5L38A

The structure of the hexagonal shell protein msm0272 from the rmm microcompartment
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
SSNAIGLIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAVIVTGEVGAVKAATEAGAETASQVGELVSVHVIPRPHSELGAHFSVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Complete Structural Inventory of the Mycobacterial Microcompartment Shell Proteins Constrains Models of Global Architecture and Transport.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Structural protein
molecule keywords MSM0272 - RMM microcompartment shell protein
total genus 23
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2016-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l38A00
2A1BA 3I6PA 3MPWA 4QIVA 3NWGA 5L38A 3N79A 4DDFA 4QIEA 3PACA 3I96A 3MPYA 3CIMA 4LIWA 2EWHA 4P2SA 2G13A 3H8YA 4OX6A 4P7VA 4QIFA 3BN4A 4AXIA 4RBVA 2A18A 4PPDA 3SSRA 4AXJA 4RBTA 5DJBA 3NGKA 3DNCA 3IA0A 4OX8A 4QIGA 3VCDA 4RBUA 4OLPA 2A10A 3SSQA 4OX7A 3CGIA 4P7TA 3SSSA 3DN9A 4OLOA
chains in the Genus database with same CATH superfamily
4FP9A 1LWEA 4Z7YA 2CVIA 4OIXA 1N32F 3N4WA 4ZPAA 4Q7AA 5C25A 1FCAA 4NMLA 5GMDA 3WIUA 4AL6A 3TJAA 4ERDA 1PJ5A 3BEGB 5C5JA 4DV6J 3LOUA 4ZPDA 3HSJA 4FBUA 5F8NA 3NCQA 3D6MB 2GZOA 2JEFA 4PUOB 2CG4A 2JNJA 5F8JA 4A8WA 1U4BA 2JVRA 2HNYA 1H0HB 2KRBA 1RAEB 3PJWA 1SC4B 3DYAA 2VD3A 3KK3A 5GAEI 4LF4J 2VG7A 3W5XA 2M3DA 3WDOA 4K4VA 1WUUA 2IRYA 3SQGB 4MIBA 1N5YA 4WIQA 4OHWA 1VRTB 3Q0AA 3ZZRA 1YLXA 1R31A 3F56A 2V8GA 4DCPB 4DF8A 3FSYA 4RWXA 4Q0BA 4BC7A 4ZVRB 4DPWA 4EU0A 2DGOA 2YWGA 4DV0J 1RWKB 2W2QP 4G65A 2MZTA 4OV1A 4P6QA 2OPRB 3CDEA 3OL8A 3LPYA 2L08A 3JSBA 3PIPQ 4B02A 2ZEJA 1M5PC 2J6SA 1FXRA 1VYAA 3BBCA 4OYWA 4JV5J 2ILYA 1C1CA 3T6JA 3CDUA 4AE5A 2RDIA 1G1XA 1M5VC 5CHCB 1DURA 2OPRA 4AD6A 1F1BB 1X4DA 2EEYA 3A3PB 1OMSA 2V4JA 4TVAB 2ZJQQ 1WC5A 3MPDA 4IDKA 4WTYA 3CCRS 4YOEA 3CJ0A 1WSRA 3EXYA 2FHMA 3IGVA 1CJVA 3MDFA 5C24A 4U95A 3MUVP 2HWHA 1N8RT 1L3SA 3KTQA 1AUSL 3P45B 2D9PA 5ETPA 2B8PA 4B3MJ 1RXOB 1KVIA 2V4QA 1WG5A 2QIFA 2DTJA 1S1WB 2HW3A 1C0UB 1WKLA 3VALA 4C9DA 1GMWA 1HNVB 2HKEA 3CVKA 4N7TA 3HVTA 1QDUB 2IFXA 4J91A 4JI4J 3IBCB 4U9RA 1HPZB 4Q2MA 3J81U 2QRRA 2CRLA 1TKDA 2OPSA 3DC2A 1IR2A 2Q6BA 4AYBD 1ZM3A 3VCDA 3DFEA 2VQFF 3G71S 4EBCA 2HMIA 2IPOB 2MSSA 4Q5VA 2ADBA 1GH8A 1R3NA 4ED1A 3RAMA 4EZ9A 4OZ3A 1RWOB 2XSJA 4JI2J 2KZZA 2QMXA 1QUPA 1X4AA 3EZ5A 4ED3A 4ED2A 3A8JA 1HWLA 3MOJB 4ED7A 1N5TA 3GG0A 2H1YA 2LDYA 3TW0A 2CNNB 2YBVA 3M32A 3ZZZA 3J81Y 2W1BA 4E98A 4LF8J 3DLHA 3DLKB 5DG8A 1HFEL 1SVDA 2AIRB 2HS4A 2W4PA 3RBZA 4C8OA 2GQ2A 4LF6F 2AYEA 3PCOB 3H2UB 5DQHA 5CXTA 3BN4A 1VHFA 5E3QA 1HR0F 1VRUB 4Y3CA 4CNZA 1CSJA 3NGKA 4KO0B 4LF6J 2Y3YA 2I9SA 3HVWA 1U2FA 5DZ7A 2AJ2A 3CF5Q 4A8KA 2UU9J 2HAFA 2PEBA 4HL9A 5HROA 1KN6A 2MQLA 1V5VA 2C2KB 3RB6A 2EFOA 1R43A 2OPPA 3T5LA 1X5TA 2G1HA 2BJEA 1FTCA 2Z2ZA 1JX4A 1HBOB 3FBBA 4I7FB 4PXBA 1VS3A 4X4OA 1IKXA 3C8YA 4K8RA 3W9HA 3CJQA 3W7BA 4KB7A 4R0EA 1VQ7S 2YWHA 4BWJA 5HQLA 2MKYA 5HROB 2ADCA 1U1MA 2VDIA 4DSJA 4JI5J 2ZH3A 2QTWA 1S4EA 3AQOA 2DGQA 1UWBB 4JOUA 1REGX 3Q83A 4J9VA 4CT9A 1U45A 3Q2SC 2R7QA 3GSIA 3CCQS 4V19X 1GXLA 3F0NA 4ZVSB 5KT7A 2YWWA 2IBKA 3RR7A 1CJTB 1RU1A 5B0AA 3EDRB 2HFSA 4UY8T 3C15B 3G2XA 3OTEA 1W2BR 4DS5A 1RI7A 3GQCA 4FF4A 3I55S 3J7A1 4RLEA 2QO3A 1WOOA 3MAAB 4RO0A 2NYIA 4K4WA 3TJ9A 1VLYA 4K2JA 5CYQA 4C8NA 2CNKB 1RBLA 2L3MA 3DLEA 3TQ1A 1U1LA 2MEWA 3NKYA 1GEHA 1YG0A 1FA0A 3CJSA 4IOBA 4KV8A 4U7CA 4M5JA 4Y28C 4ID8A 1OWXA 2XULA 3AB2B 3KG0A 3MEGA 1Q53A 1KQGB 1Y3KA 3LP2B 4ZVGA 5HVGA 2PD1A 3A1YG 3DRRB 3SYZA 1H2VZ 1U0HB 1X0PA 2GIQA 2HNDB 2AF6A 3HHLA 4Q2LA 1R8PA 3KLIA 3QIPA 3THTA 2NQPA 3KJVA 4I1TA 3HM9A 3BDPA 4FYWB 1LNQA 4K5RA 1MMLA 1NAQA 2H5IB 2M52A 2MQ8A 4H4KC 5HL7Q 1CS4B 1HNVA 2O66A 1OPZA 2YY3A 2AW0A 2FGOA 4IH7A 4MKAA 4URQU 2KT2A 3VAIA 2L9NA 1KC8T 3MMCA 3M8RA 3LW5C 2VJUA 2X1FA 1B4SA 1T9YA 3OFFA 3FEZA 5ETOA 1S1TB 1Q5YA 4XK8C 3RR8A 4MK9A 2EC0A 1JXEA 4ZVOB 3I32A 5E5NA 2C22A 4J90A 3V6KA 4NXNF 4WU3A 5HMWA 3C16A 4DR2J 4XIUA 4C0HA 2ASLA 2EW9A 3HHLD 5CA5A 3I96A 1WI6A 1EHWA 4KH0B 4TN2A 1X0FA 5ITHA 4P2SA 1FRMA 4CM0A 1BMQB 3G82A 2BKNA 4PYDA 1KOHA 2EFVA 4PWDA 2AEJA 2HFVA 3KG4A 5E0OA 3VWSA 4OL8A 4U7UK 2BZ2A 1YBUA 2W9BB 4CO1A 3FEXB 2BANA 3P8BB 2DNPA 5KFYA 5MAOA 4OX8A 4DV6F 1S7HA 1RA6A 1TV6A 2H5JB 4G6VB 4DR3F 3M6WA 1IM6A 3H2LA 5EGYA 1RYSA 4J5OA 2DYAA 3AODA 4M5IA 5B7WA 1JLAA 1HBMB 3NWRA 1IWGA 1WDDA 5D0RA 5EX0A 3ZXWA 4YQWA 4QW9A 1S76D 4JUZA 1WF1A 2DGUA 4B3RJ 4FDFA 1YJWS 2ZH1A 4ETZA 1TK8A 4DV2F 1N5YB 1X31C 1KR4A 2BKPA 4DBQA 3M2VA 2G1DA 1RT4A 1QTNB 4KGVB 3CIMA 1KRPA 3C16B 2PC6A 4OJGA 4AL7A 5KFOA 5DGAA 4LVOP 2DVIA 2Z58B 4NCAA 3UN3A 5CCMA 2X7IA 2F3JA 1GMWD 2B5JA 4OJ3A 4F3MA 4USVA 4U67Q 1FKPB 3DGPA 3JQKA 5HBMA 4LFAF 3CO0P 3QT7A 5CD4A 3RW6A 3M8WA 3NAHA 3GFXA 5CABA 5IOLA 5AJ3J 3DOLB 1PAEX 1UA1A 1LW0A 1JQGA 5KG5A 1WEXA 3IS9B 3VF0B 2EC2A 4RL1A 2MJUA 3JXOA 2DXDA 3SEOA 5L39A 2E5LJ 2ZM6F 1BC6A 5BXIA 3KJVB 1WHXA 1S9GB 2CZ4A 2VFUA 1PG5B 2D41A 2LU1A 1LOUA 2VC0A 3A13A 5J2QB 1HWUA 2E7WA 5L1JA 2ZE2B 4BHQA 1T05B 3LO3A 1P8GA 3BBBA 1HW9A 3HO1A 3QJPA 2BEFA 2PFFB 1IQZA 