4RNHA

Pamora tandem diguanylate cyclase - phosphodiesterase, c-di-gmp complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
429
structure length
423
Chain Sequence
MAYYDALTHLPNRTLFQDRLHTALQQAERNGQWVVLMFLDLDRFLGHAAGDRMLQEVATRLSACVSQDDTVARMGGDEFTLLLPSQGDREIALKRAIQVAELILGRLARPFTLEGREFFVTASIGVALSPQDGAELSLLMKNADTAMYHAKEMGKNNFQFYQAEMNARALERLELESDLRRALELGEFVLHYQPQFTGDGRRLTGAEALLRWQHPRRGLVPPSEFIPVLEEIGLVAQVGDWLLAEACKQLRSWHKAKVRVPKVSVNLSARQFADGQLGERIAAILYETGIPPACLELELTESILMSDVAEAMQILSGLKRLGLAIAVDDFGTGYSSLNYLKQFPIDVLKIDRSFVDGLPHGEQDAQIARAIIAMAHSLNLMVIAEGVESQAQLDFLREHGCDEVQGYLFGRPMPAEQFGMLYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, hydrolase
molecule keywords Motility regulator
publication title Formation and dimerization of the phosphodiesterase active site of the Pseudomonas aeruginosa MorA, a bi-functional c-di-GMP regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 146
structure length 423
sequence length 429
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4rnhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rnhA01
4MK9A 4ECRA 3LALA 2QE5A 1OS5A 5HBMA 4K4XA 3HHKA 2RF2B 3KZPA 3NAIA 4Q8FA 1JLBA 1LW2A 1RT2B 3QLHA 4KAIA 2R8HA 5KFTA 3DLEB 2QV6A 3IG1B 3E01B 5J2QB 4RU9A 4FOUA 3TQ1A 4Y9PA 5L9XA 4F4YA 1JLAB 3V6DA 3FFIB 3DRPA 2VA3A 4NRUA 5JUMA 1LWFB 1TQLA 1ZETA 2ALZA 4LSLB 4KIEA 4KKOB 2WK4A 1DTQA 3ITHB 3KLFA 2CKWA 2JC0A 2W9AA 1RT3A 3UDLA 2W8KA 2E9ZA 1HNIB 3GG1A 2IBKA 2JEGA 1JXLA 2C2EA 2ILZA 3MEGA 3RB3A 3G6YA 3H5XA 3KHGA 3DOKA 1RT1A 3GG0A 4Y2AA 1FKPA 2JEJA 3KLIB 3JSMA 3T5JA 4IFVB 1RT6B 4K4YA 3QGGA 3I0RB 4FOJA 3KJVB 2XWYA 2RKIB 2J6SA 5EWFA 5D3GA 2D7SA 3LP0B 2YNFA 3M8PA 5KFIA 4QWDA 2JEIA 2VG5B 2BASA 2FJVA 5HP1B 1ZTTA 4R8UB 3H4BA 3BSAA 1W25A 4TY9A 4EBEA 3NAHA 3TAMA 5L1IA 3BQ2A 1FK9A 2AGQA 2HMIB 4PQUA 4HU4A 1RTIA 3H59A 3PVXA 1NHVA 2HNZB 3H5YA 2RF2A 3T5LA 4DL6A 2UVWA 5KT6A 1RT2A 5JXSA 3DLEA 5J2QA 3E01A 3E51A 1HQUB 4MKBA 1C0UB 5J2NB 2RDJA 3T5KA 1JLAA 5DLGA 3FFIA 3ICLA 4RW4B 4AFYA 1Z4UA 2WCXA 3Q8SB 2JEFA 4H4MB 1RTJB 3ITHA 5J2PB 5CYMB 4TQSA 4KBIA 5KFFA 4J9NA 4ED2A 3OSPA 1SH2A 4QPXA 3Q8RB 3PJTA 2C2RA 1R0AB 5F8MA 4I7FB 2R8IA 4RW6B 3KK1B 2O5DA 1TP7A 2B5JA 3QO9B 3KLIA 4JV1A 1S1XB 3HVAA 4IFVA 3I0RA 5T14A 3KJVA 2RKIA 4NLRA 3SI8A 4K4VA 3QIDA 3CJ3A 2B6AB 3CDUA 2OPSA 3HV8A 4IDKB 5KFUA 1S0NA 1HARA 3CDWA 2UUTA 2R2TA 2VG7B 3C6TB 4R8UA 1JLFA 4ZVEA 5C24B 4F4XA 4LSNB 1EETA 2IAJB 2HMIA 4G1QA 3UQSA 3MR5A 5L1KA 4K50A 4YR3A 1DLOA 3CJ2A 3OLBA 5KG7A 3BQ1A 4ECQA 2FLLA 4NLYA 3GIMA 5KFXA 4R5PA 4Y34A 4RZRA 1C0UA 4I2PB 2ZKUA 2IM1A 4I2QB 4MIAA 3N6MA 4RW4A 3MFHA 4RNFA 2ASJA 4NLQA 2ASDA 3T5HA 3MECB 4J9KA 1N48A 4H4MA 1RTJA 4WFXA 1NHUA 5J2PA 5CYMA 4WYWA 3MFIA 4ZP8A 5F8GA 5EDWA 4LQ3A 3BJYA 2OH2A 4KO0A 3OL9A 1IKWA 3HVWA 4J40A 5F9LA 1R0AA 4B3OB 3BQ0A 4ED6A 4I7FA 3D5MA 4KB7A 3BSOA 4FOKA 5I42B 1RDRA 4RW6A 4TY8A 3KK1A 4NCGA 4RNOA 2FJWA 3QO9A 5KFJA 2BE2B 4OL8A 1RYRA 2WONB 5CYQB 1S1XA 2AQ4A 1RT4B 3H4DA 4M94A 3MEDB 2C28A 3I5CA 1TKZB 3I5AA 3GV8B 5KFKA 4URQU 3PW7A 2W9BA 1RTHB 5KT5A 4IH7A 3NKYA 3C6TA 2XGQA 3D28A 2C2DA 5C24A 4WZMA 2C22A 4IFYB 2IAJA 4ZPAA 1TL3B 3IRXA 1HQEA 4IQXA 4Q0BB 3IN5A 1JKHB 1KLMA 4J9MA 4ED8A 4RW8B 5KFSA 5L1LA 2ZD1B 4MFBA 3TLQA 4RW7B 2V4QA 2D3ZA 5HLFB 1C0TA 3OL8A 2ASLA 4IKAA 2BANB 4J9SA 4EYHB 4DL7A 2R8KA 2HNDB 4I2PA 2V9WA 3DI6B 3HVTB 3PZPA 5DG7A 2WTFA 3MECA 1GX5A 5KFLA 1HPZA 2HNYB 3EPGA 4O3RA 4RW9B 2RDIA 4NLSA 3H5SA 4TYAA 2FVCA 3BSCA 4IRCA 4B3OA 4Y8EA 4NLOA 1QAIA 5MKGB 5I42A 2JC1A 5DLFA 3H98A 3G6XA 1TKTB 2BE2A 1RYSA 2WONA 5CYQA 1RT4A 1C1CB 3MEDA 4IG0B 4O4RA 1JLGB 3LP2B 3FSIA 1D0EA 5DQHA 1TVRB 4ZHRB 2XI2A 3PFMA 3JYTB 1S1VB 4KHMA 3GFXA 1S9GB 4RNJA 4PUOB 3HV9A 1RTHA 3DMJA 3V6JA 3N6NA 2YNGB 4QWAA 2IM2A 1TL3A 4O3QA 4O3SA 4HYKA 2IMWP 3PJUA 4F48A 4O3PA 1JKHA 1TL1A 1LWCB 4F4WA 2BR0A 4RW8A 2IM3A 3G6VA 1IKVB 2ZD1A 1N56A 2DPIA 4RW7A 5HLFA 3NMAA 3M8QB 3QZ8A 5F8IA 4MK8A 2BANA 5EWGA 2J6TA 2AU0A 3RB6A 2ZE2B 1S1UB 4NLVA 3BR9A 4ZP9A 1N6QB 4IR9A 3DI6A 1DTTB 3C6UB 1S1WB 3HVTA 3IG1A 4Q43A 4IRKA 3DRSB 5KFBA 4K4ZA 3OHAA 4Y3CA 1I6JA 2HNYA 4NZ0A 3DLGB 3OSNA 2VA2A 1LWFA 3CJ4A 4RW9A 3GIIA 1S9EB 5DGBA 1S0OA 4LSLA 4KKOA 4TYBA 3I0SB 5KG3A 2VG6B 2FVRA 1HNIA 3DRRB 4K4TA 5MKGA 3UR0A 1VRTB 3T1AA 5DG9A 1QAJA 2JLEA 3KMQA 1TKTA 4ZP6A 4JV0A 3GIJA 1JLCB 4WE1B 1N5YB 4EBDA 4XPCA 2OPRB 4EO6A 1T3NA 4FS1A 5KFAA 3MR3A 4O3OA 4YMEA 3RB4A 1BQMB 1JLGA 3H5UA 4HJFA 4NLWA 1XR6A 4DG1B 1RA6A 1RT6A 1S1VA 2WRMA 4U7CA 4ED1A 1SUQB 1JLQB 4ZVGA 1K1SA 3QGHA 3V81B 5KT3A 3LP0A 2I5JB 5FDLB 4EEYA 2VG5A 4MKAA 3BREA 4YQWA 5HP1A 2FJXA 5KFDA 3OL6A 4WZQA 1REVB 5KFEA 1LWCA 5KFHA 4NLUA 3QIPB 4DL5A 2E9TA 1IKVA 1FKOB 2EC0A 1D1UA 4RUCA 4ZMMA 2HNZA 1QE1B 3CO9A 4NLXA 3EPIA 1RT7B 3DYAB 3I5BA 4FS2A 3OHBA 3TVKA 3CJ5A 1DTTA 1RT5B 1S1WA 1TV6B 3C6UA 1MU2B 1LW0B 3DRSA 2FLNA 3EZUA 2XCAA 1HQUA 4PWDB 5J2NA 3H40A 4NLGA 3DLGA 4O44B 4KE5A 1IKYB 3QZ7A 4TXSA 2IM0A 1S9EA 3IGVA 3KHRA 4Y2CA 5L1JA 4F50A 2UVVA 4ZVFA 3I0SA 4O4GB 2VG6A 4AG0A 2W9CB 3DRRA 4DEZA 3M9MB 1RTDB 1N5YA 2XC9A 4K4UA 1JLCA 4WE1A 2OPRA 3CJ0A 4URGA 1S6QB 3FDSA 1BQMA 5F9NA 2AGPA 4Q6JA 2R2UA 2OPQB 2R2RA 1SH3A 1SUQA 2WOMB 1C2PA 3QLHB 3Q8PB 4F4ZA 