1KD1T

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kd1T00
2ZJPQ 3VALA 3UWTA 2ZJRQ 2F3JA 3CMAS 5GADU 2GHPA 2OTLS 2DHXA 3N9UC 1ZZFA 2XNRA 2LMIA 3VAFA 1ZH5A 1Q86T 5LXYA 5DDRC 5D78A 1H2UX 2KXNB 2FPHX 3CCJS 4WCEQ 1FT8A 2NZ4A 4V19X 1UW4A 2OIHA 3LPYA 2L9WA 2K3KA 3THPA 1D9AA 2RS2A 2KHCA 1KOHA 2UP1A 1U1NA 3ULHA 4LJMA 5IFMA 3BO2A 2KRBA 1VQ7S 2M8DB 1FJ7A 2N7CA 3CC4S 3J7YU 4IO9Q 1O0PA 1VQLS 2MKJA 2JVRA 3TP2A 2WBRA 1DRZA 3P3DA 2CQBA 1VQKS 2OTJS 2LA6A 2RQ4A 1D8ZA 1YJWS 4PKDB 3P6YC 3CXCR 3L3CA 3MD3A 2KU7A 2DHAA 5JVGQ 2GO9A 5EN1A 1XN9A 1OIAA 1U2FA 4YB1P 1FJCA 3U1MA 4LIRA 4EGLA 3EX7B 5IQQA 3TYTA 1SJ3P 1S79A 3VAIA 1U1QA 2KH9A 1M5VC 2EK6A 3HHNB 2J0SD 5DM6Q 1WEZA 3MUTP 2DNRA 3NS6A 5HO4A 3NMRA 1G2EA 1X4CA 2DGSA 1JJHA 2XS7A 4PRFA 2OJ3A 1U1LA 1WHYA 2RUGA 5JVHQ 2G4BA 2A3JA 2FC8A 3THTA 1X5OA 1N52B 3VAKA 2RS8A 3BO3A 4YUDA 2N3LA 5GMKa 1JJ4A 3MI7X 4WF9Q 2LKZA 3H2UB 1M5OC 3P49B 2AYBA 4WFNQ 3Q2SC 2MSTA 4F25A 3UD3P 1DHMA 1VQMS 2EK1A 4Y0FA 1KC8T 1H2VZ 4QPTA 2MZJA 1SJFA 2DIVA 3G8SA 2DNGA 2U1AA 1WHVA 5DETA 3G9CA 2LEAA 4A8XA 2DNZA 5GVQA 1HA1A 4CQ1A 2M0GB 5DDOC 2DNOA 2KM8B 2B0GA 2K8GA 2ADBA 2CPEA 1VBYA 3J7ZT 1WF2A 1M5PC 2OSRA 2QA4S 2CQ1A 2F9DA 1FNXH 4TU9A 1YI2S 2KG0A 5HL7Q 2CQIA 3MOJB 1RK8A 1WF1A 2M2BA 1U1RA 2DB1A 2JX2A 1X4HA 1DZ5A 3ZZZA 1FO1A 2YKAA 3G4SS 1P27B 2MQPA 1WELA 4QU7A 2DNPA 3EGNA 2CPFA 3SXLA 1X4DA 4Y00A 3MUMP 2RNEA 2MQOA 1FXLA 2YTCA 1VC6A 2DGWA 3VAGA 2DNMA 4C4WA 5CA5A 3PIPQ 4OZ1A 1SJ4P 2JRSA 2MYFA 2U2FA 1YTYA 3S7RA 1HL6A 4QU6A 2CPJA 2M9KA 2CQCA 1H6KX 2MQNA 2ZJQQ 5BJRA 5CXTA 1VQNS 3CUNA 3UCGA 2DITA 3DXBA 2LXUA 5CYJA 2VOPA 3RW7A 1F9FA 2M52A 1VC0A 2MMYA 2M8HA 3H2VE 2M7SA 1K73T 1A9NB 3SDEA 1WEXA 2LECA 2DHGA 1VQ6S 1SJRA 1ZZNA 1YJNS 3CULA 2X1FA 2CQ0A 2X1GA 2MQLA 2DNLA 4CH1A 1U1MA 3UE2A 3MURP 2PEHA 2MGZB 2E5IA 1YITS 2VODA 2CQ3A 2CQDA 3CCSS 2DO4A 2HGLA 1QM9A 3CTRA 1B7FA 4WFAQ 2LYVA 1WG4A 2MZ1A 4FXVA 1M1KT 2SXLA 2AD9A 1H2TZ 5LJ5Y 2MKHA 1U1OA 3CCUS 2L41A 3G8TA 2MJNA 2KRRA 2D9OA 1U6BA 4WFBQ 5FJ4A 1JJ2R 1OWXA 2LXIA 3BO4A 2XSFA 3CCES 2KI2A 2MQMA 2CPZA 1X4AA 1NO8A 2LA4A 2RVJA 1VQOS 3NS5A 3DLLQ 2MKKA 3NNAA 2DNHA 2HGNA 1RKJA 2HVZA 2DIUA 2FY1A 3BS9A 1A7GE 2XNQA 3CCRS 1P1TA 2RRAA 2DNNA 2V94A 3ZZYA 4Z2XA 3PIOQ 1X4GA 2CPXA 4ZKAA 3MD1A 1VQ9S 2D3OR 4W92B 2M70A 3S01A 1X4EA 1R8HA 4BS2A 1VQ4S 2RRBA 3U1LA 1W2BR 1L3KA 3SMZA 3VAJA 1VBZA 2DGTA 4C7QA 2MKCA 4ED5A 4WIIA 2YH1A 1FJEB 2RT3A 1Q82T 2JWNA 4FXWA 3FEYB 2AYGA 3CD6S 2DNKA 5LJ3Y 2RQCA 5IM0B 2J8AA 1X0FA 4TU8A 1YHQS 2I2YA 3I56S 1X5SA 4CH0S 1IQTA 1M5KC 1WF0A 1WEYA 2RU3A 3UCZP 3MXHP 1N8RT 1NJIT 2E44A 1N88A 2MZRA 2DH8A 3CMES 3IWNC 4CIOA 4UQTA 2MHNA 1FHTA 3CCVS 2CQ4A 3OW2R 2O3DA 3B4MA 1K9MT 3Q2TC 2F9JA 1K8AT 2HZCA 3IRWP 2M88A 3BEGB 2MZQA 4U67Q 2FC9A 2KFYA 2CPHA 2HGMA 2X1BA 1VQ5S 1QVFR 2DHSA 3R27A 2VOOA 3MUVP 4QQBA 1X5TA 1OO0B 2I38A 4TLQA 2MSSA 2AYMA 2J76E 1SJQA 3G6ES 1YJ9S 2MPUA 2HYIB 2G0CA 2E5HA 2LQ5A 4IOCQ 3CC7S 2DH9A 1UP1A 4W90B 4C0OC 1UAWA 3UCUP 2YH0A 2CJKA 2XS2A 1URNA 2KXFA 2MXYA 3K0JA 3TO8A 1WHXA 3CF5Q 1WG5A 2E5JA 2CPDA 2KT5A 1WG1A 5H1SV 5ITHA 2DISA 4LMZA 3EGZA 2XB2D 3CPWR 3VAHA 3UD4P 2CQPA 1WWHA 3LQVA 2AYEA 4TU7A 2FHOB 2DNYA 4RU2A 1WI6A 2KM8C 3G71S 1BY9A 5MLCV 1KOOA 1X5PA 2PE8A 2DGOA 4PR6A 1DBDA 3FEXB 2M4MA 3NNHA 3S6EA 2KG1A 2OSQA 5D77A 3B4DA 5LXRA 5GAEU 1VQ8S 2VONA 3CCLS 2QFJA 2ADCA 1S72S 3VF0B 2CQGA 1PO6A 2CQ2A 2DK2A 1SXLA 4F02A 3SDEB 2MJUA 2E5GA 4M5DB 1R8PA 3P5TL 3I55S 1HD0A 2N82B 2QEXS 2DH7A 2CQHA 2MY8A 1QVGR 2KYXA 3CCMS 2MGZA 1M90T 1U1KA 2L08A 1KD1T 4J5OA 1CVJA 4ERDA 3R1LA 1X4FA 1Q7YT 2MB0B 1U1PA 1UFWA 1NU4A 4YOEA 2MKSA 2EVZA 2J0QD 2N3OA 3V4MA 1X4BA 2XS5A 3S8SA 3JB9k 1AUDA 2DGQA 5LSOA 1OPIA 2Q79A 4F26A 2LEBA 2CPIA 1VC5A 1N54B 1YWXA 3D2WA 2KVIA 5IM0A 4IUFA 3CCQS 5GAGU 5DM7Q 5DDQC 3G96A 2KXHA 3R1HA 2BZ2A 3US5A 1WHWA 4OZ0A 5LSLA 1WTBA 1HD1A 2DGUA 4WKRA 2NLWA 1JMTA 1WI8A 2MY7A 2MQQA 3CC2S 2DGXA 2X1AA 2DNQA 2DO0A 3NNCA 2MZTA 2LCWA 1KQSR 2CPYA 1PGZA 2BOPA 4P6QA 2MZSA 3HI9A 5GAHU 1Q81T 1U6FA 2MKIA 2D9PA 1VQPS 2YWKA 1YIJS 4UY8T 5DDPC 1VBXA 3RW6A 3VAMA 3MDFA 2ERRA 4IOAQ 2JVOA 2DGVA 2KN4A 2G1DA
chains in the Genus database with same CATH superfamily
1ZPVA 1GXUA 1LW0B 3IR7B 4FNIA 1SIWB 5F3ZA 4P74A 1FRXA 2F3JA 2FVRA 2XMUA 1T0TV 2ZE2B 2GHPA 4LF5F 2OTLS 2HS3A 2UUBF 1XNRJ 1N33J 4C11B 4NOHA 1ZZFA 1TMMA 4RNHA 4RX6A 2LMIA 4Q0BA 2FUG9 1GMWA 4JUZA 1NMEB 3VAFA 2GA7A 2ROGA 4MJKA 4O3SA 5M2RA 2UXDF 1RWPB 2V9KA 1H2UX 4QW9A 2KXNB 3CCJS 1FI4A 7FDRA 1FT8A 3UDEA 2FLNA 3OHBA 4X4PA 3QJLA 4BLGA 1LWEB 1Z2LA 4M1KA 4RLEA 2B51A 2K3KA 3MPDA 1HLWA 4C0BA 4Y2IA 2PC6A 1NZ8A 5CQGA 5B0EA 1E6YA 2UP1A 1ZM2A 4JI3F 3R6GB 4LJMA 2HNYB 3KUEA 5L8RC 4B3OB 4ANCA 4HHHA 1N6QB 5A2QU 1U4BA 2V2VA 3CC4S 3T41A 4IO9Q 4DR6J 4B08A 1HNXF 2ZHBA 2HZAA 2JVRA 1EP4A 1U02A 3BKFA 3I4HX 2IYGA 3LANA 2LU1A 3MAAA 3VTIA 1KRPA 2QRRA 1DRZA 4G1QB 1TL7A 3P3DA 3B6BA 3N28A 4OHYA 2VFSA 3D68A 5IC6B 1REVA 3DDKA 4I2QB 5E33A 2DXFA 2WBMA 2ZBRA 1TUWA 2V4QA 4DLGA 2C3MA 1FDAA 1NRKA 1PILA 2DCLA 1YJWS 3D4JA 4PWDA 3DRXA 1DLOB 2BX6A 1N5TA 4CLUA 3P6YC 2UZAA 