3MZIA

Crystallographic structure of the pseudo-signaling state of the bluf photoreceptor pixd (slr1694) y8f mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
SLYRLIFSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNETYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRPSAMDPEQCLNFLLDIAKIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activator of photopigment and puc expression
publication title Mutational and Structural Studies of the PixD BLUF Output Signal That Affects Light-Regulated Interactions with PixE.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Protein binding
total genus 29
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mziA01
3FRYA 2K2PA 4Q2LA 4ZOSA 5B0AA 5B08A 3BM7A 1W2IA 2OFHX 4NL5A 2ROEA 1YRXA 1JK9B 5F0UA 5T7LA 4F67A 4OJ3A 3DCAA 1TUVA 3HHLB 3TOQA 2EW9A 1CC8A 2N4DA 2PGCA 1MWZA 2OFGX 1P8GA 2OAUA 3BF4A 5B0CA 2IYGA 2HQIA 1GXTA 1ULRA 5B09A 3MCSA 2HLTA 2FHMA 2FIUA 1SQEA 1Q8LA 2KYZA 3LGMA 2LQBA 1FE4A 2AJ1A 1Y9OA 1URRA 1KVJA 2N4CA 1N5SA 2K1RB 4HI1A 3UDCA 2OP5A 2GFFA 4OJGA 2BJDA 1GXUA 1FD8A 3BN7A 2XMVA 3LO3A 3QMQA 2W4DA 2KT2A 3E8OA 3GZ7A 2LXFA 3K7RA 3HFKA 4HL9A 1YJUA 2BBEA 2OD6A 4Y2IA 4A47A 2XMWA 2Q3PA 3HHLA 2GO8A 4HH0A 2HFOA 2OKQA 3T9NA 1AFIA 1TR0A 2VH7A 2LDIA 3MZIA 1QUPA 2XMJA 4OJHA 1SB6A 2QYCA 5F0WA 4YDXA 1CC7A 3HX9A 2XMTA 3HHLC 2AJ0A 1R6YA 4ZA1A 2LQ9A 1VQYA 5B0DA 1AW0A 4A46A 3FMBA 5B0EA 1SI9A 4A4JA 3KKFA 4Y2MA 5B0BA 4HI2A 1YG0A 3FGVA 1XBWA 2BUNA 4QOTA 1MWYA 3QGPA 2K1RA 1Y3KA 1IUJA 1TL5A 2XMKA 2ZDOA 4YEAA 5K9FA 4DN9A 2IFXA 1X7VA 3WDOA 1JWWA 3BR8A 3HDSA 1OQ6A 3IWXA 3KNGA 2HLUA 2KKHA 1X8DA 2ROGA 2XMUA 2K7JA 2RU9A 3CJKB 2FTRA 3IWLA 3LGNA 1Q8BA 4FNIA 1FEEA 2ACYA 1Y3JA 2GGPB 2ZDPA 1VQSA 4HH1A 5B0FA 4DL0C 1X0PA 3KG0A 1Q4RA 1P6TA 1LQ9A 2RMLA 1KVIA 4Q2MA 2QLXA 2XMMA 5B0GA 1FVQA 4Y2KA 1FVSA 1YJVA 2HIQA 4OJ1A 1Y0HA 4OIXA 4FNHA 2PD1A 2QIFA 1U7LA 5A6WA 1N5QA 1OQ3A 2ASYA 1AFJA 2G9OA 2OMOA 2QLWA 2K7KA 3BDEA 5T7LB 4EFAC 3TRGA 1OPZA 2IYIA 2FB0A 3BGUA 1FESA 3HF5A 4U9RA 1CPZA 1K0VA 3VTIA 2CRLA 3DXSX 2BYCA 2N7YA 1N5VA 1S6OA 1TL4A 1V3ZA 2GV1A 2JDJA 2OD4A 2BJEA 3F44A 4DPOA 3CJKA 1APSA 2VV5A 2RSQA 2KT3A 3TNVA 1OSDA 1KQKA 1N5TA 2W4CA 2GGPA 2HFNA 4NPOA 1WD6A 1S6UA 2RILA 1FE0A 3HHLD 5IXUA 1Q53A 1YJRA 2W4PA 2GA7A 2AP6A 3I9ZA 1RJJA 1YJTA 2L3MA 4A48A 5A6PA 5KAKA 1TZ0A 2GCFA 2ROPA 3KG1A 3BB5A 2AW0A
chains in the Genus database with same CATH superfamily
5B08A 4M5DA 2NXEA 2OEJA 2ZJQQ 3AH6A 4ES1A 4AD6A 2HHWA 3NP5A 2HZVA 3KLEB 3DOKA 3AB2B 1M1GA 3M32B 2XGQA 2BJDA 3MGJA 1N5YA 3RB0A 4P73A 5KG7A 2B9XA 1A9NB 1CJTA 1IKWB 2JL9A 2MZSA 1T3OA 2UXDJ 1UVMA 4ZJQA 2DNZA 2GMJA 3C6UB 5SZTA 2KVIA 3K5LA 5IT9Y 3DLEA 2BJ8A 1M5KC 2KU7A 4NI2A 1DARA 3GIMA 2ZM6F 4LUBA 2M52A 2R8KA 3D66A 3CCJS 2AYBA 2M0GB 1KHWA 3RRGA 3VF0B 3W2VB 4NE9C 3DRRB 5KAKA 4O3QA 1D9AA 1PBUA 4GVBB 1GH8A 3I6PA 5HN0A 2DXEA 2IAJA 2W8LA 4F02A 2VG5A 3JAMY 2V2QA 4DWIA 2CPJA 2R7TA 2DR9A 2NXUA 1Y7PA 2C2MB 1VQ7S 4ID5A 5HMYA 3BPDA 4RW4A 1XMQJ 5A8RB 2KL8A 2VFVA 4Y2MA 3LP1B 3TAMA 1TL5A 1J5EF 4HTIA 5FIIA 3PW4A 4LFCJ 2ACYA 4X65F 1M1KT 4L3NA 3ZZTA 3R9LA 2HYIB 1KVIA 5HJXA 4NCBA 5B0GA 3MM6A 5ITHA 4TY8A 5KOXA 1JLEA 4H4OB 1RI7A 2RKIB 3NAHA 5M2RA 1K0VA 4QCLA 3Q8RB 2M70A 4DV2F 1R0BG 2MKKA 3F41A 4WP3A 1PBAA 4KAIA 1KLMB 1VBKA 2B0GA 4QWEA 5K14A 2PFFB 1NXIA 3VAJA 1X4EA 2EBEA 4RU9A 2FZGB 2M2BA 3QWUA 1OS5A 1U4BA 1BD6A 2ZUAA 3X3UA 2AX0A 2ZFHA 4R25A 3BKFA 3CJTA 5C7PA 4DUTA 5DJBA 3I0RA 4F50A 5IT9U 1BQNA 4FVCA 4K50A 4QOTA 1EARA 5DRKA 1IBMF 2LYVA 1RAIB 2DK2A 3CJKB 4R8UB 1VQNS 2ZZNA 2ZVIA 4LF9J 1S9EA 1DTQA 3FCHA 1KFSA 4JI8F 4C4WA 1VC6A 1LW0A 4MJKA 5KFUA 4J9RA 3ZTSA 4NMLA 1HBMB 1RT2B 4QR2A 2IJRA 4I56A 1U47A 1FTRA 2RILA 2F4VJ 4NLTA 1B0PA 2QMXA 4ZVOB 3OVSA 3CSKA 4LF8J 3TW0A 2ILZA 1W2BR 5DM6Q 4U95A 3SCJE 2N4DA 1BMQB 3V5RA 2HHPA 3H2VE 3HVWA 4RNFA 3FBCA 4ELUA 1UVNA 1HMVA 1TKTA 7AT1B 1MSWD 4NRTA 4KV8A 4DR2J 3KLFA 1AFIA 1GNKA 5C25B 3C66A 1DTTB 1QD1A 2AT1B 2W9BA 4DV0J 2LQ9A 3H5XA 3FMBA 2L08A 4JI0F 3QZ8A 1S77D 1RAAB 2KVQE 2IJFA 3OQ2A 3KNGA 4ILRA 3H2UB 3JYTB 4NLYA 3AD7C 3CT9A 4Q0BA 2HAFA 3NWGA 3W66A 3P5BP 2WVFA 1XC9A 3A8IA 3DXBA 2HHXA 3GYGA 2K3KA 3VTIA 2DHAA 3DRSB 4CO3A 3F73A 3RTVA 2M4MA 1UL3A 2FVSA 1NHKL 3OUYB 3IBFB 5H9EJ 5J2PB 3SZ2A 2QL5B 2YPYA 1FRMA 3NL0A 4PZVA 4DSIA 1WOOA 3EGVA 4KYZA 3E3XA 4YMEA 4ZVRB 1RABB 5IWAF 2XC9A 2LLZA 5D4NA 3W65A 2ASJA 3UPFA 1RYRA 4KFBA 3ONQA 1CEZA 2YKOA 4P52A 2WVDA 1Q78A 1ACMB 4B9VA 1K0TA 5F9NA 2XS7A 3ZC4A 1JLFA 1TL7A 3HX9A 1HNWJ 1PYSB 2DH7A 2DEJA 3CIMA 1Q8KA 4DBQA 4A8YA 1RKIA 4IR9A 2FVCA 2W2QP 1V6HA 2ZNYA 4NYPA 2D3OR 4GO5X 4B3RJ 2OUGA 4MKBA 4AXJA 4K4UA 2OPRB 2L41A 1T8EA 2KI2A 5KFWA 4OI1A 5HVFA 4KHMA 3N5FA 3AY0A 1JB0C 2XTJP 5IT4A 1APSA 2HS4A 1PAUB 1I6JA 4Y28C 3LTOA 1HNZF 2HHQA 4BWMA 1VRUB 1ZZFA 3K5PA 1U1KA 5FDLB 2AZ3A 3SEOA 2HHHF 2YKAA 1YRXA 3SQGA 1D09B 4KY3A 1FO1A 2CNOB 2HQCA 2GIFA 2DT9A 3ZXWA 4GKJJ 4UOHA 4UUWA 4FBUA 4J9PA 1S76D 1T9XA 4DL6A 1HWKA 1IBLF 1S1WB 3J80Y 3G6YA 1F3VA 1S72S 1JNRB 3CEDA 2XMJA 3T1AA 2P6TA 3BH6B 4M5NA 3DLGB 2F40A 3BJYA 1QSLA 4ECQA 2UXCJ 1ZYQA 3IS9B 1TK0A 1RAJA 1W26A 3JQKA 4DQQA 2CUYA 