2K1RB

The solution nmr structure of the complex between mnk1 and hah1 mediated by cu(i)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/chaperone
molecule keywords Copper-transporting ATPase 1
publication title The solution structure of the copper(I)-mediated complex between the first soluble domain of the Menkes protein and the metallochaperone HAH1.
rcsb
source organism Homo sapiens
total genus 18
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k1rB00
3E8OA 3MCSA 2XMTA 3I9ZA 3QGPA 3TNVA 4A4JA 4ZOSA 3CJKB 2GA7A 2RSQA 1OQ3A 1FEEA 1MWYA 2W4DA 4Q2LA 5B08A 1K0VA 2IFXA 3IWXA 1OPZA 2CRLA 4Y2IA 2QLWA 2GGPA 2LDIA 2RILA 3IWLA 1OSDA 3KNGA 4Y2KA 5T7LB 1P6TA 2ROGA 4HI1A 2HLUA 5A6WA 2K7KA 4NL5A 2GO8A 5A6PA 2KT2A 2QLXA 4NPOA 1FESA 2OFGX 1MWZA 3BGUA 4HH1A 4FNHA 4YDXA 5B0EA 1W2IA 1Q8LA 1TL4A 1V3ZA 3HX9A 1N5QA 1Y3JA 4FNIA 1VQSA 3HF5A 4HL9A 1TUVA 3FMBA 3TOQA 3HDSA 4ZA1A 3CJKA 4OJ1A 2QIFA 2HFOA 2OFHX 3KG0A 1SB6A 1FVQA 1VQYA 4DN9A 5B09A 1OQ6A 1YJVA 3K7RA 1APSA 3HHLC 4QOTA 5B0GA 1N5SA 2ROPA 3MZIA 2HLTA 3QMQA 2FHMA 5B0AA 5T7LA 3WDOA 1AFJA 4A46A 1YJUA 2ZDPA 2OMOA 2GV1A 1TL5A 1N5TA 3BF4A 2OKQA 1LQ9A 2XMMA 4Y2MA 2N4DA 1YG0A 2OD6A 2ACYA 1P8GA 3LGNA 1AW0A 2JDJA 1S6OA 3BM7A 3HFKA 3T9NA 5B0FA 1FE4A 1TZ0A 2N7YA 5K9FA 2BUNA 1CPZA 4HI2A 1Y0HA 2FIUA 3LGMA 2HQIA 2KT3A 2ROEA 5IXUA 2LQBA 1Q53A 2AJ1A 1GXTA 4Q2MA 2PGCA 2ZDOA 1U7LA 1S6UA 3HHLB 1TR0A 2LQ9A 4OJGA 5B0CA 2IYIA 1JWWA 3VTIA 2W4PA 2GFFA 4OIXA 1ULRA 1YJRA 4OJHA 2HIQA 2W4CA 2XMUA 3GZ7A 2OAUA 2Q3PA 3BN7A 1CC8A 1JK9B 2IYGA 2KKHA 2OP5A 3BR8A 2QYCA 2XMJA 1R6YA 3DCAA 2OD4A 1YJTA 1Y9OA 3LO3A 2K1RB 2XMKA 1GXUA 3DXSX 3KG1A 2RMLA 2VH7A 2XMVA 1FD8A 1SQEA 3HHLA 3BB5A 4HH0A 4OJ3A 4A47A 1AFIA 2L3MA 2AJ0A 2VV5A 2BYCA 1FE0A 1Q8BA 1URRA 3FGVA 5B0DA 1KVIA 1FVSA 1YRXA 3FRYA 1KQKA 2FB0A 4A48A 2G9OA 1QUPA 3KKFA 4U9RA 5F0UA 2HFNA 2LXFA 2GCFA 2AW0A 1KVJA 1X0PA 2FTRA 1Y3KA 5KAKA 2XMWA 1IUJA 2ASYA 1Q4RA 4F67A 1CC7A 1SI9A 1X8DA 2BBEA 1N5VA 2K2PA 4YEAA 2RU9A 5F0WA 4DL0C 2K1RA 3TRGA 4DPOA 3HHLD 1RJJA 2KYZA 3UDCA 2GGPB 3F44A 2BJEA 1WD6A 2EW9A 5B0BA 2N4CA 4EFAC 1X7VA 3BDEA 2BJDA 2PD1A 2AP6A 2K7JA 1XBWA
chains in the Genus database with same CATH superfamily
2RQMA 2UUAF 4DOZA 3MEKA 1IBMJ 3KK2B 2RRNA 3PYFA 2D74B 2V68A 4KGXB 2DGVA 5F9NA 1YZ7A 5ETMA 1B7YB 2W24A 3KK2A 2E1PA 4EGLA 1X5OA 2GAHC 2Y1JA 4RL1A 3OUYB 3PYDA 4PWWA 4ANEA 3MM6B 3PXGa 1V3SA 3I5AA 3OHBA 3QSIA 3SXLA 1WUUA 2GHWA 2EXUA 1XERA 3BPSP 3OUYA 1NJZA 5ETOA 3WQPA 4DL7A 3L9ZA 3MM6A 3ELHA 4KBIA 2AJQA 4GVBB 4O3OA 3JS9A 4OX9F 2DXDA 2DPJA 2FTRA 3UCZP 2CNLB 3WIVA 4CH7A 3UDCA 4GVBA 2VG7B 3JB9k 1I1GA 4F36A 3LANA 1YJ9S 1XR6A 2W01A 2W4DA 2ZH9A 5M2UA 1P1TA 3UQSA 2VG7A 4FPIA 4DX5A 2WHOA 5CYMB 3AHPA 5KFUA 4HH1A 3W9JA 1J2VA 1NAQA 3HPOA 1XJWB 1AA1B 5J1NA 2CPFA 1R0BG 2YNIB 4LF4F 1S48A 3D3BJ 5B0GA 5KFJA 3MZIA 3VALA 3P6YC 2F9DA 2WSFC 5CYMA 3THTA 3KYLA 5A76A 3MEDB 5HMWA 2YNIA 4UY85 5JXSA 2DPIA 3AA8A 5L39A 3W1YC 5IOLA 1RQ0A 3MEDA 2X1FA 5AE1A 4I0WA 4N77A 1RHJB 3H5XA 2KG0A 3KNAA 5E3QA 2MTLA 2ZNYA 4WFZA 3M6WA 2OLWA 1H6KX 2BBEA 1VJQA 1WNEA 1HMVB 1D3WA 2V67A 4MAKA 4DF4A 3GV5B 1HBNB 2IMWP 2AGQA 1HMVA 2C2NA 1R0AB 2HQ3A 5A0YB 1HBNA 2OTLS 4OMFG 2QLBB 4WWSA 5CHCB 3HZEA 2DCUB 1MW7A 4MH8A 2KVQE 4TQRA 1RAIB 1R0AA 2EK1A 1E6YB 2I2YA 5A0YA 3IC1A 1LEOA 2CQHA 5GAEI 4RO0A 4Q2MA 3N01A 4GVLA 4DG1B 4CM0A 3G8SA 1E6YA 2HHVA 3M4XA 3FFIB 3GE9A 3CJTA 2RJZA 3TX0A 3R5GA 1HNZF 2GQ2A 4WP3A 4DG1A 4C4WA 1U6BA 4NOHA 2OGUA 2H3EB 2B8PA 3FFIA 3AAWB 3R2CJ 1PJ5A 3E51A 5LSRA 5CD4A 5HJXA 4CLUA 2CZ4A 4LSZB 4OYOA 3BDEA 2PD1A 1K1SA 2YKAA 1KC8T 4Z7CA 8RUCA 3LWLA 5FIIA 2MZQA 1NK6A 3KMQA 3ZZRA 2EKYA 2HQDA 2X1BA 1KN6A 1LXJA 1DQ9A 1Y3JA 1U26A 4NCGB 4YB5A 2CQPA 1KQGB 1IQTA 3H8YA 3HXMA 5KFMA 1AZSB 3CDAA 4DMZA 3SDEB 1NXIA 4MMOA 3CJRA 1YDLA 3MPWA 2QMWA 2F4VF 2HGLA 3D6MB 2F8EX 2N7YA 4NCGA 4GC7A 2BJ7A 1F1BB 2KYXA 3MGJA 1AZSA 2CXEA 3SDEA 1GTHA 1SC3B 1U7LA 2XYHB 3VAHA 3CSKA 3QZ7A 2BR0A 4TYBA 4HDHA 3T3FA 1WDTA 2GC8A 4ECSA 1IR0A 3MAHA 1R8PA 2G4BA 1BD6A 5AXLA 3HJFA 1GX6A 4DX6A 4HT5A 4YB7A 1KQFB 2N7CA 2YQ1A 1EETB 4YHHF 1WACA 1R8HA 1UA1A 3TUJC 3OJUA 4DSEA 4NPOA 4EYIB 3CO9A 1TTHB 1T9XA 4H4KC 1EETA 2QFIA 2LMIA 1I3OB 3A1YG 2ZM6F 4C7QA 4J9PA 3O2IA 2HBYB 2FZCB 4JV0A 2ZH1A 4LBPA 3QMQA 2Y8WA 2QJ3A 5AJ3F 1A0OB 2VKZG 3QT5A 2NXCA 3MOJB 3Q23A 1N32F 2HNYB 4DPTA 2E5LF 4B9VA 1FX2A 3IRWP 3EICA 1F3FA 4P2MA 2M4MA 4RX6A 4NLXA 5KFTA 4CNYA 3ZZ0A 4JI1F 5ETKA 3Q2TC 2HNYA 4ZVRB 3QIPB 1NPKA 2J5AA 3Q8QB 2F1FA 4OLOA 5JUMA 2XMVA 4PG6A 3BQ2A 2APOA 1U8SA 2WZ1A 4JV2A 1YHQS 2E29A 1SQGA 1OSCA 4ZS6A 1RABB 3QWPA 1JNRB 3QIPA 2K2PA 4I69A 4WJBA 3TRGA 4ELVA 1RWWB 4KB7A 1HHSA 3IG1B 4PXCA 3GJQB 4OV1A 3AD8C 5LXRA 2HZVA 1FNOA 2DR5A 4NL5A 4QQBA 3AOCA 5HP1B 2I0XA 3IG1A 1FA0A 4K4UA 2JC0A 3W8PA 3M2UB 5HP1A 5IT0A 3GG1A 5KG2A 2VL1A 3CWJA 2RB7A 2AJ1A 2ZDOA 4ZVPB 2MY7A 3M2UA 2JJ4D 4ZVFA 4ES3A 5C2CA 5KG6A 4X4SA 3GILA 2RHSB 3W5ZA 5D77A 3W5YA 2VHGA 2HSEB 4EK2A 4F3MA 4X62J 1VQ9S 3DOLB 5F0UA 4Q5VA 3MDFA 2C2MB 3C19A 2FY8A 2HK3A 5GAEU 5DZ7A 4DQPA 3LALA 4TNOA 4C8KA 5C24B 3JSRA 4F8RA 3DOLA 3PV8A 3PW5A 1R8BA 4OL8A 