2G0JA

Crystal structure of smu.848 from streptococcus mutans
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
RGSMIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNALEVLADCTVSLQMDEFDGGYMKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKIMTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SMU.848
publication title Crystal structure of SMU.848 from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Unknown function
total genus 33
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04327 Peptidase_Prp Cysteine protease Prp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1490 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cysteine protease Prp 2g0jA00
2G0IA 1S12A 4PEOA 2IDLA 2G0JA
chains in the Genus database with same CATH superfamily
2B7CB 4O3OA 3R97A 3POTA 2ZM6J 1S9EA 1QUPA 4HI1A 1F2HA 3TUZC 3I6PA 3IRXB 4IOCQ 5L1KA 3SSRA 5C2CA 3VWSA 2UUBJ 5BR8J 3IWXA 3O6QA 4E8UA 5FD1A 1DBDA 4JI2J 2GO8A 5D4PA 3GB0A 3PEJA 2D3O1 2G13A 2HIYA 2W8KA 4NL5A 4NRTA 1WORA 3NCQA 1RCXB 3GTYX 1SKUB 3BQ1A 1EP4A 4DV4F 2EFPA 4QR2A 1MU2B 3H98A 3OFFA 3G82A 2HBZB 1R0AA 3VAHA 4B3SF 4O3RA 4TKTA 2U1AA 2E9ZA 4ED2A 3OPKA 2JNJA 1HW8A 5AE1A 4Z7YA 2IM1A 1N36F 4JV1A 4DR7J 1U8SA 5J2QA 3KLGA 3W8PA 4X65J 4M5KA 2RUGA 3WIUA 4N8OA 1SB6A 4A4JA 2R8IA 3DYAA 2HBYB 2CQ2A 1VRTA 3MUVP 3ET6B 2XSJA 3QPIA 4M5HA 2NXJA 3FKBA 3ZXWA 5CYJA 5LMNJ 5CD4H 1FKOA 4X4NA 3ITHA 2BQUA 5ETVA 5F8HA 4J9UE 2BKPA 1DTQB 3SCIE 3WBZA 2E5LF 4C3KA 3KYLA 4CO5A 2QC3A 1YDLA 2P9EA 1F5AA 4LSZB 3N01A 4X4SA 2HPUA 2UU9J 1Q8KA 3NL0A 1NEEA 2KT2A 2H9ZA 1M5PC 4PYAA 5KFHA 3FBBA 3M32B 3M9OB 3Q22A 3D0GE 2DH9A 3HKZD 3OUYB 5F8IA 3MHYA 1DURA 5RUBA 2VQEF 1XQIA 1B99A 2J9DE 2JEIA 1X5OA 2WOMB 3VQTA 2DPJA 1RWWB 5F3TA 2RF2B 4DFMA 1RHRB 1FWLA 1WEXA 5DZ7A 3UVJA 4P10A 1JQGA 4NE9C 2B5JA 1UKUA 1DFDA 2U2FA 2PE8A 1FD2A 5K14A 4J9PA 2VPXB 1XMBA 4YN3B 7FDRA 2PDAA 4R8UA 4JV2A 4N8NA 4O4RA 3DLLQ 1X4DA 3THTA 2MKYA 3ILLA 2UXCJ 3K89A 4DPUA 1WUUA 4I6AA 1IKWA 3DLEA 2RB7A 2QTWA 1RWXB 2RQKA 3JSMA 3M30B 1U0HA 4HEA9 2UUAF 5DGBA 2XMWA 4AL6A 4B9MA 5G4DA 3HHDA 4QWEA 3M8SA 3C6UA 2VL1A 2B6AB 1R8PA 3SFUA 1W2IA 3R5DA 5IZHA 2YTCA 3R1LA 4D3GA 3OFHA 4DPOA 4PWDB 1IKXA 4RUAA 1NHKL 2BANA 5M2PA 4DEZA 1MMNA 1HBMA 3CUNA 2HFOA 2H48B 4ILRA 1KNZA 3MMBA 3ILOA 2P9GA 2ZBIA 2J5AA 4LFAJ 1QE1A 3HSZA 2JJ4D 2QYCA 3TJ9A 4ZVTB 2EG2A 5B0BA 2DPIA 2D3OR 2XYGB 3UCGA 4QYRA 4DPYA 3GMGA 5T41A 5IOLA 2RU3A 2DNPA 4WK1A 1PC5A 1H98A 4YDDB 1SPBP 5C24B 3MOZA 1GT8A 3CDUA 4UZCA 3MTKA 4TY9A 2BUNA 1V6HA 2PEBA 1VBKA 5IT4A 1CJUA 4ANCA 2DNHA 4JV5F 1B7YB 2XMKA 5E3PA 4EI2A 9ATCB 3FZ2A 1U4BA 4ELTA 1KFDA 2GHPA 2MY8A 2RSQA 3BV8A 4DQIA 4PKDB 3FNNA 1S5ZA 2AJ4A 4YS2A 3T1HJ 2HZCA 1JJCB 4IDKB 1KHVA 2RQCA 2A2CA 2O66A 5KFVA 2BOPA 2VF3A 1WACA 4R25A 3D67A 4QIWD 1J5EF 1QAXA 4LSNA 3C15A 1VOMA 3IG1B 1PKUA 1QDUB 2PGCA 1KOHA 2IAJA 2DR6A 2XMMA 3R6GB 2HGMA 1RXOB 4B3RJ 1FNXH 2BQ3A 2QX0A 4A46A 4HDGA 3ELHA 2ZUGA 2FYXA 4X64F 1NCLA 1X5SA 1RADB 5IM0A 3HKWA 2JX2A 4I0WA 1ZS6A 2E1AA 3W9JA 1UW4A 1C4AA 2P8IA 1RHJB 1RWVB 2J8AA 3I9V9 3QIPA 4ZN1A 2CRLA 1XR7A 1HQ2A 1QSSA 4IG0A 2FJWA 3K8VA 2PMHA 2V9WA 1KSPA 1M1GA 4CLYA 4ZP6A 4M5JA 4OX6A 2GJ2A 2B9EA 2MZ1A 1NHUA 4X4RA 3BH6B 1HNWF 2W2PP 2I9SA 4CO1A 3QWUA 1BMQB 4NRUA 4ENOA 3RR8A 5AXMA 3NCRA 1UWBB 2HBQB 4X66J 4M95A 3DU5A 2LQ8A 4ED5A 4BBYA 2BVZA 2MQNA 3UR3C 2GMHA 2GC8A 1ZPVA 3F0NA 3KK1A 3Q8YA 3VVTA 1T9XA 4EEYA 2ZBRA 4Y2MA 4RW9B 2RKIA 1JXVA 3JTNA 4ILLA 4WCEQ 4DU7A 1YRUA 5D78A 3MM7A 1PJ6A 1CBKA 2HHPA 1C1CA 3HD1A 3UWTA 3OTDA 4YB5A 2KT3A 4W90B 5K20B 4PG6A 1NJWA 1VJWA 1RGVA 2KO1A 1HBNA 3CCSS 1QD1A 2BW2A 3MM5B 2CQPA 3C6TA 2ZOFA 3HHEA 3B6BA 3KG4A 5GVQA 4ZPTR 1LK5A 4ZJQA 3NP5A 2XZDB 1HARA 1VC5A 3H7HB 1CG2A 3F44A 5ETLA 2R8JA 3BKUA 4HR2A 4I6WA 5B0DA 4UUWA 2NYIA 1IKVB 3DRRA 4CYUA 2AYMA 2OH2A 2J6SA 3D68A 3PFEA 3GP9A 2E7XA 2YKPA 3TJAA 5IC4B 3UNYA 3DHXA 1S76D 2ZNZA 5L38A 2YPYA 4ZITA 3ZZYA 4NOHA 1LWCB 4K5SA 3T5LA 5KG5A 3S01A 3W9HA 5E3CA 1GX5A 3L09A 2BM0A 3DRPB 3G8QA 4JYAJ 5A8KB 1WELA 1Y9OA 1TK0A 4MFBA 1K73T 2DY9A 2FVRA 3AHPA 3V6HA 5HP1B 1F3VA 4UTGA 4DV0J 2XSFA 1JKHA 3G6XA 2LU2A 1YIJS 4GKJF 2BW7A 2PMZD 5BYQA 2AD9A 3HXMA 2HNDA 2DVIA 1F9EB 3G8SA 3MEGB 3EYZA 1ELOA 2XI2A 4QYZJ 2GHVC 4DUZF 3CCRS 1DQ8A 2ZBCA 2JLGA 4DBQA 1RWPB 1PGZA 5HQLA 3WDOA 1IWAA 4UQGA 4WU3A 1WHWA 4Z7CA 5U47A 5L1LA 4P75A 5KFUA 3J81Y 4HVZA 1OPIA 3D28A 3TI0A 4LR8A 1VRUA 2WB4A 2JVOA 3HT3A 4LF7F 1V5IB 4EU0A 2N3OA 4I68A 2MEWA 3BEGB 3EUNA 1FDAA 3LP2B 1CJKA 2K3KA 4OHYA 4L6V3 3NWGA 3KLFA 3DGPA 3BYRA 3FSYA 3C8YA 4Q2LA 2R2TA 1SKWA 1GX6A 3HHLA 4YY3J 1Y10A 5KG0A 2W9BB 3KUHA 2KDOA 5JMNA 1GNKA 3ETMA 3MWBA 3M9NB 1NB7A 3KG0A 2KFNA 3VV2B 2IVFB 2KZMA 2WW4A 5AE2A 2CPZA 1S9GB 3CT9A 1VDHA 2KYZA 5KFXA 2RMLA 2C3OA 5F9LA 3B4MA 4ECYA 3GU0A 4JI8F 3HZEA 3Q24A 3K59A 4DXLA 2AGPA 1U48A 2CG8A 1U02A 3AODA 3FMBA 1LFPA 2BJ7A 3M1VB 4U6PA 3QSYB 1LEOA 4C8LA 2ASDA 2LA6A 4B9LA 3BREA 4OYZA 4RU2A 1TFWA 1E6YB 3KLHA 2BZ2A 1XK8A 2ALYB 2FJVA 3Q89A 3THVA 2DH8A 3M9MB 4WZQA 2HVIA 3IM9A 2X3DA 1WD6A 1ROFA 2QZ8A 2FJDB 1NZAA 4C11B 3BZQA 2CXEA 2V5HG 3CIZA 2HMIB 5I42B 1ZYQA 3AXKA 4XIUA 4IH7A 2OP5A 3G8TA 3FVYA 4K2XA 2DEIA 1SC6A 5KFAA 1FE4A 3GWCA 1T05A 3KDNA 3SCLE 1YBAA 1NJZA 5KT3A 1K44A 1XNQF 5M2UA 1XMQJ 3ZNJ1 2VA3A 2ZWPA 4OQJA 1WC1A 1HQUB 1EETA 4R5PA 2XEXA 3CF5Q 1F1BB 1RTHA 2PIIA 4KHPJ 5J1EB 1LWFB 3R9LA 2IM0A 3C19A 1N54B 2LQJA 1PC4A 3D9BA 3SFGA 2BKNA 1F5BA 4Z2XA 2ZOMA 4AYBD 1ITPA 3CULA 5FLXY 2C2MB 4PXBA 2W4DA 4B3MF 5A8RB 4HT7A 2DXFA 2H5JB 3DN9A 3H5YA 2DTJA 1HHTP 4QR0A 1IUJA 4KIAA 2VU5A 1R6YA 1NPRA 4DU8A 4F3OA 4USKA 4Q2MA 1S77D 1VQ7S 3PX0A 4ZJOA 2VFSA 4OMFG 2HFSA 1T11A 3MUMP 1S6OA 3LTOA 5KFBA 4Y3CA 2GMJA 2M7SA 1MU2A 4DR3J 3F56A 2WONA 1S1UB 3L95X 3AA9A 1VQNS 3HFVA 3GFYA 3EZOA 4DQSA 1SQGA 4DUTA 3P6YC 3PNIA 3K5NA 2V50A 4JI4J 3FDSA 4F04B 2AMCB 1JLAB 1CQMA 1XJWB 4CNZA 3PIOQ 4WKYA 1Y5NB 4DCOB 2ZE2B 4TU8A 3MMAB 2JL9A 2VPWB 3PRBA 2APOA 3ET6A 3RUBL 2IM2A 1HL6A 1KRPA 4ZJLA 1TP7A 4RNMA 4BWJA 1K47A 2IJNA 2H4WB 6AT1B 1DTQA 5JXSA 1QTNB 4QQBA 3OQ2A 5DM6Q 2XLIA 2M2BA 2DJWA 1IBKF 3HDSA 3BO2A 3NNHA 5HQ8A 3M32A 1RKIA 1AA1B 2HWTA 4MMOA 1YHQS 2WCXA 3VR1A 5JUMA 3OUYA 2KN4A 4NLSA 3PW0A 6FD1A 3E8OA 3UD4P 2WOMA 3MPWA 2JFKA 2RF2A 2RJZA 1BY9A 4K5RA 3PG9A 2ZVSA 2O3DA 1C2PA 1U49A 2Z2YB 4FBTA 1TKTB 3BQ2A 4ELUA 4F4AA 2QE5A 5K5MA 3DHWC 1RAFB 2KG1A 3BYPA 1GMUA 4CTAB 3VVUA 4OYWA 2DNKA 3ULHA 3VF0B 3VAGA 2HQIA 3MPVA 5CH7B 2QV6A 4EWTA 1T3OA 4ETZA 4ZVFA 1V3ZA 1B70B 3KUEA 4M5IA 2IYGA 3AXMA 2FZKB 4P72A 5HBMB 1AFJA 5E7OB 4QJVA 5GAHU 2FQQB 3QYYA 2F9JA 2BJ8A 1ZH5A 3G9CA 4IO1A 1YJWS 2B6AA 3R1HA 2MJUA 1KS2A 1FRJA 4PWDA 4M5DB 4FF2A 4KGXB 2DRDA 4NA1A 3Q23A 1ZPWX 2CYYA 1RHKB 4OI3A 1LW2B 3ILJA 4Y2IA 1WF2A 3HVRA 3M8ZA 2E44A 1VMBA 3GLJA 3SV4A 3I32A 2UP1A 5LXRA 1A9NB 2CIMA 2D1CA 3N5BA 2FTRA 2QL9B 4USIA 3QGHA 1H73A 5C24A 4HHUA 3W60A 4PPDA 4F8RA 5A0YB 3GIMA 1VCTA 3OXFA 3DRSB 3ISZA 4WE1A 3OV7A 3ISNC 3FK4A 3KJNB 4BCAA 4X2BA 3TYTA 3M8PB 3NGTA 2ZFHA 1EJ7L 3VGUA 3ETOA 3EXCX 4IDKA 5J1NA 1BQMB 4MYTA 1AFIA 4GKKJ 2L3MA 3QMQA 1S1XB 3MCNA 1FKPB 2CJKA 3O44A 3QGPA 3CCVS 3CMAS 3FQKA 2AF6A 4YEAA 2Z8QA 4ZVPB 3AOBA 3IG1A 1VLYA 1JK9B 5HVHA 4PCQA 1S0MA 4Y2CA 1YG0A 1YJVA 3RRGA 2VC0A 3Q83A 2KZZA 2OFGX 4EBEA 2JLEA 3RYLA 4ZLJA 4J9NA 2E5GA 2MQPA 2YQ1A 4Q43A 5L1IA 2CJ9A 2HHQA 3MAAB 5L1JA 2VG5B 4BLGA 2PN6A 1X60A 2D3ZA 1T9YA 2FHJD 2AYBA 3HVTB 1OSDA 4QPTA 4I56A 3QQCD 3GONA 1Q81T 5D4NA 1F9FA 2D9OA 3KMQA 2GJFA 2V34A 4GC7A 2I8EA 4AUKA 3WQPA 1M5VC 1HFEL 1UWBA 4ID5B 6FDRA 2BR0A 3HJVA 3BGUA 3UD3P 4RW9A 2ASYA 1VHFA 1XR5A 2WAQD 2YKOA 2E5LJ 4KJIA 2OPPB 4WP9A 2G2OA 2C2EA 2HS4A 1VC6A 2YH1A 3RW6A 2FVSA 3CCJS 5A8WB 5IT0A 4U8VA 3T41A 2Q79A 5G0RB 2ZKUA 1PYOB 2M8DB 3LH2S 1QVGR 3MM5A 4WFYA 3HHLC 4J90A 3PYFA 2UXBJ 2V8HA 4OZNA 2UUCF 3U27A 5HLFB 1B0VA 3CJ4A 2VQEJ 3A8JA 1WTFA 4QWBA 2ROPA 4KKOB 4P71A 2PEHA 4PPZA 1QSLA 2VBWA 1IKVA 3SDEB 3SQGB 4P2SA 2XHCA 3NS6A 2X1GA 3AOCA 5D0HA 2V6AA 3W64A 4DSJA 2CNNB 3BBBA 4CP5A 4RW4B 4LF8J 3TZZA 4F36A 2Y3YA 3OSNA 1Q7LB 1RISA 4RNOA 1LWCA 2DNOA 3LP0B 1SH3A 2QIFA 4OV1A 3X1LB 4CRJA 2QJ3A 3IO1A 3C2PA 3T5KA 1DTTB 3DRPA 2RU9A 4DLEA 4ZPVR 1NUEA 1NHVA 5A8KA 3RAXA 4ED6A 1RJJA 2N82B 1IBLF 1HPZB 2IBOA 2M52A 4JI1J 5HP1A 4JI0J 3V4MA 3E01B 4DR1F 4B9TA 4MIWA 2M5YA 2UUAJ 2R7WA 4ICLB 2K1RB 3UDEA 1ZZFA 4LBHA 2JSXA 1TK8A 5HROB 3IS9B 1FRXA 1B0PA 3MEGA 1WF1A 2W2QP 3J81j 5IT9U 1QM9A 1Q7YT 2LQBA 1FJEB 3K7RA 3J7A1 2XTJP 1RLDA 2ZDOA 3KTQA 4OI1A 2B0GA 2N7YA 2FC9A 3KLVA 2G4BA 4W98A 1Y5LB 2EKNA 1F60B 4HACB 4Q0BB 2DISA 2OO4A 4OFZA 4CO2A 3LP2A 2DCUB 4HTIA 4G65A 1SL1A 2C3MA 2LU1A 4Y0FA 2D7SA 2V94A 1OYEA 3D6HB 2FUG9 1HIYA 5K8NA 3EE3A 3PFOA 4JV5J 1WC4A 3UNGC 2BV3A 1WDTA 4I67A 2CDQA 2YPZA 2KL8A 2Z57B 3CO9A 3I4HX 2W9BA 4MKYA 2JC1A 3VZIA 2CQHA 3W65A 1P1LA 2HQ3A 4OJ3A 1M1KT 4ES3A 3TUIC 5A2QU 1S9GA 3LA0A 1KTVA 1EARA 4RW7B 4QPXA 5KAKA 3QBCA 1J5EJ 3CD5A 1IR0A 4FYWB 1HI8A 8ATCB 2YWWA 3L4BC 2GFFA 1Q53A 2AT1B 4LREA 3OBIA 1H38A 3GG0A 5IS2A 2VG7B 2KTQA 3OW2R 4FYXB 5DG8A 3I87A 2J76E 3FEYB 1E6YA 4NPOA 4BWMA 1VQKS 2DHHA 4F3MA 4DL6A 2LKZA 4XO0A 2RE1A 1WG5A 3MPDA 3LW5C 1URNA 2VDHA 3SQOP 2MJNA 4ZP7A 5I4MA 2IPOB 3T1HF 1VIXA 2V2QA 3NBPB 2ZKTA 1KOOA 4J7CA 3AT1B 4C11A 4PG5A 3H90A 3Q8SB 5I42A 2RILA 1GTEA 4WTYA 3TUPA 3MURP 3IBFB 1HNWJ 2DKOB 4QIFA 1U1LA 2WBRA 3SYZA 4UOGA 3ZZTA 1N6QB 4XAKA 3BSAA 4ECWA 2BE9B 1K1SA 1YJ7A 1HQUA 2YKAA 5F3ZA 4UOHA 3UCUP 3TA1A 5J1EA 1LWFA 2WW8A 3PW4A 2HZVA 3DCAA 4P74A 2ERRA 3VAIA 2JC0A 1TL4A 1S1VA 4ZVHA 1X4CA 3CD0A 1NK0A 2KFYA 1VQOS 5AXNA 4X62J 2M9KA 3FMWA 4I4BA 1VR6A 4DFPA 3WC0A 2UVRA 3BKTA 2FZCB 5DDOC 1QLNA 4LR9A 2ZD1A 5T7LB 3C3LA 4OI4A 3SCKE 2GO9A 1VQYA 2CQ4A 2ZH1A 3IBCB 2HGNA 1ZTWA 3LWLA 4ED1A 4A8YA 2DNYA 4NLVA 3RR7A 3L7PA 2YBVA 2CNOB 2DHSA 4X66F 4Y65A 4B3OB 3O5TB 4PABA 3KHRA 4DL2A 1MWYA 4Q5VA 1IKYB 2RRAA 2AV5A 2BE2A 1V9OA 3GQCA 4K4XA 1T95A 3QAEA 1JLAA 2ZNYA 3UDCA 1QAYA 2WTFA 1LKZA 1XBWA 3MMAA 1T9VA 5D0EA 2HNZB 3A8EA 3QJLA 2XNQA 2JZ5A 4NCGB 3TJ8A 1VISA 3BS9A 2NXCA 4V19J 1YRTA 5KFDA 2FC8A 