4RNHA

Pamora tandem diguanylate cyclase - phosphodiesterase, c-di-gmp complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
429
structure length
423
Chain Sequence
b'MAYYDALTHLPNRTLFQDRLHTALQQAERNGQWVVLMFLDLDRFLGHAAGDRMLQEVATRLSACVSQDDTVARMGGDEFTLLLPSQGDREIALKRAIQVAELILGRLARPFTLEGREFFVTASIGVALSPQDGAELSLLMKNADTAMYHAKEMGKNNFQFYQAEMNARALERLELESDLRRALELGEFVLHYQPQFTGDGRRLTGAEALLRWQHPRRGLVPPSEFIPVLEEIGLVAQVGDWLLAEACKQLRSWHKAKVRVPKVSVNLSARQFADGQLGERIAAILYETGIPPACLELELTESILMSDVAEAMQILSGLKRLGLAIAVDDFGTGYSSLNYLKQFPIDVLKIDRSFVDGLPHGEQDAQIARAIIAMAHSLNLMVIAEGVESQAQLDFLREHGCDEVQGYLFGRPMPAEQFGMLYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Motility regulator
publication title Formation and dimerization of the phosphodiesterase active site of the Pseudomonas aeruginosa MorA, a bi-functional c-di-GMP regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase, hydrolase
total genus 146
structure length 423
sequence length 429
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4rnhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rnhA01
2FLPA 4TN2A 4KHRA 4DEZA 2UUTA 4MK9A 4DL5A 4IKAA 3V81B 3KOAA 4MKBA 4LSLB 5EWEA 4RNNA 3KK1B 3I0SB 4AG0A 3BREA 2IMWP 5J2MA 4O4GA 1FK9B 1SUQA 5KG0A 3EPGA 2IBKA 1C1CA 1S9GB 2RDJA 3V6HA 3QLHA 4F4YA 5K14A 1MU2A 4TXSA 5HBMA 2B6AB 4JV1A 2UUWA 3KZPA 2WHOA 4URGA 4O3PA 3CJ3A 2E9RX 3KLEA 3M8PB 4Y9NA 3CIZA 3H4DA 3C6UB 4O44A 4ECXA 1BQMA 1DLOA 1HQUA 3QYYA 3KLGA 2XWYA 3QO9B 2W8KA 2RKIA 1RT1B 4NLSA 3G6VA 1SV5A 4K4TA 2I1RA 3LAKA 1LWCA 1QUVA 2R8JA 4LSNB 3DLKA 4WFZA 3G6YA 3FSIA 1TKTB 3I0RA 2C2RA 4ZMMA 1C0UA 4J9NA 1DTTA 4F4ZA 4ECVA 5I3UA 1S1XA 2IAJB 3MEDB 2YKMA 4WE1A 3ISND 3MECB 5J2NB 1S0NA 2RDIA 1OS5A 3RBDA 2IC3B 1SH2A 4ED8A 3CO9A 4FBUA 1JLQA 3KLHA 4KO0B 4NLWA 1T03B 4XPEA 3HKWA 4RUAA 2YKNB 3KNAA 5KFLA 4WYWA 3DI6B 3CJ4A 2OH2A 1HNIB 1LWFA 1JLGA 1S1WA 2HNZB 4TQRA 3NBPB 4J9SA 4ED1A 3DLGA 3DOLB 3V6KA 4MKAA 4ICLA 3RAQA 3PHEA 5KFTA 1N4LA 1W25A 3PVXA 3KLIB 3KK3A 3C6TA 5HLFA 4DL4A 4WZMA 1WNEA 3G6XA 4HU4A 2IM2A 5KFDA 2BR0A 3GFZA 4LQ3A 3QZ8A 5C42B 4PQUB 5I42B 4JV0A 1RTIA 1S9FA 5KG2A 1T3NA 3M8QB 5L9XA 3GQCA 1KHVA 5C24B 1IKWA 1FKOA 4K4ZA 1RT2A 3KJVA 4H4OA 2HNYA 1J5OB 3PFMA 1SH0A 1U09A 2BQRA 4EEYA 4WXWA 1HMVB 4ECTA 2AX1A 5FDLA 4ECRA 1K1QA 5KG3A 1JLAA 1S48A 4K4VA 1TKZB 2WRMA 2IM0A 4I7FB 2CKWA 5DQHA 5EDWA 1JLEA 1BQNA 5J2QA 5KG1A 2YNFB 1GX6A 2D3ZA 2VG7B 4EO6A 3PJTA 4NLQA 4XO0A 2BQUA 1S0OA 1D0EA 4NZ0A 4ZHRB 3IRXB 4QW9A 4RNHA 1S9EB 4QWAA 3BJYA 3CJ0A 4WZQA 3KHHA 4KFBB 1I6JA 3KK2B 1RT7A 4NYZA 4EYIB 2W9CB 3V81A 4K50A 3MR3A 3KHLA 1RT5A 2RF2B 4KBIA 4Y9MA 1EETB 3KK1A 1S97A 3I0SA 4Q0BB 1FKPA 1Z4UA 2HWHA 3I5CA 2W9AA 3H2LA 4FBTA 3V4IB 3E51A 2ATLA 4MH8A 4I2PB 3SFGA 1IKVB 5C25B 2O5DA 3PJWA 3M9MB 4URSA 4HKQA 4IFVB 3MFIA 3C6UA 5KFHA 2GC8A 2R2RA 2FLLA 3QGHA 3EZUA 5F9LA 3JYTB 1JXLA 1RT1A 4EBDA 3ISNC 1HYSA 2UVWA 3S83A 1TL3B 3PW5A 3DMJA 3H4BA 2JC1A 1JLCB 1C0TB 4LSNA 4Y9OA 1TL1B 2I5JB 3ITHB 4R5PA 2HNDB 4KV8B 4TY8A 3GV7B 3NKYA 4O3OA 3PJUA 2BRKA 5KFJA 3NMAA 2ZD1B 2ZE2B 2IAJA 4IDKB 4U7CA 3RB0A 3PJXA 3JSMB 2FVSA 3MECA 4NLTA 2VG6A 3N3TA 1XR5A 2FLNA 1K1SA 1UWBB 4KO0A 3DLEA 3CDUA 3FFIA 3DRSB 4RNIA 4IRCA 1HNIA 4NRUA 3D28A 3IS9B 1RTJB 4NCGA 2HNZA 5KFAA 3GIJA 3NBPA 3M9OB 4G1QA 3KMSA 3MEEB 3HVTA 4RW9B 4G3IA 1RTDA 1IKXA 3QIPA 4IRKA 3DDKA 3BSCA 3KLIA 2BASA 1C1BB 1T05B 5KFEA 1RYSA 5EWGA 3NAIA 3UPFA 4RNMA 1RTHA 2D41A 4RW7B 2OPPA 2J6UA 1DTQB 5C42A 2WB4A 4XPCA 2XGQA 3PZPA 4EYHB 1VRUB 3DYAB 4QPXA 3N6NA 4WXOA 2VG5B 3EPIA 2R8HA 3RB6A 4QWEA 1S0MA 3M8QA 2FJWA 4M95A 1S49A 4IRDA 4ECSA 4HYKA 1S1VB 3LP0B 5KFUA 5DG7A 2YNHA 4K4UA 4PUOA 4NLXA 1J5OA 2WK4A 4NRTA 2C2DA 2V9WA 5DLFA 3OSPA 3PR5B 4MIBA 3FQKA 5KFCA 3H5YA 4PWDB 5F8NA 1TKZA 4I7FA 2R8GA 2B5JB 4IH6A 4TY9A 4RU9A 3KLVA 4Y3CA 3BGRB 5KT5A 4Q45A 4F4XA 2BANB 2JLEA 5D3GB 4IFYB 4Q8FA 4ECWA 1JLBB 2OPRB 5KFMA 3BQ1A 4J9OA 1LWEA 4RNOA 4KFBA 1S10A 2V0NA 3KMQA 1HNVA 5KFBA 4B3OB 2W9CA 4KIEA 1GX5A 4Q43A 2RF2A 4Q0BA 4KKOB 1S6QA 2W9BA 5DGBA 5KFYA 1HQEA 4URQU 5KG6A 5L1IA 4RW6B 5JUMA 3KHGA 3RBEA 3IN5A 4MFBA 4RW4B 4IR9A 4HU3A 3FRZA 5C25A 1IKYA 3Q8PB 4ED0A 4RNJA 4ID5B 5MKGB 3H59A 3IG1B 1NHVA 3FQLA 3UDLA 4ZPAA 4FOJA 1HPZA 2AQ4A 3PW0A 2YNGB 3JYTA 5CYMB 4ZVEA 3DRRA 4DG1B 2VA3A 4NLVA 3GIKA 5KFFA 4YR0A 3T5KA 4TYAA 1EP4B 1TL3A 4NLGA 5MF5A 4M94A 3SY8A 3OLBA 1LW0B 2C2EA 5C5JA 4DL6A 1JLCA 1C0TA 4QWCA 5HP1B 1JKHA 4RW8B 3KLFA 2I5JA 4Y8EA 1RT4B 2JEIA 3DRPA 4KV8A 5HROB 1S1TB 3LAMA 5J2PA 4KHMA 2IJFA 2WTFA 2DPJA 3SFUA 2ZD1A 5KG7A 1TQLA 2JC0A 5J1EB 4QWBA 3NGDA 4ZP9A 2UVVA 3IGNA 4MIAA 3RB3A 3MF5A 2ASLA 1UWBA 4O4GB 1SUQB 4FOUA 1N6QA 2B43A 4H54A 4EBEA 4KAIA 4Q44A 5F8JA 4H4MA 5K14B 1MU2B 2R2SA 1TV6B 2WONA 4QW8A 5KFOA 3Q8SB 1RTJA 3LP1A 4WFYA 2D7SA 5KFZA 3KLEB 3GILA 2V4RA 3QGGA 3MEEA 1DLOB 1HQUB 4ZVFA 4HJFA 4RW9A 5KFXA 3Q8QB 5KFNA 4LSLA 3HVAA 4IQXA 5KFVA 5KFQA 4NLPA 2W7OA 1FK9A 1S9GA 3RB4A 2B6AA 1DTQA 1S6PB 2OPSB 1C0UB 1VRUA 2OPQB 1NNDA 3DYAA 3M8PA 5KFRA 1RA7A 3BQ0A 5I3UB 4ED3A 5KFPA 5KT3A 2YKMB 3IGVA 3QO9A 3NAHA 1TP7A 4JUZA 3OL8A 1HARA 3I5AA 3V6JA 1RT3B 1D1UA 3KLHB 3G86A 4YMEA 1S1UB 4MK7A 2ASJA 1TKTA 4IG0B 2BQ3A 4NLRA 2R2TA 4ED6A 1XR7A 