3MZIA

Crystallographic structure of the pseudo-signaling state of the bluf photoreceptor pixd (slr1694) y8f mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
SLYRLIFSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNETYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRPSAMDPEQCLNFLLDIAKIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and Structural Studies of the PixD BLUF Output Signal That Affects Light-Regulated Interactions with PixE.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Protein binding
molecule keywords Activator of photopigment and puc expression
total genus 29
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mziA01
4ZOSA 2EW9A 1TL5A 1KQKA 4ZA1A 2GV1A 3LGNA 1Y0HA 1YRXA 2RILA 2BJEA 3I9ZA 4FNIA 1SQEA 3HDSA 3LGMA 1K0VA 5B0DA 3HHLC 2GO8A 2ZDPA 4EFAC 5A6WA 3VTIA 1AFJA 1N5TA 3UDCA 4Y2MA 2ROPA 1FESA 2QYCA 1ULRA 2RMLA 3KKFA 1FEEA 2AP6A 1AW0A 1URRA 1GXTA 1Y3KA 5B09A 2ASYA 2N4CA 2OMOA 1FD8A 1N5SA 1FE4A 1Q8BA 2KT3A 2HLUA 4OJGA 2AW0A 1S6UA 2XMJA 5K9FA 4A48A 2XMUA 3CJKB 2IYGA 3QMQA 5B0BA 2XMKA 1N5VA 1AFIA 2OP5A 1QUPA 5A6PA 3DCAA 1TL4A 2W4PA 1KVJA 4OJHA 1S6OA 4OJ3A 2OD6A 2LQ9A 1TZ0A 3HF5A 1MWZA 3HHLD 5IXUA 1X8DA 2FTRA 2K7KA 2OFHX 4YEAA 5KAKA 1FVSA 2ROGA 3TNVA 5B08A 4HH1A 4Y2KA 1APSA 2XMWA 3LO3A 2GFFA 1XBWA 2FHMA 3BM7A 3MZIA 4HH0A 2FB0A 3BR8A 1WD6A 3QGPA 3TRGA 4F67A 3FGVA 2IYIA 2HFNA 2RU9A 4A47A 1FE0A 2PD1A 1RJJA 3IWXA 2LXFA 4FNHA 2HLTA 2W4CA 5F0WA 4HI1A 4HL9A 2FIUA 1OSDA 2ROEA 3TOQA 4DL0C 2K7JA 1GXUA 1VQSA 2N7YA 3BF4A 2KKHA 5B0FA 2K1RB 1MWYA 2K1RA 5T7LB 3FRYA 5T7LA 1OQ6A 1R6YA 2AJ1A 3CJKA 2BYCA 1W2IA 2AJ0A 1YJTA 1LQ9A 3KG0A 3HFKA 1V3ZA 3KNGA 2BUNA 2XMTA 2K2PA 4OJ1A 4Q2LA 1X0PA 2CRLA 3BDEA 5B0EA 1Q53A 2GGPB 1YG0A 3GZ7A 3BB5A 3K7RA 2XMVA 3T9NA 2L3MA 2ZDOA 5B0GA 1N5QA 3DXSX 5B0AA 4YDXA 4U9RA 1Q8LA 4OIXA 2GA7A 1YJUA 3BN7A 1CPZA 1U7LA 1YJRA 3FMBA 3WDOA 2QLWA 4DPOA 4QOTA 2N4DA 2XMMA 4NL5A 2OKQA 2KYZA 1JK9B 1TUVA 2GGPA 2W4DA 3MCSA 1P6TA 3BGUA 1IUJA 2KT2A 4HI2A 2HQIA 3E8OA 1CC7A 2G9OA 5F0UA 1CC8A 1FVQA 4A4JA 1Y3JA 2GCFA 1Y9OA 2RSQA 2OD4A 3HX9A 1SB6A 3F44A 2HIQA 2QIFA 4NPOA 2OAUA 1JWWA 1P8GA 1OQ3A 3HHLA 3HHLB 4A46A 2HFOA 2VV5A 1VQYA 2Q3PA 1Q4RA 2VH7A 3KG1A 4Y2IA 4DN9A 1TR0A 2ACYA 2BBEA 2LQBA 1YJVA 2BJDA 2IFXA 2PGCA 2JDJA 4Q2MA 1KVIA 1SI9A 1X7VA 5B0CA 3IWLA 2OFGX 1OPZA 2LDIA 2QLXA
chains in the Genus database with same CATH superfamily
