  3GON A;  1ZTW A;  2WVF A;  2ZVI A;  5DGA A;  4CZC A;  2AX0 A;  4YME A;  3SSQ A;  3TZY A;  4DHV A;  5CA5 A;  1XMB A;  1TL3 B;  4IYQ A;  3AD9 C;  2D3O 1;  4TLQ A;  5L9N A;  2XGQ A;  3M9M B;  2BAB A;  2WB1 D;  3QID A;  2HNY B;  1P8G A;  4KC5 A;  2L48 A;  5HO4 A;  2LEB A;  3N9U C;  1YLX A;  4J9R A;  2P2C B;  3PW4 A;  2VPW B;  1PIE A;  1RT2 B;  2DH8 A;  3M8Q A;  4IQX A;  5E3P A;  3ZZP A;  4LF9 J;  2HWH A;  2C2K B;  4GKJ F;  3I87 A;  4WZQ A;  2FIU A;  5BYS A;  4ZJQ A;  4P2X A;  3DDK A;  2XYG B;  2QLB B;  2VQE J;  3LWM A;  2FVC A;  2N3O A;  2XLK A;  4KBI A;  2OPS B;  2EVZ A;  3O3L A;  1JJH A;  1OPI A;  5ETL A;  2W4D A;  1WEX A;  4ECY A;  5K8P A;  2KYZ A;  3GMG A;  4F67 A;  2F8H A;  1MWY A;  3QJJ A;  4WYL A;  3U7J A;  1S4F A;  1G6B A;  2AJ2 A;  3RU0 A;  3PRD A;  2M5Y A;  4HAC A;  3L3C A;  4X84 A;  4M5H A;  2XUL A;  4O0N A;  3CJR A;  3LAN A;  4M5D A;  2HQC A;  5BR8 F;  5J2N B;  1CEZ A;  3RB6 A;  4LF4 F;  1T9W A;  2MKI A;  3CJ2 A;  1KP6 A;  4JYA F;  3B4M A;  4O3R A;  2J8A A;  1M1G A;  3G2X A;  1SC6 A;  2H65 B;  4FS2 A;  4PWD B;  1KD1 T;  1SB6 A;  4KO0 B;  4DR3 F;  3E3X A;  4ZPW R;  2B9W A;  4KV8 A;  3OL7 A;  3W2W A;  1ELO A;  2IDE A;  2QLW A;  1N6Q A;  1D09 B;  3DOM A;  3C6T A;  4DV6 F;  1QTM A;  2F8E X;  2FTR A;  4NRU A;  2GQ2 A;  3A12 A;  2E7X A;  4ILL A;  1RTH A;  5GAG U;  1URR A;  5ETV A;  1SL1 A;  4PQU A;  2W8K A;  1X4A A;  3WIV A;  3AHP A;  4NOH A;  3B78 A;  2ZBI A;  3M2U A;  5A6P A;  1SUQ A;  4FVC A;  2ZOM A;  2BRL A;  2UUW A;  5KT5 A;  1S9E B;  1S1U B;  4ZVE A;  4NI2 B;  4NEZ A;  1VHI A;  2C3O A;  3KJN B;  2MPU A;  4KYZ A;  2ZNZ A;  2OFH X;  4HT7 A;  3CCE S;  4B3O B;  3QNW B;  2Z57 B;  4TYA A;  1HHQ A;  1P9Q C;  4DJB A;  3G71 S;  3K2Y A;  1XMO J;  3R8Y A;  1WG4 A;  2OP5 A;  1S12 A;  4URG A;  3KNG A;  2YH1 A;  1GNK A;  5KFP A;  1WSR A;  2QMU B;  1NND A;  1S1W B;  4PCQ A;  3KK3 B;  1N36 J;  5C25 A;  3DGV A;  2NSC A;  5D78 A;  2VU5 A;  2GMJ A;  4ILM A;  4JB8 B;  1D0E A;  4D3G A;  4F4X A;  3DLK B;  1HPZ A;  1Z2Z A;  1U47 A;  3IAS 9;  1A7G E;  2MY7 A;  4ANE A;  2OD6 A;  1AXQ A;  4U7C A;  1RAO A;  2HQ3 A;  2DNK A;  1QUV A;  3RBZ A;  2FJB B;  2UUA F;  3AY0 A;  5HMY A;  7AT1 B;  4LBH A;  3QBC A;  2LMI A;  1U48 A;  4YR2 A;  4DQQ A;  3ADA C;  1IQT A;  2BJ1 A;  4IFY A;  1RT5 A;  4B17 A;  1RTI B;  3V4I A;  2IJR A;  2NUU G;  1BC6 A;  1TL3 A;  1VQ4 S;  2AZ1 A;  2K1R A;  1ZYQ A;  4MYT A;  1JLF B;  3AJ1 A;  3TX0 A;  3P5T L;  4O3P A;  1SC4 B;  3FBB A;  2NZC A;  1O51 A;  2QZ8 A;  1QAX A;  4LVN P;  2LU2 A;  2F4V J;  1XMQ F;  5AT1 B;  2EK1 A;  4BC9 A;  3OLB A;  3PO4 A;  3MFI A;  2BAN B;  3RAM A;  1RWX B;  4N8N A;  1BQM B;  1KQS R;  2CQ4 A;  3BYP A;  4OZ3 A;  3OL8 