2K1RB

The solution nmr structure of the complex between mnk1 and hah1 mediated by cu(i)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the copper(I)-mediated complex between the first soluble domain of the Menkes protein and the metallochaperone HAH1.
rcsb
source organism Homo sapiens
molecule tags Hydrolase/chaperone
molecule keywords Copper-transporting ATPase 1
total genus 18
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k1rB00
2BJEA 2OD4A 3BB5A 3BM7A 2IYIA 2OKQA 3BR8A 2AJ1A 3FGVA 4NPOA 5B0CA 2FB0A 1FESA 4OJGA 1Y3KA 2OFGX 2LQ9A 2QYCA 3BN7A 1Y3JA 2QLWA 3HF5A 4ZOSA 4HI2A 4OIXA 1XBWA 1URRA 2XMVA 1U7LA 1YJRA 2K1RA 3CJKB 3IWLA 1OQ6A 1AW0A 2HLTA 4OJHA 1YRXA 1FVQA 3TRGA 2HLUA 1YJUA 2Q3PA 3F44A 3HFKA 5T7LA 1JWWA 3LO3A 2N4DA 2ROGA 3HHLB 3MZIA 5B0AA 4A47A 5K9FA 2ASYA 2KT3A 2K2PA 3KG1A 4A46A 2ZDOA 2PGCA 3E8OA 4HH0A 1Q8LA 4Q2MA 1R6YA 4Y2MA 2N4CA 2RMLA 1TUVA 2VV5A 1QUPA 3HX9A 1FVSA 2HFOA 4ZA1A 1OPZA 2GCFA 2N7YA 2AW0A 3QMQA 3I9ZA 5F0WA 2GGPB 2GO8A 1YG0A 4U9RA 5B0BA 1Y9OA 2XMKA 1TZ0A 3UDCA 2W4PA 3MCSA 1SB6A 4NL5A 4A48A 1Q8BA 5F0UA 4QOTA 2OFHX 3T9NA 4OJ3A 3TOQA 2RU9A 2OD6A 2BJDA 2OMOA 3QGPA 1MWYA 4HI1A 2IYGA 3LGNA 5T7LB 2KT2A 3BGUA 1SQEA 3HHLD 4DN9A 3TNVA 3LGMA 2EW9A 1TR0A 2XMUA 3K7RA 2XMMA 3FRYA 1FEEA 1X8DA 2BBEA 2XMJA 3DXSX 1Q4RA 2HFNA 2KYZA 2IFXA 1K0VA 1RJJA 1SI9A 2CRLA 2VH7A 1TL5A 1N5SA 1N5VA 1V3ZA 2RILA 1MWZA 2GA7A 4A4JA 1X7VA 3KG0A 1OQ3A 2FHMA 2PD1A 1X0PA 2ZDPA 5B08A 4FNHA 1TL4A 2K1RB 2QIFA 3KNGA 1FD8A 1Q53A 1WD6A 3WDOA 2W4CA 3FMBA 5A6WA 4DPOA 4EFAC 2GV1A 3BF4A 5B0EA 2LDIA 5IXUA 5B09A 1N5TA 2ROPA 1AFJA 1N5QA 5B0GA 1JK9B 2HIQA 2AP6A 3HHLC 1KQKA 3BDEA 4FNIA 1VQSA 3IWXA 2BUNA 2ACYA 2AJ0A 4HH1A 1YJTA 2K7JA 2BYCA 4DL0C 1P6TA 1AFIA 1KVIA 2LXFA 3KKFA 1CPZA 2KKHA 1S6OA 1CC8A 4YEAA 3VTIA 2GGPA 1KVJA 2ROEA 3DCAA 1Y0HA 2HQIA 2RSQA 2K7KA 1YJVA 4Y2KA 2G9OA 5B0DA 2OAUA 2W4DA 1CC7A 4Q2LA 2GFFA 1W2IA 1APSA 3CJKA 1LQ9A 1FE0A 1P8GA 1OSDA 1FE4A 2FIUA 5B0FA 2L3MA 1VQYA 5A6PA 1S6UA 2XMTA 4HL9A 4YDXA 2JDJA 3HHLA 4OJ1A 1IUJA 1GXTA 2LQBA 2QLXA 2XMWA 5KAKA 4F67A 2OP5A 4Y2IA 3HDSA 1ULRA 1GXUA 2FTRA 3GZ7A
chains in the Genus database with same CATH superfamily
2DNRA 2F3JA 4MJKA 2FD2A 3BSNA 3M32B 4CM2A 4DV3J 2BQ3A 4KSEB 2KB2A 4L3NA 3K5MA 5KFFA 1TKTA 2FB0A 4M5GA 4QYZJ 1HR0J 4MH8A 3ENQA 3HF5A 4H4MB 3G4SS 1KFSA 4G65A 2HVHA 1S7HA 4LVOP 2LFVA 2K1RA 4M5KA 3QYYA 1UVNA 3FDSA 3FMWA 3S6EA 1UMJA 3CDEA 2B7CB 3ZO7A 2E7VA 1RT2B 2QMXA 3LALA 3MHYA 5IC6B 4YR3A 4RLEA 1FRKA 1VBXA 3G9CA 1JWWA 5J1EB 3R6GB 1Y00A 2FYXA 2O67A 3W5YA 1JIHA 5I42B 4ECQA 3HT3A 4XDDA 4DQSA 1U4BA 1YHQS 3IR7B 2Z57B 1NSPA 3PYFA 1IR1A 3A1YG 4NRUA 1RAGB 2ZUGA 3TAMA 2HWHA 3QT6A 5MLCV 3UD3P 5KG3A 3W9JA 2GCFA 2OIHA 3W3SA 5F0WA 3I9ZA 2X3GA 2OI2A 1JLBA 1S1XB 1GMVA 1PJ5A 1SIWB 2D41A 1KQSR 3G6YA 2DHAA 4H4OB 4FF3A 1B7FA 3MCOA 2VBXA 4NYOA 2DXFA 5E3CA 5H1SV 2ALYB 3TX8A 3DLGA 2X1BA 2V94A 3CULA 4ID5B 2ZE2A 2IVMA 1N33F 2DNPA 1UFWA 2L9DA 1NSAA 3TUIC 3DLHA 3ZZUA 1GX5A 1C0TB 2P2CB 4TXSA 1HBMA 4X66J 2GIRA 5T7LB 3LGNA 3OT9A 1J5OB 4CT9A 4Q45A 4RNHA 4DR4J 1RLCL 1BXNA 2LEPA 4ZDNA 4USJC 1BWEA 1FO1A 3OTOJ 1SI9A 3BPSP 2M70A 2B7BB 2NZCA 3IO1A 3O1LA 2RILA 2GAHC 1M5KC 4FZVA 4O44B 4DV1J 2GVDB 1NJIT 4LIRA 5A0YB 3DYAB 1FD8A 5RUBA 3MD3A 3GIKA 2XHCA 4FVCA 2EKYA 4H4OA 5IXUA 2UP1A 2ASJA 1M5OC 2WW8A 3BJYA 3FSYA 5GADI 2H48B 3CJ8A 4OHWA 2HIQA 2MZRA 4QCLA 3BBCA 4FNIA 1FDDA 4M5DA 5KG2A 4JYAJ 3D6MB 3IR5B 3RBZA 4DWIA 1OSCA 2QLBB 4CYUA 3LTOA 2BYCA 1X4HA 1NUEA 1KVIA 2HIYA 3H7HB 2B43A 3KK3A 2DNLA 4JI4F 5I3QA 1CC8A 3CCLS 1JLFB 1JLAA 3ET6B 2MZSA 1NHUA 4CT8A 2XS7A 2QA1A 2YKMA 4Y2KA 1V5IB 1DURA 5M2UA 1RADB 5AXKA 4NZ7A 2UVUA 3ZTQA 2IRYA 1RUSA 3MEEA 4F8RA 1VLYA 1ZM3A 3M9OB 1KR4A 3LWLA 1D0EA 3B6BA 4HKQA 2C2KB 1AZSB 4CO5A 2MQOA 3GB0A 1LWEA 2DKOB 2AJ4A 2CVIA 1N0UA 3G2XA 3M2UB 2WTFA 3QGGA 1SKWA 5JJBA 4JI0J 1RT3B 2WBMA 5A2QY 2DO0A 3QPIA 4MYUA 4WYLA 3J7Z5 2CPFA 1T03B 3CSKA 1Q1KA 2PC6A 2ZUAA 3DM2B 2AJ1A 3HVAA 4NPOA 3M8RA 3U02A 5T14A 2J9DE 4NLVA 4ZVGA 2O1PA 4WE1A 2IA6A 2LQ5A 2XO6A 1WC0A 3O3LA 4L74A 4LVNP 3R7SB 2BQRA 3POTB 3K5OA 1UWBB 1T3NA 4D3GA 3SIPB 2DNMA 1NMEB 1O0PA 4HDHA 4KAIA 4XAKA 3ZTPA 5D8HB 2LQJA 4NLOA 3CJKB 1D9FA 2CNNB 1PAUB 2GZOA 3DNCA 5KFWA 2AGPA 1KSPA 1CBKA 3AQOA 5H9FJ 4RNNA 4JV5J 1IKVB 1H98A 1FWPA 5LMNJ 4RW7B 1TK0A 3LF0A 1VOMA 4ZP9A 1HMVA 5KFMA 3V5RA 5HVHA 3BBBA 3SCKE 5CZXA 2NXUA 2MY7A 1SH3A 2MHNA 1VC5A 1BY9A 3CUNA 3BEGB 2VOOA 3V81B 2QLFB 4LF7J 2ZH1A 5BYRA 4DR2F 1JXVA 4NZ6A 3V4MA 1REVB 1SJ1A 4OI0A 1YG0A 3CD5A 4ZJLA 4E98A 4YOEA 2H65B 3EM1A 2XLKA 1UPPA 4F36A 2QE5A 3KLIB 2W4PA 4ZVRB 4ICLA 3OFHA 1SB6A 1FKOA 1NH7A 1S59A 2BRKA 3DDIA 4KPCA 5D0EA 3T5LA 3KLFB 2OJ3A 2XGPA 2W7AA 1H2TZ 4UQGA 4W90B 2XZTB 4OX6A 3PVXA 2UV8G 5ETSA 4DL5A 4NLWA 5GMEA 4HI1A 2XSFA 3OSPA 1RT6B 3DMJB 4QQBA 4DV2J 4DL2A 1AT1B 2FZCB 1WHXA 3O2IA 3AH6A 3D9BA 3VWSA 1FEEA 1HKAA 2JOQA 4ANEA 4WFXA 4USMA 4YHHJ 2P8IA 2KYZA 1RJJA 2XC9A 3PYDA 2DGSA 2DEIA 2QFJA 2V34A 4IOAQ 4DR7J 2YNFB 3VHQA 1MWZA 3AXKA 1HYSB 3MR6A 1X7VA 1BQNA 3TYTA 1HNXF 1RGVA 2AQ4A 1LEOA 3AJ1A 2VDHA 4OLPA 4CLLA 3KNGA 3OSNA 2KZZA 