5L38A

The structure of the hexagonal shell protein msm0272 from the rmm microcompartment
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
b'SSNAIGLIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAVIVTGEVGAVKAATEAGAETASQVGELVSVHVIPRPHSELGAHFSVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MSM0272 - RMM microcompartment shell protein
publication title A Complete Structural Inventory of the Mycobacterial Microcompartment Shell Proteins Constrains Models of Global Architecture and Transport.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Structural protein
total genus 23
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2016-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l38A00
3NWGA 4OLPA 5DJBA 4DDFA 3N79A 4QIFA 4OX8A 4AXIA 3MPYA 4AXJA 3CGIA 4P2SA 3SSRA 4OX7A 3VCDA 2A18A 4LIWA 3DN9A 4OX6A 4QIGA 4RBVA 3MPWA 3CIMA 4PPDA 5L38A 4RBTA 3SSQA 3DNCA 4RBUA 3I6PA 3I96A 3IA0A 4QIEA 4OLOA 3BN4A 3H8YA 4P7TA 2G13A 4QIVA 2A1BA 2A10A 4P7VA 3NGKA 2EWHA 3PACA 3SSSA
chains in the Genus database with same CATH superfamily
1NEEA 1ZS6A 2KL8A 1SH3A 2JSXA 4F3OA 4AD6A 2DNHA 3UR0A 2V8DA 1YLXA 4MYTA 5LSLA 5AXKA 3TOQA 2CPJA 2A6OA 1ZBTA 4IFYA 2XMUA 2C2OB 1IWAA 1TAQA 4NMLA 1PYSB 2RMLA 4KHMA 3E51A 4DEZA 4AQYF 4PUOA 2AX1A 2CNKB 2IJFA 1IKWB 4P6QA 4O0NA 4I7FA 3OD2A 3R7BB 5LT5A 4J9KA 4LFCF 1N0VC 2B5JB 1TV6A 2FHJD 3ZTQA 4RR5A 5B0DA 3SQOP 2HHTA 1T9XA 4ECZA 3QT5A 3GV5B 4X4NA 3EGNA 2B0GA 4CLZA 4IG3B 1N6QA 1CJVA 1M5OC 2WVBA 3BGOP 2NXJA 4BS2A 4OJ1A 2OPRB 2Z2YB 1TKDA 2W8LA 4TU8A 1WC1A 2MZRA 3NNHA 1FDAA 4LBHA 3THTA 3ETOA 1CLFA 3S8SA 2DK2A 4OYWA 4BBYA 2KHCA 3MEGA 3DLKB 2CADA 1I94J 1LWFA 3RB3A 2KZZA 1P9QC 3H5UA 2M7SA 2GW8A 1WKKA 3TJ9A 5KFEA 2VQFJ 3TO8A 5B0BA 2KJVA 2KXFA 3MAAB 4X4TA 3NP5A 2WZ1A 5ETOA 2GC8A 2F40A 3EE3A 2BE2A 2ZE2B 4W90B 3DI6A 2WAQD 5GMKa 2IC3B 1FHTA 4JV0A 1RISA 4J9LA 5AXMA 1MMLA 3MM9B 4OLPA 2PFDA 1JLBA 2KTQA 2IM1A 4ZJOA 5FLXY 3ZTPA 3HHDA 1JLCA 1TK8A 1DTQB 4ZVUB 4DR2J 5IS2A 1GMWA 4TLRA 2UXBF 1R6VA 2G0CA 5HJXA 4RZRA 1I1GA 3TJAA 2DR5A 3QIDA 1FRXA 2HHPA 3UDLA 2BJ7A 1U24A 4KH0B 3BGLA 2P9EA 4F4ZA 4OZLA 4BC7A 3JTNA 4OJHA 2WTFA 1FERA 1M5KC 3F41A 4M5IA 3LP0A 2U1AA 3T9ZA 4JI2F 4NYPA 1PC5A 2LDYA 1T05A 1JLEB 5EN1A 4U7UK 2HIQA 2VICA 3FSXA 4A46A 4LF4J 1TL7B 2CPHA 1U47A 3SCKE 2WSCC 1MWYA 2PA8D 4B9NA 4B9SA 3F73A 2KU7A 3P6YC 1YJTA 4KPYA 1NLKL 1X5TA 2ZH8A 1B99A 3IXQA 4DX6A 3IRXA 3T3FA 4LSLA 1REVA 4OZ3A 3R8YA 2FVRA 4A4JA 4N77A 2WB4A 4DR4J 1X4BA 2DNOA 2YWWA 2HGMA 3MR7A 3HP6A 3UVJB 2XBPA 3CJ3A 2V69A 2W2QP 3I0SA 4NE9C 3K17A 3HO1A 2I5JB 4RBUA 2W8KA 2BZ2A 5LMUJ 3D9BA 3KNGA 4Y2AA 2XULA 1UWBB 3QYYA 1UFKA 3H20A 3UO0A 1O51A 2C3PA 5E33A 2OJ3A 2CQ0A 4ILMA 2YBVA 2VONA 3BPDA 4KSEB 2R8IA 2AD9A 2M3DA 4X4QA 4U8VA 2VJUA 4FP9A 4UT4A 2KFYA 4LJMA 1XIQA 4H4OA 5HLFB 1RI7A 2ZFHA 1OY8A 2X1FA 2V94A 2W9BB 2ZBRA 4AT1B 5L39A 4OV1A 4YB6A 3TYTA 3PYFA 2QT7A 1HMVA 2HNZA 2VPXB 1JWWA 4EU0A 4NCAA 3F44A 4N41A 4I2QB 4DV3J 3FBBA 3A4TA 3IS9B 2JC1A 1RWOB 4F8RA 1BLUA 2CQPA 1LEOA 5AE2A 3NRBA 2P6TA 3T19A 2PMWA 1VQSA 4OI6A 1UZHA 2VDIA 2IVYA 4FF3A 5IT4A 1ZM2A 3A13A 1KS2A 3SDEA 1HWKA 1RA6A 3C16B 2UV8G 1KD1T 5IWAJ 3B8HA 1YJVA 3I6PA 2RF2A 5KFPA 2V2QA 4QJVA 2VBWA 3PV8A 2DO4A 1VFJA 4DQSA 4QU7A 2Z8QA 2E7VA 1FX4A 1C0UB 4O44B 1Q5YA 1WHVA 5L9NA 4ZVEA 3TQEA 1HQUB 2VDHA 1VBYA 3OXFA 5E5NA 1QUPA 3FC9A 4F36A 2BE9B 3T6BA 3DXBA 2NPIA 2CZ9A 3T1YF 1NSAA 2CNOB 2XZWA 1QSYA 2QL9B 3D6MB 1T94A 1GXTA 4H4MA 2AGPA 2GMHA 1MSWD 2DPJA 1P27B 3AJ2A 1WOSA 1S1VA 2B8PA 1S97A 2M2BA 2HFOA 2PT0A 1E6VB 4U7CA 2EFGA 1VRTB 4MFBB 4DV5F 4AQYJ 1IXKA 4CO4A 2IBKA 3PVXA 2KYXA 4B9UA 3NGRA 2ZZNA 1B0TA 4J9UE 2DGQA 3LP1B 2DR6A 3DOMB 4LFCJ 3US5A 2FJAB 4WU3A 1HWJA 3CW2C 4ZP6A 4B3TJ 5KT3A 4NWBA 1D8YA 2XHWA 3JYTB 2K1RB 3KK1B 5EUHA 3JB9k 4NI2B 4M8LA 4C11B 1BE4A 2NXCA 1CC7A 3H5YA 3DDIA 3K5MA 3PX6A 2HAIA 3Q83A 2B5JA 4DMZA 1VQ4S 1G4CA 5CYMB 3JAMY 1X9WA 1WG4A 4KGMA 4EWTA 3MEDB 1HW8A 2ZWOA 4IG3A 1KLMB 5F9LA 2FHJA 1TMJA 2XMTA 4YDDB 5BR8J 2E1PA 2B6AB 2MSSA 2L48A 2OPRA 1S1WB 3DLJA 4I2PB 4AXJA 2Z4PA 4M1KA 3MM8B 2HNYB 1NDCA 4C3LA 3PTWA 2QFJA 1ZZNA 1RT4A 3KUGA 3VAHA 1FDNA 3QGHA 4B17A 3KDOA 3KLGB 1V9OA 3CMAS 1RHJB 2VKRA 2YX7A 5KFQA 2JZ5A 4W98A 5L38A 3JSBA 1UJ4A 3MD1A 4EBDA 5HJYA 2UVRA 3MAAA 1UVIA 4URGA 3FCWA 2QA4S 2ZE2A 3KK2B 1DQAA 3FBEA 4O3NA 1RT5B 3MMAA 5A6PA 4AL5A 1H72C 4WXWA 1SL1A 3MM9A 2GJIA 2F8EX 3PO4A 3NAHA 2FZGB 5ITHA 4TU9A 3HZGA 4OZ0A 2BQ3A 3FEYB 1YTYA 1UP1A 4ZN1A 4DR1F 1RHMB 1DTQA 1CSJA 1FNMA 3B78A 4ZCKA 2ROEA 1KVKA 4RL1A 3N79A 2EKYA 4JOUA 4IOCQ 4OYOA 3H4BA 2RKIB 1KEKA 2AEJA 4ED4A 2XMMA 3BM7A 3W2VA 4D3GA 4KB7A 4RNNA 2MSTA 2V67A 3IGVA 5C24B 4P9SA 2DXEA 2GHPA 2P9GA 3NS5A 4WP3A 1Y00A 3PW0A 1HI8A 5E0OA 1Q8LA 2N3LA 3KDNA 5K5MA 1XNRF 1K73T 1SJFA 2ZH9A 3PKMA 5HO4A 4OYZA 4XK8C 2L08A 3DGPB 4ZLPA 1TL7A 5JXSA 5F41A 4NLXA 2E5HA 3P45B 4QQBA 1X5OA 2RHSB 3HT0A 2MJNA 1PKUA 2R7QA 3O44A 1SJQA 1W2IA 3HHLD 4IRDA 2I9SA 2L9WA 4ECSA 4I67A 5I4MA 2VFRA 2OMOA 3MPWA 3V6HA 3W2WB 3ZTOA 3JQKA 2W2PP 2DISA 3AQOA 3DM2A 4DSJA 1YRUA 2CPFA 1O5JA 3ONQA 4OI1A 2D3O1 2MKKA 3LW5C 2I5JA 2LQ8A 4QPXA 3FMBA 3W5XA 1UWBA 