2L9DA

Solution structure of the protein yp_546394.1, the first structural representative of the pfam family pf12112
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSIDAAQVTEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Solution structure of the protein YP_546394.1, the first structural representative of the pfam family PF12112
rcsb
source organism Methylobacillus flagellatus
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12112 DUF3579 Protein of unknown function (DUF3579)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9dA00
2L9DA
chains in the Genus database with same CATH superfamily
2H4WB 4ER8A 1YJVA 4UW2A 5T7LA 3NWGA 5D0GA 2VQEF 2DH8A 1HA1A 2LECA 4X62J 4PWDB 1YITS 2ZJQQ 2W2MP 2IA0A 2L48A 3MCOA 1JMTA 3W5XA 1J27A 3G82B 5GAGU 4URSA 5GMEA 2BKPA 3MFHA 2V68A 3MR5A 2ZBCA 5ETPA 5MLCV 2B51A 4C4WA 2JC1A 3JSBA 3PACA 1IBMF 2DHAA 4LBIA 2IMWP 2UXDF 3SFUA 2U2FA 4IRDA 4ZPAA 4QYZK 4UTGA 4P7VA 2Z2LA 1RT3A 3ET6A 4OHXA 3TI0A 3E2EA 1TTHB 4C48A 4BWJA 2FHJA 1LKZA 2F40A 3LP0B 3FMBA 3MM9B 4DV4J 2AGOA 5E33A 1YSJA 2QLFB 3A3NB 1NK8A 3EMTA 4DR2F 2M8DB 4V19J 5L39A 1FE4A 3R5BA 3JB9k 4USVA 4Q45A 5F9NA 3HO1A 1HNVB 4C3KA 3TVKA 3QFWA 2NREA 4DV5F 3R5CA 2AYMA 2ZH7A 4LF6J 1X9MA 1IQTA 4WKYA 5F8HA 1NDCA 3UR3C 2CQ1A 3C8YA 4P75A 2H1YA 2YNIB 3LPYA 3CXCR 5GADU 2WTFA 4V19X 3NMRA 1S1UB 1GX5A 1NSQA 1RAEB 3HSDA 3I0RA 1Q86T 3C19A 1LV5A 4BC7A 2L08A 2L3MA 2CPXA 1OQ3A 1CSJA 3KK1B 1LW0B 1QUPA 2HBQB 3NP5A 3R7BB 2LEBA 1JLFA 1L3UA 1VQ6S 3I5AA 3GILA 4I1TA 1AA1B 2WSCC 1WACA 5GAEI 2L9NA 4WU3A 2CPYA 3DOMA 2QTWA 3W2VB 4X64F 2AZ1A 1CG2A 2MEWA 3KK2A 5B08A 4YB7A 2V5HG 3I9V9 4HI1A 1RTHA 2OEKA 4LF7F 5F8IA 1S6QA 3R9LA 1S1VB 2OHDA 4NI2B 1TELA 3G71S 3CDAA 2AJFE 2GQ2A 1D0EA 2RD5C 3HVWA 4JI3J 2EBEA 3CC7S 2FJVA 2HHPA 2EEYA 2MZRA 2RRBA 1T03B 2IBOA 2ZH3A 3QIPB 3FEXB 1F2GA 2IVYA 4P9SA 3A12A 3ENWA 5D3GA 1NJWA 1K8AT 3MM6A 3CF5Q 1S10A 4ECXA 2F4VF 5KFSA 3ZC4A 3Q23A 3ENQA 1P27B 3DLBA 2VD3A 2VBWA 3EGZA 1URNA 2QL9B 1JKHA 1SV5A 3RR7A 3DRRA 4IFYB 2FC9A 2XHWA 2QL7B 2N3OA 3NEKA 2K1RA 3C16B 2HZCA 2OPPA 1ZTTA 2JFKA 1S9EB 2KI2A 4K2JA 2FVPA 3M2RA 3CJKB 3K5PA 2E5JA 2YNHB 2NR0A 5B0CA 3EPIA 4DQQA 4O23A 2NXJA 1U0HA 1RWVB 2VPYB 1IKVB 2DCLA 2Z4PA 4ZJQA 3CDWA 4ETXA 4AD6A 3LPEA 2OPQA 1JXVA 2QZ8A 2ZVSA 1CPZA 4X4UA 5KAKA 3LGNA 3DRPA 2W9CA 4ZVEA 4DV7J 1R7IA 3CCVS 2YX1A 1VDHA 1UW9A 1QDUB 5K20B 5I3UA 3SDEA 2KJVA 4TLRA 2X1BA 1FERA 3CB4A 3UCZP 5DM6Q 4DR6F 1YBUA 1HQEB 1N48A 3PFEA 2XMVA 1F9EB 3CJ8A 4UOCA 2RHQB 3DLJA 2KXNB 4X4SA 2FVQA 1WG5A 4A8FA 4NMXA 3D4JA 3N6MA 1KVKA 3M8WA 2HKEA 2B4OA 2WK4A 3D6HB 2XMKA 4IG3B 3HDSA 5E0OA 3X1LB 3FBEA 4ICLB 1XR7A 1XR5A 4JI6J 3LP1A 1RJJA 4OX9F 5IS2A 1TL7B 2J0QD 2ZZMA 4ZVSB 2KM8B 1TKXA 1O51A 2KRBA 3ISZA 2YKNB 5C24B 1HWJA 2XQCA 3UPFA 1RBOB 1IBKF 2P6SA 3UN2A 2MTLA 3EGVA 4RO0A 3AB2B 2R2SA 3CD6S 3U1MA 5D4LA 3LA0A 2H51B 3P49B 1RK8A 2VQEJ 4JI2F 3O2IA 1C4AA 4PR6A 3ITHA 1KLMA 3MTJA 1ICEB 1PIEA 1FF2A 3QSIA 4O4RA 4O3NA 2EI5A 1LWCA 3MM7B 5HVFA 4MAKA 2B5JB 8AT1B 3CO0P 1GK8A 2LQ5A 3MWBA 4Y2MA 3IC1A 5AE1A 2DRAA 2HZAA 2PIIA 1N88A 1IBMJ 5CAAA 3G87A 1OWXA 2MQLA 2FGCA 2UXDJ 3EE3A 4QJVA 2AWZA 2ATCB 4RW8B 2QA4S 5M2PA 4E0DA 3DC2A 3PDNA 3F0NA 3OQ2A 1S57A 1IVZA 4KGXB 1KBRA 1FTRA 4EO6A 4J5OA 1HR0F 2Y1JA 5G0RB 3VV2B 3Q0AA 1F1BB 5AE2A 3RB6A 5I42A 4DR2J 4X4RA 5DGAA 2L9DA 2AQ4A 2WRMA 3PO5A 2EG2A 3KLGA 3QJPA 4DBQA 3J7ZT 1SH0A 4ILMA 4DV5J 1V5IB 1QE1A 3HMJG 3V81B 3N6NA 1HNXF 2YWGA 5HN0A 4NCBA 2ZE2A 4C98A 3Q86A 2H5EA 2YWEA 2IVFB 4QIEA 3MMCB 1RADB 1HWLA 3NY0A 2YQ0A 2ZDOA 4RW6B 1VRTB 4DN0A 2F8EX 3JSYA 3HM9A 3LTOA 2I0XA 4PRFA 5ETNA 5KFNA 1S59A 3SCJE 4HDHA 4AXJA 4OFZA 2QA2A 1HD0A 2B6AA 3TUIC 3H90A 3FUYA 3HX9A 1N34F 4D3GA 2CIMA 5B0BA 3DM2A 1GQEA 3W2WA 4KPYA 4PG4A 3QNWB 1NK6A 3EZUA 4KGZB 3BPDA 1BXNA 3OJUA 4BDPA 1SUQA 1OMSA 4KV8B 2ZUGA 3MAHA 6AT1B 1FKPA 2JWNA 2HQDA 1HBUA 1SQEA 3DGPA 2QFIA 2A6MA 1BWVA 3RB4A 2RKIB 3V6KA 3MXHP 2MQNA 3AXKA 1D9AA 4U8VA 1LQ9A 3QATA 1LFPA 3VCDA 2OPSB 2QIFA 3TANA 3MF5A 4DV3F 2HEKA 1JIHA 1F9FA 4WZQA 4MT1A 4IH7A 3KG1A 1WC6A 3P3DA 2KJWA 5EX3A 5A0YB 5DQGA 4NL5A 4LT6A 5KFAA 5D4OA 2ZJRQ 4DEZA 1VBYA 1X4DA 2C3MA 3A8KA 3QGHA 5HSPA 4PZVA 5GAHU 1U6ZA 1TVRA 4PPZA 4IO1A 4DL5A 2QLWA 5KOWA 2BX6A 4GC7A 1IBCB 3W7BA 1C0UA 4I6WA 2DY1A 2KL8A 4ZMMA 1SJ4P 1KEKA 2D74B 4QPTA 3M6VA 3KYLA 1EQ0A 2HNYA 2MKHA 5LJ5Y 2ZWOA 4C11B 4JB8B 5CCLA 1NK0A 4WBFA 5A8RB 3BGLA 2FIUA 1S12A 3FRYA 1WSVA 5ETOA 3UQSA 2XLKA 1NPPA 1H74A 3MEEB 1SL0A 1AT1B 2WVFA 1YI2S 3RZAA 1ZS6A 2WOMB 1VC6A 1M5SA 1SJ1A 5GAGI 3TUJC 2HQIA 4G65A 5B09A 1S0NA 4DR6J 1UW4A 4ZJOA 3OTOF 2EK1A 1JNZB 4ZKAA 5KFPA 1RT1A 4WFBQ 1VBXA 4PG8A 2DK2A 1TV6A 3KLEA 4CT8A 2HFNA 2Q43A 2CQGA 3ZZPA 3HHLC 5BR8F 4Q0BA 5T7LB 3GV7B 3EPGA 1D09B 4N8NA 1ZZFA 4EYHB 3I55S 2MHNA 3MFIA 5CXTA 3HHLA 2RJZA 2MYFA 2CAJA 4U7UK 4OX9J 4PXEA 3SV3A 4ZA1A 2K3KA 2XNQA 2E9TA 2DGOA 4ZN3A 3TX8A 2GMHA 4XTTA 5BJRA 4L3KA 3BREA 3HXMA 3DOLA 1RTDA 3QGGA 1WOOA 2JLFA 1IBKJ 4JI7F 3POTA 1DZ5A 3PYGA 5L46A 4NA2A 1REVA 2E5LF 4F4KA 1FRIA 1HW8A 3I5CA 2HLUA 1ZM2A 5LM7E 4DCPB 3ET6B 2B8QA 4WWSA 4JI2J 1S9GB 1CJTA 3MR3A 4DPOA 3M9NB 4M5LA 