3KK3B

Hiv-1 reverse transcriptase-dna complex with gs-9148 terminated primer
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
427
structure length
407
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
total genus 96
structure length 407
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B04
1MMLA 4RW6B 3KLFA 2CJQA 1HYSA 3FRZA 1JLBA 2JEJA 3DLEA 1TL1B 3EPIA 3M8PA 4RNOA 4KSEB 3DLKA 1S9EB 4MFBB 5KG4A 4TQSA 2R8JA 1TKXB 3HVTB 3MEEA 4LSNA 1DLOA 4U7CA 5HBMB 4KE5A 4WXWA 1HARA 1RT2B 4RUAA 3KLFB 4NCGA 1IKVB 3QIPA 1S1XB 1QAJA 4WFYA 5L1JA 4RNHA 1T3NA 3V81A 1SUQA 3QLHA 4MFBA 4QWAA 4NLQA 5KFSA 3BJYA 4I2QB 4K4TA 4HYKA 4EBDA 1EETA 4ED2A 3CJ3A 3GQCA 5KFUA 3FQKA 3Q8PB 3CDUA 4KBIA 4PUOA 5KFGA 1S97A 4JV1A 3V6HA 4DEZA 5KFFA 2RKIA 1JKHB 3KK1A 4IG3A 4KHRA 1EETB 1TQLA 3V6KA 2JEGA 3MFIA 5I42B 3KJVA 4ZP8A 3GYNA 2ZE2B 3KK1B 2OH2A 1REVB 4KFBA 3E01B 1RTHA 2VG6B 1D1UA 3LP2A 1S4FA 3M8QB 3I5BA 3BSOA 1R0AA 4NLPA 2R2UA 3TVKA 1RT5A 4G3IA 3QGIA 2YNHA 2XI2A 4RUCA 2RDJA 3CJ4A 3G6YA 4NLRA 4ECYA 3I0SB 4X2BA 3IRXA 3OSNA 2D41A 4YR0A 1BQNA 1TVRA 5DG7A 3ISND 1R0AB 4G1QA 1TKZA 1KLMA 1RTJB 4F4YA 4RW4A 3RB4A 2YNFB 2UVUA 4JUZA 3GIKA 3I0SA 3GIJA 5F8LA 4IR9A 4RW7A 5J2QA 2IC3A 3MR6A 2BR0A 2BANA 4LSLB 4MK8A 3MEGB 4MIBA 1N48A 3DI6A 4KB7A 3MECA 3GIIA 2YNFA 4ZP6A 3GIMA 4ECTA 2UVRA 4MIAA 3DM2A 1DTQB 1IKYA 3C6UB 1LW0A 1UWBA 4XPCA 2R2RA 1RT7A 4IRDA 3KK3B 4TYAA 1S9FA 2BE2A 3N6NA 5EWFA 3I0RB 1C0UA 4NLDA 2W8LA 4IRCA 4NLVA 2ALZA 1LWFB 3JSMB 3OL6A 3H4BA 1DTQA 3D5MA 3BGRA 2RDIA 2E9ZA 1N6QB 1RT1A 5KFYA 2C2RA 4O4GB 1RA7A 2YNIB 1RT6A 3FQLA 1SH2A 3MF5A 5F8MA 2W9CA 2IAJA 4ZVHA 1T03B 3HVTA 3MEEB 1CSJA 5CYQB 3IGVA 2XWYA 4ZVFA 3CDEA 4H54A 3OL8A 2I5JB 4QWCA 4PWDA 4IH5A 1HPZB 4DL5A 1REVA 4URGA 1S48A 3H5YA 1TKXA 3LAKA 3TAMA 5KG3A 3KHGA 1C1CB 3ISNC 4IH7A 4KV8B 3I5AA 4IH6A 4ICLA 4Y3CA 1J5OB 2WHOA 5DQHA 2OPSB 4XO0A 5KFOA 4YR3A 4EBEA 5HROB 5KFIA 2GIQA 1JLQB 2YKNA 5C25A 2V0NA 1SH3A 2FVQA 5KFNA 4Q45A 4IFVA 4J9SA 3DRSB 1K1SA 4RW9B 1RA6A 4I2QA 2XGPA 1J5OA 3BSAA 2BE2B 2HMIB 4O3RA 4Y2AA 1TP7A 1RT4A 4H4OA 5KG2A 4O4RA 2VG7B 2W9BB 5F8GA 2HNDB 4TYBA 5J2PA 1JLEA 2QE5A 3PVXA 5DGAA 1JLCB 2HWIA 3V6DB 1RT2A 2ZD1A 4O4GA 5KFBA 4ECVA 3RAXA 4J9OA 5KG7A 2E9TA 1JLFA 4J9MA 3N6LA 2WB4A 1NHVA 3OL7A 5KFVA 5L1KA 5HP1B 5T14A 1RYSA 1U09A 2B6AA 1JLBB 2AWZA 3KK3A 4WYWA 5J2NB 4XPEA 3G6VA 3FDSA 2ZD1B 3KK2A 2RKIB 3MEDA 5K14A 1LWFA 3JSMA 3OLBA 4IFYA 4TY8A 3UDLA 2DPJA 2ILYA 3PW7A 3KLHA 1T05A 3IS9B 1DTTB 4KHMA 1FKPA 1S1UA 4KO0B 1N4LA 4PQUB 1TL1A 4J9LA 5KFTA 3H5XA 3NGDA 1QE1B 5DQGA 5KT7A 1NHUA 3M8QA 3G86A 5KT4A 1S0MA 2GIRA 2O5DA 3E01A 1FKOA 3PJWA 3GILA 1S49A 2XI3A 4TY9A 2J6UA 2ASJA 4KO0A 4PQUA 4MK7A 3IRXB 3QO9A 3QLHB 4ZHRA 2ILZA 3BSNA 2AX0A 5HLFA 1LWCB 4EYHB 3TQ1A 3DLEB 1JXLA 2C2DA 4G1QB 1HYSB 4DL3A 5I3UB 3DRRA 5KT3A 3OLAA 3MR2A 3KOAA 1BQMB 4K50A 5DLGA 4ECUA 5HLFB 2V4RA 2IC3B 5HP1A 2WONA 4JV2A 4NLWA 1N5YA 2BQ3A 2AQ4A 4DL7A 2YNHB 1C2PA 3V81B 4O3QA 3FSIA 2V9WA 1S1XA 4FBTA 4H4MB 2V4QA 2AU0A 2AX1A 4KFBB 3PW2A 1TVRB 5KFLA 1SH0A 2OPRB 4Q0BA 2W9AA 2FLPA 1Z4UA 5J2MA 3I0RA 5L1IA 3QYYA 4YP3A 3KMQA 2D3UA 1S6QA 1JIHA 1S1WA 4IG3B 5F8IA 3LP1B 3KNAA 2OPRA 4Q0BB 4IOBA 5KFJA 1IKVA 2ASLA 1C1BB 4O44A 5C24A 5KFQA 3IG1A 4OL8A 5EDWA 3DYAB 5HROA 4RU9A 1OS5A 3DRPA 2JC1A 4EYIB 1C0TA 3PW4A 2JEFA 4K4UA 2BQUA 4NLTA 5DQIA 4ZP7A 3MR5A 1HNVA 3BQ2A 4R8UA 4IDKB 2VA2A 4WYLA 4ED7A 3CIZA 4WFXA 1RT5B 4ZPDA 4O44B 1TV6A 5C24B 3DRRB 2AGPA 2OPQA 4NZ0A 3KMSA 1HMVB 2VG5A 3UR0A 4ECXA 4EEYA 1S0NA 2IBKA 1S1VB 1LWEA 4GC6A 5KFDA 3NL0A 4YMEA 4M95A 2RF2B 2CKWA 2W9CB 3NAIA 5DG9A 4MKBA 5D3GA 1RTIA 4F4WA 4ZVEA 3ITHA 5L9XA 3C6TA 1WNEA 5F8JA 3IN5A 4IFVB 2HWHA 4QPXA 4Y2CA 4IG0A 3M9NB 1S6PB 2OPPA 5L1LA 3MEGA 3T5JA 4KKOA 3H40A 3LANA 3BQ1A 3HVAA 1VRTB 3EZUA 3M9MB 2WK4A 3D28A 4U6PA 2E9RX 1QAIA 2WOMB 4ZP9A 1HQEA 1KLMB 1RTJA 3V6DA 3KLEB 2B43A 2QV6A 2I5JA 4FS2A 5KFXA 4YR2A 2R2SA 4LQ9A 4NRUA 2WRMA 4QWBA 4I2PA 3V4IA 3BR9A 2JEIA 1HNIB 1RAJA 5KFCA 4RNMA 3KHLA 3LAMA 1HQUA 2IAJB 2YKMB 3OHAA 4NCGB 3KLEA 3T19A 1FK9A 2DPIA 2IM1A 4ZPAA 1W25A 4ECSA 4J9KA 1JLEB 1S1TA 1GX6A 1LWCA 3VQSA 3NBPA 5J1EA 2UUTA 4NLYA 4J9PA 1C0UB 2I1RA 1FKPB 1S1UB 3CJ2A 3DRPB 3KLGB 1FK9B 4ED3A 2C28A 1D0EA 3FFIB 3BGRB 1JKHA 1RYRA 5DLFA 1IKWA 2HNZA 5J2PB 3BSCA 3H2LA 3KHHA 3T5HA 3HKWA 4ED0A 3KJVB 2YNGA 5I42A 1IKXB 2UUWA 2J6SA 3RB6A 4KKOB 2D3ZA 3MFHA 4NLSA 2W7OA 4NLUA 4RW7B 5J2QB 4QW8A 1LWEB 2C2EA 4RW9A 3G6XA 1T05B 4WE1B 3OL9A 3DRSA 4TN2A 3KHRA 2WOMA 4KAIA 3SI8A 2IA6A 1SV5B 3PZPA 3QIPB 2IMWP 4K4ZA 1RTIB 1YVFA 3MECB 4ZVGA 2J6TA 3ITHB 3DLGB 3JYTA 5D3GB 2HNDA 4DL4A 1HNVB 4KV8A 1JLAA 3KLHB 1S6PA 2WONB 3CVKA 4RW8B 4R5PA 3HVWA 4O3SA 4RNFA 3Q8RB 3DYAA 3DLGA 1TKZB 3JYTB 2R2TA 1ZETA 4H4MA 2FVCA 2GC8A 2JLEA 1RTDA 4WXOA 5KFZA 3QZ8A 2R8IA 4Q43A 3DI6B 1JLAB 4URSA 5F9NA 3DOKB 4URQU 4LSLA 1S6QB 4FS1A 4ED8A 1RT4B 3H4DA 1BQMA 5KT2A 2JC0A 1IM4A 5KFKA 2OPQB 4LQ3A 4RW6A 1LW0B 4WZQA 5KFEA 3LP2B 1C1BA 1LW2B 1IKWB 2HNZB 2YKMA 4M94A 4PWDB 2HNYA 2ASDA 5CYMB 5C42A 3H59A 4TLRA 4ZPBA 4IKAA 2C22A 4O3OA 3RBDA 1QE1A 1S10A 4JV0A 