A;  4C8Y A;  3KUG A;  2LEA A;  3J81 U;  2FPH X;  1AZS B;  2HK3 A;  2R7T A;  3UN2 A;  2B0G A;  3R1H A;  1R0B G;  2AJ4 A;  4O3N A;  4DL4 A;  3X3U A;  3AOB A;  3GSI A;  4USW A;  2DTJ A;  2DY1 A;  2YY3 A;  2V4Q A;  2OPQ B;  3CCS S;  3ZTR A;  3H59 A;  1U1P A;  3D4J A;  3GJQ B;  1H38 A;  2DXE A;  4TLR A;  3CCZ A;  3CO9 A;  4C8O A;  3HJV A;  5HMZ A;  2AF6 A;  1RQ0 A;  4QIG A;  2BJ7 A;  2R7S A;  3SFU A;  1UZD A;  2HHH F;  4CO1 A;  1VQ9 S;  4CIO A;  1JLA B;  4N41 A;  2ZDO A;  2IAJ A;  3BQ0 A;  5ADZ A;  2QL5 B;  4OHZ A;  5IQ6 A;  1CS4 A;  4Y3C A;  2AYM A;  1IJE B;  4KO0 A;  1WOS A;  3S7R A;  2DNL A;  2KH9 A;  2PDA A;  4LF7 F;  1PKU A;  2GS8 A;  4IOC Q;  2MKH A;  2VG5 A;  2V4J A;  2GQC A;  4OIX A;  2VDH A;  7FD1 A;  4PUO A;  2UZA A;  1S6Q B;  3AAW B;  2QEX S;  4F0M A;  3OL6 A;  5D15 A;  5IV4 A;  2YQ1 A;  1RAJ A;  1NME B;  2HWI A;  2HFV A;  1A6L A;  4F02 A;  2DK2 A;  1S48 A;  3NWR A;  4R8U B;  1RAB B;  5FDL B;  3Q89 A;  1S7I A;  1N5Q A;  1S1U A;  1F60 B;  5LL6 d;  3FEZ A;  1FWL A;  2QN6 B;  3VAL A;  4B3O A;  3NGD A;  4KB7 A;  3I5C A;  5H9F K;  4C2M A;  1Q82 T;  3CCR S;  2CZ9 A;  3O2I A;  2XWX A;  4DCP B;  4CH7 A;  2OPR B;  1RTJ B;  5KFG A;  3W3S A;  3KK3 A;  2ZH8 A;  2VJU A;  1NRK A;  2FHJ D;  5DDQ C;  1N48 A;  3HHL D;  3NBP B;  3SI8 A;  2IC3 B;  5B0A A;  3H7H B;  2RF2 B;  4ZCI A;  4C8K A;  2DIS A;  4QBU A;  2LLZ A;  3DLK A;  3FCH A;  4N47 A;  3PV8 A;  3B4D A;  4ELV A;  1FDB A;  4LIW A;  2A6O A;  4Y2I A;  4Q0B A;  1Q95 G;  2NXN A;  4O4R A;  4LF5 F;  1F2G A;  3R3T A;  5GME A;  1GXU A;  4KQZ A;  1R0C B;  3SV4 A;  4HDH A;  1C0T B;  2RDI A;  3F0N A;  5J2P B;  3K58 A;  3BO2 A;  5JVH Q;  2B8Q A;  2Z58 B;  2J8S A;  1S49 A;  2DHS A;  3W7B A;  3AD7 C;  3OLA A;  2KM8 C;  3D2W A;  2AW0 A;  2ZC3 A;  2F63 A;  1M0S A;  5H9F J;  1UP1 A;  4PXC A;  4RUA A;  1ZS6 A;  2JNJ A;  4WFZ A;  3HHK A;  4G3I A;  1RI7 A;  2XLJ A;  3CED A;  4GRS A;  5SUH A;  1WKJ A;  4OMF G;  2MST A;  3EXC X;  2Q6C A;  5MAO A;  4WFB Q;  3MPD A;  1UJ5 A;  4MTP A;  1J5E J;  2XMV A;  3BR8 A;  3NP5 A;  2PD1 A;  1IR1 A;  2B9E A;  5HBM B;  3H2U B;  5FD1 A;  3OXL A;  1SKU B;  2MQM A;  2XMA A;  4X4V A;  4JI2 J;  2VOD A;  5K8M A;  2BJE A;  4ZVT B;  1FJC A;  1MN9 A;  3DOK A;  1RT6 A;  4TN2 A;  1QM9 A;  4PXB A;  3M8P A;  4JI3 F;  4TXS A;  1OYE A;  3RB3 A;  5KG6 A;  1Q86 T;  4J9N A;  3HT0 A;  4DV0 F;  3CCM S;  1KN6 A;  1UTA A;  3MCO A;  3H4D A;  5KFN A;  4UST A;  2E5H A;  1PC4 A;  1EQ0 A;  4JI5 F;  1SKS A;  1R8P A;  3J81 Y;  4QWC A;  4K5S A;  4J9S A;  2HZC A;  3I4H X;  2CNL B;  2YNG B;  3T1H F;  2R8I A;  2VQF F;  2WON B;  5AXN A;  2UUC F;  2Y8W A;  1SIZ A;  4N56 A;  2CZV C;  3VAH A;  1Y5L B;  5BXI A;  2YNI B;  4OYA