1CC8A 5IZHA 3G6YA 4PZVA 2V4RA 2K2PA 4YR3A 3U1MA 1R8AA 3Q8SB 2RS8A 2Z2LA 2KT2A 2FHKA 1RTDA 1VC0A 5KG4A 3E3XA 4USWA 4P52A 1FVQA 3GSIA 3GMGA 3OJUA 2BRKA 2CKWA 2W9BA 4TQRA 3FEXB 4OV6A 3M8WA 4UQTA 1FXLA 4DL3A 1L5UA 2Z0GA 1SJ3P 2BR0A 3ZTRA 4UOCA 2V9WA 7AT1B 1TKXA 3UQSA 2ZH1A 3R5DA 1CEZA 2RJZA 3ETMA 1TFYA 2B4VA 4Y2IA 2WBRA 2LU2A 4I2QA 1RWWB 4URQU 5BJRA 2PC6A 3IS9A 5B0GA 1IBCB 3U02A 4HYKA 4FYWB 3CDWA 4P2SA 5A2QU 2A0FB 3HI9A 4I6WA 2MZTA 3W60A 2HGLA 1J5OB 1NK6A 1RACB 1XBWA 4K5SA 2UP1A 2J0XA 1WG5A 2XNQA 4K4TA 3AD8C 4CLUA 4I4BA 3D6TB 2HYIB 1JKHA 2QMWA 2FVPA 2HRUA 1VHFA 5A0YB 5HN0A 2BMBA 1BY9A 4ZPCA 1K0VA 2IBOA 2B4OA 2XNRA 1X4FA 3LP2B 5CYJA 1EIYB 4YUDA 3B6BA 1L3UA 3EZUA 2H5IB 4IDKB 1D9DA 2VOPA 1UA1A 4C6AA 2AYEA 4LBPA 1C0UA 3KLIA 4O44A 3EPIA 3OJSA 2HHWA 1HQUA 2A10A 4CIOA 2DJWA 4OHXA 3SFUA 3VV2B 2V2VA 4DV5J 2Y1RI 4EO6A 3M8QA 5KFUA 1T3OA 3D1OA 2DRDA 4DLGA 5HBMB 2CPYA 2XS5A 1Y0HA 4EK2A 1S6UA 4IO9Q 2D41A 1U0HB 3I4PA 1WJ9A 3KG1A 2RNEA 3BBCA 2YNGB 1RYRA 2BV3A 1FKPA 2AJ2A 1GX6A 4TKTA 1UVLA 2MXYA 4WKYA 1WACA 1X8DA 2QFIA 2QSWA 3HHEA 4HDHA 1XTZA 4MH8A 5F9NA 1Z2LA 3DYAB 2H48B 5J2PA 4DF4A 2N82B 1BUXA 2Z57B 3HVTA 1ZZFA 2E5IA 3JQJA 2GVDB 2XSJB 1XNQJ 5F0WA 4LFAF 5IV3A 1J27A 3R3TA 1X0FA 3KK1A 1JLFA 4NLTA 1N54B 2RHQB 3MR2A 2GJ2A 4I69A 4LFBJ 4K2XA 1Y5IB 2O67A 3Q89A 3ILJA 5L1LA 2R4FA 4HEA9 4ECUA 1FRKA 1DQ8A 1FK9B 1TP7A 4EGLA 4FKXA 5GAEI 1I51B 3NWGA 3R7SB 1EX8A 2MKJA 3Q8YA 4NLDA 8AT1B 1FE0A 1CVJA 4TN2A 1KLMA 2QC3A 3KKFA 4KBIA 3LQVA 2CNLB 4C0BA 2Q66A 1S7HA 1S1WA 2RVJA 2XMAA 3FRYA 9ATCB 4FXWA 1ELOA 4I2PA 2BA9A 3PX4A 4HHHA 2A18A 3G82B 3DRPB 4CQ1A 2HNYA 4C97A 4DX7A 2HW3A 4DSEA 1FE4A 2M9KA 1HWLA 2Y3YA 5D0HA 2H4YB 4PYDA 3K8WA 2Y1JA 1WI6A 1Y7PA 3T1HJ 4DJBA 2WK4A 4GVBB 2DY9A 3VVUA 2DHHA 1HWIA 4CLPA 5J1PA 5DM7Q 1S72S 4H54A 4RX6A 2VA2A 4WCEQ 4ID5B 1UEKA 4OI4A 3NNAA 5J1NA 2HHXA 4H4KA 1ZPVA 4AXIA 3CJKB 2AMCB 1IWGA 5ETTA 3KK2A 1RAIB 1RKJA 4V1Ak 1RT5A 3AT1B 4X64F 4G1QB 4BHQA 4LSZB 1BHNA 5DG8A 5CQGA 2D3OR 3LALA 4RWXA 4JYAF 2BOAA 4HTIA 4CO3A 2FB0A 2LECA 4GKJF 4C2MA 5D0GA 3A8KA 2RU9A 5K8NA 4JI5F 3TEHB 2EPIA 1KTQA 2HLUA 1FNXH 3VTIA 1XNRJ 3I9V9 3J80U 4B3SF 1N5QA 4TYBA 4DG1B 4DCOB 2HNDA 2RKIA 4KFBB 4KQZA 4MIBA 4CWBA 4HL9A 3I5CA 2AZ1A 4V19J 2WVDA 1FESA 4ICLB 1KC8T 2OEKA 2YQ0A 3TX8A 3VAIA 2OEMA 2YXLA 2M5YA 4O3QA 2YKAA 3IAM9 3BV8A 3I56S 3D6HB 2IAJA 2GHVC 1HWUA 1R31A 4R5PA 4IO1A 3J7A1 3QAUA 4GO7X 4CT9A 2Q3PA 4M5LA 3HPOA 2EBGA 4LT6A 2J8SA 1DARA 5EHHA 4A8SA 1U49A 2J5AA 4TLQA 2FY8A 2FY1A 4K4UA 2BXJA 2POKA 4L75A 2OD4A 2HKEA 1HQEB 4YDXA 3W2WA 3C46A 5F0UA 3HHLA 2ZD1B 4TVAB 2G4BA 2DNMA 3M6VA 4M5DA 5F3TA 4QW8A 2AGQA 1HNIB 2QSFA 4JV5J 1JXLA 3HHLC 3H98A 2R8KA 2KXNB 1X31C 4O0IA 3EVMA 3M9NB 4S0MA 3OW2R 3FCHA 2OUGA 2KT5A 3I96A 1NB2A 3MFIA 5I3QA 4LRDA 2CG4A 4CO5A 1FEEA 2B43A 3QATA 3OPKA 2KH9A 4MKAA 3VF0B 1KKHA 4J9PA 3SXLA 4CCHA 2Z2MA 4QYZJ 1QAXA 2IMWP 5ETPA 2B4UA 3G71S 3UD5A 4JI3F 1TELA 4JBCA 4ZPTR 1S10A 3JSMB 5FD1A 1D8ZA 2YNIB 3WIVA 2ADCA 3I0RA 1VQPS 1S1XB 4XO0A 4OX7A 3EICA 4ECRA 3KTQA 2KI2A 1IBKF 4F04B 2B9XA 4DV0F 2W1BA 3CUNA 2RE1A 1IKYA 2E5LJ 2ALYB 2BJEA 4PABA 1Q0NA 2J0SD 5C2CA 4KYZA 4RW9B 4PPDA 2BBEA 5DO2A 4YN3B 1J5OA 1C1CB 3RBXA 3D54A 4DQIA 2YNHB 3OT9A 3MCOA 1WELA 3K59A 1HNVB 1YGYA 1WC4A 1HKAA 3MECA 2MKSA 1IBLF 5KFLA 4TU7A 4MK8A 3D1HA 2KO1A 1VR6A 3T9NA 1FT8A 1PCAA 5GAHU 3CCTA 4IDKA 3VALA 1OPZA 4ZVTB 2E7XA 4QCLA 4QWAA 3A8IA 3V6JA 1SC6A 2LEPA 4LF2A 1N4LA 5F8JA 3NMRA 1GT8A 1KOOA 5DM6Q 4BWJA 4F0HA 5C2GA 4ED0A 1H7WA 1RWKB 1NKEA 1UJ6A 4F4KA 1SPBP 1DFDA 2YWKA 3L3CA 3HX9A 3VAMA 4ANEA 1VRUA 3K7RA 3DLEB 1U2CA 3BGRB 5HBMA 4PG8A 1AFJA 1Q82T 2PI4A 3M9MB 2ADBA 2BJ8A 1U0HA 2CJKA 1KBRA 4I6YA 2YY3A 4RUBA 5J1EB 2VQEJ 1L3TA 4LFAJ 3IA0A 1I5OB 4IQXA 1SQFA 4E98A 3W8PA 2MZ1A 2NPFA 2KZMA 1S5ZA 1DLOB 3PCOB 4ZP8A 1NKBA 4DL4A 2AHOB 3CCJS 5D6GA 3DYAA 2UXCF 2MGZB 4PWUA 5M2PA 1LV5A 3MAQA 2VA3A 1XMOF 2XSJA 3WQPA 3J7YU 2CPEA 3MMJA 2VU5A 1TL5A 3CJ2A 2J9DA 4DWIA 4B3OB 4DUYF 5KFDA 1H6KX 1MWQA 3CEDA 2X51A 3DLGB 4L6V3 4ZLLA 1WG1A 3IR5B 4EBCA 5H1SV 1FK9A 4WK1A 4A8MP 3BQ2A 1M5PC 2XS7A 2LU1A 2RRAA 1VBXA 4I68A 4A8YA 2PN6A 2CJAA 3MUVP 3CDEA 2XZTB 3MGJA 2ZNYA 1J5EF 2J7WA 5CYQB 4WTOB 4ZCLA 2A6MA 4X4PA 3GONA 4CDIA 3QRRA 4WJBA 2B8QA 1QAIA 1U2FA 4OJGA 5KFVA 5CZXA 4O3SA 4WP9A 4PXCA 4DF8A 5DG9A 3G82A 2GV1A 1BQXA 4DR6F 3K5LA 2MKCA 2CAJA 5HK4A 1S1UA 2IA0A 2RUSA 4DS5A 3OFHA 2QYCA 4X64J 1B4SA 1KP6A 3V6KA 2V8HA 2CPDA 4FBTA 2GVZA 4HHJA 2HS4A 3G9CA 4JYAJ 4MAKA 2OIHA 1JLAA 4NA2A 4CO1A 5H9EK 2DTJA 4X4OA 4G6VB 4ID5A 4PG4A 3D28A 4GKJJ 1NK0A 4RNHA 4JI1F 4LREA 3DRSB 4CH0S 4IH6A 3TA2A 4JI5J 4NXNJ 4DN9A 5I3UB 1JXVA 4B9VA 4G1QA 5FDLA 3TP2A 3CNQP 4B3SJ 2Y1IA 4NA1A 3NG8A 4LF8F 3S01A 2YPYA 3OR2A 1VHIA 5T7LA 2CDRB 4DL5A 4CLKA 1EETB 1N33F 1F60B 1JNZB 1RE1B 1K47A 3IG1A 2RUGA 3NMAA 4PG7A 3QJLA 2RDIA 2ZH4A 1ROFA 3W5YA 4ATNA 3M2UB 5KOXA 2B7CB 2GAGC 4NRUA 1NJIT 3W62A 1T02A 3ET6A 1Y3KA 4F3MA 1IR1A 4K4ZA 1O6XA 1AZSA 4LIRA 3SZ2A 5KFFA 1WEYA 3ZNJ1 2DNRA 4A8QA 2JHEA 2HVIA 2HQFA 1ULRA 4E0DA 3EX7B 3GPAA 1NK7A 4ED1A 3J81U 3MHYA 4DU7A 4ZVFA 4KHPF 4OYAA 3WDOA 4HH0A 2BQUA 2ZC4A 3GYGA 3JS9A 4LR8A 1F6TA 1RU1A 