2DO0A

Solution structure of the rna binding domain of heterogeneous nuclear ribonucleoprotein m
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
GSSGSSGALQAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein M
publication title Solution structure of the RNA binding domain of heterogeneous nuclear ribonucleoprotein M
rcsb
source organism Homo sapiens
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2do0A01
2DNKA 2MKIA 2KM8B 2D9PA 5EN1A 2MY8A 2F9JA 1N8RT 2CPXA 1N54B 5GAEU 1KOHA 1WEZA 2M52A 1H2TZ 4F02A 5CA5A 2CQIA 1KQSR 4PRFA 4J5OA 2DGOA 1D8ZA 2DH7A 2AYGA 2MQNA 2LA6A 1QVFR 1X5SA 1X4CA 2CPYA 4UY8T 1XN9A 4EGLA 2E44A 2X1GA 3MD1A 5GMKa 2DNGA 2XS7A 2N82B 1Q86T 3NNHA 1FJ7A 2MZRA 2KXNB 1VQ4S 2M7SA 2MZQA 2UP1A 2NZ4A 1N52B 2XSFA 3CC7S 2MGZA 3BO4A 4QPTA 3NS6A 2MQLA 4C0OC 5BJRA 3CULA 5D77A 3G4SS 3Q2TC 1YI2S 1U1MA 3PIPQ 2OJ3A 2K8GA 2F3JA 2O3DA 3J7ZT 3J7YU 3CPWR 2CPIA 3ZZYA 3CMES 2KFYA 2MHNA 2JWNA 3UD4P 3OW2R 3CD6S 3BS9A 2KVIA 1VC0A 2CQ2A 2M2BA 3CMAS 5HO4A 1X4HA 3MOJB 2ZJRQ 3FEYB 3VAGA 2RRAA 2CJKA 1X5OA 3DXBA 1K8AT 2VODA 5DM6Q 3MI7X 2RS8A 2DHGA 1URNA 3SDEA 2MB0B 3RW7A 1FJCA 3CCLS 1QM9A 5GAGU 2CQGA 2MY7A 2D3OR 1FT8A 2DK2A 2J0QD 3S01A 2LCWA 4Y00A 2DHXA 3UD3P 5LJ3Y 2J0SD 3VALA 2FPHX 3CF5Q 2ZJQQ 2M8DB 1M90T 4PR6A 4WCEQ 1M5KC 2DGQA 3S6EA 3S7RA 1RKJA 4WF9Q 4IO9Q 4WFNQ 5LXYA 1WELA 2RVJA 1UFWA 1UP1A 2DNQA 1WTBA 2U2FA 4CIOA 3Q2SC 1KD1T 2DIUA 4QU6A 2J76E 1VQ8S 4BS2A 1U1NA 3CCJS 2CQ0A 4F26A 1M1KT 1JJ4A 5JVHQ 1WF0A 2V94A 4IUFA 2OTLS 2RU3A 3HI9A 1VBXA 3N9UC 2RRBA 3R27A 1H2VZ 2DITA 3UCZP 2ZJPQ 4WFAQ 2XS5A 3JB9k 1K9MT 3BO2A 1KC8T 5D78A 4CH1A 2BZ2A 2LMIA 4W92B 4IOAQ 1HL6A 2MZTA 1ZZFA 2KYXA 2MKCA 2MKJA 1WG5A 1WEXA 3P3DA 2KN4A 5DDPC 1SJRA 4TU8A 2ERRA 3CCQS 3VAHA 4LMZA 1Q7YT 1JJHA 1DRZA 3UCGA 3UE2A 2E5GA 1SJQA 1FJEB 2DO0A 3P5TL 2JX2A 3VAMA 3U1LA 1VQOS 1NO8A 2M70A 2KU7A 5DDQC 5LSOA 3BEGB 3V4MA 2DH8A 3R1LA 3RW6A 4YOEA 1VQ5S 2CQPA 1U6BA 2N3OA 1SXLA 2RS2A 4P6QA 1P1TA 2MMYA 2DO4A 3G9CA 3EGZA 2JVOA 2XS2A 1UAWA 2RUGA 3CXCR 1DBDA 2MZJA 1S79A 2MSTA 3TO8A 1VQ7S 1DZ5A 2ADBA 3CC2S 2LECA 5GAHU 2EVZA 4M5DB 2KHCA 2GHPA 1QVGR 1N88A 3R1HA 2YTCA 3LPYA 2L41A 2RNEA 2MKSA 2XNRA 1WG4A 3UWTA 2QA4S 2VONA 2CPEA 2KM8C 3TYTA 2L9WA 1G2EA 2N3LA 5IM0A 1Q81T 1U1PA 2DHAA 1Q82T 4CH0S 2CQ1A 1O0PA 1X4DA 2MJUA 3H2VE 1VQ6S 4W90B 1U2FA 2OSRA 2QEXS 1FHTA 2U1AA 2DGTA 1X0FA 5ITHA 4YB1P 2FC9A 4FXWA 1OIAA 1WF2A 1WHVA 2AD9A 1YHQS 2CQCA 1UW4A 1WEYA 2M88A 2MSSA 4TLQA 4WIIA 2X1AA 2YWKA 1PO6A 3S8SA 1VBYA 2VOOA 1NU4A 2MPUA 1JMTA 3G96A 2RQ4A 5H1SV 2HGMA 2DHSA 2LXIA 4OZ0A 2CQBA 2MGZB 1A9NB 5CYJA 2CPFA 3THTA 2DNOA 2DNLA 3CUNA 2B0GA 2CPHA 2FHOB 1M5OC 1VC5A 1AUDA 3K0JA 3B4DA 4C7QA 1VQ9S 4ED5A 2DGUA 2DH9A 3NMRA 2CPZA 2L08A 1BY9A 4IOCQ 1U1OA 1WHXA 4CQ1A 3VAIA 1U1LA 3TP2A 5GADU 2KXHA 1X4EA 1FNXH 1WWHA 4F25A 2DIVA 2KH9A 2DGSA 2SXLA 3CC4S 2KRRA 2EK6A 3ULHA 2DB1A 3MD3A 2XNQA 1YJ9S 2BOPA 2G4BA 1NJIT 1U1RA 3NS5A 4LIRA 3US5A 2FC8A 1A7GE 3MDFA 3HHNB 1RK8A 3SDEB 1VQMS 1X4BA 1VQLS 2MZSA 1S72S 3EGNA 2EK1A 1OO0B 1WI6A 1HD1A 2MKHA 5DDRC 2XB2D 2LXUA 1U1QA 2KG1A 2ADCA 2OSQA 3VF0B 5LJ5Y 1WG1A 3SXLA 2PE8A 3G8SA 3MXHP 2OTJS 1JJ2R 2MQMA 3THPA 1YITS 3P49B 3G8TA 5LSLA 1H6KX 3MUTP 2X1FA 3G6ES 2E5IA 1YJWS 1VC6A 3IWNC 1OPIA 1R8PA 4QQBA 2MQOA 1F9FA 1YTYA 3CTRA 4PKDB 3DLLQ 1SJFA 3B4MA 3CCES 2M9KA 2M0GB 2MQPA 3EX7B 1YIJS 1VQNS 2KRBA 2MXYA 2DNMA 3L3CA 2RT3A 3D2WA 1WI8A 2CQDA 3MURP 3VAFA 1CVJA 2MQQA 5JVGQ 3VAJA 1WF1A 1W2BR 2YH0A 2MKKA 2LEBA 2HGLA 4YUDA 3BO3A 3CCVS 4Z2XA 1YWXA 3I55S 4OZ1A 1VQPS 4ZKAA 4ERDA 2DNZA 2A3JA 3MUMP 4LJMA 2PEHA 4A8XA 2DNPA 2QFJA 3SMZA 2DGWA 1K73T 1KOOA 5MLCV 4TU7A 2HGNA 1L3KA 2YKAA 2DNYA 3NNCA 1X4FA 2J8AA 2KI2A 1B7FA 2Q79A 2MYFA 1HD0A 3IRWP 2LYVA 2DNRA 4U67Q 2MZ1A 3LQVA 2E5HA 1P27B 2X1BA 3MUVP 1M5PC 2G1DA 4QU7A 5DDOC 1VBZA 1YJNS 2DGXA 5IQQA 3CCMS 1ZZNA 1U1KA 1FXLA 5GVQA 2DNNA 1M5VC 2KXFA 1H2UX 2K3KA 3P6YC 4WKRA 1U6FA 1SJ3P 3NNAA 2FY1A 1OWXA 2I38A 1PGZA 1D9AA 1SJ4P 1X4AA 3H2UB 4RU2A 2CPDA 2HVZA 5FJ4A 1X5TA 4FXVA 2N7CA 2AYEA 1R8HA 4V19X 3ZZZA 2NLWA 3PIOQ 3I56S 3VAKA 2DGVA 4WFBQ 1X5PA 2DISA 2MJNA 3U1MA 2CPJA 2JRSA 3FEXB 2LEAA 2HYIB 2WBRA 2LQ5A 3CCUS 1IQTA 1VQKS 4TU9A 2I2YA 2E5JA 2DNHA 4UQTA 2JVRA 2VOPA 2KT5A 2LA4A 2LKZA 2M4MA 5DETA 3CCRS 1FO1A 2CQHA 2D9OA 1ZH5A 5LXRA 5IM0B 2AYMA 2CQ4A 2HZCA 1X4GA 1DHMA 2RQCA 5DM7Q 1WHWA 2F9DA 1WHYA 2CQ3A 2G0CA 2YH1A 4C4WA 5CXTA 3G71S 3CCSS 2KG0A 5HL7Q 1HA1A 4Y0FA 2AYBA 2OIHA 2GO9A 5IFMA 2M8HA 3UCUP
chains in the Genus database with same CATH superfamily
