1KD1T

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kd1T00
2XB2D 3MXHP 3MD3A 1QM9A 3MOJB 2YH1A 1URNA 3G8TA 5HL7Q 2MXYA 2ZJPQ 2F3JA 1YIJS 2AYMA 4PRFA 4TU7A 1FHTA 2DNZA 2OJ3A 1K8AT 4Y00A 2N3LA 3NS5A 1U1PA 1N52B 4F02A 1KQSR 1WEYA 2DGXA 1WI8A 2Q79A 4FXVA 1WHYA 1VQNS 5MLCV 4OZ0A 2NZ4A 3MUVP 1VQ4S 5DM7Q 2DGSA 1X5TA 2BZ2A 2M4MA 2CPYA 3FEXB 1OPIA 2RQ4A 2SXLA 1WWHA 5D77A 2CQ1A 2CQ3A 2GHPA 2PEHA 1JJHA 3CC4S 3THTA 1FXLA 2D3OR 3FEYB 2DITA 1PO6A 1YITS 3U1MA 2MSTA 2FPHX 1P27B 3UCZP 1U1MA 3P6YC 4C4WA 2CQ4A 1M5KC 2CQ2A 1AUDA 1WG1A 3TYTA 3MDFA 2RS8A 2DO4A 1N88A 3VAKA 4YUDA 2CPJA 2PE8A 2KFYA 3UD3P 1D8ZA 2VOOA 5IM0B 2CPEA 2X1AA 2J0SD 2N82B 2JWNA 4TU8A 3CMES 5JVGQ 3MURP 2M70A 3CC2S 2MGZB 1X0FA 4WFNQ 4WCEQ 5IFMA 2K3KA 3G8SA 2MHNA 4IOAQ 2MQOA 2YKAA 2F9JA 5IQQA 1RKJA 2LMIA 2DIVA 3UD4P 3VF0B 2KXNB 2DGUA 1U6FA 1WG5A 2LXUA 4QU7A 5HO4A 2HGLA 4IO9Q 2LYVA 2EK6A 3CMAS 1Q86T 5CYJA 1VBXA 2O3DA 2HYIB 1NJIT 1IQTA 2KG1A 4ED5A 5DDPC 2LQ5A 2MSSA 2JX2A 3TP2A 3SDEB 3THPA 2CPIA 2CPFA 4EGLA 3CC7S 2QA4S 2BOPA 5DDQC 2RS2A 3IRWP 3I55S 2MKKA 2ZJQQ 3ZZZA 1X4AA 2M52A 1OIAA 2E44A 3R1LA 2HZCA 1SJ4P 4F26A 2CQBA 3HI9A 1A9NB 2DNHA 1WF0A 4QQBA 4LMZA 1OO0B 2GO9A 2RU3A 2LA6A 2LXIA 2J0QD 1VQLS 2A3JA 2XS5A 3NNAA 1YJ9S 2UP1A 5D78A 1WI6A 1VC6A 3CXCR 5LJ5Y 3I56S 2AYGA 4C7QA 1S72S 2KHCA 4WF9Q 2CQPA 2ADCA 3UE2A 3LQVA 2MQLA 2OSQA 2MQMA 1WEZA 2KM8B 3CCVS 2VODA 2KM8C 1L3KA 1QVGR 1FO1A 1M1KT 2DGVA 4LIRA 4CH0S 2DHAA 2DH7A 1ZH5A 2FY1A 1UAWA 3ZZYA 5LSOA 2D9PA 1WELA 1U2FA 2RVJA 1HL6A 3VAJA 2OSRA 1DBDA 3NNCA 2KT5A 2MKSA 1A7GE 1S79A 3SXLA 4RU2A 3CCMS 2CQHA 3RW7A 4WFAQ 2L08A 2ZJRQ 2KXHA 4P6QA 2MJNA 3CCSS 1HA1A 4W90B 3BEGB 2XS7A 3S6EA 4C0OC 2MZSA 3EGZA 5GVQA 3Q2SC 4W92B 1X4FA 5CA5A 1FJCA 2DH8A 2AD9A 3VAGA 2QEXS 2KRRA 2LKZA 3S7RA 1X5OA 1KD1T 3Q2TC 1WF2A 1KOOA 2CPDA 2V94A 3SMZA 1VQ9S 2DNPA 3MI7X 1FT8A 1H6KX 2JVOA 3VAMA 3D2WA 3MUMP 1YTYA 2X1GA 1KOHA 1X4DA 3G96A 3L3CA 2DISA 4WKRA 3OW2R 4TLQA 2YWKA 3EX7B 2MZRA 3MD1A 3H2UB 3HHNB 3DLLQ 2CQ0A 2ADBA 2MQPA 2DHSA 2RT3A 2E5HA 5LXYA 3G6ES 1U1LA 2I2YA 2E5GA 1OWXA 3S01A 2RRBA 3PIOQ 2RRAA 3CPWR 1D9AA 3IWNC 1H2VZ 2N7CA 4QU6A 2MYFA 5LXRA 2D9OA 5GADU 4YB1P 3TO8A 2AYEA 1M90T 3EGNA 2KU7A 2OTJS 3U1LA 4IOCQ 2EVZA 3UWTA 2DGWA 1X4GA 4CQ1A 2QFJA 2DNMA 2EK1A 2CQDA 1SJRA 2M7SA 4ZKAA 2DH9A 1Q81T 2LECA 4YOEA 1BY9A 2DNQA 2XSFA 1DRZA 2M8HA 2HGNA 2G1DA 1B7FA 2MQNA 1R8HA 4CH1A 3CCRS 1VBYA 2MMYA 4TU9A 4J5OA 2E5JA 5ITHA 2HVZA 1K9MT 2AYBA 1NU4A 1DZ5A 3G4SS 2MKHA 1X5SA 3UCUP 1N54B 4U67Q 2ERRA 1UP1A 2K8GA 2KH9A 4V19X 1U1NA 1U1KA 1RK8A 2MKCA 2MPUA 1JJ2R 2NLWA 2JVRA 2DHGA 3R27A 2DNNA 1UW4A 3CF5Q 5DDRC 2FC8A 3NS6A 1WG4A 2DIUA 2KRBA 1M5OC 5DM6Q 2M8DB 1HD0A 1WEXA 4WIIA 4QPTA 1VQ8S 3RW6A 2E5IA 3BS9A 2DHXA 3CCJS 2J76E 3G9CA 2LA4A 1O0PA 5H1SV 4BS2A 1UFWA 2DB1A 1M5PC 2VOPA 3CCES 5GAGU 3UCGA 3CCQS 4LJMA 1YJNS 3B4DA 3VAHA 1G2EA 1M5VC 2MZ1A 3S8SA 3VAIA 3P49B 2DGQA 2CQCA 2DNOA 2MQQA 3J7YU 2M88A 2LEAA 4Y0FA 5JVHQ 2I38A 4ERDA 1PGZA 2YH0A 4FXWA 2RUGA 5DETA 2DNGA 1YJWS 5GAEU 4F25A 1WTBA 1U1OA 2N3OA 3DXBA 1Q82T 1KC8T 1YHQS 4PR6A 1SJQA 1K73T 2FHOB 1JMTA 3G71S 2DNLA 1WHVA 3P3DA 2M9KA 1FNXH 1H2UX 2RQCA 2M0GB 2HGMA 3H2VE 1XN9A 2DNRA 4IUFA 3CCLS 2KI2A 2CQIA 1SJFA 2LEBA 3PIPQ 2MKIA 2L41A 2J8AA 1FJ7A 4M5DB 1R8PA 3NNHA 1U1RA 2DGOA 3US5A 4PKDB 2OTLS 1VQMS 1W2BR 2JRSA 4UQTA 1Q7YT 1F9FA 2CPHA 1VQ7S 1X4CA 2U1AA 2FC9A 1YI2S 2X1BA 2F9DA 3BO2A 1VQ5S 3K0JA 3BO4A 3VALA 1VC0A 3V4MA 1SXLA 3CTRA 1H2TZ 1X5PA 2X1FA 2KXFA 2L9WA 3N9UC 1YWXA 2MJUA 1VC5A 1WHWA 2KG0A 5IM0A 2MZJA 2MZQA 1X4HA 5CXTA 2G4BA 3LPYA 2MGZA 1CVJA 2LCWA 2XNQA 4A8XA 2MB0B 2OIHA 4OZ1A 1VBZA 3NMRA 2MKJA 2WBRA 1VQPS 3BO3A 2U2FA 3CULA 2B0GA 1DHMA 5BJRA 2XS2A 3ULHA 5GMKa 3JB9k 3B4MA 2DNKA 2RNEA 2DGTA 3CUNA 5LJ3Y 5GAHU 2MZTA 1FJEB 5EN1A 5LSLA 5FJ4A 1WHXA 2YTCA 2DO0A 3J7ZT 1VQ6S 2CQGA 2KYXA 2G0CA 2KN4A 2MY7A 3MUTP 1U1QA 3SDEA 2XNRA 1ZZNA 3CD6S 1X4EA 1NO8A 1U6BA 4Z2XA 2CPZA 1QVFR 1N8RT 3P5TL 4CIOA 2VONA 2M2BA 2MY8A 1VQOS 1HD1A 1SJ3P 2DNYA 1JJ4A 1X4BA 1P1TA 1VQKS 2KVIA 4UY8T 3R1HA 4WFBQ 5DDOC 3CCUS 1ZZFA 2CPXA 1WF1A 2DK2A 3VAFA 2CJKA
chains in the Genus database with same CATH superfamily
4PUOA 1C1BB 3MEDA 2RQMA 2GFFA 2DNZA 1SC3B 4X4SA 3T9ZA 1E6YA 4J91A 4KPCA 4DF4A 3PJWA 3J81Y 4EO6A 1MMNA 1VQ4S 1KS2A 3ELHA 4TXSA 3PACA 1PILA 3M6XA 1OPZA 2W7PA 4CO0A 5HROB 1GX5A 4P71A 4Y2CA 4CYUB 3U1NA 2I1RA 3HXMA 3CJ2A 3VZHA 3KMSA 4E98A 1R89A 2M70A 1X0FA 4WCEQ 1LK5A 2MQOA 5FD1A 1UWAA 3FMBA 4ID5B 2LXUA 3BGOP 2EK6A 5KT5A 3CMAS 2CJXB 4P7VA 4USMA 5AXLA 3OR1B 1LW0A 5F9NA 1IR0A 3M6WA 2F1FA 2BKOA 2ASLA 3BSAA 2EWHA 4LF4J 2CPFA 2ZH5A 1HMVB 3I55S 1TTHB 1KQFB 4G1PA 3JSRA 4DG1B 1HW9A 1VIXA 4LF1A 2F65A 5CD4H 1NCLA 2XS5A 3TAMA 6FD1A 5LJ5Y 3C19A 2HAFA 3BSNA 2O1PA 2P8IA 2QFIA 3ILJA 3T1HF 2ZWPA 4HH0A 1HNVA 2BVZA 2QLJB 3A8KA 3M6UA 4PG5A 3LH2S 2CNKB 3DI6B 4YB6A 4NL5A 3FVYA 3MECB 3CCMS 5KG3A 2DPIA 3O2IA 1U02A 2OPPB 4FF3A 3MGJA 2D3O1 2AV5A 3LAKA 3SV3A 2CPDA 3C15A 3CJ3A 3HZEA 3IC1A 3UW1A 4J9LA 4DR1F 3E3XA 3IGVA 2W4CA 3MF5A 2UUTA 5F9LA 4M5LA 4RZRA 3ISZA 