3K5OA 2QMWA 2AJ0A 1CG2A 3R5JB 4M5MA 3PDNA 2V8VA 1TP7A 4PXEA 4DPUA 1NKCA 4NXNJ 1E6YA 3RBXA 1H3DA 1Q5VA 3OD2A 4WJBA 3D1QA 3EPIA 2WK4A 1KNZA 3KOAA 1MN7A 1TAUA 2DGVA 1B7YB 3LANA 4U6PA 2KFYA 1JLCA 1S9EA 1IUJA 3VGUA 2ZH5A 1NJZA 1VC5A 4JI4F 3OLAA 2E5IA 4PXCA 4YN3B 2R2SA 1ZOTA 1VBZA 4UQGA 1Y00A 3H20A 1NSQA 4F2RA 1CJKB 3NOGA 4UQTA 3PW2A 1DLOA 5I3UA 3B78A 3LP0A 1RTHB 1ZPWX 1IWAA 3BZQA 1F9HA 4RW4A 4WPAA 5LM7E 1T9XA 2HHHF 3HMJG 4GMKA 2C3OA 3FDSA 2DT9A 4C98A 1IKXB 3UR3C 5K8OA 1DARA 1GXTA 4RW4B 1DHMA 3OTDA 1T7PA 4RW7B 5JXSA 3HT0A 5H9FJ 2DGTA 2PIIA 5KFDA 3GR0A 4O0NA 3N28A 3MR7A 2HQIA 2CNOB 3W9IA 3OUYA 3W3SA 1S6QA 2XGPA 1MU2B 1UW9A 5F41A 1UEVA 2BE2A 4KBIA 4NRTA 2FVSA 4HEA9 4HDGA 5B09A 1VQPS 3HSZA 1RT7B 1WC0A 3IWLA 2LQ5A 3SV4A 1TMJA 2EI5A 2N7YA 2NLWA 2XG8A 4O4GB 3PKYA 3CNQP 3V6HA 1RT3A 1WORA 5AJ3F 3GV5B 2MSTA 4NYPA 4J9OA 4DFMA 3GMGA 2C3MA 1S99A 3BH7B 3B54A 1U6ZA 3ILIA 3POTA 3ZTOA 1SIWB 3NY0A 4GC7A 1X60A 2AGPA 1LV5A 8ATCB 4USWA 4X66J 4DDFA 1H98A 5J2QA 2XMJA 3GZ7A 4ZITA 1WG4A 1UEKA 4CLTA 1ROFA 5AE3A 4PQUA 2HFZA 2DHHA 1SUQB 2PFDA 5KG7A 3HSGA 4ZP9A 5F8LA 3SV3A 4TU9A 1IR1A 4IRCA 4NRUA 3KLEB 3BGLA 2FC8A 2NYHA 3QBCA 3MR6A 2I5JA 3R8YA 1LFPA 1OSCA 5C2GA 5F0UA 3BGOP 2E9RX 1AFIA 1TVRA 3OVAA 4O4GA 1M5OC 1FWLA 1RZMA 2WVEA 4URGA 2QA1A 5DDQC 1DAXA 3BSCA 1NBEB 3VQTA 4OLOA 4TU8A 2JEJA 3O2IA 3TZZA 2D9OA 2DBBA 2LQJA 3PJXA 4J9UE 1GX5A 1RT4B 2FJDB 3M1VA 2X51A 5KFWA 1C0UA 1P1TA 1KP6A 1SQEA 1GAOA 2DXEA 2GJIA 1RAOA 2FTRA 2KN4A 3C6UA 3N6LA 4KE5A 4JB8B 4KC5A 2B9EA 2WB1D 2ZJPQ 3SDEA 4R5PA 2UUCF 3W2WB 4CLWA 5LOQA 2IVYA 2HHHJ 1HQUB 1FEHA 3PYDA 2CJYB 4Y2IA 2UUCJ 2V4JB 2HHQA 2GJ2A 2FJEB 2ROPA 2B56A 4IUFA 3AJ2A 1NRKA 1TV6B 3LP0B 3VZHA 3WIVA 3JAMU 1RTIA 2JC0A 3T5HA 1KFSA 1R27B 2FY8A 2VBXA 2FPHX 3D1HA 5FLXY 2G4BA 2OSQA 3CSKA 3BREA 4ZVPB 1JLEA 5AXLA 2Z4PA 4O44B 4QYZJ 3GIIA 5L9NA 1KWMA 3L09A 4RR5A 3HI9A 5DS7A 1HQ2A 2ZOGA 4D3GA 3KDNA 4HI1A 1VI7A 4RW8A 2J0WA 3L9ZA 3RG6A 1RAFB 3UQSA 1XN9A 5DQGA 1UKUA 2XZDB 1HHTP 2ILZA 4KPCA 1BQNA 3ZO7A 3ZNUA 1XNQF 3NS6A 4WFNQ 5HANA 4LSLB 2H5EA 4F3QA 3KLHB 4O3PA 3DCAA 4ZHRB 1VRTA 4WWSA 2HQCA 4DR2F 2XMWA 2VHGA 3GFZA 2XY5A 4PR6A 2KRRA 1WI8A 1GXUA 1UAWA 1UTAA 2DY9A 4K7QA 3PEHA 4WXWA 5AT1B 4DR1F 1IM4A 1UFWA 2Z30B 5KG6A 2PMWA 3SSQA 2ROGA 2D3UA 3DLBA 3GFYA 1H2UX 4C3LA 2Q79A 2A2CA 3BS9A 2ASYA 5KFKA 3PVXA 2GMHA 1NJIT 2F9JA 4ECYA 2G2YA 1BQMA 4OI1A 3W2VA 4LF8F 4DR3J 1TL1A 4UZCA 1U24A 3M9OB 2KXHA 3R5CA 2ZBCA 5ETVA 2FLPA 1D09B 1FF2A 3NWGA 5I4MA 5IZHA 4PPZA 3CCES 4KSEB 1Q95G 3DM2B 2VASA 4DUYJ 1PYSB 3KK2B 4TY9A 4Q8FA 2BW2A 1BQNB 2HHVA 2N82B 1B0VA 3IGNA 3MTJA 2P6SA 3M2VB 4O3QA 2CADA 3BSAA 4QIFA 3HKZD 5IFMA 4DV2J 3PW0A 2MLXA 4NLRA 5I42A 1M0SA 1QAJA 1FT8A 2ZH6A 4DU7A 4E8UA 1EIYB 3AOAA 3GE9A 1WD6A 1GX6A 3VZIA 3TUZC 5GADI 2FD2A 5FD1A 3PFOA 2DHGA 1DTQA 3R9LA 2KHDA 3CGIA 1OJ4A 3PW4A 3DRPB 1JNRB 1FFSB 4M5LA 4WYWA 2VIHA 2VICA 2MLYA 4DSEA 3SSSA 2AJQA 1DRZA 2F7VA 3G8SA 4USTA 3QGHA 2QG9B 3CPWR 3GTYX 4YP3A 1MWQA 1TUWA 2IJFA 3QGIA 2XLIA 4F4ZA 1KS2A 3AQPA 3KJFB 4OJ1A 1T95A 3L4BC 4F7VA 1UA0A 2E5LF 2UUBJ 3PACA 3OTCA 1AFJA 2IA0A 4LBHA 1OIAA 4USIA 1IQTA 1HW8A 2KG1A 2G2ZA 2VC1A 4PG8A 4DV4J 5LMUJ 3FZ2A 2H4WB 2MZRA 4OX6A 3KFWX 2FZKB 4G1QA 4AXIA 2CQCA 2VG6B 1FESA 3MM8B 1BUXA 4QOTA 3QWPA 4P9SA 3QT5A 3CDWA 3ETMA 1Q82T 2XZTB 2QA2A 3LGNA 1N4LA 3MMBB 5ETKA 4ZDNA 5IC4B 4ALZA 1S1TA 2QC3A 3OXLA 4ICLB 3TA1A 2C2DA 2HG4A 3KJQB 5HJYA 3H5YA 2DNRA 3BQ0A 3HZGA 2HFUA 3AD8C 3T6BA 3BGRB 3ZZYA 3H98A 2IRUA 3L7UA 3GIKA 3KYLA 2V4RA 4HI2A 4NX9A 2DNNA 1X9SA 2DH9A 3M32B 1WSVA 2RH3A 2V68A 2HNDA 4B3RF 4V1Ak 3IWXA 1Y5IB 3QSIA 2QLWA 2XLJA 5IM0A 2EFPA 3KLVA 1CC8A 3M2UA 1KTVA 1U6FA 1KLNA 1HIYA 2AKWB 3CCUS 4LFCF 2R7OA 4I2QB 2NPFA 2O1PA 3W66A 2KT3A 3PV8A 1RTJB 2UVWA 2NPIA 4EO6A 3KUGA 1QTMA 3DRXA 2VFRA 3EWGA 3T1YJ 2CJBA 3O44A 1QAIA 1RGVA 5B0CA 1RWVB 1ZTTA 1WC3A 2VV5A 2NXUA 3I4HX 1R0AA 2QGFB 4QPTA 4X62J 1PAUB 3MM7B 3R5BA 3H42A 4MYUA 3BQ2A 4DUZF 2UU9F 1C1BB 4J9PA 4J9SA 3DXBA 2ZZTA 3CWJA 3EGWB 2RQCA 2GVDA 2PMHA 3CJ2A 5F8MA 2DGXA 2ZNZA 5KT2A 1V3SA 4M5KA 4CH0S 2MY8A 2BOPA 2HBYB 3CJ5A 3TANA 1M5KC 2BACA 5D15A 3DU6A 4CP5A 3FNNA 5B08A 3R2DJ 4HH0A 1H38A 1W25A 3TAPA 3SSRA 4ECXA 2FVPA 1WEYA 2DXFA 4DV4F 5GVQA 3CD7A 2FLOA 4H54A 5B0DA 3QPIA 4ECUA 2I2YA 2D3ZA 4G1IA 4DCOB 4KTQA 1R7IA 2E1MC 4LQ9A 2V0NA 2WOMA 5KFIA 2V2QA 3ULHA 4DF4A 2HVDA 4W98A 1NK7A 4XTTA 2NREA 1FKAF 3K5PA 3IC1A 3SCLE 4K4ZA 5A76A 4FBTA 2QX0A 3H90A 3TEGA 3GILA 4K4TA 5IWAJ 3A8EA 2QV6A 2J9CA 1PBAA 4N8NA 2C2OB 2VFSA 2H48B 3E2EA 2KFZA 2R7VA 3J7ZT 2FB0A 1AYEA 2KJVA 1W2IA 4DMZA 3PX4A 1PSDA 3TO8A 4KFBA 3FSXA 4WFZA 3QNWB 2M7SA 1UVJA 2DHXA 1HNZJ 1SJQA 3IG1A 4ZCLA 1YI2S 2DGWA 5IM0B 4HLBA 1HNZF 1D9AA 4B3OA 1RDRA 2HQFA 2OO4A 4ZVFA 2J9DE 3IP0A 3EGVA 4J9NA 3S1TA 5K8PA 4UUXA 3GYXB 1JKHA 2B4PA 3GPAA 1ZH5A 4JV5F 4L75A 3CCWA 1TKTA 4KKOA 4XPEA 3NNAA 4CO5A 2AX1A 3D6TB 3V6DB 2HFOA 3FGVA 2E44A 2KVQE 3D6FB 3D68A 3I0RA 5CQGA 4O3OA 2K7JA 4F4XA 5LSRA 3T19A 1IKVA 2OHDA 4WZMA 2VPZB 1JLGA 4DCJB 1TL3A 3P4UB 4H4KA 3DDKA 4MIWA 1T9WA 2BE2B 5I3PA 4YS2A 5JUMA 2IVFB 4X65J 2VG6A 3MM8A 1UVMA 2HIQA 2YNFB 2QE5A 1WOPA 3H5SA 1FX4A 4B3SF 