3KK3B

Hiv-1 reverse transcriptase-dna complex with gs-9148 terminated primer
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
427
structure length
407
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 96
structure length 407
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk3B04
3NAHA 2JEGA 5DG9A 3UQSA 1GX6A 4Q0BA 4O4GA 2I5JB 3KHGA 3DOKA 1BQMA 4NLRA 3I0SB 1YVFA 2XCPA 4FS1A 3CDWA 1HQUB 4WFZA 1MMLA 5CYMB 3CVKA 1S1XA 3IS9A 3KK3A 3MTKA 4J9QA 3CWJA 5KFYA 1J5OA 4J9OA 3KJVA 3QLHB 4KHRA 3QO9B 2F8EX 4Y3CA 1LWCA 5L1LA 1S1VB 3V81B 1TQLA 4WYLA 4H4MB 1RA6A 2OH2A 5K14B 4ICLB 4M95A 2ASJA 4ECTA 4I2QB 1JLEB 2RDIA 1JLFB 1FKOB 4KE5A 4K4ZA 5HBMA 1S1WA 2XI2A 2WCXA 2FJWA 1LWEA 1TKTA 5KG4A 2RKIB 4QWCA 2OPQA 3Q8SB 5KG2A 2XC9A 5F8GA 5J2QB 3V4IB 3Q8PB 1TL3A 2WRMA 4TQRA 4ED8A 5DQHA 5J2MB 4EYIB 3M9NB 1TL1A 3PHEA 4KKOA 2VG6B 1RT5A 2XGQA 3FQLA 1IM4A 3FDSA 3OSPA 1S1UB 1T03B 3QGIA 2AX1A 5F8IA 2IAJA 1RT4A 4PQUA 1S49A 2BQRA 1C0TA 4RW4B 4OL8A 4QWDA 5EWEA 1TKZB 4DL5A 2JEFA 1JLQB 3DRRA 4IFVB 1C1CA 4IFYB 1LW0B 1XR6A 1RT3A 3SFGA 2D41A 4ZPBA 2IC3A 3HVTA 1C0UB 1JLBA 2C2RA 3D5MA 2DPJA 2FLPA 5HROA 2YKNA 3NGDA 2UVRA 3NMAA 3DLKB 2D3ZA 2C2DA 1HPZB 3QYYA 2RDJA 5KFGA 2IA6A 1CSJA 5KFPA 1RT7B 1R0AA 4KFBB 4I7FA 4IG0B 2AGOA 5C25A 1C2PA 4PWDB 2YNIB 4NRTA 4WYWA 3ITHB 3KLFB 2CKWA 5F8LA 4G1QB 4EYHB 1JLCA 1JLGB 2XGPA 3M8QA 5KFCA 1UWBB 3LP2B 3DM2A 3E01B 3QZ8A 1TKXA 1RTDA 5F9LA 4DL3A 5D3GA 5KFQA 3ISNC 4YR3A 4K50A 4LSLA 4DL7A 4RW8B 4RNOA 3KNAA 4J9RA 4ZP6A 1RTHA 4IRKA 4ECRA 3G86A 3GQCA 3I0RB 3GV5B 3RB0A 1ZTTA 2V4QA 1S6PB 4J9KA 3H4DA 3LANA 3IG1B 2BRKA 2VA2A 3FSIA 2UUTA 4EBDA 5C24A 3T5JA 1KLMB 5CYQA 3DRPA 1RT6A 4NZ0A 3UDLA 3C6UB 1N6QB 1XR7A 2WONA 1T94A 5DG7A 1S0OA 3TAMA 3JYTA 3V6DB 4KO0B 3H5SA 3OHAA 2WTFA 4J9PA 2VG7B 3MFIA 4YR0A 2BR0A 2AGQA 1FKPA 3DOLA 5KT7A 3MEEB 4NLXA 5DGAA 3KLGB 2BE2A 4ECUA 1S9GA 2HNDA 2YNGB 3LAMA 4M94A 2ASLA 4KV8B 2W7OA 1S9EA 1TV6A 1SH0A 3C6TB 3DMJA 4ZHRA 4F4XA 2VA3A 3IRXB 3KK2A 4TQSA 1LWFB 4XPCA 3GILA 5F9NA 3TQ1A 3RB4A 5J2NB 2EC0A 3T19A 5EUHA 5KFUA 4NLGA 5I42B 3BREA 1C1BA 1EETA 2XI3A 4IDKA 4RNMA 4YP3A 3CJ5A 4RW9B 2YNFB 1DTQA 2XWYA 3T5KA 4WZMA 3UPFA 1SV5A 5KG7A 3KLIB 4KHMA 1IKYA 3DLGB 3FQKA 3CJ3A 5KT6A 2HNZB 2FVSA 1HNIA 1RT2B 5HP1B 3DYAB 4RUAA 4IRCA 3H2LA 3LP0A 3HVAA 5KFIA 4PUOA 1DTTB 3DRSA 1JKHB 1SUQA 4R5PB 5J1EA 4I2PB 3OLBA 1N4LA 1XR5A 2W7PA 4URSA 5KFJA 3H5XA 3KHRA 1N48A 4URQU 3KLEB 5FDLB 3NAIA 5J2PA 2JEJA 4MK8A 2IMWP 4DG1A 3PJXA 4Q0BB 4O4GB 3PW2A 4WE1A 2BQ3A 4KAIA 3DOKB 1BQMB 2B6AA 1Z4UA 2D7SA 2HAIA 2IM3A 3DDKA 5KFHA 3QZ7A 2J6SA 1DLOA 4ED1A 4LQ9A 4RNFA 3H4BA 1S1XB 1N5YA 3IS9B 3KK3B 3T1AA 2B5JA 4NLPA 2ZD1A 2HWHA 2R8KA 1J5OB 3KJVB 1MU2A 4NLYA 4O3NA 4FBTA 2V9WA 1LWCB 5L9XA 3HVWA 3SFUA 4IR9A 3IN5A 4MH8A 5KFVA 2FVRA 5C42A 1T05A 2FJXA 3GIKA 1K1SA 2UUWA 5HBMB 1S1WB 4O3QA 1REVA 1LW2A 3V6HA 3PR4A 2O5DA 2FJVA 4KBIA 1LWEB 1TKTB 2OPQB 3MFHA 3BSOA 2AX0A 3QLHA 4MIAA 4IH7A 4U7CA 5DQGA 1TL3B 2VG5A 3Q8RB 5HLFA 5DLFA 4IH6A 4ZPAA 4IQXA 1SH2A 4NYZA 3PR5B 1S10A 1TL1B 4KKOB 1S6QA 4RUCA 4LSNA 1RT5B 5KG3A 3Q8QB 2JC1A 1I6JA 5KFNA 1S1TA 2IAJB 1RT4B 4PQUB 3PVXA 4RNHA 4IRDA 1C0TB 2IJFA 1JLAA 3KLVA 4GC7A 1GX5A 4O3PA 4EBCA 3KMQA 4O3OA 3DRRB 3LP1A 3V4IA 3GIJA 1C1CB 4DL6A 2R8JA 4JV2A 4O3RA 1RT3B 4MFBA 4RW6A 3H98A 4NCGA 3KHHA 2IC3B 1RAJA 1QE1A 3HVTB 4ZPDA 1IKWA 1JLBB 3TVKA 2OPPA 5HROB 5KFSA 2YKNB 2R8HA 4MK9A 1HQEA 4ID5A 4TYAA 3CJ0A 4IR1A 1R0AB 1FK9A 4I7FB 4ZP8A 5C25B 3ISND 4IFVA 4Y2CA 3FRZA 4HYKA 1S97A 2BANA 3IGVA 1IKXA 1KHWA 2ILYA 1JLCB 1BQNA 4R8UA 3M8QB 4TY8A 1NHVA 3VQSA 2HMIA 4KB7A 4NLOA 4ECWA 3DM2B 1VRUA 3KHLA 1RYRA 4JV0A 1TKXB 4FBUA 3DLEA 2FLNA 1RTDB 2I1RA 2UVVA 5D3GB 2C22A 2AU0A 2OPRA 1ZTWA 3RB6A 4WZQA 4K4YA 4NLTA 3MECA 3QIDA 3T5LA 3MEDA 5JUMA 1RTHB 4WFXA 1RDRA 3M9MB 2RF2A 1HMVA 3NBPA 3T5HA 3CJ4A 5KT4A 3I5CA 2YKMA 1IKVA 3IGNA 2IM0A 4Y2AA 4QWAA 3KLHA 5KFAA 3PW0A 2J6TA 5C24B 4G3IA 5CYQB 3BGRA 3NKYA 3DRPB 1RT6B 4ZVEA 2W9BA 3RBEA 4ZVHA 5DG8A 5F8JA 3QGGA 1HYSA 5T14A 2WONB 3TAMB 3JYTB 3D28A 4ECVA 1EP4A 1NHUA 3FFIA 4Q8EA 1QAIA 2ZE2A 2ZKUA 2D3UA 3QGHA 1RA7A 3RAQA 1FKPB 3DOLB 2ASDA 5KFOA 3HHKA 4GC6A 1OS5A 4H54A 2BE2B 3QIPA 4MIBA 1S9GB 2HNDB 4NLUA 3GIIA 3RAXA 3MEGA 1S9EB 3DI6A 3PJWA 4ZHRB 3DMJB 2GC8A 2HNYB 3KK2B 3MR6A 3BQ2A 4ECYA 3GYNA 2W9CA 2V0NA 2R8IA 5KFEA 4QWBA 1ZETA 4RW7A 4QPXA 1C1BB 1EETB 4IDKB 5I3UA 5KFTA 1DTQB 4J9LA 1JIHA 1RTJA 5KFMA 2C2EA 4H4OA 1SV5B 3BSCA 1RYSA 1IKYB 3CIZA 2OPSA 4ED3A 2WK4A 3M8PA 1HNIB 4B3OA 1RTIA 3LP0B 5J2NA 3GV8B 2AGPA 2J6UA 4PUOB 5KG5A 4QW9A 2WOMA 3DRSB 1SUQB 5J1EB 3OL7A 3M9OB 4ECZA 4DL4A 3JSMA 4IG3A 4IH5A 4ECXA 1VRTA 1HNVA 2YNHA 2WHOA 5J2PB 3MF5A 4DG1B 2IBKA 3KLIA 4WE1B 4YQWA 3BJYA 4J9MA 2B6AB 3MR5A 4ED7A 1T3NA 3EPIA 4TYBA 1DLOB 2XCAA 1RT1A 3CJ2A 3CO9A 3N6NA 2ATLA 4O44A 2C28A 1N5YB 1KHVA 4RU9A 3KK1A 3V6KA 1TVRA 2B5JB 2ZD1B 4XPEA 5KG0A 3G6XA 1MU2B 4ECSA 3ICLA 3UR0A 2E9ZA 2I5JA 4Q44A 2GIRA 4ZPCA 3I0SA 1HQUA 5C42B 2W9AA 5CYMA 1T05B 1S0NA 4IKAA 4F4WA 3G6YA 5F8HA 4O3SA 2R2SA 2QE5A 1REVB 1LW2B 3MR2A 4IOBA 4NLSA 4K4UA 3OLAA 3QO9A 