1RU1A 4X64F 1NHVA 2FB0A 1FESA 2EKNA 1NDLA 3HCXA 4MFBB 4LREA 3RR8A 3EPGA 1IJFB 2VFTA 3W9JA 1URNA 1EKSA 2G13A 5KFRA 4LF6J 3FRYA 3BM7A 3CD0A 4B02A 3CMES 2BA9A 4Z7CA 1JLQB 2AU0A 5KFQA 2UXBJ 4DV6F 4AL5A 2CNKB 4M94A 3JSBA 2DR6A 2K1RB 1FD8A 3LGHA 3PYFA 3M6UA 4HEA9 2ZWPA 3M9MB 5DZ7A 2JX2A 3CD6S 2IM2A 2MJUA 4I67A 2IM1A 4O4GB 4ZP6A 3LP0A 3K5NA 3NGDA 3VAIA 2XNRA 4ETZA 5J2NA 2RHQB 1I3OB 3AXKA 3NS6A 4QIWD 3DGVA 1WSRA 3KJNB 4USJC 5KFCA 3IMQJ 3HD2A 2CQ4A 1HWUA 2GJIA 2XQCA 1G4CA 2Y1LB 3UVJB 4EGLA 1SC3B 4J9UE 1RT2A 3KG4A 2IMOA 4OYZA 1U0HA 2GHWA 4TVAB 1S6QB 1YX2A 3DRPB 3CCVS 2NSCA 4ZOSA 3J80U 5DGAA 1CC8A 2PGCA 3OR2B 1NKBA 3OL8A 3SDEA 1X4HA 2VPWB 5L38A 2BM1A 3LP2A 2CAJA 3EGWB 1E6VA 3BEGB 3MHYA 3P4UB 3EGZA 2DGUA 4DV5J 2VF3A 1KEKA 4NLPA 4ELVA 2MZQA 3NMAA 5HO4A 3MUTP 2FLPA 3D3CJ 3ETOA 2VIHA 2F9DA 3HSDA 3RRHA 4CTAA 2ZOMA 4KBIA 1PJ5A 5B0DA 3NNCA 2W7AA 4LSZB 2KN4A 2HLUA 1S0NA 3UNGC 2ZD1B 1HKAA 1QTMA 1TQLA 5KOWA 4LF1A 2XMMA 2VODA 1F3FA 3HO1A 2KXHA 5HJYA 3UNYA 1WG4A 4CLKA 3M05A 3ISNC 1VFJA 4ED7A 4JI1J 3CO9A 3ADAC 4DPOA 3DRSA 3V81B 2V68A 1GT8A 3NLCA 1KC8T 1TTHB 4DR7J 3LOUA 3OUYA 2YKMB 2GAHC 3HVTA 2VA2A 1HPZB 2ZBRA 4OYXA 1TUVA 1UJ4A 2ZZTA 4DSJA 4RUCA 3ZFVA 4ECRA 1SKUB 5EUHA 2CQGA 2HQFA 2K8GA 2HVEA 4C97A 1PC4A 2WBMA 2Y9HA 2C2DA 2JH3A 1KONA 2FJBB 2IBKA 1FWPA 5CXTA 2R2UA 3D1OA 4X84A 3NY0A 1L3UA 4HH0A 2HRTA 1UETA 2CJAA 2FGOA 4FYXB 2MKCA 2RIJA 1NUEA 1OY9A 5E3AA 3CO0P 3KHHA 3UFCX 4URGA 2VOPA 3DLBA 2XMUA 3KMQA 3IWLA 1R8HA 2IDEA 2W9AA 4BWJA 1UA1A 1ELOA 1FXRA 2UUTA 3NGRA 2VJVA 5K8OA 2YX7A 4I2PA 3QLHB 1B70B 4CCHA 2FHJA 4USKA 1KS2A 4J7CA 4ANDA 4JI4J 4ANCA 2AGPA 1HNXJ 4PCQA 3C8YA 1NH8A 3CJ3A 4LFAJ 3HZGA 3KXDA 2DGTA 4M5JA 1KBRA 1H2UX 3SMZA 1H7WA 2DTJA 2EEYA 2BABA 2AZ1A 1VQKS 1T11A 1LWEB 4JV5F 5AXMA 1U2RA 2IYGA 3UE2A 1VJWA 2GHVC 1FE4A 1N5SA 4S0MA 4DXLA 4PQUA 4LIRA 1LNQA 2BE2A 1IKXA 2V67A 4KH1B 2HNDA 3D6MB 4DS4A 2EBGA 5ETSA 1L3TA 3O5TB 1N56A 2Z2LA 2NCKL 2VG7B 3O1LA 3N0VA 3M9OB 1TKXB 3MEEB 4G1QB 2G4BA 5AXKA 2Y8YA 4OHWA 1LV5A 3C6TA 1GMVA 4J9QA 1LXNA 1ZM3A 3SXLA 1F6TA 1WI6A 3HULA 2CPHA 5E3QA 3N5BA 2FJVA 4RW6B 4A8FA 1X5OA 2YNHB 4XAKA 3ICLA 4UZBA 2XWXA 1FDDA 4CYUB 2FJAB 4OZ5A 4Y65A 2R9LA 1J5OB 5E41A 2H48B 3QRRA 3G96A 3M6WA 5EHHA 3KLIA 1HBUB 2KYZA 4AXIA 1UCNA 1IN0A 2OI2A 3W2WB 1IR0A 2N3OA 4EI2A 3TX8A 1NAQA 2MSTA 1JLCA 1R8BA 3OHAA 5K8MA 2P9GA 2E1PA 1HQEA 1IWAA 2HFOA 1K44A 2N7CA 3OFEA 4N8OA 4IG0A 4N76A 1NBEB 1WKLA 2ZHBA 1BGXT 4P9SA 4MH8A 3QGGA 3BR8A 3ISND 1HHTP 4M63A 1X5PA 2H5EA 2IRYA 4QYZJ 3TJAA 2BW2A 3DI6A 4YS2A 1Q4RA 3I56S 2X1AA 3H90A 2QMWA 3CDEA 2LQJA 3PIOQ 5IZHA 3TZYA 2ASYA 2MQNA 3VHQA 2OEKA 4KR0B 1VRTB 5C42A 3EZOA 2CXEA 3OTBA 2F3JA 4WU3A 4TN2A 3N28A 1S1TB 1N33F 2HBRB 5HBMB 2W8KA 1R8AA 2L9DA 2B9EA 3M30A 1LK7A 2OPSA 3M2UB 2HBYB 2N82B 4IOCQ 3RBEA 5BR8F 1JLAB 4ECSA 2DPIA 1M5HA 2ERRA 3D1HA 2VFRA 3HFKA 2Q3PA 4CLUA 5DQIA 1CG2A 4C0OC 3SFUA 3CCTA 5CD4H 3DRXA 5KT4A 5LMUJ 4EU0A 2XLJA 5B0BA 2BUNA 3ENAA 5CQGA 3OR1B 5GAGU 3CWJA 1NJIT 4RUAA 4FP9A 5IM0A 2D3UA 2AD9A 4F4AA 1C1BB 4RJVA 2VC0A 3R5JB 4IUFA 1B0TA 3DFEA 5MLCV 3BGRB 2CPYA 3UO0A 1FJGJ 2RQKA 1H6KX 2NYIA 2GGPA 4JBCA 2Z56B 2WB1D 2KFNA 2JEGA 4B9MA 2YKMA 1Z1ZA 2HNZA 2J7UA 1LK5A 5HROA 4OL8A 3FJ2A 1NM2A 4RUHA 1UEUA 2HGMA 5ETTA 2I5JB 3D7SB 1NDPA 1FA0A 2HGNA 1IQZA 4YP3A 4ED2A 3BS9A 1HYSB 1NKEA 4L74A 4LRFA 5JVHQ 2FJXA 4TLRA 3ZTRA 4WZQA 2RU9A 3TAPA 2LFVA 1N52B 4DUYF 2ZBPA 1KQGB 3L4BC 5KFFA 4ED3A 4K0KJ 3UW1A 1FNOA 2CZ9A 5L1KA 2MKHA 5T7LB 2D9OA 2J6TA 2DCUB 4I64A 3BBCA 4M5HA 5KFPA 1X4GA 2W24A 4A8QA 2DNMA 2W4CA 1MU2B 5F8HA 4CM2A 3G6ES 1U6FA 4EWTA 5I3QA 1F2HA 1F5BA 2DR8A 3A4TA 4NLGA 2W7OA 3A3OB 3BSNA 4GC7A 1NKCA 1QVFR 2OMLA 4DR4F 3POTA 1LWEA 2LQ8A 1NSPA 2E44A 1RAGB 4XDCA 4OYBA 2E66A 2YBVA 3OL9A 4B3TJ 4CLYA 1KKHA 2X3DA 2HQDA 4ZPWR 1YBUA 4QWBA 1KTVA 2H54B 3RB4A 5E3RA 4OI6A 4Q7AA 2RD5C 4K4TA 3BGLA 2QA4G 1TKXA 3HDSA 2V2KA 3MEDB 4ZVFA 3EUNA 3Q83A 1R6VA 4CI0B 3WBZA 2RRAA 4OYWA 4DL4A 2F4FA 2IHR1 2YTCA 4QR1A 3TX0A 1CJUB 2RDJA 2WAQD 4NLRA 1C0UB 2ZC4A 1VCTA 3D4JA 3D54A 1D8ZA 3MPUB 1S0OA 2QYGA 3AB4B 2BKOA 3L09A 1LFWA 1C0TB 2YKQA 2G0IA 1F1BB 4JI3J 3NMRA 2DGOA 1UWBB 1KOOA 3EVMA 4DV7J 2JRSA 3VAFA 4NCGB 3MM9B 4JI6J 1PIEA 4IFYA 2YH1A 3ITHB 1XR5A 4UUXA 3DLLQ 1JLBB 2AJFE 5F41A 2UV8A 3OLAA 2OKQA 4UF4A 1TR0A 3H4DA 4DR6J 2MLXA 1ZZNA 2QYCA 3VVUA 1RTDB 4FF3A 6FD1A 4TY9A 5HP1B 5CCLA 1CQNA 5J1EB 5HMWA 1AZSA 1CS4B 4ZHRB 1X4CA 1HHQA 3M8RA 5A8KB 1MN9A 5D0RA 2XCPA 2B6AB 3M6VA 1RXOB 1VK3A 2WVCA 3HSJA 3F44A 2OPQA 1YTYA 4X4TA 5LL6d 1KP6A 4J9OA 1OSCA 2OJ3A 4Q2LA 2AJ2A 2V8PA 2ROEA 4BCAA 4KJIA 2R2SA 3DOLB 4WF9Q 2R8IA 5J1NA 4ZN1A 1YZ7A 3C14B 1RBAA 3OSNA 2FJEB 2C3OA 1C2PA 3KJVA 2HVIA 4QPTA 2V2ZA 1VQ5S 4USWA 3L7OA 2MTLA 1NK5A 2YQ1A 3QRQA 2PC6A 3OJSA 2PFDA 2QTWA 2IC3B 2BANA 4QJVA 3HHLC 2AJ0A 1SI9A 3DOMA 1WHXA 4LF4J 2V9WA 5IC4B 1Q95G 2DNQA 1GMUA 1S1UB 3WZ0A 4DCOB 2R8JA 3IR5B 3NBPB 2LKZA 4WKRA 2C1EB 1QLNA 3CC4S 1RBOB 1TL4A 3UN2A 2B7BB 3PO4A 2XNQA 4DV4J 1UKUA 2E7VA 3C16B 4ZIWA 1IBCB 5U47A 4ZPBA 3CCUS 2K2PA 3MUVP 2VDIA 3PRDA 3FNNA 1ULRA 1VK8A 4OV6A 2NR0A 4WKYA 3I87A 2BZ2A 3GE9A 1AYEA 1SV5A 4WXWA 1JLGB 2WOMA 1RAEB 