3DM2B

Crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
431
structure length
400
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 103
structure length 400
sequence length 431
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dm2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2B03
4ECQA 3KLEA 1RAJA 5KFKA 4K4TA 1S97A 4NLUA 3DRSA 3TVKA 4XPCA 5F8IA 2OPPB 3ISND 2IJNA 1RT1A 1QUVA 3N6LA 3SFUA 3QGIA 4YP3A 3G6YA 4ED6A 2WCXA 4NLOA 3MEDA 4F4YA 4B3OA 3FFIB 4IG3A 4DL3A 5CYMB 3GQCA 5J1EB 1U09A 2V4QA 3MTKA 1KLMB 3KHRA 3HKWA 4ECZA 3SFGA 1RTHB 1RA7A 5KG5A 4EBDA 3I0RA 4DG1B 1TKZA 2R8IA 5KFLA 5EWFA 4KO0A 3TAMA 5KFGA 2UUWA 4QWCA 1N5YA 4XO0A 2VA2A 2RDJA 3KOAA 4NCGB 5J2NA 1LW0A 1MU2A 3JSMA 5HBMB 5KG2A 2W7PA 4QWEA 5HROB 2W9BB 1HMVA 1N4LA 3OHAA 3H59A 2C2RA 2I5JB 2DPJA 2DPIA 2EC0A 4OL8A 1BQNA 3NBPA 1J5OA 5JUMA 5KFUA 4MK8A 1HYSB 2WK4A 1DTTB 2R8HA 3DMJB 4IR9A 3H40A 3H5XA 5I3UB 5KG4A 4MFBA 4WE1A 4K4ZA 2HMIA 5L1LA 4TY8B 1IKXA 5C24A 1RA6A 3RBDA 2ATLA 2C22A 1S1TA 4H4OA 2IAJA 5L1IA 5JXSA 1RTIA 2WRMA 1BQMA 4Q8FA 4PQUA 3KLHB 4JV2A 1JLGB 1TP7A 4J9KA 1JLAA 3OLBA 3D5MA 4R5PB 1C0TB 2IM3A 4TYBA 1JLBB 4EYIB 3IRXA 2J6TA 5KFSA 4KV8A 4KAIA 3MECA 1IKVA 4WFZA 4KKOA 4ECTA 1TL1A 4PUOB 3KLIB 4YQWA 2IBKA 1GX6A 3RB4A 3DI6B 4IFYB 3E01A 2YNIA 4NLXA 3G6XA 1FK9A 2D7SA 1WNEA 3DI6A 4R8UB 3IS9A 4NZ0A 4PWDB 4MKBA 4R0EA 3OSPA 2AGOA 1DTQA 3KLFB 3MEEA 4PUOA 1SH2A 2HAIA 1FKOB 2ZE2B 4ZP9A 3RB6A 4QPXA 4EYHB 5J2QA 3KK1A 3BQ0A 2GIQA 5KFWA 3CJ4A 3IRXB 3BSOA 4J9SA 2OPSA 3KJVB 4R5PA 2WB4A 2XGQA 2FJXA 5K14A 4IFVA 3KLHA 2VG5A 1NHUA 1RTIB 1C1BA 2IAJB 3UDLA 4RNHA 3PW0A 4LQ9A 1JLFA 4M94A 2CKWA 1LWFB 1TKTB 4ZPAA 1KHWA 3KK2A 1S1WA 1IKXB 2FVRA 4ZP7A 3DRPB 2HMIB 1ZETA 3H2LA 4MK7A 2AQ4A 2HNYB 3M8PB 1T03B 1TQLA 3HHKA 3V81A 2BRKA 4Q8EA 5C42B 1C2PA 1JKHA 4I7FB 2B5JA 4WFYA 1JLQA 1BQNB 5DQIA 3OL7A 5F8LA 2BE2B 1RT3A 2FJWA 2V0NA 3FDSA 2D41A 2AWZA 2UUTA 1LW0B 3BQ1A 4ZVEA 4Q43A 3CIZA 4NLSA 2UVUA 5KG0A 3QYYA 2VG6A 4QWDA 3DYAB 3OL8A 5I42B 4ECSA 4TQRA 2B6AA 4ECVA 1RT7A 1HQEB 4EO8A 4DL6A 4G1QA 4NLRA 5CYQA 3I0RB 3QGHA 3OL6A 4O3SA 3GYNA 3V6HA 3T1AA 4WFXA 3NGDA 5KFTA 1KLMA 1HNIB 1JIHA 4RNOA 1JXLA 4ZP8A 1OS5A 4RW7A 4RW4B 3DDKA 2FJVA 4J9QA 3MR2A 4O3OA 5KT7A 3IN5A 1UWBB 4B3OB 3QO9B 4IDKB 4Y2AA 3MEDB 4WZMA 5KFMA 4WZQA 1RTJB 3LP1B 3LP0B 1RT1B 4O4GA 1MMLA 4G1QB 4KHRA 4URSA 2OPPA 3D28A 1RT7B 2GIRA 3PJXA 4GC7A 3DRSB 2VG7A 3KLEB 3DOKB 5KFHA 2RKIB 3QGGA 1ZTWA 5L1JA 2ASLA 1QE1B 1REVA 2YKNA 4NLDA 5F8HA 4RNMA 3Q8QB 4Q0BB 2F8EX 4NRUA 3NAIA 1RT3B 1HQUA 4NLTA 5T14A 1IKWA 3PW2A 2BE2A 2HWIA 1RTDA 3RAQA 2C28A 1TKXA 1JLQB 1XR6A 2IM0A 1JLCA 3MR6A 1JKHB 3T5KA 3MFHA 2RF2A 2HNYA 1T03A 3KLGB 3OLAA 3QLHA 5KG3A 1YVFA 4O4RA 4MKAA 4Y34A 3MR3A 2C2DA 2WHOA 3MR5A 1RT6B 1JLFB 3G86A 3DOLB 2R2TA 1C1BB 1RT2B 4ZVHA 2HNZA 5J2MA 4RUCA 3EPGA 3MFIA 4ID5A 2D3UA 4RNFA 3KHHA 3DM2B 2O5DA 3KJVA 2FVQA 3VQSA 3HVTA 3ICLA 2BRLA 4KFBB 1ZTTA 3DM2A 2IC3B 1EETB 4ZMMA 2D3ZA 5F9LA 4J9PA 4NLWA 1FKOA 3MF5A 5J2MB 3MEEB 1DTQB 3KLFA 4ECWA 3PJWA 2JLEA 4ZHRA 5F8JA 3IS9B 1RT6A 3EZUA 5KFBA 3ITHA 2E9TA 1D1UA 3DRRB 4LSNA 5DQGA 1C0UB 4Y2CA 5KFCA 3CVKA 3MEGA 5FDLB 3T19A 5KFEA 2W8KA 4RW6B 3TQ1A 2AGQA 4J9NA 4ZP6A 2R8GA 3QIPB 4K50A 4I2QA 3KLGA 1SUQB 4ED3A 4ZPDA 4ED7A 2RF2B 4Q45A 3MECB 2ILYA 4ZVGA 3I0SA 2C2EA 4GC6A 3GV5B 5KFJA 2RDIA 2XWYA 4DEZA 1IKWB 3LP2A 4MK9A 1BQMB 1K1SA 5DLGA 1RT5A 4Q0BA 4DL7A 1LWCA 1REVB 2YKNB 5HLFA 2UVWA 1S1TB 4H4OB 2BQRA 4K4YA 4J9LA 2OPQB 2VG7B 1N6QA 2IM1A 2AX1A 1S1VA 1RT4A 4RW9A 1T05A 3LP0A 4O4GB 4MIAA 1RTJA 3LP1A 1C1CB 2YKMA 2B43A 1I6JA 1UWBA 3CJ2A 1DTTA 4KSEB 1HYSA 4NLYA 2ZD1B 4JV1A 5D3GB 4RW7B 2W8LA 2JEGA 2HNDA 1HMVB 3HVAA 5J2PA 2IM2A 2YNFA 1QAJA 1S9EB 2E9ZA 4RW8B 3Q8SB 5J2NB 3IGVA 4QWBA 4RU9A 3QZ7A 1HNVB 4YR3A 4WXWA 4M95A 4O3QA 5F8NA 5CYQB 3Q8PB 4KO0B 3TAMB 2CJQA 2JC1A 2W9CA 3BJYA 4ED0A 3SI8A 1HQEA 4DG1A 4NLPA 5I42A 3E51A 3V6JA 4O3RA 2VG6B 5KFVA 5KFXA 3H4BA 1HNVA 4HKQA 1RYRA 4IR1A 3HVWA 1SV5A 2YNFB 5KFZA 5DQHA 3PR5B 5J2PB 2HNDB 4IG3B 2XI3A 4FBUA 5EWGA 3LANA 2B5JB 1TV6A 2WONB 3FFIA 3V4IA 5F8MA 3C6UA 4IH5A 2YKMB 2JC0A 3BSCA 4RW9B 1TL3A 5KFQA 3KK2B 3KHGA 4DL5A 1LWFA 1TKTA 3CJ0A 3PW7A 2BQUA 3V4IB 3V6DA 1LWCB 1VRTA 2IMWP 1S9GA 4IH7A 5KT5A 1FKPA 1S10A 4Q44A 1VRUA 2FLLA 5KG6A 4K4WA 4IRDA 2R8KA 2OPSB 3I0SB 5C25B 2R2SA 1GX5A 1Z4UA 3GIIA 3KK1B 4JV0A 1SUQA 3QIPA 1S4FA 4F4ZA 1CSJA 4I2PA 1JLEA 4RW6A 4NLGA 4FS2A 4EO6A 1C0UA 3BREA 4LSNB 4QW8A 3ITHB 3DLEB 4IFYA 4TLRA 1NNDA 4ZHRB 2QE5A 1S6QB 1K1QA 5KFFA 1TL1B 3NL0A 1S0MA 4KKOB 2W9AA 1DLOB 3DLGB 1IKVB 4MH8A 2HWHA 1EETA 2IC3A 3NAHA 4TN2A 3Q8RB 5EUHA 4KFBA 4ICLA 1JLBA 4EBEA 2WOMA 2JEFA 3CJ5A 3GIJA 3T5HA 3UR0A 1N56A 4PQUB 4ID5B 1T3NA 3BSAA 1RT2A 1W25A 3PZPA 3M9NB 3DOLA 5C5JA 2FVSA 2XCAA 5L1KA 4J9MA 1KHVA 3IG1A 4O44A 1IKYA 3JYTB 4KHMA 4TY8A 2YNGB 1RDRA 4WE1B 3CDWA 2FLNA 5I3UA 3DMJA 3IGNA 4J9OA 4IH6A 4WXOA 4ICLB 5KFNA 3EPIA 4K4UA 1TKXB 4NRTA 3QZ8A 3GV8B 1RTDB 3PVXA 2I5JA 3GILA 3DLGA 4WYLA 5DGAA 1QAIA 5HROA 1SH0A 4RZRA 1HQUB 2BANB 3KK3A 2R2RA 4KBIA 3LAKA 5HBMA 5KFRA 3OSNA 3CDEA 4H54A 