3J81U 3H4BA 1FKPB 2KJVA 1OPZA 2F8MA 2IDEA 4P52A 2DNOA 1U1NA 5C24A 1RLCL 3K58A 4F50A 2PC6A 5CYQB 3HMJG 1QAYA 1FKPA 4AXJA 5B0AA 1U47A 1S12A 1NMEB 3CC7S 3CMES 5CYQA 5B0FA 4X4TA 2K06A 4JI0J 4K4XA 3D67A 4IUFA 3CJ5A 2KFZA 2GFFA 4MJKA 5HANA 4G6VB 1RWNB 1R6YA 4LR9A 1NPPA 4PKDB 1RHRB 2VONA 2FB0A 3R5JB 2HFNA 2W9BB 4M5JA 1JXVA 2DNLA 3AQOA 1SPBP 2ZD1B 5KFHA 2W9BA 1E6VB 2XC9A 3P49B 4Z2XA 4A8QA 2ZD1A 3R5CA 3T1AA 3P4UB 2IM3A 2LU2A 1E6VA 5BYQA 4CO1A 4ES1A 2NREA 3ZNJ1 3WBZA 3G6XA 1S1UB 4ED6A 4FF2A 2RE1A 5CD4H 4OJGA 5KFLA 3VGVA 2R2RA 1X9SA 3WHIA 2XBPA 4AXIA 3O1LA 3BN7A 1S1UA 1BY9A 3OL6A 4NLDA 1WHXA 5D0HA 5J2MB 2E7VA 2BMBA 5B7WA 5HSPA 4FF4A 2W2QP 3JQMA 1XMOJ 1EKSA 3RZAA 5J2MA 1RB0A 3LTOA 3IR5B 2CNKB 3H5UA 4LFAJ 4HACB 3UI3A 2Z8QA 3K57A 2NUHA 4PG7A 4DR3F 3O3LA 4C8YA 4HACA 4NXMF 1ACMB 5AE3A 1W2IA 5D4LA 4ILMA 3R7NB 5DETA 3TVKA 1TKDA 4O23A 3GV8B 3ZXWA 2FJAB 2FHMA 1RAHB 2XY6A 1PGZA 4G3IA 4XAKA 2FZKB 1TL7B 2HFZA 3HT3A 4AYBD 3IR7B 3BEGB 4FBTA 4PPDA 4K0KJ 1SIZA 4U7CA 3BSAA 1TL7A 1NDPA 1PYTA 2ZKTA 4PUOB 4K4VA 3GFHA 3UNGC 1NK9A 2X1GA 3AOAA 5GAGI 3FRYA 1RKJA 3JYTB 2LEBA 2XMWA 4ED2A 4PUOA 3VZHA 4J9KA 2P9GA 3LP1B 3N28A 2PMZD 1C1BB 3BGOP 1X4DA 4JI2F 2P8IA 2CIMA 1IR1A 3JYTA 3JXOA 1VBXA 3W66A 1W26A 2KZMA 3EGNA 5E3AA 1C2PA 3LP1A 2XYGB 3M6VA 1PYOB 4XPCA 5KG3A 4IRDA 1C1BA 1FESA 4Q44A 3N79A 3CIZA 5DG7A 4DV0F 2Z2YB 4EWTA 2JNJA 5I3QA 4OX7A 3CJ0A 2M8HA 2MLYA 2ASDA 2BE2B 3ZTPA 1CPZA 3CD6S 2D3UA 1IBLF 5J2QB 3KOAA 4M5MA 4YB6A 2UUBJ 4PPZA 5BYSA 1MMNA 1SJ1A 3GZ7A 4RW4B 2BE2A 3GIIA 5IT9U 5IQ6A 2CPEA 1L3SA 2GNKA 4U95A 5J2QA 1WDDA 4OHYA 1KVKA 1NUEA 5B0DA 2PMHA 2ZOMA 2VPYB 4RW4A 3ZTRA 3J81j 2VIHA 2XY5A 4UUWA 1Q95G 2R8KA 1T9UA 4J91A 1U1OA 2QYGA 2EWHA 3OSPA 4QR0A 4RW7B 1NK5A 4ZHRB 1REVB 1WJ9A 1X5PA 1HA1A 2ZBPA 1EX8A 3L09A 3QFWA 5D0RA 1NBEB 3NGSA 4OX9J 4X64J 3KHHA 1RISA 4RW7A 4ZHRA 1REVA 1V3ZA 4DLEA 3J81Y 4IKAA 2IVFB 3OL8A 2Z4PA 2IY5B 3PO5A 1PJ7A 3ILIA 3DHXA 3CEDA 4NCBA 2Z0GA 3GU0A 4USHA 2VZ9A 4L3NA 4USMA 4WF9Q 4DSLA 5LSOA 4K4TA 2VOOA 4J9LA 4ITSA 3TANA 5ETRA 3W61A 4OYIA 4W90B 2VPWB 3KLGB 2XS5A 2YKQA 1X5TA 5D15A 2J8SA 1QJHA 4FDFA 3KLGA 4F4AA 2VASA 4X65F 3LPYA 3ZZTA 2GQCA 2CQBA 2LA4A 2K3IA 1N5YB 1NSKL 3CB4A 4OX6A 1NKEA 3PRVA 2LVWA 2FPHX 3R5AA 4IOAQ 2R7UA 1P6TA 4CO4A 1UMJA 3ZTQA 4FNIA 1AT1B 1N5YA 2V50A 3MURP 1SB6A 2GMHA 3CJSA 2JLFA 2IRYA 2FVSA 2XCPA 5D8HB 4PXDA 1HYSB 4R5PB 1VRUB 5CQGA 3MD1A 3J7Z5 4QR2A 1CVJA 1FNMA 5F3ZA 2OEJA 2YBVA 2YH0A 1HQUB 4H4KA 1QLNA 4R5PA 1HYSA 1VRUA 3UWTA 1H74A 4NA2A 3GQCA 2VV5A 1O0PA 2G0CA 2C3PA 5E41A 5ETNA 1HQUA 1IKVB 4DCPB 2MQOA 3RAMA 1YRTA 3F44A 3DKDA 5HROB 3PW7A 2HFSA 2N3OA 1FDNA 4DSJA 1IKVA 4LSNB 3RBDA 3THPA 1V6HA 1HNZJ 3VAGA 5KG4A 1HPZB 5HROA 2KRBA 5GAGU 1XC9A 3R6LB 4N56A 2VG5B 1H7XA 1FRMA 4LSNA 1WF1A 1KHVA 3HSJA 2KG1A 3SI8A 3JSMB 4ETZA 1HPZA 2JHEA 2QE5A 1TKZB 2I8EA 3PKMA 4I2QB 1XNRF 2VG5A 1NH8A 3ZZZA 1RBAA 1T0TV 3JSMA 2ABYA 4L72B 4AL5A 1SIWB 1TKZA 1RTDB 4F7VA 4DL2A 4I2QA 1M5KC 2P6SA 1V5VA 3N5FA 2IYGA 3D6HB 3BGRB 4DPUA 4J9SA 3MTKA 3JQKA 2A1BA 1RTDA 1T95A 1EP4B 3G8QA 2NYHA 2H5IB 3QGHA 2GX8A 1PYSB 2OSQA 3BGRA 4FF3A 5GADI 1N5VA 2OPSB 2AMCB 4NI2B 3K2YA 3QRPA 3PACA 1RWXB 2L9DA 3PR5B 2XLKA 1EP4A 1PBUA 4M5NA 2IJNA 1NDCA 4RUHA 2M52A 3FCHA 4KJIA 5AXMA 2OPSA 3G82B 2ZBCA 1HL6A 2QLFB 4NI2A 5K8MA 3FK4A 2NZCA 2JC1A 2MHNA 1HNXJ 1VQSA 4LF2A 3D1OA 5KT3A 4K2XA 4PWDB 3G82A 1I94J 2B3TB 4RUBA 2NPFA 3KJVB 4YHHJ 2HQFA 4ANDA 4YQWA 1R31A 1WHYA 1WOOA 1AW0A 2FGOA 5T14A 4QYZJ 3VCDA 2LQBA 2ZJQQ 3SFGA 1QVFR 4PWDA 3KJVA 4DHVA 2AQ4A 5F8GA 2F9JA 3ZTSA 2ZM6J 3WC0A 1B99A 1Y5IB 2QG9B 2DNMA 1HNWJ 4B3TF 4NLSA 3CCWA 4YY3F 2GVZB 2CYYA 2QTWA 3I32A 4QIWD 3C15B 5IT9Y 4A48A 3UN5A 4CLLA 5G4DA 2W1BA 4DR1F 2GVZA 2C22A 5DJBA 4USVA 1JLGB 3C15A 1WC3A 1WF0A 4K50A 4FYXB 1LV5A 5L38A 2G0JA 3MCMA 4Q2LA 5I4MA 2CQ0A 3T5JA 2RT3A 4HI1A 1JLGA 3R5DA 2QEXS 4ERDA 2ZHAA 3NG8A 3Q8VA 3F0NA 4JYAJ 1OS5A 4ZDNA 2N3LA 5DDPC 4CT8A 2FVCA 4LBHA 2XYPB 3IO1A 3UVJB 5A8WB 1YJUA 3QJPA 1QVGR 4USKA 1S99A 4K5RA 2YNHB 4ALZA 4DU7A 3MF5A 5IV4A 2OPPB 2C42A 4I6AA 3UVJA 5A8WA 2C2OB 4NZ7A 4LF5F 3LUYA 4U8YA 2IJRA 4JV5F 4LF9F 3H42A 2OD4A 2YNHA 1FK9B 2OPPA 3OFFA 1W25A 5KG5A 4GMKA 3V6HA 2QLJB 4DX7A 1QUPA 1N34J 2I9SA 3N9UC 1CJKB 2YNGB 4TQSA 1FK9A 1DHMA 2L9WA 1U0SA 2XULA 4HT7A 4ECWA 1AUDA 2JEFA 4NRTA 2IBKA 1CJKA 2YNGA 4HHUA 5SZTA 2V2VA 3ENWA 4K4ZA 2BXJA 1VQ5S 2AYEA 3DC2A 3KUGA 3TOQA 4ICLB 4ZA1A 4BBYA 2ZWPA 3HSZA 2UXDJ 1XMQF 2HK2A 2H54B 1ZAWA 2B4PA 1VGYA 4ICLA 1TFYA 2GZOA 1N88A 1DQAA 1Q53A 2QL5B 1SKRA 1U1MA 4O3QA 3VF0B 2ASJA 2J0QD 4D3HA 4LF7F 2O01C 1IXKA 1RTZA 2MSTA 2HFUA 1FFSB 4OHWA 5IWAJ 1HARA 3DRSB 4KGZB 4BWMA 1ZOTA 2NYIA 3TYTA 3HD1A 4TYAA 1PCAA 5D78A 1X4BA 2AJFE 3WX8A 3LA0A 2HBZB 2A0FB 2F3JA 3DDNA 3DRSA 5GMDA 1RU1A 3KXDA 3T1YF 4LF8J 2BJDA 1XN9A 2HW3A 2X3GA 1N48A 2FJXA 1NB2A 3PW4A 4MTPA 2A6OA 3LGHA 5HMZA 2ALZA 1WI8A 2XO6A 1Q5VA 2CJYB 5D4OA 4WE1B 1WSRA 3FQLA 5M2PA 3KLEB 5GADU 9ATCB 4CLYA 4NLRA 2IBOA 2KFYA 1VQMS 2OUGA 1TL5A 1EQ0A 1WC0A 5F8NA 2ILZA 3C6TB 1LKZA 4WE1A 2JWNA 1SL1A 4FYWB 3KLEA 5DG9A 4OZ2A 5C42B 3UDLA 4P6QA 4K5SA 4QBUA 2JLEA 5DGAA 5KFRA 