4RNHA

Pamora tandem diguanylate cyclase - phosphodiesterase, c-di-gmp complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
429
structure length
423
Chain Sequence
MAYYDALTHLPNRTLFQDRLHTALQQAERNGQWVVLMFLDLDRFLGHAAGDRMLQEVATRLSACVSQDDTVARMGGDEFTLLLPSQGDREIALKRAIQVAELILGRLARPFTLEGREFFVTASIGVALSPQDGAELSLLMKNADTAMYHAKEMGKNNFQFYQAEMNARALERLELESDLRRALELGEFVLHYQPQFTGDGRRLTGAEALLRWQHPRRGLVPPSEFIPVLEEIGLVAQVGDWLLAEACKQLRSWHKAKVRVPKVSVNLSARQFADGQLGERIAAILYETGIPPACLELELTESILMSDVAEAMQILSGLKRLGLAIAVDDFGTGYSSLNYLKQFPIDVLKIDRSFVDGLPHGEQDAQIARAIIAMAHSLNLMVIAEGVESQAQLDFLREHGCDEVQGYLFGRPMPAEQFGMLYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Motility regulator
publication title Formation and dimerization of the phosphodiesterase active site of the Pseudomonas aeruginosa MorA, a bi-functional c-di-GMP regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase, hydrolase
total genus 146
structure length 423
sequence length 429
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4rnhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rnhA01
3GFXA 1C1CA 2YKMB 2RDJA 3V81B 1GX6A 4KSEB 4NLRA 2WOMA 1T94A 4RZRA 1LWEB 1HNVB 1QE1B 2GIQA 1HARA 4AG0A 4O4GA 1TL3A 5KT5A 2YNIA 3I5AA 1KLMA 5FDLB 2W8KA 4KO0B 2AGPA 5KG6A 3KK2A 4FBUA 3HVAA 3H98A 3V6DA 1VRUB 1RTJB 2W7PA 5DQGA 4IH5A 1S49A 1EETB 4NLUA 1RT5A 2VG5B 5DLGA 1J5OA 2XI2A 4I7FA 3GIKA 2V4QA 5MKGA 3PJWA 4IFYA 5J2PB 3KLEB 1I6JA 4EYHB 4ZP7A 2HMIB 2OPSB 3MEGB 5J1EB 2JLEA 4NCGB 1UWBA 1SH3A 3I0RA 1GX5A 1IKWB 3M8PA 2FVCA 4KV8A 1EP4B 4Q43A 4AFYA 1IM4A 4ECRA 3T5LA 4QW8A 4KFBB 3PW5A 4DL6A 2D7SA 3DI6A 3SI8A 2IM2A 4TY9A 2BANA 1LW0A 2BRLA 3GFZA 4TLRA 4ED2A 3HKWA 4KKOA 2R2SA 4M95A 4FOJA 4KIEA 1HQEB 1HQUA 3FSIA 2VA3A 4Y9PA 3DOLA 1MU2A 2AU0A 2I5JB 4ECVA 2VA2A 1SV5A 3DLKB 2BRKA 1TV6A 3BGRB 1XR6A 4IH6A 4KAIA 3MR2A 4U6PA 4J9KA 2B5JA 3PW0A 2B6AB 3I5CA 3RBDA 3OL8A 4I2PA 3QLHA 5DG8A 4RW9A 2BASA 4IH7A 1IKYA 4TN2A 3I0SB 1DLOA 1RT4B 3IN5A 1RT7A 3NBPB 5HP1B 4JV2A 3KMSA 1TKXB 4TQRA 1JLCA 4JV0A 3BSOA 5L1KA 3KHRA 4Q0BA 3IS9B 4F4XA 3PHEA 3QIPA 2W8LA 2JC1A 3RB0A 4URQU 4IR1A 3TAMB 1WNEA 3OHAA 3G6XA 5KFVA 3MF5A 5KT4A 4F48A 3DMJA 5KFDA 3T5HA 2FJWA 1LWFB 4FOUA 1W25A 4NLQA 3MECA 4MKBA 2YNFA 3DOKA 4O3RA 2YKNA 2YNHB 4RNNA 4IG3A 5HBMB 1C1CB 1JLQA 4YR0A 2C2EA 2WOMB 4ECYA 2OPRB 4MFBA 4ED8A 4O4GB 1TL3B 4ZVHA 3ITHB 1S0MA 1KLMB 3Q8RB 1JLBA 4O4RA 5DGBA 3KK2B 4NLPA 4ECXA 3QZ8A 2UVUA 4WFYA 2E9TA 3NMAA 4Q8EA 1S1WA 4WYLA 3DRSA 1N6QA 4ED1A 3DYAA 3FFIA 4K4UA 4LSLA 1CSJA 3CWJA 4WXWA 5KFNA 5KFBA 3T5JA 2IBKA 4RNFA 5MKGB 1IKVA 5KFYA 5C25A 4IQXA 2ATLA 4PWDA 2JEJA 3KLIA 1JKHB 2VG6B 3CJ2A 3CVKA 3TQ1A 1UWBB 3ICLA 4GC7A 2IAJA 1TL1A 1C0UA 3I0RB 4KV8B 3MR6A 1RA7A 3KZPA 5KFGA 5DG9A 2D3ZA 3GV5B 4J9QA 4YP3A 4RNOA 3H5XA 1HMVA 2UUWA 1RDRA 4WFZA 1S6PA 1TKZA 4WZQA 1VRTA 2XGQA 2GC8A 3DI6B 2V0NA 4DG1B 5C42A 1LW0B 4NLYA 3CDEA 3M9NB 4KKOB 4WFXA 4XPEA 3KK1A 2QE5A 2UVWA 1QAJA 4G3IA 5KG7A 1RT6A 2EC0A 1RT1A 1MU2B 2WONA 4FS1A 4DL3A 1TV6B 3T19A 2B43A 3ISND 4NLTA 4ZVFA 2WTFA 3KK3A 2B5JB 3MR5A 4ECWA 1DTTA 1FKOA 3KHGA 5F9LA 4WZMA 4I2PB 1S1UA 3N3TA 4YR3A 4M94A 1JX4A 1KHWA 1C1BB 1JLAB 1Z4UA 3LP2A 1RTHB 5J2PA 4IRDA 4LSNA 4LQ9A 1N4LA 1JLCB 4ED6A 1RTDA 4B3OB 2HNDB 2RF2B 4QPXA 3RB4A 4Q0BB 2ZD1A 5EUHA 2C2DA 2JEGA 3KLGA 3EPIA 3QIPB 5M1TA 4LQ3A 4TQSA 1BQMA 1JIHA 4J9SA 1RYRA 5D3GB 4Y2AA 3LP1A 4Q6JA 3RB3A 4WE1A 1TVRA 3G6YA 3KMQA 3PR5B 3DMJB 1OS5A 4J9MA 4Y9NA 3MECB 3UPFA 2YNFB 4DEZA 3T5KA 2YKNB 3BSCA 4MIAA 2XC9A 4IG3B 1JLQB 3CIZA 4Q45A 2HNZA 3C6TB 1S1TB 3E01B 1C0TA 3LAKA 2FLLA 5F8HA 1HYSB 3KLFA 3DLGA 4NLVA 1NHUA 3LAMA 3PW7A 5F8NA 2AX1A 4ZPCA 3IG1B 2ILZA 3OSNA 1N48A 4EBEA 1FKPB 4IFVA 5J2NA 3G86A 3PJXA 5L9XA 4O3SA 1S1WB 4GC6A 1N6QB 3JYTB 3V6HA 4K4TA 1IKVB 5C25B 2BE2B 3NKYA 3KNAA 3VQSA 3BQ1A 2ASJA 4PWDB 4J9RA 3D5MA 3KLIB 2O5DA 3QO9A 1RTIA 2C22A 4KBIA 1TL1B 1C0UB 2RDIA 2XI3A 4YQWA 3G6VA 2BR0A 3KHHA 4RW7A 2YNGA 4Y9MA 3DRPB 1T03A 5C24A 4EEYA 1HMVB 1S6PB 1RT2B 2IJFA 1VRTB 3V4IA 4RNJA 2AGQA 3RBEA 5KFTA 4Y9OA 1JLFA 4R8UA 4QW9A 1N56A 2J6SA 5C42B 2RKIA 1DTQA 4LJ3A 4ID5A 2XGPA 4H4MA 3RAQA 3UQSA 5HROA 3KK1B 3FDSA 3GG1A 1REVA 2V9WA 1RT6B 5KG4A 4MK7A 1K1SA 3DM2B 3CDWA 1TQLA 1K1QA 3KJVA 2OH2A 2R8HA 1DTTB 3BQ0A 2FJXA 2IC3A 1S1UB 1S9EA 4IRCA 3OL6A 1ZTTA 4Y2CA 2FLPA 5K14B 4R5PA 3LP2B 3Q8PB 1IKXB 1RA6A 3LP0B 4IKAA 4DL5A 2AX0A 2IJNA 5KFUA 1RTDB 3BJYA 3BSNA 3HHKA 2ZD1B 1HPZA 5HLFA 5KFPA 4JV1A 3MEDA 5EWFA 1LWCA 4ZP6A 2D41A 4QWCA 5KFXA 3IRXA 1BQMB 1KHVA 4IOBA 4MH8A 3JSMA 2WRMA 3GV7B 4F4WA 3PVXA 2R8JA 3H5SA 4DL4A 3HVTA 1JLGA 2YNIB 1N5YA 5DGAA 4O3OA 5KFKA 4XO0A 2YKMA 1S1XA 3FRZA 5KFFA 4IDKA 4RW6A 3V81A 1TVRB 1S0NA 2FVPA 5CYMA 1NHVA 4RW4A 4ZPBA 1HNVA 3DDKA 4EO6A 5C5JA 5KFWA 5KT2A 4URSA 3V6DB 2FVQA 2FLNA 4RUCA 2HWHA 1LW2A 4QWDA 1D1UA 1RT3A 1RT5B 3S83A 1VRUA 4I7FB 1RTJA 4ICLA 2HNZB 2ASDA 1QUVA 4IFYB 3CJ0A 4X2BA 3SY8A 3C6UA 4K4ZA 4JUZA 3KLFB 5KFQA 4ZPDA 3DLGB 3GIJA 3PW4A 2DPIA 2JC0A 2D3UA 5KFJA 4IG0A 4HKQA 3PR4A 3M8PB 1T3NA 1TKTA 3FQLA 4NLOA 1FK9A 5J2NB 3OHBA 4YR2A 2W7OA 5I3UA 1IKWA 4LYKA 2CJQA 2HWIA 3H59A 3N6MA 4J9NA 2BANB 2XCPA 3QZ7A 3GFYA 2R2TA 4NLXA 2J6TA 3BR9A 1S6QA 1HQUB 1YVFA 