3DM2B

Crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
431
structure length
400
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 103
structure length 400
sequence length 431
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dm2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2B03
1RT2B 1K1QA 3H5YA 3LP2A 2HNDB 5L9XA 4O3SA 4I2QA 2ASDA 1RTDB 1N6QB 1N4LA 2F8EX 2HNZB 4KV8A 2ALZA 4RNMA 3BQ1A 1RT4A 1TL3A 3TVKA 1HMVA 3KLEA 3DLEB 3FFIA 2C2DA 1REVA 4MIBA 5J1EB 3UQSA 3MFIA 4TQRA 1S1WA 1KLMA 2HWIA 2HMIA 4XO0A 4PUOB 4MKAA 3H5SA 4WYWA 1LWFB 4RNOA 2WTFA 1C0TA 4G1QA 2IC3A 4KO0A 1XR6A 4TY9A 5EWGA 3M9MB 4EYIB 1FKPA 5L1KA 1RTHB 3V4IB 1HNIA 4FS1A 1S1XB 3QO9B 5J2QB 1LWCA 4Q0BB 2AQ4A 3KLHA 3ISND 1EETB 4WFYA 2YNGB 2YNIB 4KHMA 3I0RB 4DL7A 1DTQB 1SV5A 2FVRA 5KFUA 5F9NA 5F8IA 4F50A 3RBDA 1RT3A 2WCXA 3RAXA 5DG9A 1UWBB 4X2BA 1WNEA 4NCGA 1OS5A 3HVWA 5HBMB 2DPIA 4IRDA 4NLWA 3KOAA 5KFHA 4B3OA 4NRUA 1S9EB 2IA6A 3NBPA 4ED6A 2XC9A 4ZVFA 5DQHA 4NLGA 4I7FA 4QWBA 3MEGA 3DM2B 4MFBB 2W7OA 1S0OA 2QE5A 2AWZA 1JLGA 4RW8A 1S97A 1LW2B 1IKVA 4Y2CA 4YR0A 3GIIA 1R0AB 2JLEA 2VG7B 3DMJA 3HHKA 3H98A 4YQWA 2OPPA 4F4WA 2JEFA 1TVRA 2IAJB 1RTJB 1GX5A 3G86A 3C6TA 4Q44A 3EZUA 3QIDA 4QWAA 1ZETA 3OHAA 3DOLB 4HKQA 1S1TB 4DG1A 2OPRA 4O3OA 3LP1B 2EC0A 4ZHRB 5HLFA 3GQCA 5F8JA 1CSJA 5KFVA 3DRSB 4WYLA 5C25A 1TKZB 3H5XA 4WFXA 3CO9A 5KG4A 1HPZA 2ZD1B 5FDLB 3GIJA 5I42B 1IM4A 3H2LA 5DLFA 4O3RA 3KLFB 3OLBA 2W9BA 1NNDA 3IN5A 1SH2A 4F4ZA 2AGOA 2VG6A 3BQ2A 3E51A 4LSLB 4H4OB 4WE1A 4KHRA 2C22A 1RT1B 5CYMA 1S4FA 1DLOA 1N5YA 1BQNB 4IFYB 3RAQA 3ITHA 3I5AA 1QE1A 4ZMMA 3PZPA 3UPFA 1T05B 2ILZA 2XWYA 5KT6A 4IR9A 4ICLB 2R8JA 5C42A 2WRMA 1N5YB 4TY8B 1XR7A 2JEJA 1RT5A 3KK1A 2E9ZA 3DLKA 5C24B 4Q45A 4U6PA 4I2QB 2R8HA 1S9GA 3IS9A 5KG1A 5KFMA 3MR2A 2FLLA 5F8NA 4EO8A 1RT4B 2B5JA 1RDRA 2V9WA 2HNYA 3TQ1A 3LAKA 1HMVB 4NLOA 1JIHA 1TKXB 3FFIB 2I5JA 1REVB 2D41A 4H4MA 2ILYA 3RB3A 2AGQA 1JX4A 1S1WB 1KLMB 4J9LA 2HMIB 3G6YA 1N56A 4DL4A 2W9AA 5KG2A 1C0TB 4KO0B 2IC3B 3KJVA 4QWEA 1D1UA 4DL5A 2JC0A 3T5HA 3PR4A 4EBEA 4TYAA 5KFFA 2XI3A 1HNIB 2BANA 3QLHA 2UVUA 1LWCB 3KLHB 1W25A 1JLFA 3LALA 3I0SB 3KMSA 1S1VA 3PW5A 4LQ3A 3EPIA 1S6PA 1DTTA 1NHUA 1SV5B 2C28A 1TKTA 2UVRA 1RT3B 2WK4A 4TY8A 2FVQA 4NCGB 5F8HA 3IRXA 5DGAA 1I6JA 3H5UA 4K4WA 3GILA 4B3OB 4RW9A 5KFWA 4NLVA 3V6KA 5HP1A 1HNVB 2GIQA 2GC8A 3QGIA 2XI2A 4IH6A 4KFBA 5KFQA 4I7FB 4Y3CA 1Z4UA 3GV7B 3MEGB 3PHEA 4ZVGA 3T1AA 3JYTB 2CKWA 1JLGB 4ED7A 4TLRA 4OL8A 5DQIA 3N6MA 1IKVB 1KHWA 1S10A 1RT6A 5J2NA 1T94A 4TYBA 2YNFA 2OPPB 1TVRB 3C6TB 2FJXA 1T3NA 3FQKA 5KG7A 3QIPA 4DG1B 5KFDA 4IDKA 5HLFB 1JLQA 3T19A 3OLAA 1EP4A 2V0NA 1N48A 3T5LA 5C25B 5KG3A 4M95A 2BE2A 1SH0A 4IOBA 3KHGA 3LAMA 1C1CA 1HPZB 5J2PA 1RA6A 2WONA 2V4RA 4PWDA 4JUZA 1MMLA 5DG7A 4LSNA 3KNAA 3GIKA 4NLTA 3CJ2A 4ID5A 1IKWA 2VG6B 4O44A 3V6DA 2IJNA 3GIMA 3KLGA 3BSCA 5KFTA 4WE1B 3NAIA 3Q8SB 5DLGA 3OHBA 5CYMB 3MR3A 1DLOB 3MTKA 3V81A 3ITHB 4RZRA 3PW7A 2IMWP 4J9MA 1SUQA 5C42B 2B6AA 2BR0A 4O3NA 3CDEA 1RT5B 4U7CA 3KK1B 2OPSA 3DLKB 4NLQA 4MK9A 5KFLA 5JXSA 3QZ8A 4DL2A 2UVWA 4M94A 3E01A 4Q8EA 2D3UA 3UDLA 4WZQA 1S9GB 3IS9B 2FVPA 3BR9A 2J6UA 3KLVA 3BSAA 4O3PA 2B5JB 4MIAA 2RKIA 5JUMA 1RTIA 3BSOA 2HNYB 3NMAA 4FBTA 5D3GA 3GYNA 4IKAA 1MU2B 1C0UA 1NHVA 4H54A 3ISNC 3IGNA 3NL0A 2WHOA 1IKYA 3N6NA 5KFPA 2C2EA 4O3QA 3IGVA 4RNFA 1HARA 3CVKA 4TXSA 2R8GA 4RNHA 4EO6A 2W8LA 4DL6A 3RB0A 2IBKA 2YNHA 4TN2A 3DYAA 1JXLA 4NLXA 1VRTA 2BANB 3QLHB 4MH8A 4RW6A 3BREA 3BQ0A 4GC7A 2OH2A 2RDJA 1JLFB 1JLEA 1S1VB 1RYRA 4K4SA 1QUVA 2RF2A 3M8PA 3IG1A 4MKBA 4ZPAA 1DTTB 1HQUA 1T03A 2BQRA 3H4BA 2OPQA 2ATLA 4PQUA 4FBUA 5KFAA 2BRLA 4NRTA 3CJ4A 1S9FA 2YKNB 4RW9B 2GIRA 4ECXA 2YKMA 5HP1B 3MF5A 3KK2B 4ECUA 1JLBA 1RAJA 3G6XA 3TAMA 5EWFA 1LW0A 4RW7B 2FVCA 3QYYA 2BRKA 4KE5A 4DL3A 4XPEA 2R2RA 1TQLA 1LWEB 4K4TA 2AX0A 3FQLA 4J9KA 5L1JA 5L1IA 1RT6B 5J2NB 3KK3A 4KAIA 3NAHA 5J1EA 1HQEA 5F8LA 3CIZA 3LP2B 3CJ5A 2V4QA 3CJ0A 5KFZA 4NLYA 2J6SA 5EDWA 4Q8FA 1JKHA 3QIPB 1RT7A 4IDKB 2FJVA 2I1RA 4KV8B 1JLQB 1EP4B 1TL3B 4O4GA 3MR5A 4G3IA 2FVSA 3KLEB 3CDWA 2BE2B 3QO9A 5J2QA 3G6VA 4ED0A 3CWJA 4EBCA 1C1CB 4IFVA 1TV6A 5J2PB 2ASJA 2YNIA 4PWDB 1YVFA 3M9OB 4LSNB 5KFNA 5J2MA 4G1QB 3FDSA 2HWHA 5KG6A 4ID5B 1IKWB 3NGDA 1UWBA 1FKPB 1FK9A 4YP3A 4O44B 3V6DB 2HAIA 5KFEA 4ECYA 2AU0A 3KLGB 4ZVHA 4JV2A 4R5PA 1S49A 3H4DA 4KKOA 5KFJA 3MECA 3V81B 4J9QA 4I2PA 5I3UA 1ZTTA 1SUQB 1IKXA 2B6AB 2IM2A 4MFBA 4WXOA 4J9PA 5F8GA 4NZ0A 4ECRA 4ED3A 4IH7A 2OPSB 4KB7A 3DI6A 4K4UA 2VG7A 4YMEA 3NBPB 4NLUA 5C5JA 5CYQA 3M8QA 4Y2AA 3PR5B 5F8MA 3H40A 2RKIB 1RTIB 4F4XA 5D3GB 2UUTA 2ASLA 1XR5A 2DPJA 3OSNA 3PW4A 1C0UB 1TL1A 4RW8B 5KFSA 4QW9A 2C2RA 2AX1A 2VA2A 4KBIA 1JLAA 1S1UA 4NLDA 1IKYB 4RW4A 3DMJB 4JV0A 3SFGA 3JSMA 1TKZA 3QGHA 4IG3A 3KHLA 1QAJA 4URGA 4XPCA 2BQUA 1KHVA 2YNHB 4GC6A 2IM0A 3DYAB 2OPRB 1VRTB 4RW6B 3OL9A 3LP0A 1JLEB 1TP7A 3H59A 3M8PB 3IG1B 3Q8RB 1FKOA 1RT1A 2IJFA 4ZP7A 1T03B 3DRRA 4EYHB 2OPQB 1J5OA 4Y34A 3SFUA 2VG5A 4PQUB 4YR3A 3N6LA 2XCPA 3SI8A 3KMQA 5KFOA 2R2SA 4K4VA 4ICLA 2W9BB 4R8UA 