3W9IA 4W92B 5IV3A 3ZNUA 3C6TA 5KT6A 4C48A 4B9SA 1NJWA 1VQNS 1FCAA 5C42A 2E9TA 2MLZA 1M5SA 1CBKA 2KO1A 3GP9A 3OV7A 1CQNA 2AEJA 2EC2A 4ZVHA 3SCIE 2H4YB 2O1PA 3I9V9 4WFNQ 5ETQA 2ZZMA 2ZBRA 4BCAA 3ZZUA 3QFHA 4MYTA 3ISNC 3CJQA 2JVOA 4ETXA 4DS5A 2ATLA 5GAHI 5EGYA 4DUYF 2JEJA 2WVCA 2KTQA 1VISA 2RH3A 3PHEA 4RU9A 2CNOB 1B7FA 3RR8A 4OYAA 4ZCIA 1NK7A 4M1KA 3J7ZT 1KLMB 1TUVA 3SCJE 5FD1A 4UOCA 1RDRA 1HLWA 3OTOF 3J7A1 3RTVA 4LRAA 1NM2A 1VBKA 4DR3J 4NLWA 5IZHA 1KLMA 4WIIA 1UETA 3HFVA 3NNCA 5ETTA 5AT1B 4B3OB 1W7WA 3CCES 1UWBB 3PCOB 1O5JA 4GO5X 4J9UE 2CA9A 1DRZA 1OIAA 3CUNA 3U7JA 4AQYF 1GH8A 5L8RC 5LMUF 2YX1A 1QE1B 4B3OA 2MJNA 3GFZA 1UWBA 4PEOA 3IGVA 2C2ZB 2LXFA 2NSBA 5F3TA 1S0VA 3RRGA 1QE1A 3M6XA 4NYPA 3M2VB 1NU4A 2BM0A 3LW5C 2G1HA 3PJXA 4A4JA 1LWEB 2EEYA 1UPPA 1RTIB 3IAM9 4CO0A 4LFBF 2QMUB 1JJHA 2K7KA 2QC3A 3M2VA 4MKYA 3QJJA 1LWEA 1Z4UA 4YS2A 1RTIA 3TZZA 4WXWA 2GJFA 3P96A 3D2WA 3H2LA 2BRLA 3ILJA 3CJ2A 2DRBA 2JOQA 4CWBA 1U6FA 4NLOA 4DV3F 4ZKAA 2XLIA 4NEYA 3VGSA 2O67A 4ZPBA 4C9DA 3EE3A 1UFKA 1X4HA 2HVHA 2FYXA 4Y0FA 2K3KA 2F65A 2K1RB 4IG0B 1F5CA 4ZK7M 3QRQA 4OI0A 2CJQA 1KVIA 3D3CJ 4OZ3A 3MR2A 1IBLJ 1RTJB 3HHNB 2PFFB 1IJEB 4AE5A 3VQTA 2DITA 2RU9A 4ZCLA 2K1RA 4IG0A 2FGCA 1LW0B 1FEHA 1DY3A 1M90T 3PKYA 1JJCB 2Z2ZA 3CJKB 4G1IA 1RTJA 2XWXA 3UW1A 3B54A 4DDFA 4ZVQB 4C8ZA 4DEZA 5HMYA 2LDIA 1LW0A 4M5IA 3CJKA 1FWKA 3G96A 1S6PB 1SH3A 3MR5A 4N76A 4DR4J 3V5RA 2H1YA 2M8DB 1VQOS 2GO9A 2AV5A 4JUZA 3LQVA 3OJSA 1ZZFA 2NXEA 1S6PA 3SBMA 1FX4A 1VC5A 2X7IA 3BN4A 2KM8C 2FY1A 4ILRA 3D0IE 3FUYA 2WOMB 5F8JA 1U48A 4C8MA 2Q1LA 5CYJA 3KMSA 3OTDA 1NKBA 4IO1A 1RCXB 2QT7A 1FRHA 1UCNA 4C97A 2WOMA 2E9RX 5JVGQ 1IUJA 3VWSA 1OY6A 2D3ZA 1G3OA 4BLGA 2AD9A 3G71S 3PR4A 3DN9A 3U27A 1B0PA 3E8OA 2V9WA 2I38A 3AXMA 3I87A 4UZCA 4J9OA 2R9LA 3TARA 1OQ3A 1Q0NA 1UW9A 1SJFA 2VFRA 1KQSR 3PX6A 1TKTB 2KT2A 4AL7A 1BXNA 2VDHA 3TUPA 4LRCA 4URGA 1I51B 2WSCC 4U6PA 4X4NA 1OPIA 4ZJOA 3ZZYA 5ETVA 5DQIA 1TKTA 1HWKA 4RNNA 4Y2MA 4F26A 4PQUB 2EFOA 1K1QA 4EBDA 5GAHU 5CXTA 3VHQA 2LYVA 4I64A 5KT4A 3HZGA 3QAUA 1U1RA 4PQUA 2XMUA 3N0VA 5FLXU 4KYZA 4BWJA 3TZWA 1AFIA 5K8OA 2G13A 3R3TA 2FDNA 2RF2B 3OVAA 4I7FB 3QZ8A 1I5OB 1Y11A 2DEIA 1RKIA 4LVNP 2J76E 2XMTA 2ADBA 3QPIA 2RF2A 4I7FA 4JI4J 2H9ZA 1VRQC 2ZKUA 4MKVA 1XR7A 5DGBA 3TA1A 4QWCA 4KSEB 2ATCB 2EFGA 3G9CA 2M0GB 2DBBA 4DSIA 2HIYA 3D0HE 4FKYA 5F8MA 2PMWA 4A46A 1UWAA 2G2YA 3PNIA 2N4DA 2ZVIA 3OW2R 3P3DA 4C98A 4CLZA 2HYIB 2RAQA 4XDDA 3K5LA 3RB3A 3BSCA 1QY7A 2HVEA 1R7IA 3MHYA 2V34A 1N8RT 1FJGF 4DR6J 4WXOA 3TQEA 4NLYA 3T6BA 3BSOA 2WB1D 4PYDA 1QSSA 3AFGA 1HNIB 3ILOA 3CJ3A 1X31C 1N33J 5ETPA 2W7OA 2WB4A 1HIYA 1U6ZA 2B9XA 3AODA 1NDKA 5KAKA 4TXSA 3MCNA 1HNIA 1RT6B 2HKEA 2CG4A 3OVSA 4ZP9A 2VBXA 3MI7X 1OMSA 3VAIA 3OXGA 2GVDB 1R0CB 1RT6A 5L1JA 4XDCA 2XM3A 4ILLA 2RNEA 2GVDA 2PEHA 2VU5A 1KSPA 4URQU 1YG0A 1P8GA 4Y34A 1YGYA 1NSPA 3R1LA 3R7BB 4F0HA 1EAYC 4TU8A 3TUZC 5CA5A 2V8VA 2KKHA 5HO4A 3V6JA 3W8GA 3UD4P 3BH7B 1N36F 1EZZB 2W2NP 5HJYA 4X4RA 4R8UB 4PR6A 3SCLE 5HQMA 4DSKA 2QX0A 1CC7A 4K2JA 1HD1A 3OT9A 2MGZB 3K0JA 1JLAB 4R8UA 4LREA 3T5LA 2C2EA 2ZUAA 4I56A 1ZS6A 4UF4A 2CADA 2MLXA 4YY3J 2M3DA 2MGZA 1JLAA 1FJ7A 1NRKA 4KE5A 1GEHA 3D4JA 1TKXB 4U8VA 3IM8A 1NCLA 2RVJA 1HWUA 1T02A 4DR1J 2UUCF 3DI6B 1VS3A 1JLCB 2O66A 1TKXA 2MQLA 3TJ9A 2PA8D 3A3NB 4DBQA 2WW4A 2FHJD 1GXTA 1DAXA 3DI6A 1NKCA 1JLCA 3FEZA 3DRRB 2E5JA 2V8GA 1N6QB 1D9FA 1VBYA 2DGUA 1L3VA 5LL6d 4NE9C 3ZTOA 1I6JA 4DF8A 4C8LA 2BM1A 3IR6B 1U25A 4JP8A 2Z57B 4JI7F 4F4YA 3DRRA 4U9RA 1N6QA 4Q8EA 1Q82T 2MYFA 3BS9A 1UL3A 2J8AA 4CLTA 1WKJA 2FC8A 3PEJA 4JV5J 3MMBB 1X4CA 3NS7B 4LF1A 3DNCA 2DNRA 3FKBA 1H2VZ 4FS1A 4QWAA 4NCAA 2NCKL 3CCMS 4B9TA 3MMBA 4ZP6A 1UP1A 1FWPA 4UOFA 1M5OC 2MPUA 2HBRB 3UO0A 3RBEA 3CJ8A 2NLWA 2JL9A 1KWMA 2RKIB 1YSJA 1CEZA 4QYRA 1K73T 1S49A 8ATCB 4B3SJ 2XLJA 5KFVA 4HYKA 2KT3A 2ROEA 4NA1A 3CPWR 1NO8A 1Z1ZA 2BJ3A 4G65A 2RKIA 2UV8A 3AB4B 1K47A 4ZVOB 3DMJB 1YLXA 3MUVP 1S4EA 2XTJP 1TL3B 3QJLA 2MZTA 5FLXY 2HHWA 1DARA 1NZ8A 2VQEF 4FZVA 4QW9A 2FVPA 1PJ6A 3TJAA 3M30B 1RTHB 3R97A 4CTAB 1Y3KA 2GAGC 2AIRB 3DMJA 5CCLA 5J1PA 2D41A 2DNHA 1TL3A 1S10A 4FXWA 1X7VA 4LF7J 1GMVA 3M30A 4DV2F 1RTHA 4CTAA 2A2CA 1UVLA 3IFEA 4NXNF 3RB0A 3BKUA 3HFZB 4XPEA 5JMNA 1NHKL 1D1UA 2RRBA 4KH0B 3HX9A 1J27A 4RW8B 2YPZA 4NRUA 1SUQB 1J5EF 1IKWB 4USJC 2I5JB 1S0NA 4DXLA 3TVYA 3DHWC 2R7OA 4LF6F 4RW8A 1B64A 2PEBA 1SUQA 1KOOA 1IKWA 2I5JA 3QGGA 3CE8A 2UXBF 4ZPVR 5E3PA 4QR1A 2WBMA 5A2QU 1R8CA 2VG6B 1VR6A 4HTIA 2HZAA 3NS6A 1D09B 3IBCB 2HURA 3W7BA 4HHHA 1KFDA 1YRXA 3M8RA 2U1AA 1SC6A 1TAUA 1T11A 2RS2A 2A6MA 2VG6A 5F0WA 2F8HA 3QSYB 4OYXA 4X4PA 4WZMA 2VBWA 1F3VA 1TMMA 3C3LA 2WVBA 1IR2A 4DCOB 2GA7A 2YKOA 2R2UA 1ZBTA 3SSQA 2CRLA 3C8YA 3HSDA 3EM1A 2ZJRQ 4Y2AA 2Y0SD 2DH9A 2E1MC 3DLBA 4IO9Q 2CJKA 2YTCA 4H4MB 3M8WA 3H2VE 3CJ4A 2C2KB 2M5YA 1C0UB 4DV7F 2BW2A 1WELA 1U2CA 3K8VA 4TY9A 3RUBL 7FD1A 3GG0A 4H4MA 4I1TA 2HGMA 4KY3A 4ZIWA 1C0UA 2IYIA 2K8GA 3I0SB 2HHQA 3GPAA 4CI0B 3I96A 3KLVA 2HQGA 3D1QA 5D0GA 2EBEA 1T9WA 3DGVA 2AJ0A 1QAXA 4QCLA 1K44A 4IFVB 2HHTA 3I0SA 2OSRA 2E66A 4PQAA 1S7HA 1MROB 1WEXA 