4RNHA

Pamora tandem diguanylate cyclase - phosphodiesterase, c-di-gmp complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
429
structure length
423
Chain Sequence
MAYYDALTHLPNRTLFQDRLHTALQQAERNGQWVVLMFLDLDRFLGHAAGDRMLQEVATRLSACVSQDDTVARMGGDEFTLLLPSQGDREIALKRAIQVAELILGRLARPFTLEGREFFVTASIGVALSPQDGAELSLLMKNADTAMYHAKEMGKNNFQFYQAEMNARALERLELESDLRRALELGEFVLHYQPQFTGDGRRLTGAEALLRWQHPRRGLVPPSEFIPVLEEIGLVAQVGDWLLAEACKQLRSWHKAKVRVPKVSVNLSARQFADGQLGERIAAILYETGIPPACLELELTESILMSDVAEAMQILSGLKRLGLAIAVDDFGTGYSSLNYLKQFPIDVLKIDRSFVDGLPHGEQDAQIARAIIAMAHSLNLMVIAEGVESQAQLDFLREHGCDEVQGYLFGRPMPAEQFGMLYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Formation and dimerization of the phosphodiesterase active site of the Pseudomonas aeruginosa MorA, a bi-functional c-di-GMP regulator.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase, hydrolase
molecule keywords Motility regulator
total genus 146
structure length 423
sequence length 429
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4rnhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rnhA01
3QIDA 3HV8A 3LP0A 4ED8A 2B6AA 4ZP6A 3LANA 1RT4B 1XR7A 1RTIB 1S1UA 5DLFA 1IKVB 2V4RA 3GV8B 2IA6A 3V6KA 1JKHA 1VRTB 3GG0A 5HBMB 4NLYA 2R8JA 3KOAA 5KT3A 4RNJA 1BQNA 2JC1A 4KAIA 1YVFA 3GFYA 4Y2AA 4LSNA 3V4IB 4MIBA 4I2QA 4QWBA 3M8PB 3TQ1A 3HKWA 2HMIA 2AU0A 3RBDA 3VQSA 3ITHB 5KFBA 2GIRA 3DMJA 4RW9B 3CDWA 1S1UB 4TXSA 1T94A 4U7CA 1R0AB 3TAMA 2JEIA 1JLEA 4JV0A 1C0UB 5KFXA 4IFYB 5KFZA 3T5JA 2R6OA 3ISND 4IKAA 1J5OA 1S1TB 4K50A 2IM3A 3I5AA 1HNVA 3M8PA 3JYTA 4NLUA 5C24A 4R5PA 4ZPDA 3BQ0A 3KK3B 4PWDA 4O3NA 3IGNA 3GV5B 2RDJA 1JXLA 1HARA 4MH8A 2D41A 3FQKA 1ZTTA 3N3TA 3I0SB 2BRKA 3OL8A 5HP1A 1N5YA 3BQ1A 4LSLA 5D3GB 2I1RA 4ZVHA 4HJFA 2AWZA 4ICLB 4IFVA 5CYMB 4ED2A 3PW4A 4K4ZA 4H4MA 4F3HA 4RW7A 5F8GA 4NLDA 4O44B 1C0TB 4I7FA 3DRSA 4RNFA 4NLRA 3M9OB 5KFYA 3DYAB 1TL1B 3HVTB 4WE1B 3MEGB 5DQGA 5HROB 4Y9OA 3DLGB 3D5MA 3LP2A 3PJXA 2HNZB 1MU2A 1RT7A 2W9AA 5CYMA 3PVXA 5C42B 4IQXA 3N6MA 1FKOA 1S1VB 3DOKA 1JLAA 3IRXA 5J2MA 3UDLA 2UVUA 3KLGA 2GC8A 3KNAA 1HPZB 1S1XA 1TVRB 2FJWA 2IBKA 1SUQA 5JUMA 4IRDA 4ECUA 5KG1A 4F4YA 1LW0A 4FBUA 4MK8A 4ECVA 1HQEA 4X2BA 1IKYB 4K4WA 1SV5B 4NZ0A 3FFIB 3IGVA 1HNVB 4ZPCA 1MU2B 1RT7B 3MECA 4EO8A 3V81B 4O44A 2FLNA 2OPPB 4R8UA 2HNDA 2FVPA 3SFGA 1S1WB 1VRUB 3H5UA 3IG1A 3KLEB 3HHKA 4TY8A 3CJ2A 2IM2A 3M8QB 3DYAA 3HVTA 4YQWA 2WTFA 3MEGA 3T5HA 1BQMA 4IR1A 2AGOA 3EPGA 4ECWA 3KZPA 4F48A 2R2SA 4Q6JA 5KFUA 4TQRA 3MECB 2HWHA 4F50A 5DQHA 3I0RB 5KG3A 1S0NA 4ECYA 5HBMA 3CIZA 3E01A 4XPEA 1KLMB 3C6UA 3KJVA 4ID5B 4B3OB 4KE5A 3TAMB 2YNIB 2YNFA 4RW6B 5C25B 3PJUA 1RTHA 4Y2CA 2WRMA 5KFNA 4IDKA 1JLQB 2RF2B 3KMSA 1ZETA 2IC3B 1OS5A 1T03B 4URQU 5DGAA 1NHVA 5DGBA 4KKOB 1HQUB 4EBEA 4K4XA 3KLFA 2CKWA 1C1BB 4DG1A 3MR2A 3MFHA 3KJVB 1T3NA 2ATLA 4PQUA 2ASDA 2R8GA 4HKQA 4KHRA 1IKXB 4LYKA 4K4YA 1SH3A 1JLCA 3DI6A 1S48A 3LP0B 4O4RA 2ASLA 4EO6A 2YNHA 1RTJA 4NRTA 3T19A 4J9RA 4HU4A 2FLLA 1LW2A 1JKHB 1C1BA 1NHUA 1VRTA 5EWGA 4ZP9A 4RNNA 1S0MA 3GIJA 1EP4B 1S6QB 4DL3A 1RTDB 4K4SA 5KFLA 2BE2A 5F9NA 5C24B 4I2QB 4R5PB 4Q43A 2RF2A 2ZD1A 1HYSB 4G1QB 4H4OA 4ED0A 1FKOB 3Q8PB 4JV1A 4WFZA 1S6PB 1HMVA 4NRUA 5KFRA 4J40A 5JXSA 3KK2A 3G6YA 4B3OA 3CJ3A 2ALZA 2D3UA 2OPSB 3MTKA 5L1KA 1TP7A 1LWCB 1HNIB 1TKXA 4PUOB 5L1JA 2FVQA 3DLKA 3FRZA 2WOMA 3GIIA 4DL7A 5KG2A 2E9ZA 5KFKA 4QWAA 1HYSA 1S4FA 4IG3A 5K14B 4MFBB 3DLEA 5C5JA 3GFXA 3RAXA 2AQ4A 5J2NB 4KFBA 4ID5A 5DQIA 3M9MB 5J1EA 4LSLB 3MR3A 4DEZA 2JEFA 4XO0A 3M9NB 4MKBA 2VG6A 4FOUA 4ED1A 3H5XA 2IAJA 3T5KA 2JC0A 5KFDA 1D1UA 2UVWA 1FKPA 3KMQA 1RT6B 4Q45A 4R8UB 4NLQA 4ZVGA 3RAQA 1S1XB 4H4MB 4F4WA 5KFAA 1GX5A 2CJQA 3RB3A 1S9GA 3BSOA 1JLFB 2AGPA 4MKAA 3KLHA 3QLHA 4R0EA 2W8LA 2BQRA 2XCAA 3ISNC 5J1EB 2AX0A 4EYIB 3LP1B 4TY9A 2UVVA 4QW8A 1W25A 1S9EB 2XI3A 1DLOA 1REVA 2OPPA 2V0NA 2W9CB 4ICLA 1DTQB 5DG7A 3ITHA 5KG6A 3JYTB 5I3UA 3BQ2A 3N6NA 2IJNA 3QGIA 5C42A 4F4ZA 3RB6A 5L1IA 1QUVA 4ED6A 5MKGB 5KG5A 4J9QA 3EZUA 3I5CA 4IH7A 4ED7A 1TKZB 2VG7B 3NBPB 5HROA 4I2PB 3G6VA 4G3IA 5KG0A 2R8IA 3QO9A 3V6HA 2FVRA 4G1QA 4H4OB 3KHHA 4ZVFA 4MFBA 3LAMA 3NKYA 2C22A 4JV2A 3OL6A 1TKTA 3PFMA 5KFVA 1TL1A 1QE1A 4WE1A 3Q8RB 1HNIA 3OLBA 1RT1B 2WONB 5KT6A 2J6SA 4PQUB 1S49A 4ECSA 1JIHA 5KFTA 2W7PA 4IG0B 2E9TA 2XWYA 2R2TA 2RDIA 2V9WA 1JLCB 3DI6B 4NYZA 2BANB 1WNEA 3QGGA 4YR2A 2O5DA 3DM2A 5KFGA 4F4XA 4LJ3A 2XCPA 1DTTB 1TL3B 4XPCA 4RNOA 4OL8A 4RNMA 3BR9A 4FOKA 4QW9A 1JLEB 4RW6A 4Y9MA 4NLOA 1U09A 1RT3B 5F8IA 2ZKUA 2WCXA 1IKWA 1TQLA 2HAIA 4ZHRB 3OHBA 3V6DB 2IC3A 4RNIA 4J9NA 1T03A 2DPJA 2FLPA 1JLQA 1RTIA 1JLFA 2F8EX 2B5JB 1RT2B 3NGDA 1I6JA 3MR6A 1R0AA 1BQNB 3LP1A 1JLGA 5F8NA 4IRKA 3OSPA 2VG5A 1JLBB 2W8KA 3H4DA 2BR0A 1VRUA 3IG1B 4Y34A 3QIPB 3OLAA 3KLGB 4J9PA 4IR9A 2RKIB 4RW4A 2IM1A 4TYAA 4MK7A 4TYBA 3H98A 4O3OA 5DLGA 5HP1B 3DRRA 4PUOA 2VA3A 3GIKA 3PJTA 1LWEB 1S6QA 3MEEA 3T5LA 5EWEA 4NLPA 3LALA 3FSIA 3IS9B 1C2PA 5KG7A 4PWDB 3FQLA 1JLAB 3IRXB 1S6PA 5J2PA 3FDSA 4TQSA 1RAJA 1Z4UA 4I7FB 5KFHA 4URSA 2BQUA 3BSAA 4WFXA 1FK9B 4NLVA 4TN2A 3MEDB 1LWFB 4ECTA 1LW0B 2UVRA 3GV7B 4ECZA 1JLBA 2WOMB 4M94A 4MIAA 3ICLA 3KLIA 3GQCA 2E9RX 2OPRA 