3V4IB 2VASA 2HRTA 3CGIA 3FBBA 1TVRA 5MAOA 4AE5A 3MR6A 3L3CA 5JMNA 5JVGQ 4DR3F 5HANA 5GAHI 3MEDB 2GO9A 2PSZA 1A6LA 1OJ4A 1Z2ZA 3JS9A 4OMFG 4R5PB 1XN9A 1G1XA 1U2FA 3W2WB 1FJCA 4HL9A 3U1MA 4DUZF 1M0SA 3LALA 3LPEA 4LIRA 3VQSA 5C2CA 1F9HA 4RW7A 4EMDA 5CCMA 4DR1F 2NSCA 3PW2A 2UUTA 4DR5F 2OO4A 4RW6A 2R7XA 2JEGA 4QIEA 4IR9A 1U1QA 2KH9A 4ZN1A 2J0SD 5DM6Q 2CNNB 2DEJA 4Y2MA 5ETRA 1NH7A 2JC0A 4U95A 4ED8A 2V0NA 5HO4A 4I6WA 3W63A 3HT0A 3SBMA 3TWZA 1HPZB 1KS2A 2DGSA 3M2UA 4HACA 4OHXA 1EB0A 4RJVA 3OJUA 4BDPA 5CZXA 1UJ6A 2A10A 2P9EA 4X4VA 1MWQA 4QCLA 3OXFA 2IM1A 2RUGA 4LRBA 1Q53A 2E1PA 3PR5B 4K4ZA 3FK4A 2F7VA 2XLKA 5HMXA 1YZ7A 4KYZA 4V19J 2QX0A 3NG8A 2WVFA 4EWTA 4LFCF 1LWCB 1RT5A 1NH8A 4DV5J 1JJ4A 1HNWF 2B4PA 4URQU 1UKUA 3BM7A 4GO5X 4OYWA 4WFZA 4ZA1A 4S0MA 4DHVA 5I3UB 4LT6A 3BBCA 2X7IA 3V2UC 5KFCA 6AT1B 1MROA 3OSNA 5I3PA 3DCAA 2PFFB 5L9NA 2EK1A 2R7OA 1IKXB 5E3RA 1AFIA 3ONQA 2B4OA 2RQMA 3F73A 2IRXA 3KLGB 2MZJA 2ZHAA 3DXSX 4U9RA 1YRUA 2LQJA 2IC3B 3M32B 1NDPA 3G9CA 2VKRA 3H98A 2QA1A 3OUYB 4JI8F 1KONA 2MHEA 2V67A 4NI2A 5EX0A 1T95A 1B0PA 1V3RA 2QLJB 3CDUA 1HW9A 5L38A 4OI3A 3SI8A 4Y2CA 4ECVA 3A13A 4YN3B 2W9CA 2B0GA 4OI2A 4HDGA 2G2YA 2CZ9A 3AOBA 5GMDA 1NLKL 5T41A 5A0YB 1VBYA 4DN0A 1E6VB 4MIBA 2IDLA 2OSRA 3G2XA 3SEOA 2QA4S 4N8NA 2CQ1A 5KFZA 2F9DA 4EUVA 1Q1KA 2KG0A 4OX9F 3U02A 5A8WB 4K8RA 2DR6A 1TP7A 3MOJB 2DXEA 2VG5B 3DM2B 2AW0A 3ELHA 1U1RA 2DB1A 2JX2A 2ZOGA 4ATNA 3MEGB 5BYRA 4C98A 2OD4A 2W2NP 1XTZA 2V2QA 3KLHB 3C16A 2BVZA 5HLFA 2XMJA 4RUAA 2COLA 1RXOB 3M8YA 2NQPA 4O3PA 3MMBB 1RAGB 2YKMB 4RW8A 3CT9A 1P27B 1Q8IA 5I3UA 3EZOA 1XMQJ 3MMJA 2MQPA 1UVNA 3D9BA 4QU7A 3L09A 1GMVA 2DNPA 2CPFA 2FQQB 2AZ1A 2HNDA 5KT2A 4Y00A 3NGKA 4QR0A 4ETZA 2MQOA 4YR0A 2QSFA 2YTCA 1J5EF 3VHQA 3NCQA 1XMBA 3FDSA 3GCXP 5AJ3J 2AU0A 1SI9A 1YQHA 1Y7PA 4ZLPA 3TZXA 5J2PB 2EFQA 2IVFB 4QWEA 2B8PA 4ECSA 1FE4A 3QMQA 2DPJA 4DSJA 2F63A 5B0BA 2GJIA 4EBCA 4YP3A 2KJWA 3OL6A 1VYAA 2CYYA 3HKZD 4IO1A 1JKHA 2V6AA 2XGPA 2JRSA 2YKQA 4LF8F 2V2ZA 4NEYA 1UMJA 4YY3F 1SKWA 2L3MA 2UUCJ 1RLCL 5IWAJ 2ZJQQ 5K5MA 3JQMA 4JB8B 3F56A 5B0GA 1KQKA 1S5ZA 1VDHA 3UCGA 2FTRA 1UZHA 2PN6A 3DXBA 3T19A 1H7XA 2VOPA 2HIQA 1TKDA 2RKIB 2YNFA 1RHQB 4CLYA 3DLHA 1N36J 4MK9A 2R42A 2VPYB 2WVBA 1EHWA 2D69A 4NCAA 5LM7E 2MEWA 1K73T 1MROB 3QYYA 2HG4A 1VRTA 2IC3A 4K4VA 3SDEA 2LECA 2XY6A 1IKVA 1VLYA 3GIMA 4F3OA 1TQLA 1SJRA 1FRMA 2ZUGA 3E01B 1H3DA 1ZZNA 4LREA 4YDDB 3M6VA 3CULA 3M2RA 4HT5A 3QPIA 3QFWA 4XPCA 4ED7A 4PG8A 3W2VB 1Q5VA 4C48A 1U1MA 3MURP 4O0NA 2E5IA 3EUNA 1FD8A 1S97A 3C6UB 1JLCA 1FNOA 5DZ6A 3ILJA 1UEKA 3PDNA 4CRJA 4FZVA 2PA3A 4I69A 1KLNA 3HULA 4ZPCA 3IG1A 1WG4A 2F8HA 4LR8A 5A8RA 3CJKB 2HQ3A 4FXVA 4Q8FA 3I31A 1SIZA 3U7JA 1T03A 2YKOA 3DOMB 3RG6A 4YS2A 5HQMA 4RWXA 3FQLA 2AHOB 3LUYA 3T5HA 3TRGA 5T7LB 5IT9Y 3RBEA 1RTDA 4DZDA 3PRDA 4WK1A 1KLMB 3M30A 1NNDA 2J7UA 3K89A 3DN9A 1U6BA 4KPCA 4WFBQ 3MPUB 2D3O1 1M5HA 3R3TA 1A0OB 4D3HA 4MYTA 3SSSA 1RB0A 1AZSA 4I7FB 3G87A 4WYWA 1GT8A 1R6VA 2VQFJ 1KP6A 3BO4A 2RHQB 3DLEB 2K3IA 2XSFA 3QT8A 4MTPA 3IG1B 2G0JA 4OI4A 1RE1B 1JWWA 2MQMA 2XHWA 1OPZA 5ETKA 5KFJA 5ETOA 1C2PA 1NO8A 2I5JA 2HHHF 3R5JB 3LP1A 4KJIA 1REGX 2OPQB 3RUBL 1REVB 4ED2A 2DY1A 5AXLA 4EZ9A 2ZH9A 2IAJA 3W9HA 2EKNA 4B9NA 3BGFA 3H90A 3I0SB 3M8ZA 5HJYA 2XNQA 1YX2A 2QZ8A 4NLWA 4WXOA 3CCRS 3V4IA 1P1TA 3NAHA 1HQUB 3BJYA 5DJBA 4F2RA 3PIOQ 2UVWA 3MGJA 1KWMA 1RT7B 2AIRB 2QGFB 2B9WA 1T3NA 1ZBTA 4WTYA 3DRPA 4UY85 4ZKAA 3ISND 5KFHA 4UTGA 4UT4A 1NHKL 1KEKA 4PG4A 1VQ9S 2UVUA 1X4EA 2Y9HA 5AXNA 1S9EA 4BS2A 1FFSB 1S1XB 1VQ4S 3U1LA 1LNQA 3O8WA 1EZZB 4OYBA 2HS0A 5D4NA 2IMOA 1B0VA 4NI2B 2CIMA 3G82B 1VBZA 2QIFA 4FPIA 2R7TA 3LTOA 2DPIA 1RLDA 1SQFA 4P73A 2ZNZA 4DFMA 3H42A 3FEYB 2G0IA 3I32A 2DNKA 5LJ3Y 2P8IA 1LV5A 2XQCA 2J8AA 1IJEB 2ABYA 3QFHA 4TU8A 1RHRB 2YPYA 4JI7F 3MPWA 4RW4A 4F67A 2CDRB 1MMLA 2D3ZA 2E7VA 3LH2S 3W8GA 3R7BB 1X5SA 4CH0S 4JI5J 1FTRA 4JI4J 3MXHP 3OTDA 3W61A 1R8AA 4URGA 1N8RT 2FHJD 1P1LA 2E44A 2LU2A 1NHUA 1Y00A 1NSPA 4KGZB 5KT4A 3KHGA 3CMES 3SSQA 5A6PA 2Z58B 4FBTA 3TAMB 1E6YB 3CJ0A 1DQ8A 3FSIA 3SZ2A 1ZYQA 3WHIA 3J81U 2RIJA 3GG0A 4PYAA 1QJHA 1QSSA 4JYAF 3HVAA 1N33F 1BE4A 3DU6A 4EFAC 2P5VA 5IV4A 3CCVS 2P9CA 2Y1RI 1K9MT 4JV5J 2F9JA 2JH3A 2JNJA 4ZHRB 2HZCA 4CO2A 3T1HJ 3M9OB 2UXDJ 3FFIA 1JLEB 2WTFA 1S4FA 3IFEA 1WOPA 1RWVB 3KKFA 1U2CA 4OJ1A 4U67Q 2FC9A 3BGRB 2DRDA 4ANEA 1DAXA 2DYAA 1JX4A 4DV0F 2DD8S 2EC0A 2CPHA 2X1BA 4EK2A 5KG3A 1T9XA 2VOOA 1NK8A 5RUBA 1GMUA 2MTLA 2OPPB 2D3UA 2N4CA 3POTB 2XM3A 1VGYA 3KHLA 2Z2ZA 1YDLA 3QGGA 2MSSA 2YNHA 2BRLA 3PKMA 3G6ES 2R7WA 2V4JB 3W60A 4O44B 1HNVB 2R2TA 2VBYA 4YQWA 1U24A 5EX3A 2ZEJA 4D3GA 1UP1A 5KOXA 4DX6A 5I42A 1D8YA 1SV5A 2BABA 3P45B 1JLEA 4ZVQB 4QBUA 4RNFA 3EPIA 4DSFA 3MCOA 1WC3A 1WDDA 4OL8A 3UCUP 1OYDA 1Q95G 3DI6B 1FK9A 3A8IA 3OR2B 4LF2A 1HR0J 3QWUA 4Q8EA 3NOGA 3K0JA 4OFZA 1NK9A 1WHXA 4OI0A 1WG5A 3POTA 3ZTRA 1U8WA 2CPDA 3BYRA 4NCBA 2MDAA 5K8OA 3KOAA 2B4UA 2VHGA 1HNVA 5EWFA 1NJZA 3AHPA 1FVSA 2A2CA 5KFIA 3W66A 3I9V9 3WC0A 2W2PP 3AJ2A 3LQVA 3CD7A 2HQFA 3IRXA 4DUZJ 2FHOB 4NCGA 