2DO0A

Solution structure of the rna binding domain of heterogeneous nuclear ribonucleoprotein m
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
GSSGSSGALQAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heterogeneous nuclear ribonucleoprotein M
publication title Solution structure of the RNA binding domain of heterogeneous nuclear ribonucleoprotein M
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2do0A01
2CQPA 5CA5A 2MQOA 1YITS 2DNHA 2HGLA 2MQQA 3CC7S 2RU3A 2MKCA 1U1QA 1U1PA 1VQ6S 1FXLA 2RUGA 1UAWA 3CPWR 1ZZNA 2QFJA 1HD1A 3R1HA 4QQBA 2YH0A 2KRRA 2MQMA 2KRBA 2XNRA 2DGOA 2N7CA 1JMTA 2AYGA 2MB0B 2XNQA 2RRBA 3PIOQ 3HI9A 2YKAA 5GAHU 3N9UC 2F9JA 1P27B 1WF1A 2XS5A 5LSOA 5DDOC 1A7GE 2K3KA 1W2BR 1VQ4S 3VAJA 1X4FA 1N52B 2MZQA 2VONA 3FEXB 4LJMA 2RS8A 3VAKA 3VAHA 3G8TA 2JX2A 2DGVA 3I55S 1U6FA 3CC2S 3B4MA 1KOOA 1X4EA 2DGQA 1FT8A 1O0PA 3Q2SC 2FC8A 2E5IA 2DIUA 2I38A 2MZJA 4WKRA 3CCLS 2U2FA 2DO0A 2CPJA 2MKIA 4WF9Q 1OWXA 1VQNS 3CCRS 1N88A 1WG4A 4EGLA 1M5OC 2KXFA 1YTYA 2BOPA 1NJIT 2G1DA 1SJ3P 1L3KA 1WWHA 3NNCA 1QM9A 4PKDB 5LXRA 2M52A 5D78A 1VBXA 4V19X 2RNEA 4BS2A 1WG5A 2AYMA 4WFAQ 4TU9A 4UY8T 2JRSA 1KQSR 2M9KA 4LIRA 2J0SD 2V94A 3DLLQ 1WI8A 3R27A 3R1LA 2X1AA 2DO4A 2PE8A 2KI2A 2DHAA 3SMZA 3ULHA 2ZJQQ 3IRWP 1K9MT 1VQPS 3MUVP 1U2FA 3NMRA 2MSTA 2KXHA 4IOAQ 3P3DA 5HL7Q 2CQHA 3U1LA 3H2VE 2KHCA 1WEZA 1FJCA 1IQTA 3G9CA 1UW4A 2DHGA 3CCMS 3VALA 2CPEA 2MJNA 4YB1P 2ZJPQ 4C7QA 1JJ2R 1X4GA 2DNOA 1HD0A 1UFWA 1PGZA 1WEXA 2CPZA 2VOOA 2OTJS 2DNPA 3UCZP 4UQTA 2LXUA 1X5PA 1H2UX 2CQ3A 5DM6Q 4PR6A 3PIPQ 2HZCA 1KOHA 2DNRA 2MJUA 1FJ7A 2CQ2A 1U1KA 4OZ1A 3HHNB 2CPDA 4YOEA 3UWTA 2CQBA 2KFYA 3MDFA 2KM8C 3NNHA 2EVZA 2ZJRQ 2DNLA 1M5VC 1X4BA 3Q2TC 2MPUA 2WBRA 1VBZA 1Q82T 2EK6A 3G71S 5LXYA 1WF2A 1Q81T 1WG1A 3FEYB 1A9NB 2CQIA 3CF5Q 2L08A 2X1FA 2HVZA 2PEHA 3CTRA 2J8AA 2M2BA 5BJRA 2JWNA 3VAMA 3CC4S 1ZH5A 1F9FA 2HGMA 3NNAA 2DHXA 2B0GA 2KU7A 4A8XA 4QU7A 3B4DA 3BEGB 2KN4A 2CQ1A 4Y0FA 2N3OA 5LJ5Y 1WELA 4RU2A 2RQ4A 1VC5A 1M1KT 1U1NA 3MUMP 2DIVA 5EN1A 4C0OC 1PO6A 5GADU 3RW7A 1N8RT 3S6EA 2XS2A 3TYTA 2KXNB 5JVHQ 3SDEA 1VQLS 1H2VZ 5DDQC 3G96A 2DNNA 2LYVA 2VOPA 1NU4A 2A3JA 2M4MA 2MKHA 1YHQS 5IFMA 2ADBA 1N54B 2DGXA 2M8DB 2GHPA 2KM8B 1VC6A 2KYXA 3SDEB 2CPYA 1QVGR 3MOJB 2YWKA 3G4SS 2KVIA 3JB9k 2CPIA 2CQDA 2AD9A 1CVJA 4P6QA 2RS2A 2E5GA 1WTBA 5GAGU 4IUFA 1P1TA 2QA4S 1RKJA 1FHTA 4IOCQ 2M70A 2XS7A 1SJ4P 2CPFA 3L3CA 2CPXA 2J76E 5IQQA 1NO8A 1WHYA 2ERRA 2OSQA 3MURP 3LQVA 3BO4A 3V4MA 1G2EA 1WHWA 2DH9A 2LECA 2D9OA 2MKSA 4TLQA 2DHSA 3VAFA 1S79A 3J7YU 1SJQA 1YJ9S 1OO0B 2MZTA 5CYJA 2MZ1A 3SXLA 2DK2A 2JVRA 3CCQS 2X1BA 4FXVA 4IO9Q 2F9DA 3CCJS 1VBYA 4TU7A 2XSFA 2DNQA 2MGZA 3CCES 2GO9A 2FY1A 1KC8T 2O3DA 2LKZA 1VQ5S 1Q86T 4W90B 2U1AA 2RQCA 2OSRA 2N82B 2MGZB 3UD4P 1U1LA 2L9WA 3US5A 4TU8A 3CD6S 4F25A 3DXBA 3THPA 5IM0A 4CIOA 1U1OA 1ZZFA 4QPTA 2OJ3A 3IWNC 3G6ES 2I2YA 1SJRA 2M0GB 3P49B 1K73T 2MQPA 4WFNQ 5IM0B 4Y00A 5D77A 4Z2XA 2DGTA 3MD1A 2CJKA 1SJFA 3CULA 1FJEB 4C4WA 4WIIA 3P6YC 5LSLA 3U1MA 3CCUS 5CXTA 3TO8A 5DDRC 2KG1A 3D2WA 1X5OA 3NS5A 1YI2S 1WI6A 3K0JA 1SXLA 1X5SA 2MMYA 2CQGA 3S7RA 2EK1A 3MD3A 4QU6A 3UE2A 2G4BA 5MLCV 2BZ2A 1DZ5A 1D8ZA 2ADCA 3EGNA 1OIAA 2CQ4A 1XN9A 4FXWA 2MKKA 2OIHA 4W92B 2XB2D 2RVJA 5DM7Q 3H2UB 2DNZA 3NS6A 3MXHP 2M88A 2HYIB 2DGUA 1VQ7S 4OZ0A 1S72S 3I56S 1VQMS 2D3OR 5JVGQ 2CPHA 2D9PA 2LCWA 5H1SV 2MHNA 3P5TL 1VQOS 1FNXH 1QVFR 1Q7YT 3THTA 1H2TZ 2MZSA 2DNYA 2LMIA 1AUDA 3S01A 1UP1A 3MUTP 1VQ9S 3RW6A 1JJHA 2FPHX 4WCEQ 1DRZA 4U67Q 2K8GA 1M90T 1X4DA 2YH1A 2N3LA 3J7ZT 1FO1A 5GVQA 1R8PA 2MSSA 2CQCA 2MY7A 1X4CA 1VQKS 3UCUP 1B7FA 5FJ4A 2E44A 1DBDA 2LXIA 2MKJA 4F02A 1YJNS 3G8SA 2RT3A 2DITA 5ITHA 2LA6A 2UP1A 2L41A 2MYFA 2DH8A 3CUNA 4ED5A 4M5DB 2E5HA 1K8AT 1WHVA 3UD3P 3VAGA 2F3JA 1URNA 2DH7A 1BY9A 3CCSS 1X4HA 5LJ3Y 1DHMA 3CCVS 2G0CA 1YIJS 2DNMA 2MY8A 3BO3A 1X5TA 2CQ0A 3OW2R 1WF0A 1X0FA 2YTCA 2J0QD 1YWXA 1OPIA 3S8SA 2LA4A 3EX7B 1VQ8S 2AYEA 3VF0B 2FC9A 2DB1A 2KH9A 1H6KX 3CMAS 2DISA 2KG0A 1M5PC 2LEAA 2NZ4A 3ZZYA 3BO2A 2MQNA 2LEBA 1WHXA 1WEYA 4F26A 3LPYA 2RRAA 5DDPC 4ERDA 4J5OA 3MI7X 1D9AA 1KD1T 2HGNA 5DETA 5GMKa 3TP2A 2KT5A 2VODA 2FHOB 4CQ1A 2DNGA 3CMES 1VC0A 3VAIA 1HL6A 2M7SA 4WFBQ 1HA1A 2DGWA 4CH0S 4LMZA 2NLWA 2DGSA 3BS9A 1U1RA 2M8HA 2E5JA 4ZKAA 2MZRA 1X4AA 4YUDA 1U1MA 3ZZZA 2JVOA 3EGZA 2LQ5A 2SXLA 1RK8A 4PRFA 2OTLS 1M5KC 3UCGA 2X1GA 2MQLA 5HO4A 4CH1A 1R8HA 2AYBA 2QEXS 1U6BA 2Q79A 1JJ4A 5GAEU 2MXYA 3CXCR 1YJWS 2DNKA
chains in the Genus database with same CATH superfamily