1XR6A 2HMIB 2QE5A 4RZRA 3IN5A 4IG3B 5K14A 4AFYA 4O4GA 5KFSA 3HV9A 2YKMA 1SH2A 1TV6A 2VG5B 1IKWB 4DL5A 4KB7A 2JLEA 4WYWA 2IM0A 4ZVEA 3CDEA 2XGQA 1KHWA 2C2DA 3CVKA 4ED3A 3UR0A 1S9FA 4LQ9A 5FDLA 4DL4A 1N48A 1S0OA 3DOLB 4KO0B 4RW9A 2AGQA 4FS2A 3S83A 1RA7A 2HNYB 3I0RA 3KHLA 1JLGB 3DM2B 5KFPA 3H4BA 3PW2A 3SY8A 3BGRA 3H5SA 3I0SA 4QWEA 4J9LA 4DG1B 2OPSA 3HVWA 3RB0A 4K4TA 2AX1A 4K4UA 4WZMA 5MF5A 4RUAA 2OH2A 2ZE2A 1T05B 1EETB 2EC0A 4HU3A 3EPIA 3G86A 1C0TA 4NLWA 3KHGA 4YMEA 5EDWA 2B5JA 5I42B 2W9BA 3SI8A 4HYKA 1C0UA 2VA2A 4KV8B 5KFIA 5HLFB 4FS1A 4KHMA 3GYNA 3QO9B 4ZHRA 3V6DA 4I2PA 1RYRA 5KG4A 3RBEA 2YKNA 5T14A 1UWBB 3PR4A 4QWCA 3JSMB 2B6AB 3OSNA 5DG9A 4KFBB 3SFUA 4Q44A 2ILZA 5EWFA 2J6UA 1TVRA 3H40A 2C2RA 3NAHA 5MKGA 3KLHB 2W7OA 1C1CA 3BJYA 4J9MA 4NLGA 4NCGB 4RW8A 5C25A 3TVKA 4IG0A 2JEGA 1XR5A 1LWCA 4GC6A 2OPRB 3GG1A 1LWEA 3MEEB 2BRLA 5KFEA 2BASA 2D7SA 3OHAA 2HNDB 4IOBA 4LQ3A 2DPIA 4IH5A 3UQSA 4EEYA 3Q8QB 4O3RA 2YKMB 1RT5A 5J2NA 5F8JA 3TLQA 2YNGA 5KFQA 4IFVB 2VG6B 5I3UB 3DLKB 1SH0A 3DRPA 3Q8SB 4WFYA 2RKIA 4RW4B 5L1LA 4IH6A 3CJ4A 4ES4A 1NNDA 5F9LA 5KT2A 3BGRB 4WXOA 3MEDA 4Y3CA 5J2QA 2OPQA 2GIQA 3QLHB 1S97A 4NLXA 5CYQB 2W27A 4J9OA 4FBTA 5F8HA 4KSEB 4O3QA 3GIMA 4J9KA 4ECXA 4M95A 1S9EA 2WHOA 1GX6A 1K1SA 1RT6A 3C6TB 3KLEA 4RW7B 4NLSA 3DLEB 1HMVB 4KKOA 2D3ZA 1TL3A 3DRSB 3QYYA 4QPXA 3H5YA 2FJVA 3RB4A 2OPQB 1S1TA 2ILYA 4Q0BB 1TKXB 1N4LA 1RTHB 3H2LA 2IAJB 1IKXA 3JSMA 5F8LA 1K1QA 4K4VA 1IM4A 4RUCA 3H59A 1DTTA 3PZPA 3PHEA 5J2QB 2R2UA 1TKTB 3T1AA 1KHVA 1FK9A 4QWDA 3OL7A 3CO9A 4URGA 1EP4A 4NLTA 4EBCA 4LSNB 1RTDA 3KLVA 4DL2A 4RU9A 3CJ0A 1J5OB 3DRPB 1MMLA 1EETA 3DOLA 4KO0A 1ZTWA 2UUWA 3BSCA 1RYSA 4Y9NA 3KK1B 1UWBA 3PW5A 2C2EA 3KK3A 3GILA 3QGHA 1KLMA 3KLFB 2W9BB 2YNGB 5I42A 1LW2B 4IRCA 4YP3A 1TV6B 4YR0A 1QE1B 5D3GA 1C1CB 4FOJA 3PW0A 3QZ7A 2C28A 4U6PA 3PW7A 1N5YB 2FVCA 2W9CA 1RT3A 2YKNB 4DL6A 2ASJA 1N56A 2R8KA 1RTJB 5KFMA 5HLFA 2HNYA 1TKZA 2VG7A 1RT2A 3NBPA 4TLRA 4Q8FA 4IFYA 2HNZA 3KHRA 2YNFB 2YNIA 3V81A 2BQ3A 1QAIA 2HWIA 4WYLA 5M1TA 2XGPA 5L9XA 3DMJB 3GFZA 2WB4A 3HVAA 4H54A 4ZPAA 4WZQA 3M8QA 5FDLB 5KT4A 1RT4A 1S9GB 5KT5A 2WK4A 4EYHB 4KV8A 1HQUA 4O4GB 3U2EA 3C6UB 4Q0BA 3OL9A 5F8MA 3CWJA 3PR5B 4JUZA 3FFIA 3V4IA 4IDKB 3KLIB 1IKYA 2V4QA 4GC7A 3V6JA 1N6QB 3N6LA 3LP2B 3NMAA 5KFCA 2ZE2B 1T05A 5KFJA 4O3SA 3QIPA 2R8HA 4EBDA 5KT7A 3QZ8A 3C6TA 2I5JA 3E01B 1S1WA 4MK9A 1HPZA 4WXWA 1BQMB 1QAJA 5KFOA 4YR3A 3NAIA 2IMWP 3E51A 2FVSA 1HQEB 3D28A 1DLOB 1REVB 3DLGA 4J9SA 3G6XA 2BE2B 1CSJA 3BSNA 4KIEA 5KFFA 5J2PB 5EUHA 3PJWA 2XI2A 3MFIA 3CDUA 4ZP8A 2QV6A 3BREA 4TY8B 4ZPBA 5CYQA 3MR5A 5KFWA 2J6TA 4RNHA 1LWFA 4ECQA 1RDRA 3KK2B 3DRRB 2IJFA 2JEJA 2FJXA 4Q8EA 3UPFA 1FKPB 2B43A 1N6QA 3DDKA 1SV5A 1S1VA 3DOKB 4ZMMA 4AG0A 1DTQA 5J2MB 2ZD1B 3IS9A 2BANA 1JX4A 1RA6A 3MF5A 2I5JB 2YNHB 4Y9PA 2XC9A 1IKVA 1SUQB 4O3PA 2R2RA 4ECRA 4ZP7A 3KK1A 1S10A 3NL0A 3I5BA 1RT1A 2UUTA 1RT5B 2WONA 4NCGA 1D0EA 3CJ5A 4RW8B 5DG8A 4Y8EA 4KBIA 3LAKA
chains in the Genus database with same CATH superfamily
1FDYA 1GMWA 4F25A 1S1UA 2VJUA 3W29A 2WNZA 1VRTB 2VBYA 2JC1A 3GFYA 4RBUA 3PZVA 1XGEA 4B9ZA 2QT7A 1HJQA 1DORA 3BSHA 3TO8A 2HMIA 3DGVA 2C79A 4LAUA 2A10A 3S2JA 1N5QA 3W7KA 4KH0B 2DGQA 1JLEA 3H2EA 4F2BA 1YHTA 1CS4B 4YS2A 3VFLA 1RLDA 2GVJA 5JBDA 1B3WA 4A8LA 5EX3A 1FF2A 3BV7A 2OJPA 4L4MA 4AHPA 1Z41A 3NO3A 4LF7J 1FDJA 4GQRA 5AC5A 4NILA 3N13A 1DIDA 4RW7A 3N25A 4XVEA 2LP4A 4OHXA 4NJJA 3OYZA 4HNCA 1FCBA 1U24A 2GVDB 3R8HA 2W4DA 4HZ8A 3A8JA 1S5NA 1CJVA 4NNBA 1BYCA 4JI0F 3GTYX 2YWKA 3V36A 2YLLA 3T0BA 3ADAC 3F44A 4G1PA 4KGVB 3PVXA 1TK0A 1NDYA 2YH0A 5FEPA 2YX1A 3KLGA 1VIXA 1KWGA 1NBEB 2PE8A 5EGYA 5U7SA 4LUTB 1O94A 2G1DA 1H11A 3TQPA 1QOXA 2VF3A 3AZTA 3UERA 2PWFA 2DY3A 5CSSA 2Y1HA 3E02A 1OJXA 5KZDA 2AEJA 2W7AA 2FVPA 5FI8A 1V03A 4X61A 4E6MA 3HVTA 1DXFA 4A3HA 2B4OA 5BU6A 2KTQA 3UN3A 2OR2A 3GNNA 3S6TA 3MPVA 2PEBA 3URBA 1EIBA 3FYPA 1VH7A 4ZOEA 2PBOA 5BXRA 5A8WA 3W6MA 3QRQA 3KJVA 1OFDA 2YKKA 2BV3A 4OI3A 2XU2A 3RX2A 5AXNA 3KCLA 2MKIA 1CQMA 3V16A 3IBCB 1RA5A 2IC3B 4ZOCA 2XWXA 2F4VJ 4LC8A 1HQUB 1DARA 1MQRA 4YCPA 1JL8A 4B9VA 1BUXA 3P8JA 3PBGA 1CC7A 4Z2IA 3SQMA 3W7OA 1GKQA 1BAGA 2PWUA 3NOGA 1SH3A 2BKNA 1OSEA 1HL9A 4IPLA 2G95A 4PCSA 5E3AA 4LFBF 1RQBA 1CJKB 1J96A 2VQUA 2NQHA 3WF4A 4S3EA 5AY7A 2DO0A 3AXIA 1M5VC 4K4SA 5I07A 4LFAJ 4TTUA 1ZRQA 5IXUA 3T1HF 4H4OA 1YJWS 1S6PB 4WDWA 3G6YA 3CUZA 8AT1B 2C1IA 1RJJA 4PH6A 2D3UA 4N9CA 1D8CA 3SIMA 1UR0A 2PAJA 1RJPA 3UDCA 2O66A 1PC5A 5K14B 2J9YA 4IX0A 3DGBA 2AQ4A 3GDKA 2A6OA 2YCIX 3ARZA 3AHTA 5EA9A 4EPDC 1FXRA 3MMAA 5G1YA 4LW7A 1ZPVA 1HWIA 2NQJA 3LB0A 1Y7PA 3M43A 2PLKA 3Q8VA 2DRAA 1UP0A 2Y4SA 4UOZA 2WZ1A 5SWUA 1TX0A 2H65B 2I2YA 5E2QA 2VOMA 2WXDM 2MKCA 5D0RA 1Y11A 3CNYA 4QJ1A 3OODA 1DLOA 4H3DA 3PUEA 5KG6A 1OQFA 4UOHA 4AWTA 4E8GA 4UMBA 1NAQA 4LF7F 1IXOA 1OEPA 3GG8A 3V1HA 1V9OA 3N12A 4G3IA 3NQ2A 1FERA 3V6HA 1ZP4A 2YPYA 3HT0A 4HNVA 4XSMA 2VBZA 3QV8A 5KT6A 2ATCB 3ZYZA 1DIKA 4N41A 1MUWA 1VB9A 2NCKL 3LXCA 6FDRA 1RKJA 1S5MA 2AJFE 1DTTB 3BMVA 2BODX 4HHHA 5A8PA 3A8IA 2ALDA 4ZOAA 1WAUA 2E9BA 3BOXA 2D69A 3PB2A 3EGVA 3OHBA 2E9MA 4J9NA 3QPZA 1CEZA 4OQJA 1E6RA 4OECA 2MSSA 3CGIA 4GJJA 3C2EA 4QG9A 