4KR0B 3M7VA 4USMA 3LP2A 2BQRA 1MMLA 1PC4A 1U02A 2DRBA 1NJXA 3DCAA 4Q2LA 1VC5A 3GLJA 2HIYA 2ZBQA 4GMKA 2V8GA 2LDIA 4DSFA 1WHWA 1UZHA 2DNNA 2E9ZA 2WHOA 3DDKA 1ZAXA 4FNHA 2PMWA 2KVIA 3ZZRA 1HBMA 1L3SA 3N4WA 1LWXA 1HR0J 4OYMA 4HL9A 4RU2A 4OZ1A 3CW2C 1WC5A 4B3OA 4AUKA 4CCHA 1RT4A 1TUGB 1WOPA 2DHGA 2RE1A 1EKRA 2Y9HA 1T7PA 1GMWA 1S97A 4TXSA 1HWKA 1JLFB 2B7BB 4NXMJ 1VQ8S 3WX4A 3EXCX 1RUSA 1BY9A 4OHYA 3RJMB 4DPTA 2CJ9A 1QY7A 1RT5A 3DOMB 4U7UD 3LW5C 3BS9A 5B0GA 2AYEA 2LXUA 2FHKA 4UOFA 1HNXJ 3NLCA 4BLGA 2BRKA 2ZD1A 2IVMA 2G13A 1RTHB 4GKKJ 1S6QB 4RU9A 2XSJA 2EKNA 1NUEA 2VPWB 2HS3A 2YKOA 3TR5A 2CJYB 3UNGC 4RPFA 1FT8A 3OTDA 4DV6F 2H9ZA 1XIQA 3BBFA 4K4SA 3GJSB 2GJFA 4MK8A 1GT8A 2FJXA 4PWUA 5CD4A 3NL0A 2X3DA 2IM1A 3WC2A 4FF3A 3C6TA 4OQJA 1NBEB 1I51B 2B9YA 1N34J 3L7PA 4ZIWA 5JVGQ 5H9FJ 1ZPVA 2XMJA 3MM6B 3LWMA 1QLNA 2W25A 1FX2A 2IAJA 1VQKS 3BGRA 5A8WA 5D0HA 1WWHA 3W8PA 1S6UA 2JEJA 1N5VA 3UDCA 3UD5A 2DY9A 3HF5A 2W1BA 2VASA 3D9BA 1JKHB 1SV5B 2E1RA 2UVWA 2VFSA 3RR8A 1QAXA 3DRRB 2R2RA 2AP6A 1FEEA 2QJ3A 1VQMS 3AD8C 4F0MA 1E6YA 2K1RB 3KOAA 2DCUB 3OR2B 3IA0A 4OZLA 4F2SA 2OPPB 4FKYA 3MCNA 1KONA 4LJMA 3QAEA 5IT0A 2A0FB 3TP2A 4DV3J 1PJ7A 3KUEA 2DD8S 1VBZA 1VRUA 2HHTA 1X0PA 1TMJA 4U9RA 3BR9A 2YWWA 1PYSB 1NHVA 4PQUA 4ZITA 3AOAA 4URQU 1K73T 2KFZA 4C8YA 3QWUA 2E7WA 5KT5A 1HKAA 3BO4A 3PHTA 4YP3A 3DRPB 1S1XA 4DL3A 2WCXA 1CJUB 2ZH5A 4LMZA 3CCES 1U6FA 2XWXA 3GFZA 3NMAA 2O5DA 5HVHA 2GFFA 2V2VA 1KOHA 2W9BA 2DHSA 5M2RA 5JUMA 2Y8YA 3JTPA 2OKQA 3KLVA 4ETZA 3OL9A 3P6YC 4I68A 1F5BA 5D8HB 3LGHA 4OJ1A 3JTNA 4CLZA 4KGMA 5EWFA 2BJ7A 2YH0A 4W4MA 3PKYA 3PRVA 2J9CA 1SPBP 3M1VA 3R1HA 2BR0A 1JLQA 3HHKA 3OFEA 3CUNA 4NLSA 3NWRA 1R8PA 4PCQA 5DDQC 3HHLD 3LP1B 3QAUA 3CCZA 1UVIA 1U1QA 3T1HF 2I6WA 1TKXB 3CD7A 1RAOA 2A3JA 2WVDA 4ZP6A 3JAMY 3OTOJ 4IH5A 1HQ2A 3K5OA 2ACYA 3M05A 1IWAA 3IP0A 1U1OA 3P45B 1FNXH 1Q95G 2IC3A 2DGTA 2R7QA 1U09A 1SI9A 2B9EA 3FMWA 2VKZG 4OI0A 3U1LA 3DYAA 5BR8J 4UT4A 4M5KA 3Q2TC 2I5JA 2K3IA 4Y2CA 3FQLA 4ED7A 1UA1A 1X4CA 4WP8A 3ITHB 1KLMB 3J81Y 2CZ9A 4CZCA 4RZRA 2CJQA 1KLNA 3D2WA 3TUZC 2OH2A 1LWFA 4IOBA 4QU7A 1T9WA 3C2PA 2CPFA 2CRLA 1Y4ZB 4DR5F 5ETRA 4GVBA 1LWEA 2E5LJ 2MQQA 4DI6A 3EZ5A 3WIVA 2LLZA 5AXKA 3NCQA 2MQ8A 3TWZA 2EFGA 1OYEA 3W66A 2GVZA 2HS0A 1PKUA 4CO5A 4RNOA 3OVSA 4URGA 4PKDB 2FJWA 4F4XA 3IBCB 1GMWD 1T9VA 1VRQC 3VF0B 2XC9A 3MUMP 1EP4A 1UFKA 4MTPA 3KLGB 1WI6A 3F56A 2GHWA 1YJRA 1YBTA 1QE1B 2VFUA 3NOCA 3FEZA 2M0GB 2ALZA 1X5PA 1WF2A 3MEDB 4LF4F 5C25A 2ZH9A 2ZE2B 1F3VA 1YBAA 4I2PB 1NEEA 2V8HA 5B0DA 5KFQA 3KMSA 3MUTP 3M8PA 5SUHA 2VJVA 3LH2S 3A13A 3NGUA 3OTBA 3UCUP 4YR0A 1HFEL 1A6LA 5CH7B 4AXIA 4A8MP 5HATA 4GRSA 3IFEA 2E1AA 3NG8A 5CYMA 4FXWA 5I3QA 1W2IA 3GMGA 3NS7B 3VZHA 2B6AB 3RW7A 1SJ3P 4YR2A 3Q89A 4CRJA 3DM2B 4GKJF 2BKNA 1RAHB 2C2EA 1U4BA 3W2WB 3PJXA 3LALA 3SIPB 1GFWB 4NLWA 3HVTB 1T8EA 1V3RA 3HFVA 1SUQB 1CULA 1IUJA 5EHHA 3CSKA 4NA1A 5L9XA 1FKPB 2FQQB 1RYRA 1HBUB 2KT2A 4ANDA 4DV6J 4BBYA 4CDIA 2HVEA 2ZWPA 3VQSA 3D0HE 2XTJP 1T0TV 3ISNC 4DS5A 3BM7A 3CJ5A 5AE3A 5F3TA 4G1PA 5A8KA 2V8VA 1ZM9A 3BF4A 4PABA 4EBDA 3R8YA 3BSCA 3HVRA 2UXBF 5HQ8A 2XLJA 2ZNZA 2HHHF 1HHSA 3DXBA 3PZPA 4LSZB 1WKLA 4DX8H 4C8LA 3U02A 2QGFB 5LT5A 2XMMA 4B9UA 3KUHA 5KT2A 1BHNA 1MN7A 2IYIA 1ZAVA 4KGKA 4A46A 4RBTA 5J1PA 1C0UB 2R7SA 2ZC3A 2DNQA 2UUAJ 1OSDA 3D0GE 4K5RA 5DZ6A 1X9SA 2FLLA 1IKWA 3R5GA 1KFSA 4CO0A 3GCWP 3IAS9 3Q8RB 2HNYB 5IQ6A 3V4IA 2B9XA 1VR6A 1BQMB 4IG0A 4ZVRB 1NHKL 4RW4B 2BA9A 1M1HA 3MPWA 3PCOB 4PAAA 4CQ1A 3CJSA 2XM3A 2FY1A 2W4CA 1DFDA 2LQ9A 5HMYA 4BWMA 2W7OA 4J37A 1W25A 3GSDA 3OW2R 2OMLA 2BUNA 4C8OA 2NS1B 4J9NA 2O67A 5KFEA 4ED1A 2CG4A 5KTQA 1H38A 1EETB 3K5LA 4RW9A 3DKDA 2F63A 4DL4A 2LQJA 1VQSA 4WPAA 1VJWA 3D0IE 3EXYA 3N5FA 1N36F 2Z2MA 1ITPA 4NLVA 1QAJA 5K8PA 1H7WA 3KLIB 4OYBA 1XNRF 3MOZA 2JH3A 4LRBA 3ZZ0A 1RT1B 3S7RA 1KRPA 2MKJA 4M5IA 3TZXA 2RQKA 1TV6B 3KLEB 5D15A 4H4KA 3PX4A 2PDAA 3L95X 1X60A 4UOGA 3TUPA 5C2CA 2ASLA 3RBZA 2FPHX 4K4VA 2DEJA 3HHLB 4RNFA 1S1WA 2Y3YA 4LRDA 1SJQA 1JLBB 1KQKA 1JJHA 4AL5A 1DLOA 5KG3A 4YB6A 3DOLB 1RTDB 1TL1A 3PYEA 3C46A 2AYGA 5J2QB 4ED2A 1WF1A 3NCRA 3POTB 4ZP9A 3IWNC 2RILA 2Q66A 1REVB 4WK3A 3JYTA 3OLAA 3MPYA 1FRXA 1GMVA 1H73A 1SJRA 4IH6A 3PW0A 3PRBA 3MZIA 3PYFA 4XDCA 1G7CB 5J1EA 3M6WA 2GO8A 5H9EK 4MKAA 4DLGA 2X1FA 1QJHA 2HQCA 2FB0A 2JEIA 1S48A 2ZBIA 1O6XA 5JXSA 1OS5A 2HHWA 5KFTA 2H65B 4ZLNA 3TAPA 4DSJA 2MLZA 4MIWA 2RIJA 2P5VA 2RHSB 1RISA 4IR1A 1UVKA 2JVRA 1H98A 2DNHA 4WK1A 4QYZJ 5KFMA 1N4LA 3PX6A 4EGLA 1CBKA 1FVSA 2E5HA 1RCXB 3T5JA 3OFGA 3TVYA 2DR6A 1RT4B 2UXCJ 5FD1A 4LREA 4N76A 3KFWX 3PG9A 1RLCL 2B7CB 2XEXA 1F5CA 1JQGA 1JJ4A 1TZ0A 1X8DA 2FLOA 4DJBA 5LSOA 3MMAA 1RT5B 1G1XA 3OUYB 3H7HB 4F67A 1SIZA 1JXLA 2MMYA 1WDTA 4J9PA 2BV3A 1Q7LB 1RAGB 1R8HA 2O66A 2ZH8A 3OL8A 3DMJA 3G2XA 4CYUB 1NH8A 2NPIA 3DRSA 1K9MT 4Y00A 1PYTA 3KNGA 1SC6A 1V3ZA 4DG1B 3TZYA 3HSZA 2RUSA 2V50A 1Y5NB 1FD2A 2LA6A 1U6BA 1TR0A 3SSSA 4MFBB 4TVAB 2GGPA 4FP9A 3UDVA 3DFEA 5L38A 1TL3A 3C6TB 4M5DA 1RTJA 1MMNA 3GV5B 2IDEA 1ZA1B 3SQGB 5H9FK 3CGIA 4TU9A 2WSEC 1IXKA 4KC5A 4WXWA 1S4EA 3BEGB 3ZO7A 3W9IA 1CJVA 2IAJB 1UWBA 