2N4CA 4DUTA 1DLOB 2OPRB 3T6BA 1FRKA 4ECZA 3MCSA 1N5TA 3A8JA 2MQNA 1LWXA 2IIHA 3HVTB 3G82A 2UUCF 4ENOA 2JLEA 4KGKA 2ZOGA 4S0MA 3VGTA 4WP8A 5H9EJ 3CC7S 1EARA 4NRTA 2JEGA 1FX2A 2VG6B 2GHVC 3DGPB 4Y65A 1U1MA 4AXIA 2O3DA 5B0FA 3IM8A 4AUKA 4BC7A 5E0OA 1WTFA 1S5ZA 3TZWA 1QTMA 3CCZA 4KE5A 2Y1JA 1PG5B 1PYOB 3MCOA 1X5OA 2V67A 1HR0F 5J2QB 4LREA 4FYWB 4MMOA 5EWGA 1C4AA 2D3OR 2NSBA 3KK1A 2FPHX 2EFGA 3BPSP 3V4IB 4OHZA 4NLOA 1QAXA 1M90T 4WCEQ 2JSXA 4OJHA 2Z56B 3GYXB 1U26A 4P74A 2ATCB 4GMKA 3DYAA 2HEKA 4CM2A 1IM6A 2Q43A 2PO4A 4DQQA 2J76E 3KLHB 2ILYA 4B3TJ 1LWFA 2CQ0A 5KFYA 2DEJA 1N32J 2UUWA 3OQ2A 3MEDA 2DVIA 3DLHA 3D6TB 2P6TA 3IAS9 5M2RA 4G1PA 3GQCA 1N6QB 4WXWA 1D8YA 3RTVA 1N33J 3QPIA 1RU1A 1SL1A 2ZEJA 2YNFA 4ZPDA 5DG8A 2OPPA 3G2XA 1VQOS 5E3PA 4F4AA 1VIXA 2EEYA 2NUHA 2NCKL 3L9ZA 1K47A 2WAQD 1RUSA 1VRTB 2IBOA 2JL9A 1PYTA 4NXNF 2MZJA 2O5DA 4RW7A 5LSRA 2NYIA 2WSEC 3MAHA 4JI3J 3LPYA 1HHTP 2M5YA 4XAKA 4DL4A 3O1LA 4BBYA 4NL5A 2UXDJ 3D1HA 4DHVA 1BQMA 1OPZA 4YY3F 4DL6A 3T5KA 1VLOA 1TTHB 3I96A 4LFAF 5L39A 1TZ0A 1HI0P 5C25A 2HRTA 2EFQA 3UFCX 1UW4A 3PW2A 5HANA 1SKUB 2YKQA 1XMOJ 3W2VB 3T5JA 3MM5A 1XBWA 1RHKB 3UI3A 1IM4A 2VFUA 2HNYA 3T41A 1TL4A 3J7A1 3IBCB 2IBKA 5HMWA 3R6GB 4RBVA 1WC1A 4TY8B 5HLFB 4QOTA 1YJ9S 2BUNA 1TKXA 1FJGF 3RZAA 4UT4A 2FC8A 4TYBA 1MROA 2MTLA 2QLWA 2CZVC 2PEBA 2YX1A 2EK1A 4NXMJ 2ATLA 4DV1F 1AROP 4DFPA 4Q2MA 1HNZJ 5LJ5Y 3J80Y 1MWYA 4B9LA 1VBKA 2V2ZA 4NLWA 3DXSX 2KHDA 1K1SA 2Z2ZA 4PXDA 3HT0A 2HAIA 3OXFA 3NY0A 3TR5A 5CCMA 1YZ6A 1WI8A 3K7RA 3I55S 2R8KA 2YWWA 3EICA 3OD2A 2A3JA 1YJRA 3O6QA 1KWMA 3OVBA 4LFBF 4M5NA 2BJDA 1SH2A 3IMQJ 4YQWA 3NNCA 4DV2F 1QD1A 5ADZA 2BR0A 1Q95G 2H5IB 3CCTA 5A8WB 2E7XA 4K4TA 1P27B 3MUVP 1I1GA 4DZ6A 1U1KA 4KQZA 4WKRA 2IA6A 2YKNB 9RUBA 2IHR1 2FJAB 2HVZA 5FJ4A 4KB7A 3V2UC 1R8HA 1YK9A 2Z4PA 2FHMA 3C6UB 2PA3A 2XI2A 4TU9A 1MSWD 1LV5A 1RQ0A 3Q22A 5KG4A 3MR2A 4KHPJ 1FDAA 2HS0A 3Q8YA 3DRSA 3I82A 3Q23A 2HHQA 2CQHA 2V2QA 2XO7A 5IM0B 2HS3A 2HZCA 1RWKB 2GJFA 2RKIA 2BE9B 2RILA 1Q7LB 2WVBA 3HHEA 2D74B 3M2VB 1HA1A 3U02A 2AV5A 4ZVQB 4QW9A 2E7VA 1HBNA 1N8RT 1IKVA 3QAEA 3GIKA 1H2TZ 4RWXA 3BPDA 1KQSR 1S12A 4FS1A 3DOKA 2W9AA 1RYSA 1GFWB 2DCLA 3L7UA 2ZZTA 4KAIA 1TVRA 4E98A 5D0EA 2JZ5A 3NNHA 4DX8H 3ZZOA 3LOUA 2B6AA 1RTJB 1NDPA 3JXOA 1HQUA 3H25A 1SKSA 2XWXA 3C15A 5IQ6A 2F3JA 1RTDA 3J7YU 4LR7A 2AX1A 1R8BA 4P10A 2UVWA 3B82A 4O0NA 1F3VA 2AKWB 4URQU 1MN9A 4Q45A 2W9BA 2HHSA 4ZP6A 1S6QB 5FD1A 2RS8A 1RAHB 5B0DA 2MKYA 3SDEA 1QM9A 2MY7A 2POKA 1UPMB 3U7JA 3IWLA 2J0QD 3UD3P 5K9FA 2WVDA 4DFKA 5AXKA 4PG8A 4AE5A 1X60A 4FKYA 4QU6A 1RTIA 4TLRA 1G6BA 2B9YA 2CVEA 3KJFB 5L38A 1NUEA 4DX6A 1U2CA 3TRGA 1DAXA 5DQGA 2GVZA 2AZ1A 5IT9U 4XPEA 4DSKA 2LMIA 1AFIA 2BW7A 1UVJA 2KYXA 3BH7B 2PI4A 2UUBF 4ZN3A 1HNXJ 1A6LA 1JJHA 4RJVA 4DWIA 2AQ4A 3H98A 1S59A 2K3IA 3S1TA 3ILJA 1IKWA 3KHHA 4KFBB 4A4JA 1MWZA 3CDAA 2W8KA 3EVMA 1YGYA 3DLGB 3TO8A 3RRKA 4KGZB 4X4SA 3D54A 1C1CA 4FKXA 5IWAJ 5GAHU 2ACYA 1QVGR 3T3FA 1KDNA 5FLXY 4ICLB 4PG7A 1DJ0A 1WG4A 1FXDA 1S1WB 8RUCA 5KT3A 4K4WA 4CH0S 2CQ1A 5D6GA 2MJUA 3ISND 3NOCA 1JLFB 2P6SA 5F41A 5ETPA 3C14B 1U4BA 1XEZA 2CUYA 2AWZA 2OD4A 3ENWA 1VBYA 3M30A 1S4FA 2VG5A 4BLGA 2G0IA 3L7OA 3LO3A 1M5OC 1TUWA 3K0JA 1Q0NA 3A1YG 2DH9A 3D1OA 1BY9A 1RT7A 1U1OA 2OGUA 3CC4S 2BJEA 4QWCA 1KSPA 3DM2B 3LP2A 1CJTA 2QFIA 1HBUB 3CDEA 1IQZA 4DX5A 5L8RC 2HQFA 2W7PA 3ZC4A 4ZP8A 5A2QU 5CQGA 2MKHA 3DHXA 4JV5J 4NLGA 1Z1ZA 2PE8A 2V4QA 3LAKA 2JFKA 4DG1A 2E5IA 4U7UK 1ZETA 2YQ3A 1CBKA 1RYRA 2Z2LA 2DR8A 3CTRA 1FKOB 3HFZB 3KDNA 1UVIA 3IO1A 1TK0A 5CCLA 1T11A 1RACB 2IJFA 1NMEB 1TL3B 5CH7B 1U7LA 2HNDA 2CADA 2ZZMA 4ZVHA 1YJ7A 3QIPB 3ZTQA 1C1BA 4U96A 3L4BC 4KGXB 2CNOB 1BQXA 3FBFA 1NCLA 1RT3B 3AOAA 3LP1B 5CYQA 1J2VA 4DSJA 3CD7A 3CT9A 4CTAB 3R9LA 4RU2A 1GEHA 5HBMB 4A8SA 3DRXA 4ZPAA 3BSCA 5A8KA 3Q8PB 4CCHA 2GHWA 1IBMJ 3M8RA 2B8QA 2XY5A 3CJ5A 2W2PP 1S49A 1TAUA 4DBQA 4X4UA 2D9OA 2XG8A 3R2DJ 1SKWA 2R2TA 3ET6B 2E9RX 1TELA 5HL7Q 2V4JA 5F0WA 3OR2A 1T0TV 4GKKJ 1JLCA 4NCGB 2ACMA 4QIWD 3K89A 3W9JA 4I2QA 1HW8A 4F02A 2E1AA 4B3TF 4FYYB 1S10A 4FBTA 3GV8B 3M1VA 7AT1B 3SCJE 1QVFR 2B4OA 1N32F 2E44A 5E3AA 4LSZB 2XMKA 5DS7A 2UP1A 4C0OC 2XHWA 3KKFA 4FYXB 2IVYA 2COLA 4HACA 1I6JA 1JLGA 1B0TA 1IBLJ 1N33F 3H20A 1YSJA 3H5YA 3MM8B 4IFVA 3OW2R 3C8YA 4DV4J 1WDDA 3GYNA 1LW0A 2IM2A 4A8KA 3O3LA 2Y8WA 1IVZA 3DMJA 5B0CA 1XMQJ 1X7VA 2A6OA 4Y2IA 1XNRJ 4MFBB 4JI3F 1P8GA 4IO1A 1MLAA 2QLFB 5HMZA 4X64J 2UXDF 3HHDA 3KK2B 2V0NA 3MEGA 2A2CA 2VG7A 4TQSA 4RW9B 2ZHBA 3ILIA 5C42B 4RUHA 3WC2A 1H2VZ 3HCXA 3IFEA 1XMOF 3BGRB 2BZ2A 1O5JA 4IOAQ 1HL6A 3I4HX 2APOA 3M2RB 3OTOJ 1FE4A 3QMQA 3UCGA 1KRPA 2VC0A 2LQ8A 1NDLA 3M9NB 3BEGB 4TQRA 1LEOA 3RW6A 2RDDA 5L9XA 4P6QA 3EGZA 4BHQA 4NXMF 4O4GB 4DSEA 4DSIA 4OMFG 1HNZF 3FRYA 3DOMA 3IRXB 4YDDB 2P2CB 3QFHA 1WSVA 3BGOP 4NZ7A 4ECRA 2CPEA 4ZVEA 2L9WA 3BGLA 2KB2A 2F1FA 1X9MA 5GMEA 3T5LA 4C8YA 4LQ9A 1YZ7A 4CO0A 1AFJA 3SSRA 4KV8A 4YHHJ 1OIAA 4DR2J 3D6FB 3KDOA 3UQSA 4ID5B 2HGMA 2CIMA 1A9NB 4K4XA 3QJPA 5B0GA 1KHVA 4RBTA 3DHWC 2CRLA 1WHXA 1U1LA 1RAOA 1SUQB 1TU0B 2OEJA 2WOMB 3D6MB 4WU3A 1CEZA 4ZVSB 2DB1A 1OYEA 1VHFA 2OP5A 2BOPA 1U2RA 1B64A 1R6VA 5D0HA 2CJAA 3US5A 1TKTB 4MT1A 4U6PA 2CJQA 2EFPA 1VQLS 1NKEA 5MAOA 4FF3A 1EB0A 1LNQA 2XB2D 1SB6A 5AE3A 3QIDA 1S76D 2VF3A 1NLKL 4FZVA 4KHPF 1I51B 4DQIA 1HKAA 1HYSA 5KAKA 3OTDA 4JI2J 3KWMA 2RT3A 3GR0A 5A2QY 4KH1B 4L3NA 4IG3B 1E6VA 4B3MJ 1OY9A 2XMWA 4R8UB 1Q4RA 2PEHA 3RYLA 4R5PA 2XYHB 3W3SA 1IBCB 1L3KA 4QWBA 2DNYA 3QGGA 4OI6A 2ZC4A 3TQ1A 3CE8A 1T05B 2BE2A 1TKDA 4ZPWR 4QU7A 4B3SJ 2XBPA 1YJNS 1S0NA 2OPSB 4HI2A 4CWBA 4G1QA 3TW0A 1DFDA 1SJ4P 3A4TA 4N77A 2A18A 2EBGA 4ZVFA 1HNWJ 3LWMA 1HLWA 3VGVA 3WIVA 2HQGA 2P9EA 