3KK3B

Hiv-1 reverse transcriptase-dna complex with gs-9148 terminated primer
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
427
structure length
407
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 96
structure length 407
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B04
4TQRA 3BGRB 3I0RB 5KFYA 1NHVA 1HQUA 2HNZA 5KFTA 1SH2A 5JXSA 3IN5A 4WZMA 1C0TB 4XPEA 1S48A 2AX1A 3EZUA 4KAIA 5KFWA 3BSAA 5CYMB 3NAIA 4ID5A 3CJ5A 3QZ8A 3FFIB 1JLEA 4MFBA 4LSNB 2IC3B 5HP1A 3EPGA 1HNIB 3KK2A 4DL3A 4R0EA 5K14A 3NAHA 1YVFA 1KHVA 3DM2A 4RNMA 2R8KA 2UVVA 3DLKA 2VG6A 2YNIA 5KFAA 1S0MA 4MK9A 4IFVA 1S9GA 3M8QB 1LW0A 3GQCA 3RB6A 4G3IA 4ZVEA 3HVWA 4WXWA 1REVB 4ZPAA 4YQWA 1FKOA 1LWFA 1JLGA 3LP2A 4WE1B 3RB4A 2IM3A 3H59A 3IRXA 2YKNB 5C42B 2VG7A 4ZVFA 1KLMA 5F8HA 4ED0A 3PR4A 5D3GB 5KT7A 5KG5A 2E9RX 2V4QA 3H5SA 1N56A 3DOKB 3ITHB 3BGRA 3DMJA 4NLWA 3GIJA 3I0RA 5J2PA 4O4GA 2JEFA 4WYWA 4J9NA 4TY8A 3T1AA 4DL7A 4RW7A 2W9CB 3KHGA 4FS1A 3T5KA 3Q8PB 3FQLA 3RB0A 4JV2A 4O44A 3FFIA 2ATLA 4F50A 1K1SA 1DTQA 4LSNA 2ILYA 2IC3A 2YNFB 3ISNC 4O3NA 1HNIA 1RA7A 3T5HA 2FVQA 2R8IA 4NYZA 5F8GA 4ECZA 2WB4A 1LWCA 3NBPB 3TQ1A 5FDLB 3LAMA 1XR5A 1BQMB 2AU0A 5L1JA 3M8QA 4ZP9A 4OL8A 5EUHA 2RDIA 1REVA 1S1UB 1HARA 1N5YB 3OSPA 1RT2B 3OHAA 3V6KA 4NLUA 3MR5A 4M94A 3KLIB 1GX5A 5KFKA 3RAQA 1RTIB 5DQGA 3LAKA 3ITHA 4KV8B 1JXLA 1JIHA 3KJVB 4DL4A 5F9LA 1RA6A 3D5MA 4ZVGA 1S6PB 3DRSB 1EETB 4ICLB 1N6QB 2W9CA 2OPQA 5I42B 4QW8A 3T5LA 1SV5A 4PWDB 2OPRB 2HNDB 2R2UA 4DEZA 4YMEA 3OL8A 2RF2B 1RTJB 2HNYB 4IOBA 3PW2A 4RW4A 2YNFA 4NLSA 3OLAA 1RTDB 4JUZA 5KT2A 4RNHA 4RNFA 3TVKA 3NBPA 4RNOA 1S1WB 4ED8A 4WFZA 4ED1A 5FDLA 1I6JA 1BQMA 1TKTB 2B6AA 2D41A 2W8KA 3DRRB 3ISND 4Q8EA 4TYBA 3DOLA 4Y3CA 4Q8FA 3NMAA 2ASDA 1RT4B 5J1EA 1TKZB 3PVXA 2YNHA 4M95A 1IKYB 5F8NA 2CJQA 1RT2A 4J9PA 2W7OA 1JLBB 1S1VB 1IKXB 5KFRA 3I0SB 4ZMMA 2RKIA 3JSMB 1JX4A 1IM4A 1IKVB 1VRTB 4XO0A 5I3UB 3KHRA 4PUOB 4I2PB 4DL6A 3H5YA 5KFVA 3DDKA 2FLLA 4NCGB 5F8IA 1IKWB 3KLEB 4ZVHA 4K4XA 4WZQA 4NLDA 4ICLA 2W9AA 3KLFB 2FVSA 1TL1B 1C1BB 3FRZA 4O4RA 3E01B 2W9BB 2W8LA 2WONB 1TKXB 5I42A 3UPFA 1BQNB 2OPRA 3PW0A 3DI6B 5HLFB 2C2DA 4ECQA 2RF2A 4MK8A 1RTJA 1VRUB 2ZE2B 3FDSA 1EP4B 5C25B 4B3OA 1RT6B 3CDUA 1TV6B 4RW8B 4KB7A 4TXSA 5KG1A 2XCAA 3KMQA 4ECVA 5J2MA 4IKAA 1NNDA 1N4LA 1RTDA 3IGVA 4KBIA 3OL6A 4EBDA 3M8PA 3KLGB 3DYAB 5EWFA 4Q43A 1S1WA 4KE5A 4LQ3A 4Y2AA 2JLEA 2D3ZA 3I5CA 3FQKA 3D28A 1W25A 1TKTA 3QO9B 4I2QA 3DRRA 2F8EX 1HNVA 3OSNA 1UWBA 2V0NA 2V9WA 2FJXA 2I1RA 2XGPA 4WFYA 3GIIA 4IQXA 4ZHRB 1RT4A 4IH5A 4QWAA 1IKYA 3HVTB 3KOAA 1RT5A 1JLBA 4KKOB 1IKXA 1HYSB 3I0SA 5KFPA 3ICLA 3QIDA 2D7SA 4XPCA 3RAXA 3JSMA 4ZPDA 4EYIB 3MEEB 1DTTA 1SH3A 4TN2A 2AGOA 4I2PA 3LP1B 4R8UA 3DLEA 3IG1A 2JEIA 4NCGA 1DLOA 5KT5A 1IKWA 3KLEA 3PW5A 4H4OB 3M9MB 2BR0A 3KLFA 1TL1A 1C1BA 3E01A 2W9BA 2WONA 3BSNA 1SUQA 2YNGB 3MEGB 1RT7B 4R5PA 3DI6A 3N6MA 4URGA 1RAJA 4F4YA 1MU2B 3HKWA 1JLFB 3JYTB 4K4TA 1S0NA 3BR9A 4FS2A 2R2TA 1T3NA 3UQSA 4IR9A 5C25A 4IDKB 3V81B 3GILA 1TV6A 1XR6A 2R2RA 3DRPB 5EDWA 1C0TA 2FVRA 3BREA 4JV1A 4ZPBA 2FVCA 2GIRA 3KLGA 3DYAA 1LW2B 5CYMA 4WXOA 4ZP6A 2XC9A 2ZD1B 3V6JA 4EO8A 4H4MB 2IM0A 4U7CA 3Q8RB 1LWEB 2JC1A 3M9NB 2WHOA 2OPPB 2OPSB 3H4DA 2UVWA 5KFMA 5KFFA 4O3RA 1JLQB 5KFCA 2BE2B 2DPIA 5F8MA 5KT6A 2WOMB 5J2QB 4IG3B 2VG5B 4KKOA 4Q0BB 3CVKA 3RBEA 1HYSA 2UVUA 3BSOA 4RW6B 3KLHB 4Y2CA 3MEDB 5KFGA 3MF5A 4LSLB 5L9XA 3MFIA 2D3UA 3HVAA 3H4BA 4FBTA 4O3SA 4ZP8A 4H4OA 4WE1A 3KMSA 4MK7A 5KFLA 3MFHA 4K4ZA 1RT1B 5C24B 2VA3A 2ALZA 2YKNA 5C42A 2YNGA 1RT7A 2J6TA 3IS9B 5D3GA 4PQUB 2XWYA 4O3QA 4J9LA 2BRLA 2E9ZA 1JLCB 1MU2A 5KG7A 5DLGA 3DOKA 3JYTA 2WK4A 2FVPA 1RT3B 4ZP7A 3Q8QB 4IDKA 2WRMA 1RYSA 4G1QB 3C6TB 3T19A 3TAMB 1R0AB 1OS5A 1S4FA 2CKWA 4IG0B 1S49A 3CJ2A 3H2LA 3MTKA 5KFIA 4YR0A 5L1IA 4MKBA 4J9MA 1Z4UA 2ASLA 1C1CB 4QWBA 1ZTTA 3MR6A 1N48A 2DPJA 2AX0A 5KG2A 3H5UA 3BQ1A 4RUAA 1NHUA 1S1TB 4ECUA 3RB3A 3QLHB 3H40A 3OHBA 3GYNA 3V6HA 2OPPA 2JEJA 4NLVA 5C5JA 1S9FA 5HROB 3CIZA 4ZPCA 1TP7A 2UUTA 3QIPB 1FK9B 4TQSA 2O5DA 4H54A 2R8JA 2BE2A 2I5JB 1T05B 4URSA 3V4IB 4IRCA 2WOMA 5J2QA 1RTHB 2VG5A 4Q0BA 4ED7A 4NLOA 4HKQA 4RW6A 3FSIA 5DGBA 1SH0A 3Q8SB 3C6UB 3V6DB 3QGGA 3GV8B 4ED6A 4KFBB 3EPIA 3H98A 1S1UA 4URQU 4QWDA 4JV0A 2V4RA 4IRDA 1KHWA 1RT1A 1N5YA 3LANA 4RUCA 2C22A 5L1KA 1TL3B 3IS9A 3KLIA 1XR7A 3LP0B 3SFUA 1RTIA 1HQUB 2HNZB 2IJNA 4KV8A 4EBCA 4NRTA 5KFUA 4YR2A 1RT3A 2RDJA 3KJVA 2ASJA 2YKMB 3TAMA 3C6TA 4IFYB 1R0AA 4NLXA 5EWGA 4ID5B 1S6PA 3UR0A 3DRSA 1EETA 1QAJA 1N6QA 2WCXA 1C1CA 4Y34A 4K4WA 4Q45A 1JLEB 4MFBB 4RW9B 4PWDA 3PR5B 2HNDA 2R2SA 2FLPA 2E9TA 1U09A 5HP1B 3QLHA 3KK2B 4RZRA 2HNYA 4K4SA 4WYLA 4U6PA 1JKHB 1C0UB 5K14B 4IR1A 5HROA 4ECTA 2R8HA 5KFHA 5KFOA 2B43A 3DM2B 2HAIA 5F8JA 3IGNA 4TY9A 2VG6B 1T05A 2XCPA 4KSEB 3V4IA 1J5OB 4KHRA 4IFVB 4ED2A 2AGQA 4Q44A 1RTHA 3QZ7A 2JEGA 5DQHA 4QW9A 4KHMA 1LW0B 4J9OA 3BQ0A 1FKOB 1JLGB 3C6UA 3LP2B 1ZTWA 2IJFA 5KFZA 1S10A 3IRXB 3PW4A 5DG7A 4KFBA 2AQ4A 1KLMB 1TKZA 3GV7B 2R8GA 3DMJB 1S1VA 1TL3A 1CSJA 4QPXA 2B5JB 5KFBA 3LP0A 5J2PB 4O4GB 