3KK3B

Hiv-1 reverse transcriptase-dna complex with gs-9148 terminated primer
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
427
structure length
407
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
total genus 96
structure length 407
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B04
3KMSA 4J9QA 2W7PA 2YKNA 5KG5A 1C1CB 3I5BA 5L1IA 1DTQA 1OS5A 3KHHA 4ZPDA 3QLHB 2BE2B 1C2PA 3N6NA 4H54A 1QE1B 1SUQA 3DLEA 3V6JA 4O44B 5J2MA 1LW2A 4KHRA 4ECQA 4J9SA 4I2QA 4Q0BA 2OPSB 4ZVGA 4IG3B 4JV2A 5KFGA 3IS9B 5F8LA 1S48A 4Y2CA 1HNIB 3TAMB 1TL3B 1VRTA 5HP1B 5DQHA 5C42A 4F4ZA 1JLFB 3KLGA 4MFBB 1S49A 4G1QB 1HYSA 2ILZA 4DL6A 2V9WA 4K4TA 1IKWB 5KG6A 1T3NA 2BRKA 1JLFA 3LP0A 4RW6A 3KLGB 1S0NA 3FRZA 4NYZA 3CJ4A 1RT7B 3NAIA 4ZVEA 5KFLA 3PZPA 4RNMA 2I1RA 1C0UB 5J2QA 2IAJB 1ZTTA 4PWDA 3NMAA 3NBPB 2DPJA 1JLGB 1IKYA 1U09A 3PW5A 3GIIA 1LWEB 2IBKA 2VG5B 3DRSA 3DLKA 5HROB 3QGGA 1S1UB 3M8QA 3CJ5A 4PWDB 1T03B 4YR0A 2FVQA 2WHOA 1HMVA 2UVWA 3SFUA 1BQNA 2OPRB 5F8NA 4RUAA 2YNFA 3OSPA 2R8GA 1SV5A 3RB0A 5I42A 3KLIA 4KE5A 1S4FA 3LP2A 4ECSA 4WFXA 3QO9A 4XPCA 3OL8A 1TKZB 5J2PB 3CJ3A 3DLGA 1RA7A 5T14A 4TQRA 4TY8B 1RTJB 2QV6A 1N6QA 5L1LA 2HNYA 2YKMB 5J2PA 3ISND 2I5JB 2D41A 2IM1A 3KHGA 3KHRA 4O3PA 1RTIA 3N6LA 2ASDA 4YR2A 4WFYA 4ECTA 1KLMB 3H40A 3MECB 1FK9B 2HMIB 4X2BA 3V4IB 1TKTB 1LWCB 4KFBA 1NHVA 5KFOA 4H4OA 5DLGA 3T5HA 1S0MA 2HNDA 2W9BA 3C6TA 3IRXA 3KLFB 3MECA 2WONA 1IM4A 4MK9A 2VG6B 4DL3A 4NLQA 4K4VA 2UVVA 4KFBB 2XWYA 3ICLA 4TN2A 1JLQA 5L9XA 3GILA 1JLEB 2FJWA 3IRXB 3KLFA 3JYTB 2WONB 3DI6B 3Q8RB 3H5YA 1GX6A 2JEGA 1TL1A 2RF2A 4JV0A 3GYNA 3LAMA 3HVAA 4LSLB 3M9NB 3JYTA 4FBUA 1S1VA 4URSA 3I0SA 1S1WA 2R8KA 5I42B 4URGA 5HLFB 2B5JB 1MU2B 5KFYA 3OHAA 4RNNA 1VRTB 2AGPA 5C42B 4TYBA 4ID5A 4PUOB 3CO9A 4Q45A 4J9NA 2AWZA 2FVSA 3GV7B 5KT5A 3DRPA 2YKMA 1LW2B 4XPEA 5K14A 4QW8A 3PR4A 2WTFA 4K4XA 3PW0A 3IS9A 4XO0A 4EYIB 3FSIA 2XGPA 5KFXA 1EETA 1FKOB 2FLNA 1S1TB 4ZP6A 3CDWA 3Q8QB 2GC8A 4ZPAA 5KFTA 5L1JA 3OLBA 2ILYA 2BANB 4I2PB 4ICLA 4KV8A 3T1AA 3C6TB 5KFAA 2R8IA 4NLVA 3FDSA 1EP4B 1HPZA 3HVTA 4RW8A 1TQLA 2AGQA 1RYSA 4ZMMA 1S1UA 3M8QB 3V6DB 2FVPA 5KFUA 4IG0A 4F4YA 2BQ3A 2FLLA 3UPFA 3PW4A 4O3QA 3T5JA 1HQEA 2BR0A 3I0RB 4H4MB 3MF5A 4RW8B 2IAJA 1S6QB 1HARA 4JUZA 1RTHA 1DTTA 2ZD1A 3OL7A 3GV8B 4OL8A 4DL2A 1FKPB 3Q8SB 1IKYB 5J2NA 3PJWA 2R2UA 2RKIA 1S1WB 5DQGA 3MEDB 4IFVA 4Q8FA 4QPXA 1DTTB 4NCGA 3G6XA 4LSNB 2JLEA 1N6QB 4O44A 3DDKA 1LW0A 1JLAB 4EBDA 1TVRB 2E9RX 4WZMA 4ID5B 2RKIB 3EPIA 2IJFA 3PJXA 5DG8A 1SH2A 1LWFB 4RNHA 4NCGB 4DL4A 4LQ9A 3H4DA 1K1SA 2YKNB 1TL3A 5HP1A 4ZVHA 3DOLA 3E01A 2FJXA 4O3NA 4IH6A 5EWGA 4QWDA 3GQCA 1DTQB 5KT4A 2RDJA 5F9NA 2WCXA 3I5CA 1JLCA 4KBIA 4MIBA 4ZPCA 3MR2A 4ED3A 3T5KA 3KLHA 1S9EB 3ITHA 5J2MB 5I3UA 1IKVA 1HQUA 3DMJA 5KFRA 4ED7A 2DPIA 2C2DA 4ED8A 5KFFA 4KHMA 3HVWA 4O4RA 4YQWA 2W9AA 3LANA 1RT1A 5I3UB 3MTKA 3DMJB 3H98A 4ECYA 3V4IA 4FBTA 5J2QB 5KG3A 4MH8A 5DG9A 4B3OB 5KFIA 4F4XA 2BQRA 2J6SA 3DM2A 2IM0A 2C2RA 5FDLA 1RTDB 4YP3A 3LP0B 3DLKB 3FQKA 4M95A 1RT2B 5C24A 2B5JA 4RNOA 2J6UA 2WK4A 1JLEA 3KOAA 1VRUA 4Y3CA 5KT2A 3BGRA 2IA6A 2EC0A 4QWBA 4LQ3A 3G6YA 4TYAA 5DQIA 2XGQA 2AQ4A 1S9GA 4WYWA 3DOKB 2ALZA 1C0TA 4QW9A 1JKHB 3CVKA 1S9FA 2BQUA 3I0SB 2W9CA 2ATLA 4TXSA 3DOKA 3DYAA 2D3UA 5HLFA 4IDKA 4TLRA 3IN5A 5HBMB 3KK3A 2YNFB 1RT3A 4IG3A 2HNZA 3MEGA 4YMEA 3BJYA 5CYQA 2D7SA 2IM3A 4K4YA 3ITHB 2WB4A 4NRUA 3PR5B 2CKWA 2YNGB 3IG1B 5KFVA 1R0AB 4IH5A 4EEYA 1RT3B 5KT7A 2JEJA 4ED0A 2HNDB 1UWBB 1RYRA 4ECUA 3QGHA 2VG6A 5KFEA 3H5SA 2R2SA 4ECZA 4RW4A 3C6UA 3M8PB 4KV8B 2CJQA 3EZUA 4MIAA 4QWEA 1KHVA 1EP4A 1HPZB 1CSJA 1QAJA 1XR6A 4IFVB 2VA2A 3KJVA 2GIRA 3DRRA 2W9BB 3OSNA 2XCAA 4NLYA 4ED6A 4J9PA 2ASLA 4RW9A 2YNIA 3IGVA 4URQU 2R8JA 1REVA 5J1EA 2FJVA 3CJ2A 1S9GB 3H4BA 4IFYB 2ZE2A 4TY9A 1T03A 2IC3A 1QE1A 3Q8PB 4HKQA 3H5XA 5DG7A 4RZRA 3MFHA 4KAIA 5J2NB 3DI6A 4KKOB 3GV5B 1D1UA 2OPSA 1REVB 5J1EB 4NLGA 3UR0A 3BSCA 3KLHB 4ZP8A 1JLAA 1LW0B 4IOBA 4NLPA 4IRKA 4RUCA 3KK3B 3VQSA 1MMLA 4ZHRB 5JUMA 4WXWA 3SFGA 4ED2A 5KFNA 5KT3A 1SUQB 3DLEB 2V4QA 4ECWA 1RT1B 1S1TA 1YVFA 5KFPA 3PHEA 1R0AA 2R8HA 2BANA 4I2PA 4ICLB 4PUOA 1RTIB 2HAIA 3BR9A 3JSMA 1S9EA 3DRPB 1XR5A 1S0OA 5EWEA 3BSAA 3NGDA 4Y2AA 3MR5A 3G6VA 3FFIB 2E9TA 3V6DA 4H4OB 4J9MA 1QAIA 2UUTA 5C5JA 4EO6A 3QIPA 4TQSA 4KSEB 1N56A 4O4GB 3IGNA 1W25A 2IM2A 1IKWA 3I5AA 3RAXA 1RT5A 3QGIA 4EBCA 4Q43A 3DRRB 1RT7A 2C2EA 1FKPA 4WE1A 2OPRA 3KLEA 2HWHA 4RW9B 4R5PB 4PQUA 1SH3A 5KT6A 4RU9A 2W8KA 5D3GA 3LP2B 1S97A 3CIZA 4J9KA 1TKXB 4IH7A 1JX4A 1HNVB 1TKZA 5KFSA 2FVRA 3D5MA 5KFCA 3EPGA 3QYYA 4IQXA 4IR1A 1C0TB 4DG1B 4R8UA 2AU0A 4RW7B 1T05A 4GC7A 1KHWA 4I2QB 4FS1A 3MEDA 4J9OA 1RDRA 4IDKB 4MK8A 4ZP9A 5KG0A 3M9OB 2UVUA 4NLUA 2HMIA 4RW7A 1T05B 3HHKA 1RT6A 5JXSA 5HBMA 3BQ2A 4O3OA 3BSOA 1QUVA 4YR3A 1N48A 1S10A 5EDWA 2IJNA 5DGBA 3QZ7A 1EETB 1FKOA 3V81B 2HNYB 3BQ0A 5KFQA 1K1QA 4MK7A 4I7FB 3KK1A 3CDEA 4MKBA 5KFJA 3OLAA 1JIHA 4FS2A 4J9RA 4ECVA 2FLPA 4KO0A 2YNIB 2UUWA 3TVKA 3LP1B 3SI8A 5KFBA 1I6JA 2IC3B 1S6PB 4Q8EA 1JLBA 5CYMA 4KKOA 4ZVFA 3BQ1A 3NKYA 