3H5UA 3QO9B 3ISNC 4O3QA 1RTIB 3DOLB 5F8IA 3RB6A 3OSPA 3V6KA 1SV5B 4IR9A 1S1VA 4Q44A 1S10A 5C24B 2F8EX 4ED3A 3NAHA 3QIDA 3QLHB 4XPCA 4RW9B 3TLQA 3V4IB 3BSAA 1IKYB 2AWZA 3BGRA 3DLKA 1DLOB 4R8UB 2CKWA 5F8MA 1XR7A 3KLHA 4NLGA 2RKIB 4MIBA 1RT7B 3KLVA 4ID5B 5KFHA 1SH0A 2GIRA 2OPPA 5CYQA 1REVB 4KE5A 3H4BA 4ZMMA 3EPGA 3HV8A 3OL7A 4ED7A 2R2RA 3GV8B 5L1LA 3KJVB 2JEIA 4ZVGA 3HVWA 5DLFA 2ZE2A 2AQ4A 3DLEA 1S9EB 5I42A 3M8QA 4R0EA 4RNMA 5KFZA 5KT3A 4ED0A 4MK8A 4K4WA 2IMWP 2J6UA 3KOAA 4NYZA 5KFIA 2WB4A 2XCAA 3TAMA 3CO9A 5HLFB 3CDUA 3DOKB 4K4YA 4NLSA 1SH2A 2IM0A 3RAXA 1LWCB 4PUOA 1R0AA 5KG1A 1LWFA 3GIMA 1JLEA 1RAJA 3H4DA 4MFBB 4NZ0A 5KFAA 3KHLA 3HVTB 1JLGB 4I2QA 5HBMA 1JLBB 1S1XB 1S9FA 4IDKB 4KB7A 4RW6B 4NLWA 4K4VA 1S9GA 5CYMB 1SUQA 4RW4B 2OPRA 2UUTA 4YMEA 3MR3A 5KG3A 5KFOA 4F4ZA 5J2QA 2UVVA 4ECSA 3IGNA 3ITHA 5KG2A 2VG7A 3DRSB 1LW2B 5KG5A 4EBCA 1RT3B 4ZPAA 2BQUA 1HNIA 3MFHA 3DYAB 3FFIB 4URGA 5F8LA 5J2MA 4LSLB 4ICLB 2R8GA 4J9LA 4ZHRA 3C6UB 4FOKA 4K4XA 3HV9A 2R6OA 4ECZA 4J9OA 4IG0B 1QAIA 1MMLA 2IAJB 3H5YA 2XWYA 3NL0A 1TKTB 3T1AA 1FK9B 4TYAA 1JKHA 2VG6A 5DG7A 5I3UB 3GYNA 2BQ3A 2JEFA 3NGDA 4RNIA 5JXSA 1TKZB 5L1JA 3GQCA 5KFCA 2UVRA 4FBTA 3PZPA 4H4OA 3U2EA 1S6QB 3DRRA 4RW8A 5KFMA 4DG1A 1RT1B 4ZVEA 2WONB 2IM3A 2R8KA 5MF5A 5KT6A 1S1VB 3TVKA 3KK3B 2W9CA 1S48A 1FKOB 4H54A 4MKAA 4O44A 3LANA 2OPQA 1BQNA 3KLHB 3N6NA 4EYIB 1S4FA 2I1RA 2E9ZA 2HNYA 3Q8SB 4LSNB 2BQRA 1NNDA 3MEEA 3OLAA 4G1QA 5L1IA 2R2UA 3CJ3A 2ASLA 5CYQB 2OPPB 4PQUA 1C1BA 1JLAA 3OL9A 1RTHA 3M9MB 3KLGB 4ECTA 4MK9A 4B3OA 2HNDA 2RF2A 4J9PA 2FJVA 3QGHA 4TY8A 2ZE2B 4RUAA 3DLEB 4RU9A 2IA6A 5I42B 1T05A 3M8QB 5F8GA 2W9BA 3GIIA 3EZUA 3LP1B 3QGGA 2C2RA 4WE1B 5DQHA 2DPJA 1LWEA 1QE1A 4Y3CA 5KT7A 4KHMA 3BQ2A 4HU3A 5KFLA 5D3GA 4K4SA 3I5BA 5FDLA 5T14A 4KO0A 5EWGA 1TP7A 2QV6A 2R8IA 4PUOB 2V4RA 4QWAA 1R0AB 3D28A 1JLEB 1C0TB 5JUMA 3PFMA 1EETA 4ECUA 2VG5A 1XR5A 4EO8A 4I2QB 3QGIA 3CJ5A 3C6TA 1S1TA 1S9GB 1U09A 1SUQB 3PJUA 3E01A 3KLEA 5J2QB 3N6LA 2WCXA 4Y34A 4IFVB 2HMIA 2OPSA 3MEGA 5J1EA 1HYSA 4NCGA 4OL8A 2VG7B 2WHOA 3MTKA 5EDWA 1HNIB 4K50A 5J2MB 5F8JA 3IG1A 4IRKA 1EP4A 1FKPA 4EBDA 2WK4A 2HAIA 3BREA 4NRUA 4QWBA 3V6JA 4KFBA 4ZHRB 1T05B 1JXLA 3H2LA 4FS2A 3OLBA 3PJTA 3NAIA 2ILYA 5KG0A 4QWEA 4DL7A 3JYTA 2FVRA 1ZETA 4ZP9A 2FVSA 3M9OB 2BE2A 1ZTWA 2ZKUA 4RW7B 4DL2A 4WXOA 2YNGB 3QYYA 1T03B 1HQEA 4J40A 4U7CA 4Q8FA 4TYBA 2I5JA 3LALA 3MFIA 1JLFB 3DRPA 3UR0A 1DTQB 2B6AA 3E51A 3UDLA 5EWEA 3H40A 4H4MB 4ZP8A 4H4OB 3SFGA 5HROB 1RT2A 2IM1A 4Y8EA 4WYWA 4O3NA 3DRRB 3GG0A 3I0SA 4NLDA 4RW8B 1RT4A 5KFRA 4ES4A 1RYSA 2AGOA 4HJFA 3NBPA 5HP1A 2ALZA 1TKXA 1S0OA 4HYKA 4F50A 4F4YA 2W9CB 1D0EA 3IS9A 2IC3B 1J5OB 4TXSA 2C28A 4O44B 2OPQB 4KHRA 1BQNB 3PW2A 3DM2A 3IGVA 4F3HA 1S97A 4RNHA 4R5PB 2HNYB 4O3PA 4ECQA 3MEEB 3GILA 4G1QB 2W9AA 5KFEA 4PQUB 5F9NA 2W27A 2E9RX 5K14A 1HPZB 3FQKA 3Q8QB 1IKXA 3MEDB 3LP0A 4NRTA 5KFSA 3IRXB 5DQIA 3JSMB 3CJ4A 4TY8B 4HU4A 2YNHA 1C2PA 3SFUA 1N5YB 2W9BB
chains in the Genus database with same CATH superfamily
1SJ4P 3HOJA 2IIHA 3A21A 5FDLB 4J9UE 3V5OA 2A3AA 3EDKA 2NV9A 4Q4KA 3S01A 4QYZK 3H2NA 2OWXA 1IT8A 1ICEB 1RWPB 2XWEA 4X84A 4L64A 5F3TA 2W3ZA 5J2PB 1EJTC 3WQ4A 5D4PA 2HMIB 4I6VA 5J1EB 3BW3A 3W2VA 1UWBA 4GKLA 3PAJA 2YH1A 1VQ6S 1FHVA 2NREA 1FHTA 1BG4A 1XYZA 1JD7A 4JBRA 3BKUA 1W2IA 4DL6A 2PDNA 2PMZD 4OZLA 2NSXA 2XG9A 4JEQA 4IFKA 2GQ8A 4MAKA 3C2FA 4B9LA 3HKWA 1PTAA 4QG8A 1M7JA 1UA3A 3W3OA 3WBEA 5LKYA 3T42A 3CCVS 2BKNA 2CRLA 2HE5A 2GSEA 4POCA 1XR6A 1G94A 4ZPWR 3MURP 2VT0A 2HRWA 3S2CA 1BEUA 2Z28A 1DLOA 3PRVA 1NEEA 5IWAF 4JV0A 2B81A 3UY8A 1PX4A 3AI0A 2DW6A 3ANYA 1ZOTA 3LCWA 1MLAA 1Y0HA 4GUJA 3W66A 3KL5A 4RBUA 4MJ2A 3RB0A 3C5QA 4NOHA 3D9BA 3OLIA 2A6NA 4UTWA 2W2OP 3P8JA 2JFDA 2PCQA 4DBEA 4C1KA 1QI2A 1LWFB 3GZAA 2MGZA 5D15A 4RNNA 3CCSS 1ISXA 1JLQA 1XINA 1NOUA 4PB5A 2OPRB 2BM1A 3A8KA 1C7TA 1GXTA 1TL3B 1WDWA 2FHOB 3M32A 4P2FA 4WKHA 4JNZA 4CIOA 5BMXA 3WHIA 1LK5A 4DUOA 2A79A 4Q8EA 1ONEA 1D3HA 4LANA 4I69A 2DZBA 4Z2LA 1VJQA 5LM7E 4XBKA 5MKGB 2R4FA 5KFYA 1E6YB 4J5NA 1Q6DA 5FJJA 4MB5A 3WCZA 4KV8B 2CETA 1MG7A 3MR6A 4C6KA 4YP3A 2C2MB 2PZNA 5T7LB 1UA7A 4ZSTA 4ZOAA 4Z2KA 3AQPA 3W2WA 3CDEA 4UFMA 4WFXA 4J35A 1QAJA 3KRUA 4G3IA 2XSBA 5DELA 3RBXA 2G3MA 1L3VA 1ZETA 2CVEA 3H2VE 4WZMA 3CUZA 3N3TA 5KZDA 1DRZA 3QAEA 1Q2RA 2CZEA 4F4AA 1NDZA 4B3OB 4B5VA 3G1DA 2C2DA 4F2UA 2GJXA 4JOMA 3C66A 1LWXA 1KRBC 1UVNA 2BP1A 4M5KA 2OX1A 2D9PA 4DVOA 4ZPVR 4ZVTB 2IYGA 3QRPA 1A47A 2D20A 3W1RA 2NVAA 4HACB 5HMZA 3VD7A 3RB3A 3PAOA 1KM0A 4KWSA 3T4WA 2ONEA 4DO5A 4ROPA 3ZR4A 4IG3B 3RR7A 2VCBA 2INEA 3CIZA 3PWGA 1YQ2A 3C6TB 4PUKA 3LPOA 3ELFA 4XD6A 3OVSA 1IXQA 3RNDA 4DIAA 2YPYA 2XVGA 3N9KA 1FWFC 4C8OA 2M8HA 3LV6A 4E5TA 1KFEA 4UTWC 4JQ2A 4AZHA 3BTNA 4EF8A 3WLRA 2J47A 4LS1A 2HHUA 4QNEA 4RCXA 2ZICA 2QRRA 2YL5A 4JIEA 1Q3NA 5FL1A 4K4TA 1HWJA 1VLIA 3D5MA 4KGJA 3VCNA 1S57A 4TVDA 1ZAIA 1GMVA 3KLLA 2WMKA 4NPOA 4CLMA 2D3O1 4EXAA 2ZE3A 5JIPA 2RKXA 3V4IA 4DEFA 2H48B 5C42B 3ABZA 4C7QA 4XZMX 2OI2A 4ZVJA 4DR7J 2FFCA 1LK7A 2MKCA 1B4SA 2NW0A 2W63A 1K1QA 5IQ6A 1VISA 2IC3A 2QVHA 3MMWA 4LOCA 1J0ZA 3TZXA 3UCQA 1X4EA 4GNKB 1EP1A 3GS6A 3SUUA 2F6XA 1RA6A 1TMMA 2ZOFA 3LP0B 