3KK3B

Hiv-1 reverse transcriptase-dna complex with gs-9148 terminated primer
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
427
structure length
407
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 96
structure length 407
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B04
3PW0A 3BSAA 5C5JA 4O44B 4IFYA 1TQLA 3KJVB 4K4WA 5DQIA 1T94A 3OL9A 3KK3A 1FKPB 3I5AA 3KLFB 2D3UA 3DOLB 1GX5A 3CJ4A 3H5UA 3MTKA 3DDKA 4NLYA 4YR2A 1HMVB 2RDJA 4DL6A 1S9GB 2VG6A 5F8MA 2BR0A 5CYMB 3RBEA 4ZVFA 5C42A 4IG3B 5KFFA 5KFJA 3EPIA 2AX0A 1JLAA 3QLHA 3UR0A 3OL7A 3IRXB 3V4IB 1S4FA 1SH3A 4JUZA 5L1JA 1REVA 3BSNA 3V6JA 2FVSA 3PW7A 1BQNA 4KFBB 3H5SA 3RAXA 5KFVA 4PWDA 3DYAA 1C0UA 3PJWA 4O4GB 1TV6B 4ICLA 4WYWA 3KLGB 4IR1A 3KK2B 5F9LA 2E9TA 1N4LA 5J2MB 4QPXA 4TLRA 5DG9A 4TQRA 2XGPA 5DG7A 2BRLA 3N6LA 3EPGA 4K4TA 2OPSB 1Z4UA 3BQ0A 3I0RA 2IBKA 3C6UB 3MEDB 2JEFA 3IGVA 1SUQA 2HWHA 1U09A 3OSPA 3MEGB 5KG0A 3TAMB 3DRSB 1IKXB 1VRUB 1S0NA 3OHAA 3E51A 2IJNA 3H40A 4GC7A 1S0OA 5KT5A 1LW0A 3DRPA 1T05B 3GIJA 3ITHA 1RYRA 1JLEA 1LWCA 5KT2A 4U7CA 3UQSA 2OPRB 3I0SA 3MR2A 4Q8FA 3DI6A 5HBMA 3V81B 1CSJA 3Q8RB 2IAJB 4ED8A 4O4RA 4NLPA 5D3GA 3T19A 4K4XA 1N6QA 4NRTA 2ATLA 4ED2A 4K4UA 3GIIA 3GQCA 3ICLA 3PZPA 2WONA 1C0TB 1RT2B 3IS9A 4RNHA 1HQUB 2W7OA 2XGQA 4KO0A 4H54A 4IKAA 3I5CA 1RT6B 3OHBA 4OL8A 1RTIB 3CDWA 3KMSA 1SV5B 5J2PB 2BRKA 4IRCA 3CJ0A 3OSNA 4J9LA 2OPQB 3QZ7A 2QV6A 4Q0BA 4KAIA 4TYAA 1HPZA 1RYSA 2C22A 2UVVA 3PW5A 3NGDA 5KFTA 4TY8A 1S1XA 3QYYA 3BGRB 2FVQA 4Y2CA 4G1QA 4ZVHA 3T5LA 3CWJA 1N48A 5HLFB 4HYKA 4K4SA 3G86A 4ECRA 3IGNA 3MECA 5FDLA 3PW4A 2HNYA 5C24B 2E9ZA 1EP4A 4RW4A 2VG5A 1QAIA 2HMIB 4URQU 4MK8A 3E01A 3DLKA 2WHOA 1T3NA 2EC0A 4IOBA 3MR5A 1MU2A 4I2PA 1S1TA 1RA6A 4IG0B 3G6VA 2JC0A 4RW7A 3LP0A 5F9NA 1GX6A 4RNFA 4RNOA 1IKWB 1MMLA 2GIRA 4NCGB 2W8KA 2W8LA 1S6QA 1TVRB 3DMJA 3OLAA 4DL4A 1C1BB 3BQ2A 5DGAA 2ILZA 2WCXA 3H4BA 1JXLA 3H59A 4RW6A 5KG3A 2ASLA 2E9RX 2UUWA 1RT1A 2VG7A 3FFIA 2UVRA 3KHHA 5HP1B 1RTDB 4RW8A 5J1EA 4DL7A 2IMWP 2DPIA 1R0AA 4ZPCA 1EETB 5L1IA 4MK9A 3N6NA 4X2BA 3MR3A 2OPPA 3DRRA 4J9RA 3IG1A 4KV8B 3JSMB 2R2UA 2VA2A 1IKYB 4IFVA 3DM2A 2IA6A 3KLIA 3SFUA 3BR9A 1RAJA 2AX1A 4WE1B 1RTHB 4DL5A 3KLEB 4R8UA 4F4WA 4O3SA 4JV1A 3Q8PB 2HNZA 2RKIA 1RTJA 4DG1A 2YKMA 3KOAA 5KFNA 3M9OB 3M8QB 4I7FA 4ZMMA 5KFKA 2R2RA 1S48A 3KLHA 5I3UB 5KFZA 1S1WB 3FDSA 5J2QB 4TXSA 2IM0A 3NAHA 1RT7B 3CJ2A 4MIAA 5KFQA 4KKOA 5J2NB 3QO9B 1W25A 2J6TA 2B6AB 1LW2B 1UWBB 1JLQB 5KFMA 1HNIB 1QAJA 1RT5A 5KG4A 3CIZA 4K4ZA 4NLVA 4PUOA 4QWBA 3H2LA 3GILA 5DQGA 5EWFA 3KHLA 1ZTWA 4RNNA 2V4RA 2XCPA 4Q43A 4O44A 3QGHA 1IKVB 3TVKA 2IC3B 3KJVA 3NKYA 3N6MA 2IM1A 1FKPA 5DLFA 4EO6A 4ECWA 3KLFA 3ISNC 3H98A 3DOLA 4IH5A 1HMVA 3LP2B 5C25B 1S9GA 1N5YB 4J9PA 4ECYA 3KK1B 2BQRA 2I5JB 5CYMA 4O3QA 5KT7A 2YNFB 4ECXA 1XR5A 1VRTB 4IG3A 2B5JB 2HNDB 4KE5A 4Y34A 3BQ1A 4WXWA 4RU9A 3V6DB 3VQSA 5KG7A 2BQUA 1N56A 4RUCA 2YNGB 3IRXA 3V4IA 5KT3A 5KFRA 2FVRA 4KFBA 2W9AA 2HAIA 2IM2A 3CJ3A 4F4ZA 4KSEB 3LP1B 4O4GA 1TV6A 3M9NB 3KLGA 3KK2A 5J2MA 1RDRA 2JEGA 1HQEB 2XCAA 2YKNB 1S0MA 4KHMA 4ZP8A 4LSNB 3C6UA 2WRMA 3MEDA 2XI2A 1SUQB 2D7SA 4HKQA 4WFYA 4K4YA 2VA3A 2RF2B 1TKXB 3MEGA 1C2PA 3TAMA 3FRZA 4WZQA 3DRSA 1IKXA 3NAIA 1JLGB 4LSLB 2AGOA 4ZVGA 1JLBB 1DTQB 1JLFB 3HVAA 3T5HA 1T05A 3NBPB 3DLGB 2OPRA 3M8PB 3LAKA 1S1UB 5K14B 3V81A 1OS5A 2IAJA 1S9EB 4IR9A 1RT3B 1ZTTA 2JEIA 3HVTB 5KG2A 5HROB 4NRUA 2YNHB 1JKHB 4I2QB 3KHRA 3DLEB 3LAMA 3QGGA 3DOKB 4WZMA 1C0TA 1RT2A 3QIDA 3C6TB 1BQMB 1HQUA 2HWIA 4FS1A 1RT6A 5EWEA 5KG6A 1RTIA 1T03B 2XC9A 1SV5A 5J2PA 4J9NA 5KFCA 2R8JA 4DEZA 4IQXA 2OPQA 2YNIB 1TKTB 4PQUB 5KT4A 4ED1A 2ALZA 2AGQA 2FLPA 4TN2A 1JIHA 4MH8A 5KFIA 3BGRA 2O5DA 4ZPBA 4WXOA 5HLFA 5KFWA 5CYQB 3V6HA 3PR5B 3BSOA 4ECZA 4Y2AA 3EZUA 5C24A 5I42B 3RAQA 3QZ8A 4WFZA 1QE1B 3MEEB 5F8GA 2IM3A 3H5XA 1RT4B 2HMIA 4EBDA 5F8JA 4TY9A 1DTTB 2D41A 4MIBA 2C2RA 1S1TB 4RUAA 4Q8EA 2DPJA 4IG0A 5KFHA 3RB3A 4ED0A 4NLGA 2I1RA 1HYSB 1IKWA 4NCGA 2OH2A 1TVRA 1C1BA 1FKOB 4IH7A 4ECTA 1S1VB 4YR0A 5KT6A 2JEJA 1KLMB 4RW6B 4WFXA 3PJXA 3V6KA 4R5PB 3MF5A 5DLGA 4H4MB 3GV7B 1TKZB 2BANB 4NZ0A 2WTFA 4ZHRB 5EDWA 4J9KA 1LWEB 3KLVA 5HP1A 1RTDA 4ZPAA 4DL2A 1I6JA 4NLQA 2W9CB 4YP3A 4XO0A 1EETA 4H4OB 4M94A 2W9BB 2BE2B 3T5JA 1TL3B 4J9SA 1C1CB 3ISND 1S9FA 4KV8A 3JSMA 4B3OB 1LWFB 5F8LA 5L9XA 2F8EX 4NLTA 4MFBB 2B43A 3SFGA 4KB7A 4RW9B 3FQKA 4YMEA 2ZE2B 1J5OB 1HNVB 3GIMA 4WE1A 1RTHA 4MKBA 4J9QA 3KLEA 3QIPB 2WK4A 2R2TA 4IDKB 4JV0A 2ZD1B 4DG1B 2YKMB 3JYTB 1FK9B 2C28A 1S6PB 1JLCB 3M8QA 4ID5B 5KFUA 4ED3A 2WOMB 1TL1B 1QUVA 1DLOB 5I3UA 2R8IA 1S1WA 4F4XA 4IFYB 5J2QA 1RT7A 3KK3B 4U6PA 3OL8A 2QE5A 4QW8A 2C2EA 2FVCA 5J2NA 3QO9A 3Q8SB 2B6AA 1LW2A 1UWBA 4QWEA 1JLQA 4MKAA 1HNIA 3MFIA 2R2SA 2V0NA 3GIKA 2VG6B 4XPEA 1YVFA 4ZP7A 2JC1A 5KFDA 4ZP9A 4GC6A 4EEYA 3CO9A 1IKVA 5C42B 2IC3A 1NHVA 3LALA 1JLAB 3QLHB 3CVKA 4MK7A 3I5BA 4FBTA 4NYZA 4WYLA 3FSIA 2ZKUA 1REVB 5C25A 3LP2A 1N5YA 4RZRA 1BQNB 3KK1A 4PWDB 2I5JA 2FVPA 3FQLA 3IN5A 2YNFA 3DYAB 3H4DA 1C0UB 1VRTA 4URSA 2B5JA 2HNDA 5KFAA 2V9WA 4Y3CA 2AQ4A 