2ZD1A 1FRHA 3G6ES 2AEFA 2J9EA 1NCLA 1RTJA 2WVCA 2W01A 2B56A 3LANA 1PBUA 2AT1B 1HNIA 4EO8A 2OSQA 1TK5A 4ES1A 2E5JA 2KRRA 2JEJA 3H5XA 2IFXA 3QZ8A 3VVTA 3W65A 2J76E 2ZH6A 4JI3J 3CCMS 2HFZA 2DPIA 4KO0B 2C28A 4PAAA 5HROA 3DHXA 3OTCA 4OIXA 1WD6A 3U1NA 3QRQA 1NH7A 3DFEA 2O5DA 3BDEA 3NNCA 5HQLA 4GRSA 3SBMA 1KOHA 4XDCA 1IBKJ 3CCRS 2DITA 5J2NB 1HPZA 3CC4S 1SH2A 4DV0J 2N4DA 2ERRA 4Z7CA 1WHWA 2XG8A 4AFFA 1B70B 1Q1KA 1JK9B 4HACA 3KLFB 3JSMA 1IKVB 2YNIA 1S1XA 4FF1A 1YZ7A 3LPEA 2HBQB 1VQ6S 3CJ0A 4Y2MA 1HR0F 4GC6A 1S0OA 3I32A 1T11A 2BE7D 1TFWA 4EYIB 2UXDF 2XMJA 1IBLJ 2UUAF 2WVEA 1LK5A 3F0NA 2C3OA 4WWSA 4OL8A 3CJQA 2ZDPA 1S48A 3ENWA 4NCGA 2AGOA 3PYEA 2YNHA 3MMBB 3QO9B 1UVJA 3BYRA 4ZIVA 1CBKA 1SQEA 2XI2A 4ZIWA 3HFVA 2GGPB 2OAUA 2BJ3A 1HNVA 3U1LA 3P5TL 3EWGA 2QIFA 3BF4A 4Q7AA 4TYAA 3CB4A 3GE9A 1Q8BA 2NCKL 1RTHB 1WKJA 2VOOA 3TI0A 4FPRA 3FUYA 4Q43A 2ASLA 3GFZA 2QLWA 1R6YA 3VZHA 1WI8A 5IT0A 3N6MA 4WF9Q 5CAAA 4WZQA 1C0TB 2VBYA 5EGYA 4KT0C 1RT1B 2DGWA 2CQDA 3DLEA 4NYOA 2GNKA 5C42B 2VHGA 3O1LA 2ILZA 1ZM4A 2AKWB 4ZVQB 2RRBA 3DCAA 1X4HA 3OSPA 5IT9U 3WBZA 2UXCJ 5DGAA 3PO5A 2XLKA 1XMOJ 5J1EA 3MCNA 4A48A 1D09B 4NA3A 3AA8A 5DDQC 5B0CA 5E3RA 4X62F 5AXLA 1Q95G 2JEFA 4C8OA 2C3MA 1U1NA 2O01C 4F7VA 2C42A 2DIVA 3CDAA 4KGZB 1WUUA 3GFHA 8RUCA 2VFUA 5KFTA 3OL6A 2H65B 3OTBA 4MJKA 1A7GE 3OR1B 1SKRA 1Y11A 1WORA 4B3OA 2YKMB 2VPZB 1J5EJ 1RTIA 4KRWA 5IC4B 4RNMA 1R8HA 3PM9A 3FVYA 1N5SA 2XO6A 1TKTB 1NK4A 4Y0FA 4NL5A 4C0HA 1UW9A 1XC9A 2GCFA 4FNIA 1LK7A 2CWXA 1QD1A 3E8OA 2E7WA 1QY7A 3NGKA 3W61A 4DR6J 4HKQA 2BEFA 1B0VA 5IV4A 3FSIA 2WRMA 1NJWA 2HVDA 4L3KA 3EDQB 4HTJA 1S49A 1RWUA 3TW0A 5CYQA 1W7WA 1M1HA 1V5IB 1YI2S 3VR1A 2MQMA 2CFXA 4PXEA 2ZOMA 2A3JA 3SYZA 1DURA 3NOGA 4JI1J 4WP8A 5KT4A 5AT1B 1UFLA 1EJ7L 3GG0A 1U45A 3Q23A 4F4XA 4DU8A 2ASDA 2C2KB 4ZCIA 1JIHA 3TNVA 4Y65A 3CWJA 2QGFB 2RIJA 3LF0A 4F4WA 2J9DE 1LWCA 1UVMA 1G1XA 4LF8J 3TAPA 1NK5A 2AJQA 4L3NA 4ENOA 3DRXA 3CCUS 3H59A 3BN7A 4A47A 4C7QA 5I3UA 2AIRB 4UY8T 1N33J 3V5RA 1UPMB 4OZ5A 2L9DA 4CYUB 2NLWA 3Q2TC 2E1CA 1DTTA 1BQMB 3QLHB 1VQMS 1X9SA 4F02A 4LQ3A 3FQKA 1UJ5A 4ANDA 3K5NA 1HD1A 3Q86A 2I2YA 5A8KB 2B4PA 3SV3A 2ZBQA 3RGIA 1DHMA 2YPZA 1QAJA 2BABA 5EWGA 3IO1A 2UU9F 3BSCA 4UQGA 4FZVA 3M2UA 4LRBA 3AODA 4FS2A 1HQ2A 4AE5A 1QTMA 5ETQA 2C3YA 2BVZA 4NLSA 4NXMJ 3QRPA 1U25A 2DNZA 4Q2MA 4Q2LA 1JJHA 1JJCB 2XWYA 3GFYA 2V4JB 2U2FA 4MYUA 3J7ZT 4IFVB 1OIAA 2OMLA 1KHVA 5A8WB 4AL7A 4QIVA 3W9JA 3EDRB 3O5TB 2ZVSA 4DSFA 3C2PA 2W2OP 2JNJA 5IM0A 1WC0A 3FKBA 4P72A 4YR0A 4QOTA 1D3WA 1KVIA 4EBEA 3RAMA 1C1BB 1ZTWA 3CCZA 3IRWP 5K14B 3AOCA 3HHKA 5HQMA 2EI5A 2DCLA 4OYPA 3Q2SC 4QWEA 1HNXF 4YOEA 4KO0A 4Y34A 3DRYA 2PMHA 5ETMA 4IKAA 2GQQA 4DUZF 1NAQA 2JOQA 4G1PA 3QT7A 5CZVA 3S7RA 3NAIA 2MQQA 1CJKB 3DOKA 2HVHA 2IM3A 3QWUA 2UUAJ 2CVIA 1S6QA 1F9HA 4ZS6A 3N6LA 2UZAA 2FGOA 2ZHBA 4I56A 3KNAA 1IKVA 2ZNZA 3PYGA 3MEKA 3UN5A 4O4GB 3C14B 3GG1A 1DZ5A 3NS6A 2MY7A 1YSJA 1NJZA 1KFSA 2QYGA 4ZVSB 3UD3P 3BBBA 5D78A 2RB7A 1SUQB 5DQGA 2FZCB 3CJ4A 1XEZA 2DCUB 3THPA 1CJUB 4PG6A 2ZH3A 2QLJB 1SL0A 5KG6A 3QO9A 3GCXP 3QPIA 5KG1A 3ISZA 3OVBA 3C15B 1VQOS 1ZA1B 4ZMMA 3Q0AA 2Q43A 1UWAA 2PA3A 1BWVA 1SKUB 1M5VC 4PQUB 2DH7A 2PFFB 5DZ7A 1NHVA 3AD7C 4QBUA 1MG7A 1T9VA 4NZ7A 2MMYA 2FUG9 4RU9A 5JMNA 4F2RA 1SIZA 3DLHA 3IR7B 1SCJB 2APOA 3PR4A 4WFXA 1Y9OA 1RB0A 2XYHB 4QIFA 1RYSA 1YJ7A 5CABA 1BWEA 3BR8A 1RT1A 5F8LA 1U8WA 5IFMA 4PWDB 3HSZA 3HZEA 1QE1A 4IRKA 2FLPA 2QTWA 1IBMF 1HARA 1EARA 1IR0A 3BJYA 3MCSA 4P73A 5C5JA 4CNYA 2J9CA 3DKDA 1AROP 2MHNA 3D3BJ 3PKYA 2UVUA 1EQMA 4RW8B 3RW7A 1O0PA 4NLOA 2FDNA 2H1YA 2UVWA 4K4VA 1NKCA 3S1TA 1NSQA 5BYQA 2XGQA 3M05A 2AX0A 3WC2A 3M30B 1ZAVA 4J9NA 2OELA 1FDBA 1JLGA 1GXUA 3U7JA 2CG8A 3HDSA 3GSDA 5FLXU 3QSYB 2KB2A 1WSVA 2OPPA 3OR1A 2X3GA 4WIIA 3D67A 1Q81T 1DJ0A 1TUGB 2MKYA 4C3MA 4DZDA 3MM7A 3A8EA 4ELUA 3HULA 4B3RJ 3M6WA 2ZJQQ 3W9IA 3ZZPA 5DJBA 2D1CA 1TL1A 2C1EB 2LQJA 1ZYQA 2WBMA 1FXDA 1TKTA 1BQNA 4ZK7M 4AL6A 2GQCA 3O2IA 1HNZF 1HL6A 4Q0BB 3R1HA 4DFKA 5G0RB 4ZJQA 2GFFA 3TWZA 4LF9F 5E7OB 4RNFA 1QVGR 3N0VA 1URRA 1WC5A 1XWLA 3PJWA 1K8AT 3GIKA 1HYSB 3CJ5A 2CQ3A 3VGTA 1JLQA 2VV5A 1WOPA 2CZ4A 2BACA 2B9WA 3TZWA 5KOWA 2CQ2A 1ZM3A 2EG1A 3M6XA 4HI2A 3BQ1A 3N01A 3KWMA 3TR5A 4MKBA 2DEJA 1F0XA 3H8YA 3IBWA 3BREA 3LGNA 4PEOA 4DQQA 2NQPA 1VMBA 1F5BA 1N36F 5GVQA 2SXLA 4RUAA 4GVLA 4C8MA 3G2XA 1FRLA 1LWEB 1WF0A 4OZ1A 4OQJA 1H38A 2CQGA 2UUBJ 4RNOA 2D3ZA 1SV5A 2Y1LB 3HT3A 1TR0A 1HD0A 4NOHA 1YZ6A 1IKXA 2ATCB 4Q5VA 2ZC3A 3VCDA 3KLVA 4Y2KA 3TAMA 2R8HA 3C6UB 3FQLA 2KG0A 3EZOA 1RWVB 5J2MB 1SKWA 2JWNA 2QZ8A 2UU9J 2JVOA 5JJBA 2DGUA 2D74B 4WBFA 2CXEA 1BQMA 2LFVA 3QLHA 2MEWA 1YG0A 3W8GA 2IM0A 2ZZMA 1ZH5A 2HMIB 2XTJP 4AUKA 3QJPA 4ZPAA 2KVQE 1RCXB 1T9TA 2R7UA 4QR2A 5HMYA 3SFGA 1X4GA 3H42A 3M6UA 3C8YA 2IDLA 1GXLA 2AW0A 3GU0A 3F56A 2XMVA 3KG4A 4NLVA 1W26A 1RT7A 2AU0A 4J9MA 4O3PA 3MMCB 3CO9A 2CUYA 3TZXA 2DR7A 2R7VA 4M95A 1RT2B 4DR3F 1VCTA 3HVAA 3HKWA 4DCPB 3GJQB 2G0IA 3T6JA 2M8DB 4EEYA 4R8UB 2V8VA 1IR2A 2RQMA 2E1RA 1VBZA 1YITS 2HBYB 1SQGA 3AXMA 2KKHA 2CDQA 2FHMA 5GAEU 1N5YB 4HVZA 2QO3A 1HNXJ 4LRCA 4JI4F 1PIEA 3O6QA 3MURP 1AA1B 4DUZJ 