4RNHA

Pamora tandem diguanylate cyclase - phosphodiesterase, c-di-gmp complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
429
structure length
423
Chain Sequence
MAYYDALTHLPNRTLFQDRLHTALQQAERNGQWVVLMFLDLDRFLGHAAGDRMLQEVATRLSACVSQDDTVARMGGDEFTLLLPSQGDREIALKRAIQVAELILGRLARPFTLEGREFFVTASIGVALSPQDGAELSLLMKNADTAMYHAKEMGKNNFQFYQAEMNARALERLELESDLRRALELGEFVLHYQPQFTGDGRRLTGAEALLRWQHPRRGLVPPSEFIPVLEEIGLVAQVGDWLLAEACKQLRSWHKAKVRVPKVSVNLSARQFADGQLGERIAAILYETGIPPACLELELTESILMSDVAEAMQILSGLKRLGLAIAVDDFGTGYSSLNYLKQFPIDVLKIDRSFVDGLPHGEQDAQIARAIIAMAHSLNLMVIAEGVESQAQLDFLREHGCDEVQGYLFGRPMPAEQFGMLYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Motility regulator
publication title Formation and dimerization of the phosphodiesterase active site of the Pseudomonas aeruginosa MorA, a bi-functional c-di-GMP regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase, hydrolase
total genus 146
structure length 423
sequence length 429
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4rnhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rnhA01
4URQU 2IMWP 1RTHA 3G6XA 2YNGB 5L1IA 2D7SA 5DG8A 4RU9A 2XCAA 1S6QB 3ITHA 4HJFA 2ASLA 1KHVA 3M9MB 3JYTB 3V6JA 3Q8QB 2WONA 4MK8A 1TV6A 1LW0B 1JLCB 1K1QA 1RA7A 5HBMA 1JLGA 4KFBB 1SV5B 4ECYA 3GFXA 4LYKA 4EO8A 3DOKB 2C2DA 3PW7A 4TQRA 2YNFB 3BSOA 2IAJA 2W9BB 4Y8EA 1DTTA 3KLIA 5DG7A 2ASDA 2J6TA 4KHMA 5L1KA 5KFDA 4J9MA 5D3GB 5C25B 3GIKA 3E01A 3EPIA 2VG6A 1MMLA 1S6PB 3PW2A 4ZP9A 2RKIB 4M94A 4O4GA 4ECWA 5C24A 3M8PA 4RW6A 3Q8SB 5C5JA 1TP7A 4G1QB 3MR3A 5KFFA 4RNIA 3GV8B 5DQIA 2W7PA 5KG3A 3BQ1A 4DL2A 2AGOA 2JLEA 3KLEB 2XC9A 3I0RB 4K4TA 5KG1A 1WNEA 4J9KA 2OH2A 2FVCA 3BGRA 4ID5A 5I3UA 3LP1A 3KLGA 4ECXA 1GX6A 3MEDA 5HLFA 3DRSA 4IFVB 4O3SA 4URGA 4K4ZA 4R5PB 4ZPDA 2W9CB 5F9LA 2I5JB 4O3RA 4ZVFA 2W27A 1HNVA 4F4XA 5KFWA 4QPXA 4NLGA 1C0UB 2WK4A 2XGPA 3KK2B 4ECQA 1KLMB 3EPGA 3DRRA 2FVSA 4R8UB 2IM2A 1TKZB 3N6LA 3KLHA 4ECVA 3CJ0A 3H4BA 3DI6B 1S1VB 1MU2A 4RW8A 3DMJB 5HROB 2AGPA 2YNHA 3DDKA 4MFBB 5F8GA 3Q8PB 4K4YA 1LW2B 3M8QA 1NHVA 1S9EA 4ECZA 4K50A 1TL1B 2IC3A 3LP0A 5M1TA 4KO0B 3ITHB 2D3UA 3KMQA 3T1AA 4J40A 4I2QA 2I1RA 5KT3A 4Y2CA 4Y9MA 3QZ8A 1DTQA 3CDEA 3NGDA 2ZKUA 1QAJA 4KV8A 3H2LA 5DLGA 3PJXA 2C2RA 4GC6A 2BANB 5KFUA 3UPFA 3T19A 2D41A 3OSPA 1SH2A 1T03A 2WOMB 3PJUA 4EO6A 5KFMA 5I42B 1D0EA 2JEFA 2DPIA 4Y9NA 1S1WA 4IR9A 3FRZA 3NBPB 5J2QA 4KBIA 4RNOA 4WZMA 1FKPB 1N48A 2R8IA 1LWEA 4JV2A 3FFIA 3I0SB 4QW9A 2AU0A 2R2UA 5KFQA 1C0TB 4TYBA 5EDWA 4NZ0A 4RNJA 3CWJA 2BE2B 3DLEA 2R8KA 4WFXA 3PR5B 4ZP8A 1HNIB 5CYQA 2R2RA 2UUWA 1QAIA 4QWDA 5K14B 2BR0A 4IRDA 3D5MA 1REVB 2QE5A 3H5UA 4ZMMA 4EYIB 5CYMB 4KSEB 4Q44A 2IM3A 4OL8A 3DYAA 3HVTA 1N4LA 1TKXA 4FOUA 1BQMB 3OLBA 5DG9A 4X2BA 2AX1A 1RTDB 3SFGA 4KKOA 4RW7B 5J2MB 4KE5A 2YKMB 3GV7B 4J9SA 2AGQA 1J5OA 1HQUA 5J2PA 1UWBA 2B5JA 3OL6A 1JLFB 2OPRA 3QO9A 3CIZA 3KHLA 4GC7A 3H40A 5C42A 1HPZB 4O44B 1RYSA 1IKXA 1MU2B 1D1UA 1Z4UA 2R6OA 2YNHB 3ICLA 3U2EA 4F4YA 4IH5A 5KFVA 3CJ4A 5F8HA 4B3OB 3KK1A 4IKAA 3LP2B 3BSCA 3SFUA 5J1EB 2IC3B 5KFAA 5KFYA 4Q6JA 4YP3A 4NLXA 4IFYA 3MR2A 1SH3A 3GIMA 2WRMA 4TY8A 2VA2A 5KFRA 3I5AA 3QLHB 4NLOA 3BSNA 4FS1A 3NKYA 4IH7A 1IKWA 4NCGA 3TQ1A 5KG7A 2C28A 4RW9A 3LALA 3OHAA 4R0EA 1TKTB 2ATLA 5F9NA 3CJ3A 4NLRA 2E9RX 4HKQA 1RT7B 4F3HA 4K4VA 4RW4B 1DLOA 2F8EX 4YMEA 4ZVGA 2FJWA 2HNZA 1C1CA 3QIPA 4I2PB 2YNIA 2FLLA 3PW5A 3PR4A 3I5BA 2O5DA 5J2NB 4F50A 1EP4B 3V6DA 4ICLA 4WE1B 4Q43A 3RAXA 2BQ3A 4LQ9A 5KT6A 4XPEA 4Y2AA 3RB4A 3DLGA 4H4MA 2OPPA 2WB4A 4Y34A 3BQ0A 1N6QA 1HYSA 4F48A 5KFIA 1T94A 4O3NA 5KG5A 4ZHRB 1FK9A 3G86A 5MKGA 1K1SA 1TKXB 3NMAA 2VG7A 1JKHA 3GQCA 1IKVB 3NL0A 3N3TA 5KFKA 3KJVA 3IGNA 3V81B 1S97A 1J5OB 2ZD1B 5F8JA 4IG3A 3JSMA 1HQUB 4TN2A 4HYKA 3M9NB 1N56A 1N5YB 3NAHA 2HMIB 2OPRB 3MECA 2HNYA 2FJVA 5KFNA 3ISND 1RT5A 4TY9A 1RT4B 4IRCA 2ZE2A 3MEGA 1HQEA 2HNDA 1TVRB 3MEEA 5DGBA 4O4RA 1R0AA 1RTIA 4Q8EA 3IS9B 5HP1A 2JEGA 2GC8A 4IG0A 1S0MA 4EEYA 1I6JA 5DGAA 4Q0BA 4PWDB 3T5JA 5FDLA 3KHGA 5KFSA 4EBCA 3IRXA 3UR0A 3FSIA 2RDJA 2HWIA 1VRTA 4URSA 4WYWA 3DM2A 4I7FB 4MKAA 4MKBA 1FKOA 2VG5B 3GILA 2E9ZA 1S1TB 1XR7A 2B43A 1IKYB 4JV0A 1RT6B 3BR9A 1RT1A 4RNHA 4K4SA 2XWYA 5KFHA 4HU3A 1JLQA 3DOLA 3KLFA 1HMVB 1C1CB 3CDUA 3PVXA 2YNIB 1LWCB 2FLPA 1RTHB 1QE1A 1JLAA 2BASA 1RT2A 2XI2A 4DEZA 3V6DB 2C2EA 3RB6A 3FDSA 2IM0A 2UVWA 4JUZA 4DL3A 1S48A 1RT3A 2WONB 3V4IA 1TV6B 2ALZA 3IG1A 2OPQA 5HBMB 1JLGB 2XGQA 4O3QA 4DG1A 2C22A 3FQLA 1N6QB 5KT5A 4WYLA 4ED3A 1FK9B 2IAJB 1W25A 3KLIB 1DTTB 3QGGA 4NYZA 5MF5A 1SUQA 3MF5A 3E01B 4YR2A 2VG6B 3OLAA 4QWEA 3TAMA 3TLQA 4LSNA 4J9LA 4O4GB 5C24B 3M8PB 4RW6B 1T05A 3MR6A 2FVRA 3OL9A 3KLVA 3QGHA 4F4WA 3OSNA 2UVUA 1XR6A 2ZE2B 3CVKA 1RA6A 3HV9A 5F8LA 2IJFA 4O3OA 3MR5A 3BGRB 4ID5B 3KOAA 5I3UB 3LP1B 3KLGB 4EBEA 3MEDB 5HLFB 3GIIA 4Y9PA 3DRSB 3PJTA 1S10A 3KNAA 3HKWA 4MK9A 1BQNA 4ECTA 5KG4A 1HNVB 4ED0A 3DLKA 4FOJA 3UDLA 5F8MA 5JUMA 4Q45A 2JEIA 2YKNA 3Q8RB 2R8GA 3DRRB 4WXWA 3UQSA 1S6QA 3KLHB 1RT1B 5KG6A 4H4OA 3JYTA 3OL8A 4RW8B 1SH0A 1C1BA 3LAKA 4ZP7A 3H4DA 3KK3A 1JLCA 1KHWA 5DQHA 3M8QB 1S9EB 4IQXA 4KFBA 1YVFA 1SV5A 4ZVEA 3KHHA 1RT2B 3LP0B 3PHEA 5KFTA 4YR0A 4ED2A 