2K1RB

The solution nmr structure of the complex between mnk1 and hah1 mediated by cu(i)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
b'MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title The solution structure of the copper(I)-mediated complex between the first soluble domain of the Menkes protein and the metallochaperone HAH1.
rcsb
source organism Homo sapiens
molecule tags Hydrolase/chaperone
total genus 18
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k1rB00
1CPZA 4EFAC 3VTIA 2K7JA 4HI2A 4A48A 3UDCA 2ZDOA 1GXUA 2GFFA 5T7LB 2QYCA 4FNHA 2XMUA 1N5QA 1Q8LA 1YG0A 3BDEA 3HHLA 2W4DA 2LDIA 4OJ1A 5K9FA 1AW0A 2XMVA 3DCAA 2N4CA 2OD6A 2AW0A 1URRA 3HHLB 3LGMA 2AP6A 2XMKA 1YJTA 2N7YA 1YRXA 2BJEA 3BN7A 2K2PA 3IWLA 1FVQA 1V3ZA 2FIUA 2ZDPA 2ROPA 3BGUA 4DL0C 1OSDA 2LXFA 1TR0A 1AFIA 3MCSA 2OFHX 1Y0HA 2KKHA 2CRLA 4DPOA 3HFKA 2L3MA 1APSA 1YJVA 1X8DA 1IUJA 1TL4A 4Q2LA 2EW9A 2K7KA 4OJHA 1KQKA 4DN9A 4Y2MA 3DXSX 4HI1A 2GV1A 2QLXA 1KVIA 2GGPB 5B0GA 3LO3A 2OFGX 2RU9A 3K7RA 1KVJA 2IYGA 2XMJA 1YJRA 1FE4A 1Q53A 3F44A 1FE0A 4OJ3A 1P6TA 4QOTA 5B0CA 2ASYA 4NL5A 4OJGA 1S6OA 2GCFA 4OIXA 1AFJA 3IWXA 3BM7A 2BBEA 2BJDA 3FMBA 5F0WA 3QMQA 1OQ3A 2IFXA 4NPOA 2HLTA 1SB6A 2KT2A 2QIFA 1CC7A 2OAUA 2HQIA 3HX9A 3LGNA 2XMTA 4ZA1A 3TNVA 3TRGA 2VH7A 4A46A 4Y2IA 2ACYA 4A4JA 2GGPA 3BB5A 1CC8A 3FGVA 4HH1A 1VQYA 2KYZA 2Q3PA 5A6PA 5A6WA 3HDSA 2HFOA 1N5VA 3E8OA 1N5TA 4U9RA 1MWYA 2HFNA 2OP5A 2PD1A 2XMWA 1R6YA 3HHLD 1K0VA 1LQ9A 4YDXA 3CJKB 1OPZA 1X7VA 2LQBA 3QGPA 1OQ6A 1Y3KA 3MZIA 2BYCA 4HH0A 5B0FA 2K1RA 1GXTA 1QUPA 5B0BA 1Q4RA 1FVSA 2HLUA 1Y9OA 2KT3A 2FTRA 2ROGA 2K1RB 1FD8A 3HF5A 1N5SA 4ZOSA 4Y2KA 2AJ0A 3BR8A 4HL9A 3KG0A 2OMOA 4A47A 1S6UA 4F67A 2OKQA 2OD4A 1WD6A 1TUVA 2GA7A 3TOQA 2JDJA 3HHLC 5B0DA 2G9OA 2QLWA 2XMMA 1ULRA 2RILA 1TZ0A 3WDOA 4FNIA 1U7LA 4YEAA 2N4DA 3T9NA 5B08A 3CJKA 5KAKA 2W4PA 1SI9A 1FEEA 1P8GA 3I9ZA 1JK9B 1RJJA 2VV5A 3BF4A 1W2IA 1X0PA 2RSQA 1MWZA 1Q8BA 5IXUA 2RMLA 1JWWA 1FESA 2FB0A 4Q2MA 2W4CA 2FHMA 3GZ7A 2LQ9A 1YJUA 2ROEA 3KG1A 2BUNA 2PGCA 1XBWA 2GO8A 5B09A 5B0AA 2HIQA 2IYIA 3KNGA 1SQEA 1VQSA 2AJ1A 3KKFA 1Y3JA 5T7LA 5B0EA 5F0UA 3FRYA 1TL5A
chains in the Genus database with same CATH superfamily
5FJ4A 4FNHA 3PEJA 2B9EA 2HS0A 3C14A 2LEPA 1S48A 4NCGA 3GB0A 2FVSA 1YJVA 4JI7J 1RWWB 4DI6A 3UI3A 1K1SA 4KFBB 1GT8A 3QT7A 2AV5A 1U25A 4AL5A 4UQTA 2BW7A 4RW4B 2YXLA 5L1LA 2IAJA 2AD9A 2B5JB 4XDDA 5J2PB 2R2RA 4WFNQ 2J0SD 4IOAQ 1YZ6A 4E98A 7FDRA 3ICLA 3OTCA 1U09A 3PYDA 3FBBA 4MYUA 2HHQA 5B0FA 2B6AB 3DI6B 1FVSA 4JV1A 3BQ2A 3HD1A 3PCOB 1RA6A 5KG6A 4HYKA 1AXQA 1AYEA 4K4WA 5LL6d 1PAEX 2DNMA 3MMCA 2C1EB 1HNVA 4PR6A 2FB0A 5HLFA 2H5IB 4Q45A 2UVRA 2YX4A 3GFZA 5K8OA 3HK2A 2FQQB 1KN6A 1NPPA 2WVFA 3PEHA 2XLIA 3HI9A 1GXUA 4NZ7A 2E9ZA 1NZAA 1G7CB 3KFWX 2KHDA 3IRWP 3CCRS 2F8HA 3VWSA 5F3ZA 1R7IA 2CQHA 2PE8A 1L3TA 2VONA 1WF1A 1O8BA 1JLAB 2QLXA 4FS2A 4WP8A 1VQ7S 3PO4A 3QQCD 1R0BG 3OVSA 4Y28C 4K2JA 2FPHX 2XMTA 3D3BJ 2UUAF 1HNZF 3J80Y 2GJIA 3NEKA 2CDRB 4QYRA 4EMDA 3QO9A 4RW4A 4WIQA 2DGTA 3BKUA 4GKKF 2VBXA 1Q4RA 2DHGA 5AXLA 4NLOA 4H4MA 4U8YA 1HBMB 2DGXA 3NGTA 2XGPA 2OPSA 4LBIA 1F0XA 3VAMA 2CJ9A 1Q5VA 4ZLPA 2W4CA 3OD2A 3D0HE 3ZTRA 3HKWA 2LEAA 4U7CA 1WEZA 1IBLF 2A3JA 1L3KA 3E3XA 4PQUB 3B82A 1S79A 2RU9A 4F3QA 2XM3A 2Z30B 1UCNA 4MKVA 3I82A 1IM4A 4CLSA 2XY7A 1NSAA 1Q0NA 1TQLA 2F8MA 1XMOF 3NS6A 3BR9A 2Y1IA 4GO7X 1HNWF 2I0XA 4QIEA 3W8PA 2D3O1 2E1RA 4YHHF 1JKHB 3RGIA 1RUSA 1X4BA 2MQLA 5H1SV 3B4DA 3VF0B 5KFFA 4ELUA 2WBRA 4G1QA 3TA2A 3HHKA 1TL7A 4NI2B 4CYUA 4PUOA 1HBUA 4ZN1A 4ECXA 4NLXA 3DRPA 1JWWA 3G6YA 2ZOFA 3AQPA 2XSFA 3R1LA 3W66A 2BRLA 1AZSA 2HK2A 1HBMA 1FNOA 2ZZMA 2MXYA 4C0BA 2B8PA 4X64F 4OYPA 1WDDA 4NYZA 4DU7A 3FZ2A 2IJFA 4AUKA 5LT5A 4V19J 4CLFA 4PXEA 4BBYA 3FCWA 4P2XA 4X4QA 5A2QU 4L76A 1FHTA 5C24B 3VHQA 1ACMB 3PRDA 2UVWA 4M5LA 5DS7A 3HZGA 3CULA 4ZA1A 4DR6J 2MQPA 2UXDJ 2DBBA 4DX6A 3JYTA 1CJUB 5I3PA 2J8SA 4W4MA 4JI7F 3IBFB 2XMWA 4KGXB 4Q7AA 3T5KA 1GEHA 3M9OB 5EWGA 3CJTA 3BO3A 5ETPA 4AE5A 5K14A 4A8XA 1ELOA 1G6BA 1UKUA 4JBCA 1V5VA 2HBZB 2DGOA 4LSLB 4LRBA 2BACA 2ZWOA 5I3UB 4HACB 1K73T 3BV8A 1RSCA 3V81A 3E01A 1RLDA 1TL5A 3JB9k 2RQCA 4YR3A 2E9RX 2OD6A 2FZCB 4ZVFA 4DL0C 1RLCL 1APSA 3HD2A 4ES2A 2ALYB 4DV0F 3CJ2A 3B6BA 4USIA 1WOSA 5I3QA 2Q66A 2DNNA 4HHUA 5GAHU 2EFPA 2BBEA 4WFBQ 3AOCA 1FJCA 4RNOA 3NKYA 1VLOA 3MM6B 1M1HA 4JV5J 2HGMA 5KFHA 4IO9Q 3KK1A 1U8WA 2CKWA 3US5A 3UCGA 4OLPA 2ZH8A 4NXNJ 5C7PA 4DR3J 3DM2A 3G86A 2AZ1A 4J9KA 2DEJA 3PJWA 3QAUA 2HFUA 1RAJA 4LMZA 2BQUA 1SC3B 4ECVA 2V69A 3D7SB 1JXVA 5M2PA 2FZGB 1EIYB 2BUNA 4LFBF 3GWCA 4WXOA 2Y8WA 3QGHA 1U26A 2OTLS 4D3GA 4KC5A 5L9XA 2HS4A 4NLYA 2AYGA 2KO1A 1R89A 3HFZB 1YITS 3DGPB 4DV3F 4DV2J 5IQ6A 2XY5A 5HANA 2JNJA 2DGUA 2AYEA 3QJPA 2HHHJ 1WKLA 4USTA 1OYEA 4IFVB 3JAMU 3IWNC 1MMDA 4AT1B 1N32J 3PX0A 2ZE2A 3G6XA 1WUUA 1UJ6A 2EFVA 4X65J 2M9KA 2BE9B 1PSDA 3QT8A 4ZVEA 4EO6A 1T9WA 3VAJA 2DK2A 2Z2YB 3SCKE 3HJFA 2JEIA 1AUDA 1XNRF 1OQ6A 2EI5A 2R2UA 1HBOB 4OQJA 4X4RA 2XS5A 1M1GA 1N6QB 1Q82T 2C3YA 1QUVA 3PM9A 3HHDA 4IRDA 2J7UA 3DLGA 3CCLS 4G1PA 1HNIA 2RIJA 1IBKF 