3O7UA 3B4YA 4JYFA 3UA4A 4MT1A 2UXBF 3TOPA 3ZFHA 3BJYA 1BWKA 4IWWA 5KFPA 4DMZA 2P5VA 3RW6A 4YEAA 1VIZA 1K03A 4ZP6A 2M88A 5HMXA 3IRXA 4UTGA 2X40A 2R8JA 3M2RA 3MB9A 4OHVA 3T41A 4WFNQ 4PBFA 3KVKA 4RW4A 3W00A 1TV5A 3RYSA 3OD2A 2WCGA 4XO6A 5CSYA 4MADA 4BI6A 1OFRA 1Z3NA 1RTJA 4CQ9A 1U26A 1LBMA 2UZ9A 3BAXA 2CIPA 3SV4A 4GINA 1Z8AA 1OY8A 1TUXA 1UWTA 3VIOA 5REQA 4U95A 1NH6A 2X1TA 4OUIA 3MAAB 1LOSA 3OJSA 4Z1CA 4TV5A 1KXHA 1MWYA 4K8RA 4AEEA 4I8DA 2L9NA 3RCYA 3HHLB 2Q8ZA 4ALZA 2Q79A 2OKOA 3GFYA 1WC3A 3PTQA 3B8HA 3DXBA 2ERRA 1WHYA 4E0DA 2DH9A 3VF0B 4A3QA 4LYQA 4J27A 3B6BA 1S2TA 3EDQB 4H8VA 2CLHA 2OPJA 5I6SA 2CKWA 1XR7A 5AZ1A 5B7YA 2ESCA 2J6XA 3LPEA 2R1MA 3LM3A 5CPQA 3BLLA 3UW1A 4PFMA 1OFBA 4L9ZA 1NM2A 3E0VA 2YA1A 2PDIA 1EHAA 2E3ZA 3K46A 2Y9HA 1MFUA 4BQ2A 3DGVA 4KGZB 4USTA 3KZSA 3W26A 1MNZA 4CT8A 2XY6A 4L80A 3DFEA 3BURA 3GVGA 1HBNA 3DU5A 3MAQA 1KFBA 2Z2UA 1KONA 3CDUA 4HP5A 4OI3A 3M7SA 1SXLA 3TK7A 4USKA 3WDOA 3HM9A 1SZFA 3C2RA 3L21A 3KHLA 4G1IA 4NYOA 4S39A 3G3DA 1K8YA 3L3CA 2R82A 2LEPA 2W79A 5KITA 4ECSA 3J7HA 1N0VC 2FZMA 3LNPA 3PWIA 3CZLA 3NG8A 4JI2F 4L75A 2CBIA 1NO8A 2VOPA 4LF5J 3IIZA 4Z2IA 2R6OA 1AW0A 1HNZJ 3VX0A 4JFVA 1MMLA 3SCJE 3FA3A 3UR7A 3NL0A 1FK9B 4NSBA 1JZ6A 3SQMA 5DRIA 1TKZB 3QY7A 5CC7A 2R1LA 4DOZA 4UOGA 4FBTA 1TB3A 1GOWA 2IQ0A 2Z26A 2ISSA 3NCQA 1WKYA 4K7VA 1LDCA 1O1HA 4QROA 1FX4A 2WONB 4I3GA 3WQ5A 1M1HA 4Z0SA 3BH4A 4JTHA 1E5NA 1DHKA 1FKOB 3S4TA 3W63A 4CM2A 3OIXA 2CBJA 5T9BG 3N79A 4NJJA 4LSNB 4U2ZA 1GOQA 4UOCA 2OPPB 1S2WA 2RSQA 1FHLA 4Q6XA 4AX6A 3ZLHA 3RRHA 3KOYA 5G2HA 4M5HA 4KC5A 1K4HA 3DU6A 1QHOA 2Y8VA 2YZ5A 1VQ4S 3EZUA 3ZM8A 2C2RA 5DQHA 4I56A 2Q6BA 4DY1A 3CTTA 1XPGA 3BQ2A 1D7FA 2OELA 3FGCB 4HTYA 3ZQ9A 1E6QM 4XWUA 2WW4A 1HKWA 2R8IA 1JL8A 5D38A 4ZSUA 2P0IA 1TA3A 4TX6A 1RR2A 3CJ5A 3R1HA 3PJUA 3NGUA 3ARYA 4BQ5A 4FP1A 3EXCX 3WEMA 1V3IA 4U67Q 2D0FA 2YW3A 4CRJA 1CJTA 3O8AA 1N36J 3ALFA 5A94A 3PJTA 3U27A 5CABA 4DL7A 4I67A 1JCTA 1NPRA 3LHZA 1XTZA 3TWBA 3QKZA 3CPGA 3EVMA 1XYMA 4GJJA 5EPDA 3PB2A 3TX9A 4V1Ak 4MOZA 1DTQB 1PBUA 3N6HA 4UR8A 5KOWA 2HQ3A 4A46A 2KG1A 4UFKA 1ZFJA 1S0OA 4RX0A 3ILIA 1JZ4A 4QYZJ 2I2YA 4LF7F 3AISA 1GVEA 3GTFA 3USBA 4G65A 3U0HA 4J28A 2HNYB 1ODZA 4JFTA 2MJNA 4PULA 1H49A 2ZH8A 1Q66A 1UD2A 4OI6A 1IKXA 3DDIA 1JAEA 1WPCA 1G6CA 4OI2A 1H5YA 2NZCA 3TJAA 4TY8B 2ZNZA 2QJNA 4M51A 1MZHA 5LNSA 4GY7A 3T55A 3FCWA 2RDJA 4YJ5A 1TRIA 1LWEB 3MPGA 4X65J 2MQPA 3V6DA 4C7FA 3ARXA 3TC7A 1N55A 4MB4A 2ZEJA 3QATA 2EWHA 3IWXA 3L95X 5DQGA 3HZ3A 2J88A 1OF6A 2CBUA 3QMSA 2ZX5A 5DY2A 5CZVA 3PYEA 4JTFA 2DIUA 1EA0A 1FCVA 2NX3A 3CJPA 2BB0A 1IKWB 2XY7A 1VBUA 2O3DA 3A9IA 4ECRA 3CUFA 1WB0A 3Q8SB 1SMAA 4JTJA 4NXMJ 1U0HA 2VFHA 1EBHA 1SO5A 1HQEB 3SUSA 2CDRB 2I57A 4H4KA 4CH7A 3UNDA 1Q16B 3DG6A 1XSIA 3FMBA 3ES7A 3FS2A 3HJVA 1JXKA 4PUMA 3RBDA 1BVWA 2CQGA 3ZNJ1 3CCTA 4TN2A 4QRNA 3T09A 2RDUA 4RUHA 1IWPA 2DT3A 4FF2A 4JY8A 2BXVA 3TQEA 4MJ4A 3SSRA 2I8EA 2V9KA 4FR6A 3WC0A 4F4XA 2WJEA 4XZHA 1XP3A 4OZ5A 2PBGA 4GACA 3WF0A 2DO0A 3O3RA 3K5OA 3QR3A 2J7CA 3K4WA 4X22A 3KOXA 2V68A 3G1YA 4C6OA 4IOCQ 4AAJA 2E1MC 2YNFA 2YNHB 3CCMS 3O63A 2NXUA 4C48A 4RZBA 1HQTA 1E55A 2CKSA 4PUJA 4C7GA 1GHRA 4DBSA 2ZH3A 4MFBA 4QS6A 4KJIA 3BGFA 2C1EB 1ZZMA 4AZ6A 4XK2A 2PUZA 3R6GB 1Y9OA 1KQKA 4A8XA 2BXJA 3MMCB 3F2DA 2AW0A 3CCUS 1NMEB 1UP3A 3II1A 1UKPA 3D3BJ 3OTDA 4UMAA 3CCLS 1YG0A 2V3FA 3LCGA 1ESWA 2HG4A 3W2VB 4KCWA 1AQFA 1JG9A 5CPLA 3UQNA 1UWBB 2V2ZA 2VYOA 1TL1A 1C0UA 3ICLA 1EUAA 4GC7A 3IR5B 1KFJA 4C2MA 2RDDA 4B02A 1YDNA 2CBVA 2A3EA 4DG1B 4IFKB 2ZKMX 3GG7A 2TYSA 3FVMA 2E09A 5CSUA 4AYBD 2QSFA 4PMXA 2ALDA 3JS3A 3MR5A 2UUAJ 2Z1BA 5M2RA 2N7YA 2PRMA 1C1BB 4HPHA 1CJUB 2QPXA 2WB1D 3N18A 3G1RA 2DIVA 2HVHA 3UY7A 3FEMA 3J81j 2VR4A 1PKLA 1N8FA 2ZD1A 2VXNA 4XD4A 4PCQA 3W5XA 1E43A 3RO8A 2J77A 4H4KC 1JUKA 4MFDA 3WH6A 4CCHA 3M5ZA 1UZDA 2YWFA 2QA4G 2BKOA 3N28A 4DV3F 4WE1A 4C8NA 3BV8A 3MPDA 1H50A 5CQGA 2MGZB 2OG9A 2C3YA 4DSFA 1FWBC 1G69A 1HXJA 1JLQB 1BXBA 3LCXA 4O1EA 5A6LA 4URIA 3E01B 4V15A 3W1NA 2DR6A 4DZ6A 3AZTA 4LVOP 3M32B 3MMDA 5K4XA 4LCSA 4J9VA 3R5JB 2KKHA 4CQCA 5AT1B 3D6MB 2HHQA 3PTMA 3KG1A 2JALA 5BU6A 1EZWA 5AHLA 3CD6S 3NKYA 1JYXA 1YXYA 1FERA 1VI7A 2MY8A 3R5GA 3TXZA 1TPH1 4B4FA 2EKCA 1FX2A 5I3QA 3AO0A 4QBXA 4CLUA 1WJ9A 2P6SA 3WUEA 1E9LA 3BSMA 2VEPA 4Q8UA 1KFSA 3LTYA 1UOKA 2RKIA 4TQTA 4JTKA 5FJUA 3UQSA 4H9XA 1SJCA 1EIYB 4LVBA 2B7CB 3H2EA 3PHTA 5FIIA 1JNDA 1QNSA 1TQLA 3KOFA 5C0QA 1R3YA 4X65F 4AD1A 4DPXA 4IRCA 1KBRA 4J90A 2AJQA 2H90A 4OLPA 3EUNA 4DX6A 1CENA 1KBBA 2AJFE 4Z1YA 1UD8A 2N3LA 2KI2A 5IV4A 5GMKa 4JKMA 2PDKA 1JLGA 1JUEA 4IR9A 1LT7A 1F2HA 1QLNA 1H51A 5KFWA 4C8KA 2V5HG 2PGFA 3HM7A 4NXMF 1W1TA 2RD5C 3QYQA 5EN1A 1JMTA 3ILLA 1ONRA 2PU0A 4ZVRB 1E1EA 2IQDA 2F4FA 3MPVA 1XIIA 4LVGA 3C4UA 2F38A 4RV8A 4B3TF 3P6LA 3WYZA 5KFJA 1PX3A 2DGSA 1WV2A 4LCQA 3JAMY 3VVUA 2CPJA 4C97A 1HW6A 1RH9A 2W7OA 2LP4A 3H6OA 3P5TL 3H59A 3OQ2A 3PO4A 1E72M 5DMYA 1QTNB 4J9NA 4AQYJ 4P2SA 1HQUB 3AYTA 3ZR5A 4NMXA 2A7NA 2EJ1A 3U4AA 1VENA 3KE0A 1UEKA 3SCSA 3MDFA 2XFRA 3CO4A 4OZ0A 3EGWB 5H1WA 3V4IB 3BSAA 3KLHA 5F8MA 4G1PA 2XQCA 3GXPA 4MTVA 1L3TA 4PMRA 3P0WA 4DFKA 4AWSA 3OL7A 1OF8A 1WDRA 4P7LA 1KKHA 1CWYA 3BUVA 4C3KA 3OEXA 