4IG0A 3DOKA 2W8KA 3GV8B 1BQMA 2J6TA 2ZE2A 2YKMB 4ZP9A 1SH3A 3MEDA 3PVXA 2W7PA 5C24A 1JLBB 2D7SA 3PJXA 3TAMB 3BJYA 4J9NA 2JEGA 5K14A 1QE1B 1LW0B 2R2TA 3NKYA 3Q8PB 4RUAA 3HKWA 4NLPA 4ZPBA 3KK3B 1TKXA 1HYSA 4ECWA 1VRUA 2FLPA 1HQEB 1S48A 3RB6A 3HVTA 5EUHA 3KLIA 5KFGA 2E9RX 1JKHB 1ZTWA 3OL6A 1RT7B 3BGRA 5EWEA 2R8IA 1QAIA 3I5CA 1GX6A 4O4GB 3I5BA 2W9CA 4QPXA 2I5JB 5HROA 2XCAA 4H4MB 3MEEA 4DEZA 4IFVB 2XGPA 1TV6B 3I0SA 3DRPA 4F4YA 5J2MB 5KG0A 3KJVB 2JEIA 2QV6A 3FSIA 1FK9B 4MK8A 2IM3A 3OSPA 4O4RA 1RA7A 4R5PB 3BSNA 4ZP8A 1JLCA 4ED2A 4KKOB 4NLRA 3V6HA 3RBEA 3MECB 1K1SA 2JC1A 3HVAA 1HNVA 2D3ZA 3UR0A 5DGBA 1S6PB 3PJWA 4I2PB 5I3UB 5KT2A 2XGQA 4ECSA 2UVVA 1TKTB 5KFYA 1C1BA 1IKXB 1S6QA 3DLGA 3OL8A 3C6UA 3IRXB 3JYTA 4WXWA 4IRKA 4TQSA 3QGGA 2B43A 3DI6B 2WOMA 1RT2A 5L1LA 5CYQB 2HNDA 3M8QB 3VQSA 4FS2A 4KFBB 2VA3A 3GV5B 4ZP6A 5KT4A 4QWDA 1RTDA 4HYKA 1N6QA 2HNZA 2IM1A 3PW2A 1TL1B 1RYSA 4IQXA 2O5DA 4R0EA 1JLAB 1S1UB 3DLEA 4ECTA 4RW4B 2YNFB 3KHRA 3JSMB 4IG3B 2FJWA 4PUOA 3QZ7A 3RB4A 2E9TA 1LWFA 4ZVEA 5KG5A 5KFIA 4EBDA 3LP0B 5F9LA 1RTHA 3V4IA 5KFBA 2R8KA 4RUCA 1S1XA 4JV1A 1FKOB 4Q0BA 3M9NB 4K4XA 4K50A 3DRRB 1EETA 2WONB 2YNGA 1J5OB 2VG5B 3I0RA 4EEYA 1DTQA 5KT3A 4MK7A 4K4ZA 4R8UB 4IG0B 4ZPDA 3DOKB 5KFRA 3V6JA 3D5MA 1BQMB 4RNNA 3MFHA 2ZE2B 4Q43A 5HBMA 4ED8A 4WZMA 3MEDB 4J9SA 2BQ3A 1C2PA 1S9EA 5K14B 5DQGA 4IRCA 3CJ3A 3LANA 4KSEB 2WB4A 1S0MA 5KT5A 4URSA 3DM2A 2AGPA 2ZKUA 2FLNA 1HYSB 1VRUB 1MU2A 3HVTB 1LW2A 3KLIB 4RU9A 1R0AA 5DG8A 3E01B 2UUWA 3BGRB 3OL7A 2IAJA 4NYZA 1RTJA 4QW8A 1D0EA 3DOLA 1S1TA 2RDIA 4ZPCA 2W9CB 3LP1A 5HROB 4ZHRA 4URQU 5KFCA 3MEEB 4IR1A 3DRSA 5KFXA 3DRPB 1U09A 3T5JA 5T14A 3MR6A 2ZD1A 5FDLA 4NLSA 4WFZA 3Q8QB 4LQ9A 3KHHA 3D28A 1S0NA 5I42A 3CDUA 3DDKA 4IH5A 5KFKA 4K4YA 3KLFA 4J9OA 1JLCB 4ED1A 2YKNA 3PW0A 3T5KA 4J9RA 4LSLA 2RF2B 4ECVA 4H4OA 3KK2A 4ECZA 5KT7A 4QWCA 1HQUB 2R2UA 1C1BB 1BQNA 4IFYA 1S6QB 3DLGB 4RW7A 3C6UB 1T05A 2CJQA 4YR2A 1LWEA 3ICLA 3EPGA 4ECQA 3FRZA 2WOMB
chains in the Genus database with same CATH superfamily
2CQ1A 3N0VA 1GFWB 2B4PA 2ZBRA 1YRUA 3CD0A 5K8PA 4KO0A 3L9ZA 2R7XA 4CLYA 5J2QB 1VR6A 1WC6A 2MZSA 4DL7A 2HQFA 2KFNA 4NCGA 1YZ7A 1WG5A 4NRUA 5GMEA 2Y0BB 4YR0A 2CG4A 2JEFA 1YLXA 3EZUA 3QIDA 2XMUA 1N33J 3R9LA 1CSJA 3GJTB 2KU7A 2BJ1A 2ZD1B 1Q8LA 4HDGA 2E7WA 1HBOA 3MD3A 2VZ9A 4Z7CA 1Y10A 4LRFA 1BQNB 2XWYA 2RRNA 1K44A 3ISZA 4I68A 3KK1A 2D3O1 4KH0B 4P7VA 5C24B 3N9UC 2E7VA 3HSZA 2LQBA 2C42A 4QU6A 4TKTA 3SDEB 4DV3J 3LAKA 4LIRA 3WZ0A 4J9LA 3TANA 4L6V3 2ALYB 2DXEA 3T5HA 5I3PA 1W25A 3Q8UA 2CDRB 2YQ1A 3PYEA 4PAAA 4YFUA 3KUEA 1MWZA 2R42A 2N4CA 4DV1J 1P1TA 2HHHJ 5LMUJ 3GWCA 3TWZA 2JFDA 2CPZA 2JOQA 2JVOA 2R7QA 4CM2A 1VQMS 4ANCA 3R7BB 4USVA 1PKUA 2W01A 2BE2A 1WSRA 1C1CA 1IN0A 4QR0A 4QIWD 4Q2MA 1J2VA 1JK9B 1VBXA 2WBMA 5DLGA 5A8WB 1TZ0A 1ICEB 4B9TA 5C42B 1VQYA 4O3NA 5EGYA 4QOTA 3RGIA 2B7BB 4USHA 4JI4F 1NKEA 3P5BP 3BSOA 2HNYB 4FBTA 1NHVA 2I6WA 2AEFA 4RUHA 3MZIA 4ES1A 3R5DA 3RB0A 1QUVA 2R7OA 1DTTB 4UZCA 2EEYA 5KFAA 1SJ1A 4RW9B 3HM9A 2X1AA 5EWFA 1APSA 4DV2J 4DR4J 4XPEA 2XQCA 3FQLA 3DN9A 2IRXA 5J2QA 3WX8A 2BE9B 4EBCA 2OSRA 1TV6A 3TUIC 4KHPJ 4NI2B 2MQNA 1KRPA 3W9IA 2HK2A 2CQDA 2ROEA 4OFZA 1XR5A 1JLAA 1IKYB 2BJDA 4DDFA 3K89A 1QM9A 3DYAB 3JQKA 2O66A 3CCMS 1CULA 4OIXA 2ZNYA 4DFPA 2ZE2A 5C24A 3TEHB 1HD0A 1KTQA 4ECWA 4PPZA 1RT7B 1U2RA 2VPYB 5GADU 3CCQS 3FSIA 2VHGA 4DHVA 2COLA 5I3UB 1M5KC 4L73A 1VMBA 5E3AA 2DGWA 2AEJA 2XYGB 4X4VA 4ZPVR 1FEHA 1CPZA 2JWNA 3MCNA 3DGVA 1FXLA 1RYSA 1WEYA 3FJ2A 1NH8A 4MKVA 1N5SA 1RTHA 3UD5A 1X9MA 4K4XA 2KT2A 4N76A 5A8WA 2KVQE 4R8UB 2HQDA 2X1BA 4RNNA 1OY9A 2ZOMA 2G1HA 5KT5A 4N5SA 3DM2A 2AGPA 3RRHA 1LWXA 1Q1KA 3AOAA 3D1HA 3KLIB 3I9V9 3R5GA 1B3TA 4LBHA 4LF7F 2X7IA 4GKJJ 4DU8A 2LXUA 1P9YA 5SUHA 2A6MA 5KFCA 2Y1IA 4DR1J 2MKJA 2MKSA 2BOPA 3M2RB 1NK9A 2P5VA 4QWCA 4WFBQ 1ZPWX 1S6QB 4YR2A 4LREA 5AE2A 4OYAA 2PMWA 1H74A 2HZVA 4O3SA 2PI4A 2D9PA 4RNMA 4JI5J 3TVKA 1NDPA 2RNEA 3RJMB 2OMOA 3MOZA 2HWIA 1KLMA 3M9MB 4QZVB 3RR7A 2ZHAA 4TU8A 3I0RB 4P2SA 4DN0A 5DQHA 3MAAA 1YWXA 1N88A 2FZKB 3RRGA 2Y8WA 1WD6A 4DV5J 1NLKL 1FO1A 3G86A 4DUZJ 3HFZB 3LOUA 3CULA 2V9KA 4ZHRB 3GQCA 1EIYB 2XNQA 5C25A 3H5XA 3AH6A 4FYVB 1WF1A 1U1LA 1E6VB 4W98A 5IWAF 4O3RA 3D6TB 2OAUA 5CZXA 1TK0A 3UPFA 3O1LA 2AIRB 2QLFB 2E9ZA 3DLKA 2I2YA 4Z2XA 3MM8A 2R8HA 1WEXA 3DXSX 4RKUC 4Y6IA 1S1WB 1N56A 4EMDA 2IC3B 3PY8A 3C16B 4B3TF 4DL5A 5IT0A 3A8EA 1CEZA 2LP4A 2PC6A 1LWCB 2G9OA 4LRAA 2B4OA 4ZDNA 2B8PA 2UXBF 5E0OA 3D6HB 2CAJA 4K4WA 4LBPA 1FTRA 2HS3A 5HP1A 1HNVB 3GLJA 4I7FB 1VI7A 2I38A 3J7ZT 4LJMA 5C7PA 4B9SA 1FRXA 2J7KA 5KFDA 2JFKA 4DCJB 1N48A 4C98A 1HPZB 3HSJA 3LTOA 3V6DA 2KFZA 3ENQA 2NPIA 3ITHB 3I87A 3EGZA 3T6BA 3NXZA 2C2NA 3BSAA 4QBUA 4IKAA 4LR8A 2XY7A 3VVTA 5D78A 3MEKA 3IGVA 4RNFA 4TXSA 3A13A 2BRLA 1HBNA 5LT5A 3M6VA 3O3LA 4HH1A 1NZ8A 3NCPA 2XSJB 1Y7PA 1NK5A 3EXYA 5L9NA 5AXNA 4H4KA 1GT8A 5IM0B 3HHLB 3PX0A 1WHWA 2GAGC 5EDWA 1K0TA 2MPUA 5KAKA 3IA0A 1EP4B 4P10A 2X3GA 1GEHA 4ZJOA 1U24A 1AUSL 1IBCB 1DZ5A 4FVMA 5AJ3F 2F1FA 2AU0A 4O44B 4K7QA 4R25A 3H4DA 3TUJC 2G13A 