2W2MP 1S1VA 5KFKA 1JKHB 1GQEA 4U96A 3VR1A 1IVZA 1SH0A 4NEYA 1N6QA 1XJWB 4NA3A 2C28A 3G9CA 4PUOA 1Z2ZA 3UDEA 5C24A 4C3MA 4ZDNA 3NGTA 4GO7X 3R2CJ 2J0XA 4USTA 2QZ8A 1S49A 1NK0A 3TQEA 2JDJA 4TU7A 4NOHA 2RDDA 1R7IA 2UUBF 2CG8A 2Y8WA 1M90T 2RQ4A 2E9ZA 4DR5J 4LF5F 1ZS6A 4PWDB 2HPUA 1RUSA 3HVAA 1FRKA 5B0CA 1N88A 2UUCF 3MCSA 2DXFA 1OYEA 2DH9A 3M9NB 2MQLA 3J7Z5 3KHGA 1SUQB 2HBZB 1Q0NA 4Y6IA 2HMIB 2VBZA 2DO0A 4UOCA 1WTBA 4KHPF 1RTIB 2XMTA 2F8MA 2D69A 1MG7A 2HVHA 5KT5A 1QAXA 1IUJA 3UD5A 4ZLNA 2BE7D 1REVA 3PY8A 2IFXA 3WDOA 2AJ4A 1IKYB 3FQKA 4PXBA 1Y3JA 2ZDPA 5A0YA 5A76A 2P9EA 3MAQA 2UVRA 2DBBA 2GMHA 3GR0A 3ENQA 2OIHA 3O3LA 2EFGA 4B3OA 2W01A 1H2VZ 1YVFA 3TA0A 4JI5J 1N32F 1L3KA 4M95A 3V4IA 4BS2A 1S6OA 3QO9B 1OJ4A 1P9QC 1T05A 5IXUA 4KSEB 3DM2A 3JS9A 3Q8YA 4JP8A 2WONB 4NMXA 3DCAA 4AE5A 2MZRA 3S1TA 1UA0A 2HQIA 4PXEA 3GIJA 3OTEA 1HR0J 4WE1B 3MM9A 1TKDA 1KTQA 3Q2TC 1VS3A 2GVZB 3JTNA 3GFYA 1BC6A 4RNOA 3T3FA 2A18A 3PVXA 1Y5LB 2IY5B 1KDNA 2MYFA 2ZH7A 4JI7F 2ZHAA 4JI2J 3VAHA 2DYAA 5HP1A 5DGBA 1B3TA 4KKOA 4ZLPA 5T41A 4DPYA 3GJQB 3CCES 2XWYA 3N9UC 2BQ3A 3PX4A 3M2VB 3NRBA 3MR2A 2HNYA 5DLFA 1SQFA 4ZJLA 3ZZRA 3RG6A 3R3TA 1Z4UA 2ABYA 2P6SA 3CJ4A 4R5PB 3W9HA 2XHCA 4C11A 3GV8B 2KM8B 3ZNJ1 2FUG9 4LQ9A 2C22A 1T02A 1YJ7A 1VQMS 1I94F 3PRBA 4U6PA 4CO1A 5IV3A 2B9WA 4ZIVA 1H73A 4DR1J 3Q8QB 3VZHA 3OPKA 1H7XA 1GX5A 1LW2A 1S6PA 3DGPB 2FLNA 1Q8LA 3H40A 2AJ1A 2J6UA 2V9KA 3ZO7A 4KO0B 2CQCA 2W25A 2I38A 2YKNB 2KT2A 2H3EB 1TELA 4GKKF 2OHDA 4UZCA 1S9GB 1TP7A 3RU0A 3R6LB 3OTOF 4WIQA 5G0RA 4RNNA 2DNPA 3V2UC 3HT3A 4CH0S 4ES2A 3K57A 4HHUA 1JJCB 2VZ9A 1FX4A 1F9FA 1XBWA 5KFLA 4GVLA 4CT8A 2V2VA 4F4ZA 8ATCB 3I5CA 2BEFA 2Z0GA 1U1LA 4A8XA 4X4NA 3GG0A 4O0IA 2CJYB 2GMLA 1U0SA 1PO6A 4F4YA 4ZPAA 3RYLA 1YRTA 1HNWF 3OXFA 1T7PA 3OBIA 3G86A 3TZXA 3DLHA 1JXLA 2IYIA 3MMCB 2VASA 5GADU 3V6HA 2FVQA 2ZNZA 2KT3A 3MF5A 3KLGB 1N36J 3CC7S 5DG8A 2B43A 3C16A 3JSYA 5J2MA 2AW0A 2VBXA 2PA8D 2V8GA 5F0UA 2BKNA 3HHLB 5A2QY 2CPZA 3QAUA 1SJQA 2OFGX 3A12A 2RDIA 4A8MP 2L9WA 2PMZD 5E3PA 5ADZA 3IG1A 2CYYA 4LJMA 4OZ0A 2MGZA 3PR4A 1HHSA 1BXNA 3HPOA 3PW7A 1WWHA 4DHVA 4ZLJA 1R6YA 2KXNB 2J8SA 5LXRA 4X4UA 4Q43A 1D8YA 3GSIA 1N4LA 3PCOB 4DV1J 4DN9A 3THPA 4DR3F 2KRRA 1KN6A 4U7UK 1TL3A 3A8EA 2FZKB 2GHPA 2XZWA 3D28A 3MM5B 4X62J 3IFEA 1GMWA 3JQMA 3ILJA 2B4OA 1WDTA 1RA7A 2DNLA 1N0VC 2OTLS 3S8SA 3MMBB 3DLKA 1Y5IB 4F4KA 1WOPA 3CJ5A 1UJ6A 4P71A 3HM9A 3QZ7A 1QE1A 3B8HA 4DMZA 3DDIA 4FXDA 3GFXA 2XYGB 2Q1LA 2RH3A 1NJZA 3Q0AA 1SQEA 4Q8FA 3W9IA 5ETVA 2QRRA 3IC1A 3MEGA 1SUQA 4LF6F 2C2RA 1RWVB 4Y2IA 5KFEA 2J6SA 1M5OC 3U1NA 3G82B 4EMDA 2WW8A 4ECTA 4O44B 2X7IA 1IBKF 4YEAA 7FD1A 1AUDA 4ALZA 3PFOA 2HHUA 4FS2A 2NQPA 1IKYA 1TFWA 4KGXB 4LQ3A 1X0PA 3H25A 4UY85 3E01B 4X4RA 3P8BB 3EZ5A 4JUZA 1SJ3P 3HD1A 4N56A 3W3SA 5LM7E 5CH7B 4CLFA 4C0BA 3FSYA 4PYDA 2QA4S 1RTHA 1RJJA 1UVLA 2Y1IA 3BB5A 2D74B 4ID8A 3U7JA 3EICA 2GW8A 2G2ZA 1X4AA 1VLYA 1OIAA 4F04B 3QAEA 5AJ3F 5D4LA 1AROP 2IBOA 3FFIB 1NU4A 4LSNB 5DDPC 2YX4A 4J5OA 2GO8A 4QZVB 4WPAA 4WP9A 1HBOB 4F3MA 4QWCA 4G3IA 4ZPDA 3FCWA 4H4MA 1ZH5A 4F2SA 4ED1A 4D3HA 1MLAA 4K4VA 3MR7A 4TLQA 4FNIA 1N34F 4FXWA 3KG0A 2ZM6J 1TK5A 1NDKA 2GQQA 1X9SA 4M5DB 2R2TA 5GAEU 4OZ3A 2XYPB 3AHPA 3DOKB 4OHYA 5DO2A 1CJKA 4R5PA 1RCXB 3OW2R 4CO5A 3GONA 5KFDA 2DD8S 1S7HA 1VHFA 4F36A 2IA0A 2G1HA 1UFLA 2WTFA 2JFKA 3D1QA 5LJ5Y 1CJTB 3LGMA 2XZDB 3FSXA 1FWKA 3IM8A 1QSYA 2C2NA 4IFVA 1YJUA 3G6XA 3DLEB 2LU1A 4CO4A 2GVDB 1WNEA 3CDWA 4CRJA 4H4KA 3M8SA 4MIAA 1J5EJ 3ET6A 4XIUA 3BQ0A 2B4UA 4RUBA 4X2BA 2LMIA 4X65J 3FRZA 2DKOB 4WFBQ 4ELTA 3HKZD 4CQ1A 2DY9A 3QIDA 3PHEA 2D9PA 2DNHA 3MMAB 2KXFA 4USIA 4CDIA 3DXSX 2IAJB 4RW8B 4DV2J 1N5TA 3FEZA 5DS7A 2VG5B 3KLGA 1YJRA 1NK8A 2VB6A 4OX9F 2EC0A 2MHNA 2RS2A 3SI8A 2JVOA 4RW9A 2HQ3A 3S7RA 3VCDA 3QT8A 4MYTA 3CDAA 4ID5B 5KFSA 5KG0A 1LWFA 1FJCA 4RW4B 5F9LA 4OZNA 4PXDA 1I5OB 5GVQA 5D15A 2G0JA 1GFWB 3KUHA 3TAMB 2HW3A 2A0FB 1VQ9S 2HHVA 3C19A 4LR7A 2V8DA 1UTAA 1FKAF 4TY8B 3G4SS 1FRXA 1IBMJ 1JLEB 1HI0P 1IR1A 2EFNA 1XR6A 3K8WA 4C8ZA 4PKDB 1X8DA 3U02A 4NCAA 2CQIA 5D8HB 2CQBA 5I42A 1QAIA 4DL0C 2VD3A 4DU7A 3VV2B 2PSZA 4O3SA 4JI8J 1LWCA 4NXNF 1YJVA 4UOGA 3HKWA 4MK9A 2X1BA 4FNHA 2XS5A 1OYDA 5K14B 4B9TA 1VQ6S 1MMNA 4HT7A 5C5JA 1W7WA 2AX1A 3KJQB 3P49B 2H5IB 3Q8VA 2WZ1A 3QPIA 1R8CA 4M5MA 3TA2A 5E5NA 3I0RB 2WSEC 4P7VA 5FJ4A 3AD8C 5KFMA 2MZJA 2DVIA 3HHKA 4IDKB 4BBYA 3Q8UA 4DFPA 5HI7A 2LXFA 4BHQA 4X66F 2QEXS 2HURA 3V6JA 1SB6A 1DTQB 4PG6A 4LBIA 4JI0J 4OZ2A 1FWLA 3FGVA 1H98A 4K4SA 1SBRA 1F2GA 3RRKA 1UVIA 3MDFA 4OYIA 1WF1A 2IM0A 1U26A 2F5GA 4IO9Q 2JZ5A 4DX7A 3BSCA 7FDRA 4CNYA 2CQ2A 5M2UA 4DOZA 4HVZA 3LF0A 2OD4A 1V5VA 1TAUA 3QT6A 1HMVB 2I2YA 4RU2A 2A6MA 1PSDA 3ZZYA 1TKTB 4KC5A 3I9ZA 4ZCLA 3E51A 2O3DA 1AFJA 4KV8B 1UVKA 3Q89A 2CQPA 1KVKA 1RKJA 3KLFB 3ILIA 4BDPA 4YB6A 2W9BB 5IWAJ 5JMNA 3J81j 4C8NA 1HWJA 1VIOA 1FT8A 3IO1A 2IM3A 3US5A 1UMJA 1WTFA 1N8RT 3CCZA 2FHKA 2BOAA 2A2DA 2VH7A 4ECYA 1BQMA 4C8LA 4Q0BB 2O66A 4XPEA 2M5YA 2SXLA 2ZDOA 3CGIA 1KQFB 4Y00A 1TAQA 4C2MA 2W9CB 4MTPA 1EB0A 5D4PA 4TYBA 4U8VA 2Q6BA 1Y0HA 3B6BA 2H5JB 2F63A 5K5MA 3IM9A 1UW4A 2ADCA 2V6AA 2LXIA 1EP4B 