2UVVA 4G3IA 2W9BA 3PW0A 5KFGA 5EWEA 1JIHA 4I2QB 4YQWA 5KFPA 3V4IB 3RB0A 1DTQB 1LWFA 1RDRA 4J9OA 3RAQA 5D3GA 4KV8B 5C25A 3CO9A 2XCPA 1IM4A 1S9GA 3CJ5A 4LQ3A 1S6PA 4KHRA 4PQUA 2RKIA 1T03B 1TQLA 4ES4A 4ZPAA 2BRKA 3IGVA 3OHBA 3H98A 3QGIA 5EWGA 4H54A 4U7CA 4EBDA 2IJNA 3GYNA 3VQSA 1S1WB 4ECRA 3KZPA 2FVPA 3CJ2A 3G6YA 3KLEA 1SUQB 3I0RA 4NLDA 1OS5A 1S49A 5J2QB 4J9QA 1T3NA 3T5HA 2R2SA 1LWEB 2VA3A 3FFIB 5F8NA 1TL3A 3BJYA 3S83A 3T5KA 1T05B 3QYYA 4R5PA 2W9CA 3GFYA 2R8JA 2I5JA 3BQ2A 1ZTWA 4HU4A 3DLEB 3QIDA 1QUVA 4DL4A 4QWBA 3C6TA 1RYRA 1JLEA 5CYQB 2J6SA 1C0UA 2AQ4A 3KK2A 4JV1A 1KLMA 3HHKA 3MFHA 1RTJA 4NLUA 3V6HA 2BQRA 2D3ZA 4R8UA 5F8IA 4XPCA 1TKZA 4F4ZA 3DYAB 3HVTB 3N6MA 2V0NA 4AG0A 3DI6A 4K4XA 1S1VA 1S1XA 5HROA 3DMJA 4NRUA 4O3PA 4LJ3A 4KKOB 2JEJA 4J9NA 1LW2A 4KAIA 5J2PB 2UUTA 2YKNB 5EUHA 1TL1A 1UWBB 2B5JB 1EETA 4IR1A 3QO9B 4KO0A 3C6UA 5C42B 5KFBA 2JC1A 2IA6A 4H4OB 4KB7A 1IKXB 2W9AA 1C1BB 4ED8A 4NLVA 3KK3B 5KFXA 3SI8A 4MIBA 2WHOA 3GIJA 3FQKA 2R8HA 3KK1B 1XR5A 2BANA 4ED6A 5KT4A 3GG1A 1S4FA 2WOMA 1S1UA 2OPSA 2RF2A 5I42A 4RNMA 4RNNA 1JLBA 4IFYB 3M9OB 2WCXA 4TY8B 4QW8A 1LWFB 3NBPA 5DQGA 3V6KA 1S9GB 4LSLA 4NLWA 4ECUA 1IKWB 4RNFA 1FKPA 4NCGB 4IDKA 1VRUA 4PQUB 3I0SA 2AWZA 2CKWA 4NLYA 4RW9B 4NLPA 4ZPBA 3T5LA 1C0TA 4ED1A 1S0NA 2EC0A 4AFYA 2BE2A 2V4RA 1DLOB 1RAJA 1HNIA 3LAMA 2HNZB 3E51A 3QIPB 4DL5A 4FBTA 1HARA 1ZETA 5K14A 3H5SA 2FJXA 1REVA 1TL3B 5CYMA 5KFLA 4ICLB 2GIRA 5KFEA 5DLFA 2ASJA 3GV5B 1BQMA 3SY8A 4TYAA 5L9XA 4PUOA 3DLGB 5KT2A 1RTDA 3C6TB 1JLEB 4H4MB 4RW7A 2OPPB 5J2MA 2YKMA 1HYSB 3OL7A 1RTJB 2E9TA 3PW4A 2BRLA 1JLFA 4QWCA 2W8LA 2WTFA 1HPZA 5MKGB 2UVRA 4O44A 4QWAA 1S1XB 3BREA 2VG7B 1JKHB 3QZ7A 3KJVB 4RUAA 5KFZA 5L1JA 3ISNC 4B3OA 4IG3B 5EWFA 3JSMB 1ZTTA 3LP2A 4Q8FA 5J1EA 1EETB 3MECB 2HNYB 2BQUA 3HVWA 3C6UB 3I5CA 4ECSA 1RT5B 2AX0A 4WFZA 3EZUA 3H59A 3QLHA 3MEGB 2IBKA 1HQEB 2HNDB 3MEEB 4DL7A 1R0AB 1RTIB 2B6AA 3MTKA 5HP1B 5JXSA 1S1UB 2OPSB 2RF2B 4IG0B 3KMSA 1TKTA 1JLBB 4Q0BB 4NLTA 1RT7A 4U6PA 4RW4A 4NLSA 5FDLB 4K4WA 4EYHB 3DRPA 3IRXB 5T14A 4I2PA 1VRTB 3LANA 4LSLB 2V4QA 3DM2B 3IN5A 4ZPCA 3H5YA 1FKOB 4IDKB 1VRUB 2YNGA 1JX4A 4MIAA 5J2NA 1EP4A 4WE1A 4FBUA 1S9FA 3HV8A 3PJWA 4TQSA 5KT7A 3DOLB 1JLQB 1LW0A 1NHUA 2HWHA 3KLFB 2W7OA 1S0OA 2W8KA 5KFJA 2FVQA 2V9WA 3H5XA 2RDIA 2J6UA 1QE1B 4J9PA 1JLAB 1U09A 4NLQA 4WXOA 4ZHRA 3DOKA 4IOBA 3NAIA 5KG0A 3RB3A 5KFOA 2YNFA 3BSAA 1RT3B 3PZPA 4RUCA 4PUOB 1NNDA 2IM1A 1IKVA 4J9RA 3V81A 3IG1B 2OPQB 3GFZA 2ZD1A 3TVKA 4DG1B 4FOKA 4K4UA 5L1LA 1N5YA 2HMIA 3RBDA 2JC0A 4M95A 2ILZA 4ED7A 2XI3A 2HAIA 5KFCA 3RBEA 4G1QA 3HVAA 1RT4A 3D28A 4ZVHA 3G6VA 4IH6A 4MH8A 5KG2A 3KHRA 2FLNA 4IRKA 1TVRA 1CSJA 2DPJA 3PFMA 4Y9OA 3TAMB 4NRTA 4TLRA 3IS9A 2ILYA 4LSNB 3CDWA 4KIEA 4IFVA 2R2TA 4MK7A 3GG0A 3N6NA 1JXLA 4PWDA 4XO0A 4DL6A 1C2PA 4I7FA 2B6AB 2VG5A 1S1TA 2GIQA 3MFIA 1IKYA 4RZRA 4FS2A 1RT6A 4YR3A 1BQNB 4ZP6A 4WFYA 2QV6A 3DRPB 3DLKB 4MFBA 1HMVA 4TXSA 2CJQA 1GX5A 4WZQA 1LWCA 4Y3CA
chains in the Genus database with same CATH superfamily
4URQU 4DPYA 3FDKA 3ILIA 2UWFA 3K4WA 2BHUA 4JI1F 5I3DA 3WH6A 4K37A 3N2CA 3ZVHA 4CQDA 4OYPA 5GAEI 3GXMA 1YG0A 4F79A 3THAA 1VRXA 4DBUA 1FTCA 1RQEA 3G6MA 4LF8J 2YY3A 3M43A 3USBA 1QK0A 4AYGA 4LF5F 3PBGA 2I56A 1PE1A 3WBWA 4CI0B 4C8ZA 2WCGA 1V5IB 1WI8A 4YU1A 2AGOA 1KM4A 4GVIA 4W8BA 5D2VA 2XC9A 5IM51 4BKNA 3EE3A 4EWJA 5FEXA 3MEDA 2EBEA 1YBQB 4RX0A 5CD4H 3BMVA 3MZIA 2HVOA 3OTRA 4RO0A 1F4AA 4J9UE 1JXKA 3EOUA 1JPDX 3UZWA 1WB0A 4REQB 3UNDA 1QOPA 1XQIA 4ZOEA 1JFHA 2W62A 4QNEA 2Q3OA 3ENAA 2GIFA 3LU2A 3AJDA 3NY0A 2AGPA 1R0MA 4JHOA 3GJTB 5I3QA 3G9CA 1S9EA 2B31A 1C91A 3U8GA 1OF6A 3W74A 4AHOA 2CBJA 2A3AA 1VBRA 2V3FA 3CTTA 4DQQA 2CPJA 2GJIA 3C3LA 2VC7A 3OG3A 3LOUA 1BWLA 1NAQA 3MM9A 4PG5A 2DPIA 5B7ZA 3KJNB 4DV3J 1N32J 3DCPA 2YA0A 4B90A 1CEZA 4FS9A 1ME7A 3BZQA 1LWEA 4L75A 4FKYA 2PF0A 1EHNA 1C8VA 5LA1A 1NZAA 3LCFA 1EZWA 5CGTA 3M2RB 8AT1B 3M0YA 2FPVA 2NCKL 4ZR8A 1REVB 4KTQA 2RU9A 2BOEX 4JPGA 4O23A 1ZAJA 2CBIA 3DI0A 4PTVA 3I56S 3UZ5A 3G8SA 4LUIA 5HQLA 3EA2A 3B8HA 4JKKA 1TFVA 1ONXA 4JB8B 3NPXA 3VOIA 2ZDRA 4AEFA 4TNOA 4H9ZA 2GV1A 4GG9A 1EKSA 2JWNA 3AB2B 3TA2A 2IC3B 5KFAA 3THUA 4DV5F 2WAGA 4UF4A 1IJFB 3GIMA 2VA2A 2IUZA 3R8HA 2F6KA 3QLHB 2KX9A 2BZNA 4YTRA 3UCUP 1VHCA 1A5MC 1ZB5A 2J7HA 4JBRA 1YZ7A 4AD2A 2XVLA 3LK6A 4QAIA 2X3GA 4PUJA 4K59A 3MUY1 4O16A 3S42A 3U0HA 3CDBA 1LFPA 4OX9J 5DETA 3NXLA 2CQ1A 2BGQA 1HBUA 2OYKA 1KVKA 2XUCA 2OPPA 2PEHA 4H4MA 4Y34A 3ANVA 4DXVA 2BA9A 4IX2A 3VNJA 5DM6Q 3O6YX 5C5YA 3G3DA 5I02A 4USVA 3PJ9A 1POJA 3N3TA 3VYLA 3GTFA 3GY1A 4RCXA 1XGZA 5AECA 2EKNA 2DR7A 2HW3A 3LTPA 3IMQJ 2HNYA 1EL3A 2ZJRQ 2PFHA 2W91A 5KFNA 4RJVA 1WDDA 3KE0A 3B8SA 2I7GA 1OYBA 3UR2A 2ISFA 4DNMA 2Y1JA 3VGVA 1G5AA 4UNKA 5GMEA 4QFUA 2FFIA 3TUJC 3BAIA 2W24A 3MZ2A 5KFSA 4ZB5A 1VRTA 2GDQA 2N7YA 4R53A 2IVYA 2IQTA 4W87A 5HVHA 4NQ1A 3M6UA 2DRAA 3I87A 3T0DA 1C1CB 5EX3A 1H7RA 2DUAA 2EEXA 2UVWA 1FDZA 3R8YA 3G8RA 1HWJA 4JI6J 1ZM9A 1BG9A 3M7WA 2ANUA 2GNKA 1X9MA 1JLGB 3EM1A 3ENQA 4OIXA 2LMIA 1SIZA 5DELA 3OUYA 4NJJA 2VJVA 2E44A 3ZT6A 1GVQA 3NPVA 2ZTJA 2GW8A 4BQ2A 4P7NA 1TPWA 3ARWA 4MHBA 1IXPA 1FXQA 3UJEA 4AY7A 3W2WB 4DELA 3KLVA 1BSIA 2BODX 