1KD1T

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kd1T00
3R1HA 2CPYA 2DGWA 1U1OA 1Q86T 1H6KX 2G0CA 1D8ZA 3BS9A 1P1TA 1N54B 2V94A 5DM7Q 3CUNA 2QFJA 1KOHA 2OSRA 2RVJA 3VF0B 1WHVA 1YI2S 1ZZNA 3RW6A 2MXYA 3EX7B 4CIOA 4TU7A 2E5HA 2CQ1A 2VODA 2BZ2A 5LSLA 3CULA 1U1PA 5EN1A 2D9OA 3VAMA 2KG0A 1NJIT 1KC8T 4IOCQ 2OJ3A 5LSOA 3MDFA 5DDRC 5GAGU 4WFAQ 1U1KA 2MSTA 2L41A 2ERRA 5JVGQ 1IQTA 1FJCA 2DNRA 5DM6Q 5GADU 3MURP 2ADBA 1X4DA 1WWHA 2DH9A 3NNCA 1H2UX 4F26A 3CXCR 1VQ8S 1WG4A 2DGSA 2KU7A 3G96A 1K9MT 2ZJRQ 4W90B 1VQ4S 2LMIA 1VC5A 1FJ7A 1DRZA 1YIJS 5HO4A 3D2WA 3ZZYA 1A7GE 5DDOC 2CQIA 1VC0A 1W2BR 3CTRA 2KH9A 2MQLA 1Q82T 4W92B 2RRBA 1X5PA 2MQPA 2LEAA 3UCGA 1X5OA 4A8XA 4U67Q 2JRSA 2E5IA 3BO4A 3R27A 1X4CA 2MY8A 3K0JA 3MXHP 2BOPA 2X1BA 1Q81T 2G1DA 2LQ5A 2DNQA 2HGLA 3H2VE 2EVZA 2HGMA 5LXYA 2VOPA 4TU9A 2NZ4A 3G71S 2JX2A 1YWXA 1RK8A 2F3JA 2HYIB 2MQNA 5LJ5Y 4UY8T 4WIIA 3NNAA 1DHMA 2ADCA 3Q2TC 1A9NB 2M7SA 3V4MA 2I2YA 2F9DA 3CC4S 3MUMP 2KM8C 2QEXS 2MKJA 2DIUA 4WCEQ 1VQ5S 3CCSS 2B0GA 1VBZA 2CQCA 2L9WA 2DISA 2MGZA 4WFBQ 3VAGA 2PEHA 4Y00A 1SJ4P 2CQPA 3VALA 1VQKS 3NNHA 4YUDA 2EK1A 2DNNA 1N88A 2K3KA 2MYFA 4F02A 1YHQS 3HHNB 2MQMA 2CQDA 2KXHA 1ZZFA 3G4SS 4CQ1A 3CPWR 4WF9Q 2JVRA 1FT8A 5HL7Q 1U1LA 2YWKA 1SXLA 4FXWA 2L08A 1PO6A 4YOEA 2LEBA 1JMTA 1FXLA 2RS8A 2U2FA 4QQBA 1U6BA 3FEYB 2XNRA 3CMAS 5JVHQ 2YTCA 2EK6A 1SJRA 2MKHA 4IUFA 3US5A 5H1SV 1H2TZ 2F9JA 2DGQA 3U1LA 1HA1A 3CC2S 2CPEA 2M8DB 2KI2A 1YJNS 2M2BA 2LXUA 2JVOA 5D78A 3U1MA 1SJ3P 2N3LA 1B7FA 2ZJPQ 1QM9A 3P5TL 1KQSR 3S6EA 1Q7YT 2DNHA 2CQBA 3S01A 2KN4A 4OZ1A 5D77A 3OW2R 2HVZA 1WF2A 3N9UC 2D9PA 2KXFA 1WG5A 1YTYA 3G8SA 2M9KA 2RUGA 5IQQA 2DNKA 5GAEU 1FHTA 3VAFA 1VQMS 2DNZA 1X5TA 3MUTP 3G6ES 1D9AA 1FO1A 2DK2A 5IM0B 1U1RA 2FY1A 2M70A 2X1FA 2KT5A 5LJ3Y 3VAIA 1WEXA 2RQCA 1WEZA 2RS2A 3BO2A 3CCJS 3CCUS 2DH8A 2MB0B 1QVFR 3SDEB 2AD9A 2K8GA 3UCZP 3MUVP 2UP1A 5DETA 5GVQA 2M88A 3J7ZT 2MMYA 2E5GA 2X1AA 1WI8A 3P3DA 2G4BA 3R1LA 3I56S 1WTBA 2FC9A 2DHGA 2DNLA 2DO0A 1S79A 4F25A 1XN9A 2FHOB 1WEYA 1K8AT 1JJHA 2AYGA 1VQ6S 3G8TA 1NU4A 4TU8A 2MZJA 3CD6S 2MQOA 2QA4S 1P27B 2LCWA 3TP2A 1RKJA 2XB2D 1WF0A 2N82B 3B4DA 2AYEA 2XS7A 3VAKA 2CQ3A 1VQ7S 3EGZA 1R8HA 3CMES 2GO9A 2MZSA 2YKAA 2XS5A 1FJEB 3CC7S 2A3JA 2DNGA 2DNMA 4QU7A 2AYBA 1VBXA 3IRWP 5MLCV 2DNYA 1WHWA 3G9CA 2GHPA 4IOAQ 1S72S 5CXTA 2DITA 2OTLS 1OWXA 3EGNA 3J7YU 4Y0FA 4WKRA 2MPUA 2M4MA 2E44A 2WBRA 1M5VC 5ITHA 1U2FA 2CPIA 2LECA 4RU2A 2J8AA 2RT3A 2KHCA 2RQ4A 1OO0B 3HI9A 3Q2SC 3NS5A 3DXBA 3UWTA 3TYTA 2DHSA 3TO8A 2MKKA 4PR6A 1H2VZ 3SMZA 1M5KC 3ZZZA 2DH7A 1VQOS 3L3CA 5LXRA 1AUDA 2LYVA 3RW7A 1X4HA 2CQ4A 1K73T 2DIVA 2RRAA 2DGXA 2M52A 2DHAA 2MZTA 4ED5A 1KOOA 3CF5Q 3SDEA 2VOOA 2D3OR 2J76E 2DNPA 4PKDB 3DLLQ 1X4EA 1SJQA 2DGOA 3CCMS 5GAHU 2ZJQQ 4LIRA 2MZRA 2LXIA 2KVIA 3H2UB 2N3OA 1N52B 4C4WA 4CH0S 3SXLA 2PE8A 2MHNA 2MQQA 1URNA 1R8PA 3LQVA 4C7QA 1N8RT 1UAWA 4OZ0A 1HD1A 1FNXH 4ERDA 2KG1A 1O0PA 5CYJA 2DB1A 1U1NA 2OIHA 3CCVS 1HD0A 2MKCA 3MD1A 4BS2A 1VQNS 1M5OC 1X4FA 3VAJA 1VBYA 1G2EA 3ULHA 1JJ4A 4EGLA 2DO4A 2KM8B 1M1KT 2DNOA 1YJ9S 3I55S 3UCUP 3UD4P 2HZCA 4QPTA 4CH1A 2LKZA 4FXVA 1SJFA 2MGZB 2CPFA 1ZH5A 4YB1P 1WHXA 2XSFA 2XS2A 1DZ5A 2CPZA 5DDPC 2CQGA 1NO8A 2MKIA 4PRFA 3IWNC 3B4MA 3LPYA 3JB9k 4QU6A 2CPDA 3CCQS 1CVJA 2U1AA 1U1MA 3S7RA 2LA4A 3THPA 1YITS 1X0FA 3CCES 2YH0A 3PIPQ 1OPIA 4V19X 2CPHA 1WELA 3MI7X 2OSQA 2N7CA 4ZKAA 4J5OA 2AYMA 1UFWA 1WHYA 2KFYA 1UW4A 3CCLS 2KRBA 3FEXB 1VQ9S 2KXNB 2J0SD 1YJWS 3S8SA 2Q79A 3P6YC 1X4AA 2FC8A 2JWNA 1M5PC 2MKSA 4Z2XA 2OTJS 3NS6A 2CQ0A 4C0OC 3BO3A 2MJNA 5DDQC 4IO9Q 3VAHA 4LJMA 1X4GA 4UQTA 3THTA 1M90T 2J0QD 2CQHA 3PIOQ 2M0GB 2KRRA 1VC6A 1WI6A 1PGZA 1OIAA 2KYXA 2CQ2A 3MD3A 2HGNA 1BY9A 2RNEA 2SXLA 1DBDA 2MY7A 1VQLS 2O3DA 3P49B 2MSSA 2LA6A 2CPJA 1L3KA 3NMRA 2DGVA 1X5SA 2I38A 5BJRA 5CA5A 2RU3A 3CCRS 4LMZA 1U6FA 3BEGB 1JJ2R 1QVGR 5IM0A 5FJ4A 4M5DB 2FPHX 2X1GA 2M8HA 2CPXA 1U1QA 2YH1A 1UP1A 4WFNQ 2MZQA 4TLQA 3MOJB 2DGUA 3UE2A 5GMKa 2CJKA 1F9FA 1WG1A 3UD3P 2DGTA 2NLWA 1HL6A 2DHXA 1WF1A 1VQPS 2MZ1A 4P6QA 1X4BA 2E5JA 5IFMA 1KD1T 2VONA 2XNQA 2MJUA
chains in the Genus database with same CATH superfamily
2WTFA 2HHSA 4NXMF 4HT5A 5HLFB 4CIOA 2V9KA 5C24B 2D9OA 4FNIA 1NJIT 4WFZA 3BQ0A 2V2ZA 2XTJP 1FKPB 5DQGA 4QYRA 3ZZ0A 3D68A 3G96A 2EFNA 4KH0B 4H4OB 2ROEA 3MMCA 3ZZRA 3Q8RB 3CO0P 4U7CA 2J7WA 1AZSA 2ROGA 1EAYC 2JRSA 1L3UA 2GGPB 1HMVB 3K0JA 1CJUA 1Q81T 2B4OA 4GKKF 5L1IA 1HBUA 4EBDA 3T3FA 2OPQA 3OVBA 4QBUA 3NWRA 4MTPA 4ZVQB 2F8MA 3D0IE 4FBTA 3KFWX 4HACA 5A8WA 2B6AA 2V63A 5M2RA 2N4CA 2G2YA 4NMLA 4JI1J 3FJ2A 3R6LB 4MIAA 4EYIB 2A18A 2L9DA 1R0BG 1S12A 3FKBA 2HURA 3OXGA 2W4DA 4U8YA 1LOUA 4NLDA 4WP3A 1TKTB 4ZCKA 3T1AA 1WOSA 2C2DA 4LF8J 1LWFB 2DPJA 1VLOA 5KT3A 4FF3A 2YPYA 5B7WA 2WONA 1LWCA 2GCFA 3U1LA 2I0XA 3SQOP 1HLWA 1JLBA 3UO0A 1Q7YT 3HSGA 3R5DA 4LQ3A 3N9UC 3LO3A 1HQ2A 1MMLA 4HYKA 3ETMA 3I4HX 2VJUA 1S1XA 1D8YA 2PIIA 3OL7A 1DTQB 5E33A 4FN5A 3KG4A 1F5CA 4YHHJ 3DOKB 4FYWB 4UW2A 3S1TA 4F4ZA 3UN3A 1HBOB 1F3FA 3NL0A 1VMBA 2BMBA 2M88A 2IRUA 4A46A 