2G0JA

Crystal structure of smu.848 from streptococcus mutans
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
RGSMIQATFIRRKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNALEVLADCTVSLQMDEFDGGYMKIDLSYITNKSDEKVQLLFEAFLLGITNLAENSPEFVTAKIMTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SMU.848
publication title Crystal structure of SMU.848 from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Unknown function
total genus 33
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04327 Peptidase_Prp Cysteine protease Prp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1490 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cysteine protease Prp 2g0jA00
1S12A 4PEOA 2IDLA 2G0JA 2G0IA
chains in the Genus database with same CATH superfamily
2HK2A 3BO4A 4XDDA 1H2TZ 4MK9A 1U1NA 4C0HA 2AGQA 3IG1B 1QM9A 3TZXA 2GQQA 1BXNA 1UA1A 2OO4A 3PACA 3MTJA 1HKAA 2BQUA 2IBOA 1VQYA 3A8JA 1X0FA 1UFLA 1CJKA 4CLLA 1AYEA 2VPWB 1BD6A 2R8GA 3CCSS 4F4WA 1J5EF 2XSFA 2ZKTA 1RTDA 1RHUB 1RT7A 1FNMA 3A12A 2QT7A 2RHSB 1BQXA 2J7WA 4FXWA 5DLFA 1U8WA 5KFDA 2OEKA 1K73T 4FYDA 1HW8A 3MFHA 1BC6A 4DQPA 1Q81T 2R3VA 1GH8A 1AT1B 4KKOB 3UVJB 2ZJRQ 4WIQA 2V2QA 1VGYA 1WC3A 3JQKA 3W5ZA 2H54B 1S0NA 2ASYA 3K57A 5JVHQ 2GHWA 1FF2A 2V9WA 3OUYA 2UVRA 2V4JA 1X4CA 1M5OC 3HVRA 1CJTB 1GAOA 3OTDA 2CPIA 4URSA 4F2RA 1K47A 4R5PA 4B3MJ 1ZTTA 3FEZA 5CZVA 4L73A 1S1VA 2J9EA 1EP4A 1FD2A 2AEFA 2JEIA 4ECTA 4I4BA 1NK6A 1JQGA 3OVAA 4DSFA 4EGLA 1R8BA 1VQKS 2CPXA 2DGVA 4FYWB 5KFLA 2NYIA 1X4EA 3MMCB 3BSAA 2R7UA 2RQCA 3QGHA 3IG1A 3BH6B 3UWTA 1ZZFA 5DG7A 1NDKA 4QR2A 2MZTA 3VAIA 3SI8A 3MPYA 3AA8A 4R0JA 2I6WA 4RO0A 2KHDA 1N32J 2VL1A 3GJQB 4JUZA 5IM0B 5L1KA 2Y1JA 2YKQA 3NRBA 1NK9A 5AT1B 4FYXB 3HHLB 4G1PA 3IA0A 3VAMA 4WP8A 4G1QB 3M8QB 1RUSA 4ED1A 2VC1A 3CJSA 2ZJPQ 4CP5A 2M5YA 3H0PA 2HZVA 1TL1B 2W9BA 1FRKA 4HR2A 4F4KA 4UQTA 2HRYA 1IR2A 4WZMA 1P27B 1EQ0A 4N77A 3VQSA 2H65B 1X4DA 4Y34A 4FS1A 4EBEA 4USUA 4DR6J 2EC2A 3W3SA 5AXKA 3MMJA 4WK3A 4MTPA 4DR3F 4LJMA 2HAIA 1HL6A 4RBTA 5E3PA 2J8SA 3MR3A 1SH0A 3EZUA 1FJCA 1RAHB 1DTTB 1RTIA 3DHXA 4DZDA 3LP0B 3FDSA 2DNKA 2ZUAA 1T02A 1REGX 3X1LB 2V8HA 4PAAA 5HMYA 1KLMA 2BM0A 3GU0A 2XMAA 2NSCA 5IWAF 3PYDA 1PJ6A 4X66J 3DYAA 4O4GA 4PXEA 2K1RA 1FJGF 4YOEA 2QA4G 3Q8UA 1FDDA 3MD1A 2PFDA 4DL5A 1M5KC 2C2NA 3PFEA 3NAIA 1N5QA 2VBYA 4C2MA 3NNAA 1HQEA 1RLCL 3HHEA 2DRBA 2AJ4A 1YJTA 2HHUA 4NYZA 4HT7A 5IS2A 4TU8A 4USWA 3D6TB 1ITPA 4JOUA 3PVXA 1ZH5A 4J7CA 3SCLE 4XO0A 4P2XA 2XULA 2CQ1A 2KVIA 1DTQB 4ECYA 2E5LF 3OV7A 1B0VA 1VBYA 4GKKJ 1BQMB 1URRA 2UUAF 1TVRB 3ISZA 2RDJA 3EPIA 1N36J 2LECA 1SH3A 3LWLA 2NZ4A 3FKBA 2VG7B 5LJ5Y 2H3EB 4C48A 4Q0BA 1FE0A 2QGFB 1AB8A 2NXNA 2ZBRA 3IR5B 1QE1B 1T7PA 1SKRA 2CQ2A 1B7FA 2Z57B 2BJ1A 5B0BA 4IRCA 3GV7B 3CJQA 4UOGA 3V6JA 5ETPA 1FKOB 2Y0BB 3LOUA 1ROFA 1YLXA 4JI1F 1Y4ZB 4CLZA 2D3O1 2QO3A 2P9GA 2W9AA 2CRLA 1OO0B 1WI6A 2FJXA 4XPCA 2P6TA 2BXJA 3TX8A 2GJ2A 2JSXA 3M1VB 3ZZ0A 2RRAA 5I4MA 4B3SJ 2DGTA 3NCQA 2L3MA 3MD3A 5G4DA 1N34F 2HVZA 3ILOA 1WJ9A 3TWZA 1UZHA 4KV8A 2HQCA 1S9GA 3TR5A 4AFFA 2DNYA 1RT2A 4I2PB 5F8MA 2X1BA 4EO8A 4WFBQ 5KOWA 4Q2MA 1QD1A 1BE4A 3MOZA 1PG5B 3D1HA 4YDDB 3QZ7A 1H2UX 2OP5A 3U7JA 4A4JA 3JS9A 1RWKB 5A76A 4CTAB 2HHWA 1TVRA 1RWOB 5KFQA 2FTRA 2RT3A 4TY8B 2VG7A 2EK1A 1J2VA 1UVNA 2HPUA 4ZJQA 3T9NA 3TYTA 3HF5A 4ECSA 1IKXB 4FZVA 4NL5A 5LSOA 3IAM9 4UOFA 1F1BB 5B0CA 3VF0B 2EI5A 3C46A 5D3GB 1GTHA 2OFGX 4QIWD 3CE8A 5F0UA 1VC5A 1PKUA 2MJNA 3K7RA 3VGVA 4LBIA 3DGPA 3VALA 1LW2B 4DN9A 1VJWA 4NMXA 3BGUA 2YH0A 2VB6A 2F63A 1IJFB 1G6BA 3HSZA 3HHLC 4K4YA 2YWHA 4DMZA 4ECUA 3KLEB 3HSDA 4NYOA 4NA1A 4B3MF 3KHHA 1WDTA 3EGZA 3UCGA 4EMDA 2XLIA 3MM9A 2DRAA 5E2QA 4A8WA 4O3RA 2R8IA 4M5GA 1Y9OA 5CAAA 4PPDA 4NRUA 2BDPA 2N3OA 3QGPA 2QA4S 2MKYA 3WC0A 2C28A 2F9DA 5E3AA 1WUUA 4X4PA 3BKUA 2BABA 1Y00A 1N5YA 4PPZA 3ZTPA 4OZ1A 4M5NA 2LLZA 1FXDA 3IBFB 1RK8A 1GK8A 2R7TA 4QWEA 1N32F 2MGZB 4ER8A 3FBEA 3BSOA 2H5IB 1HW9A 5HI7A 1NM2A 5KT6A 5A8WB 4B9VA 1WEZA 1VFJA 1W25A 2CJBA 2Y9HA 3LF0A 4RUHA 1HQ2A 5DZ6A 3TQEA 3P5BP 4IUFA 4CT8A 4OQJA 3NOCA 1IM6A 2QLBB 3UD5A 2CNKB 1MNEA 4DV6J 2JDJA 4AE5A 4NI2A 1KTVA 1NK8A 2DVIA 3Q2SC 3I6PA 4DOZA 4PKDB 3EE3A 4A47A 4QIVA 4W90B 4DSJA 1H6KX 3M30B 1Y5IB 1KSPA 1NPRA 3OL8A 3THVA 4DR6F 4HDHA 3V81B 3CCWA 4ILRA 4CQ1A 1WSVA 1DRZA 3MM5A 2GX8A 1TMMA 2I0XA 1QAJA 2EFNA 3HHNB 4HH0A 3F0NA 5KT3A 4K5SA 5J2PB 3GQCA 4F26A 2QV6A 4DPXA 2CG8A 4QIFA 3H2UB 2R4FA 4IOCQ 4MYUA 5B0EA 1DQ8A 1PO6A 3NAHA 2IAJB 2QX0A 5IQQA 2V34A 1R7IA 4X66F 3QJJA 5M2RA 4HTJA 3BQ1A 1MMDA 1B64A 4JI2J 3KMQA 3DXSX 3VGUA 4DU7A 3J7YI 2YX1A 1KVKA 2D1CA 1H74A 3H98A 3DI6A 2CZVC 4KTQA 2YNGA 1H38A 1GXUA 1I3OB 3PKYA 2DNRA 2HHXA 1VRUB 2APOA 3LGHA 3PKMA 5C2GA 1CC8A 1DLOB 2OPPB 1JLAA 4GKKF 5KFZA 3UNYA 4UT4A 1SVDA 3W5YA 1N36F 5CHCB 2B4PA 2MY7A 1YTYA 1AW0A 2ZZNA 3M30A 3RBXA 5F41A 2LA6A 5JXSA 2AQ4A 2DNMA 1I6JA 1L3UA 3NCPA 5L1LA 4JI5J 1UWBA 3TAPA 5EWGA 3KLHA 3V81A 3ELHA 1V5IB 3I0RB 1AA1B 2CWKA 1KQFB 4ED7A 1N48A 2B4OA 4AT1B 2PD1A 3PXGa 2AEJA 2ZHBA 2HGNA 4K4TA 1H7XA 1RP5A 2FJVA 4ELUA 2GQCA 3CCQS 3W8PA 3PIPQ 2VICA 5J2PA 4V1Ak 1RCOB 2ZOGA 3OLAA 4DX8H 3C6UA 2CZ9A 5IT4A 3QPIA 3HVTB 2HWTA 1LOUA 2ZEJA 2OTLS 2HQGA 1HNZJ 4C3MA 3VWSA 3VAKA 4CIOA 4OFZA 1D1UA 4RX6A 1RI7A 1LWEB 2PN6A 3FSYA 5F3TA 2AD9A 4PG4A 4B3SF 3OQ2A 3SSQA 3KJQB 4MJKA 2VJVA 2ASLA 4K2XA 1WHWA 1VQ5S 2WB4A 2AEMA 4K4WA 4CNYA 3IN5A 2W25A 2CAJA 4KB7A 2DIVA 2DRDA 4RW4A 2DY1A 4K4VA 3R97A 1RWWB 1HA1A 1QSLA 3GP9A 3DU5A 1ZM4A 1OPIA 2HNZB 4W4MA 5KFPA 2J6SA 3TANA 4L6V3 2LXUA 3FFIB 1VQ4S 2MKHA 3KMSA 3G87A 3QLHB 3VGSA 1AXQA 5H9EK 2G0JA 1FRHA 3NY0A 4XDCA 4WP3A 2K2PA 2B51A 3V6HA 4LSLB 2M88A 3GIIA 2HURA 2KTQA 3G86A 5DETA 1X9WA 1KHVA 4YB6A 3BN7A 3D28A 2R7RA 4M5KA 3PO4A 5HK4A 1SV5B 2ILZA 3SEOA 5AE3A 1T9YA 5I42B 2JNJA 2QL7B 3P49B 5KFEA 4P10A 4EUVA 3PW0A 4KHRA 5MLCV 2AKWB 2HS4A 4J9NA 4X62J 3UDEA 2UVUA 5JUMA 2RE1A 1SUQB 5CA5A 2W2QP 4FDFA 2F3JA 2BQ3A 2PEBA 1VLYA 4ZPWR 2B9WA 1IBMJ 4CLTA 5K8PA 2CNLB 2XLKA 2C2RA 2RAQA 1HQUA 2ADCA 4J9OA 2AX0A 1GQEA 3H2VE 2BYCA 4HL9A 4F04B 4Q43A 1PGZA 2KXFA 3E01B 3M6WA 4QZVB 3OSNA 3GV8B 1KS2A 2CWXA 1T9XA 3OL6A 4Y65A 3HPOA 3ICLA 1Q79A 1MROA 4IFYB 2VASA 1WC6A 3NNCA 2YKMA 2LP4A 3AAWB 3GG0A 1U02A 4DV7J 1Q4RA 2X1GA 4R8UB 1JXLA 1OY9A 4IDKA 5ETRA 3IBWA 3I32A 4Y2IA 3GG1A 1R0AB 4NOHA 4LRBA 3J7Z5 4ID5B 5HP1A 3EWGA 3TUPA 1QUVA 1SC1B 2HQDA 1HWKA 2Z0GA 2ZD1B 1Z2LA 2AJ2A 2Z8QA 1QTNB 1HHSA 2YX7A 5DQIA 1GXLA 1HIYA 1HNIA 4F7VA 1NZAA 4C8KA 4RW6B 1QSSA 4V19X 4OYBA 1GX5A 3NBPA 3UN5A 2WTFA 2V4QA 3QT5A 2BV3A 1K1QA 1OMSA 2P5VA 4DJBA 2ATCB 4X2BA 2N7CA 1SJ3P 4NZ7A 3PX0A 4CWBA 5T7LB 1U48A 2VKRA 2VF3A 4J37A 5KFIA 3TAMB 1QDUB 4LF6J 3MMAA 4DV6F 4YR2A 4DR7J 2KT3A 3SFGA 3PHTA 1F9EB 4KFBA 1C4CA 2COLA 1ZYQA 2VONA 1VQ9S 4IG3A 2X1FA 3CJ4A 5DDOC 3R5BA 2DCUB 3PEHA 4GVBB 2LDYA 1S1WA 2NZCA 1JWWA 2ZVIA 3LAMA 3G6VA 1KHWA 2OJ3A 1V3SA 3PYGA 1L3KA 1JLEB 4I1TA 5A8KA 1REVB 2HMIA 4H4MB 5HBMA 3V4MA 3MR2A 2HSEB 1MWYA 2ALZA 2R2TA 1HWIA 1Q8BA 2DD8S 1PBAA 4F4XA 3NS6A 3B54A 1XN9A 1JLFA 3DRRB 1G4CA 4Z37A 4H4KA 4RW9B 3V2UC 1Y11A 2M70A 3VZIA 3DLEB 2DK2A 4JI2F 2IRXA 4QYZJ 5HLFB 3ADAC 4M5DB 4PZVA 3QT7A 3H5XA 5MAOA 3IRXA 3FSXA 1YRTA 1R0CB 3CMQA 1FFGB 1RYSA 3DNCA 2HHQA 2BQRA 1W2BR 1U2FA 2J8AA 5KFOA 3BGRB 1LFWA 4QW9A 2QA1A 1CS4A 2EG1A 3K89A 1FA0A 4Q45A 1KOOA 4J9MA 5KAKA 1X4FA 1F9FA 4BLGA 1RU1A 3UDLA 1FKPB 5CCMA 1S72S 4BC9A 2BE2B 2E5GA 4JI5F 4NLDA 2Y1RI 2DNOA 4Z7CA 4N8NA 4DDFA 1AZSB 2BMBA 1JLEA 2H4YB 4J9VA 1B7YB 3HSJA 2PGCA 5KFSA 1K8AT 1F9HA 3QSIA 2MZJA 3H90A 2FB0A 4DHVA 4FPRA 1RAAB 3UI3A 3CC7S 4WKYA 3KLFA 3D1OA 1NK0A 1UA0A 1I1GA 2KO1A 2BJ7A 2XMKA 2BRLA 3LP1B 3IR7B 1HNZF 3U1LA 5J2QA 1U1MA 2XO6A 2CDRB 4YB5A 3NGTA 1F3VA 1Q5YA 3CVKA 4FF1A 3QSYB 3CJKB 5SUHA 3A3NB 1FK9B 1F0XA 3M2UA 2QYGA 5GADU 3H4BA 1WTBA 2DHHA 3TJ8A 1NB7A 3MCMA 3OXLA 4DR2J 2EBGA 2ZBCA 3MMBA 3IWXA 4FYVB 3VGTA 4FNHA 2UUWA 3NWGA 1FT8A 4FP9A 1U6ZA 2V50A 3VVUA 1NKCA 2DR7A 3VAJA 3P8BB 2GC8A 4GO7X 3HK2A 1CJVA 2BW7A 1TKZA 4RPFA 2DXDA 3DU6A 2PI4A 2ZHOA 4YUDA 4QCLA 3JAMU 3KDNA 3M8SA 5LMUJ 3C15B 3W7BA 3ISND 4GO5X 4LR7A 3HVWA 3LUYA 1KRPA 1VQ7S 1VQLS 2JZ5A 1TR0A 1UP1A 1X4AA 1KFSA 4KH1B 2R7SA 4RW8B 2FY1A 3DRPB 3CCES 3KG1A 2XBPA 4X62F 2KXNB 5HQMA 4NLRA 2HEKA 1JJHA 2CJQA 3ITHB 1TUVA 1B4SA 3U1NA 3QQCD 4IKAA 5CYQB 2CQCA 3WDOA 3M6VA 4ANCA 5JVGQ 4J9KA 1C1BA 4LMZA 5HVHA 2Y8YA 2DJWA 3LP1A 5FLXU 3NL0A 4OJ1A 2DO0A 3IM8A 2KFZA 2CJKA 2MHNA 2QFIA 2DHGA 4DV2J 4RW7B 3MAHA 4PABA 5LM7E 1ZOTA 4NLVA 3CJKA 4ENOA 2R2RA 1NJXA 3QGIA 1DARA 2C3YA 1F5BA 3EJMA 2A1BA 3TARA 2B4VA 5K9FA 1JKHA 2X3DA 3BF4A 1G7CB 1QAXA 3AY0A 3FCVA 1JX4A 2CPDA 1WELA 3A1YG 2LMIA 2H5EA 3QT8A 4DV7F 1FTRA 4C8NA 4OYIA 2VC0A 2XGQA 3TA0A 3W65A 3K5OA 3MEDA 2LXFA 4MIBA 1N33J 3H5UA 3RJMB 2F4VJ 2BM1A 2GVZB 3DLKB 4KHMA 4IRKA 2V94A 1FD8A 2FGCA 2WVBA 5KFBA 1WEYA 1U1KA 3W66A 3AHPA 1DAXA 1NSKL 1ZTWA 1XNRJ 1FE4A 1C0UB 1J27A 1S10A 4LF4J 1NRKA 1H98A 3JSBA 3H5YA 3GWCA 4NX9A 3A4TA 4L76A 1RHMB 3BREA 4N8OA 4IO1A 4LF6F 3Q83A 2HHHJ 1OY6A 3SYZA 4DPYA 3OHBA 4DR7F 4WXWA 3PRBA 1GMWD 4X4NA 2WSCC 1QVGR 3SDEB 4WF9Q 5A0YB 2IMWP 4DL2A 3CD5A 3DOMA 2F7VA 5LSLA 2PFFB 3IRWP 4LRFA 1M1KT 3R2CJ 3OVSA 1SQFA 1WOOA 2ROEA 4P52A 3FNNA 2B9XA 2Y1IA 3CJ0A 4TYAA 1I51B 5K8MA 3E8OA 1XQIA 3PG9A 3C14B 1VBZA 3CCTA 1URNA 4KRWA 1EJ7L 5LXYA 4OZLA 4KQZA 4NXMJ 4J9RA 2QJ3A 4GRSA 3OLBA 4HH1A 3CD0A 3SQGB 1K1SA 2V8PA 5HJYA 2GVZA 2VOOA 3DLKA 2KJWA 5DDRC 2YNIB 1Q5VA 2XZDB 4OZ3A 2W4PA 4L3NA 4ZIVA 2H5JB 2OUGA 4O23A 5H1SV 1RAFB 2B5JA 3N5BA 2YKNB 5CQGA 2MTLA 2GAHC 3DFEA 3P3DA 2HHVA 5B0DA 5AE1A 1NJWA 1HBUB 1XMOJ 2HYIB 4I67A 3UPFA 5CXTA 3PFOA 2KDOA 4QPXA 3DOLA 1TL3B 4ZVGA 1VOMA 4UZBA 1TKTA 1PYTA 4A8YA 3FQLA 2NXUA 2GV1A 3SDEA 1WSRA 1HBMB 3C16A 1K44A 4ZJOA 3J7AN 2QSFA 1YIJS 1S1XB 4UW2A 1VQOS 2IM0A 3ETMA 2DITA 2RKIB 2HZAA 3H20A 3ZZRA 2YWWA 3TZYA 1KN6A 3Q86A 4ED2A 1VQPS 2GAGC 4MK8A 4YY3J 2PIIA 5K14A 4O0NA 1XIQA 1HHTP 4NWBA 3UNGC 4DQSA 4FF4A 3MPUB 2B6AB 2KT5A 1SJ1A 3MR5A 4OMFG 1TUGB 2EC0A 1O0PA 1IR1A 3DMJB 3VQTA 