1A7GE

The crystal structure of the e2 dna-binding domain from human papillomavirus at 2.4 angstroms
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
ATTPIIHLKGDANILKCLRYRLSKYKQLYEQVSSTWHWTCTDGKHKNAIVTLTYISTSQRDDFLNTVVIPNTVSVSTGYMTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REGULATORY PROTEIN E2
publication title Structure of the E2 DNA-binding domain from human papillomavirus serotype 31 at 2.4 A.
pubmed doi rcsb
source organism Human papillomavirus type 31
molecule tags Transcription regulation
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1998-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1a7gE00
1VQKS 1FJCA 1Q81T 3MDFA 3B4MA 4Z2XA 2JWNA 1WWHA 2QEXS 2MHNA 2DHXA 1M90T 2MQPA 4U67Q 2LXIA 4YOEA 3MI7X 1M5KC 1SXLA 2CPIA 2HZCA 2E5GA 4PR6A 3BO2A 2DGUA 1VQPS 5DM7Q 1P27B 1CVJA 4ED5A 2ADBA 5MLCV 5DM6Q 1KC8T 2KFYA 1YJNS 1G2EA 2YTCA 1YHQS 2Q79A 2L41A 5D77A 4WFNQ 2XNRA 4WF9Q 3CC7S 1PGZA 1URNA 4IOCQ 2FC9A 1X5PA 3UWTA 3FEYB 3CCSS 3VALA 1WI8A 2ADCA 2DNKA 3U1LA 1JJ2R 2MZTA 1P1TA 2MY7A 2DGXA 2MGZA 1S79A 2XS7A 2JVRA 3G6ES 2D9OA 4TU9A 3VAJA 2U1AA 2DNHA 1WG4A 3CCJS 2RS2A 2MKHA 2DGWA 2V94A 2FC8A 2LXUA 4CH1A 3D2WA 1M5OC 1VQLS 2I38A 2N3LA 2MQLA 3VF0B 3CCUS 1FNXH 2DIUA 4EGLA 1KD1T 2MYFA 1ZH5A 3SDEA 4TLQA 2MKJA 3EX7B 5IQQA 3EGNA 3S6EA 1U1KA 2KU7A 5EN1A 1ZZFA 1HD1A 2CQ4A 1R8HA 2LECA 1WELA 2VONA 3VAMA 3K0JA 2CQHA 2O3DA 4FXVA 1YI2S 3DXBA 2DGVA 2JX2A 3IRWP 2MZJA 2RRBA 2MZQA 2KXFA 1SJRA 1WHYA 2DNLA 2JRSA 1YWXA 2MQNA 2LA6A 2DISA 1K9MT 1NJIT 2LEAA 2M2BA 2DNGA 1VQ8S 3B4DA 1OO0B 2KYXA 2KM8C 1VQ4S 3H2VE 3G96A 2LMIA 4M5DB 2RVJA 2DNYA 4UQTA 3NNHA 5LSLA 3THTA 3P6YC 2HGNA 2DK2A 1VQNS 2X1AA 4C7QA 1KOOA 2NZ4A 4IO9Q 1UFWA 2XS5A 5IM0B 2X1GA 2DH8A 2K3KA 2DHGA 2XSFA 1VQ9S 1H2TZ 2DNNA 5IFMA 5DDOC 4WFBQ 1SJ3P 1U1RA 3BO3A 1N88A 1X4BA 2F9DA 1FHTA 3S8SA 1U1MA 1SJ4P 1VC5A 4PRFA 1H6KX 1U1PA 2MQOA 2SXLA 2CQ0A 4W92B 4C4WA 2MXYA 1ZZNA 3CUNA 2LQ5A 1DZ5A 2FHOB 4IOAQ 2CPDA 2KRBA 3MD1A 1VQOS 2M8DB 2DNOA 3IWNC 4F25A 2PEHA 1X4DA 3PIPQ 2DGQA 4RU2A 1OIAA 1JJ4A 4CIOA 2CQCA 2AYEA 4LJMA 3G8TA 2OTLS 5JVHQ 1IQTA 5DDPC 3J7ZT 3R27A 3R1LA 3I55S 1VBZA 1VQMS 2K8GA 3I56S 3P5TL 5DDQC 2J8AA 2ZJPQ 3MUVP 1WHWA 2MQMA 2QA4S 1R8PA 2CQBA 2MSSA 2CPEA 1JJHA 1AUDA 1XN9A 2EK6A 2DH7A 4J5OA 4WFAQ 3R1HA 1YIJS 2GO9A 3RW7A 1H2VZ 1X4HA 2LCWA 3LQVA 1PO6A 1X4FA 1VBXA 2MZRA 3CC2S 2E44A 3ZZYA 3MURP 1UW4A 1VBYA 2DH9A 2MSTA 3EGZA 2VODA 1VQ5S 3HI9A 3UD4P 3TYTA 1UP1A 1X4CA 2YKAA 3G4SS 2RNEA 1WG5A 1A7GE 2VOPA 1X5SA 5CA5A 4Y0FA 2ZJQQ 2FY1A 1QVFR 3NS5A 4LMZA 1N52B 2N7CA 1FXLA 1WG1A 2J0SD 2MJNA 3LPYA 2KXHA 3FEXB 2KVIA 1U1QA 2KI2A 1QM9A 2CQIA 2QFJA 3CC4S 3V4MA 2JVOA 2OJ3A 5DDRC 1S72S 3CD6S 2M8HA 2CQ1A 1WHVA 1DRZA 3SMZA 5CYJA 1VC0A 4PKDB 2PE8A 1X0FA 1D9AA 3UCUP 2MGZB 1WHXA 3G8SA 3CCES 2CQ3A 2E5HA 2N3OA 2HVZA 3US5A 3VAHA 1Q82T 2AYGA 3G9CA 3VAGA 1K73T 3JB9k 1A9NB 4Y00A 3L3CA 2KG0A 1WF2A 2J76E 1U1LA 1NO8A 3UD3P 1Q7YT 1WEXA 2CPXA 1F9FA 1U6BA 3J7YU 1K8AT 4TU7A 2DNPA 3BEGB 2GHPA 2OSQA 1N8RT 2DHAA 5BJRA 1D8ZA 3SDEB 1M5PC 1FJEB 2RQCA 2L08A 1X4EA 2RS8A 2DHSA 4YUDA 2MZSA 2RU3A 2A3JA 2MKCA 2LEBA 5GAEU 2MJUA 2U2FA 5GADU 1YITS 1W2BR 1U6FA 2CQGA 4C0OC 2YH0A 2KXNB 1FJ7A 2E5JA 5HO4A 2E5IA 2RUGA 2DGSA 1X5OA 2DO4A 1BY9A 1L3KA 1N54B 3ULHA 1WI6A 3CXCR 2M9KA 4F26A 4V19X 5LJ3Y 3RW6A 2KM8B 2DNZA 2MKIA 5GVQA 3S01A 4YB1P 4OZ0A 1HL6A 2DNRA 2CQPA 2F9JA 2CQ2A 1Q86T 2G4BA 2CPZA 2EK1A 4QU7A 1DHMA 5LJ5Y 2D9PA 2DGTA 4ERDA 3BS9A 2NLWA 5D78A 1UAWA 2KHCA 4W90B 2OSRA 3CPWR 2M70A 2DNQA 2LYVA 2VOOA 1KOHA 2B0GA 2X1BA 3CCLS 4FXWA 3Q2TC 3UE2A 2M7SA 3MD3A 2KG1A 2KT5A 1X5TA 5CXTA 2YWKA 1M1KT 1U2FA 2AD9A 2M4MA 1OPIA 2RRAA 3VAKA 3CCRS 2DNMA 2MMYA 2WBRA 1FT8A 2I2YA 5FJ4A 2LA4A 4CH0S 3HHNB 3CCMS 3UCGA 4QPTA 5GMKa 1KQSR 5LXYA 4IUFA 3NS6A 4WIIA 3BO4A 1RK8A 3CCQS 3CULA 3S7RA 5H1SV 1YJ9S 2DITA 2LKZA 1HA1A 2MKSA 3OW2R 2CQDA 1WEZA 3NMRA 5IM0A 3H2UB 4OZ1A 2MZ1A 2HGMA 3P3DA 5DETA 1H2UX 3Q2SC 5HL7Q 3NNCA 5LXRA 1U1NA 3TP2A 1VC6A 1WEYA 2ZJRQ 1X4GA 2YH1A 5JVGQ 4ZKAA 3MXHP 5GAHU 4CQ1A 3ZZZA 2CPJA 2UP1A 4LIRA 5GAGU 2M52A 2G0CA 2RT3A 3PIOQ 3P49B 1DBDA 4P6QA 1QVGR 2CPYA 1RKJA 3MOJB 4WKRA 2HGLA 3TO8A 2M88A 2KH9A 5ITHA 3CTRA 1WF0A 3CMES 2RQ4A 2XB2D 1B7FA 1JMTA 2MPUA 2CPHA 2BOPA 3CMAS 2OIHA 3NNAA 2OTJS 2G1DA 3SXLA 2J0QD 1VQ6S 3VAIA 3G71S 3CCVS 2DIVA 3THPA 2MQQA 1YJWS 2KRRA 1NU4A 1WTBA 1HD0A 4WCEQ 1FO1A 2DB1A 2MY8A 1U1OA 3MUTP 2KN4A 1O0PA 2AYMA 2FPHX 2N82B 2DO0A 3U1MA 2CPFA 2MB0B 1WF1A 1YTYA 3DLLQ 2M0GB 4TU8A 3VAFA 4QU6A 4A8XA 4QQBA 4UY8T 2HYIB 3MUMP 1SJFA 2EVZA 2F3JA 2BZ2A 5LSOA 1M5VC 2ERRA 4F02A 3N9UC 3CF5Q 2CJKA 1SJQA 2L9WA 4BS2A 2AYBA 2D3OR 2X1FA 2DGOA 2XS2A 1VQ7S 2MKKA 1X4AA 1OWXA 2XNQA 3UCZP
chains in the Genus database with same CATH superfamily