3V6DA 4ICLB 3MFHA 2YNGA 4NLWA 2IJFA 4QWCA 4RNMA 4O3NA 4O3OA 5F8HA 3NMAA 4ZP6A 3M9MB 2V4QA 2W7PA 5DG8A 3HHKA 4FS2A 1S10A 2OPSA 3I0RB 1S97A 2UVWA 4EO8A 4EYIB 2FJXA 3LP1A 2FJWA 4LQ3A 5KG5A 1VRUA 5L1KA 3RB0A 5L1LA 1LW0B 3DRPB 3OL6A 1HQEA 3ITHB 2YKNA 1JLEB 2ILYA 4QWAA 3NL0A 1LWCB 1KHVA 4NLSA 4LSNA 3I0SB 2AWZA 2WB4A 4O3PA 1KHWA 3DI6B 5HBMB 2FJVA 3T5KA 2RF2A 4QW9A 1TKXA 5D3GB 2R8KA 3PW2A 2UVUA 1JLGA 4LSLA 2J6SA 4F50A 1JLBA 1DTQA 1JLFA 3LANA 3T1AA 1N6QB 3CJ5A 5KFGA 5KFXA 3TQ1A 4NLUA 4EYHB 1IM4A 2J6UA 3KMQA 3DLGA 3NBPA 2WONB 5KFYA 3M8PA 4KHRA 1S1UA 5K14A 1K1QA 3IS9B 2XI3A 3Q8QB 4KO0B 1S9EA 1RT3A 3HVTA 1ZETA 5F8IA 4G3IA 4XPCA 5HROA 4ECUA 3QGIA 3MR6A 4IRKA 2YNHA 1JKHA 4I2QA 5DQHA 4EBEA 4Q0BB 3G6XA 4LQ9A 1HPZB 1XR6A 5EUHA 3DLEA 4ED6A 3CDUA 4QWDA 3PVXA 4TQSA 3DOKA 2R8GA 2CKWA 4NLXA 1JX4A 3C6TA 1BQMA 1TP7A 4TY8B 5KG1A 5KFOA 1S1XB 1T03A 3PHEA 4NLOA 3KHGA 4G1QB 2GIQA 3PR4A 3CDEA 3RB4A 3MECB 2YNIA 5FDLB 1TKTA 4PQUA 2HNYB 4IH6A 2BQ3A 4YQWA 4JV2A 1EP4B 5T14A 2C2DA 4RW4B 2VG5B 3UPFA 1NHUA 3E01B 3DLKB 3UDLA 3OLBA 5KFLA 4ECQA 4IRDA 1D1UA 1MU2B 4K4VA 4I2PB 3SI8A 4RW7B 3LP0B 5CYQA 4NLRA 4ED7A 3RBDA 5I42A 4F4YA 1QE1A 1S6QB 3DMJB 4ZVEA 3MEEA 3G6YA 5DGBA 1RT4A 2GC8A 4J9OA 3D28A 2ASDA 1SH0A 4URGA 1DTTA 2JLEA 2AU0A 1XR7A 4M95A 4ZPDA 1RT1B 2VG7B 3FFIB 1D0EA 4RW8B 1HYSA 5J1EB 2XWYA 4KBIA 5JUMA 3GV5B 2ASJA 1R0AB 1S49A 1FKOA 5JXSA 1S1VA 4NLDA 3KNAA 1KLMA 4ECSA 1SH2A 2OPPB 3DRRB 4R5PA 4TYBA 2D3ZA 4J9MA 4H4MA 4DL3A 3IG1B 1NNDA 1TKZA 2BANA 4EBCA 4ZHRA 1LWEA 4R0EA 3GV8B 4IFVB 3H5YA 1IKYA 3DM2B 5KFEA 3BJYA 3BREA 2W9CA 3KLIB 2FLLA 4H4OA 1K1SA 4O3RA 2W9BA 2BE2A 1TL3A 4R8UB 1C1CA 4Q44A 2HNZB 1WNEA 2RKIB 4YR3A 1RTJB 3GYNA 1HARA 1LWFA 4B3OA 1RA7A 5EWGA 2AGPA 4K50A 4I7FB 4MFBA 4ECVA 4RW9A 5F8NA 3KLHB 2UUTA 2ZE2A 1J5OA 3RB6A 1HNVA 3HKWA 2FLNA 2RDIA 2R8HA 3D5MA 3BSCA 3QIPA 4IDKA 2ZD1A 4KKOB 5KFSA 3JYTA 2CJQA 3HVWA 1FK9A 1RT5B 4ID5A 1JLCA 1S6PA 5KFPA 5KFBA 2WOMA 1TL1A 4PUOB 1DLOA 4Q45A 4FBUA
chains in the Genus database with same CATH superfamily
2FIUA 1AUDA 1GX5A 1HMVB 3OR2A 2DKOB 2HBQB 5CYMB 2VKZG 1FRMA 1NPPA 4NX9A 4PWDA 2HPUA 2DNYA 1QDUB 3TANA 3D6TB 2NXEA 3H2UB 1VHFA 1TMMA 2V2KA 3G82B 5ETVA 4KT0C 1RACB 1VRUB 4RJVA 4L76A 3DRPA 3FMWA 2DNKA 5KT2A 1S7HA 2AJ4A 3SQGA 2DR7A 1ZM3A 4PZVA 3GQCA 3PZPA 4KO0A 3OVAA 2XMUA 1XNRJ 2M88A 1SC1B 3PW5A 5C7PA 4WFBQ 5EGYA 1U0SA 4KGVB 3OXGA 4K4SA 1QY7A 4DFKA 3BB5A 2H51B 3IMQJ 1UA1A 2WHOA 2BW2A 1FJCA 4DSJA 2J7WA 4RNOA 1IKWB 1MMLA 3CCJS 3H4BA 4DV5J 2GMLA 1SJQA 4DL7A 2DPIA 4WU3A 3BS9A 3OTCA 4E98A 4QU6A 4C98A 3SQOP 4JI1J 3AT1B 3Q83A 1CG2A 3Q2TC 2GX8A 4ZK7M 1F5BA 1XEZA 4XDDA 1S48A 1F3VA 2PEHA 1W25A 2HS0A 4QWBA 3GILA 3H4DA 2E1AA 3TVKA 3KJVA 5CYJA 3ETOA 4LT6A 2UUCF 1NK6A 2RHQB 1NK9A 2V8GA 2FGCA 1F9EB 3C16A 1B4SA 3HHNB 4B17A 5J2MA 2UZAA 1HNWF 3MEGA 4DPTA 3FRZA 3DHXA 1FDAA 4OHVA 2E5IA 3IAS9 3DLGB 4L75A 3LAKA 3V81A 4RWXA 2EC2A 4DQSA 3D68A 3HHLC 3P6YC 3GSDA 1C0TA 1PILA 2H4WB 1P8GA 2RILA 4IQXA 3I32A 4DR5J 1NAQA 1SL1A 1VQ7S 3NGKA 1X9WA 4OLOA 2MGZA 3DDNA 1NJZA 1S1TB 2R7SA 2V4JB 2OLWA 2BBEA 3IRWP 4N76A 1PJ5A 4CO3A 1C1BA 2WAQD 4NWBA 4R5PB 1Q8LA 3PYEA 4XK8C 3GV7B 2BJ7A 3MM5B 3K8WA 4M94A 3MUVP 3C15B 4DPUA 1WUUA 3DXSX 1MW7A 2RH3A 1HNVB 2MKKA 1RTHA 4FKXA 2I38A 2UUAJ 3A8KA 2HHHF 1DLOB 4LF4F 2C2EA 1SJ4P 1NSQA 2RT3A 1X4BA 2I9SA 4ZP7A 5KFDA 4MK7A 2HFOA 2I2YA 1WKKA 2H4YB 5C25A 4ELUA 3ZTSA 1VIOA 2HK2A 3OTDA 1VRTA 4FKYA 2HS3A 4HTIA 4NLWA 4RNMA 4DLEA 1FWLA 3M9MB 2KN4A 5B0FA 4EYIB 3LP1A 5GADI 1AA1B 2V6AA 4FXWA 5D4NA 3PW2A 4F50A 4ZLLA 2ATCB 1TR0A 2XS5A 4M5HA 4L73A 3TJAA 2B56A 1FWKA 2V63A 1WHWA 4KQZA 4TY8B 3RB4A 1TKTA 4LFAJ 1GXUA 1X5OA 3CC2S 4ECQA 4DUTA 2B4PA 2A0FB 2DTJA 1U49A 3RBDA 1TUGB 1RWVB 2AU0A 1F1BB 4DQPA 2VG7B 3UN3A 3GV5B 4M5DA 1WD6A 3BYRA 2GQCA 4NLDA 4F2RA 4ZJQA 4ANDA 4B3TF 2BE2A 4RBTA 2RSQA 3M6UA 2GA7A 1HARA 2XMWA 4ECVA 2VFUA 1NEEA 2DISA 2HWTA 3QIPA 2GVDB 4IDKA 3UCZP 3FCHA 4K4WA 4UOGA 3AQPA 5IS2A 3RBEA 4ZVFA 3V6JA 1SH3A 1RAIB 3RAXA 1XN9A 2DD8S 2FPHX 4O4GB 4WYWA 2MQQA 2BRLA 1NXIA 2QIFA 2ASYA 3ZZYA 3I0SA 2IAJB 3W7BA 3PO5A 2JLFA 2MZ1A 4K4XA 1GK8A 4KIAA 3AODA 5IWAJ 4N47A 1VBXA 1RKJA 5FD1A 4H54A 2HRTA 1SJ3P 2A10A 2JL9A 4ZLJA 4ANCA 3NGDA 2WZ1A 2FVQA 3OXFA 4Y2CA 3G86A 2E5LJ 3J7A1 3GTYX 2EC0A 4IOBA 1MU2A 2G0JA 4YN3B 1VC0A 3LP0A 2MKJA 5U47A 1UPMB 2HRUA 5KG3A 1UEKA 4OYZA 3E3XA 2VD3A 4UF4A 3KJFB 1XMOJ 1GQEA 1NJIT 3OT9A 4DV7F 4N77A 3N6NA 2RRNA 4PWUA 5GMKa 2MLZA 1RAGB 4WE1B 1OQ6A 2DGOA 3M2VB 2HNZA 3FBEA 5KFNA 3H0PA 2YWHA 4LF5F 1ZM9A 1SJRA 4FF2A 5LMUF 1UMJA 4KKOA 1OYEA 3QO9B 1UVIA 2HHPA 1U24A 1FKPA 2BOAA 2CPZA 2CZ4A 4O3QA 5KT7A 2PSZA 5J1PA 3H7HB 5KG7A 2JH3A 3OTBA 2N4CA 4F4ZA 4OYWA 2C3UA 1UCNA 1RDRA 3AD7C 2E44A 2XCAA 3MAAA 4ZVOB 2K1RA 2XEXA 3FZ2A 3D67A 2XY6A 2LU2A 2RQ4A 1ZTTA 1SKRA 3IM9A 3O1LA 4I2QB 3FZBA 2F4FA 1N34J 2NR0A 2QLXA 4FS1A 2B9EA 1S12A 3VAKA 2FLPA 5HMWA 4DQRA 2HQ3A 3JTPA 2VFSA 4MH8A 2RRAA 5KFWA 3F44A 3FEXB 1U4BA 2PEBA 5F8GA 1RT4B 2Z57B 2CJXB 1DTTB 4DX5A 2CJKA 4C11A 2YWFA 8ATCB 5MAOA 1VS3A 1H7XA 4ECTA 1DARA 1RWPB 3K7RA 2EKNA 4XO0A 