2CDRB

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
b'ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 SUBUNIT P17
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2cdrB00
2HBQB 3P4UB 4ZVSB 1RHMB 3R6LB 4ZVUB 1RWWB 1F9EB 2H4WB 2QL7B 1SC1B 4DCOB 2H65B 1I51B 2H4YB 1RWOB 2CJXB 2C1EB 2FQQB 3QNWB 2C2KB 2C2OB 2XZTB 1RWMB 3KJNB 4ZVTB 1RHKB 1I3OB 1RHUB 1ICEB 2QL9B 1NMEB 4DCPB 1RHRB 3NS7B 4LSZB 1SC4B 2CDRB 3D6HB 3EDQB 3R7SB 1RHJB 4ZVRB 2XYGB 1BMQB 2DKOB 1QTNB 2P2CB 3GJTB 2H51B 2XYHB 3RJMB 2C2MB 1SC3B 2H5IB 2CNKB 4ZVPB 2Y0BB 3R7NB 4JB8B 2H48B 3D6FB 3IBCB 1QDUB 5IC4B 2HBRB 1RWPB 1RWNB 1GFWB 2CNOB 2HBYB 3P45B 3KJQB 2QL5B 2HBZB 1RWKB 4ZVQB 2H54B 2QLFB 2QLBB 2XZDB 2CNLB 2CJYB 2C2ZB 3KJFB 1RWVB 3EDRB 5K20B 3GJSB 1RWXB 3GJRB 1IBCB 1RHQB 3IBFB 1PAUB 2QLJB 4ZVOB 2H5JB 3SIPB 3R6GB 1RE1B 4DCJB 2CNNB 2XYPB 3GJQB 3R7BB 3D6MB 3R5JB 2Y1LB 1PYOB 5IC6B
chains in the Genus database with same CATH superfamily
2KJWA 3PEHA 1LWXA 1QM9A 5BR8F 1XNRF 5IS2A 2X3GA 2CJXB 1JLAA 1TFYA 1Q4RA 3GPAA 4HL9A 3NWRA 2XC9A 2GJIA 2ZHAA 1R27B 2DNLA 4DPUA 2N4DA 5E5NA 1SJ4P 5J2PA 3FK4A 4IOAQ 3ZFVA 1FVSA 4KGVB 2RSQA 1BQNA 1RT5A 2AJ0A 3VAHA 3CC2S 5A0YA 5DZ7A 2VZ9A 2VPYB 1X9WA 4NL5A 2B0GA 2ACYA 4YB5A 3HHNB 1HNVA 1RT2A 4Y00A 1N5TA 4NRTA 1APSA 3QAEA 1RKIA 4DLGA 4HYKA 2XGPA 3GONA 5DO2A 5K20B 4XO0A 1TP7A 1PCAA 2KG0A 3CTRA 4ZCLA 1OY8A 1EX8A 1S1UA 4JI5J 2BE7D 1VHFA 1YJ7A 5D0HA 4DR5F 4DR7F 3MM5A 4O23A 1RTJB 4ZKAA 4YFUA 5KFRA 2G2OA 2R3VA 3O8WA 2XHCA 4KH0B 4OL8A 2XSJB 4PABA 2EWHA 2HWHA 2VQEJ 2VDIA 4F4AA 2OGUA 2OSRA 3K5PA 2DR9A 5A8RB 3LUYA 3CULA 2YNIB 3NEKA 4KO0B 2KVIA 3I56S 1IXKA 2LQ9A 4UY8T 2HZVA 1HWJA 3QFWA 1QE1B 1VQLS 1DRZA 5HK4A 2YKAA 3TARA 3IBWA 2OH2A 1ZBTA 4IO1A 4D3GA 1ZAWA 2XI3A 2R8HA 1SV5B 2LEPA 2XCAA 5CZXA 3QIPB 3R1HA 1FE4A 4I1TA 4N76A 4E2FB 1CBKA 1A9NB 5D3GB 4ZCKA 1WKKA 1RT6B 3UD3P 2BJEA 3W5ZA 1AYEA 1FXRA 4CDIA 4YHHJ 4U7UK 2LA6A 2W4DA 4DS5A 1T3NA 1RKJA 1T9XA 1KEKA 2HFSA 2R7WA 1D3WA 3ZO7A 1D8ZA 2L41A 4KV8A 1M1KT 4DR6F 2XM3A 3OLBA 2B8PA 3BKTA 1TMMA 1N0VC 2M70A 1L3UA 1DJ0A 2DO0A 4ITSA 3GSIA 4ILRA 2LA4A 4I7FB 3G82B 4DFJA 4F02A 1TR0A 4GKJF 3MFHA 4JI1J 1EETA 4HI1A 1F60B 2FY8A 2EBGA 4RZRA 2CNOB 2ZDPA 2BM1A 2FHKA 4EK2A 4ED3A 2HRYA 5B08A 1ZAXA 3CCJS 2XWYA 4NMXA 4LIWA 2VJUA 4NRUA 2MZSA 3PW0A 4DUYF 1TAQA 1JLAB 4ELTA 3C3LA 3CD5A 2BR0A 1CJVA 5IWAF 4YEAA 4ZIVA 3NXZA 3FQLA 3MEEA 4WFZA 5EX0A 1BQNB 1RT5B 3OHAA 2BBEA 5A0YB 4ED6A 2MJNA 3BO2A 5KFHA 4EEYA 2DKOB 1X4FA 3L7UA 2BJ7A 4QCLA 3BO3A 2OFHX 1HNVB 5DM6Q 4UOFA 1RT2B 1WEXA 2DR5A 4GC7A 2EG1A 4FYDA 5DJBA 4PZVA 4MJKA 5HANA 2ASDA 3TR5A 2HG4A 2NQPA 2HSEB 2ZH3A 5LL6d 3UNGC 3G8QA 1RAOA 1CJTA 5CABA 4JUZA 1SKRA 4K50A 4P71A 3GB0A 4O4GA 2QC3A 1JJ2R 3MUTP 2C22A 5EN1A 3L4BC 4ZVOB 1PILA 4NASA 3W63A 2DPIA 2RDIA 2CNNB 3I31A 3MR3A 4B3RF 1VCTA 3KMQA 1URNA 2R2TA 2KG1A 1DQAA 1FEEA 3RAQA 2IVMA 4PQAA 3FVYA 2LMIA 3IAS9 4JI7J 1SC1B 4P72A 3JAMY 3U02A 4RBUA 3QGPA 2ZOGA 1BWVA 3CMES 4BDPA 1X4EA 2CIMA 3TP2A 2DR8A 1EARA 1U4BA 1S59A 1WF1A 1SUQA 4AQYJ 4NLSA 4LR8A 2R7QA 1HNIA 5IM0A 1RLDA 2VBYA 2ZH5A 1JLBA 2E1RA 3DLBA 1K73T 2OP5A 3WQPA 2PEBA 3IXQA 2FB0A 1IBLJ 4ZVPB 4YY3J 4DV6F 1U24A 5IFMA 4U9RA 4CT8A 2YBVA 5KFOA 4K2JA 2F5GA 1PGZA 1HNXF 2WVFA 2WSFC 3OR1A 3BS9A 3OL6A 3OTOF 2UUCF 1S72S 5DDQC 2WBMA 3D68A 3LP0A 1OSCA 2D9PA 3FZBA 2H5JB 1HW9A 1Q79A 3MEDA 3HJFA 3EPGA 2WCXA 1H74A 2Z2MA 3FRZA 2PMHA 4DV0J 1TL3B 2D9OA 1M5SA 1VQYA 2ATCB 5JVGQ 4DR3J 4KV8B 5DLFA 2L9DA 3FSXA 4CO2A 1S57A 2B5JA 1URRA 2CA9A 4M5DA 3HD1A 1TQLA 1U02A 4LRDA 2JLEA 1XMOF 2EW9A 1EETB 3IN5A 4W90B 1KN6A 1RQ0A 4Q8FA 2M5YA 2JZ5A 3D4JA 2R4FA 4NA2A 4P7VA 1FX4A 4L72B 3Q8RB 1UJ4A 3DI6A 4KPYA 2ACMA 2DHXA 3IR7B 1PYTA 1GEHA 3AAWB 1GFWB 2F1FA 2ZITA 1X0FA 1WC6A 2VPWB 1QVFR 1VRUA 1QLNA 1N5SA 2X1AA 4C2MA 4EI2A 1VBYA 2ROGA 3OTEA 2GV1A 2D7SA 3D0GE 3P5BP 2HK3A 4DL3A 3LGMA 4TKTA 3TNVA 4MYUA 3PIPQ 3QLHB 2IVYA 4DSFA 3IMQJ 4Q44A 2YKNA 1CJVB 2BEFA 4DR2J 2F3JA 2JEIA 5FJ4A 3RBEA 4G6VB 4ED7A 2C3YA 3NNHA 3RZAA 3MEEB 4ZPBA 5HQLA 4WU2A 3JTOA 2ALYB 2H4YB 5EWGA 4ZP8A 4ECZA 3TI0A 2UVWA 4OI3A 4DL0C 4QR1A 2OPPA 1YBAA 1Q8KA 2HAIA 1N36F 1V5VA 1F5BA 2DNYA 1PC5A 1ZAVA 3MD3A 1WOOA 2XMMA 5DRKA 4F4KA 3GYGA 2DGQA 4LT6A 1ROFA 4FF3A 1JLEA 4F2RA 2XY7A 1DURA 3KG1A 1JNZB 1CJTB 1I94F 2DHHA 3GCWP 4FYXB 2UUBF 1FXDA 3KJQB 2BW2A 4O4GB 3SCJE 1F3VA 1NUEA 2QLFB 1TK8A 3C15B 2DTJA 2QT7A 4DV5J 3FDSA 3C6UA 1HD1A 3EDRB 4FYVB 1UW9A 3NGSA 2OHDA 1CG2A 3N01A 2BX6A 4DQPA 5F8MA 1X4CA 5BJRA 2EKYA 3Q8YA 2V5HG 5HMYA 1X5PA 1S0OA 3KLFA 2FJXA 4F36A 4C8LA 3WIVA 1FJGF 5E33A 2VOOA 4I64A 1VQOS 1HNIB 5IM0B 1YZ7A 3G87A 4DDFA 1IBMF 3T3FA 1JLBB 3HJVA 2F4VF 4ZVGA 2YWFA 3OTBA 1IQZA 1B99A 4M5KA 5F8IA 2RF2A 1A0OB 4AYBD 3BGUA 4HHUA 1RBLA 5KOWA 2DNRA 3FUYA 5F3TA 2HHSA 2H51B 4WPAA 2U1AA 2KT2A 3R8YA 3OR1B 1IKWA 2VB6A 4LFCF 3QT8A 1N32F 2HQGA 4N77A 5HN0A 2QL5B 3SCKE 3RR7A 4JI3F 2EK6A 4FNIA 4WP3A 2X1FA 3T9NA 3MEDB 4M5JA 3ZZYA 1KQGB 6AT1B 1S1VA 3LAKA 2HMIA 1Q8IA 3HD2A 1REVA 1YJ9S 1NHKL 2O67A 2GZOA 4KT0C 2B5JB 1AUDA 2G0JA 1UZHA 4M5DB 3UN5A 4KGZB 5K5MA 3JSRA 4USJC 3CCLS 4TLQA 4L6V3 3LPEA 5EWFA 2YNFA 2QL7B 2WW4A 4I69A 2B43A 2XS5A 4B3SJ 1P9YA 1VQKS 2CJAA 2C1EB 4N7TA 1QAYA 4WK3A 2QZ8A 5HVGA 1WKLA 2RRNA 1QVGR 5J1EA 4DSKA 2N4CA 4RPFA 2CDRB 1NDLA 4TY8A 3CO0P 4X4QA 2XHWA 1KHVA 2XY5A 3R27A 1RZMA 2RB7A 2ZHBA 1WI8A 4OZ0A 1VRUB 2RS2A 7FDRA 1ZM2A 4GVBA 3TQ1A 2KB2A 4EMDA 2JJ4D 2VD3A 4JI4F 2RQCA 2UV8G 3SSQA 3PIOQ 3J7YU 1FHTA 3FMWA 2IRYA 5DDPC 1H2UX 4HH1A 2Q1LA 2YKNB 3FQKA 4TVAB 1SQFA 2M8DB 4ICLA 2D74B 3GWCA 2FDNA 2ZBIA 4OX9F 4K0KJ 3LW5C 1ZTWA 3FMBA 4X4VA 4WF9Q 2UXCF 1Y5IB 3CPWR 4K59A 1HWIA 1XIQA 1KOHA 3RU0A 3TW0A 2OPPB 1U2CA 4ED8A 3GIKA 1Y4ZB 2HNYA 1IKXA 5ETQA 2E1MC 1ITPA 3BPDA 1JLEB 1QAXA 4DCPB 3RGIA 5LOQA 1HNZF 3JXOA 2BJ1A 1FEHA 3ZTOA 1YG0A 2WBRA 2I9SA 2E5JA 2H48B 3M8RA 2YNHA 3C6UB 2W7OA 4ERDA 1T9VA 5CCMA 2E5IA 4MMOA 2IBKA 5K14A 3VVTA 4X62F 4RW9A 3ADAC 1C2PA 3MM9B 4N8NA 4FF2A 1U0SA 3KLFB 4URGA 1T7PA 3NAIA 3CUNA 3QJJA 3MM8A 4J9VA 2KO1A 2ZH7A 4X64F 2A0FB 3CC4S 2LU2A 4V19J 3Q8VA 4DPYA 4ZA1A 1UL3A 2I0XA 2J7KA 2RF2B 1HWLA 3D3CJ 1AA1B 4USTA 4WTYA 5HMXA 4XDCA 3Q89A 4XAKA 1VIXA 4RW8A 2ZBPA 1AZSA 1HD0A 3X1LB 1IKWB 2E1PA 3CCWA 3T6JA 4OYAA 4YN3B 3NLCA 5K8PA 1HWKA 4DN0A 4CTAA 1FNXH 1Y10A 2M4MA 2HK2A 3P5TL 1S1VB 5LJ5Y 1RB0A 2HMIB 3BREA 1YRXA 2QLBB 4IFVA 2V68A 1KHWA 5KT3A 1REVB 1CEZA 1IN0A 2AZ1A 3RBDA 5AXMA 1RA7A 1VJQA 2ZDOA 2V4QA 4MK7A 4F25A 4ECTA 1EHWA 2FLPA 2YNFB 2IPOB 2DNKA 3M6WA 3H5XA 1X4AA 4QPXA 1RHMB 1K44A 3N6NA 4IRCA 5J1EB 4X2BA 1FERA 3G8TA 4WK1A 2MHEA 4TY8B 5CQGA 4OZNA 2CQHA 3GZ7A 2OEJA 4KYZA 2CG4A 1VC0A 1Q7YT 1VMBA 4WBFA 1B7FA 4GVBB 4F0MA 1IKVA 1SJ3P 4H4MA 5KT5A 3GQCA 3UNYA 1NBEB 4KRWA 3R7NB 1R43A 4RNOA 1VK3A 4JV0A 3J7Z5 2GW8A 2FJBB 3A8IA 3DM2A 4CRJA 2F4FA 3PY8A 1XC9A 4ED2A 4IG3B 3D28A 3HT3A 3TX8A 2K3IA 2ILZA 3GJQB 3IR6B 2Z2ZA 3K5NA 4J9RA 4FXVA 4Q2MA 4NZ6A 2V4JA 2ZM6J 1T9YA 3AH6A 4C8ZA 2HNYB 1FD2A 1IKXB 3KLVA 1HBNA 4IRKA 2EFOA 2GHWA 2VG6A 1QD1A 2M8HA 4WIIA 2CG8A 4F04B 1KNZA 1OMSA 3UDLA 4DL2A 1L3VA 1WC4A 4JI2J 4DV2F 4L3KA 1D0EA 2LU1A 4LSLA 3SMZA 3T1HJ 5LSRA 4UOGA 3CMQA 1VI7A 2WTFA 8ATCB 4KGKA 2YNHB 3QMQA 5SZTA 3QZ7A 1LFPA 5K14B 1JLFA 1SC6A 1RWNB 3HKZD 2JLGA 4C8KA 4RW9B 2K06A 2UUAJ 4FYYB 1CJKA 2CUYA 4NXMJ 2LQBA 3V81A 2H1YA 3MM8B 3KOAA 5SUHA 4G1PA 2ZHOA 1H98A 5T7LA 4HTIA 2RUGA 4O3QA 2ZVIA 4IR1A 3OLAA 2Z57B 1IUJA 5F41A 4CWBA 2AEMA 4NYZA 4Q45A 2HQIA 2M88A 5LM7E 2DRBA 1AZSB 1VQPS 2IMOA 1I3OB 2UXBJ 2NUUG 1AXQA 3V6KA 2W4PA 1QAIA 3BZQA 1QSYA 3PW2A 4OHZA 5KFYA 1OSDA 1JQGA 2EEYA 4OZ1A 1SQGA 3IBCB 4IFVB 2Z2LA 4RU2A 5AE2A 2FPHX 4JI8J 3TUIC 2O1PA 3IC1A 1LW2A 2IJRA 2ZVSA 1R6YA 3M8YA 3O6QA 1BQMA 4OYZA 4WFNQ 4DZ6A 2RE1A 1RA6A 1EIYB 2J9DE 3VHQA 3BGLA 4I68A 2V34A 3TQEA 3F44A 3PW7A 4P2XA 2QMXA 3R5CA 1MROA 1TL1A 5KFNA 3LPYA 1U49A 3BYRA 1SPBP 5KFUA 4B9LA 3B6BA 4CO3A 5HMWA 3NNAA 5KFIA 1NK6A 5J2NA 1NXIA 2N3OA 2DEJA 4EYHB 4F4WA 5ETNA 3TUJC 5KFLA 5GMEA 4DEZA 4H4MB 1RXOB 3T9ZA 1KVKA 4DX6A 1FNOA 1S5ZA 3NMAA 5ETTA 2J9DA 4OJHA 2W8KA 3R97A 1U25A 5IV3A 1WDDA 4MKBA 4ED5A 4QBUA 3FBBA 3UDVA 1YLXA 1XJWB 3D6FB 3DM2B 3RB0A 5F0WA 3W2WA 3KMSA 3PKMA 2XCPA 1U1NA 3M4XA 2WK4A 3O44A 4USWA 1RK8A 2YX4A 1PSDA 1RWXB 1FD8A 1NPPA 1QSSA 4B3MJ 1FRLA 3G9CA 5DGBA 4Z2XA 4J9SA 3GLJA 1HBNB 2ZZTA 1C1BB 2VA2A 4MK8A 2MJUA 2VG6B 3LP2B 1LV5A 1U47A 2AGOA 2ZUGA 3DLKA 4ZVUB 2GQCA 3AY0A 3FCWA 2K1RA 3E51A 2KRRA 2AQ4A 2DNNA 1M5HA 2PFFB 1PKUA 3DYAA 3KLGA 3IAM9 4LBPA 5KG2A 4PCQA 3ICLA 3Q22A 5JJBA 1SBRA 4YMEA 3NS6A 1UWAA 2W25A 3JYTA 4KKOA 7FD1A 4LF9F 3VGTA 2B9EA 3A3OB 1JLFB 3EJMA 2Y1JA 4LSNA 3DU5A 4WXWA 2JH3A 3TZXA 2MQ8A 1WHXA 5J1NA 2JLFA 4GMKA 2WSCC 3V81B 4ZHRA 3VCDA 2A18A 2ZNZA 1UVJA 2R8JA 1MSWD 5THWA 2HHHJ 1DHMA 2W24A 5IT9Y 3UDCA 3HSDA 5L9XA 1IQTA 5T7LB 3GFYA 2VFVA 2YPZA 1OWXA 3R6GB 2BOPA 4X66J 4E0DA 4F26A 1KDNA 2HGNA 3MM7A 3F41A 4IOCQ 2FJEB 4N47A 3BV8A 1XEZA 2VOPA 1RU2A 1DTQA 2HZAA 3IWNC 3PG9A 1PBUA 1N52B 1Q53A 3M8ZA 4I2QA 3G2XA 2BZ2A 2AMCB 2CQ4A 3DOLB 4DLEA 1Q5YA 4WFXA 3G6ES 2RQMA 1TKXA 4FVCA 1JXVA 2Z30B 3CCRS 4EBDA 4A46A 2HQCA 1KLMA 4L73A 4WCEQ 3NL0A 3GJTB 2L08A 1LW2B 1O51A 2P6TA 3GYNA 4OZ2A 1BQMB 2P5VA 3EWGA 1NK9A 3BDPA 2W2MP 4LF5J 1WELA 4P2FA 3MEGB 3D1HA 2QSFA 3MCOA 4XPEA 2XS7A 3RW6A 1B64A 2FJWA 1MROB 4GKKF 2BW7A 1TL1B 4C0HA 1Q1KA 4O4RA 2FVRA 4OLOA 2K7JA 3SZ2A 4QJVA 5K8NA 2FJVA 3R7BB 3GMGA 2G13A 5J2NB 2R9LA 5BR8J 3D9BA 1JLCA 3QSIA 1VS3A 1TVRA 2CVIA 5ETMA 4N41A 2X51A 3X3UA 3R5BA 5HL7Q 2C2OB 4IQXA 3PYGA 3M7VA 2MQPA 2B9YA 1U1PA 3K58A 2HHVA 4ZVRB 1IM4A 3OJUA 1C4AA 3W2WB 1OY9A 3C8YA 4OV6A 1U48A 2DGWA 2XSFA 3CCSS 1Y00A 4LRAA 2KH9A 3Q8PB 3OQ2A 1SH3A 3P45B 4YDDB 1IM6A 4PXEA 2CQ3A 3NBPB 3C66A 2BMBA 3Q8QB 3T1YF 3IG1A 1IKYA 2YX1A 3UCGA 1O0PA 4FN5A 3MMBA 5DG7A 3W2VA 4DR7J 3THVA 3FRYA 3DLKB 4DR1J 2DT9A 2ROEA 3B78A 3UD4P 1JWWA 3HVWA 1ZM9A 4ZDNA 4B3OA 2K1RB 3R5GA 2XGQA 1JIHA 4H54A 2MKHA 5L46A 2F40A 3DYAB 4C8YA 3KLGB 1YRTA 2WVBA 3MPUB 2KYZA 4DI6A 5AJ3F 3CSKA 5JUMA 4OZ3A 4KKOB 3VWSA 5GADU 4LR7A 1NJWA 5L1KA 1PG5B 3QJLA 1TMJA 5C42A 3GIIA 2NYHA 2KKHA 1X9MA 3AJ2A 3RJMB 1W2BR 4C0OC 3PYFA 1SJQA 3CJ5A 5I4MA 3VZHA 4WKYA 1RWPB 5ETKA 5F8GA 2HBZB 2FLNA 3EYZA 4O0IA 1JK9B 2APOA 1Y7PA 3K5LA 3MM7B 3IGNA 3MEKA 1TL4A 3EPIA 2X3DA 3N5FA 3IRXA 2FGCA 1DTQB 3VAJA 4NI2B 2L48A 4LFBF 2QFJA 4I2QB 3TAPA 3J7AN 3THTA 5DG8A 1U09A 3A4TA 2W9AA 3C6TA 1KSPA 3V6HA 4MIAA 4YDXA 