1TL3A 1QUVA 5KFWA 2W8KA 2ATLA 2HNYB 1S1TB 1EP4B 1VRUB 2XC9A 3PW0A 1LW2A 5KG0A 1TKTA 1RT6B 3PHEA 4Q8FA 3MEDB 3QZ7A 3KLGA 1TV6B 4Q44A 2XCPA 2FLNA 1RTHB 2VG6A 1S9GB 1VRTA 2FVRA 2VA3A 1ZTTA 4IR1A 1DLOB 5CYQA 5KT5A 1S1VA 4Y34A 5KG6A 4ED6A 1IKXA 3T5KA 5KG5A 5C5JA 1C0TB 2HAIA 2IM3A 4J9QA 2R8GA 1JX4A 4K4SA 4K4WA 2YKNB 5EUHA 1S9EA 3BQ0A 4FBUA 5F8HA 4ECZA 4NLXA 3RAQA 2FJXA 3GV8B 3M9OB 4I7FA 4DG1B 4B3OA 4R0EA 3T5LA 4DL2A 4K4VA 1HQEB 2IJFA 2R8KA 4ID5A 4ZMMA 5JUMA 5KT6A 3GV7B 4K4XA 2BRLA 3V6JA 4I7FB 3T1AA 4DG1A 1S1WB 3RBEA 4NYZA 2XCAA 3DDKA 2D7SA 4TXSA 2R8HA 1RT7B 4ED1A 3C6UA 3IG1B 4DL6A 3EPGA 5JXSA 4YQWA 1JLFB 5DGBA 3LP0A 4NRTA 1TKTB 4PUOB 3E51A 1HPZA 1MU2A 1RT3B 1JLGA 3DOLB 5FDLA 1ZTWA 2B6AB 4O3PA 4IDKA 3QGHA 1BQNB 2WCXA 3CWJA 4F4ZA 3RB0A 1S0OA 3NBPB 2FVPA 4NLGA 3H5UA 2OPPB 1KHVA 1SUQB 3CJ5A 3UPFA 1HMVA 2VG5B 4I2PB 4RW4B 4IFYB 3V4IB 2B5JB 4TY8B 1RTDB 3SFGA 3DOLA 4J9NA 3BREA 2EC0A 1IKYB 1MU2B 1RT3A 2W7PA 3PW5A 3CDWA 1KHWA 4RNNA 1NNDA 3ICLA 3OSPA 4RW8A 4R5PB 1EP4A 1VRUA 3H98A 3IGNA 2HMIA 4ECRA 4F50A 3OHBA 4ECQA 5F9LA 2ZKUA 4MK9A 2IM0A 3MTKA 2AGQA 1GX5A 3TAMB 2IJNA 3NAHA 4K4YA 1UWBB 4TQRA 1FKOB 1SV5A 4J9RA 5CYMA 1JLCA 5C42B 4ID5B 4O3NA 2ZE2A 4EO8A 1JLQA 4ZHRB 5C25B 5HBMA 2UVWA 3QO9B 4LSNB 4WZMA 2FJVA 2BANB 5EWEA 5J2MB 2RF2A 3KLIA 3H5SA 3QGGA 5J1EB 4QWEA 4RZRA 4MKAA 3GV5B 3PR4A 2F8EX 4HKQA 3DM2B 3Q8QB 3KK2B 3C6TB 4NLOA 4IQXA 3LP1A 4WE1A 3RB3A 2OPSA 1HQUB 1DTTA 1I6JA 3KLIB 3DMJA 1T94A 2XGQA 5KG1A 2FLLA 4F4XA 2IM2A 1S9GA 1RT1B 1XR5A 1K1QA 2YNIA 3LALA 5KFAA 1N6QA 3KLVA 4R8UB 3NMAA 2WTFA 3LP0B 5J2NA 3HHKA 1RDRA 3PJXA 4H4OB 3N6MA 3DMJB 2BQRA 2VG7A 2FVSA 1HNIA 2W9BA 1T03A 4EO6A 5EWGA 3Q8SB 4GC7A 1TL3B 5KFPA 3IS9A 1JLGB 5FDLB 3MR3A 2AGOA 2YNGB 4MH8A 5DG8A 4EBCA 5I3UA 3PR5B 4IRKA 5KFRA 2FJWA 3QIDA 3CO9A 2UVVA 4QWDA 2B5JA 2BRKA 4B3OB 4QW9A 1C1CA 4ECWA 1N5YB 3CJ0A 4Q8EA 4ICLB 3DLKB 4IG0B 1N56A 3DOKA 4WFZA 4ZPCA 3UQSA 3M8PB 1XR7A 5KFHA 5KFMA 5K14B 3NKYA 3SFUA 1XR6A 3I5CA 3FFIA 5F8NA
chains in the Genus database with same CATH superfamily
1FRMA 4DX6A 1R89A 3MM5B 3VGTA 2CJQA 3D1HA 1U1PA 3FRZA 3DLEA 4C8MA 4B08A 2U2FA 5LSLA 3U1NA 2M7SA 5KG4A 3EGWB 1WHYA 2CDQA 4TQSA 3T1HJ 2MB0B 4K4ZA 2R7TA 1EKRA 1RBAA 3WQPA 4U7CA 1AXQA 4HEA9 1HARA 1RT2B 2GVZB 1UL3A 4RUAA 1J5EJ 2WSEC 2V50A 1IKVB 4WKRA 1O5JA 1Q16B 4RNHA 1T3NA 1GXTA 2BMBA 2UUCF 1CQNA 2H4YB 3H2VE 4CM2A 1HHTP 1H7WA 1UVJA 3CNQP 5KFSA 4UQTA 2F8MA 1SB6A 2C2ZB 4LRBA 3FQKA 3CJRA 3A4TA 3J81U 4OI6A 4R25A 4B9UA 2E29A 2AZ3A 2C3UA 1IR1A 3UWTA 1TKDA 3KK1A 1RAGB 2R3VA 1PG5B 4IG3A 1KOOA 2AJ0A 2Q6CA 3M8WA 3O8WA 4OI1A 1R8AA 4HTIA 2XLJA 1U24A 1XMBA 1QVFR 1Q5VA 4LBIA 1TK8A 2QN6B 5BJRA 1K73T 5I42B 3KJVA 5ETSA 3KUEA 3KK1B 2OH2A 4QIWD 3QT5A 3IBCB 5A6PA 1D1UA 1S4FA 2P6TA 4F4AA 3RRHA 1JJCB 1L3UA 3I5BA 4LF1A 4CH7A 4ED5A 3BSOA 2BEFA 2RSQA 2R2UA 5THWA 1RT5A 6FD1A 3QGIA 1X5SA 1KNZA 5GAHI 1N8RT 3G6YA 4N47A 2YPZA 3T1YJ 3I0SB 4WJBA 3BO2A 5AXLA 3OSNA 3R97A 2D41A 5B0DA 1TVRA 2QA1A 2ROGA 3S6EA 1NJYA 1X9MA 1UCNA 5LJ5Y 4X4PA 2EC0A 3ISND 4G1QA 1TKZA 1RTJB 2V2QA 2GMLA 3GZ7A 2MDAA 4RW4A 1F2HA 1SC6A 3ZNUA 1IBLJ 2HZVA 4FYWB 1M0SA 1WORA 1YJNS 3MR7A 4DV3J 1NB7A 4RW7A 1WDTA 6FDRA 4QCLA 3ZTPA 1M5OC 4MK8A 3ISZA 4DX5A 2X1AA 1N48A 3J81Y 3SDEB 1CS4B 3WC2A 2R7UA 2KRBA 4ZP6A 2ZKTA 2V8HA 4HH1A 1HBUA 1VISA 3NEKA 2BM0A 3H25A 2MKYA 3MDFA 3CJKA 2UUAF 3GJRB 2R7VA 4IRDA 1KONA 4HT5A 3KK3B 3MM6B 1OY6A 1RU1A 2WBMA 1C0UA 1NK6A 1T95A 2XMVA 1Y5LB 2OD4A 4JI2J 4NLVA 4DR1J 2VOOA 3V5RA 1LWFB 4OYIA 3H4BA 2J0SD 2OP5A 2IA0A 2RDIA 2RQKA 1RT1A 1IXKA 2BJDA 1WOSA 2V2VA 4UTGA 2IBKA 2XMMA 4LF6F 3VGVA 3VAIA 1SH2A 3MF5A 1HR0J 1T03B 2BUNA 2Q6BA 1WHXA 3ONQA 1CSJA 3M1VB 4FXDA 2KFNA 2VH7A 1VK8A 3IGVA 5ETTA 3CCJS 4ILMA 3R5GA 5HMWA 3Q8YA 1U6FA 1I3OB 3HMJG 2D3OR 1KSPA 2CYYA 2G1DA 4Y65A 2ZH8A 1I94F 1WKJA 4QOTA 2DNPA 1REVA 3C16B 4UOFA 4URGA 4DL5A 4LFAJ 1KR4A 4X64F 2B4PA 3G87A 5DJBA 3TANA 3KHGA 3RW6A 2DNGA 3I5AA 4EBEA 4DX7A 1Y3JA 1NB2A 5HROB 1DBDA 1REGX 2HQCA 2K1RA 2KVQE 2P5VA 5C25A 3AQPA 3CIMA 4ANEA 2V0NA 1IN0A 1SH3A 2D74B 5H9FJ 1C4AA 2VF3A 4B17A 1V6HA 5J1PA 3R7BB 5AXMA 2GA7A 4DPYA 1RA6A 1D8ZA 1NDLA 2BW2A 3FVYA 4M63A 2QLBB 3B4MA 1TP7A 2FJAB 1MMNA 2RD5C 3BN7A 4NXNJ 2YBVA 1HBMA 4NXMF 1S0VA 5M2UA 2LQJA 1NK0A 2UXDF 1M5SA 2L3MA 2HNDB 4LF2A 1R6YA 2BJ8A 3MURP 3PVXA 1NK7A 2HGLA 5DGAA 1RT2A 1GAOA 2GVZA 2GAHC 2OSQA 4QIFA 4J9OA 1KTVA 3OTDA 2O1PA 4LRFA 1WHWA 1BC6A 4J9MA 1NJZA 2RRBA 4KTQA 4OV1A 2DNRA 1RWWB 2E7VA 7FD1A 4ELUA 2QSFA 3OR2A 3ZNJ1 4GKKF 2B6AA 1JLBB 2AWZA 2LECA 3PO5A 4XPEA 1F5AA 3M8RA 4F36A 2E5LF 2W2PP 3G6VA 3FDSA 4GO5X 2IDEA 2AEMA 3D7SB 4GKJF 1NCLA 4ZKAA 3BBCA 1JK9B 1WC4A 2DR6A 2MLXA 2DPJA 3LUYA 3BH6B 3PW7A 5A8RA 4M8LA 1FKPA 1S1UA 4KO0B 2ALYB 2CNOB 4PWUA 4UF4A 3PKMA 2B4VA 3L7PA 4PEOA 3NGDA 2ATCB 2EG2A 3CPWR 5KT7A 3AXMA 2DR8A 5KT4A 2JHEA 1W7WA 4NYOA 4S0MA 2GIRA 4CO2A 3E01A 3ZZ0A 3GILA 1E6YB 3GLJA 2QLXA 2XI3A 3MAQA 3FK4A 4ZCLA 3K8VA 2CQHA 3HM9A 4L3NA 2CPIA 4LVOP 2DEJA 4B9VA 2ILZA 1ZM9A 4YN3B 1FJGF 3TQ1A 3PYDA 4I56A 4OI4A 4DL3A 1HHSA 2W4CA 5K20B 4KYZA 5LMNJ 1QJHA 2XQCA 