4EBDA 4NWBA 3IGNA 2DY1A 1S1XB 3OTBA 3W8PA 2ZH2A 5DETA 3VCDA 3UR0A 3EE3A 2HVIA 2AYMA 3BQ1A 4RX6A 2OMOA 1DHMA 4J7CA 5E3CA 2F9DA 4NE9C 4C4WA 1PBAA 5DQIA 3MGJA 3RR8A 3R5JB 3PJXA 2J9EA 4LRCA 1LFWA 5JJBA 3IG1A 3VQSA 2LXFA 1ULRA 3W61A 4L76A 4WP3A 3MD1A 3EUNA 3PXGa 2N82B 3TQEA 4O3NA 2FJDB 4WPAA 3KJVA 2GIRA 2MGZA 2K7KA 1RT2B 3EXCX 3BSNA 4AQYJ 2AJ2A 3G4SS 2V69A 1NHVA 3EJMA 2QMXA 3J7ZT 1F0XA 1HNXF 1TV6A 2CNNB 4HT7A 3PX6A 1RAGB 3EYZA 3DFEA 1TL5A 2KVIA 1VC0A 3QWUA 1NK6A 3DXBA 4USWA 1RHRB 3EMTA 3CWJA 2GMJA 4Y34A 5GAGU 2CQGA 3TVZA 4ANEA 3M6WA 4I6WA 3JTOA 5IWAF 3CO0P 3H7HB 3I5BA 2BA9A 2V6AA 4FNHA 5JXSA 1KLMA 3T1HJ 3DLBA 4DL5A 4JV0A 4TN2A 2GGPA 5KG5A 1TL1A 2GW8A 4OYAA 4HL9A 3LALA 1XR7A 2CJXB 4WE1B 1R43A 3ZTPA 4PQUA 1GQEA 4KO0A 1ZYQA 4PWWA 4WIQA 3BB5A 2H5JB 2FTRA 3JSYA 4N8OA 1U09A 1T9YA 5K8PA 4C9DA 3HULA 4H4KA 4E8UA 4ZLPA 2BKOA 2RIJA 1RWPB 1DTQB 1FJEB 4MIWA 2XHCA 1AXQA 3FZBA 1Z2ZA 3SSQA 2DYAA 1N0VC 2YKOA 3ITHA 2RQKA 2R2UA 4ECVA 2UUTA 2HZVA 4ZLNA 2UXCJ 1JXEA 1SVDA 1CJKA 4LIWA 1FWKA 3E2EA 4FXDA 4JV5F 3PEJA 4XK8C 3BBFA 2EVZA 3AD8C 4U7UD 2JJ4D 4O23A 3PX0A 1TL7A 3WHIA 1R8AA 5HVGA 2XCAA 2NUUG 5L1LA 2VONA 4OZ5A 3JAMY 4P71A 2R7TA 2AEJA 1FFWB 2OSRA 2E1PA 5BXIA 3OXLA 2WK4A 1HPZB 2HMIB 2BDPA 2AD9A 2CQCA 1WEYA 3POTB 4MKVA 1TKZA 2LXIA 4OZ0A 2CDRB 2WVEA 4FF2A 3JYTB 2B0GA 4M5LA 4KGMA 1FEHA 3D0HE 1ZM9A 2FVCA 2WB4A 4P2FA 5HVFA 4RO0A 3MPUB 4ZVRB 3ETOA 4CLYA 2LQ9A 1ZBTA 1ZPVA 4P73A 4ED2A 4ECUA 1V9OA 1SQFA 4GO7X 4ILMA 3FFIB 4ZCLA 4USKA 4Q2LA 1GXUA 3MDFA 1N34J 1VLYA 3BBBA 3EGNA 1R89A 1IBMF 3R8YA 3K17A 2ZVSA 1U1QA 3QNWB 5DRKA 2HHPA 1JJ2R 2DTJA 3MUTP 4DFMA 1H7WA 4GKJJ 1HBMA 3IWNC 4A8OA 2J8SA 1O8BA 2R2SA 3MCMA 2IRYA 3VVUA 3Q86A 2J9CA 4OZLA 5EGYA 3GTYX 4IH5A 2B5JA 3FSXA 1VQPS 3DRRA 4ERDA 4GKKF 3HHLC 3EDQB 1K73T 1RAIB 2YNIB 1RWWB 2E1RA 4FS2A 3QQCD 1JWWA 1RCXB 3OUYB 1TP7A 2ZWOA 1NK9A 2XY7A 2KXFA 1U6FA 3NNAA 2FY1A 4LR8A 2B51A 1TR0A 2O1PA 4ZVUB 3H2UB 1WKKA 4FF4A 3A13A 4YB6A 2E1MC 4WFBQ 1IBLF 5D15A 2EPIA 1ZOTA 1APSA 4IR1A 1WUUA 3I5CA 4QYRA 2J6UA 4ZS6A 4DV4F 2EW9A 2LA4A 3N0VA 3TZZA 1J27A 3PO5A 1T9XA 1KHWA 3ETMA 1XMQF 3D68A 4I7FB 2RQCA 3HSJA 4OI0A 3RG6A 1AZSB 2BANA 3VZHA 1XNRF 4K4VA 2ZVIA 2FZCB 3I0SA 1FKAF 2FHJD 1EIYB 4X64F 2VBXA 2ZD1A 3M2UA 3J81U 1KOHA 3O2IA 4J9PA 2C28A 2DGOA 2DH7A 3H2LA 1FKPA 2UXBJ 3EDRB 4UY8T 4EGLA 1EQ0A 1B4SA 4O3QA 1IKYA 3HXMA 1NH8A 2J9DE 3GMGA 3D28A 3RR7A 5CZVA 2HVHA 3ISZA 4U7CA 3TJ8A 4H54A 5ETVA 1HW9A 3ZTRA 1HHSA 3OTOF 5SUHA 1RT4A 1SBRA 2XMAA 2KFYA 4EU0A 1R0AB 2R3VA 2YNGB 2KZMA 4M8LA 2HFOA 4C98A 4A8FA 5A8RB 3EPIA 3KMQA 1K0TA 1KVJA 1C0UB 1QDUB 2HW3A 1FRMA 4J9LA 4E2FB 3GIIA 3DLEA 2R8GA 3S01A 5LOQA 2J0SD 3G6XA 2WB1D 5KT7A 2C2ZB 4NEZA 5JUMA 2CG4A 4IFYB 2HFSA 1UP1A 1KTVA 2AIRB 2V8PA 4K0KJ 3SZ2A 4RW8B 2RSQA 4ZJQA 4RR5A 3J7Z5 1O6XA 3K8VA 1KVIA 3K2YA 2OTLS 4YHHF 4DR2F 1ZTWA 3AOCA 2K06A 2AGOA 3P5BP 3Q24A 2Z30B 4EZ9A 1SC1B 3OBIA 1U0SA 5T7LA 2NXEA 3VGSA 3TZXA 3CCQS 5GAEI 3VAHA 4XO0A 4HR2A 2DO0A 2W25A 1VRQC 3V4MA 4ATNA 4LSNA 5C24B 3T6JA 2UUAJ 5KFRA 4USIA 3X1LB 3BN4A 1RLCL 1DBDA 1S79A 4I69A 1UFKA 4RL1A 2OHDA 4HHUA 3VWSA 4F3MA 1FD2A 3IBFB 2FJBB 2IAJB 5AT1B 4JI0F 2XNRA 4RU9A 4JI2F 4W98A 1WKJA 4ECQA 4NRUA 5HVHA 4B3MF 2H54B 2QYCA 1X0FA 3GG1A 2FVPA 3UNYA 2C2KB 4F4WA 1JKHA 3GE9A 4HLBA 2M88A 3TUJC 3S8SA 3LUYA 2OMLA 1AUDA 3OT9A 4B3SF 2H4WB 2JNJA 3KHLA 3BF4A 5THWA 3F0NA 3AD7C 2CKWA 1SQEA 5KT5A 2KH9A 4HVZA 3NGKA 4J91A 4X4NA 1A7GE 4WYWA 1HNWF 1MNEA 2BABA 1RK8A 4WK1A 3RB6A 1QSSA 1N36J 3D9BA 1FNOA 3MECB 4D3HA 1T02A 2ZNYA 3SXLA 4R0EA 5LSLA 1N48A 3LW5C 1YJWS 1VC6A 4DR1J 1JLQA 1SKRA 1VQNS 3UW1A 2VKRA 2KRBA 5HROB 2ZHOA 1DURA 5B7WA 3C46A 2QZ8A 4Z2XA 2EG1A 8AT1B 2C3MA 1KOOA 1DQ8A 4BDPA 1V6HA 5EUHA 3R7SB 3IRWP 5CD4H 5CZXA 4KT0C 1FXLA 3PW7A 3OTEA 4Y28C 1SJ3P 2FY8A 5H9EK 3SYZA 4AQYF 2JEFA 2R4FA 1Q79A 5J2PB 5IC6B 3M7VA 5KFBA 3SCIE 2JRSA 3M05A 2I5JB 2WBRA 2LQ5A 2E5JA 3AJDA 1SC3B 5CYMB 4GVBA 1EETB 4O44A 4F04B 5KFTA 4QPXA 3DLKB 3I0RA 3OFEA 4WBFA 3CCRS 3OL6A 1FDDA 4XIUA 2OPQB 4KYZA 4R0JA 4FN5A 1SIWB 5DM7Q 3SFGA 1RJJA 5J2NA 2B4PA 3OR1B 3BJYA 2J6SA 1FRXA 3NCQA 2V50A 6FD1A 1OQ6A 2ZHAA 2OELA 2WVFA 2AYGA 4KGVB 4KHRA 1UTAA 4UQGA 3FKBA 1RT1A 4PXBA 1QUPA 4OZNA 2KXNB 1VQ4S 4DJBA 3MM6B 4JB8B 3K59A 2R8IA 4NZ6A 4ES3A 2ZH5A 3J81Y 1BWVA 1WNEA 3ILOA 2WCXA 4P7TA 2QLBB 3KUHA 3RBEA 6FDRA 1DQ9A 3ZTOA 1S7IA 3MMBA 3EGWB 8ATCB 1PCAA 3UD4P 3MHYA 2DKOB 3NEKA 1CJUA 1H73A 1H7XA 1TUGB 4OYMA 3MOJB 2CJKA 3H59A 1E6YB 2VA3A 2UXCF 2MB0B 2E1CA 1XTZA 2AJ4A 1HI8A 4ZPBA 4YB5A 4FVMA 1KN6A 1ZTTA 3S6EA 3S7RA 3KUEA 2L9DA 1UFWA 1XERA 3IWXA 4CIOA 2DIUA 2H9ZA 5B0EA 2R7OA 4K50A 4BS2A 5J2MA 3IAM9 1JJ4A 5JVHQ 3QAUA 3AJ1A 1WF0A 3TEHB 4A47A 3HHLB 4DUYJ 2HBYB 3W2WB 4DS5A 1C0TA 1LKZA 4OV1A 1URRA 3KK3A 3BO2A 3EM1A 3I5AA 5D78A 2FVRA 4NMLA 1UWBA 4KR0B 5KFHA 3SFUA 1S9GA 1FRIA 2E29A 1SJQA 9ATCB 5LMNJ 2QTWA 3KLGB 4IG0B 1IR0A 2J0XA 1U6BA 2MLZA 1IKXB 1KKHA 5E5NA 1JLEB 4WTOB 3JQMA 1N34F 3QLHA 2P8IA 2ZE2A 1UAWA 1NHKL 4ANDA 4LSLA 2PFDA 3V81A 3GB0A 2XSJB 2DHHA 5E7OB 4MKAA 2ZDPA 1FDBA 2YTCA 4GKJF 2QA1A 4LFCJ 1NZ8A 1U1PA 5EWEA 4DF4A 2W1BA 3OL7A 1FHTA 2U1AA 