5BJRA 2R2SA 3PX4A 4EUVA 4ECZA 2R7WA 1NJYA 1WOPA 1O6XA 4IFVA 2XNQA 3GJSB 4JI3J 1ZM4A 2VJUA 3AJ2A 4NWBA 3MCSA 4UW2A 3TNVA 2MKIA 2V2KA 4ZIVA 4ZOSA 3A8IA 4AQYJ 4FS2A 1OY9A 1FRXA 1MROA 1NH7A 3K5PA 4L6V3 3PZPA 4DFMA 4J37A 2AYMA 4TKTA 1CSJA 1UEUA 2BW7A 2OFGX 1PBAA 3RRKA 4OYPA 2DXFA 1YRUA 2EG2A 1XNQF 3C2PA 4ZVUB 4QWDA 2XGQA 1M5HA 1B70B 2PDAA 2KXNB 4DV5F 4B9LA 3R5BA 4DR5J 2V4JB 3H59A 3W3SA 2D1CA 2VBYA 4ED8A 4M63A 3G87A 3Q0AA 4OI4A 4JI6J 3L95X 4ENOA 1GMWD 2V4JA 1ELOA 4XO0A 3EGVA 4HH0A 2OELA 3P5TL 2XSFA 1NPRA 1UFLA 2GCFA 2F40A 5EUHA 1VYAA 1DURA 3ETMA 1VHFA 4KGKA 2MY8A 1URNA 4KPCA 2BKOA 4EFAC 1OWXA 2H51B 3NCPA 4A8YA 1IBMF 3B6BA 4Y00A 4Y2KA 4ECQA 1VMBA 4Z7YA 5DLFA 4N8OA 2VFUA 1FTCA 3M9NB 4OYBA 4QYZK 1JB0C 4L73A 1IBKJ 5KFOA 3KLFB 2MQNA 4EBEA 1M1GA 1MG7A 4DL5A 2OKQA 5F8HA 1PO6A 1NJIT 1ZPWX 3OXLA 5LXYA 3V6DB 3KLFA 4X66F 3AOBA 4EU0A 2PGCA 2PI5A 4B9UA 1RAJA 3SSSA 1H3DA 2V8PA 1T8EA 2FVQA 1Q5YA 3A12A 3GSIA 2CKWA 3V6DA 1FDDA 2BV3A 2V2ZA 2L41A 3OTBA 4KIAA 1FERA 2ASYA 2ZZTA 3MM8B 1PC4A 3TQ1A 2NS1B 5F41A 2J0WA 2W9CB 4ZPTR 2W2MP 4ZLPA 3RBXA 1RAAB 2B9EA 1ZA1B 3H98A 2ZEJA 3MM8A 1RWVB 3LAMA 5HAOA 1KTQA 2W9CA 5T7LB 3CCQS 3M6UA 1SCJB 4R0EA 2CJBA 4TLQA 1K9MT 1JNZB 1N54B 5B09A 2CVEA 3GR1A 3V81B 1VLYA 5T7LA 2GMJA 4P71A 1WC5A 4CZCA 2GJIA 3LGNA 1HBOB 4IOCQ 1TZ0A 2DEJA 2HHUA 3V81A 2QA2A 2W4PA 2OO4A 1HBOA 1F2HA 3CD0A 2XMJA 2HZCA 3R27A 1VC6A 4XIUA 2MB0B 2LEAA 4A47A 5D3GB 2PN6A 4TU9A 3SEOA 5A2QY 1F9HA 3D54A 1F5BA 1NHVA 1S6QB 2MJUA 2DGSA 1RT3B 5D3GA 2MKHA 2H5EA 4IR1A 4AUKA 3D28A 4ECRA 2M2BA 2DK2A 3WX4A 3SZ2A 2BOAA 1FEEA 3LP2B 1S6QA 2G2OA 1RT3A 5GMKa 1UPMB 5LM7E 5J2NB 1JMTA 2WTFA 2AYGA 1R6VA 3BGUA 3LOUA 1LOUA 1RLDA 4L3KA 2HNZB 1YKWA 3LP2A 3LP0B 2KN4A 3K7RA 1RWUA 3O44A 1RA7A 1UVMA 1WTBA 4C0OC 1ZAXA 5J2NA 1N56A 2IMOA 3AJDA 1UVKA 1TELA 2FVRA 2ZH8A 3EGZA 2HNZA 3LP0A 5KFAA 1TR0A 1D9AA 5AXNA 2DCLA 2QMXA 2DISA 1UFWA 4DSFA 3G6VA 3DRYA 2J9CA 2VDIA 1GXUA 4N5SA 3PJWA 4NYOA 2LEPA 2EI5A 2PFDA 3ILLA 3QIDA 4RBUA 3D0GE 2Y3YA 2RUGA 3I5CA 2B5JB 4Y28C 4RWWA 2DXEA 3BR9A 4PG8A 5D0EA 2DHXA 1T05B 1VQ8S 2B5JA 3TWZA 3DLKB 2VQFJ 3GLJA 3VAMA 3KK1B 2MHEA 2UVUA 1EHWA 1T05A 4IH6A 4QJVA 1VK8A 4PYAA 4V19X 3DLKA 1YI2S 3KK1A 5U47A 4P2XA 3BH6B 4ID5B 1RT2B 4DPWA 4WPAA 4QZVB 3BBCA 3TJ8A 2J0XA 4BS2A 4NMLA 4GKKJ 1Y7PA 3FDSA 3IP0A 3C46A 2C2DA 4OIXA 1FD2A 4ID5A 1RT2A 2ZJPQ 1UVJA 2G0IA 2IHR1 4RWXA 3PRBA 4DR7F 2EPIA 4DQSA 2HAIA 3EZOA 5KFZA 1URRA 4MT1A 1FXRA 3AT1B 3OBIA 3DLLQ 5KFSA 2AW0A 2KZZA 4H54A 3NGRA 3UPFA 3M2RB 9RUBA 2LECA 4C2MA 2WSEC 2B7BB 3U1MA 4UQTA 1M1HA 3U1NA 2UZAA 2VJVA 3DDKA 2WRMA 4NLUA 3FSXA 1N36J 2E5IA 2RSQA 2U2FA 2VC1A 4C3KA 2J9EA 3M2RA 2UP1A 3A8KA 4OI1A 4L74A 1SJRA 1Q8LA 4HEA9 1FWLA 3GJRB 3GTYX 1A9NB 2OFHX 2RQ4A 3PX0A 4KGVB 1YTYA 4B3MF 3MFIA 2QA4S 5DS7A 4MK9A 4W98A 2XMMA 4HTJA 2J6UA 2CQ4A 3J7YI 4X2BA 4WFXA 3PFOA 4QPTA 3Q8SB 3T1HJ 2YQ0A 3RG6A 4LQ3A 3BGLA 2V63A 1WI6A 1LK5A 1S1XB 4L75A 2UUCJ 3N6MA 1PC5A 4F3OA 2HG4A 3IBWA 1YJ7A 3KFWX 2MQQA 4LFCJ 1KVJA 1S1XA 3QRRA 2E1CA 3H5YA 2DR8A 3RAQA 3K17A 2DT9A 2DH7A 1H2UX 3DOMB 3ZO7A 5EX3A 1LW2B 3C16B 1IBCB 4Q8FA 1SH2A 4TU7A 2BKPA 5B08A 3U02A 1K8AT 3I4HX 3NMRA 3DOMA 1RCOB 2R7TA 2RIJA 3EXCX 1LW2A 4FNHA 3C16A 1Q8IA 1SJQA 2R7QA 4IFYB 1KP6A 1KTVA 1YJVA 5KFBA 3UCGA 4GKJJ 4P2SA 1SC4B 5KFXA 3PYGA 5EDWA 3O8WA 4MYUA 3EVWA 4IFYA 2KJWA 4IG3B 4DPXA 2RS8A 4ELTA 3PEHA 1PKUA 4JI8J 3C14B 3K8WA 3KHRA 2OP5A 2A10A 2OTJS 4X62F 3EZUA 3LO3A 4IG3A 4P9SA 4U96A 3S7RA 5LOQA 4F02A 3MXHP 3QO9B 3T41A 1HHTP 3FCVA 4NYZA 3C14A 4PAAA 2HS0A 3KJQB 3RU0A 3CDEA 4R25A 2BDPA 1U1QA 4JV1A 5DZ6A 1LNQA 3DU5A 3QO9A 5DM6Q 1X5SA 3F56A 3CC2S 4UY8T 1WEZA 1EQMA 3MUMP 1WEYA 4K59A 2LDYA 1R43A 3GCWP 2FZGB 2X51A 1IQZA 3BKFA 3HT0A 4ZVTB 4WIQA 2Z2MA 3V4MA 4DV4J 2VFTA 2ZVSA 2EK6A 1RYSA 4F2SA 5KFPA 4DWIA 1L3KA 1AXQA 2OEKA 3R1HA 1X60A 2E1AA 2E44A 4CO3A 3EGWB 1H7WA 3CCVS 5E5NA 2EFQA 3MEEB 3R8YA 3KG1A 3CXCR 2IC3B 2YWKA 4LF6J 4KO0B 1RI7A 3MEEA 2QO3A 4ZPWR 4N7TA 2IC3A 4ED1A 4KHPJ 1MMLA 2ZE2B 3CCLS 3FZBA 2J7UA 4KO0A 4X4OA 4FBUA 3W63A 2X3DA 4K4WA 3OXFA 2HGNA 4IH7A 2ZE2A 4OZ5A 2BA9A 2NQPA 3W60A 3HDSA 5C2GA 4RNOA 1U45A 4O3SA 1RYRA 2FHKA 1S79A 4QOTA 3JTOA 2JVRA 3BO4A 5HI7A 6FDRA 3R6GB 4MFBB 3K5NA 4O0NA 3S01A 3G2XA 4ZVGA 2DR7A 3ZZOA 2R7XA 5LT5A 3IMQJ 4ZPAA 4MFBA 4QIGA 4DV7J 1XMOF 5FJ4A 1FRJA 1VQ4S 2HVIA 2BYCA 1SV5B 3KWMA 3J7YU 3THVA 4LFAF 1X8DA 4DL0C 3SCKE 5DQHA 3QT7A 2YNFB 5BR8F 2B4VA 3CCJS 2GIRA 5AE2A 3MPUB 4RUCA 1SV5A 2BE7D 1P27B 3MOZA 3FC9A 2XNRA 2W2PP 2P9CA 4CLSA 1NDLA 2UUAJ 2YNFA 1CS4B 2N82B 2BJ1A 7AT1B 5D6GA 1X9WA 2B7CB 2C3OA 4HHJA 3MPYA 4B08A 3DLGB 2QRRA 4DN9A 3NEKA 2VF3A 3ONQA 2CQ3A 1CG2A 4QU6A 1CS4A 2EVZA 3N5BA 3DLGA 3VAKA 1ZH5A 2ZH7A 2KDOA 4IQMA 2RQCA 2LQ9A 2F5GA 4CLKA 4FF1A 4OJHA 4KR0B 3VQSA 2AT1B 5EWGA 5LSLA 3W64A 4ZN1A 1VHIA 3R2DJ 5I3PA 3DXSX 2XS7A 5H9FJ 1IN0A 1U1LA 2Q6CA 1F9EB 1RGVA 2BABA 1J5OB 3H5SA 4E8UA 4CQ1A 2AGPA 3Q8RB 4DJBA 2PT0A 1FJEB 4QU7A 2IAJB 2R4FA 1LFPA 3QGPA 1BE4A 1RZMA 2CAJA 2DRDA 1J5OA 1NJXA 3BO3A 3HI9A 1IVZA 2HS3A 2QLWA 1IWGA 1RBOB 2IAJA 3Q24A 2IVYA 3MUTP 3UFCX 3RJMB 1U1KA 3GR0A 1RK8A 3BYPA 2B9WA 