1LWFB 2C22A 3MEDA 1TKXB 4R8UB 3HVWA 2R6OA 4K4XA 4IFYA 4GC7A 5J2NA 2OPRA 4ED7A 2ASDA 2E9TA 3VQSA 3HV8A 1C2PA 2IC3A 3MR6A 3GV8B 4F4WA 2JEJA 3I5BA 4ES4A 1KLMB 3H5SA 5EUHA 3C6TB 5F9NA 1IM4A 2ILZA 4TLRA 3KK3B 5HLFB 1T03A 2UVUA 2YKNA 4KKOA 4J9PA 3SI8A 4DL3A 3DI6A 1JIHA 3H5UA 4OL8A 4F48A 1LW2B 3MEGB 4KB7A 4LYKA 4ECUA 3CWJA 3DOLA 4J9KA 3H5XA 1N56A 4O3SA 5L1LA 4ID5A 5MKGA 3IG1A 3DM2B 2AGQA 1RT2B 1SH3A 4H4OB 1RAJA 1TVRB 2YNGA 4ZVHA 5CYMA 4ZPDA 4DG1A 2AU0A 1YVFA 2YNIB 1QE1B 4B3OA 4PQUA 3GIMA 1LW0A 5I42A 5JXSA 4I2QB 4NLUA 1BQNB 3OL7A 5HP1A 4JV2A 3TLQA 2ILYA 4WYLA 1RT4A 5C24A 4Q8EA 1RA6A 5HROA 1S1TA 4K4SA 3CVKA 5KT7A 2CJQA 5KFSA 4ZPBA 3MFHA 1RT7B 3Q8RB 5DGAA 1ZTWA 4X2BA 2FVPA 1HMVA 4J9LA 3TAMB 4ED2A 1RT5B 3T5JA 2J6TA 2UVRA 1JLFB 1FKPB 3N6LA 1N5YB 3LP2B 4DL2A 3H40A 4J9MA 2XC9A 2YNFA 2VG7A 3T5LA 1CSJA 3MR5A 3PW7A 1REVB 3UR0A 5DQGA 1TV6A 4ZHRA 2XCPA 3IRXA 1S9EA 3OHAA 2R8IA 5KT2A 2F8EX 5CYQB 3KK2A 2FVCA 3E01B 5T14A 1EETA 3OSNA 2W27A 2FJXA 4Y9PA 4AFYA 1RT6B 3GG1A 2QE5A 3LANA 3GIIA 1HYSB 3V4IA 4KSEB 3RAXA 1VRTB 3DMJB 1RYRA 4I2PA 1MMLA 4ZPCA 4IG3B 4KE5A 1S4FA 2AX0A 1IKVA 4R5PB 4ECZA 1S6PA 2OPSA 4LQ9A 3CDWA 3FDSA 2IM3A 2OPQA 4TY8B 2BE2B 1ZETA 5EWFA 3CDEA 4IFVA 2E9ZA 2FJVA 5F8IA 5KFIA 3ICLA 4IOBA 3M9NB 2VG6B 3MTKA 3TQ1A 4RNFA 1R0AB 2HMIB 2WOMB 4Y34A 1RT3A 4ZP8A 5KFKA 1S1UA 1TL1A 4FOKA 4J40A 3BSAA 3CJ5A 3DLEB 3ITHA 4IH7A 2HNDA 3FFIB 3DOKB 5KFGA 4IG0A 4ZP7A 3T1AA 5KT6A 4FS2A 5DLGA 4NCGB 1ZTTA 2ZE2A 2FVQA 4IDKA 4GC6A 1TKXA 3V6DB 4R8UA 3JSMA 4G1QB 3T5HA 2VA2A 3HVTB 2QV6A 1RTDB 1IKXB 3QIPB 4F3HA 3H98A 4MK8A 1KLMA 5J2MB 4U6PA 4TQSA 2R8KA 2XCAA 1C1CB 3QLHB 2DPIA 1RTHB 3TVKA 1KHWA 3DRSA 2OPPB 4NLDA 5HBMB 4YP3A 5DG9A 3PW2A 3IS9A 1LW2A 3MEGA 3KHRA 2EC0A 1RDRA 2XI3A 4O44B 2J6SA 2ALZA 1BQMB 3OL6A 3GFYA 5KG5A 5DQIA 3KLGB 3DM2A 3OHBA 2RKIB 4Q6JA 2YNHB 1SV5B 5L1JA 4FS1A 4PUOB 1C1BA 1TVRA 3N6MA 3UQSA 4YR2A 1T05A 1LWCB 2WCXA 4EO8A 3GV5B 2YNIA 3DLKB 1QE1A 4RW7A 3PW4A 1QAJA 4LJ3A 3I0RB 4I2QA 1DTTB 3HV9A 2VG5A 1S1XB 3T19A 4J9RA 4WE1B 3NL0A 5F8LA 4O4RA 2IA6A 1S1VA 3LP0A 5KT4A 2W8LA 2ZKUA 1LWEB 4Y2CA 1HNVB 5L1KA 4ECQA 1JLQB 2C28A 4IH5A 3TAMA 3BSNA 1NHUA 3HHKA 4PWDA 4YR3A 3CJ2A 1S6QB 1JLFA 1XR6A 3LP2A 2W9BB 2B5JA 4EBCA 5F8MA 1HQEB 2V4QA 1N5YA 4Y2AA 1QAIA 1JLGB 1S1WB 3D5MA 2R2UA 4MFBB 2IM1A 3BGRA 3DLGB 3OLAA 2XGPA 1REVA 2BANA 3BQ2A 2JEFA 5D3GA 1IKYB 4ICLB 3OL9A 1JLBA 3QIDA 5CYQA 4YQWA 1HPZB 2AGOA 2GIRA 3E01A 3QGIA 3PR4A 2AWZA 2AGPA 3DRRB 2D3UA 4ECYA 1RT6A 3GYNA 2JEGA 4NLYA 5F8HA 1VRTA 4RW6A 4RUCA 1RTIB 4DL7A 1JKHB 4IG3A 4RW4A 3KLFB 3QZ7A 3U2EA 4J9QA 3DRPB 3MR2A 4F50A 4IR1A 3BR9A 4O3RA 2GIQA 1IKWB 1FKOB 2BE2A 5J2PB 5DG8A 3KJVB 3LALA 3GFXA 4O3NA 2HNYB 4WFXA 2HAIA 4ZVGA 4TYBA 1R0AA 5FDLB 2WOMA 4K4WA 2HMIA 1EP4A 5KFWA 1JLAB 2IJNA 4NLOA 5F8GA 2FVRA 2W7PA 1JLEB 1N6QB 2HWIA 1T94A 5J2QB 2XI2A 4RW8A 4R0EA 4H4MB 4O3QA 5M1TA 3BSOA 4RZRA 3DOKA 4QWDA 1JX4A 3GG0A 2WONB 3LP1B 4ZP6A 1N48A 4K4YA 2BRLA 3V6DA 5J1EA 5KG4A
chains in the Genus database with same CATH superfamily
3THPA 4YCPA 4RNNA 1KBBA 1VOMA 3PIPQ 4F0KA 2VPYB 3EPGA 2YCEA 1C1CA 3V6HA 4E2VA 1VDHA 1EQMA 5HK4A 4MFDA 5B7YA 2RAGA 4UC5A 3M7SA 4O44A 1TA3A 2ASHA 3W8PA 2XWXA 1XKYA 2PZNA 3WKZA 1UZ4A 5FJTA 1RSCA 5LHFA 2ZZMA 3L68A 1US3A 1VISA 5FLXU 4B3MF 4DR1F 2GSHA 3HFTA 1U1MA 3BDPA 4P61A 3NPXA 1TWWA 4DUXA 2VX4A 4P10A 3GR7A 1U6ZA 4AZIA 1VBKA 2V3DA 4S3DA 2PTXA 1L2QA 5GAEI 4ELTA 4QXIA 5HNUA 5A2AA 2WBMA 1GMWD 1XLEA 1CLKA 4JI6F 5AE1A 2HVZA 2CHRA 1NK8A 2VNCA 5ETNA 3M32A 4AC7C 3MHFA 4WK1A 4GPNA 3PVXA 3G6ES 4GH1A 3MMCB 1JEZA 1FDZA 1TREA 4RDYA 3M30A 2BHYA 3LCFA 4IMAA 5E70A 3C4UA 1IYXA 1DJXA 4MIWA 1ECQA 2XM3A 2DVXA 3FEMA 4ILSA 2JLFA 2DZVA 5E3QA 2XG9A 2E1DA 4DOZA 1KRMA 4NZCA 2H51B 3OP2A 4LEFA 1Y5IB 3W66A 4JTUA 4D6FA 3M6VA 3J7AN 2GPTA 3SUUA 3HPOA 3C56A 2GW8A 4FXWA 3JSBA 3JAMU 1SJFA 4ETXA 2HHHF 2Y62A 2RSQA 1SJ4P 1GFWB 5I3GA 2VQFJ 1DJNA 3CJ8A 2ZRYA 5J2QA 1NCLA 2WVSA 4E8UA 5ADZA 3QRPA 3W2VA 1DJYA 4X4NA 4J2MA 3NWGA 2VDIA 1TQXA 2AMGA 2CWKA 2QC3A 5A69A 2EJAA 1RT7A 4NYZA 3V81A 2A6NA 3CUIA 3TZFA 4MPQA 3UJEA 4BFAA 4EGLA 1KBKA 1V3MA 3GB6A 3V4IB 3GVWA 1G2EA 2GVDA 3O3LA 8CGTA 2V8DA 2RS2A 3PZIA 4E4FA 3UXAA 5XIMA 1H63A 4MT1A 1EL3A 1Q6CA 2WCGA 3TU9A 4DWIA 3A8JA 3GG8A 3K2YA 4C98A 4WCEQ 4A8MP 3MDUA 1AW1A 1I2QA 4TY8A 3MW7A 2NS1B 2VELA 3A22A 4L76A 4WBFA 3UPBA 1GXUA 2V3FA 1EP1A 2DT3A 2EG6A 2Z56B 4OIFA 1PBUA 3B05A 2JBMA 1REQB 2GMJA 3FS2A 4E3VA 1FRXA 3G1RA 2W2NP 2GAHC 1ITPA 3AS2A 3GIJA 2K8GA 4Z2KA 3WQOA 2CNNB 3K59A 1TPVA 3HVTA 4G3IA 2V0TA 4F3MA 1OFAA 3SIMA 1TL4A 1FX2A 4CQAA 4RNMA 4DR7J 3S5SA 1NH6A 1R8LA 3HSDA 1SC6A 5I3QA 3Q58A 3U2OA 3IK4A 2YXXA 1FP9A 1CJVA 4J3SA 1M7JA 1XFBA 2HQ3A 3KWMA 3EYPA 3KCLA 4F2UA 1U2CA 4MKVA 3VIHA 1UIPA 1YHTA 1S7HA 4ZCKA 3NS6A 2R8GA 3CZKA 5HR7A 3OQ8A 5HULA 5M2FX 2DNOA 1BWKA 2MQ8A 2RJZA 2BG5A 1FI4A 1OD0A 1GONA 4IFYB 5A5WA 5A6WA 4DZIA 2I5IA 1LWEA 3TAKA 3NL6A 1HNVA 3IO1A 3SCKE 1Q63A 1SCJB 3UPMA 4TVCA 3TYUA 3BW2A 1J2BA 1HQEA 1XGDA 4XK8C 5JUMA 3IAPA 2VWSA 3BOXA 2CG8A 4Y6IA 1TUFA 4DI6A 5IOLA 4ED0A 1PV8A 4XZIA 3W72A 2UY3A 2HCVA 3SDEB 2A21A 2XNQA 2YCIX 2R9LA 3HMCA 4ZTYA 3CD7A 3MO7A 4FXRA 4ZVEA 2CHNA 4LT9A 1RAKA 2J4GA 1HWUA 