2G0JA

Crystal structure of smu.848 from streptococcus mutans
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
RGSMIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNALEVLADCTVSLQMDEFDGGYMKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKIMTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords hypothetical protein SMU.848
publication title Crystal structure of SMU.848 from Streptococcus mutans
rcsb
source organism Streptococcus mutans
total genus 33
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04327 Peptidase_Prp Cysteine protease Prp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1490 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cysteine protease Prp 2g0jA00
2G0IA 4PEOA 2IDLA 2G0JA 1S12A
chains in the Genus database with same CATH superfamily
2MJUA 2CPHA 4BC7A 4HH0A 5MLCV 1NPKA 3CD7A 2HFUA 3US5A 4X4QA 1G3OA 4BWJA 1XNQF 2C2KB 4HI1A 5FD1A 2YWGA 3MAAA 3CW2C 4CM2A 2M70A 4QIEA 1YVFA 3GP9A 1BWEA 3IRXB 3VQTA 4F4ZA 2ERRA 1BQNA 4LVOP 1FKPB 3LAKA 2W7AA 4F0HA 1H73A 5LMNJ 3S7RA 3AJDA 1F9EB 4QU6A 1HHSA 2MHEA 2UZAA 4ANEA 1FE0A 3MEGB 1WSRA 3CC7S 3WBZA 1FVQA 3MOJB 3GU0A 2PE8A 2C2RA 4FF2A 3JB9k 2YX7A 2CYYA 4U8VA 3HX9A 4ALZA 1QJHA 1ZTWA 2C2EA 1OY6A 2K8GA 2HNDA 3W2WB 3I87A 1ZYQA 1U8WA 2CQGA 3SQGB 3OTDA 6FDRA 4X65F 1TTHB 4ZVHA 3FQLA 3EWGA 2YNIB 3CSKA 1GMVA 2DH7A 3H7HB 3JQJA 1EZZB 3CCQS 2PN6A 1JLEB 3TJAA 5IM0A 2E7XA 2VHGA 2HIQA 1UPPA 4BS2A 3M30B 4JI4F 4RW7B 3OPKA 1U26A 4RNNA 4QU7A 4ITSA 2MZJA 4WKYA 3KHRA 1TUWA 2H9ZA 1U48A 4JI2J 2WCXA 1YWXA 1SIWB 1CJKB 5DDOC 3D3BJ 1URNA 4NCGA 3BN4A 5I4MA 5GAEU 4AQYF 3I5AA 2CADA 2H54B 2WONA 3P4UB 3BGOP 2GHPA 2ZWPA 1HQEA 3GR1A 3VAIA 3RBEA 1GX6A 1VQMS 4UT4A 4KHMA 2I0XA 4LF1A 2V9WA 2MKHA 2VPYB 1NSPA 2XGQA 1ROFA 2JL9A 3KUEA 3BH6B 1KRPA 2FGOA 2CPIA 1G6BA 3QYYA 3ICLA 1C1CB 2IM0A 4ED7A 3TZXA 3ILOA 1CS4A 2ASJA 4C97A 4S0MA 1IBLF 4HACA 2Q66A 3MZIA 3D5MA 2NLWA 3BF4A 4DPOA 2YH0A 3IG1A 3I0RA 4CLPA 1AYEA 1QAIA 3I6PA 2JRSA 2B9XA 5IV4A 1C0TA 3UR0A 5K8NA 4LF6F 1NLKL 4IH6A 4DR4J 3JSBA 1TL5A 1YJTA 2RQCA 2AGPA 5ETSA 1B0PA 4ILMA 4DV1F 1S6QB 4CLZA 1FFGB 3AODA 1PC5A 1TV6A 2ILZA 4QWDA 3CJ5A 2VICA 2VG5A 2J7WA 3ZNUA 2ZVIA 4ECUA 4NXNJ 3P96A 1ZETA 1SL2A 4QWBA 1Q81T 1YX2A 1U6BA 4EZ6A 3CO0P 3OR1B 3PKMA 2HAIA 1X4BA 1IM4A 3RBZA 1R6YA 1N5TA 4KE5A 2I2YA 3MURP 3F0NA 5CQGA 2J0QD 4IDKB 3H42A 5A6WA 5DZ7A 3DMJA 5C42B 2VPWB 3KHGA 4NOHA 3C6UA 5L38A 1RT4B 4QIFA 3PR5B 3TZZA 3ET6A 2JFDA 2YNHA 2U2FA 1RHMB 3QGHA 3G4SS 3BBCA 5IT4A 1GMWA 4LIRA 4LF7J 2CZ9A 3QIDA 4NMXA 4NRUA 2EVZA 1ELOA 1D09B 3GMGA 3LP2A 1DLOB 4CYUA 1IXKA 4OI6A 3ILJA 2GVZA 4CTAA 3QAUA 4DV4F 1TK8A 3PO4A 2OI2A 1JXEA 3NCRA 1YBUA 1MWQA 2DGWA 3R5JB 3H5YA 4WFBQ 3PDNA 3LO3A 1Y0HA 2RNEA 4PWDA 1WKLA 2N7CA 5D0GA 2IYGA 2AHOB 5LSLA 3ZTPA 4LMZA 3W60A 2C3YA 2IY5B 4JYAF 2V8HA 3LUYA 2W4DA 4CT9A 4PABA 2CKWA 3BDEA 3SCKE 1MU2A 2V2ZA 1RAOA 2B5JA 1C1BB 4K7QA 1S9GA 3Q8SB 3UN5A 1HWLA 4DLGA 2Z30B 3M8RA 1LW0B 1BHNA 4IQXA 2M0GB 5D78A 2CA9A 1U1OA 1NB7A 2J7KA 3CC2S 2HLTA 4IOBA 2ZUAA 3V81A 4FPRA 3HVRA 3QO9A 2VG6B 4ZDNA 2MLZA 3P5TL 1YBTA 4OLPA 2HFZA 1RWUA 1JLBB 1RB0A 2XNRA 4X62F 2G1HA 4DUZF 1SKWA 1X4HA 1WEZA 3MM9B 2CQCA 3TOQA 3G6XA 5HQ8A 2DNZA 1IBMJ 1VC6A 1KONA 3ONQA 2KFNA 1IQTA 3PO5A 3UDVA 1VK8A 3CJKA 2RRNA 3QZ7A 2GHVC 2RQ4A 2UU9F 4TXSA 1PYOB 2MZSA 2K3KA 3M32B 1VLOA 4NLUA 5CYQB 2YKMB 4IFVA 2V8PA 3H98A 1U0HB 3U02A 2JJ4D 4C2MA 5DDRC 3T1YF 5AJ3F 1FA0A 2QGFB 1WHXA 2ZJPQ 1B0VA 3PYEA 2OPRA 2BABA 3Q8RB 3ENQA 4C11B 4Q2MA 2GHWA 2GA7A 3KG0A 4HEA9 5HMZA 2BR0A 2ZZTA 3CIMA 1NZAA 2R8HA 2OMLA 5EX0A 3GFHA 2RQMA 2ADCA 1SH2A 3HZEA 3G8QA 3H2UB 1N8RT 2VQEF 3B54A 5J1EB 1F9HA 5HSPA 4ECTA 2JDJA 3FSXA 4DFMA 4MK7A 4ZS6A 1UWBB 1S1XA 4DR1J 4ZPTR 4O3RA 2RDDA 2KU7A 5KFSA 4F4KA 4X4VA 3BKTA 3IR7B 3O3LA 1N5YB 4ES1A 1BXNA 3DDNA 4ZA1A 1ZAVA 4F50A 2D3O1 1HBOB 3EZOA 2ZH5A 1PO6A 1WNEA 3CGIA 3TA1A 4ECRA 5H9FJ 3OR2A 4NCAA 3LGMA 4RW6A 4MFBA 4HDGA 1PGZA 4KTQA 4JUZA 3OXGA 1ZA2B 3HJVA 2DNQA 4QR0A 3JSMA 3PX6A 1B0TA 3RR8A 4F4XA 2UXBJ 1LW2A 3W61A 1D1UA 1VLYA 1KQSR 5CYMA 4G1QB 1GEHA 2PC6A 4PUOA 2CAJA 5HLFB 5KFEA 4KV8B 2ZBCA 4UUWA 4ZP8A 2ACYA 1N32F 2YKPA 4ZIWA 1R8PA 4IRKA 1LWEA 1RT3A 3V6KA 2G0JA 3GFZA 5HO4A 1RU2A 2PT0A 2DNOA 1OQ3A 3MWBA 4Y28C 4W98A 5K20B 3I9ZA 4B9UA 4ES3A 4FS2A 2FTRA 4L73A 1RT6B 3PNIA 1RTHB 3NEKA 5D6GA 2MQPA 2QN6B 3I9V9 1KNZA 3F73A 1U1PA 2KRRA 1CBKA 5KG1A 3B78A 3D28A 3T1HF 1WTFA 3GONA 4CM0A 2W4CA 2CVEA 4OX6A 1TKDA 5I3PA 3PXGa 2KZZA 1QSLA 2KRBA 4DJBA 1CQNA 2XCPA 3DN9A 2FVSA 2CNNB 2W2NP 3BO4A 4KQZA 2DRDA 2FJBB 1WOPA 2R8KA 2GO8A 4ID5A 4MKVA 2Y1JA 3G6VA 7AT1B 4F3OA 2QA1A 5AXKA 3ZNJ1 3HCXA 1IBCB 2HFSA 1RAJA 3M2VA 1DZ5A 4NX9A 4ZP6A 1NK7A 2FJXA 2XMTA 2HHVA 1RP5A 2DGOA 2YWWA 1YRTA 1NM2A 4ETXA 4P7VA 4LFBF 3HHKA 3BGFA 4DSIA 2QLJB 4DX8H 4CLTA 4A47A 3JXOA 4A8QA 3GYNA 4YMEA 2FLLA 3KKFA 2PMZD 4ZLJA 3C15B 3VCDA 2EI5A 3B4MA 1VCTA 3ENWA 3BGLA 4QIVA 4K4YA 2Y9HA 1TAQA 3R5AA 2JC1A 4CLSA 2VFTA 3D2WA 2HVZA 2GMJA 1VQNS 4Q0BB 4YDDB 1NK9A 1X4CA 4FXWA 3CMAS 3TWZA 4QR2A 1WDDA 2A3JA 4LSNA 2CPDA 5CZVA 1I94J 3PHEA 3MUTP 4EEYA 1IKXB 2IPOB 3BGUA 4B9NA 4XIUA 1ZPVA 1KEKA 5K9FA 3T19A 3BKUA 1LK7A 2VIHA 4CO4A 4DF4A 3PG9A 1CPZA 3CJQA 3KMSA 2WOMA 4FNHA 2DHAA 3DOMB 2G2OA 1DQ9A 4K4WA 1FD2A 3U1MA 2VONA 1TR0A 3MM6A 1RAHB 2QO3A 2XMMA 1YLXA 2HHHF 4LF9J 2XYGB 2BANB 1RKJA 1DTQB 2MZTA 4G6VB 4HTIA 1KD1T 2WVCA 2H5EA 4NA2A 1R0AA 3OL9A 1SUQB 1U49A 3UE2A 3NP5A 3UVJB 1KOHA 1HW8A 1CJTB 2L41A 4G1IA 1VR6A 1N52B 1WOOA 3K5MA 2F4VJ 4AYBD 5KOXA 2IVMA 4KHPF 1KN6A 1IN0A 1KWMA 1S12A 2XYPB 4AD6A 1Q79A 2AMCB 3KK3A 2ZC3A 5IFMA 3U1LA 2NS1B 1OPZA 1DBDA 4ZP7A 2HW3A 2F9JA 1S72S 1YSJA 5CAAA 3R7NB 3H5SA 4WPAA 2G1DA 5KG6A 4DZDA 1U02A 2WK4A 4WFNQ 3BGRA 2D69A 1V9OA 3KLFA 2HQGA 1CQMA 2DHHA 1Y7PA 4O23A 2HAFA 2CNLB 1Y5LB 4OV1A 1MROA 4DCPB 1S1TB 4K2XA 5HVGA 1F0XA 3M8ZA 4PQUA 4R25A 1WF2A 5D3GA 4MJKA 2OH2A 3UPFA 2R7OA 4Y2MA 4Y65A 3WQPA 2A2DA 5AXMA 1LFWA 4XTTA 3FCWA 2DIUA 1X4DA 3IMQJ 2I5JB 1RHKB 2FVQA 1Q86T 1HNXF 5B0BA 5K8MA 4U95A 5GAHI 2MSSA 4I6WA 4NLRA 4H4KA 5E2QA 1HL6A 3U7JA 1T0TV 5CD4A 2PFFB 3KTQA 1RUSA 5HANA 1NO8A 2HIYA 1N36F 2UVRA 4WFYA 3QT7A 1N33J 1YRUA 2HVHA 1UPMB 3CIZA 1CEZA 3MMBB 3UDCA 4QW8A 4MKAA 4IH7A 3VWSA 1TL1A 2R7WA 1DQ8A 4C9DA 2W9AA 2OSRA 1AA1B 4ECQA 4ZLPA 1FFSB 1VBKA 2ASYA 2XS2A 2V2KA 3J80U 1RWXB 3KDOA 2X7IA 1IKYB 4OZ3A 1M5VC 2XI3A 3L7UA 1UKUA 4OIXA 1RBOB 3MPDA 3CCVS 2WW4A 1XNRJ 2QIFA 2KVQE 5KFIA 1R8BA 2CG8A 2Y1LB 3GCWP 2MY8A 2DNGA 4NLSA 4P2MA 1SCJB 2FIUA 1FRXA 3GG0A 5IOLA 5K14A 5E33A 1DTTA 2BJ7A 1L3KA 1U25A 4B3MJ 1XJWB 2OPQB 2DGXA 2GJIA 1Q4RA 4DR2J 2RSQA 1RTJA 4EMDA 1IWGA 1NHUA 4L72B 1VRQC 4KPYA 2QSWA 3A8EA 4Q8EA 3SQOP 2PSZA 3H5UA 4O4GB 4YEAA 4DPUA 2DB1A 3QSYB 3HHEA 3FC9A 1YZ7A 1OS5A 4FKXA 4KH1B 3WC2A 3E2EA 2J8SA 4X66F 2W7OA 2VA3A 3A13A 5LXYA 4RLEA 5HAOA 4J9MA 3HKZD 4FVCA 3PV8A 1RT2A 3C14A 2IBOA 4KO0A 2G9OA 2QFJA 3R7BB 4ZP9A 2GQCA 3NOGA 1FKOB 2OIHA 2YQ3A 2V2QA 5G4DA 5KT7A 2YQ1A 4EBCA 3KK1A 1R3NA 3FCVA 5C25B 5KFMA 1S1UB 2VBZA 4K59A 4EUVA 4Y2KA 3B82A 3PHTA 3QWPA 2F1FA 4QZVB 3OT9A 4PYAA 4U6PA 4P73A 1H38A 4JV5J 2X1BA 3R3TA 3R5CA 3AOCA 1UA1A 4OJ1A 2BJEA 4Y2AA 2KFYA 2FHKA 5F3TA 3TA0A 3DLGB 2DTJA 2VPZB 2O3DA 2WRMA 2BOAA 1VFJA 4QYRA 2L9WA 4ID8A 3MDFA 4DX5A 5LMNF 2GIQA 3UN2A 5GAHU 3D54A 1DFDA 4WF9Q 3IGNA 3OFHA 1JQGA 3UDLA 3SV4A 4CWBA 4BCAA 1HNVA 3FVYA 2HWTA 1UJ4A 4C48A 4NLXA 4I2QA 5ADZA 4DN9A 4GVBB 1X5TA 3WDOA 5IWAJ 5HP1B 4Q8FA 3AQOA 3VF0B 1SV5B 2ZH3A 3BZQA 3MXHP 3VAFA 1S4FA 2MKCA 3SFUA 2DPIA 2J9CA 3HSZA 5E3RA 3SFGA 1KTQA 2B56A 4CLUA 2EKNA 2X51A 2OPPA 4A8FA 3H25A 4QYZK 3CDBA 4O3SA 3AFGA 3NOCA 4OX7A 4MMOA 3LH2S 4Y3CA 1Y11A 4JI2F 4AT1B 3FBCA 3ITHB 4Z37A 1Q1KA 1U24A 1PYSB 2FLOA 4WIQA 4ICLA 1GFWB 4CDIA 3D0GE 1SKSA 3QJJA 2OTJS 2FDNA 5KFBA 4NYZA 1TMMA 1S9EB 4JI0J 2W25A 5KFHA 4XK8C 4RNOA 5U47A 4DG1B 3CJSA 1SC1B 2GX8A 1NXIA 3Q8UA 3TUIC 5IT9U 4A8KA 4Y2CA 4WFZA 3NS5A 2LDIA 2AKWB 4GMKA 3HHDA 4UQGA 3R1HA 3FK4A 1FI4A 2V8VA 2F8MA 1M5OC 1VRUA 3NGDA 3OW2R 3TYTA 3HD1A 3QQCD 1RYSA 2DNHA 1PAEX 3DM2A 1SH3A 3DRSA 1TFWA 1HHTP 4L74A 2XZTB 2XQCA 2WVFA 3AT1B 4I4BA 1J2VA 1TMJA 4DF8A 2QA4G 5G0RA 2XNQA 2UVWA 1X9WA 2EFOA 1CULA 4QW9A 3TJ8A 4KC5A 2K7JA 4DR4F 4F25A 2LDYA 1HA1A 5FJ4A 4F4AA 3MEDA 2JSXA 1KS2A 2RH3A 4QWAA 3HFKA 4FDFA 1MWYA 2BVZA 2VFVA 3EDRB 1FK9B 3EGNA 3CULA 4NXNF 3CJ4A 2CJQA 4DQRA 3EZUA 2JEFA 2UUWA 1VBYA 5F0UA 3DRPA 1JNRB 1FT8A 3DNCA 3CMES 5A8RA 1VQLS 3OVBA 3M6UA 1S7HA 4J37A 2AW0A 5DG7A 2FJVA 1AFJA 4X65J 3KK2A 4IG3A 1SKRA 3R7SB 5DDPC 3LOUA 1HBNA 3GE9A 5L39A 2VJUA 3NGUA 5D15A 5IQ6A 2CDQA 3M8YA 3L95X 4LBHA 4J9KA 3BM7A 2NXNA 4LF7F 4RX6A 3FQKA 1RYRA 3CPWR 4JI4J 3NL0A 1X8DA 3IFEA 2E1RA 4TU9A 4DSLA 3ZZPA 1YJNS 2D9PA 1KVJA 5L9NA 1O5JA 3OUYB 4DV2J 3JQMA 2FVPA 5D8HB 3I82A 3EPGA 2IYIA 2QX0A 4EBDA 4H4MA 5FLXU 2ZBRA 2C3OA 1RT5B 2JH3A 4OMFG 3Q0AA 2ZHBA 4CP5A 3OJUA 1TQLA 1UZDA 3IXQA 4QR1A 3SDEA 5E0OA 5B09A 1KLMB 1ZM4A 3QJPA 3ISND 2J0SD 4JI6J 2Z2MA 2JEGA 5L8RC 1HBUA 1KHVA 3FZBA 3HK2A 2EG1A 2DR9A 3F56A 5A8WB 4U96A 5LJ3Y 5B08A 5ETNA 1BQMA 4YR2A 3RRHA 4ZPAA 2VA2A 2FHJD 4USIA 2B4OA 1U2RA 2AGOA 4C0HA 2YWKA 1TVRA 2K7KA 3TANA 1KHWA 3OLAA 2CQPA 1UL3A 5I42B 2UP1A 3R6LB 3J7YU 1VMBA 3H2VE 1T02A 2BQUA 3NMAA 4JI1J 2I8EA 3ELHA 4GKJJ 4ZKAA 3EJMA 2KO1A 1YITS 2GJFA 3L9ZA 3LP1B 4AL7A 1NSKL 1NJYA 4TNOA 4CLKA 2KTQA 4UOFA 4WE1B 1N5QA 2Z58B 1IBMF 5IQQA 2XYHB 3C16A 2V69A 2GZOA 2W24A 3DGPB 3OJSA 3QLHB 2RDIA 2ZBPA 2HS0A 2QMWA 3BKFA 3MF5A 1EB0A 2W7PA 3SZ2A 3JAMY 2VG7B 1R31A 3BB5A 1T05A 2JOQA 1M5HA 3T5JA 2ASDA 2YPZA 3FSYA 2VBYA 1HR0J 4MK8A 3LAMA 1XC9A 1WF0A 3KUGA 4LRDA 3VALA 7FD1A 1FXDA 1RWPB 1X4FA 3M1VA 2WBRA 1JK9B 3PCOB 1XMQJ 1R27B 2P2CB 2LXUA 1WEYA 4JB8B 4TQRA 3PIPQ 1C0UB 5E41A 1EKRA 2E5LJ 1GTEA 4DR1F 2RS2A 2MSTA 2G0IA 3TVYA 2XMJA 4IO1A 3UI3A 1EAYC 3RB0A 1P6TA 4QYZJ 3V6JA 2QZ8A 3CCTA 1RWKB 1NSQA 3P6YC 2WTFA 1TKXB 4ECZA 1WC3A 2XWYA 3TA2A 1HMVA 2UUAJ 2I6WA 3OTCA 4PAAA 4ZCKA 2XMKA 2JZ5A 2UUBJ 3ZZUA 2IVFB 2ZE2A 1VC5A 1TL3A 4AXIA 4DR7F 2C28A 4JYAJ 4NI2B 3FNNA 2DR8A 5GAGI 