4R0EA 2BA9A 2HGMA 2X1GA 4ED4A 4A8QA 4PXCA 4O3OA 4WZQA 2W4CA 3L95X 2HGLA 5KT2A 5HJXA 4GKJJ 2RVJA 1GK8A 4Y2IA 2HQFA 4OI0A 4H4OA 3P96A 2UVVA 2DY9A 1FFSB 2QN6B 2GQQA 2BDPA 2DB1A 4CCHA 2V6AA 2OI2A 3BR9A 4P7TA 3US5A 4LFAF 3MXHP 2RQKA 5F8LA 3D3BJ 4Z7CA 4DOZA 2H5EA 1PJ6A 2QA2A 1VGYA 3PEJA 3IGVA 4DUYJ 2CPYA 1JLCB 1BHNA 2OEMA 3MOJB 3JAMU 2JEFA 1V3SA 2HVIA 1O6XA 3MR2A 1NKBA 4DQSA 1F5CA 1VLOA 5IWAJ 1TU0B 2V69A 4FBUA 3F56A 4NXNF 5C2CA 5A76A 5KAKA 1WC5A 3OUYA 1XBWA 2CZ9A 2HS0A 1B0PA 4P10A 1S9FA 2HHXA 2P9CA 2JNJA 5EGYA 3KJNB 4IYQA 2PDAA 4QWAA 2IC3A 2KXNB 2AD9A 4C7QA 1SIZA 3H2VE 4PWWA 2GC8A 2VFUA 1MG7A 3ISNC 3EGZA 2IAJA 4NLTA 5LMNF 1AW0A 3UE2A 2C3PA 2DYAA 1RGVA 4FDFA 1XNQJ 4LBIA 3KHGA 2FHMA 3IG1B 4DSJA 1IKYB 2V8VA 2E1CA 2J6TA 3MMBB 1BGXT 3H0PA 1VQ9S 1UVNA 4MH8A 2RILA 2VBZA 4B9UA 2DEIA 4B3OB 3GFZA 3EZOA 2UUWA 4B3RJ 1PAUB 3JS9A 1NK7A 4OJ1A 1WACA 4AE5A 2XWXA 1B3TA 1A7GE 3G8SA 1OS5A 1S48A 4G1IA 4LRBA 4UUXA 4DXLA 2IA0A 3CCQS 4F4YA 4X4TA 4DL7A 1WWHA 4YR2A 2ZJQQ 1WTBA 1Q16B 5C42B 2OKQA 2LKZA 2VG7A 1FTCA 1J5OA 3OVBA 3W62A 1FRKA 2CZ4A 1S0VA 5EDWA 5F0UA 1TKTA 4ANDA 2ZH4A 3BQ1A 2HRTA 3L7OA 1V3RA 1FKAF 4YS2A 3TAMB 3NGTA 1T02A 3M1VA 1NK5A 2WOMA 1HNXJ 2VQEF 2DO4A 4UT4A 4B3TF 2ASYA 1XK8A 3OTOJ 2UUCJ 4B08A 2J5AA 1LOUA 4HTJA 4KSEB 3IRXB 4E98A 2XY6A 5E3RA 3BSAA 1K8AT 3R5AA 2MY8A 2XMVA 2XBPA 3DRPA 3PKYA 1ELOA 1S6QA 2G4BA 3ZNJ1 2EC2A 2Y1LB 2AT1B 1DQ8A 2AKWB 2ADBA 4LF8F 2VA3A 5D4OA 3MD1A 4J37A 4MIWA 3GR0A 3CWJA 8RUCA 1XMOJ 2PI5A 1JXLA 2MQNA 1YJVA 2UXDF 4K4TA 2C2NA 4H4OB 3E2EA 1X4DA 2KN4A 3AJDA 4ED0A 5LSLA 4ECVA 3TEGA 2W7PA 3BBFA 3KDOA 2XLKA 4Q8EA 2YVSA 5CD4H 2PT0A 2UZAA 1R8PA 2YXLA 4A48A 2WRMA 2DGVA 3FKBA 1VYAA 1JLQA 3DFEA 4C11A 1MWQA 1XN9A 1P8GA 1CQNA 1VLYA 1NHVA 4NLDA 2Y0SD 1IWGA 4B02A 3K8VA 3LAMA 5I3PA 4J91A 2R2UA 1BXNA 1D9FA 2EC0A 4QU7A 2OTLS 5LXRA 2KI2A 1H0HB 1ZETA 2Y8WA 4O3PA 3CD7A 5GAEI 4OHYA 3CJ0A 1X5TA 3PXGa 1N4LA 5CH7B 2GJ2A 3QIDA 4OHWA 5A2QY 2IC3B 2CXEA 3G6VA 2ZKUA 3DKDA 1FWKA 4FKYA 3M9MB 3HCXA 3RB3A 1N36J 4L76A 2VL1A 1WI6A 4BC9A 2IAJB 1KRPA 2YWHA 4N8OA 4HH0A 1NSAA 1MN7A 2QO3A 3DLLQ 4I2PB 1YZ6A 1ZA2B 2EVZA 5ETPA 2WAQD 4KIAA 1I94J 4PG5A 1FE0A 2UUBJ 2Y9HA 5HQ8A 3W7BA 2AGPA 2C42A 1T8EA 4OZLA 4QIGA 1U1MA 2GVZA 4DFKA 3CEDA 5LXYA 3CC7S 1Y3KA 1FO1A 1S7IA 4KAIA 4NZ7A 3U1LA 5ETOA 3GJRB 5E3CA 2NXNA 2DNZA 4K4YA 2IRXA 2F8MA 4DPWA 2B3TB 2DGXA 4AL5A 1S12A 1KQFB 4AL6A 4LREA 2ZKTA 1GXUA 2QGFB 1U7LA 3MR5A 1XR6A 5C25A 1NK8A 2VG7B 1FJGJ 2J0WA 3QBCA 1J5OB 5CYQB 1IBMJ 2XMUA 3ZTRA 2XO6A 5DZ6A 2HS3A 2F4VJ 2C2RA 4HKQA 1FDBA 2MQOA 1G6BA 3BN7A 5HROA 1YBUA 3TJ8A 4PWDB 3DDKA 2D3UA 5C5JA 3M1VB 2CVEA 2WOMB 3MCNA 1C0TA 3GV5B 1EP4A 3B8HA 1DAXA 2AYGA 1XMQF 3MPWA 4LFCJ 3WZ0A 2IBOA 2GGPA 5A8WA 2YWEA 4USIA 3PTWA 5A8KB 1PYSB 2E5GA 2B6AA 4OYWA 2MZRA 3AA8A 3D0HE 2ILYA 3P3DA 2RQ4A 3DRPB 1S6QB 3A1YG 4AUKA 3BGOP 3AOCA 3VTIA 4FPIA 4EGLA 3P49B 5KFPA 1WDTA 4A4JA 2CKWA 2GAHC 4FVMA 3RAMA 3JTPA 4DCJB 2AIRB 2PC6A 4BWMA 2DNMA 4E8UA 4IUFA 3ILJA 4PPDA 1RAGB 1WG5A 3N0VA 2AW0A 4MKYA 4ENOA 3EXCX 2A3JA 3BGRA 3M2RA 5KFAA 5KT6A 3OTCA 4DR4F 2ABYA 1EZZB 4LR9A 5L1JA 1CQMA 1FA0A 4RX6A 2VBWA 1EKRA 3LGHA 4QYRA 5CXTA 1RT1B 1J2VA 1YJNS 3GYXB 1S99A 2XMTA 5M2PA 2D3OR 4EBEA 1JLQB 4USHA 1QJHA 3V6DA 1BY9A 4C11B 4B9MA 4Q7AA 4CYUA 4JI4J 5KFWA 1X5OA 4CLZA 3OD2A 2HBRB 4Q5VA 5HP1A 4ZN3A 4DQQA 2B7CB 3M6UA 2D41A 1X4BA 4WFAQ 2R8GA 4TN2A 4OX9J 4PAAA 4WWSA 4ANEA 3CCES 3SIPB 2UXCJ 4K8RA 4XPCA 1LXJA 4X4RA 3I5CA 1T3OA 2BABA 3MM6A 1DTTA 4YR0A 4L3NA 3FEXB 4W4MA 5D0GA 1H38A 4M5IA 2WHOA 3DCAA 4OMFG 1JNRB 1AFIA 1JMTA 1R0AA 4ZN1A 4OYIA 3KKFA 2H65B 1WUUA 5IT0A 1R89A 2FQQB 4Q0BA 3SSSA 2D1CA 3J81j 1HNZJ 2CQIA 2L9WA 5LMUF 5CYJA 3CCUS 2AWZA 1RHRB 2MQQA 2KFYA 4ZPWR 2UUTA 5JXSA 2K7KA 1QTNB 3KK1B 2FHJA 4NLPA 2HKEA 1RAAB 2C2MB 1M1HA 2GVZB 1S9GA 2PE8A 1ZM4A 3QT7A 2M52A 4OIXA 1TKZA 4TU9A 1WORA 4C6AA 3E01A 4DFMA 4FKXA 1F9HA 3NRBA 2V4RA 2NUHA 4USMA 2EXUA 4O3NA 5C25B 5D0RA 1VR6A 2MGZA 1H7WA 2N82B 2IA6A 4TYAA 2EKNA 2RH3A 4D3HA 2UP1A 4ZJOA 2V2QA 3P4UB 5A6PA 2W1BA 2LDIA 4QWCA 2Q3PA 3K5MA 5K9FA 5HROB 5FD1A 3S7RA 3WC0A 2YH0A 1B0VA 2FZCB 2DCLA 1C0TB 1EP4B 1MW7A 2ZWOA 2V67A 3HSGA 2VFTA 3EVMA 2A6OA 3QT5A 4QIEA 1M5OC 2LDYA 3CJTA 3A8KA 2GGPB 4LRCA 5A8WB 2QEXS 2DNQA 2BYCA 2HAFA 3UD5A 4IO9Q 4ZIWA 2W01A 2B6AB 3UO0A 2ZFHA 1S4FA 4FZVA 2CQDA 4WP9A 2IHR1 4K7QA 1WF0A 2QYGA 4RW7A 3ISZA 2VPXB 1NH7A 3IA0A 2I38A 4C97A 2BJ9A 1Q0NA 5FIIA 2VQFJ 2OPQB 1YJRA 3ZNUA 3QJPA 4CLTA 3OL9A 2GMJA 1FRMA 4Y65A 2HURA 1SCJB 3D6MB 3BGRB 3NCPA 3M2RB 3WIUA 2BANA 2I5JA 1KLNA 3D6TB 5H9EK 5KFTA 2P9EA 3TWZA 3KHRA 2RHQB 3OVAA 2YNGA 4JYAF 3Q23A 4OV1A 3DOKA 3ENVA 2OJ3A 1DARA 4ZCMA 1XTZA 1YRUA 4DJBA 4TU8A 3V6DB 2Q66A 2Y8YA 4CYUB 3VAMA 3CCMS 1FDDA 2CWKA 4ES2A 3W8PA 5KG7A 4USKA 5HP1B 2X7IA 3S1TA 2IJNA 2EFVA 1OQ3A 2KZZA 3OXLA 2MKYA 2HBYB 4A8WA 4P6QA 4V19X 4CH1A 2ALZA 3QRQA 1NCLA 4F8RA 1OJ4A 2GO8A 1S1WA 4NLQA 3Q0AA 3MM6B 1DTTB 2AYEA 1FRHA 4DFPA 3IFEA 4EO8A 4OYPA 2XB2D 1YBTA 3KHLA 3EICA 2B9WA 1TL3A 1GH8A 2K2PA 4LRFA 3CD0A 1RACB 4QU6A 5FDLA 4FYWB 1CULA 1R0AB 1WKJA 4PG6A 3G96A 1WTFA 1XWLA 1IWAA 5HSPA 4QR0A 4Q0BB 2LP4A 1T9UA 3T19A 2PA8D 1NZ8A 3OL8A 2MLXA 1XQIA 3KUGA 3H2UB 1GTHA 4NWBA 3H5YA 2F65A 1N33F 4Y0FA 2QA4G 4DV2J 3A8JA 3MAAB 1RHUB 2QL9B 2F8HA 1TUGB 4USVA 2KXFA 1S9GB 3NMRA 2E9ZA 4NMLA 1UFKA 5KT4A 2CPZA 1TKZB 2NXCA 4Z37A 1OQ6A 1LK7A 3E01B 4PYDA 3G4SS 2OTJS 5AE3A 5BYSA 2YQ0A 4KQZA 4Y28C 4ZVQB 1SL0A 5CZVA 4WYWA 2CNLB 2IMWP 1S9EB 2MYFA 3QLHA 2MGZB 2XNQA 2JVOA 2ROPA 2ZJPQ 1RABB 2MPUA 3ISND 2C3MA 3MMCA 2FHOB 4BLGA 1F1BB 2FJAB 2DBBA 2J8AA 4JV2A 5KG3A 4JV5J 1RT7A 1O8BA 2HVZA 3BYPA 2J9CA 5AXLA 2H4WB 4KHPF 3VAGA 2FVSA 3CE8A 3TJAA 3PJ9A 1JKHA 1TUVA 4IFYA 1S10A 5E0OA 4GVLA 2XI2A 4A8MP 1ACMB 3KTQA 3A8EA 1FKPA 2DGTA 1F9FA 4PUOA 1YITS 1B4SA 3OPKA 3KYLA 2LQJA 1S49A 1Y5NB 2R7TA 1AFJA 3KXDA 3SV3A 4RW7B 4DX8H 5AXKA 2GVDA 2CJQA 3C15A 3I4PA 1H72C 3UPFA 4P9SA 4DPXA 4BCAA 1GAOA 1TV6A 1NK0A 2AJ4A 4WXOA 2CQGA 3EGVA 4P52A 2NSBA 3DMJA 4G1QA 2E66A 2AYMA 4A8KA 2BANB 2D3ZA 2I5JB 3DGPA 3EE3A 4I6AA 1FRJA 2DIUA 4NLVA 4DV1F 1WG4A 2YNGB 1U2RA 3DOKB 1ZYQA 3GV7B 2OO4A 2HZCA 2QMUB 5KFFA 3NWGA 2K3KA 3PX6A 3UVJB 4A47A 5K8MA 2DXEA 3F0NA 4WFBQ 3PX0A 5FLXU 4KFBA 3BM7A 4F50A 5D77A 2UU9F 2O66A 1CS4B 4KY3A 1RT3B 1UAWA 4JI0J 1U2FA 1Y0HA 3ELHA 1I5OB 1A6LA 3H42A 1YSJA 2DITA 2RT3A 3PYEA 3N9UC 2DVIA 4MKAA 3SQGA 2ERRA 3BSOA 1KKHA 1P1LA 2AEJA 3JSMA 2AJ2A 1Q95G 1S1WB 1Q82T 3HFKA 2FGOA 5B0FA 2PIIA 5CYMA 5FDLB 3FSYA 3LA0A 1CULB 2WB4A 1QAJA 3MMJA 3M2VA 2O01C 2QE5A 3UW1A 5KFQA 2OELA 2WVEA 2ZH9A 1DQ9A 1UPPA 4IOBA 1P27B 1UJ6A 2HFOA 1N88A 3EZUA 2BUNA 3M05A 4LF6F 4F7VA 2OD6A 3I9ZA 5D8HB 1YKWA 4PQUA 1FTRA 2WZ1A 3QSYB 2HHWA 2VKZG 1UVLA 2HHPA 1NB2A 3T1AA 4DV4F 4LF9J 3W9JA 1RCXB 1VQ4S 2ZM6F 4QIVA 4IH6A 4X4NA 3HX9A 2ZH8A 1UKUA 2V2VA 4N5SA 4CH0S 2FY1A 2JX2A 5HAOA 1GX6A 2R2SA 1XMBA 1V9OA 1YQHA 3MMCB 3I9V9 1UFLA 2PMZD 2RIJA 1NJXA 1U26A 4RW4A 4YQWA 4TNOA 3MAHA 1RT7B 1UPMB 3N79A 3DHWC 4DV3F 3TZYA 1WG1A 5C24A 1GMUA 1FWLA 2E44A 1UEVA 1CC7A 2ZBRA 2UUAF 1JKHB 3I82A 2E9TA 2KVQE 4IFYB 3EM1A 4CZCA 3ZZ0A 1L5UA 1VQ5S 1FKPB 4ELVA 3CJ8A 4PUOB 4XIUA 5CCLA 3TO8A 4ZK7M 2KT5A 3O1LA 2VG5A 2M9KA 4F2SA 4DMZA 1LW0A 2YKOA 1EB0A 1NU4A 1YJUA 1D1UA 3PW5A 2GVDB 1SJRA 1UWBA 3QQCD 2QMWA 3TVYA 2LYVA 3M2UA 2M7SA 1TV6B 2DGUA 5G4DA 5BYQA 2W9CA 3D54A 2JDJA 2HNDA 4G1QB 3DMJB 2R42A 1RWKB 4UQGA 1HBMA 3MUMP 4M94A 3S01A 2OUGA 3DGPB 4P75A 4GKKJ 2X1BA 4P74A 2KRBA 1SH2A 1UJ5A 1K1QA 2DH9A 2J9EA 3MM9A 1Q5VA 4ETXA 2EK1A 1L3KA 2I6WA 2FYXA 2DPJA 1S7HA 3H98A 4WU3A 1SXLA 1CVJA 2MEWA 3MTJA 2B4UA 2A10A 4KFBB 4FPRA 1RAEB 5DM7Q 4LF4F 1HW8A 2DXFA 1DBDA 2JWNA 3ENAA 3KLHA 3HT0A 2BJ8A 2LECA 4CLKA 1VHIA 2RMLA 4HHJA 2XZTB 3KFWX 1UVMA 3FNNA 1R0CB 1VQMS 2GQ2A 5B0CA 1JB0C 1CPZA 3SBMA 4ED1A 3SQGB 1NK4A 3W60A 3C14A 1NDPA 2MTLA 1W2IA 3JSMB 2JOQA 3BF4A 1NLKL 3SXLA 4Q2LA 4I56A 1UFWA 3CT9A 4ES1A 4X4OA 5CYMB 3IWLA 1AT1B 4Y2KA 2VDHA 3M2VB 3T1YJ 3GU0A 2XS2A 1YHQS 1JJCB 2BQRA 5B0EA 1HBOB 4NLYA 3L9ZA 4NLWA 3AOAA 3PNIA 1KS2A 5B0GA 1HFEL 2PSZA 3M9OB 3IBFB 4LVNP 1N34F 1FXLA 1FI4A 2PGCA 4QPTA 2ZNYA 3VQTA 4PQUB 5KFGA 5KOXA 2HEKA 1S1XA 5J2MA 3QWPA 5B0AA 2ZZMA 4G65A 5AJ3J 2F9DA 2HIQA 1TK0A 2B4OA 1VRTA 4C8NA 3EUNA 3LTOA 1DLOA 2DD8S 4NCGA 1RTZA 3SDEB 3QGHA 4ZLJA 1HWUA 4X65F 1Y5LB 4ECRA 3K7RA 2EFQA 1ICEB 4EZ6A 2VBXA 3J7ZT 4M8LA 1E6VA 4RUAA 3NOGA 2WVDA 2E5LF 2KXHA 4CT9A 5IQ6A 3QATA 3RRGA 1UMJA 3HZEA 4A8FA 2AF6A 3WHIA 3JB9k 1HLWA 2AU0A 3TA2A 3D1OA 1FWPA 2E7VA 1N5YA 1Y9OA 5LSOA 3IR5B 4WTOB 3HI9A 4PXDA 4RW4B 1FCAA 3RR8A 4IG3A 4FXWA 4DUZF 3SI8A 1YDLA 2YKQA 2QTWA 1T95A 2PFDA 2EFPA 3FBCA 5C24B 1VJWA 1RHQB 2IVFB 3AXKA 2XYPB 2CQBA 4YR3A 4K5SA 4J9MA 2HBQB 1VIOA 5DLGA 1HL6A 1U0HB 1RSCA 3HHKA 1ZA1B 3WC2A 3TA0A 3ENWA 2VG5B 2PA3A 4DS4A 3D66A 1RWMB 1LW0B 4QYZK 4OFZA 2C2EA 3AXMA 1G3OA 3BH6B 1UWBB 2WVCA 2W8LA 1RP5A 3M2UB 2LXUA 5D15A 2W9CB 2HNDB 4IH5A 4DPTA 3I87A 1HBMB 3I96A 4LFAJ 3BEGB 3MWBA 4FS1A 1IR2A 1SKUB 3BBBA 1E6YA 3VAIA 1HPZA 2P8IA 3NAHA 5ITHA 3H59A 1HI1A 1B0TA 1NH8A 2DR6A 4MK9A 1HHTP 2VASA 2DH7A 5KFVA 1NM2A 1XR7A 3V5RA 4DL4A 2NS1B 2RU3A 1WOSA 4CIOA 3KLHB 4DV7F 2NSCA 3AOBA 4LF5F 4NXNJ 1VBXA 3Q86A 3HF5A 2KT3A 4L75A 2U2FA 1P9QC 2B4PA 1HR0J 3QGIA 2DHSA 1VDHA 1WD6A 4DL5A 3T6BA 3C14B 2NCKL 1SH0A 1GXLA 4QIFA 3AQOA 2MSSA 2E29A 1RLCL 4OJ3A 1X5SA 3D6HB 3DRRB 4S0MA 2UVUA 1RTHA 1TAUA 2XYGB 5E3QA 3A3NB 1WSVA 5LMNJ 3SYZA 2JFKA 2C2DA 1RUSA 1T9WA 2VH7A 3K57A 4B9TA 3W8GA 2C3OA 3QO9A 4OZJA 3K89A 1MWYA 2DNPA 1T9TA 1SQEA 3HMJG 2QLWA 2J7UA 3GJSB 3M8SA 1Q81T 1SKWA 3HK2A 3C16A 3NY0A 1S1XB 2KJVA 2ZE2A 5J2MB 1OY6A 4I67A 2FC9A 4WP8A 4K4UA 3VALA 1VRTB 1DLOB 2A2DA 4XTTA 4NCGB 3NG8A 2MKJA 2FVPA 3KNAA 4ETZA 1K0VA 2NXUA 3DRXA 1E6VB 3CJ3A 1L3SA 3M32A 4ZVTB 1XERA 4DR1F 4M95A 2JL9A 3SV4A 2VONA 3OBIA 3LWLA 1GMVA 3FFIA 2ZOFA 3ETOA 3I0RA 3T5KA 1RHJB 1WOPA 5DQHA 4AFFA 4U7CA 4RBVA 1Z2LA 1N5YB 2EPIA 4CLFA 2V50A 4EFAC 5HO4A 1KR4A 4B3TJ 1EQ0A 1QDUB 1T0TV 5ETVA 8AT1B 2QYCA 4PRFA 2O3DA 4NLXA 1CC8A 2BJ3A 1TL5A 2XZWA 4L74A 3G86A 2B9XA 2BOAA 1HBUA 1YX2A 1HMVA 2DNGA 3W5YA 2RS8A 5KFSA 2XMAA 4M5MA 3ILIA 1C1BA 1DZ5A 3LP2A 2ZH2A 5A2QU 4J7CA 3PX4A 2KM8B 5B7WA 3M6XA 4JI6F 4OHVA 2MMYA 5KFDA 2AZ3A 2CYYA 3GSDA 4LF8J 3NOCA 3WX8A 4WFYA 5D6GA 3ILLA 5EX3A 5BXIA 1JJHA 4OYOA 2UXDJ 1BUXA 2AX0A 5HMZA 1RT4A 2PMWA 3MURP 4LF7F 5DQGA 3DC2A 3VAFA 5T41A 5KFEA 4LSZB 1U1QA 4CLWA 4IR9A 