4F4XA 1S0OA 1JLAB 1IKVA 1VRTA 3BJYA 5I3UA 4TLRA 4PUOA 1S1XB 3G86A 4TY8B 1HMVB 4RW7B 2YKMA 4LQ9A 4RNNA 4IFYA 4J9QA 1HQEB 1S6QB 5KFNA 4O44B 4YP3A 2J6UA 1DTQB 1TKXA 4RW9A 4MKAA 1BQNA 5HLFA 1ZETA 3DLGB 5L1LA 3CWJA 1VRUA 2ZE2A 1JKHA 1TVRB 1EP4A 2BANB 1C0UA 2IA6A 5T14A 1RT6A 2IAJB 3PW7A 4RW8A 1LWCB 4YR3A 3LALA 4IRKA 1J5OA 4F4WA 4HYKA 4NLQA 3G6XA 2ZKUA 4NLPA 5KG0A 3NKYA 3QO9A 4RU9A 2GIQA 5KFDA 5HBMB 3QYYA 4GC6A 4QWCA 4DG1B 1RYRA 4ZHRA 5KG3A 3VQSA 4ECYA 4EYHB 3HHKA 3HVTA 3N6NA 4EO6A 2BQ3A 3QGHA 3PJWA 5EWEA 3CDEA 4KO0B 2B5JA 5KT3A 4I7FB 1WNEA 1T03B 4O3OA 3MEEA 1JLAA 3OL7A 4GC7A 1S97A 3GIMA 3MECB 5DG9A 1FKPB 1S1XA 3LP1A 1HMVA 5DGAA 3PJXA 4DL5A 2OPQB 2OH2A 2ILZA 1HQEA 1S6QA 4ECSA 1RDRA 4EBEA 1SV5B 4NLTA 1HPZB 4F4ZA 5DLFA 3MEGA 4RW4B 4MIBA 3UDLA 3DLGA 3OL9A 1JLFA 3CJ4A 2FJVA 3T5JA 1TVRA 2BANA 5CYQB 4NLYA 3V81A 2IAJA 3PZPA 3KNAA 2C2RA 3KK1B 2IMWP 2C2EA 3DRPA 2HMIB 2QV6A 4K4YA 4ECWA 2AWZA 2B6AB 3OLBA 1LW2A 1T94A 3PHEA 4WFXA 5DG8A 2ZD1A 4NZ0A 5DQIA 2J6SA 4H4MA 4K4UA 1C2PA 1LWEA 4J9RA 3DOLB 1S9EB 1QAIA 4TYAA 5KFQA 4X2BA 2OPSA 5HBMA 5J1EB 2YNHB 2BRKA 1JLQA 4DG1A 3MR3A 4QWEA 4MH8A 2IM1A 4NRUA 5KFEA 3SFGA 4NLGA 2RKIB 3E51A 2C28A 3BSCA 4IG3A 5KT4A 3NGDA 4KO0A 3G6YA 3KK3B 4I7FA 3CDWA 3KLHA 5KFXA 1T03A 2GC8A 3MEDA 3BQ2A 2BQUA 5KFJA 4O3PA 3MECA 4LSLA 1FKPA 2FLNA 3KLVA 4ECXA 2UVRA 2XI2A 3SI8A 1QE1B 2IM2A 5J2NB 5KG4A 5C24A 3CJ0A 1HPZA 3I5AA 2UUWA 4PQUA 2FJWA 5F9NA 4B3OB 3G6VA 3KHHA 4IH7A 1JLCA 1GX6A 2XGQA 4IH6A 2WTFA 5J2MB 5F8LA 2IBKA 5JUMA 5CYQA 3I5BA 5KFSA 4K50A 3M8PB 4G1QA 3KK1A 2W7PA 4IG0A 3NL0A 2HMIA 4K4VA 3M9OB 3N6LA 3RBDA 1MMLA 1D0EA 4I2QB 1D1UA 1S1TA 3H5XA 1HNVB 4NLRA 1UWBB 1S9EA 4FBUA 4ECRA 5KG6A 3KHLA 4ED3A 2JC0A 2HWIA 2QE5A 2VA2A 3QIPA 1FK9A 1RT5B 4J9KA 2EC0A 3DLKB 2I5JA 2YNIB 1DTTB 1S9GB 4MIAA 2HWHA 4DL2A 4EEYA 4R8UB 3KK3A 3DLEB 3IG1B 4J9SA 1DLOB 2AGPA 1QUVA 1LWFB 3V6DA 3GV5B 3MR2A 1SUQB 2VG7B 1QE1A 4R5PB 3CO9A 2BQRA 3CJ3A 5J2NA 2XI3A 3GIKA 3QGIA 1TQLA 1K1QA
chains in the Genus database with same CATH superfamily
3BGRB 3SQOP 4YDDB 3TRGA 3ONQA 4WZMA 1SPBP 1OSCA 2RRAA 1RAOA 5AJ3F 2QG9B 2ROEA 2I0XA 1RU2A 4RNMA 1GT8A 2JFDA 3GG0A 1M1HA 1UZDA 4EUVA 3LP2A 3RB4A 3AB2B 4ZVFA 2X51A 3MMJA 4JYAF 1NZAA 4FPRA 2QA4S 1TL4A 2ZM6J 3DGPA 3SDEB 5ADZA 4ZVTB 2QLXA 1NSQA 3V2UC 1UETA 3TQ1A 4C97A 1B4SA 3EWGA 4WCEQ 4WF9Q 2IRXA 4RBVA 1CJUB 2CPFA 5F3ZA 1Q4RA 3RRGA 4ICLB 4M5MA 3IAS9 4DR5J 1KTQA 5CD4A 1NZ8A 5A8KA 1KBRA 1FTCA 2B6AA 3OR2B 1IR0A 5LJ5Y 4TYBA 2UUBJ 2MLYA 5DDQC 2DH9A 1BQXA 4MT1A 1IKXB 2VV5A 3MCMA 5I3UB 2MY7A 2CQIA 5F8IA 3FRZA 4K0KJ 3MPUB 3GCXP 5HLFB 3PEJA 3KJFB 4FXDA 1RKIA 2NZCA 4LIWA 1H7WA 1JNRB 2NXNA 4EBDA 2CXEA 4NEYA 4OV6A 3KYLA 1U02A 2N7YA 4MJKA 3CC7S 4QWAA 3N0VA 2HQGA 1R8CA 2P9GA 2Y1LB 4M5LA 3PW5A 3D1OA 2PMZD 1RT7B 2R7TA 4QIGA 3OVSA 2FZKB 2DR8A 2MZRA 3K5MA 1UA0A 2WW4A 3KLGA 2GQCA 4X4SA 2FJAB 3PYDA 4A4JA 1SL2A 4OZNA 2V2QA 1DURA 1HYSA 2H51B 3BSOA 4EWTA 3MF5A 1IQTA 2D3UA 2QRRA 2V4JB 1KTVA 2H1YA 3HZEA 2VA3A 5C24B 1YBTA 4X4VA 2GIFA 1JB0C 2BRLA 2MJUA 2DO4A 1UPPA 3W62A 4ZP7A 4IDKA 2XSJB 4LFCJ 1AZSA 2R7RA 1RABB 2AX0A 1NSPA 4RUAA 2Y8YA 3H40A 4P2FA 3CIZA 4X64F 4PG8A 1SKSA 3A8KA 2AMCB 2CQ2A 2DR7A 5J2QA 4ED7A 1N52B 2VPZB 1HBOA 2O67A 4DR3J 1H3DA 1HI0P 1TL3B 2OIHA 5KFUA 3TAMA 1TK8A 2UXBF 3OFGA 4FF3A 5CXTA 5IV4A 4MFBB 4N47A 3PR5B 2R2SA 2N3OA 2FJDB 2IIHA 1WOSA 3V4IA 2CDQA 1NDCA 2DD8S 2GJ2A 5L9NA 3IRXB 3NS7B 5A2QY 3RR8A 4W92B 2X1FA 4Z7YA 3I32A 1LXJA 4RUBA 1HQEB 1FFWB 3VALA 3OPKA 4YP3A 2QL5B 2HHXA 3DNCA 1DRZA 3NWRA 4DS4A 2LCWA 2KYZA 4HYKA 3NKYA 4RU9A 1SL0A 4P7TA 1CJKB 2B3TB 1YZ6A 3THTA 1A9NB 3EXYA 4EO6A 3ZNUA 5DJBA 1HKAA 3MECB 1ULRA 1F2GA 1CJVB 2MYFA 4PXBA 3OL9A 2PMWA 1RHMB 3MM9A 2HMIB 4K4YA 4LR7A 1T94A 3D1HA 1UAWA 1RWOB 4K4UA 3L7PA 1LWEA 3SQGB 5DM6Q 1KEKA 2ZZTA 2PD1A 4BBYA 4F0MA 3SI8A 4U8YA 1NBEB 2RD5C 2VUGA 1EIYB 2KM8C 5CYQA 4K50A 3KTQA 1O0PA 2HZVA 3AD8C 2QSFA 1FKAF 3GR0A 4AXJA 4K2XA 3PKMA 4FBUA 5KG6A 2QE5A 2ZJPQ 4PXCA 2ROGA 3BEGB 4CLLA 1F3VA 3FUYA 3KK3A 3BV8A 3WIUA 1SUQB 2VG7B 3UD4P 3MMBA 4LF4F 5KG2A 1F3FA 3I0RB 4Q2LA 5A6WA 4ZKAA 2HNZA 5JXSA 3IN5A 1S48A 5B0CA 2DHGA 1KS2A 3MCOA 2VOPA 3ZO7A 3L3CA 1AFJA 3DU6A 3PYGA 2DVIA 3J81Y 1WOPA 2MY8A 3F44A 3L7UA 2KTQA 1VQKS 1SKUB 4DCJB 4KGXB 1K9MT 1DHMA 4CLPA 3RB6A 3RUBL 3EJMA 2LDYA 4LRFA 4AL6A 2CFXA 5KT7A 2BMBA 5ETTA 3VAJA 2EFNA 3GB0A 5HQ8A 2LP4A 2VASA 3UN5A 1OWXA 2NS1B 1MWQA 5T41A 1RA7A 4NYZA 3I4HX 1LWCA 2HLUA 4KRWA 1Q1KA 3G9CA 4OL8A 1NH8A 1H7XA 1HA1A 4NWBA 4M63A 1HNXF 1IM6A 2PI5A 3DRSB 4LT6A 2FTRA 1QAYA 2D3O1 2DNZA 4PPDA 5D0GA 1TU0B 4MMOA 4NYOA 1A7GE 3PX0A 4OX9F 5A0YB 2E66A 3JAMU 2ZH9A 1Q82T 3KG4A 5KFRA 1T02A 3EGVA 2FHKA 4OYOA 4CWBA 2NPIA 4OFZA 4NCGB 4WZQA 3PFEA 1VJQA 3R6LB 5I42A 1EP4B 2QSWA 3BYPA 2YQ3A 3ZZPA 4NZ7A 4ECVA 8ATCB 2ZWPA 1X4FA 1RTZA 2FB0A 3DRRA 4ZLJA 1P6TA 1ZM3A 3AFGA 4Y00A 1XMQJ 2D7SA 4OYPA 4N7TA 4EYIB 1SH3A 2F65A 4I2PA 2DGTA 1IBLJ 2QX0A 4CQ1A 1G7CB 3KLFA 1NRKA 4R5PA 3N6MA 2FHOB 5AE2A 3CO0P 3BR9A 2R2RA 1N0UA 2FVCA 2ZD1B 1ZAXA 2DXDA 1WUUA 2BE2B 1N36J 3TEHB 5F8MA 3RBEA 1EB0A 1UL3A 