4RNHA

Pamora tandem diguanylate cyclase - phosphodiesterase, c-di-gmp complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
429
structure length
423
Chain Sequence
MAYYDALTHLPNRTLFQDRLHTALQQAERNGQWVVLMFLDLDRFLGHAAGDRMLQEVATRLSACVSQDDTVARMGGDEFTLLLPSQGDREIALKRAIQVAELILGRLARPFTLEGREFFVTASIGVALSPQDGAELSLLMKNADTAMYHAKEMGKNNFQFYQAEMNARALERLELESDLRRALELGEFVLHYQPQFTGDGRRLTGAEALLRWQHPRRGLVPPSEFIPVLEEIGLVAQVGDWLLAEACKQLRSWHKAKVRVPKVSVNLSARQFADGQLGERIAAILYETGIPPACLELELTESILMSDVAEAMQILSGLKRLGLAIAVDDFGTGYSSLNYLKQFPIDVLKIDRSFVDGLPHGEQDAQIARAIIAMAHSLNLMVIAEGVESQAQLDFLREHGCDEVQGYLFGRPMPAEQFGMLYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Formation and dimerization of the phosphodiesterase active site of the Pseudomonas aeruginosa MorA, a bi-functional c-di-GMP regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase, hydrolase
molecule keywords Motility regulator
total genus 146
structure length 423
sequence length 429
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4rnhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rnhA01
3M8PA 2O5DA 3CJ2A 4ZVEA 2YKMB 3OLAA 4LQ9A 2BE2B 5KG7A 4ES4A 3I0SA 2VG5B 4DL4A 3PW7A 3DLKB 2WHOA 2ASLA 1RTIB 1RT3A 2OPRA 3MEGA 5C42B 5J2MB 3MFIA 4Y9PA 1FKPA 4NLXA 3ITHB 2IM3A 4ZVGA 5KFBA 2FJWA 4IFVA 4IRKA 5DQIA 3KLIA 4Y9NA 3N6NA 4NLPA 4TYAA 2W9BA 4IR1A 3H5SA 3DLEA 4URGA 4G1QB 5KG0A 2W9BB 2BRKA 2F8EX 2BQ3A 3KLHB 5J2QB 4FBTA 4O3NA 5KT4A 4QWBA 5K14A 3DLKA 5KFPA 2VG5A 1C0TA 3KJVB 5I42A 2HMIA 3H5XA 5CYQA 2BE2A 3BGRA 4I2PA 5MF5A 4J9MA 1RTDA 5KFJA 1LWEB 3GIIA 4FBUA 1TKZA 4ED1A 3DRSA 3PJUA 1TL3B 2FVSA 2UUTA 2AGPA 4G1QA 2IMWP 2BANA 3IG1A 1YVFA 1IM4A 3HKWA 3KLIB 4H4MA 3E01A 3Q8RB 3DLGB 4ECUA 4IRCA 2XCAA 3U2EA 3EPGA 3V81A 4M95A 4Q8FA 4ICLB 1HYSB 5KG1A 1S97A 1HNIB 4O3QA 1FK9A 4MKAA 4ECRA 1W25A 4NRUA 3I0SB 4KFBA 2D41A 2D3UA 2W9CA 3KHLA 4NRTA 5HLFB 4TY8A 4NLYA 5HROB 2IC3B 4ID5B 2AQ4A 4NLGA 1HQUA 4HJFA 4FOUA 3LAMA 3PW4A 4I2QB 5KFMA 3E01B 3H5UA 4J9LA 2BANB 3HVWA 3UR0A 4ECXA 3NAIA 4IFYA 1MU2A 4NLQA 4WE1A 4WXWA 4K4UA 1RT4A 3QZ8A 2W8LA 1TQLA 2ZE2B 4R5PA 3DOLA 2AX0A 2R2TA 2IBKA 4WZMA 5KG5A 1DTTB 1TVRB 4DL3A 1TL1B 2HNDB 4ECYA 3GIKA 3ISNC 3KLFA 4KO0B 3LAKA 1S10A 2HMIB 3C6UB 3KMQA 4DL7A 5KFHA 1S48A 3LP2B 3QIPA 1DLOA 4WYLA 1S9FA 2JEGA 2UVWA 2HWHA 5F8HA 2JC1A 4O4RA 5KFTA 1HNVB 5J2NB 5KFKA 3IG1B 3DYAB 4F50A 3RB6A 1JLBB 1S9GA 1T05A 3KK1A 2HNDA 3V6JA 1HPZA 2R8GA 4KIEA 4DL6A 1CSJA 2XGPA 3KK2A 3NMAA 1UWBA 2YNIB 3QLHA 1DTQA 4G3IA 4MFBB 4J9NA 2IAJB 1R0AA 1Z4UA 3TAMB 4QWCA 3KMSA 3PR5B 4B3OB 2C2DA 3DOKA 1SV5B 4H4OB 4ED2A 5KFAA 5DG9A 3NL0A 1EETB 4NZ0A 1HQUB 4HU4A 3T1AA 4GC7A 3GYNA 2ATLA 5KT6A 2BASA 1JLEA 3TVKA 4RNJA 4ECWA 4DL5A 1OS5A 4ED8A 3EZUA 4Y2AA 4AG0A 1JLCA 4O4GA 1ZTTA 3E51A 4IDKB 3BSNA 5C24A 2YNIA 3CDWA 3KZPA 3FRZA 4RW9A 2WONB 2RDIA 5KG6A 4R5PB 1RT3B 3RAQA 5KFOA 3KK2B 4ZP7A 3TLQA 2VG6A 3G6XA 4IFYB 3N6MA 5J1EA 3OL6A 2UVVA 2AGOA 2FJXA 4LSLA 1T3NA 2ALZA 4I2QA 5KT5A 3M9MB 2RKIA 3JYTB 3PW2A 4ZVHA 4Q44A 2WTFA 1EETA 4RUCA 4TY8B 2R2UA 4NLOA 5HROA 3RBEA 4ZPDA 1DLOB 2UVUA 4RW6B 3GG0A 4QWDA 2OPPA 4X2BA 3KJVA 2DPJA 5KG2A 3KLFB 1S1UA 1XR7A 5KFFA 4Y9MA 1JLQA 1KLMA 2JLEA 4Y2CA 5T14A 4RUAA 2R2RA 4EYHB 4KV8A 3PJTA 3EPIA 1S6QB 2ZE2A 1S6PB 4IG0B 5KFZA 2RKIB 1TKTA 1LW0B 4KB7A 3JYTA 2CKWA 5FDLA 3IGVA 4QWEA 1TKTB 4J9SA 2I5JA 4F4WA 2J6SA 1WNEA 5KFIA 3G86A 3MECA 3CVKA 3GILA 3JSMB 1JX4A 4KV8B 3OSPA 5KT3A 1TKZB 4DL2A 2FVRA 3OHBA 3I0RB 2C2EA 3M8QB 4TN2A 5KFGA 2OPSA 5DQGA 5F8JA 1VRUA 1VRTB 3FDSA 5KFSA 1RTHB 5HBMB 4K4SA 4LQ3A 3GFXA 4WZQA 4FOKA 5K14B 5L1IA 2WK4A 1DTTA 1JLEB 1RDRA 1TVRA 4RW7A 1RT2A 1S1TB 3CDEA 1JLFA 1IKWB 3KHGA 1JIHA 4URQU 5F8NA 4RNHA 4J9RA 4K4TA 1S1WA 1TKXB 3PFMA 3I5BA 4EYIB 5DG8A 3VQSA 1C2PA 1N6QB 4MFBA 4R8UA 1XR6A 4FOJA 4ZPAA 1FKPB 2J6TA 3BSCA 2IC3A 1HARA 5C24B 1ZETA 3CIZA 1LWEA 4MIBA 4YQWA 1T05B 1JLBA 1S9GB 1T94A 4ZP8A 1C1CB 2ILYA 3PJXA 3Q8SB 3BQ2A 5J2NA 3QGIA 1BQMA 3H4BA 2GIQA 2YNGA 2XI2A 4EBDA 1RTJA 4GC6A 5KFEA 3V4IB 2JEFA 1N6QA 3CDUA 4FS1A 4ZP9A 3GV5B 1NNDA 2YNHB 3FFIB 2FVPA 5FDLB 4U6PA 4O3RA 1DTQB 1K1QA 3V6DA 1S6PA 4IG0A 1RT5B 2R2SA 1RT7A 5KG4A 3KHHA 4K4VA 3QGGA 3QYYA 2OPRB 3MEGB 5C42A 1RT4B 5KFLA 2IM1A 3FQKA 5KG3A 4ECVA 5DG7A 1J5OA 3UDLA 5MKGB 4KHMA 4HKQA 3HV8A 2AX1A 3M8QA 3S83A 4F4YA 3ICLA 1S4FA 2UVRA 4YR2A 1IKVB 3LP2A 1JLGA 1RT1A 3QIPB 4QW8A 4QPXA 2VA2A 1LW2A 1QE1B 4ECSA 3NKYA 2XCPA 2YKNB 1IKYA 2WB4A 3DRPB 5KFUA 3KLEA 5D3GB 5J1EB 4IFVB 4ED3A 4PWDB 3DM2B 2WOMA 4IOBA 4DG1B 2C22A 1RT5A 5DLGA 4RW9B 4MKBA 2B6AB 4MIAA 1C0UB 3V81B 5HP1B 2OPPB 4PQUA 3GV8B 2R8IA 5L1KA 5D3GA 1KHVA 3IN5A 1S1WB 1JLGB 2RF2B 1RA7A 4EO8A 1IKWA 4MK7A 4ZHRA 4ED6A 3QGHA 4IH6A 3BGRB 4TQSA 2FLLA 1QAIA 4YR0A 2YNFB 4IG3B 1FK9B 4IH5A 4O44B 5DGBA 3SY8A 3QLHB 1C0UA 3MFHA 1IKXA 5HP1A 3RAXA 2AGQA 4ZVFA 4K4XA 5I3UA 2WOMB 4J40A 5F8MA 4K4YA 2OH2A 1LWCA 2FVQA 4IDKA 2WCXA 1S1VB 3SFUA 5F8IA 3H59A 5DLFA 1HMVA 4H4MB 5EWGA 2C2RA 1HQEB 2HNYB 1D0EA 5KFQA 4NYZA 3OL9A 5C25A 4LYKA 2ILZA 3KHRA 2RDJA 1SH0A 4ED7A 1T03A 3Q8QB 3T5LA 1LWCB 5EWFA 1RTJB 3CO9A 2BQRA 1JLAB 1KLMB 2V0NA 5J2PA 1JXLA 2IAJA 4B3OA 3H2LA 4RW4A 5F8LA 1VRUB 3CWJA 5HBMA 2YNFA 4KO0A 5I42B 