3GCWP 3OT9A 5L1LA 1T03A 4EZ6A 2EKYA 1Q16B 2MY7A 2NR0A 2ZBQA 2BJ7A 1SKWA 1CJVB 2V9KA 4HTJA 4EUVA 3PW5A 2DPIA 3KXDA 2BOAA 1T8EA 2DRAA 3G6XA 1YRTA 2ZHBA 4A8YA 2CQPA 1DTTA 2VQFJ 1N5QA 5KFTA 3JSMA 2IDLA 2WSCC 1Q81T 5KT4A 4TYAA 1Q7LB 3D66A 1R0BG 3FBCA 4WE1B 5IQ6A 5L1KA 2IRXA 3EXCX 4MK8A 1TZ0A 2W2NP 3CE8A 4OHVA 5DETA 2HLUA 1O6XA 1RBAA 2B7CB 1IBCB 1SCJB 3TA2A 1GFWB 2YX4A 3MEEA 4CM2A 2XCAA 2BQ3A 1HD1A 2RMLA 1OY9A 4ZJOA 3R7NB 3HZEA 1NUEA 1S5ZA 3TEHB 2AX0A 1IKWA 4LBIA 4IG3B 5ETTA 3HT3A 2RQMA 3DRYA 3RTVA 2I0XA 3P3DA 1DQ9A 3KHLA 2N4DA 1K73T 3J80U 4DL5A 4J9KA 5DLGA 3Q8SB 1T05A 2EXUA 2GO9A 2KJWA 3Q89A 2M5YA 4YDXA 4KQZA 3TJ8A 1SC3B 3X3UA 3PW7A 1AUDA 4CO3A 3LAMA 2HBZB 2UV8G 3W60A 5A8KB 2F5GA 4JV1A 3ZZUA 5L1IA 2YWEA 3AD7C 3TAMA 2ZZMA 1LKZA 2NXEA 4DR5F 4F4YA 2KZMA 3H7HB 2APOA 2OAUA 2OSRA 3ZTRA 1RHUB 3GCXP 1V3ZA 4DR5J 2MB0B 1HL6A 4PUOA 2MKIA 1K1QA 3Q8VA 5GAEU 1CLFA 4FS1A 4KYZA 1UVLA 3N6NA 5ADZA 2DB1A 2WBMA 1FRIA 3HVAA 1SKRA 2G13A 2GIFA 3BN7A 5HAOA 3LUYA 4CNYA 2D3O1 5HQ8A 2QLBB 3OTBA 3RAXA 1KLMA 2QLJB 3N5FA 3D5MA 4XPCA 2GMJA 4DQIA 2AWZA 1UMJA 1WC4A 2JVOA 1U47A 2KL8A 4QWAA 3DDNA 2XY7A 1FRHA 2G2OA 1S97A 3SZ2A 3BR9A 1TL4A 1P9QC 1AZSB 4UOCA 2ATCB 4K0KJ 5JVHQ 2VKRA 5D77A 2DNMA 1SL0A 1QM9A 1ZPVA 4CYUA 3FFIA 4LJMA 2R9LA 1AROP 5EWEA 4OZ2A 2F8HA 3HHDA 3D6HB 5LXRA 1RTIB 1MROA 5KT5A 4YFUA 3J80Y 4KGXB 1RLDA 4TKTA 1GK8A 4CO2A 1D0EA 1XWLA 3PYEA 3UFCX 5A6WA 5IT9U 1FTRA 1W7WA 4B9UA 2KU7A 4YDDB 4X4PA 2XM3A 4DV5J 1NNDA 3OLBA 4JV0A 3SFUA 1RK8A 4ZPTR 2YQ0A 3Q8PB 2MZQA 4MKBA 1BWEA 3EGNA 2R8KA 3A8IA 1OYEA 5D6GA 2DJWA 3QGPA 2JLEA 4EK2A 4HTIA 4O3RA 4C4WA 2R4FA 5KFHA 1TL3B 2V5HG 4ECZA 1Y3JA 5F9LA 4NL5A 1S4FA 1RTDB 3HX9A 4AT1B 4QWCA 1DQAA 2QLXA 2BJ1A 2WAQD 4I2PB 4IO9Q 4HKQA 2BJDA 2BBEA 2MGZA 3BB5A 1VQLS 3H0PA 4N77A 4JI7F 5T14A 1PIEA 2LECA 1UETA 3FRYA 3VVTA 4PG7A 4IFVA 4ZMMA 2U2FA 4Y2AA 4N5SA 1UCNA 1IBLJ 2HK2A 1BD6A 1JLFB 1Q8IA 3FKBA 4ZCKA 1RWPB 5HJXA 3LA0A 1WHWA 2RHQB 3HHLB 3EX7B 4CCHA 1K44A 2IDEA 2AU0A 1Y5NB 1N88A 2EVZA 1Y0HA 2WW8A 3IR6B 4A8FA 3WC0A 3BGUA 3Q23A 2LCWA 3CJTA 1WF2A 3HCXA 4USUA 4DOZA 4DX5A 5KFFA 5ETNA 1PILA 4LF7F 3TUJC 3EPGA 1YRUA 2VONA 3C14B 1GT8A 5DM6Q 3G96A 4DSFA 1HARA 2CZ9A 2DNYA 1RT3B 3HFVA 3AJDA 3I9ZA 4OYXA 3Q86A 2IM0A 3O8WA 1RHJB 4LF2A 5CZXA 1RHKB 2OPQB 4NZ6A 1U09A 2XYGB 3G87A 2RU9A 2DR6A 3GYGA 2ZHOA 3NCPA 4L3KA 1PCAA 4NASA 2ZWPA 1G4CA 3IAM9 4IFVB 1JNZB 5HP1B 4GO5X 4DFPA 1MN9A 3FEYB 1RWXB 3OSNA 3KLFA 2CJAA 5HLFA 4PG5A 2CFXA 2IMOA 1ZETA 3CD6S 2XO7A 3Q8UA 4F50A 5C42B 2CA9A 2A18A 5A0YB 4JI6J 2QYCA 4H4MB 2DGSA 3KK1A 1RQ0A 2JOQA 3CUNA 4QU6A 1HWJA 2V69A 4ZPVR 3DDIA 2BW7A 5B0GA 5DG9A 3MHYA 2E1CA 4DQRA 2C2RA 2DCUB 1G6BA 2HWIA 1KDNA 1R8CA 2OGUA 2XHWA 3R3TA 3W61A 2WHOA 4YUDA 1NDLA 3IXQA 4TLRA 4RNMA 4ECRA 1XJWB 1T02A 1Y7PA 4F0KA 4KGKA 2ZH7A 1SKUB 4OMFG 3M30B 4TY8B 4RPFA 2WONA 3HHEA 3ISZA 3M1VB 2VQEF 3UD4P 3B82A 5E7OB 3G9CA 1U8SA 1G7CB 3GR1A 4X4RA 1UJ4A 3CULA 5IT0A 3UR0A 3MM5B 5J2PB 4PWWA 1Z4UA 3MAQA 2LXFA 3EZOA 2VG5A 1QAYA 2ZD1B 1SBRA 3OQ2A 2FHOB 2VF3A 4TQSA 1V9OA 2P6TA 4A8XA 4GO7X 3OHBA 1AZSA 3PY8A 3KMSA 2V8DA 2XMTA 6FDRA 3W1YC 2H65B 4HHJA 2BM0A 1EKSA 3DYAB 3FQLA 3KK3B 4ELTA 1NHVA 3DRSA 1WNEA 4I67A 2HHTA 4BBYA 1RADB 2HNYB 1SJ3P 4MFBB 3EMTA 1WC6A 4YHHJ 5DLFA 3R5GA 5E33A 5KG3A 4PKDB 3CCTA 2UUWA 3PHEA 3BO4A 2M9KA 3IS9A 1X4FA 1NPPA 2KYXA 1AW0A 2W4DA 3I31A 4I56A 4DR6F 4QQBA 2VFVA 4ICLA 1IN0A 2NXNA 3AOCA 3D54A 1B0PA 4DR6J 4NLOA 3FMBA 5T7LA 2OD6A 1F5AA 5KFGA 4J7CA 3RJMB 1UWAA 4BDPA 4X62F 2Y8WA 3HDSA 2LFVA 2H51B 3I9V9 3QRPA 4RBUA 2CQGA 4OHZA 2B43A 2DH7A 1TKZA 2CAJA 2BM1A 1QY7A 5GMEA 5T41A 1QJHA 2ZITA 1TR0A 1E6VB 2B4OA 1X9WA 1HBMA 2V9WA 4DI6A 2VG5B 1EB0A 4IG3A 2V8HA 1WWHA 3E3XA 3ELHA 3JAMY 3NCRA 4RWWA 1YJUA 2CKWA 5K9FA 1XTZA 4LR9A 5RUBA 3H40A 3C3LA 2UVUA 4K4SA 1U2RA 1CULA 3LAKA 3NGUA 3MMJA 2WONB 3C66A 4NEZA 1SJ1A 1MMDA 1YX2A 3CDBA 4C97A 2R2RA 1RHMB 2HK3A 4C8LA 2VQEJ 4M5DB 3TX8A 5SUHA 4L73A 1I94J 3NS7B 2UVRA 4UOHA 1EP4B 5IT9Y 2CPFA 1T11A 1VGYA 2GQCA 1HHSA 1NCLA 2IIHA 2QSWA 2WVCA 2X1GA 3A12A 5MLCV 2IA6A 4FYYB 3QZ7A 4ID5A 1QLNA 2GHPA 4KR0B 2XC9A 1VK8A 2YKAA 3SQOP 1O5JA 1TUVA 1YSJA 3ENAA 3ILJA 4L76A 5C42A 5J2NA 4IR1A 4LF4F 2UXCF 3X1LB 1F9EB 1TKZB 4ATNA 4DN9A 4ZIWA 3U1LA 1QVGR 1WG1A 1GNKA 3W62A 3AJ1A 4ES1A 4EWTA 4IG0A 1VQMS 1PGZA 2MTLA 5HP1A 3M7VA 2DD8S 2DR8A 1BQMB 3W2VB 3G6ES 4J9MA 1K0VA 3PO4A 2DK2A 4USJC 4YR3A 1REVA 3OXGA 5FJ4A 1R8HA 4LIWA 5IC6B 4F8RA 4IRKA 2H3EB 1N5VA 1U0HA 2PGCA 3D0HE 1FWPA 1SV5A 3I0RB 3SCIE 4ER8A 4HDHA 4IH6A 3UCGA 1XK8A 3KMQA 4DEZA 4F36A 3T9NA 2VA3A 1FDBA 2AT1B 2W4CA 3VHQA 4JI3J 3DGPB 4ECSA 1JKHB 2HHPA 1PC4A 4F04B 5C25B 4MMOA 4OX7A 5LT5A 3PR4A 3BO2A 2L9DA 9ATCB 3PO5A 1PO6A 2PT0A 5CYQB 2W7PA 3CJRA 5HVHA 2X3GA 3KNGA 4WP8A 2F8MA 2P5VA 3GIMA 1T3NA 2LKZA 3E51A 3ZTQA 3IG1B 3D28A 4DUZJ 2FZGB 3G8TA 1MWYA 1TELA 1IBKJ 3VR1A 1GMVA 3EE3A 4B3SJ 1S12A 2F63A 1YK9A 4FF1A 2UXBF 1JLAB 3NGSA 1FDNA 4OZNA 2OFHX 3SCJE 4ZLLA 1S0NA 4DQQA 1RTDA 4LRAA 3R97A 3GV7B 4PG6A 4D3HA 4DX8H 3DI6B 5A8RB 2DR9A 1WF0A 1HBUB 3R27A 3UDLA 1G2EA 2A6MA 4X66F 4X2BA 4QW8A 2JFDA 3M9MB 3WBZA 2NUUG 4DR4F 3U1MA 3EUNA 3D1OA 5H9EK 3SDEB 