2Y1IA 4DXLA 5SZTA 4KKOB 4B17A 2UXBF 4ILLA 4YB7A 3TUZC 5DLFA 4WWSA 3FBBA 4IKAA 1EP4B 2DNMA 1Y5NB 5HQMA 4EZ9A 1NNDA 4WXOA 1S5ZA 4R5PB 2U1AA 1N6QB 4P2FA 2CQ1A 3GYGA 2NYHA 2OKQA 4B3OB 2V63A 3I0SA 3DRYA 1EARA 3GJQB 1DQAA 3LA0A 2OPSB 2EFQA 2F4FA 2YH1A 4NCBA 2J0XA 4LBIA 1S1VA 5CA5A 3DI6B 3D1HA 3K2YA 3MAQA 3MCNA 3CNQP 3PYDA 3EZ5A 5ETOA 2GGPB 3PFEA 4UY85 4RU9A 2DNKA 3ZTQA 1UJ6A 4OI0A 3TW0A 4DUZJ 4RW9B 4RUHA 1XBWA 3FSIA 2V4JB 1RTIA 2WHOA 2FC9A 2BV3A 1BUXA 2AD9A 2IDLA 1ZBTA 2RE1A 2Y3YA 4PXBA 4DR3J 3E51A 3GLJA 4HTJA 3GQCA 3EGZA 4FPIA 1A9NB 3HHLB 2A10A 3OSNA 3I55S 3GFYA 1XR7A 3D66A 2YNGB 4N41A 2BZ2A 3GJTB 2YKQA 5F8JA 2HMIB 2PI4A 3QATA 2OEKA 3M2RB 4C7QA 5A2QY 2J5AA 2DO4A 3D6HB 1YJVA 2G2ZA 1I3OB 4L3NA 3QGPA 3HD2A 3W1YC 2BRKA 3DOLB 2XMUA 2J76E 3D6MB 1UFKA 4OLOA 4ZLLA 2DXFA 4F4WA 4ZOSA 2DVIA 3THPA 3FEZA 4NEYA 3KJVB 3SCLE 5LOQA 2E5HA 3DXSX 5KG3A 1H7XA 1BMQB 1TKZB 3OL7A 3Q86A 2HZAA 1VISA 4M5KA 2K1RA 4PG4A 3DOKA 4JV2A 5ITHA 3MECB 1PILA 2LQ5A 3AA8A 2CDRB 3MR5A 1LWCA 4WZQA 2AF6A 2O66A 3LP0B 5EDWA 2LQJA 4QIWD 1VQ7S 1HWKA 3M9OB 1W26A 1PG5B 3SYZA 1I94F 2WB4A 3L7PA 1SL0A 2C3UA 3M8PA 4ERDA 4UZCA 5F8NA 3S8SA 2K3IA 4OHVA 2CQIA 2CPFA 2CPYA 4RBUA 3TUJC 1AB8A 2DGTA 5ETVA 5BXIA 4U7CA 1B7YB 4WTYA 1NMEB 4QWEA 1Z4UA 2GVDA 3HDSA 4URSA 4LF9F 2EBEA 1B99A 1S1WB 3KLIB 3CDEA 4DL7A 2L08A 4N56A 2OJ3A 3UR3C 3SSQA 2LXIA 3VR1A 3D4JA 1FCAA 2VC1A 3C6TA 4H54A 2RRAA 1KFDA 1FTCA 1PAUB 4U67Q 4E98A 4QCLA 5ETRA 3S01A 3KHHA 1CJUA 2AU0A 4JI5J 4C4WA 3KJQB 2R42A 4OV6A 4ZHRA 3NY0A 3TZWA 1TELA 2A1BA 2VQFJ 2ILYA 2B4VA 2F4VF 2UV8A 2I38A 1L3SA 3KXDA 3HFZB 2YWHA 1WHVA 1T9TA 4ZVSB 1KOOA 5GMDA 2H5IB 3IBWA 1NH7A 3QRPA 4X2BA 3KLEB 3J81Y 1U1MA 2PGCA 2DBBA 5FIIA 3G6ES 3CDUA 1GH8A 2QT7A 1M5PC 4I64A 4I6AA 2AZ1A 1T9VA 2L48A 2IC3A 3PACA 5D4OA 1UVIA 5T7LB 2JVRA 4LIWA 3PIOQ 2UV8G 3LQVA 2NUHA 2DISA 4X4NA 2XSJB 1NHKL 2D1CA 5HROB 4DV7J 3PW0A 3RAXA 4B3TJ 4CO5A 3TAMA 1HI8A 2AYBA 4OX9J 2EBGA 3HSDA 3E01B 2YKNA 4WU3A 5I3UA 4P74A 3CJ3A 1ZM2A 3MMCB 4F0MA 2OFHX 4FZVA 2BKOA 1L3VA 3N01A 2DY1A 3CD5A 4N7TA 5HBMB 4DSFA 3W5YA 1S99A 5DETA 4P2SA 2ZM6J 3X1LB 1SQGA 2BW2A 3M9MB 1U09A 1DJ0A 2HRUA 1F1BB 3R5GA 3MMJA 3MI7X 1XN9A 1YKWA 2W9BB 1Q7LB 3M6XA 3MM5A 3DC2A 4WTOB 4ZVPB 1FE4A 4R8UA 2EFNA 2ZNYA 2BE2A 4RUAA 4C8KA 3DLEB 5L46A 4ER8A 1FRIA 4H4OA 1QUVA 2DGVA 3JYTB 4EWTA 1IQZA 4ZVRB 2K2PA 1PC4A 4D3GA 1N33F 2OEJA 2KI2A 3HM9A 1OYEA 2KB2A 1WSVA 4TYBA 4M5DB 1RT1B 1AZSA 1JLAA 5ETKA 3KFWX 4DL4A 2HHHJ 3TP2A 1OSDA 2FQQB 2FVRA 4DZ6A 2WSFC 1UA0A 1NSAA 5JJBA 2BKPA 5CXTA 2O67A 4WCEQ 4I1TA 3NRBA 1GTHA 3FFIA 2D3ZA 3NGTA 2HHSA 1UWAA 3Q89A 2GC8A 4NEZA 4KB7A 2M9KA 2Z57B 2HBRB 3ZO7A 3CCMS 2V94A 4ZMMA 2CPEA 1IKVB 2YKOA 3UWTA 4PYDA 5AE2A 1XNRF 2POKA 4PPDA 1FJEB 1BC6A 5IV3A 1N5VA 2F3JA 3PZPA 3CJ0A 3BQ0A 4BC9A 1N0VC 1HYSA 5H1SV 1WDTA 4HHUA 3FEYB 4F8RA 2CZVC 4KFBA 4B3MF 1W7WA 3IR6B 2PMWA 3O44A 4DR2F 3M6VA 3NNHA 2CQDA 5IC4B 1PBUA 1JLQA 3AAWB 4IOAQ 4TY8B 4QPTA 4B02A 4J9SA 3MMAB 4P9SA 4WK1A 1QY7A 2JLGA 1QLNA 4J9UE 4ZVOB 2OLWA 3QT5A 2A18A 1GX5A 3UQSA 1RLCL 4LRCA 3WIUA 2HYIB 2NYIA 2CXEA 1NJWA 4OJHA 1AT1B 5BJRA 2W2OP 3W2VA 2BJ8A 4DL5A 1RZMA 1FNOA 1WACA 2JNJA 4LREA 2XO6A 4K0KJ 1RBAA 1HNWJ 4LF5J 1TL7A 1WORA 5A0YA 4IG0A 2XLIA 1WELA 2IM2A 1X0FA 3POTA 2ZZNA 2LEAA 1UEVA 2Z56B 3DXBA 1AUDA 4DEZA 5CABA 2AIRB 4A4JA 2J6TA 1OPIA 1DAXA 2UUCJ 3GSIA 1F5AA 1FEHA 3T5LA 4Y34A 5E3PA 4CO3A 2ZJQQ 4K5SA 3QBCA 1IJFB 1S6OA 3DRRB 1ZAXA 3QRQA 4HL9A 2MGZA 4P10A 2IRYA 3BQ2A 2RAQA 4ED6A 3QFWA 2WSCC 3V4IB 1S0NA 4JI7F 1TL4A 1WOSA 4LF8J 3TARA 3CCZA 2NSBA 3CCRS 3OFEA 1ZZFA 4RWWA 3BYRA 3SCJE 4CLFA 1LWFA 2EK6A 1RU1A 4ED4A 2XMVA 1RT7A 4M5IA 3KLHA 5HVFA 8ATCB 3W5XA 2QC3A 4HHHA 3CCWA 3DYAB 3CCSS 2FHOB 2OAUA 5IWAF 2ZJRQ 2IRXA 1XR6A 4PXCA 2R7QA 2IRUA 1VRTA 5CCMA 1J5OA 3BR9A 3QT8A 1HPZB 3NGRA 1QSYA 3O1LA 1A0OB 4DFJA 1RJJA 1FX2A 1HWUA 1YRXA 2BE7D 4AL6A 3GCXP 5F9NA 2HBYB 5KT5A 4WJBA 2XB2D 4ECYA 1MW7A 3M8QA 1DRZA 3CTRA 1SBRA 3C19A 1V6HA 4C8OA 2QL9B 4WU2A 2RIJA 3MCOA 1J27A 3JS9A 4DV6J 1E6YA 3ILLA 2HURA 2KYXA 2DNLA 3LTOA 3TX8A 4JI0F 2G13A 1LXNA 3DLBA 2P5VA 5CZXA 4OYMA 1REVA 5FDLA 1KDNA 2Q3PA 3OBIA 3PJXA 2C3PA 3N4WA 1GK8A 4C98A 5J2QB 1NDPA 4DR5J 5KFVA 3C3LA 4KJIA 3AY0A 4IOCQ 3BREA 4PG6A 3M8SA 4XPEA 1S9FA 1EQMA 3NBPA 2VFUA 2ALZA 1JLCA 3W7BA 1ZZNA 4LQ9A 3CCES 2R4FA 4QOTA 2PEHA 5L9XA 2CJXB 4KGVB 5J2PB 4CNYA 2COLA 4I56A 3HSGA 1C2PA 3MEEA 3GIKA 4P2XA 4J90A 3M9NB 4RW8B 5C24A 1HI1A 1UFLA 1VQYA 1FEEA 3VGTA 2ZD1B 1FXLA 4HYKA 3FBFA 5LL6d 2RUSA 3A8IA 1M90T 2VB6A 3T6JA 2ZH1A 3JTOA 3QFHA 3KOAA 1JWWA 5DLGA 3N6MA 3KMQA 1RA7A 3PW4A 1GMWD 1P27B 4A8MP 3W9JA 3W65A 3K8VA 3MAAB 2XULA 2JVOA 2FGCA 2HKEA 3Q8QB 4DL6A 2H51B 1BQNB 3LW5C 2EFPA 4UW2A 1S97A 5THWA 2OD6A 3N6LA 2F7VA 3PRDA 1IKWA 4K50A 1UZHA 4G3IA 3FMWA 4IFYA 2CPXA 5J1PA 5ETPA 3DLHA 4LFAJ 1GAOA 1B7FA 2E5JA 3UFCX 5F8GA 4EYIB 2G0CA 5J2MA 4N5SA 2QL5B 2V4RA 2XM3A 1TUVA 3MR3A 4OZ2A 3OQ2A 5B0AA 1WC1A 2GO9A 3DLJA 4HI2A 4QBUA 4DV2F 3ETMA 3D9BA 1OY9A 1RQ0A 3CE8A 1FRMA 2HGLA 2W9CA 1S6UA 5AXLA 2HNDB 4K4VA 2GIFA 2WVEA 1X31C 1VC0A 4UUXA 3MUVP 2YX1A 2CQ4A 1YGYA 4J9RA 1Q7YT 1X4AA 2EWHA 2XCAA 2B0GA 2O01C 4ZVQB 5HJXA 1BLUA 1G2EA 2CVIA 4RNFA 5IM0B 2HHQA 4JI6F 1S7IA 5DDQC 1TKTA 1MG7A 1OIAA 3IM9A 4DSEA 1P9QC 1K0TA 2YXLA 1GT8A 1F5CA 4LR9A 2MY7A 2FVCA 2FJWA 1BD6A 3UNGC 2B6AA 3R5BA 4HHJA 2CFXA 2OO4A 2P9GA 2RKIA 4NCGB 3SIPB 3LGNA 4XAKA 2XZDB 3PW2A 2UVVA 2WONB 3AXKA 3HVTA 4ZPDA 5F8LA 4KGXB 3I96A 4W92B 3W62A 1EX8A 4JI1F 4GKJF 1RWOB 1HQEB 4B9MA 1Y4ZB 2B7BB 2PEBA 2NXUA 4Y2IA 2OP5A 3UNYA 4WFAQ 2AEMA 2FYXA 2UVUA 4P7TA 2OELA 4ANCA 2J9DE 2MB0B 1IJEB 4C8NA 1CS4B 1NEEA 2M2BA 4NA3A 1Q8IA 4NMLA 4RKUC 5GMEA 4HACB 2FHJA 2C1EB 3GV8B 3AB4B 3IG1B 3I0RB 2YY3A 1FF2A 4IR9A 1Y5IB 1C0TB 3RUBL 2ZH2A 1CG2A 1NJIT 3V6DA 4LRBA 3M8WA 1BGXT 1HR0F 4PXEA 5EUHA 1W2BR 4YR3A 1SH0A 2LA4A 4Y00A 1FJGJ 3ZZRA 1TV6B 3MAHA 1XMQF 2NREA 2VG5B 4P52A 5B0EA 3ZC4A 4URGA 1U2FA 1VJQA 1MNEA 1Y3JA 2HFNA 1MSWD 2VU5A 2B51A 1YG0A 2C22A 2Z4PA 2E5LF 5J2NA 2BJDA 2RJZA 1HD1A 2FY8A 1NKEA 3TQ1A 3DMJB 3MR7A 2QLBB 1NDLA 3C6UB 3KG1A 3NNAA 3DDKA 3ET6B 4RZRA 2YNHB 1T9WA 2UUAF 2I9SA 3BSCA 1WWHA 2MLYA 2YBVA 1NK0A 2UUBF 4M8LA 1JLGA 2D74B 2A6OA 2BRLA 4X64J 2R7RA 1RBLA 4OZNA 3ZZOA 2M5YA 3WHIA 1PSDA 2QJ3A 4YB5A 3LP2B 3HI9A 3OFFA 3NCQA 2IMWP 4J9QA 2HQIA 4CYUB 2W1BA 3H4DA 2GVZB 4CI0B 4CTAB 1F3VA 1UETA 3NWRA 1APSA 2ADBA 5IXUA 4NWBA 2BE9B 3AD7C 2RHSB 3L09A 1N48A 1X9MA 2ZH9A 3HSJA 2RF2A 4PWDB 2Z0GA 1Q78A 2HNZA 2MQNA 1M1KT 4IYQA 4TN2A 2W2PP 4OI1A 1MU2B 5EHHA 3TO8A 2JFKA 3VVTA 1TUGB 3OTBA 3GJSB 2B5JB 2V4QA 4DR3F 1S9GB 3R9LA 2YNFA 3ZXWA 4DUYJ 4XDDA 1Q16B 4Q44A 2AYGA 2E9ZA 2ZOFA 2WZ1A 3KLGA 3SMZA 3HULA 5KFLA 3V81B 3BSAA 1B4SA 4C3MA 1NH8A 4K4UA 3QO9B 3MPUB 1YDLA 1JKHA 3NXZA 3OXFA 4HLBA 3RBXA 9ATCB 3A8JA 2EC0A 4U8YA 1HNIA 4EGLA 3NMRA 3EMTA 1KQKA 1SC4B 3G8TA 1LWXA 4YDXA 1N88A 4OYZA 1XK8A 3CJKB 3CB4A 5E3QA 1VK3A 3BO2A 2XBPA 1HD0A 1DURA 3GIRA 1RTDA 2ZDPA 3ZZYA 4KRWA 3V5RA 2M4MA 5GADI 4IFVB 1VQ5S 4YN3B 3VAJA 1T11A 3G82A 2LVWA 1K47A 1R6VA 4HDHA 5KG2A 2E5IA 1HBMA 5AT1B 5I3QA 4WFXA 2NXCA 2OPRB 3FRYA 1D9FA 2XS7A 1N0UA 2LU1A 2ZKUA 4EU0A 5T14A 2AJ4A 4L76A 1FERA 1QE1A 1H2TZ 1RA6A 2N4CA 4DR7J 1WG5A 3W66A 3IS9A 3MD3A 4M5NA 3TAPA 4B9TA 1P1TA 2PD1A 4DDFA 4K8RA 1T3NA 1S1XB 2IA6A 5KG5A 1NU4A 1G7CB 1MLAA 2FUG9 3QIPA 2QTWA 5DM6Q 4C0OC 2HBQB 1SJ3P 4NPOA 1RAIB 2IA0A 3K57A 1P8GA 4M95A 4ZVTB 2G4BA 1K44A 1FTRA 2YVSA 1FKAF 1UEKA 5DGBA 1WKKA 5B7WA 2BOPA 3OR2B 4WXWA 1P1LA 4RW6B 4MFBB 1E6VA 2XLKA 2IM1A 2KDOA 1S0MA 3PEJA 1X5PA 1WKJA 4USJC 1NCLA 3H20A 4JI5F 4ZCMA 1G4CA 3NAHA 1J5EJ 2DCLA 4MIAA 4DMZA 3JSMB 4N8NA 4L75A 2CQBA 3R1LA 1EIYB 3HMJG 2EW9A 1LW2B 3G6YA 2VQFF 2H5JB 4GVLA 3W5ZA 4KGMA 2H65B 1T03A 3G2XA 3VQSA 5CYMB 3PX4A 2XMWA 2VZ9A 4UOHA 4PUOB 3G71S 4DQSA 2VFRA 2OEMA 4RW4A 1LWEB 1RT3B 1I5OB 4KGZB 1V3RA 1HLWA 3M2UA 5JVHQ 3RYLA 2MPUA 2E1MC 3R8YA 3AQPA 4GC7A 2CPZA 4USWA 4LF4J 2HNYA 1T3OA 2PA8D 2C2NA 3FJ2A 4TLRA 2R8IA 1UJ5A 3HVWA 3IAS9 4DV7F 2NPIA 1N56A 3O5TB 4B3TF 1RADB 3DLKA 3A3OB 2DH9A 2A0FB 3IC1A 1HQUA 3UN3A 4OX9F 4PR6A 4FN5A 2XWXA 4U9RA 4M1KA 4ECSA 4O44A 4ID5B 2ZM6F 2LEPA 1LV5A 5BR8J 2X1FA 2DGQA 2Q79A 3HT0A 4WP9A 4DUTA 4CH1A 5LJ5Y 4TU7A 2IAJA 2J8AA 3PTWA 2X1AA 3GV5B 3M2VB 1S4EA 1SC3B 2BUNA 1GQEA 3TNVA 5DQIA 1IWAA 2CIMA 2QLXA 2GS8A 5SUHA 3AXMA 5GADU 1FRHA 2H1YA 1LQ9A 3PFOA 4I2PA 3UDEA 2GNKA 1C4AA 3AH6A 4DPXA 3CO9A 1UCNA 1EETA 2YTCA 4QQBA 3K7RA 4X4PA 3EVWA 4KHRA 2Z2YB 1U7LA 4TU8A 3MTJA 2LKZA 2EK1A 3KJNB 2D3UA 3AD9C 1U0SA 4BLGA 3J7A1 2E1AA 3BEGB 1QSSA 4LSNB 3HP6A 3DDIA 2DNNA 2HG4A 3H90A 2MQLA 4F26A 1NUEA 1VQ6S 4LSLA 2GAHC 2WOMB 1RISA 4ILRA 2ALYB 5A8KA 1HWJA 3PVXA 3MM6B 4A8YA 1JLFA 4I7FA 2HVIA 3TJ9A 3MPYA 2N4DA 4PG8A 1WI8A 4CH7A 5KFAA 2R2TA 3LWLA 1LK5A 5DQGA 1WEXA 3TQEA 3T3FA 1S6PA 1VS3A 1S77D 1DHMA 4DI6A 3EUNA 5KFRA 3PM9A 4F7VA 1R0AB 2RUGA 2DIVA 1H7WA 3MM7A 2GQQA 1QUPA 2BW7A 2LEBA 3CXCR 1CJVA 1R8HA 4G65A 4NLWA 3MM8A 4LFCJ 1VQKS 4UOCA 3HF5A 5HK4A 3CJRA 8AT1B 4OYBA 4P6QA 3KK3B 1XMOJ 5KT6A 4F4YA 3BPDA 2DNRA 3H59A 1HKAA 4K0KF 3EDQB 1HNWF 2DXEA 4LF5F 2DKOB 4RR5A 3VAMA 4FF4A 2BKNA 2XS5A 1JIHA 3HT3A 3IRXA 1FNMA 3VV2B 1VYAA 1HNZJ 4CH0S 1FKPA 2BEFA 2ROPA 2A2CA 3GILA 2JX2A 2ZOGA 2UUCF 3BGRB 2F40A 3D67A 3Q22A 2C2ZB 2KT3A 1M1HA 3KLFB 4C8YA 2HS4A 5LSOA 3KHLA 1EQ0A 2V8DA 1D9DA 2AJQA 1YQHA 3CEDA 2ATLA 4ZJLA 1MROB 3MEGA 3NS7B 1VIOA 3OTEA 1U1LA 2ROGA 4PQUB 4K4TA 1ZTTA 5D3GB 3RG6A 3UO0A 1NK4A 5C5JA 5ETTA 3BJYA 2HRYA 3W2WA 4N8OA 4LF8F 3J80Y 1JNZB 1YHQS 3SQGA 1F5BA 2R7SA 4PG7A 3GB0A 1U45A 2MKIA 2ZH6A 3LWMA 2DRBA 2J9DA 2YNIA 4DV3J 3S6EA 1SIZA 2KM8B 2NSCA 4HKQA 4DL0C 4F2RA 3T5HA 2QYGA 1JLEA 4NASA 5CYJA 1RK8A 4ZCLA 4NLGA 3M30A 3RB6A 4EBEA 2VD3A 4RW7A 1H2UX 5KFDA 4DN0A 1YJWS 3EX7B 2VODA 4ED1A 3IA0A 3F41A 4U7UD 1CJKA 1H2VZ 1TL1B 4J91A 2LMIA 1NK6A 1RGVA 3GZ7A 2B9EA 1F60B 4RBVA 4BWMA 1T9YA 5ETQA 2A6MA 2WB1D 4KSEB 2QFIA 1JXVA 1QVFR 3LGHA 2ZDOA 5HMXA 3NKYA 4DU7A 1AXQA 3CD0A 1S79A 5E7OB 2DR6A 2C42A 2ZZMA 4DV6F 3L3CA 4KT0C 3IGVA 3UW1A 2HSEB 2GJ2A 4M5LA 4YP3A 