A;  5I3U A;  1ZA1 B;  1YTY A;  1TAU A;  3AOA A;  4R0E A;  5L1J A;  2ASL A;  1SPB P;  4ZP8 A;  5LMN J;  4ICL B;  1TR0 A;  3M7V A;  3DMJ B;  4F3Q A;  2CAD A;  5DDP C;  5AXK A;  1RHR B;  1RLD A;  4DF4 A;  2JVR A;  2NXJ A;  3HVT B;  4QCL A;  3TVZ A;  5KOX A;  3NNC A;  1QVF R;  1S6Q A;  5KFT A;  1Y7P A;  2DY9 A;  2SXL A;  1Q79 A;  2I6W A;  2B7B B;  4S0M A;  3HSD A;  3QWU A;  2D9O A;  4RNO A;  3EJM A;  4IOA Q;  3PY8 A;  4M5N A;  1E6Y B;  5A6W A;  1YJU A;  3GR1 A;  1FRL A;  3EDQ B;  5KFR A;  4F50 A;  5FDL A;  3N01 A;  3Q8U A;  1VQ8 S;  1SBR A;  2E9R X;  2ZBP A;  2CQI A;  3IP0 A;  4IO9 Q;  3D1O A;  4G1P A;  2HAI A;  1HFE L;  1YKW A;  3GFX A;  2W4P A;  2QMW A;  3MEK A;  1HYS A;  3ZZR A;  1HMV B;  3SQO P;  2ZIT A;  3PHE A;  1WC5 A;  3HUL A;  5E41 A;  4WBF A;  4CLK A;  2VF3 A;  1WDD A;  1Q7Y T;  2CAJ A;  3K5L A;  4ZOS A;  1NXI A;  1RTJ A;  1NJY A;  4F26 A;  2C3P A;  2R2S A;  1NU4 A;  2BJ8 A;  1IVZ A;  2W7P A;  3QQC D;  2Q79 A;  1VJW A;  1NJW A;  2R42 A;  3SXL A;  1NZ8 A;  5LM7 E;  1N0U A;  2ASJ A;  1X4H A;  3CD6 S;  4CO3 A;  4K4U A;  4B9T A;  4L74 A;  4NLS A;  4WJB A;  1NDL A;  4ZLJ A;  3M2R A;  2F4F A;  3RTV A;  2UU9 J;  3DCA A;  3D68 A;  4FF3 A;  3NGT A;  1ZM3 A;  2Z2Y B;  2OJ3 A;  2IVY A;  1W26 A;  1ZM9 A;  2QL7 B;  3R5B A;  4EBC A;  1Q4R A;  3FQL A;  3BSN A;  2AP6 A;  1JLQ A;  1U1K A;  3HI9 A;  3P6Y C;  3E8O A;  2FLN A;  1LWC B;  4DR5 J;  4DSF A;  1KON A;  2HEK A;  1TQL A;  3LF0 A;  1FKP B;  4FYX B;  3WX4 A;  2DNN A;  2UXD J;  3OVA A;  3R1L A;  1RSC A;  1RWN B;  2IA6 A;  1RZM A;  1BUX A;  3CJ4 A;  5HLF B;  5JUM A;  3JTP A;  2KFY A;  3MF5 A;  3GIR A;  4Q2M A;  1L3S A;  1HNZ J;  1YIT S;  4FBU A;  1PAU B;  2DNG A;  3VV2 B;  1VLO A;  1QSS A;  1N56 A;  4I0W A;  3VAJ A;  3KWM A;  2JLF A;  1M5O C;  2V0N A;  2HRY A;  2W2O P;  3NKY A;  2XC9 A;  3PG9 A;  1NDP A;  1Q8B A;  3M1V B;  2WVB A;  2ZWO A;  3FSY A;  4DDF A;  1BE4 A;  2PMW A;  4USM A;  1BHN A;  1HWU A;  2V69 A;  2PT0 A;  2GA7 A;  4GVB A;  3UW1 A;  1CJV B;  5CH7 B;  5H1S V;  4IFV B;  2X3D A;  3N5B A;  2LXU A;  4Y2A A;  2VFV A;  4QWB A;  3ZZO A;  7FDR A;  4LF9 F;  3DLG B;  2HRU A;  3JQK A;  5F3T A;  2BE2 A;  2IM0 A;  5DQI A;  3LGH A;  4L75 A;  5CAA A;  1OIA A;  3KK1 B;  4DFM A;  3R2D J;  1KVK A;  5GAE U;  2ZJP Q;  1TP7 A;  2DPI A;  4PYA A;  5LSR A;  1W7W A;  1VC6 A;  1BWE A;  1R6Y A;  1GX5 A;  2ZH1 A;  4CT9 A;  2YNI A;  3NWG A;  4C3K A;  1GEH A;  2KYX A;  4IRK A;  4RNF A;  1WEL A;  4U7U D;  4DUY J;  5KG4 A;  1UJ4 A;  1S0M A;  3IA0 A;  1BQX A;  4ZJL A;  2BMB A;  3ILJ A;  3OSP A;  3K0J A;  2Y3Y A;  2XZW A;  4N8O A;  2XG8 A;  2V2K A;  4WTO B;  3D54 A;  3RG6 A;  3ISN D;  4L73 A;  4OLP A;  5E3Q A;  4EWT A;  2E7V