3FSXA 2UVUA 3FCWA 1FJGJ 2ZC4A 1U2FA 4G1QB 1L3SA 4DMZA 1YJRA 4ZK7M 3CJTA 4ECUA 3OHBA 4NI2B 5C5JA 2MJNA 2RDDA 1NK0A 4ZCIA 4H54A 2R8JA 4URSA 1RTHB 3W66A 2ZBQA 1FNMA 4ED6A 3P5BP 4QWDA 3UDCA 4C8YA 2DITA 4WIQA 3E8OA 1TAQA 2HFUA 2HW3A 2Y9HA 5LSLA 3QLHA 4GO5X 5B0DA 3IGNA 2OH2A 3ZNJ1 4ZPTR 3QMQA 5DQHA 2WVFA 3M6VA 1JLGB 4MYUA 2YX4A 3SCIE 3EE3A 3AJ2A 2RJZA 4YEAA 2FQQB 2DNLA 4O4GB 1KDNA 3IRWP 1B7YB 4GVBA 4PUOA 3CJSA 3BF4A 2BABA 4Y0FA 4L74A 1DTQB 2EBEA 1B0PA 2J9DA 4JI8F 3ZTPA 2PIIA 1ZZNA 1TVRB 4ZJOA 1VQSA 4XIUA 2W24A 1WHVA 3VV2B 2ZKUA 4DSFA 1P9YA 1PBAA 1I94J 3QO9A 4F3OA 4F2SA 1NJXA 4DV7F 4DG1B 3G82B 1RYRA 2UXDJ 1ZPWX 3NNAA 3N6NA 3CJRA 2MKCA 1YHQS 3MEKA 1T03B 3CCJS 1WEYA 1UJ6A 2LLZA 1QAXA 4LF5F 1RU1A 3DLGA 1JLFA 4GKJJ 1UEUA 3DLJA 2XY5A 3EUNA 3T1YJ 1YK9A 3HHLD 4CLYA 2G0CA 2LVWA 1TMMA 3VQTA 4F26A 2BRKA 5DDOC 4NLGA 4WIIA 2KJVA 3TUPA 1PAUB 5IT9U 5GMDA 4B9MA 4IH6A 4JI5F 4FYVB 3H5XA 1FJEB 1UWBB 1SL1A 2H9ZA 1WC0A 2OO4A 1SI9A 3FNNA 2FZGB 2HQFA 2BA9A 5HSPA 2I38A 3IG1B 3CO9A 2UV8A 2XI3A 4KGZB 4DCPB 1FRLA 1HQUA 2DEJA 5CZXA 1YBAA 5CYMB 3W5XA 3WZ0A 2W25A 2IC3B 3ELHA 3GIRA 1HNIB 3PV8A 2C3YA 5K14A 1SCJB 2Z30B 2V8GA 4FN5A 4FNIA 3R5GA 2MQOA 5ETNA 3R8YA 1FNXH 1REVB 1FKOA 2JJ4D 2Q6CA 2D3OR 3TUZC 1CLFA 3PR4A 3DOKB 3IWLA 1YJ9S 3VAFA 3T5KA 2B8QA 5H9EJ 4B3MJ 3AH6A 4LF9F 3ISNC 2OGUA 2K1RA 3M2UA 2CNOB 2WB4A 1SC6A 4P2XA 1L3KA 1Q8KA 2DXEA 1WI8A 2HEKA 2YKQA 4CO0A 4DUZJ 1NPPA 4DI6A 4KV8B 4ILMA 2NXEA 2XYHB 3K17A 4JI2F 4DL4A 1IXKA 4CH7A 1IBKF 4X65J 1WTFA 5M2RA 1MLAA 4C98A 5HVFA 2DNHA 4LREA 4Q8FA 1IM4A 3GFHA 5KFVA 5BYSA 1FFGB 2HRUA 2X1AA 3DI6B 3VVTA 1VRUB 4KB7A 1TV6B 3OQ2A 4LQ3A 1OPZA 1W25A 2DHSA 2DY9A 2OEKA 3OSNA 3KJQB 2XSFA 3KOAA 3KWMA 3ICLA 1XMOJ 3JSMA 4UT4A 3QSIA 2NREA 4ETXA 1TL1A 1U8WA 3BSNA 2RMLA 3MEGB 1K44A 5LSOA 4HL9A 1S0NA 1LOUA 4FS2A 4QPTA 2RIJA 1UWAA 2WHOA 4K8RA 2XB2D 4GO7X 2HQ3A 4O3RA 2KZZA 2ZM6F 3MM6A 4CDIA 5KFGA 3MFIA 3H4BA 5KFLA 3MFHA 3LPYA 2YKNA 2YNGA 3IS9B 2XWYA 1MU2A 1M5HA 2VFRA 2R4FA 5KFIA 4B3RJ 1LKZA 3ZTQA 4RPFA 3H5UA 3Q2SC 3M2RA 1N5SA 2KDOA 3BH7B 3HHLB 2IYIA 4NXMJ 1TP7A 1L5UA 2QN6B 1M90T 4Q0BA 4ANDA 3W9JA 1NK8A 5A6PA 4IRDA 5GAHU 3LO3A 1F5AA 1RTIA 4CT9A 4YR2A 1RT3A 3WBZA 3KJVA 1H73A 2R7VA 1U09A 4K0KF 2XMMA 2AW0A 5KFOA 4DPXA 1RBLA 4QIWD 3LP2B 2IJFA 3MM7B 5KFZA 1EJ7L 2E5IA 3PW4A 1FO1A 1TKZA 2B51A 2Q43A 4OZ1A 4CNZA 3AT1B 4DWIA 3PW7A 3MAQA 1UJ4A 1HHSA 2AYEA 4CT8A 4AT1B 4GC6A 4PCQA 2MQ8A 5JMNA 5H9EK 3D7SB 2U1AA 3CDEA 2B5JA 4I7FB 4O3OA 4FKYA 4ZVOB 3HT3A 1S6QA 4NLTA 4PG6A 1MROB 1OYEA 2RH3A 1U0SA 2FGOA 3TWZA 3PZPA 3KNAA 3HHEA 2B6AB 2J6SA 2Y1RI 4UOFA 4LFCF 1GFWB 4YB5A 5B7WA 3OR1A 2ZC3A 4NEZA 4IG3A 2AGPA 3LPEA 4RKUC 5KFJA 1E6VA 3KLVA 5CD4H 2VB6A 1YJUA 2KXNB 1WG4A 2Q6BA 4EK2A 4DR3F 5HJYA 5JVGQ 3I5BA 3K58A 4PZVA 3FCVA 3RBDA 3H2VE 1YWXA 2MZJA 3OW2R 2FD2A 4JI0J 2CZ9A 4OI3A 5IOLA 2H5EA 2HGNA 2CDRB 3WQPA 4DPUA 1QE1A 1WHYA 3ETOA 4DU8A 3HFZB 1NH7A 5KTQA 3Q0AA 4HI2A 3BSAA 4RL1A 2A1BA 1T3OA 5DS7A 3CCUS 2XO7A 2HGMA 3W9IA 4MK9A 3W9HA 1QDUB 3BR8A 2IVMA 3RAMA 4LVOP 2J0XA 3DMJA 1WDDA 1RHUB 1AZSB 4Z37A 3VAKA 3Q8PB 2KFZA 2DYAA 2DNOA 3T5HA 4KHPF 1NJZA 1IJEB 4JB8B 1Q53A 4X4TA 1A0OB 4HT5A 3W3SA 3H90A 2VFTA 1Q79A 4QBUA 2QIFA 3OSPA 1X4CA 2E5GA 1E6YA 3Q8YA 4C8OA 3S7RA 4B3TJ 2DGSA 3AJDA 2YWHA 2CJ9A 4XDCA 1IR1A 4BC7A 3PW2A 2Z2YB 4DCOB 3OLAA 1MN9A 3C19A 4RNFA 1QSYA 1HI1A 4Y2MA 4NA2A 3NLCA 4X4NA 3M4XA 5GAHI 2Z2LA 2W2PP 1RT2A 3FVYA 4ZIWA 3C15B 5LSRA 4KGKA 2E5HA 1AROP 4NLDA 4FVCA 2GAHC 4X4RA 4Y6IA 1NCLA 4HHHA 1R43A 3IGVA 2ZJQQ 4I2QA 1EARA 3EXCX 3OFFA 2FJXA 2XBPA 4WFYA 3AXMA 1WC4A 2QJ3A 4ZVRB 2P5VA 2BJ8A 3QBCA 4J9VA 1C1BA 2DNYA 2CQPA 3IO1A 3GLJA 4KR0B 3SMZA 3MM9B 3AB4B 2A18A 4IO1A 4LRCA 3V6JA 3M8YA 3ET6A 1LWEB 2AV5A 2B7CB 3AAWB 2NYHA 4P72A 3CD5A 3MTJA 5L9XA 2FUG9 1D9AA 3S6EA 1N5VA 4J9LA 2CQ3A 5FLXY 3JYTA 4TVAB 5B08A 3FJ2A 1RCXB 3C6TB 2VJVA 3AODA 2LDIA 1HHTP 2HBYB 2ZBRA 1FVQA 1ZOTA 5HROB 2HS3A 2M9KA 4IRCA 5IT4A 3QRPA 4EGLA 3CCES 3Q24A 3LW5C 3C6UB 1IVZA 2AEFA 2MZSA 3MMBB 1NKBA 2V4RA 1KHWA 4DR7F 4DDFA 1N5YA 2VC1A 2EFVA 2HNZB 3VAMA 4M5KA 4EBCA 1M5OC 1R0AA 3UR0A 2WCXA 4K4WA 2HNDA 3MD1A 1C0UB 1UFWA 2R8HA 1M5KC 3DDNA 4ZJLA 3CCTA 3OJSA 2D69A 5ETPA 2HKEA 4L75A 3WHIA 3BQ0A 2VJUA 4C48A 4C4WA 4UY85 3IM8A 4OHXA 1S0OA 2W2QP 1H2TZ 5LOQA 1N0VC 2O01C 4EI2A 2DCUB 2R7OA 3GONA 1IBLF 2V2ZA 4KIAA 1GTEA 3EGWB 3CXCR 5D6GA 1LWCB 4A8XA 4NLQA 3I6PA 1S6OA 3ZTOA 4QWCA 2AZ3A 5ETOA 2MKHA 2BQ3A 4DR6J 2W01A 1WNEA 2LECA 4CZCA 1N36F 5DG9A 1FKPB 3LP1A 3IBWA 3HKZD 3D6MB 2OHDA 3IR6B 1FJGF 4OJHA 4AL7A 2RRNA 2C2RA 4CO1A 3ZC4A 3BGOP 1DZ5A 3OLBA 4WFXA 3G71S 1WORA 3BYRA 1C2PA 5KFQA 3NS6A 2HVZA 4FPIA 1YGYA 1VBXA 3SFGA 3N5BA 2LQ8A 3SEOA 3M30A 3DXBA 2J9EA 1R8AA 4B3SJ 2OP5A 2MQQA 1XIQA 2GV1A 1H72C 2BW2A 4H4KA 5JUMA 5KFSA 1NEEA 4IG0A 2KT3A 3M9OB 3EX7B 4OJ3A 3W8PA 1YX2A 3IAM9 4MTPA 1KNZA 3CMQA 4ZS6A 2M8HA 2GVDA 4DN0A 3LOUA 2RQ4A 1B70B 2E44A 3CCZA 4DQIA 3K5PA 4LR8A 4R5PB 2KVQE 1TFWA 4WYWA 3M6WA 4L72B 4OI4A 4BC9A 3I4PA 5DETA 3CD7A 1F5BA 4LSNB 2XYPB 2RQCA 1AXQA 1PILA 3EPGA 1U1KA 3NAHA 1PIEA 3TAPA 4C0BA 1NHKL 