4JCLA 6CGTA 3PNZA 2VRQA 5I3KA 5A3HA 4NXMF 4C0OC 1E1FA 3WDPP 3H2UB 2ZIDA 3LI0A 4GISA 3G1AA 4I9JA 1QNSA 4RV3A 4C91A 2WJEA 2NV9A 3WQEA 3NNHA 5BXIA 1NP2A 1QM9A 2Z58B 2B43A 2YWKA 1CIUA 5XIAA 1WYIA 3DLHA 4PR6A 2RQKA 2PRHA 3ITOA 5KFOA 1G94A 1ZUAX 2E5CA 5HVFA 2DIKA 4MNJA 2NQ5A 1DLOB 1U1LA 3MA8A 4ILLA 2VFHA 1U8SA 3K2GA 4PCQA 1ZBCA 1W56A 5EGYA 2WVTA 3K4AA 1US0A 1GXTA 2FTRA 1OSEA 5EGRA 1XFCA 1C0UB 3JVAA 5LIUX 1U5JA 3RPTA 2J7BA 1ZENA 4AYSA 4OZ1A 2E0PA 3PO4A 3W7IA 3R2GA 2NZCA 1X38A 3KVKA 4YTRA 2ZH5A 5H91A 5F3ZA 1M5PC 2UXCJ 4OTKA 2KVIA 1R3TA 4U2YA 4TXEA 3ENQA 2YL8A 1C8YA 2W62A 3PPCA 3UXLA 1EGVA 4NVTA 2A5HA 3SB0A 1DJHA 1UMJA 3H5SA 3BCDA 3FCPA 3CT7A 2UVUA 5I2UA 3WL0A 1SYTA 1WOSA 2YKNA 4OBRA 3UG8A 4HK5A 2A0FB 4KKOA 4OHXA 3OHIA 4XBKA 2D2OA 1GVYA 3Q45A 4I8DA 4IH3A 4PG7A 3AODA 4XTIA 1EEPA 4XSMA 2P8IA 5SUHA 1DHPA 2G3IA 4HYVA 2AHOB 1UQYA 3DC0A 3VD3A 2ZC8A 2EPOA 3QR0A 1TVRB 3DG7A 3W02A 4LJMA 3G9CA 4ZVHA 4AZ7A 1JNDA 1PIFA 3RU6A 4M5HA 2GNKA 1AZ2A 3LRMA 4TV5A 4JTTA 2C3OA 1RAGB 2XWDA 3TLQA 3MM6B 4DUVA 5KT7A 4I9MA 5KFSA 4XK2A 3VDHA 1AJ2A 1PDZA 3C0QA 1FDJA 3CZ8A 3XINA 4HZ7A 1LP6A 4YLWA 3A47A 2NXEA 1AZSB 3R1LA 1ZTWA 1LROA 5BU6A 3MBFA 4RLEA 5DDQC 2TODA 4DF4A 4LUJA 3UZ5A 3CPRA 4AL7A 1U1RA 3MMAB 1XGZA 2DZWA 3P8IA 3LK6A 3ZLGA 4AW7A 2YXGA 3LUTA 1CGYA 3NO1A 2PIIA 3TSBA 1EF3A 1EETA 1XTZA 3GIIA 3GKAA 4JIIX 1G7CB 2FZCB 4KFOA 3TN3A 4UQDA 3QPEA 2Z2LA 3QT8A 3OYZA 5DBUA 2VWTA 2I57A 3D47A 5HQMA 4ADUA 3KLKA 4HR2A 4FN5A 5A8QA 3OUYA 3GDLA 2DH9A 2AJ0A 1ELSA 3TQ1A 4KH1B 3IUHA 5KEZA 3DERA 5AYXA 2E7FA 3AH6A 3MCNA 3DOMA 2PC8A 1LORA 4L56A 3VABA 3T1HJ 6XIAA 3STGA 1ZPWX 3K58A 1XMOF 1UP2A 2VA2A 3GJSB 3CH0A 3EOSA 1RTDB 2QA4S 4FO4A 3WLQA 4WEVX 4XWUA 2R8KA 3QLHB 3EZOA 3UE2A 3NOYA 3NA8A 2WSCC 3IS9A 2J25A 2J6SA 2DGAA 2OKTA 1BGGA 4JQ1A 3VR1A 3WQPA 3LTOA 4HNCA 5LSOA 3U4AA 3AIVA 1SV5B 5L1JA 4YHHJ 1HNXJ 3UQSA 4YNGA 3MDFA 3GV5B 3MSGA 2E44A 1FWHC 1H7WA 1S3TC 5IHRA 2MLXA 2YIHA 5HWMA 2WNZA 2NSXA 3Q86A 3M6UA 4DV2F 4A8KA 4J35A 3PULA 4YMZA 4KYZA 2HKEA 3PC0A 4JQ3A 4MTPA 4YR3A 4UZUA 3LA0A 2RQCA 3VCRA 4MAKA 2EQDA 2QIIA 4MWAE 2WHLA 2CBVA 2VEFA 1JZ6A 1SQFA 3W60A 2CPEA 4DSLA 4OFCA 3S9ZA 3AXMA 3OL9A 2VOMA 4QZVB 2NW0A 1EZ2A 3TJIA 1WKLA 3U27A 1MWYA 3WC0A 3WJXA 1AA1B 4F9JA 4KFPA 3OW2R 1NB7A 2AWZA 2QPSA 1I1WA 3GXTA 2O9PA 2NLWA 3VAKA 4BHYA 6REQB 3B4UA 3D68A 2IW0A 1JQGA 1WKEA 1KN6A 3FEQA 3I55S 4AZGA 4H2CA 3PEHA 1HWLA 2LQ9A 4XKMA 4OOUA 1QVGR 4ZBCA 3NSMA 2Y4SA 1JYVA 2WOMA 1E3ZA 5D2VA 5D9MA 3VGFA 2QNEA 1JLAB 3GE9A 1LWJA 2G97A 5BRQA 3B9EA 4C6DA 2XI2A 2J8SA 1OG6A 3D3BJ 4JI4J 2F8QA 1CJKB 1JNEA 3AIUA 1NKCA 4US5A 3PUGA 3I6PA 4H8HA 1O60A 4ZA1A 4U8VA 4MKBA 3TI0A 1U1PA 2EF9A 2E8ZA 4UY8T 1V79A 3B0YA 1Q8IA 2VUNA 3I3EA 4ONVA 3TNBA 5HMDA 1WTBA 2OX4A 4JAWA 4ZEPA 1GQKA 4MFEA 1VYSX 3BQ6A 2FTWA 1HBNB 3W83A 3LWMA 1EHWA 3VDAA 5D15A 2W8KA 4NLSA 5FL0A 4EAMA 1KXTA 1SQ7A 2XMMA 4O14A 6AT1B 2JZ5A 5F2IA 1QUVA 3TZYA 4OJYA 1RWKB 1WO2A 4XUYA 2C2RA 5IT9Y 1VEOA 3CO0P 1EOKA 3F4CA 3MECB 1GW9A 4BKNA 2ALYB 2G0CA 3MM7B 1RAAB 2HQIA 1M5SA 4WTOB 1ZP3A 4X0VA 3GD6A 2BDQA 4WKRA 2OSWA 3CJ4A 4UTGA 3MHUA 4GO7X 5KZDA 2BFGA 3DOLB 1Z3NA 4MKAA 3RAQA 1LG2A 3VE9A 4Z0JA 2CLFA 2YKQA 2N7CA 6FDRA 3TJAA 3G6XA 1CXLA 4AD5A 4GI8A 5C42B 5HNNA 3LPGA 4S0MA 5GVJA 4DYKA 2J8FA 6TAAA 3Q89A 3CJKB 2CPFA 2G13A 1UD8A 3QKZA 1FKOA 2VHGA 2FHFA 4HSNA 2HNYA 2X42A 1J5OB 3HD1A 3O6YX 4EEYA 1OG0A 1M1KT 5FDLA 4RDZA 3LPPA 4RO0A 4I7FB 4Q22A 3K8VA 2MKSA 1FJCA 3C2FA 4KERA 3QZAA 1ROFA 4M1RA 4WZQA 4NCBA 1KFDA 2XS7A 2QLFB 3CCRS 5C9RA 2XLKA 2C3UA 3K57A 2HFZA 2BKOA 1RT5A 4U5IA 2OMOA 2DCLA 1YLXA 4NX0A 1JB0C 1U24A 3CMJA 2H5EA 4CIOA 3GVVA 4XAGA 4CQBA 2ZICA 4JFTA 3M9MB 2AD9A 2CWNA 2BA9A 2Z0IA 3OG2A 3IUDA 1BYBA 5DY3A 1YJ7A 2P3EA 1MWZA 1RT1A 2A3BA 3NQEA 3J81U 4LH8A 2Y5JA 3GTHA 2IPWA 5KETA 1BQCA 2WVVA 1QW7A 2XB2D 4DV5F 1B1YA 3ENLA 1FWTA 2OQLA 4HTIA 3IIOA 4FPSA 4U95A 6TIMA 4HPJA 3T78A 1FE0A 1UWBB 5IFMA 4TR9A 2BOFX 4OV1A 1OT2A 1EEXA 4KQNA 3FMBA 5KFAA 2FJEB 1P0KA 1WDPA 2OEJA 1HO4A 2VICA 4PYSA 3DYMA 3M05A 4JI2F 3EXYA 4I6KA 2CPHA 1U8WA 4KGKA 3UPFA 4HHHA 3L65A 1TCMA 1J5EJ 3PZPA 4DSEA 3S2JA 4GCAA 1IXPA 1BE4A 1P9QC 4JY8A 1S12A 5I09A 2IRUA 2VG5B 2XMUA 2R8HA 4J4KA 2FC8A 2XIQA 2HHSA 2HPIA 5E0KA 3OTEA 3RTVA 2DZSA 2B4VA 1LEOA 4PUOA 1ISWA 1XWLA 5DLFA 2BOPA 5D9PA 2ROEA 3U2CA 3PX6A 1GVRA 3VI2A 1ML1A 4ICMA 3AO0A 1W2PA 2BANB 2JLEA 4C8KA 2BTMA 5EMLA 4Q8FA 3RPDA 3U1LA 4W7WA 2V0NA 4P7NA 3O44A 2BOEX 4HVZA 5CC5A 3G87A 2CBUA 5KG6A 1JFXA 3FBEA 2PLJA 3VU2A 2CNLB 2JK2A 3QH2A 3WBZA 4WFBQ 3US5A 7AT1B 1NKBA 2BS9A 2OWXA 3TTEA 1SJ3P 3FQLA 3NJ3A 3RPMA 1CPUA 3ZTPA 1XYCA 1NXIA 4NLVA 1LK7A 3NM3A 5MF5A 2F7VA 2HS4A 3AXKA 3F1QA 3LNMA 2DJXA 4FI4A 5HROB 1WCGA 3SFUA 1RZMA 2ADAA 3T81A 1EUAA 4P2XA 2P3ZA 4W5ZA 3RB3A 4PCPA 3MF5A 4FOUA 2EPLX 5CAAA 4GKLA 3FX4A 2RH3A 3BYPA 1JMTA 1M5VC 2NXIA 1VYPX 5B0BA 3ZWSA 4BF9A 1WE5A 2D0FA 4XZWA 1OGBA 4RW9A 4GX8A 4DFJA 2HBZB 4ADSA 4QJ5B 2QX0A 1N2VA 1PHWA 3BBFA 1EIYB 1LRNA 3NDZA 5BWAA 4NI8A 4PUWA 3GC4A 1UP3A 3A3PB 4IJCA 2MQMA 3SY1A 2Y85A 5D2XA 3WUFA 1NNDA 3KTCA 2CXEA 4GGBA 5CPTA 5U4NA 2YKMB 3IGVA 4ES3A 3NAHA 4W8BA 3SYZA 1BD6A 1N32J 1UQZA 5D2YA 3PY2A 3BICA 3IWXA 1NWRA 2W92A 1TKTA 3LW5C 