2GAHC 4KHMA 3QAUA 4YB6A 2EW9A 4M94A 3KWMA 1HI1A 2W2NP 3HM9A 1GT8A 4DR6J 4IH5A 4FZVA 1ZZFA 3O1LA 1WSVA 1VIOA 1RI7A 5E2QA 1HNXF 4J9SA 4RW4A 1WC0A 1IBLJ 2C2OB 3HDSA 4TY8B 3T1HJ 1MMLA 1SJ1A 4LSNA 3VTIA 3I4PA 4ETXA 1QTMA 2YXLA 5IT4A 4ER8A 4TNOA 1C1BA 3KKFA 1VRQC 4C2MA 2DO0A 3LWLA 4ZCKA 4ECTA 5AXKA 4DPXA 2CQIA 4XDDA 2ATCB 2KB2A 5A76A 5E3AA 3NMRA 3ZTQA 1GMUA 1R0BG 3PFEA 4MKBA 2FLLA 4JI1J 2NSCA 3V4IA 3BSNA 1KD1T 2CPIA 2RUSA 1M5HA 2M9KA 3KK3B 1S0OA 4WJBA 4OJGA 5F9NA 3K57A 3I31A 2CVIA 4F0KA 2CPFA 4KSEB 3JS9A 3W60A 3UDVA 5LXYA 2MGZB 3DLHA 3QIPB 4MIWA 3PEJA 4J90A 5KFAA 1BQXA 4K2JA 1S1TB 3SBMA 4QW9A 3HF5A 1JJCB 2V0NA 2HFZA 1MWZA 3BO4A 2VG6B 4ZLLA 2IRYA 4MAKA 3R1HA 4CTAB 1MU2B 4OQJA 2H48B 4MFBB 3LF0A 1Y5LB 2VOPA 1YJ7A 2FHMA 1X4FA 1UVKA 3EZOA 5D4PA 1XEZA 2WVBA 4KGZB 2NPIA 3TRGA 4JI6F 1EP4B 1ZA1B 2FVQA 4ETZA 4OI0A 1Q7YT 4YHHJ 2KVQE 2D3OR 3VR1A 3M8PA 4GVLA 1HI8A 5AE3A 4J9PA 4LF6J 3V6DB 4PWDA 5KT3A 3KK2A 3TYTA 2DIVA 1WG5A 2Z30B 2Z57B 3IR7B 2ALZA 1TFWA 2HVIA 2HVHA 2LA4A 2CJQA 1SL2A 3A3NB 3L3CA 4IR1A 3HFKA 2E9ZA 2HGMA 5BR8F 1DLOB 1HD0A 1UEUA 1OYEA 1Z4UA 3VWSA 4TY8A 4DUTA 1Q53A 1WEYA 3OHBA 2E9RX 1RKIA 2HS0A 3D7SB 3TWZA 3RG6A 1HFEL 2QLFB 4ED0A 4LF2A 5EWFA 1H74A 3SQGA 5ITHA 1Q78A 2APOA 2WBRA 2PT0A 4CH0S 2XY6A 1N5QA 2LXIA 4ZVEA 4PXCA 4E0DA 5I3UB 4FYVB 5J2MB 1KFSA 4F4KA 2G2OA 3HD2A 5E3PA 1UJ6A 4AFFA 4DPOA 3M30A 3PCOB 1WOSA 2MQQA 5CYMA 2N4DA 4NL5A 2G1DA 4WE1A 2HRUA 4F0HA 3C6TA 3UN5A 3UWTA 1VQPS 4EZ9A 5F8HA 3I96A 2D9OA 2H54B 1PBAA 4I2QB 1K0TA 4DSJA 2EBGA 1CJTA 3H59A 3W3SA 2GCFA 2GMJA 1Z2ZA 1JLBA 2A18A 3IM8A 1RTIA 4DS4A 2DH8A 2LQ5A 5HATA 3VGSA 4OV6A 4BBYA 4HACA 3BBFA 2UVUA 4B9VA 3DXBA 3W61A 5DG7A 2OO4A 1H7WA 4KPCA 3HFVA 5CH7B 3KLGB 3T5HA 1NDKA 2HQCA 1NJXA 1Y00A 4DQRA 2ZUAA 5DDQC 2J9CA 3KUHA 1CG2A 4DN9A 2YQ3A 4OL8A 3L7UA 2RIJA 2ACYA 4IO9Q 2DYAA 3IFEA 3QT7A 3PY8A 3BO3A 3Q89A 5IWAF 2AD9A 4IR9A 1IM4A 3MM7A 1SI9A 2UV8G 2DGOA 2GVZB 3DI6A 4DZ6A 2OFGX 4ZPDA 1N36J 2COLA 3KDNA 3HT3A 3RTVA 2OSRA 4OHZA 3EZ5A 5KFUA 3NGTA 3V5RA 1VQOS 2V2VA 3IC1A 2KDOA 4DL2A 4GKJJ 4FVMA 3E01B 3Q24A 3HVWA 2UV8A 1FWLA 2ZKUA 3H0PA 4NLQA 5HL7Q 3PW4A 2DHGA 1C0TA 3WZ0A 4IG0B 5D8HB 2D9PA 3HHLC 1FERA 1DZ5A 2B5JB 2QA4S 4OI4A 1OSCA 2M88A 1HD1A 2QYCA 1PSDA 1RU2A 5A2QY 2FC8A 4LR8A 3EVWA 3KK1A 1HNZJ 3KFWX 4K4VA 2JHEA 4EK2A 2B4PA 5E3RA 4LF1A 4CP5A 1GXTA 2FHKA 3NS6A 5KFPA 1NMEB 3MEDA 2J7UA 2OGUA 3W2WB 1PYOB 2QRRA 4DX6A 4PXEA 2KL8A 1VI7A 3E3XA 3M2VA 3UN3A 3DGVA 4URGA 5DG8A 2KT5A 3CD5A 2MEWA 3TEHB 2YWFA 1BUXA 2ZJPQ 4DV0J 1OYDA 2RS8A 3B82A 2QN6B 4PG7A 1VRUA 4ED8A 2K06A 2CADA 4OZ2A 2Z2YB 3IM9A 5ETOA 2W4PA 