1A7GE

The crystal structure of the e2 dna-binding domain from human papillomavirus at 2.4 angstroms
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
b'ATTPIIHLKGDANILKCLRYRLSKYKQLYEQVSSTWHWTCTDGKHKNAIVTLTYISTSQRDDFLNTVVIPNTVSVSTGYMTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REGULATORY PROTEIN E2
publication title Structure of the E2 DNA-binding domain from human papillomavirus serotype 31 at 2.4 A.
pubmed doi rcsb
source organism Human papillomavirus type 31
molecule tags Transcription regulation
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1998-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1a7gE00
2MKKA 1U6BA 1OWXA 2DHGA 2KXFA 1WTBA 2DISA 3CULA 1Q81T 2LYVA 2MY7A 1QM9A 2QA4S 1ZZFA 3SDEB 5DM6Q 3L3CA 3CCLS 3OW2R 1X4BA 4FXVA 2MGZA 3LQVA 1XN9A 4QQBA 5JVHQ 3VAJA 1WI8A 2JWNA 3CD6S 2MKSA 1U1LA 5GAEU 4IO9Q 1FXLA 1X4DA 5JVGQ 2KRRA 2M8HA 2RUGA 1YIJS 3EX7B 3Q2TC 2DNLA 2LA6A 2MJNA 2MKHA 2M88A 2MMYA 2MQPA 4QU6A 2KVIA 1PO6A 2LXIA 2LKZA 3CCMS 1VQ4S 2L41A 4CH0S 2AD9A 3UD4P 5GADU 3NNCA 2MKJA 3VAGA 2MZTA 2A3JA 2N3LA 2CQ3A 1H2TZ 2E5GA 2FC8A 3TYTA 1DBDA 2DNKA 4YOEA 3UCGA 1FNXH 2N7CA 2ZJPQ 2RS8A 3BS9A 3BO4A 1OPIA 1VQNS 3K0JA 2KFYA 3CF5Q 1ZH5A 2M8DB 1IQTA 2CQBA 2ZJQQ 3PIOQ 1L3KA 2YTCA 4TU9A 1KD1T 2LXUA 2JX2A 2CQIA 2DGSA 3VAMA 5LXRA 2CQ2A 4ZKAA 4WFAQ 2XNRA 5IFMA 1YJWS 2CPIA 2EK1A 1D9AA 4OZ0A 4WFBQ 1X4CA 2G1DA 2HZCA 4ERDA 5DDQC 3G71S 1VQ6S 2NLWA 3CC4S 3CCVS 2X1GA 2SXLA 4WIIA 1U1RA 4WF9Q 2DNNA 1SJRA 2CQ4A 1WHYA 2N3OA 1BY9A 1A7GE 2DHAA 3CCJS 3MD3A 1FJCA 2DO4A 2CPDA 3J7ZT 2M7SA 2JRSA 1VQMS 1HA1A 3B4MA 2FHOB 4LIRA 2G0CA 2AYEA 3P6YC 1X4GA 2WBRA 2MJUA 5MLCV 4IOCQ 4W92B 1NJIT 5CYJA 5D77A 4J5OA 4CIOA 1WF1A 5H1SV 2LMIA 1S72S 3DXBA 1WHXA 2DNZA 2K3KA 2CPHA 2JVOA 2MQQA 2GHPA 2VOOA 1ZZNA 3ULHA 2YH1A 4F25A 2K8GA 2MKIA 1U6FA 2LQ5A 3ZZYA 3DLLQ 1P1TA 2CPFA 2I38A 4CQ1A 2E5IA 4BS2A 4WCEQ 2OSQA 3VAHA 1M1KT 1PGZA 1U1NA 2MY8A 2MQNA 3NNAA 2DGWA 1WG4A 1N88A 1WI6A 1VQ7S 4QU7A 1WEXA 3HI9A 2KG0A 1R8HA 1K8AT 1SJ4P 2HVZA 2MXYA 2ERRA 3CC2S 2RRAA 3H2VE 1JJHA 2MZRA 4YUDA 4UY8T 2M52A 2CQGA 2E44A 3P49B 2L9WA 2MQOA 3CCQS 2KXNB 1M5OC 3S8SA 3UD3P 1U1KA 4F02A 2X1BA 5DDOC 3N9UC 2KN4A 1YHQS 3NS6A 2RNEA 1URNA 1QVFR 2VONA 1U2FA 2F9JA 1WEZA 2LEAA 2N82B 2DNOA 2VOPA 2DGOA 3Q2SC 1N52B 2KXHA 3UWTA 5IQQA 1X4EA 5DETA 1AUDA 1Q86T 2CQ0A 2M2BA 5CXTA 2F9DA 2DNMA 5HL7Q 2DHXA 2JVRA 1X5OA 3FEYB 3MD1A 1A9NB 2MZQA 1U1OA 2DH7A 1JMTA 3VAIA 3UCUP 2CPJA 1UFWA 5DM7Q 4QPTA 5IM0A 3I56S 3U1MA 2MGZB 1DZ5A 3TO8A 3UCZP 1X5PA 2DH8A 1JJ4A 1S79A 2CJKA 2J0SD 4ED5A 2XNQA 1G2EA 2KHCA 2XS5A 4P6QA 2J76E 4Y00A 3HHNB 4CH1A 2AYMA 2MZJA 1VC5A 2KM8B 1K73T 1F9FA 3G9CA 1UP1A 1VBXA 5DDPC 2CPEA 2M4MA 1KC8T 3NS5A 3BO3A 2E5HA 2CQPA 2MKCA 1H6KX 2KH9A 4FXWA 2KG1A 1JJ2R 3CPWR 5LJ3Y 2YWKA 4WKRA 2HGLA 3LPYA 3JB9k 2XS7A 2FY1A 2M0GB 1O0PA 2HYIB 3MI7X 2OSRA 3CCUS 1FJ7A 2DNYA 3G96A 5IM0B 3ZZZA 2VODA 2MB0B 1Q7YT 4RU2A 3G6ES 4C7QA 2HGMA 1UW4A 1SJQA 3TP2A 1YTYA 3VAFA 3CXCR 2RQ4A 2FPHX 3THPA 2MQMA 2QEXS 4V19X 1FJEB 2EVZA 3CTRA 2UP1A 1RK8A 2G4BA 1VQ5S 1FT8A 4YB1P 2J8AA 2XSFA 3UE2A 2CQ1A 4U67Q 2MSSA 1KOOA 2M70A 5CA5A 4W90B 3H2UB 2ZJRQ 2PEHA 1NO8A 2DGUA 2LECA 2X1AA 4Y0FA 2NZ4A 3MUTP 3P3DA 3S01A 3BO2A 2MSTA 1KOHA 1SXLA 2DGXA 2DNGA 3SXLA 2DIVA 1VQ9S 3RW7A 1X0FA 3CC7S 1WHWA 2RQCA 2CQDA 2PE8A 1WF2A 4EGLA 3G4SS 4Z2XA 1WG1A 2EK6A 5LSLA 1VBZA 2LA4A 2MHNA 3CCRS 3CUNA 1DRZA 1HD0A 3IRWP 2LCWA 1VQLS 4C4WA 4LMZA 1WHVA 2Q79A 3EGNA 2KM8C 2CQHA 5GAGU 1DHMA 1YI2S 3V4MA 3US5A 1VQPS 2KYXA 5ITHA 2YH0A 2KRBA 2AYGA 1UAWA 2DIUA 1WWHA 3J7YU 2KT5A 3PIPQ 4TU7A 1K9MT 4TLQA 1X5SA 2U2FA 2F3JA 4TU8A 1M5PC 5GMKa 2MZSA 4PRFA 3U1LA 1VQOS 2XB2D 3D2WA 1VC0A 1YJNS 1OIAA 1KQSR 4IUFA 5D78A 4A8XA 5BJRA 5LXYA 4PR6A 1M5VC 3P5TL 1N8RT 5FJ4A 1CVJA 2OTJS 2DH9A 2DGVA 2CPYA 3S6EA 2BOPA 2XS2A 1H2VZ 2DGQA 5GVQA 2MYFA 2I2YA 1VBYA 3I55S 3R1HA 2L08A 1WG5A 5EN1A 1FO1A 2OJ3A 4IOAQ 2CPZA 1U1QA 2DHSA 3MOJB 1YJ9S 2O3DA 2B0GA 1RKJA 2V94A 3CCSS 1X4HA 3R27A 2RS2A 1YITS 3THTA 1OO0B 3NNHA 3FEXB 1VC6A 4OZ1A 1B7FA 1WELA 2J0QD 3RW6A 4C0OC 2MPUA 1M90T 4LJMA 4M5DB 2DITA 1WEYA 3MXHP 3S7RA 2YKAA 3MUMP 5HO4A 2CPXA 2RT3A 3CCES 3VAKA 2MQLA 3B4DA 3IWNC 2KU7A 3CMES 1X5TA 2AYBA 1VQ8S 3SMZA 1YWXA 2D3OR 1H2UX 2RVJA 2U1AA 2OTLS 1P27B 2QFJA 2DK2A 3G8SA 2RU3A 5LJ5Y 1VQKS 2RRBA 1SJ3P 1FHTA 1M5KC 1R8PA 1HL6A 2DNQA 3MDFA 2DNHA 1NU4A 2DB1A 4WFNQ 3SDEA 1SJFA 1HD1A 3VALA 3MUVP 2D9OA 3VF0B 2FC9A 2BZ2A 5GAHU 3R1LA 4PKDB 2DNPA 5DDRC 2D9PA 2KI2A 4F26A 1N54B 3CMAS 1QVGR 3EGZA 3MURP 1WF0A 2CQCA 5LSOA 1X4FA 1U1MA 1D8ZA 2LEBA 1X4AA 1U1PA 2GO9A 2DO0A 2OIHA 2HGNA 2M9KA 3BEGB 2DNRA 1Q82T 2X1FA 4UQTA 1W2BR 2DGTA 2MZ1A 2ADBA 3NMRA 2ADCA 2E5JA 3G8TA
chains in the Genus database with same CATH superfamily