1Q78A 1UP1A 1UTAA 3ZTSA 2G0CA 3OW2R 4KHRA 1T03A 1X4HA 3ZC4A 3NGRA 5F8JA 1H3DA 5J2QA 1X4GA 3KDNA 1VQ8S 4Y2CA 3MFIA 3RW7A 1E6YB 3W3SA 2G2YA 3BB5A 1HPZB 4CO5A 1SKSA 4ZLPA 4M1KA 4C98A 2GJFA 1U45A 5DGAA 1QSLA 3J81U 5B09A 4RNHA 3TJ9A 3EGWB 2FLLA 1FRIA 4USUA 2B7BB 5H9EJ 3NCQA 4ZPTR 3FEYB 3ZZTA 2ZWPA 2CRLA 4EYIB 2HWTA 2XLIA 4FF4A 4C0BA 1M5PC 3OXFA 3DOLA 2CQ2A 3HXMA 1NPRA 5KFJA 2Z0GA 1RTHB 4CM0A 2V2ZA 5ADZA 4YOEA 4URSA 1NMEB 3LGNA 2R7OA 3UDEA 3N6LA 1NSPA 4KGMA 1BMQB 3FCHA 3QO9B 1RJJA 2CADA 2G1DA 1FF2A 1NDKA 2ASJA 5J2PB 5L8RC 2H5IB 3GFHA 4R25A 5KG4A 2XTJP 3GR1A 2ZD1A 1GT8A 3MEGA 2GA7A 2GO9A 2LQ8A 3SEOA 2EBEA 3C16B 2ZE2B 4BS2A 2AYBA 3OXGA 4DQRA 3R3TA 4NLUA 3DXSX 4OZ5A 5HATA 3R1LA 1UVIA 1XNQF 2YKMA 4Y3CA 1OO0B 5ETSA 1FFWB 1RAIB 2O5DA 1WC1A 1S1UB 2DK2A 2GHVC 1LXNA 3HHLA 4ZVEA 2N3LA 3M32B 1TTHB 3MM5B 2R8IA 3HLUA 1GXTA 2HHQA 3FFIB 3I0RB 1ZPWX 1RCOB 5GAEU 3NS7B 4R0JA 3MPDA 1XMQJ 1HNWF 5T14A 2KFNA 1X8DA 2Y1IA 3HZGA 3CJRA 4ECUA 4DSIA 2MKCA 1R31A 2CPDA 4UTGA 3NBPA 4H4KA 1HBUB 1HMVB 4C3KA 3C2PA 2VF3A 3R2DJ 1KC8T 4UY85 2QA4S 5GAGI 3JTNA 1S0MA 3I5BA 3MPYA 5HQMA 4UOCA 2HHTA 4UZBA 2IM2A 2B8QA 1UA0A 1YJTA 3CVKA 1SL1A 3RYLA 5KFZA 4ANCA 3HP6A 5C7PA 5LJ3Y 3S6EA 3FCVA 4V1Ak 2IYIA 1RT4B 4ZVHA 2YWWA 2UVRA 2GFFA 2W2NP 4DR4J 4LIRA 1ZTTA 1T11A 3LOUA 5E7OB 1U6BA 2P6SA 2HFZA 3PJWA 1VC6A 2J8SA 4NEYA 1T03B 2JVRA 2JRSA 5IXUA 4DZDA 5J2QB 1ZPVA 4QQBA 1IBKF 3PRBA 4ZP9A 4ECXA 2GHPA 2CWXA 2DRAA 1VK8A 5H9FK 2Z8QA 3UFCX 1KVIA 2OSQA 4C3LA 2YWGA 1YTYA 3WBZA 2ADCA 3Q8SB 2OD4A 3WX4A 4ECWA 1K47A 3IM9A 4KR0B 7AT1B 3AT1B 2EFNA 3AQPA 2HW3A 3PO4A 1TFWA 4J9QA 2GIFA 2QIFA 1SI9A 4NI2A 1FK9A 4KGXB 2WW8A 2PN6A 2DNOA 4DQIA 4CH7A 1WEYA 3BO4A 1LFWA 2BQUA 3HKWA 1X7VA 4IRDA 2Z58B 1F2GA 2WONA 4DSLA 2Q6BA 1WC0A 3Q24A 5LMUJ 2CPIA 4F3QA 4RU9A 2IYGA 3VGUA 4Y6IA 4CP5A 2DHGA 4J9OA 4ZLLA 3PV8A 2R2RA 3AB2B 2PO4A 1NPKA 3BSCA 1N5VA 5DQIA 3CDEA 2R7UA 1NSQA 2ZD1B 3ILOA 4O0NA 2J7WA 2XYHB 5DG9A 4DN9A 1RAFB 4CLLA 3HSJA 2YX7A 3HHDA 4EWTA 1VQ7S 1MLAA 1FVQA 4OI6A 4RO0A 3G6XA 1KVJA 3W64A 3VZIA 5DETA 3E8OA 1D9DA 2QFIA 4C8MA 5I42A 2XZDB 3HULA 1HKAA 4P73A 2YKMB 4NA1A 1XNRJ 4R8UA 3DLHA 3KLEA 5L38A 4KJIA 5RUBA 4ECYA 1BQXA 4LBHA 1KFDA 4RW6A 3UQSA 4UOHA 3HHLB 2W9BA 4I0WA 4F4ZA 3H7HB 4N56A 4MT1A 2XG8A 3AHPA 2EG2A 4CO1A 5HBMA 2MZ1A 3DRSA 2RJZA 4IKAA 4F0KA 4IH7A 4UUWA 3NGDA 2MXYA 2ASLA 3RB6A 2NLWA 3GIMA 2CQ1A 4K4ZA 5DDRC 1OIAA 4CQ1A 1YVFA 2E5HA 1EQMA 3ZZUA 1GQEA 3DOMA 1SUQB 4NYOA 3KHHA 1HQUA 2MDAA 2Q6CA 3H90A 1LKZA 2FVCA 4NPOA 2HRUA 3IM8A 3MTKA 5L39A 3BKFA 2E1AA 4DU8A 5AXNA 3GCXP 4DR5J 3CXCR 1YI2S 4J9PA 2LCWA 3M8WA 3BPSP 2G9OA 3LH2S 4EO6A 2JEJA 2NXEA 3CJ2A 3VV2B 3ITHA 1J5EF 3HHEA 3EX7B 5ETLA 4M63A 4ER8A 3RBXA 4ZVFA 1X0PA 2DRDA 1X31C 1R0BG 3LP0B 1YK9A 5B0BA 5KG1A 1OYEA 2MHNA 2ZBCA 4JYAJ 4YB7A 1UW4A 3R6LB 3J80Y 5G0RA 3PHEA 4LF2A 1VRQC 2QA1A 3S8SA 4MTPA 3ZTQA 1VBZA 1H2TZ 4QZVB 3R7SB 1MMLA 3I6PA 4U6PA 3TAMA 1FJ7A 4J9UE 2FVQA 4W92B 1XR5A 3POTA 2GNKA 4DF8A 4Y2AA 4O3SA 1C0UA 5GAHI 3KK3A 1FJEB 5ETRA 3DI6B 4HT7A 3N4WA 3HHLD 2Z2YB 3UWTA 1LNQA 2BM0A 3VAKA 1FK9B 3OR2A 4XK8C 3Q2TC 5CAAA 4WE1A 1KP6A 4QWEA 4A8SA 3CJSA 4KHMA 4DR6J 4BBYA 2EI5A 1NKEA 2W2OP 2WONB 2QG9B 3OV7A 3GIRA 5M2RA 3WDOA 1N33J 4PKDB 5D0EA 2NXJA 2RDJA 4AXIA 2AJ1A 2I8EA 1N8RT 2A2CA 4PG8A 2Z56B 1Q8BA 3BN4A 1WNEA 1N0UA 4ZCIA 3A3PB 1BC6A 2XMJA 4GO5X 1BD6A 3NP5A 3ZZOA 4FF1A 3VGVA 1F6TA 2DGSA 3LANA 5I42B 4JP8A 1LWEA 1IJFB 2FD2A 1CLFA 4ZOSA 4R8UB 3KLEB 5E3PA 4JOUA 1G4CA 4OJGA 5EHHA 4RW6B 2ZJRQ 2WSEC 1WHYA 3MCMA 2W9BB 2WB1D 3W61A 2XNRA 5BYRA 2VUGA 1ULRA 5HBMB 2LFVA 4FNHA 3DRSB 3C19A 2AP6A 2IRUA 2RDDA 4NA3A 2PI4A 1SB6A 3UCUP 3QT6A 1IJEB 3PRVA 1S97A 4NX9A 5IQQA 4KHPJ 1RTDA 1RWWB 2BE9B 2R7SA 4C3MA 3CCZA 4OQJA 3U1NA 3DOMB 3HFZB 5KFCA 2DR7A 3DNCA 3PFEA 1HQUB 4GRSA 1VQNS 2QSWA 3UI3A 4PYAA 2VV5A 4I2PA 1TELA 3VR1A 2LEBA 1AROP 2Y3YA 4QWBA 4J9NA 2Q43A 5D4PA 4NLGA 3BH7B 3MPVA 2OAUA 1HYSA 1ZZNA 2D69A 4ZPAA 2MB0B 3ITHB 5E2QA 1FFGB 2MY7A 4IQMA 2V94A 1R6VA 3MUVP 1PIEA 3MAQA 3FJ2A 1IBCB 4DV1J 3CCVS 2VKRA 3AD8C 5G0RB 3O3LA 1OPZA 2H3EB 2QX0A 4JI5F 3GILA 1U1OA 5CYQA 2SXLA 4HLBA 4QYZJ 1KFSA 3M6VA 1Z1ZA 3AFGA 4DV6J 2GS8A 2UU9J 2VQFF 4PWDA 2J6UA 3D2WA 4I6WA 1RAHB 4Z7YA 1F0XA 2DY1A 1VOMA 3POTB 2HLUA 4NCBA 1C0UB 2LXIA 2UV8A 5EUHA 3KK3B 1DFDA 1NO8A 4TY9A 1WJ9A 5KTQA 3GIJA 4K4VA 1NJZA 5A8KA 5L9NA 1LK5A 3MR7A 3ONQA 1GTEA 2OPSA 3BKUA 3OR2B 3CDUA 1Y11A 3TUPA 1YJWS 1RISA 4WE1B 4K4XA 4EUVA 4NLRA 5GMDA 5GVQA 4RKUC 1WSRA 5F9NA 4Q43A 3E3XA 4CO0A 3ZZZA 2MLZA 1R7IA 2V63A 1P6TA 1RI7A 1KONA 3VVUA 4LF6J 4ICLB 3M8PA 2V9WA 2NR0A 2Y1RI 2ZH1A 4RUBA 4YHHF 4KPCA 2A6MA 2CDQA 2FC8A 1P1TA 2FZKB 2JFDA 2Z4PA 3H4BA 4Y2MA 4WJBA 3R9LA 3UR0A 3M9NB 1RT1A 4ZS6A 2HPUA 4DV4J 4PXBA 5IV4A 3HO1A 3K8WA 1UEUA 3HFVA 3J7A1 1LWEB 3GG0A 2RD5C 2HS4A 3A12A 5GMKa 3HDSA 1NB7A 1NHUA 3H5UA 4EBCA 4IG0A 4JI1F 2HWIA 3PCOB 3B82A 3HSZA 3OTDA 4X4UA 4QOTA 1IR0A 4ZP7A 5C2GA 4KH1B 3KLIA 4DPOA 3AD7C 1FKOA 2NREA 3CDWA 1MN9A 3K17A 4C9DA 3CJ4A 4KBIA 2QLJB 2DH8A 4DV3J 1S4EA 1RTDB 3SCIE 2NYIA 4CLYA 4UW2A 2MKSA 1B70B 2W2QP 3L7PA 1U8WA 4OI1A 3KG0A 3AB4B 1I51B 2IM1A 2RAQA 1MMDA 4DU7A 2V8GA 4FP9A 2R7VA 3KUEA 2ZC4A 2VICA 4U96A 1X60A 2BACA 2AJQA 3KK1A 1GX5A 3W66A 4JV5F 3H2LA 2BE2A 3GP9A 1HYSB 4JBCA 3M8QA 4RW8B 2J0SD 5KFBA 1QUPA 2OMOA 3EVOA 2JC1A 4CTAB 4X4PA 3GE9A 1NDCA 1R3NA 3JSYA 2YY3A 3KJFB 3PDNA 4HDGA 1N5QA 3FZ2A 2HHUA 5HVHA 3OFEA 2V2KA 1D09B 3VF0B 2B56A 2N7CA 4NYPA 4LF4J 3CO9A 2YPYA 2V8HA 2VFRA 1U8SA 1TKDA 4DWIA 2BJDA 3D5MA 4JI7F 1TUWA 4KE5A 4I6YA 4U8VA 1N32J 1UETA 4GC6A 1NNDA 3UN3A 2RRAA 2ZH6A 4ID5A 4OYMA 1QTMA 4ZPVR 4AQYF 4JI3J 3T5LA 3LO3A 1GMWA 2MQMA 1S1TA 2OPSB 2W7AA 5KFXA 3N28A 1FJCA 4B17A 3T41A 1B7YB 5KFMA 4HACA 3G71S 3DLJA 1IKVB 1IBLF 4URQU 5IC4B 2CPXA 4YY3F 2LQ5A 3IO1A 5E3AA 3OSNA 1R8HA 1EAYC 1W25A 4JI0F 3FBEA 2IJFA 2OPQA 4QR2A 1N34J 4HEA9 3D7SB 1HIYA 5JMNA 3M8PB 1L3TA 2FUG9 3I55S 3TANA 5MAOA 4UZCA 4U8YA 4DX7A 1RE1B 1M5KC 2VPZB 3TA1A 1ZZFA 3RB4A 5D78A 2POKA 5I3UA 4OLPA 2IY5B 2QJ3A 1UVKA 4DV0F 1Y3JA 1LWFA 2NZCA 3MHYA 4ELUA 4DR3F 2XULA 4A8YA 5KG0A 2V4JB 5DS7A 3Q8UA 4DF4A 4X65J 2CPHA 1W7WA 2CJKA 2RNEA 2E5LJ 4P2SA 3L09A 1SC4B 1I6JA 4IG0B 4PR6A 4DL6A 2EFGA 3HPOA 1VBKA 4QW9A 3MDFA 4RBTA 2HVDA 4LSLB 3NGKA 1C4CA 2G2ZA 3HVTA 2F9JA 2MKKA 3KLIB 2V0NA 4UF4A 4ILLA 2C28A 3LF0A 1FKOB 4OYXA 3RTVA 2RKIA 1NJIT 2G1HA 2CJBA 4DUZJ 1FESA 3PM9A 3I32A 5FLXY 1WHWA 2OFGX 2MKIA 2IM3A 5JVHQ 2ZZNA 3MI7X 3PR5B 5HI7A 4RJVA 5CHCB 1CJKB 4AD6A 1RDRA 3THPA 3U7JA 1R8AA 3W65A 5M2UA 3M30A 2DHAA 1TK5A 4DG1A 4Y34A 2KU7A 2JSXA 2OLWA 2KDOA 3R5JB 2OEKA 4MAKA 1PYOB 4JV1A 4DR2F 2KZMA 4MKVA 2XQCA 3MAAA 4OI2A 4PWUA 1PJ5A 2XMKA 3AD9C 2C2KB 4LUBA 3OJSA 2BE2B 2L9NA 1LEOA 1T05A 1NAQA 3M8QB 2ZBQA 1HHQA 2JC0A 1JX4A 3EDQB 3SQOP 2BRLA 1T94A 3BJYA 1RADB 2BQ3A 3W9IA 1S6OA 3GG1A 3T5HA 1KTVA 4HT5A 2NZ4A 4X62J 1G1XA 2HVEA 3O2IA 2DGOA 1I1GA 4PG4A 2DJWA 1K0TA 2ZOMA 1O5JA 3PVXA 3BQ0A 3FC9A 1S9EA 2YQ3A 5CA5A 3ZTPA 4X64J 3VQSA 1S0NA 2J0QD 1RWVB 6FD1A 3TEHB 2LXFA 3TRGA 4K5RA 4DV5F 4OYBA 3EZ5A 4M5LA 4TYBA 4DV7J 1N48A 4ID8A 4TXSA 3CD6S 3P8BB 1RU1A 2OMLA 3PHTA 2CQ0A 4MYTA 1HQ2A 3JQJA 3I4HX 4CM2A 2E9RX 3BQ2A 4RNMA 3V4MA 3DDIA 3QPIA 1LWCA 4ID5B 3JSBA 4NE9C 3MF5A 2CPEA 5KFKA 3MZIA 2AV5A 1S1TB 5H9FJ 2W2PP 2RU9A 4F67A 3V6JA 4HACB 2GCFA 3ENQA 3GTYX 1C1CA 3D1QA 1R8CA 3J7YI 2YTCA 4LVOP 3CCTA 3CDBA 6FDRA 5LT5A 1FRXA 4LQ9A 3RRHA 3O5TB 4C48A 1WEZA 1S79A 2BKNA 5D4NA 1PBAA 3IWXA 2BV3A 3DDNA 2AX1A 1G7CB 1G2EA 1BE4A 1HARA 1JXEA 5KG6A 2C2ZB 2CQPA 1M90T 3QAUA 4X84A 1U6FA 3IRWP 4NOHA 3W5XA 5I3UB 1MMNA 2MLYA 1LWFB 4CI0B 2I2YA 1U1KA 2HFVA 2CZVC 2V8PA 1PJ7A 1J27A 3NGUA 2CPJA 3UVJA 3KWMA 4EZ9A 4ZVSB 5CD4A 2CQCA 2F63A 4HI2A 2DXDA 3B4DA 3PFOA 1CS4A 3TZZA 4J9KA 1RT3A 2YKPA 3OSPA 1RYSA 2IM0A 4B3SF 2CJ9A 3HVTB 2QRRA 1VC5A 3QWUA 3JQKA 1YIJS 3SCLE 1WC3A 4AL7A 1UCNA 3MGJA 4CLUA 2RKIB 3JYTB 1TZ0A 3AODA 4IDKA 1HQEA 2DIVA 4U95A 4MIBA 1KOOA 3H8YA 2XO7A 2B51A 4LSNB 3DLEA 1UZDA 4QW8A 2DCUB 3A13A 5K8OA 1Z2ZA 1YGYA 4ZITA 3U1MA 1K1SA 2IIHA 1R8BA 4ZHRB 3M30B 1ZH5A 4DG1B 3CJKA 4UQTA 4XDDA 4A8OA 2VJVA 3OT9A 4JI6J 3GFXA 3QZ8A 3QFHA 1YWXA 3DLGA 2BVZA 1JLGA 4RLEA 3U27A 4K0KF 4WZMA 4ZPDA 3UR3C 4LMZA 3LALA 4M5NA 1GMWD 3LP1A 3Q83A 5HLFA 2Q79A 5F9LA 1V3ZA 3OHBA 5L1LA 4OI4A 1T05B 2FTRA 1S6PA 2MZQA 4DCOB 3SSRA 1S6UA 4LF7J 2IFXA 4B9VA 2B4VA 3CNQP 4ATNA 3HVRA 2MSTA 4ZJLA 1KQSR 2P9GA 1VISA 3C46A 4M5HA 1TKXB 3FEZA 3K0JA 3IP0A 2HNZA 4HVZA 3RUBL 4F0HA 1SC3B 2CNKB 2QLXA 4BC7A 1KLMB 1RBAA 1KBRA 3TAQA 3CIMA 2IDLA 2M2BA 2XEXA 2MQLA 2KTQA 4ES3A 4LQ3A 3CW2C 1DY3A 1CJUA 1QUVA 3ZXWA 3DN9A 1KD1T 3MR6A 9RUBA 4WYLA 3G6YA 2AEFA 2FZGB 3VGSA 2BKOA 2V8DA 1NJYA 3PW4A 3H25A 3TX0A 4QWDA 1M1GA 4F4XA 1IVZA 1K9MT 1N6QA 4LJMA 2FJDB 1LWCB 5EWEA 2DISA 2ZC3A 5IC6B 3EVWA 3D67A 4OX7A 5B0DA 1OYDA 3R5DA 1C1CB 1TVRB 4O3RA 3PO5A 3TVZA 2M0GB 4ILMA 3ZZPA 2HYIB 3EGNA 1VQSA 4HHHA 3GV8B 1HR0F 1FT8A 4RL1A 3BDEA 3TVKA 2Y0BB 5U47A 1F2HA 2E7WA 3ULHA 3ET6A 1UA1A 2QV6A 2J6SA 3IS9A 1H6KX 4HR2A 4B9NA 1SVDA 1KWMA 4B9SA 5HJYA 4R5PA 2FHJD 3HM9A 1CSJA 2OPRA 1HA1A 1AUSL 3W2VB 4FXDA 4AXJA 2KM8C 3NCRA 1TL7A 1RTIA 1MNEA 2RRBA 3PACA 3MECA 4W98A 3PZPA 2XMWA 2K8GA 3UN2A 4M5GA 4ZLNA 2HFNA 4WKRA 4CO4A 1RBOB 3QRRA 5IT9U 2F7VA 1EJ7L 3KJVA 1HNWJ 2VU5A 4ZPCA 4IDKB 1HQEB 2GX8A 3MMAA 2VFSA 2C3UA 4F3OA 2IDEA 4DSEA 3DLEB 4RR5A 2CAJA 4RUHA 1D8YA 1PC4A 4JB8B 3L3CA 2AJFE 4KC5A 3N5BA 3NS5A 3OVSA 2OIHA 3CJKB 1HBOA 5I3QA 3OFGA 2H54B 1S76D 3I0SA 2CJYB 4TQRA 4RWWA 3DLGB 4NCAA 4ZJQA 1JLGB 1MU2A 1VQ6S 5E41A 4F3MA 3LP1B 1NRKA 5HLFB 3QGGA 4YUDA 2GMHA 1SIWB 1V6HA 3AJ1A 1S6PB 4CLPA 4OX8A 9ATCB 4AT1B 3SDEA 1F9EB 1MWZA 1SJFA 4U7UD 3KK2A 3HVAA 3ZZRA 2NPIA 2XLJA 4PPZA 1AB8A 3C6TB 2HNZB 1IBKJ 3PRDA 4JI2F 2HVHA 2L3MA 4NEZA 3T1HF 1BWEA 1NEEA 3CGIA 2V9KA 2HQ3A 3TYTA 4CNZA 1CJUB 3PR4A 4RUCA 2HFUA 2N7YA 3F73A 2BXJA 4RWXA 3MCSA 5F8HA 2R7RA 4HDHA 1N6QB 4C8OA 4NXMF 3H4DA 2RHSB 5KG5A 2ZEJA 2GMLA 3RG6A 1Q8LA 1X9SA 5GAGU 1U0HA 2LLZA 2KHDA 3DU6A 4G3IA 4ZMMA 1KQKA 3BGFA 1FDAA 3B54A 3MOZA 5IOLA 4K2XA 4O44A 3PYDA 4DX5A 1OPIA 2A1BA 3H20A 5DDOC 4RNFA 3V4IA 3OUYB 1FDNA 1NSKL 2J0XA 4CLSA 3QYYA 4NZ0A 2RUSA 3DRYA 5KT7A 2UXBF 3NKYA 4ZP6A 4GO7X 3ET6B 4K4WA 3IS9B 4I4BA 3LWMA 3CMAS 1D9AA 3FGVA 4YP3A 3PJXA 3TZWA 3EXYA 2ATLA 2COLA 4J9LA 4R5PB 5HVFA 1Q86T 4QIWD 4JI8F 3K2YA 2JHEA 3TOQA 3RRKA 2YQ1A 2OPRB 2KYXA 1V5IB 3P6YC 3LQVA 4DUTA 3J80U 1BLUA 2DNHA 3BR8A 3R2CJ 3CF5Q 3KUHA 3KNGA 3N6MA 1TL7B 1RTIB 4NLOA 4C4WA 2FIUA 3MECB 2PEHA 4OX6A 2CPFA 4MFBA 1U1LA 2BRKA 3BBCA 4U67Q 3H40A 3OL7A 1WF2A 1Z4UA 1RWOB 2E7XA 3KJVB 2VC1A 2GAGC 1NKCA 3J81Y 5F3ZA 3MMAB 3DRRA 1RHKB 1RWUA 3FSIA 2R8KA 2VC0A 4EU0A 3NNCA 2P2CB 3DXBA 4TLRA 5A6WA 1PO6A 1HI0P 1TKTB 4TQSA 1WHVA 2H9ZA 3I0SB 1ZS6A 3FBFA 1LQ9A 1FNMA 4ALZA 1HI8A 1MU2B 3DHXA 2MZTA 1J5EJ 2HLTA 5AT1B 2G0IA 1UEKA 3SFUA 1F3FA 1ZM3A 2J76E 2KL8A 3K59A 2VHGA 3CDAA 4OHXA 4BWJA 3JQMA 4B3MF 3CB4A 3KK2B 1Q7LB 1H2VZ 2PD1A 4TU7A 3W9HA 2HQDA 4J90A 1F5AA 1N54B 3OFFA 1GNKA 2M3DA 1RTJA 2F8EX 3QNWB 1PAEX 4YB6A 3CIZA 4ECQA 4FBTA 2XSJA 1VFJA 2VIHA 4X4SA 3T5JA 1N56A 3W1YC 2KHCA 5A8RA 2YNIA 4KO0A 4KB7A 4J5OA 5F8NA 2HIYA 1REGX 3V2UC 1QE1A 2NPFA 2FLOA 5J1PA 1M5VC 1U1RA 4LFBJ 1S77D 2I1RA 2KFZA 4ECSA 1SV5A 4WIQA 1FX2A 5H1SV 3QIPA 2HHHF 3UCZP 5L1IA 1IR1A 2YWKA 3HHLC 4O44B 2MZJA 2LVWA 5D3GA 1QY7A 1HHSA 4X66F 3RAXA 4P2MA 1SL2A 1RT6A 4K4SA 4PG7A 3QRPA 3V4IB 2JEGA 3TUZC 4DHVA 5AE1A 5D4LA 3BSNA 3ETMA 3OFHA 2R7XA 3CJQA 4CNYA 1RAJA 4YB1P 2AHOB 2LEAA 3AA9A 1H73A 4DBQA 1RYRA 5MLCV 2VODA 4PEOA 1ZOTA 3DGVA 2YH1A 1SJ1A 4KTQA 3EMTA 1EKSA 1KTQA 1JJ4A 4I7FA 3G82A 2D3O1 3I5AA 4H4KC 2ZUAA 2CFXA 5IZHA 1H7XA 3KG4A 3D0IE 4FS2A 3H5SA 1W26A 1NZAA 2GIQA 4A8XA 3SFGA 2GIRA 2BKPA 4BHQA 3B4MA 4MFBB 2AGQA 5GAHU 5GADI 4RNNA 5IT4A 3K5OA 1U6ZA 3RBZA 1M0SA 3Q2SC 4LF1A