3BDEA 1W2BR 1XNQJ 2F8HA 3N9UC 3H5SA 2SXLA 3BGRA 2UXDF 2X7IA 4DR1J 1KVKA 4DL7A 1HBNB 2AZ1A 4JV2A 2KN4A 2N3LA 1F1BB 4P6QA 1XR5A 4GKJF 1BQMB 1NO8A 1K47A 4DBQA 3M1VA 3R6GB 1HARA 3T1YF 1H38A 5IS2A 3N5FA 2N4CA 4OYBA 2KH9A 5U47A 1X9SA 1JIHA 2NXCA 1B7FA 3IM9A 4ES2A 2BJ7A 4CM0A 3PHTA 4FXWA 2ZVIA 4CLZA 1KVIA 4FF2A 4ED1A 1VQ5S 2PA8D 4QIVA 1BLUA 1MW7A 2V8VA 3OFEA 2D1CA 1C4AA 3I0SB 4PUOB 4ZITA 2CG4A 3DDKA 2Z2MA 2KXHA 4ICLA 1X0FA 2W8LA 3JTNA 1V5IB 4B3OA 4CH1A 2DR5A 5J2MA 1N4LA 4J37A 5EWFA 1VK3A 3QO9B 2D9PA 4OLOA 4KQZA 3F41A 2V9WA 2I1RA 2XGPA 2WB1D 3FCHA 3M2VA 2CPYA 1IKXA 3LGNA 1XEZA 4XPCA 4TN2A 1FRIA 1M5PC 3DLEA 4KGVB 5BXIA 3A12A 5F41A 3OV7A 1JLFB 1PSDA 1WF0A 2XC9A 1RAIB 4WU3A 3Q8RB 1D9DA 2UXCJ 3V4MA 5KFFA 1GXUA 2F3JA 1YTYA 5IWAJ 1X8DA 3UFCX 3B4DA 4UOHA 1IBMF 1OIAA 1RT7A 2IRYA 2E9ZA 3SBMA 3MUTP 3W8GA 3M6UA 4DUZF 1S0VA 1N48A 4QWBA 3TYTA 2GHVC 5CCLA 2I2YA 3KUEA 1B0VA 3JSYA 2Z4PA 2WW8A 2PDAA 4JI3J 2V4JA 3EPIA 1S1UA 3THVA 3O1LA 5HJXA 1HI8A 2W4PA 3SFUA 1HQUB 2XSJA 1PAEX 4G1IA 2FY1A 2MTLA 4DR4J 3P8BB 1VQ4S 1X5SA 5K14B 2ZUAA 4DLEA 5KFHA 3B8HA 4KTQA 3MPYA 1FKOB 3OTDA 1GEHA 4P9SA 1EHWA 3GV7B 3PO5A 1TL3A 3UDEA 2RILA 4I67A 3BGFA 3RGIA 2E1AA 1XMOF 5KFNA 4HACB 5D0EA 2E7VA 2HBRB 4MKAA 7FDRA 3L4BC 4NASA 3TZWA 3CWJA 2K1RB 3M2UB 3NOGA 3HHLC 2BANB 2LMIA 4QOTA 3G6XA 1WI6A 2DT9A 1VS3A 3W2WA 3UW1A 2R9LA 2OAUA 1SQFA 4TNOA 2KRBA 3VQSA 4EYHB 3HHKA 2CA9A 3IC1A 5EWEA 2E5LF 5CZVA 4TU7A 1HQEA 4ER8A 5ETLA 4M5JA 1Q86T 4DJBA 4PABA 1ZA1B 1B0TA 2C2EA 2L3MA 1QVFR 3CJQA 1V3SA 3AOBA 4B3RF 4J5OA 3ZTSA 1CJKA 2DR6A 3OJUA 1UFLA 4C9DA 3GFZA 3GFYA 4NXMF 3CDWA 2JDJA 1HFEL 2BQUA 2YPZA 2CPXA 3MECA 4M5DB 2XI2A 5DM7Q 2ZWOA 4QIFA 1Q16B 2XULA 4P2MA 4WFAQ 2XGQA 2WTFA 1NM2A 2FC8A 2V69A 2HMIA 3FEZA 1UEKA 5K8MA 3ETMA 2H4WB 1XMBA 4AE5A 2H4YB 2OSRA 4LF7F 2DGXA 1RWNB 3SQGA 3DLKB 5D78A 1VQOS 2CJKA 1S9GB 4DV3J 1CULA 1HHQA 2R7WA 5D77A 3SSRA 3D4JA 2BKPA 4DLGA 1D09B 4ID5A 5HQLA 3D68A 3R2CJ 2VL1A 2C3UA 3QWUA 5LXYA 3KK2A 4YHHJ 4R0EA 4JOUA 1KHVA 1RQ0A 2UVVA 2BJDA 3M8QB 2B9XA 1LW0A 1SQGA 3HVWA 4DXLA 3BS9A 2YY3A 5GADU 3CMAS 2YKNB 2VG7A 2J0WA 1WKLA 2XMAA 3I0RA 3M8WA 1VC0A 2GW8A 1DJ0A 4O44A 2ZHOA 3M2RB 2MMYA 4U95A 2VIHA 1FXLA 3EICA 2FYXA 3WC2A 3IR7B 1FNOA 4ZP9A 2XO6A 4DX6A 3RAQA 1RTIB 1RK8A 4W90B 1ZH5A 3PJ9A 3KJVB 3ENAA 1UVIA 2CWKA 2AEMA 1DARA 4JP8A 5HVGA 2J9CA 3JXOA 2HHPA 3SCJE 4OHZA 4DX7A 4DFMA 1W2IA 3GZ7A 3CNQP 4ZN3A 1IQZA 1UVLA 1I3OB 2R3VA 1TKZB 3RR7A 1Q5YA 4J9PA 1N34J 4XO0A 2FLLA 3JTOA 4JI0F 2MZTA 4NMXA 1T0TV 5IT9Y 4S0MA 1GQEA 1FI4A 4TXSA 3CT9A 2HHVA 2QA2A 4KE5A 3AA8A 4U8VA 1HWKA 2V0NA 4IH5A 2C2NA 3BZQA 4KKOB 4B08A 3AA9A 1HWJA 3QT7A 4LBIA 4NCGA 3RTVA 4H4OB 2A0FB 3EVWA 2V6AA 3VGTA 4F4YA 3G8TA 5ETRA 3C46A 2CNLB 5EDWA 4KPCA 1C0TA 4ZPBA 4DFPA 1JMTA 4ZP6A 5CAAA 4JI6J 5KFCA 3OR1B 4IG3B 3HZGA 1E6VB 2HLTA 3EZ5A 3UVJB 4ZP8A 3US5A 4IQMA 2XNQA 3U02A 3BGUA 2ZUGA 4YR0A 4OZ5A 1C1CB 1WF2A 1LV5A 4DQSA 1ZA2B 4NLVA 1U7LA 2BE2A 1SJRA 5H1SV 5AXKA 2HQCA 3EMTA 2HFOA 5ETVA 5LT5A 3GV8B 1PO6A 2KXFA 3LANA 3KG1A 1UCNA 2DIVA 2ZZNA 4O0NA 4F67A 4IOCQ 4LRBA 3CW2C 1RBOB 2BEFA 2EVZA 3MCSA 1RTHA 2CPHA 2J0SD 2EFOA 1VHIA 3ILIA 2YQ0A 1TK0A 2FHJD 3ADAC 3DMJB 3TZXA 3UN3A 4ZN1A 4KPYA 4FVMA 3W1YC 2OEMA 3QJPA 2G2ZA 3FBCA 2A10A 2HGLA 4X4UA 1QLNA 1VRQC 4NPOA 1VQ6S 3X3UA 3LALA 3ISZA 4LMZA 2HHWA 3M05A 1U24A 4XDDA 5GADI 4NLPA 4AXIA 2GIQA 5GMKa 5L8RC 1E6YB 3QGHA 1S97A 4PPZA 1KONA 5DGAA 1PBUA 2R7XA 1X7VA 4ECSA 2PT0A 3JS9A 1R6YA 2R42A 2JWNA 2BVZA 4MIBA 1TVRA 3MD3A 1YRUA 2HHHJ 3KFWX 2MKIA 3FGVA 2YKAA 4Q7AA 3Q8UA 1RCOB 2GMLA 2ASYA 4DG1A 3G82A 3MR3A 2ZH4A 4QWEA 4MH8A 4A8YA 2HZCA 1RAGB 1T03A 1MNEA 3UCGA 3EYZA 3NS5A 5J2NB 4PQUA 4DHVA 1UMJA 3W7BA 1GX6A 3R7NB 3OVBA 3VGVA 3HSJA 3BH6B 4I2QB 5E7OB 3CPWR 1GAOA 4J9KA 2QL9B 4MIAA 1X4GA 3KKFA 1JJHA 2GJFA 1K1QA 5CQGA 3CJKB 3NAIA 2M8DB 2RHQB 3L09A 4EZ6A 4UOCA 2ZOMA 2Z0GA 2LU2A 4IFVA 4C3LA 3J7AN 4DSIA 1GK8A 2VPWB 4ZPAA 4C0OC 1H6KX 3OUYA 1R8BA 2JEFA 3EDRB 2XEXA 4DR6F 5C7PA 1EAYC 2BJ9A 3VCDA 2ILYA 2IC3A 1HNIA 2H54B 1ZAWA 1XNRJ 5ETQA 3P3DA 1H98A 3CCWA 3MPVA 1REVA 2DBBA 5DZ6A 3DKDA 4OZLA 4C8KA 1N5YB 5HANA 1PG5B 4UUWA 3HJVA 1FEEA 2ZNZA 1LNQA 4KJIA 2AP6A 5FD1A 2LXIA 2HNDB 4C8MA 1OSDA 4B3SF 2IA0A 2VBYA 4RNHA 2AF6A 1S1WB 2DNGA 2VPXB 4M95A 1JLBB 4ZMMA 1JX4A 1RUSA 6FD1A 1RE1B 1NMEB 3KLEB 3U1NA 4KC5A 2ZBIA 1SXLA 2VFVA 3M8PA 1FWPA 2C1EB 2F1FA 4Y2AA 2D3ZA 2DB1A 2I8EA 3QATA 4FP9A 4IQXA 1VLOA 3F56A 3RAXA 1ELOA 3LP1B 2V34A 1YJ7A 4DZDA 1NLKL 2E1PA 3DI6A 4URGA 4K4TA 1XNQF 2IRUA 1TV6A 2QA1A 5KAKA 2V68A 1KN6A 3T9NA 4I0WA 4DR1F 1SIZA 1P8GA 4DSJA 1WD6A 2CZVC 3KUHA 3IFEA 3DC2A 1FX2A 3M30B 3T1HJ 3UNGC 4C11B 1DAXA 4FDFA 1O8BA 4PYDA 5KG7A 4QCLA 2FVPA 3BN4A 3GG1A 1RYSA 2WRMA 3T19A 1OS5A 4IG0B 1GMWD 4MKBA 1JWWA 2E29A 1T9VA 1EKSA 2IHR1 3TUJC 5ETMA 3VR1A 3QFHA 3TARA 2IBOA 1S9FA 4F4AA 1ICEB 3PO4A 2D74B 2U2FA 2VDHA 5M2UA 1WSVA 3P49B 4HVZA 2KB2A 3R7SB 2K2PA 3IS9A 3KLIA 1FESA 3R7BB 4P74A 5AE1A 3DRXA 4WYLA 3RZAA 3PX6A 3A3NB 2B43A 1ACMB 2L08A 4CH0S 4IOAQ 3MWBA 4B9NA 5DDRC 1X0PA 5DG7A 1CJTA 3HLUA 2EEYA 1JLAB 3BJYA 1VRTA 