3M4XA 4DR1J 2KB2A 2M2BA 5D0HA 2PDAA 5EN1A 3I87A 1RKJA 1TK5A 2I6WA 3D0IE 1V3RA 3DGVA 1LW2B 3U02A 4OI0A 1PYOB 2ABYA 4ZVHA 1HBUA 3HF5A 3QWUA 4Y65A 5D4OA 3MR3A 4DV3J 1NB7A 4Y2MA 2WVDA 2RIJA 4TLQA 2IM1A 1Q78A 2H54B 2Z2LA 3BH6B 5KFVA 1TVRB 4DV3F 2HBRB 5DO2A 5L46A 2OI2A 5BR8J 5HLFB 1VISA 3H25A 1Q7YT 5CYMA 2KXFA 3TRGA 2L48A 3QRRA 3IRXB 4ZP7A 1NDPA 2B0GA 5HK4A 4NLTA 2CZVC 4AQYJ 3C46A 1S7IA 4ZLNA 1NSPA 5DJBA 4EGLA 1S0OA 1FDAA 2CQ0A 4CLYA 1VCTA 3K5NA 4J9LA 4AQYF 3HP6A 3G8QA 3QIPB 4KAIA 1UPPA 1FVSA 3GSDA 3M05A 2HNZB 4WK3A 5KFRA 2AGQA 2JH3A 3DRRA 3N9UC 1EX8A 3OXFA 1SPBP 1KLMB 2DO0A 4OZJA 3MEGB 4DL2A 2E1PA 4FYXB 3WC2A 3G86A 4MIAA 4JI3F 5THWA 2B3TB 4K4UA 4ECTA 5KFMA 2KHCA 1LWXA 4DV1F 1NJYA 3LQVA 3J81j 4DV7F 3PZPA 2D1CA 1LK7A 5EX3A 3MAAA 1Q0NA 1RB0A 4IFYB 2ZDPA 5D3GA 1U6BA 2IAJA 3TAMB 1J5OB 3N0VA 2DEIA 4J37A 4ED8A 3HVTB 1HNIA 1JJ2R 3GU0A 3LTOA 4ZP6A 3UI3A 1RA7A 1RKIA 1W26A 5HMYA 4K0KF 5SZTA 3NNHA 2XI2A 4I2PA 4C0BA 3P49B 4QR0A 1OQ3A 4LSNA 4DN0A 1SJRA 1VC6A 4EEYA 1IXKA 3S7RA 1FE0A 3UWTA 2EBEA 1F3FA 3P5TL 3R5DA 4FPIA 2DITA 2F4FA 4RU9A 1NO8A 2JC1A 2KKHA 3QO9B 2P8IA 2UP1A 3ISND 1CBKA 5F8HA 3K0JA 2JFKA 3IAS9 1C4CA 2DH8A 3MF5A 2BE7D 1P27B 1N6QB 4G3IA 4CLPA 2HVZA 3RAQA 3PX0A 4G1PA 3QJLA 1JXLA 1VQ9S 2RDDA 5E2QA 1S6UA 6AT1B 3EJMA 2Y0BB 5KFLA 2YNIA 3EVOA 2MQPA 3VAHA 3BR8A 3R7SB 2Y1JA 4GVBB 1I6JA 1F6TA 2BJ9A 5KT6A 2FJVA 1CC7A 3P6YC 4GC6A 4O4RA 3J7YI 3JQMA 3HJFA 4EBEA 5KFNA 1YJNS 4UF4A 3NNCA 3NMAA 2FY1A 1SQFA 2MHEA 2K06A 5IQQA 1CPZA 5KTQA 4FVMA 3TZWA 1N5SA 2R8HA 1TK0A 2ZH4A 5A2QY 4PABA 1XNRJ 1SC1B 1GMUA 1RCXB 3HSDA 3DHWC 1QSYA 1KHVA 3KUEA 3KUHA 5AXKA 2CJXB 1S9GA 4ANCA 2HGNA 2FVRA 3UN2A 1FHTA 4MKYA 4YR2A 4A8SA 2NXCA 3CJKA 2F4VF 1ACMB 7FDRA 1TL1B 4C8MA 3QSYB 4N41A 3VVUA 3QLHA 4TU7A 2OMLA 5DDPC 2UUBF 4RBTA 4CLFA 2OPSB 2XWYA 2B5JB 1N0UA 2HVHA 1UJ6A 3UE2A 3BM7A 2YH1A 5EWGA 1M1KT 4HYKA 2Z0GA 2V94A 2FZCB 2XWXA 1T9TA 3PKMA 2WSEC 2F1FA 2DO4A 2DIUA 2EG2A 5LJ5Y 1X9MA 3HLUA 2OP5A 4UT4A 3KLHA 2A1BA 4LQ3A 3OTOF 2VBYA 1IJEB 2GNKA 3A3OB 3NGRA 3DOKB 2E9ZA 1TTHB 3AXMA 3CMQA 4RUBA 3N79A 5IWAF 1APSA 2Z56B 4JI6F 3GJTB 4Q8EA 4X84A 1J27A 3MPYA 4TQRA 2ZUAA 3M9NB 2OJ3A 1FVQA 2IC3B 3IFEA 2CWKA 4O23A 3UD3P 3V81A 4CRJA 2FLLA 1H7WA 1BQXA 2X1AA 2VODA 1K8AT 4LT6A 1RHQB 4F0HA 1KD1T 3FRZA 1NJWA 2VU5A 2Y8YA 2ZBPA 3M30A 2CXEA 4TY8A 2HWTA 4N47A 1YTYA 4B17A 3T1HJ 4PG4A 3GIJA 1N6QA 4WE1A 2QA4S 3AXKA 1HWKA 2GW8A 2K1RA 2YX1A 3G82B 4FPRA 4FKXA 4XDDA 3UDVA 3V4IA 1U49A 1FNXH 4WFYA 3FCWA 1VFJA 2RUSA 4LF9J 4NLWA 5G0RB 1B7FA 1HWIA 1M5HA 2YWKA 1LXJA 2BX6A 3ONQA 4P2MA 1XC9A 1I51B 4H4MA 3KK1B 2RD5C 3R1HA 2KM8C 4K5SA 4DS4A 2DHSA 5LJ3Y 3OL7A 3TUIC 3TARA 3CC7S 3Q22A 4WF9Q 3GJRB 3OPKA 2GJFA 1WACA 4QJVA 3ZC4A 2ZOMA 5F0WA 3W65A 4Z2XA 3KLFB 4B9TA 4ZCMA 2XS7A 1ICEB 1XNRF 3D67A 2K7KA 1K9MT 4K4YA 1RT5A 2MLZA 3F41A 3FUYA 4FZVA 4NI2B 4X65F 1IBLF 1WJ9A 2M88A 2OD4A 6FD1A 5F3ZA 2QMUB 1ZZNA 1S0MA 2C1EB 3JYTA 1FO1A 1QD1A 1XEZA 1U1KA 3TAQA 4PXDA 3LALA 4DXLA 1S6PA 3CMAS 5D4NA 2LMIA 1YBAA 2ERRA 1NH7A 1QE1B 3C6TB 5JVGQ 4HHHA 1MNEA 2CNLB 3V6DA 2R7SA 4LF7J 4KKOB 1TKTB 4NPOA 1N33F 3MPUB 5ETLA 1SUQA 4DSIA 2J6UA 1FDDA 2AP6A 4QYRA 4CWBA 2Q6CA 4PQUB 2F40A 1AA1B 3ET6B 3MD1A 2OMOA 2P9GA 1FFGB 2FYXA 1NPKA 4OYZA 2RB7A 3MTKA 3IMQJ 1OS5A 4UTGA 5CYMB 4C8YA 1BGXT 4P7VA 4WBFA 2E5HA 1WKKA 2OEMA 1FK9B 3K5MA 4HT7A 4TXSA 1Q86T 1YBTA 1VIXA 4JI1F 2NCKL 4MH8A 4LFAJ 5BR8F 2HHSA 1U25A 1YKWA 3VAGA 1WTBA 1KVKA 4X4QA 2NUHA 3QYYA 4G1QB 1FX2A 1S6QB 4LSZB 2W9CB 1NPRA 4NLGA 2BJ3A 4O3NA 1L3KA 1S48A 3BKUA 4ZA1A 3ZZPA 2PE8A 3QAUA 4GKJJ 2W01A 4LVNP 2CQBA 1D8ZA 1KHWA 4RW7A 3I5AA 4DJBA 4NWBA 1YVFA 2PMZD 2W7AA 3DOMA 3VQSA 5CD4H 2J8SA 2W8LA 4K4XA 1RTHA 3UPFA 4I68A 2W8KA 4U7UD 2B9XA 1MROB 1N32J 3GJSB 2KXNB 1N34F 1FK9A 3KNAA 1TMMA 1S57A 3FFIB 4NZ0A 2R7UA 4J9RA 4RW6A 4OYMA 2V50A 1HKAA 1I3OB 4NCGB 4QIGA 4WK1A 3W9JA 3HULA 5KFZA 4OLPA 4B9SA 1S9EB 1S72S 3Q8RB 1LWFA 1C1BA 2BUNA 1N0VC 1B99A 2AZ1A 1N54B 2JZ5A 4MK7A 1Q1KA 4URSA 1S6OA 3CIZA 5K14A 4F4WA 4B3TF 1QVFR 1NK0A 1E6YB 1K47A 5E3RA 2Z57B 1SC6A 5I3QA 1KQSR 4QWEA 2MQNA 1URNA 2BV3A 4B9NA 5L9XA 3CDAA 3FBFA 4FF3A 3MEKA 4OX9J 1HYSB 1N33J 3NP5A 4U8VA 4PYAA 1F5BA 1BXNA 3MZIA 3FVYA 2XMKA 2HMIB 4M8LA 1QE1A 3C6TA 4ED6A 4F3OA 5KFCA 2C3UA 2HNZA 5EDWA 2FJWA 3PX6A 4F02A 4RU2A 5J1EB 1NXIA 3TI0A 1NK4A 2GHWA 1SB6A 1WELA 3ISNC 1SQGA 2UVVA 4QBUA 3B6BA 3BDEA 1FRLA 3LGHA 4WKYA 4KHMA 4F4AA 1IBKF 2WRMA 2ATLA 3DOLA 3W8GA 2HQGA 2JRSA 5JJBA 4JI8J 2LEAA 1DBDA 1FKPA 5HBMB 2G0IA 4OYPA 1VQYA 4LSLA 2IJRA 5ETQA 2E5JA 3T9ZA 3Q2TC 2Z8QA 4GVLA 5C24B 4ELVA 2WSFC 3NG8A 3U7JA 3QT8A 4Y2KA 3W5ZA 5LSLA 3EICA 2EFNA 1VBXA 2DNQA 5KOXA 4ZPCA 5LSOA 1S1UA 2D3OR 2MKSA 3HHNB 4HR2A 4IKAA 1Q79A 3G6VA 3V6JA 2HZVA 2ZC4A 2M0GB 4M5DA 5E3CA 1YDLA 4DZ6A 3W63A 4DUTA 1JIHA 4PWUA 2KH9A 2W25A 3IRWP 3IO1A 2KYZA 5EWFA 1TKXA 3GONA 3MM9B 4M94A 3N5BA 3M8ZA 4W92B 2Y0SD 4ECQA 1ZAVA 1VIOA 1X4BA 2IC3A 3ENWA 4Y2CA 2XLKA 4IOAQ 1RWUA 3QATA 1TL7A 1DTQB 3CT9A 3JQJA 4PCQA 3I5BA 4HVZA 3VGTA 3OJSA 1J5EJ 4PWDB 1FFWB 3PTWA 1M1GA 1ITPA 2VA2A 5D8HB 4NMXA 1RAGB 1YJVA 2E7VA 4NA3A 2RUGA 4XDCA 5D4LA 4X4TA 4L6V3 2XO6A 2WTFA 3L3CA 