2IDEA 2DD8S 3NNTA 4RX6A 2PLCA 1EKOA 2PTYA 3Q65A 3FEYB 4PEKA 4ID5B 3ATZA 8ATCB 4ICNA 3S5ZA 4ENOA 3EMQA 1EF3A 2ASHA 3QQ0A 4DF4A 1KEKA 5A2QU 1IJEB 4W5UA 1KBJA 5A6LA 2J7KA 5CHCB 2Q8XA 1PSDA 1CGXA 1TFWA 1FWCC 4C9DA 3B9OA 1R43A 3KRUA 3M8QB 3J7HA 2CZ5A 1N34J 1QO2A 3M0VA 5REQA 3UR8A 3MSRA 1EQ0A 1DHMA 1MXSA 1TA3B 5D2YA 1E6SM 3KRZA 3HG3A 4HH0A 1H0IA 3IGVA 1YEYA 4MKNA 1DWJM 4X63A 3WELA 3ITCA 1KS2A 3SFWA 1HNWJ 3HT3A 1PIIA 4J4KA 1U0HB 1Y3KA 2CJAA 1E55A 4JI8J 2DGXA 5BOOA 2WMFA 4C5ZA 1W1B1 4DZDA 3BKTA 3DLEB 1QI4A 3G3MA 3LXAA 2M0GB 4HOZA 2DGSA 1K44A 1QD1A 3HHKA 1JEZA 1HI1A 3CXOA 2GJLA 3POTB 4DV2J 1DFDA 4DV6F 1UPPA 4ACZB 2HS4A 3UI3A 1CT5A 1J9YA 1Q16B 2CQIA 1WV2A 2JEJA 4ZDNA 3VMPA 3VVGA 2AQOA 3KM8A 3LEPA 3HTWA 2AOSA 4HNOA 3FQKA 4JFWA 5KT4A 2PZ0A 4DZIA 2C19A 1SZGA 1PPIA 3TARA 3IRSA 3NBPA 1BD0A 3W7DA 3GVWA 1VQ5S 1GW9A 1TCDA 3VGEA 4PQUB 4RW9B 5ETPA 1Q5VA 2ZZ3A 4EVZA 3GD6A 3UESA 3WIJA 1X7FA 1DEDA 2Y4SA 2AYMA 2QGYA 3WKZA 4MWAE 3K5MA 3AALA 2FTPA 2E1WA 2PC6A 1N52B 2CU0A 2MXYA 3QOMA 1EB3A 2Y9HA 2QF7A 3BQ6A 3H2CA 2OODA 4QE4A 2WKGA 3S2JA 5B80A 3G82B 4GISA 4ES2A 3AXHA 1XIDA 2V82A 1W1A1 2OWWA 2WTFA 2QG9B 2NVAA 2GGPB 1NQKA 3KJVB 2HRWA 3VIJA 3GO2A 3T42A 4Q8FA 2GQ9A 5HNTA 3GSMA 2FHJA 3I3BA 3AMCA 1YBTA 4JN7A 1WQ5A 1HKAA 4M6UA 1K9DA 3RILA 3QSIA 3H59A 1P6BA 4DR6F 2BVDA 3E0IA 1E3XA 4IPPA 4LUJA 4HK6A 2Q6CA 3VAVA 1F9EB 1EJTC 2HZGA 1FFRA 1JJHA 3F4DA 4LSLB 3BK0A 3SFKA 1H61A 1SKRA 1RJJA 4MIAA 2K06A 5J2NA 4JEJA 4WE1A 4FBUA 5HL7Q 1QMLA 3AIBA 1OADA 3WDHA 2W7OA 1R2TA 3FJLA 3VX1A 3WX7A 4D8ZA 2XMVA 2V9WA 2OJPA 4NYYA 3BYPA 3E0VA 1Z48A 3JU2A 3J7ZT 1BXNA 4LC6A 2DIUA 1HJUA 4FF2A 1MN7A 3NZGA 1I45A 3CZEA 4KF1A 1GFWB 4PXCA 4O50A 4RDYA 4DBSA 4NPOA 2R4FA 1CB7B 3W65A 3A23A 1R2RA 1H1YA 1B0TA 2ZE0A 4KIEA 4HIBA 2J9CA 1SMAA 3GNXA 2LXUA 1B54A 4FXFA 4K3ZA 3OVPA 3CC4S 3MP3A 1V7YA 1E0XA 4QLJA 4KH0B 2RMLA 3W2VB 4K5RA 1F4HA 2L41A 2BSLA 1ADOA 2Y7EA 3TZWA 1PWLA 3NZQA 4IX0A 3M0LA 4ZOAA 5LNRA 3JAMU 2ASLA 3AJ7A 1ZM3A 2W4DA 4LYRA 2FZBA 4H1ZA 1SUXA 2AP6A 3HULA 1IZJA 3SQGA 5LMNJ 4P2MA 4O1BA 3V6JA 1V5XA 3FCVA 1IBLJ 4GXPA 2VDIA 2X2YA 1OPIA 5HBMA 3W1YC 1VQNS 3QY7A 1FEHA 4AIUA 3WSUA 2DNGA 3W2JA 1Q8KA 2AJ1A 3PW7A 4JTKA 4TKTA 5D3GB 3TC7A 4AC7C 4QR0A 2CPIA 5A6JA 2VG6A 3VGHA 3RMJA 1RB0A 4ZP9A 1H72C 4ECWA 3IJ9A 3PXGa 2XH7A 4X62J 1AH4A 1LUCB 3I0RB 2GUUA 5KG1A 5AYZA 2ZUNA 4Y2WA 1HO4A 1GX6A 2OX4A 3STEA 2I5JB 2YL8A 3ZR5A 2VEKA 4H9YA 2DO4A 2PDPA 1FD8A 3LA0A 3ARZA 4WRHA 1TKZB 1G4TA 3CJ0A 2B4UA 3DI6B 2VQUA 4O17A 4NAFB 5K9CA 5I06A 5FLXY 2RHSB 4DZHA 2ZM6F 1RA5A 1PJ6A 2IC3A 1E6QM 1KV8A 5AC6A 3MHUA 1VAHA 3VD9A 1OSEA 2VFGA 2WMJA 5BYWA 2I1RA 3NCOA 1DWGM 1VKFA 5JIPA 1R85A 2WOMB 3PJUA 3RO6A 5I42B 1RAHB 3S9YA 3VGBA 1IEQA 1VC5A 3A9IA 2DO0A 1C8YA 1M03A 3OTDA 3KRSA 3QT7A 1W31A 2E5GA 1R46A 1SJBA 3FA5A 6ENLA 3I0SB 2QV4A 2VASA 2FHOB 3OT9A 5KFQA 3DGBA 1F5AA 3AWNA 3LPGA 1F05A 5CXPA 2YDAA 4CEXC 5E2QA 3FIGA 3QATA 2DGOA 5K14B 3N6QA 3VX0A 2E6YA 4A3UA 3RR7A 3HVTA 4XZBA 2VZUA 5DG9A 5J2MB 3CCLS 4PMRA 2Y0SD 4XD3A 1LRTA 2ZH9A 3ARUA 4W89A 3WMLA 3NO5A 1VQMS 2PSNA 2J76E 2HK2A 3SV3A 2X7IA 4PXEA 2B8PA 3MMUA 2UXDF 5KFVA 1N54B 2NXIA 3LP2B 3BSCA 4JOUA 2HLTA 1J4EA 2ALDA 3G0SA 5KFYA 4IGNA 4DR4F 3AB4B 3MR2A 3E49A 1OK4A 4FS1A 3LCGA 1YJNS 2L9WA 2YXOA 1N5TA 5IFPA 1TKTB 1YYAA 3WLSA 4F3HA 1U2YA 2G97A 1IEIA 1DLOA 3D2WA 1G01A 1C1CA 3LI1A 3BSGA 2WVVB 1E6PA 3GH5A 2FLLA 4CVWA 2E40A 4I8YA 1VBGA 1PZ3A 4NXMJ 1BC6A 1FWNA 1ACMB 4H83A 4OQVA 4PMNA 1L3KA 3RB4A 4R7WA 1IXNA 1K8CA 2RRBA 1YI2S 2CJYB 4Q8OA 4R7OA 5LZLA 4AD3A 3M1VB 4DIAA 1E51A 1W9XA 4IT1A 2GK1B 1HQUB 3B9DA 4IG3A 3VIGA 2HMIB 3CH0A 3TAKA 4MUPA 5LNVA 2P9GA 2V8VA 2E7FA 2IYGA 4MB3A 1HWKA 3RFAA 1WEYA 4B9MA 2UZ9A 3M32B 3D6FB 4O4RA 1X96A 2KXHA 4D2JA 1UKPA 3L65A 3IUIA 5D0HA 4WYWA 4CH1A 2ZZTA 4JFSA 2E9ZA 3QSRA 3KJQB 3ANUA 1S1TB 4FYXB 2ZWZA 5M2RA 2DU2A 4DSFA 4C6OA 1IQ8A 4K4SA 2XWYA 1OC5A 2OTDA 1X8FA 4B9LA 1U22A 3DEQA 1GVSA 5J5DA 3AOAA 1R9YA 3CDUA 1AB8A 5JH2A 5GNXA 3CMQA 4QP0A 1JLAA 4DEZA 2P3ZA 3WO8A 5I07A 1RAGB 1MEWA 2NV2A 3SADA 2DUXA 1LK5A 4M8UA 2ZKTA 4GVFA 4Q4MA 1N6QB 3AIWA 1OYDA 4RU2A 4TVUA 1RU2A 1TJ0A 3E02A 5D0GA 2IAJB 1WZLA 1KCKA 2OMLA 1S2WA 3PUGA 3MPYA 1BF2A 4NCBA 4NZ7A 1U0HA 2YKPA 3LQLA 4C48A 2KKHA 2R7TA 2HHQA 7TIMA 3TYUA 3GZAA 3TLQA 2VFDA 3M6XA 3GIYA 1TQXA 3PBVA 3EGZA 4IIBA 2X1GA 3MHFA 5H1SV 3PHTA 4HSOA 2Y3YA 3KLGB 5E6ZA 3XINA 3AA8A 2OTJS 4HU8A 1T6MA 1E4MM 4JAWA 1TPEA 3WLMA 1HNVB 1QBAA 4YY3J 3UDLA 2O7SA 3L66A 3BO3A 1R86A 5JUMA 5ITHA 1O0PA 1P0DA 1OZQA 4TU1A 4ZQOA 2XNRA 2QN6B 1XC6A 1IE7C 3TTYA 1XMBA 4US6A 2HPUA 3ILOA 3KUGA 5EL1A 3W73A 5AFDA 4EXBA 3W7EA 1O5RA 4I8DA 1XLFA 3GIRA 5AYBA 1B0IA 5KSWA 4H19A 2W9BA 1BGGA 3S46A 3AZRA 2D2HA 3QGAC 1SXLA 3TX9A 4X66F 1CXKA 1RVGA 3PFRA 3GCWP 3OFHA 4PQUA 1WDRA 5HVGA 1N5VA 3ELHA 5CPNA 1NDVA 3IBWA 1C93A 2YB1A 2IJNA 4C1NB 4JI2F 2DT3A 3W5YA 5CBIA 1MW0A 3UR5A 4J2PA 4W7UA 2Z4PA 4G65A 2PBOA 5E3QA 2VA3A 2FZDA 1HL6A 2HDJA 4MTPA 5C70A 2Y8YA 4RV3A 3QYYA 5ETLA 3VFLA 2J7WA 3BMXA 4H4KC 2BG5A 2PDKA 4BDPA 3V5FA 2HGNA 1J6OA 3CUZA 1K77A 1QW8A 3EVMA 3EX1A 1YZ6A 3KVMA 2GGPA 4OKDA 4KGZB 3IJ7A 2ICSA 5J2PB 1XBWA 2X40A 3KUMA 3M9YA 5TNVA 4DLGA 4KO0A 4DR2F 4MLJA 3FX4A 3E74A 3BCDA 