4NLSA 3NL0A 2V2KA 2GMLA 1RHMB 4WU2A 3ETOA 4KGKA 3A3NB 2P9GA 1CJTA 3JSBA 2I9SA 4DCJB 2OP5A 4NYPA 3PCOB 1UFKA 1X0PA 1KOOA 2W7AA 3PJ9A 4WE1A 4E2FB 2IBKA 2BKOA 1TKZA 2QMUB 4F4XA 2ZM6J 4LQ9A 3TZYA 2HHSA 3FEXB 3GWCA 1S99A 3LP1B 3OJSA 1T05A 4CLFA 2E1RA 2M4MA 4JI4F 3S6EA 1U6ZA 2AP6A 2VDHA 5HMYA 1CEZA 5CZVA 3GTYX 1LEOA 1CJUA 4K7QA 2J6TA 2LQ8A 3BSOA 4QIVA 3JAMY 2ADCA 2E1AA 3VF0B 3BDEA 4WKYA 2F4FA 2HSEB 4R8UA 4DXLA 2XYPB 3I6PA 4ZN3A 3D1OA 5D6GA 4CCHA 3QZ7A 4NXNJ 3HFZB 3Q8SB 4BCAA 2GIFA 1V5IB 2ZWOA 1X8DA 5K14B 2DK2A 3TEGA 3PJWA 2J7KA 4PEOA 5J2MB 2MJUA 5KT7A 2E5GA 2BKNA 2J9DA 4M5DB 4MT1A 2R8IA 1IKVB 2ZH8A 3HHDA 1R8PA 4F50A 1T02A 2VL1A 3T5JA 4K0KF 3FKBA 2YBVA 3G82A 1F2HA 3UDLA 2QEXS 5FLXU 1MSWD 2J9EA 3QWPA 4HH1A 2CQHA 3GPAA 3I0RA 2MY8A 1UPPA 1QVGR 3CW2C 2KYXA 1VBKA 5AXKA 3KYLA 4DPWA 5E2QA 1U1KA 4IH6A 5IZHA 4IH7A 1SC6A 1R89A 1JLFB 4OYXA 5A8KA 4B9SA 5BYSA 1O8BA 2BEFA 4WTOB 2WVCA 3R1LA 1EP4B 2F65A 4DQQA 1IBMJ 3M9NB 4KO0B 5L1KA 2HHHJ 2MB0B 5KT6A 3C46A 4C3LA 2FDNA 1GH8A 3OR1A 4KHPJ 5D4OA 4Y3CA 2GQCA 4N77A 4YOEA 1FKOB 2MKSA 4ECTA 2EVZA 3HCXA 2J0QD 4J91A 3T6BA 4H4OA 4O3OA 5H9EK 2B6AA 3JB9k 1CG2A 3EWGA 3MM9B 3VGVA 1V3ZA 5LMNJ 1AUDA 3M1VB 3NCPA 2DVIA 4LF7J 4ECQA 4ZCIA 4DQRA 4I67A 4C8YA 5LOQA 3HVWA 1WC6A 4I4BA 3DLEA 2J5AA 2VBZA 3K57A 3CCQS 3BSAA 2C3PA 4U7UD 2KXHA 1U25A 3R1HA 1JLGA 4AFFA 1WTBA 1S6UA 1RAIB 1SPBP 4WP9A 3PNIA 1XMQF 1ZPWX 2JL9A 1RT2A 1JMTA 5K8MA 5E3AA 4IYQA 3K2YA 1FX4A 2ILYA 2MY7A 5KG6A 1KKHA 3K8WA 4C97A 4GMKA 1J5EJ 5D4PA 3NWGA 3HK2A 1FFGB 3OVSA 3R7NB 5HMWA 1JLQB 2IJNA 4FVCA 4WYLA 3OL7A 2V4RA 4ZP7A 4PRFA 4K4UA 2APOA 4HT7A 3W8PA 1Q81T 1U6FA 2IVYA 3EZUA 2B5JB 1ZA1B 1T9TA 2HAIA 2KT3A 3ISNC 3M8PB 1SL2A 1RTIA 1S57A 1VBXA 1ULRA 1U8SA 1L3TA 4UY8T 2H51B 3GFXA 4PQAA 2KN4A 1Q8KA 3GFHA 4BWMA 1GNKA 1MG7A 3VALA 4FKXA 4DF8A 1N5YB 1RBLA 4UQGA 2QG9B 1M1GA 2GHWA 4JI6F 2ZJRQ 2GAGC 3EGVA 4B3TF 2E9TA 3MPVA 3MR7A 4N76A 2DHXA 3T6JA 2ZKTA 1CQMA 3KXDA 3KDOA 1VK3A 1S76D 3DLGB 3O6QA 3GJRB 3VGTA 2RH3A 3VVUA 3Q8YA 3TARA 3MEGA 2LXFA 3KLHA 2NYIA 4IDKA 3ZTSA 1NEEA 7AT1B 5D78A 5DDRC 3QT6A 4AL7A 1G7CB 4WCEQ 5ETTA 5J2NA 3BGUA 2NZ4A 2O66A 3KK2B 1I3OB 2ZBQA 1DY3A 4ES1A 1RWNB 1IKXA 5T14A 1UJ4A 1F3VA 1SV5B 1WSRA 1Y4ZB 2FZKB 3BH7B 3HHLA 2L9WA 3FNNA 3GLJA 3TUJC 1S0MA 1HBUB 3MM8B 1D9AA 1HIYA 1TL3B 2CJ9A 3ISZA 4P9SA 1VK8A 3QLHB 4Q44A 2RS2A 3NY0A 2BR0A 1RHKB 3HSGA 3OQ2A 1KOHA 4NA1A 4UZCA 4NLYA 4A8OA 1HQEA 4N5SA 1H38A 3NAIA 4NASA 2UVRA 2F4VF 1FJGF 1RT6B 1UCNA 4CTAB 2KRBA 4LR7A 2M8DB 1FJ7A 2CFXA 4C8KA 3J7YU 3AXKA 3BGOP 4NEZA 1IM4A 1I5OB 1O0PA 4LFBJ 2MKJA 4KQZA 2LDIA 1R8BA 5HQLA 3GG1A 3M8PA 1U2RA 4DCPB 2PO4A 2YX1A 3GSIA 4DG1B 5FDLA 4L75A 1HNIA 1OYEA 1GX5A 2XC9A 3GJTB 1VQKS 4AT1B 3KWMA 2RQ4A 3D0IE 1S6QA 1D8ZA 3FCHA 3NBPA 4ZPWR 5ETLA 4DF4A 4OZ3A 4AQYF 1FVQA 4CTAA 2QLWA 3SV4A 2KVQE 4F0MA 1OSCA 2VKZG 3GYGA 2YWWA 3J80U 5D3GB 3CJ5A 2PI5A 2GX8A 3I82A 1RTHB 3R97A 4DR2F 2UUWA 5F8LA 5H9FJ 2CKWA 3NLCA 4DMZA 2DHHA 2IM2A 2XBPA 3IP0A 4OHWA 3TYTA 1SJ3P 3VAIA 4PZVA 4X65J 1S6QB 1OY9A 2HQDA 1BMQB 1WJ9A 3D7SB 3T5LA 1RTJB 3MM8A 5BXIA 3NS6A 4LF4J 4H4MA 3DLKA 3AD7C 2H9ZA 3FVYA 1G2EA 1YJUA 4PABA 4TY9A 1JJHA 4P2FA 2XS7A 2F1FA 3LWLA 2HHUA 5DQHA 4WZQA 2JFDA 4ZS6A 2OLWA 3M05A 1PG5B 3R7SB 1KFSA 1WHYA 4AXJA 1N5YA 2KFZA 2Y1LB 2UUAF 2GJ2A 4R0JA 1IKWB 1T94A 4NLOA 4RW7B 5ETSA 4QYRA 1NDCA 3MM7B 2CJAA 3THTA 2EW9A 4LRFA 4YB5A 1LKZA 1Q16B 1R8CA 3CJRA 3GU0A 3BO3A 1RAAB 2JLEA 2N3LA 4GVBB 4UUXA 3DMJA 5GMKa 3OUYA 2AGPA 4RO0A 2ZH6A 3TANA 1M5OC 1C4AA 2NXUA 2HWTA 3HO1A 1PYOB 3KMQA 1JB0C 2ZBIA 3Q2SC 2MSTA 2JEIA 3UD3P 2UXCJ 1HPZA 4HACB 4ZVGA 3V81A 4KPYA 2GVDA 2J9DE 3MEEA 4DWIA 1KNZA 3QAEA 4USJC 1RP5A 2R4FA 2B43A 4CWBA 1SJFA 2IJRA 4MIAA 2V8DA 3G8SA 2FVQA 3G6XA 3PW4A 1T3OA 3IMQJ 3P4UB 4GVLA 4KR0B 1AB8A 1JLAA 5KG1A 3Q8QB 5DETA 4ER8A 4DR7F 1R31A 1R6YA 3IAS9 3TJAA 1Y11A 4OYIA 1N6QA 2H1YA 1HA1A 2KB2A 3KJQB 5IQ6A 5B0AA 2YQ1A 3EVOA 5HVHA 5DDOC 1BQMA 4PXCA 3MM6A 2YKMA 3A8KA 4RW8B 2OFHX 1FDDA 1RU2A 2BE2B 2CPEA 3HHLC 2HLTA 3J7ZT 1XWLA 1RT1B 2YKNA 1WF2A 1M5PC 1IKYA 4CO3A 2AGQA 2UVVA 1TV6B 2QYGA 3K58A 2ZH5A 5KG7A 4TU9A 1NJWA 1NKEA 3ET6A 1JLAB 3D28A 3PO4A 1Y3JA 3SFUA 1HHTP 4IG3B 4EZ6A 3QSIA 2ZBCA 1ZS6A 4ZLLA 5DG8A 2CVIA 3T1HF 4HKQA 4DR4J 2V68A 5CCLA 2RHSB 2R8HA 1MWYA 3KK3A 3VQTA 1FO1A 3W62A 3ZZZA 2NPFA 3W1YC 3JXOA 3G4SS 4Q7AA 5B0FA 3GFZA 1V9OA 2C2RA 4B9LA 3QJPA 4W98A 5EHHA 5B08A 1S1UA 4Y6IA 2V8GA 4X66F 3BSNA 1WELA 1WUUA 3X1LB 4A8SA 5A76A 3W5ZA 3VR1A 1S48A 3EGNA 4ZVFA 4A47A 1X4DA 1HBUA 2RNEA 3D3CJ 4ETXA 3PX4A 1RWOB 1YJTA 4JI2F 2HFZA 2QL9B 4C4WA 2JOQA 5HI7A 2DKOB 5K8NA 1W26A 2VICA 3IWLA 4CZCA 2V8HA 3PJXA 3PFOA 4PUOB 1YJRA 1SUQB 3FC9A 2K06A 2GO8A 3HFKA 4OZ1A 5HAOA 5JJBA 1SJ4P 1CLFA 5HP1A 5KFMA 1N34J 1FESA 1WC5A 4KRWA 1MMDA 1WC0A 1X7VA 2IRYA 1UETA 4QIWD 5DGBA 5J2QA 3LA0A 5HBMA 2C2OB 1H6KX 5FD1A 5E3CA 5D0HA 3J81Y 4ECRA 1S1WB 4JI6J 3SV3A 1VQYA 4FN5A 4OLPA 4A8WA 5CXTA 4DV3J 2B9YA 3U1NA 2HK3A 3RGIA 1LWFA 2DITA 4C2MA 2LXUA 5CYJA 2HQCA 4QIFA 1SKSA 3GIRA 1XJWB 2RRNA 1VC0A 2MMYA 1F2GA 3H2VE 3A12A 5GAGI 3K59A 