4RNHA

Pamora tandem diguanylate cyclase - phosphodiesterase, c-di-gmp complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
429
structure length
423
Chain Sequence
MAYYDALTHLPNRTLFQDRLHTALQQAERNGQWVVLMFLDLDRFLGHAAGDRMLQEVATRLSACVSQDDTVARMGGDEFTLLLPSQGDREIALKRAIQVAELILGRLARPFTLEGREFFVTASIGVALSPQDGAELSLLMKNADTAMYHAKEMGKNNFQFYQAEMNARALERLELESDLRRALELGEFVLHYQPQFTGDGRRLTGAEALLRWQHPRRGLVPPSEFIPVLEEIGLVAQVGDWLLAEACKQLRSWHKAKVRVPKVSVNLSARQFADGQLGERIAAILYETGIPPACLELELTESILMSDVAEAMQILSGLKRLGLAIAVDDFGTGYSSLNYLKQFPIDVLKIDRSFVDGLPHGEQDAQIARAIIAMAHSLNLMVIAEGVESQAQLDFLREHGCDEVQGYLFGRPMPAEQFGMLYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Formation and dimerization of the phosphodiesterase active site of the Pseudomonas aeruginosa MorA, a bi-functional c-di-GMP regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase, hydrolase
molecule keywords Motility regulator
total genus 146
structure length 423
sequence length 429
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4rnhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rnhA01
2UUTA 1JKHB 3UQSA 1MMLA 2XI2A 4ZMMA 1TVRA 4QPXA 3KHLA 2CKWA 3IRXB 2XCPA 3KK3B 3LAMA 4NYZA 3M8PB 4RNMA 2UVVA 1HYSB 3NBPA 4IH6A 5KT3A 3NMAA 1DLOB 5KT7A 2BR0A 5J1EA 3SFGA 3BSCA 2DPIA 4EBDA 4NLPA 2UVWA 1RYSA 3Q8QB 1QE1B 5F8JA 5HLFA 2R8JA 1DTTA 1JLCB 2D3UA 3PW5A 1ZTWA 2VA2A 5KFVA 4WFYA 4F48A 4F50A 5FDLA 4HJFA 3DM2B 5KFFA 2VG7A 1NNDA 1FKPB 3DRRA 3HVTB 3QGGA 4RW6A 2WOMB 4JUZA 4M94A 2AQ4A 2B43A 2D7SA 3DMJB 1S6PB 4LSLB 3QYYA 1R0AB 2QV6A 2ATLA 4KV8B 1TKZB 3MTKA 5KT4A 4KSEB 4RUAA 1RA6A 3RB0A 4K50A 5F9NA 1S6QB 1TVRB 1CSJA 2YNIA 4ES4A 3I0SA 3HVWA 3BQ0A 2XGPA 1JLBB 1J5OB 4O3SA 1RT7B 3FDSA 4Q0BA 1TKTB 4FBTA 3CIZA 1TP7A 5C25B 3NAIA 1VRTB 4O3RA 1HNVA 3PW7A 1K1SA 2C2DA 2RKIB 1QE1A 3IN5A 4ED7A 3JYTA 3DYAA 2IC3A 1D0EA 3DRSA 4IFYA 3RBEA 1S4FA 1C0TA 1TL1A 3UDLA 3FQLA 4KAIA 2BANA 3ITHB 1HMVB 4JV2A 2BASA 2WOMA 3DOLA 3I0RB 3BQ1A 3PW2A 3I5AA 3MEDB 1SUQA 4LSLA 2ZD1B 1EP4B 1RTIB 4PUOA 2HNDA 3H5UA 2WCXA 4XO0A 2BRLA 3KLEA 4MH8A 3DLEB 3JSMB 2BRKA 4G1QA 4NLYA 4ECQA 4Y9OA 3NKYA 4ZHRB 3GV7B 5DLFA 3V81A 3D5MA 4O3OA 1RT7A 3RBDA 1TKTA 4QWEA 3QLHA 3KK1A 5I3UB 4F4WA 2IJNA 2VG6A 3Q8RB 2B6AB 2OH2A 3GFYA 4I7FB 4R8UB 2JEIA 4J9SA 4MK7A 4Y9PA 4RNFA 3GG0A 4FOUA 4ICLB 4KFBB 1RT3A 4IKAA 4RNOA 1SV5B 2W8KA 3E01A 2V4RA 5M1TA 4YMEA 1TL1B 4NCGA 1S49A 3TAMB 4YQWA 1YVFA 2OPSB 1N6QB 3MEEA 4NLSA 5F8HA 1S9EB 5KFEA 4NLOA 4IFVA 3S83A 4NLXA 4RW8B 5KFGA 5KFQA 4ECSA 1C1CA 4QWDA 2AGQA 4Y34A 4IRKA 4WFXA 3PW4A 3DRPB 4Y2AA 2J6SA 2IM3A 1RT5B 2ASLA 1RTDA 5J2PA 1KLMA 2HNYB 3QO9B 5KFRA 4ED6A 3DI6B 4J9NA 1S9FA 1S97A 2VA3A 1JLGA 4O44A 3LP0B 5F8NA 4K4WA 3KJVB 3DLGA 4IQXA 1S9GB 3CJ0A 3N6MA 4TXSA 4R5PA 4J9QA 4YP3A 4RW7A 2YNGB 2IM0A 4KV8A 3OL6A 5I3UA 2OPPA 4Y9MA 3N6NA 4ID5B 1DTQA 1T94A 2HNZB 1S6QA 5J2MB 5KFJA 4Q43A 1MU2B 3KLFB 2IMWP 2WHOA 1W25A 5EWGA 4DL5A 1C0UA 3IG1B 5F8LA 2FLNA 3PR4A 3PJTA 1RT3B 1S48A 3M9MB 2ILZA 3IS9A 4Q45A 4F4YA 2HWHA 4H4OB 5CYQA 1S1VA 2W27A 1REVA 1S1WA 2WRMA 5KFXA 1TQLA 5KFTA 1BQNA 1T05B 2IC3B 2C22A 1TV6B 2FLPA 4EEYA 2AX0A 5CYMA 4ZPDA 4MKBA 2WTFA 1S10A 2OPQB 3FFIA 3MECA 4MFBB 1S0NA 3VQSA 3DRPA 2CJQA 4IOBA 1S1UA 3H59A 4RUCA 2XC9A 4IG3B 1HMVA 2ILYA 5HROA 2B5JA 4ECYA 2RDIA 3DI6A 5D3GB 2JEGA 4RW4B 4WE1B 4ED3A 5C5JA 3RAXA 4IDKB 5T14A 3KJVA 5KFBA 2ALZA 1KHWA 2E9TA 4LYKA 1RTIA 4NLRA 4RW7B 1T03B 4J9RA 3KOAA 3FQKA 4PQUB 2AWZA 2OPPB 4ID5A 5J2MA 4ZP9A 4G1QB 5C42A 3GV8B 5DQIA 1C1BA 2IM2A 4O3QA 2W9CB 1RDRA 1HQUA 1XR7A 4ZP6A 5KFYA 5KFUA 4PWDB 3HV9A 3OL8A 2E9RX 4TQRA 2OPRA 3BJYA 3I5CA 3MR2A 4OL8A 2W7PA 4MK8A 3TVKA 1XR5A 2W9BA 1BQNB 2BE2A 2WK4A 3ISND 3CJ5A 3KLIA 2GIQA 2V0NA 4ICLA 4KFBA 4EO6A 5J2NA 5CYMB 5DG8A 2I1RA 3E01B 4IRDA 5KFSA 3CVKA 4TN2A 2JC0A 3HHKA 3LP1A 4IG3A 1S9EA 3GIIA 3RB4A 2YKNB 2JEJA 4ECXA 4NRTA 5L1IA 4ECWA 3OLAA 1N48A 1RT4A 5KFCA 3SY8A 5KFPA 4FBUA 2HAIA 3MFHA 4NLGA 4WYLA 3IRXA 3KK2A 4WFZA 3CDUA 4NZ0A 5I42B 3CDEA 4KB7A 1QAIA 2DPJA 4XPCA 3LP0A 3HV8A 4URGA 1HYSA 2D3ZA 2WB4A 5DG7A 3EPGA 4I2PA 4O4RA 1QUVA 3G6XA 1HNIB 2BQ3A 5KG0A 4TYBA 1IKXB 3QGIA 3KMSA 4QWCA 3OHBA 3T5HA 3IGVA 5J2QA 4TLRA 3QGHA 2AGPA 4K4VA 4DG1A 3RAQA 4O3NA 3IS9B 1LWFA 2IJFA 2I5JA 3CWJA 1FKPA 1FKOA 3HVTA 4F4ZA 4IR1A 1FK9A 3PFMA 4LJ3A 3LP1B 4FOKA 2YKNA 4RZRA 2R2RA 4F4XA 1TV6A 5EWFA 1IM4A 5KFOA 1UWBA 1RT6B 4O4GB 4URQU 4EYIB 1S1UB 2YKMA 5MF5A 5EUHA 1WNEA 3MR3A 2B5JB 3OLBA 4K4YA 3NAHA 2BQUA 4TYAA 4ECRA 4IG0A 2FJXA 2HWIA 1RT1B 4IDKA 3T19A 2EC0A 3C6UA 3NGDA 5DGBA 4K4TA 4KO0B 5DGAA 3C6TA 4MK9A 3KK3A 5F8GA 3GFXA 3DYAB 3H5YA 3BR9A 1S0OA 4ED8A 3H40A 4RW9B 3PVXA 3MEGB 4RU9A 5DQGA 4FS2A 4ZVHA 5KG1A 1JLAA 3EPIA 3IGNA 1FKOB 3ITHA 4MIAA 3DOLB 1FK9B 1JLQB 1S1TB 3I0RA 5C24B 5KG3A 5KG6A 3KLHA 1S1XB 3MEDA 1EETA 1JXLA 5J2NB 3TLQA 4Q8EA 4G3IA 3PHEA 5KG4A 5DG9A 1UWBB 3RB3A 4NLUA 4ED2A 1JX4A 4H4MB 2ASDA 2F8EX 4KKOA 5KFLA 1RA7A 3DLEA 3JSMA 3BGRA 3DMJA 5L1LA 1ZTTA 4NLDA 3T5JA 5DLGA 4QWAA 3M8PA 2RDJA 5KFAA 4F3HA 1RT4B 3ICLA 3NBPB 3BREA 4ZVGA 5K14B 4ZP8A 4ZPAA 4XPEA 2B6AA 3G6VA 4JV1A 4KO0A 4NLQA 4R8UA 2QE5A 3OL9A 2RF2A 4Q0BB 3E51A 4I2QB 5KT6A 1BQMA 4IR9A 4RW9A 3GIMA 3CJ4A 3MEGA 1SV5A 