3DM2B

Crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
431
structure length
400
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 103
structure length 400
sequence length 431
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dm2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2B03
1FKPA 1NNDA 4IDKB 3FSIA 5L1KA 3DRSB 3IS9B 2AQ4A 1C1CB 1MU2A 3KOAA 4RW6B 4YP3A 4EBEA 4O4GB 1LW0A 1TKTA 2EC0A 4Y2AA 2BE2B 3KJVB 4MFBA 3QYYA 3G6XA 5KG1A 5J2QA 4YR2A 1D0EA 2IA6A 4LQ3A 4O3OA 2WONA 1EP4B 1JLBB 3RAXA 1LW2A 3C6TA 4I2PA 2UUTA 4RW4A 4ED7A 5JUMA 3PZPA 3RBDA 3GV8B 3DRRB 3QLHA 3QO9A 4DG1B 3GIJA 1HYSA 3H5YA 1QUVA 3N6LA 1SUQA 4RW9B 5CYMA 5J2NB 4Y2CA 2YKNB 4ECYA 3RB0A 3KLGA 3Q8RB 3OHBA 4EYHB 3KLHB 4ZP9A 4G1QB 1JLFA 1HMVA 2YNIA 3DLKB 3ITHA 4RW7A 1NHVA 4EO8A 3CDUA 5EWFA 4IFVB 2WTFA 1S1UB 2GC8A 2OPSB 1RT3B 5J2PB 2R8IA 3BQ1A 1C1BA 5KFRA 3SI8A 2C2DA 2HNYA 2R8KA 4F50A 4MKBA 2W8KA 5HP1A 4ZP8A 3T19A 3MEEA 4ZVFA 2R8JA 2VG5B 4NLPA 3OLBA 3SFUA 4ECUA 2W7OA 3DRSA 3IS9A 5KT2A 3MF5A 3I5BA 4KE5A 4NYZA 4O4GA 2XI2A 4RNFA 4ED2A 3V6JA 4TY9A 4K4XA 2IM1A 1FKOB 3KJVA 3D28A 1C0UB 5JXSA 3PW7A 1JX4A 1S1TA 4ID5B 4NLVA 4RW8B 4ZPCA 1EP4A 2F8EX 3BR9A 1IKXA 3V81A 1IKWA 4TYBA 5DG8A 3MFHA 3DM2A 3E01A 3GIIA 3DRRA 5I3UA 1MMLA 2IC3A 1HNIA 4FBTA 1CSJA 4I7FA 3NMAA 4KO0B 2ZD1B 4TN2A 2RF2B 1EETA 5F9LA 5T14A 3DYAB 1S9FA 1DLOB 1S9GB 5KFBA 2YKNA 1Z4UA 4TQSA 4KHRA 2C2EA 1VRUB 5C42B 4MK9A 3KLHA 4MIBA 3DLEB 4G1QA 3LALA 2OPQA 3KLFB 3I5CA 4WXWA 3DLGB 3CJ4A 3GQCA 5J2PA 4K4TA 3KNAA 2FVRA 1JIHA 4EBCA 2FJXA 4FS2A 1N5YA 3DDKA 3OL6A 3CDEA 3CVKA 4J9KA 1FKPB 4NLGA 5KFLA 2IM0A 2VG5A 4XPEA 4NLDA 2OH2A 1RTIA 4WZMA 1TKXB 3LP0A 3H40A 4O4RA 4NLTA 1RA6A 3PVXA 2BQRA 1TQLA 3IN5A 1LW0B 1TKTB 4WXOA 2JEJA 1TL3A 4RUCA 4ECQA 3V6KA 1K1SA 1S49A 2O5DA 3GV7B 2WONB 2YKMB 3C6TB 4I2PB 3H5XA 4R8UB 5FDLA 4RW4B 1BQNB 5KFZA 2JEIA 3N6MA 3OLAA 4PQUB 1RTDA 3EPGA 2HNZA 1T05B 4J9SA 2UUWA 1GX5A 4O3RA 2JLEA 3I0SA 3OSPA 4EYIB 5KFTA 1RT7A 4I2QB 1T3NA 5KFWA 4PUOA 4ICLB 2XCPA 2R2TA 3M9MB 4TXSA 3VQSA 1SUQB 2ZD1A 4KO0A 2RF2A 2V0NA 2W9BA 4ED0A 3UR0A 3T5KA 5DQHA 3DYAA 1RT2A 1TKZA 4XPCA 4QPXA 3KLEA 3KK3A 3FDSA 4O3PA 3HVWA 3LAKA 1DLOA 5HROA 2B5JA 1JLFB 1RTHB 2YNIB 5CYQB 3ITHB 4QWAA 2R8HA 2IM3A 3CDWA 4Q44A 1C0TA 2UVVA 5DLFA 1ZETA 2UVRA 2HAIA 2HNYB 3KLFA 3MR2A 5L1IA 3CJ2A 1TL1A 3M8PB 5HP1B 3DMJB 4O44B 1VRTB 5DLGA 4ZHRA 3MEEB 2B43A 3I0RA 3MR6A 1S10A 1N6QA 1S1VA 2IBKA 4M94A 4K4SA 2HNDB 2J6SA 4ED3A 1REVB 2W8LA 2BRLA 4GC6A 5DGAA 2RKIA 1TKXA 2FJWA 3PW4A 3H2LA 3CJ5A 4NLQA 3C6UB 3D5MA 4ED8A 2VA3A 3OL9A 1S0OA 2ASDA 1IKYB 1S1TB 3H5SA 3H5UA 3T5LA 4Y34A 2YKMA 1IKXB 3V81B 1IKWB 4J9NA 1JLEA 4R8UA 4O3SA 5HLFA 1BQNA 3DM2B 3E01B 1GX6A 2JEGA 4PQUA 5I3UB 2IC3B 1TVRB 4IKAA 1HNIB 1T05A 3BGRA 4IRKA 4I7FB 4URSA 4I2QA 3IRXB 1EETB 1LWCA 4MH8A 4ICLA 4K4VA 3LAMA 2D3UA 3KK2A 4WFZA 2W9AA 2RDIA 2IJFA 5DQIA 3Q8PB 5J2MA 1C2PA 2AGPA 1LWFB 2ATLA 4Q8FA 3NBPA 1U09A 4Y3CA 1RTHA 5CYQA 3QGIA 2OPQB 3KLIA 3PJXA 4NLRA 5KT6A 1S6PB 2OPPA 3DOKB 4B3OB 3H59A 4O3QA 3BSCA 5KG3A 3RB6A 1N5YB 2C22A 3M8PA 4LSLB 3DMJA 4URQU 4O44A 4RNMA 3OL7A 1VRTA 2AWZA 4RU9A 4ZVGA 2VG7B 4DL2A 3CIZA 3T5HA 1RTIB 2HNDA 3LP0B 3MR5A 1REVA 1RYRA 1S1XB 1TL3B 2YNFB 2JC1A 4IG3B 5KFJA 4K4WA 3RBEA 3C6UA 3G6VA 1XR5A 4RUAA 2QV6A 3KHLA 4NRUA 5J1EB 1S0NA 5FDLB 2XC9A 4MKAA 3V6DB 1IKYA 5KT5A 5KFUA 1RTDB 4DL6A 2HNZB 2YNHB 1OS5A 5KFHA 3MR3A 3BQ0A 3I0SB 3Q8QB 2FLPA 1RT7B 1TVRA 3V4IB 4ECWA 4PUOB 4X2BA 1RAJA 3M9OB 3QGHA 4MK7A 1KHWA 2AX1A 1SH0A 3QZ8A 5I42B 2W9BB 3IRXA 3KHRA 5F8HA 1RT2B 1TKZB 3IGNA 4MIAA 3KLEB 3KK3B 4ZPBA 5KFVA 3JSMB 4IR1A 5EDWA 5HROB 2B5JB 4Q0BB 4IOBA 4Q8EA 2C2RA 2JEFA 4G3IA 1S9EB 4DEZA 3NL0A 2D7SA 1C0TB 1LWFA 4NLUA 3OSNA 3KMQA 3LANA 1ZTTA 1IKVB 1UWBB 5L9XA 5KG5A 4OL8A 2CKWA 5L1JA 1TL1B 1WNEA 1S6PA 3DOKA 4B3OA 2XGPA 4ZHRB 4GC7A 4IQXA 3I0RB 1W25A 3BQ2A 4LSLA 1S1VB 1N6QB 4Q45A 3RB4A 4EEYA 1JLAA 3GIMA 2HWIA 2VG7A 3LP1A 2E9ZA 1RDRA 4IFYB 2RKIB 3H4BA 2R2RA 4F4ZA 2RDJA 1DTQB 1S1XA 4JV0A 5KT3A 2ASJA 4WZQA 3T5JA 2YNFA 4IG3A 4H54A 3RB3A 4YR3A 3GILA 4KB7A 4NRTA 4QW8A 1HPZA 1DTTB 1JLQB 2YNGA 5HBMA 1JLEB 5J1EA 4ED6A 2AGOA 3V6DA 5HLFB 3DOLB 3ICLA 4K4UA 3IG1B 3SFGA 1RT5A 2AU0A 3CJ3A 3BGRB 2YNHA 3HKWA 4DL3A 4WE1A 5KFMA 3V4IA 1LWCB 2V9WA 4DL4A 4LSNA 4KKOA 2WB4A 3CWJA 4PWDA 3KK2B 2ZE2B 4TQRA 5I42A 1S1WB 1N48A 5F8JA 3PHEA 5J2MB 4H4OB 3NGDA 3FQLA 2FLLA 4J9RA 3JSMA 4R5PA 3NBPB 3HVAA 4Q0BA 4J9MA 3Q8SB 3KLIB 4NLYA 1S9EA 1HARA 4EO6A 2AGQA 1LWEB 1S6QB 1YVFA 4DL7A 3TAMA 3DI6B 2IM2A 1IKVA 1UWBA 2OPPB 3TQ1A 3CJ0A 2DPJA 2FVSA 2CJQA 4QWCA 5L1LA 3H4DA 4TLRA 3EZUA 4DL5A 3EPIA 4XO0A 5KG4A 4ECVA 2DPIA 3DRPB 1RTJB 4IG0B 4RNNA 4ZPAA 2VG6B 2C28A 4IFYA 5KFXA 1JLCB 1JXLA 3N6NA 1DTQA 4QWDA 3MTKA 3MEGB 2BQ3A 2IAJB 1JKHA 1FK9B 4NZ0A 3TVKA 3MECA 1DTTA 1KLMB 4KAIA 1JLQA 3BSNA 3LP2A 3DOLA 3IG1A 4NCGB 1I6JA 2R2SA 5KFGA 4QW9A 1S4FA 5KG6A 4RZRA 4ECTA 3GYNA 3KMSA 4ZVEA 3BSAA 3KHGA 1QAJA 2VA2A 2BQUA 4ZP6A 2ZE2A 5F8LA 2FVQA 1S1WA 4RNHA 5KFNA 4H4OA 4TY8B 2JC0A 1HQEA 5KFDA 2IMWP 3G86A 3E51A 1QE1A 2WOMA 3JYTA 4K4YA 1LWEA 