3OLAA 3D4JA 1BD6A 1PYSB 2B9WA 3KXDA 2WVFA 5IT9U 2V4RA 1WG1A 1PIEA 3VAKA 1R27B 4NLWA 1XMOJ 4CIOA 2YNHB 2EXUA 3QNWB 4O3QA 3V81B 3HVRA 1DURA 4I6YA 4KGZB 2X1FA 3QJPA 2M8DB 5E2QA 2A6MA 2OPRB 4Q0BA 4JI7J 2FLPA 3AHPA 5L1IA 3VAHA 1FRJA 4YP3A 2F63A 1PGZA 1X4EA 4PAAA 2AD9A 4IOBA 2HRTA 3IBFB 2XS5A 2B7BB 2YWWA 5E3RA 4K5RA 2BJ1A 4BS2A 4O44A 4X62J 2VONA 4RU9A 1RE1B 4EYIB 3G8TA 1C0TA 1SC4B 1XBWA 3FBFA 4D3HA 3I55S 3FUYA 2BQUA 4A4JA 2NZ4A 2NZCA 1WF1A 1TMJA 1Y0HA 3QJJA 3KG1A 1ZM4A 3TUPA 1L3KA 3BQ2A 2VA2A 4DUZJ 4WYLA 4I68A 4WFXA 1PC5A 4A47A 4OHXA 1ZAXA 5C24B 1UPPA 4OHYA 2KZMA 3PEJA 4FZVA 4OHVA 2OPQA 2G0CA 3FCHA 1FKAF 4OI0A 2CQ0A 1FNXH 2BBEA 1KVIA 3HK2A 3NL0A 1S97A 1FD2A 2CQ2A 2YKAA 4LREA 2W4PA 1W2IA 3G82A 4L75A 2LA6A 3AH6A 2DNNA 2J7WA 2W9CB 5DG9A 2V67A 4IO9Q 1RTIA 4QU6A 2Z0GA 2IVFB 1HWJA 4Y2KA 3DNCA 4IUFA 4IFVB 1IJEB 2ZH9A 3JTOA 4QPXA 1YJ7A 2ZWPA 1JNZB 3GB0A 4Y2CA 2MY7A 3GCXP 4CLSA 1ZPWX 4J9VA 2M2BA 2UV8A 2Y1LB 3FGVA 4ITSA 1H2UX 1UJ5A 1BWVA 4USWA 2OKQA 3HVAA 1P1LA 3M6XA 2NXUA 4DZDA 1VRTB 3M9MB 3CJKB 3ZTRA 3D28A 2MJUA 3MM5A 4NASA 2BM1A 3HX9A 2OAUA 4M5GA 2E9RX 1IVZA 1NAQA 3Q8UA 3NLCA 1KLMB 2DR7A 4DR6F 3KLEB 4ELVA 1KDNA 2I5JA 4DF8A 1TTHB 5HJYA 2MY8A 4JBCA 5KFXA 4B3SF 3G2XA 3QFWA 3SSRA 2JEIA 4A8XA 2Y1JA 3LWLA 1LNQA 1VGYA 1N5QA 1TUGB 3BYPA 2YKMB 4BWMA 4MKVA 3T19A 4IOCQ 2IM1A 1FRKA 3BN4A 4DZ6A 4DV0J 4ECSA 5DM6Q 1D3WA 2CVIA 2FPHX 3HP6A 1JLEB 2LQ5A 5IFMA 2PEHA 2RUGA 3WBZA 3CCSS 3IO1A 1FTCA 5DS7A 2ZVSA 5A2QU 1S79A 3DGPA 1ELOA 3VR1A 2AYBA 5DZ6A 2DKOB 1EB0A 1FK9B 3F0NA 3T6JA 3S8SA 3FFIB 1YJ9S 4AYBD 2PA3A 5DLFA 2ZBPA 2HNZA 3BSCA 2ZJPQ 1N52B 3GFYA 3DDNA 3KWMA 2ZZNA 3M6VA 4XDDA 4ED0A 3KJVB 2YNGA 5I42A 4XDCA 2RRAA 2KT3A 4KKOB 2D3ZA 2K7JA 3MFHA 1IBLF 4MYTA 4AQYJ 4QW8A 1T0TV 2XY7A 3G6XA 2DH9A 2FZCB 4F02A 3CCES 4LF4J 4TN2A 2DGQA 4B9LA 2VPXB 1SV5B 3PZPA 1SKSA 3MMBA 4G6VB 1HBOB 1YVFA 3NS6A 3MECB 4ZVGA 4KHPF 1N0UA 3JYTA 1T9YA 2GVDB 2QYGA 3WZ0A 2IRXA 3NWGA 1NPRA 5D0EA 5DO2A 4KV8A 4YB1P 4ZITA 3JAMY 2NCKL 4R5PA 3CVKA 3FMWA 3H2UB 4OLPA 3SBMA 2B7CB 5GADU 1H7XA 1G6BA 2DIVA 3VAFA 1BWEA 3DLGA 2R2TA 2CQPA 2W4DA 3UW1A 2HFNA 3W65A 3AODA 1ZETA 4OI3A 3W62A 4WXOA 1J27A 2GV1A 4KY3A 4UUWA 4MIWA 3Q23A 3PX0A 1JLAB 4OZ2A 3OVSA 5EX3A 3D0GE 4U8VA 3V4MA 3H4DA 3ETMA 1BQMA 1M5HA 2Q43A 5KT2A 1IM4A 2KH9A 2YPYA 1V5VA 3B8HA 3D1QA 5ETQA 4WZQA 1SJQA 4CLKA 3HHLD 5KFEA 2Y8YA 1C1BA 2ZITA 4OI2A 2AT1B 4B02A 1NSKL 4RO0A 2CA9A 3ZZOA 2HNYA 1CC8A 3K5OA 3D1OA 4OLOA 2ASDA 2C22A 4IKAA 3DLBA 1CJVB 3OFFA 1L5UA 3MM7A 4OHWA 2EK1A 5F0WA 1S10A 4JV0A 3VF0B 4BLGA 5LSRA 3OUYA 4FF2A 2W8KA 4DL0C 2ATLA 4N8NA 3L09A 4OX7A 1VC6A 2XC9A 1S1TB 1PCAA 2G1HA 5KG0A 3KLGA 4Q44A 3NCRA 2XCPA 4ILLA 3IFEA 2VL1A 3P5BP 1VQPS 1PO6A 1DLOB 1WC0A 4KH1B 4JV5J 1WC1A 3LOUA 2Q66A 3T5KA 4OYMA 5HJXA 5C5JA 3C15A 4QR2A 1E6VB 2C3YA 5KG5A 1U1QA 3PKYA 3R2DJ 4YY3F 2ZHOA 1NM2A 4TKTA 1VQMS 1SL1A 1NUEA 5GAGI 1HI8A 5EDWA 2HW3A 4OX8A 2K06A 4UZCA 4Q2MA 5EUHA 1S9EA 1PJ7A 3ENWA 2JDJA 3GE9A 3TX8A 2C2NA 3BQ0A 1WACA 5T41A 4NLXA 2FJXA 1RBOB 2A18A 2MXYA 3M9OB 4B3OA 4CNYA 3GV8B 1N36F 4YOEA 2QA2A 2DNYA 4USHA 4AE5A 4C2MA 5L9NA 2IJFA 4PG4A 2XMWA 5GMKa 4JV5F 1R7IA 3GV7B 3A8KA 3B82A 3BKUA 4K4XA 4DQSA 1HBMB 3V6JA 3NS5A 3Q2TC 4KGKA 3RBEA 2J0WA 1GK8A 2XCAA 3DDKA 2J9CA 1RT7B 1S59A 3KJQB 1FXDA 3HKZD 3K2YA 4DL6A 1FE4A 4JYAJ 3BB5A 3EPGA 2AIRB 5AT1B 4YS2A 1VQKS 3F44A 4PUOB 2R7RA 3R5JB 4IYQA 1WKLA 1YKWA 5FDLA 2HWTA 4ZVSB 5A8WA 1H0HB 2YQ3A 2XNRA 2J7KA 3CWJA 4P10A 3RB0A 2CIMA 4LFCF 1CPZA 3NBPB 3SIPB 5RUBA 4NLGA 3AOCA 4FVCA 4EK2A 3CJ5A 4DSJA 3MEKA 1RLDA 3FEZA 1JNRB 2WAQD 3SCLE 5T7LB 3UO0A 1RP5A 3PW5A 1QTMA 3R6LB 2XS2A 4LIRA 2WSFC 1X7VA 5LT5A 2F5GA 3OSPA 4RW8A 5IS2A 4B9TA 4ILRA 4P72A 2XEXA 1PYOB 1NK9A 3H98A 5D0RA 2GCFA 3OTOF 4F50A 4B3SJ 5M2RA 5CAAA 5F9LA 1M1KT 4L72B 1SL0A 2YH1A 1KKHA 2PIIA 2AGQA 3TAMB 3NAHA 1IBMF 1FKOB 5CD4A 2VBYA 2MKHA 2MHNA 3W61A 2IY5B 2R7WA 2IVYA 3NWRA 5DM7Q 1JLQA 1BMQB 3GJQB 4LFBF 1P1TA 2DNMA 3BEGB 5HBMA 2UVWA 4JI4F 4WZMA 1SKUB 5IZHA 4FKYA 2RF2A 2G0JA 3NGUA 3H5SA 3QGGA 3K7RA 2XO7A 4QWEA 4PG6A 2ZHAA 1U7LA 1QDUB 1T7PA 4F2SA 1U6BA 2BX6A 1G1XA 3PR4A 2DH7A 5EN1A 4HKQA 1IQTA 2MYFA 4BC9A 4NLOA 2J8SA 3LP1A 3CJ8A 2F1FA 3QJLA 2FB0A 4BDPA 2VZ9A 1HQUB 1N5VA 1DTTA 4CO5A 1TR0A 4X64J 3BBBA 3DMJA 3HHLA 2DY9A 4TLQA 5A6WA 2EEYA 3D6TB 2DTJA 3FCWA 4WIIA 1G4CA 1GEHA 3HHEA 4LBHA 2YXLA 1M1GA 3TR5A 1RSCA 1WF0A 1YZ7A 1VLOA 3M2UB 3MM8A 2E1RA 5KFAA 3LP0B 5J2NA 3KLVA 2Z2LA 2FLOA 3HHKA 3G6ES 2H65B 4A8FA 3U1MA 2W9BA 1MROB 2B51A 3ZTOA 1T03A 1RZMA 3DHWC 4O0NA 3DLHA 1TL3B 2ZEJA 3IS9A 2AGOA 2J5AA 2V5HG 2YNGB 2MQPA 1VQ9S 1NJIT 3R5BA 5AE2A 1TK0A 4QU7A 3PR5B 4IRKA 3BKFA 1EIYB 1FJGJ 3IR7B 3OTCA 2SXLA 1NJWA 4JI6F 4G1PA 4O23A 3MD1A 3P4UB 3MMCB 3ZZRA 4F26A 1T9XA 2VPYB 3K0JA 2V4JA 1O6XA 3R5CA 4ICLB 4OJGA 1CEZA 4C3KA 2GFFA 4PCQA 4WFZA 3M8PB 1XR7A 3AJ1A 3L7UA 4ZPCA 3UNGC 2ZM6J 2FJEB 3E8OA 3WX8A 4YB6A 1FJ7A 4DV4F 3I5CA 3C8YA 4A46A 1BLUA 1MMLA 4RW6B 3PFEA 2W2QP 1WC3A 2VDIA 1HYSA 2P6SA 2HHQA 3MAAB 1JLBA 4X4OA 2JEJA 2VQFJ 1TL1B 3M8PA 1S6UA 2AEJA 2RT3A 2MGZB 4M5LA 1X5PA 2KRRA 