3MGJA 4M8LA 1N33F 1FFWB 3SDEB 5I4MA 4RW8A 2OAUA 1RLCL 4OYWA 2MKSA 3A3PB 1OS5A 2R8JA 2BACA 3Q8UA 5A8KA 2VFTA 3PR4A 3NGDA 4DSEA 1VQ4S 1RWMB 5HJXA 2DPIA 2AEMA 3D0HE 1TVRB 1V5VA 4DQRA 4NLXA 1U0SA 1S76D 3FNNA 3SZ2A 1D1UA 5HATA 3GJSB 1Q8KA 2NCKL 4B02A 1BQNA 2F40A 2IVMA 5HP1B 3PXGa 4ECXA 1NXIA 4OZ2A 2FLPA 1Q79A 2NLWA 1UA0A 2FTRA 1RGVA 3CCVS 3M2VA 2R7QA 1WSVA 2RB7A 2X7IA 2YQ3A 4RZRA 2HWIA 1LEOA 3DLEB 3H59A 4OI3A 3EGWB 4F0MA 1NK9A 1S6OA 4ZVQB 3IO1A 1NAQA 2HWHA 3IC1A 2GVDB 2DNZA 1OYDA 2JVOA 2MQQA 3HKWA 4OQJA 1FDNA 4O3OA 5J1PA 2X51A 1OY6A 2EKYA 5EUHA 1MG7A 4DQPA 2WVEA 3VAHA 1JLAB 1WG4A 2ZOGA 2B5JA 1VQSA 3Q0AA 3MAQA 4FP9A 5BXIA 2M52A 1Z1ZA 4KTQA 4ECTA 4NCAA 1SV5A 3HSGA 1NH8A 4OZJA 1HQUB 2DNOA 4O3NA 2OELA 1FRHA 1G4CA 1X4EA 2BE2B 1XTZA 1SCJB 2F9DA 3R6LB 2G13A 1TKTA 5HQ8A 3H40A 2DY9A 1AFIA 1A9NB 5ETOA 4ED8A 2CPJA 5DM7Q 4PYDA 4QPTA 2V2QA 1RTIA 3U1MA 4KH0B 3POTA 3PG9A 4K59A 1TL4A 3NL0A 3E01B 3SQOP 5FLXY 3HHNB 2BA9A 2VG7A 1Y11A 4GRSA 1VC5A 3WHIA 4RW4A 3LW5C 4MJKA 2M4MA 2EPIA 4CM0A 3ZZRA 4P7VA 3OJUA 2O01C 3HHLC 1TKXA 4WKRA 5KFGA 4E0DA 1Y3JA 1Q8LA 1HBUA 4N56A 4X4NA 1YTYA 3TP2A 1FJEB 2YX7A 3T41A 3KOAA 1YJUA 4PWUA 2J8AA 2VZ9A 2HBZB 5AJ3J 3D0GE 3MUTP 4J9RA 2DY1A 4NCBA 4CLZA 4JV0A 3PYDA 2HHPA 3U1NA 2JC1A 3KLHB 1J27A 2KYXA 1WKLA 1AT1B 1HNXJ 1FWLA 2CXEA 4XAKA 2FJXA 4NYOA 5I3UB 3EXCX 3OSPA 5GMKa 1FVSA 5LXYA 3AJDA 1PYOB 2DGVA 3NCPA 1VYAA 4ELUA 5J1NA 1NJXA 4KT0C 3V81B 3OSNA 4MKYA 5C42A 2D3O1 3GR1A 3UN3A 3MEKA 3KK3B 3MAAB 4ZCIA 1HYSB 3DNCA 3M1VB 4LJMA 2DITA 8RUCA 1QDUB 3BYPA 3CJTA 4IH7A 3SFGA 5B0EA 1X5TA 3KKFA 2YKOA 5AJ3F 3ENVA 2GGPB 3WIVA 1S6PB 4NX9A 3J7AN 3SSSA 4X65J 4CLLA 3KG4A 3W61A 3IFEA 2PIIA 5L8RC 1HNXF 5C2CA 2XMTA 3I0RB 4YHHJ 1WF0A 1Z4UA 2Q66A 2YWHA 4PXDA 1O51A 3DOKB 5J2MB 5KG3A 1X8DA 4UQTA 3MPWA 4AXJA 2G2OA 1F2GA 1Q81T 5K20B 1ZZFA 4OLPA 4RPFA 3F73A 5IXUA 3QFHA 4DU8A 1S7IA 4QWBA 4PG5A 2J9CA 3JAMY 2LKZA 2AEFA 1B3TA 4J9OA 3OTOJ 4Z7YA 1QLNA 3O44A 2IMOA 4LRAA 2QLWA 1QTNB 3BR8A 4MTPA 4WZQA 1WC3A 1TAQA 5LT5A 2N7CA 1BC6A 3K0JA 4NEYA 3R9LA 4L6V3 2CQBA 1AUSL 1HNZJ 3GSDA 4X65F 4TKTA 4PG4A 1JXVA 1ZM3A 1SKWA 4H4MA 4ZCLA 1CQNA 1V9OA 2SXLA 3V4IA 1W26A 1RWPB 2W7AA 1WHYA 3MMJA 4YHHF 4PUOA 5ETTA 4DWIA 1AA1B 4NOHA 2CJYB 1VQMS 4CI0B 4K4XA 5BYQA 2GW8A 1WDTA 5J2QB 2BUNA 1T3NA 3TZYA 3T6JA 1JNRB 5KFRA 3NWGA 1NKCA 1N5VA 2V67A 3D0IE 3G6XA 3LP0B 3C6UB 1PBAA 1S9GB 4IQMA 2DEJA 3KLFA 3FQLA 4K4YA 4LQ3A 2GJFA 3OTOF 4RW6B 2VONA 2LEAA 3MR5A 1V3RA 4EBCA 3LP2A 2Z30B 2P9EA 3I32A 5IC4B 4BC7A 1HNZF 3DHWC 3HVTB 2QL9B 2N4DA 3MD1A 3M2RB 2H48B 3W64A 3JTPA 1UKUA 2G0JA 2F7VA 3TR5A 3W9HA 2KYZA 3N6LA 1X5PA 1MMDA 1GNKA 2P2CB 3LPEA 4LR8A 2BE9B 3BYRA 4Y00A 5KFBA 3CW2C 2G2YA 1ZS6A 3JYTA 2CWXA 3H4DA 4JI3J 2PA8D 2GAGC 4BWJA 4HHHA 4LF1A 1S48A 3K8VA 2WVDA 1S9EB 4ER8A 3IM8A 1URRA 2OPRB 2EVZA 3RAMA 3CD7A 2EW9A 5J1EA 2BJ7A 4Q7AA 3ZZ0A 3H90A 5K9FA 4FS1A 5CYMB 4YDDB 1HI8A 1NK6A 3IBWA 5K8OA 3RW7A 1HARA 3QJJA 2E1RA 1KDNA 4C3LA 2K3IA 1B0TA 5H9FJ 1HD0A 3DRPB 4M5NA 5IC6B 2OEJA 3C2PA 3P5BP 1F1BB 2IY5B 1RISA 4MK9A 4EFAC 3U7JA 1O5JA 1U8SA 4C2MA 3PIPQ 4AUKA 3TUJC 1X5SA 4USMA 1Q5YA 4J9LA 1LWFA 4I7FA 3U1LA 4B08A 4U6PA 4KIAA 1JX4A 3M8WA 1PC5A 3OQ2A 1R0AB 1OSDA 3TA0A 2PEBA 5ETVA 1Q5VA 2CUYA 3RJMB 2QIFA 4WXWA 2LQ9A 3BJYA 3DDNA 3DFEA 1FO1A 1TL5A 3MOJB 3HF5A 4LVOP 4JI3F 1UFLA 1N5TA 3HK2A 2E7WA 1NDPA 4P2FA 6FD1A 4O44A 1VLOA 1OO0B 1FTCA 4FKYA 3FBBA 2YVSA 4V19J 2BVZA 1UTAA 2JEIA 5DGBA 4O4GB 2CWKA 4MIAA 1ZAXA 2C2ZB 3OR1A 1P27B 3VGTA 4JV1A 1YZ6A 3BGUA 4OI0A 3MCMA 1TTHB 5M2UA 2D41A 1DTTB 4QYRA 1T94A 1FK9A 2ZWPA 2CQCA 1PC4A 1U1PA 1L5UA 4JI0J 2GQQA 2BQ3A 5KFLA 2DNRA 3KHRA 3DRSA 2KVQE 4DMZA 1KFDA 1S6UA 3MFHA 3M6VA 2MKKA 3GFZA 2DISA 4WU2A 4WK1A 2QA4S 3R97A 1NM2A 2UV8G 3LQVA 1WI8A 1Q95G 1CJTB 4HR2A 5G4DA 1SQFA 3HHDA 4DL2A 1FKPB 3CIZA 2ZFHA 4O23A 1VRQC 2IRYA 1B0PA 1NK8A 3PY8A 1MLAA 3KLGB 4ZPWR 4OZLA 2HVEA 2LQBA 2CQ3A 2E5GA 4A8MP 3OJSA 1XMOJ 1QUPA 3KNAA 2B3TB 2MLZA 1XBWA 2AJ1A 2ZZTA 3DLGB 3HPOA 3CF5Q 2XY5A 1IXKA 3DRRB 4CLPA 4I6WA 3WZ0A 1WJ9A 2HQDA 2K1RA 1LWCA 5HVGA 5LMUJ 4RX6A 1WTFA 4DR3J 3OUYB 2W1BA 4B3OB 2CZVC 3CJ0A 5KFYA 1ZAWA 5L1KA 3TRGA 4QWAA 2QE5A 4JI0F 5ADZA 5MLCV 3CDAA 1NJIT 3HD1A 3MMCA 1RTDA 3UPFA 5FDLB 1R3NA 4BLGA 5H1SV 3ENAA 4J7CA 3A8IA 1FI4A 5M2PA 2FY8A 5L9XA 2VFSA 2V6AA 3NGKA 1HMVB 1N5YB 4RW7B 1PGZA 3CJ5A 1PIEA 2ASLA 4W98A 3OD2A 2IA6A 1VQ7S 4ILMA 2LXFA 1TK0A 2Y0SD 1GXTA 2HURA 4UY8T 2MZRA 4D3GA 2GFFA 2ZHBA 2MQOA 3TQEA 2IRXA 1ELOA 2KN4A 3N9UC 3LP1B 2E7VA 1U2FA 8AT1B 3EUNA 1XMOF 3UWTA 3I0SA 1U24A 4ZA1A 3MEDB 1AW0A 2GA7A 3M9MB 3CWJA 2MZQA 3MCOA 3VAIA 2F1FA 5LMUF 4X2BA 1WACA 4DR3F 4A8FA 3I56S 2B6AA 4ELVA 1Q8IA 2B4OA 1DZ5A 2BOAA 2CJKA 2HHHJ 3KJFB 2J76E 1GMWA 2YBVA 2C3UA 3KWMA 4TQRA 1LW0B 2XULA 3Q8YA 1NSAA 2KH9A 3KLEB 2WSCC 3EVMA 3C6TA 1CBKA 4FPIA 3HM9A 3BBCA 3LUYA 4RU2A 2NXEA 3LANA 1RWOB 2K7KA 1LK5A 4P73A 1ZM9A 3BM7A 4O3PA 1UJ6A 4DQQA 4FF2A 3IGNA 3ELHA 1EP4B 1YKWA 3QYYA 2KFZA 3FC9A 3W63A 1NMEB 2G1HA 2DPJA 3M8RA 1DRZA 2FVPA 2ZH6A 1F3FA 5GMEA 3KDNA 4L3NA 3US5A 1VDHA 3NOGA 1FKOA 3D4JA 2GHVC 1TFYA 2YH0A 2ILYA 1UAWA 2JFKA 2R7SA 4K5SA 3SQGB 1U6ZA 1UEKA 2HHHF 3RRKA 2IVYA 5JUMA 1S1UA 4WYWA 4C6AA 4DEZA 3AJ2A 2OUGA 2W4DA 4BDPA 1O6XA 2OJ3A 3GV8B 1HNIA 3IR6B 3MHYA 4QR0A 3WC2A 4JOUA 3MWBA 5KG7A 3MEGB 2RS2A 4XO0A 5SZTA 5K14B 3Q8RB 5KFNA 1SPBP 5HBMB 4NLTA 1E6YB 4FYYB 2CG8A 2HS0A 1NDKA 5J2PA 4PABA 5HO4A 1PSDA 4DL4A 3G2XA 2P6TA 1EIYB 2IFXA 3CMES 1X9WA 4M1KA 3SMZA 3FCVA 3MZIA 3LGHA 3K5LA 4IFYA 1QD1A 3OL7A 2DNQA 4OJ1A 3CEDA 