1MU2B 1S6QA 4WYWA 4O3PA 1JX4A 2R8JA 4NCGA 2RKIA 1S49A 3DOKA 2ALZA 3I5AA 4H4MB 2XGPA 3RB0A 4ZPBA 3KMQA 3DLKB 1T94A 3PW5A 2WTFA 2AU0A 1EP4B 1JLEB 4I2PB 1TKZB 4ECUA 3LALA 3M9OB 4IDKA 3QO9A 1RTHA 3FQLA 3CDUA 1S1XB 4F4WA 4NYZA 2JEIA 1IM4A 4TY9A 5KG1A 3G6VA 4RW4A 2ILZA 4ECYA 5CYMA 4TXSA 3LAMA 5DGBA 1HNIA 1HARA 1S9GB 1S48A 5KFOA 3N6MA 3PHEA 5DG9A 3BSNA 5DLFA 4ECRA 2JEJA 3M8QA 1XR7A 2W9BA 1TL3B 1D0EA 1LWEB 5KFIA 4X2BA 4ZPCA 3H5YA 2B6AB 5KT2A 3DYAA 3GIKA 5KG7A 4KB7A 1S6PA 3C6UB 4K4VA 5KT3A 2ASJA 1TV6B 1LW2B 2WONA 2FVCA 5HP1B 5EWEA 4YMEA 3OHBA 4ZVFA 2R2UA 2BR0A 4FBTA 1S9FA 2ZKUA 5HP1A 1RYSA 1SV5B 2GC8A 4Y3CA 5KT4A 4I7FA 2FLPA 4URGA 5C42A 4JUZA 3V81B 1XR5A 4ED1A 3M8PA 3H5SA 2IJFA 3DRPA 1LWEA 3GV7B 3I5BA 2W9CB 4DL4A 3M8QB 4DL2A 1S1WB 4IQXA 3BGRA 1TVRA 4IRCA 2QV6A 2W7OA 3NKYA 4RW8A 1S9EA 4ED8A 1S1UB 4NLQA 4TYAA 4IKAA 2VG5B 4IFVB 4ED2A 3C6TB 5D3GA 5K14B 3UQSA 3FQKA 1S0NA 2BQ3A 2VA3A 2ZD1A 4LSLA 1S1XA 3V6KA 4FS1A 1HPZB 4O3NA 5J2QB 5KFPA 4J9RA 4MIBA 1C1CA 2OPRB 4RUAA 2IA6A 2ZE2A 1T05B 1EP4A 5KT6A 1RT4B 1S1VB 4PWDA 3DLKA 3RBEA 4R8UA 3FRZA 2V9WA 1FK9B 4H4MA 3KHLA 2OPQA 2YNIB 3E01B 1N6QB 1R0AA 5HLFB 3KLIA 3OL9A 3PW4A 1RT5B 4G3IA 2BANA 3KK3B 3H5UA 3LP2B 4IOBA 5F8GA 3KMSA 4K4XA 4K4SA 3H4DA 2YNHB 4IG0A 3KLVA 2AGPA 4KV8B 4RNNA 4NLVA 3RB3A 5DG8A 1C0TA 2AX0A 3CJ3A 1JLAB 5F9NA 4IG0B 2YNHA 1JLGA 4I2QB 4ECXA 2UVVA 3CO9A 2YNGA 5FDLA 3MEGB 2XI2A 3JYTA 1IKYB 5KFYA 5KFDA 1R0AB 4TQSA 4O44B 3IG1B 4F50A 3DRRA 2ASDA 3BR9A 4EEYA 5C24B 3N6NA 2OH2A 4MFBB 2OPRA 3PR4A 3RAXA 2J6SA 1HPZA 4YR0A 2WOMB 4LSLB 3HVTB 1J5OB 3QIDA 3NBPB 3H98A 3C6TA 1DLOA 3T5LA 1S1UA 2HNZB 2E9RX 3JSMB 2UVRA 5KFAA 4QW9A 1N48A 1NHVA 3DLEA 1TVRB 3BGRB 1N5YB 3I5CA 2J6UA 4IRKA 4KE5A 3GIMA 2FVPA 3QLHB 4EBCA 2XC9A 3ISNC 3FSIA 3CWJA 3M9MB 4URQU 3UPFA 5C25A 2V4RA 1JLCB 4LQ3A 3NMAA 2XCPA 5J1EA 4U7CA 1VRUB 5EDWA 4U6PA 4XPEA 4F4XA 1FKPB 3T5JA 4HYKA 5DG7A 1VRTB 2I1RA 1SH3A 5L9XA 1LW2A 1QE1A 3V6DB 4YR2A 3BQ2A 3KNAA 1S0OA 1S6PB 4QWAA
chains in the Genus database with same CATH superfamily
3KLEA 2Z2LA 4NX9A 3TUJC 4NLUA 3DRSA 1YRUA 3W5ZA 3NWGA 3G6ES 3CCMS 1V3ZA 1WF1A 3MPVA 4CLUA 2MHNA 4WKRA 2IDEA 2WCXA 4HR2A 1CJVA 1IR2A 4B3OA 2F8HA 5CCLA 5E3AA 4Y2MA 1FD2A 1VBKA 2KJVA 5CZXA 2AJ0A 3GCWP 4FP9A 4F67A 1MW7A 2C2KB 2HHVA 3QFWA 4CNYA 3LGMA 4UT4A 5GAHU 4HL9A 1UFKA 2M52A 2V4QA 2BV3A 2N3OA 2KN4A 2OSQA 1OO0B 2CJKA 3IM9A 4OHVA 3SFGA 4C11B 1RTHB 2DGXA 4ECZA 4DFKA 2ZBPA 4CWBA 5KG5A 1HBMB 1EHWA 3FVYA 1TKZA 1FNOA 1TL4A 4RBVA 5EWFA 3UD4P 4KO0A 5KFGA 2ROGA 1ZAVA 1SJ3P 1IBMF 3HPOA 2VA2A 2J9CA 1R8BA 4DR6F 1B0TA 2BA9A 2WSEC 1IXKA 1GFWB 2DHXA 1X4DA 3CJRA 1F9EB 4I56A 3CPWR 3JSMA 5KG2A 2W7PA 3CTRA 1QTMA 5HROB 1N4LA 3OHAA 2CNOB 1BD6A 4WP9A 4OJGA 5CH7B 5HVFA 1NJIT 1J5OA 4PG8A 2EKNA 1UFWA 2B4OA 3DMJB 4IR9A 5SZTA 4X4RA 3H40A 1TFYA 3H5XA 3TW0A 2KDOA 1OY8A 3ZTRA 2HHSA 1KRPA 2DGTA 3P49B 5RUBA 1IKXA 3VZIA 3RBDA 1HA1A 5G0RA 4EMDA 4H4KC 3RG6A 3PJ9A 2PEBA 2WVEA 4PXBA 2VQFF 4P2MA 4F04B 3OQ2A 2EW9A 3NXZA 5JXSA 1RTIA 1BQMA 3IC1A 3N28A 3KLHB 2O3DA 1FXRA 2EVZA 1WJ9A 1YK9A 3W9IA 5LMUJ 4B9MA 4EYIB 2IM3A 3DHWC 4TYBA 4DWIA 1JLBB 4H4KA 3MECA 2H5IB 1IKVA 2Y8WA 1F9HA 1PO6A 4ELVA 2XLKA 1Q53A 4W98A 3PG9A 3WC2A 1UVKA 4JI2J 1HD1A 3VWSA 3NGSA 4OZ0A 4G1IA 1Q86T 3L09A 2AD9A 5CXTA 3RB4A 3CJSA 4IFYB 3RW7A 3E01A 2YNIA 2XZDB 2AV5A 1RBAA 2H4YB 2M2BA 2V94A 5DDPC 3DI6A 2P8IA 4NZ0A 4R8UB 4PWDB 1X5OA 4DS4A 4U8VA 5J1NA 2H51B 3GP9A 3OSPA 1VC6A 1FKOB 2ZE2B 2W2PP 5E5NA 3OTOJ 3CCWA 3RB6A 4C4WA 3PY8A 4PG7A 4WKYA 2ZH5A 2NREA 3KJVB 4XIUA 1RHJB 1GK8A 5K14A 1TAQA 1N8RT 4DXLA 3AOCA 2VG5A 1XN9A 2ZBIA 1PYTA 1JB0C 3HSJA 1C1BA 2IAJB 3UDLA 2BKOA 3DKDA 4LQ9A 1JLFA 4M94A 3FSXA 2Z57B 4S0MA 1ZM9A 1TKTB 4DQSA 3KK2A 4ZVSB 2FJEB 1HKAA 2HBZB 3QBCA 3CW2C 5F3ZA 1VJQA 4OFZA 2ZNZA 4MK7A 1X9WA 4JI3F 1TQLA 2V4JB 5E2QA 3K89A 3HZEA 1JKHA 2C3YA 3PRDA 2G0CA 4I68A 5ETOA 1NPKA 3GR1A 1ZM4A 1BQNB 1SKSA 2EFGA 4MKVA 2BQRA 3BV8A 1RAAB 2V0NA 5ETKA 5AE2A 4A8YA 3T1HJ 1Q5VA 5D8HB 4DS5A 3CIZA 1A7GE 4NLSA 2VOOA 3D54A 3BH7B 8AT1B 4QBUA 4ECSA 4TQRA 4DL0C 4YEAA 1HQEB 1O6XA 2QX0A 3HHLB 5FD1A 4EO8A 2IRXA 3I0RB 4OI3A 3D7SB 3PYFA 3U02A 1SKRA 2CWXA 4JOUA 3V6HA 3OXGA 1DRZA 4LF4J 2L3MA 3T1AA 1VIOA 1RP5A 2GHWA 1D09B 2Z2YB 3FZBA 3M1VB 3DRYA 4Q2LA 5B0EA 1KLMA 4RNOA 1H73A 1JNRB 2K3IA 4ZJOA 3IWXA 4RW7A 1WTFA 4J9QA 4DV4F 4GKJF 2ZOMA 3LQVA 1ELOA 1N88A 2IVYA 5ITHA 1UWBB 3DXSX 2IIHA 5LSOA 4IDKB 4P9SA 4Y2AA 5K8NA 1BE4A 4K8RA 1FRHA 1RTJB 3LP1B 3L7PA 3P5TL 4O4GA 1HHTP 3QJPA 1WEXA 3IR6B 3M7VA 3PJXA 2DR5A 2GIRA 4NCBA 2KYXA 1DZ5A 3GJQB 2E1AA 2QRRA 1L3UA 5L1JA 4F8RA 1Y4ZB 1QE1B 2MPUA 4NLDA 2H5EA 3A8JA 3Q8QB 4LF8J 4Q0BB 2F8EX 2VC0A 2QLWA 1HQUA 1QY7A 5T14A 4AFFA 5JVHQ 1DHMA 3PW2A 1HWJA 4M5DB 1RTDA 3SCKE 3RAQA 1VQPS 2JVOA 4HI1A 2WVCA 2C28A 2WB1D 4DSJA 4DV6J 2AMCB 2H48B 4QZVB 2XS2A 3GE9A 3OR1A 5AE1A 3BN7A 3MFHA 3UD5A 3OLAA 1SJFA 3LPYA 2MQOA 4CLPA 4ETZA 3BDEA 1BLUA 1RZMA 3KYLA 3DGPA 4O4RA 4RKUC 3THPA 5E3PA 1D3WA 3TJAA 4V19X 2X1FA 2C2DA 2LEBA 4EUVA 3G86A 2Y1IA 3W61A 2R2TA 1C1BB 1RT2B 2DXDA 3DFEA 5J2MA 1R6YA 3PCOB 3KHHA 