1Q1KA 1TKXB 3HVTB 4LSNA 4E98A 3QRQA 2UXDJ 2HHXA 1Q8KA 1SQEA 1RAEB 1R8BA 2IRUA 3EX7B 2B0GA 2PT0A 2YKPA 2C1EB 4C8YA 3Q22A 4MKYA 4NI2B 4XIUA 3D68A 3US5A 4ZLPA 3J7YI 1TUWA 4KGVB 3I32A 4QWAA 5LL6d 3PRBA 3BJYA 1MMDA 1WOOA 2K8GA 3C19A 3DXSX 3TVYA 1EETA 1KTQA 4C48A 5KOWA 5KFUA 3M05A 4HYKA 4EBDA 4C9DA 3IA0A 3NNAA 2CXEA 4JV1A 3V6HA 2W01A 2KFYA 2ZJRQ 2ZNYA 1UWAA 3D0IE 4TU7A 2G13A 4KHRA 1TQLA 2FC9A 2QFJA 4UOHA 2DCLA 3G82B 2FD2A 4ZK7M 1WJ9A 2B9XA 5IV4A 4ZP8A 4ZDNA 4JI1F 2CPHA 2ZE2B 4C8ZA 2CPXA 1REVB 3C16A 3DCAA 1N32F 3OR1B 1UEKA 2N7CA 3VWSA 1RHMB 1R0AA 3TVKA 2MKIA 2P9CA 4LRDA 3DGPB 5G0RB 3PX4A 4MT1A 4RUCA 3FKBA 4NLRA 4LFBJ 3TUJC 2GHPA 3KYLA 2WZ1A 3W9HA 1BQNA 4KIAA 5DG7A 3D0HE 5K8OA 4B9SA 1K0TA 1T02A 2NYHA 5A2QY 4F4YA 5DDOC 2YNFB 1S5ZA 2UVUA 5CABA 2EFQA 3SCIE 1BUXA 3OTBA 2CPFA 5F8LA 2NREA 5J2QA 1FRLA 2BANA 1FDAA 2ZZTA 3MEGB 3VTIA 1GT8A 5CQGA 1NEEA 3GIIA 2AEFA 3GIMA 2CQDA 3QRPA 2ZH1A 2Z2YB 1DTQB 2PGCA 3NMRA 1LW0A 4J37A 5GAHU 4NCAA 4MAKA 1S9FA 1CULB 2C42A 4TYAA 3N6NA 1DQ8A 5BYQA 3O5TB 2ZUGA 3WC0A 3OL6A 4KPYA 2EFVA 3BGRA 3PNIA 1N6QB 2RHSB 3PG9A 1BE4A 4O4GB 2OMLA 3FQLA 4DPXA 1RT6A 3CJSA 2DR5A 4P74A 4DCPB 3A8EA 2W9CA 2IAJA 4ZVHA 2EFOA 4JB8B 2ZH3A 3HVTA 1Q0NA 1UW9A 1LWXA 2KXHA 1R8HA 1VYAA 1GTEA 1YRTA 1YRXA 4MMOA 1X8DA 2OIHA 3FCVA 3FBBA 4P2FA 3VVUA 3W9JA 3OL8A 3EGZA 4W90B 3PFOA 4PWDA 4IH5A 2UUBF 2VQEJ 3MMBB 2Y1IA 4LF5J 2VFTA 3QSIA 2AJ2A 1O0PA 4C8NA 4X65J 1FXRA 3TAMA 1GMVA 2HVDA 1A0OB 1C1CB 3QT8A 2RDDA 1GNKA 4ZCIA 5DQHA 1J5OB 3P3DA 1PAEX 1NKBA 3GU0A 2GIQA 1JLQB 2YKNA 2HZCA 2J7UA 3GJTB 1OMSA 3LH2S 1VJWA 2QL9B 3M2VA 4BWJA 1UA1A 2HK3A 1MNEA 2JFDA 2IRYA 4YB5A 1Q86T 2XULA 2J9DE 2Z8QA 4J7CA 4DFKA 4RPFA 1K9MT 1TELA 4NEYA 1SC1B 1ZA1B 1QM9A 2C2MB 5HQMA 2XGPA 3BSAA 2ZH6A 4O3RA 3AT1B 4HACB 2W7PA 1NXIA 2E5JA 5D15A 2NPFA 2XO6A 3OD2A 4O4RA 3RUBL 5H9FK 5KTQA 1RWNB 2L9DA 1S7HA 3A13A 3DXBA 5J2PA 1JLEA 2GX8A 2QE5A 2V8GA 3GIRA 5CD4H 1JLCB 5KFBA 4ECVA 2COLA 3R1HA 4O4GA 3TYTA 3OJUA 2HHPA 5KG7A 2CWKA 4OFZA 1Y00A 1YBAA 2Q1LA 3BPSP 1OPZA 2M4MA 1YJRA 1IWGA 2WB4A 3N6LA 4HHHA 1T9VA 1VQSA 4WFNQ 5L1KA 3N28A 1JMTA 2J0XA 1U09A 4L6V3 2M70A 3PXGa 4B3RF 3KK3A 3TZXA 3DOMA 2ZWOA 1F5BA 3D9BA 3DU5A 2M5YA 2RKIB 4M5JA 4RBTA 3AD8C 1UMJA 3CJQA 3JSMA 1DJ0A 2BJ7A 2R7QA 2A0FB 3IC1A 3MM9B 3UDLA 3OLBA 2QA4S 4RWXA 2FY1A 2BDPA 2EBGA 4ER8A 4WU3A 1X0FA 4DR5F 4J9LA 3PYGA 3M8YA 5IXUA 2QLJB 4PZVA 4JOUA 4JI7F 2HAFA 3TX0A 4DN0A 1QE1B 3BS9A 3PIPQ 2C3MA 4FYXB 4KR0B 4H4KC 1VBKA 3G86A 5ETVA 2C2KB 2MKCA 2ZBQA 4LBPA 5A8KA 1FKOA 3PJWA 2H5EA 2QYCA 4KC5A 2M3DA 2NXJA 1HKAA 1YIJS 1VC5A 2OHDA 5CA5A 2VBXA 3I96A 2J6UA 3AAWB 4KO0A 1WD6A 4MK7A 2UXBF 5FLXY 3SSSA 3QLHB 4ZPVR 2VJVA 2AX0A 4DV5J 5HLFA 1FEHA 4UW2A 2XLIA 2W2MP 4PABA 1MG7A 3L7OA 1Q53A 8AT1B 3HCXA 2BW7A 3MR2A 1BQMB 4DLGA 5HLFB 2JLFA 4KGMA 3EDRB 1N88A 5HP1A 2WONA 4QZVB 2AJQA 4BBYA 3FSIA 3U1LA 3AA9A 2V4QA 2AX1A 4JI2F 3WIUA 3TWZA 4KFBB 1XK8A 1VQ6S 1TVRB 5KFLA 4HI1A 2W9AA 2MPUA 3PJ9A 4V19X 5J2MA 2ZJQQ 4OX6A 2LCWA 2RB7A 2P9GA 5F8IA 3LP1B 3KNAA 2AMCB 4QYZK 3TP2A 4DI6A 4LR7A 4V19J 1IKVA 3K58A 3D67A 1X4HA 2ASLA 1HNZF 1CS4A 3RYLA 1B99A 2F9DA 1FE0A 5HROA 4QIGA 1UKUA 4OMFG 4OV6A 3W8PA 5MAOA 2UUBJ 2KL8A 2RUSA 1LKZA 2BVZA 4L3KA 2QTWA 1HNVA 4CT9A 3OVAA 4R8UA 1N32J 3G8QA 3MGJA 4ED7A 1RT5B 2HFOA 4ZPDA 1SCJB 4DFPA 1Q79A 3BGLA 1N36J 4RWWA 1YWXA 1KQGB 3J7Z5 2WVBA 5HVFA 5IWAJ 2FHMA 3UR0A 5LMUF 1S1VB 2KI2A 2UUAJ 4YMEA 2DO4A 2RF2B 2CQBA 4N8OA 2CKWA 4E2FB 2H51B 1HWIA 3NAIA 1MSWD 2NXEA 1NPPA 2QFIA 5D3GA 1HBOA 2QLFB 4MKBA 1OO0B 2MQQA 1XNRJ 3ITHA 1YX2A 4DFMA 3IN5A 3MCSA 2ZDOA 1KVKA 4CLUA 1Q7LB 3EDQB 3M9NB 1S6PB 4LF6J 4FKXA 1RACB 2BE9B 2OO4A 5AE3A 5BYSA 3K5MA 5D78A 3H40A 3Q24A 3LANA 3BQ1A 3VAJA 4FF3A 1RBLA 2CPYA 3M2RA 4NMXA 1RWUA 1WWHA 4DU7A 4M5IA 3S7RA 4DOZA 2LEBA 2DRDA 4JP8A 1RWOB 2WOMB 1HQEA 2HIYA 3M2UA 3MM8B 3KG0A 4RKUC 3V6DA 3FNNA 2CQ1A 2EI5A 4PXDA 1RADB 1ITPA 4YR2A 1I94J 4LQ9A 2APOA 2WRMA 4QWBA 4USUA 1HNWF 3BR9A 3HHLC 4PXCA 1MROA 2CNNB 1RAJA 3QAEA 3TAQA 3GPAA 1ICEB 3F41A 3KHLA 3LAMA 2UXCJ 1HQUA 3T6BA 3DLLQ 2IAJB 5H9EK 2VJUA 1SBRA 1T9WA 3NGRA 2KT5A 3KLEA 2DPIA 2XNQA 1OWXA 4ZPAA 3SMZA 1W25A 3EM1A 3M32B 4NE9C 4CRJA 3VAGA 1F6TA 3K17A 1X31C 1GX6A 1OJ4A 1QUPA 1UEVA 1UZDA 2O66A 4OYPA 4J9PA 2PO4A 1AW0A 1VOMA 1VQ4S 3UDEA 2R42A 1RAOA 2DGWA 2C28A 1RYRA 1Y10A 1JKHA 3WHIA 4YHHJ 3PY8A 1CJUA 1IKWA 2E5IA 3VCDA 2DGXA 2L41A 1UVNA 3HKWA 3CW2C 5G4DA 3NNCA 4DR4F 4LF8F 2CZVC 1TL4A 1VQYA 4ZVTB 3R8YA 3H0PA 5K8PA 3KKFA 4NLUA 5J2QB 3P5TL 5A8WB 3MPYA 2BJEA 2C2EA 1F0XA 4WE1B 2XS7A 2JLGA 4LF4F 3DRSA 2F4FA 2HKEA 3H7HB 4KAIA 2IA6A 5A76A 4LMZA 3S01A 2IMWP 2CQ4A 1RTIB 3KFWX 2EFPA 4KT0C 1JWWA 4L73A 5D3GB 2ADBA 3W63A 2RU9A 4HHJA 2DEIA 2MTLA 3B54A 3RR7A 4P71A 4B3MJ 4RW8B 2OEKA 2XSJA 4RNFA 5KAKA 1FVQA 2MKSA 2YWEA 3CD5A 1V3RA 3OT9A 2GC8A 1RTDA 2V6AA 3Q83A 4CLYA 4U7UK 5KFZA 1NLKL 3LWMA 1UJ6A 3NNHA 3UN3A 2KTQA 1JQGA 9ATCB 4Q43A 3I9V9 3DI6B 3D3BJ 4G65A 2VHGA 3M8SA 4LSLA 1URNA 5C2CA 1D8YA 1TAQA 2JC0A 2ZDPA 1XNQF 3ET6A 1PAUB 2CJXB 1LW0B 2DCUB 2D3O1 1U1OA 1L3VA 1LW2B 1IKWB 4JI3J 1HFEL 4M94A 