5L38A

The structure of the hexagonal shell protein msm0272 from the rmm microcompartment
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
SSNAIGLIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAVIVTGEVGAVKAATEAGAETASQVGELVSVHVIPRPHSELGAHFSVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords MSM0272 - RMM microcompartment shell protein
publication title A Complete Structural Inventory of the Mycobacterial Microcompartment Shell Proteins Constrains Models of Global Architecture and Transport.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
total genus 23
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2016-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l38A00
3N79A 3SSRA 4RBTA 4DDFA 4OX8A 3DNCA 4OLOA 3CGIA 2G13A 3PACA 3CIMA 4AXJA 4QIVA 4RBUA 4P2SA 2EWHA 3SSSA 5DJBA 3VCDA 2A1BA 4AXIA 2A18A 2A10A 3DN9A 3BN4A 4OX7A 4QIEA 3MPYA 4RBVA 3I6PA 4QIFA 3H8YA 4LIWA 3MPWA 4P7TA 4P7VA 4QIGA 4OLPA 3NGKA 5L38A 4OX6A 3I96A 3IA0A 4PPDA 3SSQA 3NWGA
chains in the Genus database with same CATH superfamily
1WWHA 2JSXA 5B0GA 3C2PA 1OMSA 2J76E 5E3CA 5HQLA 3GIMA 3S01A 2ZBPA 4EWTA 2VPYB 3HT3A 1ZTTA 3HCXA 1FTCA 3LP2B 3C6UA 4J9UE 5K20B 3RAQA 2CPXA 1IBMJ 4ICLB 4OHZA 3T41A 3T5JA 2ACMA 1TKXB 3THVA 2RHSB 4ZMMA 5T7LA 1RBOB 4UOCA 4UT4A 1MNEA 4EYHB 1F3VA 4PPDA 2GFFA 5CA5A 5I3PA 2VG5A 5K5MA 1M5SA 2GQQA 1SH0A 1FDDA 3M32A 3PNIA 2CVIA 2KXHA 4YB6A 4I6YA 3FSIA 4YR2A 2HLUA 5DRKA 1V6HA 1Z4UA 2HS4A 4HR2A 3H4DA 1UA1A 2LKZA 3PO5A 2KM8C 5HVFA 1FERA 1VRUA 2HGMA 2IRXA 4MIAA 1H6KX 3MM7A 5B7WA 5F8LA 4KBIA 4F3OA 3P5BP 3UNGC 5DQHA 2EK1A 4LF8F 2Z2YB 4XTTA 3C46A 3GTYX 4M5MA 4I7FB 1RA6A 4LIRA 2F4VF 3M8PB 5HATA 1S1UB 2M4MA 3OSPA 4Z37A 5I3QA 4PR6A 2DNPA 5J2MA 2CNKB 3DOLB 4JV5F 1Q8KA 1K1QA 4QIGA 3OFHA 3NCPA 4DQRA 3GFYA 2V34A 4A8OA 1RB0A 4DPWA 1NCLA 4X65J 2H1YA 4L76A 3L7OA 3MM9B 2KHCA 2HHWA 3M6UA 1SKRA 2XGQA 4F4WA 1TQLA 2E5LJ 4Y0FA 1L3TA 2CPIA 4EFAC 2E5HA 3KG4A 2C3YA 3EJMA 4CTAA 1LWEA 3ELHA 2O3DA 2BRLA 1BC6A 2DGWA 3DHXA 5L46A 4OJ3A 1RTZA 2BUNA 3FQKA 3HSJA 5IWAF 5KFRA 2K06A 4ZCLA 3ZZZA 1K44A 3MAQA 3D67A 4X66J 5A2QU 1HQ2A 3GILA 1YLXA 5E7OB 2A1BA 3DU6A 4L75A 2B4PA 1H7WA 2DH7A 3P96A 2XEXA 2EI5A 3TZWA 2HW3A 4G6VB 3NKYA 4CLZA 2XMUA 3KK1B 5HSPA 8AT1B 3F0NA 3TUIC 3IGNA 4N56A 4W4MA 1DQ9A 4S0MA 1EJ7L 3J7ZT 2HQIA 4DCOB 1MWQA 1NHVA 1E6VA 5LSOA 3N79A 1N36F 3MCSA 3EZOA 1XK8A 2EW9A 2YKPA 3PYFA 3ZZOA 1RZMA 2QL9B 2ZDOA 3KLGA 4CLFA 3O44A 1T9YA 1SL0A 1RJJA 2HNDB 3W66A 4RW4B 3CCTA 4HHJA 4ERDA 1BY9A 4W98A 3VGTA 2DD8S 1WTBA 3MI7X 4X4SA 4PQUB 2HBRB 1IQTA 1ZH5A 2E1RA 3HF5A 1EAYC 2B7BB 4DV5J 2Y3YA 2YXLA 3E51A 1PGZA 1O6XA 1NPKA 5AE3A 1IR2A 2RS2A 4ECYA 4H4OB 3IA0A 1XMOF 2H9ZA 3MPUB 4LF7F 1CJKB 3ITHA 3BH6B 1PCAA 1U8SA 2PMZD 2OEJA 1UFLA 2CWXA 1SC6A 1IKYA 2AEMA 2OJ3A 3I0SA 4NRTA 1SKWA 3FBBA 2B4OA 5JUMA 4UQTA 1WI6A 1UFKA 5CYJA 3KG0A 2RRBA 1RCXB 3HHLA 4RUAA 3M1VB 3ETMA 4DDFA 2QA1A 3BKUA 2R7UA 1WKLA 2KYXA 2FGOA 1YDLA 3EGVA 4AQYJ 1KNZA 1X9WA 1LFWA 1YBTA 1BQMA 3QBCA 1S6PB 4G3IA 1AB8A 1IR1A 2LEBA 1VQOS 4CO5A 2CQDA 1S0OA 1Y11A 4F0KA 2ZC4A 2RF2B 2RVJA 3PDNA 2XHWA 4CLKA 2DRAA 1N5QA 2UUCJ 4YMEA 3BKTA 2GS8A 2VASA 1FDNA 3C6TA 2CUYA 1F6TA 4LBPA 4O0IA 4DR7J 4NLOA 2FB0A 4TY9A 2O01C 2AGPA 3NS7B 1TL7B 1RTJB 4IO1A 1KHWA 3IM8A 4ZPBA 3Q0AA 2GIRA 3A4TA 4KHPJ 1SPBP 5HP1B 4X4RA 3OL7A 3DXBA 4IDKB 3JYTA 3RBZA 3C8YA 2CPZA 1WI8A 1X5PA 5JJBA 1HR0J 1HARA 2QGFB 2XG8A 3UDLA 5JVHQ 1NXIA 1OY9A 3VGSA 2PEBA 3ZTPA 2DR6A 4FBTA 2IYGA 2ZJQQ 1S1WA 1RA7A 3R1LA 2K7JA 4DU8A 1DY3A 1IKXB 2VL1A 2ZITA 4V19J 1QUVA 1GFWB 5IM0A 3Q8SB 7AT1B 1N5YB 1SV5A 1M5PC 1FK9B 4E0DA 2L9WA 1RWNB 2ZH2A 2QL7B 2X1FA 4PYAA 2R8HA 2GMHA 1SL1A 2QMWA 3U02A 4KQZA 4LR9A 2HVIA 2CNNB 5BJRA 1NKEA 3TA0A 1B0TA 2XSJA 1F1BB 4EO8A 1ITPA 5B0EA 2HHTA 2VU5A 3CD7A 3GU0A 9RUBA 2V4QA 2DVIA 2HNZA 2CADA 3CWJA 1IKWA 1WSVA 5LMNF 1NZAA 2M88A 4FP9A 2UUAJ 2CVEA 2PFFB 3LPEA 1GT8A 4B3SF 2RNEA 2XMWA 3UDEA 1QAXA 3NGSA 3OTOJ 2Z2ZA 1X4EA 4DV0J 1YJUA 1DBDA 1HNXF 2NQPA 1A0OB 3GIIA 4EYIB 4DR6J 2CQBA 4QCLA 5I42A 1T3NA 3BGRB 3RW6A 2DHAA 3ZXWA 3KXDA 1KTVA 2KH9A 1XNRJ 3ILJA 4Y6IA 5JVGQ 4ANEA 2HWTA 5AXLA 4DCJB 2RJZA 2QFJA 4PWDB 1FJ7A 4KC5A 4HTJA 3VAMA 1A7GE 4LFAF 2VJVA 1BLUA 2BJEA 3LAKA 1KRPA 1V5VA 4KGVB 4O23A 3CVKA 4CH1A 1UVJA 2HG4A 4ZVFA 3I0RB 3DU5A 1GX6A 3DKDA 3G2XA 5F8HA 4XPCA 2EFOA 4IOAQ 1U09A 4CLWA 3VR1A 4DMZA 2DCLA 1JLEA 2OSQA 5GMEA 4G1IA 2C2RA 3MEDB 4M5DB 4U8YA 4WKYA 3JAMY 4Q2MA 1REVB 1ZETA 5KFIA 1EQ0A 2EFGA 4ZLNA 2ZNZA 3U1LA 1C0TB 4LVNP 3TZZA 4USUA 2XS7A 3OSNA 3P8BB 1XBWA 4IO9Q 3SSRA 4H54A 2EFPA 3VCDA 2HAFA 3G4SS 1JWWA 4QIFA 3EPGA 2AGQA 3D0GE 2GGPB 4ZA1A 4P7TA 1TVRB 2GAHC 5C5JA 2BQ3A 2WCXA 4IFVA 1FRJA 1DZ5A 2IAJA 4A8SA 4LF6J 2A2DA 2YTCA 5F3ZA 1U6ZA 3QFHA 3D0HE 1RK8A 1VJQA 5LMUF 2I9SA 4TYAA 4ZPTR 2B4UA 2G2ZA 3DHWC 4KV8A 3T1YJ 2BANA 1G6BA 4AL5A 1NAQA 2J8AA 3V6DB 2NXCA 1RTHB 4DU7A 1U47A 2IVMA 3MAHA 1HNWF 3EMTA 1VC5A 4DV4J 3B54A 3VZIA 1RISA 1YJ9S 1N33F 3BGOP 4KAIA 1JX4A 3D28A 2DXEA 2ATLA 2IIHA 3I6PA 4DR3J 2FJBB 2VONA 2LVWA 2C3MA 3HHDA 4DV1F 1M90T 5A8RB 1VQKS 3CNQP 1SQEA 4QBUA 4CH7A 1WC0A 1VCTA 4WIQA 2N4CA 2WK4A 