3ZC4A 5D4PA 1Q79A 3I56S 1S1UA 1S79A 3VQTA 3QSYB 3HSZA 1P1LA 1RACB 4EK2A 3OT9A 4ZN1A 1G3OA 1KP6A 2HHUA 3OTCA 2NXEA 2MQOA 4QIVA 1MNEA 2XB2D 3NCRA 5B0CA 3EGZA 3PR5B 2GO9A 5AJ3F 4LF9J 3GPAA 4FPIA 1IKWB 3E3XA 3IRWP 3SQGA 1GX6A 4NCBA 3TARA 2ZH2A 4IH7A 2CUYA 5LMUF 1MSWD 1FDNA 4K2JA 1Q5YA 5ETNA 4LF7F 5EHHA 2PD1A 2YKQA 2UU9F 1XR7A 2EBGA 1H2VZ 2DH7A 4WU3A 3ELHA 3T9ZA 1D09B 2GAHC 4PG8A 3EXYA 1APSA 2O5DA 1F1BB 5IT0A 2W8LA 2DGOA 1DQAA 3FMWA 1N52B 2RRNA 1HWKA 3LQVA 3MEGA 4CLYA 4OZNA 3G6VA 2V4JA 3JQKA 3ISZA 1VQNS 1IKVB 5SZTA 3GWCA 1I5OB 1U7LA 3FDSA 5G0RA 1NXIA 1N33F 3JSRA 3EVWA 1U4BA 2FTRA 4ECRA 2LU1A 2ZOMA 5F8NA 3JYTB 4Y6IA 3DRYA 2ZWOA 5B0BA 3OHBA 4QWCA 5DRKA 3JB9k 1H0HB 2IA6A 2CXEA 3DOMA 4NE9C 4CNYA 3X3UA 3MM7A 2XZTB 4NLUA 2R8HA 1X8DA 2CNLB 3PV8A 3ZZTA 2MDAA 1FFGB 4DFPA 4NPOA 1BQMB 2Y0BB 4W4MA 3VGUA 3N5FA 1KLMB 4IO9Q 1EARA 5C25A 1VHIA 3N4WA 4L72B 1A0OB 1DBDA 3ILOA 4WJBA 1PKUA 2LA6A 2CPJA 3V6KA 3NMRA 3NWGA 5CA5A 4OLPA 4J9LA 1Z1ZA 5FJ4A 4R8UA 1RWXB 1RBAA 2GA7A 1X7VA 3PACA 4D3GA 1TFWA 4LF5J 4X66J 2BE2A 3OFHA 4C0BA 4TXSA 3CDBA 2NPIA 3DU5A 1CULB 3AJ1A 3FZ2A 3SFUA 2BJDA 2HBZB 1OPZA 2FIUA 3OTOJ 1Q1KA 3G8QA 4NLXA 2OEMA 3W9IA 3EWGA 2OJ3A 5DDRC 2VFUA 3DLEA 3MURP 2DXEA 1WWHA 5KOXA 4J37A 1RKIA 5CZVA 5BYSA 4CZCA 3CDUA 3TVZA 1K1QA 3GYGA 3R27A 4NZ7A 3C19A 3MXHP 2HHWA 2RKIA 3I6PA 1VISA 4RW7B 2HZAA 4AXJA 3DXSX 4R0EA 3M6WA 2OPSA 5L9XA 2DCLA 2KJVA 3QPIA 4XDDA 4LF4F 5LJ5Y 3SYZA 4AE5A 1NJWA 1FX4A 4JI2F 3RRHA 3RBDA 2YVSA 3UDCA 3J80Y 3PW2A 2IC3B 4K0KF 1E6VA 3AAWB 1IKXB 4AL7A 2IMOA 1S77D 2Z8QA 2PEHA 2K3KA 3TEGA 2X3GA 4A8OA 4CTAA 2J7KA 3ZTOA 2W7OA 1ELOA 1HNWF 3F41A 1B70B 2L08A 4QW8A 2HHPA 2J9CA 3GCXP 2H65B 1WC6A 2VG7B 4ZLLA 1NK6A 4W98A 4IUFA 4ECTA 4C8LA 1YJNS 4DZDA 3H4BA 4WFXA 1KTQA 4XPEA 1B7FA 2JLGA 2QA4G 2YY3A 2B8QA 2HVZA 3HO1A 4M5KA 2D3ZA 1NK8A 3BGRA 1RWVB 2VB6A 1RT5B 3PY8A 2XG8A 2R2TA 2KJWA 1BE4A 4J9UE 3GIIA 1RE1B 5A6PA 5HQLA 3TJ9A 1SUQA 4Z7CA 2B7BB 2FVCA 4ILRA 1SIZA 4I6WA 4K4SA 2L48A 1R89A 3CD6S 1R3NA 2OD4A 2LCWA 4NWBA 2BQRA 2HVEA 1JLAB 2N82B 2RF2A 3OL9A 1JLEA 2E1AA 3BN7A 3MR5A 3ZNUA 1J5EF 1R7IA 4IOAQ 2KHDA 1TL1B 1LFWA 2UUBF 1HNIB 1RLDA 3BYPA 2RQMA 3A3NB 3C66A 1BQNA 4NLSA 4WTYA 4PG6A 4ZHRB 1KHWA 2B8PA 3QJPA 4ID5B 2BW2A 3NAIA 2B43A 1LXNA 3SDEA 4F36A 2FY8A 4DV3J 3HMJG 2OLWA 3LW5C 2V4RA 2B4UA 4OJ3A 1RHKB 4X4RA 3KLIB 4ZP8A 3SV4A 4NLVA 3IBFB 1ZYQA 1R8PA 2DTJA 4D3HA 1UAWA 2QLJB 5A0YA 4IFVA 4URSA 4JV5F 4Y2AA 2NYIA 4DL3A 5T41A 1NSQA 4N77A 2XCAA 2JEJA 3DNCA 4NLPA 2I5JA 2AZ3A 1RTIA 2XSFA 4LREA 4O3SA 5ETPA 3LPYA 1D3WA 1U1MA 2CVIA 3K57A 3THPA 1YITS 3FC9A 2R2SA 3B8HA 2DEIA 2R7SA 3QGPA 4NLQA 2AYMA 2J7UA 3IG1B 1WHYA 1WC3A 1VQ9S 2J0SD 5BR8J 3SCJE 4JI0J 2IDEA 1QDUB 4EUVA 4DQQA 3DRRB 3M2VA 1PSDA 4P7VA 4B08A 3THTA 4OYOA 1HARA 4TY8B 4Q2MA 5L39A 4RNHA 4TKTA 2XMVA 2YWFA 2CA9A 1TKXA 2KYXA 5E3QA 3H5SA 3MZIA 3O44A 1HQEB 1U8WA 4NLYA 3M8WA 3BEGB 4WP8A 5DG8A 2EKNA 1T94A 4K59A 1UP1A 2FJDB 2Y1IA 5IOLA 5GMKa 3C14B 3KLGB 3HFKA 2V8VA 3RZAA 3HCXA 3ET6A 2C28A 5A2QU 4DR6F 1F9HA 5IFMA 2XNQA 5F8GA 1K0TA 4B17A 2HK3A 1IKYA 1LQ9A 4O4GA 3QO9B 4DHVA 4DEZA 3W1YC 1RAGB 3VF0B 2NXCA 1ZZNA 4KGVB 2ZUAA 3CULA 2OHDA 1U1PA 1UFLA 1L3VA 1M1GA 4X4QA 5KFCA 3IAS9 2JFDA 4WKYA 4F7VA 4DFKA 2XO6A 3CJ2A 2BKNA 1VRQC 1G4CA 2B56A 2VF3A 2R42A 4DQPA 3H4DA 1RT2A 4A8XA 2M5YA 3KOAA 2OEJA 3KNGA 2G1DA 3BGOP 3FSXA 4LF6F 4PXCA 1IBMF 4UZCA 4ZVHA 4DR1F 5GAEI 5HBMA 1FVQA 1DTTA 2W2MP 3BN4A 4UY8T 5KT5A 4B02A 4DPOA 3TVYA 3ZTQA 4KC5A 3OHAA 5RUBA 3J7AN 4KKOB 3TZXA 5KFAA 2C3PA 1VQ5S 2NCKL 1HR0J 2O1PA 4NLOA 1GFWB 1V3SA 1QSLA 2D7SA 1H98A 3W5ZA 1U1LA 1SXLA 2YWEA 3RR8A 3M6VA 3ZTSA 1KS2A 1CJKA 3W2VA 2RJZA 4ZVTB 4NCGB 3MAQA 4RUHA 1DARA 4Q45A 3R5JB 1ITPA 1Q53A 3KNAA 3RAMA 1WJ9A 4ED7A 2IYGA 2JVOA 4U7UD 4CNZA 5HP1B 4MYTA 3CGIA 4OZ1A 1IBKJ 4DUYJ 3HVWA 5GAEU 2DK2A 5GAHI 5IM0B 2HBYB 1LW2A 3CCJS 4PWDB 3MUVP 5KTQA 2MMYA 3EGVA 2VPXB 1WTBA 2DO0A 2HFVA 2YNIA 4P2SA 2ZH9A 5CCMA 2FHMA 2PEBA 1NU4A 1PYOB 3R3TA 4DN0A 3MM8A 2E9RX 3VQSA 1TL7B 3C6UA 2V2KA 4RR5A 1S9GA 1FJEB 3OFGA 2DNGA 3CNQP 2XWYA 2DNMA 1QAIA 5K14B 1AB8A 1W26A 5CXTA 2OTLS 2Z2ZA 5JJBA 3D0GE 4BHQA 1U02A 2FLPA 5F8JA 1FRKA 1SH3A 1UPPA 4M63A 4YEAA 4HEA9 4MFBB 4HHHA 2ZKTA 4X84A 1RSCA 1VRUB 1S0MA 4IQMA 2ZNZA 3ZZOA 2ZM6F 1KOOA 2VOOA 3DDIA 2UXBJ 3HZGA 3OD2A 5GAHU 2GZOA 1CS4A 2HFOA 4ALZA 2NXJA 4Y2KA 3KLEB 1NEEA 2YNHB 3PKYA 5D3GA 1EX8A 3FCVA 2RHSB 4C7QA 2W9CA 2RDJA 5KG6A 2JLFA 4YY3F 2WCXA 1G2EA 4Q44A 1QSSA 4RO0A 2KM8B 2UVWA 1RABB 3NCPA 4M95A 4C8MA 3BKTA 2OO4A 3KKFA 2LDIA 1NCLA 2F63A 5IV4A 3H40A 3S7RA 1S1TA 3T1YJ 3GR0A 1KKHA 1V3ZA 3G86A 4V19X 2CPHA 3CVKA 3AY0A 1VRTA 1K0VA 4CWBA 4KHMA 1LEOA 3MTKA 2Q79A 2JWNA 1HNZJ 3M2RA 1GXTA 2FLOA 5A6WA 4C0OC 2H54B 3BO3A 4LVOP 3PYDA 4RWXA 2CJBA 3AQOA 3I0RA 2R4FA 1WI6A 1OYDA 2JDJA 1U47A 1HPZA 4IRCA 3HXMA 1FDAA 2G2ZA 3MMCB 1UEVA 4CYUA 2EC2A 2DRBA 5DQHA 2MZQA 2YKNB 3UD3P 1CJUB 1N32J 2O01C 3EJMA 5E7OB 2PGCA 4DV5F 1HBUB 1T9WA 1HBMA 4DX8H 2W8KA 2OPQB 4AYBD 3HHEA 5D4NA 2HQ3A 2GIQA 2DGWA 1Q86T 2DXFA 4HACB 1XMBA 1S49A 2OELA 2B6AB 2QFJA 5A8WB 