chains in the Genus database with same CATH topology
2HBQB 3P4UB 4ZVSB 1RHMB 3R6LB 4ZVUB 1RWWB 1F9EB 2H4WB 2QL7B 1SC1B 4DCOB 2H65B 1I51B 2H4YB 1RWOB 2CJXB 2C1EB 2FQQB 3QNWB 2C2KB 2C2OB 2XZTB 1RWMB 3KJNB 4ZVTB 1RHKB 1I3OB 1RHUB 1ICEB 2QL9B 1NMEB 4DCPB 1RHRB 3NS7B 4LSZB 1SC4B 2CDRB 3D6HB 3EDQB 3R7SB 1RHJB 4ZVRB 2XYGB 1BMQB 2DKOB 1QTNB 2P2CB 3GJTB 2H51B 2XYHB 3RJMB 2C2MB 1SC3B 2H5IB 2CNKB 4ZVPB 2Y0BB 3R7NB 4JB8B 2H48B 3D6FB 3IBCB 1QDUB 5IC4B 2HBRB 1RWPB 1RWNB 1GFWB 2CNOB 2HBYB 3P45B 3KJQB 2QL5B 2HBZB 1RWKB 4ZVQB 2H54B 2QLFB 2QLBB 2XZDB 2CNLB 2CJYB 2C2ZB 3KJFB 1RWVB 3EDRB 5K20B 3GJSB 1RWXB 3GJRB 1IBCB 1RHQB 3IBFB 1PAUB 2QLJB 4ZVOB 2H5JB 3SIPB 3R6GB 1RE1B 4DCJB 2CNNB 2XYPB 3GJQB 3R7BB 3D6MB 3R5JB 2Y1LB 1PYOB 5IC6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBQ B;  3P4U B;  4ZVS B;  1RHM B;  3R6L B;  4ZVU B;  1RWW B;  1F9E B;  2H4W B;  2QL7 B;  1SC1 B;  4DCO B;  2H65 B;  1I51 B;  2H4Y B;  1RWO B;  2CJX B;  2C1E B;  2FQQ B;  3QNW B;  2C2K B;  2C2O B;  2XZT B;  1RWM B;  3KJN B;  4ZVT B;  1RHK B;  1I3O B;  1RHU B;  1ICE B;  2QL9 B;  1NME B;  4DCP B;  1RHR B;  3NS7 B;  4LSZ B;  1SC4 B;  2CDR B;  3D6H B;  3EDQ B;  3R7S B;  1RHJ B;  4ZVR B;  2XYG B;  1BMQ B;  2DKO B;  1QTN B;  2P2C B;  3GJT B;  2H51 B;  2XYH B;  3RJM B;  2C2M B;  1SC3 B;  2H5I B;  2CNK B;  4ZVP B;  2Y0B B;  3R7N B;  4JB8 B;  2H48 B;  3D6F B;  3IBC B;  1QDU B;  5IC4 B;  2HBR B;  1RWP B;  1RWN B;  1GFW B;  2CNO B;  2HBY B;  3P45 B;  3KJQ B;  2QL5 B;  2HBZ B;  1RWK B;  4ZVQ B;  2H54 B;  2QLF B;  2QLB B;  2XZD B;  2CNL B;  2CJY B;  2C2Z B;  3KJF B;  1RWV B;  3EDR B;  5K20 B;  3GJS B;  1RWX B;  3GJR B;  1IBC B;  1RHQ B;  3IBF B;  1PAU B;  2QLJ B;  4ZVO B;  2H5J B;  3SIP B;  3R6G B;  1RE1 B;  4DCJ B;  2CNN B;  2XYP B;  3GJQ B;  3R7B B;  3D6M B;  3R5J B;  2Y1L B;  1PYO B;  5IC6 B; 
#chains in the Genus database with same CATH topology
 2KJW A;  3PEH A;  1LWX A;  1QM9 A;  5BR8 F;  1XNR F;  5IS2 A;  2X3G A;  2CJX B;  1JLA A;  1TFY A;  1Q4R A;  3GPA A;  4HL9 A;  3NWR A;  2XC9 A;  2GJI A;  2ZHA A;  1R27 B;  2DNL A;  4DPU A;  2N4D A;  5E5N A;  1SJ4 P;  5J2P A;  3FK4 A;  4IOA Q;  3ZFV A;  1FVS A;  4KGV B;  2RSQ A;  1BQN A;  1RT5 A;  2AJ0 A;  3VAH A;  3CC2 S;  5A0Y A;  5DZ7 A;  2VZ9 A;  2VPY B;  1X9W A;  4NL5 A;  2B0G A;  2ACY A;  4YB5 A;  3HHN B;  1HNV A;  1RT2 A;  4Y00 A;  1N5T A;  4NRT A;  1APS A;  3QAE A;  1RKI A;  4DLG A;  4HYK A;  2XGP A;  3GON A;  5DO2 A;  5K20 B;  4XO0 A;  1TP7 A;  1PCA A;  2KG0 A;  3CTR A;  4ZCL A;  1OY8 A;  1EX8 A;  1S1U A;  4JI5 J;  2BE7 D;  1VHF A;  1YJ7 A;  5D0H A;  4DR5 F;  4DR7 F;  3MM5 A;  4O23 A;  1RTJ B;  4ZKA A;  4YFU A;  5KFR A;  2G2O A;  2R3V A;  3O8W A;  2XHC A;  4KH0 B;  4OL8 A;  2XSJ B;  4PAB A;  2EWH A;  2HWH A;  2VQE J;  2VDI A;  4F4A A;  2OGU A;  2OSR A;  3K5P A;  2DR9 A;  5A8R B;  3LUY A;  3CUL A;  2YNI B;  3NEK A;  4KO0 B;  2KVI A;  3I56 S;  1IXK A;  2LQ9 A;  4UY8 T;  2HZV A;  1HWJ A;  3QFW A;  1QE1 B;  1VQL S;  1DRZ A;  5HK4 A;  2YKA A;  3TAR A;  3IBW A;  2OH2 A;  1ZBT A;  4IO1 A;  4D3G A;  1ZAW A;  2XI3 A;  2R8H A;  1SV5 B;  2LEP A;  2XCA A;  5CZX A;  3QIP B;  3R1H A;  1FE4 A;  4I1T A;  4N76 A;  4E2F B;  1CBK A;  1A9N B;  5D3G B;  4ZCK A;  1WKK A;  1RT6 B;  3UD3 P;  2BJE A;  3W5Z A;  1AYE A;  1FXR A;  4CDI A;  4YHH J;  4U7U K;  2LA6 A;  2W4D A;  4DS5 A;  1T3N A;  1RKJ A;  1T9X A;  1KEK A;  2HFS A;  2R7W A;  1D3W A;  3ZO7 A;  1D8Z A;  2L41 A;  4KV8 A;  1M1K T;  4DR6 F;  2XM3 A;  3OLB A;  2B8P A;  3BKT A;  1TMM A;  1N0V C;  2M70 A;  1L3U A;  1DJ0 A;  2DO0 A;  4ITS A;  3GSI A;  4ILR A;  2LA4 A;  4I7F B;  3G82 B;  4DFJ A;  4F02 A;  1TR0 A;  4GKJ F;  3MFH A;  4JI1 J;  1EET A;  4HI1 A;  1F60 B;  2FY8 A;  2EBG A;  4RZR A;  2CNO B;  2ZDP A;  2BM1 A;  2FHK A;  4EK2 A;  4ED3 A;  2HRY A;  5B08 A;  1ZAX A;  3CCJ S;  2XWY A;  4NMX A;  4LIW A;  2VJU A;  4NRU A;  2MZS A;  3PW0 A;  4DUY F;  1TAQ A;  1JLA B;  4ELT A;  3C3L A;  3CD5 A;  2BR0 A;  1CJV A;  5IWA F;  4YEA A;  4ZIV A;  3NXZ A;  3FQL A;  3MEE A;  4WFZ A;  5EX0 A;  1BQN B;  1RT5 B;  3OHA A;  2BBE A;  5A0Y B;  4ED6 A;  2MJN A;  3BO2 A;  5KFH A;  4EEY A;  2DKO B;  1X4F A;  3L7U A;  2BJ7 A;  4QCL A;  3BO3 A;  2OFH X;  1HNV B;  5DM6 Q;  4UOF A;  1RT2 B;  1WEX A;  2DR5 A;  4GC7 A;  2EG1 A;  4FYD A;  5DJB A;  4PZV A;  4MJK A;  5HAN A;  2ASD A;  3TR5 A;  2HG4 A;  2NQP A;  2HSE B;  2ZH3 A;  5LL6 d;  3UNG C;  3G8Q A;  1RAO A;  1CJT A;  5CAB A;  4JUZ A;  1SKR A;  4K50 A;  4P71 A;  3GB0 A;  4O4G A;  2QC3 A;  1JJ2 R;  3MUT P;  2C22 A;  5EN1 A;  3L4B C;  4ZVO B;  1PIL A;  4NAS A;  3W63 A;  2DPI A;  2RDI A;  2CNN B;  3I31 A;  3MR3 A;  4B3R F;  1VCT A;  3KMQ A;  1URN A;  2R2T A;  2KG1 A;  1DQA A;  1FEE A;  3RAQ A;  2IVM A;  4PQA A;  3FVY A;  2LMI A;  3IAS 9;  4JI7 J;  1SC1 B;  4P72 A;  3JAM Y;  3U02 A;  4RBU A;  3QGP A;  2ZOG A;  1BWV A;  3CME S;  4BDP A;  1X4E A;  2CIM A;  3TP2 A;  2DR8 A;  1EAR A;  1U4B A;  1S59 A;  1WF1 A;  1SUQ A;  4AQY J;  4NLS A;  4LR8 A;  2R7Q A;  1HNI A;  5IM0 A;  1RLD A;  2VBY A;  2ZH5 A;  1JLB A;  2E1R A;  3DLB A;  1K73 T;  2OP5 A;  3WQP A;  2PEB A;  3IXQ A;  2FB0 A;  1IBL J;  4ZVP B;  4YY3 J;  4DV6 F;  1U24 A;  5IFM A;  4U9R A;  4CT8 A;  2YBV A;  5KFO A;  4K2J A;  2F5G A;  1PGZ A;  1HNX F;  2WVF A;  2WSF C;  3OR1 A;  3BS9 A;  3OL6 A;  3OTO F;  2UUC F;  1S72 S;  5DDQ C;  2WBM A;  3D68 A;  3LP0 A;  1OSC A;  2D9P A;  3FZB A;  2H5J B;  1HW9 A;  1Q79 A;  3MED A;  3HJF A;  3EPG A;  2WCX A;  1H74 A;  2Z2M A;  3FRZ A;  2PMH A;  4DV0 J;  1TL3 B;  2D9O A;  1M5S A;  1VQY A;  2ATC B;  5JVG Q;  4DR3 J;  4KV8 B;  5DLF A;  2L9D A;  3FSX A;  4CO2 A;  1S57 A;  2B5J A;  1URR A;  2CA9 A;  4M5D A;  3HD1 A;  1TQL A;  1U02 A;  4LRD A;  2JLE A;  1XMO F;  2EW9 A;  1EET B;  3IN5 A;  4W90 B;  1KN6 A;  1RQ0 A;  4Q8F A;  2M5Y A;  2JZ5 A;  3D4J A;  2R4F A;  4NA2 A;  4P7V A;  1FX4 A;  4L72 B;  3Q8R B;  1UJ4 A;  3DI6 A;  4KPY A;  2ACM A;  2DHX A;  3IR7 B;  1PYT A;  1GEH A;  3AAW B;  1GFW B;  2F1F A;  2ZIT A;  1X0F A;  1WC6 A;  2VPW B;  1QVF R;  1VRU A;  1QLN A;  1N5S A;  2X1A A;  4C2M A;  4EI2 A;  1VBY A;  2ROG A;  3OTE A;  2GV1 A;  2D7S A;  3D0G E;  3P5B P;  2HK3 A;  4DL3 A;  3LGM A;  4TKT A;  3TNV A;  4MYU A;  3PIP Q;  3QLH B;  2IVY A;  4DSF A;  3IMQ J;  4Q44 A;  2YKN A;  1CJV B;  2BEF A;  4DR2 J;  2F3J A;  2JEI A;  5FJ4 A;  3RBE A;  4G6V B;  4ED7 A;  2C3Y A;  3NNH A;  3RZA A;  3MEE B;  4ZPB A;  5HQL A;  4WU2 A;  3JTO A;  2ALY B;  2H4Y B;  5EWG A;  4ZP8 A;  4ECZ A;  3TI0 A;  2UVW A;  4OI3 A;  4DL0 C;  4QR1 A;  2OPP A;  1YBA A;  1Q8K A;  2HAI A;  1N36 F;  1V5V A;  1F5B A;  2DNY A;  1PC5 A;  1ZAV A;  3MD3 A;  1WOO A;  2XMM A;  5DRK A;  4F4K A;  3GYG A;  2DGQ A;  4LT6 A;  1ROF A;  4FF3 A;  1JLE A;  4F2R A;  2XY7 A;  1DUR A;  3KG1 A;  1JNZ B;  1CJT B;  1I94 F;  2DHH A;  3GCW P;  4FYX B;  2UUB F;  1FXD A;  3KJQ B;  2BW2 A;  4O4G B;  3SCJ E;  1F3V A;  1NUE A;  2QLF B;  1TK8 A;  3C15 B;  2DTJ A;  2QT7 A;  4DV5 J;  3FDS A;  3C6U A;  1HD1 A;  3EDR B;  4FYV B;  1UW9 A;  3NGS A;  2OHD A;  1CG2 A;  3N01 A;  2BX6 A;  4DQP A;  5F8M A;  1X4C A;  5BJR A;  2EKY A;  3Q8Y A;  2V5H G;  5HMY A;  1X5P A;  1S0O A;  3KLF A;  2FJX A;  4F36 A;  4C8L A;  3WIV A;  1FJG F;  5E33 A;  2VOO A;  4I64 A;  1VQO S;  1HNI B;  5IM0 B;  1YZ7 A;  3G87 A;  4DDF A;  1IBM F;  3T3F A;  1JLB B;  3HJV A;  2F4V F;  4ZVG A;  2YWF A;  3OTB A;  1IQZ A;  1B99 A;  4M5K A;  5F8I A;  2RF2 A;  1A0O B;  4AYB D;  3BGU A;  4HHU A;  1RBL A;  5KOW A;  2DNR A;  3FUY A;  5F3T A;  2HHS A;  2H51 B;  4WPA A;  2U1A A;  2KT2 A;  3R8Y A;  3OR1 B;  1IKW A;  2VB6 A;  4LFC F;  3QT8 A;  1N32 F;  2HQG A;  4N77 A;  5HN0 A;  2QL5 B;  3SCK E;  3RR7 A;  4JI3 F;  2EK6 A;  4FNI A;  4WP3 A;  2X1F A;  3T9N A;  3MED B;  4M5J A;  3ZZY A;  1KQG B;  6AT1 B;  1S1V A;  3LAK A;  2HMI A;  1Q8I A;  3HD2 A;  1REV A;  1YJ9 S;  1NHK L;  2O67 A;  2GZO A;  4KT0 C;  2B5J B;  1AUD A;  2G0J A;  1UZH A;  4M5D B;  3UN5 A;  4KGZ B;  5K5M A;  3JSR A;  4USJ C;  3CCL S;  4TLQ A;  4L6V 3;  3LPE A;  5EWF A;  2YNF A;  2QL7 B;  2WW4 A;  4I69 A;  2B43 A;  2XS5 A;  4B3S J;  1P9Y A;  1VQK S;  2CJA A;  2C1E B;  4N7T A;  1QAY A;  4WK3 A;  2QZ8 A;  5HVG A;  1WKL A;  2RRN A;  1QVG R;  5J1E A;  4DSK A;  2N4C A;  4RPF A;  2CDR B;  1NDL A;  4TY8 A;  3CO0 P;  4X4Q A;  2XHW A;  1KHV A;  2XY5 A;  3R27 A;  1RZM A;  2RB7 A;  2ZHB A;  1WI8 A;  4OZ0 A;  1VRU B;  2RS2 A;  7FDR A;  1ZM2 A;  4GVB A;  3TQ1 A;  2KB2 A;  4EMD A;  2JJ4 D;  2VD3 A;  4JI4 F;  2RQC A;  2UV8 G;  3SSQ A;  3PIO Q;  3J7Y U;  1FHT A;  3FMW A;  2IRY A;  5DDP C;  1H2U X;  4HH1 A;  2Q1L A;  2YKN B;  3FQK A;  4TVA B;  1SQF A;  2M8D B;  4ICL A;  2D74 B;  3GWC A;  2FDN A;  2ZBI A;  4OX9 F;  4K0K J;  3LW5 C;  1ZTW A;  3FMB A;  4X4V A;  4WF9 Q;  2UXC F;  1Y5I B;  3CPW R;  4K59 A;  1HWI A;  1XIQ A;  1KOH A;  3RU0 