1R0AA 3K2YA 3TCSA 1J6PA 3PF3A 1M7JA 3OLAA 2TPSA 1XYAA 3EKGA 2RKIB 3CPRA 2F8MA 3MB9A 2OZ0A 3LGNA 4D6IA 4FXRA 3N9UC 3BN4A 1MRQA 4DPQA 1BYBA 2RDWA 4I0WA 5J5DA 3RM4A 2WHMA 3EGJA 3LHUA 2MQ8A 1LWFB 3GTIA 2GV1A 2Y24A 2WCAA 4JR5A 3DX5A 5J1NA 2DZUA 2GVZB 3PRBA 4R33A 5LKYA 6XIAA 1HFBA 2HVHA 2QE5A 4N9EA 2OIHA 5K14A 4Q4KA 1WC4A 5A1AA 3W64A 3KVLA 4UB9A 2K1RA 2VG5B 1CCWB 4FIQA 1RK5A 3WLRA 5CPLA 3S8HA 2QMXA 2G4BA 2F2KA 1E6VB 3W73A 3CVKA 3GFHA 4RL1A 4MPKA 1EBGA 2HHPA 1PB0A 4X2PA 1R3SA 3I0RA 3W62A 3ZSSA 1F2GA 1RH9A 1IV8A 3G1FA 1TWDA 4GUHA 2YDQA 1DURA 4K4UA 4B3SJ 1UTAA 1T05B 3PZNA 3QV7A 4NXMJ 1JNEA 2KT5A 3APYA 3ES7A 1A47A 3IR6B 4CDIA 2W9BA 3SI8A 4AX7A 2O9RA 4ZHRA 1LYXA 4Z2HA 4I2PA 4L74A 7PTDA 1E15A 5A6SA 1G5AA 4AZCA 4JN6A 3H70A 2IA0A 4JD4A 2IVMA 3VC6A 3MOJB 1QI0A 3UWEA 2CLOA 2H3DA 2PGEA 1KFLA 2F8QA 2A2DA 5A6WA 3GG7A 3W2WA 2HRTA 4ZA1A 3PZGA 1YRTA 4B3KA 1VC4A 3OQ2A 1KQZA 3AHZA 3EOLA 1FWTA 4ECLA 4R9OA 5C7PA 5KFQA 3LS9A 4Q7IA 4ZFCA 1NK8A 3CDBA 1A0CA 1MSSA 3N4FA 1LP6A 2HXUA 2PDGA 2QCMA 3R0UA 4IM4A 4ZSUA 4KGKA 2PLCA 1W9BM 3KUEA 3QLHB 4NCAA 4NLXA 3OVBA 4J9KA 3LPGA 1S9EA 2WHOA 3GNXA 2X1UA 1GFWB 3ONBA 2ZX6A 1KCKA 2NX3A 4ZMGA 2NQLA 1EJVC 4C8LA 3RJMB 3TYBA 1UPMB 3UNDA 3SQGA 4Y0FA 3OUYA 1TV3A 1UOKA 4N42A 5B0AA 1DTTA 4P8UA 1JGMA 1DFDA 3T1AA 7CGTA 3VIIA 4RBTA 3AD9C 2YX7A 4ZA0A 4BWJA 2XFFA 3L95X 1QAYA 1F3FA 3T1YF 3BJFA 4FKXA 4YR0A 1O1HA 3O1LA 1B0PA 3VWSA 4O0KA 5ECVA 1QJWA 3GHTA 2ASJA 4F79A 1N56A 4EAMA 1TIMA 4LF8F 3BSMA 2IXVA 2NXIA 5HLFA 3DXIA 1NARA 3DC8A 1T95A 3L2LA 4IFYA 1QPQA 3W1UA 1SO5A 4D6GA 2GQ9A 1YDYA 2HWIA 3GC5A 5HNTA 5KOXA 3ZJKA 2PP1A 2FZCB 4EVZA 4AUKA 4ZLNA 4KPYA 5LIXX 4O4GB 3RRGA 4DV7F 1JCXA 5DT5A 1RAGB 2DIUA 4FF3A 4W86A 1IKYA 4CNTA 2F9JA 4E4FA 2XQCA 1T05A 2Q09A 3ARTA 5DFAA 4LF9F 5L46A 3QZ8A 3P6LA 1XYFA 1RCQA 2LA6A 2UV8A 4B3SF 3GR4A 4US6A 3TIMA 4LCSA 2BE2B 4M6PA 2FHBA 5CYJA 3NEVA 1POJA 2D0HA 1S5ZA 4KIEA 5CH9A 2CEQA 2YSWA 4MLJA 2H8XA 2DR6A 3U2OA 1HVQA 1E5NA 4CCDA 4GZIA 5CJ5A 3IGSA 4AG0A 1W3IA 1TPWA 4AQLA 1B99A 1SPBP 3IS9A 4JL2A 4FF1A 3W84A 1RWXB 5C55A 1O1ZA 3CPGA 4WCEQ 1IBLF 3Q89A 4OLPA 2OO0A 3GXTA 4KWWA 1AUSL 4DPWA 1JZ5A 1QASA 1BVWA 3L67A 1VLWA 1AUDA 1S0VA 3F1QA 1XIQA 3IO1A 3CCRS 1VQLS 5CJMA 2W4PA 2F6UA 2QKFA 3O06A 1P6TA 3TQ1A 4JI3J 4HCHA 5K9XA 3THQA 5KFBA 4GACA 1IR1A 1XSKA 2CBIA 4IXXA 3AB2B 4RE4A 3TAMA 2P50A 5FKYA 3NQ8A 4LQ1A 4Y2WA 3S46A 4C5YA 6ENLA 3C2PA 1OJ4A 5JIWA 3BC9A 3BQ0A 5G4EA 3R2DJ 2GUUA 3GVQA 1LDCA 3P3DA 1J0IA 2WB5A 1N5YA 2BOGX 2OOGA 5CZKA 1G94A 4JFVA 3ARRA 3CQKA 4H4MA 4DELA 1H2JA 4TLQA 4Q5VA 1F9FA 2K7KA 2PZ0A 3WJSA 1KWKA 1FWKA 4LCRA 1LV5A 2VEKA 2C19A 3BG5A 2R7QA 3JQJA 5IM51 3AWOA 3T9PA 5T9BG 3ISZA 1EDQA 3JTNA 3B54A 3KE0A 4WXYA 2O3DA 2AJ2A 4A35A 2GC8A 5AHMA 1HP5A 2GVDA 2DZTA 5CEWA 2CYYA 4HOZA 1KDNA 4XO7A 4NA3A 3BCJA 5L39A 4WKHA 3NGJA 3MECA 1PS9A 3A8EA 5FF7A 2Y0BB 1CGUA 5F2IA 2QPUA 4DO5A 3IEBA 1S1WB 1V3ZA 1XJWB 3K57A 4TY8A 3HGOA 6TAAA 2VX6A 1VQ7S 4URIA 4AY8A 2XG9A 4H83A 1OG0A 2MUCA 4HNTA 2XVPA 3SADA 4F48A 5DBUA 3SR7A 2IQTA 3DOMB 3IP0A 4QBUA 1A49A 4HN4A 2UU9F 3PEJA 2ZCGA 1V3KA 4ECYA 5AYIA 2HS0A 1GVRA 3OR2A 2BXYA 2QLXA 3S2MA 2HHWA 5CZ0A 1UROA 3PJUA 4L9YA 4K7QA 3VAIA 4X3ZA 2E9LA 1Z8AA 3QSIA 1EYEA 4C60A 1KGWA 5A6MA 1NHVA 2KVIA 3RITA 4NOHA 3L12A 3KLFA 1T9WA 3ARQA 4QTGA 2R7VA 2ZZMA 1IKXB 4GQBA 4O8AA 1X7VA 2HSAA 3SUSA 1OABA 3NAVA 2WANA 1L6GA 1SL0A 2Z57B 2JL9A 4NRTA 5CGTA 1H6KX 1I75A 1JXJA 3TONA 3WDQA 1W3KA 2IBOA 3ZWTA 2ZD1A 3SBMA 4IMDA 4GJIA 3RJYA 4I56A 1ICQA 5CGQA 2QLBB 2MQMA 3PKMA 1ISYA 5FSDC 2HVNA 1S2WA 2J8TA 2QLWA 1B31A 2FVQA 1IXNA 3M5ZA 4ILLA 5KOWA 3QGAC 4ZL1A 5KG2A 5MLCV 4IG3A 2DB1A 1TMHA 4N4PA 2DYAA 2XVLA 4X4NA 1NH7A 1EJUC 1V6VA 1U30A 1LWIA 3I6EA 4XG1A 4PUWA 4C6KA 3BL3A 4AC7C 1S1XB 4F4WA 1GX5A 3C2YA 2XO7A 4I68A 4R0EA 3WK2A 3DDNA 2XWDA 3DU6A 4CN6A 4JXCA 1PCAA 2AX0A 1UHVA 5IFMA 1CWYA 2Z4GA 2GOKA 3ITHA 2NSBA 2JH3A 3UESA 5L1IA 1YTKA 4KGMA 2DGUA 3G1SA 4W88A 2G2ZA 4IH7A 2XM3A 5AZ1A 1UIPA 4J3WA 2VFFA 3CK5A 5HNNA 3APGA 3VGDA 3AB4B 5F3TA 2GGGA 3MR7A 2BJEA 1IEXA 3DKDA 4GIYA 4D6JA 1LOSA 3IJLA 5A6LA 1ZENA 2GMHA 1PAMA 4QDPA 1LEOA 4A8XA 2NV1A 2X7VA 4ECSA 3TYCA 5A0YB 2FIQA 3NWRA 1FD2A 1N8RT 1R27B 1IF2A 4J3TA 1QBAA 1RPXA 1U1RA 1KQGB 4M6QA 1NKEA 3EWUA 1VPXA 2J7DA 4WR3A 2WBMA 4J3VA 1RBOB 4ZHRB 1QDSA 2A4AA 4RPQA 4QJ4B 3AWNA 2EFQA 3WMCA 1U5VA 2BHUA 3HGJA 1K47A 2B5JB 2F5GA 3M32B 4DPYA 4DDFA 1I94F 3NGDA 2V2QA 5D9NA 4IRKA 2W8KA 2HFOA 4QJ3B 2IPWA 2GA7A 3QMQA 1IWPA 1RWWB 4KCTA 4JTFA 3WD2A 1VRUA 4XD5A 2VQTA 3HSJA 4MVAA 3KLGB 1O60A 2JWNA 4E2DA 4JN7A 3UGRA 4IUGA 4WFBQ 3PBMA 1WDTA 4KFOA 3DRRA 2R8WA 3G82A 3GIKA 2ZA3A 3FHAA 3UG4A 1C2PA 3BLDA 3WN6A 3IRXB 1HNZF 2BUNA 1VRXA 2POZA 2ZWOA 2W66A 4NI2B 3TN6A 3QTGA 4IH3A 3TTQA 1M0SA 2J7UA 2P6SA 2GFTA 3SCPA 2QX0A 3VAMA 1JZ4A 1XG3A 2YQ1A 1HBMB 2DJLA 3EA2A 3SFKA 1PUDA 1VCVA 3ERPA 3OQEA 4UTWA 3W26A 3GP9A 4O0IA 2E9RX 3VI2A 2NR0A 4O4GA 2F6KA 4B17A 2GQAA 1ONWA 1IT7A 3RRAA 4DQIA 3DI1A 2JLEA 3CDEA 4LF6J 2YR1A 2XLJA 4UTGA 5FDLA 4HR2A 2LQ5A 2CNNB 4FS2A 1EQMA 3UXLA 2I6WA 2XZ7A 1QAXA 2F2HA 1F2HA 3JSYA 4MNLA 3LWLA 1QI2A 5GADI 3PM6A 4B3MJ 2EC0A 3FZBA 1IM6A 1VC0A 2KU7A 3PBVA 5HO4A 3CC7S 3S5ZA 3HHEA 4JOUA 4IO9Q 