4IQMA 5FDLA 4OZ3A 4C9DA 3F0NA 4PAAA 4ZJOA 4C8KA 4DR2F 4A48A 1A7GE 2XO6A 2Q43A 4RW7B 4OHWA 3CCMS 3EPIA 2R8IA 2VJVA 3KMSA 2ROPA 4ID5B 4N41A 2MLXA 4LQ9A 1X4HA 2LA6A 5B0GA 4N56A 3H2LA 4CLKA 3DLJA 1VHFA 1T94A 1H98A 2PFDA 2EKNA 4ANDA 2OPRA 1OQ3A 2FY8A 5BR8J 2ACMA 4TVAB 4IFVA 2MHNA 3V6KA 1Y4ZB 3B4MA 2BM0A 3I0SB 3DNCA 4J9PA 3MECB 2Z58B 3GQCA 4K5SA 1K9MT 3TZYA 2VC1A 3TWZA 4YDDB 1B3TA 3CD5A 3QJLA 4HTJA 1SKRA 2EFQA 2XLJA 1RTDA 1RTJB 4ZVGA 4C2MA 1TKZB 1J5EJ 2MPUA 2UXDF 3RB0A 3W7BA 2PI5A 4KPYA 4CLYA 1Q78A 3GIKA 3EZUA 4DS4A 2F9JA 1RI7A 2BQRA 2JJ4D 5KFJA 1FD2A 5AXMA 3K17A 1U0HA 3FZBA 4TQSA 4Y0FA 5ETTA 2W4DA 3M32A 3O5TB 2I5JA 4K4ZA 2F7VA 4JI0F 3K5NA 2BABA 2QTWA 3MPUB 2OFHX 1T03B 1VQ8S 1HFEL 3QZ8A 4LF8J 4B9SA 4RW7A 3OVBA 2WW8A 4Q8FA 2W25A 4NEZA 1N34J 5C42B 5IT0A 1S1WB 3OSNA 1C1CB 2HNDA 2HHUA 3DC2A 1VQ9S 2UVUA 2VHGA 5A6PA 2PDAA 2HFVA 5KFRA 5JVGQ 4IG3B 2HFNA 2LFVA 4KKOB 4DCPB 2GVZB 1U2CA 1TUVA 4BCAA 1HW8A 1T3NA 2ZVIA 4HLBA 4CNZA 4RNFA 2WOMA 4F25A 2V4QA 2JOQA 2OEMA 3J80U 4NXNF 2XYPB 1SCJB 4DR3F 3DLBA 1O5JA 1FKOB 1LXJA 3FDSA 4DSKA 1TKZA 2BE2A 4R8UA 2CYYA 3EICA 4J9NA 1RP5A 2WBMA 2ZBRA 4F4ZA 4QW8A 5CD4H 3W5ZA 3BH6B 5CQGA 2OPPA 2HPUA 3VR1A 5EWFA 3IC1A 3J7A1 4ZP8A 4MK7A 3HXMA 2BDPA 3NCPA 3I4PA 2RKIB 4O3QA 4PYAA 3BGFA 1X4CA 4RNHA 2DHHA 3FEZA 5C42A 2HHHF 4RW8A 3J81Y 2PD1A 4TY8A 1C1CA 2GAHC 3DOMB 4C6AA 1NRKA 2VG5B 2VG6B 2AU0A 2FVRA 3CO0P 3BGLA 2F3JA 4IG0B 3BSCA 4JYAF 3QT6A 4IG3A 1KQSR 2ZC4A 5L46A 4DL2A 2FHJA 2GVZA 5FLXU 3HCXA 2A18A 3DLLQ 1NU4A 3OTEA 4C0HA 2W01A 4K2XA 3PRVA 4KH1B 5LJ3Y 4DR7J 2HBQB 3RBXA 3CIMA 4WFAQ 5DQHA 1RT1A 1D9AA 4M5NA 1IKVA 2MZRA 1V3ZA 4QZVB 4Z2XA 3TZXA 4J9LA 5AXKA 2MKJA 3M6XA 3VZHA 1S76D 1ZOTA 3LAMA 4AQYF 4RX6A 4KGMA 5ETSA 3MEEA 4WKRA 3GCWP 2VDHA 1R27B 3BBFA 3TP2A 1NPKA 2G1HA 3GG1A 3VAIA 1G3OA 1V3RA 3GG0A 5KFWA 1GMWA 2ZZTA 4K4SA 2LQBA 2BQ3A 4DPYA 2KDOA 1B70B 1KTQA 2AEMA 5BYSA 1ZTWA 3UN5A 5DRKA 2ASJA 4N5SA 1VC5A 3MUTP 2CXEA 1QE1B 1N52B 1GAOA 3W63A 3OHAA 5K8NA 2HYIB 1JJ2R 4F4AA 1N54B 2VKZG 2CIMA 4O4GB 2N82B 4NCAA 2BV3A 2XYGB 2B4PA 3RAMA 5EN1A 2CWXA 1Q8LA 2V0NA 1TVRA 1JB0C 4KGZB 1KC8T 4WZQA 4CWBA 3RAQA 4KBIA 3GFHA 4O44B 2FUG9 4Z7CA 1N36J 4RBUA 3D9BA 2RAQA 4RWXA 4DWIA 4NASA 1HA1A 4NLVA 3KUHA 1H7XA 3GV8B 1UFLA 3H2UB 2XNRA 5IWAJ 4CTAB 1N5VA 2R7QA 4PXCA 4YDXA 4Y3CA 4DPXA 4DV1F 4FYVB 2CA9A 1KWMA 3EGVA 2AF6A 4G6VB 4L75A 4WU3A 4B02A 1JIHA 2DNRA 3V6DA 2V2QA 4LSZB 3CEDA 4CO2A 4NLTA 1MG7A 4I2PB 2PSZA 2V4JB 4YOEA 2HGNA 4DPUA 1IJEB 1Q86T 3OJSA 3FRYA 4B17A 3M1VB 2XZDB 1UVJA 1TL3A 2HQ3A 3N6NA 4QCLA 4EYIB 4YFUA 3CCSS 4FYDA 3I56S 2UUWA 3CDBA 1B99A 4X84A 5KTQA 1RDRA 3NGSA 1FRLA 4C8YA 8AT1B 3SSQA 3P4UB 1U6BA 2HVHA 4R25A 2XO7A 1DBDA 1OY8A 2DGWA 4BHQA 5D78A 1YSJA 5JJBA 4O44A 2MZJA 2EK1A 3ZZRA 2LXUA 3S6EA 3EXCX 2NUHA 3D0IE 4ZPVR 1MWYA 1VQPS 4FVMA 2E5LF 3H5UA 4YQWA 3LP0B 2H54B 2C3UA 3AHPA 3HHLC 3OW2R 2D69A 3CCUS 2PMHA 2W4PA 4EUVA 3MWBA 4LF7F 2DNPA 3HT0A 3DRSB 2HAFA 3N5BA 4UY85 1RBLA 2JFDA 3R7SB 3QFHA 3DDKA 1N48A 3QGGA 3N28A 4IQXA 2CQ1A 2MJUA 3EDRB 3S7RA 1ZETA 3ULHA 2CRLA 3W60A 2PN6A 4DSLA 2IYGA 4ELTA 4TXSA 5EDWA 2UXBJ 2EBEA 3ETMA 4Q0BA 4C8OA 4NPOA 5I42A 4JV0A 4QU6A 2X1AA 3TJ8A 2WONA 1NAQA 4M5IA 3SI8A 1T9XA 4BLGA 4TY9A 2HURA 4ZP9A 4QQBA 5KFKA 3FBCA 2K1RB 5DETA 3HF5A 2CDQA 2DGSA 1CS4B 2ZH5A 4WF9Q 4F67A 3KG4A 4B9MA 3PNIA 5CYQB 1WC5A 3TO8A 5L38A 5F8LA 2FJBB 5CZXA 2V50A 5ETQA 3JQMA 4IKAA 4UW2A 1XK8A 3M8WA 5B0EA 4N8NA 1RKJA 5LMNF 1CPZA 2MYFA 4HI2A 4ILRA 1IKXB 2XGQA 1YZ7A 1WSVA 3KLVA 1C4CA 3MR2A 2AZ3A 3ITHB 1NK9A 4H4KC 2XMAA 4A8MP 3RBEA 4X4TA 4J5OA 5DO2A 3NOGA 2JVOA 2F4FA 2PIIA 5D0GA 2GCFA 2CPEA 1RT3A 3NBPB 3V2UC 3W65A 1JQGA 5ETNA 4M5DA 1HBNB 3P49B 2IC3B 2BXJA 5C25B 3KHLA 2JEJA 2M3DA 1VRTB 4URSA 3MR6A 3HHNB 4R0JA 3CCVS 1H2VZ 4MH8A 1TV6B 5D6GA 3THTA 1VHIA 2EFNA 1FWKA 3AXMA 2I6WA 5BYRA 1KONA 2CJQA 3R9LA 1FEEA 3HVWA 1SJ3P 2OH2A 2BKNA 1S12A 4CQ1A 2CNKB 4F8RA 1WF2A 2X1BA 1TL1A 4F3OA 3KNGA 3KKFA 2FJDB 4KHPF 5DM7Q 2J6TA 2QYCA 3OFHA 4CT9A 1YWXA 1ZAXA 4P74A 4K0KF 1EP4B 2JC0A 1I3OB 2MY8A 2GS8A 3R97A 2Q79A 3ITHA 4L6V3 3OXLA 4CNYA 4JI4J 4DR1J 5F3TA 5J1EB 4YB5A 3BPDA 3FJ2A 1NNDA 2MB0B 4TKTA 3SSSA 4F3MA 1FRIA 1E6VA 1HW9A 2W7OA 3LWMA 2UUBF 1RISA 2VFRA 4OX9J 4MKYA 2QLJB 3MMJA 1HBNA 1FD8A 2QO3A 1N5SA 2VL1A 5K20B 4ED8A 3R5CA 5C25A 2CQ4A 1N0VC 3DGVA 1RB0A 3N6MA 1VRTA 1BWVA 5K8MA 1MWZA 3F56A 3PW5A 2ZBQA 4P71A 3NY0A 2EFGA 2HMIB 2DJWA 2P9GA 2K7JA 3ZZPA 1S72S 2L9WA 3QWUA 2AJFE 4NOHA 3DXBA 2L41A 2XB2D 3M05A 4DV7J 4CLWA 1HPZB 2NXUA 3DXSX 3MCMA 3SCJE 2GV1A 4ECWA 2IBKA 2DITA 2DY9A 1BGXT 2MSSA 3KLGB 2MJNA 2IHR1 2YNFB 3JSMB 1HIYA 1XIQA 3N0VA 4YR2A 1AA1B 3BYPA 2R8HA 1WEYA 1R8HA 2OELA 1NJWA 1CJVA 2XSJB 5BYQA 1F9EB 3O8WA 2Y0SD 3D1HA 3TAMB 5F8GA 2WB4A 1R0CB 1Q8IA 5LSRA 3Q86A 3M4XA 3DLEB 1CJKB 3GIIA 1URNA 2UP1A 4IH5A 1M5SA 2H9ZA 1K1QA 4ZLLA 3MDFA 2V2KA 1IWGA 3R1HA 3M2UB 3T1HJ 3VCDA 4PXDA 3DYAA 2GVDA 3KK3A 4EZ6A 2W7AA 3GMGA 5IT9Y 2ZJRQ 2I1RA 4HDHA 2IJNA 2ZM6F 1YTYA 1N5QA 4JI3J 1AW0A 3HSZA 4CLPA 4LRDA 1U1OA 1NO8A 1TFYA 4YB6A 2XS7A 4ZPCA 3SBMA 2HMIA 3T6BA 4I6WA 5F9LA 2XHCA 4ECUA 1QD1A 5CH7B 2VD3A 4C3MA 