4P6QA 1XNRJ 4AYBD 3H5YA 2BJEA 1HNZJ 3IRXA 4DFKA 2DNOA 1RHJB 4ED4A 2M88A 3RB3A 1S59A 1Q81T 2HHHJ 1TL1A 2F7VA 1RTJA 4KFBB 2M7SA 2VQFF 4GMKA 3CF5Q 2ZH9A 1ZPWX 2G0CA 1JLFB 1TL7B 5D3GA 1TVRA 3ZNUA 1U8WA 1Q1KA 2MLYA 3CW2C 1VBYA 2Z2MA 4IKAA 1J27A 4KGKA 4C48A 4IH6A 2GVDA 3L7PA 3R97A 3BSAA 4Y0FA 3BBFA 3OV7A 2KDOA 3MECA 2EXUA 4PABA 1EJ7L 2PI4A 3GFHA 2R7WA 1RYSA 2XO6A 2CADA 3W60A 2QLFB 1XTZA 1FVQA 2UUWA 1FVSA 3UI3A 4XPCA 2ZHOA 4OIXA 4X64J 5F8IA 1P1LA 3SQGB 2QLWA 2HWIA 2ATLA 3MMAA 2DGWA 3M8YA 2A6OA 1CBKA 3KJFB 2Y0BB 4RW8A 1RHMB 2XSJA 5I3UA 3I0SA 2VFUA 5B0AA 3OD2A 1J2VA 1HBNA 3R7SB 3CDBA 4HDGA 4DV6J 1SKSA 3JSMA 1UEKA 2HLTA 2M8HA 2QSFA 3N6NA 1RADB 1KR4A 4C8MA 2UU9F 4NLDA 3MPDA 3I82A 5G4DA 1T03B 3PHTA 4PQAA 1DLOA 5KFBA 1PKUA 3IBWA 5HVHA 1T9YA 4L6V3 2IRXA 3M8QA 3TWZA 5KG1A 3FKBA 1G3OA 3T1HF 4OX8A 1GK8A 3MOZA 1WC4A 2QLBB 4M8LA 4DPXA 4C98A 4K4ZA 2M8DB 3NOGA 3LQVA 3D6HB 2Q79A 2A3JA 2AGQA 4HACA 1TKZA 1SJ1A 1YLXA 1FRLA 1EX8A 3IBCB 3PW2A 5BYQA 5K8PA 4WTOB 1KD1T 4WFXA 3KG1A 3NGKA 2V4JA 1JK9B 3EDRB 4FKXA 4JYAF 4P2FA 2BDPA 1SPBP 5BXIA 1MWZA 2YQ3A 2JEIA 3G87A 5LSLA 3P45B 2FIUA 2LQBA 1RLCL 3LP0B 3UCGA 2JFDA 3OXGA 1Q5YA 4IDKA 1FXDA 4W92B 1WG5A 4PG8A 3E2EA 2H51B 2HVDA 5J2NB 4PPZA 4RR5A 1U02A 3W8PA 1R8PA 3PYEA 4B08A 3GTYX 2X51A 4RZRA 2DNRA 4MIWA 3MXHP 4IYQA 2X1FA 1NCLA 2IDLA 2GAGC 1FFWB 2AIRB 2DPJA 1U0HB 2FHJD 2H9ZA 4DQPA 3DLJA 5HMXA 2Z2YB 1WKJA 3CB4A 4B9NA 2CPFA 4FPIA 4NX9A 4N5SA 1FFGB 1PJ7A 3SDEB 3GLJA 2B56A 3LP2B 3SQOP 1E6VB 1FE0A 1ZPVA 3KK2A 3BKUA 4DL5A 4DSLA 3DMJA 2GZOA 3FQLA 5H9FJ 3KK3A 3O6QA 4CTAB 1HQUA 2FY1A 2C2OB 2OELA 5EWGA 4LMZA 3UD3P 4B9UA 2XGPA 1WC1A 2PT0A 1O51A 3VQTA 4PXCA 4ZP7A 2ASLA 3PR5B 4QIEA 2BX6A 3UN5A 1RT5A 4ES3A 2JJ4D 1UEVA 3BYPA 2QSWA 2VPXB 3J7YU 2FQQB 1ZM4A 4E8UA 1Q16B 2MPUA 1ZTTA 4RL1A 1Q5VA 4A8WA 2LEPA 1MMDA 2ZH4A 1Q8BA 2W9CA 2RHSB 1VQSA 1S79A 4OZJA 1DHMA 1SCJB 2HZAA 5IQ6A 3CULA 3HVTB 2LECA 4KE5A 2ZH6A 2Q43A 6AT1B 2VQEF 1AXQA 1EP4A 1V3ZA 3A1YG 4RWXA 3X1LB 3VGUA 4ZCIA 3F0NA 2YWGA 4QU7A 4YB7A 2JHEA 1H2TZ 1T0TV 3PKYA 4TNOA 4N8NA 2CFXA 4F67A 1XNQF 4JV5J 1HNIA 1CULA 2AEJA 3I96A 4PG7A 1RT7A 2KJVA 3MCNA 1OPIA 3KDOA 4DZDA 4OJGA 3G71S 1NSAA 2ZBIA 2AJQA 1RAHB 1ZAWA 2YPZA 3RUBL 4CP5A 1QUVA 3MPVA 4F3QA 1HQ2A 4OHZA 2X1GA 1PGZA 4N47A 1M5SA 2E7WA 4DSEA 4I1TA 4I2PB 1UAWA 4LF7F 4MYUA 2POKA 3MFHA 3DYAA 4DUZJ 2APOA 3W1YC 3MOJB 3NS5A 1VQ4S 3TZZA 2GS8A 4OX6A 2OMOA 2Q66A 4ECXA 3EXCX 2BJ9A 3PEJA 4LRAA 4EBEA 4ED8A 3D0HE 4PQUB 2AP6A 1NZAA 4O0NA 4Y34A 3LW5C 2BE2B 5HMZA 1IKXB 2VC1A 2DR5A 3C2PA 4OYPA 2JLFA 2HNDB 4ZVSB 1A0OB 2DHGA 5E7OB 1DJ0A 3MAHA 1Q7LB 1VI7A 4R0EA 4IH5A 1SIWB 3VQSA 2NUUG 4CWBA 1HIYA 1T03A 2M9KA 2GQ2A 2W2NP 3C6TB 5EWEA 5KFZA 4X4PA 3GFZA 3T5JA 1FNMA 5KFIA 3AOBA 4DFMA 1YQHA 2JVRA 2RQMA 3TARA 4PG4A 3HXMA 2QLJB 1S7IA 3CCLS 1MROA 2P8IA 2V4RA 4ZVPB 2B9YA 5KFOA 3BKTA 2JWNA 3A3PB 1WHYA 4ZKAA 3K2YA 1RT4A 3B4MA 2ACMA 2RAQA 4MKAA 3I32A 3TJ8A 4ITSA 4DQIA 4A8KA 4NZ6A 3KUGA 3KFWX 3CUNA 2XYHB 2MEWA 3NNHA 1TU0B 2ZKUA 9RUBA 5KG4A 1S4EA 4LBPA 5CAAA 1QDUB 3KLIB 2R7QA 1RWXB 1JLCB 4RW7A 1H74A 3GR1A 1HQEB 4C9DA 4OQJA 3QSIA 2LEBA 3PYDA 5BR8J 3EE3A 2L48A 4IG0B 3PACA 3A13A 4DI6A 2ALZA 3OVBA 5E33A 1QSSA 4HL9A 1SL2A 4M5LA 4DLEA 4FZVA 3TUIC 3DI6B 2UUAF 2E5GA 4U67Q 3UQSA 4KHRA 4PWUA 2DIUA 4ZPTR 2J0QD 1Y3KA 5C42B 5H9EK 1XMOF 3J81Y 3N79A 5KG2A 4HYKA 3L3CA 4F25A 1CLFA 4ZS6A 3CPWR 1S10A 2HVZA 3M30B 1QAJA 2MLZA 4LSLA 2OPSB 4HDHA 3PJXA 4IOAQ 1V3SA 3OFFA 1WACA 1OY6A 2FYXA 5EN1A 1LOUA 2FGCA 3VZIA 2YNGA 1TK8A 1E6YA 3SIPB 1FKOA 1FCAA 3THTA 5HQLA 1RWKB 2U2FA 3AOCA 2R7RA 2Z30B 5HSPA 2FLOA 1HI8A 1KVJA 3CMQA 2AEFA 3UDLA 4DF4A 2QL9B 3RBZA 5DDOC 3ZTOA 3KYLA 3VAKA 1S5ZA 5IM0B 5J1PA 1RWNB 4OI3A 1WKKA 6FDRA 4AT1B 3UCZP 3C3LA 2QJ3A 1HD0A 1FDAA 2DCLA 4Q45A 1NRKA 3TJ9A 4DUYJ 3BSOA 1CVJA 3KUEA 3R8YA 1U1MA 5LXYA 2E1RA 2GGPB 4QWDA 3NAIA 1GAOA 5HATA 2OH2A 3WC0A 5CHCB 1WC5A 2R7UA 3PW5A 3QRPA 5KFJA 4BLGA 2HNZB 4MAKA 4PYAA 4F0KA 2K7KA 4AQYF 5L1JA 5HROB 2VJUA 2ILYA 2MMYA 4K4YA 4DX5A 3PG9A 1X0FA 5DLGA 3TUZC 2BQUA 4NA1A 4LVOP 2B5JA 2V8HA 2XY5A 2I0XA 5A6PA 5CD4A 4DR4J 3L9ZA 1SC6A 2GIQA 3ZTPA 1WC3A 4NXMJ 1JJHA 3AXMA 2GIRA 1WEXA 3LH2S 2FHMA 3PXGa 2ZH1A 1M5VC 1SC4B 1FRJA 2P2CB 4QBUA 4J9VA 3FK4A 3W5YA 3K7RA 1NH7A 2LQ5A 3CXCR 5DETA 1M1HA 1MN7A 4QW9A 3GCXP 2V0NA 1QUPA 4ZITA 3J81U 3K5OA 3W7BA 3RJMB 4F0HA 1OO0B 2LDYA 4FKYA 2JC0A 4IR1A 2HIYA 2E5LF 4PRFA 2VG6A 2EK6A 4K7QA 4G1IA 1YI2S 4EUVA 3R5DA 2HHSA 3JQJA 3DDKA 4Y2KA 1JQGA 3H20A 4HHJA 3ZTQA 3BH7B 4OHVA 1VQOS 2NXNA 3POTB 4PWWA 1IXKA 1Y4ZB 2GO9A 1NZ8A 2MKYA 3GJSB 4O23A 2YQ0A 4WTYA 5D0EA 1WD6A 1TV6A 3G8QA 2CPEA 2ROPA 2CPDA 1V9OA 3H59A 2RJZA 4G1PA 2W7PA 1CSJA 3CDUA 3PEHA 3T6BA 2QA2A 4OI2A 3FBBA 2RF2B 3QMQA 3UCUP 1T95A 2ZZMA 4A47A 1SKWA 3NKYA 3HP6A 2AKWB 4QQBA 3CVKA 4IG3A 4NLXA 4HI2A 4F26A 2B3TB 2HK2A 1X7VA 3SV3A 3CD5A 2Z58B 1F5CA 2J9DA 3HSZA 3PYGA 5HQ8A 1SKRA 3OVAA 1Q82T 4UY8T 4QYRA 3DRYA 1O6XA 4QIVA 2XEXA 3FEYB 1ZTWA 5D78A 4EEYA 3FSIA 1VBZA 3QFWA 1YBAA 5HVGA 3U1LA 1RWOB 3AQPA 3QJJA 2RS8A 4ILLA 3C15A 1U1PA 4B3MF 4IFYB 5I3PA 2YWKA 3PTWA 2RVJA 1LEOA 4E0DA 3FEXB 2B8PA 4IH7A 1U1QA 4K59A 5KT7A 