1T7PA 4UQGA 3SDEA 4QIGA 2AT1B 3EZUA 4E8UA 2XM3A 2ZBPA 3LO3A 3W60A 2COLA 1UMJA 2JEFA 1GX5A 3MURP 3AT1B 1YBTA 3FBFA 2HK2A 1RSCA 1X4AA 3FFIA 1QE1B 1YX2A 1SKRA 2Z58B 3K5MA 1L3TA 2VH7A 1W2BR 1TVRA 1KRPA 4H4KA 1U6BA 1JKHB 3BR9A 2QX0A 3PHTA 4ITSA 1QM9A 3L3CA 2WW8A 4FXVA 4CM2A 1S99A 1IBCB 2VIHA 2VQEJ 3OLBA 1T02A 4RNFA 5GAEU 2RUGA 5HP1A 4QR2A 1DY3A 3HHLD 4JB8B 3EVWA 4Q5VA 3A13A 4MIBA 3N5BA 3NRBA 1CLFA 4N47A 4YY3J 3DLEA 3PCOB 2FVCA 4YOEA 5B7WA 2R2RA 2Y1JA 2CIMA 3BS9A 1PAUB 2J8SA 4U96A 4QYZK 3PACA 4TLRA 2VFVA 3O5TB 4DLEA 1M1HA 3QIPB 4DR2J 2XNRA 5IS2A 1D9AA 4OZ0A 1SH0A 2OFHX 1S6QB 4ERDA 2PMZD 1D3WA 4OI6A 3F0NA 1JLAA 3ZZOA 5E3AA 3E51A 3NBPB 3C66A 1NK0A 2Z0GA 5KFUA 2RAQA 3NAIA 2WB1D 2EC2A 3DU5A 3T9ZA 4ZVSB 1Y0HA 3VTIA 3KJQB 5KFWA 2V2ZA 3ULHA 4ZMMA 2BE2A 4F8RA 2VQEF 4W4MA 3QRRA 5KT3A 3NNAA 3M9OB 4QU7A 1K8AT 3BBBA 3NAHA 5F0WA 2R7RA 2R8IA 2X1BA 1A6LA 4RBTA 4YY3F 1BWVA 2CJQA 2EFPA 2Q43A 4K2JA 2DGOA 3IWXA 5IWAJ 5DETA 2CQ0A 3QSYB 3L95X 3BN4A 4DR2F 2DHXA 2JVRA 1LWEB 1S0NA 2GHWA 2R7XA 3KLIB 2ATCB 3OVSA 1N6QB 1YJ7A 1Y5LB 1U45A 3ILJA 3RBZA 3AXKA 1SL2A 1XMQJ 5KFZA 2R7TA 2WSFC 1U48A 2J0SD 2FJDB 4DCPB 1U7LA 1UWBB 4K4WA 2B51A 2KT3A 4ZLPA 4OZ5A 2FGOA 4XPCA 1JLEB 1JJ2R 3PKYA 3DHXA 3JB9k 3PO5A 3KG1A 2A18A 4FYXB 1UETA 2MB0B 2RILA 2YNFB 5F8LA 1KSPA 3KLHA 1YDLA 2IM0A 2FPHX 3NGUA 4DUZJ 2UP1A 5ETPA 1VQ5S 2NPFA 2XSFA 5I3UA 2J7UA 3GP9A 4LFCJ 2XLKA 3H7HB 3P3DA 3S01A 2HRYA 1KOHA 2KZZA 2DGXA 3RB0A 1LK7A 3W5XA 5F8NA 2BE7D 4JI4J 3BF4A 5IWAF 3CCRS 1GAOA 1VQLS 3OL9A 2JH3A 3KJVB 1CG2A 3V81A 1I1GA 3V4MA 4ID5B 1NDLA 3ETMA 3GFXA 4OI2A 1U0HB 3DLBA 5A0YB 2R42A 3IN5A 4TU7A 3KK3A 2QL7B 4TLQA 2B4PA 3MAAA 2HK3A 4X4OA 2HNDB 2ACYA 1XMQF 1HYSA 2J9EA 5D8HB 2D69A 3IA0A 2XS2A 4ECQA 2MHEA 1H2VZ 3G82B 4JV5J 3FZBA 2NUHA 5HMZA 2GGPA 1NPKA 1U25A 1X0PA 4IOAQ 1NNDA 1S6PA 4CLYA 4O0IA 1RKJA 4DL5A 1GEHA 4DN9A 2IBOA 1FWPA 5CYQB 1KR4A 2C3PA 2OHDA 4OYPA 1KLNA 4YR0A 2BXJA 4DUZF 3E2EA 1K1SA 4R8UB 1UPMB 2V8GA 3I0RA 3VAKA 2ZOMA 2HIQA 3K89A 1S49A 4X4UA 4LFCF 3K57A 3DOKA 1TL7B 5J2MA 2DK2A 5L38A 5IV3A 4JI4F 4DSIA 2FJWA 3J7Z5 1RA7A 2D7SA 4MFBB 4YDXA 4IRKA 1RU2A 2OPQA 2QC3A 2BZ2A 2OFGX 2DNPA 5F9NA 2CAJA 1FNOA 3V6KA 3CNQP 3QATA 4TVAB 2C2DA 2V69A 3B54A 3CE8A 2A0FB 4IDKA 2GO9A 3EXYA 3MTJA 1WC1A 4ANDA 3HT3A 4B3MJ 3TARA 2XWYA 1OWXA 4JV5F 1VRUB 1Q1KA 4DX5A 4N7TA 4ED4A 2JWNA 1X4DA 1F60B 4R0EA 3H4BA 1ZTWA 4NZ0A 3ZTOA 4R25A 3QO9B 1EB0A 3UD4P 2E9TA 3TW0A 2JNJA 2MZTA 1Y4ZB 4HH1A 2FC8A 1JLFB 4QW8A 5CD4H 4CO4A 4FVMA 4C11A 2XHCA 2Y9HA 4G6VB 3OTBA 5J2QA 2A2DA 2UVUA 1KONA 3H5YA 4Q2MA 2FZCB 3LWLA 4NLUA 1X4CA 3LP0A 1NK7A 4U7UD 4C8LA 4U95A 3G71S 2X1GA 2B7BB 3AODA 1TKZA 4CLKA 3ETOA 4H4OB 5CZVA 1S9GA 3VZHA 2DO4A 3IAM9 4NPOA 4RO0A 1I6JA 3HDSA 4B3MF 4W92B 3HZGA 3D66A 3X3UA 4YS2A 2JLGA 5BYSA 1RP5A 3GV7B 4CLUA 3AD7C 3DGVA 2HS3A 2ZBIA 2QLBB 5FIIA 2GNKA 3PEJA 3H2LA 3NCQA 1U1NA 2Q6CA 3LALA 3W7BA 3M2RA 4Q8EA 3DOLB 5B0BA 2RRAA 3R7NB 4USWA 2CZ4A 1IVZA 4IOBA 1T8EA 4OZ3A 2LFVA 2HQCA 1NKEA 2N82B 4ED6A 3C16B 1TUGB 3MM9A 3O3LA 1BD6A 1KWMA 4USHA 2XMMA 2PMHA 4U8VA 2NUUG 1JXLA 2ZE2B 1S9FA 1F9EB 1KTVA 3ILIA 3KDOA 3M8PB 3P4UB 4M5LA 3VVUA 2G0IA 3BSNA 2DD8S 3D9BA 2FVRA 4P71A 3TO8A 1V3SA 2OPRA 2OPSB 4P6QA 4ILLA 4X4RA 1RWVB 2C2OB 2BW2A 2XY7A 2C3MA 2GIQA 5CYMA 2VD3A 4NLGA 2H54B 2KJVA 4ZVFA 4URGA 2WBMA 1C4CA 4AT1B 3KUEA 5F8GA 4IKAA 1KQGB 1D8YA 1O0PA 1OQ6A 3DRPA 3THVA 2QZ8A 4ATNA 4PQAA 2WAQD 2M3DA 5E5NA 1Q7YT 2RF2B 4C0HA 1N4LA 2J7KA 2DKOB 4P9SA 1P1LA 4KHRA 1VBKA 2PEHA 2DGUA 3PTWA 1W25A 3I87A 4XTTA 1WC4A 3HT0A 1R0AA 5G0RB 1K0TA 1WF2A 1NDCA 2EK6A 4FYVB 3CUNA 4G1IA 4B9TA 5IV4A 5AXLA 1FE4A 1Q8BA 2KM8C 1S1TB 2KRBA 3ILLA 1K9MT 2F3JA 4UOGA 4PRFA 3D6HB 4UOHA 2XB2D 1M5SA 3BZQA 1NHKL 2NR0A 2QGFB 2BJDA 4BC9A 1C1BB 1M5VC 4C8NA 2UV8A 2DH9A 4O4GA 2BOPA 2MYFA 3AH6A 1VBYA 3R1HA 5EN1A 1NHUA 3MPVA 2IDEA 4KV8B 4R5PB 1LXNA 5HQLA 4NRUA 3TA2A 3CD5A 2IDLA 2KKHA 1DTTA 4C0OC 5AE2A 2PT0A 3WDOA 2YKAA 1R8CA 3MUMP 4CNZA 5KG1A 2AJFE 3R7SB 2ZH1A 2AIRB 1IBLJ 2KU7A 1TK8A 3ZTSA 3UI3A 4NA3A 2D3OR 3GIJA 3J7A1 3AOBA 4IFVB 5KFDA 3R5AA 4DV1J 1SJ3P 3DN9A 3FJ2A 1QSYA 4ZLJA 2VA2A 1CJTA 3PJXA 1RHJB 3GE9A 1QVGR 1PBUA 1FKPA 3R3TA 4PPZA 4ED0A 2JEGA 5HMYA 4NL5A 3KLGA 4LT6A 2J9DE 2M9KA 2X3DA 2OI2A 2X1FA 2BJ8A 2IHR1 3TUZC 1O8BA 3UO0A 1NJZA 2DR9A 4ZPTR 3ICLA 1HWIA 4Y2KA 2KXFA 1UVNA 4USKA 4Y3CA 1RCOB 1E6VB 3DLGA 4Q0BB 3R5GA 2BMBA 2R2TA 4O3SA 1EZZB 2IC3A 4IO9Q 3W2VB 2M8HA 5HVHA 1RACB 4QWCA 4IYQA 4E2FB 1M5HA 4DV0J 2GMJA 3OUYA 3D67A 4B3OA 1UVLA 4WP9A 5D0GA 1H2TZ 4IR9A 1PKUA 3E3XA 1IBLF 3PNIA 2CDRB 2KFYA 1VR6A 4DV1F 5FDLA 1ZETA 2JX2A 2DGSA 3W2WB 3VAMA 3TNVA 4KPCA 4NLSA 2VPXB 4NLDA 3T6BA 5DDQC 1N5YA 2VFUA 4RW7A 4ES3A 2YQ0A 4J91A 1FXRA 3CCJS 1FRIA 5B08A 3OTCA 5E2QA 4LIRA 4CT9A 3LGMA 1FXDA 5CYJA 3FCHA 1ZA1B 3RG6A 3EE3A 2RKIB 2H3EB 3LP1A 4EI2A 2BJEA 3DXBA 1WHXA 3I4HX 4ELTA 1RTJB 3R5DA 3EDRB 4AQYJ 2HFUA 3H20A 3MEDA 3ZZYA 4V1Ak 4DV4J 4K7QA 5AXKA 1U4BA 4ZVHA 3OXLA 3BPDA 1LV5A 1HI0P 2VKRA 4DV0F 4DU7A 3H2VE 3TI0A 1CJVB 2FVQA 4EBEA 1JLQB 3MR7A 1WEZA 2VOPA 1TFWA 4LVNP 1RBLA 1AUDA 4OHWA 5GAGI 1LW0A 3JS9A 3MEEB 1RT4B 4WJBA 1UFWA 2I1RA 2AMCB 2JLFA 4WTYA 