1K1SA 2B9YA 2VG5B 1H74A 3EXYA 3G6VA 2ALZA 4B02A 3AHPA 2VG7B 4C8KA 4X65F 1RAAB 1M1GA 2MZQA 1VQNS 1C2PA 3RAXA 3DMJB 3NCRA 3M9OB 4FDFA 5DDRC 6FDRA 3KHLA 2NXEA 1U4BA 2CJ9A 1T03B 1PYOB 4C9DA 2IDEA 4IYQA 4DR5F 1FXRA 3AJDA 4FXVA 2K7JA 2GMJA 3MR6A 3GB0A 1T9WA 1UEVA 3K57A 3OFGA 4NASA 1CJKA 4NMXA 1X4AA 4NLYA 4U6PA 2ATLA 1U1RA 1Z2ZA 1SJRA 5AE1A 3BO2A 3MAHA 4DFPA 2WW8A 3MM5B 3AOBA 2LXUA 3RJMB 2ABYA 3ENQA 1FVSA 2HQ3A 4O4GA 2AP6A 2WONB 3C14A 1RGVA 4Z37A 2PGCA 2DD8S 5HANA 3B4DA 2M8HA 3ZXWA 5LXRA 2Y0SD 3K8VA 1SUQA 2X7IA 2EFQA 4CLWA 3D2WA 2HHVA 4PRFA 4FYYB 3ZC4A 1FO1A 2K3KA 4DL0C 5LOQA 4DV4F 1CJUA 3FZ2A 1VQ8S 3KXDA 4FKYA 1B7FA 3OVSA 3LOUA 4CZCA 1N5VA 5HI7A 4XPCA 2QA2A 4ERDA 4RW7B 1ZM9A 4OFZA 4DV1J 2N3OA 4DL6A 4OHZA 1MMDA 1S9FA 1R8BA 2OPSB 3DDNA 5KAKA 1AUSL 4ECTA 3I55S 1P6TA 1IBMJ 4OI2A 3MOJB 3SQGB 2DT9A 4CO0A 2O1PA 2H9ZA 1OQ3A 3M8ZA 1JNRB 2I8EA 4PXDA 1PBAA 1EHWA 3RG6A 1S0MA 2UUCF 1R0AA 5DDOC 1AFIA 3PHTA 5E3CA 3OLBA 2OTJS 4ZVOB 1MLAA 3GLJA 1FJGJ 1F3FA 3LGHA 2YNFA 2WVFA 1NBEB 4DLEA 5IQQA 4U9RA 5LSRA 1RAFB 4JI0F 3NGSA 4FBUA 1LW0B 3H7HB 1OJ4A 3BZQA 5KFKA 2VB6A 4CM2A 1UTAA 1XK8A 4HH1A 4EZ6A 4RW8A 4ETXA 4OX9F 3ADAC 4DDFA 4DV2J 2W4CA 2BDPA 3CPWR 1QSLA 4X2BA 3M32B 2ZOGA 4ZPVR 1EZZB 3RB6A 1KNZA 3M30A 4JI6F 5ETLA 2F5GA 4UUWA 2RT3A 2Y9HA 2V0NA 1HBMA 4LF9J 2Z30B 3PW5A 1D1UA 2FLLA 2HVZA 4M5MA 4BDPA 2MB0B 2VF3A 5KG3A 4L74A 1RT3B 2ZH2A 1XR5A 2DR8A 2EXUA 3D0IE 3CCWA 4K8RA 1FRJA 4JV2A 2GIQA 3E01B 4YY3F 2GJFA 3S6EA 4LSNB 4MK7A 4K4WA 1SVDA 4GKKF 1NDPA 1URNA 4O3RA 1LXJA 4V19X 2CJYB 3Q22A 5CD4A 4ER8A 3OFEA 5E3QA 2V9KA 4EFAC 2IVMA 2CQHA 2OLWA 4U8YA 2WHOA 4ZPWR 3MUTP 2RD5C 2XM3A 1N36J 1HYSA 3BPSP 3QQCD 1S9EB 1IKWA 4EMDA 4I6AA 2JFDA 3G86A 3CIMA 3WIUA 1VQ7S 1QJHA 1OY6A 1SC1B 3PW2A 3C19A 4PR6A 2DNNA 3TVYA 3W5ZA 2RU3A 1TV6B 7FDRA 4X66F 1PILA 2UVVA 3OUYB 2AYMA 3NBPB 3T5KA 1LWEA 2K3IA 1N6QB 1QAYA 1L3SA 3QAEA 2YQ1A 3R5BA 2F8HA 1HHTP 5HL7Q 1KQGB 2J6SA 4QWDA 2IRXA 1AB8A 4USMA 3NL0A 3R1LA 4QYZK 3DLKA 2DGSA 3VGUA 3FZBA 5J2MA 2QN6B 2CQBA 2Q79A 3QMQA 2WB1D 2BJ9A 2HFSA 2MY8A 1NPPA 1RQ0A 2YVSA 3QWPA 2JFKA 4DR3J 5D4NA 3R5CA 2UXBJ 3Q8QB 4ES3A 5KFXA 2IC3A 3DI6B 1XQIA 5U47A 3ZO7A 1A0OB 1VQ9S 1S6OA 3N9UC 2DGVA 2QLBB 1JLBB 4J9SA 4W92B 4JUZA 4WIQA 2VQFF 4OYIA 4J9QA 4UZCA 1JLCB 2F63A 2K7KA 1RT2A 5A6WA 2J0QD 1NK8A 2FJBB 3FBCA 1H73A 4DV7F 1EQ0A 1PSDA 4JI2J 4JI4J 2RSQA 3KMSA 3MF5A 4R8UA 2G2YA 3CMQA 2R2SA 1OMSA 4RO0A 2YWFA 4ECYA 5LSOA 1VK3A 3TA0A 1NHKL 1KN6A 4X65J 4NCBA 4ANCA 2NYHA 2NUUG 2COLA 3NKYA 2BRLA 1N5YA 5JUMA 1Q7LB 1IVZA 1RJJA 3MWBA 3IFEA 4MKVA 5JVGQ 2C2ZB 5GAHI 1JLEA 2GZOA 2HWIA 1SC3B 4DR5J 3D1QA 2VG5A 2HFNA 4HHUA 3KHHA 2MLYA 4DCJB 1RLDA 2DVIA 1GEHA 2VG7A 3IWXA 1T0TV 4CLLA 1M5HA 3LWMA 3B54A 1HNWF 2HLTA 2RRNA 4RLEA 1S4FA 1FD2A 1NH8A 4A8KA 4KPCA 1R27B 1E6YB 3G8TA 3RW6A 1UVNA 3ZZ0A 4RBTA 4DXLA 3K5OA 4LSLB 1CPZA 3GIRA 5DG7A 2HVEA 3OBIA 3UVJA 4Y3CA 3I0SB 3GYNA 2DXDA 4DPTA 1EKSA 4OJ3A 3UE2A 3V6DB 2R2RA 2X1AA 1DAXA 3MM5A 5IQ6A 1SB6A 1RHRB 1CG2A 2WONA 4JV1A 3I4HX 4RW4B 3TQ1A 1FTCA 2BM0A 5HLFA 3LO3A 2R8JA 3RUBL 2JH3A 5L1JA 3J7YI 3EGZA 2CJQA 2L3MA 1QUVA 3OTOF 3KHRA 3IAS9 1RUSA 2V63A 2Z56B 5LMUF 3R6LB 3QZ7A 5LL6d 4FS1A 2DHSA 3MZIA 1YK9A 5GAGU 2IPOB 4XDDA 5DETA 5SUHA 1HI0P 4RU2A 4RW7A 2HNZB 1K44A 1N5TA 5D15A 2X3DA 4ZITA 1FWKA 1FWLA 1TL3B 2OPSA 3B82A 3MEEB 2UUCJ 2NSBA 2XYPB 1FA0A 2K06A 2VFSA 3ZZOA 1TZ0A 3LPYA 1XR7A 1KONA 1KQFB 1ITPA 4GO5X 3ENVA 4ITSA 4Y28C 2C3UA 1WDDA 4JB8B 4ED7A 2QV6A 3GZ7A 5KG2A 5GADU 3POTB 3C3LA 3TZYA 1HW9A 3FK4A 5AJ3F 3CJTA 1SL2A 3M4XA 1H7XA 1VLOA 2VFTA 1C4AA 2E29A 3C16A 4RKUC 2ZBIA 3RRGA 5E3PA 2Y0BB 3T1YJ 2KT3A 4Q44A 2HS0A 3PY8A 1N52B 4G3IA 3AA9A 2O3DA 2EWHA 3BH7B 4MIAA 4K59A 3SEOA 2IYIA 1LW0A 4TY8B 1WEXA 3ENAA 3RRKA 1WEZA 1R0CB 5J2QB 2DYAA 3CO0P 3PIOQ 3EYZA 2BOPA 1NJYA 3MD3A 2OP5A 3GJSB 4ZHRB 3LAKA 3CJRA 2R7OA 3M32A 4YFUA 1N32F 5B0EA 4Y2CA 4YY3J 2GQ2A 1TTHB 1WF1A 2HBRB 2QA1A 1RHUB 2A1BA 6AT1B 3IBCB 1AYEA 3BO3A 2NR0A 4QYRA 2HFUA 2RS2A 1E6VA 4ED6A 4DV6F 1X5SA 2MKHA 1VRTA 1L3KA 4CLFA 1RT3A 2JC0A 4MFBA 2HBZB 2HQIA 1OSDA 4XAKA 2GS8A 1U8SA 4ED8A 2AJ0A 3VWSA 1NXIA 3E01A 4OHVA 2ZHAA 4LSNA 1HA1A 1F2GA 2RQKA 3SSQA 3LP1A 2XEXA 3DOMA 4W4MA 2J6TA 3JYTA 2K1RA 1IJEB 1Q7YT 3D3CJ 3IBFB 4X84A 4X66J 4NI2A 4OHWA 2LQ9A 3V81B 3CCQS 2CRLA 3D6FB 1CS4B 2VC1A 1YWXA 3DU5A 3CXCR 4C11A 3THVA 1S9EA 2DXFA 4NZ0A 5D3GB 3GIIA 1BMQB 4LR7A 2CPZA 5F3ZA 2V5HG 4F0MA 1RTZA 2C2MB 3QSIA 4DOZA 1H3DA 5KFHA 4B3TF 4KJIA 1TVRB 4FVMA 2YX1A 3OTDA 5CYMA 3R97A 3RTVA 4NX9A 2ZUAA 3OUYA 4F0KA 5L46A 3NBPA 3MEDA 2IRYA 2JVRA 4EUVA 3MI7X 2B6AA 2CQIA 1QM9A 2QMUB 3JSYA 4KY3A 2OPQB 5EX3A 3V2UC 3CC2S 2CJBA 4NLGA 2MQLA 4FYXB 1U0SA 3MM8A 4M5JA 2R42A 2KG1A 2R2TA 1RWNB 2ASJA 2XCAA 3EVOA 3U27A 1RT4B 1YQHA 3KLGA 2FZKB 1F1BB 2R3VA 2N4CA 5BR8F 4MT1A 2V8GA 4U96A 2PDAA 3CF5Q 3GIMA 2NZCA 3NOCA 4DR1J 2NS1B 1U1QA 1RA7A 3NLCA 2RDDA 4QR0A 4DV7J 4OMFG 3MDFA 1B0PA 3MMAB 1HLWA 1SJ1A 4Z7YA 2DRBA 1OO0B 3P96A 3NGTA 3R5AA 1Q79A 2VIHA 4WE1B 3CIZA 3VAGA 4O4RA 5BYSA 4UF4A 2XC9A 4YB5A 3DNCA 2ZUGA 2XSFA 4DHVA 3SCLE 4WFNQ 2EK6A 3QIPB 4TY9A 2DH8A 3BKTA 4QWBA 1SIWB 3FEZA 2IRUA 1HBOB 3CGIA 3TVKA 