1S97A 3BYPA 4RNNA 4DLGA 2OFHX 3T9ZA 4DQRA 4HHJA 3TX0A 5I42A 3V6DB 2A10A 1R27B 3MAAB 3M32B 3MAQA 4J9MA 3PW0A 1NU4A 3GSDA 3G96A 2DHSA 4UZCA 4U8VA 1CULA 2GFFA 5CYJA 2Q6BA 1MMDA 2FD2A 1RB0A 3EZUA 2CJYB 4ED5A 4Q0BA 1YQHA 2L08A 4EZ6A 4F50A 1QAIA 2QX0A 3LTOA 5DQHA 2DR5A 4F3QA 2KT3A 4C3MA 2XTJP 2PIIA 2YQ0A 3NBPB 1EQMA 1F2HA 2HQDA 3LPEA 4ELUA 4LIRA 3QGPA 1HNVB 4CO2A 1RWNB 3M8QA 4OHVA 3RAQA 1IXKA 3GFXA 4E0DA 5KFXA 2LVWA 3NXZA 2GMHA 4H4OA 2AP6A 2FZKB 2CDQA 1MW7A 3MPWA 4WZQA 3N6LA 1JJCB 1MU2B 3I6PA 3KG1A 5K14B 4PKDB 2E9ZA 3RAXA 2W7AA 2MXYA 3QO9B 1WF1A 4LRBA 1RHUB 3I9V9 3DDKA 4X2BA 4DR3J 4DCOB 3JSMA 3SMZA 2QT7A 2HFUA 3M4XA 1X0PA 3LGNA 4N41A 2UXBF 2E5HA 3H8YA 2QG9B 2PD1A 1SV5A 2DGXA 3H5XA 3HD1A 2MEWA 1M5VC 2JFDA 3TNVA 4Y2KA 3ONQA 5H9FK 1V5VA 4XPCA 4JI8J 1YRTA 1P6TA 1HBOA 4B08A 4F36A 1K0VA 4OJGA 4A8MP 4KSEB 4PG6A 2DNHA 1TV6B 2VIHA 1ROFA 1U0HA 4LQ3A 3RRHA 2KT5A 1GTHA 3W5ZA 1U02A 2XULA 3Q89A 4J9SA 2Q6CA 4ZDNA 2CQ4A 3NGDA 1NBEB 1N56A 4IRCA 2IPOB 1EKSA 1BMQB 1HMVB 1NSPA 4EUVA 2GV1A 3PYFA 1H0HB 2Y9HA 2GX8A 2DNKA 2GO8A 2WTFA 2VICA 1C2PA 4K0KF 2XMJA 4JI4J 2F5GA 1GXLA 2VBYA 5F9NA 3ENQA 3KLEA 2IYIA 3MMJA 4ECWA 1JXLA 2GJIA 2KJVA 3W8GA 3MF5A 5U47A 2M7SA 3FJ2A 1FTRA 2BRKA 2W2OP 4QPTA 3CULA 3FC9A 1GNKA 1SL0A 4CYUB 2IM3A 3X3UA 1NPPA 5K8OA 4RW4B 3KLIA 1CJVA 2LU1A 1RT5B 1KS2A 1T03A 4DCPB 3OSPA 2UUAF 1Q8KA 5A0YB 1MMNA 1OY6A 2GMLA 5J1EA 4PPDA 2AJQA 4KKOA 1KQKA 2ZFHA 3HT3A 4X66J 2BM1A 5FDLA 5ETRA 1ICEB 3LP0B 4I4BA 2AJ1A 3QBCA 5LXYA 3NAHA 1F9EB 3PYDA 3R7BB 2DNQA 1MWQA 2YPZA 5G0RB 5KG2A 5KG3A 2CJBA 4IYQA 1M1KT 1FFSB 2IDEA 2H3EB 2AJFE 1N5SA 2ZJPQ 2XS5A 1JLAA 1Q78A 2LFVA 4PQAA 2RH3A 1K1QA 4OQJA 4DPTA 1LWCA 1VIOA 3ISNC 3SSSA 3MEEB 1NO8A 5KFSA 1S1TA 2D3UA 3ZFVA 1IN0A 2QO3A 1HWUA 3SV3A 2X51A 2MMYA 4IDKB 2IC3A 1N36F 3MEKA 5KTQA 3KHRA 3EVWA 2QJ3A 3JS9A 4ZCMA 1GH8A 2YKMB 2Z2YB 4ED7A 4DR1F 4RW6A 1W26A 2XCPA 3IS9B 5BR8J 4USMA 2OEMA 3KLFA 1RXOB 1X4DA 1I5OB 3H2VE 2L48A 1UEKA 3M8PA 5F8IA 3DOLA 2IJRA 2JLGA 3PW4A 3SQGB 1S57A 1X9SA 4KIAA 2VDIA 1UVNA 4NA2A 1PBUA 3C6TA 1DLOA 2OPRA 2Z0GA 2CPHA 2UZAA 1NJZA 1SPBP 1I94J 4UZBA 4DV3J 1X4EA 4PXCA 3HVTA 3PX4A 1EKRA 5L1IA 1S77D 2VG6A 2OD6A 3DGPA 1D1UA 1CC7A 4ED0A 1ZA1B 2MZSA 2X7IA 1OO0B 2VB6A 1EP4B 2B4VA 3G6VA 3ELHA 5DDRC 1BLUA 2KYZA 1QTNB 3CD0A 3G8SA 2F8EX 3G8TA 2F65A 3CJSA 4P2SA 2CAJA 4ZN1A 4QQBA 4OLOA 3RAMA 4PYDA 3AA9A 5J2QA 2W4DA 3H4DA 2ZWPA 3D2WA 2CQDA 2D1CA 3VAJA 2YH0A 2V8HA 5D3GB 2XMTA 3V4IA 1B0VA 2RF2B 4PWDB 3KJNB 1UCNA 4WYLA 5C2CA 2HGNA 3LANA 5I3UB 2HHVA 4ZCIA 4C8MA 4KTQA 1HD0A 3KLHA 2C2NA 3FDSA 2JDJA 2ASYA 4CLTA 5DDOC 2OUGA 2C2OB 2VQFJ 5A6WA 4PXEA 2FLNA 4ANCA 4DV6J 2VUGA 3KLVA 4I6AA 2HVEA 1GXTA 3GV7B 3RGIA 2NREA 1N6QA 1Q53A 2I2YA 3P4UB 4D3GA 1GX6A 1VFJA 2FGOA 1JIHA 2XY6A 4J9KA 3UDLA 4K8RA 5AJ3J 3W5XA 2DR9A 1QE1B 7FDRA 5D4LA 4DLEA 1VRTA 1VMBA 5HJXA 2RU9A 1IWAA 1PSDA 3CCSS 3IC1A 4USUA 4Y0FA 4B9TA 2FVSA 2F9JA 3AA8A 5K8MA 1N54B 4OI2A 4NLSA 4R25A 2IRUA 1N5QA 2N4DA 3TUIC 2R7WA 3K8WA 4DUYF 3QT8A 1YDLA 3KJQB 5FLXU 1T9WA 3GSIA 3OJUA 3HSZA 2HWTA 2RUSA 3W2VA 4Z37A 1QLNA 4LRFA 2OJ3A 3M8SA 1HWKA 3CJKB 3ZZYA 4OYWA 3FCVA 4RUBA 5LMNF 2BXJA 1LWEB 4TY8A 5HLFA 3W1YC 2Q1LA 3CMAS 2CNLB 1U48A 4IRDA 1IUJA 2XZDB 2DHGA 5KG0A 4ETXA 3JTNA 4ED4A 5KFOA 4C8OA 4RNMA 3CF5Q 2C42A 4DPOA 4QR1A 3ZO7A 3ZZPA 3TA2A 3WC0A 4JI5J 4LFCF 4BC9A 3R5BA 4LF8J 5DGAA 5HJYA 2ZH3A 2VQEJ 3GPAA 2DEIA 4F4YA 4DU8A 3BDEA 1NK7A 3IXQA 2PC6A 3LWLA 1K9MT 1WOOA 4UOFA 4KJIA 2HWIA 5A8WA 1WG5A 1CQNA 2ZH9A 2K1RB 5E3QA 1DTTB 4EI2A 4CP5A 1IR2A 3P5TL 4B9UA 2Z2MA 4WKYA 2YKNA 2DH8A 3W9IA 1UJ5A 1F5BA 3OVSA 3QT6A 1OS5A 3FGVA 3M6UA 3G9CA 2JVOA 2XS2A 3E01B 3A3OB 2RUGA 4J37A 3C6UA 2ADBA 4M5DB 1HQEB 2GHPA 4HEA9 3BYRA 5KFFA 5CD4A 2G2ZA 2G13A 2CFXA 1FWPA 4WFYA 3OPKA 2EKNA 5IM0A 2DHAA 1S1UB 2C2DA 2RMLA 2CA9A 1U2FA 4PG4A 3TOQA 2DGTA 5ITHA 2VL1A 4HI1A 4DR3F 2VPYB 3M2VA 2ROPA 1YHQS 2KFNA 3NCPA 3W7BA 2MSSA 3CJTA 4B9MA 4NLRA 3CUNA 1UZDA 3HVAA 1CC8A 2VC1A 2W4CA 1Y10A 4NLTA 3VAIA 4URGA 2PFFB 2PMHA 2DXFA 1T7PA 2FHJA 3PYGA 2AZ3A 3PVXA 4JI8F 5KFCA 1RTJA 3SI8A 3SIPB 3DI6B 1PYSB 4GC6A 2JOQA 5HI7A 1WI6A 2ZKTA 4OI3A 3KUGA 3IM9A 3C16B 1YITS 3A3PB 3GJSB 1H6KX 3AOBA 4I64A 1RABB 2XZWA 5ETSA 5DZ6A 5KFJA 1S6QA 5JMNA 3B4MA 3CEDA 5D4OA 2W9CB 4N8NA 1NSQA 2MKKA 4I68A 1FD8A 2PA8D 3UVJB 1CLFA 3M6VA 1LXJA 4HKQA 1YLXA 3MM7B 1RTHB 2WONB 4ER8A 2YX4A 4JI4F 5FIIA 5DG9A 1B70B 2KI2A 1B7FA 2MYFA 1FF2A 1FE0A 3UDVA 3F56A 3PFOA 4K59A 2WW4A 2J7WA 4IQXA 1UEUA 4C8KA 3MMAB 2CZ9A 4RBUA 3TWZA 4V1Ak 2V5HG 1JXVA 2QMWA 1U24A 2XYGB 4K7QA 4P72A 1LW2B 5KG6A 4CO5A 2DISA 3U1MA 1Z4UA 2WZ1A 1UW9A 4WFXA 3FCWA 4YMEA 2JVRA 4ZHRB 2UVUA 3QGIA 1NK8A 1HNIB 3T1YJ 1SH3A 4ZMMA 1UFLA 5GADI 2BEFA 4KFBA 5D4NA 4LVNP 4Y2AA 2C3PA 3DLGA 4EYIB 3C66A 4MYUA 4X66F 4X62J 3T19A 2GO9A 4YN3B 1AB8A 4ICLA 4B9SA 2FQQB 4AL7A 2M52A 2H4YB 1S1WA 5CA5A 3KYLA 4IKAA 4DR5J 4PRFA 1FERA 3GONA 3UN2A 2AHOB 5I4MA 2A2DA 1IR1A 4YY3J 4X4OA 4Y3CA 1JLFA 4RNHA 5KT2A 3T1AA 3C14A 1H74A 2B9WA 3GWCA 5HP1B 1R8CA 1UKUA 1VRUB 2YPYA 4ZPCA 3Q2TC 3V6KA 4ZP7A 4LRDA 3PJ9A 2K8GA 3QSYB 4WTYA 3RBDA 3KG0A 1JK9B 1BQNB 4PUOB 3ZZUA 