1KD1T

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kd1T00
2CQCA 2MJUA 3L3CA 2MGZA 2DNYA 2X1AA 1JJ4A 3CCUS 2MQLA 2OSQA 3SMZA 2KRRA 1U1OA 2FHOB 2MZJA 2N82B 3N9UC 4P6QA 5CYJA 3VAGA 3UD3P 2DNRA 2LYVA 2KG0A 2BZ2A 3FEYB 3THTA 3UCUP 1VC6A 2M70A 5GVQA 2DO4A 2MQOA 1N88A 3R27A 5DM7Q 4PR6A 2DHAA 1M5KC 3MXHP 5H1SV 1IQTA 3CPWR 2K8GA 2JVRA 1W2BR 3VAHA 2VOPA 2MZTA 2N7CA 1WEYA 2AYGA 3P5TL 1JJHA 1KQSR 2HZCA 4TLQA 1WELA 2DH7A 3NNHA 2RUGA 1HA1A 2UP1A 1Q86T 2DNMA 2YH1A 5GAHU 4TU9A 1M5VC 2I2YA 5GAGU 1URNA 1K9MT 2DHXA 2FC9A 2MZSA 1NU4A 1SJ3P 1FT8A 1UFWA 1WHWA 2WBRA 4V19X 2OJ3A 1N54B 3MD3A 1U1RA 5IFMA 1SXLA 3R1LA 3G8SA 3G71S 2KU7A 1KOHA 1VQ6S 2KH9A 2ERRA 2RQ4A 3P49B 2E5GA 2EVZA 4A8XA 2V94A 1R8PA 1OIAA 2DIVA 3CTRA 3G96A 2E5HA 4BS2A 2MQQA 2KM8C 2KT5A 3S01A 2DH9A 1X5OA 1F9FA 2CPHA 4WCEQ 3SXLA 3DXBA 3MURP 2XS7A 1YTYA 2LA6A 4LMZA 2LA4A 5FJ4A 2DO0A 5LJ3Y 4F25A 2LCWA 4FXWA 1VQOS 3THPA 5D78A 4PRFA 2MGZB 2LEBA 3HHNB 2MY7A 2CQPA 4ZKAA 3Q2SC 2KFYA 1VQNS 2DISA 1X4EA 2MPUA 1X4HA 2MY8A 2AD9A 4CQ1A 1YJ9S 1H2VZ 2RRBA 3CCVS 4RU2A 2HGLA 2LKZA 5CXTA 2MQMA 1VQ8S 3S8SA 2K3KA 1U6FA 1M5OC 1YITS 1Q7YT 2GHPA 1UP1A 1SJFA 5JVHQ 2X1BA 5D77A 2FC8A 2M8HA 1O0PA 2XSFA 2XS2A 4QU6A 1X4GA 2YKAA 1DHMA 5LXRA 2CQIA 3S6EA 2SXLA 2KM8B 1K73T 2MZ1A 3PIOQ 2RVJA 2ZJPQ 3D2WA 4Y0FA 2DNGA 3NNAA 1FJEB 2J8AA 4J5OA 2DNLA 1NO8A 4LIRA 1VBYA 2E5JA 5IQQA 2MSSA 2RRAA 3H2VE 1X4CA 5DETA 2JX2A 3MUMP 2CPFA 2KXHA 2ZJRQ 2MJNA 2KRBA 4CH1A 3CCLS 3VAFA 2ADCA 1PGZA 2A3JA 1YWXA 3IRWP 5DDRC 2ADBA 2RS8A 2HVZA 2CQ4A 1H6KX 2VONA 1U1LA 3CMES 2X1FA 3RW6A 5MLCV 2X1GA 2YWKA 3TP2A 2CQBA 1DZ5A 1U1PA 2DNKA 1WHYA 1QM9A 2MMYA 2MZQA 4C0OC 3CXCR 3CCJS 1P1TA 4W92B 3BO3A 2LXUA 1G2EA 1FXLA 3CCMS 1S79A 5HO4A 5GAEU 3MOJB 1L3KA 2MYFA 2N3LA 3R1HA 1U1NA 1WEXA 5DDOC 1K8AT 1WI6A 3H2UB 1U1KA 3B4MA 3S7RA 1WF1A 2CQ1A 2YTCA 1VQLS 2CPYA 3EX7B 5HL7Q 3G6ES 1WHXA 1A9NB 2BOPA 2KXNB 2LQ5A 2OTJS 5LJ5Y 2PE8A 3U1LA 3IWNC 1B7FA 1X5PA 1BY9A 2U2FA 4F26A 2MKCA 2E5IA 2RS2A 1OWXA 2M2BA 1SJ4P 2XB2D 2MKHA 2MQNA 3OW2R 2MKJA 3MUVP 1D9AA 4ERDA 2DNPA 2LEAA 3CMAS 3B4DA 4CH0S 2JVOA 2KHCA 2G0CA 3CULA 1ZZNA 4W90B 2DGWA 1H2UX 2MZRA 4QQBA 2DNOA 3TYTA 2MKIA 2J76E 3P6YC 2MXYA 3BS9A 3VAKA 1M90T 2GO9A 2QEXS 2MHNA 4F02A 3MI7X 2KI2A 1KD1T 3MDFA 2LECA 1QVGR 3BO4A 2F9JA 1VQ7S 2KN4A 1R8HA 4EGLA 2KYXA 5LXYA 3SDEA 4M5DB 2CPEA 2M7SA 3J7ZT 1DBDA 1X0FA 1AUDA 2VOOA 2AYMA 2MSTA 3CCQS 1SJQA 5GMKa 2G1DA 2L41A 4Y00A 2OSRA 2M4MA 3LPYA 4LJMA 2D9PA 1U1QA 1WG1A 1M1KT 1X5SA 3ZZYA 2HYIB 1VC5A 5DDQC 2MQPA 3CCSS 2MKKA 3EGZA 4ED5A 1FO1A 2CPZA 4IO9Q 3FEXB 1VQKS 2F9DA 3VAJA 1VQ9S 1YJWS 2DGTA 1PO6A 1WHVA 3UWTA 3G4SS 1HD1A 1Q81T 2J0SD 3CD6S 4Z2XA 3PIPQ 5LSOA 2DNZA 2HGNA 3UCGA 3NMRA 4WFNQ 2E44A 1OPIA 2MB0B 1WG5A 1RK8A 2DB1A 3I55S 2FY1A 1RKJA 2CQ0A 4WIIA 3J7YU 3ZZZA 3K0JA 4UY8T 4WFBQ 1VBZA 2FPHX 2M52A 2NZ4A 2NLWA 4IUFA 3DLLQ 4QPTA 1ZZFA 5DM6Q 1P27B 2KXFA 3CCRS 2CQ3A 3ULHA 1H2TZ 4OZ0A 1DRZA 3Q2TC 1WTBA 1NJIT 1CVJA 2CPXA 2CQHA 4CIOA 2M8DB 2L08A 5LSLA 2CQDA 2DITA 5IM0A 1WWHA 2DGQA 2LMIA 2M9KA 2EK6A 2U1AA 2DK2A 1FJ7A 3G8TA 2QFJA 2I38A 1FNXH 3SDEB 4WFAQ 1WI8A 1FHTA 4C7QA 1U6BA 2B0GA 3I56S 2RQCA 4UQTA 3CC4S 2DGUA 1M5PC 2DIUA 2Q79A 3EGNA 1Q82T 2CPJA 1HL6A 1KC8T 2LXIA 1N52B 2KG1A 1VBXA 1HD0A 1X5TA 4YUDA 1XN9A 3CC2S 2XNQA 4FXVA 4PKDB 2JRSA 2DGXA 3U1MA 1A7GE 2VODA 2MKSA 4WF9Q 2AYBA 3G9CA 1VQMS 4YB1P 2YH0A 1X4BA 3MUTP 1UAWA 2KVIA 1WF0A 4U67Q 3CC7S 1YIJS 3P3DA 1VQPS 3HI9A 1YI2S 2DHSA 3TO8A 1S72S 2RT3A 4WKRA 4TU8A 3CUNA 3UCZP 1QVFR 2L9WA 1KOOA 1U2FA 2CJKA 3V4MA 1JJ2R 2XNRA 2JWNA 1YJNS 1N8RT 1VQ4S 3CCES 3BEGB 3BO2A 2QA4S 2XS5A 2DHGA 2F3JA 3NS5A 2M88A 2AYEA 1U1MA 1JMTA 2CQGA 2DGSA 2RNEA 3VAIA 3US5A 3VF0B 5BJRA 5JVGQ 3JB9k 1SJRA 4OZ1A 2D9OA 1VQ5S 1X4FA 2EK1A 1OO0B 2DNNA 3VAMA 4TU7A 1YHQS 1WEZA 2DGOA 2J0QD 5IM0B 5EN1A 4IOAQ 3MD1A 2RU3A 3LQVA 5DDPC 1X4AA 5ITHA 2CPIA 3NNCA 1FJCA 3RW7A 3CF5Q 1X4DA 3UD4P 2HGMA 5CA5A 2CPDA 4IOCQ 3UE2A 4YOEA 2G4BA 2CQ2A 2OIHA 1UW4A 4C4WA 2DH8A 2DNQA 2OTLS 2M0GB 2DNHA 2N3OA 2D3OR 1D8ZA 1WF2A 2O3DA 1VC0A 4QU7A 2DGVA 1ZH5A 5GADU 2ZJQQ 1WG4A 2PEHA 3VALA 3NS6A
chains in the Genus database with same CATH superfamily
1IBMJ 3C14A 4IYQA 1UZHA 4B08A 5IQ6A 3SSSA 5B7WA 1Z1ZA 1ITPA 5KFUA 5A8WA 4PR6A 2B6AB 2K8GA 3O8WA 3H7HB 1XNQJ 1LWFA 1DAXA 1GNKA 2WONA 4LFAJ 4RL1A 4MIAA 2ZWOA 1IBMF 4DS4A 2UUCJ 1QSYA 1CC7A 2BE2B 1FT8A 4DHVA 2UU9J 2YQ0A 4NEYA 3AT1B 5EWGA 2P9CA 4DSKA 3MD3A 2G2ZA 3NGTA 4CYUA 4WU3A 2EVZA 1HI1A 2DIVA 1XNQF 4J7CA 2MQQA 2NPIA 3S01A 5KFRA 3SXLA 1VRTB 2RIJA 4F4XA 4LFAF 1RI7A 4PG6A 4EEYA 4OJ3A 2UUCF 4C3KA 3QT5A 4CLPA 1UFLA 1R89A 1JWWA 2X3DA 2UU9F 1XR6A 1J5EJ 1X9MA 5KG5A 1NSAA 3HHLC 1SQEA 2N7YA 2BACA 3GYXB 4LSLB 2MQMA 3RRKA 4X62J 1N5YB 4QIEA 3I9V9 3M1VA 2W4DA 4P75A 2J8AA 1J5EF 3I6PA 3JQMA 4HI1A 5K5MA 3EVWA 1ZAXA 4I2PB 3NG8A 3MECB 2LU1A 3OR1A 4CO4A 3CCLS 3IRWP 4X62F 4ZVTB 1RWWB 4ES1A 2NXUA 4GKJJ 3DCAA 5IWAJ 4R8UB 1FK9B 3HHLB 4KSEB 5DG9A 4GVLA 4ZPDA 2VFRA 2CNLB 3CJRA 4C0OC 4HH1A 2YPZA 4DPOA 2KO1A 1FXLA 1DARA 1YBTA 4USKA 2W2PP 3MOJB 1U1NA 2MHEA 