1S1VA 3V81A 2IJNA 4K4WA 5L1JA 4H4MA 4NLQA 2WB4A 4F4ZA 5KG1A 4Q8FA 5K14A 4ICLA 3BQ0A 2VG5B 5HLFB 4I2QA 4RNNA 1JLEA 4Q43A 3G6VA 1JLFA 4FS2A 2FLLA 1FKOA 1S6QB 3E51A 4TXSA 4LSNB 3H5YA 3I5BA 4ED0A 2JC0A 1S1TB 2RKIA 3HKWA 5J2QA 2IM2A 3GV7B 1JLAB 4K4VA 2V4RA 5J2MA 3LP1B 4J9NA 3V6JA 4QW8A 2AWZA 4MFBB 2VG6A 4RW6B 4MK7A 4NCGB 4NLDA 3MR3A 1QE1B 2GIQA 1S1UA 1IKWB 1T03A 4EBEA 3SI8A 2OPPB 5F8MA 4U6PA 5DGBA 5KT3A 4RW4A 4NLWA 4K4TA 1S0MA 4ZMMA 1HQEB 1TKZA 4MKAA 4JUZA 4ID5B 1JLQA 2FVCA 2AQ4A 2CJQA 3N6MA 1WNEA 4IFYA 1N56A 1FK9B 1LW0A 4RZRA 2R2TA 1U09A 4ZVGA 5KFZA 2HWIA 2BANB 1IKXB 1C0UA 3I5AA 2R8GA 1BQNB 4R8UB 4TY8B 4YMEA 3DLKA 1NNDA 2HMIB 2BRLA 5KFRA 5DLGA 1VRUB 3OHBA 4J9SA 1HPZA 2JLEA 5KFWA 3H40A 3DLEB 3H5UA 1RT7A 4LSLB 1D1UA 4KFBA 2OPRB 4IG0A 5KFLA 4DL2A 3EZUA 1S9FA 4PWDA 1JX4A 1JXLA 2YNIA 3MECB 4X2BA 1W25A 2ILZA 5KFBA 3ITHA 3KLFA 4O4RA 5KFKA 4G1QA 3MEDB 5KG6A 4EEYA 3RB3A 1JLGA 2QV6A 4R0EA 4F50A 2W8KA 2RF2B 1HMVB 3NBPB 4EO6A 1UWBA 4JV1A 3LP2A 3E01A 3EPGA 2YKMB 4URGA 1IKVB 3CDUA 2FVPA 5KFFA 4YR2A 3NL0A 3KLHB 3N6LA 3KOAA 5EDWA 4RW8A 1HARA 4KSEB 4HKQA 3OL8A 4DEZA 3BGRB 2W9BB 3I0RA 1HYSB 4MKBA 3PZPA 1S6PA 1EP4B 1QUVA 4Y34A 3CDEA 4XO0A 1S4FA 3FFIB 3IG1A 3BR9A 2ZE2B 4WFYA 3GIMA 3QIPB 1TV6B 1KLMA 3MEGB 4ED6A 3DI6B 3C6UA 3LALA 1N6QA 2B43A 4Q45A 1QAJA 3V6DA 4KO0A 2R2UA 2W9CB 2VG7A 4F4YA 4RW7B 5KT5A 4ZVFA 5EWGA 2IM1A 5L1IA 3MEEA 5I3UB 3KLGA 2ALZA 5JXSA 3KMSA 2YNGA 1D0EA 1RTJB 1TP7A 3LAKA 4H4OB 4KV8A 4WXWA 2W8LA 3C6TA 3BQ1A 4TN2A 3IRXA 1LWFA 2OPSB 5C5JA 4LQ3A 4QWEA 2E9TA 2JEIA 3M8PB 4ZP7A 2HNYA 4B3OB 4TY9A 1RTIB 4K4SA 3PW4A 5I42A 2WOMB 4RW9A 2YNFA 3JSMB 4IG3B 3H59A 4NLVA 5DQIA 1VRTB 3OSNA 3RBDA 2E9RX 1HNVB 2YNHB 4K4XA 4NRUA 4ECQA 3PW5A 5KT2A 5KFXA 5EWFA 2R2RA 3PW7A 3DLGA 4EO8A 2HNZA 1RT2A 5HP1A 3DYAA 2FVQA 3OL9A 5F8NA 1S48A 4TLRA 5KFDA 3OL6A 1RT1B 1DTTA 4ED2A 1JKHA 4R5PA 2BQUA 4I2PA 4O44B 2UVWA 3BSNA 2UVUA 3KK1B 1K1QA 3BSAA 1TVRB 4WXOA 4ZP9A 3KLEA 5L1KA 5FDLA 1SH3A 2DPIA
chains in the Genus database with same CATH superfamily
3NAHA 3SEOA 3M05A 3KUGA 3H42A 1UA0A 3HSGA 5IM0B 4WFZA 3E8OA 4C0OC 2B9EA 1LWCA 1S1VB 3W65A 1ICEB 3MUVP 5HQ8A 4AL5A 4ZKAA 2WCXA 2OFHX 5KG4A 5KG2A 4OI2A 2L08A 4ED8A 3Q89A 5DQHA 1IBKF 4EYIB 4LFAF 1CJVA 3F41A 3BDEA 3UVJB 3OXFA 2IAJA 3RR8A 4RW4B 5K8MA 2OO4A 4DCJB 3C14A 3LGHA 2IC3A 4DR5F 2W2PP 3NGDA 2J8SA 3M2UB 1WC4A 2YH0A 3QYYA 2RDJA 2RUSA 4DMZA 3SCLE 1C2PA 1JLGB 4B3SJ 2ZM6F 1OY6A 1BQXA 3DM2A 4OV6A 4PKDB 2FPHX 4GKKJ 3G86A 2GX8A 2QYGA 2V2ZA 1X4BA 2QIFA 4NZ6A 3EGZA 3MD1A 1RT6A 3TO8A 4WFNQ 3NS6A 1RSCA 1CULA 3B82A 2C3YA 3MM8B 2J76E 3T19A 2DYAA 4YB7A 1PG5B 4WZMA 4A8KA 1SQFA 3DLGB 1NXIA 1RWOB 3H5XA 4OX9J 3NAIA 1IXKA 4LVNP 3PW2A 1NJZA 3DOKB 2EEYA 2J6SA 2IM3A 1SC1B 3DHWC 4P6QA 5L9XA 2JNJA 2FVRA 2MHNA 3GIKA 5HBMB 1HNWJ 2FJVA 4U95A 2RRNA 3KDNA 2VFRA 4U7CA 5HLFA 4IQXA 1TL1B 5A76A 3A3OB 5CD4A 2HHHF 1AZSB 2IJFA 4EWTA 4QPTA 1T9UA 1J2VA 3LP1A 3M30B 2MSTA 5DDPC 5CABA 3ZZPA 2UUBF 1Q81T 3M8RA 1WF2A 1S97A 1JLCB 2IRXA 4DCPB 1OJ4A 5E3QA 1X9SA 4HR2A 2C22A 3VALA 4WZQA 4NLTA 4NA2A 1XMQJ 2J9DE 5H9FK 1KWMA 3G6ES 1KONA 4DU7A 1JJ4A 5KFAA 3PW0A 2MKIA 4CLYA 4LF4F 2MY7A 3A13A 1U1RA 2E1RA 3R7NB 4CM0A 1MN7A 1UAWA 4NLUA 3GIIA 3U1MA 3W60A 3LUYA 2V0NA 3GJQB 1Y3KA 1RCOB 3AT1B 5HQMA 3MDFA 3OQ2A 2C2EA 4A48A 3TNVA 3AAWB 1VQ9S 3ILLA 1S77D 2B4OA 2XM3A 2ZBCA 1R8BA 2KZMA 3US5A 1BXNA 1HHSA 1FNMA 4ZLNA 4A8OA 1SQEA 1ZA2B 1I3OB 4NLSA 4RUHA 5EX3A 1ITPA 4F4ZA 4ICLA 2VG5B 3G6VA 2FLLA 3NNCA 1WKJA 4JI6J 4ED0A 2RKIA 1CBKA 2W2OP 2V4JA 1WC0A 3V6JA 1M90T 2KYXA 2DXDA 4Y6IA 1T03A 1DQ8A 1RGVA 1JNRB 1SI9A 4N5SA 3PIOQ 1LW0A 4K2JA 4C98A 2VHGA 2ZH1A 3FBBA 2CZVC 1I94J 2BJDA 4RNOA 4CLSA 3AOCA 4CDIA 4MJKA 2E1MC 2QV6A 1U25A 2DH9A 4RLEA 1RWKB 2NLWA 3TZWA 1ZM2A 1TKDA 2ZHAA 1IJEB 1Y11A 2GMLA 1H3DA 2J5AA 4DV2F 1LNQA 3HHLA 3NG8A 2FQQB 4LF7F 1DARA 2KHCA 4WXWA 1AA1B 3WQPA 4C3LA 4DS5A 4DPTA 5DS7A 5A6PA 3BBBA 3RTVA 3A1YG 3THTA 1XMBA 2QL9B 1RT2A 2FVQA 1FT8A 4LR9A 1JKHA 5HJYA 3AH6A 3KDOA 3BSAA 1K1QA 3QRQA 2F9JA 2DO0A 3T9ZA 2XCPA 2OSRA 4Y2KA 8AT1B 4DS4A 3KK3A 4I6AA 3QLHB 4KHRA 3QO9B 1PYSB 4X4UA 5EHHA 1S72S 5ETMA 4C4WA 3MM5A 4K4ZA 1U45A 1TL3A 2YKPA 4G1PA 4ANDA 3IM8A 4GRSA 4I67A 2AX1A 3MURP 5HMWA 2GQ2A 2X7IA 1C0TA 2M2BA 2R7WA 2BE7D 5GAEU 2LQ5A 1LQ9A 1HPZB 3W66A 5HJXA 3A8KA 3KLFB 4FPRA 1XQIA 4ZLLA 4DV0J 1TKXA 1LFWA 3KG1A 5KFQA 1Z1ZA 4LIRA 1RKJA 3P4UB 4NYPA 3J81Y 4DR3J 4IRKA 4ECRA 2XBPA 2N7CA 4J9KA 1N32F 1AUSL 2VFSA 4CO0A 1F1BB 3DRPA 3QATA 4V1Ak 2WONA 2FY1A 2WTFA 3K2YA 4FKXA 2AJQA 2CWKA 2YNGB 3ZZZA 3KK2A 3TQ1A 1XIQA 4PXBA 1EKSA 4ZLPA 1EAYC 2CQ1A 4J5OA 4MMOA 1S5ZA 5EGYA 2AZ1A 4EI2A 5J1EA 1SJQA 5KFJA 2DRAA 4MK8A 2BYCA 2RS2A 3DDKA 4W4MA 1AT1B 4NXNJ 3IS9B 1PBAA 2Q79A 1X31C 3EDQB 2VC0A 3ZTQA 4BS2A 4ZVOB 2OLWA 1IUJA 1KBRA 5FLXY 2NCKL 1TKTB 2OPQB 2G4BA 4ZPAA 2B9WA 2OEKA 3RW6A 3M2RB 3C8YA 2JLGA 3GIJA 3V4IA 4UOCA 1C1CB 5E33A 3MAQA 2HFSA 4NX9A 2UUCJ 3PFEA 4B02A 2I2YA 3KJNB 2C2NA 1VLOA 2L9NA 4DZDA 5HN0A 1BQNA 4TY8A 3NCQA 3VAKA 2CXEA 4NLOA 4DV6F 3TEHB 1SVDA 4OZJA 1KOHA 3Q2TC 3QRRA 1HNZJ 2VPZB 