2MQ8A 3EZ5A 1HR0J 2ZBRA 4L75A 1C4AA 4C9DA 4LSNA 4MIWA 2Q3PA 3I5AA 1BHNA 2QYGA 3EGVA 1VBXA 3A8JA 1EP4A 3BO3A 2AP6A 5LJ3Y 3JTOA 4PEOA 2HHSA 1NPPA 3BDEA 2M0GB 4AQYF 4DHVA 3CCUS 1RB0A 4OHXA 3GIIA 2P6SA 5IM0B 2ROGA 1XC9A 4DV4F 1YZ7A 3MR6A 4EBDA 4F4YA 1NB7A 3M4XA 1T9VA 3T9NA 3J81U 3HVRA 3SQGA 1FT8A 2V50A 4UOCA 3H2UB 3QPIA 2FHMA 2X1AA 2EXUA 3TJAA 1ROFA 3KTQA 4AFFA 5FD1A 4ZPAA 1SXLA 1KQKA 1VQ9S 1R8AA 1TZ0A 2VG5B 2JHEA 2WK4A 5A76A 2LA4A 1CS4B 3EGNA 3K5PA 2E9ZA 5C24B 3RZAA 3DC2A 3SV4A 1FF2A 4NLQA 4DPTA 3MEGA 5K14A 3O6QA 4DI6A 5HBMA 1GXUA 1HR0F 1E6YA 5F8IA 3N28A 1YJNS 3P5TL 1T03B 2OTJS 1IBMJ 3OT9A 2R2UA 3UD5A 3I55S 4EMDA 4ZVOB 1RAAB 1SB6A 2C2EA 3WIUA 4WFYA 4KYZA 3CCSS 1ZA2B 2Z57B 1KKHA 3BKUA 3PEHA 2GAHC 2DRBA 3NNHA 2FUG9 1WELA 4DZDA 1HWLA 2AW0A 3TVKA 3UW1A 1QE1A 1SH3A 4CLFA 1K0VA 2VPYB 2ZITA 2U1AA 4LRDA 3PVXA 1RE1B 2YNIB 3G8SA 1U26A 2RRBA 1JKHA 3MM8B 2HBRB 3Q83A 3DGPB 4J9VA 4CWBA 3MUVP 1FDAA 1RTHB 3OFFA 3JQKA 1R6VA 2RQMA 5H9FK 3JXOA 1EJ7L 2Z56B 5L1LA 3DI6B 2OLWA 2XMUA 3ZC4A 2DO0A 3PDNA 1XJWB 3QIDA 3HJVA 3QFWA 1IBMF 1QAJA 2CRLA 3QQCD 3UN2A 2OMLA 1X4BA 3TOQA 4HT5A 2C2KB 1JQGA 5T7LB 3QIPA 4L76A 2L9NA 2LA6A 2ROEA 2MKHA 2AZ1A 2MMYA 4IH6A 4U8YA 1Q78A 1S6QA 2BDPA 2Y1RI 4NCGA 2DR5A 4S0MA 5JXSA 3KK1B 2PFDA 3NBPA 3W65A 4LFBF 1WOOA 3BO4A 1UFKA 2EC0A 2AQ4A 1U09A 1KD1T 1FKAF 1XMBA 1FX2A 3GZ7A 3N6MA 2YKMA 1T11A 2HZCA 4ZPCA 1F6TA 3AB4B 1YRUA 3VCDA 3DMJB 4DX6A 4WF9Q 1FDDA 5F41A 3BSCA 2ZM6J 8ATCB 4KY3A 3W9JA 2ATLA 3GJQB 3BV8A 2YXLA 1U02A 4C3MA 2ALYB 3FSYA 4H4KC 2ZNYA 1ZYQA 4DCOB 1LWEA 1T05B 2MQNA 4I2PB 4BBYA 2DGWA 2ZBQA 4DR6J 2KG0A 5D4PA 2ZDPA 1N6QA 2MXYA 4N5SA 1JB0C 3MOZA 2R2SA 2OKQA 5DDOC 3PW0A 2HVHA 1BGXT 3GB0A 3B78A 1GX6A 3HMJG 1SIWB 5K5MA 4ZOSA 1NZAA 5CXTA 2H1YA 4C8ZA 2YX4A 2VFRA 1U1OA 2V4RA 1CC7A 2H5IB 4BHQA 2H4YB 1XR6A 2YNFA 2XMJA 3QAUA 2V34A 3MR3A 2ZM6F 2HHQA 3GPAA 3T1AA 2F4FA 3QRQA 3G9CA 1F9FA 4JI5J 4ECUA 2H5JB 3MM5A 1RWWB 4KR0B 4N8NA 1ZM2A 3MI7X 2DNYA 2ZH9A 3KJVA 1SJQA 4ID5A 2DXFA 2IAJB 4RNOA 5SUHA 1BQNB 1U0HA 4DR6F 4Q45A 5A0YA 1FX4A 3Q8VA 4X84A 2ZUAA 4X4VA 2HNDA 1IKXB 4DCJB 4U7CA 4LF8J 2Q6BA 1RHUB 3M2VB 3W66A 3M05A 3DLHA 2RQCA 3HCXA 4EGLA 3G82A 1VBZA 2W25A 2Q1LA 4LMZA 1WHVA 3OHBA 4DFMA 2V4JB 2EKNA 3L9ZA 2OGUA 4QW9A 5CYQA 3SFUA 1NK4A 1B99A 1I51B 3G6YA 3R2CJ 1Z2ZA 1NB2A 3PYEA 2E5LJ 2OEMA 4R8UA 5B0GA 4JI1J 3SSRA 2B5JB 3CJKB 4FF3A 4EZ6A 4U7UK 4PZVA 4JI5F 2AJQA 2L08A 3MPDA 3IS9A 1FRJA 1TL7A 5A2QU 4OZNA 1UA1A 2JJ4D 2O3DA 2L3MA 4RNHA 2HHXA 2XG8A 2LQ8A 2V4QA 2O66A 3LH2S 2B8QA 4Y6IA 5ETKA 2V8HA 3TUIC 5GADI 1TKTB 2BRKA 3RW6A 1MU2B 1KNZA 2CPXA 3LOUA 5C7PA 2Z2ZA 4LRBA 3M7VA 4KBIA 3QSIA 2R8KA 1HIYA 1UJ4A 5F0UA 2D74B 1YVFA 4LF8F 5U47A 1IR0A 1N36J 1F3VA 1WC6A 3AJ1A 3M30A 5HSPA 2BJ9A 2HBQB 2BEFA 1OY8A 1VRUA 4HTIA 1R8PA 1HL6A 3I6PA 1L3SA 4OX7A 2NPIA 3L7UA 4NXMJ 1H7XA 2KL8A 2GX8A 1N54B 1CQMA 2W24A 2FZKB 2LEBA 4DX7A 3QO9A 2GCFA 1HBUB 2LU2A 3DRYA 2E5LF 1S1VB 3L4BC 1VISA 3OXGA 3NMRA 4JI1F 1CEZA 1SQEA 1RT1B 5DS7A 5KFAA 2GS8A 2UXBJ 4FN5A 1FWKA 2DR7A 1YJVA 1LFWA 2HFOA 1EKSA 1HBNB 2PC6A 4K4ZA 5JVGQ 4HDGA 2XLJA 4YB6A 4NE9C 4F4XA 2LXIA 4L74A 4AL6A 3NNCA 5HK4A 4H4OA 2XGPA 4K50A 4EYHB 4PXEA 3H5UA 3D5MA 3M8SA 1FNXH 1ZM4A 1N36F 1F9HA 1NSQA 2CQ2A 2J0XA 4ZKAA 6AT1B 2C1EB 1EQMA 1T9UA 5CABA 4F0HA 4F4WA 1NH7A 4NXMF 2R7WA 1GH8A 1ZBTA 4MK7A 3B82A 1KHWA 2N3OA 1JLGB 3BPSP 2QA4G 3VHQA 3DOLA 4HEA9 3GILA 1HWJA 2G0CA 2BR0A 4QIWD 3HKZD 3BKFA 4I4BA 2K3KA 4B9UA 2Y1IA 3C16A 2UXBF 1OJ4A 5CCMA 5IT0A 2P8IA 2CADA 2LQJA 2IA0A 3DLLQ 4DR4J 4NRTA 1AB8A 2NS1B 2FLNA 1ZOTA 3HSJA 2ZE2A 2A6OA 3UFCX 3M8PA 2A1BA 3RUBL 1JJHA 4YUDA 3PFEA 1N0VC 2EBEA 1T9WA 5K8NA 4X62J 2BKOA 1YSJA 2OPSA 2PFFB 1URNA 1C0TB 2CJBA 3PR5B 3TX8A 3Q2SC 4RL1A 2DHHA 4GKJJ 4LF4J 4ECRA 2F8MA 4JI2J 1N5QA 4HL9A 2Z8QA 4FVCA 1RHQB 2W7OA 1UEUA 1A0OB 2ASDA 2RHQB 4DOZA 3GONA 3CB4A 4MMOA 2Z2LA 2RF2A 3UCZP 1JJ4A 1Y3KA 4WP3A 4ED5A 2MKYA 1S1WB 3W5YA 4DDFA 3SCIE 1U2CA 3GCXP 1FFGB 4C98A 4DF4A 4N41A 4JBCA 4XIUA 2B43A 3S1TA 5G0RA 4LSLB 4YR3A 2QRRA 4WK3A 3KMQA 1W7WA 1HHTP 4ZDNA 3SEOA 2IJRA 3W1YC 2W9BB 3P45B 4DR4F 2WONB 1S1TA 5IT9U 1H98A 2XQCA 3A12A 4OYZA 2EFOA 2LU1A 4ENOA 1RK8A 3ZZTA 3SV3A 1MWZA 1FJGJ 4WKYA 2OD6A 4M5IA 4OHZA 4X62F 4RR5A 1UPPA 1C1BA 3PFOA 4GVLA 4L72B 2PE8A 4PUOB 4GKJF 2XY6A 4LF4F 2Q79A 3QWPA 1S57A 4CYUA 5K8PA 5HN0A 4JI2F 1R7IA 2OH2A 3G8QA 4RWXA 4KV8A 4R5PA 2UXDJ 4F4KA 1NSKL 3T5JA 2ZH4A 4LRFA 2ROPA 4OIXA 1M5PC 3OL6A 3QLHA 1CSJA 3D2WA 3FMBA 1S0MA 1N8RT 3L09A 2DGQA 4ZP6A 4P52A 3KLFB 1WG5A 1X7VA 1TAUA 4ID8A 4KAIA 2D1CA 2W2QP 5LMNJ 3CCZA 3IRXB 4RW9A 4LBPA 1N32J 1EETB 5D0RA 3VGVA 2HRTA 2DCUB 5H9EJ 2L9DA 2B8PA 1H3DA 1H74A 1UZHA 2MDAA 2BJ3A 4KHMA 3GFYA 2MPUA 2AGPA 2AJ4A 1WEYA 2W2MP 4WIQA 1FJGF 3ZTRA 2HAFA 2KHDA 4WBFA 3MFIA 2W9CB 1YRXA 5DQIA 2OTLS 2VBZA 1NZ8A 3BGRB 1RAJA 1OPZA 4CO3A 2IM3A 4F7VA 1T9TA 2HHUA 1I5OB 3EDQB 1HWKA 3MDFA 3GSIA 2DCLA 1E6VA 1FRMA 4CDIA 4Q0BA 1FVQA 2QT7A 5GAHU 4URQU 2FGCA 4F26A 3W2VA 2UXDF 3HHKA 4OV6A 2P9CA 5LSOA 2Y1LB 1DQ9A 4TY9A 1VGYA 4RUHA 3UDEA 3FSIA 2W7PA 1Q82T 2QA1A 2ZEJA 3QZ8A 2XTJP 3G8TA 1KP6A 4GC6A 4LF7J 4DL6A 2A2CA 2MY7A 5KFQA 5GMDA 4Y34A 3AAWB 