1CJTB 2IDLA 3IR5B 3ZTSA 2HS3A 3U1NA 3OR1A 5KFTA 4AL5A 4F0HA 3Q8QB 1RT2B 2J6UA 3MPUB 2FJAB 3JSRA 3NCPA 3ADAC 2GIQA 4DUZJ 1ZM9A 2DBBA 2GMLA 3EX7B 4PWUA 2ABYA 3QT7A 1X9MA 4DR4F 2DHXA 2L9NA 3KFWX 3JTOA 5CYQB 2DIVA 2H51B 3K2YA 1FRKA 3O3LA 5D6GA 2KHDA 3T19A 1FWPA 4MK7A 4DL7A 2G9OA 2B7BB 2DGOA 2XMVA 3N9UC 4FF3A 4DV0F 1QVFR 2HFVA 1RP5A 3MR5A 4IFYB 2R8GA 1TKTA 4GRSA 3IR7B 2CNLB 5F8JA 1TL7B 3SCJE 2RDJA 1P27B 4CTAA 5DETA 3J80Y 4O3NA 5AJ3F 2PSZA 3TZWA 2NZ4A 3UN3A 3MR2A 1U26A 3I0RB 3T5HA 3DKDA 2CQ1A 1FVSA 1RUSA 1YI2S 1S0VA 1EAYC 3DOKB 2YNFB 5HBMA 3K58A 3GYXB 4KRWA 4USMA 1J5OB 1SIZA 1YWXA 4P73A 1H7WA 3DXBA 3QRPA 3DC2A 3RTVA 1N33J 3WHIA 5KT6A 4ZLNA 1OJ4A 3DU6A 1S4EA 3DLHA 3D2WA 4M5DA 3PVXA 1FERA 4ID8A 2LCWA 4F4KA 4E2FB 2MYFA 5KG7A 3KLEB 2IRUA 2JH3A 4DX6A 1GQEA 3NMRA 4BDPA 3BSOA 3FBFA 3BM7A 4LF9J 2X7IA 4H4KC 4PQAA 3MR7A 1FRLA 5KFFA 2XYPB 4QBUA 5K8PA 2F1FA 1NKBA 2PA8D 5E3AA 4KPYA 1FO1A 1FE0A 4OI0A 3OFEA 1BC6A 3PIPQ 3CJ2A 1Z4UA 2FLOA 5A0YA 2HRUA 1XNQJ 3L3CA 4DI6A 5DO2A 1UVMA 3DRSA 2MDAA 2ZJPQ 1S4FA 1Q82T 1RABB 2LDIA 2KXHA 1OS5A 1BXNA 2HK3A 3M8PA 1YJTA 1FTRA 4ATNA 4DL5A 4USTA 1S97A 3PR5B 3MD3A 4Y34A 2ACMA 5ETRA 1N32F 2VBYA 2HHUA 1BQMA 2VZ9A 4AXJA 2A3JA 3S7RA 2VG6B 1WNEA 1XMOF 1T03B 4KHRA 3Q8VA 2GHWA 5F0WA 4B3MJ 5SUHA 1S1XA 5KFIA 4JI7J 4M5GA 5HANA 3MR6A 3NKYA 1FKPA 1TQLA 4NLWA 1H3DA 4LR7A 3HPOA 3W2WB 2IVMA 4NZ7A 2DGVA 1HHQA 2WBMA 2OPQB 4NYZA 5GADI 3ENVA 3I56S 1I94J 1NK9A 2A1BA 1RTJB 1SL0A 2DNQA 4N56A 1O0PA 2AYGA 2XI3A 3TANA 1XMQF 2MKKA 1T9WA 1DLOB 2YXLA 2E66A 3BBCA 2BQRA 5ETMA 2CDRB 1RKJA 1RSCA 3MAAA 3TX8A 2XS5A 1BD6A 2VG5A 3PACA 2JEGA 2XZWA 4KYZA 3HVTA 1O51A 1I5OB 3QZ8A 4KB7A 1CC8A 3SSQA 3NNCA 5EHHA 3NGDA 2W4CA 5KT2A 1NSPA 2IY5B 3OR2B 4PUOB 3VAFA 4OX7A 3KK2B 2FJBB 3ZZ0A 3NXZA 4Y6IA 2NUHA 1NJXA 2Z58B 1ZAWA 3KJFB 1TK5A 2EFGA 4FF4A 4B9NA 3GCXP 1Y3JA 2VONA 4ID5A 3IFEA 2XLJA 2YKQA 3QFHA 2BKOA 1WJ9A 2QG9B 1UVLA 2AJQA 1S6QB 1NXIA 2OPPA 4DR3F 2OJ3A 4YR0A 2O67A 4FYDA 5A8WA 4ZKAA 5G0RA 2MQOA 2FZGB 5KFZA 1RT5B 3VALA 4JI4F 4AQYF 3CW2C 2OPSB 1KC8T 2AEJA 4F4XA 5HLFA 1MN7A 2FVQA 4A8KA 2GJIA 1RAGB 4KKOA 4ZVEA 3NAIA 1P9YA 4F25A 3MM8B 3ILIA 1G4CA 4MT1A 4Z37A 3SDEA 3RRKA 3SQGA 4J9OA 2KI2A 2ZVIA 3PR4A 3KK3B 1NK6A 1VFJA 2AX1A 1KD1T 2VIHA 3G87A 4EGLA 1FKAF 2O5DA 1OY8A 3OVSA 2A18A 5HJYA 1FX2A 3LP0A 2RDDA 2YNIB 1S0OA 3CJKB 1DTTA 1UWAA 1MROB 4LRDA 2IFXA 1YJ9S 3AB4B 1HPZA 5EN1A 2VFRA 2R3VA 2C3PA 3E01A 3H42A 1N34F 4C0HA 2ZH9A 1AW0A 4ICLA 1HWKA 2K1RA 4A8OA 5EUHA 1SH0A 2OHDA 3M7VA 2W7PA 5HVGA 1Q86T 3QFWA 5HROA 4OLOA 4NA3A 3IS9A 4MIBA 4DOZA 3SMZA 3VAJA 4KO0A 4LQ9A 1T3NA 1FRHA 1HWJA 2D41A 2R7VA 2W1BA 3A8IA 2BACA 3NEKA 1TL5A 2B56A 3I31A 3BN4A 2GAGC 1PAUB 4J5OA 1NKCA 2NREA 2XGPA 1NPPA 4TN2A 4C0BA 4M5MA 3KDOA 3P45B 1WHYA 2IC3B 1U25A 5L46A 1F0XA 3W5XA 4HACA 1GK8A 4Q0BA 4IRCA 1REGX 2VD3A 3FJ2A 2AJ0A 2DGWA 3ZZOA 1HBUB 4CH1A 2KYXA 5KFWA 4WPAA 4I6YA 2ATCB 2QLJB 3JAMY 2ZITA 1HBOB 1EIYB 4ZVGA 1XN9A 3EM1A 2LEPA 1WKLA 2ACYA 1M5OC 5C42B 3AD7C 4LSLB 3KHHA 3JTPA 3EXYA 1UTAA 2K8GA 3D5MA 2HVHA 3OD2A 1RE1B 1VK3A 2AZ1A 2E1RA 3DDIA 4RW7A 4QW9A 4EYHB 2W2MP 2I0XA 1RK8A 1HYSA 4RNHA 3Q8UA 2A6MA 3EVWA 4DR2J 2DB1A 4DSEA 4IH5A 4NCAA 2BM1A 1LW0B 3LWMA 3KNAA 5C5JA 3JB9k 2VG7A 3DOLB 1HD1A 2GS8A 2KRBA 2DO0A 2GX8A 2V2KA 3KJVA 4CCHA 1KVIA 1RT7A 4ER8A 1GXTA 2W7OA 3Q8RB 1CEZA 2HNYB 4USUA 1G6BA 1NBEB 4QU6A 3QZ7A 4KC5A 2C3UA 4FPRA 3NBPA 3CDBA 1DZ5A 4GKKF 4LBIA 2F7VA 4RLEA 1V3RA 2RNEA 3AD9C 2L9WA 4F4ZA 4J9QA 1I1GA 4CO3A 5HO4A 3IA0A 2IMWP 4IQMA 2YQ3A 2J9DA 4JUZA 4N77A 2MKHA 1H74A 2XS2A 2AWZA 3CCQS 1N6QA 2Y1LB 2HK2A 2XGQA 5KFMA 3K5LA 1YKWA 4ANEA 4CO4A 4TNOA 2VPZB 2C28A 2JHEA 2RS2A 2E29A 3BSCA 2XMAA 1SBRA 4Y00A 4MH8A 4IG3A 3FC9A 1B4SA 2DRBA 1SVDA 3IN5A 2EW9A 3DDKA 2LECA 4GVBB 3FSXA 2IBKA 2MHEA 1IM4A 1H2VZ 4FP9A 1RAJA 4A47A 5DGAA 4USVA 4IO9Q 5T7LA 2RAQA 1XNRF 2UUCJ 2CPHA 1BQXA 4JB8B 5ETSA 5KFNA 3V81B 2EBGA 3W5ZA 2NYHA 2J8SA 1YBUA 1RAEB 1V3SA 3R2CJ 3N6MA 4WTOB 4DV6F 4B3OA 4OI2A 2YWGA 4LMZA 1CJVB 2GCFA 2HAFA 3W61A 2D69A 3OTEA 4ZP9A 2VKZG 2ZDPA 3MM9B 4OZ5A 1UFWA 2HHXA 3C16B 3GE9A 4HLBA 2XM3A 1GEHA 1W25A 1L3SA 3POTB 2MHNA 5LSRA 1C0TB 1S9EB 3AA8A 2B3TB 3OXGA 3A12A 1IQZA 2I1RA 3BH7B 4DV5F 4YHHJ 4NLOA 1CVJA 1AXQA 2HFZA 3M6VA 2R2SA 2UXBF 4FXDA 2HNZA 1IBLJ 5HMWA 2QN6B 4NCGA 5AE3A 4ZN3A 4C3LA 4K4WA 1RQ0A 3CDWA 4DR1J 4FPIA 4L3NA 3DGVA 1CJTA 3CJSA 2V0NA 1HW9A 4WKRA 3QJJA 4IRDA 3VAMA 1EP4B 2KB2A 4OZ1A 4IFVB 5KFEA 3MFIA 1RT2A 1QTMA 2QL5B 3PXGa 4NMXA 4DSIA 5BYSA 3W5YA 4KQZA 2ZH8A 1R0AB 1NK8A 1WDDA 4HYKA 3FRZA 2GQCA 2MQLA 3W2VB 3V4IA 4LF8F 5IQ6A 1FJ7A 3RB3A 3D0IE 3D6FB 1AUDA 1UW9A 2BABA 3SIPB 2NS1B 4ED3A 2FDNA 2MMYA 4DCPB 5CYQA 2CWXA 3TW0A 2YNGB 4FVCA 1VRQC 2I2YA 3CCTA 3QT8A 2V69A 2R7SA 3Q8PB 1LV5A 4CM0A 1S6PA 4ZHRB 2CFXA 5DZ6A 2Q3PA 4ZA1A 4QWCA 4ED4A 4JI1F 3MEEB 4JI0F 5L8RC 1N56A 2J0XA 4NX9A 3HMJG 4FKYA 2FY1A 3F41A 3HP6A 1TL7A 2A6OA 4CLSA 2HYIB 3EMTA 1NK5A 2E9RX 2FIUA 2V63A 5GMKa 1RAOA 5DJBA 1JMTA 3UQSA 1KLNA 5GAGU 2E5IA 1NSKL 4ZIWA 4WU2A 2JOQA 4LF2A 5ETQA 3I0RA 2NZCA 4WBFA 3GYNA 1I3OB 2NPIA 3DOKA 1HQEB 2YNFA 2IA6A 5DDPC 4RPFA 1IM6A 2KT5A 1RZMA 1J5OA 1Q95G 1NH8A 3R5BA 4UF4A 2UV8A 4CT9A 3H4DA 2R2RA 3D6MB 5A76A 1RACB 4DJBA 3OFGA 3EZUA 1YRXA 2FLNA 1UJ6A 1C1BB 2RDIA 2MSTA 5HMZA 4H4MB 2X1FA 3CDEA 3MGJA 3LQVA 3T1YF 3PTWA 1N5TA 4HI2A 3KLEA 1PO6A 3MF5A 5HN0A 1TFYA 3JS9A 1R8AA 4C2MA 4J9LA 1KQFB 1H0HB 1SJFA 4G6VB 1LNQA 3FGVA 4IR1A 1M90T 2PD1A 2HG4A 3L7OA 1Y7PA 3DLEB 3TUJC 1MLAA 3BBFA 4WZMA 2Q43A 1U0HB 1RT4B 3JYTB 2OD6A 3C46A 3LGMA 3PX6A 4DZDA 2MKSA 4NA2A 3CSKA 2DNLA 2M3DA 3D1QA 1OQ6A 1WG4A 2KH9A 4O23A 2XC9A 2DIUA 1P9QC 1IKXB 1SL2A 4CWBA 1HD0A 5IV3A 4DLGA 4KGMA 3CO0P 4C0OC 4OJHA 1U6FA 5GAHI 2A10A 2VG6A 1GMWD 4PG8A 1T03A 1L5UA 3C14A 2XBPA 3ZTQA 2YNHB 2QYGA 3BGLA 2E1CA 1FX4A 1JIHA 1D09B 4ZDNA 2R2UA 1YJNS 2MZJA 1LFWA 3W2WA 4OX9F 4PQUB 2OPQA 2PFFB 4LFCF 4HH1A 2AYEA 1HMVB 4OYMA 4DSLA 5IFMA 1RTJA 2IM3A 2CNKB 3I82A 2LFVA 3THPA 1CJUB 2KXFA 2KFZA 1IBCB 1DLOA 1YBTA 2Z30B 3ZZZA 1TV6A 2LEAA 4MYUA 1D0EA 4M5NA 4M8LA 5HMXA 2NXUA 5KT7A 4NI2B 4DPXA 5ITHA 4F3QA 4USWA 4GC6A 3TAMB 2HLUA 3HJFA 1R8CA 2Y8WA 4J9RA 4A8QA 4X4UA 4WIQA 5J2MA 4X62F 5L9XA 1RWKB 5KT5A 2CAJA 4DX7A 4PUOA 1SIWB 2R7UA 5LM7E 2BJ9A 5GMEA 4NLQA 2JDJA 1S72S 3DI6B 4QOTA 5J2PB 4F0KA 2N4DA 1TUWA 3W66A 3IGNA 4O3PA 5H9FJ 4AXIA 5ADZA 4U8YA 1N48A 4OHZA 5F0UA 1R8BA 3OL8A 1UA1A 1FXLA 3FQLA 4OYAA 4CZCA 5IM0B 1S6QA 1HA1A 4LRFA 3FSIA 3US5A 2MTLA 4ZIVA 4I2QB 3BR8A 3VGTA 5CYMB 4DL0C 3ZC4A 5B09A 3A8KA 3CMES 4PRFA 2WK4A 3R2DJ 3EGZA 3GPAA 2VICA 1SQEA 1OIAA 2DNMA 3RRHA 5GAEU 1RBLA 1RT5A 2J7KA 3W63A 1NO8A 2SXLA 4DR4J 2XCPA 4M63A 3OL7A 3MCMA 1KQKA 2JEFA 3NWRA 1HR0F 2ILYA 1HWUA 4XPEA 2WZ1A 1WKKA 1KVKA 3G86A 1Z2LA 4DV2J 2Y1JA 2BYCA 1FRMA 3H20A 1KVJA 3MM8A 4ES1A 2IJRA 1QAJA 1KTQA 3CXCR 1FFGB 1UVNA 2KM8B 3FBEA 3EGNA 3KK3A 4OI6A 3TA0A 1F2GA 1QY7A 2DGUA 3PRVA 2QLWA 1JLGA 3PJWA 4A8WA 4TXSA 3B4DA 5I3QA 1KFSA 4K4VA 5B0CA 5H9EK 3K5MA 1GH8A 1M1HA 3CCMS 3MUTP 5AJ3J 4J9KA 1R3NA 2YNIA 5KFYA 3MDFA 5KFGA 1OY6A 4A8XA 4O3QA 2W01A 1JLCB 2HURA 2XWYA 4NMLA 1RLCL 1ZAXA 1E6VB 2GIRA 1EHWA 2ZH7A 2KJWA 3E3XA 2VODA 3MMCB 5E2QA 3Q2TC 1R89A 3DLKB 3M05A 4IOBA 1VBXA 4P7VA 2XULA 3GFXA 2Y1IA 2F5GA 5D77A 4U9RA 1TAQA 1VLOA 5KFPA 2HHHF 2GAHC 4ELVA 4OJ1A 2EFVA 4PYDA 4PAAA 2CJQA 2DD8S 4I2PB 4ITSA 1N5SA 2X3GA 1MSWD 1VK8A 2MQMA 5DS7A 4KH0B 2ZWOA 3OJUA 1MNEA 4QU7A 4EFAC 1JX4A 4O44B 2CQIA 5T14A 4DR6J 1VBZA 4J9MA 1XIQA 1U1PA 1ZZNA 3LUYA 5MLCV 1SI9A 4IR9A 1ZAVA 2R8KA 4N47A 4ZVQB 1BGXT 1HBUA 4KGKA 5A6WA 3M6UA 4OYOA 1RTDB 1KP6A 3DFEA 4DDFA 1Y11A 5J1PA 1N33F 2VDIA 1HLWA 1Q0NA 3DOMB 2NSCA 5E3RA 1ULRA 5LMUJ 1WOSA 2V8VA 3AQPA 3TZXA 4JI5F 2NR0A 5C42A 1IJFB 1VS3A 1SC3B 2MQ8A 4X4TA 2R9LA 1SC4B 1N32J 4NLDA 1ZA2B 3UFCX 2DXDA 3GFZA 1UPPA 1XMOJ 5F8GA 3M2UB 4DV7F 3PV8A 2L41A 1U1OA 5DDQC 2DRAA 1O5JA 3EGVA 3LAKA 4LF9F 4H4OB 3BJYA 3B54A 5DLGA 5IQQA 7FD1A 5LXYA 1IR2A 4TVAB 5HL7Q 4DL4A 1U6ZA 3ZTRA 1JLFB 3MEDB 2B43A 2GA7A 1NB2A 1RTIB 1RA6A 1K0VA 4WP3A 1H72C 4O4GB 1X4AA 5CXTA 5KFOA 5LOQA 1TKXB 3MCSA 4RNFA 4E98A 2P5VA 2E9TA 5LSLA 4MK8A 2FB0A 3CE8A 1N88A 2ADBA 1RT3B 1W7WA 3KKFA 1UVJA 3N0VA 4URQU 3OXLA 2V2ZA 1UCNA 1J27A 3B82A 3E51A 1YGYA 4JI7F 3FRYA 2A0FB 1LXNA 4DQRA 2F8MA 4URGA 2P6SA 1M5HA 1UJ5A 3D3BJ 2N3LA 5AXKA 2EKYA 3IRXA 2M8HA 3CCES 1FEHA 4LF5F 1RWNB 4TYAA 1I94F 4DR5F 1WC5A 3QIDA 2VPYB 4ZPCA 1NSAA 1SC1B 2KRRA 1IN0A 3GSIA 2I5JB 4CH0S 5KFLA 2XLKA 2ROEA 2PMWA 1VC0A 2VOOA 2HSEB 1LWXA 4GVBA 2R7TA 1Q16B 4B17A 2OLWA 4NLRA 2B9XA 3GG1A 3QSIA 1YX2A 1TELA 4AQYJ 2DO4A 5KTQA 1VHIA 4UW2A 2Z2ZA 5DQGA 2ZH4A 2Q66A 2V4JB 3V81A 1EQMA 1NJYA 5HK4A 2W4PA 4DL3A 1FJGF 3FFIB 2ZHBA 3JQJA 1JLEB 2Q1LA 3NGKA 3OVBA 3BGRB 3MAHA 3MM9A 2YWHA 9RUBA 3VHQA 2DGSA 2GNKA 1BWEA 3C16A 3WX8A 7AT1B 4B02A 2VA2A 1AROP 1C0TA 1RHUB 1TMJA 1FVQA 3AJ2A 3NS7B 4YR3A 2AJFE 2QEXS 3PYDA 3JSYA 3M8QB 3D1HA 5I3UB 2D74B 3M8RA 2W2NP 3ENQA 1URRA 4KSEB 4MAKA 4F4YA 4IQXA 1LK7A 1Y0HA 4KAIA 2OPRB 3H40A 1VQ8S 2Y1RI 4JI3J 4KGVB 4FYYB 1HHSA 1N34J 3PM9A 2R7XA 4C8NA 2WHOA 2VASA 2HAIA 1IJEB 5JVHQ 4IFVA 1EQ0A 3J7YU 1HKAA 3J7ZT 2WONB 4W92B 3RBEA 3J81U 2FHJA 2EFQA 3W2VA 4WFXA 3O2IA 4ZPWR 3O1LA 2X1BA 3OT9A 4X84A 1CS4B 4ECZA 3NAHA 3PX4A 1NDKA 1G7CB 3TO8A 3ZZUA 3H59A 3R7SB 1VIOA 2YNGA 1PBUA 2XMJA 2WVCA 4KE5A 4DMZA 4ZHRA 2ZC3A 2DR9A 4YR2A 2RS8A 3JSBA 2W9AA 1S1TB 3MEEA 3QATA 4GO7X 2KHCA 1TKZB 3M30A 1DQAA 1ZM2A 5F8MA 2MQQA 2EC0A 2CQ3A 1UETA 2BRKA 2E7VA 1X9WA 3N6LA 5BJRA 2DCLA 4YMEA 1TKDA 2MKJA 1KQSR 2W24A 3MTJA 1LXJA 2C2KB 2P9CA 2VUGA 3JQKA 1OY9A 2UXDJ 2IRYA 3CJ3A 2HKEA 1NJIT 3PRDA 2VQFJ 5HVFA 4PWWA 1U47A 1N5VA 1APSA 2NLWA 1HQEA 3ONQA 4DN9A 4U95A 1U1QA 2XYHB 1PYTA 2BMBA 1RT1B 2F65A 4CO0A 3R5AA 1Q8IA 2NXEA 5FIIA 5FDLB 3L9ZA 1R31A 1S7IA 3R27A 3TOQA 4C3MA 2ZH3A 2AP6A 3FBCA 3IGVA 2HRTA 4KFBB 3TP2A 1C1BA 2BEFA 3VCDA 4RBTA 3AB2B 3UR0A 5JJBA 1YZ7A 4H4MA 3G96A 3VGVA 4GMKA 3FEZA 3UN5A 2EFOA 1TL3B 3G6ES 4TY8B 3M2VB 2CUYA 1ZTTA 4X4QA 3PHEA 2A2DA 3MOJB 3EVOA 1K9MT 1S7HA 3F73A 3CJ5A 4DV1J 