4WXWA 1HNIA 3V6KA 2O5DA 2YNHB 1NHVA 4Q8FA 5FDLB 1OS5A 3DM2A 3H5SA 1N6QA 3H4DA 2RKIA 4ED0A 3JYTB 1D1UA 4GC7A 4IFVB 4RW8A 5EDWA 3CJ3A 1JIHA 3KLGA 3KLHB 3DRSB 3T5LA 1TKXA 3QIDA 4DL4A 2XGQA 2R6OA 1R0AA 2IAJB 1IKWA 1LWFB 4J40A 3U2EA 1C2PA 1RT2A 3HVAA 4Y3CA 3Q8PB 4EBEA 3PW0A 2ZE2A 4ECZA 4KKOB 2V4QA 3QZ7A 4J9KA 3I0SB 1JLGB 2W8LA 1LW2A 1SUQB 3LP2B 1JLBA 2JLEA 4PUOB 4IH5A 3T1AA 4YR3A 2W9AA 3BQ2A 4KE5A 4EBCA 2HNZA 3KLFA 3NL0A 4ZVEA 1MU2A 4ZHRA 3V81B 1QAJA 3V6JA 3SFUA 3SI8A 5EWEA 2RF2B 1DLOA 3QLHB 3KK1B 3V6DB 4ECUA 1LWCB 2R2SA 1C0TB 3GILA 1HARA 5HBMB 2BANB 1S1WB 4IH7A 3G86A 3TQ1A 2GC8A 3KLVA 5F8IA 1T05A 3QIPA 4MIBA 4K4XA 4B3OB 2OPQA 3MECB 4MFBA 4HU3A 1EP4A 2IAJA 4Q6JA 1SH3A 2VG7B 3DRRB 5KFNA 3PJUA 2ZE2B 4HYKA 5KFHA 3KLEB 5HROB 2IM1A 3H5XA 4URSA 1C1CB 1S1XA 4NLTA 3OSNA 1S6PA 3GV5B 2HMIB 4NLWA 2UVUA 1VRUA 1TKZA 1RTDB 1NHUA 3H2LA 4H4MA 3PJXA 5KT5A 3QO9A 3M8QA 3BGRB 4DL3A 2FVRA 1N56A 5KG2A 3CJ2A 3MR5A 1J5OA 4RNJA 4FOJA 3DLGB 2E9ZA 3DLKA 4H54A 1SH2A 2ZKUA 5C25A 3GG1A 1GX6A 3V4IA 1LWCA 1VRTA 1RTJB 4GC6A 2XI3A 4NLVA 5HBMA 4ECVA 3MEEB 3G6YA 3QIPB 4EYHB 4Y8EA 1BQMB 1I6JA 4IFYB 4QWBA 3N3TA 4B3OA 4FS1A 1S0MA 3N6LA 4AG0A 4M95A 4KHMA 4QW8A 4TY9A 1N5YB 1KHVA 4Q44A 1KLMB 2HNYA 4J9MA 3KLGB 1HPZA 2YNFB 4O44B 3OL7A 1JLEB 2R8IA 2HMIA 3DOKB 4R5PB 1RYRA 2YNGA 4LSNA 2FJVA 4KHRA 2C2RA 1LW0A 4TY8B 4DL6A 4K4ZA 3KK2B 3GFZA 4LQ3A 3M8QB 1K1QA 4ZPCA 4DL2A 5KFDA 5MKGA 4AFYA 5KFWA 5HP1B 1C0UB 3IG1A 2AGOA 3H98A 3HKWA 1IKXA 2R8KA 2VG6B 3OSPA 1S1VB 4RNHA 1RTJA 3LANA 5JUMA 1REVB 4RNNA 2ASJA 4I7FA 3KNAA 1C1BB 2W9CA 2R2UA 2R8HA 4DG1B 5JXSA 4J9LA 1HQUB 5KT2A 1JLFB 1LWEA 1RTHA 2FVCA 3T5KA 3V6DA 2BQRA 2VG5A 4X2BA 3FFIB 4NCGB 3TAMA 1U09A 2OPSA 2J6UA 2W7OA 2V9WA 1TL3A 4Y9NA 4YR2A 5D3GA 2WONA 2AX1A 4WXOA 3GIKA 4O4GA 1T3NA 5F9LA 3QZ8A 3DDKA 5KFMA 1IKYA 4DL7A 1T03A 2FVQA 1RT5A 4O3PA 3GQCA 3UPFA 5J2PB 3MR6A 5KG7A 3BSNA 4EO8A 1ZETA 5C42B 2C2EA 1RT1A 3KHHA 3KHGA 3C6UB 4QW9A 1S9GA 4MKAA 4Y2CA 1VRUB 2D41A 2UUWA 5J1EB 4WYWA 2GIRA 4YR0A 3Q8SB 4PWDA 5KFIA 3C6TB 1DTQB 5HLFB 5L1KA 1DTTB 4I2PB 4JV0A 2W9BB 4TQSA 3KHRA 3PZPA 3DLKB 3FRZA 4K4UA 2XWYA 3PR5B 1JLFA 1LWEB 1HQEB 1RTHB 2VG5B 4H4OA 5CYQB 4ZP7A 4J9PA 2J6TA 3LAKA 1JLQA 1S1TA 5C24A 3V6HA 5J2QB 2C28A 3KZPA 3GIJA 4ED1A 1XR6A 2FVPA 4RNIA 3EZUA 4ZPBA 3KMQA 4K4SA 2FJWA 1IKYB 4J9OA 2FLLA 1IKVA 3UR0A 1N5YA 2YNIB 4KIEA 1HPZB 2YNFA 5I42A 3RB6A 4RW4A 4WE1A 2FVSA 1N4LA 4U7CA 1JKHA 1RT6A 1JLEA 3H4BA 5K14A 3DOKA 3BSOA 3FSIA 4LSNB 4PQUA 1LW0B 1HNVB 4TY8A 5L9XA 2IA6A 4HKQA 2R2TA 4LQ9A 4IG0B 1RAJA 4I2QA 2R8GA 3GYNA 5MKGB 3ISNC 5HP1A 1Z4UA 3OHAA 1GX5A 3PJWA 2YNHA 1SH0A 2UVRA 1HQEA 2JC1A 4NRUA 2I5JB 3MFIA 4WZQA 2OPRB 3LALA 3I5BA 5KFKA 3M9OB 3BSAA 1JLCA 4DEZA 4WZMA 1TKXB 5DQHA 2BE2B 3KLIB 2ZD1A 4U6PA 3V4IB 1JLAB 5F8MA 1IKWB 1RT2B 2AU0A 3CDWA 2HNDB 4HU4A 5KFZA 5L1JA 5KG5A 4RW6B 3M9NB 2JEFA 3MF5A 3CO9A 2YKMB 1IKVB 3D28A 4KBIA 4IRCA 1LW2B 3LP2A 1TL3B 1EETB 4R0EA 2XCAA 4ZVFA 2WONB 4ECTA 2IBKA
chains in the Genus database with same CATH superfamily
4CO1A 1ONEA 2ISVA 4I67A 3IAQA 2Z00A 2BNJA 3FHAA 4IIBA 3KK3B 1SZRA 1QJHA 2C79A 3Q24A 4V19X 4MJMA 1YX2A 2DO4A 3HVRA 2D3O1 1NFGA 2CNCA 1OIAA 2X1TA 1LRTA 3S1TA 2FZ9A 2ADBA 4DBEA 2PDBA 1UEUA 4FHAA 1J01A 4ZVRB 4C6EA 1ZTWA 2IQDA 3EEZA 3V5RA 4HEA9 2WOMB 2QIIA 3NSNA 3BGLA 5HMSA 5D4YA 3MOJB 2C0AA 2Y7FA 4US5D 1KS2A 4FNHA 1ELSA 3MKVA 3U2OA 2PRLA 3VGBA 1T0TV 1NJXA 5FJRA 1N0UA 3L68A 4K7QA 3G6ES 3OTCA 4O3SA 2OU4A 2PU1A 3STFA 3RPTA 1X8FA 3DEQA 1M5HA 3GJQB 2QS8A 2DNZA 4F3MA 1W3HA 2BX7A 3BVJA 1QE1A 2HJPA 4ED7A 4AXKA 2F3JA 1OGSA 2VFEA 1PBGA 2V5BA 2HXUA 1VIXA 4FVCA 2XB2D 4XZLX 3PO4A 3M0KA 2ACSA 3IVTA 3G1SA 3IR6B 5GJPA 4PFMA 3LTPA 2F8HA 2ZOMA 1LP6A 1NZ8A 4PUOA 2KB2A 1WUUA 5FIPA 3VD9A 4QLJA 4DWDA 5JMNA 3D66A 3O2IA 3JSMB 4WRHA 1ZCCA 1LLZA 4D6GA 4CVUA 4PQAA 1W5MA 4E8DA 1TKTA 1I5OB 5DY3A 4JTIA 2DR8A 1W2PA 4W5UA 2ZVIA 3BO4A 2BODX 4MJZA 3UBPC 1F9HA 1UVIA 1CGXA 4C6BA 2X42A 3G8TA 3ZTRA 4CRJA 2WJDA 4UZUA 1OM0A 3GYGA 1KM5A 3TFXA 1EA0A 4O0KA 2GGEA 2WOQA 1UIPA 5D0RA 5KFQA 1AJ2A 2QV4A 1EO7A 4YVXA 1XLIA 4HZ7A 3KUEA 1RAAB 1U8SA 2AQWA 3M07A 2A3CA 3AIWA 4JQ4A 3RJYA 1W1ZA 3NSMA 2CG8A 1OABA 4O44A 2Y0FA 2IQ0A 1CXIA 2D9OA 2Y70A 1NSPA 4ZVTB 3OL6A 3N6NA 1T94A 2EBGA 3WLTA 2WHOA 1OPIA 2DT3A 2FZCB 3M9MB 2QN6B 3QMSA 1C93A 2RQKA 3HO1A 3LENA 2C22A 1TV6B 3DFNA 3IBWA 3VE7A 1HXJA 1R8AA 1U1HA 5IBXA 1TU0B 4ZJLA 2OR2A 4IG3B 1HMVA 4XTIA 5IRPA 1ZCOA 2GDUA 4RUBA 1KHWA 2NWSA 1PZ3A 1OG0A 3GJRB 1GQIA 4RW7B 4PQUB 3KW3A 4WEVX 2NXJA 2BE7D 2OPPB 1YJ7A 4ZP9A 4FPRA 4RDYA 5I3HA 2VELA 3FVDA 2VGIA 2HFZA 2XS5A 1V6XA 4DBQA 3SQGA 4JL2A 4PB4A 3H6OA 4JQ1A 2YDSA 4E38A 3DECA 1KFKA 3TVKA 3W3OA 2NXUA 1OC6A 1O8BA 4EKJA 2JC0A 1V9OA 3LP1A 1ISXA 4UTTC 1PTAA 4LF5F 2ZE0A 1G4CA 3TFCA 2YA0A 1VD6A 3N6QA 2BSLA 3OLAA 4ECWA 2PEBA 4KWSA 2XVPA 3D46A 3IRXA 4R33A 1Y5NB 2YVSA 4KW2A 1NQ6A 1EB0A 4HH1A 3CCMS 1TTIA 3H22A 2QL7B 1L2UA 1RJQA 3OB8A 3VGHA 4UOFA 3MCSA 4WP3A 2EPOA 3L3CA 3W6MA 5HWNA 4I9JA 1J2BA 4OYXA 5M2RA 3TWBA 2J47A 3SURA 2WVSA 2WJEA 2WMFA 4Z2HA 1VFFA 1XSJA 2GJXB 3ZZTA 4N9CA 3T05A 2GVLA 3HG5A 4G1IA 3UG8A 2MQLA 5KOWA 5IDZA 3M8YA 4LRCA 4JX6A 1PJ6A 1V5IB 4KCTA 4BQ2A 3CZEA 4C1NA 