1VC4A 4U5IA 3PPCA 1S76D 4DZIA 3WMLA 2GAGC 4Z2JA 5KT3A 3DRXA 2EG6A 1HGYA 9ATCB 4N9DA 1H72C 1WSRA 1ZTVA 2XCAA 4OHZA 3CO9A 3DOKB 1SH2A 3RAXA 4X0VA 4C6MA 2AF6A 1J0HA 1I9CB 1QO5A 2XU2A 1OO0B 2KTQA 2HHVA 1U48A 1OBAA 4U28A 3SAZA 1X4AA 3BYRA 4P5UA 3PG8A 3WK0A 4RW4B 4F4ZA 5KG2A 3LGDA 4CP5A 2A7RA 2ACYA 3B0VC 3DKLA 3OXGA 2CHRA 2VDIA 5BW6A 1RACB 3V18A 2DHXA 2BXZA 2QA4S 4ZITA 2GMLA 1IF2A 3RU0A 5REQB 1GG0A 1WOAA 4J9OA 2UUAF 1KQZA 2G3FA 3AOCA 1NQKA 2M0GB 1B4KA 1CXKA 2BQ3A 1FDZA 4NRSA 4JYDA 4QQBA 1DIKA 3U7BA 2DR5A 2YDAA 4FS9A 3VX1A 3AHXA 2Y7GA 3SYZA 2PA3A 1KVJA 3VNJA 5I03A 3PUOA 3WQPA 1HP4A 4UQDA 3PKMA 2XSAA 5A8PA 1DJWA 3KK3B 2X2GA 1S48A 2PGCA 1XD0A 2OPQA 1JRBA 1W3HA 4Z1AA 2J25A 3ARQA 1XERA 5A6BD 4HPGA 3UXIA 1NNDA 5L1IA 2YCLA 3F4VA 1JJCB 4FAMA 3EX7B 1FXRA 2FUG9 2KDOA 4OOZA 2HS3A 3KLGB 3M9MB 4MK9A 3K57A 2UP1A 4DV7J 1UCWA 2B7BB 3NVTA 1SSDA 3S47A 3KBJA 3VTRA 1HKMA 2LU2A 1HBNB 4K2XA 3M41A 1TL7A 1IYXA 3P2VA 1VQTA 5CPSA 2ALRA 4IISA 4C3LA 2VZ9A 4B3MF 4AVFA 1BGGA 1UETA 1EJXC 3OQ8A 4EO8A 3MWCA 1PXGA 2XYLA 4DJDD 5IHRA 3M0JA 3M5YA 2WHOA 5HK4A 2J74A 2E9MA 1X38A 3R4IA 5KG0A 3PX4A 1G7CB 3BW4A 3KHDA 1O6IA 2QNEA 2QSWA 3RTVA 2VC6A 2YNGB 1S5MA 4NL1A 3SEOA 3VV2B 5DETA 4L3KA 4GFIA 4HTBA 3AD7C 2PDPA 2DZUA 2JDJA 2CQ3A 2EFQA 1RT4A 3WUBA 2YWHA 2Y88A 2Y1JA 2C28A 1X5PA 2FZCB 3OB8A 4KHRA 1K1DA 2PWHA 4LUSA 3QW3A 3CCJS 4LC6A 3SGZA 1NJIT 1A5AA 4JI1J 3KL0A 4M5GA 2E9RX 2VCCA 3FSTA 2GJRA 3F4NA 2LVWA 1KV8A 2OEMA 4U33A 2OTJS 2DHAA 5A1AA 2QA2A 3WF2A 1W7WA 3VPLA 1PO9A 3N2BA 3H2CA 4GY0A 3CE8A 2VBXA 3EWUA 1DOSA 1VYRA 2ZIDA 1AL8A 3VKJA 1BXCA 4D8ZA 2NYIA 1SSGA 4N8OA 1NZ8A 4A8OA 4CNOA 3ONCA 2AGPA 4D6DA 4USIA 4FLRA 3H98A 2WK2A 3SCVA 3TC3A 4YDDB 1NH7A 1SQGA 2GX8A 4M5PA 5FJOA 2OLAA 3K8VA 4NLUA 2Y5SA 1TA3B 3AJDA 1CGYA 1I6JA 4DZ5A 3QV6A 4UZCA 3W3SA 3UG4A 2QMUB 2YWEA 2XIIA 1K6AA 3GZ3A 1PSDA 4Y2WA 3PBMA 4M6UA 5BYWA 1NDYA 1E0XA 1U8WA 1CJTB 1XQLA 2EGZA 2JKEA 4P7QA 4AUKA 1FP8A 3AB4B 3GLCA 1XLJA 3GTYX 4TXEA 3U8GA 4LF9J 1EQ0A 3FBFA 3BV4A 3Q8YA 3MR2A 1HR0J 4MNLA 4NXKA 3KOWA 4PH6A 3UZYA 3EZ5A 1UH4A 5CGMA 5I5RA 2AZ1A 3M5VA 3UXLA 4GX8A 3BSOA 5SWUA 1O6XA 2X3DA 5GAGI 3QQ0A 2GZOA 3YPIA 4A47A 2ZRXA 3SCLE 1CGTA 3WH5A 2JHEA 3KVJA 1OWQA 1X0PA 3J7Z5 3UN3A 3GNNA 4O3RA 1YNQA 3JQKA 1HD0A 2HGNA 2ZX7A 4Z42C 1XYFA 2G8ZA 1GEHA 1QDSA 3VIFA 1XYAA 4O4RA 2W66A 4P8WA 2VQFF 2ZX9A 4FF1A 4LAOA 2F8HA 2FJUB 4ZEPA 2G2YA 2KT3A 3G0SA 2G1HA 2Z8QA 2PDMA 3GU0A 1REGX 2MLXA 4L4OA 4DR1J 4ELVA 2V2HA 2O4QA 2PGRA 5D37A 3V5RA 4OHQA 3ABSA 1OYAA 2VH7A 3RRKA 4JNMA 3T07A 3IIVA 2FD2A 1VRTA 2VRKA 2GC8A 1U0HB 4RJVA 3V0TA 2Z2BA 4C1NB 4Z2XA 4NF7A 3VIPA 5IXUA 3IGXA 1V6YA 3VOJA 2E7XA 1CGXA 3R25A 1HVQA 3ZR6A 1RT6A 4LY8A 1K9EA 3WBWA 4ZVFA 4CKQA 3P8BB 3U7JA 1JXVA 2EXUA 4PE8A 2VWSA 2WQDA 3TZZA 1LP6A 3UJEA 4H9VA 3LENA 4AE5A 2RQCA 3OYXA 1SQFA 4DO7A 1H62A 4AH7A 1N4LA 3RB4A 4OZNA 1Q6FA 2BDPA 1SW0A 4AXIA 4R88A 5D0RA 5CBIA 3S5SA 4GXMA 1WDDA 5M2FX 4C3MA 3J80Y 5H8MA 1EWDA 2BJDA 4M63A 4Q6JA 3EOEA 1AYEA 4B2DA 1XH1A 2Y24A 3ITLA 4UTMA 1TL4A 2YNFB 2V50A 3W25A 4AX7A 4ETZA 4IMEA 2CLMA 2BY0A 3KCLA 4PL2A 3H70A 3DLGA 4GUIA 2EFVA 5D9MA 2GIFA 3WJSA 1LRQA 1EJVC 5ETNA 1N48A 4Y6IA 3KS5A 1TE1A 2VB6A 1KOHA 1XJBA 3BQ1A 4EWTA 2AJ1A 3NNTA 3FEZA 1EA9C 3T0TA 4FEZA 1C0UB 1TL1B 3ZT6A 4YQWA 4YCPA 3PACA 3WLIA 5C7HA 3H8YA 4OBSA 2XNRA 2FLIA 4HHJA 1B7YB 2WO5A 3RBEA 3KBWA 4Y9OA 2PFFB 4BC9A 1GOXA 1O60A 1A3XA 2Q3RA 5B7ZA 4XVDA 1IR2A 2H8XA 5G2IA 2XS7A 1H7WA 2OMLA 4ZCMA 3W4RA 2XMTA 4JQAA 2W67A 4LRFA 1AMKA 2B8QA 1BSIA 2D3LA 4LRTA 3KG0A 4NXNJ 5IZHA 4Y2CA 3MO4A 1X4BA 3TFCA 5A8RA 3TA1A 4LAUA 1N88A 4DQWA 2HLUA 4DL5A 3MUMP 3B0YA 2J76E 3VOGA 2ZD1B 2VC1A 1NOFA 2NT0A 3CULA 3C14A 2D41A 4QWCA 2HPMA 4IOBA 2V5CA 7FD1A 5DGAA 4XO0A 1S1XA 2BW2A 3SUTA 1XI3A 1GWJA 1VQ7S 3RIKA 1TR9A 5TQLA 4UTTC 4I7FB 4EAMA 2Y1IA 1I1WA 1NSKL 3VCCA 4O0ZA 4TTGA 4OYMA 4ZPDA 2X7VA 1HR0F 4LCRA 3OFEA 1I2QA 2BV9A 1W37A 2H9ZA 1LWHA 1E9IA 2HBVA 5GQBA 1NFBA 1P48A 2HVZA 4EE9A 3AHYA 4WJ8A 4HNVA 3NOGA 1SJFA 2DZSA 5KZ6A 1OYCA 2CJQA 4DSLA 4NXSA 2P76A 2NUWA 1J0IA 4NLXA 5F4SA 2CDQA 1UMLA 4EWJA 3VAMA 5GPRA 4Y2IA 4GKJJ 3I9ZA 1W1A1 3FEQA 3V0SA 2VU5A 3I87A 4Q44A 5EGRA 4S3FA 4Z2HA 4UTKA 4EKJA 3UN5A 4I5UA 3TLQA 4GISA 4HZ8A 2LLEA 1IR1A 4FXFA 4BK9A 4V28A 2RKIB 4ZLLA 1RWVB 3WQWA 4CO3A 1Q7YT 4MIMA 3BDPA 4IUFA 3L2MA 2RU3A 1VD6A 4IL2A 3VZIA 4ZO6A 4FXWA 2DJLA 5HJYA 4LAMA 4A8IA 3V1PA 2DCUB 2VFIA 3HFVA 1U5JA 1CBKA 2YXXA 4B08A 1FWHC 8XIAA 3L12A 2CLIA 1U7LA 3MZ2A 2V2VA 4PYSA 3JU2A 4NLSA 4XIAA 3UU0A 4WDWA 4YWIA 3SJ3A 2E5BA 2FGCA 2E4TA 1U2CA 3HB9A 1JLGB 1PILA 4DR4J 1HJSA 3VGEA 3QFWA 4KB7A 4RWXA 2GVJA 1IXKA 3OO2A 2XHYA 2FC8A 3OPKA 3CAWA 4A8WA 3M8YA 3BDEA 2BZ2A 1RBAA 1FWRA 3BZJA 1AW5A 3CCRS 4JI7J 3JAMU 1MMFA 3R97A 3W85A 5LIUX 3IIXA 4F79A 5E5NA 2O7SA 1FT8A 4D6FA 1W5OA 2WSKA 1R7IA 1W2VA 3GQCA 2PPGA 1BTMA 1SFSA 4IPIA 2KFZA 5GADU 1V02E 4F36A 3VGFA 3K2YA 3PWAA 4B5UA 3WL1A 4WUIA 1PYSB 2J9DE 8AT1B 3PEJA 2J75A 3DHPA 1WZLA 4MKAA 2W24A 3LANA 4LBIA 3A3PB 3KLHB 4OE7A 4HZ7A 2P3EA 4JI3F 3NYZA 4DU8A 4PN2A 3MEEA 4PQUA 3ZNUA 5ETVA 4HDGA 1O5KA 1VFJA 2A6LA 1OCJA 3O05A 4JAWA 3NO5A 3QLDA 2ZDRA 1HA1A 3WLOA 1VFOA 2X09A 3MHYA 3QGAC 1J2WA 3BOFA 3HBLA 4Q4OA 