2L9DA

Solution structure of the protein yp_546394.1, the first structural representative of the pfam family pf12112
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSIDAAQVTEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the protein YP_546394.1, the first structural representative of the pfam family PF12112
rcsb
source organism Methylobacillus flagellatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12112 DUF3579 Protein of unknown function (DUF3579)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9dA00
2L9DA
chains in the Genus database with same CATH superfamily
4NOHA 1KR4A 1N5VA 3T19A 3R5BA 2HQIA 2UUAF 1S49A 2F63A 4HTJA 2DPIA 2CPDA 3DHWC 3HSGA 3HKWA 5KFSA 3PIPQ 4ECVA 4OX6A 1UMJA 2NXJA 4L74A 2V4JB 3DLKA 4ZVSB 2DK2A 4KGZB 3S7RA 2X1GA 3UN5A 4EU0A 4BLGA 1RTIA 4USTA 4UZBA 3BQ0A 2MYFA 1C0TA 3OL7A 1HQEA 3GILA 4ECRA 2PIIA 3CD7A 3OXGA 5L9XA 3J81U 3L09A 1PILA 3KHHA 5LMUJ 2ADCA 1EB0A 4ZIVA 2PMZD 1HW9A 3TVYA 3FSIA 3FVYA 3GJRB 3LANA 3OR1A 1K44A 2PN6A 4DFMA 3HHLC 3ZTQA 1IBCB 3CC4S 1WTFA 2XMMA 2YKAA 1BC6A 3TQ1A 2VC1A 3DRPB 2JEGA 4OZ2A 3I96A 3M6VA 4H4KC 4B9MA 1MMDA 2W7PA 2NQPA 3M8YA 5KT7A 4ID8A 2HEKA 4DQIA 2WB4A 4MAKA 5IS2A 1EIYB 1UPMB 1VBYA 1DQAA 4C8KA 5C5JA 4JI3F 2VFSA 2QYGA 2QLWA 2H48B 5G0RB 1RT1B 3ZTRA 1BQMA 2ZZNA 4OX8A 3K5PA 1DRZA 3NAHA 3FFIA 4RW4B 3MUMP 5E3CA 2E1PA 5IT9U 1HQUB 4LF8F 1T9YA 1OJ4A 4GVBA 3DXSX 4AXIA 2E29A 3IG1B 4WCEQ 3ZTPA 2BBEA 1XQIA 4PRFA 2L9DA 3H42A 4USJC 1S10A 2GO8A 3EPIA 1GH8A 4DSFA 4ELVA 1P1LA 2XHWA 2GV1A 3OD2A 1F5CA 4F2RA 1V6HA 4LBPA 4GMKA 3CSKA 3CTRA 5HATA 5SZTA 2VQEF 2JL9A 4P9SA 4P2FA 3W8PA 5ETQA 3NWRA 1FNOA 3PYEA 2R4FA 2DNPA 1KHWA 1PBUA 3DGPA 2UVVA 4X64F 2HMIB 2BJ1A 3SFUA 3KG4A 1FK9B 2RU9A 2J6UA 7FD1A 4F3OA 1VJWA 3VF0B 1U2CA 5KFWA 2BE2B 3MEKA 3W66A 4RNNA 5L38A 3OTOF 4NXNF 1YRXA 2M5YA 1TV6A 1RHJB 2F5GA 1SL1A 5KFUA 1WKJA 3SYZA 4HT5A 3E3XA 3TR5A 1S0VA 4PZVA 3D3CJ 2L9NA 4ED7A 3MOJB 1M5SA 4FDFA 2BM1A 2CAJA 4DV4F 2JWNA 2BJ3A 3PCOB 2HBZB 2FHKA 1DTTB 2DH9A 3GE9A 1BGXT 2CIMA 2DO4A 2WW8A 3M2VB 4HVZA 2OSQA 4NI2A 4V19X 2PDAA 3CCZA 2J0XA 1SVDA 4KQZA 1N6QA 1JXLA 1VQ4S 3ZZZA 1VRUA 1HBUA 1NHUA 3PW4A 1YIJS 5KG5A 5D0HA 3GG1A 3ZNJ1 4B9SA 1QUVA 1U0HB 1WG5A 1S1TB 4CQ1A 3D54A 2GQQA 1RTJB 3KFWX 4QR2A 4BC7A 2HBYB 1RWVB 2VG5A 2KM8C 3JSBA 2R8IA 3FNNA 5A8WB 1FE0A 1FWPA 2HFUA 2C1EB 3HCXA 4IG3B 4MIAA 3IS9A 4PWUA 3RGIA 1TMJA 2MSTA 2HHSA 3MECB 4AQYJ 3V6KA 3BKFA 1YZ7A 2UUWA 3VVTA 2OKQA 1ACMB 1UETA 1PC5A 1T9UA 3LP2A 5D0RA 2B9EA 5LSRA 3VAGA 1NKBA 1S1WB 2F4FA 2V4RA 2WRMA 4J9MA 2HYIB 2YKNB 4O0NA 1X4EA 4OLPA 4P71A 4CNZA 1RHKB 2L9WA 4EO8A 3OTOJ 5CCLA 4ECXA 2XY7A 5D0GA 2CNNB 4XK8C 2IVFB 4GKJF 3ISNC 1CLFA 3G6VA 1WTBA 4DF4A 3SSQA 5AT1B 4J9VA 3ZZTA 3JQJA 1NBEB 1ZAVA 4F67A 1FNMA 2VBZA 3P5TL 4FN5A 1YGYA 3Q0AA 3G9CA 3RJMB 5F3TA 1LW0A 1NRKA 4WFYA 4A8KA 1XMOJ 2HK2A 2Z4PA 1TL7B 1SH0A 5B09A 1UEUA 2EPIA 3P6YC 2V8DA 4XPCA 3BO3A 3CCRS 3MCNA 1H72C 1V3SA 4RW8A 1ELOA 5KG3A 2R2SA 2AYGA 1VC6A 3NCPA 1VRQC 2HZVA 2FZKB 4TNOA 4TXSA 2KO1A 3GU0A 2CJKA 1JJHA 2N3OA 4DUZF 4C8YA 2DHSA 4IOBA 3W5XA 3JB9k 2OPQA 1RBAA 3RB3A 4K7QA 5M2PA 2EKYA 4EFAC 3I4PA 4IDKB 4KGVB 3J7YI 1WEXA 3I82A 3T3FA 3FBCA 3M2RA 3VVUA 2VF3A 3DLBA 4ED1A 1RT5B 2FLOA 2FGCA 2I6WA 2GX8A 1HNIB 1J27A 2MZQA 3PTWA 4P74A 3PKYA 1FKAF 1LFPA 1QSYA 1NB2A 1JKHA 5DDOC 1FO1A 2E5GA 1JLQA 2XULA 4FP9A 2ZVIA 5L1LA 4DV6J 4M94A 4ZPDA 3LP0B 4MFBB 2ZDOA 5IWAJ 5HQLA 2KHCA 2Z2LA 1D8ZA 2B3TB 3DFEA 3QT6A 4OIXA 1TUGB 4NMXA 4DG1A 2IBOA 5ETLA 5A76A 2XY5A 4C8ZA 4W90B 3QIPA 3UVJA 5LXRA 2I8EA 3HDSA 3PW2A 4QIEA 2XGQA 3G8TA 4FF4A 3QT8A 4O44B 4NYZA 2BQUA 3DN9A 3WQPA 4DV0F 4ZVFA 2DHGA 1CS4B 1MU2A 3BH6B 3I0SA 3PRVA 3KHRA 3R3TA 3TAMA 4LMZA 3EMTA 3W7BA 1MROA 4NCAA 1Q8LA 2FQQB 4K50A 4RUCA 1ZA1B 4FVCA 3CMQA 3GV8B 5JVGQ 3R6LB 2OIHA 4EUVA 2RHQB 4F0KA 4N5SA 2GVDB 3I9V9 1Y7PA 2CJXB 2HNDA 2I5JB 2M0GB 4O4RA 5HVGA 4TKTA 3ZZUA 3RW7A 4ZP9A 4R5PA 4LVNP 1YJNS 1T02A 1ZM4A 2MQQA 1SJ4P 2VDIA 5C2GA 3KHLA 2J0SD 4HLBA 4LREA 4YDXA 2H1YA 3UDCA 2VODA 3AD7C 4A46A 4WK1A 5J1EA 3VGSA 1R43A 2HBRB 2HZCA 3F41A 4I7FA 4QIGA 5F9NA 3CCVS 1OY8A 2LQJA 4DV3J 3RAXA 3M7VA 1FXLA 3MMCA 1Q1KA 3MR6A 2XLKA 2KZMA 4DWIA 3VQTA 1LEOA 3CJ4A 3D66A 2RF2B 1LOUA 2EI5A 1LWEA 1JJCB 1N52B 3TJ8A 4RWWA 2P8IA 1HYSB 2IM3A 2JNJA 1RAAB 3J81j 4U7UD 1UZDA 4K8RA 2D74B 1HNVB 3W9IA 4JV5J 3M6UA 1XR6A 3TX0A 3R5CA 1D8YA 2AYBA 3WZ0A 4EZ6A 2BQRA 3PV8A 3IC1A 1KTQA 3KLIB 5H9EK 2ZM6J 3OSNA 2OH2A 3OR2B 3ZNUA 3Q22A 2V2ZA 3CJTA 1F3FA 2QL5B 4P7VA 2CJBA 5JVHQ 3RB4A 2YWWA 5KFMA 3MXHP 4NX9A 1JLEB 1RT2A 1RTHB 5KG2A 2C2NA 3HULA 4NZ6A 4DEZA 3HJFA 4EBCA 3IFEA 3MR2A 1RAOA 4ZVHA 4B3RJ 4YHHJ 4G6VB 4WKYA 1YJUA 3NAIA 2R42A 3W64A 3BBCA 1FESA 2JVRA 3FCHA 4B3MF 2UUTA 3QATA 4PG5A 1IQTA 2GJ2A 2A2DA 4DR6F 1AROP 3ICLA 4ELTA 3GFXA 2IA6A 1I3OB 2FC9A 4TY8B 4DV7F 4OYZA 4DR6J 2EWHA 4WP3A 4E2FB 1EETB 3PACA 3B4DA 3D3BJ 2E5JA 3RAMA 4ZLNA 5HMYA 4B9NA 3H5SA 1X4BA 4KH0B 3Q8RB 2D3ZA 4YP3A 5HROA 3HXMA 3MAQA 5B0EA 1VQOS 1P8GA 3QNWB 3MM5A 3BF4A 4P6QA 5HQ8A 2FVRA 4TQSA 5D6GA 2F4VJ 1VQ6S 1NNDA 4KGMA 4BCAA 4EGLA 2R7TA 1OSDA 2H4YB 5LM7E 3O1LA 4WYWA 3TA2A 