2CVEA 3A8IA 4I56A 5C24B 4X66F 1QVFR 2XMTA 4HT5A 2AD9A 5T14A 4ECVA 3HFVA 1OS5A 1PIEA 2YTCA 2DR7A 1C1BB 3TRGA 2W1BA 1V9OA 3HD1A 4LREA 2M88A 3J80U 4DPWA 3NGRA 3LP0B 5BYRA 4WTYA 3OL7A 4ECXA 1FE0A 3PO5A 3OTBA 1VBZA 1AYEA 4N47A 1UVJA 1RT1A 2DNMA 1H7XA 4X4TA 2OMLA 3TAQA 1YJRA 5I3QA 3HHLD 2B56A 3BKUA 2BVZA 1PO6A 2W9AA 1X4AA 2LXIA 3TZZA 4YB1P 4I0WA 1R3NA 3LPYA 1FEHA 3H5YA 4FF4A 1N36J 5ETOA 1X4HA 1JLAB 1U0HB 1NK9A 4OJGA 2ADBA 4W92B 1VHFA 2Y1IA 1VC5A 1IKWB 2QFIA 1YITS 3B8HA 5AXMA 4USWA 2H5IB 1JLQA 4MAKA 2GHWA 3HMJG 4DCOB 5LOQA 1KN6A 3H40A 2DXFA 3J81j 3LGNA 4KFBA 1HI1A 3ZZRA 2C3UA 3G8TA 3MMCA 4W90B 3KXDA 4XDCA 4JYAJ 2YKMB 4AUKA 2CVIA 4ZOSA 4X4VA 3HP6A 5EDWA 2B9YA 1RBAA 3L09A 2OELA 3R6LB 1SB6A 2POKA 3RW7A 2O66A 3NGUA 4LF9J 2VV5A 1R8HA 2ZE2B 3GE9A 5GMDA 5A0YB 5ITHA 4RUBA 3C6UA 2B43A 3Q0AA 4CTAB 3MEEA 5ETTA 4QWEA 1H73A 3RAMA 2YBVA 3CCRS 2QLBB 3AXKA 3KOAA 1M5VC 1LK7A 2DBBA 2N3OA 3OL9A 1VQ6S 4ZVPB 1X5OA 2XY5A 2YKQA 4ZP9A 3UN2A 2QGFB 4Q0BA 2Z2LA 1XNRF 2W4DA 3MTKA 1OYDA 2EFOA 5L1LA 4WYLA 1N52B 9RUBA 2HQ3A 1JLEB 1JLFB 4JI1F 4PRFA 3VGVA 4I68A 1X0PA 4TQRA 3MM7A 4UQTA 2X1FA 5AE3A 3QGIA 5B0EA 1H38A 3O8WA 4ZPBA 2CQPA 2DNNA 3UW1A 1KS2A 2UU9J 1FRXA 2PE8A 4LF5F 1R0AA 5DM6Q 4E8UA 4PWDB 2YNIB 4FF1A 2QLWA 1RJJA 2A2DA 1VQLS 3NP5A 3CW2C 4LBHA 2F3JA 2ZH9A 3GQCA 2Z2ZA 4KGMA 3IG1B 3ILIA 2APOA 3GJRB 4KH1B 1Q5YA 2C1EB 3N5FA 1FRJA 2GIFA 5KT7A 4DQQA 2ROPA 2MLXA 5K5MA 2E5JA 5ETKA 4B3MJ 3RB4A 5F9NA 3D1QA 4NLGA 1QAXA 4FYDA 4FP9A 2KYZA 3BGLA 5HAOA 1SV5A 4F4KA 2HNZB 4JI4F 2R4FA 2V2VA 2SXLA 3UCUP 2OD6A 2W7PA 4URSA 4CLWA 4DR7J 4URQU 3AB2B 3G71S 2HIYA 2B6AA 4P10A 4RNFA 1N5YA 2ZITA 3GFYA 3P45B 2N4CA 3HVWA 5KFVA 3A4TA 5IM0A 2NXEA 2FC8A 3BPSP 3BSOA 1XTZA 1VK8A 1GMVA 3B78A 4RUCA 2HURA 3GCXP 3Q8QB 4F2SA 3C66A 1F9FA 4DN9A 5K8OA 3TOQA 2QFJA 4EBCA 1U1MA 4XDDA 5HROB 2P2CB 2P9CA 2ZOGA 3CJ0A 3FRYA 4IR1A 4BWMA 5C25B 2MGZA 1N5VA 1XWLA 1IKXA 1J5EF 3VHQA 5IFMA 3KHLA 1RYRA 2FLNA 1RTDB 1M1KT 4C0BA 3G82A 3T5LA 3EE3A 3GB0A 3T5HA 2UXDF 2UV8A 3PCOB 2IM0A 2BJ1A 4XK8C 2OIHA 1YTYA 1NHUA 2E7VA 1N0VC 1FDAA 3ET6A 4QU6A 4NCAA 1HHTP 2YH1A 4QWBA 4DUTA 1EETB 2ZOFA 4HTJA 4DV3F 1N54B 2IDLA 2NYHA 2VD3A 1SIWB 1MSWD 3GG1A 2DIUA 5DDOC 4EFAC 1TAUA 1CQNA 2Q3PA 3FBFA 4KGXB 2R7VA 2LU2A 3VAFA 1NKEA 2BABA 3RRHA 1FF2A 1REVB 3MR2A 2PN6A 4C7QA 2WB4A 4Q8FA 5K14A 2WVCA 4JI2F 4AD6A 4N8OA 3F56A 3HKWA 3GV7B 2IDEA 3H8YA 3CXCR 4MK7A 1X5PA 2R7SA 4OZ3A 2CNOB 1RWPB 1R8AA 5F8MA 4NCBA 2BA9A 4ZMMA 2Z2YB 5KFZA 3H25A 3FGVA 5JVGQ 2CQ3A 1HNXF 2CPIA 3NS7B 3AJDA 4IG0A 2G1DA 4DR6J 3BO4A 5KFBA 4G1QA 2AEJA 5LMNJ 3FSYA 2V8HA 4P74A 3CMQA 4X65F 2XS5A 2ZC3A 1N33F 2G2YA 3PZPA 3PXGa 1EP4B 1YLXA 2BKOA 4ANCA 1KLMA 1L3SA 3V6DA 3GU0A 1RAEB 4F0MA 4F8RA 2W2NP 3OR2B 1UWAA 2JEIA 1IQTA 3JQKA 4F67A 1EIYB 3JQMA 3JSMB 2HKEA 3QGPA 2D74B 2P6SA 2LA4A 3C15A 5HP1A 1JNZB 1Z2ZA 4HLBA 3NY0A 1WSRA 1DTTA 2IMOA 3DDNA 4DX8H 3CIMA 4Z7YA 1QTNB 2RIJA 3M6XA 4ZN3A 3I0SB 1D8ZA 3HSDA 4RX6A 2MQPA 1Y7PA 2FIUA 3EUNA 5D4OA 3OTOF 2RDIA 4KE5A 4A8FA 2ZZTA 2M4MA 2MZTA 4LFBJ 3BO2A 3U1LA 4DQSA 1WHXA 2HS3A 3B6BA 1V5VA 2LA6A 4PQUA 4LRAA 2JEFA 3HHEA 3NS5A 5F0WA 2Z56B 3LW5C 1C0UB 2C2RA 2GCFA 4NRTA 4WYWA 4QIEA 3M8QA 1FDBA 4RWWA 1TK5A 4K5SA 5AT1B 1VK3A 2F9DA 2XMWA 1CLFA 3KNAA 4CQ1A 5GAHU 3CJKA 3MMBB 3NGKA 1VYAA 1YJVA 4NZ0A 4HDHA 4WPAA 3W2WB 2B7CB 2DVIA 2CQIA 2GQCA 3DOMB 5B0BA 2AJ0A 3ONQA 3GILA 2CPHA 1NPRA 2K06A 3CCMS 3T5KA 1EHWA 1UFLA 3KLIB 2MKCA 3V2UC 2IJRA 2FVSA 3H2LA 2YVSA 4DPYA 1QSYA 3I56S 1R27B 4DI6A 2IMWP 4DG1A 1HBNB 2D7SA 5IT0A 3U1NA 2HBRB 4OYWA 1FD2A 3DDIA 2X1GA 1MU2A 1QSSA 1M5KC 3D1OA 2GAHC 3UNGC 3NOGA 3NWGA 1P8GA 1LWEB 1WWHA 1ZM4A 3QLHA 4ZVTB 4YDXA 1U8SA 2DY1A 1NBEB 2NQPA 4IRDA 3MM9B 1VBYA 2BJ9A 1YJUA 3SSRA 4DR1J 4K0KF 2OPPA 2HPUA 2LYVA 2HYIB 3OTEA 1FK9A 4FNHA 1OO0B 4JV5J 3PJ9A 3MTJA 1GQEA 1WTFA 2AU0A 3RB6A 1CJUA 2QA4S 4H4KA 1I5OB 3M9MB 4OJ3A 4JI8F 1O6XA 1HWUA 2Z2MA 1FWLA 5ETVA 2K7JA 1S79A 4G3IA 1KFDA 1HYSA 3HVRA 1K44A 4C2MA 3TAMB 2RRAA 3RAQA 4H54A 2HNDB 1TU0B 3DI6A 1IN0A 2Y1JA 4ECYA 4FYVB 1ZETA 2MLYA 1H2VZ 1O0PA 1JIHA 2JH3A 2VQEJ 4ED3A 3FJ2A 5HVFA 1NSQA 3OT9A 1IJFB 3P5TL 1WG4A 1T9WA 4QR0A 3FMWA 1UEVA 4R0JA 4DHVA 3EXCX 5GAEI 3ICLA 1IBMJ 5HMXA 4AFFA 4RJVA 1WG1A 1S0NA 1MNEA 2H65B 4NA1A 2KRRA 1F0XA 3EGNA 2VJVA 2WW4A 2ROGA 2KG0A 4ILMA 4PQAA 3X3UA 2FHJA 2MZSA 3K8VA 3HM9A 3AA8A 1QE1B 2GIQA 1GMUA 4PWUA 1U2CA 4NOHA 2OGUA 5KT3A 4JUZA 5HK4A 4CO5A 2DB1A 3HSJA 2CQCA 4LUBA 3W63A 1PCAA 4KT0C 4Q2MA 1OYEA 3G87A 3VWSA 2ZUAA 4DL2A 1IBLJ 2PFFB 4EEYA 3RB3A 5GADU 1GXUA 1U2RA 4JV1A 4EO6A 1UWBA 3LP2A 2ZH8A 2DGOA 2HLUA 4MTPA 1NMEB 1N34J 2VKRA 2DISA 1S4FA 3BR9A 3OJSA 3QT5A 3QIPB 4A8XA 2R9LA 3F44A 3RBXA 4KO0A 1M1GA 4AYBD 2HHWA 3UNYA 2QZ8A 4H4OB 4KV8A 1M5HA 1YBTA 4TN2A 5KTQA 2E9TA 2XZDB 3PW4A 3RBDA 2BW7A 2EWHA 5KT2A 1BD6A 3DYAA 5F8NA 3DXBA 2MKSA 1EB0A 4KYZA 2DGTA 5IT9Y 4WXOA 1RWWB 2GGPB 1WC6A 4NLRA 4C11A 1S1XA 2BXJA 3VQTA 3T1HJ 1F9EB 3UDVA 2HFNA 3R1HA 2ASJA 4I2QB 2V63A 3CJ8A 2FJWA 2M70A 5J2MB 2YWFA 3PHEA 3WX8A 4WIIA 2VG6B 1G6BA 3FDSA 2VB6A 3PX4A 3JSBA 5F8IA 2B9XA 4OL8A 3SQGB 