1HKJA 1NPRA 1XQLA 1AROP 2B6AB 4GNJA 4C8ZA 2OODA 5HN0A 1KM1A 2GIFA 3PR2A 2DH3A 1DQ8A 1V93A 1Q6RA 1GG0A 2YYUA 4UTIA 4HSHA 2D7SA 2VVSA 1UUOA 5JMUA 2EKYA 3W5XA 1QVBA 1AXQA 4JI8F 5D32A 3MM9A 4TX6A 3BDEA 4RE2A 1TMLA 4IUOA 4OI4A 3KJFB 4XIAA 2QIWA 2B7CB 5C9WA 4V1YA 4GZJA 2VRKA 3XIMA 4RW4B 4F9DA 4IH6A 5KMYA 1WD6A 3GDMA 4DBSA 1B1YA 2GWGA 4IPNB 3AA8A 2AV5A 3V4MA 4FBTA 5F8HA 4B9NA 3EDJA 5C71A 4XBJA 3UWUA 1KR1A 1BPLB 3KLEA 3TC3A 2J9CA 3SDOA 3EXRA 3BWWA 1ELSA 2YKAA 2OPQB 4EF9A 1UMLA 3S47A 2WW4A 2CQBA 3VA8A 3C15A 4YVVA 5A95A 5I09A 1K1QA 4PCPA 3WH8A 2YCEA 5LNSA 1Y5LB 4NZ4A 1VS1A 4U8YA 4V19X 3KBJA 4M82A 2FGLA 1XLKA 4KY3A 4O28A 1TFVA 3DFHA 2DNRA 4PMVA 3V75A 5D2WA 1ZBVA 3GYXB 2Z1XA 4FNTA 3DOLA 5G1MA 4JYAJ 2KZHA 1UWBA 1CGXA 1XGZA 1KS2A 2X09A 1C1CB 1IHIA 3R1ZA 2FVCA 2QFJA 3QY7A 4Y6IA 5CZVA 2ZADA 3THCA 2O9OA 4CO5A 1YNYA 2B31A 2BE7D 3L0GA 2X16A 3NO1A 1TZ9A 5A6TC 3HFTA 4CCCA 1QVFR 4QITA 1RBLA 5H1SV 1FCQA 3NBPA 4ETXA 1QI5A 1FXDA 2C6QA 1S2TA 3KOXA 3ME3A 3VGSA 1IZJA 1HL6A 3VZYA 4Z37A 1RP9A 2HLTA 5ETNA 4X84A 1W5NA 3SEOA 1RT4A 4KFPA 3VALA 2WOQA 2ACUA 2ZRVA 1N0UA 4M5LA 4IHCA 4HA3A 2O4QA 3ELHA 1W2BR 3LGEA 1VFLA 3N6LA 3RDKA 2DVUA 4GHRA 2OFHX 3MMJA 3Q58A 3SUVA 3MTWA 1VHFA 1JF5A 2CHRA 2LU1A 2IMWP 2J88A 2OKTA 4GY7A 2I9UA 1XWLA 4PUMA 4ZVTB 1EC8A 1O7AA 1WZKA 3G6XA 3Q2DA 3A23A 3CO4A 3BUVA 4GYFA 5MHBA 1PIEA 3CDUA 1XF0A 3TN5A 3OO2A 4MJZA 3ABSA 3KK2B 1JDFA 1JYWA 3VD3A 1UKUA 2PSZA 2W4CA 2KDOA 2CQ0A 2O55A 1S1VA 2ISFA 1CJTB 4Z2LA 5CBJA 4XD4A 4O3PA 4PUEA 1EKRA 4YY3J 1H49A 7FDRA 1KFEA 3IACA 3CXOA 1PO9A 2OKOA 4KBIA 1OK4A 3G9CA 3LP0A 4DLEA 1W31A 2KJVA 3B06A 3BPWA 1DBTA 4KIRA 3WLIA 3GG0A 4KAIA 3EDFA 4DLMA 4MIBA 3FYOA 3CH0A 3AY0A 3MCSA 1RP8A 3E5BA 4UFLA 2AKZA 3TJIA 2MZ1A 3BB5A 1J2BA 3W82A 3VNLA 2QL5B 3VQSA 1YTEA 4BBYA 4IFKA 3RO8A 4LYQA 1H63A 3QV9A 3WUGA 1R8PA 1TO3A 3C2FA 3M4XA 4MPQA 2FC8A 1D9EA 1I1XA 1R9XA 3FA5A 4IKAA 4IQEA 2JF6A 1S1TB 1GAOA 1RQ0A 3KK3B 3D3BJ 4F0KA 3IGNA 3LHWA 2RFGA 4B3TJ 4FSAA 2OEKA 3BYPA 3AUJA 4BCAA 4K4ZA 1YNQA 2NSXA 1EC7A 1VBHA 3J81U 3MHGA 4HHMA 4YTQA 2F61A 3SGGA 2IIHA 1K1DA 3TK7A 2DH7A 4B9TA 2VR5A 4Y9OA 3PRDA 3GY1A 1R2TA 2Q3PA 3HZEA 5ETSA 2J78A 3N6MA 2FJEB 1JLAA 1X5OA 2QZRA 1Y5WA 2OMLA 1TJPA 1RV8A 3UQNA 3RU6A 4F4YA 3CL8A 4KEUA 2REQB 4MKSA 6FD1A 1FVSA 5BXPA 1IKYB 3KG1A 3VF0B 2HNDA 1EXBA 3G0SA 5E0CA 3USBA 4AZGA 4A3YA 1GOMA 2OSXA 2ONEA 1V0KA 4Q6JA 1ZBWA 4TQRA 3MECB 2WB1D 2DXDA 5A6JA 5B7YA 2FVKA 1NSQA 3KM8A 2DIVA 3S6EA 5HBMA 1ZZNA 3E01A 3VOJA 1E71M 4KE5A 2Z2UA 1WUUA 4RW6B 1XXXA 4IDKA 4TNOA 1VEMA 4FX8A 1R47A 1Q6FA 2L5HA 2RDDA 3PUOA 3MSYA 4FNQA 2CKWA 4CT8A 4DG1A 4EK2A 5HUOA 1FE0A 4NYOA 4PQUA 2V63A 5AT1B 3VZZA 4G8TA 3MUVP 3CH9A 5AB3A 4I9JA 1AMKA 3P84A 4DWSA 1C29A 2YNHA 2YX4A 1LW2A 1VRTA 4RNNA 2PCQA 3MWAA 1E51A 1DPMA 2VH7A 1XD0A 3EPNA 3UD6A 3SCVA 5K8PA 4JHZA 3E1F1 4M29A 3MYOA 2V2ZA 3QC3A 3D1HA 3SCQA 2GW8A 3WKZA 3BMXA 2Z2BA 2CQ1A 2ALZA 2Y6ZA 2ZICA 2VC7A 1QW7A 1Q6OA 2OLWA 3N79A 1UPPA 4P52A 4DV5F 2ZA1A 2ZM6J 2EPOA 4YHHJ 3V5RA 5AJ3F 3GFXA 3TR9A 1QXLA 2EPMX 4Z2JA 1H61A 3O7UA 5FJJA 1TUVA 5AVNA 5HJYA 2YXOA 2VC6A 2IVYA 2C0HA 3EMTA 4R8UB 4OHYA 1SFSA 3IUDA 1ZNNA 3W1NA 1LRTA 4G1NA 1YK9A 3BO3A 2WMGA 4EYIB 4JI5J 4IISA 5SZTA 4L6HA 2W2NP 5F4SA 4C1NB 4ICLA 2GO9A 5K8NA 3JYTB 3BQ2A 5I3UA 1UA7A 2RQKA 4ED6A 5HOSA 3WHIA 2Y0SD 1QAPA 3I5CA 5FOOA 2P8IA 2WZTA 4P2XA 3UYCA 3KUHA 3G6VA 2HEJA 4NSBA 1S7HA 3VOIA 1TTJA 3P6YC 4J5NA 3TX9A 3TOPA 2PFFB 4ZE5A 2HVZA 3E3HA 3PNUA 4ZQMA 2AAAA 4A8KA 3USZA 1NDWA 1SJAA 2JIWA 2QL7B 3B97A 2QUNA 2NV9A 2J6SA 2AGKA 1Q4NX 1DJ0A 3Q65A 2PF0A 4RDZA 2ZBRA 4F4XA 1SW0A 2CLIA 1TL3B 4O1FA 4RNOA 4QYZK 4ZZ9A 5ABFB 3PY8A 2ZDSA 1W9UA 2XIBA 2DCUB 5F8IA 2DNYA 3EMCA 5C7VA 2HAIA 2DPJA 3FY1A 1PYTA 2PODA 1VHIA 4IZGA 4WFAQ 1RTIA 2OFJA 4H9YA 4P2VA 4G9PA 2WHJA 2ZM6F 4C8KA 5F8NA 1W8GA 1Q7ZA 1QPKA 4L9ZA 3VKAA 2JFKA 4DCJB 3TW0A 1M9HA 3QF0A 4EMDA 5D4YA 2HHUA 3SAZA 3OBIA 2BR0A 3VGHA 3MYPA 3LNMA 3FAWA 2BJDA 5IM0B 1XRFA 1Y4ZB 4U4MA 4C6OA 1VIWA 2DR9A 5HMDA 1MN9A 3LK6A 4ZITA 3CJTA 3EGWB 3SV4A 3IS4A 1ONRA 3CC2S 1NEEA 3NDOA 4KERA 5TQLA 1RLCL 4TMBA 5DDRC 4DLGA 2QEXS 1H7RA 3PACA 1ZBKA 9ATCB 4JS3A 3WZ0A 2H51B 4UQAA 1C92A 2E7FA 1ITPA 2HBQB 1ICPA 3NCOA 4ZVEA 1WE5A 1OCJA 1KBLA 4ED3A 5J8LA 1S9FA 1S0OA 2JZ5A 2FKPA 4JFUA 4LAKA 5KITA 2AGQA 4O14A 3S83A 3H8YA 1AJ2A 3VMNA 3DM2B 2CNOB 2VFSA 3H5SA 1P0EA 3I0SA 2N3OA 2I38A 1X8DA 1B0VA 1P9YA 4EGLA 4FDFA 1WXZA 4XUGA 3R9LA 2ZUMA 4HK7A 1HTIA 2WZMA 2LYVA 4P6QA 1FJEB 4LBPA 1JDAA 3PRVA 2V6AA 1OGSA 3SSZA 4KV8B 3WSUA 3GDLA 1UH2A 2E5DA 1QHOA 4N7TA 3BZJA 5FJTA 1F6YA 1JPMA 3ANVA 3JZEA 3U8GA 1G4SA 2ZITA 3L4BC 5GVQA 3EYPA 2J6UA 5D4OA 2E7VA 5EWFA 3PN8A 1V3RA 4M5MA 2ALRA 3TJ4A 1R31A 2V5BA 5BCAA 6XIMA 3I4PA 1WC1A 4WP3A 3TOQA 3VCCA 2GX8A 1LL4A 2XZ9A 3H2NA 2XS7A 1Q2RA 3TVYA 4DF4A 3M64A 4E2FB 3TLLA 1H4PA 2OHDA 5EGRA 3LMYA 5C2XA 2J25A 7AT1B 4KRZA 4OGZA 4EFAC 5AE3A 3ENQA 3C46A 1W3HA 1VKFA 1MEWA 4DNMA 2PDWA 3EM1A 2HQDA 2LEPA 4AXKA 2VYOA 3MM9B 4NXNJ 1NK4A 4G1KA 4GZEA 4MWAC 4ECXA 1GOKA 2MLXA 1ZAVA 4MSSA 5LIUX 3DLEB 6AT1B 1H62A 2EKCA 3FZ2A 4CH7A 2FJVA 3QV6A 5T41A 2ZRWA 1TKXB 1NVMA 1RSCA 1R46A 2XULA 1A5SA 4H6QA 3CO0P 3JSMA 2P5NA 1WKLA 5F8LA 2C1EB 3O6QA 1A5NC 