2DVIA 3OHBA 2JEIA 4ZVEA 2RU3A 4DV0J 2Z58B 1YBUA 1UAWA 2HHVA 4AXJA 3RZAA 2CDRB 3Q86A 2ZUGA 2MQMA 2XNRA 1JMTA 3LP1A 2QL9B 3BH6B 4CNZA 3SCKE 5KFLA 5DDOC 1TZ0A 3MM5B 1S4FA 1RTDB 1S76D 1CEZA 3IWLA 3I0SB 1UA1A 4DQRA 2DGQA 2SXLA 5D3GB 4DSKA 1YJRA 4OYZA 4WF9Q 3Q8SB 1N88A 2DYAA 5ETLA 3R5JB 3JAMY 4GRSA 2BRLA 5LXRA 3QJLA 5D78A 2IDEA 4F4XA 5F8NA 4JYAJ 3QT7A 4I2QB 3CJKB 1Q4RA 1N5YB 3TW0A 4UY8T 4EFAC 6FDRA 2NYIA 4TY9A 2ACYA 3KK3A 1YGYA 1U47A 3PR5B 4NPOA 3ULHA 1XNQJ 3NMRA 3C14A 3ISND 5T7LB 3GU0A 5D0RA 4ZPWR 3ZZTA 2CPEA 3PJXA 4C3LA 1TK0A 1PGZA 3SV3A 3TUIC 4DZDA 1M1HA 3ITHA 2QLFB 5A0YB 5DM6Q 2PN6A 3HHNB 2CPDA 2COLA 3CDWA 4NA3A 2E5LJ 3SQOP 4OL8A 3A12A 1S9FA 4K4ZA 2WTFA 1QUPA 1NKEA 2N4CA 2W4DA 1HR0F 5DLGA 3NGTA 3DXSX 1EETB 3W7BA 4BWMA 2V9WA 4CCHA 1YQHA 1YX2A 1RHUB 4B3SF 2HFZA 4PYAA 2N3OA 1NKBA 3FCHA 1FF2A 4KTQA 5CCMA 1NUEA 3UDVA 2A3JA 3P8BB 4ZVHA 2W7PA 1VC6A 4DPXA 3EICA 3JB9k 3T6JA 4ZPCA 4P6QA 4R8UB 1MU2A 2ZH5A 3PW7A 1SJ1A 1HHSA 2GJ2A 3TUJC 1SJ4P 1LV5A 1BWVA 1Y5LB 3PXGa 1K1QA 2ERRA 2QGFB 4C8MA 3FSIA 1SKRA 2GX8A 3BO4A 4QR1A 3V4MA 2DH9A 4RW4A 2MKSA 3DLKB 1YJ9S 2UVWA 1CS4A 3MR7A 4QBUA 1M5HA 1RABB 4RLEA 3GIMA 3DI6B 2X1BA 4I7FB 4DS5A 4QWDA 2MGZA 1WKJA 1G1XA 5CYMA 2QYCA 1JIHA 4ZP6A 4UZBA 2C2EA 2WVFA 2FLLA 2IM3A 3P49B 3Q8VA 4GC7A 4WFNQ 4EZ9A 1SC3B 2HHSA 3PKYA 3U1MA 2CZ4A 3W1YC 4K4XA 4DQIA 3AB4B 1GEHA 2J8SA 1T8EA 5DQGA 3OT9A 3UDEA 1RT1A 4IG3B 2W8LA 1C1BB 3UR3C 3TUZC 3QYYA 5A2QU 2GHWA 4RNFA 2YNFB 2CPHA 2F8MA 4RBTA 1ZM2A 1H2TZ 3BBBA 3IG1A 2JNJA 3HVAA 3M2UA 2IC3B 1OS5A 1QAIA 4H4OB 2XZTB 2RJZA 3LP1B 3J7ZT 3PM9A 1VQKS 4C3KA 4N77A 1BQXA 2MYFA 2IJRA 1WNEA 3KK1A 2F3JA 4X62J 3J80Y 3MMBA 2UXDJ 4PG6A 1IQZA 3O5TB 5D0HA 2B43A 5ETNA 2DB1A 4KGMA 4KE5A 4DSEA 4DV4F 1VGYA 2NZ4A 2LEBA 4BCAA 1WC0A 4HDGA 3KJFB 4ECWA 2RQMA 1KFDA 4WP3A 2HGNA 2V34A 5DETA 2IFXA 3KK3B 3AA8A 4RPFA 2K06A 5DS7A 5IZHA 3C14B 5C5JA 2QG9B 3EDQB 3MM8A 3SCLE 4I64A 5AT1B 4DR5J 5KG0A 2JEJA 1HQEA 1FI4A 2L9NA 3R6GB 4DN9A 4Y34A 1D8YA 3GZ7A 1M5KC 3CEDA 5HO4A 4DUYJ 4NRTA 3QFWA 5C25B 4BLGA 3HD2A 4NCGB 1ZETA 1I94F 3E01A 3KLGB 3R1HA 2XYHB 3PDNA 2ZDPA 4FXDA 3ZFVA 2O66A 3G87A 2QYGA 4DL2A 5LOQA 1T0TV 3MMCA 1VQYA 1VOMA 5IWAF 1W2BR 1OSCA 2R42A 3LW5C 1KRPA 4EWTA 3S1TA 2DIUA 3SFUA 3LP0A 2DO0A 4LF1A 5L39A 1VQNS 4KGXB 3CCRS 4WU2A 2MQ8A 1Q5VA 4FVMA 4USHA 1N32F 1S6UA 3BSCA 3SSRA 2BJ9A 4ETZA 1MU2B 1ZS6A 3QGGA 4V19J 4Y6IA 2KTQA 3N5FA 4I56A 1TFWA 2R7QA 2PFDA 2JL9A 3O3LA 4K0KF 2YX7A 1CS4B 2MSTA 4DUZF 4XDDA 4P74A 3DKDA 1HWIA 4DR4J 3VQTA 3BF4A 1HNVB 4K2XA 2ZJPQ 2CYYA 4L3KA 2ACMA 4C7QA 4RW9B 2DNOA 4IQXA 3EZUA 2HHUA 2VOOA 1MMLA 4CLWA 2G1HA 1SCJB 3PIPQ 4C11A 1UEKA 2BABA 4ED8A 4K59A 3B8HA 4U6PA 3ILJA 4H54A 3DLJA 4LBPA 1Y7PA 1Q81T 2C2OB 5K8OA 2IA0A 1S7HA 2V4JB 2UVUA 3RB3A 2PMZD 3N6LA 1DTQB 5KFBA 3BEGB 4ECSA 5LJ5Y 4LRFA 1PC4A 1OY6A 2E1PA 3HHLB 3MM9A 1S99A 3M2VA 3HO1A 3CO0P 4ES2A 3L95X 3IAM9 1F2GA 5A8WA 3ZZRA 4QIEA 3IG1B 5ETRA 6FD1A 3Q89A 4DV2J 1FHTA 1QY7A 4ZVQB 3OHAA 2D41A 2VV5A 5IQQA 3TRGA 4FF3A 4RUCA 3H59A 4J91A 3I9ZA 2DRDA 2N7YA 4WE1A 3ADAC 4RW7B 3GIJA 1U09A 2IRXA 1KN6A 2VQFJ 3UD4P 1FCAA 2YKPA 4F04B 2I5JB 4U7UK 2HHXA 3AA9A 3G6ES 5IM0B 3MD1A 3PFEA 4C4WA 4J90A 1HNIA 5DDRC 1FDNA 2KG1A 3D2WA 2KDOA 4KYZA 2Q66A 1HWJA 2C3UA 1HNZJ 1SXLA 2G2OA 3D9BA 3MPYA 3MM8B 4NXNJ 3HJVA 4G6VB 1PG5B 5MLCV 4DV0F 2NPIA 2HBQB 1TVRB 3H2UB 3O1LA 3IR7B 4ALZA 3TARA 2V4RA 2HQDA 3MF5A 2R2TA 3PX0A 3JSMA 3P5TL 1FNXH 2QA2A 2DCLA 3WX4A 3E01B 3LWLA 2QE5A 4WZMA 3DM2A 1M90T 4Q8FA 1BGXT 1JLCA 1HBUB 2W8KA 1K0VA 3PEJA 5ITHA 1V5IB 1XR5A 2L41A 3IAS9 3ZZUA 4YDXA 1F60B 3NBPA 3P45B 4DX5A 2LXFA 2IMOA 3BO3A 2HBRB 2YKNA 3POTA 2GCFA 1O6XA 1RAEB 3I87A 1XNQF 1RCOB 1NDPA 3QT5A 2KG0A 4ED0A 4IYQA 4ZIVA 1WOOA 3MI7X 2BXJA 3GFYA 2RB7A 2F5GA 4IO1A 1UETA 2G9OA 3T1AA 2M7SA 3DFEA 3PY8A 4LMZA 3I31A 4ES3A 4EBDA 1WC1A 3KKFA 2YNIA 1SL0A 1RT6B 4A47A 4D3HA 3ZZZA 1XR7A 5KG4A 2MEWA 2QN6B 4EO6A 5IT0A 3HSGA 2KJWA 3FZBA 1VBKA 4I4BA 3OUYA 2DNHA 4UOFA 4PQUA 4WP8A 3VV2B 2QO3A 4E0DA 4WU3A 4M94A 3NAIA 4WTYA 4CRJA 1IVZA 5E41A 3B6BA 4U96A 5L8RC 2YKAA 4KKOA 1GXUA 2F9JA 3PV8A 1NDKA 3VQSA 3M1VA 2H4WB 3BM7A 3R9LA 1QLNA 2JFDA 2IM1A 4OLPA 4ZPBA 4YB6A 3DLHA 4ELTA 1W25A 1X4EA 5EGYA 2E9TA 3MM9B 4NLYA 1SC6A 2CPJA 1CBKA 3M2VB 4OI2A 1FJGF 1M5OC 2NQPA 1YTYA 4P9SA 3DOLA 1SJ3P 2LDYA 3NNCA 3QRQA 4K4TA 3UN2A 1WC6A 3GR1A 2OEMA 2OAUA 1Y5NB 2FJBB 1RHMB 2K2PA 3M32B 5DRKA 4R5PA 2KI2A 3PO5A 4P7TA 2CKWA 1QAXA 1S97A 3PW4A 1BLUA 3BZQA 3BR8A 1U8SA 2A6OA 3HULA 3EWGA 4KHRA 1K47A 2RIJA 1WEXA 2ASLA 3CCTA 2C22A 2MJUA 4X64J 2UUAJ 2EVZA 3TAMA 3V4IA 4C8YA 3HZGA 4YHHJ 2YNGA 2ZE2B 5E3QA 2W2NP 1YKWA 1SV5A 3CTRA 5HVHA 2M2BA 2C2MB 2O1PA 3PHTA 1CJTA 3HKWA 1U2CA 4KSEB 4PG8A 3MTJA 2WVDA 3BN4A 2RQ4A 3JS9A 5JMNA 2UU9J 3EVMA 4P73A 4IRKA 4PABA 4TYBA 3PZPA 4IR1A 2VOPA 1YHQS 1VIOA 3TA1A 4JV2A 2J6TA 2NXJA 1SL1A 2RS2A 1HNWF 4RWXA 1S1XA 2XS7A 3DM2B 3TR5A 1UWBA 2R7RA 3CWJA 3DLEB 3KMQA 1UKUA 4MYTA 4ED2A 1N6QB 1XTZA 1UFLA 2WAQD 3W2WB 1QJHA 4ZCKA 4F0MA 1DAXA 3NBPB 3SZ2A 1YSJA 2P9CA 2O3DA 2R7VA 4W90B 2YKNB 3POTB 4J9VA 1NPKA 1B4SA 1EB0A 2HVIA 2MLYA 2PD1A 1TFYA 1FEHA 3VHQA 2GVZA 3GJTB 1BC6A 4KHMA 2MHEA 2QV6A 2BE7D 1Q79A 3H98A 7FDRA 4WIIA 2ZBQA 5LSLA 4C98A 3IM9A 3NGRA 2HNDA 2W2QP 1PAUB 4LF7J 1V9OA 3NS5A 2W24A 4CH7A 4OIXA 3EZOA 1M1GA 5B7WA 2BZ2A 2XGQA 4QIFA 3KUGA 2QRRA 3UNYA 3CJ2A 2XMWA 4ED7A 2FVCA 3ENAA 2VF3A 4JBCA 3EDRB 1T9UA 5BYQA 2BE2A 4ZVUB 3OUYB 1VQMS 2D3OR 2LCWA 3PW2A 3W5YA 3THTA 4QCLA 3CJ0A 1X7VA 4MIAA 3H4BA 1BQMB 3DRXA 2FPHX 3QIPA 1AROP 2CZ9A 4KIAA 2ZZNA 2FVPA 1RWUA 4M63A 1K1SA 3DRYA 3M8QB 2N4DA 1WUUA 5IV4A 4EEYA 2OPRA 4WKYA 5LJ3Y 1DHMA 3N79A 1L3TA 3DOLB 3BKFA 1S1VA 2KT2A 2LA4A 2AYEA 1VQSA 2MQNA 