1O51A 3NCPA 2GMHA 4Q45A 1FESA 1C1CA 3KDNA 4X4OA 1WF1A 2VKRA 5K14B 1DTTB 5H9FK 2BXJA 4PCQA 3QAEA 1LNQA 4DR5F 4MT1A 3QNWB 1NJXA 1RTJB 1SXLA 4USHA 1F3FA 3TI0A 2CNKB 4AFFA 4PQAA 2AJFE 5B0GA 4ED0A 1RHRB 3K5NA 2WAQD 1S6QA 3PYFA 2DYAA 3W8PA 3AA9A 1FDDA 4DV5J 2CJ9A 3NG8A 4ZVUB 8RUCA 1RAAB 2R7TA 1KQGB 2WVDA 4X4UA 2R7VA 4IH5A 4K4XA 3BBBA 1EJ7L 4Y6IA 4HH1A 1RT2B 3EICA 3C14B 3OR1A 2RT3A 4KO0B 2MZRA 1H0HB 3QGGA 3KNGA 1BY9A 1R7IA 2KJVA 3TVZA 4JI7J 1VI7A 4YHHJ 1X5SA 2CPJA 4IDKA 1GXTA 1FRLA 5C42A 2FZGB 2KT2A 1H3DA 3KK1B 1RT4A 2BACA 1K9MT 4FXVA 4P72A 4DWIA 1TFYA 5F8IA 2XHWA 1YTYA 4NLQA 1R0CB 4PG5A 5CCLA 1TU0B 1KP6A 3KJFB 3TX0A 4OX8A 2H48B 2Y0SD 2C3MA 3K89A 2WSEC 1U6ZA 2B9YA 1RAFB 1V3SA 3D7SB 3BN7A 5KFGA 1FO1A 3NNCA 3J81j 1QD1A 1IM6A 4XO0A 1TP7A 1DLOA 2MJNA 1U8SA 1F2HA 2N3OA 2MEWA 4OQJA 1UVMA 5KFKA 4LFAF 2J6SA 4DSJA 2B8PA 5D0EA 3VGSA 1YI2S 2E7VA 1U1KA 3KNAA 3D6TB 3N5FA 1HNVB 1X9SA 2FB0A 3QZ8A 4TQSA 4RL1A 4I2QB 4PWWA 3HHLC 4KH0B 4RU2A 1WG4A 1WD6A 3THVA 4MIBA 3VZHA 5T41A 5KFJA 3JSYA 5IT9Y 2V68A 2IBKA 1VQSA 4OHZA 1VHFA 1C1BA 3D68A 3J7YI 1HW9A 1VQ9S 4Q5VA 4KR0B 2DO0A 3CMQA 1LW0A 4C8MA 2D3OR 2OPPB 3MR6A 4EO8A 3IBCB 2R2SA 2CQ2A 2DGUA 2Y0BB 2YWFA 1OY8A 4RO0A 1K1SA 1UVKA 4ENOA 4BHQA 3DRXA 3HLUA 1KLNA 3IAM9 2VG6A 4LUBA 3ZZ0A 3CJ8A 4MKBA 2R8JA 4TLQA 1XQIA 2VF3A 4FNIA 2R8GA 4ICLB 1FJCA 3MFIA 2Y1RI 4F67A 1JLBA 2PMHA 4WK3A 1T95A 4FF3A 2CQ3A 1RLDA 3MM9A 4DSKA 1IR1A 2XG8A 4AXJA 3RTVA 3RAMA 4FKYA 1VBXA 4URQU 2LFVA 4N76A 1SJRA 2JWNA 3M32A 5CD4H 4L6V3 1S0OA 2KXFA 5CYQA 4M94A 2YKMA 3CUNA 4OFZA 1U0HA 2NZ4A 1PJ5A 4ZLNA 3VZIA 3K17A 3KG4A 4XDCA 3EXCX 3KYLA 3K0JA 4C11A 1VRUB 2FC8A 1O0PA 2AX1A 5LM7E 5KTQA 3DM2B 3DRSB 4F0KA 2HVDA 1RSCA 3FEXB 2BYCA 2LA6A 5G0RB 4O0IA 3T9ZA 4RUCA 1X0PA 4DR6F 2LLZA 3P8BB 1I51B 2KHDA 1K0VA 1CULB 2RQKA 5J1EA 1LFPA 4HT5A 1AFIA 1SVDA 1FJGF 1UWBA 3MEDB 1M5SA 1R8AA 4JBCA 1JJHA 3ZFVA 4NE9C 3AHPA 2DJWA 1N5YA 4CNZA 2LU2A 5FLXY 1QAJA 3A12A 1HBOA 3Q24A 3DRPB 3CJ2A 3ISZA 3CDAA 2JHEA 5A8RB 1NPPA 4NXMJ 1N4LA 5JXSA 3M7VA 4MH8A 2MQQA 1H72C 4OYIA 1NBEB 2BMBA 1D0EA 2Z2LA 5LMUJ 1FDAA 4IRDA 1WJ9A 2EFVA 2V0NA 2B3TB 1PKUA 3T9NA 2PFDA 1U4BA 3KK2B 4IG3B 2F8HA 2GMLA 3FKBA 2E1CA 2V8GA 1Z2ZA 3HHLD 3OLBA 2VBXA 1HBNB 4FP9A 4G1QA 4UF4A 5C2GA 2E29A 2HHWA 3OSPA 5HLFA 4KV8A 3I4HX 2B43A 2IJNA 5DG8A 4K5RA 4X64F 3G87A 1YBAA 3GSDA 3QGIA 5E3CA 4OYXA 2QLWA 1RWNB 2HWHA 4LQ3A 2V6AA 1MMNA 4I0WA 2XTJP 2J6UA 1UEUA 4H4MB 2IVYA 1OO0B 1RT6A 1RTHA 3O6QA 3BYPA 2GV1A 2Q1LA 3ETOA 3PYGA 3N79A 3KLVA 4ED3A 3QJLA 2YWEA 3FBEA 4R0EA 3SDEB 4DFPA 1SPBP 3BBFA 5KFCA 2ZWOA 4A46A 4TVAB 3H5XA 2APOA 1JX4A 3V4MA 4F2SA 1HBUB 3A1YG 1D3WA 9RUBA 1SJ1A 2QEXS 1KBRA 3TUPA 1HQ2A 1MN9A 2OSQA 3B8HA 4NLTA 2FJAB 2ZH7A 1BQMB 4QJVA 5EGYA 5JVGQ 4MAKA 1TVRB 3RZAA 2W2QP 4DUYF 1SKUB 2JC0A 4Y0FA 1H98A 3OTOF 2VOOA 4K4SA 1LKZA 4CO2A 3EGWB 1FHTA 5D0RA 1YJ9S 2HQFA 1R0BG 2LQBA 2BDPA 2XC9A 4ETZA 1PBAA 2JEIA 4ZCIA 5LT5A 2MZ1A 4NLYA 5F8HA 3VAHA 3C15A 2IJFA 2FD2A 1S57A 2IHR1 4NZ6A 3RBDA 2V50A 3C16B 1Z1ZA 2XZWA 2CQ0A 1SL1A 1Q8KA 4IQMA 1Q82T 2OTLS 1UFWA 5M2RA 4Q0BA 4M5GA 4YY3F 2DNPA 4M5JA 2VDHA 4RPFA 1T05B 3CF5Q 1XWLA 1IKXA 4WP8A 4GKKJ 4NYPA 1KC8T 4UQTA 4KBIA 2EC2A 3UD5A 5H9EK 1VQOS 4AL5A 4OHWA 3FUYA 5KFWA 5KFFA 1TK5A 3N5BA 2VFSA 2KG0A 1FD8A 1HIYA 3DOMA 3ADAC 3MOZA 4TY9A 2PDAA 3M1VB 1Z2LA 4OZLA 1NK8A 4NYOA 4UZBA 1KFSA 1KSPA 2VPXB 5IT0A 3B4DA 2BANA 2IM3A 4LR7A 4YFUA 1DTQA 2KJWA 1PJ7A 4DPYA 3GFXA 4CLWA 1ZA1B 4NLVA 3WX4A 3I4PA 4NA1A 1SUQA 1B70B 3H4BA 2PA3A 1RAGB 4KPCA 1SB6A 4J9VA 4QIGA 2I1RA 2FJEB 3UVJA 4CIOA 3BO3A 1CJTA 1HMVB 4LT6A 4MKYA 4HR2A 2UXDJ 4YS2A 3GV7B 4BDPA 2ZE2B 4IRCA 3FGVA 1TL3B 2MHNA 3SCIE 3H2LA 2XLJA 4B3SJ 1J5EF 4YB6A 3I5BA 4WZMA 2E44A 2ZEJA 3PRBA 4JI3J 5C7PA 5D0HA 1UVJA 2XY5A 2JLFA 4DQQA 2QG9B 4GO7X 3V2UC 2GFFA 3A4TA 2QL7B 2OGUA 2ZITA 4HVZA 4RWXA 5HMWA 1H6KX 1HARA 4X84A 2YX4A 2V9KA 4JP8A 4J9NA 4FVMA 4B08A 3I0SB 1YJRA 3VHQA 2RVJA 2FLNA 2FHMA 1FFWB 3GTYX 6FD1A 1S1VB 3DFEA 1Q5YA 3AJ1A 2B9WA 4C3KA 1S1TA 4LF4F 3C8YA 4YOEA 1NDKA 5AE3A 5AE1A 3OHAA 2XI2A 3M4XA 2BQRA 2HVEA 5KAKA 4X4RA 3ZTSA 1RTIB 1SQFA 1F9FA 5EWFA 2E1PA 5HVHA 2I5JA 2VASA 5M2PA 4FBTA 1UVNA 2YQ0A 4I69A 1KQFB 1RWMB 1R43A 2R2UA 3R2DJ 3LF0A 2DEIA 3P45B 5A76A 1GXUA 2F63A 1NPRA 3CC4S 2VBWA 5BR8F 5EN1A 3U1NA 3A3PB 2KN4A 2P9EA 1WUUA 4DPTA 3GWCA 2FZCB 2AV5A 2KT5A 2K06A 2AYEA 3MMBA 3VTIA 2BJ3A 3JSRA 3K5OA 1D9AA 1A6LA 5KFTA 3MPWA 4FS1A 3GYXB 4Z7YA 4QPXA 1IKYA 1W2IA 2ZBQA 2M88A 4M5HA 3BS9A 2K1RB 3DOKB 3VGVA 1UTAA 3CJTA 3LANA 5B0CA 2JEJA 3ZZZA 4JI8J 1LWCB 5KG7A 2W4PA 3CCJS 4OZ1A 1S10A 2IDEA 2CNOB 4M63A 4DS5A 1UVLA 4W4MA 2MXYA 4X4TA 1B64A 4KIAA 3M8PB 2MDAA 1ZPWX 2HFOA 2FLPA 2P8IA 2OPQA 1M1GA 3RB3A 4USTA 3W64A 1AW0A 5KFXA 4N47A 3OL8A 3R5DA 6AT1B 2DR7A 2GVDB 3K58A 4F04B 2AEJA 4O4GA 2DHGA 3RR7A 2F9DA 4O0NA 3SXLA 1N34J 2NXEA 2DNYA 1RCXB 3C6TB 7FDRA 2DITA 1CJUB 1I6JA 3AB2B 4ZPWR 3UD4P 1SJQA 3HKWA 3C46A 1L3TA 1T94A 3PEHA 1RABB 4ZHRB 2KG1A 4NLDA 3IR5B 1FKOA 3DGVA 1BWVA 4LFCF 4OHXA 3BSOA 2FJDB 4K2JA 2P9CA 5C25A 1AUSL 1S1UA 3AJ2A 4ZJQA 4NLPA 1VOMA 1MN7A 1XMOF 2WBMA 2GCFA 1MWZA 1IVZA 2RD5C 4RBTA 4ED5A 2EPIA 4A48A 3EE3A 1FDBA 2IC3B 1C4CA 1PCAA 4F3QA 1REGX 2RHQB 1HWIA 1MMDA 2Y8YA 1HNZF 3DLGA 3NGSA 3Q83A 2HHPA 2R3VA 3UCUP 3TRGA 5H9EJ 3TAMB 2CWKA 3PY8A 3ILIA 3IP0A 3K5LA 3I32A 5BYQA 2MTLA 2YKNB 5I3UB 2QLFB 4KAIA 4F02A 1YZ6A 4J7CA 1DY3A 2HK3A 3Q8PB 4MIWA 1X4GA 4RNMA 5KT4A 1N54B 4PWUA 5E5NA 2LXFA 4GVBA 1M5KC 5HP1A 1RHQB 1SV5A 1Q5VA 2ZC4A 4B9LA 2RS8A 1WC6A 1S76D 2P6SA 5C2CA 2RILA 2Q43A 2W8LA 1ZS6A 4MTPA 4DV3F 4CRJA 4R0JA 3RW6A 3MM5B 2IMOA 1U1NA 4OJGA 1QDUB 4R8UB 4ZVEA 2BE2B 2KYZA 3HFVA 4KGKA 4ZN1A 4H4OB 4Q43A 3Q2SC 4MK9A 1QVGR 1I1GA 3G9CA 1RAEB 4PPZA 3BR8A 1B3TA 3ITHA 2AT1B 1AZSB 3DHWC 2UXCJ 1F6TA 3FRZA 1JLAB 2C2OB 4DV0J 1WC4A 2NQPA 1OWXA 3LALA 2M8HA 1IBKJ 2AYMA 2W01A 1JJ2R 3TR5A 1S9EA 4FBUA 3FFIB 3OXLA 5IC6B 1V3ZA 3NS6A 1R89A 1SI9A 1W25A 4DG1A 4F36A 3MD1A 1HFEL 2DXDA 3IM8A 3TAQA 4GC6A 2RU9A 2HQ3A 2LCWA 5IZHA 2N3LA 3J7AN 4ZVFA 3MPVA 2MLXA 2QYCA 1ZM3A 1HYSB 4PZVA 2E5GA 1ITPA 5KFUA 3L7OA 4IUFA 4KFBB 1KVKA 3R27A 1DARA 3QMQA 4DL2A 3HPOA 3PR4A 3ISNC 5F9LA 4ECXA 4USMA 1JLQB 1FRJA 4LBPA 3RJMB 4ZPCA 3WC0A 3RAQA 3GIJA 2ASLA 3VVUA 1GNKA 2ROEA 4OHYA 1V5IB 4B3RJ 2DHSA 2NR0A 1FXRA 4DV5F 4C8ZA 1FK9A 3K59A 2VV5A 3SBMA 4HT7A 2M8DB 4GO5X 3W2VB 5JMNA 1XNQJ 2HWIA 4I68A 3D3CJ 5EWGA 4DL3A 2MQMA 4ELUA 2NCKL 2NXJA 1TL7B 4YHHF 2ZFHA 3JTNA 5A0YB 4IG0B 2X3DA 3H0PA 3J7ZT 1T7PA 1BQXA 3POTB 2HEKA 5HQLA 4LJMA 1Q0NA 5HMYA 3PW5A 4O3QA 2KL8A 2FZKB 2PIIA 3QT6A 4KY3A 1RACB 4B9SA 1VQPS 1NDCA 4ECVA 4C3LA 2LQ8A 4B9VA 3Q8VA 2AX0A 2OHDA 3SSSA 1Y9OA 3PJ9A 2MGZB 3RW7A 1JXLA 4UOGA 3THTA 2LQ9A 3OUYA 1FX4A 2WVBA 3G96A 4ZJOA 2J7UA 4D3HA 1WC0A 1SJFA 4XPCA 2QV6A 2XHCA 3MUMP 4TKTA 4ZPVR 4LF2A 1RT5A 1JJ4A 3K8WA 4DHVA 1LWFB 2CJYB 4WKRA 3BSNA 2LP4A 1RT7B 3KLHB 4UY8T 1XIQA 2CJBA 2BJ9A 1JB0C 5K8OA 3PJWA 1FWLA 1KLMA 2VKZG 3NWGA 3OD2A 2W2MP 5L1IA 5ETMA 3EXYA 1U2CA 2ATCB 1VRTB 5A8WA 1J5OB 1CSJA 3IWLA 2AEFA 3W9HA 1L5UA 5KG0A 2BQ3A 1UW9A 1IR2A 2NUUG 3DLLQ 2R2RA 2AWZA 1T9UA 1RCOB 3TEGA 3T5KA 5D4PA 4AQYJ 3R6GB 4IO9Q 1UW4A 4OYOA 5I42A 4V19X 4J9PA 1CVJA 5AXNA 2H3EB 3CCLS 5DO2A 2HFVA 5CHCB 4WIIA 1S48A 2HBZB 5KFQA 3M8QB 2HHXA 2KH9A 3Q2TC 4PEOA 2DCUB 3LP1A 1QAYA 1Y10A 4YB1P 1RXOB 2GQ2A 1E6YB 1FNXH 2OFGX 4EFAC 4USVA 4WE1A 2KFZA 3DGPA 1CC8A 4USUA 3QLHA 3T1AA 2HGNA 4RNHA 3UCGA 1REVB 5FDLB 3CCUS 4A8XA 2OUGA 4Z2XA 1XERA 3GR0A 4YR0A 2VG7A 1M0SA 1IBLJ 5KT2A 5KOWA 4J9OA 3HHNB 2B4PA 2KXHA 1WHWA 1L3UA 5L1JA 1Y3KA 4LF6J 1RI7A 2XY6A 3NBPB 2HZCA 1JLCB 2ZVSA 3EYZA 3PRVA 2PO4A 1RHJB 1GMUA 4P75A 4DV1J 3FDSA 1G1XA 3E3XA 1LXJA 3I56S 3MEEB 2ZHAA 2HQDA 3IO1A 2CJAA 4C0BA 4F3MA 4DBQA 5GVQA 4O4RA 5C24B 2ZOMA 3MR2A 4M5MA 1U1RA 5K5MA 1C0UA 1X4EA 4EO6A 1BE4A 2HRTA 4E0DA 3W3SA 5DZ6A 3TZYA 2BA9A 1NKCA 3ZZTA 4OYWA 5EX3A 2R7UA 2M52A 3PW7A 4P71A 1TKXA 3JAMU 3I31A 1JJCB 3IRWP 2DEJA 4OYPA 4NXMF 1TK0A 3GPAA 3VAKA 2YKAA 5LMUF 3UCZP 4ELVA 2F5GA 5HN0A 3OVSA 2C2MB 3ZTOA 3CVKA 3VAGA 3EVMA 3OV7A 2EFGA 1KKHA 4NI2A 2AQ4A 3N28A 3TVKA 4KKOA 1FWPA 1IKWB 1S49A 1VIXA 4IFYB 1EP4A 1XTZA 4DS4A 3ULHA 4R5PA 1O6XA 1N6QA 1SJ4P 2B4UA 4DV4J 5J2MB 2E66A 3PKYA 5J1NA 3W63A 4B3OA 3KUHA 1CLFA 1OJ4A 1ZOTA 1YK9A 1VQ8S 2OPSA 3J7Z5 4DX7A 3DI6A 5DQHA 2W9CB 4DQIA 2AP6A 4UTGA 2GGPA 2ZNZA 3WX8A 5HI7A 3A8KA 4J9LA 4FYWB 2HLUA 4JV1A 4RW9A 4DX6A 1S59A 2V4JA 1Q95G 4A8SA 4NZ0A 2V5HG 1RE1B 3EPIA 2XY7A 3RB4A 1QTMA 1U6FA 3WZ0A 3HHLA 1X7VA 1TKTB 2YNGA 4DOZA 3CT9A 5KFOA 4E2FB 2HMIA 3I5CA 4WP3A 3M2RA 2SXLA 2PI5A 3OFGA 2B6AB 3DOLA 2V2VA 1KTVA 2RKIB 3FCHA 1ZAWA 3IWXA 2YPYA 2KVIA 3P49B 2EKYA 3Q23A 4E8UA 4X62J 2R9LA 4NLOA 2IIHA 3W9IA 3HVTB 4DR6J 5D77A 2H4YB 2BJ1A 1KVIA 3BQ1A 2HHTA 2D41A 2KHCA 2UU9J 2MYFA 3Q8YA 2QE5A 3D1OA 4LR8A 3KJVA 2F65A 1XR5A 2AJ1A 5B0DA 1TKZA 2HZVA 4QWCA 4OI3A 2Z8QA 2QA4S 3T1YJ 4OI2A 2CJKA 4YQWA 5AJ3J 1QTNB 1CC7A 2DY9A 4A8OA 2MQ8A 3MECA 3G86A 4U7UK 3HVAA 1UMJA 3A3NB 3LP0A 1FVSA 3AD8C 5A2QU 3C66A 4EI2A 2FY1A 2BX6A 3T6BA 4ZPBA 1MMLA 4FYXB 4PXDA 1YIJS 1YJ7A 4GKKF 4Q2LA 3T41A 1IR0A 2CG4A 2VQEJ 1OQ6A 3V6DB 2ABYA 2N7YA 2DHXA 2GIRA 2VJVA 5KFZA 5HATA 2GW8A 3C2PA 2Y8WA 1NKBA 2DT9A 2X3GA 2XGPA 4OZ0A 3P5BP 1WI6A 1S1WA 3KLIA 4OI4A 1FWKA 3LPYA 5EWEA 3CWJA 4DCJB 3IN5A 3GIIA 4O3PA 5J2NB 1OSCA 5BYSA 3GJRB 3R2CJ 3CDWA 3FZ2A 4ED8A 2CWXA 1RHUB 3BH7B 2ZUGA 4O3NA 4CT8A 2G2YA 1WTBA 2RDJA 3ENAA 3OL6A 3OHBA 5DJBA 1OYDA 5JUMA 2XO7A 2DK2A 1T8EA 2UXDF 1FDNA 1ICEB 2L9DA 3SI8A 5CH7B 2AJ0A 1JLGB 2OMOA 3NGKA 2XMAA 4CO1A 4B3SF 2B7CB 3KLEA 1N32J 3RRGA 2E9TA 4JI3F 2R7XA 2P6TA 2UUTA 4EYHB 2CQHA 5K8PA 3G8SA 1ZH5A 1FRKA 1U47A 4FF1A 5T7LA 5GAGU 2QMUB 4NL5A 4NZ7A 4CQ1A 4FYVB 4AUKA 2XSJA 3QRRA 5HROA 3OTOJ 2EEYA 1K1QA 3W8GA 3T1HJ 3TEHB 2RF2B 3DHXA 1X5OA 3E01A 1VBZA 2VH7A 3MMCA 3PX0A 1SQEA 2HNZB 5BYRA 2HQCA 2M7SA 5MAOA 3MCSA 2KM8C 1RWWB 2Z2ZA 5HBMA 4H4KC 3D6FB 4DPWA 1VQ4S 2BBEA 4AE5A 4CCHA 3ZTRA 3K5PA 3J81U 1URRA 2YNFB 5F0WA 1NJZA 2C2DA 2W9BA 2RRBA 2MQOA 4YY3J 2HK2A 2MKYA 3GIMA 3EM1A 