2CADA 4PWDB 3KUHA 4ANDA 3H59A 4TLRA 2KHCA 4ZPBA 5LXYA 4O3OA 2WVCA 3RAMA 2CPZA 5HMXA 1RB0A 1QUVA 3TA2A 4W98A 4HLBA 2XMAA 3M6WA 3IXQA 4JI1J 1TAUA 2DNQA 4CTAB 4GVLA 5ETKA 2RS8A 1JJ4A 2N3OA 2ZH4A 1MW7A 3DU6A 1RHJB 1U2RA 3GG0A 4ZIVA 5GADI 2UP1A 2ZUAA 1RJJA 3MEDB 2AJ1A 4OIXA 1TV6B 2PMZD 3QZ7A 4UY85 4CLTA 2WW8A 1LK5A 1S9GB 1OIAA 2FVRA 3A8JA 1ZTTA 4P7VA 5F3TA 1RKJA 2VA3A 1UETA 2JJ4D 3BPDA 4ED6A 4Y34A 2ACYA 1CG2A 2CPEA 2VFSA 2GJ2A 2FGOA 4DV5F 2A3JA 4FYYB 1VDHA 3PX6A 1KQSR 1CJKA 1EX8A 4C7QA 5CZXA 1FNMA 3QQCD 5D4OA 4DX8H 4ES3A 1NDCA 3Q2SC 2Y1RI 3J80Y 4K4SA 4K4WA 3W3SA 2YKNB 2JSXA 4JI8J 1LXNA 4FBUA 3A8IA 4ECZA 2N4DA 2LA4A 4DG1B 1VIOA 2L9NA 5E3CA 2VKRA 4DL2A 4K4VA 1NU4A 1RLCL 2GZOA 2R8KA 4ID5A 2LMIA 2FC8A 3NOCA 3CF5Q 2BRLA 4RJVA 4WTOB 1FDNA 3DHXA 2VKZG 2XYPB 2F40A 2Y3YA 4HH0A 2B9YA 3GFHA 2CFXA 3PRVA 2Y0SD 2KG1A 2HFSA 1U8SA 5JXSA 5HVGA 5DGBA 4YQWA 3LP0A 2CNLB 3OXFA 4NRTA 3N01A 1B0PA 1SXLA 2C3PA 1HPZA 2H4WB 3E51A 2Y8WA 4LSZB 5IQ6A 4X62F 1JLGA 3DOLB 3I82A 1DFDA 2N7YA 4O3PA 5AJ3J 1WI8A 4LIWA 5AJ3F 4F4ZA 4MJKA 4Y0FA 2POKA 5K9FA 2KDOA 2FVPA 3NG8A 5B7WA 2HHWA 1KHVA 3CDAA 1KOHA 4HL9A 4F3MA 3UPFA 2ZH7A 1TK5A 4PYDA 2KM8C 1RTDB 2E5GA 3DOLA 3AFGA 3SFGA 2Q3PA 5CZVA 2KXNB 4J9NA 1MU2B 1RT3A 1WTFA 2F65A 2FHJA 3EUNA 3RBZA 3W5ZA 2ASYA 4N56A 1RAIB 4DR2J 1FF2A 2AJ4A 4R5PB 3KDNA 1VRUA 1FCAA 3R3TA 1R0BG 5E0OA 4ATNA 3UVJB 2MQMA 4HACA 4PKDB 2HIQA 4RL1A 5SUHA 1LV5A 2ZKUA 2BZ2A 2IM0A 3X1LB 1NKCA 1GX5A 2IJNA 5GAEU 1YG0A 1VRQC 1UWBB 2HVZA 2DGTA 1SV5A 2XMKA 5CYMA 1KS2A 2W2NP 4TQRA 4DV6F 4JYAF 4ID5B 3PYFA 2ZE2A 1OQ3A 1X60A 3M2VB 3VZHA 2MSTA 4EO8A 2A6OA 1X4DA 1OYDA 1TL7A 2EPIA 3W2WA 3QO9B 4LSNB 3AD9C 4P2XA 1HBNA 3SQGA 2IFXA 1K44A 5GMEA 4RZRA 2E44A 2QLWA 4MKAA 3M6UA 3ZO7A 3GV5B 4WU2A 2F8EX 3Q8QB 3C6TB 3QFHA 1XNQJ 3MM9A 2VFVA 3ZZUA 3HZEA 4I4BA 2QA4G 3PIOQ 2HS0A 4A8YA 4NA2A 1RAHB 3UDCA 1Q82T 3MCOA 3TJ8A 2DGOA 3UCUP 2OPSA 2BKNA 1I6JA 3KLIB 2DVIA 4JI6J 1K0VA 2B8PA 4EI2A 3QT7A 3BDPA 1NK5A 4KPCA 2DGSA 5CYJA 2IM2A 1RT1B 3OTOJ 3ENQA 3CC4S 2YNIA 3TUIC 3PEHA 1N6QA 2WTFA 2V63A 4ALZA 4P7TA 1VLYA 1RDRA 2XMJA 4H4OB 2OLWA 3PJXA 3DMJB 1FFWB 3HHLB 2FVSA 4X4RA 2BQRA 1YDLA 2MQLA 3ZC4A 2NLWA 2YY3A 5B0EA 5L39A 3CO0P 4GO7X 4X84A 5F3ZA 3Q8SB 3RU0A 1AFIA 1JLGB 3A3PB 1VC0A 4FF4A 2AYMA 5DG8A 1YJTA 2EBEA 2G0IA 3FZBA 3T9NA 2V2ZA 4JI4J 2LXIA 5KFRA 2CJYB 1RTZA 5A0YB 1RXOB 3AOAA 2FJWA 1AUSL 4NXNF 5GVQA 2XZTB 4NOHA 3TEGA 1NH8A 4PPZA 2DITA 2BKOA 2DXEA 2KVIA 3PHTA 1U1LA 4B3OB 5L38A 1R8CA 4CO1A 2XYHB 2LDIA 4DMZA 1N56A 3DOKA 4HDGA 3UQSA 4DV7J 1PJ5A 5GAEI 4PG7A 4DQQA 1NKEA 4CCHA 1W26A 3FFIA 3R7SB 1NZ8A 1HNXF 1XWLA 4U8YA 5E3AA 1IBKJ 1IBKF 2CQCA 2NXCA 1LQ9A 1D9FA 1HIYA 3EMTA 1YLXA 3MCMA 4RNOA 1WHVA 3K89A 2R8JA 3A3OB 4RUBA 3CCQS 2HHHJ 3L3CA 3UCZP 1DLOA 3CMES 3W2WB 4KE5A 1TU0B 4WXWA 3FJ2A 3H90A 5EHHA 3KLFB 4DUTA 4NCGA 3QIPA 2MEWA 3CD0A 3OFHA 3LGNA 3TZZA 2F4VF 3V81A 2HURA 3GSIA 4A48A 3IWXA 2XM3A 4I6AA 3QLHA 1X4AA 4MFBA 2V9KA 3GYGA 3M4XA 3O44A 1BY9A 4I2QB 1NSQA 4K4TA 3JQJA 4ED2A 1Z2ZA 2YKQA 4NA3A 3Q8PB 1H74A 3CDUA 4KBIA 2NUHA 2LQBA 4PUOA 1SC3B 2CUYA 2IDLA 1NBEB 1OYEA 5KFGA 5M2PA 4DEZA 4X4TA 1YZ6A 1FA0A 2RKIA 1JKHB 5IT0A 1U2FA 1CBKA 2D9PA 3HSGA 2R7SA 1DQAA 2V8VA 1N33F 2GGPA 3EJMA 3V6KA 3VAMA 1N34J 1PKUA 2BOAA 3BV8A 2JEGA 4P6QA 3G8SA 2ZOFA 3TI0A 4QYZJ 2B3TB 1S6OA 3GYNA 2DYAA 3MMJA 4OHZA 4DR3J 4KFBA 4NZ7A 4BCAA 1IUJA 3E01B 1RTHA 2VG6B 4LT6A 3LP2A 3G71S 1RQ0A 3M8QB 2K3KA 4M5DA 1HD1A 1WF2A 4ES1A 2G4BA 2Y9HA 4DLEA 3OFEA 5LMUJ 1FFSB 2I0XA 4ZJLA 4ECYA 2BJ3A 1T3OA 2QG9B 3QBCA 3IRXA 4DV0F 4K7QA 4LR8A 4A8MP 4IQMA 1F3FA 4X4SA 2KG0A 1VQ5S 1GMWA 1EQ0A 1FXLA 1YJUA 1R0AB 5F41A 5E5NA 2D9OA 2M0GB 1AA1B 5LJ3Y 3RB4A 2VPWB 2RE1A 3GIKA 4IR9A 2BR0A 2NQPA 4LSLB 1HNZJ 1YSJA 1P9QC 2HQFA 3KJFB 3CGIA 4MIBA 4KB7A 4DSEA 3U7JA 3VGUA 5D4LA 4ECTA 5BYRA 4EWTA 1VBYA 2UVRA 4CQ1A 3DM2A 4I1TA 2JFKA 2N4CA 1FX4A 2A10A 1DAXA 1AYEA 4XPCA 4LF9J 1RT7A 2NSCA 1KP6A 2XSJB 2B8QA 4QQBA 4C6AA 1G7CB 1U47A 5EWFA 3I0RB 1CJVA 1H73A 1IBCB 3THPA 1YHQS 4IRCA 1BXNA 1K47A 2G2YA 3H20A 3JSMB 3NCQA 5U47A 3QT6A 1DTQA 3D5MA 1RWMB 1Q5YA 1A6LA 2E9ZA 3NGKA 1SQGA 2HBZB 5KFYA 2YNIB 3N9UC 4ZVQB 2CJAA 3FZ2A 5E33A 4M1KA 4WP9A 1QTNB 4CLPA 3K57A 2OEMA 3Q0AA 4DWIA 5CYQB 3HF5A 3P45B 2VOPA 1OSCA 1CJTB 2CQ3A 3FEXB 4H54A 4V1Ak 3MAAA 3RBXA 2L08A 2ZOMA 3EVWA 3SYZA 1SQFA 4GVBB 3JTNA 3AB4B 4KQZA 1Y7PA 3W9IA 4ZS6A 5ETOA 1S48A 1MN9A 4CYUB 1TKXA 2EC2A 3LAKA 3H5YA 2XY5A 3ISNC 4IH7A 4IH6A 4QBUA 5DZ7A 3W1YC 4ICLA 4YR3A 1QVGR 1U6ZA 1LXJA 2WHOA 4XO0A 4WK1A 4ZCMA 1FWLA 1HL6A 4RX6A 5KFOA 2AF6A 4DUYJ 4KGXB 2W24A 1NHKL 2XTJP 1TL7B 2RHQB 3VZIA 1WC6A 4IFVA 2EWHA 2PMHA 3DRSB 1K1SA 2OTLS 4N5SA 1KFSA 1J5OA 2Y0BB 2P8IA 4Y2AA 4FXWA 4F2RA 1P6TA 2QIFA 2IHR1 2W9BB 2AJFE 2MQNA 5GMDA 1HI0P 1DZ5A 2DNLA 5F8GA 2KJVA 3CB4A 4K4YA 3IR6B 2GO9A 3MI7X 3PYEA 2KO1A 1S0MA 2JOQA 3RAXA 2GHVC 4K2JA 4ES2A 3QWUA 1JLFA 1FHTA 4LF5F 3OL7A 3J7AN 4AL7A 3JSBA 5T14A 3W2VB 3D6FB 4RUHA 1FT8A 1WG5A 4WYWA 3MMCA 3W66A 5DDRC 4F3OA 1B4SA 1R43A 2BJ9A 4YFUA 1HWUA 2ZD1B 4HHUA 4DV3F 1ZM3A 1S57A 3KK2A 3D6MB 3QWPA 3MEDA 