1B70B 4DV1F 2DO4A 4OX9J 3B8HA 3ISND 4MMOA 2VUGA 2ZE2B 1J5OB 2GCFA 3R3TA 4B9MA 3NS5A 3HSZA 2HQIA 2SXLA 3OUYA 4BBYA 2DYAA 3M8QA 2CPEA 2ZDPA 4OMFG 2VBXA 2FVCA 2QFJA 1UWBA 1JLQA 4F26A 4XPEA 1WG5A 2VBZA 2G2YA 1IKVA 3OVSA 3I5BA 3FSIA 3BO3A 1REVB 3AJ1A 2FHJD 4UZBA 1VQOS 2NCKL 1SQEA 3BM7A 5DS7A 3FQLA 3D6MB 4IUFA 2X1GA 1FNMA 4TU9A 2ZVIA 4B3MF 5ETNA 3I0RB 4P52A 2GVZB 1M1HA 3TUJC 2HAFA 1OWXA 1S0VA 3CSKA 1KHWA 3T5KA 4RPFA 1BC6A 5D3GB 2P8IA 1IJFB 3LANA 1FFGB 1S1UA 3IS9B 2CZ9A 1RT3A 1N0UA 5LM7E 4IRKA 4GKKJ 2KT2A 4OJGA 4Q0BB 3TA0A 1M0SA 1ZAWA 4FF3A 1JX4A 1TP7A 1RAFB 2JHEA 2YNIA 4OHZA 3MI7X 5CD4H 4WKYA 3H20A 5KFLA 2KRBA 4M5NA 1JJ2R 4CIOA 5ETSA 2YPZA 4L3KA 5ETLA 1G3OA 1O8BA 5JUMA 1B7YB 2XMAA 1GMVA 1KLMA 4DZ6A 2CQ1A 4JI2F 2ZOGA 2YX7A 1LWEA 3BJYA 1ZA2B 2CVEA 3HO1A 4KYZA 5ETTA 3VAHA 1C1CA 4Q44A 1PBUA 3GJTB 3J80U 3QWPA 4I7FB 3ADAC 4PXCA 4F4KA 1IBMF 3QAUA 2UP1A 1H72C 1X4GA 1IR2A 1X4HA 4DR7J 1JLCA 4PYAA 2GFFA 1TL1A 1RTZA 3U7JA 4OI0A 1HBNA 1N5TA 1ACMB 4USTA 2DGQA 2RNEA 4I68A 5KFJA 1KONA 3CE8A 2V67A 5L1JA 4HT5A 2XNRA 2RHSB 4UTGA 4DL0C 1CJVA 5DG7A 3H90A 1QAYA 2R7QA 3T1YJ 4GRSA 1OSDA 1AZSB 4TKTA 4HDHA 3FK4A 3Q8RB 1E6VA 4O4RA 1GEHA 5L9NA 2OD6A 4LR8A 1T0TV 5IQQA 2F4VJ 1SV5B 1NHKL 5LXYA 2BRKA 4J9LA 4PPDA 1IBLF 2OPQB 2L3MA 3DFEA 1EARA 1EP4A 3NCRA 2VG5A 3T1HF 4UUWA 3M05A 4I2PA 1RA6A 5F9NA 2ROEA 3GCXP 2EK1A 3H59A 1ITPA 1SCJB 5HP1B 1RTDB 4CH7A 3GG0A 3TAPA 9RUBA 5H9EJ 3OR1B 3GPAA 3PIPQ 1IKYB 2BM1A 2Z0GA 2R3VA 4NMLA 3KXDA 2CQ0A 3EVWA 5D4OA 5GAEU 2YKMA 1QJHA 4NXNJ 1OY6A 3IWNC 2A3JA 3VR1A 3FCVA 1RLDA 4ILMA 1FVSA 3ONQA 2CQBA 3KDOA 3CIZA 3CCUS 2CWKA 1W26A 2V4RA 3CCSS 2EFPA 4QR0A 5GMDA 3BN4A 2NUUG 3QRRA 4RUCA 3HDSA 4L3NA 2DR5A 5KFRA 2W9AA 3CJ3A 2RVJA 5K9FA 2B4VA 2OELA 3FRYA 2VA3A 1HWJA 1UFLA 2YBVA 2KVIA 4WZQA 3UNGC 4JI1F 3D7SB 2DNHA 2YWKA 1FF2A 2ZOFA 3DLLQ 4OZ2A 2AHOB 3EX7B 1KBRA 4MJKA 3QT8A 4DMZA 5KFCA 1J5EF 4DEZA 5KT4A 2AGQA 2DT9A 2DXFA 1RHKB 3I56S 4ECZA 2CQDA 2PI4A 3HFZB 4NCBA 4U9RA 2MY8A 2J8SA 1IR0A 4EBDA 4Q8EA 4ED0A 3M2UB 1T3OA 1ZZNA 1U7LA 1I3OB 4AL6A 3RRHA 1S1VB 2DR9A 2DNQA 1UKUA 1N32J 2CNOB 1UJ5A 3PFEA 1S6OA 4OI6A 2Y0SD 2DHHA 4G1PA 4JB8B 1VCTA 4MFBB 4B02A 2R2TA 3O6QA 1NSAA 2MJNA 3QJJA 2G4BA 4CNYA 1E6YA 1M5HA 2HFNA 1P9QC 4GMKA 4F3OA 2CDQA 3CB4A 2CXEA 3IM8A 2IDLA 1JLAB 3QLHB 1VJQA 3C14B 3R5DA 5IT4A 3LP2A 1QUPA 3BEGB 2GGPB 5JVGQ 2QT7A 2NPIA 1MG7A 3QNWB 5LSRA 3DGPB 1H38A 1IN0A 5DDRC 2F9DA 2XLKA 4EO8A 4K2XA 3QSIA 3ELHA 1EKSA 5D78A 4DR1J 3IR6B 1VRUA 3HLUA 4ES2A 4DR4J 2HQFA 4LSNA 4O3PA 3LQVA 4CLFA 2RF2A 2R8KA 3NWRA 2J6SA 2HIQA 5KFGA 3K57A 3KMQA 2DNRA 4HH1A 3R9LA 5HMXA 2J0XA 1H74A 2UUAF 1XMQJ 4XPCA 2CQIA 3T6JA 4H4KA 4TQSA 3FKBA 3SZ2A 1SXLA 3MECB 4YQWA 2YPYA 3PV8A 4LF6J 3DRYA 2CRLA 4CI0B 4RW7B 4LF8J 1FRLA 1YITS 2BYCA 3IAM9 4M95A 1U25A 3R7SB 2P5VA 2QMWA 3TA2A 1FXLA 5B0CA 1VJWA 1B0VA 4LFBJ 5KAKA 3F56A 1T9TA 2MY7A 3ZZPA 4ITSA 1RTJB 3MHYA 4DSEA 5AXLA 4OZJA 4XIUA 4IOCQ 1WSRA 1S4EA 3HVRA 1TFWA 1H98A 4LREA 3PM9A 3CJ4A 3DDKA 4LFAF 1S9GB 3BKTA 2Q43A 2BR0A 3NGRA 3EICA 2UU9J 3W2VB 1HBMA 1JNRB 1UW4A 3ZNUA 2DR6A 3MEDB 2J0QD 4FXDA 2IJRA 1S0OA 2CQGA 2IHR1 4NLPA 5AXKA 1FD2A 3O5TB 1PYOB 3R8YA 1UVMA 1RT2B 2KZMA 2LECA 4ZA1A 2ZH2A 2BJ3A 2QV6A 1HPZA 3TI0A 3CULA 4DWIA 3KG4A 2MKCA 1RSCA 3BGRB 5HLFB 3PW4A 2HNYA 4Q2MA 2NZ4A 4OZNA 2HMIB 3WX4A 4C97A 1S1TA 1CJKA 2M4MA 3CJRA 2GV1A 5HVHA 4FYVB 1JXLA 1RBAA 2CYYA 1DZ5A 2NPFA 2XS2A 5KOXA 4LFCF 1WC6A 3CW2C 2VA2A 3DM2A 5HI7A 3FEZA 2GMJA 3TVYA 2MLXA 5EX3A 4F4WA 4WWSA 4CO0A 4A8KA 2RKIA 3SDEA 5IWAF 1S1WB 3QSYB 1YJRA 5J2NB 3M2RB 2MSSA 1QM9A 4PUOA 5LJ3Y 4CM0A 4DFMA 4ECWA 1Q0NA 2N4DA 2UXDF 4ZLNA 4Y34A 3V6DB 2YNGB 2XMJA 5T41A 5ETMA 5CA5A 4KFBA 1J27A 3LGHA 3KK2A 3WDOA 1XMOF 5E41A 3JB9k 1RWOB 3GP9A 1JLBB 1JLFB 3BPDA 1QSYA 3QPIA 4NL5A 4IR9A 5AE1A 2YXLA 3TX8A 1JMTA 1RWXB 3UCGA 1VYAA 5KG2A 4X4PA 3D9BA 3DOKB 1FRXA 1I5OB 3RW7A 2HHQA 2EG2A 3NOCA 4YS2A 4ZN3A 1RHMB 3WQPA 1RKIA 4USKA 2LYVA 2Q3PA 1DY3A 1L3VA 1M5SA 1F5CA 2BX6A 2G1DA 2IM3A 4PXBA 2B9YA 3EDRB 2I1RA 2FY8A 2BJEA 1TVRA 1WC0A 3PNIA 2AIRB 2L9NA 2QMUB 3MM7B 1D09B 1NM2A 3MXHP 1CS4B 3F73A 3CCQS 4A8WA 1WC4A 2X7IA 3DXBA 4B3OB 1NUEA 3MM9B 3TZZA 5HSPA 1NCLA 1UTAA 3H8YA 2KG1A 4ED3A 3MPWA 1YZ6A 4AL7A 4QOTA 4UQGA 3W9JA 3MFIA 2HBRB 2OI2A 3M30A 3CVKA 4Y28C 3RRGA 2E7XA 1U0HA 5BXIA 4BHQA 1VQ9S 4CTAB 2F9JA 1P9YA 2B5JA 2HNDA 2CG8A 3R1LA 5HAOA 2CQ3A 2ZFHA 4I69A 4FS2A 3VVTA 3C46A 1NH8A 2YH1A 4P6QA 1QAXA 1LWCB 1X5PA 5DDQC 3LPEA 5A8RB 4LSLA 1B99A 4I4BA 4OJHA 3HP6A 1S9EA 2GMHA 1FT8A 1HBUA 3LF0A 4NZ7A 3BF4A 1O5JA 1ZS6A 4NLXA 5HVGA 1R8PA 3SV3A 1DBDA 5KFOA 4LF7J 2Y0BB 4AE5A 1G4CA 2RB7A 2JZ5A 2C2DA 4X84A 1NHUA 3CD6S 5CYQA 1F0XA 3U02A 3IR5B 3K5OA 4DFPA 5DJBA 2JLEA 4ZVQB 1R0CB 1VGYA 2OPPB 1WKJA 3IG1B 3GV8B 2HEKA 1HHTP 5KFEA 2YX4A 1UP1A 1RWMB 1K1SA 2LEAA 1OPZA 1RADB 5AXMA 2AGPA 1UL3A 3K17A 1NDCA 2E5HA 2QA2A 4NMXA 2C2KB 1PGZA 3OL9A 3Q2SC 4DL6A 4F0MA 1NBEB 4IG3B 3OL7A 4A48A 3H5SA 3WHIA 3KLGB 4M5IA 4ZPTR 5F9LA 3CEDA 4BDPA 1IWGA 1SKUB 4C0HA 1Z4UA 3UDVA 2XSJA 2HWHA 2CJBA 1X31C 2MYFA 3UDCA 3VGVA 2EXUA 4USJC 1F2HA 