3PIOQ 3N5BA 4NMLA 3GV7B 2OFHX 2BQRA 5DQGA 2EK1A 2HW3A 5LSRA 2PI4A 3F41A 4F3QA 1S9GB 4YHHJ 4A8YA 2LU2A 2WVBA 5D3GA 1JLQA 1DZ5A 3CGIA 3GU0A 4DL5A 3PW4A 3M1VB 3Q22A 1SKSA 2BE2A 3C6UA 1HHQA 1LFPA 4X4UA 1Q16B 3WQPA 4MFBB 2UUCF 4NEZA 5A8RA 1M5OC 1S1XA 1WEXA 3FFIA 2VG5A 5DQHA 1UFWA 5DS7A 1NSQA 3CCQS 4LJMA 2VIHA 3UNGC 4G65A 2R8GA 1RWNB 4I4BA 1M5VC 4YB5A 2CQCA 2M88A 3HDSA 3DLBA 3QATA 1FE4A 2GV1A 1QDUB 2FYXA 4LUBA 1N6QB 1VK3A 1U0HB 4QCLA 5KG5A 2Y8YA 4OQJA 4J9UE 4KAIA 3LOUA 1H2UX 4G6VB 1RTJB 4OI2A 1V3RA 2ZITA 4W98A 4GO5X 2AX0A 2UXCJ 4JI7J 1VQ7S 2VICA 2LP4A 4C11B 2ZH3A 3ZXWA 3E51A 1SXLA 4K4XA 3OFGA 2L9NA 1RBOB 4B3RF 5ADZA 3BM7A 1TUWA 3BR8A 1JB0C 1ACMB 2BUNA 4PWWA 3QFHA 3G86A 2RDDA 2XS2A 3K89A 1TAQA 2DNKA 2ZUAA 3CUNA 2HFUA 2BANB 1JWWA 4QIGA 3TVKA 5KFEA 3PV8A 3D6HB 4ZVPB 3H42A 3FSIA 1HQ2A 2VH7A 4WFXA 1VRTA 1M1GA 4Z2XA 4S0MA 3GR0A 1ICEB 1KVJA 1RT4B 1EB0A 1P1TA 5A2QU 4F2RA 1LQ9A 2KZMA 3R1HA 3M30B 4GVBA 4ZHRB 4M8LA 5ETTA 3G8TA 4K7QA 2AYMA 2XMKA 2L3MA 1S9EA 2NR0A 3NKYA 1I94F 1SC6A 3OL8A 2K7KA 5KFXA 3ZZRA 2BZ2A 4RUHA 4UW2A 1S59A 1ZA1B 4USTA 3RAMA 3UD5A 3OVSA 1HI0P 3EMTA 4LFAJ 1YX2A 1JQGA 4ILLA 1NK4A 5KFTA 3BPSP 2IVYA 2UVUA 2JFDA 3LP1B 2PE8A 4F04B 2JWNA 1S6PA 4Z37A 3W63A 3ET6A 1N34J 1L3UA 1VS3A 1VCTA 3MZIA 3CB4A 1U8WA 2YNGA 3SIPB 5IQ6A 4LF5F 4OLOA 4OI1A 1HNXJ 4K50A 3WDOA 1R0CB 2LQ5A 1T0TV 2DXDA 1REVA 2CZ9A 2ILYA 3IRWP 2ZJQQ 3CCZA 2ASJA 3DLKA 4OI4A 1DY3A 3HI9A 2XC9A 2OELA 4JI4J 5LMNJ 2ZE2B 4F0HA 2UP1A 1RT2A 2WSEC 3MMAA 3CXCR 3UE2A 3OQ2A 2CZ4A 3QZ8A 4O3OA 4DR5J 1UAWA 4DLGA 1K1QA 2HRUA 2OSRA 1DBDA 2EKNA 1UVNA 2ZHOA 4DPOA 2XMMA 2A2DA 4W4MA 4CO5A 2V2VA 4RUAA 2IC3B 2W2PP 3JYTA 3ENAA 3DNCA 3PZPA 4W92B 3AQOA 2JL9A 4LRAA 1KN6A 3T1YF 1JLAB 1C1CA 1VK8A 2P9CA 1JKHB 3DLLQ 4YP3A 1WC3A 4ED8A 3AH6A 2ROEA 1N36F 4N8NA 2RT3A 2OPSA 4P10A 1T05B 1QAYA 3TJAA 4ZN3A 4QU6A 2ZD1A 4URQU 2D9OA 3PR5B 4YEAA 3KLFA 2KU7A 2FZKB 2EVZA 4LQ9A 5HP1B 1NKCA 3GR1A 4NLYA 9ATCB 1HNWJ 1N33J 2XWXA 3TR5A 1B7FA 1ROFA 2KYZA 3J7Z5 5KG2A 1UVJA 3OPKA 4X65F 3H4BA 1NJZA 1CJTB 4YR3A 4O3NA 1H7WA 3DKDA 4PPZA 4IH7A 3Q8QB 5JXSA 3T19A 3ILIA 2FLOA 1FDDA 4O4RA 3CJ0A 4CLWA 4DFJA 2NLWA 1FEHA 4M5MA 2DHGA 3UQSA 2QZ8A 4C0HA 1IN0A 3QIDA 3OXFA 3V81A 1NBEB 4UOHA 3CD7A 1ZAVA 5KFVA 4ZLNA 5DJBA 3RYLA 4KGZB 1IBLF 1HI8A 4KHRA 4RR5A 1YJNS 2LEAA 4ERDA 4U8YA 4DX6A 4C8KA 1C1BA 3GYXB 3HFZB 3R7NB 2N3OA 3EZ5A 1Q82T 1U49A 2VPXB 4N56A 1RWVB 3P3DA 3MCMA 4H4MA 2EFGA 4OI0A 3CT9A 1LOUA 5HROA 2FIUA 1K47A 3UN2A 1CJUB 4CYUA 3OXLA 2F9DA 2P2CB 3BSCA 4YFUA 4QBUA 3J81j 4LF8F 3CTRA 4ED3A 2RSQA 2DVIA 2UXBJ 1U0SA 2MZJA 5KG7A 1X4HA 3GYNA 1B3TA 3NMRA 3KLIB 2WBRA 1I5OB 4ID5A 2W9CB 2HHSA 3ULHA 1KHVA 2HQGA 4FYVB 3B4MA 2RNEA 4Q2LA 1FJEB 3OR1A 5FJ4A 3SSSA 2VBYA 1GX6A 2CKWA 2G0CA 1IKVB 4GC7A 3N0VA 3KFWX 1YJRA 5AXNA 1HMVA 5KFRA 2NUHA 2XI3A 3DRSB 4DG1A 5KFBA 2XYHB 4QR2A 4FF1A 4OX9J 3B54A 5EX3A 2BQ3A 4JI2J 2PDAA 2DNYA 3FBFA 2FLLA 4NCAA 5A8KB 4FF2A 4JI1F 4PWUA 4OHWA 3GIKA 1LW2B 4MYTA 1HYSA 4J9KA 2VQEF 2YH1A 1URNA 1NDCA 3HHEA 2HURA 2Y9HA 3IN5A 4B3TJ 2UVVA 2GAGC 3DI6A 4PG6A 3MECA 1VQNS 4ZPCA 3X1LB 4DSEA 2EG1A 4DSJA 1FWLA 1F3FA 1PJ7A 3MPWA 2CQ3A 4J9PA 5CD4A 1URRA 2UUBF 3ILLA 3DDKA 3U1MA 4DFKA 2Y0SD 4CO2A 4OZJA 2J6UA 1F9HA 2NXJA 3TYTA 2ZBQA 3TVYA 4HHUA 4OYXA 5GMDA 3BH6B 1JJCB 5K8MA 1JLCB 4DSLA 4TYBA 3PEHA 1R0BG 4LSNB 4ECUA 1GMVA 4DZ6A 2Y1JA 1TP7A 5F0UA 2DIVA 4K0KF 2DGUA 2HGLA 1N5YB 4DWIA 2VU5A 4U9RA 3TOQA 3QMQA 4NZ7A 1S9GA 2HFNA 3R7BB 2ZDPA 5B0AA 3CC7S 1YQHA 2QA4S 4CO1A 4YB7A 3ICLA 5KOWA 4OJHA 2H65B 1ZPWX 3GLJA 1A9NB 5D4PA 1JXLA 2GO9A 2LXIA 3AB4B 3CDBA 2BBEA 4HH1A 2IMWP 4MFBA 3DOMB 1WI6A 1CBKA 1EARA 2D69A 4DV1J 2KM8C 4DUTA 1LXJA 3BV8A 4AQYF 5BYQA 1NAQA 1LFWA 4AYBD 4URGA 4WTOB 2CQHA 3HULA 3M8PB 1YRUA 4P6QA 4ZVTB 4KR0B 3KLVA 5CA5A 5T41A 1FJCA 2UVWA 2GIFA 1X4DA 3L3CA 2IVMA 1RTJA 3PYDA 4C8OA 5CZVA 4QW9A 3TZWA 4P2SA 3G6ES 3MM9A 3S01A 1IQZA 3K59A 3QNWB 1LWXA 2IRYA 3IWNC 3OTBA 3CO0P 4C11A 4X4PA 5GADU 3NCQA 3TO8A 1RBLA 1UCNA 3U1LA 1X4GA 4K4SA 2CQDA 3K5OA 4NXNJ 4ZKAA 2GJ2A 1CG2A 2LDIA 1DRZA 2HGNA 2MQNA 2HVZA 4I6AA 3HJFA 2XCAA 5D15A 2BANA 2JNJA 1N54B 2OD4A 3B78A 2DRAA 3FKBA 4P2FA 2FLPA 1LWCB 3GB0A 1WG4A 5F8MA 4KO0B 4ECWA 4USHA 2X3GA 3W64A 2XWYA 2AZ3A 3BQ1A 1VQYA 1W7WA 1RT4A 3LUYA 2NCKL 3EDQB 5EWGA 2W9BB 2VFTA 5DLGA 3M30A 1IWAA 4ZHRA 2DR6A 3GSDA 4FXWA 2FJWA 3MAAB 2DNGA 3H4DA 2B8PA 5KG6A 4H54A 2XO7A 3OTOJ 4OHVA 1SC1B 1SPBP 3PW7A 1DJ0A 3KJQB 2ZH1A 4J9VA 4N76A 3WIVA 4FYYB 2E9ZA 7FDRA 5KTQA 3GIRA 3MHYA 3J80Y 1ZAWA 1WKJA 1G4CA 2HHXA 3BQ0A 2IBOA 1VQMS 1WC4A 3GP9A 3BO2A 4DOZA 3V4MA 4B3RJ 2Y1RI 3KHGA 2AGQA 2OP5A 1SI9A 1S49A 4PQUB 2XULA 3LP1A 1FRJA 3PX4A 2KG0A 2FQQB 5HLFA 1G1XA 3HVAA 2YY3A 2HBRB 2ZOGA 5AJ3F 5CZXA 1EHWA 3PW5A 2OMOA 3AAWB 3H25A 1RDRA 2IJNA 5E41A 5H9EJ 2E7XA 1Y00A 2G2OA 4RW7B 3JXOA 1FX4A 2AGPA 2VFUA 4Q43A 2QLXA 1RLDA 3BYRA 4O3SA 2ZZTA 2OH2A 1ZZNA 3T5JA 4Q5VA 1S1UB 2EFOA 3AD7C 1N8RT 5K5MA 3W61A 4LBHA 1F2HA 3BGLA 1ZETA 2Z2ZA 1BQXA 2IYIA 2ZE2A 3CMQA 3GYGA 2KVIA 1UWBB 2DKOB 4M94A 1H73A 2YX4A 1N0UA 1NSKL 3M6VA 2RHQB 3OUYB 