4PEOA 1FDDA 4JI1J 2MHNA 5EHHA 1R8CA 3M32A 1EARA 4M94A 1SI9A 2PFFB 1HWUA 3ZFVA 4ZVFA 4OI6A 7FD1A 4USTA 2B43A 1NJYA 1N5SA 6FD1A 1IBMF 3Q8SB 4U95A 5IXUA 1K47A 4EEYA 3AOBA 4HR2A 1P1TA 2HNYB 1H73A 1REVB 1S6PA 2HFZA 2HQ3A 3HP6A 5F8JA 4NLWA 1V3ZA 4CLTA 3PHTA 4ZCIA 3HHEA 1HPZB 3ENVA 4EK2A 4RZRA 4DQIA 1ZH5A 1FRMA 5IQQA 3EGNA 1K44A 1OYEA 4RW4A 2ALZA 2POKA 4X4VA 2CQ4A 2LECA 1C1CA 3CJ2A 4FPIA 4OLPA 5F8HA 2EFNA 1S0NA 2E1PA 1X7VA 3W9JA 2LEAA 4URQU 1XTZA 2B9XA 1ROFA 2LMIA 4LFCJ 3H40A 3ISNC 5I42B 3WC0A 3W66A 4P10A 2AKWB 2UUBF 5IFMA 1WC6A 4PWDB 2EFOA 3M6UA 4ZP7A 1RT2B 5F9LA 4X2BA 1XK8A 1JLCB 3N0VA 1HWKA 2MQOA 3UDVA 2Y9HA 4HHHA 3J80Y 2W1BA 3KG1A 4F3QA 4PPDA 3QWUA 1MN7A 3OFGA 1DQ9A 1S57A 4E2FB 5IWAJ 2ACMA 2PEHA 3RAXA 3CJ0A 5LM7E 1GTEA 2AYEA 3D6FB 3KKFA 4U8YA 1HWJA 2PT0A 4OYOA 1VBZA 1LFWA 2ZH1A 1MMLA 2J8AA 3MUVP 1N4LA 3BSAA 1JJHA 3B78A 1HNWF 4O3SA 1S6UA 3ZNJ1 1TVRB 1H2VZ 2DXFA 2CNKB 1BQNA 1KDNA 3FBEA 2ZNYA 1VBYA 3HVTA 3I31A 4LBIA 2V63A 3G8QA 4ITSA 4XIUA 4BHQA 1LXNA 3BB5A 3H5SA 4JYAF 1KQGB 2JEFA 4Y0FA 2RSQA 4K4YA 4IRKA 4FKXA 2BKOA 2CJBA 3N5BA 1R0AA 1X8DA 2ZBIA 4PQUB 1WUUA 3GR1A 1REGX 1N0VC 4JI6F 1NSQA 3ZZ0A 2QFJA 4QW9A 3BBCA 1FTCA 2ZBQA 2MGZB 1NEEA 3G87A 3MFIA 5CZVA 2WZ1A 4Y65A 4KIAA 1CG2A 1LW2A 4PG6A 5KG4A 3FNNA 1XR7A 5GAHI 2F65A 4L6V3 3QT8A 2HKEA 2JHEA 1NNDA 3MR5A 1URRA 2LEBA 1ZM2A 3TZZA 4JV2A 3TAMA 4LFAJ 1RT5B 2R7WA 2CQGA 3OFEA 1JLAA 3AT1B 3OQ2A 1N54B 3KLHB 2GIFA 5LT5A 2HAFA 1BD6A 2ILZA 2IVYA 3KXDA 4ID5B 2HWTA 4QU7A 4WU3A 3C6TA 3DDNA 2ZD1B 2J9CA 2VOOA 1FRHA 3T1HJ 3NMAA 4FXWA 4F0HA 1FX2A 1T94A 1TUVA 1XERA 1VQSA 3UCGA 2K1RA 4ED0A 2F63A 5H1SV 2AP6A 2VG7B 3LOUA 2FJWA 2CQDA 4DV1J 2FVCA 1U0HA 2MZ1A 1PAUB 3FK4A 3UR3C 4V19J 4WYWA 2BQUA 4XO0A 3GG0A 2B9EA 1PYSB 3QGHA 1FTRA 3F41A 3HLUA 4RWWA 2E5LJ 1SB6A 4WKRA 4LRFA 4DFPA 1RTZA 1MU2B 4IDKA 1EZZB 2WK4A 3BPSP 4O23A 5DJBA 3L95X 5IQ6A 3OTBA 3TR5A 2M0GB 4YDXA 4ZVGA 4UY8T 3MUMP 2F3JA 2PGCA 5A8RB 3MM9B 1RA6A 2XS2A 4XPEA 3Q8UA 4Z2XA 1HIYA 2CADA 4ECSA 4CO4A 2VIHA 3BN7A 4MFBB 3M8QB 4ANEA 1GTHA 2OEKA 3SFUA 3RBEA 4HYKA 4MIAA 1OS5A 1JLEB 4DPXA 3AODA 3I82A 2UVWA 4JV1A 2V0NA 3W2WA 1O6XA 5E3RA 3T5HA 2JL9A 4PG4A 4NLYA 2EFGA 3OPKA 4DZ6A 1CJVB 2D69A 1SUQA 5AJ3F 3UQSA 3KLIA 3BKTA 1HD1A 1WELA 2DJWA 4KV8B 2CQHA 3FSYA 4ILLA 4CNZA 4FYVB 4Y2CA 4IQXA 4J9UE 1Z1ZA 4FYDA 2ZC4A 4LF9F 1RT3B 4ZPWR 2ACYA 1OO0B 1TL1A 4B9MA 1FDNA 5D4LA 2EC0A 1J5EF 2UXCJ 4DR7J 3W3SA 3THTA 1CJUA 3VV2B 4KHPJ 4OJHA 3C3LA 1WDTA 4K4ZA 4DR4F 1P8GA 2V8VA 3MM7B 4J9QA 1OY6A 2IA0A 4X66F 1X4BA 4IO1A 3K58A 3UW1A 4PRFA 3W2VB 4KAIA 1NK9A 5IT4A 1TKXA 4B3SJ 2MXYA 2EC2A 2W4PA 3AAWB 3BSOA 4PXBA 2NPFA 5A2QU 3H42A 4LF6F 1FNOA 4RPFA 2QSFA 3CDEA 2YNIB 3KUGA 4OYBA 1TL3B 2WB4A 2UV8G 1VQMS 3U02A 1ZAWA 3DGPB 1RXOB 2EK6A 3BN4A 1FWPA 2R7TA 4LF4F 2ZUAA 1HNXJ 2FLNA 2Z4PA 2LXFA 2EG2A 1QY7A 2G2YA 4B3OB 4K4WA 1N34F 2W01A 4FP9A 5EGYA 4NWBA 1VMBA 3SQOP 3HI9A 1VHFA 3OSPA 4HHJA 4DR1F 2YNGA 4J9VA 4L76A 5F0UA 5C5JA 2MJNA 2XGPA 2PFDA 2R7OA 2CQIA 1RCXB 1LFPA 1RBOB 2PN6A 3CD6S 3RRHA 5E7OB 3QZ8A 1DARA 4RR5A 1T11A 1WKKA 2FJBB 4CDIA 2ZNZA 5B0GA 4JI5F 5KFOA 4TY8B 5F8IA 4ECWA 4I6YA 1DTTA 1CJTB 4WP8A 4CI0B 1UZDA 1WF2A 1RU2A 1ITPA 1WC5A 2VDIA 1BWEA 3KJFB 1HQEB 2M3DA 2UUCJ 3EGWB 4KB7A 4I64A 2IRXA 2XG8A 3NCRA 4ATNA 3T1YF 3K5PA 3OTCA 2YQ0A 3ENWA 5H9EK 2BOAA 3QRQA 4A8KA 4CYUA 1M5HA 2E1RA 4DUZF 3UNGC 2W8KA 2YY3A 2NUHA 4P2FA 2F9JA 2GGPA 2VJVA 1I6JA 3RTVA 3K5OA 5FDLA 3PO5A 2M7SA 3MD3A 5LMUF 2FVQA 2ROEA 2RRAA 4X65F 1NK6A 4B9LA 3CVKA 2WBRA 4EUVA 5KT3A 4WTOB 3V6JA 3ZZOA 5IV4A 2QFIA 2BE9B 3CULA 2KDOA 2A0FB 4O4GA 4F4ZA 3FUYA 2ABYA 2HHWA 4OZ1A 2KB2A 3J7A1 3PW5A 1Y9OA 4JV0A 3IWLA 3KLEA 2HMIA 4OX8A 1Z2ZA 1ZTTA 2KYZA 2W2QP 3M8PA 2G0CA 1EQMA 4J7CA 4BWJA 3DLGB 4KPCA 1NK0A 4ZCKA 2XMAA 2UXBJ 1AZSA 1K1QA 3CW2C 4X4UA 3DOMB 3GU0A 1NK7A 4NYZA 3C6UB 1P6TA 4LRDA 3KK3A 4BBYA 1XQIA 3RRGA 4N5SA 5AE3A 3MR3A 2AYMA 3BKFA 5E5NA 5HK4A 2AMCB 2HYIB 3QLHA 2ERRA 4B17A 3N9UC 5RUBA 4NLXA 1RLCL 3V4IA 1VI7A 2W9BB 5J2MA 1FJCA 2V50A 5J1EB 1TAQA 1WC0A 4CM0A 4QR1A 1F5AA 5J1PA 1SXLA 3TJ9A 1H38A 2EXUA 1QD1A 2RILA 2YWWA 5MLCV 5DGAA 4C8NA 2WW8A 2RAQA 3PW2A 3I0RB 3SSQA 5A0YB 1U7LA 3QJPA 3UWTA 1RP5A 5D3GB 2ADCA 1Y5IB 1XJWB 4ZVTB 4B3TJ 1T0TV 5T41A 2VC1A 2HHTA 1GNKA 4USJC 2JEJA 4ALZA 5JJBA 1FNXH 3ZTRA 2C2MB 2O01C 1KR4A 1H3DA 4MK9A 4CO5A 3OTOJ 3QFHA 1WOPA 1B70B 1PC5A 4X62J 4ZA1A 1G1XA 1TAUA 3AA9A 1C1BA 1JLFB 2A18A 3Q8RB 4JI4F 4L74A 1SV5B 2I5JB 2ZWPA 4I6WA 1AT1B 1SQEA 3I96A 3VQSA 5L46A 3TVZA 3DXSX 4FF2A 4IO9Q 1XMQF 2RQKA 3M8SA 3H2LA 2DH8A 2CWKA 2QA2A 2F9DA 4B08A 3M2VB 1SJ4P 4ED7A 2HNDB 3BPDA 4WK3A 3I4HX 3V6DB 1DAXA 2DCUB 3DLKA 4KGVB 1HNVB 1C4CA 4IOAQ 1VHIA 1YLXA 2YNHB 1S0VA 1X4DA 4RU2A 4WJBA 2B4PA 4GC6A 3DOKA 4XDDA 4M5KA 4K4UA 3P5TL 1WHWA 1N0UA 3I0SB 2NXCA 5DQIA 1KQKA 2J6SA 3CJ5A 2JLEA 1UJ6A 5C24A 2CUYA 1YIJS 1UW9A 2H65B 2RMLA 4TLRA 4RLEA 1NHVA 3IBCB 2DVIA 2E44A 1L5UA 2PSZA 4I7FA 4L75A 4C8KA 3GILA 4IFVB 2ROGA 3VWSA 1LKZA 2C2OB 1BE4A 4TKTA 3FSXA 1N52B 3ENQA 3KYLA 4QWAA 5IT0A 2N4DA 5CYQB 4ER8A 1NKBA 2BV3A 1U1QA 4DUYJ 3IAM9 1MWZA 1TL5A 3EXYA 1RHKB 4A8SA 2LQ9A 4PAAA 4X64J 3IG1A 5KT5A 3PYDA 1LWCB 2QG9B 2BJ1A 1KRPA 2IY5B 2J7KA 5MAOA 2NR0A 3RG6A 3EVMA 2N3OA 3OT9A 2NSBA 3LWLA 1FFGB 2UXDF 3JXOA 2A2DA 1ZBTA 4FS2A 3AB4B 1U6BA 1VIXA 3R97A 2YWFA 3GCXP 4GKKJ 5HI7A 1TKTB 2DHAA 2GQQA 2V69A 4LF1A 1CEZA 5ETQA 1NDCA 1NH7A 4DI6A 4HDHA 3PACA 2KXNB 2YH0A 5DG8A 3BV8A 4H4MA 4ECXA 4PPZA 4I68A 3ULHA 2COLA 3RW6A 3VGTA 3VGSA 1S4FA 3F56A 2IJRA 5E3CA 3FFIB 3KNGA 2M70A 