2AF6A 4OV9A 2FHCA 2GYIA 4WSHA 4MIBA 2C0HA 3AO0A 1HI0P 4LB3A 4M5PA 3SDEB 2W2MP 1S5ZA 1QK2A 4S2CA 4RNNA 1DJIA 4DSKA 5CSYA 2ZCGA 1ECQA 2V2QA 2OO0A 4LSLA 3FKRA 1FKPA 4C8KA 3QRRA 2Z1XA 1F6KA 4NLYA 3GIQA 1X8DA 1EP2A 4U5KA 4EK7A 2BE2A 2VGIA 4IP7A 1W37A 6TIMA 3ECQA 3KP0A 3CUGA 3N11A 2O67A 1KFBA 5HI7A 2Y5JA 3CMGA 3KOWA 4MY8A 1OK6A 1CULB 1UEKA 3GUGA 3USZA 2CETA 4WU3A 3RYLA 2JKAA 3GZ7A 1YXCA 3VABA 1RTJB 1XWYA 3ENLA 4MKYA 4HTJA 5MKGB 3H42A 1I0DA 1YPIA 2EPLX 4P8VA 1NK5A 4OZNA 3UNGC 2HISA 2PDQA 3T1GA 4RUAA 2ZE3A 4OI1A 1PC5A 3JSMB 5J1EA 3CCTA 1LJYA 4G1NA 3CLWA 2F7VA 2APOA 1UCWA 3MEEB 1JG9A 4HPNA 4U7UK 3TV8A 1RQ0A 2GVEA 3WDOA 2P5VA 4EAMA 4F9DA 4IG0B 1JLBB 3E8OA 1TV3A 3N2OA 2KG1A 3ZM8A 4RW4A 3VAGA 5C55A 5JXQA 2P8BA 4JTCA 4I2PA 4MVAA 5IC4B 4XIAA 3JSBA 4IDKB 1VRUB 2RJHA 1UL3A 3AOCA 2J9XA 3LCIA 2WB5A 2FZCB 3FBCA 4Q7NA 2XMTA 5FOOA 4D6HA 2OZ3A 1R30A 2V34A 3FBEA 3C14B 4DQSA 4N7QA 2GQAA 3LPYA 3W26A 2VUNA 4S3AA 4B08A 2L08A 1UR0A 1HBMB 2J7BA 1VYRA 2F63A 3EPOA 2ZX7A 1YJ9S 3K5XA 3VCCA 2W1BA 4O1DA 4UC5A 1FDYA 4JQ1A 4UTGA 2O9TA 1VBJA 1PIGA 2HGLA 4I3GA 3NNCA 4K7QA 2HSEB 5JUVA 3D6TB 3RBEA 3T78A 4B3RJ 3DLHA 3AXKA 1M5HA 1ODUA 2V4JA 4EKJA 4AD0A 5LMUF 3M6WA 3QNWB 1B0PA 3QJJA 1T40A 3WK3A 4CNYA 4TLRA 4LSNB 3S5OA 3MCOA 4EE9A 4H4KA 2OSXA 3UZXA 5FEPA 4K8RA 3FMWA 5C7VA 1LQ2A 3G8TA 4N47A 1EA9C 3F44A 5B09A 2A0FB 3PEHA 3K30A 4ZN3A 1UKQA 3ABXA 5FJOA 2MUCA 2QIIA 1RT6A 4ZQPA 5HJLA 2WW4A 3M6YA 4EF8A 3DLKB 1W1TA 3PV8A 3O16A 4YYCA 4QYZJ 3PZVA 1CLXA 3G6XA 3N13A 2WVTA 4RU9A 1OY6A 3JUGA 3JYTB 2QC3A 4MK8A 2BW2A 4DHVA 3DOPA 2E5JA 1EX1A 2BMBA 2QUNA 5EMLA 1SV5B 2B56A 2KL8A 2DZPA 2MZ1A 2YNFB 4TQRA 2AQVA 4AZ5A 3RZAA 2EJAA 1CJVA 3H2AA 3S5NA 2VZOA 4HNTA 3B0YA 2DT0A 1RBLA 3LTSA 4XTTA 2FYMA 3F5KA 1HHQA 1WPCA 2FVCA 1U47A 3BGAA 4LVOP 1WG5A 4HOWA 1YIXA 1F07A 2NLIA 4S3FA 1QNVA 4URGA 2W9CB 4UBPC 4AFFA 1WTFA 3TI0A 4ZVFA 2B9YA 2VDGA 4B5XA 4JBCA 4L4MA 1ZYQA 3C2YA 5E3PA 2GCFA 3L2MA 4CN4A 4ZCLA 2TSYA 1R3NA 3A4AA 3S7RA 5SUHA 3TUZC 1A80A 3W9JA 3AIRA 1VC0A 3MUTP 2CNKB 2LEPA 1EX5A 4KEVA 3UT0A 2A7PA 3OU8A 4ZXOA 3WH7A 2ZHOA 1FNMA 4DPTA 2CJXB 1ZPVA 4GBUA 4JYEA 1XR2A 1TRIA 3HDSA 4GJIA 4GC6A 3VAKA 1DHKA 2V5CA 2H5JB 2ZZ5A 3KWXA 3GG8A 1XRTA 1BD6A 2VZVA 4Y6IA 2V0TA 2XZTB 2PRMA 1TU0B 2CZ4A 2X7WA 5G2IA 1WTBA 1G2EA 3QMSA 1M3UA 4S2BA 3HFKA 2X0YA 3AYVA 4WDUA 4QIFA 3GAYA 1PZ2A 2HVIA 2NX3A 3S5SA 4DWIA 2E0PA 3RRGA 5CYQA 3LBOA 3DFTA 3O7UA 2KG0A 2BR0A 3NYZA 2KAUC 2J0XA 3SCPA 5E5CA 4AAJA 3V0SA 7FDRA 1AJ0A 3OLBA 3CAQA 3QPEA 2AX1A 3TA9A 5E0CA 1JNZB 2I6WA 3EYZA 1KBRA 2YKMB 4ZVUB 2J0SD 1HQUA 2MKJA 4AD4A 3MAAB 1YTYA 1G67A 1V0MA 3Q67A 5K4XA 4JKLA 3WQDA 4E4PA 2BKOA 4NEYA 1Y3JA 1QUMA 3SIMA 2ZOXA 4DFJA 3CJ4A 3LQGA 1TTIA 3PZMA 2OT1A 4ER8A 1OD8A 4XDDA 2YXXA 4ANEA 3BW2A 4MIMA 3POCA 4Z0JA 4KHPJ 3F4VA 2R94A 3JQJA 4DF2A 2C28A 1R3RA 3KBNA 2OXNA 2V5JA 3KG4A 2ZBRA 4O1EA 3H8YA 3CJSA 4B3KA 3GVVA 2B0GA 1KKHA 1RT7B 4D6IA 1U30A 3QV7A 3BDPA 2Y62A 2F8EX 4ZVGA 3HGSA 4AEOA 1K70A 3M30A 4HMCA 3K57A 3I5BA 1UIPA 1OD0A 4N9CA 3UGRA 4DY1A 5D6GA 4XPEA 3TZZA 4Q4SA 1OMSA 1N6QA 4BQ4A 5BWFA 3VZHA 2X1SA 4UFKA 4AZCB 4O3NA 1ZJHA 1MO0A 5FAGA 3CMAS 3MA8A 4F3OA 3FZ2A 5DRCA 2ZC4A 4HYKA 4TN2A 3ZVIA 4WOQA 1Q2SA 2P8CA 2A10A 4A21A 1YTDA 2XPKA 1I2RA 1RT5A 4I9TA 5CZKA 1UD2A 1YSJA 2JNJA 2AMGA 1XF0A 4LRSA 3G77A 2N4DA 4JFUA 1CQNA 2E1RA 1MI3A 3E5BA 4Q0BA 2DHAA 3T5JA 3CCUS 3VQTA 3KHGA 5ABGA 4X0NA 1ZAVA 2PU1A 5G4HC 3BTNA 2AEFA 5L46A 4ATWA 4MKBA 1Q63A 3V5RA 3VHQA 4E3VA 3THQA 4LBPA 3C8YA 3LV6A 4GOAA 5E93A 3RJMB 3K8KA 3M6VA 3A8JA 4R88A 3G22A 3UXAA 2XB2D 4MLRA 4L6V3 4IF2A 3CJ8A 3U7BA 4Z1DA 5GQBA 1WBHA 2ERRA 1NDWA 4DB7A 4IL2A 5TBOA 3IG1A 4MPQA 4C6QA 2OPQA 3B4UA 1D8CA 1ONRA 3VDAA 3RLHA 4EXAA 3AT1B 1R3SA 4IXXA 1F73A 1FDJA 2XIBA 1RU1A 3M8ZA 3TONA 4JL1A 3BLKA 3SCLE 1ADDA 1ELSA 2B8QA 1YW1A 5CZXA 3MSDA 6CGTA 4CLSA 1NDLA 2ZH1A 1W0MA 3CEPA 4MAVA 2RDXA 5K8NA 3GP9A 4UTKA 4JY8A 2E5IA 5I7GA 2E5HA 3OPKA 3NOCA 3OHMB 1TO3A 2I0XA 2N4CA 1PIFA 5EHHA 4QCEA 1JL8A 3VCRA 3W3OA 2WVSA 3QR3A 4ZEPA 3ITTA 2A2IA 4ROPA 3SCJE 1VJQA 1U45A 4R34A 1FWLA 5I24A 4NZCA 2ZXAA 1WG1A 2BGSA 1JLCA 4FSAA 1WUEA 4AZGA 4W85A 1I3OB 1UWAA 2EC2A 1JXVA 1JI2A 2UUBJ 2DZVA 1EGMA 2RT3A 1C3FA 2MKHA 2X1UA 4GUFA 3TTQA 4OYIA 3PW0A 4YTTA 1DTQB 3BYRA 2MHEA 5F1VA 4KV8B 2VONA 1ZP4A 3KYLA 1YE6A 2RKIA 3IC1A 4KGKA 3QF0A 1WHVA 3BJSA 2BRKA 3CC7S 5EWGA 1QU4A 3OTCA 2OIHA 1RGVA 2Y8KA 1DZ5A 4F0RA 1NO8A 1SUQB 3QRQA 1OS5A 2DSZA 3JQKA 5LHFA 2WBGA 3NO3A 4GFIA 3DCAA 2KYZA 1FCUA 1CULA 2QUVA 3CT9A 3FSYA 3GH4A 4HU4A 3EX2A 3HKZD 1SQ7A 3EWUA 2NVCA 4LCQA 5D4PA 4C0OC 3PWGA 5IOLA 1XKYA 1RTJA 4WIQA 1TX2A 1UUOA 4R8UA 3UU0A 3N6MA 1QNQA 2XGIA 5HROA 1ITUA 4WR3A 3CJRA 3DXSX 4O3PA 4XBSA 1NJZA 3IBFB 2Z7KA 1N7KA 4J9NA 1IT7A 1XD1A 3S01A 3S6EA 2DSUA 2KHCA 5CPMA 3KFWX 3W38A 2OR2A 4BWMA 2W9AA 4RE2A 4MJ2A 4NLVA 1Q1KA 3ZFVA 4MWAD 1JNRB 1XC4A 2Y2WA 2BZ2A 1CPZA 3PFOA 3IARA 3GHRA 1ICPA 4RNMA 3FV9A 1JLBA 4HA3A 3GIPA 1ZPTA 4WD0A 4NY2A 4M80A 2W2NP 2R9LA 3W27A 3BICA 4IDKA 1VRUA 2AWZA 5F0UA 3R8GA 1TUWA 5JQ9A 1UOZA 3W37A 1YHTA 4JI3F 1XG4A 3T6CA 2Q01A 3ZZYA 1WNOA 3H5SA 2MQQA 2FJXA 2B4OA 4BJHA 1PJ5A 5CYMA 1KONA 3UJFA 2QSFA 3QV6A 3QT8A 3PZUA 1AJZA 4F8RA 4IMCA 