1WHXA 2VC1A 2AMCB 1Q7LB 4J5OA 4DPWA 4C2MA 2CG4A 1TK8A 3SI8A 1R0AA 4HKQA 3CIMA 3BS9A 1U1RA 1NHKL 3KJVA 3KHGA 1GX5A 1ROFA 2UXCJ 3OJSA 2B7CB 2OTLS 4R0JA 3EXYA 3GP9A 5G0RA 4B9MA 3ZTQA 5J1NA 1FTCA 3V4IB 2MKCA 1HWUA 4ZOSA 2RE1A 1VJQA 1TMJA 2QFJA 1HD1A 4F2SA 5DQIA 3NG8A 4ELUA 5HI7A 3QAUA 1CJTB 1SVDA 4DLGA 3H0PA 2E7VA 5DLFA 5AXKA 3VAJA 3VZIA 4F36A 3Q8YA 1QD1A 2NR0A 3IR5B 1PYTA 2I38A 4WKRA 2A18A 1RI7A 4C48A 2VD3A 1Z4UA 4OJHA 1IKWA 2Y0SD 1AZSA 4J9OA 1MNEA 1WWHA 3NCQA 4MKYA 2DRBA 2AKWB 1MG7A 3K8WA 1CC8A 2FVQA 4XO0A 1LWCB 1RUSA 2JRSA 1S1XB 2UUWA 3GONA 3W63A 1UWBB 5AXLA 1CULA 4A48A 2VQFF 1VISA 4F50A 3FGVA 4PAAA 3TEHB 2HHQA 4X4PA 5L1IA 3C6TA 3HSJA 3R5BA 1KKHA 1IM4A 2JFKA 1S6PA 4JI5J 1TV6B 4I68A 2WB4A 4CT8A 2M3DA 3T5LA 2KHDA 2GO8A 1HNZF 2ZOGA 4B02A 3GPAA 2HFNA 4KFBA 4XPCA 3MWBA 2Y1IA 1WG1A 4OX8A 4JI7J 3TJ9A 2AEFA 1IXKA 2HNDB 3FKBA 1S9GB 3BGLA 4OHWA 1PKUA 3TZXA 4LFCJ 3FCVA 3BBFA 4NRUA 2EFVA 3IGVA 4QU7A 4HACA 2FZGB 5KT3A 1HYSB 2DR6A 1LNQA 1U1NA 5F8LA 2AX0A 2CG8A 1N8RT 3JSYA 4OX7A 3KMSA 1HHTP 4J9SA 2V50A 1IM6A 4C0HA 5KFFA 2M8DB 2KM8B 1S4EA 1Y3KA 3GYGA 3H90A 2EBEA 1WKLA 2QA4S 1WKKA 3HVTA 3P96A 4ANDA 3W5XA 4EYHB 4M5IA 3OR1B 4ENOA 2KO1A 5IT9U 2OUGA 5KFNA 1ZM3A 3OPKA 3BQ1A 2B4VA 2VG6A 5CYJA 3SXLA 2DK2A 4OI0A 3FSYA 2XMKA 5I3PA 3NOGA 3KLEB 2OPRB 5C42B 1SC4B 3I9V9 2HFVA 3PYFA 5LM7E 3DDNA 2X7IA 1U4BA 4F25A 4J9KA 1ZZFA 4RKUC 3IWXA 5D4PA 4B9SA 2DGTA 1C0TA 2BACA 3FFIB 3OXFA 5CXTA 1UVLA 4KY3A 4Y2CA 3RRHA 3ISZA 1YI2S 1FRKA 1WI6A 1R0AB 3K0JA 1MW7A 3DLGB 4QW9A 3MD3A 5DG7A 3NCRA 3VGTA 3KJVB 1DZ5A 2ZWPA 4DWIA 2HLUA 2HHWA 2ADCA 3ZZ0A 1EQMA 3MAAB 4GO5X 4YDDB 5U47A 2R4FA 4B9TA 1C4AA 2KFZA 2EG1A 1LWFA 5G0RB 4RUHA 1GQEA 2JHEA 3IO1A 3IP0A 1YBTA 3U1NA 3KLIB 4IH7A 3FQKA 3RBDA 2PMWA 1NXIA 1RP5A 4ID8A 2OPQA 1FNOA 2FJVA 2RU9A 4UUWA 5I42B 4F4KA 1BQNA 3FK4A 2HWHA 3QO9B 2DRAA 1N34J 1SH0A 2E29A 4C8NA 5F8MA 3N5BA 2B3TB 2E7WA 4F7VA 2LXIA 1S1TA 1IR2A 3W60A 3W66A 2DR5A 2V9KA 3W61A 2XY7A 1T94A 4C97A 2QA4G 1D9FA 2HBYB 1AZSB 2VG5A 1LFPA 4U95A 4BHQA 5KG7A 2YBVA 3G82B 3Q8QB 1WEYA 2LDIA 4NEYA 2H5JB 4ZS6A 3WC0A 3D6MB 2KT5A 4OX9F 2GA7A 4UOHA 1YK9A 1DARA 3TOQA 4LSNA 3FJ2A 3O8WA 2AJ1A 3W5ZA 4I0WA 1HA1A 1X9WA 1LXNA 3AODA 4X64F 1GFWB 1IKYA 1HIYA 1S1WA 2H3EB 2JLEA 4NLQA 1U26A 2MZRA 2VJUA 2Y8YA 1S6PB 1RA7A 3OD2A 3EGZA 3BGOP 4EBEA 3H25A 4KGVB 4PWDA 2E1CA 4KFBB 2YWWA 2H65B 1RB0A 4WXWA 3MMAA 5KT6A 2BJ8A 2AYGA 3ELHA 1RYRA 4JI1J 3CE8A 3KJNB 3J81Y 4FBUA 3MOZA 5ETPA 4HACB 3IMQJ 4LJMA 4U8VA 2NSBA 2YKQA 3VAKA 2QC3A 2QLWA 4L73A 3I55S 1OY8A 4N76A 1C1CB 3VGVA 2ILZA 3CCLS 1FXRA 2NPFA 4EGLA 2HQFA 3FCWA 3BV8A 4LSLB 2PT0A 3KG1A 4K5RA 2ZZTA 1YBAA 2F4VF 4W4MA 5F41A 3N28A 7FD1A 4B17A 4F0KA 2ZM6F 5FLXY 3IR6B 4NI2B 1PBAA 2VG6B 3ZZPA 5E3PA 3W9JA 4PWUA 1RWMB 2VJVA 3U1LA 5ETTA 4DR1J 5M2UA 1JLEB 3BREA 1LEOA 2C3MA 4FKYA 3KNAA 3M7VA 2VA3A 4PUOB 2OPSA 4CLYA 2XMUA 2FHJD 4LF9F 2CQ3A 2J9EA 3D6HB 2XO6A 3NNHA 4HL9A 5KFKA 1Q1KA 3Q24A 4URSA 2POKA 1C0TB 1O8BA 3D67A 4DPTA 3CF5Q 2RKIA 2WVEA 1UEUA 5BJRA 2RQKA 1RWXB 5J2NA 4C8KA 5HMWA 1ZH5A 2M5YA 4MTPA 2B0GA 5J1PA 4G1QA 3PJWA 1LWEB 2CQ1A 4Y0FA 2IJFA 3G6XA 2HFSA 1KDNA 2YQ3A 3QFHA 4C0OC 3RW7A 2UV8G 2KXNB 5JVHQ 1REVB 1NK6A 3BYPA 1FE4A 3L7OA 1P9YA 3QJJA 1TU0B 3ZTOA 1P9QC 3MOJB 2CPYA 3LO3A 1JNZB 5EHHA 2AD9A 5A6PA 2E5GA 1UVMA 4IUFA 4PQAA 4Q8EA 1LQ9A 3RG6A 1RAHB 3TANA 3L3CA 2CJ9A 3OLAA 4GVBA 3M05A 1S1TB 2AU0A 3HSDA 2HW3A 3P5BP 5HLFA 1D1UA 2R7UA 1Q8BA 3HZEA 2LKZA 4K50A 4GKJJ 2H5IB 2U1AA 3K8VA 4ICLA 5KFRA 3DCAA 3K5NA 2HK3A 4QPTA 2QFIA 4C8ZA 3HJFA 5K8PA 4CLPA 3K5OA 2UXCF 2DEJA 2PDAA 3MZIA 1DURA 1FRJA 3DYAB 3CO9A 1V3RA 3KUEA 1IKYB 1S1WB 2XMJA 1D8ZA 3CJ5A 3EGNA 2CQ4A 4HT7A 1BMQB 1EIYB 2DNZA 4LVOP 4IH5A 4YMEA 2B5JA 4OYOA 4TVAB 4X4TA 2RILA 4DR2J 2D9PA 4DBQA 2Q3PA 3MPWA 3EJMA 1RTIA 4EI2A 1SL2A 3BSNA 1VQ9S 3MMAB 1JJHA 2ROEA 1TAQA 2MLXA 2HRYA 1S49A 1AB8A 1N56A 2OKQA 2B56A 2GGPA 4RUBA 1FD8A 4RZRA 4PXCA 2EBGA 1SQFA 1RT2A 4CO2A 1SC1B 3OTCA 1TMMA 2F7VA 4LFAJ 3GG1A 4DSLA 1U48A 2EFNA 3BGRA 1X5TA 1UZHA 3OW2R 3QZ8A 1L3UA 1OY9A 2C3PA 3CJ8A 2LEAA 3ZZYA 5CZXA 3LTOA 4F26A 3BGUA 4C8LA 3T5HA 1T05A 3EPIA 1DQAA 2VPZB 2DXFA 1IJEB 1J5OB 3QRRA 3VTIA 4WFBQ 3R5DA 3SSQA 2HIYA 2DGSA 4Y2AA 2JVOA 3FBBA 5HAOA 1FFSB 4RW6B 2K1RA 4LFCF 2DNKA 3M9OB 4ZLLA 4IKAA 2W9CB 3CPWR 1S7IA 1ZZNA 4JI2J 3M2RA 4ER8A 2OD4A 2ZUAA 5J2NB 2XNQA 3A8JA 2IJNA 5I3UA 5AJ3J 5C24B 1TUWA 4G1QB 2K3KA 2C2KB 1X4FA 3F41A 1TKZA 3KXDA 1FT8A 1RLDA 2U2FA 2V8VA 1OWXA 2FTRA 5DQHA 3E2EA 2BOPA 4TYAA 1H73A 4PKDB 4LQ3A 5J1EB 5B09A 5L38A 4Q2MA 2KZZA 3MR3A 4V19X 2QTWA 4LQ9A 3SCIE 1S6QA 2JLGA 4G65A 4LR7A 2UUBJ 4YEAA 2VPXB 1RT3A 5DZ6A 3DHWC 4GVBB 2B9YA 1T9TA 3IRWP 2BQRA 2GVDA 3R7SB 1RTJA 2AW0A 4N47A 5HP1B 1WEZA 4M5MA 1UW4A 2DHGA 4NA2A 4A8WA 3TX0A 4LF4J 3GV8B 2B9WA 5KG6A 4X4RA 4X4UA 3OXLA 3D0GE 1KQGB 4ILMA 2RD5C 1FXDA 4OYIA 3KHLA 2CQ2A 3SV4A 2VQEJ 2OEJA 4ZJQA 2KFYA 2YKMB 3QZ7A 3TZZA 2IBOA 2XI2A 1GX6A 3RJMB 1B0PA 3CVKA 4FYWB 1Y4ZB 3OVSA 1WC4A 3C16B 4F4YA 1SQEA 3R3TA 5GMDA 3T1YF 1XMQF 3I0RB 4USJC 3MECB 1JJCB 1F5BA 3MM6A 1PO6A 2JZ5A 2XQCA 3KYLA 2B5JB 4QIVA 1GK8A 1N34F 2DNNA 2HQIA 2LYVA 