3H25A 4RPFA 4LF4J 4QW8A 1TQLA 2HHPA 4M5GA 3A13A 4FKXA 4GO7X 2UUBF 2Y0BB 3RGIA 4ID8A 1TK8A 4CNZA 1G4CA 2M9KA 2H5JB 1NNDA 1JK9B 3M9OB 1TUGB 3CCZA 3HJVA 1FJCA 3G6ES 3TZXA 4X66J 1UJ4A 5L9NA 3M8SA 3TO8A 3HHLD 2KL8A 1S57A 2XQCA 5B0BA 2N4CA 2Y1LB 2HBQB 4USUA 4PZVA 4WK1A 5E33A 4X64F 2YWHA 1RHMB 4RNHA 1K0VA 2NR0A 3IA0A 1T03B 3GFYA 4C8OA 1RA6A 1ZM2A 3PRDA 2CPIA 1S9FA 4CIOA 3HHEA 5ETSA 2D69A 2OIHA 1BLUA 2C3YA 2CWKA 2KRRA 1T03A 4CM2A 3H40A 4X84A 1ZETA 2JLGA 3JQJA 3PVXA 4J7CA 5CH7B 4ECYA 1M5PC 5ETLA 4KQZA 3PW2A 2J6TA 2Q3PA 1KS2A 3CCTA 2X1AA 4BHQA 1WF2A 1H72C 4LVOP 3SMZA 1CLFA 3MMCB 2CDQA 2G9OA 3GIKA 1SBRA 1JX4A 3I6PA 5E3CA 2YX4A 1VQPS 1BQXA 3M8QB 3MMCA 5DM7Q 1TK5A 1OJ4A 2YKNB 4OX8A 1JKHB 2CPZA 2DB1A 2WVFA 2D9OA 3HLUA 1KFSA 4KHRA 3I82A 3ULHA 4IR9A 4C3MA 4DN0A 3L7PA 3EMTA 3M8QA 4CRJA 3K5OA 2YKNA 1JKHA 3FBBA 2MMYA 4HVZA 2A18A 2AJ2A 3QT6A 2DKOB 3NGTA 4DFPA 1ITPA 3LF0A 1CJUB 2LP4A 4NASA 3MPDA 3UD3P 2HWTA 2ZH6A 1LQ9A 2ACYA 2VFSA 2F4VJ 3HKZD 2MZ1A 4OHVA 1CJUA 1YIJS 3MM7B 2R8HA 2XO7A 3KHGA 4LRDA 2FJVA 4YFUA 3NNHA 1OYEA 2CQDA 3L4BC 4G1PA 1EB0A 5DRKA 3UN3A 2OJ3A 1QUVA 1Y9OA 2YKPA 3MM7A 4USTA 1DTTB 2GHPA 2H65B 4A8SA 1JLQB 8AT1B 1A6LA 1C0TB 3PW0A 3CMQA 5K20B 4O3RA 4KAIA 4WP9A 2DNZA 3E01B 2VA3A 4B9NA 1U49A 4DUZF 4K8RA 1DTTA 5KFWA 4OV6A 4WBFA 1JLQA 1ROFA 1LFWA 2HHSA 1C0TA 3MPVA 1QD1A 5DO2A 3OSNA 1IKYB 2JRSA 3E01A 5LJ3Y 5E7OB 2MZRA 2ROGA 5FDLB 5L9XA 2WBRA 4O3PA 5F8IA 1Q7LB 4KKOB 4HL9A 4LIRA 4DZ6A 3MAAB 3VGUA 1APSA 1IKYA 1FHTA 3ENQA 1SH0A 3ETOA 2M70A 5HATA 4YUDA 5FDLA 5G0RB 3NCRA 4YN3B 2XI2A 4M8LA 4RJVA 4KKOA 4OZ0A 2LU1A 1Y0HA 4M5DB 5AJ3J 4WKRA 4QWBA 5IC4B 3MAAA 3I56S 4KH1B 5AXKA 1VQ6S 1N32J 2IA0A 3B82A 4FVMA 2E5LJ 3ENAA 5G0RA 3M8PB 4ZLLA 1CC8A 2KHCA 2AJ4A 3CCSS 2E9ZA 2GS8A 2QYCA 4M5DA 4W4MA 4O44B 3D5MA 3KUEA 1S1VB 4WU3A 4ZVEA 4DL6A 1SJ3P 1KOHA 4JI1J 3M8PA 4ECVA 3RW6A 4NLGA 2VUGA 2AEMA 2FLNA 3TA0A 3H0PA 4O44A 5ADZA 1S1VA 3M8ZA 4U7UK 3EPGA 2ZBIA 3L3CA 3LH2S 1HI0P 4X4UA 3FQKA 4DR7J 5CZXA 3V4IB 3OPKA 3I5BA 3TZYA 1HNXF 1FFGB 4F4KA 4CH0S 1TL4A 3MECB 1I94F 1SKUB 4WFYA 3UR0A 3V4IA 4M94A 3MFHA 2HAFA 4OYWA 5C7PA 1Q78A 2QA4G 2IM2A 2XS2A 3MECA 3T9NA 4P73A 3LGMA 3QBCA 2RHQB 2UXCF 2DY9A 4WYWA 4OYZA 4BDPA 4QWEA 1HNWF 1R8AA 5K8NA 4DFKA 2MKYA 4ER8A 5E0OA 2KXFA 2DYAA 4ZLJA 4B3MJ 3GB0A 2DGTA 1Y5LB 2J7WA 4P2FA 3FGVA 2YWWA 1SL2A 1H98A 4AD6A 2ZH5A 3N6NA 4PRFA 4WYLA 4YP3A 3D9BA 3NXZA 2ASLA 1W2BR 2UUWA 5CZVA 3AH6A 1TAQA 1JJ4A 4K4SA 3US5A 1UKUA 4JYAF 2PO4A 4O4RA 2BKNA 4JOUA 2LCWA 4J9RA 1RAOA 4ELUA 2V0NA 1B0TA 3JTNA 2IPOB 3H90A 2OEMA 3TVZA 1FRIA 1S6OA 1MLAA 2DO4A 1ZTWA 1S0OA 2D9PA 4FYVB 1RWKB 1ZAVA 1Q16B 4J9MA 5HMXA 4RUAA 1WORA 2Z58B 5K14B 4A8FA 1N34F 5H9EJ 1SQFA 3OHAA 5MLCV 2NZ4A 6FD1A 1EARA 3N4WA 5K14A 1D9DA 2EW9A 3OVBA 3K89A 2AP6A 4Q7AA 2CDRB 2O5DA 3DFEA 1JXLA 3DRXA 3E3XA 1PILA 1VK3A 4OI3A 3W5XA 3BSNA 2LQ8A 3SFUA 2UXDF 4P7VA 2QN6B 1PAUB 1T7PA 4B9MA 3BBFA 3QGIA 1N5TA 4HLBA 3NOGA 4WCEQ 1HR0F 2W7PA 4P7TA 5K9FA 1G1XA 1RT1B 4HI2A 2HQIA 2Z30B 5IXUA 4B3RF 1HD0A 3NKYA 4TLRA 3OLAA 5IWAF 1FT8A 3UR3C 4DX8H 4R0JA 1VCTA 2CPXA 4DV6F 4EEYA 4MIBA 1RT1A 4ATNA 3J80U 1Q7YT 4QPXA 2IRXA 3A8JA 3BQ1A 1MN7A 3HSGA 2AF6A 5I3UB 1KDNA 1R89A 4LF8F 2XB2D 4EYHB 4AFFA 1NSQA 1F0XA 2FLPA 3NCQA 1Y10A 3P8BB 5I3UA 5A8RB 2CPYA 4ZPDA 4NLPA 4HKQA 3FBEA 3GJTB 1VOMA 3KLIB 1UTAA 4YR2A 2R8IA 1CQMA 1NK0A 1WG4A 1N0VC 5A8RA 1TL1B 1WG1A 1HI8A 3KTQA 2QA1A 4NXMJ 4P75A 3KLIA 5C25B 3B8HA 5HQ8A 4RNFA 3NOCA 4WFBQ 4FXDA 1TL1A 2DNPA 4B02A 1GX5A 2DIUA 2FIUA 3TEHB 4CLPA 4I2PB 2CWXA 1BQMB 5C25A 5B0CA 2AHOB 2XGPA 4GRSA 3OTEA 5MAOA 1SL0A 1KLNA 3CDUA 2LXIA 5HVGA 2F7VA 3FBCA 2HQCA 2KVIA 4ED5A 1T9VA 3VGTA 4I2PA 1BQMA 5HLFB 2ZOGA 3RW7A 3VAJA 2BOPA 4KV8B 2E1RA 3CVKA 1SC1B 3OD2A 1WTFA 4A8WA 1X4GA 3KLHB 3JSBA 4EO8A 4N41A 1GQEA 2ZZNA 5KOXA 3SV4A 1IM6A 3LPEA 3CIMA 5HLFA 1RJJA 1RADB 2IDLA 2CQ1A 1T3NA 2DR6A 4FYYB 4KV8A 4OZJA 1S4FA 2VOPA 3KLHA 3OQ2A 4IOBA 2L48A 4JI2J 4OFZA 4ZLNA 1VDHA 2EKNA 4LSLB 4RNMA 3L7UA 2QLXA 2AYBA 2DR9A 4WFAQ 1T9TA 2BVZA 1P9YA 4ED7A 5CAAA 5BR8J 3DLHA 2VB6A 2YKMB 1GK8A 4LSLA 3DLEB 3WDOA 5HVHA 4DV0J 3BQ0A 2MXYA 3GYNA 1FDBA 3T6JA 5KG0A 3CCRS 1B3TA 3MR7A 2YKMA 2YH1A 3DLEA 2XMAA 3EYZA 2D3OR 3EVOA 2GW8A 1R3NA 1LK7A 2DNQA 3VR1A 3AQPA 1RT7B 5J1EB 4OJ3A 2L3MA 2AX0A 7FDRA 2GMLA 4CCHA 4CT9A 2CPDA 1X0PA 4PG5A 3NGKA 4UOHA 5DG8A 1RT7A 3IWNC 2JX2A 3BV8A 5J1EA 1FF2A 4YMEA 3CC4S 3BREA 1Y00A 3HKWA 3T5HA 2AEFA 4PG4A 2ZNZA 4F04B 3MMJA 1RUSA 2PIIA 1SJ4P 5A6WA 4WP8A 2ZH4A 1L3TA 3CDWA 2FLOA 3QWUA 1U2FA 2ADCA 4E0DA 5IQQA 3H4DA 2CZVC 3QQCD 2BZ2A 1GFWB 3PYEA 4KGMA 5LMNF 4AL6A 1X0FA 2OD6A 3OR1B 5JJBA 3IN5A 1GMUA 4PXEA 2ZOFA 2CFXA 3MEGB 3G86A 3DOKB 3VVTA 4M95A 4WTYA 2F63A 1T3OA 1S77D 1QAIA 3OR1A 5HL7Q 4EBCA 3MEGA 3VV2B 1Q81T 5KFYA 1FRKA 3DOKA 3BB5A 4J9QA 3PDNA 1XIQA 1DLOB 2UVVA 2ZUGA 3N6LA 1Q4RA 2CQGA 4DZDA 3TA2A 3C6UB 1U4BA 2G1DA 2XHCA 1WD6A 1WKKA 1DLOA 3BBBA 4X65J 1HKAA 5CABA 3DU6A 2AZ3A 4YDDB 3C6UA 5HK4A 1OSDA 1SKWA 4ED4A 3DM2B 1WC1A 3Q8PB 3LAKA 4EZ9A 5KFKA 4DR4F 1RT5B 5K5MA 3Q89A 3A3OB 3T9ZA 4OJ1A 4UQGA 1F60B 1C4AA 2NUUG 4J9VA 3SV3A 2FD2A 1OQ6A 3M05A 