3BGRB 5U47A 4P73A 3BO3A 2A2DA 8ATCB 3L4BC 1HI0P 2H5IB 2R7OA 3SEOA 3BO2A 4QZVB 4R0EA 3W9HA 2QA1A 1E6YB 1Q79A 1SL2A 4LFCF 1RHMB 1K44A 3IR7B 3TAQA 3K0JA 4OZ2A 2YXLA 4I4BA 4RW7A 1JLCB 2EXUA 3UVJA 5K8NA 1NJZA 3QBCA 1NK7A 3ILOA 1Y00A 2OMOA 3WQPA 2ZJPQ 2YKAA 1NPKA 1WTFA 2RNEA 1VRUB 4EEYA 3OR1A 2UXBJ 4J90A 2QE5A 1PBAA 2HHHJ 2W4DA 2RU9A 1QUVA 2XZTB 4NZ7A 3VALA 1FESA 1FX4A 4F26A 4PQUB 3CCSS 2J9EA 4I69A 2KHCA 2UVRA 2CZVC 4AE5A 2NXNA 2DITA 1XQIA 1S1XB 3BGUA 2NSBA 2XYHB 1P1TA 2VG5A 3MMJA 1PGZA 4DXLA 1HYSA 3VGTA 1RKIA 4UY8T 1IBLF 1CVJA 1OYDA 4EMDA 4USWA 2DPIA 3BQ0A 4L74A 2W9BB 2HG4A 1WOSA 2FC8A 4ID5A 4L75A 2V34A 4KB7A 1S77D 4ED5A 4NZ6A 1N54B 3FSYA 1KOOA 2E5GA 4PXCA 3W3SA 4W98A 2CPJA 4ZPCA 3DI6A 1WKKA 2EFOA 2JNJA 4DUZF 1X0FA 3J7Z5 4YFUA 1UEVA 1TL5A 1JLQB 1JJCB 2CJKA 1C1CA 3OD2A 3QT8A 4OZ3A 1QAYA 4HEA9 2AYBA 2I2YA 3BGFA 2OEJA 4DUTA 2JJ4D 5KFYA 2VA3A 5J2NA 3NGTA 1PAEX 4BC9A 3PJWA 2OFHX 3ILLA 1N36J 4KPCA 2ZOGA 4JI5F 1NDPA 3MEKA 4ZLLA 4NMLA 4LF9F 4ED0A 2AIRB 3RAQA 1YWXA 1RWPB 5BYSA 1XNRJ 1CJKA 4YHHJ 3KJQB 1JLAA 4RL1A 4TY9A 1HBOA 3ILJA 2IC3B 2HBZB 3OXGA 2ROEA 5E3RA 2DR7A 5THWA 2R7TA 2F5GA 2L9WA 4ALZA 5CYJA 1U47A 3FQKA 1PILA 2MY7A 1KS2A 1VFJA 3U7JA 3CIZA 5SZTA 4O3RA 3DYAB 2BANB 4AQYF 1VI7A 2I5JB 2BM1A 3M8RA 2OO4A 3D6FB 4OMFG 4DZ6A 1DURA 4OI6A 4XDDA 2JLGA 1KR4A 3EGNA 2LVWA 2KT5A 2ZH4A 2CDRB 3JQJA 1RQ0A 4X66F 2FVRA 4F3QA 1LWFB 1EKSA 3HKZD 1FWKA 3IN5A 3KKFA 1BWEA 3TA2A 1VHFA 4GVBB 1LWEB 3TZWA 3GIRA 3N28A 1D8YA 4WYLA 4B9TA 3LAMA 4C8KA 1F2HA 3ZXWA 2VDHA 1NXIA 2GVZB 3Q22A 4YN3B 1HWIA 1Q0NA 2VOPA 3F41A 4WIQA 1HMVB 4IO9Q 4QU6A 1U7LA 4RWWA 4K0KF 1EP4B 1NSKL 2F4FA 2HRTA 3JQMA 2GA7A 1YJWS 4GO5X 3W9JA 4OV1A 2R7XA 3BBCA 3QT5A 4AT1B 2XI3A 4O0NA 3N01A 4H4MA 1LFWA 1H0HB 1SKWA 2MQPA 1XR6A 4WTYA 1KC8T 4OZ0A 4N5SA 2K7KA 1IKYA 2FZKB 3N0VA 3G96A 3W62A 5DLGA 2GJIA 1DTTA 5HQLA 1OPZA 2V2ZA 2BE2A 3TEHB 3KDNA 5E3CA 4NXNF 3Q8PB 2KT3A 3P4UB 2CQDA 2KZMA 5CYMB 1DTQA 2J9DE 2HNZA 4YMEA 4LF8F 5F0WA 1RTIA 3CEDA 2JX2A 3RBDA 2QO3A 1BUXA 2X1GA 1HPZA 3EVOA 4O3SA 3NKYA 2JVOA 5KFGA 1WJ9A 3HLUA 2DR8A 1GTEA 1R89A 1VGYA 2WB1D 4WE1A 3OBIA 2NXEA 4O3OA 4L3NA 1SCJB 3DDIA 2D9OA 1DQ8A 3CCLS 2ROGA 5RUBA 5ETVA 2DR5A 4MK7A 4KHPF 4Y3CA 1UEKA 2XY6A 4R25A 1KQSR 1U45A 3HD1A 1KN6A 2YY3A 4C8MA 2U1AA 2GCFA 3EZOA 4QW9A 2RQMA 2UU9F 2Y0BB 2XZDB 2HHSA 5IM0A 2R3VA 4EFAC 1VK3A 3SSQA 4KH0B 1HNIB 4GC6A 1U2RA 2VKRA 4ZCIA 4XAKA 1XWLA 4DUYF 2AHOB 1DBDA 1S6PB 5FLXY 2Z8QA 1FCAA 4LF1A 4KIAA 2QV6A 3GIKA 1V3SA 1I5OB 1R6VA 5C42A 2DXDA 4C9DA 4P72A 3K17A 5HI7A 4LFCJ 5KG4A 4LF2A 3GONA 1RXOB 1I1GA 4ELUA 1FRMA 1S7HA 1RLDA 3V4IB 2RDDA 4DR7F 3VTIA 4G1IA 4IG0B 3MAAA 3Q2SC 2HGMA 2DTJA 4WFXA 2JOQA 4QIGA 3QPIA 1HHTP 2BACA 3O6QA 4KAIA 2W2QP 3GQCA 1UZDA 3HHDA 4NLRA 2QSWA 1FNOA 4DR4J 2D41A 4OI4A 5D0EA 1VQ5S 3GPAA 4EYIB 1F5AA 4JI4F 2FZGB 1YDLA 3VGUA 1ELOA 4LQ3A 1G3OA 1IM6A 1HIYA 3BQ2A 3ZFVA 3IMQJ 4KY3A 2ILYA 4HT5A 2FGOA 2B4UA 2M2BA 1JB0C 1S6OA 2UV8G 1IBLJ 4AFFA 2H48B 2AW0A 1ZM3A 3O8WA 2APOA 2OD4A 3CJ3A 4NLXA 4RNNA 1V6HA 4KO0B 4DDFA 4NEYA 1J5OA 2XY5A 4FPRA 2HURA 2QEXS 5KOXA 5LJ3Y 3D54A 3C6UA 3V4MA 2QC3A 1RA6A 4DU8A 3UR0A 4M5NA 3K2YA 1CC7A 2EWHA 5HMZA 2GJ2A 3CTRA 1WC4A 1Q8LA 4LR7A 4WU2A 3G8SA 4D3HA 4HHHA 3TAMA 1N5SA 4FBTA 1EAYC 2VPXB 4DSKA 4PUOA 5FDLA 3ETOA 3FRZA 1S1WB 2NYHA 4Y2KA 4A8XA 4LF9J 1H2VZ 1M0SA 2QLBB 3A3OB 4JYAF 2P9EA 5IXUA 4CH1A 2HSEB 2UUBJ 5HL7Q 1UP1A 4I7FA 5HJXA 5IC4B 3C14A 2J0SD 4K4TA 1WHYA 4FVMA 2H3EB 3AOBA 4ZK7M 1VQNS 2HPUA 1Y5IB 1WC3A 4QBUA 4PWWA 3SI8A 5J1EB 3HHEA 1TKZB 4AQYJ 3HVAA 4LSLA 4DFMA 2HFSA 2RF2A 2NXCA 1XERA 5A76A 5EUHA 3T3FA 2BQUA 3W65A 4LUBA 1NK4A 3DLHA 3MOJB 4A8SA 2YNFA 2A1BA 3SCKE 4FXDA 4Q2MA 5KT3A 4WTOB 1X4AA 4JI0J 5K14B 2UV8A 3K5NA 2PMHA 2FJBB 5GMKa 2V67A 2RMLA 2MSTA 4WKRA 3BYPA 4Q43A 3T9ZA 3E8OA 2C22A 3CO9A 4ECQA 4KFBA 3VZIA 1A7GE 2ZBPA 4GO7X 2RH3A 2J8AA 4U95A 1EX8A 1JLGA 2KH9A 3IRWP 2M52A 1RHKB 4AL7A 2W8LA 2J76E 5CYQA 2YH1A 2HNDA 3DLLQ 4K0KJ 3B54A 1FWLA 4QWBA 4OLPA 1OSCA 1HBNA 3MMAB 3H25A 1XNQF 5CABA 5KFUA 3IXQA 3EJMA 4TNOA 1I94F 4DU7A 3VQTA 3K57A 4JBCA 4ZHRB 1S0VA 2XNRA 4PPDA 3LOUA 4M5MA 1WHXA 4P74A 4FYDA 2LU2A 1EARA 4IRCA 2B56A 3BH6B 4ZLPA 4R5PA 2HK2A 4DN9A 3DRSB 3NOGA 4OYIA 5CQGA 1VCTA 3AB4B 1O0PA 4OHVA 4N7TA 2C2NA 1K1SA 4RLEA 1S72S 4EUVA 3J81j 3G4SS 3PHEA 1AUDA 2DVIA 4V1Ak 2BJEA 3FBCA 2DGWA 2WBRA 3FZ2A 1Q82T 3AD7C 5DZ7A 5KT6A 5BYRA 2ZITA 4DV1F 2AD9A 4ZOSA 2W4PA 4NCGB 2NQPA 3PKMA 6FDRA 3QLHB 1GMUA 2HQGA 3H59A 3H5XA 2YKMA 2G2YA 4WP9A 3PFOA 2XMTA 4OYAA 1IWGA 5DRKA 4Y2IA 2Q1LA 2I38A 4DQSA 1WI8A 4UUXA 2EPIA 2ZM6F 4E98A 4YDDB 4FF4A 3G82A 3BR8A 2J0WA 1X9WA 4R0JA 4KHPJ 4NRTA 2ZHAA 4Q5VA 1PSDA 2QG9B 4FDFA 2BJDA 4RW7B 2UU9J 3UVJB 1U49A 2B4PA 5L1JA 3Q8VA 1PJ5A 2D9PA 3HZEA 1S1TB 3NCPA 5IFMA 3L7UA 2C42A 2AZ3A 1IR1A 4DHVA 2D69A 3GCXP 1NKBA 4QIVA 3OR1B 2YTCA 4NLDA 3HULA 5D4NA 3QZ7A 2EFVA 1DJ0A 3RRHA 3LP0A 1WEZA 5ETLA 4Q8EA 4Y2AA 1N32F 1NO8A 2HHXA 2R9LA 1YX2A 3U1NA 5KFKA 4MKBA 2BQ3A 4DPWA 3AODA 1Q8KA 3DHXA 1RDRA 5IV4A 4NLGA 2ZC4A 1HNVA 3QJLA 3NNAA 2XYGB 2PFDA 3SSRA 3B78A 2DHHA 2GW8A 4KYZA 2YNIA 4DR7J 4N56A 4ID5B 1QM9A 5IWAF 4L76A 