4ID8A 2ZOMA 4L74A 2HNYA 5HBMA 1U1KA 3X1LB 1DARA 2HRTA 1DTTB 4FYDA 1M5KC 4MFBB 3RJMB 2DGUA 4ZOSA 4B9MA 1XEZA 4ZPDA 2EKNA 3MM6A 2HK2A 4KO0B 2AT1B 1HWJA 1G4CA 2IRYA 4H4KC 4EMDA 1BQNA 2WSEC 2BR0A 4OZ2A 2MSTA 2W9AA 3RRGA 3M2VA 2UV8A 2AJ4A 1UVNA 2IVFB 2Q1LA 2FLOA 4PUOA 3ENAA 2DR8A 5H1SV 1I1GA 3PR5B 1M1HA 3MCMA 1H0HB 3MMCA 1CJTB 2ZOFA 2OD4A 1S7HA 4OYPA 4PYDA 4MK8A 1RAAB 2Q66A 1RXOB 3HULA 4AL7A 3Q8UA 3DLLQ 3UI3A 3CIZA 2XTJP 1RQ0A 3BF4A 3GJRB 5CD4A 3T5HA 3QJPA 3NG8A 3CCES 4TY8B 1NHUA 2YQ1A 3CB4A 3PJWA 2PMHA 3D5MA 1VLOA 2IJFA 4OI4A 4DR4F 3OJSA 5E3QA 3A3NB 2LYVA 2AJ1A 4UOFA 3ZO7A 2OKQA 1U1QA 4LR7A 4EK2A 4DX5A 2C2EA 1IKVA 4NYOA 1XMBA 3THTA 1GH8A 1EB0A 3VTIA 4C3KA 1WKKA 5A8WA 1Y0HA 2AV5A 3ISND 3L7PA 2J5AA 2XMKA 2MQNA 4Z7CA 4R8UA 3CT9A 4CDIA 4UF4A 3CMES 2D3OR 3DC2A 1X7VA 3KLFB 3EYZA 5KFWA 5CZVA 3MR2A 2CWKA 3TNVA 3GSIA 1HBMB 2YH0A 3FMWA 3B82A 1XN9A 3DYAA 4P73A 5DS7A 2JEFA 3SEOA 5B0BA 3SCKE 4IH6A 2OHDA 4DUTA 2EFVA 2LLZA 2R7SA 1RT1B 2QZ8A 3R7BB 2FZKB 1LEOA 1RBAA 3OTDA 2K1RB 3ISZA 1HQEA 4DPOA 3HD2A 1S4FA 4C97A 2EEYA 2PGCA 3I96A 3O8WA 2IY5B 1EETB 4R5PA 1TL3A 2HHQA 2QYCA 2R7TA 1WSRA 4P2FA 1IBKF 4DV7F 4RUHA 2D9OA 2CDRB 1GXTA 2VV5A 2QC3A 3J7YU 2QSWA 4MAKA 1L3UA 2GCFA 2ZD1A 1MU2B 4WCEQ 1JNRB 4J9KA 1ZZFA 4B3MJ 3GIKA 1FRXA 2DNNA 1FX4A 2DNKA 4F8RA 4ECVA 3FRZA 3RBEA 1SIWB 2JDJA 3TRGA 3MR5A 3KWMA 3Q8VA 4EZ6A 4LF5F 1S6UA 3UDVA 2QTWA 3ZZUA 5J2PB 1Q5VA 4O44B 2BJ9A 3T1HJ 2X51A 1UW9A 2PEHA 3W60A 3QJJA 4RBUA 5T41A 1V3RA 4TLQA 3HFKA 4FXDA 4DR1F 5A0YB 2RU9A 4I2QA 4C7QA 2AMCB 4WFNQ 4AUKA 3DRRB 3TX8A 5A2QY 4CNYA 2JFDA 4DV6F 5LJ3Y 2PI5A 5F41A 4Z2XA 3HVRA 3KJVA 4EEYA 1RHMB 2JH3A 2DGVA 1SJ4P 2AD9A 2J0WA 1EHWA 2VOOA 1PJ6A 4CLTA 1FI4A 3NMAA 3J7YI 4JI0F 3NS5A 5CZXA 4F26A 3NGRA 2Y0SD 2JNJA 2FHJA 4WU2A 2H4YB 1NDKA 4NLVA 1JLQA 3LA0A 4YDXA 1N32F 3PW0A 1DLOB 4ZN3A 2YWGA 1H7XA 2M5YA 4WU3A 3ADAC 3NBPB 2HFUA 3HMJG 3K7RA 3QPIA 3F41A 1JLCB 1JNZB 4GRSA 1FWPA 3J81Y 2CJ9A 2E44A 4YB7A 2QO3A 3D6MB 2W9CB 3DDKA 4D3HA 3R5DA 4JYAF 3EUNA 1O5JA 5EWGA 1UAWA 2A3JA 1LFPA 3NWGA 3W8GA 4RU2A 2CQPA 3DOKB 4LVOP 1J5EF 2YKMA 4NXNF 2KI2A 1KTQA 1NSKL 3OXLA 5DM6Q 1I6JA 1YK9A 3MMBB 4HI1A 2R2TA 3Q2SC 5DLGA 2J0QD 4F3QA 2DEIA 1TTHB 3N28A 4OZ5A 2P9CA 2B4VA 1FXRA 4J91A 4N8OA 1S6QA 4JI2F 1Y00A 1FE4A 4NLGA 3I31A 3IXQA 4LMZA 2F8HA 1GXUA 4CO4A 4DQIA 3P5TL 1FRLA 2OAUA 3EDQB 4OZJA 4NL5A 3IBWA 4OYXA 2XSJB 2IM0A 2Z4PA 2IM3A 3DRPB 4DL7A 3N0VA 3KMQA 3MZIA 3I55S 1B4SA 5AXKA 1YQHA 3F44A 1HMVB 4FVCA 2F40A 4PG5A 2MDAA 4CIOA 2AJFE 2G9OA 2RDIA 3OW2R 4ED0A 2XMMA 3MPDA 2HVHA 3THPA 3W1YC 2Q3PA 4DR2F 3MM8B 3FJ2A 4PRFA 3AAWB 3JSRA 5HMWA 3SSSA 1S79A 5KFZA 3HKZD 2MKIA 2CJBA 3FBCA 4XPEA 2QE5A 1RABB 4U8VA 1F5CA 3LWMA 3W3SA 5L1JA 4WTYA 4YP3A 3NNAA 4YY3F 4K4XA 4F4XA 5GAHU 2GVZB 4UZCA 4UQGA 2VB6A 2DBBA 1MROA 1YHQS 4C48A 1OJ4A 4F0MA 1F9HA 3V4MA 1YBAA 1LXNA 1AW0A 3WX8A 1LQ9A 1CJUB 1VQ9S 3E8OA 3OL8A 4LF9J 3NNHA 2F1FA 2VICA 5ADZA 1X4HA 3SQOP 1R8AA 4NCGA 2IBKA 2XMJA 2EKYA 2BKPA 4OX7A 4F0HA 1P1TA 2ABYA 5KT3A 4J9SA 3CPWR 3AQPA 5SUHA 3G6VA 1EIYB 3NOGA 4WKRA 4HT7A 3WQPA 5IT9U 1YJ7A 3AOBA 4ZLJA 1WNEA 4B9NA 1TUVA 1KOOA 3W9IA 4HKQA 3JSMB 2BV3A 1SJ3P 1IVZA 4KGXB 1OWXA 4KRWA 3WZ0A 6FDRA 1FRKA 5GAHI 2ZZMA 1FKPB 1P9QC 5J2QA 3HSDA 3H42A 2HHHF 4RL1A 5DDRC 4CH0S 1T05A 3NMRA 1UJ4A 1W2BR 4OI1A 2R7OA 1VYAA 3EGWB 3POTB 2YY3A 2FY1A 4ELVA 4X64F 1XJWB 4K4YA 2J0SD 5FLXU 1TAUA 1CS4A 1R3NA 4DFPA 4O3PA 2DITA 2FC9A 3IR6B 4UZBA 2VHGA 3FVYA 3JS9A 3MECA 4IG0A 1Q8LA 2OUGA 4DUYJ 2CJQA 4DPYA 2R9LA 2OIHA 4WE1A 3W5XA 2G0JA 1HBOA 4CO3A 3LP0A 5K14B 2NSCA 1TKZA 1TELA 1M1KT 3GLJA 3GB0A 2OEKA 4CLYA 1D09B 4ETZA 4DF8A 2ROEA 4O3SA 3W2WB 1Q5YA 2XWXA 3PYDA 3KTQA 1I94F 1H98A 3QZ7A 6FD1A 2B8QA 4A46A 2MJUA 2BE2A 1N5VA 4Q0BA 4P2XA 5I4MA 4CM0A 1I3OB 4NLWA 1QSLA 1N34J 2MB0B 2MQ8A 1T9WA 2B6AB 2MQPA 1K1SA 4PXDA 2EK6A 2B51A 3J7Z5 4C8LA 5F0WA 4MK9A 2VH7A 1FWLA 3M2RB 3OL6A 1HI0P 2LDIA 4USKA 2QA4S 5F3TA 4FYXB 1XWLA 4LSLA 5DG8A 4MT1A 3BM7A 3W2VB 5JXSA 4GKJJ 2HHUA 4ZLPA 2VFVA 1NK6A 1VQ6S 1TMMA 4OIXA 2LXUA 1HI1A 1HQUB 4OQJA 2XCAA 3TAMB 3CCMS 5EX0A 4RLEA 2KFYA 4URGA 2RIJA 3J7AN 4ID5B 4ECUA 1U0HB 3D6HB 5L38A 4CLPA 3FCHA 4I64A 2KDOA 2H5IB 2ILYA 1QJHA 3AH6A 2Z56B 4DSLA 1RU1A 3K17A 4O4RA 4DZDA 1VRQC 1R8BA 4OX9F 3QRPA 4RJVA 4XAKA 2C3UA 1SB6A 4RW7B 3C15B 4J5OA 1RAGB 3PY8A 2XZTB 2RD5C 2CAJA 2DNQA 4OJ1A 1L5UA 2ALZA 2FQQB 4F50A 3QWPA 3RU0A 2VIHA 1S1XA 1VS3A 2KHDA 4A4JA 5KFAA 4IH5A 4JI8J 1HNIA 3AJ2A 5ETOA 1JLBA 3T6BA 1PAEX 4G65A 1X31C 4M5JA 3QIDA 4OHWA 4G1QB 2HFZA 1H74A 3GONA 2MPUA 1P9YA 4NEYA 5SZTA 4IOCQ 3QGHA 4LRDA 1B70B 2RSQA 4OHXA 1CJVB 2XCPA 1OSDA 3DLGB 2Y0BB 5GVQA 1KONA 2Z2LA 2LA4A 4ED5A 1HHSA 3CC2S 3T5LA 2UP1A 2P2CB 2RKIA 3IG1B 4ECXA 4XIUA 4WXOA 3T1YF 1RHRB 2OPSB 3MFHA 2D7SA 1TUWA 3CC4S 3CEDA 1YRXA 4LFBF 1BWEA 2V8VA 5DM7Q 4C6AA 5D78A 1C0UB 4AD6A 4K4SA 1FEEA 3IWLA 3QQCD 1N4LA 3IN5A 2AJQA 2CPFA 3ZFVA 5D0GA 3LOUA 3TVKA 4YS2A 3QGGA 2VDHA 3OTBA 4K7QA 2XS5A 2XI2A 2QA2A 5IFMA 2BBEA 2FC8A 3GV8B 2OEMA 3U27A 1KEKA 4NMXA 4RWWA 4CRJA 1FRHA 1AYEA 2CDQA 4MKVA 3NXZA 1Q86T 2K3IA 2BE7D 3SI8A 1S9GB 5KFGA 2J9EA 1DRZA 5C42B 4NLXA 4KSEB 2GVDB 2J7WA 