1JLQA 5KFMA 4WFZA 3V81A 1KHWA 4Y9OA 2B6AA 2I5JA 4IDKA 5FDLA 1S10A 5KFQA 2VG7A 4LJ3A 4QWCA 1REVA 4LSNA 2YKMB 4ECTA 4J9QA 1S1TB 2HWHA 2YNHB 2DPJA 4ID5B 3GFYA 1RT3B 1QE1A 5KFCA 3MR6A 4GC7A 4H54A 4IH6A 1RT7A 3DYAA 2XGPA 1T03B 3MR2A 4IG3B 3N3TA 2IC3B 3FQLA 1HMVB 3QGIA 1RT5A 2V4RA 2W8LA 1TV6A 1MU2A 2B43A 4QW8A 1LW0A 3LAKA 2FLPA 4PWDA 2BQUA 4I2QA 3HKWA 1FKPB 3KLEB 3BGRB 4KSEB 4O44A 3NGDA 3JSMB 3LAMA 4G3IA 2IA6A 2CJQA 5EUHA 1IKXB 2V0NA 4NLDA 3OL7A 4YR2A 2I1RA 2AGOA 4JV2A 1RAJA 4ED7A 1RTDA 2D41A 3U2EA 3V4IB 4WXWA 4ECXA 3TAMB 5KG4A 3GFZA 1JX4A 1FK9B 3BSNA 1S6QA 4PQUB 1RTIB 4LQ9A 2FVQA 5C25B 5C5JA 1S6PB 4IH5A 3KNAA 1MMLA 4J9LA 2OPQA 5J1EB 4RNMA 2WOMA 3KMSA 1S97A 5KG5A 5MF5A 1TKZA 1S49A 3S83A 5KFGA 4RNHA 1S48A 3M9OB 3H2LA 4R0EA 4ECUA 2E9RX 3V6HA 5DQGA 1ZTWA 4NRTA 3GIKA 4IFYA 2YKMA 4WYLA 3PR5B 1S1TA 3SFGA 3KLGB 2YNHA 3V6KA 3FQKA 4MK7A 5KFWA 4ID5A 4Q0BA 2OPPB 3SFUA 3KLHB 3CWJA 3MTKA 1T03A 4HU3A 4IG3A 2IC3A 3KLVA 3ISND 1HMVA 4NLTA 2ILYA 4EYIB 1S4FA 1SV5B 1QUVA 4K4WA 1TKXB 2HNDA 4XPEA 3NBPB 2B5JB 3GV5B 3KLEA 1KHVA 3BGRA 3KK2B 4RNNA 2UUWA 5K14B 3KHHA 1IKXA 1BQNB 1U09A 5KG6A 2AX0A 4QW9A 1T94A 2R2SA 1T05B 5F8HA 4IRDA 1VRUB 2OPSB 1HNVB 3PW0A 1N4LA 4ZPCA 4NYZA 2J6UA 4Q45A 1JLFB 4YR0A 3V4IA 4IOBA 3PW4A 1IM4A 1EETB 3FRZA 4ECVA 4G1QB 4DL4A 4QWEA 4ED3A 5C25A 5KG0A 1S6PA 4KHRA 5HROB 2W7OA 3PW2A 1DLOB 4ICLB 5J1EA 4U6PA 3PR4A 1WNEA 1C1CA 3ISNC 4IG0A 3IS9B 3LP2A 4QWBA 4DL2A 2BQ3A 4EBCA 1K1QA 1TVRA 4ZHRA 3RBEA 3JYTA 4R5PB 2D3UA 1S9GA 4PUOA 4X2BA 2UVRA 5DQIA 3RAQA 3T19A 4KV8B 5KG1A 4TQRA 2YNGA 2XCPA 1YVFA 3KLGA 4H4OB 5F8LA 2R6OA 4WFYA 5KG2A 3DLKB 2OPPA 3KLHA 3SY8A 4ZPBA 3RBDA 2HAIA 4Q8EA 1XR7A 2W27A 4KO0B 1JLEB 1IKWB 3DM2B 1EP4B 3M8QA 4MH8A 4DL3A 1LWEB 3UPFA 4IR1A 2BRLA 2XI3A 3PJXA 2ZE2A 1SV5A 1C1BB 1S1UA 5M1TA 1TKXA 4TY8B 4KFBB 4NCGB 5I3UB 3NBPA 3KK3B 4ECSA 1N6QA 3CDEA 3KK2A 5KFZA 3CIZA 5K14A 4M95A 1BQNA 3PW5A 2IJNA 2BRKA 3VQSA 4URSA 5C42B 3DOLB 1T05A 1VRUA 1HNVA 4JUZA 1CSJA 2W9BB 3MF5A 3LP1B 2HWIA 4J9OA 2YKNB 3CVKA 3PHEA 1VRTA 4EO8A 2WB4A 4YP3A 3GV7B 1J5OB 1UWBB 4LYKA 5J2MB 1HYSB 3DDKA 3IRXB 1HQEB 4ZVHA 5HROA 1S9FA 1GX6A 4ICLA 1KLMB 3MEEB 2YNIB 5DG8A 4MFBB 4Y9MA 3IS9A 3RAXA 2FVPA 5HBMB 2FVSA 1C0TB 4DG1A 3GQCA 4J9RA 4GC6A 2AWZA 1JLBB 1LW2B 2AX1A 4MIBA 4RNIA 5KFYA 4NLPA 3KOAA 4XO0A 4KV8A 3PJWA 5KFPA 3OLAA 4ECZA 4HKQA 1HPZB 4H4OA 4ZP7A 3V6DB 3KHLA 3DRPB 5F8JA 3DLKA 3QIPA 3IGNA 3KLFB 5KFVA 1FKOA 4J9PA 1DTQB 1JLEA 3DM2A 1EP4A 3RB0A 1LWEA 3GILA 2R8JA 2W7PA 5KFNA 1XR5A 1C1BA 4WXOA 3NL0A 5I3UA 1JIHA 4KFBA 4ZPDA 3KK3A 1RA7A 4RUAA 5DGAA 4ES4A 1NNDA 4FBUA 3GYNA 5KT2A 3MEGB 3QYYA 4F3HA 2BQRA 2R8GA 3DOKB 1RT1B 4Y9NA 4FBTA 4ECWA 1IKYA 4O3NA 3DOLA 3G86A 5C42A 2GC8A 3LANA 2GIQA 5KFOA 5KT7A 1S0MA 4K4SA 3M9NB 2IJFA 2WHOA 3DMJB 3LP1A 4O4GA 4TLRA 2W9CA 5D3GB 5F8NA 2F8EX 3Q8QB 2YNFB 2YKNA 3M8PB 1J5OA 5KFRA 1HYSA 2GIRA 1UWBA 5KT4A 4TN2A 5EWEA 4ED0A 5J2MA 2ATLA 2UVUA 1SH0A 1TL1B 4Q44A 4ECYA 3MEEA 3N6LA 2YNIA
chains in the Genus database with same CATH superfamily
1H11A 4D6CA 3H53A 3OIHA 2FGCA 4K4XA 3HHKA 3GWQA 4HI1A 2JEPA 4F8XA 4DZIA 3WSUA 1LW2A 2WSPA 6FD1A 2UV8G 3TVZA 2ZZ7A 1OFRA 2D74B 4LAKA 5HL7Q 3P80A 3VGHA 1NFGA 1U2RA 5CBJA 1VIOA 4A8WA 3THQA 2E9ZA 4ZVSB 1VC6A 2YTCA 3HG5A 3VGFA 2X1BA 2LVWA 1NSQA 1XR2A 1ZPTA 3VZIA 1JXKA 2CNKB 4JZ5A 1P0BA 1NHKL 4KIRA 1W5NA 2H9ZA 1RT6B 3N15A 2UUCF 2VDHA 2VWTA 1PBUA 3K46A 1RHMB 5HVHA 4MKSA 1WKLA 1VBGA 1ZAWA 4IPLA 3G8QA 3DGPB 4S3DA 2J77A 3F56A 1IEVA 5CJNA 2FB0A 1XBXA 3FAXA 1MWOA 3G5EA 2CPJA 3SURA 1HL8A 1WOSA 1WAWA 4X66J 2VC7A 1YADA 4JEJA 3DLEA 3T2QA 3BW3A 4CRJA 3LERA 1GOIA 4OYMA 3NWGA 1ISVA 1FWBC 4JP8A 3Q8SB 2MJUA 2QIIA 4L65A 2VKZG 1N55A 2WMIB 1EDGA 1EYEA 4X62J 1G9HA 4DR1F 1Y9OA 2BZ2A 2V5DA 2JOQA 4S38A 1HG3A 1TA3B 2C2RA 4DELA 1R0AB 3SYZA 5LNSA 3LUTA 3LLFA 2XY7A 3TTSA 3ZTRA 4TVAB 5AC4A 4FYDA 1HW9A 3WF1A 2RKIA 2YL5A 5BCAA 1E3ZA 3QIDA 4NI2A 2NV1A 3MHGA 1TJPA 3PUDA 2UUTA 3E49A 5IC6B 2DUAA 1EETA 4U10A 4D6FA 1XMOF 4Z7YA 2W2NP 3HM9A 1L8NA 2NYIA 2BV9A 2HHUA 2LKZA 2FFCA 3A3HA 4R5PA 4ZSTA 2EBEA 5FF7A 1RWOB 1ODZA 5DM7Q 3AWNA 3UR8A 3C56A 1EGMA 3AXHA 3UJFA 4E3VA 1V08A 3MFIA 3MKKA 1Q63A 3OL9A 1R86A 3P60A 3BSGA 1SJAA 2B8PA 5C9XA 2BVZA 2HHQA 4IIDA 1ZCCA 3I65A 1IM6A 4RW6A 1ZGDA 4NCGA 4EZ6A 9RUBA 4S3FA 3AXKA 1RT4B 3N28A 4O0IA 4ASTA 4HNVA 5M5DA 4URQU 1KBJA 3R97A 1RV8A 7ODCA 2W9BA 4LFAJ 4X0NA 3GHTA 3SN1A 3V35A 2GDQA 1US0A 2V5HG 2E09A 3DXBA 2J13A 2YYUA 4C65A 4UZBA 4RW7B 4LF9J 3GMGA 1J0ZA 1AJZA 1Y4ZB 3TH6A 2J7CA 4DL7A 2DT1A 2QF7A 3GHUA 4MAZA 4JI6F 1W1A1 1R8AA 3BW2A 1B0IA 3ZNUA 1RJJA 3AOCA 4I90A 1YJ7A 4Q4MA 4M5GA 2FJBB 4EK2A 3B8UA 2QCFA 2MPUA 3H5SA 3O3LA 2X0YA 4IRCA 3BZJA 5AHFA 1B9BA 1IYXA 4YN3B 1QAIA 4EAMA 5FAJA 2KL8A 2NVCA 3DOMA 4JV5F 4DJFA 3P6LA 2C3PA 4O4RA 3FSIA 1Z89A 1C4CA 5DDOC 4QCEA 5B08A 4USHA 2CBJA 3I6RA 3TKFA 2BXVA 2VR4A 1K8XA 4JTCA 5C8BB 2C79A 4V19X 5KZEA 3O06A 1SO4A 2G95A 3WFZA 4PRTA 3LCIA 4TU9A 3G6MA 4F4WA 2DPIA 1OINA 4OOUA 2B0GA 3GFHA 4E4PA 2PMQA 5EWGA 3VAFA 4DUZF 2QEXS 1MW1A 3O6DA 4C2MA 1UOKA 2PS2A 2ZBQA 4Q43A 3DRSB 4XZWA 3PIOQ 4H00A 3TMLA 4AZ5A 2GW8A 3CJ4A 3L95X 2GVLA 1TV4A 5DGBA 4Q33A 3F41A 1QO5A 3ZMRA 3WELA 5G4EA 4OV6A 