2DPIA 5A0YB 4QQBA 1FJGF 4UQTA 2ZC4A 4TLRA 3M32B 5FLXU 3RJMB 5BYQA 1H2VZ 3GYNA 4LT6A 1FKOA 4XPCA 1WJ9A 3G8SA 3MEDB 3SYZA 4OYOA 4DF8A 3NCRA 4FYXB 5HQMA 3R97A 1RDRA 3VHQA 4CQ1A 1NPRA 2X1BA 4A8FA 3T6JA 1WD6A 3Q22A 2EXUA 3FGVA 4A47A 1F3VA 3SCKE 1RJJA 2HAIA 1U1QA 4DQPA 2QE5A 4A8OA 2F4VF 3VGUA 4B3TF 3HULA 3ULHA 3LP0B 3H20A 2W01A 7FDRA 2J5AA 2VPXB 2J0SD 2B3TB 2RKIA 1K9MT 2KKHA 1NZAA 5B0FA 2K1RB 3AHPA 5T7LA 3PHEA 2X1GA 2V50A 3RB3A 4JV2A 5DO2A 3NEKA 4C0HA 3MR2A 1U45A 2VQEF 4OJ1A 1YQHA 2VG7A 1Q81T 4DUYJ 3FKBA 3CDWA 3E51A 1FKPA 3DLKB 4MJKA 3JSYA 1BGXT 3SMZA 1M90T 1UVIA 4PPDA 8RUCA 5E41A 3MMBB 2I1RA 2DNQA 4QIFA 4R25A 1S1TA 5LJ5Y 1DQ9A 4M5NA 5KFLA 1S59A 3KK1B 3T1YF 3JAMU 3PKMA 2Q1LA 4DV6F 2KJVA 4RZRA 1MW7A 1R43A 4WXWA 3HSJA 1S49A 1CPZA 3M8QB 1AA1B 1UAWA 1YJRA 1D3WA 3LP1B 4NRUA 2KM8C 2LU2A 2NXNA 3OLAA 4DR3F 1XMOJ 1KN6A 2ZEJA 3A13A 2HPUA 4DCPB 1EQMA 3MEEB 4DV7F 4RW7B 3PX0A 3BBCA 3N5FA 2KT2A 2RQ4A 3PRBA 2G9OA 1RAFB 1YSJA 3UVJB 1RWKB 1RT5A 3CGIA 5E5NA 2P9CA 5HBMB 2W8LA 1JKHB 1VR6A 3PXGa 2QMUB 2QMWA 5I42A 3SSQA 3LTOA 3I0SB 4YFUA 4ZIWA 3P5TL 2AJ2A 2MQOA 4F8RA 3I0RB 4ZKAA 3BGFA 4R5PB 3RW6A 2HHSA 3GFHA 2XHWA 3M8QA 4F02A 3MECB 3D3BJ 5H9FJ 3THVA 3J80Y 2BBEA 2UP1A 4JI0J 2FHOB 2VQFF 4J9MA 4AE5A 4DR2J 3NRBA 3W7BA 2F1FA 5DLGA 3R3TA 1QSSA 4F4WA 4AUKA 2XWXA 4JP8A 3MFIA 4L76A 1QAIA 3NCPA 2E66A 4USTA 4QW8A 1RQ0A 3LALA 1HHTP 3ICLA 4KB7A 1VLYA 2C2KB 2DY9A 1PJ5A 3DOLB 4KH0B 1AB8A 2HZCA 3K8WA 3QPIA 1ZYQA 2FJBB 3OSPA 1B0TA 3I9ZA 3PDNA 2NZ4A 3OHAA 2AGOA 2C42A 1G7CB 3M6WA 3HSZA 2BOAA 3FBBA 3K0JA 2HHTA 2F8MA 5I3QA 4EFAC 1Z1ZA 2ZC3A 4TLQA 4USUA 4C3KA 1KQSR 1N5TA 5IZHA 3UDCA 1RT1A 1VMBA 2PMHA 1JNZB 2AYEA 5EGYA 4X4SA 1YHQS 3CCLS 1HL6A 1AXQA 4DG1A 4RNHA 1Y3KA 4ED4A 2LA6A 1T9TA 3IS9A 2B9WA 4P6QA 1UW9A 4ZCMA 3MMJA 4U8YA 3W5YA 4FS2A 2QC3A 3PG9A 1J5EJ 5CABA 1IJEB 2JLFA 4N8OA 4RLEA 4ZLJA 5CD4A 1NNDA 1GX6A 3KLHA 1L5UA 4DG1B 3I56S 1IQTA 4CLTA 5IQ6A 2X3GA 3OXFA 2V8HA 1PIEA 4I6AA 5ADZA 2QV6A 3OVSA 1K1SA 2IVMA 1JXLA 3CULA 3PW2A 3K5LA 3MM9B 1PYSB 2D7SA 2IRUA 4IQMA 4LRDA 3CMAS 2RQCA 4P71A 2CQ4A 3CCZA 4ILRA 2FTRA 3TW0A 1H2UX 2Z56B 5KT2A 2VPZB 4HH1A 2XB2D 3EMTA 2ZH6A 3MM9A 2KHDA 2FB0A 2F5GA 2QO3A 3DNCA 5ETLA 1TKTA 1YJNS 1WEZA 2FPHX 2RQKA 3JYTB 5D15A 2P9GA 2EFNA 1VQKS 3KUGA 4LREA 2CZ9A 3VQSA 4I64A 4LIRA 2E29A 1SVDA 2ERRA 2ZBPA 3NP5A 1C0TB 1GNKA 1LNQA 2OLWA 1D0EA 2AEJA 2LCWA 3BF4A 4BLGA 2Y8YA 4FF4A 3O8WA 3KDOA 4KGMA 4O44A 1LKZA 3EPGA 4IG3A 4MYTA 3VAFA 2BUNA 4RW9B 5CHCB 1XQIA 3R6GB 4AXJA 2CA9A 4JI2J 1NB2A 