3QAUA 2YBVA 1U45A 2V67A 3EX7B 2E5HA 3EGWB 4QJVA 4Q0BA 5LMNJ 2ZBCA 4A48A 4FKXA 3E2EA 3TANA 3K89A 5GAGU 3JSMA 3SV3A 3N6LA 4XAKA 2FJWA 3LGNA 4HR2A 2DGSA 4Z37A 1T9VA 4W90B 4MK9A 1HYSA 1YIJS 4KO0A 3FRZA 3TQ1A 2MQLA 2BACA 2WONB 2EFVA 1LWCB 2BOPA 3A1YG 4NXNJ 3VR1A 3RTVA 1UVKA 2MQ8A 4B9LA 1URRA 1ZTWA 1TUVA 4JI6J 1U49A 2ZC3A 3F73A 1JLBB 2UXCJ 5EWFA 1Y5LB 2BA9A 4OYBA 2C2ZB 2I2YA 1LK7A 4DV6J 4QIFA 2HSEB 2EFOA 3P5BP 4I1TA 1S1XB 1TVRA 2B0GA 2R8GA 3D9BA 1B3TA 4WXOA 4YR2A 2L9WA 4USVA 3RU0A 3KK2B 2B3TB 4CLZA 2EK1A 4OQJA 3KXDA 1RP5A 1S1UB 1C1BA 3H42A 3AA8A 4K4ZA 3PHTA 4N8OA 4DR3J 2QN6B 1XR6A 4IFYA 2IJFA 4ZPTR 5J2MA 2AEFA 4YOEA 1JMTA 3EVMA 1WKLA 4KHRA 1SKUB 5JVHQ 5KFOA 3EZOA 1OMSA 4X62F 3SQGB 4MKVA 3U1MA 2VKRA 2ZOFA 3PW5A 3K5LA 3W7BA 3QATA 2ILYA 1WG5A 2GS8A 3DGVA 5IQQA 1FHTA 4GRSA 1VQMS 3DFEA 4LSNA 3PRBA 4DR7F 2RDDA 1WEXA 1W7WA 4DMZA 3DLKA 2MHEA 4A8MP 3ZXWA 3B6BA 3TJAA 1ACMB 3CO9A 4TY9A 3AQPA 2YX4A 8ATCB 1RHJB 5SUHA 5F3ZA 2CQ3A 2V4JB 3CMES 1RBLA 1U26A 3IBCB 1J27A 1TTHB 2GHPA 3I5CA 2ASDA 1UZDA 2BUNA 4DPXA 4KR0B 1S6OA 1U2FA 2CPIA 4ZCIA 3IM9A 3H8YA 3PFEA 2DHSA 1FESA 4PG4A 1O51A 4EO8A 4NYOA 3BZQA 1NDLA 2E7XA 1Q4RA 3MM7B 5ETLA 3CEDA 1NHKL 1KRPA 3L95X 3BSOA 2WBMA 2VPWB 3NOCA 2GJIA 4P72A 2W2OP 5B0EA 2OPPA 4PKDB 1IM6A 4LBIA 1RAHB 1SBRA 5K8MA 2N3OA 1VJWA 2RB7A 2PE8A 2AJQA 3UQSA 5C25B 1URNA 2YNGB 4ZVUB 5CYJA 2HS0A 3NG8A 4RJVA 2IAJA 1X4FA 4M94A 4DL7A 2W01A 4U9RA 2DEJA 4P75A 3M7VA 3H98A 4KB7A 4UOCA 1N4LA 2DBBA 3MOZA 4A8WA 3K8WA 3OBIA 1PBUA 4USKA 2H4YB 4QIWD 3M30A 1RZMA 1B64A 3PW7A 4OYZA 3I31A 3PTWA 1OPIA 2BE2B 4O23A 2QSWA 5ADZA 2KDOA 4DR5J 1KN6A 2ZD1A 3AODA 1F5AA 4WU2A 1FTRA 4ZP6A 4B3TF 2OTJS 2VJVA 1U8SA 3ISND 4ZJLA 2FZGB 2MJNA 3IWLA 4C6AA 3V81B 1Y10A 1T05A 3DOLA 3DLEB 1MN9A 3PO4A 2HFUA 1WOPA 2PA8D 4CLSA 2X1GA 2UUTA 2W9AA 1U1QA 1EETB 4LBPA 4CM0A 2DGTA 1CPZA 2RKIB 4RUBA 1ZAWA 1N5SA 1X4BA 2NSCA 3ZTPA 1T9TA 2OPSB 2UXDJ 4JV0A 2BW7A 2R3VA 2V94A 3KYLA 1VI7A 4Y2MA 4A4JA 4LF1A 2XI2A 2MXYA 2ZHAA 3JS9A 2VODA 3QJJA 3CJQA 1HBNA 2C2RA 1IBLF 1E6VB 4KBIA 3PXGa 5BXIA 5JVGQ 1FJCA 3PZPA 4LFAJ 1RHRB 4GO5X 4CTAB 4WPAA 4URQU 1B0TA 3G87A 4M5DA 4IDKA 4U67Q 2LEAA 3UCGA 2KO1A 3R2CJ 5ETRA 3HVRA 1G6BA 6FDRA 4TU9A 1CLFA 3KLFA 2ADCA 2XYGB 4RNOA 3GFYA 1EQ0A 3BGRB 2G2OA 1YVFA 3JTNA 7AT1B 1XBWA 2IIHA 4DSIA 3OL8A 1RT1A 1SUQB 2P6TA 1UTAA 2MYFA 4I67A 4HLBA 1P9YA 2BANA 2VG6A 3KJNB 3ENWA 1Z2LA 4MH8A 3ENVA 1PO6A 4P74A 4BDPA 3DC2A 4JI1F 1HFEL 2RF2B 4L75A 2ASLA 2F9JA 3NGDA 3OR1A 2AU0A 1JLFA 2EKYA 1SJ3P 3IN5A 1PJ6A 4PQAA 3PW0A 3MEKA 4NLTA 1A6LA 3CD7A 1BQNB 2B9WA 3G8SA 2RUGA 4LF8F 1TK0A 1MN7A 3QT5A 4U96A 4C8NA 1F60B 1QLNA 5HQ8A 4J9RA 3SDEB 1VS3A 3J7ZT 2I1RA 1SCJB 2CNKB 1IM4A 7FDRA 2R8JA 2FC9A 4DDFA 3I4PA 3GIRA 5D4LA 1MLAA 3FQLA 2B5JB 3MEDB 3P45B 5A0YB 2MTLA 2AYEA 4IFVB 1K47A 2XS5A 2PI5A 4YHHF 2XCPA 2WBRA 4JOUA 4ZJOA 1M5VC 4LSLA 2I5JB 2RT3A 2RH3A 5E41A 2RQ4A 1T95A 1EKRA 2DR6A 3RB0A 1BMQB 4XK8C 3DDNA 3SCKE 1H7XA 2OUGA 4K4YA 5F8IA 1X4HA 3GTYX 2RRAA 5I3UA 4LF9F 2M52A 4ED0A 2MZTA 4KJIA 3GG1A 4QW9A 1UVJA 4CLPA 1S9EA 1RWWB 1XNRJ 2BM1A 2AJ0A 3DRXA 2QX0A 4LIRA 2LXIA 4UUWA 2P5VA 4CLTA 2VG5A 4TVAB 3MM6A 1N6QB 1TKXB 2DB1A 4OLOA 2MKCA 1VBYA 4AT1B 1VIOA 3FBEA 1LW0A 2DO4A 4LR8A 1H38A 2HZCA 2YWHA 2MEWA 2XS2A 2AV5A 3ET6B 4O0NA 4QWAA 4L74A 3W60A 3C6TA 1IKYB 2ZHOA 3FEXB 2DY9A 4O4GB 1JNRB 1RBOB 4P7TA 1S5ZA 2AX1A 2BJ7A 3AD9C 5DDQC 2APOA 3PIOQ 1XTZA 2V69A 4B3OA 1SV5A 1BY9A 3HVTA 2MLZA 2MY7A 3GFZA 2HVHA 2ZH3A 4DV2F 2RU3A 1TMMA 2QT7A 3IR5B 2AKWB 1RT2B 5C2GA 2CKWA 1DAXA 2HBQB 3AD8C 3M1VA 2AQ4A 4LRFA 1WC5A 2JL9A 4ZDNA 1KD1T 3VVUA 2BVZA 2DY1A 2XM3A 1DTTB 1H6KX 1Q78A 1TK8A 5LSLA 1ZPVA 1TU0B 2YKPA 1KC8T 3GIMA 3NOGA 3BQ1A 4N56A 4N41A 1RUSA 5IS2A 5AXKA 4LR9A 2VUGA 5DM6Q 4LF5F 5GADU 4X66F 3VWSA 2ATLA 2VQFJ 1U2CA 4LVNP 2GVDB 3D5MA 1CJKB 3OTOF 4JI5J 4RUAA 3W2VB 1X4CA 2MY8A 2ATCB 2HS4A 2ASYA 2YNFA 3QFHA 4NLGA 2WW4A 2EVZA 3LALA 4DI6A 3MAHA 3E01B 4JB8B 2MQNA 1HWIA 4ECXA 2IYIA 3CDAA 4LFCJ 4OX7A 1DHMA 4AQYJ 5HI7A 1NSAA 3CD0A 2W9BA 1U0HA 4L3KA 4URGA 2KZMA 2IPOB 2BJ3A 2QEXS 2DIUA 3QMQA 4ZK7M 5FDLB 1LW2B 3TX0A 3VAGA 4Y00A 2CQPA 2FHKA 5CYQA 3VALA 3NNHA 2F8HA 2Z58B 2CFXA 1GK8A 3UN2A 4ECUA 1AXQA 4F02A 1KNZA 1ZZFA 2YNIB 4PAAA 5HL7Q 4FXDA 4OYXA 3OQ2A 4P9SA 4JI7J 1PYTA 1YLXA 3MM8B 3CJKA 2YKMA 3R9LA 1J5OA 1FXLA 4FDFA 4X64J 1NDPA 1M0SA 1IWAA 3EICA 1EKSA 1S9GB 2BKOA 4I2PA 1RT4B 1R0CB 2UV8G 4DQSA 2YPZA 4F3QA 4JV1A 1NK0A 6FD1A 2QMWA 2HNYA 2DNHA 2F4VJ 2QA2A 1WF2A 1W25A 4LR7A 1JK9B 3M05A 3M9MB 3MUTP 4IR9A 1YBUA 2FY1A 2VC0A 4RX6A 1WEZA 2DH8A 5D4OA 3I32A 1NDCA 2N7YA 3UCZP 5DETA 5KFQA 3QZ8A 3TUPA 4TQSA 3GV8B 3BDEA 3FSIA 3T9NA 3R1LA 2LEPA 1CS4B 2AYGA 5D3GB 4TU8A 3TJ8A 3OTEA 3MECB 1KFDA 2IMWP 1WC0A 3TUIC 5CQGA 4KQZA 4J9QA 2Y1RI 1FKOA 4PQUA 2ZITA 3V4IA 2XLKA 1S72S 4KHPJ 1B7YB 3T6JA 3OSNA 4RU2A 2HRTA 1GXUA 2NSBA 4DPYA 3OFEA 3OUYA 3UWTA 2J9DE 3G82A 3TAQA 2RE1A 1VK3A 4DV7J 5LXRA 2C3YA 3IBWA 2VZ9A 2DIVA 2AIRB 1VRTB 2DR5A 4ED5A 2CYYA 3M2UA 4IKAA 3QLHA 3BJYA 1IVZA 3PG9A 2VPZB 3DLLQ 1X4EA 4NI2B 4YS2A 2XMMA 2MZRA 1WACA 