2I6WA 1E6VB 3E51A 3NOCA 4DPOA 4LJMA 5KFEA 2MLXA 4Y28C 1EQ0A 1RHKB 2WW4A 3LANA 1SH2A 4QWCA 4EBEA 1G4CA 4DQRA 2Y3YA 2C2NA 3IC1A 3QZ8A 4DV5F 2FHKA 4C9DA 1NKEA 4PXCA 2AJQA 2KZMA 4B3TJ 5K5MA 2EBGA 2LECA 3FFIB 4U95A 3HO1A 3HSZA 1ZTWA 2DNKA 1LFPA 2D1CA 1DTQA 4FXWA 4IG0B 4RR5A 5HMYA 4XPCA 2XS2A 1R3NA 5D4NA 1HW8A 1HBMB 2ZZTA 4X62F 4KTQA 1M1GA 7FD1A 2ZHBA 3QGHA 3QSYB 4NI2A 2ABYA 1CJUB 3QAUA 2B9EA 1N36J 4YEAA 2GGPA 2F1FA 2OPRA 1BD6A 1X5PA 1ZS6A 4I6WA 1Y0HA 2BX6A 4IH5A 3AB4B 2AEMA 3NCRA 3HPOA 4LF4J 4U96A 4C8MA 3PX0A 1HHQA 1WELA 5IC4B 3RGIA 3I0SB 3M1VA 5C24B 3RRHA 4JI7J 2CJQA 2KRBA 3I55S 3ENVA 4IOBA 5KFZA 3V4IB 4DSJA 3EGNA 5J2NB 2NLWA 4C6AA 5A8WA 4LF6F 3H0PA 3O5TB 3KHRA 4F67A 3PRBA 4CDIA 2WRMA 3LP1B 4TNOA 1O8BA 3MMCB 3ETMA 4PXDA 1U2FA 4E0DA 1GXUA 3EXYA 4QU7A 3BM7A 1F5CA 2ZVSA 3R5BA 4CLUA 2ZH7A 4F4WA 4WPAA 2CPDA 1S1TA 1UWBA 1RWUA 2R8GA 4OZNA 4M5NA 3PR4A 3Q8QB 3UD4P 2BXJA 5FD1A 1F1BB 4C0HA 4DV2F 2I9SA 2PI4A 5DO2A 3L9ZA 3NWRA 3BH6B 3NGRA 5KFXA 1U1NA 3OXLA 1SC4B 3PKYA 4XDCA 3LQVA 1AYEA 3IWLA 4J9QA 9ATCB 3L4BC 1FNXH 1G2EA 1X4AA 5HP1A 3NKYA 3CCJS 2ADCA 1CJKB 2RQ4A 3WZ0A 3HULA 1FFSB 1EHWA 3EJMA 4I64A 4DR4F 2M5YA 3AOCA 2XTJP 5KG0A 5DQIA 1NJYA 4JI3F 4OZJA 3CCSS 3ISND 1KWMA 1JJHA 2KU7A 2ZDOA 3O6QA 3OR2B 3PW7A 1FK9A 4LF5F 3MFHA 2RUSA 1E6YB 1Q0NA 1WG5A 4Y2MA 3RW7A 3UPFA 2ZZNA 3HX9A 3QWUA 3MMBA 2HFOA 1YBUA 2F9DA 2WVEA 1Z4UA 1EETA 2N7YA 4HDGA 5HL7Q 1IWAA 2JEFA 1IR0A 1VLOA 1JLFA 3ET6A 2FJXA 2B3TB 2XHWA 4PYDA 1WUUA 3IGNA 4AYBD 3QRRA 2QRRA 3I4HX 5L1IA 1G3OA 3MWBA 1FHTA 3TZXA 1UJ5A 3BSCA 3LP1A 3SQOP 1D3WA 4IRKA 1ZAVA 2Z2LA 4LMZA 2MSSA 4DX7A 2A0FB 4LF4F 4LRCA 3M6WA 3BV8A 4Y34A 3KMQA 1TL7B 1UVMA 3H90A 2G1HA 1FRHA 1WKKA 3I0SA 3M1VB 3VZIA 1RE1B 1HBNA 5D15A 1XR5A 2PA8D 3K58A 2ZOGA 1X8DA 1D8ZA 4GO5X 5DG7A 3A8IA 5H9EK 2C28A 1U1OA 2UUBF 1IKXA 2GJIA 3CCTA 5IFMA 1RQ0A 4JOUA 4YR2A 4F4AA 4ECSA 5DETA 1VC0A 2V4JB 1UL3A 3K5LA 4NYZA 1TK8A 5C2CA 2QX0A 2E9RX 2CWXA 2HHPA 3ZXWA 5EDWA 1OWXA 3N5FA 2GJFA 2W4CA 2YNIA 3GSIA 3GG0A 3MMCA 3DGVA 1T02A 4HHHA 1I94J 1HQUA 3UNYA 3KWMA 3NBPA 4DV1F 1U1MA 1PYSB 4R0JA 2I38A 3W9HA 4TYBA 2N3LA 1FWKA 2HWIA 5L1LA 2V69A 3ILOA 2EG1A 1WOSA 4PZVA 5ETKA 1OS5A 4ILMA 3P8BB 2K3KA 3JB9k 5DGAA 2QN6B 4DSLA 2VB6A 2VG6B 2DHSA 1BQMA 1NDPA 3MFIA 3AOBA 3HCXA 4GKJF 3ZZPA 3DI6B 4DSFA 2P6SA 3NGKA 1CLFA 1NNDA 4BC9A 4DR1J 4I67A 4GKKJ 4X84A 4WFAQ 1F2HA 1YJVA 2BOAA 4OYAA 3T19A 1H74A 2IA0A 3CCES 1HHSA 1VS3A 1X0FA 1FTCA 2YNGB 3PM9A 4L76A 4OZ0A 1DTQB 3DOLA 4Y2AA 2W1BA 2JLGA 1Q86T 3M6UA 2CADA 3BS9A 4EBCA 3THVA 3FC9A 3NP5A 4JYAF 4KV8B 3GYNA 4HHJA 4YB5A 1RT5B 5IM0A 1M1HA 4EK2A 2X1AA 5F9NA 3V6DA 5I42A 1YVFA 3MMAA 4U7CA 3TEHB 4KO0B 4DR2J 5A8KA 1RYSA 3K5NA 1S5ZA 2X1GA 1N5SA 4F4ZA 4GKKF 1TP7A 2GHPA 5CD4H 1EAYC 4DX5A 2HS3A 1UTAA 2M3DA 1UZDA 1XQIA 2CQ3A 4PWUA 1U0HA 5G4DA 1FRIA 2A6OA 1A7GE 2VG7A 3DU5A 2OFGX 4LFAF 1WKJA 3A12A 1UFKA 2YNFA 3C66A 2HKEA 1D9AA 3BN7A 3NS7B 1BQMB 2MJUA 3D54A 4KC5A 4ZVUB 4CNYA 3EPGA 4ZLLA 4HI2A 4E8UA 4K4ZA 4DV6F 4OV1A 4AUKA 3Q8SB 1YJRA 5IT0A 3K2YA 2YXLA 5DZ7A 2HLTA 4N5SA 4RJVA 4WCEQ 2ASLA 1RT6A 2GMLA 1Z1ZA 4PUOB 1AROP 1DQAA 4PYAA 2AWZA 2HRTA 4OFZA 4OZLA 4RUAA 5AE3A 4BS2A 4CCHA 5A2QU 1DBDA 2V2QA 2BJ3A 1T8EA 2AIRB 1R6VA 1RWWB 2A2CA 2K2PA 1BLUA 4ZPWR 3TJ8A 4LREA 2IC3A 4BWMA 4J9NA 5KT6A 2KI2A 1R31A 3GLJA 4UZBA 1R6YA 1WF2A 2B4PA 2V2VA 3DGPB 4KFBA 4NZ0A 4DUYJ 3OL7A 2IRXA 2J8SA 4FYVB 1VGYA 2I5JB 3NGTA 1T05B 2CDQA 2ZH3A 2MDAA 2CIMA 3KLGB 3HT0A 2F8HA 4ED1A 1REVA 5EHHA 3R1HA 1DRZA 2R7TA 4K4YA 4DHVA 2CJKA 4ECZA 5ETQA 3IXQA 4DR5F 2NPIA 1LWFB 3UDEA 4AXIA 2CQCA 1MU2A 3M2VB 1VDHA 4QPTA 2XLJA 2W8KA 1S97A 4NL5A 4ZP6A 1X4FA 2R8KA 3CO9A 4O3NA 3P6YC 2ZBQA 4MK8A 3VZHA 2QG9B 5H9FK 4HR2A 3GCWP 2HGNA 1KS2A 3MDFA 1MWYA 4IOCQ 4P2MA 4ED6A 4QIWD 2PN6A 3ZTRA 2I2YA 5DZ6A 4UF4A 4X4TA 2EW9A 4USIA 2SXLA 3FEZA 2EK1A 2G0JA 1FDNA 2IVYA 2VPXB 2DCUB 2RHSB 4L6V3 4S0MA 2DRDA 1Q4RA 1OPIA 2UZAA 4JI3J 2IFXA 4U7UD 2H5JB 2Z30B 5F8HA 4HYKA 4JI7F 1WHVA 2VKRA 5AXMA 4CH7A 2HHHJ 4LF5J 4R0EA 2R7UA 1XR7A 3T5JA 3QZ7A 1NDKA 2VFVA 1XMQF 3DM2A 4WFZA 2E5JA 3HHKA 4X4QA 2UXCJ 1ZPWX 1P27B 4LFAJ 1RCXB 2R3VA 4KE5A 3CCVS 2LDYA 2LDIA 2X51A 2YQ3A 3EICA 2WZ1A 5DM6Q 2R9LA 5KFPA 1FRXA 4OHYA 4K7QA 4B9SA 2RT3A 2MZ1A 2E1AA 5BXIA 2DR8A 4YB7A 4XTTA 1XK8A 2W2NP 1VK3A 4PXBA 3KLEB 3AJDA 1I1GA 4F02A 5I4MA 1HI8A 2BUNA 1IVZA 2R2RA 1YTYA 2OSRA 1JMTA 2OO4A 1RHRB 4ECUA 1ZAXA 1TK5A 2YKAA 4M5LA 2QV6A 3D66A 3OQ2A 4KPYA 2Y1JA 2H4WB 4N77A 2APOA 4H54A 4MT1A 4DPTA 3QAEA 1S1TB 2LEBA 1VBKA 4RNMA 1U1KA 2E5HA 4WU2A 4URSA 1N34J 2DR7A 3OFGA 4WJBA 1RWVB 3D3CJ 4MIBA 4R25A 2VF3A 3T5KA 1VFJA 3R5DA 5LMUJ 2AYGA 2CG8A 3ONQA 4LQ3A 4NLGA 4O23A 3W63A 2CG4A 1N4LA 1FFGB 2GX8A 3U27A 4OI4A 2YKQA 2IM2A 4YHHF 4HL9A 3OLAA 1JLQA 2OLWA 4OJ1A 4AFFA 5CXTA 2QLXA 2LEAA 3C19A 3CD0A 5KAKA 3GV5B 3RBEA 4LF8J 5E5NA 1S6PB 2VKZG 4USWA 1F9FA 3ISZA 1OIAA 4MAKA 2DPJA 3TVKA 3HVWA 1S9GA 1RT1B 1WJ9A 3C15A 4M63A 4NCBA 2H9ZA 1S1XA 4KKOA 3SCIE 3M05A 2CPEA 4OJGA 3UN3A 3TANA 1HNVB 1WORA 4OYOA 4ZVPB 1NJZA 2Q1LA 4KR0B 3UD5A 2R7WA 4W4MA 1TUGB 3PV8A 4BC7A 2QL5B 4DR3F 3C16A 4ED0A 3E3XA 4CWBA 