2L9DA

Solution structure of the protein yp_546394.1, the first structural representative of the pfam family pf12112
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
b'GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSIDAAQVTEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution structure of the protein YP_546394.1, the first structural representative of the pfam family PF12112
rcsb
source organism Methylobacillus flagellatus
molecule tags Structural genomics, unknown function
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12112 DUF3579 Protein of unknown function (DUF3579)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9dA00
2L9DA
chains in the Genus database with same CATH superfamily
1KDNA 5EGYA 2Z4PA 4DV5J 3THPA 3G6VA 2CNOB 2UXDF 2AMCB 4ZLJA 2G2OA 2L3MA 4Y2AA 2XQCA 5B0BA 5JUMA 2YNFA 4I2QA 1SUQA 2WSCC 2IYIA 4YY3F 2LQBA 2QL5B 1OYDA 5D0RA 3MMAB 3PW7A 4DR4J 3UDCA 4DI6A 3UCUP 1X4DA 3MR7A 1DRZA 1RT5A 1VLYA 1EKRA 2B9XA 2HVZA 2CZ9A 4PEOA 3MM8B 5MAOA 2EKYA 3QZ8A 4DQRA 2HRYA 1UVMA 2KJWA 1N32F 2UV8A 5F3TA 3FUYA 2EXUA 3C15B 2NXJA 3BN7A 1SJQA 3KLIB 3BEGB 2CRLA 2ZBRA 4L72B 3VVUA 4QWBA 3GFXA 1BE4A 4ECVA 2O01C 1RHUB 1IXKA 4L75A 3PACA 4LFCF 3C16A 1Q8BA 2KJVA 4EZ9A 3GB0A 1NB7A 3FBBA 3BO3A 3I56S 2NLWA 4F2SA 1YJ9S 1KFSA 2IMWP 3L9ZA 4QCLA 3MEKA 5E5NA 4ECTA 2YKNB 2AP6A 4L74A 4F26A 3SI8A 3I55S 2HNYB 2XNRA 5M2RA 2E5HA 4LBIA 1GMVA 4ZCIA 1WD6A 1UAWA 4K2XA 3B4MA 2ZUAA 2J6TA 4YS2A 2NXCA 3IWLA 1WJ9A 2BW7A 1VRUA 4YR3A 5L1JA 4ECZA 2ALYB 3A8IA 4CLLA 4DX5A 2B5JA 2DGSA 2G0IA 5FDLB 4RW9A 1UA0A 2VQFF 1HNZJ 1S9FA 3NGSA 2WB1D 4FNHA 4UOFA 2MDAA 2ZC3A 1BWEA 2DNOA 4KHPJ 4C8ZA 1EHWA 1U2CA 4IQXA 4QR0A 5LSLA 2FC8A 1XMOF 4DL3A 3TVYA 2N82B 4K4WA 3LOUA 1KBRA 2MSTA 4LJMA 1NJIT 3RAMA 1FJEB 1JLBA 2DR8A 2X7IA 1MLAA 3JAMY 2HVEA 2LA4A 2EFOA 2ROPA 1R0AB 1IBMF 2JOQA 3U1LA 1RTIA 3CCUS 1RHRB 2ZZNA 4J37A 1TL1B 4ECQA 1BQNB 3M9NB 2E44A 3MPVA 1OY8A 5GAGU 1C1CA 3UVJB 4DF4A 4XO0A 2VG5B 1XNQF 2HFVA 2H5IB 2E7VA 1YHQS 3FBFA 2ILYA 4OL8A 3AB2B 3VQTA 3I0RA 4EO6A 2FJEB 4KC5A 3OL8A 3W7BA 5DGAA 3CB4A 4J9NA 5DG8A 1YGYA 4N76A 3WC0A 4I69A 4ZKAA 3CCSS 3F73A 3GV8B 2P8IA 2M8DB 2IC3A 2D69A 3DN9A 1BD6A 1GTHA 2F7VA 4ER8A 4FXVA 4KE5A 2R9LA 1GQEA 1QTMA 4K0KF 4Z37A 1JLEA 4YHHF 1LNQA 4X4SA 1NB2A 4UOCA 2KXNB 3DI6A 3OLBA 1IBCB 3CMQA 4F02A 1LW2A 3KNGA 2VFRA 2FJDB 3HX9A 3AAWB 5HSPA 4I67A 4LR7A 1AB8A 4C8YA 1SQFA 2FJAB 4NCGA 1HBMA 3SSSA 5A2QU 4QZVB 1CQMA 3SCJE 1KVKA 3D4JA 1FE0A 2C3UA 1VC6A 4PXBA 2B8QA 4RKUC 1AUDA 3EXCX 3F41A 2E29A 1AT1B 4DR5F 3M6UA 3KMSA 1S0NA 2ZHBA 2ZNYA 4LBHA 3DRRA 2LQJA 4JI6J 4F4KA 3BO2A 1H0HB 4QR2A 2VG6B 4LVNP 5BYSA 3J7YI 2CQ0A 3MAQA 4USUA 2FJWA 2HHSA 1UVLA 3DMJA 2VQEJ 4OV6A 4TY9A 2BJ8A 1TKXB 3J7A1 3HK2A 1HQUB 3KJQB 2I8EA 4CI0B 4ZMMA 4R8UA 2AZ3A 2GVZA 7AT1B 3HO1A 1N88A 1U1QA 2FPHX 2GGPA 3C6UB 4RW4A 2JFKA 2XB2D 1FRHA 1O0PA 2XSFA 1TZ0A 2HHQA 4O3NA 1F2HA 2OPSB 2HHVA 3QGHA 1IN0A 2VIHA 3PG9A 4FYDA 5L39A 3TUJC 4PKDB 1N33J 4OX9F 5CD4H 4EEYA 4B02A 5DQIA 3NS6A 1FDNA 3QSIA 3I0SA 3PV8A 3QO9A 2C2OB 2V4RA 3VCDA 2K3KA 1BXNA 2KN4A 4ZPBA 4ZN3A 2FHJA 3T1HJ 4PWDB 4RW6A 2V4QA 1R8CA 1VRTB 4U96A 4X4NA 1LWCB 3D2WA 4LSLA 2MZ1A 4IG0B 4O0IA 3KLVA 4FS2A 5HMYA 3M8QB 3A3PB 4N41A 3P3DA 1IKXB 2E5LJ 5CYJA 1FK9B 1NMEB 1RLDA 3MCSA 4KIAA 1A7GE 4UZBA 4YEAA 3HT3A 2ZFHA 5C7PA 1NU4A 2VC0A 5EUHA 2YKMB 4FZVA 4OYAA 2LQ9A 1X60A 3QT7A 2E1RA 5DQGA 1DAXA 4QWCA 1HD0A 1P27B 2J6SA 3N0VA 2LVWA 5J2QA 2XC9A 3H5XA 4QR1A 1BUXA 1XTZA 1RWNB 2CPXA 5HBMA 1GH8A 1OS5A 4IFVB 3EZOA 1MU2A 3CJ8A 4B9TA 4JI1F 3HI9A 1R8PA 2NZCA 5CQGA 5J2MA 2C28A 2IA6A 3HSDA 4MYUA 3FFIA 3RBZA 5F8JA 1RWVB 2A6MA 2UUAF 2GIRA 4DL7A 2MQNA 4LR9A 4LVOP 1LWXA 2E1AA 5KOWA 5ITHA 2YWEA 2DY9A 1L3UA 1ZH5A 4QIWD 4IH5A 1UP1A 3H25A 3QRQA 4JUZA 1PSDA 1WHWA 5LMUF 4WPAA 1RTHB 1RT7B 4I7FB 2BJEA 2L9NA 2CQBA 1KLMA 1WORA 3H5SA 4Q7AA 2MJUA 2AJ1A 3CIMA 2XCAA 5ADZA 1XN9A 3ICLA 4CLKA 4LQ3A 1GMWA 3UDLA 3HJFA 5CYQB 3P5BP 2YWGA 4G1IA 4DQIA 3T9ZA 2YKPA 3HVAA 1V5IB 3D9BA 3J81j 4ZVRB 5HVFA 3TUPA 1NZ8A 2F5GA 2PFDA 2EG2A 3I82A 4DUYF 1IQTA 1CJTA 2CQ2A 2VJVA 2OPQA 2A3JA 2HPUA 3G4SS 2MZSA 4F4AA 3B82A 1MW7A 3R1LA 5KT7A 2JZ5A 5ETNA 1RT4A 3IR7B 2J0SD 1S76D 1EAYC 4P2SA 1CSJA 1EQ0A 3QWPA 1PYOB 3UD3P 2IPOB 1PO6A 3GLJA 2OEJA 2QT7A 1SQEA 3TQ1A 2DISA 2R2SA 1Q86T 3O44A 3M7VA 3OL6A 4NRUA 2VDHA 3GJQB 3CMES 3FBCA 2C22A 1RCXB 3LH2S 4ZPCA 2QFIA 3R5CA 2CPFA 4X64J 3M2RA 2DRBA 1HQ2A 1FXRA 4Y2MA 2WONB 1AZSB 1F3FA 3G96A 5D4NA 3BDPA 2QYGA 1R8HA 2ZH5A 3CXCR 3QMQA 1IBKJ 1TK5A 5HP1B 2MLZA 2BBEA 2QTWA 3HDSA 2MQOA 3W65A 5EWEA 2C3YA 3OL9A 4K50A 1P9QC 4KGXB 2A6OA 2NXUA 3DOKA 2DHHA 1EJ7L 2L9DA 3BSOA 2FVRA 4B3SF 3PR4A 3M6VA 1KWMA 4LT6A 2FVCA 2BABA 3T6BA 3A13A 4DR1F 5E3CA 4IRKA 3ZZ0A 3KLFB 3MAAA 2QGFB 3OR2B 1CG2A 2EFVA 4J9SA 2HFOA 2BJ3A 2MKYA 4IR9A 2BM0A 3BGUA 3BBCA 3OFHA 3IO1A 4XPCA 3NG8A 4F0HA 1FCAA 1BLUA 1F5CA 1NPRA 1P9YA 1M5KC 4OHZA 4ZVQB 2K06A 3NRBA 2YQ1A 1FNOA 1HNVA 2GJFA 4P72A 4B3RJ 2KKHA 4CTAB 2HURA 4JOUA 3R2CJ 3MEGB 1VK8A 4FF1A 2XS2A 1O5JA 3NWRA 2HFSA 1WKKA 1H72C 5FLXY 2QO3A 3E01B 2HFUA 5DDRC 2MQPA 1Y5LB 2XSJB 2QMWA 4NI2B 3MEEB 2R8GA 