4ZK7M 2E9RX 1VDHA 3KLGB 2DGSA 3KWMA 5D4NA 1UAWA 4PRFA 2D7SA 5ETLA 2XEXA 3DLEA 1IUJA 3FMBA 3H8YA 3JYTA 4LFBJ 5DGAA 2DR5A 1JKHB 3QWUA 4ECWA 1HNIB 1FJ7A 3MFHA 2ACMA 4A8WA 2VDIA 1H74A 4DFKA 3OVAA 5IS2A 4JV0A 4M5DA 1RT1A 4I67A 3F44A 3QPIA 3MCMA 4G1PA 2Q6CA 3RGIA 4C6AA 4BBYA 1RTDB 2ZBIA 1LOUA 3G82B 2DD8S 1VHIA 3H40A 2RMLA 4LRFA 1YJUA 2HS3A 2OD4A 3DKDA 1HBMB 2L9NA 1K8AT 4WYWA 3M6WA 5F41A 1IKVA 1JMTA 2ZHOA 5D4LA 2NPFA 3ENVA 5HL7Q 4JI8F 1QAXA 2RB7A 3DU5A 1D8ZA 2VUGA 1QE1B 3M05A 4USKA 4PKDB 3X3UA 2DPJA 4OZJA 5DRKA 1PJ6A 2IFXA 3IS9B 1U1QA 2KZMA 5F3ZA 4RUBA 1TAUA 1NRKA 1PIEA 4ELTA 4DCOB 1QM9A 3D0IE 1Q8BA 3DU6A 3MEKA 4IR1A 3D1QA 5RUBA 1WG1A 2QSFA 3QIPB 3V6HA 4FYYB 3GG1A 3HXMA 4TY8A 1AROP 4ES2A 4WYLA 3VGUA 5LXRA 5KFPA 3MMAA 1NK5A 4LVNP 5E3AA 1LEOA 3D0HE 1PYTA 4KYZA 2LYVA 2J0WA 2MMYA 5L1KA 2J9EA 3SSRA 1HI0P 2EG2A 4CZCA 1N34F 3WIVA 4KHPJ 2CZ4A 1E6VB 5B0FA 2LECA 4OJ3A 3BDPA 2X1GA 2KXNB 3N9UC 5KFNA 1RKIA 3AOAA 1ZM9A 1SC6A 2L3MA 5DM7Q 1VJWA 1V5VA 3EVOA 3HJFA 4CLLA 5HJYA 2GAGC 3QSIA 4CO0A 1T03B 4FYDA 3E8OA 3IWNC 2ZKTA 4X4SA 3N0VA 4ZITA 5DS7A 2VL1A 4RW4B 3RU0A 1ACMB 4ZN3A 5L1LA 5A6PA 2W8KA 2VC0A 4Z7CA 1WC5A 4K4ZA 3M2UB 1NAQA 4ANDA 2HHUA 1T9XA 1RWVB 3DRRA 3DCAA 3P3DA 2HNYB 4V1Ak 1EKSA 5KG4A 1HHQA 1X60A 2BM1A 4GRSA 2F8EX 3V4IA 4RJVA 3DLKB 3SV3A 3U27A 1HQUB 1GXLA 1F2GA 3RRKA 1RDRA 1EHWA 2KKHA 3EGVA 1O8BA 5GMKa 2V34A 3B6BA 1VGYA 1HNXJ 2N82B 4EK2A 3N6NA 2MKJA 2HPUA 3IBFB 4YUDA 3DYAA 1XEZA 4JV5F 1Q53A 4O44B 1N5SA 2NZCA 1TZ0A 1ULRA 1S0VA 4OYAA 2IAJB 3HO1A 1N36J 2V67A 4WBFA 4DQPA 5KT3A 2O5DA 5DG9A 3CD6S 1HPZA 3R97A 1XMBA 2QRRA 4O3OA 4L3KA 2IJRA 1KR4A 5LSRA 2AGQA 4DU8A 3S1TA 2B8QA 4W90B 3NAIA 4C8LA 4I2PB 3BV8A 2MKKA 1NHVA 4MYUA 4LRAA 4JOUA 5M2UA 2H4WB 2EXUA 3BPSP 2DRAA 1EETB 4ZIVA 2WW8A 1Q8LA 1D8YA 2CRLA 1P9YA 2UXCF 4I6YA 4DV0F 3JQKA 2XSFA 3JTPA 1IBKF 2Q6BA 4FXDA 4Q7AA 2QA2A 2HGMA 2CUYA 5GAEI 3NLCA 2ZH4A 2JLEA 4CLYA 1NB2A 2FPHX 2VOPA 2RU3A 2AZ3A 3O8WA 4TYAA 3UD3P 1WHYA 2O1PA 4LSLB 1Y00A 3HZGA 4DLEA 4J5OA 4N77A 4NRTA 5J2QA 1RTZA 4ZVGA 5A8KB 1OMSA 2ZH8A 4ATNA 1JLFB 2BM0A 4I7FB 2MKSA 3SEOA 1R8CA 4LSZB 4V19J 3O2IA 2MZQA 1A7GE 5J2PA 1UP1A 1S6PB 2DH8A 4ED2A 4X66J 3MTKA 5F8MA 4MYTA 4OL8A 3L4BC 4RW8A 2D9OA 2QMXA 3MHYA 3MM7B 3MGJA 2ZD1A 1NZ8A 2E7WA 2AJ2A 1CJVB 2M3DA 4OZ5A 4B3RF 5KFYA 3AOBA 3LPEA 1K73T 3MM8B
chains in the Genus database with same CATH topology
2G0IA 4PEOA 2IDLA 2G0JA 1S12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0I A;  4PEO A;  2IDL A;  2G0J A;  1S12 A; 
#chains in the Genus database with same CATH topology
 2MJU A;  2CPH A;  4BC7 A;  4HH0 A;  5MLC V;  1NPK A;  3CD7 A;  2HFU A;  3US5 A;  4X4Q A;  1G3O A;  4BWJ A;  1XNQ F;  2C2K B;  4HI1 A;  5FD1 A;  2YWG A;  3MAA A;  3CW2 C;  4CM2 A;  2M70 A;  4QIE A;  1YVF A;  3GP9 A;  1BWE A;  3IRX B;  3VQT A;  4F4Z A;  2ERR A;  1BQN A;  4LVO P;  1FKP B;  3LAK A;  2W7A A;  4F0H A;  1H73 A;  5LMN J;  3S7R A;  3AJD A;  1F9E B;  4QU6 A;  1HHS A;  2MHE A;  2UZA A;  4ANE A;  1FE0 A;  3MEG B;  1WSR A;  3CC7 S;  3WBZ A;  1FVQ A;  3MOJ B;  3GU0 A;  2PE8 A;  2C2R A;  4FF2 A;  3JB9 k;  2YX7 A;  2CYY A;  4U8V A;  3HX9 A;  4ALZ A;  1QJH A;  1ZTW A;  2C2E A;  1OY6 A;  2K8G A;  2HND A;  3W2W B;  3I87 A;  1ZYQ A;  1U8W A;  2CQG A;  3SQG B;  3OTD A;  6FDR A;  4X65 F;  1TTH B;  4ZVH A;  3FQL A;  3EWG A;  2YNI B;  3CSK A;  1GMV A;  2DH7 A;  3H7H B;  3JQJ A;  1EZZ B;  3CCQ S;  2PN6 A;  1JLE B;  3TJA A;  5IM0 A;  2E7X A;  2VHG A;  2HIQ A;  1UPP A;  4BS2 A;  3M30 B;  4JI4 F;  4RW7 B;  3OPK A;  1U26 A;  4RNN A;  4QU7 A;  4ITS A;  2MZJ A;  4WKY A;  3KHR A;  1TUW A;  2H9Z A;  1U48 A;  4JI2 J;  2WCX A;  1YWX A;  1SIW B;  1CJK B;  5DDO C;  3D3B J;  1URN A;  4NCG A;  3BN4 A;  5I4M A;  5GAE U;  4AQY F;  3I5A A;  2CAD A;  2H54 B;  2WON A;  3P4U B;  3BGO P;  2GHP A;  2ZWP A;  1HQE A;  3GR1 A;  3VAI A;  3RBE A;  1GX6 A;  1VQM S;  4UT4 A;  4KHM A;  2I0X A;  4LF1 A;  2V9W A;  2MKH A;  2VPY B;  1NSP A;  2XGQ A;  1ROF A;  2JL9 A;  3KUE A;  3BH6 B;  1KRP A;  2FGO A;  2CPI A;  1G6B A;  3QYY A;  3ICL A;  1C1C B;  2IM0 A;  4ED7 A;  3TZX A;  3ILO A;  1CS4 A;  2ASJ A;  4C97 A;  4S0M A;  1IBL F;  4HAC A;  2Q66 A;  3MZI A;  3D5M A;  2NLW A;  3BF4 A;  4DPO A;  2YH0 A;  3IG1 A;  3I0R A;  4CLP A;  1AYE A;  1QAI A;  3I6P A;  2JRS A;  2B9X A;  5IV4 A;  1C0T A;  3UR0 A;  5K8N A;  4LF6 F;  1NLK L;  4IH6 A;  4DR4 J;  3JSB A;  1TL5 A;  1YJT A;  2RQC A;  2AGP A;  5ETS A;  1B0P A;  4ILM A;  4DV1 F;  1S6Q B;  4CLZ A;  1FFG B;  3AOD A;  1PC5 A;  1TV6 A;  2ILZ A;  4QWD A;  3CJ5 A;  2VIC A;  2VG5 A;  2J7W A;  3ZNU A;  2ZVI A;  4ECU A;  4NXN J;  3P96 A;  1ZET A;  1SL2 A;  4QWB A;  1Q81 T;  1YX2 A;  1U6B A;  4EZ6 A;  3CO0 P;  3OR1 B;  3PKM A;  2HAI A;  1X4B A;  1IM4 A;  3RBZ A;  1R6Y A;  1N5T A;  4KE5 A;  2I2Y A;  3MUR P;  3F0N A;  5CQG A;  2J0Q D;  4IDK B;  3H42 A;  5A6W A;  5DZ7 A;  3DMJ A;  5C42 B;  2VPW B;  3KHG A;  4NOH A;  3C6U A;  5L38 A;  1RT4 B;  4QIF A;  3PR5 B;  3TZZ A;  3ET6 A;  2JFD A;  2YNH A;  2U2F A;  1RHM B;  3QGH A;  3G4S S;  3BBC A;  5IT4 A;  1GMW A;  4LIR A;  4LF7 J;  2CZ9 A;  3QID A;  4NMX A;  4NRU A;  2EVZ A;  1ELO A;  1D09 B;  3GMG A;  3LP2 A;  1DLO B;  4CYU A;  1IXK A;  4OI6 A;  3ILJ A;  2GVZ A;  4CTA A;  3QAU A;  4DV4 F;  1TK8 A;  3PO4 A;  2OI2 A;  1JXE A;  3NCR A;  1YBU A;  1MWQ A;  2DGW A;  3R5J B;  3H5Y A;  4WFB Q;  3PDN A;  3LO3 A;  1Y0H A;  2RNE A;  4PWD A;  1WKL A;  2N7C A;  5D0G A;  2IYG A;  2AHO B;  5LSL A;  3ZTP A;  4LMZ A;  3W60 A;  2C3Y A;  2IY5 B;  4JYA F;  2V8H A;  3LUY A;  2W4D A;  4CT9 A;  4PAB A;  2CKW A;  3BDE A;  3SCK E;  1MU2 A;  2V2Z A;  1RAO A;  2B5J A;  1C1B B;  4K7Q A;  1S9G A;  3Q8S B;  3UN5 A;  1HWL A;  4DLG A;  2Z30 B;  3M8R A;  1LW0 B;  1BHN A;  4IQX A;  2M0G B;  5D78 A;  2CA9 A;  1U1O A;  1NB7 A;  2J7K A;  3CC2 S;  2HLT A;  4IOB A;  2ZUA A;  3V81 A;  4FPR A;  3HVR A;  3QO9 A;  2VG6 B;  4ZDN A;  2MLZ A;  3P5T L;  1YBT A;  4OLP A;  2HFZ A;  1RWU A;  1JLB B;  1RB0 A;  2XNR A;  4X62 F;  2G1H A;  4DUZ F;  1SKW A;  1X4H A;  1WEZ A;  3MM9 B;  2CQC A;  3TOQ A;  3G6X A;  5HQ8 A;  2DNZ A;  1IBM J;  1VC6 A;  1KON A;  3ONQ A;  2KFN A;  1IQT A;  3PO5 A;  3UDV A;  1VK8 A;  3CJK A;  2RRN A;  3QZ7 A;  2GHV C;  2RQ4 A;  2UU9 F;  4TXS A;  1PYO B;  2MZS A;  2K3K A;  3M32 B;  1VLO A;  4NLU A;  5CYQ B;  2YKM B;  4IFV A;  2V8P A;  3H98 A;  1U0H B;  3U02 A;  2JJ4 D;  4C2M A;  5DDR C;  3T1Y F;  5AJ3 F;  1FA0 A;  2QGF B;  1WHX A;  2ZJP Q;  1B0V A;  3PYE A;  2OPR A;  2BAB A;  3Q8R B;  3ENQ A;  4C11 B;  4Q2M A;  2GHW A;  2GA7 A;  3KG0 A;  4HEA 9;  5HMZ A;  2BR0 A;  2ZZT A;  3CIM A;  1NZA A;  2R8H A;  2OML A;  5EX0 A;  3GFH A;  2RQM A;  2ADC A;  1SH2 A;  3HZE A;  3G8Q A;  3H2U B;  1N8R T;  2VQE F;  3B54 A;  5J1E B;  1F9H A;  5HSP A;  4ECT A;  2JDJ A;  3FSX A;  4DFM A;  4MK7 A;  4ZS6 A;  1UWB B;  1S1X A;  4DR1 J;  4ZPT R;  4O3R A;  2RDD A;  2KU7 A;  5KFS A;  4F4K A;  4X4V A;  3BKT A;  3IR7 B;  3O3L A;  1N5Y B;  4ES1 A;  1BXN A;  3DDN A;  4ZA1 A;  1ZAV A;  4F50 A;  2D3O 1;  1HBO B;  3EZO A;  2ZH5 A;  1PO6 A;  1WNE A;  3CGI A;  3TA1 A;  4ECR A;  5H9F J;  3OR2 A;  4NCA A;  3LGM A;  4RW6 A;  4MFB A;  4HDG A;  1PGZ A;  4KTQ A;  4JUZ A;  3OXG A;  1ZA2 B;  3HJV A;  2DNQ A;  4QR0 A;  3JSM A;  3PX6 A;  1B0T A;  3RR8 A;  4F4X A;  2UXB J;  1LW2 A;  3W61 A;  1D1U A;  1VLY A;  1KQS R;  5CYM A;  4G1Q B;  1GEH A;  2PC6 A;  4PUO A;  2CAJ A;  5HLF B;  5KFE A;  4KV8 B;  2ZBC A;  4UUW A;  4ZP8 A;  2ACY A;  1N32 F;  2YKP A;  4ZIW A;  1R8P A;  4IRK A;  1LWE A;  1RT3 A;  3V6K A;  2G0J A;  3GFZ A;  5HO4 A;  1RU2 A;  2PT0 A;  2DNO A;  1OQ3 A;  3MWB A;  4Y28 C;  4W98 A;  5K20 B;  3I9Z A;  4B9U A;  4ES3 A;  4FS2 A;  2FTR A;  4L73 A;  1RT6 B;  3PNI A;  1RTH B;  3NEK A;  5D6G A;  2MQP A;  2QN6 B;  3I9V 9;  1KNZ A;  3F73 A;  1U1P A;  2KRR A;  1CBK A;  5KG1 A;  3B78 A;  3D28 A;  3T1H F;  1WTF A;  3GON A;  4CM0 A;  2W4C A;  2CVE A;  4OX6 A;  1TKD A;  5I3P A;  3PXG a;  2KZZ A;  1QSL A;  2KRB A;  4DJB A;  1CQN A;  2XCP A;  3DN9 A;  2FVS A;  2CNN B;  2W2N P;  3BO4 A;  4KQZ A;  2DRD A;  2FJB B;  1WOP A;  2R8K A;  2GO8 A;  4ID5 A;  4MKV A;  2Y1J A;  3G6V A;  7AT1 B;  4F3O A;  2QA1 A;  5AXK A;  3ZNJ 1;  3HCX A;  1IBC B;  2HFS A;  1RAJ A;  3M2V A;  1DZ5 A;  4NX9 A;  4ZP6 A;  1NK7 A;  2FJX A;  2XMT A;  2HHV A;  1RP5 A;  2DGO A;  2YWW A;  1YRT A;  1NM2 A;  4ETX A;  4P7V A;  4LFB F;  3HHK A;  3BGF A;  4DSI A;  2QLJ B;  4DX8 H;  4CLT A;  4A47 A;  3JXO A;  4A8Q A;  3GYN A;  4YME A;  2FLL A;  3KKF A;  2PMZ D;  4ZLJ A;  3C15 B;  3VCD A;  2EI5 A;  3B4M A;  1VCT A;  3ENW A;  3BGL A;  4QIV A;  4K4Y A;  2Y9H A;  1TAQ A;  3R5A A;  2JC1 A;  4CLS A;  2VFT A;  3D2W A;  2HVZ A;  2GMJ A;  1VQN S;  4Q0B B;  4YDD B;  1NK9 A;  1X4C A;  4FXW A;  3CMA S;  3TWZ A;  4QR2 A;  1WDD A;  2A3J A;  4LSN A;  2CPD A;  5CZV A;  1I94 J;  3PHE A;  3MUT P;  4EEY A;  1IKX B;  2IPO B;  3BGU A;  4B9N A;  4XIU A;  1ZPV A;  1KEK A;  5K9F A;  3T19 A;  3BKU A;  1LK7 A;  2VIH A;  4CO4 A;  4DF4 A;  3PG9 A;  1CPZ A;  3CJQ A;  3KMS A;  2WOM A;  4FNH A;  2DHA A;  3DOM B;  2G2O A;  1DQ9 A;  4K4W A;  1FD2 A;  3U1M A;  2VON A;  1TR0 A;  3MM6 A;  1RAH B;  2QO3 A;  2XMM A;  1YLX A;  2HHH F;  4LF9 J;  2XYG B;  2BAN B;  1RKJ A;  1DTQ B;  2MZT A;  4G6V B;  4HTI A;  1KD1 T;  2WVC A;  2H5E A;  4NA2 A;  1R0A A;  3OL9 A;  1SUQ B;  1U49 A;  3UE2 A;  3NP5 A;  3UVJ B;  1KOH A;  1HW8 A;  1CJT B;  2L41 A;  4G1I A;  1VR6 A;  1N52 B;  1WOO A;  3K5M A;  2F4V J;  4AYB D;  5KOX A;  2IVM A;  4KHP F;  1KN6 A;  1IN0 A;  1KWM A;  1S12 A;  2XYP B;  4AD6 A;  1Q79 A;  2AMC B;  3KK3 A;  2ZC3 A;  5IFM A;  3U1L A;  2NS1 B;  1OPZ A;  1DBD A;  4ZP7 A;  2HW3 A;  2F9J A;  1S72 S;  1YSJ A;  5CAA A;  3R7N B;  3H5S A;  4WPA A;  2G1D A;  5KG6 A;  4DZD A;  1U02 A;  2WK4 A;  4WFN Q;  3BGR A;  2D69 A;  1V9O A;  3KLF A;  2HQG A;  1CQM A;  2DHH A;  1Y7P A;  4O23 A;  2HAF A;  2CNL B;  1Y5L