5KZMA 3R8YA 3CU2A 1MG7A 3QOMA 1Y3JA 4HCLA 1Q45A 3BLFA 3W7HA 3MPDA 3WQ5A 2Q43A 1E0XA 2O0TA 1JZ5A 2FMNA 3GNPA 2VOOA 1JNRB 4D3GA 4EPDC 2R7QA 3MEGB 2J8TA 1E6QM 3BSHA 4MSSA 1PBUA 2A3BA 4QJ1A 3B9OA 4OHYA 2BUNA 4ZO9A 2Y85A 3DOLB 5DMNA 3CYVA 2J7BA 4O53A 1JXLA 1HKIA 2ZRWA 5J2NB 2QUVA 3D0HE 3LF0A 2GQCA 2CQ3A 1WI6A 1UP2A 3IAPA 2G37A 1YIXA 1LYXA 2BOGX 5IV4A 1J2WA 5H1SV 3NQBA 1GHRA 2YCEA 4WDUA 3VUPA 3NBPB 4A8WA 4ZP8A 3W86A 5AHMA 1MNZA 1CG2A 1U33A 2YKQA 5KMYA 4OUEA 2E29A 4LUJA 4S3CA 3SGUA 2BJ7A 3CJTA 1BQMA 1NOFA 3L0GA 4NXMF 2OWXA 1S2TA 1A0CA 4DZHA 1NHVA 1FDYA 2ACYA 2OFHX 3CCLS 3W2JA 4UTTA 2AYBA 1U24A 3M5XA 3VZHA 2Q66A 3IV3A 2FGLA 3UG4A 3T5LA 4G7FA 3QIDA 3PX4A 4AWTA 5HNTA 5EN1A 4LX4A 3JSRA 4NI2B 4E2OA 2IAJB 1C2PA 5EFDA 2YY3A 3MTJA 1X6LA 3D6NA 2YWEA 3WN6A 3LTYA 3W6LA 3U27A 2QMWA 4TU1A 8CGTA 1JUBA 3T0BA 4GJIA 5ABEA 4DV7J 5CG0A 4JTDA 3KLFA 3MY9A 1KOHA 3ZZUA 3VD4A 4FNSA 3LPYA 2NUWA 1UVJA 1H50A 1U6FA 5HBMB 4IZGA 1PCAA 1A47A 5CZKA 2OYMA 1IN0A 1WDRA 2WZEA 1ZBWA 3KTXA 4O1CA 4WCJA 2TYSA 3GKAA 2ZJPQ 1J0KA 3SCUA 5GMKa 3RCYA 3BDPA 3WFZA 1C1CB 2XZ7A 3C15A 2VEMA 3KCOA 3W5YA 2WMGA 3TMQA 3UEQA 2MSSA 1RTDB 3RU8X 2YTCA 3AIVA 4HP5A 4TVAB 3K5LA 1E0WA 3MI3A 4YN3B 3H2AA 5DANA 2HKEA 3LOTA 5HBFA 1LWCA 1VRTA 3ONQA 3VD7A 2XI3A 1W2VA 1SC4B 2DHGA 3PY2A 3O06A 4GY0A 3KBWA 4N6FA 4A8KA 1BQMB 4RUHA 2JBMA 3GU1A 2N4DA 1S76D 3N6LA 3DI1A 3M6YA 5EB8A 3WG6A 3MMAA 1VJIA 1E51A 4KBXA 1PTDA 4OJHA 8XIAA 1SW7A 4UTKA 4TY8B 2HVZA 4FO4A 4N4QA 2CPHA 1P1TA 2ZUSA 4L4PA 1B30A 1HUVA 3H2VE 4OI2A 2M8DB 2BG5A 5CPTA 5K5MA 2Y63A 5L8RC 3OYXA 4RNHA 3M1ZA 1RTJA 5JUMA 2W2MP 1HNYA 5IHRA 4J9LA 2YYTA 5E41A 4JTLA 2X1BA 2IY5B 3ZJ6A 1LL7A 3FFIB 5FACA 4S3GA 4I3GA 4DJFD 5D77A 1R38A 2UXDF 1WG1A 1RWNB 1JDCA 2DR5A 3WLRA 4QS5A 4WXOA 5CAAA 5CZ0A 3WH8A 2GJNA 1ITUA 5J2PB 1M53A 1M90T 5BJRA 3G77A 1FRJA 1RT1A 3QQ0A 1DJZA 4KTQA 4PCQA 3LSCA 4ETXA 3WQ4A 3XIMA 4UQGA 2ZH7A 3NDOA 2ZZ6A 2PMHA 3BO9A 3QR0A 1DTQB 4P2VA 5DEZA 1N33F 2K1RB 1ISZA 4KRZA 3GNRA 1I0BA 3S5SA 4J9PA 4H4OA 3BLKA 1ULRA 1YRTA 1DQXA 1LWIA 4D3HA 3CGTA 3SCRA 4B3KA 3H2MA 3EX6A 4OZ1A 3I6EA 3L4ZA 4ZODA 4DNMA 1OFBA 2ZIDA 4U2ZA 2O1PA 3MAAB 1M5PC 4LY4A 2QDHA 2OLHA 1J5SA 3GNOA 1IKYB 1RQ0A 5D15A 1OY6A 2OT0A 2V6AA 4S1FA 1K4GA 3WLPA 3S1GA 5C7VA 3FSIA 5I5RA 3QSIA 2R94A 4TY8A 3K59A 1MXSA 1J5EJ 3L09A 1VQYA 1F74A 3TYZA 3W7KA 2GX8A 1D3WA 1UWRA 2NSOA 2IXVA 2BJDA 2OPRB 3DGVA 3B8UA 4UQTA 2QKFA 1DZ5A 1TIWA 3BSAA 4WZMA 2J6VA 4YMZA 3V4IB 5A2AA 1PAMA 2Z56B 4JN6A 2HBQB 5KG5A 2Q3OA 5AHIA 3TQVA 3EMCA 5DZ7A 2HWGA 4I5XA 2GZXA 1BRLB 4EK7A 4LBUA 4CGTA 1B54A 3P5BP 2E5GA 2QCDB 3ILJA 1IZJA 1NELA 4ZMMA 3UCGA 1FKAF 3G1HA 1BVWA 3PTDA 3Q45A 5KT3A 3W85A 4OIXA 4GY1A 3GU0A 2Y1HA 3ZVHA 1KQFB 3L0KA 2MQOA 1WOSA 3RBZA 1YJRA 5DLCA 2PUZA 4C6AA 1IR1A 2D3UA 4GIRA 2YJQA 1FDJA 3SDEA 4LR8A 1KKOA 4E0DA 2WVUA 2R82A 2B43A 4GI6A 1KP6A 2GUYA 2WAQD 5HVHA 1BYBA 5AYZA 3PDNA 5D8HB 2HHHF 5FF4A 2DNQA 4K50A 1BLIA 1EHNA 3TYAA 1Y5XA 3I0SA 3OFFA 2WBMA 1KBJA 3K13A 3ZNJ1 3TJXA 1GOIA 3QGAC 4N4PA 4J5OA 3NAIA 3BH7B 4D6DA 1CTNA 3PW7A 4MWAA 3NZRA 3MMTA 2RKIB 2OX1A 3MA8A 4Z0SA 1CZ1A 1N52B 3CO4A 2VKZG 1Q6LA 3T3FA 4UNIA 3FGCB 3GXDA 4QQUA 2G2OA 2BANA 4I8YA 1D8ZA 3ITHB 1T6MA 3GIRA 4PTXA 3P8IA 2FHJA 2QYCA 5GMDA 3TN3A 3EXCX 3HG4A 5AVNA 4KWWA 5IM51 3NUKA 2KL8A 3DLEB 2XWXA 3EX2A 2CYYA 4GUIA 5D30A 1EJRC 2WMIA 1ML1A 1RAEB 1X4EA 5I3UB 2V68A 3TJLA 1DQWA 3C14B 3I96A 1SJ1A 1C7SA 5HMFA 1SC3B 4RJVA 3I56S 2WSKA 3P74A 4AXNA 3BLOA 1EP2A 1MFVA 1XYBA 1RPXA 1A3WA 3DDMA 5M1TA 3W1AA 3Q8YA 2OPSB 1AW0A 4HU0A 2O9PA 3NZ1A 4XD4A 4KJIA 1QW9A 1PKUA 2OJPA 1NM2A 1PKMA 3GPAA 5KETA 4FP1A 3GP9A 1DPMA 1ZTVA 1RP5A 2X1SA 5M2PA 3T4WA 5JVLA 1J5TA 3T4CA 2ZH8A 1JLGA 2GVYA 3LP0B 1UWUA 5F2LA 3UDCA 4PYDA 3WENA 3CZGA 5FEXA 4DR4J 4Q43A 4DV4J 2YFOA 1C0UA 3C0LA 3VKJA 3WFAA 3KCLA 4FZIA 4JFVA 2ZWYA 2HEJA 2INEA 2W27A 1QOPA 1B3OA 3AICA 4AC1X 1XHGA 3W7OA 2DISA 3R0KA 2IC3B 2WM1A 4FR1A 4ZVOB 4QFUA 2ZH2A 2LVWA 4BK9A 4LV9A 1KRAC 1GZJA 4PUKA 4HZ6A 3H59A 1EX1A 3F0NA 1Q63A 1V0NA 4HHMA 4IDKB 3GVVA 3IFEA 4NWBA 5EGYA 1YITS 1TFWA 3T55A 1Z32X 1LFWA 4S3EA 3WF3A 3NEKA 2IM2A 2VODA 2Q3PA 4JZ5A 3EOUA 1WF0A 4JI0F 3AFGA 4RE0A 1TWSA 1YEYA 3KLIA 5FJTA 1Q7ZA 4FALA 1XK8A 4M8UA 5FLXU 4O8AA 1OYAA 4IRDA 2GGPB 1XR2A 4K38A 3CM4A 2PPGA 5KFSA 1O5XA 1B7YB 2EK1A 1N0VC 3IIPA 4IG3A 1S9EA 3AUOA 1BTCA 4LYPA 2VFVA 5K8OA 3E3HA 1SFTA 1AQHA 1GXTA 4PSRA 1H41A 3VK5A 3C2EA 1Z89A 1IBLJ 4G7EA 1OY0A 2IKGA 1NWRA 4O4RA 3J7ZT 1DJYA 2DT9A 3QFWA 2PDQA 4N8OA 4KH1B 2C8NA 2XSXA 3W1XA 1SO5A 5J2QA 3W1QA 3PFEA 3TEVA 2OT1A 4O28A 1J11A 1SQFA 3PAOA 4HQVA 5SUHA 3RAQA 2AYEA 4I7WA 3II1A 2QX0A 3FBCA 1MQQA 1QSSA 3LP1B 4QS6A 3ARZA 1UR2A 1KXVA 4HACB 1P48A 4H2CA 1AJ0A 2FTPA 2JSXA 2EJ1A 1S77D 2XN1A 3W82A 4IUGA 3OLBA 3NAHA 3WNPA 3EDFA 1DIOA 3AYSA 3GWQA 2BV3A 3O3LA 1WOPA 2CNKB 3PPHA 4AIEA 3TTQA 2IPWA 1KOOA 3HZEA 2RJZA 5DGAA 2EG7A 1Q6GA 3C6TA 5B0GA 4W98A 5GAHU 2J4GA 4YIWA 4USTA 3ARRA 5KG1A 2RNEA 4KIRA 3UJRA 3TSBA 2DNYA 3PO5A 3IJIA 1MROA 2YQ3A 1T96A 2DH3A 1TFVA 2E68A 7ODCA 2PF8A 5I00A 1EJXC 2YLAA 1JX4A 2FHBA 3WZ0A 4LF4F 1VAHA 4HVXA 2Y8UA 4EIVA 1QNPA 4C1NB 2FLPA 3V5FA 5T9CE 1KTNA 3BDEA 4P8UA 2Y1JA 1LL6A 2R1KA 1Y3KA 1R0BG 4Y2IA 3C2RA 