4ITSA 4NE9C 5J2NB 6AT1B 2LEPA 1R8HA 2G0IA 1K47A 5B09A 3OR1B 1K73T 3E2EA 8ATCB 1PJ7A 5ETNA 1RU2A 3RB3A 5AJ3J 4RUBA 4F2SA 4WFZA 1NLKL 2X7IA 1ZA1B 3UWTA 4UOGA 2W9BB 1SQFA 3HVWA 3RAMA 2CPYA 4ZJLA 5KFSA 1RTDA 2LU1A 3I4PA 1PSDA 1T7PA 2OELA 3CJTA 3IAS9 3M8QA 2R8IA 1VQYA 4B3OB 3M8SA 2R4FA 4ZP6A 4B02A 5F0UA 3VAKA 4HYKA 4TU9A 1TMJA 3LP2A 1SUQB 1UL3A 4ICLA 3BSCA 1GMUA 3H25A 4ANCA 4C0BA 4GC7A 2XLKA 2VBYA 2VODA 3AY0A 4ILRA 1TKXA 4DX6A 4OV6A 1NMEB 2YNIB 2AF6A 2V4JB 3KNAA 3W8PA 2CG8A 4Q8FA 2QMUB 3N6LA 2IM1A 5HLFB 1X60A 3UR0A 2DIUA 5KFOA 1G7CB 4PG7A 1VIOA 3CJRA 1RI7A 1RBLA 4F4ZA 3R3TA 4RX6A 1FNOA 2L08A 3PKMA 1TK5A 1FKOB 2UXDJ 3UVJB 5G0RB 2VQEJ 3R6LB 1RT2B 4K2JA 4RW8B 5CH7B 2CQCA 3KLHB 2W2QP 2NPFA 2OPQB 4WYLA 1KVIA 2IBOA 4RO0A 5G4DA 2VPWB 1TZ0A 1S9FA 4B3RJ 1WHVA 2CRLA 1KQFB 4G1PA 1FNMA 4I7FA 2DH8A 1S1TB 4DQPA 3BV8A 3M8PA 1S1UA 2ZBRA 3CD5A 2ZC3A 3B4DA 1NJYA 4DEZA 4OI0A 3OTCA 2OPPB 2H4WB 2DNYA 3JQJA 3DLJA 3CCRS 1E6YB 2UUWA 4DSKA 3DOLA 4DWIA 3DLKB 4BWMA 4F04B 3O2IA 2C42A 2IC3B 3PJXA 2ZWOA 3AFGA 5EUHA 3MM9A 2IRUA 2HLTA 1SIZA 1ZZNA 3KMSA 3DLHA 3ZZPA 3CC7S 2DGSA 1X5TA 4QPTA 3U1NA 4RBVA 4NXMF 4TYBA 3CCWA 2I5JB 3BGLA 3QGPA 1U02A 1KP6A 3TA1A 4I1TA 3AA9A 1WJ9A 1BQXA 1N8RT 4OYIA 2LQ8A 2UV8G 1CVJA 4I68A 2DIVA 3RBXA 5M2UA 3PW7A 3QYYA 2XMAA 2J6TA 3G8TA 2G1DA 4YUDA 3H5XA 4QZVB 2FJWA 3IR5B 4YHHJ 1HW8A 3N9UC 1X4GA 2RDDA 4LFCF 1HYSB 1FJGF 1WOSA 2LEAA 2W2NP 3KK1A 2B9EA 3W64A 4JI3F 1TL5A 2I1RA 5KFMA 1VISA 3BQ1A 3IRXB 5D4PA 3CJ3A 1RGVA 1NDCA 1N54B 2BKOA 4O4GB 4IUFA 3SZ2A 1U48A 2JRSA 1D9DA 3M9OB 3ILLA 4DBQA 4CZCA 1M5HA 1LW0A 1C4CA 4P2MA 5D3GB 2WBMA 1SH3A 4AE5A 3PIOQ 4IFYB 4OI3A 1CQMA 2OPRB 3TW0A 1A9NB 3QFWA 4GKKF 4NLYA 4JI5J 2HNDA 1FFSB 2DEJA 3MM5B 4RW4A 4J9LA 2HKEA 4URQU 4HH1A 1U2FA 4DN9A 4FF4A 3V4IB 2R2RA 3CULA 2C2KB 5L1LA 1BXNA 3D1HA 3FUYA 3OT9A 2WVFA 4C8KA 3RRHA 1RTIB 2DR7A 2UU9J 3DFEA 4H4OA 2BJ1A 1X4FA 2WB4A 4EBCA 1CJKA 3UN3A 5IQQA 4F36A 1KBRA 2KT3A 3CCVS 4C4WA 2VG7B 2V5HG 2V94A 3IP0A 1W26A 1U4BA 2I2YA 1QVFR 1VQLS 1RWPB 3PX0A 3R8YA 1KDNA 3FRYA 3IM9A 1S99A 3HHEA 2M8HA 5E2QA 1JLAB 3WIVA 2H3EB 1J2VA 3KFWX 5L9XA 5ETRA 3NGKA 2VUGA 1JLFB 3KLIB 3AXMA 5F8JA 2V50A 1JIHA 3AHPA 2YVSA 1ZPWX 3M1VA 2VQFJ 2NZ4A 1Y5IB 2QG9B 2XMVA 2GHPA 3MXHP 5FD1A 1UTAA 3HVAA 4DUZF 1S48A 3OHAA 5H9EK 1U2CA 2IM2A 2ZVIA 3RR7A 2KVIA 2BOAA 2FY8A 2DXDA 2Z8QA 2FDNA 1S6PA 4B3TJ 2MZRA 2QMXA 3OR2B 3KHLA 3K59A 3D54A 2ZM6J 4LF4J 2RF2A 5B08A 4IRKA 3BYRA 3ENQA 2DH9A 4TN2A 5ETKA 2VC0A 3PX4A 3ZTOA 2HK3A 1M1GA 3GFHA 3PJ9A 2E1PA 3M6WA 1P27B 3LUYA 2FVQA 2RILA 3VWSA 5U47A 1SC1B 3TEHB 2WHOA 1ZAVA 4HH0A 5BYRA 2KTQA 2P9EA 1OYEA 5RUBA 2Q43A 1OYDA 1TU0B 5IT9Y 4GO5X 2BVZA 3RYLA 1TL7A 1NSAA 3PXGa 1RTJA 2HHVA 3M8WA 1HHTP 1XERA 2IA0A 4ZN1A 5HP1A 1BMQB 4ZVOB 1RAHB 4IDKA 1YBUA 3LGNA 1JKHB 3V6KA 1OPIA 4FYVB 1WDDA 2D69A 4JV1A 3AD8C 2GJIA 3TQ1A 4RW6B 4JI6F 4I2PB 1NUEA 2J8SA 4GVLA 2DXFA 4KFBB 1IKXA 2C3OA 2UZAA 1YIJS 1B7YB 2ZWPA 1X4AA 3ZZYA 1WC4A 3DMJB 3ISNC 1FK9A 3BDPA 4AYBD 5J1PA 4HACA 2C22A 3C3LA 4ECQA 2CQGA 1VQ5S 1KLMB 1VK3A 2MZQA 2D74B 2CJKA 1GQEA 4Q8EA 1RUSA 5DGBA 3TA2A 1TUGB 1B0PA 2GZOA 1NPPA 2NSBA 2P5VA 4NA3A 2F9JA 3UCUP 4C2MA 2W4CA 1JJHA 5CYQB 1KC8T 3QO9B 4DL4A 4P2SA 3ETOA 1WOPA 4TQRA 4W90B 2BACA 4ED1A 4FXWA 2BQRA 1R6VA 1UVMA 1MN9A 5DZ6A 4JI4J 2BJ3A 4QR1A 5JMNA 3BGRA 3C14B 1RYRA 2AP6A 2KM8B 2RHQB 4CO2A 4USIA 1NH7A 4I69A 3IFEA 2HURA 4OJGA 3M2UB 1N52B 4X62J 4J9OA 4PWDA 3OUYB 1U49A 3AB4B 2HVEA 2PD1A 4DF4A 2IDEA 1CULB 3FC9A 2ASLA 1CC7A 3E3XA 5EWFA 1RWVB 4PWUA 4LJMA 2DNRA 4Y00A 2GA7A 3I0RA 1MW7A 2YBVA 1NPRA 4U7CA 1XMQF 1R8CA 2C2DA 1UPMB 2YNGB 1SC4B 1VJWA 3MEDA 4NLDA 2NXUA 4M5DA 4WP9A 4LBIA 3MURP 4AFFA 2DGOA 4K5RA 4M8LA 4PZVA 1REVA 4ZPAA 1MWYA 1FJCA 4DR5F 4ZVSB 1C0TA 4F25A 1GNKA 3M4XA 2Y8WA 3NEKA 2XHCA 4CLSA 2RH3A 4RZRA 2CQ0A 4LSZB 3GIRA 1CBKA 3I5AA 3ZNJ1 1UCNA 4JV0A 2VDIA 3WIUA 2JOQA 1RSCA 2HFNA 3WC0A 2GGPA 1PC5A 1TVRA 4PCQA 3BEGB 5KFCA 2LCWA 1XC9A 4JOUA 2HMIB 1FD8A 3ILOA 1FO1A 2QIFA 5IXUA 1RT7B 4X4VA 1WACA 5HQ8A 2VD3A 3K5PA 2AQ4A 2U1AA 1WOOA 1Y9OA 2OMOA 3Q24A 2XYPB 4E8UA 2A2CA 4DL2A 2P9GA 3B8HA 3VV2B 2FLPA 1HNVB 4J90A 3V6DA 1T94A 3I5BA 1RTHA 3B4MA 1B99A 2RE1A 5IV3A 2H5JB 3VGVA 2FD2A 2PC6A 4ZCKA 2W7AA 4QU7A 2PA8D 2EVZA 4MK7A 1RKJA 2HBZB 2ROGA 2FJXA 1D8YA 5KT7A 4NZ7A 3KYLA 2H5EA 3DRSB 3QATA 2YNFB 3H59A 1M5OC 1YKWA 2QJ3A 5A8RA 3TJAA 2Z2MA 3TOQA 1HBUB 4GMKA 4QJVA 5BR8F 2X3GA 3AJ1A 3DXSX 1NRKA 3WC2A 1YGYA 3HO1A 2ZOGA 2M52A 1FVQA 1X5OA 4PG4A 3A3PB 1DTTA 1K0VA 3C66A 5FIIA 2HQDA 3M8YA 4MFBA 1KS2A 2FPHX 2C2NA 4KO0A 4IR9A 2A0FB 3TX0A 3PYGA 4BWJA 2MSSA 4P74A 1NJZA 4J7CA 4NI2B 1HHQA 4HI2A 1UVIA 5BYSA 4LF8J 4F4YA 2M2BA 1IN0A 1GTEA 2ZH9A 2F4VJ 3IS9B 3ZTRA 2V68A 1CJTA 2WTFA 2YX4A 4NLSA 4JV5J 2RRAA 2DTJA 4ZK7M 4ES1A 4PG8A 2XYGB 1WEZA 4AT1B 3T3FA 4LRFA 3S1TA 4AXIA 4TY8A 5C25B 2UXCF 3I87A 2WVDA 1DTQB 2YKQA 1WG4A 2QLXA 3EVOA 2NXEA 2CFXA 1U6BA 2EG2A 2O67A 1T3OA 3IR7B 2J7UA 2V2QA 4MJKA 3W5YA 4YB5A 5DZ7A 4P72A 3KK2B 4K5SA 3MOJB 2IMWP 2GIFA 1VQNS 3PO4A 3BO4A 1U1MA 4F4KA 4IOBA 5DG9A 5KTQA 3HVTB 4DPUA 2YH1A 1T0TV 3OFGA 4PKDB 1NSQA 3MWBA 1X4DA 1NK4A 3H5YA 2H54B 4DFMA 2ZFHA 3MUVP 