4IKAA 5JMNA 3AJ2A 5H9FK 2IPOB 5T7LB 3R97A 4B3RJ 3IGNA 4QYZJ 4M5JA 4CLLA 2FHJA 2JC0A 2H5JB 3L9ZA 2E1PA 2NYIA 4B3SJ 4Y2KA 1QD1A 2K06A 2VQEJ 3BH6B 4DV4J 4RW8A 4RWWA 1YJ7A 1HR0J 3HHEA 1YZ7A 1RUSA 4X2BA 3MR3A 1XC9A 4RU2A 2R2UA 3PG9A 4ED5A 1S99A 4JV1A 3Q8PB 3PRDA 4HACA 2EI5A 4NASA 4PXEA 4EMDA 2F4VF 4MIAA 4CLWA 5J1NA 2Z2MA 1APSA 3PX6A 5DQGA 1NDPA 2QLJB 2G2OA 4YDXA 1ULRA 1X4AA 3LUYA 4UZCA 1VC5A 1VFJA 2ZBCA 3TX0A 2HIYA 4C7QA 4KC5A 2GIFA 5A2QU 4ZVPB 3UDEA 1SQFA 2XS7A 2QG9B 2XI2A 1RZMA 4LRFA 4W4MA 1L3KA 3HD2A 2G1HA 2H65B 3PTWA 3HVTB 4NRUA 2YNHB 1WOPA 1RT6A 4KGMA 1Y5NB 1GMUA 4BS2A 3GR0A 3EDQB 4TN2A 2IBOA 3CCLS 3IC1A 3IWLA 4Y2AA 4WFZA 5A0YB 1T9YA 4O0IA 2JVRA 2AW0A 2VC1A 2C2RA 3OTOF 4PABA 2OH2A 4IH7A 1JNZB 2CNNB 3EM1A 4ZHRB 5IM0B 1IBCB 2W9BB 2RQKA 2CA9A 2YKOA 1HHQA 3ENWA 2IRUA 1LWFB 3RGIA 3O3LA 3SFGA 1PCAA 2Z56B 3OQ2A 2M8HA 3W63A 1MROA 3S8SA 4JV0A 4D3GA 1IQZA 1RABB 4DF8A 1VQ4S 4M8LA 1F9HA 3POTA 1KTVA 2O1PA 1I94J 1ZOTA 1HNIA 2FB0A 3FEYB 5C42B 1VHIA 2BVZA 2HFVA 4A47A 1BQNB 4HHHA 2AKWB 4F8RA 3RYLA 5AJ3J 3Q8YA 3G2XA 2A1BA 1PSDA 4LJMA 1MNEA 3UW1A 3TW0A 3G9CA 1TK0A 3QRPA 3QFHA 2M3DA 1N32F 1LW0B 3OL6A 1JLEB 3KWMA 4NLSA 5D0HA 2OAUA 1U2CA 4E8UA 3TQ1A 4I1TA 2PIIA 2ZBQA 1YDLA 4BWMA 2J6UA 1VLYA 5KFYA 1K1QA 4P7VA 5HROA 3MR6A 4OX8A 2AV5A 5M2PA 4ED6A 1TTHB 2YKQA 4CP5A 2NZCA 2XMTA 2HQDA 2V8DA 5DRKA 5AE2A 4WFAQ 4M1KA 1A6LA 3NGSA 2QA4S 4PQUA 2GJIA 2UUBJ 4CT9A 1PJ6A 2B7BB 3CMQA 1YI2S 4Y65A 3Q24A 2FQQB 4QJVA 2RIJA 1NKBA 3ZZRA 1NDLA 1XR7A 2P6TA 5HANA 1HYSA 4P72A 4DR1F 4XTTA 3OJUA 2O3DA 1TKZA 5E3AA 4R0EA 1IKYA 2F5GA 2KU7A 4FPIA 1FDNA 2XB2D 3DKDA 2B9WA 3W5YA 2ZH1A 1SIZA 1XMQF 4ILRA 4J9QA 4C8NA 3MCSA 1NU4A 4IFYA 3CMAS 4DV3J 2D3UA 1T8EA 2VG6A 2PFFB 2IA0A 4LF6F 2B3TB 4ES1A 3DN9A 2IYIA 3IRXB 4DLGA 1NLKL 5LL6d 3LWMA 4ELTA 2ZHOA 2GZOA 1U8SA 3FSXA 4LF1A 2VPWB 1IR1A 2DITA 2DY1A 3EPGA 4K4TA 1RAAB 4C8LA 4OYOA 4FYXB 1T05B 2OHDA 4USIA 1TL4A 3W60A 4K4UA 1WELA 3GIIA 1NPRA 4NI2B 3MAHA 1HQUB 4OL8A 3KMSA 3HKZD 4ZCIA 1SJ1A 2EFQA 2UVVA 5FDLA 2JFKA 3E01A 1FWPA 4IG0B 4FYDA 3PACA 4RNFA 2CAJA 2ILZA 1RCXB 1ZZFA 4DX6A 2F8HA 4UT4A 1WEXA 3GFYA 5J1EA 4CYUA 1EETB 2WSEC 2Y1RI 3MMCA 5D4LA 2CJAA 2BMBA 3CIMA 2AX1A 3CJ8A 4JI0J 4PG4A 3P49B 4ZDNA 2ADBA 1YRTA 4ZMMA 3WBZA 3D0GE 4TXSA 3NAHA 1RT7B 3JSBA 2FZCB 3KUEA 5KG4A 4NLVA 2XBPA 3ILOA 2KB2A 2KL8A 2HHVA 3GJQB 1IM6A 3JS9A 1A9NB 2YNFB 4CQ1A 1LFWA 1VQYA 3VQSA 5KT3A 3LPYA 1VQLS 5CXTA 4QYRA 3THPA 1SC6A 5C2CA 1TV6A 2ZKTA 4RO0A 4X4RA 2BKPA 3UN5A 4CO1A 3C6UA 2HVZA 3DRSA 2AGOA 1TZ0A 1DTQB 2VC0A 3OFGA 1OS5A 2DXEA 2FJDB 3C19A 3R7NB 1BQXA 5I3PA 3QGGA 3CJKB 4LBPA 3QIDA 2HWIA 1FNXH 2HKEA 5J2PA 1WC3A 5SZTA 3HJVA 5A8KA 1H2UX 4G1IA 4ED1A 2Z30B 1FJEB 2A2CA 4PRFA 2GW8A 3MEEB 3P96A 4NXMJ 2FHOB 3KKFA 2BUNA 2K2PA 4KPCA 4ID8A 4ZPVR 3QFWA 4H4MB 1HD0A 2MXYA 4HH0A 3TQEA 4DV2J 2XMVA 3HT3A 2YTCA 1BXNA 3GFHA 2WSCC 5F8LA 3R7BB 4WTOB 3FQKA 3PYFA 3CCWA 1K8AT 3V4MA 1T9VA 3KLEA 4K0KF 2ZD1B 2D3OR 4WIQA 4KTQA 2IVFB 2Z2YB 5KFUA 2CPDA 2HHWA 1YRUA 3GSIA 3QBCA 4K59A 4QW8A 3ZZ0A 5DZ6A 4YB6A 5A8WA 2MPUA 5EHHA 1K0VA 1N5YA 1N33J 1RHUB 2QYCA 2V9WA 4I6YA 1CULB 1WHYA 4ICLB 2OIHA 1SPBP 4CWBA 2W7PA 4XDCA 2WVFA 5A76A 2JJ4D 4YOEA 2EK6A 3IFEA 2MKHA 5HBMB 2FJVA 4J9VA 2EVZA 2PE8A 4DPWA 2I8EA 3NBPA 3A3NB 3Q8QB 1G7CB 2VJVA 9ATCB 4WJBA 5F8IA 4L72B 2QLFB 3S7RA 5FLXU 3PVXA 2CKWA 4YB1P 4GO5X 2GIQA 3HD1A 1K73T 1HD1A 1REGX 3W64A 2X51A 3UPFA 1Q8IA 3P45B 2WVDA 2PGCA 4NLRA 1RAEB 1NB2A 2EFNA 5D15A 1Y10A 2HYIB 2XYGB 3JTNA 1HW9A 5GAHU 1FERA 4CLPA 3AY0A 4DL3A 4C8MA 4HHJA 3HXMA 2ROGA 4IO9Q 3TUIC 3AA8A 2ZZNA 1RHRB 1RA7A 5D0GA 3E2EA 5JJBA 3N4WA 4FPRA 3KLHB 3W2WA 2WBRA 1YIJS 3MMAB 4Y2MA 5KFSA 2LKZA 5HQ8A 3HVWA 2NREA 2WOMA 1ZM4A 2M7SA 2ZITA 4FVCA 4YR2A 2HS4A 2ADCA 1RU1A 5KFFA 1CJUB 3M1VA 3EPIA 2Z58B 3Q8VA 3V4IB 3PX4A 3VAFA 2DGVA 4AD6A 2J0SD 1VC6A 4G65A 1XK8A 1YG0A 2QGFB 5DG9A 4TQRA 1FCAA 3L7UA 4X4SA 3H40A 1LFPA 3THTA 3ITHA 2OPRB 1N88A 3MR2A 2BABA 4K5RA 2DHXA 1EHWA 2MZQA 3K5NA 4U7UD 5BR8J 2WONA 2LDYA 4OYMA 4KAIA 1RYSA 4TYAA 3CNQP 2DIUA 1YK9A 3EVOA 4C8KA 5HATA 5CHCB 2R7TA 2ZNZA 1QAIA 2KXNB 3BGFA 2VZ9A 4JBCA 1X4FA 1WSVA 1V5VA 2W8KA 2W8LA 4DL4A 3AD9C 2C2ZB 1ZA1B 3US5A 3HFVA 4DUYJ 5H1SV 3HCXA 3W1YC 2D3O1 3G8QA 3DRRA 2ZC4A 4DR6F 4O0NA 3SFUA 3BR9A 3G96A 2EFVA 2DNOA 1FE4A 3AFGA 5DM7Q 1R8AA 5I3UB 3A1YG 2BKNA 4PEOA 2F65A 4WP8A 2J6TA 1RT5A 1LK7A 3L7OA 4C8ZA 1UJ4A 2XNQA 3N6MA 3KLFA 1S7IA 3KK1B 5K8MA 2ZM6F 4I0WA 4NYOA 3GLJA 4KE5A 4QR1A 1KTQA 4HT7A 5HQMA 3BDPA 4B3SF 3NWGA 3M6XA 1HI1A 1OSCA 2GHVC 5SUHA 3P5BP 4EZ9A 1HQEB 3ZTRA 1HR0F 4KHMA 4MYTA 1KQKA 1KQSR 1WEYA 1VQSA 3QT6A 2JFDA 4B9UA 3TAQA 2AP6A 2VONA 2AJ0A 2OSRA 1YHQS 2A18A 3LAMA 3MMJA 4FN5A 3SIPB 1V3ZA 1KC8T 1F3FA 3U27A 1KWMA 1LV5A 3K5MA 3DOMB 5I4MA 2O5DA 3U1MA 4YHHJ 2E66A 2PMWA 5ETPA 1FO1A 4DU7A 1DAXA 3FSYA 2DNGA 2DR8A 4IQMA 4RKUC 2KHCA 3RB3A 5H9EK 2MKIA 4NCGA 4DX7A 1FKOB 1HBOA 4WFXA 3MF5A 2BANB 1PJ7A 3KLVA 3CGIA 3M8RA 2Q1LA 1TK8A 1UEVA 4H4OB 1EZZB 3MM6A 3C66A 2AEMA 2H1YA 1D8YA 3R5GA 2JX2A 2V69A 3MMBA 2UXCF 3PDNA 1FK9B 1B7FA 4ID5B 1HIYA 2DRDA 3W5XA 