1NH7A 2YXLA 4CLKA 4QIGA 3DM2A 3EWGA 3OLAA 2PMWA 1WC0A 3LGMA 1HBUA 2RRAA 1Q8BA 2VODA 5DM6Q 4DL3A 3MM9B 2D69A 2WHOA 5L1KA 1RHMB 5LJ3Y 3HHLD 3MPVA 2VPZB 1S1VB 4DR4J 2R8JA 3LH2S 4LF7J 4IO9Q 2QA2A 4WFNQ 4RLEA 5BR8F 4OV6A 1FKOA 4DUZJ 1XQIA 4X4RA 1C4CA 1GMWA 4CNYA 1HHQA 1O51A 1ZM3A 2RU3A 3N5BA 4DU7A 5F0UA 1RZMA 3UCZP 4X65J 1TL3A 3T9NA 4OFZA 1CSJA 4QR0A 4M63A 3BBCA 1AT1B 3QIPA 1AUSL 1YG0A 3VQTA 2V8GA 2IFXA 3M8YA 3TEGA 1I94F 4DV3F 1RT3A 3LP1A 2A1BA 3MTJA 4ELTA 4QCLA 4CT9A 1TAQA 2WSCC 2JX2A 4HDHA 3UO0A 1Y9OA 1RT6B 2C22A 2PGCA 1Y11A 4B17A 5ETNA 3TAMB 4CTAA 1SXLA 3VTIA 5ETTA 5HBMA 3N4WA 4YP3A 4A46A 2JC1A 1JLBB 2VHGA 3CXCR 4B3OB 2ASDA 1Q5VA 6AT1B 4M94A 2VFRA 4ECYA 2LECA 1YRXA 3MFIA 2BOAA 2E5LJ 2ZKUA 3GILA 1G2EA 3G87A 3GCXP 2YWGA 3D5MA 3ET6A 1FI4A 1T9TA 4N76A 2DY9A 5C5JA 1WJ9A 3BSOA 2X1AA 4NCGA 1FTCA 1S0VA 5L9NA 3CJ0A 4ED6A 3CJ8A 1NM2A 2IMWP 1F3FA 3E3XA 4DI6A 1FVQA 3BSAA 3BGUA 4H4MB 3MR3A 2B3TB 1NPRA 4G6VB 1FNXH 1KQGB 2VQFF 4G65A 2SXLA 1R3NA 2NPIA 4J9NA 3PHTA 4DV6F 3MD3A 4KPCA 3UR3C 2XNQA 2FIUA 3O8WA 2XEXA 3NS5A 1OQ3A 1XIQA 2HAFA 3MMCB 1D09B 2QSWA 2QRRA 2O66A 3MM8A 5KFKA 2XO6A 1ZM4A 1S9EB 4W4MA 3THPA 5LT5A 2GIQA 2ZUAA 1L3UA 3G6ES 3AAWB 4A48A 4C3LA 4C11B 3TUZC 1ZAVA 1NEEA 2MQOA 3DLLQ 5AJ3F 3SV4A 1S6PB 2ASLA 2VBZA 2Q66A 4PPZA 4BWMA 3DRPB 2NXUA 2HGLA 5KFLA 3BO3A 4MFBA 3KXDA 1KONA 1R7IA 1J5OB 3ZNJ1 3IGVA 2Q3PA 1RI7A 4F0MA 4CLFA 1X9WA 4M5KA 1RU2A 3KK2A 2DRDA 4U67Q 2MZ1A 2ZH8A 4OX7A 1NXIA 4RW9A 1KBRA 3VR1A 5C42A 3CCMS 3A8KA 2ILZA 2ZH6A 2K3KA 3WZ0A 2FJEB 1CS4B 3PEHA 1WSRA 2EFVA 2KO1A 4QBUA 2XYPB 4FPIA 1WACA 1KLNA 3BGRA 4ZA1A 4LF6J 2L9NA 1HFEL 3M2RA 2ZBPA 3NOGA 3IP0A 3PFEA 1ZAXA 1KQFB 4B9NA 3DRYA 4DPXA 2WVCA 1NSAA 3DDNA 2GNKA 2JLFA 4O4GA 5J1EB 1WHYA 2YH1A 3P8BB 3IRXA 2OIHA 1FK9B 4C48A 1QJHA 3WDOA 5DZ7A 1UVKA 4JI5F 3IR7B 5GAEU 4LF8F 1M0SA 3HF5A 4DL0C 1G3OA 2CQIA 2VQEF 4USVA 1D8ZA 1NKBA 1UMJA 1X5SA 4NOHA 1XN9A 2KZZA 4DCJB 3ILLA 4TXSA 1Y5NB 5F8LA 4ALZA 1YRUA 4USHA 4ID5A 3NWGA 3R2CJ 3JAMU 5D77A 1R0CB 4X4PA 4YDXA 3HX9A 2HG4A 4YB7A 1SUQA 2MHNA 4RKUC 4NLUA 2WOMA 4DQSA 3HSDA 4YR0A 4MJKA 2QL9B 4ZPVR 3BR8A 4RWWA 1RBOB 1X4HA 1F60B 4ES1A 3AD9C 3JSBA 1K8AT 2PSZA 1TKTA 3RB4A 4C2MA 4HH0A 3CCLS 2R7QA 3BKUA 3BN7A 3A12A 1REGX 1QY7A 2AT1B 2VU5A 3VALA 1RAEB 2ZJQQ 4NI2B 4PEOA 1N5YB 2YNHB 1YKWA 2RHSB 2YBVA 4M95A 1VJQA 1WTBA 2YWHA 3NRBA 1UJ4A 3DC2A 1U49A 2LQBA 2VJVA 2F40A 1KFSA 2GVDB 4IG3A 1JNZB 2DITA 4R8UA 1YJUA 3OHBA 2VFTA 1NSKL 2HNZB 2M3DA 4EO8A 4W92B 4ZVTB 5KT6A 4F4KA 2MZTA 1ITPA 1T05A 4I2PB 2AF6A 1QUVA 4MKBA 3CGIA 1SJRA 2ERRA 1REVB 3OHAA 4LMZA 1Q7YT 3PACA 1DRZA 1XWLA 1PC4A 2VFVA 2B9XA 2OPSA 3JQJA 2V4RA 5LSOA 3OXGA 2N3OA 4EWTA 3NAIA 3G6YA 2B9EA 1FEEA 5DG7A 5F8MA 4K4UA 2F8MA 3KHGA 4ILRA 1A0OB 2RQMA 2KHCA 2RJZA 3V6HA 4PAAA 1DQAA 1S1XA 3EZ5A 3B8HA 2WRMA 4O4RA 3AB4B 4WFZA 4OX6A 2KM8C 5DLGA 3N79A 4K4SA 4X4QA 5A76A 4MK9A 2DRAA 2GZOA 4OZJA 1TK5A 2QEXS 1HARA 1FRJA 2ZH7A 5DLFA 3CJRA 1NKCA 3G82B 4QIEA 4QYZJ 1LQ9A 4OYIA 4EBCA 2VOOA 4IQMA 1RE1B 3GFZA 5H1SV 2DNLA 4C3KA 2RB7A 1OY8A 3BGFA 3PRVA 2HQIA 2YY3A 3CJQA 2DIVA 1MG7A 2KRRA 4QIFA 2EFOA 2V2VA 4LRAA 4EEYA 2XMVA 2FDNA 2C2EA 4NLVA 1RT2A 3HHNB 1OSDA 1VQMS 1NHUA 4F0HA 3KK1B 2OSQA 3HPOA 3R5GA 3T1YF 1NK4A 3I4PA 1R8PA 3DYAB 3ZZ0A 3L09A 1LWFB 3VGUA 4CLZA 2X3DA 4J9QA 4X62F 4QWAA 3VZIA 2DPIA 2HSEB 2IVFB 2A0FB 2DNZA 3MEDB 2EBEA 3MPDA 2V8DA 2G2YA 3DDIA 5MLCV 2YKAA 1SJ1A 4DR5F 1H98A 2UV8A 4NYOA 1IWGA 4CLLA 3TJ9A 1Y5LB 4K2JA 1QSYA 4WE1A 1OYDA 2RE1A 3PRDA 5IQQA 4ID8A 5GVQA 2R7SA 3QWPA 2CVIA 1NZAA 2YNFB 4FNIA 3Q8QB 2OPPB 1OWXA 2I38A 4NEYA 1KNZA 4NX9A 4FXVA 2N7CA 2ZM6J 3FZ2A 2HHHJ 2HYIB 4RW7B 2Y1IA 5IV4A 2BJ1A 4HHHA 1VQKS 1VQYA 4ZVPB 4UQTA 1DTQA 2JEJA 1B0PA 2AJ0A 1RAAB 3I9ZA 4EK2A 1FXRA 1BQMB 5LXRA 2BJ8A 3CIZA 5HAOA 4OYOA 2HURA 1B7YB 5C25B 4DR4F 1TUVA 5IFMA 2GAHC 4LF7F 4EO6A 2C3OA 4M5HA 1Q8IA 2CWKA 2VZ9A 1LK5A 3F73A 1X8DA 3BKFA 1YBAA 2ZUGA 3MM5B 4DUZF 3B78A 1UETA 4XDCA 2HNYB 2LA6A 1FA0A 1BXNA 1OMSA 4MH8A 1S0OA 3FNNA 1HPZA 2HMIA 4J9VA 4X65F 1Q86T 2BYCA 4Q7AA 3TANA 3POTA 5BYQA 1TKXB 2XSFA 3JYTA 1VYAA 1MROB 4LR9A 4WU2A 4ZJOA 2IYGA 2MQ8A 2DRBA 1WOSA 1XC9A 3D1QA 2FHKA 4UTGA 1WKLA 1RHJB 3BS9A 3A8IA 4Y2MA 5HN0A 2M2BA 4KH0B 5HO4A 4ZPTR 4OYBA 3FFIA 1Y4ZB 4EBEA 3P45B 4DS4A 1L3TA 1URNA 3GLJA 4ECTA 3R5CA 3OL9A 4F8RA 4C8ZA 2CWXA 1VDHA 2DHXA 3FQKA 2VH7A 1S7HA 2BQ3A 2DGQA 3ZXWA 2E5LF 4AFFA 3H4BA 4PZVA 3HVRA 4X4TA 4NMXA 3R97A 4F26A 5EWFA 2IY5B 3KNGA 3N9UC 1ZA2B 3IA0A 5KFIA 3PG9A 3JB9k 2YNIA 2V9KA 4NLXA 3TA0A 3PCOB 2KN4A 3OUYA 2P9CA 2W2QP 3CCWA 2LQJA 2E5GA 1VISA 3AXMA 2VPWB 4NLDA 3CNQP 3Q8UA 2NPFA 4CDIA 3DRSB 3H42A 4OI4A 5H9FJ 2RKIB 2MSTA 3RB3A 3MTKA 2I6WA 3QJLA 3HSGA 2QMUB 2J7UA 2Y1RI 1HBNB 3NWRA 1CPZA 1IKVB 4GO5X 3OVAA 2E9TA 2QA4S 5HMYA 3DOKB 1Q81T 2KL8A 4I7FA 1O0PA 3BKTA 1AZSA 1TVRB 4FPRA 1FRLA 3JTPA 4OJ3A 4AD6A 2BKPA 2XZTB 3QT5A 2KVQE 2B6AB 3N5FA 2CPFA 1BD6A 2DNOA 3ENAA 4WXOA 1HQUB 3PTWA 3C15B 1TMJA 1RTDB 2B7CB 1NDCA 2BM0A 2F4VJ 4EFAC 3GIJA 3I32A 2AW0A 1R31A 1GAOA 2W9BB 3DN9A 4JOUA 2G4BA 4JI1J 3QT7A 4C97A 4LF6F 1YBTA 1BC6A 4IRKA 2CYYA 4OHXA 4DR6J 1T95A 3SDEB 2J0WA 