3D5MA 2ASJA 3TQ1A 1EP4A 1RT7B 3OHAA 3PW5A 2OPQA 2ZKUA 3G6VA 3UPFA 3PJWA 2GIRA 4K4WA 3QO9B 1I6JA 1HNVA 2W9AA 1HQEA 2HNYA 3NAHA 3GIJA 2FVCA 1GX6A 3MR3A 1S6QA 1LWFA 1TV6A 4F4ZA 3KLVA 1D1UA 5CYMB 2HNZB 4Y34A 1JLQB 3T5JA 3V6HA 4RZRA 1JLFB 3I5CA 4TLRA 4YR3A 2YNGB 1S1UB 4ECZA 1BQNA 3QIDA 3G6YA 3BSAA 3H5YA 3NGDA 2EC0A 4KFBB 4TYBA 1IKYB 2GC8A 5KFDA 3NBPB 4F48A 2VG7A 1LW2B 1QE1A 4EEYA 1SH2A 2I1RA 4LSNB 1C1BA 4F4XA 2RF2A 4NLUA 4NLWA 3H98A 4JV0A 1QAJA 3CJ5A 4JUZA 1LWFB 3JSMA 3MTKA 2VA3A 4KHRA 4K4ZA 4Y3CA 2WRMA 3M9NB 4RW8B 4QWAA 3KLGB 2FJVA 1RT2B 4MK8A 4R0EA 3V6KA 3BQ0A 3SI8A 2JC0A 2VG7B 4RNMA 5L1LA 5CYQB 4Y9OA 3T19A 4LJ3A 4RW4B 1HNIA 2W7PA 4NLVA 4RW6A 5KFWA 3OL8A 4IKAA 2W8KA 1N56A 5F9NA 4RNIA 3LP0B 1GX5A 1S9EB 1SUQA 4TQRA 3KK3A 4K50A 2R6OA 1FKOA 3IGNA 3IRXA 3DOKB 1T03B 3HVTB 1BQMB 5JUMA 3QO9A 4IR9A 1S0OA 3GG1A 4KAIA 2VG6B 1RYRA 3KLGA 3H40A 3CJ4A 4RW8A 3FSIA 2E9ZA 3V6DB 3DMJA 3RB0A 3DI6A 3MR5A 4O44A 4IG3A 3PVXA 1C0TB 4Q0BB 3FFIA 3LP1B 3FQLA 5JXSA 1FKOB 2YKMA 3IRXB 1S0MA 1REVA 1MMLA 2XC9A 3MR6A 2C28A 4ECTA 4JV1A 1QUVA 5EUHA 2FLNA 1SH3A 4RW7B 4O3OA 5M1TA 3MF5A 5C25B 4KE5A 2W9CB 1C1CA 5KFCA 2QV6A 3IS9B 3BSOA 1RTHA 4NLDA 1VRTA 4J9KA 3GIMA 2XI3A 2B5JA 3BR9A 3DMJB 3LALA 4HU3A 3OL7A 2WONA 4ICLA 5DGAA 1HYSA 2BQUA 5CYMA 2QE5A 4WYWA 4PWDA 1HPZB 5F9LA 3KNAA 3MECB 4URSA 5KFVA 2V4QA 4J9QA 3PZPA 5KFNA 2J6UA 1TKXA 4RU9A 1RT1B 4RNOA 1TP7A 2OPQB 3DDKA 3DRRB 4MH8A 5EWEA 3DRSB 4ID5A 1S9EA 1SUQB 4LSNA 4KKOA 4YP3A 3PR4A 3OSNA 3RB4A 1S49A 4I2PB 1RTDB 2ZD1A 2D3ZA 4I7FA 5MKGA 4XPEA 1S1XB 1NHUA 4EO6A 4AFYA 4WXOA 1RAJA 1J5OB 3C6TB 1S1XA 3OLBA 3M9OB 2V4RA 2JEIA 4HYKA 4XPCA 4NLRA 3MEEB 4KKOB 1RYSA 3Q8PB 3BJYA 4WFXA 3DOLB 3DLGA 4TY9A 4ECQA 2YKNA 3DRPA 3KLEB 2D7SA 3DLEB 4ED0A 3PW0A 2JEJA 3T5HA 2YNHA 4DEZA 3HVTA 5EDWA 1HMVB 3BQ1A 1ZTWA 3LP0A 1EP4B 4IH7A 3KK3B 5L1JA 1RTIA 4MK9A 2DPIA 1IKXB 4NLSA 5HLFA 4Q6JA 1JLCB 3CJ3A 4O4GB 3IS9A 4O3PA 2HAIA 1RA6A 3CJ0A 4WFZA 4ZPCA 5J2PB 1TL1A 3H4DA 3LANA 2W27A 2BR0A 2IM2A 1JKHA 2BRLA 5F8GA 4WE1B 1REVB 1MU2B 1RT6B 3HVAA 1N5YB 3MEDB 1KHWA 4Y8EA 3LP1A 1R0AB 3GQCA 5C5JA 4PQUB 4ZMMA 3V4IA 3RBDA 4RNNA 3QZ7A 2IJNA 1JKHB 5I3UB 1U09A 5J2MA 1C1BB 2R8JA 4YMEA 2B5JB 4M94A 3N3TA 3DM2A 4JV2A 2FLPA 3KK1B 2XWYA 4H54A 4F3HA 5KFRA 2OPSB 1BQNB 2IM0A 5DQHA 3MR2A 1S0NA 1IKVA 4PUOB 2HWIA 1JLAA 2HNZA 5KFXA 2XGQA 3KLHA 5J2QA 4R8UB 1TV6B 2E9TA 1SV5A 4H4OA 2I5JB 3TAMA 2UUWA 3C6UA 1N5YA 4Q43A 3DI6B 5L9XA 3PHEA 1UWBB 2B6AA 4U7CA 4IQXA 1TL3A 2AWZA 2V9WA 2R8KA 3MEEA 4FS2A 3I5AA 4O3SA 3GFZA 3DYAA 3D28A 4NCGB 1K1SA 2B43A 2ZD1B 4I7FB 4KBIA 4KSEB 4Q0BA 4QW9A 3I0RA 3RB3A 3M8PB 4ZPBA 4PUOA 4J9OA 4TXSA 2IA6A 2ASDA 3T5KA 4Q45A 3ISND 4NCGA 2AU0A 4OL8A 3NBPA 4LSLB 1LW0A 2W7OA 4Q8EA 4ZP6A 1S1VA 4EBEA 2E9RX 3ITHA 4XO0A 1NHVA 4DG1A 3BREA 3UQSA 2CJQA 3GV7B 5KT2A 3SFGA 3C6TA 3N6LA 4RNFA 5KFYA 2R8HA 1N4LA 3GFYA 4NLTA 5KT7A 3MEDA 1RT6A 4WFYA 3HV9A 1N48A 3KOAA 4J9PA 1XR5A 4EBCA 4IRDA 4ZHRB 3HHKA 3DRRA 1S1TA 2IJFA
chains in the Genus database with same CATH superfamily
3M8WA 4LAUA 1UH3A 2HNEA 4XO6A 2BE2B 1P5BA 4NE9C 1CPZA 2UZ9A 5K3VA 3CC1A 5AXKA 5H8MA 2I38A 4US5D 3KBJA 3B4DA 3CCVS 1FWNA 1Q6FA 3EXSA 1WKJA 4TYAA 3KOWA 3KZSA 1O5JA 2DT1A 2CJXB 2CLHA 2QUMA 1R30A 4ALDA 2BQ3A 4L61A 3PRDA 4BLGA 2E1MC 1XSKA 1PDYA 2PURA 4QWBA 3SXLA 3WUEA 2HMIA 2AMGA 4LIWA 1IXKA 1RTDA 5MF5A 4X66J 1LWEB 4FBUA 2XGBA 3WKZA 2W1BA 2HS6A 2WVEA 1QW7A 1WAUA 4WCJA 1NKEA 3QGKC 1CXLA 3WD4A 2HE5A 1O12A 1RHMB 1IIGA 4WK3A 3VHQA 4ECUA 4O0NA 3D66A 3UYIA 2X1FA 1QJWA 2C6QA 3ZS4A 3BR8A 4M6VA 1HNWJ 1MXGA 4OT7A 4GISA 2DRDA 1HNZJ 4GIYA 3GWCA 1G67A 1ISYA 3CT7A 4NYOA 5JQ9A 4NLYA 1NELA 2NUYA 3QTGA 3LYEA 1UZ1A 5FIPA 1Z42A 2ZUNA 1CLXA 1EX8A 5EMMA 5HQMA 2BANB 2ZHOA 3S8SA 1S39A 4WZMA 4FPIA 1IWAA 4PTNA 2CHOA 3CJQA 3NG8A 4O17A 1T0TV 4RZBA 2UVWA 4EPDC 1W26A 2OO4A 1KFLA 4XZWA 3WUFA 1R8BA 2B4UA 1LORA 2KFNA 4MIMA 3IVTA 2DNYA 5KFTA 1ICSA 2Z57B 1QWKA 2IA0A 1Y5XA 3AXMA 4OYXA 5FF3A 1S9GA 5AE1A 1T05A 1KSPA 2C2MB 2PC4A 1GVFA 4TX8A 2TPSA 1VHNA 1C8XA 3KHJA 4JTHA 1MW0A 3MO4A 3CCRS 4MFBB 1R0AA 1EB3A 1XLDA 3E02A 4RUHA 3Q8YA 4AZHA 2BGQA 2G4BA 3ITYA 1WCGA 1ZSXA 2F9DA 5D2TA 4HZ7A 1N5VA 1KFBA 4LF9F 2XFRA 1S46A 5I06A 2OO0A 3EZUA 3BN4A 1JDEA 3W88A 4GKJF 3TONA 8XIAA 2YNIA 3G1RA 1VMBA 1RT3B 2V8GA 2RJHA 3E0IA 2OKQA 2EG7A 1QNQA 3FSUA 1NOWA 1OFOA 2FTWA 1PXGA 4W4MA 2UVVA 4JCLA 2HS8A 4KQZA 1GMWD 4I2QA 3AIWA 1PCAA 3WDIA 1BXCA 1CJKB 2RH9A 3RBEA 4A8RA 5HBFA 1UJPA 4X2BA 1MDRA 1VLWA 4RXGA 3HHEA 3H7UA 7REQB 4RUAA 3G2GA 1T41A 2GJXA 1UB3A 4BI5A 3W1LA 1LP6A 4RWXA 2CKWA 3EKZA 2F6XA 2PP0A 4JR5A 3VD3A 2J6SA 1KO0A 3GILA 3JSMB 1CENA 3K8VA 1CQMA 4M0XA 2INEA 3HQNA 2UXCJ 2VZVA 3SCTA 4FO4A 1L6SA 3FDSA 5HBMB 4UQTA 4NYPA 1BD6A 5K14B 4K6AA 1DTTA 4Q8PA 4KWUA 3D6FB 3OJUA 5FKYA 3TA6A 3EMTA 4TKTA 3CJKB 2VR2A 1FA2A 1KRCC 4ICNA 2Y5SA 4X9SA 2D74B 5B0AA 3LSBA 3CIZA 3LSCA 3BO2A 3NM1A 1YBUA 4M63A 2ZRWA 1HW6A 3TFCA 2V3FA 4DYJA 4BQ4A 1H5YA 5F2GA 3N01A 1UJ5A 1NARA 3T8LA 4GC6A 2HHHF 1PWMA 1XK8A 1FWDC 4GH3A 1Z8AA 1TPB1 4FXFA 1IT7A 3PPHA 3MBFA 1DTQB 2D3NA 2FJAB 2VKRA 1RT5B 2R3VA 4M5DA 3GXNA 4MB4A 4UQDA 4DLMA 3IRWP 1RT4B 4X0VA 4H1ZA 1MWZA 4ECVA 2Y6ZA 3QPEA 4NSBA 1LLZA 5I07A 