2F8MA 4NPOA 3OL8A 1H2TZ 2WSFC 2B6AA 1KOOA 1TK5A 3EVMA 1VR6A 3OR2B 4DBQA 3C8YA 3FBCA 3SSRA 5LOQA 4PAAA 4PWDB 2I5JA 2FVPA 3VALA 1U48A 5KFAA 3TVZA 1RAHB 5B09A 3EZOA 3HHLD 4ES3A 1GXTA 2V4QA 1S10A 1KVJA 1KKHA 3TOQA 1M1GA 5L1LA 3DRPB 2YKNA 3LH2S 2WB4A 2VB6A 3SSSA 3RRKA 4QW9A 2FC9A 3SQGB 3CJ5A 3D6HB 4RBVA 2H3EB 2RQCA 2W2PP 4KO0B 1SQGA 1XR6A 3V2UC 1BQMA 2LP4A 3R2DJ 3KHGA 1S72S 3IXQA 4DJBA 3O8WA 4CLSA 4W98A 3VV2B 1YJUA 3UDLA 1AB8A 4JI7F 4AXJA 3FVYA 2ZC3A 3GJRB 1QE1A 2M2BA 3DHWC 5AJ3F 3UCUP 3BBCA 3MM8A 5BYQA 3HK2A 3WC2A 3EZ5A 1SH2A 2G2ZA 1VLOA 3MPDA 2F63A 2FLLA 2XYPB 1Q4RA 3UO0A 5BYRA 3GONA 3W5ZA 2L08A 1HWIA 1TELA 2OGUA 2VBWA 2UUTA 3RB6A 3VGUA 2LA4A 5GADU 3CD0A 1WJ9A 3KJVB 1RLCL 3RAMA 3KK3A 5DM6Q 1XBWA 1RJJA 5LSOA 4WK3A 2UUBF 4HLBA 3GB0A 2DNPA 2M8DB 3RJMB 4ILLA 4MKYA 2CPXA 3C16B 2DRBA 2J9EA 4CM2A 1IXKA 5B0DA 5J2MB 3N6LA 4YB7A 1KOHA 4ZVUB 2JEFA 1U09A 3MEGB 2R7WA 5KG0A 4C48A 3LWLA 1N36F 2EBEA 1C4AA 1P1LA 3V81B 3OD2A 4TU8A 1X7VA 3T19A 1YWXA 2HW3A 1C0TB 1S59A 1R8BA 2FYXA 3DLJA 2DBBA 3SXLA 1HQ2A 4N41A 3PKYA 4DV3F 3J7ZT 2WVEA 2MGZB 4RW4A 1GXLA 1XQIA 3D66A 1C1BB 3WX8A 3CD5A 2WCXA 5DGAA 3NP5A 2ASLA 1LOUA 3FFIA 2C2MB 1M5OC 1IBKJ 3BBBA 1ZH5A 2E1RA 2FLOA 3K5PA 4M63A 3N28A 2QYGA 1Y9OA 1U1RA 1XTZA 1CVJA 2DGUA 1RTHB 4R8UA 2B51A 2HBZB 3PX0A 4J91A 1EQMA 3KFWX 3NCQA 3FJ2A 4F0HA 3GFZA 1CBKA 1LK5A 2UV8A 4O44A 1M5PC 3I96A 4AT1B 4F3MA 5DLFA 4EO6A 3DOLA 4RLEA 5C25B 4J9PA 4CT8A 1VRTB 2ZUGA 3RU0A 1H2VZ 2R42A 2OEJA 4CLYA 2FVRA 3D1OA 2HAIA 3DCAA 4KSEB 3LP1B 2LLZA 1SJFA 3PEJA 2WRMA 4WFYA 1FFWB 1IKXA 2V8VA 4JI0F 1N5VA 3M6WA 2W2MP 5IV4A 1S5ZA 2E5GA 3MD1A 4C0OC 5ETOA 4PCQA 2LCWA 3Q89A 1TKTB 2UUCJ 2PT0A 1Z1ZA 4OI2A 1RWUA 1FESA 2MDAA 3OXLA 5KFIA 4DR2J 4P74A 2R9LA 2CQHA 3QZ8A 3WIUA 2AEJA 4PPZA 3IP0A 1KRPA 4WF9Q 1RWKB 4V19J 1JXVA 5B0EA 1TL7A 1VQ5S 4M5DB 3MDFA 5LSLA 4RW6B 4Z2XA 4P2SA 1HWLA 1HNWJ 3CJSA 1VQPS 3IBWA 2BE2B 2CJ9A 4KV8A 3JSMA 3VTIA 3VQTA 2B0GA 2ZDOA 4J5OA 4KB7A 3QIPB 4IDKB 4YUDA 4DG1B 1BE4A 4UW2A 2PO4A 4W92B 3PXGa 3AB4B 3DGVA 2FZGB 1OY8A 5J2QA 1DRZA 3F41A 1WF2A 2AF6A 3LA0A 2Y8WA 5GAGI 1W7WA 4ZKAA 1Y7PA 4FYYB 2QO3A 3W66A 2EFOA 4NYZA 5HK4A 2XZWA 1UJ6A 4NXMF 3EGZA 4WU2A 3R5AA 5ETKA 1LKZA 4X66F 2FHMA 1TU0B 2DH8A 1U1QA 1IQTA 1S97A 2PC6A 4X65F 1VISA 4DV2F 1K44A 3UVJA 3R5CA 2AWZA 3I0SB 1UFKA 2HLUA 1IVZA 1FJ7A 1X9MA 1TKXA 3KJQB 3PYDA 1BHNA 3T1AA 3B4DA 2KRRA 3Q23A 2RRBA 5THWA 3W3SA 4Q7AA 2FHKA 3RR7A 3MAQA 4G3IA 3K89A 2LXUA 3AQOA 1JKHA 1V5IB 1Q78A 4LQ9A 3TARA 2FTRA 3SYZA 4I64A 1Z2LA 3C6TA 1YTYA 2VOPA 4DXLA 4OI4A 3CDEA 4HHUA 5E5NA 3B54A 3EWGA 2KT5A 3MGJA 1D1UA 1MU2B 2QC3A 1N33F 3LP0B 3VGSA 4ED7A 4CCHA 5DGBA 2GC8A 4NZ6A 3BKUA 3MEKA 1FKAF 4NEYA 3W8PA 2CQPA 5KOWA 1HW8A 2HLTA 1TL3A 2HNZB 2M0GB 2IRYA 4CO4A 4DPYA 2VBYA 2C2NA 5GMEA 2LFVA 1NK8A 1PC5A 4F7VA 2KO1A 4KKOB 3JYTA 2CWXA 1FFSB 1S6PA 4QBUA 1KEKA 1NK7A 2ZWPA 3PRBA 1Y00A 3UR3C 1P6TA 1FKPB 3I5AA 3H5UA 4EK2A 5B0AA 1HWUA 2XWXA 3HSGA 4TNOA 1URRA 2QRRA 4HR2A 1V6HA 2HGMA 2XULA 2YH0A 3W62A 1VBKA 1T9UA 3NXZA 1C0UA 1RB0A 1BWEA 3OBIA 2XQCA 4JI5F 3BH7B 4WBFA 2G13A 4Z7YA 4B9TA 4B3TJ 3MAAB 3W9HA 2K1RB 3DNCA 3RTVA 2WB1D 2B8QA 1U2FA 1N6QA 4NRTA 2ATLA 2YQ3A 2J8AA 4JYAF 4HEA9 3B6BA 3CTRA 3MPYA 1DQ9A 4WKRA 2FC8A 4G1QA 4ANEA 3CWJA 5L8RC 3GWCA 4JV5F 4A8YA 4URQU 3MR5A 5C2GA 4C11B 1GX6A 1YBUA 4OYPA 1ZPWX 3DMJA 3M32A 1Q7LB 1RT1A 1S6UA 4CLZA 3KHHA 3T6BA 4ZPCA 1FE0A 1FXRA 1N5SA 4LVOP 2CADA 4WCEQ 1RWNB 3QT7A 3KLIA 1DHMA 5IFMA 2R7UA 2PMZD 2DB1A 3OUYB 3M8QB 4P7TA 1ICEB 5GVQA 3EXCX 2I0XA 1UWBB 1JLQB 2OO4A 1PC4A 2XCPA 1IKVB 4OFZA 4WK1A 1BWVA 4MYUA 2CIMA 3KTQA 4C6AA 3S6EA 4WFNQ 4A8XA 1PG5B 4OYAA 2J7UA 2JOQA 3MZIA 5LMNJ 1YGYA 1RI7A 4DV7J 1NK5A 1KFDA 1PKUA 2ZJRQ 5B08A 3J81U 1SUQB 4C8YA 2Y1IA 1SC4B 3K8VA 3TAMA 3QGPA 3CMES 5G0RA 4IOAQ 3T5HA 2X1FA 1R7IA 4CO5A 4LRBA 2ALYB 2NXCA 1S1UB 4LF5J 3Q0AA 1RT3B 4XAKA 5LMUJ 3KHRA 4HDGA 2E1CA 2F40A 5BYSA 4QYZK 4DZDA 1RTIA 2XC9A 4J9NA 2YNIB 1VK3A 4YDDB 2ALZA 5M2UA 3IBCB 4X4NA 4NA1A 4ZPBA 5IT9U 2MMYA 1LQ9A 3PR5B 5C24A 1KNZA 2ZH4A 2Z2LA 2BE7D 4R0JA 1S57A 1H0HB 2PI5A 1KLMB 5D0EA 4NZ0A 1LWEB 4DL2A 4LIRA 1R6YA 4JI8F 1I6JA 3I55S 1U26A 1O0PA 2A6OA 4OV6A 1SVDA 4Q5VA 1M90T 1C1CB 4ED4A 2HQGA 4KHPJ 2VPZB 3WIVA 4QIVA 3QJLA 2C3YA 3HHDA 2KI2A 1JLCB 1TL1B 2ZHBA 3TYTA 1WTFA 1G6BA 1HBNB 1LW2A 3OV7A 3BPSP 4DR3F 1YJNS 3I9ZA 1RE1B 2UXBJ 2IC3A 2YQ0A 4WYLA 3RZAA 2OUGA 4CRJA 4Y00A 3BDEA 1CJVB 4EZ6A 1U1NA 4MKVA 4QIWD 4EGLA 4DV1J 5KG5A 3CDAA 4GVBA 3QAEA 1E6VB 4OV1A 1JLGA 1HWKA 2K3IA 3M8PA 1DQ8A 2QSFA 5K14A 4KHRA 4A8OA 4F67A 1EIYB 4X64F 1HKAA 1K0TA 3A8JA 5DQHA 2JRSA 3DLEA 1NK4A 1RBOB 2VFVA 3TR5A 1Q53A 1T03A 2VJUA 4ZCKA 2DH7A 1EP4B 2VG5B 3QMQA 1WKLA 4I2PB 1EAYC 1N5QA 5L39A 4B3MJ 5I42A 2V8PA 2BACA 4F4YA 2HVEA 3D1QA 1JXEA 2QJ3A 3CF5Q 2AEFA 3D28A 2JLGA 5A2QY 2LQ5A 4ZPDA 3JQJA 1WG4A 3DC2A 1D0EA 2XWYA 5AT1B 5JXSA 2PD1A 4F4AA 4TYBA 2KH9A 1RP5A 3SCJE 2W9CA 1OQ3A 4AUKA 4F25A 4OIXA 3BO4A 1MN9A 2F3JA 4RW9A 1FX2A 5CZXA 2O66A 3BSCA 3GFXA 2AT1B 5K5MA 1EB0A 4E2FB 1XNRF 3MTKA 4ZIVA 4OJ3A 3LTOA 2FVSA 2QLBB 1U02A 4YB5A 2M9KA 3DYAA 