2VQFJ 4O0NA 1SJ3P 3EDRB 5L39A 2RQKA 4OJHA 2VJUA 1WC4A 3D67A 4AXJA 5T7LA 2N4DA 3P4UB 2Z0GA 3HZEA 4FXVA 3NAHA 2RVJA 3B78A 4IFVA 1NSKL 1U09A 2I5JA 4MK7A 3TZYA 3O8WA 2FLPA 2DGXA 4O3SA 1WF0A 4ZK7M 4DG1B 4P10A 4C0BA 2Y8WA 4ZN3A 3CDBA 4H4MA 4DEZA 1HL6A 1ICEB 4CTAB 5HLFB 2UXDF 1K1SA 1WEZA 4HLBA 1JJ2R 2DNGA 1ZOTA 2OEKA 3GG1A 4ZP8A 2R7VA 1MN7A 2CUYA 4EEYA 1A9NB 1XTZA 2WVBA 3Q8UA 4OYBA 2WVDA 4YN3B 3G8TA 1VQ5S 5L46A 3SFUA 4PWDB 1UVLA 3B4DA 3UCGA 3PR5B 4KGZB 2V50A 5IT4A 4IO1A 2XYHB 1REGX 3T9NA 3TOQA 1SQGA 3VR1A 3M8PA 3QGPA 2OMOA 3G82A 4HT5A 4PG4A 2M0GB 4PG6A 4M95A 2RB7A 3V6KA 5HLFA 4F4KA 1KP6A 4IUFA 2H5EA 4FN5A 4DMZA 5C5JA 4JI8J 4RW8B 3DRSB 4DN0A 1U0HB 2KT2A 3CVKA 4NA1A 5IWAF 2ZM6J 2YKOA 3LGMA 4KJIA 2EC0A 2FVSA 4JI5J 1UW4A 3EUNA 3BYRA 3SFGA 2VONA 5EGYA 1RWXB 3GJRB 4JP8A 4DV0J 2GAGC 4N41A 4PWWA 4CH1A 1WDDA 2YKPA 3CJSA 2C2ZB 3KHLA 2QA4G 3QGIA 2A10A 4OYPA 4DPUA 1YI2S 1KNZA 5IS2A 1SJFA 2HFSA 4O3OA 1X5TA 4C3LA 3JSMA 4FPRA 2MKKA 4IRCA 1T11A 1NB2A 1P9YA 3AA8A 4DV4F 4L73A 4PKDB 4Q0BA 2YNGA 3ZZ0A 1N36F 5JVGQ 4EFAC 4Y6IA 2IAJA 2AMCB 2YKNB 2JLEA 5GAEI 5GAGU 1RAAB 1BUXA 2GIQA 1WHYA 3W2WB 1IJFB 1VHIA 2LA6A 1KQKA 3VAGA 1TL1A 2C1EB 1RISA 1VQSA 2FY8A 2HBRB 2RF2A 2E7WA 3PG9A 3PDNA 4I2PA 1WI8A 1DLOB 1HWKA 1IKWB 3I5BA 1S6PA 3UDVA 4DQPA 2DH9A 3FQLA 5CQGA 2OEJA 4M8LA 3C8YA 2B9YA 4CLZA 3EMTA 1P6TA 2N3OA 2ZKTA 1SL1A 3FZBA 3MAQA 4N7TA 2DVIA 3C6UA 1Y10A 4AL7A 2DGQA 2PFDA 3U1NA 1GTHA 2QGFB 3UQSA 5H9EJ 4JI1F 2CQ1A 4I0WA 5FLXU 4DV7J 3EDQB 2ZBCA 3T1HF 4OX8A 4QWBA 2DNQA 3IS9A 2V2ZA 3MEGA 3Q8YA 5KFVA 4X65F 2J0WA 4XK8C 5CH7B 1W2IA 4DZDA 1XMBA 1YJ7A 4K8RA 4ZCMA 5LJ3Y 2KL8A 2UUWA 4I56A 1RCOB 3M2UA 4HEA9 5B0FA 3W60A 4O0IA 2G4BA 1V6HA 2V4JA 3D6TB 1N5YB 5I3PA 1Y5NB 2NXNA 2VG5B 1Z2ZA 3WC0A 2ZH9A 2E9TA 1FJ7A 1WC3A 4KY3A 2FHJD 3GFHA 2KFYA 3BGFA 3LP2A 1R0AB 4KKOB 4MKVA 2ZFHA 1RT1A 2LXIA 4MIWA 3CC4S 2XM3A 4YY3F 1KONA 1U0SA 3FGVA 2E1PA 3VQTA 2XB2D 3JTNA 4ER8A 5L9NA 1S77D 1OYEA 2R7QA 2AGQA 2G2ZA 4LT6A 3GV7B 1R8HA 3W64A 3SV4A 3R2CJ 3KYLA 1NZAA 2XULA 4DV3F 2HNYA 3N28A 3T1YF 1SC1B 4NLTA 1LK7A 3C14B 3FK4A 3HVTB 4G1QA 1L3SA 1AW0A 3J80Y 2YPZA 3BZQA 1Y11A 3HSJA 4FYYB 3WBZA 1CJVA 2KHCA 4ES1A 4AD6A 2ROGA 4CO1A 4P73A 3W1YC 4NLSA 2FJDB 4F04B 5EUHA 3W65A 4JV0A 3BREA 4MFBA 2C2DA 4KGMA 1WC5A 4LRAA 4USTA 5ETOA 1CULA 2PT0A 4ZVOB 1RWOB 3ZZYA 4ZN1A 4HACB 1H0HB 3CCZA 1VISA 4O44A 4Y65A 1QUPA 2CNOB 4X4SA 3GIJA 3CD6S 1UJ4A 3GYXB 3NMRA 2AW0A 2DK2A 1Y7PA 4KGXB 3EVOA 4RUCA 1UVKA 2W9AA 5LOQA 1K73T 5J2PB 4MKBA 3RTVA 4X4VA 4KHPF 4U7UK 2A18A 1LXNA 1AUSL 4KYZA 2V8HA 3BR9A 1WF1A 1SJRA 2YNHB 1HNZJ 4NXNJ 1C0TA 1KD1T 5LXYA 3RAXA 4XIUA 2FPHX 4NCGB 1L3TA 1UEKA 2EC2A 4U67Q 1U8SA 2ZE2B 2DHXA 2MQLA 4ZKAA 3HP6A 4EU0A 4M5JA 3ZFVA 2CA9A 1GK8A 2DH8A 1Z2LA 2E44A 2H1YA 2KVIA 3LP0B 1S79A 2MKJA 2V9KA 3MR2A 2CPZA 2J9DA 4DR5J 1X9WA 1HW9A 2HAIA 2Q79A 4ZITA 4JV5F 1R0BG 2QFIA 3MM5A 1SV5A 1W2BR 4NLUA 2PMWA 5AE1A 2H4YB 2WAQD 2D3ZA 5KFRA 1LW0A 2YWWA 4Q5VA 2EXUA 2VQEJ 4Q0BB 4X4NA 3H42A 2EFVA 4ED8A 1R43A 1Q53A 4L3KA 4JI4J 1HQEA 2DYAA 3WDOA 4DF4A 1IBLF 1X5OA 2COLA 2ZWOA 4ECYA 3A13A 3T9ZA 1FKPB 2WOMA 3DLKB 1C0UA 2GW8A 2C2OB 3HLUA 4B9VA 1NHKL 3UE2A 1RA6A 1KRPA 1IM6A 4LIWA 2FHOB 1HA1A 1AXQA 3K59A 1T0TV 4KBIA 4OMFG 4QW8A 3D2WA 4B9UA 3FVYA 3DGPA 1HBUB 4DR6J 5GVQA 1JLGA 1H3DA 2ALZA 1AFIA 1NDCA 5HK4A 2DJWA 2RKIA 2AT1B 2JRSA 1MSWD 1NK6A 3RB0A 4LFBJ 1N0VC 1S10A 4QWAA 2FJVA 2CXEA 4X64J 4ECWA 5F8IA 3HVRA 4EO8A 2C2EA 1N32J 3IR6B 4CZCA 1YK9A 1PJ6A 2YX1A 3FBEA 2J0XA 3MF5A 3AAWB 4NLYA 4PWDA 2Y0SD 1UFLA 2CPIA 3I5CA 2EG2A 3RU0A 4ANCA 1UEVA 2DGWA 3R6LB 4TU7A 2C2RA 4G3IA 3CD7A 3RAQA 3PXGa 4ANDA 4MFBB 3J80U 1UA0A 4JI5F 4AT1B 1TKZA 3CXCR 3Q24A 2AYMA 3KHHA 1GXTA 1WHWA 2O01C 1HQ2A 4OX9J 4CLPA 4Y2IA 2HZCA 4LBPA 1R0CB 1VCTA 2KH9A 3PX4A 3CDAA 1DQ9A 3UVJA 5CCMA 3KXDA 2OKQA 3CCMS 2AZ1A 2KO1A 2PEHA 3BR8A 3DRPA 2BZ2A 3NMAA 1SKRA 5KG7A 5L1KA 1H6KX 2YQ1A 1GH8A 1NPPA 1U6ZA 3PO4A 2IDLA 3QJLA 5ADZA 3C6TB 2Z8QA 2C2MB 3DLEA 3W7BA 2QMWA 5KT3A 4TU9A 1NK0A 1U7LA 2XI2A 4ICLB 2LA4A 2MLZA 1U2RA 3OR1A 4OL8A 2YTCA 3Q86A 3TRGA 3F44A 4CM0A 2UUCF 5G0RA 3VGSA 5D6GA 4B3OA 3MZIA 1T9YA 3DI6A 3GIRA 5KFJA 3M9MB 1NK5A 2AEJA 4OZ3A 1O6XA 5HN0A 5KFCA 5FLXY 4K50A 1FF2A 2RQCA 1F3FA 4URQU 1WOPA 2B8PA 2FZKB 2DNYA 2JJ4D 2JNJA 3D28A 2XYPB 4PG7A 3MR5A 3TQEA 1QUVA 2JWNA 5F3TA 3OLBA 2QSFA 3CT9A 3T1AA 1NK8A 1B0PA 1SIZA 4F3MA 4I6YA 5DDRC 3DRRB 3TWZA 3ILLA 3QO9A 5K20B 3NBPB 1T7PA 3GP9A 4FKXA 3M2RB 3RAMA 3VAIA 3RYLA 3R5JB 3MPYA 3CJ5A 3MCSA 3F73A 4P71A 5KFGA 4B02A 1BMQB 3HK2A 2QL7B 2E29A 4IDKA 1SPBP 2BMBA 4PAAA 3IRXA 1EETB 2LKZA 1A0OB 5L9XA 4ZCKA 1S1WA 3JAMY 2HYIB 1VYAA 2YY3A 4DUZF 5K8NA 4EMDA 4AL5A 1Q78A 1FK9B 3M9NB 4K2XA 4C8KA 3GQCA 2FLLA 3MM9A 4GVBB 5DJBA 1N8RT 2MPUA 1YITS 1PGZA 1S57A 1SJQA 4B3SF 4DUTA 3T1YJ 4OX9F 4CI0B 3BKFA 3OTDA 4Z7YA 1EKRA 2VH7A 1QAYA 2HQGA 4CLKA 3AOAA 1YJWS 4NCAA 2B8QA 3CTRA 3BGRB 5LL6d 5HP1B 2XBPA 1NB7A 1HBUA 5B08A 1MW7A 3QLHB 2BQUA 4OYWA 3QRPA 4PCQA 2V6AA 3QRQA 4IG3A 4K4SA 1J5EF 1FJGJ 4DS5A 3ZC4A 3FSIA 1TFWA 3OL9A 1SKUB 1C4CA 3HHLC 4F25A 2HGLA 5CZVA 3W9IA 1QD1A 1X31C 3D0GE 3H8YA 3IWXA 