4ID5A 5HJYA 2XZDB 3SQGA 3MR5A 4LBIA 3ZZYA 4DS4A 4WFBQ 4CIOA 1VIOA 1ZAXA 3V4IA 2I1RA 3MEEA 2OPSA 4MT1A 4QIVA 1QAJA 4ETZA 1YZ6A 1S99A 2RU3A 3A12A 2Y8WA 2A3JA 3NWGA 2ROPA 1N36F 1UWBB 4B3MJ 2GMJA 2W4CA 1ZTTA 1U1KA 1IBLJ 1N48A 1AUSL 4PCQA 2U1AA 4M5HA 4M5DB 4ZPWR 2Q6CA 1TKTA 5D3GA 3W3SA 5A6PA 1RA6A 4DUYJ 3EVWA 3ILOA 3KNGA 2NPFA 4QCLA 1DAXA 4ZP8A 3TAQA 3KYLA 3DOMB 2QEXS 1XJWB 3MI7X 4QW8A 1PGZA 2WCXA 3ZFVA 2BDPA 2M3DA 3FZBA 3UD5A 4ZJQA 5JMNA 1NK7A 3IR6B 3OUYA 1Q5VA 2D7SA 4MYUA 1FCAA 2YNGA 5KFIA 1N33J 5IOLA 2EK6A 2CQDA 5DLFA 4NLXA 4EMDA 2GGPA 2IC3B 3NL0A 2FVCA 2ALYB 2C3MA 2CQ3A 3BZQA 1RP5A 2FLLA 1HD1A 2Q1LA 2JH3A 2BJ7A 2NXUA 3C46A 2UZAA 3ISND 2DRBA 4W98A 2DB1A 5HVFA 3CO0P 4K5SA 4KSEB 1PYTA 3TWZA 1S1VB 3LP1A 3O6QA 4IG0A 1F60B 2W8KA 3SV4A 1H38A 3KNAA 4RPFA 3J80U 2QFJA 1QE1B 2HG4A 2C3YA 3E01B 1TL4A 3Q89A 4NLUA 1TTHB 2R2TA 1VBZA 4MKYA 4NMLA 4ETXA 3DC2A 3LTOA 1C1BA 1Y10A 1X0PA 4LSNA 4RBVA 3U02A 1KTVA 2V63A 3BREA 3DXBA 3MM8B 5J2NB 4QWEA 1HW8A 5ETPA 2ATLA 1L5UA 3PW7A 4NLPA 3QJPA 1S0OA 4RL1A 1T94A 1TP7A 1U45A 4M5DA 2DISA 4FNHA 2ZH3A 1Q4RA 1YLXA 2WTFA 3AXMA 1U25A 2CQIA 2CPXA 2XSFA 4YS2A 4QWAA 2XC9A 1R6VA 5K14A 2E1RA 5F0UA 4RX6A 1L3VA 3CULA 5KT2A 3CEDA 4NZ7A 1R7IA 1I6JA 2QLBB 4CH7A 4YR3A 2H3EB 5DZ7A 1FRKA 1OO0B 1IQZA 4DR5F 5F8NA 3CXCR 4XPEA 4ZVUB 5KFHA 1DZ5A 2E5LJ 1CULB 3SDEA 1DBDA 3PG9A 3NEKA 5IV4A 1VQMS 3CIZA 1GX5A 4YUDA 1OQ3A 4OYOA 5B0DA 1S4EA 5KFQA 1S12A 3KK1A 2VBWA 4QR0A 2VL1A 3A8JA 4HHUA 5KFDA 2XMVA 2G2OA 1T95A 1S0NA 3R5AA 2D1CA 4OI3A 1MG7A 4RKUC 2AJ0A 1RAJA 2AKWB 2H5IB 2XWXA 5HI7A 4B3SJ 1VQPS 1WI8A 2SXLA 4B3SF 2K3IA 1PAUB 1RA7A 3LH2S 1UZHA 4JI0J 4N56A 2J9EA 4TY8A 4F26A 3MFHA 2D3O1 3HZGA 3Q86A 1KWMA 5DM6Q 2OTJS 4WZQA 4JI2J 4UT4A 4K4UA 4KHRA 2FC8A 1VHFA 2CNOB 2XI2A 1CSJA 3TJAA 3K8VA 4A8QA 3RTVA 2Z2ZA 1LK7A 1QSSA 1SJ3P 2BVZA 1KVIA 5IXUA 1NDKA 3OJUA 2FB0A 2DKOB 3CGIA 2C3UA 4NLVA 1W26A 1RTHA 5F9LA 1RHMB 2DGUA 4DR7J 1S48A 3T5LA 3PR4A 1S6PA 3NNHA 3M4XA 1F3VA 3DDKA 2QA1A 4DI6A 3OXLA 4GRSA 2MKHA 3CJ8A 1JLBA 5J2QA 1NZ8A 3W65A 1W2IA 1FNXH 1EQMA 1TQLA 4JI4J 1DLOB 1XMBA 2J0WA 1U6ZA 4KGKA 1OY6A 1PYOB 2EFPA 3QPIA 1FDDA 1SKRA 2UU9F 5EX0A 4IOCQ 3AJ1A 2VOPA 3I5BA 4OYWA 1U09A 3JAMU 4LF5F 3QRQA 4UY85 2ZKTA 3JSYA 1BHNA 4YEAA 3H2UB 1X9SA 5DETA 2UUAJ 3IMQJ 3H2VE 1DTQB 4CO2A 3R1HA 2GNKA 1GXLA 2FZCB 2HHXA 2ZE2A 4DDFA 3SXLA 2E66A 1GMVA 3MPVA 2EFQA 1K0VA 4P73A 2ADBA 4CLLA 4DUTA 3MD1A 1DY3A 3KK3A 4E98A 4X4OA 2KT3A 4KHPF 3IAS9 2BKNA 3BM7A 5C24A 1OY9A 2GVDA 1XNQF 4FNIA 2KFZA 2RKIB 4RUHA 3O8WA 1RKIA 4QR1A 2IBKA 3MPYA 2ZITA 1RAFB 2HQDA 2JC0A 3BQ1A 9ATCB 3MTKA 4WYLA 2J0QD 2IM2A 1RHRB 3DNCA 3E8OA 1Q16B 4URQU 4JUZA 3TAMB 1FERA 3BKUA 4IFYB 3VALA 4DLGA 3OXFA 3N28A 3EX7B 2UXDJ 3LGHA 1VMBA 3KK1B 4U96A 1RZMA 2W4DA 4L6V3 1M5KC 4A8WA 3D68A 1RWOB 2DGSA 2QN6B 3TW0A 3KK2A 3MMJA 5IM0B 2Y1LB 4DBQA 2ZBCA 2F9DA 1SH2A 2PA8D 1Y3KA 2K06A 2AJFE 2AWZA 1FDNA 1X31C 3QIDA 2DR6A 1H2VZ 1PIEA 4IKAA 4WTYA 3CJKA 4CYUA 3M9OB 3V6DB 3I4HX 1CJVA 2N4CA 2YNFA 3EGNA 3M8RA 5M2RA 1IM6A 3T6BA 4JV0A 4EYIB 4QPTA 1R27B 1RWWB 1TU0B 2XSJB 3A8IA 1BY9A 2FLPA 3DM2A 2NSBA 3CJ0A 3LQVA 4F4KA 2W9BA 2ACMA 2VJVA 4KE5A 4NPOA 3CCQS 2A6OA 2ZUGA 2AJ4A 3JTOA 3PO4A 1B64A 1WKLA 3PHEA 8AT1B 3KG1A 1HNXF 1C1BB 4CRJA 1AFIA 5E3PA 4O3QA 5DG9A 4Q8EA 4WE1A 3TANA 4DV0J 1S4FA 2KN4A 2Z30B 2EVZA 5KG1A 2HVZA 2KU7A 2VC0A 4X4PA 1D09B 2ATCB 4NLYA 4X66F 2VG6A 1X9WA 1T03B 1YJVA 1VLYA 1WF0A 1FKOA 5E3RA 2QT7A 2NXEA 3EGVA 3NOGA 2RS8A 3MEGB 4JI0F 1F9HA 3OLBA 5D77A 2KTQA 2AZ1A 1UTAA 3KKFA 5L1IA 2HWHA 2DIVA 4HHJA 2ZBRA 1UVIA 1REVB 2GQ2A 5HK4A 1I51B 4ZJLA 4A47A 4BWJA 2H5JB 3JAMY 3GR0A 2AW0A 2YKQA 2UV8A 2QV6A 3C66A 5HSPA 2MQOA 3WDOA 3H98A 2IYGA 1VC0A 3ZZ0A 4X4QA 1T11A 2ZWOA 1OYDA 2V67A 2IAJA 3MEDB 4LFAF 3R2DJ 1FVSA 2IJNA 4DPOA 1UEKA 2XO7A 3ET6B 3QYYA 5D3GB 1V5IB 1JLFB 1GNKA 4H4MA 2XCPA 4K4YA 4OZ5A 1KKHA 1VIXA 2ZJQQ 3KTQA 4Y28C 3KLEB 3G6XA 5BYSA 3KG0A 3TEHB 4CLTA 1RTJA 2AEFA 4KRWA 3MURP 1QVFR 2MKJA 2E7VA 2RRBA 1ZAWA 1RB0A 2N4DA 4HYKA 4OZJA 3GV5B 1FJGF 1D1UA 1X4DA 2GIQA 4WIQA 1HBNB 1VQLS 1P1TA 2HWTA 2MXYA 2DXFA 2YH1A 1WG1A 2WONA 1Y5LB 4NI2B 4NLDA 1JXVA 4DHVA 2EK1A 4ID5B 3W60A 1F6TA 4IFVB 5B0BA 2HHHJ 2I2YA 3I0RB 2HVEA 2OP5A 1UWAA 2FHJD 1ZPWX 5DQHA 2JRSA 5GAHU 2UUBJ 2XMJA 1WEYA 2G9OA 3C16A 3LALA 2WSCC 3VCDA 4UOCA 4K2XA 2XZWA 5I42B 5L1KA 3ULHA 1U0SA 3DI6B 3R1LA 1IJFB 1DFDA 4ZLJA 3F73A 1YVFA 2PC6A 1S6OA 3MPWA 4H4MB 4WIIA 3P8BB 3ET6A 5KT3A 2NLWA 4WK3A 4WKRA 1L3SA 1H73A 2V2KA 2Z8QA 4TU7A 1R8HA 2ILYA 2MTLA 2V8HA 3M32A 4UOFA 3KLFB 3HSZA 4I69A 4QWCA 2KXNB 2CDRB 3Q8PB 4YDDB 6AT1B 1RLCL 4NWBA 3AJDA 4X4VA 4O3PA 2KKHA 1JX4A 5H9FJ 2XNQA 2CQ0A 2JFKA 3G2XA 3H8YA 2FJXA 3AH6A 2RMLA 4LF7F 2CKWA 2BABA 1RUSA 1R0BG 2WZ1A 4UOHA 2GAGC 3MOZA 5F8MA 1PG5B 4DV1F 1LW2B 1M5VC 2F9JA 2AMCB 2MLYA 1JLEA 3P3DA 2F3JA 2HWIA 2NS1B 2Z57B 2BYCA 1KOOA 1I1GA 2OD6A 1REGX 3MGJA 4GVLA 1AZSA 1Q8KA 4PXEA 3OLAA 4DR1J 5GMEA 3KUHA 1CQNA 2A10A 2DTJA 3K17A 3KLIA 4ZPAA 3H0PA 1PJ6A 2HPUA 2OO4A 3I32A 4LJMA 2KXHA 1HNZJ 1LKZA 4LIWA 3K5LA 2C2MB 3HJVA 3JTNA 2FVSA 3K89A 2V6AA 3O3LA 4Y34A 2C2KB 4FPIA 1I94F 1FD8A 5GAEU 1VI7A 