1T3OA 1RAIB 1TL1B 4FXDA 1PIEA 2DGXA 1FRHA 1WHYA 2R7SA 2BV3A 2IC3A 4OZ2A 1MMDA 5C5JA 4U7CA 2CQ1A 1VLYA 1B64A 5CCMA 3PFEA 1JLAA 1KDNA 2D3OR 4MK9A 3GIJA 1DLOB 2ZFHA 1F5BA 3V6HA 3SCLE 1JKHA 3WX4A 3SBMA 4YUDA 1H0HB 1FI4A 4WP8A 1T05A 3CMES 4TU8A 2MGZB 2QL9B 1RHQB 2NSBA 2J7WA 1YJTA 3LANA 3WC0A 4X2BA 4HHHA 4DV0F 3M8ZA 4HEA9 4LF5J 1TAUA 4IO9Q 2OEMA 4FYDA 3JQJA 5HP1A 4AD6A 1YZ7A 4ID8A 4PPDA 2ZM6F 4PZVA 3NWGA 1HBUB 3EM1A 5HMXA 3TP2A 4XDDA 2R7UA 2W24A 8AT1B 1KFDA 1T9WA 3TVZA 2CA9A 4LFBJ 3ZZZA 3AJDA 3I6PA 1RISA 1CJTA 3AFGA 3NG8A 3R1LA 4K4WA 2CQBA 2YQ3A 1U25A 4QIFA 5D4LA 4X4VA 1F2GA 1Q79A 1YJ9S 2ROPA 2OKQA 3CSKA 2LLZA 3QIPB 4WF9Q 1RLCL 3QFWA 2MQLA 3RR7A 4LIRA 4CTAB 2FY1A 5LSOA 2NXUA 3ITHA 4EFAC 3RRHA 1PYTA 2GC8A 2HQFA 3GCWP 3GONA 4P72A 4E8UA 2XSJA 3EVOA 4ZOSA 2XMWA 1RZMA 4YDDB 5FLXY 2DXFA 1X4FA 1X60A 1X5OA 2CVIA 4OJ3A 4NYOA 2O67A 3MUMP 3G96A 2J5AA 3T9NA 2N4DA 3OW2R 1CC8A 2ABYA 1N36J 3MD1A 3G2XA 3K5NA 2RRNA 4D3GA 4F0MA 1JK9B 1CJUA 3FCHA 2RRBA 2HMIA 4K4TA 3X3UA 3KHRA 1IXKA 1J2VA 5F0WA 4KC5A 1SB6A 2PI5A 1Q81T 5L1IA 4J37A 4X65J 3KLIA 2W9CA 5B0DA 2YNFB 3HSZA 1U6ZA 1XEZA 3IBFB 3GTYX 3GFYA 1S1WB 1KBRA 1S1VB 1VRQC 4I64A 3M4XA 4CLUA 4LBPA 3QRRA 5J2PB 2IM1A 4DL4A 2JVRA 2GIQA 3R27A 2B4OA 2DNNA 4F7VA 3DRSA 2FC8A 2K06A 2YVSA 3N4WA 1IBLJ 1VQ8S 3NAHA 1CJVB 4HVZA 2FVPA 1KTQA 4I1TA 1XQIA 4O0NA 2ZOMA 4DL2A 2BDPA 3ZZPA 5A8KA 3VAIA 1RP5A 1LW2A 1J27A 2CXEA 3MPYA 4IQMA 2B4UA 1CLFA 4U7UD 3TAQA 1NKEA 3RB4A 3CJ8A 1UZHA 3P96A 2YKNB 3QSIA 2V8HA 2BJ9A 4CLFA 5KT4A 1TL7A 3F56A 4B3MF 3NXZA 3PIPQ 1QTNB 4UZCA 4RBTA 2MLXA 1Y5LB 4LF8J 3PHTA 1WC0A 1YLXA 2JEJA 3VALA 3D0HE 4P52A 1JLGA 3TEHB 4YS2A 1HNIB 4Y2MA 1NM2A 3DRPB 3GG1A 3DFEA 1S10A 1JLCA 2XNQA 4A8XA 5HN0A 4LSNA 1O5JA 3JB9k 1N5YA 3MEGB 3OBIA 1GQEA 2KJWA 1XMQF 1EP4A 1LKZA 1L3SA 1U1QA 5C7PA 1SCJB 3OVBA 1U6BA 1KLNA 1T9TA 5F41A 3MM6B 3ENVA 5KFJA 3PEJA 1M0SA 5BXIA 3FK4A 2HEKA 3Q8UA 1TFWA 4JI1J 3DOMA 1WDTA 2OFGX 4PCQA 2ZC3A 5DZ7A 2IRUA 4CLPA 2VQEJ 1S4EA 4I7FB 1VLOA 2A18A 2BMBA 3HSDA 2HQCA 3G82B 2Z56B 4IG0B 2RE1A 2R2RA 1IJEB 2OAUA 5J1NA 4F2SA 3M8PA 1TVRB 3CDEA 2BA9A 5DM7Q 4GKKF 2RQ4A 1NB7A 1QY7A 1U24A 2OPRB 1ZAXA 4DL3A 2GHPA 3RAXA 4DSKA 1DQAA 1JJHA 2IMOA 4ZA1A 3KTQA 2A1BA 3HLUA 5AXKA 1FXLA 3AXMA 2AQ4A 2F7VA 1FNOA 1P27B 1BWEA 4RUBA 3FBEA 4CDIA 5AE3A 5C25B 5IT9Y 2VHGA 2R8KA 3AD8C 3GFXA 4YR2A 4XO0A 2NPFA 2J0SD 3QBCA 2HRYA 5IFMA 3G8SA 4O0IA 1RKJA 5KG4A 2G9OA 4TN2A 1TV6B 4N47A 2YKOA 1Q86T 3R8YA 2VC0A 4NI2B 1MWQA 3UO0A 3D67A 1RACB 4V19J 1O6XA 4C3LA 4ZITA 1A0OB 3EPIA 4ZPTR 4ZP8A 1S0MA 2R7XA 2E9RX 1FXDA 4DR3F 3HFKA 1NK6A 4CZCA 4OYIA 5L1LA 3AHPA 3NNAA 1HWIA 1VC6A 4DFMA 2ZH9A 1LWCA 1KQGB 2CQPA 1SV5B 3TEGA 4KO0A 4MMOA 4ZVRB 2KM8B 4C98A 2KJVA 4AQYJ 3C14A 4MT1A 2DGVA 3ZZYA 4QYZK 4DU8A 4I56A 3T1AA 4PAAA 1SQGA 1GNKA 3GFZA 2HIYA 1BQMB 3UDVA 5T7LB 2W9BA 3PYGA 4P75A 3CCSS 3GSIA 3MAAA 2GGPA 3FNNA 4CNYA 2VQFF 2LKZA 1KOOA 3SMZA 4NLTA 3MI7X 2HPUA 2KTQA 1KOHA 3BBCA 5AT1B 3AODA 3BZQA 4RX6A 3W1YC 2C22A 2C2ZB 2CQ0A 2R2TA 3Q8SB 2V4QA 1RAOA 4ETXA 3ZO7A 1KONA 1RGVA 4EEYA 2WB1D 3MMCB 4NCGB 1H2VZ 3UN5A 3PW2A 2C28A 1UVIA 5DG7A 4OIXA 4U7UK 2OTJS 1M5SA 3NCPA 1RT1B 1HBOB 4ILRA 2J9EA 4PQUA 5C2GA 1X0PA 4IYQA 1S6OA 5IT0A 4P2XA 1XK8A 4YQWA 4R5PB 4CH1A 2EXUA 3DM2B 1PJ6A 4RW7A 5E5NA 2VL1A 3HVRA 2L9DA 3O1LA 3BBFA 4KV8B 2DY9A 2RJZA 3DMJB 3IWLA 2V9KA 5F8JA 3CF5Q 3L09A 1S1UA 4F4KA 4UY85 3RR8A 1T03B 4BDPA 4JV5F 4PG8A 3EVMA 1F9EB 5CABA 2NXEA 3TUIC 3CCES 1GFWB 3J7YI 4B9UA 2RUSA 1UWBA 2MZ1A 1TMJA 4JV2A 1X9SA 2XMTA 2RF2B 1NJWA 1KP6A 3OUYA 3HO1A 4DV6J 1TL1A 3M2RB 3D5MA 4M5HA 3UFCX 2GW8A 3K5PA 3R97A 3H2VE 1Q5YA 2V6AA 4CLTA 4WXWA 2F8MA 4KB7A 1PBAA 4B9VA 3M8QB 2DRDA 4IRKA 4FDFA 4WPAA 1RCXB 2JRSA 1EKRA 2HHPA 2AKWB 3N5FA 4C6AA 1DLOA 2YWGA 1T3NA 1UKUA 3N9UC 1GT8A 2F40A 1WOPA 1LEOA 1HKAA 1AFIA 3MPDA 2MGZA 1VBZA 4Y2AA 3D6MB 1RI7A 3D1OA 1IKWB 1BXNA 4NLWA 4GC6A 5LJ3Y 3EDRB 2KHDA 3R5GA 2RD5C 4TKTA 1WHXA 3J7ZT 1PC5A 3MAQA 5G0RA 1HBUA 3M2UB 5DGAA 3ZTRA 2WONB 3THVA 4X64F 2BW2A 4JBCA 1QLNA 1QAJA 2QMWA 2R9LA 1RT6B 4K8RA 3M8YA 1JIHA 2AEMA 3UI3A 3DDIA 5L8RC 1SJ3P 1B7YB 4JYAJ 3DRXA 1WC5A 3QIPA 5IWAF 2R42A 5IXUA 1YGYA 4CTAA 1RYSA 5A2QY 1MMLA 4EYHB 4DUYF 4Q8FA 2QIFA 1U1PA 1YZ6A 5ETQA 4F02A 4KHPF 1U48A 3OJUA 2NZCA 2Q79A 4JI5J 1P9QC 5H9FK 3K8WA 4C2MA 3FEXB 3N79A 1YKWA 4ZVUB 4ZVGA 3SCJE 2V9WA 2ZHBA 4WJBA 1NPRA 1XR7A 1T9VA 2KVQE 4CLYA 2JJ4D 4C4WA 1R0AB 3H40A 2QG9B 1WG1A 2D1CA 2HS0A 2E1AA 2CPJA 2KFYA 2PGCA 3K7RA 1UEUA 3CC2S 1XMOF 4M5JA 4DV0J 5DO2A 5IQQA 2P5VA 3BKTA 2ZH4A 4KRWA 2EI5A 5KFHA 2R8HA 3OLBA 2ZM6J 1NK8A 3TX0A 4DCOB 2C2NA 2O3DA 4XDCA 3LGHA 4DLEA 5DDPC 3TA0A 3THPA 2CPIA 1Y7PA 2XY7A 2YWFA 2V4RA 2BM0A 2YNFA 4ES1A 1SL2A 1S1WA 4GKJJ 3H2LA 5F3TA 4Q0BB 4CM0A 1S1VA 1PJ5A 4QQBA 3ZNJ1 2RU3A 3J7AN 1Q53A 4NE9C 5J2PA 3TA2A 3MEEA 4ZJLA 4ANEA 3A3OB 2UZAA 4DV5F 1HBMB 2CNLB 1VMBA 2ZH8A 1FO1A 1CJVA 4DV4F 5G4DA 1Q1KA 4OFZA 3KWMA 2HBQB 4RKUC 2ZNZA 3KG0A 3RW7A 4WFAQ 3CDUA 4OYMA 2MJNA 1P9YA 2PD1A 1FDAA 1Z4UA 2ZBRA 2FGCA 4DV2F 3S7RA 1HHSA 3C15B 4FVCA 1VQ9S 2YKNA 3IR5B 1U45A 