1F5AA 1ZA2B 3NWRA 1ZL1A 2FJDB 3AH6A 3M30B 4I2QB 2OLAA 3BV8A 3MEGA 1T8QA 1V0KA 2A7RA 2O5DA 3O05A 5CSRA 1J93A 3SADA 1R8LA 4UZSA 4UTWC 2AKZA 6FD1A 3KLHB 3ELFA 3TR9A 4P7TA 4LSZB 2E9BA 1C91A 1LWFB 3U2EA 1CEZA 2PWHA 3F4WA 3HSJA 1KBRA 1Q82T 2EEYA 1KNZA 2R7XA 2HFNA 3I6PA 2XPKA 1SUQB 3R7SB 3ZR5A 1TKDA 3VIIA 2E1DA 5LIUX 1HJUA 2J5AA 3NFUA 4IMAA 4LTSA 2LEBA 3I31A 1T9XA 3AOCA 2KKHA 5EWEA 2CA9A 2DBBA 3TZZA 2YBTA 7REQA 1LWCB 2GK1A 3YPIA 3QJLA 1IZKA 1CXHA 1UH4A 2FVLA 2GC8A 4PBEA 1T05A 3WD3A 4A2RA 1XYLA 1HFEL 2H6RA 1L3SA 2OKOA 1HT6A 2JIEA 5DCBA 2C3MA 2LXFA 1QW7A 3M7WA 1TA3A 1UA0A 3PHTA 4NRRA 3H5XA 3J7YU 3N1AA 3VZYA 2XYHB 2PE4A 3OODA 4RXGA 3K58A 1VRUA 1JJ4A 3M47A 1CS4A 4E4UA 1V02E 1QNOA 3MUZ1 4FYDA 2BHUA 3FZ2A 3THUA 1IXKA 3W8GA 5C25A 3RLHA 1RHKB 1IQTA 2YQ0A 4U2YA 4TOQA 4J27A 2J7EA 2MANA 3QSRA 1UEVA 2QCGA 3PBMA 3HO8A 2KN4A 4R27A 4R7WA 1BXCA 2WK2A 1AW1A 2HHTA 1KC7A 5L39A 1T8XA 4YDXA 1Q3NA 2HHPA 4DV0J 5JJBA 1RWMB 1TPC1 2UY3A 4M56A 4LB4A 3RDKA 2V94A 3GO2A 4LQ3A 1OT1A 2ZA3A 3W7PA 1CI1A 2PDUA 1QNQA 2E5LF 3L21A 2XLJA 2E9MA 4RWXA 4MGGA 2VG6B 1HJSA 3K5NA 5G1YA 5HATA 3B8HA 1C1BB 1YNQA 2VPYB 4DUYF 1MYRA 3UJ2A 3BKFA 3N9UC 3HT3A 4EK2A 1HNWF 4EWTA 3W7EA 2YCIX 2VG5A 4UZCA 1ADDA 2REQA 2ZBPA 1KDNA 3RGTA 5HQEA 3OZYA 1M5OC 1VFTA 3M46A 2XFFA 1TL3A 5D3GA 4PMYA 4W86A 4L75A 2OGJA 4E3VA 4OV9A 3UFYA 2HAFA 3A22A 4O12A 4HDHA 3BLPX 2PMQA 5M2FX 3DKDA 1VRUB 5IDIA 4DX3A 3UD3P 3NGUA 3FDGA 4UOZA 1YBTA 5HLFB 4YFUA 4CEXC 1TAUA 3V1PA 5I4MA 2XVLA 4ASTA 4MB1A 2V2QA 4CM0A 1UIOA 5CG7A 4M1KA 1S99A 1N36J 4PXEA 3O6CA 3SV4A 4OBSA 1T02A 5FCZA 1ZJBA 1FH8A 2X1FA 2E9LA 4IXHA 4DV2F 4MYTA 4K4SA 4YXGA 1XNRJ 2DH8A 1IKVA 2YNIB 2MB0B 1V02A 3BO3A 2VEIA 1BQGA 1OBAA 3LYEA 4IJCA 4X4PA 2WVCA 2OJ3A 7ENLA 3P5YA 1BXBA 2CBUA 5FJIA 3JRKA 5H9EK 3PNZA 1SKWA 2YSWA 1BYDA 2WLZA 3PWGA 5MKGB 4O0NA 3SMZA 3BQ5A 3WK1A 5DCDA 3D0CA 4HMDA 1OX6A 1EC7A 2KZMA 3BAJA 4JX5A 3C3LA 1Q1KA 2G3FA 5F8MA 4MTPA 1TPVA 1VENA 3WIUA 1A5SA 3MGJA 1K7EA 1Q4RA 4WY0A 5FSEC 5LGXA 3N6JA 4DAIA 1EETB 4ECTA 3MYOA 1ECEA 1BMQB 3GTNA 2JRSA 4LFCJ 4ANDA 2AT1B 3NQGA 2CKWA 1AH3A 3DBNA 1ZRQA 1GTHA 5IWAJ 4HHLA 5KT7A 3JTNA 4OTKA 1ESWA 4L7ZA 3KRZA 2VC1A 4HMNA 3VALA 3LY0A 1XUUA 1PB0A 1FA2A 1P0BA 2JE8A 4CD8A 3TOYA 3QSYB 2DR7A 3NQ2A 1KRMA 1XUZA 1TK0A 3TONA 4ZQNA 4NA1A 1S0VA 3KRUA 4HK6A 4ZXOA 3J81j 1XIDA 4DQIA 1A6LA 3NR0A 1TIMA 2GLKA 3HHLC 1C92A 1Z41A 3QV7A 1EC9A 3RILA 4GI4A 2B4PA 4F40A 3S3GA 3KVJA 2A1YA 1JJKA 3ECQA 1W9BM 4BS2A 2WCAA 2EPKX 3E12A 4LOCA 3DDNA 3ATZA 4ZZ9A 2DNOA 5F7UA 1M7OA 3JSYA 4KAIA 4NA3A 4UTGA 3RTVA 3GTFA 3BTNA 3GSDA 4O1DA 2RRBA 1ZSXA 4UQAA 2XVGA 3VIHA 4A8YA 4CLMA 3UZYA 3ITTA 1QJWA 2EJAA 5U47A 2WCXA 1U4BA 4QBXA 1GOXA 1N8FA 3V2UC 4Y9OA 1L6GA 3PCOB 3CJKB 1DE6A 2B7PA 2MZTA 3SN1A 2VTFA 3NYDA 3S46A 5B08A 2ZXDA 4IHCA 3KG4A 4C7DA 1FX2A 2X3DA 2EG8A 1OJXA 4NZ7A 4ZCWA 3UVJB 1ZM9A 5CPQA 5M17A 3FGCA 3R43A 4YS1A 4DN0A 5DELA 3HGJA 1HJQA 5K20B 1TSIA 5HULA 1T9YA 4UTMA 1C1CA 4QWDA 3HIJA 4M80A 1IBKJ 4OI1A 1NP0A 4I9TA 1NF0A 1HNWJ 2H9AA 2C1HA 4JTAA 1B5TA 2ZZ1A 1S97A 4A4JA 4RDWA 5H9FK 1CB2A 3KWXA 2JKPA 1B4SA 3GFHA 2LQJA 1EOKA 3JSBA 1UR1A 2CLFA 3TW7A 4DPWA 1DTQA 3C14A 2J79A 4LRTA 1PE1A 1DJQA 3C2OA 1YBQA 4B92A 2K1RA 5ETOA 2XFYA 2JHEA 4GKKJ 4PKDB 1WV2A 1W7WA 3NXZA 1PBAA 1G3OA 4H04A 1HJVA 1R7AA 2VCAA 4OHQA 4C6FA 2WRMA 3B78A 1LZOA 2WZMA 2NZ4A 3BGJA 1ZJIA 1QPQA 3PULA 4Q7AA 4MKBA 1WD6A 1S10A 2OPQB 1NFBA 3WQWA 2V4JA 3HHLA 5LJ5Y 4J5NA 2RDIA 4WE1B 4NJIA 4O52A 3KJVA 4GJ1A 1YW1A 2Z27A 1RTIA 1UZ4A 1R5YA 5EMLA 4O0ZA 4LAOA 3MM8B 2D22A 1DWFM 3P82A 4TNOA 2XM3A 2PWDA 1JRCA 2QF7A 5D0HA 3QZEA 1NMEB 1VYAA 1VH7A 4LF4J 3HSGA 4AIOA 1FNOA 2AAMA 3B8DA 1U7LA 5D4OA 2KH9A 4JL1A 2JFEX 4W4MA 3BPWA 1U5JA 1V6VA 4DJED 3DXIA 2V0NA 2CPYA 3ISIX 1WDSA 3Q67A 4PUJA 2G97A 1RAKA 4OZ0A 4CH0S 2A7NA 3CLWA 3H2FA 3TA2A 5B0BA 1Z48A 2JEJA 4GX9A 1NAL1 2FH8A 5I3GA 1VKFA 3THCA 2YKNB 2BXVA 2VHGA 4NRTA 1IYXA 2KT3A 1KTBA 3BSGA 4INFA 1UVNA 2CKSA 4Y7EA 5AFDA 1UVLA 3TUZC 2POKA 1PILA 5HPCA 3S6EA 1WBHA 2V0TA 1TWZA 3BMXA 2GQQA 2RGLA 2VC6A 3O07A 4QG6A 2D3ZA 1K4HA 3EPGA 1OJ4A 3D3FA 1MUWA 4O0QA 1RU2A 2XHWA 4O18A 3LS9A 3MPVA 5CC3A 4CWBA 4HPJA 1E6VA 1N36F 5A69A 1CENA 2FY8A 2BS9A 3R4IA 3OW1A 3LCWA 2G0WA 3PYDA 3SDEB 4AEFA 2GGPA 4M0XA 2I5JA 1E71M 3UYCA 4IR1A 4N5SA 2FUG9 1JD9A 1TVLA 4PCPA 1WKFA 1BG4A 3A3HA 3FNNA 5KFOA 2Y1LB 3OVPA 4DUVA 4V1Ak 2VGFA 2X16A 5CBJA 1VQTA 2EFNA 3OTOJ 3G8EA 5D2WA 1FWAC 3V35A 3MM9A 4QCEA 5ECVA 4MJKA 4LC6A 2C2MB 3BCFA 4MWAB 3DG7A 4MK9A 1XGEA 2EGZA 3NPXA 5F8GA 4DX6A 4NP7A 3B0XA 3OSPA 3PTQA 2C7FA 3GH4A 5C24B 3KLHA 1S1XB 1KD0A 2RH3A 3QWUA 3WEZA 2ROEA 3S2MA 3DRYA 2DNPA 5DG9A 4FVMA 2OHDA 5KFLA 4FPSA 4YCOA 4MLRA 1W1YA 3SIPB 5LXXA 5LA1A 3W7BA 2YW4A 4W90B 5KFAA 3NGRA 1P1XA 3NCOA 4GPNA 3V0TA 4KGLA 5I3JA 2YKPA 1J0ZA 3QBCA 1U2YA 1C3FA 4RXFA 1KN6A 3OZMA 4N2YA 1XP3A 1M03A 1NZAA 2HGNA 3CJ4A 5HNUA 2HVDA 1U47A 3LCLA 4GIEA 4H19A 2LDIA 3H5SA 1N6QA 3MSYA 2POTA 2FGCA 3HB9A 4GC7A 5BRQA 2PE8A 2V63A 3WUEA 1RGVA 1JXJA 3DRSB 4TX9A 2D3LA 1I51B 4M7TA 3N4EA 4JYEA 1XM3A 4W4QA 4YU1A 3T41A 2ZUAA 3D3BJ 2W8LA 3GYEA 2XZDB 3EX4A 1EGVA 2W9AA 1NP2A 2XIIA 1RAHB 3TCEA 3W1UA 1WACA 4F4RA 4CIOA 3EB3A 4ECUA 3HK2A 1JFHA 