3PW7A 3E2EA 4HT5A 3G8QA 2LQ5A 1KQSR 1NSPA 2QMXA 3W2VB 1HFEL 5C24A 3NCPA 3L7UA 2W9CB 1HNWJ 4C4WA 3KLEB 1XN9A 2ROPA 2R2UA 3MOZA 3QT8A 3UDCA 3H2UB 1SXLA 4J9RA 1H2VZ 1RWPB 1VC5A 1N34F 1SKSA 4BLGA 1FJEB 3DGPA 4DPWA 2YKQA 4RUCA 1EP4B 2ZHOA 2BQRA 5KFNA 2GO8A 4ZVRB 4OI3A 1VQLS 1E6YA 1LWXA 3X1LB 3H5SA 2VODA 3A8JA 1FI4A 4QZVB 2LDIA 2BJDA 5FIIA 1H2TZ 4PYAA 2XQCA 4KE5A 2HAFA 1U7LA 2P6SA 3DM2B 1PAEX 1NJXA 1GMVA 4FYDA 1X5PA 3GJTB 5IXUA 3OTOJ 3FDSA 4ECVA 5MAOA 3V6DA 4MKYA 3D7SB 3L4BC 1TMMA 1U6FA 4GMKA 1R8PA 1G7CB 3PG9A 3ILOA 2EKNA 4KR0B 4RW4A 3DRRB 2ZKUA 4LIWA 2QA4G 1S57A 2HPUA 1DY3A 1RTDB 3CDBA 2WSFC 1UPPA 5KT6A 3VQTA 3UCGA 5LM7E 2XYGB 4FVCA 2Z2ZA 3G4SS 3O8WA 4G65A 4ZVGA 2FHOB 2HRTA 4DI6A 4DSIA 1JJ2R 2VASA 5AJ3J 3AH6A 1TL3A 3MEEA 1TKXB 3D68A 4EZ9A 1S59A 2LMIA 3BKFA 4B9LA 3R5JB 5ADZA 2MQPA 3KHGA 2XY5A 5HVHA 3IM9A 1T3NA 1NZ8A 3PEJA 3TX0A 3EPGA 1YDLA 5CD4H 5B09A 1L3VA 2VPYB 5L9XA 4TQSA 1X7VA 4A8XA 5FJ4A 2DNGA 3HK2A 3POTA 1NNDA 4HT7A 2I1RA 4EI2A 3PRBA 3R27A 3CJSA 3BBFA 3SCIE 1APSA 1JKHB 5A0YA 4NLWA 5D77A 4F4AA 4YQWA 3DLLQ 2AYBA 3LP2A 3VGVA 1VK8A 5E41A 2MQ8A 1N32J 1T9UA 1N8RT 2JDJA 3FGVA 3VQSA 2AJFE 4TY8A 4N76A 1RWXB 5DQIA 2H5EA 2OD6A 2YX4A 2DR9A 3EGWB 5J2QA 2YKPA 3KLIB 5E3AA 2G2ZA 2JLFA 3M2VB 2YH1A 4ZHRA 4DV6J 4J37A 4F4YA 4X4RA 3EVWA 1ZOTA 3UD4P 1RHKB 1O8BA 1TAUA 1HBUB 3AQPA 2YKNB 3M8QB 1VJWA 2W25A 2ZBPA 3QFHA 3TUIC 2AF6A 3TA1A 3KMQA 3BSNA 1GK8A 4WKRA 3ZZRA 1NPKA 3SCJE 2YNGA 3FFIB 3CC7S 3KOAA 1FKPB 3I82A 5B7WA 3X3UA 2AJ4A 1OQ6A 4U7UD 1LOUA 4YEAA 2EW9A 3BDPA 3CT9A 4D3HA 1OY9A 4USKA 4C8NA 1HI1A 2RQCA 2OFGX 4NZ6A 4PPZA 1NMEB 3CE8A 4QW9A 2EEYA 5J2PB 2GVDA 3D0HE 1U02A 3HVTB 2HZAA 5GMEA 3ZZUA 1YJ9S 1JLFB 3V81A 5A8RB 5KFRA 2G2OA 1CS4A 1V3SA 4IR1A 4I1TA 2BM1A 4G1IA 5D3GA 2QL7B 1F5AA 1P8GA 4CT8A 1RWMB 1QLNA 4M5HA 3KJVB 3HJVA 1JB0C 2ZJRQ 3NXZA 2EFOA 1S77D 1TVRA 2L41A 1XNQF 2ILYA 3L95X 3M8PB 2AEMA 3TUPA 2HHQA 2ZEJA 1Q53A 5HSPA 2KFZA 4IRCA 4USVA 4LFBF 4E2FB 2DNQA 3LGMA 1U1OA 1S6PB 5KG7A 3UWTA 3W66A 2OPQA 5SZTA 2NYIA 1F5CA 3UCUP 3HF5A 1CQNA 3DRPA 3W9HA 3K5PA 4CLTA 3I5AA 5M2RA 1B64A 2BKNA 3CCVS 2XMKA 8ATCB 2P8IA 2OGUA 1P9YA 4GVBA 2KYZA 2HFVA 1UEUA 1YHQS 1MN7A 2XB2D 4WYLA 2DKOB 1VOMA 5H9FJ 1GMUA 2XWXA 5AE3A 4NEYA 1WKLA 2RILA 1VBKA 3NS7B 3TANA 2J7KA 3R7NB 3UNGC 4USJC 4K50A 3PEHA 3IR6B 4ILRA 5ETKA 3CJKA 4R0EA 4BWMA 2XCPA 2JRSA 1JJ4A 4WFAQ 3T1HF 3UN3A 1LNQA 4C8ZA 4HLBA 3BR9A 3TAQA 3CD0A 3QT6A 1CJTB 3LWLA 3LA0A 2F3JA 4WE1A 3DC2A 4UY85 2XY6A 4XIUA 3QIPA 1UCNA 2BKOA 3JXOA 4WFZA 5DQHA 3GQCA 3WHIA 4LQ9A 2XLJA 1HBOA 1YRTA 1W2BR 2PEHA 4DG1A 2HURA 1N34J 4KFBA 2HNDB 3SMZA 2D69A 4ICLA 4CLSA 3VAKA 4YMEA 2JL9A 3OL9A 2W9CA 3KLEA 4NLPA 1Y4ZB 2LA4A 4YHHF 4FXDA 3W63A 1C4CA 1NK9A 3VGSA 4USHA 4ECWA 4X4VA 1H0HB 2PIIA 4NYZA 2IAJB 5L8RC 3P8BB 2HGNA 2HQCA 4R5PB 2ASYA 1FD8A 3EGVA 1EP4A 1RSCA 3R5GA 2OSRA 3JSRA 5HVFA 2AQ4A 4LVOP 3GCWP 2ACYA 4USIA 1D0EA 1F3VA 2LLZA 1WWHA 1VLYA 1HQEA 4F3QA 2PMZD 3IC1A 2MQOA 2GMLA 1HHSA 4K4SA 5D8HB 4C8YA 3J7Z5 2GAHC 3HHLB 4B9MA 1P1TA 2B51A 4EYHB 1RDRA 1VIOA 4M5DB 2VL1A 1R3NA 5DRKA 2QEXS 1IM6A 1PJ5A 1FRMA 2FYXA 5C7PA 2P9CA 2DO0A 4M94A 4NLUA 3KLHB 3QGPA 1KVJA 4IH5A 4NEZA 4OHYA 1WC6A 4OYMA 4IG0B 3DRRA 4PCQA 3HSGA 3GP9A 2NZ4A 1WSRA 4JV5F 5K8MA 3AAWB 1UL3A 3JQMA 4DPYA 2F8MA 3GJRB 3P3DA 2D7SA 3HMJG 2YQ3A 1V3RA 3PX0A 3PW4A 1K1QA 2DBBA 4F50A 1S0VA 4NLQA 1RU2A 1M0SA 1OYDA 4MK9A 1U09A 5B0FA 4IUFA 2GX8A 2V68A 1Y5NB 3CD5A 4J90A 2CZVC 3I0RB 5F8IA 1KWMA 1V3ZA 1RT6B 2AZ3A 1Q16B 3HFZB 1FKOB 3SSSA 1IKYB 1FRIA 1S99A 2FQQB 4RW9A 2MHEA 3HFKA 3NWRA 3BSAA 4KKOB 2LA6A 1C1CA 1S1TB 3I9ZA 1PC4A 1VYAA 2KVIA 2NXUA 4OX8A 4O3OA 4LBIA 2VC0A 3HCXA 3QJJA 1JQGA 2HS3A 2P2CB 3TARA 2DHXA 3MECB 5KFZA 2GA7A 2E5LF 2R7TA 4LMZA 3FMWA 5D4OA 4ILLA 3PZPA 2Q1LA 2UUWA 3CD6S 1OYEA 3R6GB 2V50A 3TVZA 4DS4A 5KFIA 4YS2A 5ETSA 4ZJLA 3V4IB 2HWHA 3M2VA 4NPOA 2F9JA 1B3TA 4CM0A 1ZA2B 4BCAA 4J9VA 4DQRA 1T7PA 1X4EA 3J81j 3M8YA 1HBUA 3MPUB 1NDKA 4WXOA 1VRUB 2YKNA 3PR5B 3BGRA 3L7OA 3OV7A 1R0BG 3W64A 2C2NA 3R2DJ 2K8GA 3PDNA 2BANB 2ZITA 3FFIA 5BXIA 2C2RA 5LJ5Y 3WX8A 3V4MA 3DDKA 1DQ9A 1RK8A 4CRJA 2Y8YA 4DUYJ 3UFCX 1DLOA 2FLNA 1UW4A 5B08A 1NU4A 4AYBD 3UDEA 4R0JA 2MGZA 1ACMB 2EFNA 1DRZA 4WFYA 4UOGA 4MIWA 4ZDNA 2VQEF 4WTYA 4OYBA 2PSZA 4LR9A 4CTAB 4FF4A 4ZP7A 4DR7F 2AJ1A 2Y8WA 1ZETA 5A8RA 2IA6A 2XS2A 2D9PA 5HP1B 4B9TA 3OLAA 3DLGA 1MROB 1H98A 2X1BA 2LKZA 2MLZA 3KJNB 3KJVA 2ROGA 3LTOA 4FPIA 3MPVA 4PG5A 5K8OA 4IR9A 1MW7A 4OYXA 3IWLA 3HLUA 3M8PA 3KK3B 1VDHA 4DFMA 3FBFA 5HATA 3GTYX 2V2KA 5A2QY 2BYCA 3MFHA 1S6PA 1SBRA 4M5KA 3H0PA 3OFFA 4X4UA 2YWGA 2OEJA 1TL4A 4UTGA 3QBCA 4OZJA 1FFSB 3N6NA 1OSCA 2YTCA 2MYFA 4OX6A 1LW2B 1MWZA 3RBZA 2G1HA 2A2DA 1NM2A 3IN5A 1S1UB 1V6HA 1UMJA 1TK0A 3RAQA 1VRQC 2ZWPA 1UVKA 1T8EA 3TRGA 4CO2A 1IUJA 2GVZB 1RKIA 2VZ9A 2HZCA 4WK3A 1JLAB 2BKPA 1LFWA 3C6TB 3CULA 2M70A 3DRSA 1FX2A 4DX5A 2HG4A 2MZJA 2DH9A 1FF2A 2FC8A 5FDLB 2E1AA 4H4KC 2XO7A 4HR2A 2FTRA 1YVFA 1VC6A 2CVEA 4USTA 5C25B 1CJTA 1AUDA 5CCLA 5D0RA 1JMTA 3T41A 2G9OA 3JTPA 3QNWB 3M2RB 1BC6A 3OR2B 5T7LB 1EETA 4JI8F 4XTTA 4YHHJ 2WOMB 1H2UX 4FNHA 3NCQA 4NXNF 2E1MC 5HMWA 5B0AA 5HMZA 