1SL2A 3Q0AA 1QVGR 3DM2B 3ILLA 2KVQE 1T02A 3KJVA 3GJSB 3VQSA 4XDCA 1H38A 1ZTTA 3DM2A 4CLTA 1F9FA 1VIXA 4J9PA 3MF5A 1SKWA 4X65F 3KLFA 2OGUA 2V8GA 3PJWA 5F8JA 4NA2A 2ZDOA 3W5YA 1NPPA 2VU5A 3EZUA 4C0BA 1SQFA 2DHHA 4Y2CA 3TQ1A 2RH3A 3MEGA 5FDLB 3T19A 1VQYA 2FHKA 2OEMA 5KFEA 2R8GA 4J9NA 2VASA 4ZP6A 4I2QA 2DRAA 1SUQB 4ZPDA 3OR1B 1X5TA 3MECB 4Q45A 2ILYA 2C2OB 4B9NA 2B9EA 4DUZF 3I0SA 2HBRB 4NI2A 2C2EA 3FSYA 3R7BB 3BM7A 2PMHA 4YDDB 1FCAA 3CJTA 4M5DA 1S7IA 4USWA 4DR4J 1N5QA 1RCOB 1K1SA 4Y65A 1RT5A 4Q0BA 1LWCA 3D6HB 5HLFA 2UVWA 2HHWA 4H4OB 5A8RA 3ZTSA 3C14B 1N6QA 2G2OA 4A4JA 2MGZA 2GMLA 1RT4A 4RW9A 3UWTA 1T05A 1WI8A 2Q79A 2YKMA 2EFVA 2J8SA 3W7BA 3VGVA 1UWBA 3CJ2A 4KSEB 2JH3A 4NLYA 2ZD1B 1Y5LB 2JDJA 4JV1A 2B8PA 1H74A 1UZDA 2RRBA 1BMQB 4RW7B 1N54B 2A2CA 2VBWA 2YQ3A 3PTWA 4L75A 2W8LA 3CF5Q 5JVGQ 2LDIA 3TUIC 5J2PA 3THVA 2GFFA 2HQGA 1M5SA 4YS2A 1HNWJ 2E9ZA 2ZZNA 2UXBF 3Q23A 4Y2IA 4BS2A 3AOBA 1O5JA 2QFIA 2RQ4A 4WXWA 4M95A 4DCJB 2XO7A 4G65A 2PI5A 3TAMB 1EKSA 1FRLA 3IMQJ 2JWNA 5E41A 2HZAA 2XS5A 1HQEA 2RQMA 3HXMA 2OTJS 2XZWA 1SXLA 4FNHA 2VG6B 1RYRA 2RB7A 4HKQA 3R9LA 2P2CB 1F3FA 1FFWB 1LV5A 4IR1A 1EQMA 2YNFB 2FQQB 3PR5B 4CQ1A 1WEYA 2KXFA 3OTEA 3BO4A 3BS9A 2VBYA 3LANA 4OYPA 1YZ6A 3PEJA 2CAJA 2CQ0A 2VODA 4IH5A 2YQ1A 3LPEA 3ZNUA 2E1CA 3QRRA 1AB8A 2ROEA 2PE8A 3PACA 4JV5J 1T9TA 4U7UD 3W8GA 1PAEX 3KHGA 4LF7J 3AJ1A 3F44A 3MD1A 1TKTA 2FZKB 3KUGA 4DL5A 1YTYA 3CD7A 4ZVPB 1SJRA 3NCRA 3PW7A 2HW3A 2YQ0A 1VRTA 3POTB 8ATCB 1YJWS 2AF6A 4F7VA 4JP8A 2RSQA 4FYDA 3HCXA 5HAOA 4K4WA 4B9VA 4IRDA 4N8OA 3D0GE 2OPSB 2HVDA 2A6OA 3DLLQ 1S77D 3BGOP 2R2SA 1RJJA 1WC6A 2QLBB 3GIIA 1KVJA 3CEDA 4M5LA 3TZZA 1YBUA 2HHHF 3Q8YA 1GT8A 4NLGA 1BWEA 1JLEA 4RW6A 1LXNA 1N5VA 1Q8LA 4NXNF 2N4CA 3I4HX 1PG5B 5B08A 2FGCA 1IWGA 1S59A 3JSRA 5B09A 2JSXA 3DLEB 1WD6A 1WDDA 4ED5A 1NNDA 1IJFB 3H90A 4NZ6A 3OR2B 2AJ1A 2GCFA 3X3UA 1XMOF 2KXNB 1P27B 4UUXA 1VC5A 4KKOB 4PCQA 1C4AA 2PFDA 3C15A 3EVWA 1IKVB 2CWKA 2HWHA 3WIUA 2PA3A 1FDNA 1U0HA 4F0KA 3FMBA 5HQMA 3QRQA 3K5LA 1JLBA 2W01A 1KP6A 1HHSA 5AT1B 3CJ5A 3VAIA 3MMBA 3T5HA 1FRJA 1HNZF 5IQ6A 1LXJA 2LKZA 1NJYA 1Q0NA 4QIFA 2CQIA 5BYSA 4LIRA 1T11A 2VZ9A 3ZZOA 3A3PB 1KHVA 2PC6A 3UDEA 1IKYA 1H0HB 4M8LA 5B7WA 2ZUGA 1EX8A 5GAEU 2LA6A 3UDVA 2DBBA 3IGNA 4DX5A 2ZJRQ 4J9OA 4OI0A 2BEFA 2FLOA 4WXOA 3EPIA 1DAXA 1UAWA 4LBPA 5IS2A 3GILA 4WYLA 1RTZA 1TK0A 1QAIA 2CG8A 5D0GA 3PX4A 3FC9A 2HWTA 1B7YB 4KBIA 4C0HA 3C19A 1ZZNA 3CDEA 4H54A 4WYWA 3OR2A 4O3PA 1CG2A 3L3CA 2R8JA 2JRSA 4LF9F 2BBEA 4PPDA 4DQPA 4X2BA 2JVRA 2XGPA 2DK2A 4DSIA 1TK5A 1SQGA 2XMUA 3RB0A 4PXEA 2C1EB 3PKYA 3PW5A 4J90A 3C16A 4OV6A 5CD4H 1JLEB 3T3FA 1TKZB 2O67A 2RVJA 3HULA 2AEMA 2HS0A 2KO1A 2GA7A 2NXCA 4LF2A 4IO9Q 4C8MA 2MKHA 1RTHA 1NDKA 4F4WA 3CDUA 3GJTB 4JI5J 5SUHA 4TY9A 2K3KA 1X4FA 3C3LA 1YBTA 4ANEA 1IJEB 2XS7A 3H42A 1S48A 3UO0A 4U67Q 3ZZUA 5KFOA 3HHEA 5HATA 4DF4A 4LREA 3FCHA 1IBLF 1SC3B 3MCMA 2ZOGA 3T9NA 2HPUA 1LFWA 3M8QA 2G13A 3A12A 1TL3B 4AQYJ 1L3SA 1LWEB 1XNQF 3ZXWA 4ZPCA 5C2CA 3H5YA 3A13A 2B6AB 3KDNA 4OLOA 5LMNJ 5LJ5Y 4NCAA 1U1MA 2X3DA 1UP1A 1HNXJ 4K4VA 3J80U 5KT3A 1FKAF 4X84A 3J7AN 1GEHA 3WX8A 2F5GA 5HP1B 2MZSA 2X7IA 4YMEA 4YUDA 2Y3YA 2ZVIA 3KJQB 3NG8A 2IVFB 1R27B 1SQEA 2GMHA 2ZUAA 2BR0A 2ZKUA 5HP1A 1RACB 2OEKA 1SV5B 1GXLA 5KT4A 1RYSA 1T3OA 2FUG9 2MHEA 1CLFA 2DEIA 2BW7A 4NXNJ 1BWVA 1MWZA 1XR5A 3M8PA 1OQ6A 3DGVA 2XTJP 4CDIA 2OFGX 3I5BA 3K17A 1S0VA 3M8QB 1IUJA 1WACA 2AYMA 4DL2A 3NOGA 3IWNC 4CO0A 1TVRA 2V2ZA 3G4SS 4R25A 3OBIA 3NKYA 1PJ5A 4PXCA 4UY85 3MCSA 4WP3A 1S1UB 2CPXA 1FERA 4NLQA 3VTIA 2CJ9A 2V2QA 2X1GA 4IFVB 2AGPA 5D3GA 2RS8A 2R7QA 3UQSA 1N36F 4M5KA 2VA3A 5CYJA 4JBCA 4CCHA 2ZD1A 4JI8F 1RKJA 3PEHA 2Q6BA 1VJWA 1U2CA 1X4AA 3K5NA 1NRKA 5KFPA 1PBAA 1LWXA 2LYVA 1RAFB 2DNZA 1F6TA 5IC6B 3PYEA 3ZC4A 2DCLA 1T05B 2BM1A 1ZA1B 4LFAJ 4RU2A 5GAEI 3G9CA 3DLKA 1JNZB 3D3BJ 1FK9B 1PYOB 3BKUA 1U1NA 3S8SA 4KGKA 1VDHA 3N0VA 4ZVTB 3PHTA 3ZTOA 5HLFB 3KLIA 2V8DA 2BX6A 4LT6A 1RT5B 3PW4A 2DR8A 2KHCA 1TZ0A 4K4XA 1X4GA 3QRPA 4KV8B 2HFZA 3NS7B 3DDNA 4RR5A 2EC2A 5K8PA 3H2UB 3EMTA 3J7ZT 5H9FK 5ADZA 2AX0A 2EFOA 2GJ2A 5F9NA 4IG0B 4DR1J 1JLGA 4OZ3A 4KTQA 4UQGA 4I2QB 1HI8A 2DNRA 3M2RA 2AKWB 3P3DA 1ZYQA 4DF8A 4OI6A 5FDLA 3MEGB 3GFXA 4TQSA 1IKYB 4F50A 3T1HF 2XNRA 3DRRA 4ZIWA 4K7QA 1J5EJ 1OQ3A 5CCMA 1MN7A 4ELTA 1VQLS 2KRRA 4Y00A 1JJCB 3FEZA 3K57A 1FE0A 3CE8A 4NA1A 2V2VA 3VGSA 4C3LA 4DDFA 4N41A 3OJSA 1AFIA 2Z58B 3VAFA 4LSLB 3NBPB 1UWAA 4ZPWR 1UVJA 1U0HB 2ZBRA 3G2XA 4CH0S 2BUNA 3WHIA 3R2DJ 2FJBB 1NUEA 3FEXB 2WSCC 2E9RX 5KFAA 2VBXA 2VFRA 3CMQA 1SJ4P 3H8YA 2QG9B 5E3QA 1S0MA 2MEWA 3RRHA 3M8ZA 2F7VA 2HSEB 3DGPB 3T6JA 2J6UA 1NH8A 1CQNA 3NEKA 1FFSB 1FNXH 3ISNC 3FSIA 3BPDA 1IBKF 4CNZA 4ZVQB 3EYZA 2CJXB 2YWEA 4OIXA 4CO3A 4LQ3A 1JLCB 4RX6A 2BJDA 2WVBA 1WKJA 1HR0F 3NMAA 2XCPA 2ZFHA 2AP6A 2OIHA 2DR7A 1VRUB 2W4CA 2BVZA 4U6PA 2UUCF 1U0SA 2LQ8A 3H20A 2L08A 1VRTB 2I1RA 2MKSA 3POTA 5L9XA 1QE1A 1VHFA 4ECQA 1Q78A 6FDRA 5L39A 3VAGA 4K4TA 3P45B 2HFOA 2GVDB 3ISND 4DFPA 1L3TA 1WC3A 1QUVA 3N6LA 5D77A 3SFUA 4YP3A 2A6MA 3TJ9A 3ILIA 4BC9A 