2L9DA

Solution structure of the protein yp_546394.1, the first structural representative of the pfam family pf12112
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
GMGTTEKSGIKEIIIQGLTRAGKPFRPSDWVDRMCSTYASFGADRKLRYSPYLKPRVIEGVRCLAVDLKLKDTNPEGFNQLMHFATENQLNILDAEGNSIDAAQVTEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the protein YP_546394.1, the first structural representative of the pfam family PF12112
rcsb
source organism Methylobacillus flagellatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12112 DUF3579 Protein of unknown function (DUF3579)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9dA00
2L9DA
chains in the Genus database with same CATH superfamily
3LP1B 4NX9A 1FVQA 4ZP7A 2QE5A 1U1LA 1T8EA 4NLXA 1TZ0A 1IKXA 2D74B 2W25A 4HT5A 1KQFB 5FD1A 4DV2F 2BA9A 4I7FA 2CJ9A 4PUOB 4DX5A 1ZS6A 2HIYA 3PACA 4N41A 3CMES 4A8KA 5ETMA 1XR7A 2YWWA 2DO4A 4DF8A 1M5KC 4OJ3A 4P7TA 4AQYF 1RCOB 4CH0S 2DIUA 5GADI 2HHSA 2GJFA 5DDOC 3R5JB 1UKUA 1S77D 1UEVA 3BYRA 1T9TA 1WKKA 2E5IA 2V9KA 4USMA 5I3QA 3BKFA 2XQCA 1I1GA 4KJIA 2XZTB 3P8BB 2JEJA 1YWXA 5J2QB 2VA3A 5DETA 1S49A 1OYDA 3CCUS 1JLEB 1I94J 2EFPA 2CJYB 3TUZC 5GADU 5CQGA 4F25A 4WCEQ 4R25A 3T19A 2RH3A 3D6TB 1S6OA 2Z56B 2R7TA 4Y0FA 1XR5A 3UO0A 4EU0A 4DSJA 4N7TA 1HI1A 2JLEA 4L75A 2EW9A 4EEYA 2DGXA 4LF7F 2W4CA 3J81U 1W25A 4QWEA 4RX6A 4IKAA 5CYMA 3ZTSA 3JSMB 2W9BA 4KV8A 2NXEA 1UA0A 3P3DA 2IVFB 1LW0A 4EBDA 3CJRA 4OX9F 3L3CA 5KG3A 2L9DA 2IVMA 2VBXA 3AXMA 4WK1A 4CLWA 3CD7A 2BE9B 5K9FA 2YKOA 1JJ2R 2BX6A 2DH8A 3GU0A 4NRTA 3ZFVA 1EARA 1OQ6A 3QWPA 5AJ3F 2WVDA 5LT5A 2Z0GA 5KT2A 1SJ4P 1S6QA 4AD6A 3C19A 4OLOA 1R8BA 2NREA 3CNQP 3M8PA 4AQYJ 1U6BA 3T5JA 3DOLA 1F0XA 2HRUA 2R8GA 4LR9A 1IQTA 3H0PA 2BKNA 2Z57B 3KK2B 1YG0A 2WONB 3AA8A 3FSYA 3MM7B 4FVMA 2LXFA 4P72A 1RBLA 2HNZA 1S6QB 2J9DE 1GXTA 3LP0A 4RU2A 4L76A 3KMQA 4ZITA 1BWEA 4IUFA 2DXDA 2QYCA 3FSXA 4Y00A 5JVHQ 2MKHA 4M5NA 3M2UB 2HHVA 1EETB 1TL7B 4LF8F 4LFCF 1BQNA 3BS9A 4IG0B 2KDOA 4DV3J 2DVIA 2XM3A 2GW8A 3CIMA 1U1NA 3W2WB 3HSDA 2C28A 4LF4F 2BACA 5KG0A 3CC7S 3OTOJ 2LLZA 1VRTA 2AGPA 4XK8C 4ZPDA 3G2XA 2NS1B 3T1HF 2DITA 2JFDA 2WOMA 4DUTA 2KHDA 2KM8C 3BR8A 1BUXA 3O1LA 4E98A 4ZVTB 1GTHA 2XWXA 5HANA 2F63A 2EFQA 3TUPA 4JI6F 4PZVA 2L9NA 1QD1A 4CTAA 1K0TA 1JLEA 3EDRB 2LEBA 3QZ8A 4J9LA 3MAAB 4NLRA 3R5GA 4IDKA 2UUAJ 2EKNA 5GMDA 2R7SA 4NZ7A 2R2RA 2CPXA 3MMCA 2RS8A 2BJ9A 2BANA 2G1HA 2L48A 3AT1B 3GE9A 4FKXA 2P2CB 1SBRA 3B82A 2ACYA 4DQRA 4GO7X 2JC1A 1OPIA 2HHHJ 3MAAA 3TR5A 3EVMA 1T9VA 5KG2A 1RBOB 3U27A 4JI4F 2X1BA 5H9FK 1TUVA 2FGOA 2H5JB 1FE0A 3OL9A 3UDVA 5CYQA 2YKNB 5AXKA 1N54B 4MFBB 3SSQA 5A8KB 2R4FA 4M5HA 1R0AA 3OSNA 3J7A1 3DNCA 1QTMA 4LF8J 2GIQA 1VQ5S 1TUWA 4QQBA 4YOEA 5EUHA 4AFFA 4CQ1A 4ZN3A 3W65A 2O1PA 4IFYB 1IKWA 1HARA 5M2RA 3NAIA 3TZYA 3HSGA 5DG9A 3HZGA 4ED2A 1YIJS 3NBPB 4ES1A 4DR3F 2C1EB 3HHDA 1VQOS 1T3NA 2YNHA 4P2XA 2HWTA 2CNLB 5ETKA 1NKCA 2ZBIA 3NG8A 3NNCA 5BXIA 1WHXA 3T6JA 2CA9A 4XPCA 3M9MB 3OV7A 2ZH8A 4DX6A 2R7WA 1PBAA 1LOUA 4JI5F 3GR0A 1MG7A 3MR3A 4U67Q 1UVJA 3T9NA 2WW8A 2GGPB 4KRWA 2V67A 4OZ1A 3QNWB 3SEOA 4ZJQA 2RF2A 1SH3A 1LEOA 1VHFA 2AW0A 4R0EA 5F0WA 1UVNA 4DCPB 3ONQA 2MYFA 5J1PA 1HHTP 4JV5J 1ZAVA 1LWFB 4M5DA 2HNYA 3NRBA 1T7PA 2OFHX 3PV8A 4HYKA 2VU5A 3CC4S 3DLEA 1XN9A 4ZPAA 1RT6B 2MQPA 2CRLA 1I5OB 3KLGA 1X0FA 3CDEA 1N32J 2RF2B 2I6WA 3SCJE 1VQNS 1DQ9A 3DOKB 4ZVSB 3D0IE 1S59A 1ZPWX 4LBHA 5F8GA 3MPDA 4EUVA 5HLFB 1SIZA 2RUGA 3H42A 4C7QA 3EVOA 5DGAA 4QWAA 4J9RA 2DTJA 2H5EA 3R5AA 2ZUAA 4DU7A 1SC4B 1FD2A 1FRJA 4IFVB 1KLNA 4QZVB 2V69A 5KOWA 3DCAA 4ER8A 3RAXA 2MJNA 3DLBA 3T3FA 1NM2A 4P73A 3GSDA 4CLYA 5LSRA 4DL0C 1Q4RA 1N34J 2RUSA 2RKIA 3GWCA 4QIEA 4X65F 4DS4A 2IA0A 4C48A 4WE1B 1VIXA 1X0PA 4MK9A 3KJFB 4QOTA 4ZVQB 3LWMA 3I0SA 2R2SA 4LF9F 4K8RA 1UPPA 4YB5A 3W64A 5IT9U 3P6YC 1AB8A 2DCUB 4ZCLA 1F60B 3FMWA 1IBKJ 2BBEA 3M6VA 4HLBA 5A2QU 2RB7A 3FBFA 2ROEA 4PPDA 4I2PB 3FK4A 2W4DA 1MNEA 4O3QA 5IC6B 5IV4A 4JI1J 1S9EB 2QN6B 2MQOA 2ZJQQ 3DMJA 3T9ZA 1Y7PA 1I6JA 4DR7F 2BR0A 2V2QA 2HBZB 3AQPA 3AD8C 4GVBB 7AT1B 2WW4A 2QSWA 4LBIA 2IM1A 1RT2A 3MEDB 2IPOB 2XCAA 3PJWA 2RHSB 3D28A 2OGUA 3CDUA 2IJNA 2HFOA 3MM8A 3QGIA 4RBVA 1AUDA 1SC6A 2H54B 1C1BB 1EKSA 1VQMS 4CM2A 4OJ1A 5D0RA 3KLHB 4Y6IA 3QRQA 1VC5A 1TK5A 2QL9B 4UQTA 2B9YA 3RZAA 4P2MA 2OD6A 4NA2A 4NLWA 3T1AA 3D66A 4BWJA 2UVUA 3BSAA 2Y1LB 4MIWA 4DZDA 1SL1A 3PX0A 3K8VA 3DRYA 2BMBA 3NS5A 1NDKA 1GH8A 5HBMA 1ZA1B 2FJEB 5K8MA 5T41A 1C1CB 4X66F 2DT9A 4UW2A 4DWIA 5DLFA 2QLFB 2YQ3A 5KFJA 1FT8A 3G86A 1H3DA 4PXCA 3DU5A 2FJDB 3ZZZA 4I6YA 1M1KT 2LEAA 1HI8A 3IS9B 1RLCL 4FYYB 4Y65A 2Y1IA 2BJDA 1DQAA 4WTOB 3GMGA 1B64A 1WACA 3DOKA 3PFEA 2XO6A 2MMYA 4RR5A 4IH5A 5H1SV 1S4FA 1ZYQA 5HLFA 2VG5A 1HBOB 1TMJA 1CEZA 1HPZB 1NDCA 9RUBA 3OL8A 2VPYB 1Y00A 3ICLA 3L9ZA 2JX2A 4WYWA 3UE2A 2LKZA 3AQOA 2OMOA 1MLAA 4IFVA 1N5YB 2KN4A 2E5LJ 2UXCF 2YKMA 5DM6Q 3WBZA 1AUSL 2OEKA 4ZVRB 4CZCA 3J7Z5 3FVYA 1ZM2A 3PYEA 5ETTA 5IOLA 3HM9A 5B0GA 3VALA 1O5JA 1NHVA 1TL3A 3H2LA 2BJ1A 4OI4A 1H7XA 5BR8F 2UUBJ 2FC9A 3OHBA 2PFFB 2HQIA 4OV6A 3QQCD 4M1KA 4USVA 2V5HG 4ZLLA 2P6TA 3UDCA 3BYPA 3VGUA 2FJBB 