1S6QA 5KFEA 3DI6A 1SH3A 1SV5A 4Q43A 5C24A 1N4LA 1RT6B 2OPRA 4KV8A 4NLWA 2ALZA 2J6UA 4KSEB 3GIKA 3QIDA 1RT1B 2W7PA 1JLAB 3BJYA 1HQUB 4J9PA 2E9RX 5C25B 3LP1B 1TV6A 2R8GA 4F4WA 3DRPA 4F4XA 1RTJA 4IG0A 4ED1A 3T1AA 1JLGA 2I1RA 3ISND 4JUZA 3UPFA 5DQGA 5D3GA 2V4QA 2VG6A 2E9TA 5KG7A 4YMEA 1RT4A 3H98A 5KG0A 1JLCA 4WYWA 4J9OA 5F8IA 5K14B 5C5JA 3HHKA 4U6PA 1BQMA 3GV5B 1HPZB 3KK1B 2YNGB 5HBMB 3MEGA 2D41A 1SH2A 5KT7A 2IAJA 2FJVA 3FRZA 2B6AB 1FK9A 2UVUA 1RT5B 1KLMA 3KHHA 4WFYA 2WRMA 2W9CA 3M8QA 1R0AB 1KHVA 2ILYA 5KFSA 4WE1B 4NCGA 2IJNA 1ZTWA 2GIRA 4J9LA 4LSNB 1XR7A 4KKOB 2FVCA 4KFBA 4KHMA 3PJWA 4NLXA 2FLNA 4JV1A 4PWDB 2ZKUA 3RAQA 4FBUA 4URGA 3V6HA 4IDKA 3HVTB 4WYLA 1S97A 5KT4A 3UQSA 1K1QA 1C1CA 3FFIB 4R5PB 4ZMMA 4RW6A 2ILZA 3NKYA 4IRCA 4NLOA 4TY8A 4IH7A 3OHAA 2WHOA 4HYKA 3TAMB 4M95A 2BE2A 4EBDA 4IR9A 2GIQA 4J9QA 1IM4A 4H4MB 1JLBA 2QE5A 3CO9A 2BR0A 1RT6A 3FQKA 4KBIA 1J5OB 5KFYA 1RT1A 1S0MA 1T94A 3NAHA 4ZVHA 4QWBA 1HQUA 4DG1A 1NHUA 4WFXA 3BREA 5C25A 1TP7A 3ISNC 3QIPB 2HMIB 4IH6A 5F9NA 4IRDA 2BANB 4RW9A 3UDLA 5J2NA 5KFOA 5EWGA 4F4YA 4ECZA 3I5AA 3PW0A 4TYAA 5K14A 3MEDB 1T03B 1JKHB 3DLKA 3MECB 3KK1A 4IH5A 4IFVA 2I5JB 1S1UA 2OPSA 1RT3A 2V4RA 3LP2B 2B6AA 4FS1A 5DG9A 1HNVB 4ZPDA 1RYSA 2R2UA 1R0AA 4R0EA 4QWEA 5KFCA 4YQWA 3PW5A 2XWYA 2FVPA 3M9NB 3BSOA 2ASLA 4ECRA 4YR0A 1MU2B 5KFIA 5KFFA 5F8MA 3HVTA 2XI3A 5KFKA 2XGQA 2UVWA 1HQEB 3MFIA 3FFIA 3KLVA 1QE1B 2WOMB 4MFBB 3JYTB 3QZ7A 5J2QB 1D1UA 5KFPA 4O3NA 2WCXA 1LW2B 1SV5B 1FKOA 1C0UA 5C24B 2AX0A 2OPRB 4ID5A 4KV8B 4RW8A 5F8NA 3QLHB 2XCAA 4H4MA 4ECSA 5EUHA 3QO9B 5EWEA 5KFQA 1HYSB 1TV6B 1J5OA 5DGBA 1N56A 3PR5B 1JLGB 3G6YA 5D3GB 5DG7A 3PW2A 5CYMB 1S48A 1RT4B 3KLGB 3QIPA 2HMIA 4HKQA 2BANA 1S9GA 1BQMB 4RW7B 1HMVB 2HWHA 1XR6A 5KG2A 4K50A 2BRKA 4RNOA 4NLSA 1VRUA 5C42A 1T03A 3MEDA 4MK8A 3DLEA 1C1BB 3OL8A 4U7CA 1QAIA 4K4ZA 4LQ9A 2I5JA 3DLGA 5KFAA 3M8QB 3PR4A 2W9CB 4ECXA 2J6TA 2D3ZA 1RA7A 1HNVA 5F8GA 3IGVA 4KFBB 4JV2A 3QGGA 4ZP7A 2WK4A 3NAIA
chains in the Genus database with same CATH superfamily
4UQGA 4IDKB 3MTJA 3FEYB 4B02A 5LMUF 4OI2A 1N8RT 4O4GB 2IDLA 1TK8A 1H7XA 4K8RA 2UV8A 2B56A 5JUMA 1N5SA 1Y5NB 1RCOB 3B8HA 1RBLA 3T1HJ 2W2OP 2GC8A 5BYQA 1JWWA 2B51A 4IO1A 4ZP8A 1H2VZ 5G0RA 3SFUA 2W7OA 3IS9A 3I5BA 4USTA 3QBCA 4ID5B 2V8HA 4NLVA 2XSJB 2LDIA 2L48A 5D4PA 2DHSA 2HGNA 1R7IA 3NMAA 4F02A 3KG4A 2EPIA 2MQOA 1RJJA 2OPQA 4FPRA 4ERDA 3HVRA 2NXUA 2OGUA 1YIJS 2VONA 2DNMA 4J9KA 3PVXA 2DNHA 4K5RA 3EJMA 2BX6A 3PNIA 2QMWA 1SQEA 2DY9A 3NWRA 4R8UB 2UV8G 4PQUB 4J9SA 1PO6A 4KHPJ 2CPIA 1X4AA 1TKZA 4XPCA 1F3VA 2KYXA 5CYQB 1PIEA 1B64A 2DXDA 3MR2A 3QRQA 3CJ2A 1HKAA 3MR6A 2ZJQQ 5CABA 3L4BC 1WORA 3C6UB 1X4DA 2VPYB 3CSKA 4J9NA 4C0BA 3LO3A 4B08A 4I2QA 2DR7A 2NQPA 2YH0A 2HK3A 2PD1A 3QGIA 3KLIA 4PWWA 2OP5A 1WF2A 1RTIB 1G6BA 1VC6A 1JJ2R 1S1XB 2YNFB 2P9GA 3OXGA 3N5FA 3Q24A 1F6TA 3V6DB 4DFKA 4NE9C 2YNHB 1YWXA 3BQ0A 1TVRA 1AT1B 2CJKA 2HVDA 1SJ4P 2QMXA 4ED5A 1TUGB 2D7SA 4DS5A 5L1JA 3AD7C 3NOCA 2AD9A 3BQ2A 3GP9A 1CS4B 2PSZA 2HWIA 2RS2A 3RBZA 3Q86A 3H4BA 3MM7A 1SKRA 3T5JA 4KB7A 5IZHA 1WG1A 1YJ9S 1NK4A 4JP8A 3SFGA 3QT6A 1S57A 5KFMA 5K9FA 4CYUB 2RSQA 3ADAC 5H9FK 3D67A 2XHWA 5D4OA 4DL7A 4OYXA 4JI3J 1UAWA 3H4DA 1VQ9S 4DL0C 5GVQA 1GH8A 2IAJB 3K0JA 3KKFA 3BN7A 3FCWA 4KR0B 1VLYA 1S4FA 5KG6A 1N5VA 1RZMA 4NEYA 2QLWA 3W2WB 3WIVA 1QE1A 1S6QA 2XMWA 4KH0B 3QIDA 5CZXA 3IAS9 2AYBA 4LF1A 4A4JA 5BR8F 3T3FA 1JLCA 2NCKL 3AAWB 4RL1A 3HT3A 1FK9A 2HHHJ 2G0JA 3SSQA 3W7BA 3BGFA 1Y0HA 4KHMA 4LJMA 4YFUA 4PAAA 4DSKA 3MMBA 2AYGA 4JI7F 3RGIA 1FRMA 1IBLJ 3NAHA 2HS3A 3CNQP 1WHWA 2FDNA 2MJUA 4IH6A 4Z2XA 5J2NA 1SI9A 3N28A 1YSJA 2XB2D 3MECB 1FTCA 1ZM4A 3DGPB 4DHVA 2CNOB 3MCOA 3A12A 2AX0A 1TMMA 4CRJA 3WQPA 3H2UB 3BM7A 1HR0F 3PRBA 5IQ6A 4NCBA 4OHVA 1D9FA 3ZTSA 1VS3A 1T9UA 3OL8A 4K4ZA 3PR4A 4K5SA 3VTIA 3GPAA 4LF8F 2KM8B 1Y5IB 5L1KA 2VUGA 2KT2A 4YR2A 4LR9A 2B9EA 3GONA 2DCLA 1HBNB 5LOQA 1DJ0A 4B9VA 2QLFB 3W2VA 3CO0P 4J91A 3ZZRA 4LREA 3KLGA 3OHBA 3ENAA 4WP3A 2ROPA 1HMVA 3UVJA 1RYRA 2WTFA 5KFRA 4DFMA 2C2DA 2DITA 2HZCA 2W8KA 5HP1A 2PA3A 4R25A 3TJ8A 3PRVA 2Y1IA 6AT1B 3G71S 2NXNA 2FZGB 1NH7A 2C1EB 2P9EA 4TY9A 2CFXA 4DCPB 1NJZA 1EP4A 5CCMA 2RU3A 2QA4G 1HNIA 5DS7A 1Q4RA 1U2CA 1CJKA 5H9FJ 1DLOB 1S9GB 3P3DA 4KHRA 5C42B 3KLHA 4FYWB 4G1QA 4OI1A 3VAMA 2FVRA 2ZC3A 1JIHA 4MYUA 4X4NA 3DLBA 2X1FA 5KFLA 1T0TV 4DN9A 3VAJA 4G6VB 1UTAA 1VQ5S 1RA6A 2MDAA 4PABA 1KFDA 2F5GA 3D0GE 3OLAA 1T05B 1GX5A 1WHYA 3POTA 4EYIB 2IYIA 3IRWP 3LAKA 2DGTA 2IM3A 1WG5A 2E1CA 4TVAB 2UVRA 4MKYA 3JTNA 2DNOA 4ED3A 2F3JA 4K0KF 2BRLA 5DGAA 2KFYA 3TUPA 2VA3A 3A13A 3NS7B 2YWWA 5HVHA 3BKUA 2ZITA 4AXIA 4XK8C 3L7PA 3M2RB 3T9ZA 1M90T 3BGRA 2GFFA 2IVFB 4OJ1A 1LWCA 1E6YB 4L72B 2LQJA 2CZVC 1ROFA 4Y3CA 2EBEA 1RTHA 2VOOA 1S6PB 4O3QA 2C22A 4O44A 2F4VF 1VRTA 4USWA 1CJVA 2LDYA 2VG7B 2E7XA 3TUZC 3QJLA 4X65F 1YJRA 1RAOA 7FD1A 1JJ4A 4DX8H 1S0NA 4F3OA 4Y2MA 5KFUA 1ZS6A 4LBPA 5KFHA 3QGHA 3WC0A 1HI0P 2GAGC 1AXQA 3KHRA 5HROB 4OHXA 2C2RA 2AP6A 3NL0A 1C0TB 1LWFA 1T9XA 2YPZA 4QR2A 4ZHRB 2R42A 3G87A 1J2VA 8AT1B 3J81Y 4B9LA 1FRJA 