5KFZA 3CWJA 3SFUA 2F63A 3R9LA 3GZ7A 1OWXA 1JLFB 2VKZG 4ZMMA 1OQ3A 4K2XA 4JI0F 3R5AA 2JEIA 3GCXP 4BC7A 3PJ9A 1J5EF 1HNIA 1RHMB 4QOTA 3DLGB 3DRPA 4O44B 3D66A 2AJ1A 1B0VA 3ZTSA 3RU0A 5D3GB 4DJBA 4TU9A 4OZLA 2XY5A 1RHJB 2EW9A 3PCOB 4U67Q 1UP1A 3KG1A 1T9UA 1DURA 1FF2A 1NHKL 4KH0B 5IV4A 4KGVB 2DT9A 5CYQB 3LPEA 3TRGA 1RCOB 4DS5A 1HBNB 3I87A 3ZNUA 3FCVA 4EBDA 2E5IA 3D0GE 4ETZA 1O0PA 5GAGI 1IR1A 3BBBA 2HLUA 1M5PC 1H72C 2NYIA 4MIWA 1D3WA 3TQ1A 4URSA 4TQRA 1ZA2B 4LFCF 3L4BC 4I7FA 1N32F 1OY6A 8RUCA 4WP3A 3G82A 2XCPA 4IG0A 4IRCA 2AIRB 1PYOB 3NP5A 1XN9A 3I5BA 2DNRA 1TVRA 3PVXA 1IBCB 4ZVEA 2OPRA 5A76A 2QV6A 1NKBA 3US5A 2R8IA 5CYMB 3SZ2A 5IZHA 3HCXA 4JI6J 2XHWA 5D0GA 2EC2A 2Q1LA 2IBKA 2GNKA 2EFNA 1FJGF 2BYCA 1TV6A 2AU0A 1RHRB 4J9SA 2RILA 3PNIA 1HWUA 4NI2A 4F4AA 2G0JA 1XMQJ 3NRBA 5HAOA 1C0TB 5HQMA 3PJXA 1RTDB 1E6VA 3DHWC 2CPZA 1RABB 4RPFA 2ZZMA 4ENOA 3GQCA 1WSRA 1SVDA 5E3QA 1OSDA 1S5ZA 3NS7B 4WE1B 1SV5A 2HVIA 3RB3A 1ZZFA 4UUWA 3OHAA 4K4ZA 1PC4A 1ZBTA 3DOKB 4X4QA 4L74A 5E3PA 2HHHF 2OJ3A 2N3LA 1S9EB 4DFPA 3W5XA 1BQMA 3D7SB 5T7LA 4QWCA 1TU0B 1RAEB 1XBWA 4DQSA 4HI1A 2VJVA 5BYRA 2W25A 5DZ6A 4OI6A 2IAJB 1PO6A 1NK7A 3UD3P 2N7YA 1EX8A 1RHKB 2BJ3A 1S6PB 3I9ZA 2YNHB 3MMCA 3CJKB 4NCGA 2CWXA 3FCWA 3ET6B 4ZCIA 2WOMB 1Y0HA 2I9SA 1RT1A 1HBOA 2W2NP 3R5JB 3HT0A 5ETLA 3H98A 4R5PA 2PSZA 4EO8A 4DR3J 3H5XA 2FHMA 4MTPA 3VTIA 1RKIA 2M52A 2PC6A 2HZCA 2QMXA 4UT4A 4XK8C 1NPKA 4DSIA 4L6V3 1KEKA 1VRUB 3DMJA 2XTJP 4R8UB 3MCOA 1S72S 3MAHA 4P9SA 4Y3CA 1WD6A 1T03A 1CULB 1FRKA 2B6AB 2DYAA 1NSAA 4EBEA 4L72B 3B8HA 1HNZF 2WZ1A 4F3OA 2H3EB 3R5DA 4MAKA 2RF2A 1T7PA 2VQFJ 1HA1A 1N5SA 1RHUB 2VDHA 2WVFA 2D3UA 2MZSA 3EGZA 3Q2SC 3M2RA 4DR6F 1WF2A 4PQAA 5AE2A 2V94A 2CDRB 2B9YA 1FT8A 3VAMA 4B3OB 2HNYB 4E0DA 1C1CB 3T6JA 3EX7B 3M8QA 2FZGB 2HVDA 1HW8A 1VGYA 3C66A 1VQSA 2C2RA 3CCTA 2V34A 1AROP 3NBPB 3CPWR 2B4VA 3T5HA 2HZVA 4ZPBA 2N7CA 2MYFA 3ADAC 3G87A 3NMAA 4RL1A 4NPOA 5LXRA 2FJXA 2V0NA 1VR6A 2A0FB 4NRTA 1NDKA 3PRVA 1SJRA 3QGPA 4QIWD 4DR7F 2ACMA 1BY9A 4NA3A 4USUA 1GMUA 5D4NA 2XSFA 3CJSA 2G1DA 3O8WA 3RBZA 1X7VA 4ECYA 1IKWA 2FJAB 3SYZA 1SJ1A 1G7CB 2MKHA 2F4VJ 3M2UA 1RK8A 2O5DA 2MPUA 2FJDB 2WONA 2D7SA 3BGRB 2PT0A 5DRKA 1RT6A 4JV5J 2W4DA 1RWWB 2VKRA 4CO3A 3LWMA 3SQOP 4TLRA 4A8OA 3MTKA 1NH7A 2AT1B 3P49B 2DNOA 1FE0A 4JUZA 4JV1A 1FDBA 1VDHA 3EGWB 2FVRA 4IUFA 2CQIA 4UQGA 4H4MB 4TYAA 1OYEA 4M5DB 3VGSA 4IR1A 1WDDA 3O44A 2XLJA 2OTLS 3FBCA 3JQMA 2LQBA 2FTRA 3KHLA 2U1AA 2R8JA 2FVCA 1KSPA 5L9NA 1R0AA 4H4KC 1T9YA 5B0CA 2IVFB 4Q2MA 3OL9A 1R31A 1WHWA 3FDSA 1SH0A 2MZQA 5ETNA 2H5IB 4ED4A 4EBCA 3LP2B 2LCWA 2IIHA 2YWWA 2Q6BA 2MKJA 2HZAA 2GJFA 3D9BA 3EVWA 3VGUA 3TA1A 3L7UA 1TKZA 2CQGA 3JTPA 1F60B 2KN4A 2YBVA 2VFVA 3CD6S 3I4HX 4EWTA 3MM8B 4A47A 3OFFA 2W8KA 3TJ9A 4Q0BA 4OYAA 2J0WA 2M2BA 1V3SA 2CJQA 1NMEB 4RLEA 1YG0A 3BB5A 2R7WA 5IWAJ 1SH3A 1NEEA 2QO3A 4DF8A 3CCUS 1HBMA 4I2QB 1SKRA 4ED5A 1HYSB 4DUYJ 4M1KA 3M9NB 5HL7Q 1TUGB 1FHTA 2EFPA 1N52B 1QD1A 2RU9A 3HJVA 1WEYA 1M1HA 1LWFA 3W8PA 1FD2A 2B43A 1V5VA 2FJBB 4DUZF 2R7RA 2KT2A 2HS3A 4L3NA 3EXYA 1WOOA 4X84A 1BGXT 5E0OA 1VOMA 3THTA 2B9EA 3ETMA 1SUQB 2FPHX 3P6YC 1S4FA 4KHMA 3OJSA 4P2MA 2RS8A 2FDNA 1XMOJ 1XJWB 2CPEA 2R7OA 1JLFA 3H8YA 1LWEB 2QTWA 5JVGQ 1CC7A 3MURP 3ZC4A 1PAUB 4MIBA 3IBCB 2AJ4A 5ETSA 5HO4A 3K2YA 3IG1B 1VBXA 3DLGA 2XGQA 4B9TA 4O44A 3IRXB 1R3NA 5E3CA 1YJ7A 2MSSA 3FUYA 2PMZD 2FB0A 5M2UA 4EGLA 1Y4ZB 3IS9B 4O23A 3NGKA 1OIAA 1EJ7L 2R2UA 1KNZA 1RAAB 2NS1B 2NPIA 2EG2A 2W2OP 5CYQA 5HJXA 1HBNA 4ILMA 4BBYA 4DV4J 3RAQA 2KB2A 2VODA 4HT7A 5KFLA 3K17A 4CP5A 1VJQA 5CHCB 2ZVIA 1WELA 1Y3KA 3BR9A 3QLHB 4EZ9A 1SL1A 1RTHB 1WC1A 3W3SA 1LNQA 1A7GE 1S79A 2AJFE 1KQKA 4PXCA 1F3VA 1RWPB 1CEZA 3CIMA 2IPOB 3SI8A 3S6EA 2E1CA 5E7OB 1B4SA 2AWZA 4WZMA 2VBWA 3QAEA 3MM7B 1WTFA 1YTYA 1FWKA 4EZ6A 1SKUB 1RA6A 4ZVQB 4TLQA 3KNAA 3H2UB 3HHNB 2DCUB 5I42A 2HQIA 1Y5NB 4USWA 2MQPA 1K1SA 3DCAA 4J9QA 5CAAA 4KIAA 3MM9B 3DRYA 1TKXB 2RRAA 4JI0J 5CYMA 2A10A 1I3OB 1F5CA 1DAXA 2FGOA 2XLIA 5J2NA 4LVNP 1Y11A 4A8SA 1CQNA 3AXKA 3HSGA 4CQ1A 2DNMA 1SQFA 1GXUA 5HVGA 2DH9A 1FRMA 2DR7A 2BABA 1IUJA 3A8IA 3AOBA 3OT9A 4LF4F 4X4RA 3TI0A 1JNRB 1S0NA 4LRDA 3UCUP 2H4YB 3TX8A 1C0TA 1U1KA 3A13A 3HVWA 2ALYB 4XAKA 1NDPA 1UJ6A 1RTDA 2C2DA 4NRUA 1NUEA 3PO4A 3LP0B 1AW0A 4NLVA 4JOUA 4OX8A 4C48A 3EJMA 4ZPAA 4WE1A 2XMUA 4OJGA 4LFCJ 3D3BJ 1EZZB 2BOAA 4PYAA 3ILOA 3DOKA 2RUGA 4DCJB 5HQ8A 3VCDA 3VWSA 2QL7B 4F4XA 3I0SB 5I3QA 1Y5IB 2XQCA 2EFVA 2RQCA 1RTZA 4UZBA 1FK9B 2B7CB 2MKIA 3VR1A 2HVHA 2HBZB 1OY9A 2KKHA 1U1RA 2VV5A 2DGOA 3D6FB 2IAJA 4DX8H 3QYYA 5F8GA 4EK2A 1H2TZ 1EQMA 4DSFA 4A4JA 4GVLA 2I8EA 5HLFB 5CXTA 3K58A 3I9V9 4B08A 1FJGJ 3MMJA 1CVJA 2YNHA 3CJKA 4L3KA 4LVOP 4ZJOA 5ETRA 2U2FA 2WOMA 3M9MB 3DU5A 4YHHF 1VISA 3WC2A 2H51B 3HHLA 2MZTA 3CDAA 1VQ6S 5D6GA 4E2FB 2B9WA 2HHQA 2BQUA 4FBTA 5D0RA 2PO4A 1OSCA 2JH3A 1RADB 3KLHB 2R7VA 1K0VA 2LDYA 2R3VA 3DXSX 4ECTA 4DMZA 2CIMA 4AE5A 1HD1A 3BSOA 1VRUA 5E3AA 3GV8B 2EKYA 4DPYA 4R8UA 3PFOA 4UY8T 4KJIA 2VPWB 3MXHP 5E3RA 4JI8J 2WHOA 5B0FA 4C8MA 1CULA 3MOJB 2HHHJ 