1R6VA 4W98A 3PYEA 3CJ4A 5B0FA 1RTHA 2DGXA 2ZEJA 4DFJA 3JSRA 3LH2S 2RMLA 1CVJA 1RTIB 5FIIA 3QPIA 1HW8A 1JLGB 4OHXA 4ZP8A 2OLWA 1NO8A 1WHYA 2FY8A 1WDDA 3MAHA 4YY3F 3AJ2A 2MZTA 4ES1A 4IOBA 2JVRA 2XMVA 1R8CA 3KLHA 5L1JA 3BGFA 4WBFA 5KT4A 1BXNA 1RT2B 4PWWA 2IRUA 5KFHA 2Z2MA 5IS2A 1RBOB 4CLUA 2ZBCA 1NCLA 2XLKA 1HQ2A 1SKSA 1R6YA 2RDDA 3BGRB 2N82B 2C28A 1KQKA 2R8HA 4WPAA 1L5UA 4JB8B 1MWYA 2GHVC 4EO8A 4UW2A 3BQ0A 2I2YA 4UZCA 1VI7A 4YR2A 5D77A 1SJFA 5B0BA 1FJEB 1MSWD 4CLLA 2BW2A 1FWPA 3LGNA 5BR8J 2HVEA 2EK1A 3S7RA 3NL0A 4KC5A 2MTLA 4FXWA 2MKKA 2BX6A 2XB2D 1YG0A 2RVJA 1WD6A 2R3VA 3MXHP 4KV8B 2R7SA 2B9EA 4G3IA 2DGUA 2K1RB 5D8HB 4DG1B 1B7YB 1IBCB 2MHNA 3HKZD 3OFGA 2DKOB 3Q8UA 3Q0AA 3AHPA 2MZSA 4NLUA 4FF2A 1UP1A 2GC8A 1ZPVA 2A1BA 2Z57B 1FWLA 4USVA 4F2RA 3R6LB 2RHQB 5I3UB 5GVQA 1XC9A 5AE3A 1WOPA 2EFQA 2CQCA 4DR6F 4M5DA 1PJ6A 4F02A 1EKRA 2NCKL 1HQUB 4K2JA 5J2QA 5D4LA 2E5HA 1WHVA 3VAGA 4FDFA 4J9LA 2VU5A 3D6TB 1FE0A 1HHQA 1QDUB 5KFSA 4OLOA 5IQ6A 4LBIA 4DF8A 3UW1A 3EX7B 3K59A 3GSIA 4DQPA 4DR1F 2D3O1 3ZO7A 4ERDA 4M5GA 4MH8A 2VFVA 3TP2A 4P75A 4UY85 4USUA 4PG5A 4PPDA 4DR3F 1SUQA 1HNXF 1HL6A 2BRKA 4ZVPB 2DPIA 2GVDB 1JX4A 3VGSA 4HI2A 3NEKA 2ZNZA 1U1MA 4DI6A 1DY3A 4NLOA 4PRFA 3UCGA 4RW8B 4F67A 4RBUA 5KG5A 3IFEA 1LK5A 1UVJA 4FZVA 1Q78A 1AFJA 3C15B 4RU9A 4QQBA 4YS2A 2YH0A 3PNIA 3MM5A 2XHCA 3AOBA 5CAAA 1F1BB 1H38A 1RTDA 2RRBA 2V67A 2AJ0A 3N9UC 1M0SA 1VCTA 3I0SA 1A7GE 3TX8A 5D3GA 1HI8A 3G8TA 4P71A 3MM6B 4WWSA 4ZVRB 4YB5A 2BW7A 3K5PA 4LF5J 1B0VA 1NJIT 4I2QA 3UDCA 1N5YA 4A8OA 2XY6A 4KH1B 2Y1LB 2AV5A 1NPRA 1JLQB 1PIEA 1JLBA 4WFXA 4FYYB 5IT9Y 2E9ZA 2ZHBA 3KLHB 1T3OA 1HWLA 4CO5A 3OXGA 2GJIA 3MEDA 3QBCA 3WIUA 4ECTA 1R7IA 4HI1A 3DGPA 3SBMA 4DU7A 2VDHA 2BDPA 2LU2A 4QYZK 2BKPA 2D1CA 1KOHA 1YRXA 4A8KA 3DRRA 4CO3A 3PFOA 2QMWA 1TL1B 1X4BA 3Q2TC 1EETA 1VBZA 3M8WA 4O44B 3GV5B 4L74A 1S10A 5LT5A 4I2PA 4GVLA 4FYXB 3THVA 1QSLA 3WHIA 4RU2A 4H4KA 5EX0A 3NAHA 1FERA 2RF2B 4UT4A 5H9FK 3X1LB 4XK8C 3EVOA 2RAQA 2ZD1B 3G96A 2LQJA 2IVYA 1MROB 4Y2MA 1VLYA 2J9DE 3SDEB 3G4SS 5E0OA 1UVIA 4QR0A 4L6V3 4L75A 2EKNA 1RKJA 3DLKA 1GNKA 1XR6A 3H5XA 3LQVA 1G2EA 4I7FA 4PCQA 4XDCA 3VAFA 1OO0B 3J7Z5 4JV5J 1YRTA 1FKPA 3CB4A 5J2QB 1U02A 1VJWA 4QR2A 1VBYA 2EFGA 1FRMA 4ED1A 1KC8T 2DPJA 5KG3A 2BJ1A 2J6UA 4E8UA 3DRPB 2W4PA 3DXBA 3THPA 5B0EA 1U1OA 3I4HX 2M0GB 1XMOF 1K73T 4CM2A 1NKCA 4Z2XA 3IS9B 4GKKJ 2HWTA 1DLOA 1HLWA 4Z37A 1SUQB 3W62A 4LF6J 1X5SA 4LF2A 4IG3A 5HVFA 1C1BA 2A10A 4RR5A 3FNNA 3FZ2A 4X2BA 4JI2F 2YKOA 4DV3J 2YNFA 3LOUA 3E51A 1XMBA 1X0PA 4O3RA 3I56S 2RDIA 2IC3A 3RUBL 4F4AA 4H4OA 1VQOS 1HI1A 1Q7YT 2FYXA 1TP7A 1CC7A 1AFIA 2WSFC 3C2PA 1VK3A 4LIWA 1RKIA 4B9VA 2D3UA 1R0CB 3KLVA 1IR0A 3UCUP 4K4UA 4DV1J 2DITA 4K4SA 4MIBA 4AQYF 4NXMJ 1SB6A 3T9NA 2DH7A 4XAKA 4ZK7M 4PG7A 2W7AA 1MN7A 2QLXA 1NK0A 1LW2A 3C6UA 1R43A 1VQ8S 2KL8A 1H0HB 2FC9A 2UZAA 1H6KX 1T9VA 1XERA 2YWHA 2HLTA 4DPOA 1TTHB 2MDAA 4B9LA 3V6JA 2KVQE 4X4VA 2FJDB 2GS8A 1JLBB 4CQ1A 2DNGA 1KNZA 1NK4A 3HHKA 4NLSA 3R5CA 2VQEF 2AJFE 4PZVA 2ZBPA 3T5KA 3MEDB 2R2SA 4TY8B 3TJ8A 1W2IA 3DGPB 5KFQA 5LMUF 5C25A 2MQLA 1R8HA 2HIQA 2VKRA 1RHKB 5J2MB 5K9FA 5GAEU 3DRRB 4NCGA 4ATNA 3KLGA 1HBOB 2XLJA 4OI3A 3PX6A 1T03B 1T9YA 3DU5A 2O01C 5F8IA 4LRDA 1P6TA 1N0UA 2H4YB 2AQ4A 2FGCA 2KZMA 5EWGA 4I2PB 5KFCA 3HK2A 3IRXA 2PFFB 4F3MA 2X3DA 1TUGB 2WW4A 1UJ5A 3MPVA 4C3MA 5LMNJ 2GFFA 2FLOA 1Q53A 1YJTA 2MKIA 3NRBA 1D9DA 3OTOF 3GFHA 4ANCA 2B4UA 2ROPA 2RNEA 3R2DJ 2Q6CA 2VPYB 1RAAB 4ED6A 2V2KA 4JI3J 4WP9A 4WJBA 4QYRA 1JLAA 3R1LA 1KSPA 2DHAA 3SMZA 3QT6A 1HNVA 3P3DA 1U25A 4IFYB 2CQHA 1RU2A 4RW9A 1FKPB 4DSIA 5AXMA 2O67A 1N5TA 4B3OA 4KR0B 4H4KC 3DHXA 1YJUA 2JC1A 4PR6A 4MAKA 4JUZA 5BR8F 2AZ1A 3N4WA 4FF1A 2V4JA 1WOSA 3V2UC 3EGWB 5LXYA 1XIQA 1DTQA 2W01A 2J0XA 1DLOB 1CJVB 3RRGA 3L4BC 1S1UA 3N6NA 4NE9C 2HMIA 3HDSA 1XEZA 3HHLA 2VPWB 1M1KT 1MN9A 4WYLA 2DIVA 4ECUA 3I5AA 5KFVA 1RT4B 1VQLS 2UXBJ 3G86A 3J80U 3FBFA 3PX4A 3TAQA 2VBYA 3NOCA 1F3FA 4HVZA 2CPIA 3K57A 3AXKA 4K8RA 2XULA 2AEJA 3PR4A 3ETMA 4IOCQ 1ITPA 2LP4A 2YWGA 2A6MA 3EMTA 4Q43A 3MURP 4TLQA 4RW7A 4ZVSB 2HK2A 4L72B 5CCLA 2F9DA 4UF4A 3M8RA 3D3BJ 2W2PP 2E1MC 1JB0C 2FY1A 2I5JA 4QWEA 1LW2B 1I3OB 1ZA2B 3V5RA 3C6UB 1PJ5A 1DJ0A 4A4JA 1GMWD 5IM0A 2OJ3A 4FS1A 3WIVA 1NPPA 2UUCF 2B8PA 2QMUB 3DU6A 1R31A 3HHDA 3BPSP 1WC3A 3P6YC 3CCUS 5KFTA 3PW0A 1JWWA 1TVRA 2ZHOA 4DR7J 2CQGA 1MWZA 4BC7A 4WFYA 4YN3B 4ID5A 1NHVA 2YNHB 3G2XA 4DL6A 1KEKA 3GFXA 4FNHA 4J7CA 2MLZA 3A8IA 3NS6A 3X3UA 2XZWA 2XC9A 1NK8A 2OI2A 3HHEA 4OZ0A 3CSKA 4ZJLA 3KHHA 3RB6A 1S72S 2VZ9A 1IKVB 4CO4A 4OV6A 4USMA 3MGJA 4JI8J 5J2PB 5CYQA 3HVRA 1F0XA 1OMSA 2DBBA 2LMIA 3RW6A 2Q1LA 3K58A 1HBUA 5F0WA 1X4DA 3M8YA 3KG4A 4LF5F 1TAUA 4LF8J 1R8PA 2MY7A 3IRXB 2CNOB 3HXMA 5E2QA 3R7NB 5KFGA 5KFWA 4O0NA 4DUTA 2G0CA 2DNMA 3PG9A 1WF0A 1OPIA 2KFNA 3I82A 4Q44A 2KH9A 5F8JA 3OLBA 5T14A 3BO2A 4FNIA 3DMJB 2FVSA 2ILYA 2ALYB 4D3GA 1RWNB 4ZCMA 3TQ1A 2VASA 1YVFA 4OZJA 3M30B 1JLAB 3RAXA 1VC0A 4Q2LA 2IVMA 1RT6A 2VUGA 4QIWD 4NMXA 4WXOA 4CP5A 2OH2A 4NLWA 2HRUA 4B3OB 4KB7A 1KLMB 3MR5A 3ZXWA 2X1GA 1FVSA 3CJQA 1TKTA 5G4DA 4J9NA 1LW0A 1RISA 