4O3SA 3LP1A 2BE2A 2BRLA 1RA6A 2UVRA 5F8IA 3N6MA 1JLBB 5CYMB 1BQNB 5FDLB 2AX1A 1TL1B 2RF2B 4IKAA 3KK2B 2XC9A 1RT4A 3BSNA 4ED1A 2ZKUA 3MR6A 3BREA 2AX0A 1IKXB 4NLTA 1T94A 5CYQB 3ISNC 3E51A 3FQLA 2B43A 2YNGA 3IG1A 2J6TA 3DYAB 1UWBA 1KLMA 4WFZA 1FK9A 5KG7A 1C0UA 2WRMA 3V6KA 3KHLA 1JXLA 1Z4UA 4KB7A 3PW7A 3JSMB 4WE1B 3KLEB 2HWIA 2YNHB 2JC1A 5D3GB 3KJVB 3MEEA 2JEIA 4ZPBA 4O4GA 4ECXA 4F4WA 1RTDA 3HVTB 1GX5A 1SV5B 3PW2A 4NLRA 3KLIB 2R2RA 5KFHA 3C6UB 2ZE2B 4IFYA 3M8PA 4LSNA 4LSLA 3KMQA 4DG1A 4R8UB 1JLGA 5L1KA 5KG4A 3KLVA 1C1CA 4F50A 5DLFA 3PVXA 5KFKA 3I0RA 2JEFA 5HROA 3DLGB 2VG7A 3QLHA 4HYKA 3M9MB 5KFWA 2C28A 1TP7A 1HNVA 2JC0A 4QWCA 4K4UA 1N5YA 1S1XB 2O5DA 1RAJA 3RB3A 3V6HA 4Q44A 4ZHRA 3UQSA 5EWFA 2W8LA 4EYHB 2B6AA 3GIMA 1C1BB 2OPPA 1JLCB 1J5OA 2VA3A 3V81A 3OL9A 4K4ZA 1TVRA 1TKTA 3RBDA 1LWCA 4MFBA 5KFDA 3MFIA 3TQ1A 4RNFA 1LWFA 4G3IA 2V4RA 5F8JA 3DOLB 3E01B 2RDIA 2IMWP 1ZTWA 2E9ZA 3KNAA 3FFIA 4K50A 3H5UA 5F8GA 4DL7A 1DLOA 4QWAA 3TAMA 1NHUA 2WOMB 5KFZA 1TV6A 1WNEA 4WYLA 3GIKA 2OH2A 4Y34A 5C24B 4IG0B 1DLOB 3MR3A 5DGAA 4NZ0A 4G1QA 1HYSB 5F9LA 3BGRB 1TV6B 2D3ZA 4H4MA 2V0NA 4K4SA 4R0EA 3RBEA 4B3OA 1JLQB 1MU2A 1S6PA 1HMVB 2OPQA 1D0EA 4EO8A 4U6PA 3QZ8A 2C22A 3OHBA 3QIDA 3OL6A 2XCPA 2XI2A 4MKAA 3NAHA 3LAKA 3NL0A 2FVCA 3LALA 3QO9B 3D28A 2R2TA 1N5YB 5KG2A 1S1XA 4WXOA 3T5LA 4R5PA 4PQUB 2F8EX 2VG5A 3MEGB 2HNZB 3DRSB 4NRTA 5EUHA 1C1BA 1RT4B 2OPPB 1RTJA 1J5OB 1TKXA 4NLDA 2GIQA 5KG1A 5C25B 1N4LA 1JKHA 4JV1A 4M94A 4J9LA 2I5JA 1IKXA 4Q0BB 3H2LA 4ZP7A 4IRCA 2W9CB 4WZQA 3HKWA 1HNIA 5C25A 3G86A 1IKVB 1HQUB 5K14B 4NLSA 4NLOA 4GC6A 1ZETA 5F8MA 4DL5A 3MEEB 4TY8A 4EBEA 4U7CA 1NNDA 2W7OA 1HQEB 2WOMA 2ASJA 3RB4A 4KO0B 3H59A 1RT6B 3T19A 5F8HA 4IR9A 4NLXA 4RW6B 1S6QA 1RTHB 2ZD1B 3UDLA 1XR7A 4K4WA 3QIPB 4ECRA 3GIJA 1SH0A 3DM2B 2QE5A 2YNHA 4I7FA 1BQMB 1RT5B 3KK1B 3CJ0A 3CWJA 4RW4B 2VG7B 1RT2A 3RB6A 5KFMA 4NLWA 2XI3A 3RAQA 4IRDA 3NBPA 2OPQB 4DEZA 1VRUB 2AGOA 1S1VB 1LWEA 1BQMA 4O3RA 3CDUA 2B6AB 3KK2A
chains in the Genus database with same CATH superfamily
1RGVA 3KMSA 5CCMA 4GVLA 1FI4A 2AJ1A 2B8QA 3I5BA 4RWXA 3FBEA 1FFWB 3MTJA 3ULHA 2E7XA 4CO4A 5GADI 2E1CA 4P2SA 1LW2A 2DGSA 2NQPA 2ZC4A 1MLAA 3CO0P 3TJ8A 4Q0BA 2RUSA 3KNGA 5KFGA 3IS9B 4WFAQ 2HHWA 1S48A 2KZZA 1TL3B 5DQHA 3KLGA 1BE4A 3MOZA 3NWGA 1VC0A 2RHSB 3A12A 1S6OA 3ZNUA 1QY7A 2Y9HA 1WC4A 1S49A 2IA0A 2ILZA 4DL6A 4ZLNA 2UUAJ 1YJRA 4L72B 3ZNJ1 3D6TB 2BJ7A 1VGYA 3Q89A 4ILMA 2RH3A 1RT7B 2LU2A 4OYIA 3NCRA 2KG0A 2BW2A 3ILLA 1YJ7A 3Q86A 3B8HA 2Z2LA 3LW5C 3ZFVA 1B99A 3KUEA 2JRSA 2IAJB 3C2PA 2GMJA 3MAAB 4ZVQB 1LNQA 3W7BA 2OEKA 1TL7A 2MYFA 1PAUB 1SQGA 1IKYA 2G2YA 2MQ8A 3BKUA 3VGVA 3LH2S 3WC2A 1VRQC 4M5IA 2VUGA 2VG5B 3D9BA 2IBKA 4DSEA 4F67A 4Y2KA 1IUJA 1T03B 1VCTA 4YR0A 4KPCA 3J7A1 1SBRA 2BM0A 2K8GA 2UU9J 5A8RB 3PW5A 3AJDA 2DXEA 4RUAA 2R8GA 1SV5A 1HI0P 5I42A 3KLIA 1V3SA 3O44A 4ECSA 1VQ8S 2G0JA 4WFXA 1BXNA 3ZC4A 4F26A 3BYRA 3KYLA 2XSFA 1XC9A 5T14A 3HFKA 2QYGA 3I9ZA 3R1LA 4WCEQ 3IXQA 2PC6A 2YWWA 4LRFA 3ISND 3KHGA 2IM1A 4BCAA 2XMWA 4C8NA 3ILJA 2YKAA 2F8MA 2K3KA 3N6LA 3BN7A 1T9VA 4HACB 1X5TA 3QJJA 5DO2A 3D1HA 2OMOA 1LWCB 1NHVA 1F5BA 2QJ3A 4B9SA 4CCHA 5DLGA 4JI7J 2GVDB 2HNDA 3OR1A 1Q1KA 2GHPA 3BDEA 1A7GE 3TZZA 3MECA 1IM4A 4QIVA 1HBMB 4CM0A 1KVKA 5JMNA 3BM7A 5U47A 1NXIA 4TN2A 2X1BA 2HK3A 3O8WA 5L9XA 3M8ZA 4QIFA 3IRXB 5A2QY 1SL1A 3DI6B 4F0MA 3AODA 2ROGA 3QBCA 3K5OA 3OXGA 2RQMA 4I1TA 1HWIA 5BR8J 2XTJP 2M3DA 3ZZZA 2BE7D 1UVJA 1KTVA 2RRNA 3JYTA 2VF3A 3GSIA 1S1VA 1T95A 1YJVA 4URSA 4U95A 3GCWP 5I42B 1RJJA 5LSLA 1UKUA 3HD2A 3KUGA 2BMBA 4URGA 2QFJA 4RKUC 3UN5A 1MU2B 4WF9Q 2OMLA 1QTNB 1WI6A 2DB1A 4TYBA 5B0BA 4OJ3A 2QLWA 4ID5A 3MWBA 5AXKA 1TMJA 4GMKA 4A8KA 4QU6A 4PUOB 4KR0B 4DV4F 4J9NA 2AF6A 2GMLA 2DHHA 1KWMA 4XPEA 5K14A 2YBVA 3I96A 3N5FA 4C8KA 1RWVB 3JQKA 3EICA 3MPYA 3M6XA 5E0OA 3O5TB 3FSIA 3CCES 2EFNA 1YRXA 1X5SA 1S1TB 2DJWA 3G87A 3M2UA 4L74A 4ZP6A 3K5NA 3CCUS 1JMTA 2I0XA 3OLBA 4NXNJ 2ILYA 1O6XA 1PKUA 1XEZA 5HJYA 5HVFA 1U2FA 4DSLA 3NG8A 4NLVA 3M32A 3NGRA 3W2WB 2AZ3A 5HI7A 4YOEA 2AGQA 1S1UA 3M8QB 3V6DB 2KVQE 1M5KC 2BQ3A 2Z30B 2HHPA 4KGZB 4WIQA 2ZZNA 2W4DA 3PW4A 4ID8A 1SKRA 3MF5A 4RW8B 1YRUA 3MD1A 1I94J 3OL7A 1RISA 2NYHA 4QCLA 4CLWA 2JL9A 3L9ZA 3PJWA 2R2UA 2CZ4A 1ZM9A 2CVIA 2HFSA 3QAEA 4JI2F 3MEDB 5DQGA 4TU8A 4IFVA 3UD3P 4Q8FA 3G9CA 4QPXA 3OJUA 1DTTB 2JLEA 1N6QB 4O44A 3DDKA 1LW0A 4OI1A 2E5LF 4ID5B 2RKIB 3UO0A 2IJFA 1NSKL 3LPYA 3VVTA 5DG8A 2KYZA 1YSJA 4C6AA 4CQ1A 5D78A 4RNHA 4DL4A 4NCGB 1RWMB 2X7IA 1PYTA 3OFFA 4JP8A 1K1SA 2YKNB 3V6JA 4UY8T 3EGVA 3W5ZA 5AXNA 2R7TA 2GJFA 3QQCD 3GQCA 1B4SA 4ZCKA 2RIJA 1EKRA 3T5KA 4KBIA 8ATCB 4KY3A 2OELA 3T1HF 1S9EB 1Q7LB 5J2MB 2AD9A 3L7OA 1N33F 3DMJA 2ACYA 1VLYA 2DD8S 4ZVUB 1RHQB 1U25A 3DGVA 4NASA 5J1PA 3QNWB 3HVWA 3N0VA 2W9AA 4HHJA 3LANA 1RT1A 5I3UB 2ZHOA 2MEWA 5J2QB 1RBAA 1E6YA 2XNQA 1APSA 3GJTB 2J6SA 4OZ3A 4F2RA 5FDLA 2CXEA 4B17A 4ZJQA 2NXJA 3GTYX 3VHQA 4LR7A 4RPFA 2MSSA 1T9XA 2WK4A 2M5YA 1HBUA 2DHXA 2WVBA 5KT2A 1IJFB 2EC0A 3BDPA 1S9GA 1YWXA 3DOKB 3BGLA 3I32A 3DXBA 4LFCJ 4QW9A 1VMBA 