5IXUA 4YOEA 2QO3A 1ZM4A 3IBWA 3DLGB 1ZETA 4CI0B 3DLBA 2DNRA 2F4VJ 2DGQA 3T6BA 3IMQJ 1KBRA 3GIJA 2CPEA 2EG1A 1RT4A 3JYTA 4DR2F 4ZCLA 4NLYA 5KOWA 3U1MA 3CIMA 3NRBA 2G0IA 5FLXU 1YJUA 2Z4PA 1T0TV 2ZEJA 1UEKA 5F41A 4ZK7M 3HM9A 3LO3A 4NXNF 5GADU 3S6EA 4DV3F 3AH6A 1RBOB 3O8WA 5B0AA 4LRAA 2CQDA 5ETPA 1JLQB 3MI7X 4W4MA 3ZFVA 2PI5A 1FI4A 2CG4A 2YNHA 2CA9A 1RBAA 4LRBA 1NH7A 2QA4G 2XZTB 2LQ9A 5KFCA 3RGIA 2HLTA 2ZBQA 4F26A 2JRSA 1PJ5A 4PQUA 1XNRJ 2OTLS 3H8YA 3BO4A 2L08A 4A8MP 3PKYA 1WC6A 3CD6S 1FXRA 1HMVA 2W7AA 4WE1B 4ZVOB 4ALZA 4LF1A 1KR4A 1X4BA 4DV6J 1U09A 2DYAA 4HDHA 4UZBA 3R6LB 2V67A 4U96A 3HK2A 4NI2A 4H4KA 1JXEA 3TAMA 4KTQA 2XO6A 1F3FA 1R27B 5EWEA 3TQEA 2M88A 4K8RA 4DV5J 2LXUA 4ANDA 3MPYA 3TNVA 1X4EA 3DI6A 1REVB 5J2PA 1IXKA 2R7QA 4RUCA 2PA3A 1HNIB 2L9DA 5B7WA 2K3IA 3OL6A 1M5KC 2FLLA 4NXMF 2G2YA 1EX8A 3CPWR 4B3TJ 2V68A 3LP1B 3SSSA 2H54B 1T9UA 4O0NA 1RYRA 3SZ2A 5HMYA 4BC7A 1HNXJ 4IH6A 4USHA 2VOPA 4I2QA 2ZH2A 5CYMA 5KFJA 5B0FA 4L74A 1NRKA 1D1UA 1BHNA 4L3KA 4CH7A 4ZCMA 1TZ0A 4WXOA 1VQ6S 4NASA 2HW3A 4LT6A 2H65B 2DNZA 3RBDA 4URSA 3V2UC 1G3OA 2J9CA 4LIWA 4DQQA 2HEKA 1UMJA 3NY0A 4DS4A 1JLBB 4B9UA 4YHHF 4E0DA 3TVYA 3W3SA 2C42A 1LQ9A 1T94A 1AZSB 4ED8A 1EB0A 5LSOA 4DUYF 1S57A 3IWNC 1YSJA 3RU0A 1FHTA 1FDNA 3GZ7A 2VJUA 4JI6J 2EWHA 2WB1D 3ZTPA 2YX1A 3OL9A 3MAQA 3QRQA 2B4PA 5B0GA 2XHWA 4B9VA 1UEVA 2FVPA 2OAUA 3I55S 1ZBTA 4RW8B 1S1WB 1KN6A 4U7UD 1FRIA 2OD4A 3EDRB 4O0IA 1JLCA 1XWLA 1TUVA 3P4UB 4PXCA 4FBUA 2ZUAA 2ZC4A 1E6VA 3TVKA 3UDLA 2IVYA 2CQBA 2KVQE 4Q8EA 4OX8A 4OHXA 3U7JA 4WF9Q 3MMCA 1XERA 3DLKA 2V9KA 4P7TA 4LF4J 4WWSA 2LEBA 4K4SA 1MMLA 3T1YJ 1MMDA 1N0VC 2RH3A 3SXLA 4KV8B 2RQMA 4TQRA 2PFDA 4I2PA 1X0PA 4TLRA 2D3UA 4X4VA 1RHQB 3CNQP 1RAHB 1FA0A 2FGOA 1F9HA 3A4TA 1S10A 4O44A 3TEGA 3EJMA 2YKMB 2ZH5A 4OYBA 4DZ6A 4DQPA 3BGOP 4ZVRB 5F9NA 3AY0A 1RTZA 4K0KJ 1YITS 4Q45A 3PHTA 5E5NA 4KR0B 4CLLA 4RW6B 2HQCA 1RTDA 3EZ5A 3H0PA 3SI8A 1MWQA 3IP0A 3M1VA 4LFBF 3TARA 3DOMA 2ZZNA 4XPCA 2LDYA 3GIRA 4LUBA 2MZTA 3NOGA 1FF2A 3D0HE 1D9FA 2NCKL 3RAQA 3CJQA 2MXYA 2QMXA 2VFUA 3ENAA 4OL8A 2F3JA 2ASJA 3OSPA 1K1QA 2VFTA 4NWBA 2YVSA 3P5BP 3M2UA 4MIAA 3CJ8A 3T1AA 1P6TA 5ETKA 2FPHX 4YFUA 4ECVA 3HD2A 4H4OA 5CCLA 1Q78A 1CULB 5HATA 2HMIA 2XQCA 1N52B 3IM8A 3V6DB 4OX9J 3R3TA 1UPMB 1WEZA 5D4LA 2YY3A 1FK9B 5D3GB 4LFCJ 1S99A 2QGFB 1JLFA 3MEDA 3LAMA 1WTBA 2E1PA 1VGYA 5KG1A 1T8EA 3Q2SC 4N76A 1RTIA 2Y9HA 4FNIA 4O4GA 1WKJA 3P49B 3D7SB 1TKXA 2ZHOA 2F8EX 5KOXA 2HRYA 3N79A 1TU0B 3GV7B 1AB8A 2BRLA 2VJVA 1WHXA 1RT3A 3SV3A 4LRCA 3FCHA 4PXDA 1L3KA 3UD5A 3MCOA 1UJ4A 4OJGA 1SKSA 4RR5A 3DMJB 1L3TA 5A8RA 4FNHA 1VQ4S 3UDVA 1N5YB 4LF6F 1VQLS 1A7GE 5AXLA 2FVCA 1OQ3A 2UUWA 2HFUA 3HSJA 1W26A 1WOOA 2B9YA 3ISND 4L75A 2XWXA 3Q86A 4ZVUB 4TYBA 2L48A 2HHVA 3HULA 3DM2B 5DM7Q 5D8HB 2E5HA 2M4MA 2ATLA 2ZJRQ 1HNZJ 1VQ5S 1M0SA 5HJXA 4OV6A 3PW7A 2I5JA 5DLFA 3C66A 3NLCA 1NU4A 1C4CA 2EI5A 1S1UA 4ZPDA 4OLPA 2NUUG 3VQSA 2LA4A 3EVMA 5EX3A 1U45A 1ZM3A 5E0OA 3IXQA 2CPYA 3IAS9 2JFDA 2GGPB 3EWGA 4QWDA 1HR0J 4RJVA 5A6PA 3RW7A 3NGSA 1I51B 2V4JA 4NLGA 2ALZA 2ASLA 2ZE2A 4DCJB 2XY5A 5D0GA 4CM2A 2HVZA 3FFIA 1WI6A 5KG2A 1JLEA 4V19X 1S49A 1PJ7A 3IAM9 4I7FB 4O3SA 1OPZA 5FJ4A 2V8PA 3H5UA 3BGRA 2ZJQQ 1RAAB 4S0MA 3I5CA 4DG1B 4CQ1A 3TEHB 1RDRA 1S1VB 4XTTA 2QMUB 2MLYA 3MECB 5LJ3Y 2NPFA 4ECRA 5C2GA 1NLKL 2AEMA 4F50A 1FCAA 4DSFA 2Q6CA 3M8QA 3U1LA 1SJ3P 3PJ9A 4Y2KA 3OTBA 5I3UA 4DFJA 4ILMA 1NM2A 5C7PA 2ZD1B 4UY8T 2BJ1A 1U8WA 2XB2D 2EFNA 3CVKA 3GIKA 2XY6A 2OIHA 2OPRA 2C22A 3OTOF 2DY1A 3BSNA 4C9DA 4DV2F 4NEZA 5LL6d 1JNZB 3X3UA 3GILA 4M5LA 4MTPA 3QRRA 1FESA 3CDAA 3B78A 2E5JA 3H2LA 4G1QB 1XTZA 5KG3A 1TL1B 2QLXA 4DPWA 2BE2B 1SUQB 1Z2ZA 5I3PA 1AYEA 2WSCC 2HHHJ 4BC9A 2BJ3A 1AT1B 3HHLD 4K4TA 1NZ8A 1CS4A 1C0UB 3T5JA 1UP1A 2C3YA 4RL1A 2UVVA 3M6WA 2KKHA 3CCWA 2YX7A 5F8LA 2AZ3A 4OYXA 1WHVA 1P8GA 1S1TA 5L9NA 4OZ3A 4QW8A 2DHAA 1TKZA 5C25B 3L7UA 3OR1B 4TU9A 4QR1A 3D66A 1VJQA 1GMVA 3HHNB 4USJC 2XY7A 4JI5J 2W8LA 1TUGB 3BKFA 1SJRA 4C8MA 1T7PA 2FJEB 1NAQA 2J0SD 3FZBA 3CCZA 4DV7J 1SJ4P 2GVDB 1WSRA 3BGFA 3G4SS 1LW2A 3PEHA 1NSQA 1NDPA 2G0CA 3MZIA 2KU7A 5HQMA 3GJRB 2AHOB 4DR6F 1RT1A 1TVRB 2LXIA 4FDFA 4K4UA 1S79A 3NNAA 5FDLA 2FD2A 2JWNA 4FF1A 3BN7A 2B8PA 4KFBA 3KMSA 3R7BB 3FUYA 5H9FK 2GVZB 4OHVA 3G6VA 2LMIA 5HAOA 2BX6A 2Z2MA 3QO9B 5LMUF 4CLTA 1TL3A 4OHWA 4TY8A 3M2VA 1XC9A 1KWMA 2AJ1A 2XNRA 2H4YB 3AAWB 1TTHB 3KLIB 1S48A 2ZZTA 3HFZB 4A8SA 1D8YA 2CVEA 1S12A 3DLGA 2EK1A 4NLUA 1H2UX 3CC7S 1NPKA 3SBMA 3TR5A 4L73A 2C2RA 4C98A 5IT9Y 3DDNA 3UN2A 4JOUA 1FT8A 1PBAA 2H1YA 5IWAJ 4LF5J 4HHHA 2IIHA 2RIJA 3MMJA 3TA2A 3PY8A 5GAGI 3AOAA 4DR5J 3KG1A 1Y3KA 2ZH6A 3T9ZA 5K9FA 4ES2A 4YB1P 3MR3A 4K4YA 1JB0C 2RUSA 2HGLA 3A3PB 1JLQA 1X8DA 2O1PA 3CWJA 4MKBA 4YQWA 4EYIB 1S59A 5D15A 3M2RB 4F2RA 3NS5A 2KM8C 1UAWA 4QYZK 2FJXA 1X31C 2DXEA 3A1YG 5E3QA 3NMAA 1D9AA 4XK8C 4FS1A 4KHMA 1BQNB 2XO7A 2F8HA 1U0SA 4Q7AA 2WVFA 2YKNB 2MLZA 3H25A 4RBVA 3G6YA 2K06A 4NZ0A 1R8HA 2FHOB 2QA4S 4DPTA 3TAPA 1NDLA 1DHMA 1FFSB 1FJGJ 1UEUA 2CVIA 4K2JA 1WF0A 3CD7A 5A2QY 5BYRA 1DAXA 4OZJA 1SKRA 1Y5IB 5DG7A 3HSDA 1R7IA 5E33A 2EEYA 2R42A 1WC3A 2IJFA 2QA2A 2PC6A 2W25A 4CLUA 4DS5A 4ECTA 2GQ2A 3H2VE 1SQFA 2YX4A 1CC7A 1RU2A 5D4OA 2LP4A 2AGQA 1NDCA 4C97A 1H7XA 3KHGA 4ZPBA 1REVA 2RRNA 2AJ2A 4LQ3A 3FCWA 2EPIA 2Z56B 1HNIA 3W7BA 3TAQA 3HSGA 2QFIA 2JLFA 2CPXA 1DY3A 2I6WA 4ZLPA 3LP1A 2G0JA 1TMMA 4DV4J 2AQ4A 2ZBPA 2CPJA 4OIXA 4V1Ak 1QAIA 1RAIB 4DF4A 1SV5B 4B3SJ 5SZTA 4RW4A 2VKRA 1VI7A 3HZGA 1IBMF 4OZ0A 1D8ZA 1D3WA 3RB0A 3PCOB 2ZM6F 1N36J 1LWEB 3MEKA 4F67A 1KDNA 4WYLA 1JLBA 4KBIA 2BOAA 2CWKA 2H3EB 5JVGQ 3NGRA 2X1AA 2V2VA 1AZSA 4M1KA 4EZ6A 2UUBF 3R5GA 5E41A 5BR8F 3HI9A 4JI2F 3S8SA 2OELA 2VV5A 4G1PA 3FCVA 8AT1B 4JI3F 2WSEC 3J80U 3OLAA 3D54A 3VGSA 1KLMB 3I96A 4FYVB 1OYDA 3I0SB 3BDEA 4H54A 1IR1A 4IOAQ 4NLTA 4CLPA 2VC1A 2IDEA 3W1YC 1GXLA 4DSKA 4K50A 1UA0A 1Q8BA 2QSWA 2IYIA 4RW8A 1S1WA 2NXNA 4J91A 1BLUA 5KFQA 4CLWA 4CT8A 1B3TA 1RWOB 3B8HA 2RVJA 5CHCB 4DR7F 3WZ0A 4X65F 4IYQA 3VAKA 2DH7A 3W9IA 5IV4A 2XCAA 1R0CB 5IC6B 1D9DA 4FKXA 1BUXA 4AFFA 3D3CJ 2W9CB 3I5BA 1U2CA 3T9NA 4P2MA 2J6TA 3GV8B 1CPZA 2RD5C 1B0TA 4J9VA 3RB4A 5GAEI 5LMNF 2DEJA 1FDBA 4WFZA 3OHBA 1S9FA 1F5CA 5J2NB 2EXUA 1PYSB 4KV8A 2QA1A 2UU9F 1CQNA 2PI4A 3HHKA 2LQ5A 2VBZA 3PKMA 1DJ0A 4F7VA 2DR8A 3RB6A 2HHSA 4A48A 4IRKA 1FDDA 1JWWA 5KFKA 3MM6B 5ETOA 1BE4A 2UXDF 3OHAA 5CQGA 2YKMA 4EK2A 4QCLA 2VQFF 5GMDA 2WRMA 5D0RA 3P5TL 3ZZPA 1DQ9A 2K7JA 2E7WA 4MK9A 5HI7A 3UE2A 1Q5YA 2LLZA 1UL3A 4RW6A 3EPIA 2AIRB 3I4PA 3LGNA 4EMDA 1EKSA 3PO4A 3OJSA 4KO0B 1RHMB 1O8BA 4NEYA 2VH7A 2DT9A 4NXNJ 3U02A 4I69A 4RZRA 2LYVA 3ICLA 3GV5B 4DV3J 3H2UB 2B8QA 1T9TA 3DXSX 2MY7A 5DQHA 4J9SA 4NLXA 2YWEA 3CCLS 2DGXA 3PYEA 2KVIA 3OVAA 3M8WA 4U7CA 4DV1F 3AFGA 4UUXA 4AD6A 1WSVA 1MG7A 2MGZB 2UXCF 3ENWA 5EGYA 2CZ4A 1CULA 2Y0BB 1U2FA 3K0JA 1HI1A 1T02A 3V6DA 2J0QD 1CSJA 2J7UA 3UW1A 2F4VF 2MZSA 1FK9A 2V4RA 3PZPA 5D3GA 1RB0A 2UVWA 3QT5A 3EDQB 4DX8H 1RT6B 4ZP8A 4ETXA 3PW2A 2OMOA 8RUCA 1NK7A 5BXIA 3TZYA 4DFKA 2P6TA 1RYSA 4C8KA 1YTYA 4LVOP 4PZVA 5AT1B 2MSSA 1HNVB 3R8YA 1YJRA 5CD4A 3DMJA 2ZHAA 4LFAF 3JQMA 4JV0A 2OSRA 1QSYA 4I64A 4X4PA 4ERDA 2V4QA 1N5YA 2B9WA 3K5PA 1UVKA 4BHQA 1HYSB 3QLHB 2UV8G 4G1IA 1U1MA 3AJDA 1X9SA 4AE5A 1SH2A 1YQHA 2IMOA 2C2OB 3DM2A 4DN0A 4NXMJ 1NNDA 2CJAA 1WI8A 3KJVB 4ZCKA 2KG0A 4X64J 1RT7B 4P2FA 4G3IA 2HS0A 5H9EJ 5B0EA 3BB5A 3J7Z5 3CC2S 3RJMB 2YH0A 2POKA 2LXFA 4ZCIA 1IKYA 4U67Q 4F2SA 5KFSA 3RAMA 1FXDA 4WYWA 5KT4A 4TQSA 2G1HA 4TU7A 2GGPA 3M6XA 2MLXA 1FD8A 2KJVA 2AGOA 4U7UK 2BDPA 1MW7A 3IWLA 3QJPA 4DX5A 4N41A 4DUYJ 3E2EA 2R7OA 3HT0A 4HKQA 4YB6A 4LBPA 4B3RF 2B51A 2K7KA 3DNCA 4B3TF 4N5SA 4C8OA 1A6LA 4I7FA 3BR9A 1R43A 4CDIA 1KEKA 1GTHA 1HNXF 4F0MA 1SJQA 4IG3B 4DG1A 1OSCA 3G82B 1H2TZ 2QSFA 2HIQA 1GMWA 4C7QA 3MECA 1VQ9S 4CNYA 2UVUA 1YVFA 4RX6A 5ETTA 4UOFA 1N0UA 2ROGA 4IUFA 3K8WA 4NLPA 2N7CA 1UVIA 4PR6A 3WIVA 3OLBA 5J2QB 4NCBA 3KLGB 2R4FA 3AJ1A 4HL9A 4CIOA 3BPDA 1FWKA 1FTCA 2H5EA 2WVEA 1IVZA 5MAOA 2BXJA 1DRZA 2MZQA 3DYAB 3IRWP 1RA7A 1WC0A 1VRTB 2RHSB 4MKAA 2XSJB 4K59A 2F63A 2F40A 3A13A 2DITA 4RO0A 4JI6F 4G1QA 3RBZA 1FKOB 3UPFA 3ITHB 5K8MA 2Q6BA 2OKQA 4IFYA 1TL1A 1YZ6A 5K8OA 3LANA 2QL7B 1SUQA 3P3DA 3R5CA 4AL7A 5H1SV 4B9SA 4L72B 3PO5A 4Y2AA 3H5XA 2V8GA 1X4GA 1C0UA 4KGZB 1BWVA 2CQGA 1PCAA 4GVLA 1Q4RA 1VYAA 4F02A 1VBYA 2MB0B 4FXVA 3JAMU 1MN9A 4HT5A 5DG9A 4LIRA 3TX0A 4YP3A 1F6TA 1ACMB 2HQGA 4EBCA 1YLXA 5CA5A 3CJTA 5KG4A 4XDDA 3N28A 3GR1A 3EPGA 3V6JA 2OUGA 4FVMA 4WK3A 1KQGB 4GKJJ 2Z2LA 1X0FA 2B4VA 1MWZA 4QZVB 5C25A 3UI3A 3R7NB 4LFBJ 2E1MC 3HVAA 2HBRB 3UVJB 2EBEA 3KOAA 1X4HA 2QRRA 3IR6B 2B5JB 2W2OP 4LVNP 2P2CB 1I6JA 3HLUA 4QIGA 4LF4F 2BBEA 2BJDA 4RWWA 3V4IB 5K14B 4X4OA 4RNNA 3DRYA 3QNWB 1R6VA 2VB6A 1W2BR 5EWFA 3MD1A 3Q0AA 3BDPA 2C2ZB 4C8YA 2GVDA 4R8UB 1O6XA 4K7QA 2CJXB 3GJQB 3J7YI 1JXLA 3CGIA 1JJ4A 4ED0A 4LF7J 3N5FA 4ZMMA 4KY3A 4P6QA 4JYAF 1TVRA 4Q8FA 1S6PB 2VBXA 2IRXA 3CTRA 1RU1A 3HVWA 1FJCA 1IKWB 2CPIA 4YUDA 3VZHA 1HI0P 5B08A 4K0KF 3JSMB 1U2RA 3BQ0A 3C6UB 5M2RA 1U1KA 2GVZA 2HHWA 4QIEA 2C2NA 1CLFA 4YDXA 3QO9A 3KWMA 2BANB 1B7FA 3K5OA 4F4WA 3I5AA 3HX9A 5LT5A 3GR0A 3N6NA 2MZRA 3KLIA 1HBMB 1U7LA 2MKCA 1OWXA 4EO8A 3W8GA 3RZAA 3HO1A 3MMBB 1H6KX 1KKHA 1ZOTA 1VQPS 1QE1B 2CJBA 2CPDA 4NYPA 3KXDA 5DDRC 1S0NA 4KT0C 2N4CA 4LF6J 1GXUA 3D1OA 4JI8J 2DR5A 4K4ZA 2CJYB 4P52A 1KHWA 1NMEB 1PAEX 2DK2A 2HQDA 2CQCA 1Y4ZB 2HVEA 3NGUA 2CZ9A 3T3FA 3PW5A 4QIVA 2G2ZA 2YWFA 3W62A 1X5TA 4Y28C 2HWHA 2OGUA 1UFKA 3LF0A 4EBDA 2G1DA 4GO5X 4CLKA 4YY3F 3WC2A 4PG4A 5CAAA 3M2RA 2RQ4A 4ZOSA 1WEYA 1X4FA 3KHLA 4OZLA 2MKIA 1BQNA 3OR2A 3KK2A 2YKNA 4LSNB 4RWXA 4ECSA 3C15B 1K8AT 2EC2A 2QLFB 2UZAA 1HWLA 2J7WA 2R8HA 2IAJB 4IKAA 1U6BA 3GJTB 1U1NA 1QJHA 2Z0GA 1IQTA 1PIEA 2J0WA 3BO3A 3M8YA 1HNZF 1NK4A 3AD8C 3IC1A 4RBUA 2OMLA 2FHKA 3H4BA 3K57A 2FLPA 1XR6A 1Z1ZA 4FS2A 1PILA 3CEDA 1N5QA 4HHJA 3GSDA 3LPEA 4C48A 4ZLLA 5F8NA 3C14B 3CMQA 1IWGA 4A8FA 2C1EB 3QIPB 3HF5A 2QT7A 4ECQA 3TVZA 4EO6A 2BA9A 4IG0B 2ZOGA 3HCXA 