1S9EB 3QAUA 1WOPA 1RT5A 2YNIA 4IYQA 3F44A 4LVNP 3L3CA 2A18A 3IXQA 1N6QB 1PAEX 2FHOB 2OH2A 2I5JB 4DL0C 1F60B 4MFBA 1NXIA 5AXMA 1SPBP 4C8ZA 1CQMA 3KLGB 2NPIA 4ZVUB 2YKNA 3JAMY 3EGWB 3NP5A 4DR2F 5KT5A 3LP2A 1SJFA 1UEVA 3Q8VA 2OMOA 3EDQB 3D6FB 3CF5Q 4OI6A 3LTOA 1ZM3A 4H4OB 1D0EA 1T03A 1O8BA 1S59A 3O44A 1M5VC 2MQ8A 1SKSA 1LWFB 4TLQA 2A2CA 2OPSB 2HHSA 1FO1A 2W8KA 5LMUF 4LSNB 2DH9A 4FF3A 2RRNA 3L4BC 1RYRA 5G0RA 5KG1A 1S1XA 3QMQA 5DJBA 2C2ZB 2RKIA 2YKAA 2UXDJ 2D3ZA 4Y6IA 4QYRA 4DR1J 1D9AA 4RU2A 2P2CB 5IQ6A 5CCLA 2Z56B 3UFCX 3M9MB 3D3CJ 2B6AA 2DR5A 4DI6A 1HMVA 2FVSA 4EZ6A 4C3LA 2QLFB 3EXYA 4DV2F 3GPAA 4EYHB 1T95A 3EGVA 2MMYA 1LNQA 1X9MA 3UD4P 1RWPB 3TI0A 4I6WA 2I5JA 3Q8RB 1O6XA 5GAGI 1U1RA 2M2BA 2YPYA 3UCUP 1XMBA 3VV2B 1HBNA 4E8UA 2B7CB 4KYZA 1SC6A 3AD7C 2QE5A 4C11B 3TEGA 1JJ2R 4A46A 2D69A 5D4PA 2YWFA 1H0HB 1YZ7A 3QIPA 3BS9A 4ZPCA 4RNFA 2XY6A 1N33F 2D7SA 2YXLA 2F4VF 3A8EA 3JYTB 2GVDA 2NCKL 2XHWA 3RW7A 1DBDA 1EAYC 2OPSA 3MAAB 2A2DA 3N79A 2E9TA 3H4DA 5J1PA 3ETOA 4CM2A 4BWJA 3PJXA 1RQ0A 3GFYA 3DN9A 1XNRF 3O8WA 2JLEA 2WBMA 3HMJG 3OFHA 4OHXA 4QR1A 4LF4F 2HRTA 3M8RA 3AD8C 2N3LA 4HKQA 2FLLA 4QIEA 2V0NA 2FVQA 2HHHF 5F3ZA 3T3FA 4E0DA 5E3QA 1NDPA 5LJ3Y 2UV8G 5EGYA 2MQOA 5KFGA 4I0WA 3KXDA 4OHYA 5ETVA 5BYSA 4CLUA 1GMWA 1S48A 5ETMA 3M2VA 1FESA 3KJVB 4LRAA 4F8RA 3HD1A 1T9WA 1FRIA 2VDIA 3E2EA 5ADZA 3KHRA 2NYHA 1M1HA 3VAHA 1VR6A 1EETA 1TV6B 5KFKA 2QFJA 1NLKL 4WU3A 1RT3A 2FHKA 3KNAA 2VG6A 2MZQA 1FXLA 2V9KA 3HD2A 4O0IA 4KAIA 2Q1LA 4NCGA 2YTCA 1FRLA 4RUCA 4ZVSB 4C11A 1HD0A 1HI0P 1LXNA 4NXMF 2MZRA 2BW2A 3BKFA 2YNHB 3M8YA 1H2VZ 3SIPB 3JSRA 1RJJA 1GEHA 3ET6A 3K5MA 1CJUB 5HMZA 1N0UA 2WCXA 4UOHA 1YI2S 1RBOB 1M5HA 2C2KB 3HKWA 2DNPA 4MKYA 2AYGA 2JWNA 2EW9A 2AZ1A 3DKDA 1D9DA 3KHGA 2OPRB 2FHJD 5KFRA 2IRYA 3M6UA 1G2EA 4ZPVR 1V9OA 1O5JA 3HULA 3POTA 2VODA 3JTOA 3MM6A 4KGZB 4DSKA 3EICA 4Q44A 1NNDA 4M5MA 3O3LA 2MLXA 4ED3A 4C7QA 1MU2B 3QZ8A 1PC5A 1WHXA 2BA9A 1FWPA 4DSIA 3K8WA 1TV6A 2MKIA 3B82A 3KK3B 2FVCA 4DF8A 4I7FA 4YY3F 1T8EA 1IKWB 2VHGA 3OR1A 5KFTA 3AOCA 4I6AA 4LFAJ 4ZK7M 3PDNA 2FQQB 4DZ6A 4IO9Q 2YNHA 2LEBA 7FDRA 2AV5A 2X51A 3BR8A 3I0SB 3O5TB 3EZOA 3L09A 5GAEU 4DLEA 4DL3A 2CZ4A 3J81j 2CQDA 2GW8A 5F8GA 4YDXA 1OYDA 4DWIA 1U0HA 4ZVFA 3BEGB 4FKYA 4JI7J 2V2VA 3K5LA 1FWLA 1TL5A 3AD9C 5EHHA 2OPRA 1Q86T 3PM9A 3NGRA 4OYXA 2CPEA 4KY3A 4DR5J 4IG0B 1RT6B 2I9SA 2LYVA 3G82B 1C4AA 3DLGA 1SC3B 4AD6A 2BE7D 1JK9B 2KZMA 4QIGA 1U1LA 4QU7A 2A0FB 2MLYA 3WC2A 4OZ0A 4LR9A 5E3CA 3O2IA 2V4RA 4B3OB 2BEFA 2XSJB 3U1MA 2B8QA 4LUBA 5C42B 4I56A 4YQWA 2JH3A 1UPMB 2V67A 2XNQA 2BR0A 1YRUA 1RWVB 1IBCB 2KG1A 4NLUA 2UXDF 3S1TA 3H5SA 5IT9U 4ZHRA 3CMAS 2CDQA 3RB6A 3FSIA 4DR1F 5CYMB 3HSGA 4KH0B 2RF2A 4ZMMA 3HHLD 3DDNA 2QIFA 4LR8A 3I9V9 2YQ1A 5IZHA 3T5LA 3BYRA 5L9NA 4KR0B 3MHYA 2D74B 3C6TA 2A6OA 1FRMA 1WHVA 2MY8A 3GIKA 1F2GA 1HNVB 1HI1A 1B0PA 4ECWA 4JBCA 1ZA1B 1H7WA 2R9LA 4K7QA 4H4KC 4Y2CA 3JTNA 2AF6A 2HQ3A 4ICLA 3FZ2A 3P45B 4A8QA 3D54A 4N5SA 2O5DA 3MECB 1R8CA 2OSRA 5LSRA 1R6VA 3EXCX 3ULHA 4IG0A 1JMTA 4DUZJ 2BKOA 3D67A 5DDPC 3R6LB 2BZ2A 2AJQA 2MKCA 4OI4A 2IM2A 2J5AA 3CW2C 2XI2A 3CJ2A 4HHHA 1LWCB 5GMEA 4OYOA 4Z7YA 1JLQB 5J2NB 1FDBA 3D68A 4RWXA 2FLPA 1DFDA 3D1QA 2AZ3A 3MAQA 2QZ8A 4J5OA 2LQ9A 5DO2A 3QT6A 3Q8PB 3GJRB 4USTA 1Q82T 1FEEA 5E41A 1NSAA 4IFVA 2E5JA 3TRGA 4ZPDA 3VVTA 3V4IB 3GR0A 3Q89A 1M5SA 4LIRA 2G4BA 4N41A 2FZGB 3BN4A 3I55S 2XMVA 3PEJA 3ILIA 4FPIA 2F40A 5KT7A 2VG5B 1X5SA 4HLBA 3BO3A 1RXOB 4ETXA 2KM8C 3HFZB 1FDNA 1ZPVA 2QMUB 2V8GA 1S7HA 3PW5A 1U26A 2LQ8A 1S99A 4PXCA 1JLBB 2QA2A 2VFVA 3SBMA 2IA0A 2HWIA 2EKNA 3GTYX 2XI3A 3K59A 4L72B 5M2PA 4TVAB 4EK2A 3DRSA 3MEEA 3KKFA 5B0GA 4J91A 3D6MB 2DNQA 2Y3YA 3CO9A 2DR9A 3FGVA 3EVWA 5A2QU 3WX4A 3K0JA 3SSSA 4CLPA 1R3NA 2HNDB 2GGPA 3FMWA 1IKVB 4ZIWA 4OX9J 3ZZZA 3PW7A 2MSSA 5AXLA 4LVOP 2BJEA 4S0MA 2PSZA 4F36A 2W9CB 4OLOA 2DGQA 1UZDA 2R7WA 2LEAA 1NU4A 3P96A 1TAQA 2K7JA 1VHIA 1CULA 3ILLA 4LQ9A 4FF2A 3GCWP 3SXLA 4PRFA 2KVQE 5C25A 4LRDA 2FIUA 2N82B 5B08A 5J2NA 4DPOA 2EWHA 2XZTB 3CJ5A 1J5OB 3DLLQ 1IKYA 1V5VA 5HAOA 3EVMA 3IFEA 3GJSB 4NEZA 1U47A 4DFMA 1HLWA 4MYTA 4AL7A 1NO8A 2FHJA 1TAUA 2ADBA 2IA6A 2BANA 3M8ZA 5KFFA 4YEAA 4CO4A 3AOAA 3R9LA 1Y10A 1DZ5A 3RB0A 1YJWS 4P7TA 3QRPA 2FJEB 4DCOB 4BWMA 1FFSB 2GIFA 4K4XA 2Z2LA 1N5TA 3IGNA 3GFXA 4NZ6A 2Z30B 4LF1A 4YP3A 1NK7A 1FKAF 2HRUA 3Q8SB 2JFKA 2MSTA 1FRXA 5H9EJ 1KWMA 1UJ6A 5HROB 4IR9A 2AW0A 3NEKA 3I87A 3OXFA 2UUCJ 4ZITA 2I1RA 1X7VA 3RZAA 1FWKA 4G3IA 1UWAA 3OL7A 1LK7A 2F5GA 2MZSA 4MMOA 1RKJA 1VIOA 3R8YA 4O3QA 2V6AA 1NH7A 5LXRA 4LFAF 4KT0C 1IJEB 3BDEA 3BPSP 4UUXA 3R5AA 5KG6A 4K4UA 1S1UB 3VAFA 1BMQB 3VAGA 3BDPA 2IJFA 4KKOA 4MIAA 3UVJA 3H59A 5D4NA 3CB4A 3R5JB 4UUWA 1RADB 2ROPA 1VBXA 3CNQP 2WBRA 3QWUA 2BUNA 2ZE2B 2OIHA 3BBCA 3HHKA 1VQSA 4JI7F 3PYEA 2RRBA 4PCQA 5DLGA 2B56A 1R8PA 2RVJA 1CJTA 4IQXA 1T9VA 1NHUA 3DLBA 3E3XA 3M9NB 1PSDA 5DG8A 4DR5F 2VIHA 4BS2A 2M3DA 3S01A 3PHEA 4DF4A 1T94A 3R5DA 5D78A 2GQ2A 1NK5A 5IT9Y 3IM9A 1HFEL 3RBEA 1WTFA 3PO5A 4OHZA 3R6GB 3MM8B 3HCXA 4TLRA 4ZCKA 3MMCA 4NA2A 5F8LA 4USJC 1PYOB 2ZDOA 4XK8C 3HO1A 1RAEB 1TTHB 3OR2B 4USMA 4NLOA 1Q7LB 5C24B 1S0OA 1WC5A 3CEDA 1JLGB 4WIIA 5I3UB 2IDEA 4EEYA 3C8YA 3SFUA 5IM0A 3PX6A 4ETZA 1MMNA 3TVKA 3AQOA 3M8WA 1S6QB 4DL7A 1VHFA 5EWFA 4C8MA 2WONB 3HHLA 2IJRA 3PRVA 4KGKA 1WD6A 4ED0A 4G1QA 1S6PB 3M8QA 2PT0A 9ATCB 4RR5A 1FVQA 4DQRA 2QLXA 1TL1A 2DISA 1Q78A 1NPPA 2VBZA 4WE1B 4ZCIA 2UUTA 3LPEA 4LF2A 4WBFA 1ELOA 4ZA1A 1HBOB 2OD4A 3OTBA 2WRMA 4C6AA 2ZE2A 1H73A 1IN0A 1PIEA 2GFFA 4P2FA 3NLCA 1Q53A 2OPQB 5THWA 3TVZA 2MEWA 4EFAC 4QR0A 3RYLA 4JI6J 1QTMA 2AU0A 1QSYA 5F9LA 1T05B 4DUZF 2GJIA 4I64A 3K5NA 3ZTRA 2DR8A 4B9NA 1A0OB 3EZ5A 4KGVB 3M2RB 1HI8A 4C8LA 5BR8J 1VC0A 4C4WA 1DTTA 1TL4A 4DG1B 3LP0A 1GMUA 3BGOP 4H54A 2ZOFA 2QG9B 2LDIA 5F0WA 3I31A 4LF5J 1KEKA 4RL1A 4DU8A 4K59A 4OV1A 4D3GA 3CSKA 3OR2A 2FDNA 2JLGA 3D66A 3UR0A 1OSDA 1CC7A 3DDIA 3BGLA 2ILYA 2QYCA 2HAFA 2HLUA 1QY7A 1ACMB 1KQKA 1WNEA 1WG5A 2CPHA 1SJRA 3IP0A 2ZH4A 2CXEA 5EN1A 5D4OA 2HFSA 1IBLJ 3TO8A 3FZBA 1HYSB 4U7UK 1E6VB 2L08A 1DTQA 4J9UE 3F73A 1EARA 5ETOA 3G8SA 3AA9A 2HHPA 5A2QY 4F4YA 1BQMA 3GCXP 3OTOJ 3L7OA 2OELA 1I5OB 1TP7A 1RHKB 2CIMA 4JI0J 2IMOA 4YMEA 2CQHA 2BBEA 4DV0J 4AL5A 3JSMB 1S0MA 3R7NB 2X3GA 3TJAA 4OYPA 1XMQJ 2FLNA 1SQEA 3H42A 2UVWA 1FNXH 5B7WA 2ZBQA 4PG7A 3UDVA 4DFKA 4BDPA 1QE1A 4Q7AA 3QFWA 3T1YJ 2NUUG 1B0TA 4M8LA 4ZVTB 3MPWA 4OX9F 4X65J 1FKOA 1GMVA 2QN6B 1TK5A 3I56S 2P8IA 4P75A 2XS2A 3SV4A 3CD7A 2MQQA 4DG1A 1Q8KA 4OZ5A 1KNZA 3CCMS 1HPZB 4R25A 2XYPB 1U8SA 3CJRA 4P71A 2JRSA 1OPZA 4AXIA 2BJ3A 1RT1B 2DKOB 1HNWJ 4YB1P 1S1TB 5ETNA 3M1VA 4KPYA 4ES2A 3RU0A 1SL2A 1RAJA 3RUBL 2WAQD 3W63A 2RMLA 3N0VA 2NXEA 2E29A 4I2PA 1TMJA 3ISNC 4X84A 1N88A 2M0GB 5B09A 2Q6CA 3PW2A 2QL9B 2XEXA 3M8PB 3A3PB 2GIQA 4PQUB 3AJDA 1S7IA 2B3TB 2WOMB 3CD6S 5KG0A 1YJ9S 4F0MA 1LEOA 2CVEA 1D8ZA 3DM2B 4CTAA 2K3IA 4G1IA 4G6VB 2ACYA 1RT4B 2UUCF 3R27A 2Q3PA 4TY8A 5F8JA 3M32B 2DNHA 1AFJA 1VRTB 2M8DB 2XWYA 2F8HA 3GLJA 1IKXA 5KFNA 2E7XA 1XBWA 3A13A 2POKA 5D3GA 1ZM9A 5ITHA 3UDCA 4DEZA 3AXKA 4OZNA 2HBZB 5F9NA 1I94J 2VV5A 2P9CA 1D09B 2XS7A 2BE9B 3W2WB 1LW2A 5FJ4A 5IC6B 4Z2XA 3G6XA 2IC3B 5J2MB 3H2LA 2GMJA 3G2XA 3I82A 3MUTP 4XIUA 4XAKA 3NMRA 1S0VA 3CIZA 1S1TA 8ATCB 4QU6A 2ROGA 3Q8QB 3UN2A 4L3KA 4I69A 4B9LA 3KLEA 1ZAVA 1UPPA 1FXRA 1TK8A 5ETQA 3VZHA 5K20B 4IH5A 4JI4J 5C5JA 4DQQA 2HLTA 1TFWA 1X9SA 3BQ0A 4K0KJ 2CJ9A 2PMZD 1U4BA 2GMLA 5CZXA 1P9YA 3HKZD 4O44B 4WJBA 2WOMA 1R8HA 4EYIB 2HQFA 2JL9A 3TEHB 2EFVA 2Q79A 4D3HA 2XQCA 4ZPTR 4Q8FA 1SH2A 4GC7A 5E3RA 4AUKA 1HNXJ 2R7OA 2RUSA 2B9YA 4NLQA 2MGZA 1LK5A 2PMHA 1P9QC 5A8WA 3MWBA 4RWWA 5J1NA 1JLCB 1D9FA 1JXVA 4DPWA 2DPIA 4QWAA 2DGWA 4KO0B 4ZCMA 3NG8A 2JC0A 1VBKA 5D0GA 1WI8A 1WACA 4PUOB 1Q0NA 5KFYA 2IC3A 4GC6A 5KFWA 3K58A 2H48B 3EUNA 1VYAA 3KK1B 4B3RJ 4UOCA 4C8YA 3W2VB 2AGPA 1T0TV 3PNIA 3QFHA 2AGOA 4ELTA 2Q6BA 4JI6F 2HGMA 4PWUA 3W62A 4CH7A 2FVPA 1ZAXA 1E6YB 1Z2ZA 2JX2A 2MB0B 2QEXS 2BKNA 4Q2LA 4RNOA 3THTA 2E66A 2L9DA 4ZVEA 1CLFA 1FCAA 5BR8F 1N54B 5KT4A 1AFIA 2IAJA 3CCUS 2OTJS 4JYAJ 3NCRA 3O1LA 4LF5F 3NMAA 3MCOA 5F8NA 2K3KA 1CJKB 2IPOB 3CJ3A 2LVWA 5KFUA 4CO3A 4WWSA 1RTDB 4CLWA 2XWXA 5IT0A 1RT7B 3VR1A 2DEIA 2RUGA 1TKXB 3MZIA 5HATA 4PR6A 1UKUA 2XS5A 3S7RA 3E51A 2WB1D 4FVCA 5GAHU 1SCJB 4YFUA 2YH1A 4NZ0A 4ZCLA 1JLCA 2NLWA 5HMXA 1VRUA 5IXUA 4P7VA 1IBLF 3RB3A 4KO0A 3TNVA 5KG2A 1DLOA 2OPPA 5DM7Q 2KI2A 3MDFA 1U1PA 5HO4A 4ZP8A 3UW1A 3Q24A 1FERA 3UN3A 2KHCA 4PUOA 1CEZA 3M7VA 3OTOF 2KG0A 4B9UA 3CJTA 3DCAA 1X8DA 4JI0F 4J9LA 2OGUA 5IOLA 2E1PA 3OUYB 3FUYA 1JB0C 2V4JB 4DV0F 1T3NA 3Q23A 4ALZA 4ZLLA 1NMEB 1XK8A 4J90A 1ZBTA 1XMQF 4R5PB 2N7YA 1UCNA 3W2VA 5KFAA 1SKWA 2MLZA 3CDAA 2O67A 3I0RA 1S1VB 1ICEB 3T1YF 1EP4B 2D9OA 2F65A 1WKLA 4RBVA 1OJ4A 4X65F 4MKBA 1L3VA 2CNOB 3P6YC 3WZ0A 3AXMA 4DFJA 3DRYA 4I2QB 2DPJA 4PG8A 4ED5A 1SXLA 3HVTA 1YKWA 4Y00A 3CCZA 2GHVC 1H72C 3G4SS 2EFPA 3T6BA 2KRBA 3IS9B 2MQMA 1X5TA 3I4PA 1HNWF 1LWEA 1Y3JA 2XMTA 3TUJC 3ZNUA 2KL8A 3FEXB 4EO6A 4ZDNA 1VJQA 4X4UA 4IOAQ 1YRXA 3ENWA 4ILMA 1TKXA 4CRJA 3HX9A 2MKKA 2CQGA 5ETSA 3SMZA 4OYWA 3BM7A 3Q8YA 4WTYA 2HNZA 4IQMA 5BYQA 4R0EA 2R7XA 3TVYA 4KPCA 1O51A 1N4LA 2M9KA 4PXBA 3CXCR 2X1AA 3FFIA 2WW4A 3QLHA 2W9BB 7FD1A 5T41A 1MLAA 3CMES 3HJFA 4X4RA 4LSLA 1RHJB 4EI2A 4JV0A 2BOPA 3I96A 5BJRA 3GMGA 1BGXT 2OEJA 1P6TA 2HVIA 4DV1J 1SV5A 2DYAA 1RDRA 2JVRA 1RTHB 5I42A 2DXEA 2W2OP 4ITSA 4U95A 2W8LA 4RZRA 2PE8A 4FBTA 3LO3A 3IC1A 1RTIB 1SUQA 1WG1A 2M8HA 2RHQB 4ELVA 4P72A 1I94F 1W26A 2FD2A 4MIWA 1QJHA 4I2QA 4OL8A 3IGVA 1VI7A 5KG3A 1SJQA 1KLMB 2YBVA 1TU0B 3HVAA 3DYAB 3IS9A 4O4GB 5B0AA 2ZH1A 2K1RB 3E01A 2H9ZA 5E33A 4TU9A 3V6DB 1OS5A 4FBUA 1LXJA 3ZXWA 1XC9A 2ZH3A 1HQEB 4JI4F 3ZZPA 2VUGA 4ZP7A 4IFYA 3TAQA 2W7OA 1A9NB 4USVA 4K0KF 1CG2A 4R8UA 2WHOA 4RUAA 4OJGA 4YS2A 1R0AA 4ID5A 3OJSA 3JQJA 4CO5A 2ZD1A 1OSCA 1R43A 2QTWA 3ZZUA 3PZPA 1N8RT 1AROP 3GILA 3B8HA 4P2SA 4RW6A 4Q0BB 1HNXF 2DY9A 2OD6A 4DS5A 1F5AA 4NLXA 3PCOB 1XR5A 2NXJA 2EPIA 1RWMB 4B9MA 