2ZM6J 5B09A 2Z0GA 4YR3A 1HPZA 2QRRA 2W2QP 4K4UA 2F8HA 1EQMA 1H6KX 1NZ8A 3H7HB 2IRXA 3KK2B 4UOFA 3VV2B 4H4OB 3OBIA 1O6XA 1FNOA 4ZK7M 1AUDA 4F0HA 3IWXA 2F9DA 2WW8A 4TLRA 4WTOB 3OQ2A 2U1AA 3BGLA 4P74A 4QWDA 2BA9A 2V8DA 2VB6A 3Q2TC 3LH2S 1HBOB 4OYPA 4ZN3A 2OMLA 3TR5A 2XO6A 4QW9A 3DXSX 4M8LA 2X1AA 3SIPB 1SJQA 1RHQB 3MM5B 4PG7A 2CRLA 1P1LA 2R7TA 3JYTA 4C8OA 2GCFA 2E9RX 3AJDA 5C25B 3M7VA 4QYRA 4BCAA 3T1AA 2AEJA 1IWAA 3HHKA 1BQMA 1P9QC 2W4PA 3IBFB 1SIZA 2GIRA 4LSNB 4G1PA 1TAUA 3I9ZA 1HFEL 2EEYA 1A6LA 3I6PA 3OHAA 5IM0A 2MGZB 4KBIA 2AT1B 4M5KA 4UOHA 1RT1A 1T94A 3SCKE 4PRFA 2W4CA 1UVJA 2HMIB 4J5OA 4YY3J 1GTHA 2QX0A 3PHTA 1IJEB 1N5TA 3LP2B 4FS1A 2FVPA 4LR8A 4ECRA 3TQEA 3HFZB 1AB8A 4DR7J 4Q5VA 2M70A 2HS4A 3NS6A 3FFIA 3VQTA 1RADB 1RLDA 2E5LJ 4CNZA 2COLA 3HSDA 3PKMA 4A46A 2VHGA 4ZCIA 1T03A 3QNWB 2IVYA 2Y0BB 4B3RJ 3C19A 3NG8A 3ILLA 3DOMB 4TU8A 4FKXA 1RLCL 2KJVA 4WIQA 1N54B 2EK6A 4NX9A 3P5BP 5HATA 3VVTA 4I6WA 5CYJA 4O3OA 1LW2A 4N8NA 3PZPA 4JV5J 2M4MA 2N4CA 1X4EA 2GGPA 4PYDA 5ETRA 4CLKA 2HBZB 1U2RA 1HNXF 1N33F 2B4OA 3R1LA 3MEEA 2VG5B 4A47A 2CQ0A 3A8KA 1X4BA 4ED2A 1FKOB 1JX4A 2CQPA 2Q6BA 4IUFA 2KXNB 2JJ4D 2DRDA 2Z56B 3Q8VA 2DH9A 5HI7A 2GA7A 4OX7A 4BWMA 4ELUA 5E41A 2NREA 4O4RA 2JEJA 2N7CA 2O3DA 4CLSA 2HVZA 3EXCX 2JLEA 4J9UE 2XCPA 1EAYC 2WVDA 2QT7A 4ATNA 3UR0A 2DRBA 1VK3A 4O3PA 5A76A 3MR3A 2HFZA 2B5JA 5HQLA 3B4DA 2IPOB 3CDWA 3T6JA 5I3QA 1ZETA 1VBXA 2CG8A 1V5IB 1XNRJ 1YRUA 1AROP 2M5YA 4PXBA 1A9NB 3JB9k 2C2OB 3PO4A 2ZH9A 4NMXA 3CJ5A 4Y2IA 4JI8J 1W26A 2QA4S 2MQPA 1UWAA 4IRKA 3R9LA 1V9OA 2OUGA 1HWIA 2LQ5A 5HK4A 5EX0A 3PYGA 2OPQB 2JLFA 3CW2C 1UZDA 5KT6A 3DOKB 4LF4F 4DQQA 3LGHA 2XMMA 4NXMF 2Z2MA 2Q66A 1C4CA 5LMUJ 3AODA 4ZDNA 4FYYB 4K4WA 2Z4PA 4CLFA 1WD6A 2A1BA 3M4XA 3C16A 3H90A 4F3QA 1J5EF 1H3DA 1UMJA 4ECWA 2C2KB 2CQHA 2XO7A 4C3KA 1TKZB 1S59A 4MIAA 1CPZA 2YQ0A 3BYRA 4OFZA 1KWMA 2XEXA 4OI0A 3MAHA 1VCTA 1QSSA 3VWSA 2WBRA 2HAFA 2DGXA 3WZ0A 4ED6A 3BYPA 2ZDPA 3IG1B 4L74A 1S99A 4WE1A 2DVIA 1IJFB 2V9WA 4DL4A 4USHA 4J9RA 3NS5A 3Q8SB 3KLIB 1HARA 4G1IA 4OI6A 3DC2A 2HURA 6FD1A 4DL5A 1FVQA 3UCUP 4IG0B 3P96A 2NR0A 4X4TA 4DWIA 3ENVA 4KPCA 1I51B 2X3DA 4F67A 3PFOA 3M6VA 4QQBA 3CMAS 2HS0A 3MOJB 1R8BA 2EFOA 1I5OB 1NXIA 1RWUA 1KQGB 4U7UD 1S1WA 2J8AA 3B4MA 3HFKA 2AJQA 1WSRA 1NCLA 2ZBIA 5LXRA 3TVYA 1N4LA 3ZO7A 4ZJOA 1RWOB 2H5EA 2OHDA 3MM7B 1S77D 2HYIB 2RNEA 3MWBA 2MZTA 4I56A 1KLMA 3JAMY 4N5SA 4J9LA 4LF6F 4KFBA 2AJ2A 2DJWA 2M7SA 1URRA 3HVTB 4U9RA 3E3XA 1ZAVA 4RW6A 2YWKA 3NKYA 4NLOA 4IH7A 2ALYB 2XWXA 3GFXA 2GV1A 2RT3A 2BM0A 2YKQA 1NHUA 4EZ9A 1T02A 3KG1A 1KLNA 2LXIA 4F4YA 4DPWA 3KK1A 2I5JB 3GIRA 2R2UA 1NSAA 3JS9A 4QWEA 2ZKTA 3R5AA 3MM8A 1HWUA 5KFKA 3W65A 3GZ7A 5L8RC 1QE1B 4WFAQ 4USVA 3VAKA 2GVDA 3MD1A 3OTDA 3GFZA 5EUHA 1HYSB 3VHQA 2HZVA 2EFVA 3DXBA 3FBBA 3ILOA 1FE4A 1OQ3A 1C1BB 3A3OB 4K59A 1T9YA 3FSIA 2IFXA 3WX8A 2EC0A 3RRKA 2BOPA 3QO9A 3D6FB 4N77A 2MSSA 3WC2A 2OEJA 2E66A 3N6LA 5J2NB 1IBKF 4ZJQA 2RB7A 2J9DE 4CLTA 2UXDF 1WF1A 1P8GA 4NL5A 2HNYA 4MKBA 3D4JA 4ZVFA 2JVOA 3OLBA 4D3HA 4XDCA 2LEPA 2CA9A 2G0CA 4P2FA 4A8OA 5BYSA 3BR9A 4TYBA 2UXBF 2P2CB 4I7FA 3DYAB 2FJEB 2MKSA 3EYZA 5FJ4A 5BR8J 2A0FB 4C2MA 1LNQA 2UUCF 1HNWF 3LALA 1Y4ZB 2BYCA 3I5CA 3GQCA 4YDDB 2FHJD 1N5YA 3BV8A 1RWVB 1Y00A 1TQLA 1TL3A 2D1CA 3A8JA 3MM9A 1QAXA 3LUYA 4JI7J 2PMWA 3P45B 2HNZA 3CT9A 3W2VB 2R2TA 1NK8A 1F9EB 2B9XA 2XQCA 2XNRA 2FGOA 2OMOA 4DV6F 5HP1B 4ZVTB 1S1VA 2J6SA 2XTJP 1PAEX 2A3JA 3D54A 4DUZF 3BZQA 2VFTA 3HMJG 4ZVPB 1GT8A 4L75A 5ETPA 4CH1A 3OVSA 5DZ6A 2VIHA 1HNIB 3SQGA 4HT7A 2CJ9A 1CJKB 2IJFA 1APSA 4DX6A 2ATLA 3FMWA 2C3YA 3DMJA 2HNDA 1T9VA 2K06A 2JC1A 4OZ0A 3G6VA 8RUCA 4GVLA 2XC9A 4MKAA 1HIYA 1NJIT 3QZ8A 4ILLA 2ZOMA 4G3IA 3OSNA 2CVIA 2DEJA 1GMWA 1W25A 1TELA 2E9ZA 3R97A 1DTQB 4JV0A 4WZQA 4ES3A 3CCMS 4WK1A 3DOLB 1GAOA 4OJHA 4DF4A 3BGRB 2E1PA 1KTQA 1LWCB 4KKOA 1WOPA 3JSMA 8ATCB 1S9EA 1NUEA 4EO6A 2AGQA 4G65A 1CJVB 3HSZA 2MEWA 4DV4J 2HHXA 5F3TA 4M63A 5ETMA 1FHTA 2OO4A 3M2UA 4FXVA 4RZRA 4ECTA 4P7TA 2ZVSA 2VA2A 1TU0B 5F8LA 4KTQA 2YY3A 2DNKA 2WOMA 2I0XA 4DV0J 2E7VA 4KSEB 3R7NB 2H9ZA 1L3SA 4HLBA 1FXLA 1RI7A 4K0KJ 4RX6A 2MLXA 1HPZB 2D41A 3M32B 2B6AB 3DNCA 3MUVP 4Y28C 1ZYQA 1Q7LB 3M8QA 4QZVB 1MSWD 2IJNA 1PYOB 2GQ2A 2MZJA 2ZKUA 4GVBA 4URGA 4WYLA 2BDPA 2MPUA 1DHMA 2UP1A 2R7VA 1ZM9A 3HF5A 2DKOB 2CG4A 3BS9A 2V2KA 2F4VJ 5K8NA 4X65J 1NSKL 3AH6A 1WSVA 4DQSA 1R8HA 2KYZA 1BWEA 3OFFA 1R0AA 1XBWA 4UOCA 4YQWA 4F0KA 2W7AA 1L3KA 3ZNUA 1NM2A 2M88A 3C14A 4C8KA 2BJDA 3JYTB 4MFBB 5J2QB 4H4MA 5EWEA 4WBFA 4O0NA 1CJTA 5IXUA 1BQMB 2VPXB 2OSRA 4MK8A 3HHLD 4B3SJ 2O1PA 3QAUA 2NSBA 2EFNA 4QBUA 3DRSB 1BQXA 2DR8A 2LFVA 2XBPA 2YH1A 1VQ6S 5IM0B 4ES1A 2DGUA 1CJUA 1N32F 4KPYA 3RB0A 4CZCA 4IOAQ 4C3MA 2HSEB 2V67A 4P10A 2R8KA 3QPIA 5FLXU 1MMNA 2M52A 3ETMA 3DKDA 2DCUB 3HZGA 1G7CB 2XMAA 3ONQA 4F2RA 1AFJA 4I0WA 3V81A 2B7CB 2JFDA 1D09B 5BJRA 1UVLA 2RQCA 3KUHA 4CDIA 3W63A 3PEJA 1XERA 3GR0A 3QATA 1JNZB 3HT0A 1Q53A 4M5JA 1KD1T 3CDEA 3AY0A 3SZ2A 1BC6A 2EG1A 1FX2A 4DV3F 4Z37A 3DLLQ 3ISZA 1K1SA 4BDPA 2GAHC 3EDRB 5I3PA 3OSPA 3T1YF 