1GVSA 4USUA 3L7RA 1XMQJ 1UA0A 3RXZA 2BKNA 1AODA 3K8MA 4K8RA 3J7HA 3HMJG 3CCTA 4GYFA 3ITCA 1UB3A 2YCJA 3VAIA 1YJTA 2H1YA 4NLWA 3R7BB 3L5MA 4NF7A 5I3FA 3OU8A 1FCAA 2DTJA 4EEYA 5K20B 3NQBA 1UJ6A 1REVB 4WZQA 1N5VA 4UTWC 1Y5VA 1UWQA 1AFIA 4H41A 4B2DD 1RT7B 3DYAB 1RQBA 4CNOA 1Z69A 4ZJQA 4FP1A 5E7OB 3EZUA 1FP8A 4NLGA 1EA0A 4O44B 1EKOA 2GGPB 4DYJA 1O6IA 2FVMA 3L0GA 2W9CB 2E4TA 2G3IA 1UKOA 4G1PA 4PMVA 4AZHA 1QW7A 3MVIA 5LXEA 3UW1A 4CI0B 1N32J 4QSHA 4WSKA 1VQ5S 3DFOA 4Z1AA 4ZCLA 3DG6A 2AGPA 3PF3A 2OSRA 2G5WA 3UZXA 4PEOA 2YA1A 2INFA 4LR7A 3LGHA 3SCTA 4UT4A 1EZWA 4REQA 3W4RA 4DPTA 2TODA 4JBRA 4N7TA 3SUVA 2F65A 3WFAA 4L4LA 4OHXA 3LRLA 4GYJA 3ZLFA 1T03B 2CBVA 1RBAA 5LNVA 2QL5B 4GGHA 4NZ4A 4LPCA 1G4EA 2BQUA 3HZGA 1G4CA 3TW0A 2EWHA 3PBWA 4C6NA 3W8PA 2CITA 1LOLA 1UVJA 1FDYA 1LTDA 3VGEA 4UZCA 4LB4A 1Y5XA 3GNDA 2AGOA 1RAJA 3AUJA 1A7GE 3A9IA 1FERA 5KG4A 5C25B 3VABA 1S6PB 4IH5A 1MW7A 4FPIA 1QOQA 2WOMA 2FTWA 1MEWA 1K9FA 2XYGB 3E02A 1S48A 2VFRA 1Q6DA 1Z3NA 3V6HA 1OK4A 3ILJA 1U1NA 4NRTA 2LA6A 2WSKA 3GHRA 4HT3A 4N4QA 4CQBA 2CNNB 4N9CA 4AC7C 4C0HA 2YQ3A 3EB4A 5D38A 1BY9A 3IBFB 4DBQA 1KV8A 2HFUA 3KRSA 1TKXB 1H2VZ 1K0TA 3VI2A 3W26A 4QR0A 3W60A 4DWDA 5FSDC 2XYLA 1R27B 4MJ2A 1TB3A 2OOFA 3S0CA 2CQ0A 2OPSB 2KH9A 1K6WA 4W8AA 3STGA 3RO8A 5M03A 3MMUA 3PX6A 1QI4A 3WMBA 2NZ4A 3FDGA 8A3HA 1AFSA 5J5RA 3M5VA 3PR4A 4EBCA 3RBEA 3JYTA 3TP2A 5C5YA 4D2JA 1JDFA 1S5TA 4KV8B 4TQRA 3NGFA 2YX1A 2ZOXA 3MAQA 2XYPB 4LF4F 3PIPQ 3BARA 1KONA 3RBDA 3ME3A 2BLEA 2FTRA 1JVNA 1QI3A 4IGHA 1JQVA 2QCMA 4GHRA 3MZNA 1B4KA 2R9LA 3L4TA 1FHLA 1T05A 4A8RA 2D2GA 2NXHA 4K7QA 2CU0A 1YDNA 3I6EA 2GHPA 3DFNA 1J96A 4YP3A 2FQIA 4B9MA 1FWRA 1LBLA 3WBXA 1TVPA 4QBUA 3K1DA 1WCGA 4X64J 3B9NA 2DZSA 4YTUA 4M5LA 3AA8A 3H2VE 2VTFA 2O7SA 3GH5A 5A2AA 3W27A 4P2MA 3PXGa 1DQWA 4HNNA 4XO0A 3WEMA 3BQ6A 5TD4A 4IFKA 4ZK7M 4CLLA 1EJ7L 4HNUA 3QV7A 4JCMA 3B8DA 2IDEA 3HHLD 2OFJA 4NSBA 3V16A 3DM2A 4PG8A 4GLEA 5KFNA 4KEMA 1XTZA 2E66A 5AHIA 1GQIA 4DAFA 1CLFA 2O92A 1SZEA 1XC9A 3QYYA 2MB0B 2QDEA 3KOYA 3PBGA 1QHOA 4LFBF 3RILA 2XO7A 3TDFA 3PYGA 1XLLA 1N0VC 4JQAA 1VBZA 5DBUA 1DJZA 1LORA 1ECEA 2YSWA 1YDOA 1GUVA 5KFRA 1Y8BA 3RRGA 5E33A 1NJZA 2A4AA 2JKAA 2YDRA 1CXFA 3S1VA 1XV8A 3UWVA 1OS5A 4XUGA 2RF2B 5CD4A 4S3KA 2J0WA 1NVMA 5BXRA 3C66A 3NM3A 2AIRB 1F5CA 3UCCA 1DJQA 1VDHA 2CLIA 1OFDA 2XU2A 3C2FA 1IJEB 3TVYA 3GP9A 3OGRA 1LWFB 8ATCB 4C0OC 3AB2B 3RU6A 2PRMA 2ANUA 3NNTA 4QRNA 3ITGA 3W7EA 3UDLA 3UF9A 3CIWA 3PR2A 1K03A 1F2JA 1YGYA 5IXEA 3WF4A 1FWWA 1PIFA 2FIQA 4PXEA 1OFBA 3WNOA 4OOZA 5A6MA 1WG5A 1JAEA 4M80A 4Q8NA 4PUMA 2N82B 4O50A 5E3RA 1SO3A 5FIPA 1S2WA 3M7SA 1KVJA 2RRNA 1MG7A 4RE4A 2RILA 4IP7A 4NMXA 3VZYA 2Z8QA 1EKSA 3CZJA 3TTYA 1FTXA 1IF2A 2F2KA 4LBHA 4RDZA 1QVFR 1M5VC 3DFEA 4N8NA 1NHVA 2WSRA 4Q8VA 2D2OA 4BF9A 2LMIA 3T5LA 1B54A 3CAWA 4H01A 4LUBA 3MA8A 2PDCA 3OIXA 4USIA 5A8PA 1S79A 3WDHA 1C0UB 1RK8A 4DXKA 3CL7A 1FHVA 2R94A 5I7GA 4ZDNA 3KBVA 3R94A 4CO5A 3OBKA 2V4JA 4PMRA 4M1RA 2PD1A 2WJEA 2PDPA 2XY6A 4WCEQ 3O7UA 3RR7A 1VRQC 2J8SA 2U1AA 1B30A 2C8NA 3STPA 2FPHX 4K8GA 4P75A 4FK9A 1YBAA 1OX6A 1X4AA 3VNMA 3X3UA 1NKBA 2IKIA 3KJVA 1NK8A 1IWBA 4QIUA 3QW3A 3UN3A 3M16A 3M0HA 1UEUA 4HA4A 1MLAA 3NDZA 5JVLA 1F74A 3AQOA 2NPFA 4I8DA 2YH1A 1V3JA 1FVSA 3POHA 2IXUA 2XZ7A 2EFGA 2Q01A 3XIMA 2NZCA 1YRUA 1T7PA 2HQIA 3CO4A 3LM7A 1WELA 2ASJA 1RKJA 3M2RA 1XUZA 4XWUA 3WF2A 4OVXA 4AIUA 2V69A 4I6WA 4KGKA 1JI1A 1NHUA 2YXGA 4WYWA 5AT1B 4FVMA 4RWXA 3GG7A 3G1RA 3L09A 3BLDA 1UUMA 4OMFG 4E98A 4H83A 5I07A 2X1GA 2XNQA 3LM3A 1DIEA 1XN9A 1U8SA 4TY8A 4C48A 2FJWA 1IUJA 2VD8A 5RUBA 3JS3A 2RAGA 1VBHA 2C28A 1B57A 3SMZA 2D2JA 3TR2A 2C3OA 2PGRA 3D3AA 4MLRA 2KRBA 1RTHB 2XGQA 4W89A 2Z2LA 3UCZP 1QUMA 2AJ0A 4BFAA 1O5XA 4HSHA 4AISA 4JTIA 1C0TA 3NO1A 1HW8A 2WMGA 4GIRA 3R0KA 4AC1X 1SJQA 1CJKB 2VD9A 3DI6B 2AL1A 3HVTB 5AXMA 1OIMA 3OYZA 1VCVA 3T8QA 4RXGA 2GQ2A 2IQ0A 3M64A 5JIPA 3MMTA 3C15A 4GZEA 1WHYA 5LNRA 1H5YA 4P10A 2KI2A 4DPOA 2H8XA 1D9DA 1PHQA 3UDEA 3UPWA 3MSRA 4P8VA 3TZFA 1DJ0A 4X4SA 1JF6A 5KMYA 2DH2A 3LP2B 4ZHRB 2Z29A 1FRKA 3OVAA 3WENA 5G5IA 3KKFA 3RRHA 1Q6OA 3WNMA 1ZLPA 2EHHA 2AJ2A 2YNGB 1TELA 5CZTA 5I2UA 4O3SA 4O3QA 5AE1A 1DZ5A 1NEEA 2G97A 4PXBA 3ZOAA 5HMXA 2E5IA 3GIPA 3CDBA 2IM3A 3G6VA 2ZD1A 1XS2A 1C90A 3S2NA 4GY7A 3M8QB 4XAGA 4KS0A 3TFXA 4Z0JA 1YNQA 3HMCA 3CQHA 3W01A 4IHCA 1VS1A 2Y6ZA 2YQ1A 1SL0A 2WV8A 4AX7A 5LMNF 1IXNA 3FKRA 2SFPA 2ZH7A 1QJWA 6XIAA 2QTWA 2WZTA 4KKOA 3LD5A 1U8WA 4Q8OA 3R6GB 2FVRA 1XNQJ 2FGBA 2D69A 2EPNA 4LF5F 3WCZA 1CXHA 4QJ5B 1GMWA 2Y8UA 2Y5JA 2WPGA 1BQMB 1JLGA 1L6SA 4NCBA 3TFCA 4DG1B 1V3MA 2GGIA 3R13A 1J9YA 4BA0A 5KOXA 5DY2A 3N29A 3NGSA 4OHWA 5EBUA 1FKWA 3TTOA 3IBWA 1P1TA 1M5WA 2QA1A 3BREA 3M6DA 4PMDA 3Q4DA 1B2YA 3W7MA 5DO8A 1N54B 4AZGA 4RUCA 3L7OA 3MZIA 3PCOB 4W8BA 2R7XA 3UXDA 4PXDA 3T55A 3J80Y 1H63A 2HSAA 3BLIA 4A4JA 1RISA 1DTTA 1RT5B 1A4MA 2NQ5A 4MB5A 1SJDA 1XM3A 5TAOA 4GFSA 1S9EA 4MWAD 3FNNA 2GVDB 3GB0A 1X31C 3PNIA 4O4GB 2DGQA 3DRRA 3SUSA 1JUEA 4GJJA 1UJQA 3CAQA 3M9MB 3UY7A 1RTDB 2E6FA 1XXXA 1JLCA 2WAQD 4H6QA 2OJ3A 4JR5A 5DZ7A 3P8BB 4EGLA 4B3SJ 1YXCA 1WF1A 1HP4A 3F4VA 2R2UA 2XH7A 3FVYA 2J4GA 1B31A 1PCAA 1UZ1A 5CBIA 1JLQA 1FA2A 