4QPXA 3W62A 2HQCA 3ZC4A 1UL3A 2O67A 5E3RA 3UNGC 5KFEA 4OI0A 1S1UA 4FBTA 4X62J 1ZBTA 4JI7F 1BQXA 5A8RA 4D3GA 3IAS9 2H54B 3U1MA 1KONA 3PDNA 1ZPVA 2CWKA 4DR7J 1KSPA 5K9FA 2FVQA 4DUZF 2U2FA 3LPYA 2AJ4A 2ZOMA 4TXSA 3NNCA 2RU3A 1S1VB 2ERRA 1FNMA 3FBEA 1F5BA 2YNHB 4GRSA 2VDIA 1IBLF 4RUCA 3M05A 2V8HA 3HHLA 1B4SA 2CQ4A 3LW5C 1Q8LA 4DMZA 2B9EA 2Y8YA 2HWHA 4JI4F 3EGNA 1M5HA 3CJTA 5D0HA 1G6BA 3DXSX 4IYQA 5DZ6A 1U6ZA 3SMZA 1CQNA 2DPIA 2J0WA 1RBAA 3L09A 3PHTA 2CYYA 2IC3B 1T95A 3IR6B 1FD8A 3HHLC 1CVJA 4O3PA 4TYAA 1RAAB 5EDWA 4LRFA 5AE2A 1RE1B 1HBNA 2HS3A 2W9CA 2OPPB 4NLPA 1HWLA 4RNFA 1K73T 2YH0A 4CIOA 3N6LA 1UVNA 5ETVA 4ZVHA 2DGVA 3UFCX 1VHFA 1S9GB 1N5TA 1SC3B 2AYEA 5HVGA 2KFZA 4C8KA 1RA6A 3VAKA 4NXMJ 5LOQA 2QLFB 1RT1B 3A8EA 5JVHQ 1WF2A 2C2KB 3T5JA 4KO0B 3UWTA 3J7Z5 4AL5A 1HNWJ 2GZOA 1YBUA 4LRDA 3GP9A 2I6WA 5I3QA 1FA0A 3UPFA 3RW6A 1SH0A 1DTTB 3ONQA 5DDOC 4URQU 4C97A 3G9CA 4CH1A 4DCPB 2A0FB 4R5PB 3THVA 3NCRA 2GJ2A 2XHCA 4ZVSB 1OY9A 3UDVA 1T3NA 1TKDA 5KFVA 4Q2LA 3EX7B 2F9JA 3DRSA 4MIWA 1X9WA 1FVQA 3RRHA 4PG5A 8AT1B 2UU9F 4DV4J 4KH1B 3GSIA 3W2WA 2YNGB 4F3OA 3DRPB 1QTNB 2FY1A 4K4TA 3MMBB 1WDTA 1UCNA 2PMHA 4ZOSA 3M2VA 4GVLA 1OMSA 2UVVA 4ZVPB 1FKOA 1JLAA 2I5JA 3P8BB 3LAKA 3KHGA 5IT9U 1E6YA 4NLDA 4A47A 1U6FA 3LGNA 3MGJA 4WU3A 1WWHA 7FD1A 5F8HA 4NLUA 4ZVFA 4CT9A 2B4VA 1H98A 2EK1A 4HEA9 3N28A 1R43A 2N7CA 3FNNA 1HBUB 2VKRA 3TRGA 1MWZA 2RUSA 3CDBA 1GNKA 1RKJA 1LOUA 4CZCA 4P7TA 2P6SA 3GE9A 4ZDNA 1LV5A 3GU0A 3LP0A 4K5RA 3I9V9 2YKOA 4DL5A 2OEKA 4Q0BB 3BKUA 1DQ9A 2H4WB 5K8NA 3OLAA 4IDKA 2GV1A 4MIBA 1HR0J 1LKZA 5D6GA 2Q43A 4OZ3A 1Q16B 2QLJB 1TTHB 4IOAQ 3TA1A 2QA4G 3G2XA 1C0UB 5BR8F 4F8RA 3Q86A 1NNDA 3FCVA 5FD1A 1FWLA 2F65A 3KHRA 1NSPA 3BSCA 3IGNA 3UN5A 3JB9k 2CPYA 1PAEX 2JWNA 4DU8A 3J81U 3BM7A 3ZTSA 4U7UD 5A0YA 2ZUGA 2J7KA 4BLGA 3MTJA 3W5YA 3CD0A 2IJFA 4HH1A 3CCTA 1N0UA 1WOPA 3CSKA 3Q8SB 5KFJA 3AFGA 4NLRA 1IKWA 4FF2A 1RUSA 1AFIA 2M88A 3HVRA 4LF4F 1HBOB 4J90A 2CVIA 3Q0AA 2A10A 3FEZA 1WELA 1I3OB 4I1TA 4C8MA 2G4BA 1TKTB 3B6BA 1S0OA 3MPWA 1QVFR 3OR1B 1NDKA 3RB3A 4Y28C 4MKBA 4IRCA 1KP6A 2OFGX 5L46A 2R8JA 1IR0A 1U4BA 4C3KA 5B0DA 1QAXA 1KNZA 1J5EJ 4O3QA 5J1EA 3M9OB 1MMLA 3JTNA 1X0PA 1HWJA 4M5GA 3PYFA 4ES1A 4TYBA 3DU5A 4J9PA 3TUIC 5DZ7A 2Y1RI 2CPEA 1K1QA 4P52A 1V3RA 2AQ4A 1JLQB 3BH6B 4K2JA 2HSEB 2ADBA 3ZZPA 4LF7F 2ZBQA 3L3CA 1NXIA 5BXIA 1VBYA 1JWWA 3R8YA 3QAEA 1SJRA 5KT3A 2HNDB 3VF0B 1U1NA 3TJ8A 3T3FA 1Y10A 4DL0C 2V2VA 2UUCJ 1NH8A 3NOGA 5A8WA 3HHDA 5LM7E 1HW8A 1P8GA 5C42A 4FXWA 2ZH6A 1Z1ZA 1Y4ZB 4CM0A 4TLRA 4KB7A 1TK0A 3TAMB 4ED0A 4ZN1A 4WFYA 1ZM4A 5D4LA 4LIWA 4YDXA 1EIYB 1HHTP 1U0HB 1TVRA 4L3NA 3DLHA 4O3SA 2YKQA 5E0OA 3IMQJ 4ZJOA 2HQIA 3TZYA 1NSAA 2FLPA 2FJBB 4USHA 4L3KA 4WYLA 2FHOB 3AH6A 2MXYA 1FNXH 4ZK7M 1MMNA 1NSKL 3KG1A 2CNNB 3GONA 3O8WA 1H2UX 1N6QA 4NZ0A 1B0TA 4O23A 5L1IA 2FDNA 2BANA 1GTEA 1CC7A 2BACA 2X3DA 1MN7A 1CLFA 1FEEA 1C4AA 5F0UA 1Y7PA 5T41A 1VRQC 2CUYA 4IRDA 1T05B 2G2YA 1F9HA 3RB0A 1UWAA 1HW9A 4ILLA 4UZCA 3KLHB 2KG0A 3MI7X 3U27A 4HKQA 5IXUA 3K89A 2N3LA 1FXDA 4DXLA 2W8KA 4X4TA 1P1TA 3ZTPA 1U02A 3K0JA 2IVMA 1RBLA 1TL3A 2AYBA 2DXFA 1H2TZ 3EXYA 2ZJRQ 2WRMA 2UUBF 2IRYA 4JB8B 1Q79A 2EC2A 3BN4A 2CDRB 1XQIA 1XNRF 5E41A 2KB2A 4MFBA 4ZPTR 2FLOA 3M8RA 1JXEA 3CCZA 2KXHA 3UDEA 1ZS6A 5D0GA 2QSFA 4FVCA 3KK3B 1M5PC 4ED7A 3S1TA 1SV5B 1DLOB 6AT1B 4BCAA 3DYAA 5KFGA 3FGVA 2OTJS 4ZPAA 1N5YB 3MM9B 4B3OB 5IT0A 1CEZA 3UQSA 3IWNC 3RU0A 1UEUA 1HI0P 2Q1LA 1W25A 3G87A 4UQTA 1V3SA 2MKJA 3MFHA 3N01A 3W2VB 2DXEA 4FDFA 4I6YA 5K5MA 1G3OA 3Q8QB 2DGTA 4PYDA 4HLBA 4LFAJ 1X5PA 4HACB 2WHOA 4PG8A 2RNEA 2MSSA 2KM8C 3M32B 2RKIB 1NLKL 2N4CA 3NKYA 2IDEA 1BQMA 2ZITA 4ZLPA 2HLUA 1K0TA 1SKWA 3QGGA 1WC0A 2MQLA 3P45B 2CJBA 3M30A 3PEJA 3LP2B 2EFNA 2Z8QA 5ETOA 2EPIA 3QIPB 3QWUA 1WNEA 2N4DA 3BH7B 3O5TB 2MZQA 1DY3A 3GCWP 1YJRA 2AGQA 2XGQA 5B7WA 3I4HX 2XO6A 1UJ6A 2KT5A 4DN0A 2JLGA 4N56A 2V68A 2R7RA 4IFYA 1WI8A 1VQ9S 4Q8EA 3V81A 2K8GA 3D1OA 1G4CA 2RT3A 4WK3A 2W9BB 4HI1A 5LMNF 2F4VJ 4HI2A 1YVFA 4CLTA 4UOGA 2W7PA 2HZVA 1FO1A 2BEFA 2B0GA 5U47A 4GKJJ 4IUFA 2HQDA 4I64A 2HKEA 4DR2F 4DJBA 2HNZA 3SFGA 2IMOA 2RD5C 2HHUA 3C14B 2LLZA 4PQUA 1KTVA 2AW0A 1R6VA 4IG3B 3CVKA 3R97A 1QUVA 2M5YA 2AX1A 5CYMA 3UE2A 2XMWA 4M5IA 5F41A 1LK7A 1HNXJ 2ZZMA 1U0SA 3BGRA 2X3GA 9ATCB 4K7QA 4ZHRA 3QBCA 4Y34A 1WKJA 3DDIA 2MKCA 1U47A 4OYXA 1T9VA 5KG6A 2JC0A 3ILOA 2HMIA 3QIDA 5ETKA 4C9DA 1S57A 3LANA 4FPIA 4OYWA 4AL6A 2B6AB 1M1HA 5CH7B 4I56A 1QSLA 3DLEA 1P1LA 1N34F 2KDOA 3IG1B 3HM9A 1R8AA 3I5AA 3FRZA 4B9SA 1IJEB 5KG7A 3M1VA 2HLTA 4O44B 2RE1A 3HVTB 2Z58B 1NHUA 3PW5A 1DFDA 4O3OA 3N6NA 5KT2A 1XERA 4A4JA 4NEYA 5HQMA 4RBVA 4WFAQ 2QFJA 4I6WA 1ZAXA 2I5JB 1GXUA 5LJ5Y 1CJKA 3MECA 2BE2A 1DQ8A 3G6ES 2XY7A 3KUHA 1HNIA 1T8EA 1XK8A 1Q53A 4ENOA 3Q8VA 4ELVA 1S1TA 1T0TV 1BY9A 2FHJD 4HYKA 2IM2A 3CCWA 1IKVA 3THTA 1VISA 4QW8A 1JLGB 1N32J 3IBCB 5KFYA 3B78A 4KJIA 4LMZA 5LXYA 4QWEA 2GS8A 1NDLA 1RT6A 1RU1A 2ZWOA 3UNYA 1U1PA 2A18A 4KKOA 1YBAA 4PQAA 2E7WA 3QT5A 3SYZA 2CZ4A 5HL7Q 1LW0A 2XMKA 2MGZA 3AJDA 3PKMA 5K14B 4KPCA 3HT0A 4F0MA 4QIFA 1JLFA 4XIUA 1DBDA 1Q95G 4DSEA 1HPZA 1T9XA 2XGPA 4DZDA 