1JKHB 1DJ0A 2LMIA 2CQ1A 1R3NA 4L3KA 2KFYA 4AL7A 1S9FA 5CZVA 4RUBA 2BQUA 1KLNA 2HHHJ 4TXSA 2VB6A 3DYAA 5HLFA 4DPXA 4PG6A 2NLWA 4HH0A 3QT5A 4IG3A 4OX9F 2BJ9A 3ETMA 4CT9A 3AXKA 1QM9A 2KO1A 4PXCA 4Y2MA 3SQGA 3PR5B 2QSFA 4NRUA 2VU5A 1WACA 4EEYA 1R0AB 4IH5A 2DBBA 2JEJA 2KXNB 2NUUG 1UVIA 5LMUJ 1GTEA 1G1XA 2LEBA 4OHVA 4ECUA 3MMJA 2I2YA 2MZJA 3VAHA 2R2SA 1FESA 4RW4A 4X66J 2B0GA 3CMQA 3R1HA 3JB9k 3SCKE 3J7AN 2BZ2A 5D4PA 2YWKA 2Z2MA 5B0GA 1QAJA 3EZ5A 2VA2A 1RKIA 2ZUGA 2HBQB 4TU9A 1FJEB 4YY3J 3OTEA 1WC6A 4RW9A 2YNIA 4URQU 1HD1A 1REVA 5J1EA 1S9GB 3H4BA 4IFYB 1U0HB 4XDCA 2ADCA 1QE1A 3H5XA 4YS2A 4RZRA 2VBWA 2X1FA 2YTCA 4C8YA 1D1UA 4B9UA 2F1FA 5LSOA 2E5LJ 4NLGA 5D8HB 3UFCX 3KLHB 2HHTA 2FZKB 1XNRJ 1U48A 3OUYB 1S7HA 3CTRA 5EN1A 3VQSA 4N56A 3VWSA 2CYYA 4JV5F 2OI2A 1U45A 2VQEF 4PR6A 2AYGA 3D3CJ 2QG9B 5J1NA 1RE1B 2ZJQQ 1RBOB 4DV3J 5A0YB 3DDIA 3BKFA 3PHEA 5HO4A 1VBYA 1R0AA 2ZDPA 2EFQA 2BANA 1SC6A 3FBFA 1BUXA 3A8EA 2R4FA 2M2BA 2PDAA 4UY85 2FC8A 2H3EB 1S0OA 5EWEA 4ZIVA 3G6VA 3JQMA 3D68A 3MR5A 3FFIB 1RP5A 2IFXA 2ZWOA 3FGVA 3H25A 4H4OB 1X0FA 2V2ZA 1QD1A 4J91A 4USMA 4EO6A 1RU2A 3FBBA 3IGNA 2IM2A 1VFJA 2NS1B 3QGPA 2QO3A 3RAXA 2HFZA 2J8SA 4B3SJ 3QGIA 4EBCA 3CCJS 4Q43A 2ZBPA 1RT7A 3AOAA 1NMEB 1RAGB 1XTZA 4WE1A 2B51A 2FHKA 3LWLA 3UCUP 4RW9B 4N41A 4PQUA 1QSSA 5CA5A 2GZOA 2Y8WA 4RU9A 3LP2B 4IQMA 1HLWA 2JFDA 1M1HA 2ZZTA 1TKXB 1IR2A 1JX4A 4NCBA 1T9TA 2LCWA 3HO1A 2D9PA 1TKZA 3BKTA 2AJ0A 2FVRA 2DO0A 5L46A 4I67A 2HFVA 4ZN1A 3MM7B 4DG1B 2HEKA 2P6SA 4HI2A 4P2MA 3SSQA 5A8RA 4C3LA 4EK2A 1KHWA 4LF7F 4HTIA 3SCLE 4DCJB 5HSPA 4MK8A 4ZP9A 2DRAA 3FCVA 3M9OB 2D74B 4DV7F 3ZTSA 1P1TA 1PJ5A 2K7JA 5JXSA 2HWTA 5A8WB 2GCFA 3MMBA 4YR3A 2HVEA 3VAFA 1I94F 1EQ0A 4OZJA 5DGBA 2CAJA 1NAQA 1EETB 3TW0A 4DUYJ 2Y8YA 1ZM3A 2E29A 2OHDA 4NZ7A 5CHCB 3THPA 3BQ0A 2VQEJ 4AQYJ 3NGSA 1XN9A 1UVNA 3CDEA 1VJQA 5KFJA 4ITSA 4J9RA 1PAEX 1OYEA 1A6LA 1JK9B 2VPWB 3GFZA 1WORA 2UV8G 4J5OA 4WFNQ 3Q23A 5BYRA 1DAXA 2W2NP 3GFHA 3KG4A 1Q16B 3TVKA 3FK4A 4C0HA 5K20B 4J7CA 1FD8A 3QWUA 3M7VA 1S6PB 3UD5A 2GIFA 4RBTA 2XS7A 3OR2B 4KKOA 2NXCA 1N5QA 3W5XA 1N0VC 1NDLA 2BM1A 5AJ3J 1RA6A 2UVRA 4WKRA 1TKDA 1B64A 2MZSA 1NK5A 2WBRA 3M2VB 1AT1B 4DU7A 2AX1A 2L41A 3AJ1A 2X3DA 2WAQD 3GCXP 3HKZD 1X5PA 4HVZA 1RT4A 4FYDA 1JNZB 4DV1J 2ZKUA 1KOOA 3MR6A 2DNNA 3M4XA 1X4BA 5ETOA 4CLYA 1IKXB 3ZTRA 1A9NB 3H90A 3CD6S 3OFEA 1XWLA 5CYQB 1UTAA 3ISNC 3E51A 3FQLA 5F0UA 4B3SF 2CJXB 4LF8J 1NK7A 2JOQA 1K9MT 2XS2A 3IG1A 3WZ0A 4B02A 4DV5F 1VIOA 3HLUA 4DSFA 2LQ9A 2J0SD 3LGMA 1S0VA 2C2ZB 3I82A 3MUMP 4WFZA 3P8BB 5HQMA 2EBEA 3KWMA 3MM5B 3PRDA 4NI2B 5K8PA 1ZAXA 5ETLA 4CH0S 5L39A 1FNMA 3PW7A 2WVEA 3K2YA 2HWIA 5M2PA 3GJSB 1GXLA 2IJRA 4OI6A 1CVJA 1WHWA 5D3GB 2W01A 1SPBP 3KJVB 2ZH7A 2JEIA 4OI2A 3CF5Q 2HBRB 1FDDA 3KXDA 4GRSA 4LFCF 1RTDA 1B70B 2B8PA 1GX5A 5D15A 4NLRA 5KFHA 1Q4RA 2ZE2B 1NPRA 2EEYA 4LSLA 3ZO7A 1P8GA 4F50A 2JEFA 4UTGA 5HJXA 1TUGB 4X62F 3PFEA 3IBFB 1TMMA 3GR1A 4ZVRB 3TWZA 4DSJA 5B0EA 2DNRA 3PEJA 3QT8A 2UXCJ 3V6HA 1WF1A 4UOHA 2DR9A 2OPPA 2VA3A 2VV5A 1UETA 3V4MA 2Y0BB 3SCJE 2MY8A 2XYHB 3N4WA 2BDPA 2OJ3A 3TQ1A 4MFBA 2FYXA 2FDNA 2RUGA 2HHUA 1YDLA 2BKPA 4DZDA 4ZJLA 5F8JA 2A2DA 3KKFA 5CABA 1ZTWA 2K06A 2RU9A 2V8VA 3BF4A 2E9ZA 3KNAA 4K50A 4ZDNA 2AJFE 2KN4A 1NHUA 5ETNA 3SEOA 3T9NA 3ZXWA 2NYIA 3M8RA 2JH3A 4V1Ak 2MDAA 2RS2A 1RAHB 5HQ8A 2DR6A 3GIKA 1V3ZA 4AXIA 1QSLA 5C24B 1DLOB 2FZGB 4NZ0A 3C3LA 1WEXA 3C16A 4G1QA 3BGRB 1TV6B 1SIWB 4H4MA 1HBMA 4KH1B 4PYAA 3RAMA 3JAMU 5BYQA 3CD7A 3RBEA 1U6FA 1HMVB 2OPQA 3EVOA 4P71A 3UNYA 4U6PA 2C22A 2FJBB 2HFUA 2XCPA 3V5RA 4FYXB 4MKAA 1WC1A 3LAKA 3NL0A 1YGYA 3EDRB 3LALA 3QO9B 4BWJA 3E8OA 3TVYA 1RU1A 2B4VA 4WXOA 2XNRA 1YQHA 3DRSB 3MEGB 4NRTA 2AJQA 5DDOC 4NPOA 2OPPB 8AT1B 4JI3J 1HNWF 3A3PB 1R8PA 2GIQA 4M5GA 5KG1A 1JKHA 1FXDA 1X0PA 4IOAQ 4A46A 2A10A 1VBKA 2QSWA 5HVHA 1UVKA 3RR7A 1RKJA 2R7XA 5FJ4A 5C25A 4AYBD 2A1BA 1HQUB 5K14B 1UCNA 4GC6A 1ZETA 5F8MA 3G6ES 1HNZJ 2CNKB 3CEDA 1HBOA 1RCOB 1FNXH 3MEEB 1FEEA 3GLJA 4E8UA 2ZH9A 2NZ4A 3T41A 1HQEB 4Q2LA 2ASJA 3RB4A 4KO0B 3BH6B 3HMJG 3T19A 5F8HA 4UZBA 1D8ZA 4RW6B 4NLXA 4EGLA 4DV4J 1UA0A 3IR7B 1FJGJ 3D2WA 3M30A 3QIPB 5F3ZA 1VHIA 3DM2B 1FE4A 1KP6A 3FMBA 2YNHA 3LA0A 3MR7A 1QDUB 5LM7E 3TARA 1RT5B 1HWLA 2ZNYA 4X65F 4RW4B 3W8PA 4KGKA 1FRIA 2HQ3A 1GXTA 2XI3A 4WJBA 1HD0A 3NBPA 4DI6A 4IRDA 4NE9C 1F2HA 2OPQB 1WJ9A 4ZLLA 1H98A 2A18A 4ES1A 1WKKA 4F2SA 1LWEA 1CS4B 4OJGA 2W4PA 2L08A 3I31A 4ZCMA 3MOJB 2Z56B 2KVIA 3NS5A 2W7PA 2BE9B 3DGPB 2FJDB 4USVA 3CE8A 1C1CB 2AYEA 5L1IA 1OS5A 2PEHA 2QX0A 1OY6A 2BE2B 2LP4A 4NWBA 3N6NA 4ZPDA 4H54A 1QE1B 2MXYA 1N36F 4O44B 2BYCA 3SSSA 3VV2B 1U7LA 4ECQA 3N9UC 3KUHA 4J9SA 3TZXA 4DV3F 2OFHX 2M52A 2XMJA 3RW7A 2SXLA 5F8LA 4CO0A 3EX7B 4B3RJ 2QL5B 1V5VA 2KT5A 4KYZA 3MCNA 1F1BB 1VRTA 2OAUA 4J9UE 5C42A 3CT9A 4KGVB 5AXMA 4ZLPA 4BBYA 1F5AA 2ZUAA 3JTPA 4OYAA 4JI6F 1VBXA 5IOLA 3A3NB 3GPAA 1JJ4A 4DR4J 2UV8A 1YTYA 2KFNA 4FPIA 1EKSA 1HYSA 4OIXA 1BMQB 2ZFHA 5D77A 5HQLA 2CNOB 1IKWB 3C66A 3OVAA 1M5PC 4LF9J 1JLFA 2GX8A 4RW6A 1Q8LA 1WKLA 2H48B 3ZTPA 1S0NA 1VQ9S 3FRZA 