1R7IA 1JLQA 3HSGA 3BQ2A 4QJVA 1C0UB 4DJBA 1TL3A 4B9UA 2FLNA 4F4YA 4GKJF 5IWAF 5SZTA 2RS2A 5ETLA 1HWIA 5D0RA 3BGFA 4U96A 5I3PA 2O66A 3MEDB 2FLPA 3H5UA 3CULA 3C6TB 4QQBA 1TL5A 4FNHA 2HQDA 2BRLA 4CNZA 3W65A 2HMIA 4WIQA 3A4TA 3W5XA 4B3RJ 3IP0A 5HMXA 4CLFA 1S1XB 2MSTA 5KFKA 1BUXA 3H5XA 2EFOA 1RAOA 2IDEA 2OPPA 1M1KT 1VC5A 2CPZA 3GIKA 1MROB 2XG8A 1PO6A 4CM0A 4NMXA 1L3VA 1ROFA 4B3RF 2LLZA 4PWWA 3AD7C 1RT5A 3T5JA 1EKRA 2WVCA 1C1BB 3KG1A 1UVLA 2VC0A 3KLHA 4DU7A 4J91A 2RE1A 3MAAB 1D9DA 3B6BA 3HMJG 2HAFA 4CO1A 3KLEB 3FC9A 1JLAB 1UVIA 2LQ9A 1RTJB 4LF8J 3EGWB 3BYPA 2YWHA 2CQDA 2BMBA 3GJSB 3IBWA 2YX7A 5KFHA 4DQRA 1JQGA 2GMJA 2UV8A 4TY9A 3W9IA 1Q82T 1NJWA 3MM6A 5BXIA 1DLOA 2QX0A 1RAIB 4RNFA 4LF8F 3OPKA 4I0WA 2VHGA 5KFDA 2BM0A 4WZQA 5K8MA 2FDNA 2DYAA 1VQPS 5EX0A 4K4UA 5EHHA 2VFSA 4KV8A 3JTNA 4C48A 4UT4A 3DC2A 4OYMA 1FDDA 2YY3A 4K4XA 3KUHA 3OTOJ 1WC3A 2JC1A 1EQ0A 4ED2A 1BQNB 3W62A 1S9FA 4QIWD 3WIUA 4DR3F 4ATNA 2VFUA 5IC4B 3EJMA 4ED6A 4ZDNA 3MPWA 2G1HA 3AOAA 4IKAA 1NHKL 1KQFB 3GJTB 2DNHA 4NPOA 3H5SA 4EI2A 1VS3A 1IKXA 5CD4H 5D3GA 4RW4B 1UA1A 2XI3A 3LGHA 3WDOA 3IR5B 3X1LB 5LMNJ 2Y1JA 1PBUA 3BR8A 2B5JB 5AE3A 1ZM3A 1ZA2B 1NRKA 1QSLA 5HSPA 2VOPA 2J7WA 5KG1A 3Q8QB 4I7FB 4CZCA 4A8KA 4TLQA 1WACA 4IRCA 4DL7A 4F3OA 4USWA 2CZ4A 2W7OA 1BQMB 4KGVB 3AXKA 3RBEA 2JH3A 4N76A 1LK5A 3FRYA 5LMNF 4DQIA 3G8SA 2ATLA 2KH9A 2QO3A 1E6VA 1FKPB 2KT5A 3LP2A 4OHVA 5DGAA 4YR0A 2ZBRA 2XS7A 1NPRA 3GWCA 3ENQA 1JLBB 2Z58B 5J1EB 3HHNB 1U45A 1S6OA 5KFJA 1EHWA 3KHHA 1MSWD 1IBCB 3TAMB 2NUUG 3W8GA 2MPUA 3CIMA 5AXKA 3TX0A 5HANA 4K2JA 5KFAA 2HS4A 2YNHB 1W25A 2PDAA 3FBFA 1YBUA 3FBCA 3D0GE 1O0PA 2XSFA 2IDLA 4NA1A 4H4MA 4RBTA 4NLOA 4DV1J 1CBKA 2C3PA 4OFZA 5C24B 1FFWB 4KFBA 3AJ1A 4FF4A 1RHMB 3VQTA 3V6DA 3SSQA 5DG8A 1RT1A 4C8NA 2CQ4A 3VV2B 1XBWA 4XTTA 4DPTA 5DGBA 2RSQA 2W9BB 4B3MJ 5HLFA 4RNHA 4DV1F 4NLGA 4RWWA 3BO3A 4HT5A 5HO4A 4B3SJ 2OFGX 3TVKA 1Q95G 4BBYA 2PEBA 3G6ES 1A9NB 2OEJA 5LJ5Y 4J9KA 2HFNA 3FCVA 3LW5C 4O4GB 2QA2A 1D3WA 4CCHA 3H4DA 2FZKB 2MKHA 4B3MF 4IRDA 2MKJA 2A6OA 2DNPA 4MKVA 2OUGA 3RRGA 4CH0S 2HKEA 2DGWA 5EWFA 4B3SF 4A48A 2GO9A 4TYAA 2G9OA 2JNJA 2JJ4D 4WYWA 2QJ3A 4RW6B 3UNGC 3GMGA 1H0HB 5A8WB 4BLGA 4L72B 2L41A 1U1QA 1LWFB 4HR2A 3TQ1A 2HZVA 2WONB 4ED5A 5F9LA 5F8MA 2BQ3A 2W2QP 1JNZB 2XTJP 1CJVA 3CJQA 4DR6J 5CCLA 1TQLA 2FJDB 3M8RA 3UN3A 5C25A 3QATA 2LDYA 3C2PA 2UUTA 4OYAA 4CYUB 2OMOA 4CO5A 5D4LA 2C2KB 4P10A 1RKJA 4M5LA 4LFCJ 3N0VA 4UY8T 1UVJA 1IBKJ 4DQSA 3J7YI 4NRUA 1HMVA 1VI7A 4QPTA 1B7YB 5JMNA 1HNZJ 1RT4B 3KJNB 2P8IA 1WD6A 1CVJA 4DR6F 3B82A 2AKWB 4CIOA 1AFJA 1EKSA 3GR1A 1HQEB 2C2RA 4LFCF 1RE1B 2RU9A 2JFDA 3EZUA 1H72C 1FXDA 1N52B 1HNZF 4AL5A 3HSDA 4OJHA 1N0VC 2PC6A 4NYZA 5RUBA 1RZMA 3DLKB 4W98A 4PPZA 3KJQB 2CVEA 4M5GA 2FHMA 3NCQA 4JI2J 4RUHA 1Y3KA 3DLHA 1LFWA 3DKDA 1ZM9A 1JKHB 2DHGA 5KFQA 3UNYA 4TY8A 4NCAA 2J9DA 2GQ2A 3G6VA 2VKZG 1YJVA 4OIXA 4OZ1A 2YWFA 4F3QA 4YR3A 4EO6A 3R6GB 1L3UA 2WB1D 1RU1A 3PCOB 2E1MC 2HHQA 4TN2A 1UPMB 4JI2F 4M5NA 2RRNA 4NLRA 1YKWA 2NZCA 3PRDA 1Q5YA 4C4WA 3EXYA 1EB0A 2DNQA 3FVYA 4I6WA 1D8ZA 2P2CB 2N4CA 1VRUB 2BUNA 5GADU 3VALA 1TUWA 1EX8A 5AXNA 1RCOB 2FHJA 3HZGA 4P6QA 4MIBA 1OSDA 2KG0A 1RAFB 4DX5A 2W9AA 2HMIB 1S4EA 3GIMA 2DHAA 3MXHP 4G1IA 4FN5A 2XYHB 5KT4A 4CH7A 4L73A 4RBUA 3PKMA 3MPUB 5AT1B 1RYSA 3PYDA 3CW2C 2ZUAA 1TTHB 2HQFA 4LFBJ 1XMQJ 1G7CB 1N33J 4WE1A 3ZTPA 3R1LA 4Q8EA 2GZOA 1H3DA 1TAQA 4YR2A 3NOGA 1P6TA 2VASA 3MCNA 2ZOGA 2BR0A 2A1BA 2HURA 1RHRB 1RDRA 4ZKAA 1RWKB 2V9KA 5T7LA 2D7SA 3OL6A 3A1YG 3FGVA 1HPZA 1RTDB 1U2RA 4LFBF 1XMQF 1N33F 3GG1A 3X3UA 5IXUA 2F1FA 4Y34A 2J7KA 2KFNA 2F63A 1HR0J 1RTHB 5JVHQ 2VQEJ 5KFPA 3FQLA 3DOMA 1TVRB 1FRMA 1N0UA 5IQQA 5DZ6A 3UN2A 2R8GA 2PN6A 2NQPA 4ZA1A 2A3JA 3DOLA 2H5IB 1HR0F 3CMES 3MM5A 2VQEF 4ZHRB 2HW3A 2MZQA 1QM9A 1HQUB 3LTOA 1HYSA 5HJYA 3V4IB 3L7PA 2IYGA 4DEZA 5C2CA 2KT2A 2CPYA 2CJ9A 1P1LA 1FTCA 3V6JA 4KH0B 2NS1B 2D69A 2M2BA 1HQ2A 3A8EA 2VKRA 2ZBPA 3N5BA 3EYZA 3I0RB 3PZPA 4NCGA 5KFOA 3QT6A 3CD0A 1K0VA 3PX6A 1M90T 4OX9J 1UA0A 4PG8A 1SV5A 5A2QY 1SL2A 1S1WA 1YSJA 2VBWA 1ZAVA 3RRHA 4B3TJ 2ASLA 1URRA 1S7HA 5E2QA 3MWBA 4DFJA 7FDRA 4HT7A 2UVWA 2W2OP 2I0XA 2HQGA 1VQ9S 4OX9F 4WK1A 3EZ5A 3IXQA 3KK3A 3M8WA 5HBMA 1S0NA 2ASDA 2DB1A 4B3TF 5J2NB 4KGXB 3HFVA 5KFMA 2NZ4A 4JI4J 3B78A 2V63A 1DURA 1SC1B 3AQPA 1S1VA 4X4SA 1YBAA 3FDSA 4NRTA 1SB6A 2OMLA 1WTBA 3IN5A 3O3LA 2O5DA 5HROB 5IZHA 5I42A 1FJ7A 1IJEB 5FDLB 4C0HA 5CYQA 3OJSA 4FNIA 3HDSA 4Y65A 3GV8B 4JI4F 1KVIA 4FS1A 4F8RA 3M8SA 3MF5A 1IR0A 3MPVA 1T7PA 4PKDB 1T3NA 4OX8A 4A8SA 4YB1P 1NK7A 2RT3A 3A8JA 1KOOA 5KG2A 4YHHJ 1FNMA 2JDJA 2CJKA 1TMMA 2AJ2A 5D6GA 1YJNS 3THVA 2XS5A 2CNNB 1DTQA 2JFKA 2AYEA 3IS9A 4IH7A 4ECVA 4XDCA 3C66A 2CNKB 3KDOA 5HP1B 3SSRA 2WW4A 2JC0A 4PWUA 3FSXA 3GB0A 3HHLD 3DMJA 3NL0A 5ETMA 3Q23A 5HQ8A 4YHHF 3W9HA 4IG0A 4LF9J 4ANDA 2B3TB 5FLXY 4Q43A 3NS6A 5DDQC 5KFFA 2AGPA 1EETA 1FRLA 2G2YA 2OSQA 1Y4ZB 3MM9B 3TAPA 2H51B 3EZOA 6FD1A 2WVDA 3GTYX 3QSYB 3ICLA 4KKOA 4LF9F 2JLGA 3W7BA 3BV8A 2HBQB 4JI0J 3NAIA 4DR1J 2XBPA 2IVMA 4RW8B 4A47A 2EFPA 