B;  4OV1 A;  1MRO A;  4DCP B;  1S1T B;  4K2X A;  5HVG A;  1F0X A;  3M8Z A;  4PQU A;  4R25 A;  1WF2 A;  5D3G A;  4MJK A;  2OH2 A;  3UPF A;  2R7O A;  4Y2M A;  4Y65 A;  3WQP A;  2A2D A;  5AXM A;  1LFW A;  4XTT A;  3FCW A;  2DIU A;  1X4D A;  3IMQ J;  2I5J B;  1RHK B;  2FVQ A;  1Q86 T;  1HNX F;  5B0B A;  5K8M A;  4U95 A;  5GAH I;  2MSS A;  4I6W A;  4NLR A;  4H4K A;  5E2Q A;  1HL6 A;  3U7J A;  1T0T V;  5CD4 A;  2PFF B;  3KTQ A;  1RUS A;  5HAN A;  1NO8 A;  2HIY A;  1N36 F;  2UVR A;  4WFY A;  3QT7 A;  1N33 J;  1YRU A;  2HVH A;  1UPM B;  3CIZ A;  1CEZ A;  3MMB B;  3UDC A;  4QW8 A;  4MKA A;  4IH7 A;  3VWS A;  1TL1 A;  2R7W A;  1DQ8 A;  4C9D A;  2W9A A;  2OSR A;  1AA1 B;  4ECQ A;  4ZLP A;  1FFS B;  1VBK A;  2ASY A;  2XS2 A;  2V2K A;  3J80 U;  1RWX B;  3KDO A;  2X7I A;  1IKY B;  4OZ3 A;  1M5V C;  2XI3 A;  3L7U A;  1UKU A;  4OIX A;  1RBO B;  3MPD A;  3CCV S;  2WW4 A;  1XNR J;  2QIF A;  2KVQ E;  5KFI A;  1R8B A;  2CG8 A;  2Y1L B;  3GCW P;  2MY8 A;  2DNG A;  4NLS A;  4P2M A;  1SCJ B;  2FIU A;  1FRX A;  3GG0 A;  5IOL A;  5K14 A;  5E33 A;  1DTT A;  2BJ7 A;  1L3K A;  1U25 A;  4B3M J;  1XJW B;  2OPQ B;  2DGX A;  2GJI A;  1Q4R A;  4DR2 J;  2RSQ A;  1RTJ A;  4EMD A;  1IWG A;  1NHU A;  4L72 B;  1VRQ C;  4KPY A;  2QSW A;  3A8E A;  4Q8E A;  3SQO P;  2PSZ A;  3H5U A;  4O4G B;  4YEA A;  4DPU A;  2DB1 A;  3QSY B;  3HHE A;  3FC9 A;  1YZ7 A;  1OS5 A;  4FKX A;  4KH1 B;  3WC2 A;  3E2E A;  2J8S A;  4X66 F;  2W7O A;  2VA3 A;  3A13 A;  5LXY A;  4RLE A;  5HAO A;  4J9M A;  3HKZ D;  4FVC A;  3PV8 A;  1RT2 A;  3C14 A;  2IBO A;  4KO0 A;  2G9O A;  2QFJ A;  3R7B B;  4ZP9 A;  2GQC A;  3NOG A;  1FKO B;  2OIH A;  2YQ3 A;  2V2Q A;  5G4D A;  5KT7 A;  2YQ1 A;  4EBC A;  3KK1 A;  1R3N A;  3FCV A;  5C25 B;  5KFM A;  1S1U B;  2VBZ A;  4K59 A;  4EUV A;  4Y2K A;  3B82 A;  3PHT A;  3QWP A;  2F1F A;  4QZV B;  3OT9 A;  4PYA A;  4U6P A;  4P73 A;  1H38 A;  4JV5 J;  2X1B A;  3R3T A;  3R5C A;  3AOC A;  1UA1 A;  4OJ1 A;  2BJE A;  4Y2A A;  2KFY A;  2FHK A;  5F3T A;  3TA0 A;  3DLG B;  2DTJ A;  2VPZ B;  2O3D A;  2WRM A;  2BOA A;  1VFJ A;  4QYR A;  2L9W A;  4ID8 A;  3MDF A;  4DX5 A;  5LMN F;  2GIQ A;  3UN2 A;  5GAH U;  3D54 A;  1DFD A;  4WF9 Q;  3IGN A;  3OFH A;  1JQG A;  3UDL A;  3SV4 A;  4CWB A;  4BCA A;  1HNV A;  3FVY A;  2HWT A;  1UJ4 A;  4C48 A;  4NLX A;  4I2Q A;  5ADZ A;  4DN9 A;  4GVB B;  1X5T A;  3WDO A;  5IWA J;  5HP1 B;  4Q8F A;  3AQO A;  3VF0 B;  1SV5 B;  2ZH3 A;  3BZQ A;  3MXH P;  3VAF A;  1S4F A;  2MKC A;  3SFU A;  2DPI A;  2J9C A;  3HSZ A;  5E3R A;  3SFG A;  1KTQ A;  2B56 A;  4CLU A;  2EKN A;  2X51 A;  2OPP A;  4A8F A;  3H25 A;  4QYZ K;  3CDB A;  4O3S A;  3AFG A;  3NOC A;  4OX7 A;  4MMO A;  3LH2 S;  4Y3C A;  1Y11 A;  4JI2 F;  4AT1 B;  3FBC A;  3ITH B;  4Z37 A;  1Q1K A;  1U24 A;  1PYS B;  2FLO A;  4WIQ A;  4ICL A;  1GFW B;  4CDI A;  3D0G E;  1SKS A;  3QJJ A;  2OTJ S;  2FDN A;  5KFB A;  4NYZ A;  1TMM A;  1S9E B;  4JI0 J;  2W25 A;  5KFH A;  4XK8 C;  4RNO A;  5U47 A;  4DG1 B;  3CJS A;  1SC1 B;  2GX8 A;  1NXI A;  3Q8U A;  3TUI C;  5IT9 U;  4A8K A;  4Y2C A;  4WFZ A;  3NS5 A;  2LDI A;  2AKW B;  4GMK A;  3HHD A;  4UQG A;  3R1H A;  3FK4 A;  1FI4 A;  2V8V A;  2F8M A;  1M5O C;  1VRU A;  3NGD A;  3OW2 R;  3TYT A;  3HD1 A;  3QQC D;  1RYS A;  2DNH A;  1PAE X;  3DM2 A;  1SH3 A;  3DRS A;  1TFW A;  1HHT P;  4L74 A;  2XZT B;  2XQC A;  2WVF A;  3AT1 B;  4I4B A;  1J2V A;  1TMJ A;  4DF8 A;  2QA4 G;  5G0R A;  2XNQ A;  2UVW A;  1X9W A;  2EFO A;  1CUL A;  4QW9 A;  3TJ8 A;  4KC5 A;  2K7J A;  4DR4 F;  4F25 A;  2LDY A;  1HA1 A;  5FJ4 A;  4F4A A;  3MED A;  2JSX A;  1KS2 A;  2RH3 A;  4QWA A;  3HFK A;  4FDF A;  1MWY A;  2BVZ A;  2VFV A;  3EDR B;  1FK9 B;  3EGN A;  3CUL A;  4NXN F;  3CJ4 A;  2CJQ A;  4DQR A;  3EZU A;  2JEF A;  2UUW A;  1VBY A;  5F0U A;  3DRP A;  1JNR B;  1FT8 A;  3DNC A;  3CME S;  5A8R A;  1VQL S;  3OVB A;  3M6U A;  1S7H A;  4J37 A;  2AW0 A;  5DG7 A;  2FJV A;  1AFJ A;  4X65 J;  3KK2 A;  4IG3 A;  1SKR A;  3R7S B;  5DDP C;  3LOU A;  1HBN A;  3GE9 A;  5L39 A;  2VJU A;  3NGU A;  5D15 A;  5IQ6 A;  2CDQ A;  3M8Y A;  3L95 X;  4LBH A;  4J9K A;  3BM7 A;  2NXN A;  4LF7 F;  4RX6 A;  3FQK A;  1RYR A;  3CPW R;  4JI4 J;  3NL0 A;  1X8D A;  3IFE A;  2E1R A;  4TU9 A;  4DSL A;  3ZZP A;  1YJN S;  2D9P A;  1KVJ A;  5L9N A;  1O5J A;  3OUY B;  4DV2 J;  3JQM A;  2FVP A;  5D8H B;  3I82 A;  3EPG A;  2IYI A;  2QX0 A;  4EBD A;  4H4M A;  5FLX U;  2ZBR A;  2C3O A;  1RT5 B;  2JH3 A;  4OMF G;  3Q0A A;  2ZHB A;  4CP5 A;  3OJU A;  1TQL A;  1UZD A;  3IXQ A;  4QR1 A;  3SDE A;  5E0O A;  5B09 A;  1KLM B;  1ZM4 A;  3QJP A;  3ISN D;  2J0S D;  4JI6 J;  2Z2M A;  2JEG A;  5L8R C;  1HBU A;  1KHV A;  3FZB A;  3HK2 A;  2EG1 A;  2DR9 A;  3F56 A;  5A8W B;  4U96 A;  5LJ3 Y;  5B08 A;  5ETN A;  1BQM A;  4YR2 A;  3RRH A;  4ZPA A;  2VA2 A;  2FHJ D;  4USI A;  2B4O A;  1U2R A;  2AGO A;  4C0H A;  2YWK A;  1TVR A;  2K7K A;  3TAN A;  1KHW A;  3OLA A;  2CQP A;  1UL3 A;  5I42 B;  2UP1 A;  3R6L B;  3J7Y U;  1VMB A;  3H2V E;  1T02 A;  2BQU A;  3NMA A;  4JI1 J;  2I8E A;  3ELH A;  4GKJ J;  4ZKA A;  3EJM A;  2KO1 A;  1YIT S;  2GJF A;  3L9Z A;  3LP1 B;  4AL7 A;  1NSK L;  1NJY A;  4TNO A;  4CLK A;  2KTQ A;  4UOF A;  4WE1 B;  1N5Q A;  2Z58 B;  1IBM F;  5IQQ A;  2XYH B;  3C16 A;  2V69 A;  2GZO A;  2W24 A;  3DGP B;  3OJS A;  3QLH B;  2RDI A;  2ZBP A;  2HS0 A;  2QMW A;  3BKF A;  3MF5 A;  1EB0 A;  2W7P A;  3SZ2 A;  3JAM Y;  2VG7 B;  1R31 A;  3BB5 A;  1T05 A;  2JOQ A;  1M5H A;  3T5J A;  2ASD A;  2YPZ A;  3FSY A;  2VBY A;  1HR0 J;  4MK8 A;  3LAM A;  1XC9 A;  1WF0 A;  3KUG A;  4LRD A;  3VAL A;  7FD1 A;  1FXD A;  1RWP B;  1X4F A;  3M1V A;  2WBR A;  1JK9 B;  3PCO B;  1XMQ J;  1R27 B;  2P2C B;  2LXU A;  1WEY A;  4JB8 B;  4TQR A;  3PIP Q;  1C0U B;  5E41 A;  1EKR A;  2E5L J;  1GTE A;  4DR1 F;  2RS2 A;  2MST A;  2G0I A;  3TVY A;  2XMJ A;  4IO1 A;  3UI3 A;  1EAY C;  3RB0 A;  1P6T A;  4QYZ J;  3V6J A;  2QZ8 A;  3CCT A;  1RWK B;  1NSQ A;  3P6Y C;  2WTF A;  1TKX B;  4ECZ A;  1WC3 A;  2XWY A;  3TA2 A;  1HMV A;  2UUA J;  2I6W A;  3OTC A;  4PAA A;  4ZCK A;  2XMK A;  2JZ5 A;  2UUB J;  3ZZU A;  2IVF B;  2ZE2 A;  1VC5 A;  1TL3 A;  4AXI A;  4DR7 F;  2C28 A;  4JYA J;  4NI2 B;  3FNN A;  2DR8 A;  5GAG I;  2Y1I A;  4DXL A;  5SZT A;  4KKO B;  4B17 A;  2UXB F;  4ILL A;  4YB7 A;  3TUZ C;  5DLF A;  4WWS A;  3FBB A;  4IKA A;  1EP4 B;  2DNM A;  1Y5N B;  5HQM A;  4EZ9 A;  1NND A;  4WXO A;  1S5Z A;  4R5P B;  2U1A A;  1N6Q B;  4P2F A;  2CQ1 A;  3GYG A;  2NYH A;  2OKQ A;  4B3O B;  2V63 A;  3I0S A;  3DRY A;  1EAR A;  3GJQ B;  1DQA A;  3LA0 A;  2OPS B;  2EFQ A;  2F4F A;  2YH1 A;  4NCB A;  2J0X A;  4LBI A;  1S1V A;  5CA5 A;  3DI6 B;  3D1H A;  3K2Y A;  3MAQ A;  3MCN A;  3CNQ P;  3PYD A;  3EZ5 A;  5ETO A;  2GGP B;  3PFE A;  4UY8 5;  4RU9 A;  2DNK A;  3ZTQ A;  1UJ6 A;  4OI0 A;  3TW0 A;  4DUZ J;  4RW9 B;  4RUH A;  1XBW A;  3FSI A;  2V4J B;  1RTI A;  2WHO A;  2FC9 A;  2BV3 A;  1BUX A;  2AD9 A;  2IDL A;  1ZBT A;  2RE1 A;  2Y3Y A;  4PXB A;  4DR3 J;  3E51 A;  3GLJ A;  4HTJ A;  3GQC A;  3EGZ A;  4FPI A;  1A9N B;  3HHL B;  2A10 A;  3OSN A;  3I55 S;  3GFY A;  1XR7 A;  3D66 A;  2YNG B;  4N41 A;  2BZ2 A;  3GJT B;  2YKQ A;  5F8J A;  2HMI B;  2PI4 A;  3QAT A;  2OEK A;  3M2R B;  4C7Q A;  5A2Q Y;  2J5A A;  2DO4 A;  3D6H B;  1YJV A;  2G2Z A;  1I3O B;  4L3N A;  3QGP A;  3HD2 A;  3W1Y C;  2BRK A;  3DOL B;  2XMU A;  2J76 E;  3D6M B;  1UFK A;  4OLO A;  4ZLL A;  2DXF A;  4F4W A;  4ZOS A;  2DVI A;  3THP A;  3FEZ A;  4NEY A;  3KJV B;  3SCL E;  5LOQ A;  2E5H A;  3DXS X;  5KG3 A;  1H7X A;  1BMQ B;  1TKZ B;  3OL7 A;  3Q86 A;  2HZA A;  1VIS A;  4M5K A;  2K1R A;  4PG4 A;  3DOK A;  4JV2 A;  5ITH A;  3MEC B;  1PIL A;  2LQ5 A;  3AA8 A;  2CDR B;  3MR5 A;  1LWC A;  4WZQ A;  2AF6 A;  2O66 A;  3LP0 B;  5EDW A;  2LQJ A;  4QIW D;  1VQ7 S;  1HWK A;  3M9O B;  1W26 A;  1PG5 B;  3SYZ A;  1I94 F;  2WB4 A;  3L7P A;  1SL0 A;  2C3U A;  3M8P A;  4ERD A;  4UZC A;  5F8N A;  3S8S A;  2K3I A;  4OHV A;  2CQI A;  2CPF A;  2CPY A;  4RBU A;  3TUJ C;  1AB8 A;  2DGT A;  5ETV A;  5BXI A;  4U7C A;  1B7Y B;  4WTY A;  1NME B;  4QWE A;  1Z4U A;  2GVD A;  3HDS A;  4URS A;  4LF9 F;  2EBE A;  1B99 A;  1S1W B;  3KLI B;  3CDE A;  4DL7 A;  2L08 A;  4N56 A;  2OJ3 A;  3UR3 C;  3SSQ A;  2LXI A;  3VR1 A;  3D4J A;  1FCA A;  2VC1 A;  3C6T A;  4H54 A;  2RRA A;  1KFD A;  1FTC A;  1PAU B;  4U67 Q;  4E98 A;  4QCL A;  5ETR A;  3S01 A;  3KHH A;  1CJU A;  2AU0 A;  4JI5 J;  4C4W A;  3KJQ B;  2R42 A;  4OV6 A;  4ZHR A;  3NY0 A;  3TZW A;  1TEL A;  2A1B A;  2VQF J;  2ILY A;  2B4V A;  2F4V F;  2UV8 A;  2I38 A;  1L3S A;  3KXD A;  3HFZ B;  2YWH A;  1WHV A;  1T9T A;  4ZVS B;  1KOO A;  5GMD A;  2H5I B;  3IBW A;  1NH7 A;  3QRP A;  4X2B A;  3KLE B;  3J81 Y;  1U1M A;  2PGC A;  2DBB A;  5FII A;  3G6E S;  3CDU A;  1GH8 A;  2QT7 A;  1M5P C;  4I64 A;  4I6A A;  2AZ1 A;  1T9V A;  2L48 A;  2IC3 A;  3PAC A;  5D4O A;  1UVI A;  5T7L B;  2JVR A;  4LIW A;  3PIO Q;  2UV8 G;  3LQV A;  2NUH A;  2DIS A;  4X4N A;  2XSJ B;  1NHK L;  2D1C A;  5HRO B;  4DV7 J;  3PW0 A;  3RAX A;  4B3T J;  4CO5 A;  3TAM A;  1HI8 A;  2AYB A;  4OX9 J;  2EBG A;  3HSD A;  3E01 B;  2YKN A;  4WU3 A;  5I3U A;  4P74 A;  3CJ3 A;  1ZM2 A;  3MMC B;  4F0M A;  2OFH X;  4FZV A;  2BKO A;  1L3V A;  3N01 A;  2DY1 A;  3CD5 A;  4N7T A;  5HBM B;  4DSF A;  3W5Y A;  1S99 A;  5DET A;  4P2S A;  2ZM6 J;  3X1L B;  1SQG A;  2BW2 A;  3M9M B;  1U09 A;  1DJ0 A;  2HRU A;  1F1B B;  3R5G A;  3MMJ A;  3MI7 X;  1XN9 A;  1YKW A;  2W9B B;  1Q7L B;  3M6X A;  3MM5 A;  3DC2 A;  4WTO B;  4ZVP B;  1FE4 A;  4R8U A;  2EFN A;  2ZNY A;  2BE2 A;  4RUA A;  4C8K A;  3DLE B;  5L46 A;  4ER8 A;  1FRI A;  4H4O A;  1QUV A;  2DGV A;  3JYT B;  4EWT A;  1IQZ A;  4ZVR B;  2K2P A;  1PC4 A;  4D3G A;  1N33 F;  2OEJ A;  2KI2 A;  3HM9 A;  1OYE A;  2KB2 A;  1WSV A;  4TYB A;  4M5D B;  1RT1 B;  1AZS A;  1JLA A;  