2Z2MA 1B0PA 1Q53A 4X4OA 2YWGA 2BE7D 4LF6J 4B3MF 3MEKA 1TFWA 3R3TA 3PHTA 2VA2A 2Z0GA 4TYAA 5A6WA 4U6PA 3KLGA 4I7FB 3UN2A 1KHWA 2ZOGA 1U48A 1WKJA 4DS5A 4WTOB 2RD5C 4QJVA 1B4SA 5DG9A 9RUBA 4I4BA 2FDNA 3TQ1A 4JI5J 2CZ9A 2Y1RI 2K06A 1IBMF 2GIQA 3T1YJ 2J76E 4NLQA 1M5HA 1X5PA 3CGIA 3DLEA 4PPDA 2WW4A 1YJNS 2GJFA 2NPFA 4X62F 4DLEA 3W2VA 1IQTA 3IS9A 1VQLS 3BZQA 4QR0A 1UA0A 3K8WA 3RBDA 3S1TA 1F60B 2QMWA 4C7QA 1FKPA 1Y0HA 1FFSB 3CE8A 1PJ7A 3ILLA 1NXIA 2OFGX 3KK2A 2MMYA 4DF4A 4OX6A 5HN0A 3BREA 3Q0AA 3L09A 4JI6J 3D0GE 3KWMA 5DG8A 5F0WA 3POTB 5KFMA 1H2UX 1HHQA 4IO1A 3MGJA 2ERRA 3KXDA 2W8LA 1IVZA 3W61A 2KYXA 1N5TA 2J6UA 3FSXA 3CJKB 2X7IA 3P5BP 4NXMF 3THVA 4NMLA 1SIWB 3G71S 5A8RA 5LOQA 1LW2B 3R2CJ 5B08A 5ETRA 1Q8BA 2W1BA 3FFIA 1HQUB 3VQTA 3ZZTA 1NHKL 1JNZB 2V5HG 2VJUA 4YY3J 5HROB 1I6JA 4RKUC 4EFAC 1KLMB 4DU8A 4D3HA 3A12A 2MZQA 4GMKA 1I1GA 3BN7A 1R31A 2XNQA 5LM7E 3RG6A 3CMAS 3BQ0A 3VGSA 1S0NA 2CJKA 2OMLA 1ZM2A 3NOCA 1W26A 2HVEA 2IM3A 3MAHA 1L3SA 1HQ2A 2WZ1A 3FRZA 1I51B 4CI0B 2ZD1B 1VS3A 4C11A 1NBEB 3PIPQ 5HSPA 3K0JA 5H9FJ 2BJDA 4ZDNA 5DDPC 4ZCLA 2AGOA 3D3CJ 2IM1A 3G82A 4FVCA 4O3RA 1BHNA 2W2PP 2BOAA 5D3GB 4J9SA 2E1AA 1M1KT 4K8RA 1UWBB 4ZPWR 2HGLA 2MZSA 3CSKA 4CLZA 4X66F 4ED5A 2FJAB 1HWKA 5KFOA 4P75A 3CJKA 3GLJA 1BMQB 3PVXA 4LQ3A 3Q23A 3GYGA 1SQFA 2RQMA 2ZH1A 1RAHB 3FCHA 3PRBA 1FRKA 3U1MA 1LW2A 2WVBA 1PILA 3MFIA 1C0UB 4ZVSB 1OYDA 4QR1A 3PJXA 5A8WA 1YHQS 1XERA 1HQUA 2HQDA 3GJSB 3H5YA 4G1IA 5EX3A 1S9GB 3PKYA 4DFKA 3ADAC 3I9V9 3T1HF 2KKHA 3A3OB 3MR7A 1VGYA 1TMJA 1U1NA 3OJUA 2ABYA 3BGRA 3B78A 1WTBA 2PEHA 1JLFB 1JLEA 1EAYC 2VBWA 3VGVA 2V68A 1CULB 4W98A 1EQ0A 4B3OB 3TNVA 4PPZA 2OEJA 3UCZP 1F2HA 5GADU 2I2YA 4LRCA 2KYZA 2KHCA 2KG0A 3DLKB 3IR7B 2ZD1A 2R7WA 2WVEA 4J90A 1N33F 2IRXA 4JI1J 3MFHA 1QSYA 3SFUA 3K5LA 3OV7A 5KFTA 4NYPA 3DOLA 1UPPA 1IKWB 2N3OA 2J8AA 3HSGA 4GC6A 4FN5A 1WTFA 2OJ3A 1MU2B 5B0AA 3U27A 3BN4A 4PG8A 1QTMA 3VAFA 1H0HB 1EQMA 1XC9A 4NYOA 2QT7A 2ZNYA 4UY8T 1AFIA 1LNQA 3UN3A 3SCLE 2B3TB 4P73A 1DHMA 2A10A 4FS1A 1SKUB 4MT1A 2CZVC 2DKOB 4QYZK 1XR6A 3OXGA 3QYYA 4A46A 1FDNA 4EZ9A 1JJCB 3I96A 3HDSA 3UW1A 2VG7B 3CVKA 2OP5A 2DNGA 2CQ0A 2ZH9A 2HKEA 1KOOA 1ZM3A 1UEKA 3CCJS 3FC9A 1VIXA 4JI6F 2KXNB 1Y7PA 3AA9A 2QYGA 4OZNA 2CQ2A 3OHBA 1RHMB 1X9MA 5J1PA 2B7CB 3L7OA 4OI1A 1VRUA 4MIWA 5B09A 2YKAA 1WC4A 1WELA 2W8KA 2F63A 1VQ5S 4KTQA 1OSDA 1MSWD 3TUIC 3LALA 2NXJA 4DV5F 5CA5A 3CCQS 1YJRA 5M2RA 4PG7A 4LBPA 1MMNA 2HLTA 3DDNA 2NCKL 3MM9B 1JXLA 1QVFR 3ZTPA 3NRBA 3QRQA 2JC1A 1JLQA 1RTIB 4M5MA 3M2RB 3EUNA 4QWDA 2MZ1A 1SKSA 3C6UA 2XWYA 3FEYB 1S1XB 3M30A 5ETKA 2E44A 4HKQA 1VLYA 3R7NB 2YKMA 1T0TV 2VPWB 1KHVA 1WI6A 3I5CA 4FDFA 4A8WA 4DZ6A 4ILLA 2E5IA 3FVYA 2D3ZA 5DQIA 1SJ1A 4GKJJ 1RT7B 2KG1A 3L95X 2B56A 2GIFA 2PO4A 3X3UA 1HQEB 3Q2TC 3CB4A 1TAUA 2KVIA 2XHWA 1XWLA 3AJ1A 2UUCF 5MLCV 1IUJA 4ED4A 3OFFA 3Q8PB 3VQSA 4B3RJ 4IR1A 2V34A 2CADA 4H4OA 2QA4G 4RBTA 1VQ6S 1OIAA 3C16A 2ACYA 1EETA 2RF2A 3QAEA 2YKNA 1HI1A 1S6PA 2B8QA 2YPZA 3I55S 3EX7B 4U67Q 5SZTA 1VC0A 1M5OC 2XULA 2HNZB 2DNLA 5IQQA 3KLEA 2QLWA 3LANA 4FNIA 2RB7A 3M2RA 3ILOA 3ONQA 5HMWA 1CLFA 2ZBPA 1C0TB 4EGLA 3G9CA 4RW9B 2EG2A 3ISZA 1U6FA 1S1XA 4ECRA 4JI1F 1X31C 3HHLA 2D7SA 4N47A 2IA0A 1X4AA 3H4BA 1UW4A 4C3LA 2AW0A 4TN2A 4FPRA 3D67A 4DPOA 4GVBB 2YKOA 1FWPA 2VUGA 2EW9A 2YPYA 4IDKA 3Q8SB 5AJ3F 5D15A 1S77D 2QV6A 4UUXA 1LWXA 3BJYA 3MEGB 5FIIA 1TKDA 4DPWA 5J1NA 4DV6J 2CQ3A 1TK5A 4Y6IA 2ATLA 2RH3A 2R7SA 1S1TB 3HVTB 1WWHA 3M8PA 3KJFB 5HBMB 4NEYA 3ZFVA 1FRMA 3MUVP 4PWDB 2QMUB 2HNYB 1WOPA 3JTOA 4DQPA 4C3KA 2VICA 1JLGA 4NE9C 2COLA 1UA1A 3LGHA 2XMMA 2DR5A 1QAXA 2PEBA 2QSFA 1U49A 1RU2A 4DR5F 4CH1A 2LECA 3GZ7A 1CJTA 5G0RA 2IYIA 1TKXB 1S1UB 2HNZA 2ZBCA 2AJ2A 2ZWPA 4NWBA 4ZCKA 4B3TJ 1RU1A 2YNIB 4YP3A 2DT9A 5L39A 2F4VJ 1KQGB 1GH8A 4P9SA 4ZPTR 4DLGA 3TA0A 2GX8A 3WIUA 1M5PC 4AXJA 2VQEF 3U1LA 2ASYA 4LVOP 4OJGA 4F4KA 2NREA 4H4KA 4LBHA 1FX2A 3O3LA 4LF4F 4K4TA 1YJ7A 2JFKA 2KN4A 1C1BB 1HWUA 2XEXA 1U1LA 3W2WA 3MEGA 2JHEA 4ZKAA 3MM7A 3N5FA 3BR8A 2VPXB 1QJHA 4EEYA 2HZVA 3M9NB 3HVTA 2F40A 1FTRA 3GIJA 2G0CA 1PG5B 4BC7A 2PA8D 4PWDA 3IBCB 2C3PA 4CO4A 4C8ZA 1SVDA 4F0KA 3UQSA 2GFFA 3KLHA 1XNQF 4OJ1A 5E0OA 3TJ9A 1MW7A 3GYXB 2AP6A 1PC4A 1HD0A 3LWLA 4C8LA 2E1CA 3IGNA 4AL6A 2QL9B 2BANB 4M5GA 3RZAA 4MJKA 2FHKA 2XMJA 2YNIA 1LEOA 1U02A 3FBEA 3OVAA 3MAAB 4M5HA 3HJVA 5L1JA 4GKJF 2ZH7A 2DIUA 4G3IA 3LGNA 3MEDB 1LWCB 3I87A 2FVQA 5U47A 3D28A 4KT0C 1SV5B 2MQMA 2R7RA 3NAIA 5F8HA 3K89A 3KJVA 1NSPA 3PW0A 3J7AN 2ALZA 4HL9A 3PDNA 4L3KA 1RAAB 2IM0A 3SQOP 3KJQB 4WP3A 2R9LA 1W2IA 2JX2A 3D66A 3UO0A 4ANEA 3M6UA 2L48A 4I69A 1FJEB 2C2MB 1LWEB 3HMJG 3G6VA 4J7CA 2XMUA 3T3FA 4LF9F 2W2OP 1MLAA 2WK4A 1BQMB 2L9NA 2CPHA 1MN7A 1REVA 4IR9A 2L08A 1E6YA 3OUYB 3L9ZA 3AD8C 3M8QB 2IDLA 1TMMA 5E33A 1VDHA 3DRRB 2D3UA 4WE1B 3H59A 4OYAA 3KTQA 1JJ4A 1JMTA 1NK0A 3HKZD 3CMQA 4QIWD 2CFXA 3ENQA 3R5DA 3LP2B 1FK9B 3TR5A 3MAAA 3CCES 1QM9A 1FFWB 3GE9A 3MPDA 5L1IA 3CJSA 1UETA 3DHXA 1VOMA 2LKZA 4WPAA 3MEDA 4OZLA 3W9HA 1LWCA 3A1YG 3QGIA 5IV3A 3D6MB 1O0PA 2ZJPQ 1BD6A 1SV5A 4WYWA 1KD1T 3I9ZA 4FYYB 2EPIA 2RRAA 2EWHA 2FHMA 