1KVKA 2WVEA 3RTVA 2CZVA 2F7FA 1QFEA 4RE3A 2X7IA 3DHXA 1TRIA 4XZLX 1FY6A 3MANA 3RG6A 3FVMA 2MY7A 1J5OB 3QMSA 3TZNA 1HBUA 1F60B 2CQHA 3I4EA 3BSCA 4H04A 3QGHA 4YB5A 2AYMA 4X4RA 4IRCA 2HQCA 2RMLA 4UUWA 3MMBA 1I9CB 3HO8A 4AZ5A 2UY2A 2XLKA 1R8LA 2WBGA 3WDJA 3DGPB 4X63A 3P81A 3B05A 1F76A 4JYEA 1W8SA 2WM1A 4ZJLA 5ETPA 4CLFA 3H4XA 3NVTA 1IUJA 1EQ0A 1QNSA 3S7RA 3OTRA 4MF4A 3QHNA 1YJTA 4WU2A 2J0XA 2YNFB 1SM9A 1D7KA 3AS3A 4ROPA 2WV8A 3NGTA 2Q3RA 5DRIA 3QSYB 2NYIA 3TTEA 3G22A 3OLIA 4ETZA 4JGDA 1S7IA 2YBVA 2Y62A 3L5MA 4MKVA 3H0PA 2QJGA 4Q7BA 2NSCA 3IRWP 2GUYA 5AC8A 1W9VA 5HMWA 5KFCA 3NMAA 1V77A 3NPWA 3I9ZA 1VPQA 3C6TA 3ORWA 2NZLA 4XAKA 2DNPA 4DM2A 2HQGA 4CM2A 5ABTA 2MPUA 1KKOA 3RLHA 1GONA 5D03A 3LRMA 1BQXA 4FLSA 2KG0A 4J9SA 3GH4A 2MJNA 1CB2A 2VDIA 3VAJA 4YNGA 3D1QA 3E2VA 4DV2F 2ADAA 5B0DA 3ZZ0A 5KFWA 4IQJA 4WK1A 4DHVA 4LEFA 4UZUA 5A69A 4OYIA 3CIVA 2KYXA 2PGRA 3FSTA 5C9ZA 4C3KA 3ANUA 4Y9PA 3ZZRA 1R86A 1IQZA 4YWSA 1EJTC 2QC3A 1TWIA 2VURA 3HPZA 1O0PA 3S1WA 2WONA 4NCGA 1I0BA 4C8YA 2BOEX 2CPDA 4AZ7A 3BAJA 1RABB 2CNKB 3WF1A 4ZP6A 3LANA 5ETVA 3PO5A 1NMEB 1CECA 1XH2A 1LWJA 5AE2A 4WGHA 2V4RA 3V6KA 1PE1A 4LR7A 3QW3A 4KQZA 2BS9A 1D09B 1J4EA 1XRVA 1EDGA 3E9AA 2QA4S 1Q82T 3MAAA 4J7CA 1P1LA 1UWQA 4LF2A 2NXNA 1SW3A 2ZBIA 1T94A 1AL7A 3TZFA 2NPFA 4M5GA 1B3ZA 1PCWA 3AMDA 4NEZA 2CJXB 3REQA 1QPRA 3J81j 3SIPB 2PTYA 4CO2A 4HSOA 3UWYA 4DJFA 3IV3A 3WFAA 4L9XA 4A3UA 3CAKA 1LWXA 4HHUA 4CU7A 1G7VA 3PAJA 2OWCA 1VC6A 5EPDA 1FJGF 2BYCA 2I1RA 2ZZ1A 3B0YA 3W1PA 1T0TV 4HJFA 1ZJIA 1AB8A 5ETTA 3PW4A 2KAUC 3WLKX 1JZ7A 1KNZA 1FI4A 2ZOFA 4F3HA 1N33F 3WIJA 1DHKA 2QR6A 3GYGA 5AYXA 1R38A 3EGNA 3AHVA 1I51B 1V3MA 4I7FA 4JQ2A 4OJHA 3M8RA 1X9SA 3ABQA 3G0XA 3ATYA 4OQVA 3BBBA 5DQGA 4X4QA 4PODA 1HR0F 4LFCJ 4A8WA 2OWXA 1P1XA 3GD6A 2Y8VA 3SO7A 3NYZA 4OI0A 1FKOA 3WBWA 1LUCB 2FHFA 3BLLA 3DESA 4C1NA 1JZ6A 3OVSA 4LRSA 3M2RA 3A13A 5FL0A 1SUQA 3O5TB 1TQXA 4Z2XA 1VF8A 1TU0B 1SV5B 3HULA 4HSNA 2QQ6A 3TYAA 3PSWA 4DYJA 1RT7B 1RP5A 1OYDA 1KTQA 1V8EA 4MNKA 2HURA 2ZNZA 4R8UA 1UA1A 2W4XA 3KLEB 4ZVQB 3C61A 2ZYFA 3D3AA 1A5MC 2DSZA 3ZJ7A 1W7WA 4XQ6A 5J04A 2J9DA 1T9VA 1H38A 5IV4A 3I0RB 4DUTA 3RUBL 3CIZA 3HTWA 4LUTA 1X5PA 3E0VA 3CMGA 2CVIA 2C13A 4JTQA 2A6MA 4N5SA 2FDMA 2XSFA 1NM9A 2HROA 3W7DA 4GH1A 4ALDA 5LGXA 2RF2B 1ZETA 2CKSA 3OJSA 2OP5A 2DHAA 2ZVRA 2PD9A 1CJVB 4F8RA 2AJQA 1WPCA 5A2AA 2GAHC 2ASDA 3K89A 5K9DA 1XW8A 1FP8A 5D4NA 4UCGA 3HJFA 3U7VA 1HNYA 2E5GA 1RWMB 1RTJA 1BLIA 3T1GA 2AMGA 5AVHA 1N5SA 5LNRA 4WY0A 3CD5A 5CC6A 1UC5A 4JV1A 3NGSA 5DXXA 1TB3A 3A24A 4J40A 3R6GB 5DDPC 1MZRA 4JTDA 3CO8A 3SYZA 2VGBA 1E6QM 4H7CA 5JBEA 3QPIA 4DO7A 4DR4F 3ENAA 4V19J 2CERA 3G1XA 1H60A 1WOPA 1U6BA 2HK2A 3KMQA 4OFZA 1RAOA 2VBWA 3EGZA 2M2BA 5K7JA 4H4MB 4J3XA 2WJZA 4H7VA 3PS7A 3LZ3A 1MW2A 2XCAA 1HBNA 2UVVA 4TY9A 4QW8A 1HL8A 1RALA 3W85A 4U3CA 4M5KA 1GYLA 4KKXA 4XD3A 2CJKA 5MKGB 4I5XA 2B4VA 2E1CA 2DJWA 4CWBA 1XH1A 3M9YA 1CPUA 1GTHA 3AICA 1OSDA 2WK2A 4ZOSA 4BF7A 3B4DA 4H4OB 2ROPA 3DFQA 4KT2A 2FJDB 4JKMA 3NKYA 3OGVA 5D2VA 4EPBC 2KG1A 1TL1A 1QE1A 5K8OA 1QI4A 1K9TA 1XWYA 3SZ8A 4DFMA 2MKKA 1H73A 4ZQRA 4ATDA 3NSXA 2ZH4A 2QA2A 3WQEA 1A3WA 2WMJA 3QJAA 4OL8A 2XGZA 4A8QA 1GH8A 4FOKA 3P7YA 4RW6A 3RM8A 5K9CA 4PUJA 3STPA 3AIBA 2HGNA 4YWIA 4BC7A 4P7RA 3FBCA 3QGKC 1KO0A 2L41A 3WG6A 1HX0A 2NUHA 3TWZA 5KAKA 1C4CA 4DUZJ 3ZWSA 3VC5A 1Q6DA 4OHQA 4RW5A 2Z2ZA 3S1VA 3BH6B 4UOGA 4FVCA 2FPTA 3M5XA 1FWIC 2H9ZA 2VEGA 4QQBA 4GKKJ 1E6VA 1PL9A 3LCHA 1XFCA 1GVFA 3ZJ6A 4FPRA 2AKMA 1IN0A 1YX1A 2CG4A 2ZRZA 4TYAA 4AHQA 1HGWA 2E09A 1Q65A 1X7FA 4UFMA 4DCOB 1P27B 3ETMA 2E5LF 4D71A 5CCZA 5ETRA 1GVYA 4LF9J 3NPXA 3FQLA 3FDSA 4CUCA 1OC5A 3WF0A 3HSZA 2LDIA 4ECZA 3TW9A 1R9YA 5GAGU 3P5BP 3MI7X 2HHSA 3MPWA 1G0CA 1V02E 3PBYA 1XR6A 4JI6J 2UWFA 3GS6A 4EZ9A 4QYZJ 1T9TA 3AD8C 1O5JA 2RD5C 3R2GA 1Y3JA 1JZ2A 4WXZA 1A5UA 4WYWA 3GTFA 4PBEA 1D8ZA 3NSNA 4GI4A 2EJ1A 3A9IA 2UY5A 4H4IA 5GNXA 2F84A 4IOAQ 4LREA 5DETA 4MDOA 4HT7A 3OLDA 3E2RA 3LBCA 2JFDA 3KHLA 3V1PA 1KQFB 1TL5A 5LA1A 4DG1B 3RB0A 1EO7A 3M8SA 2BE9B 4USTA 2ANUA 1A50A 5D2XA 3DIPA 4C4WA 1EETB 1XLGA 4DR3F 3KBVA 1POKA 4P75A 5A94A 1MMNA 1JYNA 2EGZA 3I31A 4H2HA 1WHWA 2B0GA 1GJUA 2OEJA 1K0VA 4ZN3A 1WC5A 4QWCA 5A8QA 4Q44A 2ILZA 1YBQB 2VVNA 1ZHAA 4DF8A 1C1CA 4DNHA 3DYPA 2C18A 4FPSA 5HL7Q 3BN7A 4IG0A 1U1LA 4RK8A 1LWCA 1VBXA 4AZBA 2DGOA 5ECUA 3DC2A 5CXTA 2N3LA 2DPIA 3PG8A 1JUKA 3BJTA 3BBCA 1WA3A 2MQNA 2PIIA 1OIAA 3C0LA 1XBYA 2ABAA 3H55A 4ERIA 1L6YA 5LSLA 2KYZA 1B9ZA 3C14B 4GI6A 5HULA 4UQCA 2DNNA 3BM7A 4LGXA 1YWXA 4C7DA 5AOUA 5KT2A 4TU8A 1EKSA 2OPQA 4DUWA 4IGMA 2X1TA 2IMOA 4H41A 4J9OA 1JPHA 1RVGA 2E6AA 4NRRA 2O4MA 2FGZA 2QPXA 4M8LA 2Z7GA 1K1SA 2I9SA 1N8FA 3UZ5A 1GOIA 4OV9A 3A6OA 4IGHA 1LQ0A 2X42A 3W74A 3UVJA 4UR9A 4Q4QA 2ZZ7A 3GNPA 1P9QC 3DHWC 4OZNA 1YDLA 3FXGA 1ZAWA 1JCNA 1ZPTA 4C48A 3CUGA 2WJFA 1RTHB 2YCJA 1IKXA 2B7QA 3P2VA 4H1ZA 2ZDRA 3NQEA 1X4AA 4RUCA 2VHGA 2C3YA 4J35A 1VC5A 3WDIA 2R7UA 2CJ9A 4U8VA 4Y00A 1K8XA 2FYXA 2CZ9A 4EBCA 5D0EA 3UEQA 1X31C 1T7PA 4KO0A 4XWUA 2IKIA 3VV2B 1G2EA 4M5DB 1DXIA 3ALFA 1M1BA 3W9JA 1B3VA 3GHUA 4LBSA 4MGGA 3W5ZA 2AQOA 3ULHA 3MPGA 4AB4A 2DVTA 1EZZB 1KVIA 4Q4OA 3PZMA 3AIWA 1VCGA 2FDSA 