2FUG9 2VL1A 4NZ7A 1S1XB 4UZBA 4F0MA 3C19A 3PEJA 5J2MB 4QCLA 4ES3A 2HHUA 3KK2A 3M8SA 4OX9F 3HPOA 2BRKA 3MCMA 9RUBA 3RRHA 4DZDA 4N56A 2KM8B 3QJJA 1JLQB 4N76A 2J7UA 2UUAF 4UOGA 1CS4A 3EVMA 2IVMA 4NLUA 4P2XA 3EVWA 3CJKB 2J6TA 1XMOJ 2N3LA 2C2MB 2KI2A 2OUGA 4UOFA 3CXCR 4PZVA 2Y1RI 3MCSA 4DSLA 5KG0A 3DLGB 2XS2A 5BJRA 3VAJA 3MUTP 1H73A 4B3OB 2W7OA 1JJCB 3GG1A 2OKQA 2VZ9A 4NA2A 4EBDA 2FHJA 1L3TA 3CCZA 3KJNB 2DCLA 1TFYA 4FYVB 5H9FK 3PM9A 3FC9A 1XNQJ 1Y9OA 4J9QA 3K5LA 2CPJA 1V5IB 3OBIA 5IXUA 4QIWD 2LU2A 3TA0A 2HS0A 2A0FB 1EJ7L 1PYTA 2PO4A 3MM5A 5J2PA 4FS2A 2EFGA 4YY3F 3WX4A 1FRJA 1CJTA 1RT1B 3QGGA 1X7VA 2E66A 3PHTA 2BMBA 2COLA 4RKUC 5BYQA 4PRFA 3QFHA 2PI4A 1VR6A 3FZBA 2DEJA 2WB4A 5HMXA 5D78A 2YKQA 3PYGA 2GS8A 1H2TZ 4KH1B 4RW9B 1PBUA 4C11A 5J1NA 3D9BA 2AZ3A 2MHNA 4LRFA 4OI4A 5U47A 2V2VA 3B8HA 2HBQB 4FXVA 3T5KA 1RYRA 1XQIA 3JS9A 1HA1A 3D3CJ 4M5GA 4WYLA 2LP4A 4QWBA 1DLOB 3UNYA 4R5PB 4Q43A 2R8GA 1TQLA 2WBRA 5DRKA 3THPA 1T03B 4NYZA 1S9FA 4AXJA 5EHHA 3ZZOA 1RU2A 1L3VA 1F0XA 1X5OA 2UUTA 3T5JA 2OH2A 5K20B 4IRDA 3T41A 4NXMJ 3R7BB 4HHUA 4A8QA 1RISA 3H59A 2ASJA 3OFEA 5DQIA 3EM1A 1OSDA 4JI1J 2RHSB 2QLFB 2XGQA 4DQSA 4KRWA 2XNRA 1RAJA 2CUYA 1F9FA 2Q1LA 3AAWB 3C14A 1NHKL 3IBWA 4GRSA 1Y10A 4JI0F 4DR4J 3BYPA 2RRAA 4P73A 2ZE2A 4FVCA 2QA4G 4I4BA 3GWCA 4CIOA 3ZTPA 3D0GE 2QN6B 2MDAA 4BS2A 5KFJA 4ZOSA 3BPDA 2YKMB 2YKMA 4ILRA 4CLLA 1GTHA 2RQ4A 2R7TA 4DWIA 3US5A 2RJZA 4K59A 4FNIA 1MLAA 3MGJA 2L41A 3OR1B 5LMUF 4EO8A 1F60B 1XMQJ 2G0JA 4KFBB 5GADU 1R8BA 4CTAB 3AH6A 2YX7A 3OFGA 2MGZB 1Q4RA 1H7XA 1NU4A 2DHAA 2EFQA 1N34J 3NXZA 4X64J 3F44A 4GKKJ 4QYZK 4YY3J 2MKCA 3UW1A 2YNGA 2GVZB 1U2CA 3MMAB 3I6PA 2CPDA 3DU5A 1MU2A 2LYVA 1FKOB 4A8OA 2XB2D 1WTFA 1NLKL 3BF4A 3DMJB 3MECA 3J7Z5 2EG1A 1U7LA 3GFHA 3K8WA 2CDQA 4LRCA 2ALZA 2LQ8A 4YB7A 3JSYA 2QFJA 1TL7B 2ZUGA 1RUSA 3LF0A 3AFGA 3L7OA 4NLXA 4LF9F 1PJ7A 4P2FA 5LXYA 3RRGA 3MXHP 2GV1A 2CQDA 3MR5A 3OSPA 2VFTA 3ITHA 2K1RB 1RABB 2H4YB 1JXVA 3DHXA 4ANEA 1VQ8S 1LQ9A 4QU7A 5HSPA 1B70B 2G0CA 4BC9A 4ZPWR 2ZZNA 2RQKA 4H4OB 2ACYA 1SH3A 1YZ7A 2QL7B 3MPVA 4IOCQ 4ED5A 1UL3A 3N6MA 2DKOB 1ZTWA 3SMZA 4P52A 1CEZA 1FRXA 5KFSA 3ILOA 1NJXA 4QR1A 2AHOB 4ECWA 2MJNA 5KFBA 2DRBA 2MPUA 4YB5A 4DG1B 3CW2C 3M8YA 2MZJA 3OVBA 1LWCA 3KLGB 2GQQA 2A6OA 4CT8A 2DISA 1N52B 2HZAA 2J8AA 3DM2A 3DXSX 3M6VA 3UDEA 1A9NB 3BPSP 4OI2A 4QZVB 2P9CA 4CLUA 3IM9A 3NEKA 5F3TA 3SFGA 4ECVA 1RAIB 2F8EX 3M2UB 1VQ4S 3SIPB 2CPHA 2ZOFA 2QJ3A 4KJIA 3JTOA 3OJUA 2W2MP 1D9FA 2HAIA 3KG1A 2JLFA 1IKYB 1IKYA 3MM6B 3UN5A 3KLIB 3OV7A 1RWWB 3OFHA 1SIZA 4MT1A 2AYBA 4KHPJ 2NSCA 4RUHA 5G4DA 4F4KA 1J5EF 2J7WA 4A4JA 1ZM9A 2MKKA 4FF2A 2HRYA 1ZM2A 1LW0B 1FD8A 1XR7A 1ZAXA 1DQ8A 3ADAC 3KDOA 3O1LA 4IG0B 4DPOA 3RBDA 3CCVS 4IQXA 3IM8A 3M8PA 2R7XA 2BE9B 4KV8B 2UXCJ 2BQRA 4K2XA 3ETOA 4HACB 1FRKA 3CJ4A 4B08A 5F9NA 2MQQA 3SCKE 3KLGA 1D1UA 2DR5A 2EWHA 3LPEA 1S1XA 2B8QA 4WCEQ 3K58A 4K50A 1FJGF 1XR6A 3GLJA 1U8WA 2EPIA 1KQFB 4DG1A 4Z7CA 4LF5J 3GIRA 2CPIA 4EMDA 2X3DA 2V34A 4LR8A 1EP4A 3DLJA 3SI8A 2RAQA 2AJFE 4GKJF 4KHPF 3H2VE 2DNGA 5E3PA 2GGPB 2NZ4A 2B7BB 3WHIA 1S10A 5KFQA 1IR0A 1HNXF 1FEEA 2AD9A 1SXLA 2WVFA 4ZN3A 2KO1A 1U0SA 3CCLS 1K0TA 3ITHB 1NKBA 1T0TV 4GVBA 2RNEA 4DL6A 1HNXJ 2ZWOA 3JSRA 3K8VA 3N01A 2CQ1A 2R3VA 1HBNA 3MM9A 1R8AA 1U1QA 2XTJP 5H1SV 2W9BA 1CQNA 3MCOA 1T3OA 2IJNA 3EZUA 3FK4A 3K57A 2UXDJ 2ZVIA 2LDIA 4I7FA 4DV7J 1B3TA 3R5AA 5A2QU 2EK6A 2FHKA 2BDPA 1CVJA 2OPPB 3QO9A 1S1UB 2PA8D 3HFKA 4OHXA 3HXMA 3QZ8A 1I1GA 1DY3A 4TNOA 2OFGX 1RWMB 4I69A 3GV8B 3LP1B 2C28A 5HVFA 5A8WA 1WEZA 2DR7A 2IM3A 2C2ZB 3V4MA 4LSNB 2HHXA 4OZ0A 2R8JA 1RAAB 4KO0A 2HGLA 3M8PB 1S0VA 2ZC3A 4DL7A 3MMCB 2PN6A 4NLPA 2I5JB 3AHPA 4I6YA 1OY6A 2CJ9A 2H9ZA 3CD0A 2VJVA 2JX2A 2JWNA 2UZAA 1HNIB 4MKVA 1XIQA 1F5CA 3OR1A 3PR5B 4V19J 2BRLA 1VBKA 2JJ4D 4ZIVA 4ED0A 5J1EA 1Q8KA 3AA9A 4MAKA 2FVQA 1UVNA 1OPIA 2KVIA 3ZFVA 4C0OC 2E9TA 2C42A 5A8KA 3BQ1A 4M63A 5HO4A 1F2GA 1PC5A 1FERA 1S49A 2DNHA 4A46A 8RUCA 2FDNA 1UVIA 4RBVA 1VDHA 2J9DA 1HYSA 2CQHA 4CLKA 4QWDA 2K8GA 1NSAA 1LWCB 3I56S 2CPXA 2J7KA 5KAKA 2EKNA 4RW8B 1MSWD 4UUWA 2C3PA 3MUMP 2AYGA 3IN5A 2Q3PA 4KT0C 1HPZA 1HHQA 3NBPB 4P7TA 3VAMA 3D7SB 1EQMA 1BHNA 3VV2B 3M2RA 2XMVA 4NXMF 4Q45A 2LQ9A 2RS2A 4RW6B 3CTRA 4ZS6A 3W5YA 4MYTA 1U26A 2DIVA 5GAGU 1UWBA 1IBMJ 1R89A 4F67A 1DTTB 3MWBA 4EI2A 4NLYA 3DOMB 4WTOB 1DZ5A 4U96A 4X4SA 4R25A 1HMVB 1XERA 3CEDA 1TAQA 2JDJA 5KG1A 3W2WA 3KHGA 3JTNA 3U1NA 1HBOA 3V4IB 2CPEA 1C1CB 3E8OA 3DMJA 1X4CA 3MECB 3P96A 4WXOA 4DX7A 3LGMA 4Z37A 4QPXA 1RJJA 2XYHB 2N3OA 1NK5A 1HNWF 2YNFA 3PRBA 2RRBA 1HNWJ 3BBFA 3V81B 3ZNJ1 2VPWB 1KONA 1SH2A 5CYJA 3BSNA 5DM7Q 4N8OA 4RNFA 1U1OA 2DRDA 1YZ6A 2XEXA 2V2KA 2XI3A 4NYOA 2RU3A 2R7RA 2ZFHA 1ULRA 2FC9A 3J7YU 4EYIB 4NLQA 1YGYA 2GA7A 2GX8A 3CMES 3OTOJ 3O3LA 1EARA 4C8KA 2R2UA 4O3SA 4OFZA 4I64A 4X4NA 2AJ1A 4DV5F 2UV8A 4UW2A 3TP2A 5FLXU 1VRQC 2VB6A 4ZCIA 3D2WA 1S79A 2CJKA 1A0OB 2KT5A 3DLGA 2VOPA 1R6YA 4LRDA 4CQ1A 3QIDA 4ENOA 1LXNA 2NZCA 3GB0A 2OIHA 1RHRB 4DLEA 3T1HF 3BGFA 4USMA 2IYIA 2Y9HA 1VOMA 1M5SA 3MEDA 3PJ9A 4RNHA 5KFAA 1NH8A 4CI0B 4LMZA 1ZYQA 1JLQA 1SV5B 4DHVA 1S6PB 1ZBTA 1K1SA 4OI6A 2RILA 