2O01C 3J80U 2B6AA 2HWIA 2CDQA 3NGUA 3H5UA 3I5CA 3IP0A 1TELA 3D1HA 5A8WB 3K8VA 1T9XA 2QYGA 4HKQA 2CPYA 2OUGA 2CZVC 3DLEB 2IM2A 3GJRB 3BKUA 3F0NA 4KQZA 3IR7B 4B3OA 2HNYA 3H7HB 5I3UB 2YKQA 1U1MA 4OX7A 2UXCF 4L76A 4JI7F 1DQ8A 1XMBA 3IBWA 4WYLA 2XZTB 3UR0A 1YBTA 3OVAA 1RWXB 3MMBB 5IM0B 3NBPA 1QAXA 2F9JA 4KYZA 3JAMU 1KWMA 3PKMA 2XM3A 2HQ3A 4O3QA 2BKPA 2RKIB 1RT5B 4A8KA 1VHFA 3HZGA 3RG6A 2JX2A 3V5RA 2VZ9A 2BOPA 3B6BA 4Z7YA 3W9IA 2YXLA 2PMHA 4RW9A 4ZVOB 4NZ0A 2P6TA 4B9LA 1VQLS 2A3JA 2VFRA 4QWAA 3I56S 2KHCA 2RH3A 2C3OA 3BGRA 2MQMA 5A0YB 3ITHB 4ZS6A 2J9CA 1HNZJ 1TR0A 1RTIB 3FC9A 2CG4A 3AQPA 2XSJB 4RU2A 3AT1B 3GG0A 4A8QA 2XS7A 3PHEA 3HHLD 2V68A 1HPZA 1ULRA 3PKYA 4FKYA 1NZAA 4A8MP 2BACA 4CLSA 1UL3A 3EGVA 4CNZA 2HAIA 1RUSA 5KFKA 4ZP6A 5CH7B 3QJPA 5ETKA 2YWKA 2MZRA 2MQ8A 4M5DA 4FPIA 2E5HA 3BN7A 4FVMA 3AB2B 2HMIB 3BREA 1QSYA 3KK2B 4Y6IA 3Q8RB 3ZZTA 4ZN1A 4ECRA 3RB6A 2OO4A 3CJ4A 4LR9A 5LT5A 2WCXA 4I6YA 4TQSA 2LECA 2YWHA 4YOEA 3LP2A 2HK3A 2DR8A 2LFVA 4DL7A 4OYBA 1S1TB 1Q8IA 4IFYB 3G4SS 3BDPA 5THWA 5D0EA 1X5SA 1DTQB 2IRXA 2V8PA 1YBAA 4ECSA 4FKXA 1IBKF 1FXRA 1XNQF 3MM8A 4JI4F 4KFBB 2HNDA 4DR2F 4JI3F 4IR9A 4IO1A 3G9CA 2PN6A 5T14A 5B7WA 5SZTA 2BW7A 5FLXU 3PYEA 4LR8A 3ZTOA 5HVFA 3J7YU 4MH8A 2GQQA 4Y0FA 2OGUA 5JVHQ 3C6TB 4I2QA 3M8SA 5GAEI 5DGBA 2F8EX 1IM6A 1HWKA 5DETA 1YJWS 1KC8T 3IA0A 2FHOB 3G71S 2M9KA 5I4MA 5KT2A 2H5JB 2PFDA 4DR4F 1TL7B 2BE9B 3J7A1 3PR4A 4MKBA 4K4VA 2J8SA 3DRRB 2J8AA 2R2SA 4ED2A 1BD6A 5K8NA 5BYSA 5KFGA 4NEYA 1NZ8A 2QA1A 1SUQA 4M5NA 4DQPA 2WB4A 1JLGB 4EYIB 4DHVA 1ZM2A 1ZOTA 2G4BA 2BJ8A 1LWEA 3FRYA 1S9FA 2IHR1 4P74A 2MB0B 1AXQA 2HFVA 2HWHA 1HNWF 1ZYQA 1DHMA 2JEGA 1YBUA 3IG1A 5KFYA 2KO1A 2GAHC 4BLGA 3AJ1A 5HMZA 2YTCA 2D3ZA 1Q95G 2DO0A 2VDIA 3CJRA 4OZ3A 3IRXA 1EP4B 5ETVA 2V8DA 1S48A 4KSEB 1NO8A 3IS9A 1BWVA 3TUZC 4C8NA 3BDEA 3NEKA 4I69A 4TY8B 3KYLA 2B5JB 1ELOA 2BJDA 3L7PA 2XLKA 1UVKA 2RIJA 4DQRA 1HQUA 3T1HJ 1R8AA 4QIEA 5DDOC 4ZVSB 4I0WA 1WF1A 5KFIA 4IOBA 4FN5A 5J1PA 4K5RA 4GMKA 1YIJS 3QLHA 1RTHA 2HRTA 1KQSR 3A8JA 3OFHA 1V9OA 1WI8A 4FXVA 1IKYB 2RAQA 2WVDA 2SXLA 2V2KA 2V67A 1IJFB 5D4OA 3I96A 2JFKA 5L39A 4DR1J 2LQJA 2QX0A 4ANDA 3MM7A 2XMVA 4WFZA 1DQ9A 3UCZP 3CEDA 3QGGA 4DN9A 1M5KC 1AUDA 1UA0A 3V2UC 3DOLB 2VBZA 1CSJA 4ELTA 2QA4G 3AY0A 3L9ZA 1TKXA 3KK3A 5H9FJ 1KRPA 2CJAA 4IOAQ 2YKAA 4DU7A 2KXNB 3A3NB 1NJIT 3VGTA 2Z30B 2AHOB 4J90A 1WKLA 5DDQC 4WU3A 4RBUA 4F4YA 4ZPVR 5E33A 2Q3PA 4QWDA 4ECZA 1UJ5A 1WUUA 3RRKA 1WF0A 2BR0A 4LMZA 2UUCJ 3MPVA 2J0QD 5HK4A 3QO9B 3OR2A 3ZFVA 5U47A 3IAS9 3PX6A 4JI2F 1OY8A 2FJEB 2OD6A 3LP0A 5KT3A 2EBEA 5B09A 3C14B 2HHVA 1EAYC 2ZNYA 2GZOA 5B08A 1L3TA 4ED7A 2YPYA 5KFUA 5JMNA 1C4CA 1FWPA 2XHCA 2RVJA 3GILA 3DN9A 4AL6A 3T3FA 3M32B 3NNCA 1C4AA 2MKSA 5EGYA 4AFFA 4B3TF 4LSZB 3WX8A 1GTHA 1VHIA 3DGVA 2LU1A 1Q8LA 2GGPB 3Q8PB 4C8LA 4NX9A 4DCPB 3Q23A 5IT9U 4MIAA 2AD9A 1LK7A 2KRRA 3I0SA 4QJVA 3GWCA 2PIIA 1Z2LA 1FK9A 3WIUA 5HMWA 2EEYA 2ADBA 2VA3A 1RT7B 2C42A 4ECQA 4BCAA 2I2YA 3KHHA 4J9NA 5HQLA 4KGMA 3H59A 2AYEA 3SQGB 1N56A 3IAM9 3UWTA 2M7SA 1S0VA 4RNNA 4HACB 1R8HA 3CCRS 4MJKA 3CJ5A 1R8BA 1CPZA 3HP6A 2GX8A 2Z58B 2ERRA 5F8NA 3V6JA 5KFNA 3O6QA 3AOAA 5KFPA 5C24B 4F4ZA 3KLHA 2KRBA 1Q8BA 1JLEB 4NA1A 1SBRA 2DEIA 2J76E 3NAIA 2DB1A 4DV1F 4NLPA 5GAGU 2JC1A 3RGIA 4B9SA 2ALZA 3NY0A 4MYUA 2I38A 3GFHA 4ZPWR 1S7HA 3I0RB 2UU9F 4F25A 2Y0BB 1I94J 2XBPA 2DR9A 1HLWA 3D54A 3OLAA 1KVKA 1C0UB 5A8WA 2WW4A 2M0GB 1PKUA 1CQMA 4DPUA 2KI2A 2XI2A 2LEBA 3O3LA 3DLEA 4CT9A 1R7IA 2QT7A 4PKDB 1W2BR 2DJWA 3OTCA 2CJ9A 1X4CA 2HSEB 3KKFA 2FC9A 5I3UA 3DGPB 3H20A 3DC2A 3A12A 3CIZA 5LL6d 1GAOA 4QR1A 5EUHA 3MMBA 5IM0A 1D09B 1H3DA 1FVQA 2HWTA 1EIYB 4NXNF 2AMCB 2ZEJA 4DX5A 1QTMA 2B0GA 3QWPA 1D8YA 5IS2A 1MN7A 3GV5B 2AEFA 3SCKE 2RKIA 1RT5A 5G0RB 3TZZA 3JSBA 2GJIA 4B02A 4IKAA 4F50A 2KT3A 4B17A 4C0BA 4NA2A 1RQ0A 4ZK7M 4K59A 1D1UA 3GIMA 1VQOS 2XO6A 3P4UB 1I6JA 2AJ2A 3AD9C 1Q8KA 2AEJA 4D3HA 1SIZA 2KDOA 2XB2D 5A0YA 6FDRA 2DR5A 2ZH6A 1GXLA 1FCAA 3HD1A 3GJQB 4ICLB 1S0OA 5KFCA 1RTIA 3FEZA 2W7AA 3OTOF 2IM0A 2NZ4A 2WSCC 3LTOA 5ETMA 3MPUB 3C3LA 3T1YJ 1N5QA 2OMLA 2PEHA 3MR6A 4F36A 3UN3A 4CCHA 3TNVA 5EWFA 2HFZA 2QC3A 4ES3A 5FDLA 1F6TA 4C8ZA 2R7TA 2MTLA 3KK2A 2XEXA 1RWMB 1WG5A 1BQNB 1HR0F 4U6PA 2LYVA 2VG6B 4WU2A 1FFWB 1HFEL 4PABA 3IFEA 4CLLA 1ZM4A 1GMWA 1S1TA 4RNFA 4LF2A 2MKKA 1AA1B 4IFYA 4WP9A 2WRMA 1DTQA 4DXLA 4J9OA 2CUYA 2LA6A 2H48B 3EXCX 5AXMA 1RYRA 2QN6B 3MEEB 4KFBA 2UVRA 2ADCA 4C97A 5DG9A 4X4TA 2PEBA 3DYAB 1U2CA 3G6YA 1UW9A 2K3IA 1U2FA 2RMLA 2YWEA 2ZH7A 3MR5A 5HANA 5JJBA 2VASA 3SXLA 3C6TA 1BE4A 2HVEA 2KXHA 3G6XA 4C3MA 4DI6A 3TQEA 1IWGA 4FZVA 4OYZA 3HVTA 2QEXS 4I2PB 2HQDA 4AL7A 2DNPA 1VBKA 5BR8F 2JVOA 1H6KX 3FQKA 4N5SA 4WKRA 5KT6A 4PXDA 2HK2A 3DRRA 1F5AA 3Q24A 3UPFA 1TL3B 1Y9OA 4G3IA 4C8YA 1TK8A 1FA0A 3C2PA 4N41A 4H4KA 2WVEA 1FD8A 3V4IA 1IBMF 3N01A 2KL8A 5MAOA 1QSSA 5FIIA 2NSCA 2W8LA 1M5HA 4OLPA 4OI3A 3CJQA 4QIVA 2E5JA 3W5YA 1KKHA 4WKYA 4X66F 3WHIA 4QWEA 2IFXA 3OD2A 1IBKJ 4LFBF 1U1NA 2COLA 4X4NA 1XNQJ 3W60A 4DR2J 4JI3J 2C2MB 4R25A 1XWLA 