5HI7A 4NLDA 1HMVA 2IAJB 4NOHA 1U09A 3DLEA 4DHVA 2CUYA 3CDEA 4JBCA 2YX7A 2YX4A 1AT1B 3HVTA 4P52A 3QWUA 1HI0P 2VIHA 5KFHA 4YR0A 4NLPA 1PC5A 5D0HA 3NAIA 3SDEA 4M5KA 5CD4H 1U1RA 1HNIB 1HQUB 5CYMB 1R8PA 1REGX 4C11A 5F8IA 1AYEA 4A8QA 1JLAB 2V2ZA 1R8CA 1KLMA 3MTJA 1RAHB 4OYBA 3NNCA 1T94A 2M3DA 2DGVA 1Y3JA 2E5GA 3R5BA 2UXBJ 3OJUA 3BKFA 1NDPA 3L9ZA 1RWOB 4EU0A 1TL7A 2YNGB 1XMQJ 5HK4A 2WW4A 1GK8A 2MYFA 3DDNA 3MWBA 2PN6A 1XNQF 2UUAJ 2D3O1 2Y0SD 4EO8A 5JMNA 2HKEA 4R0JA 2YY3A 3MUMP 3BKTA 1VIXA 2G2ZA 3MDFA 2KI2A 2XULA 4CDIA 2ZFHA 1QSLA 1NPKA 2QGFB 4PG4A 4Z37A 3HLUA 5T41A 5LXRA 2VJUA 1VQ4S 2Y0BB 5MLCV 3A8JA 2JFDA 4KO0B 1S6QB 1WWHA 2QJ3A 3W63A 2MZRA 5L1IA 3RAMA 3ZNJ1 4A8XA 1S1XB 3D0IE 2CPDA 2EVZA 4MIBA 4PYDA 1YLXA 4S0MA 3M30B 1TK0A 1URNA 3M05A 5GAHU 1VK8A 1U1OA 2X3DA 1VC0A 1X4HA 5I3UA 3I5AA 1TK8A 2E5IA 2RILA 2V63A 3D4JA 3UO0A 5KFWA 2QL9B 1M5PC 4W92B 3NNHA 1MG7A 3GV8B 3M32A 3H42A 3ITHB 2N3OA 1A0OB 4C6AA 1WORA 2BANB 1C4CA 5GAEI 4PR6A 3SI8A 4KHPF 1SC6A 1X5OA 4UOCA 4Y2MA 4DR2F 5J2NA 2HHHJ 3W64A 1FESA 4FXDA 5FIIA 1H7XA 2KRRA 1AW0A 2VDIA 2V8PA 4P7TA 4LF4F 1NJYA 2X1FA 4P10A 2C3MA 2Q6BA 3MHYA 2A6OA 1SC4B 2IIHA 3FQKA 1FD8A 1UW4A 2HWHA 3TZYA 1IKYA 3TJAA 3IN5A 1YI2S 4DLEA 2HK2A 2L9WA 3J7AN 3QGIA 1FD2A 2BJ1A 2UXBF 1YK9A 2ILYA 2NQPA 5ETVA 3BQ2A 1SV5B 2V6AA 3LPEA 5CQGA 5BXIA 3S7RA 3JSMB 4C48A 3RAXA 4HYKA 2UVWA 1N4LA 1HW8A 1KNZA 2RHSB 5KOWA 4ITSA 4F4AA 2HNYB 5IT9U 1HWLA 4G1IA 1L3UA 5KAKA 3G6XA 1SC1B 3M8WA 1X5TA 2FVPA 1QSYA 3RRGA 1D1UA 3HHNB 3TQEA 3UD5A 1B7YB 2XMWA 5D0EA 3ZO7A 4DV4J 3B8HA 2GVDB 1OIAA 2KZZA 1XMBA 1ELOA 2BE7D 4ANDA 1K47A 1ZPVA 2CNKB 2HFNA 2DJWA 2VF3A 3AQOA 4USJC 4B17A 3CEDA 3MCOA 4DV2J 4ECWA 1JLGB 1R8AA 2HNZB 2ZNYA 3CT9A 3C6UA 5M2RA 3JAMY 2DR8A 2DNYA 5E3CA 5A2QU 4Z2XA 2LEBA 1UVMA 2FIUA 4I67A 2H1YA 4DS5A 1B0PA 1M5KC 4M1KA 3QNWB 4FPRA 3NY0A 5HMWA 5KFFA 2NUUG 4WBFA 5I3PA 3G2XA 1EX8A 2BYCA 1IM6A 1FNXH 1SKSA 1LQ9A 4EBDA 2DGWA 2IM3A 2CYYA 3D9BA 5J1NA 1X0PA 4WFNQ 3HXMA 4QU6A 2ADCA 2W9CB 3HSDA 1D8ZA 1UZDA 2DBBA 3CXCR 2BANA 3J7Z5 2BEFA 1CULA 5IM0A 3EICA 2W1BA 3RW7A 4QYZK 2HHXA 1NXIA 2W24A 2WSEC 3RUBL 1KOHA 1YBAA 2Z2LA 5HQLA 1SUQB 3M2UB 3CIMA 2F9JA 1P27B 3O5TB 2KN4A 3S6EA 2MZ1A 2DRBA 1GTHA 4FXVA 2NXJA 3NNAA 2KYZA 4P9SA 1UMJA 2FY8A 3TEGA 3OL7A 5KFVA 3DOLA 2MQ8A 3NWRA 4DX7A 1X9MA 3KJNB 4LFCF 2IC3A 1RT5B 3T19A 3BH6B 3PYFA 4Y3CA 4DV7J 1FK9B 1XR7A 2LLZA 2NXCA 5C2GA 2X7IA 4IH7A 3LA0A 3B4MA 3IP0A 3LUYA 2DR5A 2GW8A 5AXLA 2C3PA 5HO4A 3AA9A 3GFYA 2PA3A 2F3JA 1OY8A 4NEZA 1KR4A 1SJFA 