2DP3A 2HHSA 3QY6A 4YIWA 5T14A 2HS8A 4KO0A 4PRFA 3CUXA 5AC8A 1Q8KA 3GUGA 3ETMA 1CXIA 4Z7CA 1JNZB 2VCAA 1XIHA 2EJAA 1R7OA 3EX3A 4KF1A 2NVDA 2VG5A 3QGIA 3C61A 4EFAC 4AZCA 2DZAA 1PO6A 4WY0F 4EWND 4MLJA 4UQ9A 4Y2KA 1FDNA 3IR7B 4QG9A 4CD8A 5B7WA 2HPIA 1F1BB 1NOWA 4QWBA 2J62A 1QAYA 3CUIA 1UH3A 4MSSA 4PSPA 3D0IE 1W32A 3VIHA 1VBHA 1QVGR 2QCCA 9CGTA 4WP3A 2Z1KA 1DWIM 2QXWA 3CQJA 1GW9A 1T03B 3HO1A 3GW3A 1ICQA 4A4JA 1EX8A 2B4VA 5LMNJ 1T99A 3GWQA 1JLFB 1E6VB 4QIUA 1UP0A 4FXSA 4Q8MA 1RT2A 2ZQ0A 4NLDA 3G24A 1N34J 1IJFB 3Q94A 1RWOB 4HJFA 2KVIA 3N0VA 3A4JA 1YX2A 4F50A 4Q8VA 3W7JA 3BVJA 3VU2A 4IP4A 1B5TA 1D0EA 4PRRA 4R33A 1YKWA 2OPQB 1V3RA 1RVGA 2D74B 3E0IA 5IOLA 1IZCA 3L7PA 3A23A 3TYAA 1SZGA 5DRKA 4M56A 1P6WA 3L65A 4M19A 4D6HA 1FO1A 5A6KA 2YCKX 4B90A 3L4ZA 2ATCB 4F0KA 2R2TA 1KLNA 3QC0A 1BRLB 2ZITA 4KH2A 2YKMB 1NF7A 4RZ4A 2WOMA 4WFAQ 3NS7B 2ODOA 4DAFA 4O4GA 2M9KA 1JQXA 2IVMA 1CJKA 4DF4A 1TL7B 1X6LA 4ZN3A 2U2FA 1M65A 1NJWA 1Y5NB 3M1VB 5C9UA 2ZDSA 1W1PA 3MUIA 4GKJF 1TFWA 3MZNA 2XI2A 2XTKA 2YL9A 3GB0A 3CC4S 3W76A 3VVGA 2Z7GA 1W2BR 1YJVA 1SH3A 3HMCA 2XIOA 3W28A 2EFGA 4CQDA 1GX5A 2IRUA 4Q7NA 1YJTA 1Q6QA 4YTQA 2V67A 4JTRA 3DI0A 5M17A 2Z25A 4A6GA 2R7TA 2ZUSA 2YA2A 3AHVA 4ED2A 4TLRA 1F3XA 4FOJA 1O0PA 3KCOA 4I9AA 4CLFA 2QUUA 3G71S 4MNJA 1PS9A 4EUVA 3MVIA 4J9KA 3M8SA 2DH2A 3QRQA 2RS2A 3PBUA 3EX6A 4LRSA 1RT4B 1XRFA 1RQEA 1RT7A 5BROA 3GDMA 3CPRA 4I6KA 4DR4F 4UOZA 1A53A 2PRLA 2PSNA 4DV0J 4B9SA 4N9EA 3T1YF 4N47A 2VBYA 3AZRA 2IKIA 2CXEA 4IR1A 3UGVA 1NQ6A 4JQ4A 3PXGa 2ZX8A 2PI4A 4AZBA 1WNEA 3MHUA 3VWSA 4LBHA 1N54B 3GMGA 2FZBA 1X97A 3TW7A 4FOUA 3H53A 4PUEA 3U48A 7PTDA 1W54A 2YTCA 1P9QC 4A8RA 2FGBA 4DUVA 1TTQA 3WQVA 4AVNA 3DERA 4FYXB 1L2UA 3BANA 1V6UA 4P2MA 2CNNB 1VFTA 1V03A 2YBTA 3FIGA 5DF0A 2ZUTA 4BFAA 2DGXA 2RT3A 4LIRA 2LXUA 3S46A 5KFBA 4HI1A 3DHWC 2HISA 6CGTA 2CESA 2QCFA 2ZUNA 1KD1T 4B3LA 1XD1A 1XDJA 3BCFA 4WIQA 1X1ZA 4L6OA 2JKAA 3CZJA 5CA5A 3AWOA 3I4KA 3RM9A 4N6FA 4PMOA 3QMTA 4C5ZA 1XCFA 1ITUA 4HDHA 3U1MA 2VD8A 1RDRA 4WZQA 2XGQA 3UD3P 3HI9A 4YVPA 1Q63A 1EUNA 1N8WA 4NLYA 4BJHA 5DT5A 1RADB 5E3RA 4CO1A 1UTAA 1EZ2A 1DIEA 2NYHA 1TIMA 2VL1A 1RKJA 1URRA 2WWDA 2R7RA 1JX4A 2F9DA 4Z08A 3NA8A 2VURA 1VH7A 1Z4UA 3NQGA 2HWTA 1Y8BA 3I10A 3GU9A 4IRDA 4LQ9A 2G50A 5HI7A 3OZYA 2WJDA 5DBTA 3H7RA 4H9TA 2C19A 4RDZA 1A5SA 3FAWA 3QV8A 4DPOA 4Z17A 1C9WA 3MMBA 4HOZA 4XTDA 3AT1B 1FHUA 1FWAC 4Y2AA 3KRBA 2C14A 1MNSA 1J5SA 2VD3A 3GXMA 3W72A 2YSWA 3G8QA 3S42A 1PX8A 4YS1A 4U10A 2QX0A 1TZZA 2WLZA 3K8KA 4CZCA 4DSEA 2MMYA 1KC7A 3ZZYA 5LMNF 4NLVA 2VONA 1OM0A 1E6RA 4TVAB 4Q4QA 5L9XA 1NP0A 2Q8XA 3RAOA 3IC1A 1N34F 1E9YB 3M05A 3EWYA 2C42A 5M5DA 3QC3A 2J7FA 4N0RA 3F56A 4M5NA 2DNZA 3OTBA 4L6V3 4E2OA 2HZAA 3S9YA 3QAUA 1OYBA 5FL0A 4V1XA 2G0CA 3SDOA 1NDKA 1GH8A 4ZZ9A 2B56A 1VRTB 2MZJA 1W9BM 1TV4A 4DUYJ 4ID5A 5IBXA 4H6EA 1QATA 1RT6B 1LUCA 1LOLA 2PDGA 3KP1A 5H8UA 2RMLA 4WR3A 1UWAA 2RDTA 3OW2R 1YBQA 3B8IA 2GLKA 1OT1A 2XO6A 3MZIA 4Q8NA 1TL5A 4L76A 1HKJA 3FCVA 3EWDA 1MUCA 3J80U 4XD3A 1LWCA 2GZXA 5KFXA 4MH8A 4G2DA 1V3SA 4TLQA 2YX4A 4GX9A 1QBBA 5KT2A 3M0VA 5K9FA 1Q6LA 1WEYA 1UCNA 4B15A 3LCHA 2V2CA 4MAVA 4OYBA 4RWWA 2VPYB 3NZRA 2VP8A 3P60A 5DANA 4O18A 4JTQA 3GVQA 3NDOA 4UFIA 3DLGB 5KFQA 4GHRA 3GYEA 1OC7A 1G67A 4IG0A 1A0OB 4I6YA 2BVDA 2VUGA 4P8UA 3CMES 2R1KA 3EZOA 1S77D 3TA2A 3NS6A 3AFGA 3EKGA 3B05A 3QH2A 3PTKA 1EC9A 3HG3A 3IAM9 3EBVA 4O3QA 2ZUVA 2NV2A 3DOLB 3WLTA 3M0MA 2ZRYA 3PCOB 3VZYA 2C15A 1JGMA 3F1QA 3OUYA 4LTSA 3UP8A 3DLKA 4GRSA 2B7PA 1ZZFA 3CCES 2AMXA 3O0FA 4DJFD 3TZFA 5AHNA 1HLWA 3G6LA 4PWUA 5E0OA 3QEZA 2ASHA 1BFNA 1E1FA 4HSHA 2C2NA 2IKGA 4BDPA 4IJBA 1Q95G 1P1XA 1IJEB 3HVWA 3IJLA 1AUSL 4QU6A 5A8RB 3EB3A 1XWLA 2HHHJ 3BAWA 3OOQA 2JWNA 1E6PA 1SQ7A 3FSYA 1IGSA 1ZALA 4KEUA 5IBXC 5LGZA 1R6VA 3H25A 1P27B 3TVZA 3AH6A 4ILSA 3OFGA 4ZE5A 2QFJA 5FJ4A 4I2QA 2QA1A 3CZKA 2MKYA 1S1XB 3LI1A 3KHJA 4MFEA 3UBPC 4YMEA 3NZPA 4GIRA 3VK5A 3W84A 5JMNA 4EF9A 1HNIA 3P82A 4LVNP 4WKAA 2W2NP 2R8GA 1THFD 3BR8A 1WOBA 1NM9A 1VFLA 3PFRA 1OC6A 2PDLA 1ZBWA 4MPKA 3FOKA 4IIDA 2WVVA 2QLFB 2X1AA 4HMNA 4YB7A 1JKHA 5DG7A 5FOOA 2IDLA 4M24A 4PR4A 3JQMA 4NAEA 1VQSA 2Z2AA 2CPEA 1WDPA 2OGUA 1TPC1 2RB7A 3UESA 1P0EA 4NASA 4JHOA 4CEXC 3MTJA 3IRSA 2CG8A 2Z7KA 2Q8LA 2HEJA 3E2QA 2VEKA 5HR7A 4QR1A 1M03A 3ANUA 4AZIA 1BQNA 2DD8S 2E9ZA 4ZXLA 1DJHA 3MYPA 3MQTA 3PZVA 1EB0A 2BOGX 3NGKA 2WHLA 4WD0A 4XO7A 3W02A 2R2UA 5FF3A 2VGBA 4YL2A 2DHGA 4HMEA 1JLAA 4L4PA 1NRKA 2B9EA 3GNDA 2DHHA 1ECQA 4KIRA 2E0PA 5FAGA 4MTPA 3AODA 4FNSA 4ZA1A 3I6EA 5F8GA 4JQ3A 5I78A 1A0EA 1H3DA 1I94J 1JEZA 1WKEA 7ENLA 2DPJA 1EJSC 1Y00A 2Y1LB 3GTHA 2CQ4A 4UY8T 1ZJAA 1EYEA 5AJ3J 1KO0A 3MM7A 2ZXDA 2QV6A 1TPVA 2DJXA 5H1SV 3D28A 2HSEB 5CLWA 4HNUA 4C9DA 3SN0A 4DJEC 4MIWA 1JJ4A 3LPPA 1VBJA 2BJ7A 4R5EA 2AYGA 4PWWA 2JKPA 3N6LA 4PG4A 1PB0A 4ETXA 1DWJM 1OG0A 3UZZA 3AICA 5EDWA 4IG2A 3NSXA 5HNTA 2MZRA 2Z6IA 4ZO9A 4G1KA 2M52A 4LNYA 1NDLA 4IIGA 3NAIA 1JAKA 2XS5A 3DH7A 1YBUA 4ZP9A 3C15A 4RW7B 3AYRA 3R13A 3T0DA 2DUZA 1AUDA 1WBHA 4QE5A 3LALA 3UR0A 5EWEA 3E51A 3WNMA 2YCJA 5FI8A 3WBZA 1ML1A 1YJRA 1KLZA 4WU2A 4TV6A 4D72A 3ZIZA 3W23A 6FDRA 1ZH5A 1E6XM 2VZTA 2CPZA 3MUCA 3K2GA 3U02A 3V7PA 