5ETK A;  3KFW X;  4DL4 A;  2HHH J;  3TP2 A;  1OSD A;  2FQQ B;  2FVR A;  4DZ6 A;  2WSF C;  1UA0 A;  1NSA A;  5JJB A;  2BKP A;  5CXT A;  2O67 A;  4WCE Q;  4I1T A;  3NRB A;  1GTH A;  3FFI A;  2D3Z A;  3NGT A;  2HHS A;  1UWA A;  3Q89 A;  2GC8 A;  4NEZ A;  4KB7 A;  2M9K A;  2Z57 B;  2HBR B;  3ZO7 A;  3CCM S;  2V94 A;  4ZMM A;  2CPE A;  1IKV B;  2YKO A;  3UWT A;  4PYD A;  5AE2 A;  1XNR F;  2POK A;  4PPD A;  1FJE B;  1BC6 A;  5IV3 A;  1N5V A;  2F3J A;  3PZP A;  3CJ0 A;  3BQ0 A;  4BC9 A;  1N0V C;  1HYS A;  5H1S V;  1WDT A;  4HHU A;  3FEY B;  4F8R A;  2CZV C;  4KFB A;  4B3M F;  1W7W A;  3IR6 B;  2PMW A;  3O44 A;  4DR2 F;  3M6V A;  3NNH A;  2CQD A;  5IC4 B;  1PBU A;  1JLQ A;  3AAW B;  4IOA Q;  4TY8 B;  4QPT A;  4B02 A;  4J9S A;  3MMA B;  4P9S A;  4WK1 A;  1QY7 A;  2JLG A;  1QLN A;  4J9U E;  4ZVO B;  2OLW A;  3QT5 A;  2A18 A;  1GX5 A;  3UQS A;  1RLC L;  4LRC A;  3WIU A;  2HYI B;  2NYI A;  2CXE A;  1NJW A;  4OJH A;  1AT1 B;  5BJR A;  2W2O P;  3W2V A;  2BJ8 A;  4DL5 A;  1RZM A;  1FNO A;  1WAC A;  2JNJ A;  4LRE A;  2XO6 A;  4K0K J;  1RBA A;  1HNW J;  4LF5 J;  1TL7 A;  1WOR A;  5A0Y A;  4IG0 A;  2XLI A;  1WEL A;  2IM2 A;  1X0F A;  3POT A;  2ZZN A;  2LEA A;  1UEV A;  2Z56 B;  3DXB A;  1AUD A;  4DEZ A;  5CAB A;  2AIR B;  4A4J A;  2J6T A;  1OPI A;  1DAX A;  2UUC J;  3GSI A;  1F5A A;  1FEH A;  3T5L A;  4Y34 A;  5E3P A;  4CO3 A;  2ZJQ Q;  4K5S A;  3QBC A;  1IJF B;  1S6O A;  3DRR B;  1ZAX A;  3QRQ A;  4HL9 A;  2MGZ A;  4P10 A;  2IRY A;  3BQ2 A;  2RAQ A;  4ED6 A;  3QFW A;  2WSC C;  3V4I B;  1S0N A;  4JI7 F;  1TL4 A;  1WOS A;  4LF8 J;  3TAR A;  3CCZ A;  2NSB A;  3CCR S;  3OFE A;  1ZZF A;  4RWW A;  3BYR A;  3SCJ E;  4CLF A;  1LWF A;  2EK6 A;  1RU1 A;  4ED4 A;  2XMV A;  1RT7 A;  4M5I A;  3KLH A;  5HVF A;  8ATC B;  3W5X A;  2QC3 A;  4HHH A;  3CCW A;  3DYA B;  3CCS S;  2FHO B;  2OAU A;  5IWA F;  2ZJR Q;  2IRX A;  1XR6 A;  4PXC A;  2R7Q A;  2IRU A;  1VRT A;  5CCM A;  1J5O A;  3BR9 A;  3QT8 A;  1HPZ B;  3NGR A;  1QSY A;  3O1L A;  1A0O B;  4DFJ A;  1RJJ A;  1FX2 A;  1HWU A;  1YRX A;  2BE7 D;  4AL6 A;  3GCX P;  5F9N A;  2HBY B;  5KT5 A;  4WJB A;  2XB2 D;  4ECY A;  1MW7 A;  3M8Q A;  1DRZ A;  3CTR A;  1SBR A;  3C19 A;  1V6H A;  4C8O A;  2QL9 B;  4WU2 A;  2RIJ A;  3MCO A;  1J27 A;  3JS9 A;  4DV6 J;  1E6Y A;  3ILL A;  2HUR A;  2KYX A;  2DNL A;  3LTO A;  3TX8 A;  4JI0 F;  2G13 A;  1LXN A;  3DLB A;  2P5V A;  5CZX A;  4OYM A;  1REV A;  5FDL A;  1KDN A;  2Q3P A;  3OBI A;  3PJX A;  2C3P A;  3N4W A;  1GK8 A;  4C98 A;  5J2Q B;  1NDP A;  4DR5 J;  5KFV A;  3C3L A;  4KJI A;  3AY0 A;  4IOC Q;  3BRE A;  4PG6 A;  3M8S A;  4XPE A;  1S9F A;  1EQM A;  3NBP A;  2VFU A;  2ALZ A;  1JLC A;  3W7B A;  1ZZN A;  4LQ9 A;  3CCE S;  2R4F A;  4QOT A;  2PEH A;  5L9X A;  2CJX B;  4KGV B;  5J2P B;  4CNY A;  2COL A;  4I56 A;  3HSG A;  1C2P A;  3MEE A;  3GIK A;  4P2X A;  4J90 A;  3M9N B;  4RW8 B;  5C24 A;  1HI1 A;  1UFL A;  1VQY A;  1FEE A;  3VGT A;  2ZD1 B;  1FXL A;  4HYK A;  3FBF A;  5LL6 d;  2RUS A;  3A8I A;  1M90 T;  2VB6 A;  3T6J A;  2ZH1 A;  3JTO A;  3QFH A;  3KOA A;  1JWW A;  5DLG A;  3N6M A;  3KMQ A;  1RA7 A;  3PW4 A;  1GMW D;  1P27 B;  4A8M P;  3W9J A;  3W65 A;  3K8V A;  3MAA B;  2XUL A;  2JVO A;  2FGC A;  2HKE A;  3Q8Q B;  4DL6 A;  2H51 B;  1BQN B;  3LW5 C;  2EFP A;  4UW2 A;  1S97 A;  5THW A;  2OD6 A;  3N6L A;  2F7V A;  3PRD A;  1IKW A;  4K50 A;  1UZH A;  4G3I A;  3FMW A;  4IFY A;  2CPX A;  5J1P A;  5ETP A;  3DLH A;  4LFA J;  1GAO A;  1B7F A;  2E5J A;  3UFC X;  5F8G A;  4EYI B;  2G0C A;  5J2M A;  4N5S A;  2QL5 B;  2V4R A;  2XM3 A;  1TUV A;  3MR3 A;  4OZ2 A;  3OQ2 A;  5B0A A;  1WC1 A;  2GO9 A;  3DLJ A;  4HI2 A;  4QBU A;  4DV2 F;  3ETM A;  3D9B A;  1OY9 A;  1RQ0 A;  3CE8 A;  1FRM A;  2HGL A;  2W9C A;  1S6U A;  5AXL A;  2HND B;  4K4V A;  2GIF A;  2WVE A;  1X31 C;  1VC0 A;  4UUX A;  3MUV P;  2YX1 A;  2CQ4 A;  1YGY A;  4J9R A;  1Q7Y T;  1X4A A;  2EWH A;  2XCA A;  2B0G A;  2O01 C;  4ZVQ B;  5HJX A;  1BLU A;  1G2E A;  2CVI A;  4RNF A;  5IM0 B;  2HHQ A;  4JI6 F;  1S7I A;  5DDQ C;  1TKT A;  1MG7 A;  1OIA A;  3IM9 A;  4DSE A;  1P9Q C;  1K0T A;  2YXL A;  1GT8 A;  1F5C A;  4LR9 A;  2MY7 A;  2FVC A;  2FJW A;  1BD6 A;  3UNG C;  2B6A A;  3R5B A;  4HHJ A;  2CFX A;  2OO4 A;  2P9G A;  2RKI A;  4NCG B;  3SIP B;  3LGN A;  4XAK A;  2XZD B;  3PW2 A;  2UVV A;  2WON B;  3AXK A;  3HVT A;  4ZPD A;  5F8L A;  4KGX B;  3I96 A;  4W92 B;  3W62 A;  1EX8 A;  4JI1 F;  4GKJ F;  1RWO B;  1HQE B;  4B9M A;  1Y4Z B;  2B7B B;  2PEB A;  2NXU A;  4Y2I A;  2OP5 A;  3UNY A;  4WFA Q;  2AEM A;  2FYX A;  2UVU A;  4P7T A;  2OEL A;  4ANC A;  2J9D E;  2MB0 B;  1IJE B;  4C8N A;  1CS4 B;  1NEE A;  2M2B A;  4NA3 A;  1Q8I A;  4NML A;  4RKU C;  5GME A;  4HAC B;  2FHJ A;  2C1E B;  3GV8 B;  3AB4 B;  3IG1 B;  3I0R B;  2YY3 A;  1FF2 A;  4IR9 A;  1Y5I B;  1C0T B;  3RUB L;  2ZH2 A;  1CG2 A;  1NJI T;  3V6D A;  4LRB A;  3M8W A;  1BGX T;  1HR0 F;  4PXE A;  5EUH A;  1W2B R;  4YR3 A;  1SH0 A;  2LA4 A;  4Y00 A;  1FJG J;  3ZZR A;  1TV6 B;  3MAH A;  1XMQ F;  2NRE A;  2VG5 B;  4P52 A;  5B0E A;  3ZC4 A;  4URG A;  1U2F A;  1VJQ A;  1MNE A;  1Y3J A;  2HFN A;  1MSW D;  2VU5 A;  2B51 A;  1YG0 A;  2C22 A;  2Z4P A;  2E5L F;  5J2N A;  2BJD A;  2RJZ A;  1HD1 A;  2FY8 A;  1NKE A;  3TQ1 A;  3DMJ B;  3MR7 A;  2QLB B;  1NDL A;  3C6U B;  3KG1 A;  3NNA A;  3DDK A;  3ET6 B;  4RZR A;  2YNH B;  1T9W A;  2UUA F;  2I9S A;  3BSC A;  1WWH A;  2MLY A;  2YBV A;  1NK0 A;  2UUB F;  4M8L A;  1JLG A;  2D74 B;  2A6O A;  2BRL A;  4X64 J;  2R7R A;  1RBL A;  4OZN A;  3ZZO A;  2M5Y A;  3WHI A;  1PSD A;  2QJ3 A;  4YB5 A;  3LP2 B;  3HI9 A;  3OFF A;  3NCQ A;  2IMW P;  4J9Q A;  2HQI A;  4CYU B;  2W1B A;  3H4D A;  2GVZ B;  4CI0 B;  4CTA B;  1F3V A;  1UET A;  3NWR A;  1APS A;  2ADB A;  5IXU A;  4NWB A;  2BE9 B;  3AD7 C;  2RHS B;  3L09 A;  1N48 A;  1X9M A;  2ZH9 A;  3HSJ A;  2RF2 A;  4PWD B;  2Z0G A;  1Q78 A;  2HNZ A;  2MQN A;  1M1K T;  4IYQ A;  4TN2 A;  2W2P P;  4OI1 A;  1MU2 B;  5EHH A;  3TO8 A;  2JFK A;  3VVT A;  1TUG B;  3OTB A;  3GJS B;  2B5J B;  2V4Q A;  4DR3 F;  1S9G B;  3R9L A;  2YNF A;  3ZXW A;  4DUY J;  4XDD A;  1Q16 B;  4Q44 A;  2AYG A;  2E9Z A;  2ZOF A;  2WZ1 A;  3KLG A;  3SMZ A;  3HUL A;  5KFL A;  3V81 B;  3BSA A;  1B4S A;  4C3M A;  1NH8 A;  4K4U A;  3QO9 B;  3MPU B;  1YDL A;  1JKH A;  3NXZ A;  3OXF A;  4HLB A;  3RBX A;  9ATC B;  3A8J A;  2EC0 A;  4U8Y A;  1HNI A;  4EGL A;  3NMR A;  3EMT A;  1KQK A;  1SC4 B;  3G8T A;  1LWX A;  4YDX A;  1N88 A;  4OYZ A;  1XK8 A;  3CJK B;  3CB4 A;  5E3Q A;  1VK3 A;  3BO2 A;  2XBP A;  1HD0 A;  1DUR A;  3GIR A;  1RTD A;  2ZDP A;  3ZZY A;  4KRW A;  3V5R A;  2M4M A;  5GAD I;  4IFV B;  1VQ5 S;  4YN3 B;  3VAJ A;  1T11 A;  3G82 A;  2LVW A;  1K47 A;  1R6V A;  4HDH A;  5KG2 A;  2E5I A;  1HBM A;  5AT1 B;  5I3Q A;  4WFX A;  2NXC A;  2OPR B;  3FRY A;  1D9F A;  2XS7 A;  1N0U A;  2LU1 A;  2ZKU A;  4EU0 A;  5T14 A;  2AJ4 A;  4L76 A;  1FER A;  1QE1 A;  1H2T Z;  1RA6 A;  2N4C A;  4DR7 J;  1WG5 A;  3W66 A;  3IS9 A;  3MD3 A;  4M5N A;  3TAP A;  4B9T A;  1P1T A;  2PD1 A;  4DDF A;  4K8R A;  1T3N A;  1S1X B;  2IA6 A;  5KG5 A;  1NU4 A;  1G7C B;  1MLA A;  2FUG 9;  3QIP A;  2QTW A;  5DM6 Q;  4C0O C;  2HBQ B;  1SJ3 P;  4NPO A;  1RAI B;  2IA0 A;  3K57 A;  1P8G A;  4M95 A;  4ZVT B;  2G4B A;  1K44 A;  1FTR A;  2YVS A;  1FKA F;  1UEK A;  5DGB A;  1WKK A;  5B7W A;  2BOP A;  3OR2 B;  4WXW A;  1P1L A;  4RW6 B;  4MFB B;  1E6V A;  2XLK A;  2IM1 A;  2KDO A;  1S0M A;  3PEJ A;  1X5P A;  1WKJ A;  4USJ C;  1NCL A;  3H20 A;  4JI5 F;  4ZCM A;  1G4C A;  3NAH A;  1J5E J;  2DCL A;  4MIA A;  4DMZ A;  3JSM B;  4N8N A;  4L75 A;  2CQB A;  3R1L A;  1EIY B;  3HMJ G;  2EW9 A;  1LW2 B;  3G6Y A;  2VQF F;  2H5J B;  4GVL A;  3W5Z A;  4KGM A;  2H65 B;  1T03 A;  3G2X A;  3VQS A;  5CYM B;  3PX4 A;  2XMW A;  2VZ9 A;  4UOH A;  4PUO B;  3G71 S;  4DQS A;  2VFR A;  2OEM A;  4RW4 A;  1LWE B;  1RT3 B;  1I5O B;  4KGZ B;  1V3R A;  1HLW A;  3M2U A;  5JVH Q;  3RYL A;  2MPU A;  2E1M C;  3R8Y A;  3AQP A;  4GC7 A;  2CPZ A;  4USW A;  4LF4 J;  2HNY A;  1T3O A;  2PA8 D;  2C2N A;  3FJ2 A;  4TLR A;  2R8I A;  1UJ5 A;  3HVW A;  3IAS 9;  4DV7 F;  2NPI A;  1N56 A;  3O5T B;  4B3T F;  1RAD B;  3DLK A;  3A3O B;  2DH9 A;  2A0F B;  3IC1 A;  1HQU A;  3UN3 A;  4OX9 F;  4PR6 A;  4FN5 A;  2XWX A;  4U9R A;  4M1K A;  4ECS A;  4O44 A;  4ID5 B;  2ZM6 F;  2LEP A;  1LV5 A;  5BR8 J;  2X1F A;  2DGQ A;  2Q79 A;  3HT0 A;  4WP9 A;  4DUT A;  4CH1 A;  5LJ5 Y;  4TU7 A;  2IAJ A;  2J8A A;  3PTW A;  2X1A A;  3GV5 B;  3M2V B;  1S4E A;  1SC3 B;  2BUN A;  1GQE A;  3TNV A;  5DQI A;  1IWA A;  2CIM A;  2QLX A;  2GS8 A;  5SUH A;  3AXM A;  5GAD U;  1FRH A;  2H1Y A;  1LQ9 A;  3PFO A;  4I2P A;  3UDE A;  2GNK A;  1C4A A;  3AH6 A;  4DPX A;  3CO9 A;  1UCN A;  1EET A;  2YTC A;  4QQB A;  3K7R A;  4X4P A;  3EVW A;  4KHR A;  2Z2Y B;  1U7L A;  4TU8 A;  3MTJ A;  2LKZ A;  2EK1 A;  3KJN B;  2D3U A;  3AD9 C;  1U0S A;  4BLG A;  3J7A 1;  2E1A A;  3BEG B;  1QSS A;  4LSN B;  3HP6 A;  3DDI A;  2DNN A;  2HG4 A;  3H90 A;  2MQL A;  4F26 A;  1NUE A;  1VQ6 S;  4LSL A;  2GAH C;  2WOM B;  1RIS A;  4ILR A;  2ALY B;  5A8K A;  1HWJ A;  3PVX A;  3MM6 B;  4A8Y A;  1JLF A;  4I7F A;  2HVI A;  3TJ9 A;  3MPY A;  2N4D A;  4PG8 A;  1WI8 A;  4CH7 A;  5KFA A;  2R2T A;  3LWL A;  1LK5 A;  5DQG A;  1WEX A;  3TQE A;  3T3F A;  1S6P A;  1VS3 A;  1S77 D;  1DHM A;  4DI6 A;  3EUN A;  5KFR A;  3PM9 A;  4F7V A;  1R0A B;  2RUG A;  2DIV A;  1H7W A;  3MM7 A;  2GQQ A;  1QUP A;  2BW7 A;  2LEB A;  3CXC R;  1CJV A;  1R8H A;  4G65 A;  4NLW A;  3MM8 A;  4LFC J;  1VQK S;  4UOC A;  3HF5 A;  5HK4 A;  3CJR A;  8AT1 B;  4OYB A;  4P6Q A;  3KK3 B;  1XMO J;  5KT6 A;  4F4Y A;  3BPD A;  2DNR A;  3H59 A;  1HKA A;  4K0K F;  3EDQ B;  1HNW F;  2DXE A;  4LF5 F;  2DKO B;  4RR5 A;  3VAM A;  4FF4 A;  2BKN A;  2XS5 A;  1JIH A;  3HT3 A;  3IRX A;  1FNM A;  3VV2 