4AD6A 2GAHC 2WBMA 3TEGA 3BH6B 9ATCB 1VBZA 3JB9k 3OV7A 3I32A 2MKYA 3O6QA 3VAJA 3GWCA 1U2FA 4KIAA 4DL3A 4DR6J 5EX3A 2GGPA 2HRYA 3CCES 4DV1F 4FF4A 2R42A 3MTKA 4ETXA 4USVA 4UQTA 3R1HA 4P71A 1UJ4A 2G1HA 2HQIA 1RABB 3SZ2A 4AT1B 2BABA 1K44A 4F2RA 4DSKA 3I0RA 2FC9A 2NXEA 3MTJA 5DM7Q 3H25A 2R8IA 2C3UA 1KQKA 2MLYA 4DR4F 1WHWA 3TAMA 4WP8A 4DV1J 4WWSA 3NLCA 4QWCA 3C46A 1N5YA 1ZPVA 4P2FA 2BZ2A 2CFXA 5T7LA 1XBWA 4NCGB 1Q1KA 1RHQB 1WF0A 4LBHA 1MU2A 2IYIA 3RTVA 2ZBQA 2DJWA 4QWEA 1HWKA 3N79A 1PKUA 1JXEA 5IFMA 2DPJA 2YWHA 4JYAF 2Q43A 1WWHA 1BQNA 5KFUA 1HYSB 2WK4A 1TTHB 1B0VA 1GNKA 5I3UB 3K2YA 1RGVA 2GMJA 4CM0A 5JMNA 2UU9J 4WE1A 4K4ZA 4GKKJ 1U47A 1AROP 4A48A 1RA6A 5THWA 2KFZA 3M2VA 1MG7A 1N5SA 2G1DA 2HEKA 2LXUA 2H4WB 4NPOA 1XMQF 4OYIA 4DV2F 3QATA 5LMUF 4H4OA 1ROFA 3CB4A 3G87A 5A8RB 1EQ0A 2IAJA 2IHR1 4DPTA 1U26A 2JNJA 3EVOA 3QT8A 4LRCA 5A0YB 2ZH2A 5L1IA 4PQUA 4PG5A 5HJYA 4JV2A 5CQGA 1R89A 3MUMP 3I55S 4C8OA 4R5PB 4QIWD 1DBDA 1IQZA 4I6WA 2M7SA 5AE3A 2HK3A 4EZ6A 2GVZA 3GLJA 1RHMB 3LTOA 4AXJA 5LXYA 3HO1A 4OZ5A 5K9FA 4DJBA 5A8WB 3LWMA 2KG0A 3KWMA 4YQWA 1K9MT 1JJHA 2IBKA 3FKBA 4LFBF 4NXMJ 2YXLA 2D7SA 2XEXA 3ENAA 1UVNA 3IS9A 2J7KA 3MUVP 3Q89A 3LH2S 3KLFB 1S6UA 3MEEA 1SH2A 1FVQA 2W2NP 3V5RA 4ES3A 4ERDA 4L73A 4QPXA 4DSLA 3G8TA 2FZGB 1IM6A 5IZHA 5KTQA 5KFWA 2W1BA 2VDIA 2A0FB 1S7HA 3U27A 1UMJA 4R5PA 2WB4A 2NCKL 2FJXA 2I0XA 3A3NB 4DOZA 2BDPA 3RW6A 2LECA 3B82A 2AYEA 2VICA 1NHUA 3ONQA 1MMNA 4CTAA 1VYAA 2DISA 1LWFB 2CDRB 3AA9A 5H9EJ 2OD4A 1IKXB 2BOAA 1A0OB 2QIFA 2BJ3A 2DGWA 2RU3A 3QT6A 2UXDF 2XYGB 1FA0A 1T03B 2ZVSA 4ZK7M 2AQ4A 3V81A 2C3OA 1C2PA 4I7FB 3LA0A 4LF4F 2B5JA 2P6TA 1KR4A 4WFYA 3H2VE 2YWWA 4NMLA 3MM6A 3LWLA 5F8LA 3R6GB 1EIYB 1NBEB 5IQQA 1F5AA 1VHIA 2A18A 4DR3J 2OTLS 3BQ1A 2F63A 2JX2A 4CLWA 4L76A 2G2ZA 3JSYA 5KG0A 1VQNS 1RHKB 2QSWA 1TMJA 3HLUA 5ETQA 4DL6A 3GYXB 3OFHA 1CPZA 4L74A 5IOLA 4NLRA 1YJRA 2KYZA 5B0CA 2P9GA 1HBMA 3GFHA 3OL6A 4AL7A 3QJLA 1RU2A 1ZBTA 4C11A 1IBKJ 2MKJA 2L9NA 2DH8A 4UZCA 3US5A 4EGLA 3NGDA 1JJ2R 5K20B 1RU1A 3HD1A 1NDLA 1OS5A 2D9PA 1XTZA 1VQKS 4TU8A 3DDKA 2FJVA 1U1PA 2MDAA 5CAAA 3JQKA 4ZDNA 4O3OA 3IN5A 1TL7A 4B3OB 3NGTA 3ULHA 2MB0B 3N9UC 3W3SA 4WZQA 3D68A 1FT8A 2YWGA 2NUUG 4KHRA 3HKZD 2E44A 1RHUB 3HI9A 1C4CA 1Y10A 1U1KA 2RHQB 1DQ8A 1QD1A 1SC1B 2CPJA 1ZTWA 3HSDA 3I87A 3E8OA 5D4LA 2YKNA 4RNMA 1ZOTA 2B51A 5F8HA 3I56S 4QR0A 2Y8YA 4Y2KA 2FJAB 5DDQC 5LMNF 1U8SA 1G4CA 3HHLC 1MNEA 1TKXA 2GNKA 2GQQA 4WIQA 1JLCA 3MR6A 2I38A 6FD1A 3EGZA 1JKHB 3T5KA 3CNQP 4B3MJ 4DSFA 2RMLA 2DY1A 4HEA9 2HNYA 4JI2F 3JTPA 3ZZ0A 4XAKA 2FHMA 1U6FA 3HM9A 5KG3A 1YVFA 1LOUA 2QLXA 2UP1A 3ILOA 2VKZG 1HHQA 4Y34A 2HS4A 2N82B 4ZLJA 2WHOA 3MR5A 1JLFB 4CI0B 3DOLB 3RZAA 3UVJB 2R7TA 1I5OB 4CLLA 2CG4A 5A8KA 2U1AA 3ZO7A 4RUCA 1K0TA 1F3VA 2HK2A 4ID5A 2D3UA 4C8NA 4C97A 1FF2A 4RNFA 3NY0A 4PAAA 3MFIA 3ENQA 4DV2J 4QYZK 2CQHA 1MMDA 1FTCA 2FVQA 2VQFJ 3HVTA 2HQDA 1EETB 1U1QA 3B8HA 5DS7A 4B9SA 1IR0A 4LFAF 4OZ2A 4A8KA 4K0KF 2RRNA 1FKOA 3M2UB 2BKPA 4KH0B 3VR1A 1U1OA 4OI2A 3CDBA 4JI4F 2JLEA 4ZHRA 1S79A 1T9UA 1RT6A 3C66A 2UV8A 4QIGA 4USMA 5AXNA 3ITHA 1NSPA 1I94F 3DRRB 4LSNA 3ZTPA 1SB6A 3OTBA 5DQGA 2K8GA 3S1TA 5DDRC 3CVKA 4ANCA 4G3IA 3WZ0A 3QIPB 3NRBA 1WHYA 3KLGA 1X4CA 2R3VA 2Z4PA 3A8KA 3CJ8A 2RF2B 1HQ2A 4LIWA 1M1HA 2XSFA 2UUAF 4ZVGA 3L7OA 3MOJB 4L6V3 3Q8VA 3H0PA 5KFJA 2RDIA 4OMFG 3AAWB 1IKWB 3LP2A 3F0NA 1BQMB 5DLGA 1SKUB 1G6BA 4DL7A 1Y9OA 2AEFA 2E66A 3QPIA 4A8WA 4YN3B 3TX8A 2RRAA 4J9LA 2VG7B 3K0JA 1WSRA 1E6YA 2CQDA 2DNGA 1BGXT 2PT0A 3LP0A 2L48A 2WSFC 4MIAA 2EXUA 4PG4A 4A8SA 3ILJA 1Z2LA 2B43A 1H2UX 4PRFA 4J9UE 3J80Y 2F1FA 2DGSA 3FJ2A 5EX0A 4F3MA 2DY9A 5D3GB 2BJEA 2NXJA 3HVAA 3HSGA 1WELA 1RWOB 3M8YA 5CABA 3OUYA 3VAMA 3C2PA 5J2NB 3IGVA 3R5AA 4KT0C 4QWBA 1RK8A 3VVUA 4YR3A 2BJ7A 1DFDA 2CPZA 2ZM6J 1MROA 3HFZB 5CYQB 5F8NA 3TYTA 1R6VA 4KO0B 4ED0A 2W9CA 3BJYA 2QYCA 5I42A 5HSPA 1MROB 1FWPA 2EBGA 5KFVA 4RJVA 2ZJQQ 1HNVA 1WORA 1X4EA 1XQIA 1AYEA 2MSSA 2Q6CA 2ERRA 1YI2S 1VBYA 1APSA 4F26A 3BZQA 1SV5A 4OX6A 3ENWA 1RKIA 1YQHA 3F73A 4UW2A 4ID8A 4Y6IA 3TO8A 3CD5A 4EK2A 1RAEB 4DLGA 1TV6A 2WONB 3FFIA 1GMWD 1H6KX 5F8MA 3C6UA 2HAFA 2ACMA 1FJGJ 3D3CJ 2A2DA 3IA0A 4NASA 1Q7YT 3ISZA 3MMCB 3AH6A 5I3PA 1TL3A 4YDXA 4LR7A 2IPOB 3KG4A 1V9OA 2YKPA 4QR2A 2R9LA 5L46A 2BQUA 5D0EA 1IR1A 1WOOA 4QIEA 1NAQA 3PNIA 4Q44A 3IXQA 1Z1ZA 2OSRA 1KTQA 4HHHA 1DARA 2ZH3A 3MEKA 1X4BA 2CPIA 2FLLA 1U6BA 2C42A 3BPSP 4N5SA 4B3TF 1N32J 4K59A 4CLZA 5C25B 3NGRA 1NK8A 1GX5A 1Z4UA 1AZSA 3KK1B 1FVSA 3AD9C 4USTA 4JV0A 3UNYA 2AYGA 3QIPA 4F4ZA 1Q8KA 3LGNA 4X4QA 1P1LA 1ZPWX 1URRA 3B54A 3UE2A 1WUUA 4XTTA 2HVEA 5CZVA 4QW8A 3GIRA 1S99A 4L72B 4A8OA 4CT8A 4JI0J 2HHUA 2G0JA 2FTRA 5KFFA 2PMWA 1F60B 3NCQA 4OYAA 1U48A 2RILA 4WU2A 1PAUB 3M2UA 2E5LF 3NL0A 2COLA 2FB0A 1DLOB 2ZC4A 4TN2A 1SCJB 1EETA 1PC5A 4PXDA 1NCLA 2WOMA 1PC4A 4GRSA 3AFGA 2P6SA 2VC1A 3GIJA 4ZIVA 1N56A 2ZH4A 1UKUA 3IBFB 4ID5B 1FWKA 3AJ2A 2J76E 2YKAA 3G82B 1QAXA 4DV5F 1W25A 1MSWD 3ETOA 3DOLA 1KQFB 1UETA 3UVJA 2ATCB 2FVSA 4TU7A 4J9MA 1NJWA 4X4OA 2MQLA 2Z2ZA 4TVAB 2O66A 2YPYA 