1HWJA 3DM2A 1YX2A 2E7WA 3D66A 3FNNA 1YVFA 1RT5A 2DIVA 1M0SA 5HVFA 1X4EA 1G6BA 1QTNB 4YOEA 5KTQA 3Q2SC 4LQ9A 1ZTTA 2RMLA 4MKAA 2B4OA 2BQUA 4FVCA 3BZQA 1WHVA 2QGFB 1XEZA 2GHVC 4UT4A 1RXOB 1WSVA 1KKHA 4LR7A 5KFEA 3J80Y 4KFBB 4USWA 3QYYA 3NAIA 1IJFB 1YJNS 5BYRA 1HW9A 2PA3A 4I67A 1UEKA 3HO1A 1WG5A 1FO1A 4C0HA 1BWVA 1YJWS 1PAEX 2JZ5A 2HVDA 2RU3A 4PXBA 3GCXP 1HNVB 4KFBA 4X4VA 1NK4A 2DGXA 1MWYA 1RWPB 2VA2A 2ZC4A 4CH1A 2DRAA 1UW4A 3I4PA 3IBFB 4LMZA 2ZWOA 1HNVA 3ICLA 3PTWA 1Q1KA 2W2OP 1G2EA 2FHOB 2XCAA 2B9YA 5DLGA 1HQEB 2DNYA 2LQJA 3Q8YA 2R7RA 2CJAA 2XHWA 3MCOA 1FNXH 1XNRJ 1JLBB 4Z37A 5H1SV 3G8TA 2QSFA 1YWXA 1HQEA 4CO5A 2P9EA 1YBTA 2ALYB 2CPJA 3EXYA 4ECUA 1ZYQA 4F3QA 1JIHA 2XSJB 1JLBA 1TK0A 2KT5A 3TW0A 5C5JA 2AKWB 2W8LA 4EMDA 1B0VA 3GSDA 5HBMB 2Y1IA 2XSJA 5IS2A 4ZVSB 4JI4F 2Y9HA 1S7IA 2W25A 3FSIA 1HI1A 2QL9B 1TUWA 1WWHA 4NLQA 5HBMA 1H73A 3T5KA 4C0BA 4M5HA 2GQQA 3MAQA 2HHXA 3KG0A 3VZIA 2FHJA 2IA6A 3CCUS 4NLVA 2Q66A 4DQRA 1RAGB 2Z56B 4DUZJ 1F9FA 1DFDA 3KJFB 1FFWB 4LRBA 3WC2A 2JDJA 5I42B 2NXNA 1VQLS 2ZHOA 3OTCA 4IRCA 2BUNA 2R42A 1WHWA 4DR6F 1WC4A 3O5TB 1F6TA 5I42A 1N33F 3FCWA 2CQIA 1SQEA 3KHLA 4B3TJ 2ZFHA 1JXEA 2DNKA 1XQIA 4UUXA 2HFVA 2RDDA 1YBUA 1U1PA 1D8ZA 2DH8A 3NRBA 2DGQA 3AD9C 1XBWA 3W9HA 2KB2A 4RBVA 2ZH2A 3MMAB 1QTMA 4FYDA 4CLWA 4IQXA 2SXLA 2DVIA 4I4BA 1FKAF 4EZ6A 4DPYA 3RB6A 3NGDA 3MMAA 2Q6BA 1AFJA 2ZDPA 5KT5A 2ZC3A 1HBMB 2MQPA 1TP7A 2CZ9A 5KOWA 2UU9F 4GC6A 1QAJA 2XY7A 3EDQB 2CQ2A 3ADAC 2DHHA 1HBMA 2ILYA 2DJWA 3M7VA 4WZQA 1U02A 3JSYA 1PSDA 4X4QA 4LF5J 4KPYA 4LF9J 2BJ8A 2ZHBA 2J6SA 4DL3A 4USIA 2VICA 3Q86A 2BEFA 2DY1A 2RRAA 1X9MA 4F67A 2UXCJ 4OI6A 3PFEA 3BPDA 2B51A 1FI4A 4ZCMA 4A8OA 2R8GA 4TN2A 2XZDB 1UZDA 3I9ZA 4CLFA 3OLBA 1VJWA 2RD5C 3EDRB 3RR7A 5IT4A 2CJ9A 1TMJA 2B43A 5HN0A 4V1Ak 1FXDA 1VC0A 3PJ9A 5B0EA 1KHWA 1U2RA 4DV1F 1U0HB 1H38A 1TV6B 2CPHA 3EPIA 3PO4A 2XI3A 3HK2A 2JH3A 1O51A 1XMQJ 2DGOA 3EWGA 1XR5A 1U0HA 2ACMA 3NGUA 4URSA 1ZA2B 5H9FK 4CDIA 1PG5B 1TV6A 1YJRA 1WC6A 4BC7A 2W4CA 4A8XA 2M7SA 2HHHF 2EC0A 3BJYA 2VH7A 2YXLA 3PM9A 6AT1B 1HWLA 1OO0B 4N47A 1H2TZ 3KKFA 4ECTA 5THWA 3W62A 2DNNA 2HIQA 4J90A 3M32B 1S97A 3T1YJ 1VQKS 3KUHA 2J9DA 1Y5NB 3ET6B 3W2WB 4BC9A 4ZP7A 3M32A 5BXIA 1HWIA 2Y1RI 3FSYA 4E2FB 3R9LA 5KT2A 2QIFA 2HFOA 1H0HB 2OI2A 5JVHQ 3KDOA 1BGXT 4K4YA 3W2WA 3ET6A 4B3SF 3MWBA 2R2TA 3Q8UA 4PCQA 2R8JA 3HFKA 4C8NA 2OMLA 2CJXB 1VFJA 2YY3A 1S5ZA 2R7SA 4MKBA 3JTPA 3FVYA 5HQLA 4TY8B 5T41A 1RAEB 4N8NA 2Q43A 4H4OB 4AT1B 1P9QC 4MIAA 1HR0J 4TY8A 4IH5A 4B3RJ 3IGNA 1U09A 4YEAA 4H4OA 3PHTA 5GVQA 2LFVA 2UVWA 1VI7A 2E7XA 2NXJA 2XZWA 2OH2A 3SSRA 4LRFA 2L08A 1M1KT 3Q22A 4DV6J 4L76A 4MIWA 4P72A 5KT7A 2EBGA 2EG1A 1SXLA 4DUYJ 2YQ3A 1MWZA 1CULB 3QLHB 2FJWA 2W9AA 4NMXA 2ROPA 4ZMMA 5KFNA 2DTJA 2GV1A 4ECXA 3OL9A 1CULA 3OTOJ 1GMWA 3QLHA 1L3UA 2KFNA 2KM8B 5L46A 2QZ8A 2WK4A 4Y6IA 3H20A 2HWHA 2MKCA 2E5GA 1UAWA 2V9KA 2MKSA 1FD8A 1REGX 4LIWA 3PIOQ 4ZITA 5LMUJ 3HHKA 3SIPB 3AJ1A 2FC9A 2UVRA 5L1LA 1S9GB 1N0UA 3I55S 3TEGA 2YX7A 3AY0A 1DZ5A 2JEIA 2LKZA 4DR2F 2WW8A 3AA9A 2CUYA 4I6YA 1HW8A 4YR0A 4XTTA 1L5UA 1NLKL 1S9GA 1EKRA 3D68A 3SQOP 3D1HA 3G4SS 2WONB 4KHMA 3IAS9 4LFBJ 5K8PA 4RBTA 4D3GA 3TAPA 1VQYA 1MSWD 1N5SA 4JI5F 2FJBB 2IIHA 2RDJA 2WONA 4OI2A 1T9YA 3DDIA 3NP5A 2ZBQA 3CULA 2BQ3A 2B0GA 3NL0A 2FJEB 1VIXA 2HRUA 1R27B 2QSWA 4LUBA 2R7VA 1S1TB 2OAUA 4DV3J 2V8HA 1KEKA 3UD5A 3ZZPA 1S72S 1UA0A 2LQ5A 4O3NA 1CJTB 3X1LB 4QIVA 1YZ6A 1P1LA 3IS9B 3MR6A 1UVNA 5EN1A 2J9DE 2B56A 1S1TA 3I31A 2VFVA 3HP6A 4WU2A 1CJTA 4JI3F 5E2QA 2W7AA 3P45B 4ZN3A 3IS9A 1LWFB 1VRTB 4FXVA 3OFEA 3FBFA 2P5VA 1JLFB 3KDNA 2FJDB 4J9NA 3GIMA 3TR5A 2G2ZA 2Y8YA 4KTQA 2LLZA 1UEVA 1LWFA 1VRTA 1Q79A 4U67Q 4M5LA 3CF5Q 2MZJA 1JLFA 3O6QA 3UDVA 1FKOB 5LJ5Y 4DQQA 1BMQB 1BQNB 3CW2C 4PABA 4DR5F 2E5HA 4OQJA 5F9LA 4OHXA 3ENVA 3QAEA 1FKOA 2B6AB 2M88A 1GXLA 3CMAS 2MKJA 4JI6F 2V4QA 2R3VA 1D0EA 1S6UA 1SKSA 1BQNA 4F0MA 5GMEA 5DQGA 2DNGA 2KHDA 1RE1B 3PIPQ 3BR8A 2B6AA 3OFGA 4HDGA 1RACB 2XMKA 2KXHA 5LMNJ 2NXUA 1Q8BA 3FEXB 2RDIA 2BJ9A 4UOGA 3V2UC 1Z2LA 5EX0A 4WK3A 2VKRA 2HRYA 4TVAB 3F73A 2H4WB 2B8QA 1EIYB 2BJEA 3MM5B 5EWEA 1LWXA 3E2EA 1M5VC 5CCMA 2MQ8A 1XTZA 4Y65A 1RP5A 2HS4A 4IYQA 3MM5A 1IBKF 5A6PA 1RU2A 2MEWA 1AUSL 3A3PB 3JAMU 3HF5A 3T19A 1UJ5A 3SQGB 2F4FA 4FN5A 3HHLC 2MDAA 3U1LA 5KFGA 2POKA 2GJ2A 2V6AA 4NZ0A 1A7GE 1RWMB 1FE4A 1VBZA 1WOSA 3SQGA 2QFJA 4F4ZA 4KT0C 1KRPA 1AROP 2C1EB 3D6TB 1B4SA 2W8KA 4J5OA 3DRPB 1ZPVA 3DCAA 1ZM3A 1FE0A 2CNNB 1LWCB 1O8BA 1C4CA 3DRPA 2KH9A 1S59A 2C3UA 4LBIA 4YB1P 3UN2A 2ERRA 3GIJA 1XK8A 4ZJQA 1LWCA 3BDPA 2C3MA 2J0SD 2MQMA 3GV7B 3HVRA 1RWOB 3IWXA 2D3O1 3DYAB 3SYZA 4FP9A 4NX9A 1N5QA 3W2VB 5KFCA 4PWUA 3HM9A 1G7CB 1YBAA 4JBCA 2EFPA 3EX7B 1MMDA 3S8SA 3A4TA 2P2CB 3NLCA 3NY0A 1MWQA 3DYAA 3RRHA 4F0KA 1GAOA 2B4UA 1F2GA 3W2VA 3BM7A 4RZRA 4CYUB 1V5IB 2IM1A 4EI2A 1KR4A 2Z2LA 4S0MA 1QSYA 5H9EK 3VTIA 1MN9A 4P74A 1Z2ZA 1ULRA 2VODA 3H7HB 4CYUA 2V8DA 1FJGJ 2NSCA 2D7SA 2HEKA 1VQ7S 2V5HG 3CT9A 4DS4A 1IKXB 3MD3A 1GNKA 1WKLA 1HQ2A 1QSLA 1FTRA 2KYZA 3HCXA 3HVAA 3OL7A 1MNEA 3DLJA 1BWEA 1RHQB 1BUXA 3BYRA 3MR3A 3IRXB 4P10A 