4ICLB 5HJXA 2BW2A 4BLGA 5A0YA 2YPYA 2DO4A 1GFWB 1NPRA 3MEEB 1MNEA 2K2PA 1S10A 2AJFE 1QJHA 4GKJF 2OD4A 1QLNA 2K7JA 3G9CA 1KBRA 2EW9A 5A8RA 4AQYF 4JI4J 1WC4A 2A2DA 3J7AN 4X4SA 5J1NA 3ZNJ1 3N01A 1X31C 2CQ2A 3NXZA 4B3OB 3BSCA 2ZVIA 3EMTA 4NEZA 3T5HA 1HI8A 1ZA2B 4FYVB 2HQIA 4NYPA 2BE9B 2HBYB 4YB6A 5CD4A 3O8WA 2HG4A 3NOGA 3QJJA 2HBQB 2JRSA 3NMRA 2GMHA 3V4IB 4C11B 4E98A 2ZJPQ 2YXLA 2B5JB 3FBFA 3M6XA 1YBAA 3GJQB 4DR5J 5ADZA 1HNXJ 2W01A 3SBMA 2Q1LA 2L9NA 4FPIA 1VBZA 3U1LA 2N7YA 5HBMA 3LPEA 2M2BA 4C97A 5IS2A 4AXJA 2Y3YA 3TYTA 1HQ2A 5HL7Q 4ZPTR 2CQBA 3KWMA 2KT3A 1RGVA 1HBUA 2KH9A 3S8SA 3R3TA 3E2EA 4RNNA 3R2CJ 4IFYA 2J7WA 3DLJA 3CUNA 5D0RA 2D9PA 3EZOA 2XM3A 2ZDOA 2MHEA 3GJSB 2AW0A 2JC0A 3NGUA 4OZ3A 4K4YA 4JI0J 1SV5A 2YWGA 3JTOA 2W7PA 2OAUA 5CZVA 2CJAA 3RR8A 1YKWA 5D3GA 4EU0A 2VG6A 1YZ6A 3MEGA 3UD4P 2HFSA 3Q2SC 2UUAF 4WE1B 1T11A 2LQBA 1Y7PA 2CXEA 4F4AA 4TY8A 2BE2A 3FQKA 2XY7A 2BBEA 3QSIA 2ZH4A 4LF4J 3QIPB 4NXMJ 3UDLA 3W60A 5LJ3Y 1H38A 1VQYA 1J5EJ 2UZAA 3ZTPA 5KFCA 4DV5F 3ENWA 2QLJB 4I6YA 4QR1A 3MCNA 5B0GA 2HQDA 1ZM3A 3K8WA 3C66A 1TL4A 1N56A 5AE2A 1EQ0A 1UJ5A 1UVKA 3CJKB 3MEDA 1NDKA 4TU7A 4KFBB 4ZP7A 1MROA 1BE4A 3O1LA 1MU2A 4JBCA 4MYTA 3HSGA 4RW6B 3AA9A 4YP3A 3M2VA 1TKTA 2V9KA 4FYXB 2UUTA 4ED7A 3RBDA 3QLHA 2YWFA 1RCXB 4DPYA 5IWAF 3UNYA 3PFEA 2OELA 5LMNJ 2WBMA 2YKNB 4DFJA 3Q8RB 5T7LB 3NNCA 1ULRA 1JLFA 2WB1D 5L38A 3SI8A 4AL7A 4ETZA 4GKKF 1IQZA 5B0EA 2G2YA 2R8JA 1FERA 1R8AA 1FF2A 2MMYA 4NYZA 3HP6A 2DK2A 3DRXA 4USMA 1IKWA 3MFHA 5L39A 3KUEA 3R5JB 5I3UA 2BMBA 4KO0B 2ZD1B 1JB0C 3W5YA 2PGCA 3GSIA 3LGNA 2QO3A 4LF9F 3BO4A 5KOWA 2ZWOA 1WHXA 4ZA1A 4PG6A 2HVIA 1KQSR 4LF6J 2OH2A 1TKXB 4USIA 1RWPB 3CCJS 1SQFA 1X7VA 5KTQA 2QYGA 4W98A 2JEIA 1QTNB 2CYYA 1OY6A 1XEZA 2I6WA 4TXSA 5D77A 2DGSA 3T5KA 3JQJA 4QPXA 5GAGU 2VBXA 2GNKA 2HNYB 3KLFA 3A1YG 4CO5A 1XTZA 3W5XA 4PXCA 4A48A 4EGLA 3BBFA 4M94A 1REVB 3CPWR 4ZVOB 2MQLA 5CA5A 2HRTA 3CD0A 2UXCJ 4F4KA 2PI5A 5HLFA 1BQNA 4I7FB 3OR2A 3BBCA 2I9SA 3PV8A 1N5QA 5J2MA 1HWLA 2D69A 4CH7A 2KXHA 4JI6F 1N5YB 4FXDA 3S7RA 3R8YA 4ED4A 4DL2A 2SXLA 4P72A 1IR2A 3IR7B 1TL3B 1R0BG 1FFSB 3EGWB 3MM9B 2RRNA 2QV6A 5J1EB 1O8BA 1YI2S 2F7VA 4OV1A 2QEXS 2HNZB 1MWYA 3AT1B 2H3EB 2NSCA 1G4CA 3FCHA 1IBKJ 2DIVA 3OFGA 4QR0A 4UZBA 3BDEA 2UXDJ 2HPUA 2DXEA 1S1VB 2OJ3A 4U8VA 5E33A 2HGLA 1TMJA 2DRAA 2HWTA 3DLHA 4IG3A 4NRTA 5F41A 1UW9A 2Y1RI 3ZZYA 1VQOS 2AGOA 3FNNA 1M5HA 3NEKA 3ILJA 3J81j 2UXBJ 1Y5LB 3SQGB 1HBMA 5HMWA 1SC4B 2RQ4A 4PWDA 2DO0A 1R3NA 1NK6A 4B9UA 4Q0BA 4NLYA 3BGOP 2UUCJ 1IKVA 1UWBA 1HNWJ 3CJ0A 3BO2A 1UJ4A 1UFWA 2E1MC 3HKZD 1KVKA 4USKA 1QSLA 1H0HB 1N34F 1Q0NA 3NCRA 1JKHA 2XHCA 1DTTA 1WJ9A 2B4VA 1T9WA 2NUUG 3TX8A 4NCGB 1ZZNA 3BF4A 2HHWA 4CLYA 2DH7A 2AZ1A 1FDBA 4UF4A 2ZE2A 3ZZUA 1DRZA 3HZEA 1SIWB 1JJHA 1UETA 3THVA 3AOBA 1LWEA 2HHSA 4DV6J 4FN5A 3GIKA 3CE8A 1HQUB 2BV3A 2LXFA 3RU0A 4DUZJ 4J9OA 5F8IA 4LVNP 1AA1B 2PE8A 1GMVA 2Z58B 2W9CA 2RE1A 4PCQA 4DLGA 4KKOB 3PJWA 4ALZA 3V6HA 2XY5A 2NZCA 2CQIA 2C3MA 2M3DA 4U96A 2AF6A 5B0AA 4IR9A 2ZOGA 2E5IA 5AXNA 3HHLB 4NOHA 1RWKB 2KT5A 4ECZA 1S72S 4RO0A 4HDGA 2Z57B 3KTQA 3PW5A 4A8QA 1S7IA 3NY0A 3M9NB 3CMQA 2EI5A 2H4WB 3KLVA 2WOMB 3MMCA 3W62A 4OZ2A 2OTLS 2KZMA 3HO1A 1VQ8S 4EI2A 3FGVA 2RRBA 3CJTA 5CYMB 1L5UA 1N52B 1I94F 4QYZK 5E2QA 1EIYB 2APOA 2DISA 3W9HA 3M8QB 1P1TA 3F56A 2ZHAA 1HNZF 2WK4A 1FKPA 1NLKL 2CQDA 2AQ4A 1U24A 4DR3F 3KJVB 2VQEF 3NGTA 4JI1F 3MR7A 2FLOA 4JYAF 2BJ7A 4CLZA 3ULHA 4RW4A 3DRRB 2X3GA 3K2YA 4UT4A 1RWNB 3HCXA 4LF2A 4F25A 1SUQA 3I96A 5GMKa 1NKEA 1FJEB 3K7RA 1YLXA 2LA4A 4FNIA 5J2PB 1F9FA 1GXTA 4I4BA 4MTPA 3RTVA 3PYDA 1G3OA 3SSRA 5H1SV 4BS2A 1UEUA 3C14B 1RAIB 2QL5B 3LGMA 1E6VA 5LJ5Y 3DM2A 3E01A 2CPJA 3GYGA 2IC3A 1WHVA 4ZN1A 1TUVA 3B78A 3TUJC 1CJTB 3EM1A 2RHSB 1AW0A 1S9FA 4QIEA 2V5HG 1RAGB 2XYHB 2MSTA 5B0DA 1UPMB 2VU5A 5D4LA 2XY6A 1QD1A 4FS2A 2ZH5A 1NK5A 2MB0B 3LP0A 3MPWA 4QCLA 1YJ7A 2BQRA 5M2PA 4DUTA 2FQQB 4LF7F 2NPIA 4PUOA 4OZNA 4DLEA 3KLEA 3FDSA 2G0IA 4ZKAA 1LK5A 1JQGA 4I1TA 2QSWA 2W4DA 2GX8A 2CPEA 4ZCMA 4X4PA 1TL7A 3VAGA 1T3OA 1S5ZA 5A8WA 1EKRA 3HK2A 4NLQA 3OXLA 2HQ3A 1JK9B 3F73A 4ANCA 3V81B 3G96A 5MAOA 1QM9A 4EZ6A 1GNKA 1NZAA 2VPWB 4E0DA 2BJEA 3PJXA 4OLOA 5KG3A 4URQU 3GR1A 2EC2A 3TRGA 3NCPA 4M5IA 2FUG9 3QFHA 1S6UA 3KHLA 4NRUA 3VGVA 5A2QU 1N0VC 4DV7F 3M8WA 2ZBPA 4I64A 1N32J 3PO5A 1K0TA 4HEA9 2JEFA 4LRBA 3R1HA 2J9EA 5KG5A 4OL8A 3PDNA 4LSLA 3RB4A 5DJBA 3AB4B 1DBDA 2RDJA 3MPYA 2IJRA 1IVZA 1V5VA 2PEHA 2J8SA 5F8JA 2VD3A 5D0EA 2BEFA 2DR6A 3CTRA 3DI6B 3SYZA 4QWCA 3H0PA 2FC9A 4P73A 3NNHA 2ZEJA 2C28A 1LOUA 5J1PA 3TVZA 4DV3J 1VC5A 1XMBA 2MZ1A 4NZ0A 5GAGI 2PMZD 3PG9A 2V2ZA 5E3CA 3T1YJ 4LUBA 1R43A 2AIRB 2BABA 3G86A 2K3IA 2C2ZB 1PC4A 3S1TA 5KFEA 4LRDA 2EVZA 4KV8A 2H65B 2XMVA 1SC3B 2V50A 1RTJA 3UR3C 5GMEA 3ZXWA 2RH3A 5KG7A 5IOLA 5HMZA 4DV1J 5K14B 4GKJJ 2QYCA 2XZWA 5HBMB 3H42A 4LRFA 2XS7A 5ETNA 2RUGA 3KHHA 2WRMA 1AFIA 4AQYJ 2FLNA 1WUUA 2Q6CA 2KDOA 3LA0A 1RHKB 3OJSA 4CM0A 3OXFA 1RT6A 5LT5A 4B3TF 1PYSB 1TP7A 4C8ZA 4NZ7A 2LA6A 4LSZB 1Q81T 2MY8A 2PIIA 5FIIA 3UN3A 2KI2A 1EHWA 2GVZB 3K5NA 