2IDEA 4TLRA 4CO2A 1OY6A 2GZOA 1HMVB 4LQ9A 2XM3A 2VPYB 4OLPA 1QUPA 2KZMA 4PR6A 2BE9B 3A8JA 2HIQA 4RW8A 1L3UA 4ED5A 4F4WA 5LXRA 4USTA 2KG1A 2HK2A 3M1VB 1WEXA 5KFDA 1F2HA 3DN9A 3MM7A 2UXCF 2ZKTA 4KO0B 2L48A 1TR0A 5IWAF 3GMGA 1HPZB 4QU7A 2PO4A 2FJVA 3S8SA 1YKWA 1RXOB 1GMVA 8RUCA 2OPSA 4M5GA 1NKCA 3JB9k 2JVOA 1JLQA 3G2XA 2QYGA 4CYUA 3BSCA 2DIUA 4I7FA 1X31C 3UNYA 2X3DA 4L76A 3MEDA 2NZ4A 4DUYF 1BE4A 2E1CA 4JI3F 3D0IE 4B3OB 1MROA 2H5JB 5AE3A 1VIXA 1X5TA 5J2MB 2E7WA 2K3IA 4WP3A 1XBWA 2DNPA 3QQCD 4RO0A 2XLIA 4K5SA 4DR4F 1Y11A 2VA2A 3M2VB 1VK8A 5I4MA 4Z7CA 1HBMA 3LUYA 3DLEB 2MQNA 1LWFB 4J9UE 3MUMP 2JOQA 4ZVQB 3D67A 2M70A 3G8SA 4WJBA 4KAIA 3AOAA 4B9VA 5AJ3J 1TUWA 3QZ8A 3Q23A 5HP1A 1VQ7S 3E2EA 4NXNJ 3DM2A 5KFAA 4JI7J 2NSBA 1S7HA 4WXWA 4HT7A 2MSTA 4JYAJ 2CIMA 2XS7A 2AYGA 3NXZA 3VAIA 3K89A 4TY8A 1SIWB 4OX7A 2Z8QA 2HHTA 4DQRA 3VWSA 3QT5A 3FMWA 5GAGU 1RAHB 3RG6A 1R6VA 4PKDB 3LA0A 2MGZA 4EZ9A 1S1UB 2ZH2A 2ACYA 1KC8T 2LU1A 3MUVP 4F8RA 3J81j 1S59A 3I9V9 2IVFB 3VZIA 4CLKA 1F6TA 1Y5LB 3D5MA 3QSYB 1SC4B 2OPQA 1TUGB 4Y2IA 1WC3A 3OL8A 3M6XA 1U1NA 2DNRA 3EM1A 1V9OA 4WFZA 2QYCA 2VZ9A 4I68A 4ENOA 3NMAA 5LMNJ 3TW0A 2M4MA 4BS2A 2V5HG 3LGHA 2UU9J 1U48A 4AQYJ 4EMDA 2GAGC 3K8WA 5KOWA 2M88A 3OL6A 3DYAB 1TL7A 2OUGA 3RJMB 3FQKA 2LEAA 3W2WB 1KQKA 4DF8A 3MI7X 3SXLA 4A8KA 1ZYQA 4FF1A 5L39A 4YHHF 5KFPA 4OZ0A 1KLNA 2ZH3A 3TUIC 4A8FA 3C15A 2JEIA 1QSLA 3PRDA 1VQ8S 2RT3A 5B0GA 1X5PA 4DV4J 1RKJA 1JNZB 5I3QA 5IM0B 2F7VA 4F4KA 1N33J 2F5GA 1OY8A 5G0RB 2WOMB 1CS4A 4RW6B 4UOGA 2QTWA 4R0JA 2FDNA 2WK4A 3MPDA 2CKWA 3CJ2A 2XHCA 2ASLA 2LEPA 1PGZA 5B09A 2HBQB 4ZPCA 1N32J 4TQSA 3SV4A 3TJ8A 4NLOA 2FIUA 1CULB 3QGGA 5A8WB 2QT7A 3CIMA 5J1PA 2OD4A 2IJNA 1N34F 3C6TA 4ID5B 4I4BA 4WKYA 1UVKA 3O3LA 2FLPA 1BC6A 3KK2B 3B82A 5HROA 1RLDA 5BR8F 1W7WA 2VD3A 4F04B 1LW0B 3C6UA 1ZTWA 4RUHA 4I6YA 1RWUA 1FRKA 1N5TA 4F4XA 2KYXA 3PG9A 1U0HB 5IT0A 2V50A 2DRDA 4DL0C 4O44B 3CC4S 5EN1A 2EFQA 4HDHA 4FNHA 4V19J 3O8WA 2YX7A 4R25A 1C0UA 1VYAA 2B7BB 2V8HA 1UP1A 2CPDA 2RSQA 1Y3JA 4NCAA 3MGJA 3P4UB 4CP5A 4ECYA 5K9FA 4JI6F 1TUVA 3TA0A 1Q8BA 4RBUA 3PJWA 1F0XA 2V9KA 5KT3A 2J7UA 3GIMA 5L38A 5AT1B 2Q79A 5GAGI 3UDLA 4USWA 5EX0A 4F36A 2LQ9A 1LW2A 1S9EB 4TYAA 3TX8A 3Q2TC 2PEBA 5KFEA 1PCAA 3VAGA 5KFXA 1FKPA 1D8ZA 2XMJA 3RBXA 1UTAA 4HHUA 2VC0A 3MOZA 3NL0A 1T7PA 3T41A 1A6LA 1D0EA 2HQIA 4WTOB 1R31A 3GPAA 2IMOA 3W60A 4ED3A 1HWLA 3OVAA 1T9YA 2YNIB 3IWXA 3HDSA 4EEYA 4ZLPA 3HI9A 4J7CA 4LF4J 3V6DA 2LQBA 3MR2A 4U7UK 3D6FB 3U27A 2QZ8A 3G4SS 1C0TB 1HD0A 2XMWA 3FFIB 1JLEA 5AXMA 3PM9A 4OMFG 2ADCA 3OTCA 2DEIA 4HEA9 1FFSB 3H7HB 3GQCA 4YQWA 3PFOA 2QLWA 2G2OA 3JQMA 5K8PA 4ILLA 1YJNS 5KG5A 4F3MA 3O2IA 3ZXWA 4DFJA 2W9CB 2AJQA 4CRJA 4LSNA 1YQHA 2YNFB 4B9LA 2JZ5A 2R8IA 1M5VC 1SJ1A 2BW7A 1LK7A 1VOMA 4F02A 5L1JA 2RDIA 3NRBA 5A8RB 1RGVA 1NPRA 3MAAB 2E7XA 1V5VA 5F9LA 3MHYA 1HBNA 4QW8A 4YY3J 3IBCB 1GMUA 2Q3PA 1RTJB 1J2VA 2EK6A 3GCWP 2B8PA 4OX9J 1BWVA 1I6JA 1BQMA 3TNVA 3OXGA 1KRPA 2DRAA 2BJ3A 3B54A 3CD6S 3IP0A 5J1EA 1NK4A 1LFPA 4DV6J 4MYTA 3KHRA 1JK9B 2A2CA 4A8MP 3P5TL 2W4DA 2YVSA 5E3RA 1KP6A 2QGFB 4YDXA 3OT9A 1F60B 1X4AA 2DNQA 2YWGA 4ELTA 3FBEA 2JLEA 3CCQS 1RAEB 2L9NA 1H0HB 1UA1A 3M32B 1WEZA 2KFYA 3I0SA 4JV5J 1UEVA 4WK3A 1MMDA 4NA3A 4DV1J 2CQHA 3HKWA 3PRVA 1XR6A 1X4HA 1XWLA 2OELA 2DKOB 3AXKA 1R7IA 3MXHP 3MM5A 4WTYA 2ZH5A 4LIRA 1JXVA 2IDLA 2B9WA 2Y0SD 2DPIA 3CVKA 1FD2A 3W65A 4OX8A 2HSEB 1K0TA 3HVAA 1T9TA 4FBTA 1URNA 2J9DE 5MAOA 2M2BA 5C42A 4PQUB 5D3GA 4NZ6A 4OQJA 3UI3A 4Z2XA 3NNCA 2XHWA 1S4FA 4NOHA 3GP9A 3ZZRA 2WVBA 1B3TA 1Y3KA 3OTOF 5DGBA 2B0GA 3K7RA 2FPHX 2VONA 4KFBB 2LQJA 2B9EA 1CC8A 4XK8C 5L1KA 1WC5A 3WC0A 4LVNP 1RZMA 4RWXA 2YKMB 1SJFA 5KOXA 1S6PA 3UCUP 1N6QA 4Q45A 2IVYA 4K7QA 3A3OB 4K4SA 4ECTA 4IFVB 4Q44A 4U7UD 2IY5B 4J9OA 5D0HA 1FTRA 1YI2S 2C3OA 1FJCA 1G4CA 1SC1B 3I31A 1CSJA 3OUYB 3HF5A 2X1BA 4H4KC 1IKVA 1UJ5A 3UO0A 4ELUA 2G2YA 1RAFB 2QFJA 2MEWA 4QZVB 2CYYA 4ZVSB 1SKRA 1BHNA 2KT2A 4YR3A 2ZDOA 4OYXA 4QR0A 2ZITA 4DV7J 3QGPA 5HK4A 4ZJQA 3UN2A 3NMRA 2QO3A 1VGYA 3MEEA 4D3GA 1RWVB 3T1HF 3ILJA 2GJIA 5BYRA 4HACA 2ATCB 5DLFA 1YG0A 4LFBJ 2BANA 1LWXA 3KK1B 2W2MP 3D3BJ 2AD9A 1TAUA 2AYMA 1CC7A 3TVYA 4A46A 2F63A 1VC6A 3MMAA 4USKA 4JI5J 3PKYA 2ZVSA 4HH1A 1L3TA 1JLCA 1B99A 3M8PB 1IUJA 4QYRA 3RRHA 5HMZA 4NLRA 3QIPA 1EKRA 2K06A 2I5JA 4OJ1A 1BMQB 3P96A 1U25A 4M5DA 1JXEA 4ZLNA 3QJLA 4P10A 5IQQA 4M5IA 1FE0A 1UW9A 4RLEA 5KFWA 3A1YG 3I96A 2MKSA 3RBZA 5BJRA 1D3WA 2A2DA 1P1TA 2PE8A 2XTJP 3DLKA 1S9GA 3ILOA 5AXNA 3MPWA 2P9CA 3FSYA 4PXEA 2RUSA 2PA3A 1N56A 4ZCLA 2K7KA 3GIJA 5GAEU 4J91A 3PTWA 1LXNA 4RW7A 4FYDA 4FS1A 3U1MA 3PDNA 3QAEA 2ATLA 3S1TA 3Q22A 4U96A 2FVQA 2G0IA 3NBPB 1WKKA 5FDLB 2YWKA 2OD6A 2EXUA 3M8QA 2DGWA 2QMWA 4JI2J 3KLIB 3RU0A 5KFKA 4F3QA 2UZAA 1IBKJ 3OBIA 5CYJA 2YKOA 3ZZOA 3WX4A 2OPRB 2QEXS 4OIXA 1TELA 2WZ1A 4DR5F 1S99A 2DXFA 2DCLA 1HBUB 2V8PA 2W8KA 2D41A 3TP2A 1R3NA 2GQQA 1ZM4A 2EC2A 3QRQA 1X4BA 2CQBA 1CJTB 1RT4B 2YNHA 5F8NA 2UUBF 2RKIA 3N28A 1VRTB 3O5TB 2UP1A 1RLCL 1IKWB 3CDAA 4K4XA 2W9AA 2AJ0A 3AY0A 4ILRA 3J7Z5 5LJ3Y 2C2DA 