3ISND 3QMQA 1S9EA 1RTJA 2J5AA 2FLOA 1MSWD 3SSSA 3VAKA 2X3DA 2JDJA 1PYTA 2HEKA 2HNZB 4RW6A 3ICLA 1RHJB 3OFFA 3CCQS 2HW3A 4CLKA 4U96A 2MKSA 3R5JB 1SQGA 3PTWA 1MMDA 2CZ9A 3H2UB 4CH7A 1IUJA 1F3FA 3ETMA 2DXEA 3H8YA 5LXRA 3D1HA 1IBKF 5KT2A 5HP1A 4A8WA 1DBDA 2R2TA 4ECZA 1VQYA 4B3RJ 3C19A 3N28A 1KNZA 4AL7A 4ZS6A 5F8NA 1O5JA 3FMBA 5C42B 3C14B 1TK8A 2X7IA 3MUTP 2KN4A 4LSNB 3KK1A 3M30A 1O51A 1QTNB 3MM5B 2AGQA 2E1CA 4L3NA 4A8OA 4I6AA 3EWGA 3TZXA 3N5FA 2VQEJ 3NKYA 4TQRA 4I1TA 1S1XB 1SKUB 2VL1A 3DMJA 4ZJLA 3QO9B 2B5JA 2JZ5A 2HZCA 1RT7A 2E5GA 4YHHF 2XULA 4ZP6A 1VQPS 2AGOA 2ADBA 4HTIA 3BSNA 2WBMA 1FK9B 5DG9A 5KTQA 1URNA 1S1UB 3FEYB 3J7AN 3MGJA 4ZPCA 2DT9A 1ZPWX 1JJCB 4WWSA 2XS7A 3K5NA 2PMHA 3K2YA 3OL6A 3GLJA 4LR7A 4EGLA 1V9OA 1GMWD 2EFPA 2FTRA 1BHNA 1Q8KA 3BBBA 3K0JA 4OLOA 1YI2S 4LF8J 4ZPVR 4X4TA 2MZQA 1FEEA 2JRSA 2LA6A 3K5MA 3M9MB 3I4PA 1TL7B 2K7KA 3KTQA 3WZ0A 2CNNB 1BQMB 2V4RA 5HBMA 1I5OB 3HHKA 1FKAF 4JI2J 3LP1B 3R5AA 4YFUA 4AL5A 1KOOA 4LREA 2NZ4A 2XHWA 2L3MA 3P96A 3L7PA 2XS5A 3OXFA 2R7SA 2B8PA 1I51B 2UVVA 3MEKA 1N88A 1GK8A 4KRWA 2HHVA 1W25A 1R6YA 2XYHB 2SXLA 4DR2J 1NDKA 1IKXB 2RRNA 5U47A 4HI1A 2W24A 4CLYA 3MCSA 2CAJA 1HI0P 1XIQA 2VASA 3BR8A 3A3PB 5EDWA 3IWNC 2HBRB 2H5IB 2QL7B 4DU8A 4GVLA 2XLJA 3I9V9 4R8UA 2ZJPQ 2L9DA 1NDPA 2CQBA 1R6VA 2W9CA 1M1GA 1LNQA 2P6SA 1XN9A 3CCWA 1C4AA 2F40A 3CJSA 3RW7A 3KJVA 1JNRB 2J6TA 4EZ6A 3GZ7A 1MNEA 3NY0A 3H25A 4C9DA 4H4OB 2LFVA 3FDSA 4QW8A 1UP1A 5LMNJ 2VG5B 3QIDA 3G4SS 2IM2A 1R8BA 2E9RX 1Y4ZB 2PMWA 4RNFA 1L3VA 3NOCA 5F3TA 4DL6A 2KI2A 5IZHA 1ZYQA 5G0RB 3HSDA 2HHPA 3O2IA 2V2KA 4Y2IA 2H5EA 2ZH8A 2FYXA 1GFWB 1FDBA 4NLGA 3GE9A 1S6QA 1N36J 3VAHA 5KT6A 2VPWB 1WEXA 4F50A 3RRKA 4DSEA 1NRKA 4RW8A 1S0MA 4KKOA 5H9FK 4WE1A 2L08A 1LQ9A 2RS8A 1RACB 2RU3A 5BYQA 2NPIA 2NYHA 2IYIA 2MJUA 3BR9A 3O5TB 1UTAA 3IBWA 2V6AA 3DC2A 3T19A 3ZC4A 1NSPA 2G1HA 3FEZA 3BDEA 1PJ5A 3R7BB 2GVZB 3LANA 3CPWR 2VPXB 3THVA 2MTLA 1X5TA 5CXTA 3MM8A 1U2FA 4IFYB 1JKHA 3HD2A 2AIRB 4NLQA 4ILMA 3A8EA 3POTB 1HA1A 4CRJA 3OTDA 5D0HA 5DZ7A 3PEJA 1AYEA 2VB6A 4DF4A 2Q6CA 4JI3F 3ZO7A 2NZCA 3Q8VA 4P7VA 2VV5A 4G65A 4DL7A 3EICA 2BJ9A 3GV7B 3DFEA 4DDFA 2A1BA 1S9FA 2YKPA 3WC2A 3QYYA 1FXDA 3M8YA 4B9TA 3OR1B 4AT1B 2RKIA 1JLBB 3O44A 2BE2B 4DV4F 2FB0A 1HI8A 3VVUA 1DY3A 5KT7A 3G6VA 1M5KC 4OV1A 1FRLA 4L3KA 3L7OA 1SKSA 5HROB 4OI2A 3LP0B 1UVLA 2XSJB 3B54A 2OPPA 3NGDA 2YKMA 3I5CA 4FVMA 2ZM6F 2XNRA 1I94F 4WF9Q 5A8WA 4CO1A 2RQMA 2FC9A 4KHMA 2ZOFA 3AB2B 5LL6d 1JJ2R 2ZVSA 3MMJA 2GAHC 4L72B 2R8KA 2V8DA 3CD0A 5ETOA 3DDKA 1RLDA 4KPYA 3SCLE 2DGWA 4OZLA 2KJWA 3I5AA 1J5OA 4CLPA 3IS9A 2RD5C 1KD1T 3FBCA 3TA1A 5KG1A 2Y1RI 3B82A 2PMZD 1R8HA 2W7OA 5D4OA 2WSFC 4QCLA 4FXVA 4A4JA 3Q8QB 4NZ7A 1GEHA 4Q8EA 1RYSA 4DXLA 4DR6F 4DQQA 2KYXA 2KM8C 1U2CA 5K8PA 3H2VE 1VS3A 4Q45A 4U7UK 2YX4A 1V3SA 1HFEL 2JSXA 5AE1A 2XHCA 2AZ1A 1S9GA 3ZZPA 3MR2A 4WIQA 1YBTA 3UVJB 4J90A 3MECB 2XLKA 2HK2A 1G7CB 3I87A 2W25A 3MAQA 3GV5B 2NQPA 2P9GA 1X9SA 2HURA 4LQ9A 4I4BA 3OTEA 4HH0A 1JNZB 1FRJA 1OPZA 1BMQB 4N8OA 5EWGA 5KFCA 1FF2A 3J7YI 1XMBA 4DFMA 3X3UA 1CBKA 2CDRB 2CWXA 4OMFG 5I3QA 4NXMJ 1CS4A 4MMOA 4M5HA 1MROB 3R1HA 3RBZA 2DRBA 3HSZA 3VGVA 2W9AA 3MEDB 2KHDA 2ZH4A 2DR6A 3NGTA 3MMAB 3EGZA 4ECUA 3G82B 3C15B 1W7WA 2GS8A 4DQPA 1IKVA 1WG5A 3TAQA 4K4SA 1D9FA 4CO3A 2N7CA 4DV0J 1U24A 4H4KC 4ETZA 3MPYA 3TUJC 3KUHA 1UETA 4WYLA 5A8KB 5HMZA 2HRYA 3DRRB 4J37A 4D3GA 1S72S 3MPWA 4QIFA 3T1AA 5CYJA 1VC0A 1IBLF 4HT5A 3UCUP 1WHXA 3G8SA 1UWAA 3GYXB 3Q86A 3NAHA 3HDSA 4JI0J 1WOOA 4JI1F 2DTJA 1U1LA 1B0PA 1FWLA 1QJHA 1M5PC 3W9IA 3KNAA 3MEGB 5KFMA 5K14B 3I6PA 4C98A 5KFIA 5GAEU 2OLWA 3QJLA 2CG8A 4V1Ak 2E7XA 1NZAA 4RW7A 5LSRA 4NEYA 3GJQB 3CXCR 1BLUA 4F26A 2AJ0A 4F4WA 4YB1P 1RT6A 2WCXA 2CQPA 4DL4A 2BM1A 1MU2A 4LBPA 3CCLS 1PAEX 1VIOA 2KT5A 2HHUA 4YEAA 2DNMA 4J9PA 3B8HA 1C0TA 3OUYA 2F4FA 1F3VA 5HQLA 4WIIA 1RK8A 4TVAB 1U6ZA 3ET6A 2FLLA 1EX8A 3D0GE 3ZZUA 2R9LA 1S12A 2H48B 1VC6A 3QNWB 2KTQA 1X4GA 5JVGQ 4ZKAA 1S7HA 2NXUA 2F8HA 4LFCF 2CPJA 2M52A 3PIOQ 3QIPB 1AROP 1HNZJ 2JOQA 2G0JA 3FSIA 1FFSB 4GVBB 4ANDA 3CTRA 1GMUA 3LAMA 3KJNB 4GO5X 1DLOB 3NNAA 4RJVA 5B0CA 1TZ0A 1MWYA 2WSCC 1FXRA 2KRRA 2YKQA 1WTBA 1VFJA 3CJKA 5D15A 2ASLA 5KG7A 3K59A 1SJFA 5CHCB 4E0DA 3ELHA 1NPRA 4QR0A 2R7QA 4S0MA 1TKZA 5IWAF 4MH8A 3UCZP 4Q0BB 2KVQE 4DOZA 4DR5J 4DLEA 3VVTA 5AE2A 1KQFB 4ZIWA 1S59A 1UA1A 2CPIA 1XMOJ 3TX8A 4LR9A 4RU9A 1QAJA 4I56A 4ED5A 1ZM9A 5L1JA 4RKUC 4ZOSA 4JI7J 3OHAA 4J9OA 3A3NB 2VQFJ 1HQUB 3SI8A 2E66A 4RUHA 5J2QB 4LVNP 1FA0A 4O3QA 3FQKA 2MZTA 2XBPA 2ZC3A 1HBMB 3GV8B 4B9NA 3VAJA 3P45B 2MKHA 4DX6A 1M5OC 3PM9A 7AT1B 4PQAA 1RWPB 2DBBA 1PSDA 4DZDA 2C3MA 3SDEA 1LK5A 4F3MA 3PDNA 1H74A 1FDAA 4RNNA 3MF5A 3KK2A 2VONA 3P4UB 2MQ8A 4JV5J 4UF4A 4F4KA 2IM0A 1GT8A 5IOLA 1FVSA 2DISA 2IM3A 3K8WA 2YKNA 3MTKA 2V8GA 5HLFA 1VQ8S 5I4MA 2OMLA 1CJKB 2RVJA 3A13A 2MDAA 4JI6J 4NI2A 2BXJA 2RHQB 3G86A 4C7QA 4GKJF 3AA8A 1Y3KA 4LFAF 2BJ3A 2DHGA 3QBCA 3NAIA 1H2TZ 1H98A 5DDOC 2IRYA 2WONB 1VC5A 2AF6A 2XZTB 3H20A 2C3OA 3AJ1A 1JX4A 3MOZA 1QUVA 4D3HA 3HFKA 2HFUA 4LSLA 2LQ5A 1VGYA 2WOMB 3GPAA 4C8YA 3MD1A 2AZ3A 1S1VB 2NYIA 3R27A 5J2NA 5DDQC 3PKYA 