5K14A 2QO3A 5I4MA 4IFYA 4TY8A 2KM8B 1UFLA 2ILYA 4C3MA 2CZ4A 3LF0A 1ULRA 3KLHA 1T05A 1D09B 1Q8BA 3MCNA 3IS9B 2J9DA 4ZPTR 1DTTB 1F60B 1TL5A 2GGPB 4PQUB 3EXCX 4KHMA 1TL1A 3VV2B 5KFTA 1YI2S 1L3SA 4LF7J 3ZZPA 1Y4ZB 2Q79A 3TZWA 5DQGA 3O2IA 3QATA 1NHUA 2O5DA 4ZLLA 2KB2A 1WELA 1F3VA 2AP6A 4ELTA 4DSIA 4FYDA 4B3MF 2DNKA 1CC7A 1CQMA 4ZVUB 4CP5A 2NS1B 2Z57B 2KKHA 3I4HX 1CLFA 1ZS6A 3PRDA 3JSRA 4RU2A 3QO9A 4ZN1A 3BSNA 4DR6J 3GONA 4GKKJ 1FWKA 3DLEB 3RGIA 4U96A 2C2DA 1JXLA 1HYSB 4OZ1A 1ZZNA 4C98A 4JI0F 1DY3A 4DV2J 1U1MA 5KT3A 4OYOA 3G4SS 1D9DA 1VJQA 2DD8S 2HRYA 3GP9A 3KOAA 5DLGA 4ECUA 2IC3B 1Q78A 1S12A 2VODA 1G3OA 1WG4A 2BQ3A 4FXVA 1N5TA 1C2PA 3WDOA 2V9WA 4J91A 1S1XA 3I31A 4H4MB 1F5CA 1U0HA 3GR0A 2AU0A 4NEZA 2DB1A 1HQ2A 1RKIA 2MMYA 3GFXA 4Q7AA 4YDDB 2RS2A 2UU9F 2F4VJ 1SH0A 2GAGC 4EFAC 5H1SV 4QR0A 3QYYA 1HD0A 3HT0A 3KMQA 5E7OB 2D3UA 1S1WA 2MZTA 4IG3B 3MPVA 4G1IA 4C11A 2Z4PA 2OPRA 4Q0BB 4OJ1A 2X7IA 3WIVA 4BC7A 1B7YB 2RAQA 3JAMU 1RISA 5KFQA 3CMAS 4OL8A 4C3LA 3DYAB 2W7AA 4GMKA 2JC1A 3DRPA 3LGMA 3MMAB 4OZLA 2JEFA 4K4UA 2PA8D 3IWLA 3SQOP 4DR4J 1T9TA 2JZ5A 2OEJA 3V2UC 4ZP7A 3MR5A 1AB8A 4NPOA 1XMOF 3OVBA 4DR3F 4R0JA 1Q4RA 2HBRB 4B9MA 3U02A 3ETOA 2AGPA 2G2ZA 1ZH5A 4Q5VA 3ET6B 4NZ0A 5A8KB 1HMVB 2VG5A 2YWGA 4XK8C 4D3GA 4RBVA 3KMSA 1VBZA 1S0NA 4K59A 2GNKA 3HD2A 1LWEA 2HFUA 3B6BA 2UV8G 4M5MA 2XB2D 4ENOA 1VK3A 1CULA 2M52A 4USVA 1QAXA 4F4WA 1XNRF 4ZVEA 4ZVPB 4USJC 1Y5IB 3C6TA 5L9XA 1NK4A 2KZZA 3DRYA 2HHSA 2FHOB 2A2DA 2NPIA 3A1YG 1YK9A 3LQVA 1FRXA 3RZAA 5L1LA 3MEGA 3T5JA 1FJEB 4KKOA 3D6HB 1HI1A 1PBUA 3EGNA 1UVIA 4DFJA 4DN9A 5I3QA 1WEXA 3K5NA 5LOQA 5DDPC 4JI0J 4U6PA 3MPUB 4QPTA 2FZKB 4TVAB 1E6YA 1QAIA 4FVMA 5B09A 1X4BA 3R27A 4ZP9A 4AQYF 3CTRA 2QV6A 2QSWA 3VHQA 1MWZA 1Y3KA 2O01C 4OYAA 4DBQA 4FS2A 2VQEF 1FRIA 4NRUA 1U48A 2R7XA 1QSYA 2ZOGA 4I2PA 3V4IA 2K7KA 1HNIB 2MLYA 1YBUA 5KFCA 2JNJA 3OR2B 4RNMA 3K59A 2PC6A 2HHVA 4X4NA 1MWYA 1QSSA 1JXEA 3OHAA 1I51B 1Z2LA 2J0QD 2KN4A 3CCLS 1IWAA 4J9KA 2LXFA 2NUUG 1S1TA 1LWCA 3VQSA 3DKDA 3NBPA 4DV6J 5J1EA 2HRUA 3W5YA 1RWKB 2I1RA 1FKPB 1S1UB 3CEDA 4CLZA 1HWLA 2L9WA 3CSKA 3BO4A 3SZ2A 1PBAA 3MPWA 3LPYA 3DRPB 2CG4A 4C8KA 2UXBJ 1OQ6A 5DETA 2GJFA 3BGRB 4F7VA 1WOPA 3CULA 5J2PB 3FSYA 2JX2A 3H2LA 3KHHA 3T5HA 3ZFVA 4B3TF 1E6VA 3MUMP 1IKXB 3NOGA 3PCOB 4ANCA 4YUDA 1HNXJ 3RB6A 3UD3P 4NLSA 2W7OA 4RW7B 2ABYA 3MPDA 1U02A 3RJMB 3TARA 1APSA 2CZ9A 3B4DA 2DXFA 4NXMJ 3OL9A 2P9EA 1XJWB 2DR9A 4J9UE 3SI8A 3QIPB 2GHWA 1MLAA 4QIVA 3AY0A 5FD1A 5HI7A 3ITHB 3DLGB 2XYGB 3UFCX 5LM7E 2HNDA 1BQXA 2IIHA 4I69A 1KBRA 1S6PA 2MKJA 3VQTA 4CO0A 2MQOA 3HVWA 3QRRA 2LFVA 3JYTB 1VI7A 3HSZA 3KUGA 4TNOA 2W2OP 4H4MA 1U0HB 5B0GA 2B56A 1S7IA 4X66J 1DRZA 3RW7A 5F0UA 3LGHA 1X0PA 3MZIA 4QJVA 3DOKB 1UJ4A 4URQU 5F9NA 1S6QB 3CCUS 3ELHA 4FS1A 1RT4B 4ED8A 4USIA 4KH0B 3ZZYA 5KFKA 2DNZA 4CWBA 5A8RB 2VICA 1VMBA 3LP2B 3GCWP 4WK3A 2HNZB 3FMBA 3UCGA 3R5DA 5C42A 2DO0A 3AJDA 3POTA 5CH7B 2VUGA 3W64A 2HS3A 2QC3A 3HULA 5DRKA 5LXRA 1YITS 4DV4J 4DR2F 3P8BB 1TL3A 2MZQA 1FI4A 5ETMA 2AHOB 2B4UA 2VC0A 3L95X 3O1LA 4FPIA 1J5EF 5JMNA 2HNYB 2VB6A 1EP4B 3HHNB 1LW2A 1B7FA 5AXNA 1TKTA 1RT6B 3PHEA 4AL6A 3GTYX 2H5JB 4Q8FA 2N3LA 3EYZA 2FLNA 2PI4A 1RGVA 1RTHB 2VG6A 2EKYA 2JH3A 4EMDA 3RRKA 2LKZA 4AL5A 1XTZA 1KRPA 5KG6A 4A8KA 1FJCA 3N79A 1UP1A 4XTTA 2AW0A 2ASJA 1I5OB 3G9CA 4USTA 4PXEA 1EKSA 4A8SA 1P9YA 3ADAC 2IM3A 5AE1A 4J9QA 2X51A 3W5XA 3D3CJ 4JI3F 1RCOB 4HI2A 1UAWA 3JQKA 3CMQA 1X5OA 3M2RB 1F9EB 2OI2A 2YWHA 2BKPA 2HHHF 2GVDA 4I7FA 1RI7A 2ZNZA 2CPJA 2QX0A 1QY7A 1HQEB 3BF4A 4C0OC 5IM0B 2DRBA 4NI2A 2CRLA 4DPUA 3CCZA 3QPIA 4I7FB 3EE3A 2WW4A 2RJZA 2Z58B 2V8PA 4X4VA 2D7SA 5D0GA 3UI3A 4ED1A 3C6UA 3D2WA 1C4CA 2C2OB 2MZ1A 3KTQA 1T9UA 3NGSA 3PM9A 4PRFA 1JLFB 2YWFA 4LUBA 1TKTB 1IQZA 1S99A 2VV5A 5E41A 4HT7A 2BOPA 3FRYA 1MU2A 1RT3B 2RRNA 4PR6A 5HQ8A 3HO1A 3HXMA 3UNYA 2GO8A 2B6AB 1HW9A 3EZOA 1KEKA 3HPOA 1N33J 2CAJA 3SEOA 3OW2R 4N76A 3UVJA 2OPPB 1ZYQA 1JB0C 1WSVA 1HMVA 2VG5B 1KWMA 4RW4B 4IFYB 2LEPA 1Q8IA 2QGFB 3K5PA 4TY8B 3TJAA 5HVHA 1TMMA 1P8GA 3ENAA 3I9ZA 1UFKA 2E1CA 1KHWA 1SKWA 4EU0A 1H2TZ 2HYIB 1NNDA 2YVSA 3ICLA 4OX9F 4X4QA 4K5SA 1VQOS 1EP4A 4USKA 3M8ZA 5CXTA 3SDEA 1B3TA 2NR0A 3IBWA 3IGNA 5HN0A 4ECRA 4GKJJ 2RQCA 3OHBA 4FP9A 4ECQA 3CT9A 1S76D 3O3LA 4K0KF 4MK9A 3L9ZA 5D4NA 3MTKA 1N0VC 4DPOA 4AXJA 3K5LA 4RR5A 4DSLA 4OYBA 5K5MA 2DK2A 5IT4A 4CH1A 2RH3A 5C42B 3HFKA 4J9RA 4DR5J 1VCTA 1EARA 4CO3A 3HLUA 3OXGA 1AUDA 4DPTA 3HJFA 3IAM9 4KHPJ 1H6KX 3TRGA 1GXUA 2AKWB 3TQEA 1V3ZA 2BANB 4Z7CA 3KLIA 3VVTA 1V3SA 5HK4A 1F1BB 2ZBIA 3SXLA 4B3RJ 1R0CB 2YTCA 4Y28C 3KK2B 2VBZA 3ILLA 3HFZB 2IPOB 3MTJA 5HATA 3UE2A 4CLFA 4UT4A 4IQXA 4WE1A 2I6WA 5JVHQ 2VFUA 2QMUB 1GQEA 2VIHA 5HAOA 1RWVB 3ILOA 3C15B 1BHNA 2ZH5A 1U4BA 1T94A 1U8WA 4M5KA 2C3OA 2QL5B 2ZC3A 5EGYA 1U49A 2CJKA 1TFWA 2DIUA 1SIWB 2M88A 2FLLA 4F4XA 3N5FA 1S9GA 2GQ2A 5LSOA 3NMAA 4R8UB 1QLNA 2CNKB 1FESA 3DOMB 4HR2A 4DSKA 4HDHA 3HFVA 3R9LA 5IM0A 2U1AA 3N6MA 2GW8A 4CLWA 4EO6A 3IRWP 4Y00A 4CLLA 1NH7A 5FDLB 4DQPA 2KFZA 3FEYB 3AQOA 3GG1A 1PILA 4EBCA 1KQFB 1LEOA 4PQAA 