4LFAF 3JSRA 2JSXA 2ASLA 1BXNA 4DUYF 1PGZA 2LP4A 1KTVA 1Z2LA 3BDEA 1S5ZA 1ZM9A 2YBVA 2UV8A 5J2NB 3VGTA 3KUGA 3PY8A 3CO9A 1IN0A 3J7Z5 3RRKA 2HRUA 1EKRA 3H4DA 3K59A 1CSJA 4ATNA 2EXUA 3Q8VA 2QG9B 4ZMMA 4GC7A 3SQGB 5B7WA 1R8BA 4B3TF 2WSFC 1NLKL 1S6QB 1GX5A 3IA0A 2F4VF 3P96A 5LMUJ 4B3SJ 3DRRA 2V8DA 1SH2A 5K5MA 2FVPA 5KT5A 2HWTA 4ALZA 2FGOA 1DLOA 4L73A 4DSJA 4A47A 4QYZJ 1N8RT 3MOZA 2ZUGA 3K5PA 1X5TA 4LR8A 1FK9A 4URQU 1X5OA 3LP1B 4OL8A 2C2OB 3MMAA 2HEKA 4B9VA 4P7VA 2R8JA 1RAEB 2MLZA 3DDIA 3GJRB 4MKBA 5HI7A 2E5HA 2RS8A 5T7LB 3CDUA 4PXBA 1DQAA 5D0EA 2XC9A 4USKA 4ES1A 4OZ0A 5FD1A 1I94J 1R8PA 2X3DA 3K8VA 4KFBA 2K7KA 2VQFF 4JI8J 1SL1A 1S59A 4DUZJ 2B5JA 3RRHA 1H38A 4I2QB 2G0IA 5J2PA 4DL5A 1ZM4A 1FTCA 1MMLA 4RW6B 3AFGA 3FSYA 3SQGA 2B6AA 1QTNB 2GIRA 1IQZA 3DI6A 8RUCA 1HLWA 1FDDA 4DCOB 5E3CA 3MPVA 2HLUA 4EBDA 2AJ0A 2AX0A 1S6QA 6FDRA 2YWHA 2W9AA 3OLAA 4OX7A 4OYXA 5AT1B 1KFSA 4PG5A 2ZITA 1JNRB 5D4PA 1NPRA 1R6VA 5HQ8A 4BWMA 2FLOA 3DMJB 3UD5A 4KB7A 1VJQA 2DXFA 4QU7A 4RO0A 2DH8A 3LP1A 5CABA 1VFJA 2HHTA 3CCTA 1T05B 2N7YA 2V2ZA 1JLAA 1HR0F 5LXYA 4DR4F 4TLQA 3QIPB 1GXLA 3ETOA 3WBZA 2LDYA 3F44A 3M2VB 2IMWP 4TLRA 3ZTQA 5KFEA 1S57A 1UWAA 3DOKB 2YQ1A 2SXLA 4XO0A 3OL6A 1Y5LB 1PCAA 3CJRA 3WIVA 3W1YC 2E66A 1S4EA 4UOFA 3SMZA 2RUGA 3K57A 2W9BB 4BDPA 3NWRA 5KFYA 4W92B 1FJGF 2BKOA 2CPYA 2NXNA 1IJFB 2DISA 3I5BA 3WDOA 5KFQA 3BDPA 1A6LA 1P8GA 5IXUA 4Q2MA 3KDNA 2RU3A 3FQLA 2ZBIA 3JS9A 3PW2A 5IM0B 1S9EB 1KLNA 1WEXA 4PQUA 4F0HA 2VFUA 2V9WA 3V5RA 2QL7B 2Q6CA 2BJ9A 4P2SA 1PIEA 1RAGB 3H2VE 1ZA2B 3MM5B 5M2UA 4DL4A 4OX8A 1S0VA 2DO0A 3JTPA 4RL1A 2HHWA 3FK4A 3MR5A 4I6AA 4OJ3A 3EJMA 4ENOA 4NL5A 2BW2A 2VZ9A 2DCUB 5KFIA 2F1FA 3BBCA 2NZ4A 5GVQA 3MMBB 3IP0A 1TK0A 2X1GA 3M6WA 1CQNA 2NR0A 3QIPA 3HO1A 1QAYA 1G4CA 2Q3PA 3E8OA 3G8TA 4FF2A 1JKHA 1GQEA 1MNEA 5DLGA 2VASA 3R6GB 2LU1A 3DOKA 4JOUA 2OD4A 3IRXB 4NI2A 2MTLA 2F9DA 1EKSA 1NUEA 3CDWA 1GFWB 2JRSA 3PR4A 3Q8UA 1NB7A 2HVZA 3E2EA 2ZC3A 2ROEA 2OUGA 2XCPA 5F8JA 3H42A 1XMQJ 2H48B 5D0HA 3G87A 1RT6B 2UXCJ 1RBOB 3PYGA 3ENVA 3UVJB 2ZH2A 1M0SA 3D2WA 1U8SA 1DARA 4IH7A 5C24A 4OYWA 1ZBTA 2NUUG 2FHOB 4QIVA 4LF5J 1CJUA 1H7WA 4ILMA 1VRQC 1R3NA 2EC2A 2EVZA 2RS2A 2QC3A 4KSEB 1JXEA 5A76A 1UZHA 3MMBA 1W7WA 2NYHA 4LSNB 2QSWA 3W9JA 3EGWB 1WG1A 1KVKA 1VQOS 2Y1JA 1V9OA 4LSLA 4B9TA 2J9DA 5KAKA 5I3UA 4HACA 4OI3A 2J0XA 3GIMA 4HEA9 4DBQA 1S1VB 1WC6A 3IRXA 4FF4A 3KLFB 2JLFA 4LRFA 5ADZA 1YJTA 2IMOA 2POKA 2QGFB 3LPEA 1U4BA 2ZVSA 4LIWA 1AROP 1JLCB 1WNEA 3A8JA 3UR0A 4M95A 3ELHA 4DV4J 1KVJA 1LWFB 3G2XA 2WRMA 3AY0A 2A2DA 3X1LB 2CPXA 3M9MB 3MM6A 1WG5A 1ZPVA 2W24A 2VH7A 4EYHB 2HHPA 2LEBA 3RB4A 4AFFA 1HWIA 1L3VA 1U24A 4PZVA 2C22A 4K7QA 1S10A 2Z56B 2O5DA 4RBVA 1PO6A 4O0NA 1Y9OA 3C66A 2R7UA 3TZWA 2E29A 2OI2A 4MKAA 4DL6A 2BKPA 1D8YA 3TOQA 5B0DA 3D68A 2HK3A 4J9MA 1PKUA 3D5MA 1K44A 1RT5B 3QZ7A 1IR2A 4ANCA 4PYDA 4ECYA 1H2TZ 2FD2A 3MR3A 1NEEA 2RRBA 1KDNA 2R8KA 3RR8A 5J2MB 2HSEB 4KO0B 3H98A 3DGPA 3MCOA 2XLKA 5AE3A 5CYMB 4Z7YA 4DL7A 2WSCC 3PFEA 5DZ7A 2L3MA 4B08A 1T95A 5CCLA 2ADCA 4ZHRB 2QE5A 2CPDA 3JSBA 2C28A 1NHVA 3TUJC 4WXWA 4MK8A 2IRYA 2FHJD 3PO5A 1RYSA 1TK8A 4H54A 5HL7Q 4DN0A 2LYVA 1LWFA 4RUBA 4DR6F 1HBOA 3FCVA 1KSPA 3RB3A 3CD7A 1N6QA 3OTBA 1N88A 3VVTA 3CMES 4GVLA 3T5LA 1PYOB 1S49A 2GMLA 3TUPA 1N0UA 4C8NA 3N01A 2DR8A 2R3VA 4MIBA 3KG1A 3VAHA 3AB4B 2ZH4A 3M8ZA 3NNAA 3C6TB 4QWEA 1GMWD 4CM2A 3GPAA 3GSDA 1FRXA 4TNOA 2P5VA 3IR5B 3WZ0A 4ID5A 5HAOA 2DTJA 2XG8A 3AA8A 5A2QY 3RYLA 4M5KA 4DX5A 1YGYA 4PWUA 3KMQA 3QNWB 5CYMA 4FXDA 2QFIA 4RNNA 4J9OA 2O01C 1F5BA 5A8KB 3I0SA 2JZ5A 3SV4A 2VF3A 4A4JA 2OTJS 3MECA 4JV5F 2JH3A 1UMJA 2DH9A 5C2CA 3T5JA 2WCXA 4HH0A 4OHZA 4CM0A 3G8QA 2MKKA 1RTJA 2H3EB 1ZA1B 1XR5A 3Q22A 1T8EA 2EBGA 4NRUA 3NMRA 2W7PA 3GIRA 4XAKA 2ZHOA 5HMYA 2B4VA 2CPZA 5DLFA 5KG2A 1X9SA 3FMWA 2P9EA 3MPYA 4X4UA 1CG2A 4U7UK 3R5JB 5KFUA 2CWKA 2V63A 1T03A 3K5OA 4ZVRB 4DV2F 4KHRA 1FCAA 3C6TA 4NZ6A 1S1WA 2XZTB 1FE4A 2J9EA 1N32F 2UUAJ 1HNZJ 1VIOA 3KHRA 5KFXA 2NPIA 4WWSA 1SPBP 5DZ6A 4X65F 1B7FA 2W2QP 1RWVB 4ZVPB 3BBBA 7AT1B 3SSRA 4GKKJ 4KKOA 3OXFA 3IG1B 4ECTA 5KT4A 2CQCA 3CDAA 2ASDA 4NA1A 4GRSA 3UWTA 4RUAA 2QLFB 3D6HB 4OI2A 3CJQA 3NP5A 1LK7A 3K2YA 1IBLJ 5GAHI 3BKTA 1FKOA 1P9YA 4NRTA 2P8IA 5JXSA 2UZAA 4J9QA 4DZDA 2BZ2A 1YBAA 2QA2A 3C14B 2ILYA 3MPWA 4LJMA 3JAMY 4NCGB 3BKFA 2RRNA 4DG1B 1KEKA 5D8HB 5DDRC 1X8DA 1XQIA 2K3KA 2KI2A 1NK7A 1WC0A 3Q83A 8ATCB 1NK4A 2DHSA 3GP9A 3HFVA 1OMSA 1U1KA 2RKIA 1S6OA 4BWJA 1XMOJ 1VYAA 3EVOA 2Y0BB 1HNWJ 2N7CA 2IAJB 1VC6A 4WZMA 4PEOA 5BR8F 1RWMB 5KT7A 3DOMA 1RWKB 1RWXB 1IWAA 2CNOB 2MLYA 1TU0B 3MZIA 3RAXA 2VG5A 2VG6A 2YTCA 2BRKA 4IG0A 2OMOA 1NSKL 2M52A 3TX8A 2NQPA 2D74B 4LR7A 2F5GA 2DPIA 4L3NA 3CC2S 1DTQB 4USWA 2VV5A 3WHIA 2DPJA 1RWUA 3MMCB 3VZIA 4CO0A 1J5EF 1HNVB 3M7VA 3BYRA 5IV4A 5HLFB 3Q2SC 1SKWA 1WORA 4C48A 5KFGA 3TEHB 3VTIA 1PBUA 4X64J 4DSIA 1YRTA 3IAS9 5E3PA 3UDLA 5K8PA 3CXCR 1R43A 3BSOA 4NLUA 4FF1A 3PHEA 1RWOB 3V6JA 3GU0A 3BPSP 2AX1A 2QMXA 1UVKA 3MCNA 4LF8F 4F0MA 1HHSA 1SIZA 4DG1A 1N34F 3MOJB 3AH6A 2VPZB 2HBRB 4ZIWA 2PMZD 2HFOA 1NB2A 3LA0A 3QO9B 2MKHA 2HZAA 1B64A 