3H7RA 3IUIA 3EGZA 2DVTA 1P0DA 3UR2A 2KT5A 3WBEA 4GYJA 4LS1A 2QQ6A 2MKSA 2PD5A 3IR7B 3I82A 3A4AA 4P8VA 4DSEA 3I6EA 1LDCA 5A1AA 2CKSA 2VGGA 5HP1B 1YJ7A 4MLRA 3CAQA 2Z1SA 3E74A 4OLPA 1RHQB 2A7PA 3KVMA 1UP3A 2CNOB 1ONXA 1SKSA 1DWHM 1X5OA 1HP5A 4BI6A 4YFUA 2PDHA 4MZ8A 5KZDA 2W2MP 4TQSA 2FLLA 1EDGA 3AICA 5DZ7A 2Y1IA 1WD6A 2WMIB 2VV5A 5F8MA 1P0KA 4IDKA 2NXUA 1IXQA 1HQEB 2R91A 4NJGA 2HRYA 3GIYA 4OGZA 4NJHA 2GS8A 1TV2A 2ACRA 1REQB 2PF8A 2BJ3A 4DJDD 4YB6A 3CO0P 4ZCKA 4GVLA 2P8CA 4UTHA 4XAKA 2VCBA 1WF0A 5A6AA 1VC4A 4PMXA 4EU0A 1F7BA 3OBIA 1BQCA 2OI2A 1RKIA 3M16A 4J9VA 2HCVA 1WKKA 2QCFA 3HJVA 2WSRA 3VM5A 1JLQB 4WIWA 4RZRA 4ECZA 3HLUA 4USVA 4NX5A 1E1FA 3NBPB 3BH6B 5JMUA 5CCLA 2HBQB 1AVAA 2M3DA 3UZWA 3LHUA 4QIGA 2HISA 4JV5J 1SO4A 1GOKA 3N0VA 3VNYA 3WL1A 1FHUA 4FF7A 2DRBA 5D02A 4A2RA 4XK8C 1ZAJA 4PSPA 3T19A 4RW4B 1J93A 1IF2A 4TVCA 1NUEA 1F74A 3OODA 3U7JA 1MYRA 4M5MA 1UIPA 2ZXAA 2WJEA 4RBUA 4WGHA 3VDHA 4U5IA 3QNWB 4C7QA 4EFAC 3EWUA 1KM1A 2HJPA 2Y1RI 2H3DA 1JL8A 3VZIA 2D2OA 1DJ0A 1OGBA 1OO0B 2YKMA 4R5EA 4ECTA 1A50A 1GVQA 4E5TA 3OXFA 5I3QA 2ZYFA 2AAMA 2OWXA 3ITCA 6FD1A 3K5MA 1GVYA 1ELSA 1SW7A 1NSJA 4GKLA 3M8YA 4B08A 4DV0J 3DG3A 4GXPA 4OWGA 4CCCA 5KFVA 3PZPA 2XO6A 4AD2A 2IFXA 1W3KA 2YPZA 3JQKA 1ZPVA 3ENLA 3CJ8A 4RZ5A 2DEIA 4EPBC 5CCMA 1Z89A 4A2SA 1S49A 2KX9A 2J7FA 4XD3A 4LVAA 5LMUJ 3MPGA 2AYGA 1KKHA 5AC7A 4Y65A 2CJYB 4KGXB 1HIZA 3M9OB 4G1IA 3EVWA 4HYKA 4WFXA 2IYIA 4GYPC 4OX9F 2D7SA 3BO4A 3H26A 2D1CA 1XIIA 2M52A 4QAIA 3AOBA 3S6TA 2E6FA 1YX2A 2ZNZA 3DOMA 3LP0A 5D2YA 3SURA 3G1DA 2DPIA 1IXOA 4DV4F 4LXFA 4B9VA 1JQGA 2OLHA 4BFAA 4DBEA 2CBVA 2VBWA 1AUSL 4IPJA 3TLLA 4FNIA 4WFZA 4B9NA 1BTMA 4K1WA 1ZOTA 2GHVC 1YBQB 1VYPX 4OI0A 2R7RA 2NS1B 2F61A 3KUHA 4OJ1A 4KWOA 2KFYA 5JH1A 4OBTA 1TJ0A 1W5NA 2PEBA 3R5CA 2XO7A 3AMKA 3CZEA 2X1RA 1P6TA 4HHUA 1YPXA 2CQPA 3ZZTA 1RK5A 1WC0A 4AQYJ 3TI0A 3OZMA 3QEZA 3BGGA 4DO7A 5KEZA 3OJSA 2VC0A 1W9BM 1BFNA 4XBJA 1RWMB 2XGQA 3KLHA 2Q6CA 3PTDA 1OY0A 2WVBA 1I51B 1IR0A 2UUWA 3C6UA 5DRCA 1XISA 7TIMA 1FVQA 3ZYZA 4PC8A 2VBXA 1SFTA 1FWHC 1IBMJ 2QCDA 1YQ2A 1OCJA 3I5AA 4O3SA 2EPIA 4O12A 3NZGA 3Q67A 1U8WA 4DXVA 4C8YA 1JRBA 3IWXA 3R6IA 5GADI 1BGAA 1UPMB 3CK5A 5FA5A 3P6YC 4J4KA 4J3TA 2E28A 5K9DA 2VCAA 2XZTB 3LK6A 3NZRA 3TE9A 4LF2A 2Y0SD 1WB0A 4JFUA 2ASHA 1OT2A 3HPSA 4MKSA 1DBDA 1SR9A 2PFFB 2VENA 2J79A 2H3EB 1EHAA 3UDEA 4XG1A 1E0VA 4FKXA 1XYFA 4K1GA 4Y90A 4JS3A 3NQBA 1WORA 4EBCA 1UW9A 2IJFA 1W2PA 1LJYA 5G1TA 2YKMB 1RJQA 1QBBA 5J04A 4J3ZA 3F5JA 4GIRA 1H62A 1NFPA 4J28A 3WX7A 2E5GA 3VV2B 4RW5A 4PG8A 4C1LA 4Y2WA 1HF6A 4IRKA 5DQIA 1FP9A 3KLIA 2JQXA 4LMZA 1MZRA 2KXFA 1K0TA 2AYBA 3M32A 1PSCA 3BANA 4IJRA 4D6IA 2GMJA 5KT4A 2JBMA 4OJ3A 3VA8A 2Z26A 4HU0A 1ROFA 2CNCA 2F9JA 3WDRA 3COTA 4OQJA 1A5OC 4O11A 5GAEI 4JTUA 4UTKA 1WNOA 2UUTA 2VFSA 3HPFA 2CZEA 3W01A 1QU4A 2XZ9A 1HNZF 1S3TC 2VL4A 4HSNA 4D8ZA 3ZZZA 4RZ4A 3KM8A 3LW5C 1T11A 3NS6A 3R3TA 2UP1A 1PAUB 4MKAA 3WLOA 2WQDA 5BZAA 3CL6A 3CL7A 2E5LJ 1KCLA 3N29A 3N2CA 1JJCB 4GCXA 1EEXA 1R8AA 1KR1A 1NH8A 2YQ3A 2ACUA 3SN1A 1XRVA 3DUGA 4I2QB 5KFMA 2I5QA 3PW4A 3AMCA 3MHGA 3ES7A 2ZX6A 3CUIA 1MU2A 4AC7C 1EHNA 2XG8A 3FEMA 4S3BA 3QAUA 2D69A 2XTJP 1VD6A 3LAKA 4N02A 3BAXA 3GDKA 5HPOA 4WSHA 4WK1A 4F4KA 4QIVA 1A0CA 3PY2A 2FHCA 3ET6A 4CGTA 1Z3NA 3NA8A 4B5WA 1HNVB 3LV5A 1YTEA 3AZSA 2WMGA 5BXPA 3EWBX 4NMXA 1OX6A 5LA1A 2HVNA 2YDQA 2HFNA 1R3QA 4K8RA 3H4GA 1U33A 4O4WA 3OUYB 4QR0A 3AYRA 3PJ9A 2CQDA 1ZBVA 4UUXA 4P8UA 1EAYC 1LCOA 4P9SA 2GUYA 4N8NA 1FTXA 1S1RA 2E6YA 5JJBA 2CLLA 5TF0A 3TVKA 1WZKA 2JF6A 3NOEA 1TTQA 2CG4A 4BEUA 2CQCA 1GXTA 1QSYA 1TWIA 3FRZA 5KG6A 3AXXA 1TA3A 1DIEA 4HMCA 1D3CA 5I3DA 2OJ3A 5L38A 3DFEA 1W1A1 4YYFA 4RUCA 5A6TC 3BSMA 4LAKA 4IOAQ 1HIYA 3W3OA 2V30A 2DSZA 3T78A 1PX4A 2X40A 2HSEB 2XLIA 4Y2CA 4JBRA 4EZ6A 4B5TA 2G4JA 3NQMA 4RR5A 8XIMA 5KFZA 1UL3A 1K4HA 2YDAA 2BODX 3U4AA 4KB7A 4GY7A 2CZ5A 5FDLA 3ENAA 1RI7A 4DV6J 3CMES 3L66A 4OYMA 5KT3A 1UPPA 1XSIA 4DL2A 3E49A 1PIGA 3CEPA 3QWUA 2VEFA 4ENOA 1EQ0A 2V2KA 3IAQA 1PKNA 2O66A 3MUZ1 4IFKA 3A4JA 3TKFA 4B3ZA 2BZNA 2YX7A 3SUWA 1UA1A 3VNZA 2P0IA 2Q02A 1TKXB 1O1ZA 3O6CA 4J3SA 3DGRA 4U2ZA 2FQQB 4MFBA 1XX1A 1FO1A 2L5HA 2X3GA 3AD9C 3TUJC 4CIOA 2QUTA 2GQ8A 1HG3A 1S5VA 1V3KA 5D9MA 1S9GB 1C1CB 1V3HA 2VPYB 4ZBCA 2G4FA 2REQB 4JI4F 4M7SA 3AFGA 5DM7Q 2A79A 1KD1T 1LTDA 1XIQA 2B7BB 2JEFA 3AHXA 4ECLA 3TYTA 2CUYA 2E9LA 2ZX7A 4MJMA 1H7OA 3MA8A 4H9TA 1T9XA 1XFBA 1YDYA 2QCEA 5I2UA 3L4WA 5BMWA 3RILA 4GXMA 4O0KA 5BOFA 1JJ4A 3MSDA 3CIMA 1YK9A 4F2BA 4I8DA 3RG6A 1XI3A 1OABA 3E0WA 1ZNNA 1GCYA 3S83A 3QV6A 2Y7EA 4DWDA 1XLGA 1J2BA 3W1RA 2A6MA 3D47A 5AYBA 1CCWB 5IV3A 4C9DA 1IT0A 3WJYA 3WLKX 4HQVA 2HLTA 3RNDA 3AZRA 3R8YA 3UCUP 3WC0A 3ZJ8A 1EH9A 3OFEA 7CGTA 3RU8X 3IN5A 3RYSA 1CIUA 4PMJA 1CYGA 1H7XA 4NNBA 1VLYA 1WF2A 3OLEA 3A4TA 4JX4A 1ZA1B 1MROA 3W2UA 2VH7A 2OZ0A 3U7VA 3IGSA 3RAXA 2O56A 2OH2A 4M5LA 3F0NA 1VQ7S 5T26A 4LAMA 4U67Q 2XN2A 3SSZA 5K20B 1P1XA 1U5JA 2G2ZA 1T03A 1KB3A 4JTDA 4C8KA 2DZPA 3O44A 1RWUA 3TMLA 2BVWA 3H2LA 4IQLA 4AZGA 2HQ3A 4JTJA 1TJ1A 4AF0A 1AT1B 1EXBA 4PBGA 1D3HA 1XJBA 1XUZA 1WUUA 2DHXA 4UOFA 3VXGA 3PB0A 3BCFA 3L21A 3MUCA 4X63A 3CC7S 2FGZA 3F4WA 3Q2DA 2FVCA 1CXEA 