2ROEA 4P75A 1Z1ZA 2KFNA 5CAAA 2HRTA 2YH0A 4LUBA 2WZ1A 1S77D 3EYZA 3F73A 4JI7J 1YRXA 3W8PA 2NSBA 2CQ3A 2QSFA 4WFBQ 1NMEB 1JJ4A 5HN0A 1T94A 3CJ3A 3AOBA 4ED4A 1N48A 3JTPA 1AT1B 2HLTA 1RTZA 1VJQA 2ACMA 5BYRA 3OUYB 2DNKA 2CWXA 4PPDA 3KHHA 3NGTA 1NK8A 3PXGa 2GFFA 1O0PA 2HIYA 1IBMF 1M1HA 5FIIA 2W2OP 2GO8A 2B6AA 1VQKS 3AA8A 5E41A 3O5TB 4FYDA 1HLWA 4JI2F 1RWNB 2MXYA 2P2CB 1TUGB 2CJQA 1TU0B 4RW9A 5J1PA 2MZ1A 3RB3A 2V6AA 2ZKUA 4KIAA 1RT6B 2D7SA 5I3UB 3HFZB 2C2NA 1P9YA 3D3BJ 2CVEA 3W64A 4OHYA 1KEKA 3MI7X 1XBWA 5AE1A 3TNVA 4QIVA 2GGPA 2HQDA 1NHUA 2ZDOA 5L38A 4RNNA 3T3FA 2IMWP 2BVZA 1SL2A 1CULB 5HI7A 5GAGI 3QMQA 1IVZA 2AYMA 3MM7A 1HR0J 2B9YA 5HMZA 2ZH9A 2MMYA 5J2NB 2PEHA 1GTEA 4LF1A 2QL5B 1OO0B 3RBEA 3T1YF 2ASDA 4LF5F 3DOKA 1ELOA 5ETMA 1C2PA 1FJGJ 4DQPA 4I2QA 3FMWA 2YNHB 4ANDA 1AXQA 3TOQA 5C2CA 4JI0J 2HHWA 3QQCD 1MG7A 2VG7B 4ZJLA 4WFAQ 3UVJB 3WQPA 3NGDA 2W9AA 4B9VA 4BCAA 1H72C 4IYQA 2JEIA 3BKTA 4LRBA 3BSOA 3ICLA 1KVJA 3WX8A 1QSLA 1VQ5S 4E0DA 2HVEA 4NCBA 4ZVUB 3RW7A 2LA6A 4DFKA 2CQ4A 1BE4A 2XY6A 1B64A 3CC2S 1BY9A 5HQMA 1HI1A 3R6LB 2DY1A 2I1RA 4ZHRA 1JLBA 1WHVA 2MZSA 3MOZA 3K17A 3M8QB 4BWMA 1RLCL 1FXLA 1YQHA 2YVSA 4L72B 3TR5A 5J2MA 3U27A 3LP1A 3CD5A 2HRUA 3JB9k 1N56A 3AT1B 3IA0A 4NEYA 2WVBA 1NZAA 4WIIA 4DL4A 3UNGC 2BQUA 3TVYA 5K14B 4A8MP 2A10A 4ELUA 5AE2A 3OL9A 1LK5A 2VBZA 2XSFA 3C15A 1X4EA 2F9DA 1QUVA 1TL5A 4P71A 2LXUA 1JLEB 5E3AA 1BLUA 2HZCA 2BXJA 4RJVA 2ZD1A 4E2FB 3GYNA 2HSEB 1UEUA 1Y4ZB 3OR2A 1UPMB 1ZAWA 2AJ4A 2YQ3A 4ZVTB 4YMEA 1RT6A 2K2PA 2CYYA 2PI5A 3H5XA 2KTQA 1HI8A 2A2DA 4ZLPA 4ZJQA 4OZ5A 3AB4B 5DGBA 2D74B 3FCVA 2GAGC 3L95X 3PFEA 5KG4A 1UVKA 2B6AB 3HK2A 2XBPA 2FQQB 3C2PA 3QRQA 1C4AA 3BV8A 3FBEA 2XS5A 4WZQA 4A48A 2MKHA 3BKFA 1RCOB 4IO1A 1LEOA 3DNCA 3C6UB 4AL5A 2GC8A 1FKOA 3IBFB 5B0EA 2MQOA 3HVRA 3OW2R 2AMCB 3DI6A 1U48A 2VH7A 5KFXA 3R6GB 4R8UB 2AEMA 1MW7A 2GAHC 3QAEA 3DKDA 3TZYA 4OJHA 1J2VA 4CO4A 1X4GA 4O0IA 1NZ8A 2SXLA 4HH1A 1VRUA 3PIOQ 5IV3A 3K59A 4B3MF 2HVIA 4CTAA 4ZK7M 1RT2A 1HQEB 4OI3A 2XMAA 2HYIB 3THVA 3MEDB 4QIEA 1OQ6A 1ZS6A 2VKZG 3MCNA 1B0TA 1WHYA 1FNOA 3DLKA 3CCSS 2IAJB 5EUHA 1J5OA 4WU2A 2MQMA 3MM6A 1VJWA 3ET6A 4CDIA 3I0SB 4L74A 3GP9A 3PRVA 2C2EA 3MD3A 4LFBJ 4Y34A 4NOHA 3KHRA 1NB2A 3CCJS 4BLGA 2RDJA 3K7RA 4Y6IA 4RNOA 2R7WA 4FNHA 2HURA 2YXLA 4B9LA 1D3WA 4KPYA 4USHA 5KFPA 4MJKA 3T1AA 1NSKL 3DLEB 3LWMA 2YKNA 2R2TA 2N4CA 3BO3A 3UCUP 5DG7A 4M95A 1VLOA 1SKSA 4NLDA 1RAHB 2RE1A 4Y0FA 4F25A 1G3OA 1RP5A 5F8IA 2Y1IA 3KKFA 4X4UA 3K2YA 4FXWA 1LWFB 3V5RA 5GMKa 1X8DA 2WOMB 1CJUB 1VK3A 2YKPA 4NCGA 1S1WA 2YPZA 1TFWA 1QAXA 2Y1LB 4W90B 1H74A 1FD2A 3QT6A 1RE1B 7AT1B 3OL6A 2OEJA 2HEKA 2VPYB 3I82A 1HMVA 2M70A 3HD1A 4C6AA 1U1NA 1H6KX 1C0TA 4IDKB 2R8IA 1JMTA 3TVZA 1JWWA 4ZVEA 5G0RA 4I0WA 4KY3A 1UP1A 1X4HA 2UUAJ 2XYPB 5GAHU 2J9EA 3CO9A 3Q8QB 2KG0A 2UXDF 2G9OA 1IJFB 2VBWA 2R42A 3ILLA 4ZPBA 5C7PA 1XMOF 3TUPA 3RUBL 2VDHA 4JP8A 3MMAA 1RT1A 3IR7B 2QL9B 3MPWA 3M2RB 4ZN1A 2JEGA 1PJ6A 3NBPA 4JI8F 4ES2A 3CJ8A 3RB4A 1R0AB 3V2UC 2ZBRA 3PRDA 5DDRC 1NDCA 3UO0A 4Q0BB 2UXBJ 3CCMS 2LXIA 4CYUB 4HT5A 4I6WA 2YWFA 2GMLA 2M8HA 5K5MA 3ZZTA 1RTJA 2I38A 3MURP 3R2CJ 2J76E 2EK1A 2XMMA 4OV6A 2FJAB 2J5AA 1S1VB 3PNIA 1KSPA 4Q44A 3A4TA 1VQSA 4OQJA 4L3NA 1WKJA 1R6VA 2CQIA 2K3IA 3MAHA 3VGVA 3TX0A 1I5OB 3VGSA 4LFBF 2W2PP 2XSJB 1JK9B 1JLBB 3FCHA 3RU0A 8AT1B 4EFAC 1NK6A 2RF2A 2AEFA 3POTB 3QLHB 3MR2A 3BGRA 1N36F 4OYAA 4ZP8A 1EZZB 2FVCA 1YJ7A 2RF2B 3LH2S 5H9EJ 1VQNS 2O67A 2X1BA 3R1LA 4PAAA 3EGZA 2PSZA 4KGZB 5HATA 3JYTB 2RRNA 2C3YA 2U1AA 1REVB 5KG2A 1A7GE 1KQKA 4NI2A 4CLSA 5A8WB 2BJ8A 3PG9A 3TZXA 1LWEB 1FI4A 2XMUA 3B4MA 3NRBA 2ZJRQ 1YWXA 2LA4A 2HGMA 4JBCA 2M8DB 2JSXA 2K3KA 4XO0A 2YNHA 2JL9A 1NDKA 5GAHI 4TYBA 5LL6d 1V6HA 3SBMA 4CH7A 1FXDA 3TQEA 1NEEA 2AQ4A 1EQ0A 1GQEA 5CZVA 3FSIA 4NLSA 1Z2ZA 2WW4A 2ZHAA 2V2ZA 4FN5A 1Y5LB 2M4MA 3LWLA 2Z2YB 1IKWB 3G4SS 1HBNB 4OZLA 2B4UA 4P72A 3NOCA 2NXJA 3VTIA 4LBPA 1OY8A 2YNIB 4C11B 5CCLA 5DDOC 2BR0A 4I6AA 2QEXS 4DV1J 3MEEB 3O6QA 4IH5A 1TKXB 1KOOA 2ZNYA 4OZ1A 2FJBB 1UZDA 1JJHA 2F65A 2IHR1 2O5DA 3M6XA 4YB6A 3H4BA 3IWNC 1YJRA 2KDOA 3I4PA 4C2MA 4X64F 1MMNA 4MTPA 2AGOA 2ZVSA 2JLGA 4WKRA 3NAIA 1JLCB 3QFWA 1UFKA 3HHKA 5I42B 3H5UA 4P10A 4DR7J 2MYFA 1UZHA 4ZLJA 4JYAF 1EKRA 4EYHB 3PYFA 2OELA 2N7CA 2E1AA 1UFLA 2DPJA 1SI9A 3A3NB 2AV5A 5B0FA 2XZWA 2LLZA 4RX6A 1ZZFA 4F26A 3MFIA 4DFJA 1QSSA 3TWZA 4HACA 3CC4S 4ILLA 3A8KA 2F4VJ 2CQ2A 3FQKA 2ZH8A 4DUYF 3UCZP 2B9WA 1JB0C 2XNQA 4AFFA 5ETSA 2CG8A 2NS1B 4GKKF 2OLWA 4M5HA 3EDQB 3WZ0A 2LEBA 3OHAA 4M1KA 1Z2LA 3UD5A 5AXNA 1VC0A 1NM2A 2L9WA 1VBYA 1X5PA 1JLGB 1P6TA 3NS5A 1L3UA 2ZBIA 2OPQA 5T7LB 1X5SA 5D3GB 1IKVB 5M2RA 2RSQA 4CZCA 4ZVQB 1P1LA 2ALYB 2IYGA 1UW4A 2BA9A 5K8NA 2LVWA 3DLLQ 2XHCA 2GIRA 2YKNB 1YIJS 5L8RC 2RKIB 3RB0A 2EBGA 4QR2A 3VAFA 1N36J 2J0SD 3SXLA 2IY5B 2ZKTA 2QFIA 3UDCA 2Z2MA 1KTQA 1R0CB 7FD1A 3B4DA 4DPYA 5LMNF 4JI5F 4MFBA 3H4DA 2DNLA 4WP9A 2VOOA 4YB1P 3DRSB 1AB8A 3M6UA 4DU8A 2J0XA 2YPYA 3MFHA 4DLGA 1FJEB 4UY85 3K89A 2YKOA 1JLFA 2CPYA 5D0GA 4C8ZA 1S1VA 5B0BA 2WCXA 4FXDA 2RT3A 2LQBA 1SJ4P 2O3DA 1KFDA 3IRXA 2FGCA 4O44A 1VMBA 3ZZ0A 1HQEA 1RT2B 1U1RA 