1U6BA 3RYLA 2R8GA 2GV1A 4Y65A 1HR0J 3ZTRA 1YITS 2AGOA 1FRIA 4RL1A 2DR9A 1RWVB 1YJ7A 4B3SJ 3W9HA 2R9LA 2KRRA 1HI0P 1S1UB 2HMIB 1RU1A 1P27B 3H5YA 3EXCX 3PEHA 4J9UE 2XYPB 4OHYA 5JJBA 1U6FA 1XQIA 2X51A 4N41A 2XG8A 5D0EA 3CDEA 5K8MA 5FD1A 5B0CA 1AXQA 4KRWA 1FRHA 2HQ3A 4JV5F 3CNQP 3M32A 1IKXA 1WG5A 3MMJA 1FX2A 4WFAQ 2AX1A 5I4MA 1RCXB 4JI4F 2VBXA 2M9KA 3M8PB 4DZ6A 2DO4A 2O5DA 2BYCA 1CQMA 1KTVA 4IOAQ 4AYBD 3K5LA 3H2VE 2CWKA 1ZM4A 3CCMS 3AQPA 3GE9A 4YB1P 5KT5A 5IT4A 1HD0A 3HHLC 4X66J 2CPZA 2EWHA 2D7SA 3TVKA 1U1KA 1OYEA 4ZLNA 2PGCA 4CZCA 3PTWA 2ZE2A 2CQBA 1VMBA 2VHGA 3TWZA 3SQGA 3RBZA 2NREA 1NSPA 1Q82T 4OV1A 5CABA 2FJAB 2CQIA 4AL6A 3OL6A 2J8AA 5EX3A 1AT1B 4NZ7A 2QIFA 3OFEA 1VR6A 4DV5J 3AH6A 1U45A 3RBXA 4ID5B 2V6AA 1ZTTA 2W9BA 4M5JA 1VC5A 3T5JA 4ZHRB 3A3NB 1FKOA 4FKXA 2XS2A 4R0EA 1G3OA 1F3VA 3W64A 1X31C 2YWFA 4MKAA 2XYGB 1QVGR 1Q0NA 2BBEA 5CYQB 4NXMF 3DLEA 5KT2A 1P1LA 2OHDA 3ENQA 4DL7A 1N6QA 3UO0A 2CPXA 3W2WA 2YQ1A 4JYAF 3FRYA 2XHWA 1WHWA 2LECA 4DV6J 3UVJB 1HPZB 5SUHA 2J0WA 2ZKUA 4BDPA 4FXVA 4S0MA 3CCJS 2GMJA 3MR2A 3SCJE 2OEKA 4DV4J 1UJ4A 2Q6BA 2HQCA 2OSRA 1EP4A 3ISNC 3US5A 4ANEA 3PRDA 3D66A 3OR2B 5HBMA 4I6YA 3D0HE 4BC9A 3NY0A 1S0OA 1Q95G 2CJKA 1ZBTA 2E5LF 2QSFA 5L9XA 1J5EJ 3M6WA 3RR8A 1VS3A 2JLFA 4URGA 5DM7Q 5KFPA 2QMXA 5ADZA 3HMJG 4IG0B 1TKTB 1LW0B 1ZAXA 2C2ZB 1WDTA 2NYHA 2B51A 4DCOB 2DR7A 1T9WA 1BD6A 1NJYA 1BQMA 5H1SV 4OI4A 1V6HA 5LMNF 1H7WA 1U24A 4DXLA 1RQ0A 2QX0A 5IC4B 2P5VA 2HNZB 2BM1A 4NLDA 4OFZA 3GIRA 3M8QA 4CNYA 4ZVGA 1NDCA 1FTRA 4M1KA 2RT3A 3Q22A 2DH8A 2DXEA 2W25A 3JQKA 1FRXA 1SIZA 4JI3F 1BY9A 2IAJB 3CCSS 4JV1A 1L3VA 3LF0A 1LKZA 4YP3A 4OMFG 3QLHA 2J0QD 2HHTA 2FLPA 1KQFB 2EEYA 1S57A 4O3SA 2BA9A 2DISA 3E8OA 1IKXB 3B54A 4K0KJ 1MLAA 4ZITA 1VRUB 1NK7A 3DOMA 3HSZA 3Q8RB 4B9NA 1N36J 5RUBA 4NOHA 2DGWA 2Y3YA 2Z2LA 3AOAA 3QRPA 2EI5A 1AUSL 1Z2LA 5F9LA 4UOGA 4OZ3A 4HEA9 1MMNA 3D1QA 3PRBA 2JH3A 4P72A 2V0NA 2HEKA 4USTA 1OQ3A 2PA3A 3KK2A 3JYTB 5ETMA 3GJSB 3MEGA 2QL7B 5HATA 2YPYA 3SQGB 1U1QA 4J9MA 5FDLB 1VQ6S 1FXLA 5H9EK 2B9XA 3SSSA 1VIXA 1RT7A 3U27A 2GMLA 3TNVA 1UA0A 2UXBF 4P2MA 4F0HA 4O23A 1WF1A 2PSZA 2W9BB 1H98A 2DGVA 2AHOB 1KOOA 4NWBA 3I5CA 3EVWA 3Q2SC 2QLJB 1FKOB 2D69A 2BEFA 5K20B 3G6YA 2P2CB 4P2XA 5D4OA 2WONA 1LWCA 4DCJB 2EC2A 3QGIA 4O3NA 3AD9C 4X62F 3LAMA 5M2RA 2Y8WA 2UXDF 1KWMA 4IRDA 3D28A 4TKTA 1OSDA 2YXLA 2Y9HA 2QL5B 3L7PA 2BQ3A 3DLLQ 3R27A 4ED4A 5HQMA 2FB0A 3QWPA 1NMEB 4NLVA 3K7RA 2J6SA 1JK9B 1TV6A 5DO2A 1IQTA 3OFHA 2F8EX 3D4JA 3MPUB 5HROB 3VGUA 1Z2ZA 2CJQA 2WOMB 1EP4B 5F0UA 4GC6A 2V2QA 1H2UX 4NLXA 2HZCA 1YZ7A 2DNRA 4DR5F 1T7PA 3J81j 4PYDA 1FX4A 5HBMB 3ICLA 4DSJA 1FNMA 4HTIA 4DUYF 1S9GA 1NSQA 1U49A 1WF2A 3DOKB 2AIRB 2X1FA 5L1KA 4ZPTR 1ZOTA 1HYSA 4OYXA 3DGVA 2FJXA 2AT1B 1F2HA 3NNAA 1XBWA 2DHXA 2CVIA 2D74B 4ITSA 4JI8F 4OYMA 5A6WA 4YR0A 1ZM9A 1S0VA 1F6TA 5GADU 2XI3A 3TYTA 2EXUA 2F4FA 5THWA 3GG0A 4LF8F 1QE1A 3P4UB 2BOAA 2GHPA 4G1IA 1OJ4A 3PRVA 1O5JA 3OR1A 5GAGU 2CDQA 2XEXA 2YWEA 5KG2A 2XZDB 4CYUB 2IM0A 5L1LA 1S79A 2HG4A 3KLEA 4QJVA 5E3RA 5C42A 3KOAA 4LSZB 3F0NA 3VVUA 1SH2A 5E33A 3ZNJ1 4FVCA 3PW5A 3QLHB 3BBCA 4DFKA 1QUVA 2L9WA 4DR4F 2V2VA 1SI9A 3CT9A 3QSYB 2BUNA 3FFIA 3O2IA 5K14A 4CT9A 3Q83A 3GILA 2C3OA 2NXUA 3DOMB 3CULA 4OYWA 1RWKB 2D3ZA 2W2OP 2FQQB 3DLGA 1X5OA 4AE5A 1OPZA 2OO4A 3IBWA 3OTEA 5HSPA 2MMYA 3MAAA 5L9NA 2NS1B 2V8HA 3OVBA 2B6AB 2DY9A 3EUNA 3A1YG 3KLIA 4DCPB 2HYIB 2IMWP 4KGKA 3KK2B 3MEGB 4MFBB 3Q23A 2DHHA 2GIRA 3FMBA 5I42A 1VYAA 4QZVB 3QO9A 3M4XA 4ZN3A 5IV3A 1RT7B 4X4QA 4I1TA 4NL5A 3D54A 2ZVSA 1Y5IB 2YH1A 1AA1B 3MEEB 1NB2A 5DJBA 2OMOA 3VR1A 1FJGJ 3E3XA 3M6XA 4DV2F 3G8SA 4TQRA 4MIWA 2UP1A 1NZ8A 1K8AT 2H54B 4IQMA 4O3OA 4EUVA 3G82A 2CQ0A 3HFKA 1ZYQA 2WONB 2ASYA 3TA0A 1DFDA 3IGNA 2BKOA 2OD6A 1TKXB 2HBZB 2FGOA 4X66F 3CMES 4OZ2A 3VZHA 5KFIA 5GAEI 4OQJA 3D1OA 3ETOA 3H20A 5E3AA 1YLXA 2VFUA 1KVKA 2M8HA 3MM7B 4O4GA 2CZVC 3D5MA 4OX6A 3HFVA 4J9PA 2GQQA 4NXNF 2X3GA 1KHVA 5B0GA 4H4MB 1JJ4A 4DV5F 3JSBA 5E5NA 2IDLA 1BWEA 3CD7A 5CZVA 4OZ5A 4HT5A 3H7HB 3C46A 4C6AA 4DL5A 2DGOA 2GNKA 2I0XA 2ZH2A 5LSOA 3LP2A 1FKAF 1C1CA 4NASA 3CJSA 3CD0A 3W2VA 2E5IA 4LSLA 1A6LA 2NUUG 4FP9A 1SBRA 5A2QY 3CCWA 1WG4A 4F3QA 2KXFA 1HNWJ 1QE1B 3K89A 4O4RA 4DV6F 2CWXA 1VBXA 3R5AA 2VFTA 4NI2A 2XO7A 4ZPDA 1PYSB 1IBLJ 4PG4A 3ET6A 1TK5A 1JQGA 4AUKA 4Q0BA 1HARA 4HHHA 3O6QA 2V94A 4QW8A 4L3NA 4WFZA 4K7QA 2AP6A 3PYGA 5KOXA 4NX9A 3UFCX 4A8MP 4NCBA 1WJ9A 4KT0C 4XIUA 3UI3A 1JLEA 1HBNA 3PO4A 4PUOA 5BYSA 1JJ2R 1UVNA 1JKHA 1VRQC 2LU1A 9RUBA 2IVFB 1RZMA 2LXUA 2DY1A 3CJTA 4DL3A 2ZOFA 4OZ1A 4N5SA 2BR0A 1J5EF 3UWTA 2KM8C 2ROGA 2V5HG 3ITHB 2AGPA 5K14B 4ZIWA 4JP8A 2BVZA 4RNNA 3QNWB 1EJ7L 3U7JA 4P2FA 3OV7A 2L08A 2HVZA 2HHHJ 5KOWA 4LT6A 4DEZA 4ZLPA 1LWEA 2KB2A 2V68A 3RTVA 3W8PA 3MR6A 3H5SA 2VKZG 1REVA 1FDDA 1OYDA 4X4NA 2YPZA 1KS2A 3I6PA 4ZPAA 4JV0A 2ADBA 2WB1D 2E7XA 2YWKA 2KVIA 3HT3A 1WTBA 5BYRA 2ZC3A 2EFOA 2Z30B 3GWCA 4DMZA 3ENVA 3A8EA 2QJ3A 2D9OA 2DHSA 4GO7X 4IFVA 4DU8A 1RGVA 1PSDA 2OMLA 2F8HA 4RW4B 2HNYA 2JDJA 4HH1A 2DNQA 2NXCA 3CCES 3QT8A 3HCXA 3LA0A 3TAPA 1N36F 3QIDA 2MGZB 1U1LA 4CDIA 2LLZA 2CUYA 