4HZMA 1F7BA 1VMBA 3L9CA 4XZNX 3HT3A 5E70A 2PU1A 3FC9A 4W85A 4NHVA 2OD4A 1F1BB 4TX8A 3DMJB 3BDPA 2Z2LA 2FGBA 4DV6J 2XIOA 1YTDA 1WEYA 2QA1A 4C7QA 4MWAB 3S5OA 1BTMA 4LIRA 5F8MA 3W70A 4B3LA 3P74A 2D1CA 2ISSA 2NREA 3GJSB 2XMMA 2AAMA 3KLIB 3W2LA 5I03A 4KR0B 2BX7A 3OTDA 4MJMA 2QYGA 5BROA 1EB0A 2QSWA 2FB2A 2ASHA 2WVUA 1WG1A 1H74A 1TZ7A 5DJBA 3FUYA 3G71S 3VD4A 3VMPA 1XSIA 1G6BA 4J1OA 2ZOMA 4E98A 2QF8A 1BF6A 3CCWA 5HNUA 1ZH5A 3SY5A 1XLJA 3C2OA 3UCGA 1R5YA 3AS1A 3C66A 1CI1A 2GJXA 4DN0A 1XNRF 2X41A 3EA3A 3RCNA 4DJFC 1N36F 4QGCA 3PWGA 1BD0A 3M30A 1JYXA 5H9EK 1Q5YA 4DPPA 1K9DA 2KX9A 1V3HA 3CJ5A 3VM7A 2QUUA 3EE3A 5D9MA 1E6XM 3K8VA 3OTCA 2C91A 3W28A 3LUYA 2CQDA 4E8UA 4C6CA 4IUFA 2E67A 1HNZJ 5K4XA 4GI8A 3TYEA 4RNJA 2CADA 2KB2A 5DF0A 4LSNA 2HIYA 1SQEA 3A5VA 2PC8A 2EFNA 1KR4A 3M8PB 4QNWA 4CNPA 2MGZA 4ZQNA 4DV4J 2ZXAA 4U7CA 4GC4A 3CB8A 1E1CA 5KFXA 3CCES 1UJPA 1R7OA 1HNVA 2YCLB 1U49A 1HHQA 2HQIA 3RHGA 3TXZA 2XIJA 1HARA 5DANA 1MXGA 4QR1A 3FQKA 3JXOA 3CJ8A 4TTGA 3DC0A 3R25A 3WQ4A 4S3GA 3W7NA 4WOZA 2EFOA 3C0QA 2Z25A 3NTYA 1EP2A 2IUZA 4FX6M 4O44B 2ZHBA 4IF2A 4JQ3A 2EJAA 3KFTA 5FF4A 1NLKL 2PDBA 3R5BA 1GZ1A 1FFWB 2XFRA 2VZTA 2ISWA 3DLGB 1X6LA 5I3JA 2QJNA 3PJXA 4RDWA 3T0TA 1HGYA 2K2PA 2PC6A 2AMXA 4ZODA 4LFAF 1XDLA 2INEA 1LRNA 3HA1A 1LW0A 2D2OA 3IWLA 3LI0A 4ZR8A 4B4FA 1YXDA 4YDDB 2GK1B 3WJYA 3FKKA 3Q8YA 1EUNA 3IGVA 4A22A 3QHOA 3WQ5A 1JIBA 1LM1A 4KW2A 1ZA1B 3HHKA 1WP6A 4LJMA 2VJVA 2FZDA 3KZPA 4HGXA 4QCEA 2IYIA 1CJUB 2HVDA 3KLLA 3DFOA 4Q8QA 2ON3A 2A2CA 2J0QD 3BGOP 1XISA 2PS2A 1NWSA 1RY0A 5AXLA 1A5BA 2ZE3A 4AISA 2G4FA 3R10A 1B3XA 3AQOA 3IGUA 1T03B 3FGVA 4RKAA 4K4XA 1XV8A 1EDTA 3LHZA 2QFIA 4GMKA 1KVJA 1SJFA 3KJVB 1SQ7A 1HFEL 3L5AA 4HKQA 1FCAA 1WC3A 1H51A 3QPEA 3B8IA 2HGMA 3LP0B 4PTDA 4CU8A 1KLNA 2PSNA 5HR7A 1CGVA 4HACA 4K2JA 1TJRA 3EPOA 5EWGA 2APOA 2J62A 2DEPA 1QRQA 1M01A 1XIFA 3TN4A 4E3TA 4Z1YA 4EOUA 3RYLA 5F3ZA 4BJHA 1REGX 3ABOA 4LB4A 3CV1A 1M03A 1M1GA 3MTKA 2YWGA 4ZCWA 3B04A 1VFHA 4NXSA 3MUCA 3W7EA 3M2UA 1X39A 4Q8PA 1VJWA 3DLEA 2XS5A 4B3RJ 5BOEA 3ITOA 4DEZA 1M53A 1X6NA 1ZCOA 2ZKMX 4MKBA 1XS2A 3SDEB 3SCIE 5A2QY 5HDRA 4DR7J 4X0NA 4I6YA 4ZLLA 4XK8C 3VAFA 4WP9A 2YH1A 4CZCA 3BSOA 3T2QA 4JTCA 3RU0A 3M7WA 3L7RA 4E38A 1P6CA 2MHNA 3IVUA 3S2LA 3EPMA 4JN8A 3ZO7A 1JD7A 4JCLA 1W1B1 4A8SA 4F0LA 5KG5A 3SSJA 2HS3A 3DXBA 3ZNJ1 3NBPB 2KRBA 2IVFB 4KCVA 1H0GA 3SCUA 1CDGA 5L8RC 2ZZNA 1DHMA 4C6BA 1I2NA 4JICA 3BQ5A 3BURA 3OGRA 4PRWA 1NPPA 3W37A 3N9RA 5E93A 3QVQA 2V69A 3PFMA 1P0DA 3GC2A 5G1TA 1HJVA 4EWTA 1GWJA 1J0YA 3B8UA 5GJPA 3GIYA 1ME9A 2HRUA 1JIHA 2V4JB 1RWOB 1GXLA 2B9WA 5D77A 1SFJA 3XINA 2WMIA 1FH7A 1HNXF 4PE8A 2INZA 4F2UA 4DV5J 1Z2ZA 4ZENA 4UNKA 3UDEA 1CBGA 4QJVA 4ZCKA 1DJGA 2Y8UA 1RT3B 2W2MP 1Y5VA 4DFKA 4MY1A 4GLEA 4NJKA 1FX2A 1JLFA 4KJIA 4UMAA 4MYXA 1EO5A 1YJVA 4MY8A 3OSPA 4F4KA 1VFOA 2R24A 1W1PA 1NU4A 1CXLA 3KXQA 2YL9A 1WQ5A 4Y34A 1YZ6A 2F40A 2JHEA 5C8BB 1Q13A 1RPKA 4KCUA 4HU0A 4IR9A 2J8SA 5FJUA 1S6UA 3EDKA 1TKKA 3N6HA 3MUAA 3BH7B 3HHDA 3ET6B 4IYQA 4XDCA 5KG7A 1OYAA 4GVIA 3UJEA 1GGOA 4TN2A 2ZWPA 3MI6A 2RH9A 3GV7B 3ZLGA 1JXVA 2GJLA 4MIAA 5A8RB 5A8KA 3W1MA 1DJQA 4LRBA 1DQUA 3I3EA 2WCGA 1K4GA 2OGUA 3MM7A 3PBUA 4WJBA 1XICA 3ZM8A 5KFSA 3VZIA 4HTBA 1W3JA 3FSXA 3PNZA 2PE4A 3ZZ1A 1PTGA 1OPIA 4BEUA 1S2AA 3NEKA 1KRAC 4RW9A 5ABGA 2IRUA 5AC7A 3FCVA 2D0FA 2VZSA 3VIHA 2Z6JA 1TTHB 1WCGA 3HVWA 1AL8A 5KSWA 3CWOX 2ZH3A 1QW8A 1FXPA 4OVXA 3DU0A 4B90A 4K0KF 2EFGA 3AHYA 2KN4A 2XMWA 2V94A 3G86A 3UO0A 1S12A 3I68A 5C54A 4PKDB 3EBVA 4HPJA 4DBQA 4BK9A 3QM3A 4F2RA 2H5IB 3KBWA 4F4RA 1HKIA 2X0YA 3TUUA 4FP9A 3Q45A 1SL1A 1CQNA 3LYEA 1SC1B 2NUXA 1Y5NB 4M24A 4K2SA 1P0NA 2C2RA 3NAHA 3BGGA 2W7OA 2PTXA 1OIFA 3R7MA 3DNCA 1K9EA 4W9TA 2PWVA 5A8RA 5LZLA 1XR5A 3SCLE 4X64J 2BSLA 2EF9A 4ZQOA 2BRLA 2V5HG 2YLAA 1TMJA 4IH5A 1W1ZA 2C14A 4XKYB 3W9HA 3NPVA 3PHTA 4ZLJA 5FEWA 1RT5A 4UQTA 1GQIA 5CABA 2D3OR 3QN3A 1HNWF 1N8IA 3NG3A 3MJMA 3DRPA 3W9ZA 1H1ZA 3UCCA 3Q8SB 2EEXA 5FESA 2XHCA 3CJ4A 4P7VA 4PMUA 3O15A 5ETOA 3BSGA 1I2PA 4GFSA 3RNDA 1DYSA 1RWKB 3D0HE 3QRHA 4J2PA 2W6RA 3AD7C 2CBVA 2J13A 2WW8A 1TV7A 1RQHA 1FEHA 3QYYA 2FJUB 2VFTA 1FWPA 4MADA 3NURA 1Y0HA 4FAMA 4B02A 1EQPA 1J5TA 3DG7A 5I02A 3H59A 1QNQA 3PZPA 4V33A 2R2UA 3ITVA 3LOUA 2E5HA 4D6FA 5HBFA 1M41A 3C0JA 4CD7A 3HD1A 1DTNA 3EKZA 3DRPB 3RXZA 1NK5A 1W1VA 1WDDA 1APSA 3W38A 4LS1A 1IXKA 1BTCA 2WWCA 1HW9A 2XY7A 3GILA 2CWNA 4CNUA 4O13A 2J6VA 3HG3A 4YP3A 3LI1A 1B3YA 3UN2A 3T07A 3W1QA 3H26A 1VHNA 4UFKA 5CC7A 1S39A 2V38A 2PGFA 2AZ3A 4PWUA 1X1NA 1WDSA 3H12A 2R8KA 3NLCA 3TEGA 2HNEA 1FWDC 4OYOA 5FJ4A 2COLA 4P2FA 4O15A 5I5RA 1KLZA 3NXZA 3HHLD 4PB4A 2RS2A 2BACA 2CLFA 3KTCA 1XFBA 3MP4A 3GBDA 2OQLA 1KC7A 2PA8D 1J9YA 2CDQA 2DNZA 2VC1A 3O8AA 2NPIA 3UW6A 1W9DM 2DR5A 3S0CA 4CRJA 1UEKA 1J2VA 4S3BA 1FDDA 4WWSA 3TZWA 4O3SA 3CJKB 4CLLA 4GOAA 1JNDA 2OO4A 5CLWA 1GEHA 5KFOA 2OSWA 1KBJA 1DWAM 3X3UA 3WD1A 3W63A 1KV8A 5BXSA 5SUHA 1JZ8A 2GZOA 2LDYA 2J7FA 4B9YA 3VCRA 4ML4A 1LWFA 1QHZA 1CVJA 4DJEA 2F6XA 4G6CA 3DDKA 3PTWA 2FLOA 5DLCA 4Q2MA 1H7PA 2OSQA 2ZD1B 4X66J 2BANA 2Y5SA 2YDAA 2BQUA 3LGGA 4F3OA 4EK7A 3FJ2A 2DHXA 3GW3A 1VFFA 1SMAA 1Q7QA 2C15A 2QCDB 4RW8B 1VQKS 1SJDA 