1HFEL 4O0NA 2XSFA 4ZS6A 2AX1A 3G96A 5IWAJ 1RHUB 5DDQC 2G0CA 1FRIA 1CQNA 1F9FA 1GMWA 3EWGA 1X8DA 3K2YA 1R0CB 4J9MA 3FNNA 3KLFA 2O1PA 2DY1A 4KH1B 4WTOB 4P6QA 3UFCX 4DV2F 1RHJB 1FA0A 1LNQA 1F5BA 1S0VA 1S57A 2KKHA 2CZ9A 1LW0B 3PM9A 1HBMA 1M5VC 4DV3F 3G8SA 1YX2A 2YWKA 3IC1A 3UD5A 2DNOA 4RPFA 2AYEA 2V2VA 3J81U 1SJ1A 3V81B 1SKUB 4CYUB 1N36J 5B0AA 2UXBF 2CQIA 1X4CA 1RT1A 1VIXA 4USHA 2HS3A 4QYZJ 1MLAA 5LJ5Y 2K1RA 1PC4A 3BPSP 2R7WA 3R5AA 2W4PA 4M5NA 1EETA 2OD6A 1LW2B 5EHHA 4RNHA 2UVUA 5HK4A 1EQMA 3X3UA 1ZM3A 3ENVA 3W9HA 1BD6A 2HGNA 3A3OB 3QZ8A 4RNOA 2MQLA 2K2PA 1MU2A 3FKBA 2YQ0A 1HWKA 2BW2A 2ASJA 1JJ4A 3D6TB 4Y34A 2XC9A 1U8WA 3FFIB 1JB0C 1RT4B 4HHHA 2EG1A 1JJ2R 5DQGA 4IG3B 1XMOJ 4J9PA 4LF7J 2DO0A 3PACA 5DETA 3I5CA 3DOMA 3FDSA 3ONQA 2I6WA 3ZZRA 3PR4A 3R5JB 4JBCA 4B9LA 5J2PA 3RB4A 1WC5A 4O44A 3I9V9 4F2RA 2V9WA 4ECZA 3V2UC 1V5IB 3DN9A 3AXKA 1VBZA 1YITS 2L9NA 2DNZA 3Q22A 2ZNYA 5A0YA 1SKSA 4K0KF 3OVSA 1FTRA 2V8DA 4LF1A 4EGLA 4LRCA 2OH2A 3CCJS 2N82B 2M9KA 3N4WA 2JEGA 1HD1A 5B0CA 2J9DA 3DRRA 4RW9B 4RKUC 3KG1A 4QR2A 1NK0A 2E5IA 4KHRA 3HI9A 5B0DA 4LQ3A 4M5KA 4XK8C 7FDRA 2XLIA 2I8EA 2QV6A 4ZDNA 1JLGB 3QLHB 3EPIA 3CDUA 4OL8A 4A8MP 3HM9A 1C1BB 1FDBA 2PN6A 4NZ6A 3BN7A 5A6WA 4V19X 3VAGA 3L4BC 1DLOA 1H2TZ 4XO0A 4LR8A 4X4TA 1H2VZ 1KVJA 3V6JA 3NBPA 3HFVA 4ILLA 3DI6B 4PWWA 1JLCA 2W01A 2ZDPA 2BYCA 2M7SA 5MAOA 4DPXA 4Q2LA 2FVCA 3ZZ0A 1RWKB 3SFGA 1N48A 4DX8H 1TAQA 2W9CA 2HZAA 4OLOA 1K9MT 2GO8A 3CTRA 3DOKA 2F65A 1FHTA 1Y3KA 1HBNB 4YR3A 3MCOA 2MKCA 1UPPA 4FF1A 2JWNA 3OFEA 3MMBA 5HI7A 1WDTA 4BDPA 4CT9A 4TKTA 1UVLA 3L3CA 4HACB 1ZAXA 1UJ6A 2MKJA 1CPZA 4NOHA 1J27A 3CJKB 4DFJA 4KYZA 2KL8A 2O5DA 4R0EA 3M9NB 3DM2B 2J0XA 1QVGR 2XB2D 2MKKA 2ZZTA 2OI2A 5IOLA 3T6JA 3DRPA 5KG0A 3OVBA 1HMVA 1VHIA 3SBMA 5IT0A 4F02A 3KJFB 1R6YA 3H7HB 1AUSL 1C2PA 2ALYB 3MM8A 3CF5Q 1FXLA 5THWA 2MJNA 2XYHB 4HTIA 5KOWA 1LXJA 2JX2A 1HKAA 1XNQF 2DGQA 1HWUA 4DL3A 3I32A 5LMNJ 4J9QA 2VZ9A 1RCOB 5IZHA 5KT5A 1LWCB 3ZTQA 2CYYA 4W92B 4QWBA 4B3SJ 2ASDA 4UUWA 2JC1A 2FGCA 2VA2A 1VRTB 2GVZA 1FFGB 4C11B 1FX2A 2JC0A 4ZVQB 1HNXJ 3MR7A 1N0UA 5HVHA 1VI7A 1JMTA 3M30B 1TFWA 4QU6A 1KWMA 1MMNA 4Y3CA 4YN3B 3ZTSA 5MLCV 2FUG9 4TU7A 1UEUA 1CJUA 1AA1B 1Q95G 3DLEB 2ZHBA 3O3LA 2WVBA 3PRBA 1WD6A 5HVGA 2OP5A 3UW1A 1QUPA 2SXLA 4LFAJ 4Y2AA 2R7XA 2BW7A 3R9LA 2B0GA 2X3DA 3D0IE 1Q79A 1IBLF 4PAAA 3KLEB 5KFEA 4WF9Q 3RW7A 5M2RA 4DOZA 4JI7F 5AXMA 5KFKA 3OTEA 1IUJA 4HHUA 3JSMA 4USJC 3Q8YA 3VF0B 4ED4A 3TANA 1UWBB 3QAUA 3H4BA 2XULA 2WSFC 3BO2A 4RNNA 3HX9A 1RHKB 4WZMA 1FKPA 1HI8A 3DCAA 4DI6A 3HPOA 1XIQA 3EVWA 2MMYA 2RMLA 3SCIE 2W24A 4QIWD 3SCJE 1FCAA 3OBIA 3POTA 3CXCR 5DJBA 2B3TB 4RWXA 3LQVA 3BKFA 2CPDA 5F8MA 2W2OP 3TAQA 2EXUA 3B6BA 5LMUJ 3OLBA 3HJFA 4P75A 1YZ6A 3OLAA 2YWHA 4UW2A 2V8PA 3CJ4A 5K14A 2VKZG 1HNZF 4I4BA 1HNWJ 2XI3A 1FVSA 2D41A 1N33J 4KGMA 3W2WA 3SV4A 2JFKA 2ZE2B 4WXWA 2LQ5A 2V67A 3G71S 5KAKA 2GMLA 2OTJS 2QRRA 3JXOA 4DV1J 2F63A 3OD2A 4IQXA 3D3CJ 1X0PA 2GIQA 2J6UA 2RDJA 1BWVA 4ZIVA 2B6AA 1AT1B 4MYUA 4HEA9 4LREA 3N6MA 1YI2S 3EE3A 2ACYA 2CXEA 3M2RA 3Q8QB 4H4MB 3P45B 2V63A 3R5BA 1ZM9A 1N5TA 4ECTA 1FJEB 2NR0A 5KFLA 3W2VA 3HDSA 3J7A1 1AZSB 1CG2A 3HHLD 3R5GA 1OIAA 3IWXA 3D9BA 2BJ8A 1Q4RA 4FBUA 1HQUA 3L95X 3TAMA 1RLDA 2NREA 2PO4A 1R0AB 2KN4A 3PEHA 4N41A 1B7FA 3GCWP 4ID5A 2WAQD 1U0HA 3TJ9A 5F9NA 3PHTA 1UZHA 3H20A 3CIMA 2KJVA 3SQGB 1B3TA 3MR6A 4KB7A 1V3ZA 3BBCA 1RACB 4F67A 1RLCL 2WZ1A 3CCUS 5KFFA 4RW7A 2KRBA 2CJYB 1TL1A 3C15A 2Y1LB 1NNDA 1EX8A 1S4EA 5C2GA 1R43A 4LSNA 3M8RA 4DR4J 1Q0NA 4NX9A 2V4RA 4HLBA 4JI1F 4GO7X 4YR0A 2XBPA 3CCQS 2E7XA 3M7VA 3O1LA 2AHOB 2PIIA 2F9DA 4QPXA 4K4WA 2YPZA 2DRBA 1FNXH 1ICEB 2R8JA 1T9UA 2Q6BA 4WZQA 4G1QA 4Y2KA 1T9XA 5KFHA 4GVBB 5CAAA 4PXBA 5GMDA 1MG7A 1C1CB 5E3PA 2HQGA 3GG1A 5LXRA 3PW5A 1CJVA 5D0EA 3DLGA 5KG4A 4OZLA 1C4AA 1V9OA 2V9KA 5IS2A 3BSAA 4USVA 3A8IA 1U45A 4NASA 4ZPCA 2DHHA 1IBMF 3IRWP 3SDEB 1RT5B 3T5KA 3IAM9 1S97A 4YFUA 2AJ2A 3IG1A 2I38A 3VQSA 3MMJA 1FRMA 2L41A 3G9CA 1KQKA 2OPSA 3GJQB 3FSXA 3KDOA 4NLQA 4N8NA 4KT0C 4DL0C 1C0UA 1D9AA 1CSJA 5DG7A 4DQSA 1SCJB 2KO1A 1NK9A 3CD6S 2AGOA 2B43A 3EVMA 1JXEA 2XQCA 3CDBA 5A8KB 3NLCA 2D3ZA 1QSSA 5C7PA 1B0VA 5FDLB 1TV6B 5D8HB 2ZBIA 3R7NB 1FT8A 3C16B 5J1EB 1F60B 2RT3A 4MTPA 1IBKJ 4DV7J 2PA3A 2QEXS 2BRKA 3QT8A 4ZCMA 1S9GA 3QSYB 1Q8BA 3QT6A 5C42A 3DOMB 3MEGB 1U26A 3NS6A 2GVDA 2YNHB 4KKOB 4ZIWA 4DPTA 5J2NA 2DJWA 3OR1A 3KLVA 2VA3A 2N7CA 1UZDA 4P52A 4FYWB 2MKSA 4LF5J 3A13A 1VOMA 1URNA 1V3SA 3OVAA 4FS1A 2H51B 3EX7B 3AD9C 3HXMA 3LANA 4JB8B 3RB6A 2G2YA 5LSLA 4QR0A 2RS8A 3RTVA 2W9BA 4X65F 3FZ2A 2LQBA 2VPZB 2Q79A 5K8NA 1Y7PA 2W8LA 3VHQA 2YQ3A 4K4VA 1D0EA 4USWA 4B3OA 1H2UX 2ZUAA 1W2IA 4DR1J 2HHSA 2P8IA 3TYTA 4ES3A 5CYMB 4C9DA 2E5LF 2HYIB 1S0MA 2F8EX 2YX1A 3RRKA 4X4UA 3HSZA 1SUQA 1B64A 1G1XA 4TU8A 4DV6J 3G82B 4UUXA 4UY8T 1JXVA 4ZITA 1OQ3A 1PYTA 2YNIA 2V4JA 4U95A 2MGZA 1T03B 1UVKA 2LP4A 3HSGA 4JI0J 5HLFA 2W7OA 2QA4G 2HBYB 4Q7AA 2C1EB 3PHEA 4X66F 1FESA 1N32J 3ET6B 2HHPA 3UNYA 2FLLA 4DCPB 1FKOA 3UVJA 2V8HA 5G0RA 4ED6A 2OGUA 4FYYB 4ILMA 5K8OA 3G6ES 1RT2A 1RT3B 1FDAA 2XO6A 4RW8A 3KLHA 3KHRA 3LH2S 3PEJA 4DLEA 