2M7SA 4LRDA 1R3NA 1WTFA 2GGPB 3KMSA 3MMBA 1FRHA 3H5YA 1WKKA 4HTJA 1ZTTA 2R7UA 1JLBB 3GP9A 2DHGA 3HXMA 1S6PB 4CT9A 1VQ6S 4DDFA 1T7PA 4X84A 1PYSB 3OT9A 3MR2A 5F8JA 2CQ0A 1TL5A 2VFTA 4DX5A 4JOUA 2ZE2A 5E7OB 2V34A 3TA1A 3T5KA 1Y0HA 1PYTA 3THVA 2WOMB 3UE2A 3V6KA 4MK8A 3TA2A 1AA1B 4X62F 2MGZB 3G6VA 1HNXJ 2Y8WA 1ROFA 2CQDA 4R0EA 5FIIA 2DO4A 4O4GA 3OV7A 3PY8A 2E1CA 1G6BA 1FK9B 5F8HA 3V6HA 1ZAWA 4EU0A 4I2PA 1AUSL 1QUVA 4GC6A 1XC9A 3EPGA 1UVMA 1H2TZ 2K1RB 2QMXA 1MU2A 1WDTA 4V1Ak 2XCPA 1SC4B 2R7RA 3LF0A 3W64A 2CJBA 4Q45A 3CCUS 2E9ZA 3M8QB 4FXDA 2MJNA 5K20B 1FXDA 2PFDA 1NK0A 5HQ8A 1NK5A 4H4KA 5AT1B 1BGXT 2ZWPA 4BHQA 4X4RA 3KLIB 1CULB 3BR8A 3HSDA 4MH8A 1JJ2R 5FJ4A 1RACB 2BW2A 1OWXA 3GONA 3IS9B 3N6LA 1HARA 1S7HA 1F9EB 2LXIA 1IBLJ 4USUA 3OL9A 1H74A 2YNIB 3M8WA 4K4WA 2ILZA 2IPOB 2KI2A 2W25A 3DRPB 4Z37A 1U48A 4JI2J 3ETMA 3K5LA 4LF9F 4NLRA 3AOCA 2CPZA 1X4AA 1PCAA 4ZVHA 4N47A 2KO1A 1IBMF 3NS5A 1F5AA 4C8MA 3HHLD 4L6V3 4ZJOA 4A8QA 4DV2F 2ZHOA 3BREA 2GS8A 2HGNA 2ZITA 3NGUA 4J9VA 3W9JA 2ALZA 2FY1A 3TJ9A 2W9BA 4DX7A 1FRJA 3KTQA 3E2EA 2C3UA 1RT1A 4K50A 1B0TA 1GEHA 2ZZNA 4ZCLA 2VA2A 3JTNA 3RBDA 1B70B 4P7VA 2Z4PA 3QBCA 4TXSA 4RUCA 4IH5A 4P2SA 2HHVA 2H4WB 2LQ9A 5E5NA 2D3OR 4DV3F 2M70A 1W2IA 2YWGA 3CE8A 3UVJA 1LW2A 3HT3A 3WDOA 3H40A 4J9OA 2C28A 4F3MA 4RW6B 5BYQA 4RZRA 2Q1LA 5G0RA 3TW0A 2C2NA 1PSDA 3VAJA 1H7WA 4A46A 2OPRA 4U96A 5C24B 2DR7A 2DGTA 3M30B 4NRTA 4ED5A 1FJEB 5AE1A 3BN4A 1GXLA 1BWVA 2H48B 3UFCX 2NSBA 4FXWA 3RAQA 2QLBB 1U49A 3N01A 3GMGA 4K5RA 3AXMA 5K8PA 4P2MA 3I5AA 4DUYJ 3FBEA 1N5SA 1YHQS 3T9ZA 1T11A 1IWGA 1U0HA 4RU9A 3AOAA 1M5KC 1S1XA 1WF0A 2K2PA 4RBUA 2RU3A 3R5DA 4DSEA 5ADZA 3MEKA 2WK4A 3OR1B 3MAHA 4J7CA 4OZLA 3DHXA 1NJIT 2WSEC 3EICA 1JLCB 1FKOA 4TVAB 4B3RF 2ACYA 4J9PA 3TQEA 2ZFHA 1D09B 4M5KA 1VI7A 4I56A 3VZHA 1JNRB 3K7RA 4F2SA 3N5BA 2A2DA 2GQQA 1FRLA 3OTEA 4UQTA 1MLAA 2MHNA 3RU0A 2YX7A 2BQ3A 3HZEA 2BV3A 1L5UA 4LF5J 1WNEA 2P6SA 1FHTA 3TQ1A 2ZOFA 4DL6A 1CSJA 4K4YA 3Q2TC 2HRUA 2Q43A 3JQJA 3CJ2A 4FYVB 4USMA 3QRPA 1TZ0A 4LF1A 4C8OA 3JQKA 2FZGB 2C2DA 5E3QA 2M88A 3KLIA 4DL5A 4LUBA 1UWBB 3L7PA 2R7QA 3BEGB 3NOCA 4MMOA 2UU9J 4JV2A 3PHTA 4HH0A 1CC8A 1IBLF 1YLXA 5IT4A 3BV8A 3TAMA 1Q78A 5C24A 3PW7A 2W4DA 1QVFR 1H72C 1R0BG 3MUVP 3WC2A 4DV6J 4ZVSB 1MN9A 4OHVA 3V81B 1AZSB 4I7FA 3VGSA 5KFEA 3RBZA 5L1IA 4Q0BB 1KTQA 2HHQA 4USWA 4NA2A 2AYMA 1SJQA 1YJ9S 1FWKA 5HVFA 4IG0A 2MPUA 2OUGA 5LMUF 4ELTA 2G0CA 2VPXB 4J9SA 3UI3A 3CC7S 4KHPF 4C6AA 3G8QA 1YSJA 3KHRA 4OZJA 1Y5LB 3ZC4A 2HWHA 1R43A 4NPOA 5D8HB 2I6WA 2YH0A 1UW9A 1VISA 2CJKA 1URNA 2XS2A 2KXFA 3PVXA 3C8YA 3LGNA 4CM0A 1CQNA 4WK3A 3TO8A 1Q8BA 2WHOA 2E5JA 4KV8B 1KSPA 4N56A 3QT7A 1WG1A 3DFEA 3RAMA 5ITHA 4LMZA 2BE9B 5CYMB 1FKAF 2XB2D 3T1YJ 2QMWA 1NPKA 4ZMMA 3FBCA 2QJ3A 1QTNB 2CQPA 2YWHA 4UZBA 3EXCX 4J9LA 4DQIA 4TU7A 3MMCA 2LP4A 5F8NA 1HBMB 2HBYB 4X4SA 4RU2A 1GX6A 4NX9A 2KM8C 1FFWB 3G71S 1XIQA 1BY9A 1JNZB 5HP1B 5DS7A 4EO6A 3O44A 2RB7A 2PE8A 2DGOA 4PR6A 5F9NA 5J2QB 1DBDA 4LBHA 1LXNA 3Q22A 4F8RA 3CCTA 2OPQA 2GVDB 2K1RA 3MEEB 5DQIA 2W7PA 4C9DA 1HHSA 3OFFA 1P6TA 4QR1A 1PIEA 1HWLA 3AA9A 3FBFA 1IUJA 4DV7F 1QAIA 5J1PA 4CNYA 3R8YA 3MMCB 1BWEA 5HROB 2ZD1B 1LQ9A 4NLQA 2VONA 3K8VA 3CCLS 2VFUA 2UUAJ 2QFJA 1CC7A 4B3SJ 2RAQA 1S72S 3KK1B 2RDJA 4CLWA 4P7TA 1CJVA 1RKIA 4KT0C 1IXKA 2CQGA 4WIQA 4CLTA 4JI0J 3FMWA 1B64A 5L1JA 2JFKA 3AD9C 4F7VA 3D6HB 5EDWA 2HBQB 5F8MA 4MIWA 4ZVRB 4F02A 4X4NA 3SDEB 3D54A 4KE5A 2KZZA 2O01C 3P5TL 1VHFA 4HI2A 1RCXB 2JJ4D 1FTCA 1HD0A 2AX1A 3ENWA 3HSJA 3X3UA 4X4TA 4PUOA 1DJ0A 3SIPB 1DTTA 3R2CJ 2RQKA 3F0NA 2DR5A 2E5LF 3RRKA 3VGUA 3C14A 1X9MA 4G65A 3CCMS 2EC2A 3AY0A 5F0UA 4DV6F 1M90T 3C6UA 1IR1A 1GTEA 2IDEA 2L08A 4DOZA 4J5OA 1TL3A 2WW8A 3KDNA 1HYSB 2MLYA 4K4XA 2BM0A 3EVWA 1X4FA 4ZVTB 2XMTA 2Y0BB 2ZKUA 3BR9A 1Q7YT 1L3UA 3H2LA 1RT6A 2O5DA 1J2VA 1S1TB 3MTKA 1X9WA 5KT3A 2X51A 4DQPA 4DN9A 3H4DA 3PW0A 4L76A 1CJKA 1X4BA 4K2JA 1ACMB 3WQPA 3NEKA 3OLBA 1HR0F 1TR0A 5I4MA 4KHMA 4NLDA 4CLLA 1OPIA 4YR2A 4OX9J 1X31C 2LEBA 1ZAVA 4ENOA 1N54B 3TI0A 5KAKA 4ZP8A 3D2WA 2KVIA 2FJEB 4MK7A 3GCWP 4LF6F 4G1PA 5GAGU 2FZCB 2HWIA 3QATA 1HBOA 4MFBB 4ZCKA 2FJDB 4ZPBA 3W2WA 4RUHA 4PAAA 4ZITA 3GB0A 2BZ2A 3US5A 5C2GA 7FD1A 1HNZF 4OZ0A 1TAUA 4DR3J 3HVTB 1RUSA 4WKRA 4K4TA 3PRBA 2NLWA 4R5PA 2FHMA 1F5BA 1WI8A 2NCKL 2NZCA 3GZ7A 5EUHA 2MQQA 1O6XA 1DQAA 2PT0A 1DURA 5THWA 2DGXA 3QIDA 5SUHA 1ZTWA 2MZTA 1KDNA 3LOUA 4X65F 3HD1A 3Q8RB 3K5MA 1XQIA 5EGYA 4NXNF 1RA6A 4NZ6A 4DQSA 2R7VA 4USKA 5IXUA 5GAHU 2HFSA 2YQ3A 4LF4F 5HN0A 1RTJA 2VPWB 3CIMA 4OV6A 3Q8VA 3SCLE 2HZVA 3RRGA 2EI5A 2YWKA 3B78A 4ED0A 1YIJS 4EBDA 1LFPA 4ZVEA 3PO5A 1U26A 2K7KA 3VAMA 3UQSA 1D9DA 1H73A 4RW9B 4WU3A 2KFNA 2BE2A 2GNKA 2G1DA 3DRRB 3NKYA 2Q6CA 4NYZA 4F36A 2YKNB 1LWCA 3UDCA 2AWZA 2QA4G 2AKWB 4F4AA 3UWTA 3CB4A 1M1HA 1OMSA 4KH0B 2VG6B 4ED4A 5C42B 5F0WA 3KLFB 3CMAS 2KJVA 3FSYA 3GV7B 2EFPA 2HMIA 4WF9Q 4DSKA 1V5VA 3MAQA 2E7XA 1EQMA 1HI8A 1JKHB 5DZ7A 4ZJQA 1TTHB 5LXYA 3ZZ0A 3H8YA 1J27A 4ZOSA 4FYWB 4ZDNA 4F0KA 3IBCB 5DRKA 3PFEA 3AJDA 3BPDA 3IGVA 2BJ7A 1UW4A 