3I9ZA 2Z2BA 3GH7A 5A6AA 3Q65A 4PUEA 1LT8A 4B3TJ 5MLCV 4HNOA 4K36A 4NU7A 1T7LA 4K2XA 4F4WA 2JEJA 1PPIA 1VBUA 3U48A 3UU0A 5BRPA 2NUHA 1P0NA 4DV0J 4AWUA 2ZNYA 3DFNA 3W1AA 3ZJ7A 3DI6A 1NEYA 4OL8A 1FTXA 3M9YA 1OY0A 2G3MA 1N56A 3QOKA 4RE3A 4ZOBA 4OMFG 2GIFA 3NTYA 4DCJB 1SGJA 1YE6A 1Q13A 4N9BA 3S5NA 4I68A 2LEBA 3SCVA 2EC2A 4KGJA 1XIEA 2E6DA 1KVKA 5F2GA 3CT9A 4NLUA 4M82A 4HHMA 4WYLA 1QHZA 2ZWYA 3BARA 5DT7A 3B97A 4XISA 4UTTA 5K5MA 3MOJB 2VOOA 5F4WA 3CHFA 4BS0A 5CSSA 4X2BA 1KNWA 2FVPA 1HMVA 4FKYA 4ZFCA 3G1XA 2VVSA 2NQHA 1UROA 4GFSA 4KWSA 1FKPB 4O11A 2YCLA 2EFQA 4U31A 2Z1BA 4LS2A 3NQGA 2KG1A 2Q1LA 4XO7A 5HPCA 5DQGA 3SIPB 1YNPA 2JRSA 2GJLA 2ZX5A 4MZYA 2F9RA 2KH9A 4DFPA 1JVNA 1VFSA 2ICSA 2I16A 4F2BA 4Y9PA 5EL1A 2YSWA 4ZPCA 1S4FA 2XVPA 1RLCL 1ODUA 2Z4PA 4IFVA 1E72M 2GJXA 2ZH4A 3WJSA 2YKOA 3HBLA 2GV1A 4JFUA 2QG9B 2GLKA 1E56A 2OTJS 5B7ZA 3BJSA 1RT3A 4A3HA 4O1BA 1VD6A 2WMFA 3ABQA 4PH6A 2F4VF 2KM8C 2OWCA 4DWSA 3BSAA 4H4IA 1R85A 2QVNA 4U10A 3PSWA 1JXVA 4PB3A 4CCHA 3VM7A 3CMAS 5J04A 3Q2DA 5K3VA 4I64A 2Y0FA 3V6DB 1TKXA 1T3OA 3SUVA 4LX4A 5HWNA 2DW7A 2DGSA 1ONXA 3B0PA 2VMFA 2AJFE 3LU2A 2RDUA 1VLWA 3V1PA 4UTUA 2LDYA 1AUSL 1BVWA 3WUEA 3MEGA 2OT0A 1TKDA 4ZB5A 1CBGA 2RKIB 1GOIA 1W54A 4NWBA 2E5IA 4YB1P 3CUXA 4LFYA 4KT2A 3R8HA 5HQ8A 1LWCB 4G2DA 5A8OA 2WCXA 4RW7A 2PTYA 2VU5A 2DR8A 4LQ1A 3HJFA 3HV9A 1QBAA 2XZTB 2OSXA 4GQQA 4PB5A 3DUGA 3PFOA 1E6VA 3PK7A 2NPFA 3R7MA 5KT4A 3R0DA 3A6OA 4FXJA 4PTWA 4E4PA 5A94A 3BSNA 5LMUF 3U02A 2XVLA 3U9IA 4HU0A 3VUSA 1XC4A 1AK5A 1A3WA 4C8LA 2NV2A 3CTLA 4LIRA 4CQDA 2V8VA 4CQCA 3CHEA 2QTWA 4ZQCA 2NXUA 3VOCA 1B3VA 4FVMA 2HE8A 2CJKA 3GYNA 4MHBA 2V5JA 4OX7A 4YN5A 3C52A 1IJFB 4OWGA 1B54A 1SFTA 2YW3A 2KZZA 2D3NA 2UWFA 4MY1A 4POCA 2GJ2A 3ZZ0A 5DG8A 1T5AA 4ZVGA 3MGJA 4TYBA 1ZJIA 2PA6A 2V63A 5JBFA 4R88A 3UI3A 2YFNA 3CQHA 5GAGI 3VCDA 5FIPA 3GG0A 1U0SA 3M6WA 3KHJA 4B3SF 2AGKA 3HGRA 2KFNA 2WYSA 1XW8A 3GH5A 2HFNA 1QK2A 2IMWP 1YBUA 2ZRUA 4Z2GA 1Z89A 3LUYA 3VAVA 4DLEA 2B6AB 2AAMA 2MZ1A 1R3QA 1I51B 3THUA 1IUJA 2AL2A 1U2FA 3KBNA 5C54A 2Z30B 3ALFA 3DAQA 2AF6A 3G6VA 1JL8A 2UUCJ 3TQKA 4R85A 3MAQA 3W7PA 3Q4DA 1Q86T 1ME8A 2AZ3A 4IXXA 3TA6A 3RBDA 1OABA 1B9ZA 2NUYA 1VLOA 3GPAA 3NY0A 2DNGA 1WXZA 3BK0A 5FF7A 2ROGA 1KR4A 1TUGB 3RU0A 4KWVA 2HNZB 3NBPB 3V6KA 4UTTC 3AAMA 2WKLA 3P82A 3KXQA 2WKJA 4YY3F 1FFGB 1UVJA 1XX1A 1XEZA 3A4WA 1M1GA 2GUUA 3POTB 2ACQA 3UCUP 3R25A 4DV3F 1PAUB 2HZCA 1VJSA 5F1VA 1VPQA 4H9XA 4OQVA 3M8SA 3TOPA 3PVFA 3VV2B 3M2RB 3WD4A 4UCFA 4RDWA 3LBOA 2ZZ7A 2PDMA 2PA8D 4ECTA 1SKRA 2ADBA 3FSXA 5KG3A 1NM9A 4WIQA 1ZPVA 1K7EA 2VPWB 4EO6A 3WD2A 1FXRA 3HPAA 2NYHA 3WH9A 3LV6A 4DXLA 1GKQA 4HCLA 5AB3A 1HNWF 4RDVA 4DJDA 1FH9A 2WZHA 4JX4A 4N02A 3I0SA 2F61A 1Z4UA 3QKEA 1C4AA 4CCEA 4R3UA 4DWSC 4I2PB 5HN0A 3PTMA 5C25B 4AVOA 4URSA 3LCIA 3W7BA 1PJ5A 2FLLA 4FA3A 2X7WA 4NAFA 3FN9A 3GIQA 1UWQA 2JC1A 1V9OA 4A8QA 3EKZA 1W1TA 4C6PA 2HWGA 5HINA 3GCXP 3OBIA 4LAZA 2XSJB 3PYDA 3RB0A 1SXLA 3L0NA 3CIXA 3KJNB 4M81A 2FIQA 3JAMY 1SO5A 3NDOA 3C2RA 3GP9A 1M9HA 5J5DA 3FFIA 4IOAQ 7REQA 3CJQA 4IRCA 1ZBVA 3GXDA 1RWNB 4NRUA 4HACB 4G1QA 1T9TA 1A0OB 1YDNA 4FNUA 1S1RA 4O23A 1JCTA 1S0VA 4K0KF 1VAHA 2W2MP 3J7YU 3WF3A 4NMLA 3LB0A 3SEOA 1HI0P 1ICSA 1X31C 2R82A 3DHUA 1W9DM 3UP8A 4Z2HA 3BG9A 4PXDA 5EB8A 3CZGA 3W1RA 5EU9A 2HBXA 3EPIA 2ZZ2A 1PBAA 1JWWA 2E66A 4H6EA 4CH0S 4ECSA 4HYKA 1S1VB 2FJBB 5DG7A 4QLJA 1A9NB 2IY5B 1RQ0A 2WAGA 3FJ4A 3U0HA 4MIBA 3FQKA 3UZJA 4AWTA 5CG7A 1U33A 3BPDA 2IDEA 3BLEA 3LRLA 3FFSA 4RU9A 3RX4A 3AHVA 4ZDNA 3UVAA 3WNOA 3APGA 5KT5A 4Q45A 1XLAA 2E5JA 3D67A 4PXEA 3HB9A 1VBHA 1CDGA 4CN1A 3ENVA 1ZLPA 1GX5A 4Y7EA 2W2PP 3RR7A 4GO8A 3AS0A 2TPSA 1ME9A 1O5XA 3BDKA 1SPBP 2K1RA 2DYAA 2QJJA 3L95X 4A8OA 2HK0A 4HU3A 3VK5A 3UJFA 3GS6A 2LYVA 4ID5B 4X4SA 3CPWR 1IXOA 1QSLA 3GSDA 4PTVA 4CNOA 2OMLA 2R42A 2DZAA 3PX4A 5AJ3J 1GYLA 1GZJA 1LW0B 3HFKA 1H0IA 4FNQA 5HP1B 2HZGA 3CB8A 4ATWA 2I5JA 4DSJA 3QGVA 5BOFA 4C7GA 2MTLA 1LQAA 3P93A 1F60B 5J2PA 2AMCB 1B3YA 2V2QA 3FSUA 4MKSA 1UAWA 2P53A 3POCA 4JOUA 3H12A 3W7CA 3W62A 3B6BA 4HOWA 1N6QA 3EXTA 4LNYA 4LF4F 5C7VA 2WONA 4DDFA 3R2DJ 2YLAA 4DAIA 3UW1A 4E0CA 5BXRA 4KJIA 1PYTA 1KV8A 3MO4A 4X64J 5AE3A 5E1QA 1YX2A 3M5YA 5BZAA 3LHVA 1QMLA 1RISA 5DO2A 4DR2J 4G5DA 1W3LA 3W23A 3WLRA 1KLNA 5EBUA 2X1BA 5KFPA 1MEHA 2VOTA 2OZTA 4MVAA 1W37A 3ZSTA 3TK7A 3N0VA 3RILA 3OPKA 2J24A 3V6JA 2UP1A 2VURA 2X09A 1JJ4A 1QPKA 3GLJA 1S1UB 5FEXA 4H19A 4DQSA 3CL8A 4ZODA 1GXLA 1WXJA 1TFYA 1XR7A 5GJPA 4DR3F 3W88A 2XY6A 3ZVHA 1OD8A 3R6LB 1VBZA 2AYGA 2OPRA 1LF1A 3ISZA 3MM8A 1XLLA 3FIGA 4M6QA 3A9BA 4Q8QA 4J3TA 4C2MA 4DV1J 4B9SA 2WVEA 1VC6A 3H5UA 3LLFA 4M5GA 1FFSB 4ICNA 1HGYA 4QM1A 1L3UA 2NREA 4GI4A 1UUQA 3NOEA 3IFEA 4DJDC 3BAKA 2QAFA 2JVRA 4P73A 2G4BA 3R94A 2CQBA 1V03A 5FF3A 3PEJA 5CSUA 1VFTA 2TSYA 1AMKA 3RFAA 1GQEA 4WY0A 3T1GA 3S6EA 2ZE3A 4DXXA 2MUCA 4L5ZA 2BSLA 4NZJA 2PDHA 3T6CA 4NZ6A 5A6PA 1DBTA 1QNOA 2PDIA 3QPZA 3VDGA 3NQ2A 2OI2A 3ILOA 3EOOA 5AYBA 4C8NA 3T42A 2QYGA 3UR0A 2VFGA 1TV6A 5D37A 1S79A 3TZNA 1TIWA 4ZLLA 2FLIA 2KU7A 2L08A 3E12A 4JHOA 4KHPF 2DBBA 3W76A 1MMLA 4LB3A 4KE5A 1JCMP 2OPSA 1TV4A 4RR4A 2IM3A 2VM8A 2OPQA 3IGUA 3CDEA 1PG5B 4TVAB 2FJVA 3QJLA 3MV11 