1Q8LA 2CZVC 2AX0A 4BS2A 1X5PA 2M70A 2WVDA 2OPSA 2DHGA 3D4JA 2OEJA 2WSFC 4ECXA 3BPSP 1Y00A 3NG8A 2JVRA 3OTOJ 2RHQB 4N7TA 4YB7A 5ETNA 3HFKA 3OTCA 4OZ2A 1TAUA 2F9DA 1TV6B 3KK1B 4CLFA 4P9SA 3SEOA 4KHPF 2RKIB 1SV5A 5CZVA 3TRGA 4PXEA 3TWZA 3MM7B 4WXWA 5HSPA 1NKEA 1X7VA 4HH0A 1UZHA 3ZZRA 1C1CB 3LGHA 4NZ6A 3LPYA 5J2MB 3EGWB 2ILZA 4MJKA 1Q79A 4C6AA 3FEXB 1LWEA 1DARA 1HBNB 3H5SA 3PDNA 1FNMA 3CJKA 4D3HA 2OI2A 3C6TB 1MROA 3G71S 4ECUA 2UUTA 3GFHA 3MXHP 3S1TA 1YK9A 3K17A 1G2EA 2IA0A 1J2VA 5CZXA 3AQOA 4WFNQ 3CB4A 4OYIA 1R0BG 1KLMA 2YWKA 3ZTOA 2BE7D 3I0SA 3DRRB 4CYUB 4JBCA 3LALA 4WJBA 3JXOA 1XEZA 2AKWB 1IBKJ 4RU9A 1RCOB 1RWUA 2AU0A 2R7RA 1PG5B 1ICEB 3A3OB 3MFHA 1FEEA 2YQ0A 4PG7A 3QT6A 3TQ1A 4RKUC 1ZA1B 1KONA 2PT0A 3ZNUA 2I38A 2QFJA 1AUSL 4UOCA 4WIIA 2FHMA 2NSBA 4XDCA 2IC3A 2V8DA 5EWGA 2B4UA 4MFBB 1SCJB 4CLZA 1EKRA 2EVZA 2D9PA 4EUVA 2W9CA 3CC4S 4DWIA 3QAUA 3ZO7A 3GYGA 1JKHB 4RUHA 2PO4A 1P1TA 2DNNA 4R0JA 5THWA 5DQIA 2HNDB 2OEMA 1HBOA 1VQSA 4B08A 5LJ5Y 4RUBA 1JLGB 2JEJA 5J2NA 4EZ9A 4R0EA 3QWPA 2HFNA 1S6UA 4UQTA 4LSLA 1N8RT 3BF4A 4LJMA 4C4WA 3I9ZA 1PSDA 2OFHX 3CJ0A 3PJXA 3GCWP 2CKWA 3MM6A 2COLA 3QGGA 3QGIA 2C2DA 2GW8A 3P96A 2MPUA 5EX0A 4KPCA 1V5VA 4WP8A 1VRUB 2HQFA 2QMWA 2LVWA 2RRBA 4FXWA 1A0OB 3UO0A 4MKVA 4PEOA 4J37A 2XS7A 1OO0B 1EZZB 2J9EA 1Q5VA 3V6KA 2GIFA 1CJKB 2NQPA 3KUGA 1LW0A 4OYPA 3DOLA 3KLFB 1B64A 3DGPB 2HVDA 1FNOA 3KNGA 3GIIA 2DNGA 3NOCA 5EDWA 2HNYA 1WOPA 4WFBQ 3N4WA 3HHLB 4ED7A 2EK6A 3CCUS 4QWAA 2FGCA 3M4XA 1M5SA 3G2XA 3RG6A 1HWIA 2XG8A 1K0TA 1N4LA 4DF8A 5L39A 1VQMS 4FZVA 2MGZA 1UFLA 2HZAA 3J7AN 1L3UA 2IHR1 1U24A 2WVBA 1L3VA 1JJ2R 2CPFA 4M94A 3RBXA 4ZVSB 5KFRA 2ZZMA 4DHVA 2BJEA 2M0GB 1RWMB 4C8ZA 5KG6A 5IWAF 3PYGA 1UZDA 4ZPAA 1RT6A 1WWHA 3DLJA 3GJSB 2Y8YA 2HWIA 2GQQA 2DR7A 1QUVA 2HHTA 3UCZP 2XMUA 1U1RA 3R5JB 2GV1A 3P8BB 3KLHB 3LOUA 1RI7A 2X51A 4P2XA 4HTJA 1Q1KA 3A3NB 3EICA 1HNVA 1FFWB 4WFAQ 2XMTA 2K2PA 1GAOA 2VFVA 1GFWB 4L76A 2FY8A 3VTIA 1SXLA 4TLQA 1LOUA 2RT3A 2VHGA 4UY85 3QLHA 2KXNB 2B4OA 2GZOA 2AEFA 1SJ1A 5CCMA 5DRKA 2QLBB 1JNRB 1G1XA 4ZS6A 2OSQA 2CQ0A 4AT1B 4NYOA 2OTJS 2DGTA 2Y0SD 1T05B 1OMSA 2AW0A 3WX4A 4JP8A 2CADA 3DRXA 5CABA 2ADCA 2F4FA 1EETB 1JJHA 4R5PB 1RTHB 1CJVA 2OEKA 1WG1A 4FN5A 2H5IB 4KH1B 3D6TB 4I1TA 1TR0A 3V5RA 4UT4A 3KJQB 3T6JA 2O01C 4Q44A 3CJRA 1IBMJ
chains in the Genus database with same CATH topology
2G0IA 1S12A 4PEOA 2IDLA 2G0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0I A;  1S12 A;  4PEO A;  2IDL A;  2G0J A; 
#chains in the Genus database with same CATH topology
 2B7C B;  4O3O A;  3R97 A;  3POT A;  2ZM6 J;  1S9E A;  1QUP A;  4HI1 A;  1F2H A;  3TUZ C;  3I6P A;  3IRX B;  4IOC Q;  5L1K A;  3SSR A;  5C2C A;  3VWS A;  2UUB J;  5BR8 J;  3IWX A;  3O6Q A;  4E8U A;  5FD1 A;  1DBD A;  4JI2 J;  2GO8 A;  5D4P A;  3GB0 A;  3PEJ A;  2D3O 1;  2G13 A;  2HIY A;  2W8K A;  4NL5 A;  4NRT A;  1WOR A;  3NCQ A;  1RCX B;  3GTY X;  1SKU B;  3BQ1 A;  1EP4 A;  4DV4 F;  2EFP A;  4QR2 A;  1MU2 B;  3H98 A;  3OFF A;  3G82 A;  2HBZ B;  1R0A A;  3VAH A;  4B3S F;  4O3R A;  4TKT A;  2U1A A;  2E9Z A;  4ED2 A;  3OPK A;  2JNJ A;  1HW8 A;  5AE1 A;  4Z7Y A;  2IM1 A;  1N36 F;  4JV1 A;  4DR7 J;  1U8S A;  5J2Q A;  3KLG A;  3W8P A;  4X65 J;  4M5K A;  2RUG A;  3WIU A;  4N8O A;  1SB6 A;  4A4J A;  2R8I A;  3DYA A;  2HBY B;  2CQ2 A;  1VRT A;  3MUV P;  3ET6 B;  2XSJ A;  3QPI A;  4M5H A;  2NXJ A;  3FKB A;  3ZXW A;  5CYJ A;  5LMN J;  5CD4 H;  1FKO A;  4X4N A;  3ITH A;  2BQU A;  5ETV A;  5F8H A;  4J9U E;  2BKP A;  1DTQ B;  3SCI E;  3WBZ A;  2E5L F;  4C3K A;  3KYL A;  4CO5 A;  2QC3 A;  1YDL A;  2P9E A;  1F5A A;  4LSZ B;  3N01 A;  4X4S A;  2HPU A;  2UU9 J;  1Q8K A;  3NL0 A;  1NEE A;  2KT2 A;  2H9Z A;  1M5P C;  4PYA A;  5KFH A;  3FBB A;  3M32 B;  3M9O B;  3Q22 A;  3D0G E;  2DH9 A;  3HKZ D;  3OUY B;  5F8I A;  3MHY A;  1DUR A;  5RUB A;  2VQE F;  1XQI A;  1B99 A;  2J9D E;  2JEI A;  1X5O A;  2WOM B;  3VQT A;  2DPJ A;  1RWW B;  5F3T A;  2RF2 B;  4DFM A;  1RHR B;  1FWL A;  1WEX A;  5DZ7 A;  3UVJ A;  4P10 A;  1JQG A;  4NE9 C;  2B5J A;  1UKU A;  1DFD A;  2U2F A;  2PE8 A;  1FD2 A;  5K14 A;  4J9P A;  2VPX B;  1XMB A;  4YN3 B;  7FDR A;  2PDA A;  4R8U A;  4JV2 A;  4N8N A;  4O4R A;  3DLL Q;  1X4D A;  3THT A;  2MKY A;  3ILL A;  2UXC J;  3K89 A;  4DPU A;  1WUU A;  4I6A A;  1IKW A;  3DLE A;  2RB7 A;  2QTW A;  1RWX B;  2RQK A;  3JSM A;  3M30 B;  1U0H A;  4HEA 9;  2UUA F;  5DGB A;  2XMW A;  4AL6 A;  4B9M A;  5G4D A;  3HHD A;  4QWE A;  3M8S A;  3C6U A;  2VL1 A;  2B6A B;  1R8P A;  3SFU A;  1W2I A;  3R5D A;  5IZH A;  2YTC A;  3R1L A;  4D3G A;  3OFH A;  4DPO A;  4PWD B;  1IKX A;  4RUA A;  1NHK L;  2BAN A;  5M2P A;  4DEZ A;  1MMN A;  1HBM A;  3CUN A;  2HFO A;  2H48 B;  4ILR A;  1KNZ A;  3MMB A;  3ILO A;  2P9G A;  2ZBI A;  2J5A A;  4LFA J;  1QE1 A;  3HSZ A;  2JJ4 D;  2QYC A;  3TJ9 A;  4ZVT B;  2EG2 A;  5B0B A;  2DPI A;  2D3O R;  2XYG B;  3UCG A;  4QYR A;  4DPY A;  3GMG A;  5T41 A;  5IOL A;  2RU3 A;  2DNP A;  4WK1 A;  1PC5 A;  1H98 A;  4YDD B;  1SPB P;  5C24 B;  3MOZ A;  1GT8 A;  3CDU A;  4UZC A;  3MTK A;  4TY9 A;  2BUN A;  1V6H A;  2PEB A;  1VBK A;  5IT4 A;  1CJU A;  4ANC A;  2DNH A;  4JV5 F;  1B7Y B;  2XMK A;  5E3P A;  4EI2 A;  9ATC B;  3FZ2 A;  1U4B A;  4ELT A;  1KFD A;  2GHP A;  2MY8 A;  2RSQ A;  3BV8 A;  4DQI A;  4PKD B;  3FNN A;  1S5Z A;  2AJ4 A;  4YS2 A;  3T1H J;  2HZC A;  1JJC B;  4IDK B;  1KHV A;  2RQC A;  2A2C A;  2O66 A;  5KFV A;  2BOP A;  2VF3 A;  1WAC A;  4R25 A;  3D67 A;  4QIW D;  1J5E F;  1QAX A;  4LSN A;  3C15 A;  1VOM A;  3IG1 B;  1PKU A;  1QDU B;  2PGC A;  1KOH A;  2IAJ A;  2DR6 A;  2XMM A;  3R6G B;  2HGM A;  1RXO B;  4B3R J;  1FNX H;  2BQ3 A;  2QX0 A;  4A46 A;  4HDG A;  3ELH A;  2ZUG A;  2FYX A;  4X64 F;  1NCL A;  1X5S A;  1RAD B;  5IM0 A;  3HKW A;  2JX2 A;  4I0W A;  1ZS6 A;  2E1A A;  3W9J A;  1UW4 A;  1C4A A;  2P8I A;  1RHJ B;  1RWV B;  2J8A A;  3I9V 9;  3QIP A;  4ZN1 A;  2CRL A;  1XR7 A;  1HQ2 A;  1QSS A;  4IG0 A;  2FJW A;  3K8V A;  2PMH A;  2V9W A;  1KSP A;  1M1G A;  4CLY A;  4ZP6 A;  4M5J A;  4OX6 A;  2GJ2 A;  2B9E A;  2MZ1 A;  1NHU A;  4X4R A;  3BH6 B;  1HNW F;  2W2P P;  2I9S A;  4CO1 A;  3QWU A;  1BMQ B;  4NRU A;  4ENO A;  3RR8 A;  5AXM A;  3NCR A;  1UWB B;  2HBQ B;  4X66 J;  4M95 A;  3DU5 A;  2LQ8 A;  4ED5 A;  4BBY A;  2BVZ A;  2MQN A;  3UR3 C;  2GMH A;  2GC8 A;  1ZPV A;  3F0N A;  3KK1 A;  3Q8Y A;  3VVT A;  1T9X A;  4EEY A;  2ZBR A;  4Y2M A;  4RW9 B;  2RKI A;  1JXV A;  3JTN A;  4ILL A;  4WCE Q;  4DU7 A;  1YRU A;  5D78 A;  3MM7 A;  1PJ6 A;  1CBK A;  2HHP A;  1C1C A;  3HD1 A;  3UWT A;  3OTD A;  4YB5 A;  2KT3 A;  4W90 B;  5K20 B;  4PG6 A;  1NJW A;  1VJW A;  1RGV A;  2KO1 A;  1HBN A;  3CCS S;  1QD1 A;  2BW2 A;  3MM5 B;  2CQP A;  3C6T A;  2ZOF A;  3HHE A;  3B6B A;  3KG4 A;  5GVQ A;  4ZPT R;  1LK5 A;  4ZJQ A;  3NP5 A;  2XZD B;  1HAR A;  1VC5 A;  3H7H B;  1CG2 A;  3F44 A;  5ETL A;  2R8J A;  3BKU A;  4HR2 A;  4I6W A;  5B0D A;  4UUW A;  2NYI A;  1IKV B;  3DRR A;  4CYU A;  2AYM A;  2OH2 A;  2J6S A;  3D68 A;  3PFE A;  3GP9 A;  2E7X A;  2YKP A;  3TJA A;  5IC4 B;  3UNY A;  3DHX A;  1S76 D;  2ZNZ A;  5L38 A;  2YPY A;  4ZIT A;  3ZZY A;  4NOH A;  1LWC B;  4K5S A;  3T5L A;  5KG5 A;  3S01 A;  3W9H A;  5E3C A;  1GX5 A;  3L09 A;  2BM0 A;  3DRP B;  3G8Q A;  4JYA J;  5A8K B;  1WEL A;  1Y9O A;  1TK0 A;  4MFB A;  1K73 T;  2DY9 A;  2FVR A;  3AHP A;  3V6H A;  5HP1 B;  1F3V A;  4UTG A;  4DV0 J;  2XSF A;  1JKH A;  3G6X A;  2LU2 A;  1YIJ S;  4GKJ F;  2BW7 A;  2PMZ D;  5BYQ A;  2AD9 A;  3HXM A;  2HND A;  2DVI A;  1F9E B;  3G8S A;  3MEG B;  3EYZ A;  1ELO A;  2XI2 A;  4QYZ J;  2GHV C;  4DUZ F;  3CCR S;  1DQ8 A;  2ZBC A;  2JLG A;  4DBQ A;  1RWP B;  1PGZ A;  5HQL A;  3WDO A;  1IWA A;  4UQG A;  4WU3 A;  1WHW A;  4Z7C A;  5U47 A;  5L1L A;  4P75 A;  5KFU A;  3J81 Y;  4HVZ A;  1OPI A;  3D28 A;  3TI0 A;  4LR8 A;  1VRU A;  2WB4 A;  2JVO A;  3HT3 A;  4LF7 F;  1V5I B;  4EU0 A;  2N3O A;  4I68 A;  2MEW A;  3BEG B;  3EUN A;  1FDA A;  3LP2 B;  1CJK A;  2K3K A;  4OHY A;  4L6V 3;  3NWG A;  3KLF A;  3DGP A;  3BYR A;  3FSY A;  3C8Y A;  4Q2L A;  2R2T A;  1SKW A;  1GX6 A;  3HHL A;  4YY3 J;  1Y10 A;  5KG0 A;  2W9B B;  3KUH A;  2KDO A;  5JMN A;  1GNK A;  3ETM A;  3MWB A;  3M9N B;  1NB7 A;  3KG0 A;  2KFN A;  3VV2 B;  2IVF B;  2KZM A;  2WW4 A;  5AE2 A;  2CPZ A;  1S9G B;  3CT9 A;  1VDH A;  2KYZ A;  5KFX A;  2RML A;  2C3O A;  5F9L A;  3B4M A;  4ECY A;  3GU0 A;  4JI8 F;  3HZE A;  3Q24 A;  3K59 A;  4DXL A;  2AGP A;  1U48 A;  2CG8 A;  1U02 A;  3AOD A;  3FMB A;  1LFP A;  2BJ7 A;  3M1V B;  4U6P A;  3QSY B;  1LEO A;  4C8L A;  2ASD A;  2LA6 A;  4B9L A;  3BRE A;  4OYZ A;  4RU2 A;  1TFW A;  1E6Y B;  3KLH A;  2BZ2 A;  1XK8 A;  2ALY B;  2FJV A;  3Q89 A;  3THV A;  2DH8 A;  3M9M B;  4WZQ A;  2HVI A;  3IM9 A;  2X3D A;  1WD6 A;  1ROF A;  2QZ8 A;  2FJD B;  1NZA A;  4C11 B;  3BZQ A;  2CXE A;  2V5H G;  3CIZ A;  2HMI B;  5I42 B;  1ZYQ A;  3AXK A;  4XIU A;  4IH7 A;  2OP5 A;  3G8T A;  3FVY A;  4K2X A;  2DEI A;  1SC6 A;  5KFA A;  1FE4 A;  3GWC A;  1T05 A;  3KDN A;  3SCL E;  1YBA A;  1NJZ A;  5KT3 A;  1K44 A;  1XNQ F;  5M2U A;  1XMQ J;  3ZNJ 1;  2VA3 A;  2ZWP A;  4OQJ A;  1WC1 A;  1HQU B;  1EET A;  4R5P A;  2XEX A;  3CF5 Q;  1F1B B;  1RTH A;  2PII A;  4KHP J;  5J1E B;  1LWF B;  3R9L A;  2IM0 A;  3C19 A;  1N54 B;  2LQJ A;  1PC4 A;  3D9B A;  3SFG A;  2BKN A;  1F5B A;  4Z2X A;  2ZOM A;  4AYB D;  1ITP A;  3CUL A;  5FLX Y;  2C2M B;  4PXB A;  2W4D A;  4B3M F;  5A8R B;  4HT7 A;  2DXF A;  2H5J B;  3DN9 A;  3H5Y A;  2DTJ A;  1HHT P;  4QR0 A;  1IUJ A;  4KIA A;  2VU5 A;  1R6Y A;  1NPR A;  4DU8 A;  4F3O A;  4USK A;  4Q2M A;  1S77 D;  1VQ7 S;  3PX0 A;  4ZJO A;  2VFS A;  4OMF G;  2HFS A;  1T11 A;  3MUM P;  1S6O A;  3LTO A;  5KFB A;  4Y3C A;  2GMJ A;  2M7S A;  1MU2 A;  4DR3 J;  3F56 A;  2WON A;  1S1U B;  3L95 X;  3AA9 A;  1VQN S;  3HFV A;  3GFY A;  3EZO A;  4DQS A;  1SQG