1R43A 1WORA 3W2WA 3GIMA 1EHWA 5LMNF 3W9IA 1N32F 1NSPA 4FKXA 3CCMS 2C22A 1Q7LB 4CH0S 2L41A 1VK8A 1QAXA 2MKJA 3TJ9A 3WBZA 4CLWA 1OQ3A 5CAAA 1U2RA 4NASA 4RJVA 2AU0A 3KHHA 1OPIA 4QYZJ 3KK2B 5KT5A 2QJ3A 3HULA 2RKIA 1IUJA 2CZ9A 3CSKA 1YJWS 2ASJA 2CJXB 4MYTA 2J9DA 2EK1A 1RTJA 2JDJA 2HKEA 3AA9A 1Q0NA 4C8YA 4CTAB 3TEGA 3J81Y 1JNZB 2XI3A 3MD3A 3QT5A 2R3VA 2CPDA 4RBVA 4Y2IA 1IQZA 4P2MA 2EI5A 4RWWA 4N77A 1CJVA 1F5BA 2WBRA 1T3OA 5D77A 3ITHB 1JLQA 5HI7A 7AT1B 4LF7F 5E41A 2V8VA 3IAS9 3C8YA 5F3ZA 2CVIA 3SCJE 1GMWD 4WCEQ 3AD8C 3DLKB 3MEEA 1M1KT 3TWZA 4KGXB 1RT4A 2HQFA 1Y9OA 3ENWA 3M8YA 1NJYA 2CG4A 4DSLA 1R31A 2WW4A 1WI6A 3BQ1A 2WB4A 4OL8A 4DF8A 2HVZA 4A8OA 3D1OA 1T0TV 4DX8H 3NWRA 3S8SA 3QRPA 1GK8A 2DRDA 1X9MA 2V8DA 3TZZA 3GR0A 2GO8A 3AQPA 4FXDA 2AWZA 2XO6A 1ZPWX 4OYOA 1Q86T 3VZIA 2VU5A 1VQYA 1SIZA 1X5OA 1RT7B 3O1LA 5IM0A 4DS5A 3H8YA 2V8PA 2XYPB 4FYWB 4J9KA 2OP5A 2XNQA 2QLJB 1G2EA 2FDNA 1FRLA 2LLZA 1K73T 2R8GA 1NLKL 1SBRA 4X66J 2VG5A 4PWWA 2VV5A 5KAKA 1CS4A 2K7JA 4MH8A 3UDVA 1FJ7A 1DARA 1B70B 1RA6A 1ZTTA 5C24A 1N48A 1UW4A 3VAFA 4V19X 5HMXA 1RXOB 5KTQA 4LBIA 1HLWA 5B09A 3I9V9 3ISNC 5CA5A 2GMHA 1RJJA 2OEKA 2PI4A 1S12A 3KMSA 1T03A 2DIVA 1X0FA 2VASA 4ZITA 2CQDA 5HLFB 5DLFA 5ETMA 5F9LA 2LCWA 4B9NA 1FEHA 9RUBA 3EPIA 2CQHA 2ZZNA 2Z2MA 1YI2S 1XERA 2NSCA 2AYGA 2DIUA 3J7YU 4GO7X 5BR8J 4J9SA 2QLFB 5B0DA 4KSEB 4BWMA 2XCPA 3QT6A 3ENQA 3I4PA 1CULB 3M6WA 4M5KA 1I94J 4EK2A 2BW7A 4PR6A 5LSRA 4A8KA 1HNVB 2RMLA 4UTGA 1VRTA 3CJ4A 3U02A 2YNIA 4PG7A 4X66F 1NK5A 3R6GB 3T19A 1YRTA 1YITS 4DV5J 2GMLA 3DGPA 3THTA 5AE1A 5D3GB 2WOMB 2BANB 2PI5A 4OZ1A 2R4FA 1RTHA 2IBKA 3K5NA 1KVKA 4M5DB 2F5GA 2EFVA 5HAOA 3B4DA 2DR6A 2F8EX 4RLEA 4J9QA 3DI6A 1VQ8S 3UDLA 3TVZA 3RB6A 4HTJA 3OFGA 2UVWA 1SKSA 4IRCA 4YN3B 3VQTA 3VWSA 5T41A 4NLRA 4K0KJ 4WPAA 3IM9A 1FRKA 1TUWA 2AX0A 4WFNQ 4ZHRA 2C2MB 3CCWA 1HD1A 4CO1A 2VUGA 4F3QA 3N0VA 5T7LA 3N5FA 4NWBA 4NA2A 2LDYA 4OX9J 5BR8F 2I0XA 5EHHA 4FZVA 2M5YA 5E0OA 4GO5X 2I8EA 2V2VA 2V68A 2R7VA 3KK1A 1I94F 3OV7A 2ADCA 1JLBA 2MLXA 2WHOA 3K58A 4LR7A 1S4FA 3ISZA 2DHGA 4FS2A 4OYMA 3CCLS 3OW2R 2MGZA 4NLPA 3SI8A 5JMNA 1YIJS 5D0HA 2ZWOA 4KGVB 2ZOFA 2M88A 3Q8PB 4DV5F 1J5EJ 3KLVA 4LR9A 4FPRA 2AJ0A 4B9MA 3DMJA 3CJ8A 5ETLA 1MWYA 1RDRA 3TYTA 3W62A 3RB3A 5L39A 2C3OA 3NGSA 3I9ZA 1S5ZA 1L3KA 4TU9A 4C8MA 4K0KF 1RAFB 4WFAQ 1S1UB 2VBXA 1DTQB 2I5JB 1RAOA 2HEKA 2NXUA 1VQ6S 1TKDA 4NXNJ 5LOQA 1DJ0A 1RI7A 4R0JA 1T05A 2ACMA 4I2PA 4OX9F 1M0SA 3QNWB 2DHAA 4FF4A 3J7ZT 2AEJA 2BKNA 1YG0A 3B4MA 1V6HA 5KFEA 2AGQA 4CIOA 2B56A 4QJVA 2E1AA 2WVCA 1U49A 4IH5A 2K8GA 1IKYB 4Q43A 3C3LA 1P1TA 4H54A 2H65B 2OSQA 1EARA 4F4ZA 1P8GA 1J5EF 1ZAVA 4MT1A 4K4SA 1NUEA 2VC0A 2ERRA 2E44A 4DG1B 4HH0A 3UD3P 1KS2A 4A8WA 5GAHI 3DYAA 4K4UA 2PDAA 5AXMA 5DJBA 3QGIA 5A2QY 2KXHA 2QL5B 2NXJA 4KB7A 3FFIB 1SL0A 3FBCA 4M95A 3QZ7A 4B9SA 1Y5IB 5A8WB 1IN0A 4J9PA 2DH7A 3FUYA 1RBAA 4ZP8A 3Q8SB 2AV5A 4NXNF 5M2RA 3WQPA 2IAJA 3D1QA 2HFNA 3HSZA 4WFZA 4KH1B 1XWLA 2N4CA 4TN2A 3MR2A 4CH1A 2MZJA 2XYGB 2IPOB 4ZCMA 5DDPC 1IKXA 1KC8T 3C15B 2E9RX 2C42A 2YWKA 4EZ9A 1RWXB 4Y2CA 3OL8A 2B9EA 2VJVA 1XR7A 3QGGA 4M5HA 3PJ9A 4WFXA 1HNWJ 2RQ4A 4A4JA 1FFSB 3HHEA 2V4JA 4DR5J 2JEJA 4X64J 3CTRA 3QT8A 4ZVTB 1KTQA 2XGQA 4EU0A 1TV6B 4HT7A 1IJEB 3MTKA 4U67Q 3QT7A 1U47A 4ZVEA 2FIUA 3BO2A 3FCWA 1SC1B 3N4WA 1TELA 1RWKB 1WOSA 3CC7S 3PHEA 4D3HA 3CJKA 3TQ1A 3HXMA 3MMAB 3H0PA 1UVKA 2FHJA 2ZC3A 4I64A 1IM4A 3C19A 4B3TJ 2XSJB 1T9YA 1FTRA 2QMXA 2H4WB 3MECB 2DEIA 5KT4A 1Y10A 1CJUB 1BMQB 4JYAJ 1FDBA 1P9YA 1GTEA 1MU2A 3JSRA 3PYGA 3G6VA 5KG0A 1AZSB 4G3IA 2I2YA 1VIOA 5KFHA 1SI9A 1RTZA 2YKQA 3EYZA 2EBGA 1X31C 2VKZG 1HNWF 2BABA 4IG0B 2GVDA 4DR5F 2RRNA 2Z4PA 4X64F 5I42B 3V6DB 3MPUB 4ECYA 1FE0A 2E7XA 1S1VA 3F41A 3Q8QB 3HVWA 3LAKA 1RT1A 3B6BA 3N79A 4UUWA 1NKBA 4K2XA 1FESA 4DV2J 4B3TF 3VF0B 1MN7A 3MM6B 2R7OA 3HVAA 1OSCA 1HBNA 2D9PA 3KHLA 5DRKA 1VS3A 3GWCA 1HQUA 4MAKA 5EWFA 4OYAA 2CFXA 1X4FA 4JYAF 1DQ8A 2PO4A 5C2GA 2HGNA 1XK8A 4J9UE 3M8QB 3PRVA 4WYLA 4LFAJ 2Z2YB 3R7BB 1LFPA 4AXIA 1PJ7A 5E3CA 2YNHB 4XDDA 4ZVPB 1XN9A 1YJRA 2CNNB 3CDUA 3E01A 2ZVSA 1FXLA 1MROB 2YWGA 2NXCA 2MJNA 4FBUA 3I5CA 1N0UA 2KVIA 4B17A 1PO6A 1BQMB 5KFVA 2AD9A 2B9WA 4B9VA 5L1IA 3RB4A 1LW2B 1JLGA 3J7YI 3UCGA 1HWUA 5DQHA 3GTYX 2CNLB 2RDDA 3D54A 2NREA 1VQNS 2OMOA 1ZH5A 4DZ6A 3LF0A 5L1JA 5LXRA 4PYAA 4KO0B 3JTNA 5IFMA 5EGYA 3KUGA 3W8PA 2HHTA 5IT9Y 4DV2F 5KG5A 1G6BA 3CVKA 4I1TA 1RKIA 2G1DA 4USJC 1FRXA 2GIFA 4I69A 1A7GE 1TQLA 1YBAA 2M7SA 2JRSA 3G86A 2BM1A 2FHOB 5F8JA 1X4GA 3Q86A 4DL7A 3DOMB 4EO6A 4LFAF 4ICLB 2KDOA 2GV1A 2K06A 1S72S 1C0TA 4ANEA 3PW5A 2J6TA 1REVB 2GHPA 1T95A 2CKWA 4PXCA 4F25A 3VGUA 1U6FA 3CDEA 2FZGB 4LSZB 2MY8A 1HKAA 3R5JB 1UWAA 3KNGA 4UF4A 3U27A 4CH7A 4NZ6A 3FRYA 3D3CJ 5KFXA 5D6GA 3V6HA 2FD2A 2OPQB 4QPXA 3HHLB 1U1KA 4G65A 5D4OA 2ZHOA 4ANCA 3BKTA 4AYBD 3NS6A 1S1WA 5DZ6A 2ZC4A 1QVFR 3OHAA 2LP4A 3BSOA 1AXQA 2HVDA 2QYCA 4EO8A 3GU0A 4CCHA 2RDIA 4IDKB 3KFWX 1Z2LA 4ZN3A 2DNMA 4CO5A 3M1VA 3JSMB 4LSLA 3WX4A 1JMTA 2W9BA 4IG3B 2VG6B 2WONA 3BB5A 1QUVA 5ETSA 1YK9A 3OXFA 1H38A 4RUAA 3AOCA 4QWDA 3PM9A 2NSBA 3V2UC 1RT3B 4DLGA 1H6KX 4DXLA 3PZPA 4HI2A 