3WX8A 3CCSS 3CDUA 4RW8B 4KBIA 1SBRA 4N56A 1DFDA 1YDLA 5E0OA 3QIDA 2A6MA 2XS5A 1DTTA 2AGOA 3PACA 4NXNF 4DR2J 4WK1A 2BR0A 3M9MB 5FLXU 4JI7F 3OXLA 1JJ4A 4IR9A 2R2TA 3UQSA 4PRFA 1DQAA 3CUNA 3FZ2A 1ZBTA 4EO8A 2CJAA 4TU8A 3M9NB 1M1GA 2OPSB 2UVWA 1ZM9A 1JLQB 2M52A 2OMLA 3SIPB 1Y00A 4CYUB 5KT6A 1VCTA 2VG5B 4KKOA 2VF3A 4V19X 3MEDB 1GXLA 4H4OA 3DLLQ 3KMSA 4ZPVR 4MK7A 3HHNB 4O3QA 2VQEJ 2L9WA 3F73A 3TA2A 1EX8A 1S49A 3H2LA 5L1IA 1KQSR 1PYOB 2JEJA 2AYBA 2KG0A 3UD5A 1T05B 2C42A 1HBMB 2AJ4A 4OV1A 2HYIB 2FY8A 2M5YA 2QLBB 2XS2A 3UVJA 4LJMA 1TTHB 1FEHA 3GWCA 3LGMA 4DF4A 5LMNF 4NRTA 4LSZB 2Z56B 2ROPA 1C1CA 2UU9F 5HP1B 1NAQA 4AQYF 1FDDA 2GQ2A 3DM2B 2HAIA 2OKQA 1BUXA 2KT5A 3U7JA 3T6BA 3TR5A 3T6JA 5KFBA 2JH3A 4UQGA 4CLUA 4TY8B 2XZTB 3HT0A 2NSCA 1BQNA 4ERDA 4B9UA 4LRAA 1I1GA 5T14A 3RW7A 2WAQD 1WHWA 4DQQA 3TAQA 2MGZB 4DV4F 4YB6A 1NDKA 2J7WA 3M8RA 4PG4A 1N33F 5GAEI 2JL9A 4ELVA 2LA6A 3Q86A 1QVGR 3DFEA 2MHNA 3PJXA 2OPQB 3H20A 4EBEA 3GJQB 3P6YC 3GYXB 1YZ7A 4NLYA 3DRPA 2QV6A 4ECWA 2YPYA 5H9FJ 1PJ5A 5DQIA 4H4MA 2ZH6A 2QMXA 1TK5A 2IM1A 4NRUA 1N32F 2JNJA 2NUUG 4F2RA 2IBKA 3NGKA 1M1KT 1AYEA 1TL7B 2KJWA 2WVEA 4G6VB 3CDBA 4ECRA 4DL2A 4Y65A 1U47A 1QUVA 4WFNQ 4DN9A 3CJ3A 5HMXA 5J2NA 2E1RA 2BKNA 2HFNA 1URRA 3EZUA 2A6OA 1XERA 1HQ2A 4CNYA 3GJTB 2XG8A 4E8UA 4DQPA 2GGPB 3ENWA 1CS4B 1U1MA 2BOPA 1G3OA 2OSQA 2P6TA 3SZ2A 1CVJA 1K73T 5E3CA 2HS4A 2JRSA 3OD2A 3ITHB 5ETSA 2R7QA 3HSZA 3CJKA 1NDLA 3BPDA 3W64A 5A76A 4F50A 2MLXA 4KHPJ 3HD2A 3CB4A 2J5AA 2KHCA 3GTYX 2KHDA 3LAMA 1P1LA 1PKUA 4CO5A 2N4DA 3M8ZA 3GYGA 4X4PA 3OHAA 2GO8A 1YJWS 3BKUA 4BDPA 3HFVA 3GSIA 2G0JA 2JLGA 4F0HA 3JQJA 2RF2B 6AT1B 4RW4A 3GSDA 1KKHA 1YRXA 3TVKA 2MKKA 1T9XA 2YKPA 5E3QA 4UUXA 2UUAJ 1IKYB 3ZZYA 3MURP 2EWHA 3P45B 1J27A 2O66A 1TFYA 4LFAJ 2VU5A 1KOOA 2W9BB 2WONB 3UPFA 3R5CA 3R5BA 2VQFJ 2GMJA 4BWJA 2GVZA 2XCAA 5KG1A 2R7SA 5D4NA 2XQCA 2ZH8A 1FJ7A 1S1WA 1IBCB 3I5CA 2ZOGA 4X66J 1ITPA 1HNVA 1S57A 1JJCB 2HBZB 1JLBA 4JBCA 1NJWA 1CG2A 1XMQF 3KLEA 4EFAC 4NA1A 3PY8A 1Q8IA 2HVDA 4JV1A 1LW2B 1U2RA 4KH1B 2OPPB 3H4DA 2FHJA 1G6BA 4YB7A 4ES1A 3G6ES 2ALZA 4RBTA 5H9FK 1X9MA 1NK5A 2OEJA 3UD3P 4J9MA 1Z4UA 3GU0A 4ETZA 5FIIA 3V6HA 4DZ6A 5CCMA 2PEHA 1RHRB 4YY3F 4V1Ak 4DV0J 1YRTA 2O5DA 4C11A 4DR7J 3V6DB 2KVIA 4E2FB 3TI0A 1FX4A 1VDHA 3H98A 1JQGA 3MZIA 1IWGA 5DO2A 3IA0A 4IUFA 2IJRA 2MHEA 4NLXA 2L9DA 4DV6F 1QAJA 1JLEB 4RW9B 5DRKA 4PYAA 4U6PA 2MKJA 1F5CA 4PEOA 2VODA 1QD1A 1DBDA 1Q95G 4KSEB 1J5OB 2Z58B 3CGIA 3JSRA 4KHMA 4OZJA 2CNNB 2CZ4A 2V2VA 3BBBA 1ZPVA 2R8GA 3DLHA 3KDNA 1S1VA 4QPXA 2MB0B 1S1XB 2MLZA 4JV5F 4GVLA 3GR1A 1S12A 2LXFA 2ZE2A 4DV1F 3TOQA 4A8SA 2BX6A 2DGOA 4DX8H 2BKOA 5KG0A 2N7CA 5HBMB 3QYYA 1Y5NB 4ZHRA 1I94F 4AL5A 1YSJA 3HVTA 2OTLS 2L41A 4N8NA 2CJYB 1JLAA 1HMVA 2NUHA 1AW0A 2O3DA 3KJNB 4YS2A 3MM8B 4Q2MA 1WC6A 1CBKA 3MAHA 3DOMA 3CJ4A 2RS2A 4OHVA 3HCXA 5E3AA 3HO1A 3DCAA 2AWZA 2HVHA 2MDAA 4PQAA 1QAIA 2P6SA 2B4PA 5J1EB 2BE7D 3POTB 4I69A 1U1QA 4OI6A 1S76D 3B4MA 4DOZA 4KO0A 3R1LA 1S4EA 2JLFA 5K8NA 4LSLA 2C2MB 4FKXA 1HPZA 2EFPA 3J80U 2BUNA 2IFXA 1QTNB 1HNZJ 4IH7A 1U1RA 4E0DA 4K4VA 3ZZTA 2GHPA 1HD1A 1X4DA 2CQ4A 2HQDA 3GJRB 4L73A 2N82B 1FK9A 3Q89A 3SCLE 1FWKA 2LQ5A 2NXJA 2XNRA 3GV5B 1HW8A 4OJGA 5HMYA 3ZZZA 3C16A 3GIKA 1U1PA 4CTAB 3AQOA 2CQ0A 2B4UA 1NHVA 4K5RA 2PMHA 4ED4A 3A3PB 3K2YA 3MM5B 1RB0A 2YWFA 2MKYA 3MCNA 3B6BA 1AB8A 1AUDA 2G9OA 1FHTA 4CCHA 5B0AA 1UW4A 4C7QA 1WJ9A 1S0MA 3QAUA 3VVUA 4CI0B 2Y1JA 1LWFA 2IM3A 3H59A 4MKYA 5C42B 1KLMA 2LEBA 2LFVA 5D3GB 2Z2ZA 2YH1A 4NLWA 1X5OA 5J2PA 2CG8A 1U49A 4RX6A 3L95X 3KHGA 1VIOA 2AJ2A 3CTRA 5IXUA 1NKEA 3CEDA 3C66A 3TZZA 4B3MF 4OYIA 4YFUA 4LFBF 1PC4A 1QY7A 2EKYA 1FDNA 1SQEA 4AYBD 3PXGa 3OTBA 4KT0C 2KKHA 2P9EA 3MMCA 2MXYA 3LH2S 3V6KA 5IC4B 1MWZA 4C8NA 2H65B 4ZVGA 1S6PB 3ILLA 1U6ZA 1N6QB 1HLWA 4QR2A 2CRLA 1RTDB 5KT2A 4JI1J 4X65F 1RACB 1BY9A 3UWTA 4ED8A 3JQKA 3DRYA 4DFKA 3BM7A 2DGQA 1TKTB 3D3CJ 3SSSA 2BM0A 4DSLA 3RW6A 2WVDA 1VC5A 2J8AA 3I82A 2X1GA 1IKVB 2OFGX 3C8YA 4CLSA 2GFFA 3E01B 1GMWA 3NCRA 2EBGA 5ITHA 4N8OA 5LMUJ 5C25B 4C2MA 4CLWA 4HTJA 2RU9A 2XMKA 4Q43A 3NCPA 2OTJS 1TL5A 3H42A 1FVSA 2KI2A 4CO4A 3JAMY 2GHWA 1KFDA 1NSAA 4MIWA 3MEEB 2HFZA 3PIOQ 1RWXB 5CH7B 5CABA 2RS8A 2KO1A 4WXOA 3DYAA 2BJEA 3HD1A 1U1OA 1T9UA 4U7CA 2QL7B 1S72S 8AT1B 2GCFA 2HFSA 1REGX 3ULHA 3D0HE 4DX5A 2ADBA 5E3PA 1FRMA 2YWEA 4K2JA 4JI4J 3MMAB 4Y2CA 1IBMJ 4O3SA 1RT1B 2OLWA 1H2VZ 1YJVA 3FK4A 1JLCB 5DLGA 2IPOB 1S77D 1Z1ZA 1DY3A 4NMLA 4CO3A 5IM0A 2DNKA 2PGCA 2UUTA 3QIPB 4CLFA 3V5RA 2I5JB 5G0RA 4O0IA 2WOMA 4HKQA 4RW6A 4A47A 3FSIA 1XQIA 1SH0A 1AT1B 1WDTA 4XTTA 1HWIA 1FXDA 4RUCA 3D66A 3LP0B 2DJWA 3I87A 2CJXB 2RDJA 4OX6A 4IFYB 5EWGA 2P2CB 4Y34A 4LF6J 1JJ2R 3PX4A 4QIEA 2HNYA 1JKHB 3R2DJ 1VQPS 3IMQJ 3R5DA 5F8JA 2VBXA 3TEGA 1XTZA 5A8WA 4N5SA 3QT6A 3HK2A 3HP6A 1SC3B 3BBCA 2XLKA 2HVEA 4RW7B 3K57A 1RADB 2PFDA 5RUBA 2I6WA 4DR2F 2ZH1A 1HW9A 2CPJA 4USHA 2IA6A 1RT6A 2IAJB 1Y4ZB 3FEYB 3AJ1A 1ZAVA 2GX8A 2E5LJ 2G13A 2DRBA 4WFBQ 2FZCB 3UDVA 1U0HA 1Y9OA 4X4QA 3BB5A 4BCAA 1HNWJ 2CUYA 4OI2A 2BM1A 1WELA 3THPA 2VQEF 