4OJ1A 4NX9A 1XWLA 2EKNA 4AUKA 3CJ4A 3D66A 4DHVA 2EG1A 4KR0B 4C48A 3TZXA 2QLWA 4DV5F 3ETMA 2DNLA 1WG1A 1D1UA 1FDAA 2PMWA 1PKUA 1ZM2A 2IHR1 4NRTA 3AB4B 4WE1A 1IKYB 4LFBF 2DT9A 3VZIA 4OI4A 2CQIA 1S77D 4V19J 1FRMA 3QFWA 1GEHA 2KO1A 3OXFA 2CQGA 4DR4F 1VQ7S 3AJ2A 4LUBA 4USMA 2UP1A 5DJBA 4ZJLA 1TKZB 3JQMA 3A1YG 3ZNUA 4NZ7A 6FDRA 4WFNQ 2HHHJ 2WW8A 2U1AA 2D1CA 3I6PA 2DB1A 2CQHA 2VG7A 3ZZZA 2D3OR 1Q1KA 4F3MA 1U2RA 2KT3A 1DARA 3NOCA 2VBZA 2JH3A 4WP9A 2HVHA 1X9MA 4OI6A 2OPRA 1NZAA 2YX1A 1QE1A 2FC9A 2NXNA 4C6AA 1B70B 3JQJA 1KFDA 3MR5A 1URRA 4TU7A 4ES3A 3MUTP 2MJNA 1CULB 3NAHA 6FD1A 2E1PA 1FESA 1O6XA 2DR9A 2DO4A 3EYZA 4NLQA 4G1PA 4CCHA 4AL7A 4JI3F 1GMWD 4GKKJ 4X4UA 1TV6A 1TU0B 4OLOA 1IBMJ 2ZVSA 1YJNS 2YNIA 3MWBA 3G82A 2R42A 4M5KA 5KFUA 1UA1A 3UCZP 1D09B 1V6HA 4GC6A 1LWEA 2OMLA 1KR4A 1ZAVA 3W1YC 3EGZA 1XNQJ 2YPZA 2QSWA 1S79A 3DLKB 3HJVA 2O5DA 4B9MA 1SCJB 1ZA1B 4K4ZA 1F0XA 2GCFA 3FVYA 1Q8IA 4NA1A 1SJ4P 3R5BA 1SL2A 1WF1A 2LXUA 3ISNC 3NCPA 3H8YA 2V63A 3C8YA 1PBUA 4LF1A 2M9KA 1X4FA 4J9KA 3ZZTA 3GSDA 4KHPF 4GVBB 2Y0BB 2XMVA 4K0KJ 4YHHJ 1WACA 1VS3A 2LYVA 3MM7B 3JSMA 2CQ1A 4RUAA 2P9CA 4H4MA 1HA1A 4LRAA 2WVBA 3GFHA 2XLKA 1VQPS 2CFXA 2DNPA 1EP4A 2Q79A 3EM1A 2GJIA 3NL0A 1WDDA 3NGDA 1WG4A 2DR7A 2Y1JA 3ITHB 2DNMA 2MY7A 1NDPA 3AHPA 4E0DA 2E9ZA 1WC4A 2YWWA 1MMDA 4W4MA 2HQGA 2YWFA 1B64A 2WZ1A 2GVDB 1VGYA 1JJ4A 1QAYA 2W24A 4B3MJ 2AHOB 2BRKA 3S8SA 4BS2A 2VBXA 2VFSA 3W66A 4IH7A 1MSWD 3IWXA 3Q2TC 4HHUA 1RTJB 1HI1A 3PRBA 3QLHB 4ZLLA 2BMBA 1G2EA 2HQFA 4TY8B 2QIFA 1EETB 4ED4A 5JVGQ 5IFMA 3KUEA 2IAJB 3ET6B 4DR3F 2ZM6F 3NGUA 2PDAA 4NYPA 5KFKA 1WC5A 2V8PA 3N9UC 3NS5A 5B08A 4IR1A 5M2PA 3TZZA 3EMTA 1M0SA 2F63A 2W4CA 4KY3A 4Q5VA 4CLPA 3IRXA 1RAEB 3MCNA 2HS4A 1OPIA 2VB6A 2DCLA 4L6V3 1S49A 1PYTA 3K17A 4HT7A 3E2EA 4U6PA 1WOOA 4NYOA 4QPTA 4WU2A 1M1KT 2JX2A 1YZ7A 3DLGA 2R7SA 3HD2A 2O1PA 4LRBA 3DHWC 4I2PA 4JI6F 3GFYA 2NREA 5C2GA 3SCKE 2RH3A 1CJVB 1KQGB 3O6QA 4DLGA 4CLUA 5D4OA 2AT1B 4E2FB 2CG8A 5KFFA 2NSCA 2OKQA 2VBYA 1QM9A 2ZD1A 4TNOA 1YRXA 3L7UA 2ZOGA 3VZHA 2C1EB 1JIHA 3MOZA 5CAAA 1D9DA 3OTOJ 1HFEL 2LXFA 2R2RA 1KVIA 1I5OB 1C0TB 3ILLA 1WI6A 5J1PA 3T1YJ 2X1FA 3C6TA 1X8DA 4J91A 3TYTA 4ED8A 4ID5A 3OUYB 4DQPA 4C11B 2KT2A 3JAMU 3KLGB 3KWMA 1X9SA 2VKZG 4Y3CA 3HSGA 2ZZTA 2ZKUA 3W64A 3VAFA 4CDIA 3M8PA 1S7HA 1REVA 4CYUB 1N33F 4JI1J 3V4IA 2BX6A 2B7BB 3R6GB 2R3VA 5KG4A 4NPOA 1KVJA 2ZKTA 1S6PB 1VYAA 4DPUA 3OTBA 2B3TB 2D3ZA 2UUAJ 4XK8C 3R9LA 4KT0C 1U45A 3WHIA 4F04B 2BE9B 4DV0J 2J0QD 4KPYA 4FVMA 3H7HB 1FT8A 4F2RA 2BKNA 4J9LA 1VIXA 2DHSA 3GG0A 1ACMB 4OI2A 1HYSB 1H3DA 2IM1A 3G6XA 2AJ0A 2PEBA 2VD3A 1WHVA 4PUOB 4OHVA 4ELUA 2E5LF 4ZVOB 3POTA 5LMUJ 1Y3KA 3VTIA 3D0HE 4JI2J 2P5VA 4OV1A 1K8AT 2VPXB 4B9UA 1TP7A 2G1DA 2ALZA 1HWKA 4PXEA 3BGRB 3G8QA 4RW8A 1WC3A 1TR0A 2AKWB 2MZTA 3NBPB 3R3TA 2GX8A 3IS9B 4X4OA 5HMWA 5C25B 1X0FA 4OJHA 5IM0B 4C3MA 2ATLA 4KFBA 2JDJA 2LDYA 2V50A 3MD1A 2IY5B 2Z56B 2V9KA 2VFUA 1HWIA 4KV8B 2R7WA 2XULA 1MWYA 1FTCA 3JXOA 4CM2A 2V8VA 5IS2A 3KLEA 3QPIA 3NXZA 3FSYA 1D8ZA 4ICLB 2QL9B 4H4OA 3EVMA 4OHYA 1S1XB 4Z7CA 2VBWA 2V4JA 4JV5F 3D6FB 3GILA 1SB6A 1Z4UA 4GO7X 4YDDB 1GX5A 2RHQB 3T41A 2JNJA 4AQYJ 3I5BA 2BQ3A 4OQJA 1L3KA 2I38A 5B0GA 3GYGA 1JJCB 1TL7A 4RR5A 3D0GE 4J9MA 4EBDA 3AODA 3MUMP 1A0OB 2UZAA 3CO9A 5HROA 3K2YA 4CQ1A 1X4HA 3N6MA 1NK7A 3MR2A 4HHJA 2MZRA 3OTEA 3LGMA 4DWIA 4KYZA 2VOPA 3UD4P 3ZO7A 1RHQB 3DM2A 1F2GA 2WOMA 4P2FA 4QYZJ 2P9EA 1RISA 2G0CA 3CEDA 4ED6A 1Q81T 1JLFB 3JYTA 3GIKA 1NKBA 2W2NP 3TAQA 1NCLA 2BJ9A 3CJKA 1NH7A 1D9FA 2A2CA 3V6HA 3PCOB 2FYXA 2XZWA 5KTQA 5JXSA 4B3SJ 3HMJG 3DGPA 1FERA 1OJ4A 2B4OA 4ETXA 1YJWS 2RQMA 2PT0A 3ULHA 3P49B 5E2QA 1RK8A 3VGTA 5F9LA 3AD8C 1K1SA 2B7CB 3KYLA 1APSA 3BKFA 3IP0A 3ETOA 1FKAF 5KFBA 4KRWA 2VZ9A 2IJRA 3LP1A 3TEGA 4CT8A 4KHMA 4JV0A 4NLVA 3GR0A 1RYSA 2DH8A 1X4EA 3OJSA 3MM5A 3CCVS 5DDQC 3VALA 1XMQJ 1KC8T 4ZP7A 1X31C 2FIUA 2D41A 2YXLA 4BC7A 1FRJA 2FZCB 2CJKA 1T11A 1VJWA 3PO5A 3CCJS 4QWAA 1YLXA 4OZLA 1PG5B 2KYZA 3TA2A 1LWFB 1UW9A 2BKOA 4P75A 2K3IA 2J0XA 2XMJA 4DG1A 3LWLA 2DVIA 1T03B 4G1QA 4U95A 3MPUB 2WBMA 1F6TA 1RAJA 4RNMA 3PIPQ 4DFKA 5CA5A 1S6OA 2HK2A 1S6QB 1YX2A 1RAIB 5IT9Y 1RLCL 4DPOA 1UWBB 4LSNA 2XZDB 2I9SA 3RG6A 2DRAA 1CS4A 3P4UB 3MR6A 2HAFA 3H5UA 1IBLJ 2FTRA 1GAOA 1HQEB 3Q89A 4DEZA 3KK1A 3PZPA 4F4XA 2EBGA 1J2VA 2KZZA 1AROP 1VC5A 4CLSA 1PJ5A 4WZMA 4DV6F 4M5MA 5DG9A 1U7LA 1NDCA 1PJ6A 2VODA 1Q0NA 4ZVEA 4Y0FA 1WSRA 1S1WA 1S9EB 2DGOA 3EPGA 2ABYA 2R2TA 1TELA 3D6MB 5JMNA 4F4ZA 2PN6A 1N4LA 1DTQA 3DOLA 3BGFA 3A8JA 3KDNA 3UCGA 4X62F 2ZH4A 4ID8A 3UN3A 4BBYA 3TX0A 2DGWA 2DKOB 2Z2ZA 3ZZOA 3A3NB 3IM8A 4DR7F 3SEOA 2RF2A 1JKHB 3MZIA 5DDPC 4AFFA 3CMAS 1BGXT 4X66F 2HBYB 1S12A 2F40A 5HLFA 5I42A 3CCRS 1YTYA 1E6VA 2B4PA 1YJUA 4O4GA 3LUYA 3BQ0A 1FKPA 1RJJA 3KJVA 2IA0A 1RT3B 1HD1A 3SZ2A 4YR0A 2RSQA 4Q44A 2ZH2A 4TN2A 2RIJA 3CJ3A 1RA7A 1VOMA 2QMUB 4KBIA 4K4YA 5DQHA 2D3O1 2W7AA 4EBCA 1S4FA 4ED5A 3X1LB 2A1BA 2GIQA 1VDHA 2NYHA 3TUZC 2CIMA 2NQPA 1OY6A 3M4XA 4JI0J 1WF0A 4M5DA 2IRUA 1SKRA 2F9DA 5KAKA 5G0RA 2DGUA 2CKWA 2K2PA 5F8IA 1NKEA 1QJHA 5A6PA 2DNYA 3G86A 3TNVA 4KGKA 4XTTA 1RTDA 2DPJA 1NJXA 