3OVPA 2WC4A 1N82A 4CO2A 3M9NB 3KVMA 3HM9A 2NXHA 1W2BR 2HMIB 3L4YA 5TBOA 1HQTA 3N9RA 1RAHB 2YPYA 4HI2A 3LPYA 1ALDA 6ALDA 4B5SA 5I03A 2HNDA 4WOZA 4IG0A 4WQ6A 3S2NA 1ZTTA 3JZUA 4EAYA 4JIRA 4QPTA 1CI1A 3QOMA 3VA8A 2V6AA 1SZNA 4LPCA 1TTPA 2W2QP 1I75A 2I17A 4FAMA 4ZN1A 3KUEA 1V5VA 5CBIA 5G0RA 1N8RT 1KRBC 4C6OA 2QJHA 3FK4A 2PMQA 1O1HA 5CC6A 4WLCA 3QR1A 3OYXA 1DV7A 2Y61A 1HR0F 4K3ZA 3OHBA 3G1FA 4DR6J 4DBWA 3GUGA 3M5XA 3MI3A 4L9ZA 4PTXA 1C1BA 4C3MA 1T05A 2YR1A 1B3ZA 2PGCA 3VVUA 4F67A 4H6RA 4HK6A 4H8VA 1TL5A 3K1DA 1DTTB 4O0KA 1XBYA 5F8LA 1K6WA 5E0OA 1SL0A 1CULA 3R4IA 2ZOGA 4ECQA 4AD3A 4C0HA 3TAMA 1RHJB 1FO1A 4OI2A 1N5YA 2ZCGA 5ITHA 3MUXA 3G3DA 1KD0A 4D6JA 2P8BA 1H09A 5CJ5A 1AW0A 4P8UA 3MBDA 5FOOA 3SCQA 3AWOA 3JB9k 3BC9A 2VPXB 1IIGA 3V16A 1SC1B 4JI8F 5U7SA 4QG9A 3TA9A 3IR5B 4FEZA 5D8HB 3VD4A 2DV0A 1B3XA 5ECVA 3R5DA 4ORIA 3RRGA 4V28A 1X60A 4IMCA 4IG3A 2NLIA 4RW4A 5I6SA 1JPHA 2V94A 4GMEA 2VH7A 3QAEA 3LD5A 1IQZA 1WF2A 4LVNP 1UR4A 2WCAA 1O5RA 4ZL1A 2ABBA 1BUXA 4JKKA 5CXTA 4Z08A 4EACA 4DU8A 3T4WA 2IBOA 1CEOA 3C3LA 1UUMA 2A2IA 1RWOB 1IEXA 3E49A 3DGBA 3LCHA 4DR4J 2FLPA 4P9SA 2JFDA 2FJKA 2HVIA 1HBOA 2YGYA 3GZ7A 4CM2A 4D8LA 3HHDA 2HRTA 4AG0A 3UCQA 3RLUA 3ARYA 3CCSS 2GFTA 3MMDA 1YIXA 4JR5A 5HBMA 5MAOA 3N6JA 3N6HA 4B3RJ 1UR1A 2NWRA 4Y9NA 1V3ZA 1NJJA 4RV8A 3N11A 5I78A 4O0ZA 3ANYA 4DIAA 2B4GA 2RRBA 3P3BA 2I1RA 3HSGA 1TPC1 4J28A 3DLKA 1DXEA 2CVIA 1TQJA 4DPQA 2CZFA 1PKNA 1XK8A 8ATCB 3NEHA 2MPUA 3NGRA 4WE1A 2ZH9A 2AKWB 5J2NB 3VNDA 2Q79A 4UTHA 1VQ4S 3OLGA 1MO0A 1BSLA 3URAA 3UXKA 1WKDA 3EWGA 4KO0B 1T40A 3L3CA 5I4MA 3BSMA 2A3JA 3VIJA 3SRFA 4KCUA 4B5UA 2G4FA 1WB0A 4ES1A 3HHLD 2E9MA 1DORA 1GZGA 2YA2A 5DMYA 1P27B 3N4FA 2R7TA 3CC1A 3Q0AA 1DWGM 3UWUA 1L3TA 1Y00A 2J13A 3GFZA 2CJXB 2V69A 1WC5A 2DXEA 1AFSA 4MYAA 3NM1A 2VCAA 1U6BA 1PIIA 2W79A 1FY6A 5ETTA 1HKMA 4J3ZA 3UWEA 4FF5A 4O4VA 1HKVA 3D6NA 1LOQA 2YJQA 1O0PA 1DZ5A 4KR0B 3QTGA 2VG7B 2VQFF 1JGIA 3VKBA 2QHAA 1JDEA 3BLKA 4RNHA 3W84A 3WDJA 3C8NA 1BFNA 3TONA 4WKYA 3P96A 2E29A 4HPXA 4WDWA 3OVGA 2YB1A 4ERDA 2VZSA 1R0CB 4FX7A 5E41A 3LXBA 3O2IA 1IKVB 1YADA 4JEQA 2CUYA 3OQ2A 5E6YA 2FTYA 3IARA 3LSBA 1Y5LB 3FXGA 5KFHA 1KBIA 3GW0A 7ODCA 1JPMA 4Z1BA 5DXYA 2RQMA 3ALGA 2O1PA 4PBGA 3CDBA 2QEZA 5IC6B 1NWSA 1XXXA 3H4BA 1TWSA 4JNYA 5IQ6A 3RRHA 1G9HA 4JKMA 3W07A 4GVBA 3P5ZA 3NKYA 4DS5A 4FF4A 4ACYA 2BJ8A 2YKAA 3T8QA 1GKPA 2VQTA 3PJXA 4BQ3A 1UEUA 2E5HA 3PG8A 4IO1A 3R6IA 2FTPA 5FKYA 4DPPA 2AQVA 1EWDA 1NZ8A 2B8QA 4D3HA 2FH8A 4P7QA 2NXGA 3OA3A 3N12A 1VQSA 1VQYA 2FGLA 4NXSA 2A85A 3EZ5A 1DJGA 3EOEA 2DEIA 3FUYA 2Q3RA 3A8KA 3OTCA 4OQJA 1LCOA 2VD9A 4XZHA 5DF0A 3MMCA 2BASA 4CYUB 3T1YJ 4S2BA 4UUIA 4GKKF 1UIOA 3ANVA 5JVGQ 3VALA 1OM0A 3E96A 5FL1A 4RJVA 2OGUA 4QPXA 3MHGA 3WMSA 2FJWA 4QWEA 3V75A 5AC6A 3A1YG 3NXFA 3ISIX 1SPQA 4K4UA 1E4MM 3M8RA 1N88A 5A2CA 1U1OA 4GC4A 1UFLA 1BMQB 3QATA 3J81Y 2VQEF 3SIZA 1EXPA 2NLYA 4IH6A 1GWJA 3LOUA 2DUZA 3OFFA 2WPBA 4Y3CA 2D20A 4F4XA 1N34J 4DUWA 4IOTA 4PRRA 1N5SA 4ACZB 3PUDA 1T9WA 1LLZA 1YTEA 5D0EA 1MRAA 2J78A 4KIEA 1NDZA 3UN3A 4W92B 1VQNS 4PMUA 2M9KA 3GXPA 3PPFA 4DX8H 1UR8A 2Q09A 3WF0A 3MMBB 2QIWA 4ZVOB 3EA2A 3GTFA 3F2CA 1TR9A 4KCWA 3KLLA 4YPJA 1PKLA 3PW0A 4WX2A 3ZZZA 4A8XA 2WPGA 3IVUA 4D6HA 5FEPA 1YBAA 3TZWA 4Z1YA 4I6WA 3XISA 4L72B 1NLKL 1X5PA 4N8OA 3L4VA 1JKHA 4F26A 3C15A 3PXGa 3E6EA 2XMWA 4A8LA 3TW6A 5KG7A 3DGVA 4LF9J 4QWBA 1M41A 1U1JA 4FZIA 4ZP9A 1JPDX 1WKJA 1E6PA 3L0KA 2BB0A 4QLKA 2R91A 3AWNA 3TRGA 1E9ZB 3RGTA 2HBQB 2V2ZA 5GJMA 1TPH1 4PRFA 3KWXA 5KFZA 3F03K 2D7SA 3OBEA 1TA3B 4CT8A 4PWUA 2J5AA 3BR8A 3N2XA 3RDKA 3EM1A 1Y65A 2H4YB 4ZVSB 1IXKA 4LCSA 4Q4SA 4GABA 1Q79A 4JI0J 3R7NB 1PX8A 3HURA 1RA7A 3L7UA 2XFYA 4Q8MA 3SN1A 3MI7X 3TC3A 3U57A 3GUWA 2C79A 2CLOA 1SW0A 4WF7A 4ILRA 2ATCB 2QMUB 2ZDPA 3GBDA 4ZOCA 1H49A 1B0PA 5I23A 4ED6A 1VFHA 2UXCF 2RUGA 1KQYA 2DEPA 4IP7A 1XP3A 4IFYA 1U1QA 2JF7A 4Q4OA 1IQTA 3BLPX 4LAUA 2IC3A 3WX8A 4LYQA 2IXVA 5CPQA 5HUOA 1J0ZA 2FKPA 1CJUA 5CA5A 4DL3A 5CLWA 1JIHA 4C65A 1E9LA 1GYMA 4F48A 2BKNA 4EPBC 1P1LA 3AYSA 2ZZ1A 3L4UA 4LUTA 3WNNA 3GM8A 1CPZA 2V5KA 3C16A 2VR4A 4URIA 1Q6RA 3LHZA 3N5BA 2X41A 1R86A 2BY0A 2OTDA 1I1GA 2B7QA 4PFMA 3PS7A 4ZJLA 3W2JA 1BWEA 1MYRA 3G0SA 2ILYA 2DT1A 3D0CA 4U3AA 3VGBA 1KA9F 1TRDA 3MFHA 1RT7B 2GQQA 4P7VA 2NV1A 4AL6A 4XSLA 2I1OA 3OFGA 3MYOA 5C2CA 3L2IA 3ARXA 4J9MA 4CNTA 4AZHA 3I56S 1UCNA 1SO4A 3QQCD 3ZJ8A 3S1GA 4UOZA 3LNPA 2PRLA 1DIOA 2F84A 2ZH2A 4B3MJ 4QIUA 4WXYA 2PD1A 3OTOJ 2MZJA 4ELUA 3CBWA 4WVXA 3TUUA 2GJRA 5B0EA 3BDEA 3TR9A 2F6KA 5D0GA 3EX2A 4TY8B 1Q4NX 5C2GA 2A3HA 4DQWA 2HS0A 5KAKA 1D3WA 4UMAA 3CLWA 4Z0SA 5BW6A 3CJ5A 4FYDA 2INFA 3DOKB 3TWBA 4AVFA 1WA3A 2CZDA 5KT6A 5DLGA 3PHAA 1WDDA 4MB4A 1QHOA 3E74A 4I0WA 2DR9A 3HVTB 3G3MA 4CNZA 3BGGA 1PKUA 3ZNJ1 1XJBA 2LA6A 4BBYA 1UP1A 1KFKA 4KY3A 5C9XA 1T9YA 1YRRA 3TZZA 3DFSA 2EK1A 2H3EB 1K7FA 1SVDA 3R5EA 1KHWA 4ZMGA 3NXZA 3OW1A 5B0DA 3NEVA 3RNDA 5IWAF 4N7QA 1N8FA 4OX6A 3LOTA 1TVRA 1ZJHA 1TU0B 1ZM2A 4UOJA 4YHHF 1P9YA 3T4CA 4BLGA 3MUIA 3MANA 4MDOA 4O50A 1FTRA 3I96A 2R7SA 5HXMA 1KM5A 4QSFA 4GKJJ 2DZPA 4IJRA 3MT1A 5CJMA 4XBJA 3SSJA 1LWEB 5JVLA 2F8MA 3UCCA 1HNVB 2LP4A 4OZNA 2ZH7A 1AZSA 4IWWA 3M2UA 