4OHXA 3BE7A 3VOIA 3EGJA 1UOZA 1X9SA 1NWTA 2EXUA 1I2QA 1H0IA 3EX1A 1P0NA 4IPLA 3CUXA 1PS9A 1SU5A 2AV5A 3VR1A 4C5YA 1HL9A 3J81Y 1VFUA 1QU4A 3EKLA 3NPVA 4RX6A 1X39A 2C19A 4GRSA 3SFWA 2XS2A 1UR3M 4UBPC 5M2UA 1S1XA 2E5LJ 4KEVA 2J13A 1DHPA 3KM8A 1XMQJ 3W66A 4DJDA 3RR7A 5J04A 4LRAA 4XDDA 4GD0A 3UP8A 1VQPS 2ZZ5A 1XG3A 5T41A 4PG6A 2GV1A 3H8YA 2OTLS 4ECVA 3MEEB 8AT1B 1E40A 3GX9A 1W5PA 3S8HA 2PZNA 3CE8A 3VNYA 3U1NA 1S0MA 3WH5A 2VNCA 4S0MA 2MGZA 1MNEA 3RM8A 5C0QA 4J9MA 1KLMB 1W9UA 1NEEA 3GCWP 5EA9A 2EBEA 3BAIA 3WBAA 1GKRA 4DF4A 3VNJA 4LSNA 4UOJA 1SBRA 3PXGa 1VGYA 5GAHI 2I5GA 4OI0A 4GFSA 1KONA 2DIKA 3K5MA 2Q3RA 1GYMA 1UUMA 4H9TA 2HS3A 3BLEA 2ONEA 4JV5F 5B7WA 1REVB 4DVOA 3KNAA 1RCOB 1LWEA 4XK8C 2J76E 4XBKA 3PG8A 4D8AA 3K8VA 5IFMA 1WOBA 2VIHA 5LMNF 2HQCA 2B7NA 2MLZA 5KG7A 1GW9A 2Z7GA 3CGIA 2RKXA 2XGBA 1HI0P 2V2KA 4CZCA 3VCDA 1E4MM 2VX7A 3E49A 1X4FA 4CQAA 4ZJOA 2EQDA 2UUCJ 1N32J 1DTTB 1J0IA 3ZS4A 3PZPA 1O4UA 3KHRA 3ZJ8A 3Q8UA 5HVFA 2CLEA 5G4DA 4ZP7A 5GNXA 3KOXA 2REQB 4XZHA 1S1TA 4C8LA 1MMDA 3UU0A 1D3GA 5D04C 4KRUA 4BWLC 4OV1A 1OGBA 4WBFA 4S2BA 3INPA 1WF1A 1JCTA 3J7HA 1YJUA 3HA1A 4LAZA 4O19A 3W1LA 4MYUA 1NPKA 4IP5A 1RT6A 3H4BA 2W92A 3MUXA 1BUXA 1P6TA 4AX6A 4AEEA 5A6LA 3NIYA 2R2TA 1PZ2A 2MKHA 2A10A 3ZIZA 3VZIA 4M81A 3RM4A 5I2UA 1TUVA 2DEPA 2I9UA 1GVYA 3D0IE 1EO5A 3OXFA 4WZQA 3BZQA 1WC0A 1X6NA 1M65A 3UG3A 4YB1P 3SIZA 4MHBA 1F3XA 5E0CA 4LT6A 2J9EA 3TVYA 4I56A 4QIVA 4DSKA 3EOLA 5E7OB 2WVDA 2LQ5A 3KTSA 2XMTA 3V6KA 4OQVA 3MMJA 1MN9A 2VFIA 3VAFA 2BGNE 3TW0A 4ICCX 4ZCLA 5JBFA 3UT0A 3AB4B 3W75A 1O12A 3GU9A 1SJQA 3VAIA 2FHJD 5K8NA 1QOQA 3BSCA 4RX0A 4D72A 3W1YC 3W07A 2ATMA 3CMGA 3ZM8A 2MLYA 1DTTA 3HF5A 5DBUA 1RP8A 2JJ4D 1TELA 1VIWA 1T9VA 5G2IA 2MZSA 1FDZA 4HYVA 4FLRA 2PWEA 2EK6A 2BYCA 1FF2A 3MTKA 3AT1B 4ORMA 5ETQA 1UEKA 3N2TA 2OKTA 3Q4DA 4IPJA 4DV3F 3QH2A 1QI4A 3W02A 3HVWA 2D1CA 4OYMA 3ICJA 4NZJA 2ZWPA 1TREA 3DESA 4HZ8A 4O15A 1E5JA 3LCHA 3LRLA 2VX4A 3RRKA 2HRWA 2N4CA 4LR9A 3Q8VA 3N79A 2YOCA 3N15A 4QQBA 2GVDA 3JR2A 2TRSA 4ZKAA 4JV2A 3QJAA 3NQ6A 4BF5A 4UMBA 4NY2A 2Y8YA 3C2YA 2IMOA 1D9EA 1ZBCA 4L6HA 4XKMA 4ECLA 1W9XA 4PH6A 6PTDA 5DLFA 3ET6B 5LNRA 1RT7A 1AZSB 4NA2A 4ZSTA 2GK1B 3HGOA 3SXLA 1GG1A 3SSJA 4GBDA 4ES2A 1HIZA 2JEIA 4H2HA 1V4YA 3A5FA 4ICLB 1G4PA 1LL4A 3VDBA 1SV5B 1PIEA 4IFOA 4L76A 2OO6A 2V69A 3LSBA 2ZXQA 3QTGA 2G0CA 4MWAD 4LIWA 1RBLA 5CPSA 2UXCF 5FI8A 2K8GA 2OQYA 1WKYA 4Y34A 4IRKA 1IIGA 4Q7BA 1LOUA 4X60A 3GW3A 2IM3A 1VIOA 1G0CA 2HNYB 2UY2A 3HOJA 2RHSB 4XQ6A 1NOWA 4K4WA 3N3MA 4TXSA 1HKMA 2DO0A 1PAEX 2GHPA 2Y8WA 3LRMA 5LIKX 4B91A 1JCMP 2Y3YA 5AJ3J 2ZJRQ 4F2UA 3NJ3A 5LSLA 5F8LA 1JCJA 4GMEA 3PJTA 1RT3B 3CCVS 2ILZA 2QCNA 3A23A 2PN6A 3AD7C 2XWDA 1LG2A 4MKNA 3BV7A 4B9LA 1E9IA 3WYZA 3W2KA 5DX7A 1NARA 4B5XA 2HPIA 4C0BA 2MTLA 1RA0A 1S0NA 3WQGA 3ONCA 3FFIA 2VD3A 3TARA 3MHFA 3SSRA 2NSCA 4Z1DA 3T1HF 2ALZA 4V19J 2EHHA 5KFBA 3T1YF 4NL5A 5I0DA 3HSDA 3M2VA 4NLRA 1B7FA 3EWDA 3I3DA 4CN1A 1UOKA 3GSIA 2IW0A 1FRHA 2G3IA 2G4FA 2MY7A 4G1QB 2Z4PA 3CD6S 3LQLA 4AQLA 2DRBA 4LF8J 2W9CB 4C65A 1XR7A 3MANA 1HQUA 1SW3A 2F63A 3TVZA 3AODA 2DJXA 2GQ3A 2X0HA 4YN5A 2EKNA 5G2HA 4M3PA 4DUOA 1JQVA 3P45B 4EO6A 2GIQA 1SJ3P 4D1IA 5DG8A 2PBGA 2IRUA 1VQMS 2CJ9A 3CCJS 3DDIA 1X4GA 3BMWA 4ECXA 4GKJF 5L1IA 3CEUA 1HVXA 2Z7KA 1NSQA 3K0JA 2PDPA 3I6TA 1FESA 2RRNA 2W67A 4JQ3A 4F0HA 2ZBIA 4URGA 3KUMA 1QUVA 3VC5A 4DJFC 1XH1A 3T5HA 2B81A 1YDLA 4XAZA 4QSHA 1RWKB 2VT0A 3DYOA 3KJNB 4C2MA 4URIA 3R9LA 2VFSA 3CS2A 9XIMA 3OTBA 4CU6A 3VIPA 4AZCB 4C91A 1EIXA 3PIOQ 2HFUA 2XDFA 1UCWA 1K02A 1JIBA 2PGFA 2YH0A 3OR1A 4X4TA 5DGBA 1X60A 3DG3A 1C7TA 1F3EA 4J4KA 4PXBA 3GFXA 1ICQA 1PYFA 2CPUA 2E7VA 1Q78A 4NYYA 5E5CA 4RU9A 4FS2A 1UPMB 1HN1A 1JLAA 3RK8A 3NZQA 1DWGM 3HPOA 1BGAA 2R14A 3RJXA 3CDAA 2DNKA 2TPSA 3W9ZA 1W5NA 1EETA 1JWWA 2ZNYA 4Q8EA 2ZUMA 3N2XA 4I9AA 1R85A 3AS0A 4N76A 2FB0A 3ITGA 5L1LA 4L3NA 3RO6A 4QWAA 4XX6A 2C42A 3BREA 3A13A 1FRBA 3PZOA 2QE5A 2O55A 4IJRA 2QMXA 1V8EA 5A8QA 2B7OA 1XNQF 4XAGA 4IISA 5I3QA 3FVYA 2VGGA 2H1YA 3FKKA 1TPFA 2RKIA 1TTQA 3GXNA 2J9XA 4HNNA 5EDWA 2CZVA 2R6OA 4KGJA 3C61A 2H9AB 1QK0A 1WUEA 5CJMA 4Z1YA 1LW2A 2E5JA 1AZ1A 2FGBA 1SZFA 3R1ZA 2UV8G 1RJJA 2ZDPA 1VISA 1U1KA 3R0UA 4PMOA 3W2NA 4IH5A 2YKAA 2HNZA 4XK2A 3IUIA 1OK6A 1BEUA 1QAJA 3AMKA 2XTKA 3FA4A 3R8GA 4GXWA 3SQSA 1XBYA 3NM3A 1WEYA 4PG7A 3K5OA 1LLOA 1KV5A 2HQ3A 4ALZA 4GINA 4TX8A 2QMJA 2D0FA 4OOUA 4R7JA 5G2WA 3B4UA 3U5UA 1K8CA 3PNIA 2E66A 3E38A 2AF6A 5IQQA 3JB9k 5IM0B 2YXLA 2JQXA 3TXVA 3DRRB 1SKRA 3SRKA 4NZ4A 1OD0A 3TXZA 1VC4A 4NLWA 3A8EA 2LECA 3SI9A 3Q0AA 2ZDSA 4AY1A 2M0GB 4AVFA 1MUMA 2QUMA 2VR2A 2E9ZA 3VKCA 4JI6J 3G8QA 5F1VA 3N2OA 2V2VA 1JZ8A 4F0LA 2AQVA 3DFTA 3U57A 1AT1B 2IRYA 2Y0SD 2DUAA 3THVA 1GKPA 1AL8A 4EYHB 2DVUA 2RU9A 2H8ZA 1KM0A 4ZGYA 4YEAA 4TV5A 3HPAA 2L48A 4X4RA 1QAPA 4TY9A 1R7OA 3WJSA 4RLIA 4WJBA 4C11A 4HA1A 2Z2MA 1G4SA 4ZPCA 4LS2A 5KFDA 2VZ9A 1SIWB 1ITCA 3O0KA 1QDUB 3PX0A 2AGOA 1V5VA 3ITLA 1D8CA 4RNNA 3LBOA 3VAMA 1E9YB 4AUKA 4ZA0A 1JCNA 1US0A 2XHCA 1Y8BA 3PYEA 4Z7CA 4ZIWA 5JIWA 1U09A 2OPSA 3KFTA 2V4JB 1PWMA 1A5MC 1YKWA 2GJXA 3LPOA 3SCJE 4BLGA 2CFXA 3O3RA 3OA5A 2APOA 1D9DA 4MMWA 2P6TA 1S5WA 1K47A 4TTGA 2Z6IA 