4EU0A 4KHMA 3ZTQA 2KVIA 3VZHA 4GMKA 1RDRA 3CDWA 2UVRA 2FLNA 2AZ3A 4L3KA 1XWLA 3N4WA 4UOFA 4ZLLA 3V2UC 3MMBB 5KOXA 3MHYA 5ETNA 1XMOJ 2F4VF 1B0PA 4X4VA 3OVAA 1YDLA 1NKEA 1AXQA 1I51B 1RWMB 3P4UB 4I6YA 4ES1A 3GV8B 4ZCLA 3DLGA 1KKHA 2VPWB 2W9BA 3AXKA 3D0IE 3OFGA 3LAKA 5KFRA 3R5JB 2K7JA 4DQQA 4K0KJ 1KTVA 4ZPVR 2CPYA 1QAYA 1U7LA 2HZVA 2RKIA 1RE1B 2ALZA 1TR0A 4H4MB 2MLZA 3OW2R 3KMQA 4Z7YA 3LF0A 4OHWA 2AU0A 3O3LA 1UEUA 2BACA 4UZBA 5GAHI 1YWXA 1HI1A 4ECUA 4CO2A 3M9OB 4LBIA 1SJ1A 1WOSA 2HHXA 3CCRS 1G7CB 2UXDJ 4K5RA 1HLWA 1S1XB 4NYZA 1DJ0A 4C98A 1S5ZA 4PPZA 1NJXA 4FNIA 4RW4A 4ECYA 1VCTA 3BKTA 1VQ6S 2I2YA 4CYUB 3OVBA 2W2OP 5CYMA 3LAMA 1T9XA 1HNIA 3TJ8A 2WBRA 4P7TA 3TEHB 1IBLJ 2ZWPA 2UU9F 3OPKA 4RLEA 2D69A 5DRKA 2BYCA 4LRBA 4WTOB 2VV5A 3PHEA 4FYWB 2JEJA 2QZ8A 4A46A 4IQMA 3VGTA 4OI1A 2Y1JA 2PIIA 2JL9A 1HBNB 2YKOA 5KT2A 3DYAA 1H2TZ 2IFXA 3GIKA 3C8YA 3Q2TC 4LVOP 5AJ3J 3CIMA 1LW2B 4CP5A 4HT5A 3OFFA 2K06A 5E3RA 5E7OB 1WHXA 5G4DA 3T9ZA 1I94J 4AL5A 4DCPB 2ZH9A 1S9FA 3TAPA 4P52A 1VQOS 1ZH5A 4FZVA 2Y0SD 2FLPA 5C42A 4JUZA 3V81B 1WF2A 4J5OA 4C48A 4ED1A 3H5SA 5BJRA 1FI4A 1WTBA 1T8EA 1URNA 3D9BA 3SYZA 1T7PA 4R0JA 1A9NB 4KHPJ 2YX7A 2RAQA 3WC0A 1DQAA 2NYHA 3BGRA 3SBMA 4IRCA 2PSZA 2QV6A 2XMVA 4V19J 1B64A 5GAGU 5BXIA 4P74A 4LMZA 3ET6A 2CQ4A 2H54B 1RLCL 2HBYB 4ED8A 4DR2J 1SIZA 2OKQA 4IKAA 3NNCA 1WHVA 4ZN1A 3HJFA 3C6TB 2C3MA 1SBRA 3FQKA 1N5TA 1S0NA 3Q86A 3V6KA 5DM6Q 1HPZB 5E3CA 3M6UA 5J2QB 4J9RA 4M63A 3CD0A 4ZVRB 4RUAA 1U45A 2W4PA 3G8SA 2DGQA 2PA8D 2NZCA 4I1TA 3MM7B 3J7YI 1RT4B 1UPPA 4OHXA 2MKIA 2MGZB 1TAUA 3FRZA 3CXCR 4PG6A 1NK6A 4FVMA 1N6QB 1WOPA 4DV4J 4GKJJ 2XULA 3MM9A 5FIIA 1QJHA 1S6OA 1M5VC 2SXLA 3OL9A 3GSIA 4WF9Q 2B7BB 1RWVB 2BANA 3KK3B 3H5UA 4HHJA 1OJ4A 2ASYA 2NXNA 1IBMJ 3CMES 3H4DA 2LEAA 2B4UA 1CJKB 2GVZB 2QN6B 3CJQA 3JTOA 3NWRA 4YB6A 4ZCIA 3IWLA 2I9SA 4RNNA 2VDHA 1C0TA 1X7VA 2HQFA 3PFOA 1YBAA 1JLAB 2YNHA 2XMWA 3DOMA 4ECXA 2UVVA 2OAUA 3PXGa 3LOUA 3CO9A 4CLKA 2XI2A 2LU2A 5KFYA 3JYTA 2KB2A 4RBTA 4CH1A 1R0AB 4DLEA 3IG1B 1JJ4A 1PIEA 2ASDA 3DLJA 1UJ5A 2CPEA 2ABYA 5H9FJ 2OH2A 5GVQA 4MFBB 2OPRA 2CXEA 3OVSA 4M1KA 1KQGB 3EE3A 2ZKTA 1NK0A 2E5GA 2V9KA 3AB2B 3AHPA 2KKHA 1VK8A 3C6TA 3OJUA 2J9EA 3IFEA 4NYPA 2JHEA 2RUGA 4CO4A 2PD1A 4LRAA 4ZCMA 1RHRB 3UCUP 5BR8F 1N48A 3OTCA 5A6PA 2K1RB 2CQPA 1AUDA 2UUCJ 2UXCF 2GJFA 2R7SA 2E1RA 1N5YB 2J0QD 3DCAA 2R7XA 3GIMA 1JK9B 4FPRA 2FVPA 3UN3A 3JS9A 2CNKB 1BUXA 1VC0A 1NEEA 2E29A 3VVTA 3UPFA 5LJ3Y 2MQQA 2V4RA 5B0FA 4F3OA 1IVZA 4ZITA 4OQJA 2GJIA 5J1EA 1U24A 2C3PA 4ZLNA 2A1BA 2HHPA 4U7CA 1F1BB 2XLIA 3T5JA 2W2MP 3EJMA 3D0HE 4KRWA 4WBFA 3SCIE 1SH3A 1YRXA 2DO0A 3HKWA 3V4IA 3V6DB 3OD2A 4YR2A 3CULA 5ETVA 2B4VA 1S6PB 1IN0A 2FIUA 4X65J 1RAJA 2HVZA 4F3QA 5A2QY 2XMAA 5DZ6A 2EC0A 4J7CA 1YLXA 1FJEB 4XPCA 4UOCA 3HX9A 3MWBA 4M5IA 3UNGC 1RT1A 2CZ9A 3QGIA 5KAKA 4DR2F 4F4YA 4ITSA 3MMJA 3MOZA 4N77A 4QU6A 3L95X 2ALYB 3MXHP 3FK4A 4W90B 1HWLA 3R7SB 1GMVA 3QFHA 2H5JB 1FXDA 2Q3PA 3GQCA 5J1EB 4NEYA 1U09A 2OFHX 1NK9A 1KLMB 1YJTA 2D3O1 3M1VA 3G8QA 4B9TA 2AT1B 4DR1F 2LCWA 2YBVA 5DO2A 3VGUA 4OLPA 1RA7A 2H3EB 5L38A 2QLFB 3AD8C 4EBDA 5HI7A 4DG1B 1HW8A 3HJVA 1IBCB 3ENVA 3DU5A 2GO9A 5KFLA 3BEGB 3HHLA 4FF3A 3KTQA 3RRGA 2UUWA 1NZAA 2C2ZB 4XO0A 2RDJA 2AGOA 3D6MB 4OJ3A 3VALA 3KOAA 4JYAJ 3R7NB 1LW0A 2CPFA 2B9XA 2HRTA 1H7WA 5HBMB 3BN4A 2XLJA 4PYAA 1UW4A 4DQIA 2C2RA 3VAHA 2I5JB 1VQ7S 2DPIA 4P72A 2QTWA 3NBPA 2R7RA 3PKMA 4MK8A 2R8HA 4C0OC 2R7VA 1QUPA 4Q2MA 2ZBCA 2V4JA 3OFEA 5KG4A 4Y28C 1M5HA 1ZZFA 4MFBA 3VCDA 1YHQS 2YTCA 1OYDA 2ZNYA 2FHJD 3LW5C 4TY8B 2BW2A 4HVZA 2DGVA 2PN6A 3W2WA 4KC5A 4ZVUB 3QJJA 3B4DA 3M6WA 5F41A 1S1TA 1GTEA 2DVIA 1NHKL 4LR9A 3R6LB 1XNRF 2EI5A 2WRMA 1FJ7A 2B8QA 4UTGA 4EZ9A 4KPYA 3BBFA 3DOMB 4J9KA 1JLAA 3OLBA 4C2MA 1WC5A 1C0TB 1HBOB 2NPFA 4UF4A 2VUGA 2J0SD 3IRXA 4J91A 1CJKA 1LQ9A 5KFSA 2LQBA 4GO5X 2QA2A 4WFZA 2KM8B 3M6XA 4ECTA 3DN9A 4CH7A 2ZWOA 1TL1A 4PUOB 3KLIB 3AD7C 2FHOB 4HDGA 2QA4G 1ZA2B 4C3MA 1PYSB 3CC4S 1JWWA 3DI6B 4FXWA 3ZZRA 3G6XA 4NLXA 3D6FB 3IP0A 3A3OB 1WNEA 1S97A 1R8PA 1ZM2A 4R0EA 1WKKA 1DTQA 3TZWA 4DUYJ 3EICA 1RWNB 3DRXA 1GTHA 4CZCA 3MM5B 4DV0F 5J2QA 4U8YA 1KEKA 4IUFA 3SXLA 3GTYX 1FWLA 2AHOB 4ZA1A 4CRJA 3IAM9 5A2QU 4MJKA 1NKBA 1BC6A 2FPHX 3RYLA 1W2IA 2HLUA 3TARA 3CCUS 5I4MA 4RPFA 3KLHA 1RTIB 4RNHA 2UZAA 1RAHB 2CKWA 1HR0J 1KHWA 1RLDA 2X3GA 1NH7A 3O1LA 4MTPA 2MY8A 4NMXA 1FRMA 3NOCA 1RBLA 2HS3A 5HK4A 5A6WA 2ZC3A 5EGYA 4GKKF 1ZETA 3MMCA 3M8PB 3HHKA 4HH1A 4C7QA 3BO2A 2BRKA 3J7Z5 5C42B 4N56A 5GADU 4B3RJ 1W7WA 1Q79A 2MTLA 2VFUA 1JLQA 3SMZA 2DHAA 4CLYA 2IDLA 2VL1A 4X4UA 4OX9F 2FZCB 5HVHA 3OL7A 3JQMA 2DR6A 2X51A 4FKYA 3FEYB 1RT3A 2FJWA 1J2VA 3FDSA 2BXJA 3GG1A 2D41A 2AWZA 3PIOQ 1S72S 2HHHJ 4ZVEA 8RUCA 3QYYA 1T9YA 2MJUA 3DYAB 4F2SA 4ECVA 5I42B 2LP4A 3RR8A 1RT7A 1TK8A 3M05A 4CO1A 4G1QA 2IYGA 1SL0A 3D6TB 3QGHA 2N3LA 3TA2A 4YHHJ 4O3SA 3W2VB 3GYNA 2R7WA 3K5PA 1YJNS 4B3RF 2WW4A 3HF5A 2HVHA 4USJC 1MWQA 1VGYA 4WFXA 5KFTA 4U95A 3EDQB 3OUYB 1HNIB 1CJTA 1JIHA 1JXLA 4ZP8A 2NQPA 1UEVA 2GQ2A 4CYUA 2XY6A 3RBXA 4E8UA 4RW4B 1CJTB 3M6VA 