3GCWP 3A3OB 2W9BB 2WOMA 2O1PA 2OLWA 1A7GE 3EICA 4I2PB 3O5TB 4HH0A 2NUHA 4DZDA 3MR7A 4CCHA 1Y3JA 3A3PB 2NPIA 1HPZB 2OEMA 3D6HB 3LAKA 4C7QA 4D3HA 2HGMA 4EI2A 4F7VA 3CCMS 2MLZA 4B9TA 3QGHA 2CADA 2LQ9A 2ROEA 2YKMA 3BH7B 3GG0A 5D15A 5AE1A 4CZCA 3D2WA 3H4DA 2AGOA 1RTDA 5J1EB 3V6DA 4V1Ak 1VDHA 4M95A 4WU2A 2VA3A 1U26A 3GJSB 4LF1A 3UPFA 1M0SA 2CQHA 5JJBA 2KL8A 1LK5A 1U2FA 1LWCA 2HLUA 1K8AT 3DOKA 3QFHA 3V2UC 4TYAA 4J9OA 2RE1A 2V4JA 4A48A 1VR6A 2OHDA 2HNDB 2I5JA 4ZP6A 3P4UB 2ZH2A 2XMUA 2VBYA 3IP0A 1S97A 2L3MA 1WOPA 2LEAA 4J37A 2GHWA 1R89A 2O66A 4ZPBA 5LMUF 2BV3A 3CDUA 4HHHA 4DLEA 1GAOA 1UJ4A 2BKOA 2M9KA 2HRYA 2XHCA 3H2LA 4UTGA 4F0MA 1MU2B 1MW7A 2AX1A 4O3OA 3CMAS 2LU2A 3CWJA 1Q53A 2E9TA 3QMQA 4WXWA 1S77D 5GAEI 4H4KA 4EK2A 4QIFA 2FUG9 3K57A 3UDLA 4QZVB 3Q8YA 1RAHB 3P49B 5CCMA 3GQCA 3G87A 3HSDA 1FF2A 4ZHRB 1WACA 2AGPA 1S0MA 1FJGJ 1DTQA 1FD2A 2DNNA 3HHEA 2IMOA 3BR8A 1LWFA 1N0UA 1TKXA 1U6FA 2DCLA 2B5JB 1O0PA 2DNRA 2HRTA 3IM8A 2YKMB 1TVRB 4I2QA 4LF2A 4MIBA 5HL7Q 3QJJA 2VBXA 4ITSA 3GJTB 1M1GA 2LQBA 4JOUA 4X84A 5JXSA 3MPDA 3CCLS 4DV3F 2HQFA 3QLHA 1U1PA 2RVJA 2CNKB 4RO0A 5HQMA 2O3DA 2LECA 1LNQA 4H54A 3GYNA 3KLVA 3D0HE 2LQ8A 1DARA 5B08A 1M90T 2CVEA 4U8YA 4OQJA 1O51A 3QJLA 2ZJRQ 2B4VA 4ZVGA 3TX8A 2GW8A 1TR0A 1NMEB 3TVZA 1BQNA 4Y2AA 3FRYA 4LRBA 1GFWB 1FEEA 1HFEL 3KJFB 1S6PB 4DL7A 2B43A 1LW0B 3LO3A 1SCJB 4FS1A 3B4MA 3C6TB 3DGVA 2BW7A 2JJ4D 1HBOA 4RUBA 3LUYA 4H4OA 5KFAA 5D4NA 1HBOB 1B99A 1QAIA 1AB8A 2GVZA 3C6TA 3CPWR 1UPPA 2V34A 1MWQA 2AF6A 2ZEJA 3VAJA 2FVPA 2WSFC 4I64A 1ITPA 3FSXA 2HFNA 4DPUA 5DDPC 3BGUA 3LAMA 1MN7A 4LFBJ 4PXDA 3V6HA 1YWXA 2FLNA 3AOCA 1ROFA 3HVTB 1FRIA 3G86A 3K8WA 5AXNA 1GMUA 4PKDB 3KLFA 5J1PA 4KTQA 4LFBF 4DOZA 2Y1JA 3DLGA 4F50A 4HKQA 1U1QA 4ANCA 5BR8F 1P27B 1UFWA 2C2ZB 4RW9B 1YTYA 4K4XA 4IO1A 4JV5F 2DY1A 3DI6A 1GXUA 1QAYA 1VCTA 3QLHB 4ATNA 4JI6J 5HANA 3F56A 1S1TA 3BR9A 4ZIWA 1NK6A 3HLUA 3ENAA 4JI6F 1WOSA 3GCXP 1BE4A 4ZMMA 2B5JA 4I2QB 1FJCA 1HBUB 1VRTB 2RQCA 2Z2YB 3RBXA 3FRZA 3W61A 4IFVA 1Q8BA 4NASA 3KJVB 3T1YJ 1JLGA 2MHEA 2VPZB 3D6MB 4OZ0A 5B7WA 2IM0A 2KRRA 2Y1RI 2BZ2A 1JLAB 2K7KA 4FYDA 4OX7A 2B8PA 2X7IA 1GXTA 1N54B 1WHYA 1B70B 4USKA 5K14B 1MMNA 4ZK7M 2ZC4A 2B9WA 4C9DA 1IKYA 1G2EA 2QRRA 1WDDA 5T14A 3CCES 1WELA 2HIQA 3W2VB 3UNGC 1TV6B 2GMLA 3D4JA 4C8NA 3KUEA 3NMRA 3NRBA 1EX8A 1O5JA 2UV8G 4UUXA 3QBCA 3H5YA 1U6BA 1HMVA 4ED5A 1BWEA 1YRUA 1WC1A 4DV7J 1CJKB 3C8YA 1Q78A 4KT0C 2RQMA 1N5TA 2CJ9A 2F8EX 3G71S 1BQXA 4UY8T 3RRHA 3MUTP 1SI9A 1CC7A 2VH7A 5ETRA 5FJ4A 4ZITA 4RU9A 5IT9Y 3DRXA 1TL3B 1U7LA 4ZS6A 4PWWA 4J9UE 2MGZB 2DGVA 4ANEA 3ELHA 5E2QA 1VS3A 2HNZA 2V8GA 1GX6A 2A2CA 1VC5A 4C8LA 2HHQA 4LQ9A 5ETVA 1DQ8A 2O5DA 2W7AA 3D6TB 3IG1A 1U4BA 1REVA 4F8RA 1HQUA 2ILZA 5HMWA 2V4QA 5KFGA 3FFIB 4RW4A 4AL6A 2QJ3A 5L8RC 2WOMB 3JYTB 1RT1A 3PEJA 4C6AA 1FWLA 1W7WA 4KR0B 3OT9A 3FBBA 2FPHX 4WE1B 3I56S 4LFCJ 5HAOA 2DR5A 2ASLA 3Q24A 1RT7A 1WI6A 4PQUA 2DY9A 3I5AA 1FJ7A 2JC1A 1N32F 2WVBA 3AT1B 3Q2TC 1TKTB 5GMKa 1NJXA 1B0PA 1KBRA 4A8MP 1SPBP 1Y0HA 3TO8A 4DN9A 2QA4S 3T1HJ 3ADAC 4MJKA 4A4JA 2ZBQA 3AB2B 4P75A 1M5PC 1RHUB 3UDVA 1UWBA 3VR1A 4Q43A 4NLQA 4ZPTR 1CJVB 3UI3A 1F5AA 1RADB 2OPSB 2W2OP 2DCUB 4PABA 1U8WA 3HPOA 3SQOP 3MFIA 1ZZFA 2JLEA 1FDAA 2CQGA 2CG8A 2MGZA 1K1QA 4USHA 4HI1A 1IKVB 2OPRB 3F44A 5IM0A 3TI0A 1IBKF 2OSRA 4L3KA 2VPWB 1URRA 4PR6A 3HHNB 4RR5A 2HAIA 4PEOA 2QA4G 3RBDA 3FMWA 3D67A 2FHOB 5CYMB 3MM5B 2YWGA 1NB7A 4MMOA 5EWFA 2XB2D 5K8MA 1RABB 3M2UA 3KHGA 3N5FA 1HKAA 4ZCKA 4EZ9A 2Q43A 2GIFA 4A8FA 1KONA 3PRBA 4R0JA 2BR0A 1WKKA 2VU5A 4KV8B 3W2VA 1UA1A 4NXMF 1EETA 2A0FB 2HS3A 3KJNB 4Y2MA 1HBMB 2WBRA 3LW5C 5C24B 2DEIA 1IBLF 3J7A1 3AB4B 3AHPA 2DD8S 5DO2A 1KQSR 3KK3B 5KTQA 2F4VF 2QL7B 2AYMA 2JOQA 5IC4B 4LSLA 4UZCA 3F0NA 1NZAA 3T41A 3J81Y 4LF4F 3ONQA 2Y8YA 3AFGA 1RAGB 1IR1A 1IJEB 1PAEX 1RWXB 1S1XB 2H5EA 3CJ2A 3MZIA 4PPDA 3PXGa 1TKDA 1Q7YT 2W4PA 2R8KA 1B4SA 3OTDA 4ZN1A 5DQGA 4R8UB 2FJBB 1D0EA 2ASDA 3MD3A 3KLEA 5MLCV 3FUYA 2W7OA 1XBWA 1IXKA 1G4CA 2P6TA 1FJEB 4RW9A 2QA2A 3QFWA 2L48A 4Y2CA 2LEBA 1SIZA 2FHMA 2KVIA 4U8VA 5GMDA 2DGXA 2ZH1A 1M5HA 1FX2A 2Z58B 2IAJB 4Y65A 3N6NA 1K9MT 2XBPA 2ZBPA 3G4SS 2P6SA 3Q2SC 4LR8A 2WW4A 2E9RX 2J9DA 5HMXA 1D9DA 1UJ5A 1AXQA 5DDRC 2UVUA 1UVNA 1WC0A 3N9UC 4YQWA 1VQKS 2R7OA 4HTIA 3FEZA 2HHVA 4RNMA 1RU2A 1FX4A 2GA7A 2K1RB 4MTPA 1S6UA 3PHTA 3QGPA 3S01A 3H20A 3Q23A 4M5KA 2R7XA 3DOLB 2P2CB 4DQPA 4FXDA 4OHWA 5F41A 3WX4A 3MF5A 4USUA 2VV5A 2MPUA 4WU3A 4BHQA 3M8SA 2UXDF 3N6LA 5AXLA 2AGQA 3KWMA 5IQQA 4F4XA 1TK8A 1QM9A 2D41A 4DX8H 1KVKA 2HHPA 1B7YB 4UQTA 4C0HA 4KKOB 3PO5A 3BGRA 3R8YA 2LCWA 3Q83A 1QAXA 3AQPA 5IQ6A 2WVCA 1BD6A 2QSWA 2QTWA 5GAGI 2LKZA 3ITHA 1W2BR 2V2QA 2ZFHA 3L9ZA 2J9DE 4PG4A 3A8EA 1Z2LA 1OYEA 1IKWB 3OQ2A 3TVKA 1M1KT 3R6GB 2ZJPQ 1AT1B 3I87A 5KFLA 4AUKA 2R2RA 3DRRA 4DSLA 1N36J 3FKBA 4FKXA 3UCUP 5DM7Q 3EGWB 3K7RA 3UR0A 2MZRA 4O4GB 1RAIB 1WDTA 1YKWA 5AJ3F 3M9NB 3GIJA 3SDEB 4YY3J 3HI9A 1H6KX 4LF6F 1NLKL 1RI7A 2BJ8A 3W2WA 1LWFB 3Q8VA 4OZ3A 3QZ8A 1U1NA 4FBUA 5HP1B 1TL1B 3U1MA 3FCWA 3GB0A 4B3TJ 1EZZB 2MLXA 3N5BA 4ZHRA 2PSZA 2M4MA 4TLQA 3PR5B 3SV3A 2FJDB 4NLGA 