4JV5F 5E2QA 1FK9B 1SVDA 4PCQA 2LDIA 2QO3A 2XSJA 4K2XA 3LP2B 2ZH2A 1TL4A 2CQ4A 2GJIA 1F6TA 1EAYC 1PAEX 2RDIA 1SQFA 3IWLA 3QYYA 4RU9A 3V6KA 4DR4J 2VH7A 1HQUA 2FQQB 3J7ZT 5HMXA 1BQXA 3J81j 2DYAA 3I0RA 3M6WA 4ZVUB 5HMYA 3H40A 3MM9A 3OVBA 4GKKF 1R6YA 3F56A 4BHQA 3HHLD 2V94A 1UJ6A 3GJTB 1OY9A 3GLJA 5KT7A 2N7CA 4ECRA 1TMMA 3BO3A 3NMAA 1D8YA 3AJ2A 2CQPA 1TAQA 1QM9A 1IKXB 1GMVA 1R8AA 3NXZA 3PG9A 3WX8A 1C1BA 1NUEA 3ZC4A 3NGRA 3L95X 4DUZF 3UCUP 5CABA 3D5MA 4JV1A 2CQCA 3T41A 4OHYA 2D3UA 2KFNA 1Z2LA 3TUJC 3EICA 7FDRA 1J5EJ 3VCDA 1QVGR 4CH1A 1HWIA 2Q66A 3VAHA 5IM0B 3OFHA 3X3UA 5KT6A 1RYSA 2GCFA 2E9TA 4MK8A 1RA7A 1UAWA 5IC4B 1S9GA 1GXUA 3BR9A 3KUHA 1IM6A 3Q8QB 2ZH7A 4FF2A 1S48A 4DX7A 4PWDB 3W61A 1RQ0A 2HS0A 5HK4A 4F4YA 1PYOB 1JX4A 2ILYA 3DRSB 4JI2J 4IOAQ 1HNIA 2CQGA 2PA3A 3VAJA 2U2FA 1YJ9S 1PYSB 5B0AA 5C2GA 4CO3A 4OLPA 4C6AA 2OI2A 3MUTP 2J7WA 3ISNC 4CO5A 3JSMA 4NYZA 3NS7B 3TOQA 1FA0A 1FKPA 1NJWA 4F2RA 1JLGA 4HEA9 4JI3F 1S5ZA 3U1LA 1H7WA 5KFMA 2DNYA 1HBOA 1P9YA 2FY8A 1LWEA 1EQMA 3CVKA 2CQIA 1P27B 3M7VA 3OPKA 3MEGA 4TYAA 1S79A 4PQUB 1RT5B 2VB6A 3RR8A 4X4PA 3T1HJ 2Y8YA 2KTQA 3OUYA 4DR6J 4YY3F 3DDNA 2DNHA 4LF6J 3Q83A 2YWHA 4X4NA 4KFBB 5HQLA 3FCWA 1RUSA 3HFVA 4ECUA 1UCNA 2DGVA 3ILJA 1GTEA 2HVZA 1J5EF 2WCXA 4ELTA 4OV1A 3MMBA 1EIYB 1KBRA 3D4JA 2BJEA 2CJXB 3IXQA 2DEJA 3SCLE 3GONA 4RUBA 4BC9A 4WPAA 3M1VB 4CLTA 3JB9k 2OKQA 4RJVA 2JL9A 3R5CA 2HK3A 4LRCA 2M5YA 4FZVA 2F9JA 1FJ7A 1F2GA 1QSSA 3M8PB 3P49B 3V81A 2HNDA 3EPGA 3IGVA 2AJ2A 2DPJA 4O4RA 1WF1A 1ZM4A 2DH9A 2WONA 1Q81T 3PY8A 4RNOA 4OYZA 1RTZA 2XYGB 4F67A 2C22A 3EE3A 4ED4A 3RJMB 2FVSA 3C6UA 1NAQA 4B3SJ 1DBDA 2DXEA 1RWUA 2BE2A 3BM7A 1KVJA 2B9WA 4DV6J 4YDDB 3T1YF 5HJYA 1SL2A 5J2NB 1R6VA 1U6ZA 2PFDA 2JWNA 2YKQA 3R5DA 1S0NA 2DGSA 1RWXB 4GVLA 3W7BA 5FLXY 1D9DA 4E2FB 2MJUA 4Z2XA 2ALZA 3D67A 3EUNA 5FJ4A 3TZWA 1NZ8A 3SZ2A 3Q89A 3CPWR 3FFIB 1EX8A 1G6BA 4OYBA 3HHLB 3RUBL 5E33A 3BJYA 2UVVA 1Y5NB 2Y0BB 4ZVFA 4D3HA 2HGLA 2D41A 1HNVB 2Z8QA 5K14A 4WKYA 5K5MA 2XHWA 4ZVEA 3VR1A 3R3TA 5THWA 2VFSA 1KLMA 3IR7B 4FN5A 4OI3A 1RYRA 1D0EA 3R9LA 2MTLA 3MECA 4DG1B 4I4BA 2M8HA 4RZRA 1GMWA 2XY5A 3LPEA 4GMKA 4LIWA 3PW0A 2RQMA 3IA0A 2BANB 2W7AA 3RW6A 2G2YA 5ETQA 1VQSA 2OPRB 5B0BA 1B0VA 2VFUA 3EGNA 2C2MB 4OQJA 2VL1A 3KDNA 1RWOB 2K7KA 3DI6B 5DZ7A 2XYPB 1JJHA 4ZVHA 3ZZYA 5K8OA 4DQQA 1JLCB 3QATA 2HBRB 3LH2S 4BLGA 2B4PA 1MROA 4RNFA 4ZKAA 2DR5A 3DMJB 2OHDA 3CJTA 3HZEA 1NHKL 3V6HA 4JI0J 3H4DA 1IVZA 4I2QA 1VQ6S 4PEOA 2K1RB 1VFJA 3TAMA 1UZDA 3FBEA 5HQMA 1J2VA 3VVUA 2Q79A 4J9VA 1H6KX 3KLEA 2QTWA 2J5AA 3I9ZA 2DNLA 5I3PA 4DV7J 4OYPA 4KHRA 1NKBA 4NLGA 4FYVB 2HFSA 5CZVA 4PG7A 1ZZFA 5CYJA 4IRCA 2MZSA 1S57A 2JEIA 3QRRA 1RBAA 4H4KA 4ZP6A 1KNZA 2WSFC 1IKWB 4PQAA 2A10A 1OPZA 4YFUA 3CCQS 1PIEA 4ED6A 4CNYA 3I56S 5H9EK 1KC8T 3HO1A 1DQ8A 4Y34A 3TEGA 4OYIA 2BW2A 1NCLA 4PXBA 4DV6F 1KFSA 3DLLQ 1TL7A 2Q43A 2DCLA 3CO9A 5EX3A 3VAMA 3UVJB 2IM2A 3SSSA 2N82B 1PYTA 3J7YI 1LW2A 3G71S 3KUEA 1VDHA 3M8YA 3CUNA 2QL7B 4ZP8A 3SYZA 4OL8A 1GX5A 4YB6A 3OHAA 4JI4J 1YRXA 2FZGB 1HNXJ 1R0CB 1G7CB 3OXLA 4IG3A 4JOUA 1R27B 2WBRA 3PO4A 1NSKL 1LWFA 4M5DB 3MR6A 5L1KA 2POKA 3HMJG 3SCKE 4O44B 2MXYA 1RJJA 2EBGA 2D1CA 1DTTA 5K14B 1NK5A 3FEYB 1WOOA 1LWXA 4A47A 3G6YA 2QRRA 4KBIA 1IKYA 4WXOA 3SIPB 3MEEA 3CCTA 1LWCA 2RE1A 5GVQA 2IFXA 2BW7A 4MYTA 4NEYA 2E44A 2G13A 5JJBA 2CADA 2BV3A 1Q79A 3AA9A 3N4WA 4EGLA 3I4HX 4CO2A 2HQGA 4O0IA 1RP5A 1NU4A 2QLBB 4NMXA 4ECZA 4LFBF 3EMTA 1KOHA 4USKA 3WIUA 3KNGA 1IR0A 3D1QA 3ENQA 2HZAA 3N6LA 2EC0A 2M7SA 1S9EA 1YBTA 4ZVGA 2AZ1A 4WFAQ 3VVTA 5LXYA 4OZLA 1FVSA 2F5GA 4OJGA 1JXEA 4WU3A 1YQHA 4C0BA 3J80U 3TARA 2D9PA 1E6VA 1UWBB 2F40A 4ZLJA 5AXNA 2ABYA 4BBYA 3KHGA 2ASDA 3IBFB 3ZZ0A 2YNFB 2DKOB 3BGUA 3DRPB 1Z2ZA 4PPZA 5AE2A 3MM8B 2FVPA 2I1RA 2QIFA 3QSIA 4DU8A 4K0KJ 3K17A 3JAMU 3KK3B 2ADCA 3N5FA 4NOHA 1REVA 3QGHA 2MZQA 1P6TA 2NZCA 4KO0A 4OYAA 3POTA 4TKTA 5J1EB 5G0RB 2GX8A 1ZETA 3DGPA 3H20A 1AROP 3ENVA 2J6SA 1NJZA 2MY8A 1FFWB 4C11A 4CRJA 3CT9A 3FSIA 2JOQA 1HBUA 4F4KA 2DHAA 4DR6F 4Q7AA 1JNRB 1FWPA 4A8SA 4DFJA 4KO0B 2MKJA 3QAEA 4B17A 5CCMA 5KFLA 1VOMA 2AEMA 4LJMA 2Q6BA 2WTFA 1LW2B 1HPZA 1ZAXA 2B8PA 2LQ8A 4YP3A 3OR2B 4QWDA 2KVQE 2RSQA 3TX8A 4B9VA 2XHCA 2BRLA 2OMLA 2QV6A 3UN3A 4DV5F 2DBBA 2IYGA 3AOCA 2ZHAA 2MQNA 3DRXA 3C15B 2W2PP 2L41A 3CB4A 4V19J 1XWLA 2RQ4A 5C42A 4GC6A 2VG5B 3K0JA 1SI9A 3SFGA 3J81Y 4RL1A 4QU7A 2XGQA 4ZLPA 1EJ7L 3CJ8A 4X4TA 3ITHB 2V6AA 3GCWP 5EGYA 3H8YA 1N5YA 1NPRA 2BKOA 3BBCA 2D69A 2FHJD 2DNZA 1MW7A 4BDPA 3D1OA 1RK8A 1U24A 1M90T 2HYIB 4ZIWA 2DHGA 3C6TB 3V4IA 2FHKA 1U0SA 2CKWA 4UOGA 4PYAA 4ES2A 2WB4A 2B56A 2EKYA 1R7IA 2VBZA 3MCMA 1RABB 2PI5A 3EXCX 1B99A 2PD1A 4DV3F 3JQKA 3AOAA 2DD8S 2VPWB 4I6WA 4ZS6A 1KEKA 3N79A 5HVFA 4CLFA 2VZ9A 3Q86A 1O8BA 3K89A 1KKHA 5GAHU 2CYYA 4O3SA 1UVIA 1QTNB 1T9UA 2GVDB 4PWWA 3PIPQ 1VBXA 4RKUC 5J2MA 1S12A 1YHQS 1CJTA 5L8RC 4WWSA 2B43A 4RNMA 2ASJA 2ZJPQ 5FLXU 4CP5A 3VQTA 5F8HA 4XO0A 1TV6A 2DY1A 1YRTA 1XERA 2PMWA 2QLJB 4I2PA 1IR1A 2HK2A 3W2VB 2ZHBA 4M5KA 5KFIA 2KT5A 3PHEA 1NJXA 2VQFF 4AXIA 4KGZB 1Q86T 2DNKA 3NAHA 3ZNUA 1G2EA 3GJRB 2G4BA 4OMFG 3V2UC 3OFFA 4D3GA 