B;  1VYA A;  1HNZ J;  4CH0 S;  1FKP A;  2BEF A;  2ROP A;  2A2C A;  3GIL A;  2JX2 A;  2ZOG A;  2UUC F;  3BGR B;  2F40 A;  3D67 A;  3Q22 A;  2C2Z B;  2KT3 A;  1M1H A;  3KLF B;  4C8Y A;  2HS4 A;  5LSO A;  3KHL A;  1EQ0 A;  2V8D A;  1D9D A;  2AJQ A;  1YQH A;  3CED A;  2ATL A;  4ZJL A;  1MRO B;  3MEG A;  3NS7 B;  1VIO A;  3OTE A;  1U1L A;  2ROG A;  4PQU B;  4K4T A;  1ZTT A;  5D3G B;  3RG6 A;  3UO0 A;  1NK4 A;  5C5J A;  5ETT A;  3BJY A;  2HRY A;  3W2W A;  4N8O A;  4LF8 F;  3J80 Y;  1JNZ B;  1YHQ S;  3SQG A;  1F5B A;  2R7S A;  4PG7 A;  3GB0 A;  1U45 A;  2MKI A;  2ZH6 A;  3LWM A;  2DRB A;  2J9D A;  2YNI A;  4DV3 J;  3S6E A;  1SIZ A;  2KM8 B;  2NSC A;  4HKQ A;  4DL0 C;  4F2R A;  3T5H A;  2QYG A;  1JLE A;  4NAS A;  5CYJ A;  1RK8 A;  4ZCL A;  4NLG A;  3M30 A;  3RB6 A;  4EBE A;  2VD3 A;  4RW7 A;  1H2U X;  5KFD A;  4DN0 A;  1YJW S;  3EX7 B;  2VOD A;  4ED1 A;  3IA0 A;  3F41 A;  4U7U D;  1CJK A;  1H2V Z;  1TL1 B;  4J91 A;  2LMI A;  1NK6 A;  1RGV A;  3GZ7 A;  2B9E A;  1F60 B;  4RBV A;  4BWM A;  1T9Y A;  5ETQ A;  2A6M A;  2WB1 D;  4KSE B;  2QFI A;  1JXV A;  1QVF R;  3LGH A;  2ZDO A;  5HMX A;  3NKY A;  4DU7 A;  1AXQ A;  3CD0 A;  1S79 A;  5E7O B;  2DR6 A;  2C42 A;  2ZZM A;  4DV6 F;  3L3C A;  4KT0 C;  3IGV A;  3UW1 A;  2HSE B;  2GJ2 A;  4M5L A;  4YP3 A;  1O51 A;  3NCP A;  2GMH A;  4Q45 A;  1FES A;  1C1C A;  3KDN A;  4X4O A;  1WF1 A;  2VKR A;  5K14 B;  1DTT B;  5H9F K;  2BXJ A;  4PCQ A;  3QAE A;  1LNQ A;  4DR5 F;  4MT1 A;  3QNW B;  1NJX A;  1RTJ B;  1SXL A;  4USH A;  1F3F A;  3TI0 A;  2CNK B;  4AFF A;  4PQA A;  2AJF E;  5B0G A;  4ED0 A;  1RHR B;  3K5N A;  2WAQ D;  1S6Q A;  3PYF A;  2DYA A;  3W8P A;  3AA9 A;  1FDD A;  4DV5 J;  2CJ9 A;  3NG8 A;  4ZVU B;  8RUC A;  1RAA B;  2R7T A;  1KQG B;  2WVD A;  4X4U A;  2R7V A;  4IH5 A;  4K4X A;  3BBB A;  1EJ7 L;  4Y6I A;  4HH1 A;  1RT2 B;  3EIC A;  3C14 B;  3OR1 A;  2RT3 A;  4KO0 B;  2MZR A;  1H0H B;  3QGG A;  3KNG A;  1BY9 A;  1R7I A;  2KJV A;  3TVZ A;  4JI7 J;  1VI7 A;  4YHH J;  1X5S A;  2CPJ A;  4IDK A;  1GXT A;  1FRL A;  5C42 A;  2FZG B;  2KT2 A;  1H3D A;  3KK1 B;  1RT4 A;  2BAC A;  1K9M T;  4FXV A;  4P72 A;  4DWI A;  1TFY A;  5F8I A;  2XHW A;  1YTY A;  4NLQ A;  1R0C B;  4PG5 A;  5CCL A;  1TU0 B;  1KP6 A;  3KJF B;  3TX0 A;  4OX8 A;  2H48 B;  2Y0S D;  2C3M A;  3K89 A;  2WSE C;  1U6Z A;  2B9Y A;  1RAF B;  1V3S A;  3D7S B;  3BN7 A;  5KFG A;  1FO1 A;  3NNC A;  3J81 j;  1QD1 A;  1IM6 A;  4XO0 A;  1TP7 A;  1DLO A;  2MJN A;  1U8S A;  1F2H A;  2N3O A;  2MEW A;  4OQJ A;  1UVM A;  5KFK A;  4LFA F;  2J6S A;  4DSJ A;  2B8P A;  5D0E A;  3VGS A;  1YI2 S;  2E7V A;  1U1K A;  3KNA A;  3D6T B;  3N5F A;  1HNV B;  1X9S A;  2FB0 A;  3QZ8 A;  4TQS A;  4RL1 A;  4I2Q B;  4PWW A;  3HHL C;  4KH0 B;  4RU2 A;  1WG4 A;  1WD6 A;  3THV A;  4MIB A;  3VZH A;  5T41 A;  5KFJ A;  3JSY A;  5IT9 Y;  2V68 A;  2IBK A;  1VQS A;  4OHZ A;  1VHF A;  1C1B A;  3D68 A;  3J7Y I;  1HW9 A;  1VQ9 S;  4Q5V A;  4KR0 B;  2DO0 A;  3CMQ A;  1LW0 A;  4C8M A;  2D3O R;  2OPP B;  3MR6 A;  4EO8 A;  3IBC B;  2R2S A;  2CQ2 A;  2DGU A;  2Y0B B;  2YWF A;  1OY8 A;  4RO0 A;  1K1S A;  1UVK A;  4ENO A;  4BHQ A;  3DRX A;  3HLU A;  1KLN A;  3IAM 9;  2VG6 A;  4LUB A;  3ZZ0 A;  3CJ8 A;  4MKB A;  2R8J A;  4TLQ A;  1XQI A;  2VF3 A;  4FNI A;  2R8G A;  4ICL B;  1FJC A;  3MFI A;  2Y1R I;  4F67 A;  1JLB A;  2PMH A;  4WK3 A;  1T95 A;  4FF3 A;  2CQ3 A;  1RLD A;  3MM9 A;  4DSK A;  1IR1 A;  2XG8 A;  4AXJ A;  3RTV A;  3RAM A;  4FKY A;  1VBX A;  4URQ U;  2LFV A;  4N76 A;  1SJR A;  2JWN A;  3M32 A;  5CD4 H;  4L6V 3;  1S0O A;  2KXF A;  5CYQ A;  4M94 A;  2YKM A;  3CUN A;  4OFZ A;  1U0H A;  2NZ4 A;  1PJ5 A;  4ZLN A;  3VZI A;  3K17 A;  3KG4 A;  4XDC A;  3EXC X;  3KYL A;  3K0J A;  4C11 A;  1VRU B;  2FC8 A;  1O0P A;  2AX1 A;  5LM7 E;  5KTQ A;  3DM2 B;  3DRS B;  4F0K A;  2HVD A;  1RSC A;  3FEX B;  2BYC A;  2LA6 A;  5G0R B;  4O0I A;  3T9Z A;  4RUC A;  1X0P A;  4DR6 F;  2LLZ A;  3P8B B;  1I51 B;  2KHD A;  1K0V A;  1CUL B;  2RQK A;  5J1E A;  1LFP A;  4HT5 A;  1AFI A;  1SVD A;  1FJG F;  1UWB A;  3MED B;  1M5S A;  1R8A A;  4JBC A;  1JJH A;  3ZFV A;  4NE9 C;  3AHP A;  2DJW A;  1N5Y A;  4CNZ A;  2LU2 A;  5FLX Y;  1QAJ A;  3A12 A;  1HBO A;  3Q24 A;  3DRP B;  3CJ2 A;  3ISZ A;  3CDA A;  2JHE A;  5A8R B;  1NPP A;  4NXM J;  1N4L A;  5JXS A;  3M7V A;  4MH8 A;  2MQQ A;  1H72 C;  4OYI A;  1NBE B;  2BMB A;  1D0E A;  2Z2L A;  5LMU J;  1FDA A;  4IRD A;  1WJ9 A;  2EFV A;  2V0N A;  2B3T B;  1PKU A;  3T9N A;  2PFD A;  1U4B A;  3KK2 B;  4IG3 B;  2F8H A;  2GML A;  3FKB A;  2E1C A;  2V8G A;  1Z2Z A;  3HHL D;  3OLB A;  2VBX A;  1HBN B;  4FP9 A;  4G1Q A;  4UF4 A;  5C2G A;  2E29 A;  2HHW A;  3OSP A;  5HLF A;  4KV8 A;  3I4H X;  2B43 A;  2IJN A;  5DG8 A;  4K5R A;  4X64 F;  3G87 A;  1YBA A;  3GSD A;  3QGI A;  5E3C A;  4OYX A;  2QLW A;  1RWN B;  2HWH A;  4LQ3 A;  2V6A A;  1MMN A;  4I0W A;  2XTJ P;  2J6U A;  1UEU A;  4H4M B;  2IVY A;  1OO0 B;  1RT6 A;  1RTH A;  3O6Q A;  3BYP A;  2GV1 A;  2Q1L A;  3ETO A;  3PYG A;  3N79 A;  3KLV A;  4ED3 A;  3QJL A;  2YWE A;  3FBE A;  4R0E A;  3SDE B;  4DFP A;  1SPB P;  3BBF A;  5KFC A;  2ZWO A;  4A46 A;  4TVA B;  3H5X A;  2APO A;  1JX4 A;  3V4M A;  4F2S A;  1HBU B;  3A1Y G;  1D3W A;  9RUB A;  1SJ1 A;  2QEX S;  1KBR A;  3TUP A;  1HQ2 A;  1MN9 A;  2OSQ A;  3B8H A;  4NLT A;  2FJA B;  2ZH7 A;  1BQM B;  4QJV A;  5EGY A;  5JVG Q;  4MAK A;  1TVR B;  3RZA A;  2W2Q P;  4DUY F;  1SKU B;  2JC0 A;  4Y0F A;  1H98 A;  3OTO F;  2VOO A;  4K4S A;  1LKZ A;  4CO2 A;  3EGW B;  1FHT A;  5D0R A;  1YJ9 S;  2HQF A;  1R0B G;  2LQB A;  2BDP A;  2XC9 A;  4ETZ A;  1PBA A;  2JEI A;  4ZCI A;  5LT5 A;  2MZ1 A;  4NLY A;  5F8H A;  3VAH A;  3C15 A;  2IJF A;  2FD2 A;  1S57 A;  2IHR 1;  4NZ6 A;  3RBD A;  2V50 A;  3C16 B;  1Z1Z A;  2XZW A;  2CQ0 A;  1SL1 A;  1Q8K A;  4IQM A;  1Q82 T;  2OTL S;  1UFW A;  5M2R A;  4Q0B A;  4M5G A;  4YY3 F;  2DNP A;  4M5J A;  2VDH A;  4RPF A;  1T05 B;  3CF5 Q;  1XWL A;  1IKX A;  4WP8 A;  4GKK J;  4NYP A;  1KC8 T;  4UQT A;  4KBI A;  2EC2 A;  3UD5 A;  5H9E K;  1VQO S;  4AL5 A;  4OHW A;  3FUY A;  5KFW A;  5KFF A;  1TK5 A;  3N5B A;  2VFS A;  2KG0 A;  1FD8 A;  1HIY A;  3DOM A;  3ADA C;  3MOZ A;  4TY9 A;  2PDA A;  3M1V B;  1Z2L A;  4OZL A;  1NK8 A;  4NYO A;  4UZB A;  1KFS A;  1KSP A;  2VPX B;  5IT0 A;  3B4D A;  2BAN A;  2IM3 A;  4LR7 A;  4YFU A;  1DTQ A;  2KJW A;  1PJ7 A;  4DPY A;  3GFX A;  4CLW A;  1ZA1 B;  4NLV A;  3WX4 A;  3I4P A;  4NA1 A;  1SUQ A;  1B70 B;  3H4B A;  2PA3 A;  1RAG B;  4KPC A;  1SB6 A;  4J9V A;  4QIG A;  2I1R A;  2FJE B;  3UVJ A;  4CIO A;  3BO3 A;  1CJT A;  1HMV B;  4LT6 A;  4MKY A;  4HR2 A;  2UXD J;  4YS2 A;  3GV7 B;  4BDP A;  2ZE2 B;  4IRC A;  3FGV A;  1TL3 B;  2MHN A;  3SCI E;  3H2L A;  2XLJ A;  4B3S J;  1J5E F;  4YB6 A;  3I5B A;  4WZM A;  2E44 A;  2ZEJ A;  3PRB A;  4JI3 J;  5C7P A;  5D0H A;  1UVJ A;  2XY5 A;  2JLF A;  4DQQ A;  2QG9 B;  4GO7 X;  3V2U C;  2GFF A;  3A4T A;  2QL7 B;  2OGU A;  2ZIT A;  4HVZ A;  4RWX A;  5HMW A;  1H6K X;  1HAR A;  4X84 A;  2YX4 A;  2V9K A;  4JP8 A;  4J9N A;  4FVM A;  4B08 A;  3I0S B;  1YJR A;  3VHQ A;  2RVJ A;  2FLN A;  2FHM A;  1FFW B;  3GTY X;  6FD1 A;  1S1V B;  3DFE A;  1Q5Y A;  3AJ1 A;  2B9W A;  4C3K A;  1S1T A;  4LF4 F;  3C8Y A;  4YOE A;  1NDK A;  5AE3 A;  5AE1 A;  3OHA A;  2XI2 A;  3M4X A;  2BQR A;  2HVE A;  5KAK A;  4X4R A;  3ZTS A;  1RTI B;  1SQF A;  1F9F A;  5EWF A;  2E1P A;  5HVH A;  2I5J A;  2VAS A;  5M2P A;  4FBT A;  1UVN A;  2YQ0 A;  4I69 A;  1KQF B;  1RWM B;  1R43 A;  2R2U A;  3R2D J;  3LF0 A;  2DEI A;  3P45 B;  5A76 A;  1GXU A;  2F63 A;  1NPR A;  3CC4 S;  2VBW A;  5BR8 F;  5EN1 A;  3U1N A;  3A3P B;  2KN4 A;  2P9E A;  1WUU A;  4DPT A;  3GWC A;  2FZC B;  2AV5 A;  2KT5 A;  2K06 A;  2AYE A;  3MMB A;  3VTI A;  2BJ3 A;  3JSR A;  3K5O A;  1D9A A;  1A6L A;  5KFT A;  3MPW A;  4FS1 A;  3GYX B;  4Z7Y A;  4QPX A;  1IKY A;  1W2I A;  2ZBQ A;  2M88 A;  4M5H A;  3BS9 A;  2K1R B;  3DOK B;  3VGV A;  1UTA A;  3CJT A;  3LAN A;  5B0C A;  2JEJ A;  3ZZZ A;  4JI8 J;  1LWC B;  5KG7 A;  2W4P A;  3CCJ S;  4OZ1 A;  1S10 A;  2IDE A;  2CNO B;  4M63 A;  4DS5 A;  1UVL A;  4W4M A;  2MXY A;  4X4T A;  1B64 A;  4KIA A;  3M8P B;  2MDA A;  1ZPW X;  2HFO A;  2FLP A;  2P8I A;  2OPQ A;  1M1G A;  3RB3 A;  4UST A;  3W64 A;  1AW0 A;  5KFX A;  4N47 A;  3OL8 A;  3R5D A;  6AT1 B;  2DR7 A;  2GVD B;  3K58 A;  4F04 B;  2AEJ A;  4O4G A;  2DHG A;  3RR7 A;  2F9D A;  4O0N A;  3SXL A;  1N34 J;  2NXE A;  2DNY A;  1RCX B;  3C6T B;  7FDR A;  2DIT A;  1CJU B;  1I6J A;  3AB2 B;  4ZPW R;  3UD4 P;  1SJQ A;  3HKW A;  3C46 A;  1L3T A;  1T94 A;  3PEH A;  1RAB B;  4ZHR B;  2KG1 A;  4NLD A;  3IR5 B;  1FKO A;  3DGV A;  1BWV A;  4LFC F;  4OHX A;  3BSO A;  2FJD B;  4K2J A;  2P9C A;  5C25 A;  1AUS L;  1S1U A;  3AJ2 A;  4ZJQ A;  4NLP A;  1VOM A;  1MN7 A;  1XMO F;  2WBM A;  2GCF A;  1MWZ A;  1IVZ A;  2RD5 C;  4RBT A;  4ED5 A;  2EPI A;  4A48 A;  3EE3 A;  1FDB A;  2IC3 B;  1C4C A;  1PCA A;  4F3Q A;  1REG X;  2RHQ B;  1HWI A;  1MMD A;  2Y8Y A;  1HNZ F;  3DLG A;  3NGS A;  3Q83 A;  2HHP A;  2R3V A;  3UCU P;  3TRG A;  5H9E J;  3TAM B;  2CWK A;  3PY8 A;  3ILI A;  3IP0 A;  3K5L A;  3I32 A;  5BYQ A;  2MTL A;  2YKN B;  5I3U B;  2QLF B;  4KAI A;  4F02 A;  1YZ6 A;  4J7C A;  1DY3 A;  2HK3 A;  3Q8P B;  4MIW A;  1X4G A;  4RNM A;  5KT4 A;  1N54 B;  4PWU A;  5E5N A;  2LXF A;  4GVB A;  1M5K C;  5HP1 A;  1RHQ B;  1SV5 A;  1Q5V A;  2ZC4 A;  4B9L A;  2RS8 A;  1WC6 A;  1S76 D;  2P6S A;  5C2C A;  2RIL A;  2Q43 A;  2W8L A;  1ZS6 A;  4MTP A;  4DV3 F;  4CRJ A;  4R0J A;  3RW6 A;  3MM5 B;  2IMO A;  1U1N A;  4OJG A;  1QDU B;  4R8U B;  4ZVE A;  2BE2 B;  2KYZ A;  3HFV A;  4KGK A;  4ZN1 A;  4H4O B;  4Q43 A;  3Q2S C;  4MK9 A;  1QVG R;  1I1G A;  3G9C A;  1RAE B;  4PPZ A;  3BR8 A;  1B3T A;  3ITH A;  2AT1 B;  1AZS B;  3DHW C;  2UXC J;  1F6T A;  3FRZ A;  1JLA B;  2C2O B;  