2DIUA 5DM6Q 4TY8A 4ZDNA 2B5JA 1UFLA 4USKA 4LT6A 3BF4A 1EETA 2D74B 1UETA 1TMMA 2DHHA 3OFEA 1BUXA 2XGPA 3K5MA 4NLUA 1WTBA 1CS4B 4F8RA 4DR4J 4RWXA 1ZM9A 4TY9A 1FNXH 5IC4B 4NLQA 1IKYA 1VI7A 4WTYA 1GMWD 3CCLS 1SJFA 4JV0A 3NNHA 2UUBJ 2GHVC 2HIQA 4IH5A 4HHJA 3CCWA 2CVEA 1VC0A 1FVSA 2ZHAA 1QAIA 2HS4A 2PMWA 3DOLA 3R6LB 1DARA 4K0KJ 4GO7X 4OZ1A 4B9NA 5L1JA 5IOLA 3DHXA 4G1QB 5GAHI 2OEKA 1B70B 2ASYA 2POKA 2GCFA 3MR2A 3HHLC 1K0TA 4RBVA 1LXNA 1PAEX 2M5YA 2V63A 3HK2A 4HT5A 2Y8WA 2HG4A 2J7KA 3OV7A 5J1EB 4ECVA 2ATLA 2K1RB 4FBUA 3SFGA 4NLGA 1E6VB 1PSDA 4HL9A 1BMQB 3OXGA 4ZCLA 1X9MA 3P45B 2GMLA 4Y28C 3WBZA 3QO9A 3LGNA 3Q89A 2V5HG 2FVQA 4CT8A 2Q66A 2W2QP 4OX6A 4M5GA 3MD3A 5K14B 1TKDA 9RUBA 2D41A 4OYWA 4HLBA 3IM8A 3M32A 5K9FA 3QQCD 3SSRA 1MU2B 2NREA 4WK3A 4F3MA 2H9ZA 2QYCA 1WWHA 1UMJA 1JX4A 1RAHB 2E1MC 2WTFA 3H90A 1REGX 1S97A 3UDCA 3R5CA 2YKPA 3JSMB 2WAQD 1SL0A 2QGFB 3MDFA 1RT7A 3NL0A 3C46A 4G1IA 4PG4A 3OTDA 1NB2A 4A8WA 1Q78A 2EFQA 1NRKA 4QWBA 2GS8A 3PRBA 3UD4P 4ZVHA 1MG7A 4H4OB 3SQGA 2QMUB 1FTRA 3QT6A 4RU9A 5CYJA 4NCBA 4OHXA 2FHJA 4HACA 2RDJA 4OJ1A 4I68A 4U8VA 2FLNA 5A6WA 3OL6A 1S57A 1SJ4P 3D0IE 3EE3A 3D1QA 5K8OA 1YSJA 5EWEA 2HHWA 4V1Ak 2LVWA 2DD8S 5L38A 2GVZB 5C24A 4JP8A 2AYGA 3UDEA 2Q43A 1MN9A 4ALZA 1JLEA 4PG7A 5C42B 4HI2A 3KJVB 3PYFA 2XY6A 2D9PA 1UPPA 4LF6F 4P7TA 5EDWA 5KFSA 2FD2A 2E5LF 2VA2A 1HL6A 4USJC 2VJUA 4XPCA 3T41A 3TJ8A 5F3ZA 2ZJRQ 2OPPA 3I0RA 2IA6A 1P1LA 4MK7A 4DV3F 4U95A 1PBUA 1C0UA 1QUVA 1TQLA 3M05A 3F73A 3EYZA 4HDHA 3FQLA 2Y3YA 1U1LA 1WORA 3PTWA 2QL5B 1UEKA 4UOCA 5KAKA 4DBQA 3R3TA 1A6LA 2DXEA 3DGPA 1U26A 1QE1B 2CNNB 4YB1P 1NHUA 1PCAA 4RNHA 1WNEA 5AJ3J 5J2MB 2XYGB 3AJ2A 2M8HA 2P9GA 2Z2MA 2HKEA 1H98A 2MKYA 4CI0B 1TFYA 1NU4A 2KFNA 1J5OB 3M1VA 2GO8A 1T94A 4KTQA 2GMHA 1KVIA 1FKPB 4LF9F 3NS6A 4XPEA 1XNRF 3EZOA 1LV5A 4ZJQA 2VC1A 1PG5B 3CCJS 1R43A 1SQEA 2CG8A 2J6SA 3LA0A 3B4DA 3I82A 2MLZA 2DGQA 4EUVA 4WK1A 3QPIA 4FP9A 2UU9J 3QZ7A 3KUEA 2C3UA 5CCLA 5HJYA 3QT7A 1N6QA 1U0HA 1L5UA 4ICLA 2CWKA 3LAMA 1B0TA 1WHVA 3RBDA 2FHJD 4DPTA 2CFXA 3I4PA 4K4YA 4DEZA 3EPGA 5LOQA 5HATA 4RW8B 4IG3B 1F9FA 2OI2A 1YI2S 4CM2A 5IT4A 1BHNA 3Q83A 3BO4A 1H38A 3PXGa 4DQIA 5LMUF 2X1FA 2MJUA 4X4OA 4RNOA 4BWMA 1O8BA 2B7BB 2OIHA 3TARA 1YJUA 1MWYA 4MKAA 1BQNA 5BJRA 3V6DB 2VG6A 2HFOA 1TKZB 3P5BP 2E7VA 3GIIA 2YX1A 4LR7A 2P9EA 4ES2A 2MY7A 2KFZA 1T8EA 5J2QB 3QRQA 3FZ2A 3GMGA 2QLFB 1IM4A 2FJVA 3QAUA 4CIOA 2QE5A 4TVAB 4LRFA 4JB8B 4ECXA 1OQ6A 2A6MA 1OYDA 2X3DA 5KFWA 2BX6A 3IO1A 4CWBA 2ZZNA 3VAFA 3TUJC 2OHDA 1C2PA 3E8OA 4IH6A 3U02A 3J81U 3DYAA 1V3ZA 2NQPA 3OTEA 2ZJPQ 2Z0GA 4DS4A 3T5KA 4NMXA 1K8AT 1RXOB 3NS5A 4DV6F 2UUAF 2CYYA 3BH7B 1LWFB 1WOSA 3W8GA 4OZ0A 2V8VA 2IJRA 4M63A 3MUVP 3IGNA 1X5TA 1MNEA 3RBXA 4ZLJA 4I2PA 2I5JB 1NJXA 3VHQA 4ELUA 5AE1A 1JLBB 2B8QA 2DITA 1T02A 3B82A 2MSTA 3NOCA 3D6TB 2CQ4A 1JNZB 3M8WA 4NLOA 1N88A 4ED1A 1TL3A 2QSFA 2N82B 1RBAA 1NHVA 2V8GA 2YQ0A 4MKYA 4WFNQ 2DCLA 5CQGA 1HR0J 1HQEB 2LMIA 1X8DA 1U6FA 2OEJA 3KMQA 1HWJA 1ZPVA 1RAFB 3GE9A 3C16B 4PXEA 2FY8A 4WBFA 2AW0A 2KG1A 2WSFC 3JAMY 4RUCA 5LM7E 4YR0A 3ZZUA 4FF4A 1ZTTA 1WSVA 2A6OA 4F4WA 4BHQA 1Z1ZA 1TL4A 2BM1A 1TK0A 3M2VB 2PA3A 4JYAF 4ZP7A 3LQVA 3KUHA 2OSQA 2BKNA 5KT7A 3CCVS 5KFOA 4YN3B 1L3KA 2M3DA 1QVGR 4CH0S 4RWWA 1ZH5A 1FRIA 4Y34A 3QRPA 4WYWA 2MDAA 4LF7F 3FSXA 4WIQA 5F8LA 1V6HA 3HKZD 4JI5F 2IJFA 1RT3B 2AF6A 1CS4A 2DH8A 5BR8J 1H74A 4B3MJ 3Q8VA 2B9XA 3CJTA 4J9MA 1U8SA 5I42B 5IV3A 3QJLA 2DHSA 5B0GA 4DL0C 1U7LA 1Y3JA 5J2NB 1O51A 2E66A 1IBMJ 1UZDA 1AB8A 4IOCQ 2BJEA 3ISND 3LW5C 4PXBA 3TZXA 3HF5A 4HTJA 2DNQA 4LRBA 3RZAA 4X66J 4J5OA 2G13A 2QJ3A 3KLGB 4G1QA 3JTNA 2V4JB 3KLEB 2XMAA 2KH9A 2ILZA 4V19X 2UXDF 4GKJF 3TANA 4Q44A 4OZNA 4ZIWA 5J1EA 3CE8A 1AZSB 2K1RA 4HDGA 4MK8A 5DDRC 1JXVA 3OSPA 4WIIA 4NXMF 1Q4RA 4QPTA 3RW6A 3BS9A 1S6UA 2VOPA 3IWXA 1TUVA 3A8EA 3W2VB 5B0EA 1G2EA 5KG1A 2VPZB 3CD5A 4M5IA 4B9MA 1N5TA 1QSLA 1X9WA 2ZH2A 3RUBL 2ZBIA 5K14A 4AT1B 4NWBA 4FNIA 5GAEU 4OV6A 1U1OA 4UUXA 2RQKA 2J9DA 1VIOA 4FS2A 4KY3A 3KUGA 2HGMA 4GKKJ 2W9AA 1MU2A 3MR3A 4YY3F 2L41A 3UDLA 2CAJA 1RWOB 5M2RA 3NGTA 1DFDA 3Q8YA 4N8OA 1D0EA 1XERA 3D4JA 1XR6A 2BXJA 2E29A 2UUWA 2X1BA 3PG9A 3CNQP 1D9DA 3JSMA 3QT5A 2I6WA 1WKKA 1YWXA 1UVLA 3HD2A 3MM5B 2C2OB 1VC5A 2QRRA 3I31A 5L46A 2A2CA 2OPQB 2RB7A 3LPYA 5GMEA 3VGVA 3HM9A 1WC6A 1VQPS 3E01B 3CULA 2BRLA 4H4OA 5GMKa 4ZCMA 4UTGA 4FNHA 4LRCA 3HHLB 3BQ2A 4IDKB 5EN1A 1MROB 3N6NA 3BGFA 4CLKA 3AOCA 2RDIA 3RBEA 1IKVA 5KFDA 5ETPA 3MUTP 4R0JA 4OHZA 2CJYB 2XNRA 2C2KB 4N77A 1AT1B 3E2EA 1U09A 3R7SB 4RJVA 4ZPDA 1FESA 3P8BB 1GK8A 2ZWOA 3FBBA 3P5TL 5EX0A 2VONA 5KG0A 5L1KA 2YPZA 3KJNB 2GVZA 4O3RA 2XYPB 3HHKA 1EKSA 4F67A 1H7XA 5C42A 4U96A 1ITPA 3KJVA 2X51A 3IXQA 3U27A 4IRDA 1TKTB 3SCIE 2LEPA 4TU7A 4Y00A 4M95A 3EUNA 2AJQA 1X31C 3IR6B 4LSLB 1IKXB 4IQXA 1BC6A 4RW4B 5HSPA 5F8HA 3KDOA 2VG7B 3CDWA 3NGRA 3KXDA 2M4MA 4K2JA 2DY1A 3POTB 1B0PA 4NYZA 3L7OA 5HVHA 3ETOA 2WVCA 2J9DE 2CQ2A 3KDNA 1XTZA 1EQ0A 2DO4A 4B3SF 2GVDB 3VAKA 4A48A 1RAJA 1D8ZA 2X1AA 4JI6F 2C1EB 1KLMB 4C9DA 1NSPA 1QE1A 1UVMA 