2NPFA 4TKTA 1U0SA 1RTHA 2ZNYA 5HMWA 5T7LA 5KFXA 2WK4A 4TY9A 3AH6A 3TAMA 1R6YA 2IRUA 4DL6A 4KE5A 2AJ0A 2W1BA 3K8VA 2HIYA 2ZWOA 1Y7PA 3OFGA 3LW5C 1UVMA 2CQ0A 4K5RA 2XO7A 2HVHA 4IH7A 2ZC3A 2DHAA 4OYMA 1VLOA 5L8RC 2G2ZA 4B3RF 1YJ7A 4GVBA 4JV1A 4DS4A 4X4SA 2OLWA 2CKWA 1Q16B 2OKQA 3FVYA 4KV8B 2DGXA 2HNYB 4P2MA 3W9JA 3JB9k 1S9GB 4LQ3A 4YB7A 1REVA 4DV5J 3V6DA 4EZ9A 1S4EA 1RT2B 4H4MA 4NPOA 3HFVA 2P9EA 4N47A 3NKYA 2MDAA 1TL7B 1AUSL 4M5IA 3H8YA 1RWXB 2PI5A 3KUHA 3T1AA 2EXUA 3PY8A 2VJUA 4J9SA 3LA0A 3KUEA 3DRRA 1OYEA 3QATA 1F5CA 5H9FK 1JIHA 4JYAF 2R2UA 2M4MA 4RW9A 3OL9A 4ZJLA 4NLPA 3CDEA 4CT9A 1U7LA 2ZNZA 5DQGA 1RABB 1RCXB 3DLEA 4DR4J 1OIAA 1VIXA 2C1EB 5I3QA 2EFOA 5HLFA 4M5DA 4DUYJ 4NLYA 1PJ7A 1UL3A 3FCWA 3EYZA 2NS1B 1T11A 1FRJA 4JI8J 2VFTA 1SL0A 2GMHA 3SQOP 2OEMA 2ZDPA 5C7PA 1YK9A 3B78A 1W2IA 5DZ7A 6FD1A 3R7BB 5I3PA 3BGRA 1N5VA 5GMKa 4HT5A 4DX6A 2VOPA 3DGPB 3SCJE 2DNNA 2C22A 2XLJA 3THPA 4QWCA 2KYXA 4MAKA 1WF2A 4IR1A 1FX2A 4CZCA 5GVQA 3QNWB 2ZH7A 4M94A 1FKPA 3HZEA 2FPHX 2U1AA 2BE2A 2V68A 3MEKA 1IQZA 2YQ3A 3CCVS 3GR1A 1CQNA 3W1YC 2HNYA 5JJBA 1AZSA 3CC2S 3MM9B 3LPYA 2RQMA 3KG0A 4CH0S 4XPEA 5F8IA 4BC7A 1TL7A 5BYRA 4HHJA 2DH8A 3KG4A 1T3OA 4CLKA 1ULRA 1PILA 4P6QA 2DR6A 2FUG9 1UJ4A 1F2HA 1BWVA 5EX0A 3CCLS 4OJ3A 1N5YB 4RNMA 1DQ9A 3SV3A 3DRXA 5K8NA 1U2CA 3A8KA 1YBAA 2E44A 2ACMA 1WKKA 2WSFC 2Q43A 3K2YA 1FK9A 2FJBB 3N01A 4KBIA 3ENVA 3NS7B 2MJUA 5KG5A 4AL6A 3ZNJ1 2LA4A 3D0GE 1U6BA 2RQKA 1V3RA 4KJIA 2ZHAA 4A8MP 6FDRA 2F8MA 2KN4A 3EX7B 1U09A 1TQLA 3T6JA 3DC2A 3C19A 4DLGA 3DLJA 3G8TA 3W9HA 3GZ7A 3GSIA 5CD4A 4NI2B 2OFHX 3FMBA 4WP9A 3ZZYA 2X7IA 2R7VA 5HL7Q 5DDQC 1OY8A 4CLSA 5IV3A 2MYFA 1RA7A 2YVSA 1ZM2A 3X3UA 3UE2A 2MQLA 4LF8J 3KYLA 2GNKA 3C15A 1LQ9A 3KK2B 4LFCJ 4DV1F 3MM5B 4YR0A 3IWNC 3I4HX 3R5CA 4ZVHA 1RISA 2IVYA 4ED8A 3GIJA 4RW8A 2KH9A 3DRPA 3C66A 3LAKA 2UXCJ 2JLFA 2UU9J 4I6YA 1UVLA 3QIDA 3H7HB 3ITHA 1S77D 2JEFA 4CYUB 4FS2A 5CYQA 4DV3J 1RWUA 3FBCA 4X64J 3EVOA 3TP2A 4JI3J 3G6YA 2DGUA 1TZ0A 3OJUA 2XZWA 3R1LA 1NJYA 4DCJB 2D41A 2IHR1 2P6SA 4RW7A 2K8GA 4RNHA 2KYZA 4X4VA 3ZO7A 1KR4A 2XB2D 2HBYB 4ZLJA 2ZOMA 2QMWA 2CA9A 1YJVA 3DI6B 2UVVA 6AT1B 2XM3A 2W7PA 4CH1A 2YNGB 3PIOQ 3OFEA 1DJ0A 4B17A 2VH7A 4DXLA 1UW4A 4OX8A 2YKPA 2B7BB 1JLAB 3BB5A 1U25A 1TUWA 5KFCA 2WZ1A 2JEJA 4M5HA 2MQPA 2QLWA 3EMTA 1UVJA 5RUBA 4USHA 1UETA 5J1EB 1WHYA 4J9QA 1UWBB 2AJFE 1QAYA 2UZAA 3D9BA 3KLHB 4WZQA 4DX7A 1NSPA 3BV8A 4P9SA 3KK2A 1SC4B 3T1HJ 2XMWA 1VQ6S 3W60A 1UAWA 1TFYA 4ATNA 3MPVA 1C0UA 2J7KA 2ZBPA 4KHPJ 4JP8A 4DSEA 4XTTA 2DHSA 2VDHA 4PWWA 3QJPA 3C6UB 2VPZB 4CYUA 5GAEI 3NGDA 1Q8LA 1APSA 3US5A 2MXYA 2LKZA 4C0OC 4HDGA 2YNFB 4K8RA 3ILJA 4O3PA 1XERA 1Q95G 4RUBA 4NMLA 2EBEA 5A0YA 1BLUA 2VA2A 3IO1A 4U67Q 3Q0AA 4ED6A 2G2OA 2GA7A 1KLNA 1WDDA 2EFQA 4O3OA 2BX6A 4M5LA 4RW4B 3P5TL 1WC1A 4DV5F 4U7UD 2CG4A 3AFGA 4QWBA 1UTAA 3AODA 2DTJA 3J80U 3C14A 5HN0A 3FEYB 4NXNJ 1NZ8A 1RWNB 4TN2A 1WKJA 4CO2A 3W8GA 1SBRA 4ANDA 1T9TA 3I5AA 2AP6A 4X4TA 4LIWA 2BVZA 4P73A 3RRKA 3MI7X 3SQGA 1UEUA 3VCDA 5KFMA 4OI0A 2KKHA 4DR4F 4Y2MA 1S76D 2CJAA 2J7UA 4DUYF 2M7SA 5J1EA 3AOBA 2ZH6A 1N5SA 1EIYB 4KSEB 2OSQA 2RS8A 4HHUA 3D0HE 4JI8F 2CJXB 3M6XA 4WFZA 1GFWB 4O3SA 3ZZTA 2WVCA 1S9FA 2ZBIA 1NH8A 1N56A 3N6LA 1HBUA 3EM1A 4X4QA 2G1DA 2RILA 4OZJA 2OI2A 5EX3A 2QL5B 4JV2A 5E7OB 2AYEA 3WBZA 3JQMA 4PYDA 1VCTA 3R1HA 1TL3A 1HQUB 2G9OA 3W64A 2JEGA 2YNFA 3ZZOA 2XMUA 1MMLA 3MURP 1HBMA 1VQ8S 1RACB 2WVFA 4GVLA 2BKPA 5FLXY 2AJ1A 4HYKA 3CC4S 4KGXB 3DXBA 5A6WA 2XYHB 1BWEA 1YDLA 2ZH9A 4UY8T 1ZA2B 2RD5C 4F2SA 2FYXA 4K4SA 1NKBA 1MROB 4IRDA 2AX1A 2YKMB 4E2FB 2DEJA 2VPYB 3F41A 2ASDA 1RBLA 1X5PA 3N4WA 4IDKB 1LV5A 2XNRA 1C0TB 3RB4A 5CYJA 3MUMP 3G71S 2I38A 2CNNB 3D3BJ 5HP1B 1TKDA 2V2KA 1F6TA 3RR8A 4LBHA 2C42A 2ZVSA 4Y28C 3DMJA 1M90T 4CNZA 1HNIB 1S9EA 1NDCA 1RAGB 2HFVA 2Y0SD 3FBFA 3CWJA 3GIRA 1FTCA 2HVEA 2DIUA 1N6QA 4RJVA 5SZTA 3NBPB 4DN0A 1S6UA 1PCAA 3T41A 1LKZA 4OV6A 3FQKA 1S5ZA 3KLGA 4RKUC 2IYGA 4PG6A 1KTQA 3GYXB 3MFIA 2H1YA 2JFDA 4B3TJ 2VFRA 3JXOA 3MMAB 2KFYA 4JB8B 2IVMA 2ZC4A 3EGNA 1Q1KA 3BSCA 1LFPA 1RHQB 4P74A 2L41A 4N56A 4KFBB 4M95A 4H4OA 3MTKA 1B70B 2DGOA 4IG3B 1LWFA 3HDSA 3AQPA 1DHMA 4HACB 1S1WB 2AYMA 4LF8F 1RZMA 3OSPA 2Z2YB 5F8HA 3BPDA 3CT9A 4LSNA 2ZKUA 4LFCF 1NCLA 2R8HA 5A8KB 3AT1B 2AWZA 2HMIB 1D3WA 4O4RA 5L9XA 2CQBA 5HBMB 4E98A 1KC8T 4ZKAA 3B4MA 2UXCF 1EQMA 2UU9F 3TUIC 1NEEA 1JJCB 2JHEA 4NA3A 4OYZA 4A8KA 1Y0HA 4MKAA 3UR3C 5C2CA 2DNLA 5EUHA 2CPYA 4DV3F 1C0TA 4AQYJ 5E5NA 1YQHA 3BYPA 1JLFB 1IR0A 3PR5B 2C3UA 4X64F 2V8DA 3SCIE 3MPDA 1Q7YT 2YWGA 4LF9J 4FVMA 1IQTA 3FRZA 4JI3F 1NAQA 4A8OA 4WFNQ 4PG5A 3QRRA 2ABYA 3HZGA 2KRRA 4QJVA 2RS2A 2XTJP 1U49A 2DHXA 2NQPA 3CJ8A 1MG7A 3KTQA 2LU1A 3IRXB 1VISA 3V5RA 2LQJA 3B6BA 3CGIA 4DPTA 2VZ9A 4W92B 3L95X 2Z2ZA 2CADA 2QMXA 2W4DA 3OFFA 4DBQA 1G1XA 4J9PA 1HWLA 2LEPA 2BJ9A 2V69A 3BH7B 1RGVA 2OHDA 1CS4B 5DG9A 2J0QD 2QSWA 3TA2A 4QQBA 3NS5A 1KONA 3HJVA 5AXNA 4C98A 3ZTOA 3PTWA 3I9ZA 4ZN1A 4RBUA 3JYTA 3PV8A 4U96A 3NXZA 4QOTA 1L5UA 4CCHA 3EPGA 8AT1B 2ZM6J 4NE9C 3MAAA 1YHQS 1X60A 4HACA 2JVOA 5KG7A 1PAUB 3FJ2A 2O3DA 3T1HF 5ETLA 3L9ZA 1V3ZA 1NJZA 4MKVA 2ZZTA 2IYIA 2CFXA 4KHPF 2JOQA 1TELA 3KLFB 1HARA 2R2SA 3AJ1A 3LWMA 2GO9A 2DO4A 5D15A 2KM8B 2QRRA 1U1QA 5J2QB 3RTVA 4A8FA 1IXKA 3J80Y 3BZQA 4DL4A 4CO0A 2A6MA 3G96A 3OXGA 2L9NA 1QUPA 4ZLNA 5AE2A 2XC9A 1YZ6A 3KJVA 1JJ4A 3M2UB 4OI1A 3R5GA 4ES1A 1GTEA 1YVFA 3WIUA 2DNGA 1X5OA 4RLEA 1U1OA 4UZCA 2LQ5A 2V63A 4OX6A 2UUBJ 3MMBB 2E5HA 1YJRA 5AJ3J 1KVIA 2C2OB 1V6HA 1K0TA 1G3OA 2DCLA 4NXNF 4NYPA 1JNRB 3U27A 4F0KA 4LREA 2YKOA 2MKJA 1Y5LB 4MK7A 5HANA 1CJVB 1TKZB 1FDAA 2C2EA 1X4BA 5KG4A 3NWRA 4ERDA 5D0RA 1PC4A 1YWXA 5B0FA 2LXIA 2R7QA 4DV4J 1CJUA 4FN5A 4YN3B 2CQ4A 5LL6d 1P1LA 1SL1A 4W98A 1RKIA 5CH7B 4ZVRB 4NLTA 3T9ZA 4L74A 3K5PA 5K8OA 3LALA 2LFVA 3J7YU 1XR7A 5A8RB 4F3MA 1FHTA 1FI4A 2FHMA 1NK4A 3GYNA 2PMWA 1XNQJ 3LGNA 4WFYA 3W9IA 1C1BB 2GCFA 4TQSA 4ZVQB 3OTEA 2G13A 1YBUA 3LGMA 4WTOB 3WHIA 3W5XA 1WF1A 2CYYA 2CPJA 4L75A 3R2DJ 2KJVA 3DHWC 2ZH2A 4DSLA 1YX2A 4OYAA 4F02A 5DRKA 5KFHA 2Z58B 2O01C 3UCZP 5L39A 3T19A 1MU2A 1JKHB 2HK3A 1VS3A 1DY3A 2E1RA 2Y1LB 1RTZA 2R8JA 2VA3A 2VQEJ 1DQAA 4Q5VA 1VC6A 2HBQB 4TYBA 3KK3A 2CJYB 2GIRA 3HLUA 1IKWA 2QC3A 1VMBA 3KLIB 1HR0J 4U6PA 4HI1A 3SCKE 3CUNA 3UO0A 2VD3A 1EB0A 1UFKA 3ENQA 3RAXA 3MEDB 1D8YA 3IAS9 3MEGB 1MN7A 2ZH5A 5CD4H 5EWEA 1C1CB 1UVIA 2BJ8A 3I0SA 4A48A 2NREA 2YY3A 1ZS6A 3DLHA 4F3OA 5T14A 3C2PA 2RSQA 4F25A 2MZ1A 1KOHA 2B9EA 2KFNA 3OPKA 1PYSB 3D6HB 3GV5B 3R7SB 1UVKA 3SSRA 2XY7A 1SI9A 4X4OA 3PRDA 3QWPA 3RRGA 2DB1A 1EKRA 4B3TF 5A8RA 5JMNA 3OHAA 1L3TA 5D8HB 3QGGA 1ZPWX 2ATLA 2E7WA 2E1CA 3HT3A 1IBMF 1RT6A 3GONA 1UMJA 3G82A 1XWLA 2HVDA 2XG8A 2IIHA 4ID8A 1X4HA 4U8VA 1R0BG 1NB2A 3GYGA 1Z1ZA 2VPXB 3BGFA 4U7CA 3LANA 3DOMB 4DUTA 2KZZA 3CULA 1ZAWA 4CM0A 4ECZA 3TW0A 4B3OA 2B8PA 2XSJA 2VFUA 2AHOB 5C42A 1Z4UA 2HGLA 1N52B 5DGBA 3J81U 1KDNA 2HG4A 2J0XA 3HI9A 1IBKJ 4V19J 2E1AA 3FC9A 5CYMA 3KLIA 4ZVPB 4AQYF 4HI2A 4I68A 1KP6A 4TQRA 2RQ4A 4LF9F 3S6EA 2BACA 3G8QA 4KIAA 4GKJJ 2HS0A 2G2YA 3MEGA 3AJ2A 3AB4B 3NNHA 3KHLA 3OW2R 1C1CA 4DCPB 1XTZA 1HNVA 1S57A 2FZCB 2HHTA 2HFNA 1BHNA 1EKSA 4QPTA 3G9CA 4PEOA 4ECQA 4LF7J 3FRYA 3TZZA 3MOJB 2WVEA 3ZTSA 2B5JB 3PW4A 2CVIA 2DNZA 3CDWA 5FDLB 4HTIA 1VDHA 3OT9A 2UP1A 2IBKA 2FVRA 1M1GA 3MECA 2R8KA 1UJ5A 2J9CA 3HM9A 2N4DA 3HXMA 3DOLB 1U24A 2ZZMA 2O1PA 4YHHJ 1WWHA 1TKTB 2C2DA 1UEKA 2W24A 5ETKA 2D3OR 2J6TA 3HHDA 2V8VA 4FXDA 3L7UA 5HJXA 3C16B 2ZM6F 3N6MA 4M63A 2XHCA 3U02A 2ERRA 3QRQA 3KLVA 1JXEA 3TOQA 1LWCA 2MKSA 2MPUA 2RNEA 4K50A 2N4CA 3CCRS 1JLQA 3N28A 5HVFA 2G1HA 2G0IA 1RSCA 5HQLA 4QBUA 1Q8IA 3PJ9A 5K14B 2IM3A 4U8YA 4EU0A 4WKRA 1IUJA 2M52A 4NCAA 5D6GA 2PDAA 2W2MP 3V4IA 5KFJA 1NSQA 4ED4A 2RIJA 2E9RX 1OQ3A 2F4FA 5LOQA 1EZZB 2EKYA 3K17A 4KC5A 3KUGA 1RT5B 3CIMA 2FC8A 2ALYB 1IWGA 2A10A 1KD1T 3EDRB 4F4AA 2VG5A 2V2ZA 2C3OA 2XCPA 1ZZNA 4MFBB 2XY5A 4ECVA 1JLBA 5D77A 4Y2AA 5FDLA 1ZETA 5L1JA 1BUXA 2UUBF 3KDOA 1OWXA 3LP2B 2B4UA 2ZUGA 2LQBA 4TXSA 1KBRA 2HFZA 5AJ3F 3I5BA 1U6FA 2I2YA 1FEHA 3A8IA 3RAMA 2B43A 5IC4B 1X31C 4A8SA 1BQNB 1RTJB 2R42A 1P1TA 4NASA 3HP6A 2L9WA 2YWEA 3I5CA 4RU9A 3KFWX 1T03B 5LMNJ 2HNDA 3ZFVA 1IKVA 1HWUA 2W2PP 4IOBA 5D0HA 2VFSA 4OIXA 1X4GA 3BQ2A 1NPKA 1NHVA 3FK4A 3GB0A 2W9CA 4DV4F 4F4ZA 2GJFA 4WXOA 5G0RB 3KJNB 3KNGA 3IWLA 4URGA 4ILLA 4LFBJ 3KJFB 4B9SA 2FGOA 2I8EA 4MH8A 3TZWA 2GO8A 1SKUB 3NGKA 2DT9A 1FVSA 2GHPA 1J5OA 1H3DA 3R3TA 2FC9A 5K5MA 1XNQF 2NR0A 3NGSA 3S8SA 1F3FA 2E5IA 4UQGA 1QLNA 3UD3P 2F1FA 2WSEC 3TX0A 2E9ZA 1OQ6A 1HMVB 1NDLA 1XEZA 4OHVA 2VQFJ 4C9DA 2OMLA 3MGJA 2FJDB 2JJ4D 5L1IA 3Q2TC 4Y2KA 3TA1A 1GT8A 4N76A 1W7WA 2YWKA 2ZITA 3BR9A 2J0SD 2VU5A 3RG6A 3MUVP 1MWZA 2Z4PA 4ECXA 2CQIA 2HZCA 3CDBA 4M1KA 2VQEF 4BHQA 5HROA 2H51B 1HBNB 4KGMA 1L3SA 3NOGA 1KFDA 1HR0F 8RUCA 3HFKA 2KXHA 2C2MB 5D4LA 4URQU 3QIPB 1M5PC 2IJNA 3BJYA 4MT1A 5BXIA 2D3UA 2MQNA 3ZTQA 2U2FA 4IH6A 1BQNA 1RBAA 2V5HG 4HVZA 1RTJA 4C8OA 3W61A 4ANEA 2GVDB 1S1UA 3MM7B 2UV8A 2A3JA 2YX4A 3QO9B 4BCAA 1B3TA 1FJ7A 3BSNA 5FD1A 2DBBA 4LRCA 4DX5A 5HQ8A 2HFUA 3QYYA 4PYAA 5L38A 4FYYB 7AT1B 3RGIA 2J9DE 1SIZA 2XCAA 3NGUA 4USKA 5GAHI 1XJWB 3WX8A 2DXFA 1N0VC 3GJTB 4ES3A 2EFGA 2VBXA 4CLFA 2K7KA 3J81Y 1VK3A 2PEHA 4UF4A 3L7PA 2EK6A 1VQNS 1MW7A 2RU3A 2B0GA 1GXTA 3M2VB 3PR4A 3AB2B 2C3MA 3BBBA 3MM8A 3D7SB 1NKEA 2VKZG 3RAQA 4OX7A 2IFXA 1R89A 2ZWPA 2F9JA 3CDUA 1EETB 4JV5J 3A3OB 1RT3B 3QAEA 3UQSA 4LSZB 2VG6B 1YGYA 2UXBJ 5C24A 3VHQA 2FY8A 3ZC4A 1JLGA 2NXCA 2KU7A 4WYWA 2HQIA 5I3UA 2FZKB 1IBKF 4NCGB 2XYGB 4GMKA 2EEYA 2PC6A 4AYBD 2J9DA 4ZPBA 3VTIA 3MR7A 1S6QA 2JC1A 3J7A1 2WONA 4GKJF 3Q22A 3T5KA 1S49A 2GZOA 1S6PA 3CCJS 4WFXA 1U45A 5EDWA 3MF5A 2AIRB 4U9RA 3CPWR 2E1MC 4QYZK 1KQSR 3DOKB 3ET6B 3MM7A 2IDLA 3GFZA 3O6QA 2Z2MA 3QO9A 4F0HA 1WC4A 1EHWA 1WOSA 4LF7F 3FCHA 3BO2A 4WE1A 2ASJA 2LCWA 1HWJA 1HBOA 4ZN3A 5KOXA 4TNOA 1R8AA 2L48A 4A8XA 1XR6A 2KT2A 4LBPA 4FKXA 4NLGA 2DH7A 5M2UA 5L46A 1SB6A 2OPQA 4PQAA 4WK1A 4ZVOB 3MCSA 3MCNA 4F3QA 3WIVA 1K9MT 