4ZPWR 5KG2A 3CJ0A 2ROGA 2RS2A 1MROA 3AY0A 1C1BA 3ISZA 1UW4A 3IRXB 4NXMF 4RW7B 1PAUB 2NUUG 5LSRA 1X5TA 3Q2SC 4ERDA 3A8KA 2ZE2B 2YQ3A 4P6QA 4PR6A 2GO9A 1T9UA 3P6YC 3R7BB 1KOOA 3SQGB 1HNWF 2HBRB 4I68A 3KOAA 3QNWB 4DF8A 2I0XA 3OD2A 1RT2A 1RWOB 4B3TF 4X65J 2CNLB 2ZJPQ 4MKYA 2Y1IA 2FGOA 1UEVA 5KFDA 2J8AA 3OT9A 4LSZB 1PC5A 4P2XA 4QJVA 3DOMA 1ZM9A 2HZAA 1JLCA 4OZ1A 2QYCA 1OO0B 1FE4A 4O4RA 1VQ8S 2AEMA 5J2PA 2DR6A 5J2NA 5FLXU 2NZ4A 4DV4F 3DNCA 4OI3A 3AD9C 3PW4A 5GAHU 1CJUA 1G7CB 3PYDA 3O1LA 3BJYA 3N5BA 3RJMB 4WFBQ 4DV1F 2DITA 4TLQA 5BR8J 1KQFB 4DDFA 1PGZA 3M2UB 5KFPA 2QLXA 3QFHA 3RRKA 1RKIA 5CD4A 3H5YA 4EBEA 2MHEA 3T5KA 2QA1A 3JTOA 5KFCA 3M8PB 1N36F 1REVB 3MMAA 1AUSL 3WBZA 4PG7A 2XBPA 4UQGA 3PX4A 4P74A 1U2FA 4ANCA 5D3GB 3MM8A 4UUWA 3OXGA 1QUPA 3NP5A 5ETSA 3C15A 4TKTA 4OZ5A 2G2ZA 2JL9A 3KLIA 2NXEA 2E9TA 4MKVA 3SCLE 3L7OA 1JJHA 3M6XA 1RAFB 3CC7S 1XMBA 3PFEA 4WXWA 3I87A 3CO0P 4RPFA 2JLFA 3FSXA 1WC1A 2DNQA 5M2UA 2R2UA 3LWMA 3BB5A 2CVEA 3CULA 2RS8A 4URGA 2ZBPA 1SIWB 2YKNA 2HBQB 2HNYA 3KG0A 2NS1B 4ZLNA 4ZPVR 4MK9A 4F3QA 2GW8A 4KFBB 1RAOA 2N3OA 3HHEA 1QVGR 4P10A 1A9NB 3BS9A 3CD6S 2VPWB 3EZUA 1T02A 1SJ3P 1FEHA 3I9ZA 4U7CA 4M5NA 3MEDB 3VGSA 4YB1P 1QLNA 1M5VC 1J5OB 1B99A 3GCXP 1NHKL 3MM6B 2BUNA 1MN9A 2XMAA 1M5OC 1ZTWA 4G65A 4RUBA 4LREA 3U7JA 4OYPA 4HDHA 3KK2B 1HIYA 1NPKA 1FVSA 5FDLA 2CXEA 3OTCA 3OPKA 2XM3A 2VUGA 3MPYA 1SC6A 1YWXA 2HYIB 2K1RA 4NXNF 3CDWA 3QZ7A 4NOHA 2KHCA 4DX8H 4G6VB 5AXKA 1OYEA 4DBQA 1IM4A 1UKUA 3HZEA 1J5EF 1VLOA 1H73A 1R0AA 5F8NA 4RNHA 4OZ2A 5DLGA 4YB5A 2OD6A 2D3UA 1TL1A 1BQNA 3H90A 1VBKA 3UO0A 2RJZA 3UVJA 4FYWB 4DU7A 1B0PA 5B0FA 1H74A 2VG5A 2ZBIA 1FJGF 3CJKB 4B17A 3ENAA 4EI2A 1UFWA 4R0JA 3K5NA 3CF5Q 2UXCJ 1K0VA 2X51A 3PM9A 2Q66A 2AEFA 3K5MA 3AOBA 2UUCF 4WKYA 3UD5A 4KH0B 2COLA 4NLOA 3BGOP 3GTYX 3H0PA 3V6DB 3SDEB 1WG5A 5LL6d 2F8EX 2LEPA 5KFIA 2KFNA 2IFXA 3W9JA 3FMBA 2HAIA 3MMCB 4DV2J 3H20A 2LDIA 1UMJA 2UUBJ 2M3DA 2G9OA 3W60A 2Z2LA 1XNRJ 3OBIA 2KG1A 3D54A 1M1GA 1VMBA 1QY7A 1NJWA 2V2KA 4DCJB 3TARA 3BO4A 2W7OA 1MG7A 2QLBB 4OMFG 5A76A 2OP5A 2MB0B 2DGXA 4IOBA 2YNFB 4I2QB 1SUQB 3ZZRA 1M90T 3FKBA 5C5JA 2BOAA 2QMXA 4DV7F 1R3NA 3OHBA 3EICA 1RT5B 2J8SA 3GR1A 2LEBA 3D3BJ 4X4RA 2H5EA 3PW2A 2ZH1A 3EGVA 1UETA 1VQMS 1PBAA 2BJDA 2VJUA 3QJPA 1TL5A 1F3VA 4JYAF 2VG6A 2OHDA 3ISND 3IRWP 2ZHOA 1IUJA 1LXNA 1OPZA 3VQSA 1GT8A 2XI3A 4RNOA 2DNKA 4ILRA 4DPWA 2XMTA 1TKXA 2CG4A 3C16B 1HQUA 1RP5A 5HK4A 4O0NA 3V5RA 3ZTRA 2R7UA 3IN5A 3FC9A 4M5JA 3FJ2A 4TU8A 2J9DA 3C6UA 2IDLA 2GMLA 3W5XA 4RZRA 3W8PA 4DPYA 4PYAA 2F3JA 2DR5A 4NLWA 2QE5A 1RAGB 2OPSA 1YZ6A 4FF3A 3AA8A 3TVZA 3VAGA 5AXLA 4AXIA 1TK8A 1S99A 2IBKA 4PAAA 3H2VE 2RDIA 2J9DE 2VF3A 2HIQA 1VBXA 3RR7A 3S01A 2EEYA 2OEMA 2RVJA 1OIAA 1RZMA 4OZ0A 5AXMA 2OGUA 4PWDA 2HFZA 1KEKA 1Q7LB 5LJ3Y 1VRTA 3EWGA 4ECYA 1VRUB 1LWCA 4DSFA 4LFAF 2B5JB 4LRCA 4KGVB 4PPDA 3DKDA 4EK2A 3ZTQA 5THWA 3ZZYA 4IG0A 1JXLA 4RW9B 4DV3J 4DLEA 3M8QA 3EE3A 1NAQA 1O51A 2LA6A 1IKXA 1UTAA 1FK9A 4NL5A 3TVKA 3FZ2A 1L5UA 3BV8A 1VHIA 4HHHA 5AT1B 4DPTA 2UUTA 4FKYA 4C8LA 2YKMA 3RZAA 3K59A 4DQSA 1S59A 2BE7D 1B3TA 1JLBB 3V6KA 5AJ3J 2R8KA 2YBVA 2IRXA 4FYYB 3N5FA 4MJKA 2PO4A 3WDOA 2WVCA 1RTIB 1FRLA 2HWTA 4IFVA 3HSZA 1NHVA 3NNHA 4WFXA 3R5AA 1C1CB 2FHKA 2DBBA 1H7XA 1U1LA 3BBBA 2LCWA 3DRXA 2GMJA 1W2IA 4F4WA 3LPEA 2WSFC 2EWHA 2YTCA 1R27B 4BC9A 2MQMA 4TVAB 3I0RB 4J5OA 3BBFA 1OQ6A 3KTQA 2B8PA 2FGCA 1CPZA 3ENQA 2VA3A 4EWTA 1SKSA 1BHNA 2V6AA 1LFPA 4DZ6A 1YG0A 3GV7B 4MH8A 8ATCB 3T5HA 3T5LA 1RTHA 2VC1A 1RT7A 3J7YU 1L3VA 4I7FA 3TP2A 1JLEB 4JI5F 5ETTA 1RT2B 1I1GA 2QA2A 1NK8A 2W01A 4NZ6A 1NEEA 3DI6B 3M9MB 1HNXF 2L41A 4WK1A 4UUXA 2CQDA 2HVDA 3TAPA 1VQ6S 1YJVA 5CYQA 1LW2B 1FTRA 4FPRA 4EUVA 2GQ2A 3RTVA 2V94A 1JX4A 5HJYA 1R7IA 3VVTA 3R5DA 3R6LB 2XCPA 1DHMA 2RRBA 3PO4A 4YN3B 5J2PB 3LO3A 4NCGB 2YX7A 2W2QP 1HBMB 2UV8G 3VGVA 1SVDA 5E7OB 3DGVA 3SIPB 5HAOA 5GADI 3F56A 4YFUA 4PWWA 2CQPA 3HKZD 2SXLA 3DRRB 4LFBJ 2FVPA 5LSOA 3H4DA 1BMQB 3T19A 4ZS6A 4X2BA 1PILA 1U25A 1HARA 2HZCA 1GX6A 3NLCA 1JB0C 2IYGA 3DMJB 3WC2A 3PX0A 2P9GA 2AF6A 1HWUA 1VQLS 2HHWA 1WHXA 3K5LA 3A12A 4R8UB 4K59A 5ETMA 2HGLA 2GVZB 1IWAA 2B51A 1OSDA 2GGPB 2H65B 4RW4B 4A8XA 2C42A 4C4WA 4Q8FA 1RYRA 4OJ3A 2WONA 1AZSA 1KD1T 3Q23A 1KLNA 3HFKA 4Q2MA 4ATNA 4OYOA 5HP1A 5E3QA 1YRTA 5ETPA 5AE1A 4Q43A 2V8GA 3AQPA 3PXGa 1AA1B 4MT1A 3PVXA 5B0EA 3TOQA 3I0SB 1VBZA 4LF8F 3QO9B 2DD8S 3DRYA 5F3ZA 2OJ3A 4JI3J 4GC7A 4A8QA 2PD1A 3O3LA 4X4QA 3C46A 4D3HA 2ZH3A 2BQUA 4RW6B 2R7XA 2RRNA 4CO2A 3KLFA 4LSLB 3H98A 2YH1A 4HTJA 3NMRA 2LP4A 3OR2A 3GIIA 2W4PA 3CC4S 2QL7B 3BF4A 4MKAA 1YIJS 2BJ1A 3C19A 4WCEQ 2HHHF 2W4DA 5H9EK 3QRRA 2CQ3A 3TJ9A 5K8PA 3HHKA 3TI0A 3VHQA 2HBZB 4A8KA 2C3OA 1ZYQA 4CTAA 3HHNB 4C3LA 7FDRA 3FSIA 1CC8A 3TO8A 4LF9F 2HHXA 2PMZD 3AJ1A 3MEGA 5J2QB 2CPHA 4RLEA 1TQLA 2K1RB 3EGWB 2CPJA 3E01A 5HBMB 3D5MA 2PI4A 2EBEA 2XSJA 4NI2A 3MEEA 2FQQB 3OV7A 1S48A 1TMJA 1MU2B 2KRBA 4JI8F 1KHWA 3MMJA 3DC2A 4NLSA 3US5A 4EFAC 1R31A 4OHWA 5J2MB 5DG7A 5KG0A 1TAQA 3WX4A 2OSQA 3D0IE 3GIRA 4GKKF 3FFIB 8RUCA 3H59A 3NEKA 2Y3YA 2OIHA 4IOCQ 4HDGA 2GAHC 3CDUA 3V6JA 2YWKA 3MOJB 4HL9A 4RBUA 1Y5IB 