4GC7A 4MFBA 1TL1A 3VGVA 2YVSA 2BOAA 3DU5A 2JFDA 2YKOA 1SC3B 4HDHA 4B3TF 4DL6A 1N5SA 1RBOB 4LT6A 1XMOF 1VQNS 1RCXB 4RBUA 3THPA 1R8CA 5DG8A 4XIUA 2IRXA 3OVAA 4RBTA 4DPWA 2BX6A 4OZ1A 3DRRB 5DRKA 2Z2MA 4OLOA 3M8PB 1N34J 3PY8A 1U8SA 3K5OA 1IKWA 3D1OA 3N0VA 3LWMA 2M8DB 5F8IA 8RUCA 4IRDA 1RCOB 3M05A 2VQFF 4NA3A 3MM8A 4K4TA 4JP8A 4C97A 4IOAQ 2IDEA 5J1NA 5CQGA 3OTEA 4KKOA 2AEJA 2CZVC 2PEHA 1X8DA 3E01A 3SSSA 1LWCB 1MNEA 2NYHA 5E0OA 4F4ZA 2RQKA 1RKJA 1TL7A 4K2JA 4NA2A 5SUHA 1S1VA 3LP1B 1SJ1A 1Q79A 3CO9A 2B9XA 1QTNB 2Q3PA 1WC6A 4ERDA 2M52A 3P5BP 1U1RA 3DOLA 2CJYB 3PW0A 4N7TA 3OHAA 1OWXA 2C3OA 2JX2A 5AXMA 1YJTA 1Y11A 2V0NA 1LFWA 3DMJB 2COLA 2CXEA 4ILRA 4ICLA 5D4PA 4I0WA 4OHXA 4DPXA 4X65F 4CO5A 1XIQA 4DFKA 4NLRA 5MAOA 4B17A 2YKNA 5EWEA 4I67A 5KFXA 2QX0A 4MKAA 5KG6A 2VIHA 4NRUA 4B08A 3OFEA 2RRAA 1RBLA 3ETOA 2YWKA 1PYSB 5HN0A 3QT7A 4LBHA 5KT5A 1S7IA 1LWXA 2WBMA 2X3DA 2ZC3A 4IH7A 4M1KA 4LFAJ 2P9EA 3MUVP 3BO4A 4S0MA 4HI2A 1UFLA 4LRAA 1ZM9A 4RZRA 2DNYA 2IRUA 1S1UA 2VG5B 1SC1B 4Y6IA 5KT4A 3Q8QB 3FQKA 1O6XA 1APSA 5IZHA 2PD1A 1R8BA 2AT1B 1RGVA 4NL5A 2M88A 3OFHA 5CYJA 1LQ9A 4ECQA 2R7UA 3G8QA 4ZN3A 1UAWA 4L75A 5KG0A 3BBBA 1CJTA 1RU1A 1S1XA 1HL6A 5CHCB 2HVDA 2MJNA 2KJWA 3PM9A 4WFNQ 2XLIA 3THTA 1NUEA 2OEJA 3M2VA 4LSLB 5E41A 3NGSA 3E51A 3GIKA 2GHVC 3LOUA 3MPUB 2ZH7A 1FXRA 1T3NA 1CVJA 5D8HB 3W8GA 1CEZA 1NPRA 1FKPA 2NXNA 3NXZA 3T9NA 2P9CA 3BPDA 4LVOP 4KV8A 2BM0A 3PYFA 1XR7A 4PPZA 3CCJS 1J5EJ 2CQPA 3VHQA 3PVXA 4PG8A 5K20B 5C7PA 2C2EA 1XNRF 3TA0A 4K4ZA 1Z1ZA 2LXFA 2VPXB 3OL9A 2DR8A 4FF3A 3BN4A 2IHR1 4CO1A 4OI4A 4NLWA 2QC3A 4WP9A 4U6PA 4WF9Q 1GT8A 2IIHA 2E1AA 3NNCA 3NNAA 1SJQA 3CVKA 1BWVA 1X5OA 3FSYA 1SC6A 3U7JA 5IT4A 5EWGA 3CT9A 5DJBA 2FZGB 1HBNA 2CQCA 2OMLA 3FGVA 3NS7B 1Z4UA 1ZS6A 1T9TA 1KFDA 1AUDA 3CCWA 3WX8A 1SQEA 2I0XA 4HL9A 5JUMA 3OV7A 3G8SA 3C2PA 2C3PA 3OBIA 5GVQA 2Q6BA 3RR8A 2CVIA 2RDJA 1UA0A 4WFZA 1FDBA 4YB5A 3R2CJ 3FK4A 3VAMA 2I38A 2YWEA 3HHDA 5ETNA 5KFVA 3HFZB 3K2YA 5CA5A 1EAYC 2VD3A 2VDHA 1PBAA 1EARA 3P96A 5ETTA 4PQUB 1CQMA 1QUPA 1FE4A 2BEFA 5C25B 2NZ4A 4X4SA 3EPGA 2MKYA 1K1SA 1HNVA 1NDCA 2KH9A 1J5EF 2DGQA 1HR0F 1FA0A 1IBMJ 1C0UB 3G96A 1SJFA 1NXIA 2R8HA 2AV5A 1IR0A 2RUSA 3JYTA 4OX9F 4IG0B 3PX6A 4CWBA 1KOHA 2C2OB 2DRDA 3EXCX 3IRWP 1SH3A 1TUVA 4J9PA 2M7SA 3H40A 4F02A 3HHKA 4M5MA 5D4OA 1HNWJ 2RT3A 3ZO7A 4CLZA 4DR2F 2EFNA 1NM2A 3MEGA 4C8OA 1KN6A 1GTEA 2PMHA 1PJ7A 2G0IA 1IN0A 4NEYA 4J5OA 1QJHA 4YFUA 1RYRA 1NHKL 5H9FK 1R8PA 1FFSB 2KDOA 3HFVA 4R5PB 1VK3A 4ZVEA 4DPYA 3L95X 1MMLA 2OUGA 1YJ9S 1JQGA 1A6LA 4P52A 2A1BA 3CJQA 1Q5YA 3FDSA 4DX6A 4B9UA 2I9SA 2RS2A 2POKA 2CPEA 4KY3A 1K0TA 4Q5VA 2RIJA 2MKCA 2EXUA 4J91A 1Q7LB 1NAQA 4G1IA 4OJHA 4DU8A 3HMJG 3TA1A 1RWPB 2K2PA 2XSJA 1M1HA 2HSEB 2R7QA 3QSIA 2EG1A 2DH8A 4B9VA 3J7YU 3RAQA 1IKYB 4XDCA 4FS2A 2DYAA 1B0VA 2LA6A 4QJVA 3UQSA 2MQMA 3QIPB 1S76D 2XS5A 4HDGA 4OHVA 3OSPA 4O3SA 2P5VA 4NA1A 1JLAA 2ROGA 4NLTA 2KG0A 4EBEA 4MK7A 3V4IB 1HNXJ 2CQ2A 2RH3A 1JLGB 1RSCA 3FZ2A 4OI1A 3UDEA 4P2SA 2HBQB 2RRNA 3GLJA 3M9MB 2ZM6F 2R7VA 3GSIA 2C28A 4MH8A 3W2WB 2E5HA 3GFHA 5KFOA 2V9WA 2A18A 5IT0A 2ZZMA 4O4GA 4ZCMA 4Q7AA 1VISA 3GYGA 3M2RB 2HLTA 4OYMA 3U1LA 2QMWA 4LRFA 1FRMA 2DNZA 4TVAB 5LOQA 2JLFA 2IA0A 4L76A 1C4AA 2R9LA 1VQ9S 4LF9F 3BDEA 2EC2A 1WHWA 4X62J 2ERRA 5IWAF 2VZ9A 2HURA 3BN7A 4DZ6A 2BW2A 3TUIC 2FGOA 3PJ9A 4BC9A 9RUBA 1XN9A 3V5RA 4MKBA 4DV1J 1NKCA 4IRKA 5T41A 3J80Y 1R3NA 2JEJA 4LF8J 3HVTA 2HS4A 1NPPA 3HVWA 4NLOA 2GJIA 2BE9B 3FCVA 5A6WA 5ADZA 1EQ0A 4RW8B 3GV7B 4JI8F 1X4FA 4DL3A 2HIYA 2FJWA 1ZM3A 3C14A 2PMWA 3P45B 2ZE2B 3W5YA 4DV2F 1F2GA 5EDWA 5BR8J 2EFGA 1KHVA 5KFCA 2D3OR 3QO9B 1RDRA 2AJ2A 3NLCA 3UWTA 1NK0A 4NXMJ 1U1MA 2DEJA 4M8LA 2NCKL 4H4OB 4AT1B 5E7OB 4DCOB 5F3ZA 1Y9OA 2OGUA 1MSWD 3IWNC 4OI6A 4B02A 4DX5A 3QSYB 5E3AA 4A8YA 3R27A 1U24A 2W25A 3BSAA 4FKYA 3IWLA 4I56A 4QW9A 2FVQA 4M5GA 3MR3A 3VAKA 2VICA 4Q8FA 2HFSA 1BQNB 1RT6B 4JI7J 2UUCJ 2M70A 3HVRA 2D9PA 1X4CA 3EDRB 3N4WA 5J2PA 1NHVA 2MQNA 3MMBB 1ZTWA 1JLBB 3M30B 4N77A 4YB1P 5J2QB 2XZTB 2PFFB 1R6YA 4GKJJ 4WBFA 2YQ3A 2XMWA 2DNOA 1QTMA 1HYSA 2V2VA 3ENVA 2ZH8A 2DH7A 2J5AA 2RF2A 4ZP7A 5U47A 4R8UA 3S1TA 1U0HA 2DHAA 3PNIA 1U1LA 2AIRB 3CB4A 2CYYA 2GHPA 3RG6A 2WHOA 3ZXWA 2NYIA 1V9OA 2G2YA 3DLEB 3R7SB 5L1JA 1JNRB 2YPZA 2OJ3A 3VZIA 1VQYA 5DGBA 2XM3A 3JSMA 2XY6A 5KFEA 1N6QB 1CG2A 4DSIA 3DU6A 2CFXA 2H54B 3OJSA 1OIAA 2IFXA 2FYXA 1HNWF 1PC4A 3EWGA 2BKPA 4DUZJ 4WP8A 1S57A 2H9ZA 1VHIA 2WB1D 3KLGB 1HBMA 4P2XA 1XR5A 2ZOFA 3IBCB 3LPEA 3OFFA 5HJXA 5IC6B 2E44A 1H74A 3L4BC 2W2PP 5AE3A 3V81B 1KD1T 2MZTA 2FY8A 2B7CB 3JQKA 4KPYA 3EGZA 4UW2A 2KI2A 3H59A 5L39A 1YBTA 4ES3A 3BYPA 3M2UB 1A0OB 1GMWD 1RT4A 2L08A 4IH6A 1LXJA 4YB6A 4PWDA 1T0TV 2FHJA 3ZC4A 4DPTA 4ECTA 2E7XA 3D6FB 1CULA 1QSLA 4LQ3A 3IRXB 3I9ZA 2Y0BB 3L7UA 1RK8A 4ZVQB 2PA3A 3RU0A 2OPRA 5A2QY 3R5JB 2NREA 2E1MC 2QIFA 1F5BA 3M6WA 1NJWA 3UFCX 1KEKA 5LMNF 1DURA 2ZOGA 3T5HA 2R8JA 4Q0BB 4ER8A 4IUFA 3EE3A 5FDLA 2V9KA 4J9SA 3B82A 4OYAA 4I4BA 4G1PA 1HNIA 1U1OA 1QD1A 3DRYA 2Y1IA 1HPZA 2CJAA 3PJWA 3DKDA 4NLSA 4B9LA 1P9YA 3VAFA 4DL4A 2HGNA 2GIRA 3TZZA 4FBTA 4IDKA 3DCAA 