A;  3TW0 A;  2OPP B;  1U2C A;  4ED8 A;  3GIK A;  1Y4Z B;  2HNY A;  1IKX A;  5ETQ A;  2E1M C;  1ITP A;  3BPD A;  1JLE B;  1QAX A;  4DCP B;  3RGI A;  5LOQ A;  1HNZ F;  3JXO A;  2BJ1 A;  1FEH A;  3ZTO A;  1YG0 A;  2WBR A;  2I9S A;  2E5J A;  2H48 B;  3M8R A;  2YNH A;  3C6U B;  2W7O A;  4ERD A;  1T9V A;  5CCM A;  2E5I A;  4MMO A;  2IBK A;  5K14 A;  3VVT A;  4X62 F;  4RW9 A;  3ADA C;  1C2P A;  3MM9 B;  4N8N A;  4FF2 A;  1U0S A;  3KLF B;  4URG A;  1T7P A;  3NAI A;  3CUN A;  3QJJ A;  3MM8 A;  4J9V A;  2KO1 A;  2ZH7 A;  4X64 F;  2A0F B;  3CC4 S;  2LU2 A;  4V19 J;  3Q8V A;  4DPY A;  4ZA1 A;  1UL3 A;  2I0X A;  2J7K A;  2RF2 B;  1HWL A;  3D3C J;  1AA1 B;  4UST A;  4WTY A;  5HMX A;  4XDC A;  3Q89 A;  4XAK A;  1VIX A;  4RW8 A;  2ZBP A;  1AZS A;  1HD0 A;  3X1L B;  1IKW B;  2E1P A;  3CCW A;  3T6J A;  4OYA A;  4YN3 B;  3NLC A;  5K8P A;  1HWK A;  4DN0 A;  4CTA A;  1FNX H;  1Y10 A;  2M4M A;  2HK2 A;  3P5T L;  1S1V B;  5LJ5 Y;  1RB0 A;  2HMI B;  3BRE A;  1YRX A;  2QLB B;  4IFV A;  2V68 A;  1KHW A;  5KT3 A;  1REV B;  1CEZ A;  1IN0 A;  2AZ1 A;  3RBD A;  5AXM A;  1RA7 A;  1VJQ A;  2ZDO A;  2V4Q A;  4MK7 A;  4F25 A;  4ECT A;  1EHW A;  2FLP A;  2YNF B;  2IPO B;  2DNK A;  3M6W A;  3H5X A;  1X4A A;  4QPX A;  1RHM B;  1K44 A;  3N6N A;  4IRC A;  5J1E B;  4X2B A;  1FER A;  3G8T A;  4WK1 A;  2MHE A;  4TY8 B;  5CQG A;  4OZN A;  2CQH A;  3GZ7 A;  2OEJ A;  4KYZ A;  2CG4 A;  1VC0 A;  1Q7Y T;  1VMB A;  4WBF A;  1B7F A;  4GVB B;  4F0M A;  1IKV A;  1SJ3 P;  4H4M A;  5KT5 A;  3GQC A;  3UNY A;  1NBE B;  4KRW A;  3R7N B;  1R43 A;  4RNO A;  1VK3 A;  4JV0 A;  3J7Z 5;  2GW8 A;  2FJB B;  3A8I A;  3DM2 A;  4CRJ A;  2F4F A;  3PY8 A;  1XC9 A;  4ED2 A;  4IG3 B;  3D28 A;  3HT3 A;  3TX8 A;  2K3I A;  2ILZ A;  3GJQ B;  3IR6 B;  2Z2Z A;  3K5N A;  4J9R A;  4FXV A;  4Q2M A;  4NZ6 A;  2V4J A;  2ZM6 J;  1T9Y A;  3AH6 A;  4C8Z A;  2HNY B;  1FD2 A;  1IKX B;  3KLV A;  1HBN A;  4IRK A;  2EFO A;  2GHW A;  2VG6 A;  1QD1 A;  2M8H A;  4WII A;  2CG8 A;  4F04 B;  1KNZ A;  1OMS A;  3UDL A;  4DL2 A;  1L3V A;  1WC4 A;  4JI2 J;  4DV2 F;  4L3K A;  1D0E A;  2LU1 A;  4LSL A;  3SMZ A;  3T1H J;  5LSR A;  4UOG A;  3CMQ A;  1VI7 A;  2WTF A;  8ATC B;  4KGK A;  2YNH B;  3QMQ A;  5SZT A;  3QZ7 A;  1LFP A;  5K14 B;  1JLF A;  1SC6 A;  1RWN B;  3HKZ D;  2JLG A;  4C8K A;  4RW9 B;  2K06 A;  2UUA J;  4FYY B;  1CJK A;  2CUY A;  4NXM J;  2LQB A;  3V81 A;  2H1Y A;  3MM8 B;  3KOA A;  5SUH A;  4G1P A;  2ZHO A;  1H98 A;  5T7L A;  4HTI A;  2RUG A;  4O3Q A;  2ZVI A;  4IR1 A;  3OLA A;  2Z57 B;  1IUJ A;  5F41 A;  4CWB A;  2AEM A;  4NYZ A;  4Q45 A;  2HQI A;  2M88 A;  5LM7 E;  2DRB A;  1AZS B;  1VQP S;  2IMO A;  1I3O B;  2UXB J;  2NUU G;  1AXQ A;  3V6K A;  2W4P A;  1QAI A;  3BZQ A;  1QSY A;  3PW2 A;  4OHZ A;  5KFY A;  1OSD A;  1JQG A;  2EEY A;  4OZ1 A;  1SQG A;  3IBC B;  4IFV B;  2Z2L A;  4RU2 A;  5AE2 A;  2FPH X;  4JI8 J;  3TUI C;  2O1P A;  3IC1 A;  1LW2 A;  2IJR A;  2ZVS A;  1R6Y A;  3M8Y A;  3O6Q A;  1BQM A;  4OYZ A;  4WFN Q;  4DZ6 A;  2RE1 A;  1RA6 A;  1EIY B;  2J9D E;  3VHQ A;  3BGL A;  4I68 A;  2V34 A;  3TQE A;  3F44 A;  3PW7 A;  4P2X A;  2QMX A;  3R5C A;  1MRO A;  1TL1 A;  5KFN A;  3LPY A;  1U49 A;  3BYR A;  1SPB P;  5KFU A;  4B9L A;  3B6B A;  4CO3 A;  5HMW A;  3NNA A;  5KFI A;  1NK6 A;  5J2N A;  1NXI A;  2N3O A;  2DEJ A;  4EYH B;  4F4W A;  5ETN A;  3TUJ C;  5KFL A;  5GME A;  4DEZ A;  4H4M B;  1RXO B;  3T9Z A;  1KVK A;  4DX6 A;  1FNO A;  1S5Z A;  3NMA A;  5ETT A;  2J9D A;  4OJH A;  2W8K A;  3R97 A;  1U25 A;  5IV3 A;  1WDD A;  4MKB A;  4ED5 A;  4QBU A;  3FBB A;  3UDV A;  1YLX A;  1XJW B;  3D6F B;  3DM2 B;  3RB0 A;  5F0W A;  3W2W A;  3KMS A;  3PKM A;  2XCP A;  1U1N A;  3M4X A;  2WK4 A;  3O44 A;  4USW A;  1RK8 A;  2YX4 A;  1PSD A;  1RWX B;  1FD8 A;  1NPP A;  1QSS A;  4B3M J;  1FRL A;  3G9C A;  5DGB A;  4Z2X A;  4J9S A;  3GLJ A;  1HBN B;  2ZZT A;  1C1B B;  2VA2 A;  4MK8 A;  2MJU A;  2VG6 B;  3LP2 B;  1LV5 A;  1U47 A;  2AGO A;  2ZUG A;  3DLK A;  4ZVU B;  2GQC A;  3AY0 A;  3FCW A;  2K1R A;  3E51 A;  2KRR A;  2AQ4 A;  2DNN A;  1M5H A;  2PFF B;  1PKU A;  3DYA A;  3KLG A;  3IAM 9;  4LBP A;  5KG2 A;  4PCQ A;  3ICL A;  3Q22 A;  5JJB A;  1SBR A;  4YME A;  3NS6 A;  1UWA A;  2W25 A;  3JYT A;  4KKO A;  7FD1 A;  4LF9 F;  3VGT A;  2B9E A;  3A3O B;  1JLF B;  3EJM A;  2Y1J A;  4LSN A;  3DU5 A;  4WXW A;  2JH3 A;  3TZX A;  2MQ8 A;  1WHX A;  5J1N A;  2JLF A;  4GMK A;  2WSC C;  3V81 B;  4ZHR A;  3VCD A;  2A18 A;  2ZNZ A;  1UVJ A;  2R8J A;  1MSW D;  5THW A;  2HHH J;  1DHM A;  2W24 A;  5IT9 Y;  3UDC A;  3HSD A;  5L9X A;  1IQT A;  5T7L B;  3GFY A;  2VFV A;  2YPZ A;  1OWX A;  3R6G B;  2BOP A;  4X66 J;  4E0D A;  4F26 A;  1KDN A;  2HGN A;  3MM7 A;  3F41 A;  4IOC Q;  2FJE B;  4N47 A;  3BV8 A;  1XEZ A;  2VOP A;  1RU2 A;  1DTQ A;  2HZA A;  3IWN C;  3PG9 A;  1PBU A;  1N52 B;  1Q53 A;  3M8Z A;  4I2Q A;  3G2X A;  2BZ2 A;  2AMC B;  2CQ4 A;  3DOL B;  4DLE A;  1Q5Y A;  4WFX A;  3G6E S;  2RQM A;  1TKX A;  4FVC A;  1JXV A;  2Z30 B;  3CCR S;  4EBD A;  4A46 A;  2HQC A;  1KLM A;  4L73 A;  4WCE Q;  3NL0 A;  3GJT B;  2L08 A;  1LW2 B;  1O51 A;  2P6T A;  3GYN A;  4OZ2 A;  1BQM B;  2P5V A;  3EWG A;  1NK9 A;  3BDP A;  2W2M P;  4LF5 J;  1WEL A;  4P2F A;  3MEG B;  3D1H A;  2QSF A;  3MCO A;  4XPE A;  2XS7 A;  3RW6 A;  1B64 A;  2FJW A;  1MRO B;  4GKK F;  2BW7 A;  1TL1 B;  4C0H A;  1Q1K A;  4O4R A;  2FVR A;  4OLO A;  2K7J A;  3SZ2 A;  4QJV A;  5K8N A;  2FJV A;  3R7B B;  3GMG A;  2G13 A;  5J2N B;  2R9L A;  5BR8 J;  3D9B A;  1JLC A;  3QSI A;  1VS3 A;  1TVR A;  2CVI A;  5ETM A;  4N41 A;  2X51 A;  3X3U A;  3R5B A;  5HL7 Q;  2C2O B;  4IQX A;  3PYG A;  3M7V A;  2MQP A;  2B9Y A;  1U1P A;  3K58 A;  2HHV A;  4ZVR B;  1IM4 A;  3OJU A;  1C4A A;  3W2W B;  1OY9 A;  3C8Y A;  4OV6 A;  1U48 A;  2DGW A;  2XSF A;  3CCS S;  1Y00 A;  4LRA A;  2KH9 A;  3Q8P B;  3OQ2 A;  1SH3 A;  3P45 B;  4YDD B;  1IM6 A;  4PXE A;  2CQ3 A;  3NBP B;  3C66 A;  2BMB A;  3Q8Q B;  3T1Y F;  3IG1 A;  1IKY A;  2YX1 A;  3UCG A;  1O0P A;  4FN5 A;  3MMB A;  5DG7 A;  3W2V A;  4DR7 J;  3THV A;  3FRY A;  3DLK B;  4DR1 J;  2DT9 A;  2ROE A;  3B78 A;  3UD4 P;  1JWW A;  3HVW A;  1ZM9 A;  4ZDN A;  4B3O A;  2K1R B;  3R5G A;  2XGQ A;  1JIH A;  4H54 A;  2MKH A;  5L46 A;  2F40 A;  3DYA B;  4C8Y A;  3KLG B;  1YRT A;  2WVB A;  3MPU B;  2KYZ A;  4DI6 A;  5AJ3 F;  3CSK A;  5JUM A;  4OZ3 A;  4KKO B;  3VWS A;  5GAD U;  4LR7 A;  1NJW A;  5L1K A;  1PG5 B;  3QJL A;  1TMJ A;  5C42 A;  3GII A;  2NYH A;  2KKH A;  1X9M A;  3AJ2 A;  3RJM B;  1W2B R;  4C0O C;  3PYF A;  1SJQ A;  3CJ5 A;  5I4M A;  3VZH A;  4WKY A;  1RWP B;  5ETK A;  5F8G A;  2HBZ B;  2FLN A;  3EYZ A;  4O0I A;  1JK9 B;  2APO A;  1Y7P A;  3K5L A;  3MM7 B;  3IGN A;  3MEK A;  1TL4 A;  3EPI A;  2X3D A;  3N5F A;  3IRX A;  2FGC A;  1DTQ B;  3VAJ A;  4NI2 B;  2L48 A;  4LFB F;  2QFJ A;  4I2Q B;  3TAP A;  3J7A N;  3THT A;  5DG8 A;  1U09 A;  3A4T A;  2W9A A;  3C6T A;  1KSP A;  3V6H A;  4MIA A;  4YDX A;  4R0E A;  2BA9 A;  2HGM A;  2X1G A;  4ED4 A;  4A8Q A;  4PXC A;  4O3O A;  4WZQ A;  2W4C A;  3L95 X;  2HGL A;  5KT2 A;  5HJX A;  4GKJ J;  2RVJ A;  1GK8 A;  4Y2I A;  2HQF A;  4OI0 A;  4H4O A;  3P96 A;  2UVV A;  2DY9 A;  1FFS B;  2QN6 B;  2GQQ A;  2BDP A;  2DB1 A;  4CCH A;  2V6A A;  2OI2 A;  3BR9 A;  4P7T A;  3US5 A;  4LFA F;  3MXH P;  2RQK A;  5F8L A;  3D3B J;  4Z7C A;  4DOZ A;  2H5E A;  1PJ6 A;  2QA2 A;  1VGY A;  3PEJ A;  3IGV A;  4DUY J;  2CPY A;  1JLC B;  1BHN A;  2OEM A;  3MOJ B;  3JAM U;  2JEF A;  1V3S A;  2HVI A;  1O6X A;  3MR2 A;  1NKB A;  4DQS A;  1F5C A;  1VLO A;  5IWA J;  1TU0 B;  2V69 A;  4FBU A;  3F56 A;  4NXN F;  5C2C A;  5A76 A;  5KAK A;  1WC5 A;  3OUY A;  1XBW A;  2CZ9 A;  2HS0 A;  1B0P A;  4P10 A;  1S9F A;  2HHX A;  2P9C A;  2JNJ A;  5EGY A;  3KJN B;  4IYQ A;  2PDA A;  4QWA A;  2IC3 A;  2KXN B;  2AD9 A;  4C7Q A;  1SIZ A;  3H2V E;  4PWW A;  2GC8 A;  2VFU A;  1MG7 A;  3ISN C;  3EGZ A;  2IAJ A;  4NLT A;  5LMN F;  1AW0 A;  3UE2 A;  2C3P A;  2DYA A;  1RGV A;  4FDF A;  1XNQ J;  4LBI A;  3KHG A;  2FHM A;  3IG1 B;  4DSJ A;  1IKY B;  2V8V A;  2E1C A;  2J6T A;  3MMB B;  1BGX T;  3H0P A;  1VQ9 S;  1UVN A;  4MH8 A;  2RIL A;  2VBZ A;  4B9U A;  2DEI A;  4B3O B;  3GFZ A;  3EZO A;  2UUW A;  4B3R J;  1PAU B;  3JS9 A;  1NK7 A;  4OJ1 A;  1WAC A;  4AE5 A;  2XWX A;  1B3T A;  1A7G E;  3G8S A;  1OS5 A;  1S48 A;  4G1I A;  4LRB A;  4UUX A;  4DXL A;  2IA0 A;  3CCQ S;  4F4Y A;  4X4T A;  4DL7 A;  1WWH A;  4YR2 A;  2ZJQ Q;  1WTB A;  1Q16 B;  5C42 B;  2OKQ A;  2LKZ A;  2VG7 A;  1FTC A;  1J5O A;  3OVB A;  3W62 A;  1FRK A;  2CZ4 A;  1S0V A;  5EDW A;  5F0U A;  1TKT A;  4AND A;  2ZH4 A;  3BQ1 A;  2HRT A;  3L7O A;  1V3R A;  1FKA F;  4YS2 A;  3TAM B;  3NGT A;  1T02 A;  3M1V A;  1NK5 A;  2WOM A;  1HNX J;  2VQE F;  2DO4 A;  4UT4 A;  4B3T F;  2ASY A;  1XK8 A;  3OTO J;  2UUC J;  4B08 A;  2J5A A;  1LOU A;  4HTJ A;  4KSE B;  3IRX B;  4E98 A;  2XY6 A;  5E3R A;  3BSA A;  1K8A T;  3R5A A;  2MY8 A;  2XMV A;  2XBP A;  3DRP A;  3PKY A;  1ELO A;  1S6Q A;  2G4B A;  3ZNJ 1;  2EC2 A;  2Y1L B;  2AT1 B;  1DQ8 A;  2AKW B;  2ADB A;  4LF8 F;  2VA3 A;  5D4O A;  3MD1 A;  4J37 A;  4MIW A;  3GR0 A;  3CWJ A;  8RUC A;  1XMO J;  2PI5 A;  1JXL A;  2MQN A;  1YJV A;  2UXD F;  4K4T A;  2C2N A;  4H4O B;  3E2E A;  1X4D A;  2KN4 A;  3AJD A;  4ED0 A;  5LSL A;  4ECV A;  3TEG A;  2W7P A;  3BBF A;  3KDO A;  2XLK A;  4Q8E A;  2YVS A;  5CD4 H;  2PT0 A;  2UZA A;  1R8P A;  2YXL A;  4A48 A;  2WRM A;  2DGV A;  3FKB A;  1VYA A;  1JLQ A;  3DFE A;  4C11 A;  1MWQ A;  1XN9 A;  1P8G A;  1CQN A;  1VLY A;  1NHV A;  4NLD A;  2Y0S D;  1IWG A;  4B02 A;  3K8V A;  3LAM A;  5I3P A;  4J91 A;  2R2U A;  1BXN A;  1D9F A;  2EC0 A;  4QU7 A;  2OTL S;  5LXR A;  2KI2 A;  1H0H B;  1ZET A;  2Y8W A;  4O3P A;  3CD7 A;  5GAE I;  4OHY A;  3CJ0 A;  1X5T A;  3PXG a;  1N4L A;  5CH7 B;  2GJ2 A;  3QID A;  4OHW A;  5A2Q Y;  2IC3 B;  2CXE A;  3G6V A;  2ZKU A;  3DKD A;  1FWK A;  4FKY A;  3M9M B;  3HCX A;  3RB3 A;  1N36 J;  4L76 A;  2VL1 A;  1WI6 A;  4BC9 A;  2IAJ B;  1KRP A;  2YWH A;  4N8O A;  4HH0 A;  1NSA A;  1MN7 A;  2QO3 A;  3DLL Q;  4I2P B;  1YZ6 A;  1ZA2 B;  2EVZ A;  5ETP A;  2WAQ D;  4KIA A;  1I94 J;  4PG5 A;  1FE0 A;  2UUB J;  2Y9H A;  