3FK4A 4I7VA 2XWXA 2B0MA 3GH7A 2QCLA 3GJTB 2ZWOA 3PPHA 3GWCA 3ZLGA 1R3VA 1W3IA 3EA3A 3DM2A 2CKRA 5AZ0A 6XIAA 1E4IA 4JR5A 3D0GE 4HK7A 3MEEB 2ZVRA 2CZVA 4ZQMA 4R3UA 4UMCA 5F9NA 3I6PA 1IN0A 4PQUB 3NFUA 3EDEA 1JYVA 3P45B 3G18A 4CI0B 2EPOA 5CSSA 2AJ0A 2QZ8A 3LGGA 3WK1A 3TUJC 2HWGA 3OLDA 4JI8J 5DO8A 3N11A 2PEHA 3KL3A 1WEXA 3UR3C 1YLXA 1O95A 3B9NA 4AG0A 3GU2A 4HIBA 1IEXA 1SO3A 4KO0B 5ABGA 5A2QY 3D4JA 1JB0C 5JVHQ 2GQQA 4UTLA 1NDPA 4JICA 1S49A 1RT5A 2VG5B 4I4BA 4HL9A 2XSJA 2NPIA 3COTA 4WXYA 5D09A 5FSDC 3URNA 2A5HA 3S1UA 3IJ7A 3TZNA 3QW4B 1FDDA 3NCRA 4JGDA 2VICA 1NPPA 3UE2A 2IKHA 2MLYA 1V6TA 5EMYA 2DGTA 2LXFA 1X8CA 4K0KF 1LOQA 5EBUA 1SU5A 1VLYA 2FPVA 4LR9A 2FVKA 4C90A 2ISFA 3FXGA 4JFSA 4A8NA 1UJ6A 2KJWA 1D8YA 2WSRA 3FBCA 2MB0B 4TY9A 3GE9A 4DPYA 3B4MA 3DHUA 1HN1A 2WB5A 1OD0A 2DQWA 4EACA 3OG2A 4ACYA 1YE6A 2DIEA 1PPIA 3V0UA 4AWTA 1S72S 1TV6A 4H7VA 4IGMA 1JCLA 3TOYA 3OTCA 4IH7A 4F04B 2DEJA 2H9AA 2KRRA 1S38A 2F1FA 1QI5A 3VALA 1VKFA 2NSCA 7AT1B 4WK9A 2DW7A 2QEZA 5DMMA 1R5YA 1H7OA 2GL5A 2XZ9A 2KN4A 4M81A 1Q6RA 3AIRA 5BNKA 3HSJA 1JI2A 4DM2A 5KFVA 3C46A 1P9YA 2BZNA 3QN3A 1R8CA 2V5DA 4DO4A 4DR3J 4IT1A 4MY1A 2FJWA 2OLHA 4CT9A 2CZ4A 2Z27A 5HMFA 1WC1A 2GQ2A 1O66A 4IFOA 2Y4SA 2WOMB 2Y7EA 2ZX6A 2GW8A 2DT1A 1K8CA 3BOLA 4O4GB 3HVRA 3CHFA 1CJKB 2CZVC 4ECXA 3QQWA 2M8DB 1NH8A 3UA3A 3IGHX 2APOA 1N6QA 5FD0A 4ZLPA 3ZMRA 4IQXA 3NQVA 3RU8X 4GGBA 2VG6B 1TTJA 2IW0A 5DG9A 3UWUA 3KJFB 2FZNA 2DGWA 3C8NA 2XLKA 5HANA 4LIWA 3HK2A 1XC4A 4GI4A 4ERDA 2A1YA 2VO5A 1QR7A 2QE5A 3N2MA 1L6YA 1LLWA 3SCRA 1KCXA 3QV9A 3PFOA 4NLTA 1TZ7A 1NWTA 4S0MA 4B9TA 5H91A 5AJ3F 2ZC3A 4GG9A 2VZSA 1IR0A 4CNZA 1R9XA 3R0UA 1BLUA 1S1RA 3HHNB 1HL9A 2WNQA 2J7GA 1RAHB 4KFNA 1I2PA 1CNVA 2PTXA 2XTJP 2R7QA 1DWGM 1JD9A 4CYUA 3S8SA 1H3GA 3ZVHA 2XHWA 2PTWA 1HFBA 1A0CA 1LORA 4YNGA 7FDRA 1EKSA 2QDHA 3GH5A 1GQKA 1P43A 2PWGA 5XIMA 2WZMA 1BY9A 2XMJA 3LAKA 3AALA 1JCYA 1FEEA 5F8HA 2GDUA 1O1ZA 3KCJA 3PW7A 1UFKA 3L5AA 4F02A 2W1BA 3T8QA 4ER8A 1KNZA 1TK0A 2A0FB 2WM0A 4X2PA 3THVA 2QT7A 4U3CA 4Y8FA 2QMKA 2FHJD 3N4FA 3URQA 1UEVA 3JYTB 2LQ8A 4ZOBA 2QEXS 3UWVA 1B9BA 3VAJA 2Z58B 1I60A 3HO8A 5CD4A 4OQJA 3T6CA 4WQ6A 1XMOF 3PJ9A 2J9XA 5A8GA 5I77A 4LFAF 3IJIA 1HVXA 1RHCA 1LCOA 2E7FA 2IJFA 4RNJA 1GOMA 1W5NA 3WNKA 2J5AA 2J6SA 3W75A 4USHA 3NPVA 1LLOA 2BS9A 4DWDA 3HLUA 1QNRA 1REVA 4RKUC 5KG4A 3LI0A 3LW5C 2IVYA 5G1MA 1OQ3A 2OH2A 5H9FK 3HQOA 2MYFA 2DBBA 5PTDA 1OCQA 3GVRA 2WBMA 3FJ4A 2GUBA 2QDEA 5EL1A 1UKQA 2DGUA 4FNIA 1W1YA 2HBXA 1TK8A 4AD4A 1M1KT 3C2PA 4O14A 5D9NA 1KHVA 3UDEA 3WFZA 2VF3A 2CERA 2O9TA 3I31A 4O3OA 3FRZA 3VD5A 3V81A 1FEHA 1K6WA 4IDKA 4ZCIA 5C5JA 1ZUAX 4LVDA 2XH7A 5KETA 2QT3A 2XM2A 4RUCA 4EVZA 3BN7A 1FNXH 1X60A 4XSMA 2F7VA 3DU0A 5CZTA 5HUPA 1DQ9A 4QM1A 5JBDA 1SPBP 1GVFA 2DFAA 3D6FB 3WX8A 3BW2A 4FX8A 4YR2A 4QP0A 2OJ3A 1XGEA 2XN2A 4D1IA 3Q22A 3DLHA 1GQIA 3X1LB 1RBLA 3H5UA 2FDMA 4WGHA 4KQNA 1DJ0A 4GO9A 3WJWA 2BOEX 5CAHA 2JNJA 3PNIA 3UG8A 5HQMA 2GSJA 4DR3F 1FCUA 3HG4A 3BE7A 3LRKA 3KLVA 4KBXA 2Z2LA 4ID5B 1Z7AA 1T8QA 1BQCA 4C6JA 1N33F 3DHXA 4ZVQB 4DZDA 3HV8A 4CQ1A 3ANVA 4ED7A 4QIVA 3NM1A 4A8KA 5JU6A 3M4XA 5ABHA 2RQKA 1OD8A 1QASA 1XISA 1DBDA 4UQGA 3GCXP 1XM3A 3GLJA 1G2EA 2HVDA 3JXOA 4ED0A 2HRTA 4K4WA 3JZEA 2IMWP 1UWSA 5AXKA 4MZ8A 4P7VA 5LXXA 1KC8T 1T9VA 3U2CA 1GQNA 4R7WA 1HI8A 2ADAA 4E8UA 2DSVA 1AD4A 1ZAWA 2FMOA 1LWCB 4ZE4A 1RP8A 1XIMA 1HJXA 1AH4A 3W24A 1M41A 5HUOA 1K8XA 1Z6KA 5HBMA 3W62A 2D73A 3P14A 2CPIA 2VA2A 1MXSA 1FJ7A 5J2QA 1GYMA 4KCTA 5KFOA 1TQXA 3BS9A 2MSTA 3DYAB 3W7CA 3KG4A 2GQAA 4EMDA 4UBPC 4AIEA 3BO2A 3WK2A 4DS5A 1WYIA 2ZTKA 4K4XA 2FIUA 4QQ3A 3S6TA 2MKJA 3ZTQA 4IG0B 5A76A 4TOQA 1MWOA 1ZCCA 1TJRA 3TWAA 4Y6GA 3B0UX 2K2PA 1JJKA 4AYGA 2ZH5A 3UFCX 5GMEA 3O2LA 3NL6A 4DS4A 5KFMA 1SJ1A 4UR7A 3E74A 4JIIX 5DO2A 1JJ2R 5KT6A 4OOUA 3M2VA 1GHSA 4WHBA 3WEOA 4H54A 1FXPA 4O44A 2DKOB 4XK8C 4HMCA 1P0BA 4F2TA 2N4DA 3VC5A 1KFLA 4OMFG 4R85A 4P72A 4UY85 3GC5A 2PFDA 4ALDA 4LBRA 1NK8A 2GQ9A 2VGFA 1WAWA 3UR5A 3WENA 2GGPA 3VO0A 4XZLX 1TKKA 4ZFCA 2AL1A 3MSRA 3C0LA 3LCFA 3W6LA 3HD1A 3GBEA 2AJ4A 1PYFA 1RHMB 3WD0A 4UB9A 2WBRA 3M07A 1R3TA 2YLAA 1MW1A 4G8TA 4FPIA 1TWSA 1CEOA 1JPIA 5AXMA 2KU7A 4K8HA 4HU0A 1XH2A 3NO3A 1C0TB 4Y28C 4TU1A 4I2QB 1J6OA 3IAQA 3Q2DA 3LGMA 1JNEA 5TF0A 1PDZA 1ZU8A 3VAHA 1HNIB 4M1RA 3IAS9 5A8WA 3M6DA 1S79A 2GJPA 4AT1B 2WVDA 2XISA 4IXXA 3LV5A 3SRDA 4CGTA 3BKFA 3QTPA 4GQRA 2WVVB 3GJQB 2A21A 2FLOA 2QVNA 4ZVUB 4CO4A 1VC0A 3QPZA 4LF8J 3F0NA 4NAEB 3U5YA 4TIMA 1QVFR 3QHNA 5F3ZA 3BB5A 2B4UA 3GZ7A 3E6EA 4R9XA 2W01A 1VRDA 3SM0A 5DFAA 1CQNA 4L73A 4UOHA 1HNWJ 2DT2A 2AGOA 3L2LA 4NJIA 2PWDA 3UN2A 2TAAA 3CMFA 2AL2A 1J0JA 1KQFB 1BQNB 1UKUA 5AE3A 2CXGA 5I23A 1GZGA 2ZUWA 4B91A 5I79A 2C3PA 4U96A 3UNTA 2DV0A 5DM6Q 5AHEA 9XIAA 3SUWA 2W27A 2QG9B 2QCGA 3CPUA 4RLIA 5I2UA 3P67A 3JSMB 3QSYB 3JTPA 2ISDA 1N5YB 2FY1A 1RV8A 2H5JB 3S9IA 3KBSA 1AG1O 2NQLA 3RR1A 1WD6A 1PC5A 5KT5A 2J7EA 2JRSA 3CV6A 2VMFA 4NNCA 4YS2A 4OQVA 5EMLA 4C6DA 3ITYA 4W8LA 3CTLA 1G4CA 4O4WA 3L4VA 3NVDA 4CNPA 3PJWA 1M01A 3CGTA 5ETSA 2XBPA 5AHIA 3D6HB 1Q65A 3Q89A 4GUHA 3IR6B 2PIIA 4XAFA 1D8ZA 4KIAA 5BXTA 1OPIA 3M0IA 1W3LA 1ZAXA 4P75A 1YNPA 1UZHA 2ZH9A 1KM3A 