1RAAB 4DV1F 2C3PA 3H5XA 4ELVA 2B4OA 1X4FA 2MZRA 1EJ7L 2YQ1A 1YG0A 3RB0A 4MKBA 3R7NB 1E6VA 5KOWA 4RUAA 5C2CA 2IM1A 1X4CA 2V5HG 4P72A 2J0SD 4USUA 3V6KA 1QLNA 4DSJA 1ZTWA 4ZVEA 3HMJG 4OHZA 3BBFA 3W9HA 2OJ3A 1WHVA 4KGMA 2XEXA 3R5BA 4LF5F 1S6PB 4P52A 2WTFA 3TI0A 4M5MA 3UI3A 1F0XA 4IG0A 4P2MA 2PD1A 1UZHA 4EWTA 2J76E 5KFFA 1NO8A 4I2PA 1VRQC 4M95A 3PR4A 1N5YB 3H98A 5AT1B 4ZHRA 4RW4B 3EZ5A 1QAYA 3J80U 3DRPA 1C1CB 1FI4A 2WVFA 4HTJA 2ROPA 4DFJA 1RWMB 4KO0A 2QO3A 2E5JA 2XY6A 2VFTA 1X5OA 4MTPA 5LJ3Y 1HL6A 1CC8A 5E41A 4ERDA 3BS9A 2FZCB 4J91A 2ATCB 2HLUA 2C2RA 4NLDA 4PYDA 1YJ7A 3CWJA 2KG1A 1S76D 5E3AA 5I3PA 2C2ZB 1N6QA 4QIWD 2AQ4A 2D74B 1D1UA 3CGIA 5LXYA 1T9XA 1GXUA 4LVOP 3NS6A 4NCAA 3CT9A 1HLWA 4KGXB 3RBDA 1X9WA 5IM0A 1Y11A 4M1KA 4ZCMA 1AA1B 1Y7PA 2W9BA 2R8HA 2DD8S 3TP2A 2ZJRQ 2FZKB 1A6LA 1YRXA 5GAGU 1T05A 4DR7F 2RT3A 1YGYA 1WORA 4P6QA 1RCOB 1NAQA 4F2RA 5HMWA 5AJ3J 4X4PA 2YX1A 2Y1IA 2J0QD 3VAIA 1HBNA 1XNRJ 4DEZA 2IDLA 8RUCA 1EAYC 3HVTB 3MR7A 1RE1B 2XI3A 2MHEA 2CPFA 1LXJA 3SZ2A 5T7LA 2FIUA 2ZBRA 3QRRA 3V81B 1S5ZA 2EW9A 3BH7B 1R0AB 4DR4J 3PRBA 1RTDA 3UN2A 1U2RA 1RTHA 4Y3CA 4K2XA 3JYTB 3KLGA 3T9ZA 3BO2A 3TVYA 1OJ4A 1SBRA 3M8WA 2BQ3A 5DM6Q 3UN5A 1MG7A 2BA9A 1HNIA 2ASDA 3IR7B 1PILA 1YJNS 1S6OA 2KZZA 4K5RA 3TZYA 1LW2B 4FKYA 4KY3A 4MKVA 3AXMA 3DLEA 4B3MF 4LF6J 3VALA 1SV5A 2VBYA 3OLAA 1YQHA 4FXDA 3DU5A 3RR8A 3HVRA 4TU9A 3G6ES 2HHHF 3TAMB 1EP4A 1WG4A 2LLZA 4LF4J 4DV6J 4CH1A 1VQLS 1JLAB 3C46A 3W61A 4OZNA 3MPDA 2O66A 2QYGA 1WSRA 4TYBA 3S1TA 4C11A 2RJZA 3C6TB 1KVIA 1E6YA 2V4JA 2JX2A 5J2PA 4QWCA 1GXLA 2M5YA 4CLWA 5AXLA 2MQNA 3D5MA 1ACMB 3DYAA 4BWMA 3TA0A 2K1RB 5THWA 3H90A 4ZLLA 1U0HB 1U1RA 3PX0A 3QQCD 2RH3A 2VF3A 1H6KX 1UEVA 1NB7A 3ITHA 4W92B 1R8AA 2R7VA 2HS4A 1X60A 2E1MC 2W2OP 3WX8A 4IDKB 4YMEA 5KFSA 1GMWA 1NPKA 2GVDA 4UTGA 5BR8J 4F25A 2R7UA 3PIPQ 1OIAA 4I67A 2ZE2A 4CIOA 2B4VA 3J7ZT 3HHLB 3HD1A 3GIKA 1R3NA 2IVMA 4ZPDA 5C7PA 1WTFA 2GO9A 5HQMA 1VYAA 2LCWA 5CCMA 3PW4A 2H5JB 5G4DA 4AUKA 4P2SA 4X65J 4ID8A 3Q22A 4P75A 3FJ2A 2UXBF 2VOPA 4KSEB 1B3TA 4YQWA 2HBYB 3OR2B 2R8GA 3NS5A 3UFCX 5GMDA 4NA2A 3HX9A 3K17A 3CC4S 1EETA 2RIJA 2VDHA 4M8LA 2M8HA 3D4JA 3FRZA 3LGNA 3AJDA 2PE8A 3OVAA 1U45A 3W2WB 1WD6A 2MLZA 2E5HA 2C22A 3MMCB 2VPYB 3VAGA 1XWLA 2KG0A 1UMJA 3JSMA 2Q6BA 5ETRA 4LFBF 4CM2A 2PO4A 3RYLA 1ZETA 4ZVQB 4TU7A 2GHPA 4QJVA 2CIMA 4NLUA 3F0NA 1SC4B 2AT1B 3EE3A 1SUQB 3KLIB 5DZ6A 3T41A 1FJGF 2EFVA 2YBVA 4MIBA 3HM9A 2GV1A 3K57A 4O3NA 2E5IA 1OSCA 4LSZB 5KFVA 2QX0A 4RBUA 2HFVA 3QT7A 1SJ1A 1N48A 4DN0A 1XBWA 2MKIA 2QRRA 5DRKA 1EB0A 3WIUA 1TL1B 1Q86T 2V8PA 1F2HA 4B3TF 1CJUB 1UAWA 4XTTA 1T9TA 4CO0A 5L38A 4NPOA 3VZIA 4RUBA 2QJ3A 2X3GA 2YNFA 5FLXY 3NBPA 4KGKA 1IKYA 4DFKA 3TQEA 2LA4A 4JB8B 2R2SA 3RB6A 4ZPBA 1WKJA 2Z2YB 3D3BJ 3LP2A 4X62F 3OW2R 4MK7A 1TKXB 2VKRA 1TMMA 3H5UA 4FN5A 3HF5A 1U1NA 1S1XA 3QGGA 5KFQA 2QA1A 5GAHU 2XY7A 1XC9A 1OYDA 4E98A 4MIWA 1LEOA 5H9EJ 2BOPA 4ZVPB 1XNQJ 4C8ZA 2GQ2A 4RNOA 2DIVA 2ZWOA 2PIIA 1A0OB 1AXQA 2LU2A 3A8JA 2IRUA 4JI4J 4PG5A 2R7XA 4TU8A 3IXQA 3HVWA 2CJKA 4CCHA 2Y0BB 3M6XA 1X4AA 3KHLA 2DY1A 4FF1A 4ED3A 3UO0A 3JQKA 4JI8F 2PI5A 2QLJB 4DCOB 2K06A 2B8QA 1RBLA 2FHJD 4IOBA 1FRKA 3TVKA 1KC8T 2KFYA 3HHLD 3D6MB 1G2EA 4IRDA 1Y5NB 3DCAA 1DTTB 4CLSA 4JOUA 4OZ5A 1RABB 1X5PA 4MKAA 1BWVA 1JLQA 3FMWA 3GFZA 2XCAA 4GC7A 2DNKA 3D0IE 2HK3A 4O3OA 5LOQA 2LEPA 4R25A 4CYUB 1L3SA 2N3LA 1UEKA 4M5LA 3WX4A 3CCUS 1R0BG 4X64F 2NSCA 4DQSA 3SV3A 2BRKA 4ZJQA 1S4EA 2GGPB 4C0HA 1VCTA 3DN9A 3LW5C 2XZWA 3NCPA 5FDLB 4DMZA 3IRWP 4ECQA 5F8MA 2DNLA 5HVHA 3QPIA 4EI2A 4LF7J 2I9SA 3F44A 4F2SA 3SSRA 4QYRA 2VFSA 3D28A 3G96A 3BGUA 4MKYA 3IM9A 2C2NA 2KJVA 4OZJA 3U7JA 4HL9A 5D0RA 3M6VA 1B0TA 1RHMB 5K20B 3S8SA 3KLEB 3PFEA 2HMIB 1YJTA 3OL9A 1UFLA 3ZTPA 2UXDJ 4YB5A 1VLOA 1RTIA 2ZFHA 3M8PB 4DLGA 3NGSA 2OFHX 3O8WA 1CC7A 5A76A 1AZSB 1XEZA 2XZDB 3LPEA 2FHOB 3K89A 3KK3B 3HHDA 2CQCA 4ES3A 1S49A 2IAJA 3KLVA 1ZM4A 5E2QA 2OPRA 3MCNA 2P9EA 3D54A 1RSCA 1HR0F 3UD5A 4F04B 4HACA 3QLHB 5GADI 1HWIA 2JEIA 4QIEA 3T6BA 3V4IB 1U8WA 1X4HA 1FD8A 1U4BA 3C16A 5J2MB 1T9WA 2BANA 2EEYA 2J9DA 5L1LA 3R2DJ 1C0UA 3DHXA 4B3RF 2QL9B 4LMZA 1WG1A 4EO6A 4FF4A 2KXHA 5CH7B 4X4OA 2D3UA 1IBKJ 2B7BB 3JAMY 1ZPVA 5CYMA 4OHWA 1NHUA 4DX8H 3BQ1A 1FWKA 2QSWA 4GMKA 2LVWA 4HH1A 3EVOA 2DHHA 4UW2A 3SQGA 1RAJA 1RZMA 1HWLA 2HQGA 2P5VA 1X4EA 3BGRA 5I3UA 3EPIA 4QIGA 2CZVC 3KG0A 2VHGA 3HK2A 4USVA 1NXIA 4BCAA 4F0KA 3M9OB 3NLCA 4DS4A 1BY9A 1L3KA 2D3O1 3MEEA 1CLFA 1UJ4A 4FS1A 2XQCA 2JC0A 4OI4A 2CQ2A 4P7TA 5LJ5Y 4O44B 3I9ZA 4F7VA 2X1BA 3PJ9A 3MAAA 3ETOA 2AD9A 1RAHB 5FIIA 1NJXA 2OPSA 4YR3A 2VA2A 4R5PA 1IQZA 1LWEA 3LH2S 2JLGA 1QSSA 4HI2A 2IMWP 4LF8F 4NLRA 3DLKB 3T5LA 4C2MA 1JLBA 2CYYA 1ZOTA 2BE2A 3TUPA 2EBEA 4CTAA 2BR0A 2HWHA 4B9SA 3MXHP 3ZZZA 1PJ6A 4OYPA 4P2XA 3DOKB 2CPYA 4JI2F 1S97A 3OHBA 2M88A 3SFGA 3KHRA 4TY9A 2N7YA 1JMTA 1JIHA 2AU0A 5C24B 1NK4A 1UCNA 3WIVA 4DF8A 3CB4A 2ALYB 3I32A 3D9BA 3J81Y 1U8SA 3R7SB 2BBEA 4AL6A 1YTYA 1GX5A 4DR2F 4A8XA 1IR0A 2CJ9A 3HSGA 4OV6A 4BS2A 3MM6A 3DI6A 5KFDA 1Y3JA 1JLGA 2DRDA 2D3OR 3DOLA 2D3ZA 1Q81T 3B4MA 1WWHA 2VBZA 3HZGA 1K1SA 3W5XA 1RDRA 1HKAA 1FRIA 1TKDA 