3DXBA 2B51A 3LOUA 1ONEA 1V6YA 3ZZUA 4DJDC 2R14A 3VCCA 1D7KA 2ISDA 1WACA 1PCKA 3BXWA 5EGRA 1UBPC 3AT1B 3FBEA 3T1YJ 1IZCA 3R6GB 1W56A 1LKZA 2I1RA 4X4QA 1O60A 2BVYA 2VRQA 2HVMA 4OOZA 4YWIA 2J6XA 1S99A 1AJ2A 1WZAA 3QQ0A 1R86A 2YWGA 3RK8A 4DI8A 4CI0B 1YSJA 3LNPA 4YXGA 4TXEA 4NCAA 3SCKE 2RJZA 3S2NA 2KVQE 3P7YA 2VG7B 5FF0A 1V02E 3B8TA 4ZVJA 5CGMA 2RIJA 2HYIB 1VPQA 3PBWA 4JOMA 2MLZA 3OTBA 2PE4A 3IGNA 1UROA 2CPDA 3VAVA 4H6KA 5D9PA 5JBFA 4WTOB 3GG1A 3MKVA 2CPXA 4CYUB 3HG2A 3M5YA 3KLGA 1H60A 3C2OA 1XNQF 1F8MA 3BH4A 2XYHB 3FFIA 4XKMA 5JXSA 1WHVA 4DV0F 2Z4PA 3HZ3A 2XC9A 2C28A 1A53A 3S9YA 1TRDA 3NM3A 3MF5A 2PE8A 2KM8C 2I57A 2UV8A 5E5CA 4JQAA 2PDFA 1BXNA 1U1UA 1S6UA 5ETNA 3R1HA 4JTAA 4HU3A 4R85A 3ABOA 4CD6A 2DGOA 2VZ9A 2E7FA 3L4VA 1VFUA 5FEPA 2XSJA 1R3WA 3LM7A 3CQ0A 2H3BA 1MN9A 2ZUSA 1HR0J 2DR8A 3H2UB 1S76D 2ZIDA 3OSNA 2PDMA 4I7FA 4G8TA 1ODZA 1Q13A 3S6DA 3DFSA 3CASA 3U2ZA 4O8AA 1RQHA 2QMXA 2PGRA 1RYSA 3BJYA 3U8GA 4F3OA 1V0MA 2HRTA 2BHZA 3AISA 3NJ3A 1IQTA 1HMVB 4PBFA 2E5IA 1LWHA 1EP4B 1F6TA 2G50A 3IIVA 4NLSA 5U4NA 3UO0A 3GR7A 4C6EA 4O4GB 1EFZA 1KBRA 4O3PA 3H0PA 2VU5A 2VFEA 3QLLA 3ZJ6A 4C90A 2VX5A 1Q16B 3T1HF 3K5NA 5AC4A 4QHRA 3B0XA 1W1YA 3A5VA 4XD6A 1XGEA 2D20A 4BF7A 2MZSA 4O1EA 1SGJA 4NY2A 4F79A 2ROEA 4QYZJ 1OFDA 3M7WA 3OPKA 2HHTA 3SEPA 2HHQA 4JV2A 2NQ5A 3KOXA 4UOHA 4I8YA 4F3HA 4B3MJ 3NZPA 4JTTA 4W89A 1ZB5A 3UJ2A 1QWGA 3HO8A 3JUGA 2WMKA 2BY0A 2EBEA 2V38A 1UQYA 3BO3A 3VZZA 1E6VB 1E9YB 1QD1A 4ZOCA 3WEZA 4M5PA 3K8LA 4UMAA 2GUUA 3QHNA 1T3OA 2R8KA 3E96A 4ETZA 3B9NA 3UETA 1UMJA 3ONQA 4GUJA 2EF9A 2IMOA 3AROA 1TG7A 2E1AA 1WKEA 4PUOA 4LYRA 3CJPA 4KEUA 2WZIA 4PCQA 1HKKA 3SCSA 2LXIA 1XXXA 3ZVHB 3VIHA 2C3OA 4EBEA 1M90T 4S3JA 4AX6A 2CW6A 1VCVA 2ZRZA 4AVOA 1P0NA 1W7WA 3M6XA 4OBRA 3OBAA 3K4DA 1N5TA 3AU2A 4EGLA 4WFAQ 4AY7A 4ZHRB 3KTSA 1E4LA 1WDSA 1U1PA 2AJ0A 3CV2A 2YY3A 1JCNA 2OZTA 4KH0B 3VIFA 3BSHA 1XDMA 3V5CA 1TK5A 2OPRA 3P93A 3HA1A 3M1VA 4DFPA 4PYDA 3UDVA 1FBAA 4UTUA 1MQRA 3HSJA 2F7FA 2RDTA 2VEIA 3ET6B 2VZTA 4V33A 3KLHB 1FWGC 4M1BA 3WLSA 4JQ1A 3PEJA 3HPAA 4FYXB 5KFJA 4DBWA 4ED1A 4DUZF 4UZBA 2B7PA 4S3GA 1D9FA 3F41A 4DZDA 3T2PA 1XYMA 4AZ7A 3RO6A 2RS2A 2GK1B 1HQTA 3BLDA 4GGHA 1W25A 3I0SB 4NAEA 1J6OA 3MEKA 2D3UA 2W9CA 4IGHA 4R9XA 3KHLA 5A8KB 3FCHA 3VIGA 1FRXA 4HGXA 1YXYA 3B97A 4J9LA 4NI2B 1VEMA 3C5QA 4IMCA 4ZOAA 4ANEA 2E7VA 4NLQA 4N4QA 4WE1A 1QW8A 2OGYA 4LIRA 5B0DA 3DOLA 3B3DA 2E25A 3MC5A 1YLXA 5DDPC 4NL1A 4PXEA 3UWUA 3KLFA 1S10A 3O1LA 4ZVSB 1HX0A 4DR5J 3NCQA 1ZS2A 2Y89A 3T08A 1V6VA 1XD0A 1T9UA 1MEIA 4RK8A 4O4RA 4EWND 2YZRA 4NIRA 3T4CA 2O7QA 3CZJA 2PTDA 1UR8A 2CRLA 5DM6Q 1VGYA 3EXTA 5HNUA 2XIBA 2QGHA 1KGWA 2CLIA 3F2CA 4HI2A 1X9WA 5ETRA 2C2DA 3SY1A 3Q8VA 4J7CA 1EETB 2RGMA 4LR9A 1VHCA 2ATLA 1TMLA 4MYXA 2X7WA 3TR9A 1U2FA 3IPWA 2TRSA 1YJTA 1LFPA 3P82A 2CQIA 5CH7B 4IXXA 2XS7A 3UWWA 2LU1A 2FZKB 1IVZA 5FD1A 3LBMA 2YCLA 1ACMB 2BBEA 5KFOA 3C56A 4H9UA 2B8QA 2CPFA 2VX4A 4FP1A 4QLJA 2GSJA 2YH1A 4LSLA 4OYOA 1ZAIA 2HBYB 1DE5A 5KZEA 2J9DE 3M9MB 5FSDC 3W0KA 2KKHA 1BQXA 5HNNA 1DWAM 2HHPA 4KGVB 4QWDA 3KJVA 3W7BA 3HPOA 3KLFB 4LV4A 1NU5A 1CGXA 5DRIA 1JLQA 3HFZB 4MNLA 4LRBA 4EYHB 3KCJA 3U4FA 4O13A 4KH1B 4PODA 4M1KA 2DZTA 3FEYB 1E0WA 1RU2A 1HUVA 4QS5A 1NB2A 4TMBA 1ZCOA 2LQBA 4DCJB 3HCXA 1KD0A 2FVRA 4TN2A 2O9PA 4C3MA 3FXYA 1PBUA 4XWUA 3WLNA 4P52A 2ADBA 2GK1A 4AHQA 4TVAB 2PDUA 4B9TA 1LUCA 5IXUA 3PFMA 3OV7A 2N82B 3LG3A 4UCGA 2AF6A 4EYIB 4PUWA 1F2JA 4P75A 1B0VA 4IQMA 2ISSA 1BRLA 2JGQA 2OMAA 3AJ2A 4ZMGA 3FGVA 5IDZA 1JFHA 3KWXA 5K4XA 4YQWA 1LWEA 5EKYA 2BOEX 3OO2A 1ZLPA 3LCFA 4JI7F 1IR2A 4ZP8A 1UZ4A 3MHFA 3BQ2A 3OQ2A 4B9UA 1I60A 3KLLA 3VILA 5KFEA 3JAMY 3GV5B 4LBUA 3H2NA 2Y8VA 1UD5A 3H53A 4W9TA 4DN0A 1RT7A 1EC7A 5KG4A 5H8PA 3UXIA 1YXCA 3FQKA 2C91A 4FDFA 1FFSB 2XBPA 3M8QA 3CCMS 1HWJA 4YR2A 2UBPC 3B9DA 1IKVB 1SFJA 1ECEA 1HHTP 1X6UA 5J1EB 4QP0A 2AMCB 3NZ1A 2WOMA 3O3RA 1RT5A 4ZQMA 1RAOA 2B6AB 4UFJA 1ZAWA 2B4OA 3D1QA 1H0IA 3VPLA 4AZCB 2CESA 4CH0S 3GV8B 3OP2A 5DY3A 5CD4A 3NNHA 3P6LA 2BFGA 4MK7A 1ZJAA 2ZNYA 2GDVA 1Y5IB 1K7FA 1V6TA 1MW3A 3NQ7A 1CT5A 1GMUA 4UOGA 1YHQS 5DGBA 1OQ3A 2XVLA 1VI7A 3A4WA 4X62J 2CLPA 1YTYA 5I3UA 1DIOA 3GCXP 1I8JA 1MRQA 4GUHA 1XBVA 2PRHA 4RJEA 4OZLA 3W02A 4NYZA 1RADB 5CQ1A 4A35A 4HB7A 4E2VA 5GMKa 3LENA 2GVZB 4IQEA 5BJRA 3CMQA 4GMEA 3VAJA 1W91A 2D0HA 3TW9A 3MCMA 3QYQA 2EO7A 1NOFA 1H3GA 3N2TA 4JN6A 1HNVA 4RE3A 3ZMRA 3G71S 2VGBA 3BL3A 2KFZA 5CZSA 2QMUB 1C8YA 3OQEA 2VD3A 2YA2A 1GJUA 3OVPA 4P2FA 4GYFA 1S5ZA 3TWBA 3UGVA 4C6FA 1XG4A 4JUZA 3JSMA 2VA3A 3I4HX 4A48A 4AH7A 1K8YA 1TPFA 2OT1A 2FJVA 4ZN3A 3BQ0A 4PULA 1BTCA 1K6WA 3CNQP 1X60A 5IT0A 1VFSA 3FBBA 2W7PA 5T7LA 2Z2ZA 4P7QA 1U48A 4L9ZA 1VBRA 2VOTA 4QX4A 3HVTB 2Y63A 3M2RA 2P3EA 5BXSA 3B06A 4YHEA 2NZ4A 1KVKA 1ONWA 1QAXA 2W9MA 5EL1A 2LLZA 4JP8A 1DJGA 3BDEA 2R94A 1NU4A 3OQ8A 3FSIA 3HSGA 1HKMA 1O68A 3OVQA 4U4MA 3W25A 1RABB 4XAFA 3MVTA 2HK1A 4UTJA 1SH3A 2DXFA 4PYSA 3WNLA 4B15A 4CLTA 1YDOA 4KE5A 3NQFA 1WC1A 2ZXDA 3BSOA 4WQ6A 1RTHA 2YL5A 2G3FA 4NPOA 2FUG9 2ZRYA 1HYSA 4GZ7A 4L80A 1GPFA 2ZWYA 4PYAA 4Z42C 3KVKA 1F5CA 1KBBA 1NK6A 2QT7A 1UG6A 3M0KA 2MQLA 1IEVA 2OELA 1ZM9A 3OG3A 3JTNA 2B7CB 4Q4KA 4WEVX 3DN9A 