2YQ3A 2VBWA 3RRGA 4B9SA 1RT3A 4L3KA 2DY1A 3OTEA 2BJ8A 3BH6B 3C46A 4AE5A 3BSOA 1OIAA 2ASLA 3O5TB 2F1FA 5KFIA 2XI3A 3AXMA 2HK2A 1U1NA 2RDDA 1SV5B 2NLWA 1NRKA 4ECSA 1KOHA 5DGBA 3G6YA 5D3GB 4OYZA 2PN6A 5KOXA 5BXIA 3CC7S 1RWMB 2F4FA 3BH7B 4NYOA 2FIUA 2CQ4A 3MPVA 4MAKA 2R7RA 1ZPWX 2HQCA 4EBEA 1HD0A 2BE2B 2WONA 4I2PA 4WPAA 4ZOSA 5IT0A 4UY85 4DF8A 1VQKS 4EO8A 2KRRA 2MKJA 3WHIA 1XMQJ 3KNGA 4NLPA 3OUYA 1VQMS 3PX6A 2IVMA 1UP1A 4PWUA 4O4GA 2HHPA 1F9HA 2VFVA 1SKSA 5JXSA 3PW7A 1FRLA 1CSJA 2RF2B 1F1BB 2LVWA 2JDJA 2IRYA 3QWPA 5GAEU 1F2GA 4TQSA 2C2EA 1U1KA 2CAJA 3C15B 1NB7A 2C2NA 1JNRB 3AJ2A 3H20A 2UUAJ 1VHIA 2VKZG 1Y3JA 1TKTB 4WXOA 2VBZA 1Q79A 1IBMJ 3CGIA 4QIWD 1SC1B 3ZZOA 2CPXA 4L3NA 3ENQA 4XDDA 4OZ1A 2DGOA 4PG8A 3QT5A 1XIQA 1JLFB 2P9CA 1TL1A 3M8PB 1Q1KA 5DLGA 1U26A 4DV5J 3ZFVA 3TUIC 2W8LA 2MXYA 1U1RA 3DU6A 2RKIA 3MMJA 3PW4A 3UN5A 4MJKA 1IKYB 4Y34A 3RBXA 1IKWB 4O3SA 1JLEA 4R8UA 1TKDA 4PQUA 5I3UB 1KN6A 3G82B 2A6OA 3IRXB 3Q8PB 1ZPVA 4OHYA 1U0SA 5CYQA 4DX5A 2GQCA 2UU9F 1YJVA 4QU7A 4RNMA 3M1VA 4WU2A 1NK0A 4RU9A 2W2NP 2NYIA 4RKUC 3C6UA 2BOAA 3ZTRA 1WEYA 2FLPA 2RD5C 2XMUA 4QOTA 1U02A 1KHWA 4E2FB 3TA0A 5IWAJ 5F8HA 3G6ES 4DR2F 4DQRA 2VC1A 1VFJA 2GIFA 2N3LA 4AFFA 4B9TA 4OJGA 4GC7A 5HAOA 1R31A 4GKKJ 2GS8A 3QWUA 1X4FA 2CPYA 4F4ZA 1S1XA 2ASJA 2YNFA 1X0PA 1KVJA 1NO8A 3D6MB 3V6DA 5HLFB 2P5VA 3N0VA 3CJ3A 2YNHA 2AJ0A 1FJGF 2C3PA 2K7KA 2LLZA 3PHEA 5J2MB 1D9DA 3NGDA 3FQLA 2FLLA 4R5PA 1RAEB 4C8NA 4LF9J 3TQ1A 4DCJB 2FHMA 3MM6A 1YJNS 3MI7X 2OEKA 3GTYX 3F0NA 2ADBA 5IT9U 2VFSA 1LKZA 3BSNA 4B9NA 2NS1B 2N3OA 2DNYA 2WVCA 4ZVEA 4JOUA 5K8MA 3BSAA 2B3TB 4CYUA 4ZP6A 1M5SA 1PGZA 2G4BA 2FVQA 1BHNA 4RNHA 1URNA 3IP0A 2QA1A 2XNQA 2N4DA 1BWVA 5C24A 2J6UA 3J7YU 5IV4A 2JNJA 3Q83A 1HL6A 4JUZA 3UPFA 2V4QA 2E9TA 3UFCX 5ITHA 1D8ZA 3M30A 2IAJA 3FRZA 4X66F 1OMSA 4OI4A 1HBMB 1EKSA 1XR7A 2DYAA 1RABB 4PWDB 3RAQA 1RAAB 3QT8A 2KRBA 1CC8A 2RMLA 3W2WA 5I4MA 4USUA 4M95A 4JI6J 4MT1A 4WJBA 1IM4A 4M5GA 4CTAB 2W1BA 2Q43A 1GTEA 2EKNA 1S79A 1NSQA 3R2DJ 2VV5A 3CULA 3VGTA 1BMQB 2R7SA 1JKHB 3KXDA 3I55S 3F41A 5H9EK 1PKUA 1FJCA 2CNLB 2PMHA 3TI0A 1Q95G 3SDEA 1YX2A 4O3NA 4RUHA 2WCXA 5GADU 1FVSA 2MZQA 4LFCF 4CO0A 4HT5A 4OYOA 4EWTA 4ZLJA 5DG7A 2GJ2A 1S48A 1WTBA 1V3RA 4RW7B 3UCZP 2ZHOA 3FJ2A 3IWNC 2CZ4A 2ZUAA 3DLGA 1RBAA 2W9CB 2V4JA 3U7JA 1U7LA 4S0MA 3DGPA 3US5A 4YN3B 1LW0A 4DI6A 4A8WA 2R7OA 5B0FA 4LQ3A 2R3VA 1PBAA 3EICA 1R27B 3R6GB 3GIJA 2BKPA 4RWWA 4Y2CA 5D6GA 1MN9A 3IMQJ 1FTRA 1N34J 4ZP9A 3BQ1A 4F50A 2DNPA 4DSEA 3R7BB 3EX7B 2RQMA 4WCEQ 3NP5A 2ATCB 1CC7A 2MKKA 3MF5A 3CF5Q 3BDPA 2XI2A 3MMCB 3V6JA 5B7WA 2J0WA 4DPTA 2F8EX 1W2IA 1PILA 4M5LA 4AD6A 1HBNA 2F65A 4I68A 3IXQA 5F9LA 1RKJA 1TUWA 1Z4UA 5MLCV 4MIBA 4X62F 3TZWA 5F3ZA 2FJXA 3F44A 1H73A 1FKPB 4XPEA 4IQMA 4ZPVR 3IN5A 1CQNA 3Q8YA 3DFEA 4ECQA 2O5DA 1NAQA 2JSXA 2YKMB 4RW4B 1DQ8A 4M5DA 1DY3A 3KDOA 2UUWA 5KFTA 3MUTP 4HACB 3G8QA 4PXDA 3VQSA 1SUQB 4WKYA 3TX0A 4C9DA 1DLOA 4AL5A 3MEKA 2EFPA 2V63A 2B43A 4DQPA 3PACA 1YDLA 2NPFA 2DBBA 3MMAB 3W66A 4OHZA 2HLUA 3H5SA 3FSXA 3JQKA 3TJAA 3DM2B 3E01B 2IC3B 1T05A 2YX4A 2YQ1A 5FLXY 1SCJB 3T9NA 1I94J 1MN7A 4TLQA 2YX1A 3H59A 1HWJA 5HMYA 2JL9A 3Q22A 1SKWA 5K5MA 4Y0FA 3J7A1 1HNZJ 4DSIA 3CIZA 4AUKA 1U1MA 3CXCR 3LP0B 2ZM6F 1RHUB 1NPPA 2HQGA 2KFZA 4P2MA 1NPKA 4CO2A 4DR3J 3JQMA 2VQEJ 4JI1J 3SCIE 4JYAJ 3B6BA 3I87A 1KC8T 5H9EJ 3J7Z5 3M2RA 2Q3PA 4PUOB 5I42B 1E6YA 3T41A 4MMOA 3IGNA 3KLEB 3RRHA 2CKWA 1S6PA 2VG7A 5A8WB 2HKEA 1RHRB 3EDQB 4XTTA 5GAEI 1JLQB 4EFAC 4N47A 3TW0A 4ZITA 5DDQC 1T9TA 5JMNA 3PYEA 1UCNA 1O51A 3MAQA 2B9YA 5BYRA 2E44A 2A6MA 3LPYA 4J9MA 4F8RA 1V6HA 3ZZ0A 3EZUA 5KG4A 3DRPB 3TEHB 4HH0A 4NA1A 3NNAA 1JXLA 1SVDA 4QIGA 1DURA 4LF7J 2R2SA 3DGVA 3H2VE 2QLXA 3MGJA 2HHTA 3VGSA 4H4OA 2VFUA 3D3CJ 2BZ2A 3QSYB 5A6PA 3X3UA 3N9UC 4N8OA 3NGRA 4LMZA 1X4GA 2BKNA 1WEZA 5KG0A 2QLBB 1BGXT 3PX0A 4DPXA 2HZAA 1H72C 1HBOA 3ZTQA 3VAFA 3KFWX 2CWKA 1XQIA 1KQFB 1FD2A 3RW7A 3OPKA 1WTFA 3TZYA 2DH8A 4B3MF 1HHQA 2QE5A 3D6TB 3J80Y 1J5OB 4CI0B 5C25A 3ISNC 4IRDA 1S4EA 2BANB 3I5AA 2LQ9A 1VQ4S 2OPSA 2VBYA 4DV7J 2G1HA 2CQCA 1HNVB 4A8MP 4K2XA 1UEVA 1U4BA 1FA0A 2JHEA 2YTCA 1C0UA 4CIOA 4KV8B 4RW8A 4RLEA 3V2UC 3BN4A 3GG1A 2CDRB 1IM6A 2Y9HA 1HW8A 1WC6A 3FBCA 2HMIA 3IM9A 4CLLA 1G2EA 3ZZPA 1PBUA 5KG2A 4K50A 4RNOA 2V94A 2XYPB 5E3QA 3OTOF 2ZH3A 2F63A 1A7GE 3IGVA 1GXUA 3TWZA 3I4PA 5G0RB 3IS9B 3IO1A 2FD2A 1U47A 3R5CA 2UUBF 4HVZA 1LV5A 3G6XA 2IA6A 4R0JA 2E5GA 3QRPA 3CCRS 1NDPA 1ZAWA 3VVUA 1Q82T 1WKJA 3PX4A 4QIFA 1RT3B 2I2YA 5L9NA 1S12A 1UZHA 1EX8A 3J7YI 1U48A 4ECUA 2ADCA 3DOMA 1RE1B 1J27A 1X5TA 4RNFA 2CPZA 3EXYA 1S1TA 1SBRA 2VDIA 5ETOA 2FJDB 1WI6A 2DGQA 3HD2A 2IYGA 2MKIA 3IA0A 1X0FA 1ZAXA 3VZIA 1FESA 1TR0A 5IQQA 1SB6A 3OL6A 2LU2A 2IM0A 2VG5A 2R9LA 4JI2F 1SPBP 2WONB 3OJUA 4I2PB 3H5XA 3EPGA 4HH1A 2E1AA 3W64A 5RUBA 4N76A 3I0SA 4B3TJ 1RT7A 4I2QB 1T3NA 5KFWA 2W9BA 2NXCA 2Y0SD 1NJWA 1MG7A 2HFOA 4ENOA 1TTHB 1NK7A 1XNQF 3TAPA 3OFHA 1EB0A 3NLCA 4IYQA 2DB1A 5HMXA 1H7WA 5GADI 1FXRA 3THTA 1DARA 4ED8A 4UOGA 2QC3A 1FFGB 2R7UA 1WOSA 4CH0S 1RAHB 2OEMA 4HHJA 