3PFOA 3PJWA 1JK9B 4JI2J 4NOHA 4DV5F 2DCUB 3OHAA 2AJ1A 3UQSA 2W4DA 3SMZA 3DI6A 4ED8A 2B8PA 2V2VA 4YFUA 1IBMJ 4ED2A 3RBZA 4B9LA 2KXFA 1YJ9S 1RXOB 3FBBA 1CJTA 2DIVA 1S1XA 2J76E 2QMXA 1QVFR 1XERA 1LWXA 3A12A 5AE3A 3TRGA 3DLKA 2L9DA 2C1EB 3UI3A 2WW4A 2RUSA 2QA4G 1S6QA 3HHLA 3IBFB 4V19X 3GIRA 5F3TA 4LF9J 1R0AA 2VL1A 2W01A 3M8SA 4PG6A 2ACYA 3EYZA 4IFVA 3VAGA 2ZNYA 3ET6A 3CXCR 3G8SA 3OVBA 1HLWA 2GJFA 2Y3YA 2F1FA 4LIWA 3NG8A 3CO0P 2L41A 1ZPVA 2CPIA 1E6YB 5KFQA 2IVMA 4ZCMA 4K4ZA 2QL5B 2XO7A 3GZ7A 1AT1B 3T1HJ 3I6PA 4DR5F 1HMVA 3LP2B 4LUBA 4FVMA 2CDRB 1YJTA 5CYMA 3ZXWA 2IYGA 4DX8H 2BQUA 4UOHA 1R31A 1HFEL 5HQLA 2OEKA 1IBKF 1JJHA 3I4PA 3T3FA 3MR7A 4KGXB 4ZP8A 4LSNB 3G82A 2RF2B 1C2PA 1LXJA 4ZVGA 3HVAA 4PG7A 5HL7Q 2IRXA 1CC8A 2ZBPA 2VF3A 2L48A 1WWHA 4JI4J 2R8JA 1WC1A 1VK8A 3ZFVA 3SCLE 1KQFB 2ERRA 2VKRA 1JQGA 4X4VA 5ITHA 2D1CA 2BZ2A 4DF4A 3RAQA 3EZUA 2FD2A 5HVFA 4ATNA 5F8JA 3MCNA 5E3QA 3H25A 5KFHA 2CG4A 4DSIA 1IKWA 4USUA 4MTPA 1RWWB 1U6FA 3E8OA 4YR0A 4DU8A 3ZTPA 2IMOA 1MN7A 4J7CA 3T5JA 1D9DA 4OJ1A 2X1BA 1WF0A 4BLGA 3D0HE 1X0PA 3GIMA 2WK4A 3CCZA 4FF4A 4CLTA 5D4PA 2GHPA 1J5EJ 1QLNA 4EU0A 2VFRA 2R8IA 1N0VC 2JVOA 3R5JB 4F2SA 3GIKA 3I87A 4DR2F 3CCTA 3KDNA 2ZKUA 1WDTA 1CQNA 4C9DA 3VAMA 3JXOA 1Y3KA 1HBMB 2HHUA 2DO0A 2Z2ZA 5D0RA 2KJVA 2BW7A 4ZP6A 4N7TA 1X5SA 2KKHA 2VQFJ 4PG8A 2BE9B 1AFJA 4UUXA 5K8OA 1RBLA 4D3HA 2NUHA 2IY5B 1YLXA 3DLGA 1R6VA 2GAGC 5HO4A 4B08A 1PYTA 1HPZB 1Y0HA 2R8GA 2VDHA 4JV2A 2HNYB 1AUSL 4EUVA 4Z7CA 3CPWR 1TMJA 2E1MC 1I51B 1CJKB 4U8VA 1FI4A 5CD4A 2MLYA 2HFSA 4OI1A 2MQOA 2V4JA 1OO0B 4CZCA 2OD4A 2OTJS 1GFWB 4R5PA 3DM2B 3MM5A 3BREA 3UN2A 2RDDA 1WNEA 2HSEB 2RKIB 3SDEB 3C15A 1CPZA 4K50A 1TUVA 5F8NA 4C0BA 1HNVA 2RDIA 3G6ES 3M8WA 1QTMA 4NYPA 3HT0A 1MWZA 2EPIA 4PUOB 5D77A 1DLOA 3CCES 5I3QA 1U2RA 3HULA 4KJIA 2V5HG 3MOJB 3ZNJ1 2HVIA 2E5LF 3BGUA 2KYXA 2DEJA 4KFBB 3CDBA 4H4KC 3DLBA 3KK2B 4TVAB 2FGOA 4KGZB 1VIXA 5G4DA 2OPSB 3BQ0A 3EE3A 3FUYA 4KGKA 2RUGA 3B4MA 4M5LA 4ZJLA 3MCOA 2KG0A 3SEOA 1OMSA 3ICLA 1KQGB 1AXQA 4RNHA 3CDWA 3OSNA 2LA6A 1ZAVA 8AT1B 1EX8A 1WI6A 4CLKA 2HVHA 5KFTA 4TY8A 2KFYA 2KDOA 4FDFA 4JOUA 2HQCA 3BGLA 3EUNA 2E9ZA 3HFKA 1T3NA 3MPVA 3ILJA 1TVRB 3OLAA 4RW6A 2E9RX 4JI6J 3FC9A 2IVYA 2VG7A 4X4QA 2XY5A 3C3LA 1OJ4A 3MWBA 3KNGA 2IA6A 2KT3A 1VOMA 4F36A 4DG1A 3ZC4A 2ZZMA 5FLXY 2R2RA 2P2CB 1Y11A 3UE2A 3ILIA 3CCMS 6FD1A 2GVDA 1VQMS 1N34F 1T02A 5F0WA 2J9DE 3P4UB 5IV3A 3TA1A 3HI9A 4NEZA 1EQ0A 3OFFA 3M30B 4LSZB 4C3MA 3NNHA 1D8ZA 1R27B 4PWWA 4DOZA 1U0HB 4PG5A 4ECYA 4DHVA 4HTJA 3CT9A 2ZH6A 2B5JB 2HNDB 1Q8KA 2PMHA 1HL6A 2ZEJA 4ZS6A 4HI2A 3VAIA 1OY9A 2IM2A 2NSBA 1J2VA 4O4GA 3ZZZA 4LFCJ 3AAWB 3NEKA 5CAAA 2JEGA 4WP3A 4OLPA 4ZVTB 2M5YA 2OSQA 3J81j 2D7SA 4K4YA 3L09A 3M7VA 4N5SA 4LSLB 1X8DA 2IAJA 1FDBA 4OX9F 1S9EB 1HBUB 1NH7A 4F04B 2D69A 2N7CA 1YRXA 1BY9A 4M5KA 3ZO7A 1JIHA 1WACA 2RS8A 2UXDJ 3UD5A 1U45A 5CYQB 3MPUB 2QN6B 4TY9A 5LMNF 3PHTA 1B0PA 1NJWA 4HI1A 1UFWA 4NE9C 5DLGA 2JDJA 1Q86T 4DV0J 3T9NA 4ZPAA 1U1MA 3C2PA 3CUNA 2U2FA 2Y8YA 2DGXA 3EMTA 3K58A 3ZZUA 2B43A 2YKAA 4AYBD 4WE1A 3M2VA 4P2FA 3JSRA 2B4OA 4ALZA 1KSPA 2AYEA 3AA9A 4GKKF 3QO9A 1S79A 1F9FA 2A6MA 2HRYA 1YVFA 1KDNA 2JC1A 1VQ8S 4U8YA 4OQJA 3LALA 4FBTA 1GMWD 5HJXA 2DRAA 3W61A 3IN5A 2VICA 4KRWA 4Y3CA 2AQ4A 3GJSB 2CVIA 3BR8A 4F0KA 2XSJB 1NKCA 1FXDA 3I4HX 4ZPWR 5L1KA 3J7Z5 4QWAA 2NLWA 1WOOA 1QSSA 4KHPF 1I1GA 4EYHB 1IM4A 3KJNB 1X4EA 4CH1A 2XI3A 4QZVB 2Y1JA 3TJ9A 2VHGA 2EWHA 3VCDA 4I2QA 4EBEA 3G6XA 1Q95G 4DR7F 3D3BJ 5FIIA 1TFYA 3PIOQ 2UXBF 4C4WA 4OYIA 1UZDA 3EJMA 3H2VE 4ER8A 1RT4A 2ROPA 4J9OA 3MURP 1DTTA 2MJUA 1TAUA 2C42A 1M5KC 4RW8B 5E3CA 2CNKB 3I82A 3TJ8A 1UPPA 2KZZA 4DDFA 1ZBTA 4FXVA 1UVJA 3K2YA 4DV6J 3T1YF 5DZ7A 3QJPA 2OEMA 3GYNA 4HACB 2ZE2A 1J5OA 3D5MA 2LQ8A 1CEZA 5DDOC 1FRHA 1NZ8A 3NS7B 2KYZA 1U1LA 4NLYA 3SCKE 4P2MA 3OJSA 2VOOA 1REVA 1U6ZA 1VI7A 2DHGA 3HX9A 4TLQA 1NB7A 2E9TA 1N4LA 5CCLA 2W4PA 4ERDA 2IBKA 3I0RA 4U95A 3IGVA 1QVGR 2GVZA 3A3PB 1SUQA 3OSPA 2D9OA 2LXFA 1C4CA 3E51A 2NSCA 4U7CA 4Y6IA 1CSJA 2JSXA 5D3GA 2WVBA 3VF0B 4ELVA 3LW5C 4LRAA 3ENQA 2B9XA 3L3CA 4P71A 3IS9A 1S77D 1RT6B 4NXNF 3PJ9A 2OTLS 4Q0BA 5JVHQ 3NY0A 2DK2A 3QYYA 3T5LA 2ZZTA 1N48A 2VIHA 1PAUB 2G0CA 2AYMA 2DCLA 1F2GA 1UETA 2UUWA 3N0VA 2N82B 2XTJP 3J7AN 4AQYJ 4J90A 3HMJG 2GQ2A 1RAOA 3RG6A 1A7GE 1RAJA 1A0OB 1MROB 2MKYA 4O3SA 3M9OB 4I7FA 2J0WA 1GTHA 3VZIA 3MUTP 2ZVSA 2DH9A 3POTB 1NZAA 2HZAA 5KFMA 1HNIB 1QAJA 2LEPA 1FEHA 1VRQC 2CPYA 3ISNC 1V9OA 3CJTA 3N9UC 1YKWA 1R89A 2XZDB 1D9FA 1BD6A 3BQ1A 2G9OA 4RU9A 2Z4PA 2HFUA 2K7JA 4LR9A 4USMA 3SBMA 4M5MA 3CC7S 4LF9F 2IFXA 3TO8A 2QL7B 4PQAA 5HMZA 4W90B 3G4SS 3LGNA 2YQ1A 3NAIA 1AZSA 4BC7A 5LT5A 4CH0S 3AD8C 3P5TL 2CQ4A 1PIEA 5HROB 1CQMA 3FCWA 4LBIA 4ZLPA 1M1KT 2V94A 1SV5A 2OPQA 4JI3J 4PQUB 4B9VA 4OI3A 4QR2A 3V6HA 5AXNA 3BSOA 1JWWA 4RUAA 4NLGA 3BO2A 1FRJA 1HYSB 2MZRA 3RW6A 2C3PA 3DRXA 1TKZB 1GNKA 2BM0A 5HP1A 1RTDA 2GS8A 3OR1A 2PDAA 1JJ4A 2AYGA 3PKMA 4DR4F 4YMEA 4DN0A 4FNIA 1T95A 4C3LA 4MAKA 4A46A 1QUVA 2J7KA 4IFYB 4JI4F 3A8EA 3J7YU 2VG6B 1PO6A 1NHVA 1UVNA 3TZWA 