1JZ4A 4UF4A 2QS8A 4NMLA 2WVSA 4FEZA 3C6TB 3CQJA 3EWYA 2ZZ1A 1NK5A 2FPTA 3ARXA 5G4HC 1X7FA 1F3WA 4JHOA 3MSGA 3KEHA 4UZSA 2YBVA 4QEEA 4LUTB 4XIAA 1KWMA 3MPVA 2JEJA 1LT8A 1J5EF 2HPMA 4WWSA 1BF6A 4ATDA 5J5DA 2C18A 2GVEA 2CQ4A 1NDCA 1JYNA 5E70A 2WC3A 4IICA 4B5SA 1REGX 1CJUB 2R4FA 1Y00A 4PN2A 1VCTA 3CJ0A 3H4DA 4QBXA 1XMBA 4YOEA 4OV1A 2HAFA 1TPEA 3FV9A 3A3WA 3IWNC 4PEOA 2ZDPA 1R8LA 5A8NA 1EF3A 2AL1A 1REVB 3DIPA 4B3MF 5A8RB 4Y8EA 3PFEA 3NGSA 1OCNA 4DPQA 2GVJA 1EA9C 1K02A 4ATWA 4CT8A 1TTIA 3NZQA 1UEKA 3KOFA 3TZYA 1CXHA 5L6UA 3NGUA 5GMDA 2BXJA 3C4UA 1CBKA 5AE3A 4X22A 4FYVB 3H54A 1OZMA 1YJVA 3C16A 3UR8A 4HK6A 1NBEB 1NSKL 2ATSA 2M8HA 2DZXA 1BE4A 3UD3P 2EI5A 4LR8A 1XUUA 1C8VA 3LH2S 4MHBA 4IIHA 3K7RA 1U1NA 3WK0A 1C90A 4FI4A 2EFPA 3H2EA 3TQVA 4JIPA 2PPGA 3P5BP 1FVPA 4ZZ9A 3SRFA 4I7FB 3T0AA 3OVGA 3H21A 2MZQA 1XYLA 2I56A 2IA6A 4P61A 2D9PA 4ZVOB 2HVZA 3BAIA 1HD0A 1LW0A 3TWAA 3UE2A 4OIFA 3W5ZA 5EMYA 4DF2A 5BRPA 1A9NB 4G1PA 2V2ZA 4RNFA 4A8OA 4RPQA 1PO9A 4MTVA 3ENVA 4DDFA 1MW2A 2B9EA 3PSWA 4Z1AA 3WF1A 3CCQS 3PEHA 1KONA 5D37A 3WH9A 1W3NA 3I0SA 2E5CA 4K5RA 3LOTA 3INPA 3SW6A 3E1F1 3MFIA 2E8YA 1SU5A 2ZBRA 4NJIA 1JAEA 4C48A 3FMBA 4LAOA 4ZFCA 3WDHA 2E77A 3FKRA 3DLKA 3MQTA 3MAAB 2G95A 3HPZA 5I42A 4DVOA 4J1OA 5C9RA 1VQPS 4Z2HA 1E1EA 3AIVA 4ZLNA 4GI9A 3WF0A 1J6PA 3PN8A 3GIIA 1MLAA 3H23A 3CM4A 1QNPA 3L68A 2CFFA 2FVSA 3LGNA 2DJLA 5DEZA 1W3JA 3WD1A 4RDVA 1DKWA 3KLIB 5C71A 4IRCA 4HACA 1X9SA 4M95A 3FSXA 1XKJA 1KS2A 1VFTA 4G1NA 4KCVA 1R47A 3AHZA 1R89A 2P50A 4A8KA 1XLAA 2J75A 3FDKA 1QVBA 5KOWA 2JL9A 2VASA 4GFIA 5C54A 2LA4A 2M9KA 2O9RA 3UR0A 4NNAA 2GHWA 4K4UA 4HU8A 3EGWB 2MJUA 3LPPA 4F67A 5LIXX 1ZHAA 3DERA 3ZM8A 3G8EA 4DX5A 1JCTA 3WFLA 3D6MB 2LEBA 4MZ1A 4X2PA 1VQKS 1TFYA 4AE5A 3S6EA 4ZS6A 4XK2A 2HWHA 4K2SA 3H2MA 3R7MA 2YKQA 3QPZA 2YVSA 1FXRA 5J2NB 3TUZC 2DW6A 4ZOBA 3D6HB 3DYAB 2VFHA 5D9NA 1R3VA 1H0GA 3RR8A 3OR1A 3R27A 2AP6A 4F02A 5I7GA 2R8GA 3V18A 4DL6A 1CSJA 1B2YA 2ESCA 2FJUB 2RH3A 4KRZA 5GNYA 4I9JA 3JQJA 1IXNA 3CB8A 2YL6A 3WQWA 3V4MA 4F8RA 4JB8B 2ZDOA 2IBOA 5KFAA 3STGA 3N6JA 4GC7A 4KGJA 2BKNA 2NXNA 2IKHA 3T1GA 4WIIA 3JZEA 4O4GA 1FWFC 4TU1A 1GQEA 4F3QA 4V2XA 4F9DA 1E3XA 4FLOA 4L5ZA 1RGVA 1OY8A 4NVTA 2HEJA 3NQEA 4A3UA 4XBSA 2JKPA 2DVXA 1UD8A 4Q44A 2ZH1A 4ZIWA 3IJDA 1A5UA 4NZ1A 4NLOA 2W61A 3N9SA 3NDZA 2QG9B 1WHWA 1I2NA 2Q71A 3BPWA 1Q3NA 4PPDA 4LY8A 2M0GB 2R2RA 3NOYA 2AJ1A 2PU0A 2ZDSA 3EA2A 4IG0B 3SADA 3P2VA 3W7DA 4QWEA 3TCEA 3TUUA 4POCA 5CSSA 1MN7A 2RT3A 2KJWA 4OX7A 3I68A 4CU8A 2LLEA 4CD7A 4BZYA 2LDYA 5F4XA 3GS6A 2Q1LA 3NL6A 4D1IA 1NDLA 1NK8A 1RAHB 4K4SA 4LQ3A 4H8UA 2WK4A 1TVRA 3CDEA 3GAKA 1JCLA 1GAOA 4LSBA 4Q3MA 2QKFA 1UA3A 2WWCA 4JOUA 4D3GA 1IQ8A 3OLGA 1UVKA 1GPWA 1B3XA 1IJEB 1RU1A 1XR6A 4FMVA 1VFOA 4L4MA 2YPIA 3VE7A 3IS4A 3TSBA 4WBFA 1P4CA 4AD1A 5JXQA 1AW2A 4MAVA 2V5BA 3VE9A 4DR7J 5D77A 2XGZA 2B8PA 3MI2A 3FFIB 3MW7A 3WF4A 1P8GA 2YTCA 1LOUA 1HHQA 3ABSA 4M5GA 3EGVA 4K4VA 2I1OA 4INFA 2WJFA 2R9LA 1N88A 2ZOMA 1B0IA 2K1RA 3UJRA 2BDPA 3PCOB 4GACA 1B9ZA 1MI3A 2DIVA 1EJTC 2CHNA 1W17A 3UXDA 3KLEA 3PIOQ 1HL8A 4IGSA 3TAQA 3VALA 4FS9A 4RE2A 4JTGA 2X2GA 4OV6A 3BK0A 1NJYA 2L9NA 3HDSA 2I14A 3N6HA 3K89A 4CCZA 4RXFA 3SQMA 1UUQA 4G56A 1PGZA 2I2YA 1ZJIA 3WQ8A 2QUVA 2MLXA 4CLWA 3NMRA 4B3RJ 3OUYA 1EHWA 4DSIA 3UN3A 3MAQA 5ABGA 5E7OB 2QCDB 4HNTA 3B8VA 4GQBA 1BRLB 1LWCA 3DFYA 2C2RA 4IGMA 5E5NA 2WC4A 3TP2A 1ZAHA 4LYKA 3II1A 3L5LA 2MTLA 2C2NA 2F7VA 1KLMB 3EE3A 1WDTA 3A23A 4UTTA 1HBMB 5CJNA 3OZYA 2CWKA 4I68A 2W67A 4HZ8A 3PBUA 1RQ0A 1YDLA 3W23A 1T6MA 2TAAA 2DQXA 2V5DA 4F4ZA 4K5SA 1S6QA 1XCFA 4YTSA 3W1QA 3N15A 1B3TA 2HNZB 2X3DA 2MSSA 2Q3OA 3NQ6A 3HF3A 3NDOA 3I5CA 2MQQA 3AFBA 1RVGA 5BXRA 3FEXB 2VI0A 3L0KA 3SFWA 3QT7A 3W7LA 1NJWA 1VFLA 4RDWA 1OIFA 4BR1A 1BD0A 1OYCA 2FHMA 3M6VA 3MP4A 4F4XA 1QAJA 4NLWA 3H98A 3BO9A 1LWFB 5CXPA 2RAQA 1EKRA 2V8HA 4R7JA 3HVRA 2VQTA 3LN3A 2J78A 2IPWA 1XLKA 1YZ7A 4Q4RA 2WRMA 1GOXA 3GLJA 4QYZK 2OAUA 2DY1A 2JC0A 1OGGA 4MVAA 3GIRA 2MKIA 5H9EJ 1QHZA 4RBVA 4NLVA 4PG6A 1GXLA 3WC2A 1ISZA 2YYUA 5LKYA 5F9NA 3AS0A 4HTYA 3TX0A 2PP3A 1FJCA 1I2OA 2Y88A 3KP0A 4LFAJ 5LIUX 2NXIA 3VGHA 3H12A 2Z2YB 4OZOA 3WSUA 4AZ5A 3JS3A 1QMLA 3G8SA 3IGUA 2A3BA 3AHTA 1U7LA 2DT9A 3DHWC 4ES3A 3BLPX 3GNOA 3UCDA 1S5TA 3W26A 4TNOA 1HBNA 2CQ3A 5CZ0A 3RCNA 3IRXB 3KFTA 4LRDA 5IOBA 1S0MA 4YTUA 1REVA 4DV2J 1MMLA 4LSZB 4JEJA 4JV1A 1PKUA 2FLNA 1AL7A 4BC9A 2VNCA 1UAWA 1YRXA 3T6JA 3KW3A 3RPMA 1XYCA 2YWKA 4DPTA 5KFCA 1W2VA 5IFPA 4HYRA 1EX1A 2DH7A 5AXMA 4ZENA 2XI3A 1GOOA 3GIMA 4ROQA 4MUZA 1AQHA 3NEKA 2F8QA 5ENLA 3B9EA 4WYWA 1T0OA 1R6WA 3QJJA 3EOUA 4KEZA 3L4YA 1L3UA 2F4VF 3SIPB 4IGNA 1RT1B 3WQ4A 1PUDA 3G5EA 4UZCA 1S9EA 3BLLA 2DP3A 2PDNA 3AJ1A 1POJA 5LSMA 1WBJA 1OJ4A 4ZSUA 1H0HB 3QC3A 4ZIVA 1RAGB 4H01A 4JL1A 3CEUA 2FPYA 2OZ8A 1P0BA 3FNDA 2VMFA 1YITS 2ABBA 5H6HA 3S5ZA 3HHLA 2VWTA 5L1JA 3N2MA 5D30A 4K68A 5ABFB 5ABEA 2YH0A 3MZIA 3ABXA 2XB2D 2H9AB 3VGGA 1BWVA 3W6MA 5THWA 1RBAA 2E1DA 4QIEA 1TL1A 3R8HA 4GVBB 2QJMA 4LVDA 3BGAA 3QW4B 1N2VA 1W3IA 3O7UA 1UA7A 1KEKA 3HKZD 3B0PA 4RNNA 2IJNA 3FVYA 1U5HA 2M2BA 2NYIA 4PUJA 5G0RA 2DR9A 1Q4WA 1VFMA 3GU1A 3WQVA 1KGXA 3H2OA 4UQCA 2V67A 1IKVA 1Y10A 2CBIA 1JLAA 