1OIAA 1VQ4S 2ABYA 1NDKA 3DI6B 4C97A 3K8VA 2J5AA 3E01A 2BEFA 2CQBA 3M30A 3HD2A 1SJFA 3HP6A 5EN1A 1OY8A 3KK1A 3WC0A 1LW0A 3PM9A 2X7IA 2ZH1A 3TARA 4QWDA 2J7KA 2BE7D 4DFKA 4P71A 4NLUA 3VAIA 1M5PC 5J2NB 2WONA 3W2VA 2MZ1A 2Q79A 3TX0A 5M2UA 5IC6B 2UUCF 4HVZA 1S5ZA 1H7XA 2UVUA 1SKUB 1LXJA 4DLEA 5B0FA 1UJ4A 2CQCA 2QMXA 1QSYA 3MR6A 2G0JA 2DXEA 2ZHOA 2J6SA 2XG8A 1NSPA 1QTMA 2FVCA 2XLIA 1HBOB 2RQCA 3P5BP 4MYUA 1N5QA 1BD6A 2VONA 1X4HA 1EQMA 1Z4UA 4EWTA 1SQFA 4U8YA 4GVLA 3VVUA 3RB0A 3W60A 4A8QA 4QIWD 3EICA 4O44B 2KKHA 2HGNA 5K9FA 2MHEA 5DETA 3QIPA 5GAEU 2QRRA 4HH0A 5I3PA 5A6PA 4TYAA 1Q53A 3ZZZA 4ZVOB 4CTAB 1RHQB 3GWCA 3UW1A 1RWUA 4DMZA 1S49A 4PYDA 3KJVA 1NSAA 1FJGF 3SQOP 3MCMA 2AJ2A 2BVZA 2XCAA 2J6UA 3OTEA 1FWPA 2NUHA 3C3LA 1VLYA 3BBBA 2VPZB 4A48A 4P10A 4QR0A 4ECTA 3TYTA 1TAUA 4NZ0A 4LRFA 1VQLS 4LFBF 1BQNA 1FNMA 3C16A 1UVLA 2MSSA 1S9EA 3MD3A 2VG7A 3CE8A 2MLXA 5FIIA 2FHJD 4KH1B 2FDNA 1YRTA 3ZZUA 3CJKA 4CM0A 3KTQA 2P8IA 1KSPA 3KHLA 4FPIA 1KDNA 3ZZOA 1RWXB 3M6UA 4RUHA 1Q81T 3NNCA 3LQVA 1TFYA 3OVAA 1YJ9S 4ECYA 1UL3A 1UFLA 3CCTA 2MKIA 2V2QA 1UPMB 1YJNS 3QQCD 5F8LA 4ECUA 2DISA 1SIWB 1RBLA 4H4MB 2FHMA 4J9LA 3PW7A 4I67A 2OLWA 2J8SA 1WC0A 5KFCA 1DTTB 3K5MA 1IR0A 1NKCA 5D78A 4Y6IA 4PG6A 3FFIA 1Q78A 1M5KC 2BE2B 1K0VA 3I96A 4DPYA 1PBUA 4OV6A 4NWBA 4DF4A 5B0AA 4TQSA 2XCPA 2MKSA 1GX6A 3IG1B 2MKKA 1VQPS 2KYZA 1WD6A 1C1BA 1RTIB 1XJWB 1HPZB 1DQ9A 5CD4H 5HROB 3E3XA 4ES3A 4B9MA 3CWJA 4CWBA 4WE1B 3J80Y 2K06A 1Z2LA 4G1QB 4I2QB 1PAUB 3ZTPA 3D1HA 2NSCA 3WZ0A 2ADCA 4X62F 2Y1LB 3ENAA 2DB1A 1B0VA 1YIJS 4I56A 3LWLA 2HWHA 1SH3A 1B4SA 1MW7A 3OVBA 5KFRA 5C24A 2ROPA 4DV1J 4RUCA 3FSXA 3D1OA 4X64J 3RUBL 5IM0B 5HMWA 4J9KA 2EW9A 2FYXA 3HK2A 1UVJA 3HFZB 5KFZA 4JV2A 5C5JA 1C0TA 3FSIA 4ITSA 2OPRA 4OI1A 2HMIA 3GG1A 4KE5A 2HFOA 4LF7J 2HK3A 4NEZA 3GIMA 3A8IA 4RR5A 1T05A 1Y11A 2PGCA 3MM7A 3OT9A 4DQRA 2GHPA 2A6OA 3MGJA 3PY8A 2BDPA 3W1YC 5LOQA 1AZSA 1Y3KA 3GTYX 2VC1A 3M2UA 1MMDA 1FDAA 2C2RA 2KVQE 3T19A 4U7CA 2XULA 5ETTA 1VBKA 4USKA 1MROA 3MAAB 4ZDNA 2LYVA 1T9XA 4J9OA 2ASYA 4KSEB 2F4VJ 4MKYA 4P2SA 1CC8A 1RWOB 3MM8B 5KFLA 2FLPA 2Y1IA 2FJAB 1UJ6A 2V2KA 3D5MA 1U1MA 1RT7B 4OLOA 3IRXA 3P5TL 2D3UA 5L1LA 2EC0A 4QR2A 2QL5B 2P6TA 4HT7A 1RCOB 2ZZTA 2BE9B 2BBEA 2AGQA 3UE2A 4ZVQB 3V2UC 5K8MA 3M32A 5KT7A 1YJ7A 3EGWB 1HI1A 1Q8BA 4ED3A 1J5OB 4NE9C 5IWAJ 4F3OA 3GP9A 1URRA 3C6UB 4H54A 1KQFB 4IDKA 4JI1F 4RW6A 1VRTA 1L3VA 3ZTSA 1NDLA 1TP7A 5AJ3F 3H2VE 4K4XA 4OJ3A 2N82B 3L7OA 2DGUA 4LIWA 2E9RX 3TAMB 5HK4A 4IFVA 4LSNB 3R5JB 2DNMA 4S0MA 2DXFA 3CC4S 3CJ2A 5FDLB 3OHAA 2UUCJ 4K4ZA 3NGDA 2GVDA 2MKCA 1HNWF 4ES1A 4CLKA 1FRJA 2RT3A 4CLPA 3KHGA 4PQAA 3M8ZA 1FKOA 1DQAA 1YKWA 3TNVA 5FLXU 3R1LA 4NLTA 2D3OR 1N33F 4Y28C 4ZCKA 1NM2A 4F50A 3G6XA 5IT4A 2BKOA 4CNYA 3BZQA 2YPYA 2Q6BA 3G6VA 3TOQA 1JLEA 4YUDA 2RKIA 2DR9A 1WF0A 4HDGA 4IUFA 4LSLB 1FE0A 2C2KB 4HHUA 2KXFA 5I4MA 3U27A 4TU8A 4OL8A 3JQKA 3Q24A 2XY7A 1VQ7S 2IRUA 1FJGJ 3PYDA 5IZHA 5A0YA 5KG6A 4G6VB 1B70B 1Y0HA 2CKWA 1KTVA 4MKVA 3O3LA 4HR2A 1RE1B 2RRAA 3OFFA 5GADI 3OSPA 5KFFA 5KG1A 5T41A 2PD1A 4U67Q 4L6V3 1WG1A 2N4CA 1RT3B 4HTJA 1Q16B 4F3MA 4N77A 4IKAA 1L5UA 3M8QA 2COLA 3RG6A 4I6AA 2C1EB 5H9EJ 4M5JA 3TQ1A 2XO6A 5CYQB 2AF6A 2OTLS 1R3NA 2WVEA 3WDOA 1QSSA 1LK7A 3UWTA 2HNDB 4J9SA 4OX6A 4F4ZA 2Q3PA 2CPDA 2CUYA 1HBNB 2IPOB 3GIJA 5A8RA 4NYPA 1UWAA 1RZMA 5A6WA 4K5SA 3HFKA 4FXVA 2GZOA 5D77A 2GIQA 1X5TA 2CXEA 4UY85 2BJ9A 3MEEA 5HANA 2P9CA 3I0RB 3D7SB 2ZOMA 3UDEA 3L3CA 2VQFF 2QLJB 3PW4A 4JI6F 1IN0A 2E7XA 1MN9A 1GXLA 2RSQA 1R0CB 5KFOA 4B9SA 4ZPDA 4F02A 2OP5A 1PCAA 3UD4P 5EX0A 3D3BJ 3EDQB 2DPJA 3OTCA 4B3RF 4ZPVR 5E2QA 3BKUA 3KK2B 4O3QA 1R8BA 4F2RA 1F0XA 1IQZA 4U6PA 3VAFA 3Q8SB 2YKMB 2JDJA 2HBYB 2PT0A 1U25A 1HWUA 2DNLA 3TJ9A 3QRRA 3DLEA 4ATNA 5CCMA 3A3PB 2Z0GA 3I9ZA 5LMNF 3ZTRA 4OIXA 1WG4A 4LR9A 1M5OC 1ROFA 3IM8A 2KO1A 1F60B 4CP5A 1YZ6A 5JVHQ 2V9WA 2GMLA 2OIHA 3QO9A 4PXDA 5D3GB 1JJ2R 1PO6A 4USJC 1R0AA 3OXLA 4B9VA 4IOAQ 2N4DA 2MY8A 2QMUB 1S9GA 2I1RA 1YRXA 2VBZA 2VG6A 4DCJB 2BMBA 3QJJA 1GH8A 2OSRA 3NGSA 3MMBA 2CQIA 4FKXA 5T14A 3AH6A 3ETMA 1O5JA 1AXQA 2BYCA 2ERRA 1V5VA 2DHXA 4Z7YA 3M2RB 3NAIA 3D6MB 2MKYA 4QIFA 1FA0A 1AFIA 1K1QA 2DH7A 1TL4A 3DLGA 2IRXA 4Y65A 2DGSA 5F8GA 5H1SV 1U0HB 1AFJA 2MZTA 3E01B 3KK3A 3M30B 4K7QA 4X4OA 2Z2YB 3V5RA 2OPQB 2G1HA 5A2QY 2VODA 2UUTA 2FUG9 4DR1F 3BV8A 2K7JA 2W9CB 1RHUB 1HNZF 1RAIB 1U26A 3DU5A 2WONB 3FCWA 4KHMA 2WW8A 3G6ES 2YWFA 2WBMA 5F8MA 4M94A 2CNLB 4B3SF 3GYGA 3SYZA 5I3UB 3SDEB 4DSIA 1N5YA 1VS3A 3AXMA 3RTVA 3WHIA 2GIRA 3VR1A 1EB0A 1R43A 1U1RA 1U0SA 2EKYA 4LQ9A 1PC5A 3QT6A 1TFWA 2ILZA 4A47A 1REGX 4JI1J 1RU2A 3CMAS 2ZEJA 4F4WA 5AJ3J 2JEFA 2Z58B 1SBRA 2FHOB 2FY8A 2W2PP 2G1DA 3IO1A 4OHWA 3GR0A 1Q8IA 4EU0A 1S76D 4FNIA 3I31A 1Q5VA 2O3DA 4IQXA 3EYZA 4OYXA 1RKJA 2AJ0A 3RRKA 5DS7A 2XYPB 3GYXB 3S01A 1FFWB 3UI3A 1HNWJ 2HFZA 2CNKB 1VQ9S 4ZN1A 1HL6A 3TW0A 1N0UA 1BLUA 2XMAA 4TU7A 3KJVB 3OHBA 5K8OA 1Z1ZA 2BRLA 1H2TZ 1N33J 2AEFA 1LW2A 1EHWA 3R97A 1UAWA 2ZKUA 1BQNB 3CCMS 3OR2A 4B9LA 3MECA 4MMOA 2VG7B 3LGMA 4CT9A 4CO4A 4L73A 1MSWD 4DL7A 2CQHA 1VIXA 3AD9C 3D67A 1KTQA 1SKRA 2DH9A 