2AMXA 1EJWC 3S6TA 3LYEA 3CJ2A 2HWTA 3E38A 5F8MA 1HQEB 2EO7A 5RUBA 1GAOA 2PEHA 3MMAA 2N4DA 3MCMA 5HO4A 1EJSC 2X1AA 1DWHM 2IHR1 4OVXA 3QBUA 3V5FA 5G2HA 1ZZMA 3BJTA 1UWTA 2DNLA 4RW6A 2QCCA 1NWUA 1DJZA 3QZ7A 1FHVA 4OFZA 3BR9A 3BKUA 3SCUA 3ZTQA 1YTDA 1WC6A 1KB3A 1QW8A 1TPB1 2WSEC 4WFXA 4C8OA 3E5BA 2YA1A 4TMCA 5HMEA 1SQEA 5C71A 3TP4A 4AXJA 2IJNA 3EVWA 4LVFA 2XZ7A 1HFEL 2GJIA 1C8VA 3SQMA 7FDRA 3JXOA 1UWAA 1K9DA 2FZNA 3KK1B 3DBPA 1V77A 4UFKA 1YJRA 1YMYA 4KH2A 3HTWA 2GK1A 5JMUA 4HPHA 3QLHA 1CC8A 4DM2A 9RUBA 4A3QA 5C9WA 2JH3A 3W29A 2E9RX 2MJNA 1R6WA 3STFA 4XZ9A 3D0IE 3NOGA 2ZDOA 3KOYA 3N28A 1MXSA 1WG5A 1SV5A 5F41A 1DJQA 4IUOA 3DLBA 1O1ZA 1W9UA 5ECUA 3S47A 2ABYA 4RZBA 3ABOA 2IS7A 3CC4S 4F4ZA 4WSKA 5I3UA 3O6CA 3F4DA 4L64A 3MCSA 1WOPA 1S0NA 2RDIA 3Q37A 3NZ1A 4P2VA 3QT7A 4RZ6A 3DYOA 5G1TA 2OO4A 2YPZA 4X84A 4CLTA 2YKNB 3KNAA 3HO1A 5AC5A 1Q4WA 4WYWA 3NPUA 3M0JA 4O54A 1U25A 4TQRA 1V6XA 5E0CA 2FPHX 3S4TA 4KTQA 1X9MA 3RJYA 3SQSA 3Q94A 3BBBA 3MM9A 1KGUA 1TL7A 5JMNA 2W4XA 3CD5A 1J01A 2PT0A 6REQA 4LQ3A 3FZ2A 5EFFA 3AT1B 1K9TA 2YWHA 1IM6A 4NXMJ 2DZXA 3CPUA 2BJ1A 4CD8A 1UH2A 3K13A 4PN2A 5E3AA 2REQB 2FHBA 4LIWA 1RT2A 2ZX6A 4DNMA 3CV1A 2VFTA 1AL8A 2JIEA 2C1EB 3KW3A 2GQ3A 2CZVA 4J2PA 3HKZD 4DV4J 4M0XA 3AOFA 3HFZB 1JLAA 1TKZB 4UTFA 2Q02A 4C6LA 3K89A 3PYFA 2PDAA 3L4XA 5F2MA 1CJKA 1KOOA 3W7DA 5ETPA 4DPYA 1HP5A 2DH8A 2QCMA 1KFEA 4UQAA 1EETB 4L4MA 4UFHA 1QASA 1I60A 3M7WA 5DZ6A 2X0YA 4I4BA 4DR5J 3M0LA 4F25A 3TE9A 3U7BA 4NAEB 2DH7A 3NGKA 2Q43A 1WNOA 1B31A 1G67A 1EZZB 3W64A 2NZ4A 1HBNA 2WZTA 4AD0A 3IR7B 4O1EA 1PO6A 2DD8S 2CPJA 1SZRA 2DVTA 1U1HA 1DY3A 4G1IA 3KHDA 4PTMA 1ITCA 5D8WA 3KFWX 1TB3A 1UA1A 3RBZA 3PFRA 3DMJA 4X65J 3CB3A 2C1IA 3RO8A 1O6IA 3DOMB 1IIHA 2Z1WA 4PMZA 1Z48A 3PRVA 3L67A 1MN7A 2RHGA 4O1CA 4JTKA 4CO5A 3MECA 3MM7A 3THTA 4CEUC 4JNZA 1C4CA 1W6TA 5D05A 5BOEA 1FVPA 2Y0BB 1H1YA 3IS9B 4NCGA 4A6GA 4WSHA 1XCXA 2Q01A 3QM3A 2V3GA 4FF7A 3QHNA 2YX7A 2GVYA 1YEYA 1X4EA 3CJSA 1RYSA 2EBEA 2X7VA 1M5HA 3WDIA 2OPPA 1NMEB 5C42A 3M6YA 3CGIA 1HQ2A 2DEJA 2MKKA 3CO4A 3L7OA 4EMDA 5D78A 4G7FA 3CJKA 2QL9B 3W4RA 4CLKA 3SADA 4NASA 3RCNA 5G1MA 4E8GA 1Z2ZA 1IJEB 2W25A 3GXIA 1W1PA 3QY8A 2ZRXA 1J5OA 1MNSA 1E73M 2QW5A 4IP4A 2H1YA 1RE1B 4AHOA 5CHCB 3K0JA 1R38A 4I7FA 4BF5A 4IIFA 1HL9A 1UC5A 1OFRA 1GW1A 1ZY9A 1JQVA 2ADCA 2KXFA 1OVDA 4LCQA 2ZADA 3UDEA 2G96A 3M0VA 2C15A 2J88A 2WSQA 1S6QA 3WH6A 3AQUA 1YLVA 4Q7IA 4MYTA 2ZBCA 4WF9Q 1ZS2A 1E70M 4YVPA 3CM4A 2AQ4A 2ON3A 4GO9A 3WZ0A 4B3OB 4YR0A 1W5QA 4L1WA 4Q8NA 4UZSA 2VCBA 1MDRA 1P1XA 1SU5A 1FKWA 1K8YA 3A3HA 1FWRA 1BKSA 4AT1B 3LAMA 3ZTRA 2IJFA 2WTFA 1KTVA 3OR2A 2OZ3A 4HD5A 1HNZJ 2LQBA 3GXNA 2X1IA 1S2VA 4BI6A 3KVJA 2Z1KA 2L9DA 2A7NA 2YXLA 1Y0HA 3ZS4A 1N5TA 1UWBA 3PYEA 1FNXH 1B90A 1J4EA 5F8JA 4KAIA 2M2BA 1XH1A 1GOKA 5FA5A 3GJTB 2R2SA 4W89A 4F36A 4KRTA 2HAFA 1NBEB 2V4RA 3BAYA 1C90A 1DFDA 4QLLA 1FFWB 4J37A 2KI2A 1TX2A 4A35A 2V81A 2KHCA 1G3OA 1S9GA 5CYJA 4C6NA 1XLCA 4HNNA 4GGHA 1F9EB 2DZBA 5BXPA 2A3LA 1T9XA 3T2PA 1ICEB 1MQPA 2VL4A 2J7GA 4LOCA 4YXGA 1FWPA 1ZA2B 4I56A 4I7WA 1TJPA 3PACA 1KCLA 3TFCA 2RHQB 4X4OA 4WDTA 3JW7A 3U5YA 3W5ZA 2DSVA 3DFYA 1RP5A 5T8GA 4IQJA 1NEEA 3EWWA 4IUFA 3HF5A 3F4NA 3W1LA 1XCFA 4B3TF 1CTNA 2CZVC 2C2ZB 2XIJA 5F9NA 1T03A 4Y8FA 2F6UA 4LAKA 1A5NC 1OJXA 2J27A 4K8EA 2Y7EA 1VFLA 4R5EA 5CC3A 4AC1X 1RAFB 4DV0F 3GKFA 4O17A 3DI1A 1HW9A 1VK8A 2H54B 3KEHA 1Q53A 4QNEA 2DIVA 2BHZA 4MWAB 4P8WA 1JIBA 3GWQA 2HXUA 5IFTA 1F6PA 1RI7A 2VGGA 2YQ3A 4GOAA 5HROA 2GO9A 1W3NA 2CJQA 4A8YA 3QGKC 2LEAA 4JI1F 5BCAA 1RHMB 3C0LA 5TD4A 2C42A 1EHAA 3PM6A 1RT5B 4NL5A 1V6VA 2VC9A 2GVJA 1H7NA 3F2BA 1R3VA 3LF0A 4I9TA 3S7RA 4RU2A 2V5CA 3NGSA 2A6LA 1DJ0A 4UF4A 2ZBIA 3ZZUA 2GQ2A 3GK0A 2F8EX 2MSTA 4LUBA 3IJ7A 4F0HA 5TF0A 4NRSA 2ZH8A 3WBEA 3DHPA 2QV5A 3ES7A 3UZZA 1IN0A 3TVAA 4K39A 5BR8F 1OT1A 3G1HA 1RYRA 1K8ZA 2BY2A 3JR2A 2R7VA 2PTZA 1KDNA 4CDIA 1L5UA 1XPGA 2WVVB 1TG7A 4K68A 2V5LA 5EWFA 1S46A 4OHWA 5F8IA 2J7HA 3EBVA 3ICLA 1H2JA 3TFXA 1R5YA 1WJ9A 2ZZ3A 1OPZA 2F8HA 2CJAA 4FXDA 1QJHA 1H7OA 5KFKA 4GZEA 4RJEA 3VTIA 4ZMMA 5DMLA 3ZOAA 2X8RA 4XZBA 3FNDA 5DM7Q 5CZ0A 4M8UA 1I6NA 1I0DA 3ARUA 2DGTA 3TP2A 1GVSA 1AW5A 1WZAA 3ONCA 1GMVA 3S9IA 1JDFA 3G1YA 1QUPA 5DCEA 1NSPA 5AT1B 4LSBA 2MKCA 2OFJA 3PW2A 3DRSA 1S5WA 5DFAA 2VFFA 4FMVA 4ROPA 2FZ9A 3CQIA 4JTIA 5KG5A 4QX4A 3BN4A 4EZ9A 2RDWA 1O5JA 2LQ5A 3WENA 4EXQA 4PUOB 2ZUTA 4FB7A 1PZ2A 3G1SA 2CU0A 1WZKA 3BO2A 3I0RB 2PWEA 3QVQA 4Q4RA 1IE7C 5HATA 3V0TA 4O16A 3EKLA 2ZKUA 1LZOA 4Y2CA 2ZTKA 3WLJA 1NUEA 4E2DA 4AQYJ 1QD1A 4QR2A 4PWDA 3H23A 4M63A 3GVRA 1Q2SA 3FVMA 2VRJA 3D5MA 4C3KA 1IEIA 3S1TA 2XGPA 3WFZA 1XF0A 3WF2A 3L2MA 3VKDA 2W9MA 4LALA 4LRFA 5CBJA 3MOZA 4D9PA 3HQOA 1IZCA 3CCTA 3P67A 2IQDA 4DZAA 5F8HA 1NDCA 1QPNA 2J7WA 2OFHX 3DHWC 4DELA 2F9DA 4DL7A 1BTMA 2VJVA 4J9QA 4PTNA 1RU2A 4DV5J 1U5VA 2EPMX 1YTYA 1A7GE 3I4PA 2KRRA 1VQPS 3TTYA 2OZ8A 3NNCA 4K2JA 4MOZA 2V9KA 1UZHA 3EUNA 4DSIA 2I9EA 3QV7A 5CPOA 2OYMA 1GH8A 1ZALA 1JLEB 1LWXA 4FYVB 1V7AA 3F5JA 2C0AA 1PYSB 1M53A 3HG2A 4FPIA 1QAPA 5G4EA 3TCSA 2BHUA 4C6JA 4HNVA 4O0NA 3TR5A 2RDXA 3V6DA 1VQTA 3A23A 4JI2J 3T7VA 3SQGA 4EI2A 3WF4A 4ZSUA 4PR4A 4HYRA 2Q6CA 1HHTP 1U48A 3D2WA 