1BWVA 1E6YA 1TUWA 1SUQA 2KXFA 2XZWA 4N8NA 4CRJA 1VJQA 2YQ0A 4M5DB 1EARA 2AX1A 2VPYB 3TUPA 1CS4A 3QT7A 4M5MA 1VQPS 5KOWA 1PSDA 3HHEA 1KOOA 2H51B 1VQMS 3CO0P 5LSRA 1X4DA 4CLFA 4LBHA 4WP3A 4CLWA 3T6JA 5B0DA 2AJFE 4OHVA 1FTRA 2HS0A 2LYVA 2QJ3A 1S0NA 1UETA 1LQ9A 2BKOA 1FE4A 1NLKL 2GVDA 3M7VA 4KGKA 4O4GB 2VU5A 2RUGA 1VQYA 2MQMA 3NOGA 4PQUB 2XMTA 3IBFB 5F8GA 1OY8A 2QYGA 3AJ2A 4I7FA 4P2SA 1X5SA 2CDRB 2PO4A 3UO0A 4P2FA 2PEBA 3HSDA 3L95X 5A8RB 5J1NA 2VZ9A 1HARA 2MKSA 3R27A 4IG0A 2F5GA 4ZJQA 1W25A 2E9ZA 5B0AA 4H4KC 1GT8A 1NJXA 4ELUA 2XY7A 3TAPA 2OPPA 2YX4A 1SC6A 2DR5A 2CNLB 3HMJG 1PIEA 3MPWA 4X65J 4K0KJ 4PPZA 4R8UB 3H5XA 1CSJA 1WOOA 2W2PP 3MM5B 2WBRA 5E2QA 1JXLA 4KHRA 3V4IA 1I94F 3ZTOA 3GCXP 1RTDA 4HACA 2UV8A 4LF2A 3TZWA 1S0OA 2MKCA 1TMMA 3QATA 4QR1A 5DG8A 1RBOB 2HQ3A 3MOJB 2Z58B 1PC5A 1YRXA 1BQNB 2XMAA 3RUBL 3NEKA 4RZRA 1YJUA 3HFKA 2QA2A 2LXUA 4MMOA 3A8EA 1N48A 2JC0A 3TA2A 2F9JA 3KJNB 2HZVA 1N54B 3N5BA 3PEJA 3OL6A 4DF8A 2Z2MA 2KT3A 1VHFA 4OYIA 1KLMB 1RKIA 3JAMU 2NZ4A 1GMUA 1BQXA 2HHVA 4KT0C 2HNYB 5HQ8A 4IFYA 1QDUB 3B82A 3ILJA 3DXBA 8ATCB 5JUMA 5F8JA 2KTQA 4P74A 3FZ2A 4CO4A 3OHBA 4JI0F 3OVAA 4ZPBA 4UW2A 1U45A 3R5CA 1ITPA 1FFWB 3G71S 1RYRA 5IT9U 3J7YU 3HFZB 4I68A 1TZ0A 5I3UB 2LVWA 4GVBA 4LR9A 4A8MP 4NOHA 2V4RA 3UDCA 3KOAA 4R5PB 3LP2B 1UW9A 1EKSA 3CW2C 2DGVA 5MAOA 1C1CB 2BVZA 5AE2A 1VI7A 7AT1B 5IWAJ 1EX8A 4QU6A 4K4XA 3D4JA 3TI0A 3W5ZA 4CIOA 3P45B 2XNQA 1HYSA 4IDKB 4GC6A 3RBDA 1CJVB 1HLWA 1RT4B 2IYGA 3MM6B 3US5A 3G96A 1PBUA 2AEFA 5KFLA 1NAQA 3Q0AA 3K7RA 5E7OB 4P72A 3M8SA 3ITHA 3GMGA 4TLQA 4C3MA 1V9OA 4LF6J 3DMJA 3F56A 1PYTA 1Q8KA 1FNMA 2CRLA 3QO9B 4J37A 2NYHA 3C6UB 3EZUA 3CF5Q 3X3UA 2ZNZA 4ZMMA 4RW7A 4KB7A 3JQJA 3OL8A 3PX6A 1OQ3A 3DRYA 3ISNC 2YNIB 4QPXA 4WIIA 3GIIA 3SI8A 1WEYA 2PA3A 3L7UA 4LSZB 5FIIA 2ZKUA 3W5XA 4YDDB 4LF7F 5HQLA 1S1VB 2ZJRQ 1YQHA 5GAHU 2GV1A 5B0EA 5KFQA 3H5UA 2JL9A 2W2QP 3H4DA 2EFOA 3MCMA 4NASA 2KT5A 5G0RB 4BWJA 1J27A 5B0GA 1IKXB 1VQ8S 2GNKA 2YKNA 4NYPA 3OW2R 1Q5YA 4XO0A 3FCVA 3QSIA 4PEOA 4QJVA 2H3EB 3V6JA 2A3JA 3RJMB 5BYQA 5KT2A 3DLEB 2J6SA 4J9LA 2NYIA 1TL7A 1V3RA 1YBAA 2A1BA 2JLFA 2NXCA 2Y1RI 3UN5A 2BV3A 3R3TA 2GVZA 4YFUA 2ROEA 3I56S 3MM8B 4GC7A 1FXRA 1IKYB 1JQGA 4O4RA 3FNNA 1IKVA 3THTA 3ZZRA 4EI2A 4WFBQ 5E0OA 3VAHA 1DJ0A 2GFFA 1APSA 3CJKA 3DOMA 1FE0A 1SH0A 1U02A 1OSDA 2MLYA 2RD5C 3BGLA 1VRQC 3CMES 2D9OA 3MI7X 4JI6F 1ACMB 1S6UA 5AXNA 1KVKA 4DSKA 2AYEA 3C2PA 4CO2A 2F7VA 2BA9A 2ZZMA 3H5SA 1RABB 2PMHA 2ASDA 3HDSA 2KJWA 1LV5A 5HROB 3QWPA 1GXLA 1RTIB 4JI6J 2B9WA 2RQMA 5C25B 4URGA 5J2MA 4B3TF 2HHQA 1X4GA 1GQEA 5B0CA 5KFKA 1WWHA 1QY7A 1TAUA 1FRLA 2HNDA 3RRGA 4ZOSA 2VG7B 1OY9A 3NWGA 3D1QA 1GEHA 4J9SA 1URRA 1EIYB 5A0YA 2CPJA 2DY9A 2WONB 1UWAA 4FPIA 4QWDA 2VHGA 1VQ9S 4DFPA 4LBIA 4WK1A 4A8SA 3GTYX 4RW8A 4ECRA 4CO3A 3G8SA 3LO3A 2CZ4A 1RP5A 2RHQB 4RW6B 1M5HA 2VBZA 3JQKA 1XNQF 2OPQB 3KG1A 2MYFA 1HQEB 3KG4A 4USVA 5IQ6A 2O66A 3P5BP 3C16B 2JH3A 4J90A 2DGOA 2N4CA 2VV5A 1TUVA 4I69A 5ETNA 4C7QA 2YBVA 3MEDB 2FY1A 3KTQA 1FXLA 3MR7A 2RS8A 3BKTA 3GJSB 4UOHA 2IRUA 1S0MA 1LXJA 3WC2A 3W8PA 3TA1A 3C15B 4C48A 2R7XA 1FDBA 3EXCX 1HPZB 2ACMA 2F63A 2V8PA 4ES2A 1Q81T 3NNHA 2DXEA 2G2OA 1FJEB 3LWMA 4RL1A 4NLXA 2B4VA 3DYAA 2V8GA 3ELHA 1XMOJ 1RBAA 4HTIA 4NX9A 1YBTA 4N56A 1NKBA 1XNRJ 4C8NA 2XI3A 1CEZA 1IBMF 1RAJA 3K5PA 4FKYA 2RDIA 3J7YI 3TUJC 1N88A 2U2FA 2L41A 2DGUA 3IFEA 2YWFA 3PACA 3HHLD 1SQEA 3TARA 4JI2J 2YNHA 1SVDA 5DDPC 1UVJA 3SCJE 2XGQA 3JSRA 1B64A 2FHJA 4KH0B 1J5OA 2HHUA 4QYZK 1FWLA 1WACA 4C8YA 4K2JA 2KM8B 4B9MA 1SL0A 4U8VA 1HNWJ 1PG5B 3LAKA 4AE5A 1NKCA 2POKA 7FDRA 1E6VA 2ZC3A 4O4GA 4FYDA 1MMNA 4ID5A 1TL4A 1V3SA 2K1RB 4BCAA 3DLGB 3AODA 2LMIA 2RDDA 3FMBA 2CPYA 2RH3A 3BF4A 3I5AA 1HPZA 2LP4A 1TV6A 4X4OA 3BQ1A 4F4YA 4DPYA 3KK1A 3GV8B 3D0IE 3QFHA 1U6BA 3JS9A 1JLQB 4OZ1A 4F0MA 3K17A 2GHVC 1HIYA 2VL1A 2DRAA 2M4MA 3ZTSA 2VIHA 4C4WA 4G1QB 2ZHOA 3UDLA 2VBYA 5D77A 1T9WA 2HWTA 3OBIA 1WG1A 5CYQB 4ZVSB 1JJCB 2W01A 3A8KA 3I31A 2L9NA 1JLEB 2DHGA 3TR5A 3LUYA 4V19J 2O5DA 4RBUA 3MPUB 3FEYB 2LXFA 1Q8IA 2OPQA 4OLOA 3H4BA 1U49A 4A8FA 4ZPTR 4PRFA 3PRDA 1AUDA 3H2VE 3DOMB 1RACB 3EGWB 2AYBA 3T3FA 2DNOA 3KLIA 4B17A 2E7XA 3J81j 2OHDA 2F4VJ 3FCHA 4P2XA 4ZHRB 3OUYB 3OR2A 3DOKA 2FC8A 3Q83A 1R8BA 1SCJB 3RB6A 1YRTA 3X1LB 2FJEB 4J91A 4JB8B 3KK2B 1S4FA 1TMJA 3JTPA 5K8MA 1NBEB 3KUGA 3CJ2A 5HJXA 1VQ4S 3M8WA 5J2MB 1ULRA 3VAKA 1G6BA 2NUHA 3TQ1A 3IS9B 1SQFA 3MEGB 3MM9B 2BJEA 4QR2A 4ZPVR 1RTIA 2JEGA 1QVFR 2CNKB 4LR8A 2HVIA 4DU8A 2B4UA 1F5BA 2OSQA 3F41A 3BN4A 3GFZA 4K4WA 1C1BB 3M4XA 3RZAA 4CNZA 1LKZA 2QYCA 1LWXA 2CQIA 3VV2B 1S6QB 2GMJA 3SSQA 4IH7A 4F4XA 1OMSA 1FRJA 2V2KA 3CJ3A 4C98A 1IXKA 1KQFB 3W8GA 4C2MA 2DR6A 1KFDA 2MJNA 3U1MA 4D3HA 4LF8F 1TL1B 4FBUA 2M9KA 1IKYA 1GNKA 1X4EA 2MTLA 2ZOFA 4DPWA 2MQPA 1S0VA 2EPIA 1SKSA 5DG9A 3DRRA 4OZ5A 4RW4A 1EZZB 1C1BA 5J2NA 2ZJQQ 1IM4A 5K14A 4F26A 1CJTA 2QT7A 3OTOF 1FA0A 2B6AB 1U1LA 1EB0A 2UU9F 5CYJA 2PGCA 2ILYA 3B8HA 4Q2MA 1MN9A 4I1TA 4YMEA 5F8MA 4JI1J 4UY85 2HHXA 1D09B 3M2VA 3MM6A 3CC2S 1TFYA 3I9V9 3NS6A 3JSMB 3NNAA 2MQQA 3U7JA 3MAHA 4OYXA 3D3BJ 3IM8A 4K5SA 