3UI3A 3IG1B 2EC2A 4N47A 2RH3A 1RBOB 4GC7A 3BS9A 5THWA 4DL7A 2F4VF 2ZH5A 2BX6A 4C48A 4L73A 2CNNB 4ZLNA 5KFYA 1P1LA 2W24A 1HIYA 4KHPJ 3K2YA 1REGX 2VUGA 1XJWB 3TZZA 2E9TA 3ET6B 1AZSB 2KRBA 4PQAA 4U95A 4ZVHA 1WHYA 3DU6A 4R25A 2CPXA 2KDOA 3HKZD 3NGUA 2V6AA 2I0XA 1XERA 3BB5A 2F9DA 2DIUA 3N5FA 2OH2A 2BUNA 4UUXA 5HMXA 5DLGA 5CCMA 5K20B 3N4WA 3FNNA 3JTOA 2HZVA 4TXSA 1Y5LB 3UW1A 4P7TA 1A9NB 2CA9A 1RTJB 3H2LA 2GIRA 2J0WA 2H5JB 5K8PA 3EZ5A 3AOAA 2CPIA 3BGUA 3EUNA 1XR6A 2M88A 1WHXA 2ZJPQ 4K5RA 2E5GA 2O66A 4YB1P 4QPTA 2XMWA 2J7UA 3KLHA 4C8LA 1N56A 4CP5A 4DZ6A 2ACMA 2AYGA 1YJWS 2MLXA 4IG0A 3MPYA 1S9GB 2HK3A 5HROB 1MNEA 2VH7A 1FEHA 3D5MA 2WCXA 1HR0J 2W2MP 2E44A 5J2NA 1LXNA 1VIXA 2UXDJ 4YP3A 1HPZB 1N0UA 3M1VB 2I38A 1EAYC 3Q8RB 4N5SA 4MTPA 1YBAA 4B3MF 2LQBA 5ETRA 2HHHF 4DX8H 1WC3A 1YBUA 2ZM6F 3KLFA 5KFCA 1D9AA 4HACB 4ZLJA 2VKZG 2HQGA 2W2NP 1HBNB 2MZSA 2ZKTA 2D9OA 1S7IA 1R43A 1GTHA 3NEKA 3GYXB 1RT6A 2I6WA 3EXCX 3KYLA 3HVWA 4QU6A 2R7XA 1FKOA 3RYLA 3TUZC 3OVAA 2DNLA 4KKOA 1NO8A 3DXSX 3J80Y 1OS5A 4ZOSA 1S1TA 2W7PA 3MMBA 5I42B 4NCGB 4K0KF 2GGPA 4ZVPB 3GR1A 2C2EA 5T41A 1X0PA 3N28A 4KC5A 3RZAA 2H4WB 1S79A 4JP8A 3P4UB 1KR4A 3UR3C 1RTHA 5CA5A 5KFBA 5KFGA 3MTJA 4QR1A 2V8PA 1FTRA 1KLNA 4P74A 4UOHA 2L9NA 1IQTA 1LFPA 3FRZA 3OTEA 4M63A 4ZP9A 4KGVB 4MMOA 4XPEA 3V4IA 2IHR1 2ZOFA 3PJXA 1C0TA 3H2VE 1VGYA 4X62J 2DGTA 3ZZZA 6FD1A 5C42A 2X1GA 4IOBA 5KFSA 2CQCA 1TUVA 2GIFA 1KQKA 1VQYA 3PHEA 4P2MA 1RBAA 2BANA 3EJMA 1U2RA 4Y00A 3AJ1A 1M5SA 3CD7A 3H40A 4DR7J 4KGKA 4HI1A 3DOLB 4ZPBA 1Y10A 5LMNF 1Z4UA 2LEAA 4CH1A 4LVNP 1EB0A 2ZH7A 3L9ZA 4RWWA 2AWZA 3A3PB 5EDWA 3SV4A 3PRVA 1DBDA 4CTAA 4ZPDA 1CQMA 3DHWC 2DNKA 3ZFVA 1G2EA 2YKMA 2LXFA 3ISND 5HP1A 2OFHX 2YWHA 1MROA 1RTIB 2E9RX 1TU0B 3H90A 1Q5VA 1FFWB 3RR8A 3GR0A 1LQ9A 1N48A 4DFJA 4ECXA 5HAOA 3KK3A 2QJ3A 4M5NA 4J5OA 3PRDA 4DPOA 2QE5A 1YKWA 2PI5A 4RW6B 2NREA 2H3EB 4Y6IA 1U6ZA 2F4FA 3OXLA 1GX5A 5KG5A 1Q78A 3P5BP 5EX0A 5D4LA 3CMES 2G1DA 1LW2A 1XMQF 1MU2B 1WOOA 2M4MA 5F8MA 2EC0A 1NRKA 1VS3A 3L09A 3GIJA 3KJFB 2IYGA 4P10A 4RPFA 1RZMA 3PIPQ 5KTQA 2J6UA 4N8OA 1G3OA 1FNOA 1G6BA 2V4QA 3D66A 2FJDB 3P49B 1LWCB 1KDNA 2ZZTA 2DB1A 2C22A 3C6TA 1I3OB 1RAJA 1SC4B 2XY7A 2Q6BA 2EFVA 2R7WA 3D4JA 2W7OA 3TEGA 4JI8J 3Q24A 1NDLA 4P75A 2FLOA 2FD2A 4NRTA 1N88A 4O23A 4A8WA 4QIEA 2VFVA 4CYUA 5LXYA 1GNKA 1Q4RA 5AXNA 1ZPWX 5C25A 1GH8A 4ED2A 1RHQB 1U1MA 4J7CA 4P2FA 2F4VJ 1DTTB 2HEKA 1UA0A 3M2RA 4B08A 3M8SA 5GMDA 1Z1ZA 2WOMA 3BEGB 5JVHQ 4LF7F 5A8KA 1U1PA 1X4CA 1NHUA 2OI2A 4RBVA 1F2HA 5GAGI 3MPDA 1PO6A 3CCES 3ULHA 2R7SA 2WSEC 3TUJC 4OZ2A 2JLEA 1YJUA 4Q8FA 1ZAWA 2OKQA 4A8OA 4DN0A 2FVQA 3MXHP 1PGZA 2NXNA 2DEIA 1RP5A 4A8FA 1YJNS 3SIPB 3VAJA 3AY0A 1U1KA 4C3KA 5GADI 2V4JA 2HK2A 4IFVA 1BD6A 5A8WA 3MCMA 3NY0A 1RAGB 4CH7A 1YRXA 1MN9A 4NXMF 1LKZA 2HIYA 3VHQA 2OO4A 4Q8EA 5IM0B 1KFDA 1QTNB 1UAWA 1VI7A 1KHWA 2DRAA 5EWFA 1C1BA 2DHGA 3GILA 5K14A 4K2JA 2PE8A 3AB2B 4U67Q 3CSKA 3BKUA 2FJVA 1WTBA 1RABB 4KV8B 4I64A 2EBEA 2QLFB 2KM8B 4F67A 2JJ4D 1PJ7A 3CCLS 2C2DA 4B3MJ 2HHHJ 3QGIA 4WFBQ 4RUHA 3T5LA 2ZM6J 1S9GA 2IJNA 2CIMA 1AXQA 1QDUB 4KH1B 3AFGA 2FC9A 1TUWA 4J9OA 1SJ4P 1AW0A 2IM2A 3W7BA 3OL8A 3UCZP 2LYVA 1JXEA 2LCWA 3Q8VA 2VG6B 1FCAA 4N7TA 3MM6B 5A76A 3M1VA 1RAHB 2DGXA 3O3LA 3DOKB 2MKIA 3KUHA 5KT2A 4X4SA 3OL7A 3RRHA 1S6QB 2IVFB 3BN4A 1PG5B 1M1KT 2G13A 2M52A 3OXGA 3RB0A 2PO4A 1HBNA 2RDJA 1S76D 2VJVA 2NUHA 1VQKS 3I87A 4CNZA 4K0KJ 2P5VA 1RXOB 2M0GB 4ED5A 2FJEB 3NGDA 3GWCA 1K0TA 4YR2A 4LF6F 1R89A 4DL2A 4I0WA 3K89A 2PEBA 1RAOA 2IIHA 4DUTA 4KTQA 5I42A 7FD1A 2W9AA 4ZCMA 3MR3A 1JX4A 3C15A 2HHUA 2IJRA 2D3UA 4PQUA 1ICEB 4WPAA 4RJVA 3ITHB 2VBXA 4USUA 1ZTTA 3WZ0A 5DLFA 3JAMU 1RCOB 3A3NB 2LEBA 2MQNA 2DNPA 2V2ZA 1TKZB 1CULB 2BW2A 3OSNA 3W3SA 2MDAA 3T1AA 2EVZA 4QIWD 4OLOA 1B7YB 2FGCA 1NSKL 4URSA 2UV8A 3J81Y 5D0EA 4LUBA 3FSYA 3HJFA 5G4DA 2FPHX 3T5JA 1X4DA 4PWDA 5LMNJ 4OI0A 1QE1B 4LRAA 3M7VA 5ETNA 3H4DA 4JI7F 3UDVA 3Q8PB 2YKOA 2MTLA 3VZIA 4C0OC 4NLRA 1VQ5S 3KJQB 2N7CA 3MUMP 2GO9A 1WTFA 4FYVB 1ZAXA 3DOLA 4ZN3A 4WYWA 5DDPC 1UETA 4E8UA 4ES2A 3I5BA 1W25A 5CXTA 2XLIA 3ILIA 1SH0A 3GV8B 1JLGB 1HNZJ 4N8NA 2FVSA 4CLYA 1YBTA 4P71A 2KFNA 2OPPB 3MM7B 4ALZA 3PNIA 2QL5B 2HHSA 2LP4A 2JX2A 5DZ6A 2DHAA 4ED3A 5IOLA 3IWNC 1TL1B 1BQNB 3BYPA 4PKDB 5EWEA 4Q0BA 5G0RA 2XZDB 1RBLA 1XMQJ 3EM1A 3ISNC 4ID8A 4LF5F 4IFYB 4RW6A 5MLCV 4B3RF 1Q86T 2HWTA 2R7RA 2R8GA 3KUEA 3K58A 4KAIA 3RR7A 3ZZYA 1JLQB 3IGNA 4PUOB 2H54B 3ELHA 3DLBA 4OZNA 1M90T 2G0JA 2R9LA 4I7FB 4P2XA 1MU2A 3PJ9A 2OHDA 2OTLS 2W4PA 2B9EA 2YH0A 2F1FA 1UKUA 5KT7A 1FDDA 2FJXA 2QG9B 1F9FA 2F65A 3OHBA 3A12A 1CJVB 3UN2A 2AV5A 4DQPA 3HXMA 3RB4A 1VISA 5DS7A 5CH7B 1SV5B 2KHDA 5HQ8A 1IKXB 4L72B 5F8NA 1S12A 2BW7A 3HSJA 2FVCA 4UW2A 2Q6CA 4LF7J 3DGVA 2HQDA 2N7YA 3C6UA 3TAMB 1FFGB 1GFWB 3MEGB 4N56A 1J2VA 1K9MT 4KIAA 1QSSA 1LWFB 1S0NA 2QRRA 3EMTA 2UUBF 1YIJS 1KTVA 2LXIA 4QIGA 5KFMA 5IT9Y 2YWEA 5KFAA 2MPUA 2HMIA 3PFOA 5KFOA 2RAQA 4LF1A 1GAOA 1T95A 2BE2B 4YB7A 1PYTA 3WX4A 3GFXA 4DSLA 3J7AN 2EK1A 3R2CJ 1I94F 4LRFA 1IJFB 4ETZA 1RT7B 3G8SA 3BSOA 3PACA 1GMWD 1Q8KA 1X9MA 1VJQA 3MMCA 3TJ8A 1U6BA 3HM9A 2HRYA 3UNYA 4F26A 