3NS6A 3H5XA 2MZSA 5KOXA 2AU0A 1AFJA 2RDIA 1H7XA 1WF1A 4WFAQ 2CPZA 2D3UA 3AJ2A 5J2NA 2EC0A 1R0AB 4OMFG 1RT7B 3OVBA 2H4WB 2MDAA 1ULRA 3BV8A 1JK9B 1YSJA 5AXKA 1ZPVA 3U27A 4DR5J 2HK3A 2BQ3A 4CTAA 1RWMB 2OFHX 1KLNA 4ZVOB 1U49A 3D5MA 1RACB 4J9QA 2ZH4A 3V6JA 4C2MA 1YRTA 1H2UX 3QZ7A 1R31A 4DF8A 2JEIA 3K5NA 5FIIA 2VB6A 3OR1B 4OYIA 1T05B 2FIUA 4YB7A 3UD4P 1XC9A 1H2TZ 1XMQJ 1BXNA 3MM9A 4G65A 2K7JA 2BRLA 2F7VA 2VFVA 4OHZA 4OI2A 3ZZPA 5BJRA 2HNZB 2QLJB 2DBBA 1VJQA 2JZ5A 3AQOA 1RWUA 4IYQA 2R7WA 3H90A 1WUUA 2G13A 4I1TA 2C22A 1ZH5A 2XYHB 2ZH6A 2IY5B 2CQBA 5I3PA 4JI2F 2W01A 1CJUA 4PG6A 3LP2B 4QQBA 1NJIT 5D78A 4ALZA 5DQIA 3IS9B 3T6JA 3NMAA 2QYCA 1CJKA 4YR0A 4ED6A 2EW9A 4DSKA 3UN2A 1FRHA 2VKRA 4V19J 4M5NA 4YMEA 3A13A 5A8WA 3DRSA 2B8QA 4QBUA 2UVWA 4LFCF 1KRPA 4JI1F 4EO6A 3C16B 2LA4A 4CO0A 4NYOA 2VPYB 1UVJA 4GC6A 1SUQA 5ITHA 3J7ZT 4L73A 3PIOQ 2RJZA 1HWKA 3I0RA 5LSLA 2YWFA 3CUNA 4FYWB 2XYGB 2ZWPA 4Z7CA 1NK8A 2KYZA 1IWGA 1EP4A 1B0TA 4DUYF 1WG4A 2WONB 3ILLA 4ZCIA 4DQSA 5RUBA 1OPIA 3FJ2A 3QRRA 1HWIA 2JVOA 4DQQA 2IDLA 1VRTA 3NY0A 4XAKA 1F1BB 3T1YF 3HHLA 2BA9A 3HD2A 3RUBL 2DNQA 1BUXA 5LJ3Y 2M8HA 1A9NB 2HFVA 3K58A 2X1FA 4K59A 3PFOA 2XEXA 3AD9C 4IO9Q 2PEBA 2DXEA 3C3LA 1J5OA 4AE5A 1G3OA 1FI4A 1FK9A 2AJ1A 3DYAB 1L3KA 3LPYA 3DDNA 2B7BB 2RNEA 3QAEA 4U9RA 4ZVPB 1JMTA 2CZ9A 4LSZB 3OHBA 4PQAA 2YX4A 2XMTA 4CLWA 3IR5B 5CZXA 3MAAA 1S6QB 2J76E 2LXUA 5E5NA 1FHTA 2CQ1A 3SSRA 2XS2A 4NRTA 3MCOA 5M2UA 4QIWD 2XTJP 2DGOA 4USIA 4BDPA 2J9CA 1IM4A 4DMZA 2J6TA 2HQCA 2HVHA 2J7UA 3FQLA 2VFRA 3HHLB 4F36A 4JYAF 2DGTA 1CC8A 4JV1A 1RT2B 4DS5A 2DR9A 2QSFA 1S9EA 4CI0B 1S72S 1BQMB 3BSNA 1FKOB 3SIPB 2NUUG 2OMOA 2QMUB 3NS5A 4KIAA 1BMQB 4KO0A 5EX3A 1HNZF 3RR7A 2BE7D 2PO4A 3GIRA 3N79A 1JLCA 2DNMA 3WHIA 1N88A 1KP6A 1N33F 1MWZA 1UVMA 1NK9A 1WD6A 2FY1A 5K8OA 2CRLA 2WK4A 3N6MA 2VONA 3IA0A 1YK9A 2HNYB 4U95A 1U47A 2DITA 3MTJA 1LWEB 3DM2B 1S9GB 1C4CA 4P72A 5BYRA 4YOEA 3SCIE 2DNGA 4B3OA 3TUJC 1Y4ZB 3MMCB 2KYXA 2FJVA 4GO5X 4AL5A 5AJ3J 1H0HB 3I31A 3QRPA 3D0IE 3TEGA 5A8KA 2VHGA 4JI4F 4AFFA 1TAQA 5LXYA 5DLGA 1R0CB 2ZUAA 4ILLA 2QE5A 2QLFB 2ZHAA 3KK2B 1V3ZA 3DLKB 3HO1A 4Q2LA 4A8OA 4I6WA 5KAKA 5CD4A 3CDWA 1T05A 4ED2A 1Y5NB 2W2NP 3VV2B 5J2MB 3QWUA 1N5QA 4ES1A 2XMAA 2GC8A 4F4WA 1YITS 3LA0A 4W4MA 4IFYA 4DV5J 2IM1A 3BDPA 1RJJA 3HK2A 2V50A 2XG8A 1SV5A 1CS4A 2O67A 2Q79A 4L72B 2E9ZA 4WZMA 3UN3A 2KZZA 2GZOA 2RKIA 3X1LB 4OV1A 4DCJB 3SZ2A 2YPYA 1R0AA 2WVEA 1JIHA 4I6YA 5EGYA 1PO6A 3DOKB 3HZEA 2RAQA 4ED8A 1XNQJ 3EYZA 3M8QA 2NXCA 5KG7A 5ETKA 4OL8A 5A0YA 3JXOA 1X5TA 2ABYA 3KUGA 5HO4A 4M63A 1Q81T 3DHXA 4WJBA 3M1VA 4ECYA 1JKHB 3G82A 1RTDB 4HACA 4CH1A 2XS7A 4QU6A 4Q44A 2OAUA 2YQ0A 2B56A 2QGFB 3M8ZA 1RT5A 2IVYA 4Z37A 4ZVTB 1WORA 3N01A 3GFYA 5A0YB 4I2PA 4USVA 3RZAA 1SC4B 1TK0A 4O3NA 3UW1A 4LF5J 2GMHA 1UVKA 1HWUA 2CPHA 2KT2A 1KS2A 4CM2A 6FDRA 2ALZA 1DLOA 2OEKA 3V4MA 2PT0A 2HFOA 5A8RA 3J7Z5 4GKKF 3CNQP 1X9MA 3RB0A 1YG0A 3J7AN 3FEYB 4C11A 4R0EA 1SV5B 1RT4B 4PWDB 2LQ5A 1U48A 1AZSB 1NPKA 2RILA 4MIWA 4PXCA 4KHPJ 4Y00A 1VBXA 1RXOB 3PYGA 1TFWA 1YDLA 1LW2A 5B0AA 1KQGB 4J7CA 3V81A 1HHTP 4AL7A 3BS9A 3GSDA 3HKZD 3PYDA 2B6AB 2GFFA 2ZNYA 3KLHA 2ZH5A 2VQFJ 3D7SB 4A8XA 4O0IA 3RBEA 3W9JA 2UP1A 1MLAA 2ZDPA 3JSRA 3KDNA 4HH1A 2BJ9A 2AD9A 3TARA 1DJ0A 4PUOA 2LP4A 4TYBA 2B51A 4ECZA 1J2VA 5FLXU 1FTCA 2AP6A 3W5ZA 1T3OA 2YNIB 2K8GA 4QU7A 4UQGA 3MM6B 3T1AA 5K8NA 4ED0A 2UXBJ 1U2RA 3M32B 3OTCA 4W92B 3MECA 1SKWA 3CCTA 2HHTA 5KFPA 3TUPA 4B3OB 2BMBA 4FF2A 5IFMA 1S9GA 1Q95G 3AD8C 3MWBA 3BSCA 1E6YA 3X3UA 1NCLA 2WSEC 3PRDA 2V68A 2R2UA 4C3MA 4Y3CA 4C98A 5I42A 4OYBA 1VQ5S 2EBGA 3D1HA 3MCSA 2LU1A 3MMBA 5F8LA 4IR1A 4X4TA 4HT7A 2YNHB 4TLRA 4CLFA 4Q45A 1G6BA 2W2QP 4USWA 3R7NB 1JNZB 3GP9A 4DL2A 1HD0A 3KJQB 5CH7B 4CLKA 2VKZG 4R25A 4CT9A 2ZH9A 1SQFA 1WC4A 2CUYA 3POTA 4KYZA 1I94J 4OJGA 3BYRA 1BLUA 1ZBTA 2VG7B 1NJYA 2HZAA 1M5OC 1OSCA 3ZZRA 2KRBA 4X4UA 1QLNA 1HHQA 3QO9A 1PCAA 3NGUA 2J6SA 1GTHA 3CJSA 4IQXA 3BEGB 1F9EB 1D3WA 1RT3B 3CIMA 3M6XA 1DQ9A 4C0OC 4ZKAA 4ZLPA 2CPFA 3BSOA 1YI2S 2BE2A 1I5OB 2KG1A 3CD5A 4X64J 2AJQA 3MM7A 1JLFA 1NU4A 3KDOA 3MAAB 1RQ0A 2APOA 3NCRA 4PXBA 4TU9A 4J9KA 4AXJA 1VBKA 3BBFA 4TY9A 4LSNB 1PSDA 2Y0SD 4LF9J 4KGXB 1WNEA 1QY7A 2B4OA 3TJ9A 2CJQA 3MEDA 5KFRA 4LF7J 5GAGU 2D69A 2WVFA 2YX7A 4G1QB 4KAIA 1QE1A 2OTLS 2Q66A 1IKXB 1FFGB 3K59A 2F8MA 2LVWA 4O3RA 2VOOA 4YY3F 2W8LA 2DVIA 3EVMA 2XCAA 2LLZA 3RRGA 1N56A 1XNRJ 1ZOTA 3IGVA 3ISZA 1VYAA 1VK8A 3EVOA 3HT0A 5E3QA 1TAUA 4ED4A 1NSAA 1EKSA 1YX2A 1FFWB 1HHSA 2RSQA 2YNGB 1FRLA 3B6BA 2XLJA 1L3TA 2VG6B 4K5RA 1XEZA 2G0JA 2GS8A 3BGLA 3E2EA 2PI5A 2R7SA 2YX1A 1YBAA 3U1NA 3RW6A 1FTRA 3TNVA 3ZTSA 3IWXA 4KHMA 3VAHA 3UCGA 5LT5A 5HMZA 2FTRA 2IJFA 2GQCA 2HQ3A 4X66J 5IV3A 1HWJA 2DNHA 4ZOSA 2HHHF 2GCFA 4P7TA 4EYHB 3GR1A 1D9AA 3DRSB 4CH0S 1QVGR 1N8RT 2IMWP 1DHMA 2BANB 2C42A 3CD0A 4QWBA 2UUBF 1VGYA 4P10A 3SEOA 2R3VA 5K8PA 1N0VC 3GMGA 1RAEB 5FD1A 4QPXA 2MKKA 4DR4F 2YNFB 4ZDNA 2ASYA 3EDQB 2A6MA 1NDPA 2BACA 1CJUB 5E33A 3CJKB 4CYUB 2UVRA 3CCUS 4DR4J 3DDIA 1ZZNA 3JS9A 5DS7A 5KFNA 1S59A 2W24A 3CJRA 3QQCD 3S8SA 1R8AA 2IVMA 2XYPB 1HQEB 3SQGB 