4P8VA 1L3SA 3HV8A 3EB4A 1A5CA 2HK3A 4RO0A 1LL6A 1RTIB 3GV8B 2G0JA 2D2GA 1BQNA 3V4IB 1ISVA 1BKSA 1OINA 1PX3A 2F63A 2M70A 4DX5A 4R5EA 1FWWA 1Q66A 3BCFA 4QLKA 1GOWA 5HANA 2EBGA 3BOFA 3M8YA 2RJGA 3VNKA 2DZBA 1PDZA 2QAFA 3CDWA 3UN5A 5M2UA 4JV0A 1C0UB 1I60A 2B81A 3HQ1A 5KFZA 3BW2A 5ITHA 3CT9A 3ZTOA 3MUMP 3LX9A 3C5QA 3VGEA 3LM3A 3QQ1A 4ZPDA 4LNCA 1TZ0A 1RAAB 3BV4A 2QMJA 3W88A 2D41A 1PKNA 8TIMA 3WNOA 3SN1A 4ORMA 4XO6A 2M8HA 1J27A 4G65A 1QU4A 1N8WA 5F8GA 4NJHA 4LYPA 4DR2J 1XNQF 3M6VA 4LAZA 2NVAA 5GPRA 3TQVA 3QFEA 3H8AA 3IK2A 3NZGA 4LVOP 2VQEJ 3P0WA 3MD1A 3S9IA 1MU2A 5CYMA 2VCCA 5J2MA 2CHOA 4K36A 4W89A 1DY3A 4FHAA 3EWZA 2A1YA 4FBUA 2PB1A 4MK8A 5FIIA 4CQ8A 2OTDA 2V68A 4Y9AA 1E6YB 3V81B 2XH4A 3WMLA 4AX6A 4TO8A 4NL1A 1QMLA 3CMJA 2MKSA 3GU0A 5AXMA 4H8UA 5LXXA 5IT9U 3SXLA 1FP9A 3B0VC 2O92A 3LZ5A 3F4DA 4LYRA 2HSEB 4CH1A 1NSAA 1CXHA 3GB0A 2UXDF 3V0UA 4Q8UA 2TSYA 5IFTA 4HZ7A 3STFA 2W24A 4LCQA 1Z2LA 4R25A 2GFFA 3TP2A 3KTXA 2G3FA 1QWKA 2DZVA 1TAQA 4JTSA 3TAMB 2ZXDA 2VTFA 1WELA 5CD4A 4DWSD 1XPYA 4PZVA 2HK1A 1FWRA 1OS5A 1SCJB 1RA0A 3DFNA 1BVNP 1DE6A 3LPYA 4DV1F 5DY3A 3TJXA 1T3NA 4FZVA 2R8GA 5EYWA 4DIAA 1SSDA 5F0WA 3FW6A 2YPZA 3N9KA 5DRKA 1R89A 2JGYA 5IFPA 1RQEA 5HPOA 4WK3A 2WJDA 3N14A 4CT9A 4JI2J 4E0CA 3OR1B 4LFCF 2OO6A 3IGHX 1NJYA 4WIIA 4HNLA 5GMDA 1FOBA 3W76A 5LIYX 4KIAA 5CKSA 1RU1A 3KOWA 2HQ3A 5FJRA 1EA9C 2BXZA 5C24B 4R5PB 5M2FX 3S1TA 3R2CJ 1HYSB 4G1QB 4C0HA 2AJ4A 1XM3A 4K38A 1UL3A 4ED0A 3WLJA 2DITA 3BR8A 1Y00A 4HNNA 4LMZA 4XZHA 5AN7A 2EFPA 2XSXA 1JWWA 3VIMA 1UVMA 3CUNA 4USKA 3RR7A 4NX9A 2D1ZA 4M6UA 4B3ZA 1PO6A 2DT2A 3FVYA 1HD1A 1U1KA 5C2CA 4PTMA 2DNLA 4GXWA 2A1BA 1I94J 1FQ0A 3IIPA 4ZVGA 1NQKA 2WKGA 3VXGA 2AEFA 1S9GA 3DGRA 2CNLB 4B5SA 3LDVA 2W8LA 4NXNF 3CCQS 2YW4A 3LP1B 3JSRA 3V35A 4FXJA 4USVA 1REVA 2V0NA 3QRPA 2WM0A 4OYWA 2V2CA 3BYRA 1H5VA 4F4ZA 2WZHA 1Q86T 1NK6A 1JXKA 1TKZB 5HATA 1FWJC 5HROA 1XIDA 5D9PA 4O1DA 5KG0A 2MMYA 4GO8A 4IP4A 4U67Q 4HTIA 1NJWA 3VINA 4JYFA 4WE1A 4NAFB 2NX1A 3WEZA 3ZVHA 2QNEA 2SFPA 4NP7A 5CAHA 2NX9A 3R5GA 1HD0A 4C6AA 2FC9A 3EXTA 3DI6B 3KVMA 5I3DA 3CIMA 4OX8A 2G97A 1CG2A 2F4VF 5HAOA 1NSKL 3VR1A 5IOBA 2PDQA 1A53A 1NK9A 1PIFA 4HDGA 4F02A 5BMXA 2Q02A 1U2YA 4J27A 3UNGC 3QOKA 1IKWA 3QGVA 3OBEA 4LBIA 2FLPA 4O4VA 4CLKA 4PC8A 2F8HA 3EEZA 2G3NA 4UOCA 1W2PA 3MMWA 1Y5XA 2OTJS 3J7AN 2YXLA 3UCQA 4X60A 1FBAA 4HOWA 2B56A 4AL7A 3H7VA 2N82B 1HHTP 2J8GA 2FD2A 1FWAC 1NDPA 2ZDPA 3PJTA 4PUKA 4MZ8A 3THAA 3THVA 1X7IA 1QT1A 2CLMA 4PUDA 2YY3A 4H00A 1JLAB 3MDFA 1YJRA 2HZAA 4GVGA 4UXDA 1WYIA 3HPFA 1JPKA 2RSQA 5HQEA 3TROA 3W2KA 1GXTA 2VKZG 5E09A 1WJ9A 4MKYA 3P49B 2RUSA 3PAOA 3DOPA 3YPIA 4IPIA 1ZZMA 4PUUA 3GQCA 2RQCA 1U1PA 4UQGA 3STGA 1IEIA 3AJ2A 3IN5A 3CZGA 1SH2A 1EP1A 2ZBTA 1NZAA 2NS1B 4QEHA 3AZSA 1IKWB 2L9DA 4KQNA 2DR8A 5KZMA 4L5ZA 1SBRA 5K20B 3MW7A 1KRPA 2DJXA 1NWUA 4ZS6A 2I5GA 3CHDA 1F2JA 2BKPA 2OPSA 3RCYA 1SW7A 3B4YA 1EFZA 4C0BA 2XSJB 4NLWA 4CNSA 2YFOA 2FHMA 2EKNA 4HHJA 2OKQA 3IAQA 4GVHA 4FS1A 1FESA 4JTRA 3GYNA 3MXHP 1KCZA 3V6DA 2M52A 1XLFA 2VX4A 4RZBA 4LVAA 1YJUA 4USWA 3QR0A 2W1BA 4C91A 3OVRA 1CLVA 1Y65A 1FTCA 4M1KA 1DWGM 4N77A 2GGPB 2KM8C 2YKQA 3BJYA 1NK7A 3AMLA 3W00A 2BHZA 2HLUA 1LZOA 2WNNA 2GQ3A 4WVXA 4NXKA 1CYGA 2BVWA 1EQCA 3GU1A 3GVRA 4KGLA 4AIUA 3CUHA 1UFLA 1R8AA 3ARUA 1FNOA 9RUBA 3GK0A 1XUUA 1HA1A 4NXMF 1YRRA 1S76D 3N15A 4OYXA 2DH2A 4YOEA 4YJ5A 2VNCA 4IFVB 3C16B 1IBMJ 1UG6A 4LAMA 3TA2A 4IIBA 3T2PA 2XMJA 4NZJA 2FH8A 1FDBA 3WQOA 2MKJA 4JKLA 3CLWA 3WCZA 1NNDA 2W79A 3KDOA 4JL1A 3GC4A 2E44A 3ELFA 2ZUNA 4DAIA 3GU9A 4HA1A 1K4HA 3PYEA 3TFCA 3GIMA 3NQCA 4DXVA 3HI9A 3G3DA 2CBJA 3CAVA 2OPJA 5A76A 4RW7B 3Q24A 1ONXA 1DTUA 3FCWA 3IIOA 4AEEA 3L4UA 1GW9A 3KRSA 1S1TA 1SUXA 1ZP3A 2D0GA 3AUOA 2I17A 4TR9A 4YEAA 1Y9OA 2YA2A 1RE1B 1FRIA 2Z1SA 1QJHA 1E4IA 5IZHA 4O0NA 4XSLA 2XHYA 3CCVS 3PO4A 3G1HA 1RTDA 3BGLA 4QSHA 1A5LC 1UWAA 2YQ0A 3KK1B 4MLRA 1OC6A 1SIWB 2OGYA 2MSTA 3OTEA 3GIPA 3IRSA 5CZJA 3BS9A 2HISA 3WH5A 2HW3A 3AIRA 3HJEA 1PX8A 4C7FA 1OYBA 4ZXLA 3P60A 4J4KA 1LXJA 4UR8A 4O18A 3RX3A 1K73T 3GB6A 4JIIX 3WC2A 1OB0A 3UZXA 3VGVA 3MDWA 2PMZD 4BZYA 3WD3A 3WX8A 2R1PA 5M1TA 2CCRA 4ZE4A 1ADDA 2EW9A 2HHTA 3VKJA 2ZH5A 6ALDA 4L3KA 1NP2A 2V4QA 1S99A 1VYSX 3T4WA 3NM3A 4L4LA 4Q8OA 2W61A 3TU9A 2DDXA 3GXMA 5KT7A 5BYRA 1XPGA 1W9PA 4S3FA 1S1WA 3HFZB 3L23A 3DLHA 1LOUA 3LGHA 4RLEA 3TJ9A 1LQ2A 4HDHA 3QR1A 2DPEA 1W2IA 1AZ1A 1AW2A 3NEHA 3VNJA 5DDQC 3IJ9A 3TUJC 1Z89A 4X4PA 2B7OA 4LWWA 2DZPA 5EUHA 2OCZA 3M7SA 1BY9A 4A4AA 2OLAA 2D9PA 4FF7A 3D6HB 3VX0A 3K7RA 3HSDA 3DRRB 4HHPA 3Q86A 2FJXA 2EKGA 4Q8EA 2OAUA 3ILIA 2J74A 1H5YA 2HBYB 4QISA 3ZIZA 1BWKA 3T42A 1LJYA 1TZZA 4DM1A 3ZC4A 4L1WA 1E0VA 3GR7A 3NDYA 3POTA 2ACQA 1JCLA 5IHRA 4HA0A 2O7SA 2UBPC 3FGCA 3VTRA 5H9FJ 4CO0A 4UZBA 3IJ7A 4Z1CA 2GSJA 4HVZA 3ZR4A 4L56A 2QCFA 1OFPA 1FWEC 3OFGA 4Y2AA 1YVFA 5H6HA 3NWGA 1MEIA 3K0JA 3ICJA 4J3SA 1R0BG 1IBMF 1FVPA 3DN9A 1VGYA 2HG4A 1CENA 2QO3A 3Q2TC 1QUMA 2E1MC 3OXFA 5D78A 4IGNA 4TXSA 2UU9J 4RPFA 2QCLA 2DHHA 2DH8A 3AS2A 1XP3A 1ACMB 3D66A 3I5AA 2BJ7A 1OFQA 4A2SA 1LROA 1GJPA 2OELA 5D4LA 5B0BA 5GADU 2C2NA 2BRKA 3P0XA 4B9UA 5CSUA 3Q67A 4ADUA 4ZCIA 2XH0A 3MQTA 4QX4A 1QSSA 1B9BA 1RAKA 