4E98A 2OPQA 4HL9A 1I51B 2P6TA 3Q83A 5D4OA 5HANA 3VQTA 2DRDA 3HZGA 4JYAJ 2FIUA 3AA8A 1S1TA 4PXEA 1WEYA 2M8DB 1WC3A 3NAIA 2VG6B 1J5EJ 2RU3A 4NXNJ 3KK3B 1GEHA 3D4JA 5HL7Q 2OPPA 3SIPB 1E6YA 2GAGC 2RQKA 3GSDA 1YJVA 1RHQB 1LWFB 3OJUA 2UVVA 3D6FB 3DLKA 1Y3JA 2UUTA 3KHHA 5HO4A 2WBRA 4JI2J 2XZWA 3RAXA 2KT2A 1ZYQA 2IC3A 3H8YA 3EGZA 2KJWA 4WJBA 1NK8A 5KFTA 4DV5F 2DNMA 3ILIA 4LUBA 1I5OB 2E5GA 4DG1B 1S76D 1LWXA 3KJNB 2DR9A 4WPAA 4NLRA 3GWCA 2NYIA 2I5JA 3N5BA 4DSIA 2BQUA 4DR2J 5KFBA 2PI4A 4CQ1A 1F5AA 3AOAA 3HHKA 4DJBA 3SV3A 3D66A 1RWMB 1U1OA 3BGFA 4C8MA 2DYAA 4EU0A 3JSYA 2DPIA 5DO2A 5IC4B 1WKJA 4C8NA 3RR8A 2VKRA 3DDNA 4DSFA 1UEVA 4ZHRB 2KFNA 4YY3J 2HWHA 2X1GA 3BR8A 4ED2A 2CJXB 2B5JB 3P4UB 4FZVA 4WYWA 3D7SB 1S49A 1HYSA 4QOTA 3QSIA 3SFUA 2ZH7A 3MMAB 3FEZA 5KG7A 2GO9A 2JL9A 5D0RA 2MLYA 2DPJA 4AQYF 5I3UB 4KGKA 2AEJA 1APSA 2W2PP 2G2OA 5HAOA 3IBFB 3IRXA 4TXSA 3UE2A 5KFVA 2FZGB 2G1HA 4O4GA 3ZNUA 5C2CA 7FD1A 4BBYA 5AE1A 1XR6A 2CJAA 2UUCF 2QLFB 4FXVA 5D6GA 2UVWA 5D3GA 3A8EA 2V8GA 1VQSA 1S1VB 4IFYA 1IJFB 3OXGA 1Q7YT 3EDRB 2OPRA 1ZM4A 4DR7F 1LK5A 3MM5A 2ZH3A 3LP1B 2MLXA 2ILZA 2KYZA 1YTYA 4I6WA 4J37A 2XMTA 3GR1A 4DSJA 4UOHA 3EICA 4KHPF 3V4IA 2DO4A 3GFZA 3AJDA 2AJ0A 2BXJA 2GHVC 2FVSA 1W7WA 4WFAQ 3M8ZA 1RTIA 3H5UA 1HR0F 3CJ8A 2HHHJ 2F8MA 4ZVHA 2ATCB 5E0OA 1Q53A 3B78A 2B7CB 1NU4A 1J5OB 2HBQB 2VG7A 1F2HA 4X64J 5DDOC 3PFEA 1F3FA 3M6XA 1IXKA 2HEKA 5HMXA 1JLAA 3RZAA 1WF0A 3DGPB 1EP4B 3QRQA 3R1HA 2ADCA 5HROB 2HS0A 1JLFA 5EN1A 3KLIA 1G2EA 1H73A 1PG5B 4BC7A 4QWDA 3VALA 3K58A 1S77D 2AWZA 4M63A 2FJAB 2B9WA 3H0PA 2ZHOA 3E01B 4YDDB 3I9ZA 1I94J 1PIEA 3BSOA 3CJ0A 2MHEA 2RB7A 3OR2A 1NKBA 2UUAF 4BC9A 5KFQA 3MEEB 1S9EB 2ZEJA 3RBDA 2CQ1A 3TWZA 5L1KA 2HQCA 1YJNS 1VQPS 1WF2A 1QE1B 2WOMB 2V6AA 3LPYA 2C2ZB 4M5HA 3OTOF 3L7UA 1TKDA 4WK3A 4DV0F 2NLWA 3FEXB 1OY8A 4DR6F 3CE8A 3VAIA 3Q8PB 1S0NA 1P1LA 2QSFA 2A6OA 1BGXT 1TK0A 2R8GA 4PG6A 4K4UA 1S6OA 1VDHA 4ED8A 3AD7C 4C8YA 1XNRF 2DNHA 2XGPA 1HPZB 4F3MA 3H90A 1HWIA 3EZ5A 4KY3A 2LQJA 3P3DA 5C24B 5KG5A 1ELOA 4QIVA 1O8BA 3MCNA 2GQCA 1REGX 5LXYA 4CT8A 3L9ZA 3KJQB 1JKHA 1TL1B 2ZBQA 3MAAB 4P7VA 2Q6CA 2OSRA 4QWEA 3H2LA 3TR5A 1NHKL 3IMQJ 1WHWA 2ZVSA 1SJFA 4LSNB 4RW6A 1SC3B 4I2PA 4OX9J 2MQQA 2FHJD 2CG4A 1P6TA 3W65A 3C19A 4KFBA 2HPUA 2LDYA 5ETTA 1AROP 1PBUA 2YKAA 4FF3A 2GJ2A 2HSEB 3DMJA 4QIEA 1YJWS 2QLBB 1RT6B 1H3DA 2Y1RI 1TKTB 3BJYA 4B17A 3NGUA 1N0VC 4C98A 3T9NA 1KLMA 4DXLA 1W25A 4OMFG 3Q23A 2QX0A 3GQCA 3QIPB 2RAQA 4DS4A 2WONB 2M0GB 2YKNB 5K8MA 4LF6F 5CYQA 5K9FA 1U1RA 3R5CA 2QLJB 3CGIA 1N6QB 3QO9A 2HQFA 2FZCB 5CHCB 4FKYA 1SQGA 3NOCA 4CM2A 4A48A 1Q81T 4OX6A 4X2BA 5KT2A 1K8AT 1WC1A 4TVAB 1QTNB 3C6UB 1YJRA 4B9TA 1KLNA 1HL6A 2F7VA 2YWEA 1RWUA 2QYGA 4DV4F 3C14A 2XY7A 1MWZA 1KSPA 1RAIB 2UVRA 1DJ0A 1DQ8A 1KVKA 2XLJA 4NLPA 2NZCA 2FJEB 3BGUA 5BYQA 3BR9A 2EBEA 3UO0A 3W9JA 5T7LB 2EBGA 3O5TB 1SJRA 4J9VA 2E9RX 1BHNA 5AXNA 2WW8A 2MY8A 5EX3A 4CI0B 4DR3F 3MDFA 3M2UA 4LFBJ 2DT9A 1O0PA 3HJVA 3OUYA 5KT6A 2VG5B 1KQGB 1ZPVA 2MEWA 3TUPA 2N3LA 1PILA 2MQMA 3M32B 3DNCA 2AKWB 3FCWA 1CULA 4AXJA 2XNRA 4WFYA 3W63A 3DLBA 2DB1A 2ZBCA 3T1AA 4BLGA 3HT0A 3PCOB 3HK2A 1X9SA 3OHBA 1PYSB 4LF2A 3ZZTA 2E7WA 2HZCA 4YQWA 2R7QA 2DHGA 2YNGA 2DNLA 1VRUB 3CCLS 3FBEA 2Y1JA 3MM7B 5F8IA 2JLGA 2IVYA 4NEZA 5GAEU 1RAOA 3CCSS 4OV1A 5DGAA 4ES2A 3BBFA 1VQ4S 1WUUA 1VBYA 3AT1B 5J2MB 2HIQA 3H2UB 4OYZA 2KU7A 1YZ7A 2Z57B 3UR3C 3N5FA 1UKUA 4ZPVR 2HMIA 3AB2B 2W2MP 1S5ZA 2L48A 1RT7A 3R7SB 3VVUA 1X9MA 3GYXB 1R27B 3EGNA 3MPVA 2LMIA 3FCVA 2UUBJ 3HHNB 4PQAA 4ZVUB 2F4FA 5EWEA 2EPIA 1HNVA 1IBCB 2KZMA 2MGZB 5KFDA 5DLFA 4C8ZA 4QYRA 5HMYA 3GV5B 1HD0A 2HRUA 3NNCA 4KGZB 2R8KA 4CTAB 1RP5A 3VZHA 3F73A 4Y28C 2IJRA 3KHGA 1LWEB 1T95A 5E3AA 4OI6A 3QJLA 3U7JA 5D4LA 3DRSA 2HFOA 2YNFA 9ATCB 1GTHA 1WG1A 5GADU 2BA9A 1M0SA 1HBUA 5GAEI 4DLGA 4OJHA 2W25A 3BQ0A 2C3PA 3CJSA 2R42A 5BXIA 5E5NA 2JVOA 2BEFA 1KKHA 2LU2A 2WB1D 3QRRA 2IJNA 1NJIT 2DNGA 4RNFA 3KUEA 4N5SA 1GXLA 1CEZA 4NLUA 2ZH6A 4Q44A 4NI2A 3CDAA 2OLWA 3MEKA 4Y2CA 1OSCA 1DQAA 4OZ1A 1U1NA 1E6VB 4NCAA 4CNZA 3CJ5A 1SH2A 4TNOA 1RDRA 1SJQA 1Y4ZB 3OXFA 3IS9A 2Y8YA 3LWLA 3KLGB 3CJ2A 1U7LA 4ANDA 1RAJA 4R0JA 1PAUB 2K7KA 1VC0A 1FKAF 3MPWA 3GYGA 5GADI 5C25A 4NA2A 5CQGA 4ZVRB 3R2DJ 2ZZNA 1DTQA 2R2UA 1OO0B 4OZNA 1AFIA 4B3MF 2MLZA 5KOXA 3BQ2A 4OI2A 2G4BA 2VC1A 4NWBA 4NXMJ 3ITHB 4X4PA 3A1YG 2ADBA 3KK2A 2POKA 2XO7A 3GE9A 3IBCB 2BE9B 3LGMA 3HVTA 2D1CA 1U24A 1IKYB 1WTFA 3I0SB 3VAFA 3T1HF 3H40A 2IA6A 1F9EB 4OFZA 5KT4A 2MXYA 4Q5VA 3RUBL 2NS1B 2A18A 1Z2LA 3A8KA 3U1MA 2PSZA 4MYTA 3HHLB 4LFCJ 1FJGJ 2GJFA 3JTOA 3M05A 4FKXA 3PIPQ 2MYFA 3PV8A 1S12A 3UPFA 4LIWA 4JI3J 2DY9A 1NO8A 4GC6A 4YEAA 4M5GA 1BQMB 2XZDB 5DQIA 2DGXA 1FEHA 1SL2A 2MHNA 3V81A 4U67Q 4CYUA 4QQBA 2DHXA 2FLNA 5IQ6A 3MD1A 4L6V3 1QD1A 1SVDA 1UW4A 3C6TB 4IKAA 2E1CA 1QM9A 2MTLA 3S6EA 3QGIA 3PX6A 4GKKJ 1LW2A 1U25A 1VR6A 1YJTA 1KFDA 1D1UA 4FN5A 1UEKA 4Q43A 2B9XA 2FHMA 2J6SA 3J80U 3Q2TC 3MPYA 5ETQA 3GIJA 3FZBA 2BKNA 4PXCA 3JYTB 4NA1A 1D3WA 3CMQA 3FFIA 1RT4A 1FXDA 3K8VA 4IG3A 2IHR1 4Y65A 1YSJA 3QAEA 2D9PA 3NP5A 2M3DA 2AEFA 2W1BA 3GYNA 3PVXA 1S1WB 3MF5A 2BJ7A 1SXLA 2PT0A 