1LWCB 4ES2A 4E2FB 2HGLA 1SQGA 1IM4A 3HJFA 1FD8A 2NCKL 3W5YA 5F8NA 1OQ6A 4RUAA 1P6TA 3ZTQA 1I6JA 2G4BA 4JI7J 4DOZA 1JK9B 1UPPA 4RNHA 4F04B 3UDLA 1J5EF 3AJ1A 1XEZA 3A4TA 5EDWA 2DNOA 1CJUA 3ZNJ1 2PSZA 5HBMA 2CADA 2XI2A 3FFIB 3CVKA 4KBIA 2Z2ZA 2MGZA 4IRKA 5D4PA 1FHTA 3IR5B 2JEGA 2PI5A 5I42B 1N8RT 2CWKA 3F73A 3VHQA 2VIHA 1Y7PA 4M1KA 2YNGA 3CDBA 2V9KA 2KG1A 2F7VA 3IWLA 3PJ9A 3N5BA 1C1BB 3PIPQ 1YLXA 3NNHA 5DGBA 2XS7A 2UUWA 1R0BG 3G8QA 3MHYA 2W2OP 5L9NA 1F9HA 2H54B 3A8JA 4C0OC 3ILIA 3KXDA 3R2CJ 1F3FA 2VQFJ 4O4GA 4WP3A 2GQCA 2QLXA 3L09A 1ZZNA 3PIOQ 5LSRA 5J2MA 2HRUA 3H2UB 4OZ5A 3UCGA 2ATLA 2SXLA 3JS9A 4B02A 4B3RJ 2R42A 1TUVA 2IMOA 3QSYB 1TQLA 3TQEA 2FTRA 1YK9A 4NLPA 4NASA 1C0TB 2B8PA 2OPRB 4J9QA 2HMIB 1B3TA 4WF9Q 2QSFA 2F3JA 4WIIA 5LMNJ 2E29A 4I6YA 2XB2D 1T05B 4FF1A 2B43A 3EWGA 3HZGA 1RB0A 5GAHI 3DGPB 1HHQA 2IDLA 5KFVA 2ACMA 4G3IA 3SFGA 1AZSB 1ZH5A 3M2UB 3CC2S 5J1NA 4LIRA 2AKWB 7FD1A 3IBFB 3UN3A 3HT3A 1RTZA 4P2FA 2C3PA 2C3OA 4B3MF 3GE9A 3PR5B 4R8UA 2YX4A 4DV0F 1MROB 2XWYA 3MDFA 3PNIA 2EC2A 2X3GA 4K59A 1WTBA 5HP1A 2G2ZA 2KZZA 2A18A 1OY6A 2B4VA 3VAHA 3GFYA 3T9NA 2AX0A 4DSLA 1TVRB 4CI0B 4NXMF 4O3PA 3EM1A 1TUWA 3GJQB 1VJQA 3IRXB 2AEMA 1BGXT 2ZVIA 3SV4A 1RWWB 2OD6A 3TJAA 3OSNA 1U1PA 1GNKA 4B3TF 2M3DA 4UQGA 5FJ4A 4EI2A 3OV7A 3M32B 1M5VC 1J2VA 3JSRA 3J80U 4MIAA 3HJVA 3MEDA 2BW2A 1B7YB 4I2PA 4P2MA 4GKKF 2V4JA 2IJNA 4DL0C 4IDKB 3H2LA 4A8OA 1ZETA 4NOHA 4K50A 5LL6d 4TN2A 4DR1J 3FJ2A 4Y0FA 2H4YB 1HNZJ 5LXRA 4KQZA 2MPUA 4IFVB 4M95A 3KLFA 3PW2A 1EZZB 4W92B 4B3SJ 3BYRA 2HLTA 2GVDB 3DOKA 4KHRA 5KFBA 3HVTA 4W90B 2CA9A 3ULHA 2PA8D 2VHGA 2MXYA 5KG7A 1JX4A 1FKOB 2OUGA 1S7IA 2WB4A 1L3TA 5E3AA 4H4KC 1BMQB 2RAQA 2RUGA 2QMWA 1RACB 3CCWA 3LO3A 3TVZA 1GXTA 1U1LA 4ELVA 1QAIA 3OL7A 3SCLE 3VAJA 5KFIA 1WSRA 2LXIA 1WC1A 4JOUA 1YVFA 1JLEB 2KYXA 1ZBTA 3PEJA 4Q0BB 1FK9A 2F65A 2H5JB 3QWPA 3Q8UA 2PN6A 3EVWA 4DL6A 2HW3A 2ZH2A 1NZ8A 4YOEA 2CVEA 3T1HJ 2BJ1A 2CJAA 2KXHA 2NUUG 1NH7A 4YEAA 1TKTA 1NNDA 4FZVA 1B64A 1MNEA 3AOCA 4N41A 3FEYB 1CQMA 3SZ2A 2IBKA 3AT1B 1U1KA 2AX1A 1ACMB 2HWIA 1CS4A 2JFDA 1NAQA 3O5TB 4RX6A 4CO2A 4A8WA 3D28A 2ZDPA 3MURP 3H4BA 4JUZA 1F6TA 3BPSP 1CJTB 3M8QB 1IJEB 3I0SA 2F1FA 1FXDA 3LP2B 2C2DA 4QOTA 4X4QA 1BQMA 3HI9A 4CLSA 3BB5A 3US5A 4LF5F 4XPCA 3OL6A 1VYAA 3TO8A 2HVZA 2XHCA 4RW4A 2DT9A 4F7VA 2Z56B 4RWXA 3UD3P 1NCLA 2ZFHA 4CH0S 2HS4A 4ZLJA 4DR5J 4LFAF 2VICA 1WKJA 5CZVA 3T5LA 1J5EJ 1KVIA 1WELA 3HSGA 4DR3F 1EETA 1HBMB 3BSOA 3G6YA 1NB7A 5F41A 4B3OB 3E51A 1KD1T 3CULA 1D9DA 2GQQA 5J2PA 5DQIA 3MR7A 4Y34A 5EGYA 3KLIA 3VVTA 3H5SA 3GG0A 5BXIA 3P96A 4OX8A 2RQ4A 3NS5A 3RYLA 3NBPA 2OFGX 1XK8A 1RT2A 2HAIA 4NYZA 4QCLA 1U2FA 2DRDA 3DGVA 4LF4J 2ZD1B 3DLEB 4DX6A 3RGIA 2VFTA 2HQ3A 2FD2A 5D6GA 3V6DA 3AA9A 4KTQA 3TJ8A 4FYYB 1LOUA 2XSJB 2Z57B 4ZP8A 4CH7A 2DKOB 2M5YA 3GV8B 3AQPA 2IY5B 1NKEA 1JLBA 2IJFA 1D8ZA 2CQ3A 1UJ5A 3MPDA 4X4NA 3KHHA 2CFXA 5J2QA 2R2UA 3QO9B 2R8IA 4UF4A 4GKJJ 1U8WA 5B0EA 3M8SA 5IT9Y 4HHJA 3QGIA 3AY0A 2IM3A 1R0AB 4JV1A 1UVNA 3QGPA 5E3QA 2GMJA 3C15A 3OPKA 3JXOA 3R27A 1NB2A 5A8WB 2GS8A 2Y8WA 1GEHA 3IS9A 2VG6B 1FDNA 1N5TA 2BABA 2F9JA 3M9OB 5ETKA 3MMBB 1Q1KA 4DF8A 2VU5A 3I82A 2R8GA 2YBVA 3FBBA 1XMOF 4QR1A 2VC0A 4NCAA 2J6TA 1UKUA 3DDNA 3K59A 4MK9A 4ZVHA 3A8EA 4B08A 3FDSA 1MG7A 3PEHA 1U1NA 4XK8C 2E5IA 4B3MJ 3W8GA 4DS4A 3QFHA 2NLWA 4ZVGA 4DV0J 4QYRA 3V6HA 4YDXA 3F44A 3DLGB 2J7UA 4JP8A 1E6VA 2PEBA 4WXOA 2W01A 2HVDA 4Z37A 3PVXA 2CQPA 3MAQA 2E1MC 1FEHA 3OJSA 3KK3B 2C2OB 5KFDA 2DNKA 1M1GA 4A8YA 2YPZA 4NLQA 3CCUS 2FLNA 3I4HX 1KP6A 2IM0A 3NXZA 4UZBA 4RUBA 3OUYA 5IQQA 2MJUA 2Q6CA 4LBHA 4B3TJ 1ZM4A 1N5YB 1S99A 4C0BA 4HLBA 4J7CA 2OSQA 4DPUA 3TEGA 5JJBA 4BCAA 4CYUA 4DX7A 2OELA 2LU1A 4ED8A 3JSMA 1SB6A 2WVBA 1FDBA 1RHRB 1OO0B 3QT7A 1ZPWX 2HHUA 3D1QA 5G4DA 1MU2A 4DG1A 4WFZA 2ZH6A 1R8CA 2DNGA 2N7CA 3W64A 4MFBA 1H2UX 2KDOA 1FFGB 3M1VB 4ECVA 3PTWA 2UZAA 2G2OA 3VWSA 3GZ7A 4K4WA 5KG2A 2HAFA 3SQGA 1R27B 2BXJA 3AHPA 3IWXA 1T95A 2F8MA 2GAHC 2HBRB 2AGPA 4KT0C 3H42A 1FFSB 2QN6B 3THPA 3J7AN 3MEGA 2CNOB 1FJ7A 2VJUA 3GSIA 4UZCA 1LW2B 3BN7A 4PEOA 1N6QA 1FXLA 1X4GA 2GC8A 4NPOA 4ECRA 1NJIT 1IKXA 2MDAA 2BJ3A 3MECB 4F25A 2UUAF 4FF2A 4F0HA 1JLCA 1MWQA 1VHIA 1DRZA 3CPWR 2JL9A 1T3NA 3CD0A 2YQ1A 2E1PA 1AYEA 4ELTA 1WEXA 5DDPC 2R8JA 1FTCA 2A10A 1VK8A 3PXGa 2HZVA 3J7A1 4X65F 1LNQA 2YKQA 5A2QU 1H3DA 1MWZA 1P1LA 3P8BB 4YB5A 4P2XA 1DY3A 3T1YF 3BSAA 2HFUA 1YHQS 2RU3A 3DN9A 1B7FA 1PYOB 3CMES 1C2PA 4ZP7A 2DO0A 5E41A 5HBMB 3H0PA 1XMBA 2AJ1A 5F9LA 2MGZB 2KFYA 1MLAA 2C2MB 3ZZYA 2PA3A 2E44A 2YNGB 4YB1P 4LF5J 3OLBA 3KJNB 6FD1A 4WFNQ 3K7RA 3H4DA 4LFAJ 4Z7CA 1N56A 4WFAQ 4C0HA 4NA3A 4ANCA 3MUVP 4LRAA 2PEHA 3CIMA 5C25B 4DR3J 2AV5A 2IFXA 1W26A 2KU7A 3M8PB 3BSNA 4CLWA 4RBUA 4O4GB 3R2DJ 1VIOA 4ZVPB 2R4FA 3HCXA 4C3MA 1A0OB 5J2MB 2MZQA 4OYZA 2VA2A 5L1IA 4CIOA 2R7WA 2CYYA 2GV1A 5DG9A 3DRXA 1B0PA 1Y3JA 2LQ8A 1YQHA 3VAGA 2BW7A 3HKWA 2M9KA 4MH8A 4F8RA 5KFHA 2NZCA 4ED4A 2EBGA 1YTYA 1RI7A 1X31C 5DQHA 1VMBA 1CULB 3IR6B 2BANA 2WAQD 2KN4A 2HWTA 1WNEA 1GXUA 4M8LA 3KWMA 4Z2XA 5KFXA 3QMQA 1X4EA 3CJ4A 3PO4A 2IJRA 2GO9A 1Q4RA 3J7YU 4HI2A 4O0IA 4MIBA 