A;  4K59 A;  1FF2 A;  3TEG A;  1HHT P;  2J7U A;  3OFF A;  5L1L A;  1WEY A;  2LYV A;  3H90 A;  1E6Y A;  2H4W B;  1VBX A;  5ETN A;  1S97 A;  3DOL A;  1R6V A;  1KOO A;  4B08 A;  2VBW A;  3QLH A;  3LP1 A;  4OHW A;  1SKW A;  1L5U A;  2DHH A;  3PM9 A;  4F8R A;  5I4M A;  2R9L A;  4WP9 A;  1RHQ B;  3VAF A;  1WC4 A;  1HMV A;  5A8W A;  4BWM A;  3OTO J;  4ZCK A;  3DLL Q;  3I4P A;  2DIV A;  3EZO A;  1NK4 A;  4DSE A;  1FRJ A;  2PSZ A;  1NO8 A;  4I67 A;  4IUF A;  3DRR B;  3ENA A;  3M6W A;  2QTW A;  1D3W A;  4FXD A;  1RB0 A;  2HK2 A;  1R3N A;  2Z30 B;  2VKZ G;  3DM2 A;  4U96 A;  1W25 A;  1ZPW X;  1Q8L A;  1IBL F;  3HVA A;  1SC1 B;  3MMB A;  1XMO F;  2DRD A;  2UXB J;  1WI8 A;  2G2O A;  1O0P A;  4OJG A;  1YJR A;  1JKH B;  1RAF B;  2WHO A;  1VBZ A;  3M2V B;  4DV5 J;  3MAA A;  5G0R A;  4DFJ A;  3UCZ P;  1NKE A;  2BR0 A;  1N4L A;  3RB0 A;  3I32 A;  4RNH A;  3IFE A;  4LJM A;  5FII A;  3DLJ A;  5D0H A;  4WU2 A;  1IJF B;  3BH6 B;  2CJB A;  1VGY A;  1K47 A;  3BGF A;  2DR8 A;  1XEZ A;  1Y3K A;  4I2P B;  4UUW A;  2ZBC A;  1RCX B;  3HZG A;  4Z37 A;  2HHU A;  2HFU A;  3ZZZ A;  1X9M A;  4UZC A;  4P7V A;  2KT5 A;  1T7P A;  3FBE A;  2E1A A;  1HNI A;  1LFW A;  1HBN B;  1QVG R;  2CXE A;  2KRB A;  1V6H A;  2R3V A;  5HLF A;  5T7L A;  3DNC A;  2CQ2 A;  1PAE X;  1GTE A;  4DR4 J;  1T03 B;  2VH7 A;  3LP0 B;  3NL0 A;  1XER A;  4MIB A;  2B56 A;  4CYU B;  3GV7 B;  4DMZ A;  1E6V A;  5HL7 Q;  4IH5 A;  1U24 A;  5AE1 A;  3T1Y J;  3M1V A;  4RUB A;  5HMW A;  3QYY A;  4NYP A;  2VUG A;  2D69 A;  2NYH A;  3I82 A;  1VRT B;  2QX0 A;  2J0W A;  4K2X A;  2F4V F;  1ZAX A;  3D1Q A;  2WW4 A;  1RT7 A;  2E5L J;  2FJV A;  4IFV A;  3CB4 A;  2G1H A;  5DDO C;  4F4Y A;  3SBM A;  2MKK A;  5IFM A;  4RW4 B;  3FFI B;  4OI3 A;  1VDH A;  1KNZ A;  3DI6 B;  3K59 A;  2Q3P A;  3Q8P B;  1BLU A;  2Y0S D;  2OTJ S;  2DJW A;  4M5I A;  4NCG B;  1HBU B;  3B6B A;  2YX7 A;  1PJ6 A;  4RW9 A;  3D67 A;  1R8H A;  1VFJ A;  1DBD A;  3TEH B;  3MMC B;  2X1A A;  2HLU A;  4B3R J;  3UPF A;  4O44 A;  1Z1Z A;  4HHJ A;  3MR6 A;  3D0H E;  3EZU A;  4TU9 A;  1Y3J A;  3EUN A;  3DYA A;  3WC2 A;  3R5A A;  1I3O B;  4FNI A;  1FEE A;  4MMO A;  4DR6 J;  4A48 A;  4DG1 A;  4BLG A;  3C6U A;  4DEZ A;  4WF9 Q;  2V8D A;  3T41 A;  2EBG A;  1I94 J;  2IM2 A;  4G6V B;  5F9L A;  1JX4 A;  3LW5 C;  3JQM A;  3J7A 1;  2Y1L B;  1YK9 A;  2YKM A;  3QO9 B;  5EHH A;  3KMS A;  3TAP A;  2ALZ A;  4NXM J;  5A2Q U;  3PJX A;  3M32 A;  2KXN B;  4YY3 J;  4JV2 A;  4OZ1 A;  2W2M P;  2W25 A;  2C1E B;  2QFI A;  4XDD A;  2EWH A;  2CJY B;  3LAM A;  4WIQ A;  3NCR A;  3FSX A;  1U6F A;  3OV7 A;  4YEA A;  4P2S A;  2IY5 B;  3M6U A;  1U0S A;  1F1B B;  3OTC A;  2AHO B;  4ZVS B;  2NLW A;  1I5O