1TVRB 3V4MA 2HFUA 4URSA 2IDEA 2DGVA 1IUJA 3GYXB 2MLYA 4K4VA 1GQEA 1C2PA 2FPHX 4XIUA 2K8GA 2PA8D 4WP8A 1SJFA 1G1XA 1F60B 4DXLA 2C42A 3R6LB 4C8MA 2DHHA 2HHVA 3M05A 3FK4A 2A18A 3CIMA 4DL6A 4E8UA 3CDBA 1KQKA 4IOCQ 2H48B 5B08A 2YWEA 3CC2S 4EMDA 2ZBQA 1QY7A 1EZZB 4YUDA 1YJUA 1TL1B 2KL8A 1WNEA 3DOKA 2Z30B 4IQXA 2WZ1A 2BVZA 3GIMA 3FMBA 3LP1A 3D2WA 2RKIB 5DDOC 3EE3A 3K59A 1FX4A 4V1Ak 1U1OA 1OYEA 4DX7A 3GILA 3PRDA 3HD1A 1JLEB 3E8OA 4M5MA 2H51B 3UNGC 2FY1A 2YKPA 2ACYA 2GO9A 5ETTA 3HPOA 1F3FA 2LEBA 2KO1A 3AXKA 1S6QB 2HFVA 3TAMA 3V5RA 4C6AA 2HRUA 3M1VB 1QDUB 4XO0A 3THPA 2DPIA 2J5AA 1V3ZA 5KFXA 1JLCB 1VI7A 2DHAA 1TK0A 2I38A 3CD5A 4FF1A 2BQ3A 1U25A 1U6FA 3ZZZA 1FK9B 4KAIA 1OSCA 4Q2LA 3IG1A 5LXYA 1I6JA 3L3CA 1I1GA 1Q8KA 4PZVA 1T8EA 3MMBB 4DR1F 4C48A 4CP5A 2PEBA 1NDCA 1R6VA 2OPRA 2MKHA 4NLWA 3TANA 4DSFA 4OIXA 3PXGa 1WDTA 4IG0A 2I1RA 4HDHA 1W7WA 4DS4A 4YMEA 3H98A 3U02A 4WYWA 5E0OA 1S6OA 3VF0B 4LRAA 2IMOA 1OO0B 1FD8A 3SV3A 1ELOA 1AYEA 2CPHA 4PEOA 1NJYA 1C1CA 4R5PB 2Z2ZA 3ILIA 1NSPA 4EBDA 2FZKB 1U6BA 1JLBA 2V34A 2UU9J 3MM6B 2K1RA 4ZVRB 5KFOA 1RACB 3MDFA 1X4CA 3KJNB 4KC5A 4C3LA 2MY7A 5DG9A 3RW6A 5AXLA 3GCXP 5F8MA 3HVTA 3G8TA 4DR2J 2O01C 2XGQA 2GZOA 2AJ1A 5C24B 2D3OR 2XCAA 1DQAA 4DN0A 2HHQA 3ZZTA 2DT9A 3KLGB 1H98A 3M30B 1HMVB 2HWHA 3UVJB 2EFGA 4N56A 2XULA 3DLEA 2E5HA 2I5JA 2J6TA 2ZFHA 1FJGJ 3QGGA 2YVSA 1WACA 4RBUA 1IQTA 4KT0C 2V8GA 1UVIA 2ZUGA 4KY3A 2Z2LA 1YBTA 4RU2A 5KG1A 1EP4B 5AE3A 5CHCB 1B0VA 1HYSA 3T6BA 1HR0J 3H5YA 5HQ8A 1GXLA 2O66A 1U0HA 4ECYA 4LR7A 5EN1A 3N5BA 3KLHB 4G1QB 3K17A 5IV3A 1C1BA 3JSBA 4CT9A 2ZHBA 3T19A 2D74B 4O23A 4LF8J 3LOUA 4Q2MA 4H4KA 4ID8A 4J9VA 3SDEB 4QJVA 3QGPA 2KG1A 5DG8A 4YHHF 5DRKA 3HFVA 3W1YC 1BY9A 3CEDA 3POTB 3W8GA 3GIIA 1MMLA 2EG2A 4TNOA 1RBOB 1VC0A 1UKUA 5M2RA 5ETLA 1VLOA 4DV2F 1VJWA 5LSLA 4MK9A 1VQSA 3BPSP 1KVIA 2L41A 3DLGB 4ER8A 4X66J 2B8QA 2V4JB 1Y10A 2RRAA 3DDKA 1OPZA 3CVKA 4NLDA 5HJYA 4WZMA 3H40A 1LW0B 4RUCA 3UO0A 2M9KA 4W92B 3W8PA 4GO7X 5KAKA 1B70B 4QPTA 3DYAA 3K8VA 3HVWA 4Q43A 1RTHB 5D0HA 1FCAA 5L1IA 4O44B 1VRTB 3HJVA 2MKYA 1VISA 3QJPA 5B0CA 1YJWS 1B0PA 2V8PA 2XLIA 2MZSA 1ZBTA 4LFCJ 5DETA 1YRTA 4MH8A 1KONA 4WFZA 3IC1A 5E5NA 4ELTA 1LWFB 2YBVA 3NBPA 4FP9A 4W90B 3KDNA 2KTQA 2KB2A 1WG4A 3UN2A 3MR5A 4P52A 2ZZNA 2QL9B 3MOZA 5KT5A 3CD7A 4M5DB 1IXKA 3VR1A 5CQGA 2EBGA 2DIUA 2XG8A 3GB0A 1VBKA 5B0BA 2XGPA 2P6SA 1X9SA 4DV4F 4N7TA 3RUBL 2PC6A 1GMWD 3EWGA 1MLAA 4OX8A 2C3UA 5C7PA 2BE7D 2WB4A 4KGXB 4CQ1A 2OLWA 1UA1A 2RJZA 3CMES 2PO4A 3OT9A 3IR5B 4X62J 4DV0F 1KTVA 1ZOTA 4DR4F 1S76D 1DFDA 4OYMA 4U95A 1DTQA 1JMTA 4J90A 1QSYA 5GAHI 2M8DB 3DOLA 3HM9A 5KFGA 3KMSA 2KKHA 2A2CA 3P49B 2BQUA 1N36F 5A2QY 1RT1B 2VODA 4DU7A 2HQFA 3VGUA 4CM2A 5DQGA 2JZ5A 3GV5B 4WFYA 3CCSS 4NI2A 2Y8WA 2ILYA 3MXHP 4F2SA 4JV1A 4FF4A 4ZCKA 3A4TA 3FFIB 4ZMMA 1LWXA 2ILZA 5HN0A 2WHOA 1H2TZ 4HYKA 2HVEA 2PDAA 2GIQA 3IBCB 4J9QA 3IR6B 2CQ1A 1XMOF 1L3UA 2U2FA 4UUXA 1KSPA 1FFWB 2DR9A 4DR6F 3KJFB 4RW9A 3CCQS 4OYWA 1YG0A 1B4SA 3PW0A 1T03B 3DLKA 1Z2ZA 1S1UA 4B3SF 3M32A 2B6AA 2IHR1 2MQ8A 1PAUB 1UL3A 2HHUA 3UE2A 1XWLA 1FDAA 1LW2B 2E1RA 1WOOA 4D3GA 3CCUS 2FC8A 2DGWA 2GGPB 2XS5A 3SCLE 3RR7A 1VHFA 4J7CA 2ZH2A 1XR6A 1MWZA 3OVAA 1TFWA 4U7CA 1ACMB 3QAEA 2QGFB 1VQPS 4NXNF 1PJ6A 1KRPA 2FGCA 3L9ZA 1YBUA 2ZJRQ 4MFBA 5J2QA 3LW5C 1LFWA 3N4WA 3C6TA 1FKAF 1UVNA 3PCOB 2HEKA 3AJ1A 4CLWA 2Y1JA 2JFKA 2J9DA 4ANDA 1F5BA 1VGYA 1U2FA 3TOQA 2YNIA 2ASYA 3K89A 3VAIA 2OPSB 4LF5F 3M8SA 4UUWA 1F5CA 1WELA 3HSJA 1M5VC 1KS2A 3DRSA 1FE0A 3GFYA 3ZTOA 1M1HA 2IM1A 1C0UB 2B8PA 4RW8B 1WI8A 3AOCA 1CG2A 2LCWA 2FHOB 3G8SA 3M8ZA 3D7SB 1EETA 1UPPA 5CAAA 5KFBA 4M5NA 1N33J 1NEEA 1SJ3P 1DAXA 2H1YA 7FDRA 2F40A 1NK9A 4QU6A 1NDLA 1K47A 3J80U 4B3MJ 4H4KC 4C0HA 4JI4F 3RZAA 4EK2A 3X1LB 2CNNB 4HHUA 4A8YA 4QWAA 2R8HA 4Q44A 4BC7A 5DLFA 2LQ8A 3I0RA 1FO1A 3D1HA 4KH1B 5HANA 1RTZA 2GHPA 5ETKA 3QRRA 2FJWA 3H2LA 3OL9A 1S0OA 4X4UA 3C16B 3L7OA 1S1TB 2QL7B 4DBQA 2LU1A 1YITS 2KFNA 3AQPA 4KQZA 5DZ7A 4ICLA 4C4WA 3NRBA 4ZVUB 1U09A 4DR5F 1YRXA 4DUYF 5A6WA 3OTOJ 2ZBRA 3LWLA 2XMJA 2CPDA 2P6TA 2ZC4A 9RUBA 5KFJA 1BXNA 4LRCA 3FZBA 2X1GA 2UUBJ 2IBOA 2IY5B 3I0SB 1RT7B 2MQQA 4X2BA 2J0XA 2AX1A 2W9BB 4OMFG 3OV7A 5KFVA 4IOBA 1HW9A 4F7VA 2EK1A 4B3OA 3C2PA 4A8SA 2V2QA 1R8PA 4JI5F 1QAYA 1ZM2A 3GCWP 2R2RA 5AT1B 4H54A 3U27A 3BKFA 3MAAA 4NWBA 4GO5X 4Y2KA 1K8AT 1HHTP 3V4IA 1NKBA 1S1WB 4C11A 4ZVQB 4Y65A 1D8YA 3TA2A 2NUHA 4JI0F 2AYEA 1Q78A 2ZH6A 4LT6A 4OYAA 2W2PP 2FVSA 1WWHA 2CJQA 3M8YA 5L1LA 4DPOA 3EPIA 4AYBD 4ILRA 1B0TA 4ZPAA 1LK7A 1VR6A 1XN9A 1LQ9A 2QJ3A 1CULA 3N6NA 1KR4A 2Q79A 3D1QA 4JI2J 1KLMB 1QVFR 1O5JA 3AQOA 4A8FA 1CEZA 2FJBB 4CO4A 1PCAA 4USJC 2PT0A 5KFNA 2GW8A 1UW4A 3AOAA 1XNQJ 3K58A 2RQKA 2ALZA 4ILMA 4QIVA 3LP1B 1TV6A 3TO8A 4UY8T 2RU9A 2D3O1 1JLGA 5U47A 1Q5YA 1FWKA 2HLTA 4U6PA 2DR5A 3KK1B 4FXWA 1U8WA 2DNZA 4NLXA 5THWA 1FEHA 3MM8B 3D1OA 1F5AA 1F2HA 1K44A 3TAMB 1MW7A 2QZ8A 5DM7Q 2GVDB 2B4UA 4ZCLA 4P6QA 2LXUA 1VK8A 4O0IA 4LFBF 4DFPA 4Y00A 2V4RA 2HW3A 3OTBA 1D3WA 1RYSA 2QSFA 2H5IB 5A8KA 4BC9A 1MMDA 2FZCB 3P4UB 3MURP 5IT9Y 