1N48A 2FLNA 1RXOB 1S1VA 4OFZA 3NGRA 5D15A 4QIEA 3TW0A 4ALZA 2WBRA 4URSA 2CA9A 2YNHA 5CCLA 3TEHB 2PGCA 5HN0A 2UVUA 4FYVB 3CC2S 3I31A 1KLMB 3MXHP 2HK3A 2VV5A 5A8KA 5ETLA 1SPBP 2ZEJA 2FJVA 5D8HB 1T7PA 4G3IA 5HATA 3IC1A 5D77A 1FFWB 4QU6A 3CT9A 4PWUA 4DSKA 2HVIA 1H7WA 2LMIA 3A3OB 5IWAJ 1SJFA 4UTGA 4ED1A 4DR3J 2ZM6J 1I94F 2JRSA 2OPPA 1CJTB 2OPQB 3QATA 3J80Y 5E3PA 1ELOA 5KFLA 1S9GA 4WJBA 1MWQA 1RT4B 4KGZB 4NLXA 2WSEC 1RT1A 2V69A 4W90B 1KOHA 4KO0A 1HKAA 1F9FA 3BSNA 2OSRA 3JQKA 2DO0A 2OMOA 3C66A 2JSXA 4LF5F 2GQCA 3RAXA 2VPZB 2BA9A 2XEXA 1TFYA 1DTTA 2X1AA 5DRKA 3PIOQ 2EFPA 4OZNA 3F0NA 2UVWA 2H1YA 1QD1A 4USJC 3CDEA 2ZOFA 1SH3A 4R5PA 2FY8A 3M2RB 2RB7A 4B3MF 1BC6A 3Q24A 3KDOA 3TR5A 4P73A 4B9VA 5AXNA 1EARA 2FJXA 3Q22A 4ECSA 2YNGA 1XC9A 2RDJA 3DRPA 4EGLA 4IQMA 5KFHA 2KZMA 1ZTTA 3QQCD 2KVIA 3MMBA 1T9YA 2RRAA 3DOKB 4WFZA 2V67A 2LU1A 1ULRA 2CPIA 2H5JB 3GYXB 3K57A 5JJBA 4RX6A 3J7ZT 3IR5B 3PX6A 3QSYB 3MAAB 2YKAA 2YWHA 2QX0A 4EO8A 1NM2A 3KHHA 4WKRA 4KSEB 2JEIA 4LR8A 4RUHA 2M52A 2FD2A 5K8MA 1HBUA 3I4PA 2OH2A 2YQ0A 3FMWA 2R7VA 4W98A 5HMXA 1REGX 2RU9A 1HNVB 1WOSA 5B0AA 1V5VA 2RUGA 1B7FA 3IFEA 4U8YA 4DUTA 2DCUB 5KFSA 2MLXA 2IVYA 5BYQA 2Z30B 9RUBA 3GJSB 4Q0BA 3RR8A 4DPXA 1GFWB 4KAIA 1N8RT 2UXBJ 4BWJA 1URNA 3OTOF 1S1UB 3MF5A 3HKWA 1XR5A 1V3ZA 3U1NA 5A8RB 3NS7B 3T1YF 5ETQA 1C0UA 4HT5A 5EHHA 1VQ4S 2FZGB 2NR0A 1M5SA 1HI8A 1QSSA 2VFVA 3L7PA 3VAMA 2V8DA 3TX8A 3KJNB 3PTWA 1VIOA 4OHXA 1UPMB 4RU9A 4B9NA 4JV5J 3PW0A 1S7IA 2XG8A 2APOA 3HHLB 4USTA 3QT8A 2Q6BA 4DV0F 4FYXB 3CJQA 4F36A 3Q8RB 1FX4A 2B9WA 4E98A 4QWDA 1T94A 1DZ5A 1HBOA 3SXLA 3DCAA 3GYNA 1ZETA 5GADU 2ZVIA 5GVQA 5AE3A 1TKTA 4KGMA 4CO1A 1H2VZ 3OR1A 2C2ZB 3IBWA 2VASA 2W2MP 3D6HB 4RBTA 1KQKA 4JI2F 1X5OA 2FUG9 5CABA 1IR1A 5T14A 1UVJA 3SBMA 3R7NB 4DOZA 1HBNB 1R89A 4BWMA 2W9CB 2CZVC 2MZJA 3CCES 2CPZA 1T9TA 4CO5A 5KT4A 4WBFA 2R7OA 2KH9A 1UZHA 5CXTA 1VK3A 2GHWA 3FCHA 2ZH7A 3B8HA 5FIIA 4J9UE 3CUNA 3ZFVA 4FS1A 3CDAA 2N7YA 3OQ2A 1U8SA 3AD7C 1JLQA 3FEXB 2D7SA 1X4CA 3EZ5A 4N8NA 2BXJA 4GO5X 1RU2A 1RWPB 1YKWA 3OVAA 1NK0A 2GQQA 2PE8A 4DFJA 2RMLA 2JLEA 2R8HA 5HI7A 4A8WA 2HNDA 2R4FA 4MMOA 5BJRA 4M63A 4AYBD 3S7RA 1PC4A 4OX6A 2HIYA 2V2ZA 2RQKA 2PI5A 1B0VA 2CJQA 4AQYF 3PJXA 2QRRA 1LEOA 1IQZA 2HS0A 2AGOA 4O3RA 3TAMA 3DRSB 4WP3A 2ASDA 3ADAC 3JSYA 2NYIA 4PXDA 2F1FA 3BYRA 5IQ6A 2XLJA 1U0HA 1YDLA 1NK6A 3W8GA 4HH0A 2CJ9A 3W2WB 4WIQA 4PRFA 2XYPB 3CJSA 4PPZA 4WTYA 1TL4A 5IC6B 3HVWA 1J27A 2UXDJ 2CADA 1HHQA 1KKHA 3PEHA 3M2VB 2NPFA 3TWZA 4LF6F 1RHMB 4TU9A 3KKFA 1WC6A 3OFEA 1OSCA 5H9EJ 4YY3J 1FKOB 1JLAB 2LECA 1B7YB 4H54A 1E6YB 2W2PP 4CH0S 2RILA 3BQ2A 4DSIA 4C98A 4QIGA 4USIA 2K7JA 1UFKA 2XO7A 4LQ9A 2GA7A 2RHSB 3CIZA 5IZHA 4ECXA 5KFOA 1T05A 1S72S 5GAEI 3M8SA 4UY8T 4DR6F 3KLHA 3D28A 4KHRA 1ZOTA 3HF5A 3LP0B 4YR2A 3ZTOA 2VU5A 3TJAA 2HRUA 4LFCJ 4M95A 4PG6A 2C2NA 2W2OP 2DHAA 4S0MA 2HFNA 1U26A 3OTDA 4Q45A 2EFQA 2QJ3A 2DIUA 5CZVA 4IDKB 3RB6A 4CNZA 4C0OC 1UVIA 1I6JA 1VCTA 2LFVA 4DX6A 4DV6J 1XMQF 4AXJA 5H9FK 3H2LA 3R27A 1RHKB 5DLFA 3BKTA 4GMKA 3KK3A 1WTFA 3LF0A 2BV3A 3H4BA 1SV5A 1DLOA 1T9WA 5A2QY 4M5HA 5KFAA 2CJAA 3H42A 1N5YA 3MM9A 3W9HA 4B3OA 3C3LA 4B08A 3K7RA 3GJTB 5KT5A 5A0YB 2GNKA 2EK6A 3W5ZA 2ZDOA 2BVZA 1U1OA 3W2VA 2DXDA 4QYZK 3HSJA 5IT4A 1ZZNA 1VR6A 2M7SA 1DJ0A 4PABA 4HACA 4A48A 2YY3A 4X66J 1RCOB 1IKWB 2G13A 3GFZA 3M32A 2VQFJ 2RKIA 1U48A 3K58A 3R2DJ 4I4BA 3T6JA 3HFZB 2E7XA 1U24A 2MLYA 3AOAA 3FEYB 4DCOB 2AGPA 5C2CA 1X4AA 4UF4A 1XMOJ 1AW0A 1SC4B 4OI1A 3RGIA 5EN1A 3LP2A 4WP8A 2IM3A 3QIPA 2Q3PA 5DO2A 2YX4A 4QYRA 1EX8A 5A8KB 3EUNA 3OFGA 4C7QA 1EZZB 4HVZA 1U6BA 5EWGA 5J1EB 1UJ5A 4CH7A 4UT4A 2AIRB 4OYIA 2E1MC 2E5IA 1FX2A 2KHDA 4NLGA 2XWXA 4RO0A 2MKKA 3NGKA 5DM6Q 1N56A 4RWXA 3RRGA 4C8OA 4Y2CA 2W9BA 1Y5NB 2CJYB 2H3EB 4B9LA 2CWXA 2R7TA 4CLWA 5H1SV 2VA2A 5K20B 1RQ0A 3BYPA 4CRJA 1P6TA 1FHTA 5A8WB 4FBUA 3BPSP 2XY6A 5C42B 2OUGA 4OJGA 4WTOB 3C14A 2NPIA 5D0EA 1HNZF 2V34A 4IG3A 1LQ9A 3MCMA 3I5CA 5E33A 1F9EB 3DU6A 4B3TJ 1TVRB 3K8VA 1N5VA 3KXDA 5K8OA 3QJJA 4A8YA 2J6UA 1FDDA 4ZP8A 3VAJA 4ELTA 4ES2A 2P6TA 4IH6A 3CJ5A 4IKAA 3N79A 2B6AA 1ITPA 5LT5A 3GPAA 4X4VA 3Q83A 5EX3A 3CGIA 3IG1A 2DK2A 5GMDA 3W9IA 4JI0F 1N6QB 2DEIA 1RTZA 1JMTA 2BANB 1NSQA 3LTOA 4DV1J 4O44A 1FFSB 3HVTA 2KTQA 4BHQA 2YVSA 4DR5J 3HLUA 3TQEA 3PRVA 1W2BR 2F8MA 1DQAA 4K4VA 1IVZA 2AEJA 1EKSA 1N36J 4C2MA 1SH2A 2I2YA 2Z0GA 2VPYB 2AV5A 4XAKA 5IOLA 4ECWA 3DDNA 5C24A 3D6TB 2J7WA 1TL3B 3OFFA 4QBUA 2C3PA 1JLGA 4EMDA 1RWUA 2FZKB 4XDDA 1IJFB 4X65F 3PR5B 4N7TA 3A4TA 3UI3A 2HW3A 4MFBB 2MEWA 3CE8A 1QAJA 2B4UA 2E5GA 3JTPA 4ZCKA 2OLWA 4MK8A 4NWBA 5K14A 2H4YB 2AD9A 4OX9J 4ILMA 1XJWB 3DYAB 3OL7A 1SL1A 2MPUA 2KM8B 1KQSR 3W61A 4NCBA 2ZJQQ 2GHPA 3V2UC 1O8BA 2ADCA 3E3XA 4N5SA 3PNIA 1OWXA 1HLWA 2GO8A 3QGIA 1ZM3A 4YP3A 1RDRA 2B43A 1IKYA 4YOEA 2IBOA 1RABB 4Y2KA 3Q8UA 3PRDA 4TQRA 4ETZA 2AWZA 3GQCA 1S4EA 2JHEA 1BQMB 1TKZA 2E5JA 4OZJA 2JFDA 2VQEF 3GIJA 4F67A 2CNKB 3DHXA 2D9PA 4WIIA 3M30B 3MUVP 2XWYA 4Z7YA 4A8OA 3KMQA 4Y00A 1S0VA 3DXBA 2VHGA 4P71A 4U8VA 4E8UA 5I4MA 1FD2A 3GJRB 2IM0A 2ACYA 1UJ4A 5KOXA 5FJ4A 2B56A 4WZQA 4NXNJ 5KG3A 2G1HA 3K5PA 2UVRA 3GIMA 