3D1OA 1VJQA 2CPEA 3KG1A 4KFBB 4RBTA 4DZDA 5E3QA 1TR0A 1F0XA 3C16B 4ZJOA 3BQ1A 2L9NA 4IKAA 4J37A 1DJ0A 1EP4A 3VAMA 1F1BB 1U26A 3M6UA 4ID8A 4X4RA 4WZQA 1H2TZ 1FI4A 3SCLE 1F5CA 1HNIA 2A0FB 1TL5A 1FWKA 4ID5A 3ZNUA 1EAYC 4DPWA 1F3FA 3J7ZT 1HHSA 1GX5A 1RT4B 3D67A 4FNIA 4ANEA 4ZVOB 2JEJA 2AGQA 1S77D 3HK2A 4Q0BB 4QWBA 1YBUA 5LM7E 2W7OA 1F5BA 1SJ3P 5IWAJ 1BMQB 3SSRA 2JVRA 5K14A 2HZAA 1C2PA 2ROPA 4LBPA 4AXIA 2NCKL 3PYDA 5DGAA 1JMTA 3N9UC 2HMIB 2CQ3A 5K20B 2E44A 3DHXA 3SQGB 3C46A 1MSWD 4NE9C 1LK7A 1TL3A 5KG7A 3DRXA 1LWFB 4U96A 3CC7S 3MM6B 1R8HA 2J0WA 1N5SA 2R7QA 1S48A 1R0AB 4Q45A 2K3IA 3FEYB 3KJVA 2EEYA 2E1CA 2P2CB 1DAXA 5KFSA 2YWHA 2YKMA 4MTPA 4O4GB 4C0OC 2R3VA 3GONA 4CZCA 1F6TA 3M4XA 4Q43A 3PR4A 3MPYA 4MH8A 2BOPA 2YH0A 5KFQA 2V2QA 1S0NA 2R42A 1L3KA 2BABA 4EWTA 2QX0A 4CIOA 4TU9A 4C3MA 5FDLB 2A2DA 1DLOA 1IKVA 1EQ0A 2ZUGA 4GO5X 4OI3A 5D77A 5HJYA 4DCJB 3FCHA 2JRSA 4F67A 5HMYA 1IBMF 1ZTTA 2EK6A 2LDYA 5ETNA 2XSJB 3W1YC 4ZPBA 5MAOA 3PIOQ 2XGPA 1E6VB 1JQGA 3LQVA 1MROB 4CI0B 3MI7X 2HQ3A 2RDJA 5KFTA 3TOQA 5BR8J 3PX6A 1W2BR 1CEZA 5BJRA 5EDWA 1U4BA 1U8WA 5KT4A 2CPJA 3GIMA 3MEGA 2V5HG 5AT1B 4OLPA 5GMEA 1JJHA 2GMHA 2A3JA 3MGJA 5J2NB 3HJFA 3AB4B 4K4XA 2UUBJ 2K2PA 1VQMS 4RW6B 4K4UA 5B0EA 5H9FK 3M2RB 4ECRA 1KRPA 4G1PA 2IM2A 2J9DE 4GO7X 1WC3A 4K8RA 4LF5F 4O3RA 4K0KF 3AH6A 4YHHF 3BO2A 1LW2B 1P9YA 2AF6A 3HKZD 1PJ6A 3I87A 1C1CA 2Z4PA 3DN9A 4USWA 5DQIA 3GQCA 1IKXB 3MPWA 5A8KA 3RB0A 1T05B 4WZMA 2PMZD 1RT7B 3JQMA 2GA7A 3CDBA 2AYGA 4YP3A 4NYPA 3BR9A 4ES1A 4CLFA 1LW2A 1V9OA 4X62F 1ICEB 4QOTA 3JTOA 3K17A 3TVYA 3WIUA 2MKIA 1S1WB 4MIAA 2R7RA 3QFHA 2YNHB 4O3OA 1MMNA 3K2YA 1RT7A 1IUJA 3CJSA 1M0SA 3OQ2A 1JKHA 2N82B 1BQMA 1CC7A 2GZOA 5ETQA 4AQYJ 1KHWA 2AJFE 3MM5B 2R8GA 1YITS 4ZLNA 1RBOB 2IA6A 4WTYA 2DNMA 2HRTA 1IR0A 3UCGA 4RX6A 3AJ1A 2DGSA 1RK8A 4USVA 1SQGA 2R2SA 4XPEA 2BQUA 2UVRA 1NBEB 1AZSA 1WELA 2BW2A 4A46A 1JLGA 4RKUC 2KXFA 1TMJA 3QGHA 2K8GA 2Q3PA 1NDLA 3IRWP 1VLOA 4I7FB 2ZWOA 2CNLB 3FJ2A 1YJWS 2LQBA 4WFAQ 4Z7CA 3TARA 2UVVA 3ZZOA 3M7VA 1RTDB 4CH7A 4DV3F 1NUEA 5KFOA 1RU1A 3CVKA 4RW7A 3QT8A 2IJNA 3BSAA 3I9V9 4NLUA 3J7YU 2QZ8A 3GJSB 3TAMB 3PR5B 1JLFA 2E1MC 2ATLA 5KFIA 4WP9A 3MD3A 4AL5A 1Y0HA 3H4DA 2VPYB 3NG8A 4NWBA 2RUGA 2MTLA 3BZQA 4Y2AA 3J7YI 2BDPA 3SV4A 2QSFA 5ETTA 2DIUA 1X4DA 3DLJA 3MR6A 1RT6A 4C8OA 2EC0A 2MQMA 2V9WA 5L1JA 3UFCX 4TU8A 3G71S 1TVRA 4N8NA 2B56A 2VA2A 5DJBA 5F8MA 1ULRA 1YZ6A 4FF1A 2YPYA 2PMWA 4YY3J 5KFZA 1HBNA 1PC4A 5AE1A 4YUDA 3OW2R 1T03B 1NK0A 1N36F 2DR9A 4JI4J 