1N88A 1Y65A 4LT6A 4DR5J 3N3MA 1JLFA 2HAFA 4KMQA 1E3ZA 1PKLA 1EJXC 2BDQA 3IFEA 3AIVA 3QC3A 4N8OA 1NBEB 5ETQA 4AUKA 1IXQA 2BQUA 2DNZA 4GX8A 3WLTA 4LJMA 4IG2A 3VGDA 2QA4G 4EX4A 3EJMA 3CJKA 3DFNA 3C8FA 3EWZA 2PA6A 4UB9A 4QLKA 4WFBQ 4NLTA 4K4WA 3U3HA 1GQIA 2K1RA 5EFFA 4JX4A 3VNLA 4UQDA 2YWKA 3RNDA 1XYFA 1HR0F 3FSXA 4ZLPA 1D3GA 3N29A 3SEOA 4JNMA 4AQYF 1UD4A 5A8KA 4EOUA 5G0RB 2VURA 1SFSA 2W8KA 2MKSA 3P5ZA 1U09A 4KWWA 2GZXA 4L72B 2YNFA 1TMQA 4B2DA 1JPHA 5CLWA 2VD8A 3PZPA 4HHHA 1L8NA 3GH7A 3UBPC 2HIQA 4QZVB 3G1XA 2VFUA 2PB1A 5HN0A 3PBWA 2PN6A 4ONVA 4DJEC 1HJVA 3VMOA 3C2RA 5KFCA 3BE7A 3RGIA 3CEDA 1S7IA 1R5YA 2ZX9A 1FDAA 4USHA 2FD2A 4IH6A 4LRDA 5KG2A 1LZOA 3SZ2A 1D3HA 4OI6A 3HHLC 1U7LA 2JRSA 4HZMA 2H9AB 3T7VA 2OO6A 4MT1A 1JXLA 3TVYA 4F7VA 2IFXA 2J5AA 4TO8A 2Q43A 4LV9A 1FVQA 1L3VA 1SJAA 2C7FA 2Z00A 6A3HA 4MG4A 4YR3A 1TMMA 1Q8JA 2JH3A 4HZ6A 3LOTA 4UTWA 2GVGA 4ZCMA 2ZZ7A 4ZSTA 5AT1B 1LWCA 2WSKA 3GNRA 4XAGA 2V9KA 1Y5IB 1U1UA 7REQB 3QPYA 4USIA 1XMQF 3EMCA 3MPVA 1DWAM 3GYXB 1MW3A 4AMCA 3W66A 3M46A 3PFEA 4KFBB 5CH7B 4ECYA 1HNZJ 5F1UA 2ZQ0A 2M4MA 3CPWR 4KR0B 3OTOF 2NZLA 3L67A 3RXZA 4B3TJ 2ZIDA 1DTTA 2YOCA 4PG8A 3KBVA 2J27A 4WVXA 3EPIA 1GHRA 3Q86A 1W3TA 4CP5A 1P8GA 2REQA 3U7VA 1IZCA 3EWCA 5IFMA 2INFA 2OTLS 1SU5A 1KR0A 3KJFB 4QQUA 1DL3A 3BGRA 1N2VA 1KXHA 3LP1A 4P9SA 1OCNA 4IFVB 1J2BA 1AZSA 3I65A 3QQCD 1UJPA 3RX2A 1HZYA 4FZIA 1UETA 1XERA 5ENLA 4ZJLA 3ABZA 4NLGA 1Q66A 3GC5A 1YLXA 4CQAA 2WMKA 4NSBA 4CNPA 4DAIA 2QSWA 3DG7A 1S12A 1CCWB 3C2VA 5FJJA 4J90A 4MFDA 2EXOA 3CCRS 3RR8A 3N15A 3T1HF 4BC7A 2DT2A 4NX0A 2F4VF 3BBBA 4RWWA 4XAYA 4I7UA 3PWAA 2ACMA 4DLMA 5KZDA 3WK2A 1QAJA 1KXQA 4G1IA 4RWXA 3GU9A 1C29A 4GBDA 4ASTA 1M0SA 3LMYA 3BAXA 3LI0A 1SH2A 5KFMA 3NDYA 1R7OA 1IQTA 5LSOA 1EFZA 3FRZA 4DWSB 1L6YA 4KBIA 1VK3A 1TQJA 1O68A 4X84A 2A6LA 1N33F 1V6YA 1T95A 1J18A 3NCQA 2P0IA 3A4WA 2UUWA 2YFOA 2R7UA 3S9ZA 4JTHA 2IA0A 3DC2A 3MMBA 1N4LA 2QVNA 4RW7B 2G50A 4W93A 3T6BA 5ETKA 5A69A 3V3WA 3CIZA 2C3UA 4CUCA 3SW6A 1NH6A 3HHLA 4JI5F 2LCWA 4NZ1A 3K58A 2FHBA 3R43A 4IH5A 4D8AA 4C6NA 4UT4A 3O9NA 3WZ0E 3LNPA 3GCXP 4NLXA 5GAEU 1KNWA 2WRMA 3TO8A 4FNPA 3EICA 3CGTA 3GK0A 4QS5A 3OFEA 4QR1A 3UO0A 3WC0A 1S38A 3RPTA 3OHAA 6ALDA 3ZXWA 3PX0A 1XIFA 3W1LA 3RU6A 1L0PA 5TAOA 2F61A 2FJWA 4DQWA 3T55A 3BSMA 5D2XA 4KPCA 4JX6A 1B64A 5C6MA 1FTRA 2CUYA 1IXKA 3JZUA 5LXXA 1KFEA 2AJ4A 2H48B 4NKCA 4HVZA 4E4FA 3VZIA 2P88A 3MWBA 1QPNA 3PRDA 3DESA 4DX5A 3G4SS 2QXWA 2D3OR 1OB0A 2OG9A 1K1SA 1WG4A 4DV1J 1FKWA 3RM4A 2MQNA 4DV5J 2ZZ2A 4XAFA 1SO5A 1IKVB 4GKKF 1FWKA 3TEVA 2XINA 5CCLA 2D0FA 2OYMA 2PTXA 2GJNA 2XZ9A 3ABOA 2OHDA 2OEKA 3VE9A 3Q2SC 2HXTA 3K46A 5CJMA 5DGBA 1T9WA 3SIPB 1GVIA 2WWDA 3BH7B 2SFPA 2DNLA 3EDJA 5DANA 6FD1A 5DT5A 1GMUA 4J2MA 3UQNA 3NL5A 1XYMA 3IRDA 1JF6A 2BX6A 3MI3A 8A3HA 3T8QA 3I32A 3CB3A 4DQIA 3M8RA 4IMEA 2EBGA 2DXFA 4CT9A 5CQGA 4O14A 1H11A 2XZ7A 1WSVA 2YNIB 1ZM4A 4M5DA 2VBWA 3DGVA 2X1TA 4OBTA 1DJQA 3RB6A 4JUZA 4QTGA 1Q6CA 4C3KA 2YX4A 1Q7MA 4GABA 3OBKA 1QRQA 3NOGA 2KB2A 3UDCA 4RBUA 4KYZA 4DJBA 2V2HA 5EKYA 3M8WA 2X51A 4ALDA 2G0IA 2G0CA 1SUQA 3BL3A 5C54A 4R33A 3U1LA 2XM3A 3OLAA 4IPJA 4NJGA 2J0QD 1FHDA 3K1GA 3RRXA 5I3JA 4RW6B 3MR6A 2EFNA 1RA6A 4RLIA 2MY7A 1OG6A 3TYEA 5C7PA 4S3DA 1NFGA 1BXCA 3VOGA 3HSJA 4NEZA 4K8HA 1LWHA 2QF8A 2XM2A 3A22A 4GO8A 1OG0A 3QT6A 4MYAA 3NLCA 3EOLA 3IUHA 3MO7A 2PEVA 2AGKA 3MPDA 2I9UA 3JSRA 4HTYA 3E2EA 1YDNA 4ELUA 1DY3A 1HJXA 1UR8A 3OL8A 2QA4S 1GQEA 1I8JA 4FF7A 4GXMA 1BWEA 1R27B 1XIMA 4NYOA 2I38A 4AHQA 4XZLX 5K3VA 1XSKA 5KFGA 4YQWA 3RB0A 4CWBA 3ZTPA 5HUPA 3NVDA 4LUTA 4TMBA 4YMZA 1CBKA 1HNXJ 4LXFA 2R7XA 1T03B 4GNKB 4O57A 3D0HE 3RW7A 4G7EB 3CJ2A 4I56A 4TV6A 2ON3A 3HZEA 1W91A 2DH9A 3RHGA 3STFA 3DFHA 4B5TA 4D6EA 4LF8F 2I9SA 2D3LA 1FJ7A 4WPAA 2R8JA 4XZWA 1WEXA 4JNZA 4GUJA 4C6IA 4PMXA 4WWSA 4ALZA 2TMDA 4S3JA 5FI8A 1E56A 5F8IA 4XPCA 4F4ZA 3M5VA 1KR1A 2X42A 4AG0A 2QLWA 3V0TA 1G94A 1JPIA 4FP9A 3Q0AA 4KKOB 2CVIA 4DJFC 1B90A 1LW2A 3EDFA 2ZYFA 1UUQA 4K7VA 3NFUA 2B5JB 4IR1A 5LIYX 4MMWA 4N8NA 3EAUA 3AU6A 4A29A 4ETXA 4NYPA 1R6WA 1IKXB 3N9SA 3B54A 1RE1B 3GJSB 5KFXA 3GDTA 1E6YA 1SC4B 2B51A 4PUMA 3WJZA 1CJKA 1M5VC 3CIXA 1UJ5A 1HL2A 3U5YA 3PPHA 4LUYA 2RQCA 2GQ3A 2BJEA 5LA0A 4FF3A 1K0TA 1AFJA 5H8MA 5DFAA 1BYDA 3CB4A 1MROA 4QU7A 1DARA 2F8HA 3FYYA 5CGMA 2WPBA 3ILJA 4DV6J 1X4DA 4X4NA 3REQB 4QROA 5D03A 3RX3A 5HWJA 4OV6A 4NNAA 3GV5B 3QKZA 2AKMA 2HG4A 4HCHA 2OFHX 2A21A 4IGSA 4XO7A 2QMWA 3QFHA 3MUMP 1NDKA 3RM9A 4F0KA 2ZTKA 3VIIA 3PYFA 5E9XA 2OYLA 4OJGA 3T07A 2K8GA 1B3XA 3LLXA 3ISNC 4LSBA 3KHJA 1R2SA 3BQ5A 3MEKA 5HNUA 3PX4A 5A8MA 3RX4A 2ZA3A 1B7YB 1AJ2A 2E1AA 3EZUA 3OXFA 1DJYA 4HPXA 3HIJA 4IUOA 3HD2A 3MEGB 4KQZA 4CCCA 4C6PA 3LYEA 2X09A 2QCGA 4QYZK 3VIFA 3R7BB 2GOUA 1JPKA 2H4YB 1QAYA 5FDLB 3RYSA 1DXIA 4UUIA 4CT8A 1O66A 2HFUA 4K7YA 4ZPCA 1ZPWX 2J25A 4YHEA 1JX4A 2XH0A 3M05A 4C6LA 2RSQA 1VBKA 4RPQA 5IQ6A 5CAHA 1S9FA 3FGVA 4QU6A 3KLFB 3KOYA 2E5LF 3NNHA 3CB8A 3SCVA 1UZ4A 4JI4F 1RHUB 3O1NA 1G6CA 2YL9A 3M0HA 4N42A 5B0AA 4LFAF 2VHLA 5I3GA 3VD4A 1DPMA 3QTGA 4YLWA 4OX9F 2GGGA 3V81A 3UCQA 3S1WA 2C18A 1LXJA 4FO4A 5DDQC 4F2RA 1YIJS 3C4UA 2OMAA 5DMLA 1M68A 2HHVA 4HA0A 3PBMA 2HS0A 4OJ3A 