3CWOX 2HHXA 1UCNA 4UTIA 1QFEA 3TR2A 2PTYA 3Q8SB 4C90A 2EO7A 3W7MA 2BZNA 4P2MA 1H51A 3A3PB 3LHYA 1VF8A 3CIMA 2ZKMX 5L1KA 5CSYA 2IFXA 3QN3A 4FNRA 4AYSA 5AC8A 1UA7A 3BBFA 4L80A 4W92B 2P8CA 2XGIA 4PMJA 5ABTA 2VC7A 3GC2A 2F4VF 1HP4A 3WMBA 1FDNA 4KGMA 3BLLA 1AW2A 2IPJA 5I23A 1FEEA 4W9TA 1TTPA 1I4NA 4DHGA 4ZCMA 2ISSA 1QSLA 4ZFCA 1KQYA 1MVYA 3AJ2A 4LRSA 4L3KA 3PWAA 3Q58A 1U0HB 1UMJA 1RAJA 1KFEA 5EY5A 3A8IA 4XTTA 3QRPA 1XIIA 2J88A 2JX2A 2E6DA 3KCJA 2I5JB 4MB4A 4KEMA 3ISZA 5CPOA 4GQ0A 3NNAA 3UJEA 1O1ZA 2WHMA 1DQ9A 4BJHA 3OJUA 1WAUA 2NYHA 4HU4A 1AQ0A 4F2SA 1LG1A 4MTVA 7TAAA 3KFWX 1Z3NA 4KGKA 2XCAA 2LYVA 2AMGA 5A94A 2NPFA 1R0MA 5IBXC 1HD0A 3VQTA 5A6MA 2KHDA 3C3NA 2VM8A 2I6WA 2QT3A 2J27A 2OVLA 2NXCA 1TWWA 2VYOA 3FJNA 1I94J 1XJWB 4AH7A 3MBDA 4EPKA 2B4VA 3LAMA 2H65B 3VX1A 1OYCA 4CN4A 2OG9A 3WH7A 1FI4A 4QG9A 5F8JA 4LF7F 2DVTA 3E0IA 1WO2A 3MUCA 4RWWA 1J5EF 3I68A 2VQUA 1UP0A 4ADSA 4ATNA 1MZHA 2P3EA 5AYIA 3MM7B 3HVTB 4H4KA 2HGLA 3N4WA 3FRYA 4I0WA 5HQMA 3E9AA 3WO8A 1CULA 2HW3A 3EZ4A 2J9DE 3L7UA 4Z42C 1H4PA 1JAKA 1ZS2A 3N13A 2W63A 4KV8B 2XSAA 4GNVA 3RB0A 4EPEC 4GMKA 1CSJA 1AD1A 3E0WA 1YZ7A 3HD1A 1RT7B 3TDFA 4TVCA 1UZHA 3B03A 5HWMA 1LQ0A 4A29A 4KCWA 1VRTB 3Q86A 1QR7A 3TX9A 3HM7A 4QAWA 2R1PA 3HURA 3K4DA 4IQDA 4LUYA 3WJXA 5HQ8A 3CZKA 3M2RA 3GLJA 3F4NA 1Z1ZA 1WHVA 2A0FB 3FQLA 4NVTA 1IV8A 2HHQA 5A76A 3DNCA 2ZYFA 1XPYA 2VKRA 1CLFA 2IVFB 3U7VA 3VINA 4LSLA 3LK6A 1F3WA 2ZUUA 4DCPB 1TUWA 2MKCA 1SZGA 4AZGA 4A8RA 4R88A 5E9XA 4LUTB 1HW8A 4ZHRB 3VGDA 3VILA 4GQGA 4JEQA 3D5MA 2DIVA 3UR3C 1HG3A 2VASA 1TJ2A 3MCNA 1WDDA 2OH2A 1GYLA 3A4XA 4O17A 4JR5A 2FHOB 1IEWA 1EDGA 3DXBA 2DHAA 2GGGA 4M8LA 3ITXA 4FSAA 3ZZPA 5AT1B 3L4WA 3PFOA 4O8RA 2W8KA 2P50A 3O8AA 3ARSA 3UWEA 2D2OA 4RW8B 3PM6A 3T0DA 1NDCA 2ZM6J 4S23A 4JFWA 4M51A 4B2DD 3QAUA 2DUXA 2NXGA 4OLPA 3IJQA 3DRPB 2EWHA 2H3EB 5KFRA 3GIYA 5CZTA 2VRJA 5F8NA 2NVCA 3DN9A 5IHSA 4XTDA 1EYWA 4KV8A 4HTJA 2XY7A 4Y90A 1E73M 1U83A 1BF2A 3P96A 1J8VA 1KWGA 2DCLA 3IJ9A 1O94A 2HDJA 3ELHA 1PIFA 2FHCA 2IKJA 1WKDA 4PRTA 5KFXA 1TQLA 1NFPA 2AX0A 3PZTA 1ZU8A 3FHQA 2W24A 2FVKA 1S1UA 1F4HA 3MUTP 3T9PA 4Q4PA 3BARA 2JEPA 4RW4B 4D71A 4F25A 1UYQA 4KWVA 4X64F 1PAUB 4JTJA 2QZ8A 3MV01 1VQNS 4UQBA 4I90A 2PT0A 2RSQA 5KZDA 4RE2A 3C19A 4QQ3A 1B3TA 2TSYA 2EFOA 1K6AA 4DSEA 3OGVA 1ONWA 3RO8A 4ENLA 2V81A 2FDNA 3CD0A 3G2GA 4JI6F 5HK4A 4UQ9A 3CZ8A 3CCTA 3PN8A 4XAFA 3OVGA 4J1OA 2DYAA 1UL3A 3OZPA 3EMQA 1TE6A 3RAOA 3JAMU 3J7AN 4YPJA 3S9IA 4YWIA 2DV0A 2FLOA 1QAIA 4JI5J 3GUWA 3PBUA 4ATLA 1TJ0A 1FHUA 4HDGA 4ZCIA 1TWDA 1PXGA 4FDFA 3V1HA 4BWJA 1LFPA 5D05A 3W9JA 4E2FB 3C8NA 4F4ZA 4R9XA 2J6XA 1CEOA 2MKSA 4F9JA 1RHQB 4B5NA 6XIAA 5A6WA 2FJUB 2DCUB 1RT6B 2DY1A 2QLWA 1CJTA 2HE8A 4WJ8A 2X2YA 1C4CA 1EBGA 3WF1A 2J0XA 1ZALA 1GH8A 1S1PA 2EC0A 5AC7A 2WNZA 2J75A 3C6UA 1F60B 4CYUA 3NGDA 3ES8A 4WSJA 1SC1B 4X4OA 4LAMA 2MKYA 3NAVA 1JZ3A 1UJPA 1L3KA 3VTIA 2Q09A 1VBZA 3NGFA 4A05A 4Y6IA 1U6BA 1R9ZA 2NR0A 3R2GA 1MN7A 3DI0A 3HTWA 4P71A 2HK1A 1DV7A 4L73A 1V51A 4B4FA 4MKYA 1ISVA 4LV4A 1UWBB 2VCCA 2QCDA 2J7WA 4QIEA 2HLUA 2RFGA 3GHUA 1JDAA 3TVAA 2J7UA 3EMZA 3WC2A 5K7JA 3EWYA 4CNNA 2YBUA 4W7VA 2L5HA 4R8UA 1VYPX 1QK2A 4JTTA 2CPJA 4IR9A 3S1UA 2LXIA 1SV5A 4HR2A 4GZEA 3EKGA 4LF1A 1QSYA 2QXWA 1OQ3A 1THFD 4I7UA 4CLUA 4HIBA 1JCLA 4DXLA 2PDCA 3VPLA 1NRKA 1Y5WA 4PUDA 4CQDA 2BBEA 1KRBC 4J40A 4EBEA 1NDZA 2BDQA 1MWYA 2QJJA 1S5MA 1SSDA 3W1MA 4WY0B 4KKOB 5JVGQ 4XWUA 3JQKA 3ATYA 3I0SB 3L7RA 3V7PA 1JLGB 3CPRA 4ORIA 3M0HA 2VC0A 3IBCB 3ZFHA 2WWDA 1EP3A 2GOKA 3B04A 4R7OA 3I9V9 4Y6GA 3CCQS 2V5LA 3DH7A 3LG3A 1JG9A 1APSA 7PTDA 4NKCA 4HPXA 2HFSA 3H53A 3H7RA 1RP9A 4YVVA 4UFJA 2GVZB 5CXTA 3GDBA 2R7WA 3T6JA 3RIKA 1JUEA 1TZ9A 1W1B1 2R91A 3QIPA 4IUOA 1WKJA 4Z2GA 4NXSA 1DIEA 6REQA 2CLIA 1EP4A 4EOUA 3DFSA 3GD6A 3HJFA 1AQMA 5J8LA 5C9ZA 3P67A 2DNMA 1H73A 4QE1A 1X8CA 3GV5B 1TRIA 4W5ZA 5C5YA 3BM7A 3FCHA 3M2VB 4CQ8A 3BKTA 3NTYA 2KVQE 1H63A 3PJXA 1XCXA 1GOWA 1RQHA 5I06A 2QUNA 3A47A 3P5ZA 3G22A 1FWSA 4ID8A 1MI3A 3MO4A 4KF1A 3UR2A 3GR1A 4U67Q 2EC2A 4GVHA 1LORA 4K68A 3CQJA 2X51A 1UMLA 3CW2C 5EHHA 3FBEA 3W7CA 4KHMA 2YCLA 4JAWA 3ZLFA 4F67A 1Y0EA 3OL7A 3TYTA 2ZH4A 2NT1A 1JF5A 1TJRA 4WD0A 1ZHAA 1RYRA 5FEPA 1BHNA 2QC3A 3HP6A 3BYRA 1K1QA 4DI8A 1WHYA 4WFBQ 5HP1B 1A5AA 3RRAA 4X9SA 1C0UB 4XO6A 4KGZB 3NWGA 4HN4A 2OI2A 4DYJA 3IGSA 2WNWA 1M5SA 2Z2AA 2PZ0A 4KQNA 1JNDA 3BH6B 4CQ9A 2R2UA 2MHNA 1OSDA 1OSEA 2QYGA 4J9JA 3V6DA 3VAKA 4UFKA 1JMTA 3M43A 4J3ZA 1FVSA 1CT5A 1JXEA 3I87A 4KKXA 1A5OC 1DP0A 3T8LA 3WNOA 1ZM4A 3GUGA 2AX1A 3N28A 1I8JA 3KTQA 4DL7A 2QL5B 3FAWA 1XRTA 4NNAA 3N04A 4MNLA 4J2PA 3VAGA 2XFRA 2VZSA 3K8KA 4EX4A 3HHNB 4WFAQ 3PUOA 4LT9A 4Y0FA 2QJ3A 3AZRA 4GA8A 3C6TB 4DELA 4JQAA 4NU7A 4MLJA 3DHPA 4OECA 3OW2R 4GO8A 4K4UA 1R86A 1UROA 3DOPA 2HG4A 2V3EA 4O50A 2K3KA 1H1YA 2A79A 5CYQB 3W01A 2ZJQQ 3AZTA 1V0LA 1YJNS 4WKHA 3GIJA 2CNLB 2WSRA 3KMQA 2J9DA 3CT9A 1X4CA 3T2OA 3UR7A 1O66A 4JS3A 4NZFA 5CQ1A 3E2RA 3TH6A 1RAFB 3VAJA 2ZOXA 3H54A 3LQGA 4D9PA 4B08A 1NK7A 5IOLA 4KCUA 5HNNA 4TVDA 5L9XA 2QDGA 5A8OA 2GPTA 3G1DA 1HBNB 1E56A 1PX3A 2ZADA 2Q6BA 3WNKA 3MFIA 4AL7A 2V8HA 1HF6A 1UKSA 2VVSA 2E1CA 4QE5A 3VVUA 1A5CA 1WPCA 4X84A 1PYOB 3TR5A 