1ZM4A 3C14B 1I94J 2OIHA 1XMOJ 2UU9F 1EQ0A 3KG1A 3AAWB 2CDQA 5D4LA 1GMWD 3Q0AA 4XAKA 2GZOA 1IN0A 4ZPVR 4DPOA 3DLJA 3NP5A 1HNIB 1JLFA 2IHR1 4DPTA 3RR7A 2HKEA 3M8SA 1U1NA 2W9CB 3ULHA 2G1HA 2RKIA 2YNFB 3CJ4A 4YR3A 1FDNA 5DLFA 2JSXA 5F3TA 2N7CA 3EDRB 2QC3A 1KHWA 1RI7A 4IFVB 2PMWA 1VQLS 4DV1F 3LWMA 1B99A 2FD2A 2HFOA 2I8EA 3GE9A 3HDSA 4PXDA 2W7OA 3V6DA 4OI6A 3TAPA 3KNGA 3TP2A 2WBRA 4YMEA 2HW3A 4NLUA 3M1VA 3R5GA 2FJAB 4KFBB 1QAXA 2CQBA 2XYHB 4LRCA 4OYZA 1PJ5A 3K5NA 4EYHB 2HPUA 2HQIA 4LF6J 2VPZB 3D1QA 4A8YA 5LSRA 4DS5A 4TYAA 4DL4A 2Y1JA 2FHKA 4B3OA 4DR4F 3CEDA 2AMCB 1ZM9A 2DHAA 4DV4J 3GJSB 3HP6A 3KJFB 4G3IA 1UJ5A 5DG7A 4GKJF 3MAAB 5EN1A 1KFDA 1OIAA 1YVFA 4K5SA 1SKRA 3PG9A 4NRUA 2B9EA 3H59A 2IFXA 1S0OA 2H54B 4EGLA 5HROA 2DJWA 3EX7B 3JYTB 2HNDB 1SQGA 3KUGA 1RCOB 1S79A 2YPZA 3TZZA 1YBTA 1M5VC 1AW0A 1S49A 4M5LA 2JHEA 2QLFB 1WEZA 3MUTP 3E3XA 1OY6A 1G4CA 1LK5A 4QYZJ 4WBFA 3L95X 1RYRA 1YJVA 4O3NA 1X4CA 4OI1A 1UPMB 3UR3C 4PQUB 2OFGX 3ENAA 3M6WA 4KB7A 4CO0A 1B3TA 2Z57B 1HI0P 4H54A 1U1LA 2XZDB 3GFYA 5A8WA 2PD1A 2XO6A 5JVHQ 2G4BA 5KFGA 2A3JA 2J8SA 3MCMA 4OZ2A 1P8GA 4BBYA 4LBIA 2FC8A 2CG4A 2XGQA 2XWYA 2UUCF 1ZOTA 4NCGB 3M2VB 2RE1A 3I87A 2GW8A 1DFDA 1K47A 3F44A 1Q79A 1HKAA 1AROP 4B02A 1N32F 3IN5A 2LKZA 3IBFB 2UXBF 5C42A 2DEIA 3CWJA 1Y5NB 2AYBA 3UNYA 4IQMA 4WFNQ 4A8KA 4JV1A 2FB0A 2OMLA 2VQEJ 4K0KJ 3PKYA 1Y5IB 1RTZA 4M63A 1HHQA 1FXRA 3PHEA 3A3OB 4LBPA 3HHLB 3LO3A 2EWHA 3NGRA 3Q83A 1KN6A 2VA3A 4C0HA 2OD6A 2DIVA 2HURA 5C7PA 3LAKA 2I1RA 4DUYF 1QSYA 3TA0A 2U1AA 1IQZA 3MTJA 3AD8C 4J37A 4OJGA 1FJGJ 2W9AA 2F4VJ 1CS4A 2IM3A 2DNZA 2LEAA 3JTPA 4A8XA 4AL6A 2OEKA 4CQ1A 4DUTA 1HWJA 5EWEA 2M0GB 1HMVB 2DNOA 2HFUA 1S1UB 1YGYA 2B56A 1N0UA 2B7CB 2HVEA 5D0RA 1LK7A 2HIYA 4EI2A 2FJXA 4YHHJ 4F0HA 4P75A 1HQUA 4OX6A 3J7Z5 3HVTA 2LLZA 3FRZA 1OS5A 2F8EX 4UW2A 1NSQA 3RB4A 3B8HA 3M8QA 3KLGA 1YI2S 1NDKA 2YNGB 2ZH4A 1FNXH 5HL7Q 2FVSA 3RR8A 5E41A 4Y34A 4GRSA 4AL5A 4MKVA 1RK8A 4NLVA 4PG7A 3RTVA 2XY7A 1JLQA 1X4HA 2BANA 2FLOA 2XG8A 1JQGA 5IC4B 2FLPA 3MM6B 1RT4B 3D1HA 1SL0A 1QY7A 4FKYA 3LP2B 2VC1A 4DR1J 2G9OA 3MUMP 4ED1A 1RSCA 4DR5J 3SQGA 2PMHA 2VG7B 1BQNB 1I51B 4ID5B 4LF9J 2DGWA 4DL2A 2DNMA 4URSA 4L72B 4DL7A 1WOSA 3MOZA 3TX0A 3KHHA 5CA5A 4YEAA 1UVJA 2OELA 2R9LA 1MNEA 4Y28C 1PBUA 4GKKF 3T1AA 2OAUA 2QV6A 2XZWA 4NMLA 2PI4A 4FYXB 4DJBA 2VF3A 3BKUA 4IKAA 1VJQA 4FDFA 3BBBA 1AYEA 2MYFA 2AJ4A 2U2FA 1HL6A 4DEZA 5BR8F 4QWAA 2CPJA 4DFPA 1RJJA 4QU6A 4FVMA 3H25A 1U0SA 4CM2A 1S9EB 4QIGA 2R8GA 4B17A 1FKPA 1BQNA 4ID5A 2MQNA 2XULA 4QZVB 5G0RB 3ENVA 4CO1A 2C3YA 1VQNS 3CUNA 3M2RB 3B82A 3MM7A 1K0VA 1LW2B 2HVIA 2C2KB 3IS9A 4KBIA 1TFYA 5HVGA 5DQGA 4OYOA 3RW7A 2CZ4A 1F9FA 1U7LA 2HNYA 4JV0A 4RNNA 3IM9A 1M5SA 2BANB 4J9KA 5KFQA 3GIJA 4K4SA 4DSLA 3MWBA 3QGPA 3AT1B 4MAKA 1XMOF 5A8RB 5KFBA 1S1VB 2I5JB 3ZZOA 4A8MP 2HVDA 4LR9A 2GMJA 2ASDA 1S12A 1WEXA 2GC8A 2Z2LA 3KFWX 3LW5C 2J7WA 4O4RA 4G1QA 5F9LA 2ZM6F 1AFJA 4KFBA 4CLSA 2CVEA 1EARA 2ZNYA 2MLZA 3OTBA 1YJNS 2X1GA 1HBNA 3ILLA 1S10A 2MQLA 2DNLA 4LFAJ 1T8EA 4EYIB 2R8JA 1HQ2A 2NYHA 3GYXB 1IBKJ 1YITS 3QO9B 4FYDA 4YHHF 1AXQA 2CQ3A 1VCTA 2CJQA 3PYFA 4HDHA 2HAFA 2HGLA 3CTRA 1B7FA 2LYVA 2LVWA 3R6LB 3UVJB 4ZVPB 3UN3A 2SXLA 2GIRA 3DGPB 2AD9A 4WZMA 1U09A 5LJ5Y 2VD3A 2MKHA 1BD6A 4WFYA 4X64F 3OVAA 1U1OA 3CCZA 1VS3A 4ECWA 2W2QP 1APSA 2Y1IA 1EAYC 2IAJB 2VUGA 2XI3A 2D9OA 3W5XA 2HRYA 4NXMJ 4F4WA 3TUPA 3I0SA 3AJ1A 4ILRA 5KFLA 5IV3A 4RUBA 1LWFB 1ICEB 4X66J 4GKJJ 1UVIA 1PBAA 1DTQB 2JLFA 2VBWA 4O4GB 2VZ9A 1NDLA 3BBFA 4PWDB 3CJKA 1QDUB 2QYCA 3CCES 3Q8PB 3FZBA 2BUNA 3ICLA 3UO0A 3VWSA 3J80Y 3C15A 2IMWP 1YKWA 2IYIA 4NL5A 2O67A 4P10A 5C5JA 4HVZA 2LA4A 4L74A 4DSIA 3DLLQ 2MKKA 5CHCB 3J7YI 2M3DA 3NNAA 2PEBA 1SUQA 4GKKJ 2OPSB 1CPZA 2FY8A 2HVZA 2B3TB 1CULA 1SCJB 2XO7A 3BS9A 1GK8A 4IFYB 3C19A 4WP3A 2RRAA 2L9DA 2V94A 3LAMA 1NAQA 3EGWB 4I68A 4Z2XA 1UA0A 1G3OA 2HNZB 1LWXA 3R9LA 4LF7F 4RKUC 1UTAA 1TL4A 2CPXA 3H0PA 4OJ3A 2EG1A 4DX8H 4DU8A 4W92B 1SBRA 1BUXA 1R8HA 3CDBA 3JYTA 1W2BR 4RW9A 3SSRA 1N32J 1L3KA 3M32A 1N5QA 5KFDA 3LGHA 2WSCC 5KFTA 5B09A 3GILA 2DBBA 4JI1J 3D6TB 3CDWA 4QOTA 4C7QA 2AX0A 2MKCA 4DI6A 1XR6A 4Q2LA 2YX4A 2CWKA 2E7WA 2JDJA 2JWNA 1VRTB 2RDIA 2AYGA 1XNQJ 3L9ZA 3CD6S 2RQCA 2H5IB 2PMZD 5CH7B 4P52A 3ZTOA 3CD0A 1XERA 2XLJA 2GGPA 2KHDA 1DQ9A 2GIQA 3PYGA 2I2YA 3CJ3A 4A4JA 3I56S 4DR7J 1D0EA 1VLOA 4ZHRA 1IQTA 3GJQB 4IG3A 1FCAA 1RGVA 1YZ6A 3BQ2A 3ITHB 3UCZP 1RISA 2RD5C 3FEZA 1FWLA 1IBKF 1RT5B 2K7JA 1RT3A 3KJVB 4KGXB 2HVHA 4TYBA 3C16B 3W65A 2ZOMA 4OX7A 1RWKB 5D15A 2WRMA 3PXGa 5ETNA 5CAAA 3TVKA 5HSPA 4HR2A 4B3MJ 2NXNA 2AGOA 4B3TJ 4BC9A 4AXIA 4ZLNA 2R7SA 3DDNA 1HNWJ 1KBRA 4X64J 1RTDB 2CQ4A 2Y3YA 3OW2R 2RDDA 1KLMA 4RW4B 2ZVSA 2WAQD 2JLGA 4R25A 1RU1A 2J6UA 4PPZA 1OQ6A 2CNKB 4N41A 2I0XA 2QTWA 3C66A 3FSXA 2HEKA 4Z7YA 2WSFC 2RILA 3VZIA 4DPYA 4L73A 2ZBPA 2DRBA 3OFEA 5KFRA 2HGMA 3UW1A 2VQFF 1VQ5S 1HYSA 2VDIA 4CH7A 2HMIB 3KLEB 4QQBA 1X5TA 1YRTA 1OO0B 3D6MB 3HSZA 1SB6A 2BW7A 1TKXA 2DXDA 4TLQA 3GYNA 2J76E 3E01A 5HBMB 4DS4A 4AYBD 3CD5A 5IOLA 3HLUA 2B6AB 1EETA 4IOCQ 