1KVJA 1KQGB 3POTB 4YHHF 3PX4A 1T05A 2Y8WA 1S6OA 2WW8A 3MM6B 3BKTA 3MXHP 1SQGA 3M4XA 3M2RA 2FJAB 2EVZA 1IM4A 1JNZB 2ZFHA 1RLDA 1YBTA 2NUHA 4F50A 4TU7A 4USIA 4PXDA 3D0IE 1HHQA 4NEYA 5H9FJ 1RA6A 4O3NA 1M0SA 5KFVA 5ETTA 1WG4A 2YPZA 1YJNS 1UFWA 4QWDA 4C0BA 1J5EJ 4I7FB 3F56A 1RU2A 4NLWA 3RBDA 1PBUA 2J0WA 2W4CA 3OR1B 2RB7A 2HW3A 3N6NA 4NRTA 4CLYA 4QW8A 4OLPA 3WQPA 2C3PA 3B4DA 4ZPAA 1B99A 1CPZA 3CO0P 1QVFR 2GS8A 3ENAA 5KT2A 3N5FA 4EWTA 1X0PA 2HBRB 3QBCA 2LU2A 4WCEQ 1SIWB 4G65A 3KWMA 2WVDA 1CVJA 4DFPA 2HFOA 4F67A 1HYSA 4YR3A 2RU9A 1E6VA 2BRKA 3DOKA 2Q66A 1YJUA 1T9UA 3RR7A 4OI2A 3H40A 3IBCB 1U0HB 4M5JA 5KTQA 4RNNA 2IVFB 1YITS 2W7AA 3PJWA 3JTPA 3J7ZT 3JSMA 3JSYA 3RBZA 1AUDA 4ZP9A 1IVZA 1XMOF 2CQ3A 2XMJA 2BOAA 1FJEB 2RJZA 3SZ2A 2NSBA 5CABA 3DLGB 3KOAA 5LMNF 3D5MA 1CBKA 4OI3A 2FJWA 2J76E 1BY9A 4K4ZA 2E7VA 4PWDB 4ZP6A 1CSJA 5DM6Q 2ZH8A 1K0VA 1HPZA 1NHKL 2KB2A 4CDIA 1QAIA 1LW0B 1RT1A 4LFBF 2K06A 3IR6B 1RE1B 2PA3A 1MSWD 2IM1A 4AXJA 2G0CA 2HIQA 3OBIA 4ZHRB 4EBDA 4B9TA 2RF2B 4NLSA 3CTRA 4ECRA 1KKHA 5U47A 3DGVA 1HD1A 4Q8EA 1NJIT 2CPZA 4CO1A 2D9PA 5HSPA 1IWAA 2VQFF 3C6TB 4ZS6A 2SXLA 1DURA 4FXVA 4HEA9 2XGPA 3N9UC 2HKEA 3M8PA 4PQUA 3FBBA 3DDKA 1WEXA 4DQIA 2RDDA 3DM2A 4OZ2A 4WYLA 2HWHA 1Y5NB 5DS7A 4ICLB 3G6ES 1RT4A 2H4WB 3RRHA 1P8GA 3M32A 4LT6A 3OTCA 5IFMA 1Y3KA 3D2WA 1TK0A 1A7GE 1VRTA 5E0OA 3TJ9A 2IY5B 4OHWA 1MWQA 4DR3J 4B08A 1R27B 2HS3A 3TUZC 1LWXA 1NUEA 3V6KA 1S4FA 4EBCA 4C3KA 3LQVA 4OJHA 4UY85 2AMCB 1FNOA 4WPAA 3W2WA 4PWDA 1U2RA 3IMQJ 2DGSA 5GADI 1WC0A 3LH2S 5J2MA 1FFWB 1WORA 5IWAJ 1LW0A 2ZJQQ 3T5JA 1A6LA 1S97A 2RDIA 1S79A 1FJGJ 1RHRB 1S12A 4CI0B 2AYBA 9RUBA 4UTGA 1WF0A 4ZOSA 4N7TA 3GSDA 4Y3CA 4IFVB 4Y0FA 3P4UB 2PO4A 2F8EX 1NBEB 3M05A 2CUYA 4K2JA 1GX6A 4DPUA 3GE9A 3HT0A 5DQHA 3D4JA 5GMDA 3ONQA 1EX8A 1C2PA 2YQ0A 4B02A 2J6UA 2E5LJ 1YG0A 1RAIB 4O44A 2UUAJ 4JV5F 3OVBA 3MR6A 2UXBF 1VQMS 2FLOA 3DRSB 3MEEB 4C97A 5A6PA 3BBFA 2O66A 2W01A 5D0EA 3GFHA 5HVGA 1YSJA 2RH3A 3QJLA 1FX4A 4ZLPA 4FNIA 2W2NP 2GGPB 2MHEA 1SJ4P 4JI1J 2BJDA 5IV4A 1GNKA 3RW6A 3C3LA 3GIMA 3T5HA 2XMMA 1UW9A 2EG2A 1CULB 2PA8D 1RAOA 5C25B 3OD2A 4BBYA 3PYFA 2VBWA 5DGAA 3KK1A 2CQPA 4WFAQ 1IKYB 1N34J 5FIIA 1VRQC 1R31A 5LT5A 4WU2A 3TQ1A 2AT1B 5GAGU 1RB0A 2OAUA 3M9OB 1PJ5A 4NCBA 2QLJB 1E6YA 1VK8A 2BANB 1MN9A 3H25A 2CPFA
chains in the Genus database with same CATH topology
1S12A 4PEOA 2IDLA 2G0JA 2G0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S12 A;  4PEO A;  2IDL A;  2G0J A;  2G0I A; 
#chains in the Genus database with same CATH topology
 2HK2 A;  3BO4 A;  4XDD A;  1H2T Z;  4MK9 A;  1U1N A;  4C0H A;  2AGQ A;  3IG1 B;  1QM9 A;  3TZX A;  2GQQ A;  1BXN A;  1UA1 A;  2OO4 A;  3PAC A;  3MTJ A;  1HKA A;  2BQU A;  2IBO A;  1VQY A;  3A8J A;  1X0F A;  1UFL A;  1CJK A;  4CLL A;  1AYE A;  2VPW B;  1BD6 A;  2R8G A;  3CCS S;  4F4W A;  1J5E F;  2XSF A;  2ZKT A;  1RTD A;  1RHU B;  1RT7 A;  1FNM A;  3A12 A;  2QT7 A;  2RHS B;  1BQX A;  2J7W A;  4FXW A;  5DLF A;  1U8W A;  5KFD A;  2OEK A;  1K73 T;  4FYD A;  1HW8 A;  3MFH A;  1BC6 A;  4DQP A;  1Q81 T;  2R3V A;  1GH8 A;  1AT1 B;  4KKO B;  3UVJ B;  2ZJR Q;  4WIQ A;  2V2Q A;  1VGY A;  1WC3 A;  3JQK A;  3W5Z A;  2H54 B;  1S0N A;  2ASY A;  3K57 A;  5JVH Q;  2GHW A;  1FF2 A;  2V9W A;  3OUY A;  2UVR A;  2V4J A;  1X4C A;  1M5O C;  3HVR A;  1CJT B;  1GAO A;  3OTD A;  2CPI A;  4URS A;  4F2R A;  1K47 A;  4R5P A;  4B3M J;  1ZTT A;  3FEZ A;  5CZV A;  4L73 A;  1S1V A;  2J9E A;  1EP4 A;  1FD2 A;  2AEF A;  2JEI A;  4ECT A;  4I4B A;  1NK6 A;  1JQG A;  3OVA A;  4DSF A;  4EGL A;  1R8B A;  1VQK S;  2CPX A;  2DGV A;  4FYW B;  5KFL A;  2NYI A;  1X4E A;  3MMC B;  3BSA A;  2R7U A;  2RQC A;  3QGH A;  3IG1 A;  3BH6 B;  3UWT A;  1ZZF A;  5DG7 A;  1NDK A;  4QR2 A;  2MZT A;  3VAI A;  3SI8 A;  3MPY A;  3AA8 A;  4R0J A;  2I6W A;  4RO0 A;  2KHD A;  1N32 J;  2VL1 A;  3GJQ B;  4JUZ A;  5IM0 B;  5L1K A;  2Y1J A;  2YKQ A;  3NRB A;  1NK9 A;  5AT1 B;  4FYX B;  3HHL B;  4G1P A;  3IA0 A;  3VAM A;  4WP8 A;  4G1Q B;  3M8Q B;  1RUS A;  4ED1 A;  2VC1 A;  3CJS A;  2ZJP Q;  4CP5 A;  2M5Y A;  3H0P A;  2HZV A;  1TL1 B;  2W9B A;  1FRK A;  4HR2 A;  4F4K A;  4UQT A;  2HRY A;  1IR2 A;  4WZM A;  1P27 B;  1EQ0 A;  4N77 A;  3VQS A;  2H65 B;  1X4D A;  4Y34 A;  4FS1 A;  4EBE A;  4USU A;  4DR6 J;  2EC2 A;  3W3S A;  5AXK A;  3MMJ A;  4WK3 A;  4MTP A;  4DR3 F;  4LJM A;  2HAI A;  1HL6 A;  4RBT A;  5E3P A;  2J8S A;  3MR3 A;  1SH0 A;  3EZU A;  1FJC A;  1RAH B;  1DTT B;  1RTI A;  3DHX A;  4DZD A;  3LP0 B;  3FDS A;  2DNK A;  2ZUA A;  1T02 A;  1REG X;  3X1L B;  2V8H A;  4PAA A;  5HMY A;  1KLM A;  2BM0 A;  3GU0 A;  2XMA A;  2NSC A;  5IWA F;  3PYD A;  1PJ6 A;  4X66 J;  3DYA A;  4O4G A;  4PXE A;  2K1R A;  1FJG F;  4YOE A;  2QA4 G;  3Q8U A;  1FDD A;  3MD1 A;  2PFD A;  4DL5 A;  1M5K C;  2C2N A;  3PFE A;  3NAI A;  1N5Q A;  2VBY A;  4C2M A;  3NNA A;  1HQE A;  1RLC L;  3HHE A;  2DRB A;  2AJ4 A;  1YJT A;  2HHU A;  4NYZ A;  4HT7 A;  5IS2 A;  4TU8 A;  4USW A;  3D6T B;  1ITP A;  4JOU A;  3PVX A;  1ZH5 A;  4J7C A;  3SCL E;  4XO0 A;  4P2X A;  2XUL A;  2CQ1 A;  2KVI A;  1DTQ B;  4ECY A;  2E5L F;  3OV7 A;  1B0V A;  1VBY A;  4GKK J;  1BQM B;  1URR A;  2UUA F;  1TVR B;  3ISZ A;  2RDJ A;  3EPI A;  1N36 J;  2LEC A;  1SH3 A;  3LWL A;  2NZ4 A;  3FKB A;  2VG7 B;  5LJ5 Y;  2H3E B;  4C48 A;  4Q0B A;  1FE0 A;  2QGF B;  1AB8 A;  2NXN A;  2ZBR A;  3IR5 B;  1QE1 B;  1T7P A;  1SKR A;  2CQ2 A;  1B7F A;  2Z57 B;  2BJ1 A;  5B0B A;  4IRC A;  3GV7 B;  3CJQ A;  4UOG A;  3V6J A;  5ETP A;  1FKO B;  2Y0B B;  3LOU A;  1ROF A;  1YLX A;  4JI1 F;  1Y4Z B;  4CLZ A;  2D3O 1;  2QO3 A;  2P9G A;  2W9A A;  2CRL A;  1OO0 B;  1WI6 A;  2FJX A;  4XPC A;  2P6T A;  2BXJ A;  3TX8 A;  2GJ2 A;  2JSX A;  3M1V B;  3ZZ0 A;  2RRA A;  5I4M A;  4B3S J;  2DGT A;  3NCQ A;  2L3M A;  3MD3 A;  5G4D A;  1N34 F;  2HVZ A;  3ILO A;  1WJ9 A;  3TWZ A;  1UZH A;  4KV8 A;  2HQC A;  1S9G A;  3TR5 A;  4AFF A;  2DNY A;  1RT2 A;  4I2P B;  5F8M A;  2X1B A;  4EO8 A;  4WFB Q;  5KOW A;  4Q2M A;  1QD1 A;  1BE4 A;  3MOZ A;  1PG5 B;  3D1H A;  4YDD B;  3QZ7 A;  1H2U X;  2OP5 A;  3U7J A;  4A4J A;  3JS9 A;  1RWK B;  5A76 A;  4CTA B;  2HHW A;  1TVR A;  1RWO B;  5KFQ A;  2FTR A;  2RT3 A;  4TY8 B;  2VG7 A;  2EK1 A;  1J2V A;  1UVN A;  2HPU A;  4ZJQ A;  3T9N A;  3TYT A;  3HF5 A;  4ECS A;  1IKX B;  4FZV A;  4NL5 A;  5LSO A;  3IAM 9;  4UOF A;  1F1B B;  5B0C A;  3VF0 B;  2EI5 A;  3C46 A;  5D3G B;  1GTH A;  2OFG X;  4QIW D;  3CE8 A;  5F0U A;  1VC5 A;  1PKU A;  2MJN A;  3K7R A;  3VGV A;  4LBI A;  3DGP A;  3VAL A;  1LW2 B;  4DN9 A;  1VJW A;  4NMX A;  3BGU A;  2YH0 A;  2VB6 A;  2F63 A;  1IJF B;  1G6B A;  3HSZ A;  3HHL C;  4K4Y A;  2YWH A;  4DMZ A;  4ECU A;  3KLE B;  3HSD A;  4NYO A;  4NA1 A;  4B3M F;  3KHH A;  1WDT A;  3EGZ A;  3UCG A;  4EMD A;  2XLI A;  3MM9 A;  2DRA A;  5E2Q A;  4A8W A;  4O3R A;  2R8I A;  4M5G A;  1Y9O A;  5CAA A;  4PPD A;  4NRU A;  2BDP A;  2N3O A;  3QGP A;  2QA4 S;  2MKY A;  3WC0 A;  2C28 A;  2F9D A;  5E3A A;  1WUU A;  4X4P A;  3BKU A;  2BAB A;  1Y00 A;  1N5Y A;  4PPZ A;  3ZTP A;  4OZ1 A;  4M5N A;  2LLZ A;  1FXD A;  3IBF B;  1RK8 A;  1GK8 A;  2R7T A;  4QWE A;  1N32 F;  2MGZ B;  4ER8 A;  3FBE A;  3BSO A;  2H5I B;  1HW9 A;  5HI7 A;  1NM2 A;  5KT6 A;  5A8W B;  4B9V A;  1WEZ A;  1VFJ A;  1W25 A;  2CJB A;  2Y9H A;  3LF0 A;  4RUH A;  1HQ2 A;  5DZ6 A;  3TQE A;  3P5B P;  4IUF A;  4CT8 A;  4OQJ A;  3NOC A;  1IM6 A;  2QLB B;  3UD5 A;  2CNK B;  1MNE A;  4DV6 J;  2JDJ A;  4AE5 A;  4NI2 A;  1KTV A;  1NK8 A;  2DVI A;  3Q2S C;  3I6P A;  4DOZ A;  4PKD B;  3EE3 A;  4A47 A;  4QIV A;  4W90 B;  4DSJ A;  1H6K X;  3M30 B;  1Y5I B;  1KSP A;  1NPR A;  3OL8 A;  3THV A;  4DR6 F;  4HDH A;  3V81 B;  3CCW A;  4ILR A;  4CQ1 A;  1WSV A;  1DRZ A;  3MM5 A;  2GX8 A;  1TMM A;  2I0X A;  1QAJ A;  2EFN A;  3HHN B;  4HH0 A;  3F0N A;  5KT3 A;  4K5S A;  5J2P B;  3GQC A;  4F26 A;  2QV6 A;  4DPX A;  2CG8 A;  4QIF A;  3H2U B;  2R4F A;  4IOC Q;  4MYU A;  5B0E A;  1DQ8 A;  1PO6 A;  3NAH A;  2IAJ B;  2QX0 A;  5IQQ A;  2V34 A;  1R7I A;  4X66 F;  3QJJ A;  5M2R A;  4HTJ A;  3BQ1 A;  1MMD A;  1B64 A;  4JI2 J;  3KMQ A;  3DXS X;  3VGU A;  4DU7 A;  3J7Y I;  2YX1 A;  1KVK A;  2D1C A;  1H74 A;  3H98 A;  3DI6 A;  2CZV C;  4KTQ A;  2YNG A;  1H38 A;  1GXU A;  1I3O B;  3PKY A;  2DNR A;  2HHX A;  1VRU B;  2APO A;  3LGH A;  3PKM A;  5C2G A;  1CC8 A;  1DLO B;  2OPP B;  1JLA A;  4GKK F;  5KFZ A;  3UNY A;  4UT4 A;  1SVD A;  3W5Y A;  1N36 F;  5CHC B;  2B4P A;  2MY7 A;  1YTY A;  1AW0 A;  2ZZN A;  3M30 A;  3RBX A;  5F41 A;  2LA6 A;  5JXS A;  2AQ4 A;  2DNM A;  1I6J A;  1L3U A;  3NCP A;  5L1L A;  4JI5 J;  1UWB A;  3TAP A;  5EWG A;  3KLH A;  3V81 A;  3ELH A;  1V5I B;  3I0R B;  1AA1 B;  2CWK A;  1KQF B;  4ED7 A;  1N48 A;  2B4O A;  4AT1 B;  2PD1 A;  3PXG a;  2AEJ A;  2ZHB A;  2HGN A;  4K4T A;  1H7X A;  1RP5 A;  2FJV A;  4ELU A;  2GQC A;  3CCQ S;  3W8P A;  3PIP Q;  2VIC A;  5J2P A;  4V1A k;  1RCO B;  2ZOG A;  3OLA A;  4DX8 H;  3C6U A;  2CZ9 A;  5IT4 A;  3QPI A;  3HVT B;  2HWT A;  1LOU A;  2ZEJ A;  2OTL S;  2HQG A;  1HNZ J;  4C3M A;  3VWS A;  3VAK A;  4CIO A;  4OFZ A;  1D1U A;  4RX6 A;  1RI7 A;  1LWE B;  2PN6 A;  3FSY A;  5F3T A;  2AD9 A;  4PG4 A;  4B3S F;  3OQ2 A;  3SSQ A;  3KJQ B;  4MJK A;  2VJV A;  2ASL A;  4K2X A;  1WHW A;  1VQ5 S;  2WB4 A;  2AEM A;  4K4W A;  4CNY A;  3IN5 A;  2W25 A;  2CAJ A;  4KB7 A;  2DIV A;  2DRD A;  4RW4 A;  2DY1 A;  4K4V A;  3R97 A;  1RWW B;  1HA1 A;  1QSL A;  3GP9 A;  3DU5 A;  1ZM4 A;  1OPI A;  2HNZ B;  4W4M A;  5KFP A;  2J6S A;  3TAN A;  4L6V 3;  2LXU A;  3FFI B;  1VQ4 S;  2MKH A;  3KMS A;  3G87 A;  3QLH B;  3VGS A;  1AXQ A;  5H9E K;  2G0J A;  1FRH A;  3NY0 A;  4XDC A;  4WP3 A;  2K2P A;  2B51 A;  3V6H A;  4LSL B;  2M88 A;  3GII A;  2HUR A;  2KTQ A;  3G86 A;  5DET A;  1X9W A;  1KHV A;  4YB6 A;  3BN7 A;  3D28 A;  2R7R A;  4M5K A;  3PO4 A;  5HK4 A;  1SV5 B;  2ILZ A;  