4JL2A 2BANA 1HJVA 1IBMJ 3BKTA 1CG2A 1EX5A 1AZSA 2VA3A 1EL3A 1UJPA 5K9CA 4XQ6A 4DV1F 4B9VA 4ECVA 1DKWA 1K3UA 2MDAA 4JI4F 5E5CA 3ZJ6A 2AZ3A 3G87A 4WY0B 3TN6A 2XMKA 3QLHA 4RW9A 1W26A 4K3ZA 2RGMA 2NZ4A 3GNPA 4TQRA 3CT7A 1UZ1A 1R3SA 1V3JA 1ZPVA 3GSIA 1QNVA 3C0SA 4KH1B 3S5YA 3I68A 2V2KA 3A3WA 3O6YX 4DBWA 2E5IA 2AAMA 3WQEA 3TQVA 4HYRA 3QPIA 5AHMA 3TYCA 2RRAA 1P1LA 5IQQA 2VX4A 4DNHA 4KRUA 1DL3A 5LGXA 1J93A 1U83A 4USUA 3K8WA 2ZRUA 2A1BA 2YKNA 2I6WA 4XZWA 2XH0A 1EF3A 1ZM4A 3VYLA 1C29A 3CYJA 2PDUA 1EARA 3GDBA 1TPDA 2C1GA 1XSKA 1YQHA 2FGOA 4X61A 4L3NA 2XSJB 1S3TC 1PTGA 3BCDA 3GXNA 1T8XA 1EIXA 3NGRA 1R3QA 2JEJA 3WELA 3R11A 4CNNA 4O52A 2XGIA 3WDJA 1OEPA 3SIMA 3DLBA 1MN9A 2J0WA 1W1IE 1XL9A 3VGHA 1QTMA 4RNOA 3SCUA 5CPTA 3ARSA 2VELA 5GVJA 2VPWB 4IQEA 4V33A 1XF0A 3L2IA 1QUPA 2B8PA 3GONA 4J2PA 4WTOB 1X5TA 3U9IA 5D2YA 1XIFA 4GY1A 3CT2A 4ZVSB 4C6IA 3IWNC 1TV6B 3LD5A 5F0WA 4LX4A 3CIMA 4O4VA 3O6DA 3KHGA 2DGOA 2H9AB 2HRYA 2LDYA 5BR8F 2TPSA 4XUYA 2RF2B 2EHHA 5EUHA 1SZEA 3MMTA 1UR4A 2W4XA 3FA5A 3I65A 3LUYA 1RQ0A 1YHTA 1NU4A 4ID8A 4RE4A 1U1JA 1P8GA 2MHEA 1L8PA 4S38A 1FWCC 2RHQB 3LHUA 2PMWA 5SZTA 1Y3KA 3PR5B 2H54B 1EXPA 5GMDA 2DH3A 1E71M 1DXFA 4FMVA 5CXTA 1GVRA 1LKZA 3IGUA 2CPFA 3O6QA 1NF0A 4LYPA 1NJXA 2FLLA 1WUEA 2QF7A 1NHUA 3A22A 5K2ZA 4AXKA 3TWZA 1S99A 3HF5A 3HT0A 4PUWA 3H24A 4RPFA 1HNWF 5H9FJ 5A3HA 4B17A 1N6QB 1VQOS 3M6YA 4H8UA 3MANA 2C3UA 3DFOA 3UT0A 3VQSA 1FRMA 3X3UA 2E6DA 1NU5A 1V3HA 2E8YA 3LHYA 5IC6B 1JXJA 3TYUA 1XGDA 3VZXA 3NEKA 1EO7A 2WC7A 1Q8IA 3I3EA 1VPXA 3QLLA 3W07A 3P6YC 3S2NA 4WKRA 1ACMB 1S7IA 4A8FA 3TNVA 5E1QA 3LMZA 1GKQA 3CSKA 1CULA 2XIJA 1R8BA 3TARA 3QSIA 1UMYA 1K7FA 1HWKA 4AL7A 4W9TA 1MYRA 4LY4A 2NWRA 3CDWA 3PZGA 4KGKA 5K8OA 1NHKL 1HIYA 1RLCL 4IKAA 3CJQA 4LT9A 1TE6A 3W1LA 3BSNA 1NFPA 3WH9A 4HHLA 5HLFA 2WZTA 1V8EA 3BMXA 2HFZA 3VNZA 3FJLA 2X3GA 1SC6A 1EDQA 3LX9A 2DNOA 2YLLA 4RW6A 1J5EJ 3BXWA 1NHVA 5DJBA 3EOLA 1W9PA 1Q79A 4EO6A 3ZVHB 2FLNA 3BARA 1V77A 1A50A 1IBMF 4HSOA 2PE8A 4DPUA 2UXDJ 3IFEA 3EDDA 1PSCA 1QUVA 2ZUAA 3T3FA 8CGTA 3T6BA 3E02A 4FA3A 3VNKA 3IBCB 4MWAE 3RGTA 4NEZA 3AQOA 4F0LA 3M6UA 5ITHA 3JTOA 2QUTA 3SCPA 1KXQA 1ULRA 1CCWB 1QHPA 3N6MA 1FFRA 3E96A 4W86A 3SIPB 3ALGA 3ABRA 3PFEA 4TVUA 1O5JA 5F1UA 2ZWPA 4NCAA 5L46A 4LF2A 4F2BA 4C11A 4PUUA 1KBLA 3H55A 5ABFA 4DU7A 1VCGA 1D9FA 1L6FA 1L8NA 4GGHA 3OYZA 4NIRA 1REVB 3DXSX 1QPKA 3OBIA 1CXFA 2A3HA 2DT0A 5HVGA 2PURA 5IFMA 1F4HA 4XZNX 1E3ZA 4CO5A 3IJ8A 3ZT5A 1R8LA 3NGFA 1WDTA 2CJYB 2MPUA 4ICCX 3QHOA 1FUYA 1UFLA 5G4WA 4DX5A 1YTEA 1TZ9A 1QNPA 3WNNA 1LWFA 5HBFA 5AE2A 4Q22A 1FVQA 4AHOA 4LUIA 1DHMA 1JLBB 1GMWD 2BJ1A 4IDKB 1S9GA 3TEGA 2I14A 2OPRA 3CZEA 4LEFA 3OVAA 4FLOA 2VG7A 5RUBA 4EBCA 4REQB 2PN6A 4PUNA 3CJKA 2GWNA 2RQMA 4LSLB 5ETMA 5F8LA 3G8EA 3L09A 4S1FA 3ID7A 1P6CA 4MAZA 4ECZA 4FI4A 2MQLA 2WKGA 2KXHA 3G0UA 4ZJOA 4DHGA 1ZJHA 3AIVA 4WIWA 4MY8A 4AZ5A 2X1GA 1JZ2A 2CJAA 5FLXY 3QM3A 3NQCA 3P93A 2JH3A 3TQ0A 2RFGA 3MTWA 2OLWA 2F6KA 4N4PA 3TCSA 8XIMA 2UVRA 4FXJA 4GQQA 1DQWA 1UD6A 3LRLA 2UUBJ 7REQB 5E9XA 3AHTA 3MCOA 1EDTA 2IM3A 5E3PA 2R8KA 1I2RA 4YHGA 4NRRA 3TVKA 3FC9A 2DVTA 1E6SM 2W9CA 5DM7Q 1FWNA 2HW3A 1HKIA 4FLQA 1FRXA 5DZ6A 5IT9Y 4WTYA 4NNAA 1RPKA 2ZBIA 5A6PA 1Q7MA 1YX1A 1ZGDA 1WF1A 4OHYA 1GPWA 3OL9A 1GUVA 2GCFA 1JVNA 4U8YA 1YHQS 5IDIA 2WLYA 4B3OA 4HD5A 1QNOA 3PBGA 4H3DA 4GQ0A 1J2BA 4GI8A 4J9PA 1VEMA 3MPWA 1X4CA 4HYWA 3HF3A 1TTPA 1Z69A 1VK3A 1CIUA 3J7A1 3FYOA 2XDFA 1A3WA 2YBVA 3M7WA 4DUXA 4HB7A 2GFTA 1DE5A 4JTDA 1XEZA 1EOKA 3GR1A 4AC1X 4QWAA 4M7SA 1S2VA 4DR2J 5A6TC 3AS1A 1EJWC 4A2RA 5A6AA 8ATCB 4P8VA 2VFGA 2IPWA 4DLGA 4HPNA 2KHDA 3C6TA 3P62A 2PS2A 3NNHA 5J2QB 2V0TA 2OB3A 3W87A 4NCGA 4XVEA 4QU7A 3MUZ1 4OL8A 1E56A 3NJ3A 2WZ1A 2B7OA 2OWCA 3VILA 1FWWA 3RRAA 3PUGA 2GQ3A 2E6YA 2CQPA 2HAIA 2ZZNA 2GVZB 2HGLA 4OLOA 4FS2A 1EGZA 1FFGB 4DB7A 1E51A 5E6YA 5DDQC 1O94A 4L9XA 4WXOA 1A5NC 3DFPA 1T7PA 1PHQA 1F6TA 2G1DA 2JLFA 4ZOSA 3OW1A 1TMQA 2F7FA 4BF9A 3UPMA 1L3SA 2QL7B 1JXEA 3UDLA 1UUQA 1EHNA 1EBGA 4YU1A 3WG6A 4EZ9A 4P7NA 4O13A 4BCEA 5AECA 3GIRA 2P8CA 3P8IA 5KFRA 3NBPA 2KZHA 4DJDA 3M2VB 4BI5A 1CGVA 1AL7A 1WXYA 2BVWA 4O44B 1J5EF 2J0XA 1ENUA 1S2UA 3PY8A 3VUPA 2DU2A 3SN4A 2IA0A 3K0JA 2ZOMA 2UXDF 4B9NA 3V5CA 1C90A 3RXZA 2PT0A 3MEDB 3LP0A 4NRTA 1W9VA 3IV3A 2HBZB 4ASTA 2IQTA 4KR0B 3NQMA 3CH0A 4MF4A 4NUWA 3VOIA 4J7CA 3GM8A 1T94A 3AQUA 2I0XA 3LPFA 3BG3A 4UNIA 4UQBA 4Z37A 3W1TA 1MUMA 2XGZA 2VC0A 1DWFM 4GUFA 1D3GA 1XLFA 2W7PA 3K59A 2W2MP 3FCPA 5DLGA 4CH0S 3GIKA 4CNYA 1DXIA 4MUPA 4H6QA 4LREA 3PZOA 3CQHA 1VRQC 2WNNA 1OX5A 5A8WB 4YVVA 4AFYA 3EXSA 1W9DM 3H90A 5A6JA 4YYCA 5LNRA 1DQAA 1VS3A 2NUHA 1VYAA 2D7SA 3RHGA 1F07A 4ZCLA 4KKOA 2DRAA 2A3LA 4N7TA 3M44A 3IPWA 2VRJA 4PBEA 2B9XA 1PAEX 3MJYA 3W1QA 2Y70A 2ZH7A 1OABA 1YMYA 4QIWD 2Q09A 3DN9A 2PCEA 3GG8A 3RX4A 2WCAA 2CVIA 1FJCA 4X4UA 3ABOA 3B54A 1X9MA 3STEA 4UQAA 5L1KA 1DVJA 1ONXA 4JS3A 3NCPA 2QLXA 3EPMA 4W7WA 2XINA 4GNJA 3MBDA 1T9XA 3M2UB 2A3JA 3MT1A 2HNHA 1TFVA 1WKKA 2OZ8A 1WAUA 3ABQA 2XMUA 2BGNE 1VPYA 3E49A 1RHRB 3GKAA 2UY5A 3BBBA 4DJDC 3BPSP 1SJAA 5H6HA 1RWWB 5CC5A 3WIUA 3L0KA 1H41A 3GR0A 4AXNA 3PBWA 2CU0A 4I68A 5HMDA 3ITHB 5LHFA 2Z57B 2FGZA 1RWXB 