1BGXT 1UFWA 2CYYA 1U4BA 3FZ2A 5KTQA 1SXLA 1NMEB 4HACA 1VCTA 3OV7A 3GIIA 3QFHA 3P49B 2E5GA 4A8XA 1HBUB 3WHIA 4OLPA 1H73A 4LRFA 3QPIA 2DO0A 5LT5A 4JI0F 3WZ0A 3MFIA 3D1OA 2UV8G 1RCXB 1HMVB 2N4DA 3B54A 3K5PA 4DR1F 4MIWA 4I68A 1HBOA 3W3SA 2MY8A 3R5BA 4U7CA 3F0NA 4FDFA 1VQ8S 5B09A 4EYIB 1Y00A 4MTPA 4X84A 4E0DA 3RB3A 1CEZA 3RAMA 2E9RX 4D3HA 4LSNB 2JSXA 2XMMA 1SH2A 3L7UA 5GMDA 5JJBA 4OLOA 1YVFA 4F2RA 2F8EX 3FMWA 2DNLA 1B0PA 1NZAA 4OX6A 3ZZ0A 4ZCMA 5L1IA 3IM9A 1YWXA 1K44A 2W1BA 3BGRB 3JQKA 1H6KX 1SC4B 5CYMA 2QV6A 4ECTA 1F9HA 3RW6A 3KOAA 2DNKA 3JSMA 4RLEA 2WAQD 4ZJQA 2D3UA 2E1PA 4ZVQB 3CCJS 2VFTA 2FJWA 4NZ0A 1U25A 1KR4A 2HHSA 2HNZA 3VQSA 3IG1B 1WF1A 3MMJA 4N56A 3QIPB 2NR0A 2U2FA 2C2ZB 2UVUA 3KLVA 3CO0P 2WVFA 2JOQA 4NMLA 1UCNA 1D9FA 2FUG9 4OJ1A 4ZP9A 5J2QA 4ANCA 4N77A 2OI2A 4Q2LA 1QTMA 2UVVA 3PHEA 4ZIVA 4JBCA 4LRCA 3SYZA 1VJQA 1T9VA 2HSEB 2F9JA 2Y1LB 1TK0A 4EGLA 1OYEA 2VOOA 3D3BJ 3CCQS 3OVBA 2QYGA 4NLUA 5KFZA 1S97A 2GJIA 2P6SA 2Y8YA 3M32A 4KBIA 1M1HA 5K8OA 1NXIA 2FQQB 4OI4A 5DLFA 3UWTA 4LF1A 2B4PA 3AD8C 1Y10A 1L5UA 3V5RA 3R7NB 2XMWA 3BQ1A 2C2NA 5E41A 1IQZA 3IO1A 3K5LA 3ILLA 4FPIA 4FKXA 2CQ3A 5AXMA 4H54A 1QY7A 3OVAA 2AX1A 5M2RA 2LMIA 3D5MA 5KOXA 2QLJB 3G8TA 2QFJA 4O0IA 1Q8KA 2ACYA 3R5AA 2HHUA 4WFAQ 1S0OA 4B3OB 2RQCA 2ASYA 3DYAA 4TYBA 4IG3B 2B4UA 3SFUA 3CJSA 4I4BA 3PNIA 3M9MB 5HK4A 2YKMA 2GIFA 2R7SA 1ACMB 2MKSA 2BBEA 4DR2J 3G6YA 5T41A 2B51A 3R5JB 2XMVA 4KH1B 5IV4A 4BWJA 1N8RT 1TKZB 3FJ2A 4R5PA 5KFGA 1E6YA 3ILJA 3M6VA 3K8WA 3KYLA 3TEGA 4JV5J 4DR2F 4IOAQ 1A6LA 4UY85 3OTCA 4B17A 4RPFA 2R7TA 4J9VA 1JLFB 2RQMA 1VHIA 2JHEA 3BGLA 3VGTA 2OTLS 4UUWA 3MCMA 2O3DA 1AXQA 4DV2J 1SH3A 3MM7B 4B02A 4JV5F 1BMQB 2CQCA 2MGZA 3AHPA 2L9NA 3NEKA 1N36J 3UCUP 4PQAA 4IQXA 1Z2ZA 2K2PA 3GQCA 1GMUA 5H1SV 5K20B 2IA0A 1S1WB 1JB0C 1WEYA 1YZ7A 2ZWPA 1SKSA 2IAJB 2VG6A 2Y1RI 5D4OA 2J6SA 4DV2F 2HZCA 1WELA 2RUGA 4OHYA 3DRXA 1LV5A 1SJ3P 1N36F 1RAEB 5IFMA 4ECRA 5L1KA 2HBYB 3RTVA 2BRKA 2ERRA 4DF8A 5H9EK 4DLGA 4UOCA 2X3GA 3KK3B 5E7OB 5HBMB 3R7SB 1M5HA 1NPPA 2XLIA 4GO5X 1YTYA 1C2PA 1S48A 8AT1B 1KSPA 2H65B 5KT3A 3M8YA 4F0KA 3G82A 2E29A 2HVEA 2L48A 1VOMA 3UFCX 3MR5A 3CJ3A 4M5HA 3KHRA 2K1RB 3E01A 1NCLA 2QMWA 3LP1A 4QU6A 1HWLA 3HF5A 4Y2MA 1VLOA 3S6EA 1KBRA 5DQHA 4LF7J 1CULB 1CSJA 4KT0C 4QYRA 4KHRA 6FDRA 3H2VE 2JX2A 3PO4A 4GMKA 2XLJA 1GMWA 2PI4A 1IWAA 5MLCV 3IBFB 4DU8A 1FRJA 2HNYB 1Z4UA 1DZ5A 1WC5A 1WHYA 4XK8C 1DTQB 3MAHA 3W1YC 4LF7F 2QRRA 1TL1A 3FFIA 2MYFA 2R7RA 2ZD1A 1XEZA 4NWBA 4CLZA 2ZVIA 2DR9A 4BWMA 3HVTA 2W9CA 1KTVA 3RG6A 2BANB 4WP8A 3MUVP 5DLGA 3SBMA 4K4ZA 1R0AA 1IUJA 3SZ2A 1U24A 4ZPCA 4V19J 2XMTA 2AJ4A 1TV6A 2MZRA 2KL8A 2ZE2A 2EBGA 4FVMA 3DLGB 3RR8A 3BS9A 1JK9B 4DUTA 3M30B 4ZLPA 2KI2A 2UUWA 1T03A 5A8KA 2ZNYA 4KGKA 2ZHBA 4HKQA 3HK2A 2WHOA 3AOCA 4W4MA 1RP5A 1LQ9A 1SKUB 3DRPB 3VZIA 4A8QA 3LPYA 4B9TA 3M4XA 1HWUA 4AFFA 1TL7B 1Q81T 1T05A 3T1HJ 2DR5A 3UCGA 4HTJA 4CNYA 1B3TA 1L3TA 3Q8PB 2AWZA 2OKQA 3BPDA 5ETQA 1RT6A 4LRAA 2FIUA 2CWXA 1J2VA 2GFFA 2L08A 3C6UB 1DFDA 3T1HF 2U1AA 3ENAA 3MMCB 3RB6A 5L1JA 1EP4A 2OAUA 1M5SA 2DGUA 3GCWP 2FVPA 3MMAA 1P9YA 4NYOA 1IKYB 3GFXA 4OV6A 2I1RA 1RHQB 3SV3A 4ICLA 5L38A 4DFMA 1VQMS 2C3YA 3N28A 2Q1LA 1X60A 3UW1A 2XMJA 1FERA 4QR0A 3M2UA 2ZZMA 3GFYA 2DEJA 5KT7A 3TJ9A 4LRDA 4M95A 2XNRA 3LOUA 5D0EA 4WU2A 3DRYA 1DQ9A 3NS5A 3WIVA 3KUGA 2W01A 4DZDA 3AA8A 1LW0B 1ZPVA 3GE9A 3Q86A 1FFGB 1TKTA 4TU7A 1SVDA 5KFVA 2V8HA 2HNZB 1S0MA 2P9EA 3PRVA 3DU5A 4ID5A 2NSBA 4QIVA 2GNKA 2HBRB 1I51B 2B8PA 3L7OA 3PW7A 3JSBA 4ZLLA 1VR6A 3RZAA 3JS9A 1HWKA 2B9EA 2VPWB 4F3MA 2XMAA 4NOHA 1NK4A 3FQKA 2ZJQQ 1WG4A 2CAJA 4PYDA 2VJVA 5I3QA 1LWXA 1NB2A 3CCUS 2GGPA 1RU2A 5A8RA 4OYPA 3N9UC 3VAGA 5D0GA 2GA7A 3PY8A 5F8NA 1S5ZA 2B9XA 1TUGB 1V3SA 1RT7A 1TAUA 5KFIA 2AJQA 1U0HA 3C8YA 1S6QB 3FBBA 1Q86T 3TOQA 2OPRA 1N5QA 3HLUA 1K9MT 2GIQA 1RGVA 2GMLA 1WHWA 4OHWA 1T0TV 3KMQA 1EZZB 4C3LA 4LF6J 4JI7J 3ZNUA 1C1CA 1YJTA 2L9DA 3ET6A 3Q8YA 1O8BA 2JEJA 2D1CA 3G96A 3CTRA 3DM2A 3NGDA 4CTAA 4MK7A 1R27B 3I5BA 4FXWA 3VCDA 1S6PB 2LEBA 1RUSA 1R3NA 1NUEA 4ETXA 4OYIA 4LF6F 2Q6CA 5CCMA 4JI7F 3ZO7A 2VV5A 2ROGA 2VBXA 2BJ1A 1C0TA 2HLUA 4G3IA 4RU9A 2WSFC 4FYDA 3M8QA 2MQ8A 2ILZA 3U02A 4IFVA 3QMQA 3NGRA 1RWOB 3A13A 4DV4J 4L3KA 2XY6A 1K47A 4K0KJ 2M3DA 2JLFA 2R7OA 1MG7A 2MSSA 3KJVB 4DWIA 2V6AA 2NXNA 2EI5A 2ZJRQ 4CH1A 1F6TA 3EUNA 4J37A 1R31A 3PR5B 1NK0A 1PJ6A 9RUBA 3GR0A 1EJ7L 4X66J 1U47A 2AGOA 2YKOA 5HQLA 1S12A 1VMBA 4GKKJ 1U1PA 3JXOA 1TKXA 4FZVA 2FVCA 4K4WA 2QN6B 3CJKA 1G2EA 4K0KF 4X4UA 1WEXA 5DDOC 5D4NA 1PC5A 2E7VA 2QGFB 4HTIA 3PW4A 2QFIA 5KFLA 1BQXA 3DRRB 3FCWA 1MMNA 5KFBA 4X66F 1NK6A 1I5OB 1JLCA 5CAAA 3M7VA 4GKKF 3OW2R 3HD2A 1RBAA 2HK3A 3M8PA 2HFSA 5LSRA 2KHCA 5D15A 4KPYA 2XWYA 1RT3A 4I2QA 2EG2A 1H2UX 3W2WA 2QLFB 3OUYB 1JXLA 4ZVUB 1RBOB 1FD2A 4U95A 4A8FA 3POTA 2MEWA 1B64A 3TA1A 1X31C 2NYIA 5GMKa 4U6PA 4O0NA 5C5JA 3D7SB 4A8OA 4ZVHA 1ELOA 1AZSA 3WQPA 1HKAA 3NRBA 1N5VA 5B0GA 3W63A 1UVKA 3N6MA 4ETZA 2QG9B 2HRYA 2YNIA 4NLXA 3G4SS 1ZA1B 2CJYB 3UDEA 4B9MA 2JEGA 4ED7A 2R8JA 1WDDA 3PIPQ 3UR0A 