4PXBA 3TOQA 3BH7B 4P52A 1VR6A 1IJFB 2I38A 3CO9A 1LK7A 2PFDA 2VU5A 4FYVB 4QWDA 1FRHA 2IYGA 4ZJOA 1FERA 3NP5A 4DQRA 1S77D 2ADCA 2FYXA 2K2PA 3CJ0A 4WFAQ 4IG0B 3HD1A 1YRUA 3TZYA 2W25A 4OZNA 5KFHA 3EVMA 2RDJA 1RHQB 5KFMA 5K14B 2O3DA 1EQMA 3NKYA 3SFUA 1UVMA 2V2KA 1M5VC 3ILJA 4X4UA 2FIUA 1L3TA 5F8NA 3KLFA 1FFGB 1CJTA 1RHUB 3A12A 2MLZA 1UTAA 2QZ8A 3IR5B 3EPIA 1QSLA 4KSEB 3FBEA 4J90A 3DLKA 5GAGU 1S9EB 4MFBB 1HWKA 4DR7F 3ZZZA 5H9EJ 3MEEA 2HQDA 2JRSA 3MOZA 1YJVA 3M30B 1U45A 5HBMB 3B78A 3EZ5A 2X3DA 1XN9A 4DSFA 4IO1A 1XIQA 1S1XB 1QAJA 2ROEA 4WFYA 1CJKB 4BHQA 4TU9A 2D1CA 5L1JA 3T1YF 1SUQA 4WCEQ 3OXLA 4U7UD 1EAYC 1N5SA 4DXLA 5IOLA 3PACA 4NLQA 4WKYA 3MUVP 3G96A 1F2GA 4PPDA 1URRA 4OZ5A 2KT2A 2XMTA 3CJ3A 2E7XA 4OQJA 5ETRA 3GQCA 2E7WA 2ZM6F 3QGPA 1XMQJ 4ERDA 5KFFA 1S72S 3UD4P 3J7A1 2HFZA 2K3IA 3CD6S 2HLTA 2MZJA 2RIJA 1X5TA 1EETB 1WDDA 2NYIA 4WIQA 3T9ZA 4F0MA 3R6GB 2CJ9A 2GQQA 3MFIA 5D0HA 4ZIWA 2FUG9 1IR2A 1DQ9A 3LTOA 5CCMA 3EVOA 5C7PA 4DV1F 2FJBB 4DV1J 1NRKA 4DUYF 3M32A 4H4KA 4QR1A 3CXCR 1UVLA 2ZZMA 2G2OA 4NLPA 4CZCA 4G3IA 2YNHA 2EFNA 2XI2A 3RG6A 4CT8A 2XG8A 1U0SA 3H42A 3CJ4A 2FQQB 3CCTA 1DARA 2AZ1A 2B4OA 1V9OA 2PD1A 4KRWA 4UZBA 1HNWJ 1ZOTA 3W8GA 1X9WA 2HG4A 4X2BA 3NGTA 4YR0A 1YBTA 2DXDA 2P2CB 4OJHA 3PV8A 4FF1A 4LFCJ 2ZHBA 4Y2IA 4DF4A 1HLWA 3P49B 2HVHA 2XBPA 1KLMA 1LFPA 3EXYA 5B0AA 1HBUB 1YQHA 4CYUA 1KLNA 4JUZA 2ZVIA 3I0SA 3CC7S 3AA8A 3GIJA 4I67A 2IC3A 3MR6A 1QD1A 1RK8A 3NXZA 3R7NB 3DI6A 3EWGA 3MUTP 3MECA 2EVZA 1UW4A 2YNFA 3TO8A 4J5OA 3SSQA 4MIAA 4F4KA 3L4BC 1IKYA 1PYTA 2DISA 3C6UB 3JXOA 1UWBA 2R2RA 4FDFA 1EZZB 4USMA 2CWXA 1TFYA 1FD8A 4DR7J 1OSDA 2QT7A 2ERRA 5K8NA 2BE2A 3OJSA 4OYWA 2LLZA 2KXFA 3QSYB 3R1LA 1SJFA 2BABA 4I0WA 4NLDA 3P96A 7FDRA 4WPAA 2W8LA 3JQMA 2ALZA 3EGVA 3LA0A 4LF7F 1R31A 3CCWA 2MKKA 3BGUA 2C2RA 1RA7A 2HBYB 1Q8LA 2V68A 4ZCKA 5FJ4A 3TUZC 5F8MA 3LW5C 2DGVA 4C97A 1M90T 1WTBA 2BACA 5ADZA 3MEEB 1VFJA 4NZ6A 3CC2S 2DBBA 2NXNA 1SJRA 4AD6A 3C14A 1P27B 2LQ8A 3IM9A 1EJ7L 2BE7D 3IMQJ 2XWYA 4ZOSA 4UQGA 4ZVFA 3CDEA 2OFGX 1R8PA 1VS3A 1WKKA 2I5JB 4QWCA 1ACMB 2A2CA 2RVJA 1Y9OA 1HPZB 2A1BA 2VASA 3AD7C 1YJWS 4EZ9A 3KG4A 2YX4A 1RU2A 5SZTA 4TU8A 1S4EA 1U1NA 1ZBTA 5KG3A 2OELA 4CNZA 3J81j 2R8GA 4KV8B 4Y3CA 4LF9F 4FNHA 4DUZF 2OPSB 2CVEA 2DNHA 1UZHA 2PDAA 3Q8VA 5KFIA 4CO4A 2QEXS 2XLKA 4NWBA 3IAS9 1KC8T 2FVQA 5KFNA 2CQGA 3M7VA 2F9JA 5CCLA 4Q45A 4J9SA 1VBXA 1GH8A 3UR3C 5IT9Y 4RW9B 1H72C 1JXVA 2FJDB 4I2QA 2LXUA 4DPWA 3SQGB 1VQLS 2XSFA 2BE2B 2HMIB 1RWPB 2FHJD 2V8DA 1RT4A 2CJBA 4H4OA 2HS4A 5KG2A 1FO1A 2VG7B 2QL7B 3HHDA 4CH0S 5HSPA 1FVSA 4TYBA 2GIFA 1B70B 2ACMA 2IBOA 1KFDA 2HZAA 3V6DB 2HWIA 2ZD1A 2M9KA 3I87A 4Q2LA 5B0CA 2E9TA 4LRCA 4X66F 2XZWA 3CJTA 1NHVA 2UUCJ 2KYXA 1V5IB 3R5AA 5KFVA 5HP1B 1RYSA 1AT1B 2R7OA 1HBNB 1LFWA 3ENVA 2KHDA 2UXCF 3MHYA 1KD1T 5J2NB 2PEBA 2LP4A 2XHCA 3PTWA 4CDIA 2B9EA 4YDXA 1DHMA 4DDFA 4DCJB 2X1BA 2M8HA 1GMUA 2GMHA 2XWXA 2OD6A 1LWFA 1RHKB 3GFZA 1H3DA 3JTPA 3QAUA 4LR9A 1FEEA 2MZRA 4DV2F 1XEZA 1ZA2B 1SJ3P 2PE8A 2VPZB 4U95A 2H48B 3J7YU 4OX9J 1N4LA 1XQIA 4NYPA 1X4CA 2OFHX 2DHXA 2N82B 2FZGB 9RUBA 5IC6B 1T8EA 1YTYA 4FNIA 3M8QA 4M5DB 1SPBP 3TW0A 1PC4A 4ETZA 2YQ1A 2Z30B 1UFWA 1WEYA 4CTAA 1S49A 5HANA 4AFFA 5L46A 1M5PC 4TY9A 1O8BA 3BM7A 1OY8A 4PQUA 2CPDA 2EFGA 2MZSA 2R4FA 2H54B 4FN5A 3IRXB 3SCJE 3OPKA 5FIIA 4ZHRA 1GTHA 3TNVA 4K2XA 4EYHB 1LWCB 2CG8A 4IOAQ 3N4WA 4EGLA 4G1QB 1FNOA 4ZJQA 3CE8A 5I3UB 3JS9A 1SI9A 1NDPA 3DRRA 1ZM2A 1JJ2R 2YWKA 1EHWA 5LMNF 2OMOA 3THVA 3VGSA 2LU1A 1XMQF 4K50A 2LEAA 3N5BA 1N54B 3C14B 5E3PA 1W2BR 1ZZFA 1QAYA 4F0HA 4A8QA 4NMLA 3DN9A 2QMXA 4OZ0A 3UD5A 1N5YA 3BZQA 2MQ8A 4JV2A 2AQ4A 4DL7A 1U26A 2LU2A 4P2MA 4FBTA 3POTB 2NSBA 3HI9A 2H5IB 4MYUA 1AFJA 1Y11A 2CDRB 2OGUA 3PW2A 5ETNA 4DU8A 2DHHA 2BV3A 1RAFB 4UOGA 4PG8A 3R2CJ 4Q8EA 1NDKA 1Z4UA 5IC4B 3I0RA 4OJ3A 1RCXB 4C0HA 4AUKA 1S6QA 1JIHA 2KU7A 2WVEA 2VD3A 7AT1B 3W60A 1PSDA 4YY3J 2HK2A 4GRSA 5KFJA 2LYVA 4ED4A 4JI5F 2DGUA 2X1GA 3MD3A 1C1BB 5C24A 2D69A 2VBWA 4AT1B 3EICA 3IG1A 4P9SA 3BO3A 2L48A 1OS5A 3PW4A 1HR0F 2MSSA 3X3UA 5C2GA 4NLTA 5DQIA 3OUYB 2E5LJ 1ZAWA 2DJWA 3N0VA 4M5HA 4YEAA 2QJ3A 4ZVOB 4IDKB 2BXJA 5G0RA 5ITHA 3CIZA 2E1PA 3HDSA 4O44B 1TV6A 2AV5A 3DRRB 3SV4A 4HTJA 4ECXA 2OUGA 1RABB 4EEYA 1XC9A 4LFAF 4DCOB 1NZAA 4GC6A 3TA1A 5KFDA 4M95A 1B0VA 2V69A 1TUVA 4QIEA 1T11A 1VQ8S 2Z2MA 3MM6A 4F3QA 2IYIA 3T1HF 5DDQC 2HBQB 2XMUA 1WUUA 1WNEA 1CJUB 5F8JA 2GMJA 2YKOA 2HQ3A 2HWHA 2ROPA 4WWSA 4XAKA 2PN6A 5D77A 1HA1A 3S1TA 4IG0A 1Q7YT 5ETLA 4W92B 2OPPA 1O51A 1RUSA 3CCMS 3OFGA 3HSJA 1VIXA 4NA1A 4WFBQ 3EZUA 3THTA 4AXIA 2WK4A 3ZZTA 1WSRA 3VALA 5HQLA 4Y6IA 1RTJA 4F25A 2B43A 2J76E 2K1RB 2YQ0A 5B0BA 2R2SA 1VQNS 1JJHA 1FDDA 3I56S 3FSXA 4N77A 4E0DA 4CM0A 2IMOA 3ZTSA 5I3PA 2HEKA 4DS5A 4NCGB 4A8OA 2PI5A 1WI6A 4C8OA 1FK9A 1U2CA 4L74A 4RBUA 4WP8A 3Q86A 3IP0A 1M5KC 1K8AT 2X3GA 2KJWA 1SIZA 3MAHA 1AZSA 3CUNA 4F0KA 2UUTA 4NLYA 4DR1F 1SL2A 2V4JB 1C0UB 3GWCA 5HL7Q 4MTPA 3DRXA 2F8HA 2GJIA 1A9NB 4Z7YA 3CJ2A 4DS4A 4NCBA 2EKNA 2KYZA 3KLGB 4ED3A 4JI8F 1D0EA 3ILIA 4E8UA 3C3LA 4DV7F 1M1HA 