B;  3FSI A;  2YQ0 A;  1RLC L;  1U2F A;  4KPC A;  4XAK A;  3EYZ A;  1C1C A;  1SJ3 P;  1KHW A;  1U1Q A;  3DRR A;  3MEE B;  3QRP A;  4HI1 A;  2L41 A;  1HD0 A;  2B6A A;  3N6N A;  2W9C B;  3H5S A;  3ET6 B;  4WFX A;  1RWK B;  5CYM A;  3K5P A;  3G82 B;  3A4T A;  3BEG B;  2FQQ B;  1HBM B;  3M2V A;  1PBU A;  5F3Z A;  4NYZ A;  2Y1J A;  3AXK A;  1AA1 B;  1DTT A;  1GMW D;  5E3C A;  4ECW A;  1RAC B;  4MFB A;  1HBO B;  4ZN3 A;  3J7Y I;  1QY7 A;  2HRT A;  1JXE A;  2L9D A;  3P49 B;  4M5J A;  2VKR A;  1VS3 A;  5K20 B;  4I2P A;  2XBP A;  1FVS A;  3U1L A;  3BGU A;  4M63 A;  2DVI A;  4MK8 A;  3TAN A;  4DX5 A;  3NRB A;  3FRZ A;  1QAJ A;  4OZ2 A;  3P8B B;  3VQS A;  4A8Q A;  1U1M A;  2XMU A;  2LA4 A;  3ISZ A;  4F3O A;  3LAK A;  5LSO A;  3FBC A;  3T9N A;  1HBN A;  2V5H G;  4DPY A;  2AGQ A;  3GIL A;  3X1L B;  4J9Q A;  1TZ0 A;  1C2P A;  4N77 A;  2FVR A;  1S7H A;  1V3Z A;  3NY0 A;  3OR2 B;  1KTV A;  1G2E A;  4LBP A;  2HHT A;  1IKW A;  4PEO A;  1QE1 A;  3MGJ A;  2KZM A;  2QGF B;  4CQ1 A;  3J7A N;  4IQM A;  3D66 A;  1SH0 A;  3OJU A;  3P96 A;  1DTQ A;  1T9U A;  3K7R A;  3V6D B;  4I7F B;  1TL7 B;  1GXL A;  1RT3 A;  2JZ5 A;  1P1T A;  3T5H A;  3JYT B;  5L1K A;  2BV3 A;  3UDL A;  3MI7 X;  1S1T A;  5M2P A;  1VRT A;  2AGP A;  3HCX A;  1J5E F;  3R2C J;  1VQ6 S;  1SJ1 A;  1X0P A;  3GIK A;  2W7A A;  3KLI B;  3DN9 A;  2J0S D;  3AA8 A;  4K4S A;  1XNQ F;  2E9Z A;  5AJ3 J;  1X31 C;  4YDD B;  2V8G A;  4HH1 A;  4KFB A;  4JI2 F;  2C3Y A;  1URN A;  3CWJ A;  3GJR B;  4NCG A;  3RYL A;  3CC7 S;  1QLN A;  2WSE C;  3TA2 A;  1D9A A;  1U7L A;  2ASY A;  2VPX B;  4DS5 A;  3MM9 B;  1S9G A;  1UWA A;  1HQU B;  4JI1 F;  4DV3 J;  3M6X A;  3EXY A;  2ATL A;  3IGN A;  5KT3 A;  1MN7 A;  1D9D A;  4MKA A;  2D74 B;  3JSR A;  1UFW A;  1VRU B;  5DRK A;  4GC7 A;  2CQH A;  2BKN A;  2EEY A;  4X62 J;  3ZTQ A;  4P75 A;  1XNR J;  1DFD A;  2DR6 A;  4MIA A;  5ETO A;  3EGN A;  1Y5I B;  2K8G A;  2GIQ A;  1CC7 A;  4Y28 C;  4LRD A;  1IUJ A;  3IS9 B;  1OSC A;  4MIW A;  4DV4 J;  2N7Y A;  3V2U C;  5LMN F;  1RKI A;  1APS A;  3CCW A;  2RQ4 A;  2XB2 D;  5K14 A;  4OV6 A;  3MMA A;  3TZZ A;  4EK2 A;  3BKU A;  4DL0 C;  2K7J A;  3ICL A;  1N5Y B;  4HDG A;  3LPE A;  1HIY A;  5KFV A;  1B3T A;  1NCL A;  4X4P A;  1IKV A;  4HL9 A;  3PO5 A;  3NNA A;  2ZZM A;  4JI0 J;  5JVG Q;  3BO4 A;  1YZ6 A;  5A2Q Y;  1H72 C;  4N5S A;  1H0H B;  4ENO A;  1B70 B;  2MJN A;  5HVF A;  3ZFV A;  1YJT A;  4JV1 A;  3I9Z A;  3H25 A;  2XO7 A;  2IM3 A;  4B9L A;  1K8A T;  3EWG A;  3CW2 C;  2G2Z A;  3R6G B;  3NGR A;  2E29 A;  2GW8 A;  2BVZ A;  4PPZ A;  2BKO A;  2KJW A;  5FJ4 A;  4C9D A;  3KLG B;  1G7C B;  4AXJ A;  2C3U A;  3M05 A;  3V81 A;  1S1V B;  4F36 A;  4OZ0 A;  2IMW