2XZDB 1LEOA 3ENVA 5AXLA 3ZZZA 4KR0B 4AXIA 2CZ9A 2HWIA 2QSFA 2HNDA 1CLFA 3DLLQ 5CH7B 4QYZK 1H2TZ 3WBZA 1Q5VA 1NJIT 4RUAA 1WDTA 3K57A 1UWBA 5IT4A 1RT2A 2ZHOA 4DMZA 3IC1A 2LXFA 2IRXA 2YPYA 3PACA 1J5OB 4C7QA 1U6BA 1PG5B 3I56S 3PVXA 1CJUB 1CG2A 2EFNA 3DRSA 1KONA 3I87A 4WPAA 3CC2S 4PWDB 4GVBA 3DLEA 2DRAA 4WFYA 5KT6A 2GAHC 1GT8A 4X4RA 4UOHA 1RYRA 3QGHA 1VISA 1YI2S 1CJKA 1S9EB 3NGSA 4DL0C 4DFPA 4ZJOA 4FBTA 1NK9A 3JYTB 3BEGB 5K8NA 2W2MP 3OSPA 5LMUJ 3VF0B 1RKIA 1KKHA 5BJRA 3ITHA 3PFEA 2H4YB 4ZP6A 2D9OA 4RW7A 2YKNA 4YB7A 1SQFA 2R2RA 1WEZA 1CS4B 4ZP8A 2ZD1B 3HT3A 2Z2YB 3CDWA 4ZLNA 3D6HB 1QD1A 1SIZA 4ECUA 4O44B 1IKVB 3CEDA 3TZWA 2KRRA 3KLGB 1U1OA 2EWHA 1RHJB 1YG0A 5KFXA 4DCPB 1Y9OA 4USUA 2CZVC 4RWXA 1M5KC 4R25A 2OPQA 1IQTA 4RUBA 1RA7A 4YFUA 4DPYA 2R9LA 4MFBB 1WKLA 3QQCD 4F0HA 2DH7A 5GAHU 1FEEA 2VICA 2FD2A 4K8RA 4NA2A 4HEA9 3Q8UA 4P2MA 2R7UA 3CCTA 2ZZNA 3M05A 3TUIC 1RISA 2GVDA 5T14A 1ZM2A 1RADB 2GVZA 3NBPA 3FKBA 1F5AA 2OELA 4QWCA 2LA6A 2G13A 2ACMA 4KHMA 1VQOS 2VC1A 1Y5IB 2CQPA 3QGPA 4BCAA 4NXNF 2B4OA 5D4PA 1VQNS 2DXFA 2CKWA 5AE2A 3HSZA 3P4UB 1OQ3A 5KAKA 1F0XA 4M1KA 1U6FA 2XZWA 3KK2B 4ED8A 2ZKTA 3FSIA 8RUCA 1D8YA 2PO4A 1AW0A 2ZJPQ 3SQGB 5C42B 3CSKA 1RWPB 3DI6B 2FY8A 2E5JA 4NLTA 3G2XA 3T6BA 3BQ0A 3MMBA 4PUOB 2GX8A 2ZBIA 2GQQA 3KFWX 4UOGA 2H3EB 1UVMA 4CLUA 3EE3A 2BW7A 3CD7A 5K14B 2HVZA 2VONA 1GFWB 2AJ0A 2X1FA 3J80Y 1ICEB 4ITSA 2OO4A 2F8HA 4NLDA 2HQ3A 4USVA 3WC2A 4KHPJ 1GMVA 1TUVA 3CCMS 3E3XA 1B0VA 1U1KA 1OYDA 3TAQA 3JTPA 1LWCA 1H38A 1WJ9A 2KXNB 1FCAA 2RJZA 2E5IA 2YQ1A 4UZBA 2V8DA 1EAYC 1SUQA 3CMAS 3E8OA 1RHKB 4CWBA 2VA3A 3HFZB 1EQMA 1HBNA 1FKOA 2QL5B 2R8HA 3P6YC 2RB7A 3K17A 3H4BA 2FHKA 3MTJA 2HLTA 2C28A 3MTKA 3UPFA 3SDEA 3J7ZT 2CPEA 4DOZA 1DBDA 1Q78A 1T95A 2M4MA 4ENOA 1X5SA 3IMQJ 4WFZA 2KDOA 3EGZA 4Q0BA 4CT8A 2H4WB 2RF2A 4RW9B 1VBKA 3ZZTA 4XPCA 5LSOA 1C1CB 2HAIA 4DS5A 4USTA 4JB8B 4Y2AA 1F2GA 4IFYB 2PMZD 2HK2A 2KXFA 1JNRB 2I6WA 3TQEA 4KYZA 4QIGA 4DV6J 2IM2A 4OZ0A 4CLWA 4N47A 3SEOA 2VG7A 4I69A 2HHWA 5AE1A 4A8MP 3O2IA 4NZ7A 1I94J 4PQUA 4WJBA 1C0TB 1OMSA 3I0SB 1YRTA 4ES3A 3QSIA 1FX2A 3RR7A 2J0XA 3QFWA 1NK5A 2K3IA 3HULA 2XNQA 4DV6F 2JRSA 4N41A 1A7GE 5KFYA 2YNFA 4C8YA 4ZCIA 2GW8A 4U67Q 3CC7S 1VHFA 3JSRA 1I94F 4LF4J 1D0EA 2R8IA 3ISNC 3NY0A 3M6XA 3V6KA 1QE1B 4XIUA 3IGNA 1SJRA 1NKBA 4ZIWA 1VQ5S 3DHWC 5E3AA 1OO0B 2I5JB 5A2QU 4YN3B 5IM0B 4ES2A 2RU3A 2B8QA 4LF4F 2HIQA 2GMHA 5B0FA 3AAWB 4DL5A 3I4HX 4AYBD 2DH8A 2DHHA 2D3O1 2VBZA 1WF2A 2W8LA 2CA9A 2HS0A 1RT3B 1RWXB 3QRPA 3NCPA 1C4AA 2FGCA 4QCLA 4UW2A 4YDXA 3QT7A 1HHSA 3DU6A 2COLA 4USJC 3FRZA 2DD8S 1HHQA 3EWGA 2PT0A 4X4PA 2PGCA 3NWGA 1R43A 2DR8A 5HQMA 3QRQA 1JJHA 1MWQA 2WCXA 2WW8A 1I6JA 2B7BB 1NAQA 1QDUB 2HHXA 2I2YA 1URNA 2FVQA 5CQGA 1NU4A 5GAGI 5KFWA 4ELVA 1NEEA 3GSIA 1N32J 5B08A 4G65A 3Q89A 2BA9A 4DSIA 3V81B 1NM2A 3H98A 3PFOA 3QYYA 4AL7A 3WX8A 4CLTA 4P2XA 4BS2A 2KM8C 1VQYA 5ETKA 3OR2B 3L95X 2DPJA 3QLHA 3FBEA 2KJVA 5KG7A 4F25A 2XULA 1TKDA 4YS2A 1I3OB 1SCJB 1N32F 2VDIA 1T02A 4ZPTR 3F73A 1X4HA 4DV7J 3DGPB 3LF0A 4PZVA 3D28A 4YY3J 3SFGA 4MJKA 3S8SA 4F7VA 2YNGA 3GILA 4K4VA 1REVB 5F8HA 1YJRA 2Z30B 2YKAA 2VFVA 3G8QA 3CJTA 1R8AA 2V2KA 4NLVA 2KM8B 4ZP7A 2RVJA 2B9YA 2Z4PA 3WC0A 3DLEB 3HKWA 4KPCA 2RRAA 4DV7F 4IH5A 1ZYQA 2PIIA 5J2MA 1X4CA 2UUAJ 3H5YA 9ATCB 4YY3F 2VL1A 1IKWA 1D1UA 2ADBA 3ILIA 1RTZA 4K5SA 5FLXU 3DN9A 2RHSB 4FYVB 3C19A 3QJJA 2XEXA 2A2DA 3OTDA 4W92B 3LP0A 1WC1A 4U9RA 3ITHB 4NE9C 1GXTA 1L3KA 4URSA 1NDLA 3C15B 2IM1A 2UUAF 3H2UB 1U02A 4B9NA 5GAHI 1SC6A 3MM8A 3IGVA 3IRXA 5KFSA 1S1TA 4WXOA 2APOA 5H9FJ 4DL2A 4F26A 4DR7J 1KQGB 1RTIB 7AT1B 3PV8A 4ERDA 1MU2A 2CJBA 1YJUA 1LWEA 3TYTA 2FLLA 2QEXS 1FRHA 2ZKUA 4F02A 4NA3A 4NCBA 1SBRA 2KN4A 2QLXA 2HHVA 4P7VA 1T94A 1S4FA 4DR7F 4H4OA 4M5DB 1XMOJ 2AF6A 2IA6A 3LH2S 5G4DA 1OPZA 2D9PA 2R2UA 1GXLA 3R5CA 4J9LA 2VBYA 1VK8A 1N56A 1CQMA 1YJWS 2HZAA 2VG5B 2HVHA 1RACB 3CD6S 2DNZA 1XJWB 3OTOF 3RBZA 3ZZPA 3VHQA 4U7UD 2RHQB 3K0JA 3DXSX 1ZM4A 2NLWA 3ZZRA 4CLKA 1SKWA 3TRGA 3RGIA 1B0TA 2J6TA 1DQ8A 1NH7A 3LWLA 3J81j 4IR9A 4J9OA 1VFJA 2ABYA 3OFGA 4ER8A 2ZH2A 2M8DB 4OZLA 3EICA 3NOCA 5A0YA 2C42A 2I38A 1TELA 3KWMA 2IC3A 1NKCA 2UXCJ 4DSLA 1NKEA 4AUKA 3TNVA 3D67A 4ZPBA 2DIUA 4PXEA 3GYNA 1VBXA 3QO9B 1G3OA 2HRUA 2VODA 2LQ8A 3IBCB 2AYBA 3AODA 1ZTTA 2MLYA 2XYPB 1ZS6A 1UAWA 1WNEA 2KVIA 3ILOA 3MMBB 3PW2A 4F2SA 3T41A 3T9ZA 3UCZP 2UXCF 4FF1A 3QRRA 1CJTB 4XDDA 5ETNA 4EZ6A 1NB7A 2F7VA 2CQGA 2DCLA 3VAIA 2J9EA 3US5A 4DL4A 1WC4A 4HHJA 1KEKA 3E2EA 1YDLA 5I3UB 3IFEA 5EDWA 2BE2A 2HPUA 4KQZA 3UVJB 4WKYA 1N6QB 1X4AA 1KFDA 3HZEA 4ECSA 1AA1B 3NNCA 2OPSB 5B0EA 1Q8BA 3CF5Q 2W8KA 4X4QA 2H5JB 4QWAA 1XNRJ 4MH8A 2H1YA 3KK1B 3GYGA 2FVSA 1FKAF 3UN5A 1KTQA 1SUQB 4XAKA 4L74A 2W24A 3C16B 5HN0A 2WOMB 3I31A 1XERA 3JSYA 3DNCA 2MZJA 2V69A 4OHZA 1PYOB 1HW9A 3THTA 4RBVA 3CJ0A 2RMLA 4G1QB 4LSLA 4DR4J 2KZMA 4P9SA 3BDPA 3KLIA 1N5YA 4MMOA 2AJ1A 3BM7A 2VB6A 2C3MA 3IWLA 3K58A 5J2PB 4DL3A 2M5YA 2DHXA 2V8VA 1JLEA 3VR1A 2VPXB 1WC0A 2WBRA 1U8WA 4A46A 4I2PA 3M2RB 3MECA 3GP9A 1HI8A 3G71S 1XQIA 2YQ3A 