4JI4J 1KOOA 3TA2A 1GMWA 1RTIB 2J0XA 2DNRA 2NZCA 2PEBA 3VAIA 3DDNA 2AX1A 5AXKA 3E2EA 4JV0A 1QAJA 4FPIA 3S7RA 2H5EA 1N32J 5DDPC 3GYXB 3DRRA 2HQCA 3EGWB 2VG5A 3GONA 4K4VA 3B8HA 2L9WA 3GFHA 2W8KA 4V1Ak 2YKMB 1F60B 4J9NA 2IMOA 3IM9A 1JB0C 1WHYA 3NG8A 1X31C 3PYFA 1HYSA 2GJIA 3GJRB 4TVAB 5IC4B 2E9RX 2V8VA 3C16A 2LXFA 3FUYA 4CH7A 2AP6A 2XS5A 4MAKA 2GHWA 2CUYA 4F04B 2FIUA 3KJVB 3MPDA 2EG2A 4NLRA 1NO8A 1TMMA 1HNVA 4NA2A 1NHKL 1GXTA 4UY8T 4JV5F 1SKRA 2B43A 2XYPB 2FUG9 4P9SA 5B0GA 2MLZA 1RTDA 3PW2A 2GHPA 1IM6A 3JSMB 4IG3B 2QT7A 2NREA 1U7LA 1BQXA 3TEGA 1SC3B 4MMOA 3MPVA 4J9SA 4IRCA 1N5VA 3FBCA 1TTHB 1KQFB 1MSWD 1Y0HA 2CZ4A 2K3IA 2BE7D 5GAEI 1PG5B 1X4HA 2PO4A 3OR2A 1HNXF 3QWPA 3BO3A 3W60A 3I4PA 4LT6A 2FZGB 4C0HA 4ECQA 2NXUA 2K1RB 3X1LB 2UU9J 1EAYC 2AYGA 3PO5A 1HI8A 3HMJG 1EKRA 4WYWA 2GMHA 1C0TA 2V2ZA 5EWGA 1HI0P 1KR4A 1HNIA 1EETB 2YKOA 1DTQB 3UNGC 2HBZB 2OGUA 3HVWA 5HBMB 3UN3A 5B09A 5KFHA 5ETRA 1S9EB 2DO4A 4B9NA 4NLGA 3CIMA 4MFBB 4FXDA 2QE5A 3MOJB 4DPOA 1JNRB 5D0RA 2IA0A 1GX5A 4HT7A 4P6QA 3DCAA 4FYWB 2BJ8A 9RUBA 4C8OA 4K59A 3EJMA 4ANDA 5D6GA 3KKFA 3KLFB 4OYWA 1SH2A 1VLYA 2CJ9A 5DO2A 3G8SA 4ICLB 1CJVB 5HVHA 2CFXA 3UR3C 2LEBA 3NMRA 2APOA 2B5JA 3H42A 1FE0A 1JIHA 5GAEU 4LMZA 1KVJA 2C2MB 3JTPA 3KJVA 6AT1B 1LFPA 1FKAF 3VALA 2BW2A 3OR1B 2ZBCA 3D2WA 3LALA 3I0SB 1SPBP 1RT3B 1VQOS 3R3TA 2EBGA 2ZHBA 3R97A 1VIOA 3H25A 4U96A 1NEEA 1JLGB 1NMEB 4F4KA 4Y28C 3PJ9A 4PR6A 4C48A 2DHAA 4BLGA 1LKZA 1HNWF 5KG7A 4IDKA 2WVCA 2HVIA 1KSPA 1UTAA 1X5OA 1IKWA 3WIVA 1TL7A 4RZRA 3PW7A 2V5HG 1RXOB 2H54B 1U1KA 3CC4S 4CCHA 5JXSA 1S9GB 2HHVA 2N3LA 2Q1LA 1RHJB 4MIAA 1M90T 1OJ4A 4ILRA 4WU3A 2AHOB 1ZS6A 5E41A 4J37A 3P5TL 2UXBJ 2FHJD 2AJ0A 8RUCA 2W25A 2YQ3A 2WSEC 2LECA 2GIFA 4PXDA 1U8WA 3LGHA 2VJUA 3LGMA 4LBIA 5A2QY 1XMQF 3MUMP 2AJQA 5L1JA 3MD1A 1AT1B 1RUSA 5ETPA 2ZVSA 3M1VB 2IVFB 3K5PA 3QNWB 3KXDA 4OYPA 3CWJA 2BVZA 2ASJA 4UOCA 4JV2A 2MEWA 4ZVHA 2MLXA 4ZPWR 1XC9A 4ERDA 3C14A 3DOMB 4MFBA 1YITS 1X5SA 4NXMF 1NJXA 3PR5B 2UUTA 1J5EF 4J9VA 4UT4A 4CO5A 2XMMA 2YNHB 4RW6B 4KRWA 4U67Q 4PQUB 2RJZA 4ICLA 1BQMA 3AAWB 4B9LA 4NCBA 5GAHI 3FK4A 3NKYA 3EZ5A 1NJWA 5G4DA 3GZ7A 4D3HA 1GXUA 3I5CA 3ZZOA 2W9CA 4RPFA 3OR1A 4BC7A 3I0SA 3CGIA 2J76E 2P9EA 2F5GA 4DLGA 2CIMA 4PXCA 3M8RA 3R1HA 2ZITA 1K1SA 4YS2A 3F0NA 1YRTA 2DO0A 4ZPTR 3PFOA 4WXWA 4TQSA 4DF8A 4CT8A 2WOMA 3ADAC 3C19A 3M8QB 1DY3A 1U8SA 4M5IA 5T7LB 1VISA 3BDPA 2BUNA 3QT5A 1M1GA 3IFEA 5ETKA 5KFIA 4OJ3A 4EGLA 2QL7B 4EBDA 4ZCMA 4RUCA 1S59A 1FKOB 5BR8J 1J5OB 2YNGA 2DGXA 2P6SA 1XIQA 1UPPA 4CLWA 3HHNB 1AA1B 3D5MA 3OTOF 3W3SA 3BPDA 1VCTA 2BQ3A 2QMXA 1VBKA 2HHPA 4KSEB 1S0MA 1NK7A 1SQGA 3HVTB 1CJKA 3IWNC 1A6LA 2BJ7A 4URQU 3MEEB 5DZ6A 3ZTOA 4AYBD 5T14A 3MR6A 4JV5J 2CQ4A 1R0CB 1BUXA 3FCHA 1WDTA 1GMUA 3FRZA 1NK6A 2F8EX 4EU0A 3BQ1A 1MW7A 2W2MP 3ENVA 4MIBA 3MFIA 2GJFA 3K8WA 1XMBA 3H90A 1EX8A 3HVRA 3Q8VA 5B0DA 4NLWA 2Y1RI 1PSDA 4MKYA 3D4JA 1HNXJ 2BW7A 3KMQA 1KDNA 4F0MA 4RUBA 1NB2A 1HA1A 1HBUA 2F40A 5F8JA 2PE8A 1HIYA 4OX6A 4USIA 2YX1A 4WP8A 3GIJA 1MN7A 1IM4A 2CJBA 2CQPA 2HGNA 2AGOA 2Z56B 3AJDA 2PA8D 2MKCA 2V8HA 2CWXA 5HK4A 2DBBA 2A1BA 2UV8G 3SSRA 4C11B 5HMXA 1UCNA 1S5ZA 2EPIA 4MYUA 4AUKA 3DC2A 5LJ5Y 5A8RA 3LPYA 1QAXA 2I0XA 2JC0A 1SL0A 2HS4A 4I6YA 2UXCF 3UDVA 4EZ9A 3SCIE 3IAS9 4C2MA 3V6KA 3C46A 3E3XA 2ZBPA 3T9ZA 2W1BA 2B51A 2KTQA 3D67A 2YKQA 1CQNA 3T19A 3KUGA 1HR0J 3SZ2A 3PV8A 4LSNA 2VC0A 1X4BA 3MM6A 2D9OA 4UOHA 3HJVA 4WKYA 2F63A 3IXQA 2B6AA 2BKPA 3QZ8A 3FSYA 2DGVA 3W65A 3AB2B 4LRCA 1N0UA 2AF6A 4NZ6A 2RDJA 1JLFB 1JLEA 2IVYA 1JXVA 3TVYA 2BA9A 4NRTA 1N54B 2MKIA 1NSKL 1HL6A 4USTA 2CNKB 2DNPA 3N79A 5E33A 3PHTA 3OJUA 5FIIA 2UXDJ 1UFKA 3NY0A 2CPHA 3QIPB 1ZYQA 4K8RA 1I94F 3CDWA 4DPYA 3G6VA 3BDEA 3O5TB 3UI3A 3FDSA 2ZUAA 1CC7A 1X0FA 5CXTA 1E6YA 4WXOA 4IH7A 1YJWS 4K4UA 3EYZA 1KC8T 4B17A 5F8MA 3OFHA 2F8MA 5E3RA 5DDQC 2E5GA 3QGHA 2LU1A 5H9FJ 2DH9A 3MM7B 4HI2A 1D8YA 3ZZYA 2I9SA 4DQQA 1XMQJ 3KG1A 4P7TA 2OPQB 3P8BB 3OPKA 2GX8A 3CD7A 1T7PA 3TAMB 4OI2A 3HZEA 3SBMA 3FGVA 4KT0C 3G82A 3SCLE 1TKDA 4WP3A 3JS9A 1QAIA 5KTQA 4AQYF 4O4GB 1XN9A 3ZC4A 1REGX 2DISA 2QMWA 2QV6A 3IM8A 4NXMJ 3HULA 1XMOJ 5ETSA 4DX8H 4Y2MA 3UR0A 1JXEA 4CT9A 3G71S 2C3MA 3QWUA 1HHQA 3NS6A 1RBLA 3DI6B 1BXNA 5CYQB 3O8WA 3UDEA 4OZ3A 3CJKA 3OW2R 4DQIA 3DLEA 2JSXA 4RW4B 1X9WA 4I1TA 3G9CA 3QZ7A 1LWFA 4ZVEA 2Y9HA 4DLEA 3DXBA 3LP0B 5D4PA 2NYIA 4K50A 1FD2A 1FWKA 2CZ9A 2VASA 3UN5A 4PYDA 1FF2A 2VOPA 5DG8A 3E01B 1QD1A 1R0BG 2UUWA 4QW8A 4X65F 3ZFVA 3DFEA 1S0NA 3NGUA 4F3OA 2VKZG 3MAQA 3PW0A 1UVIA 4LSLA 4ECVA 4DR6F 1DQ9A 1TFWA 3DLGB 4WWSA 3F56A 4YDDB 3ZTRA 3MI7X 2DNOA 1ZAXA 4WF9Q 4K2JA 1SIZA 5CCMA 1REVA 2YY3A 4PG4A 2VPZB 1K9MT 4EYIB 2KZZA 1SJ3P 4J91A 1IBMJ 2B4UA 3CEDA 4FF2A 3MHYA 3KUHA 1OQ3A 4A8MP 3PG9A 2XLJA 1S57A 1I5OB 1IKVA 2DNHA 3RW7A 4U8YA 3UNYA 1HNZJ 4LR9A 4DG1A 4AL7A 4LVOP 5CH7B 4Q2LA 3DRSB 1TKZB 1VQ5S 1CJUB 3H2LA 1ZAVA 3IN5A 2MQPA 3EVWA 4FXVA 1WKLA 2IIHA 1VQ8S 1ULRA 1VQ6S 2AV5A 4OYIA 1T9VA 4QYZK 3THVA 5EN1A 1FXDA 1X5TA 2AJFE 4PQAA 5KOXA 3G6YA 1FDAA 2BKOA 3L09A 2GFFA 2DGOA 1FCAA 4ZJLA 2J5AA 