2LDYA 2RVJA 1K47A 1FXRA 2R7UA 2VBXA 4JV0A 1Y9OA 1K0TA 3GJTB 1S79A 5A8KB 1LEOA 3QRPA 4WCEQ 5IOLA 4K8RA 4R8UB 1I3OB 1FJCA 4CLFA 1NHUA 4NLOA 4J9MA 2QYCA 4RJVA 4OYWA 3ZZTA 1NK5A 1SH2A 2Z30B 1FDDA 3RW6A 3KUGA 3HSJA 2R8KA 4KGVB 1AUSL 4M5HA 2C2ZB 2CVIA 5HP1B 3THVA 5L8RC 1PJ6A 3MM5A 4DPXA 2I8EA 4P7TA 2EFQA 4J9UE 4UQTA 2XGQA 4C6AA 2UXCF 4PG7A 1HMVA 3TA0A 1TK5A 2ASJA 4C8ZA 4EZ6A 1HD1A 1APSA 4KJIA 1XMOJ 2V0NA 4FYWB 1XC9A 1RU1A 3T5HA 3TRGA 2B9WA 3OXFA 2LEPA 1IKWB 2F8HA 1G2EA 3W61A 1AROP 3R7NB 2PI4A 3DLKA 2HQFA 1H72C 2ZNYA 4ZJLA 1MWYA 2B3TB 2WW4A 4ZVFA 4LVNP 2CWXA 2V4JB 3HPOA 2RDIA 4J9VA 2V8DA 4WZMA 5HMXA 3K58A 3MI7X 4USTA 4J91A 3GU0A 4B17A 4KKOA 1KHVA 2NPFA 2W8KA 2PFFB 3QRQA 2EVZA 1ZAWA 2GAGC 3A1YG 4E8UA 4EBEA 4RW9B 1UFWA 2ALYB 2IM2A 3N9UC 3KLFB 2OAUA 1QTNB 2HHVA 4ZIVA 3DOKB 2VUGA 1D9FA 1R31A 2MJNA 1JXEA 4LR8A 4A4JA 4N8OA 1M90T 1SVDA 2LMIA 2BOPA 1X5SA 3T6JA 5HO4A 3RBXA 3PV8A 3AQOA 1RWNB 4CO3A 3BDPA 2O1PA 1NJYA 1CEZA 4UOHA 3V6JA 1RHJB 4DUZJ 4IOCQ 1YJUA 3KLHA 4ZCLA 2VF3A 4EZ9A 1T94A 4CLLA 2MQMA 2AJ4A 5MAOA 3DRYA 4TY8A 1RWKB 1FK9B 4OYPA 3G8TA 1NLKL 1Q5YA 4TYBA 4ZVUB 3FVYA 1IJFB 3FK4A 2OI2A 4FYVB 5HLFA 2ADBA 2X51A 4JI5J 4OI3A 3VGSA 2YQ3A 1HNIA 3FGVA 3NGRA 4X4TA 1KFDA 1DLOB 1KKHA 1TK0A 1TKTB 2R7RA 3B6BA 4F4YA 1S6PA 1TL1B 2F9DA 3FBFA 4ZVTB 4J9RA 2EK6A 3JYTB 5DLFA 3M2VA 1P9YA 5EWGA 1M5HA 1CS4B 3TA1A 1QVGR 2DNPA 5ADZA 3HT0A 4HACA 4OZJA 4YQWA 2MQOA 3I0SB 4QW8A 3L9ZA 4F4AA 1H6KX 3OFHA 4HH1A 5DDOC 1KNZA 2D3ZA 1HQUA 1VQYA 4OYOA 4X66J 2VB6A 3LAKA 4ENOA 3R5DA 5CZXA 4X65J 3WIUA 1YZ7A 2P2CB 2O01C 3T1YJ 1N52B 1ZYQA 4L72B 2ZZNA 4ZPBA 3LF0A 2CQ2A 2LKZA 2QX0A 1T9YA 3LANA 1SC1B 2LA4A 4ZPWR 1S9FA 3CJ0A 3PX0A 2YWHA 5J2PB 1M1KT 1RABB 2KG0A 4KO0A 3O1LA 2MLYA 2OTJS 5KG5A 4YHHF 4M5GA 4I64A 1EIYB 2HIQA 3NBPB 3RBEA 1RT2B 4H4OA 1SC3B 5IV3A 3KMQA 3ADAC 1CQNA 5E3PA 5E5NA 2N7YA 2LP4A 3DMJB 3T5KA 2EFNA 1RSCA 3EVMA 3N6LA 4YY3F 3V6DB 5EWEA 2B0GA 4OJGA 2JRSA 5AXNA 1B99A 2D3O1 2RDJA 3FKBA 4PXBA 2VFVA 1RWMB 4C2MA 3RU0A 1NRKA 1RT6A 5K5MA 4NXNJ 4CLTA 4MYTA 2GGPB 5CHCB 1XMQF 3MPVA 3JTOA 3BGOP 3ONQA 4LF8J 1TL3B 3MPUB 5F3ZA 4M5DB 1RTJB 4AYBD 1QSLA 1ULRA 4X84A 4YR3A 4PYAA 2D7SA 1NMEB 3I4PA 2BJ8A 3KG4A 3C15B 1CJVB 2UVVA 2C3UA 1UWBB 1TKZA 4TLQA 2J9DA 3I87A 3IS9B 1AB8A 4PWDA 1FRKA 3ELHA 2HVIA 1VC0A 2RB7A 5C2GA 1N0VC 2K2PA 4WJBA 3MD1A 1T9TA 3RAXA 1BE4A 1C4CA 3RAMA 5E7OB 1ZOTA 2NXUA 5K14A 2MB0B 4F0KA 3S1TA 7AT1B 3N79A 2PMZD 3CCQS 2EFPA 1NZAA 1UETA 1JNRB 3Q8YA 1G4CA 2BM0A 1S4FA 2JSXA 2KTQA 2QT7A 1E6VB 2I9SA 3AFGA 4DUYJ 3QZ8A 3M9MB 2FJEB 3T1AA 1OY9A 2E1CA 3GB0A 4Q44A 3MM9A 3MR2A 3M6XA 3M8YA 1FO1A 2CQ0A 2QYGA 2FJDB 2VBYA 2RS8A 2E7VA 2Y0SD 2OGUA 4MJKA 2M7SA 2GNKA 2IA6A 3FCHA 3GR1A 1W7WA 4M63A 2VG5B 2JLEA 5LMUF 1HYSB 3UFCX 4ZHRA 5DG8A 1W2BR 3B4MA 2LEAA 2JC0A 1S1UA 2AT1B 1X4BA 3T6BA 3JSMB 4RKUC 4OX7A 3BJYA 2GHVC 1MU2B 2ZUAA 3IGVA 3C66A 2WSFC 4NRUA 2AU0A 5ETMA 1O8BA 2R2TA 3W5ZA 3KHRA 3GYNA 3K8WA 4FN5A 4JI4J 1D1UA 3AAWB 1X7VA 1YG0A 1C1CB 3DU6A 4ECWA 3D68A 3ISND 4C3LA 4DCOB 2GX8A 2MZJA 4NCGA 2VZ9A 4JI8F 3X3UA 4QPXA 3QLHA 1YJTA 5IT9U 4USHA 1RA7A 4USUA 4ILLA 1L3KA 2M70A 5F8JA 4N47A 2YVSA 3VGVA 1CJKB 2UP1A 1LK5A 3MEGB 2HHQA 1KWMA 1JLAB 1JWWA 4FS1A 1S1VA 2CPIA 2XS5A 3THTA 3W63A 1N6QB 5KT4A 4XO0A 4NI2A 2M88A 4WFYA 4CLUA 4USIA 4EBCA 1IKXB 4JV5F 4NYOA 1G6BA 4TQRA 2CPEA 1OPIA 1T03A 3D66A 2LQBA 4DV2F 4FYXB 4XPEA 2CPZA 1S1TA 2MZSA 4A8KA 4FBUA 1X5OA 5AT1B 2HFVA 2VOOA 4JYAJ 3D3CJ 1UVMA 1FRHA 5GVQA 3GFXA 4DR4F 2V4RA 2A2CA 2KFNA 1U8SA 2AJQA 4DL2A 4IFYA 2DYAA 1HARA 2KRRA 3R3TA 3SCIE 2V94A 2ZHBA 4ID8A 3DNCA 2DNRA 4K4UA 1TK8A 4DQIA 1BC6A 3SXLA 2LXFA 3FCVA 1GAOA 2OJ3A 2XGPA 3CCJS 2YNHA 5HAOA 2VV5A 3R6LB 4ZCMA 3BKFA 3H5YA 3KNAA 1BQXA 3AA8A 4CNZA 4ZS6A 5F0UA 3ZNUA 2CJXB 3ZTOA 4CO1A 4RBVA 3BKTA 5LSLA 3NAHA 1IKVA 3TZZA 1V9OA 2L41A 4FVCA 5KFWA 1RAAB 2HRYA 5CA5A 3Q83A 2CPHA 1UTAA 5LXYA 3B8HA 3FNNA 3I6PA 2FZCB 5DDRC 1IKYB 2M8HA 1X4FA 3UO0A 2QFJA 1UMJA 4DFJA 3J7YI 2R7VA 3H40A 3MCSA 1SC4B 1DTQB 2DGQA 2HNZB 1HQEA 2UUBF 5DO2A 3O44A 3BN4A 1TKDA 1XNQJ 3PRDA 2YKPA 3H20A 1LXNA 4ZPTR 1WDDA 1I94J 1R8AA 2DJWA 2PE8A 1D3WA 5KFJA 1HI8A 4YY3J 4O44A 2W7PA 1XBWA 4IG3A 2G9OA 4Q8FA 4HTIA 1QVFR 1NK9A 1DHMA 1RAJA 2W7AA 4ICLA 2KM8C 2D1CA 2AEJA 3ICLA 3BH7B 4CTAA 1TL7A 2DO4A 3GJRB 2VL1A 1XMQJ 3I5BA 2PO4A 3UN5A 1XN9A 2YKNA 5L1KA 2CNNB 4JI0F 1HW9A 1NU4A 1U48A 4HYKA 1UCNA 3BDEA 1DARA 1SL1A 1AW0A 3IM9A 2DIUA 2DEIA 4P52A 3MTKA 4ILRA 1VQOS 4QWAA 3MM5B 3B4DA 1RYSA 2HVHA 1FJEB 2ZM6J 1ZTWA 4DV4F 1SXLA 1P8GA 3SBMA 2POKA 1R6YA 2B5JA 5C42B 3R6GB 2XMUA 4DWIA 2G0CA 2DGXA 1WEYA 4QWCA 1Z2ZA 3BQ1A 1U24A 1Y10A 1T11A 3T41A 2WZ1A 3CDEA 3RRGA 4LF6F 4ERDA 1Y5LB 1EJ7L 1RP5A 4KRWA 5B7WA 4RW8A 4X4PA 3DLKB 2P9GA 2C28A 2XS2A 3KJFB 2KHDA 1TMMA 3S6EA 4K4YA 2G0IA 1UA0A 2VDIA 2XSFA 5G0RA 1TU0B 1N32J 1KHWA 5HJYA 3JAMU 2JHEA 4KKOB 1RBAA 4HKQA 1QD1A 2GIFA 5ETSA 2CQ4A 3IG1A 2OEMA 4I0WA 2RRNA 4RNMA 3KG0A 4F36A 3CJTA 5LMUJ 5HROA 3V81A 2PC6A 3B82A 4G1QA 4I2QA 3FC9A 2J7WA 2CDQA 3S8SA 4OJHA 3I56S 3J81U 4C7QA 2W2NP 2CJBA 2W9AA 3MMCA 2WVCA 3PR4A 2ASDA 1DAXA 2YWKA 5C7PA 3CD5A 3RB3A 4B9NA 1Q7YT 3KLHB 