1IKXA 1X4FA 4F25A 3ZC4A 1RSCA 4NA3A 3UNYA 1AB8A 3NMAA 1IWAA 1DJ0A 2HLUA 4DU8A 4IDKB 4UZBA 3IRXA 3FMBA 3WIUA 3EZ5A 1YITS 4IRKA 3FEYB 2LA6A 4ZP8A 4IDKA 3VVUA 4FPRA 2HMIB 2VPZB 2PE8A 1GT8A 3UDEA 2EFNA 1BC6A 4KRWA 1UZHA 2CVIA 5DDQC 1JWWA 2AWZA 1X4AA 5DDRC 4DI6A 4CP5A 2QV6A 2HMIA 1C1CB 1VIOA 4K7QA 3NWRA 1HBUB 1QDUB 2BQRA 1YK9A 1C1CA 3FZ2A 3J7AN 1HBUA 2JFKA 2K7JA 2VQFF 4O0IA 3K5MA 2XEXA 4LT6A 3IXQA 2IVMA 1U24A 2VPXB 2RILA 5EHHA 1JJ2R 3QNWB 2EFVA 2JEGA 1OY8A 2CQCA 2C2RA 4DQIA 2I6WA 1U8WA 2CG8A 2OMOA 4GKKF 3B78A 3NS5A 4NLTA 2PSZA 3C66A 2AZ1A 2UUTA 3AXKA 1RBLA 1HFEL 1N52B 3IM9A 2XZTB 2COLA 1DTQB 2BRKA 4DCJB 2OHDA 3Q83A 4DLGA 1KQKA 1DTQA 2UU9J 3NWGA 1KD1T 3GFXA 1SI9A 1GTEA 1T94A 4JI7J 2GGPB 3GWCA 2KI2A 1S0MA 3TX8A 4WTOB 2AGOA 1YQHA 3CGIA 4A8MP 1RHKB 1V9OA 2I1RA 2P6TA 1NSAA 2IFXA 2BANB 1KONA 4Y2IA 2GGPA 3IWLA 3KJNB 3NBPB 3TUIC 2GO8A 2MSSA 2WVEA 4ED3A 2PI4A 1DBDA 3RB4A 2BANA 1AYEA 5IFMA 4C6AA 4C3LA 3NBPA 2JFDA 1Y4ZB 3JAMY 3BF4A 4MK7A 5KFIA 3MM9B 3HULA 3BKTA 4WKYA 3T1HF 2AX1A 3EJMA 1JLEB 5KFQA 2DHSA 1TVRB 1Q8KA 3CTRA 3M8YA 4DV1J 2RQKA 3MM9A 2GIFA 1JLEA 4LFCF 3KK3B 1TVRA 3OR2B 2FQQB 1F5AA 3FMWA 3RYLA 1NHUA 2VQEJ 2HNDB 3AB2B 4C11B 4DPOA 3H2UB 2O3DA 3KK3A 1S9EB 2DD8S 3K59A 4RW6B 1D8YA 4G1QB 4LR8A 3OR2A 2HHHJ 2XWYA 1FDAA 1LXNA 1HHQA 2HNDA 4C11A 4DFJA 2DHGA 4JI0F 4DV2J 1UVIA 3KNGA 3P5BP 1S9EA 3GYXB 4RW6A 4NXNJ 1ZM9A 5A8KB 5ITHA 4OLPA 2VBZA 1DQ8A 4G1QA 3TAMB 4GKJF 3G6YA 2BX6A 1QM9A 1PIEA 3KG4A 3R7SB 4MK8A 2HLTA 4OYMA 1FXLA 5KFFA 2WCXA 3HVWA 2HPUA 5A8KA 1VLOA 2NPIA 2IJFA 3TAMA 3UCUP 3CNQP 4E98A 1NZAA 4F2RA 1J5EJ 2VC0A 4QIFA 1V3RA 5IC6B 5D4PA 1NK8A 2A3JA 4JI8F 2KU7A 5KFDA 2WAQD 3BGFA 3CD7A 4OZLA 1CJVB 2IRUA 4ANCA 2C28A 4KC5A 1YJTA 2XG8A 3QATA 2WVDA 2UXBJ 1CJVA 2L9NA 5F8LA 3M9MB 1SVDA 2OPQB 3HHDA 3TI0A 3BO2A 1BHNA 2ZH3A 3TP2A 4Q0BB 3D7SB 1ICEB 2GIQA 2RUSA 3POTB 1JQGA 4OZ1A 2IM0A 1Q86T 2OPQA 2LXUA 5J2PB 4Q0BA 4I68A 4DL4A 4DV4F 4OZNA 1S76D 3POTA 1MU2B 3ISZA 3RBZA 4ES2A 3TAQA 4RLEA 1FVQA 5J2PA 4YR3A 2BE9B 3A8EA 3B4MA 2A2DA 4RR5A 4A8KA 3CO0P 1FRLA 2V4RA 5RUBA 3OFHA 1MU2A 4HR2A 5E3RA 5L1IA 2HVZA 4OHZA 4EO6A 3ISND 1KNZA 4RU2A 4Q43A 4Y3CA 5L1KA 4DUTA 2OPRB 4U7UD 3I0RB 4F4WA 3L7OA 2MZSA 1UJ6A 2YWGA 1TFWA 4NEZA 1OYDA 2VD3A 1RT4B 1IM4A 5D4NA 2FUG9 4O4GB 4JB8B 4ZPCA 3GYGA 3FRZA 1FVSA 4CO2A 1N4LA 2OPRA 2DGWA 3GIRA 3I0RA 2JSXA 4KHPF 1RT4A 3D6FB 4XK8C 1RAFB 4O4GA 4UTGA 3S1TA 2HRTA 2AU0A 5IM0B 3LWMA 3GMGA 4RKUC 2V2QA 3HVTB 2FLLA 2J7KA 1NB7A 3QT8A 3EVMA 4NZ6A 4ZCKA 3DGPB 1EJ7L 5IM0A 5KG7A 4YDXA 2UV8G 1TU0B 4K0KF 3HVTA 5M2RA 1RHUB 3VAFA 3CDBA 3RAXA 2MKKA 1KBRA 1K0TA 4DR2J 1ZZNA 3DGPA 3DXBA 3FJ2A 3W65A 4RW9B 3HD2A 1XNQJ 3NAHA 4V19J 3CD5A 4Q45A 2YVSA 2Q79A 3ITHB 4DV5J 3EUNA 4I6WA 3HHLB 3WZ0A 4RW9A 1S1WB 3MTJA 4ZJLA 4F4XA 2V69A 4LJMA 3ZFVA 3V6KA 2DO0A 1XWLA 2H48B 4JI5J 3M1VB 4QIEA 3NNAA 3UE2A 3ITHA 2BACA 1XMBA 3B4DA 3HHLA 3AD7C 2V94A 2HWIA 2YWFA 2DHAA 1S1WA 3PG9A 3X3UA 5EWFA 4Y2CA 2YPYA 5KG1A 2YWEA 5SUHA 3M1VA 3PY8A 2QL7B 4M5KA 2ZITA 1NEEA 3GONA 4ED0A 5DDOC 3F41A 4B17A 3S6EA
chains in the Genus database with same CATH topology
4PXBA 3U1NA 2HW3A 1HNVB 2RQMA 2X3GA 2UZAA 4KFBA 1N48A 2FJXA 2UUAF 3DDKA 2WRMA 4NLUA 4DOZA 3FSXA 3PW4A 4X4VA 1NK4A 2E5IA 2RSQA 2U2FA 2VC1A 2DGXA 1MWYA 2VA2A 2ZC4A 4C3KA 4CH1A 2DRAA 2J9EA 3M2RA 3MEKA 4MTPA 5HMZA 1UW4A 2UP1A 2ALZA 3I4PA 4OI1A 1WI8A 3KK2B 2RRNA 4LMZA 1SJRA 1Q8LA 5D4OA 2D74B 4WE1B 1HNVA 3ICLA 4HEA9 3FQLA 2DGVA 1A9NB 5M2PA 3KLEB 2OFHX 2RQ4A 5F9NA 5GADU 1Q1KA 3PX0A 1G2EA 4NLRA 1YTYA 2IBOA 2FHOB 2KFYA 4B3MF 3MFIA 2W24A 2QA4S 2XCAA 3KK2A 1VQMS 5DS7A 4MK9A 2B9YA 4EGLA 1TL5A 1X5OA 2XMMA 4HTJA 5DLGA 5F8NA 2Y1JA 2ILZA 3C6TB 2J6UA 1LKZA 4WE1A 3OUYB 2JWNA 1HQEB 2CQ4A 1SL1A 3MM6B 2DNYA 2LQJA 3PXGa 3J7YI 1V3SA 2CJAA 3I5AA 3PFOA 4WFXA 5DG9A 3KLEA 5C42B 3OHBA 3UDLA 4QPTA 3SXLA 2GHWA 2XHWA 1FNXH 4P6QA 4K5SA 4QBUA 3Q8SB 2JLEA 1JLBB 5DGAA 5KFRA 4Z37A 5H1SV 1XERA 4W92B 4LQ3A 3G8TA 2QSFA 3BGLA 3C6TA 5KT6A 1WI6A 1YWXA 3OUYA 1LK5A 4B9SA 1HQEA 1NJZA 1S1XB 4CO5A 1NJWA 1VQNS 2P9EA 4DL7A 3MM6A 2CPJA 3EXYA 4ECUA 1ZYQA 3N6MA 1FCAA 1PC5A 5C42A 4F3OA 2E9TA 4F3QA 2HG4A 1JIHA 1M5SA 4KBIA 2XSJB 2KO1A 3IBWA 3OV7A 1JLBA 2AJQA 4O3OA 1TK0A 2KT5A 4OX9F 1CQNA 3KFWX 4ZVHA 3SCIE 2MQQA 2O1PA 3I9V9 4WFNQ 2DPJA 3TW0A 2ZZMA 5C5JA 1KVJA 2FTRA 3UCZP 1S1XA 2W8LA 4BCAA 3ZZUA 1B0VA 2E1CA 3GSDA 4MYTA 3H5YA 3ISNC 3RAQA 2DR8A 2DT9A 4CH7A 5HBMB 2DH7A 2Y1IA 1H2UX 2XSJA 3UDCA 5IS2A 2JVOA 2VG7B 3JB9k 4JI4F 4ETXA 5EX3A 4DS5A 2W25A 3FSIA 1LW2B 1I1GA 2ATLA 3LANA 1YJ9S 1HI1A 1XR6A 5GAHI 1WWHA 4Q8FA 1SH2A 5EGYA 4DUYF 2JEJA 4TU7A 2W4DA 5B08A 2KTQA 2ZH9A 4NLQA 3U02A 5HBMA 5M2UA 2RH3A 3PHEA 1K8AT 4RU9A 3I4HX 3T5KA 1P1TA 4C0BA 3UQSA 3NMRA 2VG7A 3DOMA 1B7FA 2RIJA 2WHOA 2R7TA 3EXCX 3RR8A 5CYMB 1LW2A 3AHPA 5KFUA 4HH1A 4FNHA 1Q8IA 1J2VA 4ZCIA 1NK7A 1NAQA 1SJQA 2GQQA 4M1KA 3HPOA 3MAQA 2HHXA 3J7ZT 2R7QA 1KLMB 1TUVA 5J1NA 4IFYB 3KG0A 2CPFA 3SCJE 4LF4F 2YNIB 5FD1A 1KTVA 4UOCA 3VZIA 2FHJA 1YJVA 1S48A 5KFBA 4NLVA 5KFJA 5B0GA 3CCUS 1RDRA 2IA6A 3MZIA 2Q66A 4DQRA 3UCGA 3VALA 4P2SA 1F9FA 3OTOF 3J7A1 3P6YC 2F9DA 2WSFC 