3CJRA 1S1VA 1SJFA 6FD1A 3HO1A 2GC8A 4DR7F 4QIVA 1WDDA 3DU5A 4ZVGA 3T1AA 3C15B 3SSSA 2LDYA 1KBRA 4CM0A 5G0RB 2H51B 3EX7B 4O23A 5D4NA 1G7CB 1RK8A 2HQ3A 2VODA 2EC2A 1YBUA 1U2FA 4PWDA 1KONA 2RQCA 3AD7C 3GR1A 4ELTA 5F41A 2ZBQA 1BD6A 5HO4A 4OX8A 3V81A 3L3CA 3J80U 5HSPA 2UVWA 4M94A 3E01A 3IS9B 4OYMA 2J6UA 5D3GA 3ISNC 3IGNA 3CTRA 2CPXA 4CLFA 2HHSA 2UXCJ 2R8GA 2BANB 3BREA 2K7KA 1U1OA 1UVMA 5IT9Y 4DV7F 2AZ1A 2NUHA 4BWJA 2BJ3A 1JLBA 1PJ7A 3R7SB 4HI1A 2W4CA 3OXGA 3FEYB 1LWEB 2H9ZA 1N36F 4ETXA 1JLQB 1TL3B 5ETLA 1S4EA 5AXMA 4N8OA 3NS5A 2HWHA 1U1PA 4GO5X 1F1BB 3KLGB 1UJ5A 3FMBA 2YKPA 4NZ7A 5B7WA 3PM9A 4M1KA 1VRQC 1N5QA 1RAAB 4O0NA 4ZS6A 1YHQS 1RADB 4FKYA 1FTCA 1R8CA 3ZTSA 1TKZA 3D3BJ 2QA2A 1U1RA 1P8GA 3EVMA 4X4OA 2NUUG 4JP8A 4ZP7A 1WOPA 2KI2A 2QFIA 3PX4A 1F5BA 1X5PA 2YWWA 3JTNA 3W1YC 3DOKA 3VZHA 4WCEQ 1SH3A 3JTOA 1U6FA 1QE1B 2H4YB 2MQMA 4KH1B 3TO8A 4L72B 2HKEA 4OI0A 5KFGA 4M5MA 1JKHB 3OL6A 2HFVA 1D9AA 4K0KJ 1WWHA 4ZA1A 3DRPA 2FPHX 5J2MB 5LXRA 4JI6J 3U1MA 1WC1A 3MECB 2HFZA 1S6PB 4ENOA 1T3OA 1C1BA 5IXUA 4F2RA 1WACA 2AW0A 1FRHA 3VQSA 3QRPA 4KFBB 3ZZPA 1S1UB 5CA5A 3KHRA 4P71A 3KJNB 2HBQB 2VFVA 2BJEA 3PIOQ 3ZO7A 3PIPQ 3MXHP 4DV6F 3LANA 3QAUA 4FZVA 3MPYA 2Z2YB 4PG6A 1SIWB 3QT8A 2C3YA 3DOLA 3V2UC 5HROB 3MM9B 2F3JA 1UFWA 2DTJA 4F02A 4NLSA 3D28A 1Q8KA 3GMGA 4IH5A 4QIGA 1CG2A 3FEXB 4P74A 1GAOA 4DSLA 1GMVA 3LO3A 3C6UB 3NCQA 2G1DA 3GJSB 1LWEA 3ICLA 3MM5A 3H5YA 1OSCA 2YX4A 5CD4H 3ENWA 3TZYA 1XK8A 5L9XA 4JI8F 2ASDA 1TL3A 3TP2A 1PIEA 2RB7A 8ATCB 4C8MA 5J1EB 1GMWD 4MKAA 2JLFA 1FJEB 3Q2SC 2FJBB 1MROA 1SI9A 3KLHA 4DOZA 3TZWA 5F8IA 1MWYA 2MY7A 3QMQA 3KOAA 1L5UA 5J1NA 3NLCA 2XC9A 2Q66A 4RBTA 1X8DA 2MZQA 3K57A 3R5BA 3GIIA 2JLEA 1TELA 1TAQA 1NPRA 3K5NA 1U0HB 2ZEJA 3LP1B 5HLFA 3LGNA 3SCKE 3SV4A 1L3KA 2DITA 3CO9A 3E51A 1VBZA 1RT1B 2UUCF 1QE1A 1KEKA 2C3PA 2WRMA 1RBOB 2V94A 3ELHA 1JJ2R 1AZSB 4I64A 1BWVA 3RB3A 1QLNA 3TRGA 2HMIB 3VAJA 2X1GA 2JHEA 1VLOA 5LXYA 3OFGA 1SC6A 3EPIA 3MMAB 4OI3A 1S6PA 2C28A 1G4CA 1U4BA 2V6AA 2DGTA 2OFHX 3QBCA 4NLVA 3TJ8A 1VJWA 2VFSA 4KFBA 3U7JA 1UVJA 3PHEA 3PEJA 2CKWA 1FNXH 2OPPB 3NRBA 1YRXA 2DNQA 3QGPA 4I56A 4NL5A 3TYTA 3PKYA 3X3UA 4ZOSA 2N82B 1H2TZ 1YBAA 4O0IA 1RWUA 1F2HA 4WE1B 1WSVA 2DY1A 2PMZD 4AXIA 3SQGA 2XO7A 2BR0A 2DIUA 2OPSA 1M5OC 3CF5Q 3PNIA 3UDLA 1WI8A 1QTMA 2QLBB 1FERA 1DHMA 1C0UA 1WKJA 4TU9A 4ZCLA 1SKSA 3PTWA 4EO6A 4RBVA 2JX2A 1CS4B 3RG6A 2CQ2A 4OX7A 3QQCD 3BKUA 1RWKB 4CDIA 3G6XA 2K2PA 2FVCA 2HGMA 2R2RA 3MMJA 3M8WA 2PT0A 1RT6B 5J1EA 1D9DA 3LP2B 2BBEA 4NLYA 3BBBA 1Q8BA 4X4RA 3I56S 3MR5A 5IS2A 2FVSA 2FC9A 2NSBA 2VB6A 3M9OB 2F4VJ 3ILLA 4ID5B 2F65A 1FK9A 3OVSA 2CQ3A 5HI7A 4KKOA 3LF0A 1ZTTA 1IBLJ 1NCLA 4CO2A 3QSIA 1WTFA 2RKIB 4WK3A 3L7PA 4F4XA 2GV1A 5M2RA 3S8SA 4H4KC 1TL1A 4NLDA 4WU2A 2H1YA 2G0IA 3LH2S 4WFAQ 4GC6A 1VRTB 1N33F 4WPAA 2CJAA 1RT1A 2IJFA 2YPYA 2XCPA 1Q4RA 4YR3A 3N6LA 5K20B 1H2UX 1OQ6A 2XMAA 1O51A 1QVFR 1VRUA 1HQEB 3RB6A 1KVIA 1L3VA 2HHUA 3OFEA 3LUYA 4IUFA 2HHQA 2QRRA 2XCAA 2KM8B 4DV3F 2R7VA 3Q0AA 1EB0A 2CNOB 2A3JA 4KY3A 4HH0A 1RZMA 1D8ZA 4X84A 1D9FA 1RA7A 4R5PB 3P45B 1FEEA 2JC1A 2G4BA 1FI4A 2DRBA 5A6PA 2KG0A 4DV1F 1RISA 3LW5C 1M5VC 4OZNA 5CABA 1RT2A 2HHHF 2HNDA 4FS2A 3DRYA 1TR0A 2M7SA 1O8BA 3CMQA 4OHYA 2RU9A 4FVCA 2J9DA 4B9MA 4F4AA 3G8TA 2CJKA 3G96A 1YJUA 1S1XA 2WONB 4CO3A 3KTQA 1M5PC 4IG0B 1MLAA 2HBRB 4AXJA 2C2OB 2CPYA 1GQEA 2AD9A 4UTGA 4P75A 1JMTA 2PA3A 4ZVPB 2Q6BA 1UKUA 3MURP 2HVDA 2V67A 2AYEA 4HACB 2XZTB 1JLCB 1YK9A 4J9RA 3MMCA 3SXLA 3NNAA 3DLHA 3JXOA 3D1QA 2MKHA 2ZKTA 1N5YA 4HEA9 3D3CJ 2ZH6A 5D8HB 3LP2A 2CWKA 2KO1A 3CW2C 3CSKA 2OTLS 4U8VA 5FLXY 1RT4A 4DV2F 4DR4F 2AMCB 2VL1A 1TUGB 4JYAF 4DPWA 3TR5A 4Q0BB 4Y2KA 1N0VC 4QR2A 2NXJA 2FVRA 5F9NA 4KHPF 4ZN1A 1UWBB 2GJ2A 3J81Y 3OTEA 4OYBA 3VWSA 2M5YA 1H6KX 3FKBA 3U1LA 4DZDA 1TL5A 2W7OA 4PXBA 3HHLC 2MB0B 3CCZA 2DD8S 2IAJB 1T9WA 3TI0A 4V19J 3IR6B 3C6TA 4QWAA 1ZETA 1IVZA 1YJVA 5FDLB 2B56A 2D3OR 3AJ2A 2XMJA 1OYEA 1T05B 4ITSA 3M30B 4FYXB 2XG8A 5IFMA 4I67A 4LF4F 4DX6A 5KFMA 2OD6A 3MR2A 2FLLA 2OUGA 3TQ1A 3IC1A 2AGQA 2YWGA 2MZTA 4KO0B 1Y3KA 2RRBA 3PR4A 4EBEA 1KWMA 2PIIA 3AB4B 3GG0A 1T9XA 3KDOA 2EG1A 2J7WA 2WK4A 2YBVA 4NCGB 2LMIA 1V9OA 2XLKA 3THTA 5D0GA 1XWLA 1FRIA 1NSQA 3CXCR 4N47A 1FRKA 1Q53A 1LK7A 4M95A 2VBZA 1RA6A 2WONA 3KNAA 2CYYA 2W24A 4OHZA 1KQGB 2L9DA 2F9JA 3N4WA 3PFEA 3CJQA 1HBOB 2LA4A 4Y65A 1AFIA 3MTKA 3M6WA 2JNJA 2Q3PA 3KK1B 4C0BA 1QSSA 3BYRA 5JUMA 4X4QA 1RAGB 5LMNJ 3G4SS 3VGUA 2WHOA 4ZCIA 1HARA 3G2XA 3UN2A 3IG1A 2ATLA 2H4WB 4DR1F 2LLZA 4KTQA 5HMWA 4PYAA 2ZOGA 3CIZA 4DPXA 1UFLA 1F6TA 2FJVA 2HWTA 2BE2B 2O67A 1C1CB 1YVFA 2YPZA 4ZCKA 2RE1A 1UWBA 1DBDA 1UW4A 1VQPS 5K8OA 1FVQA 4I2PA 2KDOA 4V19X 3KG4A 5GAGU 5F8GA 4GVBA 1FFSB 4ECRA 3P49B 2UP1A 2DR6A 2XWXA 4RW8B 2C2RA 4DV5F 2Z2LA 3GB0A 1P9QC 2IM0A 2ZC3A 4J5OA 3OXLA 2DRDA 2F4FA 3SSQA 2R2SA 1FRJA 3LWLA 4LFBF 4NLPA 2QLXA 2QYGA 3Q89A 5EUHA 3CD5A 2KHDA 1X0PA 3IRWP 3UCGA 3WDOA 1TV6B 5A8KA 2BXJA 3VTIA 2DNKA 2HURA 2ZJPQ 4ECSA 5GMDA 2MQOA 3PDNA 4NMXA 3IRXB 2HIYA 2HSEB 1NXIA 1PBAA 2VV5A 1M1HA 2L08A 2HNZA 2IM1A 