5ETPA 4KH0B 3EZUA 4NLTA 1QAYA 3GP9A 5IM0B 4ALZA 5IC6B 4O3NA 2E5JA 1SV5B 5IT4A 2KG1A 1IQZA 4I56A 3BREA 3LTOA 3UCGA 4IRDA 5LOQA 4O3QA 4A8FA 4I0WA 2ZKTA 3WHIA 4LRAA 1AFJA 3LALA 2N4DA 4MIWA 3RG6A 5F8NA 2A6MA 4EUVA 4RW9A 5F9LA 1K0TA 4DUZJ 4YOEA 4RBTA 4C0OC 1WORA 2VF3A 2NUHA 2BOPA 2V2ZA 2HNZB 1IKWB 3G6YA 4JV2A 5HJXA 4ATNA 3HHLC 3BN4A 3GJTB 1JLGA 3QLHA 3OL9A 3QWUA 3FBFA 2XY5A 2OFGX 3KUGA 4FPRA 1C1BA 2VBZA 3NCRA 2BMBA 1L3KA 1L3VA 2IPOB 3R97A 3MGJA 2JLEA 5D15A 4WFBQ 5CABA 3TUZC 5I42B 1ZS6A 4M5LA 1TL4A 3NCQA 1TP7A 4ETXA 3DI6A 5GMKa 5ETSA 1YRTA 1BE4A 3PRVA 2C2OB 2EFQA 1XR7A 5E3RA 1GX5A 4LF9F 1NJWA 4N76A 4KHMA 2E1AA 4X4OA 3CJQA 5AT1B 3TZXA 3FGVA 3K57A 1HBNA 4WBFA 1NSPA 2MZTA 4NPOA 3GG0A 1KHVA 4MIBA 2COLA 2FVPA 1XTZA 1Q82T 4JI6J 1JLEB 2MZ1A 3EM1A 1GMVA 4WP3A 3AQOA 1WHYA 3KKFA 3CJKA 2E66A 1NDLA 4HT5A 3DM2A 2RRNA 1GAOA 1NB7A 3HKWA 1MMLA 3TZYA 3JB9k 3RGIA 3JSBA 1T9TA 1VK8A 2PE8A 2ZH5A 4NMLA 2EFNA 3G8QA 2AX0A 2DGTA 3NWRA 2XY6A 3PFOA 1EKSA 3MTKA 1JQGA 5ITHA 5EDWA 1QLNA 4ER8A 1QDUB 2HRYA 1IR0A 1X5SA 2D3O1 3BPDA 3WX4A 2KFZA 3KUHA 1R31A 2JEJA 1U1LA 4IFVB 2IAJB 2E29A 4FPIA 5LL6d 2KRRA 2AZ1A 2PMWA 3MFIA 3H98A 4UY85 1LWCA 1VHFA 4N77A 4DFKA 3I56S 1QAJA 1U6FA 3VAJA 4DUYF 4KV8B 2KZZA 2BANB 1T8EA 2K8GA 1PJ5A 4O3OA 1LV5A 3DRXA 1VRTA 3UDCA 1NJXA 4C11A 2FJDB 3D1QA 3CSKA 3SMZA 3M30A 1A6LA 4U7UD 2RQCA 4IH7A 3LF0A 3FEYB 4H4KA 3N6NA 1WF1A 1G3OA 2HHXA 3GMGA 1VFJA 3DLEA 1NM2A 1NDPA 3PG9A 4PEOA 2RQMA 1NH8A 1HA1A 4OZ3A 2BX6A 2HNYB 1N34F 5HBMB 3CO0P 3MHYA 1VQ8S 2JHEA 3BZQA 5A6PA 2L3MA 3KLEA 2ZJPQ 4A8QA 4ECWA 1XMQJ 1ZTWA 3MM6B 4IYQA 4NZ0A 4GKJF 1BQNB 4A8WA 2HVZA 3NAHA 4CCHA 1S59A 1SBRA 4TQSA 4OZ0A 3TAPA 3BBBA 4DR5J 3M2VB 2DKOB 4ZCIA 4PUOB 1UWBA 4KPCA 4QWAA 1N88A 2CQHA 1QTMA 3GZ7A 1TR0A 4RU9A 1RAEB 5L1IA 1FE0A 1Q16B 1UWAA 1H38A 3MMCB 1LK7A 3HD1A 2CPHA 3PRDA 2HFVA 2JEIA 5KG1A 1EARA 3KOAA 2MKYA 1HIYA 4FF2A 1DAXA 4ED7A 3MD3A 1JXLA 1WG5A 2H65B 1KQSR 1U2RA 3MUTP 1HW9A 2FHOB 2R3VA 2AU0A 2P6SA 1UFWA 3NL0A 3TEGA 4K4ZA 1N56A 4DL5A 4JI8F 3I4HX 2XM3A 5H9FJ 1TK8A 4XDCA 2BABA 3G86A 3JQMA 1IKVB 3ICLA 4J9RA 1ACMB 2ZE2A 4LT6A 5L39A 1Z1ZA 5A8WB 4ZJQA 4ZP9A 4R8UB 5BR8J 3K8WA 5KFJA 3EXYA 2LXFA 4UTGA 2EC2A 3BO3A 3LW5C 2WSCC 1NZ8A 4NYZA 1XR5A 4H4MA 2EWHA 3TQEA 2GX8A 2N7YA 2O66A 5KFPA 4C3LA 4CWBA 4X84A 2V69A 3PW4A 2E9TA 2X1AA 1AZSA 3DYAB 2ZH1A 4K4TA 3GCXP 2VBWA 4XDDA 2LECA 1TFYA 1OQ6A 3UD4P 4D3GA 3VGUA 2VPXB 1NK7A 1R0AA 4DZ6A 2YX7A 4I67A 4FDFA 4HDGA 1YVFA 1HQEB 1OS5A 3SQGA 5L8RC 1ROFA 2I0XA 4Y2IA 4ZVTB 4ECRA 4PPZA 4HDHA 4AL6A 5GAGU 4R5PB 1PYOB 1TL3B 2OFHX 4I6AA 2K3KA 1QY7A 2WRMA 3CMAS 2FYXA 1UP1A 4Z7YA 3GPAA 1T9VA 2UXCJ 3PW2A 1LOUA 4HVZA 2CA9A 4ZLLA 2ZD1B 1NK5A 3K89A 4RNMA 1ULRA 2CQ3A 1S7IA 3W7BA 2RUGA 4JP8A 3GV7B 5KFYA 4C8OA 1T02A 4BCAA 4K8RA 3R2CJ 2JLFA 3SCLE 4KJIA 5AJ3F 4ZVGA 1URRA 3UQSA 4ELTA 1ZOTA 4GVBA 2E9ZA 8RUCA 2CIMA 3GR0A 1C1CA 2JVRA 2HIYA 2ERRA 2KB2A 4CLUA 1WHXA 2VOPA 5DDPC 3HP6A 1FF2A 3ZC4A 1KOHA 5ETLA 2QN6B 2NUUG 1ZA2B 5K8PA 4I2QB 3OV7A 1AXQA 3FSYA 4F4AA 2MQOA 3PYEA 4CP5A 5IV4A 1Y5LB 3SDEA 5GAGI 1RT5A 4MKBA 2AZ3A 4DV2J 2UUBF 3KJVB 4K59A 4B9VA 4DX7A 4DV3J 3AODA 5D0HA 2AYMA 2QT7A 4M94A 4OYOA 2HAIA 4DS5A 2CNOB 1ZBTA 1BUXA 2JJ4D 2UXBJ 3IWNC 4DSEA 1ZM2A 1U1PA 4MKYA 1JLQB 4EZ9A 5A8KA 2CQ4A 1WC6A 4L3NA 1WELA 4MH8A 2UXDF 5KFNA 2DR5A 5FDLA 1TV6A 2VQEF 1DHMA 4IRCA 1VLYA 4MKAA 3K5OA 1KR4A 4IQMA 2CKWA 3UCZP 1VMBA 3JQKA 1VQ7S 3LGHA 2MZJA 2R2SA 3C16A 5J1EA 2ZH4A 4ZPWR 3TARA 4N47A 2RQ4A 4N7TA 3BDEA 4B3RF 4LBHA 3MEGA 3T19A 2KG0A 2YNHA 2GW8A 4KKOA 4O3RA 5H9FK 3M9MB 2ZH8A 2YKMB 2QFIA 3OQ2A 2PFDA 1D8ZA 3FMBA 4CO0A 4USMA 1IWAA 2V0NA 4ZP7A 3UN2A 5H9EJ 1CC8A 2KT5A 1RWXB 2ZJRQ 4C3MA 1GK8A 1S6QB 3NGDA 2XWYA 2HZVA 2L9DA 2W4DA 3LO3A 5D77A 3O6QA 1JJCB 4WP8A 1KFSA 5KG6A 4BS2A 1YG0A 4K0KJ 1NEEA 1H72C 5CYMA 4A8KA 3Q86A 3US5A 4DN0A 4KPYA 2QLWA 3DRYA 1FFWB 3K5MA 1Y10A 2R7VA 4P10A 3G82A 5B0FA 3SSQA 3A12A 4MMOA 4NCBA 1X4BA 4E2FB 3KNGA 2IYIA 4Q45A 4B9UA 3UN5A 2M70A 2X1BA 1S72S 1T03A 1JK9B 5KFXA 3QT7A 4ZVEA 4ELUA 2CZ4A 2AYGA 2ASYA 4L73A 4ED3A 4YHHF 3V6HA 2IFXA 3PTWA 3ET6A 2V2KA 2J7KA 4BHQA 1MROB 2CPJA 3R27A 3BYPA 1PBAA 1XQIA 2WW4A 2HQ3A 2YWWA 3V5RA 3T9ZA 2VFSA 4EI2A 1RT3A 4M1KA 2DHSA 2J9CA 3MUMP 4JUZA 3QNWB 4LQ9A 4P9SA 1KD1T 1RADB 3A8JA 3H2VE 3LAMA 3RB0A 1MN7A 2KXFA 1HLWA 4FNHA 4LRBA 4NCGB 3OPKA 3IGVA 2GV1A 2HVDA 2HWIA 3Q89A 4DHVA 2XNQA 3N01A 1F0XA 1UJ5A 3JTNA 3F56A 2VG6A 3J80Y 1VC6A 3KK3A 4ZVPB 2AW0A 4K2XA 4M5IA 4U6PA 4OLPA 1IM4A 4ZJOA 4PABA 1RAFB 3PZPA 2OTLS 4OYMA 3TVYA 1LWFA 1LKZA 2GC8A 2C28A 4JI5F 2GHWA 2QL5B 3D3BJ 3W62A 2GNKA 2J9DE 1RWWB 3OFFA 2JZ5A 2DISA 4WWSA 4RR5A 2CZVC 4M95A 3MOZA 2BM0A 4DG1A 4USTA 4R25A 4EBDA 5J2QB 2UU9F 3CCZA 3QT5A 4EBEA 1NBEB 4KIAA 3BB5A 2F3JA 3D68A 1OPZA 3L09A 4QYZK 4A8XA 4WK1A 4PQUA 4J9NA 2WVEA 3D2WA 3K0JA 1T05B 2Z30B 2FHKA 4ZP8A 1FD2A 3DGVA 2B9YA 4U7UK 4RUCA 1WEXA 2E1MC 1XNQJ 3D1OA 3HFZB 1CS4B 5LSRA 2IMOA 2VFTA 3MECB 2WVCA 4IG0B 1VBKA 1Q78A 2OO4A 4ZHRA 2BM1A 4ZKAA 2NPIA 2Y1IA 5F8GA 4WE1B 2W7PA 3H5SA 1HBOB 2B5JA 3FK4A 4CLLA 2VQFF 3LP0B 3S8SA 1NKCA 4A8YA 1TKZB 3R6GB 2ROPA 3HLUA 3NGTA 4F7VA 3PKYA 3TP2A 3MMAA 