A;  4DUT A;  3P6Y C;  3PNI A;  3K5N A;  2V50 A;  4JI4 J;  3FDS A;  4F04 B;  2AMC B;  1JLA B;  1CQM A;  1XJW B;  4CNZ A;  3PIO Q;  4WKY A;  1Y5N B;  4DCO B;  2ZE2 B;  4TU8 A;  3MMA B;  2JL9 A;  2VPW B;  3PRB A;  2APO A;  3ET6 A;  3RUB L;  2IM2 A;  1HL6 A;  1KRP A;  4ZJL A;  1TP7 A;  4RNM A;  4BWJ A;  1K47 A;  2IJN A;  2H4W B;  6AT1 B;  1DTQ A;  5JXS A;  1QTN B;  4QQB A;  3OQ2 A;  5DM6 Q;  2XLI A;  2M2B A;  2DJW A;  1IBK F;  3HDS A;  3BO2 A;  3NNH A;  5HQ8 A;  3M32 A;  1RKI A;  1AA1 B;  2HWT A;  4MMO A;  1YHQ S;  2WCX A;  3VR1 A;  5JUM A;  3OUY A;  2KN4 A;  4NLS A;  3PW0 A;  6FD1 A;  3E8O A;  3UD4 P;  2WOM A;  3MPW A;  2JFK A;  2RF2 A;  2RJZ A;  1BY9 A;  4K5R A;  3PG9 A;  2ZVS A;  2O3D A;  1C2P A;  1U49 A;  2Z2Y B;  4FBT A;  1TKT B;  3BQ2 A;  4ELU A;  4F4A A;  2QE5 A;  5K5M A;  3DHW C;  1RAF B;  2KG1 A;  3BYP A;  1GMU A;  4CTA B;  3VVU A;  4OYW A;  2DNK A;  3ULH A;  3VF0 B;  3VAG A;  2HQI A;  3MPV A;  5CH7 B;  2QV6 A;  4EWT A;  1T3O A;  4ETZ A;  4ZVF A;  1V3Z A;  1B70 B;  3KUE A;  4M5I A;  2IYG A;  3AXM A;  2FZK B;  4P72 A;  5HBM B;  1AFJ A;  5E7O B;  4QJV A;  5GAH U;  2FQQ B;  3QYY A;  2F9J A;  2BJ8 A;  1ZH5 A;  3G9C A;  4IO1 A;  1YJW S;  2B6A A;  3R1H A;  2MJU A;  1KS2 A;  1FRJ A;  4PWD A;  4M5D B;  4FF2 A;  4KGX B;  2DRD A;  4NA1 A;  3Q23 A;  1ZPW X;  2CYY A;  1RHK B;  4OI3 A;  1LW2 B;  3ILJ A;  4Y2I A;  1WF2 A;  3HVR A;  3M8Z A;  2E44 A;  1VMB A;  3GLJ A;  3SV4 A;  3I32 A;  2UP1 A;  5LXR A;  1A9N B;  2CIM A;  2D1C A;  3N5B A;  2FTR A;  2QL9 B;  4USI A;  3QGH A;  1H73 A;  5C24 A;  4HHU A;  3W60 A;  4PPD A;  4F8R A;  5A0Y B;  3GIM A;  1VCT A;  3OXF A;  3DRS B;  3ISZ A;  4WE1 A;  3OV7 A;  3ISN C;  3FK4 A;  3KJN B;  4BCA A;  4X2B A;  3TYT A;  3M8P B;  3NGT A;  2ZFH A;  1EJ7 L;  3VGU A;  3ETO A;  3EXC X;  4IDK A;  5J1N A;  1BQM B;  4MYT A;  1AFI A;  4GKK J;  2L3M A;  3QMQ A;  1S1X B;  3MCN A;  1FKP B;  2CJK A;  3O44 A;  3QGP A;  3CCV S;  3CMA S;  3FQK A;  2AF6 A;  4YEA A;  2Z8Q A;  4ZVP B;  3AOB A;  3IG1 A;  1VLY A;  1JK9 B;  5HVH A;  4PCQ A;  1S0M A;  4Y2C A;  1YG0 A;  1YJV A;  3RRG A;  2VC0 A;  3Q83 A;  2KZZ A;  2OFG X;  4EBE A;  2JLE A;  3RYL A;  4ZLJ A;  4J9N A;  2E5G A;  2MQP A;  2YQ1 A;  4Q43 A;  5L1I A;  2CJ9 A;  2HHQ A;  3MAA B;  5L1J A;  2VG5 B;  4BLG A;  2PN6 A;  1X60 A;  2D3Z A;  1T9Y A;  2FHJ D;  2AYB A;  3HVT B;  1OSD A;  4QPT A;  4I56 A;  3QQC D;  3GON A;  1Q81 T;  5D4N A;  1F9F A;  2D9O A;  3KMQ A;  2GJF A;  2V34 A;  4GC7 A;  2I8E A;  4AUK A;  3WQP A;  1M5V C;  1HFE L;  1UWB A;  4ID5 B;  6FDR A;  2BR0 A;  3HJV A;  3BGU A;  3UD3 P;  4RW9 A;  2ASY A;  1VHF A;  1XR5 A;  2WAQ D;  2YKO A;  2E5L J;  4KJI A;  2OPP B;  4WP9 A;  2G2O A;  2C2E A;  2HS4 A;  1VC6 A;  2YH1 A;  3RW6 A;  2FVS A;  3CCJ S;  5A8W B;  5IT0 A;  4U8V A;  3T41 A;  2Q79 A;  5G0R B;  2ZKU A;  1PYO B;  2M8D B;  3LH2 S;  1QVG R;  3MM5 A;  4WFY A;  3HHL C;  4J90 A;  3PYF A;  2UXB J;  2V8H A;  4OZN A;  2UUC F;  3U27 A;  5HLF B;  1B0V A;  3CJ4 A;  2VQE J;  3A8J A;  1WTF A;  4QWB A;  2ROP A;  4KKO B;  4P71 A;  2PEH A;  4PPZ A;  1QSL A;  2VBW A;  1IKV A;  3SDE B;  3SQG B;  4P2S A;  2XHC A;  3NS6 A;  2X1G A;  3AOC A;  5D0H A;  2V6A A;  3W64 A;  4DSJ A;  2CNN B;  3BBB A;  4CP5 A;  4RW4 B;  4LF8 J;  3TZZ A;  4F36 A;  2Y3Y A;  3OSN A;  1Q7L B;  1RIS A;  4RNO A;  1LWC A;  2DNO A;  3LP0 B;  1SH3 A;  2QIF A;  4OV1 A;  3X1L B;  4CRJ A;  2QJ3 A;  3IO1 A;  3C2P A;  3T5K A;  1DTT B;  3DRP A;  2RU9 A;  4DLE A;  4ZPV R;  1NUE A;  1NHV A;  5A8K A;  3RAX A;  4ED6 A;  1RJJ A;  2N82 B;  1IBL F;  1HPZ B;  2IBO A;  2M52 A;  4JI1 J;  5HP1 A;  4JI0 J;  3V4M A;  3E01 B;  4DR1 F;  4B9T A;  4MIW A;  2M5Y A;  2UUA J;  2R7W A;  4ICL B;  2K1R B;  3UDE A;  1ZZF A;  4LBH A;  2JSX A;  1TK8 A;  5HRO B;  3IS9 B;  1FRX A;  1B0P A;  3MEG A;  1WF1 A;  2W2Q P;  3J81 j;  5IT9 U;  1QM9 A;  1Q7Y T;  2LQB A;  1FJE B;  3K7R A;  3J7A 1;  2XTJ P;  1RLD A;  2ZDO A;  3KTQ A;  4OI1 A;  2B0G A;  2N7Y A;  2FC9 A;  3KLV A;  2G4B A;  4W98 A;  1Y5L B;  2EKN A;  1F60 B;  4HAC B;  4Q0B B;  2DIS A;  2OO4 A;  4OFZ A;  4CO2 A;  3LP2 A;  2DCU B;  4HTI A;  4G65 A;  1SL1 A;  2C3M A;  2LU1 A;  4Y0F A;  2D7S A;  2V94 A;  1OYE A;  3D6H B;  2FUG 9;  1HIY A;  5K8N A;  3EE3 A;  3PFO A;  4JV5 J;  1WC4 A;  3UNG C;  2BV3 A;  1WDT A;  4I67 A;  2CDQ A;  2YPZ A;  2KL8 A;  2Z57 B;  3CO9 A;  3I4H X;  2W9B A;  4MKY A;  2JC1 A;  3VZI A;  2CQH A;  3W65 A;  1P1L A;  2HQ3 A;  4OJ3 A;  1M1K T;  4ES3 A;  3TUI C;  5A2Q U;  1S9G A;  3LA0 A;  1KTV A;  1EAR A;  4RW7 B;  4QPX A;  5KAK A;  3QBC A;  1J5E J;  3CD5 A;  1IR0 A;  4FYW B;  1HI8 A;  8ATC B;  2YWW A;  3L4B C;  2GFF A;  1Q53 A;  2AT1 B;  4LRE A;  3OBI A;  1H38 A;  3GG0 A;  5IS2 A;  2VG7 B;  2KTQ A;  3OW2 R;  4FYX B;  5DG8 A;  3I87 A;  2J76 E;  3FEY B;  1E6Y A;  4NPO A;  4BWM A;  1VQK S;  2DHH A;  4F3M A;  4DL6 A;  2LKZ A;  4XO0 A;  2RE1 A;  1WG5 A;  3MPD A;  3LW5 C;  1URN A;  2VDH A;  3SQO P;  2MJN A;  4ZP7 A;  5I4M A;  2IPO B;  3T1H F;  1VIX A;  2V2Q A;  3NBP B;  2ZKT A;  1KOO A;  4J7C A;  3AT1 B;  4C11 A;  4PG5 A;  3H90 A;  3Q8S B;  5I42 A;  2RIL A;  1GTE A;  4WTY A;  3TUP A;  3MUR P;  3IBF B;  1HNW J;  2DKO B;  4QIF A;  1U1L A;  2WBR A;  3SYZ A;  4UOG A;  3ZZT A;  1N6Q B;  4XAK A;  3BSA A;  4ECW A;  2BE9 B;  1K1S A;  1YJ7 A;  1HQU A;  2YKA A;  5F3Z A;  4UOH A;  3UCU P;  3TA1 A;  5J1E A;  1LWF A;  2WW8 A;  3PW4 A;  2HZV A;  3DCA A;  4P74 A;  2ERR A;  3VAI A;  2JC0 A;  1TL4 A;  1S1V A;  4ZVH A;  1X4C A;  3CD0 A;  1NK0 A;  2KFY A;  1VQO S;  5AXN A;  4X62 J;  2M9K A;  3FMW A;  4I4B A;  1VR6 A;  4DFP A;  3WC0 A;  2UVR A;  3BKT A;  2FZC B;  5DDO C;  1QLN A;  4LR9 A;  2ZD1 A;  5T7L B;  3C3L A;  4OI4 A;  3SCK E;  2GO9 A;  1VQY A;  2CQ4 A;  2ZH1 A;  3IBC B;  2HGN A;  1ZTW A;  3LWL A;  4ED1 A;  4A8Y A;  2DNY A;  4NLV A;  3RR7 A;  3L7P A;  2YBV A;  2CNO B;  2DHS A;  4X66 F;  4Y65 A;  4B3O B;  3O5T B;  4PAB A;  3KHR A;  4DL2 A;  1MWY A;  4Q5V A;  1IKY B;  2RRA A;  2AV5 A;  2BE2 A;  1V9O A;  3GQC A;  4K4X A;  1T95 A;  3QAE A;  1JLA A;  2ZNY A;  3UDC A;  1QAY A;  2WTF A;  1LKZ A;  1XBW A;  3MMA A;  1T9V A;  5D0E A;  2HNZ B;  3A8E A;  3QJL A;  2XNQ A;  2JZ5 A;  4NCG B;  3TJ8 A;  1VIS A;  3BS9 A;  2NXC A;  4V19 J;  1YRT A;  5KFD A;  2FC8 A;  1CJT B;  2IDL A;  3IR5 B;  3ZTS A;  2HS3 A;  3U1N A;  3OR1 A;  5KFT A;  4AL5 A;  4F0H A;  3Q8Q B;  1RT2 B;  2J6U A;  3MPU B;  2FJA B;  3JSR A;  3NCP A;  3ADA C;  2GIQ A;  4DUZ J;  1ZM9 A;  2DBB A;  2GML A;  3EX7 B;  4PWU A;  2ABY A;  3QT7 A;  1X9M A;  4DR4 F;  2DHX A;  2L9N A;  3KFW X;  3JTO A;  5CYQ B;  2DIV A;  2H51 B;  3K2Y A;  1FRK A;  3O3L A;  5D6G A;  2KHD A;  3T19 A;  1FWP A;  4MK7 A;  4DL7 A;  2G9O A;  2B7B B;  2DGO A;  2XMV A;  3N9U C;  4FF3 A;  4DV0 F;  1QVF R;  2HFV A;  1RP5 A;  3MR5 A;  4IFY B;  2R8G A;  1TKT A;  4GRS A;  3IR7 B;  2CNL B;  5F8J A;  1TL7 B;  3SCJ E;  2RDJ A;  1P27 B;  4CTA A;  5DET A;  3J80 Y;  4O3N A;  5AJ3 F;  2PSZ A;  3TZW A;  2NZ4 A;  3UN3 A;  3MR2 A;  1U26 A;  3I0R B;  3T5H A;  3DKD A;  2CQ1 A;  1FVS A;  1RUS A;  1YI2 S;  1S0V A;  1EAY C;  3DOK B;  2YNF B;  5HBM A;  3K58 A;  3GYX B;  4KRW A;  4USM A;  1J5O B;  1SIZ A;  1YWX A;  4P73 A;  1H7W A;  3DXB A;  3QRP A;  3DC2 A;  3RTV A;  1N33 J;  3WHI A;  5KT6 A;  4ZLN A;  1OJ4 A;  3DU6 A;  1S4E A;  3DLH A;  3D2W A;  4M5D A;  3PVX A;  1FER A;  4ID8 A;  2LCW A;  4F4K A;  4E2F B;  2MYF A;  5KG7 A;  3KLE B;  2IRU A;  2JH3 A;  4DX6 A;  1GQE A;  3NMR A;  4BDP A;  3BSO A;  3FBF A;  3BM7 A;  4LF9 J;  2X7I A;  4H4K C;  4PQA A;  3MR7 A;  1FRL A;  5KFF A;  2XYP B;  4QBU A;  5K8P A;  2F1F A;  1NKB A;  2PA8 D;  5E3A A;  4KPY A;  1FO1 A;  1FE0 A;  4OI0 A;  3OFE A;  1BC6 A;  3PIP Q;  3CJ2 A;  1Z4U A;  2FLO A;  5A0Y A;  2HRU A;  1XNQ J;  3L3C A;  4DI6 A;  5DO2 A;  1UVM A;  3DRS A;  2MDA A;  2ZJP Q;  1S4F A;  1Q82 T;  1RAB B;  2LDI A;  2KXH A;  1OS5 A;  1BXN A;  2HK3 A;  3M8P A;  1YJT A;  1FTR A;  4ATN A;  4DL5 A;  4UST A;  1S97 A;  3PR5 B;  3MD3 A;  4Y34 A;  2ACM A;  5ETR A;  1N32 F;  2VBY A;  2HHU A;  1BQM A;  2VZ9 A;  4AXJ A;  2A3J A;  3S7R A;  2VG6 B;  1WNE A;  1XMO F;  1T03 B;  4KHR A;  3Q8V A;  2GHW A;  5F0W A;  4B3M J;  5SUH A;  1S1X A;  5KFI A;  4JI7 J;  4M5G A;  5HAN A;  3MR6 A;  3NKY A;  1FKP A;  1TQL A;  4NLW A;  1H3D A;  4LR7 A;  3HPO A;  3W2W B;  2IVM A;  4NZ7 A;  2DGV A;  1HHQ A;  2WBM A;  2OPQ B;  4NYZ A;  5GAD I;  3ENV A;  3I56 S;  1I94 J;  1NK9 A;  2A1B A;  1RTJ B;  1SL0 A;  2DNQ A;  4N56 A;  1O0P A;  2AYG A;  2XI3 A;  3TAN A;  1XMQ F;  2MKK A;  1T9W A;  1DLO B;  2YXL A;  2E66 A;  3BBC A;  2BQR A;  5ETM A;  2CDR B;  1RKJ A;  1RSC A;  3MAA A;  3TX8 A;  2XS5 A;  1BD6 A;  2VG5 A;  3PAC A;  2JEG A;  2XZW A;  4KYZ A;  3HVT A;  1O51 A;  1I5O B;  3QZ8 A;  4KB7 A;  1CC8 A;  3SSQ A;  3NNC A;  5EHH A;  3NGD A;  2W4C A;  5KT2 A;  1NSP A;  2IY5 B;  3OR2 B;  4PUO B;  3VAF A;  4OX7 A;  3KK2 B;  2FJB B;  3ZZ0 A;  3NXZ A;  4Y6I A;  2NUH A;  1NJX A;  2Z58 B;  1ZAW A;  3KJF B;  1TK5 A;  2EFG A;  4FF4 A;  4B9N A;  3GCX P;  1Y3J A;  2VON A;  4ID5 A;  3IFE A;  2XLJ A;  2YKQ A;  3QFH A;  2BKO A;  1WJ9 A;  2QG9 B;  1UVL A;  2AJQ A;  1S6Q B;  1NXI A;  2OPP A;  4DR3 F;  2OJ3 A;  4YR0 A;  2O67 A;  4FYD A;  5A8W A;  4ZKA A;  5G0R A;  2MQO A;  2FZG B;  5KFZ A;  1RT5 B;  3VAL A;  4JI4 F;  4AQY F;  3CW2 C;  2OPS B;  1KC8 T;  2AEJ A;  4F4X A;  5HLF A;  1MN7 A;  2FVQ A;  4A8K A;  2GJI A;  1RAG B;  4KKO A;  4ZVE A;  3NAI A;  1P9Y A;  4F25 A;  3MM8 B;  3ILI A;  1G4C A;  4MT1 A;  4Z37 A;  3SDE A;  3RRK A;  3SQG A;  4J9O A;  2KI2 A;  2ZVI A;  3PR4 A;  3KK3 B;  1NK6 A;  1VFJ A;  2AX1 A;  1KD1 T;  2VIH A;  3G87 A;  4EGL A;  1FKA F;  2O5D A;  1OY8 A;  3OVS A;  2A18 A;  5HJY A;  1FX2 A;  3LP0 A;  2RDD A;  2YNI B;  1S0O A;  3CJK B;  1DTT A;  1UWA A;  1MRO B;  4LRD A;  2IFX A;  1YJ9 S;  3AB4 B;  1HPZ A;  5EN1 A;  2VFR A;  2R3V A;  2C3P A;  3E01 A;  