4Y00A 2DH7A 4F50A 2UU9J 1ZPWX 1QE1A 2XCAA 2C42A 1RKIA 4C0OC 2BX6A 1SL2A 4H4MB 1VQNS 2X1FA 5DDOC 2UVVA 2OPSB 4IFYB 1Y11A 4O4GA 2HWHA 4KHMA 1VMBA 2WVDA 3ZC4A 1WC3A 1BUXA 4RU9A 3L3CA 4JV2A 2K8GA 4E8UA 1BWEA 2IIHA 3M8RA 5DM6Q 4DHVA 1DTQA 3LAKA 3PR5B 1MROB 2EK6A 2ZJQQ 3W62A 1U45A 4AXIA 4DV0J 3Q8YA 5A0YB 2PT0A 4F4WA 4UOGA 1DY3A 2O66A 5KFDA 3CC4S 3CJ3A 3H0PA 4CLTA 2HBYB 4OYZA 2ZZNA 2KM8B 4ELVA 2H65B 3TVYA 1LV5A 2HHXA 1S4FA 5HMZA 3OL8A 4CTAA 4ETXA 3PW7A 5IT4A 4WYLA 1J27A 3V4IB 3RB6A 4DMZA 1F1BB 1U1MA 3VV2B 5KG4A 4WCEQ 3E51A 4G1QB 1RHKB 2JDJA 2P6SA 4F7VA 1TL7B 2MEWA 4I2PA 3GFXA 4LFBJ 4CYUB 4PUOB 1HBUB 5DGAA 1T11A 2V4JA 3QJJA 2YH0A 3DRPB 2XZWA 2HVIA 1CVJA 4OV6A 2DGVA 3M1VA 2ZKTA 3EWGA 4NX9A 2XWXA 4DV3J 2CZ4A 3ENAA 4B9LA 3AB2B 1AZSB 2AYBA 3VGUA 3I32A 3OFGA 4HHHA 1SC6A 5E5NA 4IFYA 3W3SA 3DN9A 2BJEA 2Z57B 4DR7F 5AXNA 4TU8A 4RPFA 3HFKA 2VOOA 3MXHP 3HP6A 1NH7A 2GQ2A 1D3WA 1VJWA 1KVIA 1MROA 1RYRA 5HMXA 3HVRA 5A0YA 5AE2A 4OI0A 1KQFB 2YWEA 1YRUA 4TQRA 3TJAA 3P6YC 2CG8A 3H5XA 1UZDA 1UVIA 4A8KA 1XNRJ 5T14A 3ENWA 2AEFA 2LQJA 1P27B 3JYTB 1RBAA 4U96A 3LPYA 4KR0B 5ETLA 2B4OA 4PABA 3LP0A 1P9QC 3NMAA 3GSIA 2HQGA 1FA0A 1QUPA 2QX0A 3P3DA 2KT3A 3FUYA 1YBUA 1SJQA 3PFOA 1IBKJ 3F73A 4O0IA 1NH8A 5FLXY 5K14B 5RUBA 3V4IA 3O44A 3DRSA 1NK6A 1TUGB 1FESA 1FDBA 2CQDA 4DR2J 1SH3A 3AOAA 1X4EA 1IR1A 4QIFA 2MQ8A 3V81B 3E01B 1RQ0A 3R2DJ 1J5OB 5EGYA 2JWNA 3IMQJ 3SDEB 1NJIT 2RDJA 1KOHA 1SJRA 4X2BA 2DO4A 1GMVA 1UP1A 3OBIA 1J2VA 4F26A 3P5TL 3R7BB 4OJHA 3G96A 5HJYA 3M6VA 1N36F 4IRKA 4OYMA 4K4UA 4LF2A 4DUTA 5KFAA 3DRYA 4A8YA 1NKEA 1RWNB 3MURP 4YB1P 3BB5A 2Y9HA 2G0JA 3KK1B 1VK3A 1QSLA 2AYMA 1K0VA 1ZH5A 3DM2B 2M7SA 5IWAF 2K1RA 1CS4A 2Z8QA 3AJDA 3KUEA 3DHWC 5CYQA 3CJ4A 1HMVB 4HT5A 4FZVA 1U6ZA 2NXCA 1ULRA 1ZTTA 5IZHA 1LKZA 1IXKA 2RSQA 3RTVA 1FXRA 2M0GB 1UEVA 1YIJS 4DX7A 2CQPA 1Y5IB 3GFYA 1IKXA 4JI0J 2HS3A 1UW9A 3KNAA 2HVDA 2PMWA 2WHOA 2LDIA 5KT6A 3PTWA 2UU9F 2BM1A 2V4RA 4ED7A 2D41A 2RNEA 1TR0A 3OT9A 3RR7A 4RWWA 2CJYB 1NDPA 1J5OA 4P6QA 2Z4PA 3SDEA 3F41A 4ES3A 2Y3YA 3BSAA 3AODA 2ILZA 1ZZFA 2ZE2B 1FE0A 3ZTOA 3NBPA 3ZTSA 4UTGA 2FLNA 1N56A 4IOCQ 2B0GA 1NDLA 3QWPA 2G1DA 2IC3A 4DXLA 1YDLA 2GHPA 4KGVB 1M5VC 1Q8KA 1TV6A 2V8GA 2BYCA 4Y2AA 1BLUA 1YBTA 4FYWB 5HQMA 3J81U 4UZBA 4A8QA 4N7TA 2C3MA 3NGUA 3BO2A 1U1RA 4HDGA 2GMHA 3HVAA 2J7WA 3IXQA 5LSLA 4N77A 3DLGB 2AHOB 1HNIB 2GW8A 5FDLB 4O3SA 2HFSA 2NZCA 4KQZA 2Y8YA 3T5HA 2IVMA 2HIQA 1HMVA 3LUYA 1N5YB 3RW7A 3G8SA 5CD4A 2ZDOA 5JVHQ 2JVRA 3TUZC 2G4BA 2YH1A 3TANA 2QJ3A 4CH7A 3IWLA 2FLPA 3D1QA 2ZDPA 3CC7S 1EP4A 1EHWA 1IM6A 1TP7A 4LREA 2ZHAA 3HZEA 1NKBA 4Y2MA 1QAIA 1Y10A 5HVGA 1SJ4P 3UDEA 3K7RA 1NM2A 1SUQB 3JSYA 3HULA 2DVIA 1X60A 3BM7A 5J1EA 3OL9A 2AKWB 4UT4A 4LUBA 1H72C 2OPRB 1RACB 2UXBF 2CQGA 4F4XA 1SC1B 2UUTA 1BQXA 3VALA 2H4WB 2AT1B 2B4UA 4JYAJ 1Q5YA 2DR6A 2WSEC 4OFZA 4ZJQA 2QRRA 2E7XA 4OI6A 3U7JA 4OHVA 1RTDB 4XK8C 3BF4A 5HQLA 2R4FA 1CBKA 3K58A 1QDUB 3A3NB 3W64A 3NGKA 1RK8A 1U0HB 2XBPA 3CW2C 2R7VA 3M32B 2JL9A 2I5JB 3EGNA 4ED3A 3PZPA 4O3PA 2YWKA 1RXOB 3OTDA 1RHJB 1HPZA 4AQYJ 2AEJA 1HL6A 1N5YA 2BOPA 3MM8B 1RAIB 2VFVA 2MQQA 2G2YA 2E9TA 2H51B 1FXDA 2YNFA 3JSMA 1X5SA 2YQ3A 2FVCA 4KRWA 5KG7A 4UOHA 4XDCA 1S9FA 2XSJA 4FBUA 2HNDB 1F6TA 3TAMA 4CH0S 3KLIB 1SUQA 2ZHBA 1R6YA 3OQ2A 4NLDA 2HAIA 3WC0A 1Q1KA 1CJKA 3SV3A 3TARA 1FT8A 2KVQE 3SEOA 4ED2A 2CVEA 3HHEA 2EKYA 3M2UA 5IOLA 2RDIA 2P2CB 3QFWA 4HT7A 2WOMB 2JLGA 1XN9A 3NS7B 4N8OA 3GILA 6FD1A 2HQCA 2RHQB 4QW9A 4DFMA 4NLPA 4ZJLA 1PJ6A 3LQVA 3CUNA 1OY6A 4USVA 3C8YA 1ZYQA 2BE2B 4R8UB 1VBXA 4J9RA 4Y2CA 4C4WA 1RAFB 4QPTA 1OO0B 2P9CA 4ZP6A 5F41A 4KY3A 1YJWS 4RZRA 2OPPB 3Q24A 2V94A 1NDKA 4I56A 2RHSB 1P6TA 4KYZA 3T19A 1K47A 2XS2A 1WHWA 4ZVQB 2AQ4A 3QMQA 5KFLA 2U2FA 1LFPA 2VODA 3MM8A 3HX9A 4JI4F 1XTZA 4DV1J 4DR1F 2DIVA 3R5BA 4I7FA 2CVIA 4F2RA 2QA1A 3OLBA 4RW8B 1V6HA 4ED1A 1K0TA 4TY8B 2G13A 3IGVA 1UVNA 4X4VA 2M5YA 1FRJA 3H8YA 3A8KA 3CJ8A 4OX9F 2J9CA 3KLIA 1SXLA 1U7LA 1FXLA 1T3OA 4USHA 2XYHB 5IC4B 3KDOA 1LXNA 2DXEA 2JEFA 1SC4B 1PBAA 1SQEA 5SUHA 1VCTA 5F8IA 4B9NA 5ETOA 4EU0A 1T9UA 1RT1B 1QVGR 1IKVB 2IA6A 1DRZA 4QR2A 5CXTA 2FJXA 2FY1A 1EB0A 4DV7F 4X4NA 3QT5A 2YVSA 1FRHA 3CPWR 3MEEB 5E3QA 3POTA 1PJ5A 4AYBD 1U47A 1FF2A 5GAGU 4FYXB 3EMTA 1CC8A 4LR9A 2E5LJ 1DQ8A 2DD8S 5LJ5Y 2V8VA 5MAOA 4CZCA 4IYQA 4LF7J 1OPIA 3W8GA 3ILJA 3JQKA 2PFFB 1OJ4A 2PC6A 1WC1A 5GAEU 4LRAA 2FJWA 1TAQA 1YJUA 4OLOA 1M5KC 4CO3A 5HROA 4K59A 4NZ0A 1KLMA 4HVZA 1JX4A 3GJQB 1TVRB 3KHGA 1G1XA 3BGUA 4JI3F 4YUDA 1ICEB 3MCSA 1TL4A 3ISNC 2ZUAA 4JI2J 1KQKA 4DOZA 1WOOA 4RNMA 2E1PA 5KFBA 3TAPA 2FZKB 5BXIA 2H5EA 1CC7A 3AAWB 2EC0A 2GO9A 4Y2IA 4LF6F 5D3GA 4A8OA 4HR2A 3ZNUA 2KXHA 5KG3A 1UWBA 1U1QA 4CO5A 1GXTA 2D3OR 2AJQA 4ZOSA 2QFJA 2GC8A 3RJMB 1TZ0A 1K8AT 5L1KA 1PAUB 3V6DB 4JI5F 3WX8A 3T1YF 2HG4A 5LMNJ 1OS5A 1H3DA 4UOCA 4O3OA 2P6TA 3GCXP 1C0UA 1Q79A 4UF4A 1GNKA 2FYXA 1Z1ZA 1TL3B 1RZMA 2VKRA 1S9GA 1FVQA 2FIUA 4EBCA 3PX6A 2J0WA 2NYIA 2ZEJA 2O1PA 4FF3A 4Q2LA 5H9EK 4K4YA 4X4SA 2E1MC 3IM8A 3IN5A 1HI0P 1JLFA 4I64A 3IFEA 3P45B 1CULA 4B3OA 2EEYA 2D9OA 1UPMB 4BS2A 3BEGB 1SQGA 3DLKA 3LOUA 3AQOA 