5CYMB 3GFZA 1Y11A 1VFJA 4DQSA 5ETSA 3I4PA 1RHRB 4Y00A 4DX6A 1UW9A 5ETQA 4U7CA 1V3SA 3DYAA 1IBKJ 4TLRA 2UUAF 2JEFA 3OTDA 4YHHF 4KGZB 4ZVTB 3J81U 4RWWA 4O4GB 2OIHA 2R8KA 4YR3A 2H5EA 4R25A 4NLPA 3IM8A 1RT1B 4ZVFA 2UU9F 1PILA 3AT1B 5JVGQ 3C19A 3AD7C 1QVFR 4FS2A 4FYDA 3NGUA 2GAHC 5D6GA 4E98A 2P6TA 3M2UB 4Q7AA 5FLXU 3LP2B 1KP6A 2MKYA 4YQWA 4UOCA 5KFZA 2ATLA 4OYBA 3W2VB 2PI5A 3TUPA 1EHWA 1QAYA 3CCVS 3KK1B 4WTOB 1D0EA 4M5HA 1YWXA 3MMBB 2CJXB 4NEZA 3VF0B 1F9EB 2RH3A 2IBKA 2R7XA 5HANA 1QSYA 3DDKA 3H2LA 1J5OA 1C2PA 3ET6B 4Q0BB 2VDIA 4NYOA 2YY3A 3KTQA 4ZP7A 3TZYA 4ILRA 2VA2A 2VODA 4K4YA 2XMMA 3VAIA 4TN2A 3WX8A 2OFHX 4CH0S 5F8GA 2VB6A 1HBNB 2ZOMA 4ZKAA 1NHUA 4WYWA 4LF7F 3FBEA 4RW6A 1JKHB 1RK8A 3N6MA 3JTPA 2YQ0A 1HQEB 4CH1A 3OSPA 3HP6A 2W9CA 2LQBA 3GLJA 1YJWS 3NS7B 2MQOA 1B64A 1U1PA 1I6JA 1LWXA 2XWYA 3EPGA 2RUGA 3BYRA 1VLOA 2UV8A 3QSIA 2HS3A 1XJWB 5C24A 3AOCA 2KRBA 2N7CA 3Q8PB 3MAQA 2MB0B 2HQGA 3PIOQ 4FN5A 2F65A 2RS8A 5C2CA 3VAHA 4HH0A 3MMCB 4EZ6A 4FPRA 4LVNP 2MZJA 1AW0A 2VFSA 5J1EA 2LFVA 2G1DA 1RHJB 3LP0B 2LVWA 4UQGA 2CJBA 5L46A 1CLFA 2XMAA 1FFGB 5B0AA 2OELA 1UCNA 1EZZB 2AYMA 3LALA 4Y3CA 4B3TJ 3TVZA 5CH7B 2ZHAA 5HP1A 2Y0BB 4IFVB 3RU0A 2HNYB 2WVBA 3AB2B 1UFWA 4UUXA 4MK8A 2OTJS 2A2CA 4DN0A 1SPBP 2DNPA 2YKMA 3CGIA 4OZNA 3NXZA 3MDFA 2ZJRQ 2DNLA 4C11B 2MPUA 3C16A 3TI0A 3J7AN 2ASJA 2KJVA 4B9UA 2PEHA 2VC0A 2IA6A 2WHOA 4LUBA 3I0RA 4I69A 5E3CA 3TQEA 3VVTA 3MECA 1FD2A 1H72C 3CC4S 5KFAA 5F8HA 2EFPA 3RRKA 3NGDA 1IWAA 4QWCA 4AT1B 2ABYA 2LQ9A 5DGBA 2R8IA 3OBIA 1E6VA 1X9SA 3AJDA 1KHWA 4WIQA 4OHVA 2MKHA 1Y00A 1Z1ZA 3TVYA 3LGMA 2B8QA 3F73A 1JLGA 2PO4A 4ZVOB 5B0DA 5A8WB 1KR4A 2W4CA 2GAGC 4M95A 2FD2A 1NK5A 1YRUA 2RDJA 3J7YU 4TXSA 4U7UD 2Y1JA 1YJVA 2FIUA 2CJAA 1IN0A 1WTFA 3MTKA 4WE1B 2XCPA 4ED3A 3QATA 5LL6d 3RB0A 3GJRB 4QIGA 4OX9J 3AXMA 3M8ZA 3FUYA 1OQ6A 2AJ4A 4JI5F 1G4CA 4DL0C 1UTAA 5ETOA 2MQPA 3OL7A 2FZCB 4RO0A 5DG8A 2J9CA 3GCWP 2WZ1A 5KFDA 3OVAA 5AE2A 2ZH7A 4ECQA 4ETXA 3JTNA 2RUSA 3WQPA 1HNIB 1HW9A 2ZDOA 4DOZA 1EX8A 3T19A 4JI7F 2BV3A 4HYKA 2JJ4D 4KV8A 4ZMMA 4MKBA 4O3QA 3LAKA 4KBIA 5KG1A 1X8DA 4PXEA 1Q8LA 2M88A 4DG1A 4DFMA 3T1HJ 3J7A1 3IBCB 2CNNB 4PXDA 3V81A 3FC9A 3A3OB 2FHJA 3R2CJ 2C1EB 1C4CA 2WBMA 1IR1A 1M5SA 4WCEQ 2B7BB 3JSMB 1ZAWA 5D15A 2ZZMA 1HQUA 3IA0A 1HMVA 1X4CA 5CHCB 2F1FA 1GAOA 1RWPB 4TNOA 5FJ4A 4LRCA 4M8LA 1JLCB 1UPPA 3CUNA 1IBLF 3R97A 1SH3A 4PEOA 3R8YA 5EUHA 2F4VJ 1X4HA 2IYGA 1KONA 2AJQA 4AL7A 2DEIA 2ZM6J 1S0NA 1NLKL 4LREA 1M5PC 1IWGA 4Y2KA 2G13A 2R8JA 2RRAA 4P52A 2RSQA 4IR9A 2V2ZA 2YVSA 1EQ0A 3NGKA 2FHOB 2H51B 5KFYA 3OQ2A 3FMWA 2F63A 3L7UA 1FWKA 3BJYA 4FPIA 4LF9J 1VDHA 4RW8A 2VBZA 2A2DA 4N8NA 2ZH9A 4I6AA 1I1GA 2LQ5A 3CJ3A 3M9MB 1NSKL 2R7WA 2CADA 3CDBA 3H42A 2HHHF 2YNIB 2AZ3A 2BMBA 1CJUA 4DJBA 3TA2A 3C15A 4DX8H 3JQMA 2HZAA 3GSDA 4EU0A 2V69A 1O51A 4NZ0A 4PQUB 2ATCB 3F56A 2PA8D 3VCDA 1N5QA 5GAHU 4A8QA 2Q43A 2XS5A 4CI0B 3W65A 4ZCLA 1U0HA 4KKOB 4QYZJ 3M1VB 2FC8A 2V8DA 5EWFA 3NP5A 1E6VB 1CJKA 1UWAA 4HR2A 4AD6A 1UEVA 3KDNA 5HN0A 2M52A 2XSJA 4A8FA 3DDIA 1JLQA 1VHIA 3LPEA 3LANA 1RJJA 1TL4A 1S6OA 1G7CB 1URRA 5HMYA 2X1AA 4Q45A 5H9FJ 3H40A 3QGPA 4USWA 4R5PB 4O0IA 1K0TA 3G9CA 1FDAA 2HVDA 2ZH6A 4A46A 1U2RA 1FESA 4J9RA 3KG0A 3C3LA 1RYSA 4NLTA 2HPUA 1IBKF 3UCZP 3OFFA 2C2NA 4IH6A 1TL1A 1HBMA 4OI6A 1CPZA 2Z4PA 4OJ3A 2BJ3A 1Q8KA 2Y1RI 4OJGA 4O44A 1RBAA 1J27A 2ZKTA 3UPFA 2ZH3A 3K5MA 3L09A 5GADI 3RAQA 4P10A 3G71S 3MHYA 3TAMB 2OP5A 5DGAA 4OHZA 2NXNA 2YNGB 2FHMA 2Z2YB 1F5AA 4U9RA 3HVWA 2RF2A 1SV5B 4RBVA 1NK9A 3AJ1A 4KJIA 5GAGI 1WELA 1ULRA 2GQCA 2ZD1A 4X84A 1MROA 4JI1F 2WCXA 3S6EA 4LFBJ 2ZNYA 2BM0A 4RNOA 1H7XA 3SDEA 5HMZA 4KQZA 1S12A 4KO0A 1NU4A 2HS4A 1GXLA 3V81B 1GXTA 5D4NA 2ZITA 3FEZA 2CQDA 2R2UA 3OTBA 1P1TA 5KTQA 2CXEA 3GTYX 3JTOA 4JI6J 3T41A 2H48B 3W3SA 1NM2A 1F5CA 1HMVB 2KT3A 1G6BA 2QSWA 4KPYA 1XNRJ 1LXJA 3WZ0A 3ZTSA 1S5ZA 4IO9Q 3FDSA 2E66A 2J7WA 3DRPA 3QWUA 2JC0A 4CO1A 4YB7A 2YX4A 3HM9A 4ECZA 3DC2A 1B70B 1NJZA 3T9ZA 2W1BA 1R3NA 1UPMB 3IS9A 4NA1A 2ZC4A 3IWNC 2IYIA 1REGX 3O44A 1RWOB 1FRLA 5JXSA 2GMHA 3D7SB 4IRCA 2GVZB 1PJ7A 1ZA1B 3A8KA 3FRZA 3TO8A 2PIIA 1RE1B 1UL3A 1FK9A 2R2RA 1T95A 1OIAA 4W92B 2W7OA 3KLFA 2BJ7A 1CJUB 2CNLB 5K5MA 5KAKA 1JXEA 3PHEA 2BE2B 1SKUB 3RR7A 5ETKA 3NWGA 2IPOB 4CLSA 4B3RJ 3LGHA 2K8GA 9ATCB 2VH7A 1JLFA 2IHR1 1C0UA 1Q16B 2MSSA 1UVKA 3U02A 3QIPB 1N33J 4P2SA 1B7FA 5B08A 2DT9A 1U0HB 3DRSA 2G2YA 1S0MA 4B3TF 4FYVB 1CJKB 4CLZA 1YIJS 1RXOB 4A8YA 2NXEA 4J9QA 1E6YA 4DLEA 2BJEA 1ICEB 2Z56B 2XSJB 2DD8S 1S1VB 4Y28C 8ATCB 3LPYA 4GKJF 1PC5A 1ZTWA 1KD1T 4QOTA 1QAJA 1VHFA 4XPEA 4FBTA 3BQ2A 1YDLA 1TQLA 3RAMA 4TY8A 1GMVA 2ZH1A 5HMXA 5LSRA 3C66A 3NWRA 3OJUA 5HQLA 2KYZA 1YZ6A 5J2MA 3N0VA 2PI4A 4CLTA 1BUXA 1HBOA 1HBMB 1R8AA 2MXYA 1T03A 3M9NB 1N0VC 3CC7S 1D3WA 3T1YJ 1XMQJ 3WC2A 2EC0A 1NH7A 1NSAA 2V63A 4DR2F 2B4OA 3HI9A 1A0OB 4M5LA 4MT1A 2L9DA 3B82A 3EYZA 4EMDA 1UMJA 1N52B 3NCPA 4V1Ak 2VONA 3FEXB 3I32A 1LK7A 2JX2A 2GQ2A 3CC2S 1FVQA 2DCUB 2F40A 1TL7A 4KO0B 4KHPJ 2JEGA 4AL5A 1UZDA 1SQGA 1IKWB 1EARA 4BS2A 4LFAF 1TUVA 1RTZA 4YY3J 1QTMA 3A3PB 3H4DA 4IFYA 1WI8A 2FVRA 1NB7A 2PE8A 