3H42 A;  1N34 F;  4C0H A;  2ZH9 A;  1AW0 A;  4ICL A;  1HWK A;  2K1R A;  4A8O A;  5EUH A;  1SH0 A;  2OHD A;  3M7V A;  2W7P A;  5HVG A;  1Q86 T;  3QFW A;  5HRO A;  4OLO A;  4NA3 A;  3IS9 A;  4MIB A;  4DOZ A;  3SMZ A;  3VAJ A;  4KO0 A;  4LQ9 A;  1T3N A;  1FRH A;  1HWJ A;  2D41 A;  2R7V A;  2W1B A;  3A8I A;  2BAC A;  3NEK A;  1TL5 A;  2B56 A;  3I31 A;  3BN4 A;  2GAG C;  1PAU B;  4J5O A;  1NKC A;  2NRE A;  2XGP A;  1NPP A;  4TN2 A;  4C0B A;  4M5M A;  3KDO A;  3P45 B;  1WHY A;  2IC3 B;  1U25 A;  5L46 A;  1F0X A;  3W5X A;  4HAC A;  1GK8 A;  4Q0B A;  4IRC A;  1REG X;  2VD3 A;  3FJ2 A;  2AJ0 A;  2DGW A;  3ZZO A;  1HBU B;  4CH1 A;  2KYX A;  5KFW A;  4WPA A;  4I6Y A;  2ATC B;  2QLJ B;  3JAM Y;  2ZIT A;  1HBO B;  1EIY B;  4ZVG A;  1XN9 A;  3EM1 A;  2LEP A;  1WKL A;  2ACY A;  1M5O C;  5C42 B;  3AD7 C;  4LSL B;  3KHH A;  3JTP A;  3EXY A;  1UTA A;  2K8G A;  3D5M A;  2HVH A;  3OD2 A;  1RE1 B;  1VK3 A;  2AZ1 A;  2E1R A;  3DDI A;  4RW7 A;  4QW9 A;  4EYH B;  2W2M P;  2I0X A;  1RK8 A;  1HYS A;  4RNH A;  3Q8U A;  2A6M A;  3EVW A;  4DR2 J;  2DB1 A;  4DSE A;  4IH5 A;  4NCA A;  2BM1 A;  1LW0 B;  3LWM A;  3KNA A;  5C5J A;  3JB9 k;  2VG7 A;  3DOL B;  1HD1 A;  2GS8 A;  2KRB A;  2DO0 A;  2GX8 A;  2V2K A;  3KJV A;  4CCH A;  1KVI A;  1RT7 A;  4ER8 A;  1GXT A;  2W7O A;  3Q8R B;  1CEZ A;  2HNY B;  4USU A;  1G6B A;  1NBE B;  4QU6 A;  3QZ7 A;  4KC5 A;  2C3U A;  4FPR A;  3NBP A;  3CDB A;  1DZ5 A;  4GKK F;  4LBI A;  2F7V A;  4RLE A;  1V3R A;  2RNE A;  3AD9 C;  2L9W A;  4F4Z A;  4J9Q A;  1I1G A;  4CO3 A;  5HO4 A;  3IA0 A;  2IMW P;  4IQM A;  2YQ3 A;  2J9D A;  4JUZ A;  4N77 A;  2MKH A;  1H74 A;  2XS2 A;  2AWZ A;  3CCQ S;  1N6Q A;  2Y1L B;  2HK2 A;  2XGQ A;  5KFM A;  3K5L A;  1YKW A;  4ANE A;  4CO4 A;  4TNO A;  2VPZ B;  2C28 A;  2JHE A;  2RS2 A;  2E29 A;  3BSC A;  2XMA A;  1SBR A;  4Y00 A;  4MH8 A;  4IG3 A;  3FC9 A;  1B4S A;  2DRB A;  1SVD A;  3IN5 A;  2EW9 A;  3DDK A;  2LEC A;  4GVB B;  3FSX A;  2IBK A;  2MHE A;  1IM4 A;  1H2V Z;  4FP9 A;  1RAJ A;  4A47 A;  5DGA A;  4USV A;  4IO9 Q;  5T7L A;  2RAQ A;  1XNR F;  2UUC J;  2CPH A;  1BQX A;  4JB8 B;  5ETS A;  5KFN A;  3V81 B;  2EBG A;  3W5Z A;  2NYH A;  2J8S A;  1YBU A;  1RAE B;  1V3S A;  3R2C J;  3N6M A;  4WTO B;  4DV6 F;  4B3O A;  4OI2 A;  2YWG A;  4LMZ A;  1CJV B;  2GCF A;  2HAF A;  3W61 A;  2D69 A;  3OTE A;  4ZP9 A;  2VKZ G;  2ZDP A;  3MM9 B;  4OZ5 A;  1UFW A;  2HHX A;  3C16 B;  3GE9 A;  4HLB A;  2XM3 A;  1GEH A;  1W25 A;  1L3S A;  3POT B;  2MHN A;  5LSR A;  1C0T B;  1S9E B;  3AA8 A;  2B3T B;  3OXG A;  3A12 A;  1IQZ A;  2I1R A;  3BH7 B;  4DV5 F;  4YHH J;  4NLO A;  1CVJ A;  1AXQ A;  2HFZ A;  3M6V A;  2R2S A;  2UXB F;  4FXD A;  2HNZ A;  1IBL J;  5HMW A;  2QN6 B;  4NCG A;  5AE3 A;  4ZN3 A;  4C3L A;  4K4W A;  1RQ0 A;  3CDW A;  4DR1 J;  4FPI A;  4L3N A;  3DGV A;  1CJT A;  3CJS A;  2V0N A;  1HW9 A;  4WKR A;  3QJJ A;  4IRD A;  3VAM A;  1EP4 B;  2KB2 A;  4OZ1 A;  4IFV B;  5KFE A;  3MFI A;  1RT2 A;  1QTM A;  2QL5 B;  3PXG a;  4NMX A;  4DSI A;  5BYS A;  3W5Y A;  4KQZ A;  2ZH8 A;  1R0A B;  1NK8 A;  1WDD A;  4HYK A;  3FRZ A;  2GQC A;  2MQL A;  3W2V B;  3V4I A;  4LF8 F;  5IQ6 A;  1FJ7 A;  3RB3 A;  3D0I E;  3D6F B;  1AUD A;  1UW9 A;  2BAB A;  3SIP B;  2NS1 B;  4ED3 A;  2FDN A;  2MMY A;  4DCP B;  5CYQ A;  2CWX A;  3TW0 A;  2YNG B;  4FVC A;  1VRQ C;  2I2Y A;  3CCT A;  3QT8 A;  2V69 A;  2R7S A;  3Q8P B;  1LV5 A;  4CM0 A;  1S6P A;  4ZHR B;  2CFX A;  5DZ6 A;  2Q3P A;  4ZA1 A;  4QWC A;  4ED4 A;  4JI1 F;  3MEE B;  4JI0 F;  5L8R C;  1N56 A;  2J0X A;  4NX9 A;  3HMJ G;  4FKY A;  2FY1 A;  3F41 A;  3HP6 A;  1TL7 A;  2A6O A;  4CLS A;  2HYI B;  3EMT A;  1NK5 A;  2E9R X;  2FIU A;  2V63 A;  5GMK a;  1RAO A;  5DJB A;  1JMT A;  3UQS A;  1KLN A;  5GAG U;  2E5I A;  1NSK L;  4ZIW A;  4WU2 A;  2JOQ A;  4LF2 A;  5ETQ A;  3I0R A;  2NZC A;  4WBF A;  3GYN A;  1I3O B;  2NPI A;  3DOK A;  1HQE B;  2YNF A;  2IA6 A;  5DDP C;  4RPF A;  1IM6 A;  2KT5 A;  1RZM A;  1J5O A;  1Q95 G;  1NH8 A;  3R5B A;  4UF4 A;  2UV8 A;  4CT9 A;  3H4D A;  2R2R A;  3D6M B;  5A76 A;  1RAC B;  4DJB A;  3OFG A;  3EZU A;  1YRX A;  2FLN A;  1UJ6 A;  1C1B B;  2RDI A;  2MST A;  5HMZ A;  4H4M B;  2X1F A;  3CDE A;  3MGJ A;  3LQV A;  3T1Y F;  3PTW A;  1N5T A;  4HI2 A;  3KLE A;  1PO6 A;  3MF5 A;  5HN0 A;  1TFY A;  3JS9 A;  1R8A A;  4C2M A;  4J9L A;  1KQF B;  1H0H B;  1SJF A;  4G6V B;  1LNQ A;  3FGV A;  4IR1 A;  1M90 T;  2PD1 A;  2HG4 A;  3L7O A;  1Y7P A;  3DLE B;  3TUJ C;  1MLA A;  3BBF A;  4WZM A;  2Q43 A;  1U0H B;  1RT4 B;  3JYT B;  2OD6 A;  3C46 A;  3LGM A;  3PX6 A;  4DZD A;  2MKS A;  4NA2 A;  3CSK A;  2DNL A;  2M3D A;  3D1Q A;  1OQ6 A;  1WG4 A;  2KH9 A;  4O23 A;  2XC9 A;  2DIU A;  1P9Q C;  1IKX B;  1SL2 A;  4CWB A;  1HD0 A;  5IV3 A;  4DLG A;  4KGM A;  3CO0 P;  4C0O C;  4OJH A;  1U6F A;  5GAH I;  2A10 A;  2VG6 A;  1GMW D;  4PG8 A;  1T03 A;  1L5U A;  3C14 A;  2XBP A;  3ZTQ A;  2YNH B;  2QYG A;  3BGL A;  2E1C A;  1FX4 A;  1JIH A;  1D09 B;  4ZDN A;  2R2U A;  1YJN S;  2MZJ A;  1LFW A;  3W2W A;  4OX9 F;  4PQU B;  2OPQ A;  2PFF B;  4LFC F;  4HH1 A;  2AYE A;  1HMV B;  4OYM A;  4DSL A;  5IFM A;  1RTJ A;  2IM3 A;  2CNK B;  3I82 A;  2LFV A;  3THP A;  1CJU B;  2KXF A;  2KFZ A;  1IBC B;  1DLO A;  1YBT A;  2Z30 B;  3ZZZ A;  1TV6 A;  2LEA A;  4MYU A;  1D0E A;  4M5N A;  4M8L A;  5HMX A;  2NXU A;  5KT7 A;  4NI2 B;  4DPX A;  5ITH A;  4F3Q A;  4USW A;  4GC6 A;  3TAM B;  2HLU A;  3HJF A;  1R8C A;  2Y8W A;  4J9R A;  4A8Q A;  4X4U A;  4WIQ A;  5J2M A;  4X62 F;  5L9X A;  1RWK B;  5KT5 A;  2CAJ A;  4DX7 A;  4PUO A;  1SIW B;  2R7U A;  5LM7 E;  2BJ9 A;  5GME A;  4NLQ A;  2JDJ A;  1S72 S;  3DI6 B;  4QOT A;  5J2P B;  4F0K A;  2N4D A;  1TUW A;  3W66 A;  3IGN A;  4O3P A;  5H9F J;  4AXI A;  5ADZ A;  4U8Y A;  1N48 A;  4OHZ A;  5F0U A;  1R8B A;  3OL8 A;  1UA1 A;  1FXL A;  3FQL A;  4OYA A;  4CZC A;  5IM0 B;  1S6Q A;  1HA1 A;  4LRF A;  3FSI A;  3US5 A;  2MTL A;  4ZIV A;  4I2Q B;  3BR8 A;  3VGT A;  5CYM B;  4DL0 C;  3ZC4 A;  5B09 A;  3A8K A;  3CME S;  4PRF A;  2WK4 A;  3R2D J;  3EGZ A;  3GPA A;  2VIC A;  1SQE A;  1OIA A;  2DNM A;  3RRH A;  5GAE U;  1RBL A;  1RT5 A;  2J7K A;  3W63 A;  1NO8 A;  2SXL A;  4DR4 J;  2XCP A;  4M63 A;  3OL7 A;  3MCM A;  1KQK A;  2JEF A;  3NWR A;  1HR0 F;  2ILY A;  1HWU A;  4XPE A;  2WZ1 A;  1WKK A;  1KVK A;  3G86 A;  1Z2L A;  4DV2 J;  2Y1J A;  2BYC A;  1FRM A;  3H20 A;  1KVJ A;  3MM8 A;  4ES1 A;  2IJR A;  1QAJ A;  1KTQ A;  3CXC R;  1FFG B;  1UVN A;  2KM8 B;  3FBE A;  3EGN A;  3KK3 A;  4OI6 A;  3TA0 A;  1F2G A;  1QY7 A;  2DGU A;  3PRV A;  2QLW A;  1JLG A;  3PJW A;  4A8W A;  4TXS A;  3B4D A;  5I3Q A;  1KFS A;  4K4V A;  5B0C A;  5H9E K;  3K5M A;  1GH8 A;  1M1H A;  3CCM S;  3MUT P;  5AJ3 J;  4J9K A;  1R3N A;  2YNI A;  5KFY A;  3MDF A;  5KFG A;  1OY6 A;  4A8X A;  4O3Q A;  2W01 A;  1JLC B;  2HUR A;  2XWY A;  4NML A;  1RLC L;  1ZAX A;  1E6V B;  2GIR A;  1EHW A;  2ZH7 A;  2KJW A;  3E3X A;  2VOD A;  3MMC B;  5E2Q A;  3Q2T C;  1R89 A;  3DLK B;  3M05 A;  4IOB A;  1VBX A;  4P7V A;  2XUL A;  3GFX A;  2Y1I A;  2F5G A;  5D77 A;  4U9R A;  1TAQ A;  1VLO A;  5KFP A;  2HHH F;  2GAH C;  4ELV A;  4OJ1 A;  2EFV A;  4PYD A;  4PAA A;  2CJQ A;  2DD8 S;  4I2P B;  4ITS A;  1N5S A;  2X3G A;  1MSW D;  1VK8 A;  2MQM A;  5DS7 A;  4KH0 B;  2ZWO A;  3OJU A;  1MNE A;  4QU7 A;  4EFA C;  1JX4 A;  4O44 B;  2CQI A;  5T14 A;  4DR6 J;  1VBZ A;  4J9M A;  1XIQ A;  1U1P A;  1ZZN A;  3LUY A;  5MLC V;  1SI9 A;  4IR9 A;  1ZAV A;  2R8K A;  4N47 A;  4ZVQ B;  1BGX T;  1HBU A;  4KGK A;  5A6W A;  3M6U A;  4OYO A;  1RTD B;  1KP6 A;  3DFE A;  4DDF A;  1Y11 A;  5J1P A;  1N33 F;  2VDI A;  1HLW A;  1Q0N A;  3DOM B;  2NSC A;  5E3R A;  1ULR A;  5LMU J;  1WOS A;  2V8V A;  3AQP A;  3TZX A;  4JI5 F;  2NR0 A;  5C42 A;  1IJF B;  1VS3 A;  1SC3 B;  2MQ8 A;  4X4T A;  2R9L A;  1SC4 B;  1N32 J;  4NLD A;  1ZA2 B;  3UFC X;  2DXD A;  3GFZ A;  1UPP A;  1XMO J;  5F8G A;  3M2U B;  4DV7 F;  3PV8 A;  2L41 A;  1U1O A;  5DDQ C;  2DRA A;  1O5J A;  3EGV A;  3LAK A;  4LF9 F;  4H4O B;  3BJY A;  3B54 A;  5DLG A;  5IQQ A;  7FD1 A;  5LXY A;  1IR2 A;  4TVA B;  5HL7 Q;  4DL4 A;  1U6Z A;  3ZTR A;  1JLF B;  3MED B;  2B43 A;  2GA7 A;  1NB2 A;  1RTI B;  1RA6 A;  1K0V A;  4WP3 A;  1H72 C;  4O4G B;  1X4A A;  5CXT A;  5KFO A;  5LOQ A;  1TKX B;  3MCS A;  4RNF A;  4E98 A;  2P5V A;  2E9T A;  5LSL A;  4MK8 A;  2FB0 A;  3CE8 A;  1N88 A;  2ADB A;  1RT3 B;  1W7W A;  3KKF A;  1UVJ A;  3N0V A;  4URQ U;  3OXL A;  2V2Z A;  1UCN A;  1J27 A;  3B82 A;  3E51 A;  1YGY A;  4JI7 F;  3FRY A;  2A0F B;  1LXN A;  4DQR A;  2F8M A;  4URG A;  2P6S A;  1M5H A;  1UJ5 A;  3D3B J;  2N3L A;  5AXK A;  2EKY A;  3IRX A;  2M8H A;  3CCE S;  1FEH A;  4LF5 F;  1RWN B;  4TYA A;  1I94 F;  4DR5 F;  1WC5 A;  3QID A;  2VPY B;  4ZPC A;  1NSA A;  1SC1 B;  2KRR A;  1IN0 A;  3GSI A;  2I5J B;  4CH0 S;  5KFL A;  2XLK A;  2ROE A;  2PMW A;  1VC0 A;  2VOO A;  2HSE B;  1LWX A;  4GVB A;  2R7T A;  1Q16 B;  4B17 A;  2OLW A;  4NLR A;  2B9X A;  3GG1 A;  3QSI A;  1YX2 A;  1TEL A;  4AQY J;  2DO4 A;  5KTQ A;  1VHI A;  4UW2 A;  2Z2Z A;  5DQG A;  2ZH4 A;  2Q66 A;  2V4J B;  3V81 A;  1EQM A;  1NJY A;  5HK4 A;  2W4P A;  4DL3 A;  1FJG F;  3FFI B;  2ZHB A;  3JQJ A;  1JLE B;  2Q1L A;  3NGK A;  3OVB A;  3BGR B;  3MAH A;  3MM9 A;  2YWH A;  9RUB A;  3VHQ A;  2DGS A;  2GNK A;  1BWE A;  3C16 A;  3WX8 A;  7AT1 B;  4B02 A;  2VA2 A;  1ARO P;  1C0T A;  1RHU B;  1TMJ A;  1FVQ A;  3AJ2 A;  3NS7 B;  4YR3 A;  2AJF E;  2QEX S;  3PYD A;  3JSY A;  3M8Q B;  3D1H A;  5I3U B;  2D74 B;  3M8R A;  2W2N P;  3ENQ A;  1URR A;  4KSE B;  4MAK A;  4F4Y A;  4IQX A;  1LK7 A;  1Y0H A;  4KAI A;  2OPR B;  3H40 A;  1VQ8 S;  2Y1R I;  4JI3 J;  4KGV B;  4FYY B;  1HHS A;  1N34 J;  3PM9 A;  2R7X A;  4C8N A;  2WHO A;  2VAS A;  2HAI A;  1IJE B;  5JVH Q;  4IFV A;  1EQ0 A;  3J7Y U;  1HKA A;  3J7Z T;  2WON B;  4W92 B;  