4RWWA 2KT5A 4UOHA 6AT1B 5KT7A 1TELA 5BR8J 1TUVA 1OPIA 3MEDB 1Q7LB 5KFMA 3PO4A 4B3SJ 1D8ZA 2PFFB 3SCJE 3LP0B 2F40A 1MMLA 4LF5J 5F0UA 1M1KT 2MJNA 2HG4A 2NYIA 1RT7B 3ADAC 1E6YB 3DRSB 3V4MA 1X9MA 2DRBA 3KLEB 5KFHA 2RKIB 2ASLA 4C8LA 2BM0A 4DPOA 2X1BA 1REVA 1RAOA 4LJMA 1NXIA 3X1LB 4NRUA 3W62A 4BC7A 3EM1A 2BE2A 4LSZB 4MAKA 3SDEA 5HL7Q 3EVMA 1XR6A 2IM0A 2N7CA 3GJRB 2VB6A 3JQJA 5FLXY 2MXYA 2AYBA 1REGX 1NSQA 3DDIA 2F8MA 3QLHA 2KT2A 1F2HA 3R3TA 1CC7A 4AXIA 1GXTA 2K7KA 4MKAA 2ZH7A 5D78A 3MURP 2BE9B 2G9OA 4GVBA 3TOQA 4FXVA 3MAQA 2HNZA 2KZZA 1T9VA 1CJVB 2DNYA 3G82A 4YOEA 4LF7F 1WG4A 2WVDA 2B7CB 1L5UA 4KHPF 4TKTA 4HDHA 2O5DA 2QSFA 3ICLA 2BRLA 4PQAA 5ETPA 1OIAA 4NXMF 1O8BA 2YX4A 1GXUA 2CIMA 3CSKA 5E0OA 3C15B 2PMZD 2CQ2A 4ZMMA 5HMZA 3IBCB 3KNGA 2HGMA 2WW8A 4HACA 2WZ1A 3RBZA 4ER8A 4DPYA 3HDSA 3JAMU 4ECWA 1EAYC 1KBRA 5KFBA 2E9TA 2CDQA 1D1UA 1U02A 1Y0HA 1XEZA 3AA8A 1V6HA 4ED4A 4RBUA 2Y0BB 1UJ6A 2W8KA 2ZH1A 2YWKA 2AGQA 1KN6A 4RW6B 3THTA 2HVIA 1AFJA 1G1XA 4W92B 5ETLA 4JB8B 1IQTA 4DV3J 1NPRA 3L4BC 4TU9A 2JFKA 3ZZPA 4EI2A 1RWUA 1HBOA 2ZZTA 5LM7E 1LK5A 3W8PA 3GV5B 2HURA 1KOHA 4GC6A 4N7TA 2MZ1A 1HI0P 3D1OA 4MK9A 3UI3A 3MAAA 2M70A 2LA4A 2OO4A 3M32A 3JAMY 1REVB 3KDOA 2KM8C 4PABA 3K58A 1N0UA 1Q95G 2DNQA 4WTYA 2IM1A 4W4MA 1UZHA 1UPMB 3FGVA 3LO3A 1K8AT 3CD6S 1KS2A 3HP6A 1KONA 1Z2ZA 2GV1A 1C1CB 2A10A 2BOPA 3W60A 4DMZA 3TR5A 2Y1LB 3W63A 1WI6A 1U1LA 1DTTA 4QJVA 1B7FA 3QSYB 4X66F 3CC7S 1I1GA 2QYGA 1HW9A 5GMDA 2JEGA 1X5SA 1HMVB 1V5IB 2M0GB 2V63A 1D9FA 2YWFA 1HBUA 1KDNA 1QAJA 2FGOA 1S9EB 2V8VA 4RW8B 2XO6A 3Q8SB 3HHNB 2F65A 1SPBP 5AXLA 1HNVB 3FCVA 3QZ7A 4O3QA 3L7UA 3W2VA 2CJYB 4P2SA 1OY9A 1VFJA 1UTAA 2DCUB 3KJFB 5J1PA 3Q8PB 1HNZJ 2CJQA 2Z8QA 4A8XA 4JI1F 1S76D 3W64A 1H3DA 2UXCJ 3W1YC 4BBYA 2R7UA 3E51A 3B78A 3V6JA 4O3RA 2Q1LA 2ZITA 4BCAA 1VQ4S 2Z2MA 3HVWA 5IT0A 3VQTA 3T41A 5J2PB 4LF6F 4J37A 3EPGA 1UCNA 1YSJA 4IG3B 5EWGA 3K5MA 1K47A 3H7HB 4MYTA 3K8WA 2YKMB 4FKXA 4CIOA 2RU9A 2X1AA 1FDBA 2JC0A 3BSCA 4PWWA 1UFLA 1X0PA 4A8FA 1WC4A 3M8RA 3IM8A 2GS8A 3C14A 1OSDA 4CTAB 3TUPA 3V4IB 3V6DA 4L3NA 1LWCB 2IMWP 1SL1A 1S9GA 4IH7A 1S10A 1FKPA 4NA3A 4YHHF 4LFCJ 4OYZA 2P9CA 4FVCA 1JXVA 4XDDA 4JI6F 4YB5A 3QT5A 2J8AA 3PIPQ 2DNOA 7FDRA 2LU1A 2RNEA 1TMMA 3MPWA 1N33F 4PZVA 3MM5A 1M1GA 1S4FA 1S4EA 1VS3A 4I2PA 4QOTA 4C3KA 3T1YF 5HMWA 3I9V9 2V8HA 3PX0A 3BREA 2R7OA 3J81U 3PO5A 4OX9J 4LSNB 3J7A1 2CA9A 1XK8A 3ITHB 1OWXA 2LEPA 2QJ3A 2K1RA 4ZHRB 1S6QB 1ACMB 1K1QA 1Y5NB 4K2XA 1VK3A 3RAMA 1TL1B 1KVKA 1CJUB 2HFVA 5HMXA 2P5VA 2EG1A 2GAGC 2CQ3A 4KGVB 2XM3A 2W9AA 2F4FA 3NP5A 3Q8RB 2LMIA 1HNXF 3NAHA 4ANDA 3TVYA 2V2KA 2HRUA 3PX6A 2ADBA 4ICLA 3DNCA 4GO7X 4EBEA 4LRFA 2BJ8A 2JEFA 1NJZA 2NSCA 1HWUA 3UR0A 2M4MA 5CHCB 1RWWB 1XNQJ 4PQUB 3SEOA 1F5CA 5A0YA 1YJVA 3BSAA 2U2FA 4P7VA 5A8KB 1D8YA 3TAQA 5C5JA 2V50A 1RSCA 4WPAA 2VQEJ 5L1KA 1HNWF 3SV4A 3W2WB 1MWYA 2FD2A 4O44A 3OTDA 2XSJB 1QLNA 4TY8A 2YNGB 3DXBA 3PYGA 3NS6A 4WE1B 1CQMA 3D1HA 4CLFA 1RWXB 2JJ4D 4KYZA 4F0MA 3BBBA 1B99A 3DC2A 1XERA 1YX2A 2EG2A 3QQCD 4DX7A 2ZH8A 2NZ4A 3ETMA 1XIQA 2ADCA 4FYVB 1TKXB 4NRTA 4OV1A 1FEEA 4PEOA 5GMEA 1RTDB 5A76A 2I5JA 5M2PA 3QZ8A 3R8YA 4WU3A 4RZRA 3OSNA 2R2RA 1CJUA 5HBMA 1RBOB 4FXDA 1MU2B 1S6QA 4ZN3A 1NKCA 2C2NA 4NCGA 2PGCA 4KPCA 2E1PA 3F56A 3GR0A 3I5AA 1T94A 3MMAB 3R97A 3GU0A 3JXOA 1EP4B 3MM7A 4QQBA 4I2PB 3LALA 1P6TA 4JI3J 5DZ7A 2H1YA 2DRDA 3D67A 1AUSL 3QAUA 5CD4A 4JI7F 2Q66A 3BBCA 3FQLA 1HL6A 1ICEB 4CO5A 2XHCA 3AQOA 1XMQJ 2ILZA 3MGJA 3EGVA 5DGBA 1HARA 1S9GB 1BY9A 4P75A 1QTNB 3N6MA 7AT1B 1D9DA 1ITPA 4V1Ak 4ZOSA 5DG9A 2IJRA 2QL5B 1GAOA 1NSAA 4ECRA 1CBKA 2CADA 1XR7A 1HIYA 2VPZB 2XMKA 3W9HA 1RISA 4O0IA 3U7JA 1RWPB 2KL8A 5KG7A 2QFJA 4KB7A 1S6PA 4B08A 4JI7J 1J27A 2DEJA 3U1MA 2VKRA 2E5LJ 5IM0A 5EWEA 1CC8A 2DGOA 3EDRB 4WFAQ 3BB5A 4WJBA 1LNQA 4OYMA 2DIVA 4MIWA 2R2UA 2OJ3A 3MM6B 1UVIA 3KUHA 2VFVA 3Q8UA 5U47A 3TZXA 2P9EA 5IM0B 5D4OA 4I7FA 2NUHA 1LK7A 4URGA 2FC8A 2Y9HA 4A47A 2IJFA 2F9DA 4DFJA 4HTIA 4DSEA 1VQSA 2Z0GA 4FYYB 3GV7B 1KOOA 3CCJS 4IQXA 3CCQS 3NNAA 3EUNA 3KJNB 1N32F 1UL3A 4M5NA 4ILLA 4EFAC 5IT4A 1RWKB 5EN1A 1S9EA 1R0CB 2L9DA 2NSBA 3ZZTA 2VG5B 2IRUA 1NU4A 3QT7A 4ED2A 2HFNA 3TRGA 2YH1A 1P9YA 4QYRA 3P6YC 3N01A 2OLWA 2XWXA 2DIUA 4PWUA 1AT1B 3CUNA 4F4AA 5H1SV 2IA6A 3I82A 1R3NA 3KXDA 1PILA 2QGFB 2OPRB 4MIBA 4N76A 2ZE2A 2M5YA 3D4JA 4PR6A 2Y1RI 4UY8T 2DH7A 1EP4A 5KT6A 5HQLA 1S1VB 3KG0A 3PV8A 2EKYA 1VOMA 3TX0A 2V9WA 1GH8A 4H4MA 2DHGA 3UCZP 2OPQA 3UDCA 3E01B 2LXFA 2DXEA 1R0AA 3I31A 2DNHA 5B0AA 1KD1T 1KVIA 4USHA 4ZLPA 2IY5B 1Y5IB 2O1PA 5IC4B 3MAAB 3KMSA 5H9EK 4K4SA 2RQKA 2YNHB 4IG0A 2DNKA 2W4DA 3GONA 1L3VA 1P8GA 1SVDA 1U2RA 1V3SA 4JI0F 4NLVA 1T9WA 3U1LA 3TZYA 3RB3A 5DG8A 1NK7A 3RR7A 2CZ4A 1UVLA 4C6AA 4MKYA 2DT9A 2YNGA 2YY3A 4B02A 2JEIA 4CT9A 2XSJA 4UOGA 3HVRA 3OXFA 4O44B 1PJ6A 4USUA 3BR9A 2OHDA 2HLTA 2QEXS 1M5KC 3GG0A 1HWIA 4RWXA 4HACB 3HT0A 2LQJA 3PYDA 4QU7A 4OJHA 2OMOA 4DQRA 2CQ1A 1P9QC 1EKRA 3S01A 1HPZA 1MLAA 4YR0A 4NL5A 2LVWA 5ETSA 1EZZB 2KFNA 2WOMB 1J5OB 1BQXA 1N52B 5DDOC 1QSSA 2J5AA 1Q16B 4LRDA 5HO4A 2HKEA 