1EZZB 2OH2A 1TQLA 1R0AA 1WG1A 4OZ2A 2AGQA 2YNGA 4JI7J 3HFVA 3AH6A 1UL3A 3L7PA 5A8RA 4N56A 4DXLA 1F9FA 2M0GB 1RTIB 3PZPA 1SH0A 1C0UA 3MURP 1RSCA 4PG5A 1AYEA 2LEBA 5KOXA 3HVWA 3H5SA 4OZ1A 4ZP9A 5IC4B 5KFQA 3QRPA 2GVZB 2QFJA 4LF5J 3WBZA 4IFYA 3UPFA 2FLPA 3FUYA 1K44A 4P2MA 1Y3JA 1D9FA 1ZAWA 2Q79A 2LYVA 2R2RA 4RW8A 1AA1B 3LQVA 3KG4A 2Z8QA 3HHKA 1KP6A 3PO4A 3UD5A 1VBZA 4DFJA 5DO2A 4X84A 1IKWB 2A6MA 2FYXA 4FBUA 1U8WA 4MYTA 4OYXA 3CO9A 4QZVB 4OZ3A 4WJBA 4YR2A 3GV5B 3HO1A 2WW8A 2LEAA 2MHEA 3MCNA 3NGRA 2ZBQA 1C1CB 3NG8A 2IM0A 2OO4A 2Y0BB 4IH6A 2R7RA 2EXUA 2LKZA 1KVKA 3NMAA 4ZK7M 5C24A 3PKMA 1FO1A 1ZH5A 3OJSA 5D4PA 2HFZA 3FMWA 1RA6A 2UVVA 3EPGA 3HK2A 3UCUP 4C8LA 2IAJA 3OL8A 3RB0A 3M30B 5ETOA 2MKIA 3R3TA 2KM8B 2VG5B 1PAEX 1WEZA 5ETLA 2IVMA 3QFWA 2VJUA 4IOBA 2X3GA 1RT7B 4NYZA 4K4YA 2CPYA 2G2OA 2QLJB 4O0IA 2XS7A 4N5SA 3MOZA 3LP2B 1CJTB 2ZOMA 4FP9A 1BHNA 3FRZA 1SC6A 3D0IE 3NS6A 1H72C 4DV0J 1UEVA 1KTQA 2CPIA 2NXJA 2I9SA 2FJWA 1Q5YA 2CG8A 4CM0A 2CQ2A 4DG1B 4Q8EA 3FBBA 2ZH4A 4WK3A 2LP4A 1PKUA 3AFGA 3RW7A 4MKYA 2NS1B 1RHQB 2DK2A 2XLJA 4Y00A 1VK3A 1MMLA 3MECA 4Y2CA 4B3RJ 4HH1A 5AXLA 2HNDB 4FF1A 4F0KA 4DMZA 1C1BB 2RVJA 2D3O1 1T3OA 5F3TA 4U95A 3KNAA 4XDDA 1U47A 1NNDA 4Z7YA 3OFFA 5HROA 3THVA 1U1NA 3CCJS 5CYQB 1VR6A 3FMBA 3B54A 2V94A 4H4KC 1J5EJ 3W65A 3WX8A 3R27A 4WFAQ 2HWHA 3B6BA 5A8KB 5KFUA 1GMWD 2J5AA 1UA0A 4CZCA 5B09A 4NYPA 3UE2A 2NXCA 4J9RA 5DDQC 5HQMA 4YOEA 4QW8A 5F8GA 2GJ2A 5J2PA 3AODA 4NA3A 1RLDA 2FVQA 3PRBA 3HFKA 3NLCA 1XR6A 5KG7A 2I5JA 1VQ7S 2F63A 4ZCKA 2V4JB 3PY8A 5CYMA 3OR2B 1N88A 1JLCB 1EETA 2KKHA 3KMSA 3DLKA 3W63A 2MKSA 2XM3A 4LF9J 4B9VA 2V34A 4I2QB 2EC2A 1RADB 3Q8SB 2OPQA 3A3NB 1Q82T 3M1VB 3RRGA 2XGPA 3KFWX 3N28A 3IN5A 3OR1A 1GMUA 4LBIA 2KTQA 1PO6A 3H5UA 1RDRA 3CW2C 4C7QA 4HACB 2CPZA 1JLGB 3RBZA 3FEZA 3CDWA 2KXHA 2ZBCA 4F25A 4IFVB 2EK6A 3Q0AA 3DU6A 3MM6A 1NB2A 2P5VA 1LW0B 4DN0A 1SIZA 3CJ4A 4LF4J 2ZM6F 3DMJB 1Q8LA 2RAQA 4DV7J 4O3SA 3HKWA 2HHHF 3FBCA 4YEAA 3ZZTA 3VF0B 1RBLA 3T1HF 2BVZA 4DN9A 2X1FA 1Z2LA 2AEFA 5G4DA 5IT9Y 2HBRB 1E6YA 3CCES 2YWFA 2MQPA 3MEGB 4ZITA 2VG7B 1UVMA 5IZHA 2UVRA 3VAFA 2MQQA 2UV8G 2D41A 1W2BR 5KT4A 3AQPA 3LAMA 4ZKAA 3HKZD 3HMJG 3MUMP 4Z7CA 4WWSA 3HP6A 3TJAA 4OYPA 2DGWA 2W24A 5CHCB 4AL6A 2RHQB 2R8HA 2O67A 4XTTA 2J8AA 5D8HB 3BREA 3CIMA 4Q5VA 3BV8A 2ASJA 2C3UA 1ZZNA 3HHLA 4QWDA 1VQSA 3QRRA 5A6PA 2CNKB 2DXEA 1D9AA 3W2WA 1X4AA 3PKYA 1X5TA 1RWMB 1RKIA 1L3SA 3PIOQ 3VAKA 2BJ9A 3T5HA 3AXKA 4UY85 3DOMB 3AT1B 4I67A 3MZIA 1X31C 4RNOA 1V3ZA 2W2NP 3CDBA 5ETQA 1HWLA 3TX8A 2OI2A 3KLGA 4IG0A 2M4MA 1IKXA 1JLEA 1QSLA 4UUWA 5LMUJ 1X4GA 5T41A 4LUBA 3G71S 4FYVB 4BWJA 4KV8B 2XSJA 1T94A 2XWYA 2M8HA 2HK2A 2GAGC 2D9PA 2HRYA 3VV2B 4L3KA 4JI0J 2BACA 4NA1A 3G86A 2D3ZA 3TAQA 2GQ2A 3WQPA 4F2SA 1NJXA 3ENVA 2D7SA 4JI6J 4MTPA 3TARA 2X1GA 1P1LA 2QL7B 2DNGA 3BM7A 3V6DA 3MAAA 3M32A 4J90A 3PHEA 1XJWB 2I1RA 1QAJA 1VS3A 2GQQA 3U1NA 4ZLJA 3UDEA 3CPWR 2RRNA 4ECXA 1GMVA 3FQLA 3ZNUA 4NLPA 1CG2A 3NBPA 3HJFA 3IR5B 1HYSB 2BX6A 3QSIA 1HNVA 1GTEA 1EX8A 1U45A 2W2MP 3KOAA 1E6VB 1TMMA 2H65B 2BQRA 2E66A 2HFVA 4F2RA 1T3NA 1LK7A 1PC5A 4NCAA 1JNRB 4QWEA 5J1PA 1EHWA 4R5PB 4WF9Q 1RKJA 3CSKA 1MU2A 1UA1A 3NGTA 3FK4A 2Z57B 3HJVA 5K14A 1XR5A 4OL8A 2BE2B 5DGBA 3QO9A 4UW2A 2XMMA 1RWXB 4F4XA 1F9HA 3MWBA 1VBXA 3DLJA 3GP9A 4BCAA 4G1QB 4O3OA 3GFHA 4USTA 4P75A 4V19J 2HVDA 1ZZFA 1ZS6A 3QZ7A 4KPYA 4FVCA 2VASA 1WEXA 3HLUA 3ZTSA 2VDHA 2F4VF 1PIEA 4OYZA 1Y7PA 5HQLA 2GCFA 5CAAA 3FVYA 3VAMA 4ECSA 3U1LA 1LFPA 4CT8A 3R1LA 4JI1F 1VGYA 3VVTA 2CQPA 2V8VA 4DR6F 2DO4A 4PABA 2YQ1A 3D3BJ 5F3ZA 2DD8S 2H1YA 4HDGA 4UOGA 3F44A 1RBAA 3CJ3A 2C1EB 4JI7F 3R1HA 1Y0HA 5KFAA 3J7YI 4P9SA 4QIVA 1V5IB 3IG1B 3OV7A 1HWIA 4ES2A 3AY0A 2H51B 3K5OA 3BDPA 2B7BB 2DR7A 4RZRA 2HHXA 1HMVA 4HTJA 1OJ4A 4M5MA 4CNZA 4LF5F 3K57A 3KJVB 2RQ4A 1M5HA 2MGZB 4RUCA 1XK8A 2FHOB 2LDYA 5B0BA 5KFNA 3RJMB 3GG0A 2LEPA 5K5MA 1UJ6A 3M8WA 2H48B 2HBQB 3H90A 3R5DA 5C2GA 5GADU 1WWHA 5EHHA 3ULHA 2V2KA 4IR9A 4JYAJ 4DSFA 3G8QA 3GFYA 3W9HA 4OX9J 2K2PA 2G9OA 4Y6IA 4ZOSA 4CYUA 1X4BA 4ILLA 3K5NA 1HD1A 4RW4A 2KG1A 2ADCA 2EFNA 4DSLA 4WP9A 2EG2A 2RD5C 1RT5A 5RUBA 1KLMB 4AT1B 1ZM2A 2BQUA 4M5GA 2GGPB 1TL1B 3SQOP 2RDIA 1SJFA 2R7UA 5A0YA 1CVJA 1RAFB 4YUDA 2ZZNA 4PQUB 1YWXA 3M9MB 5D0RA 4CO4A 3H0PA 4KO0B 4A8XA 5SZTA 3LP0A 4YS2A 2FLLA 5GAHI 5G0RA 2PMZD 3CB4A 4DDFA 3DGVA 1SC4B 1M5PC 2G1DA 3K5PA 1RWOB 4ED8A 1YJTA 2FUG9 1U25A 5BYRA 4QR2A 2GIFA 1PGZA 4ZIVA 4O3RA 2CPDA 1IJFB 2OAUA 3ITHB 1W2IA 2AYEA 4L73A 5DJBA 2VD3A 4DV0F 2DGVA 4TKTA 1CJKB 2E7WA 2UU9J 4HYKA 1Q1KA 1ELOA 2VOPA 1TL7B 3MEEA 1TFWA 2ROEA 3D6HB 4IDKA 4CO1A 1R6YA 3QRQA 1HWJA 1PJ5A 1WHWA 2XLIA 2ALYB 5EDWA 2CQ3A 5M2UA 2KG0A 4B3RF 2C2MB 5D0GA 2YKMA 2R7VA 4K2XA 1TKZB 5KOWA 2MY8A 3GJTB 3WIUA 3IS9A 1ZPWX 3AJ2A 5E3RA 4LF2A 3SQGA 1J5EF 2AGPA 3MR5A 3PDNA 4A8YA 4NASA 2NXNA 2BKNA 3R6LB 2MZQA 3PR5B 1R0BG 2KFZA 3W5YA 2R7XA 4OHYA 1KEKA 3BO4A 2MQLA 3GYGA 4DF8A 4I0WA 3N6MA 4AL5A 1HI1A 3PIPQ 4DR7J 5KFEA 1RISA 2BW2A 5ETKA 2NYHA 2VFSA 3CMES 3CD6S 4EYHB 2ZOFA 4LVOP 4ED3A 2QL5B 2PN6A 1HBMB 2ZJRQ 3UNGC 5CABA 3QJJA 1WD6A 4L72B 3EXYA 4EMDA 