3C2PA 1QJHA 3TAPA 4M95A 2LFVA 5KFMA 1VQ8S 1XR6A 2OMOA 3MMCB 4LR7A 4ZLPA 3GFZA 2VFUA 3NKYA 4BHQA 4LF7F 2FVSA 4Y34A 3TI0A 4MMOA 2CQ2A 2FDNA 2JLEA 1M1GA 4KKOA 1GQEA 2B7BB 1X9SA 1Q16B 2VC1A 4KHRA 3WC2A 3UW1A 4CLSA 3K58A 2DCUB 3IAM9 1L3VA 2OP5A 2RT3A 2AX0A 2KHCA 4FN5A 2YKOA 2HGNA 4CWBA 3T5LA 2WVEA 5A6PA 3DOKB 4OJHA 3TO8A 2ZH9A 5F8NA 2GAGC 4WFXA 2D3UA 2MKJA 3G4SS 4JI5J 2DR7A 5BYSA 3MOJB 1RT4A 2VA3A 1Q0NA 1S9EB 2CFXA 1UP1A 3LO3A 2GFFA 3D2WA 2BJ3A 3BM7A 4EBCA 4HH0A 5HANA 2GVDA 3FCVA 1IKWA 1KSPA 1ZH5A 1RWVB 4X66J 3GMGA 3QZ8A 2MQNA 2Z0GA 2GVZA 4MK8A 4X64F 4G1QA 4M63A 3MUTP 3IAS9 1EETB 1Q79A 2EFPA 2IRXA 3KLHB 3GV7B 1VOMA 4LSLA 1PKUA 2I38A 3D6TB 1IWGA 5D4NA 3CB4A 2J9EA 3ENAA 5LSOA 5F8GA 3W2VA 4EYIB 2R9LA 2LYVA 3DRSA 4TN2A 5GAHI 1FTCA 3NCQA 4LUBA 2B0GA 7AT1B 3QSYB 4X65F 4Q2LA 5EUHA 2PIIA 4GKJF 1FEHA 3IBWA 2HIYA 3I5BA 1H38A 5E0OA 5DDPC 3UN2A 1H3DA 4EZ6A 4OHXA 2AJ4A 3D6FB 3MAAB 5B0GA 1NKBA 1NZ8A 3OBIA 5DZ7A 1N5YA 2C2DA 4ZIVA 4OIXA 4MT1A 3OPKA 4GVBA 2WONB 1N34F 3TJ8A 4TY9A 3P6YC 1ZAVA 4NLOA 4YB5A 2OKQA 5EX0A 2H5JB 3GJTB 4TQRA 1IQZA 2GS8A 4ECVA 2PDAA 3CJQA 4B3MF 1E6YA 5IT9Y 1BHNA 1KDNA 2VUGA 1UL3A 3MPUB 4Q44A 5L1KA 1Y5IB 3L95X 2JNJA 4A4JA 1UVJA 2IC3B 1RBLA 3GSIA 3MMBA 1G6BA 5KOXA 5HVFA 3CCMS 2OD4A 2V4QA 2BVZA 4DV0F 3FUYA 2KTQA 4XTTA 1V6HA 1DBDA 2VZ9A 2FJWA 3QBCA 2ZZMA 4QCLA 3ENVA 2OAUA 5C7PA 2MDAA 2KFNA 3BDPA 1UA0A 2H4YB 1EKRA 4CLYA 3CWJA 1C0UB 2MMYA 1IKWB 3HCXA 5G0RA 4DV1J 3MM5A 1Y11A 4UW2A 4JI3F 3ZTOA 2BJDA 4PWUA 4QPXA 3TUJC 3VCDA 2B6AA 2XZDB 4H4MB 3QAEA 2VBWA 5DQHA 2M5YA 5IQQA 5HP1B 4PRFA 2MKKA 3A8IA 3EE3A 2DB1A 3T9ZA 3QLHB 3NGRA 1W7WA 2QLXA 2HWIA 3G6ES 3KMQA 5J1PA 4I2PB 1KQKA 4ZA1A 4KAIA 3EDQB 4ID5B 4J9UE 4DPTA 1FHTA 5EWGA 2CJBA 2EBEA 2O5DA 3FZ2A 2A6MA 5KFRA 4JOUA 4QYRA 5HQ8A 1VBXA 3LP2A 3PJWA 4I56A 3MECA 1NSQA 1T05A 4P2XA 4LF8J 2RQMA 1WKJA 2AYMA 2W9AA 3BSOA 1VHFA 2GO8A 4RNMA 4OYZA 1R31A 1KQGB 2BJ8A 3CJ0A 4M5GA 5A6WA 1JXVA 5KFDA 4DR1J 3N5BA 3CD0A 3DRPA 3HKWA 1U6ZA 3QQCD 1S6PA 4PYAA 1J5OA 2KZMA 2ZH3A 2J6TA 4PG6A 1VFJA 2QFIA 4RPFA 5DLFA 1HBMB 4WYLA 4UZCA 5IFMA 1S0MA 1BQMB 4OZNA 3H7HB 1DFDA 2FD2A 3OTBA 3PJ9A 3DLBA 3ET6B 4ZP7A 4ECYA 2EKYA 1YKWA 2HLUA 5ETSA 5K9FA 1XMQF 3LP2B 1YZ7A 2XCPA 2M8DB 1VQLS 2NS1B 1DURA 2M70A 3GJQB 1N5VA 3JQKA 3FFIB 5DS7A 4B08A 4J9RA 4Y6IA 3MR5A 1KVJA 2QA1A 1UFWA 4ES2A 1TZ0A 1NJIT 4WE1B 1CQNA 1VS3A 1MU2A 2FJDB 3OD2A 4P2MA 4PPZA 2AX1A 5C42A 5CAAA 4X4VA 3CE8A 2GJFA 2VFSA 1J5EF 1FXLA 4ZVHA 2AT1B 2ZZNA 3QYYA 3KUEA 4UUWA 3CC2S 3D0HE 3BR8A 4RWXA 