4I6YA 1AFIA 3NAIA 5HMXA 2M8DB 2I1RA 1C0UB 1RWKB 1CJVA 3SMZA 5J2QA 1RACB 1TK8A 3NMAA 3NBPB 2F7VA 2H65B 2R7SA 1GMWD 1RLCL 3D0HE 5E33A 2XMKA 2O3DA 2J7WA 1ZOTA 1LWEB 3GIIA 2DNHA 5HROB 3QGGA 3CD5A 1Q78A 2MLZA 4B9NA 3CJ5A 4F3QA 2IY5B 1SVDA 3AD7C 1BQNA 1F3VA 3PYGA 2ZH6A 1R6VA 1XIQA 2YNFA 5CCLA 3RB0A 3CCWA 3MM8B 3NY0A 3LP2A 3NXZA 2VFVA 4KE5A 3WX8A 4N5SA 2F3JA 1AA1B 2R7WA 3J7Z5 4L76A 3LGNA 1TKZB 4DV0F 2YQ0A 1O5JA 4JI0J 1UJ5A 3DLGA 4TQRA 3L3CA 1M1KT 2VPYB 4TY8B 2QV6A 2A3JA 3M05A 3H2VE 3PIPQ 1H2UX 1QTMA 1HNWJ 1WUUA 2BJ1A 5K8OA 3KHRA 1OPIA 2AP6A 2YH0A 5I4MA 1IR0A 4USTA 2ASDA 2MSTA 4ECTA 2Q43A 3MECB 1TL4A 1WEZA 1KEKA 4X64J 3TAQA 1I51B 1UPPA 3V4IB 2AKWB 1X4EA 3TJ9A 2D69A 4DN0A 4Y6IA 3C46A 4DQPA 4KGMA 3T5HA 2G0IA 2IMOA 3UDVA 2R9LA 3EZOA 5M2RA 3C6TA 3IRXA 2VONA 4MK9A 1X9SA 3KDOA 4Y2IA 3JTOA 1VQLS 3G2XA 4NLQA 4NOHA 3TYTA 3M1VB 2E5JA 2G2OA 3TP2A 4BC9A 4DR4F 3ICLA 2EKNA 4OYWA 1RWXB 2RVJA 2FJWA 3LOUA 4ENOA 3GILA 3KLFA 3JYTB 3C15A 3TNVA 1VQ7S 2YPYA 4GKKJ 4OJ1A 4LR8A 4W90B 3DU6A 1ROFA 1UVMA 2KYXA 2W2PP 1CC7A 3IM8A 3GYNA 4OYBA 4WP9A 4JV0A 1XBWA 2BACA 4U8VA 1YBTA 1IM6A 4WBFA 2RD5C 3N5BA 1H7WA 2FUG9 1YZ6A 4USKA 4RNNA 6FDRA 2AGPA 3HFVA 3T1HJ 1FVQA 2FHMA 1VBZA 3CJSA 4Q45A 1NCLA 2IRUA 4ER8A 1HI1A 3GV7B 3L09A 4OZ2A 2VOOA 1FRLA 3R5BA 2VQFF 2WTFA 4XDDA 1ZPWX 1SJ4P 4XO0A 5IXUA 1UEUA 2APOA 3AOBA 2HQCA 2FGOA 3VZIA 3PFOA 1UA1A 2FLNA 3CDWA 3OVSA 2XMUA 4ZPAA 5KFTA 1VS3A 2NXEA 2BANB 1DY3A 4WP8A 3T1AA 1RWNB 2ZEJA 3PDNA 3VGSA 1WG4A 1S4EA 3LPEA 3C6TB 1RLDA 3UE2A 2R8IA 1VQNS 2VH7A 2ATCB 3FDSA 1HPZA 1ZH5A 4K0KJ 3HVTA 4RW8A 1KTQA 4L75A 5D0HA 1RYSA 3GIRA 2FVPA 5KFUA 3QJPA 3CXCR 1S6UA 2EFPA 5IZHA 1CJTA 4F4YA 3K17A 2J9CA 5DJBA 4DLEA 3T3FA 2FLLA 4O3QA 1UEVA 2BR0A 3G8QA 1FRHA 2ZH3A 2FC9A 1S6QB 2V4JB 2CRLA 1DTTA 5LXRA 4DL2A 2MQMA 4E0DA 3Q8SB 1Y9OA 4WU3A 5J2NA 2XHCA 2XULA 3ETOA 3MM9B 4NA3A 2RKIA 1IBKJ 3S6EA 4OX6A 1YK9A 1OIAA 4PKDB 1AROP 2CA9A 3AB4B 4NCGA 4EBDA 2M0GB 2QA2A 3ILIA 3VQTA 2E9RX 4CNZA 5F41A 4P7TA 1JJ2R 3IWLA 1OJ4A 1X8DA 4LRCA 2OLWA 1V6HA 1WDDA 4L73A 3HHDA 1LWFB 2Z8QA 4RU2A 2P9GA 4LQ9A 2F4VF 2XY7A 5HP1A 3DOLA 2FJXA 3NCQA 2XMAA 2KU7A 4TVAB 4QWDA 2RDJA 1JJCB 5E3RA 1HHQA 2OEJA 3GYGA 4MIBA 3L7UA 3QT6A 2LXIA 4USWA 5D0EA 4C11A 2DPIA 5I3UA 1IKVA 2GHWA 1L3TA 1HWUA 1UZDA 3MMBB 2C2DA 2LA6A 2DGQA 4ED8A 5KFFA 2DVIA 2C1EB 1RK8A 3IFEA 4L3NA 3TA0A 5D4NA 1NB7A 2UUCF 3AHPA 2G2ZA 1NZ8A 2CPZA 1WC0A 2HBYB 1VR6A 2LQBA 2PA3A 3GJRB 4I64A 5KG3A 4MH8A 1N5SA 4PXDA 1RCXB 4B3OB 5DZ7A 2DO4A 4ZIWA 4F4XA 1FWKA 4GVBA 1U1LA 2MGZA 4GKJF 1PIEA 3DLKB 1J27A 4M95A 2DCUB 1NEEA 3DCAA 5C24A 4RNOA 2KM8B 4CLUA 3K57A 4DS4A 1JLEA 4PPZA 2LU1A 1VRUA 2J7UA 2YX1A 3BGRA 3CW2C 3MM9A 4OZLA 4Y28C 4QWBA 3P3DA 4TYAA 3G6YA 2XGQA 2AQ4A 2CPHA 4FZVA 2HQGA 2VFTA 3TUPA 5JJBA 4DMZA 1ZM4A 2E5IA 1Y7PA 5LJ5Y 2HHXA 5K5MA 1RSCA 2XEXA 1K73T 4ED4A 3I0SB 2Q3PA 2VL1A 3GG0A 3MMCA 4X4TA 3TAPA 2F5GA 1LV5A 3NNCA 1MSWD 1IBKF 1R8BA 2XY6A 4FYWB 4B3MF 3KJQB 2RDDA 2ROEA 2C42A 3KK3A 4YMEA 3MEGA 1FE0A 1YBAA 5K8NA 1EIYB 1Y3JA 5CYQA 3DLHA 2LVWA 2Y1LB 1WHVA 3WIVA 3HHNB 3EGNA 3IG1B 1NK6A 1NK9A 2XZWA 1IQTA 2QA1A 5KT7A 4DFMA 4ED0A 5CXTA 5LMNF 3PTWA 2CPYA 3A8KA 3GJQB 3NEKA 3TA1A 3QGHA 4LREA 4FVMA 1WG5A 3FJ2A 2VG6A 1KQSR 2MJUA 5KFEA 3IM9A 4ECZA 1RBLA 4E2FB 2R7QA 3C6UA 3IBWA 4KV8B 4PEOA 1G3OA 1S12A 1UJ6A 3W2VA 4KHPJ 1KDNA 2H4WB 1KHVA 1EP4A 1W2BR 2F8HA 1MN9A 1CSJA 3HVRA 1XR6A 4IFVB 5LJ3Y 1EJ7L 3KJVA 2DNQA 2V8GA 3DRRA 3OR1B 3CCRS 1IXKA 2E5HA 1AB8A 1B0VA 2BKNA 2C3OA 2XCAA 1URNA 3NMRA 2VJVA 3CJ2A 2UXBJ 3IAM9 1WC3A 3T9ZA 2ZE2A 3UDCA 1OQ6A 1ACMB 5DG7A 5GAGI 3MFHA 4V19X 3DI6A 1W2IA 4P9SA 2OIHA 1NH8A 2JVRA 1AXQA 2NUHA 2OD4A 2V6AA 2C2OB 2UZAA 1TZ0A 2H9ZA 4L6V3 3CJKA 3J81j 1FDAA 3BSCA 2ADBA 1FX4A 4FKXA 5GVQA 4ANEA 2AV5A 1JLAA 4IOBA 1FX2A 1O51A 1X60A 4RUCA 3KK3B 1T3OA 5JUMA 2FJEB 1QLNA 1HHSA 1N0UA 1RI7A 3F56A 2DRBA 5KT3A 2V4QA 1RT1B 5C2GA 3SV3A 1IQZA 4PG8A 2OUGA 1H72C 2ZNZA 3OXLA 4HH1A 1E6YB 4I2PA 4ICLB 4PUOA 3RGIA 1RTIB 4DZ6A 2XG8A 1VC5A 3BR9A 4KC5A 3JSMA 1SKSA 1FD2A 3TZYA 2H1YA 1XMQJ 3H42A 4Y2AA 2BEFA 4J9MA 4LBPA 3I4PA 3BPSP 4OV1A 2R3VA 2AEFA 2NXUA 3CCQS 2Y1JA 1UVLA 4O4GB 5IM0B 3M2UB 1KS2A 1UAWA 1IKWA 3MDFA 2FHOB 4PWUA 3WQPA 1N8RT 4I69A 4X4OA 2ROPA 1M5SA 2N4DA 3DRRB 1R31A 5I3PA 3VAKA 4A8QA 2C2EA 1FKPA 1F60B 2OPRA 4UOFA 1ICEB 2HWHA 4R5PB 1FTCA 4B3RF 3FUYA 5KT6A 1N34F 1S57A 2G1HA 2JWNA 3Q8YA 3R7BB 1BLUA 4IH7A 5G0RB 1U47A 3GSDA 3CDBA 5B0AA 3R5JB 5IT4A 1FJCA 4DF4A 1PC5A 4LBIA 2NR0A 5KFCA 1GFWB 4OHWA 4AL6A 3KDNA 3VAMA 5B7WA 1C0TB 4R8UA 4GKJJ 4GC7A 2W2OP 1U1NA 1CPZA 3PRVA 4MKVA 5L9NA 1VQ4S 3MEDA 4CYUB 3SZ2A 2VC0A 2VZ9A 4IDKB 5KG0A 3MEKA 3K7RA 2UVUA 4HL9A 4NLUA 4C8LA 2HMIA 2LQ5A 4RW7A 2WSCC 3OT9A 3HHKA 1RT6A 3BQ2A 5HBMA 1F6TA 2P8IA 1S10A 3ENQA 2IJNA 2U1AA 2QL7B 3FZ2A 4CLTA 2IVYA 4EU0A 5EDWA 2HS3A 2PT0A 2A6OA 1FKOA 1FRKA 1MN7A 4B9TA 1K1QA 4MK7A 4I7FB 3KK1A 4I6AA 4J9VA 5DDQC 1O8BA 1NBEB 2DITA 4MKBA 4WTOB 3KG1A 4DR6F 4ECVA 2CJ9A 5IM0A 2DR7A 2ZVSA 4KO0A 2YNIB 3BEGB 4OX7A 2UUWA 2J7KA 4QR1A 4PQAA 3R97A 4CRJA 4F04B 1HNXJ 1SJ3P 1MG7A 5SZTA 2J8AA 