4DEZA 1FDNA 3F41A 1EP4A 1LXNA 2LCWA 5T14A 2B5JB 2B56A 3DRRB 4LT6A 1SQGA 2M8DB 1M5KC 4LF9F 3OFGA 1NJWA 1P9YA 1Q16B 2Z58B 2EC0A 2DR6A 5B08A 3HI9A 3ICLA 5D3GA 3TAPA 2R9LA 2RF2A 4PWDA 5L1JA 3OLBA 3O44A 5KFWA 1RA7A 5I3UA 4CH1A 3N01A 2HRUA 3DNCA 1T9VA 1SI9A 1L3VA 1NB7A 4OJ1A 4URSA 1G1XA 1Y5IB 4M1KA 5K20B 2XQCA 2AMCB 2QYGA 2KU7A 4LF4F 3WX4A 2VBWA 4DV7F 2IM1A 5AXMA 2BANB 2QV6A 1YX2A 2LU2A 3I0SB 3NL0A 3MR6A 1OSCA 2L41A 4FDFA 2RNEA 2ZD1B 3M2UB 4DL2A 4DV5J 3UWTA 3NP5A 3D67A 2R42A 4TYAA 3AQOA 3QGHA 1M5SA 3CVKA 1FKPB 4CLWA 1QE1A 4W90B 1RGVA 4PYAA 4YB1P 1D0EA 4OLPA 4FXWA 1IKYB 2DPJA 1CQMA 4WZMA 1B99A 2YWKA 2MPUA 5IS2A 1U6ZA 2CQBA 1XNQJ 5F9LA 1G7CB 2P9GA 3B4DA 2NZCA 1VQ9S 4L75A 3NMRA 1RT4B 5KFPA 3FSYA 1MN7A 3KTQA 2W7OA 2DGSA 1WC3A 2ZNZA 4CI0B 2AX0A 3MPYA 2GQCA 2FLOA 1U1RA 4G3IA 3AB2B 2PT0A 2G0JA 4K5SA 3DLEB 3P96A 1RAJA 2OFGX 2ZBRA 3CJKA 2LXUA 4ZIWA 3MXHP 2OTJS 3GU0A 2MQMA 1LWEA 1OPIA 3W62A 3EZOA 5LMUF 4P52A 1YIJS 3EX7B 4OI1A 2J7KA 1WC4A 4NLYA 4JP8A 1PILA 3AHPA 2KT2A 4MIBA 4CO3A 1TFYA 3GJQB 2Y0SD 3C2PA 3PM9A 1YJVA 2IDLA 1IJEB 1F6TA 1BGXT 4DPWA 1F5CA 5EX0A 1X4FA 2BMBA 4J9UE 5T7LB 4JI6F 2OLWA 5F8NA 2BE7D 1DY3A 5E2QA 2RDJA 1H2UX 3P6YC 2W01A 2O01C 5ETMA 4A8QA 2KJWA 1BWEA 3SBMA 2VPXB 4LSNB 2BBEA 2VA2A 2DCUB 3QATA 4V19X 2NLWA 1QAYA 2K1RA 1IQTA 1DTTA 4KBIA 5AXNA 4NCBA 3D3CJ 3MFHA 4GVLA 1FX4A 4ETZA 3J81j 4DQPA 3BH6B 2JC0A 1WOPA 2XI3A 3IBWA 1W25A 1PAUB 3E01A 5LM7E 5F8HA 2HFNA 4P2XA 1UPPA 1WORA 2IA0A 5CXTA 2J9DA 4LF1A 1JKHB 4M5DA 2AYBA 4TVAB 1HQEA 1LOUA 2JH3A 4I56A 3TI0A 3UN5A 4J5OA 1S1UA 2YWEA 1FNMA 4KY3A 3U27A 4KC5A 1X4CA 5BYSA 5GMKa 2I8EA 2MZRA 2ZBIA 5IXUA 1IBKJ 5BJRA 3GIRA 3UDCA 1RCOB 4P7VA 2EWHA 3W60A 1PJ6A 4KRWA 3FCHA 2WBMA 2YVSA 2HZAA 1N4LA 4HT5A 3PJWA 2ALZA 1JLQB 3PV8A 3DI6A 1FJCA 3BR9A 5KFGA 5E33A 1FT8A 1M1GA 3C16A 4AXJA 2GA7A 1V3RA 2ZDOA 3JSRA 4PR6A 4PWUA 3PNIA 1RWUA 1WELA 4MAKA 2IRXA 4LBPA 2U2FA 3Q2SC 1KD1T 1XMBA 2C3YA 1YVFA 1VHIA 4C6AA 1VQ8S 2W9CA 4QYZK 1WC5A 4IUFA 2QC3A 3GZ7A 2DXDA 2F7VA 1SL2A 5K8NA 3UVJA 3N6NA 3LGHA 2HIYA 3C19A 3PR4A 3PYEA 2UUCJ 3MM7A 1T9UA 3NGSA 1RTHA 2BJ3A 2WONA 1KC8T 4TNOA 2AEMA 3SEOA 1ACMB 2MKJA 1YBUA 1JQGA 4QJVA 3D66A 2IMOA 3HDSA 3P3DA 1GT8A 3D0GE 5F8JA 5DDPC 4GVBB 2HHUA 4O44B 4ITSA 4JYAF 3MMAA 3I0RB 5IT4A 3M9OB 4OX9F 5LL6d 2RS2A 3QZ8A 1HR0J 3TUPA 2Y1LB 3M6XA 1NK0A 5HSPA 4DPUA 1LW2A 3M8ZA 1G4CA 2FJXA 5J2NB 1DZ5A 5AE2A 2B4UA 1DARA 1Y3KA 5KFZA 4USJC 5B0AA 3SCLE 4ZHRA 3EVOA 1GX5A 4DPYA 1HNIA 1H3DA 3L95X 5I3QA 4C8NA 2AU0A 1UVLA 3DCAA 3GJRB 2N3LA 4UF4A 1VQ6S 2HPUA 2IJNA 2DJWA 1RT1B 5HK4A 3HM9A 1WHVA 4UOHA 4K5RA 1RWVB 4WIIA 3W64A 1PJ7A 5GAGI 3OTCA 1RP5A 1HIYA 4YFUA 2QGFB 3Q83A 1NJYA 4JUZA 1FVSA 3TZYA 3HD2A 2OKQA 3MMBB 3HZGA 1CJUB 4L74A 4NLQA 5HP1A 1VRUA 2LLZA 4RNFA 4I1TA 2I0XA 1S72S 2HQ3A 1VK8A 3UN3A 2UU9F 4F3OA 4NXNJ 1BQNA 3K5MA 2HHTA 4PUOA 3A8EA 3P49B 1FWLA 2QE5A 1BE4A 4JV2A 2QN6B 4K4ZA 1S48A 2DNMA 2FJVA 3MM9A 5J2MB 4O3PA 4LFAJ 5C7PA 3CCVS 4C0BA 3BQ0A 2XGQA 1JX4A 1VCTA 1S1VA 3PW5A 2HKEA 1NK5A 2HHWA 2DNPA 1C0TB 3D7SB 3KK3B 1F1BB 4UUXA 4JV1A 3LF0A 1UWBB 2X1BA 2Y3YA 4IH7A 1S9GB 1JB0C 5M2PA 2DNNA 4C0HA 5I3PA 1V3SA 2HBZB 3TVYA 5IT0A 3CMQA 2MLXA 4YR3A 4N7TA 3OSNA 1N0UA 1FJGJ 3GCWP 3QLHB 3ZZZA 2ZE2B 4DR7F 1X5PA 1S6UA 1SCJB 4LSLB 3V81B 4TY9A 4DV1J 1W7WA 2VV5A 3GIMA 1M1HA 2FZGB 2W8LA 1RT6A 4MK7A 5HMXA 4Q8FA 3TAMA 2CZ4A 2PDAA 1D3WA 1WC6A 4DL7A 2B43A 1JLBA 2BV3A 4B3OA 2NSCA 2CJ9A 4ELVA 5I42B 1EAYC 4DZDA 1FFGB 4AYBD 3TA1A 3NCRA 5EN1A 4LFBJ 1CULB 2CPXA 2V68A 2NQPA 4DV2J 4Q0BB 2KDOA 4U8YA 3ZZRA 2VKZG 2ZH1A 4CLUA 4B02A 1B3TA 2K7JA 3CD5A 2XC9A 1S4EA 1NRKA 2CXEA 3D4JA 3RBXA 2NZ4A 1N52B 1P9QC 3M8QB 1YI2S 4H4MA 4H4OB 4U9RA 1S0MA 2JWNA 1KR4A 3DU5A 5EX3A 4F7VA 3CDUA 3LA0A 5KG1A 5J1NA 3FEYB 3HZEA 3VAGA 4RUAA 3MI7X 4X4VA 2G1HA 1TK8A 3MMCA 4ZLLA 4F4ZA 1L5UA 4UOCA 5KFMA 3RUBL 1S9EA 3GR1A 2V63A 3JSMB 4DV5F 1D9DA 5IV3A 4C11A 4PCQA 2FGCA 1S6PA 3E51A 3R7NB 4RPFA 4J9OA 3DRPA 5E41A 1SV5B 3ADAC 1N5VA 2RRBA 4ED1A 3IR6B 1J5OA 3R5AA 1XNQF 2QSFA 2ZC3A 4CH7A 3E8OA 4M5IA 1HBOB 3NS7B 1UZHA 3NGUA 4MK8A 2MKCA 4HTIA 3K5LA 3CJ2A 4TU8A 4I6YA 4N47A 1U0HB 4OIXA 4G1IA 1CS4A 2M70A 1FCAA 1VQ5S 1VOMA 2BJ7A 1P1TA 3SCKE 3FBEA 2F4FA 4Q44A 2HS4A 1WDTA 2WSFC 3JQKA 2HLTA 4CRJA 2ABYA 1VJWA 3CC2S 2PI5A 5AE1A 1VI7A 2DBBA 5IOLA 4KHMA 2QA4G 1FRHA 5KFDA 3TYTA 1F2GA 3OFHA 4NZ0A 4GC7A 3KLEB 1T8EA 2LDIA 2FC9A 2H5EA 4ZVGA 1WF2A 2QLXA 2XLKA 3Q8VA 3H40A 1FK9A 3I87A 4TLQA 3MR7A 1JMTA 2B8PA 2V9WA 3THTA 3QYYA 3V5RA 1GK8A 1VC5A 5HQ8A 3J7AN 1NAQA 2EI5A 2DGUA 4IOCQ 1S9FA 4CLPA 4CQ1A 3TP2A 1AW0A 3KLIB 1CJVB 4ZJLA 2UUBJ 3J80U 1U8SA 1S99A 3W66A 1T03B 2JHEA 4M5JA 1NJIT 4OHWA 4ZVOB 2HQCA 2OEKA 2DT9A 3DKDA 2C2RA 4KKOB 3K58A 3I31A 4OX8A 2EKYA 4JBCA 5FDLB 2MDAA 1RTZA 2BRLA 1I3OB 2GC8A 3Q8RB 2YX7A 5HATA 3BZQA 1YTYA 1FJ7A 2M9KA 3C3LA 2W4PA 3L3CA 1HQ2A 5KFVA 5GMDA 5JVGQ 3RU0A 3EGVA 4L6V3 3TVKA 4A8WA 3FSIA 4LJMA 2MLYA 4MIAA 4NI2A 1N5YA 1S6OA 1JLAB 2NR0A 2YNHA 2J6TA 3O5TB 4TU7A 3BQ2A 2N7YA 2DNRA 4LBHA 3VHQA 4DX7A 1LWCB 2XMUA 2GVDA 2FB0A 1NDKA 4GRSA 2ZITA 3NKYA 4NPOA 4F67A 2YKPA 1S1TB 1IBKF 2HNZA 4FYDA 2IC3B 2HK3A 2L3MA 1H38A 3I56S 1EJ7L 2MJNA 2CPJA 4I2PA 3FEXB 1F5AA 3CCUS 3V6JA 1REVA 1NPKA 1FESA 2HIQA 4Q43A 2QIFA 2F8HA 2HLUA 4RW6B 7FD1A 2GS8A 3KLFB 1BUXA 3M8PB 3DOLB 2G0CA 4DOZA 5L46A 1Y00A 1UWAA 4CLSA 1KFDA 2Y8YA 2JEIA 2ROGA 3C6TB