3P49B 2GGPB 2OPRB 2BABA 1QAXA 5KFDA 2L08A 4Q8FA 2VD3A 4DDFA 2D69A 5B0BA 2QEXS 4LR7A 1VQ6S 5DLFA 3E01A 4I2QB 4Z7CA 2YWEA 4RW9A 4ZVEA 2CQ2A 4F7VA 3GR0A 3HD2A 4P7TA 5FDLA 2JFDA 1OO0B 1YSJA 2CAJA 3EVMA 1KTVA 1J2VA 4KO0A 3LPEA 3I82A 3NAIA 1JLAB 1RTHB 2VFRA 3ZNJ1 4F3OA 2ZH2A 2GIFA 1EP4A 2JHEA 2DHHA 4F0HA 4Z37A 5KT5A 2IBOA 2ILZA 3EGZA 1JLEA 1N52B 1FI4A 2XNRA 2DXDA 3WQPA 4KRWA 1TR0A 1K47A 1FJCA 1GAOA 2XMMA 5C2GA 2BBEA 2XMJA 3QT5A 3V2UC 3PW5A 2ZH4A 1TL5A 1Q7YT 1DTTB 4C11B 2BKPA 2ZM6F 2KYXA 1H7WA 2FHMA 1NK9A 2IPOB 3BGOP 3KLHB 1QSLA 1FRMA 1HWUA 4ALZA 3GONA 1T3OA 2QTWA 3FKBA 4PG5A 4WXWA 1F3VA 3OV7A 4LSNB 3PW4A 2CZ9A 5BR8F 3LPYA 3AD7C 2EFQA 2M2BA 3IP0A 3LGHA 3KJQB 1RHQB 1N5TA 2DIVA 2D74B 1EQMA 1N5QA 1U6FA 3TW0A 3IBWA 4DCOB 2AP6A 3VCDA 2Z56B 2C3OA 1IBMJ 1RTHA 4Z2XA 1XMOF 1JNRB 1JLGB 5KFAA 3DDKA 4Y0FA 4DSIA 4LF9F 3R5AA 2B5JB 5E33A 2HVEA 4HH1A 2ZEJA 4LRBA 4TQSA 4JV1A 4RW9B 4E2FB 4NEYA 4J9KA 1VQ7S 1U1RA 4UOCA 2WSEC 2HAFA 5DRKA 2F4VF 2XS5A 2M52A 3VTIA 3QNWB 5D4PA 3CCRS 5LSLA 1ZTTA 2KXHA 1KVJA 1YGYA 1RDRA 1ZZFA 3UI3A 4NMLA 1VIXA 3GSDA 1QAJA 4WKRA 2YVSA 3PNIA 4J9RA 1XNQJ 4ZPAA 1VIOA 2HHHF 3W2VB 1RWPB 1G1XA 2EFGA 2J5AA 3CJTA 4J5OA 4A8XA 4LF9J 2BE9B 3MD1A 2CJXB 3HJFA 2NXEA 3JXOA 1VK8A 3H2UB 4F0KA 3MECB 3MEDA 3PFOA 4ZCLA 2BJ1A 2OP5A 3A3PB 2MZJA 2Y1LB 4N47A 4X4RA 1MROA 5J2QA 5DGBA 3PYEA 2FTRA 5F3ZA 3BB5A 3NXZA 5AXLA 4DSEA 4L75A 3AD9C 3VAFA 4FVMA 3Q8PB 3SV3A 1RAEB 4QWEA 2DISA 1BGXT 2CWKA 2ZITA 1F9EB 2RS2A 1YX2A 2HSEB 1FD2A 2CKWA 3R1LA 3NGUA 2G2YA 4WE1B 1RT2A 1K44A 1H2UX 1NJWA 5LSOA 2BJ8A 1RBLA 2HNZB 3JQMA 3OD2A 2YH0A 3PEHA 3QIPB 1OQ6A 4YS2A 3NCPA 3K57A 5HANA 5HMWA 3PIOQ 4MK9A 2HLUA 2ATLA 3DHXA 3OFFA 2EKNA 4RNFA 2VFTA 4KHMA 3CCQS 2BR0A 1CJKA 4B3MJ 3F0NA 2KFNA 2C3PA 5L8RC 2NSBA 2ZBPA 1Q7LB 5C25A 5BR8J 2CJ9A 2HW3A 2BKNA 3QIPA 4NRTA 1HNIA 1TKXB 4H4KA 2E5LF 1BC6A 4DL3A 1CG2A 4QBUA 2WB1D 3A3OB 3KDOA 1CULB 1RSCA 3CB4A 3GFXA 4ZA1A 5DLGA 2IBKA 4FP9A 1S9EA 1BE4A 1KEKA 2L9WA 5KT4A 1PAEX 1UA1A 1RHJB 5HI7A 3S8SA 1PC4A 4G6VB 4P75A 4Y00A 3H20A 3HHDA 1RI7A 1M90T 1EJ7L 3HKWA 4ZIWA 4IR1A 2DT9A 2MGZA 2UUAJ 4O3PA 4FBTA 2V5HG 4DV7F 3T1HJ 4W98A 1QLNA 3R97A 3UWTA 5CA5A 4DQIA 4B3RF 4ZS6A 1RWKB 2HBZB 2V68A 3AFGA 4QZVB 3TJ9A 5HJYA 3ZZZA 4JBCA 4ZLJA 1WSRA 3KK1B 3VAMA 1ZZNA 1XIQA 2FZGB 1MU2B 1TU0B 3PO5A 2MSTA 1X9MA 3H40A 2CQDA 3EVWA 3S7RA 2JX2A 1FERA 1TL3B 3TX0A 2XLIA 2MQNA 2PSZA 5HO4A 2DNHA 2KHDA 4B9LA 5JXSA 2G0CA 3TA0A 2DB1A 4WK3A 4M5IA 3KG0A 2BE2A 4ETZA 5C42B 1UP1A 2N82B 1I51B 4ED5A 3KFWX 4YR0A 1WD6A 4PR6A 2EFPA 1KQGB 1U47A 2HG4A 4DI6A 3HXMA 2UU9J 4ED2A 4DR1F 5AT1B 1HWLA 5B09A 1UZHA 1H73A 1N32F 4B08A 4OI6A 1XC9A 2XSJB 3JSYA 5E3AA 4DCPB 4ED3A 3DRPB 4X62J 4A8QA 4FDFA 2CJAA 1U8WA 3M8QA 1RK8A 2OMLA 5D78A 4K59A 5C24A 1Q79A 2XQCA 2AJ0A 2AGOA 1RT4A 2M8HA 3UR3C 4I2PB 3M6XA 2DD8S 1TKZB 2KKHA 2ZOMA 1DTTA 1C4AA 4C11A 1S6OA 3W2WA 2VQFF 3SYZA 2HQCA 4C0OC 3GR1A 1JX4A 2P6TA 2NR0A 4FXDA 1C1CA 1D9DA 1B99A 2JVRA 3CJRA 3KUEA 1M0SA 1KKHA 2W4DA 2OTLS 1RTZA 2FLOA 2LQ8A 3QFWA 1VQLS 3Q89A 4UY8T 3MMAB 4IYQA 4K4TA 4WBFA 3CJQA 1H2VZ 1RT5A 3V6DB 1EP4B 3CEDA 2B4OA 2JDJA 2RKIB 2M88A 4RW6A 1M5VC 2DEJA 2KM8C 1ZA2B 1IWGA 1ELOA 2BACA 5J1EA 5KFNA 2UXDJ 1ZPVA 4OV6A 4CP5A 5CABA 1DAXA 1B4SA 3ENWA 3Q22A 2WONA 3UVJB 1P9QC 4CLYA 4F3QA 2B9XA 4RO0A 4DLEA 3CMQA 1L5UA 3UW1A 1J5EJ 2W25A 1BHNA 1X4CA 2QLWA 2ZVIA 3QQCD 2YPYA 2GS8A 3M8PB 3W61A 1YLXA 2VG6A 1T9TA 4A8OA 5CCLA 3VAJA 2WSFC 3U1LA 2HBYB 4ATNA 1K1QA 4GMKA 4CO0A 3K8VA 3SQGB 4DU7A 2UVWA 3M8ZA 2KN4A 5HMZA 4QIGA 1L3UA 1SV5B 2Q3PA 4RW4B 4JV2A 3CPWR 2HBQB 2CQHA 2JFKA 4YB6A 4AQYJ 3Q8VA 1OYDA 3DU6A 2CVEA 2B0GA 1XJWB 2ASYA 1LFWA 2GHWA 2OPPB 3D5MA 4P9SA 5K9FA 1ZM4A 2XY6A 2P9CA 4HH0A 3IBCB 3ULHA 1M1KT 1TQLA 4CQ1A 3CE8A 1LWCA 5AJ3F 5A8RA 1FVSA 5KG5A 1OPZA 3AD8C 1NEEA 5KFHA 2BM1A 5E3PA 3CWJA 5IOLA 3QMQA 1X9SA 1R89A 4MIAA 1VRTB 1SJ4P 4IR9A 5FJ4A 1PJ7A 3FJ2A 5HVFA 2UXBF 3IRWP 1RT7B 4DR6F 3VALA 2ZBIA 2W9CB 1RA7A 5F41A 2ZBRA 3V81A 1T03A 1WTFA 4EYHB 3CC7S 4DOZA 1CQMA 2M8DB 3KDNA 5HATA 4C8OA 1HWIA 2OFHX 3D0HE 4M1KA 3VVTA 4ECVA 2B6AA 2E5IA 3KK2A 5K14B 1XMQJ 2UXCF 1CS4B 1NDLA 2L48A 4L72B 2IDEA 3DOKB 3OVBA 2JZ5A 1RHMB 2IJRA 1IBLJ 4FF4A 4X4UA 2V67A 4DN9A 1LK5A 3TNVA 3ETOA 3GJQB 2XMUA 3CCWA 1S9GB 3EWGA 3FRYA 1MWQA 4ED4A 2WK4A 4ZVHA 4B3MF 2HFNA 3Q2TC 3P96A 5ETPA 5CAAA 2NCKL 3A8JA 2IVFB 1TAQA 2NPFA 3DRXA 3O44A 5GAGI 2R7SA 1S9EB 1R8PA 3LW5C 1FDAA 1KHWA 3TVYA 3KK3B 1IQZA 2CFXA 2E5LJ 4ITSA 2M7SA 4WWSA 1T9VA 1ROFA 3DLBA 3EX7B 3TP2A 2EBEA 1HBOB 2AV5A 1WSVA 2W2MP 5CYQA 1UPMB 1K9MT 4J9OA 2QIFA 2BEFA 2DBBA 2J76E 3M30A 1VC6A 3WHIA 1RT3A 1U2CA 3OPKA 3H59A 3PRVA 2J9CA 5J2PA 1AFJA 5E3RA 1JK9B 1LWEB 1TV6B 3JYTB 4RU9A 3D6FB 3IM9A 4OHXA 4CLSA 2R4FA 3KNAA 1QSSA 4NE9C 1RTJB 4ZPCA 1JXEA 3B54A 2ACYA 1LNQA 3HI9A 2W7PA 3PW2A 2GC8A 3EGVA 3NGSA 1N56A 4JI8F 4DZ6A 4O3QA 3WIUA 4BHQA 1G7CB 3PY8A 2G0IA 1N5YA 3AHPA 1UAWA 4QYRA 3DCAA 3DFEA 1MG7A 4DL6A 2FLNA 2I1RA 4ERDA 2RSQA 1U24A 1FX2A 1DY3A 2XCAA 5L38A 1NM2A 3M30B 1ZA1B 4WZMA 4QW9A 2WVFA 1HBOA 2OPSB 3N6NA 3R7NB 2MXYA 2BOPA 2JEJA 4Q8EA 2NSCA 5KFSA 3R5GA 3VGUA 4EGLA 4WTOB 