3SEO A;  5AE3 A;  1T9Y A;  5I42 B;  2JNJ A;  2QL7 B;  3P49 B;  5KFE A;  4P10 A;  4EUV A;  3PW0 A;  4KHR A;  5MLC V;  2AKW B;  2HS4 A;  4J9N A;  4X62 J;  3UDE A;  2UVU A;  5JUM A;  2RE1 A;  1SUQ B;  5CA5 A;  2W2Q P;  4FDF A;  2F3J A;  2BQ3 A;  2PEB A;  1VLY A;  4ZPW R;  2B9W A;  1IBM J;  4CLT A;  5K8P A;  2CNL B;  2XLK A;  2C2R A;  2RAQ A;  1HQU A;  2ADC A;  4J9O A;  2AX0 A;  1GQE A;  3H2V E;  2BYC A;  4HL9 A;  4F04 B;  4Q43 A;  1PGZ A;  2KXF A;  3E01 B;  3M6W A;  4QZV B;  3OSN A;  3GV8 B;  1KS2 A;  2CWX A;  1T9X A;  3OL6 A;  4Y65 A;  3HPO A;  3ICL A;  1Q79 A;  1MRO A;  4IFY B;  2VAS A;  1WC6 A;  3NNC A;  2YKM A;  2LP4 A;  3AAW B;  3GG0 A;  1U02 A;  4DV7 J;  1Q4R A;  2X1G A;  4R8U B;  1JXL A;  1OY9 A;  4IDK A;  5ETR A;  3IBW A;  3I32 A;  4Y2I A;  3GG1 A;  1R0A B;  4NOH A;  4LRB A;  3J7Z 5;  4ID5 B;  5HP1 A;  3EWG A;  3TUP A;  1QUV A;  1SC1 B;  2HQD A;  1HWK A;  2Z0G A;  2ZD1 B;  1Z2L A;  2AJ2 A;  2Z8Q A;  1QTN B;  1HHS A;  2YX7 A;  5DQI A;  1GXL A;  1HIY A;  1HNI A;  4F7V A;  1NZA A;  4C8K A;  4RW6 B;  1QSS A;  4V19 X;  4OYB A;  1GX5 A;  3NBP A;  3UN5 A;  2WTF A;  2V4Q A;  3QT5 A;  2BV3 A;  1K1Q A;  1OMS A;  2P5V A;  4DJB A;  2ATC B;  4X2B A;  2N7C A;  1SJ3 P;  4NZ7 A;  3PX0 A;  4CWB A;  5T7L B;  1U48 A;  2VKR A;  2VF3 A;  4J37 A;  5KFI A;  3TAM B;  1QDU B;  4LF6 J;  3MMA A;  4DV6 F;  4YR2 A;  4DR7 J;  2KT3 A;  3SFG A;  3PHT A;  1F9E B;  4KFB A;  1C4C A;  2COL A;  1ZYQ A;  2VON A;  1VQ9 S;  4IG3 A;  2X1F A;  3CJ4 A;  5DDO C;  3R5B A;  2DCU B;  3PEH A;  4GVB B;  2LDY A;  1S1W A;  2NZC A;  1JWW A;  2ZVI A;  3LAM A;  3G6V A;  1KHW A;  2OJ3 A;  1V3S A;  3PYG A;  1L3K A;  1JLE B;  4I1T A;  5A8K A;  1REV B;  2HMI A;  4H4M B;  5HBM A;  3V4M A;  3MR2 A;  2HSE B;  1MWY A;  2ALZ A;  2R2T A;  1HWI A;  1Q8B A;  2DD8 S;  1PBA A;  4F4X A;  3NS6 A;  3B54 A;  1XN9 A;  1JLF A;  3DRR B;  1G4C A;  4Z37 A;  4H4K A;  4RW9 B;  3V2U C;  1Y11 A;  2M70 A;  3VZI A;  3DLE B;  2DK2 A;  4JI2 F;  2IRX A;  4QYZ J;  5HLF B;  3ADA C;  4M5D B;  4PZV A;  3QT7 A;  3H5X A;  5MAO A;  3IRX A;  3FSX A;  1YRT A;  1R0C B;  3CMQ A;  1FFG B;  1RYS A;  3DNC A;  2HHQ A;  2BQR A;  1W2B R;  1U2F A;  2J8A A;  5KFO A;  3BGR B;  1LFW A;  4QW9 A;  2QA1 A;  1CS4 A;  2EG1 A;  3K89 A;  1FA0 A;  4Q45 A;  1KOO A;  4J9M A;  5KAK A;  1X4F A;  1F9F A;  4BLG A;  1RU1 A;  3UDL A;  1FKP B;  5CCM A;  1S72 S;  4BC9 A;  2BE2 B;  2E5G A;  4JI5 F;  4NLD A;  2Y1R I;  2DNO A;  4Z7C A;  4N8N A;  4DDF A;  1AZS B;  2BMB A;  1JLE A;  2H4Y B;  4J9V A;  1B7Y B;  3HSJ A;  2PGC A;  5KFS A;  1K8A T;  1F9H A;  3QSI A;  2MZJ A;  3H90 A;  2FB0 A;  4DHV A;  4FPR A;  1RAA B;  3UI3 A;  3CC7 S;  4WKY A;  3KLF A;  3D1O A;  1NK0 A;  1UA0 A;  1I1G A;  2KO1 A;  2BJ7 A;  2XMK A;  2BRL A;  3LP1 B;  3IR7 B;  1HNZ F;  3U1L A;  5J2Q A;  1U1M A;  2XO6 A;  2CDR B;  4YB5 A;  3NGT A;  1F3V A;  1Q5Y A;  3CVK A;  4FF1 A;  3QSY B;  3CJK B;  5SUH A;  3A3N B;  1FK9 B;  1F0X A;  3M2U A;  2QYG A;  5GAD U;  3H4B A;  1WTB A;  2DHH A;  3TJ8 A;  1NB7 A;  3MCM A;  3OXL A;  4DR2 J;  2EBG A;  2ZBC A;  3MMB A;  3IWX A;  4FYV B;  3VGT A;  4FNH A;  2UUW A;  3NWG A;  1FT8 A;  4FP9 A;  1U6Z A;  2V50 A;  3VVU A;  1NKC A;  2DR7 A;  3VAJ A;  3P8B B;  2GC8 A;  4GO7 X;  3HK2 A;  1CJV A;  2BW7 A;  1TKZ A;  4RPF A;  2DXD A;  3DU6 A;  2PI4 A;  2ZHO A;  4YUD A;  4QCL A;  3JAM U;  3KDN A;  3M8S A;  5LMU J;  3C15 B;  3W7B A;  3ISN D;  4GO5 X;  4LR7 A;  3HVW A;  3LUY A;  1KRP A;  1VQ7 S;  1VQL S;  2JZ5 A;  1TR0 A;  1UP1 A;  1X4A A;  1KFS A;  4KH1 B;  2R7S A;  4RW8 B;  2FY1 A;  3DRP B;  3CCE S;  3KG1 A;  2XBP A;  4X62 F;  2KXN B;  5HQM A;  4NLR A;  2HEK A;  1JJH A;  2CJQ A;  3ITH B;  1TUV A;  1B4S A;  3U1N A;  3QQC D;  4IKA A;  5CYQ B;  2CQC A;  3WDO A;  3M6V A;  4ANC A;  5JVG Q;  4J9K A;  1C1B A;  4LMZ A;  5HVH A;  2Y8Y A;  2DJW A;  3LP1 A;  5FLX U;  3NL0 A;  4OJ1 A;  2DO0 A;  3IM8 A;  2KFZ A;  2CJK A;  2MHN A;  2QFI A;  2DHG A;  4DV2 J;  4RW7 B;  3MAH A;  4PAB A;  5LM7 E;  1ZOT A;  4NLV A;  3CJK A;  4ENO A;  2R2R A;  1NJX A;  3QGI A;  1DAR A;  2C3Y A;  1F5B A;  3EJM A;  2A1B A;  3TAR A;  2B4V A;  5K9F A;  1JKH A;  2X3D A;  3BF4 A;  1G7C B;  1QAX A;  3AY0 A;  3FCV A;  1JX4 A;  2CPD A;  1WEL A;  3A1Y G;  2LMI A;  2H5E A;  3QT8 A;  4DV7 F;  1FTR A;  4C8N A;  4OYI A;  2VC0 A;  2XGQ A;  3TA0 A;  3W65 A;  3K5O A;  3MED A;  2LXF A;  4MIB A;  1N33 J;  3H5U A;  3RJM B;  2F4V J;  2BM1 A;  2GVZ B;  3DLK B;  4KHM A;  4IRK A;  2V94 A;  1FD8 A;  2FGC A;  2WVB A;  5KFB A;  1WEY A;  1U1K A;  3W66 A;  3AHP A;  1DAX A;  1NSK L;  1ZTW A;  1XNR J;  1FE4 A;  1C0U B;  1J27 A;  1S10 A;  4LF4 J;  1NRK A;  1H98 A;  3JSB A;  3H5Y A;  3GWC A;  4NX9 A;  3A4T A;  4L76 A;  1RHM B;  3BRE A;  4N8O A;  4IO1 A;  4LF6 F;  3Q83 A;  2HHH J;  1OY6 A;  3SYZ A;  4DPY A;  3OHB A;  4DR7 F;  4WXW A;  3PRB A;  1GMW D;  4X4N A;  2WSC C;  1QVG R;  3SDE B;  4WF9 Q;  5A0Y B;  2IMW P;  4DL2 A;  3CD5 A;  3DOM A;  2F7V A;  5LSL A;  2PFF B;  3IRW P;  4LRF A;  1M1K T;  3R2C J;  3OVS A;  1SQF A;  1WOO A;  2ROE A;  4P52 A;  3FNN A;  2B9X A;  2Y1I A;  3CJ0 A;  4TYA A;  1I51 B;  5K8M A;  3E8O A;  1XQI A;  3PG9 A;  3C14 B;  1VBZ A;  3CCT A;  1URN A;  4KRW A;  1EJ7 L;  5LXY A;  4OZL A;  4KQZ A;  4NXM J;  4J9R A;  2QJ3 A;  4GRS A;  3OLB A;  4HH1 A;  3CD0 A;  3SQG B;  1K1S A;  2V8P A;  5HJY A;  2GVZ A;  2VOO A;  3DLK A;  2KJW A;  5DDR C;  2YNI B;  1Q5V A;  2XZD B;  4OZ3 A;  2W4P A;  4L3N A;  4ZIV A;  2H5J B;  2OUG A;  4O23 A;  5H1S V;  1RAF B;  2B5J A;  3N5B A;  2YKN B;  5CQG A;  2MTL A;  2GAH C;  3DFE A;  3P3D A;  2HHV A;  5B0D A;  5AE1 A;  1NJW A;  1HBU B;  1XMO J;  2HYI B;  4I67 A;  3UPF A;  5CXT A;  3PFO A;  2KDO A;  4QPX A;  3DOL A;  1TL3 B;  4ZVG A;  1VOM A;  4UZB A;  1TKT A;  1PYT A;  4A8Y A;  3FQL A;  2NXU A;  2GV1 A;  3SDE A;  1WSR A;  1HBM B;  3C16 A;  1K44 A;  4ZJO A;  3J7A N;  2QSF A;  1YIJ S;  1S1X B;  4UW2 A;  1VQO S;  2IM0 A;  3ETM A;  2DIT A;  2RKI B;  2HZA A;  3H20 A;  3ZZR A;  2YWW A;  3TZY A;  1KN6 A;  3Q86 A;  4ED2 A;  1VQP S;  2GAG C;  4MK8 A;  4YY3 J;  2PII A;  5K14 A;  4O0N A;  1XIQ A;  1HHT P;  4NWB A;  3UNG C;  4DQS A;  4FF4 A;  3MPU B;  2B6A B;  2KT5 A;  1SJ1 A;  3MR5 A;  4OMF G;  1TUG B;  2EC0 A;  1O0P A;  1IR1 A;  3DMJ B;  3VQT A;  1S9E B;  3QAU A;  1WOP A;  1RT5 A;  2YNI A;  4IYQ A;  3F44 A;  4LVN P;  3L3C A;  2A18 A;  3IXQ A;  1N6Q B;  1PAE X;  2FHO B;  2OH2 A;  2I5J B;  4DL0 C;  1F60 B;  4MFB A;  1NXI A;  5AXM A;  1SPB P;  4C8Z A;  1CQM A;  3KLG B;  2NPI A;  4ZVU B;  2YKN A;  3JAM Y;  3EGW B;  3NP5 A;  4DR2 F;  5KT5 A;  3LP2 A;  1SJF A;  1UEV A;  3Q8V A;  2OMO A;  3EDQ B;  3D6F B;  3CF5 Q;  4OI6 A;  3LTO A;  1ZM3 A;  4H4O B;  1D0E A;  1T03 A;  1O8B A;  1S59 A;  3O44 A;  1M5V C;  2MQ8 A;  1SKS A;  1LWF B;  4TLQ A;  2A2C A;  2OPS B;  2HHS A;  1FO1 A;  2W8K A;  5LMU F;  4LSN B;  2DH9 A;  4FF3 A;  2RRN A;  3L4B C;  1RYR A;  5G0R A;  5KG1 A;  1S1X A;  3QMQ A;  5DJB A;  2C2Z B;  2RKI A;  2YKA A;  2UXD J;  2D3Z A;  4Y6I A;  4QYR A;  4DR1 J;  1D9A A;  4RU2 A;  2P2C B;  5IQ6 A;  5CCL A;  2Z56 B;  3UFC X;  3M9M B;  3D3C J;  2B6A A;  2DR5 A;  4DI6 A;  1HMV A;  2FVS A;  4EZ6 A;  4C3L A;  2QLF B;  3EXY A;  4DV2 F;  3GPA A;  4EYH B;  1T95 A;  3EGV A;  2MMY A;  1LNQ A;  1X9M A;  3UD4 P;  1RWP B;  3TI0 A;  4I6W A;  2I5J A;  3Q8R B;  1O6X A;  5GAG I;  1U1R A;  2M2B A;  2YPY A;  3UCU P;  1XMB A;  3VV2 B;  1HBN A;  4E8U A;  2B7C B;  4KYZ A;  1SC6 A;  3AD7 C;  2QE5 A;  4C11 B;  3TEG A;  1JJ2 R;  4A46 A;  2D69 A;  5D4P A;  2YWF A;  1H0H B;  1YZ7 A;  3QIP A;  3BS9 A;  4ZPC A;  4RNF A;  2XY6 A;  1N33 F;  2D7S A;  2YXL A;  2F4V F;  3A8E A;  3JYT B;  2GVD A;  2NCK L;  2XHW A;  3RW7 A;  1DBD A;  1EAY C;  2OPS A;  3MAA B;  2A2D A;  3N79 A;  2E9T A;  3H4D A;  5J1P A;  3ETO A;  4CM2 A;  4BWJ A;  3PJX A;  1RQ0 A;  3GFY A;  3DN9 A;  1XNR F;  3O8W A;  2JLE A;  2WBM A;  3HMJ G;  3OFH A;  4OHX A;  4QR1 A;  4LF4 F;  2HRT A;  3M8R A;  3AD8 C;  2N3L A;  4HKQ A;  2FLL A;  4QIE A;  2V0N A;  2FVQ A;  2HHH F;  5F3Z A;  3T3F A;  4E0D A;  5E3Q A;  1NDP A;  5LJ3 Y;  2UV8 G;  5EGY A;  2MQO A;  5KFG A;  4I0W A;  3KXD A;  4OHY A;  5ETV A;  5BYS A;  4CLU A;  1GMW A;  1S48 A;  5ETM A;  3M2V A;  1FES A;  3KJV B;  4LRA A;  4F8R A;  3HD1 A;  1T9W A;  1FRI A;  2VDI A;  3E2E A;  5ADZ A;  3KHR A;  2NYH A;  1M1H A;  3VAH A;  1VR6 A;  1EET A;  1TV6 B;  5KFK A;  2QFJ A;  1NLK L;  4WU3 A;  1RT3 A;  2FHK A;  3KNA A;  2VG6 A;  2MZQ A;  1FXL A;  2V9K A;  3HD2 A;  4O0I A;  4KAI A;  2Q1L A;  4NCG A;  2YTC A;  1FRL A;  4RUC A;  4ZVS B;  4C11 A;  1HD0 A;  1HI0 P;  1LXN A;  4NXM F;  2MZR A;  2BW2 A;  3BKF A;  2YNH B;  3M8Y A;  1H2V Z;  3SIP B;  3JSR A;  1RJJ A;  1GEH A;  3ET6 A;  3K5M A;  1CJU B;  5HMZ A;  1N0U A;  2WCX A;  4UOH A;  1YI2 S;  1RBO B;  1M5H A;  2C2K B;  3HKW A;  2DNP A;  4MKY A;  2AYG A;  2JWN A;  2EW9 A;  2AZ1 A;  3DKD A;  1D9D A;  3KHG A;  2OPR B;  2FHJ D;  5KFR A;  2IRY A;  3M6U A;  1G2E A;  4ZPV R;  1V9O A;  1O5J A;  3HUL A;  3POT A;  2VOD A;  3JTO A;  3MM6 A;  4KGZ B;  4DSK A;  3EIC A;  4Q44 A;  1NND A;  4M5M A;  3O3L A;  2MLX A;  4ED3 A;  4C7Q A;  1MU2 B;  3QZ8 A;  1PC5 A;  1WHX A;  2BA9 A;  1FWP A;  4DSI A;  3K8W A;  1TV6 A;  2MKI A;  3B82 A;  3KK3 B;  2FVC A;  4DF8 A;  4I7F A;  4YY3 F;  1T8E A;  1IKW B;  2VHG A;  3OR1 A;  5KFT A;  3AOC A;  4I6A A;  4LFA J;  4ZK7 M;  3PDN A;  2FQQ B;  4DZ6 A;  4IO9 Q;  2YNH A;  2LEB A;  7FDR A;  2AV5 A;  2X51 A;  3BR8 A;  3I0S B;  3O5T B;  3EZO A;  3L09 A;  5GAE U;  4DLE A;  4DL3 A;  2CZ4 A;  3J81 j;  2CQD A;  2GW8 A;  5F8G A;  4YDX A;  1OYD A;  4DWI A;  1U0H A;  4ZVF A;  3BEG B;  4FKY A;  4JI7 J;  2V2V A;  3K5L A;  1FWL A;  1TL5 A;  3AD9 C;  5EHH A;  2OPR A;  1Q86 T;  3PM9 A;  3NGR A;  4OYX A;  2CPE A;  4KY3 A;  4DR5 J;  4IG0 B;  1RT6 B;  2I9S A;  2LYV A;  3G82 B;  1C4A A;  3DLG A;  1SC3 B;  4AD6 A;  2BE7 D;  