2ZNZA 5HVHA 4DFPA 3UD3P 1RTIB 2G0CA 1KNZA 2HHUA 3HP6A 4EEYA 3MM9B 2QMXA 3NG8A 5CAAA 3LWLA 5KFBA 1RTZA 3W63A 4JI5J 2DXDA 5BYQA 3JTPA 4F3QA 1HI0P 2MKSA 2E1CA 1VQ8S 5KG4A 4BWMA 1Q0NA 3RB6A 3IO1A 2UXBF 4Y2KA 2F1FA 5HROB 1YJWS 1IKXA 2YXLA 2B4PA 3VQSA 3VWSA 4DR2J 3KOAA 1C0UA 4FXVA 3TOQA 4G1QA 3ZZOA 4CTAB 3I55S 4PG7A 3EZOA 4KH1B 2KHDA 2OFGX 3EZ5A 5EN1A 4CT8A 5GAHI 1UP1A 2YQ1A 4C3LA 2FJEB 1SKUB 2YKPA 3HF5A 2J7WA 3US5A 5A2QU 4JB8B 3TUZC 1RT3A 1NKEA 4M5IA 4DR3F 3OVSA 1NSPA 2HGLA 2YH0A 3RYLA 1N5YB 1HR0J 4D3GA 4K4SA 4CNYA 2BUNA 3S6EA 2X1AA 2CWKA 4N47A 1WJ9A 3CE8A 4DR3J 2VG7A 1IWAA 1NSKL 2E5IA 3GIMA 4Q0BA 5D0EA 5F0WA 1X4HA 1KQFB 4KFBA 1B7FA 2Y3YA 3PX0A 2ZD1A 1WHXA 3NGRA 3AA8A 4DXLA 1KFSA 1UVLA 2G4BA 3OR2A 1OMSA 1F9FA 1T7PA 1C1CB 4J90A 1KLMA 2EEYA 4OJ3A 5H1SV 3KXDA 1EJ7L 1VQSA 2MZ1A 1FRXA 3GONA 4LR9A 4RW6B 4FPRA 3DLHA 3CJ5A 2U2FA 5HLFB 1X7VA 3NKYA 4PAAA 3BGOP 2OELA 3BGFA 2XQCA 3OL6A 3BJYA 1WSVA 2JLGA 4K0KJ 1E6YB 4DV6F 1WWHA 3EM1A 4NZ0A 2YTCA 3CC2S 2JEFA 1YBUA 5THWA 1SL0A 2DIUA 1NO8A 2EKNA 1GMWA 2HQGA 2CNLB 4DV4J 1FXDA 3GPAA 1HI1A 1GEHA 4I7FB 3MM6A 4OX9J 1TKZA 4U7CA 2YNIA 7AT1B 4RUAA 4WTOB 3GIIA 1UKUA 2DO0A 2J8SA 4Z7YA 1AYEA 4F4AA 3EXYA 3K0JA 3HVAA 4PYDA 4IRCA 2YY3A 1HI8A 1CJTB 4ZVRB 1TKZB 1IVZA 3C6UB 2KT5A 4DV2J 4JV2A 3VTIA 2XNRA 1SJRA 2HRUA 4RJVA 2CG4A 1NK5A 4X4NA 4FYVB 3QGIA 3OTBA 2W9CA 1WOOA 2ZKUA 3B54A 2RUGA 2RQ4A 3PKMA 3AA9A 3GWCA 2LEPA 2ZBIA 4JI7F 4I68A 1X60A 3M30A 5HLFA 3H7HB 2IPOB 4ZA1A 4ANDA 3TZYA 4RW6A 4E0DA 1RT6A 4DR1F 2CWXA 3LGNA 4OJ1A 3MAHA 4DG1B 3PX4A 4KPCA 5T7LA 4EWTA 3CDBA 3FBEA 3PEHA 2ZVSA 2LMIA 4KFBB 2VA2A 2C2RA 3B78A 3LP0A 4OYXA 1K47A 4FYXB 1IR2A 1VOMA 2VASA 4RLEA 1JLQB 1UW4A 5HBMB 3NGKA 1D9FA 4NXNJ 1E6VA 1KSPA 4ENOA 3G82B 3MMAB 5CYQB 2ZHOA 3NCQA 5EUHA 1K73T 4WWSA 4LIRA 4UOGA 1TL5A 4L3NA 2HW3A 2DPJA 2KXFA 4WFXA 2VJUA 4Q2MA 5B0GA 3WIUA 4XO0A 4JI5F 1UW9A 3L3CA 2OPQB 2EG2A 2XWYA 3PDNA 5D4LA 3HM9A 4ZPCA 4X4RA 2HVIA 3D0GE 2JHEA 4K0KF 3MDFA 2K3KA 2IYIA 1WSRA 1JXEA 4X62F 1L3UA 1HLWA 4ED3A 2Z0GA 1YHQS 4XTTA 4DSJA 2LDYA 2XI3A 2VFTA 3TZWA 6FD1A 1ICEB 2E7WA 1NH8A 4HR2A 3SBMA 4QOTA 2CA9A 5KFZA 5J2MA 3VZHA 2KFYA 3A4TA 4CLUA 3MMAA 5CYQA 3BPSP 3CJ3A 2OPPA 2IJRA 4RW7A 4DL5A 1JWWA 1XK8A 2MKIA 5HBMA 3TYTA 2GGPB 2IC3A 1X5PA 3IN5A 2LXIA 3GZ7A 2HKEA 2QG9B 3KMQA 5LMNJ 1GK8A 3WBZA 2WAQD 2DNLA 4O23A 4CO3A 4NEZA 5T7LB 3OUYB 2CPIA 5HP1A 3EJMA 3R5DA 1S1WA 4A8SA 4NCGA 2AYEA 4URSA 4CLSA 3WC2A 3GJQB 2W2MP 4LF4J 2DJWA 3DOMA 4OHYA 2PE8A 1G1XA 3ILJA 3VGTA 3BB5A 4KJIA 5KFTA 4C3KA 3TAPA 2N3LA 3LF0A 3AOAA 4OZLA 4K4VA 5KOWA 1MN9A 1JB0C 1O8BA 2QLXA 3IXQA 2HNYA 4AQYF 1LXNA 1HWLA 4YHHF 1SKSA 2KM8B 2MB0B 5H9EJ 1RYSA 4FZVA 2W9CB 4RU2A 2R8GA 4AD6A 3NP5A 4ES2A 2QO3A 1JLCB 1V3RA 4J9LA 3BGRB 2NR0A 1VRUB 2L41A 3MEEB 3PFEA 1KVJA 5KT6A 1KC8T 4KO0B 4DQRA 2V5HG 5L9NA 3AOBA 2HFZA 3W9HA 2H65B 1S9EB 1SXLA 4JBCA 2V94A 2WVDA 3R7BB 5B0FA 1XMQF 2Y9HA 3NGTA 1FRJA 2RHSB 1PKUA 2BXJA 3AXKA 3I6PA 3OFGA 1NK4A 3T5JA 1JJ4A 3TP2A 4CM0A 2K1RA 1NH7A 1X4GA 2X51A 1OS5A 1SB6A 2MY8A 2EBEA 3C15A 3ZTOA 1TFYA 5ETMA 4GO7X 4BBYA 1NEEA 4MK9A 3G6YA 1G7CB 3ETMA 3RBZA 2HMIA 2BOPA 1AW0A 3SFGA 3DGPB 3TRGA 5I3UB 4FYYB 4Y0FA 1SIWB 2MSSA 4HEA9 4WPAA 2LFVA 1X4AA 1KQKA 5C25A 3SMZA 4F25A 2DR7A 4N8OA 3FMBA 4PYAA 3D1QA 3DYAA 1C1CA 1P6TA 3ENWA 3FEXB 1UL3A 3MM7B 2CQ4A 4ELUA 3Q8SB 3M8WA 3UCZP 2UUCF 1W25A 3THVA 1ZETA 2F40A 2HS0A 1SQGA 1N32J 3HX9A 2OD4A 4OZNA 3IBWA 5CZVA 3WC0A 1TMMA 1RHQB 4GVBB 2MQPA 2EFVA 1YQHA 1S9FA 3T9ZA 4USMA 1N4LA 4CLPA 1N34F 3PJXA 1T8EA 3WIVA 4DU7A 5DDQC 5G0RA 3QAUA 4U67Q 2DHHA 1S79A 1WF2A 1XWLA 3NGDA 1CBKA 1AA1B 4ECUA 2MHNA 2C2DA 2YNHA 2LYVA 2YWHA 2JSXA 4YR2A 1SUQB 3DLJA 1URNA 5I3UA 2VFUA 3CDAA 4FF1A 3IAM9 1UEVA 3ENQA 1OPZA 4X2BA 2QZ8A 3H5UA 4IR9A 1TZ0A 5KFKA 4FXWA 1S7HA 4OV6A 1RLDA 2V8PA 3C15B 3VGUA 1H98A 3SI8A 2HHWA 1S5ZA 3CF5Q 1T9VA 3EUNA 1Q8IA 5CYMA 2DGWA 2AZ3A 5EHHA 4RNHA 1FKPB 2KB2A 4MK8A 1IBKJ 4QYZJ 3BKTA 3TZXA 1IKVA 2AHOB 4ILMA 2KVQE 2F65A 1HIYA 4XDDA 3SCKE 1C0TB 3KMSA 2P9GA 3C19A 2R7RA 1YJ7A 4TN2A 4QYRA 3IBFB 4LR7A 3UE2A 2RDDA 4OYPA 4CP5A 2IRYA 5BXIA 1F0XA 3FBFA 3H4BA 4JYAJ 1Q82T 3ILIA 1HARA 2B6AA 3KLHB 3EZUA 1WC3A 2W9AA 4LRCA 4M5JA 1P9QC 4OI0A 2CPJA 1UJ6A 1Y00A 2ZZTA 3T1HF 3GTYX 3CD6S 1MROB 1S1UB 2BANA 3HSJA 2G1HA 4IQMA 3UO0A 3NOCA 1XERA 4UUWA 4F3MA 3I0SB 4DJBA 2V8VA 4C11B 2DRAA 1NSQA 4F04B 4O44A 1T9WA 1Y5IB 2MZJA 2FDNA 2RB7A 3RRKA 4C0BA 2PGCA 4KC5A 2DHXA 1H3DA 3QT5A 3UVJB 5L46A 4NCGB 4BS2A 4DFJA 2M2BA 1B3TA 5CD4H 4B3RF 2E5LF 4ICLB 3L7PA 4Y2IA 3D28A 2JDJA 1EKRA 3DMJA 5LL6d 5LJ5Y 4QWDA 5C2CA 3HT3A 4ECSA 3CW2C 4DX7A 2OPPB 4RW7B 4HACB 1V5VA 2G2ZA 5FDLB 1VQ7S 3O2IA 2AQ4A 4G3IA 2FD2A 1VLOA 1ZYQA 5LSOA 4QYZK 4P2MA 2D9OA 5CABA 3R97A 4TQRA 1NDLA 4F2SA 2ZHBA 5KFYA 1GQEA 2QFIA 3AAWB 3GYXB 1TL3A 2GO9A 3HHLD 5B0CA 4J9RA 2QL9B 1RWKB 3JQMA 1CPZA 3IRXA 5KFJA 4M5LA 5ETSA 4AYBD 2XO6A 4K4WA 2VUGA 3HFKA 3R5GA 7FDRA 4LRDA 2XGPA 4ECWA 2N7YA 2AEMA 1TK5A 4NE9C 2MJUA 4GKKJ 1FEHA 1HMVB 1OQ6A 3M8PA 4C4WA 1UCNA 4E8UA 3PZPA 1TUWA 1H7WA 4DV5F 2MMYA 4KBIA 5DGAA 1RISA 3A3NB 4CO4A 4RWXA 1E6VB 5C42A 2HAFA 3KLGA 2Z56B 2KJVA 5CXTA 