1RQ0A 3T5LA 4B3SF 3FBBA 2HBQB 1S1UA 2HNZB 3WDOA 3IAS9 2KRBA 3AODA 2UV8G 4QW9A 1NHVA 2W2QP 4MT1A 4P2XA 1TVRB 3BGRB 5T7LB 4K2JA 2D1CA 7FD1A 2DD8S 1DURA 3M8WA 4IRKA 4KE5A 1FRXA 5D0RA 3QLHB 2J0WA 4DV7J 4EBCA 1Q82T 3MD3A 4WIIA 3NNHA 1Y3JA 1XNRJ 1D9AA 3BO3A 2UUAJ 1U1RA 5C25A 2APOA 5IV3A 3G96A 3HFVA 4LVNP 1VLOA 4KGXB 1WG5A 3TI0A 2J9DA 3O2IA 1GQEA 5EDWA 4DX6A 2F9JA 4XPEA 2EK6A 1FKPB 1RCXB 4F4XA 3BKFA 2YPZA 2HIYA 4HYKA 5DG7A 1LW2A 1ZM3A 4LFBJ 2E5IA 5HMYA 4LF1A 4ZPTR 4QWAA 2CZVC 3K8VA 1S0OA 5KFKA 3GFZA 3CC2S 4G1PA 3TVKA 3CMAS 5F8IA 2OPPB 1V5VA 2GVDA 2IJNA 4O0NA 4M5GA 3G6YA 3M4XA 5IV4A 4ED6A 1GMWA 5BYRA 2RUSA 4Z7CA 4NLOA 3MEDA 1RADB 3MZIA 2RE1A 3OTOF 3MUTP 3FFIB 2AIRB 2D9OA 2V67A 2RIJA 2PDAA 2CJAA 4IG3A 4CLSA 1CS4A 3QWPA 5CYMB 3I96A 5LT5A 3TUZC 3SIPB 2D74B 2ZHOA 5K8OA 3KHRA 1UEKA 4Q5VA 3R5CA 5K8MA 1NO8A 2MKKA 3UN5A 3W66A 2QMXA 2IBOA 2OP5A 3NMRA 3LGHA 5L8RC 4E98A 4P10A 1X5PA 3D2WA 1K0VA 1EB0A 5GMKa 4WFBQ 1KLNA 4IYQA 4BWMA 1O0PA 1VI7A 3AY0A 5J2NA 4NZ7A 1QVFR 3A8EA 5AJ3F 2CQGA 1EJ7L 4Q7AA 2ZHBA 4LF8F 2W9BB 1HMVA 1WC0A 1H98A 2XMMA 3H59A 1FX2A 2AJ4A 2CQBA 2XBPA 4OL8A 2DHSA 3P96A 4ENOA 3SQGB 4OYWA 5JUMA 2MZJA 2XHWA 1DTTB 4KGZB 2Z56B 4DPWA 4I67A 2OUGA 1FRIA 4IOCQ 1PSDA 4AL6A 3HFKA 1AA1B 4I4BA 1Y11A 2HMIA 2VF3A 5M2UA 5L1LA 5C24A 2ATLA 2H9ZA 5D0HA 3AOAA 3J81j 2XY7A 1WEZA 3MDFA 4E2FB 4J9VA 1VLYA 3PDNA 3PRVA 3R5GA 3M32B 3T6BA 3M2RB 2XMTA 4Q8FA 4ZKAA 3GFYA 3MPUB 1JLGB 4DN9A 1TP7A 5IWAJ 1R7IA 2ZJPQ 3D5MA 2KTQA 1P1TA 1TL5A 2XYHB 1FO1A 4A8MP 1K73T 2VBZA 3MCOA 2VPXB 2VJUA 2J6TA 4KV8A 2GHVC 3EZOA 4KAIA 1NDPA 2JLFA 4DUTA 1YIJS 3CCSS 4KKOA 2M3DA 3LUYA 1X0FA 1YKWA 2FHJA 3BGFA 1GX6A 1U8WA 1PGZA 5KOWA 4X4PA 1VR6A 4QPTA 4E0DA 3EZ5A 1FK9A 3GB0A 4MKBA 2PEHA 2EWHA 4YFUA 1BXNA 4ZP9A 1L3KA 4PUOA 2HAIA 1X9SA 4DBQA 4B9LA 2UXBJ 1R0BG 4EYHB 3KK1A 1AZSB 3BYPA 4AYBD 3BQ0A 2GIQA 3GYGA 3CJ4A 3IRXB 1ULRA 4FPIA 3BSOA 2OPSA 4J9SA 4ILMA 2XZTB 1RI7A 2XGQA 3Q24A 1F2GA 4OYXA 2KJWA 2V6AA 4IFVA 5B0DA 1TFWA 2QT7A 4FF2A 2IA0A 4DZ6A 4DV5J 1NMEB 5MLCV 4DFMA 3EXYA 3PW0A 5D6GA 4GVBB 4IOAQ 4TLQA 1YJ9S 4OZ1A 3SCLE 2E7WA 1U6ZA 2EFNA 2HGLA 2XMJA 3O44A 3F41A 4ZPAA 1S1WA 3SSRA 1WG1A 4DHVA 2FVRA 4ZP7A 3DRPB 2HMIB 4KGMA 3R2CJ 2QO3A 3H2LA 2WVFA 4U96A 2HNYB 4Q8EA 1MN9A 2JOQA 2EFQA 1BHNA 1KFDA 2OD6A 2KZMA 5IXUA 1YITS 3CJKB 5DQIA 2EPIA 2LQ5A 1ZS6A 2BE2B 5BYQA 1JQGA 1FEHA 4M5JA 3CCLS 2HFSA 2RHSB 2UUTA 1LW0B 4USIA 2CNLB 2G2YA 4Q43A 1VRQC 2CRLA 1U4BA 2UVUA 2HHTA 2VG6A 2MQMA 4QWDA 1RAIB 4O23A 3OL8A 2QA4S 2B6AA 1FDAA 2HQ3A 1U49A 3CO0P 2B9WA 3AJDA 1N36J 4OHYA 2CYYA 4G6VB 4KH1B 2CJBA 3J7YU 5CYQA 2M8HA 2MZTA 3J81Y 3FBCA 5E33A 1KC8T 4HHUA 4HI2A 1QM9A 3A4TA 4DV7F 4BDPA 2KH9A 3FNNA 3DU6A 4X62J 3MR2A 1YG0A 2AEJA 5HQ8A 2MQNA 2UUBJ 1RXOB 4DPXA 3FUYA 4XK8C 3QO9B 4C9DA 4WZMA 3A1YG 4MYUA 5AXKA 2ZZMA 1M0SA 3EWGA 5IT9U 1RT1B 2VIHA 4G1QB 2XQCA 4URSA 2OPPA 3GCXP 3D28A 2OI2A 2L41A 4JI8J 4GC7A 3B4MA 2VG7A 3AT1B 1F0XA 3DOKB 2B3TB 2KU7A 3E3XA 2PO4A 3FMWA 3K5OA 3QGGA 2MQPA 2RT3A 3EX7B 3UD3P 3FBFA 3ZFVA 4DV0J 4I6AA 2AW0A 3NAIA 1RT3B 4NLTA 1WC1A 1IKWA 3EGWB 2QMUB 3KUEA 3TNVA 1V3RA 1Y00A 2HWIA 3ZNJ1 4WFNQ 2MLXA 1J5EF 4OX8A 1NM2A 1JLQB 5M2RA 3CT9A 1R31A 4FDFA 2RF2A 2DNLA 4Y0FA 1T03A 3KLGB 1PBUA 5HVGA 4B3TJ 4OYOA 1Y3KA 1SC6A 4HT7A 2DNNA 2VFTA 4X64F 2FYXA 3MR3A 5B0GA 1Q5YA 1XMBA 4LUBA 4B9UA 1RT6B 1SIWB 1NK5A 3NGKA 4ZVHA 3MAHA 4BHQA 3A8IA 4AUKA 2BJ1A 4OHZA 2CNNB 1LKZA 2BE7D 4WK3A 3N5FA 4KFBB 1KWMA 1FJGF 2IC3B 3MI7X 2IRYA 2DNPA 2D3ZA 4LF9J 5LSLA 3Q83A 5F9LA 2NLWA 4NLWA 3MM8B 5J2MB 1LFPA 3MEEB 2VFSA 1DTQB 2FY8A 2GO8A 3IS9B 2HGNA 3HZGA 5F3TA 3FBEA 2O01C 3JSBA 3QNWB 2KHDA 1C0UB 2RJZA 5KFCA 2QLJB 2BMBA 4K50A 2R4FA 2YX1A 2MSTA 4YY3J 4D3GA 4YY3F 1M90T 1YZ7A 4ED3A 2DGUA 5I3QA 1PJ7A 2E7XA 4ED7A 1UA1A 1Q81T 3E2EA 1R8CA 1TU0B 1Q4RA 2MQ8A 1XJWB 5FLXU 3L9ZA 2DO4A 3MPYA 3PM9A 1KNZA 1NB2A 1HFEL 2XWYA 1S57A 3PRBA 3Q2SC 2DNMA 1E6VA 2GIFA 4DEZA 3DLBA 2B56A 1R8HA 5EHHA 4OZNA 1CULA 4BWJA 2KT3A 2YKNB 3I4PA 4P6QA 1S1TB 3QSIA 3MM9B 5T41A 2I6WA 3QAEA 2GW8A 3UFCX 2OPQB 5CA5A 4WCEQ 4K4YA 2AX1A 4C8YA 1S1VA 1X4HA 3FZ2A 4KR0B 2GZOA 2EK1A 1F5BA 3UW1A 4O4GB 1VQ9S 1RTJA 3LP1A 1H2VZ 4OX7A 3SSSA 1FFGB 4HH0A 4ZS6A 1RB0A 1WDTA 1B3TA 4QCLA 2RQCA 5LXRA 1I6JA 1TL7B 3ELHA 1HYSA 1R43A 1NZ8A 2DXFA 3KKFA 4AQYF 4C8ZA 2HNDA 2H65B 3O8WA 3NGUA 4DZDA 1KSPA 5D15A 3T1YJ 2IM2A 3HHDA 3WIVA 2YNFA 4F4KA 3I6PA 1VQ5S 2ZOFA 4RU9A 4OZJA 1NDCA 5F0WA 1NSKL 4QYZJ 5GAGI 3VAKA 2G4BA 4HTJA 2C2MB 2LFVA 2JC1A 2MY7A 3OT9A 3SI8A 2OMLA 3MR7A 2VOPA 4DG1A 2F4VJ 4NLPA 3VV2B 3H4BA 5KFXA 3IR7B 1ZAWA 3QMQA 3CCVS 2CQCA 5KFZA 4F02A 5DQHA 2EFPA 3TANA 3TVZA 3NS5A 2XNQA 3S7RA 2HNDB 3HD2A 3VHQA 2XI3A 4FBUA 2CVEA 3GSDA 4PYDA 4QIVA 1VBXA 2B5JB 4B17A 2KI2A 4X4TA 1H7XA 2DTJA 1FE4A 3TWZA 2M8DB 5D4PA 4RW9B 2W7AA 5FJ4A 4X62F 5IT9Y 4MMOA 5KFQA 1O51A 3KK2B 2XYPB 3P5BP 3U1NA 3BYRA 2ZH6A 1NK4A 1LWFA 2EEYA 1QSLA 3CJ0A 5DJBA 3OXLA 4LFCF 3I9ZA 1CULB 1WKLA 4K5SA 4EWTA 5KT5A 4FYXB 2DITA 2GQCA 2VHGA 1VRUA 1E6VB 1T0TV 2GHPA 2J7WA 4P73A 5KG6A 5HN0A 2V8PA 2B4PA 3MPDA 1FX4A 2WAQD 2VQEF 3R1LA 2ZM6F 3I0SB 