1JK9 B;  2KZM A;  4QIG A;  1U1L A;  4QU7 A;  2A0F B;  2MLY A;  3WC2 A;  4OZ0 A;  4LR9 A;  5E3C A;  3O2I A;  2V4R A;  4B3O B;  2BEF A;  2XSJ B;  3U1M A;  2B8Q A;  4LUB A;  5C42 B;  4I56 A;  4YQW A;  2JH3 A;  1UPM B;  2V67 A;  2XNQ A;  2BR0 A;  1YRU A;  1RWV B;  1IBC B;  2KG1 A;  4NLU A;  2UXD F;  3S1T A;  3H5S A;  5IT9 U;  4ZHR A;  3CMA S;  2CDQ A;  3RB6 A;  3FSI A;  4DR1 F;  5CYM B;  3HSG A;  4KH0 B;  2RF2 A;  4ZMM A;  3HHL D;  3DDN A;  2QIF A;  4LR8 A;  3I9V 9;  2YQ1 A;  5IZH A;  3T5L A;  3BYR A;  5L9N A;  4KR0 B;  3MHY A;  2D74 B;  3C6T A;  2A6O A;  1FRM A;  1WHV A;  2MY8 A;  3GIK A;  1F2G A;  1HNV B;  1HI1 A;  1B0P A;  4ECW A;  4JBC A;  1ZA1 B;  1H7W A;  2R9L A;  4K7Q A;  4H4K C;  4Y2C A;  3JTN A;  2AF6 A;  2HQ3 A;  4ICL A;  3FZ2 A;  3P45 B;  4A8Q A;  3D54 A;  4N5S A;  2O5D A;  3MEC B;  1R8C A;  2OSR A;  5LSR A;  1R6V A;  3EXC X;  3ULH A;  4IG0 A;  1JMT A;  4DUZ J;  2BKO A;  3D67 A;  5DDP C;  3R6L B;  2BZ2 A;  2AJQ A;  2MKC A;  4OI4 A;  2IM2 A;  2J5A A;  3CW2 C;  2XI2 A;  3CJ2 A;  4HHH A;  1LWC B;  5GME A;  4OYO A;  4Z7Y A;  1JLQ B;  5J2N B;  1FDB A;  3D68 A;  4RWX A;  2FLP A;  1DFD A;  3D1Q A;  2AZ3 A;  3MAQ A;  2QZ8 A;  4J5O A;  2LQ9 A;  5DO2 A;  3QT6 A;  3Q8P B;  3GJR B;  4UST A;  1Q82 T;  1FEE A;  5E41 A;  1NSA A;  4IFV A;  2E5J A;  3TRG A;  4ZPD A;  3VVT A;  3V4I B;  3GR0 A;  3Q89 A;  1M5S A;  4LIR A;  2G4B A;  4N41 A;  2FZG B;  3BN4 A;  3I55 S;  2XMV A;  3PEJ A;  3ILI A;  4FPI A;  2F40 A;  5KT7 A;  2VG5 B;  1X5S A;  4HLB A;  3BO3 A;  1RXO B;  4ETX A;  2KM8 C;  3HFZ B;  1FDN A;  1ZPV A;  2QMU B;  2V8G A;  1S7H A;  3PW5 A;  1U26 A;  2LQ8 A;  1S99 A;  4PXC A;  1JLB B;  2QA2 A;  2VFV A;  3SBM A;  2IA0 A;  2HWI A;  2EKN A;  3GTY X;  2XI3 A;  3K59 A;  4L72 B;  5M2P A;  4TVA B;  4EK2 A;  3DRS A;  3MEE A;  3KKF A;  5B0G A;  4J91 A;  3D6M B;  2DNQ A;  2Y3Y A;  3CO9 A;  2DR9 A;  3FGV A;  3EVW A;  5A2Q U;  3WX4 A;  3K0J A;  3SSS A;  4CLP A;  1R3N A;  2HND B;  2GGP A;  3FMW A;  1IKV B;  4ZIW A;  4OX9 J;  3ZZZ A;  3PW7 A;  2MSS A;  5AXL A;  4LVO P;  2BJE A;  4S0M A;  2PSZ A;  4F36 A;  2W9C B;  4OLO A;  2DGQ A;  1UZD A;  2R7W A;  2LEA A;  1NU4 A;  3P96 A;  1TAQ A;  2K7J A;  1VHI A;  1CUL A;  3ILL A;  4LQ9 A;  4FF2 A;  3GCW P;  3SXL A;  4PRF A;  2KVQ E;  5C25 A;  4LRD A;  2FIU A;  2N82 B;  5B08 A;  5J2N A;  4DPO A;  2EWH A;  2XZT B;  3CJ5 A;  1J5O B;  3DLL Q;  1IKY A;  1V5V A;  5HAO A;  3EVM A;  3IFE A;  3GJS B;  4NEZ A;  1U47 A;  4DFM A;  1HLW A;  4MYT A;  4AL7 A;  1NO8 A;  2FHJ A;  1TAU A;  2ADB A;  2IA6 A;  2BAN A;  3M8Z A;  5KFF A;  4YEA A;  4CO4 A;  3AOA A;  3R9L A;  1Y10 A;  1DZ5 A;  3RB0 A;  1YJW S;  4P7T A;  3QRP A;  2FJE B;  4DCO B;  4BWM A;  1FFS B;  2GIF A;  4K4X A;  2Z2L A;  1N5T A;  3IGN A;  3GFX A;  4NZ6 A;  2Z30 B;  4LF1 A;  4YP3 A;  1NK7 A;  1FKA F;  2HRU A;  3Q8S B;  2JFK A;  2MST A;  1FRX A;  5H9E J;  1KWM A;  1UJ6 A;  5HRO B;  4IR9 A;  2AW0 A;  3NEK A;  3I87 A;  3OXF A;  2UUC J;  4ZIT A;  2I1R A;  1X7V A;  3RZA A;  1FWK A;  4G3I A;  1UWA A;  3OL7 A;  1LK7 A;  2F5G A;  2MZS A;  4MMO A;  1RKJ A;  1VIO A;  3R8Y A;  4O3Q A;  2V6A A;  1NH7 A;  5LXR A;  4LFA F;  4KT0 C;  1IJE B;  3BDE A;  3BPS P;  4UUX A;  3R5A A;  5KG6 A;  4K4U A;  1S1U B;  3VAF A;  1BMQ B;  3VAG A;  3BDP A;  2IJF A;  4KKO A;  4MIA A;  3UVJ A;  3H59 A;  5D4N A;  3CB4 A;  3R5J B;  4UUW A;  1RAD B;  2ROP A;  1VBX A;  3CNQ P;  2WBR A;  3QWU A;  2BUN A;  2ZE2 B;  2OIH A;  3BBC A;  3HHK A;  1VQS A;  4JI7 F;  3PYE A;  2RRB A;  4PCQ A;  5DLG A;  2B56 A;  1R8P A;  2RVJ A;  1CJT A;  4IQX A;  1T9V A;  1NHU A;  3DLB A;  3E3X A;  3M9N B;  1PSD A;  5DG8 A;  4DR5 F;  2VIH A;  4BS2 A;  2M3D A;  3S01 A;  3PHE A;  4DF4 A;  1T94 A;  3R5D A;  5D78 A;  2GQ2 A;  1NK5 A;  5IT9 Y;  3IM9 A;  1HFE L;  3RBE A;  1WTF A;  3PO5 A;  4OHZ A;  3R6G B;  3MM8 B;  3HCX A;  4TLR A;  4ZCK A;  3MMC A;  4NA2 A;  5F8L A;  4USJ C;  1PYO B;  2ZDO A;  4XK8 C;  3HO1 A;  1RAE B;  1TTH B;  3OR2 B;  4USM A;  4NLO A;  1Q7L B;  5C24 B;  1S0O A;  1WC5 A;  3CED A;  1JLG B;  4WII A;  5I3U B;  2IDE A;  4EEY A;  3C8Y A;  3SFU A;  5IM0 A;  3PX6 A;  4ETZ A;  1MMN A;  3TVK A;  3AQO A;  3M8W A;  1S6Q B;  4DL7 A;  1VHF A;  5EWF A;  4C8M A;  2WON B;  3HHL A;  2IJR A;  3PRV A;  4KGK A;  1WD6 A;  4ED0 A;  4G1Q A;  1S6P B;  3M8Q A;  2PT0 A;  9ATC B;  4RR5 A;  1FVQ A;  4DQR A;  2QLX A;  1TL1 A;  2DIS A;  1Q78 A;  1NPP A;  2VBZ A;  4WE1 B;  4ZCI A;  2UUT A;  3LPE A;  4LF2 A;  4WBF A;  1ELO A;  4ZA1 A;  1HBO B;  2OD4 A;  3OTB A;  2WRM A;  4C6A A;  2ZE2 A;  1H73 A;  1IN0 A;  1PIE A;  2GFF A;  4P2F A;  3NLC A;  1Q53 A;  2OPQ B;  5THW A;  3TVZ A;  2MEW A;  4EFA C;  4QR0 A;  3RYL A;  4JI6 J;  1QTM A;  2AU0 A;  1QSY A;  5F9L A;  1T05 B;  4DUZ F;  2GJI A;  4I64 A;  3K5N A;  3ZTR A;  2DR8 A;  4B9N A;  1A0O B;  3EZ5 A;  4KGV B;  3M2R B;  1HI8 A;  4C8L A;  5BR8 J;  1VC0 A;  4C4W A;  1DTT A;  1TL4 A;  4DG1 B;  3LP0 A;  1GMU A;  3BGO P;  4H54 A;  2ZOF A;  2QG9 B;  2LDI A;  5F0W A;  3I31 A;  4LF5 J;  1KEK A;  4RL1 A;  4DU8 A;  4K59 A;  4OV1 A;  4D3G A;  3CSK A;  3OR2 A;  2FDN A;  2JLG A;  3D66 A;  3UR0 A;  1OSD A;  1CC7 A;  3DDI A;  3BGL A;  2ILY A;  2QYC A;  2HAF A;  2HLU A;  1QY7 A;  1ACM B;  1KQK A;  1WNE A;  1WG5 A;  2CPH A;  1SJR A;  3IP0 A;  2ZH4 A;  2CXE A;  5EN1 A;  5D4O A;  2HFS A;  1IBL J;  3TO8 A;  3FZB A;  1HYS B;  4U7U K;  1E6V B;  2L08 A;  1DTQ A;  4J9U E;  3F73 A;  1EAR A;  5ETO A;  3G8S A;  3AA9 A;  2HHP A;  5A2Q Y;  4F4Y A;  1BQM A;  3GCX P;  3OTO J;  3L7O A;  2OEL A;  1I5O B;  1TP7 A;  1RHK B;  2CIM A;  4JI0 J;  2IMO A;  4YME A;  2CQH A;  2BBE A;  4DV0 J;  4AL5 A;  3JSM B;  1S0M A;  3R7N B;  2X3G A;  3TJA A;  4OYP A;  1XMQ J;  2FLN A;  1SQE A;  3H42 A;  2UVW A;  1FNX H;  5B7W A;  2ZBQ A;  4PG7 A;  3UDV A;  4DFK A;  4BDP A;  1QE1 A;  4Q7A A;  3QFW A;  3T1Y J;  2NUU G;  1B0T A;  4M8L A;  4ZVT B;  3MPW A;  4OX9 F;  4X65 J;  1FKO A;  1GMV A;  2QN6 B;  1TK5 A;  3I56 S;  2P8I A;  4P75 A;  2XS2 A;  3SV4 A;  3CD7 A;  2MQQ A;  4DG1 A;  1Q8K A;  4OZ5 A;  1KNZ A;  3CCM S;  1HPZ B;  4R25 A;  2XYP B;  1U8S A;  3CJR A;  4P71 A;  2JRS A;  1OPZ A;  4AXI A;  2BJ3 A;  1RT1 B;  2DKO B;  1HNW J;  4YB1 P;  1S1T B;  5ETN A;  3M1V A;  4KPY A;  4ES2 A;  3RU0 A;  1SL2 A;  1RAJ A;  3RUB L;  2WAQ D;  3W63 A;  2RML A;  3N0V A;  2NXE A;  2E29 A;  4I2P A;  1TMJ A;  3ISN C;  4X84 A;  1N88 A;  2M0G B;  5B09 A;  2Q6C A;  3PW2 A;  2QL9 B;  2XEX A;  3M8P B;  3A3P B;  2GIQ A;  4PQU B;  3AJD A;  1S7I A;  2B3T B;  2WOM B;  3CD6 S;  5KG0 A;  1YJ9 S;  4F0M A;  1LEO A;  2CVE A;  1D8Z A;  3DM2 B;  4CTA A;  2K3I A;  4G1I A;  4G6V B;  2ACY A;  1RT4 B;  2UUC F;  3R27 A;  2Q3P A;  4TY8 A;  5F8J A;  3M32 B;  2DNH A;  1AFJ A;  1VRT B;  2M8D B;  2XWY A;  2F8H A;  3GLJ A;  1IKX A;  5KFN A;  2E7X A;  1XBW A;  3A13 A;  2POK A;  5D3G A;  1ZM9 A;  5ITH A;  3UDC A;  4DEZ A;  3AXK A;  4OZN A;  2HBZ B;  5F9N A;  1I94 J;  2VV5 A;  2P9C A;  1D09 B;  2XS7 A;  2BE9 B;  3W2W B;  1LW2 A;  5FJ4 A;  5IC6 B;  4Z2X A;  3G6X A;  2IC3 B;  5J2M B;  3H2L A;  2GMJ A;  3G2X A;  3I82 A;  3MUT P;  4XIU A;  4XAK A;  3NMR A;  1S0V A;  3CIZ A;  1S1T A;  8ATC B;  4QU6 A;  2ROG A;  3Q8Q B;  3UN2 A;  4L3K A;  4I69 A;  4B9L A;  3KLE A;  1ZAV A;  1UPP A;  1FXR A;  1TK8 A;  5ETQ A;  3VZH A;  5K20 B;  4IH5 A;  4JI4 J;  5C5J A;  4DQQ A;  2HLT A;  1TFW A;  1X9S A;  3BQ0 A;  4K0K J;  2CJ9 A;  2PMZ D;  1U4B A;  2GML A;  5CZX A;  1P9Y A;  3HKZ D;  4O44 B;  4WJB A;  2WOM A;  1R8H A;  4EYI B;  2HQF A;  2JL9 A;  3TEH B;  2EFV A;  2Q79 A;  4D3H A;  2XQC A;  4ZPT R;  4Q8F A;  1SH2 A;  4GC7 A;  5E3R A;  4AUK A;  1HNX J;  2R7O A;  2RUS A;  2B9Y A;  4NLQ A;  2MGZ A;  1LK5 A;  2PMH A;  1P9Q C;  5A8W A;  3MWB A;  4RWW A;  5J1N A;  1JLC B;  1D9F A;  1JXV A;  4DPW A;  2DPI A;  4QWA A;  2DGW A;  4KO0 B;  4ZCM A;  3NG8 A;  2JC0 A;  1VBK A;  5D0G A;  1WI8 A;  1WAC A;  4PUO B;  1Q0N A;  5KFY A;  2IC3 A;  4GC6 A;  5KFW A;  3K58 A;  2H48 B;  3EUN A;  1VYA A;  3KK1 B;  4B3R J;  4UOC A;  4C8Y A;  3W2V B;  2AGP A;  1T0T V;  3PNI A;  3QFH A;  2AGO A;  4ELT A;  2Q6B A;  4JI6 F;  2HGM A;  4PWU A;  3W62 A;  4CH7 A;  2FVP A;  1ZAX A;  1E6Y B;  1Z2Z A;  2JX2 A;  2MB0 B;  2QEX S;  2BKN A;  4Q2L A;  4RNO A;  3THT A;  2E66 A;  2L9D A;  4ZVE A;  1CLF A;  1FCA A;  5BR8 F;  1N54 B;  5KT4 A;  1AFI A;  2IAJ A;  3CCU S;  2OTJ S;  4JYA J;  3NCR A;  3O1L A;  4LF5 F;  3NMA A;  3MCO A;  5F8N A;  2K3K A;  1CJK B;  2IPO B;  3CJ3 A;  2LVW A;  5KFU A;  4CO3 A;  4WWS A;  1RTD B;  4CLW A;  2XWX A;  5IT0 A;  1RT7 B;  3VR1 A;  2DEI A;  2RUG A;  1TKX B;  3MZI A;  5HAT A;  4PR6 A;  1UKU A;  2XS5 A;  3S7R A;  3E51 A;  2WB1 D;  4FVC A;  5GAH U;  1SCJ B;  4YFU A;  2YH1 A;  4NZ0 A;  4ZCL A;  1JLC A;  2NLW A;  5HMX A;  1VRU A;  5IXU A;  4P7V A;  1IBL F;  3RB3 A;  4KO0 A;  3TNV A;  5KG2 A;  1DLO A;  2OPP A;  5DM7 Q;  2KI2 A;  3MDF A;  1U1P A;  5HO4 A;  4ZP8 A;  3UW1 A;  3Q24 A;  1FER A;  3UN3 A;  2KHC A;  4PUO A;  1CEZ A;  3M7V A;  3OTO F;  2KG0 A;  4B9U A;  3CJT A;  3DCA A;  1X8D A;  4JI0 F;  4J9L A;  2OGU A;  5IOL A;  2E1P A;  3OUY B;  3FUY A;  1JB0 C;  2V4J B;  4DV0 F;  1T3N A;  3Q23 A;  4ALZ A;  4ZLL A;  1NME B;  1XK8 A;  4J90 A;  1ZBT A;  1XMQ F;  4R5P B;  2N7Y A;  1UCN A;  3W2V A;  5KFA A;  1SKW A;  2MLZ A;  3CDA A;  2O67 A;  3I0R A;  1S1V B;  1ICE B;  3T1Y F;  1EP4 B;  2D9O A;  2F65 A;  1WKL A;  4RBV A;  1OJ4 A;  4X65 F;  4MKB A;  1L3V A;  2CNO B;  3P6Y C;  3WZ0 A;  3AXM A;  4DFJ A;  3DRY A;  4I2Q B;  2DPJ A;  4PG8 A;  4ED5 A;  1SXL A;  3HVT A;  1YKW A;  4Y00 A;  3CCZ A;  2GHV C;  1H72 C;  3G4S S;  2EFP A;  3T6B A;  2KRB A;  3IS9 B;  2MQM A;  1X5T A;  3I4P A;  1HNW F;  1LWE A;  1Y3J A;  2XMT A;  3TUJ C;  3ZNU A;  2KL8 A;  3FEX B;  4EO6 A;  4ZDN A;  1VJQ A;  4X4U A;  4IOA Q;  1YRX A;  3ENW A;  4ILM A;  1TKX A;  4CRJ A;  3HX9 A;  2MKK A;  2CQG A;  5ETS A;  3SMZ A;  