4LUBA 2GAHC 4RNFA 4JI1J 5I3QA 4RNOA 2CZ4A 4N41A 3I5CA 3POTB 2N82B 1Q86T 4URGA 3KJVA 4J9NA 3G6ES 1ZM2A 1FWKA 5A8KB 4LF6J 1U02A 3NBPA 3JSMB 4EBDA 2J8AA 3DLEA 3HD1A 1JJ2R 4DL0C 2BRKA 2DT9A 4YN3B 5G4DA 4ZPVR 2B0GA 1MWYA 1UFKA 2FJAB 3AY0A 2BJDA 4I6AA 4IG3A 1VFJA 1FVQA 3D9BA 1C2PA 2X1BA 3CDEA 4UF4A 3CC7S 3IM9A 3BQ2A 3W1YC 2B9YA 3OPKA 1ZA2B 3MHYA 3SCLE 2UU9J 3DLGB 3ITHB 5J2PB 1T9XA 5AE2A 2ASJA 3C6UA 2UXCJ 4CDIA 1EHWA 1WC5A 3NBPB 4DCPB 5F8HA 3CMES 3QWPA 3PW5A 3B8HA 5GADI 2MQLA 4MYTA 4DN0A 4PUOB 4KB7A 1DTTA 1IBMF 4ZCLA 3AODA 3OW2R 2GVZB 2W1BA 5K5MA 4ZJOA 5C42B 4DR7F 1PJ5A 3H25A 4F0HA 5I4MA 1LV5A 1KDNA 3TQEA 3BO2A 5DZ6A 2VQEJ 5F8GA 2X3GA 3DLLQ 2GJFA 4DSEA 8ATCB 4JI8J 3LGMA 3MCMA 3C14B 4OFZA 2ZOMA 3UNYA 3CCSS 1S6QA 4ZLLA 3GFZA 3O44A 4CLYA 2O01C 5A8RB 1RWNB 2G1DA 3T5KA 5KFFA 1KLMB 1WHVA 2DNKA 2MQ8A 2OI2A 4N8NA 1NJZA 2F8HA 1T03A 3FC9A 3QGGA 5F8JA 2LDIA 3OL8A 4FVMA 1J5OB 2ZD1B 2MY7A 3K5MA 3A8KA 2BJEA 1SL2A 2N7CA 4Z2XA 1Z2ZA 4JI3J 4X65J 5GADU 4NCBA 2YBVA 3W62A 4F4YA 2UXCF 5DG7A 2NZCA 1TVRA 1QDUB 4WXOA 3M1VB 1TELA 1TKXB 5FLXY 3VAIA 1N5YA 2J7KA 1HA1A 1WEZA 1X0FA 5ETOA 4N76A 2KFNA 3M8QB 1EP4B 4TU8A 2AX0A 2B4UA 2XMKA 1IUJA 2ACYA 1HQ2A 3L7OA 4C48A 2NSCA 3SCJE 2CPYA 1X5SA 4NYPA 3A1YG 1SBRA 4U7UK 3Q8UA 1FT8A 3IR7B 2H51B 2RD5C 3IGNA 2PI4A 2V69A 4IH5A 2CDQA 2MEWA 4MKVA 3UR3C 5K9FA 1F2HA 1XTZA 1YJRA 3R9LA 2EFOA 2PFDA 1RE1B 3DRPA 4C8MA
chains in the Genus database with same CATH topology
4NOHA 1KR4A 1N5VA 3T19A 3R5BA 2HQIA 2UUAF 1S49A 4HTJA 2DPIA 2CPDA 3DHWC 3PIPQ 3HKWA 5KFSA 4ECVA 4OX6A 1UMJA 2V4JB 3DLKA 3S7RA 2DK2A 2X1GA 4EU0A 1RTIA 3BQ0A 2MYFA 1C0TA 3OL7A 1HQEA 3GILA 4ECRA 2PIIA 3CD7A 3OXGA 5L9XA 2ADCA 3L09A 1PILA 3KHHA 2PMZD 1HW9A 3TVYA 3FSIA 3FVYA 3OR1A 3LANA 2PN6A 4DFMA 3HHLC 3CC4S 1WTFA 2XMMA 2YKAA 1BC6A 3TQ1A 2VC1A 3DRPB 2JEGA 3I96A 3M6VA 4H4KC 4B9MA 1MMDA 2W7PA 5KT7A 4ID8A 4DQIA 2WB4A 4MAKA 5IS2A 1VBYA 1DQAA 4C8KA 5C5JA 4JI3F 2VFSA 2QLWA 5G0RB 1RT1B 1BQMA 2ZZNA 4OX8A 3K5PA 1DRZA 3NAHA 3FFIA 4RW4B 3MUMP 5E3CA 1HQUB 4AXIA 3DXSX 2E29A 3IG1B 4WCEQ 2BBEA 2L9DA 4USJC 1S10A 2GO8A 3EPIA 1GH8A 4DSFA 4ELVA 1P1LA 2XHWA 2GV1A 4F2RA 1F5CA 1V6HA 4GMKA 3CSKA 3CTRA 5SZTA 2VQEF 2JL9A 1FNOA 2UVVA 2R4FA 2DNPA 1KHWA 3DGPA 4X64F 2HMIB 3SFUA 3KG4A 1FK9B 2RU9A 2J6UA 7FD1A 1VJWA 3VF0B 5KFWA 2BE2B 3MEKA 4RNNA 5L38A 3OTOF 4NXNF 1YRXA 2M5YA 1TV6A 1SL1A 5KFUA 3SYZA 4HT5A 3E3XA 3TR5A 1S0VA 4ED7A 2L9NA 3MOJB 1M5SA 2BM1A 4DV4F 2JWNA 2FHKA 1DTTB 2DH9A 3GE9A 1BGXT 2CIMA 2DO4A 2WW8A 3M2VB 4HVZA 2OSQA 4V19X 4C8YA 2PDAA 3CCZA 2J0XA 4KQZA 1N6QA 1JXLA 1VQ4S 3ZZZA 1VRUA 1HBUA 1NHUA 3PW4A 1YIJS 5KG5A 3GG1A 4B9SA 1QUVA 1WG5A 4CQ1A 1S1TB 3D54A 2GQQA 1RTJB 3KFWX 4QR2A 4BC7A 2VG5A 2KM8C 3JSBA 2R8IA 3FNNA 5A8WB 1FE0A 4IG3B 4MIAA 4PWUA 3IS9A 2MSTA 2HHSA 3MECB 3V6KA 2DVIA 2HHQA 2UUWA 4HKQA 2OKQA 1UETA 1PC5A 3LP2A 5LSRA 3VAGA 2HYIB 1S1WB 2V4RA 2WRMA 4J9MA 2YKNB 4EO8A 1X4EA 4OLPA 4CNZA 4C8ZA 2L9WA 4FYDA 2XY7A 1B64A 5CCLA 4ECXA 4XK8C 2IVFB 4GKJF 3ISNC 1CLFA 3G6VA 1WTBA 4DF4A 3SSQA 3ZZTA 1ZAVA 4F67A 1FNMA 2VBZA 3P5TL 4FN5A 1YGYA 3Q0AA 3G9CA 5F3TA 1LW0A 1NRKA 4WFYA 4A8KA 2Z4PA 1SH0A 5B09A 1UEUA 2EPIA 3P6YC 2V8DA 4XPCA 3BO3A 3CCRS 4RW8A 5KG3A 1V3SA 2R2SA 1ELOA 1NJZA 2AYGA 1VC6A 3NCPA 4TNOA 4TXSA 2KO1A 1JJHA 2N3OA 4DUZF 2DHSA 4IOBA 3JB9k 2OPQA 3RB3A 5M2PA 2EKYA 4EFAC 3I4PA 4IDKB 3J7YI 1WEXA 3I82A 3T3FA 3M2RA 3DLBA 4ED1A 1RT5B 2FLOA 2FGCA 3PKYA 2GX8A 1HNIB 2MZQA 1NKBA 1FKAF 1QSYA 3CMES 1LFPA 1JKHA 5DDOC 1FO1A 2E5GA 1JLQA 2XULA 4FP9A 5L1LA 4M94A 4ZPDA 3LP0B 4MFBB 2ZDOA 2KHCA 2Z2LA 1D8ZA 2B3TB 3DFEA 4OIXA 4DG1A 2IBOA 2XY5A 4W90B 3QIPA 5LXRA 2I8EA 3HDSA 3PW2A 4QIEA 2XGQA 3G8TA 4FF4A 4O44B 4NYZA 2BQUA 3DN9A 4DV0F 4ZVFA 2DHGA 1MU2A 3I0SA 3KHRA 3R3TA 3TAMA 4LMZA 3W7BA 1MROA 4NCAA 1Q8LA 4K50A 4RUCA 4FVCA 3GV8B 5JVGQ 2OIHA 4EUVA 4N5SA 3I9V9 1Y7PA 2HNDA 2I5JB 2M0GB 4O4RA 4TKTA 3ZZUA 3RW7A 4ZP9A 4R5PA 4LVNP 1YJNS 1T02A 1ZM4A 2MQQA 1SJ4P 3KHLA 2J0SD 4HLBA 4YDXA 3UDCA 4A46A 4WK1A 5J1EA 1R43A 4I7FA 2HZCA 3F41A 4QIGA 5F9NA 3CCVS 1XMOF 2LQJA 3RAXA 1FXLA 3MMCA 1Q1KA 3MR6A 2XLKA 2KZMA 3VQTA 3CJ4A 2RF2B 1LOUA 2EI5A 1LWEA 1N52B 4RWWA 1HYSB 2IM3A 2D74B 1HNVB 3M6UA 1XR6A 1D8YA 3R5CA 2AYBA 3WZ0A 4EZ6A 2BQRA 3PV8A 3IC1A 1KTQA 3KLIB 2OH2A 3OSNA 3OR2B 3Q22A 4P7VA 3RB4A 2CJBA 5JVHQ 5KFMA 3MXHP 4NX9A 1JLEB 1RT2A 1RTHB 5KG2A 4NZ6A 4DEZA 3HJFA 4EBCA 3IFEA 3MR2A 4ZVHA 4G6VB 4WKYA 1YJUA 3NAIA 1FESA 2JVRA 3FCHA 4B3MF 2UUTA 1IQTA 4PG5A 2GJ2A 2A2DA 4DR6F 1AROP 3ICLA 4ELTA 3GFXA 2IA6A 2FC9A 4TY8B 4DV7F 2EWHA 1EETB 3PACA 3B4DA 2E5JA 3RAMA 5HMYA 4B9NA 3H5SA 1X4BA 3Q8RB 5HROA 2D3ZA 4YP3A 3HXMA 3MAQA 5B0EA 1VQOS 1P8GA 3MM5A 3BF4A 4P6QA 5HQ8A 2FVRA 4TQSA 5D6GA 1VQ6S 1NNDA 4KGMA 4BCAA 4EGLA 2R7TA 1OSDA 3O1LA 4WYWA 3TA2A 4ID5A 3SQGA 3ZZYA 4DS4A 4WFBQ 4CIOA 1VIOA 1ZAXA 3V4IA 2I1RA 3MEEA 2OPSA 4QIVA 1QAJA 4ETZA 1S99A 2RU3A 2A3JA 3NWGA 2ROPA 1N36F 1UWBB 2GMJA 2W4CA 1ZTTA 1U1KA 1N48A 4PCQA 2U1AA 4M5DB 4ZPWR 2Q6CA 1TKTA 5D3GA 3W3SA 5A6PA 1RA6A 2NPFA 4QCLA 3KNGA 1DAXA 4ZP8A 3TAQA 3KYLA 2QEXS 3MI7X 4QW8A 1PGZA 2WCXA 3ZFVA 2BDPA 2M3DA 3FZBA 1NK7A 3IR6B 