3PO5A 1ZZNA 1UEUA 3HI9A 1RU2A 3AB2B 1TR0A 2F1FA 4LRBA 1N32F 1KN6A 4S0MA 3CD0A 4EBCA 1VMBA 4L72B 2BOAA 3KHLA 3IM9A 3FKBA 2DNQA 1B70B 2W8KA 2IJRA 5KG4A 5IT9Y 2G2ZA 1MN9A 4R8UB 4P71A 1XMOJ 1FJGJ 3PX4A 3QGPA 4IQMA 5LJ3Y 4RWWA 4V1Ak 4F36A 2H48B 4WIQA 3RB3A 1YTYA 4NCGB 3S01A 2PO4A 1LFPA 2UUWA 5HP1B 1WC5A 4N76A 2V8HA 1V6HA 1IM4A 3WIVA 3MPVA 5DQIA 1JB0C 2UXDF 3R2CJ 2JSXA 3SMZA 1U48A 1UETA 4KGMA 4K2JA 3I55S 4M5MA 1ZTTA 4IH6A 2K3KA 3CD5A 4N5SA 5H9FJ 4DR3J 4B3RJ 4CYUA 2HFUA 3IS9A 3UDEA 1Q7YT 3VHQA 1VK3A 1CJVA 5K8PA 4KGKA 4KH1B 1YVFA 1NDLA 1NBEB 2WAQD 3BB5A 3GFZA 3QT5A 2PEBA 2RILA 2UV8G 1J5OA 3CJ3A 5HVGA 3W9IA 2BJ7A 5CD4H 4EYIB 1S76D 2EFGA 3H25A 2ZZMA 1RAGB 1TKZB 3KKFA 1F2HA 4KQZA 4U7UK 5HL7Q 3KLFA 2NR0A 1LWEB 5L46A 1QAJA 2C42A 1Y5LB 4J9OA 3ZNJ1 2QFIA 3MCSA 2PMZD 3EX7B 3QGGA 1I51B 2QMUB 4DQSA 4K4SA 1EB0A 1YLXA 3Q8RB 4L3NA 2GIFA 1MWYA 4PG8A 3LGMA 3L09A 4OYWA 5HN0A 2XNQA 2VOOA 3HT0A 3MM7A 2P9EA 4ZLNA 3MFIA 2YWFA 1FDDA 3UD5A 3JSBA 3T6BA 4IO9Q 1RACB 1T94A 2D3O1 3AOBA 2M2BA 3DU6A 1T11A 3M2UA 3MM5B 4MTPA 3K2YA 4PYDA 4U8VA 4Z7CA 4EBEA 4TQRA 1DY3A 3QFWA 1PO6A 1K1QA 4LRFA 4U7UD 3I31A 3LP1A 1WEXA 4BCAA 2HS4A 3D6FB 4CLUA 5J2NA 2DRDA 3EYZA 3PKYA 3RB6A 1JNZB 2CXEA 3DDIA 4NLVA 1X4GA 1RTDA 5E7OB 2CVIA 4K50A 4K4XA 2DJWA 3D0HE 1RAJA 4ZMMA 3M2VB 3G6ES 2M70A 1L3TA 5KT4A 5C7PA 1PKUA 1NLKL 1RAHB 5ETVA 4PKDB 2LECA 2RRAA 2XC9A 1RWMB 1VCTA 2C2KB 3EXYA 4J9PA 2BE7D 3ISZA 4K4TA 1GMUA 2NXNA 2IAJA 2VQEJ 4LF6F 4OYOA 2Z2YB 3C46A 2HHHF 1WOSA 3MWBA 5HATA 5KFAA 2BE2B 4DF4A 1CJKB 2WVFA 3MECB 1RI7A 4KAIA 5G4DA 3SV4A 4A8WA 3OTDA 3TA0A 1U1QA 2L9WA 2MLYA 1BHNA 2X3GA 4LSNB 3OLAA 5GAEI 4KHPJ 1Y3KA 1F5BA 1BLUA 1CULB 4LSZB 4LBPA 4WK3A 2ZUGA 1TKXA 4TY8A 2FIUA 1TL1A 1EP4A 5J2PA 5J2QA 5BYRA 5DS7A 4CTAB 4V19X 4OI1A 4DR5J 4ZPCA 4IR9A 3D3CJ 1LWCB 2ATCB 5IWAJ 1J27A 2N3OA 3KOAA 4AUKA 3KK1A 2IC3A 1S1TA 3UN2A 1MMNA 4DSFA 3IRXA 2GQQA 1WHYA 3OLBA 3NGTA 3EM1A 1HWKA 1X9MA 1B4SA 3P4UB 4LFBJ 2CQ2A 1CLFA 3QIDA 1RT5A 2DR9A 5LMUJ 2WB1D 1JLQB 1RWWB 3RBZA 4B08A 1A9NB 2FC8A 2MHEA 2R8HA 3N0VA 1P1TA 4ZDNA 3BN4A 3NY0A 4IRDA 2MZTA 3MMAA 3NBPA 2KH9A 1MN7A 1OIAA 4YR0A 4ECVA 1FNXH 3W9HA 2E9RX 1E6VB 5ADZA 2DRBA 1REGX 3OTEA 3OUYB 4DFMA 1JLQA 2UP1A 4I67A 2JLGA 2UVRA 2LQ9A 4GRSA 4TNOA 5B7WA 2ERRA 5KFBA 3LP0B 4J91A 1B7YB 3HHEA 3KK3A 2OH2A 3CULA 4MH8A 2MSTA 3VAFA 3O3LA 2K3IA 4NMLA 4ITSA 4QW8A 4EWTA 2XO7A 3OD2A 3PNIA 1HYSA 4NPOA 2H4YB 4QR2A 4MIBA 1NSAA 2YNGA 4NLSA 1X7VA 3KK2A 3SSRA 4DI6A 1NDPA 2ZZNA 1HL6A 5KFFA 3GIMA 1IN0A 1RA6A 3MTKA 3K58A 1Z1ZA 1HBUB 3I9V9 4LVNP 1WNEA 2R7XA 1HKAA 4PG6A 4LRAA 1SV5A 1XNQJ 1U8SA 1HYSB 4KPYA 2O3DA 4B9LA 1R31A 2Z58B 2GHWA 1TVRB 1RTIA 3CEDA 3IBWA 3QBCA 4DX8H 2R8IA 2XTJP 5HROA 2E1PA 2UUAF 1KSPA 3FDSA 2EI5A 1U49A 5CA5A 3Q23A 4RW8B 3LW5C 3C14A 2GHVC 3OXGA 3IN5A 5DM7Q 1SV5B 2E5HA 1Q8KA 4Q5VA 2W7PA 5AE1A 3Q22A 4F0MA 2HGNA 2WOMB 4PR6A 2YNIA 4H4OB 4U8YA 2E5LF 2W2NP 1ZAWA 4F02A 1WG1A 3P5TL 4HACB 2PE8A 2OAUA 5KFOA 4DPTA 4DS5A 3KG0A 4XDDA 3QZ7A 1P8GA 2FZCB 5D78A 1Y9OA 1YKWA 3HF5A 2VHGA 1TUGB 4NLUA 2G0CA 3VAKA 3NNAA 3TJAA 2OJ3A 3EPIA 2LU1A 4YB1P 4OFZA 1HNXF 5A6PA 4ID5A 4O44A 3Q0AA 3HKWA 3PHTA 1I94F 3R97A 3BH7B 4CI0B 1RKIA 2V9WA 4ILRA 1KRPA 3MGJA 1O51A 2ZJRQ 2CPHA 3PTWA 4UF4A 1IKVB 5LSLA 4H4KC 1XMOF 1C0TA 2OTLS 1QUPA 1GK8A 3CDWA 2QMWA 4OZ2A 5KAKA 1QLNA 4USUA 1KDNA 2J0XA 3OFGA 2GVZB 3M2RA 4LR7A 4WFYA 4O3RA 1F5CA 2HLTA 3KFWX 2JVRA 4J37A 3CJKA 5I42B 2OTJS 3UFCX 3DLGA 4KIAA 2QGFB 1FKOA 3UR3C 2QZ8A 1FFGB 3B4MA 1W26A 2EFNA 2RU9A 2VDHA 4O3OA 1S9FA 3N01A 3W5ZA 3GYNA 4C8OA 1U47A 2VKZG 4KT0C 2W2MP 5D15A 1WDDA 2R7OA 4DL6A 4UZCA 4MIAA 1YDLA 3LAMA 4X66J 3FRZA 3MFHA 3GP9A 1OSDA 5HQ8A 1FF2A 2MKCA 2W1BA 1SJ3P 2UU9J 4AL5A 3FNNA 3B54A 4LREA 3AJDA 3G6VA 1M0SA 1Z4UA 3BF4A 4JV0A 3KLGB 4OX8A 4X62J 4CCHA 1VBYA 2IRXA 2DNMA 4GO5X 4X4UA 1Q1KA 1N52B 3WQPA 4OX6A 2XCPA 4J5OA 2NXJA 1XNQF 1TU0B 4U95A 2I2YA 4JP8A 1RZMA 2KKHA 2CQ3A 4RLEA 4NCGA 4QWBA 3LA0A 2APOA 2KO1A 3JYTB 2HQCA 3VZHA 2J6UA 3QIPB 3TAQA 3AD9C 2Y3YA 1SJFA 3CGIA 2QA4G 3BBFA 1T0TV 3SQGB 1YJVA 3IP0A 2LYVA 3UD3P 3FZ2A 2ZWOA 3TA1A 3ZTOA 4LIRA 1HWUA 2HHPA 4R5PA 1FESA 1XC9A 1D3WA 4C8NA 3CJQA 2W9CA 5D4OA 2CQ1A 2OPSA 1FJGF 3TX0A 4HACA 4LQ9A 2HQDA 5FDLA 4TU8A 4DPUA 1XK8A 1U2CA 5C2CA 1RT3A 1RADB 3EGVA 3GV7B 4W90B 4WU2A 5HAOA 1SJRA 2ROPA 1FEHA 2Z2MA 4WBFA 3WC0A 1NPKA 1VRUA 1V5VA 1FXRA 2CWXA 1LQ9A 5KFYA 1T9YA 4G1IA 3PM9A 2EPIA 1PJ6A 4YB7A 4EO8A 3DLJA 3A3OB 3QAUA 3HJFA 4N47A 4J9KA 1B7FA 2FVCA 5KFZA 1Q7LB 1X4BA 3HFZB 4GVBA 2VKRA 4C8MA 3MM9B 4KC5A 2EFVA 3RU0A 2MKKA 4UY8T 1S1XB 3NKYA 1RWKB 4C4WA 2G1DA 2E1AA 1VBKA 2ADBA 4DXLA 1FX2A 1SKUB 3U02A 4NLDA 3TWZA 1JLFA 3OJUA 1X9SA 3I0RB 4QCLA 2BUNA 1WC4A 4USHA 1RLDA 1ICEB 2PSZA 3DN9A 2OEMA 1FE4A 2CUYA 2A2CA 5KFHA 2FVQA 2ZVIA 3E01A 1YJUA 2DK2A 1U2RA 2AF6A 4USIA 4X2BA 5L1LA 3MR5A 1K0VA 4MJKA 3JS9A 1RDRA 2I9SA 4JI8F 2OO4A 3Q8SB 5LSOA 4XAKA 2HWIA 3PYFA 1A7GE 3G4SS 1QVFR 1JMTA 3GIRA 3ZTQA 4HVZA 2KXHA 1OS5A 2KRRA 4LR8A 4RW6B 3V5RA 3DGPB 1CJUA 1WI6A 2QC3A 5F8JA 3M9OB 4A8OA 4WF9Q 2X1AA 3WX4A 2F4VF 3NMRA 5ITHA 4KGVB 4M5IA 4WJBA 5IV3A 4IQXA 2XEXA 3L7PA 4MAKA 1U7LA 4DR1F 