2W1BA 4X62J 3PHEA 2MZ1A 4X2BA 1CPZA 2YNHB 1WG1A 2RKIB 4LBPA 3KLHA 2AIRB 2FLNA 1I51B 3AHPA 1HR0J 5KG4A 4P71A 3KHHA 3VHQA 1XC9A 3CJ8A 3UE2A 5G4DA 3IWNC 2HRYA 5HL7Q 2MZQA 2ZOFA 4LF7J 1S1TA 1S9EA 2K7JA 4WKRA 4DPTA 2Y8WA 4DV2J 2HWIA 4C3KA 1DTTB 3FKBA 2C2ZB 3ZZUA 3R9LA 2BQRA 3X1LB 4TQRA 3KG0A 1T9WA 2PC6A 5HI7A 1OJ4A 1G2EA 2AX1A 2V2KA 3W2VA 4ZA1A 1F9EB 1ZM2A 3CJ5A 3D6HB 1SKWA 1Q78A 3DGPB 1NK6A 5JJBA 1QTMA 4WPAA 1WACA 3B78A 5D15A 1VI7A 2VG6A 2YNIA 5IFMA 1HWUA 1Q7LB 2QLJB 4Y2KA 2DR9A 3HX9A 1RWPB 3EZOA 2E9RX 1S6UA 4OI1A 4DPWA 4HR2A 3RYLA 3T1AA 3FQLA 3RB0A 3GJSB 3FFIA 1U6FA 4ZIVA 2XLJA 3CCLS 3PIPQ 1VR6A 2QMUB 5A8KB 2RRBA 1P27B 4C0HA 4KY3A 2V67A 2FLOA 2EFGA 3N4WA 2DH8A 4NLUA 1GX5A 1CQNA 1RA6A 2W9CA 4YUDA 1WTBA 4B3TF 2F40A 2HS0A 2VOOA 5B0FA 2ZBCA 2YNFA 4MAKA 5D0RA 4RNOA 2W7AA 1QJHA 3H8YA 3TANA 3DOLA 1PYSB 1M5SA 3FBFA 2JSXA 3M8SA 5A8RA 3MAAA 4UQTA 1P9QC 3D0GE 2B56A 1KVJA 5F3TA 2FHMA 4O4RA 1BQNB 1RP5A 1RTJA 3FDSA 2OMOA 2HURA 1X9WA 3KLGB 2DHXA 3NWGA 2EK1A 1RI7A 5FJ4A 4M5HA 3GIIA 4WP8A 1RHJB 2W2OP 1RT5A 4FZVA 1HYSB 3KXDA 4A8WA 4ZPDA 2QFIA 4R8UA 3C14A 1DQ9A 2RUGA 4OYZA 4QQBA 4HTIA 1O6XA 2CNKB 3D54A 1T8EA 1SJQA 4IDKB 3HSDA 3DRPB 2ABYA 3QT8A 2GIRA 4H4MB 2HVIA 1MN7A 3CMES 3M32A 5J2QB 1R27B 2CQGA 1SJ4P 1HBOB 4TU9A 1XK8A 4WE1A 4K4ZA 1YJTA 2J6TA 5K5MA 2HG4A 3TAMB 1VJWA 4L3KA 1ZTTA 2DNNA 2Y0BB 1QM9A 3V4IB 5HAOA 3HVRA 1MG7A 2DTJA 2BXJA 1UZHA 2UUAF 2ASJA 5AXLA 1NB7A 2WBMA 1EETA 3CC2S 4FYXB 4PWDA 3VF0B 4LFAF 5LL6d 3TO8A 1EQ0A 3ZTRA 3IR5B 4ANCA 2VQFF 4PAAA 2JEGA 5J1NA 4U67Q 2XWXA 2BV3A 2UV8G 4KFBA 2VFUA 1SJ3P 4X66F 3DU5A 4AUKA 2O1PA 7FD1A 3PYFA 4ZPWR 2MSSA 4TLQA 3DHXA 2HRTA 2YKMA 4OI0A 4J9QA 2XZDB 3R5AA 2J6UA 1TKXA 1ZETA 3TJAA 3HPOA 2VFSA 1Y5IB 1O5JA 1NPKA 4AFFA 5E5NA 2KL8A 4DSEA 4EU0A 4OYAA 3U1LA 5HN0A 2ZDPA 3TA1A 5KG3A 1Q81T 1FF2A 1FDBA 2M3DA 4GRSA 2X3GA 4QJVA 3OFHA 4DL5A 4I56A 4F4ZA 3BDPA 4RW4B 5CYQB 2PN6A 3V81A 2DHAA 3KDOA 3W63A 3A8IA 5HQMA 2DNMA 3KK3B 4DV0F 4HI1A 2J0QD 3EGZA 1KD1T 3QWPA 1U26A 2FJWA 2GVZB 5F9NA 3G6VA 3KK1A 2EI5A 2NQPA 1KWMA 3N6LA 1PYTA 1HNVB 1UKUA 2ZJRQ 1X60A 2MPUA 4D3HA 2XZWA 1FCAA 3CF5Q 4J9SA 1U2CA 4I6WA 5E33A 3EGNA 2Q1LA 3EDQB 1TQLA 3WIVA 5KFYA 1Q0NA 4C3MA 2CPEA 2J7KA 4PG7A 2LXUA 2VICA 1YIJS 4G1PA 5K8OA 3A8EA 5IV3A 1OQ6A 1SB6A 2R8KA 4WWSA 4USUA 4G3IA 4ZVEA 3FZBA 1U1LA 2DY1A 1W26A 2FJEB 4J9NA 2F8MA 3LWLA 2I9SA 4GKKJ 1RHKB 5F8GA 4ECZA 1GNKA 1I5OB 5DDPC 1WF1A 3H2UB 3PCOB 3NCQA 4UTGA 1LQ9A 1H2UX 5T7LA 3MR5A 3LAKA 3R3TA 3NGUA 3HJFA 5I42B 3T5LA 1SV5A 2R2UA 3T3FA 5SUHA 1Q5VA 4IOBA 2DHHA 2BJ1A 2YWWA 2ERRA 3VTIA 2V8DA 4DUTA 1KOHA 3NBPA 1HNZF 4PG5A 4P52A 3CCRS 5FDLA 3T9ZA 1UVMA 1WKJA 5A2QU 3DRRB 1NJYA 4Q8EA 4OYMA 2ASDA 4ZVPB 4L6V3 2W7OA 1S1VB 4RR5A 3W61A 2Q66A 1BXNA 1KQFB 1VFJA 3R27A 4I2PB 2P8IA 3KLFB 2VKRA 3PW0A 2OPRA 4YB1P 4ECQA 2ZE2B 4DV5J 1Y0HA 4IKAA 1U6BA 6FDRA 1HBUA 2QC3A 5IZHA 2YH0A 4I64A 2ZEJA 4PWUA 5D8HB 4ZHRB 1RT4A 3HVTB 3F0NA 1X4EA 5E41A 2APOA 2VH7A 4QU6A 1DLOA 2WSFC 1GXTA 1IKWA 2AT1B 5KT5A 2F4VJ 2UUCJ 4N41A 3DXSX 1J5EJ 3DOMB 2ZNYA 1GH8A 4QYZJ 2JVRA 2RAQA 3BREA 4A8QA 1AFIA 3ZFVA 2IM0A 3QFWA 2F9JA 3E3XA 1S79A 2CQ1A 2EW9A 4LSLB 4FXVA 3NNHA 3QRRA 4BHQA 1APSA 2HFVA 1O51A 1FT8A 1S7IA 4CIOA 4F0KA 3LF0A 3L7OA 2DH7A 2DPJA 2BYCA 4M5NA 3QLHB 3SDEA 2JHEA 3GYNA 1VMBA 2POKA 3I9ZA 1FK9B 1FD8A 3KNGA 3NGTA 2VG5A 4LRDA 4JI1F 4C6AA 1WOOA 4URQU 3C16B 2NXUA 2BDPA 4Y28C 1OQ3A 1WSRA 2CQCA 4GVBB 1CJUA 3FEXB 4ATNA 4J90A 3J81U 1R89A 1CEZA 4LF8J 1HL6A 1OMSA 4IR1A 5HVHA 2VDIA 4X84A 5C2CA 2COLA 4OZ2A 4TY9A 1T05A 4ED2A 4KHRA 5LMUF 4IO9Q 2HWTA 3OR2A 2CPIA 4K59A 1S10A 4USMA 1KLMB 1LEOA 4IYQA 5J2PB 1UPMB 5I3UA 2MQLA 4RNNA 4ZVUB 2ZZMA 4OHYA 1YBUA 3QJJA 5HLFA 3DLGB 3QNWB 5L1LA 4ZCKA 2VHGA 3SSQA 4UF4A 3OXFA 2BACA 2ZH7A 3K5NA 3GE9A 3FMBA 3MMCB 1TMJA 3BKTA 3D6TB 4I1TA 1FA0A 2FGCA 3OL7A 2GA7A 2DO0A 1FRHA 2ILZA 4JI4F 1RDRA 1KFSA 2XMUA 1DQ8A 4W4MA 1VLYA 4M1KA 3DDIA 5DG8A 3TQEA 1F9FA 2HK3A 1FERA 3LQVA 1TKDA 1LFWA 2C2OB 3E51A 2C28A 3NGDA 4DUYJ 1OYDA 2GC8A 3BQ2A 4O3PA 1T95A 1IN0A 2UVRA 2ZHBA 5C24A 4P2SA 4QR1A 4M8LA 5F8LA 3TZYA 3A13A 4YOEA 1MMLA 4LF2A 5JVHQ 3JSBA 3HFKA 4I6AA 2AEJA 1NDPA 2PI4A 4LF6F 2EC0A 2MQMA 3HM9A 5B0BA 2RHSB 1G1XA 2MQPA 4DV3F 1EZZB 2V94A 4KH0B 4XPEA 2EG1A 2NLWA 4MFBA 1CQMA 4DL3A 3LWMA 1UFKA 2EG2A 4LUBA 4ALZA 3DGVA 4HHJA 2LYVA 3N01A 4QYZK 1TZ0A 1AA1B 1NSKL 3N79A 3IRXA 1RBAA 2NCKL 1S5ZA 2WVCA 4A8OA 5THWA 1XN9A 4N76A 1RWMB 3R97A 1Q8LA 2EKNA 3L9ZA 3CULA 1U4BA 1VBYA 3FBBA 1VBZA 5IC6B 4O3NA 1HNWF 1GTHA 2W4CA 2GGPA 5BYQA 1N8RT 2RQMA 3NG8A 2F9DA 3HULA 3K59A 4BLGA 2AU0A 5EUHA 2F4FA 2GO9A 4X62F 1VHFA 2DISA 2RE1A 3UCZP 1JXLA 3ITHA 3BKFA 3IXQA 2KU7A 1HIYA 4X64J 4RU2A 3VGUA 1CJVA 2HNYB 2Z57B 1HR0F 1KSPA 2RNEA 1VQLS 2HPUA 2M0GB 2HIYA 1SVDA 3ENVA 3BO4A 4Y3CA 2Y3YA 3NEKA 2DGVA 2UXBJ 4DSKA 2PSZA 1YLXA 2V63A 3JSMB 4DV2F 1WC1A 4DL6A 2FVSA 1TL1B 2CAJA 2RF2A 1F9HA 1Z2ZA 3K5LA 1RT6B 1NK7A 3J80Y 2WBRA 2CVIA 4HDGA 4HLBA 2F8EX 3BN7A 9ATCB 1FE4A 1IKYA 3MM6B 1FXRA 2D9OA 2HHUA 1NU4A 4AD6A 4LBHA 2W9BA 2WONA 1SUQA 2YNGB 1RAJA 1MU2B 1T3NA 4TKTA 3GILA 