4F4WA 3NMAA 2HFVA 1WC6A 3HHDA 1U49A 4R8UA 3HHLA 3BR9A 4HLBA 3MURP 4Q8FA 3MEEB 2LEPA 5C7PA 2KVQE 3HM9A 3ZTOA 2LQJA 3C14B 3ISZA 5HJXA 2MY7A 5K9FA 1DTTA 1TFYA 2ZNZA 3AOBA 1FEHA 2H48B 3CDEA 2UUBJ 2RRBA 2R7XA 1C0UA 3O6QA 3VGUA 3QGIA 4JUZA 1YITS 4R0EA 3K5OA 5DJBA 3UDVA 4K50A 2X1BA 3CVKA 4HYKA 3MEDA 2MZ1A 3PIOQ 4WP3A 3D2WA 3C6TA 2DNGA 1LXNA 4J5OA 1IR1A 4C6AA 2UUBF 1SQGA 2VPZB 2I9SA 2XO7A 5C2GA 2V34A 1U48A 2KRBA 1PGZA 1NSPA 3PXGa 1S1XA 4K59A 3PO5A 4CLLA 1Q8LA 3IA0A 2MMYA 3BN7A 3OHBA 1B99A 4DSEA 4K4SA 1FVQA 1MROA 3L9ZA 1FI4A 3PR4A 2BOPA 3RBDA 2PE8A 1RLDA 3IWNC 3HXMA 1BY9A 1TP7A 1LK7A 1IBKF 2VU5A 1KLMA 1YRXA 3M1VB 1Z2LA 1KRPA 4PXBA 1SPBP 3MAAA 2ATCB 3PEJA 4FYXB 2JVOA 3KLEA 4CRJA 1JLAA 3VAKA 4WZMA 1RTJA 4QR2A 4Q7AA 1S10A 3OR1B 2JEIA 4TVAB 4OZ3A 3HO1A 2FGOA 2DEIA 2M7SA 3MR3A 1AUDA 2VJUA 1SJQA 4Y00A 1IM4A 5HATA 1U7LA 3P45B 4UZCA 1JLQB 3H25A 2IJFA 4M5JA 3HP6A 1TL3B 2HGNA 2E44A 5L39A 2CQ0A 2BQUA 3CGIA 1UW9A 3I4PA 4WFBQ 3ZNJ1 3CE8A 3B8HA 1Q0NA 5L9NA 4IQMA 5F8IA 4DN0A 3KHLA 1UPPA 3CCRS 5B0CA 1BQNA 3F41A 1AYEA 3T3FA 3QJLA 3UDCA 3G6XA 2YNGB 4LVNP 2OPPB 4DV3J 1FWKA 1HD0A 1AB8A 3BB5A 4FXVA 3E51A 3CJ2A 1HNWJ 3V6HA 4RW4A 3J7Z5 1KWMA 1HLWA 4USIA 4LQ9A 1YIJS 2NXJA 3ZTSA 4OMFG 1RT5B 1MN7A 3F56A 2B5JA 4HDHA 1QAYA 4PG4A 1IKWB 4OJGA 3V4MA 1JJ2R 3KLHB 1A0OB 4O3OA 4I7FA 2F4FA 1JXEA 1C4CA 2CFXA 3KDNA 5JVGQ 1HNWF 2XLKA 2V8GA 3N6LA 1RWMB 4XO0A 5CA5A 4KE5A 3ZFVA 3ENWA 3CDUA 4ZVRB 3PRBA 2ZH5A 3TVYA 2O67A 1FKPA 2PA3A 1Y3JA 2VIHA 2OIHA 3MM6B 4NLYA 1U26A 1DLOB 2E7WA 4U7UK 3V2UC 3BGOP 3DDIA 2POKA 3MPDA 2PEHA 4JI1J 3EGNA 1JLBA 2CVIA 1G1XA 5J1EA 2DNYA 4DUYJ 4C8MA 4AT1B 3TAMA 2M70A 3CO9A 1F2HA 2DO4A 4PXDA 2CJXB 3TW0A 4KV8B 3CPWR 2JVRA 2YNHA 1RBLA 3W8PA 4EFAC 1S57A 1Y5LB 4OYOA 4NLSA 4JI1F 1REGX 2YH1A 4DN9A 3OTEA 4DUYF 1IVZA 3U1NA 5C24A 4FS2A 5J1PA 1VGYA 1YK9A 3GCXP 3M8ZA 4OYWA 3NKYA 4I56A 2KYZA 1Q53A 3CCWA 3QAUA 1TFWA 2RQ4A 2E1AA 3KMSA 2W9BA 5HVGA 4PABA 3BKFA 3Q0AA 1IKXB 4FKYA 5D3GB 2BJ3A 2DRBA 3HVRA 1Y5NB 2IFXA 2V2VA 4G1PA 3EM1A 3P5BP 2LKZA 2BABA 3S1TA 1RJJA 1NHUA 1ZOTA 4NI2A 4O4GA 2RQKA 4F04B 3IWXA 3F44A 5FIIA 2CQIA 4FYWB 1KLNA 1TK8A 4PYAA 1FJEB 2V67A 2RD5C 5MAOA 2CIMA 3KTQA 1OJ4A 2HWHA 3L4BC 5F0WA 4RW6A 1E6VB 2IYIA 1U1LA 3LP2B 4DF4A 3I32A 1KN6A 4CI0B 3U7JA 2R8KA 4YP3A 1S79A 5GAEU 2PSZA 2PFFB 1U6ZA 4TLRA 4EO8A 1K8AT 2DY1A 2XM3A 3GPAA 1LKZA 5HL7Q 2Y8WA 1T11A 2OTJS 3RJMB 1X5PA 5HMZA 1OWXA 2Z8QA 2XB2D 3D54A 4H4MB 1YQHA 2OHDA 3B4DA 5IT0A 2RILA 2HHPA 1HBMA 2ZM6J 1RT4A 2EC2A 3NS7B 1V6HA 4K7QA 4OL8A 3D0HE 3BF4A 4KFBB 3T5KA 3D4JA 1V5IB 3ZZOA 4QYZJ 3V6DB 2GS8A 5F9NA 1S7IA 1PIEA 1KQKA 4EBDA 1RT1B 3BZQA 3ISND 4YB6A 2ROPA 2KYXA 1JLGA 2DT9A 2KZZA 3UO0A 3EVOA 3FK4A 3KLIB 1HQEA 2QL9B 1F5BA 5HLFB 2GCFA 4G6VB 4QWBA 2ZM6F 5A6PA 2ROEA 1FO1A 2J5AA 2DJWA 3DLKA 1JLEB 5KFEA 1NDCA 2LVWA 1H98A 4TNOA 4ZN3A 1OPIA 2YX4A 2QLWA 3R3TA 1HARA 2CJAA 4YMEA 3J7YU 1JKHA 3ETOA 2M52A 2VUGA 4BHQA 4E98A 1P27B 3N6NA 2IPOB 3TEHB 2ZC4A 2O1PA 3Q2TC 1DTTB 2ZC3A 2NPFA 4QOTA 1Q4RA 4OI1A 1U2CA 4P2SA 5HMYA 1T3OA 1U8SA 4X64J 1FNXH 2CRLA 4KO0A 4UQTA 2V4RA 5KOWA 1M5PC 1GK8A 4P73A 1KHWA 2KG1A 1M0SA 2BE9B 1VRUA 2Z2MA 4YQWA 4ECXA 1CJVB 2JL9A 5G0RA 4USMA 4DUZJ 4A8WA 3W60A 1XR5A 5C25B 4USHA 3D68A 4X64F 3O5TB 2ZHAA 1NHVA 3FCHA 1LOUA 5JXSA 2I8EA 5KT5A 1FDNA 3HT0A 4K5RA 3EDRB 3OD2A 1ZPWX 5LM7E 4KJIA 1KNZA 1MLAA 2BM1A 3FSYA 2C2MB 2Y3YA 2PMWA 3QGGA 3LAMA 2DNNA 5CZXA 3BH6B 4DPXA 1YHQS 4DUZF 3OXFA 5EN1A 5DDPC 4E8UA 3UD4P 2EW9A 4CO3A 4KTQA 5D8HB 5KG3A 5K8PA 1KLMB 2OD4A 2N3OA 1VC0A 1HNVA 2LP4A 1SI9A 2MJUA 3L3CA 3H59A 5GADI 3ZTQA 3NLCA 2AGQA 3SMZA 1RAHB 3MR6A 4ED1A 2DNRA 1RTDA 3FEYB 2VD3A 1HHTP 2IBOA 1N88A 3PG9A 1ULRA 2ZEJA 3H8YA 3GIJA 3MZIA 2BDPA 3VGSA 1RTHA 3U27A 4RO0A 4TY8B 2HFUA 2EKNA 2KHDA 2QL7B 2DNMA 1RAJA 1TVRA 2YXLA 3HD1A 2E7XA 4K4TA 3LO3A 3R8YA 3SCJE 4L3NA 1Q7LB 3TZZA 4DR3J 2YKQA 2B4VA 2KB2A 2OH2A 2WB4A 3QZ8A 1R8PA 3UR3C 1F9FA 1WTFA 2G2OA 5DG7A 4ZHRA 1Q1KA 5BYQA 4LMZA 5FJ4A 1HQUA 2LCWA 3BKTA 3V4IA 4C9DA 4F4KA 2UXBJ 1NSKL 5ETTA 2J9CA 2CNOB 3RYLA 3J7A1 1R0BG 3Q8RB 1VDHA 2ZH8A 5THWA 4RNNA 1FXRA 1DHMA 2XY7A 3I0RA 5KT2A 2UXBF 3MEGA 4PG5A 3QJPA 2XMUA 3CIZA 1HNXJ 3W64A 4WE1B 4ILLA 3MUMP 2CPFA 2KXHA 3A3NB 4C8LA 1IBLJ 4JI8J 2WTFA 2VDHA 2V4QA 1AROP 4FF3A 4KGMA 3HHEA 4L6V3 5LL6d 4NL5A 2PD1A 2AV5A 1W26A 2LU2A 5HVHA 3PEHA 5T7LB 4H4KA 2F4VJ 4NLWA 1HPZB 4ZK7M 3R1HA 3L09A 1HNXF 1JIHA 3B4MA 2C3UA 1IBLF 4JI8F 3U1LA 2HFOA 4EK2A 1QJHA 1RLCL 2IJNA 1DJ0A 5J2NA 1XTZA 2LEAA 1V9OA 3DOMB 2BJDA 1UJ5A 2GO8A 4OV1A 4P71A 1HI0P 1PILA 4UOFA 1SJ1A 1ZZNA 4K2XA 2C2EA 2F4VF 4LSZB 2MKIA 1RA6A 4OI6A 3D1QA 2H9ZA 3LWMA 1P8GA 5HROA 3NGKA 3BO4A 3DOLB 2W7AA 1OSCA 5FDLA 5LXYA 3HKZD 3LA0A 1VLYA 4J9RA 3MM5B 1R0CB 2J0WA 1K1SA 4Z7YA 1HYSB 3M2VA 2GV1A 2MQPA 1S59A 2IJRA 3PJWA 3UDLA 4QIFA 4ZITA 1WSRA 2AT1B 3W66A 4AL6A 4IR1A 3DLBA 4LRBA 2YBVA 3H2LA 1GTEA 7FD1A 3NMRA 1F9EB 4NZ6A 3AD9C 4I64A 3I55S 3UD5A 4M5KA 4ILRA 4NCGB 2XI2A 3RU0A 1VIXA 3W2VA 2Z2LA 5HP1A 1NJXA 3GV7B 2D41A 2AP6A 4DBQA 3NP5A 1SV5B 2DITA 4ZVPB 5GAEI 3PYGA 2EK6A 