1BWVA 2CWKA 2RAQA 4X22A 1RALA 3IGSA 4IFVA 3F41A 4R27A 3UJ2A 4CO1A 4XO0A 3MOJB 4YJ5A 1VLYA 1NSPA 2QJGA 3QJAA 1WF2A 2KO1A 2VG5A 1GXTA 4O0NA 4DJFA 3WNNA 2RRAA 4B17A 1KCZA 5BW6A 5CC5A 1XLHA 2P1FA 1GKPA 3GYNA 4DS4A 1QNPA 1YHQS 2LEBA 3B4DA 1UPMB 1V6VA 1KHVA 1YBAA 5H6HA 1TSIA 5U4NA 2FHKA 1LW0B 2QUTA 5A6SA 1K1QA 3TW6A 1QPKA 2JIEA 3EX7B 2CERA 3A6OA 4PEOA 1XLDA 3E2RA 3TJ8A 3LXBA 5B0DA 2Y61A 3ANYA 4F67A 4Y8EA 3CXCR 3SCTA 3G24A 5L1KA 4QJ4B 3AICA 2WSCC 1S72S 3ONBA 2DR5A 1RJPA 5B0FA 1G9HA 3ZOAA 2DHSA 5DJBA 1F9CA 2MQPA 1FWIC 5C24A 4PRFA 2CWXA 4JI6F 3TYTA 3WC2A 3EBVA 5E33A 3R10A 2QCCA 1HKWA 2YKAA 5DQIA 1WKEA 4QQBA 2HQDA 3PCOB 2F65A 1ICSA 4U5IA 4L1WA 4G6VB 1LDCA 3TYAA 4M5LA 1CGYA 2ACYA 3HT0A 5HLFA 3WQPA 4C7GA 2QL7B 2A3BA 4K4ZA 4L6DA 4OYBA 3NEVA 1XLGA 4HYVA 3Q45A 1S2CA 1U5VA 2YXGA 3R6LB 2YDRA 1A0OB 4K0KF 4ECQA 4H00A 1QNOA 3DRRA 2PA3A 2J9EA 4TU7A 1XP3A 2CC0A 4S39A 2CADA 3KLHA 1IF2A 3W87A 1HWIA 4PBEA 4GNVA 2PDYA 3DDKA 3Q8PB 1QWKA 3D3AA 3LZ3A 2VCBA 4J1OA 1RD6A 2ZH8A 6REQA 1MSSA 2D3UA 2GSJA 3GONA 4I6AA 5KT3A 1PKUA 2ZKUA 1XNQF 1AD4A 1Q4WA 3WQ5A 1BYCA 3VD3A 4AC1X 4G1PA 3C0JA 2OLWA 1W17A 3I6RA 3HK2A 2UV8A 1Y5LB 3L4ZA 5ABFA 3HSGA 2QGFB 2EQDA 5L6UA 4Y9NA 1VS3A 2G41A 1WC3A 2CXGA 3HMJG 3NURA 4WZMA 1PEZA 5HQEA 1NUEA 4X4QA 1WF1A 2O9RA 3FFIA 2NZ4A 4TYBA 3GW3A 2DZWA 4DYJA 5L38A 5IZHA 3LF0A 3QKEA 1US3A 1QAIA 2E1PA 4I64A 2IKHA 3A9BA 2XN2A 2ALYB 2ZM6J 3LA4A 1HNWF 2RHGA 3V75A 3WLKX 2J6XA 2DSWA 2NLWA 4BS0A 3PUDA 2CPDA 4DXXA 1RLCL 3UA3A 1TPDA 1B3TA 3RCNA 2CJ9A 2PMQA 4Q8VA 2O4QA 1W2VA 1LLOA 2G3FA 1CXIA 4QE1A 4ZXLA 1JR1A 5D15A 3I6TA 4NI2B 1JD7A 4Q8UA 2CYYA 2DNQA 4MDPA 5HWNA 3KK1A 4CNTA 3PHAA 4DM2A 1IEWA 4DV2F 1UKTA 2CLPA 4MKSA 1BHNA 4HTBA 1ITXA 4I1TA 2DNPA 3ZTSA 1W9PA 1MDLA 3DFOA 3P49B 2FIQA 3WY1A 3E3HA 1W26A 2DR6A 4CNZA 4BEQA 4R0EA 4AZ7A 5EY5A 3W63A 4S3KA 1KD1T 1DQ8A 1R89A 4WK9A 1T02A 3NR0A 3M2UB 1B9BA 4HI1A 3W02A 4ZS6A 4YCPA 2YNIA 2BKPA 2K7KA 2DIEA 3J81U 2J9ZA 3BUVA 2O5DA 1ZHAA 2J8SA 1MXGA 2CDQA 2HVMA 3G1VA 1JMTA 5M5DA 1Y7VA 3M47A 4AIOA 2ZEJA 1SW0A 4F04B 1Z6KA 1X31C 5G4DA 1LEOA 1NPRA 4H9UA 4PUKA 3ES8A 3VIOA 1VYAA 1BRLB 4DR4J 5KAKA 3IP0A 2WSRA 3L4YA 3IGNA 3W72A 2BHZA 1O8BA 1UP3A 3MQTA 2VZ9A 3GXIA 2DGAA 1XLKA 1GONA 2VJXA 3E12A 3MZNA 4A47A 4F9JA 2RQKA 1BLIA 2V5KA 1FA0A 2DGVA 1VFHA 3LERA 4QIWD 3WBXA 1ZJBA 3WCZA 4FPIA 3QHOA 3PTWA 3TP4A 2VGBA 1UMJA 2V2CA 5E3RA 1Q7ZA 4AZBA 2HZCA 5EPDA 1MLAA 2HPMA 3GILA 3WEZA 2BXZA 3UJRA 2QIFA 1A5AA 1X4AA 3T0TA 3KZSA 1HMVB 3U2OA 4XKYA 1SZFA 1VQ8S 4P5UA 3SYZA 2C2MB 1P0EA 4G5DA 2FGZA 1BXBA 2MTLA 1WOAA 1NWUA 1HHTP 3FAXA 2VFVA 4DUVA 5D2TA 2KT3A 4UOHA 4B5UA 1LLWA 2HBZB 1GYLA 2CFXA 4NYZA 4BCEA 2FTRA 4B5VA 1NK9A 1Z89A 2CAJA 1S2VA 3TAMA 3L7OA 1KFCA 3C0LA 1K7XA 3QW3A 3M8PB 2BB0A 3H55A 4XZMX 3HV9A 3NTYA 5HANA 2DTJA 1ENUA 2J13A 2IJRA 5I3UB 3O5TB 1HFBA 1FWHC 3APYA 5D9PA 2VB6A 2EPOA 2IPFA 3UVJB 3MYOA 4JTRA 4GVBA 4UMCA 2J7DA 2YGYA 4I9JA 1Y5VA 4UFIA 4XVDA 5F8MA 1Q0NA 2XULA 4O0ZA 1YJRA 4WXWA 2Q02A 4O19A 1MZHA 4ZO7A 2WVEA 4LIWA 1QI2A 2J8FA 3FSTA 2G5WA 4Z1CA 3Q2TC 5FEWA 1R8CA 3AOFA 1GG0A 3IBCB 1JIHA 3F2BA 4JL2A 3AS1A 4NZJA 4AH7A 1UWRA 3C0QA 2Z2ZA 2PRHA 1KM5A 3CQ0A 4EGLA 4ZJOA 2OEMA 2GGEA 4U7CA 1IBLF 4NUWA 1Z42A 4L9XA 1NKCA 1K9MT 2PIIA 3S1GA 4KETA 1E9LA 2FQIA 1OHLA 3D0IE 5I0DA 4IQDA 3TN4A 3NXZA 2DCLA 3MFHA 1SC3B 1KXTA 4YEAA 2HFZA 2YJQA 3H2NA 9RUBA 3DMJA 3N6HA 3CHFA 4N56A 2DDXA 3ZMRA 3LENA 3W5XA 2UUTA 4X66J 4I6KA 2YPIA 3JB9k 1VFFA 3LRMA 1CLFA 5KTLA 1GWJA 5L39A 4UIOA 1C4CA 3OA3A 3QLLA 3WFAA 4LR9A 1K8XA 4AXNA 3TMLA 1YNQA 2F6XA 4PTWA 5A8OA 4HEA9 3UCCA 1UR2A 4M24A 1W1VA 3ZIZA 2KFZA 2ACUA 2XY6A 2MEWA 5TD4A 1W5MA 4GD0A 4EAYA 1TZ9A 1XLMA 1IBMF 2BJ8A 3EPMA 3OBIA 2RUGA 1WKKA 1OJ4A 1EJ7L 1RAJA 4W7WA 2CESA 5GVJA 2DNMA 3N28A 3BPWA 3R79A 3EVOA 3ZQ9A 1ZETA 2E68A 3CTRA 1IGSA 5FF3A 2L9NA 1X1ZA 1TVLA 3A13A 4HCDA 1YNPA 2JDJA 1LORA 2DORA 3OQ8A 3M7SA 3BKUA 3FJ2A 4C8YA 4GYPC 2A3HA 1YX2A 5KINA 4ML4A 2DR8A 4W86A 1QM9A 2WKJA 4MF4A 3BN7A 1VF8A 4JYFA 1JKHB 1QVGR 4BY3A 3VALA 3UF9A 2NPFA 5KFZA 4OUIA 4B3OA 3O07A 3PVFA 4UTJA 4LY4A 2IQDA 3MECB 4UCFA 1RBOB 3EXRA 1BKHA 1E1EA 3Q58A 4ECSA 4HPJA 4ZKAA 1G7CB 3SN1A 2QMXA 1ONWA 3SBFA 3PM9A 1FFQA 4BEUA 2HQGA 2VQEF 1RTIB 3IS4A 2V30A 1GMVA 3M5YA 1MWYA 1T3OA 3AAMA 1QHOA 3AYSA 3CHCA 4O10A 5B0CA 4WU2A 2G3JA 4UNIA 3P5YA 3APTA 3C15B 5CSRA 4ZE4A 1D7FA 3DM2B 3AOBA 3MDUA 2XWEA 3PM6A 4PFMA 4OZ2A 4B9SA 2WWCA 3R5CA 3W7NA 1XRFA 3GVRA 2XISA 1SR0A 1LW0A 4X65J 2A6OA 3O3LA 4X0VA 1Q5MA 4XAZA 1BVWA 4N4QA 1U1RA 3WLPA 1K4HA 3LBMA 2QCMA 3W2LA 1XC9A 4R85A 4J9RA 4K4UA 2RQ4A 2HV5A 3P62A 2MZSA 5LJ3Y 2Z1BA 1O1ZA 1WJ9A 3BAKA 4OGZA 2XI3A 3D5HA 3R6IA 2QCDB 1V6XA 4XV0A 1LFWA 3PFMA 4LVNP 3HHDA 2B4VA 2EFGA 2HHWA 3ZR4A 2PDXA 2M5YA 3W60A 4OECA 3BH4A 2B9EA 3UY8A 4M5IA 3KEHA 2WLZA 3QR1A 2WAQD 3T9PA 4DUWA 1WZKA 1V3RA 3IM9A 4PXBA 2PDGA 1EH9A 1GX5A 4K39A 5ETMA 3A3OB 3MHYA 1PSCA 2Y6ZA 4V28A 2ZX6A 1FXRA 4UY85 2FLOA 1R3TA 4YTQA 2EG6A 4JTJA 3PB2A 1LT7A 3MCMA 4OZJA 3V35A 1TREA 4RDZA 3RPDA 5HXMA 4PL1A 2XSFA 2J62A 4HB7A 5CZSA 3VD5A 5GVQA 3B04A 4KHMA 2HBVA 3HO1A 1Z3NA 3CC2S 3LCXA 3MU7A 4E4UA 1S59A 3U9IA 2PBGA 1MMFA 4Q33A 2CKRA 3AISA 1GPWA 5E6YA 1LOSA 3W71A 4LT9A 