P;  2QA4 S;  1N5V A;  2PO4 A;  4OZJ A;  4KT0 C;  4J9L A;  5C24 A;  4Q2L A;  2CJX B;  4LFA J;  2PC6 A;  5A0Y B;  3T3F A;  3GG1 A;  4ID5 A;  3RRH A;  3KHH A;  4DL5 A;  3WHI A;  1U8W A;  4F0H A;  4UOG A;  2D7S A;  2DGS A;  2IJF A;  5EX3 A;  2HFZ A;  1Q1K A;  4WK1 A;  3BKT A;  3HHL C;  4PG8 A;  4OYX A;  4DU8 A;  1NAQ A;  2UU9 F;  1RBO B;  5ETP A;  1NK7 A;  1NDK A;  4TNO A;  2HVE A;  1IKY B;  3HP6 A;  4DN0 A;  2CUY A;  4YR0 A;  1FK9 A;  2UUT A;  2FJD B;  5D0R A;  4AL5 A;  3CDU A;  1YJ7 A;  2KM8 B;  2VG7 A;  5B0E A;  1FVQ A;  1XR7 A;  2ZD1 A;  1S77 D;  3IWL A;  1UVI A;  1JXV A;  2XMW A;  3TO8 A;  2YNH A;  1FER A;  2UV8 G;  3PYG A;  4B3T J;  4I7F A;  3VQT A;  3NCQ A;  1MG7 A;  1TL7 A;  1VQ7 S;  1TV6 B;  1HNZ F;  5GAH U;  5DM6 Q;  2PEB A;  2EPI A;  1KKH A;  1HHS A;  1S1X B;  4ZHR B;  3MD1 A;  2RIL A;  2WB4 A;  2GMH A;  4M5M A;  1VK3 A;  2H48 B;  4MH8 A;  1SJQ A;  2R7V A;  1HD1 A;  5RUB A;  4CCH A;  3BBB A;  3NAH A;  4I6W A;  4RW7 B;  4IH7 A;  3US5 A;  5KTQ A;  1YBU A;  4L72 B;  1SQF A;  3CNQ P;  9ATC B;  2A3J A;  1FX4 A;  3GCW P;  1ROF A;  3BBF A;  3B54 A;  1AUD A;  1MU2 A;  2NPI A;  1VJQ A;  5KG0 A;  4H4O B;  3ZO7 A;  1MWQ A;  4WYW A;  5KFS A;  2WBR A;  2V2Z A;  3FMB A;  3T6B A;  4LF8 J;  1ZOT A;  5F8N A;  4WP3 A;  1OY9 A;  3AT1 B;  2HNZ B;  3H20 A;  2EBE A;  2QRR A;  5H9E K;  3GFH A;  4UOF A;  1HI1 A;  3FZB A;  2GZO A;  2A10 A;  4P6Q A;  1JB0 C;  2HFS A;  4EI2 A;  1X4D A;  5JMN A;  3MM5 B;  3WC0 A;  1FEH A;  1NSA A;  5A8R A;  4DQS A;  2WOM A;  2YTC A;  1N54 B;  3CD5 A;  3QMQ A;  1R0A B;  2CJ9 A;  1U2C A;  3IWN C;  3CJK B;  3UVJ A;  1KBR A;  3IS9 A;  2MZS A;  3MUR P;  4DUY F;  2MZJ A;  1HQE A;  2XSJ A;  1ACM B;  2W4C A;  5HQL A;  3EVO A;  4MKV A;  2JDJ A;  3R5G A;  2CVE A;  5AXM A;  3KLV A;  2XZD B;  2R7Q A;  3OUY B;  1IM4 A;  4IR9 A;  4Q45 A;  4TKT A;  3B8H A;  4YB1 P;  2R7X A;  2AYG A;  1IBM J;  4DXL A;  1WC6 A;  3UDE A;  2QYC A;  4ED1 A;  3GZ7 A;  4NX9 A;  4USV A;  2OH2 A;  5I42 B;  3D7S B;  3DXB A;  1NSP A;  2GCF A;  1FI4 A;  5L39 A;  3QT7 A;  2HND A;  4RBV A;  1JLC A;  2GVZ A;  1SJR A;  2P9C A;  4EYI B;  4WE1 B;  3EMT A;  3I0R A;  1JJ4 A;  4F2R A;  5EWG A;  3R7S B;  1GXT A;  1UA1 A;  4X4T A;  1SKR A;  4QIV A;  1C1B A;  1BQN A;  5H9E J;  1B7Y B;  2JEI A;  2L9N A;  3C14 B;  3QJP A;  1RT4 B;  4YDX A;  2I0X A;  2QL9 B;  3OTO F;  1LWE A;  2J76 E;  2OHD A;  3DLH A;  1ZA2 B;  5A76 A;  3CGI A;  1NPR A;  4LF2 A;  2W2Q P;  3PRV A;  1FTR A;  4R5P B;  3CJ0 A;  4DSK A;  4A8X A;  1N0V C;  1ULR A;  5A0Y A;  2XI2 A;  1TVR B;  3W65 A;  3JTO A;  1SV5 A;  1RIS A;  2F9J A;  4DV2 J;  4HH0 A;  3LH2 S;  3BZQ A;  4P71 A;  2ZH2 A;  3I9V 9;  2UP1 A;  4RNN A;  4DV5 F;  