3AD9C 1JLAB 4AL6A 4DSIA 3O2IA 2BEFA 2DNLA 4MYTA 2KYXA 5DETA 2DGSA 2KB2A 4MJKA 1RCXB 2FJDB 3AXKA 3FBEA 1CULB 3PYGA 1Z1ZA 2C2KB 1LV5A 4K4ZA 1HHTP 3KDNA 2ZE2B 5CQGA 4WZMA 4HHHA 3TOQA 2QYCA 2N7CA 1Y00A 2QN6B 1VHIA 4CO0A 1XTZA 1S1TA 4X4TA 1DJ0A 1QSLA 1RE1B 2DNGA 2P9GA 4WFZA 3KHHA 5GMKa 3DDKA 4AT1B 1Y9OA 1N34J 2GO9A 2GNKA 4YB7A 4CO4A 4B9UA 4CQ1A 4A8QA 4JI2J 2BM1A 2W7AA 1U6BA 3UQSA 1RWXB 1Z2LA 2SXLA 1LOUA 4F7VA 2DGQA 1RTHB 3Q2TC 2ADBA 4HT5A 2CNNB 2MSTA 1SKUB 3H20A 2XNRA 1U1MA 1OS5A 2FTRA 4B3OA 4DUTA 2ZFHA 3T41A 4ZVFA 1EHWA 3DM2B 4MIWA 3J81j 4RW8A 2HQGA 5B08A 2VG7B 1BGXT 4B3SJ 4HKQA 4HTJA 3BN7A 3PRDA 2F7VA 1UL3A 3FBBA 3TX8A 1N32F 5H1SV 4TU7A 1T9YA 4OHWA 5CYMA 2V8DA 2DXFA 4CYUA 3RW6A 3FRYA 2MMYA 4YY3J 5IV3A 3D68A 2V34A 5DM6Q 1Y11A 4JYAJ 4EO8A 1HW9A 1XQIA 2ILYA 1KLMB 4FN5A 4FPRA 3T9NA 4TYAA 2Z58B 1NSPA 1FFGB 2RUSA 4ZVUB 1SL1A 3IRXA 1CC8A 4DI6A 2GVDA 3QGIA 2XI2A 2CXEA 4YB5A 3MAAB 1WF2A 3M2UA 3OV7A 1WG4A 2CG8A 3A4TA 4N56A 3DNCA 5C25B 2LU2A 1KFSA 3O6QA 2HK3A 5J2PA 1VQKS 3P4UB 3FVYA 2J0WA 5CZVA 3GIMA 1Q5YA 4LFAJ 4LF4J 1ZBTA 5LOQA 3CDEA 4EFAC 2CNLB 3OQ2A 3PX6A 3DLKB 4DL2A 3MM8B 2W2OP 4QQBA 5A2QU 5HANA 4DCOB 3OJSA 2MDAA 5KFPA 2QZ8A 2C2EA 1PILA 3AY0A 4NLXA 2OH2A 2W2PP 1ZOTA 2VFRA 3M8PA 4GRSA 5K8MA 1ZA1B 3NGKA 1DRZA 4BCAA 2GHVC 4Y0FA 5HP1B 3BH7B 1RHRB 4ECUA 3M32A 5I4MA 1F3VA 1R43A 1V6HA 3GSDA 2V69A 2CQGA 4U95A 2V4QA 5K9FA 2OJ3A 2I1RA 3HDSA 1C4AA 4HTIA 2DH8A 2UU9F 2JJ4D 4FYYB 4A8KA 4IFVA 4DX5A 4WTOB 1AUDA 4G1QB 3CMES 2BM0A 2HIQA 3V6DB 3F73A 3H0PA 2VH7A 1UVLA 1ITPA 1IKXA 2WW8A 4PPDA 5E3CA 3OTCA 3SV3A 2VG7A 1H38A 3F44A 1NK0A 3NS7B 2OHDA 2RQ4A 4QW9A 4AD6A 3PEHA 3KNGA 2XO6A 1H72C 3VV2B 2VONA 1BC6A 4L76A 3H59A 2XMTA 1YTYA 2ZDOA 4GMKA 4F67A 1HBNB 3ET6A 2MXYA 1UETA 4UZBA 2XMKA 3MEDA 1U48A 1LQ9A 1U45A 4ZPBA 1VDHA 1GK8A 2POKA 1PC4A 2L41A 2B9XA 2GGPA 2ROGA 1ZZNA 4BDPA 5DZ7A 1LNQA 4F4YA 3CPWR 3CD6S 4ANEA 4UUWA 3U02A 1MMDA 3HVAA 1K73T 2CPIA 4ZITA 6FDRA 4ZP6A 1RWVB 4X4SA 2FHOB 4G6VB 2GQQA 3WHIA 2EW9A 4PUOA 2E9TA 2ATCB 2R8KA 3V4IA 2ACMA 5KFBA 2DR9A 1NDCA 3DRRB 4LFBJ 2VG5B 2KJWA 1W7WA 4NXNJ 3V6JA 3PACA 2HVHA 3VAKA 2RRAA 3HSDA 3MCSA 2JLGA 4QIFA 1HYSB 3OXFA 2EK1A 5ETOA 1RTJA 2OEJA 1UA0A 5I42A 2GQCA 1PYOB 1QVGR 3AFGA 4IO1A 4IFYA 1WHVA 5A0YA 4I2QA 1V3ZA 1RTDB 3QRRA 3ZZZA 1HMVA 2EK6A 2CQCA 3BKTA 3IAM9 4G1QA 2E7XA 4TY9A 1VGYA 2YWHA 1SV5A 2EFNA 1OIAA 1F9EB 5CHCB 1UVNA 4RBUA 3MEGA 2DR8A 4HL9A 3VAGA 2FYXA 2ZDPA 3OR2B 5DJBA 4DR5J 1JNZB 2M9KA 4X4PA 2PFDA 4C3KA 1WELA 2VG6A 1HWKA 5LSLA 2E5LJ 2LEAA 2ILZA 2BYCA 2JL9A 1RDRA 2PDAA 2V68A 2WW4A 1JX4A 1Z2ZA 1RKIA 5AXLA 3K5MA 4DL4A 1WG1A 1C0TB 2OIHA 4B3MJ 1HNIB 3QLHA 4K5RA 3GIRA 1KVKA 2HEKA 2HVEA 4M8LA 3H5UA 3W2VA 5LSOA 4IH6A 4LF5J 4Y3CA 4USUA 3DGPA 2D74B 5J2NA 1S0VA 4OHXA 1T3NA 2OMLA 3FQKA 1RABB 4M5KA 1WC5A 4M5DA 4XDCA 5IT4A 2KJVA 1RWNB 1MMLA 3IR5B 2QJ3A 3NEKA 1G6BA 2M0GB 3BSCA 3T1YJ 4C9DA 4ZN3A 5BR8F 2E5JA 4C7QA 3NWGA 1U47A 1P27B 1HBMA 1V3RA 4WZQA 4USMA 3M05A 2RSQA 1DQ8A 2B5JB 3MUVP 3NMAA 2B3TB 4WIIA 3NL0A 3IBWA 1RHKB 2F8HA 3BQ0A 1OYDA 4L3NA 1RYRA 1UJ6A 3W63A 1T03A 3QATA 1S9FA 1X4CA 2LDIA 5LM7E 3T1HJ 2HHXA 4ZJQA 2CPJA 1FJGJ 2IPOB 1LW0A 2BRKA 2GAHC 2AX0A 4J9KA 3KK3A 2ERRA 4RJVA 1RWWB 3CJ0A 1MWQA 4IDKB 2FDNA 4LFCJ 1U1QA 3NWRA 2MGZA 3UCUP 1IKWB 1URRA 3R7NB 2B9EA 2YXLA 1TL7B 4J9QA 4Y00A 4ED3A 4KB7A 1TAUA 3BF4A 1L3SA 4KGVB 3C3LA 1SC4B 1EQMA 3MWBA 3J7Z5 3I96A 4WBFA 3WIUA 4URGA 2WVBA 2L3MA 4PABA 2Z30B 2J9EA 3MAHA 2QC3A 3AXMA 2ZH4A 4W92B 2MTLA 2PEHA 2EFQA 4NE9C 1HKAA 2R9LA 3M8YA 2CVEA 1GX6A 2HFOA 3I5BA 4FF4A 4H4MB 4DEZA 5HJXA 2C3UA 4LF8J 5E3PA 1S76D 4M5LA 3EDQB 1RU2A 1X4GA 3J80Y 2UVVA 3C14B 3PO4A 1B70B 2K3KA 3VR1A 1N6QA 4CTAA 1B99A 3AJ1A 2QO3A 2VDHA 2M88A 2MQ8A 4OI4A 1AYEA 5MLCV 4PXEA 3KFWX 3D0IE 2HLTA 5HAOA 1HR0F 5FD1A 1FWLA 2W4PA 1YJ7A 2HQIA 2CPEA 2RUGA 1BQMB 1VQ9S 2ZWOA 4C8YA 2QSFA 4CZCA 4URSA 1YDLA 2H65B 2UV8A 1VC0A 1LW2A 2MJUA 1R0AA 2R7SA 2W9CB 1CVJA 1A9NB 4WFNQ 3T5JA 2XMVA 3Q8QB 3CDUA 4G65A 4H4OA 4OI1A 1CLFA 3SQOP 3ETMA 1MG7A 2GA7A 3BH6B 2WOMB 4TY8A 1IWAA 1U0SA 1WOOA 3V4MA 2BOAA 4Z37A 3FFIA 3SMZA 2E5HA 2UXDF 1QDUB 4ZVQB 3P6YC 2AQ4A 3HF5A 2YNGB 2XM3A 2VQFJ 3D1OA 4F50A 2JH3A 4CLSA 4DV4J 4C97A 2LA6A 1F3FA 3KJQB 5I3QA 2WZ1A 3JAMY 3M2VB 4UY85 1CJKB 1UJ4A 2KKHA 1TVRA 5B0BA 3UVJA 5DM7Q 1OPZA 3F41A 4O3OA 4EUVA 4OMFG 3TUZC 4DV0J 1NRKA 2ZJRQ 3BQ2A 4KHRA 4NOHA 3IWXA 1DLOA 3JSBA 3RAQA 2YTCA 1DFDA 4IR9A 1FFWB 1JJ4A 2R8JA 1XBWA 2DJWA 1RT5A 1G2EA 3C66A 1NKBA 3CCSS 3CCES 1H7WA 2P6TA 4NLOA 4H4MA 1B4SA 4OV1A 2W9AA 3A3OB 5KG2A 4QWEA 2HPUA 3C8YA 2UVUA 3PRBA 1R8BA 1UP1A 5AE1A 2HRYA 2AYBA 1I6JA 4DQSA 2NXNA 3IP0A 1XMOF 2ABYA 4IO9Q 1A0OB 3CNQP 3MMBA 1T94A 2FJAB 1FDBA 2EWHA 1HBUB 2WVEA 3S1TA 5BYQA 7FDRA 3R27A 3T5LA 3GFZA 2QFJA 1QTNB 4ILMA 2M70A 4ZVTB 2B9YA 3OHBA 4GKKJ 4B08A 1F0XA 4J9MA 1SUQA 5IT9U 2OO4A 2GMJA 1PJ6A 2HVZA 4X62J 3AQOA 4E0DA 1U6ZA 4KGZB 1K8AT 1ZM4A 4PCQA 1RJJA 3B82A 5A8RB 1B64A 1IWGA 5HJYA 2HW3A 2XEXA 1XERA 3BYPA 2E1MC 1PYSB 2Y0SD 2GS8A 4I6WA 4DR3J 4IYQA 2RS8A 1VJQA 3NNCA 5E2QA 3QFWA 1TUVA 3LPEA 4DPUA 5JMNA 