3U57A 3V81A 1S10A 2IIHA 2IKJA 5DF0A 4PRFA 1SO6A 4UTTA 4A8FA 1R9ZA 2YZ5A 5EL1A 5IQ6A 1HO4A 4ZIVA 3ZT7A 4P2VA 4TXEA 2ZKTA 4O1BA 4C3KA 5A8RA 3F4CA 1LUCA 1Q85A 2HG4A 1J6OA 3FJNA 3M05A 1RVKA 4QG8A 4QFUA 2V0NA 3GU0A 1BF2A 2RUGA 1FDZA 1W31A 3BE7A 4O1FA 5H9FK 1BYBA 1CW2A 2DSZA 1X7IA 2TAAA 4A8XA 1U0SA 2C3UA 2L48A 3VD9A 3TAMB 1LEOA 1ZBTA 1V3ZA 3C52A 4ANCA 1EJVC 4WDUA 1N88A 3EUNA 4PMZA 3PNZA 5ETNA 4CD5A 4XDCA 1T40A 5GADI 2AQVA 3M9OB 3H2LA 2QSWA 4K68A 1EGVA 4RZ6A 4QCLA 2YKKA 2OYKA 1YJNS 4MNMA 3KLGB 1S1TA 5IV4A 1QVGR 3UFCX 2PZNA 3CQJA 3SFUA 2HWGA 4DPYA 4K1WA 2BYCA 2O66A 4X2PA 3C16A 2P0OA 5LIXX 2Z00A 2HS8A 3RLUA 2NWSA 3EBVA 4UOFA 3HGOA 3M6YA 1Z42A 3PEHA 3UA3A 3FA4A 2UV8A 4PTWA 2EI5A 5E9XA 2PO4A 1BPLB 3TSMA 1MFUA 3VINA 1CZ1A 1A3HA 4AQLA 5GJMA 3TTQA 5I00A 1UD2A 2GJNA 2IKGA 4ZPCA 1T99A 3OTOF 1NFBA 3T1YJ 1K73T 2F8MA 4DV4J 1RP5A 2BX6A 1OY6A 1WNEA 3TTEA 2KYXA 1BXBA 4BBYA 2A6MA 1S9GA 4DY1A 2CQ4A 5DQIA 2UVRA 4I5XA 2XSJA 1E0XA 2J7GA 1IXKA 2B7QA 1Y00A 4WUIA 1KKRA 2F7VA 2CPIA 1WG4A 4L5ZA 2R6OA 1AD1A 3R6LB 4OBSA 1HBNA 4Q8EA 4ZPBA 1XYFA 3VGVA 4ZCWA 1P0DA 2KVQE 1U1OA 2UXCJ 5CPNA 2XI3A 5M1TA 2NREA 6REQB 4JDBA 3CIZA 3GR0A 4M95A 5C9RA 3D0CA 2VGFA 3UJSA 2RT3A 2ZA3A 3MMBB 2PU1A 1EF3A 2M4MA 3WEZA 6XIMA 3QLLA 3WLOA 3CEDA 1XW8A 4ROPA 5EMMA 4ICLA 2YX4A 3UVJA 3PRDA 1G6CA 5BNKA 4HPJA 2HS4A 2VR5A 4YDDB 1KP6A 4KRWA 1AH3A 5A2CA 3RJYA 3ULHA 4YXGA 2PP0A 4JOUA 5TF0A 4OV9A 4EOUA 1LROA 3C0LA 3CMFA 1LWEA 1AZ2A 3TYDA 2QLBB 3QN3A 4NZCA 3ARPA 5BRBA 1WEXA 4ERAA 4I5UA 4RUAA 3SBFA 5H1WA 3K8KA 4MM1A 1R38A 1S4EA 2GVZB 2PTZA 1I6NA 5HA7A 1RABB 2QCDA 3C61A 3RX4A 4OYWA 3H2AA 2DVIA 4DJED 3N4FA 4KGVB 1PTDA 4B3ZA 1PCKA 2GUBA 3WQEA 2RU3A 4B9SA 2QT3A 3OFGA 4JHOA 4DFMA 1ME8A 4FX7A 4ILLA 2Z57B 5E3QA 1ZPWX 4CLUA 4CZCA 4NI8A 4DZHA 2QMXA 1I1GA 1QUPA 3A3OB 3V1HA 1V6TA 2CJ9A 1MWZA 5JUMA 4PUDA 3W2VB 4I68A 3KLFA 2DITA 3OPKA 2NX1A 3GG1A 3QPIA 1RBLA 1V4YA 3UVAA 2OSXA 3PAOA 3R5GA 3URAA 2CPXA 1KTNA 1VBJA 3E38A 3MGJA 1WSVA 4JQ3A 3V18A 1KWGA 2PDAA 4UBPC 4UFMA 2QIWA 4HA3A 4W5UA 4LVBA 3A12A 2HIQA 5G2IA 3M0XA 2XPKA 1K4HA 1M7OA 2HNHA 2HMIB 1QAPA 4JYEA 5LNUA 3POTB 4PQUA 3H59A 2P6SA 3VD7A 1JZ7A 2NUXA 4OUIA 4I8YA 1LZOA 3WNKA 1TV5A 1KM5A 3G8RA 3S5SA 3E01A 4MYTA 3L2LA 4IQMA 4F66A 2E8ZA 2WZHA 1HKKA 4LSBA 4FIQA 2V5CA 2AJQA 4DV7J 2V63A 4OJYA 2NQLA 2ISVA 5KFFA 1H62A 4WSHA 3NCOA 4PMXA 1QW9A 1O95A 2Y24A 5HMEA 4QJ1A 3MMDA 4PMJA 1IT0A 1Q8LA 5F8MA 1EOMA 1QK0A 2YDAA 4K39A 3SGGA 1QNVA 4O53A 5LM7E 2Q3PA 2J24A 4QNWA 3WL1A 1Q5MA 4JN8A 2O7QA 1IIHA 1Q66A 3TNOA 1FA0A 6AT1B 3GAKA 3TX8A 1A5NC 3GX9A 1BWKA 2DSVA 1SKSA 3CDWA 1AA1B 1VOMA 4ZVEA 4DSEA 2IAJB 1U26A 4X4PA 4DJFC 4DLGA 3OLBA 4ES3A 4D9PA 2Y63A 1URNA 4IMAA 3LSBA 3AD8C 5CAAA 1IT8A 2KZZA 2PGFA 1HBMB 2PGEA 3DI0A 1F5ZA 3IC1A 1R0BG 5AOUA 3N6MA 4E0CA 3VZZA 1VRDA 4UQTA 3OFHA 1HVXA 5M3WA 1RTJA 5J2PA 3HKZD 4WJ8A 2V3DA 5C71A 3IFEA 2L9NA 4N56A 3SSZA 4JTFA 4A8SA 4ED6A 4K0KJ 3D5MA 1PWLA 3WNPA 7AT1B 3QMSA 3NAVA 3EA1A 3B8VA 1C3FA 1OZQA 2AGTA 1SJBA 3H4DA 4IIBA 1A0DA 3ABXA 3H7RA 3TYUA 1OIFA 2VHLA 1SMAA 4DV5J 1IVZA 2YPIA 3EDJA 4JYAF 5CGTA 1A5MC 3T2PA 2FTPA 2C2DA 3HT0A 2GVEA 2JEQA 1IQ8A 2QCGA 2GJRA 3W66A 1R2TA 3W62A 4WP8A 1RTZA 1GNXA 1Z2LA 2XSFA 4WJBA 1E55A 2AQWA 2JF7A 5IV3A 3RW6A 4EYHB 3T6BA 2ISFA 4KF1A 3U8GA 1N34F 3W7GA 4WCJA 2R1NA 3LXCA 4MPKA 2WHMA 3IAM9 1UHVA 4GVLA 5DG7A 1E43A 3GUGA 2CQ3A 1DIOA 3IUHA 5JUVA 2VCAA 3H7VA 2ZUWA 3UGVA 4MYAA 2XGIA 3G6XA 4MWAB 4XAYA 4BS0A 1GMVA 5EN1A 4QDWA 1IGWA 3QRHA 4C91A 1H0HB 1TE6A 1P8GA 3SXLA 1LDCA 4LBRA 1JJCB 1P7TB 3ZTPA 1IIGA 2RH9A 4XK2A 4ZQNA 4P7TA 2HVIA 1P1LA 4HR2A 2ACUA 2Y1HA 4IUFA 3HHNB 4PG4A 1I0BA 1X4HA 2COLA 1TRIA 1IKVB 1PJ5A 3NEHA 4YY3F 1E6YA 2AU0A 2Q6CA 1E9YB 1QOXA 4FF5A 5EFFA 3H54A 4W84A 1HLWA 1S1WB 3CTRA 1WC6A 1FXPA 4MZYA 3J81U 4CDIA 1SJRA 3BBBA 4XTDA 3OSNA 2K7JA 3K1GA 7FD1A 4U28A 3DFPA 1KGUA 1LRTA 4IYQA 3UR2A 1DJWA 4TYBA 3FBBA 4L72B 4DS4A 3HG2A 1PJ7A 1YSJA 3IGXA 1NK0A 3NGJA 3SM0A 1N5YB 4JTQA 4GUJA 3B78A 1OB0A 4HHHA 1OEPA 2ZFAA 4H9VA 1F3VA 3AAWB 1X5TA 4GXWA 3TX9A 3VNIA 3I4KA 4U3CA 4CLKA 3CCUS 4O23A 3KLLA 4M56A 4YN5A 4C6QA 1V6VA 5B0AA 4JTEA 2J9DE 1I94J 1K1SA 1ISZA 1PX8A 2P8IA 3LA0A 3PKYA 1CYGA 1MSSA 1UBPC 3PB2A 4YWSA 5HP1A 1R2RA 3EXSA 4C97A 5GAHU 3W7KA 2ZWZA 2P3EA 3IGHX 2OSQA 2CVIA 1RB0A 3BVJA 4DL5A 4XVDA 1XLEA 4G1IA 1K7EA 3KG4A 3T0AA 5K4ZA 3GVRA 3TVKA 1QHPA 3H2FA 3PZIA 3CJ5A 1QK2A 3OOQA 3I55S 4E6MA 1GW9A 4Y2KA 2NXGA 3EA2A 4GVBA 5CQ1A 3OO2A 4W7WA 3I7QA 3B82A 2MQPA 1KFCA 1NP2A 1DJGA 2K1RA 5B0EA 2CPFA 2W66A 3MP5A 5HJYA 3VM7A 3AJ1A 4DEZA 4GBUA 3QT8A 3E5BA 2VFHA 2W01A 2OJPA 3PY8A 5GADU 4AWUA 2OPRA 1MUWA 1EJUC 3NOCA 4QOTA 1SW3A 3BKFA 1K4GA 1LXNA 2H65B 1E0WA 1W9VA 4DQSA 1XH1A 2YWFA 3AMKA 1SL2A 3S5NA 3T09A 3A4AA 2HHSA 3F03K 5SZTA 4L4MA 3S9YA 2VG7A 1T02A 3TW9A 4HHPA 1N33F 1U6FA 1WDDA 5IT9U 4TQTA 1DTNA 1C93A 3CAKA 1MVYA 1HBOA 4RR4A 1E6VA 3T9ZA 2IHR1 1ZAJA 3ONCA 3TA0A 3CV1A 4M5IA 3UXAA 4JAWA 1UR1A 1IKXB 1WDSA 4C5YA 2BEFA 1W2PA 4QYZJ 1NKEA 2A1BA 2N7CA 1PS9A 3DC0A 2BW7A 3DGVA 4JI0F 1WF0A 4XVEA 3BQ5A 1MO0A 1EDTA 4OX6A 4MWAE 2J8GA 2ZNYA 2XGBA 3TR9A 3KMSA 4JNMA 2DGSA 3NGRA 4JFSA 3T1HJ 3PYEA 3ANVA 3N9SA 4ZITA 4ECUA 3ENAA 3W7QA 2GDUA 3J81j 