2BBFA 1U45A 1ZS6A 4WOQA 4UTHA 3CO9A 1XIEA 1VQOS 4FXRA 2DH9A 3MPWA 4A8FA 2M7SA 3CMAS 3AJ1A 3POTB 1S5VA 2IBKA 2PI6A 3VZZA 5D4LA 1EH9A 2ZBCA 2AJ4A 2OZTA 2ZVRA 3APGA 2XCPA 3T9ZA 3B8SA 4YUDA 1CB7B 1LOLA 3IGHX 4K1WA 2BR0A 3VGSA 1XBZA 5AZ0A 1S7IA 2R8JA 2N82B 4X62J 3DM2B 1NNDA 2EPMX 4L56A 4JUZA 1J6OA 1TA3B 3UGVA 4DO4A 3CQHA 3CC7S 1R0AB 4NXNJ 3C2VA 2JVOA 2IXUA 3HG3A 2CZVC 3CCUS 5HOSA 1PSCA 3EAUA 3TWAA 2AIRB 4HH0A 1EA9C 3U0HA 4HA4A 1R30A 2YB4A 3PK7A 3W2WA 5LM7E 3QYSA 1TKTB 1LK5A 4E3TA 5C25B 1O5RA 4CCCA 5GADU 2XNRA 5FF2A 5CJNA 4UFHA 1WC4A 3ARVA 2FMOA 3SAZA 1NIUA 5ABFB 4MT1A 2IC3A 2ZBQA 2IKIA 4QYRA 2VD9A 2H4YB 2BHZA 3QPIA 1C0TA 4DJFA 1F6KA 2V9DA 2WSPA 4DWIA 3R0DA 5E70A 3I3BA 2ZRVA 3I5AA 2OWWA 3F4CA 1FA0A 2E6FA 3LU2A 2VZUA 1XD0A 2OMAA 1XWYA 1EXBA 4NG3A 3SCNA 3GR4A 3MBFA 2VBYA 3H5UA 3HULA 4LF9F 1ZENA 1CW2A 3H4WA 4OHVA 1CJUB 5AECA 1W17A 4WU3A 3TYCA 5ADZA 1HW9A 2IJNA 4C8YA 3EWZA 2VRQA 1M1HA 4Q2LA 5I77A 4KFBB 4OU1A 3UPMA 5D9PA 4JN8A 2ZOGA 3LBMA 1GOOA 3MEEA 4LIRA 2HHSA 1V5XA 1EKSA 1S9EB 4OX8A 4PR6A 4I5UA 5KFGA 1TMHA 3QY6A 1NB2A 4ECSA 1U1JA 3RPDA 1Y7PA 4YS2A 3BN7A 2CQBA 1RACB 4DS5A 2OCZA 4PG4A 4GIAA 1OEPA 5HJLA 5XIAA 3L2LA 1NDPA 1SB6A 3UWVA 4ED6A 2VA3A 3OJGA 3FY1A 4H7ZA 4F26A 1JPKA 1RWWB 1FWDC 1S9GB 2MZ1A 4OYZA 3ZO9A 4YP3A 5KSWA 2KRBA 1R31A 2VUNA 5FJ4A 5IC4B 4CNTA 2YBVA 2CZDA 3WQOA 1R9XA 2RJHA 2DW6A 4C8KA 4HI1A 4OZ3A 3OQ8A 4I68A 2CEQA 4NSBA 1HJXA 4HK7A 1VBJA 4GVBA 5BXPA 4BY3A 4EEYA 5I24A 4HACA 2E1PA 1OPZA 2HEKA 1JQXA 3MUVP 3PBVA 1WF2A 2CJQA 4RUCA 3IUDA 3NO1A 5GNYA 3AMDA 3LCFA 3RAXA 5C5JA 4KEUA 3KJQB 1A5NC 3UNDA 2EG6A 3MPUB 2PMZD 4X62F 3CF5Q 5LJ3Y 2F9JA 5H9EJ 3L7OA 5D32A 4UR8A 2RDXA 1KKRA 4O3QA 1XJBA 3GAKA 2G95A 2YZ5A 1S6UA 5FSDC 1G9HA 1F0XA 3AQOA 1J27A 1PC4A 2AJ1A 3NNTA 4NI3A 2RUSA 1V77A 4NMXA 1HNXJ 4QDPA 4HL9A 3GZ3A 1QHZA 2I8EA 1WQ5A 2Y7DA 2PC6A 3PJ9A 3HU7A 2H90A 3EGWB 3FGVA 4OBTA 1EOMA 2HAIA 4DUWA 3MFHA 2E1RA 1EJUC 1K9EA 2BZ2A 3HQNA 1OIMA 1S4EA 1N7KA 3PRBA 2VJUA 3ZT6A 4Q8TA 2I5QA 2VUYA 4DCOB 1DAXA 3HJZA 4JPGA 3KMSA 2WHJA 1B0TA 4XD5A 3JTOA 3R6GB 3PEHA 1IBKF 2IYIA 3JZUA 2Z30B 3F5LA 2RIJA 3MVTA 5KOXA 2P8IA 2ZH6A 3TRGA 4WTYA 1IGSA 2Z6JA 2Y5JA 2NSXA 3DN5A 4ATWA 4OLOA 1OK4A 3M5VA 2XG8A 3FA3A 4GVBB 3ZJ7A 5HMEA 2KZHA 1UWBA 5DRKA 1WNEA 2Y5SA 4H9XA 4K4YA 2BKPA 2YB1A 4MJ2A 2W3ZA 1WXYA 1FHTA 1GORA 4JTEA 4QIGA 2IPFA 2NQ5A 3VIMA 4F8RA 3OBEA 3DYAB 2GJPA 4DLEA 3W74A 1OCJA 3M2RB 4ZVHA 1VBUA 4N8NA 1PVNA 4Y8FA 1HLWA 5KTLA 5IQ6A 1V3SA 3CUNA 1RBAA 2CKRA 4MNMA 1S1TB 3ENWA 1Y7VA 4JTCA 1U1QA 4DMZA 1VJZA 4KETA 4G3IA 4NAEA 1JD7A 3HM9A 2BABA 2FYXA 2O7SA 2JWNA 1RA7A 2V30A 3JVAA 4S38A 2M4MA 2M2BA 1ZP4A 3HQOA 2CJYB 5DS7A 1K9TA 4ALDA 1XGZA 3O0FA 3UGRA 1RVGA 3WMCA 5LNSA 3DLLQ 3SSZA 3PBYA 1B31A 4Q22A 2RU3A 5F2GA 3LHWA 2X2GA 1MW2A 9CGTA 3QHOA 4DPYA 1BQCA 3I7QA 4ZO8A 1OS5A 3ZO7A 1A3XA 5E1QA 4NMLA 3IJ6A 4HMCA 1VQ5S 1D9FA 2OX4A 4DLMA 2DZXA 2YWHA 4WGXA 4DR6J 1LM1A 3Q8PB 1GXUA 3MD3A 1RCXB 2ZRZA 5GMEA 1Z7AA 1U25A 4ZK7M 1UFWA 3NCRA 4FXVA 3HHDA 4V28A 1CWYA 4F9DA 1XIQA 1Y5LB 1FDBA 3BQ2A 5AHLA 1X4AA 3MDUA 1TZ7A 3IM8A 3W1NA 1MU2A 2IDEA 3ET6A 5A8MA 1U5HA 1MWQA 3UE2A 3RRGA 4DJBA 2ACRA 5K9XA 3QF0A 5CQGA 1QT1A 3QLHB 2I9SA 3P62A 1E0UA 4KERA 4EXBA 4E2VA 3TN4A 3TQ1A 4U8VA 1PJ7A 4MIBA 2VFFA 4MJ4A 2OEMA 2XH7A 2MLXA 4ZEPA 5HI7A 3HHEA 1X97A 2CVIA 5I3IA 1CGYA 3HHLB 1EHAA 4I64A 1UBSA 3BC9A 4M5IA 3AUJA 1UG6A 3LN3A 4P2XA 4X61A 4U5IA 1IEVA 2PDMA 4H01A 2VC5A 4MAVA 4P75A 5F41A 3CJKA 5LA0A 1V93A 2VX6A 3VOJA 5KT5A 2OTJS 3DERA 4WVXA 1BD6A 4ML9A 1F4AA 4AHPA 1SH2A 5ETKA 3SCKE 3EDDA 3WJWA 1RTJB 2OD4A 3MW7A 2JNJA 4U5KA 1H61A 2PIIA 4NJGA 1C4AA 1GXLA 2R1MA 4QM1A 2PRMA 1I6JA 4RV8A 1TMJA 4B3OA 1T95A 5DRCA 1DHMA 1HBMA 1VMBA 3QEZA 3EOOA 4R5EA 3MYPA 1KCKA 2J66A 1XRVA 1PJ5A 3BG5A 2E5CA 3WBYA 2CQHA 2XH4A 3DOKB 1ODUA 2YNGA 4LBSA 4GVGA 5HJYA 1JNZB 3KNGA 2CBIA 4M5DB 4OGZA 2Q8XA 3LHZA 4AHQA 5MKGA 1PJ9A 5ETVA 1DFDA 1KM3A 1YQ2A 4P2SA 1YYAA 3M6UA 3WQFA 5DO2A 5K9FA 4PMNA 5I3FA 1VHCA 4UUXA 2KT2A 1D2KA 1FTRA 4J91A 3P3BA 1HQUB 4QGCA 4JP8A 3OJSA 4AZ5A 4NJHA 7CGTA 4DV1F 3W5ZA 1DY3A 5HMZA 3GE7A 3WD1A 3TSMA 5M03A 4IQJA 4QPTA 1VEMA 1ZP3A 4QLKA 2E7XA 1RCQA 1EGZA 1HKVA 5GAEI 2GNKA 4DEFA 3M5ZA 4EF9A 1JVNA 1T3NA 3RBXA 4FXDA 3GMGA 4FF2A 1GMWD 5GAGU 1HNZJ 2XY5A 2VQFJ 4Y2CA 3TJAA 5J1EB 3VKAA 4RPFA 4PWDA 4GK8A 1FFQA 3M8ZA 4PZVA 3Q83A 4XD3A 3VABA 4ILLA 5EMJA 3WELA 3PR5B 4NEZA 1GQNA 3TJIA 4DCJB 2WHLA 4W88A 2X7IA 5C24A 2QCMA 3GHRA 2G4JA 4IM4A 1JGIA 4L9ZA 5LNVA 3HFVA 2OMLA 3CMFA 1XR6A 1MWZA 1MW3A 1VQKS 4DQWA 4F0KA 1WZKA 2YWWA 3IXQA 2DIEA 1GCYA 5K3VA 4QR2A 4M7SA 4H6RA 2DSWA 2GJIA 1J18A 1RWUA 3UN3A 3CCSS 3HCXA 3USZA 2O92A 1R3TA 1K9FA 5G4EA 2X0YA 1KC8T 3OHAA 5LXYA 5EBUA 2DGOA 2UVRA 4RU2A 4UW2A 2FTYA 5A8WA 1TG7A 4LFBJ 3SGGA 4X4SA 1YJTA 5D2YA 4A46A 1N32F 2QGYA 4DR5F 4LVBA 4USHA 2DQXA 1XIGA 2HV5A 4B5TA 4IL2A 4KBIA 4R0EA 2VJVA 4P7NA 2CQ1A 4ZVFA 1Q65A 2QEZA 4KH2A 1EWEA 4GXPA 4KRTA 2M88A 2ZZ2A 4WF7A 1LQ2A 3OLDA 3DOMA 4QPXA 2I1OA 3KHLA 4XIAA 2R7OA 5D0GA 1C8XA 5H91A 4Q7NA 3EWWA 4YJ5A 1U1LA 2MZJA 2J62A 1FEHA 1V3IA 1HD1A 2ASHA 1UR4A 1ME7A 4ZO6A 2X41A 4C6OA 4WFYA 1OFEA 3PUEA 2IJRA 3GRIA 3QGGA 4JI5F 4M94A 5CZXA 1LUCA 3VGFA 3EJMA 