3WDOA 3CDWA 5HJYA 5KG2A 1QAIA 1U0SA 2W8KA 2FJVA 2MKHA 5I3UA 2G13A 1R0BG 4B3TF 1FWKA 2BE2B 4Q0BB 2AIRB 1IM6A 2MZSA 1L3SA 2YKOA 4B9SA 2B56A 2ZM6F 4LF4F 3NRBA 2LFVA 1R8PA 1NB2A 3JTPA 1QSYA 4U96A 1Q1KA 3EXCX 4DL6A 3W61A 3DDIA 3CW2C 1IBLJ 3TVZA 1EKRA 1RE1B 1S1VA 1UA0A 5HQMA 4L72B 4LSLB 2RUSA 2BJDA 5ETMA 4JI7J 2C2MB 1GMWD 3LP1A 2NXNA 1VGYA 3NY0A 5E41A 2MY7A 5HMZA 2NYHA 2KXNB 5D4NA 1PO6A 2ZHAA 1VQMS 2HGLA 2YPYA 4QWCA 2CPEA 1UETA 2FTRA 1HWLA 2CQ2A 4NYPA 4P71A 5ETVA 2U2FA 3CUNA 3P49B 3AOCA 1RKIA 3Q8RB 1F2GA 2CNLB 4WIIA 2VFUA 5KG3A 3JAMU 3MTJA 1J5OA 5FJ4A 4IR1A 4KR0B 4ECSA 4YB1P 3M6VA 3TO8A 3SXLA 1DFDA 3DGPA 1EP4A 4X4QA 1CLFA 4CO1A 2B8PA 4KE5A 5HROA 2BDPA 1X0FA 1EZZB 2VJUA 1S1XB 2BZ2A 4FS2A 5AE2A 2VBXA 1AUDA 1HNIB 3BH7B 2APOA 1HNZJ 1IJEB 2NXJA 3QMQA 2GQ2A 1N5YA 1JLBB 2EC0A 3TUJC 5CXTA 1T11A 3MR3A 2A10A 5FLXY 3SYZA 1Q7LB 3E01A 1IWGA 3W5ZA 1Q8IA 5J1NA 1VBXA 4B08A 1N5SA 2DCUB 3FQLA 2R7RA 4NRUA 3J81j 3MEEA 1S9EA 5T14A 1D9FA 1Z2ZA 2D3UA 2PDAA 1UMJA 1QE1A 2WOMA 3UD3P 2DK2A 4C0HA 3G6XA 3CD0A 3GFXA 3CDEA 5CD4H 4FVMA 4JI4F 1O51A 5CCMA 4K50A 4TLRA 2RKIB 1SI9A 1R89A 2H48B 3I82A 1HPZA 1YWXA 4OYAA 4FNIA 5EGYA 2FVRA 4QW8A 4X62F 4Y2MA 2ZUGA 5C24A 2LXIA 4ENOA 2XS2A 3BSNA 2ZKUA 4X4NA 4QW9A 4EO6A 1RWOB 5LM7E 3MAAA 5M2PA 3G87A 2KVQE 3CO9A 1YRUA 2GMJA 3HZEA 3KDNA 2E7VA 4A47A 3GJSB 3BS9A 4WFXA 5LT5A 5CCLA 2LQ9A 2HFSA 2LA6A 1RYSA 4OX8A 3S7RA 1ZAWA 4OHVA 3ENWA 1DURA 3TI0A 1MMDA 4V1Ak 5A76A 1S10A 2VFRA 2F5GA 2YWFA 3IO1A 3P6YC 4URSA 1RT6A 4KTQA 4JI1J 3TJ8A 4U9RA 1TKTA 2IDLA 2OMLA 5KFUA 2Z58B 2AYBA 2NCKL 1OY6A 1Y5NB 5E33A 4OYWA 3K5NA 2Y9HA 3VAHA 4OYBA 1R7IA 3K5LA 4DQQA 3QIPA 1KN6A 2N3OA 2WONA 2YKNA 5HN0A 4OHYA 5L9NA 1MSWD 1N6QA 1PKUA 1P8GA 1RTDB 4L3KA 3WBZA 3VVTA 2Z0GA 3ULHA 3M8QB
chains in the Genus database with same CATH topology
1WWHA 2ZZNA 2JSXA 1DTQA 4NLWA 5B0GA 4OLOA 3C2PA 1K9MT 2J76E 1QSLA 5E3CA 2MB0B 2GO8A 2R2UA 1OO0B 4OZNA 3CTRA 3DOKA 2B6AB 3GIMA 3S01A 1FHTA 1AFIA 4EWTA 2MQPA 2VPYB 4B3MF 1K1SA 3HT3A 1Y3KA 4PXDA 2EK6A 2B51A 3J7Z5 4C8LA 5F0WA 1HBNB 2VH7A 4MK9A 5KOXA 3BQ2A 1ZTTA 1FTCA 4OI2A 4YR3A 3UD3P 3LP2B 2MKCA 2VC1A 3C6UA 3M2RB 4NWBA 2G4BA 3RAQA 3OL6A 1HI0P 4FF1A 2JWNA 2CPXA 2LDIA 3ITHB 4X4PA 3A1YG 3OFEA 4ICLB 2ADBA 3KK2A 3MMBA 2POKA 4OHZA 5HI7A 2XO7A 4BDPA 4CT9A 2QA4S 5F3TA 1XWLA 3GE9A 4TKTA 1UVLA 4LSLA 3L3CA 3T5JA 1ZAXA 5DG8A 1UJ6A 3BM7A 2MKJA 3LGMA 3W2VB 1CPZA 5JXSA 3HVTA 2HHUA 1TKXB 4NOHA 3THVA 4ZMMA 4ZLPA 5T7LA 2D1CA 3CJKB 1U24A 4DFJA 1IKYB 2VFVA 1WTFA 1NK6A 2O5DA 4R0EA 4UOCA 3M9NB 3I0SB 1MNEA 3VAFA 4EYHB 3T1HF 3DM2B 1VQ6S 3H40A 4OIXA 2LXUA 2DRAA 1HI1A 2IA6A 4PPDA 1HQUB 2J0XA 4OFZA 2GFFA 5KT4A 4OQJA 5CA5A 5I3PA 2VG5A 5K5MA 1QVGR 2XB2D 2XCAA 2MKKA 1M5SA 2MXYA 2GQQA 4Q5VA 3T6JA 3TAMB 3CCMS 5EX0A 4RLEA 1SH0A 3DRPA 5KG0A 2KFYA 3OVBA 1FDDA 3M32A 2NS1B 3PNIA 4URGA 2A18A 1Z2LA 2CVIA 2RIJA 2KXHA 4YB6A 4ID5B 3U1MA 4ECUA 1HMVA 2PSZA 4I6YA 5IT0A 4MYTA 3FSIA 4YR2A 2HLUA 3HHLB 4F02A 5DRKA 1V6HA 5L38A 1R6YA 3FCHA 1Z4UA 2HS4A 4I64A 2KDOA 3H4DA 2ILYA 1UA1A 1C2PA 1QJHA 3AH6A 3JTOA 2LKZA 3M05A 3PO5A 4DSLA 3MM8A 3PIPQ 3CF5Q 1FXLA 5THWA 2MJNA 2MYFA 4O4RA 3PV8A 1R8BA 4OX9F 4HTIA 4XAKA 5KOWA 2KM8C 1LXJA 3UPFA 2C3UA 1SB6A 4LIWA 2JX2A 1FERA 1VRUA 2HGMA 1XNQF 4RW7B 2DGQA 1NO8A 1HWUA 4GC6A 4YEAA 4DL3A 2IRXA 4J5OA 1BQMB 4MIAA 1H6KX 3I32A 3MM7A 5B7WA 5F8LA 2VZ9A 4KBIA 4J9QA 3PY8A 4F3OA 5DQIA 2DGXA 1FEHA 2RD5C 3UNGC 5DQHA 5IZHA 2EK1A 5KT5A 1SL2A 1LWCB 4LF8F 2DNQA 4OJ1A 2MHNA 3V81A 4U67Q 2CYYA 4QQBA 4W92B 4QWBA 1L5UA 2ALZA 2DHXA 2ASDA 4F50A 2FLNA 5IQ6A 4UUWA 3C46A 4I7FB 3QWPA 1RA6A 4LIRA 2JC1A 2F4VF 3M8PB 2FGCA 3RU0A 2VA2A 1VRTB 1S1UB 2M4MA 3MD1A 4L6V3 4C11B 1S1XA 1VS3A 3OSPA 4Z37A 2JC0A 2KHDA 4A4JA 5I3QA 5KFAA 4PR6A 1UW4A 2DNPA 4IH5A 3C6TB 1N0UA 1HNIA 5J2MA 4IKAA 2E1CA 1QM9A 1VI7A 3AJ2A 1JMTA 3S6EA 3M30B 3DOLB 3QGIA 1TFWA 1JLBA 4JV5F 3T6BA 4QU6A 3PX6A 1K1QA 1LW2A 1MMNA 1U25A 1YJTA 4Y3CA 4QIGA 3OFHA 3QIDA 5MLCV 1KFDA 4G1QB 3NCPA 4OHWA 4DQRA 1D1UA 2FUG9 3GFYA 4FN5A 4TU7A 2HFZA 1UEUA 2MPUA 4A8OA 4Q43A 2B9XA 3DLEB 2ZHBA 2FHMA 2J6SA 3O3LA 3L7OA 3MM9B 3PRBA 5SZTA 4IOCQ 1WD6A 3QGHA 3Q2TC 2OP5A 3MPYA 2RSQA 4OHXA 3GIJA 2KHCA 2HHWA 3FZBA 3M6UA 1SKRA 4PXCA 3UW1A 1QUPA 3JYTB 2SXLA 4NA1A 4Y2AA 2XCPA 1D3WA 1OSDA 2R7XA 3DLGB 2XGQA 2B0GA 4F4WA 3FFIA 3D0IE 1TQLA 1Q79A 1RT4A 1IBLF 4Y0FA 1FXDA 3K8VA 5GVQA 1KONA 2Z2LA 4IG3A 2IHR1 2LA4A 3KLEB 4Y65A 1L3TA 5KFEA 4ED5A 1HHSA 1YSJA 3CC2S 3QAEA 2CPIA 4EFAC 2E5HA 4WF9Q 3KG4A 2D9PA 3NP5A 3T5LA 2M3DA 3RW7A 5M2RA 2UP1A 2C3YA 3GYNA 4DOZA 3PVXA 1S1WB 4CTAA 2RKIA 4JI7F 3IG1B 3MF5A 5AXMA 4ECXA 1LWEA 1SXLA 4XIUA 4WXOA 3T1YF 2PT0A 2O3DA 2BRLA 5KFKA 2OPSB 3OTEA 3EZUA 3MFHA 1IUJA 2D7SA 3CC4S 4NLTA 1QAYA 3CEDA 1YRXA 1BC6A 3JSMA 5IM0B 2DGWA 4LFBF 1BWEA 4ALZA 3DHXA 4O3NA 2V8VA 5DM7Q 4OJ3A 4USJC 2E5JA 1SV5B 3VF0B 3TANA 5D78A 5IT4A 2BUNA 1C0UB 1IQZA 3FQKA 4I56A 1UWBB 2KG1A 4K4SA 1FEEA 3IWLA 3BREA 3UCGA 3QAUA 5KFRA 5IWAF 4ZCLA 4IRDA 3ZZZA 3MAQA 4O3QA 2XULA 2WSFC 3H4BA 3IN5A 4RNNA 3HX9A 3BO2A 1N4LA 4A8FA 4WZMA 4I0WA 1FKPA 2ZKTA 2AJQA 2CPFA 3ZFVA 3GILA 5E7OB 1HI8A 2A1BA 3DU6A 3LOUA 3TVKA 1AFJA 3DCAA 