4JI8J 3GR0A 4Q8EA 1U02A 2RRAA 5G4DA 4ZVFA 3P45B 8RUCA 5DDPC 1NDCA 3M1VA 3P5TL 1AYEA 2BRLA 4LRDA 4O0NA 5A6WA 2JDJA 5F8IA 3RR8A 5CYMB 4LF5F 1U8WA 5FDLB 2KXFA 1MMDA 1J5EJ 3EYZA 1N32J 1R8CA 2ZOMA 2Z4PA 2IIHA 2XC9A 4OQJA 4ED1A 1JQGA 3UR3C 3BREA 2RNEA 5A0YA 4F36A 1FERA 1VQYA 4DR3F 1TFYA 7FD1A 4PG4A 1T94A 3HD1A 1NDPA 3QPIA 1NJXA 2EPIA 1KVJA 2ZH8A 2JZ5A 2LECA 1SB6A 2E1RA 3Q83A 3QSIA 1AZSA 1Q0NA 3ET6A 1PG5B 3TA2A 4DR2F 1H73A 2YNGA 1LK5A 4ZPVR 1F2GA 1NKEA 2WVFA 3GFXA 3DYAB 1UWBA 3PRBA 4ES3A 3EGZA 1R27B 4DL0C 5KG7A 2WRMA 3VCDA 1L3UA 4NXMF 2VD3A 1NJZA 3MUTP 3PX4A 1Z4UA 3MPWA 4NEYA 2CPEA 1EAYC 2W7AA 3CCLS 4X65J 4WE1B 1OSCA 2PN6A 3K8WA 2F9DA 2QLFB 3FSYA 3E2EA 1I5OB 1REGX 4G6VB 1GMVA 2RILA 1X7VA 3MPUB 3OFGA 4FKYA 4ILRA 3UCGA 3M8SA 5DS7A 3A8JA 2CPJA 3HVTB 5FLXU 3U27A 3PW2A 3DRXA 3JTNA 2R2RA 2KRRA 4DR7F 1RWPB 3GP9A 2V8HA 1CJTB 4LSNA 3KMQA 4DG1A 5L1KA 2HIYA 2XO6A 5DLFA 2KRBA 4GO5X 1R8HA 5HROA 4DPWA 1SKUB 3G82A 2MHEA 1TP7A 4C4WA 1HNVA 2JC0A 2GVZA 1U0SA 2AIRB 1HI8A 2ZBCA 2IVFB 2KH9A 4WTYA 3ZZRA 2C3PA 1YRTA 2FB0A 5KOXA 1H6KX 5EWFA 1HNXF 1J5OA 1JLCB 4PXBA 2HVIA 2HW3A 2DH7A 3A8IA 3OL9A 2DT9A 2H5JB 1UWAA 1TUVA 4MYTA 1TKTA 1PBUA 3EXCX 4ZCLA 5M2UA 2NZCA 4P7VA 4RNFA 3VALA 4DFKA 1LWFA 4G3IA 3PXGa 1UFLA 3RRKA 4ES2A 3W60A 2KHCA 3DOLB 2R7VA 2IMWP 3H5UA 4Y65A 5F8GA 4DL7A 1DLOA 3ZZPA 4TLQA 4Q7AA 1SJRA 4AL5A 4QWAA 3TAMA 3PO4A 4FYVB 4JB8B 5KFZA 1TV6A 4A8OA 5BR8F 1B0TA 3FRYA 3I56S 3VTIA 3EJMA 1GNKA 1JXVA 2E5GA 4WYLA 3W9JA 4DJBA 2XM3A 3K5LA 1UFWA 3RBZA 2P6TA 5DGAA 2FQQB 4DFJA 1HWKA 2D3ZA 4NEZA 4OHYA 4K4SA 4F0KA 1XNQF 1KQKA 4DQRA 3E3XA 4B3OA 3RG6A 4DV5J 1ZA2B 1EB0A 2P9EA 4DCPB 3QZ8A 2UUBF 2KL8A 1NRKA 2V69A 4LF8F 1U24A 3QIDA 4QU7A 4FP9A 3UI3A 3P5BP 2XI2A 2ZM6J 3CJQA 3NAHA 3G82B 3P4UB 2BJ8A 1K8AT 4AXJA 4J37A 1FA0A 3UVJB 4CNYA 5MLCV 4B3TF 4NYPA 2OEMA 2IDEA 4ZCIA 3T5LA 4PQUB 2HNZB 1RAIB 2H4YB 3C8YA 3FC9A 1J5OB 3D6FB 4NLDA 4RUHA 2QMXA 2CQ2A 1TKXA 5EHHA 4EZ9A 5C25B 1N4LA 4JI2J 4JV1A 1FWLA 1UFKA 2H54B 2IHR1 3H2LA 4LVOP 4WKYA 1OPZA 5IQ6A 5ETMA 5FIIA 1S99A 2IYGA 2QC3A 6FD1A 1NJIT 1NDKA 3IR6B 5DRKA 2GO8A 4IYQA 3UNGC 2BA9A 3K5MA 1LKZA 3B82A 1HHTP 3VAJA 2DEJA 2DTJA 2GAHC 3HFZB 1VDHA 2FGCA 4TNOA 2XHWA 2XZDB 4Z37A 4U7CA 1NK8A 4QYZJ 3PX0A 3UN2A 4B3TJ 1FO1A 1URRA 5HMZA 3HZEA 1RTHB 2ZD1B 2HPUA 4KT0C 1XR7A 4K4WA 4ECRA 3EDQB 4DSKA 1D3WA 2ALYB 4LF7J 1YITS 1CS4A 2U2FA 3CWJA 3HDSA 5A8KA 3RAQA 1WWHA 2EKYA 3MGJA 5KFMA 1HIYA 3IRWP 3HSGA 1QSYA 1WDTA 1R0CB 3DGPA 2HKEA 5E3CA 2AGOA 1S1VB 2BABA 2HGNA 2P5VA 2VJUA 1AUDA 4R0JA 5H9EK 3CDUA 3AD9C 3KK2A 3NWRA 2HAFA 2UUAF 4FXDA 4J9QA 3F0NA 4F8RA 4ZJOA 4HTJA 3CSKA 5KG5A 3VGTA 4WU2A 2AT1B 1B7YB 4ETZA 1DTQA 2CQGA 3KHHA 3UW1A 3QLHB 2AEMA 2N7CA 4KIAA 2EG2A 3D6MB 1SUQA 4P74A 5IWAF 4F3OA 1G6BA 1ZBTA 2MKJA 5AJ3F 4CIOA 5E5NA 4I2QA 4IG3B 1LQ9A 4ETXA 4DSIA 3H8YA 1ITPA 3A13A 2VBYA 5HP1B 3QMQA 3HPOA 3TANA 4F4ZA 4RO0A 2BKOA 1JLFB 3MURP 3LWMA 2PD1A 2KI2A 3G8SA 3GONA 1YJTA 4G1QB 1PYSB 2V9WA 2KDOA 1NPPA 3MMAA 2YVSA 3T1YJ 2BRKA 1X9WA 3LP0A 4MJKA 1FHTA 1L3SA 5JVHQ 4EZ6A 3CJ4A 2CVEA 4BDPA 1TFWA 4ZVEA 5KFLA 2CUYA 4LF6F 1U6BA 4UOGA 1NZAA 2E7WA 3AT1B 2FY1A 3DLLQ 2J9EA 3GG1A 4DPUA 1K44A 2BJEA 3C14B 4WK3A 2DH8A 4HI1A 2MPUA 3JAMY 4ANCA 3HSJA 3CULA 4C98A 2XLIA 3R9LA 2CQHA 5L38A 3DRSA 3PEHA 3DLKA 1UMJA 2JLGA 4PWDB 2HHVA 2FVQA 2C2KB 2DIUA 3SFUA 3W9HA 2OPRB 1NKCA 5F8NA 2RB7A 3OSPA 3CB4A 3D66A 4A8FA 4RJVA 3WBZA 1S4FA 4ATNA 4DPTA 3OTDA 4FNHA 4DQQA 1SJ1A 2ZVIA 1V9OA 4ZKAA 1XMOF 2EI5A 3MMCB 4CO1A 3IAS9 2NPIA 3AY0A 3WIUA 4DUZF 1RTJB 2RJZA 2MY7A 2YKOA 2XBPA 3BGOP 2BJDA 3K5PA 2HNYA 2YKMB 4YEAA 3RZAA 5HVGA 5J2PA 4D3HA 2I5JB 1VQKS 2HHSA 2HVZA 5DM6Q 1ULRA 4MMOA 2F40A 4CYUA 5BJRA 4DR1J 4A8WA 4WFYA 2CQPA 1KLMB 1TELA 2YQ1A 1FK9B 2HMIB 3NNHA 3MCMA 4XIUA 1FXRA 1VQ5S 3HF5A 4ZPTR 4H4OA 2QYCA 1S0MA 2W9BA 4Q5VA 1NKBA 3RW6A 3KLFB 4PXEA 4DQSA 2VG6B 2QA4S 3Q2TC 4K4VA 4QIWD 2RT3A 4KFBB 3C14A 1YLXA 4K59A 3IA0A 1U26A 1P1LA 4G1IA 5DETA 2WONB 1GX6A 2QIFA 3MM6A 3B78A 4KHPF 4X4QA 1BC6A 3TOQA 4DPYA 2RF2A 2V5HG 4I68A 3LAMA 4XAKA 4AD6A 3HT0A 1LFWA 3HVAA 3TVZA 2ZJRQ 2PI4A 3M9NB 2YKQA 1ZAVA 4Y0FA 4FBUA 2CQ0A 4I0WA 4N77A 4PZVA 1EX8A 4RR5A 5HL7Q 1L5UA 2R8KA 2NXNA 5HLFB 2B5JB 1HW8A 3DHXA 5KFYA 4A48A 4OI0A 1VRTB 1JXEA 5C42B 1UL3A 4DN9A 9RUBA 3CO9A 3CJKB 5GMKa 1NPKA 2CZVC 5KT5A 2VKZG 1S7IA 3DRPA 2YKMA 1LW2B 4QW8A 3SBMA 1V3RA 4K4XA 3PW0A 1XQIA 3OTBA 5C7PA 3IS9A 1U2CA 1RWOB 1WHYA 3D6HB 5KFXA 1EETA 2OGUA 4PABA 3K0JA 2GC8A 1T11A 5L1JA 3W8GA 3DC2A 1U6ZA 1AW0A 4I2PB 4ICLA 2YWHA 5KFAA 1TK0A 4CO3A 1P9YA 3DOMA 3OQ2A 5CZXA 4CLFA 2EC2A 2JJ4D 3NOCA 4CWBA 1NJWA 5K8MA 4X4VA 4IG0A 4HLBA 1Q79A 2LLZA 3UPFA 1T0TV 2KKHA 1HQEA 3D67A 1FDNA 3I0RB 4K7QA 1NSQA 4OX9J 3UCZP 2JHEA 2IAJA 1HARA 3GV8B 1KSPA 4IOCQ 1FKPB 2XSJA 3MI7X 1IKYB 3Q0AA 4ELUA 4OMFG 1RWUA 2FD2A 3ZZUA 2UUCJ 3EE3A 1ZPVA 4NL5A 3OTCA 1RHRB 1AFJA 3G6XA 4GKKF 4LSNB 3R6GB 2KZMA 2DNGA 1A0OB 4WPAA 1LXNA 4YB6A 4W92B 2VOPA 3PJ9A 3TI0A 1WSRA 2GFFA 2W1BA 1TU0B 2RRBA 4LF9F 2RQKA 2DXDA 4B3MJ 1Z2ZA 2N3LA 3CCZA 2O01C 3ZTOA 2FZCB 3FKBA 3E01A 1RABB 3EUNA 5HATA 