4HL9A 3QAUA 2GZXA 4AZIA 2BEFA 2WAGA 1SKUB 3CMAS 2GQ2A 2ODOA 4M1BA 3DFYA 5BOOA 3DRSA 3WL0A 4K3ZA 2JDJA 3T81A 4L75A 2BBEA 2W92A 3NUKA 2EG8A 1FH8A 3Q8UA 4DJFD 3LP2A 1KQSR 1EOKA 2PI6A 1WG4A 4YTSA 1RK8A 3THUA 2N4DA 1S1XA 4DPXA 1SZRA 2VB6A 2UUBF 2OI2A 5CJNA 4RX6A 3FJ6A 4RDYA 2XUCA 2E5LJ 4X2BA 4QG8A 1G4EA 3PPFA 4ZPCA 1GNKA 5D30A 4L6V3 4S3CA 1K9FA 5E3QA 3W07A 2OX4A 1VK3A 5H8MA 2HHHJ 5DMNA 2WTFA 3ABXA 4J2MA 3IARA 3O63A 3LY0A 4ECWA 4XBSA 5CHCB 4CEXC 4HVXA 1S57A 1VBKA 4F50A 3MZIA 1S0NA 2A7RA 4AZ6A 2Y2WA 1XC9A 5A8MA 2X2YA 4MWAD 1I0DA 3W1RA 3K4DA 3S5SA 3H4WA 4Y2CA 3OV7A 4RXGA 4NPOA 4N0RA 4DQRA 1PYMA 4ELTA 3MUXA 1NAL1 4HMNA 2J24A 4GZ7A 4RU2A 2ATLA 3BG9A 1E4LA 4QLJA 1IJEB 4LRFA 4NA2A 3FKBA 2QCGA 4OLOA 4BKNA 3DI6A 4A2RA 4GCXA 1C90A 4O4RA 3F73A 4F3QA 2W63A 3PWIA 2R1NA 1KM5A 1NHUA 3AH6A 2WZIA 1V51A 3A9BA 5KFLA 1HBOA 1TWZA 3AQUA 2HK0A 2FJBB 3K5OA 2I16A 1E0XA 3W7LA 5JBFA 1TMMA 2RIJA 3M30B 3GONA 2YZRA 3UR2A 2EVZA 1YPIA 4PTXA 1Q6GA 3N3MA 4O52A 4GABA 5AHEA 3G82B 2VC9A 3SQGB 3DLKA 4DL7A 4UR7A 3V2UC 4YS1A 4QHRA 1AMYA 2NUUG 2JEFA 5IT9Y 1CW2A 3M9NB 3LWMA 1FFSB 1KRMA 1VFUA 2JQXA 4M7SA 1UJQA 4N6FA 4ZO7A 1Q8BA 3IWNC 3N6JA 3URQA 1XLCA 3QNWB 3R7BB 2ZJQQ 2WSRA 4Z42C 3PULA 3BO2A 1B2YA 5AFDA 1UR8A 1B0TA 3P96A 3TYDA 3LRLA 4AXJA 4DV0J 1IQTA 3HO1A 2ATMA 2DQWA 1OX4B 3OD2A 3MPDA 4X9YA 3RRXA 2GGIA 3TUZC 4D6CA 2ZUGA 1RWVB 3EZUA 4J28A 2VEIA 3H2FA 5CCMA 5E3CA 4K2XA 5I3GA 3FIGA 5I3FA 1SMDA 4Q7NA 4KH2A 4IQMA 3DH7A 1X4GA 2C22A 4QOTA 1VJIA 2FTWA 2E40A 2IW0A 2YKOA 1T0OA 1N82A 5EU9A 2N7CA 1ZS6A 3C86A 1KW1A 2RH3A 5KFTA 2J77A 1JLCB 3IRDA 3MHUA 2OMAA 3UYIA 3DRXA 4D8LA 1GKPA 4PXCA 3P82A 4B5NA 4X65J 2DSUA 3BR9A 4JQAA 3N18A 1U09A 1B3TA 2Z1WA 3KCJA 2ZBPA 4X9SA 4G7EA 4TQTA 1DIEA 5HQMA 1NWTA 4XAFA 2PTWA 2V50A 3ZS4A 4FO4A 1WDRA 1WG5A 1TA3B 2BB0A 1U1QA 2QJJA 2VG5A 3UR5A 3H4DA 1X96A 8ATCB 2PEVA 1TPH1 5CH7B 4DV6F 2IRYA 1THFD 4MFEA 4ML9A 2EXOA 3OG3A 2H90A 2OZTA 3LGMA 4DI6A 3H98A 4GQ0A 5CAAA 4RV8A 3TR2A 1YQ2A 3HFYA 1C3FA 4JDBA 2DW7A 3U57A 2HVMA 2CQIA 2XINA 5LT5A 1OYCA 1I5OB 3VAGA 4IFRA 1G9HA 4HK6A 1NOFA 1R3YA 3WF2A 1DXEA 2ESCA 4OYBA 4E8DA 1P7TB 1K44A 4DQPA 3KLIA 2BDQA 4MTVA 3CGTA 2HMIB 5A6BD 4S1FA 2P76A 3SRHA 1R3WA 5LL6d 3MD3A 3SGZA 1P48A 3EB2A 1ZBTA 1CZ1A 1WHVA 2JX2A 4KBXA 2CG8A 3OTBA 4J3UA 5LXYA 2C2DA 4TVDA 1T41A 4DL4A 3T1HJ 1DJNA 3DOLB 3OG2A 1FWGC 1FXQA 3GE7A 2LVWA 3K5LA 2UXCJ 3CTTA 4NMLA 3NGFA 3SY8A 4AWEA 5KZ6A 1EB3A 2PLMA 2FHKA 4K4TA 4CTAA 1AA1B 2NUYA 4KMQA 3VIGA 1OX6A 3AA9A 5L38A 1F5ZA 2CPIA 4XZBA 3TSMA 1JNRB 1KWMA 4M80A 1ZGDA 3HKZD 1WV2A 4F3MA 5DCDA 3GHSA 2I56A 4OI2A 3QO9B 3EWCA 1YSJA 2XYHB 5CPMA 2J0SD 3FV9A 2ZE0A 5D9OA 4P73A 3UGVA 3AXKA 4AIEA 3SFUA 1TVRA 1YXCA 4PCQA 3KLHB 4PPZA 2GHPA 4USHA 3HLUA 3WBZA 1ZB5A 2CLKA 5C25A 2VENA 1C8XA 3EX6A 2HS4A 4WSKA 4NY2A 4Z2KA 1FFGB 2ZXBA 3GXIA 1LWEA 3MEEB 3PFOA 2CZDA 2JLGA 1W3LA 1LLOA 3IPWA 4GISA 5J2NA 1JULA 3PUDA 3DRYA 4ZFMA 4H2CA 3KBNA 1KOOA 1LK7A 3D0GE 3DLKB 1TL4A 3HHNB 1L8PA 3MSRA 3MI2A 2D22A 3KJNB 3BK0A 1JJCB 3RPTA 2QJMA 1WOBA 3FHQA 3R11A 4B5XA 2RQ4A 3ILLA 3VNDA 1JFXA 3S6DA 2W9MA 3NRBA 4NLSA 3FJNA 3BJSA 4KEVA 1HMVB 4IXHA 1Q2SA 4GYPA 3QFWA 3ARYA 5CSRA 4QPXA 3D2WA 3FMWA 5IT4A 2VUNA 4G5DA 1IE7C 3M0MA 1B30A 2IAJB 1OFEA 4X62F 1EHNA 2QRRA 3CD7A 3VIJA 4YXGA 3OVQA 2KZMA 3U2CA 3PHEA 2V5KA 1N2VA 2JFEX 4NQ1A 3FCHA 4QWDA 4E4UA 1AW1A 3I3DA 1RWPB 4ICMA 1UJ6A 1T6MA 4TKTA 4DV2J 2IY5B 1OQ3A 2BJ9A 3VU2A 1ZTWA 5CPOA 2K06A 3SRFA 1UUQA 1MW7A 2J75A 3CLMA 4LY8A 3KK3A 1KLMA 4IMEA 1FDNA 3HFVA 3P5ZA 3GR0A 2FH6A 4ZGYA 5L6UA 4U6PA 1U45A 3NSMA 2K8GA 4LF1A 3R6IA 3IBFB 1JAEA 3L4TA 2Y85A 2O01C 4O16A 1TR1A 4PMRA 2VG7A 2HBXA 2OOFA 2HFNA 1IVZA 4F0HA 2GNKA 1FRXA 1GVSA 1M6JA 4RPPA 3DFTA 5L9XA 3GH7A 1TVLA 2VFGA 5I3IA 1U47A 1LCOA 1FUYA 2VFDA 4AYGA 1MN7A 4FMVA 5BRPA 1FHDA 4JUZA 1F9EB 3FFIA 2R14A 3CZKA 5C9XA 2L9NA 2LU2A 4B9LA 4RWWA 3BGUA 1L8NA 3B82A 1D7FA 2ABYA 1N54B 2VX7A 2I5JA 3J80Y 3A22A 1MDLA 1JNZB 4NU7A 3NAIA 4FYVB 2VD3A 3EDQB 1N34F 4JV5F 3D3FA 1SZEA 1U26A 2E1PA 2VFIA 1MWYA 4TU7A 4NJIA 1M1HA 3KRZA 3ZTPA 4RXFA 3TAOA 1J0HA 5KFFA 1UD6A 2FB3A 5XIAA 2BWGA 1LT7A 1MUMA 3GXDA 1ZU8A 5LGZA 2NXCA 5G4HC 1E55A 5LNVA 4LU0A 1SV5A 5J2MB 4KEZA 4UQEA 4GO9A 3UVIA 4EKJA 3ARXA 3KL3A 1GYNA 3PPHA 5GAGI 2V8ZA 3MO4A 2UUTA 1D0EA 1REQA 5H8UA 2GS8A 2NT0A 3WMBA 5BYQA 4MYTA 3W6YA 5BRBA 2PGWA 3EB3A 4OYZA 3GTXA 3MUZ1 2IA6A 4MAVA 1C9WA 4E2BA 4M7TA 1HI8A 1EJSC 4DZ6A 4NYUA 3MWBA 1XIHA 4QWBA 1U2RA 3HKWA 3P8BB 3ITHB 4NEYA 3RR8A 2LLEA 1V3LA 4HPGA 5JU6A 1PAEX 1X4FA 4OT7A 4MM1A 2VQFJ 2PDJA 4O12A 3ZZOA 1LQAA 2R6OA 1EUAA 4V1Ak 4C3LA 4LUYA 4O50A 1KFDA 1PBUA 5HMSA 2JOQA 1PZ1A 2ZC4A 3I87A 1UVLA 4NLUA 4JTGA 4NT0A 1XQIA 1GHRA 3B9DA 4WKYA 3HGRA 4IIDA 4MH8A 4U10A 3R7SB 2GMJA 2QVHA 1OMSA 1TREA 1R6WA 1JUEA 3SN4A 4ED2A 2V5DA 2DIEA 4P2SA 4U95A 3G18A 3QSRA 2EBNA 2VGFA 2PC4A 4R0JA 1LG1A 3NR0A 1AQFA 3VOCA 3MZ2A 4DUXA 3DYAB 3BZGA 4GXPA 4U31A 2LQ8A 3QEZA 1O95A 1QLNA 2CQ2A 1G6CA 4ZIVA 2DNGA 3O44A 5JVHQ 4BHQA 3UCZP 1K9MT 2C7FA 2XN1A 1S77D 2WLYA 1HO4A 4AE5A 5KG1A 2ABBA 2HQAA 1GKRA 1XKYA 1T02A 1AZSB 1IYXA 4C6NA 4EO8A 3FEQA 1SGJA 2V0TA 4X2RA 3A4TA 2J7HA 3KVJA 1TV2A 1Q95G 4E0DA 4QE1A 3OBAA 1B4SA 4IR1A 2Z1KA 2P8B