5HQ8 A;  3W7B A;  2AGP A;  2C42 A;  1T8E A;  4OZL A;  4QIG A;  1U1M A;  2GVZ A;  4DFK A;  3CED A;  5LXY A;  3CC7 S;  1Y3K A;  1FO1 A;  1S7I A;  4KAI A;  4NZ7 A;  3U1L A;  5ETO A;  3GJR B;  5E3C A;  2NXN A;  2DNZ A;  4K4Y A;  2IRX A;  2F8M A;  4DPW A;  2B3T B;  2DGX A;  4AL5 A;  1S12 A;  1KQF B;  4AL6 A;  4LRE A;  2ZKT A;  1GXU A;  2QGF B;  1U7L A;  3MR5 A;  1XR6 A;  5C25 A;  1NK8 A;  2VG7 B;  1FJG J;  2J0W A;  3QBC A;  1J5O B;  5CYQ B;  1IBM J;  2XMU A;  3ZTR A;  2XO6 A;  5DZ6 A;  2HS3 A;  2F4V J;  2C2R A;  4HKQ A;  1FDB A;  2MQO A;  1G6B A;  3BN7 A;  5HRO A;  1YBU A;  3TJ8 A;  4PWD B;  3DDK A;  2D3U A;  5C5J A;  3M1V B;  2CVE A;  2WOM B;  3MCN A;  1C0T A;  3GV5 B;  1EP4 A;  3B8H A;  1DAX A;  2AYG A;  1XMQ F;  3MPW A;  4LFC J;  3WZ0 A;  2IBO A;  2GGP A;  5A8W A;  2YWE A;  4USI A;  3PTW A;  5A8K B;  1PYS B;  2E5G A;  2B6A A;  4OYW A;  2MZR A;  3AA8 A;  3D0H E;  2ILY A;  3P3D A;  2RQ4 A;  3DRP B;  1S6Q B;  3A1Y G;  4AUK A;  3BGO P;  3AOC A;  3VTI A;  4FPI A;  4EGL A;  3P49 B;  5KFP A;  1WDT A;  4A4J A;  2CKW A;  2GAH C;  4FVM A;  3RAM A;  3JTP A;  4DCJ B;  2AIR B;  2PC6 A;  4BWM A;  2DNM A;  4E8U A;  4IUF A;  3ILJ A;  4PPD A;  1RAG B;  1WG5 A;  3N0V A;  2AW0 A;  4MKY A;  4ENO A;  3EXC X;  2A3J A;  3BGR A;  3M2R A;  5KFA A;  5KT6 A;  3OTC A;  4DR4 F;  2ABY A;  1EZZ B;  4LR9 A;  5L1J A;  1CQM A;  1FA0 A;  4RX6 A;  2VBW A;  1EKR A;  3LGH A;  4QYR A;  5CXT A;  1RT1 B;  1J2V A;  1YJN S;  3GYX B;  1S99 A;  2XMT A;  5M2P A;  2D3O R;  4EBE A;  1JLQ B;  4USH A;  1QJH A;  3V6D A;  1BY9 A;  4C11 B;  4B9M A;  4Q7A A;  4CYU A;  4JI4 J;  5KFW A;  1X5O A;  4CLZ A;  3OD2 A;  2HBR B;  4Q5V A;  5HP1 A;  4ZN3 A;  4DQQ A;  2B7C B;  3M6U A;  2D41 A;  1X4B A;  4WFA Q;  2R8G A;  4TN2 A;  4OX9 J;  4PAA A;  4WWS A;  4ANE A;  3CCE S;  3SIP B;  2UXC J;  4K8R A;  4XPC A;  1LXJ A;  4X4R A;  3I5C A;  1T3O A;  2BAB A;  3MM6 A;  1DTT A;  4YR0 A;  4L3N A;  3FEX B;  4W4M A;  5D0G A;  1H38 A;  4M5I A;  2WHO A;  3DCA A;  4OMF G;  1JNR B;  1AFI A;  1JMT A;  1R0A A;  4ZN1 A;  4OYI A;  3KKF A;  2H65 B;  1WUU A;  5IT0 A;  1R89 A;  2FQQ B;  4Q0B A;  3SSS A;  2D1C A;  3J81 j;  1HNZ J;  2CQI A;  2L9W A;  5LMU F;  5CYJ A;  3CCU S;  2AWZ A;  1RHR B;  2MQQ A;  2KFY A;  4ZPW R;  2UUT A;  5JXS A;  2K7K A;  1QTN B;  3KK1 B;  2FHJ A;  4NLP A;  2HKE A;  1RAA B;  2C2M B;  1M1H A;  2GVZ B;  1S9G A;  2PE8 A;  1ZM4 A;  3QT7 A;  2M52 A;  4OIX A;  1TKZ A;  4TU9 A;  1WOR A;  4C6A A;  3E01 A;  4DFM A;  4FKX A;  1F9H A;  3NRB A;  2V4R A;  2NUH A;  4USM A;  2EXU A;  4O3N A;  5C25 B;  5D0R A;  1VR6 A;  2MGZ A;  1H7W A;  2N82 B;  2IA6 A;  4TYA A;  2EKN A;  2RH3 A;  4D3H A;  2UP1 A;  4ZJO A;  2V2Q A;  3P4U B;  5A6P A;  2W1B A;  2LDI A;  4QWC A;  2Q3P A;  3K5M A;  5K9F A;  5HRO B;  5FD1 A;  3S7R A;  3WC0 A;  2YH0 A;  1B0V A;  2FZC B;  2DCL A;  1C0T B;  1EP4 B;  1MW7 A;  2ZWO A;  2V67 A;  3HSG A;  2VFT A;  3EVM A;  2A6O A;  3QT5 A;  4QIE A;  1M5O C;  2LDY A;  3CJT A;  3A8K A;  2GGP B;  4LRC A;  5A8W B;  2QEX S;  2DNQ A;  2BYC A;  2HAF A;  3UD5 A;  4IO9 Q;  4ZIW A;  2W01 A;  2B6A B;  3UO0 A;  2ZFH A;  1S4F A;  4FZV A;  2CQD A;  4WP9 A;  2IHR 1;  4K7Q A;  1WF0 A;  2QYG A;  4RW7 A;  3ISZ A;  2VPX B;  1NH7 A;  3IA0 A;  2I38 A;  4C97 A;  2BJ9 A;  1Q0N A;  5FII A;  2VQF J;  2OPQ B;  1YJR A;  3ZNU A;  3QJP A;  4CLT A;  3OL9 A;  2GMJ A;  1FRM A;  4Y65 A;  2HUR A;  1SCJ B;  3D6M B;  3BGR B;  3NCP A;  3M2R B;  3WIU A;  2BAN A;  2I5J A;  1KLN A;  3D6T B;  5H9E K;  5KFT A;  2P9E A;  3TWZ A;  3KHR A;  2RHQ B;  3OVA A;  2YNG A;  4JYA F;  3Q23 A;  4OV1 A;  3DOK A;  3ENV A;  2OJ3 A;  1DAR A;  4ZCM A;  1XTZ A;  1YRU A;  4DJB A;  4TU8 A;  3V6D B;  2Q66 A;  2Y8Y A;  4CYU B;  3VAM A;  3CCM S;  1FDD A;  2CWK A;  4ES2 A;  3W8P A;  5KG7 A;  4USK A;  5HP1 B;  2X7I A;  3S1T A;  2IJN A;  2EFV A;  1OQ3 A;  2KZZ A;  3OXL A;  2MKY A;  2HBY B;  4A8W A;  4P6Q A;  4V19 X;  4CH1 A;  2ALZ A;  3QRQ A;  1NCL A;  4F8R A;  1OJ4 A;  2GO8 A;  1S1W A;  4NLQ A;  3Q0A A;  3MM6 B;  1DTT B;  2AYE A;  1FRH A;  4DFP A;  3IFE A;  4EO8 A;  4OYP A;  2XB2 D;  1YBT A;  3KHL A;  3EIC A;  2B9W A;  1TL3 A;  1GH8 A;  2K2P A;  4LRF A;  3CD0 A;  1RAC B;  4QU6 A;  5FDL A;  4FYW B;  1CUL A;  1R0A B;  1WKJ A;  4PG6 A;  3G96 A;  1WTF A;  1XWL A;  1IWA A;  5HSP A;  4QR0 A;  4Q0B B;  2LP4 A;  1T9U A;  3T19 A;  2PA8 D;  1NZ8 A;  3OL8 A;  2MLX A;  1XQI A;  3KUG A;  3H2U B;  1GTH A;  4NWB A;  3H5Y A;  2F65 A;  1N33 F;  4Y0F A;  2QA4 G;  4DV2 J;  3A8J A;  3MAA B;  1RHU B;  2QL9 B;  2F8H A;  1TUG B;  4USV A;  2KXF A;  1S9G B;  3NMR A;  2E9Z A;  4NML A;  1UFK A;  5KT4 A;  2CPZ A;  1TKZ B;  2NXC A;  4Z37 A;  1OQ6 A;  1LK7 A;  3E01 B;  4PYD A;  3G4S S;  2OTJ S;  5AE3 A;  5BYS A;  2YQ0 A;  4KQZ A;  4Y28 C;  4ZVQ B;  1SL0 A;  5CZV A;  4WYW A;  2CNL B;  2IMW P;  1S9E B;  2MYF A;  3QLH A;  2MGZ B;  2XNQ A;  2JVO A;  2ROP A;  2ZJP Q;  1RAB B;  2MPU A;  3ISN D;  2C3M A;  3MMC A;  2FHO B;  4BLG A;  1F1B B;  2FJA B;  2DBB A;  2J8A A;  4JV2 A;  5KG3 A;  4JV5 J;  1RT7 A;  1O8B A;  2HVZ A;  3BYP A;  2J9C A;  5AXL A;  2H4W B;  4KHP F;  3VAG A;  2FVS A;  3CE8 A;  3TJA A;  3PJ9 A;  1JKH A;  1TUV A;  4IFY A;  1S10 A;  5E0O A;  4GVL A;  2XI2 A;  4A8M P;  1ACM B;  3KTQ A;  3A8E A;  1FKP A;  2DGT A;  1F9F A;  4PUO A;  1YIT S;  1B4S A;  3OPK A;  3KYL A;  2LQJ A;  1S49 A;  1Y5N B;  2R7T A;  1AFJ A;  3KXD A;  3SV3 A;  4RW7 B;  4DX8 H;  5AXK A;  2GVD A;  2CJQ A;  3C15 A;  3I4P A;  1H72 C;  3UPF A;  4P9S A;  4DPX A;  4BCA A;  1GAO A;  1TV6 A;  1NK0 A;  2AJ4 A;  4WXO A;  2CQG A;  3EGV A;  4P52 A;  2NSB A;  3DMJ A;  4G1Q A;  2E66 A;  2AYM A;  4A8K A;  2BAN B;  2D3Z A;  2I5J B;  3DGP A;  3EE3 A;  4I6A A;  1FRJ A;  2DIU A;  4NLV A;  4DV1 F;  1WG4 A;  2YNG B;  1U2R A;  3DOK B;  1ZYQ A;  3GV7 B;  2OO4 A;  2HZC A;  2QMU B;  5KFF A;  3NWG A;  2K3K A;  3PX6 A;  3UVJ B;  4A47 A;  5K8M A;  2DXE A;  3F0N A;  4WFB Q;  3PX0 A;  5FLX U;  4KFB A;  3BM7 A;  4F50 A;  5D77 A;  2UU9 F;  2O66 A;  1CS4 B;  4KY3 A;  1RT3 B;  1UAW A;  4JI0 J;  1U2F A;  1Y0H A;  3ELH A;  1I5O B;  1A6L A;  3H42 A;  1YSJ A;  2DIT A;  2RT3 A;  3PYE A;  3N9U C;  2DVI A;  4MKA A;  3SQG A;  2ERR A;  3BSO A;  1KKH A;  1P1L A;  2AEJ A;  3JSM A;  2AJ2 A;  1Q95 G;  1S1W B;  1Q82 T;  3HFK A;  2FGO A;  5B0F A;  2PII A;  5CYM A;  5FDL B;  3FSY A;  3LA0 A;  1CUL B;  2WB4 A;  1QAJ A;  3MMJ A;  3M2V A;  2O01 C;  2QE5 A;  3UW1 A;  5KFQ A;  2OEL A;  2WVE A;  2ZH9 A;  1DQ9 A;  1UPP A;  4IOB A;  1P27 B;  1UJ6 A;  2HFO A;  1N88 A;  3EZU A;  2BUN A;  3M05 A;  4LF6 F;  4F7V A;  2OD6 A;  3I9Z A;  5D8H B;  1YKW A;  4PQU A;  1FTR A;  2WZ1 A;  3QSY B;  2HHW A;  2VKZ G;  1UVL A;  2HHP A;  1NB2 A;  3T1A A;  4DV4 F;  4LF9 J;  3W9J A;  1RCX B;  1VQ4 S;  2ZM6 F;  4QIV A;  4IH6 A;  4X4N A;  3HX9 A;  2ZH8 A;  1UKU A;  2V2V A;  4N5S A;  4CH0 S;  2FY1 A;  2JX2 A;  5HAO A;  1GX6 A;  2R2S A;  1XMB A;  1V9O A;  1YQH A;  3MMC B;  3I9V 9;  1UFL A;  2PMZ D;  2RIJ A;  1NJX A;  1U26 A;  4RW4 A;  4YQW A;  4TNO A;  3MAH A;  1RT7 B;  1UPM B;  3N79 A;  3DHW C;  4DV3 F;  3TZY A;  1WG1 A;  5C24 A;  1GMU A;  1FWL A;  2E44 A;  1UEV A;  1CC7 A;  2ZBR A;  2UUA F;  1JKH B;  3I82 A;  2E9T A;  2KVQ E;  4IFY B;  3EM1 A;  4CZC A;  3ZZ0 A;  1L5U A;  1VQ5 S;  1FKP B;  4ELV A;  3CJ8 A;  4PUO B;  4XIU A;  5CCL A;  3TO8 A;  4ZK7 M;  2KT5 A;  3O1L A;  2VG5 A;  2M9K A;  4F2S A;  4DMZ A;  1LW0 A;  2YKO A;  1EB0 A;  1NU4 A;  1YJU A;  1D1U A;  3PW5 A;  2GVD B;  1SJR A;  1UWB A;  3QQC D;  2QMW A;  3TVY A;  2LYV A;  3M2U A;  2M7S A;  1TV6 B;  2DGU A;  5G4D A;  5BYQ A;  2W9C A;  3D54 A;  2JDJ A;  2HND A;  4G1Q B;  3DMJ B;  2R42 A;  1RWK B;  4UQG A;  1HBM A;  3MUM P;  4M94 A;  3S01 A;  2OUG A;  3DGP B;  4P75 A;  4GKK J;  2X1B A;  4P74 A;  2KRB A;  1SH2 A;  1UJ5 A;  1K1Q A;  2DH9 A;  2J9E A;  3MM9 A;  1Q5V A;  4ETX A;  2EK1 A;  1L3K A;  2I6W A;  2FYX A;  2DPJ A;  1S7H A;  3H98 A;  4WU3 A;  1SXL A;  1CVJ A;  2MEW A;  3MTJ A;  2B4U A;  2A10 A;  4KFB B;  4FPR A;  1RAE B;  5DM7 Q;  4LF4 F;  1HW8 A;  2DXF A;  1DBD A;  2JWN A;  3ENA A;  3KLH A;  3HT0 A;  2BJ8 A;  2LEC A;  4CLK A;  1VHI A;  2RML A;  4HHJ A;  2XZT B;  3KFW X;  1UVM A;  3FNN A;  1R0C B;  1VQM S;  2GQ2 A;  5B0C A;  1JB0 C;  1CPZ A;  3SBM A;  4ED1 A;  3SQG B;  1NK4 A;  3W60 A;  3C14 A;  1NDP A;  2MTL A;  1W2I A;  3JSM B;  2JOQ A;  3BF4 A;  1NLK L;  3SXL A;  4Q2L A;  4I56 A;  1UFW A;  3CT9 A;  4ES1 A;  4X4O A;  5CYM B;  3IWL A;  1AT1 B;  4Y2K A;  2VDH A;  3M2V B;  3T1Y J;  3GU0 A;  2XS2 A;  1YHQ S;  1JJC B;  2BQR A;  5B0E A;  1HBO B;  4NLY A;  3L9Z A;  4NLW A;  3AOA A;  3PNI A;  1KS2 A;  5B0G A;  1HFE L;  2PSZ A;  3M9O B;  3IBF B;  4LVN P;  1N34 F;  1FXL A;  1FI4 A;  2PGC A;  4QPT A;  2ZNY A;  3VQT A;  4PQU B;  5KFG A;  5KOX A;  2HEK A;  1S1X A;  5J2M A;  3QWP A;  5B0A A;  2ZZM A;  4G65 A;  5AJ3 J;  2F9D A;  2HIQ A;  1TK0 A;  2B4O A;  1VRT A;  4C8N A;  3EUN A;  3LTO A;  1DLO A;  2DD8 S;  4NCG A;  1RTZ A;  3SDE B;  3QGH A;  4ZLJ A;  1HWU A;  4X65 F;  1Y5L B;  4ECR A;  3K7R A;  2EFQ A;  1ICE B;  4EZ6 A;  2VBX A;  3J7Z T;  4M8L A;  1E6V A;  4RUA A;  3NOG A;  2WVD A;  2E5L F;  2KXH A;  4CT9 A;  5IQ6 A;  3QAT A;  3RRG A;  1UMJ A;  3HZE A;  4A8F A;  2AF6 A;  3WHI A;  3JB9 k;  1HLW A;  2AU0 A;  3TA2 A;  3D1O A;  1FWP A;  2E7V A;  1N5Y A;  1Y9O A;  5LSO A;  3IR5 B;  4WTO B;  3HI9 A;  4PXD A;  4RW4 B;  1FCA A;  3RR8 A;  4IG3 A;  4FXW A;  4DUZ F;  3SI8 A;  1YDL A;  2YKQ A;  2QTW A;  1T95 A;  2PFD A;  2EFP A;  3FBC A;  5C24 B;  1VJW A;  1RHQ B;  2IVF B;  3AXK A;  2XYP B;  2CQB A;  4YR3 A;  4K5S A;  4J9M A;  2HBQ B;  1VIO A;  5DLG A;  1HL6 A;  1U0H B;  1RSC A;  3HHK A;  1ZA1 B;  3WC2 A;  3TA0 A;  3ENW A;  2VG5 B;  2PA3 A;  4DS4 A;  3D66 A;  1RWM B;  1LW0 B;  4QYZ K;  4OFZ A;  2C2E A;  3AXM A;  1G3O A;  3BH6 B;  1UWB B;  2WVC A;  2W8L A;  1RP5 A;  3M2U B;  2LXU A;  5D15 A;  2W9C B;  2HND B;  4IH5 A;  4DPT A;  3I87 A;  1HBM B;  3I96 A;  4LFA J;  3BEG B;  3MWB A;  4FS1 A;  1IR2 A;  1SKU B;  3BBB A;  1E6Y A;  3VAI A;  1HPZ A;  2P8I A;  3NAH A;  5ITH A;  3H59 A;  1HI1 A;  1B0T A;  1NH8 A;  2DR6 A;  4MK9 A;  1HHT P;  2VAS A;  2DH7 A;  5KFV A;  1NM2 A;  1XR7 A;  3V5R A;  4DL4 A;  2NS1 B;  2RU3 A;  1WOS A;  4CIO