3D7SB 4IH6A 4O3NA 1OMSA 1XJWB 1KFDA 2B4PA 2Z57B 9ATCB 4X4SA 2CJBA 2E7VA 2FIUA 1WOPA 2WCXA 1JLCA 4ZPCA 3MR2A 3QJLA 2CJAA 1GH8A 3BO4A 4PPDA 3ITHA 2JNJA 2OTLS 5ETRA 2L9DA 2I6WA 4ED7A 2W4CA 3PG9A 4JI8F 2L9NA 1LOUA 1HQ2A 1GMUA 4YQWA 1OY9A 3WHIA 4GVBB 1PJ7A 2J0XA 3DOMB 3H98A 4JI3F 2PMWA 4FBTA 5AT1B 5DG9A 3FVYA 2Q66A 4C97A 1BGXT 1GK8A 4YDDB 2BQRA 3ENWA 3LUYA 5D0GA 3OTOJ 5THWA 2NCKL 1UEKA 1RTDB 2EK1A 2WW4A 2ZWPA 4I6WA 3KTQA 3FQKA 2HZCA 5L8RC 2YH1A 1RT2B 4K0KF 2MZTA 2CQCA 2G0CA 3KOAA 4Y3CA 1PGZA 3GZ7A 2HS4A 4LQ3A 1JWWA 5DQIA 5KAKA 1N33J 1TAUA 2WB1D 2YX4A 4ZN3A 1VI7A 2C2NA 1RAAB 2OP5A 3MM7A 2VC1A 1H2VZ 2QA4G 2MLYA 4ED5A 2W9CA 2ATLA 4JI1J 2K1RA 4QJVA 3M6VA 3TUJC 1U8SA 2AJ2A 1VK8A 4TLRA 3V2UC 4G1PA 3IN5A 3O6QA 4X4RA 3ISZA 3O3LA 2YNFB 3O1LA 3BJYA 2HNZA 4LIRA 1FKAF 2VFUA 1KOHA 2ZKTA 1NLKL 2D7SA 3I9V9 3HHLC 3T6BA 3U1NA 3LF0A 3ITHB 2WB4A 3PYEA 4C2MA 1U1QA 2YNGB 4D3GA 4F0HA 2UXDF 1RT3B 1RYRA 1UWBB 2UXDJ 3AH6A 3EMTA 1NK4A 4ZLJA 4KQZA 3H5SA 2B3TB 3OJSA 1DQAA 3AD8C 3M8PB 4HHHA 4LSZB 2HGMA 2PMZD 3SSRA 3RRGA 2XB2D 2PSZA 4DWIA 4LFBF 4MIAA 3C16B 4OJHA 1YHQS 3OR2A 3OV7A 4OV6A 2JX2A 3ELHA 3LO3A 4LUBA 2L9WA 2GIRA 3HZGA 2DIVA 2HLUA 1HKAA 2ZH4A 3CMES 3MZIA 1EARA 4ED6A 2DHGA 4J9PA 2ASLA 2MQPA 1VQOS 2DHSA 3M2VA 3U02A 2ZZMA 4DR6J 2R8JA 2FJVA 1RXOB 3Q22A 4OI3A 4I56A 4UF4A 2EFVA 1T03A 2IC3A 4HKQA 4JI4F 4KAIA 5B0FA 3WDOA 2UP1A 5IS2A 5IWAJ 2OPSA 1PCAA 1Q8KA 2AYMA 1VISA 1X4GA 4W4MA 4R25A 5EX3A 4DXLA 1D9FA 3SQOP 2HYIB 3CC4S 1U49A 2M9KA 2G13A 2GVZB 4ZP8A 1LW0B 4BWMA 4WK1A 1QUPA 3VF0B 1WEYA 4K2XA 2QLBB 3ZZOA 1M0SA 3OTOF 1MMLA 4M5DA 4CLLA 2GJ2A 3SFGA 4ED2A 5GAHI 1Y11A 1SUQB 1TL5A 4ECWA 2CG4A 5KFPA 4DX5A 3NLCA 4M5KA 3PY8A 4ILLA 4Z7CA 5H9FK 2F4VJ 1HFEL 2R8HA 2OKQA 3I55S 1T9WA 1C4AA 1R8AA 4MT1A 5EX0A 1Y5IB 2HIQA 3EGWB 2DR8A 1XNQJ 1S9EA 2PFFB 1XR5A 3H0PA 2GW8A 3NGDA 3PX6A 1RB0A 4OYXA 2B7CB 4DLGA 3TR5A 2CNNB 2LEAA 1M5VC 1D8YA 2G4BA 2GVDA 4MYUA 2BUNA 3R7NB 4TQSA 3QIPA 1FNOA 4KSEB 2Z58B 1P27B 1QJHA 3TX8A 1N56A 4JYAJ 3I5AA 1RAFB 1RT5A 1Q8BA 1XMQF 4DDFA 3HXMA 1U1KA 2OD6A 3KLEA 1ZA1B 4CZCA 2KT2A 3DFEA 4YUDA 2BOPA 3CJTA 1SH3A 2YWEA 1S97A 1XNRF 4FF1A 3CIZA 4J9KA 1RQ0A 3AOCA 2CADA 1YG0A 3BYPA 1Q5YA 4RBVA 5ADZA 1Q81T 3LQVA 5KFSA 2CPDA 2YXLA 2KT3A 2R42A 3EPGA 2V34A 2UU9F 3QYYA 4IR1A 3KFWX 3POTA 2KB2A 4RW7B 4MTPA 3VAGA 2B9YA 4PYDA 3TEGA 5BXIA 4FS1A 3W63A 3M8WA 4J9OA 3IBCB 2QN6B 4DV0J 3R6LB 4FVCA 1D09B 4DF8A 4EMDA 1T05B 1E6VA 4O3OA 1B0PA 1T9YA 1QUVA 3DN9A 2HS0A 3TX0A 1TTHB 4C3KA 4JOUA 3D0IE 3R3TA 5ETVA 4U96A 3QZ7A 1FT8A 3V81B 3R5GA 2HNYB 2CDQA 4J90A 1WKJA 5KFQA 4QR2A 1UP1A 2DHAA 3SV4A 5IV3A 3M2RB 5JVGQ 3OLAA 2BXJA 1W26A 1K0TA 4C11B 2UXBF 1WD6A 3FZBA 4USHA 5LMUF 2VPXB 2AEJA 1CJVB 4LJMA 3R8YA 1L3VA 4MIWA 4Z7YA 4DOZA 3SI8A 4DR2J 2HURA 2NREA 1I6JA 1HBNA 1NUEA 2IYIA 2O67A 3DKDA 4B08A 2C3UA 2MQQA 3SDEA 5CYMA 2IPOB 2W2MP 3T6JA 3VAIA 4DUZJ 1PO6A 4N76A 3BQ1A 2LDIA 1PILA 1M90T 5IT0A 4M1KA 4ZK7M 3LP1A 2CIMA 3F44A 2QL9B 5B08A 5IC6B 1JLBB 1ZZNA 1BQNB 2CQ4A 2KG1A 1ZS6A 3PV8A 2RF2B 4IKAA 5GMDA 3KK2B 2MHNA 5HANA 4NA1A 4F4AA 1HNZF 3POTB 2AX0A 3HULA 2CQBA 3D54A 3ZTQA 1OYDA 4NLTA 3OBIA 4YHHF 4DV2J 4ZVPB 1KKHA 4OHZA 4FPRA 1H3DA 2KTQA 3S8SA 5E41A 2BX6A 2DRDA 2HK2A 2V94A 2XZTB 3GWCA 2B4UA 2QZ8A 1F9FA 3HHLA 2RU3A 4EFAC 4OLPA 4YN3B 4JYAF 2XLJA 4X4UA 2FHJD 1X4FA 3CCVS 2BVZA 2J5AA 3NGUA 4QOTA 2HRUA 4JI0F 4M5HA 1Z2LA 2WVCA 3W9IA 3V6KA 2MKSA 1BHNA 4YB7A 3AA9A 3KHLA 1CBKA 2MZ1A 1KC8T 3MAAA 4OLOA 5D0RA 3M30B 1VHFA 1GEHA 2GS8A 2FLOA 3H7HB 3R2CJ 1SQFA 3RYLA 3PYDA 1CQNA 2OFGX 2YNHB 1NM2A 4M5LA 5IT9Y 1W7WA 2CNLB 1FEHA 1DFDA 2JC1A 2JLFA 2ZH2A 3QSYB 1M1GA 1B7FA 2WW8A 3J7YU 5A2QU 4F4WA 2XMVA 3Q24A 1SV5B 1IVZA 3KLIB 3TRGA 5LSRA 3C6UB 1N52B 2GQQA 2DNMA 2MTLA 4R8UB 1LK7A 1PC4A 5KG4A 1C1CA 3KLVA 4WP3A 3PVXA 5KFKA 3I0RA 1T8EA 2XWXA 2PE8A 3GB0A 2K7KA 2PI5A 1UJ4A 2VG7A 4DBQA 4HYKA 3M9MB 2VKRA 1GTHA 3CGIA 5KFWA 5DM7Q 2C28A 3MCSA 4S0MA 4F25A 4K4UA 1X5OA 4USUA 4ZVSB 3BR8A 1S1XB 1PBAA 5H1SV 1KNZA 2DNOA 4Q44A 4ZHRA 4JBCA 2W8LA 2Q6CA 3P49B 2B6AA 5T7LA 1C1BB 3GIMA 3G71S 2KM8C 1CJUA 4CT8A 1TAQA 5CAAA 3X1LB 1C4CA 3KJNB 4K4ZA 3PM9A 2Z2ZA 4DX6A 1LWCA 5KFDA 4QYRA 3MFIA 4DS5A 4DFPA 2RE1A 2LKZA 2JSXA 3ZZ0A 4AFFA 2V4RA 2N7YA 2AW0A 4A8MP 5E7OB 3E01B 5LT5A 1Q8IA 1PYOB 2EK6A 1Y3KA 2MMYA 1N36J 1P9QC 3IMQJ 1Q86T 1FJGF 3CC2S 3QAUA 2RQCA 2P9CA 3ENAA 1WNEA 1KD1T 4P10A 3S01A 1BY9A 1BWVA 2BW7A 1RHMB 2Q79A 2V2KA 5LOQA 2OH2A 4Y34A 2E1AA 2I8EA 2CQIA 4P73A 3MR3A 2LXUA 1X4DA 4CI0B 2GMHA 3P96A 5F9LA 2F65A 4FNIA 1CJKA 1N5TA 4R0EA 4YY3F 4M5MA 1MU2A 3CNQP 1S6PA 2YX7A 5DZ6A 5A76A 4HDGA 2VFRA 1FFGB 3OD2A 3MM6B 4IO9Q 1IBMJ 3OHBA 3OL6A 2GQCA 1H7XA 4LRBA 4WIIA 2QMUB 2MKKA 1NB2A 3ZZYA 2FVCA 3EVMA 4NZ6A 3D28A 1TL7B 4QZVB 1O0PA 2FJAB 1S1XA 2HG4A 4GO7X 5C2CA 4R5PA 1WI8A 2F8EX 2VG5A 2GQ2A 2D9OA 2X1AA 4OX8A 2HVHA 1C1BA 1RT4B 5GAEI 3W3SA 1NJYA 1GQEA 4DV6J 3FNNA 4M94A 1MROB 2DY9A 3FEYB 3PKYA 4J9LA 1IKXA 4OI4A 4ZP7A 2W9CB 2UXCF 2CZ9A 1FF2A 1HNIA 2RQ4A 1DZ5A 1QAYA 4EWTA 4X84A 3G86A 1IKVB 4NLSA 2VICA 3NNAA 4NLOA 2HRTA 3K8VA 4CLSA 1YI2S 3JS9A 