1T0TV 1TKZB 2DXEA 1SKUB 1XR6A 1Q8KA 1JLBA 1UCNA 3RRKA 4M5NA 4JI3F 4USIA 4CCHA 4M5DA 2XGPA 1U1OA 2ZZMA 2KZZA 2DO4A 4CLFA 1SC4B 4B3RF 2VZ9A 4D3GA 1PYOB 2E1AA 1SKWA 1T3OA 3LANA 3SCIE 3HO1A 4J37A 3ZXWA 3I87A 1PILA 1N6QB 1HKAA 1FFSB 5KOXA 1Y10A 3M8ZA 5K8PA 1S9GA 1S9EA 3IAS9 2NS1B 2KHDA 5EUHA 2HHSA 4OX8A 2XI3A 4RNMA 4RW9B 2YNFB 2C2MB 3ILJA 3MM6A 2X3GA 2V67A 2DJWA 4CM2A 3BH6B 3CCSS 3BKTA 3KLEB 2XYPB 1B4SA 5D4LA 5LJ3Y 4KAIA 2HAIA 1UEUA 2AT1B 4ED1A 2WSFC 3GJTB 3MI7X 2V5HG 3HF5A 1LWCB 2D1CA 2MXYA 2XS2A 2EBEA 4LFCJ 1GEHA 2U1AA 4OYPA 2MQNA 1LW2A 2V8VA 3M1VA 2DNHA 4IO1A 3Q8RB 2DGXA 5DLFA 2MB0B 1KP6A 2A1BA 2R42A 4MYUA 2IAJB 1HWIA 4AL7A 4DV7F 5HVGA 1WUUA 4O3RA 2IC3B 3TZXA 1Q16B 2HQIA 4MK9A 1SJ1A 1NCLA 1LXJA 2CQBA 1A7GE 3BYPA 4KB7A 2D3OR 3ETMA 5LT5A 3DM2B 3ISZA 3ZZTA 1VLYA 3HT0A 4P9SA 1Q7LB 3VZHA 4OI0A 4B9NA 5AXLA 3KYLA 5HANA 2RF2A 1HMVA 3NBPA 5KT4A 2HQCA 5JMNA 2FHJD 4NEYA 4Y2AA 2FJAB 1FRLA 1WI8A 2I6WA 2YQ0A 1RT6B 1Q5VA 2IVYA 4DBQA 5DG8A 1MN9A 5HL7Q 2FJDB 2BJ7A 1EJ7L 2IVMA 3CE8A 1CULB 2DITA 2R8IA 2W01A 1X5TA 2VH7A 5I3UA 3WZ0A 3OFEA 3C19A 1S76D 1RI7A 2XZWA 1Y4ZB 3M9OB 1RWUA 2RQMA 2PC6A 1X4CA 1H74A 4F3MA 3CO9A 3KK1A 1Y9OA 4DV5F 2AYEA 3GR1A 4ZPCA 4FYXB 1HQUA 1FE4A 3MUMP 4MYTA 5IOLA 1OWXA 2KFNA 4IOBA 1HL6A 1D8YA 4ZPWR 2Q1LA 1SL0A 3FCWA 3GJSB 5HLFB 2HVEA 3SXLA 2VJUA 4I6WA 4QR1A 1DZ5A 2AYBA 1M5SA 1XNQJ 4B08A 3LP1B 4CO1A 2J7WA 1SKSA 4GO7X 4ZVGA 4PYAA 5U47A 2DEIA 2HEKA 2W4PA 2ZEJA 2W25A 1RUSA 4HI1A 1N88A 4M1KA 3N9UC 1WOSA 2ILZA 3ITHA 1WDDA 4Z37A 5KG6A 1VQPS 3WC0A 1HW8A 2W8KA 2A3JA 3MPUB 3CCJS 5KFFA 2VKZG 2F4VJ 1HARA 1D9AA 2PIIA 4DEZA 4DJBA 3CD6S 2J9DA 4MKBA 2UUAJ 4E98A 2CJKA 3UCGA 3UFCX 5CYJA 4LF6F 4Y34A 3CDEA 3GIMA 1VQOS 4ZK7M 2D3O1 4CZCA 1SC6A 2ZJPQ 3R8YA 3W64A 2YQ1A 3TA0A 4OYIA 3KLGA 4A8QA 3IRXA 2IY5B 5C5JA 1NKCA 2CQ0A 1WEXA 4TY9A 1DQAA 3LO3A 5EWFA 4EO8A 2ZDOA 5KFDA 2CA9A 5A8WA 1U49A 5FDLA 2QC3A 4O4GA 4UW2A 3HJVA 3SMZA 1BQMA 1YJ7A 1T9TA 3MPYA 4FS1A 2G2OA 4C8KA 3L7UA 5KAKA 2Z4PA 1UW9A 2KXFA 1FRHA 5DDRC 4ICLB 5BR8J 3D6FB 2L41A 1TK0A 4CT9A 2ZDPA 2RKIB 1I1GA 2XC9A 2V4JB 2UUCF 4ERDA 3M9NB 2FHMA 2ADCA 3OSPA 1T03B 3G2XA 4PXEA 3J7A1 4DV1F 1WC3A 3ZNJ1 2N7YA 1LW0B 2BUNA 2FLPA 4HACA 3MGJA 2WW8A 4A46A 1DAXA 4ZS6A 2VF3A 1V6HA 1S6OA 3KG0A 2BACA 5ETQA 2ZZNA 5LSOA 4C9DA 4OYOA 2ZBIA 3FSIA 1TK8A 1FHTA 3HHLB 1S0OA 3OHAA 3JQJA 4J9PA 4OI6A 2CZ9A 4Y65A 2QEXS 2OUGA 4LVOP 3H2VE 1MWYA 2QA1A 4ZCMA 1NH8A 2W7OA 1YX2A 5C7PA 2BMBA 3FCVA 3S6EA 4LF1A 4B9MA 3CJ5A 1DTQA 3PRDA 4UY8T 1HNIA 1RT2B 4W98A 4DPXA 1JKHB 4PZVA 3P3DA 3QSYB 3ETOA 1SL2A 1H7WA 1K0VA 3KK3B 3T1AA 2B5JA 2R8KA 2KDOA 5C42A 4PG5A 3MM5B 4I1TA 5CA5A 4DR2F 4DOZA 2A2CA 4MIAA 4IH7A 2HIQA 3R27A 3M8SA 1KOOA 1TL3B 4NEZA 2CRLA 2HFZA 3TARA 3A8EA 1C0TB 8ATCB 3CB4A 1XMOF 4NCGA 1RABB 3TVKA 2X3DA 4FVCA 3M8YA 4DPOA 4Y2CA 3MAAA 1RZMA 2E7WA 2E5HA 1TELA 3K5PA 1UTAA 1W7WA 1TKXB 2M52A 3UDEA 1RBLA 3MECA 3QIDA 4L73A 2K1RA 4A8MP 2ZNZA 3V5RA 1NDKA 2FC9A 3IGNA 1NK0A 2XG8A 1JJHA 1YZ7A 2J6TA 1CJTA 2R7OA 3DRPB 3QGGA 2Y0SD 2WONB 3PACA 3OJUA 2ASDA 5FIIA 3MMBA 4FPIA 5KFOA 4Q7AA 1UEKA 1E6YA 2QTWA 1KEKA 2BBEA 2F8MA 1H6KX 2HNYB 3KK2B 3IWLA 3GYNA 1UVNA 3D66A 1PJ6A 3QQCD 2PSZA 4B9SA 3H0PA 5B0AA 2B4PA 5J1EB 1FI4A 1VRTA 2YNHA 3MF5A 3KLIA 3OBIA 4NASA 1X8DA 1KR4A 3DHXA 3LPEA 2JVOA 4AQYF 1GXTA 4F4WA 3SSQA 4NLQA 3UN5A 5KG1A 2HQGA 1KC8T 2GV1A 4FF2A 3E51A 3FKBA 2K8GA 3PG9A 2OAUA 2CQ4A 2V4RA 3KJQB 3OVBA 1QTMA 1DQ9A 1EX8A 1IBKJ 4LFAJ 3ZNUA 1NH7A 2CPJA 2GVZA 2BJ3A 1GNKA 1V5IB 2AQ4A 2FVCA 1FRMA 3Q22A 1R8PA 2LQBA 1YRUA 2DGWA 1BQNB 4TY8B 1UPPA 4DR5J 2FY8A 1TL5A 4LSLB 3W5YA 1JXLA 4KH0B 2G0IA 2HHTA 4MT1A 6AT1B 2ZM6J 3UWTA 3TUPA 2Y9HA 1MROA 3HLUA 2V2QA 4OI3A 2BX6A 1B0TA 3NCPA 2RHQB 2A18A 2VPYB 4B3MF 5T41A 5L38A 2FGCA 1C4CA 3RRGA 3W9IA 4LF8F 4ED6A 3LALA 5GAGU 2NXCA 3R7SB 5KT5A 4ZVFA 3H7HB 2Y0BB 2ALZA 2DR8A 1TP7A 3C6TA 4AE5A 2E29A 2IRUA 1LWFA 4LQ3A 3J81U 4DV4F 3LWLA 2AYMA 2E5IA 5BYSA 5HO4A 5IQQA 2WSCC 3OL6A 1RT1B 1NM2A 1F5CA 2UVUA 5L1KA 2DPIA 2RD5C 2ZWOA 3TX0A 1UJ5A 3J7YU 1TMJA 1J5OA 1Q78A 3DLJA 1HR0F 4FF3A 3OUYA 4FXDA 1JJCB 2KB2A 3UO0A 1LOUA 2NPFA 4OHVA 3OVAA 4I4BA 4UUXA 2IYGA 4N7TA 2WAQD 2UXCF 4M5KA 3M6UA 3RYLA 3RZAA 4HHHA 4QWDA 2HHHJ 2QLJB 1JLQB 5B0FA 1WACA 2QSWA 1UJ4A 2D69A 3EGWB 3HVTA 2ZFHA 4DLEA 2YKNA 4PCQA 5KFGA 5FLXU 4KFBB 4I7FA 4LSZB 1UA1A 2QX0A 2UUBJ 5E7OB 3MMCB 3RGIA 1FKAF 3QZ8A 2RJZA 3J80Y 1RXOB 3BO3A 3MCNA 4ZP6A 2ZJQQ 3QJPA 2PO4A 1DRZA 2VONA 3BKFA 3VVTA 4BHQA 1U2FA 5HSPA 2PA3A 2CJAA 3C6UB 4USJC 5DG7A 2KJVA 4OZ5A 4LF4J 1P9QC 3MEEB 2LMIA 4M94A 3S7RA 4EK2A 1LWXA 1ZAWA 1BMQB 4QYZJ 2E44A 1PJ7A 3HCXA 2YKAA 2XWYA 2J7UA 1URNA 5KG7A 2F65A 2AEMA 3O44A 3AXMA 2V8PA 4DX5A 4F26A 1YGYA 4UQGA 4YY3F 2NR0A 1N48A 1FD8A 4X4RA 4Q0BB 3CNQP 4F7VA 5KFHA 4CO2A 2O01C 1PSDA 3CCLS 2DGQA 2DK2A 2V69A 1NK7A 1H72C 2BM0A 2JZ5A 3SFUA 2KM8C 3NCRA 4HTIA 3K5LA 2FJXA 3VTIA 2RVJA 1D9FA 5GADI 5H9EK 1IWAA 4P72A 2HLTA 3MM7B 2VQFF 3GYGA 1S6QA 4UZCA 4JB8B 4LF2A 1B0PA 4WP9A 1LXNA 4DFMA 4RW6A 2MQQA 3JSRA 5B0DA 1WDTA 1R0AB 1X4DA 2EK6A 5CXTA 1AB8A 1PAEX 2K3IA 3D4JA 2BKPA 