4RZRA 3W9IA 3F0NA 3OTOJ 4LF8F 2QSWA 3ENAA 3MFHA 2HHSA 5DG8A 2LQ9A 4LBHA 3NL0A 3BZQA 4DPOA 4EI2A 3BKFA 4ZITA 1HNZJ 1NKEA 4LFBF 2UVUA 4JP8A 1XNQJ 4PXDA 1RK8A 3PY8A 4L6V3 2G0IA 1S76D 5K8PA 2DNZA 3PHEA 1Q8BA 2OKQA 3QATA 4LF2A 4UOFA 5FDLB 1ZYQA 4IO1A 3E01B 1AW0A 7AT1B 1V3RA 4DQQA 1B64A 4ZVEA 3G6YA 4URGA 1AFIA 5D6GA 2JWNA 1LXNA 4X4UA 3M2UA 4DUZJ 5J1EB 2UU9F 4CYUB 2H5EA 1ELOA 5HMYA 1S1VA 1UEUA 1T9XA 1GT8A 3MMCB 2E29A 2VQFF 3U1NA 3H5YA 2XMMA 1N54B 1ZM2A 4O3RA 2YVSA 4RUBA 2HGNA 3HSJA 2QLWA 2ZOMA 5F0UA 5EWGA 1WC5A 4P73A 4MFBA 2X3DA 2FLNA 3HKWA 3JQMA 5E2QA 1R8HA 2EKYA 2WVCA 6AT1B 4FF1A 1VQKS 2MSTA 3PW0A 1T11A 2A2DA 1TQLA 1B0TA 1EKRA 2O67A 5F8MA 1WEZA 1JLAA 3QLHA 3C14A 5E3PA 3KYLA 4U7UK 3Q86A 1YBAA 5KFVA 2FY1A 2GGPA 4USVA 1TV6B 4A8QA 3DGPA 2CPFA 3BBFA 5GAEI 3C6UB 1ZAXA 2C3OA 5CQGA 3R27A 3A3OB 3DRSB 1MMDA 2DNMA 4K5SA 5KT5A 2C3MA 4ZCLA 1KVKA 3PCOB 2Q66A 4AFFA 3D2WA 1H3DA 3J7YI 4A8MP 4S0MA 5HN0A 5J2PB 1IUJA 1FRIA 2BJDA 5A8KB 2H54B 5B0BA 2C22A 2YX1A 4X62J 2ZJQQ 2GNKA 2LXIA 4V1Ak 4HYKA 3MECA 4UY8T 1FDDA 2Q6CA 4MK8A 3UWTA 4QQBA 4RW7A 2AYBA 2R4FA 3BQ2A 1VMBA 2PA8D 3PO4A 1UA0A 2NQPA 4CDIA 5E0OA 5M2RA 4MK9A 1ROFA 2MHEA 4CLUA 2OFGX 1DQAA 4DL5A 3KLEB 4I56A 1RTJA 1EJ7L 3P8BB 3CJ2A 2OP5A 1L5UA 2RS2A 4J9KA 5A8WB 2DHAA 1UZHA 1MWYA 4IH5A 1N5YB 2BQRA 1S9GA 1TKDA 1X4CA 1W2IA 2U1AA 2BKOA 1BMQB 1Y5IB 3JSYA 3THVA 4QIGA 3W2VA 1UVLA 4JI6F 4ETZA 5IT0A 4KR0B 3R2CJ 1L3UA 4A4JA 3MEDA 4HKQA 4DI6A 1H6KX 2BXJA 1L3TA 3NBPB 2ABYA 2QEXS 4MT1A 3D4JA 3JAMY 1RISA 1LEOA 4WZMA 1RT2A 2ZBIA 1U1PA 4K8RA 3D54A 3BGRA 4WXOA 2Z8QA 5HLFA 2HMIA 2BOPA 2CPJA 4MIBA 1KFSA 1NK0A 3NRBA 5ADZA 5ETRA 7FDRA 2JEJA 3V6KA 2AD9A 3PYGA 2WTFA 3QRQA 1NSKL 4KH0B 3QQCD 4WPAA 2MZSA 4IYQA 1S9FA 3M8ZA 4OZ3A 2JNJA 2QFIA 3W2WB 2QA1A 1OIAA 2BJ9A 2WOMB 1AROP 1S1WA 4F4XA 4N8NA 3VHQA 5J2NA 3M2RA 2VFTA 4MKAA 2J5AA 2W7AA 4X4OA 3CO9A 5B7WA 3AB2B 3M1VB 3R1HA 1UVKA 4LF7F 4FZVA 2L9WA 5IZHA 3HSDA 4URSA 4DS4A 3V6DA 2YNGA 2AZ3A 4P75A 3HJFA 5DO2A 4WIIA 3HHKA 2OPSA 5IXUA 2UVWA 2YWWA 4DV0F 3DDIA 3ITHB 1UWAA 3FNNA 4ENOA 3K5LA 2OJ3A 3PEHA 4K0KJ 1JLBA 1JLFA 5KFXA 2P9CA 4NLUA 3GR1A 3I31A 2P6SA 2WONB 3AH6A 4KH1B 4OZLA 2CFXA 2P9EA 5EN1A 2BJ1A 4AXIA 4QWDA 4DS5A 3DOKA 1VDHA 5CCMA 1U47A 4NLOA 2CZVC 4IH6A 4IRDA 1O6XA 3CC4S 1SH0A 2H5IB 2ASJA 1S49A 3J81Y 2DXDA 5A6PA 3DRRB 1U6BA 2XY7A 3MM7A 3PRVA 4DCOB 1G1XA 1CS4A 2N3LA 1VBYA 4ZIWA 4B3OA 3MM9A 3ISZA 3DLHA 3OFHA 2W4CA 2RQMA 3ILLA 1RT5B 5KFPA 2BA9A 5KFBA 3UD3P 4FBUA 2ZBRA 1GH8A 5C5JA 4WTYA 2EG1A 3KLFB 2XHWA 5IT9Y 4DCPB 2J9DA 2RU9A 3TEHB 3HZGA 5FJ4A 1S4FA 4B3RF 4DSFA 4CNZA 2R7VA 4DFJA 2MTLA 3L95X 2QZ8A 4CTAA 1RQ0A 4IR1A 4QPXA 4TLRA 2V9KA 2VQEF 4ZJOA 4DV4F 1WI8A 1QTNB 2VU5A 3CCRS 4DQIA 4DV6F 1LWCA 3N01A 5A8RA 3QWUA 1HNXJ 2LDIA 3A8IA 2W7OA 3I5CA 3CJ0A 2RMLA 2IIHA 3VAJA 1DFDA 3ZZOA 2VH7A 2KVQE 1GMWA 2H9ZA 2HHXA 2LEBA 1Q79A 2LVWA 3OFEA 3WZ0A 4NCGB 3KUGA 1HBOB 1Q7YT 1SKWA 4FNHA 5CH7B 4DPXA 2N7YA 2HBYB 3ULHA 2OPPA 3MM6B 3IG1A 2OMLA 2VV5A 3AXMA 4QPTA 1AYEA 4OHWA 3S1TA 1V3SA 3MMBB 2XLIA 2ZH8A 5KFZA 2IM0A 2PFDA 2B6AB 3ZTQA 5EWFA 2YWEA 2I6WA 4RNNA 3QGHA 3WC0A 3NKYA 2IM1A 5EX0A 5IQ6A 1Q82T 3H98A 4GKJJ 3MD3A 3GCWP 3R5BA 2I5JB 1XR5A 3BYPA 4IG3A 4F02A 4ZN1A 4WXWA 4F3QA 2V50A 5IC6B 4LR7A 1VQNS 2AJQA 2ZH7A 4YY3J 1CC7A 3KLGA 3AHPA 3FMBA 4AQYF 2YKNB 1S0MA 4DR6J 3GU0A 2ZUAA 4B9SA 2KXHA 2MQPA 2VASA 3MCMA 1FD8A 5RUBA 2DGWA 3JQKA 4PKDB 1WORA 2BV3A 1U1OA 2B4UA 3GE9A 1BQMB 1HHSA 2V34A 4J9UE 2ZM6J 1SKSA 5T7LA 1I94F 2DHSA 3B78A 2CUYA 1QE1B 4X4TA 1CLFA 2D41A 2M70A 2HK3A 2DPJA 3MM8B 1UAWA 2RJZA 3PJXA 1Y3JA 2HZCA 3ENVA 4OYBA 4YP3A 3U1LA 3O44A 2F8EX 3AOBA 3N5FA 2E5JA 4J37A 4OZ1A 1WF1A 4MKBA 3QT5A 4NA2A 1NJXA 2Q79A 2GHWA 4LVNP 4RBUA 2MQ8A 4RX6A 3KK3B 4C8OA 3Q8SB 2P9GA 4JI3F 5CABA 4ZP9A 5MLCV 3AOCA 4LMZA 5ETQA 1PYSB 4ZVRB 2MHNA 2IJFA 4O3OA 5F8HA 1MLAA 2FJWA 2V2ZA 3RB0A 3ZTOA 1BLUA 2XLJA 4YEAA 2E7WA 2W2OP 1X9SA 2KFNA 1FJGJ 3TEGA 2ZHAA 2UXCJ 3RUBL 1VBZA 3HVTA 1U1KA 2YNHA 3L4BC 1SIWB 4K2JA 5EUHA 1WHVA 3LOUA 3KG1A 2CQCA 4HVZA 1RHQB 4CO2A 2BQ3A 2KM8B 3UNYA 4G6VB 4RW4B 3ZZTA 1Q1KA 1QSLA 3SI8A 2XG8A 1KVIA 1XJWB 3JTOA 3X3UA 5A0YA 2DNNA 2ASDA 2W1BA 1TUWA 5GAGU 3FFIB 4KBIA 4RR5A 2FUG9 3D1HA 2HZVA 2W25A 3KNAA 2FDNA 4ZHRA 2DEIA 4ETXA 5IM0A 2W9BA 2FJEB 1HNZF 4R8UB 2CPHA 2HHTA 4YR3A 3NLCA 4P9SA 2MB0B 1LWFA 4QU7A 5HJYA 1XNQF 2DGSA 5IOLA 4AL5A 2GO8A 3CD7A 3B82A 4M5GA 4Q45A 1NDKA 3NS6A 4O44B 2PN6A 1NRKA 1OYDA 4TU7A 3DOLB 3N5BA 4JI7J 2RDJA 4GO7X 5C42A 7FD1A 2V2QA 3UR0A 2WBMA 4JUZA 3K0JA 1OPIA 1BQNA 3UFCX 3OPKA 3VVUA 4DSKA 4LRCA 2ZH3A 4DUZF 3X1LB 1G2EA 1IKXB 1S0NA 4DSLA 1LW0A 3GIJA 1RYRA 2R7XA 1JLEA 1Q5VA 2M52A 4Q8FA 2RD5C 2POKA 1UW9A 4PR6A 8RUCA 2YKPA 5K8NA 3OW2R 1SBRA 2EW9A 1F60B 4IRCA 1FHTA 3QZ7A 3GG1A 1D9AA 4UQTA 3G8TA 3VGTA 4FYWB 3M4XA 3K59A 5KTQA 2FJAB 3BV8A 1WOSA 5LXRA 1TL7B 3TP2A 3CJQA 1TAQA 2UVRA 3KG0A 1N36J 3SCIE 2HFZA 2IMWP 4Y2IA 4B9NA 4J9RA 4KV8B 3JSMB 2MZTA 5F41A 4WP9A 3KOAA 6FDRA 1M5VC 3IR7B 3FDSA 5J2QB 3VZHA 1JB0C 4QIEA 2BJ8A 1MSWD 4X62F 3H2LA 3KHLA 1N8RT 2K3KA 1WTBA 5K20B 3CCVS 1FTRA 2LMIA 