3ILIA 5IT9Y 1YZ6A 4LIWA 3GIJA 3IG1B 1HARA 2QLXA 2XYPB 4DPTA 2QV6A 3M2RA 1FKOA 4AXIA 2V2VA 1RWNB 3VQTA 1QTMA 2L41A 4ZLPA 5D77A 2D41A 4G1QA 3TJ8A 1JB0C 4DR3F 2R4FA 4DSFA 4IOCQ 2PA3A 3CJTA 4KT0C 4N8NA 1NH8A 1BUXA 4X4RA 2O67A 3H59A 3TUZC 3OLBA 1X9MA 2JVRA 2I8EA 4J9KA 2HLTA 2DNHA 3ISZA 4NCGA 5L1KA 4H54A 4H4MB 2DCLA 2BJEA 2HS3A 3KDOA 3D68A 3PRDA 1SQFA 2I1RA 3S6EA 1JK9B 3JSBA 3DKDA 1N33J 3ZTOA 1N36F 1Q5VA 4OYXA 3SEOA 3EZUA 4UQGA 3MHYA 2FDNA 1S9EB 1RTJB 2VZ9A 2K3IA 3AJ2A 1H7WA 2FUG9 2YXLA 3QSYB 4RW6B 2R8IA 2Q66A 4W4MA 3SIPB 2BW7A 2BMBA 2MLYA 2MKYA 3OJUA 2Z2ZA 2N4CA 4DV5J 2OEJA 1H0HB 3MEDA 2OUGA 1VBKA 2DEIA 2EPIA 1F9EB 2Y8YA 5HP1B 4FDFA 3G82A 1KP6A 1NDLA 4N47A 4ICLA 5CQGA 4C8OA 3DNCA 3ILJA 3TWZA 3K5LA 3DRXA 1ZZNA 3PFOA 4ECTA 2CPDA 3QRPA 4YR2A 1WDDA 1HHSA 2KFNA 1GX6A 4P73A 3GSDA 3KK1B 3M30B 4A48A 2ZH5A 3GR0A 4ZN3A 1K0TA 5L9NA 1AUDA 1SVDA 3MCMA 2W2NP 2RF2A 4U6PA 2UUAJ 4KFBA 2FLPA 2HHSA 4QZVB 1VBXA 5B0AA 3CO0P 4NOHA 2HVDA 4Q5VA 2MSTA 3DMJB 5KFTA 2ZUGA 2X51A 2B5JB 1RT7B 1IJFB 2V9KA 4J9NA 4DV2J 3OVBA 3FEXB 2KVIA 4N41A 2GMJA 1Q1KA 1QAIA 1TR0A 2HZVA 3AFGA 4O4RA 5L9XA 1TV6A 2IC3A 4JI3J 4UUXA 1ZA2B 2Y3YA 4UY85 4Y2KA 3DM2A 4HHUA 3VGUA 3A3OB 4ENOA 2XO7A 1ULRA 1Q7YT 2QYCA 2HHXA 3IM8A 3ONQA 3PX4A 2OSQA 1D8ZA 8AT1B 2GHWA 2HBZB 4K59A 1R43A 2EFQA 2BEFA 1NCLA 4PCQA 2V8HA 1W2BR 1NM2A 3R6GB 4USWA 1IKWA 1DQ8A 1NK5A 4RL1A 2VJUA 3IN5A 1RHQB 4FVCA 3AD9C 3PY8A 2KM8B 2UV8A 2VBXA 5HBMB 5D78A 1T03A 5KFKA 2BABA 2V68A 4DL3A 4WP9A 1H72C 3BF4A 2CJYB 4J9MA 1OPIA 2I2YA 4M5DA 1HBOA 3CIMA 3RB3A 1KSPA 4IG3A 1MWQA 3CIZA 5JUMA 2VKZG 2BYCA 1KHWA 2HVIA 3MTJA 5K9FA 4K5SA 1UPMB 1NB2A 1Q4RA 2LDYA 3TQ1A 5F8GA 1RB0A 2R3VA 1F1BB 5H9FJ 1KONA 3M7VA 2H51B 1ZA1B 4PUOA 4R8UB 4C3MA 1WF0A 3QAEA 2W9CB 2FHKA 4FNIA 3SXLA 1QSYA 3KJVB 2H1YA 1NU4A 2A10A 4N7TA 2HQCA 3TARA 1OQ6A 3RGIA 2QA4G 1P9YA 1TELA 4DR6J 4OX9F 4USIA 3M1VA 4QU6A 4MYUA 3D0HE 2P9CA 3KFWX 2CJAA 2X1FA 4DL2A 1OWXA 1RU1A 1RWVB 2YWGA 2JWNA 1M90T 2FY8A 3MI7X 3FCVA 3GIMA 4OQJA 1RUSA 1SH3A 5DM7Q 1CVJA 2QT7A 3GFXA 4HEA9 1S6QB 2OGUA 6FDRA 1VR6A 2JFKA 2CA9A 1F5BA 1HBUA 4RW8B 3QWPA 3H7HB 3F73A 2FVPA 2CJQA 4WE1B 4CNYA 3GMGA 5KFXA 1Q95G 4K0KF 3CCJS 1S99A 2G2ZA 2FC8A 2Z58B 4RW9A 5KFGA 3BREA 1QE1A 3QGIA 1QAXA 2CRLA 1VK3A 3UN3A 3SYZA 5KFRA 2J0XA 4HLBA 4G1PA 2ZHBA 4KC5A 1VK8A 1RHRB 3MM8B 4DG1A 3BH6B 2GAGC 1JKHB 4UT4A 2G2OA 3B4DA 5DGBA 1VQ4S 3PW7A 3KJQB 3R6LB 3FBFA 1DFDA 4DJBA 2DK2A 1RWOB 3T3FA 4DV7F 2X1GA 4I2QA 1IBLJ 4ED8A 1Y5LB 4KBIA 2ZH7A 4ZVOB 2HWIA 3M2UA 4N56A 3SCIE 2QMUB 2J0WA 5F9NA 5CD4H 2B6AA 1U1PA 3NEKA 5AXMA 1AFJA 1R0CB 4FYXB 4JP8A 1KVKA 3IRXA 4DSIA 3M05A 1JJ4A 1KVJA 9ATCB 4M5JA 2O5DA 4NX9A 3FC9A 2QLBB 3PR5B 4WFZA 4X4QA 1FERA 3CCTA 1RT4A 1CULA 3V5RA 2IDEA 3I5BA 2RKIB 4UOCA 2DYAA 3CC2S 1AW0A 4PWUA 1VQ5S 4ZVUB 1HNZF 1N5YA 1RT1A 3UNYA 4NEZA 3O6QA 1HW8A 2CNLB 1X5SA 4G1IA 3KOAA 3L9ZA 2RB7A 1FXLA 1ICEB 2VG6A 3LPYA 4FPRA 4QIVA 2OPPB 2YKMB 4FBUA 3A1YG 5M2RA 5L8RC 2GIRA 5A8WB 4OYWA 1I1GA 2B51A 4YP3A 3LUYA 4PKDB 4NRUA 4DCJB 2EKYA 2AW0A 1W26A 2FQQB 1Q0NA 1S1WA 2B9WA 1F60B 2AYGA 1K73T 1A9NB 2B7CB 1CSJA 4DR5F 4DPWA 3TW0A 1VRTA 4WFYA 3Q0AA 5KFJA 3HO1A 5M2PA 2AX0A 1J5OB 1XMOF 1RGVA 3IS9B 4QYZK 3KLFA 1CQMA 2RQCA 2IYGA 2NXJA 4F0MA 3IGVA 2U2FA 4JI7F 2IJFA 2VQFF 3U27A 1V5VA 1VJWA 3AXKA 3FBBA 5K8NA 3AD8C 2D1CA 4V19X 4J9RA 1LWXA 2WVEA 1F5CA 2VBWA 3NGRA 2R7RA 3DLHA 1LW0A 3NGUA 1RADB 3CDWA 5B0FA 1VOMA 1S9GB 3T5JA 2A2CA 1FT8A 4CH0S 4NXNJ 4QPTA 2PC6A 3MMBB 2EI5A 3BO4A 4ZP8A 3S7RA 2F4VF 2NXEA 3PEHA 3BDPA 4JV5F 1S77D 1T02A 3P3DA 2H54B 3V81A 2Z30B 2XI2A 3DRSA 3QFWA 4ED6A 2ASJA 3TNVA 3JYTA 5ETPA 1S10A 1UFKA 2XB2D 2Z0GA 3JQMA 1CS4B 1IJEB 5KFWA 2AX1A 1U47A 4R0EA 2MQQA 2DR9A 5B09A 4WCEQ 1U1OA 1RQ0A 4Y2AA 2ZBCA 2N82B 1TUWA 3GWCA 1GXTA 1IKVB 3QT6A 4F02A 1FKPA 1SH2A 3LA0A 3GIRA 2HRTA 3DHWC 3E01A 4RBTA 4GKJJ 2XMWA 2HQIA 2UU9J 1VQKS 5E33A 2K2PA 3N79A 4YOEA 3R3TA 3QGPA 1FEHA 1C2PA 1YKWA 3N01A 2GMLA 1Y00A 4LRCA 3OV7A 1LWFA 3TJAA 4DX5A 3H4DA 1K0VA 1PGZA 1D0EA 4B02A 4BLGA 3CCSS 1WI8A 4PXEA 3U1LA 3RR7A 2CG4A 2DGXA 2XCPA 1FE0A 4ZVHA 1NBEB 2BJ8A 2J9EA 3HZEA 3C8YA 3W63A 3HPOA 4RW7B 5ETMA 2OD6A 5KG3A 2DIUA 1HYSA 2MKJA 2OPQA 2OP5A 1U1KA 1RT6B 3JSRA 5F0WA 3VAMA 2O3DA 4NLPA 2F5GA 4DV3F 2DGVA 4H4KA 4OHYA 1ZM3A 5EWFA 2KXFA 2FHJA 1YWXA 3HXMA 2ZHAA 2BVZA 2J6UA 3CDBA 1KLMA 1KFDA 1NJZA 1C0TB 3OUYB 4WZQA 4PWWA 3HHLA 3NNHA 3AY0A 5IC4B 3ET6B 1FE4A 1UWBA 2EBGA 4LF5J 2GJIA 4LRAA 5JMNA 4FF3A 1DTQA 3H4BA 2AGPA 4ETXA 1LV5A 3SV4A 3IP0A 3C2PA 3MAHA 2CQ0A 4U9RA 3DU6A 5GMEA 3OR2A 3QT5A 4EBEA 4DU7A 1FX4A 2E9ZA 1DZ5A 2HVEA 4IR1A 4IR9A 1S1TA 5JVHQ 1RISA 3DLBA 3CJKB 5B0DA 3I56S 2CPEA 3GJRB 4CLZA 1BXNA 4WFAQ 4Q2LA 3CDUA 3MMCA 4CWBA 3EZOA 1TKZB 2C3YA 3EGVA 3ZXWA 1L3UA 2DH9A 4WTYA 4F4XA 5DLGA 5F8LA 2BACA 4CLLA 3OJSA 4CP5A 1VRUA 3A12A 2C28A 1XNRF 2PEBA 2W7AA 1PCAA 1WNEA 3PCOB 1DRZA 3HT0A 5HVFA 2HFOA 5HANA 2OD4A 4EBCA 3E2EA 1UPPA 3G9CA 2ZH6A 9RUBA 4F36A 1EIYB 5KG2A 2KFZA 2XMVA 4C0BA 3J7YU 1I3OB 3HKWA 4K7QA 3SDEB 2HNYA 5C2GA 1REVA 2MEWA 3KK2B 4OYZA 1YITS 4Q44A 3GB0A 2DKOB 2R2UA 1HPZA 1UVKA 1IN0A 3TRGA 1U09A 2YKNB 5HLFB 5KFAA 2DNRA 2G4BA 1U26A 