2RDTA 2DIUA 1B9BA 5K14A 5LSMA 1VCGA 1RTZA 3LCWA 2VGIA 3EMCA 3VKJA 1EKSA 1K0VA 4KIRA 2PWDA 1NELA 4U5KA 3WL1A 3LGDA 2RKIA 1EA9C 1GZ1A 1UJ4A 4HHJA 1FVSA 2YZ5A 4ELVA 1LWCA 2FB2A 2NZLA 4FNSA 1N8IA 1PYFA 3QWUA 1TKTB 1AJZA 2DORA 1V93A 4DJBA 1U2RA 5I07A 4HK7A 5CQGA 4U7UD 2CAJA 3TYDA 1FX6A 4LWWA 4NE9C 5IHSA 3P5TL 4JX6A 1MWOA 3BO4A 3W9JA 4FBUA 3VAHA 4NX5A 5E7OB 1X96A 4N56A 4KEUA 3DI6B 5K9XA 1ZAWA 1PZ1A 3FHAA 1TZ9A 1Q6QA 1XDLA 2CDRB 3UPWA 1Q16B 3QW3A 2CQHA 1E0UA 5E0FA 2KHDA 3U7JA 1SR9A 3DNCA 4NZ4A 3KLIB 3KK3A 5HLFA 1EQCA 4A8SA 1YKWA 4X9YA 4DL4A 1ONRA 3GSMA 4LVDA 5E09A 3T0AA 3VX1A 4GQ0A 1HKAA 1ULRA 3SJNA 1FNOA 2LXIA 4WZHA 1RJPA 2OVLA 2IA0A 2DXFA 2PP0A 3MB9A 3KRSA 4PABA 4H4OA 4IGHA 1T96A 4MDPA 4ZA0A 3AHPA 1HMVB 4TV6A 3NS7B 3PHTA 1NY1A 1OX5A 1EJRC 3PRBA 4GZJA 1RPKA 5EDWA 2CKWA 3F44A 1ZPTA 2IPFA 3CH9A 4TUFA 4JYAJ 4R9XA 1E15A 3OOQA 3IVTA 2HMCA 4Z1DA 2W5FA 3ZJKA 4QWAA 3CJ0A 2RE1A 5AECA 4QHRA 4MLRA 4B2DA 5LNUA 3U1NA 4KBIA 4NZ1A 2PWGA 3N17A 2CJ9A 4UOQA 1MUWA 3VNZA 1OGGA 3M0ZA 3GXMA 3L4ZA 1XNQF 1XQIA 4IFVB 3WHIA 2DR7A 3VAGA 2GJXB 2R2RA 4JV5F 1LDCA 4JL2A 3BF4A 4WFNQ 3WG6A 2CQ2A 4ZOSA 3MWCA 2XNRA 1JLCB 4ZITA 2JKAA 2Z28A 3BN7A 5H1SV 2EBNA 3IJQA 1ZBWA 4CLWA 2F4FA 4MPKA 3SFKA 5CG0A 4NJIA 3N3TA 1V3IA 4NILA 1S7IA 1RA0A 1XICA 1HGWA 2ZOXA 4Q2LA 5H1WA 1I0BA 1XLFA 3QJPA 4DBQA 4ITSA 1YJUA 1NU5A 1X8DA 4I5UA 2HNZA 1JCJA 4C7QA 3NBPA 5D77A 2DGVA 1SMAA 3EOUA 3QIPA 3VAFA 2L3MA 2ZE0A 2RDDA 5JVHQ 3UYCA 2JJ4D 4KEMA 3S42A 1F2HA 3KRBA 2BGSA 3AMKA 3VDBA 4J3XA 4RW7B 4DO6A 3UEQA 4CD5A 4XPCA 1G4CA 4REQB 1THFD 1X7VA 4OECA 3ZLHA 3B4DA 2AW0A 3ELFA 4GINA 2WVCA 4IRDA 3IBFB 4IMGA 1J93A 1MXDA 2OEKA 3BEGB 3C2YA 4FX6M 3EWDA 3BBCA 2VFRA 1AFIA 3GU2A 1Z32X 2OJPA 5BROA 4M1KA 5KFCA 3F41A 1FDYA 4UTMA 1ZAXA 2YW4A 3M8YA 1BG4A 2DZUA 3PSVA 1D09B 4AY8A 1NAL1 4HH1A 1JF5A 2HK2A 2U1AA 3DDIA 1QRQA 1EHNA 3CAVA 2O7QA 2XVGA 3NO5A 1ONWA 4X66F 2KT2A 3KHGA 3GC5A 1GQJA 1ZM3A 4ZJQA 2CYGA 2BX6A 2J9CA 5LT5A 1G4TA 2VJXA 4L6V3 5C25A 1DQAA 4UQEA 1EX5A 1YDLA 3CNYA 3AHZA 2FB0A 4EX4A 2UXBF 5J5RA 4XB3A 1F9HA 4J91A 3EX1A 3G0UA 3BVJA 3AXXA 5C55A 3DECA 3UXIA 1KNZA 3G1VA 3RM8A 3DU5A 4NIRA 3B8VA 5AJ3F 3EZ4A 5LIYX 5CZJA 1H41A 4H7VA 3R13A 2A2CA 2DDXA 2V3EA 1NK6A 5M2UA 2C18A 1P43A 4LRSA 1V0LA 5E3PA 1O5QA 4JY9A 1IBMJ 4IPPA 1X0FA 2YDQA 4OKDA 4EBEA 1XMBA 4H4MA 1XWYA 1RU1A 3N01A 4XQ6A 2E67A 3VCCA 2Y1HA 2XFFA 4GQGA 3HMJG 2O3DA 4HACA 4QRNA 1V0MA 2AL2B 2CETA 3IJ9A 3WC2A 4ZVFA 5HQEA 4GH3A 2NWSA 5KFNA 1TTIA 3HPZA 3BLFA 2CQGA 1Q82T 2HIQA 5D0HA 4XDCA 1CEZA 4Q8OA 1V5XA 1NQKA 3U7VA 2HXTA 3CWOX 3D0GE 1K44A 3H22A 4AE5A 3BZJA 2EFGA 3KRZA 4Z1CA 3RMJA 4RUBA 1BF6A 5KT3A 1GJWA 3W6YA 4TTUA 2EG8A 2CVEA 4UT4A 3OVRA 2HG4A 1YNQA 3AUJA 5LMNJ 5LMUJ 4O1AA 2EFOA 2IQ0A 2OGJA 1AUDA 2Z57B 1V02A 3G86A 4GZ7A 4ZOAA 1JDAA 4C6BA 2BQ3A 4BDPA 1UKTA 3KBMA 1Y8BA 5D8ZA 3TAQA 1UVMA 2Z6IA 4ZOEA 1XI3A 3VQSA 1C2PA 5B0GA 1XIJA 2J9DE 1KRPA 2JE8A 2MQNA 4MMOA 3E1F1 4K7YA 5HJXA 2HHTA 4JQAA 3IJ8A 2KN4A 5HVHA 5KZEA 2DRBA 3A4XA 4C6QA 1GQIA 1KVJA 4O1DA 4ZPTR 4O3SA 4ID5A 4C1KA 1F9CA 1OZQA 1HZYA 3KX6A 1WDTA 4RKAA 4H2HA 5DY2A 4M24A 2AU0A 4GIEA 1VC0A 1IEQA 1PJ6A 4PQUA 3GIMA 1LW0A 2NCKL 2WHKA 4WP9A 5HP1A 1DWJM 2M70A 5I0DA 4U67Q 4B3SJ 2PDCA 1M7OA 1OCNA 2WLYA 5DDPC 5AOUA 2QN6B 1ISVA 4USHA 2QUTA 3DHXA 2ZJPQ 5E2QA 5FCZA 3EPNA 2E6YA 3UERA 4J9UE 1C9DA 2JALA 1LNQA 1YDOA 2A0NA 2HVOA 5AZ1A 1NDKA 1BAGA 4PUNA 4Q4MA 3DC2A 1V3HA 1VRXA 5LA0A 2XHWA 3OR1B 3B9NA 3TYBA 1NPRA 4MTVA 5DJBA 3KK2A 4JB8B 4IQEA 5A6BA 2FVCA 1KGWA 2QF7A 2W27A 3EWXA 3SQLA 3GG1A 1OFBA 2FD2A 2P5NA 4BZYA 1CB7B 1OC5A 3H6OA 3QGPA 3WLHA 5D9NA 1X5SA 3IPWA 3CDWA 1EH9A 3NQMA 1TMJA 3AD8C 4GE8A 2RU3A 2DHHA 2BOGX 5KFIA 1FFQA 4Y96A 3GR1A 2EXOA 1QWGA 4UQBA 1OFOA 1D3CA 4M29A 4BQ5A 4Y34A 2BV9A 3VM5A 2BX7A 1E6RA 1S1UA 3ITHA 2ONEA 3FFIB 4PMQA 4HP5A 4XO6A 2OQYA 3CAWA 4NYYA 4A05A 4IDKA 4USKA 2GJFA 4G1QB 2WZIA 4O28A 4YY3J 3T5HA 2PWFA 4IFOA 2GVZB 2QV6A 2AOSA 4W8AA 4J7CA 1X1NA 3QMTA 4I90A 5J2MB 3QWPA 5LXYA 2YX4A 4MJ4A 4DV3J 5E3CA 1R3WA 3UF9A 3OT9A 1TWIA 4C6AA 3TUZC 4NEZA 1BQMB 2XMJA 3MKCA 5LNWA 4AZ5A 1IT8A 4UWMA 4FNRA 2UZ9A 1PYOB 5ABFA 4DR6F 1ZZNA 4TU1A 4DZ5A 2GWGA 2POTA 4QJ1A 1JDCA 2HEKA 4KPLA 1EC9A 2QRRA 3SDOA 1JZ8A 1W26A 3IGSA 1KKRA 1HKJA 1HNWJ 3H0PA 4QYZJ 4O4RA 2W8LA 1ZAHA 4C6KA 2XY7A 2WHJA 1AVAA 2PU1A 1F5ZA 4HN8A 4BEUA 1Q78A 2B5JA 2ATMA 3CEDA 1A4MA 5A0YB 3TC7A 3RBXA 5A95A 2O56A 1A0DA 2KX9A 3N4AA 3I3DA 3FHQA 4D1JA 2APOA 3QIDA 1M5KC 1YQHA 2WMGA 2HHVA 3NR0A 1FDNA 2E1PA 2AGOA 1XIDA 4D6EA 4RKUC 2PD9A 5DXXA 3SSRA 1R0BG 4XVEA 3WIJA 4EP8C 3H42A 1VS1A 5HSPA 1N5QA 4IR1A 4ENOA 1RBAA 5J2PB 3RR4A 1WEXA 3NG8A 4YU1A 2A3EA 1JNRB 1MNZA 5FJOA 1VCTA 3I3BA 2Q71A 1LFWA 2HMIA 4JS3A 3W28A 3QLDA 3M0KA 2BXJA 3WMBA 3IJ6A 4Y0FA 3UYIA 1N6QB 2FZBA 3WNPA 5I5RA 4R0EA 5FI8A 5AYIA 3GHTA 1JX4A 3VGSA 4PSPA 2WONB 1TV8A 3FKKA 4G6CA 3WDRA 1HF6A 5G1YA 1VHIA 5K8OA 4TN2A 4IM4A 1TK8A 4DL5A 4K0KJ 4EXAA 4KC5A 5EWEA 2WB5A 4JOMA 5CAHA 3VGHA 4MNMA 1SUQA 1G1YA 3CUFA 2Y63A 4HB7A 3W1MA 2A3AA 4CO0A 4PUUA 4JV1A 4QE5A 3H4DA 2XVNA 1RLDA 1UC4A 2GDVA 4B3RF 1HQUA 3PZQA 3LO3A 4UNLA 3DRYA 1KP6A 3ARWA 2G3JA 1G6BA 4L65A 1XERA 2OD6A 3WBAA 1UMYA 3IAS9 3EGZA 2XZWA 5D33A 