3H40A 4EYIB 4IFYB 4N8OA 3IM9A 4BDPA 3NMAA 1HHSA 1CULA 3V81B 5SUHA 3ILIA 3K5OA 2J9CA 1IM6A 3PYEA 4ZIWA 3LA0A 2LU2A 4A8MP 2Y8WA 1U1RA 4NASA 1G1XA 4K4XA 2L48A 2Y9HA 5HO4A 3GZ7A 3CCMS 1ICEB 2BJ7A 3NCQA 3T1HF 2VONA 4J9QA 5GMKa 3HCXA 1S10A 4CLZA 3ENVA 2Q6CA 4ZP6A 1VI7A 2HNZB 1JJ2R 4NA3A 2MKSA 4AT1B 5LXRA 1FJGJ 1YSJA 4PQUB 5SZTA 3DLKA 2VICA 5KG5A 2XYGB 4A8SA 3GMGA 1Y0HA 3T9NA 2C3MA 2MMYA 2R7QA 2JJ4D 2POKA 4P2MA 4MIAA 4ITSA 5CYMB 5DM7Q 4X84A 4DS5A 4DN9A 2X1GA 2QA4S 4CO3A 2MKIA 1NKCA 3RBEA 1PJ7A 4ZHRB 3MCOA 1TMMA 1D9AA 2OI2A 2V5HG 3VGUA 5HQLA 2HMIB 1Q8KA 3LAMA 4QOTA 2ASYA 4GVBA 2WAQD 4OYMA 5GAEU 4UY85 3RUBL 2X1BA 2XMMA 3DLEB 3MM7A 2ATCB 4DUYJ 1S6UA 1SQGA 3QYYA 4NEZA 3BGLA 2JVOA 3M1VB 4YB6A 4ZPDA 4K4SA 5I3UA 1GXLA 4M8LA 1SKUB 3E8OA 3CWJA 4PXCA 2RQ4A 3ITHA 5F8MA 3W63A 4YMEA 2A2DA 1CJKB 3MECB 2BE2B 4DV7J 4I0WA 1SL0A 1L3TA 2H48B 1N52B 1VQYA 1WEYA 4U9RA 4NCAA 1HNIB 1KS2A 4XPEA 2C2EA 2QEXS 2C2RA 5H9FJ 1U1KA 1WEXA 3PHEA 4P9SA 3FQLA 1RWWB 1S1TB 1X4GA 2DIVA 1Q5YA 2ZWPA 1R6YA 2H51B 2GVDA 1IKVB 1FJ7A 4C0HA 2OO4A 2CAJA 4JYAJ 2UXCF 2WVFA 3M8ZA 2HGMA 1WUUA 1BWVA 2KU7A 1Y00A 2F8HA 1F5AA 4MAKA 2ASJA 5L9NA 2OAUA 3T1AA 3IGVA 1RT6B 3BSAA 3J7AN 1D3WA 4KKOB 2WTFA 2J5AA 4QQBA 2QC3A 1N5QA 2MTLA 4OIXA 1RTJA 3I32A 1LW0B 4PCQA 1NBEB 3QLHA 2MGZB 4DV2F 4CLFA 5DETA 4TY8A 1EETA 1ZPWX 1Z2LA 1Q5VA 1HPZB 2IAJA 2RAQA 3ET6A 3HP6A 1RWMB 1I51B 1VJQA 2Z2MA 3R7SB 4AE5A 2IIHA 1RACB 1PCAA 1Q82T 2MHNA 2WK4A 4WE1B 2B9YA 5IC4B 4DR1J 3CCQS 2Z2YB 3AOCA 2EW9A 1IWGA 2Z57B 5B0CA 4DX7A 4ZVUB 4MTPA 2H9ZA 4ZP9A 2QZ8A 1PIEA 3CW2C 2VG7B 2QN6B 2W25A 2JC1A 3GWCA 3JSBA 4X64F 4F4YA 1CJVA 3L95X 4NE9C 4LBPA 4YB7A 1GK8A 2OPRB 2QG9B 1QE1B 4NA2A 4L76A 1RWKB 2OD4A 3CTRA 2DHGA 5D78A 4Y65A 2GHVC 2AJFE 1T3OA 1IBKF 4J7CA 5MLCV 2ACMA 3I96A 2P2CB 1KRPA 1RBOB 2NSBA 4JI7J 1C0TA 1Y3JA 3LGHA 1TV6B 4DQQA 3OUYA 4W92B 3RBXA 3TZWA 4C11A 4HTIA 3KLGA 3PY8A 4K5SA 2YNIB 4EYHB 4DUZJ 2BDPA 3G82B 3AT1B 2FB0A 3D1QA 2EI5A 4CYUA 3ENWA 4JV1A 4USKA 1LWEB 3OXLA 4F50A 1NO8A 5IQQA 1GMUA 1S6PA 5L1LA 2OFHX 4Y6IA 1XR6A 3KG4A 3V4MA 3KFWX 4OYBA 3QJLA 3CNQP 3ELHA 1JNRB 4N47A 4JI4J 1AYEA 2J76E 4ZIVA 5F9NA 2MQQA 3VWSA 3ZXWA 1VQOS 4B3RF 2UUWA 1HYSA 5KFXA 4DV3F 2G0JA 1Z2ZA 4DSJA 1X5SA 4PUOA 1FRIA 3MAHA 2E9RX 2XYHB 1N0VC 2M4MA 4JI5J 2M70A 4RL1A 4Y2IA 4RJVA 3QT6A 2XTJP 1SI9A 3JSMB 1ZAWA 4H4MB 4OX7A 3WZ0A 1C4CA 2MKHA 3NBPA 3PFOA 1SXLA 5L9XA 3IS9A 4A46A 5AJ3F 4PG4A 5C25A 3FCWA 2ZBCA 3PYGA 1EP4B 5IM0A 1NPPA 2HEKA 2OELA 1ROFA 1IR2A 1ZZFA 1YBTA 3RB4A 2GAGC 4KV8A 3J81Y 2ASLA 1NUEA 2WB4A 1QSYA 3HZGA 1UFLA 1LK5A 4ICLA 1YRUA 2L9WA 2K7KA 1S1XA 4R0EA 3AXMA 2DNNA 3GV5B 2VL1A 2KI2A 2AJ2A 3DLJA 5F8LA 3SSQA 2RDDA 2DYAA 3UR3C 3FQKA 4MK7A 3MR3A 4AD6A 5GMEA 3CJ2A 2HWIA 5KFNA 1XEZA 1TUGB 3P5TL 2UU9J 5C24B 2EVZA 3BR9A 2LEAA 3G71S 3UW1A 3NAIA 5IV3A 3SSRA 1NRKA 1SC1B 4OX8A 2XHWA 4RWWA 1K47A 1K44A 3VAHA 1K9MT 5KT6A 5BYRA 2PIIA 2HRTA 3MHYA 3S6EA 4CP5A 5F0WA 2DNRA 1FWKA 4LF2A 3OW2R 1FXLA 3EDRB 5KFRA 3SV3A 2IJNA 4LF8J 1JXVA 3HULA 5D4PA 4WWSA 3FZBA 3DLGB 4V19X 4ED3A 1H38A 1Y11A 4ZVGA 2MQ8A 4I2PB 5HANA 3RBDA 1U09A 2DH7A 1YITS 1TFWA 1FFGB 2WW4A 5EX0A 3EVOA 3RYLA 1DURA 2XZTB 2WVDA 1RI7A 2RQCA 3DFEA 1S0MA 1HMVA 2ZD1B 4OLPA 3WIUA 1GXTA 1XIQA 5T7LA 5HJXA 1F1BB 3IXQA 4MYTA 1VQSA 3Q8PB 2XS5A 5DGBA 2HG4A 2HHPA 5CHCB 4LF9J 4OYZA 1FDBA 3C6TB 3CD5A 4ID5B 5KFZA 4NYZA 3H2UB 1NJYA 1QDUB 2NUHA 2BRLA 5KG1A 4JV2A 1AXQA 4CO4A 3KJFB 3OSNA 1LWFA 4JI8J 2BM1A 2XMUA 4WYWA 3V4IB 1NK5A 3F44A 4USWA 1T03A 2I1RA 3IBFB 1VFJA 3FRYA 2LXIA 2DJWA 1A6LA 1RWXB 1FWPA 1S97A 1S6QA 2CDQA 2D74B 2O3DA 1UWBA 2CJXB 3KUGA 2LQ5A 2KYXA 3ILJA 4LF4J 2BW2A 3CD7A 4X4PA 3MURP 2QV6A 1VQ5S 3VAIA 4IO9Q 3CPWR 4FF4A 3R1HA 3G8SA 3POTB 1D8YA 1SIZA 3ZZUA 2J9EA 1HQEA 1UEKA 1SJ1A 3QGPA 3OJUA 5L8RC 1HR0F 3AXKA 1PYSB 2MY8A 3HD1A 1YQHA 4FN5A 4RW8B 1D0EA 3WIVA 4XDCA 2C2DA 4KTQA 2GIFA 2PA8D 1S5ZA 4WF9Q 3PJ9A 3NY0A 2DTJA 1S9EA 1ZA2B 2ILZA 3M8YA 2FLLA 5CCMA 1WHYA 3QRPA 2PFFB 1I94J 4DFMA 3KLEB 2V2QA 4CNYA 4HR2A 4LF7J 3HPOA 4H4OB 4ZVTB 3D1HA 4K8RA 3R5JB 2KXFA 2V4JB 1F60B 4F0KA 5I3UB 2JEJA 1EQMA 1JKHA 2HHTA 3OVBA 5I3PA 4R25A 3MTKA 3JSRA 4RNNA 1TL7B 2BQRA 1WKLA 3AA9A 4F7VA 3M6WA 4LF5J 1Q4RA 2ROEA 1YJTA 2F4FA 3AQOA 5HROB 1Y9OA 3UN2A 2ZH9A 4QW9A 1RT3A 5J1NA 2XY5A 2LQ8A 1KTQA 3EJMA 1HL6A 2PEHA 3NGTA 2IVFB 1KHVA 5DS7A 3LQVA 5IV4A 3PJWA 2AZ1A 2GC8A 3DM2B 2AX0A 2HQ3A 3C2PA 4J9VA 4ZJQA 4UW2A 3OSPA 2J7UA 4ZA1A 2WOMB 3NWGA 2PA3A 2FVSA 4JBCA 1X7VA 5HVHA 1W7WA 4JP8A 1R0BG 4DL6A 2V0NA 3DLBA 3UR0A 3JYTB 1SBRA 5IWAF 4V1Ak 2C2MB 1X4BA 3SFUA 2KVQE 4ANDA 4EU0A 4DS4A 3SQOP 4H4KA 3DGPB 4NLYA 4U7UK 1JK9B 1RB0A 4ECUA 3D3CJ 2Y1LB 3EVWA 2WCXA 3BQ1A 1Q78A 2DY1A 4RW7A 2DNGA 2W9AA 4KQZA 4ZCMA 2YPYA 2ZE2A 1KN6A 4J9RA 4I6AA 2JVRA 1VC0A 3M8WA 4C0BA 3SQGA 5EWFA 3LP1B 4CWBA 4H4KC 5F8GA 3DLLQ 3CCLS 2AYMA 1WSVA 1QAIA 2BZ2A 4YQWA 2V9WA 3MM5B 3OVSA 5HQ8A 5GAGI 1H6KX 1RHJB 3GG1A 2Y0SD 2PC6A 3L4BC 2DH9A 5KFWA 3KNAA 3OHAA 1LXJA 2LKZA 3HHLD 1UZDA 4ECRA 2KFYA 1TUWA 2XS7A 2KL8A 1FI4A 2W1BA 4DG1B 2E66A 4G1QB 4NLTA 4WXOA 3Q8YA 2EC0A 3SCIE 3HFVA 2AJQA 3B54A 3M2UA 1OQ3A 3FK4A 2E1CA 3IAM9 4LSNB 3B4DA 5KFMA 