4BWJA 1SL1A 2HWIA 1FA0A 2HVDA 1YJ7A 2CRLA 1AYEA 3I0RB 4OZ0A 2KG1A 5D15A 3VAJA 1HPZB 3ULHA 2KYZA 1SKWA 2GJ2A 5AXLA 2R8KA 3DM2B 4PWWA 4DV3F 4CYUB 1NHUA 3C16A 5LM7E 1EP4A 1HNVB 4R0JA 2VBWA 2ZVSA 1FJGJ 1X0FA 2IHR1 3L09A 3PIPQ 1HBMB 1T11A 2IM1A 4MJKA 3IO1A 3H90A 3NGUA 5CAAA 3QGHA 4QWEA 4FKYA 2XMJA 2QYGA 4ANEA 4DR4J 2LDYA 2HNZB 2KRRA 3JSMB 2EXUA 3KMQA 3PRDA 5ETTA 4IG3A 2HGNA 2SXLA 2E1CA 2BOAA 1TAUA 4C8OA 4HH1A 3HFZB 1N34J 4HTIA 5HMZA 1HYSB 4LMZA 1TZ0A 5BR8F 4KO0B 3MPYA 4JI0F 4K4WA 2CPXA 3OXLA 4O0IA 1RYSA 4M8LA 1NBEB 2HNDA 1NM2A 4WBFA 4FBUA 3ITHA 1JLCA 2V6AA 1YBAA 3LGHA 1C2PA 3PFOA 5L1KA 3I0SB 1IJFB 2HS3A 3GLJA 3TVKA 2AJ4A 1JJCB 5DM7Q 4QCLA 4IYQA 2OSRA 3MCOA 1WHVA 1YI2S 2ZDPA 2QMUB 2BZ2A 8AT1B 1ULRA 1TVRB 6AT1B 4HTJA 2Y0SD 4RNFA 1KVIA 3LP1B 4QOTA 3QT6A 2GVZA 3QBCA 2XBPA 1XMOJ 1DURA 1C1BB 2HK2A 3D2WA 3K59A 4RNMA 1SC3B 4IFYB 2HQCA 2FZKB 2ASJA 3M8RA 3R7SB 4C0HA 2BJEA 3AFGA 4N76A 5D0EA 1R0AA 4C3LA 5LXYA 3IGNA 4GC6A 4B9UA 5KFEA 1RK8A 3A13A 4OHWA 1I51B 3UPFA 4USJC 3GU0A 1A9NB 3V4MA 2OD6A 3DKDA 3W9JA 3IS9A 4ES2A 3CC4S 2CJ9A 2KM8C 4LSNB 3CD5A 3WIUA 2CQCA 5HSPA 3DLKB 3LWMA 1U0SA 1S97A 4FP9A 2HQFA 3QGIA 3R8YA 4HKQA 2JVRA 3I5AA 3GMGA 3TEHB 1NMEB 4CM2A 1S1VA 4IG0A 1GMWA 3HPOA 2BE7D 4NZ0A 5B0AA 1HR0F 3RBXA 5D78A 4RL1A 1FK9B 1S0NA 1MU2B 1QM9A 2F40A 1NAQA 4OHVA 4CH7A 2KN4A 1N48A 1S0VA 2E9ZA 3KHGA 5I42A 4DN9A 4EI2A 4HDHA 4C9DA 2DNKA 3MMBB 1BWVA 2DNZA 4HDGA 1VIXA 1TKZA 1F5BA 4OYWA 3PX0A 2JH3A 2RS2A 1UJ5A 3RUBL 3KK3A 2VFSA 5MAOA 2OPPB 3AA9A 3FVYA 2X1AA 2G4BA 3C3LA 2B7CB 4K4XA 2QL5B 4F25A 2XYPB 1XN9A 4DX7A 1K8AT 1S6PB 4ZOSA 1IBKF 2MZJA 4BC7A 4DUYF 1WNEA 2IDLA 5F8MA 4ZJQA 1R8HA 2IAJB 2C2KB 2FB0A 4O4RA 2PFFB 1WHWA 2HHVA 2JEIA 3IXQA 3SSSA 3AJ2A 2J9DA 1XIQA 5B09A 2M4MA 2P8IA 4G3IA 3OFFA 5C5JA 3PJWA 5KG3A 3ZZUA 3IRXA 3WC0A 2XO7A 2QA1A 3SMZA 4B3RJ 3DDKA 3FBBA 1F2GA 2OAUA 1VQOS 2AGPA 1Q16B 2CWXA 3TW0A 3A8KA 1DLOA 2EC0A 2CVEA 4DFMA 3TA2A 3TNVA 2FZCB 2ZD1B 2C3MA 5HVFA 4I2QA 4YB7A 3UW1A 2J5AA 1FXRA 2KVIA 5LT5A 4C4WA 2G0IA 5IZHA 2PMWA 1T05B 1LK5A 1U24A 3HSDA 4LFBJ 3DOLB 1FNXH 4NRUA 7FD1A 2G9OA 1UCNA 3DRSA 3HLUA 2A1BA 3LF0A 3KUHA 1Q7LB 2UXBF 3K5NA 1RHQB 3LP0A 4C48A 4YB1P 2AX0A 5DDPC 4GVBB 3MEEA 1M5HA 2Q6BA 2KT2A 1NHVA 2ZNYA 4FYVB 2QG9B 5LOQA 2ILZA 2N7CA 4Q5VA 2HQGA 4F8RA 3A8JA 4J9MA 4I0WA 1UW4A 2KXNB 2QFIA 4ZVSB 2VA2A 4ANDA 1BWEA 3IGVA 2JEGA 4JV2A 4BLGA 2P2CB 4A8KA 1HBNB 4YMEA 3MF5A 1M90T 2QRRA 2CQHA 5KFSA 1UVNA 1NB2A 3A4TA 3T1YF 2O3DA 2DGVA 1JLQB 1RISA 1QVGR 1P9QC 3F56A 3KUGA 4M5DB 1HNZF 4E2FB 3UE2A 5AE1A 5JXSA 3DYAB 4EYHB 1NK7A 1S10A 4PXBA 4PPDA 1Q5VA 1QY7A 1M5SA 2ROPA 2YQ1A 5H9FJ 1GAOA 3OSPA 1FWLA 1V5VA 1UEUA 5F9LA 2LQ8A 4DV1J 3DMJA 3KLFB 1KOHA 3QZ7A 3A12A 2FVSA 1HHTP 5F8HA 3GV7B 4X4OA 1N32F 1RT1B 2C2EA 4RU9A 1XEZA 3BBBA 3R2DJ 2FHJA 2R7WA 5IC6B 3UI3A 2C22A 4DS5A 4CO2A 1K9MT 3JTPA 2BANB 3CDWA 5CCLA 2LMIA 5KT7A 2VG6B 2V0NA 3M9NB 4XPCA 1RDRA 2V8HA 3I96A 2VDHA 4M1KA 3JXOA 3F0NA 2LQJA 1TFYA 1ZETA 4ELTA 4DSKA 2X7IA 5LMNF 3OR1B 3BREA 3CJ3A 1JLFB 4UOHA 2HWTA 1YWXA 5IC4B 3T5KA 3RRKA 4B9NA 1NPRA 3H5YA 4DSEA 2DJWA 3UN5A 4LQ9A 5A2QY 3M8YA 1I94J 1MG7A 4NXNF 2DISA 2WW8A 5KFMA 1VQKS 1T3NA 2VKZG 5HATA 3HHNB 2DVIA 4WYLA 4JI6F 4R25A 4M5NA 2CQDA 1QUPA 1FRMA 2FUG9 2UXCF 4TYBA 4FXWA 4IQXA 3EZUA 3MMAA 2LEBA 3HHDA 1S99A 4DV6F 1RHMB 2YTCA 4TYAA 1SJRA 2D3O1 4G6VB 2KI2A 1OSDA 1KLMA 3CJTA 3N6NA 2E5LJ 4OX9J 2BBEA 5C42A 1XNQJ 3CJ0A 4NYPA 2GMHA 4LSLB 5KFVA 4IH5A 3D3CJ 4DR3F 2QLXA 2FGCA 1YTYA 1QSYA 4HI2A 4P2FA 1RTHA 2M9KA 2GQ2A 4WZQA 1B0PA 3ONQA 1NLKL 4ZLNA 2F8EX 3KHLA 1RLCL 4YB5A 2M70A 2HMIA 4MMOA 5I3UB 2V50A 1F2HA 3ZZPA 2AD9A 2K8GA 4PZVA 1S9EB 3U1NA 4DQIA 2IM3A 1RWUA 4MKAA 5H9FK 5L1JA 4NMXA 1WEYA 2HLTA 1LKZA 4LBHA 2VG5B 3MM6B 1WF0A 5J2QA 3D6FB 4GO7X 1S4FA 3FQKA 1N5TA 1UL3A 1LW0B 2C42A 2MPUA 3AB4B 4DBQA 2ZC4A 2OPRA 1OO0B 4OYAA 3VGVA 1SH0A 4X65J 1KBRA 5D8HB 2P9GA 5IT4A 5HMXA 3KJFB 1XERA 3CF5Q 2D3OR 2J76E 2DNPA 3VCDA 1LV5A 1SJQA 3ZO7A 3C2PA 5KFTA 3MM5A 3MWBA 3N5BA 1SC4B 4K2XA 3GJTB 3SXLA 2MQQA 1Y3KA 1N8RT 5HJXA 2H5JB 4B3OB 1GMWD 1SV5B 1HD0A 1MROA 4PCQA 3RAQA 4I56A 4DL5A 2EBEA 1KFSA 1FD8A 5DZ7A 2XMAA 1FFWB 1M1KT 3M9OB 2Q3PA 3HT3A 1KEKA 3I55S 2IC3A 1BQXA 1IKXA 1SJFA 2MGZB 2F1FA 2KZZA 2CPZA 2W4PA 1R8CA 3HKZD 3IWNC 3M1VB 2PMHA 4WE1A 2CPDA 1HNXJ 3MTJA 5HK4A 5LL6d 1WKKA 3MR3A 3D28A 2JC1A 4EZ6A 4WK3A 2ZZTA 3R5GA 4P10A 4DWIA 3S8SA 2V68A 1H73A 2IY5B 3BYRA 3R97A 4F0MA 4NZ6A 2DR9A 2VG7A 5DZ6A 1HQUA 2ZM6J 3D3BJ 1PILA 4MKYA 3JQMA 4ZIVA 1SKRA 5H9EJ 1YJUA 4LRAA 1RT5A 4DR5F 1S4EA 3QSIA 3FCWA 3PX4A 3GG0A 3KMSA 5FLXY 2HQIA 2ZBRA 1WF1A 4EMDA 4B9MA 2YNFB 5CABA 3Q83A 3PM9A 2ZWPA 2E5JA 2NQPA 1ROFA 4A8YA 2ZH4A 1FCAA 3W5XA 5L46A 1XMQJ 2J9EA 4DV4J 1S9FA 2JOQA 3CUNA 2RVJA 3OJUA 2W9BB 1U0HB 1RTJB 2Q43A 5EDWA 4ZPAA 4HHUA 1RA6A 2KG0A 2J6UA 4WFAQ 2WSCC 1U1KA 2ERRA 1KSPA 5CYQB 5EX3A 3NNCA 1YRUA 2UXDF 3EUNA 2VD3A 2CZVC 2XYHB 3R5CA 5HO4A 2CZ4A 3ZZYA 1A7GE 2OMOA 5FD1A 3CJKB 2YKMB 3R6GB 2PO4A 4CO3A 3OVAA 3G2XA 3K17A 2QTWA 4I2PB 1TUGB 2UUAJ 2BJ9A 2VOPA 5EUHA 4O44A 2CADA 2EPIA 4PXDA 