2B4PA 3HPOA 3LALA 3QGGA 2MMYA 1H7WA 2N4DA 4MIWA 3OTBA 2DH7A 3P96A 2XS5A 5F8NA 2XI2A 2RMLA 2XEXA 3SCIE 2QA2A 4RW9A 4EUVA 5IFMA 5F9LA 2BBEA 2FC8A 3GV8B 2EI5A 2HW3A 4YOEA 1K0TA 4G6VB 2W24A 3NKYA 4QIWD 1FCAA 3OBIA 3SCJE 3U27A 4RBTA 1KEKA 4C0OC 4RWWA 2XMUA 3KK1B 3POTA 2NUHA 3CXCR 2BOPA 1FRHA 3TUIC 2HNZB 1IKWB 3G6YA 5DJBA 2B3TB 2CDQA 4RWXA 4JV2A 3LQVA 3IGNA 4ATNA 3HHLC 3BN4A 4N56A 1Q86T 2CPDA 5F8MA 2K3IA 1DQ9A 3J7ZT 3TAQA 2HQIA 3SI8A 1S9GB 5KFGA 2J9EA 1DRZA 5C42B 1JLGA 1NHVA 1E6VA 3QLHA 5LSOA 3N79A 4NLXA 3OLBA 1N36F 4KSEB 3OL9A 3QWUA 3MCSA 3HJFA 2XY5A 2J7WA 2OFGX 4FPRA 4ITSA 1C1BA 5J2NB 2VBZA 1XK8A 2EW9A 2LEPA 2YKPA 3NCRA 3ZZOA 1R8HA 3OLAA 1L3KA 1L3VA 2YWHA 5B09A 4UW2A 3OR1B 3CJ4A 1K73T 3MGJA 5K14A 2VKZG 2JLEA 2ZDOA 4WFBQ 3KLGA 3TUZC 1HNZF 5I42B 3E2EA 4I4BA 3O44A 1SL0A 2XI3A 1RJJA 1FVSA 2D41A 1TL4A 2HNDB 3NCQA 3RB3A 1TP7A 4ETXA 4RW4B 3DI6A 4KGMA 5GMKa 3W2WA 4F2SA 4WFZA 3CCTA 3SV4A 2JFKA 4HHJA 1YRTA 2ZE2B 4WXWA 4ERDA 2LQ5A 2EFQA 1XR7A 1BY9A 5KAKA 3G71S 2GMLA 5E3RA 3UWTA 2W9BB 1GX5A 2OTJS 4LF9F 3HVWA 2QRRA 2CPYA 3RAMA 2DD8S 5KFSA 3MI7X 4X4SA 1WTBA 1NJWA 1RTDA 4PQUB 4N76A 2LU1A 4KHMA 3I4PA 1PSDA 4IQXA 1IQTA 1T7PA 1ZH5A 2E1RA 3HF5A 3IAS9 2B7BB 2E1AA 3M8QA 3E51A 4X4OA 1PGZA 1X0PA 2R8IA 1VQYA 2GIQA 4B3OB 3M8SA 2J6UA 2RDJA 5AE3A 3FGVA 2B6AA 2R4FA 4ZP6A 4MYUA 3K57A 2RS2A 4HEA9 4B02A 4ECYA 4H4OB 3N6MA 5F0UA 1YI2S 3VAKA 1HBNA 4HYKA 4TU9A 2ACYA 2MZTA 4NPOA 3LP2A 3IA0A 3M2RA 1XMOF 2H9ZA 3GG0A 3Q8QB 4H4MB 4LF7F 1SUQB 1KHVA 3ITHA 1UL3A 4ICLA 3R5BA 4MIBA 1ZM9A 1N5TA 2COLA 1U8SA 3BSCA 2PMZD 2FVPA 4ECTA 1UFLA 1FJEB 3H25A 1XTZA 2NR0A 1Q82T 5KFLA 4C0BA 4GC7A 2XLKA 2VBYA 1JLEB 2VODA 2MZ1A 1SC6A 3AY0A 3W2VA 4ILRA 3HDSA 1TKXA 3J7A1 2YNIB 1CG2A 3HHLD 3AQOA 1WHYA 1OIAA 2AF6A 3KKFA 3CJKA 2V4JB 3KNAA 1IKYA 2E66A 4Q8FA 2OJ3A 3IWXA 4HT5A 3N6LA 3I0SA 4NRTA 1SKWA 3DM2A 1Q4RA 4FBUA 1HQUA 1GAOA 2RRNA 3L95X 1NB7A 2B4OA 3HKWA 2IM1A 5JUMA 1MMLA 5HLFB 4UQTA 3JB9k 1WI6A 3TAMA 3UR0A 2NREA 2PO4A 2DIUA 1R0AB 5CYJA 3JSBA 2KN4A 1G7CB 3KG0A 3PEHA 2RRBA 5KFOA 4N41A 4PG7A 1VIOA 1B7FA 1VK8A 2PE8A 4ID5A 2WAQD 2ZH5A 4NMLA 2EFNA 1RI7A 4F4ZA 3HHLA 3G8QA 5F9NA 4RUAA 3R3TA 3M1VB 4RX6A 4DDFA 2AX0A 2DGTA 3H20A 2QA1A 1FNOA 2L08A 2XY6A 3PKMA 3CIMA 1FKOB 3PFOA 1TK5A 3MTKA 5ITHA 5EDWA 2KJVA 2R7UA 3SQGB 1QLNA 3MR6A 5G0RB 4KB7A 2HRYA 1V3ZA 1IR0A 1X5SA 2KYXA 3WX4A 4F67A 2KFZA 1R31A 1RT2B 2JEJA 2FGOA 1U1LA 3CCUS 4IFVB 2IAJB 5KFFA 2E29A 4RW8B 5CH7B 5LL6d 2CQCA 2KRRA 3KLHB 4RW7A 2KRBA 1KNZA 1X9WA 1LFWA 1TL1A 1BQMA 2NPFA 2OPQB 1S6PB 4WYLA 1KVIA 3MFIA 3H98A 1NNDA 4G3IA 2IBOA 4UY85 5G4DA 2VPWB 1TZ0A 1S9FA 2LEBA 1LWCA 1R43A 4CO5A 1VHFA 2CQDA 4N77A 1VQOS 1S0OA 1WHVA 2CRLA 1KQFB 2ZC4A 4G1PA 2RF2B 4LSNA 3I56S 4DFKA 1U6FA 2RVJA 1QAJA 1FNMA 3M8RA 3VAJA 3PDNA 2XHWA 4DUYF 4KV8B 4NX9A 4I7FA 4HLBA 2V4RA 1N5QA 2DH8A 4JI1F 1S1TB 2BANB 2XBPA 4GO7X 4YR0A 1T8EA 4DQPA 2K8GA 3CCQS 2KZZA 2E7XA 4O3OA 3M8PA 1LV5A 3DRXA 1VRTA 2PIIA 1S1UA 3O1LA 3UDCA 4YMEA 1NJXA 3CD5A 2ZC3A 3B4DA 4C11A 1NJYA 4DEZA 4OI0A 3OTCA 2OPPB 2VASA 2DNYA 2FJDB 3DLJA 1FDNA 1E6YB 3CCRS 3C6TA 2F9DA 2UUWA 4QPXA 4DSKA 3D1QA 3CSKA 3SMZA 4K4WA 2DRBA 3M30A 1FNXH 3DOLA 1A6LA 4O0IA 2RQCA 2R8JA 4DWIA 4IH7A 3LF0A 3DLKB 3FEYB 4H4KA 4BWMA 2Q6BA 4WZQA 4NLOA 2FB0A 4TY9A 3O2IA 4G1QA 4Y2KA 2C42A 5KFHA 2O01C 3N6NA 2AGPA 1WF1A 4PXBA 1G3OA 1C1CB 2IC3B 3PJXA 2HHXA 3GMGA 1VFJA 5E3PA 3DLEA 1RTJB 4IO1A 5EUHA 1KHWA 4ZPBA 3Q0AA 3MM9A 3GG1A 2IRUA 5LXRA 2HLTA 1SIZA 3PW5A 1ZZNA 2RQMA 2GIRA 1NH8A 3KMSA 1HA1A 3ZZPA 3DLHA 5HP1B 4X4RA 3OL7A 3DXBA 4IDKB 3JYTA 2HNYB 1N34F 3CC7S 2DGSA 5HBMB 3MHYA 3DLGA 1X5TA 3C8YA 2CPZA 5KG4A 1WI8A 1X5PA 4OZLA 5JJBA 1VQ8S 1C4AA 1V9OA 2V9KA 4QPTA 5IS2A 3BSAA 2JHEA 1HARA 3BZQA 2XG8A 2L3MA 3UDLA 3U1NA 5A6PA 5JVHQ 4RBVA 1U45A 3KLEA 4NXMF 4TYBA 3CCWA 4ZPCA 2I5JB 3BGLA 3QGPA 2ZJPQ 4A8QA 4ECWA 1IBMF 4FBTA 3IRWP 3SDEB 3TA1A 1RT5B 2IYGA 4I1TA 3T5KA 2ZJQQ 1ZTWA 3MM6B 3IAM9 1S1WA 3AA9A 4IYQA 1S97A 1RA7A 4YFUA 3R1LA 1BQXA 3IG1A 1N8RT 2K7JA 2I38A 4NZ0A 4GKJF 2UV8G 3VQSA 3MMJA 1BQNB 1FRMA 1IKXB 1CVJA 2VL1A 2L41A 3G9CA 1KQKA 4A8WA 2ZITA 2OPSA 4I68A 4V19J 2HVZA 3NAHA 1QUVA 2DIVA 4CCHA 5IM0A 1SBRA 3FSXA 5M2UA 4TQSA 3Q8SB 3PW7A 4NLQA 4OZ0A 4N8NA 3TAPA 1N5YB 3M2VB 3QYYA 4KT0C 4ZCIA 2J6TA 1SV5A 1M5PC 1FK9B 4E0DA 3G8TA 4DL0C 1C0UA 1D9AA 1CSJA 2G1DA 1UWBA 5DG7A 4PUOB 4YUDA 4QWAA 2L9WA 4DQSA 1N88A 2KO1A 1NK9A 2CQHA 3CD6S 2AGOA 2ZH2A 1QTMA 3GZ7A 4QZVB 2X1FA 3H5XA 2FJWA 2R8HA 1TR0A 2B43A 2GMHA 4RU9A 3IR5B 1SL1A 5L1IA 1FE0A 1JXEA 1Q16B 1HW8A 3CDBA 1H38A 2QMWA 3U02A 5A8KB 4KQZA 3N9UC 3MMCB 1X4GA 3NLCA 2HVIA 1LK7A 4LFCF 1HYSB 5BJRA 1FJGF 2CPHA 2D3ZA 1QSSA 1NKEA 3TA0A 3PRDA 1B0VA 1B0TA 2XSJA 5FDLB 1TV6B 2LEAA 4EO8A 5B0EA 2HHTA 2JEIA 5D8HB 3CD7A 5KG1A 3KK1A 2ZBIA 2V4QA 2DVIA 2HNZA 3CWJA 1IKWA 1FT8A 4JI3F 3KOAA 5J1EB 1F60B 1TL5A 2RT3A 4MTPA 2I1RA 2PA3A 2QEXS 5KFMA 5LMNF 4FF2A 1NZAA 2M88A 1DAXA 4FP9A 3BQ1A 2BRKA 4ED7A 2CVEA 3IRXB 3MD3A 4ZCMA 1S9GA 5D4PA 1JXLA 2PFFB 3CJ3A 1RGVA 1N54B 1WG5A 1Q8BA 5C42A 3MEGB 1U26A 4O4GB 3NS6A 4IUFA 3SZ2A 1U48A 2JRSA 1D9DA 1KQSR 1U2RA 1GT8A 2YNHB 3M9OB 3MUTP 4B3SF 2RNEA 2XMWA