3OUYA 4MYUA 2D7SA 5KFIA 1FCAA 2YNGA 2EK6A 2CQDA 5DLFA 4NLXA 2GGPA 2IC3B 3NL0A 2FVCA 2C3MA 3BZQA 2CQ3A 1HD1A 1RP5A 2FLLA 2Q1LA 2JH3A 2NXUA 2UZAA 3ISND 2DRBA 2DB1A 4K5SA 4KSEB 1S1VB 3LP1A 3O6QA 4IG0A 1F60B 3SV4A 1H38A 3KNAA 2QFJA 1QE1B 2HG4A 2C3YA 3E01B 1TL4A 4NLUA 2R2TA 1VBZA 4MKYA 4NMLA 4ETXA 3DC2A 1C1BA 4LSNA 1X0PA 4RBVA 3U02A 1KTVA 3BREA 3DXBA 3MM8B 5J2NB 4QWEA 2ATLA 1HW8A 1L5UA 4DQPA 3QJPA 3PW7A 4NLPA 4WZMA 1S0OA 1T94A 1TP7A 1U45A 4M5DA 2DISA 4FNHA 2ZH3A 1Q4RA 2WTFA 1U25A 2CQIA 2CPXA 2XSFA 4QWAA 2XC9A 5K14A 2E1RA 5F0UA 4RX6A 1L3VA 3CULA 5KT2A 3CEDA 4NZ7A 1R7IA 1I6JA 4CH7A 4YR3A 1FRKA 1OO0B 1IQZA 4DR5F 5F8NA 3CXCR 4XPEA 5KFHA 1DZ5A 3SDEA 1DBDA 1VQMS 3CIZA 1GX5A 4YUDA 1OQ3A 5KFQA 5B0DA 3KK1A 2VBWA 4QR0A 2VL1A 5KFDA 1S0NA 1K8AT 2XMVA 1T95A 3R5AA 2D1CA 4OI3A 4RKUC 2AJ0A 1RAJA 5HI7A 2XWXA 1VQPS 1WI8A 2SXLA 4B3SF 2K3IA 1RA7A 3LH2S 4N56A 2J9EA 4TY8A 4F26A 3MFHA 3HZGA 5DM6Q 2OTJS 4WZQA 4K4UA 4KHRA 2FC8A 1VHFA 2XI2A 1CSJA 3K8VA 4A8QA 3RTVA 1LK7A 1QSSA 1SJ3P 2BVZA 1KVIA 5IXUA 3OJUA 2FB0A 3CGIA 2C3UA 4NLVA 1RTHA 5F9LA 2DGUA 1S48A 3T5LA 3PR4A 1S6PA 3NNHA 3M4XA 3DDKA 2QA1A 3OXLA 2MKHA 1JLBA 5J2QA 1W2IA 1FNXH 1TQLA 1DLOB 1XMBA 1U6ZA 2J0WA 4KGKA 2EFPA 3QPIA 1FDDA 1SKRA 2UU9F 5EX0A 4IOCQ 3AJ1A 2VOPA 3I5BA 1U09A 4LF5F 4UY85 2ZKTA 3JSYA 4YEAA 1X9SA 3H2UB 5DETA 3H2VE 1DTQB 4CO2A 3R1HA 2GNKA 1GXLA 2HHXA 2ZE2A 4DDFA 3SXLA 2E66A 3MPVA 2EFQA 1K0VA 2ADBA 3MD1A 3KK3A 4E98A 4X4OA 2KT3A 4KHPF 3IAS9 3BM7A 5C24A 1XNQF 4FNIA 2KFZA 2RKIB 4RUHA 3O8WA 1RKIA 4QR1A 2IBKA 3MPYA 2ZITA 3BQ1A 2JC0A 2J0QD 3MTKA 4WYLA 2IM2A 3DNCA 3E8OA 4URQU 1Q16B 4JUZA 3VALA 3TAMB 1FERA 1W2BR 4IFYB 4DLGA 3OXFA 3N28A 3EX7B 1VMBA 3KK1B 2W4DA 4L6V3 1M5KC 4A8WA 2DGSA 3TW0A 3KK2A 3MMJA 5IM0B 4DBQA 2ZBCA 2F9DA 1SH2A 2PA8D 1Y3KA 2AJFE 2AWZA 1FDNA 3QIDA 4WTYA 4IKAA 1H2VZ 3M9OB 3V6DB 3CJKA 3I4HX 2N4CA 2YNFA 3EGNA 3M8RA 5M2RA 3T6BA 4JV0A 4EYIB 4QPTA 1R27B 2XSJB 2FLPA 1BY9A 3DM2A 2NSBA 3CJ0A 3LQVA 4F4KA 2W9BA 4KE5A 4NPOA 3CCQS 3PO4A 2ZUGA 2AJ4A 3JTOA 3PHEA 3KG1A 1HNXF 1C1BB 1AFIA 5E3PA 5DG9A 4Q8EA 4WE1A 3TANA 1S4FA 2KN4A 5KG1A 2EVZA 2HVZA 2KU7A 2VC0A 4X4PA 4NLYA 1X9WA 4X66F 2VG6A 1YJVA 1VLYA 1WF0A 1FKOA 5E3RA 2QT7A 3OLBA 4JI0F 2RS8A 3MEGB 2KTQA 5D77A 3KKFA 5L1IA 2HWHA 2DIVA 4HHJA 1UVIA 1REVB 2GQ2A 3JAMY 4A47A 4BWJA 3GR0A 2AW0A 2YKQA 2UV8A 2QV6A 3C66A 2MQOA 3WDOA 3H98A 2IYGA 1VC0A 3ZZ0A 4X4QA 2IAJA 3MEDB 4LFAF 1FVSA 2IJNA 4DPOA 2XO7A 3QYYA 5D3GB 4H4MA 1JLFB 1GNKA 2XCPA 4K4YA 4OZ5A 1VIXA 2ZJQQ 3KTQA 4Y28C 3KLEB 3G6XA 5BYSA 3KG0A 1RTJA 4KRWA 3MURP 1QVFR 2MKJA 2RRBA 1ZAWA 2N4DA 4HYKA 1FJGF 4OZJA 3GV5B 1D1UA 1X4DA 2GIQA 1HBNB 1VQLS 1P1TA 2HWTA 2MXYA 2YH1A 1WG1A 2WONA 1Y5LB 4NLDA 4DHVA 2EK1A 4ID5B 5B0BA 4IFVB 2I2YA 3I0RB 2OP5A 2FHJD 1ZPWX 5DQHA 2JRSA 5GAHU 2XMJA 1WEYA 2G9OA 3VCDA 3LALA 2WSCC 4UOCA 4K2XA 2XZWA 5I42B 5L1KA 3ULHA 3DI6B 3R1LA 1IJFB 1DFDA 3F73A 1YVFA 2PC6A 1S6OA 3MPWA 4H4MB 4WIIA 5KT3A 2NLWA 4WK3A 4WKRA 1L3SA 2V2KA 2Z8QA 4TU7A 1R8HA 2ILYA 2V8HA 3M32A 3KLFB 4I69A 4QWCA 2KXNB 3Q8PB 4YDDB 4NWBA 4X4VA 4O3PA 2KKHA 1JX4A 5H9FJ 2XNQA 2CQ0A 2JFKA 3H8YA 2FJXA 3AH6A 2RMLA 4LF7F 2CKWA 2BABA 3MOZA 5F8MA 4DV1F 1LW2B 1M5VC 2F9JA 3P3DA 2CJKA 1JLEA 4YMEA 2F3JA 2HWIA 2NS1B 2N7CA 2BYCA 1KOOA 1I1GA 2OD6A 3MGJA 4PXEA 3OLAA 1CQNA 2A10A 2DTJA 3KLIA 4ZPAA 2HPUA 3I32A 2OO4A 4LJMA 2KXHA 1LKZA 4LIWA 3K5LA 2FVSA 4DWIA 3JTNA 3O3LA 4Y34A 1I94F 1FD8A 5GAEU 1VI7A 2W9BB 2WOMA 2O1PA 2OLWA 1A7GE 4I2PB 3O5TB 4HH0A 2NUHA 4CCHA 1Y3JA 2NPIA 1HPZB 3LAKA 4C7QA 4D3HA 2HGMA 3CCMS 4B9TA 3QGHA 2LQ9A 3GG0A 2ROEA 2YKMA 5AE1A 4CZCA 3D2WA 3H4DA 2AGOA 1RTDA 5J1EB 3V6DA 4M95A 4WU2A 2VA3A 1U26A 3UPFA 1M0SA 2CQHA 5JJBA 2VODA 1LK5A 1U2FA 1LWCA 2HLUA 3DOKA 3V2UC 4TYAA 4J9OA 2RE1A 2V4JA 4A48A 2HNDB 2I5JA 4ZP6A 2ZH2A 2XMUA 2VBYA 1S97A 2L3MA 2LEAA 4J37A 2GHWA 1R89A 2O66A 4ZPBA 5LMUF 2BV3A 3CDUA 4DLEA 1GAOA 1UJ4A 2M9KA 2HRYA 3H2LA 1MU2B 1MW7A 2AX1A 4O3OA 3CMAS 2LU2A 3CWJA 1Q53A 2E9TA 3QMQA 4WXWA 1S77D 5GAEI 4H4KA 4QIFA 2FUG9 3K57A 3UDLA 4QZVB 3P49B 5CCMA 3GQCA 1FF2A 4ZHRB 1WACA 2AGPA 1S0MA 1DTQA 1FD2A 2DNNA 3HHEA 2IMOA 3BR8A 1LWFA 1N0UA 1TKXA 1U6FA 2DCLA 2B5JB 1O0PA 2DNRA 4I2QA 2W8KA 2YKMB 1TVRB 5HL7Q 4MIBA 3QJJA 2VBXA 4ITSA 3CCLS 2LQBA 4JOUA 4X84A 5JXSA 1U1PA 4DV3F 3QLHA 2RVJA 2O3DA 2LECA 4H54A 3GYNA 3KLVA 3D0HE 1DARA 5B08A 1M90T 2CVEA 3QJLA 4OQJA 1O51A 2ZJRQ 2B4VA 4ZVGA 3TX8A 2GW8A 1TR0A 3TVZA 1BQNA 4Y2AA 3FRYA 1FEEA 1HFEL 1S6PB 4DL7A 2B43A 1LW0B 3LO3A 4FS1A 3B4MA 3C6TB 1HBOA 2JJ4D 3LUYA 4H4OA 5KFAA 5D4NA 1HBOB 1QAIA 3CPWR 3C6TA 2AF6A 3VAJA 2FVPA 2WSFC 4I64A 3FSXA 2HFNA 5DDPC 3BGUA 3LAMA 4PXDA 3V6HA 1YWXA 2FLNA 1ROFA 3HVTB 1FRIA 3G86A 3K8WA 5AXNA 4PKDB 3KLFA 5J1PA 4KTQA 4LFBF 4DOZA 2Y1JA 3DLGA 4F50A 1U1QA 5BR8F 1P27B 1UFWA 4RW9B 1YTYA 4K4XA 4IO1A 4JV5F 3DI6A 1GXUA 1QAYA 3QLHB 4ATNA 3F56A 1S1TA 3BR9A 1NK6A 3HLUA 4JI6F 4ZMMA 2B5JA 4I2QB 1FJCA 1HBUB 1VRTB 2RQCA 3FRZA 4IFVA 1Q8BA 3KJVB 1JLGA 2MHEA 2VPZB 4OZ0A 5B7WA 2IM0A 2KRRA 2Y1RI 2BZ2A 1JLAB 2K7KA 4OX7A 3TVKA 1GXTA 1N54B 1WHYA 4ZK7M 4C9DA 5K14B 1MMNA 2NQPA 2ZC4A 2B9WA 1G2EA 1IKYA 2QRRA 5T14A 3CCES 1WELA