5DGBA 3BH6B 4WU2A 1TQLA 4DPUA 1SI9A 5KG0A 1IQZA 5F8GA 3PFEA 1R8CA 3LAMA 4ZKAA 4K4YA 4QWCA 5RUBA 3ZTSA 1Y3JA 5CHCB 5T14A 3G87A 3AXKA 4J91A 5LJ3Y 1EKRA 2B3TB 4ELVA 1IN0A 2QLXA 3CDUA 2E66A 1YJRA 2LVWA 4FN5A 4DR2F 2XHCA 4WZMA 1NZAA 3MR5A 3GV7B 5L1KA 2JEGA 3LP0B 2DY1A 2QX0A 4K4XA 5D4PA 1UZDA 2XI3A 3G6XA 1T05B 3RU0A 3PYDA 1U26A 3L7PA 5I3PA 1RADB 1R7IA 1WDTA 4KV8A 1GQEA 2FJWA 2CQ1A 4IOAQ 1X60A 3PXGa 2Z58B 3BO4A 1FKAF 3HVRA 3DMJA 1XMBA 4K7QA 4P7VA 1PJ6A 4PWWA 2KM8C 4Z2XA 3IRXB 1RLCL 3IM8A 1T03A 5F8HA 4BC9A 2EG2A 2W4DA 3KG0A 1KRPA 1REVB 3SI8A 4ZA1A 4DPXA 4LF4F 3LUYA 2IMOA 1FJCA 2VG6A 3T5HA 2RQ4A 3MM6A 2CWKA 3W1YC 3HHNB 4LF6J 4Q45A 4DV4J 1YX2A 3Q8UA 5H9EJ 1NB7A 5E2QA 2KJWA 1A6LA 4DBQA 4IQMA 3CJ8A 4DR4F 2W7AA 4C98A 2VBZA 3AB4B 2VD3A 1OPIA 4H4OB 1IM4A 1PAUB 4FF2A 3C66A 3KFWX 2HSEB 4IH7A 3SSRA 4ELTA 3WC0A 1WNEA 1FWPA 4F2SA 1GTEA 2BJ1A 3K0JA 3R9LA 3RBDA 4L76A 2ZVIA 5IC6B 3QGGA 1D9FA 1HMVB 3OHAA 3CCSS 2H51B 2B7BB 2CQ4A 3ITHA 3HD2A 2V34A 3N5BA 3HD1A 1WF2A 3HSDA 3IMQJ 2PD1A 4HDGA 2WW4A 1TKZA 3D0GE 2IY5B 3SQGA 4JI0J 1CULA 3I31A 4JI7J 4CI0B 1U1LA 2ZBCA 9RUBA 5L1IA 3VAFA 3BQ0A 4DV1F 1F9EB 2FIUA 3OQ2A 4TNOA 2DGOA 3SDEB 3G96A 5ETVA 1V5VA 3ILLA 4OX9J 5H9FK 1R0AB 3ZNUA 3CTRA 2GHWA 1QVFR 3DN9A 4DV3F 3LH2S 5KFJA 2EFPA 5KT5A 2RF2B 3A1YG 2YNFB 2CJXB 4JI6J 2JLGA 3A3OB 3UPFA 1RAEB 5M2UA 4KHRA 2CYYA 2UUTA 2F7VA 3IP0A 4UOFA 4PXBA 3M8RA 1S4EA 4DSKA 1FJ7A 1I6JA 2KN4A 2ZDOA 2JEIA 5IWAF 3BGFA 3B4MA 1BGXT 4KGXB 1KSPA 1U48A 3FJ2A 2XGPA 4F25A 1FJGF 3QFWA 3H25A 1UFWA 2J8AA 4ECQA 2KXHA 3RBEA 1HHQA 1T9YA 4UZBA 5KFWA 3MTKA 2VPWB 5K9FA 1AT1B 5HVGA 1NPRA 4GKKJ 2DNYA 2A2CA 4H4MB 3AD9C 5BYRA 1OWXA 2E9ZA 1Q8IA 1NUEA 1HBMB 1S1VB 3CVKA 1BXNA 3ZZTA 3ICLA 3FCVA 1MMNA 2MJUA 4LF5J 4DV2F 2NSCA 4M5GA
chains in the Genus database with same CATH topology
2DR8A 1NEEA 3D0IE 3MAQA 3CCWA 1DRZA 1XMOF 2XSJA 4WFYA 1FRJA 4MIWA 2VA3A 4JV2A 2GIQA 3J7YU 2CPEA 3E01B 4ZDNA 1SH3A 3MMJA 4YY3F 4WTYA 2VQEF 2JSXA 3S6EA 4LSNB 2PSZA 4MK7A 4F3OA 4K4WA 4CTAB 1TL5A 3CJ2A 2DNHA 4ZP7A 2J9DA 4FF4A 3UR0A 4DR7F 2V8DA 4GKKF 1URNA 4O3RA 4DWIA 2AJ1A 4MYTA 5LSLA 4B3OB 1ZETA 4DUYF 1LXJA 4V19X 5A8RA 2IA6A 3Q22A 2XS2A 2D9PA 5AXKA 5KFDA 3OFEA 3TOQA 5HP1B 4B9TA 5E3QA 2V9KA 4EFAC 1H6KX 2IVMA 3CEDA 2CQHA 2CPJA 2OLWA 3OLAA 2WHOA 3DLGA 4ZPWR 3MUTP 1ZBTA 2X51A 1MROB 3DLGB 1H98A 4L6V3 2RD5C 2LKZA 2X1BA 3KJVA 4IFYA 2XMUA 2ROGA 1WG1A 3IR5B 4EBCA 3MPVA 5H1SV 1TAQA 4PG5A 4NMLA 5K8OA 4IR9A 1FK9A 2RMLA 1HYSA 1MW7A 4WK1A 4KHMA 4A8MP 3IWLA 3HLUA 3E51A 3BQ2A 1M5PC 4DEZA 4AQYF 2XS7A 3M8PA 4PUOA 1S9EB 2AX1A 2LU1A 3KK3B 2RRAA 1IKWA 1VBXA 2IJFA 1IKWB 4P6QA 4I68A 4A8YA 2PN6A 4DFMA 2CJAA 4I7FA 3MUVP 3CDEA 4I6AA 2JFDA 2V2KA 3MGJA 3G86A 3CIMA 5LT5A 1VQ7S 1QJHA 5A2QY 2ZNYA 4J9KA 1J5EF 1N0VC 4LFCF 2J7WA 2BYCA 3MFHA 5CYQB 3PW2A 4ZCLA 4X4PA 1S6PA 1SBRA 2B5JB 2DNNA 4PR6A 3TVYA 4WJBA 3OFFA 1TV6A 4X4UA 2YWGA 2FHJD 2RU3A 1TV6B 1QAIA 7FDRA 1TL4A 1U2FA 4OJGA 5B0DA 4X66F 2HHTA 1PILA 4OZJA 5CZXA 5KFVA 4O3SA 3N6NA 4PXCA 4ECZA 4DF8A 5DG9A 2UVVA 1OSCA 2YTCA 3OUYB 2AYMA 3GV5B 3NBPB 2GV1A 2MYFA 4OX6A 1LW2B 1MWZA 4X4NA 3EGNA 3T5KA 1BQXA 1LWEA 2B0GA 4DR6F 3K5LA 4IG3B 2MKCA 2A2DA 1N6QA 2K3IA 1N6QB 1QAYA 1S1UA 1L3SA 3QAEA 3IN5A 2IA0A 1M5OC 1S1UB 1V6HA 3R5BA 4DS5A 1UMJA 3OFHA 4BS2A 2F8HA 4OJ1A 2OPRB 2QYCA 1TKDA 1HHTP 2W8LA 5HL7Q 1TK0A 4TU8A 1KQGB 3RAQA 2J6SA 3V6KA 2MZRA 4QWDA 2V8HA 1UVKA 2CPDA 1T8EA 3NNHA 2IRXA 3TRGA 4FBTA 1FDAA 4HHJA 1IUJA 3THTA 3ETOA 4CO2A 1CLFA 3S8SA 2HS4A 3NL0A 1RKIA 2DK2A 2VZ9A 3G9CA 4MAKA 2OIHA 2HZCA 3R1LA 1JLAA 4NA2A 4BBYA 3DLKA 2DGSA 4CO1A 2KHCA 1JLAB 3MEGA 4WK3A 3DLKB 1LFWA 3C6TB 3FZBA 2DTJA 4X4OA 3CULA 5J2MA 4G6VB 4ID5A 4PG4A 2CQBA 3D28A 2M70A 2Q79A 4RNHA 1NK0A 1LWFA 3DRSA 4JI1F 3DRSB 2WB1D 3QMQA 4CH0S 4IH6A 3RB3A 3TA2A 2KZZA 1P9QC 4DN9A 5I3UB 3H5UA 2M7SA 2GW8A 4B9VA 4G1QA 5KFEA 5FDLA 2HG4A 3TP2A 3TO8A 2MZJA 2VOPA 2DH9A 1FF2A 2FC8A 5FDLB 2E1AA 4H4KC 5B0BA 2KJVA 2XO7A 2KXFA 2MY8A 2FTRA 1RQ0A 2YVSA 1YVFA 4X4TA 3NP5A 3QWPA 1VC6A 2CVEA 2JFKA 5C25B 5D4NA 2Y1IA 2GC8A 2F40A 4NA1A 3NG8A 1AUDA 2BE2A 3R5CA 5CCLA 4LF8F 2ZE2B 4W90B 1JMTA 3S01A 3Q8QB 4ES3A 3DI6A 2G9OA 3JTPA 2WAQD 3M2RB 3OR2A 5KFXA 1BC6A 2IC3A 3DI6B 5T7LA 3OR2B 5U47A 5GMKa 2IC3B 5T7LB 4DL5A 1FHTA 4JV0A 1EETA 4JI8F 1RISA 1EETB 2WOMB 1VQ9S 4J9LA 1H2UX 5AXMA 1S6OA 4FNHA 3NCQA 3N9UC 4NXNF 1MMLA 2DGVA 2E1MC 5HMWA 3MM9B 4OLPA 5B0AA 1N33F 1JLBA 1F60B 1JNZB 2KTQA 5HMZA 1JLBB 4J9SA 4W92B 2IM1A 3IG1A 5FLXY 2RUGA 4JUZA 3UI3A 4PG7A 2VQFF 3NMAA 3IG1B 3HHDA 3QJLA 1JLCA 4J9QA 4N47A 2RDIA 1TK8A 1JLCB 1DTQB 2K7KA 5IS2A 1RT2A 5A6WA 2J0QD 1NK8A 2ZH4A 2FJBB 2RH3A 4TLRA 1ROFA 4GC7A 3BS9A 5THWA 4DV7F 2UXBF 4ATNA 4DL7A 2F4VF 2ZH5A 1PSDA 3M2UB 2RSQA 3KMSA 2G0CA 5KOXA 2B7CB 3MF5A 1P1LA 4R8UA 5KFYA 4RZRA 2W24A 1I1GA 4NRUA 3K2YA 1NJIT 2VUGA 2R2SA 1T02A 2YWFA 2DR5A 2E9TA 4ECYA 3QIDA 1FRXA 5LSOA 2HHPA 1VK3A 3UDLA 1U24A 3TA0A 1Y3KA 4F3MA 3BGLA 4K4ZA 4LIRA 3SZ2A 2P9EA 5KFFA 1KN6A 4F4ZA 1WEYA 2KRBA 4NCBA 4OZLA 4BC7A 2DNRA 3JTNA 2NUUG 2COLA 4A8QA 4OJHA 4PQAA 2JHEA 3NKYA 1FERA 2WTFA 2HVIA 1M5KC 2BRLA 3F41A 4ZVHA 1N5YA 5JUMA 1Q7LB 1WHYA 3DU6A 