1JQG A;  4CH0 S;  1KHV A;  1TAQ A;  2I8E A;  3QZ8 A;  1VC0 A;  3TVY A;  5IZH A;  5CYQ B;  2CWK A;  3NLC A;  2RDJ A;  4G1I A;  2MDA A;  4EZ6 A;  3BPD A;  5KFH A;  4KGM A;  2RQC A;  3PVX A;  3GIM A;  2LQ5 A;  3UE2 A;  4NLR A;  2HKE A;  1CVJ A;  1Q7L B;  2W8L A;  2AT1 B;  2JH3 A;  1AB8 A;  5JXS A;  2HPU A;  4MT1 A;  3HF5 A;  5C2C A;  3POT B;  3CCJ S;  2IPO B;  3E01 A;  4X4S A;  2COL A;  3VAM A;  2MQO A;  2M0G B;  1PYS B;  2GC8 A;  2PII A;  1KVJ A;  1H3D A;  3SIP B;  5KFJ A;  1TTH B;  4WZM A;  1TKZ A;  1QSL A;  4DR4 F;  4YN3 B;  3M30 B;  4ZHR A;  3W2V B;  2DNZ A;  3TQE A;  1FO1 A;  1QD1 A;  2GIF A;  3MTK A;  3GLJ A;  3SQG A;  3JSM B;  4OI6 A;  3C2P A;  4FNH A;  2G0J A;  3BRE A;  2ZOG A;  4H4M B;  1GFW B;  3SCK E;  3T1Y F;  1WEZ A;  2V34 A;  1JNZ B;  4ZPA A;  2CQD A;  5HVG A;  3IGV A;  2KVI A;  4JI7 J;  4Q44 A;  1RAI B;  2LQJ A;  3ENV A;  3VGV A;  1WI6 A;  2I1R A;  5B0G A;  4FS1 A;  1PJ7 A;  1T9Y A;  2CQ3 A;  1NK9 A;  1ZAW A;  1WDT A;  1HR0 J;  4H4O A;  4ZLP A;  4DSL A;  2IBK A;  2V8H A;  2HQF A;  3CCT A;  2UVR A;  2UV8 A;  1OYD A;  3KG0 A;  5J1E A;  3M8Q B;  1TFY A;  3CVK A;  3OTB A;  4NCA A;  3QT5 A;  1IWA A;  2EKN A;  2DR7 A;  4DQI A;  3MM5 A;  3QIP A;  2NS1 B;  1OQ6 A;  5ETK A;  2YWE A;  4B3R F;  3W60 A;  4EBE A;  2F1F A;  2LKZ A;  4GKK J;  2QO3 A;  4LVO P;  2RT3 A;  3Q23 A;  1NKC A;  4WKR A;  1X5O A;  2J9D A;  3K8V A;  4N7T A;  3L95 X;  4O23 A;  4BBY A;  4IG3 A;  2C2O B;  2HS4 A;  2BJ9 A;  3CDA A;  1TL5 A;  4DR6 F;  3C15 B;  2HQI A;  1YG0 A;  3HFV A;  2VBX A;  1JIH A;  4PKD B;  4A8W A;  3TAM A;  5KAK A;  2ZUG A;  4HAC B;  2BDP A;  3C3L A;  2WRM A;  3OR1 B;  4OX6 A;  1I94 F;  3MM8 A;  1SC3 B;  1HW8 A;  1U02 A;  2YWW A;  5DLG A;  4M5D B;  2EFP A;  1Y10 A;  2YX1 A;  2EFV A;  2MYF A;  3AA9 A;  5F8J A;  4FBT A;  3KLE A;  3WDO A;  4NXM F;  5KFU A;  2R7U A;  2ROP A;  1M5V C;  2DEJ A;  3U1M A;  2FJE B;  3ISN C;  4YY3 F;  2POK A;  1OJ4 A;  1HW9 A;  4A8O A;  1QUP A;  2AJ0 A;  1F3V A;  4JV5 J;  5EN1 A;  2H54 B;  3JQJ A;  2IM1 A;  2W7O A;  2XMT A;  2ZKT A;  1RHU B;  4KV8 B;  3W2W B;  1U25 A;  1VC5 A;  1VQY A;  2ZM6 J;  4CLF A;  4KGV B;  1N6Q B;  4NLU A;  3LAL A;  3C6T B;  4DS4 A;  4PZV A;  3HVR A;  4DUZ J;  3H0P A;  4OL8 A;  1VQL S;  3I0S A;  2V9K A;  3C14 A;  1RT4 A;  1TKT A;  4LSN A;  2VD3 A;  1NDC A;  4ZVP B;  1RTH B;  1RWP B;  2V68 A;  4GMK A;  3A8I A;  2FC9 A;  2RRB A;  4PG5 A;  4PQU B;  2GHV C;  2MQN A;  1GK8 A;  3UO0 A;  2E9T A;  3PW7 A;  1SUQ B;  1S72 S;  4R5P A;  2WW8 A;  4AUK A;  3H42 A;  2QLF B;  1JLG B;  1R8C A;  3CCU S;  3P4U B;  3K5O A;  5I3P A;  2ZH3 A;  2YKA A;  2ZBQ A;  4DR7 J;  1XC9 A;  3ZNJ 1;  1HNV B;  4RNM A;  1FNM A;  1UMJ A;  5B0C A;  