chains in the Genus database with same CATH topology
2N4CA 2VBXA 1DLOB 2D9PA 2HRYA 2OPRB 4ICLA 2ZD1A 4B9SA 3T6BA 3M2UA 1KOHA 4AL7A 2M52A 1S1WA 3O2IA 1FRKA 5CA5A 4ECZA 3MCSA 1N5TA 2BACA 4NA1A 3KYLA 4J9PA 4IKAA 3G86A 2D3ZA 4PRFA 3TAQA 2C28A 1FERA 2DGOA 2DH7A 3H2LA 2MQNA 1FKPA 5I4MA 2A2DA 2GQ2A 4X4OA 4Y3CA 4F2SA 1JLFA 1NJXA 3ENVA 2D7SA 4MTPA 4UY8T 4EGLA 3HVTB 4RNHA 5KT2A 3TARA 2X1GA 1P1LA 3T1AA 2DNGA 4O3QA 1IKYA 2B9WA 3BM7A 3HXMA 3V6DA 1NH8A 2J9DE 2UUCF 3GWCA 5HP1B 2JLEA 3GMGA 1R8CA 4KGKA 1UKUA 3M32A 1VRUB 3D28A 3RR7A 2ZOGA 5CZVA 2HVHA 3ISZA 3PHEA 5H9EJ 3CC7S 4NRTA 4U7CA 2JEGA 2VG6B 4ZPCA 4H54A 2GHVC 2I1RA 1HW9A 1QAJA 3Q2TC 3V6KA 1HHSA 1VS3A 4Y65A 4ZP7A 1U1MA 2GQQA 4AXIA 3U1NA 3OTOF 2K8GA 2O3DA 5SUHA 4WTYA 5B0FA 3RBDA 3KG0A 1JK9B 1RT4A 3CPWR 2RRNA 4AUKA 4BC7A 4ECXA 1SBRA 5E0OA 1WTFA 1BQNB 2KFYA 4EU0A 1R0AB 4PUOB 3FQLA 3ZZUA 1QTMA 2YNGB 2KZMA 3CCZA 4M8LA 1NH7A 4NLPA 4QIGA 1CG2A 2HFOA 4KE5A 3DM2A 3NBPA 3OLAA 3HJFA 4C98A 3IR5B 2Y1JA 5A8RB 4A8FA 3LGMA 1HBUA 2RRAA 1HYSB 1Q8BA 1X5OA 1HR0F 2VODA 3EPIA 5DM6Q 3KMQA 5J2QB 1HNVA 1K0TA 1KVJA 4DL3A 1GTEA 3MM9B 1C0UB 2HW3A 1FRMA 2WHOA 4J9LA 1U45A 4MMOA 3KOAA 5L1KA 1E6VB 5EWGA 3GIIA 3DLEA 1C4AA 2D3OR 2BQRA 2R8GA 2E66A 3S01A 5LJ3Y 2NSBA 4F2RA 3KK1A 3HHLD 1T3NA 3G6XA 2FPHX 2J0SD 3MPVA 2EFGA 1LK7A 1PC5A 2WB1D 5KT7A 3V4IB 4OHZA 4NLOA 2VPZB 4NCAA 1JNRB 1QAXA 1S1VB 1M90T 4QWEA 5J1PA 4WCEQ 2JSXA 2R8JA 3LH2S 4R5PB 4OJHA 5JUMA 4WF9Q 1RKJA 3CSKA 4IO9Q 2QA2A 4WFNQ 1MU2A 2CG4A 3GYXB 4IFYB 4RLEA 1UA1A 1U26A 5BR8F 4GMKA 1UP1A 1KTVA 3DYAA 5K14A 2Q43A 3SZ2A 2PO4A 1FKOA 1XR5A 2BE2B 4RW8B 5DGBA 2J76E 2RSQA 2ILYA 3QO9A 3KLHB 4DQQA 4UW2A 2XMMA 4X4RA 4F4XA 1LWFA 2CQ0A 1C4CA 3J7Z5 3K8VA 5KFYA 1KVIA 4CNYA 1O51A 3MWBA 3K2YA 2OTLS 1ZM3A 2RU3A 4YHHF 4DR2F 1VBXA 2UUWA 3N5BA 1ZTWA 3OQ2A 3DLJA 5F0UA 3UCZP 3MEDA 4BCAA 1TL3A 4G1QB 3T9NA 4OFZA 1CSJA 4QR0A 4O3OA 2AGOA 4M63A 3GFHA 3Q24A 2DVIA 3DLHA 3QIPA 2P6TA 4EZ9A 3IAS9 5M2RA 1YG0A 3VQTA 2V8GA 3OBIA 2IFXA 4V19J 4G1PA 1ZZFA 5T7LA 3QZ7A 4KPYA 3GQCA 4FVCA 1N6QB 1I94F 2VASA 1WEXA 3HLUA 4WXWA 4DV3F 1RT3A 3LP1A 1D8YA 2A1BA 3CCQS 3RTVA 2F4VF 3QPIA 5GAEI 3VAHA 4XO0A 3MTJA 4ELTA 1SL1A 4QCLA 4CT9A 1Y7PA 2DO0A 2WSCC 1TAQA 2GCFA 2JX2A 2W25A 2YNFA 4ZPDA 4HDHA 3FVYA 3VAMA 1Y9OA 5DG8A 1RT6B 2OPPA 1LFPA 3U1LA 4ECSA 5E3PA 1VQOS 2C22A 4CT8A 3V4MA 3R1LA 2PGCA 4JI1F 4ATNA 1VGYA 4B17A 4LSNA 3TAMB 4CTAA 1VIXA 2CQPA 1SXLA 3VTIA 5C24B 2NUHA 2V8VA 3T6JA 5HBMA 2DO4A 4DR6F 3N4WA 5KFRA 2WAQD 4USIA 3X1LB 4YP3A 3BN4A 4A46A 1VRTB 2IBOA 2JL9A 2DD8S 2JC1A 1JLBB 5F3ZA 3CXCR 4HDGA 4NXNF 1DBDA 2MZJA 1S79A 2O5DA 4B3OB 4I69A 2ASDA 4RW7A 3F44A 3CJ3A 4M94A 2VFRA 4ECYA 4F3MA 3VWSA 2LECA 1FD2A 5LSRA 2NYIA 2WSEC 4JI7F 3R1HA 3MAHA 2FJBB 1Y0HA 3LPYA 2IAJB 1YRXA 1HHTP 2M5YA 4XAKA 5KFAA 4DL4A 4JI0F 3MFIA 2XNRA 4RU9A 3O1LA 4BBYA 3J7YI 4JI2F 4NL5A 4QIVA 4ECQA 3D1HA 2ZKUA 3GILA 4NRUA 4DHVA 1BQMA 1G2EA 3IG1B 1OPZA 4YY3F 3OV7A 4DL6A 1HWIA 3T5KA 4ES2A 3I96A 3AY0A 4LFAF 5L39A 3K5OA 4B3MF 2QYCA 2B7BB 2YWGA 2DR7A 3D5MA 3BDPA 1X0FA 3GG1A 4RZRA 2HHXA 1TZ0A 2FVPA 1HMVA 4HTJA 4F4WA 4N76A 1HI0P 1JKHA 3GE9A 5C25A 5C5JA 2EFQA 3UFCX 4HLBA 1UW4A 2M88A 4CNZA 2X1AA 3BSOA 3TUJC 3PW2A 4NCGA 4LF5F 3S8SA 1FTCA 3K57A 3LUYA 1S0VA 5L9NA 3CJ0A 3KJVB 2RQ4A 4ED6A 1M5HA 2YKQA 2MGZB 3W2VB 2OMLA 2IMWP 3E3XA 3T5JA 4RUCA 1XK8A 2FHOB 2LDYA 3MM5A 1FVQA 3BSAA 1AUDA 5B0BA 5KFNA 3GG0A 1XBWA 3BGUA 2LEPA 5K5MA 4H4MB 1UJ6A 3MR3A 3UI3A 1IM4A 2VFUA 4B3SF 2HNYA 2B3TB 4G6VB 3R5DA 3KHLA 1TL4A 3BF4A 5GADU 5THWA 1FNXH 3J7A1 1WWHA 1KQGB 2IBKA 5EHHA 2CKWA 2VQFF 1SQEA 5HMWA 4RBVA 5KT5A 2KH9A 4HVZA 2SXLA 1R3NA 4TY8B 5HLFB 3ULHA 2NPIA 2V2KA 4IR9A 4QOTA 4J9NA 4DV6F 3MD3A 3NGKA 3UR3C 4DSFA 2XNQA 2FIUA 3G8QA 3O8WA 2BUNA 1YJ9S 3GFYA 2XEXA 1TKXA 3NS5A 1FJGF 2K2PA 4X4NA 3RZAA 2G9OA 4Y6IA 2FC8A 4TYBA 1A7GE 4WYWA 1HNWF 1MROA 1MNEA 2BABA 2QLWA 4ZOSA 1OQ3A 1RK8A 4WK1A 2CZVC 3MMCB 1X4BA 2YX1A 2EK1A 4ILLA 3RB6A 2ATLA 4DV1F 3K5NA 2QSWA 1QSSA 1HD1A 2QRRA 1AROP 1FNOA 4RW4A 4Q2MA 4DFPA 2KG1A 2O66A 3MECB 2ADCA 4D3HA 1T02A 2EFNA 5LJ5Y 3MM8A 4DSLA 2ZNYA 3SXLA 5KFKA 3J80Y 2EG2A 1MWYA 2RD5C 1RT5A 1ZM4A 4B9LA 4R0EA 1S9EB 1KLMB 3THPA 4OL8A 4NLWA 1ZM2A 5LSLA 5LT5A 2BQUA 2GIQA 1L3UA 3G6ES 1N48A 3DXSX 2GGPB 2KHDA 3AAWB 3LW5C 1K1SA 4A48A 1YJWS 1VC6A 4C3LA 4C11B 3TUZC 1TL1B 1ZAVA 1JLQA 4PXDA 1NEEA 2MQOA 2HAIA 1SKRA 2RDIA 3DLLQ 1SJFA 5AJ3F 3UW1A 1VQNS 2VKRA 3SV4A 2KRBA 3OXFA 1S6PB 2ASLA 3TR5A 5CCMA 2VBZA 5A0YA 2R7UA 5HROB 1WI8A 3K7RA 2Q66A 2ZHOA 4PPZA 1CVJA 1DURA 4BWMA 5B7WA 3DRPB 2NXUA 3C46A 2QZ8A 2HGLA 5KFLA 4YUDA 3BO3A 2ZZNA 4Z2XA 1YWXA 3I55S 4PQUB 3M9MB 2R8KA 4CO4A 4MFBA 2EG1A 1KONA 1R7IA 2A3JA 1J5OB 1YJRA 3O6QA 3IGVA 3OVBA 4KO0B 2C3MA 2Q3PA 4LFBF 4A8XA 5SZTA 3LP0A 1RI7A 2BJDA 1KOOA 2FLLA 1DQ8A 4BDPA 1V6HA 1SH2A 4YQWA 3NNCA 4DV2F 1X9WA 5EUHA 5ADZA 5GAHI 2BR0A 3KK2A 3IRWP 5CD4H 5G0RA 2PMZD