4DV0 J;  1WC4 A;  2NQP A;  1OWX A;  3LAL A;  2M8H A;  1IBK J;  2AYM A;  2W01 A;  1JJ2 R;  3TR5 A;  1S9E A;  4FBU A;  3FFI B;  3OXL A;  5IC6 B;  1V3Z A;  3NS6 A;  1R89 A;  1SI9 A;  1W25 A;  4DG1 A;  4F36 A;  3MD1 A;  1HFE L;  2DXD A;  3IM8 A;  3TAQ A;  4GC6 A;  2RU9 A;  2HQ3 A;  2LCW A;  5IZH A;  2N3L A;  3J7A N;  4ZVF A;  3MPV A;  2MLX A;  2QYC A;  1ZM3 A;  1HYS B;  4PZV A;  2E5G A;  1ITP A;  5KFU A;  3L7O A;  4IUF A;  4KFB B;  1KVK A;  3R27 A;  1DAR A;  3QMQ A;  4DL2 A;  3HPO A;  3PR4 A;  3ISN C;  5F9L A;  4ECX A;  4USM A;  1JLQ B;  1FRJ A;  4LBP A;  3RJM B;  4ZPC A;  3WC0 A;  3RAQ A;  3GIJ A;  2ASL A;  3VVU A;  1GNK A;  2ROE A;  4OHY A;  1V5I B;  4B3R J;  2DHS A;  2NR0 A;  1FXR A;  4DV5 F;  4C8Z A;  1FK9 A;  3K59 A;  2VV5 A;  3SBM A;  4HT7 A;  2M8D B;  4GO5 X;  3W2V B;  5JMN A;  1XNQ J;  2HWI A;  4I68 A;  3D3C J;  5EWG A;  4DL3 A;  2MQM A;  4ELU A;  2NCK L;  2NXJ A;  1TL7 B;  4YHH F;  2ZFH A;  3JTN A;  5A0Y B;  4IG0 B;  2X3D A;  3H0P A;  3J7Z T;  1T7P A;  1BQX A;  3POT B;  2HEK A;  5HQL A;  4LJM A;  1Q0N A;  5HMY A;  3PW5 A;  4O3Q A;  2KL8 A;  2FZK B;  2PII A;  3QT6 A;  4KY3 A;  1RAC B;  4B9S A;  1VQP S;  1NDC A;  4ECV A;  4C3L A;  2LQ8 A;  4B9V A;  3Q8V A;  2AX0 A;  2OHD A;  3SSS A;  1Y9O A;  3PJ9 A;  2MGZ B;  3RW7 A;  1JXL A;  4UOG A;  3THT A;  2LQ9 A;  3OUY A;  1FX4 A;  2WVB A;  3G96 A;  4ZJO A;  2J7U A;  4D3H A;  1WC0 A;  1SJF A;  4XPC A;  2QV6 A;  2XHC A;  3MUM P;  4TKT A;  4ZPV R;  4LF2 A;  1RT5 A;  1JJ4 A;  3K8W A;  4DHV A;  1LWF B;  2CJY B;  4WKR A;  3BSN A;  2LP4 A;  1RT7 B;  3KLH B;  4UY8 T;  1XIQ A;  2CJB A;  2BJ9 A;  1JB0 C;  5K8O A;  3PJW A;  1FWL A;  1KLM A;  2VKZ G;  3NWG A;  3OD2 A;  2W2M P;  5L1I A;  5ETM A;  3EXY A;  1U2C A;  2ATC B;  1VRT B;  5A8W A;  1J5O B;  1CSJ A;  3IWL A;  2AEF A;  3W9H A;  1L5U A;  5KG0 A;  2BQ3 A;  1UW9 A;  1IR2 A;  2NUU G;  3DLL Q;  2R2R A;  2AWZ A;  1T9U A;  1RCO B;  3TEG A;  3T5K A;  5D4P A;  4AQY J;  3R6G B;  4IO9 Q;  1UW4 A;  4OYO A;  5I42 A;  4V19 X;  4J9P A;  1CVJ A;  5AXN A;  2H3E B;  3CCL S;  5DO2 A;  2HFV A;  5CHC B;  4WII A;  1S48 A;  2HBZ B;  5KFQ A;  3M8Q B;  2HHX A;  2KH9 A;  3Q2T C;  4PEO A;  2DCU B;  3LP1 A;  1QAY A;  1Y10 A;  4YB1 P;  1RXO B;  2GQ2 A;  1E6Y B;  1FNX H;  2OFG X;  4EFA C;  4USV A;  4WE1 A;  2KFZ A;  3DGP A;  1CC8 A;  4USU A;  3QLH A;  3T1A A;  2HGN A;  4RNH A;  3UCG A;  1REV B;  5FDL B;  3CCU S;  4A8X A;  2OUG A;  4Z2X A;  1XER A;  3GR0 A;  4YR0 A;  2VG7 A;  1M0S A;  1IBL J;  5KT2 A;  5KOW A;  4J9O A;  3HHN B;  2B4P A;  2KXH A;  1WHW A;  1L3U A;  5L1J A;  1Y3K A;  4LF6 J;  1RI7 A;  2XY6 A;  3NBP B;  2HZC A;  1JLC B;  2ZVS A;  3EYZ A;  3PRV A;  2PO4 A;  1RHJ B;  1GMU A;  4P75 A;  4DV1 J;  3FDS A;  1G1X A;  3E3X A;  1LXJ A;  3I56 S;  3MEE B;  2ZHA A;  2HQD A;  3IO1 A;  2CJA A;  4C0B A;  4F3M A;  4DBQ A;  5GVQ A;  4O4R A;  5C24 B;  2ZOM A;  3MR2 A;  4M5M A;  1U1R A;  5K5M A;  1C0U A;  1X4E A;  4EO6 A;  1BE4 A;  2HRT A;  4E0D A;  3W3S A;  5DZ6 A;  3TZY A;  2BA9 A;  1NKC A;  3ZZT A;  4OYW A;  5EX3 A;  2R7U A;  2M52 A;  3PW7 A;  4P71 A;  1TKX A;  3JAM U;  3I31 A;  1JJC B;  3IRW P;  2DEJ A;  4OYP A;  4NXM F;  1TK0 A;  3GPA A;  3VAK A;  2YKA A;  5LMU F;  3UCZ P;  4ELV A;  2F5G A;  5HN0 A;  3OVS A;  2C2M B;  3ZTO A;  3CVK A;  3VAG A;  3EVM A;  3OV7 A;  2EFG A;  1KKH A;  4NI2 A;  2AQ4 A;  3N28 A;  3TVK A;  4KKO A;  1FWP A;  1IKW B;  1S49 A;  1VIX A;  4IFY B;  1EP4 A;  1XTZ A;  4DS4 A;  3ULH A;  4R5P A;  1O6X A;  1N6Q A;  1SJ4 P;  2B4U A;  4DV4 J;  5J2M B;  2E66 A;  3PKY A;  5J1N A;  3W63 A;  4B3O A;  3KUH A;  1CLF A;  1OJ4 A;  1ZOT A;  1YK9 A;  1VQ8 S;  2OPS A;  3J7Z 5;  4DX7 A;  3DI6 A;  5DQH A;  2W9C B;  4DQI A;  2AP6 A;  4UTG A;  2GGP A;  2ZNZ A;  3WX8 A;  5HI7 A;  3A8K A;  4J9L A;  4FYW B;  2HLU A;  4JV1 A;  4RW9 A;  4DX6 A;  1S59 A;  2V4J A;  1Q95 G;  4A8S A;  4NZ0 A;  2V5H G;  1RE1 B;  3EPI A;  2XY7 A;  3RB4 A;  1QTM A;  1U6F A;  3WZ0 A;  3HHL A;  1X7V A;  1TKT B;  2YNG A;  4DOZ A;  3CT9 A;  5KFO A;  4E2F B;  2HMI A;  3I5C A;  4WP3 A;  3M2R A;  2SXL A;  2PI5 A;  3OFG A;  2B6A B;  3DOL A;  2V2V A;  1KTV A;  2RKI B;  3FCH A;  1ZAW A;  3IWX A;  2YPY A;  2KVI A;  3P49 B;  2EKY A;  3Q23 A;  4E8U A;  4X62 J;  2R9L A;  4NLO A;  2IIH A;  3W9I A;  3HVT B;  4DR6 J;  5D77 A;  2H4Y B;  2BJ1 A;  1KVI A;  3BQ1 A;  2HHT A;  2D41 A;  2KHC A;  2UU9 J;  2MYF A;  3Q8Y A;  2QE5 A;  3D1O A;  4LR8 A;  3KJV A;  2F65 A;  1XR5 A;  2AJ1 A;  5B0D A;  1TKZ A;  2HZV A;  4QWC A;  4OI3 A;  2Z8Q A;  2QA4 S;  3T1Y J;  4OI2 A;  2CJK A;  4YQW A;  5AJ3 J;  1QTN B;  1CC7 A;  2DY9 A;  4A8O A;  2MQ8 A;  3MEC A;  3G86 A;  4U7U K;  3HVA A;  1UMJ A;  3A3N B;  3LP0 A;  1FVS A;  3AD8 C;  5A2Q U;  3C66 A;  4EI2 A;  2FY1 A;  2BX6 A;  3T6B A;  4ZPB A;  1MML A;  4FYX B;  4PXD A;  1YIJ S;  1YJ7 A;  4GKK F;  4Q2L A;  3T41 A;  1IR0 A;  2CG4 A;  2VQE J;  1OQ6 A;  3V6D B;  2ABY A;  2N7Y A;  2DHX A;  2GIR A;  2VJV A;  5KFZ A;  5HAT A;  2GW8 A;  3C2P A;  2Y8W A;  1NKB A;  2DT9 A;  2X3G A;  2XGP A;  4OZ0 A;  3P5B P;  1WI6 A;  1S1W A;  3KLI A;  4OI4 A;  1FWK A;  3LPY A;  5EWE A;  3CWJ A;  4DCJ B;  3IN5 A;  3GII A;  4O3P A;  5J2N B;  1OSC A;  5BYS A;  3GJR B;  3R2C J;  3CDW A;  3FZ2 A;  4ED8 A;  2CWX A;  1RHU B;  3BH7 B;  2ZUG A;  4O3N A;  4CT8 A;  2G2Y A;  1WTB A;  2RDJ A;  3ENA A;  3OL6 A;  3OHB A;  5DJB A;  1OYD A;  5JUM A;  2XO7 A;  2DK2 A;  1T8E A;  2UXD F;  1FDN A;  1ICE B;  2L9D A;  3SI8 A;  5CH7 B;  2AJ0 A;  1JLG B;  2OMO A;  3NGK A;  2XMA A;  4CO1 A;  4B3S F;  2B7C B;  3KLE A;  1N32 J;  3RRG A;  2E9T A;  4JI3 F;  2R7X A;  2P6T A;  2UUT A;  4EYH B;  2CQH A;  5K8P A;  3G8S A;  1ZH5 A;  1FRK A;  1U47 A;  4FF1 A;  5T7L A;  5GAG U;  2QMU B;  4NL5 A;  4NZ7 A;  4CQ1 A;  4FYV B;  4AUK A;  2XSJ A;  3QRR A;  5HRO A;  3OTO J;  2EEY A;  1K1Q A;  3W8G A;  3T1H J;  3TEH B;  2RF2 B;  3DHX A;  1X5O A;  3E01 A;  1VBZ A;  2VH7 A;  3MMC A;  3PX0 A;  1SQE A;  2HNZ B;  5BYR A;  2HQC A;  2M7S A;  5MAO A;  3MCS A;  2KM8 C;  1RWW B;  2Z2Z A;  5HBM A;  4H4K C;  3D6F B;  4DPW A;  1VQ4 S;  2BBE A;  4AE5 A;  4CCH A;  3ZTR A;  3K5P A;  3J81 U;  1URR A;  2YNF B;  5F0W A;  1NJZ A;  2C2D A;  2W9B A;  2RRB A;  2MQO A;  4YY3 J;  2HK2 A;  2MKY A;  3GIM A;  3EM1 A;  4ZK7 M;  2E9R X;  1VDH A;  3KLG B;  2DGS A;  3KWM A;  5D4N A;  1UAW A;  4PRF A;  2D7S A;  5ETL A;  2XEX A;  3DLE A;  1IUJ A;  3FMB A;  3H8Y A;  3JYT A;  4LFB J;  5DGA A;  2DR5 A;  1JKH B;  3QWU A;  4ECW A;  1HNI B;  1FJ7 A;  3MFH A;  2ACM A;  4A8W A;  2VDI A;  1H74 A;  4DFK A;  3OVA A;  5IS2 A;  4JV0 A;  4M5D A;  1RT1 A;  4I67 A;  3F44 A;  3QPI A;  3MCM A;  4G1P A;  2Q6C A;  3RGI A;  4C6A A;  4BBY A;  1RTD B;  2ZBI A;  1LOU A;  3G82 B;  2DD8 S;  1VHI A;  3H40 A;  2RML A;  4LRF A;  1YJU A;  2HS3 A;  2OD4 A;  3DKD A;  1HBM B;  2L9N A;  1K8A T;  4WYW A;  3M6W A;  5F41 A;  1IKV A;  1JMT A;  2ZHO A;  5D4L A;  2NPF A;  3ENV A;  5HL7 Q;  4JI8 F;  1QAX A;  2RB7 A;  3DU5 A;  1D8Z A;  2VUG A;  1QE1 B;  3M05 A;  4USK A;  4PKD B;  3X3U A;  2DPJ A;  4OZJ A;  5DRK A;  1PJ6 A;  2IFX A;  3IS9 B;  1U1Q A;  2KZM A;  5F3Z A;  4RUB A;  1TAU A;  1NRK A;  1PIE A;  4ELT A;  4DCO B;  1QM9 A;  3D0I E;  1Q8B A;  3DU6 A;  3MEK A;  4IR1 A;  3D1Q A;  5RUB A;  1WG1 A;  2QSF A;  3QIP B;  3V6H A;  4FYY B;  3GG1 A;  3HXM A;  4TY8 A;  1ARO P;  4ES2 A;  4WYL A;  3VGU A;  5LXR A;  5KFP A;  3MMA A;  1NK5 A;  4LVN P;  5E3A A;  1LEO A;  3D0H E;  1PYT A;  4KYZ A;  2LYV A;  2J0W A;  2MMY A;  5L1K A;  2J9E A;  3SSR A;  1HI0 P;  2EG2 A;  4CZC A;  1N34 F;  3WIV A;  4KHP J;  2CZ4 A;  1E6V B;  5B0F A;  2LEC A;  4OJ3 A;  3BDP A;  2X1G A;  2KXN B;  3N9U C;  5KFN A;  1RKI A;  3AOA A;  1ZM9 A;  1SC6 A;  2L3M A;  5DM7 Q;  1VJW A;  1V5V A;  3EVO A;  3HJF A;  4CLL A;  5HJY A;  2GAG C;  3QSI A;  4CO0 A;  1T03 B;  4FYD A;  3E8O A;  3IWN C;  2ZKT A;  4X4S A;  3N0V A;  4ZIT A;  5DS7 A;  2VL1 A;  4RW4 B;  3RU0 A;  1ACM B;  4ZN3 A;  5L1L A;  5A6P A;  2W8K A;  2VC0 A;  4Z7C A;  1WC5 A;  4K4Z A;  3M2U B;  1NAQ A;  4AND A;  2HHU A;  1T9X A;  1RWV B;  3DRR A;  3DCA A;  3P3D A;  2HNY B;  4V1A k;  1EKS A;  5KG4 A;  1HHQ A;  1X60 A;  2BM1 A;  4GRS A;  2F8E X;  3V4I A;  4RJV A;  3DLK B;  3SV3 A;  3U27 A;  1HQU B;  1GXL A;  1F2G A;  3RRK A;  1RDR A;  1EHW A;  2KKH A;  3EGV A;  1O8B A;  5GMK a;  2V34 A;  3B6B A;  1VGY A;  1HNX J;  2N82 B;  4EK2 A;  3N6N A;  2MKJ A;  2HPU A;  3IBF B;  4YUD A;  3DYA A;  1XEZ A;  4JV5 F;  1Q53 A;  4O44 B;  1N5S A;  2NZC A;  1TZ0 A;  1ULR A;  1S0V A;  4OYA A;  2IAJ B;  3HO1 A;  1N36 J;  2V67 A;  4WBF A;  4DQP A;  5KT3 A;  2O5D A;  5DG9 A;  3CD6 S;  1HPZ A;  3R97 A;  1XMB A;  2QRR A;  4O3O A;  4L3K A;  2IJR A;  1KR4 A;  5LSR A;  2AGQ A;  4DU8 A;  3S1T A;  2B8Q A;  4W90 B;  3NAI A;  4C8L A;  4I2P B;  3BV8 A;  2MKK A;  1NHV A;  4MYU A;  4LRA A;  4JOU A;  5M2U A;  2H4W B;  2EXU A;  3BPS P;  2DRA A;  1EET B;  4ZIV A;  2WW8 A;  1Q8L A;  1D8Y A;  2CRL A;  1P9Y A;  2UXC F;  4I6Y A;  4DV0 F;  3JQK A;  2XSF A;  3JTP A;  1IBK F;  2Q6B A;  4FXD A;  4Q7A A;  2QA2 A;  2HGM A;  2CUY A;  5GAE I;  3NLC A;  2ZH4 A;  2JLE A;  4CLY A;  1NB2 A;  2FPH X;  2VOP A;  2RU3 A;  2AZ3 A;  3O8W A;  4TYA A;  3UD3 P;  1WHY A;  2O1P A;  4LSL B;  1Y00 A;  3HZG A;  4DLE A;  4J5O A;  4N77 A;  4NRT A;  5J2Q A;  1RTZ A;  4ZVG A;  5A8K B;  1OMS A;  2ZH8 A;  4ATN A;  1JLF B;  2BM0 A;  4I7F B;  2MKS A;  3SEO A;  1R8C A;  4LSZ B;  4V19 J;  3O2I A;  2MZQ A;  1A7G E;  5J2P A;  1UP1 A;  1S6P B;  2DH8 A;  4ED2 A;  4X66 J;  3MTK A;  5F8M A;  4MYT A;  4OL8 A;  3L4B C;  4RW8 A;  2D9O A;  2QMX A;  3MHY A;  3MM7 B;  3MGJ A;  2ZD1 A;  1NZ8 A;  2E7W A;  2AJ2 A;  1CJV B;  2M3D A;  4OZ5 A;  4B3R F;  5KFY A;  3AOB A;  3LPE A;  1K73 T;  3MM8 B; 
#chains in the Genus database with same CATH homology
 2G0I A;  4PEO A;  2IDL A;  2G0J A;  1S12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...