2BACA 2UV8G 4CH7A 3H7HB 2IA6A 2GJFA 3V6DA 1AZSB 3GZ7A 4FYYB 2R8HA 4ZCKA 2I9SA 4YR0A 1YKWA 4A8SA 2XCAA 1FJEB 3HK2A 5KTQA 4YDXA 4ZVHA 3T1YF 2O1PA 1RGVA 4K8RA 1BY9A 3RGIA 3MAAA 1UFWA 3N6LA 3DHXA 4CO0A 4DF8A 3AT1B 4F4WA 2CQDA 3GB0A 4RBTA 2OPQB 2F8EX 1Y11A 2IPOB 3L7UA 4ZMMA 3F56A 1HWIA 5BYRA 3FC9A 2EWHA 4YFUA 3R5CA 2B7CB 5KT2A 4AFFA 2VUGA 2QT7A 2K06A 3DU6A 3TA1A 1UJ5A 4ETXA 1JMTA 4LF2A 3GV5B 3KJVB 2HGLA 4DX6A 3D5MA 3Q8PB 3TZWA 4KPCA 2OTJS 4MK8A 5CCMA 1VDHA 3D68A 5GAGI 3NOCA 1HARA 4CH1A 2R7OA 5J2QA 2BANB 1X4DA 2XB2D 3A8KA 2LA4A 3PNIA 3UR0A 2PMHA 4DV3F 1GTEA 3KLHA 3DOMB 1F60B 2V63A 2GX8A 3BN7A 3AQOA 4RBUA 1U6BA 2BM0A 4YB1P 2E9RX 1CC7A 2JC1A 2EI5A 2HKEA 5B0EA 1SXLA 4USVA 4AUKA 4NWBA 2G2YA 1JJ2R 3R2DJ 2FHOB 1NPPA 4ZN3A 2DXDA 3TVZA 4TU8A 1RTZA 5DDQC 1OY8A 2CJBA 3KTQA 2NSBA 1OQ3A 3PW0A 3HSGA 1MMLA 1VIXA 2BR0A 4B3SF 2QGFB 2UUBJ 4R0JA 1VBXA 3LAMA 2QX0A 1U09A 2E9TA 4YB5A 2WW4A 4J9NA 4LF5J 3EDQB 1SV5B 4QPXA 1IKVA 2UUCJ 2WOMB 2DNNA 2HRUA 1KNZA 2YWWA 3U1MA 1S1VB 3VGTA 2OPPA 4WFZA 4UQGA 2E1AA 8RUCA 1R89A 1AUSL 2UVUA 5IQQA 4U7CA 1KHVA 2DISA 2NYHA 4KHPJ 1N6QB 4WXOA 2ZVSA 4PUOB 1AT1B 2ALYB 4CLTA 1O5JA 5C24B 3KKFA 4ZK7M 4DSFA 3BGOP 2ZE2A 3G8SA 4O3PA 4RPFA 1VGYA 5HLFA 3FVYA 2WVEA 2WBRA 1I1GA 1YJNS 4ECUA 3M8PA 1AA1B 1KRPA 2XO7A 4ICLA 4H54A 1XMBA 4WYWA 1FFSB 3FCVA 2G9OA 1N32J 3GJRB 4CT9A 3BGUA 5GMDA 1XIQA 3TVYA 4F2RA 2N3LA 1YRUA 2RE1A 2ZWOA 4I2QA 3CCQS 1FDNA 1S1XA 1NPKA 2R7VA 3PX0A 1RQ0A 2DGXA 4QYZK 3OTDA 3JAMU 1REVB 3RBXA 2RF2A 4MIBA 1FRHA 4P74A 5A0YB 1GX6A 2YY3A 1YZ6A 5AE1A 4JI7J 4B3OB 3MI7X 1RWWB 4DQRA 3PDNA 2HBQB 1K47A 3V4IB 3IWXA 1IM6A 1GXLA 3NGUA 1T05B 1R0AA 3DM2B 4NA2A 1SQGA 1ZOTA 3SSQA 1WC0A 5KFGA 4QU6A 5CYMA 3PKMA 1RT3B 3KK1A 1L3VA 2C3PA 4LT6A 3IP0A 2DNKA 2VBWA 1DFDA 2YWHA 1VRQC 2RQCA 1I94J 4NZ0A 2J9DE 3AJDA 2A2CA 4KB7A 2MQOA 2XLKA 2A1BA 2KM8C 2VKZG 4UT4A 2BMBA 1WF2A 2IRUA 3OT9A 4G65A 4W90B 5JUMA 2AQ4A 2C2ZB 3WC2A 2IVYA 2RRNA 1HA1A 2N4CA 4F0MA 4GKKJ 2WHOA 3GV7B 4KKOB 1U8SA 3T9NA 3OTOJ 2KHCA 3K59A 1PILA 2XS2A 3KLEA 5M2PA 1PG5B 2WRMA 4O3OA 3O8WA 2G1DA 4A46A 2V34A 1RHUB 2HNYB 3JTPA 3M32A 2C3YA 1GMWD 3CD7A 1QVGR 2Y1JA 4H4KC 2CQ3A 1REGX 2H4YB 1RACB 2E29A 4C11B 2ASDA 4PEOA 1RU2A 4FYWB 1RP5A 4USMA 2OLWA 2MXYA 3TEHB 1N5QA 1IKWA 4DEZA 3ENWA 4KPYA 1U6ZA 1LW2B 3C6UA 1S6PB 4Y2AA 1ZM9A 5F8MA 1ZETA 2UZAA 2K3IA 4YY3F 5LMNF 1HLWA 2L3MA 2R4FA 3EZUA 4OYAA 3VAMA 4RBVA 1RT6B 5ETRA 2NPFA 4OI4A 2EK1A 5D0HA 5G0RB 2DR7A 1B0VA 3CMAS 2CG4A 1XNRF 5L9NA 3M8WA 4B9LA 3W2VA 5GMKa 3DRRA 1T9WA 3TO8A 2BRLA 1H38A 4GVBA 3VVTA 3KWMA 1LKZA 4OV1A 2V5HG 4ECZA 1V3RA 4WWSA 3HHEA 1RSCA 1TUWA 2WSFC 4DR3J 2NREA 2UXDF 4OLOA 1FDBA 5B09A 1RWPB 3H8YA 4JV1A 3KLVA 3QQCD 1XQIA 3AA8A 5A8RA 5J2MB 3R7NB 2AEMA 2DNYA 5H1SV 3LP1A 2BOPA 3P5TL 3T19A 4P10A 4M5IA 3TNVA 4CNZA 1U1RA 2EG1A 2PE8A 3IG1B 3R5GA 5IFMA 4G6VB 1IJEB 2MGZB 2Z8QA 5HK4A 3UWTA 5LSRA 3GG1A 2Z57B 4NLVA 2H65B 4H4OA 2MQMA 2PI5A 2RKIA 2XI3A 3TOQA 3BPSP 3FZ2A 2MZ1A 4FYDA 3DHWC 2EPIA 3R27A 1RAFB 2QO3A 1F9HA 4NZ7A 2PMWA 1TL3B 5T14A 2MQQA 1VISA 1KLMA 4GRSA 4YR3A 3MZIA 3BO4A 4LR9A 3EXYA 1RHKB 3FUYA 1IBKJ 1PCAA 1F5AA 2AF6A 2DHSA 1TFYA 4FN5A 1XMQF 2KFZA 1GEHA 3DLKB 2PIIA 2Q6CA 5L1IA 2YVSA 2QC3A 2Y1RI 3K0JA 2HFSA 1VQ8S 2WCXA 1VJQA 2CNLB 2C42A 3HZEA 3H5UA 1QE1B 2RMLA 5JJBA 4LFCF 2OEMA 3LPYA 1G2EA 2E5JA 2CPIA 2NZ4A 1K9MT 1TMJA 1EETB 2WSCC 5FD1A 2WVBA 3CJKA 4R8UA 3MMJA 4CO2A 1KLNA 3K89A 4DL3A 3MEGB 1PAEX 2LA6A 1DQAA 3CJ2A 5AJ3J 5ETNA 4NLWA 3EYZA 1HBMA 5D77A 1KQSR 5L46A 5D4OA 4KTQA 4BC9A 4OFZA 2IVFB 3LO3A 2YH0A 5SUHA 1Q86T 1KOHA 3AJ1A 2CQHA 3SCKE 2HK3A 1VQYA 2PA3A 1YG0A 2PEHA 2XMKA 3EX7B 3GMGA 3P96A 1WEZA 4P2XA 8AT1B 2XI2A 2IJNA 1N34J 2EFOA 2CWXA 2HWTA 1EQMA 4NLUA 5C25A 4E2FB 1DTTA 1RTHB 3B4DA 4C3KA 5KFYA 4DPUA 4LF9F 2LP4A 4P75A 1OPZA 1PC5A 2CJXB 4WIIA 3GSDA 4DSKA 1RT3A 3FDSA 4F8RA 4HKQA 1YITS 3NEKA 2J9EA 3MTKA 4NASA 1D9DA 3NNAA 4NRUA 3JYTA 1WDDA 1VR6A 4P72A 3HHLD 3M8ZA 3P3DA 1SVDA 2F4VF 4A48A 3ZZOA 4ZA1A 5E0OA 5KFVA 3MM8B 2AYEA 1UFKA 3IN5A 3QWPA 3NCPA 4LF8F 3CTRA 4OYOA 1DY3A 2H4WB 2AYGA 1O8BA 2MKJA 4H4MB 4K2JA 4X4SA 5CZVA 4DDFA 5J2PA 3PZPA 4ENOA 1CQMA 3I9V9 1NJWA 4DR2F 3M2RB 2RUGA 1MW7A 4OJHA 4RNHA 1HW9A 4DV0F 3BZQA 4ILMA 2VA3A 3M6XA 2AMCB 2XMAA 1U24A 1CJKB 5AT1B 4EO8A 4URQU 3HFVA 3SSSA 3GP9A 1JNZB 4OLPA 2KTQA 5FLXY 4EZ6A 4ZCMA 1T3NA 1Y00A 2ZH2A 4IRDA 3VAGA 2DJWA 5ETLA 2QN6B 4OX9J 3JXOA 2OPRA 4GC6A 1DQ8A 2VHGA 3O44A 2KZZA 1WUUA 4IFVB 4M5GA 1NB2A 3DDNA 3CJ8A 1NPRA 2W2PP 1RT6A 4RO0A 2COLA 2X3GA 1XERA 1DQ9A 3AA9A 4YHHJ 1VRUA 1YJWS 2CJ9A 3CCWA 3EVOA 1GTHA 2GFFA 2VBYA 3ET6B 1JXEA 4ZVGA 4WFYA 5FDLA 1G7CB 5GADI 4AL7A 1UWAA 5D6GA 2JSXA 4M5KA 2XM3A 2O67A 1VMBA 1XR7A 1RZMA 3HLUA 3IXQA 1M0SA 4TKTA 4ECVA 5LOQA 4HR2A 5ETPA 3GILA 4L73A 1S1WA 4FXVA 2BJ3A 3ZZPA 1FNXH 1LWXA 4B3RF 1S12A 4NXNJ 2VONA 5B7WA 4RW9B 5ETKA 5HAOA 3DLGA 3PJWA 2ZJPQ 4KT0C 1R43A 2HFVA 2ZH3A 4NLSA 1CJVB 1LWFB 2BYCA 1SL1A 3HI9A 3PJ9A 3IS9A 3K8VA 4HTJA 4K4XA 2DH8A 2LXUA 4LFBJ 3D0GE 3D6FB 4DUZF 1C1CB 2QMUB 3EMTA 4IQXA 1Q8IA 5DQHA 1XK8A 4MFBA 2CKWA 1YDLA 4GKJF 2MJNA 1P1TA 2UP1A 1NSKL 1RLDA 2AWZA 4EBDA 3FMWA 5F8NA 4X66J 