3W3SA 2L08A 3NNAA 4USVA 2BYCA 3BDEA 3KHLA 2XI2A 1CS4B 1UPPA 4J9OA 3BPDA 1U8WA 3WQPA 5B09A 4C8NA 5D3GA 2ZC4A 2JEGA 5RUBA 3JS9A 2HGNA 1LFWA 1C2PA 3KK1B 3P96A 4M5LA 2KRRA 4IO1A 3MPDA 3X3UA 5E3AA 1WTBA 1FJCA 2EFGA 4UOHA 1U49A 2DHXA 3D7SB 1VQKS 3G6YA 2M2BA 5GAHI 1JQGA 4NMLA 3CJRA 1V9OA 1TUVA 4ED2A 4TQSA 2DRDA 1RSCA 2GMHA 3G8TA 5CZXA 3HXMA 1S1WB 1RAHB 3U02A 1R0CB 2ZDPA 4DL2A 2UXBF 2CQCA 3RW7A 2VH7A 5L38A 1DTQB 5LMNJ 3DOLB 3O2IA 3LALA 3N4WA 1CBKA 4FKXA 2M0GB 2OTLS 2ZHAA 2BOPA 2XNQA 3J80U 2D9OA 3K8WA 3IA0A 2RF2B 4DR2J 1FRKA 3TANA 4PZVA 5HLFB 1JNZB 5I42B 3MEDA 1E6VB 3BREA 5KFTA 2DGQA 4O4GB 2W8LA 2O66A 1J5OA 3EPIA 1AFJA 1YK9A 4DFPA 1FKPB 3MFIA 3MM6A 1YJ7A 1WEZA 3KJVB 4DSLA 2DNHA 2VFTA 4L73A 2DEJA 2ZNZA 1NK9A 4ZCLA 3KK2A 3ZNJ1 1MNEA 5G4DA 3SV4A 3E51A 3TA0A 4P7VA 3FDSA 4YUDA 2AYGA 3R5GA 2NCKL 2DNZA 1N34J 2BKPA 3D67A 1RGVA 1N5SA 4F25A 2M8HA 4M5DB 1W26A 3QAUA 1R8BA 1U1MA 2FHMA 5G0RB 1XBWA 4N77A 2F4VF 4M94A 4ANEA 1FF2A 4RU2A 4LF6J 3D68A 4CLYA 1RTDB 1UVKA 2WVEA 2AU0A 4GKJF 5ETRA 1YI2S 4M1KA 1MROB 3VV2B 2VOOA 1C1BB 5KFQA 4FP9A 3EDQB 1N54B 2GFFA 5L1KA 1VQNS 3DDKA 2BR0A 1Q7YT 1EB0A 3BZQA 4LIRA 4NMXA 3VR1A 5A6WA 4DL4A 1RADB 4K4UA 5HMZA 1NK4A 2XLIA 4DR6J 4FXDA 4ZITA 2CPDA 3V6DA 2PSZA 4QIVA 2MYFA 3SDEA 3RAQA 1NJZA 2R8IA 2JEFA 3DOMB 4A8FA 4QU7A 1XR7A 1JLCB 3PKYA 2ZH8A 1HMVB 3MMCA 3MD3A 1FRXA 4CO0A 1TAUA 4EZ6A 1L3SA 5T7LB 5J2NB 3BR8A 3MDFA 4FNIA 4U67Q 3WX8A 4Z2XA 1CJUB
chains in the Genus database with same CATH topology
1M5OC 1ZTWA 3W2VB 5EGYA 2Z4PA 5K8OA 4I6YA 3QJJA 4A8YA 3THPA 3U7JA 1FDDA 3G6VA 4ZP8A 2J6UA 3VAJA 2UXDF 4ELTA 3KK2B 4HDHA 4ES2A 5K5MA 1G3OA 3Q8QB 2P6TA 2L3MA 2DGTA 1FVSA 4Y2AA 4HLBA 4IH6A 1X5PA 2WHOA 5FDLA 4PG8A 5B0BA 3CJ5A 2RNEA 2MSSA 5JUMA 2YNFA 3OTCA 3OPKA 4I2QA 1SUQA 4IKAA 2KM8C 3M32B 2RKIB 2WSCC 2IYIA 3N79A 2N4CA 3NKYA 2B6AA 2VUGA 4YY3F 3MPYA 5LT5A 2LQBA 1SC6A 1BQMA 2ZITA 4ZLPA 4X4VA 5EX3A 3MMAB 3PW7A 1YWXA 3UDCA 2HYIB 2HLUA 2K1RA 3UCUP 4NXNF 1X4DA 3CGIA 1K0TA 3IG1A 1SKWA 2DK2A 3CDWA 3QZ7A 3QGGA 4JI0F 1DRZA 2MQLA 1N6QB 1RT5A 1VLYA 2CJBA 3M30A 4NOHA 2B9XA 3PEJA 3LP2B 1JMTA 2HVZA 2KHCA 2BANB 2EFNA 2Z8QA 4DX8H 4G6VB 2EPIA 3QIPB 4O44A 5AXKA 3HVTA 2KTQA 4BHQA 3MM8B 5MAOA 3QWUA 4DBQA 2EKYA 3QZ8A 2YVSA 4DQRA 1IM4A 1WNEA 2N4DA 3HLUA 1UKUA 2HRYA 1UVMA 3HZEA 3O5TB 1W2BR 1J5EF 2KJWA 2MZQA 1N32F 2UV8A 5F3TA 1R0AA 5F8NA 4RNHA 2F8MA 3BN7A 5DLGA 1YJRA 1SJQA 4YB5A 2AGQA 1DQAA 4K4VA 2XGQA 5B7WA 3I4HX 4C2MA 2OD6A 2D3UA 1TL1A 3KLIB 3BEGB 1BQNA 2CRLA 4L72B 1UJ6A 4QWBA 3GFXA 4ECVA 2KT5A 1SH2A 4DN0A 2RJZA 2JLGA 2O01C 2I2YA 4N56A 1IXKA 3PACA 4LFCF 2R7RA 1Q8BA 2Z0GA 2VPYB 4IFYA 2AV5A 1B0PA 1WI8A 2KJVA 4EZ9A 4XAKA 5B0FA 1VQ9S 3GB0A 1NB7A 4Q8EA 3V81A 2VG5A 2K8GA 2ZBIA 3D1OA 1FJGF 3CJKB 4ECWA 3DDNA 3BO3A 2RT3A 4B17A 5C24A 3I56S 2J7WA 4WK3A 2W9BB 1TL3B 4HI1A 3OFFA 4HI2A 5LMNF 4QBUA 2NLWA 2C3PA 1UFWA 4F2SA 1JLGA 4R0JA 3K5NA 1YJ9S 1YVFA 2W7PA 1KFSA 1RWUA 4XDDA 1IJFB 3CF5Q 1K0VA 2IMWP 4X65F 4QCLA 2X51A 3MEKA 5E5NA 3PR5B 1FO1A 4ECTA 2B0GA 5U47A 3UI3A 3PM9A 2Q66A 3K5MA 2UUCF 2HW3A 4WKYA 4MFBB 2YKNB 3CE8A 1QAJA 2AP6A 2COLA 4F26A 3SI8A 3I55S 2B4UA 2E5GA 2HNYB 4NLOA 3JTPA 4ZCKA 4IUFA 2XNRA 5M2RA 2E5HA 3V6DB 3SDEB 4I64A 1WG5A 5LL6d 4ZCIA 4DR2F 4DJBA 2OLWA 2HNZA 1WD6A 3SFGA 2IMOA 1UAWA 4MK8A 4K2XA 2F8EX 2RD5C 2HHUA 2LEPA 5KFIA 2LLZA 2KFNA 4NWBA 5K14A 2IFXA 4PQUA 3FMBA 1KTVA 3B4MA 2AD9A 2AW0A 2HAIA 3MMCB 4IG3B 2J6TA 4ILMA 3DYAB 3H20A 3OL7A 3CVKA 2LDIA 1SL1A 1UMJA 2MPUA 2KM8B 1KQSR 1QUVA 4NCBA 2M3DA 2G9OA 2ZJQQ 2M5YA 2Z2LA 2AX1A 5CYMA 3UE2A 2GHPA 3V2UC 1O8BA 3OBIA 2KG1A 3D54A 2ADCA 3E3XA 4N5SA 3IWLA 1OWXA 3PNIA 2XMWA 2GO8A 1VMBA 5F41A 1LK7A 3QGIA 1QY7A 1ZM3A 2ZZMA 3BGRA 1NJWA 4YP3A 1VRUA 1RDRA 4YR3A 5L1JA 4ECZA 2V2KA 2X3GA 2B43A 4ZHRA 2B5JA 1IKYA 4Y34A 4YOEA 2IBOA 3TARA 2MKCA 2DGSA 4Y2KA 1U47A 3BO4A 5FDLB 3PRDA 4RW9A 2W7OA 2VQFF 5KG6A 4OMFG 1UA0A 4TQRA 2JC0A 2OP5A 2HMIA 2MB0B 3QIDA 2DGXA 1S9FA 4IOBA 4C9DA 2WB1D 4FNHA 2YNFB 2MDAA 4I2QB 4ETZA 1SUQB 2AWZA 3LANA 3ZZRA 2ZC3A 3GQCA 1M90T 1BWEA 4AL6A 2DNOA 2B6AB 5C5JA 4C8ZA 5CH7B 4IQXA 2JHEA 4QR0A 1BQMB 4I56A 1QSLA 5LSLA 2FC8A 1XMOF 3DLEA 1TKZA 2E5JA 4OZJA 1P1LA 2QMXA 2JFDA 2VQEF 4DV7F 1N34F 4DL3A 2KDOA 3IG1B 3GIJA 4F67A 1R3NA 3OHBA 3HM9A 3TVYA 1RT5B 1R8AA 3GR1A 3I5AA 2N82B 4K4WA 3DHXA 2D9PA 4WIIA 3M30B 3LOUA 3MUVP 2LEBA 4X4RA 3FRZA 2XWYA 2H5EA 4B9SA 1IJEB 3PW2A 2MSTA 2ZH1A 4A8OA 4LJMA 1NJIT 3RAMA 5KG7A 1UETA 3M1VA 2HLTA 1VQMS 4O44B 2RE1A 3HVTB 2BJDA 4Y00A 1JLBA 1FJEB 2DR8A 3KMQA 1NHUA 3PW5A 3QJPA 1TL5A 1DFDA 4O3OA 3N6NA 4JYAF 2VG6A 3JAMY 1S0VA 2LA4A 3ISND 2EFOA 5KT2A 1XERA 3IRWP 3DXBA 2ZHOA 2ROPA 4A4JA 1R0AB 4E8UA 5I4MA 1IBMF 2JOQA 4RBVA 1FD2A 4WFAQ 1IUJA 2QFJA 4I6WA 3U1LA 2IM0A 2ACYA 1ZAXA 2I5JB 1LXNA 1RTIA 1GXUA 1UJ4A 5KOXA 3CCUS 2ZZNA 5FJ4A 2B56A 4J37A 5LJ5Y 1OPZA 1TL1B 3VQSA 4ECQA 4WZQA 1BQNB 3MECA 2BE2A 1DQ8A 1GT8A 2E44A 2XI3A 3MPVA 4RNOA 3M9NB 2DNKA 5KG3A 3G6ES 4ILRA 5GAGU 3K5PA 2XMTA 2XY7A 2UVRA 1TKXA 1C1CA 3GIMA 1HNIA 3H40A 1T8EA 2CG4A 4EYIB 1HQUA 4DF4A 4IFYB 4N8OA 4BDPA 1XK8A 1Q53A 1RP5A 4XO0A 1HHSA 3NMAA 4ELVA 3V81B 3V5RA 1S1TA 5SUHA 2VG5B 