2CQGA 3MAAB 4DJBA 1JLCA 1F0XA 3FQKA 4J7CA 2B51A 2HRUA 4QIVA 3MGJA 2AD9A 2VBWA 3GZ7A 1VRUB 4CH0S 1SL2A 1HHTP 2FQQB 3IAM9 1RWMB 4ETXA 2RNEA 5BJRA 2G13A 3DHWC 3P3DA 2R8IA 4ES3A 1CJUA 5L1JA 2D7SA 1DZ5A 4ZP7A 5KFUA 2VG5A 2JVOA 4EBDA 1N33J 1T9XA 1M5PC 2KG0A 4R8UA 1K0TA 4CLTA 2Y8YA 4LRFA 5D0RA 4OIXA 2R8JA 4Y3CA 3ICLA 1UEUA 2H5IB 5HSPA 2R2TA 1DFDA 3R2DJ 1R8CA 2XEXA 2OELA 3I0RA 4Q43A 3GFYA 1OY6A 2VFSA 3FFIA 2HVDA 1IJEB 2UVVA 1PBAA 5GAEU 3K0JA 1U26A 1CQNA 2J7KA 3HZGA 3IAS9 4N8OA 2DITA 4PQAA 3ZZTA 2J7WA 3CGIA 3H25A 2VDIA 3DKDA 1XN9A 2KJVA 2VFUA 5DQGA 4DS4A 3IG1A 5HAOA 2RMLA 3CCUS 2IC3B 3CIZA 2IMWP 3J81Y 2YWKA 4OQJA 2XYGB 1QM9A 1B3TA 1RWNB 4J9UE 3BDPA 5F8NA 2W24A 4U9RA 4UOFA 1I5OB 1JB0C 3W66A 1IBKF 1NZ8A 4C8LA 1NK7A 1HWJA 3OTCA 2EWHA 2DTJA 1PKUA 3OTEA 3N4WA 3SQGA 2HMIB 4DFKA 2IJFA 2BW7A 1RKJA 3PHTA 3FBCA 1T9UA 3BPDA 4P6QA 1W26A 1XEZA 3VQSA 5M2PA 2HEKA 2BJDA 2OD6A 4OZ2A 1S48A 3UFCX 3MUMP 5D3GB 3KLFA 5D4LA 2HVZA 2FGOA 1V5VA 5ETRA 5T41A 3VGVA 2VJVA 1PO6A 3RR7A 2D3O1 4MYTA 1JKHA 1U25A 2Q6BA 1SC3B 2X7IA 4BLGA 3MCNA 4JUZA 2UUCJ 2QC3A 4DXLA 3HD1A 3E01B 5D0GA 4RU2A 1D1UA 1IBKJ 1H7XA 2DGTA 3BKUA 1JKHB 3MM8A 4UZCA 4DV6J 2DNZA 5A8KB 2ZNYA 1QTMA 3SCLE 3OVSA 5EWGA 3LH2S 2GQQA 1C0UB 5EX3A 4ZLNA 2HNDB 5ETMA 2GA7A 5U47A 4TQRA 3G6VA 4KV8A 5D3GA 1YJ9S 4TVAB 2YWGA 4NLPA 3PW0A 2ZDPA 2Q66A 2PE8A 2ZJPQ 4DL4A 3ILIA 3M32A 2F65A 3PTWA 4LF1A 4K0KF 3N9UC 2RRBA 2KG1A 1VBZA 3L7OA 1U1PA 2AX0A 5HROA 4TLRA 1NO8A 4RUHA 3E2EA 4KH1B 1HNVA 1PYOB 2ROPA 1XR6A 2IM1A 1HMVB 1S1WB 3N01A 1WTBA 2D3UA 4U6PA 3KUHA 4F2RA 3LP0A 1KN6A 1S1UA 2E1MC 2KVQE 3UCUP 2K3IA 3PKMA 3M6VA 2CYYA 2VUGA 1ZETA 4TY8A 4ILLA 2K7JA 3M8QB 5JVHQ 2FUG9 2DNNA 1FEHA 3EE3A 2YH1A 3L3CA 1WC1A 1RAOA 3G6XA 4K4VA 2DPIA 2VPWB 3AQPA 5F9LA 2HQIA 3OXGA 3TVZA 4B9NA 5A76A 3NS5A 2DCLA 1UJ6A 3ITHB 3TJAA 2G9OA 4DLGA 2RE1A 4LFCJ 4Q2LA 4Q44A 5DM7Q 2QSWA 2VASA 2RU3A 2BANA 2Y0BB 2R8HA 1KOHA 3I96A 5THWA 2VA3A 2BE2B 1B0TA 4YDXA 1LW2A 3HHLA 2WB4A 4K5RA 2PMZD 4ID8A 1KLNA 4ZPDA 2HQFA 2E1CA 4R5PA 1HD1A 3MR3A 3MEEB 4IQMA 3OR1B 1RTJA 4TN2A 2ZHAA 1Y4ZB 4QR0A 2IYIA 5LXRA 1H38A 1WEXA 2ZD1A 2QZ8A 3KJVB 3JYTA 2C22A 3MTJA 4IRDA 1YKWA 4WU3A 2HFUA 4G1IA 1Y3KA 5DQHA 3G87A 2V4QA 1S72S 1HD0A 1HI0P 4YY3J 1FKAF 1P1TA 4CYUB 1F5AA 2XMVA 1S9FA 4HT7A 3WX8A 3W62A 1QJHA 4N76A 3R9LA 1QVGR 3D68A 3HJVA 3SSRA 3KLVA 2AU0A 4YQWA 1FVQA 5GMKa 1NSQA 5EWFA 1I3OB 4NEZA 2GQ2A 4YUDA 4ECXA 1Q82T 3QJPA 4B3RJ 2XWYA 4EZ9A 2VC0A 3DN9A 1TVRA 2WSCC 1ZYQA 3QIDA 1FJGF 3SDEA 3MMBB 1YZ6A 5GAHI 1NK4A 1N6QA 2Z4PA 2MHEA 4LQ9A 4DV5J 1RTDB 1OJ4A 2D9PA 2HFZA 2ZWPA 2N7CA 3CIMA 3HHNB 2P5VA 4AQYF 4KHPJ 2BJ7A 2CQ0A 3SXLA 2IM0A 2F8EX 4OI3A 4ZJOA 4AL6A 5CYMA 1HNZF 4NXNF 2EK6A 5BYSA 4WFYA 2ERRA 4LSLB 4OI2A 1Y9OA 2OH2A 1NU4A 2LLZA 3GIMA 1UVIA 2R2UA 1SBRA 5LM7E 2E66A 3MTKA 1GX6A 2C42A 3MUTP 5E41A 2E1RA 3TEGA 1GFWB 4OJ3A 4RPFA 4EO6A 3KLGA 5HBMA 3AB2B 2HHSA 2FGCA 2WOMB 2J9EA 3DLKA 1LWCB 3KJFB 2FVQA 4J9PA 3AY0A 4LUBA 1QE1A 2HZAA 1DLOA 1MMDA 3I4PA 1PILA 2DO4A 1NXIA 2RF2B 3SDEB 2AJ2A 1NRKA 1FNOA 2UXBJ 1RZMA 4U8YA 1YDLA 1NPKA 2FVPA 3RW6A 2ZH6A 3MECA 3GPAA 4OYZA 2BM0A 3D7SB 1QAIA 1V3ZA 1MLAA 2MKYA 4UQTA 3N79A 3V6HA 3VF0B 2J7UA 5KFTA 3J7AN 5EX0A 4I6AA 1VJWA 1HFEL 1RLDA 1DHMA 5KTQA 2R2SA 2HHTA 2ZH8A 2W7OA 1ZM9A 2FJAB 2J8AA 4OHZA 5D0HA 2EEYA 4TY9A 1QE1B 3LOUA 5A6WA 2JSXA 1NH8A 5DS7A 5HVGA 2W9CA 4GRSA 2QL9B 4WYWA 1PCAA 4ELVA 1IN0A 5HBMB 1KC8T 1S49A 4UUXA 2ATCB 5ETTA 2MY8A 4GO7X 3EPIA 1C2PA 1ZH5A 2VPZB 4GKJJ 4HHUA 3QLHA 3R7BB 4Y2CA 4KFBB 2CQ4A 1HNWF 1L3KA 5D4OA 1YJTA 3DRSA 4DL0C 1Q16B 2PIIA 3KKFA 3UNGC 3BH7B 3A3NB 9RUBA 1TKTB 3ZNUA 2Z2ZA 2CJYB 1NHVA 1S12A 1S7IA 1KTQA 2A2DA 3FRZA 2LU2A 3QT8A 4Q7AA 3L7PA 2R42A 4RWWA 4WIQA 4WTYA 3R8YA 4DX8H 6AT1B 2XO7A 4PUOA 3NCQA 2KRRA 1S4EA 2OAUA 2VICA 1FX4A 4FS1A 1FCAA 4LSNA 1URNA 2IJNA 1O51A 2PFFB 1O5JA 4KIAA 4TKTA 8AT1B 1N6QB 4NMXA 2FIUA 3QJJA 3KLHA 4FS2A 1TVRB 3MM7A 3IN5A 3Q2SC 3PJWA 1D8YA 4ZVFA 4CTAA 2AHOB 2MMYA 4TYAA 4DG1A 5KG1A 4J9MA 2J6TA 4V19X 3NRBA 2XCPA 4DR7F 3BQ0A 3IG1B 1VBYA 5IQQA 3DDNA 2OD4A 3M2RA 3C14A 3HVTA 4WP9A 4DQQA 2GMHA 6FD1A 2F40A 2WVCA 3TAQA 2D3OR 1R7IA 2GVZB 4NWBA 1FESA 1IQTA 2QMUB 4MTPA 2J0SD 4XPEA 3PJ9A 3BGRA 5IM0B 1X60A 2UUAF 2Z2YB 4ZVQB 2FDNA 2CZVC 1DQ8A 2W2OP 1H72C 3C3LA 3DOLB 1Y5LB 1JJ4A 2BJ9A 3J81U 4EZ6A 1WNEA 3IWNC 3FEXB 1F6TA 2CPXA 5KFIA 4I2QA 3BSOA 2Y9HA 4PXEA 2PI5A 4B3OB 5KOXA 4KGVB 3RB4A 5KG4A 5AJ3J 1WG4A 3HHLB 2U1AA 1TL3A 4USKA 3IRXB 3SSSA 5HQMA 2H54B 2X3DA 4HVZA 5M2RA 3I6PA 1YIJS 1HI1A 2BANB 1S1VA 4V1Ak 2BE7D 1VR6A 3D1OA 4RBVA 1HBNB 1Q8LA 3BO4A 3FSXA 1GMWD 2CQPA 4RX6A 4NA3A 1JLCB 2VQEF 3MAAA 4RKUC 2AKWB 3I32A 1RAFB 4IO9Q 2AZ3A 2GO8A 2OPSA 2GQCA 3RG6A 4USUA 3S01A 2ZH5A 4GVLA 2IM3A 3MOZA 1WC6A 1ZM2A 1HQUB 2XMKA 3FBBA 3SBMA 4P52A 3PZPA 1TKDA 1HNXJ 4BBYA 4M5HA 4OYMA 4PPDA 3UN2A 1Q8BA 4DUZJ 2OEMA 4QOTA 1S1UB 3BYPA 4X64F 2F4FA 2RIJA 5KT7A 2RU9A 5C42A 1S99A 2Y1IA 3EZ5A 3N6LA 3AT1B 4C3KA 3MXHP 3BQ2A 4PG8A 2MEWA 2CJBA 3BGUA 2JC1A 3NNCA 1HNIB 1TKXA 2HK2A 3IMQJ 3RRKA 2IHR1 3G8QA 4NLQA 5ETVA 4NLRA 1YRUA 2C3YA 4ZVTB 3WIVA 3GILA 2QLJB 1T95A 2RJZA 