2BBEA 1G6BA 2F8HA 3MPYA 3ZZ0A 5I42B 1JLQA 2EC2A 1ZA2B 2XLIA 3QSYB 1LWCB 4OHXA 4RLEA 2OO4A 2V50A 2K1RA 4PAAA 5GMEA 5FLXU 4WFNQ 4DG1B 2UXCF 3LA0A 2R7SA 4WZMA 2VPYB 3GYNA 4Q2MA 2FJDB 4F3OA 4O4GA 3CC2S 2VU5A 1EETA 4EYHB 2BVZA 4XTTA 4DL7A 4DZ6A 4NPOA 1ZA1B 3KHLA 3WX4A 2YXLA 3MPWA 1WORA 2OFHX 3MCOA 1WF0A 3UVJA 2FC9A 2ZITA 2UXBF 1URRA 1NJYA 1EKRA 1Z2LA 4HI1A 2JLGA 2QFJA 1SL0A 4J9LA 1S6QA 4CIOA 3DRPA 2QL7B 1L3SA 3MTJA 2DGSA 3GIKA 4IQMA 2EFPA 4TU9A 2ZOGA 3OR2A 4CLWA 1NSQA 2C2KB 4J9SA 1EHWA 4W4MA 3QATA 4ZPCA 3TAQA 1C4AA 4K5SA 1QJHA 1KWMA 3LGNA 2FVRA 5B0FA 5L39A 3MM7B 2I1RA 2LCWA 4EFAC 3QBCA 5ETMA 5DG9A 2IIHA 4OZ1A 5DM7Q 2VV5A 2JEJA 2MSSA 4N41A 2ZD1A 3GYXB 5E3CA 3QYYA 4J37A 2ATCB 2D3O1 3KHRA 2J7KA 1YJ9S 1WJ9A 2VQFJ 3MM8A 5DDRC 4K5RA 2EW9A 2RB7A 1BQMB 3SFGA 2MY8A 1Y5NB 3V81A 3P6YC 4XO0A 3Q24A 4RX6A 5GAEI 3W61A 1XN9A 1TMMA 4DV5F 3HVRA 5ETOA 1HPZA 2OD6A 1QTNB 4RKUC 4FF1A 5DQGA 3MFIA 3H5SA 1FD2A 3M2RA 4LRBA 4X4VA 4M1KA 3BV8A 4TQSA 1NO8A 3QGIA 4WK3A 4DFJA 3IGVA 1U1OA 3IRXB 1RHQB 2K7JA 3RAXA 2CIMA 2KG0A 1NJXA 1NEEA 1A7GE 2JNJA 1TL1B 4EK2A 1RTJB 1ZM2A 1S48A 4HT5A 3TRGA 2GQCA 4LBHA 2YX1A 2E1MC 3TYTA 1N5VA 4YR2A 5D3GB 1TVRB 4J90A 2LVWA 4JI1F 1T94A 4O3NA 5L8RC 4DR7F 4F7VA 2R2RA 4XDDA 4V19J 3UD4P 2J76E 4Z37A 3MR3A 1EIYB 5LSOA 4LIWA 2MY7A 2E5HA 1U48A 1WSVA 4WBFA 2FPHX 3QLHA 3C46A 3J7A1 2UU9J 1VYAA 4KRWA 3MD1A 3MECB 1OMSA 2OGUA 3AAWB 4KIAA 4DCJB 5LT5A 3T6JA 4NXMF 1BWEA 3T1HJ 4A4JA 5KG5A 1BLUA 2YWEA 5F8JA 4QW8A 1O0PA 3UN3A 1NNDA 5EX0A 2HHTA 1Q79A 2R3VA 2XSJB 5I3UB 1WOSA 5RUBA 3I0SB 4EYIB 2L9NA 2ADBA 3WX8A 2VG7A 1HBNB 1HNVB 3HF5A 3MEEA 4G1QA 5JVGQ 2MKSA 2ZOFA 1CJVA 2DRAA 3JSMB 1SJ4P 1U25A 4JI4F 4JV0A 2J8AA 3HHDA 1HNXF 2NUHA 4FS1A 3OFHA 4LFAF 2EVZA 3K5MA 4JYAJ 2XG8A 2B51A 2KZMA 1DLOB 1C1CA 2KHDA 4LRDA 1NMEB 2DO4A 2QA1A 4RW6A 3M8QB 2YNHA 1NDCA 1RDRA 1U49A 3TQ1A 1QAYA 3PX6A 3PM9A 4CYUA 3ENVA 3HJVA 3MWBA 4ZVQB 1J5OA 3CJ0A 3JSRA 2HQGA 1HBUA 4HACB 1TKZB 2O5DA 3W2WA 3LWMA 4KGMA 2HRYA 1S4FA 1F9EB 2AV5A 5AE2A 3IRWP 2MB0B 1FX2A 5THWA 4DG1A 4X4QA 3OFGA 2KFYA 1U2FA 3CJSA 2V4JB 5CYQB 3CNQP 1M5PC 3SCLE 4U9RA 1DBDA 2DB1A 1HWLA 2N7YA 4MMOA 2XY7A 4AL6A 3QT7A 4DL2A 2RSQA 4QR0A 2C3MA 3PFEA 3KOAA 1KQKA 2W2OP 5C2CA 2OSQA 3EJMA 1RAOA 2ZKTA 4ZP9A 5E2QA 4O4RA 2RT3A 3S6EA 4C7QA 3I5AA 1VRTA 4JB8B 1FKPB 1B99A 1BQXA 2CA9A 3LUYA 1BUXA 1P27B 1B7YB 2YNFB 1S1TA 5HBMA 2ZH8A 1WHWA 2XMWA 2ZBQA 3RZAA 4DU8A 3M2UA 1FXLA 3MEKA 1RK8A 1NK9A 1JLAA 3WIVA 3Q23A 3I4HX 4A8OA 4WK1A 4L3KA 3PIPQ 3M7VA 4FDFA 4ZLLA 4LR8A 1IQTA 3TP2A 3R6GB 1P9YA 1XWLA 2RU3A 3BGFA 3KK2B 4YUDA 3BR9A 3MM7A 4EO6A 2VDHA 3DMJB 2VQEJ 1UPMB 4RNMA 2DNGA 3KK3B 3Q86A 3V6KA 4FF4A 3OR1A 1C4CA 1HQUB 4MKVA 1HI1A 2NXCA 2HS0A 3BO2A 4QIFA 1S6UA 1Q53A 1S97A 3CJQA 2IVMA 1D3WA 1XNQJ 1C1BA 3GIRA 2J0WA 3IR6B 3N01A 2DRDA 1FEHA 4X4OA 1RT5B 2I8EA 3BGRA 2G2OA 3R1LA 2C2EA 2XBPA 3UDCA 2OP5A 3MCMA 4FVMA 2XMVA 3S01A 4WFAQ 3KMSA 4DJBA 1DZ5A 4CLSA 2I5JA 4NLOA 2FC8A 3J7AN 3IWNC 5LMUF 2OSRA 4LF7J 3ILLA 3K17A 2KO1A 4Q44A 3NCRA 4IRKA 2A10A 2ZBCA 4PG5A 2QLXA 3LALA 1FHTA 1HYSA 3T5LA 2R7XA 3NWRA 1HNIB 1CULB 1U45A 1RT7B 1DURA 3EWGA 4USUA 2DHHA 4WU2A 1T9TA 4FPRA 3B54A 2D3ZA 5DZ6A 5EGYA 3ILOA 1FJGF 3BBBA 3NGSA 1IBLJ 4DX8H 4C8KA 1AB8A 1WC6A 1S0MA 5T7LA 2VFSA 3QJPA 5L1LA 4LRCA 4UTGA 1OWXA 5EDWA 4BC7A 4DQSA 1RE1B 2Z4PA 1GXTA 2PEBA 1DAXA 3HMJG 1MU2A 2CJQA 2DRBA 2J5AA 4WJBA 2LU2A 3U27A 3DYAB 2V94A 4KH0B 1AW0A 1JX4A 4J9KA 4W98A 2VPZB 4PR6A 4P2MA 1FK9B 2VKRA 3WHIA 4MT1A 4Y3CA 2KRBA 2MHEA 4TQRA 2PN6A 4NEZA 2BJ1A 4K2XA 4ZPVR 1LQ9A 3RAQA 4HHHA 4NYZA 2HIQA 4Q8EA 4K0KF 2ZH5A 2PDAA 3HFZB 1HNVA 2UVWA 3W5ZA 3MEDA 5AXLA 2MZTA 3EPIA 1NK6A 4F4XA 1U1NA 4IRCA 3IAS9 3HHNB 1YJTA 4ZJOA 3D6TB 1TUGB 1CJUA 1WEYA 3GJTB 1I51B 1C0UA 1P8GA 2CNNB 4ZVUB 4UQTA 3JB9k 3B82A 2EKYA 1MROB 4CZCA 3SSRA 2QV6A 1HL6A 1FERA 1RT4B 2AGOA 1C0TA 2R8GA 3GPAA 2BXJA 1R0CB 2D7SA 2UUAJ 3M4XA 3W63A 3KNAA 4B3TF 1QM9A 3NCQA 4DPWA 2CDRB 2B4VA 1UWBA 3RW6A 4EBCA 3H2LA 5IS2A 1RWUA 3R7BB 3CCSS 2FDNA 1EQ0A 4NCGA 4U7UD 3EGNA 4CLPA 4D3GA 3GQCA 5K9FA 2EG2A 3ITHA 1UP1A 1XMOJ 5DG7A 1R27B 3W64A 3RBDA 1JLBA 3QJLA 2FLLA 1KFDA 3VGVA 4V1Ak 2J9CA 3R5AA 2DGVA 4UW2A 5IC6B 4RW7B 1RTDA 2WK4A 4DLGA 1X5TA 2GC8A 3MUMP 3ULHA 5CYQA 1LXJA 2F1FA 1SIZA 3A8JA 1DRZA 5J1EA 1F0XA 1IR2A 1CPZA 3PRVA 3A3NB 4ZVEA 1CS4A 3N6MA 3WQPA 4ZHRA 3D9BA 3AOAA 2DEIA 5A8KA 2GA7A 2ZUGA 3M1VB 3IA0A 2B6AA 1W2IA 2NPIA 3MR6A 2Y3YA 2HFZA 2IMWP 5K8NA 4JI3F 1FKPA 2BW7A 4OI0A 1NK7A 2AHOB 2HS3A 5ETQA 4DV7F 5KFAA 4JI6F 2YNIB 4OYMA 2YNFA 5F3TA 2DHXA 5K20B 5KFXA 1N48A 2ZJRQ 3DOLA 3OHBA 4DR6F 4J91A 3C14A 2XSFA 1G1XA 3VGSA 5HQMA 3IGNA 4LSLB 4ECWA 3D3BJ 4L72B 2FTRA 3OLBA 3JTOA 2IC3A 4NYOA 4I4BA 4Z2XA 2VL1A 2YNGB 2CQ0A 3AFGA 1E6YB 4QWAA 2FZCB 4AQYJ 1FKOB 1UZDA 4HLBA 2BE9B 2BQRA 1ITPA 2WB4A 2KYXA 4U8YA 4B17A 2D41A 3GU0A 3BN4A 4Z7YA 5CYJA 3D0IE 3CIZA 1V5IB 3J7YI 3I4PA 1S1UA 4C0HA 3T41A 3DKDA 3OTCA 1JIHA 3NBPA 1PYOB 2HG4A 4OX7A 4QIGA 1QY7A 2JLEA 3LAKA 2NLWA 2CPXA 4USHA 3QGHA 2XULA 2FD2A 2CVEA 1N54B 4N77A 1VQLS 4MKYA 4DS5A 4OZLA 2O01C 2FJWA 3SBMA 4I68A 1D0EA 1U2CA 1K1QA 4DPTA 2E5LJ 3QGPA 2DITA 4C8YA 4LF4F 3SYZA 