4ECWA 4WU2A 1VRUA 3QAUA 3DLEA 4DU8A 2OPRA 1AXQA 3MEDA 1U6BA 4QIVA 1HBUA 3HI9A 5E5NA 1ZOTA 2PEHA 1W2IA 2CG4A 3GWCA 3ZO7A 1RK8A 3LOUA 1RP5A 3RU0A 3NMRA 2OEMA 3FFIA 2XLKA 2YPYA 4ZIVA 2DH7A 3KNGA 5ETLA 5B08A 5EN1A 4DV2J 5KFEA 4DL0C 2AJ1A 1RTJA 1SV5B 2WB1D 1CC8A 4LF7J 2WK4A 2VFUA 4WIQA 2AGPA 2J6UA 3BBFA 1HNVA 1R43A 1RAOA 3K8WA 2B6AB 1O8BA 4CH7A 4DR4F 1GT8A 1U1NA 1N5YB 1KHVA 3CC4S 1TVRA 2HGMA 1RAFB 2EFGA 3Q8UA 4CYUB 3L4BC 2HK2A 4DUYF 1DBDA 2R2SA 4C3KA 1NZAA 1QM9A 4H4MA 3MMAA 4CI0B 1UP1A 3D6TB 2QLXA 1R31A 1F60B 1YG0A 4F2RA 2M5YA 4U6PA 4XAKA 1S0VA 2CPDA 2MGZB 3TI0A 2HWIA 1IKXB 3GSIA 3OHBA 1NNDA 5KFRA 4LRFA 1D1UA 2G0JA 1TUWA 4O4RA 3G82B 4NZ7A 2X51A 5HI7A 2GMJA 2XLJA 1U48A 2MLZA 1I51B 3I0RA 1S6PA 1F5AA 3R2DJ 3P6YC 1UETA 3TP2A 5A2QU 1N32J 3A8JA 4NE9C 4QOTA 2QO3A 3ET6B 2R2UA 1UVLA 1WF0A 3MPWA 1FTRA 5L1IA 4WP3A 3IBWA 4B3TF 4WFAQ 5KFXA 3BR8A 1CS4A 4TLRA 4OYAA 3TJ9A 4I2PA 2DGVA 5D78A 2UXBF 1GX6A 2LEPA 3AY0A 4DUZF 3T6BA 3B4MA 1N5SA 2KI2A 3I9V9 3R5CA 1U1KA 2E1PA 1HBMA 1MWQA 2P9EA 5ADZA 3ZFVA 5K14B 1S1WA 5DM7Q 5B0CA 3J7AN 2KN4A 3R5AA 3FSXA 4FZVA 2PEBA 2RHSB 2LU1A 5H1SV 1S49A 4M5IA 2PMZD 2ACMA 3ENAA 3DGPA 3FMBA 3QFHA 1KQGB 1TFWA 4IG0B 1YBAA 4G1QB 1HBOA 3P8BB 2J0QD 3SCJE 1FJGF 1FEEA 4K50A 4DV6J 2CFXA 1ZH5A 1ZTTA 4S0MA 1U4BA 1VFJA 5HATA 2GQQA 1RAGB 2RUGA 1KLMB 2DRDA 5L8RC 4C8LA 4X66J 3V6DB 2JFKA 2BEFA 3TVYA 1RCXB 2BR0A 1T11A 2BE2A 1K73T 3M6WA 4ECUA 2FUG9 2DHGA 3TAPA 3BREA 4YDDB 1VQKS 3C15B 3POTA 5HP1B 3PRVA 3EX7B 2XNRA 1JWWA 1NSKL 3A12A 4PUOA 1DTTB 3O3LA 1SUQA 1XR5A 4OI1A 2NREA 3IR6B 1HIYA 5CHCB 2L48A 1DLOA 3H4BA 5CZXA 4FBTA 4C8MA 4M5JA 5GMEA 1AUDA 4F36A 5JJBA 2CPFA 4EZ6A 4JI5F 5LXRA 4IH6A 3VGSA 1Q82T 4QYRA 4FXVA 5CCMA 5KFNA 1S1TA 2CIMA 4PQUB 1RU1A 4GC7A 1NDLA 2RH3A 2G0CA 1RAJA 4UTGA 1Q1KA 4YHHF 3IBCB 4OQJA 1UFWA 4TU8A 1MMDA 3M8QB 2F5GA 2KG1A 2Q6BA 3QT8A 1N5QA 4LRCA 4RPFA 3M8WA 2R7RA 3CJRA 3SV3A 3D9BA 3I5CA 2A6OA 1LK5A 3CJKB 1F2HA 2VFTA 3BGRA 3RBEA 3SDEA 1ZM9A 1G3OA 2CPEA 2M8DB 1LKZA 2KT5A 2W2QP 4QQBA 5AJ3F 4MIBA 4RBTA 2BW2A 2Z0GA 4YS2A 2Z58B 1B3TA 2HW3A 2VFVA 1K9MT 1XEZA 3BSCA 5A8RA 1RYSA 3K5NA 3CIZA 4WFBQ 3T1YF 2EPIA 4U8YA 4DG1B 2R7QA 1SPBP 2C28A 1WC5A 1MU2B 4Q44A 4F04B 1P9YA 4IKAA 4M5HA 3ENWA 1F9HA 3N4WA 1XNRJ 4K4UA 2B4VA 4NXMF 3V81A 4WCEQ 1HWLA 2BKNA 4RNNA 4Q43A 4FS2A 1R7IA 1ZAVA 4TXSA 4ZJOA 3I5BA 1YWXA 4JI1J 5J2QA 2J0SD 2H9ZA 3G9CA 2XTJP 1NB2A 4NLDA 2OPPB 2YXLA 1WSVA 1WJ9A 1FK9B 2MDAA 4OZ2A 3BB5A 4K8RA 5DLGA 3DLKA 3VCDA 2BRLA 4CNZA 1BHNA 1F6TA 1ZA1B 1RT7A 3UR3C 1CJUB 3S1TA 1S9FA 3HKZD 1W25A 1HWKA 1TFYA 4DQRA 4LF5J 2A10A 5LMUF 2HRTA 2I8EA 4HKQA 1HYSB 2C3OA 1Q86T 2KVQE 1FO1A 4WFYA 4OFZA 3AJ1A 3DI6B 2HBYB 2HNYA 4FVMA 2HRYA 2EW9A 4NLVA 2CPYA 2E9RX 5DQIA 3WIUA 4QBUA 1KVJA 1A6LA 3DC2A 4JI4J 2AF6A 4PEOA 2JFDA 1VQ4S 4PR6A 1YJ9S 3ZTOA 2WZ1A 4FN5A 4OZ1A 2B51A 5KFYA 3KJVA 2MEWA 1BGXT 2VL1A 1SJ4P 2FJEB 1CG2A 1E6VA 4M95A 2Y1LB 1X9WA 4P73A 3JSYA 2R7TA 3K59A 3GFHA 4RKUC 2XGQA 2Z30B 4DPUA 1VQNS 3OW2R 3A3NB 2BJ8A 3PFOA 2EI5A 1SJRA 2FGOA 4DXLA 4J9VA 3D6HB 5KOWA 2GJFA 5KFPA 1YJWS 1NZ8A 5AXKA 4AT1B 5KFCA 2EFPA 1UWBB 3LP2B 2DHHA 4U7UK 1J5EJ 3ISNC 4LSLA 3OFGA 1VC0A 3BF4A 4KHPF 1RTHA 3CCTA 1Q8LA 1UJ6A 4C8OA 3H4DA 4HHJA 2UXDJ 1VDHA 2RE1A 3BPDA 2OI2A 5CYQA 3THPA 4KO0B 3MWBA 4GKJF 2D9OA 3IR7B 4KV8B 4JI7F 4TQSA 4ATNA 2EC0A 3LWMA 1RWNB 3TZYA 1TUGB 3JS9A 4IDKA 4TNOA 1IKYA 4DV3J 3DYAB 5KFIA 4E0DA 1NK5A 3DRSA 2DY9A 2QT7A 1UVKA 2AP6A 5DJBA 5J2PA 3P96A 1QDUB 2C42A 4C11B 2NZCA 3N01A 3R5GA 1FDNA 1S1XB 4J7CA 4RBUA 3HHNB 4P2FA 3GONA 1R0CB 2AIRB 1K1SA 2FHKA 2GMHA 1F5BA 3QWPA 3OD2A 4DFKA 3JTOA 2V50A 2BZ2A 4JI2J 5E0OA 4YB5A 1AFIA 4RNHA 1T7PA 1Q53A 2JHEA 5F3ZA 5IWAF 4MFBA 3TA2A 1JLBB 3D2WA 3FNNA 5GAGI 1CJKA 4M5DB 4Y2MA 3IGVA 1KHWA 2WSEC 2ZC4A 5M2UA 3IWNC 2J9CA 4JV0A 1BE4A 4WF9Q 1HNXJ 4M8LA 3VGUA 4QR2A 2IA0A 2MSSA 4TU7A 4RL1A 1IKVA 2KM8B 1VR6A 4F0HA 3Q8VA 1LFPA 1TL7B 2FB0A 3PM9A 4X65J 2HZVA 2W9BA 1TTHB 3WHIA 4NMLA 1N33J 1AROP 1Y5LB 2QN6B 1S9GB 3MEGA 2OKQA 4OLPA 1S9EB 4L76A 2CG8A 2Y1RI 2DEJA 2EG1A 2MJNA 4QIFA 3MM6B 2XYHB 1NJIT 4CH0S 3M8PA 1IR2A 1RTIA 5KG5A 4ECZA 2JWNA 2MZQA 4IG3A 3DU6A 2JRSA 2WHOA 3QPIA 5DRKA 1T95A 2GVDA 3EWGA 4J9MA 1SCJB 2XB2D 3N6NA 2HK3A 1U6FA 7FD1A 2Y8YA 2EK1A 1LW2B 2OTJS 3M1VB 2AW0A 4B9TA 2HHPA 3KG4A 3TX8A 2GW8A 2OD4A 4CIOA 3OTOJ 5IT9U 3RG6A 2JVRA 2IPOB 1NK4A 3KJFB 2KXHA 2H4YB 1WNEA 1N56A 4RZRA 2KVIA 5C2CA 2R8GA 1RB0A 2PI5A 4PABA 2EFNA 2M3DA 1NK6A 2HBZB 3D7SB 4OJHA 1WTBA 2RF2B 1HMVB 3NBPB 2LQJA 4URGA 3EVMA 3CDUA 1RE1B 4JI0J 5F41A 2CUYA 3D68A 1WG5A 2ZH5A 4UY85 2YKOA 3CJTA 3K5OA 2F63A 4NI2A 3PKYA 1YSJA 2XEXA 1NSAA 1HFEL 3HK2A 2VG7A 2JJ4D 5I3UB 4ILRA 1JB0C 2YQ3A 2W8LA 3EZOA 1M1HA 4L72B 4ANEA 3NNAA 1MG7A 1Q79A 4CP5A 1HQ2A 1S48A 2BQUA 3KKFA 3KK1B 4X62F 2CQ2A 2HFUA 2N82B 1HQUB 1FFWB 1WKLA 4J9QA 3R5JB 1WEYA 4Y3CA 3MHYA 2PA8D 4MKVA 2OH2A 4C97A 4CYUA 5D15A 1BLUA 5E3CA 3VZIA 1S57A 2LQ9A 4Y2IA 3Q8PB 2HHVA 1DHMA 3EYZA 4KKOA 1RT5A 1S59A 3G4SS 2RT3A 2OP5A 2XULA 2NYIA 2BE9B 2BOPA 3DRRA 2VBZA 1OIAA 2XYGB 3D5MA 1YZ6A 2EBGA 2D3ZA 4OZ0A 4K0KJ 