4LSNB 3MM6B 4ALZA 3JSYA 2NZ4A 2HLUA 3RTVA 1NK8A 3BM7A 1IBMF 2B6AB 3NGTA 1UEUA 2A2CA 1KNZA 3RYLA 3WQPA 1Q81T 3M2VA 3NBPB 2W2QP 4UW2A 5C5JA 1WC3A 3PCOB 5CD4A 1FE4A 2VA2A 4KBIA 2J9DE 1HNZF 1JLEB 3K2YA 2V2VA 2KH9A 3KYLA 1TFYA 1FNMA 5E3QA 1F5AA 5GAHU 1FA0A 3JB9k 1RAIB 5IC6B 3PJXA 5K14A 1I1GA 3Q8PB 2VQEF 4E98A 2BX6A 3BGRA 2B0GA 3TA0A 4CLUA 5BYSA 3K5LA 3R5CA 5KG0A 4CWBA 2V2QA 3OTBA 3N28A 5GADI 5F3ZA 2XS2A 4CP5A 2QLWA 3HPOA 3RBEA 1E6YB 2GZOA 1IR2A 4KGKA 5C2GA 1VBYA 2VA3A 3GV5B 2XZWA 2ZOFA 4QU7A 2ZC4A 3B6BA 2HS0A 3DHXA 4IQXA 2XZDB 2PFFB 2XY6A 3GCXP 4LF9F 1H0HB 1YGYA 3RB4A 4P73A 5A76A 5HATA 3C2PA 1U49A 2M3DA 1BHNA 3E8OA 3RUBL 1IJEB 4ZPDA 5KFRA 2J8AA 4DUYF 2ZKUA 3G82B 4RU9A 4PG7A 4YHHJ 2BDPA 3GG1A 2M2BA 1PJ5A 1UA1A 4ZKAA 3D54A 2L48A 2ZD1A 2FC8A 4OZJA 4ED1A 2NXCA 3GSIA 4ECZA 1HQUB 2R2UA 1BQNA 4U9RA 3TAQA 2ZZTA 4JI0J 3CJKB 3AODA 3SDEA 1ZM2A 3DLEB 4A8XA 4TQRA 3GU0A 1NBEB 2QIFA 1LWFB 3UE2A 4OJHA 2M4MA 2ZH9A 1W26A 2RQKA 7FD1A 4OYXA 3FZBA 4WFYA 3WX4A 4I69A 4KGMA 4J90A 4JI3J 4PWUA 3CUNA 2NPFA 1HLWA 3NBPA 4FNHA 1LEOA 4B3RJ 4F2SA 1MN9A 2DCLA 2QA4S 2Q43A 2FGOA 2IBOA 3IMQJ 1X60A 5KG4A 2C1EB 2OEMA 4LR7A 3LA0A 5DLFA 2ADCA 5HQLA 3OLBA 3FC9A 2B4VA 4LSLB 1TK5A 3VCDA 2C3OA 4X64J 2G0JA 3HI9A 5C42A 1B7YB 2E1RA 1L3UA 2HNYA 5HQ8A 1REVB 1SCJB 2AJ4A 1HQ2A 3BGLA 1D1UA 1GTEA 2XI3A 4K0KF 2ZM6F 4NCAA 5FJ4A 1DTTA 3JSRA 4KGXB 1YKWA 1VHFA 4JI6F 4RW9A 4F0HA 3HFVA 2DHGA 4RLEA 4LVNP 1M1KT 3JYTB 3W5YA 1IKVB 3ZTPA 2UUAJ 2ZJQQ 4DG1B 3B78A 3OLAA 2V0NA 2OEKA 2KM8C 4Q5VA 4M5JA 3KHGA 1Q79A 5B0AA 1RGVA 2KXNB 3CJ2A 2IYGA 3B4DA 1Q7LB 1S12A 4NI2A 3Q23A 4DBQA 3D0HE 3W61A 4PRFA 3FBFA 4MK9A 1OWXA 5H9FK 2FY1A 5ETTA 2KXFA 3BZQA 3NGSA 1FD8A 1GXLA 3HP6A 1IR0A 4DS4A 1IKYA 4O3QA 1BMQB 1TU0B 4DL6A 2IBKA 3DYAA 1JXLA 1S1VB 4BWMA 1PCAA 3BR8A 4ES2A 4JI1J 1HQUA 3VGVA 1FDDA 2DRAA 2RT3A 2MHEA 2GIRA 4ECXA 5DS7A 1V3SA 1YX2A 1S79A 1TQLA 3EUNA 2IRUA 1N8RT 1FHTA 1UAWA 1RT7A 1AW0A 3HT3A 3KLEB 4WP9A 2ZH8A 1H98A 3MCMA 1M0SA 4PWDB 1WORA 2DYAA 3HHDA 4YP3A 1FKPB 2HAIA 3GFXA 4J7CA 1UEVA 4P72A 3V81B 5I3UA 4F25A 1OPIA 1AB8A 3V5RA 1Q16B 4A8YA 1S6OA 2OLWA 2QX0A 5D3GB 2ASLA 3S01A 2K7JA 3SFGA 3DMJB 2E1CA 1NJZA 3TJ9A 1TP7A 3CMAS 1RU1A 4F8RA 2G2YA 4EYHB 3SI8A 4R8UA 2NYHA 2M8HA 2J6TA 2D7SA 1JLBB 4PG8A 2R2TA 3M8SA 3L7OA 4RUAA 2AT1B 2J8SA 1NDKA 1VFJA 3KLIA 3QJLA 3QFHA 2W2NP 3R2CJ 1AROP 3HJFA 3VVUA 1WF0A 4MK8A 1JJHA 1YI2S 3U27A 2D3ZA 3M2RA 3LWMA 2EFVA 1TKTB 2J7UA 5KFYA 1S6QA 3BPSP 3JYTA 4CI0B 3SEOA 1U02A 4WIQA 1RAHB 3UO0A 5KG5A 2QG9B 2UUBF 2A18A 3HCXA 2RD5C 2VQEJ 3I0RA 1RWMB 3CO0P 2EVZA 4W4MA 3DOKB 4OV6A 3MFHA 4P52A 3A8KA 4QJVA 1IJFB 1FVSA 1H73A 1R6YA 3SYZA 1CJTB 2HZCA 3GTYX 5BYRA 3OL7A 4NYZA 2AKWB 1D0EA 5MAOA 4ZHRA 2DIVA 4KIAA 5HN0A 5FLXU 3DRPB 3BGFA 2YQ0A 3HXMA 1E6VA 1EZZB 4FF1A 2A6OA 1C1BB 1RLDA 3EPGA 4LF9J 3DDIA 3H7HB 4LIWA 3J81U 5D0HA 4QIEA 4F26A 3MCOA 3OFFA 2MKKA 3KLEA 2C2DA 3NP5A 2B7CB 1NKCA 1S1WA 1Q86T 3IWLA 1X9SA 2IC3A 1XR6A 4DL0C 1FKPA 1LWCA 3CCWA 4N41A 2KT5A 4DUYJ 2Y1JA 1I51B 5KFUA 2F4VF 4X2BA 2KRRA 1PGZA 4A47A 2IA6A 1LFWA 3J7AN 2E44A 4I7FA 1VC6A 1RWOB 2PSZA 1B0PA 1IBLF 1S97A 2FQQB 4Y2CA 4F4WA 3DMJA 3HHKA 3H98A 4WK1A 4DU7A 3I55S 3DOLB 5JVHQ 1EJ7L 4AFFA 3TZZA 5KFVA 3HD2A 5B0EA 4YB6A 1HPZA 1R8HA 3JQMA 2AEMA 1NNDA 1UW9A 1CBKA 2RH3A 3WC2A 1VQLS 2YWEA 1S4FA 2Q6CA 3ITHA 4ZMMA 1W2IA 5KT6A 1XR7A 3MM5B 3POTB 3J7YI 1RP5A 2DKOB 4CLZA 1G3OA 1N5TA 2XTJP 3CDAA 4OLPA 4ID8A 4DPTA 2DY9A 3GE9A 1WKKA 4DQRA 2HBYB 4OYOA 1MROB 3UD3P 3KLHB 1S77D 4LF6F 1PO6A 1YQHA 4OZ2A 1TKTA 1SXLA 2FVQA 3UCZP 5F8HA 5DGAA 4FP9A 2VBWA 2XSJA 2P9CA 2FGCA 3SIPB 1VC5A 3KJFB 1YJTA 3BBCA 1KHWA 5IM0A 3HHLA 4U7UK 4YN3B 1UMJA 2DHXA 2LEPA 3KWMA 2VFTA 1AFJA 5HLFB 1EP4A 5IV4A 1JJCB 2Z8QA 5DG7A 1NM2A 3CT9A 3G87A 4O44A 1YBTA 4DFJA 3VF0B 3QT7A 2IHR1 1XNQF 3I6PA 1KQKA 2IMWP 3T3FA 1KOHA 4LF7J 1CJTA 1I3OB 1YIJS 1SJQA 4WJBA 3KLVA 4O3PA 1RTIA 1V5VA 1N52B 2ZM6J 4XK8C 4H54A 1KS2A 2CDQA 3QJPA 4M63A 5D4OA 3WBZA 4N77A 3CVKA 3FCWA 4TN2A 4GC7A 4WKRA 4K4SA 2BQRA 3D66A 2MLYA 4ES3A 1WEZA 2YKMA 1R6VA 3J7YU 4KE5A 4GVLA 1HW8A 4DL3A 2LCWA 4K4TA 2ZBIA 3DLBA 3RBZA 3HLUA 4DSJA 1B0VA 2RILA 4L75A 3CCTA 2H48B 2CZVC 2IJRA 2O3DA 4ED0A 3EGVA 5AT1B 1LXNA 5KFNA 3ZTQA 2R4FA 3TAPA 5KFEA 4ECYA 3K0JA 1NDLA 3OTDA 2EKNA 1GTHA 3ZZTA 3SQGB 2OPSB 4YMEA 3H40A 4YDXA 3N01A 1TL4A 3OSNA 1C0UB 1TK8A 2FJEB 5L39A 4CNZA 4OZLA 3JSMA 4IG3A 4I0WA 4DF4A 5HMYA 5IWAJ 5DRKA 4P2XA 2HGLA 2OP5A 3GV8B 5LSRA 2N3OA 3POTA 2YH0A 2MHNA 5JVGQ 3BJYA 1NU4A 3TX0A 1VS3A 3BGUA 3TUPA 2QSWA 2HHTA 1OY6A 5LL6d 4B3TJ 2QL9B 1S99A 5B0FA 2I5JB 4BS2A 3ILIA 2V4JB 3FEZA 4BBYA 4ER8A 3B54A 3ONQA 8AT1B 1FK9B 2IM3A 3OSPA 3Q8YA 4KKOB 1KFDA 3V6HA 5DGBA 5KT2A 2VKRA 3CJSA 3ZZRA 1NZAA 3OL8A 5L8RC 2P2CB 3IO1A 2PMHA 1NUEA 2K1RA 5ADZA 2IDLA 2ZWPA 1TL1B 2VJVA 1WC0A 4RX6A 4KYZA 4WTYA 5GVQA 5U47A 3DKDA 4E8UA 1T0TV 3UW1A 1EETA 2DR7A 1DTQA 3ILJA 5HBMA 4ED8A 1WTBA 3S6EA 1S9EA 4HHUA 3MGJA 2L9NA 1VRUB 4CLLA 2KT3A 2ZH2A 2A2DA 3AA8A 1X4DA 2HHWA 4M5HA 1FX4A 5LMNF 4CRJA 3BN4A 3W8GA 2FLOA 3ULHA 3GJQB 5EHHA 3KLFA 4J9OA 1IXKA 3T5KA 1JWWA 