4USUA 3OV7A 4V1Ak 4LFAF 2HNYB 1V5IB 4U95A 2D69A 3L7UA 4WIIA 4EBCA 3ENQA 3GZ7A 3Q2TC 5KFUA 2H51B 3W64A 3W5YA 3HJVA 1PJ7A 1TELA 1WDDA 2DNNA 5ETKA 4YUDA 4DSFA 4WZMA 1Y4ZB 3MCMA 2R9LA 3IG1A 1VFJA 1ZA1B 4U6PA 3BSNA 3O3LA 3FEYB 1T8EA 2M2BA 4PQUB 4ZVPB 3V4IB 1FEEA 4EZ9A 2PDAA 3S6EA 4DFJA 2WRMA 5H9EK 4ZVRB 2CQBA 3S01A 4OI3A 1D9DA 2KXFA 2BV3A 2ZUGA 3G82B 1S1WB 1D9AA 4RW6A 2XLJA 2QJ3A 5LJ3Y 4ETZA 3K2YA 2I6WA 3M2UB 1JLGA 3C14A 4XO0A 1UPMB 5GVQA 4ZPCA 4R5PA 1WI8A 3EXCX 3QYYA 2FHJD 1HW9A 1SQGA 2ZZMA 1PC5A 3OXFA 5F9NA 1DJ0A 3TP2A 3UVJA 3DLHA 1ZM3A 2YKAA 3AJDA 2NXNA 3CC7S 1YJRA 2NREA 2V34A 4QWBA 2AYBA 5J1EA 5L9NA 2ACMA 2ZH6A 2UVVA 3C16B 2DCUB 1Y5IB 4N47A 4RW4A 2CWKA 2CJYB 1AROP 2UV8A 4PUOA 1CG2A 3UDVA 3HHLC 3DI6B 2MKKA 2NYHA 4F4YA 4J9KA 2HHQA 3ZZZA 3A3OB 3NY0A 5DG9A 5D0RA 2CQ4A 4B9SA 2H1YA 2CJAA 3HF5A 1VHFA 2BYCA 3D1HA 4HL9A 1P8GA 4FF1A 3LOUA 5HN0A 3ILJA 1FE0A 4G1IA 2AP6A 2RQKA 2J6TA 1HKAA 4Z7YA 4IG3B 1RTDB 4G1QA 1WOOA 2QE5A 1M5OC 4KAIA 2YQ0A 1TUWA 1XK8A 2K7KA 1VYAA 1X60A 2CJXB 1BGXT 2V8DA 1WD6A 1RAFB 1XNRF 1ZPWX 2FDNA 2QV6A 2XY7A 1SVDA 1HI1A 4FYXB 5T14A 1LFPA 1V9OA 3ISNC 3J81U 2J6SA 2LA4A 4UOFA 1JLCB 2ZOGA 4BWMA 2C1EB 3KJVB 3OR2B 3GFXA 1Y7PA 2KRBA 4XTTA 2QLBB 2L3MA 3BH6B 4NCGA 1M1HA 2KB2A 1VGYA 2JNJA 4Z2XA 5EX0A 2FJBB 2VL1A 3VAHA 4F50A 3PDNA 3PR4A 4ICLA 2BJ1A 2GHVC 1HWUA 2BJ8A 3GR1A 5KFFA 4J9VA 2CQ2A 4JI8J 2GVZB 2DKOB 2AZ1A 5BJRA 2IJNA 3HK2A 2V2QA 4NLWA 5IM0A 1RYRA 2IA0A 3EE3A 2Z30B 4CP5A 4P73A 2VFVA 3MOJB 3V2UC 1R0AB 1NJXA 4ZPBA 4IOBA 3HHLA 1VQPS 2FJAB 2FD2A 4NA2A 3PEHA 2AMCB 3QJLA 1CEZA 5L1LA 1P1TA 2BR0A 3AT1B 1FRJA 2VDIA 2UZAA 2AW0A 3IS9B 3VAMA 5A8RA 5LSOA 1NJYA 3V6JA 2MSTA 2B9YA 3HFVA 2ADBA 3Q8VA 3FZBA 1X4DA 2GAGC 2NPFA 4DR2J 2XSJA 1DRZA 5E2QA 1XC9A 3H2LA 1WKJA 3R5BA 1S1VB 4IG0B 3PNIA 3X1LB 1X5OA 3BO4A 1GTEA 1GEHA 5CZXA 5A76A 2DNQA 1I1GA 2XMUA 4KGMA 1FNMA 3N0VA 3F44A 3Q24A 4IO1A 4J7CA 5E5NA 4B3MJ 1QJHA 2DYAA 1RA7A 1UJ4A 2COLA 5I42B 1NNDA 5KG7A 2VQFF 2F9DA 4H4KA 3T1HJ 2QLFB 4MIBA 5KFYA 1FI4A 4J90A 4JI5F 1TKZB 4EEYA 1NSPA 1NH8A 4ZITA 4BBYA 2HHXA 3KK3B 3IMQJ 2BXJA 1J2VA 1FTCA 1YHQS 2HWHA 1HHSA 5E3AA 3MR2A 4EO6A 1T03A 2K2PA 3IAM9 3W2WA 3QRPA 4LFCF 3M32A 2J8SA 2FJXA 4AQYF 1IR2A 4B9VA 1PAUB 3BM7A 4HI1A 3Q23A 3E8OA 3SI8A 2M8DB 4CCHA 3P5TL 3KJQB 2WB1D 3QWUA 5FLXU 3IRXB 3HD1A 2PN6A 2QC3A 3K5OA 4TN2A 4HH0A 2B9EA 4JI7F 4K4VA 3TZWA 1U1RA 4X64F 2RAQA 3KHHA 1DLOB 3CCUS 5A8KA 5HROB 5KG0A 2YKNA 5K20B 4I2QB 1MWYA 1UWBA 3BGFA 1FERA 2FHOB 2F4VF 2Y8WA 5J2PA 4WTOB 4OHZA 2DXDA 1RKJA 3EZ5A 3B4DA 3P4UB 3NAHA 5GAGI 3NGSA 4ELUA 3WC2A 3DRSB 3JSBA 4EFAC 2E9TA 1H74A 2C3UA 2HPUA 1ZA2B 2E44A 3PYFA 1RT3A 4DF8A 3LP0B 1B99A 1NKEA 2RIJA 3QFWA 3MEEB 4USWA 3D7SB 4F0HA 2WZ1A 1L5UA 1AZSB 2DGXA 1VLYA 2HVIA 4QZVB 1YDLA 3O2IA 2Z57B 4DLEA 4ECQA 3LA0A 2VBYA 4ZLJA 3H20A 4KHPF 1H7WA 2VU5A 4X4PA 3NGTA 3GP9A 1SL2A 4ILMA 4ZVEA 3W66A 1HD1A 4ATNA 1TP7A 4OHYA 4DV7F 3BSAA 3HD2A 2ZDOA 1OS5A 4EGLA 1D1UA 2HFSA 2HG4A 3VVTA 5C2CA 1F3VA 3DRPA 3KK2A 1QE1A 4Q8EA 2VFTA 3VGSA 4LF2A 2CDRB 2MKIA 1JXVA 3RRGA 1PJ5A 3WBZA 4NEYA 4DV0J 1ZM2A 2HBRB 4DCJB 2ZEJA 2G13A 5CH7B 2GQQA 1VCTA 2R7XA 3DMJB 2FC8A 4U7UK 3SFGA 4I4BA 4P2XA 3KDNA 1VR6A 1NZ8A 3NS6A 1FD2A 2XI3A 3GV5B 1R31A 5C7PA 1FDDA 4ZCLA 5KFZA 2M0GB 4OI6A 4ZVGA 2Z2LA 3HSJA 1FJGF 3HVAA 2WVCA 3JSYA 4RLEA 3PW4A 1FWPA 4KYZA 2JSXA 5I4MA 2VC1A 2J0XA 5B0GA 1L3KA 2CNOB 3TA1A 2WOMA 1NB7A 4YR3A 1CJTA 5M2PA 2DRDA 3NS7B 2LQBA 4ECSA 2FPHX 4OZJA 2D3UA 2GMJA 4TLQA 3D6MB 1F9FA 2CIMA 1CQNA 2BKPA 3AB2B 4DR4F 2R7OA 4P6QA 4C3MA 5KFBA 4KFBA 1Y00A 4C8YA 4OZ3A 2XGPA 5KFRA 3R1HA 1U1OA 5K8OA 4MIWA 1N34F 3CWJA 3FNNA 3NKYA 1N54B 1RWMB 4NLRA 3ADAC 2R7TA 2H3EB 4O3NA 1RU1A 2CQ1A 1N5VA 1UEKA 1VOMA 2NUHA 3OJSA 1REVA 2D1CA 3BBCA 1O5JA 4F26A 2G0JA 1WG4A 4S0MA 2OMLA 3DGPA 3GJRB 4RW8A 3CB4A 4UTGA 2CQIA 3MMAB 4DV2J 5KT6A 2XHWA 1FVSA 4W92B 4NL5A 3MAAA 4CLFA 5J2NA 4YQWA 5KG4A 2CNNB 2LQ5A 1C4AA 1WSRA 3WX4A 1U09A 4CLWA 3G71S 5KFPA 4I7FA 1XMOF 4JI3J 4KPYA 5C42B 3HP6A 2YNGA 2ZE2A 3MEGB 1ZAVA 1MWZA 1RTHB 5G0RB 3QT7A 1JXEA 2XZWA 2W7PA 3L9ZA 2HMIB 1EHWA 2WSFC 3M6XA 3M8PA 3DOMB 2RD5C 4F67A 1OY6A 3G4SS 3EPGA 2CG4A 3FBFA 2GQCA 5HVGA 1RAAB 5HQMA 2U2FA 4RPFA 3BH7B 2BX6A 2JLEA 4FS2A 5J2QB 3HHLD 3US5A 3V6DA 3BB5A 1S59A 4YN3B 1VQSA 4H4MA 3V81A 4N8NA 2ZJPQ 3VGTA 1XR5A 2OPRB 4PYDA 5IT9Y 1NKBA 4M5JA 3DHXA 4DQRA 4ECVA 4C11A 4DSLA 2V8PA 4M5LA 5E3CA 2RDIA 3D54A 2IM0A 2KT5A 4R8UB 2HRYA 2MB0B 1YQHA 1EETA 2JFKA 1WC4A 1RJJA 4OZ5A 4KV8A 2E5GA 3FUYA 2VH7A 3MM5B 3TQEA 4C3KA 3POTA 1LWEA 1S48A 4B3SJ 1O8BA 1MROB 1X9MA 2R7UA 4TLRA 2A6OA 1U2RA 3BGLA 3GSDA 1VBXA 3IR7B 5MLCV 4U8VA 3IWXA 3GIKA 2HIQA 1VJQA 3K5MA 1RADB 2XGQA 2KHCA 1SQEA 3CJ8A 1EQMA 3TYTA 4WE1B 2Y3YA 4G65A 4GVLA 2F7VA 1AUDA 2VQEJ 5HVHA 3CJ5A 1GXLA 1PC4A 5KFKA 2DHAA 2N4DA 1MMDA 5ETVA 1RTZA 3DLGA 2IRYA 1T9XA 4F2SA 1HQUB 4JI4J 1GH8A 3M4XA 2R7QA 4AL5A 4C2MA 2UUWA 2MHNA 1IXKA 3HX9A 4B3RF 1ZM9A 3MD1A 3LANA 4OZLA 2XQCA 1NDKA 4WWSA 5KFGA 2M3DA 2PSZA 2ZKUA 1UVMA 2XEXA 5KT2A 2DNOA 4P2MA 1YG0A 2KL8A 3UCUP 4DOZA 4CH1A 2R8IA 