4JTEA 2EFQA 3CCZA 4R8UB 1TV6B 4MG4A 3L23A 4U3CA 2E9TA 1EUNA 1KTBA 3CPRA 3SCRA 4JNYA 2PTWA 1B0PA 4DLEA 4DBSA 1RCQA 3D0HE 4I5RA 3BVJA 3KHDA 3ZC4A 3BB5A 2ZFAA 4IL2A 3D28A 1FRHA 3CTLA 3V1HA 4HNLA 3UNTA 1CECA 4PWUA 2CIMA 2DY9A 1XQKA 3GJRB 3HHDA 1EGVA 1XG3A 2FZNA 4WDXA 4GH1A 3T5KA 2OKOA 2J7HA 4JDBA 3ISND 5D78A 4LSLB 1QLNA 2GO9A 2BGSA 1D3GA 1GKQA 5A6JA 1RAFB 1PEZA 1HP4A 3GY1A 3R2GA 2M4MA 4FYYB 4KPLA 4HZ6A 4RLIA 2Y7GA 3PY8A 2QLYA 3EOEA 1J8VA 2J6VA 3TQPA 3UEQA 1NO8A 2WO5A 4KGLA 3LHYA 2YCIX 5DLCA 5A8GA 1U6FA 1RQBA 2ALRA 4F40A 4M3PA 3U57A 4S1FA 2CJ9A 2Z1VA 1B3OA 4FHAA 2H9ZA 3GYGA 2O5DA 4URIA 4DJBA 4F2SA 2J8FA 3THQA 2TSYA 3GONA 4GO5X 3M0HA 4DL4A 3KXQA 1M5HA 5J2MB 4WRHA 4Y9PA 1HR0F 2XFYA 5KFBA 4EAMA 1HBUB 5HWNA 1F8IA 1QVGR 5LSLA 1LNQA 2FHKA 3HPXA 4C6AA 5I78A 4FBTA 4OFZA 2FJKA 3WLJA 4PRRA 5KFPA 3N73A 3IR6B 5GAHI 2FZBA 1F0XA 2GSHA 1TTHB 4HKPA 4PMRA 3SAZA 2GA7A 2PEHA 2WMJA 3M7VA 3FKKA 5EMJA 5CYQA 4X4TA 1TB3A 2XMVA 3MSRA 3PZQA 4PXCA 1XKYA 1E15A 3DFOA 1B9BA 3CIWA 3W28A 4RE0A 2W25A 1D9EA 1E6PA 1UVIA 4S3CA 2HZVA 4PMVA 4ZOEA 4LYQA 2ISVA 4L4OA 5HLFB 3C2YA 1K47A 5ETQA 3HFTA 4GKKF 3Q37A 2FHBA 5A6PA 3ARRA 1Q6LA 4ANCA 1N8FA 4ZVUB 1X0FA 3HVWA 3MVIA 1YNYA 5AY7A 4KKXA 2B7OA 1GQJA 4WXWA 3VM7A 1PB0A 2AX0A 1XRTA 3L7PA 3DHFA 3BBFA 2EPLX 2HZAA 1GG1A 2FGBA 2IPJA 2C1GA 2PWDA 5CSYA 3UG3A 2BLEA 3TFXA 1DQWA 2MKYA 1K8XA 4U96A 3BG3A 1SL0A 3PXGa 2G3JA 1RA0A 3ZFVA 3QMQA 1K9DA 3QR3A 3OOQA 4MZYA 1U0SA 5AECA 1F5AA 3MOZA 4EK7A 3EDQB 2BX6A 3CD5A 1NSPA 1BSIA 3SN4A 4UY8T 3IJ9A 3GKAA 3DGPB 4W7VA 1M01A 3JZUA 4H8NA 1GONA 4ED2A 3KAOA 2DZAA 1FQ0A 1OGSA 4RR4A 2AEJA 2XN1A 4DR2J 1E0UA 4JX5A 2VICA 3O9NA 5DCBA 2PMQA 3UYCA 1JDCA 2EFNA 2XH2A 3NXLA 4A8QA 3S1WA 4XZHA 2FJXA 4ERAA 1T3NA 2J8AA 5T9BG 3PYGA 1ZM4A 2RKIA 2ZZTA 1R2RA 4UW2A 3TP4A 4A8LA 3MUAA 4L75A 1W3HA 4L6V3 2KTQA 2X0HA 1X1OA 4RW6B 5HSPA 4USTA 4XZBA 3T6BA 4J3XA 1S1UA 3TX8A 3AQOA 4O28A 1QDSA 1D9AA 3N2BA 2ZBIA 3MUY1 2OQLA 3JVAA 4UB9A 3SQLA 3MZNA 5FL1A 1HBUA 4Z0SA 3PDNA 5F1UA 1TKZB 2D23A 2A6NA 1NK9A 3PZVA 4XB3A 3V3WA 4EMDA 3UPWA 4WZQA 4DPPA 2QL5B 3QTPA 3O2IA 5DDOC 1S57A 3KWSA 2RDUA 1RUSA 4LF9J 4YB1P 3W81A 2P9GA 1OK4A 1Q63A 1ICQA 5CLWA 4G5DA 5DFAA 1F9FA 4DN1A 3DBNA 4DR3J 2OODA 3PKYA 1ZETA 4MSSA 2MY8A 5TD4A 3OR1B 3M4HA 1T94A 3PRVA 2ROGA 3FSTA 2J13A 4MDPA 3PNIA 3H4BA 4EE9A 1F05A 5I5RA 2BJ8A 3WD2A 1IV8A 3RU6A 5I3HA 3AS3A 3AMDA 3B40A 2HQCA 3WK3A 2Z56B 2YKOA 2P6SA 3WCZA 4LX4A 4X4UA 3GHUA 1JGIA 4K2JA 4WLCA 3VZXA 3QH2A 3UCGA 4O53A 4JFSA 5DG7A 2F38A 2CZFA 3OTDA 1HJSA 2TODA 1EZWA 1R2TA 1NJJA 4FYWB 3TANA 2FDMA 5F3ZA 4LF8F 1TVNA 3LPGA 3UW1A 2YKNB 4WKHA 1YJRA 5ETLA 3SCQA 3J81Y 4DS4A 4ED3A 4PWDB 4FALA 5M2PA 3QSIA 2K3IA 1AMKA 1JI2A 3GLCA 1XLHA 4RW9B 1U1JA 3W9ZA 2HQAA 2R82A 4LANA 3Q4DA 1ULRA 3VVTA 2RDWA 2CADA 1JQXA 1WQ5A 1W31A 4HK5A 5EYWA 1IBKF 4GXWA 1H73A 4WIQA 1OSDA 1FRMA 2YNFB 3M2UB 2PWHA 3A3PB 4IG3B 2VJUA 4NXMJ 1YEYA 3LZ3A 3QLHB 4C3LA 5HP1A 2I0XA 2DORA 3VAFA 3U1LA 3S5OA 1EP2A 2LQ9A 1DP0A 1LWCB 5FEXA 1CULB 3K5XA 3LZ5A 4LUSA 1FWBC 1M1HA 2DVUA 2C3UA 5FSEC 1JF5A 1IYXA 1GHSA 2PODA 1T99A 1NKBA 3NNAA 3DU0A 3EXYA 3VX1A 2OPQA 3CF5Q 3UG8A 2XUCA 5LNUA 3STPA 3PJWA 5HVGA 1I6JA 1J96A 2IVMA 4YCOA 1JZ7A 1U83A 3A8IA 4S2CA 4ES1A 3UVAA 4DPXA 2YNGB 4DSFA 3S6OA 2CXEA 1WWHA 3G6YA 1UYQA 4JTSA 2XSFA 3J7Z5 2EC0A 3UXKA 4M7TA 4PABA 3VDBA 2XM3A 1UOZA 3THPA 3BARA 1KCXA 2CQ2A 1DBTA 5XIAA 3CJ5A 3RFAA 2PDGA 3JRKA 2RHSB 1NKCA 2O67A 1X6LA 1L6FA 1TJPA 4Y96A 1NEEA 2CWXA 3UR3C 2WW4A 3LTOA 4PXDA 5K8MA 4DQSA 3M2VA 2G1DA 1V0LA 2OGJA 4AHOA 4DF0A 1Q79A 4UNIA 4CQCA 3RAMA 2HQGA 4OECA 4XZNX 3TTEA 4P10A 3A3OB 4QDMA 3W7NA 3GVRA 4FKYA 3QVQA 4PXBA 4DR6J 2MB0B 2AW0A 3LPFA 2P6TA 3GTYX 1XQLA 3C2VA 4J2PA 3T0CA 5KAKA 3WQGA 2RRNA 4LVBA 2G0IA 5I09A 2C2OB 1T8QA 3C0JA 2OSQA 4AY8A 3R10A 1G9HA 3HJEA 2HRWA 1SPBP 2ZWPA 3N4EA 3EA3A 3FJLA 5C7PA 3MMAB 1YPIA 2E5HA 2AEFA 1V0KA 5A8WB 1V9OA 4R3UA 4Z2KA 3IIOA 1K9TA 2BGNE 3V0UA 1S7HA 2JALA 4LW7A 4TVDA 1F9HA 2MZJA 4JI4J 3NCOA 3EGJA 5ABTA 4KFPA 1UP2A 4CCDA 4PKDB 3P5YA 4AIUA 3URNA 1T7LA 1V6HA 2XN0A 4GGBA 5KFNA 1YHTA 1VQ5S 4RNOA 1KFKA 3MPWA 5EWEA 2CYYA 3VOIA 4UY85 1NVMA 2FY1A 4MY8A 3PR4A 4YP3A 2PA6A 1E5NA 1TE1A 5MKGA 1S1XB 5H91A 4WXOA 4ERGA 1S1XA 2DO4A 3RM8A 2MQMA 4Z2GA 4NXKA 2YXGA 4USUA 1TFVA 4QGCA 2Q79A 3DRPA 3PIPQ 3ALFA 4MMOA 1I9CB 4O1FA 3BQ1A 2CC0A 4MKVA 3C0LA 2PT0A 5E0OA 1SMAA 4JI3J 4GYPA 4GFSA 3MUIA 5I23A 3TJIA 2FVLA 2J7DA 2OLAA 1SJDA 4IFOA 3QAEA 1HL6A 4O19A 2CEQA 2W7AA 3NL3A 2BRLA 4LH8A 3MMAA 2GQ2A 2LVWA 4O10A 3ILLA 3W73A 7TAAA 1N5SA 2OEMA 3FHQA 3GDRA 5C5JA 3V4IA 2KH9A 5I3UB 1JKHB 2OSRA 2V8DA 4R25A 3H24A 3ES8A 4R88A 3KK1B 4M82A 2FLPA 1NK4A 3EDEA 2Y0FA 1ZBKA 3NSMA 1JNRB 2HWIA 3CXOA 2ZDRA 4QFUA 1UR1A 3M6YA 3P8IA 2BOPA 2OWCA 4XO7A 2AYMA 1FDZA 4LUBA 2FB3A 4DUYF 2B6AA 4HHPA 4NI3A 5AN7A 3NGJA 1M7JA 5D4NA 3W75A 2GCFA 4B16A 1XTZA 2G2OA 3FJ4A 3M8PB 1Q6GA 4ZPBA 1QI2A 1ZH5A 3MANA 2A2IA 5LT5A 3U0HA 3EWDA 4OL8A 1R3NA 4FX7A 4JBCA 3C8FA 3KWMA 4XO0A 5KMYA 5J5RA 3BREA 2GJ2A 2WC7A 1KV8A 1M5SA 2BW7A 3GNDA 4LFBF 2H4WB 4KBXA 3WF2A 3AQUA 4CNSA 2HFSA 2RHGA 4W98A 3KBNA 1VQMS 1TZ7A 3BLKA 3WMCA 1TUGB 3H7HB 4N8OA 2ALDA 1W2BR 3FIGA 1JAKA 2A1YA 3VKCA 3UCQA 1M5OC 