3J80U 2E9ZA 3Q83A 3Q8SB 4WP9A 1FHTA 4DZ6A 2RKIA 5GMEA 4NI2B 2CPJA 4LR9A 2XGQA 2AIRB 2W2NP 1XR7A 2H5EA 4RZRA 2UZAA 1BC6A 1YRUA 2XY5A 2NSCA 2CG8A 4QWEA 3GU0A 2R2TA 3HI9A 1NH8A 4ZPWR 4O3RA 3RBXA 2DR7A 2HWTA 1H74A 3TO8A 4A4JA 3MM9A 4MK8A 4TU8A 3CNQP 2A2CA 4U8VA 3VZHA 3DLJA 3BO2A 2IMOA 3W5YA 2HHTA 2J9DE 4KAIA 1S1VB 3A8IA 4OZ2A 1GTHA 2DGOA 4RW8A 4AD6A 3DDKA 5IC6B 5I42B 2DKOB 4OYXA 4ZS6A 5F0UA 2CPIA 1FJCA 3QT8A 5CYQB 5IT9U 2BQRA 4EUVA 4TQRA 4DPUA 2CQ2A 1HBUA 1BE4A 3D1HA 3T1YJ 2ZOMA 1YJ7A 2YKPA 1HBMB 3TZYA 4GC6A 4MKYA 2UXDJ 2MQLA 3D0IE 2W7PA 3HX9A 2R3VA 3QNWB 2E9TA 1UEUA 1YLXA 2FVRA 3NGUA 1X7VA 3J81Y 3BREA 4WXWA 1JLGB 2MZTA 2N7CA 2DXDA 1IM6A 3T1YF 2HIYA 3CDBA 3IS9B 3HSJA 4LSNA 3NNHA 5F3ZA 4X2BA 2ZBCA 3HJFA 2UXDF 2V5HG 4DFKA 1PCAA 3DMJB 2JZ5A 3IAS9 1SC3B 1N54B 2C22A 5CHCB 2V94A 1OIAA 3HHKA 2Y1IA 3BGRA 4IG0B 2XCPA 4DV5J 1X5OA 2B43A 2EPIA 2MTLA 4ZCKA 5LJ3Y 2ZOFA 1EETB 3Q2SC 4UF4A 3CJ4A 3R6LB 2B9WA 3IG1A 1H2VZ 2BJ9A 1RWVB 2FTRA 3QIPA 3SCKE 2D3ZA 4C97A 3A3PB 5F8LA 2XC9A 1M5OC 1JX4A 4DV5F 4KKOB 4AXJA 4X4TA 1SJFA 4KO0B 2GJFA 2XS2A 1NBEB 2LFVA 1X4GA 3T9NA 4J9UE 1X9WA 1X0PA 2NREA 4OYZA 3NXZA 5E3PA 5G0RB 5DETA 4HACB 4K4YA 2Z57B 5EGYA 2R42A 3AJ2A 5DQGA 2AW0A 4CO0A 3UQSA 3GJRB 2CADA 5M2PA 3CXCR 4DX7A 1VJWA 2F65A 1HBOB 3LANA 3GJQB 1UETA 3W9JA 4FBUA 2CQ1A 3H90A 2LQ5A 2ALYB 4ED3A 4TXSA 4OI3A 1SJ4P 2MQNA 2DRDA 1D9AA 1NDPA 2G0CA 2P9GA 4JV2A 3KNGA 2NXEA 3K89A 1ZAWA 4QPXA 1WSVA 1HNVB 2MXYA 1QUVA 2F5GA 1NLKL 2YWWA 2J8SA 3KNAA 3BH7B 2DCUB 1R8HA 3I5CA 2AEJA 3JAMY 5CYMB 1X0FA 2GC8A 3H42A 4B3OA 2OSRA 3OJUA 4IOBA 1WG1A 4QR1A 3JSMB 4DQPA 3BKUA 1U0SA 4C8KA 1K0TA 3D6TB 4IG3A 4M8LA 3CCSS 2MKKA 3CT9A 5HVFA 2OEMA 3MCSA 4M63A 3GFZA 3FEXB 3OTBA 1BWVA 2G0JA 3SQOP 2J0SD 2BYCA 3PDNA 3ELHA 2MLZA 3P8BB 1WG5A 3VVUA 5KG0A 2DBBA 4IH6A 5IV3A 1TKZA 3LGNA 1S1UA 1FX4A 4R0JA 1VQSA 1KFSA 3NWRA 2HHHJ 2C2OB 2R2SA 3ULHA 2V9WA 5J2QB 2J6UA 2MKYA 1DRZA 3QAEA 4PEOA 1PAEX 5LSLA 3GONA 1FNOA 2C1EB 2BXJA 3N5FA 2IHR1 5B0BA 4ECWA 4ZVFA 1T9WA 4FP9A 1SH0A 1NNDA 1JLFA 4KY3A 2Q79A 4H4KC 3M32B 2Z2ZA 4YUDA 2HHHF 4ZVGA 4EBEA 3MM7A 4PXCA 3U1MA 3RB0A 3MEGB 4GC7A 4DI6A 3OXLA 1WF0A 2ZUGA 4C3MA 3AH6A 2R7QA 3PM9A 2B7CB 3T5LA 3ZTRA 4CLSA 2Q66A 4WKRA 1UWAA 1QVFR 4DQQA 2CUYA 1VYAA 1F5CA 4ZVSB 5L8RC 1JMTA 2IAJA 3ADAC 4P52A 3JB9k 3CWJA 3T5HA 2NCKL 1X4FA 2AEFA 3GLJA 1SL1A 3CCZA 3I5AA 4C11A 3EXCX 5ADZA 3MD1A 3DDNA 5HI7A 3Q24A 3RW7A 5BYSA 2HGMA 3RB4A 2CPDA 5BR8J 1RAGB 2AU0A 1Y0HA 2IRUA 3MEKA 3RAQA 3O1LA 3DYAB 4HHHA 4ED4A 2J7UA 3UI3A 1N48A 2YKMB 4N5SA 3OVSA 1FWLA 2BX6A 2N82B 5CYJA 3UD3P 3CJ8A 1OY9A 2GIRA 2LYVA 4F67A 4X65J 5BR8F 4MKBA 2EKYA 4JOUA 3VAHA 4R5PB 2K1RA 2PMHA 4BDPA 1E6YB 1QLNA 2AYGA 2PI5A 4DV4F 5IS2A 5E3RA 4FF2A 2XHCA 3M2VB 1M5VC 3M6WA 4AQYJ 4HI2A 2ALZA 1CULA 3GG0A 3GIRA 2IM0A 4V19X 2OD6A 4X65F 1IWGA 2L3MA 4HDGA 2KU7A 4N8OA 4L76A 4KIAA 2DH9A 3OSNA 2XO6A 2HNYA 4TKTA 4AQYF 4TQSA 2MGZB 3W2VB 3PJXA 2K7JA 4GO7X 1X4EA 2P6TA 1FA0A 3IAM9 3LPEA 4CQ1A 4QW9A 3SCLE 4J9QA 4BC9A 4WYLA 1OQ6A 1T9XA 2K3KA 3D6MB 4LIWA 2GHPA 3ETMA 3D3CJ 2BANA 2VG6B 5D77A 2HVIA 2RKIB 4RR5A 5LXRA 3Q8VA 4Q45A 2K7KA 4ZPAA 5ETPA 1MW7A 4ELTA 4WTOB 2YWEA 3DLGA 1NO8A 2NXCA 3BN4A 2XMKA 3KUEA 3M30A 3HCXA 3H40A 2HS3A 4Y28C 3OT9A 3P96A 2ADCA 1QAIA 2VZ9A 4FPRA 3PYFA 1N34J 2YWKA 2H54B 3TP2A 3DRPA 4DX8H 4ECYA 1PSDA 3OQ2A 2FJBB 4LBHA 1S6UA 2IRYA 4J90A 3FEZA 3G82B 1MMDA 2LDIA 3EGVA 3DOKA 1TL7A 3S7RA 3TARA 1M1GA 2YTCA 3EVMA 2ZDPA 3EX7B 1J27A 2RDDA 4HH0A 3KG0A 4O4RA 3TUPA 1N34F 3E01B 5JUMA 1TR0A 3KLFA 3LP1B 4NX9A 1VIOA 4ZVEA 3M6UA 3MGJA 5M2UA 3GZ7A 2BEFA 2HBZB 3TVZA 4B9VA 1HNIA 3AQOA 1R8CA 2BOAA 2VPYB 2CG4A 4WFXA 3BBBA 4NXMJ 3SCIE 1VQ7S 3C6UA 4QW8A 3MMCA 3BBCA 2AYMA 2Y0BB 2G1DA 4LJMA 4DSJA 4EU0A 5SUHA 1IKYA 2HEKA 1U09A 1TL1B 3FFIB 3EPGA 2XHWA 2WK4A 1FJGJ 1VQKS 3VAJA 3MPYA 4NXMF 2FJXA 1HD1A 4Z2XA 2OP5A 2VA2A 2HRTA 3HVTB 2AZ1A 2W9CB 2BJEA 5LMUF 1PKUA 2FY1A 1SKRA 2ZH9A 4ECQA 1R0AB 1VBZA 3EPIA 3TI0A 1ZZFA 5DM6Q 1TV6B 2ZE2B 1LW0A 2GHWA 1FJGF 5FD1A 4FXDA 1CC8A 3K59A 5ETSA 4CDIA 1T03B 5A8KB 1EIYB 1SIWB 2M9KA 1UJ6A 1V3ZA 4OZ5A 2QSWA 2DK2A 3H0PA 2R7VA 4E2FB 3VTIA 3FNNA 4M5MA 5L9XA 1P9QC 4DXLA 2FHJD 2EXUA 1FRXA 2QMUB 2LXIA 5ETVA 2E5LJ 2MLXA 2ZH3A 2DGXA 1KHVA 4DSFA 3SV4A 1RWNB 2XZTB 4MAKA 5F8GA 3TJ8A 2OLWA 4N8NA 3P3DA 1T05B 5AJ3J 4HL9A 2FJEB 5L1LA 1ZTWA 3AB2B 4LREA 1S72S 2AEMA 3N4WA 2GAGC 1PJ7A 4S0MA 3TR5A 1S99A 1XMBA 3OBIA 2E5LF 1BHNA 1RT6B 2C2DA 1S6QA 3QIDA 4ECZA 4LF2A 1LXJA 4D3GA 1O6XA 5AJ3F 5H9FK 5J1NA 4X4OA 2DVIA 1EP4B 3EMTA 4M5IA 1CQNA 1WOSA 5DO2A 2G4BA 3MMAB 2R7WA 3A8KA 5E33A 2FJVA 1F1BB 3JQJA 4I67A 4ICLB 5E5NA 1S6PA 2V50A 4ZJLA 4ZN1A 4URQU 3OFFA 2NUHA 5BYRA 3M2UB 4RNMA 4HHUA 2VH7A 2OFHX 5GVQA 4F50A 3DHXA 2MQOA 3DGVA 2HQCA 4C8ZA 3HPOA 4JI3J 2FZCB 1IXKA 1W7WA 3P5TL 1QSSA 2JEFA 1KQSR 4ZMMA 2UP1A 4TU9A 1TKTB 2FC9A 5IOLA 3CB4A 3K5MA 2AMCB 2WVBA 3A3OB 1FFSB 5E3QA 3KJVA 2LQBA 2OJ3A 1X9SA 2V4JA 2V8PA 4ID5B 1ZETA 1KOHA 1VQ6S 4JI3F 2E5HA 1QUPA 5HAOA 4KHPF 4WCEQ 1RWUA 3DXBA 1S1UB 5CD4A 4OX7A 3THPA 5D78A 4PRFA 2V2QA 3W5ZA 2GGPB 