4OYW A;  3BM7 A;  3Q8Y A;  4WTY A;  2HNZ A;  4IQM A;  5BYQ A;  4R0E A;  2R7X A;  3TVY A;  4KPC A;  1O51 A;  1N4L A;  2M9K A;  4PXB A;  3CXC R;  2X1A A;  3FFI A;  2WW4 A;  3QLH A;  2W9B B;  7FD1 A;  5T41 A;  1MLA A;  3CME S;  3HJF A;  4X4R A;  4LSL A;  1RHJ B;  4EI2 A;  4JV0 A;  2BOP A;  3I96 A;  5BJR A;  3GMG A;  1BGX T;  2OEJ A;  1P6T A;  2HVI A;  4DV1 J;  1SV5 A;  2DYA A;  1RDR A;  2JVR A;  1RTH B;  5I42 A;  2DXE A;  2W2O P;  4ITS A;  4U95 A;  2W8L A;  4RZR A;  2PE8 A;  4FBT A;  3LO3 A;  3IC1 A;  1RTI B;  1SUQ A;  1WG1 A;  2M8H A;  2RHQ B;  4ELV A;  4P72 A;  1I94 F;  1W26 A;  2FD2 A;  4MIW A;  1QJH A;  4I2Q A;  4OL8 A;  3IGV A;  1VI7 A;  5KG3 A;  1SJQ A;  1KLM B;  2YBV A;  1TU0 B;  3HVA A;  3DYA B;  3IS9 A;  4O4G B;  5B0A A;  2ZH1 A;  2K1R B;  3E01 A;  2H9Z A;  5E33 A;  4TU9 A;  3V6D B;  1OS5 A;  4FBU A;  1LXJ A;  3ZXW A;  1XC9 A;  2ZH3 A;  1HQE B;  4JI4 F;  3ZZP A;  2VUG A;  4ZP7 A;  4IFY A;  3TAQ A;  2W7O A;  1A9N B;  4USV A;  4K0K F;  1CG2 A;  4R8U A;  2WHO A;  4RUA A;  4OJG A;  4YS2 A;  1R0A A;  4ID5 A;  3OJS A;  3JQJ A;  4CO5 A;  2ZD1 A;  1OSC A;  1R43 A;  2QTW A;  3ZZU A;  3PZP A;  1N8R T;  1ARO P;  3GIL A;  3B8H A;  4P2S A;  4RW6 A;  4Q0B B;  1HNX F;  2DY9 A;  2OD6 A;  4DS5 A;  1F5A A;  4NLX A;  3PCO B;  1XR5 A;  2NXJ A;  2EPI A;  1RWM B;  4B9M A;  2NPF A;  4TKT A;  1U0S A;  1RTH A;  2ZNY A;  5HMW A;  5T7L A;  5KFX A;  2WK4 A;  4TY9 A;  3AH6 A;  3TAM A;  1R6Y A;  2IRU A;  4DL6 A;  4KE5 A;  2AJ0 A;  2W1B A;  3K8V A;  2HIY A;  2ZWO A;  1Y7P A;  3OFG A;  3LW5 C;  1UVM A;  2CQ0 A;  4K5R A;  2XO7 A;  2HVH A;  4IH7 A;  2ZC3 A;  2DHA A;  4OYM A;  1VLO A;  5L8R C;  2G2Z A;  4B3R F;  1YJ7 A;  4GVB A;  4JV1 A;  4DS4 A;  4X4S A;  2OLW A;  2CKW A;  1Q16 B;  2OKQ A;  3FVY A;  4KV8 B;  2DGX A;  2HNY B;  4P2M A;  3W9J A;  3JB9 k;  1S9G B;  4LQ3 A;  4YB7 A;  1REV A;  4DV5 J;  3V6D A;  4EZ9 A;  1S4E A;  1RT2 B;  4H4M A;  4NPO A;  3HFV A;  2P9E A;  4N47 A;  3NKY A;  2MDA A;  1TL7 B;  1AUS L;  4M5I A;  3H8Y A;  1RWX B;  2PI5 A;  3KUH A;  3T1A A;  2EXU A;  3PY8 A;  2VJU A;  4J9S A;  3LA0 A;  3KUE A;  3DRR A;  1OYE A;  3QAT A;  1F5C A;  5H9F K;  1JIH A;  4JYA F;  2R2U A;  2M4M A;  4RW9 A;  3OL9 A;  4ZJL A;  4NLP A;  3CDE A;  4CT9 A;  1U7L A;  2ZNZ A;  5DQG A;  1RAB B;  1RCX B;  3DLE A;  4DR4 J;  1OIA A;  1VIX A;  2C1E B;  5I3Q A;  2EFO A;  5HLF A;  4M5D A;  4DUY J;  4NLY A;  1PJ7 A;  1UL3 A;  3FCW A;  3EYZ A;  2NS1 B;  1T11 A;  1FRJ A;  4JI8 J;  2VFT A;  1SL0 A;  2GMH A;  3SQO P;  2OEM A;  2ZDP A;  5C7P A;  1YK9 A;  3B78 A;  1W2I A;  5DZ7 A;  6FD1 A;  3R7B B;  5I3P A;  3BGR A;  1N5V A;  5GMK a;  4HT5 A;  4DX6 A;  2VOP A;  3DGP B;  3SCJ E;  2DNN A;  2C22 A;  2XLJ A;  3THP A;  4QWC A;  2KYX A;  4MAK A;  1WF2 A;  4IR1 A;  1FX2 A;  4CZC A;  5GVQ A;  3QNW B;  2ZH7 A;  4M94 A;  1FKP A;  3HZE A;  2FPH X;  2U1A A;  2BE2 A;  2V68 A;  3MEK A;  1IQZ A;  2YQ3 A;  3CCV S;  3GR1 A;  1CQN A;  3W1Y C;  2HNY A;  5JJB A;  1AZS A;  3CC2 S;  3MM9 B;  3LPY A;  2RQM A;  3KG0 A;  4CH0 S;  4XPE A;  5F8I A;  4BC7 A;  1TL7 A;  5BYR A;  4HHJ A;  2DH8 A;  3KG4 A;  1T3O A;  4CLK A;  1ULR A;  1PIL A;  4P6Q A;  2DR6 A;  2FUG 9;  1UJ4 A;  1F2H A;  1BWV A;  5EX0 A;  3CCL S;  4OJ3 A;  1N5Y B;  4RNM A;  1DQ9 A;  3SV3 A;  3DRX A;  5K8N A;  1U2C A;  3A8K A;  1YBA A;  2E44 A;  2ACM A;  1WKK A;  2WSF C;  2Q43 A;  3K2Y A;  1FK9 A;  2FJB B;  3N01 A;  4KBI A;  3ENV A;  3NS7 B;  2MJU A;  5KG5 A;  4AL6 A;  3ZNJ 1;  2LA4 A;  3D0G E;  1U6B A;  2RQK A;  1V3R A;  4KJI A;  2ZHA A;  4A8M P;  6FDR A;  2F8M A;  2KN4 A;  3EX7 B;  1U09 A;  1TQL A;  3T6J A;  3DC2 A;  3C19 A;  4DLG A;  3DLJ A;  3G8T A;  3W9H A;  3GZ7 A;  3GSI A;  5CD4 A;  4NI2 B;  2OFH X;  3FMB A;  4WP9 A;  3ZZY A;  2X7I A;  2R7V A;  5HL7 Q;  5DDQ C;  1OY8 A;  4CLS A;  5IV3 A;  2MYF A;  1RA7 A;  2YVS A;  1ZM2 A;  3X3U A;  3UE2 A;  2MQL A;  4LF8 J;  3KYL A;  2GNK A;  3C15 A;  1LQ9 A;  3KK2 B;  4LFC J;  4DV1 F;  3MM5 B;  4YR0 A;  3IWN C;  3I4H X;  3R5C A;  4ZVH A;  1RIS A;  2IVY A;  4ED8 A;  3GIJ A;  4RW8 A;  2KH9 A;  3DRP A;  3C66 A;  3LAK A;  2UXC J;  2JLF A;  2UU9 J;  4I6Y A;  1UVL A;  3QID A;  3H7H B;  3ITH A;  1S77 D;  2JEF A;  4CYU B;  4FS2 A;  5CYQ A;  4DV3 J;  1RWU A;  3FBC A;  4X64 J;  3EVO A;  3TP2 A;  4JI3 J;  3G6Y A;  2DGU A;  1TZ0 A;  3OJU A;  2XZW A;  3R1L A;  1NJY A;  4DCJ B;  2D41 A;  2IHR 1;  2P6S A;  4RW7 A;  2K8G A;  4RNH A;  2KYZ A;  4X4V A;  3ZO7 A;  1KR4 A;  2XB2 D;  2HBY B;  4ZLJ A;  2ZOM A;  2QMW A;  2CA9 A;  1YJV A;  3DI6 B;  2UVV A;  6AT1 B;  2XM3 A;  2W7P A;  4CH1 A;  2YNG B;  3PIO Q;  3OFE A;  1DJ0 A;  4B17 A;  2VH7 A;  4DXL A;  1UW4 A;  4OX8 A;  2YKP A;  2B7B B;  1JLA B;  3BB5 A;  1U25 A;  1TUW A;  5KFC A;  2WZ1 A;  2JEJ A;  4M5H A;  2MQP A;  2QLW A;  3EMT A;  1UVJ A;  5RUB A;  4USH A;  1UET A;  5J1E B;  1WHY A;  4J9Q A;  1UWB B;  2AJF E;  1QAY A;  2UZA A;  3D9B A;  3KLH B;  4WZQ A;  4DX7 A;  1NSP A;  3BV8 A;  4P9S A;  3KK2 A;  1SC4 B;  3T1H J;  2XMW A;  1VQ6 S;  3W60 A;  1UAW A;  1TFY A;  4ATN A;  3MPV A;  1C0U A;  2J7K A;  2ZBP A;  4KHP J;  4JP8 A;  4DSE A;  4XTT A;  2DHS A;  2VDH A;  4PWW A;  3QJP A;  3C6U B;  2VPZ B;  4CYU A;  5GAE I;  3NGD A;  1Q8L A;  1APS A;  3US5 A;  2MXY A;  2LKZ A;  4C0O C;  4HDG A;  2YNF B;  4K8R A;  3ILJ A;  4O3P A;  1XER A;  1Q95 G;  4RUB A;  4NML A;  2EBE A;  5A0Y A;  1BLU A;  2VA2 A;  3IO1 A;  4U67 Q;  3Q0A A;  4ED6 A;  2G2O A;  2GA7 A;  1KLN A;  1WDD A;  2EFQ A;  4O3O A;  2BX6 A;  4M5L A;  4RW4 B;  3P5T L;  1WC1 A;  4DV5 F;  4U7U D;  2CG4 A;  3AFG A;  4QWB A;  1UTA A;  3AOD A;  2DTJ A;  3J80 U;  3C14 A;  5HN0 A;  3FEY B;  4NXN J;  1NZ8 A;  1RWN B;  4TN2 A;  1WKJ A;  4CO2 A;  3W8G A;  1SBR A;  4AND A;  1T9T A;  3I5A A;  2AP6 A;  4X4T A;  4LIW A;  2BVZ A;  4P73 A;  3RRK A;  3MI7 X;  3SQG A;  1UEU A;  3VCD A;  5KFM A;  4OI0 A;  2KKH A;  4DR4 F;  4Y2M A;  1S76 D;  2CJA A;  2J7U A;  4DUY F;  2M7S A;  5J1E A;  3AOB A;  2ZH6 A;  1N5S A;  1EIY B;  4KSE B;  2OSQ A;  2RS8 A;  4HHU A;  3D0H E;  4JI8 F;  2CJX B;  3M6X A;  4WFZ A;  1GFW B;  4O3S A;  3ZZT A;  2WVC A;  1S9F A;  2ZBI A;  1NH8 A;  1N56 A;  3N6L A;  1HBU A;  3EM1 A;  4X4Q A;  2G1D A;  2RIL A;  4OZJ A;  2OI2 A;  5EX3 A;  2QL5 B;  4JV2 A;  5E7O B;  2AYE A;  3WBZ A;  3JQM A;  4PYD A;  1VCT A;  3R1H A;  1TL3 A;  1HQU B;  2G9O A;  3W64 A;  2JEG A;  2YNF A;  3ZZO A;  2XMU A;  1MML A;  3MUR P;  1HBM A;  1VQ8 S;  1RAC B;  2WVF A;  4GVL A;  2BKP A;  5FLX Y;  2AJ1 A;  4HYK A;  3CC4 S;  4KGX B;  3DXB A;  5A6W A;  2XYH B;  1BWE A;  1YDL A;  2ZH9 A;  4UY8 T;  1ZA2 B;  2RD5 C;  4F2S A;  2FYX A;  4K4S A;  1NKB A;  1MRO B;  4IRD A;  2AX1 A;  2YKM B;  4E2F B;  2DEJ A;  2VPY B;  3F41 A;  2ASD A;  1RBL A;  1X5P A;  3N4W A;  4IDK B;  1LV5 A;  2XNR A;  1C0T B;  3RB4 A;  5CYJ A;  3MUM P;  3G71 S;  2I38 A;  2CNN B;  3D3B J;  5HP1 B;  1TKD A;  2V2K A;  1F6T A;  3RR8 A;  4LBH A;  2C42 A;  2ZVS A;  4Y28 C;  3DMJ A;  1M90 T;  4CNZ A;  1HNI B;  1S9E A;  1NDC A;  1RAG B;  2HFV A;  2Y0S D;  3FBF A;  3CWJ A;  3GIR A;  1FTC A;  2HVE A;  2DIU A;  1N6Q A;  4RJV A;  5SZT A;  3NBP B;  4DN0 A;  1S6U A;  1PCA A;  3T41 A;  1LKZ A;  4OV6 A;  3FQK A;  1S5Z A;  3KLG A;  4RKU C;  2IYG A;  4PG6 A;  1KTQ A;  3GYX B;  3MFI A;  2H1Y A;  2JFD A;  4B3T J;  2VFR A;  3JXO A;  3MMA B;  2KFY A;  4JB8 B;  2IVM A;  2ZC4 A;  3EGN A;  1Q1K A;  3BSC A;  1LFP A;  1RHQ B;  4P74 A;  2L41 A;  4N56 A;  4KFB B;  4M95 A;  4H4O A;  3MTK A;  1B70 B;  2DGO A;  4IG3 B;  1LWF A;  3HDS A;  3AQP A;  1DHM A;  4HAC B;  1S1W B;  2AYM A;  4LF8 F;  1RZM A;  3OSP A;  2Z2Y B;  5F8H A;  3BPD A;  3CT9 A;  4LSN A;  2ZKU A;  4LFC F;  1NCL A;  2R8H A;  5A8K B;  3AT1 B;  2AWZ A;  2HMI B;  1D3W A;  4O4R A;  5L9X A;  2CQB A;  5HBM B;  4E98 A;  1KC8 T;  4ZKA A;  3B4M A;  2UXC F;  1EQM A;  2UU9 F;  3TUI C;  1NEE A;  1JJC B;  2JHE A;  4NA3 A;  4OYZ A;  4A8K A;  1Y0H A;  4MKA A;  3UR3 C;  5C2C A;  2DNL A;  5EUH A;  2CPY A;  4DV3 F;  1C0T A;  4AQY J;  5E5N A;  1YQH A;  3BYP A;  1JLF B;  1IR0 A;  3PR5 B;  2C3U A;  4X64 F;  2V8D A;  3SCI E;  3MPD A;  1Q7Y T;  2YWG A;  4LF9 J;  4FVM A;  1IQT A;  3FRZ A;  4JI3 F;  1NAQ A;  4A8O A;  4WFN Q;  4PG5 A;  3QRR A;  2ABY A;  3HZG A;  2KRR A;  4QJV A;  2RS2 A;  2XTJ P;  1U49 A;  2DHX A;  2NQP A;  3CJ8 A;  1MG7 A;  3KTQ A;  2LU1 A;  3IRX B;  1VIS A;  3V5R A;  2LQJ A;  3B6B A;  3CGI A;  4DPT A;  2VZ9 A;  4W92 B;  3L95 X;  2Z2Z A;  2CAD A;  2QMX A;  2W4D A;  3OFF A;  4DBQ A;  1G1X A;  4J9P A;  1HWL A;  2LEP A;  2BJ9 A;  2V69 A;  3BH7 B;  1RGV A;  2OHD A;  1CS4 B;  5DG9 A;  2J0Q D;  2QSW A;  3TA2 A;  4QQB A;  3NS5 A;  1KON A;  3HJV A;  5AXN A;  4C98 A;  3ZTO A;  3PTW A;  3I9Z A;  4ZN1 A;  4RBU A;  3JYT A;  3PV8 A;  4U96 A;  3NXZ A;  4QOT A;  1L5U A;  4CCH A;  3EPG A;  8AT1 B;  2ZM6 J;  4NE9 C;  3MAA A;  1YHQ S;  1X60 A;  4HAC A;  2JVO A;  5KG7 A;  1PAU B;  3FJ2 A;  2O3D A;  3T1H F;  5ETL A;  3L9Z A;  1V3Z A;  1NJZ A;  4MKV A;  2ZZT A;  2IYI A;  2CFX A;  4KHP F;  2JOQ A;  1TEL A;  3KLF B;  1HAR A;  2R2S A;  3AJ1 A;  3LWM A;  2GO9 A;  2DO4 A;  5D15 A;  2KM8 B;  2QRR A;  1U1Q A;  5J2Q B;  3RTV A;  4A8F A;  1IXK A;  3J80 Y;  3BZQ A;  4DL4 A;  4CO0 A;  2A6M A;  3G96 A;  3OXG A;  2L9N A;  1QUP A;  4ZLN A;  5AE2 A;  2XC9 A;  1YZ6 A;  3KJV A;  1JJ4 A;  3M2U B;  4OI1 A;  3R5G A;  4ES1 A;  1GTE A;  1YVF A;  3WIU A;  2DNG A;  1X5O A;  4RLE A;  1U1O A;  4UZC A;  2LQ5 A;  2V63 A;  4OX6 A;  2UUB J;  3MMB B;  2E5H A;  1YJR A;  5AJ3 J;  1KVI A;  2C2O B;  1V6H A;  1K0T A;  1G3O A;  2DCL A;  4NXN F;  4NYP A;  1JNR B;  3U27 A;  4F0K A;  4LRE A;  2YKO A;  2MKJ A;  1Y5L B;  4MK7 A;  5HAN A;  1CJV B;  1TKZ B;  1FDA A;  2C2E A;  1X4B A;  5KG4 A;  3NWR A;  4ERD A;  5D0R A;  1PC4 A;  1YWX A;  5B0F A;  2LXI A;  2R7Q A;  4DV4 J;  1CJU A;  4FN5 A;  4YN3 B;  2CQ4 A;  5LL6 d;  1P1L A;  1SL1 A;  4W98 A;  1RKI A;  5CH7 B;  4ZVR