2HSEB 8RUCA 4WP3A 2I8EA 4B3TJ 3OTEA 2V34A 3FBCA 2VDHA 3GSDA 2UUWA 1IR0A 2Z56B 5EX0A 2J6SA 3SV3A 4DQIA 2RMLA 1F9FA 4ZN3A 5ETPA 3M1VA 1LWEB 5HMYA 4RW9A 1AROP 1T05B 8ATCB 2PMWA 2H3EB 2RU3A 3KHRA 1ROFA 2WOMA 3CD7A 1N34F 2IVMA 2ZFHA 4X65F 2VC1A 4GVBA 1NSAA 2BYCA 4I64A 5BR8F 2WBRA 2J6TA 2OTJS 2WSCC 2UZAA 2DHGA 3AOBA 4PWWA 4DL4A 1HNVB 5IQQA 5MLCV 2UU9J 1JLAA 3KLHB 4A8WA 2WONB 1FTRA 2ZBCA 1YGYA 1Z1ZA 3O6QA 2F3JA 2MGZA 4O3SA 3Q8RB 3DYAA 1TKZB 4ZVRB 2FVCA 1TZ0A 2JLEA 3BR8A 5KOXA 1MN7A 4U9RA 3GJSB 3QZ8A 2HVIA 2R8IA 3MXHP 1I1GA 2G9OA 2RQMA 5AXKA 4URSA 1Q81T 4KJIA 1R6VA 1FX2A 2OPQB 5CHCB 4RLEA 4PYAA 4LQ3A 4RW6A 2AYEA 3GMGA 4Y2MA 5B0FA 3T3FA 1PJ6A 2YKMA 2HLUA 4FPRA 5CYMB 3ZXWA 2HQIA 1QE1A 3RBDA 3HJVA 1H98A 3KJNB 2HQGA 4PG5A 3JSYA 3PO4A 5KFWA 5D4PA 2E5HA 4ZA1A 1J2VA 1Y5NB 3CDBA 1VHIA 1VRUB 3PW0A 1FWPA 1UEUA 5A0YA 4DHVA 2E1AA 3AJ2A 3BKTA 3TAPA 1LOUA 3DFEA 1U25A 2J8AA 3OR1A 5B08A 1VRTA 4IR1A 3M30A 2JWNA 3UN2A 5HMZA 4UUXA 5CYQA 5KT5A 1S1VA 1U1KA 3UDVA 1IKXA 1NMEB 4Z37A 4UY8T 1VQ7S 4NX9A 4EZ6A 1C0TB 2DH8A 3CCVS 3NRBA 2H9ZA 1SJ4P 2QMWA 1HHQA 2HFVA 3C2PA 4DJBA 5K8MA 1MWQA 2HAIA 3WX4A 2XZDB 1JX4A 4LVNP 1VHFA 4OYZA 2FDNA 2H1YA 1IM6A 5F8HA 3MMAA 3F56A 3RAQA 3JB9k 3HT3A 5BR8J 2J9EA 2WB1D 4R0EA 3T5LA 4QYRA 2E66A 5FLXU 2FY8A 4HVZA 4WBFA 2VQFF 4ZMMA 1NSPA 2XY6A 5JUMA 3RRGA 1FDBA 2FTRA 5KT6A 4CI0B 2RNEA 1H38A 3H8YA 2HPUA 2LQ9A 4ZLJA 3IWNC 3T1AA 4DG1A 2YX7A 1S1WB 2EG1A 4NYZA 4YB7A 4C11B 4TXSA 2R8HA 1IBMJ 1NPKA 1U1RA 3PDNA 3IG1B 3NY0A 1SJ1A 2VFRA 4ETXA 3E3XA 5HO4A 5IV3A 2HHTA 2DRAA 4B9NA 3BYRA 3IM8A 3NCPA 3TJ9A 2YH0A 3RR8A 1ZTWA 2F7VA 2I9SA 2ZC4A 2RILA 3KDOA 4IDKA 3QGHA 3SCKE 1BQNB 3W2VA 2WCXA 1S0OA 3TA0A 1AZSB 2IJRA 5BXIA 2V94A 3H5UA 3MM7B 2OJ3A 4O0IA 3E2EA 1SUQB 2E1MC 2EK6A 2LDYA 1UPMB 4I2PB 3V4IB 4C4WA 2B5JB 4WF9Q 3BREA 1IKYB 2AYGA 3A3NB 3ULHA 1H2VZ 2GS8A 3CDWA 3I4PA 4NL5A 4UOCA 4RNNA 1NO8A 2HGNA 3MOJB 1G2EA 1KVJA 4OZ3A 5JJBA 3K8WA 3DGVA 4N7TA 4P75A 4ZPWR 5D8HB 2HMIA 4LJMA 2HGMA 3W7BA 1A7GE 3HZGA 2LVWA 3QMQA 3H5XA 4K8RA 1F9HA 1JLCA 2JVOA 2EW9A 4O3NA 4OZJA 4M5NA 2JL9A 2CQIA 3D54A 1UA0A 4ZHRB 5C25B 6AT1B 3FC9A 1D9AA 2WVDA 3DLJA 1GXLA 3OV7A 3RTVA 3BDEA 4LRAA 1KN6A 2FJVA 5EWEA 5J2MB 1CVJA 2QRRA 5J1EB 3P6YC 4Z2XA 3U27A 3TEHB 3UN5A 1ZAVA 3DM2B 4C0BA 4LF8J 4I6WA 3J7ZT 2MJNA 1RWXB 1B0TA 3OBIA 3RB3A 3AXKA 5JVGQ 1SVDA 3DDIA 1X9SA 1GMWD 1BGXT 3MWBA 4U67Q 4P2SA 4EUVA 2XGQA 2DHSA 3DC2A 5KG1A 3GR1A 3I6PA 5IWAF 2ZBRA 2FHKA 3LPEA 4K0KJ 1NJXA 5D6GA 1KQKA 1XR5A 2YX1A 1K1QA 3C66A 2DY1A 2ZH2A 2OSRA 3LALA 2PSZA 5L8RC 1SKRA 1B64A 3BBFA 3T41A 3BGOP 2DT9A 2JVRA 3GYXB 1HW8A 2O67A 3KNGA 3OQ2A 2DHAA 2MHEA 2I2YA 2HVEA 1WC5A 2Z2ZA 3LO3A 2VG7A 1HNIA 4L76A 3AB2B 1RHRB 2GQCA 5EWGA 4W4MA 4GC7A 5J1NA 5KFPA 3MR3A 3NS7B 1UVKA 4P73A 4F8RA 2DNOA 4MH8A 4JI5J 4OYXA 1Q95G 5I3UA 3ZTQA 4F04B 1WEZA 3BGFA 2FGCA 2W1BA 3QIDA 3CCRS 4N41A 5T7LA 1NK8A 3J80U 2UVVA 2B5JA 1X4GA 2BRKA 1OY9A 1X4FA 1ZPVA 2BA9A 4QW9A 1XERA 2PFFB 1C1CA 1OPIA 1N5YB 3D66A 5E3QA 3TVZA 4ZLNA 3DLKB 3F73A 2R9LA 4ECWA 4C8LA 4ID8A 4YHHF 2HHUA 3HSDA 2RQ4A 4WTYA 1GFWB 3C46A 1XR6A 1RAAB 2XHWA 4F67A 3Q89A 1R3NA
chains in the Genus database with same CATH topology
1FRMA 1R89A 3MM5B 1U1PA 2CJQA 3D1HA 3FRZA 3DLEA 4C8MA 4B08A 2U2FA 5LSLA 3U1NA 2M7SA 5KG4A 3EGWB 1WHYA 2CDQA 4TQSA 2MB0B 4K4ZA 2R7TA 4U7CA 1AXQA 4HEA9 1HARA 1RT2B 1UL3A 4RUAA 2WSEC 1IKVB 4WKRA 1O5JA 1Q16B 4RNHA 1T3NA 1GXTA 2UUCF 1CQNA 3H2VE 1HHTP 1H7WA 1UVJA 5KFSA 4UQTA 2F8MA 1SB6A 3FQKA 4OI6A 4R25A 4B9UA 2E29A 2C3UA 3UWTA 1TKDA 3KK1A 4IG3A 1KOOA 2AJ0A 2Q6CA 3O8WA 4OI1A 2XLJA 1R8AA 4HTIA 1U24A 1XMBA 1QVFR 1TK8A 5BJRA 1K73T 5I42B 3KJVA 3KK1B 2OH2A 4QIWD 5A6PA 3RRHA 1D1UA 1S4FA 2P6TA 1L3UA 3I5BA 4CH7A 4ED5A 3BSOA 2RSQA 2R2UA 5THWA 1RT5A 6FD1A 3QGIA 1X5SA 1KNZA 5GAHI 1N8RT 3G6YA 4N47A 3I0SB 4WJBA 3BO2A 5AXLA 3OSNA 2D41A 5B0DA 1TVRA 2QA1A 2ROGA 3S6EA 1NJYA 1X9MA 5LJ5Y 4X4PA 2EC0A 3ISND 4G1QA 1TKZA 1RTJB 2GMLA 3GZ7A 2MDAA 4RW4A 1SC6A 1M0SA 1YJNS 1NB7A 4RW7A 6FDRA 4QCLA 1M5OC 4MK8A 3ISZA 2X1AA 1N48A 3J81Y 3SDEB 3WC2A 2KRBA 4ZP6A 2ZKTA 2V8HA 4HH1A 1HBUA 2BM0A 3H25A 3MDFA 3CJKA 2UUAF 2R7VA 4IRDA 1KONA 4HT5A 3KK3B 3MM6B 2WBMA 1C0UA 1NK6A 1T95A 2XMVA 1Y5LB 2OD4A 2VOOA 4NLVA 3V5RA 1LWFB 3H4BA 2OP5A 2IA0A 2RDIA 2RQKA 1RT1A 1IXKA 2BJDA 4LF6F 2XMMA 3VAIA 1SH2A 3MF5A 1T03B 2BUNA 2Q6BA 1WHXA 3ONQA 1CSJA 3M1VB 4FXDA 2KFNA 2VH7A 1VK8A 3IGVA 3CCJS 4ILMA 5HMWA 1U6FA 2D3OR 3HMJG 1KSPA 2CYYA 2G1DA 4Y65A 2ZH8A 1I94F 4QOTA 4DL5A 2DNPA 1REVA 4URGA 1KR4A 4X64F 2B4PA 5DJBA 3TANA 3KHGA 3RW6A 2DNGA 3I5AA 4EBEA 1Y3JA 5HROB 1DBDA 2P5VA 3AQPA 2K1RA 1T8EA 5C25A 3CIMA 2V0NA 1IN0A 1SH3A 2D74B 5H9FJ 1C4AA 4B17A 5J1PA 1V6HA 5AXMA 2GA7A 1RA6A 1D8ZA 2BW2A 3FVYA 4M63A 3B4MA 1TP7A 2FJAB 1MMNA 2RD5C 3BN7A 1S0VA 1HBMA 4NXMF 5M2UA 2LQJA 1NK0A 2UXDF 1M5SA 2L3MA 2HNDB 1R6YA 3MURP 3PVXA 1NK7A 2HGLA 5DGAA 1RT2A 1GAOA 2OSQA 4QIFA 4J9OA 1KTVA 3OTDA 2O1PA 1WHWA 1BC6A 4J9MA 1NJZA 2RRBA 4KTQA 4OV1A 2DNRA 7FD1A 4ELUA 2QSFA 3OR2A 4GKKF 2B6AA 1JLBB 2AWZA 2LECA 3PO5A 4XPEA 1F5AA 3M8RA 2E5LF 3G6VA 3FDSA