1SL1A 3R7NB 4QU6A 2W4CA 1WO2A 4ZVGA 2EJAA 2CQBA 3KL3A 1D09B 4CQ9A 2GOUA 4B2DD 2W9BA 3I65A 4EI2A 5C5YA 1AJZA 1A5LC 2D0GA 3GXFA 3OEXA 5CAKA 2VFIA 4C6OA 1QPOA 2AL2A 4DZIA 2JLFA 2UUBJ 1S2AA 4JXCA 3GXMA 2ABYA 2IQDA 4PL2A 3THDA 3VFLA 1P0EA 3AIBA 5DF0A 2EFOA 1IEIA 4JICA 1OY6A 1IXPA 4E4PA 4I2PA 1BY9A 4CLMA 5F2IA 1HJUA 4PQAA 3RN6A 1IGSA 3AXIA 5C7VA 2ISFA 4L6OA 3E01A 4FR6A 4USIA 3SMZA 3E5PA 5DJBA 2NPIA 3UJFA 5KG1A 1O8BA 1R43A 2JVRA 1W1TA 1A5MC 1UWQA 4HN4A 4OUIA 3D1HA 5ABFA 1XLFA 1M5WA 3IBWA 2V5CA 1OBAA 4GMKA 1NF0A 4JI1J 4XZLX 5CH9A 4AFFA 3FXGA 2WNNA 1ITQA 2Y8KA 4KTQA 4IFYA 4N9EA 5HMDA 4EVZA 3GXPA 3TEHB 2ZE2B 5BXTA 4MGGA 3GIKA 4NZFA 1XGDA 4KHPF 1Q5MA 1YDVA 2YLLA 2C3ZA 1SKUB 1UR0A 2I17A 1E1CB 3CJRA 3MUVP 3T2QA 2OU4A 4IWWA 3LWMA 1TX0A 5E3PA 1P6WA 2XMUA 5F4SA 4WVXA 2VRJA 2XMTA 2XZDB 1O5KA 3AMLA 3G24A 1O7AA 1XW8A 1VYSX 3ZR4A 3L7OA 2ZH8A 5HR6A 3O06A 3P80A 2XTKA 3KOYA 4NASA 4MWAB 1P7TA 3MMCA 1V3JA 3M0JA 1QSLA 4U2YA 4R27A 4KYZA 4E98A 3WNKA 3GDMA 4NZJA 3E51A 2X1UA 1CTNA 4CLZA 3G6XA 2BP1A 3TK7A 2E66A 3ZQ9A 2I9EA 2ZJQQ 5REQA 3Q94A 3GNXA 3K1DA 4TOQA 1X31C 5HA7A 4YB7A 5I0DA 3HP6A 4X61A 4JHMA 9ATCB 2ZTJA 2DPEA 3E5BA 2J7BA 1NAQA 3OHMB 4YPJA 4P7OA 1WDDA 2DSUA 4L4LA 3QJPA 3CV7A 3GHRA 2OKTA 1LW0B 4M80A 4X0NA 1OD0A 2DNQA 3W71A 1FXQA 3G86A 3MECA 1EUAA 3USBA 2XWXA 4DI9A 5CG7A 3GH4A 4NP7A 3P45B 3H7VA 3OTCA 3RX4A 5DQGA 3SB0A 1VRUA 3D6TB 6ENLA 1RTHB 4F2UA 1I2PA 1KQZA 3UT0A 1RHJB 3UW6A 2A18A 1KTCA 3P0WA 2Z2LA 1IKWB 2VWSA 4K4TA 3DOPA 1RE1B 2D2JA 3TQEA 2HMCA 3MAHA 3A3NB 2YA0A 1FKPB 4C5YA 4YDXA 1V02A 5U47A 2MQOA 1HARA 2HZCA 1B64A 4MJ2A 2ZBQA 3BPDA 4WX2A 4PTDA 3CAKA 3MWCA 2DH3A 4LOCA 4FS1A 1CGUA 3GO2A 4PBEA 4S3FA 4NZ6A 4UNKA 4AZBA 4B4HA 5DDQC 3V6DA 3PWGA 3HMCA 3NQVA 3ZVHA 4LF8J 5KFLA 5SUHA 1Y4ZB 4PUEA 3UN5A 1XGZA 1WG1A 3HV8A 2ZXBA 4HEA9 3VX0A 3LXCA 2A2CA 2WHMA 2UVRA 1TQJA 4WHBA 5GAGU 3J80U 3GG7A 3ABQA 1SSDA 3P81A 4RDYA 3RXZA 1JLGA 1XLJA 2XCPA 3CXCR 4ZE4A 1T96A 2OXNA 4C7DA 1MXDA 5AC5A 3ERPA 3NFUA 3UD4P 5E0KA 4LNCA 2Q01A 4LRFA 2R8IA 1W9VA 4B3LA 2DDXA 2Z29A 1F07A 3QHOA 2VODA 2HBZB 4MY9A 3GR4A 4E8DA 2KRRA 4BWJA 1HJWA 3MURP 1U1HA 4MWAA 4JI6F 2OLSA 3SN0A 1QAIA 5H8UA 4B3TF 2R7UA 4O44B 4DZ5A 1VJIA 1A0OB 1IKXA 4RBTA 2D3OR 2R24A 1HKAA 2WCXA 1S1VB 1JPDX 3RM4A 4TUFA 5C55A 3CUJA 2QSFA 5KFQA 1FCVA 1R46A 1RA5A 3BG5A 5CGQA 3WNOA 4MNJA 4S3EA 4ACYA 1PZ1A 4UC5A 1YZ6A 3T5LA 1HJQA 2Z8QA 2MJNA 3W5YA 3TSDA 1ZP3A 3BMVA 1BGGA 3DKDA 4DQPA 2QLJB 5H9FK 3EMCA 1EP4A 1U1MA 4WJBA 4E6MA 4DQWA 2XHYA 3AA9A 4DJED 2ZKUA 1URNA 3ZR5A 2DNGA 3UPFA 1QHPA 3MPDA 1CGTA 3RMEA 2QJIA 2FZ8A 3MR3A 1IBCB 3KLVA 1QR7A 3ATYA 3R1ZA 4RDZA 2OFGX 4KESA 4PG4A 5HMXA 3FAWA 3POHA 2FY8A 4NAEB 1XD1A 3CHCA 5A8QA 4XVEA 3EX3A 1HW9A 3V75A 2MQNA 1OEPA 4W93A 1HZYA 4A8YA 3CHFA 1EPXA 1Y65A 2C3YA 1PWLA 2VPWB 3A22A 5HPCA 4NLUA 3CCJS 2LP4A 1X39A 1XYBA 1Q53A 3QR1A 2VBYA 4MK8A 4R0EA 4DR6F 1ZUAX 4H9MA 1UP1A 2GQAA 1W1ZA 1D8ZA 2VP8A 2GNKA 3QMSA 4F9JA 1LBLA 3HM9A 3UNYA 4A3QA 3AHPA 3P5TL 1GX5A 1SUQA 3OLDA 3D67A 1FKOA 1L3KA 1VQYA 3TU9A 3WLTA 2X1BA 1FD8A 5A2BA 3QO9A 1WBHA 3R5BA 1VQLS 4DWSA 2WPBA 2VM8A 3JS9A 3RRHA 2FZ9A 4UTTC 3JQMA 2VG6B 1GQIA 3I96A 2VQFJ 4AF0B 1MQPA 1FVSA 1QOPA 3DMJA 3QT6A 3K4AA 4ITSA 2DH9A 1PBGA 4WY0F 4QNEA 2JFEX 4AD3A 1KNWA 2IXUA 3IAM9 4KGMA 4IF2A 2O9TA 4HSOA 1FH9A 1U0HB 3TUPA 5LXYA 4M81A 1VRTA 4ZVRB 3RR7A 3IK2A 3GTIA 2B5JA 1V5XA 4L72B 1W54A 3ZZOA 3P62A 3RIKA 3CLWA 5I3PA 4LF4J 5IWAF 2DGAA 4D2JA 3TOPA 1NFBA 2J0WA 3LTSA 4NEYA 1MEWA 1XDLA 2NSOA 1TZ0A 3DRRB 3WNMA 4ID5A 2WHJA 4KKOA 4CQ1A 3NWGA 2FLIA 5M2RA 1Q6CA 3GR1A 2RSQA 1TK0A 3ABZA 3FJ6A 4GUGA 4O14A 4O4VA 1AZSA 1FWIC 2LFVA 2VT0A 2HSAA 4XTIA 3EVOA 5I6SA 4UR8A 1PE1A 4ELVA 1VQSA 3HN3A 4KGKA 1JJHA 3T5HA 1V77A 5IM51 1F6KA 5EDWA 2GGEA 2KZHA 4AWUA 1PX3A 5A0YA 2GVGA 3CUGA 3W9JA 4LF5J 1NDVA 2RDDA 2WVFA 4QEHA 3CLMA 1ISWA 1H09A 2DGXA 2PSZA 1W5PA 4FAMA 5ETPA 3TRGA 2W4DA 4WE1B 5D0HA 5A6LA 4PA8A 1Q6OA 2QXWA 2HVIA 3MM9B 1IWGA 1HKJA 5DS7A 4QG8A 2IDLA 5DO8A 4YNGA 2B5JB 2QJGA 1FWRA 1KXTA 5AKQA 5C70A 3ZZRA 3MWBA 2W6RA 3KBWA 3ZFHA 1B70B 5E3QA 3AJ7A 4N0RA 3VMNA 2HNZA 3BZJA 1WOAA 1K1DA 4H4OA 1TV4A 2WYSA 2CHRA 4LCSA 3FX4A 4U7CA 1TL3A 5A6BD 4C1NA 3MCSA 2GSEA 3A12A 2JJ4D 3IJ7A 2VX6A 4CNPA 3CIXA 1X1NA 2BXYA 3GFZA 5C2CA 4M51A 5G5IA 3FA5A 4KEVA 3NLCA 1N5QA 1JXEA 3RB3A 2L48A 5C8BB 1RTZA 5AE2A 4LAZA 3W9IA 5AHFA 1X4FA 1N0VC 2CFXA 3HK2A 2GWGA 2IHR1 1R3RA 3S5YA 2OYKA 3EDRB 3N13A 1EKOA 5J8LA 1OX5A 4LTSA 3S1UA 3SRKA 1SIZA 5HR7A 3WBAA 4ATNA 1OSEA 1AMYA 1BQGA 4A8FA 3WX4A 3HV9A 3KOAA 1DYSA 4DX8H 1NPRA 5I3GA 2QCLA 5FIIA 3GTNA 2X1GA 1E5JA 3V36A 1KBKA 1VJQA 1OFPA 1Y3JA 2L9DA 2LKZA 2UUBF 3C52A 3NGKA 3QT5A 3MEGA 2XY7A 1GVOA 3TN3A 5FF2A 3H90A 3S5NA 3ZXWA 2YKPA 3EM1A 4EX4A 1YDNA 3VGFA 4PEEA 1B30A 4GNJA 1JCYA 2QCMA 2OMLA 3DLEA 1NB7A 4Z17A 2G37A 1AH3A 1PTDA 2JSXA 3N18A 3TTYA 1UD6A 4S38A 1TAQA 5T9CE 3TZNA 2VEMA 5CBJA 3N17A 1E72M 5FAJA 1W1PA 2BE2A 1K9FA 4DPUA 2RUGA 3HFKA 3HF5A 5HVHA 3E2EA 4JIQA 2VBZA 1F2HA 2OSYA 3EXCX 1A7GE 1U30A 4FF5A 4C7FA 4LREA 3ZTSA 2FVMA 4KPYA 1IM4A 1BKSA 2DGVA 4FLSA 1DQ9A 1F1BB 1O0PA 3P5ZA 2J88A 1HNIB 2PWUA 5LMNF 1LK7A 4LGXA 1XERA 2FYMA 4Z08A 1NF7A 5EPDA 1KFSA 1OF8A 3WD3A 