4ACZB 1A5AA 3VWSA 2R9RA 1TV2A 2J7KA 3GIKA 4LS2A 2P5VA 3R5JB 2HHHJ 1A3WA 4M1KA 3HJZA 4Q0BA 2ZBIA 3QRQA 1RACB 3TUUA 2B7CB 4FF7A 4JFTA 5D0HA 3NBPB 2OMLA 2YBVA 4OBRA 3W3OA 3N6HA 1SL1A 2WB1D 4HIBA 1E72M 1ZM2A 4MZ1A 3R7NB 1KM6A 2JLFA 4Q8MA 2C42A 4HA1A 3ZLHA 2XIMA 3W82A 4QWEA 1UC4A 3V1PA 4ONVA 3UXIA 4PTXA 4IGMA 3ABSA 1RWXB 2RS8A 2PC6A 1O51A 3QBCA 3TJ4A 3CULA 4C8ZA 3KVJA 3N01A 2MUCA 1CIUA 2YKPA 1PEZA 2VEPA 1V7AA 3ENWA 3T19A 2KZMA 2D3OR 4JI3F 4CM2A 2DIVA 3HN3A 3R8YA 5DDRC 2KX9A 2CIMA 5HANA 4HPXA 4UF4A 3RIKA 2NQJA 1J27A 5D8ZA 3RCMA 1L3UA 2J8TA 4XUYA 2WSCC 2QS8A 1S1UA 1E1FA 3PZQA 3GE9A 2GPTA 3AZSA 3ZWSA 4JIQA 1W3LA 2BB0A 4CCCA 3P2VA 3PW5A 2QPXA 1TUWA 2XMMA 2DY1A 1MW0A 1QNSA 5D78A 1PX3A 3MF5A 2DKOB 4IG2A 4B08A 1KKHA 2ROEA 1H61A 4BK9A 4EO8A 2AAAA 4J9OA 4C8YA 4B5TA 2E5LF 3DKJA 5DN1A 4FF2A 1GX6A 4OV1A 2X1UA 2L08A 3IS9A 3AISA 3QZ6A 3A13A 3I87A 4WQ6A 3A64A 4DOZA 1KBBA 2HISA 2FHJD 2MQ8A 4NLPA 3KOAA 1E1CA 1MROB 3M2UA 3CWNA 1N0UA 4DV0J 4HKQA 1HWKA 4L6V3 3WIUA 3T81A 5DELA 3WEOA 2GQ9A 3MB9A 1RSCA 2R8JA 4PUWA 4PTMA 1P9QC 4AU0A 4YYCA 3QF0A 2DT2A 1HBUB 1H6KX 1IXQA 4PH6A 3OB8A 5AN7A 1NDLA 4FR1A 3M0VA 3MYOA 4QE1A 5HAOA 3IV3A 3H55A 3ZSSA 2WVFA 1GG1A 3ZJ7A 4XSLA 1UJ4A 2A7RA 3KUMA 2NX3A 4QQ3A 3S9IA 3W7IA 5M2RA 5AYIA 4AL7A 1CJUB 1JJ4A 4BR1A 1U6BA 4MAVA 4GIYA 4GVHA 1J6PA 4G9PA 1Y7VA 5A8QA 2PSNA 3DKLA 4NEYA 3OJGA 2GK1A 3G3MA 3SFKA 5F2MA 3W7RA 5LIUX 1JPDX 1FXRA 2G4BA 3MOJB 1Q79A 2V2VA 4KPCA 4DLFA 5EX3A 3RAMA 1F4AA 3R5DA 3OGSA 1K8AT 2RHGA 2BFGA 3IJQA 1J5TA 2XFFA 3IJ9A 2DH3A 4NILA 4LUSA 3LZ5A 2QLFB 1GPFA 2EG6A 2VZUA 3MEGA 4X22A 4GABA 3TR5A 3HG4A 3BKUA 2PUZA 3IJ7A 3VD4A 1TAUA 2YKQA 2D7SA 3M0LA 1RHCA 1LKZA 3QV9A 4JIEA 3ZTQA 3KW3A 4R8UB 3H4BA 4EBEA 2E67A 1J5EF 4FXSA 3VKAA 1FK9A 1QTWA 2JK2A 3CT7A 2WC3A 4C8OA 3LCHA 2DJWA 4ZO7A 3ARTA 2HQCA 4AD5A 1SJCA 1JFXA 2FZDA 5D4YA 1OF8A 2H8ZA 3V0TA 1NSJA 4UB9A 1K8ZA 1JPIA 2WCXA 4RW5A 3IBCB 3S6OA 4QU6A 4PEKA 3IACA 1CECA 3HPAA 3WH7A 2E6AA 1BG4A 4JS3A 3AOAA 1B7FA 4PTNA 4Z7CA 4EU0A 2R8IA 2Z1BA 3P4UB 1S2VA 3KK1B 2GO9A 1S1XB 1U1HA 4Z2KA 2TSYA 4H7CA 4K4VA 2WVSA 2HVDA 1KFKA 2C15A 3GTYX 1N8WA 3A8IA 4KWUA 4D1JA 4LF8F 3MPDA 3MR5A 5L1KA 4IF2A 5JBDA 2CEQA 4NMLA 2VWSA 3I32A 3EX7B 4LF7J 2ABAA 1XISA 1QPNA 3SY1A 5K5MA 3UWEA 1BGAA 1DHMA 1DWIM 4I7UA 1ENUA 1ZAVA 2W91A 5FIIA 3WX7A 5CYMA 3TMQA 5H8MA 4KO0A 1IKWA 2ZHOA 3IV8A 3APYA 4I7FA 1TZ0A 2V8GA 1RDRA 3KBNA 4D8ZA 4D6GA 3MUZ1 4HZ8A 4WIQA 1XF0A 2NUYA 3MEDB 1TWWA 4KRUA 1OCJA 1AQFA 1GZGA 2RDUA 2H4YB 3DHUA 2GVGA 2LFVA 2NUUG 3C6TA 4IPJA 1RD5A 1JNZB 5AYYA 2G2OA 3FS2A 4FX8A 1VQ7S 1PBGA 1KRAC 1JKHB 2EG1A 4Q6XA 4NE9C 1JD7A 3SCRA 3RRKA 2WZIA 3HURA 1J18A 3S1XA 2R8KA 2CLHA 1XWYA 3PZPA 2R7TA 4Q4OA 4ERIA 2DBBA 2XHCA 1F61A 4JKMA 1AZSB 2RDIA 1UH2A 4GMEA 4KFPA 5FL1A 3VIFA 2QAFA 2OHDA 4C6LA 2HXTA 4EANA 3L9CA 2F5GA 4MFDA 5MKGB 5BXPA 2DNKA 2BY3A 1TWIA 3FMWA 3Q89A 3CYVA 3P0WA 3URQA 2PGWA 1EC7A 3TARA 2LXFA 2VQTA 3MUVP 1QSYA 3C5QA 4EI2A 1V6YA 3LYEA 1S1VB 3IAS9 4DUOA 5D9MA 3EWBX 2O01C 2QLYA 2IM2A 1TL3A 4H7ZA 2VUYA 1QWKA 5D05A 4DV6J 3DXSX 3HGRA 3HU7A 2ZITA 1HT6A 3QTPA 5D9NA 1YJWS 2KFZA 5JU6A 5F8IA 1YI2S 3HCXA 3BDPA 1FWIC 1ZU8A 4H7VA 5CZXA 1O68A 5D15A 2B4PA 1V6UA 3QQCD 5E41A 4JPGA 1EB0A 4K4ZA 2AJFE 4AD6A 2WSQA 3NQDA 2B4OA 1H5VA 3GIIA 3BOFA 2DXFA 2Q66A 3I0SB 3B06A 4PBGA 1HNIA 3QAEA 4FA3A 1PBAA 3GIJA 1C8XA 4K37A 3NLCA 1UR2A 3RB4A 1IBMF 2GWNA 1FOBA 1NDYA 3ATZA 4LVDA 3R9LA 1PVNA 4ZCMA 2UUCJ 3ZLGA 4QIVA 1RWMB 4YB7A 5BYWA 3WDRA 3QGHA 2E7FA 2ZDOA 4UTHA 2XZTB 2ROPA 1IJFB 4FF1A 4DSJA 3PYFA 4FXRA 2ADAA 1VHNA 4K1GA 4QS5A 3A3XA 1CGVA 5CSRA 1J11A 3TA6A 4WOQA 2E9TA 3WX4A 2W9MA 3BLKA 1LBFA 4DR7F 4ZOAA 1XBYA 4IMCA 4MDOA 3UYCA 1VQTA 1XD1A 1CXKA 2HYIB 3IRDA 4QBXA 3EMCA 4R53A 3EZ4A 2VFDA 2Z6JA 4DB7A 4UXDA 3TQVA 3ARXA 2DIJA 4DR1J 3TAQA 3JAMU 2GJFA 3GCXP 3FSYA 1ZZMA 2WNWA 3CUIA 4M1BA 1FTCA 1LRNA 3G71S 4OWGA 4CH7A 2DR8A 4DAIA 3NG3A 2HFNA 4DUTA 3RDKA 1W3NA 3ONQA 5FEWA 2KJWA 4WK1A 3HJFA 1E4LA 1HGWA 1BD6A 4ZZ9A 1C2PA 1SUQA 3HIJA 1HVQA 1HTIA 3UZZA 2NXCA 3KBSA 4FO4A 3B0XA 5CZJA 4Y9OA 3AS3A 2XG8A 1XNRF 4NYUA 3GO2A 3NL6A 2YNHB 1XC4A 4DSIA 3EAUA 3D68A 1A5OC 3W5XA 1M04A 4CLYA 4CQAA 2B43A 4DQQA 2JNJA 1V6WA 3VVUA 3B97A 4H9TA 4UUXA 1Y3KA 2VYOA 1SUXA 3RRXA 3FJLA 3KLEB 3NGDA 3BLPX 5AFDA 2XWDA 5EX0A 4DX6A 4N4PA 4GBDA 3SRKA 3I6PA 4FNPA 3VFLA 2ZUMA 4O12A 2D41A 3RR4A 4R34A 3RN6A 2HBZB 2VF3A 2BOGX 4WDXA 2E68A 2ZICA 4L6OA 2OPQA 2FGLA 2EK1A 5I3KA 2XMWA 3WQOA 1XCXA 5MF5A 2VENA 2DNZA 5IOBA 5L38A 2X2GA 2J6XA 1XIHA 5FACA 1CULB 2M5YA 4I5RA 5HXMA 3M30B 3W84A 1TL4A 1SI9A 3ELFA 3CQIA 5CGQA 4PCTA 3W70A 2OKTA 1SC1B 5PTDA 3URBA 4B5NA 2H3EB 4JI1F 3PEJA 3GU9A 1S4FA 4L56A 4JI6J 2VRQA 3CTTA 1C92A 3TXZA 2VBZA 1VQ9S 2WVTA 4N9DA 3R58A 3HFTA 4G56A 1L3SA 3DUGA 4IL2A 4KRTA 2YCLA 5FF4A 5I3QA 3QYSA 3BLFA 4OZOA 4JV5J 3NQ2A 4WVXA 5KG0A 1SJFA 2W7OA 2QG9B 3DH7A 3WK0A 4WJXA 1C8QA 4OYAA 3TANA 5BXTA 4U95A 2WSFC 3N2BA 3CJPA 1DHPA 1XWLA 3VXGA 2NUHA 4PSPA 4XD5A 3CEPA 3QJPA 1UWAA 1CLVA 5EGRA 1EP4B 4DUZJ 5G4DA 1ZZNA 1V5VA 3OW1A 2OU4A 3M0MA 3OTRA 5E5CA 3BS9A 4PCPA 3SCSA 4UTKA 2PRLA 1RAFB 3M7WA 1N6QA 4K8HA 3A4WA 3FV9A 5FJJA 1BTCA 3DX5A 1F7BA 3TJ9A 3MI6A 5I78A 3OHMB 2IJNA 