4KGZB 3C14B 2KTQA 1REGX 1YLXA 5A8RB 2XS7A 4IO1A 2OSRA 5KG6A 2B7CB 4C11B 5CHCB 1RT5B 5KG2A 3G6ES 1BXNA 1KN6A 3QGHA 4YEAA 1SL1A 2DBBA 4WXOA 4ZLLA 3GLJA 4W90B 4O3QA 2H51B 3DLJA 2ILZA 2KJWA 1YJTA 4CP5A 2MSTA 1TKZB 3M2UB 2DNGA 2W2NP 2HFSA 4QBUA 4LF2A 2Y8YA 1OYEA 3I96A 3MMBB 2FQQB 3TZWA 5GAGU 4Q44A 4DFKA 4HVZA 2DVIA 3CDWA 1XEZA 5LL6d 4DN0A 1J2VA 3IRXA 1C1CB 2HLTA 4A47A 1EETA 3GV5B 3NXZA 2MZSA 2QA2A 1S0OA 2DXDA 3TAQA 3OR2B 2CPYA 1C0UB 2UVRA 1VIXA 2IRUA 2W9CA 1S1XB 4ZS6A 4DSKA 2XZWA 3E8OA 2WSEC 3PKMA 2B0GA 3BGRA 3DM2B 2F65A 5EDWA 3ZZPA 5J2NB 5E3PA 2V5HG 3MM9B 1QSSA 3BQ0A 3CJ2A 4F2RA 3GJTB 4TQSA 2W8LA 3MXHP 3S7RA 2VICA 4F2SA 2POKA 2PN6A 2PA3A 4ZLNA 3LAMA 2E1MC 2AYBA 1PJ5A 1RT6B 3RBDA 3C6UA 2DXEA 4DJBA 5DQGA 1WSRA 1SJ1A 3UVJB 5LJ5Y 2EG1A 2G2ZA 4DBQA 1FERA 2RDJA 1HW8A 4GVBB 2BRLA 4OLOA 2D9OA 4GC7A 1S4EA 2FC9A 2ZH7A 4RW6A 3PX4A 3DDIA 2QO3A 2HMIB 1U1MA 2FVSA 4MKBA 2UUBJ 3HVTA 3TUPA 4LBHA 2ADBA 3B8HA 3VR1A 1XIQA 2WTFA 2RD5C 3KK2A 4YMEA 5AE3A 2V0NA 3D7SB 2MLYA 1SC3B 2KZMA 4PPDA 2O1PA 2ZDOA 4J9MA 5KFSA 4F36A 2XCAA 4CTAA 3WX8A 2EG2A 1WKJA 1S9EA 3ISND 2R8HA 3VVTA 1B0VA 1IQTA 4LRCA 3ITHA 2YTCA 2ZKTA 3NY0A 3CC4S 4USUA 3DLKA 1G1XA 2UUTA 2CQ4A 4F67A 3VV2B 1J5OB 2FJVA 1VI7A 5EX3A 1K1QA 3ZTPA 3RU0A 2UUBF 4J5OA 1WF1A 2LMIA 3C46A 2VOOA 3AQOA 2CDQA 2CPFA 2YNGB 1HQ2A 3ET6B 4BS2A 4M94A 3CJ3A 2LDIA 3HI9A 1RT7A 2B9YA 2VB6A 2R7UA 3CCQS 2YWEA 4PWDB 4NA1A 3TAMB 4F50A 1WKKA 4KFBB 4F02A 1VFJA 2HHWA 1ITPA 2RNEA 1WUUA 2F9JA 4DFPA 1S0VA 3A4TA 3FVYA 4I0WA 1D0EA 2IJNA 4PQUB 2JL9A 2KO1A 2IIHA 4DPUA 3BBFA 3TVYA 1TK5A 1S97A 3AB2B 4ZIVA 3GQCA 3W5ZA 1XQIA 4ZCKA 2JFDA 2YPYA 3O2IA 1HPZB 4FBTA 2IC3B 4ED7A 2B4VA 4RBUA 3M32B 2NZCA 2W2OP 4K8RA 2CPEA 2ZH3A 7FDRA 4RKUC 4KQZA 1DLOB 1L3VA 3GYGA 5HLFA 2FY1A 2HYIB 3BGFA 2JSXA 4ECZA 3HO1A 2CA9A 2QEXS 3CXCR 3THPA 4A8QA 4RUCA 3GMGA 2GQCA 4P10A 5HANA 3T3FA 2JOQA 1HHQA 1K47A 2CQ1A 2ZJRQ 4OJ3A 1CULA 2WCXA 4Y2MA 3T5HA 1LXJA 1F2HA 4Z2XA 4IQXA 1HNVA 3UR3C 3O8WA 2QMWA 2ZH2A 4TYBA 4HACB 4DPXA 2HZVA 3ADAC 3UDCA 1VQPS 3ZNUA 1UZDA 2VDIA 4OX6A 4NMLA 2Y8WA 2HFVA 2QSWA 4YB5A 4OJGA 5D3GA 2WOMA 2BANA 2HNZB 4ZVUB 3RRHA 3DRRA 2ASYA 2OO4A 4M5DA 5BJRA 1R0CB 3PO4A 3T1HJ 1JIHA 1T9XA 4MYUA 2JLEA 2PD1A 1H0HB 3AHPA 2DHSA 2QSFA 5DO2A 4DPWA 5AT1B 3MAHA 2D3UA 1SC6A 1F5AA 2BKPA 4F4AA 5KFFA 2C28A 4N8OA 4ES2A 3CO9A 4DV3J 1MNEA 2IM1A 3MCNA 1P9QC 1PJ6A 1L3UA 3F56A 3GJRB 2RQKA 1LNQA 1B64A 1HMVA 4LSNB 1VQKS 1M5KC 5E3RA 5KOXA 2XMAA 4F04B 4UUXA 3ZXWA 3F44A 4OMFG 3FGVA 4MKVA 5IZHA 2O5DA 2ZHAA 4ZJOA 1K44A 4X4QA 5DG7A 4ZK7M 3L7OA 5KFJA 4I2QB 3T1HF 4DFJA 1WTBA 4NZ7A 2VPWB 2LYVA 1FNMA 5KFMA 5B0CA 3CJQA 1R8BA 2GZOA 1TL3B 3D3BJ 3QBCA 2VQFJ 5JJBA 2V9KA 1CJKB 1KEKA 1DTQA 4USTA 2I5JA 4GMKA 2J0WA 2OPPB 4KPYA 2F4VJ 4B9LA 2KFNA 4XK8C 5GADU 4DV3F 1PAEX 1R89A 3KLEA 1PYTA 3KXDA 4TYAA 1U8WA 4ZJQA 1DBDA 4FF1A 1HHSA 4LREA 1H72C 1KLMB 5H9EK 1VK3A 2UZAA 4RUBA 3PRBA 4F3OA 1DFDA 1HBMB 3GCWP 5HROB 2XO7A 2CQIA 1WD6A 2HQ3A 2VL1A 5F8HA 4WFBQ 1IKYA 4TY8B 4YP3A 2QG9B 3PW4A 3VGSA 1SJRA 3FSXA 5D15A 4LF5J 1HA1A 4C48A 4DG1A 2AYEA 4UOFA 2D3ZA 4WU3A 1UEVA 1MMNA 2JC0A 4P2SA 1Q53A 4JI8J 2HS4A 4URSA 2MKIA 1UVMA 2HIYA 3W3SA 3V5RA 4CQ1A 2E5IA 2ZVIA 3OPKA 5KT6A 2VQFF 5A8WA 1N88A 3KG0A 1KQFB 3TEHB 2A6MA 2F4VF 3ZZUA 2UU9J 4UT4A 2P5VA 4I6YA 1S10A 2CQGA 2XMKA 3GG1A 3P49B 1M5OC 5KFTA 4ED3A 2Y0BB 1YHQS 5HQMA 2BQUA 4P75A 3K59A 4DL3A 1MN9A 1VLYA 3C15A 2KB2A 3MM7B 1QAYA 2VJUA 3LGNA 3UCUP 4YFUA 1RAGB 5DLGA 1QSLA 2ZD1B 1S79A 1JLCB 3CGIA 3A3NB 4Z7CA 2YKNB 1TV6A 4LF5F 4FNIA 4USIA 4NCGB 3EVOA 2HNYB 2KG1A 3CPWR 4JI8F 3MMAA 4LFBJ 4WE1B 3EZOA 4Q8FA 2I9SA 4LF9J 4LQ9A 4ECSA 2E1CA 2HGMA 1RAIB 2XSJA 1UCNA 3J80U 3FMWA 1RYSA 2BQRA 2IJFA 4DR7J 3MECA 1GMVA 3IG1B 2UU9F 4J9NA 4YB1P 1GFWB 2MSSA 1KOOA 2RUSA 1CJUA 2YKMB 1NO8A 2LECA 3AOAA 3NMAA 3SXLA 4C0BA 4EWTA 2XC9A 3ZNJ1 1AZSA 2AF6A 2MHNA 1SKUB 3M8ZA 3RTVA 4DPOA 1DHMA 4F3MA 1TL1B 2BBEA 4RU9A 1NBEB 2F63A 2DYAA 1IM6A 2FLLA 4WWSA 1RT2B 4IG0A 5CD4A 3OLAA 5D78A 4JV2A 5I42A 3V6DA 1HQEB 2DTJA 3N01A 4KKOB 2RHSB 4X4PA 5GVQA 1RAHB 2HAIA 3CJRA 4G1QB 1P6TA 2GVZB 2VDHA 3HFKA 4LF9F 1LKZA 3MM6A 2HQGA 1VC6A 2VBYA 2HFZA 1B7FA 2YQ1A 3R8YA 2J0QD 1NEEA 1M90T 2L48A 3RGIA 4KGKA 4DR7F 2VA3A 3JSYA 1KBRA 2AHOB 1MW7A 1YWXA 1B4SA 2EWHA 1Y5NB 3K2YA 3M8QA 4ZN1A 4EEYA 2G9OA 5DGAA 4NI2B 1PILA 2DNHA 2YNHA 2R9LA 3VALA 4NLYA 3UNGC 1IKWB 2DRAA 1HBOB 4PKDB 5C25B 1MROA 3MM5B 1SUQB 3EPGA 4KE5A 4A46A 5KFPA 2E66A 3AFGA 3CCTA 1IKVB 5L9NA 1YBUA 1BQMA 2AGOA 3PRDA 2OIHA 4ILRA 1TU0B 3JQJA 2C3YA 2XI2A 1GT8A 3I5BA 3RRGA 2MZ1A 1LW2A 4M5JA 1IR2A 3KLIA 3M9NB 4QIEA 1RU1A 3KHGA 1F5CA 3CULA 4UY85 5DM6Q 4Y2AA 1GMUA 3LWMA 3FKBA 1RUSA 1UWBA 1RHRB 1QTMA 3EX7B 4KO0A 3Q2TC 1VHIA 2MQPA 1TMMA 2BYCA 5I3PA 4OFZA 4TXSA 1PYSB 1JK9B 4TNOA 1JLEA 4I68A 3P8BB 3KUHA 2A3JA 1KVJA 3FDSA 3QJLA 2ZJPQ 4RW8B 2XYHB 3DOMA 2DT9A 3ZFVA 1OY9A 4K4VA 1JJCB 1RLDA 3QAEA 4ICLA 4KHPJ 5KG4A 1D9DA 1REVA 5A8KB 2J6SA 5E3QA 5C5JA 3TANA 4ZVRB 3PW2A 4N76A 3ILOA 3IS9B 1U1RA 4AL7A 1DURA 2RSQA 2X3GA 1SQGA 3A8KA 1TUVA 1FJCA 2QN6B 3L7PA 3PJWA 3PX6A 2HHVA 4B3RJ 3PX0A 3HHLA 5DG8A 5KFIA 2IVFB 4OYBA 2MEWA 3IXQA 2CPHA 3H25A 