1S79A 4YMEA 4IFYB 3PEHA 3H8YA 3BS9A 4PKDB 2C3UA 4DSIA 3DM2B 2ZBIA 4HLBA 2WB1D 3BGRA 2MZJA 2VC0A 4LBHA 3FBCA 4NA1A 4CNZA 1GMWA 5H9EK 4PCQA 2DHHA 2YVSA 2MKYA 1S72S 5IC4B 3CNQP 1ZETA 2VFRA 3T1HF 4W98A 3FRYA 1D9AA 3TVZA 4XO0A 1WC5A 4X4QA 2DH7A 2FYXA 1D8YA 1SH2A 5D78A 2XY7A 4P7VA 1JLAA 1UETA 1RBAA 3C19A 2FJXA 3M8YA 2M2BA 1EETA 3HHKA 2MJNA 2JC1A 3HZEA 1SJQA 3CMQA 4DR6F 2BQ3A 2YTCA 3BPSP 4Y65A 4OI1A 1RKJA 2JEFA 4EMDA 3HJVA 2CQ0A 5L8RC 2ZH8A 1FX4A 2ZZTA 3H2VE 2RRAA 3DXSX 3Q2TC 4LFAJ 3I32A 2N3LA 3E2EA 1BXNA 1S57A 4NCGA 1T3OA 1S9EA 3CDAA 3BN7A 4ZVFA 4CO3A 4DXLA 3WDOA 3R5GA 1CBKA 2KRBA 5K8PA 3NLCA 4ECSA 1WF1A 2FZGB 1WACA 1CQMA 3GJRB 1CS4B 5GMDA 4F26A 1HMVB 5JVGQ 1TUVA 3ZZUA 4RUCA 2DEIA 2XZTB 4O3SA 1T7PA 1JLEA 1IVZA 2DTJA 4DL7A 4N41A 5HMXA 2RRBA 4K5RA 4ZCLA 2F4FA 3N6NA 2DGXA 3PACA 3UD4P 3EM1A 2O3DA 3W2VB 5HVHA 3KLVA 4DLGA 2O66A 2QIFA 1T3NA 4NPOA 3HHDA 1TVRB 2KVIA 4NYOA 4PQAA 2NSBA 2HEKA 5LL6d 2D74B 2CJYB 2I6WA 1TUGB 3R1LA 4X2BA 4NZ7A 1WHWA 2OPQA 2PA8D 3MM8B 4OX9J 4C8MA 1YRUA 3P96A 2RE1A 4I7FA 3H5SA 2ADBA 4F2RA 1LWEB 2CQDA 2X51A 4J9NA 1XNRJ 2IFXA 1QE1B 2Z58B 2MLXA 4P2FA 4Q2MA 2P6TA 1KVIA 2D1CA 3EZUA 3N0VA 3DI6B 3PW5A 4EI2A 1IBKF 3AB2B 2WB4A 2BJ7A 1FJCA 1CJUB 2XTJP 2VICA 5A8KB 2XBPA 3TQ1A 4C97A 1QVFR 1PG5B 1RISA 3EYZA 4LF6F 2A2CA 4EGLA 4KY3A 3ZC4A 2BJEA 3OTEA 1NPPA 5K8NA 5D3GA 1S1VA 1TKZA 2AGPA 2BE9B 4WFYA 3LGMA 2HAFA 1HYSA 5CYJA 1K0VA 2MZQA 1S6QA 1AFJA 5EHHA 2UU9F 2J6UA 2KYXA 3DLGA 3M9MB 3MCMA 3QGGA 3U02A 9ATCB 5IOLA 1TL3B 1CLFA 5DDRC 1RWWB 3TX8A 2AP6A 3LH2S 4KE5A 1S99A 5IV3A 4RU2A 3DHWC 3RYLA 1NK7A 4B3OA 3TJ9A 5A8RB 3D68A 2CJKA 1ZZNA 4N47A 4QZVB 4V19X 1VC5A 1RGVA 3L7OA 1DARA 2DGUA 2XLJA 5HAOA 3WIVA 4JV5J 1TP7A 1KC8T 5B7WA 2MB0B 3PJXA 5LJ3Y 5D3GB 2N7CA 3JB9k 1S6PB 1XK8A 1BLUA 4OZJA 3NGDA 4ZVSB 3K5OA 3T1AA 1N0VC 4H4KC 5DETA 5D6GA 3A8EA 3FBFA 1TL4A 4URSA 3TAMA 1XR5A 3FDSA 1HPZB 1TL1A 3HFZB 4HDHA 1M1KT 4B9UA 4DFMA 2K7KA 4G3IA 1KP6A 4DBQA 2VFVA 4DI6A 1APSA 4WK1A 4M5IA 1NJWA 1HBOB 1X4GA 5AXMA 2E1PA 1WEXA 2L9DA 2PO4A 5KT5A 1V3SA 4N7TA 2R8KA 1YWXA 4USHA 2XYGB 3HVTB 1EHWA 3QLHA 2WSFC 5J2QA 2XS7A 4DR7F 1FE0A 1NEEA 2G1HA 2KH9A 1SV5A 5LMNF 1FRIA 2XGQA 2CG4A 4DFJA 2VD3A 2HLTA 3R5AA 2DH9A 4ILLA 4HL9A 2ASLA 1HBMA 1WI8A 1NDCA 1RLCL 2YQ1A 2J9DA 3DRRB 1X0FA 1PGZA 3G9CA 2YKMB 3BEGB 4O4GA 5IS2A 4F2SA 1ZS6A 3DRSB 2ASJA 4NXNJ 3QWPA 2CDQA 4DFKA 2ASDA 2DCLA 2NYIA 4QBUA 1XTZA 4NA2A 2ZH2A 4CRJA 4XK8C 1O5JA 4DF4A 3GU0A 3GZ7A 2QSWA 3SZ2A 3K7RA 2I8EA 4KC5A 4QPTA 1T02A 1U8SA 3SIPB 