1G7CB 4LSZB 4ZA1A 2F5GA 2CPFA 1WTFA 3CJSA 3TAMA 5LSRA 1H72C 3W62A 4ZPDA 2OI2A 3ILLA 3DLJA 4LFBF 4F4AA 3UDEA 4F4KA 1PG5B 1Z4UA 1BHNA 1N36J 4DUTA 3IFEA 3MPDA 2CQ0A 2W1BA 4UQTA 3WQPA 2YKOA 3GE9A 3UR3C 2IVFB 4X4SA 3SCIE 2R2RA 2W2QP 4Y65A 2AJ2A 1KONA 2HRUA 4BCAA 1IQZA 4GC7A 3LTOA 2H9ZA 2KVQE 2WK4A 5F0UA 2CDQA 1YZ6A 2CJKA 1AT1B 3EDRB 1WORA 2AJFE 1BD6A 1K1SA 3SCLE 4O44B 4WYWA 2ACYA 2XHCA 3PO5A 2B5JA 2CPYA 3MEDA 2G0CA 1D8ZA 2Q6CA 3W61A 1C1CA 4GKJJ 1NK4A 4Q43A 1JLEB 3I9V9 1RU2A 1NPKA 4FYYB 3NBPA 2W2NP 4J9SA 1GQEA 2AGOA 4E0DA 4Y2IA 1L3TA 4I6AA 5EWGA 2OH2A 3CXCR 2L9NA 1SI9A 4ED8A 2HKEA 4WIQA 1NJZA 1V6HA 1CJVA 4WP9A 4PEOA 4FS1A 4DV1F 2KH9A 4LRDA 4ZP7A 1Q82T 2MQPA 2V9WA 1UETA 3MFIA 2Q1LA 4JBCA 3ICLA 3BKUA 3L4BC 2JJ4D 2LQ9A 2JX2A 2ZBIA 2F3JA 2FJVA 1X0PA 3TR5A 1MW7A 1N6QA 3NNAA 1FDBA 4K4UA 2XY6A 4OX8A 3IC1A 1N56A 4DUZJ 3DLBA 2IJRA 4RW6B 4CLKA 3KHRA 2GIRA 1X9SA 1RTIB 3SZ2A 2B9XA 1JLGB 1NSKL 4MKBA 3LWLA 4R5PB 1JXLA 5IWAJ 3A8EA 1EIYB 4USTA 4OIXA 4AXIA 4X4UA 4DSJA 2Z0GA 4A8SA 1TAQA 1QAYA 2QLWA 3UVJB 3J7YI 1TV6A 5DLFA 3N28A 5JMNA 1F9EB 3CMAS 5ETOA 1I94F 4NRTA 1AUSL 4YDDB 1P6TA 3M2VB 3GCWP 5J1EB 3BF4A 2LXUA 1GT8A 4OYIA 1E6YA 3MCSA 2FVQA 2FJEB 4RW4B 4WXWA 4PUOB 2D9PA 2HHHJ 2QL9B 3AH6A 2UUCJ 2YX1A 1VQYA 5DS7A 2PFDA 1FO1A 2C2OB 1BC6A 2X1FA 3U02A 4NASA 3VAIA 2A6MA 1MWQA 2IBKA 2POKA 1UWAA 4DG1A 4OYMA 2MLYA 3PKMA 4OX9F 2E5LF 1KQFB 2DNLA 4FZVA 1XNQF 5K8PA 3NCQA 1VQ6S 3PRVA 3LH2S 2Y9HA 1JKHA 1P27B 5K5MA 4I69A 3KTQA 4G1QB 5GADI 2HLUA 5F3TA 2LU2A 1ZM4A 3G9CA 3D6HB 4KY3A 3WZ0A 4JYAJ 3J7YU 4LRCA 1UJ6A 3CMQA 2LECA 1WUUA 3NS5A 4OZ2A 4YB6A 3B54A 1M5KC 1FF2A 3CIMA 4J9OA 4M5MA 2YWWA 4DX5A 4MYUA 4O3PA 4ZN3A 2GVDA 4IH6A 4DPUA 3ILIA 4XIUA 3SIPB 1S0OA 2ZJQQ 1KLNA 5KOWA 1T0TV 3UD5A 2EFQA 5HBMB 2AHOB 4RKUC 3RB3A 1RT6A 2FLNA 4ICLB 3HULA 3ETOA 3E01A 4I6YA 5E0OA 5M2UA 3R7NB 2OIHA 2FLLA 3TZYA 2WVBA 4X65F 1FEHA 1V3RA 1GMUA 5AE3A 2E66A 1JJ4A 2X3DA 3O5TB 2EWHA 3PJ9A 4HT7A 1YJ9S 4L76A 3CDEA 3KK1A 1RWPB 2W2PP 1WHXA 5FDLA 2GNKA 2CQGA 3P96A 3WX8A 3HHLB 1YBTA 4ZMMA 3CCQS 1CVJA 2U1AA 4K5RA 5T7LA 5AE2A 2BE9B 1AFIA 3MI7X 4ZKAA 3HKWA 1UA1A 5ETQA 2KFYA 3UFCX 3CW2C 5IT9U 1QAJA 4CLLA 1SC6A 3L7OA 1RT4A 1BXNA 5A8RB 1VK8A 4RBVA 1HNXF 1IR0A 1PGZA 3GQCA 3KWMA 4Y2CA 4NXMJ 3AXMA 3TZZA 2XSJB 4RBUA 1SQFA 5J1PA 2QIFA 3D0HE 3ZFVA 1GNKA 2M8HA 4LIWA 4DX6A 1C4CA 2DHHA 4WFNQ 2E29A 4RNNA 3OLBA 4I64A 1GX5A 2AEJA 4YFUA 1X31C 2AGQA 3H5XA 4CRJA 3J80U 3NLCA 3IP0A 1NH7A 5L38A 2W25A 3QRRA 1RB0A 1T9YA 4Y34A 5JUMA 3MPUB 4ECYA 1REGX 3MECA 3C6UB 4YP3A 4GMKA 4X2BA 3UNGC 2CZ9A 3GB0A 1ZS6A 2XMKA 1R6YA 4DL0C 1AA1B 2QGFB 2P9CA 3D4JA 3FFIA 3D66A 4GKKJ 3I87A 2BQ3A 4AUKA 3K58A 2A2DA 1TQLA 5KFJA 1H2UX 1VQ8S 2FVPA 2KU7A 3HJFA 3A3PB 5B0FA 2BEFA 1T03B 1XMQF 3W2WB 4DV4F 1Q0NA 3EDQB 4UQGA 3M32B 1VC0A 1Y0HA 3CTRA 2XWXA 5B08A 2O67A 1X5PA 2RRBA 1XQIA 2E1MC 2W7AA 2RILA 4QR1A 3V6HA 4NI2A 3MFHA 2XULA 2NZ4A 3NGRA 2W9CB 3CT9A 1TL3A 3AOBA 3JQJA 1FRLA 1BLUA 1JIHA 4KGZB 2R7RA 3H7HB 3NGKA 5I3PA 4DL4A 3DM2A 2WVDA 3CCSS 1HW8A 1L3SA 5A8KB 3HHKA 1N5YA 2UUAF 1HNVA 3TX8A 2IM2A 3T5JA 3D1OA 1S1TB 3K8VA 1UWBB 2E1PA 4CQ1A 3CPWR 4WF9Q 3CCWA 4ED2A 4OV6A 4Y3CA 1FXDA 4IRKA 3Q8QB 1FRHA 1RT7A 5J2PB 1HIYA 1YGYA 1IN0A 2X51A 2F4FA 4KH1B 3M2RB 3UR0A 5F0WA 4QWDA 1FRIA 3Q22A 4ES3A 4YDXA 3I82A 4TQRA 4AD6A 1RT3B 1QUVA 2HNZA 5CD4A 4JUZA 4ED3A 1DY3A 3QIPA 2K1RA 1CC7A 3ZNJ1 5AJ3J 5BYQA 1MMNA 4DPTA 2LXFA 3ZTRA 3Q86A 4ANCA 3GFHA 4OMFG 4KSEB 1H3DA 3CCTA 3QAEA 3P3DA 2KKHA 3BSCA 5LMUJ 5FIIA 4LF7J 2DHGA 1XWLA 2UU9J 3TOQA 2PC6A 3I0SA 4OHXA 3T19A 3NXZA 3QT8A 3D6TB 3C15A 1VQ7S 4H54A 5I3QA 1CQMA 4QU7A 4A8QA 4QR0A 1Z2ZA 3H5UA 4USMA 1RAJA 4ITSA 4Q0BB 2DITA 1OWXA 3PYEA 5E3PA 1QD1A 1RQ0A 2PI4A 2DT9A 2EW9A 3DRPB 1QE1B 2GO8A 3LP1A 3PX6A 5CYMA 2I8EA 2AT1B 3DXBA 4PR6A 3QRQA 3W8GA 1UA0A 3SBMA 1Q8IA 1K73T 1RCOB 1N33J 5KFNA 5KT4A 1CBKA 3HT0A 4J91A 3CCMS 1S76D 1Q8KA 1TL4A 3RAXA 3MM9A 3LGMA 3FCHA 2XLIA 4ZP9A 3D1QA 3M8QA 3ENAA 1B4SA 4NA1A 1O0PA 4F2RA 4YR0A 3KLHA 4UY85 2VASA 1OY8A 2PA3A 8RUCA 1S7HA 2WOMB 1CJTB 3CJ4A 1XJWB 3E51A 1C0TA 9ATCB 1HHQA 1ZH5A 2ZVIA 1DZ5A 1R27B 5KFIA 5K8NA 4IR1A 2W4CA 1IBCB 3B4MA 4QU6A 3CCES 2YH0A 4KFBB 4X4TA 4ELVA 1WELA 5J2MB 4P52A 3LP2A 3FEZA 3GONA 2MLXA 3AD7C 3G6XA 4RW9A 1X9WA 3PEJA 1T3OA 4ED6A 1FK9A 3HM9A 1MU2A 1YSJA 2GV1A 3RB4A 3KG0A 1RI7A 1REVB 4MK7A 3SEOA 3VZHA 1S6QA 5D0GA 2MSSA 1R6VA 1KQGB 3Q89A 3MMBA 3DGPB 1X5SA 4ECZA 2AF6A 4RW8B 4K4TA 1S6UA 4X4VA 3BPDA 3MAAB 4C8ZA 5J2NB 4MAKA 2NLWA 1D9FA 4FNHA 1PIEA 1YX2A 2XY5A 5KG5A 1YJTA 4JI8F 1C0UA 1S6PA 2P6SA 4I7FB 4ILLA 3BS9A 2ZE2B 3JAMY 2LLZA 2JZ5A 3RW6A 4OL8A 3J7A1 2IFXA 5DO2A 3PHEA 1EJ7L 4QPXA 4ENOA 1OQ6A 1IQTA 2DNRA 1U6ZA 3BPSP 2DH9A 3M8PB 2RMLA 4LF4J 4OX6A 2C2NA 2DD8S 4M5IA 2GFFA 1VQ4S 4JI2J 3M8SA 1FJ7A 4X4NA 3FMBA 4FYDA 3EM1A 1W2BR 3GYXB 4PPZA 4K0KJ 5IXUA 2GC8A 4L3NA 2X1BA 1T02A 2HGLA 5CD4H 3AOCA 3V6DB 1S7IA 4XDCA 2PT0A 1WDTA 4H4MB 4DCOB 4DR2F 1HNWJ 4Y28C 5HLFA 1DFDA 2J0WA 5DG7A 2FVRA 1NKCA 2M7SA 4C11B 3PJXA 4N7TA 5C24A 1NK5A 3QQCD 3TRGA 3TAPA 2IVYA 4FF4A 2MKJA 1NUEA 