1DHMA 5DG7A 2DGTA 2XMKA 4NI2B 1N5VA 3EDQB 2IHR1 2YKOA 5HVGA 4AXJA 1KFSA 4DV6F 3PV8A 1PIEA 2M4MA 1N32J 1RAIB 2BDPA 1NSKL 1J27A 1IR1A 4ZPTR 3CCMS 5A6PA 2VD3A 4IUFA 3NS7B 5I42A 2V4QA 4B3MJ 4X4SA 3NMRA 2HGMA 4LSLB 1BGXT 4PWDA 3CNQP 4UOHA 3NNCA 1RT2A 1WEYA 2HHHJ 3RAMA 1JLCA 4LIRA 2WB1D 1UVMA 5J2NB 3MOJB 2H4YB 2Z2MA 5DQGA 2HHQA 2YPZA 3CMAS 3LO3A 3QJJA 2GQCA 3BYPA 3W65A 3KHHA 1IWGA 1D09B 1B99A 4OHVA 8ATCB 1E6VB 2DO0A 4UOFA 5D0GA 3U1NA 2QGFB 2RDDA 4NZ0A 1KHVA 4OJ1A 3CF5Q 2GC8A 2LP4A 1TVRA 5E0OA 3LGHA 3WHIA 5BR8F 1WOSA 3RUBL 5ETTA 2R2RA 5DS7A 2QEXS 5BXIA 2DHXA 3A4TA 4QWDA 1H7XA 3D7SB 2ZZMA 4OJ3A 2BM0A 3OD2A 3PO4A 3SCKE 4NYOA 1FD2A 4Y2MA 5CAAA 4AQYJ 1QSLA 2NCKL 4ECYA 1YHQS 2V2QA 4PQUA 4IG0B 1AUSL 3DDIA 3CC7S 3UPFA 1R31A 1HHQA 4I2PB 2FJVA 4PG8A 5D4NA 4USHA 1Q7LB 5T14A 3W5ZA 4U7CA 3TEGA 4ZHRB 4NA1A 2MGZA 4ZITA 2VA3A 3DRPB 1X0PA 5B7WA 4YY3F 1MMNA 2V94A 2W7PA 4KJIA 4KO0B 3PZPA 2KL8A 2EWHA 3VF0B 2A6OA 1SL1A 1D9DA 2MLXA 3PXGa 4TN2A 3QATA 4DHVA 3BQ2A 3ZZTA 3N6LA 3WQPA 2BKPA 3FQLA 2XM3A 2ZDOA 3OL7A 1HQ2A 4OI0A 3W5YA 1RT5A 1WHYA 3M4XA 3KLHA 2M2BA 3NOGA 1N6QB 1N5TA 3V2UC 4ID5A 3M6WA 5IS2A 3HHLC 3BM7A 4IH5A 3J81j 4O3RA 4ZLNA 3P6YC 2ZD1A 1VQNS 2NUUG 1UFWA 5IM0B 2HVHA 1AB8A 4YS2A 5CABA 4F67A 2DNNA 3BJYA 3CJ8A 3FCHA 2FVSA 3TZWA 4LFBJ 1RA7A 1T05B 2VG7A 2Z56B 1OMSA 4K4VA 2GW8A 5EX0A 3HJFA 4O3PA 4C8LA 1FJGJ 3GTYX 3R5CA 2H9ZA 4IRCA 2F8EX 3D1OA 2M8DB 2IBKA 3OVSA 3R8YA 4ELTA 1HBNB 4J9SA 5HSPA 2OTLS 3G8TA 5HN0A 3H0PA 1N5QA 2LU1A 4P71A 3I55S 2Q1LA 4DL5A 1G6BA 3JTOA 2QA4S 2E7WA 2AEMA 1S0OA 5SZTA 5B0EA 3CDAA 3VTIA 5T7LB 2ZEJA 3D6HB 3VHQA 3GSIA 1IBMJ 4BDPA 2CVEA 3MURP 1RJJA 1FVQA 1RTDB 2QLWA 3Q24A 1RTHB 2YKAA 3SBMA 2RNEA 1N56A 2G0IA 3KLGB 4EZ9A 2ZDPA 3WDOA 1FNMA 1TUGB 2C2KB 5A8RA 3MM9A 1XNQF 3KMSA 5BYRA 3HJVA 4EMDA 1HNIB 4OFZA 3OXGA 3KMQA 3HFVA 1RWKB 4MFBA 3V4MA 3M8QA 3FKBA 4M5GA 3DLEB 3OXLA 2CQ1A 3T5KA 4M5NA 4NLTA 4CT8A 2C2EA 4O44A 2CQ3A 1Q82T 1SPBP 3JB9k 4A8MP 1EP4B 3L3CA 1JLEA 5KG6A 4KHRA 1SC6A 5EWEA 1HMVB 3GJTB 1PBUA 1T9UA 1RAFB 2VFVA 3UDCA 4YUDA 3HCXA 4C11B 3MPUB 4FNHA 1P1LA 2IJNA 5IC6B 1E6YB 3IWXA 1U6FA 3Q83A 2V4JB 4KTQA 5J2PB 4OX7A 4YB6A 2UUBJ 2HFNA 2LDIA 2Y1JA 1CJVA 2M9KA 5GVQA 3DYAB 4JI8J 2VICA 2EK1A 1Q8BA 2ZHOA 4KV8A 4DN9A 2OSRA 2DNQA 3PJXA 3G6YA 4MYTA 3UE2A 5C25B 2XC9A 1R7IA 2YWKA 3BQ0A 3EPGA 1RT3A 4DBQA 2ZBPA 2HIYA 1KQSR 2P2CB 2F8MA 3ITHB 5D8HB 1Q8IA 4KH1B 4USKA 1HNWJ 5DETA 1H2UX 3Q2SC 3MM7A 4LF7F 3IFEA 2GVDB 2HS0A 2ZE2B 4NLSA 3W2VA 5L1IA 2AV5A 2WVBA 4JYAJ 3JTNA 4TXSA 1YBUA 1SH0A 2G1DA 1HW9A 3G6XA 3SCJE 5SUHA 1HD0A 2YNIA 3IR5B 1M5SA 1TL3A 5HMYA 4Y34A 3UDEA 1WF1A 3HVAA 3Q23A 3CCZA 3DGPA 2EVZA 4UZBA 5K5MA 1SJQA 4Y28C 3KHGA 2L9WA 1T3NA 4NLOA 2W2PP 2WVDA 4B3OA 3NRBA 2GX8A 1JXEA 2RDIA 2FHMA 2XTJP 3GIIA 1L3TA 1EETB 2DPJA 1AFIA 2QE5A 1WACA 2DGUA 1F6TA 3T1HF 4O0NA 4QR2A 1UA0A 3QSIA 4CO2A 2HBQB 5A2QY 4QBUA 2RHSB 5FLXU 3JSMB 1EKRA 4C8MA 2DY9A 2QLFB 1ZAVA 4C97A 1YDLA 3D66A 3BSCA 1HR0J 1JQGA 2DEJA 2Z8QA 2JC1A 4TY8A 4FBTA 2GIQA 1CJTA 2CNOB 1RWUA 1OQ3A 2MQLA 5D4PA 1D8YA 1IWAA 3MFHA 3M32B 1HQEA 2MYFA 2W2MP 2E5LF 4TLQA 1CQNA 1ZZFA 2AWZA 1IR2A 4IH7A 1NKCA 2WVCA 2FJEB 3GYGA 1UVNA 4HDGA 2MZJA 2RRBA 1SJRA 3CO9A 2W4CA 1V6HA 2YNFB 3NBPB 1IKYB 3PYFA 1YZ7A 2DNYA 1F2GA 5K8MA 3LP2B 4F3OA 4DUTA 2VH7A 3CJ4A 2K3KA 1SIWB 1VQ9S 2ZKTA 4P9SA 1FHTA 3PHEA 1KTVA 2C3UA 1RWWB 1ELOA 5EX3A 5HJYA 1ZS6A 3O1LA 2H4WB 2BW2A 1MW7A 2Z2LA 1PBAA 2ILYA 2DR8A 2KRBA 1U49A 4KYZA 5ETNA 2YQ3A 2I0XA 3R1LA 3DLGA 2MQMA 2YWHA 1R8PA 3P8BB 1TFWA 2J7UA 2B3TB 2XY5A 2DH7A 3DOMA 4J5OA 4TNOA 3C6UA 3AOCA 4CT9A 2B4UA 1R89A 3TA2A 3GFHA 1S48A 2BX6A 3UD4P 4ZDNA 4YN3B 3MCOA 1IBCB 2BRLA 2DR7A 4Z7CA 4C6AA 2XYGB 3KUEA 4DSKA 5J1EA 1TTHB 5KOXA 2HQDA 1PKUA 2UXCF 2GO8A 4URGA 4DPOA 4ZP9A 5DDRC 1JLQB 4KHPF 5E3PA 4USMA 1YVFA 3C66A 4Q8FA 5KG0A 3US5A 3I0RA 5A0YA 1BQNB 2OAUA 1F9FA 4G6VB 2UUWA 1K8AT 4LF9J 5D3GA 1N8RT 3PVXA 4B3SF 1U0SA 1RI7A 1J5EJ 2V9WA 1NK8A 2A3JA 4DPUA 1QDUB 3HULA 2RUGA 2RDJA 1DURA 3KWMA 2IMOA 2XMTA 5KT4A 4X66J 2KZMA 2DNZA 3S01A 4OZ0A 2VFRA 1HNXF 2FVRA 4W90B 4LUBA 1KOHA 1OY9A 4MT1A 5KAKA 1JLFA 2HIQA 2MMYA 1BC6A 2QMWA 3FZBA 4XAKA 5GMKa 2I5JA 4DR3J 4OIXA 1RTIB 4XPCA 2W8LA 1N33F 2R42A 2HRUA 3GQCA 3M9NB 3M2VA 2JH3A 3BGLA 2DPIA 4LQ3A 2HNDA 1N34J 2UP1A 4RUCA 2IAJB 3LWMA 4WZMA 3B6BA 3JAMU 4DS5A 1RKJA 3V6DA 2OPRB 2KO1A 3EMTA 4DR1J 4WU2A 5ITHA 3CMES 4WP3A 5E3QA 3W62A 4PXCA 3ILLA 4DV5F 3IO1A 4HACB 1HNVA 2E7VA 2XWXA 2OIHA 2E9TA 3CD5A 2YNHA 1OSDA 1TK0A 3THPA 3R5GA 2BE7D 4UUWA 2UUCF 2Y8WA 3C16B 2FPHX 2OH2A 4FYWB 2BANB 2FJXA 3CEDA 2QC3A 4YR0A 4QQBA 4LBHA 3I0SA 1RWXB 1C0UB 4WK1A 5JXSA 1RAEB 1Z2LA 4JI5J 3GG1A 1SC3B 4NLVA 2AJ2A 4M63A 4U67Q 4GO7X 4OI3A 2FJAB 1PC4A 4PR6A 5CCLA 4IFVA 4LT6A 1ZAXA 3AOAA 2P8IA 3OFHA 5CYMB 2Y1LB 2GNKA 4X84A 1NPPA 3T1YJ 2UUAF 3PG9A 1WC1A 5D6GA 4U8VA 5CYQA 4KE5A 4LF2A 4UOGA 7FDRA 2W4DA 5KFYA 4LR8A 2BQRA 4WXOA 3SQGB 4DUZJ 1LWCA 1BQXA 4NRTA 2V2ZA 3BGRB 4DV2F 5I3UB 2D9OA 4OL8A 2RS2A 3D2WA 1G4CA 5LMUJ 1Q53A 1TKTA 3MEEB 2RUSA 3T9NA 4K4XA 4R0JA 4QOTA 1T7PA 3IGNA 3KDNA 2WRMA 4A47A 4DSLA 4NL5A 2IVFB 3MAAB 1RYRA 1K9MT 1JXVA 4WBFA 3NGKA 4I69A 2DNGA 