1R8CA 5E41A 4X62F 2PT0A 3IC1A 4DUYJ 2E5JA 4HKQA 2IBOA 3WDOA 4DFKA 2YQ0A 3IFEA 1F9HA 4F26A 5CZXA 1ROFA 1WG4A 4Q43A 4ZIVA 2F3JA 3ZZUA 2V63A 2V68A 1WELA 2BDPA 3H5XA 2P6SA 4UT4A 3I6PA 2ZH9A 4XPEA 5A6WA 4ENOA 2IC3B 5GAHI 3HVTA 1HWLA 1CJVB 1OY8A 3VGVA 3G6XA 3B6BA 1O0PA 2B9XA 2IHR1 2PC6A 2AGQA 2R7RA 2YH0A 3V6JA 2UXDJ 1VC6A 2LU2A 2A2DA 2XG8A 4DV1F 1R89A 2YWEA 4C98A 4ECQA 1LW0B 4P7VA 2ZITA 1XMQF 2XS7A 2K2PA 1VRUB 1ZOTA 3D1HA 4KFBA 4USJC 3OTCA 2UUBF 3I5AA 1U0HA 2NUHA 3ZZRA 5EWFA 1GEHA 4YN3B 2FHMA 3V81B 4ICLB 3G8TA 5F8NA 4JI6J 3H2UB 3PX6A 1HFEL 3BDEA 4KGXB 4U9RA 4ZA1A 1QSLA 3M1VA 1NO8A 5DG8A 1SH2A 3OSPA 2Q1LA 4DFPA 2ZOMA 2MGZA 1AFIA 3CWJA 4URQU 2VONA 4URGA 1N0UA 4ICLA 2A6MA 4CO4A 4FF4A 1DLOA 2MQMA 2D7SA 2VQFJ 1WJ9A 4ANDA 5DZ6A 2P8IA 2Y8WA 1RTDB 2X7IA 3W2VA 5L39A 2BEFA 4NE9C 1PC4A 3D54A 5L1JA 4Q45A 5KFNA 1YJRA 3DKDA 1VGYA 1YK9A 1HHSA 3E51A 4NXMJ 1BQNB 1YI2S 4JUZA 2VDIA 4MYUA 3S1TA 3OT9A 1V9OA 4XIUA 3K5NA 1PGZA 3T5LA 4KY3A 4W4MA 2ZE2B 4JI0F 4DV2J 4P6QA 1Q95G 2LA6A 2RJZA 2YX1A 1HNIB 1NK7A 4QWCA 4ED5A 1ITPA 3A3NB 2GIRA 3DOMA 2FHJA 4JV2A 3VF0B 1V3SA 3RRGA 4Y2MA 1N8RT 3H90A 4O3NA 1HR0J 2J8AA 2R2UA 5E3RA 3UNGC 2GC8A 3VGTA 3IG1B 2M0GB 2PN6A 5ETNA 2O5DA 2VFVA 1HQEA 1PJ5A 2VG6A 1FKAF 3DRSA 2C3OA 4HL9A 3OVAA 1FRHA 1S1TB 1N5TA 2BJ3A 4ZPTR 4ZJOA 1KR4A 1PSDA 2AJ4A 2BQ3A 2UXBF 4DCOB 4OZNA 3NWRA 1FTRA 2B6AB 2I0XA 2IM0A 2KVIA 2YKAA 3GPAA 2AX0A 4R8UA 5I3UB 3NGDA 1KQSR 3D9BA 1U1OA 1S0VA 1IBLJ 2UXBJ 3TANA 1NSPA 1JWWA 1EZZB 2VPXB 3PR5B 3B8HA 1CULA 2HFNA 4F3OA 1SJQA 2ZDPA 5HP1A 4JI1F 2AEJA 1HR0F 2WHOA 3PDNA 4KHMA 1JQGA 2AQ4A 3GTYX 2MPUA 2ZH4A 3KTQA 2HKEA 2XB2D 2B0GA 3NCQA 2Y1JA 3W5YA 1GQEA 2GMLA 2NPIA 3A3PB 4ZOSA 3PW2A 4LF9J 4RBUA 1Y4ZB 1D9FA 3T1YJ 3HX9A 2E7VA 4KTQA 4PQUA 4DV1J 3TYTA 3R2DJ 5F8LA 4KV8B 1U1KA 1RAFB 3MMBB 4WP3A 5KG5A 3MUVP 2HW3A 4RO0A 2R42A 4KKOB 1OMSA 2M52A 2DB1A 4NYPA 1RWPB 5D4PA 4QIVA 4PWUA 3CCMS 1HW9A 4MKBA 2GAHC 4ED0A 2D9OA 4DJBA 2F65A 1DLOB 2HRTA 3JTNA 2IRYA 4MMOA 2HBYB 1RTIB 1S1UA 1VJWA 3BSCA 2GA7A 1IQZA 1MWQA 3NOCA 5F3TA 4KR0B 4OZJA 2PI4A 1S7HA 3UNYA 2I5JA 1SKWA 4A48A 3ETOA 4RW8A 2JZ5A 2KXFA 2ZDOA 2JVOA 4F4WA 3CMAS 2OLWA 1SC3B 2YWGA 3FFIA 1N33J 2YNIB 2W24A 4H4OA 3HPOA 5ETLA 2VJUA 1IJEB 2AJ0A 1HNVA 1BE4A 2C3YA 3M32B 3RAQA 2WZ1A 3BV8A 1IXKA 3C14B 4BWMA 4I7FB 3VV2B 3BH6B 3VAIA 2GMHA 1N34F 1HA1A 2ZNZA 4RPFA 3GQCA 2V0NA 1XTZA 3LALA 5HI7A 4EYHB 2MZ1A 5GMEA 2OIHA 4JI8J 2VJVA 1F5AA 4Y2CA 1VQ9S 1CS4B 4DR2J 4IDKB 2D3OR 1UL3A 1KOOA 1HQEB 2VG6B 3HSZA 1FDAA 3UI3A 2VOPA 1YJWS 2Z30B 1TQLA 2L3MA 4PABA 1JKHB 2JNJA 5CAAA 1H38A 2VODA 1UEKA 1HBMA 2YPYA 3EDQB 2AMCB 4DMZA 4ZVPB 3OVSA 3G8SA 1BMQB 1W2BR 2VFTA 2DPIA 4LMZA 3MR2A 3C66A 3LGHA 1K8AT 2F8HA 3AB4B 3DRRA 3ET6A 3LOUA 1S1WB 2H3EB 5KFEA 5A0YA 3MEGB 2WBMA 2XMAA 4YUDA 1RT7B 3QMQA 3BQ2A 4C3MA 1XBWA 8ATCB 2W01A 3AJ1A 3ZZTA 3KDOA 3LANA 2CJKA 3UR0A 4HI2A 2MEWA 4X4OA 4ILMA 4DN0A 3F73A 3IGNA 1WEZA 4IFYA 3IMQJ 2GVZA 3M2RB 4RNNA 3H2VE 3KK1B 1CG2A 3DRRB 3ET6B 1VQPS 1F9FA 4JI3J 1FRLA 3HVWA 1M5OC 1RT7A 3Q8UA 1M5PC 4DL4A 3KLIB 4NCAA 3CCSS 3E01B 5CXTA 5KFRA 2RQKA 2HHTA 3CJ4A 2MQLA 4C9DA 1SPBP 2AEFA 3TW0A 2GAGC 2MQQA 4KHPF 1FDNA 4ES3A 5B09A 2QJ3A 4MFBA 5A8KA 1R0AB 4MT1A 2HHQA 1IUJA 2DRAA 1OJ4A 3DXBA 4LT6A 2F4VJ 1D8ZA 1RAIB 2VFRA 3C16B 3M8ZA 5IS2A 1HHQA 3FCVA 3W8GA 1XQIA 5LJ5Y 3KG4A 2X51A 1VRQC 2ACMA 3DLEB 3I96A 2OFGX 1FDBA 1VS3A 4G3IA 4DR4F 4NXNF 4QYZK 3D2WA 3FUYA 2FHOB 2B5JA 3NGUA 2DR8A 3M8QA 1U1RA 4ZCIA 4ZVOB 1RTJB 3C8YA 4PAAA 2KRBA 4AL6A 1L3SA 3QT6A 1AYEA 1YZ6A 4C3LA 4FPIA 1RISA 2C3UA 5F41A 5DG7A 3M32A 5JMNA 2C3MA 2KZMA 5LMNF 2G9OA 4ZPVR 4USTA 1VRTB 2E1MC 2HMIB 2ZHOA 3GJQB 1QY7A 2XS5A 3Q8YA 1C2PA 3M8SA 2W9CB 5A8RB 3MEEB 3HHLA 2E7WA 2F8EX 5E0OA 3H5YA 2MY7A 2HS3A 4OX7A 3RR7A 1UA1A 1N36F 1WSRA 2J0WA 1GT8A 4TQSA 2LXIA 5D4LA 2AX1A 5L9XA 5KOXA 2QT7A 4DOZA 1RWNB 2HBQB 2RAQA 3CJ5A 1XR6A 4DG1A 3RRHA 1VQ7S 3BO4A 1ZPVA 4ID8A 4LF4J 2AKWB 1N5VA 1ZM9A 5IT0A 3MOJB 1DTTB 4MKVA 1VQ4S 4DDFA 2PMHA 5B0FA 1FNOA 1EHWA 3MMCB 3HSJA 3MZIA 2NPFA 3W9JA 4EI2A 1G1XA 2H9ZA 1VQLS 2OSRA 3HDSA 4HTJA 1FO1A 3DLKB 4RW4B 4RW9B 3SCIE 3OL6A 4GKJF 4G65A 3RW7A 3MD3A 4NI2A 2GVDA 2DNGA 2EC2A 3GFHA 4U6PA 3EGZA 2CJAA 3SQOP 1OSCA 1V5IB 2XLIA 2U1AA 1DAXA 3ILIA 5KFKA 1RHRB 2X1GA 3FZBA 2RDDA 1VC0A 1Y10A 1X60A 2RHQB 3OW2R 3QSYB 4WZMA 1S1XA 2RNEA 3KLIA 4WP8A 2K06A 3ZXWA 3KLEB 3MUMP 2VG7A 2FD2A 2FUG9 2CNOB 2NXUA 2EK1A 4H54A 3KWMA 4A8QA 3FQLA 5KG7A 4PRFA 1H72C 2CQBA 1WC6A 2DNOA 4LVOP 1T95A 3MTJA 5AJ3J 2VC0A 1L3VA 1Q5YA 1RCXB 1PC5A 3G82B 3H5UA 3TEHB 1QE1B 4DV0J 3V6DA 2BOPA 1NK6A 2YNFA 4I1TA 1U6FA 2ZNYA 5EWGA 2VG7B 2XWYA 5KT3A 2Z2LA 3CD6S 3QWUA 1FWKA 3FJ2A 2IIHA 4WP9A 2LXUA 2CZ4A 1SUQA 2XMWA 3FMBA 1WTBA 2WVBA 4ALZA 1BXNA 3BBBA 5RUBA 1GFWB 5IQ6A 4ZK7M 1CC7A 2JLFA 3NCPA 3W1YC 4UOFA 4CO1A 3H59A 1WC3A 1BWVA 5DDRC 4ED8A 1NXIA 1N0VC 4LF7J 5T7LA 3ZO7A 4ED3A 1IBMF 3R5BA 4YDXA 5ETRA 1TFYA 3R27A 1JXVA 3IAM9 1QUVA 3EZUA 4C11B 1FRKA 1M1GA 5K8NA 4J90A 2E9ZA 1AW0A 4QJVA 3BN7A 2XLJA 3JYTA 4YY3J 1G3OA 2V2KA 3MCOA 1U8WA 2CDRB 2KG1A 1S0MA 3M6UA 3KJVB 4OZ0A 3BZQA 3HK2A 5IQQA 3O5TB 4L73A 3CJ0A 1KQKA 3FRYA 3MAQA 3O8WA 