4U9RA 1FFGB 3N9UC 2DRAA 4WK1A 3HHLD 1LQ9A 3QSIA 4ECSA 1WACA 3FQKA 5KFCA 3I4HX 4ZVTB 3KG0A 1ZAVA 2CPFA 4L74A 1W25A 3CCZA 1IKWA 1VI7A 3ZXWA 4O3NA 1SI9A 3NXZA 3GJTB 2DEIA 1U2RA 5G4DA 3B8HA 4KHPJ 1MU2A 4WKYA 4ZLJA 2AJ1A 1CQMA 3R6LB 1LW0B 1RTHB 4KE5A 3AD7C 3WQPA 4YMEA 4YY3F 4ZN3A 2EG1A 1DURA 3DCAA 4K0KJ 3NLCA 2MKSA 1AUSL 4OHXA 1ZS6A 4CDIA 2AJ4A 3G6ES 3ZZZA 2KTQA 1AB8A 4MIAA 3VAGA 2APOA 4WFZA 3C19A 2KB2A 4V19X 5H9FK 2RUSA 4ZPBA 1D09B 4Y34A 4HTIA 4Q0BB 4LF1A 5I42B 3N79A 3QLHB 4NMXA 1R8AA 2UUBJ 2VG7A 2WONB 3FGVA 1F2GA 3QRPA 1GK8A 3OL7A 3Q89A 5LXRA 4DDFA 4DSFA 1LFWA 2GJ2A 5KFZA 2RJZA 4ER8A 3B54A 2LCWA 2WAQD 1Z4UA 3QPIA 4QWAA 3NNHA 3CF5Q 4DF8A 1T9TA 1RE1B 2MY7A 2IVFB 3PW4A 1BC6A 5IT9U 2CPJA 2VBYA 2OSRA 2X51A 2KFYA 4EBEA 3TQEA 5E41A 4QWBA 2NSBA 1LW0A 1RTHA 2RDDA 4Y65A 5ITHA 2OHDA 3OR2B 1NKCA 3MM9A 3JQJA 1RT3B 2QIFA 1U2FA 1EZZB 4M5DB 1RTIA 2XQCA 3R5AA 2GHWA 3GTYX 2Z2ZA 1UJ5A 1QAJA 3PX4A 3C15B 2IY5B 4JI2F 1RA7A 2C2NA 3R27A 1OY9A 2Y1LB 1X0FA 3QLHA 1B0VA 2RQ4A 3EZ5A 4KIAA 1RWPB 5THWA 5LSOA 4CIOA 1PC5A 2MSTA 2D9PA 4FKXA 2OSQA 2GQQA 2RMLA 5HATA 2ZM6J 2E5JA 3PXGa 3P8BB 3HPOA 3DU5A 3KHHA 2DHXA 2YNGB 1RT7A 1TL1B 2R7OA 3TVKA 3UE2A 4ECZA 1KKHA 1HQEA 1YG0A 1T02A 3SYZA 4X4PA 1QSSA 2OIHA 3W5XA 2KL8A 4FKYA 2RVJA 4L72B 1NJXA 1D9FA 3A3PB 3NGRA 5GAGI 2RE1A 4DSEA 1VK8A 4B3MJ 4ITSA 1WDTA 4ECQA 4ZPDA 1LK5A 2IRUA 3PV8A 5DGBA 1Q7YT 2UV8G 2IFXA 5ETVA 4P72A 1NDCA 4DFJA 2OAUA 3HSDA 5D4NA 1KP6A 2B9YA 1FO1A 1XJWB 5T41A 5F8NA 3GYNA 1O6XA 1FERA 2GNKA 4ZVOB 1RADB 1E6VB 3OR2A 4NLWA 2CQIA 3GR0A 4JP8A 3IR6B 1DTTB 4Q44A 1IBMJ 3W9IA 1A0OB 5GAEI 3QRRA 2R7TA 2A2CA 4UQGA 4OI4A 4YEAA 1S7IA 2N4DA 3C15A 4ED0A 4ERDA 2CJAA 1RJJA 3FNNA 1C0TA 4X62J 1SL0A 4RW9A 1YI2S 5HP1B 2QLBB 3U1NA 3SZ2A 2VFSA 4ZPAA 1EARA 4URGA 3EXYA 5GADI 3L7UA 3UNYA 5KT2A 1NZ8A 3DFEA 1X9WA 4GVBA 3CNQP 4PKDB 4ZS6A 3NCRA 2YNGA 2PA3A 4KH0B 4IOBA 1RT4B 5KT3A 2B7BB 4DN9A 5I4MA 4CLUA 5GMKa 3LO3A 2GMJA 3CTRA 3OFEA 1X4FA 3A8IA 5GMDA 4ZCIA 4LFCJ 4MK9A 1DZ5A 1FKAF 2R42A 2KFNA 3TRGA 1FEHA 4NCBA 4NXMJ 1S1TA 4XPCA 1CJVB 2QL5B 2MQNA 3QBCA 3I0RB 5HBMA 2GHVC 4P10A 2ADBA 1I5OB 2Q6BA 2HNYA 5AE1A 4IRCA 4Y2KA 2XI3A 2OKQA 2R7XA 2F8EX 2M70A 2GA7A 3BSNA 1F3FA 2ZKUA 3CDEA 1NJYA 1DTTA 3DYAB 2GVDB 3KK3B 1F5AA 1TKXA 1S1UA 3ET6B 4PQAA 4YB7A 2YQ0A 5KOWA 1MWQA 1NSQA 1YQHA 4MYTA 1WHYA 2CPIA 2IBOA 2N4CA 1YK9A 2XMKA 5E2QA 4J37A 2LU2A 5HP1A 3R8YA 3LTOA 2GGPB 1Q81T 4M94A 4ICLB 2YWFA 1VQKS 2BJ1A 1V3SA 4QWCA 3JTNA 2MDAA 1VR6A 4B3RF 2DNKA 2MGZB 1LOUA 1ITPA 1RT4A 3OTOJ 1NK5A 1UTAA 4P52A 1C1BA 5DG7A 2HFZA 1SH0A 2DRBA 3D4JA 4X66J 1RHQB 2FTRA 1KFDA 3N4WA 2AMCB 3DRXA 1REGX 1DQ9A 3I0RA 2KT5A 4K50A 4DQQA 3V6HA 4XIUA 2DXDA 4YS2A 2LQ9A 1XBWA 1VQSA 3SIPB 3W2VB 3HLUA 3MD3A 4PG4A 3IS9B 3IM9A 3HM9A 3JXOA 3NCQA 3BO4A 3ET6A 2BJ8A 2H4YB 5CYJA 3MUMP 2QZ8A 2BANA 1FKPB 1SBRA 3PYEA 4ED6A 2VPYB 1L5UA 3CWJA 1XMBA 4ZITA 3NG8A 1DAXA 1HKAA 3CCWA 5GMEA 5IS2A 4QOTA 1KBRA 3KK2B 3EPGA 5E3RA 2H5JB 4CCHA 2BA9A 4F04B 2R2SA 1R0AB 3TW0A 3WC2A 1S99A 1UJ4A 3PYFA 1BQNB 5DDQC 4OZ1A 5HJXA 4LIRA 2GGPA 4EWTA 4OYIA 2BR0A 1OWXA 1N33J 4ICLA 4DV6F 3D6FB 3DLHA 3T1AA 1L3UA 5KG5A 3NWGA 4KGKA 2MGZA 2HIYA 2OEKA 3EE3A 2DR9A 5KFNA 3TAQA 4RJVA 1NMEB 5HVFA 4C8MA 4KJIA 3ZZOA 2DYAA 3RUBL 3UD4P 2DR7A 5A8RB 4UZCA 5C2GA 3AXKA 4LVNP 2FJEB 3T9NA 2IJRA 1C2PA 2V2VA 1SJFA 1LWEA 3FFIB 2E7WA 3TZZA 2FLLA 3MHYA 3UNGC 4Z37A 2IM2A 2NS1B 1S0MA 1BQMA 4WP9A 2R8GA 5E7OB 4O4RA 4Q8EA 4ZVHA 4USJC 3OUYA 3R5GA 3M8QA 5E3AA 4K4VA 4KAIA 2D1CA 4CT8A 5L8RC 3IBWA 2NSCA 1KR4A 1WHVA 4A8SA 4PG6A 2O3DA 4WE1A 2C2DA 2HRTA 4OIXA 2KJWA 1NK8A 2F65A 4C11B 4AL7A 2MKIA 3G82B 3LP2A 3SCIE 5H9EJ 3RBZA 3MD1A 1MN9A 4QIGA 5HVHA 4USMA 2ZNZA 3CJ0A 1R0AA 1IBCB 1ROFA 2V6AA 2J7KA 4QBUA 4DQRA 1BQNA 1C4AA 1JLBB 3UCUP 2BJ7A 4LFCF 2G9OA 4E2FB 2FGCA 2EFOA 1JK9B 4CO1A 5JMNA 3RU0A 3FSIA 4U95A 1VBYA 2LXIA 1AT1B 4PCQA 1H6KX 4FPIA 1YX2A 3PG9A 2E7VA 2KM8C 2M8DB 2AIRB 1F9FA 2WB1D 5J2NA 1WF0A 1YLXA 1URRA 2CNNB 2YWWA 2VFTA 4M1KA 5A8WB 4DFPA 4HHJA 4DV5J 5CZVA 2GAGC 2B9XA 2W9CB 4F2SA 3ZO7A 1V5IB 1EJ7L 3ISND 4WJBA 3UR3C 3H90A 3BGRB 1TTHB 5CAAA 1JLEB 1NCLA 2AWZA 2B9WA 4RR5A 4P2FA 4F36A 4I68A 3N6LA 1X7VA 3NAHA 4O23A 3IAM9 5B0BA 3TEGA 1CEZA 3S8SA 1S6UA 5CCMA 2KFZA 2I9SA 3WX4A 2E5GA 1RGVA 2DNOA 1G2EA 3BQ1A 4NLSA 3OTOF 4FXWA 4OMFG 5KG1A 3DOLB 4MFBB 2QEXS 3IO1A 4XPEA 1JLBA 1VISA 4PWWA 5T7LA 4USUA 5F0UA 2ZOMA 2ATCB 1T9YA 5K9FA 1KNZA 2UUCJ 4NLGA 2V8PA 2K2PA 4ZP7A 3CT9A 4PRFA 1B7YB 1EX8A 2I38A 2LQ8A 4J9UE 2W2NP 3C46A 2KH9A 3G4SS 2OO4A 4I2QA 2C2KB 1RAOA 2FC8A 3FMBA 1B0TA 2V9KA 1W2BR 2HQIA 2W9CA 2HQFA 1RCXB 4RW6A 1YJ9S 2RQKA 3MI7X 3ZZYA 4LT6A 1Q95G 4F02A 4K4XA 5EUHA 4R0EA 2ROGA 1WG4A 2AGQA 1WHXA 1RHRB 1UVMA 4YR0A 2J0QD 1NHUA 1D1UA 2CG4A 2RT3A 4WK3A 1FNXH 4KPCA 3DMJA 1VRUB 3EVMA 3TX0A 1UVLA 1HNXJ 1T05A 2M88A 2XMVA 4G65A 2HHSA 4WTYA 4MFBA 1UFKA 3OR1B 2DNZA 1A9NB 2LXFA 4FXVA 2HZCA 5AJ3J 2B43A 2VDIA 4I67A 2HW3A 1GMUA 1RT2B 2M8HA 4DCJB 3M2VA 3CD6S 3I31A 1HD1A 1O51A 4N76A 3H20A 2YNHB 2YY3A 3M8YA 2X3GA 2YKQA 4F4YA 3GR1A 3TA1A 4KV8B 2IDEA 2VC0A 1VBZA 1IR0A 1JLQB 2W9BA 4ID8A 3ZZ0A 3RRGA 3PIOQ 