1D9FA 2FVRA 4GMKA 3UR3C 4F7VA 1Z2LA 3WDOA 4X4OA 2RU3A 3PEHA 4FF4A 1PC5A 4NCBA 4Q0BB 3KLHB 2BOAA 2OFHX 3FC9A 4ITSA 2WSEC 1MWYA 2HZAA 1RT3B 1PJ6A 3MTKA 2XYGB 3MR6A 1KR4A 1FRJA 2JFKA 3NGRA 1NHUA 3C2PA 1S1TB 3RB3A 3BBFA 1AUSL 1WWHA 2OPPA 2H48B 1VQMS 2M7SA 2VBWA 4USJC 3CCVS 4DU7A 1D8YA 2GMHA 5C2GA 2LA4A 4JV0A 3H25A 2CPZA 3NP5A 2B4VA 2C3MA 1XR7A 4P75A 3W2VB 2GNKA 3DRSA 1PJ7A 4P7VA 3VZHA 1IWAA 5BR8J 4RZRA 4DS5A 5M2PA 5CHCB 3M7VA 3ZZ0A 4NE9C 2VG6B 1V3RA 2XCPA 3QZ7A 4QW9A 5A0YA 3O6QA 1NK9A 1IR2A 1C4CA 2K8GA 3BPSP 4MKVA 2B5JB 1NB2A 1RISA 4UZCA 1S6QB 2DGUA 7AT1B 4RW9A 4DPOA 2HAFA 3PRBA 4PWWA 2KM8B 1EP4A 1WG5A 2J76E 4C8ZA 3K0JA 2BBEA 4IRKA 1J5OA 2BZ2A 3I56S 1IJFB 1B64A 4ZOSA 1K8AT 3A4TA 5HO4A 3J7YU 3J7ZT 4ANEA 1ZS6A 1S1XA 5IQ6A 3VGSA 3FRYA 3HSGA 3CCMS 2NR0A 3G8QA 2AJFE 2G1HA 1L3VA 2IMWP 1RJJA 1VBKA 3NOCA 1NUEA 2ZD1A 4NZ0A 3D9BA 3MR7A 2HHHF 4J9RA 3DOLB 2CJBA 5HBMA 3EVOA 1Y10A 3HXMA 3SV3A 4NYPA 1HNXJ 5B0EA 2B9YA 2XMVA 2XMTA 1KQGB 5EHHA 4ECXA 4XAKA 3H0PA 2ACMA 1QE1B 1RHQB 3MM8A 4O23A 3I5AA 2UUWA 3AD7C 4G1QA 5ETKA 1FRXA 1XJWB 5K20B 4ES3A 5CA5A 2FJBB 1D1UA 1VQ9S 1FDAA 2WSCC 3NGSA 2C2KB 4NI2A 2JC0A 1RT5B 3POTA 2YX1A 4RJVA 4R8UB 4Q5VA 1VISA 2NYIA 3DLBA 3C14B 3AOCA 2C3PA 1H74A 3KHLA 4USIA 3QGIA 3K5OA 5KFTA 1SH2A 3Q83A 2A3JA 2CWXA 4F25A 3EVMA 2E1MC 5F0UA 1V6HA 4OHWA 3R1HA 4ID8A 5D4LA 1YVFA 3D2WA 4WE1B 1JLGA 1U8SA 5F8HA 4ED0A 3Q8VA 2V4QA 4CTAA 4O4GA 1R0BG 3CE8A 5E2QA 1Y7PA 1K1SA 1DTQA 4BWMA 4PXDA 1R8HA 4C8LA 1XNRF 4U9RA 4A48A 4RWWA 5D4PA 4NX9A 3W5ZA 4CM2A 1N54B 3R5JB 1OO0B 5EX3A 1RT2B 4M94A 5DQGA 2EPIA 4KGMA 4W98A 1EETB 3D1QA 1UVJA 1N5QA 4PWDB 4DEZA 4YMEA 3TVZA 4OYWA 1EQMA 2Y1IA 4NLSA 4JUZA 2GS8A 4ZCMA 1ROFA 1R8PA 3SCKE 1N88A 2JX2A 3ISND 3JTPA 3PVXA 3PYEA 2HHQA 3SYZA 5DZ7A 1LK5A 2CJQA 2IYGA 3TJ9A 3H5YA 4ZVHA 2ZFHA 1C1BB 1U45A 1TKXB 5GVQA 4MK8A 4YN3B 2YBVA 2RB7A 3KMQA 1NNDA 1RTDA 2W2NP 1VQYA 1BGXT 1Q7YT 3ET6B 3D28A 1TKTA 5MLCV 1UWBA 1MSWD 3MDFA 5HATA 3IBFB 4ZLLA 3I55S 2G4BA 3G87A 4USVA 4UZBA 1FWLA 3IG1A 2CADA 4JI8J 3DHWC 3E01A 4B17A 2AKWB 3O44A 5GMEA 3JYTB 2QA4G 1RWKB 5C25A 3V81B 2NPFA 2J8SA 5CYMA 4FYWB 3K8VA 5HMWA 2JC1A 3J7YI 3LTOA 3RRKA 5KFMA 2VKZG 1RSCA 4GKKF 2RQKA 4FYYB 1UVNA 4LF5J 3W5YA 4WBFA 5L46A 4LR9A 4ZDNA 4KYZA 3BO2A 4E98A 3TX0A 3DOKA 3Q8QB 2AHOB 3VAHA 1R0AB 4DPYA 1ZZFA 2R7UA 3BQ1A 3HMJG 3AD9C 1MMNA 2FC9A 4WU2A 3OTOJ 3PNIA 1BD6A 3MOJB 3Q8SB 5F0WA 1RT1A 1V3ZA 2DK2A 2C22A 2AJ1A 3J7A1 3OTEA 4KV8A 3C3LA 4LF1A 2ALYB 1YITS 2E9TA 3CD0A 4N77A 5SZTA 3ENQA 9RUBA 1T11A 2AGQA 2CVEA 4DV5F 4P73A 1VQNS 2OJ3A 2AQ4A 1K0VA 2G1DA 2H3EB 3BO3A 3LP0A 1QSSA 3G86A 4IFYA 3NY0A 2XY6A 2K3KA 2F4VF 1VRUA 2UUCF 1JKHA 1J5EF 1OPIA 3HHDA 1NJIT 5LM7E 3S01A 3CSKA 5T7LB 2PFFB 5EGYA 4HH0A 4GC7A 3G96A 4LF9J 4B9TA 1SV5B 2QLFB 2YTCA 3MEGA 3T5JA 2XY7A 2IAJA 2YXLA 4UY8T 2VBZA 2CQDA 1R0CB 4G65A 2KRRA 2OI2A 1NXIA 2H5IB 2B4OA 1OY9A 5D4OA 3GFXA 4B02A 2GVDB 1WHXA 5KT4A 3G6YA 4L3NA 2KFNA 1RAAB 2IM2A 3CJ0A 1M0SA 4UW2A 2HHSA 2ZBPA 2W7PA 3AQPA 4CLTA 3BGLA 4B9SA 4NL5A 2E5JA 3HHLA 4WP9A 4LF8F 2RVJA 2ZHAA 3QPIA 2HWHA 1DLOB 1BWEA 2YQ1A 1RWWB 2LKZA 3KUGA 5I3PA 4OZ3A
chains in the Genus database with same CATH topology
4TQRA 3BGRB 4OI4A 4BC9A 4YDDB 3KG0A 3U27A 2PC6A 2QZ8A 3TRGA 3G4SS 3ONQA 5HI7A 1G2EA 4WZMA 1C0TB 1HD0A 2AX1A 2V2KA 3W2VA 4ZA1A 3I4PA 2XMWA 1OSCA 1ZM2A 3CJ5A 5DETA 3FFIB 1SKWA 3CD7A 1Q78A 1JLEA 2RRAA 1F5BA 4LSNB 1NK6A 2RQCA 1AXQA 1PILA 5AXMA 5JJBA 5AJ3F 3EPGA 1QTMA 1U1KA 1WACA 3B78A 3NAHA 2ROEA 3PM9A 2I0XA 4OMFG 3OTCA 2ADCA 3TAPA 1VI7A 4RNMA 4HEA9 1GT8A 2VG6A 2YNIA 5IFMA 2JFDA 1HWUA 3GG0A 1Q7LB 4C0BA 3GQCA 4EUVA 4YQWA 4Y2KA 3BDEA 3LP2A 3PFOA 2QLWA 3RB4A 1W2BR 3AB2B 2DR9A 3HX9A 2F8HA 3N9UC 4ZVFA 5K8PA 2X51A 4ILLA 1YJNS 5KG5A 2E9RX 3H5SA 1S6UA 2SXLA 3O2IA 4F3MA 3BGRA 4OI1A 2UXDF 3RYLA 3MMJA 4DFJA 4JYAF 1NZAA 4DL7A 3T1AA 2W9CB 4FPRA 2QA4S 1HBNB 2AJQA 3FQLA 3RB0A 4JV2A 3FFIA 1TL4A 1U6FA 3DGPA 3SDEB 2KN4A 5ADZA 2N3LA 4LSNA 2QLXA 2XLJA 1YQHA 2YNFB 3CCLS 4B9LA 3PIPQ 2JZ5A 3V2UC 2R8IA 1UETA 5A8KB 1M5VC 4P6QA 1SJ1A 3TQ1A 4C97A 1LK7A 2RRBA 1P27B 1VOMA 1XR5A 1BQMB 4GKJF 4F02A 4C0HA 1NO8A 5L1JA 4DBQA 3M1VA 2FLOA 4WCEQ 2RDIA 2EFGA 4WF9Q 1HARA 3T1YF 3N4WA 3NRBA 1H38A 5A8RB 3N5FA 5IS2A 1RGVA 2N4CA 2IRXA 4RBVA 2DH8A 4NLUA 2KH9A 1GX5A 1CQNA 2E7XA 5U47A 1X9SA 1JIHA 2CPFA 5F9LA 1RA6A 5F3ZA 1Q4RA 3MHYA 3RRGA 4ICLB 2W9CA 1HBNA 4YUDA 1B7FA 4QW8A 1WTBA 4B3TF 2F40A 3IAS9 4ES2A 2HS0A 1KTQA 2Q3PA 1RTJB 1J2VA 2VOOA 5B0FA 2EK6A 2ZBCA 2YNFA 4MAKA 4FXWA 5A8KA 4RNOA 1KVIA 4FF2A 4ED1A 1I6JA 2W7AA 1BQMA 2B6AA 1FTCA 3OR2B 1VQ5S 1QJHA 3TNVA 3OXGA 3H8YA 1KRPA 2DRAA 1IR0A 5LJ5Y 4TYBA 3TANA 5DDQC 2DH9A 3DOLA 3CD6S 2PA8D 4QIVA 1BLUA 1M5SA 1MW7A 2JSXA 3M8SA 5J1EA 2V8VA 3OFEA 2D1CA 5A8RA 1BQXA 1NK4A 1LFPA 4UQTA 1IKXB 1C4AA 3I0SB 1P9QC 2VV5A 3D0GE 2B56A 5I3UB 4MYTA 4PUOB 1JK9B 2A2CA 3KHRA 2MY7A 4A8MP 2CG4A 2CQIA 3DDKA 5F8IA 1KVJA 5F3TA 2Z2MA 2KXHA 4ICLA 1X0FA 2FHMA 3FRZA 3P5TL 2W4DA 4O4RA 2W8LA 2YVSA 1BQNB 5HLFB 3PEJA 1RP5A 3JTNA 4YDXA 5E3RA 4FXDA 1RTJA 1RKIA 4LIWA 3FDSA 1H7WA 1JNRB 4B3OA