B;  4NLT A;  3T9Z A;  4L74 A;  3K5P A;  5K8O A;  3LAL A;  2LFV A;  3J7Y U;  1XR7 A;  5A8R B;  4F3M A;  1FHT A;  1FI4 A;  2FHM A;  1NK4 A;  3GYN A;  2PMW A;  1XNQ J;  3LGN A;  4WFY A;  3W9I A;  1C1B B;  2GCF A;  4TQS A;  4ZVQ B;  3OTE A;  2G13 A;  1YBU A;  3LGM A;  4WTO B;  3WHI A;  3W5X A;  1WF1 A;  2CYY A;  2CPJ A;  4L75 A;  3R2D J;  2KJV A;  3DHW C;  2ZH2 A;  4DSL A;  1YX2 A;  4OYA A;  4F02 A;  5DRK A;  5KFH A;  2Z58 B;  2O01 C;  3UCZ P;  5L39 A;  3T19 A;  1MU2 A;  1JKH B;  2HK3 A;  1VS3 A;  1DY3 A;  2E1R A;  2Y1L B;  1RTZ A;  2R8J A;  2VA3 A;  2VQE J;  1DQA A;  4Q5V A;  1VC6 A;  2HBQ B;  4TYB A;  3KK3 A;  2CJY B;  2GIR A;  3HLU A;  1IKW A;  2QC3 A;  1VMB A;  3KLI B;  1HR0 J;  4U6P A;  4HI1 A;  3SCK E;  3CUN A;  3UO0 A;  2VD3 A;  1EB0 A;  1UFK A;  3ENQ A;  3RAX A;  3MED B;  1D8Y A;  3IAS 9;  3MEG B;  1MN7 A;  2ZH5 A;  5CD4 H;  5EWE A;  1C1C B;  1UVI A;  2BJ8 A;  3I0S A;  4A48 A;  2NRE A;  2YY3 A;  1ZS6 A;  3DLH A;  4F3O A;  5T14 A;  3C2P A;  2RSQ A;  4F25 A;  2MZ1 A;  1KOH A;  2B9E A;  2KFN A;  3OPK A;  1PYS B;  3D6H B;  3GV5 B;  3R7S B;  1UVK A;  3SSR A;  2XY7 A;  1SI9 A;  4X4O A;  3PRD A;  3QWP A;  3RRG A;  2DB1 A;  1EKR A;  4B3T F;  5A8R A;  5JMN A;  3OHA A;  1L3T A;  5D8H B;  3QGG A;  1ZPW X;  2ATL A;  2E7W A;  2E1C A;  3HT3 A;  1IBM F;  1RT6 A;  3GON A;  1UMJ A;  3G82 A;  1XWL A;  2HVD A;  2XG8 A;  2IIH A;  4ID8 A;  1X4H A;  4U8V A;  1R0B G;  1NB2 A;  3GYG A;  1Z1Z A;  2VPX B;  3BGF A;  4U7C A;  3LAN A;  3DOM B;  4DUT A;  2KZZ A;  3CUL A;  1ZAW A;  4CM0 A;  4ECZ A;  3TW0 A;  4B3O A;  2B8P A;  2XSJ A;  2VFU A;  2AHO B;  5C42 A;  1Z4U A;  2HGL A;  1N52 B;  5DGB A;  3J81 U;  1KDN A;  2HG4 A;  2J0X A;  3HI9 A;  1IBK J;  4V19 J;  2E1A A;  3FC9 A;  5CYM A;  3KLI A;  4ZVP B;  4AQY F;  4HI2 A;  4I68 A;  1KP6 A;  4TQR A;  2RQ4 A;  4LF9 F;  3S6E A;  2BAC A;  3G8Q A;  4KIA A;  4GKJ J;  2HS0 A;  2G2Y A;  3MEG A;  3AJ2 A;  3AB4 B;  3NNH A;  3KHL A;  3OW2 R;  1C1C A;  4DCP B;  1XTZ A;  1HNV A;  1S57 A;  2FZC B;  2HHT A;  2HFN A;  1BHN A;  1EKS A;  4QPT A;  3G9C A;  4PEO A;  4ECQ A;  4LF7 J;  3FRY A;  3TZZ A;  3MOJ B;  2WVE A;  3ZTS A;  2B5J B;  3PW4 A;  2CVI A;  2DNZ A;  3CDW A;  5FDL B;  4HTI A;  1VDH A;  3OT9 A;  2UP1 A;  2IBK A;  2FVR A;  1M1G A;  3MEC A;  2R8K A;  1UJ5 A;  2J9C A;  3HM9 A;  2N4D A;  3HXM A;  3DOL B;  1U24 A;  2ZZM A;  2O1P A;  4YHH J;  1WWH A;  1TKT B;  2C2D A;  1UEK A;  2W24 A;  5ETK A;  2D3O R;  2J6T A;  3HHD A;  2V8V A;  4FXD A;  3L7U A;  5HJX A;  3C16 B;  2ZM6 F;  3N6M A;  4M63 A;  2XHC A;  3U02 A;  2ERR A;  3QRQ A;  3KLV A;  1JXE A;  3TOQ A;  1LWC A;  2MKS A;  2MPU A;  2RNE A;  4K50 A;  2N4C A;  3CCR S;  1JLQ A;  3N28 A;  5HVF A;  2G1H A;  2G0I A;  1RSC A;  5HQL A;  4QBU A;  1Q8I A;  3PJ9 A;  5K14 B;  2IM3 A;  4U8Y A;  4EU0 A;  4WKR A;  1IUJ A;  2M52 A;  4NCA A;  5D6G A;  2PDA A;  2W2M P;  3V4I A;  5KFJ A;  1NSQ A;  4ED4 A;  2RIJ A;  2E9R X;  1OQ3 A;  2F4F A;  5LOQ A;  1EZZ B;  2EKY A;  3K17 A;  4KC5 A;  3KUG A;  1RT5 B;  3CIM A;  2FC8 A;  2ALY B;  1IWG A;  2A10 A;  1KD1 T;  3EDR B;  4F4A A;  2VG5 A;  2V2Z A;  2C3O A;  2XCP A;  1ZZN A;  4MFB B;  2XY5 A;  4ECV A;  1JLB A;  5D77 A;  4Y2A A;  5FDL A;  1ZET A;  5L1J A;  1BUX A;  2UUB F;  3KDO A;  1OWX A;  3LP2 B;  2B4U A;  2ZUG A;  2LQB A;  4TXS A;  1KBR A;  2HFZ A;  5AJ3 F;  3I5B A;  1U6F A;  2I2Y A;  1FEH A;  3A8I A;  3RAM A;  2B43 A;  5IC4 B;  1X31 C;  4A8S A;  1BQN B;  1RTJ B;  2R42 A;  1P1T A;  4NAS A;  3HP6 A;  2L9W A;  2YWE A;  3I5C A;  4RU9 A;  3KFW X;  1T03 B;  5LMN J;  2HND A;  3ZFV A;  1IKV A;  1HWU A;  2W2P P;  4IOB A;  5D0H A;  2VFS A;  4OIX A;  1X4G A;  3BQ2 A;  1NPK A;  1NHV A;  3FK4 A;  3GB0 A;  2W9C A;  4DV4 F;  4F4Z A;  2GJF A;  4WXO A;  5G0R B;  3KJN B;  3KNG A;  3IWL A;  4URG A;  4ILL A;  4LFB J;  3KJF B;  4B9S A;  2FGO A;  2I8E A;  4MH8 A;  3TZW A;  2GO8 A;  1SKU B;  3NGK A;  2DT9 A;  1FVS A;  2GHP A;  1J5O A;  1H3D A;  3R3T A;  2FC9 A;  5K5M A;  1XNQ F;  2NR0 A;  3NGS A;  3S8S A;  1F3F A;  2E5I A;  4UQG A;  1QLN A;  3UD3 P;  2F1F A;  2WSE C;  3TX0 A;  2E9Z A;  1OQ6 A;  1HMV B;  1NDL A;  1XEZ A;  4OHV A;  2VQF J;  4C9D A;  2OML A;  3MGJ A;  2FJD B;  2JJ4 D;  5L1I A;  3Q2T C;  4Y2K A;  3TA1 A;  1GT8 A;  4N76 A;  1W7W A;  2YWK A;  2ZIT A;  3BR9 A;  2J0S D;  2VU5 A;  3RG6 A;  3MUV P;  1MWZ A;  2Z4P A;  4ECX A;  2CQI A;  2HZC A;  3CDB A;  4M1K A;  2VQE F;  4BHQ A;  5HRO A;  2H51 B;  1HBN B;  4KGM A;  1L3S A;  3NOG A;  1KFD A;  1HR0 F;  8RUC A;  3HFK A;  2KXH A;  2C2M B;  5D4L A;  4URQ U;  3QIP B;  1M5P C;  2IJN A;  3BJY A;  4MT1 A;  5BXI A;  2D3U A;  2MQN A;  3ZTQ A;  2U2F A;  4IH6 A;  1BQN A;  1RBA A;  2V5H G;  4HVZ A;  1RTJ A;  4C8O A;  3W61 A;  4ANE A;  2GVD B;  1S1U A;  3MM7 B;  2UV8 A;  2A3J A;  2YX4 A;  3QO9 B;  4BCA A;  1B3T A;  1FJ7 A;  3BSN A;  5FD1 A;  2DBB A;  4LRC A;  4DX5 A;  5HQ8 A;  2HFU A;  3QYY A;  4PYA A;  5L38 A;  4FYY B;  7AT1 B;  3RGI A;  2J9D E;  1SIZ A;  2XCA A;  3NGU A;  4USK A;  5GAH I;  1XJW B;  3WX8 A;  2DXF A;  1N0V C;  3GJT B;  4ES3 A;  2EFG A;  2VBX A;  4CLF A;  2K7K A;  3J81 Y;  1VK3 A;  2PEH A;  4UF4 A;  3L7P A;  2EK6 A;  1VQN S;  1MW7 A;  2RU3 A;  2B0G A;  1GXT A;  3M2V B;  3PR4 A;  3AB2 B;  2C3M A;  3BBB A;  3MM8 A;  3D7S B;  1NKE A;  2VKZ G;  3RAQ A;  4OX7 A;  2IFX A;  1R89 A;  2ZWP A;  2F9J A;  3CDU A;  1EET B;  4JV5 J;  3A3O B;  1RT3 B;  3QAE A;  3UQS A;  4LSZ B;  2VG6 B;  1YGY A;  2UXB J;  5C24 A;  3VHQ A;  2FY8 A;  3ZC4 A;  1JLG A;  2NXC A;  2KU7 A;  4WYW A;  2HQI A;  5I3U A;  2FZK B;  1IBK F;  4NCG B;  2XYG B;  4GMK A;  2EEY A;  2PC6 A;  4AYB D;  2J9D A;  4ZPB A;  3VTI A;  3MR7 A;  1S6Q A;  2JC1 A;  3J7A 1;  2WON A;  4GKJ F;  3Q22 A;  3T5K A;  1S49 A;  2GZO A;  1S6P A;  3CCJ S;  4WFX A;  1U45 A;  5EDW A;  3MF5 A;  2AIR B;  4U9R A;  3CPW R;  2E1M C;  4QYZ K;  1KQS R;  3DOK B;  3ET6 B;  3MM7 A;  2IDL A;  3GFZ A;  3O6Q A;  2Z2M A;  3QO9 A;  4F0H A;  1WC4 A;  1EHW A;  1WOS A;  4LF7 F;  3FCH A;  3BO2 A;  4WE1 A;  2ASJ A;  2LCW A;  1HWJ A;  1HBO A;  4ZN3 A;  5KOX A;  4TNO A;  1R8A A;  2L48 A;  4A8X A;  1XR6 A;  2KT2 A;  4LBP A;  4FKX A;  4NLG A;  2DH7 A;  5M2U A;  5L46 A;  1SB6 A;  2OPQ A;  4PQA A;  4WK1 A;  4ZVO B;  3MCS A;  3MCN A;  4F3Q A;  3WIV A;  1K9M T;  1KVJ A;  1KQG B;  3POT B;  4YHH F;  3PX4 A;  1T05 A;  2Y8W A;  1S6O A;  2WW8 A;  3MM6 B;  3BKT A;  3MXH P;  1SQG A;  3M4X A;  3M2R A;  2FJA B;  2EVZ A;  1IM4 A;  1JNZ B;  2ZFH A;  1RLD A;  1YBT A;  2NUH A;  4F50 A;  4TU7 A;  4USI A;  4PXD A;  3D0I E;  1HHQ A;  4NEY A;  5H9F J;  1RA6 A;  4O3N A;  1M0S A;  5KFV A;  5ETT A;  1WG4 A;  2YPZ A;  1YJN S;  1UFW A;  4QWD A;  4C0B A;  1J5E J;  4I7F B;  3F56 A;  1RU2 A;  4NLW A;  3RBD A;  1PBU A;  2J0W A;  2W4C A;  3OR1 B;  2RB7 A;  2HW3 A;  3N6N A;  4NRT A;  4CLY A;  4QW8 A;  4OLP A;  3WQP A;  2C3P A;  3B4D A;  4ZPA A;  1B99 A;  1CPZ A;  3CO0 P;  1QVF R;  2GS8 A;  3ENA A;  5KT2 A;  3N5F A;  4EWT A;  1X0P A;  2HBR B;  3QBC A;  2LU2 A;  4WCE Q;  1SIW B;  4G65 A;  3KWM A;  2WVD A;  1CVJ A;  4DFP A;  2HFO A;  4F67 A;  1HYS A;  4YR3 A;  2RU9 A;  1E6V A;  2BRK A;  3DOK A;  2Q66 A;  1YJU A;  1T9U A;  3RR7 A;  4OI2 A;  3H40 A;  3IBC B;  1U0H B;  4M5J A;  5KTQ A;  4RNN A;  2IVF B;  1YIT S;  2W7A A;  3PJW A;  3JTP A;  3J7Z T;  3JSM A;  3JSY A;  3RBZ A;  1AUD A;  4ZP9 A;  1IVZ A;  1XMO F;  2CQ3 A;  2XMJ A;  2BOA A;  1FJE B;  2RJZ A;  3SZ2 A;  2NSB A;  5CAB A;  3DLG B;  3KOA A;  5LMN F;  3D5M A;  1CBK A;  4OI3 A;  2FJW A;  2J76 E;  1BY9 A;  4K4Z A;  2E7V A;  4PWD B;  4ZP6 A;  1CSJ A;  5DM6 Q;  2ZH8 A;  1K0V A;  1HPZ A;  1NHK L;  2KB2 A;  4CDI A;  1QAI A;  1LW0 B;  1RT1 A;  4LFB F;  2K06 A;  3IR6 B;  1RE1 B;  2PA3 A;  1MSW D;  2IM1 A;  4AXJ A;  2G0C A;  2HIQ A;  3OBI A;  4ZHR B;  4EBD A;  4B9T A;  2RF2 B;  4NLS A;  3CTR A;  4ECR A;  1KKH A;  5U47 A;  3DGV A;  1HD1 A;  4Q8E A;  1NJI T;  2CPZ A;  4CO1 A;  2D9P A;  5HSP A;  1IWA A;  2VQF F;  3C6T B;  4ZS6 A;  2SXL A;  1DUR A;  4FXV A;  4HEA 9;  2XGP A;  3N9U C;  2HKE A;  3M8P A;  4PQU A;  3FBB A;  3DDK A;  1WEX A;  4DQI A;  2RDD A;  3DM2 A;  4OZ2 A;  4WYL A;  2HWH A;  1Y5N B;  5DS7 A;  4ICL B;  3G6E S;  1RT4 A;  2H4W B;  3RRH A;  1P8G A;  3M32 A;  4LT6 A;  3OTC A;  5IFM A;  1Y3K A;  3D2W A;  1TK0 A;  1A7G E;  1VRT A;  5E0O A;  3TJ9 A;  2IY5 B;  4OHW A;  1MWQ A;  4DR3 J;  4B08 A;  1R27 B;  2HS3 A;  3TUZ C;  1LWX A;  1NUE A;  3V6K A;  1S4F A;  4EBC A;  4C3K A;  3LQV A;  4OJH A;  4UY8 5;  2AMC B;  1FNO A;  4WPA A;  3W2W A;  4PWD A;  1U2R A;  3IMQ J;  2DGS A;  5GAD I;  1WC0 A;  3LH2 S;  5J2M A;  1FFW B;  1WOR A;  5IWA J;  1LW0 A;  2ZJQ Q;  3T5J A;  1A6L A;  1S97 A;  2RDI A;  1S79 A;  1FJG J;  1RHR B;  1S12 A;  4CI0 B;  2AYB A;  9RUB A;  4UTG A;  1WF0 A;  4ZOS A;  4N7T A;  3GSD A;  4Y3C A;  4IFV B;  4Y0F A;  3P4U B;  2PO4 A;  2F8E X;  1NBE B;  3M05 A;  2CUY A;  4K2J A;  1GX6 A;  4DPU A;  3GE9 A;  3HT0 A;  5DQH A;  3D4J A;  5GMD A;  3ONQ A;  1EX8 A;  1C2P A;  2YQ0 A;  4B02 A;  2J6U A;  2E5L J;  1YG0 A;  1RAI B;  4O44 A;  2UUA J;  4JV5 F;  3OVB A;  3MR6 A;  2UXB F;  1VQM S;  2FLO A;  3DRS B;  3MEE B;  4C97 A;  5A6P A;  3BBF A;  2O66 A;  2W01 A;  5D0E A;  3GFH A;  5HVG A;  1YSJ A;  2RH3 A;  3QJL A;  1FX4 A;  4ZLP A;  4FNI A;  2W2N P;  2GGP B;  2MHE A;  1SJ4 P;  4JI1 J;  2BJD A;  5IV4 A;  1GNK A;  3RW6 A;  3C3L A;  3GIM A;  3T5H A;  2XMM A;  1UW9 A;  2EG2 A;  1CUL B;  2PA8 D;  1RAO A;  5C25 B;  3OD2 A;  4BBY A;  3PYF A;  2VBW A;  5DGA A;  3KK1 A;  2CQP A;  4WFA Q;  1IKY B;  1N34 J;  5FII A;  1VRQ C;  1R31 A;  5LT5 A;  4WU2 A;  3TQ1 A;  2AT1 B;  5GAG U;  1RB0 A;  2OAU A;  3M9O B;  1PJ5 A;  4NCB A;  2QLJ B;  1E6Y A;  1VK8 A;  2BAN B;  1MN9 A;  3H25 A;  2CPF A; 
#chains in the Genus database with same CATH homology
 1S12 A;  4PEO A;  2IDL A;  2G0J A;  2G0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...