3TVKA 3S01A 4X4VA 4PEOA 4H4OA 2RVJA 3S8SA 1URRA 2OTJS 5IT4A 5D4PA 3ZTSA 3HD2A 4NLVA 1VQOS 3NL0A 4R8UA 5A6PA 1KKHA 2YQ1A 1A6LA 4DX6A 1RSCA 1KBRA 1UJ5A 5FDLB 4DL3A 1RBOB 2BANB 1LW2A 4LR7A 4F2SA 1HQUA 4DSKA 5IV4A 2A3JA 2HFNA 2CIMA 2FHJD 4OYIA 5KOWA 4U8YA 2BABA 4IQMA 1F3VA 2D69A 4DPXA 1EETA 1O8BA 2VPXB 4YHHF 1MWZA 2QT7A 4DR7F 3E01A 4DPTA 5JMNA 1XMQF 2HPUA 3BYRA 4JYAJ 4W4MA 1HD0A 2LEPA 3I5CA 5FDLA 2GVZA 1ZA1B 2YNGB 1C0TB 4ILMA 2GCFA 5A8RA 1VQ6S 1FJ7A 4P74A 5A0YA 2FLNA 2PA3A 1Q8LA 4B3TJ 2I8EA 1DFDA 5K8MA 1DJ0A 5CH7B 2E29A 1HI0P 5IS2A 4AUKA 3S6EA 1F2HA 2E5GA 2V8PA 2GVDB 1SL1A 4IR9A 1O51A 1CJUA 2P9EA 4ITSA 2HS3A 4LIRA 4LREA 4OYOA 4YEAA 1Q8BA 5ETRA 5AXMA 3KLEA 4C7QA 4WFXA 4S0MA 1L5UA 1PKUA 1Y11A 4YR0A 5KT3A 1YHQS 4IFYA 4C3KA 3J7AN 2Q43A 2CPZA 1XR5A 1YJ9S 1U02A 4WP3A 4ETXA 3GJQB 4CO0A 1VHIA 3HKWA 1CQMA 1D8YA 2FIUA 3ENVA 2QYGA 2VUGA 3LP2A 3M8QA 2IBOA 4DL0C 3DN9A 1ZM4A 2Q66A 1D9DA 5LMNJ 3IR5B 3RYLA 2B51A 2RKIA 3OVSA 3CB4A 1BWVA 4RUAA 1NKEA 3I0SA 5D0EA 2ZM6J 2CDRB 2O01C 2POKA 3KWMA 2YTCA 4A47A 1M90T 1RT7A 1I94F 3H8YA 1WDTA 4NE9C 1RT5B 3NLCA 4PQAA 3HHLC 3RZAA 3UVJA 4RZRA 2V63A 5M2UA 1FJCA 4B9MA 1U1PA 3RGIA 3RRKA 2V67A 3MMBA 1WOSA 2MKJA 4NA1A 5DZ6A 2OEKA 1EAYC 5M2PA 4USKA 2E1RA 3L7PA 4ID5B 4C3MA 4ZKAA 1SH0A 1XMBA 3TYTA 4CLZA 4DV0F 1YITS 1WC1A 3AD9C 2ZH2A 1NK9A 3Q24A 1FWKA 4XAKA 1FNMA 2B4VA 2IM2A 3E01B 1SJFA 2HQ3A 1T9UA 3HJVA 1CJKA 1EETB 4C48A 2DNOA 4JV2A 2BYCA 2W9CA 4CH1A 3P5BP 4LFCJ 5KFUA 2W24A 4M5NA 1YJTA 2OTLS 3D4JA 1OYDA 4RUCA 3Q8YA 1LFWA 3JSMB 5KFEA 1FE4A 4FKYA 2DNZA 1T9VA 3OR2B 3DRPA 4R0JA 1S59A 4Y00A 3BJYA 1RACB 2BKOA 1E6VA 2J0QD 3ENQA 5BYSA 3FJ2A 2XQCA 4OYBA 3AY0A 4KHRA 5F8GA 3NMRA 3G6YA 3VAKA 2QZ8A 2XCPA 3SQGA 2JHEA 1ZA2B 2RS8A 2GHVC 4KGMA 2E7XA 2FJXA
chains in the Genus database with same CATH topology
4FP9A 1LWEA 2CVIA 4OIXA 3N4WA 4ZPAA 4Q7AA 5C25A 1FCAA 4NMLA 4AL6A 4ERDA 3BEGB 5C5JA 3LOUA 4ZPDA 4FBUA 5F8NA 3NCQA 2JEFA 4PUOB 2CG4A 5F8JA 4A8WA 1U4BA 2JVRA 2HNYA 1H0HB 2KRBA 3PJWA 3DYAA 2VD3A 3KK3A 5GAEI 2VG7A 2M3DA 3WDOA 4K4VA 2IRYA 3SQGB 4MIBA 1N5YA 4OHWA 1VRTB 3Q0AA 3ZZRA 1R31A 3F56A 2V8GA 4DF8A 3FSYA 4RWXA 4Q0BA 4BC7A 4EU0A 2DGOA 2YWGA 4OV1A 4P6QA 2MZTA 2OPRB 3CDEA 3OL8A 3LPYA 2L08A 3JSBA 3PIPQ 4B02A 1M5PC 2J6SA 1FXRA 2ILYA 1C1CA 3T6JA 3CDUA 4AE5A 2RDIA 1G1XA 1M5VC 5CHCB 1DURA 2OPRA 1X4DA 2ZJQQ 2V4JA 4WTYA 4IDKA 3CCRS 4YOEA 3CJ0A 3EXYA 2FHMA 3IGVA 3MDFA 5C24A 3MUVP 1N8RT 1L3SA 2HWHA 3KTQA 2D9PA 1KVIA 2V4QA 1WG5A 2QIFA 2DTJA 1S1WB 2HW3A 1C0UB 3VALA 4C9DA 1HNVB 3CVKA 3HVTA 2IFXA 4U9RA 1HPZB 4Q2MA 2QRRA 2CRLA 1TKDA 2OPSA 3DC2A 2Q6BA 4AYBD 1ZM3A 3VCDA 3DFEA 2VQFF 3G71S 4EBCA 2HMIA 2MSSA 4Q5VA 2ADBA 1GH8A 1R3NA 4ED1A 3RAMA 4EZ9A 2XSJA 2KZZA 2QMXA 1QUPA 1X4AA 3EZ5A 4ED3A 4ED2A 3MOJB 1HWLA 4ED7A 1N5TA 3GG0A 3TW0A 2LDYA 3M32A 3ZZZA 3J81Y 4E98A 3DLHA 3DLKB 5DG8A 1HFEL 2HS4A 2W4PA 4C8OA 2GQ2A 4LF6F 2AYEA 5DQHA 3H2UB 1HR0F 3BN4A 1VHFA 5E3QA 1VRUB 4Y3CA 4CNZA 1CSJA 3NGKA 4KO0B 2I9SA 3HVWA 1U2FA 4A8KA 5HROA 4HL9A 1KN6A 2MQLA 3RB6A 2EFOA 1R43A 2OPPA 3T5LA 1X5TA 2BJEA 1FTCA 1JX4A 1HBOB 4I7FB 4PXBA 1VS3A 4X4OA 1IKXA 3C8YA 3W7BA 4KB7A 4R0EA 1VQ7S 2YWHA 4BWJA 5HROB 2ADCA 4DSJA 1U1MA 2ZH3A 4JOUA 3AQOA 2DGQA 1UWBB 4CT9A 1U45A 3Q2SC 2R7QA 3CCQS 4V19X 1GXLA 5KT7A 2IBKA 3RR7A 5B0AA 4UY8T 3OTEA 1W2BR 4DS5A 1RI7A 3GQCA 4FF4A 3I55S 3J7A1 4RLEA 2QO3A 4K4WA 2NYIA 1VLYA 5CYQA 4C8NA 3TQ1A 2L3MA 3DLEA 1U1LA 3NKYA 1YG0A 1FA0A 4IOBA 4KV8A 4U7CA 4Y28C 4ID8A 1OWXA 2XULA 3AB2B 3KG0A 3MEGA 1Q53A 1KQGB 1Y3KA 3LP2B 4ZVGA 3SYZA 2PD1A 3A1YG 3DRRB 1H2VZ 1X0PA 2GIQA 2HNDB 3THTA 2AF6A 3HHLA 4Q2LA 1R8PA 3KLIA 3QIPA 2NQPA 3KJVA 4I1TA 3HM9A 3BDPA 4K5RA 1MMLA 1NAQA 2M52A 4H4KC 5HL7Q 1HNVA 2O66A 1OPZA 2YY3A 2AW0A 2FGOA 4IH7A 4MKAA 4URQU 2KT2A 3VAIA 2L9NA 1KC8T 3MMCA 3M8RA 3LW5C 2X1FA 3OFFA 3FEZA 1S1TB 4XK8C 3RR8A 4MK9A 2EC0A 1JXEA 3I32A 5E5NA 2C22A 3V6KA 4NXNF 4WU3A 5HMWA 4XIUA 4C0HA 2ASLA 2EW9A 3HHLD 5CA5A 3I96A 1WI6A 4TN2A 1X0FA 5ITHA 4P2SA 1FRMA 2EFVA 1KOHA 4PWDA 5E0OA 3KG4A 3VWSA 4OL8A 4U7UK 2BZ2A 2W9BB 4CO1A 3FEXB 2BANA 5KFYA 2DNPA 5MAOA 4OX8A 4DV6F 1S7HA 1RA6A 1TV6A 4DR3F 4G6VB 3M6WA 5EGYA 3H2LA 1RYSA 4J5OA 5B7WA 1JLAA 1HBMB 5EX0A 4QW9A 1S76D 4YQWA 4JUZA 1WF1A 2DGUA 1YJWS 2ZH1A 4ETZA 1TK8A 4DV2F 1N5YB 1KR4A 4DBQA 3M2VA 1RT4A 2G1DA 1KRPA 3CIMA 2PC6A 4OJGA 4AL7A 5KFOA 5DGAA 4LVOP 2DVIA 4NCAA 5CCMA 4OJ3A 2F3JA 4F3MA 2B5JA 4U67Q 1FKPB 3DGPA 5HBMA 4LFAF 3RW6A 3NAHA 3GFXA 3DOLB 1UA1A 1LW0A 5KG5A 1WEXA 3IS9B 3VF0B 2MJUA 3SEOA 5L39A 2ZM6F 1BC6A 3KJVB 1WHXA 1S9GB 2CZ4A 2VFUA 5J2QB 2D41A 2LU1A 1LOUA 2VC0A 1HWUA 2E7WA 5L1JA 2ZE2B 4BHQA 1T05B 3LO3A 1P8GA 3HO1A 1HW9A 3QJPA 2PFFB 1IQZA 3K5OA 2QMWA 2AJ0A 1CG2A 4PXEA 3PDNA 2V8VA 1TP7A 1NKCA 1E6YA 1H3DA 4WJBA 3D1QA 3EPIA 2WK4A 1KNZA 3KOAA 1TAUA 2DGVA 3LANA 4U6PA 2KFYA 1JLCA 1S9EA 1IUJA 2ZH5A 1NJZA 1VC5A 4JI4F 3OLAA 2E5IA 4PXCA 2R2SA 1ZOTA 1VBZA 4UQGA 1Y00A 3H20A 4F2RA 4UQTA 3PW2A 5I3UA 1DLOA 3B78A 3LP0A 1RTHB 1ZPWX 3BZQA 4RW4A 2HHHF 3HMJG 4GMKA 2C3OA 3FDSA 2DT9A 4C98A 1IKXB 3UR3C 5K8OA 1DARA 1GXTA 4RW4B 1DHMA 3OTDA 1T7PA 4RW7B 5JXSA 5H9FJ 2DGTA 2PIIA 5KFDA 3GR0A 3N28A 