2WAQD 1CJVA 2WSCC 2I8EA 2QEXS 1RT2B 1QY7A 2HNDB 4F3MA 4DX7A 3VGTA 5L38A 1HWUA 3W62A 1FX2A 2UUBJ 5LJ3Y 4FF3A 4U7UD 2CPDA 3H5SA 1G1XA 4RNOA 5AJ3J 5L46A 7AT1B 1S1XB 3QO9B 4X4UA 1JQGA 4BC9A 1KQSR 2HRTA 1RT3A 2WCXA 2XSFA 3QSYB 2CA9A 4DFKA 2ZZMA 2RVJA 3BS9A 2IRYA 2JRSA 1C4CA 4QWBA 1S0OA 2AWZA 1JLGA 1HD1A 2XYHB 1TMJA 2EC0A 2WSFC 2IDEA 2ZNZA 4WYLA 1RQ0A 4USKA 4DCPB 3HD1A 1U1NA 2Y3YA 5E5NA 1KKHA 1FESA 5D4LA 1Q8IA 3MMCB 1K0VA 3A12A 4ED4A 5CAAA 2DR5A 2KZMA 3QT6A 1N5YB 1FJCA 3B4MA 2JEJA 2ZH1A 1WI6A 4Q45A 4U6PA 1S9GA 3R8YA 1RT4B 1YJRA 3I82A 2I5JA 3R5JB 4UOGA 4DQPA 2V4JA 1Y3JA 2CADA 2K06A 3DRXA 1P1LA 4LQ3A 1UVKA 1NHUA 3RAMA 4YOEA 3CC7S 2BJ9A 1ROFA 2KL8A 4YUDA 2Y1LB 2FY8A 2VU5A 4TLRA 4OL8A 4XIUA 3N6MA 5ITHA 1S10A 4C0OC 2VPWB 3C6TB 3M1VA 1RAEB 4B9VA 3PYDA 3A1YG 2A0FB 1SH0A 4QYRA 4TLQA 3K58A 2EFOA 3MR7A 5KFTA 3EWGA 3NAIA 5M2PA 2MZRA 3ZZ0A 2VPXB 3DOMA 1RAOA 3K17A 2BABA 4A48A 4NLQA 3GP9A 3W5XA 4LF6J 5H9EJ 1Q7YT 4NX9A 4ED5A 2W8LA 2YNHA 1X7VA 4K5SA 4RW6A 2OKQA 4PWWA 3OUYB 1SB6A 4MKBA 4NASA 4FKXA 4IOCQ 4PQUA 4FBUA 1RB0A 1B7FA 4OLOA 1X4FA 1HWLA 2BV3A 3KK2B 1N34F 5L1IA 1Y4ZB 2ROPA 5H9EK 4NMLA 2J6SA 4Q8FA 4JI2F 4ZLNA 3QO9A 1XNQJ 5KG6A 3NGDA 4KC5A 2CJXB 2HFNA 3CCJS 5KFJA 1L3TA 3EMTA 1P6TA 5EX3A 2IM2A 2FB0A 2O01C 1FWPA 3KG0A 2Z2ZA 4DXLA 2XHWA 3M8QA 4Y2AA 4PKDB 4OYZA 3RZAA 2DPJA 4NEYA 1PBUA 4D3GA 5T7LA 4EWTA 3VZIA 4FXWA 3BO2A 2BQUA 1KHVA 1DARA 4RO0A 4B3SF 3MPWA 3IG1B 3Q8RB 1FKOA 2GCFA 4PG5A 1J5OA 1D09B 2BZ2A 4EZ6A 2JZ5A 2KRBA 3CJTA 3PVXA 4MTPA 1PYTA 1KN6A 3OT9A 4CH0S 3HVTA 4YY3F 2HG4A 1ZTWA 4L3KA 2ZVIA 3MEEA 2R7TA 4PEOA 3FZ2A 1KLNA 3TZXA 3HK2A 4ED2A 1D3WA 4I2PB 2XGQA 4FYDA 3TA1A 1HHSA 4GVBB 3A3NB 4ELVA 3CC2S 1HNWJ 5KT4A 2H5JB 2O5DA 2N7YA 1T8EA 3I4HX 1YZ6A 2QA4G 5DDOC 1V5IB 4EEYA 3M6XA 4UQTA 3P96A 1M5HA 1RHUB 1UPMB 4LFAF 3OVAA 5DQGA 3EGNA 3W7BA 1S7IA 3Q86A 1VK8A 3GPAA 1NH7A 1URNA 4CO1A 4RU2A 2IY5B 2E66A 3OVBA 2XB2D 2LQ5A 1O5JA 4IR1A 3OUYA 2OTJS 5A8KB 3RR8A 4I6AA 3KK2A 1ZA2B 2MKYA 3DLJA 3RU0A 2KXHA 1K1QA 2F9DA 4C11A 4F0KA 2HNZB 2ALZA 1FJ7A 2LXIA 3MPUB 2CQIA 4DMZA 2WTFA 1R31A 3M4XA 3W9HA 1UZHA 3ISND 2U2FA 4KHMA 3DHWC 2YWFA 3RAXA 2J0QD 1WNEA 2K8GA 3R5AA 1ZZFA 2DPIA 1MMNA 4ED6A 3RBXA 1J5EJ 3MDFA 4UQGA 1M5SA 3W8PA 4Q44A 3OHAA 3MTJA 1S1TB 1IUJA 4OZ5A 2KYZA 2XULA 3K8VA 1XNRF 3N5FA 1Y5LB 4CLTA 3PZPA 4KPYA 1HFEL 2MSSA 5HL7Q 2CQBA 4UF4A 2QMUB 2V50A 1SQEA 2HZAA 4F36A 2EFPA 3EVOA 1TKXB 4QCLA 2QA1A 2HAFA 3EICA 5KFFA 1JLFA 3WC0A 1OMSA 1NAQA 3NGRA 2RAQA 4G1IA 2LVWA 4B3OB 4LF1A 2OD4A 1S7HA 5KFQA 2ZH7A 4W90B 3D7SB 1OY8A 3JQJA 3TQEA 2NCKL 2NLWA 3QIPA 4YEAA 3LAMA 5THWA 3GFYA 3THPA 3TJAA 3OTOJ 3PXGa 5CYMB 3MR3A 1YSJA 3R2DJ 4CYUB 4J9UE 4NXNF 1VQ7S 4U7CA 4NYOA 3EZOA 5KFLA 5M2UA 2D3UA 4RWWA 2FVPA 2VICA 1R7IA 1S6UA 4I4BA 3GYNA 1MU2B 3FMWA 2WBRA 9ATCB 4QYZJ 4RNHA 2DEIA 3MM7A 2DEJA 2WB1D 2KG1A 2Z57B 1VK3A 4OZ1A 2OPQA 4USWA 2GVDB 3MF5A 2VFUA 3TAMA 2C2ZB 2EI5A 2WVFA 5CCLA 2NR0A 2DCUB 3LQVA 3M2UB 3NAHA 4Q7AA 2DGUA 2LKZA 5F8LA 2RDDA 3CJ5A 5KFZA 4NA1A 4O4GA 1MNEA 1QAYA 4G3IA 3UWTA 4CNYA 5J2PB 4FNIA 1WC4A 1QUPA 2DHSA 2GW8A 1U25A 5E7OB 4OX9F 2WVDA 4J9PA 1W2BR 1X4EA 3DI6A 1RHMB 4NLUA 5CYQA 3R1LA 3PW4A 1Q95G 5KFSA 4RW4A 1A7GE 4JB8B 2GMLA 3LP0A 5D0EA 1BWEA 3M8PB 1SL2A 4KJIA 2B8QA 5KFOA 4M5NA 4DR5F 1EQ0A 1VQ4S 2W7PA 2JEGA 2MY8A 2E5LF 3TNVA 3M32B 1SC1B 3HKWA 2FLPA 1TKXA 3GR0A 1S48A 4CLKA 2BKNA 3L4BC 3H2VE 3VAHA 4IFVB 2XGPA 3N5BA 2G2OA 2NS1B 3K59A 4A8OA 2DVIA 4O4RA 4B3MF 3K7RA 2XHCA 2X51A 3PJWA 1IKXB 3M8ZA 3DLGA 2IYIA 4NPOA 2OELA 4C8KA 1OO0B 1R27B 2V8GA 4QWDA 4LF5F 4DZ6A 2R7WA 5IQ6A 4AE5A 1Q0NA 3W9JA 2FJWA 2V2KA 4QR1A 1RAFB 3BV8A 1F9HA 2CQHA 4JV1A 3I31A 1EARA 4M5GA 3VHQA 3UDCA 3ET6B 3ENAA 3H8YA 1R89A 3MEDB 3T1YF 3CJ3A 2WB4A 4HHJA 2FLNA 5ETMA 1MU2A 3CE8A 2GGPB 3IBCB 3M7VA 4ZPCA 4RL1A 3DRSA 5KFXA 3CB4A 4ZLLA 1PC5A 1CJUA 4LQ9A 1GH8A 5KFKA 4K4YA 4Y2IA 3G6ES 4OI6A 3AD8C 2IVMA 3QJJA 2DK2A 5KT7A 2XLIA 2N4DA 2CJQA 4OHVA 2R3VA 2MZ1A 1Q82T 4X66F 1RWPB 3T1HF 1O6XA 1I94J 5F0WA 1WJ9A 1FJGF 2VUGA 4C4WA 2AJ2A 3BO4A 2D69A 2FHMA 4XO0A 3JAMU 4PUOB 3V4IB 4LFCF 4KQZA 4FS1A 2DB1A 3AQPA 3J7A1 2E29A 2B9WA 4RWXA 3BGOP 3TARA 1WHXA 4A8SA 2MYFA 4IRDA 4OJGA 5BXIA 3QAEA 3C15A 4YQWA 1ZH5A 1VQNS 1RTJB 5G0RA 3PKMA 4DSEA 1RLCL 2FD2A 5IZHA 3NOCA 3H2UB 2JDJA 4WFXA 2ZZNA 5I42B 4HDHA 2PGCA 5EX0A 4C3LA 2J9CA 4L74A 4IFYB 3HX9A 4NEZA 2XBPA 5A0YB 3W64A 2VDIA 3I32A 4I2QB 4AQYJ 3IS9A 5F8NA 4AL5A 2V9WA 1KTVA 1HMVB 3VAFA 3IBFB 1SKWA 2RU3A 1SJRA 5K8NA 2BANA 3KMSA 1SV5B 2UVRA 2KHCA 4LF8F 1UEKA 3GILA 5KFWA 1BE4A 4K2XA 3RRKA 4F3QA 4OZ0A 2LQJA 4DR2F 1Z4UA 3MEGB 2Q79A 3Q22A 5HVFA 1NJYA 4TYBA 1XJWB 3G8QA 2VIHA 1XNRJ 1SQFA 4OQJA 1JLQA 1XEZA 1ELOA 1ZAWA 2V4RA 4JUZA 3GIKA 4NLTA 1SVDA 4DJBA 2DNZA 4LRBA 2VG6B 3KLGA 3Q8SB 3CCUS 5F3TA 2EKYA 2ZHOA 2CRLA 4ELUA 1FNOA 2R7UA 2AYMA 1UZDA 4Q8EA 3M6UA 1PAUB 5CYJA 4X65J 3TVZA 3HFKA 2VBXA 3L7UA 2ASYA 2JVRA 1UWAA 1FT8A 2ZUGA 1CQMA 3N6NA 2FZCB 4C3MA 2O1PA 1SJ4P 2H3EB 5HVGA 3BEGB 4UOFA 5A6WA 4RR5A 3QLHB 4DR6J 4JOUA 1YJNS 4CH1A 4ZPAA 2CJYB 3H4BA 4X4NA 3CJ4A 3W2VB 2YKNB 1RSCA 4DWIA 3Q83A 