2OPRB 3QO9B 1FRIA 5T41A 2AMCB 3PR5B 4X4RA 3D66A 5LMNF 1YK9A 3LWMA 5L46A 3QIPA 4HKQA 3CCWA 5D0GA 1FRKA 2V68A 3TAQA 3N79A 3DDNA 5LM7E 2BRKA 4PXEA 1VRUA 2DNQA 4MIWA 5KFAA 2D3ZA 1B3TA 1FRXA 2ACMA 3CJ8A 1NNDA 3VAHA 1C1CB 3D3BJ 3O44A 1K0VA 3K5LA 3LF0A 2DNNA 2XZTB 2B7BB 1D0EA 3ZC4A 1JLBB 1P9YA 1RU1A 2FJAB 2DNGA 2K1RB 3OTCA 1FXDA 2R4FA 4LBHA 3PKYA 3I82A 5EWFA 3CJKA 2R8IA 4U7UK 2NZ4A 4ZPWR 5D15A 1OPIA 3EVOA 1M5KC 1FRHA 4DR1J 4DZ6A 3TARA 1RUSA 1IKXA 4OQJA 2POKA 3O2IA 2FHJA 4TN2A 3DHWC 4PG5A 2I8EA 2YKNA 5T7LA 3DLEB 3ET6A 4OX9F 2GQQA 2DNRA 3KJQB 4NLGA 1Q8IA 5AJ3F 2UXCF 2ZNYA 4TU9A 2L3MA 4PG4A 3GJRB 4C0OC 1FI4A 3PM9A 3PEHA 1DQ9A 4IO9Q 1U0HB 4KO0A 2ZD1A 2WW4A 1RT2A 3M9MB 3KK3A 3AHPA 2KXFA 5JJBA 3DMJB 4ITSA 4N41A 2PFFB 1D9AA 3HULA 2HNDB 2W2MP 3EGVA 1TKXA 1GK8A 3D5MA 3QFWA 1GX6A 3SXLA 3M6UA 3ELHA 1YHQS 1L3VA 4OYBA 3TP2A 2W9AA 3OW2R 2AGPA 2E7WA 4Z7YA 3IWLA 1YTYA 2OPPA 3RB6A 4BHQA 3NGKA 2W24A 2BJ9A 1M5OC 4WFBQ 1REVA 4LFAF 4L73A 1NH8A 1XR5A 3MUMP 1VQNS 1HD1A 2VDHA 1OS5A 4ZLLA 4WU3A 4WF9Q 1MWQA 1SH0A 1RISA 1EARA 3JSMB 4IR1A 2VASA 1S9EB 2FYXA 3CDAA 2M8HA 2B4PA 4DZDA 1FEEA 2ABYA 5CH7B 1PJ7A 2GHVC 1U45A 4DMZA 1RDRA 2Z8QA 3M2UB 5J1EA 1FNMA 3ICLA 4YHHJ 4I6AA 2AEFA 3CCTA 3RG6A 4DL3A 3BEGB 2VFRA 3LQVA 3MZIA 5DDRC 5CD4H 2J0QD 3NBPB 3HDSA 4DV2J 4J37A 1HLWA 3EVMA 4PR6A 4NPOA 4WK3A 3QQCD 1RXOB 1KEKA 1PJ5A 3GJTB 1I3OB 3K57A 3BGUA 3TVKA 3SV4A 1SL0A 4GRSA 4GVBB 1BLUA 4NA2A 5M2UA 3DCAA 1HQEA 2JLGA 3CJRA 1SH3A 4HL9A 4AL6A 4X4OA 5HQMA 3A8EA 3BJYA 4YOEA 4ED1A 2Y1LB 1ZZFA 4NA3A 1C4AA 1Y9OA 2Z2YB 4X4QA 1TFYA 1SKUB 1R0AB 2OFHX 3S01A 4NCGA 3DHXA 4Q7AA 4WKRA 4KGKA 1CLFA 5KT4A 3UQSA 3R7SB 4RR5A 3AA8A 4FKYA 2RHQB 4H4MB 3NGSA 1XJWB 1HQUA 4DG1A 2OD6A 3UCGA 5F0UA 4RPFA 3BPDA 3VCDA 1Q7YT 4TYAA 1NJXA 2BW7A 2RUSA 4IFVA 3D6HB 3FRYA 2RVJA 4OZLA 1RHJB 3UW1A 1Q16B 2HVHA 1PG5B 1Q86T 2OI2A 2UVWA 1U1LA 1CJUB 1FDDA 2BXJA 2EXUA 2VPZB 3HHLA 4KYZA 1BUXA 5D78A 4P7VA 1YQHA 1REGX 4PPDA 4HTIA 3U1NA 5C2GA 1SQGA 2B9WA 4LQ9A 4ECXA 4NI2B 3UD3P 4M5HA 1X60A 4YB5A 3IAM9 2BACA 2ROGA 4DSJA 1U49A 1VOMA 2HGMA 3EUNA 4KGMA 3QYYA 3DN9A 2JX2A 4OV6A 7AT1B 1NBEB 4TKTA 4DR4J 4RW9B 5CYMA 4EYHB 3DLKB 3ITHA 2WSCC 3CDUA 4RWXA 1S1UB 4FYDA 3PIOQ 1VIXA 2MQNA 2AJ4A 4PYAA 1FJ7A 5KT2A 1UFLA 4KE5A 1GEHA 2GJIA 2ZH7A 1OJ4A 1NMEB 2GO8A 2X7IA 4K4XA 1N36J 3KJVA 3J7ZT 3TZXA 1A0OB 3FEZA 3DRRA 3FKBA 5T14A 2ZH1A 5A0YB 2QFIA 1WDDA 2VQFF 2DTJA 1O0PA 2OKQA 4WXWA 3CJ4A 4K4TA 5J2PA 3SMZA 1WKLA 2ZZTA 3UDEA 4DU8A 1RU2A 2VL1A 4I67A 3EGZA 1ZH5A 2PFDA 4ZIVA 2K3KA 2QG9B 1S0VA 3C6TB 5FDLA 5A8RB 1RTDA 3J81U 4O3RA 4F26A 4X64F 1XMOJ 4LBIA 2J76E 4DR6J 4K4SA 2YNIB 3M6WA 5HSPA 3P5TL 3QT7A 3GE9A 1N6QA 2KVQE 1JXEA 2XLKA 3I56S 4CLUA 4ZIWA 3JSRA 2KN4A 5K8PA 2IIHA 1KFSA 1F0XA 3TA1A 4IKAA 1PSDA 1EETB 4ZS6A 4CLPA 3LAMA 2D3UA 2DEIA 1W2BR 4UW2A 2JOQA 1WC3A 1AZSA 2H54B 1OYDA 5DO2A 2J7UA 2MZRA 4NXNJ 4B9MA 1VIOA 1FDNA 3M8RA 2Y8YA 5IC4B 4RUAA 4FBTA 1X4HA 3CB4A 2NXJA 5AXMA 3W5ZA 2RILA 3FSYA 5LSOA 3UDCA 1RAJA 3M9OB 2G13A 4ZPBA 3OD2A 4Q8EA 1VMBA 1X5OA 4DEZA 1HBUB 3KMQA 3GWCA 4I69A 4LF5J 1VRQC 3I0RB 1H2UX 3RJMB 1JLAA 1YGYA 3AFGA 4IFYB 5E3AA 4F3MA 1IWGA 4C98A 3WDOA 2YNGA 1VQ7S 4NASA 3NWGA 1RT5A 2AU0A 1IBCB 3CCLS 4FNHA 4YDXA 1RSCA 2MTLA 2EKYA 2ZWPA 3CD6S 3HVAA 3Q0AA 1YVFA 3PW2A 1B7FA 2OSQA 4OJ3A 4V19X 5E3PA 3HHDA 4B17A 4K2JA 2VG6B 3T1HF 4DV1F 1XC9A 3SQOP 3MEGB 4RBVA 2BJ1A 2NYHA 3DDIA 3H8YA 4PPZA 1QAJA 1RAFB 4HI2A 4TY8B 3E51A 1WC0A 3DI6A 1X9WA 2F9JA 3PIPQ 2WVBA 4J9PA 1T7PA 1RT4A 1B99A 2AZ3A 3MAAB 2MHNA 3OR1A 3HX9A 3L7UA 1IR0A 4ANEA 1ZTWA 4OLPA 4KJIA 3JXOA 4FBUA 4IDKA 2LEAA 1X9MA 5FD1A 3FUYA 4IRCA 5DDPC 1NKCA 1RWWB 4LIWA 2JH3A 1Z2LA 4DUYJ 4WIIA 3CO9A 4KIAA 1S0MA 4KHPF 2QIFA 3W9IA 3MHYA 2KHCA 1CULB 2GMJA 4KGZB 5AXKA 2F8MA 6FDRA 2OFGX 4Z7CA 5K14A 3MEDB 4YEAA 2WSEC 4IH5A 2H5JB 2CZ9A 4R0EA 1MROB 2XWYA 3GG0A 2P8IA 1MU2B 2QMUB 4ETXA 5E3RA 3M2VB 3GSDA 3W3SA 5KFPA 4ID5A 3RAMA 3QLHB 2XSJA 3P6YC 3K5PA 3HLUA 1TV6B 5CXTA 2RIJA 1JLGB 2WAQD 5JVHQ 4JI5J 1BD6A 2WVEA 2G2ZA 3O6QA 3Q8UA 4NLSA 2GVZA 2PI4A 2LYVA 1OY9A 1XMQF 4F04B 4OX6A 4UTGA 1SXLA 5F8GA 1SJ1A 3KOAA 5IT4A 1DZ5A 2O67A 3I9V9 1GMUA 5ETVA 1UVMA 3RAXA 4PKDB 3GV8B 2J0SD 1HI1A 3GU0A 2L08A 3Q89A 4WWSA 1NHVA 3HHLC 3SEOA 1RQ0A 2QN6B 4DQIA 5EGYA 5A8KB 1IBMF 1K73T 4BWJA 3D28A 4OZJA 4ZPCA 1Z1ZA 5LL6d 3R5DA 2FHKA 3R27A 1V3SA 2DHGA 4XAKA 5C2CA 1VRUB 3KLFB 1VBYA 3TZZA 4JI3F 1UJ6A 2VKRA 4JB8B 2XS2A 4W4MA 2G9OA 3ETOA 1RTIA 2XYGB 4NLTA 2HFNA 1S49A 1SL1A 1HA1A 1BQNB 3AD8C 1CBKA 3WBZA 4KGVB 4M1KA 3OR2B 3I32A 2OIHA 2RF2A 2V0NA 5SZTA 2CNKB 2VF3A 5DQHA 3MCSA 4LFBJ 2ASDA 4WP9A 3IBWA 2XZDB 1QTMA 2HAIA 3C15A 3EGNA 4MKVA 2KHDA 1JJCB 2DNLA 2YKOA 2IBKA 2MQMA 1CS4A 3OFEA 3CJQA 2CVEA 4GC6A 1ICEB 4CWBA 3CCZA 2AV5A 2B0GA 3H25A 2CJBA 3H5UA 9ATCB 1R0CB 1U1PA 1IKXB 2HHHF 4ZVSB 2JEGA 2YWHA 2GHWA 5JVGQ 3FBEA 1JXVA 3TNVA 5EHHA 2RDIA 2RS8A 4FZVA 1SJRA 1FNXH 3ET6B 4P71A 4NLRA 1OY8A 2CUYA 1IBLF 1OSDA 3M8PA 3OL7A 2AWZA 1FWPA 5CCLA 2V6AA 3TJ9A 4IG3B 3RBEA 2WSFC 2QTWA 1IKYA 2IRUA 1U6ZA 4DOZA 2CDQA 4RUBA 4MK7A 3G82A 1WEXA 3IRXA 1WF0A 1RT2B 