4WCEQ 5F8LA 4UUXA 1FKPA 2D41A 4K8RA 3M30B 4GVBA 4B3MF 3CIZA 4KV8B 1TK5A 3LAMA 2QO3A 2KXHA 3OTBA 4H4OA 2H5EA 1FT8A 2YWKA 3POTB 1LWEB 3AOAA 2GGPA 1HMVA 1U6BA 3T1HF 4F4WA 3KLVA 3NP5A 3CC2S 3TI0A 1HA1A 2ALYB 2Z4PA 3Q0AA 4J9PA 3GSIA 2UVRA 1JNZB 2K3IA 4P71A 2XZDB 2Y1JA 4F04B 1IJEB 3VTIA 2I9SA 2CAJA 2LP4A 4UF4A 1N0VC 1JLQA 1RXOB 5G4DA 1Y5NB 2KTQA 3MMJA 1J5EJ 3T5HA 5AXMA 3DLGB 5AXNA 2UUBJ 3DYAA 4ZPVR 4BC9A 1TKTA 3R5AA 3DCAA 1ICEB 4AL6A 1I6JA 1LWFA 1LWXA 2OFGX 2XS7A 1R43A 3VAKA 5EWEA 4MT1A 3W63A 3BKFA 2DNYA 1F0XA 2ZZNA 4Y0FA 4CO0A 1U25A 2VA3A 5ITHA 1HWJA 3TAMB 2H4WB 1T7PA 1SC1B 3B82A 3HI9A 3Q2SC 4KIAA 1KDNA 4UOGA 1Q95G 1KR4A 2WVFA 5L8RC 1DTQA 4JV5J 5AT1B 3DOKA 4IDKB 2HZVA 1HBOA 2FQQB 2BDPA 1N5QA 2K06A 5KFDA 4ZCMA 3Q8SB 3OVSA 4DF4A 3LUYA 4DPWA 3W3SA 2ZH7A 4CI0B 1JX4A 3BGUA 4CT9A 1U1NA 3CCVS 4BS2A 1IKWA 1I3OB 4OJ1A 3MR6A 2C2MB 4NYZA 2UVUA 3UD4P 1RCXB 4QPTA 3LAKA 2LKZA 4FXVA 3KDOA 2OEKA 4QIEA 3VHQA 4OI0A 3IM8A 1SL0A 2OKQA 1BUXA 5THWA 4UZBA 4I68A 1RWKB 1OY9A 2JEFA 4J5OA 3GJQB 4NOHA 1LNQA 3MGJA 1C1CB 3P8BB 2BM0A 4J9NA 1IR1A 3L7PA 3NBPB 5KG2A 1G1XA 2OGUA 2KT3A 2EEYA 1NK9A 5KAKA 2J0QD 5ETSA 4CDIA 3GYNA 4DR6J 3MR7A 3EYZA 2NXUA 4DU7A 1TKDA 3MD3A 4DV0F 3CCZA 1VQLS 3P49B 1IKVA 2XMTA 1U48A 4DCPB 3TUJC 3BDPA 2DPIA 5IQ6A 2VHGA 2ABYA 3H59A 1CJVB 4RZRA 1O6XA 3VV2B 3JYTA 2DGUA 4QYZJ 1HL6A 3SSRA 4O3OA 2NZCA 3D67A 4DU8A 4DLGA 2DRAA 2V4QA 3GIJA 2VONA 4E98A 3AXKA 2MJUA 1Q8BA 1Q8LA 2HAIA 4KE5A 3CJRA 4ZLPA 2H5IB 1BQMA 3Q8PB 3J81Y 5HANA 3OLAA 4K50A 2HEKA 5EN1A 4C8KA 4IOCQ 1IWGA 1QTMA 2OP5A 4DL6A 3MDFA 4LF6J 4G1PA 1IBMJ 4DR1J 4HHJA 1VC5A 1SB6A 4KGKA 1TL5A 4LUBA 4F4XA 5CHCB 1TV6B 2E5IA 3U27A 3RB6A 3PYGA 2P9EA 2YX7A 2VICA 3O1LA 4M5HA 4JP8A 2HGMA 1ZAXA 4Q2LA 4UT4A 5GMDA 3TUZC 1FE4A 1E6YB 2HYIB 1YRTA 1CULA 3QGGA 3KG1A 1SH2A 2VV5A 2ALZA 2NR0A 2KFNA 3W9HA 3O8WA 4QR2A 3QNWB 4DJBA 3MUMP 1FRXA 1SPBP 3U7JA 4CO5A 3PVXA 1VBZA 4OJGA 2R2UA 5J1NA 4WFBQ 2MGZA 2QMXA 3EVOA 3K7RA 3O6QA 4O3QA 2GMLA 4DL2A 2V5HG 4DG1B 1LXJA 3BV8A 3EPIA 3IA0A 1UFKA 4JI3F 1EZZB 2K7JA 3RGIA 3C46A 3BQ2A 1JKHB 3OTDA 2CJQA 1TMJA 3C6TB 2V2VA 3OPKA 2RS8A 4QQBA 1RHUB 3MPWA 4EBEA 1OJ4A 3MCNA 2MKHA 2KFZA 5H1SV 1FX2A 1H2TZ 2DGQA 4RW7A 3K5PA 2N3LA 2V8GA 3I5BA 3TWZA 1KQSR 1VDHA 3N01A 5K9FA 2BQUA 3V5RA 2G1HA 1YKWA 1HI0P 3HVTB 5D77A 3OW2R 3M6UA 3G6ES 3RJMB 2EFPA 4ZPWR 4WFYA 1NRKA 2RQCA 2EG1A 3BO2A 2OFHX 3JAMU 1SIWB 1QVFR 4QYZK 3QIDA 1RAIB 2UP1A 1YJVA 2Y8YA 4F3OA 4NCAA 2VIHA 1JJHA 2EG2A 3G8TA 5U47A 3NMAA 1UW9A 3WDOA 1RT6B 3UNYA 2IVMA 2QZ8A 2IBOA 1TR0A 3OL6A 3RYLA 3AHPA 1JWWA 1RTJA 2IRXA 1UVIA 4WKRA 3EGNA 3SSQA 4USIA 3KK1B 5GMEA 3RR7A 2J8AA 4PABA 4DZ6A 5B0DA 5T7LB 1UVLA 4B3SF 4YY3J 3L3CA 2Z2MA 3HZEA 5DGAA 2LYVA 2HFZA 5IV3A 1B0VA 3W65A 4QIGA 3NRBA 2VBZA 5KFLA 5DJBA 1PAEX 4KRWA 1JLAA 3VZIA 2JC0A 5ETMA 2VQEF 1Y9OA 2VBXA 2Z2YB 1KVJA 2B4VA 3UDLA 2FYXA 4ID8A 2HIYA 1TL1A 1IUJA 4OV1A 2ZH1A 4ED4A 1HNIA 4V19J 4JI4F 1NO8A 2RUSA 2AJ1A 4PRFA 4ZHRA 1AW0A 5HAOA 1FKAF 3NEKA 3H0PA 2HFNA 4ID5A 1DQ8A 2JHEA 3RG6A 4K7QA 3FRYA 3CCLS 1J5OB 1JQGA 4PG5A 1WSVA 3MPVA 1M5PC 4OYPA 1KHVA 3KLIA 1X4GA 3FFIB 1RAEB 5DLGA 1FNOA 4DV5J 5KFHA 1RWOB 2R7VA 4LRBA 4HVZA 2ZBQA 5HMWA 5KFWA 5EGYA 3WIVA 2HHTA 4C97A 2I38A 1S1WA 3CCRS 4USHA 1U6FA 4C98A 1JJ2R 1N36F 4ZVFA 3W8PA 3KUEA 2YH1A 1GMVA 9RUBA 2EI5A 5KFXA 4B9TA 1WG1A 2DHXA 3H25A 1Y3JA 3N6MA 3J7Z5 3BR9A 4ER8A 1NPPA 2WSEC 1R8BA 4CO4A 1UKUA 2Z56B 1OYEA 1KQKA 1TL3B 5BYRA 3BR8A 4TU7A 1FKOB 3DRRA 4ZS6A 4PWUA 4TY8A 4L73A 5F41A 3CSKA 1RGVA 5DQIA 2L41A 1N5YB 3TA0A 4ZVOB 3OUYB 4OFZA 1SKSA 3DI6A 1HQEA 4OI4A 4O3RA 3T5LA 2ZJRQ 4KPCA 2LFVA 1ZTTA 1D0EA 1FFSB 5DDOC 3B78A 1RT7B 2EFGA 4GKJF 3C8YA 4CO1A 3QLHB 3KLGA 3GILA 4FVMA 1YK9A 3H2VE 5HMYA 3Q8YA 4PXEA 2PMZD 4CT8A 1UMJA 3JTOA 4NX9A 1K44A 4NA3A 1CC8A 3FBCA 1OQ3A 2RSQA 5DGBA 2WVEA 3LPEA 3QO9A 1YRXA 1Y11A 1RTDA 1T9UA 2AWZA 2LVWA 3QIPB 4DS4A 2K1RB 4CLUA 3THVA 1R8AA 4ETXA 4X62J 1FWKA 3HDSA 1SJ4P 1EP4B 2QL7B 2NS1B 1UZHA 1WC1A 1N88A 2MQMA 2YQ3A 4F3MA 4RUCA 4DXLA 4FF2A 2ZFHA 1VBKA 4KGXB 2QSFA 4PG7A 3KJVA 3OR2A 2GW8A 2NUUG 4M5GA 1KTVA 4KT0C 2B4PA 4DR7J 2H48B 3C15B 2RU9A 2XNRA 3RBZA 4DUZF 2A2CA 2EK6A 2GX8A 5E3RA 3T41A 4Q8FA 2CPEA 4L6V3 4A47A 4ED1A 1CSJA 4Q7AA 4TNOA 1GTHA 5CYMB 5IWAF 1AFJA 3VAFA 1X5TA 3RBEA 4KKOA 2GJFA 2O66A 4ECWA 4RBTA 5KG1A 1ZBTA 2B51A 3GJSB 2W24A 2C3OA 1JB0C 1PCAA 3IR6B 4OI1A 2HNDB 2FGOA 4A8FA 3ITHB 2VPYB 3MM9B 1HI8A 1HWLA 2YWGA 4EWTA 2QA4S 2HHHF 3M8QB 2UUCF 2ZH5A 3KLHB 2MZSA 2A3JA 1KWMA 4H4KC 4RWWA 3R7BB 3N79A 5HP1A 1C0TB 1ZOTA 3T6BA 2WAQD 2DR7A 3I9ZA 3FSYA 4K5SA 4F0KA 5D0HA 3TO8A 2ZHBA 4E8UA 2F65A 3RW7A 3M8ZA 3LP2B 2A0FB 4IRDA 1NZAA 2ZBPA 1RAOA 4PWDA 4NEZA 2YXLA 3A8IA 4RW9B 4JYAF 3H2UB 2DR8A 3PCOB 2E7VA 4CH0S 1OSCA 4LT6A 2XMWA 2AEMA 4ERDA 2BRKA 1TL7A 2A10A 1YZ7A 1S6QB 3DHWC 1PBAA 2XC9A 5K14A 3EMTA 1EB0A 2Y1LB 4B3TJ 2D74B 1DQ9A 4FVCA 1SJ1A 1N0UA 4N5SA 4PYAA 3FK4A 4MFBA 2HW3A 3BBFA 2E7WA 2OSQA 2RHQB 1VRUA 4ES1A 1C0UB 1UFWA 4EU0A 2BRLA 1YJWS 2BABA 3P6YC 3Q8UA 1X4AA 2MKSA 3MHYA 1F6TA 4MK8A 3WHIA 3KLEA 2YNHA 2WHOA 4LJMA 2GIFA 4AFFA 2ZH8A 1VC6A 3J81j 1QAXA 1OIAA 1RWNB 3QWPA 2RNEA 3FGVA 2VFRA 3G6YA 3CE8A 2WB4A 2QYCA 4WK1A 5D6GA 4KTQA 3DN9A 3DU6A 2Q66A 2MKYA 1S57A 4FPRA 1KVKA 4OI2A 1QTNB 4OJHA 1IBLJ 1W2IA 5HJYA 5HROA 2E1RA 2GHWA 2HQDA 2HAFA 2MZ1A 4ZIWA 1PYSB 2CG8A