3NCRA 1RAJA 4PZVA 2MJNA 4RW7B 3QYYA 2GVZB 2EXUA 3DGPB 2FHKA 3PRVA 5J2NB 3OBIA 5SZTA 1JKHA 4KV8B 4M5DB 3HSGA 3UFCX 1WUUA 1S72S 5J2MA 1U2CA 1S49A 5B0CA 1J27A 3MECA 3BKFA 2VQFF 4B02A 1HBMB 4DV4F 3EXCX 3BB5A 3DLLQ 2OFGX 4JI7F 4KPCA 1S1UA 2M52A 3KHLA 2AZ3A 1FRLA 4XPCA 2EFGA 5D15A 4S0MA 4EK2A 2OPRB 3IR7B 3R6GB 3EM1A 2P8IA 1T03B 1NB7A 4Y34A 3HHEA 3OD2A 2W9BB 2QLJB 4DV0F 1Y5IB 1AXQA 3D0GE 1H2VZ 3ILOA 1LW0B 3KK3B 5DDRC 1F5CA 2XMWA 4A8WA 5EWEA 2R8IA 3CJ8A 4EI2A 4QPXA 5HROA 3MM9A 3HHLD 2MGZB 1ACMB 4OX9J 2E1PA 2DNYA 2JEIA 2YWKA 4C8NA 3BSNA 3VAMA 4ZP8A 4DR7J 1NPKA 2YX7A 2A10A 2V8PA 3C6UA 4A46A 3QGGA 3HKZD 4ZLPA 4CLPA 2XY5A 4HYKA 2KN4A 4C6AA 1TUWA 4R0EA 2YNFB 2HYIB 1IBKF 4ZVSB 5HQMA 1BY9A 3EDRB 3K5OA 5IOLA 4P2MA 5KT3A 3HT0A 1VOMA 2VOOA 4Q43A 3FCVA 1C2PA 4GKKF 2PD1A 5IQQA 4X62F 1T11A 1RHQB 5RUBA 4DSFA 2HFUA 1U0HA 1ZM3A 5T41A 2QTWA 3LP1A 2X1FA 1RCOB 2CQ0A 1U09A 2VD3A 2KFYA 4DV7J 1LK5A 4KR0B 2YKNA 2RIJA 2RF2B 4IOAQ 3R6LB 3W2WB 4FDFA 4E2FB 2MQQA 1FDNA 3D9BA 4RW7A 2Z4PA 2QL5B 2GVZA 3O44A 1Y5NB 1QSYA 1N36J 2NXEA 4DR3F 1AZSA 1N6QB 5ETQA 1N4LA 4CTAB 4KV8A 2FHJA 3FSXA 2DNMA 2DH7A 2HMIA 1KD1T 2VF3A 5L1KA 4N7TA 4ZVOB 1H3DA 2YNIB 4C8ZA 3MMAA 4G1PA 4LF2A 3CCRS 3RBDA 1LXJA 5DG9A 1R8AA 4NA3A 1HWJA 1LW2B 1R0AB 4IQMA 2OPPA 2DNNA 4A4JA 5LMUF 1HI1A 1NSAA 3D6MB 2R7RA 2OPRA 2RQMA 1ZM9A 3SCJE 3VGSA 1IR1A 4ILLA 4BHQA 3AOBA 1YJ9S 2W9BA 3A8JA 4X66J 4F4ZA 4C8LA 4H4OB 4WE1A 2YH1A 1FRMA 2C22A 2NSCA 3I5AA 3D6FB 2PN6A 3AOCA 1F2GA 4YB1P 3Q24A 2RMLA 4TY8B 3ZNUA 2HFSA 2E5IA 2Z2MA 5KG1A 3W5ZA 3FFIB 2D41A 3ZXWA 3GYGA 1CS4A 1O0PA 4ATNA 3PW5A 4ZLJA 2LYVA 4HLBA 4OJ1A 2YKAA 4HR2A 2NQPA 2D1CA 4QPTA 2RS2A 2GIQA 5ETNA 4CIOA 3GV7B 4ED7A 5DQIA 1RT6A 2IFXA 2KVIA 2YNFA 5AE3A 1NK4A 1TVRB 3UVJB 2FJXA 1RBAA 1VQSA 4NYPA 2X3DA 5KG3A 1T02A 1DAXA 4IOBA 2DXDA 3I9ZA 3MUTP 4ID5A 2IJNA 4DFMA 4DV6J 1DLOB 4ETZA 1RT5B 1DQAA 2VBYA 3ZNJ1 3FNNA 3BR9A 2RKIA 1B0TA 1QJHA 2DT9A 4JBCA 1HWIA 1SBRA 1T9UA 2E1AA 1RI7A 1VRTA 4MH8A 4YHHF 1R8PA 3QRQA 2RF2A 2RHSB 4DR2J 3W2WA 1Q5VA 1RACB 4USJC 1DURA 4HVZA 3MMBB 4JI8J 2Z0GA 5K5MA 2LQ8A 2U1AA 3ETOA 2UZAA 2QGFB 3AHPA 1T9TA 4KAIA 1HQEA 3L95X 2VC1A 4UUXA 4JI0F 3UD4P 1U26A 2HRUA 2OI2A 1NPPA 3T6JA 1ZPVA 4DN9A 1OSDA 1RTZA 2YNIA 2M8DB 2ACYA 4R5PA 2PI5A 2CVIA 4NWBA 2LFVA 5KOWA 1SUQB 2ZH5A 2G2ZA 2MQLA 4NZ0A 1VIXA 4JI3F 5JJBA 3NNHA 1X4AA 1RKJA 3AA9A 3BBFA 5GAGI 2AJ1A 5ETVA 4B3RF 1F9FA 4TNOA 3VQTA 4MT1A 2BACA 1GNKA 4ZVRB 3OL9A 2GQ2A 1EKSA 2UUCJ 3SFUA 1IQZA 4IG0A 2BMBA 4XDDA 4ZP9A 4XTTA 2G0CA 1IQTA 4X64F 3TW0A 4DS5A 4XAKA 4N8NA 4ZIVA 1T95A 4GO7X 2ZH3A 3QPIA 5C2CA 4LUBA 1K47A 2EBEA 3DU6A 3HZGA 1R3NA 2DHHA 1VYAA 4GKJF 4HACA 1JLCA 3A8IA 4ZK7M 3CDBA 3GCWP 4JI7J 4IRKA 2OSQA 5BJRA 5L1LA 3NOGA 2V63A 2XS7A 3US5A 4P2FA 4A8FA 4ECTA 3U1NA 3CCLS 1PAEX 3W66A 3AT1B 1FXRA 2UUAF 4Z7YA 5F9LA 4ZIWA 4JI5F 4Q0BA 3M9NB 4DSKA 2MZJA 1NJIT 4MK7A 2H5IB 2CPFA 1WOSA 5HMZA 5K14B 3EE3A 5F0UA 2J0SD 2YVSA 3BGRB 2IAJA 5D77A 2RDIA 1YG0A 2Y8YA 3ZZUA 2W4DA 3P3DA 1H7XA 2GO8A 4LRDA 5FDLA 3A3PB 3CCVS 4LSZB 4DUZF 2RHQB 1BLUA 4JI1F 1Q78A 4R0JA 2LQ9A 1T05A 3M30A 5J1PA 1IBKJ 1KP6A
chains in the Genus database with same CATH topology
2QEXS 1RT2B 1QY7A 2CQ1A 2HNDB 3F56A 4F3MA 4YDDB 3MI7X 3N0VA 2DNOA 4I2QA 1V3ZA 1ZAXA 1RTDB 4WF9Q 5L38A 1HWUA 1SIZA 3ZZZA 2B4PA 1HMVA 2EK6A 2CQCA 5CCMA 5LJ3Y 1REVA 1YRUA 2YY3A 3CD0A 4FF3A 2CPDA 3IAM9 5K8PA 4PG4A 2VPZB 3H5SA 1G1XA 4RNOA 1K9MT 4G1QA 4KO0A 4EYIB 2E7XA 4TY9A 2KZZA 2R7XA 1S1XB 3QO9B 5J2QB 1VGYA 1SJ3P 4BC9A 4X4UA 1KQSR 2YWHA 2MZSA 4DL7A 1SV5A 2KFNA 2B4UA 1RT3A 2WCXA 2EFNA 2XSFA 3CEDA 1OIAA 4NCGA 4DFKA 2ZZMA 2RVJA 1WG5A 5CHCB 3BS9A 1UVNA 4NRUA 4FF2A 2IRYA 2JRSA 3MHYA 1C4CA 4RBUA 3MEGA 4QWBA 1OQ3A 1S0OA 4A8MP 2AWZA 1JLGA 2XLJA 1HD1A 1IKVA 4YR0A 2DR8A 4HL9A 2DNHA 3VAGA 2CG4A 2JEFA 3RW7A 3EZUA 3QIDA 2XMUA 4DG1A 4AL7A 2EC0A 4LVOP 2WSFC 5CH7B 1CSJA 2ZNZA 4Q2LA 3DRSB 4WYLA 1RQ0A 2ZDPA 3OR2B 1TKZB 2KU7A 1VQ5S 1U1NA 2ZD1B 5DJBA 5E5NA 1JNZB 2M9KA 4X4PA 1FESA 3H2LA 1Q8LA 1Q8IA 4HDGA 1ZAVA 5D4LA 4C3KA 3IN5A 2E7WA 1WELA 2VG6A 2MQPA 3MMCB 1HBOA 1HWKA 3MD3A 5LSLA 1K0VA 4FXVA 2VZ9A 2DR5A 1BQNB 2KZMA 2LEAA 1VQ8S 2ILZA 2XWYA 2RRNA 1ULRA 1VQ6S 3ISZA 1N5YB 1FJCA 3B4MA 2JEJA 2AV5A 4I68A 3KK1A 2ZH1A 4P7VA 5C24B 1WI6A 3N9UC 4U6PA 2BYCA 4Q45A 3THVA 2JL9A 1S9GA 2C42A 2LQBA 4QU6A 1RT4B 1FXDA 4TKTA 3SDEB 5EN1A 1RDRA 1X5TA 1YJRA 3LAKA 2PDAA 3I82A 4LIRA 2AJFE 3WZ0A 2I5JA 1JX4A 4PQAA 1Z2ZA 5KOXA 4J9LA 4DQPA 1RKIA 3G6YA 5AXLA 2V4JA 3K5MA 1Y3JA 4DL4A 1FDAA 3TANA 1WG1A 3L09A 1C0TB 4L6V3 2GFFA 2OIHA 2DGOA 1FCAA 5A0YA 3T5HA 2J5AA 1HNIB 3QLHA 5I3PA 4K5RA 3DRXA 1W25A 1P1LA 4LQ3A 1S1VA 1UVKA 4YFUA 1SJFA 1NHUA 1MWZA 6FD1A 2N4CA 3RAMA 4YOEA 4M8LA 3CC7S 3H5UA 1P1TA 3W2VA 3HO1A 5LSOA 1ROFA 3GWCA 2GC8A 4IH6A 4DR7F 4Y3CA 4QIVA 3DU5A 4ZVGA 3T1AA 4YUDA 2JFDA 2CPZA 2JOQA 2JVOA 2LDYA 4OL8A 3DGPA 2D74B 4TLRA 3N6MA 3SSSA 2R7QA 5ITHA 4XIUA 5J2NA 1S10A 1S0VA 4OHXA 4C0OC 2VPWB 1VQMS 3C6TB 1T3NA 2OMLA 5G0RB 3EX7B 3FQKA 3M1VA 4O23A 4B9VA 4M5DA 5D4NA 3A1YG 1G7CB 1RK8A 2BE2A 1SH0A 2HQ3A 4XDCA 2VODA 1C1CA