2BJ7A 1X31C 5KFHA 1JLGA 1BWVA 1EAYC 2E1CA 1S9FA 2BRKA 3IAM9 2B5JB 3QT5A 5EX3A 3T9ZA 3Q8SB 4OJ1A 4I6YA 4IO1A 5KT6A 1JKHA 4ATNA 5F3ZA 4I7FB 1X5SA 1WG1A 1NK4A 1UVJA 2MQ8A 1OSDA 3LPEA 1VQPS 5I4MA 1X9WA 3OL7A 4DV4F 5D0GA 3QFHA 2E7XA 2PO4A 4ED0A 1X60A 4P2SA 4I0WA 1Y10A 2F65A 3PO5A 2GJ2A 4JV2A 3T5KA 1LFPA 2BV3A 2XY6A 4E98A 1MNEA 1GXUA 2CJKA 3O2IA 2VG6B 3DNCA 2F9JA 5LJ3Y 1RBLA 4PWDA 3K58A 1S0VA 3SV4A 1ICEB 2JEFA 1FK9A 3NXZA 3EVWA 3FBEA 1JWWA 3I5BA 2QE5A 2XZTB 4Y2CA 2HMIA 4CLZA 3QIPB 3OSPA 3HJFA 4C6AA 1TV6B 1RTIA 1FTCA 3BYRA 1B7FA 2PD1A 1VC5A 2NS1B 1NLKL 2DY1A 2HAIA 4Q5VA 2KB2A 1RT1B 4B3MJ 3FZBA 3I55S 2HSEB 3TI0A 3ETMA 1B4SA 4LVNP 1YSJA 4XK8C 2GCFA 4P7TA 3J7ZT 1WELA 3THVA 4NL5A 2CDQA 4TXSA 4DR5F 5A2QU 1RWMB 3DU5A 1UW9A 2CQ1A 4DCPB 3DC2A 4IG3B 2V4QA 3QO9A 3H98A 5KG6A 1L5UA 3CE8A 5KFNA 4ERDA 3QNWB 3I31A 1X4FA 1ZBTA 2W4DA 5IV4A 5HL7Q 2WONA 2R42A 4ANEA 3LWLA 1PYTA 3T1YJ 4UOFA 5F8LA 2I6WA 1H3DA 1WI8A 3BQ1A 1FRIA 4NLQA 2GNKA 1R31A 1IM4A 5A8WB 4WE1A 3G8TA 4KQZA 3UDVA 2GVZA 1FEEA 5KT3A 2B4PA 3C15B 3GWCA 1P6TA 1FI4A 1N33J 5H9FK 2J0SD 2FY8A 3H4BA 5BYSA 3CCRS 3MURP 5IT0A 4L75A 4IOBA 4JI5F 1H0HB 4WYLA 2VOOA 3RB6A 3CCMS 1SJRA 1UPPA 2KJWA 2W4PA 3M1VA 3V6DB 4O3RA 3M2VA 3IR7B 1RHRB 3OL6A 2U1AA 5L9XA 3ZZUA 3TR5A 3MD3A 4DV3J 5C2GA 2Y0SD 3G2XA 2C3UA 4OMFG 1HR0F 3MAAB 5MAOA 4URSA 2KG1A 1K8AT 3H0PA 1N5YB 2YNIA 4RWWA 3E8OA 4WCEQ 4WP8A 2JOQA 3TUJC 2V8VA 3T5HA 3R1HA 3NG8A 3DGPA 2YWFA 5KG3A 1HFEL 4KO0A 3CJRA 4JI2F 2YKNA 1SJFA 4I6WA 3BDPA 4ZVTB 1S9GA 2CWKA 4NI2B 1NB7A 3R5BA 3SCIE 4J9MA 2QIFA 4ED5A 5J2QB 3ZZZA 4B3SJ 2CRLA 4PPDA 4YOEA 3DN9A 2RUSA 4CM0A 2FVPA 2HFNA 3KLHB 3N4WA 5CABA 1FJ7A 5BJRA 1RA6A 3MMCA 4N7TA 3TUPA 3OJUA 1EZZB 3AODA 4DR1F 3BF4A 2Z2ZA 1Y9OA 2J7WA 1VOMA 2MKIA 2HWHA 4MK7A 3ELHA 3PV8A 2E5IA 3HHLA 2KT5A 1VLOA 1R3NA 4ER8A 5CA5A 4YDDB 2D1CA 2B8QA 3ISZA 1BHNA 2QFIA 3TEGA 4L76A 3NS7B 1T9UA 3G6VA 1D1UA 1MWYA 4YHHF 4ED6A 2CZ4A 2BKPA 1K73T 3EM1A 3BO3A 5KFTA 2ROGA 4YQWA 2RRBA 1YWXA 1FF2A 3RR7A 2MDAA 1YHQS 3MM6B 2NZCA 1SH3A 1K1SA 5A6WA 1IKVB 1B64A 1H72C 1X4BA 2UVVA 2GV1A 4TYAA 4I7FA 2OPPB 3RAMA 3MM5A 3LANA 1YIJS 1WHVA 1N36F 3Q22A 2NXJA 1MWQA 4FF2A 3MMBA 2H1YA 4I6AA 2P9CA 2OAUA 2MQPA 5AE3A 3Q2SC 1A6LA 1YK9A 4YN3B 2CVIA 2ZE2B 3W5XA 4FYVB 4LFBF 3BQ2A 2YKPA 3TANA 5HLFB 4KGZB 5CZXA 1S99A 3VWSA 1BE4A 1VHIA 1RCOB 2W1BA 4KGVB 3RW7A 3TVKA 2EFQA 5F0WA 1BQNB 1ZAVA 3M8PB 2VICA 4ICLB 5EWFA 3W8GA 3BREA 2LEAA 1D9FA 1OQ6A 4DV1F 4CLLA 3H42A 4DN0A 2ZEJA 2HFUA 3W62A 1S57A 4HH1A 2AYMA 3QIPA 1S9EB 4X62F 5GAHI 3G82A 3L95X 4K4WA 2EFVA 4I2QB 1RISA 9ATCB 3UR3C 1HD1A 1LW0B 1U7LA 4FBTA 3BDEA 4O44A 3B78A 2HEKA 3MR5A 2DGQA 3AD9C 1RT1A 1S1XB 1YBTA 1PJ6A 5HANA 5IOLA 3AJ2A 1RB0A 5GAHU 1SC1B 3E01A 3OXLA 4B9SA 1HW8A 4OJ3A 2KH9A 1YGYA 2HZCA 2P5VA 1IWGA 2XHWA 1JJ4A 1ZAXA 4I69A 3V4MA 4C3LA 4JOUA 1VC0A 2RNEA 3HT0A 2LDIA 1R0AB 3WIUA 1SH2A 1UZHA 4V19X 3VALA 2QG9B 5CYMB 5A8WA 1NHUA 3GIIA 5F8GA 3KK1B 3FFIA 2V69A 2ZC3A 4LSNA 2KKHA 2CZVC 4C8OA 1T9VA 1N0UA 1HBOA 4EZ9A 5AXNA 4ZP8A 1X9MA 3GCWP 1W25A 2DIVA 1KSPA 5JXSA 2M3DA 3D2WA 1JXVA 4YY3J 5LMNJ 1ROFA 1Q7YT 1XEZA 3D67A 3FBFA 3KDNA 1TZ0A
chains in the Genus database with same CATH topology
2K2PA 2BE2B 5B08A 5HMZA 1IKXB 2OFHX 2VC1A 4M5DA 2DR5A 3C2PA 2ZJQQ 3MUVP 3AH6A 3PRDA 4ES1A 3FNNA 2JLFA 2HNDB 2HHWA 3NP5A 1WF0A 3KLEB 2FC9A 3DOKA 3AB2B 2DHGA 1ULRA 5E7OB 1DJ0A 1VK8A 3MAHA 2ZITA 1Q7LB 2UXBF 3M32B 1URRA 1NJYA 1VI7A 4R0EA 2NR0A 2XGQA 4WKYA 3I87A 1Z2LA 4HI1A 2JLGA 2QFJA 2BZ2A 3GE9A 4IH5A 1SIWB 2BJDA 2NUUG 3VQSA 1SL0A 4J9LA 1S6QA 3MGJA 4CIOA 3DRPA 1N5YA 1T03A 2M9KA 1SV5A 2GQ2A 1L3SA 3C6TB 4WXWA 5EWEA 3MTJA 5KFZA 4X4PA 2DGSA 1JLGB 3GIKA 3GFZA 4IQMA 3RB0A 3T5JA 1FNMA 5KFIA 2EFPA 4DFMA 4TU9A 2WOMA 2ZOGA 3OR2A 1YQHA 2JVRA 5KG7A 2RQMA 4J9SA 2B9XA 4PG4A 3TARA 1S1VA 3HXMA 1A9NB 3CCLS 1MROA 2V4RA 5KFKA 5KFOA 2B9YA 1IKWB 1JKHB 2JL9A 2MZSA 1T3OA 2JWNA 1UVMA 4ZPCA 1WHYA 1GQEA 4ZKAA 3TAQA 3K2YA 2DNZA 1RT4A 1C4AA 2GMJA 3B4MA 3VR1A 4K5SA 3C6UB 1QJHA 5SZTA 2KVIA 1SH0A 4MKAA 3K5LA 3LGNA 3I32A 2FVRA 5IT9Y 3DLEA 4ITSA 4DQIA 1N6QA 1M5KC 5B0FA 4NA3A 2KU7A 4A8KA 2C28A 3G9CA 4PUOA 4NZ6A 1Z2ZA 3KFWX 1DARA 5L39A 3CUNA 3GIMA 3MM7B 2ZM6F 5C24A 4C3MA 4LUBA 4ZDNA 2I1RA 4GO7X 2LCWA 2M52A 2J0XA 4EFAC 3NNHA 2R8KA 2ZKUA 2QZ8A 1S49A 5DG9A 1NK0A 5KG4A 3CCJS 4OZ1A 5DM7Q 2AYBA 2M0GB 2JDJA 1KHWA 2VV5A 3RRGA 2JEJA 3KLIB 4TU7A 2MSSA 3VF0B 4N41A 2R7QA 2ZD1A 3GYXB 5E3CA 3W2VB 3QYYA 4NOHA 4J37A 1R7IA 2UUBF 3DRRB 3KHRA 5KAKA 2J7KA 1JLCB 4O3QA 4RW7A 1YJ9S 1D9AA 1M90T 2RQ4A 3GR1A 2E9ZA 4LF5F 3MM8A 1GH8A 1HQEB 5DDRC 3I6PA 4K5RA 2EW9A 4PWDB 2HPUA 5HN0A 2RB7A 4C9DA 4OQJA 2LEBA 3HVAA 2IAJA 1FRKA 1BQMB 5B0CA 1N88A 2UUCF 2L48A 4IG0B 2W8LA 3SFGA 2MY8A 1Y5NB 3MCSA 3PACA 3V81A 3P6YC 4F02A 4XO0A 2VG5A 3JAMY 2DH9A 3M9NB 3Q24A 2ALZA 2MQLA 4RX6A 4DWIA 5GAEI 2CPJA 1XN9A 3J7Z5 3KHGA 3OVBA 1SUQB 2R7TA 4DV5F 3HVRA 5E33A 1QSSA 2DR9A 1HPZA 4HL9A 1SL2A 2OD6A 4Y6IA 2NXUA 4RKUC 2HMIB 5DQGA 4DLEA 2VBZA 4FF1A 3MFIA 3H5SA 4FZVA 3TUIC 1Y7PA 2DO0A 3DI6B 4UOCA 1VQ7S 4ID5A 1WTBA 2UUAF 2E5GA 1FD2A 4KHPF 5HMYA 3M2RA 4U67Q 1RTIB 2XMTA 4RW4A 2F8MA 3UQSA 4X4VA 