2P9GA 2YX7A 2VA2A 1K0VA 3T41A 4A8WA 1KDNA 3IA0A 2VC1A 4OX7A 4YB1P 1N5VA 2I0XA 4DFJA 5LT5A 1ZAWA 3FUYA 5ETLA 4A4JA 4G1PA 4I4BA 4IFYB 2PD1A 1AZSA 3AA9A 1TELA 1RU2A 3DLJA 3T6BA 3UR0A 5IZHA 2MGZB 3TZZA 3MPDA 1F60B 1KLMA 2DY1A 2C3MA 3PCOB 2OTJS 3NL0A 3GU0A 2KDOA 1GTEA 4RNOA 4O3RA 5J1PA 1WI6A 4DV4J 4UUWA 4ED7A 2IMOA 6FDRA 1RXOB 3Q23A 2NUUG 4DV0F 3BDEA 1F2GA 5ITHA 2X1FA 1MROB 5J2QB 3ENAA 2XY5A 1LW0B 1SXLA 3LAMA 1JNZB 3EZOA 2HPUA 2HS4A 1Q5VA 2W9BB 2FC9A 4EUVA 5A8WB 3OTBA 4RWXA 4JI2F 3THPA 5LMUF 2C3UA 3CJ0A 3BSAA 4UT4A 4ELTA 1FXDA 2CQBA 3LA0A 5JMNA 2Q43A 4C97A 4DUYF 3BBFA 3JSBA 2MKIA 2ADBA 2KXNB 4A8YA 4FF2A 1LWFA 3N6MA 4B9TA 4KQZA 2EVZA 2HNZA 1DARA 4DCJB 1P8GA 2AF6A 2MZTA 2J0QD 3D6HB 2G1DA 2V8VA 4IFVB 1VRTA 2L3MA 3TUZC 4I7FB 5A6PA 5F8LA 3KMSA 3MPVA 4X2BA 5IV4A 4PQUA 5SUHA 5KFYA 1I6JA 2LQBA 2HFVA 2MQ8A 2MZQA 2UUBJ 1FKPA 2QO3A 2UVRA 3K89A 1RU1A 2V0NA 1FT8A 1RHUB 3I0RB 1YWXA 3PHEA 1W7WA 4DBQA 2J6UA 1TTHB 2HGMA 1AB8A 1L3VA 3J7ZT 4UTGA 3OXFA 1UCNA 3KHGA 2W8LA 5KFOA 4DL7A 3J7A1 2I8EA 3D1HA 4LFCF 1B70B 4RUBA 2P9EA 2LQ9A 2CPHA 1Y3JA 2KFZA 1YZ7A 2R7OA 4ILRA 3NLCA 2W9BA 5LMNF 1RB0A 1R27B 2Q6CA 2WHOA 3TO8A 1SUQB 1XBWA 3W2VA 1MMLA 3CNQP 1P1LA 1VRUA 1XWLA 4W92B 3AXMA 3SMZA 4A8KA 3S1TA 1VQNS 1VQOS 3H2LA 3GWCA 1Y5IB 2NQPA 4ZIVA 8RUCA 3K8WA 3G6ES 3DLLQ 1JLBB 2NXJA 3RB3A 4F2SA 2PDAA 4NCGA 4A47A 4NI2B 5LJ5Y 3BO3A 2BRLA 2NS1B 4A46A 2RRAA 4DPXA 2VOPA 2HURA 4ECTA 4IG3B 3CMAS 2IY5B 5E3QA 1RAIB 2WCXA 3E8OA 4FYXB 3TAMB 5IV3A 5DDOC 4K4UA 2B5JA 1X4BA 4PABA 2XZDB 1RAHB 2FVCA 3HFVA 2EFNA 2RAQA 3FBFA 2EI5A 5K8OA 3CDUA 5KFBA 3VVUA 3H98A 5IT9Y 4IQXA 4LSLA 2NREA 2E5GA 2GJ2A 1F9HA 2HHWA 4FYWB 5CYMB 1KBRA 3IGVA 4TU8A 3T5HA 2ZD1B 3ZZOA 4NA2A 1AA1B 1B7YB 1FKOB 2K06A 4NLDA 2GO9A 3WX4A 3CJ4A 1IBCB 4WP8A 1A6LA 5EWEA 4EWTA 2B56A 3HM9A 3H5YA 2FJWA 4IKAA 3RR8A 4X4PA 2DIUA 3A4TA 3NG8A 3PYGA 5F0UA 1MNEA 4A48A 5DDQC 4DX6A 2RRNA 3M8YA 3L09A 3KLEA 2XWXA 1YJNS 1U48A 4QIEA 1N34F 4P7VA 3SEOA 3EYZA 1KHVA 3PFEA 4QIFA 5B7WA 3SZ2A 1S76D 4MKAA 3I87A 1B0VA 2OGUA 2MKHA 1GMWA 5HMXA 5SZTA 1HR0F 1XNRF 2YWHA 1VQKS 3NY0A 4WKYA 1IR2A 2OUGA 2FJBB 3DXSX 2F8MA 1CVJA 2MB0B 1LOUA 1T94A 2HRYA 3DC2A 3G86A 2XSJA 3VGTA 3OJSA 4EYIB 3PJXA 4F50A 2V9WA 2DH7A 3HKZD 5KG6A 1X0PA 3MEKA 2V8DA 3N0VA 4FNHA 3KJVA 4UOGA 4YP3A 3C46A 5FDLB 2LCWA 4ZCIA 1K8AT 2BW2A 4WFNQ 3NGDA 3BO2A 1QSYA 3POTA 4FF1A 1R0AA 4WF9Q 2K8GA 3JTOA 4USHA 5GADU 1U1QA 5GMDA 1Q95G 1LW2B 4ZLPA 4WXOA 3RBXA 1XERA 2IAJB 5CD4A 2DRBA 2FVRA 3OJUA 2LU1A 3HSGA 4IH6A 5I3UA 4C8ZA 3GYGA 4NXMJ 3CDWA 3UCZP 3Q8RB 3MUVP 4DR3J 3MMJA 3ADAC 3C6TA 1RT7A 4ENOA 4X66F 1WKLA 2ZC4A 2DR9A 1CPZA 1CJTB 5EN1A 2UUTA 1WDTA 5C7PA 4NXMF 1UKUA 2VODA 2QA4S 1NCLA 4M94A 2K7KA 1ZBTA 3QBCA 2IIHA 1R8AA 2V63A 4ZHRA 2A6MA 3OUYA 2RDJA 4DFMA 1T05A 4MKYA 2JEIA 4TY8B 1CC7A 4LRDA 2BDPA 1IKWA 2YKMB 3FCWA 4OI1A 4BDPA 4LFBF 1NPRA 2XG8A 1S6QA 3G82B 5K8PA 3MURP 3PIPQ 1VMBA 3B4MA 3MM7B 4B3SJ 5CHCB 3P5TL 4J9VA 1IUJA 3GE9A 1M5SA 1QTNB 2HQDA 2XMWA 3OFEA 4RBTA 2HK3A 2O3DA 2HMIA 3OHAA 3GJTB 4WZQA 2R7RA 4HTJA
chains in the Genus database with same CATH topology
2DNRA 2F3JA 4MJKA 2FD2A 3BSNA 3M32B 2BQ3A 4KSEB 2KB2A 4L3NA 3K5MA 5KFFA 1TKTA 2FB0A 4QYZJ 4MH8A 3ENQA 3HF5A 4H4MB 3G4SS 1KFSA 2HVHA 1S7HA 4LVOP 2K1RA 3QYYA 1UVNA 3FDSA 3FMWA 3S6EA 1UMJA 3CDEA 2B7CB 3CCVS 4YR3A 1RT2B 2QMXA 3LALA 3MHYA 3G9CA 4RLEA 1FRKA 1VBXA 1JWWA 5J1EB 1Y00A 2O67A 4ECQA 1JIHA 5I42B 3HT3A 4XDDA 4DQSA 1U4BA 1YHQS 3IR7B 3A1YG 4NRUA 2ZUGA 3TAMA 2HWHA 5MLCV 3UD3P 5KG3A 2GCFA 2OIHA 3W3SA 5F0WA 3I9ZA 2X3GA 1JLBA 1S1XB 1SIWB 2D41A 1KQSR 3G6YA 2DHAA 4H4OB 4FF3A 1B7FA 4NYOA 2VBXA 5E3CA 5H1SV 3TX8A 3DLGA 2X1BA 2V94A 3CULA 4ID5B 2ZE2A 2IVMA 1N33F 2DNPA 1UFWA 2L9DA 3TUIC 3DLHA 3ZZUA 1GX5A 1C0TB 4TXSA 1HBMA 2GIRA 5T7LB 3LGNA 1J5OB 4CT9A 4Q45A 4RNHA 2LEPA 4ZDNA 4USJC 1BWEA 1FO1A 1SI9A 2M70A 2B7BB 3IO1A 3O1LA 2RILA 1M5KC 4FZVA 4O44B 1NJIT 4LIRA 5A0YB 3DYAB 1FD8A 3MD3A 3GIKA 4FVCA 2EKYA 4H4OA 5IXUA 2UP1A 2ASJA 1M5OC 2WW8A 3BJYA 3FSYA 5GADI 4OHWA 2HIQA 2MZRA 4QCLA 4FNIA 1FDDA 4M5DA 5KG2A 3IR5B 4DWIA 1OSCA 2BYCA 1X4HA 1KVIA 2B43A 3KK3A 2DNLA 4JI4F 5I3QA 1CC8A 3CCLS 1JLFB 1JLAA 2MZSA 1NHUA 4CT8A 2XS7A 2QA1A 2YKMA 4Y2KA 5M2UA 1DURA 5AXKA 4NZ7A 2UVUA 2IRYA 3MEEA 4F8RA 1VLYA 1ZM3A 3M9OB 1KR4A 3LWLA 1D0EA 4HKQA 4CO5A 2MQOA 3GB0A 1LWEA 2AJ4A 2CVIA 1N0UA 3M2UB 2WTFA 3QGGA 1SKWA 5JJBA 1RT3B 2WBMA 5A2QY 2DO0A 3QPIA 4MYUA 4WYLA 3J7Z5 2CPFA 1T03B 3CSKA 1Q1KA 2PC6A 3DM2B 2AJ1A 3HVAA 4NPOA 3M8RA 3U02A 5T14A 2J9DE 4NLVA 4ZVGA 2O1PA 4WE1A 2IA6A 2LQ5A 3O3LA 4LVNP 2BQRA 3POTB 3K5OA 1UWBB 1T3NA 4D3GA 2DNMA 4XAKA 1O0PA 4HDHA 4KAIA 5D8HB 2LQJA 4NLOA 3CJKB 1D9FA 3DNCA 5KFWA 2AGPA 1KSPA 5H9FJ 3AQOA 4RNNA 1IKVB 1H98A 4RW7B 1TK0A 3LF0A 1VOMA 4ZP9A 1HMVA 5KFMA 3V5RA 3SCKE 5CZXA 2NXUA 2MY7A 1SH3A 2MHNA 1BY9A 3CUNA 3BEGB 2VOOA 3V81B 2ZH1A 5BYRA 4DR2F 4NZ6A 3V4MA 1REVB 1SJ1A 4OI0A 1YG0A 3CD5A 4E98A 4YOEA 2XLKA 2QE5A 3KLIB 2W4PA 4ICLA 3OFHA 1SB6A 1FKOA 1NH7A 2BRKA 2OJ3A 3RR7A 3T5LA 3KLFB 2XGPA 2W7AA 1H2TZ 4UQGA 4W90B 4OX6A 3PVXA 2UV8G 4DL5A 4NLWA 4HI1A 2XSFA 3OSPA 1RT6B 3DMJB 4QQBA 