3KK3B 4Q0BB 3G2XA 4NLUA 2L9WA 1ZTTA 1IKVB 1UWBB 5L9XA 3PTWA 3JAMU 3R5BA 1P27B 1M5PC 4U8YA 5KT3A 2LKZA 2LP4A 3RB3A 1VYAA 2E5JA 3RYLA 1DTTB 3FVYA 4OI3A 2CJXB 4OYIA 2R7WA 2ZE2B 4TQRA 2LMIA 1LWEB 2IM2A 3PJ9A 2OPPB 1KDNA 3D68A 4OX9J 3MCMA 4CNYA 4HI1A 3I4HX 4X4VA 1IR1A 1WC5A 4ZJLA 1OQ6A 4ECVA 3FCVA 4ES2A 4U67Q 3TEGA 2AEMA 5AJ3J 3MTKA 2YKAA 2G2OA 3W9JA 3MECA 4C8YA 1T95A 3GYNA 4LVOP 2ZZMA 5K8OA 3UDVA 4KRWA 4ELVA 5KFDA 2IMWP 1QUPA 2GJFA 3C3LA 5ETSA 2H4YB 3IFEA 4DDFA 1RWXB 4OHWA 2VJUA 4F4XA 3ISND 3VALA 3SSSA 3MPUB 3HJFA 4L6V3 4ZLPA 1NB2A 1SH2A 2CPFA 1KHVA 5ETQA 5KFSA 4Q8FA 2FVCA 2XLJA 2GMLA 3CCVS 4OZ5A 1YJTA 1TK5A 2DD8S 2KVIA 2BR0A 4QWBA 5LSRA 1VDHA 2VICA 5F9NA 5IC6B 5EWGA 4LFAJ 1HWKA 1KKHA 1VJQA 2AHOB 1UEKA 1KOOA 4RBTA 4ZPDA 3HI9A 2V8VA 3SCJE 4LIRA 5D8HB 4YS2A 1HQEB 2WVFA 3QZ7A 1D1UA 1X5PA 3FEXB 3CCES 1UFKA 3PY8A 1L3TA 5F8NA 2QA2A 1QVGR 4CTAA 2FTRA 2KJWA 4YB1P 3D0IE 3P8BB 3BBBA 1LFPA 1S9GA 2A10A 5C42A 2W25A 2EWHA 2KZZA 1X8DA 3PYFA 2QFJA 1RA7A 4FVMA 3FC9A 1RK8A 4JV2A 4C8LA 1WC1A 1E6VB 4Y2AA 2XMKA 2C2MB 4F36A 5G4DA 2VC0A 1Y3KA 3MD3A 4DG1B 3QMQA 1ITPA 1QUVA 2ERRA 4CCHA 4RW7A 4IFVB 1VQLS 2J9CA 1KNZA 3EZ5A 2D9OA 3D0HE 3DU5A 3A3PB 3K5OA 5D4NA 4WFNQ 1N88A 4UQTA 2R7XA 4CT8A 4V19J 1R6YA 4UZCA 1SC6A 4X84A 1IN0A 4DSLA 2X51A 2CQ3A 4PQAA 1M0SA 2ZBCA 4AT1B 1X5SA 1N0UA 1CQMA 4K7QA 2HBRB 2MLZA 1U8SA 1P6TA 3KNAA 4EBCA 3EVWA 1NU4A 1YZ7A 2ZH8A 5HO4A 2BUNA 1TL7B 4ZLNA 3BKTA 3AB2B 1LXNA 3V6KA 4CO1A 2HIQA 3GV7B 3VZHA 3KYLA 1FWLA 3R5GA 3WX4A 1PYTA 1CVJA 5KFZA 3N6MA 5E7OB 1RHMB 2G1DA 2JWNA 4A8KA 1NHKL 4ED0A 3L09A 1U1QA 5HROA 3ITHB 1C0TA 2UVVA 5IFMA 2CQGA 4ZHRA 2VJVA 2C3OA 3U1MA 5K20B 4Y6IA 2ZNZA 3L95X 3BR8A 2ROEA 2BJ3A 3T5LA 2YKMA 3C8YA 4HR2A 3BB5A 3MPDA 2KG0A 4HACA 1TZ0A 5F0WA 3KK2A 5DQIA 3UWTA 4FVCA 3UI3A 2N82B 2BKOA 3S6EA 4FDFA 4LSLB 1LEOA 2RAQA 4ZVGA 3A3NB 4FF3A 2VH7A 4YY3F 3MMAA 3B82A 4L76A 5FDLB 3CC4S 2MYFA 1RTDB 2M0GB 3GFHA 2VOPA 3Q8QB 4NCAA 3D9BA 4DR7F 4RJVA 4FF2A 4BBYA 2E29A 5SUHA 5EDWA 3MM5A 3LANA 2XSFA 2E5LF 3CJSA 1N6QB 3DRYA 4Q45A 2LECA 4EEYA 5GMDA 1PC5A 1TAQA 2BM1A 1S7HA 2L9DA 3AD9C 3A8IA 1K9MT 4QW8A 1TL5A 3BO3A 3NCQA 4B3RF 4DPUA 3JSYA 2DXFA 3HKWA 4WTYA 2DHXA 3OVBA 4LSNA 1AUSL 3CWJA 2AKWB 5I42A 1N48A 4EUVA 1R89A 2VQFJ 1RP5A 2DPJA 2XMTA 4YB7A 1AZSB 4JV5F 1OWXA 2R7QA 1XK8A 3B54A 2MGZA 3O3LA 1HHSA 2VZ9A 1RTJB 1WKKA 2CIMA 3Q23A 4P2XA 4DJBA 4P75A 3FZ2A 3HHNB 2HIYA 1JLQA 2J7KA 3LP2A 3HXMA 4C7QA 4X64J 3KHGA 2ZOFA 1UA0A 1Y11A 3HHEA 1M1GA 1FT8A 2AYMA 5AE1A 4DCOB 3GLJA 1RT6B 3KUGA 4GMKA 1JLAB 1B7YB 2R8GA 5HVFA 4F4WA 3DRPA 3W61A 2HRYA 1ZA1B 2V69A 5C5JA 4P9SA 2YNGB 5KT7A 2FJVA 4A8XA 5DM6Q 2UVUA 1RT5B 3UD5A 1Q8LA 2NXEA 2FY8A 1S97A 1KP6A 1K1QA 3G4SS 2CJYB 3KG0A 4NMLA 3GMGA 2X1BA 4HTJA 5KFYA 4ZVHA 4WFXA 3BREA 1EJ7L 1H74A 2YX7A 2JVRA 2FB0A 1LXJA 1R8CA 1SL2A 4QYZJ 3LTOA 3IM8A 1XNRF 2MKCA 2IA0A 4YR0A 2V2VA 5KFFA 3JTPA 4JI8F 3MFIA 2KU7A 2MJNA 1RB0A 3WIUA 1FKOA 2CWXA 2KM8C 4HHHA 5KFQA 1J5OA 1RKIA 1M1KT 1RT4B 4CO3A 2BANA 4F0MA 5HVGA 5GAHU 1Q5VA 5EX3A 4NZ6A 1Q8BA 3K5MA 2EFQA 3OR1B 1QAIA 2CADA 1HNVA 4P2SA 3I31A 2OTJS 3OUYB 3NAIA
chains in the Genus database with same CATH topology
4UQGA 4IDKB 1NNDA 3DGPA 2EFNA 3MTJA 3FEYB 3DRSB 1BQXA 4QBUA 3US5A 3VAHA 2DR8A 1C1CB 4B02A 2XBPA 5LMUF 4OI2A 3O44A 1N8RT 1K0VA 2YH1A 3K5LA 4O4GB 1LW0A 1VQ6S 3LF0A 2DNNA 4A8WA 5IM0B 1TK8A 2B7BB 2R7OA 5B0FA 1D0EA 1H7XA 4LQ3A 4ES1A 2UV8A 3ZC4A 1JLBB 2DGUA 2B56A 5JUMA 2FJAB 1N5SA 1R27B 2DNGA 1Y5NB 1N32F 3GIJA 2K1RB 4KPYA 3B8HA 3OTCA 1FXDA 2R4FA 4RWWA 4Y2CA 5D6GA 3RB0A 3PKYA 1FTRA 4CZCA 4IOAQ 4C3MA 3I82A 4ZP9A 5EWFA 3BQ1A 3CJKA 2GC8A 5BYQA 2R8IA 1JWWA 2B51A 2R8KA 4F50A 4IO1A 3QPIA 4ZP8A 2DNPA 4DSEA 1H2VZ 3EX7B 4U7UK 2NZ4A 4ZPWR 1MMNA 2RQMA 2M52A 5G0RA 4WCEQ 3SFUA 3NP5A 2W7OA 3IS9A 1OPIA 1CC7A 2MKKA 1M5KC 2DCUB 3I5BA 3MF5A 3HZGA 3CF5Q 3BDPA 1FRHA 1G7CB 2XI2A 3MMCB 3V6JA 5B7WA 2J0WA 3ONQA 3TARA 4F2RA 1AFJA 4ID5B 4I0WA 2V8HA 4NLVA 2XSJB 2LDIA 2F8EX 1IKXA 3V81A 1W2IA 4OQJA 2B7CB 1PILA 2JFDA 2L48A 2POKA 5D4PA 3O2IA 1HBNA 2DHSA 2HGNA 1R7IA 3NMAA 2FHJA 4TN2A 5BJRA 1UVLA 4F02A 3DHWC 4I68A 4PG5A 3IXQA 5F9LA 1RKJA 2RQCA 2I8EA 2YKNA 3PEJA 1Z4UA 3KG4A 1XERA 2EPIA 3GR0A 2MQOA 5T7LA 5MLCV 1RJJA 4MIBA 3DLEB 4X62F 2OPQA 4OX9F 2GQQA 4FPRA 1JNZB 3HVRA 4ERDA 1Q53A 1KD1T 5F3ZA 2FJXA 3F44A 2NXUA 2DNRA 1YIJS 2VONA 3CDEA 2DNMA 3AY0A 1FKPB 4J9KA 3SZ2A 4NLGA 1BC6A 2EG1A 4XPEA 1Q8IA 4DV3F 4Z37A 3DLLQ 2DNHA 3ISZA 4IQMA 4K5RA 4ZPVR 5AJ3F 1CQNA 3IN5A 3PVXA 3PNIA 3DFEA 4ECQA 2QMWA 1K1SA 2O5DA 2UXCF 1NAQA 2JSXA 1SQEA 2YKMB 4BDPA 4R8UB 2UV8G 4RW4B 1DQ8A 2ZNYA 2L3MA 4PG4A 4TU9A 4PQUB 4C0OC 4J9SA 4M5DA 1PO6A 2UUWA 3PM9A 3PEHA 1DQ9A 5I3PA 3OSPA 5KFTA 3MUTP 3T1YF 4ICLB 2CPIA 3G8QA 4IO9Q 4PXDA 3VQSA 1SUQB 2ZD1A 4KO0A 1X4AA 2BW2A 4WKYA 1RT2A 1TKZA 4XPCA 3M9MB 3KK3A 5A0YA 4C9DA 1DLOA 2KYXA 5CYQB 2DO4A 4AL5A 3AHPA 3MEKA 2KXFA 5JJBA 1B64A 3MR2A 3CJ2A 3DMJB 4ITSA 2EFPA 4N41A 3MEEB 1MNEA 2K2PA 2B43A 4DQPA 1S10A 3MR6A 2PFFB 3PACA 1D9AA 2ZJQQ 2HNDB 2NPFA 2AJFE 1TKXA 1QJHA 2DBBA 3MMAB 3C6UB 2OD4A 3D5MA 4GKJF