5CYMA 3THTA 3KYLA 5KFXA 3RTVA 1DFDA 5EDWA 3WC2A 4NLWA 5IZHA 3MEDB 2JDJA 3O8WA 5I42B 4MYUA 1KLMA 2ZHOA 3OTCA 1VQLS 2BUNA 4WIIA 4IRCA 1UETA 4IFYA 5HMWA 2YNIA 2KJWA 1WHWA 4IG3B 4UY85 3NNCA 4DR6F 5JXSA 2RS8A 4ELTA 4B3OB 2DPIA 3PEHA 3AA8A 5L39A 1UWBB 3CCES 1O5JA 4GO5X 3O5TB 1RQ0A 3K8WA 3MEDA 5I42A 3KHRA 1DRZA 1N33F 1OIAA 2OP5A 2X1FA 2A10A 5AE1A 2OTJS 3CUNA 3U7JA 4X62F 3EZUA 3LO3A 4IG3A 4AQYF 4I0WA 1GH8A 5L8RC 2CQIA 5LMUF 2YX1A 1SQEA 3S7RA 4F02A 1QE1B 3MXHP 3QO9B 4N77A 4B3OA 2MJNA 3KHLA 2R7RA 2ZFHA 3GFZA 1HHTP 1UWBA 4NYZA 3H5XA 2KG0A 3IGVA 2LXFA 3KNAA 1JXEA 2DNKA 5E3QA 2HS0A 4UUXA 2ZNYA 4WFZA 3RU0A 3M6WA 2OLWA 1H6KX 3CDEA 4R25A 2BBEA 2BDPA 2NSBA 1U1QA 1U1PA 4JV1A 5F3TA 1WNEA 3F41A 3RRGA 1S0VA 1HMVB 1D8ZA 1QE1A 3DU5A 2DH8A 3M6XA 3QO9A 4NYPA 1D3WA 3NRBA 3M2VB 5DM6Q 2DGQA 1NU4A 2BM0A 1X5SA 3F56A 3CC2S 3LW5C 4UY8T 4MAKA 1WEZA 1XBWA 3PJXA 4DF4A 3GV5B 1HBNB 2IMWP 4A4JA 1LWEB 2KB2A 4RBVA 2ZH2A 3MUMP 3MMAB 1WEYA 1QTMA 4K59A 2AGQA 1RTIB 4FYDA 3IAM9 2LDYA 2SXLA 2DVIA 4IQXA 1R43A 4I4BA 4CO0A 4LFBF 1FKAF 2X51A 1HMVA 1IQZA 1JJHA 2K7KA 3M2VA 4MKYA 1R0AB 4EZ6A 2HQ3A 2Z2MA 5A0YB 3QJJA 1HBNA 3RB6A 3NGDA 2OTLS 3V4MA 4OMFG 2VFTA 1LWEA 1Z4UA 5CHCB 2ZVSA 2EK6A 1RYSA 3HZEA 3MMAA 4F2SA 5KFPA 1RTIA 2DCUB 1MW7A 4MH8A 4DWIA 2Q6BA 4WXWA 4TQRA 1AFJA 1L3KA 2ZDPA 1R0AA 3P96A 5KT5A 3D2WA 2EK1A 1E6YB 1HBMB 2ZC3A 5A0YA 2MQPA 2I2YA 3H2LA 1TP7A 2BRLA 3IC1A 1AXQA 2CQHA 5KOWA 3R1HA 5GAEI 3CJ2A 2UU9F 2E1AA 2E44A 4GC6A 4CO3A 2DRBA 4Q2MA 2JOQA 3N01A 1U6FA 4NLOA 4DV3F 3EGWB 4ZKAA 2XY7A 1QAJA 2XLIA 4DG1B 1H7WA 3CCVS 2O67A 4ZPBA 2CQ2A 4C9DA 5E5NA 3G8SA 1E6YA 1HBMA 2ILYA 2DJWA 2HHVA 4WZQA 1X4HA 2HVHA 2EFQA 3M4XA 3FFIB 3MEEB 3JSYA 4Y0FA 1PSDA 3GE9A 4X4QA 2RJZA 2K3KA 2K1RB 4KPYA 3KG1A 3CXCR 1HNZF 4IG0B 2GQ2A 2IC3B 1F5CA 4ZK7M 4DG1A 4C4WA 2ZHBA 2J6SA 4DL3A 4OI0A 2CJQA 1U6BA 1KVIA 4NOHA 2YWKA 4USIA 4KO0B 3MR2A 2RRAA 1X9MA 3FFIA 1RI7A 3MEEA 2QO3A 4F67A 1RTJB 4ZPWR 3HHNB 2PFFB 3AAWB 1IJEB 4AE5A 3VQTA 2DITA 2RU9A 4ZCLA 2K1RA 4OI6A 3PFEA 4IG0A 3E51A 5LSRA 2B51A 2FGCA 2IC3A 1LW0B 4ED1A 1FEHA 4ZCMA 2CZ4A 1MMLA 1M90T 2ZE2B 3BDEA 4A8OA 3PKYA 2PD1A 3CCLS 2R8GA 4TN2A 3FZBA 1K1SA 2YKAA 3I9ZA 1KC8T 2J7UA 4KO0A 3OLBA 4X4OA 3CJKB 4FBUA 4G1IA 1VJWA 2RD5C 1RTJA 2XWXA 3UW1A 3LWLA 4DDFA 5FIIA 2MZQA 3RR7A 4C8ZA 5IT4A 4K4WA 2CJ9A 4DEZA 5HMYA 2LDIA 1NK6A 3KMQA 2B43A 3OXFA 1LW0A 3ZZRA 5HN0A 2HGNA 2EKYA 4IH7A 1FXDA 1VC0A 2X1BA 1KN6A 2ZE2A 4OZ5A 1LXJA 5B0EA 2BA9A 1DQ9A 2NQPA 1KHWA 1Y3JA 1U2RA 4DV1F 1U26A 4NCGB 3HDSA 4YB5A 2CQPA 3CJKA 4RNOA 1U45A 4O3SA 1KQGB 1IQTA 3H8YA 3G96A 3HXMA 5KFMA 1RYRA 2FHKA 1S6PB 1SH3A 3CDAA 4DMZA 3SDEB 3MR5A 4N76A 1S79A 4QOTA 3V5RA 4MMOA 1H38A 2M8DB 3MPWA 1VQOS 2QMWA 3JTOA 1TV6B 2CPHA 2JVRA 2GO9A 3EPIA 2HGLA 3BO4A 5HI7A 3PO4A 2F4VF 6FDRA 2F8EX 2AV5A 2XI3A 4JUZA 3HK2A 2JH3A 1O51A 2N7YA 3LQVA 4NCGA 3OJSA 4GC7A 4MFBB 1ZZFA 2DGOA 2KYXA 3MGJA 3K5NA 1S6PA 3S01A 1XR5A 3SDEA 1GTHA 4URSA 1U7LA 3VAHA 1VC5A 3BN4A 4ZVGA 2KM8C 2DR7A 3CSKA 3ZZOA 3QZ7A 2FY1A 1YJRA 1TV6A 4ILRA 2BR0A 3D0IE 4BC7A 5F8JA 2WOMB 2W4CA 4TYBA 4A8XA 4HDHA 2M7SA 4C8MA 1U48A 2R7XA 2Q1LA 5CYJA 3KMSA 5LT5A 3OTDA 3T3FA 4ZPAA 2GC8A 4MFBA 4ECSA 1NKBA 1IR0A 4QIGA 2HHHF 2EC0A 1XMOF 5FJ4A 1FRJA 3BJYA 2VH7A 3MAHA 1R8PA 4IO1A 1VQ4S 2HVIA 2G4BA 3PM9A 2QT7A 2BYCA 1BD6A 1HWLA 1FRHA 1OO0B 5AXLA 4N47A 4C97A 1H2TZ 1SV5B 2WOMA 3KKFA 3KWMA 2E9RX 3HJFA 4ECTA 1GX6A 5THWA 5JVGQ 1IUJA 4HT5A 3J7YU 3THVA 3VWSA 4YB7A 4LFAF 1X8DA 1KQFB 4DL0C 2D3ZA 1G3OA 3SCKE 2N7CA 5DQHA 2YNFB 5BR8F 2AD9A 2B4VA 3G71S 3CCJS 2GIRA 5AE2A 3PR4A 3DN9A 3U27A 4RUCA 1SV5A 2DNNA 1EETB 2HIQA 1B0PA 3E8OA 3M32B 2V9WA 4YHHF 2I38A 1P27B 1WACA 3I87A 3MOZA 1R8HA 4J9OA 1S97A 1UA1A 3TUJC 2R9LA 2XNRA 3TARA 1OQ3A 1VQKS 3OJUA 4DSEA 2P9CA 1SJFA 2VFRA 1KQSR 2YNFA 2J9DA 3PX6A 1Y5NB 3W2WB 4BC9A 2N82B 1TKTB 2KT2A 4NPOA 4EYIB 4AL7A 3CO9A 4H4KC 1EETA 5D6GA 4ZP7A 3M32A 1X9WA 1HWIA 2LMIA 2B7CB 2Y1RI 3FSYA 2C3OA 3A1YG 4HHJA 5KT2A 3MPYA 2QIFA 4B08A 2HFOA 1H0HB 3DLGB 2ZM6F 4C7QA 2QRRA 4J9PA 3O2IA 4DN9A 4URGA 2WSCC 5JVHQ 3ONQA 4JV0A 2CQ3A 4U6PA 2ZH1A 1BGXT 3QMQA 4X4NA 4K4YA 1CG2A 1OPIA 3W2WA 4QU6A 4B3SF 3MWBA 3ZZYA 5DQIA 1TKTA 5AJ3F 1HWKA 4RNNA 4Y2MA 2VKZG 4F26A 2EFOA 1K1QA 4PQUB 4EBDA 2R2TA 4PCQA 2R8JA 3MOJB 3HFKA 5GAHU 3Q23A 4C8NA 5CXTA 1N32F 2OMLA 2HNYB 2E5LF 4B9VA 2EVZA 3N5BA 3DLGA 3IRWP 2LYVA 3VAKA 1ZH5A 2ZH7A 1VFJA 2YY3A 4I64A 2KDOA 4IQMA 2RQCA 2R7SA 4MKBA 2LQ9A 5KT4A 3HZGA 3QAUA 4FF1A 2M4MA 3JTPA 3FVYA 4RX6A 1U1RA 4OJHA 4KR0B 3VQSA 4NLXA 4PQUA 2XMUA 4TY8B 5KFTA 5EWGA 4CNYA 5T41A 3N0VA 5LSLA 3ZZ0A 4BWJA 4JI1F 3Q2TC 2HNYA 4N8NA 3QIPB 2J5AA 2Q43A 3Q8QB 4H4OB 1HYSB 2F1FA 4OLOA 5I3PA 3DXSX 5JUMA 2XS7A 2XMVA 1AFIA 5K8OA 2G13A 1P9QC 4PG6A 3BQ2A 3R3TA 2APOA 4MIAA 5H9FJ 1U8SA 2FDNA 4JV2A 1YHQS 1IN0A 4TY8A 1U1LA 2E29A 2Q6CA 1OSCA 1RGVA 4IH5A 4ZS6A 2RF2B 3OVAA 4I7FB 2BABA 3QWPA 1J5OB 3H5SA 1JNRB 4E8UA 3IGNA 3QIPA 1U09A 4YEAA 2K2PA 3QZ8A 4H4OA 4I69A 4WJBA 5GVQA 2UVWA 1VI7A 3TRGA 2E7XA 4CQ1A 2XZWA 2WSEC 2OH2A 3SSRA 2AGPA 3Q8RB 4DJBA 4ELVA 2PT0A 4KB7A 2L08A 2IAJB 2R4FA 1FJEB 1RKIA 4QU7A 1M1KT 4LVNP 1HHSA