3OUYA 2HQIA 3W3SA 1S6QA 2XGPA 1MU2B 5F41A 1UEVA 2BE2A 4KBIA 4NRTA 2FVSA 4HEA9 4HDGA 5B09A 1VQPS 1RT7B 3IWLA 2LQ5A 3SV4A 2EI5A 2N7YA 2NLWA 2XG8A 4O4GB 3PKYA 3V6HA 1RT3A 5AJ3F 3GV5B 2MSTA 4NYPA 4J9OA 3GMGA 2C3MA 1S99A 3POTA 1U6ZA 4GC7A 1SIWB 2AGPA 1LV5A 4DDFA 1H98A 5J2QA 2XMJA 3GZ7A 1WG4A 1ROFA 5AE3A 4PQUA 2HFZA 1SUQB 5KG7A 4ZP9A 5F8LA 3SV3A 4TU9A 4IRCA 4NRUA 3KLEB 3BGLA 2FC8A 3MR6A 2I5JA 1LFPA 1OSCA 2E9RX 5F0UA 1AFIA 1TVRA 3OVAA 4O4GA 1M5OC 4URGA 2QA1A 5DDQC 1DAXA 3BSCA 3VQTA 4TU8A 4OLOA 2JEJA 3O2IA 2D9OA 2DBBA 2LQJA 3PJXA 1GX5A 1RT4B 2FJDB 3M1VA 2X51A 5KFWA 1C0UA 1P1TA 1SQEA 1GAOA 3C6UA 2FTRA 2GJIA 2KN4A 3N6LA 4KC5A 2WB1D 2ZJPQ 3SDEA 4R5PA 2UUCF 3W2WB 2IVYA 1HQUB 1FEHA 4Y2IA 2V4JB 2HHQA 2GJ2A 2FJEB 2ROPA 2B56A 4IUFA 3AJ2A 1NRKA 1TV6B 3LP0B 3VZHA 1RTIA 2JC0A 3T5HA 1KFSA 1R27B 2VBXA 5FLXY 2FPHX 3D1HA 2G4BA 2OSQA 3CSKA 3BREA 1JLEA 5AXLA 2Z4PA 4O44B 4QYZJ 3GIIA 5L9NA 3L09A 3HI9A 5DS7A 2ZOGA 4D3GA 4HI1A 1VI7A 4RW8A 2J0WA 3UQSA 5DQGA 1XN9A 1HHTP 1UKUA 1XNQF 2ILZA 1BQNA 3NS6A 4WFNQ 4LSLB 2H5EA 4F3QA 3KLHB 4O3PA 3DCAA 4ZHRB 1VRTA 4DR2F 2XMWA 3GFZA 2XY5A 4PR6A 2KRRA 1WI8A 1GXUA 1UAWA 4WXWA 2KTQA 3PEHA 4DR1F 1IM4A 1UFWA 5KG6A 3SSQA 2ROGA 2D3UA 3DLBA 3GFYA 1H2UX 4C3LA 2Q79A 2A2CA 3BS9A 2ASYA 5KFKA 3PVXA 2GMHA 1NJIT 2F9JA 4ECYA 4LF8F 1BQMA 4OI1A 3W2VA 1TL1A 1U24A 3M9OB 2KXHA 3R5CA 2ZBCA 2FLPA 5I4MA 1FF2A 3NWGA 3CCES 5IZHA 4PPZA 4KSEB 3DM2B 2VASA 3KK2B 4Q8FA 4TY9A 2BW2A 1BQNB 2HHVA 2N82B 1B0VA 3IGNA 3MTJA 2P6SA 3M2VB 4O3QA 4QIFA 3BSAA 5IFMA 3HKZD 3PW0A 4NLRA 5I42A 1M0SA 1QAJA 1FT8A 2ZH6A 4E8UA 3GE9A 1WD6A 1GX6A 3VZIA 3TUZC 5GADI 2FD2A 5FD1A 3PFOA 2DHGA 1DTQA 2KHDA 3CGIA 3PW4A 3DRPB 1JNRB 4WYWA 4DSEA 3SSSA 2AJQA 1DRZA 2F7VA 3G8SA 3QGHA 3CPWR 4YP3A 3QGIA 2IJFA 2XLIA 4F4ZA 1KS2A 3AQPA 4OJ1A 1T95A 1UA0A 2E5LF 3PACA 3OTCA 1AFJA 2IA0A 1IQTA 1OIAA 4USIA 1HW8A 2KG1A 4PG8A 2VC1A 3FZ2A 2MZRA 4OX6A 3KFWX 4G1QA 4AXIA 2CQCA 2VG6B 1FESA 3MM8B 4QOTA 3QWPA 3CDWA 1Q82T 2QA2A 3LGNA 1N4LA 3MMBB 4ZDNA 4ALZA 1S1TA 3OXLA 4ICLB 3TA1A 2C2DA 2HG4A 3H5YA 2DNRA 3BQ0A 3HZGA 3T6BA 3BGRB 3ZZYA 3H98A 2IRUA 3GIKA 3KYLA 2V4RA 4HI2A 4NX9A 2DNNA 1X9SA 2DH9A 3M32B 2RH3A 2HNDA 4B3RF 3IWXA 1Y5IB 2QLWA 2XLJA 5IM0A 2EFPA 3KLVA 1CC8A 3M2UA 1KTVA 1U6FA 1KLNA 3CCUS 4LFCF 2R7OA 4I2QB 2NPFA 2O1PA 2KT3A 1RTJB 2UVWA 2NPIA 4EO6A 1QTMA 3DRXA 2VFRA 2CJBA 3O44A 1QAIA 1RGVA 5B0CA 1ZTTA 3I4HX 2VV5A 2NXUA 1R0AA 4QPTA 3MM7B 3BQ2A 3R5BA 4MYUA 4DUZF 2UU9F 1C1BB 4J9PA 4J9SA 3DXBA 3CWJA 3EGWB 2RQCA 2PMHA 3CJ2A 5F8MA 2DGXA 2ZNZA 5KT2A 1V3SA 4CH0S 2MY8A 2BOPA 1M5KC 3CJ5A 3TANA 2BACA 3DU6A 3FNNA 5B08A 4HH0A 1H38A 1W25A 3TAPA 3SSRA 4ECXA 2FVPA 1WEYA 4DV4F 5GVQA 3CD7A 2FLOA 4H54A 5B0DA 3QPIA 4ECUA 2I2YA 2D3ZA 4G1IA 4KTQA 1R7IA 2E1MC 4LQ9A 2V0NA 2WOMA 5KFIA 3ULHA 4DF4A 1NK7A 2NREA 1FKAF 3K5PA 3IC1A 3SCLE 4K4ZA 4FBTA 3GILA 4K4TA 3A8EA 2QV6A 2J9CA 4N8NA 2R7VA 2VFSA 2KFZA 3J7ZT 2FB0A 2KJVA 1W2IA 4DMZA 3PX4A 1PSDA 3TO8A 4KFBA 3FSXA 4WFZA 2M7SA 1UVJA 2DHXA 1SJQA 3IG1A 4ZCLA 1YI2S 2DGWA 5IM0B 4HLBA 1HNZF 1D9AA 4B3OA 1RDRA 2OO4A 4ZVFA 2J9DE 4J9NA 3S1TA 5K8PA 4UUXA 3GYXB 1JKHA 2B4PA 1ZH5A 4JV5F 3CCWA 1TKTA 4KKOA 4XPEA 3NNAA 4CO5A 2AX1A 3V6DB 2HFOA 3FGVA 2E44A 3I0RA 4O3OA 5CQGA 2K7JA 4F4XA 5LSRA 3T19A 1IKVA 4WZMA 2VPZB 1JLGA 1TL3A 4H4KA 3DDKA 4MIWA 2BE2B 5I3PA 1UVMA 5JUMA 2IVFB 2VG6A 3MM8A 2HIQA 2YNFB 2QE5A 3H5SA 4B3SF 5L1LA 1T03A 4EZ6A 2EKYA 1Q16B 2MY7A 2NR0A 1SKWA 2V9KA 4HTJA 4EUVA 3PW5A 2DPIA 1T8EA 2DRAA 3G6XA 1YRTA 2ZHBA 4A8YA 2CQPA 1DTTA 1N5QA 5KFTA 3JSMA 2WSCC 1Q81T 5KT4A 4TYAA 1Q7LB 5IQ6A 4WE1B 5L1KA 2IRXA 3EXCX 4MK8A 1TZ0A 3CE8A 4OHVA 5DETA 2HLUA 2B7CB 3TA2A 2BQ3A 2XCAA 2YX4A 1HD1A 3MEEA 2RMLA 3HZEA 2AX0A 1IKWA 4IG3B 3HT3A 2RQMA 3DRYA 3RTVA 2I0XA 3P3DA 1DQ9A 3KHLA 2N4DA 1K73T 4DL5A 4J9KA 5DLGA 3Q8SB 1T05A 2GO9A 2KJWA 3PW7A 5H9EJ 2M5YA 4YDXA 4KQZA 1AUDA 3X3UA 4CO3A 3LAMA 2UV8G 5A8KB 4JV1A 3ZZUA 5L1IA 2YWEA 3TAMA 2ZZMA 1LKZA 4DR5F 4F4YA 2KZMA 2APOA 2OAUA 2OSRA 1V3ZA 2MB0B 1HL6A 4PUOA 2MKIA 1K1QA 5GAEU 1CLFA 4FS1A 1UVLA 3N6NA 5ADZA 2DB1A 2WBMA 1FRIA 3HVAA 2G13A 3BN7A 4CNYA 3LUYA 5HQ8A 3OTBA 3RAXA 1KLMA 3N5FA 3D5MA 4XPCA 2GMJA 4DQIA 2AWZA 1UMJA 2JVOA 1U47A 4QWAA 3DDNA 2XY7A 1FRHA 1S97A 3SZ2A 3BR9A 1TL4A 1P9QC 4UOCA 5JVHQ 2VKRA 5D77A 2DNMA 1SL0A 1QM9A 1ZPVA 3FFIA 4LJMA 2R9LA 1AROP 5EWEA 2F8HA 3HHDA 5LXRA 4YFUA 1RTIB 1MROA 5KT5A 3J80Y 4TKTA 4CO2A 1D0EA 1XWLA 3UFCX 5A6WA 1FTRA 4B9UA 2KU7A 4YDDB 4X4PA 1NNDA 3OLBA 4JV0A 3SFUA 1RK8A 4ZPTR 3Q8PB 2MZQA 4MKBA 1BWEA 3EGNA 2R8KA 5D6GA 2DJWA 3QGPA 2JLEA 4HTIA 4O3RA 4C4WA 2R4FA 5KFHA 1TL3B 2V5HG 4ECZA 1Y3JA 5F9LA 4NL5A 1S4FA 1RTDB 3HX9A 4QWCA 1DQAA 2QLXA 2WAQD 4I2PB 4IO9Q 4HKQA 2BJDA 2BBEA 2MGZA 3BB5A 1VQLS 4JI7F 4N77A 5T14A 2LECA 1UETA 3FRYA 4ZMMA 4PG7A 4IFVA 2U2FA 4Y2AA 4N5SA 1BD6A 1JLFB 1Q8IA 4ZCKA 1WHWA 3HHLB 3EX7B 4CCHA 2AU0A 1Y5NB 1N88A 2EVZA 1Y0HA 2WW8A 3IR6B 4A8FA 3WC0A 3BGUA 3Q23A 2LCWA 1WF2A 4DOZA 4LF7F 5KFFA 1PILA 3TUJC 3EPGA 1YRUA 2VONA 1GT8A 5DM6Q 3G96A 4DSFA 1HARA 2DNYA 1RT3B 3I9ZA 2IM0A 3O8WA 5CZXA 2OPQB 4NZ6A 1U09A 3NCPA 2RU9A 2ZHOA 3IAM9 4IFVB 1JNZB 5HP1B 4GO5X 4DFPA 3KLFA 3FEYB <