4RUCA 3BQ1A 4M95A 1N5QA 3GV5B 3BREA 2F8MA 4Y2KA 3M4XA 1R0BG 3E8OA 3CJSA 1XMBA 1RT3B 1JLBB 4FYXB 4CNZA 2IVYA 4B3MF 2CPIA 4QIWD 3TJ9A 4K5SA 1IKYB 2W2OP 3BSNA 3DDKA 1TTHB 2MKYA 3GSIA 5HJXA 1UVLA 5A76A 2KFZA 3FEZA 3I5BA 5J2MB 2AGOA 1R8HA 2VF3A 4UOHA 4C0HA 1HW8A 1PCAA 1YZ7A 4X64J 4AXJA 2M8DB 4P9SA 1NB2A 4TY9A 2CWKA 3UCGA 4NXNJ 3CC2S 3K5MA 1FRXA 2GS8A 4ECXA 1RSCA 4YR2A 4N8NA 2KHCA 5KG6A 4UY85 3HT3A 3DM2B 2V4JB 2LCWA 3JTOA 3M2VA 3RRKA 2RT3A 3UN5A 3IR6B 2ZKUA 1DTQB 2AT1B 1TV6B 3HP6A 4C2MA 4CT9A 3LP2A 1D1UA 1KHVA 3R8YA 2CAJA 1D09B 2LQ5A 1AT1B 3I87A 2C2RA 1SH0A 2E5GA 4P75A 4X4QA 3GV8B 1SL0A 4UTGA 4DSLA 3ZTPA 1U2FA 1S1VA 2V4JA 2H5IB 5DDPC 4LF5J 3T5HA 1RT1A 1AXQA 1ZBTA 2IA6A 1VQKS 1HIYA 3I82A 3MDFA 1HNWF 1DARA 3MI7X 5DO2A 5HMWA 2J6TA 3S8SA 1RGVA 3MOZA 4ECWA 4DLEA 3JSRA 3NLCA 1T9XA 4CH7A 1XEZA 2QSFA 1TKXB 4FPRA 4TY8B 3PRDA 1Q53A 4AYBD 1EP4B 5HBMB 4DSEA 3D6HB 2DXFA 4F8RA 2F4FA 2YBVA 3CCZA 2IDLA 3PRBA 1GMWD 4QYRA 4TU9A 5I3UA 3RTVA 1CJUB 3M6XA 2P5VA 4FNIA 4LSNA 4N8OA 2AYMA 3O6QA 3OR1A 4HH0A 4Q2LA 2CPFA 4DEZA 2J9CA 2GHPA 5CD4A 2RRNA 4IR1A 5L9NA 1C0UB 4G6VB 4A4JA 4LQ3A 1FD8A 2K7JA 1WD6A 3US5A 2R7VA 2DY9A 5KFWA 2XS2A 2B8QA 3NGSA 3W5XA 2UXCJ 3EJMA 3FGVA 1HI0P 3J7AN 3RGIA 2CZVC 2PA8D 4FS1A 2IMWP 3OTBA 3VTIA 3BEGB 2CPZA 3LUYA 3ULHA 3ENAA 3Q8VA 2B51A 1T3OA 2MDAA 3MMAB 3M9NB 4DV7F 2UZAA 1SCJB 2F9DA 2BJ8A 1JJ4A 5LM7E 3F41A 2HLUA 2BABA 3DXSX 2ZH3A 4DZ6A 2VQEF 1S6UA 5C24B 3CW2C 3GYGA 4CLSA 3DYAA 4O4GA 3VWSA 3NEKA 2YKNA 2KM8B 3BKTA 4M5GA 4J9SA 4F4ZA 2BKPA 3NL0A 2ZM6F 4FYDA 3TP2A 4AT1B 2PEHA 1HNWJ 4F3QA 2RVJA 4XTTA 5LL6d 3KNAA 2J0SD 3RBEA 3MCNA 4KKOA 3Q2SC 2QA2A 2ZD1B 3TQ1A 4Q0BB 1ELOA 1RHMB 3HULA 2KXNB 4DL5A 2E66A 2XMUA 3MMJA 3GCXP 4UZBA 2I5JB 2MGZB 4K59A 3TI0A 3D6MB 2RIJA 4P10A 5IXUA 1MWZA 3UPFA 4G1QB 4P2SA 2O67A 3A8JA 2WVEA 1SB6A 5KFGA 4YQWA 4IOBA 1LXJA 4Q8EA 1C4AA 2N7YA 5E3CA 3H4BA 2HHWA 2CPJA 2CQDA 1EKRA 2CJQA 2HEKA 1N4LA 2IAJB 1WDTA 4NA3A 4C97A 2YVSA 3SFUA 3CMQA 4ZCKA 1H73A 1WI8A 2B4UA 3M8QB 4ELVA 1QAIA 1EQ0A 2ZBCA 3QJLA 1AA1B 2RD5C 4RW7B 4IOCQ 4OIXA 3GYXB 2AJ1A 3VAGA 1HBNB 3BDPA 3UDLA 3WHIA 3QT7A 1FX4A 3GILA 3LGNA 1FXDA 4PUOA 1WUUA 4QYZJ 1Q5VA 2FYXA 4CLKA 3CDBA 1VLYA 2C2NA 2ASYA 2YWKA 3PJ9A 4CT8A 1WG5A 5AXLA 3SI8A 3H5SA 3IG1A 5A2QY 4Z37A 5DJBA 1F1BB 3IWNC 2HAIA 3MM6B 1U09A 3OR1B 1BD6A 3TNVA 2FDNA 1N6QB 1FJEB 4BS2A 1RAOA 3L7UA 4OX9J 2EG1A 2GNKA 2V8DA 1M1HA 2QL5B 4NA1A 1C0UA 2FZKB 2LFVA 2WSCC 4Q2MA 3IRWP 1HBMB 4K4YA 3PKMA 3H7HB 3I4PA 4DCJB 1PG5B 2VA2A 3UQSA 3IO1A 4ZCMA 4QR0A 3MM6A 4A8XA 2O01C 2AHOB 2OEJA 1MROB 4OHVA 1N6QA 2H65B 1IBMJ 2UVWA 1LXNA 2XZDB 3KG1A 4I2QB 2LVWA 4EFAC 1ACMB 1JLAA 1KHWA 1RWVB 2Q6CA 2B7BB 5DQHA 5J2PB 3KHRA 3THVA 1NKEA 3GZ7A 1IBKF 8RUCA 4QIGA 2ZM6J 2DISA 3RB0A 2ZWPA 1VK8A 3CE8A 3DC2A 3CJKB 2AYBA 1X31C 3N28A 2J8SA 2V2ZA 2BQRA 3D0GE 4Y2AA 1KQGB 4M5LA 1CQMA 5D0GA 2R2TA 1LK5A 1V3ZA 3MEDA 4DV0F 2XY7A 3IBCB 3CJ2A 2YY3A 1H98A 3BGFA 4ED1A 2ZD1A 3BGOP 5D3GB 4Q0BA 4YS2A 4WTYA 1VR6A 2GGPA 3VZIA 2X1FA 3F44A 2KFYA 2HIQA 4DL7A 2NUUG 5E3AA 5DQGA 2LA4A 2FJAB 1FRMA 2RRBA 3GIJA 5GMKa 2DR7A 5MAOA 4WYLA 2GJ2A 4KSEB 2VASA 4WFXA 3UCZP 2ILZA 1A6LA 2MHNA 2HNZB 4DR1J 4K4ZA 1S6PA 3ENWA 3FQKA 4RUHA 2CPYA 3PR4A 1HNZJ 4NLOA 5KFSA 2FLPA 3QJJA 3DOLB 4HI1A 4LRDA 1S97A 2O66A 2KZZA 4JBCA 2VD3A 5A8RA 4QR1A 1HD1A 1UFLA 1TVRA 2J7KA 4ELUA 2AJQA 2JFKA 4LSLA 4EK2A 2ZC4A 2Y1RI 3A8IA 5FDLB 2E7XA 2OP5A 2YX4A 3BGRB 3D7SB 3LWLA 2FJVA 1EETA 4MKYA 2CJBA 1RXOB 1I3OB 3M30A 1M5HA 4WFZA 4R5PB 2KYZA 3A13A 1XNRJ 2M3DA 1N36J 1VIOA 3JTPA 1UZHA 1X4EA 2EBEA 4F4XA 5DLGA 1WKJA 5F9LA 5KT5A 4FF3A 4ZPWR 2KYXA 3MAHA 2BM1A 4IG3B 4NLTA 4DV4J 1W2IA 3W60A 1X4AA 3OQ2A 3OXFA 4PXEA 4USWA 4LFAJ 5LMNJ 1TP7A 3R1HA 1RTHB 5C25B 2ZOGA 2OPQA 4H4MB 1CS4A 1Q8BA 2FJWA 2UUCF 1FI4A 3PVXA 2FGCA 5M2PA 3BKUA 3P5BP 4DN9A 2HHXA 3E2EA 3PW5A 4FKYA 4QW9A 2HVEA 1JLAB 3CCWA 4CLLA 5K20B 2EG2A 4DHVA 2QLXA 2AJFE 2AP6A 4OJHA 4TLRA 1SJ1A 1U26A 2OPQB 3GFYA 4H4MA 3S7RA 4I64A 3NCRA 4B02A 4CLZA 2M4MA 3ZZPA 5EHHA 2ZH6A 2MKIA 4I56A 1CJTB 4JI7F 5DRKA 1Q16B 4JYAJ 3O2IA 5A0YB 5KFPA 1RKJA 4B3TJ 3GIIA 4LFAF 3G82A 3PRVA 4GKJJ 1NRKA 2NQPA 5T14A 1X5OA 3POTB 5J1EA 2E1CA 4DV5J 4RW6A 3QO9A 5ETOA 4K0KF 4DL2A 1HMVA 2HGMA 4ETXA 5D77A 1T02A 5CYQB 2NCKL 2A6OA 1JJCB 2H1YA 1TK8A 4Q8FA 3CF5Q 2BXJA 5F8IA 2R8JA 2BRKA 1XNRF 3AY0A 1RT2B 1ULRA 3A4TA 3DRPA 3OFEA 4DPYA 1L5UA 1MSWD 2ZH5A 3TRGA 1TKTA 3C16A 1BY9A 4Y3CA 3SDEA 2FJXA 2HVHA 1SXLA 3PYGA 2A3JA 4OHXA 7FD1A 1E6YA 2CQ0A 1HLWA 5CHCB 4CO0A 1RT4A 2CPEA 4ZHRA 1C1CA 3K57A 2RDJA 1H2VZ 5G0RA 3BQ0A 4DPOA 1M5SA 5U47A 3JQJA 3LO3A 4A8FA 2EWHA 2ALYB 3BPDA 4RWXA 4UOCA 8AT1B 1UWAA 2R7QA 5KFTA 2W4PA 5ETPA 1VQ8S 5IWAF 4M5JA 2HHUA 5KTQA 3K5PA 4X4VA 4R0JA 1RT4B 3NGKA 4U96A 2I38A 4AL7A 3V4MA 3R1LA 1DRZA 2HMIA 4FBUA 1Q8IA 4HDGA 4PG5A 4NRUA 2MKSA 4WIIA 3C6TA 2R3VA 1B0PA 4CWBA 1RHJB 3OR2A 2W8LA 3EZ5A 3V4IB 1K47A 5HVHA 4JI7J 5IFMA 2YPZA 4HHUA 1LV5A 3MPYA 3ADAC 1VBZA 2ROGA 1NJIT 2LP4A 1UJ5A 3ISND 3P96A 4FVCA 3ILLA 3KJVA 2MZJA 3HVRA 2W7OA 3PZPA 3NNHA 1TL3B 3W3SA 3HFKA 2A0FB 2AZ3A 2HVDA 3TZZA 5C24A 4K5RA 1HQ2A 2CFXA 2DHSA 2YKPA 1UFWA 4KPCA 4K4UA 