2VG5A 2A0FB 3DM2A 5KT5A 1OY8A 1C4CA 1X60A 1SQEA 3MCNA 4DBQA 1QUPA 4K2XA 4DL0C 3G96A 2J0XA 3Q89A 1BXNA 4J9UE 1SVDA 3QRQA 2X3DA 2C2MB 4USTA 4LSZB 2BYCA 1TELA 5KG0A 2MXYA 5LMNF 3IR5B 1TKXB 4CLZA 4E8UA 2KT5A 4IFVA 5H1SV 2DISA 4ZIWA 1C0UB 3DYAA 3FUYA 4NYOA 3QNWB 2BJ8A 3CPWR 3VAHA 3ZZTA 3PR4A 3UD4P 4EEYA 1HNZJ 2HBRB 4A8FA 1MMNA 1OSDA 1WWHA 4JI1F 3SFGA 2Y0SD 2WVEA 3ZNUA 4O23A 3IR6B 1N36F 2WOMA 2J9CA 1R27B 3BZQA 4X2BA 2C2ZB 3R5CA 1TUGB 3ZFVA 2KL8A 1EIYB 4IRCA 3M4XA 4P72A 3D6FB 4QWCA 2Z2YB 2GAHC 1RHJB 2L48A 1QE1B 4GC7A 3OHAA 3DOMA 1CJKB 1VQSA 2XZTB 2OSQA 4LFAF 3B4DA 1SH3A 1BQXA 4IG0B 1NKCA 2ZC3A 3IRXB 1VQ8S 2VG6A 4KGVB 1TKTB 2YY3A 2BJEA 3LP0A 4ECYA 2V5HG 4NWBA 5ETPA 4M5MA 4TQRA 2RF2A 4ED3A 3DRRA 3OD2A 3WIVA 5C25A 2A18A 2QA2A 3SQOP 3B54A 1X9SA 2C42A 2BE7D 4M5HA 1PC5A 1PO6A 3J81j 1OQ3A 4I2QA 2XYGB 4DV5F 5L1LA 1RWUA 1PJ7A 1Y9OA 3M2UB 1NPRA 5J2NB 1KVKA 1T9VA 3DHWC 2DCUB 5SZTA 2FVCA 4OZNA 1ITPA 3ZTQA 1UWBA 5E3PA 4DU7A 5M2UA 4ECXA 4KTQA 2NS1B 2PIIA 5KFWA 3ILIA 3HKWA 2BACA 2XSJA 4M5JA 1QAJA 4K59A 2IJFA 3KK2A 3KK1A 1GFWB 1I6JA 3UR0A 1GTHA 1R7IA 2GCFA 1MN7A 4GVBA 4ALZA 5M2PA 4FBUA 1ZAXA 3ADAC 1UEVA 1Q7LB 2EKYA 4UF4A 1CVJA 2HS4A 4ERDA 3DGVA 3KLEA 2ZC4A 1HQEB 4TY8A 1WACA 4ILMA 1U1PA 2OGUA 2OMOA 4XO0A 4LVNP 4ZVOB 2BDPA 5ETQA 4ANDA 3ZZPA 2N3OA 2G2ZA 4TKTA 3FGVA 1RA7A 2AQ4A 1F3FA 4F04B 3I4PA 2OKQA 2CA9A 3S8SA 5ETMA 1ZM3A 3ZO7A 5HK4A 5KG2A 3RRHA 5LSOA 3T3FA 3PV8A 1TL7B 5KFVA 4BC7A 1VRUA 3H5UA 4L3NA 4DG1A 3RZAA 3OPKA 4OJHA 5IS2A 2CPIA 2XHCA 3R5AA 5CD4H 3MFHA 1VC5A 1NKBA 3BQ1A 4LSNB 2H65B 5IM0A 4LSLB 4DL3A 3ILOA 5DDQC 2ACMA 1BC6A 3OTCA 2ZH7A 3QIPB 1T9UA 5HATA 1C1BB 5LSLA 2WB1D 2GVZA 1D3WA 1UEUA 2OEMA 3J7A1 3BGRA 2HHWA 1HD1A 2GQ2A 1VJWA 2FHJA 3D66A 4B9MA 3ITHA 1D1UA 4DR2J 2E9RX 4RR5A 3EJMA 2X1AA 3KLFA 2V8VA 3L7OA 2DNQA 2CAJA 1DTTB 1WC1A 2VBXA 2OI2A 1GXTA 2IIHA 2W4PA 2F5GA 1MWZA 4PWWA 4CYUA 5KFOA 1NHVA 1QE1A 4PG6A 3OTOJ 3KLVA 2CPYA 2VIHA 2QO3A 4ZK7M 1NSKL 2Y8YA 5CYQA 2MZSA 3HI9A 1R0AB 2MKIA 2D9PA 2EFNA 3K5OA 3NS7B 4RBTA 4IDKB 1K44A 4Y2AA 4FF3A 5JXSA 3IAM9 2YVSA 3MDFA 3MECA 4OQJA 2ERRA 3BQ0A 2JVOA 5A0YA 2DGVA 2BM1A 2VG7A 2W4CA 5EWGA 5H9EJ 1E6VA 2H3EB 2ZJPQ 2XI2A 4U8VA 3R2DJ 2QN6B 3I96A 3TVYA 4CLKA 2ZD1A 2E66A 2ZVIA 1PAEX 5E0OA 1HWUA 3Q23A 1TFWA 3MZIA 1XBWA 3QLHA 5D0EA 5GADU 1FEHA 2X3GA 2VH7A 3N9UC 5DLGA 4F4ZA 2RMLA 3O5TB 4LFCJ 2XNRA 4PCQA 4FP9A 2HQGA 1ZH5A 2UXBJ 2O1PA 3D3BJ 5JUMA 1Q86T 2RJZA 2B5JA 3CMQA 4BWJA 2FGCA 1RTIB 2FPHX 5B0DA 1HBOB 4MFBA 3UN2A 4USIA 2OH2A 4ES3A 5AXMA 1TAQA 2E5LJ 2C3OA 2PGCA 5KTQA 3HM9A 3LPYA 1UA1A 4V19X 1NZAA 4QW8A 4HLBA 1MW7A 4UOGA 3R5BA 3W9IA 4USHA 3GSDA 3DU5A 2Q3PA 4WFAQ 3THPA 9RUBA 2XMMA 2V9WA 1KR4A 2KHCA 4M8LA 2BKPA 3RB3A 1NK6A 1J5OA 4C11A 1HMVA 4KO0A 1KHVA 5IFMA 3BO2A 2CXEA 1TK5A 4J9NA 1VQ7S 5LL6d 4QWBA 4JI8J 1HW8A 1XEZA 2NUUG 1VR6A 3M7VA 4CI0B 1CJUB 2L9NA 4CO5A 4TQSA 4QWDA 3WIUA 2ZH3A 2AJ1A 1RTHA 1PAUB 1JLBA 2QE5A 4UOHA 5F8IA 1LWEA 4FPRA 4C8NA 4ED6A 4UUWA 2QLXA 3HFVA 2UV8A 4KKOA 4YB6A 1NK4A 1VIXA 3BKTA 4ELVA 3QAUA 4NLXA 2OTJS 2EXUA 2LA6A 2XWXA 2AEFA 4PKDB 4RWWA 4HHUA 1WSVA 3HHEA 3PEJA 2IA6A 3CXCR 2BRKA 1TKZB 3MD3A 2E29A 2KU7A 4OYPA 1VFJA 4XDCA 1UZDA 2GVZB 5GMEA 4DPUA 3O1LA 1CBKA 3D0GE 4NLTA 2AEMA 3JSRA 2AJFE 1C1CB 2QL5B 4FS1A 4YB1P 3CO0P 3N79A 4HYKA 1KQFB 2Q66A 1JLGB 3H7HB 3NMAA 1Q5YA 3QIPA 4OV1A 3GIKA 4PXEA 3PX6A 4M94A 2H4YB 2HLUA 1I1GA 1RZMA 5IQQA 3W7BA 5CABA 4FNHA 3DI6A 4PG5A 2RSQA 3HHNB 2EK6A 5B0CA 2WZ1A 1UVLA 2CJXB 2DNRA 2EPIA 3NGTA 1R0CB 1RBAA 3NGSA 4LRAA 3MR5A 1F60B 3NCRA 3NMRA 2EFOA 4C8ZA 2HHXA 5IT9U 2EG2A 5J2MA 1NSAA 4E0DA 1N34F 2YQ0A 2ZUAA 3E8OA 2OJ3A 4O3RA 1IM6A 1NJXA 1JJCB 2XCAA 1NJYA 3DKDA 3CSKA 2GV1A 4GO7X 3W3SA 2LDYA 1X5OA 1O5JA 1RWWB 1N52B 2NXJA 2R3VA 2W24A 2RS8A 3AB2B 3N4WA 3VV2B 5IWAF 3VAKA 4YUDA 2ASLA 4ECUA 4IR1A 1RBOB 2H5EA 3RYLA 3TNVA 3JAMU 3MI7X 3HVRA 2AT1B 1CS4B 2ZH1A 2BXJA 3H2UB 3P49B 1W7WA 4Y65A 5GAEI 4CT8A 1LFWA 2W8KA 1VHIA 1FRKA 2XMWA 4ID8A 4F25A 3L7UA 4FF4A 3OXGA 1RT7A 2QL7B 4DZ6A 1S6OA 1DHMA 2AJ2A 3OBIA 3GV5B 1VQMS 1VOMA 2YKPA 1WOOA 3I9ZA 5B7WA 3HMJG 1S1TA 4Y0FA 1KC8T 2QFIA 2XY5A 1H2VZ 2Z56B 4QPTA 3SCJE 3EMTA 3ET6B 4WJBA 1C0TA 1KTVA 2DNGA 5FLXY 2BJ3A 3BF4A 1WHVA 2R8KA 1QLNA 1N5VA 1KVIA 2ATCB 1YK9A 2OHDA 2LFVA 3CJ8A 4M5IA 1LOUA 4I1TA 2EFVA 4R8UB 4B9UA 2POKA 2F40A 2OPRB 3C2PA 5GVQA 1YTYA 1Z4UA 2R2UA 3DRYA 1N48A 3OSPA 3PYEA 3NWRA 4LSNA 1J5OB 3SCKE 2QSWA 4IUFA 3PEHA 2XTJP 3MECB 2K8GA 3LP2A 3BH6B 5KFXA 3VVTA 2KM8B 1RT4A 1RAHB 3BSCA 3ZZUA 2ADBA 4ZLJA 1C1BA 1RHUB 2C1EB 2BJDA 2CUYA 5FDLB 4TNOA 8RUCA 3GV8B 1NBEB 3D67A 4FF2A 1JXEA 5DG9A 3NRBA 4G6VB 4FF1A 4CP5A 4U6PA 1RAJA 3CNQP 4KSEB 3GQCA 1C0TB 2CQIA 5J2PA 2BBEA 2B9XA 1K1SA 1WF1A 2M2BA 4NLGA 3FRYA 2KTQA 3C6TA 3KG4A 4FYYB 4QYZK 2PDAA 2YKAA 4ILLA 1FF2A 3TX8A 4A48A 3DMJB 1VIOA 3I5BA 2FVPA 4Y2KA 2HK2A 5U47A 3MHYA 3BYPA 1PC4A 1S9GA 4I6YA 4MKBA 5J1EB 2DY9A 3SXLA 3BGLA 2HBZB 2JEFA 1RQ0A 1SJ1A 1S1WA 1FXLA 1EKSA 3Q86A 2WB4A 2CADA 4Z7CA 1IBCB 4O0IA 1VC6A 1TK8A 3VAGA 1QAYA 3BN7A 2W1BA 5IT0A 1BHNA 1VRUB 1YBUA 2HFVA 