5A8RB 3VWSA 2DISA 1QAJA 1KVJA 1N5SA 3MFHA 3MOZA 3QWUA 4URGA 3DRRA 1RT7B 1Q7YT 4WWSA 4JV0A 1WUUA 4OYBA 2QIFA 2FZGB 1U0HB 2M8HA 2EEYA 2CWKA 3DFEA 2OPRB 4DR5J 1K73T 4IRKA 4O3SA 2V68A 3BSNA 3O44A 2XCAA 3OUYA 4DLEA 4LIRA 2FYXA 4DCJB 2AZ3A 2BKOA 3ET6B 1QAXA 4LUBA 5DDRC 2D74B 4ZOSA 3DM2B 3BSOA 3H20A 3MAQA 4CTAB 4IDKA 2CQBA 3QWPA 5CABA 4DR5F 1RHUB 1WOOA 2Y0SD 3CJ5A 4KC5A 4LF5J 1VQLS 4NEZA 4C11B 3BPSP 3TZXA 1FD8A 3ZZUA 3M8QB 2W4PA 3T19A 1GEHA 4IFVB 2KFZA 2WVEA 4UQGA 5EX3A 2YWGA 2Q6BA 4WTYA 2QE5A 2J76E 1FESA 4ANEA 3A12A 1TZ0A 4LF5F 4LQ3A 1N5TA 4I6YA 1GX6A 1FRIA 2BJ8A 3VGVA 2MHNA 1YX2A 1KDNA 3OL8A 2ZH7A 5E3CA 2EBEA 4C0BA 1WKKA 1J5OA 3AY0A 2MDAA 2DTJA 1D09B 3BSCA 1TKXB 1XWLA 1CJUA 1TL4A 3TA0A 1T9YA 3AFGA 3CJKB 3J7AN 4PWDA 1BXNA 3N01A 2WRMA 3R5DA 4F0MA 5CZVA 2DGTA 4KB7A 1S9EA 5U47A 1JLCB 1Y7PA 4X4NA 1IJFB 2QA1A 3JYTA 2FPHX 2GJ2A 3M8PB 4ELUA 2EFVA 4DCOB 3K5NA 4I2QB 4L75A 3W2WB 4FYYB 1G6BA 3LALA 2CPXA 3IR6B 1ZBTA 1CS4A 3POTB 1VK3A 1WWHA 4J9MA 1WI8A 2B0GA 3CC4S 3CDAA 1AZSB 3I9ZA 1KC8T 3R2CJ 1X5TA 2RUSA 1MWZA 2E1CA 3K2YA 4O44A 1IKVA 4MK9A 1FTRA 2BW2A 2YNIB 2YH0A 1X4BA 3MUTP 1S49A 3KLGA 2BJ7A 3IR7B 2E1RA 4Y6IA 2DHSA 2XWXA 3R9LA 2ILYA 2KJWA 1U2FA 5B0DA 4LBIA 2JWNA 1VQ4S 3CCES 2QA4S 1S9GA 1OY6A 4MFBA 4ILMA 3D6FB 1U1MA 2HNDB 4CM2A 2DGSA 2RNEA 3FMBA 1K1QA 4OHXA 1KVKA 3KXDA 3TX8A 3BGUA 1Y11A 2RDIA 5DZ7A 1UWBB 2XQCA 1RT2B 1I1GA 3DOKB 3LQVA 4QWDA 3T1AA 1AFIA 4NASA 4QZVB 2WSEC 3DRSB 2A18A 2QT7A 1UW4A 5F41A 3KLFB 2M0GB 4QU7A 4GVBB 3GFHA 1FWPA 2K06A 2X1AA 5EWEA 4DX6A 1W2IA 2FHOB 1B70B 1HNIB 3BJYA 2Q3PA 4NYPA 1VC6A 1CJKB 4OZJA 5DQIA 3R27A 1VRQC 2GHVC 3Q22A 2QC3A 1W2BR 2AJFE 2YX1A 1WOPA 1S76D 6AT1B 1XK8A 3QZ7A 3KK2A 3D66A 2WBMA 4LBPA 2IY5B 4RW7B 2IIHA 4CO2A 2YKNB 2ZH6A 1APSA 2IVFB 3SQGA 5C42A 3DI6A 4PUOA 1GX5A 4JI6J 5KFNA 4Y2CA 4QBUA 5K14A 2A6MA 4C2MA 3HVAA 1F60B 2CPHA 3QBCA 1Q79A 1LW2A 1EARA 4KRWA 2LA4A 4YB5A 1TU0B 1PYTA 4AE5A 2ASJA 1GAOA 1UEVA 4JI6F 3PJ9A 4YEAA 2Z56B 3M9NB 5CXTA 3NAHA 4FVCA 2OPQB 1DY3A 1UVNA 2EC0A 1RQ0A 5KFTA 1UP1A 5A76A 2X51A 2NYHA 3IM8A 5LOQA 1UL3A 4Y2KA 3LUYA 3CMQA 3D9BA 4Y0FA 3NNAA 1V5VA 2KT3A 2QYCA 2P5VA 1VBYA 1BD6A 2RDJA 1XMOF 3VAFA 2GVDB 4DG1A 4RUCA 2GVZB 3NBPB 5D0HA 2YVSA 2Q43A 1YZ6A 1T9UA 4DL6A 1F3VA 1TMJA 2ZZTA 4ZPVR 2O01C 2BE7D 3I96A 2V2ZA 3BSAA 4BC7A 2FLOA 4RW9A 3TA2A 1UKUA 4PCQA 2DXEA 2XSJA 3FUYA 3AXMA 4JYAJ 3HJVA 1B7FA 2MKCA 1CPZA 4JP8A 4LVOP 3ONQA 4OQJA 4J9SA 2QMXA 4LT6A 4IFYA 2HFZA 1JXVA 1AT1B 3C46A 4IO1A 3AB4B 1F3FA 1PJ5A 1UFKA 1UZDA 5F8JA 3MDFA 2LECA 2B6AA 3EDQB 1TK5A 4JYAF 1FVSA 4Q5VA 3SIPB 3I0SA 3W61A 4P2FA 3ZZYA 2HYIB 4OZNA 4A8YA 4F4ZA 1AUSL 2A0FB 4IO9Q 2F9DA 1FRKA 2VF3A 1WHVA 2B56A 1IN0A 2DY9A 2ZDOA 4I1TA 1LWCB 3TJAA 4MYUA 4YDDB 2V4JB 4RX6A 4WFNQ 1RK8A 5H9EJ 1VRTA 4WIIA 2A10A 4O3NA 2BV3A 2IVYA 1GXUA 5B0AA 2CXEA 1QE1A 1HBNB 1FKOB 3GSDA 1PYSB 2I5JA 5F3TA 1PC4A 5IM0A 4Z37A 2DGQA 3G87A 1XNRF 2ZBQA 3KG4A 3OLAA 3SDEB 3OL7A 4WBFA 3RAXA 2E66A 4EMDA 1HL6A 1R6YA 4U8YA 1MWYA 3BYRA 4MKAA 3OXGA 4Q44A 1G4CA 3BBFA 1XN9A 2RH3A 4Q0BB 5I4MA 4EBCA 4WF9Q 2RF2B 2ZH1A 2G0IA 4DR4F 1UTAA 2X7IA 4Q2MA 4NLQA 2RAQA 2QTWA 3CUNA 1FK9A 1RAAB 2L9WA 3KKFA 1OY8A 4LR7A 1WORA 1RSCA 5ETOA 3TANA 3PX0A 2PA8D 4IDKB 1NSQA 1JJCB 2GQCA 2VG7B 3VAMA 2J0QD 4HVZA 2OGUA 5ITHA 4PQUB 2AX0A 3V81A 1X4DA 1LFPA 3MR2A 4IOCQ 3UE2A 4YOEA 5E0OA 1UEKA 3OR2A 3LAKA 5KFCA 4PAAA 2DGVA 4Y3CA 4EYHB 1HFEL 1N4LA 4ZLJA 4F4AA 1JJ4A 2YNFB 3OLBA 1MN9A 2ZH4A 2BZ2A 3DGPA 2R4FA 5DM7Q 2ZVSA 2HVDA 2W4CA 1RB0A 3OHAA 1REVA 1HWJA 1RABB 1FE4A 4MT1A 3M9OB 2AQ4A 1DQAA 4KGZB 5ETRA 1HA1A 1GMWD 2F8MA 5GAGU 1RXOB 2MZSA 2V0NA 1MMLA 5EUHA 1SL0A 1U1RA 4C8OA 3R5GA 4GRSA 1WKJA 2Z0GA 1C1BA 1Q16B 2XYGB 2WZ1A 1YGYA 4N7TA 2ZITA 1FDAA 2FJAB 3PKYA 1QTNB 2KFYA 2HG4A 1FF2A 3PYEA 3C15A 3TUZC 2AD9A 1S0VA 1YJ9S 4P7TA 3CCVS 4RU2A 3OFHA 2HGLA 2XGPA 2HQIA 2BKPA 2QLBB 1Q8IA 2QZ8A 2EFGA 4I6AA 2OEKA 2FC8A 4JI5J 3I82A 4OI0A 1RTIA 4NLPA 2SXLA 3C3LA 4UTGA 3OFEA 1NZ8A 2DR6A 3TUJC 3AA9A 4M94A 1PBAA 3VVTA 2MJNA 1NPKA 3LGMA 4V1Ak 2RS8A 4M5DA 1X8DA 4LR8A 2X1GA 4JI5F 3QLHB 1H7WA 4O23A 1S9GB 1P1TA 2LXUA 3NCRA 2N3LA 4DDFA 2CDQA 1KS2A 1WI6A 3HFKA 2ZFHA 4NXNJ 3J81U 1LNQA 2VG5A 1WHXA 1BLUA 1MNEA 2VQFJ 4RJVA 4OI2A 2PFDA 4ED0A 3JTOA 3KHGA 1O51A 4JV1A 2IM3A 4DPWA 4RNOA 4WK3A 1UJ4A 3PW5A 4W90B 3G86A 4EZ9A 3HVWA 4PPDA 2DNOA 3K7RA 5J2MB 4PG7A 5A6WA 3R97A 3MI7X 5HMWA 1KD1T 1QVGR 1NJZA 1R6VA 2VQFF 2W25A 4DV3F 4ID8A 1S77D 3T6JA 2CDRB 8ATCB 4RKUC 3CD5A 1V3RA 2BKNA 1T9TA 2Y9HA 3LP0B 3QO9A 1BQMA 1IR2A 4C98A 1H7XA 4ZVOB 5DRKA 3MM8B 1XC9A 3IRXB 1S1TB 4B9LA 1KP6A 4X4VA 3KJFB 3MCOA 3FZBA 3ZC4A 2MB0B 1FE0A 1CJTA 1B4SA 1MU2B 4IUFA 3TWZA 3PTWA 1LWEB 1LW2B 5KG4A 4UUXA 3MHYA 1O5JA 4CP5A 4P74A 5I3UA 2CQHA 1R8BA 2C3OA 1GH8A 4J9NA 4ALZA 2KTQA 3UVJA 1N6QA 2OPSA 4H4OB 4MYTA 2BVZA 2EFQA 1BWEA 2EG1A 1PAUB 3KK1A 1OS5A 3GV5B 1UMJA 3AJDA 4F36A 4J9PA 2KKHA 1NK8A 4B9SA 5KG6A 3C16A 1T8EA 2WOMA 3G9CA 3R2DJ 3PHTA 1FDBA 4O3PA 2UVRA 4ZCLA 4DG1B 2JLEA 4G1QA 4DV0J 2FB0A 1HW8A 1HIYA 3R7BB 1L3SA 3OL9A 2F3JA 4CT9A 2M88A 3N79A 4EWTA 4Y2IA 5J2PA 5IT9Y 2DPIA 2EK1A 2AHOB 2IBKA 1XIQA 4CLYA 3PW0A 1GQEA 3MR7A 3JAMU 5L46A 1NJYA 5A0YB 2QA4G 4XPEA 3M2RA 2IMWP 3SI8A 4DV0F 2XSJB 5DS7A 2IC3B 3ZXWA 2WSCC 4P72A 2F40A 4O3QA 3WX4A 4Z7CA 3PX4A 3K8VA 3BDEA 2CJQA 3MEEA 2D3OR 1ZH5A 1NDKA 3RUBL