2QA1A 4NI2B 4DU7A 2R8KA 3D1QA 2BKNA 2CPHA 4I64A 1VQMS 1SUQA 3G71S 1A6LA 2A3JA 2NR0A 1CSJA 3ZZZA 3SQOP 4EO6A 2I8EA 3MMAA 4FS2A 3AXMA 1G2EA 1C0UA 3R5DA 4YB7A 3RJMB 4C8KA 4Z2XA 3D66A 2XY5A 4IFYA 2DYAA 2VH7A 3CCZA 4TLRA 3HMJG 2QE5A 3SSQA 2HZCA 3GPAA 2RS2A 4RUHA 3O5TB 5K5MA 1S12A 2N4DA 3HSZA 2IMOA 3MM8A 5A8WA 2JFDA 4K4UA 3P8BB 3DLGB 4MH8A 1FNMA 2B9YA 4FN5A 2IC3A 5C2GA 4JV5F 1UA0A 5EUHA 4KFBA 1FXLA 3IO1A 2CPDA 2FY1A 2LXIA 2N7YA 3TA1A 2POKA 2L9WA 3R27A 4F25A 2QC3A 2KXHA 4U9RA 4RUBA 5DETA 2PI4A 1WSVA 2M9KA 4TNOA 2MZQA 2DB1A 1T3NA 1RT2A 2V68A 1OPZA 3M9NB 1EARA 3PZPA 3DLHA 4DR7J 1X31C 3QGPA 2XCAA 4LF6J 3BF4A 4RL1A 4LR8A 1TUWA 3IG1A 3M2VB 3JYTB 3DHXA 1YJUA 1QSYA 4ZJQA 2E1MC 4ES2A 4DV3F 5I3UA 5MAOA 3DMJA 3K59A 4IH6A 5LSRA 4ICLB 1OY6A 1Q8IA 1IWAA 2W25A 5KFNA 2AJ2A 3NCPA 3PVXA 5DGAA 1G3OA 3RRKA 1SH0A 5HROA 4I69A 3UN2A 1HQUB 2BANB 3KK3A 1N0VC 2VONA 4IO1A 4DR5J 1CEZA 1YGYA 4GVLA 2BJ9A 1UW9A 3WX4A 1JX4A 1VMBA 1S49A 3DOKA 1RAGB 2ACYA 2VD3A 2QL9B 2QMWA 3FCWA 3KG1A 3VF0B 4ZCKA 4X66J 2V69A 3GMGA 4ZPBA 3DLKB 3TP2A 2WTFA 5IWAF 4OI4A 3HHLD 2K2PA 2CVIA 4IDKA 1W26A 5ETRA 3QO9A 3R5BA 1IM4A 2W24A 5KG1A 3K7RA 3QWUA 4F0HA 3G6VA 3Q22A 3TA0A 4JI1J 1YRTA 2GGPB 4TXSA 2HYIB 1FTRA 4DCOB 1KFSA 1LEOA 3ET6B 5JJBA 3HT3A 4JI4J 3MCNA 1I3OB 1HD0A 1PCAA 2AJFE 2DKOB 3B6BA 2RDDA 4NOHA 4OYBA 3BSNA 4DV6F 3IBWA 5DLFA 3SV3A 1W2BR 3RGIA 3W9JA 1UVMA 3BR8A 4DPUA 3HK2A 5C7PA 1D0EA 5KFIA 2XB2D 1AW0A 2XG8A 4OZLA 4JI5F 4DX8H 3AB4B 4DUYF 4YB1P 1OMSA 3C6UB 1OYEA 2MYFA 2ROPA 2ASJA 1TV6B 2WONA 2FVCA 2J0XA 3RU0A 4DU8A 4X4SA 5AXMA 3EGNA 2E7VA 5ETMA 4ZVFA 1NLKL 2FJDB 3CJKA 3S6EA 3OHBA 2E5JA 4FBTA 5ETTA 2M88A 4DI6A 2GC8A 2VPYB 4Y3CA 1M5PC 3CCTA 5HJXA 4D3HA 1FHTA 5L9NA 4DR5F 3M30B 1ZAXA 1HBNA 2UUBF 3CDAA 1GMUA 4B3MF 3DRPA 1LWEA 5LOQA 1VQ8S 2W9CB 4DL4A 2GX8A 1CVJA 4NWBA 1S1WB 2LLZA 4JI6J 4DUZJ 4ATNA 2W7OA 2D3OR 1B4SA 2LDYA 4KY3A 4RW8A 1HBUB 4TYAA 1SJQA 3CGIA 1SC4B 4OJ1A 3EXCX 5LL6d 2V5HG 4FF1A 2Z30B 1U25A 3N5BA 2EBEA 5K14B 2BQ3A 1FD8A 4LSLA 1S1XA 1OSCA 4ELUA 3PFEA 4FS1A 2J7UA 2YH0A 4KQZA 1NB7A 4NYOA 1QDUB 4O3NA 4DR7F 2HQCA 1C1CA 1FESA 3C16B 2CUYA 3RBEA 2J9DE 4PWDA 2VJVA 4R8UA 1X60A 3FRYA 2AZ1A 1Y7PA 3KHLA 2YNIB 3BDPA 4M5MA 1DQ9A 3TQEA 2DH9A 4DN0A 1YJ7A 3WBZA 5F8GA 3LP2B 4IOBA 2KG1A 2YVSA 2ZHAA 1R8AA 4U7UK 3KLVA 1M5OC 4LF5F 1XC9A 4ALZA 5D4NA 1DY3A 1FRKA 3AQPA 4Z37A 4N8NA 3CJ3A 4ILRA 2NXUA 2MMYA 2OEJA 3IR5B 3UR3C 1N33J 1T95A 4HLBA 4UUWA 3JTNA 2RD5C 5KFDA 1TKDA 2V34A 5GADI 4BLGA 1JMTA 4F36A 2ZDPA 4M5HA 4NEZA 5G0RB 2HFUA 5C24B 3BGUA 3ZZYA 4ZVOB 2JLGA 3N6NA 4EEYA 2MZRA 1TUGB 2OELA 3PR4A 2J6SA 3RAXA 3BGLA 4WK1A 1B70B 2KFYA 3HVTB 3KFWX 3QIDA 3SQGA 3W65A 1X8DA 4NE9C 4ZJLA 1SI9A 3H98A 4X64J 2NS1B 1DLOA 4QR1A 4KJIA 4DR3F 2G0IA 2JZ5A 4X4NA 3JSMB 1RUSA 1VISA 3WQPA 4N47A 2HIQA 3DLEA 3GZ7A 4CM2A 2F3JA 3I5CA 2B0GA 5HANA 1KQSR 2ZEJA 2QL7B 9RUBA 3M8SA 4PKDB 2XC9A 4RO0A 3M30A 3IRWP 1N34F 3CWJA 3M9MB 1N34J 2DR9A 2YKQA 2HHQA 5B0BA 4URQU 1FJCA 4AE5A 2NPIA 2AJQA 4I0WA 4USKA 2FDNA 3UCGA 1FDDA 2IVMA 2E5HA 3SDEB 3W5XA 1CS4B 4A8QA 2MKCA 3BQ2A 3KNAA 2C22A 1H72C 2LQ9A 3RUBL 1Q8BA
chains in the Genus database with same CATH topology
3KLEA 2Z2LA 4NX9A 3TUJC 4NLUA 3DRSA 1YRUA 3NWGA 3CCMS 1V3ZA 1WF1A 3MPVA 2MHNA 4WKRA 2WCXA 4B3OA 2F8HA 5CCLA 5E3AA 4Y2MA 1FD2A 2KJVA 5CZXA 2AJ0A 4FP9A 4F67A 1MW7A 2HHVA 4CNYA 3LGMA 5GAHU 4HL9A 2M52A 2V4QA 2BV3A 2N3OA 2KN4A 2OSQA 1OO0B 2CJKA 4OHVA 3SFGA 4C11B 1RTHB 2DGXA 4ECZA 4DFKA 5KG5A 1HBMB 3FVYA 1TKZA 1FNOA 1TL4A 4RBVA 5EWFA 3UD4P 4KO0A 5KFGA 2ROGA 1ZAVA 1SJ3P 1IBMF 3HPOA 2VA2A 2J9CA 1R8BA 4DR6F 1B0TA 2BA9A 2WSEC 1IXKA 2DHXA 1X4DA 4I56A 3CPWR 3JSMA 5KG2A 2W7PA 3CTRA 1QTMA 5HROB 1N4LA 3OHAA 1BD6A 4OJGA 5CH7B 1J5OA 4PG8A 1UFWA 2B4OA 3DMJB 4IR9A 5SZTA 4X4RA 3H40A 1TFYA 3H5XA 3TW0A 2KDOA 2HHSA 1KRPA 2DGTA 3P49B 1IKXA 3VZIA 3RBDA 1HA1A 5G0RA 4H4KC 2VQFF 4PXBA 3OQ2A 2EW9A 5JXSA 1RTIA 1BQMA 3IC1A 3N28A 3KLHB 2O3DA 1FXRA 2EVZA 4B9MA 4EYIB 2IM3A 3DHWC 4TYBA 4DWIA 1JLBB 4H4KA 3MECA 4GKKF 1IKVA 2XLKA 1PO6A 4ELVA 1Q53A 1HD1A 3WC2A 1UVKA 3VWSA 4OZ0A 4G1IA 1Q86T 3L09A 2AD9A 5CXTA 3RB4A 4IFYB 3RW7A 3E01A 2YNIA 2AV5A 2M2BA 2V94A 5DDPC 3DI6A 4R8UB 4NZ0A 4DS4A 4PWDB 1X5OA 3OSPA 2AGOA 5J1NA 4UY85 1VC6A 1FKOB 2ZE2B 5E5NA 3CCWA 3RB6A 4C4WA 3PY8A 4PG7A 4WKYA 2ZH5A 2NREA 3KJVB 4XIUA 5K14A 1TAQA 1N8RT 2VG5A 1XN9A 2ZBIA 1JB0C 1C1BA 2IAJB 3UDLA 4LQ9A 1JLFA 4M94A 3FSXA 1ZM9A 1TKTB 4DQSA 3KK2A 2FJEB 5F3ZA 4OFZA 2ZNZA 4MK7A 1X9WA 4JI3F 1TQLA 2V4JB 5E2QA 3HZEA 1JKHA 2C3YA 3PRDA 2G0CA 4I68A 3GR1A 1ZM4A 1BQNB 1SKSA 2EFGA 2BQRA 2V0NA 5AE2A 4A8YA 5D8HB 4DS5A 3CIZA 1A7GE 4NLSA 2VOOA 3D54A 4ECSA 4QBUA 4TQRA 4DL0C 4YEAA 1HQEB 3HHLB 4EO8A 5FD1A 2IRXA 3I0RB 4OI3A 1SKRA 3U02A 3V6HA 4JOUA 1DRZA 3OXGA 2L3MA 3T1AA 1VIOA 1RP5A 2GHWA 3FZBA 3M1VB 4Q2LA 5B0EA 3DRYA 1KLMA 4RNOA 2K3IA 1JNRB 3IWXA 4RW7A 1WTFA 4J9QA 4DV4F 4GKJF 2ZOMA 3LQVA 1ELOA 1N88A 2IVYA 5ITHA 1UWBB 3DXSX 5LSOA 4IDKB 4Y2AA 5K8NA 1FRHA 1RTJB 3LP1B 3L7PA 3P5TL 4O4GA 1HHTP 3QJPA 1WEXA 3IR6B 3PJXA 2DR5A 2GIRA 4NCBA 2KYXA 1DZ5A 2E1AA 2QRRA