1RAEB 2LQ5A 1IR1A 3QGPA 2EEYA 1S77D 3BGOP 3JSMA 2CNOB 3M30B 1EQ0A 4DV6J 1WEXA 4IG3A 1F0XA 2VG6A 3H98A 5MAOA 3RAQA 1ZPVA 1N52B 4USVA 1TR0A 2M2BA 2RIJA 1N34J 1RT3A 2K2PA 2W9AA 4KHPF 3C14A 3FEYB 5A8RA 3GFHA 1G7CB 1RWNB 1RT5A 1BUXA 3D6TB 1VOMA 2DH8A 3K17A 1SV5B 5EX0A 1VHFA 2XEXA 2KHCA 1FD8A 3V6JA 4LF6J 4MFBA 1UP1A 3T1YJ 3QWUA 4B3RF 4OYXA 2MKCA 4LIWA 4HYKA 3M2UA 4FXWA 3HFVA 1N56A 2HWTA 3LPYA 4X4SA 1PCAA 4NYZA 4K5RA 3MMBA 1RTIB 3H5XA 3G96A 2B9XA 3J81j 3POTB 2I6WA 3NGRA 4DV6F 2MQMA 1KFSA 4ECWA 3H5SA 1C1CA 4UZCA 2YX1A 4ES1A 2VG7B 3FK4A 1QJHA 4RW4B 1M1GA 4Y0FA 2P9GA 4ALZA 3OR2A 3TA1A 1WHWA 4NLWA 1TKXB 1GTHA 1C0UA 2RJZA 3G4SS 4NLVA 5KOWA 2GJIA 1RWUA 4DSJA 2YKPA 1N34F 1S1XA 3P96A 3SIPB 3TJ8A 5ITHA 3DM2A 1JLFA 5I3QA 1I3OB 5J2NA 3SSQA 3BSAA 4TU8A 4IRDA 5ETRA 3CJSA 4AD6A 4PG8A 4DQSA 7FD1A 4IUFA 3NCRA 1B7YB 2CJ9A 4LF6F 3T1YF 4ZPDA 1RT6A 3NKYA 4KJIA 4OHVA 1UVIA 3CD0A 2VHGA 4O0NA 1YJ9S 3HD2A 5GAEI 2WZ1A 3UVJA 3DCAA 4CLSA 4I67A 1X4HA 4OX8A 3OTDA 3DDKA 2XBPA 4GVBA 4HHUA 2W01A 4MKAA 4A8YA 1JWWA 2ZH8A 3RAXA 2MQLA 1MSWD 3M6UA 2HMIA 2AJ2A 1RADB 3OVAA 5FLXU 4FYDA 1X60A 5C42B 4OHYA 2QFJA 5EWGA 2NQPA 4FDFA 5T14A 4Y28C 2DB1A 2FYXA 1SJFA 4M5GA 5E33A 2XLIA 3BN7A 2ALZA 3T5KA 3HX9A 5DDRC 4NLOA 2KI2A 2CJAA 1X9SA 1WC5A 3RR7A 4ED1A 3LTOA 1JXEA 3OVBA 1IWAA 3IMQJ 1C2PA 1D8ZA 4X4TA 3BEGB 3IBFB 2KT2A 2DGTA 3HFZB 1Y7PA 3HLUA 3NLCA 4EYIB 1IWGA 2VPZB 3D6FB 3VAJA 5D0EA 3AA8A 3CD6S 1U1LA 3AXMA 4U9RA 5ETQA 4CO0A 3KJNB 3BH7B 3FBEA 4CYUB 4WP8A 2GIRA 1NJWA 4DR1J 3VAGA 3TX0A 2N3LA 3K8WA 2DNKA 1J5OA 4KC5A 2XWXA 4YB7A 2UUWA 2HW3A 2OD4A 3QLHB 5CQGA 3HZEA 2M8DB 1FA0A 3PIOQ 3OFEA 3NG8A 1HI1A 3GIKA 4OI1A 4QIFA 4QOTA 2F8HA 1UVJA 1RABB 4RNNA 3ET6A 2YNGA 1NPRA 2ZNZA 2QTWA 2AX1A 1BY9A 4CO2A 3UR0A 4P7TA 1IBKJ 4RW9B 3P6YC 2MJUA 4PWDA 2QV6A 1XR5A 3TAMA 2ZH5A 4KFBA 3OBIA 1SC4B 4QCLA 1R27B 1ZZNA 3Q23A 1RBOB 1UW9A 4H4MB 5IOLA 4PQUA 4BCAA 2BJ1A 2ZUGA 2I38A 3NP5A 3UNYA 3N6NA 1RCXB 3QMQA 3V4IB 4C3KA 1R8HA 3EMTA 1SJ4P 3JQMA 4PG6A 1HPZA 2HG4A 4P72A 2KXNB 4DR1F 1H73A 4AE5A 1V5IB 3MCSA 3AY0A 1NCLA 2QFIA 3M32A 2MTLA 2HZAA 5IQQA 4NMXA 2UUCJ 2H9ZA 3K7RA 4HDHA 2UXCJ 4JI6J 3OFHA 5HL7Q 3GIRA 1DLOA 4C8OA 2J7WA 1CPZA 1BLUA 1BWEA 3R5CA 3IR7B 4IFVA 5DG9A 3JAMU 2NXNA 1IBKF 2A10A 2E29A 1R6YA 1AYEA 1LQ9A 2KM8B 3LP2B 2W8KA 3BH6B 5B0FA 3NS5A 1SVDA 3FEZA 3H42A 3CT9A 1OMSA 3CMQA 3UQSA 4HACA 3HP6A 3BREA 4C7QA 2J5AA 1AROP 3D6MB 1FEEA 2ABYA 2FHKA 1HW9A 3MPYA 5D4NA 5L46A 2G4BA 2FB0A 4PAAA 1BQXA 2Y3YA 3UE2A 3HSDA 2HNZA 3JYTB 3D28A 5EWEA 2CYYA 2XZTB 2RU9A 2IMWP 3AD9C 3I82A 3IP0A 1RZMA 2UUCF 3IRWP 2HRUA 5F8MA 4C4WA 2UXCF 4JI6F 4CRJA 1UJ5A 2YPZA 3RBXA 3VQSA 1S59A 2W4CA 4G1PA 2RE1A 5J1EB 1WWHA 3RYLA 2IM2A 1Q4RA 2DR8A 1KVIA 5THWA 3W8GA 4OYIA 1V3ZA 2GQ2A 4P2XA 1D9FA 1OIAA 1KQSR 4A8XA 5HVFA 3Q24A 1CVJA 1Q16B 4ZIWA 3S6EA 1WOPA 2O67A 5D4LA 4ETZA 3A8EA 4OJHA 1TP7A 3Q22A 5HMWA 2LEPA 2HQIA 3RBEA 1Y00A 4PXBA 2B4UA 1W2IA 2VBWA 3R5BA 3IGVA 1LWFB 2BX6A 4I7FB 4CZCA 4K4TA 1YGYA 4ZJLA 2RT3A 3CCES 4OV1A 3G87A 4ZPVR 5KT7A 2C2RA 5BYRA 5A6WA 6FDRA 1H2UX 2RVJA 4Z37A 4F0KA 1AFJA 4I2QA 2RU3A 3EWGA 2UUAJ 5F3TA 1TMJA 4O44B 1NU4A 3TZXA 2XZDB 1TL3A 3R1LA 4ZPBA 3T5LA 1QAIA 1CJKA 4JUZA 2OPPA 3FQKA 4J37A 2HPUA 3JSBA 3OR1B 4EUVA 1D09B 5CH7B 4JI7J 4J90A 3IWLA 2E5JA 1BE4A 5KFKA 2UVVA 2GC8A 5K8MA 4HKQA 5LM7E 1KLMA 3DRXA 4QQBA 4DL0C 2N7YA 5JVHQ 1HBMA 5B0AA 5HROA 2KRRA 3HJFA 2DNLA 1FK9B 2WVBA 4UZBA 4QU6A 4TY8A 2XMVA 1APSA 4L73A 4WTOB 5CCLA 2EFNA 1ICEB 3DRSB 2VF3A 2HSEB 4B3SJ 4AL5A 2V2KA 3Q89A 5A6PA 4FNHA 1MWQA 2RS8A 2E1PA 2ZJQQ 2LXUA 2UUAF 3M6XA 4E98A 2EFQA 4QWEA 1EKRA 2H5EA 2CPIA 3DU6A 3RR8A 3J80Y 1HFEL 1VRTB 3K5OA 2C2NA 1KHVA 4WIIA 4DPYA 2YY3A 2DNNA 1IJFB 1MMLA 4MK8A 2V63A 2NYIA 3CO0P 2YWFA 3ZTQA 4GKKJ 2HLUA 2YWWA 3D68A 2ZKUA 1G3OA 4IOCQ 4JI7F 1RHKB 3UN5A 1GQEA 1WNEA 3EICA 2K1RB 4DS4A 1LWCB 3IBCB 4HI1A 3MF5A 2YH1A 2ZBCA 3D1HA 1ULRA 3MM7A 2HVIA 4QZVB 5IQ6A 3OTEA 4XDCA 4CLTA 2XMWA 5HJYA 3CC2S 4I56A 4ZHRB 2L9WA 3BGLA 3DXSX 2ZD1A 4ZP7A 3MMCB 1RTDB 5ETNA 3CIMA 1JLCA 3GG0A 4B3SF 3GYXB 2YKNA 1WDDA 3A1YG 4DUTA 2QMUB 1GXLA 4DUYJ 1NRKA 4DSFA 1VCTA 2HNYA 5KFOA 1JLBB 1VJQA 2AKWB 2PSZA 4WE1A 4A48A 1RHMB 4PCQA 1UL3A 4YQWA 2MGZB 4ZP9A 5E7OB 1FCAA 1R0BG 2FHJD 3NS7B 4Q2LA 1XNQJ 3KYLA 2XS5A 3GYNA 1CC8A 3PW7A 3MM8A 3IG1A 2AYMA 4M63A 4GKKF 3I0SB 1H7WA 3NEKA 4XPEA 5RUBA 4NEZA 4C8KA 2E5HA 2CQPA 4JP8A 5DZ7A 3X1LB 3WC0A 4Y65A 2HGLA 1DAXA 1N5SA 3ZZZA 3DKDA 2VODA 2B6AB 1WC0A 1TL1A 4ETXA 2PMWA 2PGCA 4LUBA 2FJBB 2M70A 1EAYC 4UW2A 1RT2A 1XNRJ 4OI4A 2NZ4A 3TAPA 1RQ0A 1HQEA 4O3RA 5KFCA 4KKOA 1ACMB 3CDBA 1WG1A 4DUYF 5LSLA 3R2DJ 3C6TB 3IR5B 2RH3A 3PV8A 4HLBA 1DQAA 4G1QA 1VJWA 2GVZA 2HBYB 4DV7J 1EX8A 3ONQA 2W4PA 2KT5A 2ZZMA 4CT8A 1VMBA 2U2FA 4KRWA 4O4RA 2QLXA 5KT2A 3NGTA 3NOCA 4P74A 1VQOS 3ZO7A 1VC0A 3SYZA 1XNQF 2CVEA 3FZ2A 2NYHA 4ZVGA 3I31A 5FJ4A 4IR1A 2EFGA 1N33J 2AZ3A 4CNYA 4QIVA 4A8SA 3LA0A 2CPZA 1U1QA 4KGMA 4RNMA 2FLOA 4NI2A 1FKOB 2V94A 3DYAB 2APOA 2IYGA 1RYRA 3R27A 3EJMA 2IYIA 2DJWA 2GJ2A 1IKWA 3FEXB 1FD2A 4I6AA 3SCLE 1HBOA 2JZ5A 1LOUA 5IT4A 5C25A 1SH2A 1SUQA 3QJPA 2WRMA 2BM0A 3IWNC 2WVFA 3SBMA 1IKVA 1NHVA 5CZXA 1XNRF 5AXNA 4YR2A 1LWXA 1HNIB 3SCKE 2J6UA 4L3KA 2V9WA 4QR1A 3A3OB 4NYPA 3PYFA 2W2PP 1FHTA 2FJEB 2LVWA 2VC1A 3BDPA 4HHJA 5J2PB 4DV7F 4M5MA 3CMAS 4ECVA 3EGZA 1PG5B 2FJAB 2BV3A 4ED2A 4DQIA 1YQHA 2CNKB 4WZMA 1S7HA 3FRZA 3EM1A 2XHWA 1QY7A 4C97A 9ATCB 4IFYB 3BQ2A