4WE1A 1ZM3A 5KFCA 4ED7A 2YXLA 4FYWB 4L3KA 1HWJA 2GO8A 4MKAA 4A46A 2R9LA 1TFWA 1N33F 1VJQA 1X4DA 4LFCJ 2DGUA 2AV5A 2XMVA 3B4DA 4OZ3A 4EO6A 1S0OA 1DTQA 1QSYA 1TAUA 3OJSA 1YJTA 2JDJA 2NXCA 3QLHB 1WOPA 3RBXA 4TN2A 3NP5A 5KFDA 1PILA 1M5VC 2DGQA 2VBWA 1NK4A 2UU9F 3CO0P 1BGXT 2QLWA 4JB8B 5CH7B 5I42A 2QEXS 1TKDA 1UWBA 4P52A 4CM0A 1WHVA 3IWXA 2DR6A 1Y11A 5E3PA 5FIIA 1FWLA 2LQJA 4NI2B 2ZE2A 1T05A 4UUWA 3FEXB 5M2UA 1HQUB 2FLNA 1WF2A 1X8DA 3AFGA 4ECYA 3DOMB 4HR2A 1H0HB 4QPTA 4IRKA 1REVB 3A12A 4NASA 1RAAB 1X5PA 2J76E 3CTRA 3ETMA 1WEYA 1BQMB 3NOGA 5EX0A 1HNZF 3AHPA 2GZOA 2HZVA 2JEGA 4L74A 2FB0A 4FDFA 2BZ2A 2FLLA 4B9MA 4DR7J 4WKRA 4Y2IA 3J80Y 2DGOA 1URRA 2LDYA 5BR8J 2MLZA 3A1YG 3CCJS 4KE5A 2ZC3A 3FBBA 5B0CA 1WWHA 5L38A 3UWTA 4B9TA 3GG0A 1TL5A 1X5SA 2DO0A 4ZHRB 4B3OA 1UPMB 4BC7A 2V8VA 3UD4P 2IDEA 1DFDA 4ECTA 3L4BC 4NZ6A 5KFQA 4C8YA 2V2VA 2HURA 4X4RA 2DGTA 3LAKA 1K9MT 3D3BJ 5KFXA 4DPWA 1KLMB 4UQGA 1YITS 3TZXA 1SQEA 3BGLA 3GIKA 4DSKA 2RMLA 1T03B 3C2PA 1D9AA 3ELHA 1N48A 2DHXA 2GQCA 2KJWA 3A8EA 3VGSA 2XY6A 2JH3A 3K7RA 2Z2ZA 4QIFA 3PJXA 4F04B 3Q2TC 1DHMA 2GFFA 3CCVS 2FLOA 1JK9B 1IWAA 2XBPA 1N56A 4C8LA 1T03A 2HQFA 4OZ5A 2RQCA 3GB0A 1QDUB 2PDAA 1Q8LA 1YBUA 2OD4A 1B3TA 2NYIA 5JXSA 3TVZA 3M05A 2HZCA 5E3QA 4EZ6A 1YSJA 5KFUA 3RAMA 3K8WA 1GNKA 1N5SA 2XYHB 1JLBA 1O6XA 2GO9A 2EFOA 3HCXA 5JUMA 2XMJA 1H2UX 1Y0HA 3F0NA 5ETSA 4NXMF 5H9EJ 2XMMA 4I68A 1VHIA 4ETZA 4DSIA 3B78A 3N9UC 1GX6A 1WORA 1KVIA 5B08A 3HD1A 1U0HB 2H51B 4W98A 2XGPA 3MPUB 3S6EA 2V4RA 3P45B 2VPZB 1FK9A 3U1MA 2ZKTA 1SKSA 1LKZA 4M8LA 1UVKA 1PAUB 2CDQA 2YNGB 2QYGA 3WZ0A 4B9UA 3N6MA 1S1UB 3KXDA 6FD1A 2ZVSA 5SUHA 2FY1A 1APSA 1HBNA 4DQPA 1FRIA 2CVEA 1MU2B 2BVZA 2OSQA 2VUGA 2UV8A 3JXOA 1KTVA 1F3FA 2CQHA 2XI3A 2V34A 1UP1A 4HTIA 2HAFA 4NL5A 2GV1A 1RT1B 2VV5A 5D0HA 4X4SA 2SXLA 3TJ8A 4J9QA 1BQMA 4ANEA 4YR3A 4B3TF 2MZRA 3LF0A 3W8PA 3W66A 1F3VA 3MR7A 4LSLB 3QJPA 1NB7A 4M94A 5IT4A 1ZA2B 2JHEA 1S1VB 1DURA 3NWGA 1TL1B 3K59A 3M30B 2AD9A 2A1BA 5J1NA 3MPWA 1XJWB 1P9QC 4C0OC 1SC1B 3IR5B 1S4EA 4B3OB 3CSKA 4FXWA 4RW7A 2OELA 1NSQA 3SV3A 2ASLA 4B9NA 4PWDA 2J7UA 1MMDA 1Q78A 4OYMA 2XNRA 1PBUA 1FFSB 3TO8A 1LFWA 2ZFHA 5IZHA 3IRXB 5E5NA 2IJFA 1LK7A 1S9GB 3QPIA 5AXMA 1JKHA 2DNNA 4J9MA 2ZBQA 2C2OB 1UMJA 4HH1A 4YEAA 3D68A 1WF0A 4E8UA 4YHHJ 2ZH1A 3TVKA 2F7VA 2B3TB 4N56A 3HVAA 1AZSA 1JLGB 3IAS9 5MLCV 1JLCA 4CYUB 4X84A 4I69A 4KYZA 1RHQB 4O23A 2EVZA 2Y9HA 3RBDA 2KJVA 1NK8A 5EN1A 2B9EA 3THPA 1FKPB 2FPHX 5B0EA 2G2OA 5D0EA 3TUIC 4ZN1A 4X64F 1AZSB 2WVCA 5GAGI 2KG0A 1VISA 1U02A 1U4BA 5KG1A 2ZBPA 2ZOFA 3PW7A 1X9WA 4NEZA 4F0KA 2OPRA 2K1RA 3KJQB 4I6AA 3TAMB 3G9CA 4ERDA 4O0NA 4DL3A 1U1MA 2MSSA 5CYMB 4DR5F 1S10A 2FVRA 4FXDA 3HD2A 3CIZA 5F3ZA 1RHUB 1QJHA 1UTAA 3MEKA 3QO9B 2ZEJA 1Q82T 2OUGA 5AE3A 4OI0A 1X4FA 3DHXA 3OL7A 5D3GA 3A8KA 4FXVA 4JI2F 2H4WB 1OQ3A 1S6PB 1VYAA 1IBLF 3QT8A 1IBCB 2NSBA 1S99A 3MM5A 2HNDB 5HSPA 2OPPB 4JYAF 3CCRS 3W2WA 4HT7A 4TLQA 1YGYA 5HROB 3PIOQ 4J7CA 1H2TZ 1VI7A 1X4CA 3VQSA 5EWEA 2V4QA 3R7SB 1WSVA 4HHJA 4GKKJ 1MU2A 2V8GA 2B5JB 2B4VA 5BYQA 1CQNA 3UVJA 2HNYB 2ZBRA 1KS2A 2EXUA 2NLWA 2V50A 3HKZD 3IM8A 4K4WA 3TA2A 1RT6A 2XMKA 4F50A 1U45A 3HHLC 3K5OA 4P2FA 4J9UE 2P9GA 4FNHA 3EWGA 4O3PA 5D4NA 3FBCA 3N6NA 4B3MJ 4YMEA 2B4OA 4WXWA 4NWBA 4PG4A 2W9AA 1S72S 1ZH5A 1RTHA 2DIVA 3PEJA 5C25A 3RB4A 1R3NA 4DR2F 4L6V3 1KFDA 3PXGa 4Y28C 5JVGQ 3BGRA 1AFJA 3JQMA 4ZJLA 1C0TB 2IM3A 2N3LA 1N88A 4FP9A 2B6AA 3DLHA 3UW1A 3FC9A 2RKIB 4RNHA 5HO4A 2AIRB 1UVMA 2BM0A 1L3UA 3RG6A 1WC0A 2VBYA 1GXLA 1KONA 3RYLA 4F4AA 2WRMA 5GAGU 3TAPA 4TXSA 5L1IA 2C2EA 2GQ2A 1CPZA 2DGWA 1WC1A 4B9SA 3T5KA 2XLKA 2CG4A 4RW9A 2X3DA 2W9BB 1F9EB 2MQ8A 4EMDA 1FKOB 5F9NA 2AU0A 2AYGA 2QX0A 2KB2A 3EGWB 1KVKA 3PW4A 1HMVB 4K4VA 4F2SA 4B3RF 5D8HB 2BYCA 1V3RA 4WZQA 4J9NA 1IKVA 4A8MP 3E3XA 2HVIA 4NLPA 2HFZA 3JAMY 2UUTA 3DI6A 2DNPA 4QU6A 1URNA 2COLA 2UUCJ 2HFVA 3AH6A 5CCLA 1VQYA 3U1NA 1FCAA 5A8WB 1OYEA 1HD0A 2DH7A 1L3KA 1MMLA 1YJ7A 2QMXA 4UUXA 4LUBA 1RB0A 4PXDA 4DLGA 3WC2A 2CZ9A 3W62A 1T9WA 2OPPA 3EVWA 4NCBA 3SXLA 3TVYA 4ILLA 1RTJA 1FERA 4DPXA 4FBTA 4MK7A 1SUQB 4F3MA 5A8WA 2XMTA 2IRUA 4ATNA 5F8MA 2V8PA 2R7UA 2YNHB 3MHYA 1SQGA 1C4CA 1LNQA 2KL8A 2J9EA 2M9KA 2E29A 1NK9A 1X5TA 1G4CA 2C3PA 1Y5IB 3SQGA 1TELA 3BPSP 2B7CB 2E1RA 4IG0A 5T7LB 1TKTB 3G87A 3THTA 2A18A 2YTCA 1WTFA 3KUGA 3SDEB 1SKRA 4W92B 2Y0SD 3GG1A 1X4HA 5DGBA 9ATCB 1XIQA 3LPYA 4TU7A 4NYOA 4P74A 3ITHA 1XMQJ 1E6YB 2G0JA 3NS6A 1GAOA 2DNRA 4ZPBA 5AT1B 3I5CA 1K44A 5LMUF 2QA4S 2XZWA 1RHKB 2P9CA 3QFHA 4HDHA 4C8ZA 1Y3JA 4OI2A 1KWMA 3GR1A 3HVTB 4LF1A 2CNNB 5BYSA 3I0SB 5EDWA 1FNMA 2YKMB 3C15A 5SZTA 1U1PA 3HXMA 2K8GA 1IJFB 3ZZOA 2XSJB 1NHUA 2NYHA 4ID5B 3HHKA 4TVAB 3ILOA 4URSA 3LTOA 1NJYA 2D3ZA 4X65J 4RBTA 3Q8PB 1S1WA 1YRUA 1P1LA 3KYLA 3GFXA 2C2ZB 4B3SF 3R7BB 3CCLS 3DLKA 4RW4A 1QAYA 1RE1B 3MD1A 3ZTRA 4OYXA 3M8RA 3FCHA 3LQVA 2KT2A 3M8WA 1FXLA 3MF5A 3PCOB 2CNKB 2J9DA 4WFBQ 4ECSA 4LF2A 4JI5J 3OBIA 4XDCA 3PYDA 4QBUA 2HG4A 2VC1A 3DGVA 2M88A 2XI2A 3DLGB 3BO2A 3R6LB 3PEHA 2GMJA 4M63A 1YBAA 1QAXA 1IR2A 4DQIA 1K73T 4CLPA 2WSEC 3DFEA 1S7IA 3R6GB 2QA1A 3PFOA 1UJ4A 4CIOA 5LXRA 4Q44A 