2HBQB 4EYHB 3ITHB 2O1PA 3GP9A 4BC7A 1B7FA 5D3GA 4DN0A 1HI8A 2ATCB 2QL5B 1ZPWX 4ENOA 3K7RA 4JI8J 4A8WA 3TJ8A 4V19J 5C2GA 4N77A 3LF0A 3CF5Q 1ZZFA 4EMDA 4L3NA 3HZEA 1FKPA 3DOLA 4WTOB 3N5BA 3KLGB 3LAMA 2ASLA 1HD1A 3IRXB 1GFWB 4CLLA 1KQSR 4EGLA 3R7BB 3W2VA 5CAAA 1NAQA 2DCLA 3C2PA 1FCAA 3W5ZA 4EU0A 1SL1A 3C16A 4C8NA 1T9VA 2DNQA 4IRCA 4WWSA 1N4LA 5A8WB 3AFGA 5FDLB 4ED5A 5FD1A 4O4GB 4Q2LA 2A6MA 1QUPA 1BQMB 3EZ5A 5IC6B 1GXLA 1U24A 2GJ2A 5G0RB 2F1FA 4MH8A 3M6VA 3B4DA 2V2KA 2UUWA 1T9YA 1G7CB 2O5DA 1FNOA 4KRWA 3F0NA 5M2RA 3VAMA 1NRKA 5IT4A 4CNYA 3E3XA 1GX5A 3KMQA 4O3PA 1U1PA 4O3OA 3SIPB 2DNYA 1FDDA 4ZPDA 4OX6A 4BC9A 4HACB 4ID5A 2VIHA 2XMJA 3A3PB 3CD5A 2HMIA 4X4OA 2QSFA 1G2EA 1WHWA 2HVIA 4NWBA 2IIHA 4YUDA 3CJ4A 1PC5A 3DRXA 5BJRA 4DSEA 2KU7A 3TANA 4XIUA 4P7TA 3D3BJ 2MKHA 3MUTP 2ZHOA 3QGHA 2QA4G 2W9CA 1TL4A 1XJWB 1V3ZA 3IFEA 1DTQB 3T9NA 1HNIB 2WOMA 1JJ2R 4C8ZA 2AJFE 4I6YA 5ETNA 4G6VB 3TR5A 3MR5A 1QAYA 1FTCA 3CJ2A 1NJXA 2XS7A 4O44A 2B5JB 3RR7A 2H54B 2E9ZA 2I5JA 2QL7B 4K2XA 5C42B 5E3RA 3G6YA 3O1LA 3BM7A 2KTQA 5E3PA 5L1JA 1Q8BA 3HHDA 2FTRA 1FKOA 4EUVA 1YQHA 1RLCL 1T02A 2LFVA 1UL3A 2IM2A 3VAJA 4K4VA 2C2KB 3DKDA 1B64A 4UOGA 2AWZA 4NCGB 1N0UA 1S1UA 3QWUA 4UUWA 1BUXA 4BDPA 4ZCKA 3VAIA 1Q7YT 2R2TA 3MAAB 1VIXA 2F4FA 1ZAXA 3TUZC 1S7IA 3MECB 2GHPA 4JI3J 2K1RB 2JX2A 5H9FJ 3EPGA 2VPWB 1HD0A 3NL0A 3N6LA 3W9HA 4ZVSB 4X4QA 1CJTB 3VVUA 3B54A 4B3RJ 1WORA 4V19X 3BGUA 4CT8A 1E6YB 2Y8WA 4LIWA 5D6GA 2PMWA 1WOOA 1D0EA 1KQKA 2NPIA 2XSJA 3W61A 3MD3A 2CJ9A 4F25A 5MLCV 1VRTB 2HGLA 2YNHB 4NRUA 4F3QA 3UCZP 4HEA9 4IOCQ 2RB7A 3IC1A 2B0GA 2UVWA 2JEGA 1PAUB 3I31A 3MMJA 4K59A 2ZNYA 4OHYA 3CVKA 1U02A 3HT3A 4DSFA 1TQLA 3D3CJ 1RA6A 4G65A 2XI2A 5SUHA 3Q8SB 2M7SA 4A8SA 3VV2B 2AKWB 2GVZB 3CD0A 3TQEA 4DL5A 3OFFA 4IFVB 3QFWA 1RT3A 4X64F 3SFGA 4DV7J 3W1YC 4UOFA 3D1HA 2UVRA 2H51B 4TU9A 2IA6A 5CD4H 2HQFA 2HG4A 1O51A 2ZHBA 3AA9A 2F8HA 2YX7A 3PYDA 3PYFA 2W24A 2AZ3A 4J9RA 1MROB 3AJ2A 3HULA 1DY3A 4USMA 3M7VA 2E5LF 3O5TB 4HT7A 4DSLA 4HL9A 3UDCA 3JYTA 1NDPA 3R9LA 2AGQA 2VA3A 3THVA 3C6TB 1LWFB 4U7UD 5J2NB 1CC7A 2RU9A 2YX4A 4A4JA 1ZBTA 3C3LA 1MLAA 5A8KA 1NK8A 1VQMS 3KHRA 5IC4B 2BQ3A 4WE1A 4F02A 2CQDA 4DDFA 5J1NA 2Q6CA 4P71A 2CNNB 2ZD1A 4YB6A 1J5OB 2I0XA 1Y5NB 4IUFA 1K47A 4DV5J 3OUYB 4PG8A 2Z8QA 3V6HA 3PR4A 4KBIA 1SH2A 4PG4A 3DLHA 2LDIA 2ZKTA 1I6JA 4KGKA 2OSQA 3PVXA 2MKKA 1NJWA 1S7HA 3KHHA 2EKYA 3HVTB 4YN3B 2YKNB 2OEJA 2X1BA 1SIZA 1KDNA 1HQEA 3J7ZT 2GA7A 4I7FB 4B3SF 4J9UE 2BANA 1FXLA 4R8UA 4I69A 4DF8A 1NHVA 1FRIA 1KTQA 4FBUA 4GKKF 3MCSA 1ZTWA 3KUEA 4OHXA 3ELHA 2XZTB 1YBUA 2CDQA 2ZJRQ 4IOAQ 3EVWA 4LRDA 4CLKA 3CMAS 3NKYA 4ZVEA 3QRPA 1KTVA 2HZAA 3GR0A 2F40A 1NPKA 4LF6J 3RAXA 1D9DA 4I64A 4FYWB 3QSIA 2K7KA 2V6AA 4QPXA 3P5BP 5KFTA 5DO2A 4J9LA 3MOJB 4KIAA 3BGFA 2OPSA 4OX9F 4B3OA 1RBOB 3GV8B 1Y00A 1IR0A 2CJYB 1RKIA 3I4HX 3EPIA 4TYBA 2XCAA 2JSXA 5ETPA 4RU9A 2XMAA 3UR0A 4L75A 2IVFB 2DKOB 4KY3A 1JQGA 5CYMA 1HNWF 3KFWX 2YWEA 1EZZB 1VISA 4K4WA 3FZ2A 2AV5A 1S6QB 1S99A 2DCUB 1YJNS 4J9NA 5AE2A 1HW9A 2CNKB 3O2IA 4RW6B 2KL8A 3MR3A 4L74A 4EBEA 1XBWA 3L95X 5DGBA 4E2FB 2RNEA 2V68A 1Z2LA 2G1HA 4IFYA 4DV1J 3AD7C 3W62A 3I5AA 2KKHA 2XQCA 1VRUB 1XMQF 4USKA 5KFWA 3DLEB 3H5UA 4FXWA 2OPRB 2H4WB 3MEDB 4F50A 1HBUB 3E01A 4DX7A 4RW8A 1R0BG 3CEDA 3OL8A 1XK8A 2YX1A 3R5BA 1UPMB 4KQZA 5THWA 3FFIB 2FZGB 1TL7A 1ZM3A 1Q4RA 2EVZA 4MKYA 1YJTA 3Q8YA 5JXSA 2MQ8A 1RTJB 2DNKA 4DX6A 1RHMB 5I42A 3GSDA 4OV1A 1HNVB 4ECQA 3NEKA 2ROEA 3VAGA 4LBPA 4R25A 2DIVA 3NWRA 2WBMA 3CT9A 4R5PA 3EMTA 2XY6A 1TVRB 2AJ2A 3M32A 1GK8A 4KTQA 2VOOA 3JTNA 1HWJA 3R2CJ 4FNIA 4DFPA 2ZBPA 4ZA1A 3OPKA 2CADA 1K0TA 3GIRA 4H4MB 1YK9A 4JI6F 1CVJA 3MMAB 2DHAA 2XMVA 1YRXA 4PPDA 5F8GA 2JLFA 4ELTA 1RADB 4DR2J 3CC2S 3ZZOA 3FQLA 2IFXA 1URRA 1G4CA 1RT4A 5EWEA 1FWKA 2D41A 2AMCB 2ZH2A 1XMOJ 1I94F 1GTEA 3NMAA 1KVKA 2QYCA 3P49B 4B17A 2GO8A 2AGOA 5F8LA 1Q8IA 1M5OC 3IA0A 3Q2SC 4USTA 2ZH7A 4UZBA 3I0RB 1MW7A 2V4QA 4CRJA 1S6PB 3M2VA 1RWMB 1R6YA 4ZCLA 1UMJA 1T94A 2RILA 4ETXA 3LGMA 3HJFA 2DNGA 1VOMA 3OR1A 4ZHRA 3DMJA 4PYDA 1F3FA 2NSCA 1NHKL 2R7XA 1X9MA 3L3CA 4IYQA 2EG2A 2QLFB 5KT6A 1M5PC 4RUAA 1CS4B 1W26A 2R7UA 4I2PB 4BLGA 3WDOA 1ZPVA 3PJXA 2LCWA 2MPUA 4LQ9A 1H0HB 2M9KA 1NPPA 1HBMB 4WK1A 2O3DA 1T05A 1FXRA 4ES1A 4AQYJ 1S1WB 2P9GA 2FZCB 2O67A 3PR5B 1JK9B 4LSNA 3JAMU 2KXNB 3QJJA 2NSBA 3Q23A 3KLVA 1NU4A 5SZTA 3GTYX 2H5EA 2AYGA 2NXNA 2DHSA 3DGPB 4PXCA 5A2QY 3HFZB 4ZJQA 2DNRA 4NMXA 2CWXA 4ZP8A 4DV0F 1X4FA 1CPZA 2ILYA 2RQ4A 1HBOB 1X60A 3VQSA 5AE1A 2XLIA 4DR3F 4JBCA 1PJ5A 5D0GA 4YFUA 1G1XA 3CTRA 5LSLA 2P8IA 4QWAA 1VBKA 3KLHA 2DNOA 3FVYA 4ZVHA 2WBRA 3Q83A 3MAHA 1FRKA 1FA0A 2XO6A 1KLNA 2YWHA 2BE2B 2FD2A 4F4AA 2HHUA 3R6GB 1FVQA 3MR6A 4LF8J 4RW7A 1RWVB 1QLNA 2MTLA 2UV8G 1MWZA 1U1QA 3POTB 2QJ3A 1ZS6A 4PUOB 3O6QA 1SUQB 4DV4J 3GCWP 1HA1A 5T7LA 2ABYA 3PV8A 2DD8S 2B4UA 4NXNF 1DLOB 3PIPQ 3L7PA 3G6XA 4ECSA 3CO0P 3DU5A 1T8EA 2QA2A 4ELVA 5LJ5Y 2V94A 5F8HA 2LDYA 3NGSA 5IV3A 3TWZA 1S1VA 3HXMA 3VGTA 5G0RA 3BQ0A 1HR0J 4O0NA 3N79A 1S1TB 2EFVA 3UE2A 2QMXA 4RO0A 1EQMA 4N41A 2FZKB 3UVJA 