chains in the Genus database with same CATH topology
4N5SA 2CQCA 5HN0A 2WOMB 4IYQA 2MGZA 3AHPA 3I31A 4B08A 2L9NA 3OVSA 1XERA 3JSYA 5IQ6A 3SSSA 3DNCA 5B7WA 2MZJA 2N82B 5CYJA 3UD3P 1Z1ZA 4OHZA 2LYVA 2GIRA 1HW9A 3THTA 4RBVA 3UCUP 4F67A 4PQAA 3CJ0A 2RMLA 5KFUA 5A8WA 4IQXA 1Z2ZA 2K2PA 4PR6A 2B6AB 3GQCA 5H1SV 4G1QB 5BR8F 4LSLA 2KZMA 4MKBA 2EKYA 3BDPA 3KLIA 2IA0A 4JOUA 1S1WB 2K8GA 3O8WA 3VAHA 4R5PB 2K1RA 2PMHA 4MMOA 2AJ1A 1JB0C 1N5YA 4BDPA 1WEYA 3BM7A 2VB6A 1E6YB 1SKSA 1QLNA 1LWFA 2AYGA 2PI5A 1DAXA 1GNKA 4DV4F 2IAJB 5E3RA 5IS2A 2VG6A 2Y1RI 5D4OA 2J6SA 4FF2A 4DV2F 2HZCA 2WONA 1WELA 2C3MA 3IWLA 5J2PB 3K58A 4MIAA 2RUGA 3M2VB 4OHYA 1IBMF 4DL3A 2M5YA 1M5VC 3M6WA 4HI2A 3DRXA 4DS4A 2DHXA 1QSYA 1LV5A 2V8VA 1CC7A 1JLEA 3VR1A 2ALZA 1SJ3P 2BE2B 1FT8A 3GG0A 2VPXB 4DHVA 1N36F 2IM0A 2WBRA 4V19X 2OD6A 5EWGA 2P9CA 4DSKA 3MD3A 4X65F 5IFMA 2L3MA 4A46A 4ECRA 4I2PA 3M2RB 3MECA 4HDGA 3G71S 1HI8A 2KU7A 4N8OA 4WU3A 5L1KA 3RTVA 2BRKA 2YQ3A 4DF8A 2ERRA 2EVZA 4DLGA 1HI1A 4UOCA 2X3GA 3KK3B 4F4WA 3NMAA 2DIVA 1XNQF 4KIAA 5E7OB 5HBMB 2MQQA 2NPIA 3S01A 2DH9A 3HHDA 1M5HA 5KFRA 3OSNA 1U49A 4R8UA 3HHLA 3BR9A 4HLBA 3SXLA 1VRTB 3MURP 4Q8FA 2XLIA 2RIJA 3MEEB 4F4XA 2HNYA 4GO5X 1YTYA 1C2PA 4LFAF 4TKTA 1S48A 1RI7A 4PG6A 4EEYA 2LEPA 3HM9A 4AQYF 4OJ3A 1KSPA 2LQJA 3ISZA 5KT3A 4TQSA 2MGZB 2UUCF 2MY7A 4C3KA 1UFLA 5K9FA 1R89A 1JWWA 1DTTA 3W2VB 3PJXA 2K7JA 2E29A 2UU9F 1TFYA 1XR6A 4GO7X 2ZNZA 1X4EA 2P6TA 1FA0A 1FEHA 3CDEA 3IAM9 1X9MA 4CQ1A 5KG5A 3HHLC 2L48A 2RRBA 4QW9A 1SQEA 1VOMA 2N7YA 3SCLE 3UFCX 3MR5A 1C0UA 2BACA 3CJ3A 3GYXB 3O6QA 4BC9A 4J9QA 4WYLA 1OQ6A 4LSLB 2MQMA 3KHRA 3RRKA 3QGIA 4JUZA 2K3KA 1N5YB 2K1RB 1YITS 4R0EA 4LIWA 2GHPA 3E01A 4QIEA 3I9V9 3K5OA 5DJBA 2QMWA 4K50A 2BANA 2VG6B 2X1BA 5D77A 3LP1A 2HVIA 4QU6A 1HWLA 2RKIB 3M1VA 5LXRA 3CVKA 2W4DA 3HF5A 4Y2MA 3S6EA 4HYKA 4Q45A 3MEDA 2K7KA 4ZPAA 1MW7A 2MZ1A 3PIOQ 4ELTA 5DQHA 3D2WA 3C6TA 2DNGA 1LXNA 2J8AA 2YWEA 4J5OA 1CSJA 4KT0C 3DLGA 4QYRA 1J5EF 1NO8A 4KHRA 3I6PA 4HI1A 5K5MA 6FDRA 2UUBF 2VPZB 3BN4A 3H2VE 2I9SA 2XO7A 2XMKA 1ZAXA 2JX2A 3M30A 4I2PB 3H40A 3NG8A 2HS3A 3PO4A 4Y28C 3MECB 2LU1A 3OR1A 2KRBA 3P96A 4CO4A 3CCLS 4GMKA 2ADCA 1U48A 2XLJA 1PGZA 3PXGa 3IRWP 1QAIA 2VZ9A 2PI4A 4X62F 4FPRA 4ES1A 2NXUA 3DCAA 4R8UB 1FK9B 1S1XA 3HHLB 4K59A 3PO5A 5MLCV 2YWKA 4KSEB 5DG9A 1Q8LA 4ZPDA 1FRJA 2HNYB 3IA0A 3TP2A 3DRPA 1Z4UA 1DZ5A 4DX8H 2MMYA 1WHYA 2VFRA 4ECYA 3BN7A 4XK8C 1PSDA 4C0OC 3OQ2A 4HH1A 1DTQB 2FJBB 3MAHA 3OHBA 1S6UA 2IRYA 4DSEA 4DPOA 4LF7F 3FEZA 2KO1A 2QRRA 1TL1A 3FFIA 1FXLA 1DARA 3MOJB 1MMDA 2MYFA 2LDIA 1U1NA 2MHEA 1R7IA 3DOKA 4K4SA 1JLQA 2R7RA 1FVQA 1MROA 2ZD1A 3S7RA 2YTCA 3TARA 3BQ2A 2ZDPA 1XEZA 4QJVA 1C0UB 3EX7B 4NWBA 4DJBA 3PR4A 2BOPA 1TL3A 2DR9A 4B9UA 2FLNA 4BWMA 3RBDA 4HH0A 2PE8A 4F4YA 4GKJF 3KG0A 3IWNC 4O4RA 3HXMA 1BY9A 1TP7A 5IWAF 3HVTA 5SZTA 1LK7A 1N34F 1IBKF 3E01B 5JUMA 2W9CA 1HWIA 1KTVA 2RS2A 1TR0A 1KLMA 3KLFA 2BANB 3LP1B 1YRXA 4NX9A 3MUVP 5DLGA 3BGFA 4K4ZA 3M1VB 1VIOA 1Z2LA 1IUJA 4ZVEA 1R0AA 1KRPA 4PXBA 3M6UA 3MGJA 5I3PA 3SZ2A 3PEJA 1U24A 2JVOA 2O66A 3MEDB 4ZPCA 3H5UA 5M2UA 2FLPA 3GZ7A 4V19J 3CULA 2XMTA 3C6TB 2AJ4A 1TV6A 2MZRA 4QQBA 2ZE2A 2EBGA 1TL5A 4FVMA 3DLGB 3TVZA 4B9VA 3RR8A 3KLEA 4FNHA 1HNIA 1JLAA 3BS9A 3VAKA 4WZMA 1JK9B 3AQOA 1RTJA 1R8CA 4QR2A 2BRLA 4Q7AA 1S10A 4CNZA 3M30B 4ZLPA 2VPYB 2CG4A 4WFXA 2KI2A 2HMIA 2UUWA 3OR1B 1T03A 5A8KA 2JEIA 3SCIE 1VQ7S 2ZNYA 4KGKA 3C6UA 3HO1A 2ZHBA 2FGOA 4QW8A 4HKQA 3HK2A 3MMCA 2WHOA 5HMXA 2M7SA 3MR3A 1AUDA 1S1XB 2AYMA 1RP5A 2MSTA 1SJQA 5KFKA 2G1DA 1LQ9A 3H5XA 4Y00A 2EFOA 3DRPB 3VZIA 1IM4A 4A8QA 1U7LA 3LPYA 2OPPA 4LJMA 1M1KT 4DSJA 1VC5A 4EU0A 4B9TA 5SUHA 1IKYA 3M4XA 1U09A 1TL1B 3FFIB 3EPGA 2XHWA 1HWUA 2WK4A 4AFFA 2CPZA 3GIKA 1VQKS 3VAJA 3MPYA 1JLQB 1MROB 2XG8A 3H25A 1PO6A 2IJFA 4NXMF 3HP6A 2FJXA 1HD1A 1L3VA 1ROFA 4B3RF 1TL3B 2LLZA 1Q81T 4Z2XA 1T05A 2OP5A 1RT5A 3T5JA 2VA2A 2DR5A 3HVTB 2HGNA 3UCGA 1C1BB 4HTJA 2W9CB 4CNYA 2E44A 3KG1A 2BJEA 5L39A 5LMUF 2FY1A 1UVLA 1SKRA 2VC0A 2ZH9A 2CQ0A 1L3TA 3Q8PB 3CGIA 3KLHA 2BQUA 4ECQA 1R0AB 3I4PA 4WFBQ 1VBZA 2RE1A 3CE8A 3B8HA 3EPIA 5L9NA 2AWZA 2OKQA 1D9DA 3HMJG 3TI0A 4IQMA 1ZZFA 5DM6Q 1TV6B 1RT6A 5F8IA 2ZE2B 4DN0A 3KHLA 1LW0A 2FIUA 2GHWA 4CO1A 3CCRS 3KLEB 1FJGF 1JLAB 1BQNA 5B0CA 5FD1A 1UVIA 3F41A 1J2VA 1RTJB 2LQ9A 4FXDA 3EGWB 2GFFA 1CC8A 3K59A 3T3FA 3QJLA 2YWHA 5A8KB 1T03B 2L08A 2CQDA 1SIWB 3C6UB 2M9KA 3UDCA 1DFDA 1UJ6A 1V3ZA 4OZ5A 2QSWA 3T1HF 2U1AA 2DK2A 3IBWA 2R7VA 3MMCB 2YX7A 3VTIA 5KFHA 3RB6A 5L1JA 4DQRA 3FNNA 5L9XA 1EP4A 1P9QC 3G6XA 2GMJA 2OAUA 2YNGB 2FHJD 4LVNP 1M5SA 2UV8A 1FRXA 2DGUA 2OPPB 4TY9A 2FVPA 3MMAA 1Q82T 4NYOA 1IKYB 3GFXA 1NJWA 2LXIA 1HD0A 3MM6A 1DLOA 3BB5A 4FXVA 3E51A 2I1RA 2ZH3A 3CJ2A 2DGXA 1KHVA 4RNFA 3SV3A 4LF8F 4DSFA 4ICLA 3OPKA 3SV4A 5L38A