3CDAA 3OFGA 3PW5A 5AE3A 3IC1A 3N5FA 3PYDA 9ATCB 4DV2J 3PIPQ 4EO8A 3C3LA 3M6XA 2BQRA 3U27A 5KG5A 5K9FA 3RJMB 3AB4B 6FDRA 3S7RA 3V5RA 2F8MA 1BQMB 2M5YA 2M9KA 1JXVA 2CQCA 4OYAA 3TEHB 3JSMA 1JXLA 4CLPA 2BJ9A 2IBOA 5BJRA 1HFEL 1Q8LA 3N6MA 2NREA 1FE0A 2D41A 3DLBA 2IVMA 3TAQA 3H5SA 2WONA 5L9XA 4DFJA 2NXCA 1F6TA 1TKTA 3ZTPA 2ASJA 3DOKA 2ATLA 4ECZA 4LQ3A 2ROPA 2VU5A 1FEEA 2M52A 3E51A 5CYQB 2M8HA 1R0AA 2LEPA 2AJQA 3HF5A 3VCDA 1VRQC 1I94F 2B4VA 3QQCD 4ZPTR 2CG8A 1WD6A 3M6UA 1TUVA 2AZ3A 1FDBA 3EM1A 3G86A 5KFNA 2CWXA 3AA8A 4HTIA 5KFSA 3UN5A 1T03B 2VV5A 1PJ6A 3OFHA 1JIHA 4AUKA 2FLLA 4JI7J 2V50A 5KFKA 3EXYA 2WONB 1WKJA 1QSLA 2X1FA 2VFRA 5J1NA 4U7CA 3MR3A 3DOKB 4JI5F 1FERA 2A1BA 4XTTA 4CH1A 1N0VC 4N8OA 4NLPA 2PEHA 3ZZRA 1V6HA 4DV1J 2JEJA 2VODA 1RT3B 1LXJA 2Z0GA 4JI3J 3P5BP 3PRVA 3GIIA 3CCWA 3CCSS 3AH6A 1QM9A 1H98A 1YG0A 4PXBA 4TLRA 2XMAA 4JI0F 2MZ1A 1IVZA 1F1BB 1K1QA 1M1KT 3D5MA 1TU0B 8ATCB 4LVOP 1RADB 3O3LA 2Q6BA 4LIWA 4NMXA 3T9NA 2W2OP 5KG4A 4IRDA 2L41A 2BQUA 2NR0A 3G8TA 4WPAA 4JV5F 4AQYJ 2KRRA 2YNGA 1RAEB 3QGIA 1XK8A 5AE2A 2G13A 3DOLA 3MCSA 4KAIA 4LFBF 2XMKA 4OYMA 3TZWA 1EJ7L 4KHRA 3UPFA 1HI1A 2XEXA 2Z30B 3DLKB 3CDEA 5G4DA 2GJFA 2VJUA 3CO9A 1S9GB 5J1EA 3ZNJ1 3J7AN 3CIZA 1IR0A 3SCIE 2N4DA 3I5CA 2A6OA 2ROEA 3A4TA 3QZ8A 1DZ5A 2BA9A 4JBCA 3UD5A 1TL1B 2CRLA 4DLEA 4F3QA 1HWKA 1IKWA 3A1YG 4H4KC 2GMHA 2YNHB 2RVJA 2D7SA 2KKHA 4ZP9A 1VQOS 4F4KA 1GQEA 3M2VA 1Y3KA 2YXLA 1F5CA 2W2MP 5LMUJ 5HMZA 2KYZA 3Q8UA 2DNHA 4ZP6A 3NBPB 3DOLB 1RKJA 2FGOA 2DIUA 3P96A 2B7BB 4RBVA 2CNOB 1A7GE 4XDDA 2DNNA 3MMAB 4TN2A 3ZZYA 4CYUB 1IKYB 2VC0A 1S0NA 4YY3J 1H0HB 5H9FK 4JP8A 1TV6A 1X4GA 4KC5A 4P2XA 5D3GA 1B4SA 1UFLA 1BLUA 3KUHA 2W01A 3MD1A 3C15B 1S0VA 3NXZA 3S01A 5KFAA 1YJ7A 2G2OA 2D1CA 2IA0A 2IRUA 2AF6A 3JSMB 4DFKA 2C2EA 4F4YA 1S77D 1FWPA 2RRBA 2CNLB 1C0UA 3DYAB 2ALYB 5CYMA 5ETVA 3SMZA 4PWUA 4QJVA 2V63A 3KJVA 3PACA 2MKYA 2J0WA 3AODA 2OEJA 4WP8A 1U47A 2EBGA 5A6WA 1UL3A 2VQEF 2UXCF 2W9BB 4WE1B 4WIIA 3OL8A 3MFIA 4J9MA 2RT3A 2YH1A 1Q82T 1WC4A 3RB0A 3KNAA 3MMAA 2UV8G 4PQUA 5KFUA 5IM0B 3FQKA 2JZ5A 1DARA 1URRA 2ZDPA 4RNOA 4X4QA 4U7UK 1X0FA 1S7IA 1NB2A 3H20A 1EETB 2WW4A 4Q5VA 4ES2A 4QPXA 3CJQA 5KFFA 2NPIA 2WCXA 1XR7A 3A8JA 1TL1A 3HJVA 5GADI 1RT2B 1WEYA 4FS2A 4DCOB 3CJTA 1T9WA 3FCWA 1SH2A 3FJ2A 3Q24A 1NM2A 4C3KA 2YWFA 4DV7J 1N88A 1CJVB 2MZRA 5DO2A 3OXLA 1HBNB 2DH8A 1W25A 2EEYA 2KDOA 3EDQB 3W2VA 5DGAA 4B3SF 3IWNC 2KZMA 3JTOA 4CIOA 4I64A 1P9YA 2R2RA 4IFYA 5C25B 4ZJLA 2FIUA 3D0HE 2ZZTA 4PPDA 4USVA 2ASYA 2HNZA 2O3DA 3B4MA 4J9QA 1U0HB 4I0WA 5F8GA 3H5XA 1K8AT 1QD1A 4I2PB 3WX4A 3IRWP 3H4BA 1FNMA 3NGDA 2XSJB 1B7YB 1RAOA 4O44A 1HBMA 1K0TA 1RWXB 5I3QA 1Z1ZA 4OLOA 2B8QA 2GFFA 3PZPA 2MZQA 3GR1A 4J90A 5CD4A 2KFYA 3IO1A 3KJNB 2VJVA 3TUIC 3BDPA 1QTMA 2V8PA 2MQ8A 2DHSA 3R27A 1S59A 3V6JA 2ZZMA 1HWIA 4B9TA 4HHJA 3DLGA 3K17A 2I38A 4KV8A 3W5YA 3QSYB 3QRRA 4ZIVA 1XNRF 3TOQA 3OLAA 4B9VA 1FKPB 2XMVA 2HYIB 3SYZA 1IJFB 3FFIB 1IWAA 3LP0B 2E5HA 2LQ5A 3PX0A 4DR6F 2DH9A 2ZDOA 3MM9A 4W90B 1RDRA 2W8LA 4O3QA 2A6MA 3AQPA 5KFYA 1UAWA 4C0OC 1D9FA 3C6TB 3EYZA 3T1YF 4M95A 8AT1B 2VFVA 1NXIA 5HLFB 3TR5A 4LF8J 1Y10A 3KG0A 4Q43A 1CJTB 5BR8J 4P71A 3DGPA 5HJXA 3IGNA 3EZ5A 5D0GA 3CF5Q 3UDVA 1KQGB 2IM0A 2PA8D 2YWEA 1WORA 3EVMA 3SQGB 3RB6A 3EGZA 3DDIA 4Q2MA 4ITSA 4RL1A 3HD2A 4ELUA 4N7TA 2RUSA 4NZ0A 4ZPAA 1RABB 3FMBA 1IR2A 4KIAA 1P9QC 1V3SA 1ZA2B 2AYEA 2JC1A 1FRIA 3PTWA 3S1TA 4X4UA 1ZETA 2GHVC 4JYAJ 2DNYA 3QT5A 3WZ0A 1WKLA 4W4MA 4C8LA 1WI6A 1XNQF 1S4EA 5A8KB 3WX8A 5MLCV 3FZ2A 1A9NB 4QR2A 2DR8A 1X5PA 1TVRB 4MKYA 4CDIA 2AV5A 1FA0A 3OTOF 1TMJA 4M5DA 4CO4A 4KH1B 3IA0A 3NNHA 4H4OB 1MU2B 4OZ5A 4G1IA 2OPSA 2KG1A 4RNMA 2NXEA 5D77A 1YRXA 4IOBA 1S9FA 2FJBB 5LXRA 3IXQA 3JSYA 5GAEU 1YBAA 3GR0A 4I6AA 2WVDA 4X62J 2FYXA 3ENQA 1SC1B 4KGMA 2Z2MA 4OIXA 5KFPA 4XIUA 1L3SA 6FD1A 2RU9A 4DPXA 4B3MF 4IQXA 1NUEA 1DTQA 4WWSA 3FCVA 2CQ2A 2HFNA 3MPYA 5L39A 4ZCMA 3A8EA 4MYUA 3QJJA 3PM9A 3K5PA 3ZXWA 2BJ1A 5LT5A 1SXLA 2C22A 4UOCA 1DLOA 2QT7A 3M8RA 1KVJA 2BOAA 1T05B 3WBZA 1S6PA 3HZGA 3IWXA 4NXMF 3I55S 1FD2A 1O51A 2N82B 1EX8A 2D74B 2UUBJ 2DH7A 4L3KA 4DV0J 2CZVC 1XR5A 2R2SA 2BMBA 2CJYB 4WXWA 1T9YA 2MGZA 2HHPA 3QGHA 3QO9A 2FJWA 4J9RA 1L3VA 1KD1T 5K14A 3DNCA 4OHZA 3IM8A 2MLXA 3O2IA 1N4LA 2AEJA 4LSLA 3EE3A 3MM5A 4NZ7A 4IRKA 1VMBA 3IBWA 1AT1B 1RYSA 1UWAA 2J6SA 1SC3B 1UFWA 1NU4A 2H5JB 3TVZA 3HJFA 5T7LA 1N56A 4HI1A 4ZPDA 1LW0A 2EBEA 4HEA9 3V4MA 5L46A 1RWMB 1NPPA 4ZVUB 2XS5A 4MKAA 4X4OA 5I42B 1JK9B 3HPOA 2DGQA 4ICLB 3OVBA 2Q79A 4F26A 4YB7A 2LQBA 4KKOB 4OX8A 3DRSB 3RBXA 4EBEA 4E98A 3RAXA 4XPEA 3N6NA 1YWXA 1SH0A 3P8BB 3OR2A 4M5GA 1FX2A 2E1MC 1SKUB 1UVKA 2YNIA 3TJ8A 3M9MB 1NK7A 2AJ0A 4M5NA 3UNGC 1ELOA 1NB7A 3CVKA 1Q0NA 4WFXA 1SL1A 4TY8B 1WHWA 2HHTA 2P6TA 1GAOA 2NUHA 3LGMA 3CJSA 3BB5A 2DTJA 5A2QY 2DGUA 4DV4F 3AQOA 3MEDA 4AD6A 1EKRA 4UOFA 4U8YA 1C1CA 3G6YA 4PYDA 4CNZA 3CC2S 1F0XA 2V69A 2N7YA 5DM7Q 1RAFB 2DO0A 4ICLA 4H4MB 5AJ3F 2OPPA 2FJVA 3AFGA 3NNCA 4YFUA 4C3MA 2Z8QA 3DRSA 2DT9A 1NCLA 3I0RB 3N0VA 1Q4RA 5KOWA 3KK3B 2ZH2A 2LCWA 1KQSR 1PGZA 2BOPA 3HHKA 4P6QA 3BPSP 4XK8C 2EFGA 2V4JA 4RPFA 1U45A 2DR9A 4KY3A 3V6DB 2VB6A 5F41A 3L4BC 4NA3A 2KT2A 3TUZC 1VQPS 4NE9C 2XLIA 3HX9A 1S1VA 3MM5B 5DDPC 2DRAA 3RW6A 3F41A 4B3RJ 2IY5B 4IOAQ 1TK0A 3A3PB 2RF2B 3DC2A 4YDXA 1PKUA 3MF5A 2P2CB