chains in the Genus database with same CATH topology
3T1HF 2XWYA 4GC6A 4DFJA 1OWXA 4JV5F 1VRUB 3MGJA 1Q1KA 4M8LA 1N33F 4DL6A 1WTBA 4NZ7A 2VPWB 2A2CA 2LYVA 1FNMA 2MY7A 5KFMA 5B0CA 3SDEB 5I4MA 4RW8A 5KFQA 2OAUA 4Y34A 1R8BA 1TL3B 3AAWB 1R43A 2JWNA 2MKSA 1X4DA 1F60B 1OS5A 4R0EA 3W2WA 3GIMA 2R8JA 5JJBA 2V9KA 5LMNF 2BACA 3H4BA 5A8KA 1KEKA 1ZTWA 2VFTA 1DTQA 3PR4A 4NZ0A 3NGDA 1N32F 2I5JA 4GMKA 2J0WA 2OPPB 4KPYA 4B9LA 2R7UA 4DSEA 4R25A 3CCMS 2C22A 1VQ4S 3QO9B 1Q7LB 4CH0S 2L41A 4XK8C 3UD4P 2KFNA 5GADU 1VK8A 4DV3F 2DPIA 1QAXA 2MKJA 3WBZA 2E9TA 3TW0A 1R89A 2MZTA 3D0HE 1TVRB 4DQRA 1OQ3A 1Y4ZB 4NLXA 3KLEA 4HH1A 2FC8A 1S76D 4TYAA 3FNNA 1JLFB 4QW8A 1U2RA 1DBDA 3SZ2A 4FF1A 5CD4H 4CO4A 1D1UA 4FVMA 1HHSA 2AU0A 4C11A 3KHHA 1KLMB 1VK3A 2UZAA 1OPIA 4G6VB 4QYZJ 3PRBA 3KK2B 5KT5A 4F3OA 1DFDA 1HBMB 3OTBA 2RKIA 2A2DA 4B02A 5J2QA 1IUJA 5HROB 2UVUA 1KONA 2XO7A 2CQIA 1BQNA 3H5YA 2F40A 2IVMA 5HP1B 3CSKA 4Q2MA 3PXGa 4ECXA 1YJWS 1WD6A 2ASJA 3LWLA 2HQ3A 2J9DA 2EK1A 1RTJA 2VL1A 2JDJA 4MYTA 4NLUA 5F8HA 4WFBQ 1IKYA 4TY8B 1X4CA 3LP0A 1NK7A 3AA9A 4YP3A 2FLPA 4C8LA 1Q79A 3G71S 3PW4A 2NLWA 1UA0A 4C8YA 2FTRA 1RGVA 4CTAB 3CCVS 2X1GA 2B7BB 3M2VA 1TKZA 2R7QA 2RB7A 3J81Y 4RZRA 2YQ3A 3ETOA 4H4OB 5CZVA 1SJRA 3FSXA 1JNZB 1S9GA 2HWIA 3VZHA 3DLEB 2XI3A 3MD3A 2DO4A 3H59A 4RBVA 2CPDA 4Y2IA 3IAM9 4NPOA 1IQZA 4OI3A 2EI5A 3EGWB 4RWWA 1I6JA 3HDSA 1HA1A 4N77A 1NK9A 4DG1A 1S6OA 2AYEA 3IO1A 1F5BA 2D3ZA 2WBRA 4WU3A 4B3MF 1NAQA 1T3OA 1UEVA 4W92B 2HWHA 1MMNA 3IC1A 3HZGA 2JC0A 3X3UA 5D77A 2JLGA 5BYSA 3ITHB 4P2SA 1RP5A 1JLQA 5HI7A 3GV7B 1Q53A 4LF7F 5E41A 2V8VA 2DNZA 3IAS9 2JVOA 2HS3A 2MQQA 3HKWA 2ZBIA 4OQJA 1FDNA 4O3OA 2HS4A 5J1PA 2X51A 4URSA 3C8YA 5FIIA 2EKYA 2GNKA 5EUHA 2MKIA 1UVMA 5F3ZA 3W3SA 2CVIA 3SCJE 3V5RA 3PEJA 4CQ1A 3H2LA 2E5IA 4DQPA 4WCEQ 3VAHA 3DLKB 3MEEA 3OPKA 5KT6A 3NCQA 1U1NA 1JLAB 2VQFF 5A8WA 1M1KT 1RT4A 2Q6CA 1Y9OA 3ENWA 3LALA 1NJYA 2CG4A 4DSLA 1R31A 1WG4A 2ZOGA 3W7BA 3M2RA 2B5JA 1N88A 1WI6A 1VQSA 3KG0A 3BQ1A 3Q0AA 2WB4A 4Q8EA 3DOLB 1KQFB 2F4VF 3MAQA 4FP9A 4DF8A 5B0BA 4OL8A 2HVZA 3ZZUA 2RRAA 4A8OA 2M52A 2P5VA 3D1OA 4I6YA 2CQGA 2XMKA 3GG1A 2CZ4A 1S10A 3P49B 4DX8H 1Z1ZA 4KTQA 4IOBA 4ECTA 1M5OC 5KFTA 3S8SA 4NCAA 1SV5A 4ED3A 1T8EA 1X9MA 1NH8A 1YHQS 2V8DA 4OZJA 3GR0A 1HQUB 2GO8A 3AQPA 2BQUA 1NKEA 2N82B 2DNOA 4O3NA 4ED6A 1FRHA 4FXDA 2AWZA 1X4EA 3MM9A 1ZPWX 2BE2B 1XTZA 3O3LA 1BD6A 3K59A 1Q86T 3VZIA 4DL3A 2F9DA 2G13A 4USHA 2XMMA 1TKTA 1VQYA 1SIZA 1VLYA 5HQ8A 2KB2A 3MM7B 3H40A 2PMHA 2NUUG 1X5OA 1JXLA 1AFIA 2ZE2B 1S9FA 1QAYA 1A9NB 3LGNA 4ED8A 1KTVA 3UCUP 2CPJA 4YFUA 3M8PB 5DM7Q 1RT7B 4QPTA 3O1LA 1RTIA 5DLGA 5IM0A 1QSLA 3BSNA 3U1MA 4DS5A 3H8YA 2DD8S 2FVRA 3TO8A 3POTA 2ZD1B 1V3SA 2OPRA 1S79A 4K59A 1TL4A 1JLCB 3CGIA 4J9KA 2OP5A 3NL0A 3E01B 2XNQA 1G2EA 2FDNA 2OPSB 4P6QA 4ILLA 4X4RA 5FLXY 3HHNB 2YKNB 1TV6A 2BA9A 1FRLA 2VG7A 2BW2A 4LF5F 1VC5A 2LLZA 2XY7A 2C3MA 1K73T 4RW4A 2GIQA 3LW5C 4MJKA 4FNIA 2VD3A 5CYMA 4NLGA 2M4MA 2EPIA 3ZZRA 4P7VA 3OJUA 4USIA 2KJVA 4NCGB 4ZVFA 4URGA 2O01C 2WBMA 2HNYB 2KG1A 2R8GA 1C4CA 1SBRA 3HHLC 3CPWR 1TKXA 4WKRA 5KFGA 2VG5A 4JI8F 5F8GA 2VV5A 4IKAA 1KQGB 1D8YA 1O0PA 3MMAA 5KAKA 4WE1B 4E0DA 1OQ6A 2K7JA 4MH8A 4Q8FA 3DRPA 1FJ7A 1DARA 3THVA 2I9SA 1M90T 2QZ8A 4ATNA 4PQAA 4LQ9A 4ECSA 1Y3JA 2WAQD 1Q8LA 1HBUA 2M3DA 5E5NA 4N56A 1Q7YT 2E1CA 1RA6A 4X4NA 1ZTTA 2HGMA 2RF2B 5C24A 1N48A 1UW4A 2XSJA 3TP2A 1YTYA 4C0HA 3VAFA 1N4LA 4V19X 2J7KA 3FMWA 1RYSA 1FJEB 5HMXA 2BQRA 5KTQA 2YX7A 3KOAA 2IJFA 5B09A 1YJUA 4PWUA 3I9V9 3MECA 1P1LA 3IG1B 4KHRA 4J9NA 3ISNC 4YB1P 2J8AA 2UU9F 2VZ9A 2MSSA 1KOOA 5CA5A 2GMHA 2PEHA 1RJJA 2YKMB 1NO8A 2PI4A 2DGUA 2LECA 3D0GE 3MUTP 1W25A 3NMAA 3I87A 4J9RA 3KMSA 3SXLA 2DIVA 4C0BA 4EWTA 2XC9A 5G0RB 1X0FA 1R0AA 2VASA 1T03A 1K0TA 2CQDA 1WF2A 5HLFB 5DLFA 2AF6A 4NCBA 2EK6A 3CUNA 2MHNA 4G1IA 4JV0A 4B9TA 5F9LA 5AXLA 1FE4A 1Q8BA 2LCWA 4B9NA 1FEHA 3RTVA 3EPIA 2KM8C 2CQHA 4DPOA 1DHMA 1S1TB 2HHPA 3U1NA 4F3MA 2ZZNA 2Z2MA 1YI2S 2JC1A 3KLHB 2KYXA 1TL1B 1XERA 2NSCA 2BBEA 4RU9A 2KRBA 2AYGA 2DIUA 3J7YU 4GO7X 4XAKA 4J9SA 2FJXA 4NYOA 5B0DA 1K9MT 4KSEB 5I3UB 4BWMA 2FLLA 3EXCX 2F3JA 3OSPA 2XCPA 5GMKa 4PRFA 1FVSA 1RT2B 3ENQA 4IG0A 2XB2D 1M5SA 3I4PA 3OLAA 3BZQA 3M6WA 2NR0A 5D78A 4JV2A 5LXYA 3V6DA 5I42A 4PR6A 1HQEB 2DTJA 2BJDA 4BC9A 1C1BB 1M5VC 4C8NA 2UV8A 3N01A 5LSRA 4A8KA 2DH9A 2DGVA 4KKOB 3NCPA 4O4GA 2BOPA 4X4PA 5GVQA 1HNVB 2MYFA 3AH6A 1VBYA 2RMLA 4ELUA 2HAIA 5J1NA 3R1HA 1NJXA 4KT0C 1VRTA 3CJ4A 5EN1A 3V81B 3OSNA 4MKYA 1NHUA 5C42A 3MPVA 4G1QB 3U02A 1P6TA 2YNIA 3GR1A 4PG7A 4KV8B 4X66F 1NK5A 4R5PB 1LXNA 3T19A 3HFKA 1YRTA 4NRUA 1YITS 2GMLA 3DGPA 3MEKA 3TA2A 3THTA 3KK3B 4LF9F 4ZCIA 5AE1A 1LKZA 5D3GB 2WOMB 3CD5A 2BANB 3MM6A 1VC6A 2PI5A 2VBYA 4OZ1A 2R4FA 2KKHA 2HFZA 1RTHA 1B7FA 2J0QD 2IBKA 1HYSB 3K5NA 1DTTA 4C0OC 1NEEA 5AE2A 2PT0A 3DNCA 3M1VB 2DITA 2L48A 4LJMA 4M5DB