3PX0A 2G0IA 3VF0B 4QU7A 4NOHA 4KKOB 4BWJA 5J2MA 2P6SA 4FPRA 4ZLPA 4DV7F 1RSCA 1FTCA 1X4AA 4OYPA 1YJVA 1J5OA 4L73A 4RW9B 3W9HA 2E44A 4I6WA 2DNHA 4LBIA 1S77D 2VPYB 2VD3A 4ED6A 3D3CJ 1I1GA 1FKPA 4A8FA 4C7QA 1UFKA 4Y65A 2VBXA 2K2PA 2YKMB 3L95X 1QJHA 4LF6J 2L48A 4Z7CA 4IFVB 1M1KT 1S6QB 2DH7A 1RE1B 2E5LJ 3A4TA 1KR4A 4EU0A 3CVKA 3VAJA 1NJYA 4USIA 1MWZA 2H1YA 2ZKTA 2L08A 3R2CJ 3BEGB 1S12A 4DV3J 1G6BA 1NK9A 5GVQA 1HPZB 3VAGA 2NYHA 4Q45A 3Q2TC 4ITSA 2ROGA 4P73A 1FFSB 1HWLA 1Q5VA 5RUBA 4XIUA 5JUMA 5LXYA 4RW8A 4IG3A 1UEVA 1D9AA 3N6MA 3H5YA 4DL6A 1Q7LB 2HHTA 3GPAA 1N48A 3VQSA 4ELVA 3EGNA 2DGWA 2QFJA 1OS5A 1JXEA 3OHBA 1KFSA 2R4FA 3GJSB 1G3OA 5DLFA 1AUSL 4KGXB 4ED0A 3V6DA 1NDLA 4K4UA 3MR7A 1MLAA 2CJBA 1N0VC 4NLXA 1NLKL 1FX2A 4X64J 2YX7A 1JJ2R 4LF9J 2BJ7A 3DLJA 5J2QA 1XNRJ 3PY8A 2HNDB 3W2WB 3EZUA 4ZCKA 2ZC4A 2G1HA 1FRXA 2VF3A 3UCGA 3VAHA 3S8SA 3W5ZA 3W9JA 2VFSA 2Z57B 3T5LA 1NXIA 1DTTB 4LQ3A 3TWZA 1F1BB 3A3PB 3ENQA 4WXOA 4KHPJ 1TK5A 2C3YA 3DXBA 1YHQS 1NK0A 5HBMB 1CJKB 1SH2A 4RNMA 5HMYA 3PO5A 5C2CA 1L3VA 3BYPA 2JC0A 4PWDB 2UV8A 2E9TA 1FKAF 3OSNA 2I5JA 3OL7A 4K5SA 4UQTA 2ZKUA 3W66A 1JLBA 5LMUJ 3K0JA 2L9WA 1YRTA 2H54B 2UV8G 4O4GB 3C8YA 1F0XA 4GRSA 4ZIVA 1R27B 2QLBB 2HLTA 1HQEA 3BO3A 1GTEA 2GHWA 4BC9A 2CRLA 3C16A 2AZ1A 2V2QA 4X62F 2F4VF 2CNOB 2E1PA 2C3MA 3FSYA 3HSJA 4YDXA 2J6TA 1UA1A 3RRGA 1FKOB 3M8RA 3KOAA 2B56A 1X4BA 1HQUB 2V69A 3M2VA 1T95A 1YDLA 3EICA 3UVJB 4DV5J 2W1BA 4MKVA 4ZVFA 2DK2A 2GQ2A 2EPIA 5KFQA 4WFYA 1NPPA 4QW8A 1KHWA 2MXYA 2UUAJ 3I5AA 4RO0A 1WJ9A 2IY5B 3NLCA 4Y2KA 4KPYA 3CW2C 1RWKB 2DGSA 2NXCA 4HYKA 2DTJA 4DV2J 4N7TA 2YNIB 1TL5A 1RT3A 3V6KA 2G2YA 2VUGA 2AP6A 2JZ5A 2ZOFA 3QT8A 3FEYB 3PM9A 3ZTPA 2HNZB 3KK1B 4DDFA 2VOOA 2VB6A 3KK3B 4C3KA 7AT1B 2C3PA 4KH1B 3SV4A 1GXTA 2K7JA 2MHNA 1J5EJ 2QLWA 2JEFA 1NH8A 4RW6B 3UNYA 4QR0A 2V50A 3SDEB 1RU2A 2LXFA 3KLGA 2RS2A 3H0PA 4NZ6A 3R2DJ 2AGOA 2F5GA 1D9FA 3R6GB 2E7WA 4M5KA 2V4JA 3KLEA 1UJ4A 3G8QA 2GQCA 3U7JA 3RTVA 3OR2B 1AZSA 4DZDA 3RJMB 3HFVA 3DU6A 2Y1IA 1SC4B 2HBYB 4PUOB 1Q0NA 3MEDB 2W01A 4ZLLA 4LF7J 1E6YB 3W2VA 2QSWA 2IDEA 1N32J 3D28A 2Z2LA 3JQKA 2ACYA 2HHUA 4ANCA 2DPJA 3ZTQA 2B3TB 3NWRA 2BE7D 1KD1T 4OYOA 1MW7A 1S7IA 2H4WB 3FRZA 1N5VA 1XC9A 2DISA 1Z2ZA 2EC0A 2F8HA 3NOGA 4EI2A 4FYXB 3TUPA 1V5IB 2W4PA 1S76D 1APSA 2YQ1A 3W65A 1NK5A 5GADI 2JLGA 1VJWA 2BJ1A 4UF4A 3MM5A 3QWUA 3LWLA 2OPQA 1I51B 1FFGB 1LW0B 2J7UA 4OZ5A 4PYDA 1IR2A 2Q6CA 1VBYA 3E01A 5I3PA 2AYBA 3M9OB 3TAPA 5B0BA 2UXDJ 4IDKA 3N6LA 3AA9A 1MROA 4KBIA 2MKCA 4ER8A 1ZTWA 4CRJA 3SSQA 3TAMB 3W7BA 4NXMJ 4Y2IA 4DPXA 3TW0A 2EBGA 1HD0A 1HNVB 4FS1A 2DHXA 2ZDOA 4BS2A 4UOGA 5HI7A 2IDLA 2G2ZA 3QJJA 2MQQA 1XIQA 1YRXA 1R6VA 2QA2A 1HHTP 1BLUA 1PGZA 3LO3A 2FZCB 1TKTA 3F44A 2YH0A 4NLSA 3FJ2A 4USVA 2V2ZA 4PR6A 2IA0A 3KNGA 1JMTA 3Q0AA 4LSLA 4YY3J 1IKXA 4RW4A 1FDNA 2VG7A 4ZP9A 1PYSB 2AX1A 1N4LA 2ZBCA 3POTA 3EWGA 5H9EK 1Q7YT 2CPHA 1VQ5S 3DDNA 3Q86A 2WK4A 2IYGA 1X5PA 2BRKA 2GVDA 1HIYA 2AJ0A 1KLMA 3G6VA 2BEFA 2ATCB 4R0EA 2Z2YB 2J0XA 4ATNA 2JOQA 2JLFA 3VQTA 3TZYA 3K57A 1JLQB 2ZVSA 3W62A 4KKOA 2DGTA 5GAHU 3MEGA 2Z8QA 2C2EA 2BE2B 3C6UB 1TZ0A 1B99A 2OLWA 2WBMA 3ONQA 5A8RB 2XG8A 1S1XB 3MM6A 2B4PA 3ENWA 3FFIB 2VG5B 3NCRA 3IMQJ 2H5EA 1OMSA 3KJFB 3LGMA 1UTAA 2XZWA 2HFSA 1JJ4A 1R6YA 5K20B 5M2PA 3AA8A 4WFBQ 3ISNC 4EMDA 2CJKA 2YKMA 4IFVA 1OJ4A 1QM9A 1S6QA 5D0HA 1U2RA 2F3JA 4PRFA 4AXIA 4DQQA 5MLCV 1NNDA 4OHYA 1AFJA 1OPIA 4DR6J 3ZZOA 5E2QA 5D77A 3QSYB 3R5BA 1ZS6A 4OV1A 2NUUG 3CC4S 2R7QA 3HT3A 3BJYA 1W26A 2XMJA 4YMEA 4LFAF 3MCSA 1YITS 4QYZJ 4B3SJ 3O5TB 5FDLB 1KTVA 5C25A 2W7OA 1FNMA 4OMFG 3QGIA 3FMWA 3NGSA 2K3KA 1VFJA 1RB0A 3LALA 4TNOA 5KFMA 1RA7A 1N34F 4DR7J 4CO4A 2Y1LB 3VVTA 3MEKA 4I67A 2HYIB 3BKFA 4DV7J 4CLZA 1IQTA 1HNXF 5EHHA 3BN4A 2F4FA 1XR5A 6AT1B 1VRTB 2JHEA 2LQ8A 4WWSA 4LREA 4F26A 1U4BA 1U47A 1OO0B 1GEHA 1FEEA 2MHEA 3FGVA 5D78A 2ZUGA 3VV2B 3D68A 5K8PA 5LMNF 2JSXA 3W2WA 3LF0A 1FERA 2KZZA 4GVBB 1WEZA 2PA8D 4XTTA 4AL5A 3MCNA 1S99A 3PRDA 2DHAA 4DX7A 4FYWB 4JI8F 4NASA 4NLDA 5F8IA 3S1TA 2FHKA 4J7CA 4DR5F 3HMJG 2KT5A 1FRLA 2JLEA 1T11A 1YVFA 3T6BA 1DTTA 1K44A 4W90B 5D8HB 3H5SA 4HTIA 8ATCB 3RB0A 1QUPA 4C0OC 4WZQA 2GMJA 3HVTB 5HBMA 3IM9A 1W25A 1CJKA 2JDJA 2B51A 3D2WA 2X1GA 1YK9A 3HX9A 4QZVB 3MTJA 2NXNA 3UR3C 3M7VA 2IM3A 4PWDA 4A46A 3MOZA 2E5GA 3QGHA 2MEWA 1W2IA 4AXJA 2XZDB 3MFIA 1ZM3A 4KE5A 5L9XA 1P6TA 1M90T 3N28A 3V4IB 2YNGB 3NGDA 2I0XA 4O4GA 1WACA 3MFHA 3MWBA 2N4CA 4UOFA 2Z4PA 1N33F 1SIWB 2MMYA 1REVB 2LQ9A 3DM2A 5ITHA 1K9MT 2FUG9 4NYPA 3DLKB 3VVUA 2K8GA 1VYAA 4F0KA 3FZBA 4KV8A 4Q8EA 2FVSA 2DEJA 1RT2B 3MMAB 1UW4A 2M8DB 5A6PA 1FKOA 4J9RA 2LA4A 3JS9A 5H1SV 2ASDA 1EETB 4PEOA 3HHDA 5DG8A 3UVJA 3WZ0A 4Q7AA 5IC6B 1P8GA 5KOXA 1HARA 5KFAA 4LIWA 2GA7A 1IVZA 1AYEA 3HPOA 2O66A 3JYTB 4AUKA 2ZBPA 4QYRA 1SJQA 1K73T 2DNLA 4DUZJ 2APOA 3ZZ0A 1RWUA 4CH7A 3CD0A 3HKWA 1RAGB 2WW8A 1FJ7A 1R8PA 2YNIA 5ETOA 4O3PA 2OPSB 2DRBA 4KGKA 2HNZA 2ZD1B 4DPWA 3DLHA 3KK1A 2W2MP 3KLFB 5DQIA 2KXFA 5SUHA 1RU1A 3KG4A 4NLRA 2DBBA 3JTOA 3BPDA 2UXBF 1RJJA 3I32A 3K5LA 3JSYA 1R8CA 7FD1A 2RHSB 4RW6A 4QPXA 2E1RA 1HI1A 3BGUA 3CO9A 3GJTB 3VZIA 5LSLA 2MLYA 2GIRA 4X62J 1UPMB 2KYXA 1GH8A 2PFFB 3SDEA 1X4EA 1SKWA 3V81B 3PDNA 1QVFR 3SEOA 2MY8A 5KFFA 3PW0A 4OX9F 1Y10A 4L75A 1VQKS 4DN0A 2CADA 1MSWD 4KT0C 3A1YG 2X7IA 2CPXA 4HR2A 4OL8A