4YB1P 4UW2A 4G65A 1WG1A 1VQ6S 3JXOA 3L7PA 2RAQA 4EBEA 1N5VA 1IWGA 3HT3A 3THTA 3NCPA 2CG8A 3ZZTA 4YHHJ 2W7OA 3H59A 1RT6B 2PEBA 1Z1ZA 2C3YA 1FXLA 1FJ7A 2LYVA 4DPOA 2CPXA 4V19J 1IBCB 4CO2A 1YKWA 2KXHA 1J2VA 2QE5A 1WF2A 2JFKA 4I7FA 3KK1B 1DURA 3CJ0A 3TUIC 5EGYA 4JV5J 1CEZA 1BD6A 2HGLA 3N28A 3J81U 3UD4P 1DBDA 1K0VA 2DXFA 2HQDA 1JB0C 2R7UA 3BO2A 4JI6J 1VRUB 1LFPA 4OYOA 3PACA 3U7JA 2EFGA 1MNEA 1BQMA 2M88A 4CTAA 2D3O1 3BV8A 1CQMA 2A0FB 4USIA 4ZVHA 4UQTA 2AYBA 2BBEA 4NX9A 1V5IB 2YKNA 1NO8A 2X1GA 1SJFA 4P2FA 4TKTA 4HDHA 4CH7A 5GADU 3GE9A 1FTRA 1C2PA 1KQGB 3X3UA 2MKIA 2KJWA 3DLEA 3BO3A 5J2MA 4KHRA 1G2EA 3GU0A 3M8YA 1JNRB 5HN0A 2HHQA 2OPSB 4ZVGA 5IQQA 4QBUA 4PRFA 4JV2A 3LGHA 4O0IA 4O23A 4Y2CA 1HNIB 2YQ3A 3TAMB 2B4OA 3R5DA 1X4AA 1M5HA 1H74A 2B56A 2E66A 1R0BG 4ZOSA 3G8TA 2UUBJ 2EXUA 5MAOA 4MFBB 3HHEA 2DGOA 3BGUA 4C3MA 4UQGA 4ELVA 3IWNC 5HK4A 2I9SA 3FEXB 5IFMA 1IJEB 4C8ZA 1AZSB 3ET6B 3J7YI 4UOCA 3RJMB 2V68A 3NGKA 5KG6A 3KLGB 4X4PA 4K4TA 2VDIA 1LWXA 4NYZA 2J0WA 3PZPA 3W2VB 4RNMA 3ENVA 3QRRA 1U2RA 2CPIA 4ZS6A 5LMNJ 1ZTTA 4PWDA 5B0DA 1D9DA 1R6YA 2HHHF 1RAOA 2G1DA 4OFZA 1JLGB 3UVJA 4YFUA 3J80U 4HEA9 3M32B 2V2QA 3W2WA 5GMEA 1U09A 2WZ1A 2HRYA 3IWXA 4P6QA 5CYJA 3BPDA 3I87A 4H4KC 5RUBA 3PKMA 1S1UB 3M8QA 3EM1A 2ERRA 4Y00A 2MZRA 3VVUA 2WHOA 4A4JA 1WTFA 5HMWA 1HMVA 2HFOA 2UVWA 2DEIA 4B9MA 4OHXA 5CH7B 1BWEA 4QQBA 1CULA 2B9WA 1Y4ZB 3DNCA 3GMGA 3FMWA 4LFAJ 2GV1A 3SQGB 3QO9A 4XPCA 3OL8A 2GA7A 2C2MB 3CJRA 5J2PB 3D1QA 3F73A 2ZH1A 3CJ3A 4LF1A 1RA7A 3P6YC 2OO4A 3CDAA 4DX8H 1FCAA 1N6QA 4HT7A 1KQFB 5L1LA 2J0QD 3DHWC 2D41A 3IP0A 2X3GA 4O3PA 2KHDA 1SI9A 4HR2A 4M63A 1RTIA 1Q7YT 3RU0A 4YR2A 4FDFA 2GGPB 4AE5A 3H40A 4PG5A 5ETSA 2YWGA 3AXMA 4EUVA 4X2BA 1TKTB 2PGCA 1SKWA 4KFBA 1L3KA 1RHKB 2QLXA 5KFOA 1IBMF 3MAQA 1R7IA 1SQEA 4RX6A 5IC4B 1WELA 2GHVC 2WONA 2ACMA 2L48A 3LTOA 1IN0A 2ZBIA 4HACA 2XO7A 4DL3A 4QYZK 2UVVA 4JI4J 2XWYA 3M2RA 1JLQA 1JLEB 2J9DA 2VASA 1VK3A 1UZHA 4DHVA 3B4DA 3Q8RB 2LQ8A 3H5YA 3PO5A 1S59A 4JI5F 3QRQA 1TL1A 4LVNP 2EVZA 3NS7B 3OVBA 4LSLB 2LFVA 4WWSA 3EXYA 3DXSX 4M5JA 1U1RA 2QEXS 2CQDA 2XYGB 2N3OA 4U67Q 3OUYA 3I0SA 1S1WA 3DLBA 2CJKA 4TU7A 2F63A 3PHTA 2B9EA 3MPVA 1T02A 1RWWB 3S7RA 2N4CA 4YDXA 1WC5A 4M8LA 3OHAA 1XMBA 4CLZA 1KVIA 5SUHA 4ALZA 1WOOA 2VHGA 2MKCA 2EBGA 4CM2A 1XERA 2QTWA 2AWZA 2FVSA 3D3BJ 2ABYA 3RTVA 4F4KA 3PR4A 3MMAB 3L4BC 1FRJA 4FXVA 4DR5J 2OTJS 2DCLA 4M5DB 1WSVA 1MW7A 4EYIB 2XGPA 1FKOB 2HQIA 1DHMA 2KJVA 3D1OA 2EG1A 1FRXA 3Q8QB 1Y10A 1RUSA 3MPDA 3W5YA 3ADAC 1GAOA 3Q2SC 4KV8A 4X64F 2XS5A 2DPJA 2QT7A 2DISA 5ETTA 1EP4B 2HZVA 3BBBA 3DRYA 1TQLA 3ILOA 5T41A 4C0BA 2IRYA 2MZQA 4ZMMA 2VODA 2WSEC 4CLPA 1VIXA 4LRAA 3HX9A 3W64A 3K58A 3T5JA 1XK8A 4H4MB 1SC4B 2A6MA 2AHOB 4ERDA 3A3OB 5HMYA 1BQXA 4JUZA 1RTHA 2ZD1A 2DKOB 2QFIA 4CO5A 4NYOA 3J80Y 4OL8A 1NHKL 3R2DJ 2D1CA 4FF3A 3GFYA 1S1WB 3WC0A 2VPZB 2L3MA 1U1PA 4LF5J 2YY3A 4DX7A 1KN6A 4P72A 1X31C 5E3AA 1N34J 2OSQA 1KFSA 3WX4A 1JLAB 3S1TA 4X66F 1TVRB 4PG7A 2HSEB 4W98A 1GXUA 1P6TA 5A8WA 3HI9A 1WF0A 3EPIA 3PJXA 4WZMA 2EWHA 1SH2A 1QVFR 1I3OB 4U7UD 3H4DA 1YZ7A 1TL3A 5H9FJ 1R43A 5EWGA 1DQ8A 4RLEA 4DQIA 4HHUA 1DARA 2PA8D 1DTQB 2LXFA 2V63A 3B4MA 5KT4A 4U9RA 5T7LB 3I5CA 3VGUA 5F9NA 3OXFA 4ED3A 1T3NA 2JEGA 3J7ZT 3KLHA 1U4BA 1HQUA 1NU4A 5KFRA 2RS8A 3D4JA 2COLA 3CCTA 3NRBA 2DYAA 5H9EJ 3AA8A 2GNKA 5A6PA 4KHMA 1UW4A 2CQ3A 4O4RA 4EI2A 3CCSS 1CLFA 3MTKA 3DMJB 2CWXA 4ECYA 3V4IA 5FLXY 2DNZA 4KH0B 2XMTA 4N47A 3D0GE 5KFIA 3DU5A 3DM2A 1U1MA 2IM0A 2C2RA 4YP3A 3HCXA 3LP0B 2DH9A 2HVDA 4A8SA 3M6WA 2GAGC 4PAAA 2VIHA 4DUYF 2B5JA 1D9AA 1HBNB 4DR5F 1YJUA 5LL6d 3CPWR 5G0RA 2J6UA 1FFSB 4E98A 3J81Y 2W24A 3U1LA 2AJ4A 5ETQA 2HLTA 4PCQA 4QR0A 4WYWA 2NPFA 2ALZA 4DUTA 6AT1B 1C0TA 2P2CB 1HBUB 1Q53A 3CVKA 2VFSA 3RRHA 4BHQA 4OZ0A 4DV6F 2POKA 3HM9A 1CC8A 3C19A 3DOKA 1G7CB 2B9XA 2D3UA 2V67A 4IDKA 2A2CA 3W1YC 2XY5A 4K5RA 1SXLA 3MM5A 4OYZA 3W61A 5HBMB 1RZMA 4JI1F 3JQJA 1RT3A 2EFOA 2NSBA 5B09A 4A8YA 3QWPA 2IM3A 4K4YA 2FY8A 1S72S 1F0XA 2CKWA 3BB5A 5KFVA 2MJNA 3QRPA 2HNDB 4NMLA 3FEZA 1NK0A 4U8YA 2Q1LA 2EW9A 1YJWS 1SCJB 5D4LA 4AUKA 5IV4A 2CJQA 4LF4F 5CQGA 1X4HA 1PJ6A 3EZUA 1IR1A 1NH7A 7AT1B 1XMOJ 1QAXA 2C3MA 1HWJA 2MQLA 4F02A 1TR0A 4QWEA 1HPZB 2DK2A 2WVDA 1B3TA 5AXLA 3NGTA 3PIOQ 2W9BB 4CH1A 3OSNA 2PMHA 4NLYA 5E3PA 1MWQA 1MWYA 1TK5A 2MLXA 4FF4A 1S76D 3IGVA 1GMWA 4XTTA 1OQ3A 2PIIA 2MKHA 1T9UA 4N7TA 4AT1B 4TY9A 2J9DE 3Q8PB 3TO8A 4N8OA 4AQYF 2GO9A 2Y0SD 3OFHA 4KGXB 5B0CA 5J2NB 2LDYA 1AUSL 2B7BB 4KKOB 4RWWA 3GV5B 4CTAB 1YBUA 1REVB 5J1EB 4P2XA 2XYPB 4DU8A 1SL2A 2R7RA 1VQMS 3UR0A 4ZVTB 3AJ2A 2O1PA 4NLPA 4IRKA 1DQ9A 4FF2A 1RTZA 4F3MA 4ZHRB 2F9JA 4WXWA 3RUBL 4JI5J 4P75A 5KFNA 3DLEB 1K47A 2ASYA 2CFXA 1S1TA 1YVFA 2RSQA 4DR1F 2HZAA 4DCOB 2E1PA 2HAIA 3FCHA 1KRPA 2V2VA 3W66A 4CLKA 3DRPB 3OPKA 3M6UA 3BSAA 4K5SA 4C9DA 1KBRA 3VR1A 2E9TA 3MUVP 3V6DA 2LEPA 3BN4A 2IRXA 1QAIA 2UUTA 5C5JA 3L95X 1OY8A 1Y0HA 3TUZC 2ZM6F 2AZ1A 1W25A 4KRWA 4FXWA 2XLKA 1RHUB 5A8KB 3QATA 1Y5LB 4C0OC 1SC3B 1VYAA 2M70A 3PNIA 2DGWA 3C15B 2DNKA 2R7OA 1NSAA 1WOSA 4ELTA 1Q95G 