4XK8C 1GMVA 4TYAA 3J81U 2QN6B 1GAOA 2G13A 2ZH9A 2OPSB 2QL5B 5LSLA 1YJRA 2OMOA 3FFIA 4R5PB 4ZVRB 2X1AA 2XWYA 1LWEB 2E29A 2Y0SD 3PNIA 1TU0B 3BO3A 4CTAB 1U1MA 2HZAA 2HNZA 2R8JA 5IT9U 3W7BA 2AJ4A 3ZTQA 4C4WA 3CUNA 1Z4UA 2CDQA 2OI2A 2J8SA 3CJQA 4RO0A 1FFWB 4OYIA 2J9DE 2AJQA 3EUNA 3KG4A 1Q79A 4NMLA 3FCWA 1DJ0A 2YPYA 3MM6B 3DI6B 1JLGB 4N76A 4CZCA 5C42A 3C14A 3DOLB 5ETLA 3WBZA 4LSNA 2XGQA 2C42A 2VODA 3MM5A 1IM6A 2H3EB 3OTOF 3EYZA 1P9QC 3RAQA 1KN6A 2ZVIA 1A7GE 3GJSB 1NHKL 3MPVA 1JXLA 5CA5A 5KG5A 5F41A 2ZJQQ 1QVFR 1KBRA 3PYGA 1HHTP 1SKWA 4YB7A 1PYOB 5FD1A 3M2RB 3Q89A 1FKOB 3ILOA 3Q8PB 1V5IB 4FZVA 3UDLA 2ZITA 4MJKA 1KLNA 1NUEA 4G1QB 3N6MA 3QO9A 1GQEA 2OO4A 1VISA 2PDAA 2XO6A 1X0FA 2HVZA 1FK9A 5KFNA 2EG1A 4NCGB 3BGFA 4HKQA 1S1UA 2HAIA 2DNPA 2APOA 3BEGB 2QZ8A 1FJEB 3MMBA 3ZNUA 2YNGB 5CZXA 4OX9J 3CMQA 5GADU 1XMQJ 4NA3A 1YBAA 2K7JA 1FJ7A 2DO4A 3CE8A 2CJXB 2V67A 5K8OA 4ES1A 2KT2A 2CPZA 1U25A 3JS9A 5EUHA 2XMMA 2VUGA 5ETSA 1VDHA 1RKIA 3Q2TC 1IM4A 4F4AA 3IC1A 1M1KT 4Q43A 3P5BP 1TL7A 2JJ4D 3CCRS 1WSVA 1BQMA 2AHOB 3HHNB 2C2DA 1UJ5A 3EXCX 2VC0A 1LK7A 3BKUA 3LP1A 1YJ9S 4ICLB 4OI1A 5KFEA 6AT1B 3EJMA 1WEZA 2J7WA 2UVUA 4ZIVA 4DUYF 1T9VA 1YK9A 2VPZB 4K0KJ 4CQ1A 2IFXA 2CZ4A 3P49B 4DQRA 2KT3A 3HT3A 1IKXA 2HGLA 1FESA 4OX6A 3O3LA 2RQ4A 5KFBA 1NZ8A 4DCPB 2OTJS 2RF2B 3EM1A 3TOQA 2BJ7A 2Z57B 4KFBB 4GKKF 2DB1A 1HI1A 1O0PA 1B7YB 4ES2A 2QTWA 2LQBA 3PKMA 4O4GB 1TK5A 4OZ3A 3PJWA 5LSOA 3BZQA 3NWGA 4BC7A 2UZAA 2F1FA 2HQFA 4EYIB 2V34A 3E3XA 3MDFA 4DV7J 2MQPA 4H4OA 2NS1B 2VG5A 3J7Z5 2YWEA 3QAUA 3TUIC 4W98A 1TV6B 2B56A 2IC3B 3PX6A 1P27B 4O0IA 1WC3A 1NLKL 3DM2B 2YTCA 1YRUA 2Q79A 1OY8A 3AHPA 5G0RA 4Q2MA 4EFAC 1T9YA 3N4WA 3N6NA 3IMQJ 2VFUA 4WPAA 4EU0A 5A6WA 4Y6IA 4RNMA 1CPZA 1YX2A 1NKEA 2U1AA 1WKLA 3BYRA 2JEGA 3HKZD 2NREA 2LXUA 1IKWB 4ZMMA 3TEHB 4NE9C 3FVYA 4WXWA 2BUNA 2KU7A 4C3KA 5DLFA 4EYHB 4P74A 1T03B 3DXBA 3G2XA 2O1PA 4ZN1A 4X4NA 1SIZA 3W8PA 3RJMB 1EQ0A 4M5DB 5B0BA 4IQMA 1HBOB 2HGNA 4IG3B 2GVZA 2VQEF 2FGOA 3A8KA 1M1HA 5ETKA 2JFDA 4WFXA 2GCFA 4MK8A 4ZLJA 3GCWP 1SKRA 3E51A 4IFYA 3JTPA 1SJ3P 2RE1A 2IPOB 4WFBQ 4ZJOA 4YDDB 4ED4A 3LF0A 5DO2A 3TAPA 1WJ9A 2L9NA 2KKHA 3POTA 4XDCA 2DR5A 1G3OA 4AD6A 2FZGB 2OELA 3JSYA 4PUOB 4NMXA 4A8FA 2QIFA 3CSKA 3HFZB 1NMEB 2QMXA 4KGZB 3RZAA 1O8BA 2DNOA 1C1BB 3DGVA 2DGQA 5BYSA 1WC4A 2DRAA 4NXNF 4LJMA 2FJDB 4IKAA 1IQTA 5DDPC 2AEFA 1KKHA 2MSSA 4YHHJ 3M1VB 5GAEI 2BJDA 1YSJA 2L48A 2Q3PA 2A6MA 4RNHA 3GFYA 4N77A 3LQVA 4AYBD 4A46A 3H5YA 4OZ2A 1U48A 1KTQA 1UVIA 3W1YC 3RB4A 3TYTA 1TFYA 3JQJA 3OR1A 2GJFA 3ZZRA 2FY1A 2F4VJ 1RBAA 2B9YA 3BGOP 1SC1B 3NG8A 4K4TA 1HBUB 4U7UD 5ADZA 3K8VA 5HROA 3SMZA 3LP0A 2XSJA 2WHOA 5B08A 1TMJA 4ZCLA 2OKQA 2UU9F 2I6WA 3RBXA 4NASA 2CPXA 1YJUA 4RW9B 4IH6A 3V6HA 1Q8LA 4PZVA 4I7FB 2YVSA 5CD4A 1QE1B 2MKCA 3PYEA 2PA8D 1VLYA 3LTOA 1QUPA 4C3LA 2CFXA 3EVWA 2DGSA 2D7SA 4DG1B 4RWXA 2IBOA 3ADAC 1Q78A 2HSEB 5KFHA 3CD7A 2YX7A 4KR0B 4PG7A 2NLWA 2KHCA 2JLFA 1Y10A 3FGVA 2OEMA 2DXDA 3OSNA 5KFLA 2B0GA 3DLJA 4I2QB 3NWRA 5KFUA 5LMNF 3M2UB 3OBIA 3M8ZA 2ZZTA 2LQ8A 2IA6A 2B6AB 2LKZA 4DWIA 1YJVA 1UL3A 1NJWA 1F9HA 1TQLA 2GFFA 3K7RA 3IRXB 1NSAA 3UVJA 3MECA 2FD2A 5AXNA 5HMXA 4QYZJ 2KH9A 2UUTA 2WW4A 1TL4A 2CPHA 5J1NA 1RT4B 1CULB 1Q16B 4DV3J 1FCAA 4DL0C 3T6JA 1YJWS 4LRBA 3TX0A 5D0EA 2ZH3A 3DLLQ 1RT1B 4PXDA 3VAFA 1MROA 3W8GA 3R9LA 2DGOA 2AEJA 1VQ7S 3OL8A 2XNQA 2VG6B 2EKNA 4NCBA 1GH8A 1VJQA 5HQ8A 3MMAA 3C15A 1IVZA 2LXIA 4OHXA 3L4BC 3VCDA 1APSA 1RHUB 4A8YA 4WKYA 2LQJA 3M8RA 2ZOGA 2G9OA 4OYMA 4ZPAA 3E8OA 2GA7A 3QZ7A 1S1WB 2BKNA 1PJ7A 4ECVA 2HFSA 4WFNQ 1Y0HA 5A8KA 4ED2A 2GZOA 3DRRA 1VRTB 2HPUA 4IYQA 1R27B 3KLFB 2MY7A 4RBVA 1S79A 4L73A 3R5DA 1EHWA 1TP7A 3UR0A 2ATLA 2ZH2A 2I38A 1RAGB 3ZTSA 4PABA 3EX7B 3MEGA 4B9UA 4EBDA 5K14A 5EN1A 1PG5B 1B4SA 4ILRA 1KWMA 2ASYA 4CLFA 2GJ2A 2CXEA 1LW0B 2F7VA 3X1LB 3RU0A 4URSA 1B64A 2CVIA 1NJIT 3AD7C 4JBCA 3Q8YA 1U02A 4ECRA 1T95A 4NZ6A 2XLIA 1Q5YA 4MAKA 1RAOA 4UQTA 5DQHA 2GMHA 1DQAA 1IXKA 2XSFA 2C1EB 3D6TB 3NCQA 3DRSB 3PRVA 4E8UA 4DX7A 5IV3A 4GRSA 3GONA 2CKWA 2WSEC 2E1AA 4DPYA 1N32F 4G3IA 3NXZA 2AJFE 1VQOS 3D3CJ 4F4YA 4DV4J 2XMUA 3NL0A 4OJGA 3QIPA 3IAS9 3W60A 1T8EA 4GVBA 2K8GA 4AE5A 2VU5A 3FZ2A 5F3ZA 2PI4A 4EO8A 1UKUA 1FKPB 2XMJA 1DLOA 3VR1A 3AQOA 2ZOMA 1J2VA 3E01B 3L09A 1FRXA 2P6TA 1PO6A 4JUZA 2ZM6J 3ZZYA 1UW4A 1I94J 3GP9A 3EDRB 2IIHA 4HVZA 1HMVA 4FYYB 3W64A 3AQPA 3LGMA 4I0WA 1T3OA 4A8QA 4K50A 3D67A 4Q0BA 1LWFB 1M0SA 4TQSA 1QM9A 3IR6B 1SL0A 5HJXA 1MLAA 2JVOA 3LAKA 4ANCA 1V3RA 2FGCA 3IBFB 3LALA 1XR5A 1D9AA 3IA0A 3TANA 3CCES 1HQUA 5C25A 5J2QA 4Y00A 3FRYA 4RX6A 1LOUA 4BC9A 3UD3P 2ZZNA 4KH0B 3CJRA 4ELUA 5GAGI 1EKSA 2OHDA 5BJRA 1HYSB 1YRTA 4QWEA 5KFZA 1KS2A 2OPQB 4CLUA 1XR6A 2DHSA 4QPXA 1HBMA 2MZSA 4AQYF 3MZIA 3L7UA 1UEUA 3HSJA 1UVJA 4C0OC 4M5IA 5HO4A 5HATA 1WI6A 1KLMB 3CJ3A 4NXMF 2AJ1A 4ED1A 2D9PA 3MWBA 1D3WA 3ENAA 2LYVA 3NP5A 4ZK7M 2OFGX 1UWBB 3GYNA 4KQZA 3AH6A 2WAQD 1SCJB 4QWBA 1SL2A 1DTQB 2RU9A 5FJ4A 1CJKA 4KKOB 4Q7AA 5HAOA 1S7IA 3DRYA 4DV0F 2DITA 4OYAA 5KFPA 1B0VA 3VZHA 4Z37A 2ZKUA 4J9LA 4K2JA 5M2UA 5HL7Q 4F8RA 5ETVA 1JWWA 2YH1A 4YY3J 2WONA 5AXKA 4AFFA 1S1TB 4Z7YA 1QVGR 2Q43A 4PYAA 3TO8A 1B7FA 1W2IA 4JI0F 2MPUA 3MR6A 2HG4A 1KEKA 2WOMA 4NYPA 1VQ6S 4C48A 3G71S 3CCVS 4K8RA 4B9VA 1FO1A 2MY8A 1S1VA 4UZCA 5L39A 3U1MA 4HT7A 2MB0B 3A8IA 3PW0A 2NXNA 3R2CJ 2GHVC 3D1QA 2JNJA 2UVRA 2BZ2A 1M5VC 1MN9A 1X31C 2AYBA 1VRUB 2MKKA 4ZVSB