3K5OA 1BY9A 2J9CA 1XNQF 2R7UA 3IN5A 2FHJD 4HYKA 2IM2A 3CCWA 1IKVA 1YHQS 3THTA 3FJ2A 4TU8A 2ILYA 2J9DA 1JLGB 4QW8A 2LU2A 4A8MP 3C6UA 4OL8A 1U1RA 1G1XA 5KFYA 3B78A 2GMLA 3AB2B 3VQTA 4KJIA 4LMZA 3I0RA 4EO6A 2FJEB 4RZRA 2L48A 4K4XA 5LXYA 5HO4A 3GZ7A 3CCMS 4KC5A 2F3JA 4QWEA 3OL8A 4NLWA 3NCQA 3W7BA 2DR5A 5DGAA 2QE5A 3T1HF 2VONA 1RT6A 4J9QA 5GMKa 2OPSA 1U1PA 2A18A 4KKOA 1S10A 1YBAA 3CB4A 4PQAA 4J9NA 5DG8A 1YGYA 4N76A 2E7WA 3ENVA 3WC0A 2Q6CA 4I69A 4ZKAA 3SYZA 3CCSS 2CZ4A 4ZP6A 5HL7Q 4FF3A 3F73A 1VI7A 2HNZB 3AA8A 1LW0A 3GV8B 1JJ2R 4NA3A 2MKSA 3TVZA 2XMKA 5LXRA 2MGZA 3VAGA 5AXLA 2M8DB 3PKMA 4AXIA 1YSJA 1TK8A 2IC3A 3DN9A 5K14B 4PQUB 5SZTA 1BD6A 1S99A 1GTHA 3DLKA 2IBKA 4QIFA 5KG5A 4A8SA 3GMGA 1JLFA 1Y0HA 2F7VA 1DBDA 3H2VE 2C3MA 3T9NA 4XIUA 4DSEA 2RDIA 2MMYA 2J9DE 2R7QA 4FXVA 1GQEA 4KE5A 1HPZA 2R9LA 2JJ4D 2POKA 1QTMA 4Z37A 4K0KF 1JLEA 2HIQA 1VBXA 4YHHF 2XGPA 3RR7A 4X4SA 4MIAA 4OJ1A 3S01A 4NX9A 4ITSA 1XWLA 4UOCA 4AUKA 3CJ4A 5CYMB 4DHVA 5DM7Q 2EG1A 2KXNB 2RVJA 3DI6A 1OIAA 4KR0B 4OZ0A 4X84A 5AXMA 2QLWA 4DS5A 4DN9A 2X1GA 4PWDA 2QA4S 4CO3A 2HFZA 4DV5F 1KEKA 2MKIA 1NKCA 1Q7LB 5LJ3Y 2DNLA 1WG1A 1FDAA 1VRTA 3OLBA 1D1UA 3RBEA 4ECYA 4F02A 1ZM2A 2IHR1 1VRUB 4NRTA 1LW2A 1LWCA 3AB4B 4WE1A 4DSFA 3KNGA 4LFAF 4ZHRB 2B5JB 2VFRA 1IKYB 2FJDB 4PPDA 3HX9A 4LFBF 2DT9A 5THWA 1D9AA 3ZZYA 2V5HG 4IG0A 3AAWB 3VZIA 1JXLA 4OI4A 4RW9B 2CQIA 1S77D 4I67A 4DLEA 2HMIB 4V19J 1FRMA 3M8QA 2KO1A 3LAMA 3OXFA 1NAQA 2CQGA 2ASYA 4QOTA 4C8YA 1O51A 2LA6A 1IKXA 2FJAB 4DR4F 1VQ7S 4NCGA 2WAQD 3AJ2A 4LUBA 1HBMA 3SSSA 5GAEU 4UY85 1FK9A 2X1BA 2UP1A 5DJBA 4NL5A 3TVKA 3FZ2A 2XMMA 1TKZB 3DLEB 4QZVB 3MM7A 1L5UA 1CQMA 3SCJE 3A1YG 1FE0A 4NZ7A 2C3UA 6FDRA 4PXBA 1VC6A 1S6UA 4RKUC 4WFNQ 3QYYA 2WW8A 2U1AA 2UUTA 2D1CA 3I6PA 3BGLA 1AUDA 4C8LA 2YKMA 2DB1A 2CQHA 2JVOA 3EXCX 3RZAA 3F41A 3K59A 2E29A 2VG7A 3M1VB 4DQSA 3ZZZA 4DR5F 3M6UA 4YB6A 1JLBB 3KMSA 2D3OR 2ZHBA 1S0NA 4ZPDA 1Q1KA 4F3MA 2ZNYA 3V6KA 3DRRA 2LQJA 2R8KA 4F4KA 3BO2A 1U2RA 1H0HB 2KT3A 1DARA 2VBZA 2IRXA 2JH3A 2VG6B 4QR2A 4LVNP 4K4SA 2HVHA 5I3UA 1GXLA 4M8LA 5BYSA 1X9MA 4OI6A 3N5FA 3J7YI 2OPRA 2CQ0A 4MJKA 1NZAA 2YX1A 3E8OA 3MAQA 1QE1A 2FC9A 2FJWA 3CWJA 4PXCA 2RQ4A 3ITHA 2PO4A 5F8MA 3WDOA 2HHSA 4YMEA 1RTIB 2A2DA 1KFDA 3MECB 1UVLA 1FRLA 2BE2B 2HWTA 4IFVA 3DMJA 3MR5A 4I0WA 1SL0A 4TY9A 1L3TA 1NHVA 3NNHA 1N52B 1TKXB 1VQYA 1WEYA 3R5AA 4U9RA 1C1CB 4WFXA 4NCAA 1HNIB 1KS2A 1URRA 4TU7A 3HK2A 4XPEA 3J7A1 2FHKA 1HQUB 2DBBA 2I8EA 4ES3A 2C2EA 1H7XA 3MUTP 2QEXS 2MJNA 4CI0B 5H9FJ 2C2RA 1U1KA 1U1LA 1WEXA 3PHEA 4ZMMA 2LCWA 3NAHA 3FQLA 4R8UA 6FD1A 1S1TB 1X4GA 2DIVA 1FESA 3DRXA 2GMJA 1W2IA 2DR9A 4F4WA 2DO4A 1R6YA 2WSFC 3EYZA 1IKVB 2EWHA 1N88A 4NLQA 2FPHX 4G1PA 2OO4A 2YTCA 4C0HA 1U1QA 4CCHA 4AL7A 2UXCF 4JI3F 2HGMA 4X4UA 1R27B 2GGPA 4BC9A 3C6UB 1TV6A 4RW4A 2MQMA 4OLOA 2JFKA 2XB2D 2KU7A 2ZVSA 1FRHA 1Y00A 3I0RB 4J5OA 1O0PA 2F8HA 1OQ6A 1F5AA 1YJNS 4MAKA 2ASJA 2XSFA 5L9NA 3KTQA 2OAUA 3T1AA 3IGVA 2YNIA 1TZ0A 1RT6B 2HHQA 4O3NA 2FGCA 3BSAA 3MWBA 2OPSB 1D3WA 2HHVA 1CPZA 4KKOB 3ENQA 2WTFA 3QGHA 1IN0A 2J5AA 5KFUA 2VA3A 4FYDA 4QQBA 4EWTA 1UA1A 1SKSA 1N5QA 4OIXA 5L39A 1RTJA 3I32A 3UCZP 1LFPA 1LW0B 4PCQA 3TUJC 1YG0A 1V6HA 4GC6A 1LWEA 4PKDB 2OMLA 4OX9F 1KR4A 3QLHA 5CD4H 2MGZB 1ZAVA 4EEYA 3GV7B 3EGZA 4DV2F 4B02A 5DETA 4TY8A 4MH8A 1EETA 1ZPWX 2QSWA 1S79A 3DLKB 5DQIA 1Z2LA 2O5DA 3NS6A 1FDNA 3T5HA 3I0SA 3T5LA 4B9MA 1RTHA 3QO9A 2VC1A 3PV8A 1RT7A 1HPZB 3J7YU 1L3VA 4I7FA 2IAJA 1F0XA 3TP2A 4K4ZA 1JLEB 4JI5F 2GCFA 3VCDA 2K3KA 2V4RA 3FVYA 2KN4A 1RT2B 1I1GA 2QA2A 1NK8A 1Q8IA 4NZ6A 4NA1A 1SJ4P 3R5BA 1NEEA 1SL2A 3DI6B 1WF1A 4ZPBA 3M9MB 1HNXF 2L41A 4WK1A 3HP6A 2FHJA 4UUXA 2CQDA 2LXUA 3ISNC 4PWDB 3NCPA 3H8YA 2Z2MA 4RW6A 1R8CA 2V4QA 4AE5A 1VRTB 3TAPA 3C8YA 1VQ6S 1YJVA 1Q82T 4X4NA 5CYQA 1LW2B 2MHNA 1LWCB 2WK4A 1FTRA 4WE1B 4FPRA 2B9YA 4LSLA 3D2WA 2MZ1A 4EUVA 2GQ2A 3RTVA 2V94A 1JX4A 2M9KA 3CCQS 1R7IA 1X4FA 4IG0B 4O0IA 3R5DA 4J9KA 2XCPA 3KLVA 1DHMA 4FS2A 2EW9A 2RRBA 3ZZTA 3GSDA 5HMYA 4KHPF 3M8QB 3PO4A 4N41A 3P3DA 5B0CA 5J2PB 1IKXB 2XMVA 3LO3A 4NCGB 2YX7A 5CYJA 1HBMB 1FK9B 4MTPA 2H9ZA 2UV8G 1WACA 1VS3A 2LYVA 3MM7B 4ZP9A 3MCSA 4KIAA 1A7GE 3JSMA 2CQ1A 4YEAA 4RUAA 5E7OB 2P9CA 4H4MA 3HT3A 2QZ8A 1HA1A 2ZFHA 3GFHA 1NU4A 2VC0A 5EUHA 2YKMB 5GADI 2XLKA 4FZVA 3F56A 2LQ9A 4YFUA 2VG7B 2CQPA 1VQPS 3HKZD 2SXLA 2CFXA 2W25A 2JC1A 2DNPA 2E1RA 1EP4A 3DRRB 3GWCA 5DQGA 3JSBA 4X64F 2Q79A 4F4YA 1DAXA 3L95X 4QWCA 2FVPA 5LSOA 3H4DA 1HD0A 1P27B 2J6SA 3T19A 3N0VA 4YB7A 2LVWA 5J2QA 2GJIA 4ZS6A 2OPRB 4X2BA 1PILA 3NL0A 2XC9A 1U25A 3NGDA 1HARA 3H5XA 1QE1B 4NA2A 2HZCA 4QR1A 1WG4A 2DR7A 2Y1JA 2OD4A 3ITHB 1GX6A 1XTZA 2CPXA 5HBMA 3NLCA 3CTRA 2DNMA 2DHGA 2MY7A 1JB0C 3AHPA 4Y65A 5D78A 2IYGA 2GHVC 4E0DA 2AJFE 2E9ZA 1OS5A 4IFVB 3DMJB 3WC2A 1T3OA 3PX0A 2P9GA 1IBKF 1MU2A 2AF6A 4B9TA 1HWUA 1VQLS 5MLCV 4JI1F 3HI9A 1R8PA 2HHWA 1MMDA 1WHXA 3I96A 2YWFA 5CQGA 3K5LA 5J2MA 2C28A 4R8UB 1KRPA 2IA6A 4K59A 2NSBA 1B64A 1C0TA 2HGLA 4MYUA 3FFIA 1Y3JA 5F8JA 2B51A 1OSDA 2GGPB 1TV6B 2UUAF 1VGYA 4RW4B 4DQQA 3OUYA 4A8XA 4W92B 2GIRA 2C42A 4C11A 4HTIA 4DL7A 2MQNA 4C4WA 1JJ4A 4Q8FA 3KLGA