3KJNB 4DUYF 2ATLA 4C8KA 1JLFB 3R7NB 6FDRA 3O44A 1TK0A 4G1PA 4E0DA 4ZP9A 4KB7A 2G0IA 1QE1A 2QG9B 3V6DB 5B0DA 3G96A 4I0WA 4F7VA 5GAEU 1VLOA 4QPXA 1B0TA 2MLXA 1NNDA 2PGCA 2N4DA 3KLVA 4KH0B 2AYEA 2RS2A 1R8PA 3GJSB 5F0UA 3Q24A 2IBKA 4NZ0A 2NZ4A 1PJ7A 1RAEB 3KLHA 1W7WA 3CCES 2KI2A 4IYQA 6AT1B 2PIIA 3BSOA 1BC6A 1K1SA 1UW4A 2W2QP 2Z4PA 4RUAA 4LF5F 1IWGA 4IO1A 2KT3A 3AD7C 5D6GA 1FJCA 2I8EA 3QRPA 3H98A 2R8KA 2HRYA 2N4CA 1OWXA 2DHHA 2YQ1A 3G8QA 3QIPA 3TQEA 2FTRA 2AWZA 4YHHF 2CIMA 3K5LA 4Z7YA 1DJ0A 4GC7A 3KMSA 1RU1A 3SBMA 4DV4F 1H74A 1NH7A 2VIHA 1SIWB 3AXKA 2HSEB 1OO0B 2XSFA 2OPSB 3HJVA 2Q3PA 5LOQA 2YX7A 5C5JA 1NZAA 4FF1A 4DBQA 5KFVA 2NSCA 1Q0NA 4FS2A 2JEFA 4WFNQ 2HQ3A 2IY5B 1FEEA 1NPPA 2HWHA 3EZOA 4ANCA 4NLQA 1JXLA 3L7OA 5C42B 5I4MA 2JC0A 3CDAA 1DZ5A 3I32A 2LQBA 3OTOF 2L08A 4C3KA 3CXCR 2VICA 3DHWC 3DYAB 4O4GB 1NEEA 2CG8A 2IMOA 2IYIA 4OHWA 3HLUA 4HHHA 2EK6A 3MXHP 1J5OB 3DM2A 1WKLA 1CBKA 1FTCA 4F0HA 1WHWA 1CSJA 1KTQA 2LMIA 3HHNB 1NMEB 1TKZA 3KLFB 1A0OB 2YH1A 1R43A 4DUZJ 4A8YA 2WK4A 1OY6A 3J7YU 2XULA 2CPDA 1CVJA 3QLHA 2MB0B 1YX2A 5HMZA 4N77A 1JIHA 2EEYA 1KD1T 1UFKA 1KP6A 4K7QA 4AE5A 2DEIA 4G1QA 4CDIA 3C6UB 3C3LA 3U7JA 2LEPA 1ZTWA 4EZ9A 1CC8A 2KU7A 3W63A 4TYBA 4NLYA 2J0QD 1UW9A 5BJRA 2RU3A 3AODA 3JSYA 4U7CA 3MURP 5IM0A 1U25A 3KHHA 2QFJA 1T05B 3AAWB 3X1LB 5DDQC 4OI6A 1FHTA 3N5BA 2HPUA 2ZZTA 2C2DA 2JRSA 1YJNS 2BQUA 4IH7A 1NK0A 4OHZA 1CJKA 1NH8A 2JJ4D
chains in the Genus database with same CATH topology
3LP1B 4NX9A 1FVQA 4ZP7A 2QE5A 1U1LA 1T8EA 4NLXA 1TZ0A 1IKXA 2D74B 2W25A 4HT5A 1KQFB 5FD1A 4DV2F 2BA9A 4I7FA 2CJ9A 4PUOB 4N41A 3PACA 3CMES 4A8KA 1XR7A 2DO4A 4DF8A 1M5KC 4OJ3A 4P7TA 4AQYF 4CH0S 5GADI 2DIUA 2HHSA 5DDOC 1UKUA 1S77D 1UEVA 2E5IA 2V9KA 5I3QA 4KJIA 1I1GA 1YWXA 5J2QB 2VA3A 5DETA 1S49A 3CCUS 1JLEB 2EFPA 3TUZC 5GADU 5CQGA 4F25A 4WCEQ 4R25A 3T19A 2RH3A 1S6OA 2R7TA 4Y0FA 1XR5A 4EU0A 4DSJA 4EEYA 1HI1A 2JLEA 4LF7F 2EW9A 2DGXA 2W4CA 1W25A 4QWEA 4RX6A 4IKAA 5CYMA 3JSMB 2W9BA 4KV8A 1UA0A 3P3DA 2IVFB 1LW0A 4EBDA 4OX9F 3L3CA 5KG3A 2L9DA 2IVMA 2VBXA 4WK1A 3CD7A 5K9FA 2YKOA 1JJ2R 2DH8A 4NRTA 3ZFVA 1OQ6A 3QWPA 5AJ3F 5LT5A 2Z0GA 5KT2A 1SJ4P 1S6QA 4OLOA 1R8BA 2NREA 3M8PA 1U6BA 3T5JA 3DOLA 1F0XA 2HRUA 2R8GA 1IQTA 3KK2B 1YG0A 2WONB 3AA8A 3FSYA 3MM7B 4FVMA 2LXFA 3LP0A 2HNZA 1S6QB 2J9DE 1GXTA 4RU2A 3KMQA 1BWEA 4IUFA 2QYCA 4Y00A 3FSXA 5JVHQ 2MKHA 3M2UB 2HHVA 1EETB 4LF8F 4LFCF 1BQNA 3BS9A 4IG0B 2KDOA 2DVIA 2GW8A 3CIMA 1U1NA 3W2WB 2C28A 4LF4F 2BACA 5KG0A 3CC7S 2LLZA 1VRTA 2AGPA 4XK8C 4ZPDA 3T1HF 2NS1B 2DITA 2JFDA 2WOMA 2KHDA 2KM8C 3BR8A 3O1LA 4E98A 1GTHA 2XWXA 2EFQA 4JI6F 2L9NA 1K0TA 4CTAA 1JLEA 2LEBA 3QZ8A 4J9LA 4NLRA 4IDKA 4NZ7A 2R2RA 2CPXA 3MMCA 2RS8A 3GE9A 2BANA 2L48A 1SBRA 3B82A 2ACYA 4DQRA 4GO7X 2JC1A 1OPIA 4GKKF 5KG2A 3TR5A 4JI4F 3U27A 2X1BA 1TUVA 2FGOA 1FE0A 3OL9A 5CYQA 2YKNB 5AXKA 1N54B 4MFBB 3SSQA 5A8KB 2R4FA 1R0AA 3OSNA 3J7A1 3DNCA 1QTMA 2GIQA 1VQ5S 4QQBA 4YOEA 5EUHA 4AFFA 4CQ1A 2O1PA 4IFYB 1IKWA 1HARA 5M2RA 3NAIA 5DG9A 4ED2A 1YIJS 3HZGA 3NBPB 4ES1A 4DR3F 1VQOS 3HHDA 1T3NA 2YNHA 2HWTA 1NKCA 2ZBIA 3NG8A 3NNCA 4XPCA 1WHXA 3T6JA 3M9MB 3OV7A 2ZH8A 2R7WA 1LOUA 4JI5F 3GR0A 3MR3A 4U67Q 1UVJA 3T9NA 2WW8A 2GGPB 4KRWA 3SEOA 4OZ1A 2RF2A 1SH3A 1VHFA 2AW0A 4R0EA 5F0WA 1UVNA 3ONQA 2MYFA 5J1PA 1HHTP 1ZAVA 1LWFB 4M5DA 2HNYA 3NRBA 1T7PA 2OFHX 3PV8A 4HYKA 3CC4S 3DLEA 1XN9A 4ZPAA 1RT6B 2MQPA 2CRLA 3KLGA 1X0FA 3CDEA 2RF2B 3SCJE 1VQNS 1DQ9A 3DOKB 3D0IE 1ZPWX 5F8GA 4EUVA 5HLFB 1SIZA 2RUGA 4C7QA 5DGAA 4QWAA 4J9RA 2DTJA 2H5EA 3R5AA 4IFVB 1FD2A 1FRJA 1KLNA 4QZVB 5KOWA 3DCAA 3RAXA 2MJNA 3DLBA 3T3FA 3GSDA 5LSRA 4DL0C 1Q4RA 4QIEA 2RKIA 3GWCA 4X65F 4DS4A 2IA0A 4WE1B 1VIXA 1X0PA 4MK9A 4QOTA 3LWMA 2R2SA 3I0SA 4LF9F 4YB5A 3P6YC 2DCUB 4ZCLA 1F60B 3FMWA 2BBEA 3M6VA 4HLBA 2RB7A 2ROEA 4PPDA 4I2PB 2W4DA 1MNEA 4O3QA 1S9EB 2MQOA 2ZJQQ 3DMJA 3T9ZA 1Y7PA 1I6JA 4DR7F 2BR0A 3AQPA 2QSWA 2IM1A 1RT2A 3MEDB 2XCAA 3PJWA 3D28A 3CDUA 3QGIA 2IJNA 2HFOA 3MM8A 4RBVA 1AUDA 1SC6A 1C1BB 1VQMS 4OJ1A 3KLHB 4Y6IA 1VC5A 1TK5A 4UQTA 2B9YA 3RZAA 2OD6A 4NA2A 4NLWA 3T1AA 4BWJA 2UVUA 3BSAA 4MIWA 3PX0A 3K8VA 3DRYA 3NS5A 1GH8A 5HBMA 2FJEB 5K8MA 5T41A 1C1CB 4X66F 2DT9A 4UW2A 4DWIA 5DLFA 2YQ3A 5KFJA 1FT8A 3G86A 1H3DA 4PXCA 3DU5A 2FJDB 3ZZZA 4I6YA 1M1KT 2LEAA 1HI8A 3IS9B 4Y65A 2Y1IA 2BJDA 1DQAA 1B64A 3GMGA 1WACA 3DOKA 3PFEA 2MMYA 4IH5A 5H1SV 1S4FA 1ZYQA 5HLFA 2VG5A 1HBOB 1CEZA 1HPZB 3OL8A 2VPYB 1Y00A 3ICLA 4WYWA 2JX2A 3UE2A 2LKZA 3AQOA 2OMOA 4IFVA 1N5YB 2UXCF 2KN4A 2YKMA 5DM6Q 3WBZA 3CCRS 4CZCA 3J7Z5 3FVYA 1ZM2A 3HM9A 3VALA 5B0GA 1O5JA 1NHVA 1TL3A 3H2LA 4OI4A 1H7XA 5BR8F 2FC9A 3OHBA 2PFFB 2HQIA 4M1KA 2V5HG 2P6TA 3UDCA 2FJBB 4JV5F 5E2QA 1FK9B 4PCQA 2LDIA 2QO3A 2XSJA 4K2XA 3LP2B 2ZH2A 1TL4A 2CQ4A 2GJIA 2RDIA 4RU9A 3IWLA 3QYYA 3QZ7A 3V6KA 1SL1A 2FLNA 2VH7A 1HQUA 3J7ZT 5HMXA 1BQXA 2ZZNA 3OVBA 3I0RA 3M6WA 5HMYA 3H40A 2JEIA 3MM9A 1R6YA 3F56A 4BHQA 3HHLD 2V94A 1UJ6A 4ECRA 5KT7A 2N7CA 3NMAA 3BO3A 1D8YA 3AJ2A 2CQPA 1TAQA 1QM9A 1IKXB 1R8AA 3ZC4A 1C1BA 4DUZF 3UCUP 3L95X 4JV1A 3D5MA 2CQCA 4OHYA 2D3UA 2KFNA 1Z2LA 3TUJC 7FDRA 3VCDA 1QVGR 4CH1A 1HWIA 