4I6WA 5L38A 1N56A 1F6TA 3IRXA 4K7QA 3LGMA 3HF5A 4OHXA 2MEWA 2R7RA 4GVLA 3UVJB 3BGOP 2UV8G 3TWZA 1TKXB 2KM8C 1T05A 3A13A 4OZ5A 4BWJA 1YJWS 2RAQA 3TUPA 2JEIA 2H48B 3EGNA 1JKHB 4OHYA 2CNLB 4NI2A 4O23A 3DU5A 2GAHC 2HHHJ 2J9CA 3C6TB 1HQUA 2NXNA 1NSPA 4LF4J 4E0DA 5KG6A 2K7KA 2LQJA 1Q81T 2QTWA 1T7PA 3TZYA 3V5RA 2QL9B 1FX4A 1KD1T 3H5XA 4QIFA 1RHJB 3D0IE 1FNOA 2XMKA 4IG0A 2FZKB 4C3KA 5E3RA 1Y5LB 5KT6A 2HG4A 1RCOB 4L74A 4NLQA 1P27B 3H42A 1EETA 1NPKA 3N79A 1TL3B 1FVQA 2V68A 5L9XA 4NLTA 3G87A 2CQ2A 1WG1A 1Q16B 3JYTB 2C28A 1S6PB 1NJYA 2GJ2A 1U8WA 2F7VA 4U96A 1RT7A 3JAMU 4KPYA 4GC6A 1H7WA 3D6FB 4EEYA 1KLNA 4NCAA 1KR4A 2W24A 2HGLA 1GTEA 5DETA 2YNFA 1C0UB 4QCLA 2QX0A 1YBTA 3L7PA 1PBAA 3NMAA 2XSFA 3TNVA 1K9MT 4LQ3A 4EWTA 2ILYA 3M6VA 1KHVA 2HVDA 1LNQA 2K8GA 1DTQA 1N6QB 3KUHA 3EGWB 1NO8A 4ECUA 3QGIA 2ZJPQ 3CJKA 2E7VA 4MIWA 2LQBA 4G1QB 2RU3A 2Q6BA 2DVIA 5LJ5Y 4X66J 3DMJB 3MEEA 3M32B 1RT1B 2ZWOA 4X65J 1F5AA 4ECSA 4J9MA 2D3ZA 4H4MA 1VQ6S 1SL2A 3KLIB 3NGTA 2DJWA 4PYDA 1Y4ZB 1HI8A 2EBGA 2W2NP 2D74B 2R8HA 3P3DA 2ZD1A 2VDIA 2CJQA 5BR8F 1SI9A 3VWSA 3BSAA 1BGXT 3LO3A 5DQIA 5IC4B 1T94A 4BCAA 1KS2A 1SL0A 5L46A 4N8OA 2AX0A 3W65A 3UD4P 3HZEA 3BSNA 3DU6A 4RL1A 3PW7A 3Q22A 1CULA 4ICLA 1R43A 4R25A 4BC9A 1X0FA 2XGPA 2AMCB 3W8GA 4DUYF 3TAMB 2APOA 4GC7A 2IJNA 3GMGA 3SV4A 5G0RB 3OTEA 5HBMA 2DGTA 4P10A 2AZ1A 4I6AA 2OMOA 3GYXB 4OX6A 2Y9HA 1NMEB 2XGQA 1Q5YA 3OHBA 1GAOA 1RTIB 4P2XA 1X4DA 1WHXA 3FGVA 3HPOA 2KFZA 4OX7A 1WDDA 2GQQA 4ZVHA 1FEEA 4ECRA 3RR8A 5C24B 2X1AA 2ACMA 3G6VA 4A8SA 4N56A 4JI5J 2GIRA 1N52B 1MMNA 1H73A 4EFAC 4DCJB 2BEFA 2XYHB 5F3ZA 5L1IA 2DY9A 1W2BR 4I67A 2X3GA 4JYAJ 4NA3A 4OYXA 4USHA 3BN7A 1Z2ZA 4UOCA 1HNXF 5KFKA 3KLHA 4USWA 3MMAA 2MQLA 2NXJA 3AOAA 1FTCA 1LW2B 1XWLA 3SSQA 4HL9A 2CJYB 4C2MA 4JV5J 1ZTWA 4Q43A 2IC3B 2OFHX 2VPXB 4ECXA 3AJDA 2B7CB 1CJUA 4YHHF 3V4IA 4Y0FA 1X5TA 5DDPC 2LU1A 4FP9A 4U67Q 3TZXA 1URNA 5A6WA 1R8CA 2YY3A 3M9NB 2VODA 1B3TA 4GVBB 1SB6A 1KN6A 1JLGB 3A4TA 2ZH9A 2OPRA 3M8PB 5K14B 3G71S 2MZJA 2DNLA 3DLEB 1RU2A 1IWAA 4LRDA 2AJ2A 5EWEA 1T03B 1JJCB 3FBFA 2ZH5A 1YJVA 3IWXA 2C2OB 4GKJF 4ZVSB 5I42B 1K47A 1T9WA 2W2QP 3NNCA 2VPYB 3I9V9 2KTQA 2Y1LB 1BUXA 4YY3F 1YSJA 2O01C 3ETMA 3NNAA 5EDWA 1PAEX 5B0GA 1SC3B 2W9CB 3R6LB 1KP6A 1DJ0A 4J9SA 1FRKA 1RGVA 5CZVA 1YQHA 1HA1A 4RW9B 2YKMB 5I3UA 4DN9A 3NGUA 4U6PA 2QE5A 3T41A 2NXUA 4QWEA 2XZTB 2R2SA 2V0NA 1DURA 5GAHI 3O2IA 3KK1A 1O51A 2NYHA 1R0BG 5D8HB 3DYAB 3IA0A 1L3SA 4QWCA 4O3NA 1IJEB 2V8HA 2XM3A 4JI8J 2XO6A 2FJXA 1TL5A 2RE1A 4UY85 1HQEA 3J80Y 3DI6B 2AJFE 2FJBB 3EGVA 4Q2LA 2HURA 3NOGA 4A8FA 3AXKA 2COLA 3MOZA 3NCPA 3RBXA 2XHCA 2D9PA 1ZETA 2MQMA 1MWQA 1CJTB 4DR3J 2R7OA 4OZ0A 1P1TA 3CDUA 2PA3A 2BDPA 3MTJA 1HI0P 5KG1A 1S1XB 3S01A 2KJWA 3PR4A 3R6GB 2KHDA 4Z37A 3TUZC 3D3CJ 5T14A 4ZOSA 3DOMA 1XIQA 3DLKB 3OLBA 5H9FJ 4K4VA 2GO9A 2MQNA 2NS1B 1S6QB 2N3OA 3HHLB 3T9ZA 2EEYA 2IDEA 1R0AB 1FKOA 1R3NA 5E33A 1NNDA 2BANA 4EBCA 4IFVB 1X60A 5BJRA 3M8YA 4H4OA 1XMBA 3ET6B 4RUHA 2WW8A 1FJGF 3NMRA 1FA0A 2EFGA 3HM9A 1D3WA 3GYGA 3EXYA 2MKSA 4X64J 1YX2A 3Q8UA 3MUMP 4KY3A 2YWGA 1FK9A 4ID5A 1IBLJ 5E7OB 3IO1A
chains in the Genus database with same CATH topology
3PW0A 2A2DA 2FIUA 1TQLA 3PRBA 1B0TA 1PGZA 1Y00A 3UR3C 3OL9A 3Q2SC 1P6TA 1FKPB 3I5AA 1AUDA 1GX5A 2O67A 3H5UA 1HMVB 5B0AA 4DL6A 1HWUA 5F8MA 2XWXA 3OR2A 4TNOA 5CYMB 1URRA 1WEZA 2QRRA 4IG3B 1V6HA 2HGMA 1JLAA 3QLHA 2VKZG 3OL7A 4A48A 2XULA 5E3PA 2YH0A 3KYLA 4U7UK 1FRMA 4NX9A 1YBAA 3H5SA 5KFVA 4PWDA 2HPUA 2FY1A 2GGPA 1C0UA 2DNYA 1BWEA 1TV6B 3OBIA 3KLGB 4ZPTR 4A8QA 5F9LA 3DGPA 3TANA 3CEDA 4BDPA 4JI5F 2CPFA 2G13A 5GAEI 3H2UB 4C0HA 1VHFA 1Z4UA 3C6UB 2V2KA 2XSJA 4B9TA 1ZAXA 2C3OA 2HWHA 2CJBA 4KT0C 3R27A 5CQGA 3DRSB 1MMDA 1VRUB 2DNMA 4K5SA 5KT5A 2K1RB 3DNCA 2C3MA 3DRPA 3FMWA 3RTVA 2DNKA 5KT2A 2MYFA 2WB1D 1S7HA 2AJ4A 4ZCLA 3UDCA 3SQGA 2DR7A 1U2FA 4AFFA 2Q66A 1ZM3A 1N6QA 4NRTA 4USJC 2ATLA 3D2WA 3GQCA 2YQ3A 1H3DA 2J8AA 3PZPA 4JYAF 3J7YI 4A8MP 4HEA9 4KO0A 4IKAA 3CTRA 5HN0A 3OVAA 2XMUA 5J2PB 1IUJA 1FRIA 2BJDA 2M88A 5A8KB 3MPYA 3AJ2A 1DQ9A 5B0BA 2C22A 2YX1A 3PW5A 2ZJQQ 2GNKA 4WFBQ 4WKRA 2FC8A 5T7LB 5EGYA 2LXIA 4G1QA 3CWJA 3OXGA 5L8RC 4HYKA 4K4SA 3GWCA 3IGNA 3MECA 4QYZJ 4JV5F 4UY8T 4A8YA 1FDDA 1QY7A 4DFKA 3BB5A 4URQU 2Q6CA 1UA1A 4MK8A 2FHJA 2WHOA 2BW2A 3MR5A 3UWTA 4QQBA 1FJCA 2JC0A 4RW7A 2AYBA 4DSJA 4C11B 2R4FA 1GX6A 2J7WA 4RNOA 1IKWB 1MMLA 1ZPWX 3DMJA 2NYIA 3BQ2A 1VMBA 3CCJS 3M32A 2PA8D 4Y2KA 3H4BA 2GMLA 1Q7LB 1RT1A 3PO4A 1S6UA 1SJQA 3KHHA 1UA0A 4RW8A 2NQPA 4RWWA 4DL7A 3T6BA 2DPIA 4WU3A 4ZPCA 5E0OA 3HHEA 3BS9A 1FE0A 1FXRA 3OTCA 4E98A 5M2RA 4QU6A 4MK9A 4X2BA 1N5SA 4LVOP 3MR3A 1XC9A 1ROFA 4RU2A 2MHEA 4C98A 2R2UA 4WCEQ 1CG2A 3KLIA 2OFGX 3Q2TC 1DQAA 2GX8A 4ED5A 4DL5A 3KLEB 1S99A 1DHMA 4ZK7M 4JV1A 3Q8PB 1F5BA 5IFMA 4I56A 1RTJA 2R7UA 1XEZA 2PMZD 2DB1A 3OUYB 3M8QB 3PRDA 4P7TA 2EI5A 4PXEA 4XDDA 1S48A 5GVQA 2F4VF 3CJ2A 2OP5A 3EXCX 4MIAA 2PEHA 1W25A 2I0XA 2HS0A 5J1NA 1UWBB 1JLQB 2Z2MA 1APSA 1L5UA 2RS2A 4QWBA 3GILA 2OO4A 3H4DA 5DQGA 1PC4A 4J9KA 2E1AA 3PX6A 2XCPA 1IKVB 3TVKA