4DL2A 3VWSA 1WHXA 3O2IA 3AH6A 1FEEA 2JOQA 4WFXA 2KYZA 1RJJA 2XC9A 2DGSA 2QFJA 4IOAQ 2YNFB 1MWZA 1HYSB 3MR6A 1X7VA 1BQNA 3TYTA 1HNXF 1RGVA 2AQ4A 3AJ1A 4OLPA 3KNGA 3OSNA 2KZZA 1E6VB 3E51A 4DPOA 5KFEA 4LJMA 4Y28C 3LANA 1SH2A 4QWCA 4EBEA 4DQRA 4C9DA 4DV5F 3IC1A 3QZ8A 2AJQA 2FHKA 1NKEA 4PXCA 2KZMA 5K5MA 2EBGA 2LECA 3FFIB 3HO1A 1ZTWA 2DNKA 1LFPA 2D1CA 1DTQA 4FXWA 4IG0B 5HMYA 4XPCA 2XS2A 1R3NA 5D4NA 1HW8A 1HBMB 4X62F 4KTQA 7FD1A 2ZHBA 3QGHA 2ABYA 3QAUA 4YEAA 2F1FA 2GGPA 2OPRA 1BD6A 1X5PA 4I6WA 1Y0HA 4IH5A 3AB4B 3NCRA 3HPOA 4C8MA 3PX0A 1WELA 3I0SB 3M1VA 5C24B 3RRHA 2CJQA 2KRBA 3I55S 3ENVA 4IOBA 5KFZA 3V4IB 4DSJA 3EGNA 5J2NB 2NLWA 5A8WA 4LF6F 3O5TB 3KHRA 4F67A 3PRBA 2WRMA 3LP1B 4TNOA 1O8BA 3MMCB 4PXDA 1U2FA 4E0DA 1GXUA 3EXYA 4QU7A 3BM7A 1F5CA 2ZVSA 3R5BA 2ZH7A 4F4WA 2CPDA 1S1TA 1UWBA 1RWUA 2R8GA 4OZNA 3PR4A 3Q8QB 3UD4P 2BXJA 5FD1A 4DV2F 4C0HA 2I9SA 2PI4A 5DO2A 5KFXA 1U1NA 3OXLA 3PKYA 4XDCA 3LQVA 3IWLA 4J9QA 1FNXH 1G2EA 1X4AA 5HP1A 3NKYA 3CCJS 2ADCA 3WZ0A 2RQ4A 4DR4F 4I64A 2M5YA 5KG0A 5DQIA 1NJYA 4JI3F 4OZJA 3CCSS 3ISND 3PW7A 1JJHA 2KU7A 2ZDOA 3O6QA 3OR2B 1FK9A 4LF5F 3MFHA 3RW7A 1E6YB 1WG5A 3UPFA 4Y2MA 2ZZNA 3HX9A 3QWUA 3MMBA 2HFOA 2F9DA 1Z4UA 1EETA 2N7YA 4HDGA 5HL7Q 2JEFA 1IR0A 2FJXA 1JLFA 2B3TB 2XHWA 3IGNA 4AYBD 2QRRA 3I4HX 5L1IA 1G3OA 3MWBA 1FHTA 1UJ5A 3BSCA 3LP1A 1D3WA 4IRKA 1ZAVA 2Z2LA 4LMZA 2MSSA 4LF4F 3M6WA 4Y34A 3KMQA 1UVMA 1FRHA 3I0SA 3M1VB 3VZIA 1HBNA 1XR5A 2PA8D 3K58A 2ZOGA 1X8DA 1D8ZA 4GO5X 5DG7A 2C28A 1U1OA 2UUBF 1IKXA 2GJIA 3CCTA 5IFMA 1RQ0A 4JOUA 4YR2A 4ECSA 5DETA 1VC0A 2V4JB 1UL3A 3K5LA 4NYZA 1TK8A 2E9RX 2HHPA 5EDWA 1OWXA 3N5FA 2W4CA 2YNIA 3GG0A 3MMCA 1T02A 1HQUA 3KWMA 3NBPA 4DV1F 1U1MA 4R0JA 2I38A 4TYBA 2N3LA 2HWIA 5L1LA 2EG1A 1OS5A 4ILMA 3JB9k 2K3KA 5DGAA 4DSLA 2VB6A 2VG6B 2DHSA 1BQMA 3MFIA 4GKJF 3ZZPA 3DI6B 4DSFA 2P6SA 3NGKA 1CLFA 1NNDA 4BC9A 4I67A 4X84A 4WFAQ 1YJVA 3T19A 2IA0A 3CCES 1HHSA 1VS3A 1X0FA 1FTCA 2YNGB 3PM9A 4OZ0A 1Q86T 1DTQB 3DOLA 4Y2AA 2JLGA 3M6UA 3BS9A 4EBCA 3THVA 3NP5A 4JYAF 4KV8B 3GYNA 4HHJA 4YB5A 1RT5B 5IM0A 2X1AA 3V6DA 5I42A 5F9NA 3CD6S 1YVFA 3MMAA 4U7CA 4KO0B 5A8KA 1RYSA 3K5NA 2X1GA 4F4ZA 1N5SA 4GKKF 1TP7A 2GHPA 5CD4H 2HS3A 5G4DA 2M3DA 4PWUA 2CQ3A 1FRIA 1A7GE 2VG7A 3DU5A 2OFGX 4LFAF 3C66A 2YNFA 3BN7A 1D9AA 4KC5A 4CNYA 1BQMB 2MJUA 3D54A 3EPGA 4HI2A 4E8UA 4DV6F 4OV1A 4AUKA 3Q8SB 1YJRA 5IT0A 3K2YA 2HLTA 4N5SA 4WCEQ 2ASLA 1RT6A 2GMLA 1Z1ZA 4PUOB 1AROP 1DQAA 2AWZA 4OZLA 4OFZA 4CCHA 4RUAA 5AE3A 4BS2A 1DBDA 1T8EA 2A2CA 1BLUA 2K2PA 4ZPWR 4J9NA 2IC3A 4BWMA 5KT6A 2KI2A 1R31A 1R6YA 1WF2A 2B4PA 4KFBA 4NZ0A 3OL7A 2IRXA 1T05B 1VGYA 2I5JB 2CDQA 2ZH3A 2MDAA 2CIMA 3KLGB 2F8HA 4ED1A 1REVA 5EHHA 3R1HA 1DRZA 2R7TA 4K4YA 4DHVA 2CJKA 4ECZA 3IXQA 4DR5F 2NPIA 1LWFB 2XLJA 4AXIA 2CQCA 1MU2A 3M2VB 2W8KA 4QPTA 1S97A 4NL5A 4ZP6A 1X4FA 2R8KA 3CO9A 4O3NA 3P6YC 4MK8A 3VZHA 2HGNA 1KS2A 3MDFA 1MWYA 4IOCQ 4ED6A 4QIWD 2PN6A 2I2YA 4X4TA 2EW9A 4USIA 2SXLA 3FEZA 2EK1A 1K9MT 1FDNA 2IVYA 2VPXB 2DCUB 4L6V3 1Q4RA 1OPIA 2UZAA 2IFXA 5F8HA 4HYKA 4JI7F 1WHVA 2VKRA 5AXMA 4CH7A 2R7UA 4R0EA 1XR7A 3T5JA 3QZ7A 2VFVA 1XMQF 3DM2A 4WFZA 2E5JA 3HHKA 4X4QA 1ZPWX 1P27B 4KE5A 2LDYA 2LDIA 2X51A 2YQ3A 5DM6Q 2R9LA 5KFPA 1FRXA 4OHYA 4B9SA 2RT3A 2MZ1A 2E1AA 2DR8A 4YB7A 1XK8A 1VK3A 4PXBA 3KLEB 1I1GA 4F02A 5I4MA 1HI8A 2BUNA 2R2RA 1YTYA 2OSRA 1JMTA 2OO4A 4ECUA 1ZAXA 1TK5A 2YKAA 2QV6A 3OQ2A 4KPYA 2Y1JA 4N77A 2APOA 4H54A 3QAEA 1S1TB 2LEBA 4RNMA 1U1KA 2E5HA 4WU2A 4URSA 2DR7A 3OFGA 4WJBA 4MIBA 3T5KA 4R25A 1VFJA 3R5DA 2AYGA 3ONQA 4LQ3A 4NLGA 4O23A 2CG4A 3U27A 2GX8A 4OI4A 2YKQA 2IM2A 4YHHF 4HL9A 3OLAA 1JLQA 2OLWA 4OJ1A 4AFFA 5CXTA 2QLXA 2LEAA 3CD0A 5KAKA 3GV5B 3RBEA 5E5NA 1S6PB 2VKZG 1F9FA 3ISZA 1OIAA 4MAKA 2DPJA 3TVKA 3HVWA 1S9GA 1RT1B 4NCBA 4M63A 2H9ZA 1S1XA 4KKOA 3SCIE 3M05A 2CPEA 4OJGA 3TANA 1HNVB 1NJZA 2Q1LA 4KR0B 2R7WA 3PV8A 4BC7A 4DR3F 4ED0A 3E3XA 1SJ3P 5L39A 2RQKA 4OJHA 4AXJA 5T7LA 2N4DA 2Z0GA 3HZEA 4FXVA 3NAHA 2RVJA 3B78A 4IFVA 1U09A 2I5JA 4MK7A 3O8WA 2FLPA 2DGXA 4O3SA 1WF0A 4ZK7M 4DG1B 4C0BA 3CDBA 4H4MA 4DEZA 1HL6A 4CTAB 5HLFB 2UXDF 1K1SA 1WEZA 4HLBA 1JJ2R 2DNGA 1ZOTA 3GG1A 4ZP8A 4EEYA 1A9NB 1XTZA 3G8TA 1VQ5S 3SFUA 4PWDB 1UVLA 3B4DA 3UCGA 3PR5B 5IT4A 4IO1A 3T9NA 3TOQA 3VR1A 4C4WA 3M8PA 3QGPA 2OMOA 4HT5A 4PG4A 4M95A 2M0GB 4PG6A 2RB7A 3V6KA 5HLFA 4F4KA 4IUFA 2H5EA 4FN5A 4DMZA 5C5JA 4RW8B 3DRSB 4DN0A 2KT2A 3CVKA 4NA1A 5IWAF 2YKOA 3LGMA 4KJIA 2EC0A 2FVSA 1UW4A 3EUNA 3SFGA 2VONA 5EGYA 4N41A 4CH1A 2QA4G 2YKPA 3KHLA 1YI2S 3QGIA 2A10A 1KNZA 5IS2A 1SJFA 4O3OA 3JSMA 1X5TA 4C3LA 4FPRA 2MKKA 4IRCA 4DV4F 3AA8A 4PKDB 4Q0BA 2YNGA 3ZZ0A 1N36F 5JVGQ 4EFAC 4Y6IA 2IAJA 2YKNB 5GAGU 2JLEA 5GAEI 2GIQA 1WHYA 3W2WB 1IJFB 2LA6A 1KQKA 3VAGA 1TL1A 2RF2A 1RISA 1VQSA 3SDEA 5GAHI 4I2PA 2E7WA 3PDNA 1WI8A 1DLOB 1HWKA 1IKWB 3I5BA 1S6PA 4DQPA 2DH9A 3FQLA 5CQGA 4M8LA 3C8YA 2B9YA 1P6TA 2N3OA 2ZKTA 1SL1A 3FZBA 3MAQA 2DVIA 3C6UA 4AL7A 2DGQA 3U1NA 1GTHA 5H9EJ 3UQSA 4JI1F 2CQ1A 4I0WA 3T1HF 2ZBCA 4OX8A 4QWBA 2DNQA 3IS9A 3MEGA 5KFVA 4X65F 2J0WA 4XK8C 5CH7B 1W2IA 5LJ3Y 1XMBA 4ZCMA 2UUWA 4I56A 4O0IA 3M2UA