1WACA 2UUBF 3TA9A 3TU9A 5IXEA 1TPEA 4HNCA 1DBTA 1XIQA 4LFBJ 1MRQA 2O55A 1WNOA 3VAKA 3U6WA 2RRBA 3AA9A 3RR8A 3TN3A 3G1SA 3V4BA 2IUZA 1MQRA 2ZH2A 2ATLA 5K9DA 1U1KA 4PWDA 1L0PA 1JQGA 5DZ7A 3S1TA 4N5SA 3CTRA 2X05A 4DYJA 1M53A 1XIEA 1UPPA 3KZPA 5AE1A 4LRCA 2ZXBA 2CITA 4OIFA 3H5XA 2KFYA 2XM3A 1TKZA 4XBSA 3KUEA 3H26A 3ECQA 1XDLA 2V0NA 3OBEA 2V34A 5CC3A 1AZSB 5GAEU 2KHCA 5KG7A 5C9RA 1MQQA 2WONA 2ZYFA 4W7UA 1UZ4A 1WOOA 4ROQA 1EO5A 3T19A 1FKOA 5F9LA 1RHKB 4GIYA 3QJJA 1ZQ5A 1Q4RA 3T2PA 2DH7A 4FZVA 4LSNA 3TEHB 4AY1A 2HK3A 1RAFB 1K02A 4QPXA 2GFFA 4CD6A 1D09B 1SJDA 2OKQA 1KM1A 4S2CA 5HDRA 5M1TA 5L9NA 1S12A 3ZTOA 4LQ3A 1OIAA 2L48A 3TOQA 1Y7VA 2I7GA 1XIJA 4LUYA 1Y5IB 2W4CA 3R5CA 4QJ3B 4X66F 3GHRA 5ECVA 4JP8A 2R7OA 1FNMA 3UNGC 1PYOB 3NGTA 4MVAA 2AIRB 2YKNB 3N4EA 3MM8B 3T5KA 1SO6A 2WMHA 5C5YA 2IKJA 3PG9A 2OTLS 1F5ZA 3TV8A 1HYSB 2YIHA 5E2QA 1JCJA 4NI8A 2OMOA 2O01C 1I45A 1Q13A 3D5HA 3W1XA 1ADDA 1LQ9A 5KEZA 3IG1B 1U1MA 3BGLA 2FB2A 4KKXA 4GC6A 2VQEF 2ZWZA 1C8XA 5CBBA 2J66A 2P9EA 3DFSA 4GJIA 1FRKA 3VVTA 3NSMA 2UY2A 1CS4A 3WLMA 3IWLA 1C91A 3AB2B 4H7CA 4W4QA 2WVSA 1PIEA 4ZGYA 4PG6A 2RHGA 3DRPB 3P4UB 2WV8A 5C24A 5G0RA 1K0VA 4CU7A 1UW4A 1U47A 4R8UA 5LNVA 1DTQA 3ARTA 3PIOQ 3CHEA 3GRIA 2HBYB 4NEYA 4X9SA 4C6NA 2C1IA 2YKOA 2XZTB 1FHDA 2OSYA 4KPLA 3HFYA 3KNGA 3EX2A 2MQQA 3M9YA 1OY9A 2OSQA 1QVBA 4HK6A 1UVKA 5EKYA 2ZZ1A 5K20B 3XIMA 4JX4A 3MOZA 3EXYA 1G4EA 3A8EA 1X1OA 1JYWA 1CJVA 3UYCA 1B0PA 4ERGA 3HPSA 5HULA 1PKUA 2OTDA 1R0CB 1X9WA 1K7XA 1LEOA 1UQZA 2VHLA 4K8GA 3H5SA 4OHWA 4C8YA 1KFWA 2YR1A 4ILMA 1YI2S 1S0NA 2FVPA 1ZHAA 4GJ1A 3AXXA 4BHYA 5HQLA 4AMCA 1LW2A 4DFMA 3KUMA 2WSPA 4KGXB 2JVRA 4GKKJ 5LJ3Y 4X2BA 1RHJB 3SY8A 5I24A 3NOCA 4BC7A 4KGMA 2Y6ZA 1M5VC 3SY5A 3GP9A 4WK3A 1XG4A 3PK7A 4BZYA 5E0CA 4NNBA 1F8MA 4XAYA 1E4NA 4NYUA 5E41A 1IKWA 3GU1A 3RW7A 2OAUA 2DZXA 1U22A 4S3BA 5CAKA 2CPHA 4FB7A 1LXJA 3LZ5A 3LTSA 1WA3A 1BVNP 1BYCA 4PTXA 5CBJA 3OVRA 3MSYA 2WOQA 3TP4A 1RD6A 1S10A 3LN3A 4ITSA 3FLUA 4XD5A 2YWGA 3F44A 1RSCA 1VHFA 3MBFA 4GWEA 4C65A 5CYQA 3QYSA 2BDQA 6AT1B 4M1BA 1U6ZA 3MUXA 1X0FA 1BUXA 4LQ1A 3GCWP 2IHR1 2DNPA 4K38A 4CNTA 1V6VA 1DJQA 3M64A 4MK8A 1TELA 2J6UA 2D2JA 4V27A 3WX4A 1F74A 4J2MA 1V0NA 5HLFB 2R7WA 2EBNA 4L7ZA 1K44A 1TMLA 1OPZA 4ES1A 1AZ1A 4PODA 4DFJA 4ELUA 4PC8A 1GMUA 3TYDA 5LSRA 1EF2A 3TW9A 4LC8A 3K8MA 2L9WA 3L67A 1JYNA 2ISVA 1S9FA 4RW6B 3O6CA 1P5BA 2PFHA 4PABA 1F2JA 3HCXA 1ITPA 1H98A 2HLTA 3S3GA 1XX1A 3NO1A 3SR7A 1OINA 3B0PA 1JQVA 4QOTA 3FFIB 3CZ8A 4E2DA 2CCRA 2PWUA 2AJ2A 1PEZA 3MMCA 3DDMA 2UXBJ 1KRPA 3RR4A 2IAJB 3GTXA 4UTJA 2RHSB 4Y7EA 3QZ6A 2RAQA 1RXOB 4RX6A 5JXSA 2NR0A 4D9PA 1KBIA 3ET6B 2CZ5A 1YPXA 3GK0A 4H4OA 1ZBVA 4DG1A 4ED4A 4IPLA 1CLXA 3BOXA 4DF1A 4I9MA 3MV01 2YQ1A 4D8LA 1XRTA 4QR6A 4L4MA 4C11B 3N6NA 5ABFB 4Y96A 2N82B 1XFCA 1HWIA 2VC5A 1C1BA 1CJUA 3RCMA 1HNYA 1XFBA 4PEOA 3KWSA 2NUXA 1Q4NX 3BG5A 1R2TA 1LL7A 1S5WA 2DO4A 4RUAA 2C16A 2MQOA 3QGPA 4OX9F 3QF0A 1T5AA 3TP2A 5H9EK 3G1AA 1MWQA 1G7UA 1UROA 4K4SA 3I5BA 4DI8A 3HZEA 5EWGA 3I4EA 1IEWA 4DSJA 5ETQA 1I5OB 3AHPA 1JDEA 3CO8A 3R8YA 3GNXA 1M5SA 3H4GA 4GZIA 4NKCA 4ATNA 3K5XA 4PTNA 1S9GB 3TKFA 1QW8A 3E01A 2HSAA 4IMDA 4ZBCA 4GCXA 4IIHA 3KWXA 1OWXA 2VG7B 5BXIA 2P88A 4ZQNA 2CHNA 1M5WA 1RAAB 1EDGA 3CJKB 1Y7PA 4HPXA 1TTIA 4Q8QA 2WK4A 5D32A 4ADSA 5I00A 3H2LA 5FLXU 1XRVA 3N2CA 4O8RA 5B0GA 2FVRA 1VF8A 2FIQA 2CPYA 1TJ0A 1OADA 3GC2A 1R89A 1ZM2A 3OT9A 3VCDA 4U3AA 2MQ8A 3R1LA 1XC6A 1VCVA 3UD5A 3A1YG 4TYBA 4B5TA 2I5JA 1H0IA 4JFWA 2NXNA 1VBZA 3CH9A 3KXDA 1UC5A 4WP9A 4ZP8A 3TAPA 1YBTA 4P6QA 2IM1A 4Y8EA 1GFWB 3GG0A 2BHZA 1DXEA 4KEMA 2DRDA 3HSDA 4JI2J 2C3ZA 3UF9A 4C8LA 5IT9U 3VOHA 1LV5A 5U4NA 2W9CB 3LOTA 3N15A 3ZO7A 5HWNA 2XWDA 2HHTA 2QMJA 3NRBA 1R9YA 2PA8D 3SFWA 5LNUA 3EJMA 2E68A 4QFUA 3QRRA 3BO9A 5EY5A 4P7RA 3H7VA 4OGZA 2MKHA 4R7JA 5C55A 4GKKF 4AD6A 3W1PA 2W4DA 1TFYA 4YYFA 3K13A 2MZ1A 1TZ0A 2Q43A 1XICA 3TANA 1X1NA 4N9BA 2XLJA 2FTPA 3GDKA 1KLMA 3PM6A 3JVAA 1ZZNA 2XIBA 1VRUB 4K2SA 4DFPA 5LA0A 2W61A 1FJGJ 2FH6A 3SCTA 4NT0A 3KX6A 2NCKL 3WZ0E 2V4QA 1VLWA 3BO4A 1PAUB 4KQZA 7TAAA 2QCMA 4ZP7A 3SCQA 2IYIA 1V7AA 4NCGB 5C54A 2EKNA 3DHDA 5B0AA 4RZ5A 4US6A 1X5OA 2R7XA 2UWFA 3IUHA 4A3UA 3QNWB 3W7NA 1GG1A 3UDCA 2R94A 3HGSA 1HQUA 1PZ3A 3OIHA 1S59A 3AZSA 1WO2A 1UR1A 2EPLX 3QOKA 2B4OA 1VK8A 1JPDX 3BC9A 1U5VA 4KERA 2HVMA 3NG3A 3NBPB 3CUHA 5ETOA 3BAKA 3CIWA 1TR1A 2QLJB 3OTEA 1NKEA 2ZUGA 3MC5A 3JSBA 2JC1A 1R46A 3Q8UA 2LEBA 4ZJLA 3TAMB 3UEQA 5J5DA 2ZJQQ 3UZJA 1DAXA 1KQGB 3OXLA 1CEZA 3EMCA 3MM6A 3QGVA 1OSDA 2OP5A 1RTZA 2CNLB 3DOKA 1NTHA 3IS4A 4GVIA 3VE9A 3WD3A 4DF0A 1Q8AA 2HZCA 3PVFA 4AWUA 5XIAA 3UWWA 3CBWA 5FF7A 1R31A 3R7BB 5E3AA 2BW7A 3VM7A 3BZGA 1DEDA 3MP4A 1RAIB 5DGBA 4AQLA 4WDTA 2MHNA 2KXFA 3GC4A 4LF7J 2XS2A 3NMAA 1TUVA 2VFUA 2QQ6A 3MCSA 1S1WA 3VR1A 1XQIA 1FXQA 5KFNA 2IBKA 3W7RA 1QXLA 4RNFA 1OG6A 1XNQJ 4CN1A 2DIKA 1H2VZ 3GXTA 4OYOA 3IVTA 2ACQA 3MJMA 2GVDB 2X1UA 1KRCC 5CC6A 2GHWA 1KGUA 4AD5A 3N5FA 5D77A 1DJZA 2CLFA 2WJFA 2Y7DA 3B9AA 2EPHA 2DUAA 1MROA 3L4WA 4KKOB 4KHPF 3KJNB 2HZVA 2WVTA 4PYAA 1VPQA 2EC0A 4GC3A 1ELSA 3KDNA 3LGNA 3TZWA 4JHMA 3KK3A 3TQPA 4OZ3A 3ELHA 2DNQA 1S1UA 2ZBRA 3C0JA 5A0YA 3VKDA 1B0IA 3EPOA