2PODA 2BRKA 5C42B 3THUA 3ZTSA 3IVTA 1HNVA 2M8DB 2OSWA 3UU0A 1MQPA 2M8HA 3FYOA 3OODA 3KG1A 3JZEA 1GTEA 2GZXA 1JZ3A 1CJVA 1KA9F 2ODOA 4JTAA 4JI8F 4D8LA 4I9TA 3W9HA 4EPKA 2BOPA 4TOQA 3BKTA 2AWZA 3TN6A 2AKWB 3BZGA 2Z1SA 4PPZA 1HQTA 5KFPA 3QMQA 5LHFA 3GQYA 4AZCA 3G2GA 3O05A 2QLJB 3GHSA 3DLKA 1BGXT 3P82A 2ZH2A 1J5SA 1NZ8A 3JB9k 2AYBA 4RL3A 2ZDPA 2ZHBA 4S3JA 4Y8FA 2R91A 4CN4A 2LDIA 3SCIE 3O1LA 1KO0A 2VR2A 1PYFA 3W28A 2NWRA 1GK8A 1ME7A 3ZFVA 3VKBA 3BMVA 3AIEA 1UH4A 3CJ8A 1E6SM 3TOYA 3M5ZA 4C8LA 2XIJA 4R7OA 1Q1KA 5J2MA 4AZ7A 1A5SA 2V2QA 4HACA 2J0SD 3W02A 1Z9AA 1YDVA 3N18A 5AYZA 3M32A 2FYXA 1YTDA 2HRTA 3MAAA 2IYIA 2ZZTA 4PUJA 4QM1A 5J2QB 4YOEA 4FZIA 2L3MA 2EKGA 1J4EA 3AICA 4XZBA 5BYSA 2YKOA 1VFMA 4ZO6A 3M43A 1W8SA 1KRBC 4KIEA 4OYBA 1DTQA 4KCVA 2DSWA 2AD9A 3UWTA 3ZJKA 4X65F 3KTQA 3NEVA 2CHRA 1KS2A 2P88A 3H12A 2DRAA 3DCPA 2O0TA 4I3GA 5F4SA 2RS2A 2C2EA 5LXYA 4V1YA 2ILZA 5A95A 1OFEA 4NVTA 2PMZD 2DORA 4M63A 5A6KA 3QM3A 5F41A 5AY7A 2G0JA 2AMXA 5D3GA 2ZQ0A 1O5KA 4I1TA 3NQEA 4FNUA 4IX0A 2V8HA 4QHRA 1HKVA 1JDDA 1W25A 2HJPA 4KCUA 3CMAS 2UY2A 3VD5A 2J25A 4F0SA 2GAHC 4IXHA 3ISZA 3MM9A 3H5YA 2OWCA 1W0MA 1ZP3A 3V3WA 5LXXA 1RQHA 4H8VA 2HXUA 4F7VA 1OX4B 5J2NB 3A5VA 3QYQA 2ZUVA 4X61A 1WC1A 1L3VA 1G3OA 4AVFA 4CD4A 3FHAA 1VBRA 4H4MB 4R5EA 5D03A 2HQAA 4P6QA 1TCDA 1X9SA 3AJ2A 4QPXA 3DFTA 2RRBA 5T7LA 2OCZA 1JFHA 3L4WA 3CHEA 1BLIA 2L5HA 2PI5A 3H6OA 4P7NA 2O5DA 3MPGA 2HNEA 1C91A 1TPWA 1FWDC 1IHIA 1U5VA 3B4MA 3MO4A 2VCBA 1RJPA 5F1VA 2BOEX 3B8SA 4IDKB 2ZUNA 1H7NA 2EFQA 3GYGA 4GQBA 2FYMA 2HGMA 4EXAA 2MHNA 1CPUA 1E0UA 3EDEA 4OQJA 4JCLA 1JD9A 3KS5A 4XKYB 1XLIA 2HKEA 3BYRA 1R5YA 1MXGA 2X30A 3LHTA 3T08A 4G7FA 3GIMA 2ZRXA 5KFXA 3LWLA 1JI2A 1SC6A 3A21A 2NCKL 2IM1A 1X6NA 3CUGA 4UQEA 3S2LA 1TREA 5C7HA 5BU6A 4NXNF 2EJAA 1WZKA 3HHEA 4LF4J 1LBMA 1WC0A 1BEUA 1ZM9A 3IRSA 4GK8A 1O8BA 4FLSA 3N2CA 3W00A 1KCLA 2G41A 2WONB 2AQ4A 4J2PA 4B5UA 2ZRYA 3HO8A 1UC5A 5SUHA 2CG8A 5BOFA 5KT5A 4CCZA 2Z4PA 1Q0NA 2ZA1A 4PPDA 4JFVA 3UNYA 2GSJA 3JR2A 3RCNA 3TXVA 2EPOA 2Z1WA 5JH1A 1ICQA 5T91A 7CGTA 1VQYA 3PV8A 3U7BA 1WB0A 4C6PA 1WC4A 1UWSA 3I6TA 2HHVA 3VE9A 2WTFA 3R8GA 2C1EB 2WC7A 5I03A 2HNYB 4CU8A 3GSIA 3MHYA 2NXJA 4NLSA 1BYAA 1UA7A 3QGAC 4AD0A 4YU1A 4B3OA 4IM4A 4MJKA 2ZZ5A 5I42A 4FZVA 2C18A 4OI4A 4CH1A 2ZUSA 1TKTB 2PDGA 4AXKA 2LQBA 5CYQA 4LFBJ 2JKPA 4XKMA 3RZAA 4IG0B 4HHJA 2WZMA 3ZXWA 5FF3A 1TVRB 1Q7LB 4CN1A 3H8YA 3L0KA 4LYRA 3GNPA 3EXTA 2AYEA 2KYZA 1ICEB 1BVZA 1TFVA 2AAMA 2B31A 1FH8A 1LLWA 4O3PA 1NO8A 2HFZA 4OYIA 5FJTA 3AMDA 5KTQA 1JUBA 4DI6A 1EH9A 2BANA 2F9RA 3MI2A 1JYNA 4P2FA 4IR9A 5GJPA 1U48A 1VYPX 2CKSA 4AAJA 1PAMA 2LEPA 3OHAA 4M81A 1MNSA 1RXOB 3N9RA 5FSEC 4I0WA 5IM51 2ZM6F 1EP3A 2PI6A 4AHQA 2KHCA 4LIRA 4YB6A 3L2MA 5DCEA 4WD0A 1MDLA 5E3CA 1SQGA 5MAOA 3WZ0E 2YCIX 4BQ2A 2W62A 1H73A 3NQ8A 2ZOGA 3P67A 3NM1A 4D3GA 4DPPA 3ZVHA 4HK5A 1FJ7A 1RT6A 4FDFA 1E5JA 3ZVIA 5CSUA 2AMGA 1KW1A 3E0FA 1VJIA 1L9WA 3TNBA 4GY1A 2J76E 1VRXA 4IO1A 3DGPA 4A3YA 1GXLA 3QBUA 1ITQA 3NS7B 1UUQA 2EC0A 1Q53A 1Q4NX 2UBPC 4AYGA 1ZAHA 4FX6M 2W67A 1QNQA 1ICSA 2QJNA 4PWDB 4MMOA 1FWLA 2LXUA 2Q02A 3EXYA 1JRBA 4FP9A 1IKYB 3PO5A 2YH0A 1YPIA 1YX1A 3D3CJ 4QE5A 4GJIA 5IFPA 1UKQA 2AW0A 3SW6A 2D24A 2LEAA 4B16A 1A5LC 1VYAA 1TA3A 4J91A 5A6AA 1CBGA 1OIAA 1ZAXA 4NJHA 2MLXA 5F4XA 4Q6JA 3MM8B 1GVOA 3KWXA 4M5MA 1OG6A 4IUOA 1PKNA 3QLHB 5DMNA 3GC2A 4UFLA 1B3WA 2BXJA 1GQLA 3VOJA 4BWLA 2LU2A 3FLUA 2VNCA 4FXVA 3CBWA 1VR6A 4ECTA 2ZDRA 3JTOA 3ITVA 4R88A 4X2RA 4RPFA 1OGGA 3MC5A 3VOCA 4OZ3A 2Y8YA 1FWEC 3DFQA 4IG3B 1HMVB 4N2YA 4E2DA 1E71M 2CQBA 3BMXA 3GPAA 3GKAA 1F9FA 1KTQA 1NWUA 5A0YB 1CB7B 1YHTA 3LAMA 3O44A 5A6SA 3OL7A 1IEQA 3VAHA 1CGWA 1M7PA 4JV2A 3MSYA 2DRDA 1Q78A 4ELTA 1TTQA 1TMQA 2GLKA 1PWMA 3IIXA 1R85A 4WXWA 4ECXA 1VLIA 5LT5A 1RTIB 3R43A 3RM9A 5C5JA 3VUPA 3ZZ1A 3I82A 1KQSR 4WZHA 1EIBA 3DLLQ 2PCQA 1FWTA 3SQMA 4AIOA 2Y8KA 1SC3B 1G4SA 1XLBA 4KJIA 5CAKA 3NQFA 1JXJA 1XGZA 1YDLA 3NZPA 1LXJA 3PR5B 2XDFA 2LYVA 5BR8F 5K9XA 3E5PA 4F8RA 1TL5A 2DHSA 1SQEA 4J9JA 1BMQB 2ZOMA 1WKDA 4LNYA 3CWJA 3CS2A 1PSCA 1JNDA 3K8LA 3VKJA 3ZIZA 3R5AA 3UVIA 1L8PA 5G0RB 4GO7X 2J75A 3OXFA 4GVIA 5ITHA 2UUWA 1E1EA 1YRRA 3HBLA 4M5KA 1BQNB 3P45B 4IUGA 1KCXA 3KRUA 4P8UA 4PMNA 3PYDA 4ZL1A 3S6EA 4MHBA 1JLFB 3V4IA 2G4FA 3PW4A 4G1QB 4DL4A 3U4FA 3Q65A 2E3ZA 5HROB 5J1EA 3D6MB 2YA2A 4WLCA 1JAKA 2J7UA 2KKHA 1UVLA 3WLLA 3D7SB 2ZH5A 2PC8A 4QCFA 1VGYA 1SYTA 1WP6A 1WC5A 4Z2HA 3WDOA 1GT8A 4W88A 4H4OB 1XRSA 2EPIA 1X4DA 1KTBA 2Z2ZA 1QCWA 3WDQA 1XLJA 1JLEB 1LK7A 4OZ0A 1NDZA 4MH8A 2E40A 1LL6A 2DGUA 3OBAA 2VVNA 4NAEB 3D3FA 1P5BA 5ENLA 2ZH6A 1FH9A 3BJFA 2BDQA 5A76A 3VALA 3O6AA 4TNOA 4WK3A 5K14A 4LCQA 3K2YA 3C19A 2Z1VA 5LMNJ 1VFTA 3WFLA 2ZBTA 2EK6A 3DRYA 4Z2LA 5EMLA 2XMVA 4FXWA 3IRWP 3WIVA 2NPIA 2XISA 2HZGA 4J90A 4UOJA 4MUZA 3HHDA 2A6OA 4LF5J 3K5XA 4HSOA 4PXCA 2UY4A 3H20A 4B02A 4FYVB 2FVPA 5G2HA 3QOMA 3L68A 2ONEA 2XM2A 1OQFA 1LW2B 4ILMA 3GVQA 3CMGA 3TEGA 5C55A 1LWJA 1ZSXA 2RU9A 4US6A 2W5FA 5I24A 3EX2A 4H8HA 2XBPA 3LPOA 4PYDA 3LRMA 5D9OA 1SO5A 5AYXA 1GQJA 2CHNA 4LR9A 1RWKB 2XVPA 5I3UA 3H4GA 4HLBA 3PK7A 4KH0B 5DGAA 2NLIA 2A5HA 3RJMB 4EF9A 2ZOFA 4RZ4A 4GZ7A 4DS5A 3H2UB 4S2BA 4NPOA 