4DL4A 2AWZA 1U0SA 5SZTA 4JI0J 1U2FA 4E2FB 2KXHA 5A8KA 1CULB 4ECXA 3VALA 1IBMJ 3IBFB 2HAFA 1DQ8A 3C6TB 4WK1A 4Z7CA 5F3TA 1X5PA 2HKEA 2QT7A 4UTGA 2J7UA 1R8BA 2E9RX 2VIHA 2GZOA 1M5VC 2RHSB 1CJVA 2E1RA 1S77D 4NYZA 5BXIA 5IXUA 2DXDA 4K4VA 5MAOA 3T1HF 2AJ2A 1XK8A 2E1AA 4QPXA 1H74A 1FK9B 2VICA 3PACA 2EPIA 2VBWA 1UJ6A 3B4DA 3WDOA 1RT4A 1N48A 2Z2ZA 3MUMP 2V8GA 3GV7B 3HLUA 5AJ3F 2P9EA 3MFIA 3KLFB 1BE4A 3JAMU 1H2VZ 2P6SA 4HHJA 1SIWB 1S48A 1NAQA 2CRLA 1N54B 4DR6J 1ELOA 3SFGA 3I5BA 3UQSA 4DDFA 3TJAA 4USIA 3FSXA 1JLFB 1C0UB 3ONQA 3HVTB 5C7PA 1Y10A 2UUBF 3DRSB 1FA0A 3CCQS 2UVVA 1RT5A 4RJVA 1MMDA 4CO0A 3ZTPA 1VQ5S 2YX1A 2CA9A 1GH8A 1E6YB 2HVHA 1NNDA 2AF6A 1RA6A 1S59A 4TU8A 4LF4F 3CD6S 2FLNA 4U8YA 4DR3J 3UDLA 3CDAA 1HNXJ 3DNCA 1PBUA 3K2YA 4MYUA 4QWAA 1APSA 2C2DA 3GJQB 5I3QA 4F8RA 2YNHA 4RNMA 2I9SA 4C0BA 3I96A 2G4BA 4IDKA 2I8EA 3V6DA 1F9HA 1RACB 5AE1A 1IKVA 1N5VA 4C9DA 5J2PA 3QQCD 5DG9A 2PMHA 3BPDA 1LWFB 2L48A 4MKVA 3D68A 4HHUA 2DNYA 1GT8A 3GYNA 1Q5YA 3HF5A 3CCZA 3S01A 1RWWB 3SYZA 4NYPA 1RHQB 4U67Q 2OPQB 4P7VA 3HT0A 1BQNB 3BH7B 2CNKB 2PC6A 3BN7A 1B3TA 4ED5A 3PCOB 1Y3JA 1NBEB 1TL7B 2H1YA 3DMJA 5M2PA 1W7WA 4LRBA 1PCAA 3CMAS 2VG5B 3M30A 2W9AA 3AFGA 2LEPA 2IRYA 3AQOA 1N5SA 4Q5VA 1EAYC 2HRTA 3PVXA 8RUCA 1IJFB 1D9AA 3G6VA 1PAEX 2IIHA 2NUHA 2ZBIA 4PXBA 3GIKA 3KWMA 2KKHA 1LOUA 5A8KB 1CSJA 4NMLA 2G0JA 4OYAA 4LSNB 2WW8A 2W2MP 1KLMA 1T11A 3IXQA 5A8RA 2JSXA 1KVIA 2P9GA 2GIQA 4I67A 1Y9OA 3R5GA 2QEXS 3BKUA 3PJ9A 1TL3A 2HWIA 2MQQA 2R7TA 2GIFA 1VRTA 4CLKA 4PWDB 1GMUA 4MMOA 2UVRA 1NH8A 4LFBF 2P8IA 5EDWA 5F9NA 4CLFA 4DPYA 5IOLA 1VQ4S 3EE3A 2MZQA 3BKTA 1L3SA 3B4MA 4ZPVR 5CD4H 4JI6F 4USKA 2CVEA 1RAIB 3EGVA 1HWKA 1L3KA 2J5AA 1QM9A 3JQJA 1XNRF 3M8PA 1WORA 4TU9A 3ZC4A 3D3CJ 2C2RA 1RAJA 4NZ6A 2J0SD 1NRKA 2IY5B 2ZBRA 3SIPB 1K9MT 3MUVP 4RNHA 1V5VA 4B3MJ 2KHCA 1FJCA 1KBRA 1RT5B 4ECRA 2MJNA 2ZH4A 3OL9A 3MFHA 1ZAVA 1XMOJ 3GCXP 1U8WA 3BSOA 1BHNA 1FJ7A 1LFWA 5KFJA 1VK8A 3IC1A 4YOEA 2OPSB 2B4PA 5GMEA 3ILIA 5CQGA 4DV7J 2WBRA 4NLRA 4N7TA 3JXOA 3GYXB 3FEYB 1RBLA 1A9NB 2JWNA 2L3MA 1JNRB 3VAMA 1F9FA 1T9XA 4X65J 1QSSA 2RKIB 2ALZA 3BSAA 4A8XA 4ZHRA 4LR8A 4IDKB 1Y0HA 2BANA 2DJWA 3RB4A 3V6DB 5EN1A 1IUJA 3F44A 4B3RF 1T02A 5DDQC 3J7YI 2ZWOA 1GTHA 4Z7YA 2HFOA 5IFMA 5T41A 4HLBA 1N33F 2JOQA 3UD5A 4TQSA 1ZPWX 1FDBA 4OJ1A 2AGQA 3RGIA 3UVJA 4AQYJ 2M70A 3ZZOA 1HPZA 3C8YA 2OSQA 3W9IA 5HK4A 3L9ZA 5A76A 2MZ1A 4RX6A 2WSCC 2XSFA 2XWXA 1CQNA 4URQU 1WACA 3OL8A 1KLNA 1Q86T 5HLFB 3OR2A 3EZ5A 3H8YA 2RQCA 2WSEC 5HQ8A 3T3FA 1HFEL 1DTTA 1RDRA 2VFRA 4CIOA 4ICLB 4MJKA 5JUMA 3FVYA 2I6WA 3B78A 1CG2A 3MCMA 2ZVIA 1RSCA 2WK4A 2R7OA 3ILLA 3PKMA 1KTQA 5K8NA 5LMUJ 4QU6A 3ILOA 3UE2A 4DSFA 8AT1B 2CIMA 4CM0A 4IG0A 2ZFHA 3KUHA 5A8RB 3ZNUA 2V8PA 2OFGX 3R7BB 5EWEA 1VQ7S 5CD4A 3HX9A 1WC5A 3HPOA 4EYIB 4DS4A 1TL3B 4X4OA 3GB0A 2DR8A 2CAJA 1VRTB 2HNZA 4PPZA 1AUDA 4HDHA 3MUTP 2WVCA 4RUAA 2QZ8A 2HFUA 3PYDA 1DRZA 2N3LA 4KHPF 4MK7A 4M5KA 2XTJP 2E44A 5KT7A 1DBDA 2IAJA 1YJNS 2G0IA 1NDLA 3OTOJ 2XBPA 3UD3P 3KNGA 1URNA 2FJWA 2GGPB 3CD5A 3HD1A 4WK3A 2J9DA 1S9EA 2MY8A 5H9EJ 2YTCA 2BKNA 3S8SA 3AY0A 3K17A 1VRUA 4JI0F 4ZP9A 2EW9A 4AFFA 4OI1A 3CIZA 2FDNA 5DDPC 1IBMF 4FF4A 2HAIA 5HJYA 4KAIA 5KFUA 1T05B 1K44A 4A8SA 4LR9A 1B0TA 2NLWA 4GKKF 3CMQA 3BR9A 1EKSA 2XCAA 4OZLA 1KFSA 4LF6F 3LUYA 7AT1B 4CWBA 4L76A 3JYTA 5DZ7A 3AD8C 5GAHI 3QGHA 3KDOA 4YFUA 3OSNA 1WSVA 3CDUA 2AYBA 5FDLA 4ZJOA 5F3ZA 4DFPA 3QJPA 3MCOA 2CQPA 5CA5A 2XMTA 2HGLA 3GMGA 3VWSA 2HHPA 5ETVA 1GMWA 4DV3F 2K3IA 5D0GA 1RAFB 4KH0B 1B99A 2AEMA 4NCAA 4ZA1A 1QTNB 2EG2A 2XY5A 3M2RB 2UUTA 2EKYA 1I51B 3QMQA 6AT1B 4K4WA 2BANB 2HS0A 3T6BA 4ILLA 1TELA 1O0PA 3D1HA 4XTTA 4LBHA 2HZVA 3A4TA 5IC6B 1TKZB 4DV1F 1JXLA 1ACMB 1MWQA 1NZAA 3GR0A 3LWMA 4CTAA 3SEOA 2G2ZA 1U6ZA 2V4QA 2XM3A 1KQSR 2OPPA 4LIRA 1S6QB 4NLGA 1FFWB 1H3DA 2ZJQQ 1VQPS 3N01A 5KFXA 4AXIA 1JXVA 1RT3B 5HL7Q 3GQCA 3H5UA 2Z0GA 5HROA 3NLCA 1GTEA 1X60A 2I1RA 2VG7A 2WOMA 3MCNA 1RTJB 2FJEB 1X4GA 1NEEA 5HJXA 3QAEA 2K7KA 2UUCJ 4UQTA 1DTTB 2FUG9 3BB5A 4F3OA 1X9MA 3IN5A 3M6UA 4ECVA 1RAGB 3MEKA 3DOKA 4O3PA 4LRAA 1RLCL 2EK6A 2GW8A 2APOA 1FEEA 2IM2A 3W8GA 5HVGA 1UFKA 3FQLA 3EM1A 3M8SA 2HGMA 1V3ZA 2KU7A 1R89A 3MPDA 2KN4A 1I94J 2RRNA 3FBCA 3UR0A 1NJXA 4HTJA 1D09B 4B08A 2M4MA 4DQQA 5IWAJ 2KYXA 4GMKA 3CJKA 2J7KA 2NZCA 3D0IE 1RTHB 1TL5A 3AAWB 1NJWA 4CYUA 4X4SA 2ZH8A 2CPFA 1PYOB 2CFXA 4QWBA 3RBEA 2J76E 3KFWX 1RADB 3D6FB 3DLBA 4ELVA 1SJQA 1N32J 3NGSA 4MK9A 2WRMA 5T7LA 5KFMA 2K7JA 4TU7A 4J37A 2HSEB 5C2GA 3KHRA 2GO9A 1S9EB 2A0FB 1TKDA 2VL1A 5A0YA 4DUZJ 3V6KA 2QA1A 4ZDNA 4EK2A 1SJRA 4ZCIA 5KFEA 1Q8IA 2NSCA 4K5SA 2H9ZA 2XGPA 4JOUA 1U7LA 2CJYB 3TZWA 2ASDA 2B6AA 2HURA 4OYPA 4DPUA 4F4ZA 4BWJA 2C3YA 3BDEA 2LQ8A 4KPCA 1XN9A 2Z8QA 3CW2C 3UN3A 3DN9A 4MFBA 2BQUA 1TR0A 4N56A 4C8OA 3HFZB 2FHKA 3UN5A 2FZKB 4R8UA 5E7OB 2OGUA 4ECYA 3MEEA 1R27B 3CJRA 1W26A 1FO1A 4M5NA 3MCSA 3ENWA 4Y2IA 4ZLJA 2MKJA 2LA6A 3DI6A 1I5OB 3GIIA 3WBZA 4M5DB 1KVJA 5KFOA 4F4WA 3NMAA 2DTJA 3BDPA 1XWLA 4I6WA 3V6HA 3A13A 1J2VA 2BE9B 2BJDA 1X0FA 4JI4J 1AYEA 2GJFA 4CTAB 4DX7A 1HKAA 1TKXA 4B3MF 3TEGA 1DQ9A 2OPPB 2C42A 4DF4A 5GMKa 2XLIA 1P8GA 1N4LA 3HHLD 4BBYA 3MM7A 2PEBA 1R0BG 5AXNA 4WZQA 2E5JA 2VG7B 4DV7F 1X4AA 4EBCA 1SKWA 3KJQB 4YUDA 4N8OA 1RAOA 4G1PA 4DHVA 4ZN1A 4H4MA 3M6VA 4DR7F 3NKYA 2QLBB 2Q79A 3G8QA 1WSRA 3UNGC 4X65F 1T3NA 3CXCR