2IVYA 2BJ3A 4B3SF 5LMUF 2KXFA 2XY6A 1D9DA 3UFCX 1T9VA 1S7HA 3O2IA 4P7TA 2OPQB 3EGZA 1FX4A 3C6UB 3QIDA 3H5SA 4DR5J 3M30B 3TVZA 3T6JA 5CHCB 2G2OA 4Q5VA 1PYSB 4R5PB 7FD1A 2YKMB 4I0WA 3FKBA 3LW5C 3Q8RB 1IKYB 5IM0A 1S9EA 1UEUA 3CD0A 4OZ5A 2M4MA 2VU5A 3HT3A 3LGMA 2J9DE 4J91A 4NA3A 2KJVA 3MM5A 3H40A 1N4LA 3RW6A 2C2RA 2VIHA 2VQEJ 2V8HA 3V4MA 2KZZA 1I94F 1GTHA 2MZTA 4DQSA 3O6QA 2A1BA 1HI8A 1WSRA 2LLZA 3A4TA 2OGUA 4ZVUB 2JEGA 3OR1A 1AFJA 1F5CA 3HSJA 2DNYA 4JI8F 4H4OB 1HWLA 4LF4J 4DUZF 3SFGA 3ZNJ1 3NL0A 4ETZA 1RT2A 3U02A 3EYZA 5C5JA 3C16B 3ILIA 1DJ0A 2KRBA 1EETB 3OSPA 4NA2A 2RF2B 2YNHA 3J7YU 2G2ZA 4B9UA 2C2ZB 2YKNB 3I6PA 1VBKA 5KFPA 1S6PB 2ZFHA 2DRDA 4KV8A 4CRJA 1KS2A 1WD6A 5KFSA 3NS5A 4EI2A 4EO8A 3KLEB 5KOXA 4MTPA 2YKPA 1X0PA 3S01A 3PJ9A 2OPQA 2PGCA 1XNQJ 2MQOA 2CUYA 3AD9C 4ZCMA 1VQMS 4W90B 3C2PA 1H74A 2J6SA 1RT6A 2W2MP 5KG0A 3BS9A 4WIIA 3HHLB 4R5PA 3LH2S 4RUHA 3UVJA 1IKYA 4IH6A 3L7PA 2FJVA 4JB8B 4IDKB 1PYTA 2KU7A 2L9DA 2J5AA 2AGPA 4IUFA 1YKWA 1SB6A 4TYBA 1FI4A 1FWLA 3VVUA 2FC9A 1H73A 2HWIA 1R8CA 5F8MA 3NNCA 4CLLA 3MTJA 3BH7B 1FDAA 5D4OA 1OPZA 3QGPA 2DY1A 1F9HA 3M8PB 3H25A 1NJZA 2WVCA 4LSNA 5HK4A 4J9VA 5D4LA 1M90T 2LQ5A 1JLGB 1BE4A 2DB1A 2H1YA 4I6YA 1S1VA 2HRYA 2MHEA 3T41A 4LF9J 1RHUB 3KLFA 1CJTB 1BY9A 5G0RB 1GX6A 3AJ2A 2WTFA 2N3LA 2C3OA 2XI2A 5D77A 5EWEA 2BEFA 1JLCA 3ZZUA 5DJBA 6AT1B 2GZOA 2JLEA 1Y5NB 5F9NA 3KJNB 2LMIA 1FJ7A 5L9NA 4BC9A 5B0CA 2CQBA 4FBTA 3QSYB 3KOAA 1S0OA 2KT2A 1HNXF 4M63A 5J2QB 2DHAA 3C3LA 3CJ5A 4HH1A 2NLWA 3M8SA 1UFWA 2NXEA 2KZMA 3W2WB 1WKKA 3UDVA 5IFMA 2A6OA 3AT1B 3MM7B 3FEXB 3DU6A 2O67A 4OZ2A 2DNQA 2K3IA 4UUWA 4ZLNA 2DGQA 3OPKA 3K5MA 1RT5A 1JJHA 4LFAJ 1X4GA 4OYOA 4DUYJ 3KYLA 5J2MA 1FNMA 3EDQB 4KO0A 1Y3JA 4V1Ak 2HHVA 3D6TB 1Z2ZA 2A0FB 3KLHB 2A6MA 2XTJP 4MMOA 3A8EA 3PKMA 3QATA 1XMQF 4K5RA 3H7HB 4WU2A 4ZHRA 2UXCF 1RTZA 4EK2A 1TUWA 5ETMA 4XTTA 3J81j 4DX8H 4JUZA 1P1TA 4Q43A 3TYTA 2I8EA 3GV7B 3PACA 1T7PA 3BGOP 1VQYA 1WI8A 3UPFA 4LF5F 3Q8QB 2M2BA 1X4DA 3LF0A 4RUCA 1RCOB 2MKYA 5J2QA 2BVZA 3KJVB 9ATCB 2RILA 4WBFA 5KFVA 4AD6A 4E0DA 2Q1LA 1HYSB 4C97A 1OSCA 2B51A 2OLWA 3J7ZT 5EHHA 1YRXA 2PI4A 1REVB 2BMBA 2VQFJ 2DNHA 2GQCA 1E6YB 4ZIVA 1GTEA 3DKDA 4DJBA 3I5AA 1XR7A 4WFXA 2R2TA 1F3VA 3MTKA 3EM1A 4NLRA 4M5JA 4OHYA 1ZZNA 1RABB 4U7UD 4QPXA 3D54A 3EZOA 1DFDA 4DV4F 3W5YA 1HWJA 3TI0A 1UAWA 5A8KA 4DEZA 2ZH3A 1TELA 4RLEA 2CJXB 2CNLB 4OZJA 1TKTB 2VBZA 2DCLA 2YX7A 2Z2LA 4CP5A 1Y3KA 4U8VA 1QY7A 4TU7A 4FP9A 2CAJA 4OV1A 3A13A 3GONA 2U1AA 4S0MA 5DQGA 4DL3A 4I1TA 2KRRA 4M8LA 4ZK7M 1U0SA 1WJ9A 2GO8A 5BJRA 4DPTA 4WFYA 2ZH6A 3AOBA 1QLNA 3UDCA 3T9ZA 3MAQA 1Q7LB 1HYSA 3VAKA 2QN6B 1HR0J 2VB6A 4DR4J 2CJBA 2YX1A 4MAKA 3THPA 1HARA 3MF5A 2VOPA 1D0EA 4YHHJ 3GV5B 3UD3P 1HHTP 4HI1A 3NGDA 3EVWA 1YVFA 2LVWA 2V67A 5HO4A 1P1LA 3IWXA 4P2MA 3J7YI 1U1PA 1Q16B 1KRPA 4RU2A 1Y00A 4A8FA 5IC6B 3FBFA 1XEZA 1FJGJ 3IG1A 4GO5X 2C2EA 3O1LA 2QA4S 3CIZA 5D0RA 1DLOB 4TU9A 2LA4A 1UL3A 1ZAWA 5JUMA 1TKTA 5EX0A 2MKCA 4OYBA 2IPOB 3L4BC 3D1OA 3SXLA 2VA3A 4YN3B 4DQIA 3MMAB 1S97A 4C98A 1D8ZA 1VQ4S
chains in the Genus database with same CATH topology
2ZM6F 3KLFB 1LW0B 2JLFA 1YTYA 1RTHB 5FJ4A 4FNHA 4KE5A 3PEJA 4YMEA 4YY3F 1N5QA 2HS0A 2LEPA 1AW0A 1S48A 2EG1A 1DURA 3DCAA 4NCGA 3GB0A 5ADZA 1YJTA 3NLCA 2MKSA 2IMOA 1U1OA 2POKA 1U4BA 2ZVSA 1NO8A 4OHXA 1TFYA 4LIWA 1AROP 2FVSA 2AJ4A 1JLCB 3G6ES 4YB6A 2XS7A 1YJVA 4ZPCA 2HMIA 1WNEA 3T6BA 4I6WA 3UI3A 3ZZZA 1K1SA 4KFBB 1GT8A 5F9LA 3UR0A 4M95A 2AV5A 4ECUA 2KTQA 4MIAA 5CH7B 3VAGA 1U25A 2VD3A 2APOA 4C3MA 4AL5A 4WFZA 1KVJA 1LWFB 2Z2MA 4UQTA 2WRMA 1B0PA 3AY0A 1Q53A 2KB2A 2A2DA 4X4OA 4V19X 2YWGA 4ZPBA 3X1LB 2CPXA 4RW4B 3M9MB 5L1LA 2IAJA 4Y34A 3MM6A 4HTIA 2AD9A 4B3MF 2B5JB 1WG5A 4Q0BB 3MEKA 4XDDA 1ZPVA 2W24A 5J2PB 5I42B 2R2RA 3N79A 2VH7A 4EYHB 2HHPA 3QLHB 2LEBA 3RB4A 1R8AA 1TFWA 3R3TA 4AFFA 2VG7A 2WONB 4WFNQ 3FGVA 2VA2A 2Z0GA 1HWIA 4TYAA 5A6WA 1L3VA 2J0SD 4IOAQ 4E98A 1F2GA 7FDRA 1U24A 3ICLA 3OTCA 4U6PA 1U09A 3KLGA 4I7FB 2C22A 3OL7A 4MYUA 1S10A 2O5DA 2HHQA 4RBVA 1KHWA 5B0FA 2ZOGA 2B6AB 1U48A 1PO6A 4DS5A 3DI6B 1FVSA 5LXRA 1Y9OA 3C66A 2RD5C 4QJVA 4JV1A 3BQ2A 2R7UA 2E29A 4MKAA 4DL6A 5DG9A 1RA6A 4DDFA 4I4BA 2FDNA 4DSFA 3TQ1A 1D8YA 5KG6A 1LFWA 2GJ2A 5KFZA 3TOQA 2Y1RI 2RJZA 1IBMF 5B0DA 2GIQA 4HYKA 4J9MA 1AXQA 2J76E 4NLQA 4K4WA 2LCWA 2WAQD 1Z4UA 1M5HA 5LL6d 3QPIA 1X5PA 4QWAA 2DNMA 3CGIA 3D5MA 3MMCA 3DLEA 4PPDA 3NNHA 1HNVA 1RT5B 3CF5Q 4PR6A 2FB0A 5HLFA 3QZ7A 1YJNS 4Q45A 2UVRA 2YX4A 4DF8A 4ECYA 1H2TZ 2NPFA 2FD2A 3GFZA 5K8OA 3MR3A 4X62F 1NEEA 2MY7A 2RRBA 4DLEA 3HK2A 2IVFB 2R8KA 3RR8A 5J2MB 1KN6A 3W2VA 3PW4A 1BC6A 3PEHA 2XLIA 1IQTA 3HI9A 4KO0B 1GXUA 2CPJA 3H98A 2VBYA 4NZ7A 2OSRA 3IS9A 3DGPA 2E9ZA 1VQLS 1NZAA 2X51A 2KFYA 3BZQA 4QR0A 1UA0A 3K8WA 1G7CB 3KFWX 3RBDA 2XLKA 5AE3A 5CYMB 4EBEA 4DL7A 2WSCC 3S1TA 3PFEA 2KHDA 3IRWP 5E41A 1F60B 2QMWA 4C7QA 1FKPA 1Y0HA 3CCRS 2F8HA 2L3MA 3VWSA 4B08A 5F3ZA 1T95A 3CE8A 1R7IA 5CCLA 2CQHA 2PE8A 4QWBA 1L3TA 2VONA 1WF1A 2NSBA 1LW0A 2ADCA 4ZHRB 1O8BA 1RTHA 1JLAB 2QE5A 2QLXA 4FS2A 2CPDA 3JSBA 2C28A 1NHVA 2OFGX 3KK2A 2MMYA 1VQ7S 4DF4A 3PO4A 4OX6A 