2Q66A 3VAHA 5IM0B 3OFHA 3X3UA 5KT6A 1RYSA 2GCFA 2E9TA 4MK8A 1RA7A 1UAWA 1S9GA 1GXUA 3BR9A 4FF2A 3Q8QB 2ZH7A 1S48A 4PWDB 4F4YA 1RQ0A 2HS0A 1JX4A 4IOAQ 2ILYA 3DRSB 1HNIA 2CQGA 2PA3A 3VAJA 2U2FA 1YJ9S 5B0AA 4CO3A 4OLPA 3MUTP 2J7WA 3ISNC 4CO5A 3JSMA 4NYZA 3TOQA 1FA0A 1FKPA 1NJWA 4F2RA 1JLGA 4HEA9 4JI3F 3U1LA 1H7WA 5KFMA 2DNYA 1HBOA 1LWEA 3CVKA 2CQIA 1P27B 3OPKA 4TYAA 3MEGA 1S79A 4PQUB 1RT5B 2VB6A 3RR8A 4X4PA 2KTQA 3OUYA 4YY3F 3DDNA 2DNHA 2YWHA 4KFBB 4ECUA 2DGVA 1J5EF 1GTEA 2HVZA 2WCXA 4ELTA 4OV1A 3MMBA 2BJEA 3IXQA 3SCLE 3M1VB 3JB9k 2OKQA 2JL9A 3R5CA 1FJ7A 2M5YA 4FZVA 2F9JA 1F2GA 1QSSA 3M8PB 3P49B 3V81A 2HNDA 3EPGA 3IGVA 2DPJA 4O4RA 1WF1A 1ZM4A 2DH9A 2WONA 1Q81T 3PY8A 4RNOA 4F67A 2C22A 2FVSA 3C6UA 1NAQA 1DBDA 1RWUA 2BE2A 3BM7A 1KVJA 2B9WA 4YDDB 3T1YF 5J2NB 1U6ZA 1S0NA 3R5DA 2JWNA 2YKQA 2DGSA 3W7BA 5FLXY 1D9DA 2MJUA 4Z2XA 2ALZA 3EUNA 5FJ4A 3SZ2A 3CPWR 3FFIB 1G6BA 3HHLB 5E33A 3BJYA 2UVVA 1Y5NB 4ZVFA 4D3HA 2HGLA 2D41A 1HNVB 2Z8QA 5K14A 4WKYA 5K5MA 2XHWA 4ZVEA 3VR1A 3R3TA 5THWA 2VFSA 1KLMA 3IR7B 4FN5A 4OI3A 1RYRA 1D0EA 3MECA 4DG1B 4I4BA 2M8HA 4RZRA 2XY5A 4GMKA 4LIWA 3PW0A 2RQMA 3IA0A 2BANB 2W7AA 3RW6A 1VQSA 2OPRB 5B0BA 1B0VA 2VFUA 3EGNA 4OQJA 2VL1A 2K7KA 3DI6B 4ZVHA 5K8OA 1JJHA 3ZZYA 4DQQA 1JLCB 3LH2S 2B4PA 1MROA 4RNFA 4ZKAA 2DR5A 3DMJB 3HZEA 3V6HA 3H4DA 4I2QA 1VQ6S 2K1RB 1VFJA 3TAMA 1J2VA 3KLEA 2Q79A 1H6KX 2J5AA 3I9ZA 2DNLA 5I3PA 4KHRA 1NKBA 4NLGA 5CZVA 4PG7A 1ZZFA 5CYJA 4IRCA 2MZSA 4H4KA 4ZP6A 1KNZA 2WSFC 1IKWB 4PQAA 2A10A 1OPZA 4YFUA 3CCQS 4ED6A 4CNYA 3I56S 1KC8T 3HO1A 1DQ8A 4Y34A 2BW2A 4PXBA 4DV6F 1KFSA 3DLLQ 2Q43A 3CO9A 2DCLA 3VAMA 5EX3A 2IM2A 3SSSA 2N82B 3J7YI 1LW2A 3G71S 3CUNA 4OL8A 4ZP8A 3SYZA 1GX5A 4YB6A 3OHAA 1YRXA 3OXLA 1G7CB 4IG3A 4JOUA 1R27B 2WBRA 3PO4A 3MR6A 1LWFA 4M5DB 5L1KA 2POKA 3HMJG 3SCKE 4O44B 2MXYA 1RJJA 2EBGA 2D1CA 1DTTA 5K14B 1NK5A 3FEYB 4A47A 3G6YA 2QRRA 4KBIA 1IKYA 4WXOA 3MEEA 3CCTA 1LWCA 2RE1A 5GVQA 2IFXA 4MYTA 2E44A 2G13A 5JJBA 3AA9A 2BV3A 1Q79A 3N4WA 4EGLA 3I4HX 4CO2A 4O0IA 1RP5A 1NU4A 4ECZA 4LFBF 1KOHA 3KNGA 1IR0A 3D1QA 3ENQA 3N6LA 2EC0A 2M7SA 1S9EA 4ZVGA 4WFAQ 5LXYA 4OZLA 1FVSA 4OJGA 3TARA 1JXEA 4WU3A 1YQHA 4C0BA 1UVIA 2D9PA 1E6VA 1UWBB 2F40A 5AXNA 3KHGA 2ABYA 4BBYA 2ASDA 4X4NA 3ZZ0A 2YNFB 3BGUA 3DRPB 1Z2ZA 4PPZA 5AE2A 3MM8B 2FVPA 2I1RA 2QIFA 3KK3B 2ADCA 3N5FA 4NOHA 1REVA 3QGHA 2MZQA 1P6TA 4KO0A 3POTA 4TKTA 5J1EB 5G0RB 2GX8A 1ZETA 3DGPA 3H20A 1AROP 3ENVA 2J6SA 1NJZA 2MY8A 4C11A 3CT9A 3FSIA 2JOQA 1HBUA 4F4KA 2DHAA 4DR6F 4Q7AA 1JNRB 4A8SA 4DFJA 4KO0B 2MKJA 3QAEA 4B17A 5CCMA 5KFLA 1VOMA 4LJMA 2Q6BA 2WTFA 1LW2B 1HPZA 1ZAXA 4QWDA 4YP3A 3OR2B 3TX8A 2RSQA 4B9VA 2BRLA 2OMLA 2QV6A 4DV5F 2DBBA 2IYGA 2ZHAA 2MQNA 3DRXA 2L41A 3CB4A 4V19J 1XWLA 2RQ4A 5C42A 4GC6A 2VG5B 3K0JA 1SI9A 3SFGA 3J81Y 4QU7A 2XGQA 4ZLPA 4X4TA 3ITHB 5EGYA 3H8YA 1N5YA 2FHJD 2DNZA 1MW7A 4BDPA 3D1OA 1RK8A 1U24A 1M90T 2HYIB 2DHGA 3C6TB 3V4IA 2FHKA 2CKWA 4ES2A 2WB4A 2B56A 2EKYA 1R7IA 2VBZA 2PI5A 3EXCX 2PD1A 4DV3F 2DD8S 2VPWB 4I6WA 4ZS6A 1KEKA 3N79A 2VZ9A 1O8BA 5GAHU 2CYYA 4O3SA 3PIPQ 1VBXA 4RKUC 5J2MA 1YHQS 5L8RC 2B43A 4RNMA 2ASJA 2ZJPQ 3VQTA 5F8HA 4XO0A 1TV6A 1YRTA 1XERA 4I2PA 3W2VB 2ZHBA 5KFIA 2KT5A 3PHEA 1NJXA 2VQFF 4AXIA 1Q86T 2DNKA 3NAHA 1G2EA 2G4BA 4OMFG 3V2UC 3OFFA 4D3GA 3PO5A 1ZZNA 1UEUA 3HI9A 3AB2B 1TR0A 2F1FA 1N32F 1KN6A 3CD0A 4EBCA 1VMBA 4L72B 3KHLA 2DNQA 2W8KA 5KG4A 5IT9Y 4R8UB 3PX4A 3QGPA 4IQMA 5LJ3Y 4RWWA 1YTYA 3RB3A 4NCGB 3S01A 2PO4A 1LFPA 2UUWA 5HP1B 4N76A 2V8HA 1V6HA 1IM4A 3MPVA 5DQIA 1JB0C 2UXDF 2JSXA 3SMZA 1U48A 1UETA 4KGMA 3I55S 1ZTTA 4IH6A 2K3KA 3CD5A 4N5SA 5H9FJ 3IS9A 1Q7YT 1VK3A 5K8PA 4KGKA 1YVFA 2WAQD 3BB5A 3GFZA 1J5OA 2RILA 2UV8G 1TFWA 3CJ3A 5CD4H 4EYIB 1S76D 2EFGA 3H25A 2ZZMA 1TKZB 3KKFA 4KQZA 4U7UK 5HL7Q 3KLFA 2NR0A 1LWEB 1QAJA 2C42A 1Y5LB 4J9OA 3MCSA 2PMZD 3EX7B 3QGGA 4DQSA 4K4SA 3Q8RB 4L3NA 1MWYA 4PG8A 3LGMA 3L09A 5HN0A 2XNQA 2VOOA 3MM7A 2P9EA 3MFIA 2YWFA 1FDDA 3JSBA 3T6BA 4IO9Q 1T94A 3MM5B 2M2BA 3DU6A 4MTPA 3M2UA 2ADBA 3K2YA 4EBEA 4TQRA 1PO6A 1K1QA 3I31A 3LP1A 1WEXA 4BCAA 2HS4A 5J2NA 3EYZA 3PKYA 3RB6A 1JNZB 1RTDA 4NLVA 1X4GA 4K50A 5E7OB 2CVIA 4K4XA 2DJWA 3D0HE 1RAJA 4ZMMA 3M2VB 3G6ES 2M70A 1L3TA 5KT4A 2LECA 4PKDB 2RRAA 2XC9A 4J9PA 3EXYA 3ISZA 4K4TA 2IAJA 4LF6F 3C46A 2HHHF 3MWBA 5KFAA 2BE2B 4DF4A 3MECB 1RI7A 4KAIA 5G4DA 3SV4A 4A8WA 3OTDA 3TA0A 1U1QA 2L9WA 2X3GA 4LSNB 3OLAA 5GAEI 1Y3KA 1F5BA 1BLUA 4WK3A 2ZUGA 1TKXA 4TY8A 2FIUA 1TL1A 1EP4A 5J2PA 5J2QA 5BYRA 5DS7A 4CTAB 4V19X 4OI1A 4ZPCA 4IR9A 1LWCB 2N3OA 3KOAA 4AUKA 3KK1A 2IC3A 1S1TA 1MMNA 3IRXA 2GQQA 1WHYA 3OLBA 1HWKA 1X9MA 2CQ2A 1CLFA 3QIDA 1RT5A 2DR9A 2WB1D 1JLQB 4B08A 1A9NB 2FC8A 2MHEA 2R8HA 3N0VA 1P1TA 4ZDNA 3BN4A 4IRDA 2MZTA 3MMAA 3NBPA 2KH9A 1OIAA 4YR0A 4ECVA 1FNXH 2E9RX 1E6VB 5ADZA 2DRBA 3OTEA 3OUYB 4DFMA 1JLQA 2UP1A 4I67A 2JLGA 2UVRA 2LQ9A 4TNOA 5B7WA 2ERRA 5KFBA 3LP0B 2OH2A 3HHEA 3KK3A 3CULA 4MH8A 2MSTA 3VAFA 3O3LA 2K3IA 4NMLA 4ITSA 4QW8A 4EWTA 2XO7A 3PNIA 1HYSA 4NPOA 4QR2A 4MIBA 4NLSA 2YNGA 1X7VA 3KK2A 3SSRA 1HL6A 5KFFA 3GIMA 1IN0A 1RA6A 3MTKA 3K58A 1Z1ZA 1HBUB 3I9V9 4LVNP 1WNEA 2R7XA 4PG6A