chains in the Genus database with same CATH topology
4KFBB 1YITS 3OHBA 2DVIA 2AGOA 1FRIA 2JEIA 4ZVEA 2RU3A 1UAWA 2DR9A 2HHVA 3GSDA 4AXJA 3RZAA 4EU0A 4WXWA 1O51A 3MMAA 2R9LA 4NZ0A 2ZUGA 4PQUB 2KRRA 5KT6A 1HI0P 2MQMA 1S1UB 2XNRA 1JMTA 3F56A 3LP1A 2AYGA 2HMIB 4CNZA 2PA8D 3VCDA 1N5QA 5GAHU 4A8QA 1RYRA 3CE8A 1P27B 3SCKE 3H5YA 5KFLA 2Q43A 2XS5A 3EXCX 3PEHA 4CI0B 5DDOC 3J81Y 4FBUA 1TZ0A 3MOZA 3MM5B 4ZCLA 1S4FA 1RTDB 1S76D 1CEZA 4LJMA 2NSBA 4OHYA 3IWLA 4KKOB 2YKQA 4QYZJ 3VAKA 2QLWA 5JJBA 3I0SB 1UA1A 3I55S 4DQRA 1U6FA 3M1VB 2DGQA 2FC8A 2SXLA 5D3GB 4DSKA 1YJRA 4N76A 1C1CB 3CCLS 2ILZA 1FXRA 2X51A 4WF9Q 2V8DA 4N41A 2XG8A 5EWFA 3CDEA 3NP5A 1E6VB 1N88A 2NPFA 3Q8SB 5K8MA 4EGLA 5FD1A 3JAMY 5B0CA 4LSLB 2PT0A 3KG1A 4K5RA 2BRLA 5LXRA 3QJLA 1AXQA 1UEVA 5HN0A 2M52A 2XSJA 4A8FA 4KRWA 1FRHA 5D78A 2HQ3A 4F4XA 4JV5F 1YBAA 5F8NA 1JLQA 3M32A 4I2QB 1IKXA 3CJKB 1WG5A 2F4VF 1Q4RA 3MMJA 3LANA 1N5YB 3TW0A 1RJJA 1TL4A 4WFAQ 4UY8T 4EFAC 6FDRA 5F41A 2AX1A 2NYIA 3N28A 5I4MA 1S6OA 4TY9A 7FD1A 4B17A 1G7CB 2ZM6F 4JI4F 5FLXY 1URRA 2VBXA 3IR6B 2M9KA 2ACYA 3KK3A 3M8PB 1YGYA 1U47A 5HMYA 3PR5B 2X1AA 2DO4A 2O5DA 4NPOA 3ULHA 2BYCA 2VG6B 4Q45A 3ZZPA 5E3PA 5H9FJ 1CQMA 3H40A 3NMRA 3ISND 1KTVA 3QGPA 4PWUA 4IOAQ 4R5PB 4AYBD 3K5LA 4O0IA 3U1LA 3H2VE 5T7LB 1K0TA 4ZPWR 3ZZTA 3G9CA 1FDAA 1ZM4A 3CCMS 2ZH6A 3AQPA 2CPEA 5M2UA 4A46A 1U2RA 3PJXA 3GE9A 4C3LA 4YB1P 1TK0A 1FESA 4J9RA 3KG0A 5KT5A 1JLEB 3BREA 5IT4A 1RYSA 1HD0A 3HHLC 3C3LA 2C3MA 1PGZA 4NLTA 2HPUA 2CPZA 3SV3A 3KNAA 3TUIC 2EWHA 1IBKF 2D7SA 2VA3A 4PUOB 2OPSA 3UCZP 3OFFA 3ITHA 2XMUA 4IH6A 1TL1A 2FHJD 4LF9F 1HBMA 2CQ3A 2J9EA 5A0YB 5DM6Q 4OI6A 1CPZA 2Z4PA 4OJ3A 2PN6A 3TVKA 1U1KA 2PGCA 4CZCA 3HHNB 2CPDA 2ZE2A 2Y1RI 4OJGA 4O44A 2CQBA 2COLA 3CDWA 2ZKTA 3UPFA 3NNHA 4HL9A 1VMBA 4NA3A 5KFKA 1Q1KA 2ZH3A 3K5MA 3Q24A 3SQGA 4OL8A 4URSA 1S9FA 3L09A 2NREA 5GADI 3RAQA 4K4ZA 2POKA 1Q82T 2WTFA 3G71S 3MHYA 4OV1A 1C0TB 1O8BA 1QUPA 1NKEA 2FJAB 3TAMB 2N4CA 2CQIA 2W4DA 2OP5A 3CF5Q 2RKIA 4AL6A 1HR0F 5DGAA 5DLGA 3OL6A 4OHZA 2J8AA 3DXSX 5EX3A 1EETB 1UEUA 2YNGB 3W7BA 4NZ7A 2RQKA 2FHMA 4BWMA 5BJRA 5J2NA 2QIFA 4C8KA 5HMWA 1ZH5A 2V9WA 1F5AA 2M5YA 4CCHA 3OFEA 1YQHA 4MTPA 4U9RA 3HVWA 3AH6A 1U45A 2RF2A 1SV5B 2B0GA 4RBVA 4B3SF 4ID5B 5J1PA 1NK9A 4G1QA 3PJWA 3AJ1A 2HFZA 1ZTTA 4KJIA 1LWEB 2CQ1A 5GAGI 4Y0FA 2IJFA 2N3OA 2W9BA 3G6XA 1WELA 1NKBA 1VC5A 1ULRA 2GQCA 2ZD1A 3FCHA 4X84A 2YQ3A 3T5JA 4C0OC 1MROA 1FF2A 4ZHRB 2WCXA 4JI1F 3RW7A 4KTQA 1FKOA 3S6EA 2UV8G 2XS2A 2ZNYA 2BM0A 5CCMA 2KXNB 4RNOA 5JVHQ 1H7XA 3SDEA 1REVB 5HMZA 4KQZA 4R0EA 1NK6A 4KO0A 1NU4A 2HS4A 1FE4A 2A3JA 3L7OA 1G3OA 1GXLA 3QJJA 3V81B 1GXTA 2YWFA 4ZVHA 1P9QC 4MKAA 2W7PA 1VC6A 2CPYA 5D4NA 1QVGR 3MOJB 3LO3A 2ZITA 3JB9k 2BBEA 5CYQB 3T6JA 1JNZB 2CQDA 3FEZA 5EHHA 2R2UA 4ZPCA 4P6QA 3OTBA 2E5GA 5A6PA 2AD9A 4NXMF 3DLEA 1UVMA 4R8UB 5KT2A 1P1LA 4IUFA 1P1TA 1MU2A 3JTOA 5KTQA 2ZH5A 4PQAA 3PW7A 4Q8EA 3ENQA 4DL7A 1LQ9A 1SJ1A 1HHSA 2GJ2A 3TUJC 1N6QA 1SJ4P 1LV5A 3W3SA 3TANA 3PXGa 1Y5LB 3L3CA 2CPXA 1K1QA 1F5CA 3W2WA 4JYAF 2ERRA 3FRYA 4C8MA 2CJ9A 3OLAA 3FSIA 2GX8A 2XHWA 1SKRA 1HMVB 2KT3A 4QR1A 3V4MA 3BO4A 1G6BA 1WHWA 2DH9A 2LECA 4RW4A 2MKSA 2QSWA 3DLKB 1YJ9S 2UVWA 3M05A 4QBUA 1M5HA 1S1TB 4RLEA 3GIMA 2AU0A 1HPZB 5SUHA 3DI6B 4KPYA 2HW3A 2J0WA 2ZKUA 1LXJA 4BDPA 3WZ0A 2X1BA 4FXVA 4I7FB 4DS5A 4IO9Q 5HLFA 3CCJS 2GMJA 1D1UA 3FDSA 2E66A 2J7WA 4QWDA 2R7UA 3MR2A 3SCJE 2MGZA 1Q8BA 1UJ4A 2Q6BA 3DRPA 3QWUA 2JC0A 4CO1A 3HZEA 4YB7A 2LKZA 4K50A 1G1XA 2YX4A 2U1AA 3K8VA 5CYMA 2OSRA 3HM9A 1EP4A 4ICLA 2QYCA 3ISNC 5KFRA 4ECZA 3US5A 3DC2A 3DCAA 3PRDA 3K5NA 1NJZA 3T9ZA 3OR2B 1JIHA 1R3NA 4ZP6A 2C2EA 4QPTA 3IS9A 4NA1A 5HBMA 2ZC4A 3IWNC 2FLLA 2IYIA 4C8ZA 2IM3A 3HJFA 4I6YA 3P49B 4GC7A 3D0HE 3O44A 4BC9A 1FRLA 5K8PA 4WFNQ 4EZ9A 5JXSA 2GMHA 3K5OA 1S0OA 4IRCA 2CJKA 2UXCF 2HHSA 3PKYA 3FRZA 3U1MA 2CZ4A 3TO8A 2PDAA 3MZIA 1DURA 1ZBTA 2PIIA 2E5LF 1FRJA 2QSFA 5L9XA 3DYAB 3M6WA 3RR8A 1UL3A 4K4XA 3CO9A 1FK9A 4DQIA 3AB4B 1VS3A 1V3RA 1T8EA 1IKYB 2R2RA 1S1WB 2JLFA 1T95A 5DQGA 2XMJA 1D8ZA 3CJ5A 3EGNA 1OIAA 2CQ4A 4W92B 4HT7A 4URGA 1RT1A 4IG3B 5DM7Q 5KFPA 2DNZA 2QMXA 2W8LA 2W7OA 1C1BB 4LVOP 3UR3C 4IH5A 4YMEA 5ADZA 3TUZC 3HMJG 3KLFA 2B5JA 4IG0B 1TKTB 1LW0B 3QYYA 1ZAXA 2GHWA 2B51A 4X4TA 5K5MA 2DR7A 2RILA 1BD6A 4RNFA 5KAKA 1JXEA 2YNFB 1NJYA 2CPHA 1BQMA 2D9PA 5H1SV 4DBQA 2F8MA 4RBTA 4OI4A 1V6HA 1ZM2A 1H2TZ 2Q3PA 3PHEA 3MPWA 5LMNF 1H7WA 3IG1A 1U24A 2BE2B 3HVAA 3M2UA 2IC3B 1RTIA 1SL2A 3RR7A 3BSNA 3NWGA 3MMAB 1VQ9S 1JJHA 1OS5A 2ROEA 4H4OB 1RQ0A 1TAQA 1QAIA 2RJZA 2K8GA 3LP1B 2VH7A 2P5VA 2HNZB 1JLFA 2IHR1 1C0UA 1Q16B 2BM1A 4NLDA 3J7ZT 2MSSA 4OFZA 1UVKA 2HRYA 3U02A 1S49A 3PM9A 1VQKS 3M8QA 3QIPB 4CNYA 1N56A 4P2SA 1B7FA 4ZVGA 2OKQA 4N77A 4C3KA 5B08A 2DT9A 1FTRA 2B56A 4M1KA 2GGPA 2RT3A 3Q22A 3DRSA 1BQXA 1FD8A 2DH8A 2MYFA 2W25A 4RZRA 4PXCA 2EBGA 1WNEA 1RT2A 4CO2A 1FRXA