2OO4A 1QPRA 1RU1A 4M63A 2ZQ0A 2G3NA 4BEQA 2QSWA 5D8WA 2HBZB 2GAGC 5HPOA 3AYRA 3T81A 4JOUA 3TJ8A 2MZRA 4S3BA 1FFRA 1RSCA 1HNVA 4Q32A 3ALFA 3CJ8A 3FXGA 3FFSA 4Q8NA 1XLJA 3QHMA 2GQ2A 5DFAA 4Y2WA 4FNTA 1F76A 1QMLA 5K4XA 2FDMA 5DDRC 3ME3A 1HMVB 4X66F 1NUEA 4IQEA 1QI5A 5IM0A 4BWLA 3FJ2A 1RWOB 1FX4A 4XO0A 1Q2SA 4U7UK 2A5HA 2D2HA 1QNSA 4UC5A 4CD7A 4HT7A 3D3CJ 4POCA 3RBDA 3GHTA 4JEJA 1M5WA 3TMLA 3FYPA 2WSYA 3APTA 3WX7A 4R53A 4HBKA 1PTGA 2FPVA 3B97A 4B9TA 1S2VA 3GG0A 4RNFA 1DEDA 1FOBA 2CZ4A 4U3CA 5C9RA 4DI9A 3A8JA 4Q8PA 1TPB1 1J6PA 4UOQA 2MQNA 2JL9A 1KCLA 1I60A 2ZE3A 3Q65A 5D09A 2QGFB 1VPXA 1T0OA 2VL4A 1HP5A 4ZN1A 6TIMA 5DF0A 1Q85A 3KP1A 1XSIA 4BF7A 5I3UA 1OFOA 5J2MB 4B5SA 1ELOA 4P7QA 4B3RF 1L8NA 3IG1B 4ZQPA 4O54A 1Z42A 4HHUA 2A85A 2X1UA 3VKDA 1WKKA 5BXTA 5JUVA 2Y24A 3IS9A 5CZVA 2AMCB 3QWPA 1HNZF 3GZAA 3UW6A 4Q4QA 1TMLA 2VC9A 2Y1RI 4N41A 3IJDA 3WJYA 2ZWOA 2OLWA 1FWFC 5I79A 1XLFA 1RD6A 3VDGA 1FWCC 1SXLA 2ZDOA 4GQRA 2BOAA 2PP1A 4MFBB 3B9DA 1V3JA 5CC7A 5ABHA 1CECA 2JEGA 2Y62A 2J74A 2E3ZA 3VKBA 2AP6A 3CPUA 4DBSA 5J5DA 3R2CJ 4WWSA 1H2TZ 5AHNA 1EXPA 5DQIA 1ADOA 4HTYA 3GQYA 4XG1A 4OZNA 2RGMA 1R46A 3OO2A 2Z2UA 1T8EA 2X7VA 5CA5A 1KLZA 4AHOA 4E5TA 4LRBA 5AY7A 4C6DA 1RV8A 3E01B 1GOQA 3HPZA 1H5YA 3LLXA 5EMMA 5KAKA 2KFYA 1A50A 4PRWA 4C6QA 3UCZP 4FAMA 1IWGA 2NS1B 3ARTA 3CAKA 3MVIA 3S2CA 2VPZB 3KK2A 4CLYA 2NLYA 4F0MA 2FJKA 3OPSA 2DR6A 4NZ3A 4TYBA 2I9EA 3N9SA 2E25A 4UQEA 1J2VA 2ZUWA 1WDTA 3OP2A 3QQ1A 1VS3A 4UOGA 2ON3A 1E1CB 2MQMA 2QV5A 2A7PA 5T7LB 1FKPA 5DMMA 3TCSA 1K8ZA 3PFMA 1FK9A 3I4HX 3F73A 4CLFA 3EDJA 3SUVA 3W60A 4AXIA 1Z2LA 2ZHBA 1BFNA 3A4TA 2R2RA 4F4XA 1OCBA 4ERGA 2H3BA 3LX9A 4MNKA 4B9ZA 1PYMA 4YHHJ 2FJXA 2F38A 1YPIA 5HJXA 3R5JB 3C6CA 3RCMA 1Y9OA 3M4XA 3ZMRA 1BE4A 2YXXA 4MVAA 1VFMA 3CB3A 4PRRA 2HSEB 4HOZA 2IQTA 4DQSA 3BR9A 3LHVA 3BJTA 1KWKA 4GBUA 3S7RA 4DR6F 1H7WA 3CZLA 1TV2A 1KSPA 3JUGA 4ZTXA 4K7YA 5C54A 5KG3A 3MEDA 4YHEA 4LF6J 1B0VA 1DOSA 2Y6ZA 3P49B 4ICMA 4H9MA 3BCJA 3FBBA 3BGRA 2WO5A 1A5LC 3SCIE 4W93A 3SQOP 1PHQA 4K2JA 4O4WA 4QR0A 5K14B 4ANCA 5TQLA 2PLCA 5B0CA 3R7MA 4FLSA 4KO0A 5CC6A 3URAA 4TVUA 3O63A 4HYWA 4P7RA 4QROA 4XD6A 1W3TA 2B9WA 1Q8AA 1OCQA 3IWLA 3W7GA 1D1UA 3NY0A 3UZJA 2WSEC 3RGIA 1FNXH 3G1XA 2DGXA 1R8PA 1E1CA 2E09A 3BANA 3NS7B 3KL3A 4B5UA 1E15A 3DIPA 1N55A 2Z2LA 2UWFA 3CXOA 4R0JA 1VK8A 5FD1A 3OTOF 1Q6QA 1X0FA 4MY1A 1LWHA 4DR5J 3ZJKA 2WZIA 2P9CA 3ARWA 2DDXA 3EICA 2GYIA 4GO9A 5CXPA 2F8QA 2YA1A 3BAYA 4ZO7A 3QR1A 4GKTA 3SJ3A 3A24A 3BPDA 1H1ZA 4JN7A 3W26A 5KZEA 3S6OA 3P5TL 5F8IA 3LGDA 4QR1A 3GR8A 3GXMA 2L41A 3JXOA 2E1WA 1VBGA 1KO0A 4FXWA 1SH3A 3SQMA 3KG1A 3MM7A 5KFNA 2ZE2B 3TAKA 3KZSA 4X63A 3J7Z5 1A7GE 2XLIA 3G1AA 1Q6DA 3GVWA 2VX5A 1R8CA 2GS8A 4Z1AA 3PRDA 4Q5VA 3ZZOA 3BGRB 4DX5A 1OQ6A 2QIFA 2UXBJ 1IUJA 1HL8A 3O1NA 2BB0A 4DQPA 2CFFA 4NLVA 5G0RA 4U31A 3G6YA 2CHOA 3ANVA 1TJPA 3CO8A 3NL6A 5CZSA 4ZENA 4QWBA 3UY8A 2ADCA 4WKFA 2YX7A 4HVZA 3W61A 4M95A 3DFYA 1TX2A 3ITOA 3K30A 2HNYA 2YNFB 4PUUA 3OVAA 2CLHA 4O11A 3W2UA 3DGPA 1I1GA 4LALA 4GGBA 3UWUA 1CXEA 4JI7J 4K8HA 1REGX 2HPUA 1XNQJ 2PCEA 1JCXA 2INFA 4USWA 2OELA 3SY5A 3SR7A 1ZGDA 3H98A 2KG1A 2R8KA 3ZZYA 1RUSA 3F7JA 4LVFA 1WKLA 1RHJB 1OADA 3TYBA 3M32B 2GIFA 3DFPA 7A3HA 1ME8A 1NH6A 5E93A 3ZWSA 3MO7A 2EFQA 1UKPA 3L4UA 2E4TA 4BI5A 2J0WA 1C8VA 2Q79A 4KESA 4Y9NA 3AD9C 1YDYA 3IGUA 3GIKA 2Z8QA 3VFCA 4AW7A 5FESA 4LRDA 1QPNA 2BEFA 1CYGA 1QTNB 3WLIA 3GH7A 1A80A 2GOUA 2HS8A 4JTQA 1WSVA 5HN0A 1N82A 3CHFA 1CGVA 5JBDA 3G1VA 3TA0A 5SWUA 3BDKA 4LFYA 3OLGA 4DF0A 2YA2A 2XINA 4O1FA 2Z1BA 3EXTA 3LAKA 2LLEA 1JLQA 1LK7A 1EUNA 3M6XA 1Q13A 3CV7A 4KGVB 4ED1A 2FVPA 4L72B 3TAQA 4ELUA 3UR0A 2YXGA 1J9YA 4KIEA 5HDRA 2YNFA 3IBFB 3E6EA 4JYDA 3B4YA 5DDOC 3DGPB 3DOMB 4A8QA 1Q6OA 4MY9A 4V1XA 3AALA 3TEGA 1GUVA 4HKQA 1I2NA 2C91A 2XSJA 4IG0B 4YOEA 2D74B 1Z4UA 2H48B 4I6AA 1ACMB 1NJWA 2XZ9A 3QRHA 1XQKA 3N5BA 5BXIA 3IPWA 3TTOA 2OQHA 4QLLA 4UNLA 4OWGA 1VRQC 1RHCA 1OO0B 3VD5A 3QLLA 2HBRB 2AU0A 2ROGA 2UXBF 1KGXA 4DR3F 2DH2A 5T26A 1PGZA 4A3RA 1LW2B 5A6PA 3CNYA 1WTFA 4IOTA 4WDTA 2OGUA 2NXIA 1K8XA 3UQSA 4GYPC 4Q8MA 5CJ5A 2EVZA 2UY4A 6ALDA 4JI4J 1P1LA 1HYSB 4OHZA 2AJ2A 1YPFA 2C2NA 3CPGA 3K2GA 4AZ6A 1RWXB 3M2UB 3CT7A 1TV4A 1X5TA 1UA1A 4OI3A 7FD1A 2XZWA 1RAGB 3NQVA 5GAEU 2WNNA 3H23A 1I75A 4KEZA 3HFZB 3H8AA 3DRRA 3PRVA 4EFAC 4RW6A 2DEIA 3LEPA 2QR6A 1IQ8A 4WUIA 1V08A 4DX7A 1P0DA 4ZTYA 1YHTA 4B02A 3HPSA 2ZH3A 4PTNA 4WZHA 1E3ZA 3AIBA 5B0EA 1ZZMA 1G1YA 1BWEA 2DGTA 1QPOA 2VFHA 1XW8A 3I6RA 1K6WA 3O6AA 4K5SA 4LVDA 1M0SA 3FDSA 2ZRUA 4GIYA 4DF8A 1G67A 4X2PA 1NK5A 2HFOA 2PDWA 3IN5A 2OXNA 4XKYB 3ES7A 4UTLA 1D0EA 4OZ5A 4E2DA 2MQQA 3VNZA 4H41A 3LW5C 3MWCA 1OHLA 1I2PA 1MQPA 1VIZA 3LRKA 1Q8IA 2ALRA 2BP1A 2ZX9A 1IR0A 3M64A 3PSVA 3UCCA 3LI0A 1XLCA 4L1WA 2J0SD 2RB7A 3S5ZA 1XF0A 4B9SA 2LP4A 1A49A 3KK1A 4RBUA 3M5YA 3TAOA 4I7FB 1JJ2R 1M7JA 2LEAA 4FOUA 3BXWA 3QXBA 5CLTA 1G4EA 4IKAA 4PTDA 4DV2J 5CGTA 4YMEA 1BC6A 4NE9C 3T2PA 1LJYA 2WMJA 2QUTA 1FERA 4LF5J 4H6QA 3NG8A 4CT8A 3C0SA 5D02A 2HRTA 1Q2RA 2JIWA 2ABYA 1EP1A 5HQLA 4G7EB 3C0JA 3PTWA 1T3OA 3KJVB 3A1YG 3GR0A 1S1RA 1ZY9A 2FLIA 2CZFA 4ER8A 4XISA 1S46A 1NHKL 4O13A 3ADAC 3W2MA 4OT7A 5EWGA 1ZJH