4PMQA 3JW7A 1R3QA 3Q8VA 3SXLA 2UUCF 3HGRA 2ISWA 2PCQA 3BLEA 4QEHA 2ONEA 1NK4A 3EX3A 1KLMB 2D2GA 3N19B 2UZAA 3N6LA 1ZY9A 4XWUA 1LYXA 3CMES 3HG4A 1A6LA 2XLIA 4HT3A 4GKTA 2CNOB 2BHYA 4AB4A 1YJWS 4OJYA 2BGNE 2MNRA 3D9BA 1QPRA 1SQFA 3P0WA 3PX6A 2O9PA 1RHCA 2VL4A 2YCKX 3NSNA 1PJ7A 3PKYA 4YVPA 3PJXA 1OFAA 3W1UA 1E73M 3B0VC 4EO6A 4ZZ9A 2CPFA 1PXGA 4OYWA 2WZTA 2JEFA 4DPOA 1PG5B 3CZKA 4JTDA 2J74A 2HCVA 5DXYA 3A12A 2DVUA 2OI2A 4WP3A 3IAM9 1LBLA 3HGOA 3ZC4A 1O51A 2J7GA 4GZIA 4RDWA 1C8QA 2VQTA 2NV1A 2O7QA 4NZ3A 4RE0A 5CZJA 4C91A 3CQHA 2IBOA 2QE5A 4EYIB 3B8TA 4FIRA 1XEZA 2ZJPQ 4CQ9A 1J0HA 1BQMB 3TWZA 3BARA 3CV6A 3WL0A 4UOFA 2AL2B 1WF0A 4KE5A 3OJSA 4J9SA 2M9KA 2RH9A 1H7XA 2NQHA 3P61A 1HF6A 3THPA 3N12A 3H40A 1KWMA 2FZGB 2FY1A 1Q81T 3FY1A 3DHXA 1WZAA 1VK8A 4F4YA 3PULA 4AYBD 4AQLA 2JBMA 3KL0A 3HJVA 1S6UA 3D1QA 5DDRC 1QATA 4Q6JA 2A6NA 3G2XA 1FRIA 4LREA 3QVQA 1VQYA 1KRPA 3C6CA 4LF9F 5FJPA 3G6LA 1EOMA 3TQ1A 3ULHA 4XUGA 1UZHA 3Q24A 4YDXA 1WUUA 1CI1A 2QAFA 4O0QA 4M7SA 4WHBA 1Y5XA 2BE7D 4YMEA 3QIPA 1V9OA 1I2OA 4CD7A 3H7HB 3VDGA 3LLFA 4CM2A 5H1WA 5FF2A 1J5SA 1IZKA 1FH7A 2IPWA 1S4EA 2AKZA 2IPJA 2XWDA 3WUGA 3DLGA 3GTIA 3W62A 1HYSA 3P82A 3N79A 1KQYA 2OB3A 2Z29A 1JQGA 3L5LA 1T94A 5LXRA 1CC8A 4ZHRB 5K9DA 1RWPB 3DXIA 3J7AN 3GWQA 3PBUA 1SCJB 1RHRB 3TUUA 3SY5A 1J5OB 3D6HB 4XX6A 5HAOA 3M9NB 5D33A 1YBUA 3H12A 1RWNB 4IQMA 4AXKA 3DI1A 4J3ZA 2A2CA 4DCPB 3UDEA 4LFBF 1JXEA 3EDDA 1TVRB 1TUVA 1GYMA 1OCBA 1PC4A 3GNOA 2VOOA 5A8WA 1NDZA 3TAOA 4R5EA 3U4FA 2FHJD 1I6JA 3BG5A 5F2LA 1NAL1 1C7SA 1O12A 2J75A 1KM6A 4OU1A 4CNOA 3AY0A 4CCEA 1FRMA 3ETOA 4JNYA 4B92A 4ERGA 1W5QA 4DBWA 3DYOA 1EHWA 2XN1A 1UVJA 1FTXA 1RJRA 1VI7A 2NT0A 1NELA 3A24A 1NB7A 2NPIA 4ZLJA 1K3UA 3OVGA 4WY0F 1VQLS 3BSHA 1LOLA 1RTHB 3OZMA 1QJWA 1TR9A 3WLQA 3P3BA 4HCLA 4LNCA 2QMKA 4AX6A 2PWGA 3DHDA 3WQ8A 1TV6B 3C5QA 1TK5A 2FKPA 2HBXA 5DBTA 3TYZA 4O3QA 5T9BG 3ZTRA 2YBVA 4X3ZA 1X97A 2WNWA 1FK9B 1DXEA 2LP4A 1J12A 4TTUA 3KLIB 2BYCA 1I75A 3B9NA 1A7GE 3JXOA 2ZUWA 4UQGA 3CGIA 4X4PA 2RFGA 1E70M 4MMOA 1QTWA 4QGCA 1DOSA 2LU2A 3NGUA 3QGHA 3LN3A 1YJUA 3U27A 4IQEA 1W56A 4AIEA 2E25A 2XMAA 5I79A 1A4LA 3GIIA 5HPOA 3DRSB 2HFOA 1DORA 3VMNA 3HZ3A 2MQMA 1CC7A 5GAGI 4XD6A 5F2GA 4JDYA 1ZENA 2L48A 2PGWA 4Q45A 1E1CA 4A3YA 2IXVA 5CPOA 2XMJA 4UQTA 1ZZNA 1S6QA 1EBHA 3FFSA 3PS7A 1D2KA 4P8UA 1SH0A 4UOQA 4LF4J 3INPA 5CXTA 1V0KA 1OSDA 1EZZB 4HN4A 2CLFA 3TNBA 4TU9A 3FOKA 3D1HA 3P3DA 3MUCA 3R13A 2M70A 5C25A 1IM4A 4GVHA 3TFCA 3EOSA 4ZLLA 3QWPA 5G5IA 1D3WA 2XLKA 3VC6A 4CD8A 3HF5A 2FVPA 1WDQA 5JVLA 1P1MA 1UHVA 4I9AA 1U83A 2ZH3A 1T3NA 2Z6JA 2QJMA 3VVUA 5A6AA 1VFJA 4UZCA 3JVAA 3G18A 4FXVA 5LNWA 4R5PA 5IBXC 3DRYA 2V2ZA 3JAMY 2F8MA 2XYHB 4Q7BA 5FACA 4JYAF 3ZR6A 4DR7J 4AISA 1G1XA 2W92A 4JV1A 4LCSA 3T40A 4PCQA 3GFHA 4OYZA 2ZRWA 3C56A 4K4XA 1XPYA 2PT0A 3II1A 3M6DA 5LSRA 3L0NA 1OIAA 2AL1A 3V5OA 2YLAA 5HJXA 3I9V9 4M5KA 1TTQA 2VH7A 2BM0A 3KVJA 4AWTA 4P74A 4USKA 1XL9A 2I5QA 5C7HA 1NRKA 3B4MA 3VZZA 1MG7A 2BANA 2FVLA 5FIPA 2ISSA 1SJDA 3HN3A 3CPRA 1U8WA 3AS2A 1R0CB 4Y9AA 3L4TA 4OT7A 3PB0A 2FJBB 3Q83A 1AQ0A 2KRRA 1ZBTA 1H0HB 3AA9A 2B4GA 5K9FA 4B3SF 1A47A 4NCGB 2EHHA 1DQUA 2YFNA 4S1FA 4PEEA 3G0XA 3VINA 7ODCA 5H2ZA 1PAEX 5HMSA 2HPIA 3AU2A 3HFZB 1FWEC 1UUMA 1NLKL 2ZJQQ 2GWNA 4FBTA 1OZMA 5LYRA 2C2OB 2LQ9A 2C2ZB 4Y2MA 2RS8A 5L9NA 1BPLB 2HTMA 1IYXA 2V2KA 1QNRA 2AYBA 1D8WA 3NQ6A 3LWMA 1TCMA 4CD4A 2RH3A 1TE1A 2DPEA 1S46A 3VUSA 2QLBB 2R7SA 4PL2A 2RVJA 2I2YA 1FHUA 2UVRA 1FI4A 1LKZA 2VG7B 2FJKA 1A3WA 2QCDA 3H0PA 3NDZA 2NUUG 2F9JA 2J8AA 3X3UA 1PBGA 4GVLA 3P8IA 2E66A 1REQA 1XCFA 1YE4A 1XQLA 3W24A 2GDUA 2YIHA 2NQ9A 3IJIA 2HNDB 4GC3A 3AHZA 3E0FA 3MM7B 3TQ0A 2DT9A 1EWDA 3SBMA 3SMZA 2E29A 4JI3J 1TL7B 2EFOA 1FX6A 1H1NA 1L3UA 1E72M 2R91A 1AYEA 3PPFA 4ZODA 5M2FX 1CGUA 4LVDA 2W61A 3CCMS 4DLFA 2HHSA 3EDQB 3PO4A 4KHPF 4JICA 1R7IA 4RXGA 4KT0C 3WD3A 4I69A 3UZYA 4K6AA 1NHUA 3SO7A 1ZAXA 2HWHA 3SSJA 2GUBA 3UWEA 1OX5A 1R8LA 1BQCA 1WKLA 5EU9A 1ISYA 3U2CA 1IUJA 3GFZA 2ZD1A 4DG1B 5L1LA 3UN2A 3O8AA 3V18A 1IVZA 1QDSA 4RPPA 4H6QA 4RZ4A 1U24A 1A5NC 3UD5A 4MH8A 1OX6A 5I3FA 2NXHA 3I7SA 1SQGA 5IBXA 2OX1A 2EPNA 1PILA 2VHGA 1MFUA 1U25A 1PTAA 4NRTA 4EPEC 1KLZA 2CBVA 4NG3A 1LRNA 3RM8A 4ZL1A 4M1BA 4OYMA 3GR8A 4U3CA 2ABAA 5AYXA 1RWVB 2WCSA 3IJQA 5FJUA 1K7EA 1I0BA 2YCIX 1OCJA 3I31A 2QX0A 5K8MA 3H2VE 4G56A 4QSHA 5GNYA 4Y2IA 4P75A 5ETVA 1DIDA 1BQNB 4ZP6A 2WSPA 1MUWA 4TXSA 1A5BA 3I4KA 1YITS 2ZA1A 1US2A 2ZVIA 5DG8A 1A53A 3M9MB 1BQGA 4YWIA 2WONA 2RD5C 1ME8A 1NP2A 1CJTB 1V08A 2NX1A 4ILMA 3BV7A 3VVTA 1J2WA 1Z41A 4EANA 4UOZA 1DJHA 4CYUA 4QIUA 2NWRA 1OGBA 3BOLA 2XTKA 4WDXA 1N5QA 3BG9A 4M1RA 1K7FA 1RP9A 4DZAA 1S6PB 4ZFCA 5BMWA 4O4GA 3PNUA 5BWAA 3GV8B 3BQ1A 1S5MA 3V0UA 4DL2A 3EZ5A 4W5ZA 3HFTA 2CZFA 3E5PA 2X3DA 4FF1A 3SUUA 1OX4B 2VUGA 3W61A 2VC5A 3BO2A 3U57A 1QR7A 1P9YA 1XMQJ 1M04A 2AL2A 4JOMA 2XGPA 2FHFA 1EDGA 2FY8A 4L74A 4JIPA 3CHVA 3P67A 4XUYA 3I55S 2HE5A 1H7PA 4INFA 3I3DA 4WJBA 4FR6A 3OTOJ 3GTXA 3DBNA 3RLVA 2PSZA 1NM2A 4QCFA 5D8ZA 4WZHA 5M1TA 3NL6A 2ZVSA 3VGFA 3NGDA 2VC1A 4H3DA 1PO9A 1ZL1A 3CT7A 2B3TB 2C2RA 5CPTA 2ALRA 2JOQA 4M5MA 3DFSA 1KOHA 4HZ8A 4UZSA 1HGWA 1LWJA 1UH3A 3H7UA 3UVIA 