chains in the Genus database with same CATH topology
3MXHP 5E3RA 3TUJC 1C2PA 4PUOA 3E8OA 4IH6A 3U02A 2WHOA 5B0FA 4I7FB 4C8MA 3DYAA 3MOJB 2O01C 2A18A 1V3ZA 1C1BB 2B6AA 2NQPA 3MEDA 2RQMA 3OTEA 2GFFA 2HWIA 2ZJPQ 2Z0GA 2CDQA 4IG0B 4DS4A 2DNZA 3T5KA 1K8AT 2RE1A 3H5UA 4X4SA 3T9ZA 3NS5A 2R2RA 1E6YA 3I5CA 4DV6F 1IJEB 3D1HA 2OAUA 2UUAF 2CYYA 5A8WB 1LWFB 5J1NA 4DF4A 3K8VA 3PJWA 4F2SA 4OZ0A 3M8PA 3J81Y 1TVRB 4EO6A 1MMNA 2V8VA 4M63A 3MUVP 3CDEA 2BA9A 5DM7Q 1VQ4S 4HKQA 3IGNA 1X5TA 2CPYA 4GKKF 1KS2A 2RQ4A 2CZVC 4TXSA 3DLEB 2IM2A 1QY7A 3PACA 1NB7A 1PILA 1U24A 1MNEA 2OPRB 1ZAXA 4DL3A 3M6XA 4KQZA 1OPZA 2W7PA 4CO0A 5HROB 4I2PA 2GHPA 2I5JB 3RAXA 1DQAA 1NJXA 1JJHA 1GX5A 2IMOA 4ZA1A 4Y2CA 3KTQA 4ELUA 2A1BA 3HLUA 5AXKA 5AE1A 1FXLA 3IR7B 2AQ4A 1JLBB 2F7VA 2HNYA 4B3OA 1FNOA 2DITA 1T02A 3B82A 5I3UB 3U1NA 2MSTA 2YKQA 1P27B 1U1MA 1BWEA 4OX7A 2UXCF 2CQ4A 1JNZB 4JI7F 1DQ8A 1XMBA 2I1RA 3HXMA 3IBWA 4WYLA 5AE3A 5C25B 4NLOA 5IT9Y 1N88A 3CJ2A 2R8KA 3VZHA 3UR0A 3GFXA 4YR2A 3OVAA 3KMSA 4ED1A 4XO0A 3MMBB 4E98A 1TL3A 2NPFA 5IM0B 2J0SD 2QSFA 2N82B 1R89A 2M70A 3NBPA 1NHVA 2V8GA 1X0FA 4MKYA 4WFNQ 2DCLA 4WCEQ 2HRYA 5IFMA 1LK5A 5CQGA 3G8SA 2MQOA 4O0IA 1HQEB 1QAXA 2F9JA 2G9OA 5FD1A 5KG4A 1RKJA 3FMBA 4ID5B 4TN2A 2LMIA 1TV6B 1X8DA 4N47A 1U6FA 3KMQA 2LXUA 2YKOA 1HWJA 1ZPVA 2EK6A 5KT5A 3CMAS 1Q86T 2VC0A 3PKMA 3GE9A 4P7VA 5AXLA 3OR1B 4V19J 4PXEA 2HQ3A 4O3QA 4C3LA 1LW0A 5F9NA 1IR0A 3M6WA 2F1FA 2RKIB 1RT5B 4A8KA 3EPIA 2KG1A 2AW0A 1VHFA 3HZGA 4ZP8A 4ZPTR 2ASLA 3BSAA 2WSFC 2EWHA 2JX2A 3JAMY 4RUCA 2CPFA 2ZH5A 3V5RA 1S0MA 1HMVB 2VZ9A 2E9RX 2BOPA 4YR0A 2R7XA 1FXDA 3ZZUA 3I55S 4FF4A 1ZTTA 1KQFB 4G1PA 4DR3F 2PMHA 3HFKA 3JSRA 4DG1B 1HW9A 4RW9A 1VIXA 4F4WA 4NZ0A 2P6TA 5CD4H 1NK6A 4CZCA 4BHQA 1Z1ZA 5L1LA 4B9LA 1TL4A 3AHPA 2BM1A 1VQLS 2A3JA 2VFRA 1TK0A 4QWAA 2XS5A 3NNAA 1HWIA 3TAMA 3M2VB 6FD1A 2PA3A 1VC6A 4DFMA 5LJ5Y 3I56S 2ZH9A 4JYAF 1LWCA 2KHCA 1KQGB 2CQPA 1SV5B 2RH3A 4ZP7A 3BSNA 2C3OA 2O1PA 3BGRA 3LQVA 2OSQA 3T1HF 4KO0A 4MMOA 2MQMA 5KT7A 2KM8B 4HH0A 4C98A 5KFOA 3CCVS 2KJVA 1HNVA 1L3KA 2M3DA 5A0YB 1QVGR 2DGVA 4CH0S 4RWWA 1ZH5A 3ZZYA 2BVZA 3ITHB 4ZS6A 2J9CA 1FRIA 4I56A 3T1AA 4Y34A 1GNKA 3GFZA 1TR0A 3M6UA 1RTIB 4WYWA 2CG4A 1BQMB 3AQPA 5T7LB 2MDAA 3LH2S 4PG5A 3DI6B 2W9BA 4LF7F 4YB6A 2XSJB 4NL5A 3FVYA 3FSXA 3MECB 4RU2A 3CCMS 5KG3A 2DPIA 3O2IA 1V6HA 5F8LA 3HKZD 3CCSS 3GG0A 2OPPB 4A8QA 4JI5F 2XS7A 4FF3A 2IJFA 2GGPA 3FNNA 1RT3B 3MGJA 4CNYA 3PHEA 2VQFF 2AF6A 3HHLD 3PKYA 1HPZA 1ULRA 2AV5A 2DH8A 3LAKA 4A8MP 1NZAA 2LKZA 2BACA 1UL3A 3SV3A 1KOOA 2CPDA 3SMZA 4CNZA 2HAIA 3CJ3A 3HZEA 3IC1A 3MI7X 4NLTA 5KFKA 2HPUA 2KTQA 3UW1A 2B9XA 4ZP6A 4J9LA 1KOHA 4DR1F 3E3XA 5CH7B 3QJPA 4J9MA 2YWKA 3BZQA 2MZRA 4RX6A 2C22A 1U8SA 5I42B 2CQ0A 2R2TA 3IGVA 4M5DA 3QJLA 3Q8SB 2W4CA 3MF5A 2DHSA 5B0GA 2V4QA 2UUTA 2E5HA 4DL0C 5F9LA 4ETXA 4RZRA 1U7LA 3BN7A 3ISZA 4FVMA 1KONA 1RGVA 3PIOQ 3AB2B 4EEYA 2HMIB 3BREA 2WB1D 3MMCB 4NCGB 1QSYA 3KK2B 4Y6IA 1H2VZ 3Q8RB 1Y3JA 3ZZTA 4ECRA 3N5BA 5J2NB 1O51A 3PW2A 2E66A 2C28A 4NMLA 3GV7B 3RB6A 2OFHX 2BQRA 1UVIA 5DG7A 4OIXA 4U7UK 2OTJS 2OO4A 1M5SA 4IOCQ 3CJ4A 3NCPA 2BJEA 3ISND 1RT1B 1HBOB 4ILRA 5DQGA 2J9EA 4PQUA 2EK1A 1X0PA 4IYQA 1S6OA 3LW5C 4PXBA 5LT5A 2WCXA 2HW3A 5LSRA 3HF5A 2PI4A 3F41A 4HTJA 4I6YA 5IT0A 4TQSA 2YWHA 2LECA 2DNQA 3LP2A 4F3QA 1S9GB 1XK8A 4YOEA 4YQWA 4R5PB 2DR8A 4DL7A 4CH1A 4A8YA 2LU2A 3RZAA 5D3GA 3DM2B 4J5OA 2G13A 3KLGB 1S1TB 1JLQA 4G1QA 1Q8IA 3JTNA 4IFYB 1DZ5A 3G4SS 3BDPA 3CGIA 5THWA 4RW7A 5E5NA 1X5SA 2V4JB 4DL5A 2VL1A 3PW4A 3KLEB 3M1VB 1DTQB 2IRXA 3Q22A 2KH9A 1SKSA 2ILZA 3HVRA 2L9DA 4V19X 2BE2A 2UXDF 1YBAA 3C6UA 4ECSA 4GKJF 3O1LA 3TANA 4Q44A 1IBKF 4OZNA 4KV8B 5J1EA 1LFPA 2RJZA 4X4UA 3CE8A 3DMJB 1Q16B 2K1RA 3IWLA 2V9KA 4HDGA 4MFBB 2UUCF 1FXRA 1XNQF 5F8JA 3MM8A 5A8RA 3CF5Q 4JI4F 4KFBB 2HNDA 4MK8A 4DR2F 5DDRC 3L09A 4JI3F 4IR9A 1M5OC 1S1XA 3OSPA 1S1UA 1WEXA 4WIIA 4NXMF 1Q4RA 4F4KA 4IO1A 4QPTA 4UY85 3RR8A 3RW6A 3FFIA 3BS9A 2VG5A 1T03B 3G9CA 4BDPA 2PN6A 5DQHA 4JV5F 4PG8A 5T14A 1UFWA 5DS7A 5B7WA 5SZTA 1S6UA 2VOPA 3TUIC 3IWXA 3CCES 3CCQS 4LJMA 3J7YI 1TUVA 4B9UA 3A8EA 3UNGC 3W2VB 5B0EA 2R8GA 1G2EA 1M5VC 4I4BA 1UWBA 2MZ1A 5KG1A 4YB5A 2CQCA 2VPZB 3CD5A 4MH8A 3J7YU 2GQQA 2M88A 3HDSA 3DLBA 4B9MA 4Y0FA 1X9SA 4JV2A 2XMTA 1N5TA 1FE4A 3C6TB 4I2QA 2RF2B 5JVHQ 1X9WA 3M8SA 1QSLA 2ZH2A 5GAEI 2GV1A 5DGBA 2ZBIA 2F8EX 5K14A 3OUYA 1NJWA 1HWKA 4NWBA 5DETA 1YJWS 3HO1A 4FNIA 5GAEU 4LUBA 1U1OA 1KC8T 1N6QB 1VK3A 1TL1A 4UUXA 3M2RB 2RQKA 3D5MA 4QCLA 3IA0A 5KG5A 2J9DA 1VIOA 4FS2A 2FHOB 4OQJA 3G71S 4KAIA 3UFCX 2M9KA 5I4MA 3LOUA 1H2UX 2GW8A 3K5PA 4G6VB 5KT2A 2HGMA 2W9AA 1MU2A 3H2VE 3MR3A 4DR4F 1RTJB 4WXWA 2F8MA 3J7A1 4KB7A 4YY3F 3PR4A 4MKBA 4K4VA 3DRRB 2L41A 4B9VA 2J8AA 3M8QB 4OI2A 1V3RA 2R2SA 4ED2A 2ZITA 3UDLA 1BD6A 4IRKA