5G1YA 3E2VA 3WDJA 4AD0A 5DETA 2V82A 1EYEA 5M03A 1H2UX 5D0GA 5A76A 2H8XA 3WEMA 3H8YA 4I1TA 3K2GA 1TQLA 4F04B 1PG5B 2UUCJ 1DTTB 5EMKA 1TL1B 3T44A 1GOMA 2V4JA 2P9EA 3VNDA 5A3HA 2EGZA 2OPJA 2QMKA 1QI0A 1WKDA 2HMIB 2PB1A 1S48A 2FJBB 1DLOA 1A47A 1FI4A 2ZZ2A 3W1PA 2FFIA 1DFDA 1GOIA 1WG5A 3P96A 3VC6A 4DWSD 4PRFA 3AHVA 3EWXA 2VC6A 2XSXA 1Y3KA 3M46A 1XYZA 5F0UA 2GJXB 5FACA 4Z2LA 2Y4SA 1GNXA 2OT0A 3KMSA 2HW3A 4PUUA 4LFCF 3W6LA 3NNTA 1WZLA 3NQ8A 5AYXA 1A5NC 3GRIA 1KLNA 1EJVC 1NH7A 2VXNA 5CPLA 4MB1A 3THTA 4E8UA 2J7GA 1GZ1A 1OS5A 1H7PA 4AEEA 5L39A 3ZR6A 2O3DA 2WONB 3W2WA 3MPUB 2GMLA 3N6MA 5I00A 5FF4A 2CVEA 1U1QA 1OPZA 3WX8A 6CGTA 2QVHA 4FNQA 3W1NA 4YMZA 1EC8A 2EQDA 2YDRA 2HHHJ 3GG0A 2PDJA 3CV6A 1HWUA 4TU8A 3EZ5A 3BWWA 1TKDA 4ZPWR 4ZVQB 1Q8IA 3KRBA 3L5AA 3N1AA 2D0FA 2DNMA 3IXQA 4L65A 4K59A 3EAUA 5CA5A 1WNEA 5FJJA 2IKGA 2QHAA 1E6QM 3CVKA 1QDUB 1E3ZA 1S2UA 3PS7A 4HA1A 2BHYA 3M8QB 3FYYA 2OPSA 4GWEA 2JE8A 3TAOA 4C8NA 5M3WA 3E3XA 4LF6F 3TN6A 3DC0A 3CSKA 3AD8C 2VYOA 3W2MA 3C2PA 1E9IA 1JLEB 2E6DA 3QPYA 3PZGA 4H7VA 1S1PA 4UTWC 5AVHA 4J9RA 4LUIA 3GDBA 2ZUUA 7FD1A 2WSFC 1L8NA 5A8RA 3VQSA 1QNRA 3FUYA 1YTKA 3B4UA 4D6CA 4OJYA 2WVVB 3NS7B 3LCGA 4IIDA 1KRAC 1S2WA 2XIQA 3ETOA 5I4MA 2WW8A 1T05B 3P8BB 4TQTA 5SZTA 1XS2A 5CQGA 3PYFA 5J2NA 2QW5A 2VC7A 1VQ6S 1FCAA 4KERA 3N9RA 1WSVA 4ZP9A 3HXMA 4AZIA 5LJ3Y 3NSXA 4U10A 3ATZA 3EDDA 2YX4A 1O66A 3W2VA 3JTOA 2CLOA 2XGIA 1GOQA 1I1XA 1QOQA 2WCSA 5C42A 1QK2A 2DY3A 3MP5A 2BXVA 1DWJM 4K8EA 1XWLA 1MNEA 1QASA 1SZFA 3F4CA 4XAYA 3B82A 3MZ2A 1B31A 1AFSA 1BKHA 3D9BA 4V28A 2VA2A 4ZCIA 3OVBA 4WKFA 5FLXY 3RJXA 3V5OA 1JUKA 4P74A 1V3ZA 3GUWA 2ZH2A 2EFVA 4IOBA 2VHLA 4DG1B 1R9YA 4JNMA 2PDQA 4JI6J 1C0UB 3VUSA 1UWTA 4O1AA 3O07A 1VFJA 3Q86A 1YTDA 3L4XA 3LA4A 4IH3A 1B3YA 1SQ7A 5H1SV 1RA7A 3PTMA 1IKWA 2JDJA 4BJHA 3M8RA 1ZP4A 3V5FA 2XHWA 4GKTA 1SW3A 3E3HA 4Q4QA 3SY8A 3MFHA 1GYNA 2RB7A 4NA2A 5CD4H 1T8EA 3UCZP 1SFSA 2BE7D 3BE7A 5B0GA 4E2FB 3CD0A 1RSCA 3WMBA 3M8ZA 4Q4OA 4M24A 3CCTA 3WLHA 1NWUA 4ROPA 2ZC8A 3P67A 4Q7BA 4MIWA 4FN5A 3SV3A 1PKYA 3JB9k 4ADSA 2CWNA 1BHNA 5GAHU 5D8ZA 2UV8G 3J81j 3GD6A 1MFVA 1FCBA 4BA0A 4FPSA 2G5WA 4MMWA 1MVYA 1TUWA 4S3AA 3DLJA 2KJVA 3T0DA 3GPAA 3MD1A 1U45A 4PL1A 4UFLA 9CGTA 5EGYA 1HQEA 4JFVA 1ZGDA 1YQHA 4FIQA 2BJEA 3QPIA 1S1UB 5D03A 1PIIA 1JZ8A 2SFPA 3LX9A 3D7SB 2DIKA 2PD9A 1DAXA 2OTDA 4AEFA 3PPCA 3FJ2A 4JKMA 1FA0A 1XIHA 4U8VA 4Y3CA 3NYDA 2ICSA 5LHFA 1FWCC 5JBDA 2XWDA 4N2YA 3KLGB 2NW0A 3NCPA 1FNXH 4DWIA 4UNLA 3L12A 2NWRA 1T40A 3CD7A 5CYQB 2WAQD 1TO3A 2CPJA 3A8JA 2OFJA 4O23A 1KTQA 2JOQA 1NDYA 2D24A 2R6OA 3DOKB 3HFVA 1SCJB 2HXUA 2FVKA 1KFEA 2YLAA 1ONRA 2H48B 3CJSA 1RYRA 5EFDA 1LV5A 4I67A 3V6DB 3CCSS 1TYGA 1C0TB 3T0BA 5C9UA 2BOAA 1Z32X 5AVNA 4LF7F 4EF8A 1NQ6A 5CC5A 4DJFD 4FNUA 1CJTB 1GG0A 1SR0A 5M1TA 2UXDF 4L76A 3AQPA 2ZZ3A 4Q8NA 3ARTA 4DR1J 1DY3A 1SM9A 2QYGA 3DXSX 2M7SA 4R34A 5H9EK 2Y8WA 1N36F 4NZ3A 2DR5A 4FK9A 2JK2A 3AA8A 1QW9A 1FE4A 1DHPA 1J11A 3HB9A 4AQYF 4OV9A 1EZ2A 2IRXA 1VEOA 3N4FA 4TTUA 3N5BA 1DWIM 1E4MM 4XPEA 3M6DA 3SSRA 2YGYA 2QA2A 3MTJA 4FVMA 1UBSA 3BAKA 4JY8A 3UVJA 1NDZA 4L9YA 2ZOXA 4KKOB 3DCPA 3PX6A 2EG1A 3DOLB 3K1GA 3SRDA 4Q4MA 4DF1A 2VFVA 1SO5A 3PW0A 4ZODA 3IARA 4J35A 1HVQA 2YNHA 1Z2ZA 1Z48A 2DITA 1IUJA 1RTIA 4LBRA 4EK2A 4F36A 3ENQA 1QATA 4I90A 4Q8QA 1RA6A 4R9OA 1PTGA 3PULA 1FJ7A 1W9XA 2WZ1A 4MTPA 2ZM6F 4TV5A 2K7KA 3EB4A 1N5YB 5D9OA 2XSBA 1VIWA 2WMIA 2PAJA 3KYLA 3LPOA 4EKJA 2RS8A 5J2MA 3A1YG 3DM2A 5FJUA 3NR0A 2PS2A 4HPHA 3CMGA 2XIJA 4B17A 1OFRA 1PZ3A 4Q8OA 1SV5A 4CDIA 5HXMA 2BHUA 1Y0EA 2E7WA 1IE7C 3IK4A 3UZ5A 2NV1A 3WG6A 1RAIB 1KP6A 4UQBA 1O5QA 3ICJA 5ECUA 1ZQ5A 4I9AA 4KQNA 3WK1A 2R7VA 2KN4A 1VLOA 3SGUA 4DWSC 3DYAA 4P73A 1F4HA 2EPNA 3R94A 3WQPA 4HOZA 4IPLA 2PZNA 1E56A 1IT8A 4DMZA 4TXSA 1WSRA 4YLWA 3M0VA 2OWWA 4Q45A 3G1SA 1K7XA 1S5WA 5C9ZA 2XVNA 4Q8EA 3MMJA 1FWTA 1VP5A 5LL6d 2J77A 3SUUA 1EJSC 5IT9U 4EF9A 1FCUA 4RV8A 1C7TA 1ZJHA 2HEKA 1N4LA 3SCOA 1R5YA 2HWGA 2DD8S 3GFYA 3OIXA 4NZ4A 4LT9A 2E5LF 2APOA 4GC4A 1YJ9S 2PWEA 4PMOA 4P8XA 4AEOA 3GC4A 3M8PA 2AOSA 3WIJA 3NEVA 1URRA 4AVFA 4CP5A 4OZ2A 5G2IA 3MYPA 4FF1A 1KM2A 4UFIA 1N34F 5HMFA 4OZ3A 4ZPTR 1X4GA 4IFVA 2A3JA 4CM0A 3LEPA 2BOGX 4O18A 4ZEPA 4NLPA 3Q2TC 4FNTA 3SCPA 1CDGA 4ZGYA 4Q5VA 4R7OA 4F0SA 1GH8A 5KTQA 1T7PA 3CL8A 4GI4A 3W1MA 5J2QB 2IKIA 4ZFMA 3R11A 2E9MA 1JJ2R 5IT4A 2HHSA 2HIQA 1QOXA 3QR0A 3WZ0A 2GHPA 3QBUA 3RITA 1TL3B 2GGJA 4BS0A 2W4PA 3TN5A 2DZSA 2UU9J 2ZUVA 2YFNA 5F2MA 1PSDA 1DOSA 1UR3M 2V9DA 5A6SA 3EPGA 2F3JA 4DSJA 1JUBA 2OX4A 4DO5A 4LYPA 2UZAA 1JCXA 2GMHA 4CO2A 3KG4A 3IUHA 4Z37A 2F4FA 4LFYA 3G0UA 4DYKA 3N14A 3EJMA 3LAMA 1VCGA 5D05A 1B3VA 2PDYA 3ZSTA 1LL4A 2POKA 1XL9A 5A6WA 2Q6ZA 3EWGA 2R2TA 2IBKA 2GFTA 3ARZA 1VHIA 2HNDB 3RRKA 4LF1A 1ZS6A 1OK6A 2GUBA 1NQKA 5KFHA 3GG8A 4JTLA 4H00A 4P7TA 3UZXA 5IC6B 2OLWA 2BA9A 2O1PA 4LFCJ 1Y7VA 3GVWA 1JLBB 4YHHJ 1KKRA 2V3DA 3GAYA 3D3BJ 3D0IE 3NMAA 2HVOA 1KR0A 5DMNA 2YNIB 2ZBCA 2V68A 2D3O1 3WQEA 3PR5B 4GKJJ 4LS0A 3VOHA 3NL0A 1ZBCA 1NSQA 2Y5EA 1QO2A 4QLKA 4I5UA 2J9EA 1PO6A 4ED8A 4DY1A 4AG0A 4DBUA 1R8PA 4PMDA 1VS1A 2QL9B 2P5NA 3NQCA 4R5PB 3UWTA 1Q8KA 3R5JB 2FMNA 4BDPA 4ZP7A 2G96A 4CO5A 3OL6A 4WCE