4HZMA 2GC8A 3LANA 2GIQA 1VBUA 3HJEA 2X16A 1P4CA 4XZLX 2OGUA 2W9CA 4EVZA 2CLMA 2F8EX 2PA3A 2HBYB 4A8QA 1W26A 1JNRB 4GIAA 1O7AA 1RU1A 3MEEA 3R2CJ 2XFWA 2J88A 2PWFA 4UUIA 3ZZTA 1PAUB 3Q86A 4QR1A 4FR6A 1GKPA 2NS1B 1FWPA 5DLCA 2HQ3A 4GQRA 2ZBPA 2P2CB 3DLEB 4UC5A 1FXDA 2VA3A 3PRVA 5TBOA 5B7YA 5HNRA 1UR4A 3CUHA 3MWCA 5G2WA 2G3FA 2HBVA 3FRYA 3EXCX 3VNYA 1B9ZA 5L6UA 1XCFA 4DR6F 5JIWA 3W07A 3VVTA 1RK5A 3AHXA 3LPYA 2WYSA 2CQ2A 4LFYA 5IHSA 2RKIB 3QGVA 2W24A 3G1AA 5EWFA 1KR1A 4PRRA 2HVEA 4KCTA 1Z6KA 2JEIA 4UZUA 4QAWA 1CS4A 2BA9A 3ZT5A 1B1YA 3GR7A 5D09A 5L1IA 2ALDA 3BQ2A 4FNSA 3PVXA 1SIZA 4NNAA 1NPKA 3SCKE 2ABYA 3RITA 1Z48A 5LYRA 4DSLA 2UVWA 1R3WA 2VX5A 1R6YA 5A8WA 4CLWA 3N4EA 5DM6Q 4JXCA 3IEBA 3CMJA 2RKXA 1JCMP 5HWJA 4W4MA 2RDDA 3APGA 4CD7A 1YBUA 1U47A 3L4BC 4TQSA 2R42A 3Q8RB 4E8CA 1W1TA 2RFGA 4MF4A 3RK8A 3II1A 1YXYA 4YTQA 4E4FA 4RW6B 2LLZA 4JQ2A 1ME9A 2JIWA 4UMBA 1F76A 4NX9A 4IFVA 4GG9A 1RY0A 1HW6A 4LEQA 2ZZ3A 2X3DA 2JRSA 1VFHA 3WNNA 2KHDA 2OPSA 3R5BA 4JTSA 4UOQA 1S0NA 1CPZA 3OTOJ 2XMKA 1HJUA 2YL9A 2BSLA 4NZFA 1FFSB 3GU2A 2Y8WA 1XYMA 4F0HA 3B0YA 3D4JA 2BJ8A 1ZL1A 4C0BA 2OLHA 5KG7A 1J0JA 1S12A 4DX3A 3S42A 2UXDF 4TV6A 3BDEA 2CZEA 3OZMA 2WHLA 3RW7A 1HWUA 2WW8A 1H7WA 2ZKUA 1JULA 1LYXA 1UPMB 1J2WA 4GUGA 2OODA 1EHAA 3GG8A 2ALYB 2MQQA 4WK9A 1LOSA 2LQ5A 4W93A 4LC8A 5FJPA 3EA3A 1A6LA 2WMKA 1OFAA 3N2OA 2GWGA 3GW3A 4O17A 1QRQA 2CNLB 2UU9F 4UOGA 1XIBA 3DOMB 2DZTA 2PD9A 3M0ZA 4ZB2A 3VNZA 4ZE4A 2FZGB 2ZJQQ 2OX4A 3QHNA 4HVXA 4ZJLA 3GV8B 1KM1A 1O1ZA 2ZTKA 2HEKA 3Q8UA 3BMWA 4GC3A 2VFEA 4LVAA 3SN4A 3D28A 5KZMA 2Y2WA 4HU8A 2C22A 1A9NB 2BACA 2PT0A 4DQRA 4ED8A 2AZ1A 3PC0A 4M7SA 1VHCA 1VFUA 4L4PA 4UCFA 4F40A 3TLQA 2CZFA 2KRRA 3ZT6A 3D2WA 2JZ5A 4M24A 2V8PA 1ESWA 5H8UA 5LIKX 3S1GA 4V2XA 2HNDB 1UP2A 3QMTA 4PG7A 1JDEA 3N19B 2QJHA 4ES1A 3SQLA 3QSYB 1JPKA 3TOPA 3CHFA 3BH7B 3ZR6A 4JNYA 3NMRA 2BMBA 3RJXA 4NLOA 2F2HA 4IJBA 5AC8A 4CIOA 4JL2A 4MKYA 5D2XA 5IQQA 4LWWA 1C1CB 3ENQA 3AI0A 3MU7A 3MV11 2DR5A 1KXTA 4DF4A 3EVMA 1E4IA 1K8YA 4RCXA 4RNJA 2V8ZA 2WZEA 3V7PA 3LF0A 1NCLA 3N25A 3BG5A 4BJHA 3L67A 1OQ6A 2XZWA 4FPRA 2QJMA 4GMKA 1VPQA 4N76A 4RBUA 4XBSA 3SB0A 1JXVA 4AD4A 3GIQA 1D7FA 1Q65A 3MMAA 2GJLA 2PWHA 4PKDB 3VGUA 3VKCA 4WR3A 5HK4A 3VIGA 4B90A 3AIVA 3G77A 4LRSA 1GORA 2QMJA 1BQXA 4O0KA 1F5BA 5D30A 2EG8A 1LWFA 1E4MM 1D3HA 1S0OA 2V0TA 2HURA 3IP0A 5FKYA 1NB7A 1UVIA 1U5JA 3CNQP 1D8YA 4K4TA 2Q79A 3VMPA 2YWKA 1M68A 1AXQA 4EBDA 3GB6A 4N42A 3CYJA 3KL5A 1DQAA 2MKKA 1ONWA 1FWGC 2WSEC 5JMUA 1VCFA 3AIUA 4CO2A 3ALGA 3AHVA 2XMUA 2WRMA 1EJXC 1VQ4S 5D32A 4NL5A 4ZVGA 1PAEX 2C3YA 3T9NA 1EUNA 4O52A 2FDNA 3K89A 3R2GA 3W7NA 4REQB 3KUGA 3VV2B 4HPGA 3CCMS 1JPMA 1NXIA 4NA2A 4NZ3A 3P5TL 4WU3A 4NLUA 1M5PC 3TAPA 1TJRA 3JQMA 3D9BA 3KVLA 4IH3A 2C1IA 1ZBWA 3E96A 4V1XA 2ZCGA 4PYAA 4M7TA 1GHRA 2ZWOA 3W6LA 1US2A 2CJKA 1E73M 5FI8A 2IM0A 3O63A 4RPPA 1QLNA 5D4LA 1BKSA 3P8IA 2G4JA 2IKHA 3NVTA 3W65A 3G96A 1FNMA 3Q45A 1X7VA 4LMZA 1IBLF 2QDGA 2MANA 2A3LA 2CLPA 3I56S 2WOMB 3Q8PB 1V3RA 4F4ZA 3QHMA 3AS2A 1NEYA 4WFZA 1R8HA 2QN6B 1VZWA 4KWOA 3IK2A 1G7CB 3C6CA 1BKHA 3DEQA 3U2OA 4USKA 4OHZA 4GH3A 4PFHA 3CPGA 3DHDA 2HQFA 2NSBA 2FY1A 2V2ZA 4IH6A 3GLJA 3QGIA 1GOXA 2BVDA 4NZ5A 3WF0A 3NY0A 4L6HA 1WQ5A 1ITUA 4G3IA 3ZZZA 2ZRWA 1UA3A 5CXPA 3MUAA 3F0NA 1OYEA 1KXQA 2WM1A 5AJ3F 4DX5A 1PC4A 4X0VA 3AWOA 1GJWA 5K8MA 4DQPA 1L2QA 1JL8A 4F26A 1S39A 1DXFA 3MP4A 4AHPA 5ADZA 1XYCA 2TRSA 4C7QA 3R7SB 1UTAA 3S83A 4LR8A 3IK4A 1UP1A 1TQXA 4JYAJ 3HSGA 5DQGA 3HPOA 4OZ5A 3N04A 4PMYA 2ISWA 1V93A 3SCVA 1WI8A 3V0SA 2PF0A 3KRBA 1KEKA 2EKCA 5GVQA 3IGSA 4EYIB 1MNEA 1N34J 3ITTA 1X8DA 3NUKA 2VC1A 1QUVA 2DW6A 1T9YA 1CJKA 2B5JB 3VC5A 4M5HA 3GTNA 1ROFA 4E4UA 1ZENA 5ABTA 1U09A 4QW9A 1T05B 3TUZC 4LUTA 5AVHA 1JJHA 2AKMA 2N7YA 5BYRA 3D1OA 3EWCA 3KHDA 4KCWA 4YR0A 3HTWA 1NDKA 1IXOA 3BDKA 4DHVA 4YS2A 1FI4A 2AT1B 3FX4A 2ZZ4A 3SIZA 2AEFA 3R1HA 1S57A 2G1DA 3LP2A 3M6UA 4YTRA 1WTBA 4ZHRA 2IJRA 2W6RA 4C4WA 1U2CA 1S6OA 1XIJA 4HSNA 2CQIA 1R7AA 2YNGA 1LLOA 3DDMA 3I3EA 4IFKB 4ZQCA 3G0UA 4B5WA 4C6DA 2CG4A 2DEJA 4CU7A 1EP1A 2QUMA 5G4HC 2HAIA 3NGUA 4JDYA 1XR7A 4YY3J 2XQCA 4FLRA 2PE4A 3DM2B 3RBZA 3M8QA 4DL3A 1VQ8S 4HPHA 4ZLPA 3O5TB 2WCSA 5GNYA 3GJSB 5DZ6A 2XGZA 5FEZA 3GTFA 1JZ8A 3VIJA 3F2DA 3PRBA 1W91A 4POCA 2BOFX 4KEVA 3AQUA 1O5QA 1TZ7A 4MOZA 2E5GA 3D67A 4N41A 3VK5A 1LL4A 4GI6A 1FKXA 2ZXQA 1HJXA 1HNWF 1VRUA 3S9ZA 1DQUA 4CD8A 2X7VA 2WVEA 3DECA 1MEIA 3QC0A 1I75A 5EYWA 1WKEA 3SCOA 3I4PA 4ZVHA 3BAKA 3QATA 1NH6A 2VEFA 1QO2A 1TPVA 4FPSA 4V15A 4MFBB 2DGTA 2WXDM 2FVSA 4DG1A 3U4AA 3N79A 3P93A 2GJ2A 4YEAA 3MSGA 2RAQA 1RWNB 5BOOA 3U3HA 1YLVA 3UZYA 3KFWX 1HPZB 4KGJA 3O6YX 3WIJA 4S0MA 3NNHA 4GGBA 1W7WA 2WWDA 2RDTA 1NFPA 4AEOA 3MI7X 2W7PA 1JCLA 3GR1A 1FJCA 4P7OA 2V3EA 2UY3A 5ABGA 3GYNA 3GSDA 2BQRA 4F3HA 3R89A 4JI7F 5CPLA 3TJ8A 2Z2UA 2R82A 3CHCA 4O3NA 6A3HA 4ED4A 3U27A 2GVDA 2WHOA 3DMJB 4O4GA 1MEHA 1TIWA 1HD1A 2MYFA 2PN6A 4WXZA 4CO1A 1JCYA 2ATLA 4B9LA 3VAJA 3KNAA 3C0JA 3M2VA 4MK9A 5HBMA 3WQ4A 1PHWA 4WIIA 3W61A 1YK9A 4XTTA 3KZPA 4O18A 4AQYF 1MMFA 2JALA 1X98A 5U47A 2OKOA 5U7SA 3NCPA 1DWGM 2A2DA 4DV1F 3WLNA 2XLJA 1KSPA 3G0XA 5CHCB 4PCNA 4GO9A 1MZRA 3IJ8A 5E9AA 