A;  3KLH B;  4DV7 F;  2NSC A;  3AOB A;  4LF5 F;  4NXN J;  1VBX A;  3Q86 A;  3HF5 A;  2KT3 A;  4L75 A;  2U2F A;  1P9Q C;  2B4P A;  1HR0 J;  3QGI A;  2DHS A;  1VDH A;  1WD6 A;  4DL5 A;  3T6B A;  3C14 B;  2NCK L;  1SH0 A;  1GXL A;  4QIF A;  3AQO A;  2MSS A;  2E29 A;  1RLC L;  4OJ3 A;  1X5S A;  3D6H B;  3DRR B;  4S0M A;  2UVU A;  1RTH A;  1TAU A;  2XYG B;  5E3Q A;  3A3N B;  1WSV A;  5LMN J;  3SYZ A;  2JFK A;  2C2D A;  1RUS A;  1T9W A;  2VH7 A;  3K57 A;  4B9T A;  3W8G A;  2C3O A;  3QO9 A;  4OZJ A;  3K89 A;  1MWY A;  2DNP A;  1T9T A;  1SQE A;  3HMJ G;  2QLW A;  2J7U A;  3GJS B;  3M8S A;  1Q81 T;  1SKW A;  3HK2 A;  3C16 A;  3NY0 A;  1S1X B;  2KJV A;  2ZE2 A;  5J2M B;  1OY6 A;  4I67 A;  2FC9 A;  4WP8 A;  4K4U A;  3VAL A;  1VRT B;  1DLO B;  2A2D A;  4XTT A;  4NCG B;  3NG8 A;  2MKJ A;  2FVP A;  3KNA A;  4ETZ A;  1K0V A;  2NXU A;  3DRX A;  1E6V B;  3CJ3 A;  1L3S A;  3M32 A;  4ZVT B;  1XER A;  4DR1 F;  4M95 A;  2JL9 A;  3SV4 A;  2VON A;  3OBI A;  3LWL A;  1GMV A;  3FFI A;  2ZOF A;  3ETO A;  3I0R A;  3T5K A;  1RHJ B;  1WOP A;  5DQH A;  4AFF A;  4U7C A;  4RBV A;  1Z2L A;  1N5Y B;  2EPI A;  4CLF A;  2V50 A;  4EFA C;  5HO4 A;  1KR4 A;  4B3T J;  1EQ0 A;  1QDU B;  1T0T V;  5ETV A;  8AT1 B;  2QYC A;  4PRF A;  2O3D A;  4NLX A;  1CC8 A;  2BJ3 A;  1TL5 A;  2XZW A;  4L74 A;  3G86 A;  2B9X A;  2BOA A;  1HBU A;  1YX2 A;  1HMV A;  2DNG A;  3W5Y A;  2RS8 A;  5KFS A;  2XMA A;  4M5M A;  3ILI A;  1C1B A;  1DZ5 A;  3LP2 A;  2ZH2 A;  5A2Q U;  4J7C A;  3PX4 A;  2KM8 B;  5B7W A;  3M6X A;  4JI6 F;  4OHV A;  2MMY A;  5KFD A;  2AZ3 A;  2CYY A;  3GSD A;  4LF8 J;  3NOC A;  3WX8 A;  4WFY A;  5D6G A;  3ILL A;  5EX3 A;  5BXI A;  1JJH A;  4OYO A;  2UXD J;  1BUX A;  2AX0 A;  5HMZ A;  1RT4 A;  2PMW A;  3MUR P;  4LF7 F;  5DQG A;  3DC2 A;  3VAF A;  5T41 A;  5KFE A;  4LSZ B;  1U1Q A;  4CLW A;  4IR9 A;  1Q78 A;  1UP1 A;  1UTA A;  3ZTS A;  2G0C A;  3OW2 R;  4KHR A;  1T03 A;  1X4H A;  3ZC4 A;  3NGR A;  5F8J A;  1H3D A;  5J2Q A;  1X4G A;  3KDN A;  1VQ8 S;  4Y2C A;  3MFI A;  3RW7 A;  1E6Y B;  3W3S A;  2G2Y A;  3BB5 A;  1HPZ B;  4CO5 A;  1SKS A;  4ZLP A;  4M1K A;  4C98 A;  2GJF A;  1U45 A;  5DGA A;  1QSL A;  3J81 U;  5B09 A;  4RNH A;  3TJ9 A;  3EGW B;  2FLL A;  1FRI A;  4USU A;  2B7B B;  5H9E J;  3NCQ A;  4ZPT R;  3FEY B;  3ZZT A;  2ZWP A;  2CRL A;  4EYI B;  2HWT A;  2XLI A;  4FF4 A;  4C0B A;  1M5P C;  3OXF A;  3DOL A;  2CQ2 A;  3HXM A;  1NPR A;  5KFJ A;  2Z0G A;  1RTH B;  4CM0 A;  2V2Z A;  5ADZ A;  4YOE A;  4URS A;  1NME B;  3LGN A;  2R7O A;  3UDE A;  3N6L A;  1NSP A;  4KGM A;  1BMQ B;  3FCH A;  3QO9 B;  1RJJ A;  2CAD A;  2G1D A;  1FF2 A;  1NDK A;  2ASJ A;  5J2P B;  5L8R C;  2H5I B;  3GFH A;  4R25 A;  5KG4 A;  2XTJ P;  3GR1 A;  2ZD1 A;  1GT8 A;  3MEG A;  2GA7 A;  2GO9 A;  2LQ8 A;  3SEO A;  2EBE A;  3C16 B;  2ZE2 B;  4BS2 A;  2AYB A;  3OXG A;  4DQR A;  3R3T A;  4NLU A;  3DXS X;  4OZ5 A;  5HAT A;  3R1L A;  1UVI A;  1XNQ F;  2YKM A;  4Y3C A;  1OO0 B;  5ETS A;  1FFW B;  1RAI B;  2O5D A;  1WC1 A;  1S1U B;  2DK2 A;  2GHV C;  1LXN A;  3HHL A;  4ZVE A;  2N3L A;  3M32 B;  1TTH B;  3MM5 B;  2R8I A;  3HLU A;  1GXT A;  2HHQ A;  3FFI B;  3I0R B;  1ZPW X;  1RCO B;  5GAE U;  3NS7 B;  4R0J A;  3MPD A;  1XMQ J;  1HNW F;  5T14 A;  2KFN A;  1X8D A;  2Y1I A;  3HZG A;  3CJR A;  4ECU A;  4DSI A;  2MKC A;  1R31 A;  2CPD A;  4UTG A;  3NBP A;  4H4K A;  1HBU B;  1HMV B;  4C3K A;  3C2P A;  2VF3 A;  3R2D J;  1KC8 T;  4UY8 5;  2QA4 S;  5GAG I;  3JTN A;  1S0M A;  3I5B A;  3MPY A;  5HQM A;  4UOC A;  2HHT A;  4UZB A;  2IM2 A;  2B8Q A;  1UA0 A;  1YJT A;  3CVK A;  1SL1 A;  3RYL A;  5KFZ A;  4ANC A;  3HP6 A;  5C7P A;  5LJ3 Y;  3S6E A;  3FCV A;  4V1A k;  2IYI A;  1RT4 B;  4ZVH A;  2YWW A;  2UVR A;  2GFF A;  2W2N P;  4DR4 J;  4LIR A;  1ZTT A;  1T11 A;  3LOU A;  5E7O B;  1U6B A;  2P6S A;  2HFZ A;  3PJW A;  1VC6 A;  2J8S A;  4NEY A;  1T03 B;  2JVR A;  2JRS A;  5IXU A;  4DZD A;  5J2Q B;  1ZPV A;  4QQB A;  1IBK F;  3PRB A;  4ZP9 A;  4ECX A;  2GHP A;  2CWX A;  2DRA A;  1VK8 A;  5H9F K;  2Z8Q A;  3UFC X;  1KVI A;  2OSQ A;  4C3L A;  2YWG A;  1YTY A;  3WBZ A;  2ADC A;  3Q8S B;  2OD4 A;  3WX4 A;  4ECW A;  1K47 A;  3IM9 A;  4KR0 B;  7AT1 B;  3AT1 B;  2EFN A;  3AQP A;  2HW3 A;  3PO4 A;  1TFW A;  4J9Q A;  2GIF A;  2QIF A;  1SI9 A;  4NI2 A;  1FK9 A;  4KGX B;  2WW8 A;  2PN6 A;  2DNO A;  4DQI A;  4CH7 A;  1WEY A;  3BO4 A;  1LFW A;  2BQU A;  3HKW A;  1X7V A;  4IRD A;  2Z58 B;  1F2G A;  2WON A;  4DSL A;  2Q6B A;  1WC0 A;  3Q24 A;  5LMU J;  2CPI A;  4F3Q A;  4RU9 A;  2IYG A;  3VGU A;  4Y6I A;  4CP5 A;  2DHG A;  4J9O A;  4ZLL A;  3PV8 A;  2R2R A;  3AB2 B;  2PO4 A;  1NPK A;  3BSC A;  1N5V A;  5DQI A;  3CDE A;  2R7U A;  1NSQ A;  2ZD1 B;  3ILO A;  4O0N A;  2J7W A;  2XYH B;  5DG9 A;  4DN9 A;  1RAF B;  4CLL A;  3HSJ A;  2YX7 A;  3HHD A;  4EWT A;  1VQ7 S;  1MLA A;  1FVQ A;  4OI6 A;  4RO0 A;  3G6X A;  1KVJ A;  3W64 A;  3VZI A;  5DET A;  3E8O A;  1D9D A;  2QFI A;  4C8M A;  5I42 A;  2XZD B;  3HUL A;  1HKA A;  4P73 A;  2YKM B;  4NA1 A;  1XNR J;  4R8U A;  3DLH A;  3KLE A;  5L38 A;  4KJI A;  5RUB A;  4ECY A;  1BQX A;  4LBH A;  1KFD A;  4RW6 A;  3UQS A;  4UOH A;  3HHL B;  2W9B A;  4I0W A;  4F4Z A;  3H7H B;  4N56 A;  4MT1 A;  2XG8 A;  3AHP A;  2EG2 A;  4CO1 A;  5HBM A;  2MZ1 A;  3DRS A;  2RJZ A;  4IKA A;  4F0K A;  4IH7 A;  4UUW A;  3NGD A;  2MXY A;  2ASL A;  3RB6 A;  2NLW A;  3GIM A;  2CQ1 A;  4K4Z A;  5DDR C;  1OIA A;  4CQ1 A;  1YVF A;  2E5H A;  1EQM A;  3ZZU A;  1GQE A;  3DOM A;  1SUQ B;  4NYO A;  3KHH A;  1HQU A;  2MDA A;  2Q6C A;  3H90 A;  1LKZ A;  2FVC A;  4NPO A;  2HRU A;  3IM8 A;  3MTK A;  5L39 A;  3BKF A;  2E1A A;  4DU8 A;  5AXN A;  3GCX P;  4DR5 J;  3CXC R;  1YI2 S;  4J9P A;  2LCW A;  3M8W A;  3BPS P;  2G9O A;  3LH2 S;  4EO6 A;  2JEJ A;  2NXE A;  3CJ2 A;  3VV2 B;  3ITH A;  1J5E F;  3HHE A;  3EX7 B;  5ETL A;  4M63 A;  4ER8 A;  3RBX A;  4ZVF A;  1X0P A;  2DRD A;  1X31 C;  1R0B G;  3LP0 B;  1YK9 A;  5B0B A;  5KG1 A;  1OYE A;  2MHN A;  2ZBC A;  4JYA J;  4YB7 A;  1UW4 A;  3R6L B;  3J80 Y;  5G0R A;  3PHE A;  4LF2 A;  1VRQ C;  2QA1 A;  3S8S A;  4MTP A;  3ZTQ A;  1VBZ A;  1H2T Z;  4QZV B;  3R7S B;  1MML A;  3I6P A;  4U6P A;  3TAM A;  1FJ7 A;  4J9U E;  2FVQ A;  4W92 B;  1XR5 A;  3POT A;  2GNK A;  4DF8 A;  4Y2A A;  4O3S A;  1C0U A;  5GAH I;  3KK3 A;  1FJE B;  5ETR A;  3DI6 B;  4HT7 A;  3N4W A;  3HHL D;  2Z2Y B;  3UWT A;  1LNQ A;  2BM0 A;  3VAK A;  1FK9 B;  3OR2 A;  4XK8 C;  3Q2T C;  5CAA A;  4WE1 A;  1KP6 A;  4QWE A;  4A8S A;  3CJS A;  4KHM A;  4DR6 J;  4BBY A;  2EI5 A;  1NKE A;  2W2O P;  2WON B;  2QG9 B;  3OV7 A;  3GIR A;  5M2R A;  3WDO A;  1N33 J;  4PKD B;  5D0E A;  2NXJ A;  2RDJ A;  4AXI A;  2AJ1 A;  2I8E A;  1N8R T;  2A2C A;  4PG8 A;  2Z56 B;  1Q8B A;  3BN4 A;  1WNE A;  1N0U A;  4ZCI A;  3A3P B;  1BC6 A;  2XMJ A;  4GO5 X;  1BD6 A;  3NP5 A;  3ZZO A;  4FF1 A;  3VGV A;  1F6T A;  2DGS A;  3LAN A;  5I42 B;  4JP8 A;  1LWE A;  1IJF B;  2FD2 A;  1CLF A;  4ZOS A;  4R8U B;  3KLE B;  5E3P A;  4JOU A;  1G4C A;  4OJG A;  5EHH A;  4RW6 B;  2ZJR Q;  2WSE C;  1WHY A;  3MCM A;  2W9B B;  2WB1 D;  3W61 A;  2XNR A;  5BYR A;  2VUG A;  1ULR A;  5HBM B;  2LFV A;  4FNH A;  3DRS B;  3C19 A;  2AP6 A;  2IRU A;  2RDD A;  4NA3 A;  2PI4 A;  1SB6 A;  3UCU P;  3QT6 A;  1IJE B;  3PRV A;  1S97 A;  4NX9 A;  5IQQ A;  4KHP J;  1RTD A;  1RWW B;  2BE9 B;  2R7S A;  4C3M A;  3CCZ A;  4OQJ A;  3U1N A;  3DOM B;  3HFZ B;  5KFC A;  2DR7 A;  3DNC A;  3PFE A;  1HQU B;  4GRS A;  1VQN S;  2QSW A;  3UI3 A;  4PYA A;  2VV5 A;  4I2P A;  1TEL A;  3VR1 A;  2LEB A;  1ARO P;  2Y3Y A;  4QWB A;  4J9N A;  2Q43 A;  5D4P A;  4NLG A;  3BH7 B;  3MPV A;  2OAU A;  1HYS A;  1ZZN A;  2D69 A;  4ZPA A;  2MB0 B;  3ITH B;  5E2Q A;  1FFG B;  2MY7 A;  4IQM A;  2V94 A;  1R6V A;  3MUV P;  1PIE A;  3MAQ A;  3FJ2 A;  1IBC B;  4DV1 J;  3CCV S;  2VKR A;  3AD8 C;  5G0R B;  3O3L A;  1OPZ A;  2H3E B;  2QX0 A;  4JI5 F;  3GIL A;  1U1O A;  5CYQ A;  2SXL A;  4HLB A;  4QYZ J;  1KFS A;  3M6V A;  1Z1Z A;  3AFG A;  4DV6 J;  2GS8 A;  2UU9 J;  2VQF F;  4PWD A;  2J6U A;  3D2W A;  4I6W A;  1RAH B;  4Z7Y A;  1F0X A;  2DY1 A;  1VOM A;  3POT B;  2HLU A;  4NCB A;  1C0U B;  2LXI A;  2UV8 A;  5EUH A;  3KK3 B;  1DFD A;  1NO8 A;  4TY9 A;  1WJ9 A;  5KTQ A;  3GIJ A;  4K4V A;  1NJZ A;  5A8K A;  5L9N A;  1LK5 A;  3MR7 A;  3ONQ A;  1GTE A;  2OPS A;  3BKU A;  3OR2 B;  3CDU A;  1Y11 A;  3TUP A;  1YJW S;  1RIS A;  4WE1 B;  4K4X A;  4EUV A;  4NLR A;  5GMD A;  5GVQ A;  4RKU C;  1WSR A;  5F9N A;  4Q43 A;  3E3X A;  4CO0 A;  3ZZZ A;  2MLZ A;  1R7I A;  2V63 A;  1P6T A;  1RI7 A;  1KON A;  3VVU A;  4LF6 J;  4ICL B;  3M8P A;  2V9W A;  2NR0 A;  2Y1R I;  2ZH1 A;  4RUB A;  4YHH F;  4KPC A;  2A6M A;  2CDQ A;  2FC8 A;  1P1T A;  2FZK B;  2JFD A;  2Z4P A;  3H4B A;  4Y2M A;  4WJB A;  3R9L A;  3UR0 A;  3M9N B;  1RT1 A;  4ZS6 A;  2HPU A;  4DV4 J;  4PXB A;  5IV4 A;  3HO1 A;  3K8W A;  1UEU A;  3HFV A;  3J7A 1;  1LWE B;  3GG0 A;  2RD5 C;  2HS4 A;  3A12 A;  5GMK a;  3HDS A;  1NB7 A;  1NHU A;  3H5U A;  4EBC A;  4IG0 A;  4JI1 F;  2HWI A;  3PCO B;  3B82 A;  3HSZ A;  3OTD A;  4X4U A;  4QOT A;  1IR0 A;  4ZP7 A;  5C2G A;  4KH1 B;  3KLI A;  4DPO A;  3AD7 C;  1FKO A;  2NRE A;  3CDW A;  1MN9 A;  3K17 A;  4C9D A;  3CJ4 A;  4KBI A;  2QLJ B;  2DH8 A;  4DV3 J;  1S4E A;  1RTD B;  3SCI E;  2NYI A;  4CLY A;  4UW2 A;  2MKS A;  1B70 B;  2W2Q P;  3L7P A;  1U8W A;  4OI1 A;  3KG0 A;  3AB4 B;  1I51 B;  2IM1 A;  2RAQ A;  1MMD A;  4DU7 A;  2V8G A;  4FP9 A;  2R7V A;  3KUE A;  2ZC4 A;  2VIC A;  4U96 A;  1X60 A;  2BAC A;  2AJQ A;  3KK1 A;  1GX5 A;  3W66 A;  4JV5 F;  3H2L A;  2BE2 A;  3GP9 A;  1HYS B;  4JBC A;  3M8Q A;  4RW8 B;  2J0S D;  5KFB A;  1QUP A;  2OMO A;  3EVO A;  2JC1 A;  4CTA B;  4X4P A;  3GE9 A;  1NDC A;  1R3N A;  3JSY A;  2YY3 A;  3KJF B;  3PDN A;  4HDG A;  1N5Q A;  3FZ2 A;  2HHU A;  5HVH A;  3OFE A;  2V2K A;  1D09 B;  3VF0 B;  2B56 A;  2N7C A;  4NYP A;  4LF4 J;  3CO9 A;  2YPY A;  2V8H A;  2VFR A;  1U8S A;  1TKD A;  4DWI A;  2BJD A;  3D5M A;  4JI7 F;  1TUW A;  4KE5 A;  4I6Y A;  4U8V A;  1N32 J;  1UET A;  4GC6 A;  1NND A;  3UN3 A;  2RRA A;  2ZH6 A;  4ID5 A;  4OYM A;  1QTM A;  4ZPV R;  4AQY F;  4JI3 J;  3T5L A;  3LO3 A;  1GMW A;  2MQM A;  