5A8WA 5M5DA 1PWLA 1VCFA 2D2HA 4JTEA 1TFWA 9XIMA 4LSNB 4H6QA 4TU9A 3OG3A 2NXCA 5DRCA 2BEFA 5A6LA 2BW7A 1DTTA 2W4CA 4LRBA 2IKHA 1E3XA 3K7RA 1YDVA 3P14A 4I69A 2UY4A 3ZXWA 4FS9A 2FQQB 2W4PA 3HHNB 4B4FA 2FHMA 5GNXA 1PO9A 3P8BB 1W3JA 2DP3A 4GNKB 2AQWA 4G8TA 3QSRA 4GD0A 4HLBA 2YDAA 1OFQA 4JI3J 4L9YA 2QJNA 4LEQA 3WMCA 2R1MA 4K8HA 4GI9A 3E0FA 1OGSA 1VFJA 3CDAA 2XN0A 2NQJA 4WIWA 3W65A 5CCLA 3NFUA 4LFBJ 3W70A 2VBXA 3PZ9A 3N9SA 3HFYA 1WP6A 5AHMA 1K4HA 7XIMA 1T3NA 4MYUA 5L9XA 1RVGA 1DAXA 3THCA 1PHQA 4JN6A 4YYCA 3PFMA 3W1TA 1JUEA 3BQ5A 4GK8A 3UESA 2BGQA 3LSCA 4K4VA 2DISA 5D04C 3CV2A 1UVKA 1DHMA 1HW6A 5KG1A 5PTDA 1S6OA 5D4YA 4W5UA 1VZWA 1EDTA 2FPVA 4RBUA 2G37A 4UTKA 4MUZA 1WD6A 5BU9A 1JZ3A 1HXJA 1TK5A 1B3WA 5M2RA 3D7SB 3S1WA 2HWHA 3P84A 1HBUA 2MSSA 1PYMA 4Z2LA 1FQ0A 3HQPA 3TANA 5BMXA 1Q7YT 5ETMA 2GC8A 1YE4A 5IXEA 5LA1A 4X60A 1AH3A 3R10A 3R8YA 3N18A 1PSCA 3S83A 4AXKA 1A80A 3N73A 2QFJA 1C0TB 4MJMA 3SXLA 1X4FA 3PF3A 3TW7A 2HNDB 1WHWA 4AQLA 1H6KX 3BV8A 1EJVC 1URRA 3VGDA 3HT0A 3OXLA 3ZWTA 5DN1A 3NUKA 2VG6A 3W3SA 5C2XA 4GXWA 3BH7B 2FLNA 3DESA 1XSIA 2XZDB 3A5FA 4KO0A 4USTA 4LR8A 4B9TA 2PCQA 2B7OA 2DR6A 5G0RB 4CT9A 3CHDA 2XIBA 1X5OA 3G1DA 3DKLA 3FEYB 3K5LA 3UCDA 1VQ6S 4W90B 3FVYA 3MZIA 1P7TB 1PZ0A 2MGZA 3CW2C 3DDKA 2GSJA 2INZA 3BTNA 3C2PA 1C1BB 1T05B 4CP5A 4FYXB 1XSJA 1RTHA 3T1YF 4KQZA 4DQIA 2YYTA 4GC3A 3KL5A 3M0MA 4WXOA 1RHKB 3W86A 1GEHA 2G5WA 7CGTA 4YEAA 2RRAA 2Y9HA 1C9WA 4L61A 2LXFA 3II1A 1IWGA 2C2NA 1B4SA 3POHA 4DPXA 4B9UA 1H1NA 2GMHA 3RUBL 4I6VA 1L8NA 3G2GA 3X1LB 1UYQA 2Z2UA 1KKOA 3S2LA 1QOQA 1Y5NB 2PA3A 2FGOA 3IAM9 4KH0B 4QYZK 2VZUA 1J9YA 2AKZA 3LXAA 4DS4A 4IPIA 3ZO7A 4ZCMA 4IFKB 2XDFA 3N1AA 3F5KA 2BVZA 2ZKTA 4R27A 2EPKX 2FFCA 4RW4B 2IMRA 1IKYA 2GUBA 1JULA 5ENLA 3UDLA 2R1KA 2QGHA 5LZLA 2BLEA 4DG1B 4QCEA 1FCUA 2WOQA 1P5BA 4UNKA 2NVCA 3AMLA 2C2EA 4KKXA 4Y9AA 1VHFA 1O66A 2Y3YA 8RUCA 3BM7A 4C48A 3KLFA 1RT4B 2XZ9A 4HOXA 3P60A 5LIXX 1X4DA 2Q3OA 2A1YA 5G5IA 1KC7A 3FKRA 1VJZA 3BURA 3QSTA 4K8GA 1R7OA 1HBOB 4LF9F 1MLAA 1QUMA 2XMKA 2P50A 2M3DA 2CZ4A 3MWAA 2OFGX 1J0KA 2RB7A 1IGSA 2PWUA 3UG3A 4XIUA 1QY7A 4G7EB 1GK8A 2Y70A 5LHEA 4ZVRB 4H4KA 2BDPA 4CCCA 1M3UA 3LP1A 3VQTA 2XTKA 1Z9AA 1JD9A 2VX5A 3VD5A 1F05A 3T9PA 4YWSA 3F56A 5JU6A 3QTPA 2J7DA 1ZCCA 4L73A 5KFVA 3WQFA 1XLDA 1NHKL 3HDSA 1IR1A 1XC6A 3RB4A 3LHUA 4L80A 1D9AA 2HE5A 1OYEA 1J96A 3CSKA 3QV8A 1I8JA 1S6PB 4JI0F 3HT3A 4YTQA 3TXVA 2LA4A 3PV8A 3L9CA 3CEUA 5DS7A 3WD3A 2FUG9 3FBFA 1HARA 1EJ7L 5BNKA 3V5OA 3I5AA 3CCUS 5LNSA 3BGAA 4OGZA 4CLYA 3W82A 1AB8A 1H60A 2ZX7A 3LTSA 4CN6A 2MXYA 3CJRA 4K6AA 3KCJA 4XD4A 1NH8A 1UD4A 1ZM4A 3U3HA 4ACZA 5REQB 4DI9A 1HHQA 2YH0A 2C3ZA 4I1TA 3E0LA 2R8WA 4DO5A 1BPLB 5IM51 1E9YB 2ILZA 2GWNA 1GMUA 3H2AA 3TUJC 1DXIA 4FZVA 3AYRA 3ADAC 4PODA 4J9KA 4C7DA 1VQ7S 1VBJA 1L0PA 2XH7A 3ZZRA 2B9EA 3QSYB 1ADOA 2EHHA 3E0WA 3GQYA 4GVFA 1SZEA 5BRBA 3DM2B 1CWYA 1W3KA 1F5BA 2E7VA 3I32A 3PIOQ 1YVFA 2LVWA 1H5YA 5AHLA 4PCFA 3BH4A 3FJLA 3CCVS 3OEXA 3IJIA 2Z26A 2C6QA 2BV3A 4ZPBA 3MEKA 3NPVA 3VD9A 3M16A 3QFHA 3QC0A 4AH7A 4D6IA 3T5JA 3OFEA 4YTUA 3MMWA 1ZAIA 2CIMA 3S6OA 2ZKMX 3RW7A 3HJVA 2NUUG 4Y90A 7TAAA 1E6XM 1KTBA 1DQ8A 3K8KA 4N9EA 2R8IA 5CYQB 3SECA 2XEXA 3AYVA 5JUVA 3ZR5A 4HI1A 3E01B 2YZRA 1I2OA 3OSNA 4WTYA 2VFVA 5CABA 3OTOF 4QJ4B 4WPAA 4FLOA 1GT8A 4LQ9A 1W91A 2DGOA 4GVBB 3O3RA 1YK9A 1VQ9S 1ADDA 1XG3A 1W3IA 3B8TA 3EE3A 4MNKA 4BEQA 4LC8A 1R0AB 3V0SA 3NCPA 2CESA 3C3NA 3FA3A 1BHGA 4YS1A 3WNLA 5AY7A 3O8AA 3TAPA 5KFGA 1WC0A 5DRIA 4OZ0A 2ACYA 5B09A 1AL7A 1OB0A 3TSDA 1X4HA 1MSWD 1UWRA 7TIMA 2R7QA 4MK8A 5IT4A 1XLBA 4UIOA 2W63A 3D5HA 4UQ9A 2BJDA 4CO1A 1WZMA 4YP3A 1B5TA 2SFPA 3KHRA 1LQ2A 3R0KA 3BMXA 4Z42C 1XHGA 4ZXOA 3OL6A 1UP0A 3CL6A 4FKXA 2GGGA 3TIMA 1DWIM 1LOUA 3STPA 1WXYA 4N41A 1ZYQA 3N6MA 4PRWA 3JSRA 4UW2A 4QOTA 3GTNA 4PB4A 5AHEA 4EU0A 3C0JA 2O0TA 4Y6GA 2HQAA 4PCNA 4G1KA 1TV2A 3NL0A 2HBRB 4S3BA 1J2VA 4GKJF 3LP0A 2YA0A 3C8FA 4PCTA 4CTAB 1TVPA 3P8JA 1B64A 3HHKA 3KS5A 1H98A 5JH2A 3WLNA 4L6HA 1F3XA 2PFFB 3R5AA 2VYOA 3TJ8A 4N47A 4XZMX 2QJMA 2OYLA 3TTQA 3BQ2A 5D3GA 1XYLA 2J77A 1K3UA 4RLIA 4CRJA 2R7WA 2OPJA 2ZUSA 1EX1A 1UPPA 1Y7PA 4S3KA 3GTXA 1J5TA 2OOFA 4F02A 4BK9A 5HVGA 5F0UA 1D7KA 3H90A 3TCEA 5K4XA 2PFDA 4M5PA 1JKHB 4H4KC 2HBVA 3AFBA 3C15B 2K3IA 4CZCA 1IKWB 4OU1A 1S5NA 3USZA 3TOQA 2EPHA 3VAIA 5AXLA 1F5AA 1X7FA 3VKAA 3WNMA 3IRWP 2IMOA 1CT5A 1ZNNA 2ESCA 2G0JA 2MJUA 2VZOA 1TRIA 1OSCA 3DOKA 4B5XA 4ZP6A 1TUXA 4DLFA 4QNWA 5EFDA 2RT3A 2BABA 1XIFA 2MMYA 2XIMA 3SAZA 4GVHA 3TN4A 2Y8YA 2HLUA 4NKCA 4QQ3A 1Q8AA 2JIWA 4GKKJ 2PTDA 4DVOA 1M6JA 1JR1A 3BREA 4O4GA 4C8ZA 5KG0A 4RW3A 3CV6A 4PULA 1MU2A 2UUWA 2WHOA 3CD6S 1Z7AA 3MMJA 1Z44A 2ALDA 2E5DA 2OX1A 4JFVA 4AHPA 4JX5A 1XLKA 2PE4A 3C8YA 1PDYA 1KKHA 1QDSA 1D3HA 1FT8A 2IPOB 2VQEJ 3LAKA 3PB0A 4F7VA 1UBSA 2ZBQA 3K30A 1TUVA 5DO8A 3IIPA 5KMYA 1OMSA 2ZXBA 1KQZA 3NGFA 3MUVP 2IAJB 3LH2S 2B0GA 2GGPA 2XYPB 2IC3B 5CQ1A 5D0RA 3BLLA 3FEXB 4GNVA 3KLHA 3HGOA 3OTBA 1GOOA 4RUAA 1CJUB 1KQKA 4GRSA 5T9CE 4EE9A 1HNIB 4HOZA 3KTXA 3O05A 3KWSA 1RY8A 1W9BM 3TJ9A 2L9NA 4AIOA 3L21A 2VBWA 4KGLA 1FOBA 3GXFA 4LUTB 4YJ5A 2BXZA 3GO2A 4MAZA 3GZAA 1YBTA 3C16B 3GVGA 2OYKA 3ARZA 1FJEB 5K8NA