chains in the Genus database with same CATH topology
4DV4F 2D3ZA 1Q81T 3B4MA 1FDDA 2FB0A 1HI8A 2GX8A 1WWHA 2MHNA 1JXEA 2VBZA 5KT7A 3HZGA 2RDIA 1K1SA 5EHHA 1R8CA 3M32A 3G6VA 2FHMA 1RDRA 1M5KC 3GIIA 1FRIA 1TKDA 1L3TA 4OV1A 1FRLA 1EETB 4M94A 5IT9Y 2DPJA 1AFIA 4LIWA 1SI9A 3L7OA 2QE5A 1WACA 2DGUA 3GIJA 1HWUA 1SKSA 3T1HF 3IG1B 2PFFB 4QR2A 1UA0A 5HROB 4OI2A 3LP0B 1HARA 3ZFVA 2QLXA 1UVLA 4ZVFA 2XSJB 4OI6A 2QV6A 3M2RA 7FD1A 1FKOA 4CO2A 4AXIA 2B43A 1NJYA 2OPPA 5A2QY 3NGDA 1N5SA 2YKMA 3I5CA 3VQTA 6FD1A 4FVMA 1IBMF 1QTMA 2ZM6F 2L41A 4ZLPA 5D77A 4QBUA 3Q8SB 2D41A 2XNRA 4G1QA 1I94F 4WF9Q 1JB0C 4DR3F 2R4FA 3JSMB 5A8WA 4DSFA 5IXUA 4IOCQ 2PA3A 4CO1A 2RQMA 2FC9A 4KHMA 4EEYA 2ZOFA 4C8MA 4KT0C 4N8NA 3AB2B 5LL6d 1JJ2R 2ZVSA 1NH8A 3MMJA 1P1TA 2HNYB 1ZAVA 4X4RA 2O67A 4C97A 1REVB 3H59A 4L72B 3TUZC 1S6PA 2HFZA 2HQ3A 3OLBA 1X9MA 2R8KA 3BSCA 3HP6A 2Z8QA 2JC1A 2V8DA 4TY8A 5F8JA 2JVRA 2I8EA 4J9KA 4NLWA 1V3ZA 4FBTA 3CD0A 2HLTA 2GIQA 3DDKA 2DNHA 4ZCIA 4KPYA 3HHEA 3SCLE 2DGWA 1RWUA 1OQ3A 3ISZA 4NCGA 5L1KA 1HPZB 4H54A 2MQLA 5D4PA 4OZLA 1D8YA 2KJWA 3I5AA 3ENVA 4H4MB 1J5OA 2DCLA 3MFHA 2BJEA 2HS3A 3M32B 1HQEA 4RZRA 4DQIA 3IS9A 2MYFA 2RD5C 1KD1T 1FRMA 2E5LF 3PRDA 3TA1A 1ZH5A 5KG1A 4TLQA 2Y1RI 5IQQA 3EGNA 3B82A 2I1RA 1CQNA 2PMZD 3S6EA 1JK9B 3JSBA 4RW4A 2ALZA 2POKA 4X4VA 1ZZFA 2AWZA 2CQ4A 1R8HA 2W7OA 5D4OA 2LECA 4IH7A 1NKCA 2WSFC 1C1CA 2FJEB 4QCLA 3CJ2A 4FXVA 4A4JA 1N36F 4OLPA 1UVNA 5F8HA 4HDGA 2MZJA 3SEOA 3Q8QB 3EZUA 4NZ7A 2RRBA 1SJRA 3CO9A 4UQGA 2W4CA 3MHYA 2FDNA 1V6HA 1S9EB 1RTJB 2EFNA 2VZ9A 1S0NA 2K3IA 1X7VA 3AJ2A 1H7WA 1RYSA 4Q8EA 2YNFB 3NBPB 2LEAA 1IKYB 4URQU 4DR6F 4DQQA 1XTZA 2B9XA 2KYXA 2FUG9 2KM8C 5K8PA 3H2VE 1VS3A 4Q45A 1ROFA 2LMIA 4U7UK 2YX4A 1V3SA 3H40A 1HFEL 2DNYA 2JSXA 3ISNC 4RW6B 2R8IA 2Q66A 1F2GA 5I42B 5K8MA 3LP2B 4F3OA 3OJUA 3WC0A 2N4CA 5AE1A 2VH7A 3CJ4A 2K3KA 2UUBF 1H0HB 1SIWB 1S9GA 1VQ9S 3ZZPA 5IFMA 3MEDA 3MR2A 2ZKTA 4PWDB 2EPIA 2EFOA 3M6UA 1FHTA 4ZP7A 1RT2B 3PHEA 1KTVA 5HP1B 5F9LA 3MECB 4X2BA 1XK8A 2XLKA 1G7CB 1JLCB 3I87A 2C3UA 3N0VA 4N47A 1ELOA 1HWKA 2W25A 4ICLA 5CQGA 2MQOA 4C8OA 3MAQA 3DNCA 5EX3A 3J80Y 3O1LA 3K5LA 3GV5B 3KG1A 3DRXA 2NQPA 2BW2A 1MW7A 2Z2LA 2P9GA 4F3QA 1X9SA 4LQ9A 1ZZNA 4I4BA 2ILYA 3PFOA 4PPDA 3OTEA 3QWUA 3OFGA 2DR8A 1DQ9A 4ECTA 4HH0A 1JNZB 2CPDA 1FRJA 2KRBA 4YR2A 1OPZA 1U49A 2PEHA 3RAXA 4N8OA 5EWGA 1HHSA 3CJ0A 5KFCA 1FF2A 1GTEA 2AYEA 1XMBA 2YQ3A 3J7YI 2KFNA 1GX6A 2I0XA 4DFMA 3KKFA 3GSDA 3R1LA 3X3UA 3M30B 1HWJA 2PT0A 3KK1B 1VBZA 3DLGA 1LFWA 4A48A 2ZH5A 2ZH1A 1MMLA 2J8AA 3GR0A 3MUVP 2MQMA 1K0TA 2YWHA 1R8PA 1N4LA 4OMFG 3BSAA 5I3QA 5L9NA 1JJHA 3B78A 1HNWF 1TFWA 2J7UA 4O3SA 1AUDA 1S6UA 2B3TB 4MMOA 2XY5A 2DH7A 3DOMA 1MROB 1TVRB 2RF2A 4J5OA 4TNOA 4U6PA 3C6UA 3R1HA 2DRBA 1H2VZ 4KFBA 2W9AA 2FLPA 3MEDB 4CT9A 2B4UA 2HHSA 1R89A 4QZVB 1BQNA 1VBXA 2KHDA 3GFHA 5B0AA 3TA2A 4NOHA 1S48A 2ZNYA 2ZH4A 1VBYA 3HVTA 4Q5VA 3I31A 3MMAB 2MSTA 3DMJB 3G8QA 3EGZA 4ECUA 5KFTA 4ITSA 4XIUA 3UD4P 2ZUGA 4DQPA 2X51A 4ZDNA 4BHQA 1IKVA 1LXNA 2B5JB 1WG5A 1RT7B 3BB5A 1IJFB 3H5SA 3TAQA 4JYAF 1KQGB 4K4SA 2JEFA 4Y0FA 2V9KA 2RSQA 2BRLA 4CO3A 2N7CA 4J9NA 2DR7A 1D9FA 4K4YA 4IRKA 1U24A 2CJBA 4DSKA 3OVBA 5J1EA 4H4KC 3FEXB 3N5BA 3MPYA 3TUJC 4ETZA 1X8DA 2KVIA 1R0AA 2ZBIA 4PQUB 5KOXA 4N41A 2GMJA 1Q1KA 1QAIA 2UXCF 1TR0A 1UETA 3GR1A 2GO8A 1N0VC 4JI6F 4WYLA 3ZZ0A 2QFJA 5A8KB 4O4RA 4QW9A 5HMZA 2HRYA 5L9XA 4URGA 3DRRB 4DPOA 4J37A 4D3GA 4ZP9A 5DDRC 1TV6A 1S72S 1JLQB 2IC3A 3MPWA 4KHPF 4QIFA 4UUXA 5E3PA 1YVFA 3T1AA 1FTCA 4UY85 5CYJA 1VC0A 1IBLF 4HT5A 3UCUP 2MGZB 3C66A 4Y2KA 3DM2A 1WHXA 3G8SA 4Q8FA 3GYXB 1NEEA 5KG0A 2XO7A 3MFIA 3US5A 3NAHA 3HDSA 3I0RA 5CZVA 1ULRA 5A0YA 4JI1F 4Y65A 1BQNB 2OAUA 4KIAA 2DTJA 1Q7YT 1CG2A 1U1LA 1LW2A 2QYCA 4PG6A 5KG4A 2HHXA 1F9FA 3FNNA 4G6VB 1XR7A 1B0PA 5GAHI 1QJHA 2UUWA 3ONQA 4L6V3 1K8AT 5D3GA 3PX4A 1N8RT 3PVXA 2OSQA 1D8ZA 4B3SF 1M5PC 3KNAA 3MEGB 1RI7A 2JHEA 2GHWA 1NNDA 2V9WA 5KFMA 5K14B 4K59A 3I6PA 1NK8A 2A3JA 4C98A 3MR5A 1R43A 2EFQA 1URRA 5KFIA 1ZM2A 5GAEU 2LEBA 2OLWA 4JV2A 3QJLA 3TAMA 4PCQA 2V8HA 1W2BR 1RT5B 2R7WA 2CQGA 2E7XA 3OFEA 1NZAA 4RW7A 1JLAA 5LSRA 1IKWA 1DQ8A 3OQ2A 2RUGA 1NK5A 2RDJA 1DURA 3IN5A 1N54B 3KWMA 2IMOA 3KLHB 2XMTA 5KT4A 5LT5A 3CXCR 1BD6A 1BLUA 4FVCA 4F26A 2KZMA 2AJ0A 4F4WA 3PY8A 2KM8B 2DNZA 2ILZA 3S01A 4YB1P 2IVYA 1RT6A 4OZ0A 2WCXA 2VFRA 2CQPA 4DL4A 2UV8A 4ID5B 2HWTA 4QU7A 2BM1A 2VBXA 4WU3A 3C6TA 1BWEA 3DDNA 1HNXF 5HBMB 2FVRA 5D78A 1T03A 4W90B 2ZD1B 5KFKA 2J9CA 2BABA 4LUBA 1MU2A 2VOOA 1FRHA 3NMAA 1KOHA 3CCLS 4DL3A 4FXWA 5KAKA 1VIOA 2KT5A 2HHUA 3BF4A 1T94A 4YEAA 1JLFA 4J9MA 1OPIA 2HIQA 2DNMA 2MMYA 1TUVA 1BC6A 4J9PA 1XERA 2QMWA 1VQSA 1C0TA 3B8HA 2I2YA 3OUYA 3FZBA 4M5DA 4XAKA 3UCGA 5GMKa 2K1RA 2I5JA 1HBOA 3CIMA 3RB3A 4WIIA 1KSPA 4OIXA 1RTIB 1RK8A 4XPCA 4IG3A 4ED0A 3CIZA 1U6ZA 5H1SV 5JUMA 2AP6A 2VG7B 2VKZG 3LOUA 2W8LA