4P7T A;  1X0F A;  2CPI A;  3O6Q A;  3P5B P;  4LFB J;  2VPZ B;  5F8L A;  3TA1 A;  3MUM P;  4J9P A;  4EMD A;  1QAY A;  5CYQ A;  3N0V A;  2EFG A;  1N5T A;  5HAO A;  3GWC A;  3LUY A;  5D4P A;  4ELT A;  1FDN A;  5HJX A;  4A8K A;  5C25 B;  2RUS A;  1LV5 A;  1IWG A;  4DSI A;  5D77 A;  1T9X A;  3H40 A;  4ZN1 A;  3BYR A;  2FVP A;  3OL9 A;  1PCA A;  3NXZ A;  3A13 A;  1HPZ B;  1RE1 B;  3POT A;  4ITS A;  1YJW S;  3T5K A;  2HHS A;  2FJW A;  3KHL A;  3RJM B;  4DCO B;  3G8S A;  3MHY A;  4CNZ A;  1FDA A;  2RUG A;  1Q0N A;  1HA1 A;  2Y9H A;  4DUT A;  1SJF A;  1OS5 A;  2DNP A;  2A1B A;  4ZPT R;  3W5Y A;  2DNO A;  4JI8 J;  1N8R T;  1FD2 A;  4H4M A;  2ZDP A;  1H6K X;  1TUW A;  4A8Y A;  2GML A;  4ES3 A;  2VAS A;  1GT8 A;  2M9K A;  4IFY B;  1RT5 B;  2B5J A;  3V4I B;  1OSD A;  4Q8F A;  4QIE A;  2K1R B;  1BXN A;  3RGI A;  5E7O B;  2D1C A;  5DDR C;  2CPF A;  2PEH A;  3WQP A;  2KI2 A;  1HKA A;  2LU1 A;  4QWD A;  5AJ3 F;  3PYE A;  2EI5 A;  2VL1 A;  3C16 A;  2V50 A;  3BN7 A;  4LF6 F;  2G4B A;  3QT8 A;  4KHP J;  3GE9 A;  1CG2 A;  3T1A A;  3FQK A;  2VA2 A;  1FTC A;  3D28 A;  2P9E A;  4G65 A;  1HAR A;  2I38 A;  4DV3 F;  3CJS A;  5BYQ A;  2W2P P;  5GMD A;  4J9V A;  3PRB A;  5HQ8 A;  2XHW A;  3HHN B;  2HIQ A;  3GB0 A;  1JLE A;  3C15 A;  2ZZT A;  4X62 F;  1C0U A;  4USJ C;  2H9Z A;  3ILI A;  4C0H A;  4AQY F;  3IBC B;  1XNR F;  3MEC A;  4K4X A;  1D9F A;  3J80 U;  4E2F B;  2EG2 A;  4AYB D;  2AYB A;  1KDN A;  3OR1 A;  2ABY A;  2RD5 C;  4DV4 F;  3HKW A;  2J6T A;  3ETM A;  4L3N A;  4OYM A;  4KKO B; 
#chains in the Genus database with same CATH homology
 2CJY B;  2H5J B;  3GJT B;  3KJN B;  2CJX B;  2HBZ B;  4ZVT B;  4ZVU B;  3EDR B;  5IC4 B;  2H4Y B;  2XYP B;  2C2Z B;  2H48 B;  3QNW B;  3NS7 B;  3SIP B;  2CNO B;  3GJR B;  4ZVS B;  1RE1 B;  1RWW B;  2XYH B;  3D6M B;  4ZVP B;  1RWP B;  1SC1 B;  3GJQ B;  2H5I B;  2XZD B;  1I3O B;  1RHK B;  2CNN B;  2C2O B;  4ZVQ B;  3EDQ B;  3RJM B;  2DKO B;  4DCO B;  2P2C B;  1I51 B;  2H65 B;  4LSZ B;  3R7N B;  1QDU B;  1RHM B;  2QL7 B;  1GFW B;  2QLF B;  3R7B B;  1SC4 B;  1RWO B;  1RWK B;  4ZVR B;  2CNL B;  2C2K B;  1F9E B;  2QLJ B;  1RWM B;  2HBR B;  1PYO B;  4DCP B;  2H4W B;  5IC6 B;  3P4U B;  3D6F B;  3R6G B;  3R6L B;  2QL5 B;  2Y0B B;  2C2M B;  4JB8 B;  2FQQ B;  2XZT B;  2Y1L B;  3GJS B;  4ZVO B;  1SC3 B;  3KJQ B;  3KJF B;  3P45 B;  3IBC B;  1RWN B;  2H51 B;  1RWX B;  2XYG B;  2QLB B;  3D6H B;  1RHJ B;  2CNK B;  3R7S B;  1IBC B;  4DCJ B;  1QTN B;  2C1E B;  2HBQ B;  1RHQ B;  2HBY B;  3R5J B;  1BMQ B;  1RWV B;  3IBF B;  1PAU B;  1RHR B;  1ICE B;  5K20 B;  2H54 B;  2CDR B;  2QL9 B;  1RHU B;  1NME B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...