5L9XA 4F4YA 3CCLS 3ITXA 2NVAA 2H48B 1VIXA 6CGTA 3M0IA 3LENA 3CH0A 1KTVA 1N33J 4LSLB 3PUEA 5E0OA 2V4JB 3C2PA 4GACA 2Q71A 3JSYA 1ITPA 2IBKA 4N9EA 3VIIA 3MWBA 2IPGA 2DT9A 1P48A 7REQA 2EW9A 2NXIA 1HQ2A 1KV5A 4TTGA 4FNRA 4W8LA 1FD2A 2WW4A 2DZBA 3MDFA 3KEHA 2FZBA 3QGGA 1EGZA 1NK6A 3KJVB 1VH7A 5CZSA 2W2QP 2V81A 1HI1A 2ZIDA 4JI0J 3NGKA 4C1KA 2BASA 1HWLA 5FA5A 3CCWA 4ZVOB 2V2KA 3MVTA 1YQ2A 2HTMA 3BBFA 3TAMA 1VF8A 1J8VA 4HU4A 3I68A 1A80A 1M1BA 2A0NA 3K4WA 5FJIA 4AYSA 4Y2MA 3PG9A 5A6BD 4KH2A 2N4DA 3CJQA 4MTVA 4W9TA 2E9BA 1SB6A 2N3OA 2ADCA 3FFIA 3ICLA 3DYPA 4V1Ak 1HHTP 2JEFA 1EL3A 4M0XA 4UQCA 4PUNA 5CCMA 2AQOA 4JTKA 4RZBA 3PJTA 1IT7A 1REQA 5K7JA 5JBEA 5BW6A 3B9OA 2XWXA 5CC3A 4O28A 4AXNA 4BLGA 2ZKMX 1TP7A 5G1TA 1S2TA 1NB2A 3HHLA 2VZSA 1KR0A 4JHZA 1D9FA 1S7HA 3OVRA 2ZA2A 4NLRA 2KXFA 4KEUA 2G13A 2HVOA 3GWCA 2Z4GA 1W1ZA 4N02A 4DV0F 2RB7A 1KFSA 3GBDA 4LV9A 4ACYA 3BV8A 1MI3A 3PPHA 3O0FA 3WDJA 1JJKA 3T1GA 1TV3A 2HCVA 4DUWA 2BHZA 4PFMA 4O1AA 1TK0A 3U7JA 4K2JA 5BYQA 2C2OB 5MLCV 4UNKA 2GAGC 5A1AA 3MFHA 4JI3J 2QMKA 4LEFA 1MSWD 1QATA 3G0SA 4DIAA 3OVBA 3C3UA 3CCSS 1NDCA 1V3KA 4QQBA 2BABA 3SFWA 2GZOA 3C15B 4A8LA 4N7QA 2OLSA 3LK6A 4ANDA 1FHUA 4JOMA 3BQ0A 3BSOA 2W2MP 4O1DA 1KKOA 3MSDA 5IOLA 5DRCA 3QO9A 2W4XA 1GWJA 3BCJA 2AJ1A 2MKJA 1V5XA 4OX8A 2W2OP 3UWUA 1SM9A 2ZNZA 5F0WA 2VGBA 4TU7A 3N5FA 1K9MT 5HOSA 3ILIA 4HH1A 1P27B 1FWNA 1H72C 2B7BB 1RP8A 3MUXA 4I6VA 2QL9B 2ZD1B 1SZGA 2ZUAA 4OYXA 4QLLA 4D1IA 3CQ0A 5HULA 2YZRA 2FJUB 3IO1A 2PWVA 1ZBVA 2GMJA 2I9SA 3HF3A 3MECA 3DFYA 1YE6A 1D8WA 3Q83A 3L4YA 3M1ZA 4Z2IA 3MM7A 4J28A 4UNIA 3CHVA 2VJXA 1SKWA 2ZADA 2UXBF 4Y8EA 1U30A 3N2XA 4W4QA 3UWZA 3ZZOA 4LUYA 3J7Z5 5DLFA 1TKDA 4ZCKA 4F04B 4ZN1A 1JLGB 2WKLA 5DQHA 1R9XA 3BGAA 2Q1LA 3L66A 2V9DA 4ECLA 1QWGA 2D9OA 3OR1A 1P0KA 1IBKF 4JI5F 1Q6RA 1UD3A 4Z0SA 1IR2A 1LOUA 4QWAA 3ZS4A 3U1LA 2VODA 3PJUA 1OZMA 2EXUA 1O12A 1TPH1 4CNNA 4LALA 5CZVA 3SSSA 3FKKA 4PG5A 1XMBA 4M8LA 2C13A 4Q8UA 2V38A 4O57A 4YTSA 4NLVA 4BWLC 4I6KA 1DTTB 3SDEB 2JBMA 5ETSA 1XYAA 2YGYA 2ACRA 2DFAA 3O16A 1MRAA 1S9EB 1ITCA 3M8YA 1OGSA 3N9KA 2X7IA 3DRRB 5DG9A 2XS7A 3W8GA 1WE5A 2B9YA 5E70A 3VYLA 3UD4P 1JLCB 4NCAA 3G1SA 5KFAA 3MR3A 2QCEA 3MANA 3CPUA 3NIYA 3THVA 2ACMA 3BW4A 1JLQB 4X4TA 5CZ0A 3V81B 2I14A 2EQDA 5GNZA 3OYXA 1J5EJ 1DHKA 2EG7A 3NQ7A 3O8AA 3TJIA 1SSDA 1YMYA 4NYPA 1EIYB 3DC8A 2HVZA 5B0GA 4EZ9A 2BBEA 2N3LA 5A8RB 2OG9A 1LUCB 3RGTA 2XCAA 5HVFA 1DRZA 2XN0A 1M3UA 1K70A 4AD1A 4G6CA 3KHRA 2UVVA 4F50A 5BOEA 1W54A 4HDHA 4Q2MA 1K47A 3QW4B 4M6VA 2VG6A 5HN0A 3VOGA 5E93A 1EQ0A 1N5TA 1DJYA 1GZ1A 1TVNA 4QDPA 4V27A 1SW7A 3T78A 3AIRA 4ZKAA 1NJYA 1QPKA 3D66A 5F9NA 4B9TA 3MJYA 4DXXA 1RLCL 1QNPA 1OCBA 5C70A 1MNZA 4E8UA 1JZ6A 4P7QA 2FQQB 3LI1A 1HL9A 4LJ3A 4XAFA 3CT9A 4LF8J 4S39A 1EFZA 2P9CA 3BAXA 4CEUC 1S1TB 2HWHA 2CZ9A 4OI0A 1FWSA 3NS6A 3LCFA 2Z27A 1DYSA 3C16B 1HBMA 1TJ1A 3F5KA 3RPDA 1I60A 2D0HA 4Y90A 3SSJA 2KZHA 3BTNA 2JVRA 1FKPB 4H9YA 4ZN3A 3VD3A 4P7RA 2VPZB 4GKKF 3CUFA 1WOOA 3TJLA 1FEHA 4HJWA 2CQ1A 4PZVA 4C98A 1A53A 2XWEA 5BRQA 4DV6F 3CZKA 1R46A 4J9LA 1FX6A 4MMWA 3TN3A 1F8MA 4W85A 3L9ZA 4IFOA 1VQLS 3ERPA 1DWHM 2E9LA 1Q7YT 1TKKA 4KR0B 2A21A 3TZZA 3MMWA 4MK7A 4ID5A 4DCOB 5ETOA 5LSOA 1XIGA 2OIHA 2I5IA 2EFOA 2R7UA 3CUJA 2IDLA 2CYYA 1F8IA 1W37A 4ATNA 2IMOA 4Q3MA 5KETA 4WKHA 3W1QA 2WANA 5F4WA 3T3FA 4C3MA 5IM0A 2W79A 1QDUB 2QJGA 3OHIA 2POTA 2Y5SA 5ABEA 5FL0A 2RSQA 1PKLA 2GIFA 2CDQA 1A3XA 2OYLA 1DJHA 4GQGA 1DORA 2M88A 7A3HA 1X8CA 4U96A 3BWWA 4JX4A 2XZ9A 1IM4A 3OR2A 4MWAA 3W37A 3BO9A 4KHRA 2F4VF 1DLOB 4ICLB 1VGAA 3UVJB 1F9HA 3WMLA 2YXLA 4O0ZA 3ISNC 4J3XA 3TC6A 3FXYA 3LPPA 4LREA 4G1NA 1P7TA 1UH3A 3R8HA 2RDXA 2MJNA 1NY1A 4WDTA 4J37A 1DPMA 3UQNA 3MMCA 1PXGA 3WH8A 2YL8A 4OHQA 3CASA 3RMEA 4I7WA 4XISA 2HRWA 1NLKL 4S3GA 1LWEB 1NPRA 1B3TA 1E9IA 3RTVA 1EQPA 2PDMA 3WQDA 5HNTA 4XZNX 3TZYA 4CNZA 4H4KA 2ZZ6A 2HS3A 3PZGA 2ZYFA 1RGVA 1XICA 1RAOA 3B54A 1YJRA 3UCDA 3EWUA 4I9JA 2R14A 1QU4A 3SI9A 1DQ8A 2Z28A 3K17A 1O94A 1PDZA 1IBMJ 3U9IA 4CH0S 3O9NA 4DO7A 4JX5A 1EA9C 2C2ZB 5KFYA 2O56A 3HP6A 1L0PA 3M6VA 1WBHA 4LYQA 2YOCA 5CD4H 1M90T 1SKUB 2CZVC 2EFNA 8XIMA 1C7SA 3KLFB 5HJXA 4DR7J 2Y89A 1VQNS 1NDVA 4IMEA 5IT0A 4KFBA 1RA7A 4ES4A 3G87A 4UTIA 3DG7A 3H70A 1TR9A 3JS9A 5F3TA 1YW1A 3H4WA 1FDNA 3MDWA 4TO8A 3U5YA 1RA0A 3PTWA 1W9UA 2ZTJA 3S2CA 2KT5A 3LP1A 4TKTA 3L0NA 3AMCA 2XM1A 3CT2A 2Z24A 5BZAA 3W7HA 5LIYX 3UERA 2VICA 3CV7A 4LS0A 1PZ2A 3IG1B 3E01B 3A8EA 1XFCA 4ETZA 1XNRJ 4UFHA 3PBMA 4WFAQ 1GXTA 3IMQJ 5SWUA 2HFVA 1H1YA 3K5NA 5B7WA 3S7RA 2W8KA 1KFWA 1KD1T 1SFJA 2D2HA 4QX4A 2R24A 3SGUA 1WA3A 5CC5A 3HGJA 4I7VA 4OI1A 3S8HA 1GCYA 2D9PA 3C46A 1I2OA 3QTGA 4W86A 4TMBA 3H5XA 3KHGA 1P1XA 1PZ1A 3SUWA 2YY3A 5AXKA 5DO2A 3VA8A 1WDWA 3VCNA 3CJRA 1LFWA 2VQFF 4F2TA 4QWDA 1U2YA 2GO8A 3D47A 4DR3F 4ZLNA 1UIOA 3EDFA 3ARYA 2DNOA 4OIXA 2NXEA 4MJ4A 4IQJA 1BG9A 1K44A 5I3GA 3JTPA 4GYPA 3HSJA 1U1LA 4M51A 3E51A 5A2QY 2GA7A 1JLAA 1XPYA 4KEZA 5EMKA 1BUXA 4KIAA 3W64A 1YKWA 1RTJB 5J2PB 3CB3A 5C7PA 2C19A 4KBIA 3DYOA 4JI1J 4HI2A 3GJTB 3QEZA 1S6UA 5HINA 3L4XA 3QMRA 5B0BA 1FRHA 4DJDC 3KLIA 4MB3A 3I0RA 4B3RF 1TE1A 4DF2A 1ZBCA 3HV8A 2OO6A 4OZJA 2MGZB 2HHTA 5AXNA 1HARA 2WO5A