chains in the Genus database with same CATH topology
1ZPVA 1GXUA 1LW0B 3IR7B 4FNIA 1SIWB 5F3ZA 1FRXA 2F3JA 2FVRA 2XMUA 2ZE2B 2GHPA 4LF5F 2OTLS 2HS3A 4C11B 4NOHA 1ZZFA 4RNHA 4RX6A 2LMIA 4Q0BA 2FUG9 4JUZA 3VAFA 2GA7A 2ROGA 4MJKA 4O3SA 5M2RA 2UXDF 2V9KA 1H2UX 4QW9A 2KXNB 3CCJS 7FDRA 1FT8A 2FLNA 3OHBA 4X4PA 3QJLA 1LWEB 1Z2LA 4M1KA 4RLEA 2B51A 2K3KA 4C0BA 4Y2IA 2PC6A 5CQGA 5B0EA 1E6YA 2UP1A 1ZM2A 4JI3F 4LJMA 2HNYB 5L8RC 4B3OB 3CC4S 1N6QB 1U4BA 4IO9Q 4B08A 1HNXF 2ZHBA 2JVRA 1EP4A 3I4HX 1KRPA 3LANA 2IYGA 2LU1A 3VTIA 2QRRA 1DRZA 4G1QB 3P3DA 3N28A 4OHYA 2VFSA 1N48A 1REVA 3DDKA 4I2QB 5E33A 2WBMA 2V4QA 4DLGA 2C3MA 1PILA 1FDAA 1NRKA 2DCLA 1YJWS 3DRXA 1DLOB 1N5TA 3P6YC 2UZAA 3V4IB 2VASA 3CGIA 3L3CA 1TVRA 4AE5A 3MR6A 5JVGQ 4DR3F 5GAHI 1L3TA 3MEDB 2GO9A 2PSZA 1A6LA 1Z2ZA 4OMFG 4R5PB 1XN9A 1G1XA 1U2FA 3W2WB 1FJCA 4HL9A 3U1MA 4DUZF 1M0SA 3LALA 4LIRA 3VQSA 4RW7A 5CCMA 4DR1F 3PW2A 2NSCA 2UUTA 4DR5F 2OO4A 4RW6A 2R7XA 2JEGA 4QIEA 4IR9A 1U1QA 2KH9A 2J0SD 5DM6Q 4ED8A 4Y2MA 1NH7A 2JC0A 2V0NA 5HO4A 4I6WA 1HPZB 1KS2A 2DGSA 3M2UA 4OHXA 3OJUA 4PRFA 4BDPA 5CZXA 1UJ6A 2A10A 2P9EA 4X4VA 4QCLA 3OXFA 2IM1A 2RUGA 3PR5B 1Q53A 4K4ZA 2F7VA 2XLKA 5HMXA 4V19J 3NG8A 4EWTA 4LFCF 1LWCB 1RT5A 1NH8A 1JJ4A 3OL9A 4WF9Q 2B4PA 4URQU 1UKUA 3BM7A 4GO5X 4WFZA 4ZA1A 4DHVA 1TKDA 5I3UB 4LT6A 3V2UC 5KFCA 1MROA 3OSNA 5I3PA 3DCAA 2PFFB 5L9NA 2EK1A 2R7OA 1IKXB 5E3RA 1AFIA 3ONQA 2B4OA 2RQMA 3F73A 2IRXA 3KLGB 2MZJA 2ZHAA 3DXSX 4U9RA 1YRUA 2LQJA 2IC3B 3M32B 3G9CA 2VKRA 3H98A 2QA1A 3OUYB 4JI8F 1KONA 2MHEA 5EX0A 1T95A 1B0PA 1V3RA 3CDUA 1HW9A 5L38A 4OI3A 3SI8A 4Y2CA 4ECVA 2W9CA 2B0GA 4OI2A 4HDGA 5A0YB 1VBYA 5T41A 4DN0A 1E6VB 4MIBA 2OSRA 3SEOA 2QA4S 4N8NA 2CQ1A 5KFZA 2F9DA 4EUVA 1Q1KA 2KG0A 4OX9F 3U02A 5A8WB 1TP7A 3MOJB 2VG5B 3DM2B 2AW0A 1U1RA 2DB1A 2JX2A 2ZOGA 4ATNA 3MEGB 5BYRA 4C98A 2OD4A 3KLHB 1XTZA 5HLFA 1DZ5A 2BVZA 2XMJA 4RUAA 2COLA 2NQPA 4O3PA 3MMBB 2YKMB 4RW8A 3CT9A 1P27B 1Q8IA 5I3UA 3MMJA 2MQPA 1UVNA 4QU7A 3L09A 2DNPA 2CPFA 5KT2A 2HNDA 4Y00A 3NGKA 4QR0A 4ETZA 2MQOA 4YR0A 2QSFA 2YTCA 1J5EF 3NCQA 1XMBA 3FDSA 2AU0A 1SI9A 1YQHA 1Y7PA 4ZLPA 5J2PB 2EFQA 2IVFB 4QWEA 4ECSA 1FE4A 3QMQA 2DPJA 4DSJA 5B0BA 2GJIA 4EBCA 4YP3A 2KJWA 3OL6A 2CYYA 3HKZD 4IO1A 1JKHA 2XGPA 2JRSA 2YKQA 4LF8F 1UMJA 4YY3F 1SKWA 2L3MA 2ZJQQ 5K5MA 3F56A 5B0GA 1KQKA 3UCGA 2FTRA 2PN6A 3DXBA 3T19A 1H7XA 2VOPA 2HIQA 2RKIB 2YNFA 3DLHA 4MK9A 2VPYB 4NCAA 1K73T 1MROB 3QYYA 2HG4A 1VRTA 2IC3A 4K4VA 3SDEA 2LECA 2XY6A 1IKVA 1VLYA 3GIMA 4F3OA 1TQLA 1SJRA 1FRMA 2ZUGA 3E01B 1H3DA 1ZZNA 4YDDB 3CULA 3M6VA 3M2RA 4HT5A 3QPIA 4XPCA 4PG8A 3W2VB 1U1MA 3MURP 1S97A 2E5IA 3EUNA 1FD8A 3C6UB 1JLCA 1FNOA 3PDNA 4FZVA 2PA3A 4I69A 1KLNA 5A8RA 4ZPCA 3IG1A 1WG4A 2F8HA 3CJKB 4WFAQ 4Q8FA 2HQ3A 4FXVA 3I31A 1SIZA 3U7JA 1T03A 2YKOA 3T5HA 4RWXA 3FQLA 3LUYA 3TRGA 5T7LB 5IT9Y 3RBEA 1RTDA 3PRDA 4WK1A 1KLMB 3M30A 1NNDA 2J7UA 1U6BA 3DN9A 4WFBQ 1M5HA 3R3TA 4D3HA 4MYTA 3SSSA 4I7FB 4WYWA 1GT8A 3BO4A 3DLEB 2K3IA 2XSFA 4MTPA 3IG1B 4OI4A 1JWWA 2MQMA 2XHWA 1OPZA 5KFJA 1C2PA 1NO8A 2I5JA 2HHHF 4KJIA 3LP1A 2OPQB 1REVB 4ED2A 4EZ9A 5AXLA 2ZH9A 2IAJA 4B9NA 3BGFA 3I0SB 2XNQA 2QZ8A 4NLWA 4WXOA 3CCRS 3V4IA 1P1TA 3NAHA 1HQUB 3BJYA 5DJBA 4F2RA 3PIOQ 2UVWA 3MGJA 1RT7B 2B9WA 1T3NA 1ZBTA 4WTYA 3DRPA 4UY85 4ZKAA 3ISND 5KFHA 1KEKA 1VQ9S 4PG4A 2UVUA 1X4EA 5AXNA 1S9EA 4BS2A 1S1XB 1VQ4S 3U1LA 3O8WA 5D4NA 2HS0A 2IMOA 1B0VA 2CIMA 1VBZA 2QIFA 2R7TA 2DPIA 2ZNZA 4DFMA 3FEYB 3I32A 2DNKA 5LJ3Y 1LV5A 2J8AA 1IJEB 2ABYA 4TU8A 4JI7F 3MPWA 4RW4A 4F67A 3LH2S 1MMLA 2D3ZA 1X5SA 4CH0S 1FTRA 3MXHP 3OTDA 4URGA 1R8AA 1N8RT 2LU2A 2FHJD 1P1LA 2E44A 1NHUA 1Y00A 5KT4A 3KHGA 3CMES 3SSQA 5A6PA 4FBTA 3TAMB 1E6YB 3CJ0A 1DQ8A 3FSIA 3SZ2A 1ZYQA 2RIJA 3GG0A 1QJHA 1QSSA 1N33F 3HVAA 3DU6A 4EFAC 2P5VA 3CCVS 2P9CA 2Y1RI 1K9MT 2F9JA 2JH3A 4ZHRB 2HZCA 4CO2A 3M9OB 3FFIA 1JLEB 2WTFA 1S4FA 3IFEA 3KKFA 4OJ1A 4U67Q 2FC9A 3BGRB 2UUBF 1JX4A 1DAXA 4DV0F 2DD8S 2EC0A 2CPHA 2X1BA 5KG3A 2VOOA 1NK8A 2OPPB 2D3UA 2N4CA 3POTB 1VGYA 3KHLA 3QGGA 2MSSA 2YNHA 2BRLA 3PKMA 3G6ES 2R7WA 2V4JB 4O44B 1HNVB 2R2TA 2VBYA 4YQWA 1U24A 5EX3A 4D3GA 1UP1A 5KOXA 5I42A 1D8YA 4ELVA 1SV5A 2BABA 3EPIA 1JLEA 4QBUA 4RNFA 4DSFA 4OL8A 3UCUP 3DI6B 1FK9A 3OR2B 3QWUA 4Q8EA 3K0JA 4OFZA 1NK9A 1WHXA 4OI0A 1WG5A 3POTA 2CPDA 3KOAA 4NCBA 2MDAA 5K8OA 2B4UA 1HNVA 5EWFA 1NJZA 3AHPA 1FVSA 2A2CA 5KFIA 3I9V9 3WC0A 3AJ2A 3LQVA 3CD7A 3IRXA 2FHOB 4NCGA 4NLSA 3NL0A 2V2KA 2GMLA 4WU2A 3ETOA 4KGKA 2P9GA 3JSBA 2I9SA 2OP5A 4NYPA 1X0PA 1KOOA 2W7AA 4WE1A 2IBKA 1TKZA 4F4XA 4LQ9A 2HHSA 3FEXB 3GWCA 1S99A 3LP1B 3OJSA 1T05A 2E1RA 2M4MA 4JI4F 3S6EA 1U6ZA 2AP6A 5HMYA 1CEZA 5CZVA 2J6TA 3BSOA 4QIVA 3JAMY 2ADCA 2E1AA 3VF0B 3BDEA 4WKYA 4R8UA 5D6GA 3I6PA 4CCHA 3D1OA 3QZ7A 3Q8SB 4BCAA 1X8DA 5K14B 2DK2A 3PJWA 2J7KA 5J2MB <