3IGNA 1GTHA 4LVOP 2EG1A 2DIVA 4JI3F 4IQMA 3K89A 4TY8B 1FRLA 2JZ5A 3KDOA 1FKAF 5D0RA 4NLYA 4OZNA 2ZKTA 3NS6A 5HVGA 4PUOB 4JI8J 2V4QA 5HLFB 1P9QC 5AXLA 5DJBA 1FI4A 1PG5B 4FS2A 3CNQP 4QQBA 2IIHA 2QA4G 1T9UA 1S0MA 4KV8A 4I7FB 2R8HA 3Q8QB 5ETQA 1WHVA 1OJ4A 3C14B 2E66A 4X4VA 3CT9A 4ECZA 1IR2A 2Y1RI 1RGVA 3SMZA 2YX7A 3M2VB 3CMQA 1VISA 2IHR1 3NRBA 2N3LA 3QIDA 1VLOA 4JV5J 1ZA2B 3QYYA 2XZWA 4HACB 4QWEA 4DQPA 3LUYA 2K8GA 2RF2B 4UUWA 4DV2J 3IBWA 3G86A 2V63A 2XBPA 4C8NA 4Q7AA 3G9CA 2IYGA 3EUNA 2OPSA 1YRUA 2DNYA 4YS2A 2YNFB 1HQUB 3PW5A 4IYQA 2VH7A 5JMNA 2W24A 3VAKA 4ANEA 4WYWA 4EK2A 3WX8A 3MM8A 3CDUA 1UEUA 2BOAA 1XTZA 3VAMA 1HLWA 4DFPA 3GFHA 3H98A 2LCWA 4BS2A 4LFBJ 2DGVA 4KFBB 1RT7A 3D6TB 4U96A 3R7SB 3WBZA 2NYIA 4DV7F 2DNZA 4BHQA 2NZ4A 1JLGB 3AJDA 4CM2A 2ZOFA 5GMDA 4DX5A 5HQMA 2ZBRA 3ENVA 4XIUA 2DBBA 1A9NB 3CJRA 3NGKA 4NX9A 3UNYA 2X1AA 4C11A 1RAFB 2XMWA 3EX7B 1T02A 1B0TA 2RS2A 7FDRA 2C3YA 4PG5A 2HYIB 4AL6A 1YGYA 3R5AA 3M4XA 3H8YA 3GIIA 4OI2A 5DM7Q 1KQGB 4H4OB 1WUUA 8RUCA 2M4MA 2FVSA 4LBPA 9RUBA 2LFVA 3DXSX 4X2BA 1SKSA 3EDRB 4P6QA 4TKTA 2IRYA 3CJQA 3HHNB 2AMCB 4R5PB 1NPRA 2V69A 4DZDA 2XO7A 1S0OA 2VFRA 3FZBA 2J0XA 5AXMA 4EO8A 4LSNA 3AJ2A 1TAQA 4DSEA 2WOMA 2V8PA 2CG8A 3H5UA 4OHZA 3DHWC 2BZ2A 4ED6A 1RT6B 4LRCA 4CLYA 1KVJA 2V6AA 5DG7A 1U2CA 1WORA 2CZ4A 1T3OA 4K2XA 4ECSA 5BYQA 1FVQA 1CLFA 3I32A 4IR9A 2KB2A 3CCRS 5ITHA 3IAM9 9ATCB 1VOMA 5KG0A
chains in the Genus database with same CATH topology
1MU2A 4DG1A 4WFZA 4J9LA 1YJVA 4DX8H 2ZH6A 3PW7A 4C8LA 1R8CA 4UW2A 5T7LA 3U02A 2DNGA 4I67A 2OLWA 3NWGA 5LT5A 2XMMA 2N7CA 2VQEF 4B9UA 4MFBA 1H2UX 2DH8A 2KDOA 1HA1A 3M1VB 5KFCA 2LECA 4ECVA 1DTTB 3K5MA 4PWDB 5KT2A 1IR0A 2ZJQQ 1YITS 1NKCA 5D78A 2IA0A 2UZAA 4Y6IA 2L48A 4PG6A 2IYIA 1Q78A 3FFIA 1M5KC 2BE2B 1ZAVA 3VWSA 4KGKA 4A46A 1JMTA 4RBTA 5J1PA 1K0VA 3GZ7A 3I96A 1C0UB 5GAGU 4NWBA 4DF4A 5B0AA 4TQSA 2ZC3A 2DNQA 2XCPA 4K4WA 1OSDA 5KG2A 2R7SA 2MKSA 4URSA 1GX6A 3D0GE 4K5RA 3MFHA 1X9SA 2FLLA 1IKWA 3SQGA 3IG1B 2MKKA 1KFSA 4CO0A 1VQPS 1R27B 3MR5A 2ZBCA 2KYZA 1WD6A 2BXJA 1C1BA 1RTIB 3IAS9 5MLCV 2B51A 3Q8RB 3AHPA 2HNYB 3IWXA 1T95A 5IQ6A 3V4IA 4C4WA 2JC1A 2B9XA 1HPZB 3JSBA 3PACA 1BQMB 2F8MA 4IG0A 1IBMF 2AGPA 2DHAA 1DQ9A 4KT0C 5CD4H 3PZPA 5HROB 3E3XA 2IMWP 2UXDF 3SFUA 3THPA 4ES3A 2U2FA 4RW4B 2BA9A 3MPWA 4IRDA 4B9MA 3CWJA 3MEGA 4ZPAA 1FJ7A 4WE1B 4CQ1A 2FY1A 2W4CA 1LW2B 3J80Y 3BN7A 1DFDA 4P7VA 2Z2LA 2LQ9A 5HMYA 1Z2LA 4G1QB 4BWMA 1N6QA 4I2QB 1RT3A 2W7OA 4J37A 1X4GA 1FXLA 3D1HA 2NSCA 1W25A 4OHXA 2GC8A 3WZ0A 4NPOA 3TI0A 4ECRA 2ADCA 1NJIT 3GSDA 3E2EA 4X62F 1IKXA 2MDAA 4BWJA 2FHJA 2OMLA 3OW2R 2BUNA 2DB1A 1B0VA 4C8OA 2NS1B 4J9NA 1LKZA 2O67A 2F40A 3LP0B 3FMBA 3MM9B 5KFEA 4ED1A 2AGOA 2CG4A 3MECB 5KTQA 5E33A 1YSJA 1EETB 1YIJS 1H38A 3K5LA 4RW9A 4F25A 4I56A 3LWLA 2HWHA 2UUAF 1SH3A 4FF2A 1NK8A 1JLCA 4DL4A 4DR2F 2LQJA 1DRZA 2M8DB 1VQSA 1MW7A 3CPWR 5KFRA 5L39A 4V19J 2JL9A 3OVBA 1T3NA 3CD0A 1FE4A 1VJWA 3R5BA 3D0IE 3JB9k 4Q45A 5C24A 3EXYA 5F9NA 3N5FA 2ROPA 1N36F 4RUCA 3HO1A 4ELTA 2Z2MA 3FSXA 1HNVB 4C3KA 3D1OA 1WEXA 3TVKA 5DDPC 4NLVA 2NREA 1QAJA 4DV5F 5K8PA 1H7WA 2R8JA 3R5CA 2AYMA 2ZH7A 3KLIB 5IM0B 1X9MA 1IQTA 5HMWA 4WKYA 5F8HA 4J9KA 1FTCA 2A10A 2EW9A 3MOZA 2JH3A 1XNRF 3ZZ0A 1VK8A 3HK2A 3UR3C 2CQ1A 1RT1B 3C8YA 3S7RA 1UVJA 1KRPA 2MKJA 3PXGa 2YNIB 3LPYA 3CXCR 5GADU 5KFZA 2RQKA 2WTFA 4JV2A 5C5JA 4V19X 1S1UB 3NMRA 1GX5A 1C0TA 3FSIA 4ITSA 3J7A1 1TV6B 4X65F 3KLEB 2OPRA 3I0RA 2YKQA 4H4KA 3PX4A 4OI1A 2HMIA 1H3DA 1MWZA 1P1LA 3GG1A 1Q86T 4YB5A 4KE5A 2HFOA 2PDAA 3L95X 3T1YF 3BSAA 1LV5A 4BC7A 2ASLA 2L08A 2FPHX 2L3MA 3GIMA 2CPXA 1YHQS 1OQ3A 2RU3A 4K4VA 3DN9A 1T05A 1B7FA 1CSJA 2PGCA 3MM7A 3CMES 3KK1B 1C2PA 4ZP7A 1LW0B 2DO0A 1QUPA 5HBMB 5E41A 3NP5A 4DQRA 2GHPA 3MGJA 2LEBA 3PY8A 2BDPA 1JLFA 1L3UA 3HHLB 1VQ6S 1Y3KA 2VC1A 1XMBA 3M2UA 3I5AA 3GILA 2AJ1A 5F9LA 2MGZB 4I1TA 2KFYA 1MMDA 2WSCC 1WACA 4RNFA 1S1WA 1FDAA 2L9NA 3ZZYA 5GAEI 1SJQA 2C2RA 4WU3A 2PA3A 2E44A 2CPYA 3DOMA 3W2VB 1JLBB 2YNGB 1KQKA 3T19A 4X64F 4YB1P 4U7CA 1CG2A 1JJHA 4AL5A 3KK2A 1DLOA 5KG3A 5B08A 2XULA 3OLBA 6FD1A 4YB6A 4WFNQ 3DOLB 1RTDB 3K7RA 1TL1A 3H4DA 3C46A 4YB7A 2AYGA 5J2QB 2V5HG 4ED2A 1WF1A 3NCRA 3I9V9 1MROA 3POTB 4ZP9A 4WFAQ 1N56A 3IWNC 2RILA 4ZDNA 4C0HA 4NA3A 2LYVA 2Q66A 4J9OA 1REVB 4WK3A 3JYTA 3MUVP 3OLAA 2ASYA 4HI1A 3MPYA 4KSEB 1FRXA 4MKYA 1RTHA 2PEHA 4LF7F 5F8IA 1S6QA 1SJRA 4IH6A 4P2SA 3PW0A 1S1VB 3PRBA 1CC8A 3MZIA 3CIMA 5C25B 4XDCA 3MM8B 2AV5A 1G7CB 5KFLA 5J1EA 2IFXA 2KU7A 3CDAA 2AJFE 2GQ2A 3M8PB 3M6WA 3G71S 2FLPA 3BSNA 2Y1IA 1D0EA 2FJAB 2GO8A 4RBUA 1UJ6A 4O4GB 2V2KA 2RD5C 1VIOA 3HVWA 2R4FA 3D5MA 4MKAA 1U1MA 1RT7B 4OLOA 2EBEA 3IRXA 4DLGA 3CC7S 2X1FA 3P5TL 1QJHA 2FJVA 2HHPA 2FB0A 2JEIA 2MZRA 2D3UA 5L1LA 2RRBA 4C3MA 1S48A 1T03B 5J2MB 2EC0A 2IBOA 4QR2A 2ZH3A 3QIPB 2MZQA 3FEXB 1F2GA 2IVYA 2P6TA 4HT7A 2VA2A 5L1IA 2ZBIA 4CIOA 3ENWA 2BBEA 5D3GA 2AGQA 2R7WA 1NJWA 2CYYA 1OS5A 5JXSA 3UE2A 2GV1A 3V2UC 5DG9A 5K8MA 2HHWA 3M32A 5KFTA 5KT7A 3DRXA 3EGWB 1B0PA 1HI1A 1Y3JA 1K8AT 1Q8BA 3MM6A 1YQHA 3CF5Q 3TAPA 4ED3A 3VAGA 4DSJA 1J5OB 4MIWA 1S10A 2RIJA 3HKWA 2M9KA 4F3OA 