3RBE A;  3J81 U;  2FHJ A;  2EFQ A;  3W2V A;  4WFX A;  3O2I A;  4ZPW R;  3O1L A;  2X1B A;  3OT9 A;  4X84 A;  1CS4 B;  4ECZ A;  3NAH A;  3PX4 A;  1NDK A;  1G7C B;  3TO8 A;  3ZZU A;  3H59 A;  3R7S B;  1VIO A;  2YNG A;  1PBU A;  2XMJ A;  2WVC A;  4KE5 A;  4DMZ A;  4ZHR A;  2ZC3 A;  2DR9 A;  4YR2 A;  2RS8 A;  3JSB A;  2W9A A;  1S1T B;  3MEE A;  3QAT A;  4GO7 X;  2KHC A;  1TKZ B;  3M30 A;  1DQA A;  1ZM2 A;  5F8M A;  2MQQ A;  2EC0 A;  2CQ3 A;  1UET A;  2BRK A;  2E7V A;  1X9W A;  3N6L A;  5BJR A;  2DCL A;  4YME A;  1TKD A;  2MKJ A;  1KQS R;  2W24 A;  3MTJ A;  1LXJ A;  2C2K B;  2P9C A;  2VUG A;  3JQK A;  1OY9 A;  2UXD J;  2IRY A;  3CJ3 A;  2HKE A;  1NJI T;  3PRD A;  2VQF J;  5HVF A;  4PWW A;  1U47 A;  1N5V A;  1APS A;  2NLW A;  1HQE A;  3ONQ A;  4DN9 A;  4U95 A;  1U1Q A;  2XYH B;  1PYT A;  2BMB A;  1RT1 B;  2F65 A;  4CO0 A;  3R5A A;  1Q8I A;  2NXE A;  5FII A;  5FDL B;  3L9Z A;  1R31 A;  1S7I A;  3R27 A;  3TOQ A;  4C3M A;  2ZH3 A;  2AP6 A;  3FBC A;  3IGV A;  2HRT A;  4KFB B;  3TP2 A;  1C1B A;  2BEF A;  3VCD A;  4RBT A;  3AB2 B;  3UR0 A;  5JJB A;  1YZ7 A;  4H4M A;  3G96 A;  3VGV A;  4GMK A;  3FEZ A;  3UN5 A;  2EFO A;  1TL3 B;  3G6E S;  4TY8 B;  3M2V B;  2CUY A;  1ZTT A;  4X4Q A;  3PHE A;  2A2D A;  3MOJ B;  3EVO A;  1K9M T;  1S7H A;  3F73 A;  3CJ5 A;  4DV1 J;  5IXU A;  4YOE A;  2QO3 A;  1ZM4 A;  3IBW A;  3DLG B;  1ZET A;  4CI0 B;  3DLB A;  2DNR A;  2F4V J;  2DGQ A;  3T6B A;  3IMQ J;  1KBR A;  3GIJ A;  2CPE A;  2EG1 A;  1RT4 A;  3JYT A;  4DR2 F;  4ZCL A;  4NLY A;  5KOW A;  3U1M A;  3CIM A;  3NRB A;  2G0I A;  5FLX U;  1YJU A;  2Z4P A;  1T0T V;  2ZEJ A;  1UEK A;  5F41 A;  4ZK7 M;  3HM9 A;  3LO3 A;  4NXN F;  5GAD U;  3S6E A;  4DV3 F;  3AH6 A;  1RBO B;  3O8W A;  5B0A A;  4LRA A;  2CQD A;  5ETP A;  1JLQ B;  3MI7 X;  4W4M A;  3ZFV A;  2PI5 A;  1FI4 A;  2CG4 A;  2YNH A;  2CA9 A;  1RBA A;  4LRB A;  1NH7 A;  2QA4 G;  2XZT B;  2LQ9 A;  5KFC A;  3RGI A;  2HLT A;  2ZBQ A;  4F26 A;  2JRS A;  1PJ5 A;  4PQU A;  1XNR J;  2OTL S;  3H8Y A;  3BO4 A;  2L08 A;  4A8M P;  3PKY A;  1WC6 A;  3CD6 S;  1FXR A;  1HMV A;  2W7A A;  4WE1 B;  4ZVO B;  4ALZ A;  4LF1 A;  1KR4 A;  1X4B A;  4DV6 J;  1U09 A;  2DYA A;  4HDH A;  4UZB A;  3R6L B;  2V67 A;  4U96 A;  3HK2 A;  4NI2 A;  4H4K A;  1JXE A;  3TAM A;  4KTQ A;  2XO6 A;  1F3F A;  1R27 B;  5EWE A;  3TQE A;  2M88 A;  4K8R A;  4DV5 J;  2LXU A;  4AND A;  3MPY A;  3TNV A;  1X4E A;  3DI6 A;  1REV B;  5J2P A;  1IXK A;  2R7Q A;  4RUC A;  2PA3 A;  1HNI B;  2L9D A;  5B7W A;  2K3I A;  3OL6 A;  1M5K C;  2FLL A;  4NXM F;  2G2Y A;  1EX8 A;  3CPW R;  4B3T J;  2V68 A;  3LP1 B;  3SSS A;  2H54 B;  1T9U A;  4O0N A;  1RYR A;  3SZ2 A;  5HMY A;  4BC7 A;  1HNX J;  4IH6 A;  4USH A;  2VOP A;  4I2Q A;  2ZH2 A;  5CYM A;  5KFJ A;  5B0F A;  4L74 A;  1NRK A;  1D1U A;  1BHN A;  4L3K A;  4CH7 A;  4ZCM A;  1TZ0 A;  4WXO A;  1VQ6 S;  4NAS A;  2HW3 A;  4LT6 A;  2H65 B;  2DNZ A;  3RBD A;  4URS A;  3V2U C;  1G3O A;  2J9C A;  4LIW A;  4DQQ A;  2HEK A;  1UMJ A;  3NY0 A;  4DS4 A;  1JLB B;  4B9U A;  4YHH F;  4E0D A;  3TVY A;  3W3S A;  2C42 A;  1LQ9 A;  1T94 A;  1AZS B;  4ED8 A;  1EB0 A;  5LSO A;  4DUY F;  1S57 A;  3IWN C;  1YSJ A;  3RU0 A;  1FHT A;  1FDN A;  3GZ7 A;  2VJU A;  4JI6 J;  2EWH A;  2WB1 D;  3ZTP A;  2YX1 A;  3OL9 A;  3MAQ A;  3QRQ A;  2B4P A;  5B0G A;  2XHW A;  4B9V A;  1UEV A;  2FVP A;  2OAU A;  3I55 S;  1ZBT A;  4RW8 B;  1S1W B;  1KN6 A;  4U7U D;  1FRI A;  2OD4 A;  3EDR B;  4O0I A;  1JLC A;  1XWL A;  1TUV A;  3P4U B;  4PXC A;  4FBU A;  2ZUA A;  2ZC4 A;  1E6V A;  3TVK A;  3UDL A;  2IVY A;  2CQB A;  2KVQ E;  4Q8E A;  4OX8 A;  4OHX A;  3U7J A;  4WF9 Q;  3MMC A;  1XER A;  3DLK A;  2V9K A;  4P7T A;  4LF4 J;  4WWS A;  2LEB A;  4K4S A;  1MML A;  3T1Y J;  1MMD A;  1N0V C;  2RH3 A;  3SXL A;  4KV8 B;  2RQM A;  4TQR A;  2PFD A;  4I2P A;  1X0P A;  4TLR A;  2D3U A;  4X4V A;  1RHQ B;  3CNQ P;  1RAH B;  1FA0 A;  2FGO A;  1F9H A;  3A4T A;  1S10 A;  4O44 A;  3TEG A;  3EJM A;  2YKM B;  2ZH5 A;  4OYB A;  4DZ6 A;  4DQP A;  3BGO P;  4ZVR B;  5F9N A;  3AY0 A;  1RTZ A;  4K0K J;  1YIT S;  4Q45 A;  3PHT A;  5E5N A;  4KR0 B;  4CLL A;  4RW6 B;  2HQC A;  1RTD A;  3EZ5 A;  3H0P A;  3SI8 A;  1MWQ A;  3IP0 A;  3M1V A;  4LFB F;  3TAR A;  3DOM A;  2ZZN A;  4XPC A;  2LDY A;  3GIR A;  4LUB A;  2MZT A;  3NOG A;  1FF2 A;  3D0H E;  1D9F A;  2NCK L;  3RAQ A;  3CJQ A;  2MXY A;  2QMX A;  2VFU A;  3ENA A;  4OL8 A;  2F3J A;  2ASJ A;  3OSP A;  1K1Q A;  2VFT A;  4NWB A;  2YVS A;  3P5B P;  3M2U A;  4MIA A;  3CJ8 A;  3T1A A;  1P6T A;  5ETK A;  2FPH X;  4YFU A;  4ECV A;  3HD2 A;  4H4O A;  5CCL A;  1Q78 A;  1CUL B;  5HAT A;  2HMI A;  2XQC A;  1N52 B;  3IM8 A;  3V6D B;  4OX9 J;  3R3T A;  1UPM B;  1WEZ A;  5D4L A;  2YY3 A;  1FK9 B;  5D3G B;  4LFC J;  1S99 A;  2QGF B;  1JLF A;  3MED A;  3LAM A;  1WTB A;  2E1P A;  1VGY A;  5KG1 A;  1T8E A;  3Q2S C;  4N76 A;  1RTI A;  2Y9H A;  4FNI A;  4O4G A;  1WKJ A;  3P49 B;  3D7S B;  1TKX A;  2ZHO A;  2F8E X;  5KOX A;  2HRY A;  3N79 A;  1TU0 B;  3GV7 B;  1AB8 A;  2BRL A;  2VJV A;  1WHX A;  1RT3 A;  3SV3 A;  4LRC A;  3FCH A;  4PXD A;  1L3K A;  3UD5 A;  3MCO A;  1UJ4 A;  4OJG A;  1SKS A;  4RR5 A;  3DMJ B;  1L3T A;  5A8R A;  4FNH A;  1VQ4 S;  3UDV A;  1N5Y B;  4LF6 F;  1VQL S;  1A7G E;  5AXL A;  2FVC A;  1OQ3 A;  2UUW A;  2HFU A;  3HSJ A;  1W26 A;  1WOO A;  2B9Y A;  3ISN D;  4L75 A;  2XWX A;  3Q86 A;  4ZVU B;  4TYB A;  2L48 A;  2HHV A;  3HUL A;  3DM2 B;  5DM7 Q;  5D8H B;  2E5H A;  2M4M A;  2ATL A;  2ZJR Q;  1HNZ J;  1VQ5 S;  1M0S A;  5HJX A;  4OV6 A;  3PW7 A;  2I5J A;  5DLF A;  3C66 A;  3NLC A;  1NU4 A;  1C4C A;  2EI5 A;  1S1U A;  4ZPD A;  4OLP A;  2NUU G;  3VQS A;  2LA4 A;  3EVM A;  5EX3 A;  1U45 A;  1ZM3 A;  5E0O A;  3IXQ A;  2CPY A;  3IAS 9;  2JFD A;  2GGP B;  3EWG A;  4QWD A;  1HR0 J;  4RJV A;  5A6P A;  3RW7 A;  3NGS A;  1I51 B;  2V4J A;  4NLG A;  2ALZ A;  2ASL A;  2ZE2 A;  4DCJ B;  2XY5 A;  5D0G A;  4CM2 A;  2HVZ A;  3FFI A;  1WI6 A;  5KG2 A;  1JLE A;  4V19 X;  1S49 A;  1PJ7 A;  3IAM 9;  4I7F B;  4O3S A;  1OPZ A;  5FJ4 A;  2V8P A;  3H5U A;  3BGR A;  2ZJQ Q;  1RAA B;  4S0M A;  3I5C A;  4DG1 B;  4CQ1 A;  3TEH B;  1RDR A;  1S1V B;  4XTT A;  2QMU B;  2MLY A;  3MEC B;  5LJ3 Y;  2NPF A;  4ECR A;  5C2G A;  1NLK L;  2AEM A;  4F50 A;  1FCA A;  4DSF A;  2Q6C A;  3M8Q A;  3U1L A;  1SJ3 P;  3PJ9 A;  4Y2K A;  3OTB A;  5I3U A;  4DFJ A;  4ILM A;  1NM2 A;  5C7P A;  2ZD1 B;  4UY8 T;  2BJ1 A;  1U8W A;  2XB2 D;  2EFN A;  3CVK A;  3GIK A;  2XY6 A;  2OIH A;  2OPR A;  2C22 A;  3OTO F;  2DY1 A;  3BSN A;  4C9D A;  4DV2 F;  4NEZ A;  5LL6 d;  1JNZ B;  3X3U A;  3GIL A;  4M5L A;  4MTP A;  3QRR A;  1FES A;  3CDA A;  3B78 A;  2E5J A;  3H2L A;  4G1Q B;  1XTZ A;  5KG3 A;  1TL1 B;  2QLX A;  4DPW A;  2BE2 B;  1SUQ B;  1Z2Z A;  5I3P A;  1AYE A;  2WSC C;  2HHH J;  4BC9 A;  2BJ3 A;  1AT1 B;  3HHL D;  4K4T A;  1NZ8 A;  1CS4 A;  1C0U B;  3T5J A;  1UP1 A;  2C3Y A;  4RL1 A;  2UVV A;  3M6W A;  2KKH A;  3CCW A;  2YX7 A;  5F8L A;  2AZ3 A;  4OYX A;  1WHV A;  1P8G A;  1S1T A;  5L9N A;  4OZ3 A;  4QW8 A;  2DHA A;  1TKZ A;  5C25 B;  3L7U A;  3OR1 B;  4TU9 A;  4QR1 A;  3D66 A;  1VJQ A;  1GMV A;  3HHN B;  4USJ C;  2XY7 A;  4JI5 J;  2W8L A;  1TUG B;  3BKF A;  1SJR A;  4C8M A;  1T7P A;  2FJE B;  1NAQ A;  2J0S D;  3FZB A;  3CCZ A;  4DV7 J;  1SJ4 P;  2GVD B;  1WSR A;  3BGF A;  3G4S S;  1LW2 A;  3PEH A;  1NSQ A;  1NDP A;  2G0C A;  3MZI A;  2KU7 A;  5HQM A;  3GJR B;  2AHO B;  4DR6 F;  1RT1 A;  1TVR B;  2LXI A;  4FDF A;  4K4U A;  1S79 A;  3NNA A;  5FDL A;  2FD2 A;  2JWN A;  4FF1 A;  3BN7 A;  2B8P A;  4KFB A;  3KMS A;  3R7B B;  3FUY A;  5H9F K;  2GVZ B;  4OHV A;  3G6V A;  2LMI A;  5HAO A;  2BX6 A;  2Z2M A;  3QO9 B;  5LMU F;  4CLT A;  1TL3 A;  4OHW A;  4TY8 A;  3M2V A;  1XC9 A;  1KWM A;  2AJ1 A;  2XNR A;  2H4Y B;  3AAW B;  1TTH B;  3KLI B;  1S48 A;  2ZZT A;  3HFZ B;  4A8S A;  1D8Y A;  2CVE A;  1S12 A;  3DLG A;  2EK1 A;  4NLU A;  1H2U X;  3CC7 S;  1NPK A;  3SBM A;  3TR5 A;  4L73 A;  2C2R A;  4C98 A;  5IT9 Y;  3DDN A;  3UN2 A;  4JOU A;  1FT8 A;  1PBA A;  2H1Y A;  5IWA J;  4LF5 J;  4HHH A;  2IIH A;  2RIJ A;  3MMJ A;  3TA2 A;  3PY8 A;  5GAG I;  3AOA A;  4DR5 J;  3KG1 A;  1Y3K A;  2ZH6 A;  3T9Z A;  5K9F A;  4ES2 A;  4YB1 P;  3MR3 A;  4K4Y A;  1JB0 C;  2RUS A;  2HGL A;  3A3P B;  1JLQ A;  1X8D A;  2O1P A;  3CWJ A;  4MKB A;  4YQW A;  4EYI B;  1S59 A;  5D15 A;  3M2R B;  4F2R A;  3NS5 A;  2KM8 C;  1UAW A;  4QYZ K;  2FJX A;  1X31 C;  2DXE A;  3A1Y G;  5E3Q A;  3NMA A;  1D9A A;  4XK8 C;  4FS1 A;  4KHM A;  1BQN B;  2XO7 A;  2F8H A;  1U0S A;  4Q7A A;  2WVF A;  2YKN B;  2MLZ A;  3H25 A;  4RBV A;  3G6Y A;  2K06 A;  4NZ0 A;  1R8H A;  2FHO B;  2QA4 S;  4DPT A;  3TAP A;  1NDL A;  1DHM A;  1FFS B;  1FJG J;  1UEU A;  2CVI A;  4K2J A;  1WF0 A;  3CD7 A;  5A2Q Y;  5BYR A;  1DAX A;  4OZJ A;  1SKR A;  1Y5I B;  5DG7 A;  3HSD A;  1R7I A;  5E33 A;  2EEY A;  2R42 A;  1WC3 A;  2IJF A;  2QA2 A;  2PC6 A;  2W25 A;  4CLU A;  4DS5 A;  4ECT A;  2GQ2 A;  3H2V E;  1SQF A;  2YX4 A;  1CC7 A;  1RU2 A;  5D4O A;  2LP4 A;  2AGQ A;  1NDC A;  4C97 A;  1H7X A;  3KHG A;  4ZPB A;  1REV A;  2RRN A;  2AJ2 A;  4LQ3 A;  3FCW A;  2EPI A;  2Z56 B;  1HNI A;  3W7B A;  3TAQ A;  3HSG A;  2QFI A;  2JLF A;  2CPX A;  1DY3 A;  2I6W A;  4ZLP A;  3LP1 A;  2G0J A;  1TMM A;  4DV4 J;  2AQ4 A;  2ZBP A;  2CPJ A;  4OIX A;  4V1A k;  1QAI A;  1RAI B;  4DF4 A;  1SV5 B;  4B3S J;  5SZT A;  4RW4 A;  2VKR A;  1VI7 A;  3HZG A;  1IBM F;  4OZ0 A;  1D8Z A;  1D3W A;  3RB0 A;  3PCO B;  2ZM6 F;  1N36 J;  1LWE B;  3MEK A;  4F67 A;  1KDN A;  4WYL A;  1JLB A;  4KBI A;  2BOA A;  2CWK A;  2H3E B;  5JVG Q;  3NGR A;  2X1A A;  2V2V A;  1AZS A;  4M1K A;  4EZ6 A;  2UUB F;  3R5G A;  5E41 A;  5BR8 F;  3HI9 A;  4JI2 F;  3S8S A;  2OEL A;  2VV5 A;  4G1P A;  3FCV A;  8AT1 B;  4JI3 F;  2WSE C;  3J80 U;  3OLA A;  3D54 A;  3VGS A;  1KLM B;  3I96 