chains in the Genus database with same CATH topology
2WTFA 2HHSA 4Y34A 2J9EA 4JV0A 4NXMF 5JUMA 1S9FA 4HT5A 4ECYA 5HLFB 2V94A 3MECA 3KYLA 3C6UB 1VI7A 4Y2MA 2JOQA 4A4JA 3CUNA 2RVJA 4YP3A 4GMKA 2XI2A 3OJUA 4X2BA 3UNGC 2MXYA 4CIOA 2ZHAA 2V9KA 5C24B 2W9BB 3GB0A 2VODA 3QJJA 1RTJB 2Q43A 5EDWA 2XMKA 1HBNA 4ZPAA 1R6YA 2C2RA 2D9OA 4FNIA 1RA6A 4DL0C 2KG0A 2P9CA 3FFIA 1NJIT 1IBLF 2J6UA 4WFZA 1E6VB 4KBIA 3PXGa 3BQ0A 3I87A 2BQ3A 4WFAQ 2WSCC 1U1KA 4AUKA 1FKPB 5JVGQ 2ERRA 1FJCA 1KSPA 5DQGA 3K58A 4QYRA 2A2DA 5CYQB 1TQLA 3ZZ0A 5KFJA 3PZPA 5EX3A 3NNCA 1H2UX 1VQ8S 2FVPA 1YRUA 2KU7A 3G96A 2UXDF 2EFNA 3EUNA 3HJFA 4GO5X 2VD3A 5B0FA 4CTAB 1T03B 1XMQF 2CZVC 4H4OB 3R5CA 4URQU 5HO4A 2ROEA 3W2WB 1B0TA 2CZ4A 4DV4F 3ZZYA 3MMCA 3ZZRA 3Q8RB 4UQGA 1A7GE 2OMOA 3M32B 5FD1A 1VC0A 1Y0HA 4M5DA 3CTRA 4U7CA 2J7WA 2XWXA 5B08A 2ROGA 4IDKA 3CJKB 2O67A 1X5PA 2RRBA 2LEAA 3UCGA 4U67Q 2YKMB 2KO1A 2JRSA 1L3UA 2GGPB 2E1MC 1HMVB 2PO4A 2W7AA 4CO3A 3OVAA 3K0JA 2RILA 4QR1A 1Q81T 3V6HA 2B4OA 4I2PB 3MFHA 4GKKF 5L1IA 1HBUA 3HVRA 4EBDA 2VOPA 3T3FA 5EUHA 4O44A 2OPQA 3OVBA 1G6BA 6FDRA 4TU9A 4QBUA 2EPIA 4PXDA 2XULA 4MTPA 3OV7A 2NZ4A 2F8MA 4LFAF 2HNYB 2W9CB 1CLFA 3CT9A 3D0IE 1TL3A 4WIIA 4EBCA 4FBTA 3ENQA 3KFWX 5A8WA 3GZ7A 1FRLA 1BLUA 2B6AA 3KLFA 1JIHA 2ADCA 2R7RA 5M2RA 3Q2TC 5KFUA 2N4CA 3GFYA 4RNOA 4NMLA 3BGRB 3FJ2A 1YVFA 4MIAA 3JTNA 3NGKA 5I3PA 4EYIB 4DL4A 3DM2A 2A18A 1XBWA 2L9DA 3CCSS 4DSIA 3OL8A 1HW8A 1RT1A 1L3SA 5A8KB 3HHKA 1N5YA 2UUAF 3OXGA 1SUQB 2P6TA 1HNVA 2W4DA 4YUDA 2DNNA 3TX8A 1LOUA 4NLDA 2IM2A 2MYFA 3T5JA 4I67A 3D1OA 4HLBA 4DSFA 1S1TB 1TKTB 3K8VA 2BANA 1UWBB 4WZMA 4ZCKA 4CQ1A 1Y4ZB 3CPWR 4WF9Q 3CCWA 4ED2A 2VG6A 4Y3CA 3T1AA 2R9LA 1FXDA 3ENWA 4IRKA 3Q8QB 2C2DA 1Z2LA 4MH8A 1FRHA 1RT7A 3ENVA 1PO6A 3IG1A 1LWFB 5J2PB 2DPJA 1VFJA 4BDPA 1YGYA 3DC2A 1IN0A 5KT3A 4FF3A 4JI1F 4U6PA 3BSNA 2X51A 1HFEL 3O3LA 5B7WA 3FEYB 2RF2B 2WONA 1LWCA 3M2RB 3UR0A 1T8EA 2GCFA 5F0WA 2ASLA 4QWDA 1FRIA 2F9JA 3U1LA 3Q22A 2I0XA 3NGDA 3OR1A 4ES3A 2M2BA 4YDXA 1JLFA 2AU0A 4PQUB 3I82A 3V4IB 2EKYA 1SJ3P 3IN5A 4TQRA 4PQAA 1FEEA 4EZ9A 3PW0A 1RT3B 1QUVA 2PDAA 3S6EA 2HNZA 1JLBA 4DFJA 1Q7YT 2WRMA 3MEKA 4JUZA 4NLTA 1A6LA 4ED3A 2CQBA 3S01A 4OI3A 3CD7A 3R5DA 1BQNB 1D9DA 4LQ3A 3N9UC 2KXFA 2BV3A 2ZUGA 3LO3A 2B9WA 3G8SA 1MMLA 2RUGA 3QIPA 4LF8F 4HYKA 2K1RA 1S1WB 1TK0A 1CC7A 1D9AA 3I4HX 5BYQA 4RW6A 2XLJA 1MMNA 1S1XA 1D8YA 2PIIA 3OL7A 1DTQB 5E33A 2LXFA 4FN5A 4ETZA 5LJ3Y 3KG4A 1F5CA 3K2YA 3DOKB 4UW2A 4C8NA 3S1TA 1F60B 4F4ZA 1QLNA 5HQ8A 4J9RA 3SDEB 1HBOB 1JLGA 3GFHA 3M2UB 4OMFG 1VS3A 4KSEB 1H3DA 4XO0A 1VMBA 3NL0A 5GVQA 2M88A 3J7ZT 2I1RA 2IRUA 4A46A 1IM4A 4ZPCA 3CCTA 1WI8A 4R5PA 3EXCX 3QAEA 5D4PA 3P3DA 2KKHA 3BSCA 3ZC4A 3QYYA 2FHJD 1Q79A 7FDRA 2R8JA 1HW9A 5FIIA 3I56S 2FC9A 2DHGA 1S1UA 1S79A 3VQTA 1XWLA 1P1LA 4DDFA 3I4PA 3TOQA 5D4LA 1G3OA 3FQLA 2B5JB 2PC6A 3MEDB 2ZZMA 3OTCA 2HHUA 1PC5A 2MQOA 3OXFA 4QIVA 1MNEA 3I0SA 5F9NA 1DJ0A 3TP2A 5A0YB 2XB2D 3DLHA 3NCRA 4OHXA 1ZM3A 3T19A 5B0CA 2AYEA 4IFVB 1VQ7S 3EGZA 4H54A 3PR5B 2GO9A 2YKAA 5AJ3F 2XS5A 3CC7S 1YJRA 5I3QA 2PI5A 2NREA 1CQMA 1IKWB 4QU7A 4A8QA 4QWBA 4QR0A 3E3XA 3IRWP 3SQGA 2AYBA 4YHHF 5J1EA 1Z2ZA 3H5UA 5L9NA 1GX6A 2XCPA 1RAJA 4NCBA 4ITSA 3TARA 4Q0BB 2DITA 2ZH6A 1OWXA 2UVVA 5E3PA 2WBRA 2ZH2A 4JOUA 1RQ0A 4IH7A 2DCUB 1M5VC 1Y5IB 2PI4A 2DT9A 2EW9A 4N47A 4LSLA 1FDNA 2RT3A 2I5JB 2RH3A 3DRPB 1QE1B 1MSWD 5E41A 2RQ4A 4RW4A 2GO8A 4LF7F 3LP1A 3PX6A 5CYMA 1AROP 5EHHA 1T95A 2PD1A 2YKQA 1CG2A 2UV8A 4PUOA 2I8EA 3DXBA 3RB0A 3HHLC 4XK8C 2UU9F 3DI6B 1XR7A 2EBGA 4PR6A 1H2VZ 3DDNA 2MKKA 4J9KA 4F4YA 2HHQA 3SCKE 1UA0A 1H7XA 3ZZZA 2DH7A 4WU3A 3T9ZA 5DG9A 5F8IA 1X4HA 4K4YA 1Q8IA 2CQ4A 1K73T 2RRAA 5I3UA 4PG8A 3EXYA 4B9SA 5KFNA 4LF9F 2M52A 2CJAA 4ED0A 2MZTA 1APSA 2O5DA 4KJIA 5KT4A 3GG1A 4QW9A 1UVJA 5IT0A 2W8LA 3HF5A 1S9EA 2BM1A 1VHFA 2BYCA 3D1HA 2DGOA 2AJ0A 1DQAA 3CCMS 3DRXA 4HL9A 1P8GA 1S76D 3FMWA 4FF1A 4LIRA 1TL4A 2LXIA 3RAXA 3LOUA 1N52B 5HN0A 3MM9A 3LGMA 3FCHA 4UUWA 2XLIA 2P5VA 2RRNA 2VG5A 1FE0A 4ZP9A 1HWKA 3LQVA 3D1QA 4G1IA 2AP6A 3M8QA 2RQKA 2J6TA 4NA1A 3MM6A 1N6QB 1O0PA 1TKXB 3MEGA 2DB1A 4F2RA 4OZNA 3G6VA 4IG3B 4YR0A 4OLOA 2MKCA 1RTDB 2V4JA 4G1QA 3KLHA 3ISZA 4UY85 2QE5A 1VQNS 2VASA 1IKVB 1M5OC 5SZTA 1VBYA 4KAIA 2PA3A 1VIOA 1S7HA 3GWCA 1U7LA 3FDSA 5G0RA 2WOMB 1N33F 1XK8A 3JSRA 1LW0A 2K7KA 2DO4A 1U4BA 3CJ4A 1BGXT 2FTRA 2V8DA 1WD6A 3E51A 1C0TA 1H38A 2HZCA 4ECRA 2LU1A 2YWHA 1XNRF 2ZOMA 1ZH5A 1ZPWX 5F8NA 2FDNA 2QV6A 3JYTB 4Y6IA 1DZ5A 3DRYA 2XS2A 2XY7A 1R27B 5KFIA 2AV5A 5K8NA 5B0BA 1HI1A 4QWCA 3OHBA 4IR1A 2W4CA 5DRKA 3B4MA 5T14A 3JB9k 1LFPA 1H0HB 1V9OA 4QU6A 2IA6A 3ISNC 3DOMA 2J6SA 4CNYA 2LA4A 3X3UA 3CCES 3MM7A 4NLUA 2YH0A 1JLCB 2ZOGA 4KFBB 4X4TA 4BWMA 4ELVA 1WELA 5J2MB 2R8HA 3LP2A 4QWAA 3KJVB 1X8DA 3OR2B 3FEZA 3GFXA 1Y7PA