3BN4A 4RW4A 1NO8A 4NLWA 2UXCJ 5I4MA 1SC3B 3N6MA 2DGSA 4ZJLA 1U09A 1U1LA 3AQPA 2LECA 3M2UA 4HDGA 4ITSA 1L3VA 4P75A 5KFLA 4X2BA 4OHZA 1HNZF 3RBZA 1JLGA 4J91A 8RUCA 4R0EA 1FFGB 1B0VA 1ROFA 5M2PA 4KSEB 3BGRB 4M63A 4M5MA 3SDEB 1GTHA 3T41A 1U47A 2EKNA 3OXLA 1FJ7A 1APSA 5CCLA 2WVEA 3PX6A 1DURA 5EWGA 2PDAA 5B09A 2KO1A 3TUIC 3PYEA 3LAKA 5A8RB 1UW4A 3MM8A 1Y0HA 1U6ZA 4K4XA 3CJSA 4GMKA 2R2RA 3DLGA 1FJEB 1J27A 4ED2A 1A0OB 3HZGA 1KQFB 3BSNA 1CQMA 4HH1A 4UT4A 5DG9A 4YY3J 3DOKA 1YVFA 4CO3A 1Q95G 3UN3A 1MMLA 3QNWB 4LMZA 2F8EX 3NGTA 3V81B 2G9OA 1N36F 3DNCA 5HBMA 4LJMA 3FBCA 1B7YB 3MPDA 5J2QB 3EICA 3PKMA 1IQZA 1TL1A 5LL6d 3NXZA 2VQFJ 1AZSA 2PT0A 3IRWP 1FX2A 2KT2A 1QY7A 3M30A 4CLTA 5HMYA 3DLKB 1M0SA 1RT7B 4TLQA 4P2SA 3OTDA 1X4GA 4JYAF 1JLCA 3CGIA 1NSPA 1S4EA 5IZHA 3FC9A 4YR3A 2NZ4A 3TW0A 2DH8A 4LF9F 3GV5B 3BGOP 3RB0A 1D09B 4PG7A 7AT1B 2ZH6A 2LQ8A 3EXYA 1W2BR 2UUTA 4EBDA 2L9WA 2ALYB 4L3KA 2B7BB 3OVSA 3IM9A 3GLJA 4F3OA 3NOCA 6FDRA 1L3TA 2HFVA 2GNKA 4RWXA 2EC2A 4A47A 1TZ0A 2L3MA 5IS2A 4K5RA 6FD1A 2DRBA 3MCOA 2H5JB 2CQGA 5E41A 2J0XA 2HHXA 1R8CA 2HSEB 4TKTA 3OLBA 2RMLA 1N5TA 4LT6A 4OYBA 2PD1A 2JEJA 2N3LA 1Z4UA 4X84A 4F0KA 1KD1T 2HWHA 4DR4J 3KJVB 4HI2A 1FNXH 3IAM9 3IN5A 1WOPA 1E6VB 3CDBA 3HHLC 4PAAA 1VMBA 4DUYJ 3FEXB 3MFHA 2PGCA 1RHUB 1VQYA 4Z2XA 2VG5A 2J7KA 1LV5A 1Y3JA 1F3VA 5GAHI 3MCMA 2GFFA 4JV2A 4QCLA 3H98A 3DGVA 2UU9F 5CZVA 2XWXA 5KFSA 2R8HA 1S12A 4IFVA 3OTCA 2WVBA 5BXIA 3GFZA 2C2OB 4JI0F 4ALZA 4LBIA 2I1RA 2JOQA 1N8RT 1IR1A 5G4DA 4UF4A 2XO7A 1RTHB 4KPCA 3ZC4A 2HS4A 4M5GA 3N28A 5CYQB 1SJFA 1QD1A 2ASYA 2KFYA 1KVIA 3W8GA 4HH0A 1V3SA 2LXFA 1HHQA 4IDKB 5D77A 3AD8C 1IKYB 1EARA 3SQOP 4DR7F 1DFDA 5J2NA 3DRSB 1H98A 5B0GA 5ETSA 5J2PB 4B3TJ 2IBKA 4ED7A 2MYFA 3CD7A 3U02A 4WJBA 3V6KA 1UFKA 1JMTA 2UXBJ 1VC6A 4DUZJ 1P1TA 5LSRA 1YDLA 3OLAA 3QO9A 3QT7A 1U8WA 4O23A 3IMQJ 4KGVB 3CULA 3D0IE 2JC0A 5JVHQ 2OMOA 1CEZA 3ENQA 5IV4A 2X1AA 4QW8A 1FVSA 5MAOA 4MFBB 4DFJA 3LTOA 3TUJC 5FJ4A 1CJKB 3BZQA 1B99A 2IHR1 2GJIA 2DR5A 2MMYA 1HPZA 3SZ2A 1JX4A 2KFZA 3KLFA 5E2QA 3ZZ0A 2ACYA 1IKVB 1TMMA 4YR2A 3FK4A 1SQGA 1FJGJ 4X4PA 2W9BB 3EVOA 1UVMA 3CUNA 4N8NA 4FKYA 3ZZYA 4K7QA 4IQMA 1H2UX 3Q86A 1TV6B 2PMHA 2E1CA 3MEGB 4Y00A 2QMUB 2CDRB 2M8HA 4WU3A 3I96A 4ID8A 3FBEA 3KMSA 2YNGA 3BQ1A 3MR7A 4QYZK 2WVDA 3M8PB 1RTIB 3H59A 4IG3B 2DGUA 3G8SA 2GVDB 3PDNA 2CQHA 1K8AT 3K17A 3UQSA 5HQLA 4B9VA 2HRUA 3IS9A 3H2UB 4OYMA 2VUGA 2J9EA 2OFGX 4WK3A 2CPZA 4ECTA 1OY9A 4C0HA 1TKTA 4QWCA 3D6MB 2OPQA 4YOEA 3FEZA 4LR8A 4JI5J 4GVBB 3M2RA 2I9SA 2Y3YA 3R1LA 5LM7E 1C1CA 3JXOA 2B8PA 2OHDA 3IR5B 2HAFA 2DPJA 3CSKA 3JB9k 4DR6F 4GO5X 4YHHJ 5LMNF 2H3EB 4P7VA 2L9DA 3AOAA 1U0SA 3DXSX 4ZLJA 1REGX 2W2MP 4DL7A 1B70B 4WKYA 1VQ7S 3IWXA 3QJLA 3U27A 1NDCA 2BRKA 3T5JA 5C24A 4NI2B 2UZAA 3UDLA 1XR7A 3H5SA 2VG7B 5IXUA 4YR0A 3MFIA 1JXEA 3D54A 3I6PA 3BBCA 4OLOA 1BC6A 3AQOA 1SH0A 4F4XA 1C4AA 5AJ3J 4NYOA 2RQKA 5KFUA 1C1BA 1SBRA 1PKUA 1WI6A 5J1PA 2FLOA 3CJ3A 3W8PA 2G13A 3HVAA 3LP0A 4UOHA 2IYIA 3T1YJ 2MQMA 1GMWA 4PPZA 4NLPA 5D4PA 4O3NA 3T3FA 1F2GA 2XMUA 4CLUA 4X4SA 4JOUA 2RQCA 1XC9A 4LFBF 3RUBL 4RR5A 1U26A 2CZ4A 2VASA 1X0FA 7FDRA 4NXMJ 1VI7A 2GS8A 4KKOB 1RT5B 3S01A 5KG3A 3DLLQ 1JLAA 1U0HA 4FDFA 4P52A 3DRRB 4DL6A 2ZWPA 1IVZA 3AODA 2VDHA 1IKWA 1YHQS 4TYAA 4XTTA 3OXGA 3ISND 1RTZA 5GVQA 2IRYA 2XHWA 4Q5VA 2ERRA 5D3GB 3G8QA 2OTLS 5BYQA 3CCZA 3FUYA 1OPIA 1RDRA 5DZ6A 1WELA 4OZNA 2YKMA 3CCQS 1YIJS 4BBYA 4KPYA 5LMUJ 4U9RA 5F8JA 4ES3A 2DNLA 5I3PA 2ZE2A 3PRBA 1FKPB 3DOLB 3HDSA 5A0YA 3EJMA 1RHKB 2P5VA 2B8QA 4CTAA 1Q0NA 4DWIA 4OHWA 1OPZA 4ZCIA 3PO4A 3W5XA 3W2VB 3W3SA 2VBXA 3ULHA 3C16B 2G2ZA 4QU7A 2LKZA 2HWTA 2VBYA 2XHCA 5E3AA 3HFKA 2ZBQA 4YQWA 1BWEA 3WX4A 3CCES 4U96A 1QSLA 2ATLA 1WC1A 2MKYA 3EGVA 3K0JA 2HVHA 3AD9C 1R6VA 1PYTA 3EM1A 2HZCA 4C48A 1CJVB 1JLEA 1JLFA 2JDJA 2MY8A 5D0HA 2U2FA 3C14B 3SSSA 3U7JA 4DR1F 1SKRA 4PWWA 2A0FB 5GMKa 1SJ3P 3X1LB 4K4TA 1S0MA 4ID5B 1ELOA 1Y5IB 1VQ5S 3CDAA 4JV5F 4YMEA 2HMIB 4J9SA 4P2XA 4DSKA 2JLEA 4PWDA 2YNIA 2WVFA 1YI2S 2DHXA 2RU3A 1NEEA 4U67Q 1SXLA 4OX7A 2B3TB 2XSFA 4PG6A 3WBZA 1XERA 4KHPJ 3IG1A 4OIXA 4D3HA 3H90A 2MQLA 2W9CB 2V9KA 1GAOA 2GO9A 2IM1A 4M5LA 4ZN1A 1PBUA 2FDNA 2CNLB 2VQEF 2DTJA 4GKJJ 4BWJA 2VICA 2YWKA 3VR1A 2DNPA 2W7AA 4PXDA 3NLCA 4JI7J 2WOMB 2CYYA 3MXHP 2VPXB 2HNZA 4DQPA 4DZ6A 2VBWA 5EX0A 3D67A 4O44B 1OSCA 1H2TZ 1IBMF 4JP8A 4OI4A 3DN9A 1SH3A 2LEBA 2I5JB 3KHGA 3CDWA 4O0IA 2CPXA 3CWJA 4J9OA 3L7OA 4WBFA 4ZITA 2LXUA 3OFHA 2C3MA 3J7Z5 1FKOB 4KR0B 3CC7S 1EQ0A 2P6TA 3H20A 4ER8A 3GFXA 1IM4A 4EZ9A 1S1UB 1MMNA 2BQRA 5ETRA 1VJQA 3CCVS 4ES2A 2LP4A 1GMWD 1JXVA 2C2ZB 3BV8A 2VOPA 4L6V3 4OZLA 3SV4A 5IWAJ 1TUVA 5HROA 4ZPVR 4J90A 2C2DA 1IBLF 5K9FA 5AXNA 1CSJA 2MZRA 4RBVA 3AOBA 2C3PA 5C25A 3IO1A 1NB7A 5D0RA 4HHUA 1RTDA 1L3UA 3I55S 3EDRB 3IBFB 1N34F 3R5DA 3PY8A 1WHYA 3CJQA 4QZVB 4B9LA 2HVDA 3NNHA 2AHOB 1UVIA 1PGZA 3DLBA 4C6AA 5DGAA 1XN9A 4NL5A 5LXYA 4XPCA 2XSJB 4RU2A 3C46A 1EETA 2VDIA 3FEYB 4KHMA 2KH9A 3FQKA 2Q43A 4QJVA 1GH8A 3UD3P 2ZVSA 9ATCB 2YY3A 1R89A 3UD4P 5F3TA 3I82A 3BH7B 5DETA 3T1HF 3FCHA 