4Y65A 3TUJC 5HN0A 3BREA 3Q0AA 5ITHA 3L09A 4WXWA 4MK8A 2IRYA 3D0GE 3KWMA 2FHJD 3OVSA 3OR2B 5DG8A 5F0WA 1NKCA 3MM9A 1RT3B 2QIFA 1U2FA 4Y28C 3POTB 5KFMA 3PO5A 1RYSA 2FPHX 1TK8A 1H2UX 2XMTA 2UUAF 1HNZF 4H54A 5HL7Q 4M5DB 1RTIA 4DN0A 3J80Y 2GJIA 4IO1A 3MGJA 2ERRA 2LYVA 3R5AA 1LWFA 2GHWA 2W8LA 2KYXA 1N5TA 4QYRA 4DR6F 2J6UA 1UJ5A 3FSXA 1HBOA 3QO9A 4RW4A 3PX4A 1QAJA 3CJKB 4JI2F 3RB3A 1KSPA 3CD7A 1N6QA 3OTBA 1RA7A 1N88A 2DGTA 4NXMF 3R27A 4GKKF 2VBXA 3THVA 3CMES 1Q4RA 4NMLA 2DHGA 1SIWB 3T5LA 1X0FA 3QLHA 1B0VA 2RQ4A 3EZ5A 1S49A 3G71S 5AXLA 4KIAA 5A8RA 4NLOA 2GMLA 1N0UA 4H4MA 4C8NA 1LW2B 5THWA 5LSOA 3N01A 4CIOA 1HBMB 1PC5A 5B08A 2DGXA 2MSTA 2XGPA 2DR8A 2OPSA 1F0XA 3VAMA 2D9PA 2CJ9A 4ZLPA 1Q8BA 2GQQA 2OSQA 2RMLA 1HQUB 3FFIA 3VQTA 3ZZTA 2E5JA 2W4CA 3PXGa 4MIBA 3HPOA 3KG1A 1JNZB 2V5HG 3DU5A 3D0HE 3KHHA 3VAHA 2DHXA 3HKWA 2LEAA 3AB4B 2YNGB 4U7CA 1WEZA 1IBLF 1RT7A 5HROB 1I6JA 4RKUC 2ZH4A 1TL1B 2R7OA 3TVKA 4EFAC 1KLMB 3NNAA 3UE2A 3C6TB 4QWEA 4ECZA 4D3HA 2A3JA 1HQEA 1YG0A 2MZQA 3GSDA 1FRXA 1L3KA 4TNOA 4GMKA 3E3XA 2P5VA 3IR5B 3WZ0A 4PQUB 1I1GA 4ID5A 3BN7A 1R31A 2XNQA 3B82A 1T02A 3CMAS 3SYZA 3BQ0A 4X4PA 1QSSA 2OIHA 1S0NA 1S79A 2DTJA 2XG8A 2RVJA 4L72B 2OMLA 1ZM2A 2CJKA 2IM3A 3AA8A 5A2QY 3RYLA 1NJXA 1D9FA 3MAHA 1L3SA 5GAGI 1YGYA 2RE1A 4PWUA 4DSEA 2RU9A 3FRZA 1VK8A 3KMQA 4F3QA 5CYMA 4ITSA 4CI0B 4FXDA 2ZD1B 1VS3A 4ZPDA 1LK5A 2IRUA 4C11A 4ECQA 3PV8A 3I82A 3PIPQ 5DGBA 1IM4A 4RNNA 5H9FJ 2BJDA 2UV8G 1Q7YT 4ZDNA 2XY7A 3K0JA 2IFXA 4J9OA 5DDPC 4ZCLA 2O01C 4DFJA 2AGOA 1F5BA 1TQLA 2OAUA 5D4NA 5A8KB 2IM1A 2F8MA 3I0SA 2JZ5A 1XMOF 2B9YA 4FVCA 3SV4A 4O3RA 3NS6A 1FO1A 3BR9A 2Y1IA 4A4JA 4GO7X 2OTJS 5T41A 5F8NA 3GYNA 3MECA 1HNWF 1FERA 2I0XA 4QIEA 2GNKA 4JV5F 5D3GB 2JH3A 2E1RA 4J9SA 4YHHF 2E1AA 1E6VB 1M1KT 1JKHB 1UMJA 2DH9A 3OR2A 4NLWA 3T5JA 2WCXA 2CQIA 4HH0A 3GR0A 3IR6B 1X4BA 2MQLA 5H1SV 3B4DA 1DTTB 1UWBB 3VF0B 4ZPWR 5KFFA 4Q44A 4ELUA 2HGLA 2MZSA 3CSKA 4OHZA 2WBRA 4G1QA 3G8QA 5GAEI 4X66F 2MKKA 4ED5A 2R7TA 2FJAB 1HWKA 1RTJA 2A2CA 4UQGA 3TA2A 3HHKA 4OI4A 5KFOA 1XR5A 4YEAA 2N4DA 3Q22A 4PUOA 3CJKA 2EBGA 4NRUA 1HBUA 4ED0A 1T8EA 4ECXA 3NMRA 4ERDA 2CJAA 1RJJA 3FNNA 4NLXA 2W7PA 1C0TA 4XAKA 1SL0A 3DRPA 1JWWA 3PVXA 2ZHOA 5HMYA 4RW9A 3G6YA 2ZOFA 4LQ3A 1YI2S 5HP1B 3Q23A 2B4VA 2RQMA 3AQPA 2ZH1A 2XSFA 3FCHA 3R1LA 3U1NA 2CPZA 3SZ2A 2VFSA 3PRBA 1FRKA 2BRLA 3U1MA 1LW2A 1PILA 5DLFA 3MFIA 4ZPAA 1HBMA 5KG2A 1FNOA 4URGA 3EXYA 1C0UB 5GADI 4QR1A 1X9SA 3FMWA 2P9EA 3PJXA 5A8WA 3MPYA 2ZZMA 1YHQS 5KT2A 1XERA 2MXYA 4C0BA 1HQUA 4X4UA 4X64F 1CG2A 4U7UK 3DFEA 3H5YA 4G1IA 1X9WA 5KFUA 5EX3A 1S9GB 3PKYA 4PKDB 4DFKA 4ZS6A 1T03A 4NYZA 3I9V9 3K5OA 2KKHA 3T1HF 3NCRA 2YNGA 2PA3A 3FZ2A 2IJFA 4IOBA 4DV2F 4AUKA 1RT4B 5KT3A 2B7BB 4KHRA 4DN9A 1FCAA 5I4MA 5LT5A 3C6TA 4NZ6A 4V19J 4PXEA 4BBYA 5GMKa 3LO3A 1VGYA 4X4QA 1U1NA 1S1WA 3OJUA 2ABYA 1FE4A 2GMJA 3BGRA 3B78A 1WTBA 2J9EA 3CTRA 2PEHA 1X4FA 3OFEA 1N32F 1FHTA 1JLFB 5C24B 1VIOA 1JLEA 3KHRA 2VBWA 5KFXA 3PRDA 2UVWA 4ZCIA 4MK9A 2NPIA 1DZ5A 1FKAF 4B3OB 4X65F 2KFNA 5DS7A 1B7FA 3HZGA 3CULA 4ZA1A 4PPZA 3TNVA 3TRGA 2MQPA 2DBBA 3UCZP 5GADU 3JYTA 1FEHA 2I2YA 4NCBA 3SSRA 1S1TA 2KYZA 5I3PA 4XPCA 2KHCA 2KG0A 3DLKB 4JI7F 3IR7B 2MQNA 2XMWA 3I0RB 4KKOA 5HBMA 2GHVC 2ZD1A 2R7WA 3OXFA 4Q7AA 3IG1B 4ECTA 3T5KA 2ADBA 1N33F 5KT4A 2IRXA 3M9OB 2CQCA 3CDAA 5EWGA 2ASDA 2Q6BA 3MFHA 2HNYA 5AE1A 4NA1A 3BO3A 4IRCA 1QSYA 4Y2KA 2XI3A 4AE5A 3UWTA 3SFUA 2OKQA 2R7XA 5K14A 4RUAA 2M70A 2F8EX 2GA7A 4A8XA 1ELOA 3K5LA 1G6BA 3OV7A 5KFTA 4OI2A 1UKUA 4NYPA 3NP5A 4JBCA 3BSNA 3CDEA 2ZKUA 3DOLA 2DGOA 1LK7A 1IKWB 2N3OA 2J8AA 4LSLB 2BACA 3K2YA 1NJYA 5I3UB 5GAHI 1K73T 1DTTA 4GC6A 3DYAB 4FN5A 3KK3B 1FKOA 1F5AA 1TKXA 1S1UA 1WTFA 3V81A 2OJ3A 1MU2B 3E01A 5B0AA 4NRTA 3U27A 4PQAA 4YB7A 5JXSA 1TL5A 2UZAA 4J9QA 3JB9k 2RQCA 5KOWA 3BN4A 1YQHA 4PG8A 1QTMA 3VAFA 2BZ2A 4MYTA 4YR3A 1WHYA 1YBAA 2CPIA 2IBOA 2E9RX 2N4CA 2OD6A 2QA2A 2XMKA 2ILYA 3MPWA 1H0HB 4LJMA 3JAMY 1XC9A 5E2QA 4NCGB 4J37A 2LU2A 2RRNA 4NYOA 2QT7A 2ZNYA 5HP1A 4UY8T 4ZVFA 4DL0C 1AFIA 4DG1B 1KEKA 5D8HB 5DDRC 1APSA 4ES2A 3SCLE 1X8DA 2B3TB 2K3KA 4DV0F 3CJ2A 4USIA 2KI2A 1NK7A 5I3QA 1DHMA 2GGPB 1Q81T 4M94A 1NK4A 2Q66A 2DNNA 2DHSA 4ICLB 2A10A 2YWFA 4FS1A 1VQKS 5GAHU 2EFPA 1U1KA 2RKIA 2CZVC 1V3SA 1S6OA 3JTNA 4QWCA 4BWJA 2MDAA 4B3RF 2BBEA 4WFBQ 1FJCA 2DNKA 2MGZB 1LOUA 4RNOA 3NKYA 2N7CA 1XR6A 3OXGA 2IAJB 3MM6B 1RT4A 1VC6A 3QYYA 4WZMA 2HGMA 5KFHA 1NK5A 4A46A 4IO9Q 1FDNA 3KK1A 4EZ9A 2CKWA 3US5A 1C1BA 5BR8F 3UCGA 3I96A 4OLPA 2ZH8A 3HDSA 5KT7A 5DG7A 3UW1A 2VG7B 3CVKA 2HFZA 2OP5A 3DM2A 3G86A 2DNGA 3DOMA 1SH0A 2CQ0A 2DRBA 2ZH9A 3MZIA 3RAXA 2VG5A 1KOOA 2VG6A 2YTCA 1ZM3A 4J9KA 2FTRA 3PJWA 1KFDA 2BRKA 3N4WA 3QAUA 4IG0A 3CCJS 2OMOA 1RAJA 1VIXA 3DRXA 2M52A 3TX8A 2BQUA 4JI6F 4LMZA 2NQPA 2KXNB 1Y7PA 2D74B 2DPIA 4L3NA 3CC2S 1DQ9A 3I0RA 3AA9A 4ECVA 2KT5A 4OZNA 1DTQB 2CQ2A 3OHBA 4K50A 1X9MA 4DQQA 5J1PA 2VV5A 2B7CB 5M2PA 3V6HA 2DPJA 1RWUA 3L7OA 4XIUA 3MMCB 3VZIA 4CO0A 4OI1A 1J5EF 2LQ9A 1HNVB 1VRUA 2BUNA 4LFBF 4MIWA 5HLFB 1XBWA 3GWCA 3Q2SC 5B09A 2YKAA 1SKWA 4WXOA 1VQSA 3QGHA 1U26A 5KFGA 3VTIA 1WELA