A;  4FYV B;  1OYD A;  3I0S B;  3BDE A;  4H54 A;  1IR1 A;  4IOA Q;  4NLT A;  4CLP A;  2VC1 A;  2IDE A;  3W1Y C;  1GXL A;  4DSK A;  4K50 A;  1UA0 A;  1Q8B A;  2QSW A;  2IYI A;  4RW8 A;  1S1W A;  2NXN A;  4J91 A;  1BLU A;  5KFQ A;  4CLW A;  4CT8 A;  1B3T A;  1RWO B;  3B8H A;  2RVJ A;  5CHC B;  4DR7 F;  3WZ0 A;  4X65 F;  4IYQ A;  3VAK A;  2DH7 A;  3W9I A;  5IV4 A;  2XCA A;  1R0C B;  5IC6 B;  1D9D A;  4FKX A;  1BUX A;  4AFF A;  3D3C J;  2W9C B;  3I5B A;  1U2C A;  3T9N A;  4P2M A;  2J6T A;  3GV8 B;  1CPZ A;  2RD5 C;  1B0T A;  4J9V A;  3RB4 A;  5GAE I;  5LMN F;  2DEJ A;  1FDB A;  4WFZ A;  3OHB A;  1S9F A;  1F5C A;  5J2N B;  2EXU A;  1PYS B;  4KV8 A;  2QA1 A;  2UU9 F;  1CQN A;  2PI4 A;  3HHK A;  2LQ5 A;  2VBZ A;  3PKM A;  1DJ0 A;  4F7V A;  2DR8 A;  3RB6 A;  2HHS A;  4A48 A;  4IRK A;  1FDD A;  1JWW A;  5KFK A;  3MM6 B;  5ETO A;  1BE4 A;  2UXD F;  3OHA A;  5CQG A;  2YKM A;  4EK2 A;  4QCL A;  2VQF F;  5GMD A;  2WRM A;  5D0R A;  3P5T L;  3ZZP A;  1DQ9 A;  2K7J A;  2E7W A;  4MK9 A;  5HI7 A;  3UE2 A;  1Q5Y A;  2LLZ A;  1UL3 A;  4RW6 A;  3EPI A;  2AIR B;  3I4P A;  3LGN A;  4EMD A;  1EKS A;  3PO4 A;  3OJS A;  4KO0 B;  1RHM B;  1O8B A;  4NEY A;  2VH7 A;  2DT9 A;  4NXN J;  3U02 A;  4I69 A;  4RZR A;  2LYV A;  3ICL A;  3GV5 B;  4DV3 J;  3H2U B;  2B8Q A;  1T9T A;  3DXS X;  2MY7 A;  5DQH A;  4J9S A;  4NLX A;  2YWE A;  3CCL S;  2DGX A;  3PYE A;  2KVI A;  3OVA A;  3M8W A;  4U7C A;  4DV1 F;  3AFG A;  4UUX A;  4AD6 A;  1WSV A;  1MG7 A;  2MGZ B;  2UXC F;  3ENW A;  5EGY A;  2CZ4 A;  1CUL A;  2Y0B B;  1U2F A;  3K0J A;  1HI1 A;  1T02 A;  3V6D A;  2J0Q D;  1CSJ A;  2J7U A;  3UW1 A;  2F4V F;  2MZS A;  1FK9 A;  2V4R A;  3PZP A;  5D3G A;  1RB0 A;  2UVW A;  3QT5 A;  3EDQ B;  4DX8 H;  1RT6 B;  4ZP8 A;  4ETX A;  3PW2 A;  2OMO A;  8RUC A;  1NK7 A;  5BXI A;  3TZY A;  4DFK A;  2P6T A;  1RYS A;  4C8K A;  1YTY A;  4LVO P;  4PZV A;  5AT1 B;  2MSS A;  1HNV B;  3R8Y A;  1YJR A;  5CD4 A;  3DMJ A;  2ZHA A;  4LFA F;  3JQM A;  4JV0 A;  2OSR A;  1QSY A;  4I64 A;  4X4P A;  4ERD A;  2V4Q A;  1N5Y A;  2B9W A;  3K5P A;  1UVK A;  4BHQ A;  1HYS B;  3QLH B;  2UV8 G;  4G1I A;  1U1M A;  3AJD A;  1X9S A;  4AE5 A;  1SH2 A;  1YQH A;  2IMO A;  2C2O B;  3DM2 A;  4DN0 A;  4NXM J;  1NND A;  2CJA A;  1WI8 A;  3KJV B;  4ZCK A;  2KG0 A;  4X64 J;  1RT7 B;  4P2F A;  4G3I A;  2HS0 A;  5H9E J;  5B0E A;  3BB5 A;  3J7Z 5;  3CC2 S;  3RJM B;  2YH0 A;  2POK A;  2LXF A;  4ZCI A;  1IKY A;  4U67 Q;  4F2S A;  5KFS A;  3RAM A;  1FXD A;  4WYW A;  5KT4 A;  4TQS A;  2G1H A;  4TU7 A;  2GGP A;  3M6X A;  2MLX A;  1FD8 A;  2KJV A;  2AGO A;  4U7U K;  2BDP A;  1MW7 A;  3IWL A;  3QJP A;  4DX5 A;  4N41 A;  4DUY J;  3E2E A;  2R7O A;  3HT0 A;  4HKQ A;  4YB6 A;  4LBP A;  4B3R F;  2B51 A;  2K7K A;  3DNC A;  4B3T F;  4N5S A;  4C8O A;  1A6L A;  4I7F A;  3BR9 A;  1R43 A;  4CDI A;  1KEK A;  1GTH A;  1HNX F;  4F0M A;  1SJQ A;  4IG3 B;  4DG1 A;  1OSC A;  3G82 B;  1H2T Z;  2QSF A;  2HIQ A;  1GMW A;  4C7Q A;  3MEC A;  1VQ9 S;  4CNY A;  2UVU A;  1YVF A;  4RX6 A;  5ETT A;  4UOF A;  1N0U A;  2ROG A;  4IUF A;  3K8W A;  4NLP A;  2N7C A;  1UVI A;  4PR6 A;  3WIV A;  3OLB A;  5J2Q B;  4NCB A;  3KLG B;  2R4F A;  3AJ1 A;  4HL9 A;  4CIO A;  3BPD A;  1FWK A;  1FTC A;  2H5E A;  2WVE A;  1IVZ A;  5MAO A;  2BXJ A;  1DRZ A;  2MZQ A;  3DYA B;  3IRW P;  1RA7 A;  1WC0 A;  1VRT B;  2RHS B;  4MKA A;  2XSJ B;  4K59 A;  2F63 A;  2F40 A;  3A13 A;  2DIT A;  4RO0 A;  4JI6 F;  4G1Q A;  3RBZ A;  1FKO B;  3UPF A;  3ITH B;  5K8M A;  2Q6B A;  2OKQ A;  4IFY A;  1TL1 A;  1YZ6 A;  5K8O A;  3LAN A;  2QL7 B;  1SUQ A;  3P3D A;  3R5C A;  4AL7 A;  5H1S V;  4B9S A;  4L72 B;  3PO5 A;  4Y2A A;  3H5X A;  2V8G A;  1X4G A;  1C0U A;  4KGZ B;  1BWV A;  2CQG A;  1PCA A;  4GVL A;  1Q4R A;  1VYA A;  4F02 A;  1VBY A;  2MB0 B;  4FXV A;  3JAM U;  1MN9 A;  4HT5 A;  5DG9 A;  4LIR A;  3TX0 A;  4YP3 A;  1F6T A;  1ACM B;  2HQG A;  4EBC A;  1YLX A;  5CA5 A;  3CJT A;  5KG4 A;  4XDD A;  3N28 A;  3GR1 A;  3EPG A;  3V6J A;  2OUG A;  4FVM A;  4WK3 A;  1KQG B;  4GKJ J;  2Z2L A;  1X0F A;  2B4V A;  1MWZ A;  4QZV B;  5C25 A;  3UI3 A;  3R7N B;  4LFB J;  2E1M C;  3HVA A;  2HBR B;  3UVJ B;  2EBE A;  3KOA A;  1X4H A;  2QRR A;  3IR6 B;  2B5J B;  2W2O P;  4LVN P;  2P2C B;  1I6J A;  3HLU A;  4QIG A;  4LF4 F;  2BBE A;  2BJD A;  4RWW A;  3V4I B;  5K14 B;  4X4O A;  4RNN A;  3DRY A;  3QNW B;  1R6V A;  2VB6 A;  1W2B R;  5EWF A;  3MD1 A;  3Q0A A;  3BDP A;  2C2Z B;  4C8Y A;  2GVD A;  4R8U B;  1O6X A;  4K7Q A;  2CJX B;  3GJQ B;  3J7Y I;  1JXL A;  3CGI A;  1JJ4 A;  4ED0 A;  4LF7 J;  3N5F A;  4ZMM A;  4KY3 A;  4P6Q A;  4JYA F;  1TVR A;  4Q8F A;  1S6P B;  2VBX A;  2IRX A;  3CTR A;  1RU1 A;  3HVW A;  1FJC A;  1IKW B;  2CPI A;  4YUD A;  3VZH A;  1HI0 P;  5B08 A;  4K0K F;  3JSM B;  1U2R A;  3BQ0 A;  3C6U B;  5M2R A;  1U1K A;  2GVZ A;  2HHW A;  4QIE A;  2C2N A;  1CLF A;  4YDX A;  3QO9 A;  3KWM A;  2BAN B;  1B7F A;  3K5O A;  4F4W A;  3I5A A;  3HX9 A;  5LT5 A;  3GR0 A;  3N6N A;  2MZR A;  3KLI A;  1HBM B;  1U7L A;  2MKC A;  1OWX A;  4EO8 A;  3W8G A;  3RZA A;  3HO1 A;  3MMB B;  1H6K X;  1KKH A;  1ZOT A;  1VQP S;  1QE1 B;  2CJB A;  2CPD A;  4NYP A;  3KXD A;  5DDR C;  1S0N A;  4KT0 C;  2N4C A;  4LF6 J;  1GXU A;  3D1O A;  4JI8 J;  2DR5 A;  4K4Z A;  2CJY B;  4P52 A;  1KHW A;  1NME B;  1PAE X;  2DK2 A;  2HQD A;  2CQC A;  1Y4Z B;  2HVE A;  3NGU A;  2CZ9 A;  3T3F A;  3PW5 A;  4QIV A;  2G2Z A;  2YWF A;  3W62 A;  1X5T A;  4Y28 C;  2HWH A;  2OGU A;  1UFK A;  3LF0 A;  4EBD A;  2G1D A;  4GO5 X;  4CLK A;  4YY3 F;  3WC2 A;  4PG4 A;  5CAA A;  3M2R A;  2RQ4 A;  4ZOS A;  1WEY A;  1X4F A;  3KHL A;  4OZL A;  2MKI A;  1BQN A;  3OR2 A;  3KK2 A;  2YKN A;  4LSN B;  4RWX A;  4ECS A;  3C15 B;  1K8A T;  2EC2 A;  2QLF B;  2UZA A;  1HWL A;  2J7W A;  2R8H A;  2IAJ B;  4IKA A;  1U6B A;  3GJT B;  1U1N A;  1QJH A;  2Z0G A;  1IQT A;  1PIE A;  2J0W A;  3BO3 A;  3M8Y A;  1HNZ F;  1NK4 A;  3AD8 C;  3IC1 A;  4RBU A;  2OML A;  2FHK A;  3H4B A;  3K57 A;  2FLP A;  1XR6 A;  1Z1Z A;  4FS2 A;  1PIL A;  3CED A;  1N5Q A;  4HHJ A;  3GSD A;  3LPE A;  4C48 A;  4ZLL A;  5F8N A;  3C14 B;  3CMQ A;  1IWG A;  4A8F A;  2C1E B;  3QIP B;  3HF5 A;  2QT7 A;  4ECQ A;  3TVZ A;  4EO6 A;  2BA9 A;  4IG0 B;  2ZOG A;  3HCX A;  1Q8L A;  2CZV C;  2AX0 A;  4BS2 A;  1X5P A;  2M70 A;  2WVD A;  2OPS A;  2DHG A;  3D4J A;  2OEJ A;  2WSF C;  4ECX A;  3BPS P;  1Y00 A;  3NG8 A;  2JVR A;  3OTO J;  2RHQ B;  4N7T A;  4YB7 A;  5ETN A;  3HFK A;  3OTC A;  4OZ2 A;  1TAU A;  2F9D A;  1TV6 B;  3KK1 B;  4CLF A;  4P9S A;  3SEO A;  4KHP F;  2RKI B;  1SV5 A;  5CZV A;  3TRG A;  4PXE A;  3TWZ A;  3MM7 B;  4WXW A;  5HSP A;  1NKE A;  1X7V A;  4HH0 A;  1UZH A;  3ZZR A;  1C1C B;  3LGH A;  4NZ6 A;  3LPY A;  5J2M B;  3EGW B;  2ILZ A;  4MJK A;  1Q79 A;  4C6A A;  3FEX B;  1LWE A;  1DAR A;  1HBN B;  3H5S A;  3PDN A;  1FNM A;  3CJK A;  4D3H A;  2OI2 A;  3C6T B;  1MRO A;  3G71 S;  4ECU A;  2UUT A;  3GFH A;  3MXH P;  3S1T A;  1YK9 A;  3K17 A;  1G2E A;  2IA0 A;  1J2V A;  5CZX A;  3AQO A;  4WFN Q;  3CB4 A;  4OYI A;  1R0B G;  1KLM A;  2YWK A;  3ZTO A;  2BE7 D;  3I0S A;  3DRR B;  4CYU B;  4JBC A;  3LAL A;  4WJB A;  3JXO A;  1XEZ A;  2AKW B;  1IBK J;  4RU9 A;  1RCO B;  1RWU A;  2AU0 A;  2R7R A;  1PG5 B;  1ICE B;  3A3O B;  3MFH A;  1FEE A;  2YQ0 A;  4PG7 A;  3QT6 A;  3TQ1 A;  4RKU C;  1ZA1 B;  1KON A;  2PT0 A;  3ZNU A;  2I38 A;  2QFJ A;  1AUS L;  4UOC A;  4WII A;  2FHM A;  2NSB A;  4XDC A;  2IC3 A;  2V8D A;  5EWG A;  2B4U A;  4MFB B;  1SCJ B;  4CLZ A;  1EKR A;  2EVZ A;  2D9P A;  4EUV A;  2W9C A;  3CC4 S;  4DWI A;  3QAU A;  3ZO7 A;  3GYG A;  1JKH B;  4RUH A;  2PO4 A;  1P1T A;  2DNN A;  4R0J A;  5THW A;  5DQI A;  2HND B;  2OEM A;  1HBO A;  1VQS A;  4B08 A;  5LJ5 Y;  4RUB A;  1JLG B;  2JEJ A;  5J2N A;  4EZ9 A;  4R0E A;  3QWP A;  2HFN A;  1S6U A;  4UQT A;  4LSL A;  1N8R T;  3BF4 A;  4LJM A;  4C4W A;  3I9Z A;  1PSD A;  2OFH X;  3CJ0 A;  3PJX A;  3GCW P;  2CKW A;  3MM6 A;  2COL A;  3QGG A;  3QGI A;  2C2D A;  2GW8 A;  3P96 A;  2MPU A;  5EX0 A;  4KPC A;  1V5V A;  4WP8 A;  1VRU B;  2HQF A;  2QMW A;  2LVW A;  2RRB A;  4FXW A;  1A0O B;  3UO0 A;  4MKV A;  4PEO A;  4J37 A;  2XS7 A;  1OO0 B;  1EZZ B;  2J9E A;  1Q5V A;  3V6K A;  2GIF A;  1CJK B;  2NQP A;  3KUG A;  1LW0 A;  4OYP A;  3DOL A;  3KLF B;  1B64 A;  3DGP B;  2HVD A;  1FNO A;  3KNG A;  3GII A;  2DNG A;  3NOC A;  5EDW A;  2HNY A;  1WOP A;  4WFB Q;  3N4W A;  3HHL B;  4ED7 A;  2EK6 A;  3CCU S;  4QWA A;  2FGC A;  3M4X A;  1M5S A;  3G2X A;  3RG6 A;  1HWI A;  2XG8 A;  1K0T A;  1N4L A;  4DF8 A;  5L39 A;  1VQM S;  4FZV A;  2MGZ A;  1UFL A;  2HZA A;  3J7A N;  1L3U A;  2IHR 1;  1U24 A;  2WVB A;  1L3V A;  1JJ2 R;  2CPF A;  4M94 A;  3RBX A;  4ZVS B;  5KFR A;  2ZZM A;  4DHV A;  2BJE A;  2M0G B;  1RWM B;  4C8Z A;  5KG6 A;  5IWA F;  3PYG A;  1UZD A;  4ZPA A;  1RT6 A;  1WWH A;  3DLJ A;  3GJS B;  2Y8Y A;  2HWI A;  2GQQ A;  2DR7 A;  1QUV A;  2HHT A;  3UCZ P;  2XMU A;  1U1R A;  3R5J B;  2GV1 A;  3P8B B;  3KLH B;  3LOU A;  1RI7 A;  2X51 A;  4P2X A;  4HTJ A;  1Q1K A;  3A3N B;  3EIC A;  1HNV A;  1FFW B;  4WFA Q;  2XMT A;  2K2P A;  1GAO A;  2VFV A;  1GFW B;  4L76 A;  2FY8 A;  3VTI A;  1SXL A;  4TLQ A;  1LOU A;  2RT3 A;  2VHG A;  4UY8 5;  3QLH A;  2KXN B;  2B4O A;  2GZO A;  2AEF A;  1SJ1 A;  5CCM A;  5DRK A;  2QLB B;  1JNR B;  1G1X A;  4ZS6 A;  2OSQ A;  2CQ0 A;  4AT1 B;  4NYO A;  2OTJ S;  2DGT A;  2Y0S D;  1T05 B;  1OMS A;  2AW0 A;  3WX4 A;  4JP8 A;  2CAD A;  3DRX A;  5CAB A;  2ADC A;  2F4F A;  1EET B;  1JJH A;  4R5P B;  1RTH B;  1CJV A;  2OEK A;  1WG1 A;  4FN5 A;  2H5I B;  4KH1 B;  3D6T B;  4I1T A;  1TR0 A;  3V5R A;  4UT4 A;  3KJQ B;  3T6J A;  2O01 C;  4Q44 A;  3CJR A;  1IBM J; 
#chains in the Genus database with same CATH homology
 2G0I A;  1S12 A;  4PEO A;  2IDL A;  2G0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...