4X4NA 3QZ7A 4IO9Q 5CQGA 1ZYQA 4NLYA 2V9WA 2CJXB 4DF4A 4C3MA 1LEOA 1OSDA 4O3QA 1REVA 3HX9A 4ZVRB 2ZH4A 4NYZA 3DCAA 2AJ4A 4ZVQB 3LQVA 2JC1A 1RAIB 3BS9A 4G1IA 1NUEA 2R8JA 1RT3B 2EFQA 2V34A 2KT3A 3KUHA 1ULRA 2R3VA 2E66A 3FRZA 5DZ7A 3SCKE 2V8DA 3ZTRA 4AL6A 1RHRB 2UP1A 3UD5A 3PX0A 4K4YA 3BYRA 2BDPA 4QIWD 3V4MA 1FJCA 5JUMA 1L5UA 2KJWA 2FYXA 2I38A 2PI4A 3ENVA 2YWGA 3D28A 3JYTB 3QBCA 3ADAC 1EP4A 1KSPA 1U7LA 1RA7A 2ZVIA 1X5SA 3PEJA 3PJWA 5L46A 2NXJA 3VF0B 1VIOA 4OMFG 2QG9B 1KNZA 3OR2A 3T6JA 1VRQC 5A8KB 3R97A 3PTWA 3ZTPA 4CWBA 4KJIA 2K2PA 1UKUA 4DL4A 2PFDA 3JSMA 4IH5A 4ZDNA 1YRTA 4DQIA 2QRRA 4WE1B 3BJYA 1T3NA 4FYYB 2ZH3A 2AEFA 1QVGR 2BJEA 3SYZA 2N4DA 2ZD1B 1YKWA 3G96A 3I0SA 4LFCF 4X62J 4CO4A 3PNIA 3WIVA 3TYTA 1AFJA 1AW0A 1RAAB 3CPWR 1QJHA 1TR0A 2K3KA 4NPOA 1FESA 3AB4B 3KTQA 3HPOA 2MKJA 2BM1A 2XMKA 1HQEB 4ETZA 3GZ7A 4N76A 2BANB 2NUUG 1C0UA 4R8UB 2IBOA 4HVZA 5D4NA 1TAQA 4KC5A 3HD2A 1HI0P 3LH2S 1FXDA 2RDDA 2J8AA 4CLZA 2YPZA 1OQ6A 3I9ZA 2FVPA 2HQDA 2H1YA 4CLPA 3TVZA 3D0HE 4Q45A 3W2WA 3TJAA 1O5JA 4F4YA 3DOMA 1ACMB 3GG0A 5HMZA 1P6TA 3PHTA 2OPSB 4ZP7A 4B3OB 5D0EA 4ZPTR 4KGZB 3E2EA 3OSNA 3K5MA 3K89A 3PW7A 1RACB 2YWWA 2MZJA 2MZ1A 1RHJB 2COLA 2Q66A 5F0UA 4H4KC 2Z57B 1HBNA 4Z7CA 1RISA 1RHQB 5CYMB 1RWXB 1WF1A 3DRYA 3BDPA 5IQ6A 1D3WA 4U8VA 3SBMA 2HVZA 1ZZNA 4ELUA 1XNQF 3AHPA 1LWEA 2VC1A 1UZHA 2LLZA 3V4IB 2WRMA 3QMQA 3ZTSA 4DLGA 3MM9A 1IBCB 1PC4A 3QAEA 2HHQA 4IFYB 3R3TA 4P2MA 3QT6A 2EXUA 2FJBB 4ILLA 2CKWA 3GYXB 2GHVC 3BEGB 1OQ3A 1VGYA 3M4XA 3E01B 2F4VF 1VHIA 2J0WA 2RAQA 5F9LA 4DL3A 1BY9A 3RJMB 3MPVA 1KKHA 2XMMA 4RW8B 2MHEA 2UUAF 2HGNA 2ZUGA 2VA2A 4WP8A 1IM6A 4CH1A 3D0GE 3TAMA 4NA3A 5RUBA 2ZBRA 4NLXA 4DSIA 2DNZA 2HNDA 3J7YI 1TV6A 1KFSA 4QIGA 2CJBA 5I42B 2RS8A 4YP3A 4GVLA 1NKBA 3UPFA 2MQOA 4R5PB 1IWGA 3M32B 1NLKL 2OJ3A 3JTPA 1VBXA 1P1LA 4BCAA 3NRBA 3K57A 4IR9A 5BR8F 4MIWA 3FZBA 1S6UA 2MJUA 1A9NB 1OMSA 1VCTA 2AX0A 5B7WA 4AXIA 4YEAA 5DQGA 1S10A 1RAHB 2DT9A 3F73A 4A8YA 1RT4B 4WKRA 3ZZUA 1QE1A 4OYXA 4GVBA 2GZOA 3GMGA 3Q24A 4HYKA 4DSJA 3UI3A 3PEHA 3VAHA 2UVVA 4ED4A 1RQ0A 2BOAA 1WD6A 3CCUS 5K8NA 4WFXA 3M2VB 2FHOB 2ZOMA 5DDQC 3I4PA 4ZVUB 3W7BA 2DR9A 2CAJA 4AXJA 4Q8EA 1QAIA 2ZKUA 2D3UA 3HHKA 4GC6A 3QIPA 1RU2A 3LA0A 1FX4A 2VU5A 3OR1B 5HVHA 4ZHRB 3DMJB 2XNQA 2GC8A 2NUHA 3BQ2A 1BWVA 2GAGC 3IXQA 5KFMA 4H4OA 2HS0A 4QW9A 4USUA 2BV3A 3MZIA 4N56A 4XPEA 5KG0A 2E5GA 2GGPA 4LRBA 1OY8A 1VS3A 2GIRA 3TEGA 1HLWA 2F7VA 1T05B 2RSQA 3MOZA 1NJYA 4O3SA 2QE5A 3PYGA 2XY7A 2IJNA 1RLDA 3K58A 1WKKA 2VODA 2LVWA 4I2QA 5H9EJ 1V3RA 4LSNB 2HFOA 2LEAA 2QMWA 3L9ZA 1L3KA 3I32A 3TA1A 2V8GA 5J2MA 5L39A 2W4CA 2VG6A 3SI8A 2KRBA 1WEZA 3SQGA 1TKZA 4MKAA 2CJQA 1P27B 3HSZA 3OV7A 2M0GB 3S8SA 4X64J 2NXUA 2DR6A 1DJ0A 4ZIWA 1UZDA 3EZUA 2RRBA 4OYZA 5KFKA 3N0VA 4USVA 2JL9A 4C8YA 3KLHB 1VQSA 1EKRA 2D9PA 3MEKA 4B9UA 2E7XA 3ILOA 1VQ8S 1QUVA 4XO0A 3KWMA 4TVAB 5K20B 4LR7A 2E5LJ 1N6QA 5L9NA 4OJ1A 1QAJA 3CMES 3DFEA 3W9JA 2H48B 1X4EA 1KRPA 4RW7B 3CCWA 4Y0FA 1WHVA 3WC2A 5D8HB 4K4SA 1FERA 4Y28C 4RW9A 2YNFA 5T7LB 3BN7A 3PW5A 4USHA 5A6WA 3JAMY 1FWPA 1VJWA 5CH7B 3GPAA 3KLEA 1X7VA 1T9XA 3IP0A
chains in the Genus database with same CATH topology
2AF6A 3NAHA 3M05A 3SEOA 2GGPB 2JFDA 5DG9A 1VQ4S 3DOKA 1UA0A 4NLRA 1YVFA 4C11A 4CO3A 4PR6A 5IM0B 4WFZA 1YJ9S 1MMLA 3E8OA 1S1XA 2BXJA 3VQTA 4FN5A 4OZ1A 4C0OC 2B51A 5KFYA 3KJVA 1BGXT 4LMZA 2VL1A 2F8EX 1LWCA 1S1VB 3V81B 2HFNA 1SJ4P 2FJEB 1CG2A 2G9OA 3R1HA 1E6VA 4M95A 3MUVP 2ASJA 1N36F 4I2QB 3DNCA 5HQ8A 5HBMA 4AL5A 4ZKAA 2WCXA 4LJMA 2FJWA 1X9WA 2OFHX 5KG4A 5KG2A 3JSYA 2M70A 2R7TA 5J2QB 3K59A 3GFHA 2L08A 4OI2A 4ED8A 5DQHA 1IBKF 4RKUC 5J2MB 2YWFA 3PKMA 1IQZA 4EYIB 4LFAF 1TL1A 3PHEA 3F41A 3BDEA 4WIIA 2VG6B 2XGQA 1G6BA 3FDSA 3OXFA 5LL6d 2VB6A 3PX4A 3JSBA 5F8IA 2IAJA 3RR8A 1VQNS 2PT0A 3IRWP 4RW4B 2B9XA 2KT2A 5K8MA 4OL8A 3SQGB 3OW2R 2OO4A 1TKZB 1QY7A 3M30A 3PFOA 1XR6A 2EI5A 2IC3A 4DR5F 1SJRA 1JLBA 5HMYA 2FGOA 3NGDA 3RRKA 3DLKB 3M2UB 5KOWA 2YH0A 3QYYA 2RDJA 1M0SA 4JI3F 4USIA 5KFPA 1RT7B 1YJWS 4DMZA 4CCHA 3SCLE 1C2PA 4M5DA 4TLQA 4P2SA 3OTDA 1X4GA 4JYAF 1JLCA 1JLGB 5AXKA 2XGPA 5KFCA 2EFPA 1U1OA 2ZM6F 3CGIA 1UWBB 2ZZMA 3LP2B 3DM2A 1BQXA 4U7UK 2KZZA 2DO4A 5IZHA 3ISNC 4YR3A 4LSLA 3OFGA 4PKDB 2FPHX 3TW0A 2NZ4A 1VC0A 2DH8A 3BF4A 4B3RF 2VZ9A 4KHPF 1RTHA 4LF9F 3CCTA 3G86A 2GX8A 3GV5B 1Q8LA 4D3GA 3RB0A 4PG7A 1UJ6A 2E1AA 4C8OA 1SKWA 2ZH6A 1T3OA 3LANA 3SCIE 3H4DA 4HHJA 1X4BA 3HO1A 3EXYA 4J37A 1W2BR 2QIFA 2UUTA 2RE1A 4EBDA 3I87A 4NZ6A 3EGZA 5CYQA 3MD1A 1RT6A 2L9WA 1PILA 3TO8A 1N6QB 2B7BB 3THPA 4WFNQ 3OVSA 4KO0B 3MWBA 4F3OA 5KOXA 3NS6A 6FDRA 4GKJF 1L3TA 2D9OA 3IR7B 5K8PA 1S9GA 4KV8B 3B82A 1S9EA 4JI7F 2GNKA 4RWXA 2C3YA 4TQSA 4ATNA 3IAS9 2NS1B 3MM8B 2EC0A 2J76E 3LWMA 4A47A 3T19A 2KHDA 5EUHA 4YB7A 1TZ0A 2L3MA 2HHSA 4OX8A 5IS2A 2XI3A 4IDKA 4RNMA 4RW9B 2YNFB 4K5RA 6FD1A 2DRBA 4TNOA 4WZMA 4A8KA 2CQGA 3MM6A 5E41A 2X3GA 2J0XA 1IKYA 3DLGB 2HHXA 1R8CA 2DJWA 3DYAB 5KFIA 3CCSS 4TKTA 4E0DA 1NK5A 3DRSA 2QT7A 3OLBA 3H5XA 1UVKA 2RMLA 2AP6A 1N5TA 4LT6A 5DJBA 3KLEB 2PD1A 2JEJA 3NAIA 5J2PA