5HJYA 1IBKF 1U1MA 3BO9A 2UUBF 3OYZA 3NGKA 1X60A 1TRDA 1JYNA 4NAEA 5JJBA 4CLUA 1X5OA 3W88A 3B6BA 1U0SA 2ZHAA 3NNAA 3D6MB 2MSSA 4EUVA 3GC4A 3NEHA 1E6ZA 3T1HJ 3RW6A 2J66A 5IDIA 5BR8J 3DYAA 3SURA 4L4LA 3T44A 2R14A 1UROA 1J5OA 2ATMA 1P1LA 1UWBA 1XH0A 4POCA 3QO9A 3QJLA 1TMLA 4HPHA 3CZ8A 4GCAA 4FNIA 5IM0A 1ULRA 4GQBA 1MU2B 1VOMA 2WQPA 1UVIA 2JX2A 1GOKA 3JRKA 5K2ZA 4R9XA 3SFUA 3BBFA 2BJ7A 3EGNA 5J8LA 2MGZA 4CLPA 2FHMA 4U67Q 3Q8UA 2UU9J 3KWMA 2NQLA 1TJRA 3K5LA 3MV01 4DRSA 2DZSA 2F9RA 3NUKA 1GOIA 2HVZA 3I4PA 4J27A 1RK6A 4FLQA 4DBDA 1W3LA 4LEQA 2J9DA 3WFLA 1QW7A 1RPKA 2IKJA 4K68A 1JDDA 3FAWA 3B8UA 1UP0A 4JI5J 2JE8A 2L9DA 1IWGA 5D02A 3CM4A 3THDA 3EWWA 1FK9A 3G86A 3W9HA 4J3UA 3EWBX 4D1JA 3BBCA 4Y65A 3RCMA 4OX8A 3UJSA 3UD3P 3UERA 3CASA 3CCJS 1R0BG 4JTQA 3WQWA 1D3CA 4UMBA 3NOYA 3QM3A 1W32A 3KL5A 2WVDA 3PYGA 1R3VA 4ZCIA 1UFKA 3LV5A 1Y10A 4DR5F 3M4XA 3H6OA 2KYXA 4Q8PA 4DN9A 1Y00A 1QTNB 4M29A 3D54A 4C6FA 5BJRA 5D78A 1DBDA 1HBNB 1XCWA 3EA3A 5B7YA 2XS2A 2NXEA 3IV3A 1ZOTA 3GDKA 3R0UA 4I7FB 3B8IA 4LOCA 1DWHM 1J0JA 2A1YA 1O95A 1IKYB 1H41A 3VV2B 1HXJA 3BR9A 2VV5A 1T41A 3HA1A 4DU8A 3FK4A 3LUTA 1H7WA 2YVSA 4JX5A 2PMWA 3SZ8A 2VEMA 2QL9B 3L4XA 2C2EA 1YPXA 3K13A 2RJZA 4A6GA 3B9EA 1XGDA 4C7FA 4P61A 3E2QA 2IVFB 3DHFA 3OQ2A 2CLOA 1J5EJ 3T8LA 3RTVA 2RDTA 5I5RA 4ED3A 2P76A 2ADAA 1GG1A 3VI2A 1UKOA 1O4UA 4KRUA 3TROA 3ZJ8A 5AHNA 4WBFA 2HVHA 4LR8A 3O3RA 2BTMA 1CW2A 3OIHA 4ADTA 3WF2A 1CBGA 3R89A 4MYXA 4NNCA 5D0RA 2IJFA 3T9ZA 4ADSA 2EG7A 3CZGA 3MI6A 3M0IA 3ID7A 4NMLA 3OZYA 1WOSA 3I6PA 5A6WA 4GK8A 6TAAA 3FEQA 3PUEA 3QGPA 1VIWA 5H8UA 4UW2A 1X4CA 1KTCA 3UWQA 3NL2A 2PDLA 4DM1A 4ENLA 5SWUA 3TOPA 4HACB 4MWAB 3A4JA 1JRCA 2JKPA 5E0OA 1QW9A 3KHHA 3UA4A 3KP1A 3LCHA 4IJRA 3HB9A 2D0GA 4O13A 4G3IA 1K02A 4I2QB 3GHTA 3PP7A 2B7PA 2RE1A 4N4PA 4NZ6A 2E6FA 4GKLA 1AFIA 2NXNA 1JJKA 3CJ5A 3MMAB 3VAJA 5EN1A 4W4QA 4NILA 2QA2A 3KLKA 1TQLA 4RZBA 2PD9A 3L7UA 1Y7PA 3PG9A 1S1WB 2G4BA 2HS3A 4U9RA 2QO3A 4DI6A 3KLEA 1HNZF 3UCGA 1UG6A 2G3IA 1XYCA 3VF0B 2NX9A 2R1PA 2H4WB 4WP9A 2Q79A 4B3TF 2DNKA 1P43A 3CBWA 3F0NA 3BQ2A 4GY7A 4US5A 1VB9A 3APGA 1U1PA 2J6SA 1C0UA 2AQ4A 1EP3A 3KK2A 1PL9A 5K8OA 2XSXA 2CITA 3CJTA 2UUAF 3P96A 2VC6A 4LMZA 1Y11A 1Z1ZA 1FKAF 4ZOBA 4H6RA 2JLFA 1VEMA 5T7LB 1DRZA 4FYVB 2ZZMA 4WTOB 3THVA 3MSGA 2PD5A 3MKKA 4KAIA 4DN0A 1FWWA 4H8UA 3NQGA 3N9UC 4WIIA 1G0CA 4HSHA 5CZVA 2Z2UA 3IAS9 3FS2A 2ATSA 3SI8A 1FKXA 2I17A 1V4YA 3AUOA 3H2OA 1HT6A 4AUBA 1JK9B 1TV4A 2CHOA 1S4FA 2GAGC 4HBKA 5AXNA 1S99A 2LLZA 2XDFA 3DRXA 1ALDA 3LSCA 5DCBA 4Z1YA 3CW2C 3W7BA 5DQGA 2GVDB 3PSWA 2C1EB 2H54B 2QDHA 2GQQA 2IY5B 3H7RA 1NFPA 1C0TA 5AHEA 3EZOA 2HRTA 2BVYA 4JTSA 2LLEA 3HLUA 4J3XA 2AZ3A 3W1PA 4B16A 2A1BA 1TUGB 1HNIA 2QR6A 2HNZB 1OYAA 2FTYA 1IXOA 4IUFA 1HARA 4OHYA 1IV8A 3TQVA 1ZU8A 4OFZA 1V8EA 4DU7A 1VPXA 4XZ9A 2ZUSA 5C9ZA 1WYIA 3HM9A 1AVAA 1L6FA 4BWJA 3IUDA 3UXIA 4OX7A 1AZ1A 2QZ8A 1RTDA 1WAUA 2PP3A 3QPIA 3BV4A 4N9BA 2BOAA 1V03A 4QWCA 3SUTA 3A21A 2DUZA 1G4SA 3UNTA 4QWAA 3BREA 3RR4A 3QQ1A 3K8LA 3MSYA 1PYOB 2YDQA 4OZ3A 4NWBA 2OKOA 1BTMA 1ZTTA 2B9XA 4FHAA 1EETB 2OD6A 5BU9A 1M9HA 3C6UB 2OFGX 3L95X 4WUIA 2AX0A 4LUSA 1SZEA 3L9ZA 1XI3A 1XYAA 4O0IA 4Z2JA 3TKFA 5LOQA 1P48A 1R0AB 2PO4A 1MWQA 4LGXA 1S1UB 1N55A 2AMXA 2NUYA 1VRQC 4U6PA 3K89A 2E77A 1VBXA 3P2VA 2GQ8A 3IRXB 2P5NA 4GZ7A 4W90B 3GW0A 3LANA 4QPTA 1FKOB 1GVYA 3G71S 2JJ4D 1FWDC 1QAXA 4YB5A 1M1GA 2XHCA 2GL5A 1Q4RA 3CIVA 1GQJA 3TEHB 4TQSA 4HTIA 3OZOA 3DOLB 2YKOA 4LRFA 4C1KA 5XINA 3ORWA 3FCWA 5KFJA 2RGMA 3U6WA 2HVDA 1R7AA 3P14A 2DR9A 4WXOA 5A0YB 3RB3A 4KCWA 2FZNA 1N36J 3PZNA 1RT3B 4IFKB 2ATCB 4F25A 1MQRA 1UA1A 4PUOB 1V6WA 1OFQA 4TXEA 4FNUA 4K1GA 4FOKA 4E8UA 4GKJF 3UPMA 4Z2IA 3R5EA 1JJCB 2GFTA 3E2VA 2R7VA 1WEZA 1F0XA 1RT4A 5CSUA 1YQHA 1FCAA 3D28A 2FLNA 1B31A 2I14A 4WXYA 4AF0A 3GHSA 1XHGA 1HG3A 1JAEA 3IS9A 2R2TA 4DV1F 1E71M 4ZTXA 4ZGYA 5L9FA 2NSBA 5IHSA 4QIVA 4Z17A 2E5LJ 3OVBA 2Z27A 3FGCB 2B6AB 5EFDA 2DVTA 4JI4J 2H3BA 1E4NA 1S2UA 3AQOA 3MD1A 4LFAJ 1I2NA 1GKQA 3SCOA 1XBVA 2VFIA 1QASA 2D23A 4GY1A 2UXBF 2PC8A 3GG1A 1NOFA 4FALA 2D7SA 4IXHA 3MWAA 4E5TA 2RAGA 2KHDA 1IR0A 1WACA 3WBZA 4B4HA 4QOTA 5JVHQ 3ET6B 1EDQA 3MY9A 3DOKB 1RHKB 1S39A 4A22A 5HMXA 3ISZA 2R1NA 4PODA 2AZ1A 4LF6F 4PH6A 2WANA 2QVHA 4IMGA 4F0SA 1M7XA 3C2FA 3M64A 4KCVA 3FXGA 4ADUA 4GI9A 2DZTA 1Q79A 3QMQA 1X8CA 3LZ5A 4B91A 1AD1A 4UOJA 1A49A 1UBPC 1LOQA 4P2FA 1H3DA 4GYKA 1BSLA 2O92A 3MV11 5IFTA 1NEEA 3DGPA 3HVRA 5K4ZA 3KVLA 2M88A 5F9LA 3W53A 3WF3A 3QJPA 3T41A 1T7LA 5HUOA 2WK4A 2ZUUA 5I2UA 5D2WA 3QMTA 3N9KA 1HVQA 3CT2A 3M0ZA 2IM2A 3RBXA 1OFOA 3UDVA 5H9EJ 1VGYA 4X4RA 2VU5A 1H5VA 1MU2A 1WOBA 1XX1A 4UTIA 2DZAA 1I6NA 1AW2A 3MCSA 1FH9A 4K4YA 2OJ3A 2LQ8A 4K50A 1TL1B 3CULA 4MWAC 2H1YA 2LQBA 4ZN1A 3CNQP 4YOEA 5AVHA 3BLDA 4H01A 4DS5A 3T1AA 2GVJA 4J40A 2D2JA 4G2DA 4NZ4A 1KFSA 4Y9MA 5F4XA 4OJHA 3PF3A 2CVEA 3WLLA 2RHQB 3OSPA 4GC4A 3NQFA 1R3WA 5EB8A 3URQA 4U96A 2W66A 1DHPA 1DIKA 5BNKA 5F4WA 1AL7A 3STCA 2QMUB 4K0KJ 1SVDA 4QW9A 4PULA 4FLRA 3MYPA 2V8ZA 3ZLGA 4UQ9A 1D9EA 1OFEA 1HNXF 4OI4A 4JI0J 2HJPA 1UH4A 4B9ZA 4UWMA 4B3ZA 5F0WA 2Z24A 2DV0A 3I82A 1TZ0A 5A6MA 4QCLA 3L0GA 4CO3A 3Q2DA 1XBZA 4DI9A 5GJPA 2FC8A 1XNQJ