5DDRC 1MMNA 4LR9A 4RBUA 1CJKB 2G9OA 2W8KA 4LMZA 5D3GA 1RAEB 4UZCA 5K9FA 1VQPS 5E2QA 5ETPA 1HNVB 1N88A 4C7QA 5LXYA 4LFAF 2BJ3A 2ZOFA 2PO4A 4XK8C 4K2JA 2IDLA 3D5MA 2V50A 5IT9U 4IQXA 5AE1A 3K59A 2AU0A 2M8HA 1T05A 1E6VB 1WHXA 1VOMA 2XSJB 1Q5VA 2ZBQA 4I2QB 3CMAS 3TJAA 4C8OA 4UUXA 2D3OR 3CC7S 2DGUA 2M7SA 1RDRA 2V9KA 3EWGA 3I4HX 4PWWA 3NS6A 4BLGA 1YJNS 4BS2A 1KR4A 3DDNA 4H4KA 4X62J 5HAOA 2J76E 2CJYB 2XMMA 3BSOA 1N48A 1OSDA 3R7SB 3AAWB 2Y1IA 2CPFA 3SXLA 1U1OA 2MQNA 2Z2YB 3HJVA 3H20A 4IO1A 4C48A 1JIHA 4FS2A 2QRRA 3NP5A 3SDEB 4OZ5A 3MAHA 2FLPA 1FRMA 2M4MA 1ZM2A 3LP1B 2LQJA 2VDHA 5KFBA 1ELOA 2H51B 2IC3B 1WTBA 1X9MA 3CCMS 1SL0A 1I1GA 3A1YG 3R5CA 1JLBA 2YPZA 1HR0J 2I38A 4NCAA 2QMWA 3NKYA 3B54A 5KTQA 4O3SA 3MXHP 2BE2A 1HR0F 3ONQA 4ZITA 3THVA 4LBHA 2DGXA 3FSXA 3N6MA 2Q6BA 2XQCA 5KOWA 2F4FA 1TL1B 4QPTA 1RHJB 1KONA 1FVSA 2ZDOA 2ZOGA 1UW9A 3BSNA 1VJWA 3IR5B 4UUWA 3HHLD 1SC1B 4KTQA 3RBXA 2RHQB 4USJC 3HHLB 1CG2A 3CD0A 3Q8UA 1N54B 1PSDA 2HBZB 2B43A 3QFWA 2J6TA 1EQMA 1F9EB 3BZQA 3GYXB 1LXJA 2MQOA 5AE2A 2K1RB 3NOGA 4MAKA 2ZH5A 4LF6J 1KLMA 1FK9A 1ZAWA 1C0UA 2E1MC 3TQEA 3FBCA 4OZ1A 3JSBA 1JXLA 4LFBJ 3PYFA 4KB7A 7FDRA 1IBLJ 2ZBRA 4B9LA 3HK2A 4FYYB 2WBMA 3K89A 2RMLA 3CIMA 2Y1RI 2IA6A 3JSMB 3KLEB 1HL6A 4X4NA 2CDRB 4CDIA 5D6GA 2FHJA 2WSFC 4WFBQ 4NI2A 2PFDA 3BBCA 4NA2A 4UT4A 1HBOB 1YIJS 3MEEA 3IC1A 5GAHU 2HQFA 2V8PA 3JSRA 4O4GA 4LF2A 4ZPBA 3US5A 5GAGU 4ECXA 2H5IB 2MGZB 3UWTA 2V8DA 2W25A 1SIZA 3MM8A 3M8PA 1U0HA 1SJQA 4IFYA 2VBZA 3HSDA 1S77D 2O66A 1H0HB 1JLGA 1X4CA 3R27A 3SCIE 2ZHBA 1NSPA 4ANDA 1ZZFA 3MCOA 5E3QA 5ITHA 3DLGB 4DV7J 3QLHA 3CUNA 1YJ9S 1H38A 1CJUB 2HFNA 4NXMJ 2GJIA 4F7VA 3O2IA 3TEHB 2DGTA 4QWCA 1HA1A 1N5YA 3AFGA 3AB2B 2ZC3A 2O5DA 4NMXA 1RAJA 5ETKA 4DV1F 5BYSA 3RB3A 4LF4J 1CULB 3B6BA 3UQSA 3MHYA 4EYHB 1DRZA 2KFZA 2DNYA 3V81A 3MD3A 1T7PA 2ZHAA 1TVRA 3R5AA 5D4OA 3RBDA 1LEOA 2YKPA 4DR3J 4RL1A 3TZWA 2QLJB 4CP5A 3U1MA 2RDIA 5FD1A 3Q8VA 3FFIA 2YWFA 1TUWA 3JSYA 4FN5A 2W2QP 1OWXA 2OSRA 1UPMB 2ZITA 4M5NA 3W62A 1J5EF 3HJFA 3BBFA 2GGPA 1FDBA 1VLOA 2H5EA 3A4TA 5F0WA 2WOMB 4KPYA 2Y3YA 2IBOA 3FCWA 2FTRA 4IG0B 3BH7B 4OYMA 3KJFB 4DV2F 4JI7F 1HYSB 1F3FA 3IO1A 2V0NA 1IWAA 1ZYQA 1S79A 2BOAA 2DGVA 2MKYA 4ZA1A 4C8MA 1JLQB 3G4SS 2BV3A 3BS9A 3H2UB 1D0EA 4EO8A 4B9VA 4DR7J 4Z2XA 4KJIA 1QVGR 4NXNF 1R89A 5I3QA 3QFHA 3BGFA 3T1YF 1MROA 2R2TA 1N5YB 1S5ZA 5KG2A 3HP6A 2ZJPQ 1M5OC 2MB0B 4A47A 5EUHA 1F9HA 2Z0GA 4P52A 2FPHX 3SIPB 5GAEU 2E44A 2DR5A 1G4CA 1RTJA 3SYZA 1F5CA 3AQOA 4A8XA 2DNPA 2I5JA 2K3IA 3F41A 4Q0BB 4IRCA 1HW9A 2JVOA 3N01A 4BC7A 4WZQA 3HKWA 4QIEA 1VC6A 5AE3A 3CJ8A 4LT6A 3W65A 4HT5A 4K8RA 1Y00A 4YB5A 4LIWA 2CWKA 4DL5A 3PCOB 1Q82T 1H2TZ 4ZVOB 2K2PA 4QIGA 4IUFA 1JJHA 2DY1A 3QT7A 4TY8A 3VZHA 3AQPA 2VQFJ 3N79A 3G96A 1NNDA 3OW2R 2WOMA 2N82B 4IR9A 3KG0A 4MKYA 1EZZB 1Y5NB 3HSZA 1S6QA 1MWZA 1RADB 2V4JA 4ZPWR 3UDEA 2QGFB 3UDLA 1N32F 2VBXA 2X51A 3DLJA 2IVMA 1EHWA 1SH0A 4I4BA 4OYPA 5F3TA 4U7UK 1FWPA 5CD4A 3GIJA 4OZNA 1BQMB 1VQSA 1YX2A 5CD4H 3RB6A 2VG7B 1RT2A 2NSCA 4NLWA 4N8NA 4DEZA 3EVWA 1GT8A 3UN3A 1OO0B 2LA4A 1IBLF 4O3RA 2DNLA 2AMCB 2B6AB 3I6PA 4Q2MA
chains in the Genus database with same CATH topology
1RGVA 3KMSA 5CCMA 2AJ1A 3I5BA 4RWXA 3ULHA 3MTJA 2E7XA 4CO4A 5GADI 2E1CA 4P2SA 1LW2A 2DGSA 2NQPA 2ZC4A 4Q0BA 3KNGA 5KFGA 3IS9B 4WFAQ 2HHWA 1S48A 2KZZA 1TL3B 5DQHA 3KLGA 3MOZA 3NWGA 1VC0A 1S6OA 1QY7A 1S49A 2IA0A 2ILZA 4DL6A 1YJRA 4L72B 4ILMA 1VGYA 2RH3A 1RT7B 2LU2A 3NCRA 2KG0A 2BW2A 3B8HA 2Z2LA 3LW5C 3ZFVA 2JRSA 2IAJB 3C2PA 2GMJA 3W7BA 2MYFA 1IKYA 3LH2S 3WC2A 2IBKA 2VUGA 2VG5B 4DSEA 4F67A 4Y2KA 1IUJA 1T03B 4YR0A 3J7A1 1SBRA 2BM0A 2K8GA 5A8RB 3PW5A 4RUAA 2R8GA 1SV5A 1HI0P 5I42A 3KLIA 1V3SA 3O44A 4ECSA 1VQ8S 4WFXA 3ZC4A 4F26A 2XSFA 3KYLA 5T14A 3HFKA 3I9ZA 3R1LA 4WCEQ 3IXQA 2PC6A 3ISND 3KHGA 2IM1A 4BCAA 2XMWA 4C8NA 2YKAA 2F8MA 2K3KA 3N6LA 3BN7A 1X5TA 3QJJA 5DO2A 3D1HA 2OMOA 1LWCB 1NHVA 1F5BA 4B9SA 4CCHA 5DLGA 2HNDA 3OR1A 1Q1KA 2GHPA 3BDEA 1A7GE 3MECA 1IM4A 4QIVA 1HBMB 3BM7A 5U47A 4TN2A 2X1BA 3O8WA 5L9XA 4QIFA 3IRXB 5A2QY 3DI6B 2ROGA 3K5OA 3OXGA 2RQMA 4I1TA 1HWIA 3ZZZA 2M3DA 1UVJA 1KTVA 2RRNA 3JYTA 1S1VA 1T95A 1YJVA 4URSA 5I42B 1RJJA 5LSLA 1UKUA 4URGA 2QFJA 4WF9Q 4RKUC 1MU2B 2OMLA 1WI6A 2DB1A 4TYBA 5B0BA 4OJ3A 2QLWA 4ID5A 3MWBA 5AXKA 4A8KA 4GMKA 4QU6A 4PUOB 4KR0B 4DV4F 4J9NA 2AF6A 2GMLA 4XPEA 5K14A 3I96A 3N5FA 4C8KA 3MPYA 3M6XA 5E0OA 3O5TB 3FSIA 3CCES 2EFNA 1YRXA 1X5SA 1S1TB 2DJWA 3M2UA 4ZP6A 3K5NA 3CCUS 1JMTA 2I0XA 3OLBA 2ILYA 1XEZA 4DSLA 1U2FA 3NG8A 4NLVA 3M32A 3W2WB 5HI7A 4YOEA 2AGQA 1S1UA 3M8QB 3V6DB 1M5KC 2BQ3A 2ZZNA 2HHPA 2W4DA 3PW4A 4ID8A 1SKRA 3MF5A 4RW8B 1YRUA 3MD1A 3OL7A 1RISA 4QCLA 2JL9A 3PJWA 4JI2F 2R2UA 2CZ4A 1ZM9A 2CVIA 3QAEA 5DQGA 4TU8A 3MEDB 4IFVA 4Q8FA 3G9CA 4QPXA 3OJUA 1DTTB 2JLEA 1N6QB 4O44A 3DDKA 1LW0A 4OI1A 4ID5B 2RKIB 2IJFA 3LPYA 5DG8A 2KYZA 1YSJA 4CQ1A 5D78A 4RNHA 4DL4A 4NCGB 3OFFA 1K1SA 2YKNB 3V6JA 4UY8T 5AXNA 2R7TA 3GQCA 4ZCKA 2RIJA 3T5KA 4KBIA 3T1HF 1N33F 1S9EB 1Q7LB 5J2MB 2AD9A 3L7OA 3DMJA 2ACYA 1VLYA 2DD8S 1U25A 5J1PA 3HVWA