4R25A 3LP0A 2U1AA 2CPXA 1ULRA 2KDOA 1RJJA 4E0DA 3MWBA 3EX7B 3T9ZA 4JI2F 1NK7A 3IFEA 4NYPA 5JVGQ 1PC5A 2LDYA 3HKZD 5GAHI 4ED1A 2I0XA 1XERA 3BB5A 3MHYA 1T05A 1JLEA 2F9DA 2DIUA 3N5FA 2OH2A 1JLEB 4ZVFA 2HWIA 2BUNA 4UUXA 5HMXA 4KHPF 5EN1A 4U7UK 2HIQA 3WDOA 5DLGA 4HH0A 3D1QA 2VG5A 3FSXA 4A46A 5CCMA 2BQUA 2HFNA 3N4WA 3KHHA 2CPHA 1U47A 2DVIA 2ZC4A 2WSCC 3SCKE 3FNNA 3JTOA 2VG7A 3IWXA 1M5HA 2ZD1A 3LWMA 1FRHA 1MWYA 2PA8D 1HNWF 4B9NA 2HLTA 2RRNA 2J9EA 4TXSA 1Y5LB 3G6ES 4B9SA 4RLEA 3UW1A 3F73A 2KU7A 4P7TA 3P6YC 1RTJA 1YJTA 1S4FA 1FD2A 1A9NB 1NH8A 1RTJB 2B56A 3H2LA 3LANA 2GIRA 2J0WA 4A8KA 4KPYA 1HNIA 4EO8A 1R27B 1X5TA 2ZH8A 2OSQA 1E6YB 5K8PA 1TK5A 4ES1A 2E5JA 2KRRA 3G8TA 3EZ5A 2JEJA 3RW6A 3IXQA 2CPIA 1UVNA 3IRXA 3H5XA 3BGUA 3EUNA 3ZZ0A 1XR6A 2M88A 3T3FA 1WHXA 4RBTA 2ZJPQ 2IFXA 4K5RA 4LSLA 2E5GA 3QZ8A 3K5OA 2O66A 4LSLB 4YB1P 4QPTA 1REVA 2J7UA 2XMWA 2FVRA 3KLHA 2J76E 4A4JA 4C8LA 2ZH6A 1CPZA 5DG7A 4N77A 1N56A 2WB4A 3OBIA 2HFZA 3CCMS 2DPIA 1X4BA 2DNOA 2AYGA 2HGMA 4KO0B 2C28A 3HP6A 1YJWS 2XBPA 4IG0A 3CJ3A 5HROA 3DHXA 1S9GB 3MPYA 4Y3CA 3OTCA 5HROB 3I0SA 4OIXA 1WD6A 3U1NA 1MNEA 2VH7A 1NH7A 3I0SB 2I5JB 3HO1A 3GYNA 3DFEA 2O5DA 3BDEA 3NNCA 4RBUA 2W8KA 1FEHA 2BZ2A 3D5MA 4OJ3A 3UE2A 3V6DB 2WCXA 3KNGA 4Y2AA 2R2RA 2X1AA 1DAXA 1KOHA 3MM5A 2E44A 2XULA 5IQ6A 1SB6A 4XDCA 1UWBB 3QYYA 3CCRS 3H20A 1O51A 2C3PA 5E33A 5J2NA 1LXNA 1CG2A 2DITA 5J2NB 1VIXA 1HPZA 3CC4S 2OJ3A 2WONA 1SH2A 4JV1A 2CQ0A 4YP3A 1HPZB 4ILMA 1N0UA 3I4HX 4RW4B 2N4DA 3TQ1A 2VONA 3M1VB 2ERRA 4KSEB 2I38A 1WHWA 1FTCA 2R8IA 2AD9A 3Q8RB 2XG8A 2M3DA 4AFFA 4N5SA 4MTPA 4X4QA 2BM0A 1YBAA 4FP9A 4B3MF 2LQBA 5HLFA 2HHHF 2KFYA 4DX8H 4LJMA 5HLFB 4H4OA 1RI7A 3LO3A 1Q1KA 2ZFHA 1JK9B 2R8JA 2ZM6F 3KLFA 5KFCA 2JH3A 1D9AA 3KLFB 5L1JA 2X1FA 2VKZG 3J7YI 3EGZA 1HBNB 2CJQA 3JSMA 1IKVB 2L3MA 1QUVA 3OTOF 2MZSA 2V94A 2YNIA 2ZKTA 3KHRA 3IAS9 2D9OA 1S1XA 4FF1A 2W9BB 1VQ6S 5LMUF 3QZ7A 3CJ0A 4Y2MA 1HR0F 5LL6d 1R43A 4GC6A 1S0OA 1GTHA 5L39A 4FS1A 2DHSA 3I32A 3MZIA 4OV1A 4YB6A 3GYXB 1RT6A 3TYTA 5GAGU 1TFWA 3EXCX 3KYLA 4XDDA 4EYIB 5DETA 2UXDF 5SUHA 2XMJA 3HVWA 4QU6A 2R7XA 2QT7A 1HI0P 1HMVA 1FKOA 3RYLA 4RU2A 2UUAF 4RW7A 2HNZA 3TUZC 3OVAA 2VPXB 2HNZB 1LK5A 1JWWA 2C3OA 1N5TA 4OL8A 2DNLA 4EU0A 4KKOA 1TL3B 2OPSA 1NO8A 3B82A 3MEEB 3DXSX 2ZDPA 3J80Y 3F44A 2NSBA 4NCAA 4N41A 1OS5A 4ZOSA 1FA0A 2VFSA 1S1TA 2W7PA 3ZZOA 1S48A 3MMBA 3ENWA 4NCGA 4I2QB 5I42B 2AGOA 2YNHA 1TZ0A 3MMBB 3QO9B 1UVJA 4NCGB 3LPYA 1XR7A 1KONA 1KQFB 3IS9B 1SQEA 2JC1A 2XI2A 4GO5X 4K0KF 4F8RA 1BLUA 3ENVA 2CQPA 2GGPA 5AE2A 3GR1A 4ITSA 4Y28C 2GGPB 2OAUA 3NRBA 2C2EA 2P6TA 5T41A 1X0PA 3T19A 1HNVA 2C3UA 3U1LA 3P5TL 3N28A 4KC5A 4ED7A 3RZAA 2QIFA 1VQSA 4OI6A 2QV6A 3GZ7A 3BF4A 1S79A 4Q7AA 5KG2A 5GADU 3POTB 4TYAA 3CB4A 3GE9A 3C3LA 2IVYA 4FF3A 5IT4A 1KR4A 1ZM2A 3UR3C 1HW9A 1Q8BA 1RTHA 1KS2A 3SDEA 5AJ3F 5CA5A 1RTHB 5KFBA 1SL2A 3M4XA 2VOOA 1H7XA 5KFGA 3TI0A 2VFTA 4FPRA 1C4AA 3MTJA 1HWKA 4QR1A 2E29A 4RKUC 1RA6A 1FTRA 2UV8G 1KD1T 2ZBIA 1KLNA 3RRGA 3B8HA 5E3PA 4Q43A 2ASLA 1YJVA 3GFZA 3I6PA 2RF2A 2L9NA 1IQTA 1LFPA 3FRZA 3OTEA 4M63A 4ZP9A 2KT3A 2QLWA 4MMOA 5KFPA 1R6YA 4QJVA 3VZHA 2HS0A 4XPEA 1N52B 4Q44A 3PY8A 1WI8A 4G3IA 2VBWA 3V4IA 2IHR1 3N6MA 5IT0A 3AA9A 2O3DA 2EWHA 4MIAA 4WF9Q 2ZOFA 3PJXA 3PV8A 4K59A 3SEOA 2DO4A 1C0TA 1VFJA 4DQSA 4WZQA 4QU7A 1C0TB 1LW0A 2IYIA 2VBYA 2Z8QA 4TY8B 3H2VE 5EGYA 1WEXA 4KT0C 3RRKA 1WEZA 1VGYA 1RT1B 2DGWA 5J2QB 2CQDA 2DGTA 3ZZZA 1C0UB 6FD1A 4O44B 1WHVA 3DLEA 3PIOQ 4NYOA 3EYZA 5C42A 2X1GA 2BOPA 1NJYA 2GNKA 5L9NA 4ZVEA 5C42B 1HQUB 3MD3A 4IOBA 1VBYA 3OXFA 3O1LA 5E5NA 5KFSA 1QUPA 2ILZA 2OP5A 1ZM4A 2CQCA 1TUVA 2RRBA 3DCAA 3T6BA 4ZHRB 3LAKA 1X4HA 2R7OA 3OSPA 3DXBA 3M32A 1KQKA 3WBZA 5DGAA 2NPIA 4YFUA 1VQYA 3PHEA 3T1YF 2BANA 3PO5A 2XLKA 2XZWA 1QSYA 1N32F 1U2RA 4Y00A 5J1EA 4A48A 5B0EA 4Y2CA 2GQ2A 3AJ1A 1T94A 1M5SA 1WF1A 2QA1A 3CD7A 4NA3A 1GXTA 2A1BA 3H40A 3AA8A 4KGKA 4HI1A 4H4MA 5DDQC 2AGPA 3BO3A 3DOLB 5B0CA 5E3RA 2GMHA 1MSWD 4ZPBA 4X62F 5AXLA 2DPJA 1P27B 3AJ2A 2JEFA 5LMNF 1Z4UA 2LEAA 4C8OA 1S1VA 2C3MA 4CH1A 1U1NA 2O01C 2NR0A 4LVNP 2C42A 4QYRA 2DIVA 3CDAA 1S97A 2M2BA 2RS2A 1E6VA 2HFOA 2PT0A 4DV6F 4ED6A 1X5SA 3GFHA 2ZH7A 1E6VB 2MKHA 1VRTA 1L3KA 1RT3A 4U7CA 2EFGA 2JC0A 1VRTB 2VFUA 4MFBA 5KFTA 2HQIA 4MFBB 3OL6A 1OSDA 4XAKA 1U8SA 3OTBA 4DV5F 4RWWA 4ED8A 2AJ0A 2AWZA 4MJKA 3VWSA 5EDWA 3SV4A 3E01A 4OHVA 2ZHAA 1A7GE 4LSNA 3OR1B 1HA1A 1SKRA 1IXKA 1DBDA 4CO4A 4CTAA 2IBKA 3PVXA 2KYXA 4B9UA 4ZPDA 2ZZNA 1F2GA 1CQMA 2RQKA 3SSQA 3DHWC 2DNKA 1B0TA 3ZFVA 4B3OA 1G2EA 2YKMA 2LXFA 3ISND 2YKMB 5HP1A 3LP1A 2DGQA 2OFHX 2XEXA 2YWHA 3DOMA 3LP1B 2VPZB 3US5A 2J6TA 2FJAB 1RTIA 4KRWA 4RNMA 1MROA 1R8HA 3PM9A 4WU3A 1HWJA 1RTIB 4ZP6A 5KT3A 3FVYA 2E9RX 1N5SA 1TKTB 4NWBA 1NK4A 4Y0FA 3JYTA 1D8YA 2K1RA 2XHWA 1IJEB 4NL5A 3JYTB 1Q7YT 4C0HA 2K1RB 4X84A 1XC9A 2GCFA 3KK1B 4OHWA 2LQ9A 4FNIA 3RR8A 5EUHA 1LK7A 3GR0A 3JB9k 1LQ9A 1N48A 3V81B 3E8OA 3CCQS 2CRLA 2E7WA 1QY7A 2VC1A 3NGKA 1YWXA 3DU5A 4M8LA 4C11A 3CXCR 4DFJA 4ECXA 3THVA 1S9EA 4HKQA 3KK3A 4C11B 3FSIA 1B0VA 4NZ0A 5D3GB 3GIIA 4J5OA 2WRMA 3PRDA 4DPOA 1CC7A 1NJWA 2QE5A 2CPZA 2PI5A 5F3ZA 3H5YA