4ECXA 2P5VA 4MH8A 1URRA 1RISA 5KFSA 1UVKA 2JVRA 4IR1A 3ZC4A 4F8RA 1H98A 3Q23A 5KFHA 3C6UB 2DNHA 3ENQA 4H54A 2EBGA 4WK1A 1KQFB 1YTYA 1P27B 4QYZJ 4IDKA 5KFMA 1N4LA 1RI7A 3PX6A 3DLBA 4JI1F 4RW6A 2VD3A 1VMBA 1VRTA 5DQHA 4EGLA 1L3VA 2VBWA 3IR6B 1TP7A 3EGZA 1FVSA 2BANA 2WAQD 2E5HA 1URNA 1JKHA 1SV5A 3H2VE 2KN4A 5AJ3F 2HWTA 4K4XA 3T5JA 1WNEA 3RR7A 1GXUA 3DRRA 4IFYB 2FC9A 2XHWA 4M8LA 3KWMA 3OFGA 4OJ3A 3TVYA 2N3OA 4Z2XA 2N82B 5KFXA 2K1RA 3L7OA 1RT4B 3QMQA 2DGUA 4LIWA 1X4EA 3TAMB 2E9RX 2HZCA 2OPPA 1ZTTA 2JFKA 3CJ4A 5FD1A 1S9EB 2KI2A 4IFVA 3PO4A 4N76A 3KFWX 4LSNB 2GO9A 1Q4RA 2B7CB 2DNMA 3CC4S 2XEXA 1F5CA 3J7YU 4HI2A 3CJ2A 4O0IA 2FVPA 5FDLB 4MIBA 2LDYA 3M2RA 2RVJA 3OHAA 4K4ZA 1JJ4A 3NGDA 1TZ0A 1FXRA 3CJKB 2MKCA 2E5JA 3K5PA 2R7UA 1X8DA 2YNHB 2VBXA 4JV0A 2FLOA 4DJBA 1Y9OA 5LSOA 1HNWF 3MMAA 1RT5B 1G1XA 4ES1A 3OUYB 1K0TA 4F67A 1FRJA 2RT3A 2NR0A 5B0CA 1SIZA 1S79A 3KHGA 4PQAA 1JXLA 5A8KB 1FKOA 1DQAA 2MMYA 3EPIA 4DQQA 4WCEQ 4O23A 3TNVA 4R8UB 4J9PA 2BV3A 1FJCA 1Q7LB 1NHUA 4NLOA 4J9MA 1R8HA 2QYCA 2O66A 2ZH8A 3R1LA 3ZZTA 4NLTA 1NK5A 2D3OR 2VPYB 1IKVB 2DCLA 2Z4PA 3DMJA 4Y28C 3OL8A 1N33F 4ZCKA 1SH2A 3CDWA 1FDDA 4ETXA 3RW6A 4F50A 2R8KA 3G6XA 1NH8A 2NPIA 5IT4A 2OPQA 3DRSA 1K9MT 2QZ8A 4Y00A 2CVIA 2ZVSA 5HP1B 1CPZA 4CNYA 3THVA 3BZQA 3KNGA 3MM5A 5L8RC 4X4UA 2I8EA 1SC6A 2Q6BA 3G6VA 5KAKA 4P7TA 1V3ZA 3LGNA 2EFQA 3DRPA 3TOQA 4UQTA 4DG1B 1JLEA 4YUDA 2RKIA 2XGQA 2W9CA 2UXCF 4ZVEA 4PG7A 2DR9A 1Y5NB 1WF0A 1R7IA 4HDGA 4IUFA 1FD2A 1HMVA 3CCVS 4LSLB 3TA0A 1TK5A 2LA6A 1FE0A 2YX1A 1U6BA 1TR0A 2KXFA 3SSSA 5I4MA 4MFBB 2ASJA 4C8ZA 3U27A 4EZ6A 4TU8A 1HD1A 4OL8A 2GGPA 1APSA 5I3UA 4KJIA 4FP9A 3SDEA 3DFEA 3Q24A 2KJVA 5L38A 1TL3A 2V0NA 3C6TB 4TLRA 1XC9A 2X1BA 4M5DA 1FERA 1RTJA 2XY7A 1VQ7S 1MMNA 3GV5B 3T5HA 3CB4A 3TRGA 2IRUA 3UCZP 2B9WA 5DM6Q 3OXFA 2LEPA 4DR6F 1IKWB 5IZHA 3SQGB 3CGIA 4TU9A 1HQEB 2F8HA 2WSEC 1IXKA 5A0YA 4KC5A 4WXWA 1G2EA 1N48A 1AROP 3BEGB 5KG6A 2PI4A 3PFEA 2XMVA 3DLKA 4G6VB 4UOCA 3DLJA 2KXNB 4X4SA 2ZNYA 1MWYA 1Y0HA 2B3TB 2CKWA 2FVQA 4ZVFA 1KTVA 2IAJB 1UWBA 1WG5A 3O3LA 4LVNP 3BGRB 2RRAA 3OFFA 2V4JB 3HPOA 5GADI 5KG0A 4A8FA 3OSPA 2RDIA 5KFFA 5U47A 3BO3A 2A2DA 2V8DA 5KG1A 5T41A 3N6MA 1HI0P 2PD1A 4U67Q 4WZMA 2B4OA 2R7OA 4L6V3 3SEOA 5HMXA 3MI7X 3K58A 1WG1A 2WK4A 3BO2A 2N4CA 1RT3B 4HTJA 2XMKA 1Q16B 4QZVB 4IG3B 4R0EA 4B17A 4F3MA 2QA1A 4KKOA 3HDSA 1KHVA 4N77A 5E0OA 4IKAA 2NPFA 1L5UA 3X1LB 3M8QA 4ICLB 2W8KA 2COLA 1E6YB 1XR7A 1XR5A 1Q79A 2PFFB 4I6AA 5H9EJ 2EVZA 1SL2A 1ZAWA 4LFCF 3LP1A 1RJJA 4OX9F 3TQ1A 3A1YG 3IR7B 5IS2A 3TAQA 3K0JA 5CYQB 4E8UA 2AF6A 2OTLS 4EBEA 1R3NA 2J0QD 4RW9B 2ZZMA 1UFWA 3WDOA 1QSSA 1LK7A 2IM2A 3N9UC 2HNDB 3UWTA 4I4BA 4RW7A 2KM8B 1JLCB 2OAUA 5K8NA 3KLFB 4J9SA 4OX6A 4F4ZA 1NJZA 1TKXA 1NK7A 2Q3PA 1O51A 2HHVA 2KRBA 3DOKB 2CPDA 1Y00A 2VUGA 2OMOA 2YKNB 3ISZA 1HBNB 5C24B 1HWJA 1D9FA 1R31A 2MJNA 3GIJA 3UPFA 1JXEA 1IBKF 2P6SA 5A8RA 2ZJPQ 2YKAA 4N8OA 4A4JA 1M90T 2LMIA 4NYPA 1WTFA 2BOPA 1X5SA 5A6WA 2RNEA 1VRUB 3HFKA 3OR1A 4K5SA 3T6JA 4EEYA 2QE5A 5HO4A 4FXVA 3PV8A 3AQOA 2W4DA 5D77A 4CO3A 2RU9A 3AB2B 1QUVA 4NZ7A 3VALA 3BDPA 1FESA 2O1PA 2R2SA 4F26A 2GIQA 3CD6S 1NJYA 4PQUB 3V6JA 1X5TA 1CEZA 3U1MA 5D4LA 3CCSS 4UY85 2J9EA 4I69A 2KHCA 2UVRA 2CZVC 3MEEA 2P9CA 3I0RB 4AE5A 4IOCQ 1YJUA 3P49B 2ZOMA 1RK8A 3KLHA 4ZCLA 2DITA 4JI2F 3O2IA 3L3CA 4EZ9A 2VQFF 1C4AA 1S1XB 4PR6A 1T94A 3PW4A 3ITHA 3BGUA 1KLMA 2NSBA 3MTJA 4JI6F 1IN0A 2E7XA 2MQMA 1FF2A 2AJ4A 4O4RA 4O3NA 5MAOA 2EI5A 3DRYA 4TY8A 1GXLA 1LWCA 1FK9B 3MM7B 4MAKA 2RSQA 3G8TA 2B5JB 1P1TA 2VG5A 4TYBA 5KFOA 3MMJA 1PGZA 4B9SA 4ZPDA 4F02A 2LQ5A 2OP5A 3FVYA 3MWBA 1HYSA 1IJFB 1RKIA 4UY8T 1IBLF 1CVJA 3UD4P 2DPIA 4Y2MA 3BQ0A 3IC1A 5EX0A 2W9BB 5HLFA 2ADBA 2X51A 2HG4A 4OI3A 2DPJA 3OTCA 5AE1A 2FC8A 2DRAA 4B3RF 4ZPVR 4ID5A 2PIIA 2YQ3A 1N88A 5E2QA 1HNIA 3FGVA 4X4TA 1KFDA 4KB7A 1DLOB 1OWXA 2FGCA 2MQLA 1R8BA 4O3QA 3KK2B 1TK0A 4F2RA 1F0XA 1TKTB 1IQZA 4NZ6A 1N54B 2AWZA 4QJVA 4U6PA 2R7RA 4ED5A 3VAFA 3FSYA 1KOOA 3Q8SB 4F4YA 2E5GA 4PXCA 1S6PA 1TL1B 2YKMB 4RW8B 3W3SA 2JDJA 2F9DA 2QA4S 2CPJA 4ZPCA 5M2PA 2PT0A 4J9RA 1U25A 3DI6A 3DC2A 4E0DA 2EK6A 3PDNA 1HWUA 2DNLA 3DLEA 4ATNA 2EFOA 4DUZF 1X0FA 3JYTB 3OQ2A 5CCMA 3J7Z5 5DLFA 3M2VA 5EWGA 2Z0GA 4YFUA 1FTRA 1UEVA 1M5HA 4EO6A 3TA1A 3I9ZA 4J5OA 1TL5A 1HR0F 1JLQB 2Y1JA 1QVGR 2CJKA 5G0RB 1C1CA 5LMNF 3Q0AA 1QAYA 4HEA9 2AYBA 2DNPA 2I2YA 3BGFA 5ADZA 4OIXA 1WG4A 5AE2A 2JJ4D 5KFYA 3RB6A 5I42A 1M5OC 1ROFA 4OZJA 2VA3A 5J2NA 2KO1A 4YQWA 4X4RA 2MQOA 5DGAA 4BC9A 1F60B 2L9DA 3I0SB 2AQ4A 2WRMA 3PO5A 4QW8A 3PJWA 2OFHX 2EG2A 1H6KX 3KLGA 2ZOGA 4JI5F 3QJPA 3OFHA 3MEKA 4HH1A 4DBQA 5JVHQ 3J7ZT 4NMLA 2V9WA 4LF9F 1SH0A 4ED0A 2GMLA 4ILMA 5DDOC 1KNZA 3RAQA 1YWXA 2OIHA 2D3ZA 3QO9A 1QE1A 1HQUA 1VQYA 4PXDA 5BYSA 3HMJG 5D3GB 1JJ2R 3V81B 2VB6A 1JLAA 1PO6A 3LAKA 3N6NA 4TY9A 4USJC 1HNXF 1R0AA 2YWGA 1HBOA 2IC3B 3R5DA 5HN0A 3OXLA 5CZXA 3OXGA 4NCBA 2ROEA 2ZE2A 5E3RA 4B9VA 2DR7A 5THWA 2R7TA 4C98A 2O01C 2L9WA 4ALZA 4IOAQ 5CYJA 1U47A 2N4DA 2MY8A 2H5EA 1S9GA 2YWEA 1PILA 2I1RA 1YRXA 2MY7A 3FQKA 2IVFB 4QIEA 1N52B 1KS2A 1VFJA 3MMCB 1ZYQA 2VBZA 1HWLA 4L72B 2VG6A