4KHRA 4PWUA 5A8RB 4M1KA 2DIUA 2VFVA 4Y2MA 4ZPTR 2HVHA 2J0QD 5KT5A 1QAXA 4TQSA 3LP1B 3TAMA 1IUJA 1NO8A 1TL5A 1Y3KA 3QGIA 1REVA 3PY8A 2IFXA 3WDOA 1J5EF 2AJ4A 4WK3A 3IGVA 1IKYB 5C42B 4DFJA 1U1OA 3FQKA 4HTIA 3IRXB 4PXBA 2K7JA 3RAXA 5FIIA 1XMOF 2CIMA 3J81Y 3PW4A 2ACYA 1Y3JA 2KG0A 4X65F 2ZDPA 1NJXA 5A0YA 3N79A 1M1KT 4L3NA 3ZZTA 5KG2A 2HYIB 1KVIA 2P9EA 1NEEA 3MAQA 1A7GE 1TL1B 5B0GA 2UVRA 4NCBA 3MM6A 5ITHA 2DBBA 2GMHA 4HYKA 3GR0A 4F25A 1RTJB 3L3CA 1CLFA 1ZM2A 4ZS6A 4TY8A 1S48A 3ENQA 2OIHA 3CPWR 3O3LA 2EFGA 4HT5A 5KOXA 1JLEA 4B3OA 1S10A 4H4OB 1RI7A 3TRGA 2RKIB 1H2VZ 2HVZA 3NAHA 1YVFA 2GQCA 3TA0A 5M2RA 2YX1A 3M30B 2E1MC 1QAJA 1K0VA 4LSLA 1N32F 1L3KA 2OPSB 4M95A 4HDHA 3PJXA 3TYTA 3V4IA 4BS2A 1N5VA 1S6OA 4YR2A 5D3GB 4IOAQ 1TVRB 1V3SA 4QCLA 2LVWA 3OFFA 4JI1F 1T94A 4O3NA 3QO9B 3Q8RB 5L8RC 1P9QC 2M70A 1WACA 4DV2F 1T05A 5EN1A 1LOUA 2FGCA 5IXUA 3VZIA 4DR7F 2R2RA 2YNGA 4XDDA 4KSEB 1TK8A 3UD4P 4V19J 3DM2A 3F41A 2MKKA 2J76E 4Z37A 1E6YA 3MR3A 5LSOA 1FKOA 1FCAA 3THTA 2WONB 4KAIA 3DCAA 2MY7A 4LIWA 4AE5A 1KLMB 2E5HA 2MZRA 1U48A 3S1TA 2B0GA 2FPHX 3QLHA 5K14A 4QWEA 1UA0A 2U2FA 3C46A 2PFFB 3J7A1 2HQIA 4PXEA 3GIJA 2R7RA 3VAJA 3OTEA 1X4EA 2FLOA 1HI8A 2EBEA 4RU9A 2M2BA 4WE1B 1KVJA 3MM9A 3QWUA 1OS5A 4KRWA 3MD1A 3MECB 3UDLA 1BD6A 1KTQA 1U4BA 1TKDA 3X3UA 3Q2TC 4DF4A 2AX0A 2ZFHA 1VS3A 3AAWB 5DDOC 4R25A 3JTNA 3KYLA 3VAKA 4KIAA 3GFYA 1BC6A 5DJBA 3I0RA 5LT5A 4F50A 3T6JA 5IM0B 4RNOA 3T3FA 2A18A 3PVXA 1Y5LB 5J1PA 4NXMF 1BWEA 1BQNA 2MYFA 4OI3A 2ZH7A 4JI7F 4A4JA 5KG5A 4FVCA 2ZHAA 6FDRA 4K50A 1BLUA 2YWEA 5F8JA 4QW8A 3UCZP 3C3LA 3VAHA 4QOTA 1O0PA 5HP1A 5DRKA 1NNDA 1HD0A 1IBMF 5DGBA 1FDAA 2DCLA 2LYVA 4Q45A 1NRKA 3BSOA 2DK2A 4KKOA 4ZLPA 1CVJA 5EX0A 3CJKB 2HHTA 5T41A 4R8UB 1Q79A 1U1MA 1VQNS 5LXYA 3CCES 2E1RA 2GGPB 2ZZNA 4QWDA 3NAIA 1GAOA 2XSJB 2XWYA 5I3UB 1S9EA 1DTQA 2OH2A 3I0SB 3WC0A 3N9UC 5CHCB 3FCHA 2BQ3A 1KFSA 2R7UA 3PX4A 3PW5A 5KFJA 4JI8F 4C4WA 3M2VB 3NRBA 3MR2A 2HNYA 5DLFA 2HNZB 4MAKA 1LW0A 2L9NA 4MJKA 4EYIB 2VG7A 2K7KA 4AQYF 2ADBA 1VC6A 5KFUA 1HBNB 5L1JA 1HNVB 3ZZRA 5HROB 3R3TA 2ILYA 3HF5A 2MMYA 3MEEA 4G1QA 5JVGQ 1Z4UA 4K4YA 2MKSA 2ZOFA 4J9RA 2DRAA 3JSMB 1SJ4P 2ABYA 1X0FA 4NMLA 1HBMB 2P6SA 1RT2B 4QR2A 5DLGA 1U25A 3CJ4A 4R5PB 4I56A 4C11A 1U47A 3TUZC 4JV0A 1FTRA 3GV8B 2BQUA 2RILA 2J8AA 4NA1A 2KM8B 2FUG9 3HHDA 4LQ9A 4LVOP 4NLTA 2C22A 2B5JA 1T02A 1HNXF 2V8HA 2XY5A 2NUHA 1B0PA 4FS1A 2QMXA 1VQMS 2I0XA 3OFHA 5A6PA 1I94F 4LFAF 2EVZA 3PRBA 3OVSA 3K5MA 4U6PA 2XG8A 3CSKA 2B51A 2KZMA 1DLOB 1C1CA 2KHDA 3TW0A 4CO1A 2B9WA 1SC6A 2GIQA 2ILZA 1W2BR 2DO4A 5DM6Q 2QA1A 3SCJE 2N4DA 3Q8QB 4RW6A 3V5RA 3VZHA 3OPKA 1H7XA 1GX5A 2HHPA 3M8QB 1JJHA 1LW2A 3H2VE 1S6PA 2YNHA 2FLNA 2GIRA 3HVWA 1RDRA 1WEXA 3LH2S 2FHMA 1Q8LA 4RNFA 4ELUA 3H40A 1U49A 1UVNA 3TQ1A 2AJ1A 1HMVA 2J6UA 2V9KA 1QAYA 4KO0B 3PX6A 2CQCA 3PM9A 3ENVA 1TKTA 3PXGa 2ZH1A 1M5VC 1MSWD 2W25A 2I38A 1FRJA 2YKNB 4QBUA 3MWBA 4NRTA 2KT2A 4KV8A 3K7RA 1NH7A 4GKKF 2LQ5A 3CXCR 5DETA 1J5OA 3CJ0A 4QW9A 3KLFA 1AFIA 1S9GB 1GNKA 1TP7A 2V0NA 3RU0A 1QUPA 3C66A 5C25B 3JSRA 3OTOF 1DTTB 5G0RA 4RNNA 2DNPA 3V2UC 2W9BA 3K5OA 3HT3A 2LQ9A 3H5XA 4CH0S 3W7BA 4ES2A 1HBUA 3FMBA 3K57A 2L08A 2VZ9A 1OO0B 4JI0F 1TKZB 1F9FA 1XBWA 2LDYA 2O5DA 5KFLA 3W2WA 4CT8A 3QZ8A 2JC0A 3LWMA 4KGMA 4IR1A 1S77D 2HRYA 4F4ZA 1S4FA 2AV5A 3I5CA 2E5LF 5AE2A 3IRWP 4PRFA 2Z0GA 2IJFA 3OQ2A 2VG6A 1U1LA 4A8XA 3KNGA 2MB0B 4X4NA 3GG0A 4O0IA 5THWA 2EK6A 4G1IA 4ILRA 1YI2S 3H2UB 4DG1A 4EUVA 3JYTB 1T8EA 2GMLA 3R5DA 4NLYA 1PO6A 2HHSA 3CT9A 3DDKA 4F4YA 4ZPAA 4Q0BA 4Y2KA 3RYLA 4X4QA 1YRTA 3OFGA 2KFYA 1U2FA 1HNWF 3OXFA 1T7PA 3OBIA 3NWGA 3G86A 3H20A 2V4JB 5CYQB 4HHJA 1XC9A 3DLHA 4OHVA 1M5PC 1JXLA 3DXBA 2IYIA 3MMCB 2HHXA 2K3KA 2VASA 3SCLE 1VQOS 4U9RA 1DBDA 5GADU 2DB1A 3VTIA 1HWLA 2DHAA 3POTB 2N7YA 1IXKA 1Y4ZB 2GO9A 3DRSB 4MMOA 4CO3A 2XY7A 4AL6A 3V6HA 3F73A 4DL2A 2FVQA 2RSQA 2ZNZA 2KT3A 2C3MA 4O23A 3PFEA 4QR0A 3RTVA 3KOAA 4WTYA 2M4MA 1KQKA 1UL3A 2FVSA 3MF5A 3KLGB 3CC7S 1WD6A 5DG8A 2B43A 2OSQA 3OUYB 1TV6A 2ZKTA 3G8QA 5H9EJ 4ZP9A 5E2QA 2CPEA 5J2PB 3SZ2A 2ROPA 3JSYA 5J2MA 4O4RA 2CPDA 2AW0A 2VBXA 2RT3A 1V9OA 1FRMA 3H59A 3S6EA 2PA8D 2V8GA 4C7QA 3NL0A 5F0UA 4DSIA 3HHLB 3I5AA 5A2QY 2RJZA 3E3XA 4G1PA 2CPZA 3QAUA 1VRTA 4YMEA 1SJQA 2W7PA 2OFGX 1CSJA 3CDUA 3PEHA 1FKPB 2RDIA 4A8MP 2L9WA 3T6BA 2PMZD 5E3PA 1BQXA 3IG1A 2CYYA 5ADZA 5IWAF 2XC9A 4LJMA 3LUYA 2QA2A 4OZ0A 1P27B 2LLZA 5D4NA 2MGZA 2ASJA 3UPFA 3PR4A 4OI2A 2YNFB 1S1TA 2RF2B 3QMQA 1HHSA 1RYRA 4KFBA 3ONQA 5HBMA 3HPOA 1CEZA 3UCUP 2YKOA 1T95A 3PW7A 2ZZMA 2ZH8A 1Q78A 1WHWA 4A47A 1SKWA 1WWHA 2XMWA 4B9VA 3NKYA 1K0TA 4DHVA 5F9NA 3RZAA 3HP6A 2XS7A 3M2UA 1FXLA 3MEKA 1JLFA 3HX9A 4QQBA 3ZC4A 1R6YA 1RK8A 3CVKA 2KXNB 4IG3A 2DH7A 3CIMA 5LXRA 1NK9A 4X4UA 1JLAA 4Q43A 1D8YA 3Q23A 4DBQA 3I4HX 4NLXA 4HI2A 4A8OA 1N4LA 4WK1A 4F26A 3PIPQ 4A8YA 1RKIA 2B3TB 4DN9A 3THPA 4DR3F 4IR9A 1X7VA 3SV3A 2FVCA 3CD5A 1IQTA 1V6HA 2KRRA 3TP2A 1KN6A 1F5CA 2ZNYA 4NYPA 2J9DA 1TL3A 3A8EA 4GO5X 4U7UK 2D3OR 2GHPA 4MKBA 2XZWA 1XWLA 3D28A 3MM5B 2RU3A 4AXJA 3IFEA 5HQ8A 1SKRA 4K4UA 2OPRB 2B4OA 3BGFA 3OVAA 3KK2B 2L41A 4YUDA 1Q82T 4UY8T 3BR9A