1S1T A;  2OPS B;  2W7A A;  5KFX A;  3N28 A;  1FJC A;  4B17 A;  3T41 A;  1B7Y B;  5KFM A;  4HAC A;  3G71 S;  3DLJ A;  1IKV B;  1IBL F;  4URQ U;  5IC4 B;  2CPX A;  4YY3 F;  2LQ5 A;  3IO1 A;  5E3A A;  3OSN A;  1R8H A;  1EAY C;  1W25 A;  4JI0 F;  3FBE A;  2IJF A;  2OPQ A;  4QR2 A;  1N34 J;  4HEA 9;  3D7S B;  1HIY A;  5JMN A;  3M8P B;  1L3T A;  2FUG 9;  3I55 S;  3TAN A;  5MAO A;  4UZC A;  4U8Y A;  4DX7 A;  1RE1 B;  1M5K C;  2VPZ B;  3TA1 A;  1ZZF A;  3RB4 A;  5D78 A;  2POK A;  5I3U A;  4OLP A;  2IY5 B;  2QJ3 A;  1UVK A;  4DV0 F;  1Y3J A;  1LWF A;  2NZC A;  3MHY A;  4ELU A;  4DR3 F;  2XUL A;  4A8Y A;  5KG0 A;  2V4J B;  5DS7 A;  3Q8U A;  4DF4 A;  4X65 J;  2CPH A;  1W7W A;  2CJK A;  2RNE A;  2E5L J;  4P2S A;  3L09 A;  1SC4 B;  1I6J A;  4IG0 B;  4PR6 A;  4DL6 A;  2EFG A;  3HPO A;  1VBK A;  4QW9 A;  3MDF A;  4RBT A;  2HVD A;  4LSL B;  3NGK A;  1C4C A;  2G2Z A;  3HVT A;  2F9J A;  2MKK A;  3KLI B;  2V0N A;  4UF4 A;  4ILL A;  2C28 A;  3LF0 A;  1FKO B;  4OYX A;  3RTV A;  2RKI A;  1NJI T;  2G1H A;  2CJB A;  4DUZ J;  1FES A;  3PM9 A;  3I32 A;  5FLX Y;  1WHW A;  2OFG X;  2MKI A;  2IM3 A;  5JVH Q;  2ZZN A;  3MI7 X;  3PR5 B;  5HI7 A;  4RJV A;  5CHC B;  1CJK B;  4AD6 A;  1RDR A;  3THP A;  3U7J A;  1R8A A;  3W65 A;  5M2U A;  3M30 A;  2DHA A;  1TK5 A;  4DG1 A;  4Y34 A;  2KU7 A;  2JSX A;  2OLW A;  2KDO A;  3R5J B;  2OEK A;  4MAK A;  1PYO B;  4JV1 A;  4DR2 F;  2KZM A;  4MKV A;  2XQC A;  3MAA A;  4OI2 A;  4PWU A;  1PJ5 A;  2XMK A;  3AD9 C;  2C2K B;  4LUB A;  3OJS A;  2BE2 B;  2L9N A;  1LEO A;  1T05 A;  1NAQ A;  3M8Q B;  2ZBQ A;  1HHQ A;  2JC0 A;  1JX4 A;  3EDQ B;  3SQO P;  2BRL A;  1T94 A;  3BJY A;  1RAD B;  2BQ3 A;  3W9I A;  1S6O A;  3GG1 A;  3T5H A;  1KTV A;  4HT5 A;  2NZ4 A;  4X62 J;  1G1X A;  2HVE A;  3O2I A;  2DGO A;  1I1G A;  4PG4 A;  2DJW A;  1K0T A;  2ZOM A;  1O5J A;  3PVX A;  3BQ0 A;  3FC9 A;  1S9E A;  2YQ3 A;  5CA5 A;  3ZTP A;  4X64 J;  3VQS A;  1S0N A;  2J0Q D;  1RWV B;  6FD1 A;  3TEH B;  2LXF A;  3TRG A;  4K5R A;  4DV5 F;  4OYB A;  3EZ5 A;  4M5L A;  4TYB A;  4DV7 J;  1N48 A;  4ID8 A;  4TXS A;  3CD6 S;  3P8B B;  1RU1 A;  2OML A;  3PHT A;  2CQ0 A;  4MYT A;  1HQ2 A;  3JQJ A;  3I4H X;  4CM2 A;  2E9R X;  3BQ2 A;  4RNM A;  3V4M A;  3DDI A;  3QPI A;  1LWC A;  4ID5 B;  3JSB A;  4NE9 C;  3MF5 A;  2CPE A;  5KFK A;  3MZI A;  2AV5 A;  1S1T B;  5H9F J;  2W2P P;  2RU9 A;  4F67 A;  3V6J A;  4HAC B;  2GCF A;  3ENQ A;  3GTY X;  1C1C A;  3D1Q A;  1R8C A;  3J7Y I;  2YTC A;  4LVO P;  3CCT A;  3CDB A;  6FDR A;  5LT5 A;  1FRX A;  4LQ9 A;  3RRH A;  3O5T B;  4C48 A;  1WEZ A;  1S79 A;  2BKN A;  5D4N A;  1PBA A;  3IWX A;  2BV3 A;  3DDN A;  2AX1 A;  1G7C B;  1G2E A;  1BE4 A;  1HAR A;  1JXE A;  5KG6 A;  2C2Z B;  2CQP A;  1M90 T;  3QAU A;  4X84 A;  1U6F A;  3IRW P;  4NOH A;  3W5X A;  5I3U B;  1MMN A;  2MLY A;  1LWF B;  4CI0 B;  2I2Y A;  1U1K A;  2HFV A;  2CZV C;  2V8P A;  1PJ7 A;  1J27 A;  3NGU A;  2CPJ A;  3UVJ A;  3KWM A;  4EZ9 A;  4ZVS B;  5CD4 A;  2CQC A;  2F63 A;  4HI2 A;  2DXD A;  3B4D A;  3PFO A;  1CS4 A;  3TZZ A;  4J9K A;  1RT3 A;  2YKP A;  3OSP A;  1RYS A;  2IM0 A;  4B3S F;  2CJ9 A;  3HVT B;  2QRR A;  1VC5 A;  3QWU A;  3JQK A;  1YIJ S;  3SCL E;  1WC3 A;  4AL7 A;  1UCN A;  3MGJ A;  4CLU A;  2RKI B;  3JYT B;  1TZ0 A;  3AOD A;  4IDK A;  1HQE A;  2DIV A;  4U95 A;  4MIB A;  1KOO A;  3H8Y A;  2XO7 A;  2B51 A;  4LSN B;  3DLE A;  1UZD A;  4QW8 A;  2DCU B;  3A13 A;  5K8O A;  1Z2Z A;  1YGY A;  4ZIT A;  3U1M A;  1K1S A;  2IIH A;  1R8B A;  4ZHR B;  3M30 B;  1ZH5 A;  4DG1 B;  3CJK A;  4UQT A;  4XDD A;  4A8O A;  2VJV A;  3OT9 A;  4JI6 J;  3GFX A;  3QZ8 A;  3QFH A;  1YWX A;  3DLG A;  2BVZ A;  1JLG A;  4RLE A;  3U27 A;  4K0K F;  4WZM A;  4ZPD A;  3UR3 C;  4LMZ A;  3LAL A;  4M5N A;  1GMW D;  3LP1 A;  3Q83 A;  5HLF A;  2Q79 A;  5F9L A;  1V3Z A;  3OHB A;  5L1L A;  4OI4 A;  1T05 B;  2FTR A;  1S6P A;  2MZQ A;  4DCO B;  3SSR A;  1S6U A;  4LF7 J;  2IFX A;  4B9V A;  2B4V A;  3CNQ P;  4ATN A;  3HVR A;  2MST A;  4ZJL A;  1KQS R;  2P9G A;  1VIS A;  3C46 A;  4M5H A;  1TKX B;  3FEZ A;  3K0J A;  3IP0 A;  2HNZ A;  4HVZ A;  3RUB L;  4F0H A;  1SC3 B;  2CNK B;  2QLX A;  4BC7 A;  1KLM B;  1RBA A;  1KBR A;  3TAQ A;  3CIM A;  2IDL A;  2M2B A;  2XEX A;  2MQL A;  2KTQ A;  4ES3 A;  4LQ3 A;  3CW2 C;  1DY3 A;  1CJU A;  1QUV A;  3ZXW A;  3DN9 A;  1KD1 T;  3MR6 A;  9RUB A;  4WYL A;  3G6Y A;  2AEF A;  2FZG B;  3VGS A;  2BKO A;  2V8D A;  1NJY A;  3PW4 A;  3H25 A;  3TX0 A;  4QWD A;  1M1G A;  4F4X A;  1IVZ A;  1K9M T;  1N6Q A;  4LJM A;  2FJD B;  1LWC B;  5EWE A;  2DIS A;  2ZC3 A;  5IC6 B;  3EVW A;  3D67 A;  4OX7 A;  5B0D A;  1OYD A;  3R5D A;  1C1C B;  1TVR B;  4O3R A;  3PO5 A;  3TVZ A;  2M0G B;  4ILM A;  3ZZP A;  2HYI B;  3EGN A;  1VQS A;  4HHH A;  3GV8 B;  1HR0 F;  1FT8 A;  4RL1 A;  3BDE A;  3TVK A;  2Y0B B;  5U47 A;  1F2H A;  2E7W A;  3ULH A;  3ET6 A;  1UA1 A;  2QV6 A;  2J6S A;  3IS9 A;  1H6K X;  4HR2 A;  4B9N A;  1SVD A;  1KWM A;  4B9S A;  5HJY A;  4R5P A;  2FHJ D;  3HM9 A;  1CSJ A;  2OPR A;  1HA1 A;  1AUS L;  3W2V B;  4FXD A;  4AXJ A;  2KM8 C;  3NCR A;  1TL7 A;  1RTI A;  1MNE A;  2RRB A;  3PAC A;  3MEC A;  4W98 A;  3PZP A;  2XMW A;  2K8G A;  3UN2 A;  4M5G A;  4ZLN A;  2HFN A;  4WKR A;  4CO4 A;  1RBO B;  3QRR A;  5IT9 U;  2F7V A;  1EJ7 L;  3KJV A;  1HNW J;  2VU5 A;  4ZPC A;  4IDK B;  1HQE B;  2GX8 A;  3MMA A;  2VFS A;  2C3U A;  4F3O A;  2IDE A;  4DSE A;  3DLE B;  4RR5 A;  2CAJ A;  4RUH A;  1D8Y A;  1PC4 A;  4JB8 B;  3L3C A;  2AJF E;  4KC5 A;  3N5B A;  3NS5 A;  3OVS A;  2OIH A;  3CJK B;  1HBO A;  5I3Q A;  3OFG A;  2H54 B;  1S76 D;  3I0S A;  2CJY B;  4TQR A;  4RWW A;  3DLG B;  4NCA A;  4ZJQ A;  1JLG B;  1MU2 A;  1VQ6 S;  5E41 A;  4F3M A;  3LP1 B;  1NRK A;  5HLF B;  3QGG A;  4YUD A;  2GMH A;  1SIW B;  1V6H A;  3AJ1 A;  1S6P B;  4CLP A;  4OX8 A;  9ATC B;  4AT1 B;  3SDE A;  1F9E B;  1MWZ A;  1SJF A;  4U7U D;  3KK2 A;  3HVA A;  3ZZR A;  2NPI A;  2XLJ A;  4PPZ A;  1AB8 A;  3C6T B;  2HNZ B;  1IBK J;  3PRD A;  4JI2 F;  2HVH A;  2L3M A;  4NEZ A;  3T1H F;  1BWE A;  1NEE A;  3CGI A;  2V9K A;  2HQ3 A;  3TYT A;  4CNZ A;  1CJU B;  3PR4 A;  4RUC A;  2HFU A;  2N7Y A;  3F73 A;  2BXJ A;  4RWX A;  3MCS A;  5F8H A;  2R7R A;  4HDH A;  1N6Q B;  4C8O A;  4NXM F;  3H4D A;  2RHS B;  5KG5 A;  2ZEJ A;  2GML A;  3RG6 A;  1Q8L A;  1X9S A;  5GAG U;  1U0H A;  2LLZ A;  2KHD A;  3DU6 A;  4G3I A;  4ZMM A;  1KQK A;  3BGF A;  1FDA A;  3B54 A;  3MOZ A;  5IOL A;  4K2X A;  4O44 A;  3PYD A;  4DX5 A;  1OPI A;  2A1B A;  3H20 A;  5DDO C;  4RNF A;  3V4I A;  3OUY B;  1FDN A;  1NSK L;  2J0X A;  4CLS A;  3QYY A;  4NZ0 A;  2RUS A;  3DRY A;  5KT7 A;  2UXB F;  3NKY A;  4ZP6 A;  4GO7 X;  3ET6 B;  4K4W A;  3IS9 B;  4I4B A;  3LWM A;  3CMA S;  1D9A A;  3FGV A;  4YP3 A;  3PJX A;  3TZW A;  3EXY A;  2ATL A;  2COL A;  4J9L A;  4R5P B;  5HVF A;  1Q86 T;  4QIW D;  4JI8 F;  3K2Y A;  2JHE A;  3TOQ A;  3RRK A;  2YQ1 A;  2OPR B;  2KYX A;  1V5I B;  3P6Y C;  3LQV A;  4DUT A;  3J80 U;  1BLU A;  2DNH A;  3BR8 A;  3R2C J;  3CF5 Q;  3KUH A;  3KNG A;  3N6M A;  1TL7 B;  1RTI B;  4NLO A;  4C4W A;  2FIU A;  3MEC B;  2PEH A;  4OX6 A;  2CPF A;  4MFB A;  1U1L A;  2BRK A;  3BBC A;  4U67 Q;  3H40 A;  3OL7 A;  1WF2 A;  1Z4U A;  1RWO B;  2E7X A;  3KJV B;  2VC1 A;  2GAG C;  1NKC A;  3J81 Y;  5F3Z A;  3MMA B;  3DRR A;  1RHK B;  1RWU A;  3FSI A;  2R8K A;  2VC0 A;  4EU0 A;  3NNC A;  2P2C B;  3DXB A;  4TLR A;  5A6W A;  1PO6 A;  1HI0 P;  1TKT B;  4TQS A;  1WHV A;  2H9Z A;  3I0S B;  1ZS6 A;  3FBF A;  1LQ9 A;  1FNM A;  4ALZ A;  1HI8 A;  1MU2 B;  3DHX A;  2MZT A;  1J5E J;  2HLT A;  5AT1 B;  2G0I A;  1UEK A;  3SFU A;  1F3F A;  1ZM3 A;  2J76 E;  2KL8 A;  3K59 A;  2VHG A;  3CDA A;  4OHX A;  4BWJ A;  3JQM A;  4B3M F;  3CB4 A;  3KK2 B;  1Q7L B;  1H2V Z;  2PD1 A;  4TU7 A;  3W9H A;  2HQD A;  4J90 A;  1F5A A;  1N54 B;  3OFF A;  1GNK A;  2M3D A;  1RTJ A;  2F8E X;  3QNW B;  1PAE X;  4YB6 A;  3CIZ A;  4ECQ A;  4FBT A;  2XSJ A;  1VFJ A;  2VIH A;  4X4S A;  3T5J A;  1N56 A;  3W1Y C;  2KHC A;  5A8R A;  2YNI A;  4KO0 A;  4KB7 A;  4J5O A;  5F8N A;  2HIY A;  1REG X;  3V2U C;  1QE1 A;  2NPF A;  2FLO A;  5J1P A;  1M5V C;  1U1R A;  4LFB J;  1S77 D;  2I1R A;  2KFZ A;  4ECS A;  1SV5 A;  4WIQ A;  1FX2 A;  5H1S V;  3QIP A;  2HHH F;  3UCZ P;  5L1I A;  1IR1 A;  2YWK A;  3HHL C;  4O44 B;  2MZJ A;  2LVW A;  5D3G A;  1QY7 A;  1HHS A;  4X66 F;  3RAX A;  4P2M A;  1SL2 A;  1RT6 A;  4K4S A;  4PG7 A;  3QRP A;  3V4I B;  2JEG A;  3TUZ C;  4DHV A;  5AE1 A;  5D4L A;  3BSN A;  3ETM A;  3OFH A;  2R7X A;  3CJQ A;  4CNY A;  1RAJ A;  4YB1 P;  2AHO B;  2LEA A;  3AA9 A;  1H73 A;  4DBQ A;  1RYR A;  5MLC V;  2VOD A;  4PEO A;  1ZOT A;  3DGV A;  2YH1 A;  1SJ1 A;  4KTQ A;  3EMT A;  1EKS A;  1KTQ A;  1JJ4 A;  4I7F A;  3G82 A;  2D3O 1;  3I5A A;  4H4K C;  2ZUA A;  2CFX A;  5IZH A;  1H7X A;  3KG4 A;  3D0I E;  4FS2 A;  3H5S A;  1W26 A;  1NZA A;  2GIQ A;  4A8X A;  3SFG A;  2GIR A;  2BKP A;  4BHQ A;  3B4M A;  4MFB B;  2AGQ A;  5GAH U;  5GAD I;  4RNN A;  5IT4 A;  3K5O A;  1U6Z A;  3RBZ A;  1M0S A;  3Q2S C;  4LF1 A; 
#chains in the Genus database with same CATH homology
 2HBQ B;  3P4U B;  4ZVS B;  1RHM B;  3R6L B;  4ZVU B;  1RWW B;  1F9E B;  2H4W B;  2QL7 B;  1SC1 B;  4DCO B;  2H65 B;  1I51 B;  2H4Y B;  1RWO B;  2CJX B;  2C1E B;  2FQQ B;  3QNW B;  2C2K B;  2C2O B;  2XZT B;  1RWM B;  3KJN B;  4ZVT B;  1RHK B;  1I3O B;  1RHU B;  1ICE B;  2QL9 B;  1NME B;  4DCP B;  1RHR B;  3NS7 B;  4LSZ B;  1SC4 B;  2CDR B;  3D6H B;  3EDQ B;  3R7S B;  1RHJ B;  4ZVR B;  2XYG B;  1BMQ B;  2DKO B;  1QTN B;  2P2C B;  3GJT B;  2H51 B;  2XYH B;  3RJM B;  2C2M B;  1SC3 B;  2H5I B;  2CNK B;  4ZVP B;  2Y0B B;  3R7N B;  4JB8 B;  2H48 B;  3D6F B;  3IBC B;  1QDU B;  5IC4 B;  2HBR B;  1RWP B;  1RWN B;  1GFW B;  2CNO B;  2HBY B;  3P45 B;  3KJQ B;  2QL5 B;  2HBZ B;  1RWK B;  4ZVQ B;  2H54 B;  2QLF B;  2QLB B;  2XZD B;  2CNL B;  2CJY B;  2C2Z B;  3KJF B;  1RWV B;  3EDR B;  5K20 B;  3GJS B;  1RWX B;  3GJR B;  1IBC B;  1RHQ B;  3IBF B;  1PAU B;  2QLJ B;  4ZVO B;  2H5J B;  3SIP B;  3R6G B;  1RE1 B;  4DCJ B;  2CNN B;  2XYP B;  3GJQ B;  3R7B B;  3D6M B;  3R5J B;  2Y1L B;  1PYO B;  5IC6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...