4LF4J 4I0WA 1WDTA 2V4RA 1B3TA 3TZWA 1JLCB 2CWXA 3OR2B 5U47A 4CT9A 4WTOB 2DNHA 4YR3A 2UU9J 2IMOA 3DOMB 3K59A 1GTEA 3I5CA 3ZTRA 2Z2MA 3FMBA 4LF9F 5CCMA 3ZTPA 5HP1A 2AHOB 2XMMA 4X65J 1JK9B 3SDEB 2NXEA 2M52A 3VQTA 1NRKA 2W4DA 3MCSA 3I4HX 3KK3A 2XS2A 2AIRB 2OPSB 4HI2A 1AROP 7FD1A 1SJ4P 5F0UA 3SSSA 4I1TA 1BC6A 2QT7A 2MY8A 4K2XA 5L1LA 1RLDA 3AD7C 2P5VA 1FF2A 4C98A 2YNFA 3F44A 3M6XA 4QR2A 3PIPQ 3VVUA 2VASA 2XLIA 1B99A 1JWWA 1H73A 4PXDA 2CQHA 5GAEU 1JXEA 2ZD1B 4QR1A 3DYAB 5ETKA 3ZZPA 2BRLA 3BGRB 4CYUA 1YDLA 4HT7A 1HWUA 2VV5A 1N8RT 1IBMJ 5C24B 4K59A 1HWJA 4KR0B 3FK4A 4TYBA 3P49B 1DY3A 2QL7B 2HNDB 2HVZA 1ACMB 2HVEA 2CG8A 2RF2A 2JDJA 3GCWP 4OV1A 4PZVA 1Y5NB 4H54A 1I1GA 4X66F 4F4YA 2PFDA 3V81B 5KT7A 4F3MA 4ED1A 1HW9A 1FK9A 1NSPA 3L09A 1RTZA 4KO0A 3FSIA 3AXKA 4WPAA 3CCRS 4ZP8A 2MSTA 1NU4A 5JUMA 5KFCA 2KFZA 4RL1A 3H5UA 1W25A 3WQPA 4ZPCA 4QJVA 3BQ0A 4KQZA 3TA2A 3OXGA 3SFUA 5B0DA 3KHLA 4D3HA 4LR9A 3NS7B 4DN0A 2FQQB 2ZH4A 4ZCIA 1RB0A 5FD1A 3TA1A 4DSKA 4NLTA 1M5OC 4LF9J 2VG5B 2JC0A 2BKPA 1N34J 4WFBQ 2XO6A 5RUBA 4ED3A 3FVYA 2W7AA 2XG8A 3D6HB 3MF5A 3DMJB 2IA0A 2W7PA 4LFAF 1OMSA 8ATCB 5HLFB 4JI4F 5F8JA 4LF8F 3GSDA 1MNEA 2YX1A 2LEPA 5KFXA 4B9TA 3FMWA 2G0JA 2ZE2B 2C22A 2ZVIA 2EC2A 1LEOA 4OYPA 2XMUA 2XQCA 1BWEA 1HNWF 1X4EA 2W2QP 1N6QB 4C8YA 4W90B 1UWBB 2LU1A 3DU6A 3ILOA 4YN3B 2ZHOA 2VDHA 4JI8F 4XDCA 3MEEA 1NK9A 3D66A 4U7UD 2OD6A 5EX3A 2CQCA 1RYRA 1U2CA 2RVJA 1U25A 1X8DA 1IJFB 2OFHX 3Q2SC 4CO1A 4P74A 4B3TJ 2DRDA 2B4OA 2EKNA 4Y2KA 2FLPA 4G6VB 1U0HA 3C16A 4IFVA 1RAAB 3KHRA 2ZH1A 3JTPA 3OUYB 2J76E 2HYIB 3ISNC 4NEYA 3AAWB 4DV3J 2IY5B 1B64A 4CO4A 4AD6A 4CH1A 2PFFB 1U02A 2V4JA 2J6SA 1UA1A 3MM7B 4PABA 1UPPA 4I6YA 1BWVA 5F0WA 1HPZA 5HVGA 3CO9A 3IGNA 3PO4A 3QIPA 1HYSB 1OY9A 3A4TA 2LQJA 3H90A 3R5CA 1J27A 4ENOA 5LSRA 1IBLF 4LBIA 4RUAA 1FA0A 1WNEA 1OQ6A 2AJ1A 3CJKA 3OVBA 1XC9A 3OL8A 1V3ZA 3OV7A 3V6DA 3PRDA 1KKHA 4B3SJ 2U1AA 3MMAB 3QO9A 2WAQD 4NI2A 5F9LA 1XN9A 1QDUB 3R9LA 2XMVA 2CPHA 3T9NA 2BACA 4LFBJ 3CJ2A 3UVJA 1TELA 1RTJB 3P8BB 3M6VA 3TAQA 2AMCB 2HFUA 4YDXA 2Y1LB 4M5JA 4IOCQ 1IN0A 1Q8LA 1S1XA 2KU7A 2ZVSA 1YJUA 1NHVA 4USIA 4NA3A 4E8UA 2ZJRQ 3Q8PB 4LFBF 1QAXA 4TVAB 2IHR1 3DFEA 3DLLQ 3G82A 1VBKA 2I5JB 1OY6A 2NZCA 3M1VA 2HURA 4A8KA 5L39A 1IKXA 4K0KJ 3ILIA 4C8LA 2W2PP 2DT9A 3AXMA 3U1NA 1U2FA 3OLBA 3CCQS 2LKZA 4ECUA 1FX2A 2QL5B 3AOCA 1NSKL 3R27A 1S0VA 2K3KA 4JYAJ 1LW0B 3NOCA 4AL6A 1ZA2B 2A1BA 1N0UA 3CF5Q 3ZZTA 4IDKB 2RU3A 1TV6A 4DR7J 1YBTA 2YBVA 1FDBA 4LJMA 5M2PA 4Y2CA 1PAUB 1UWAA 4OI2A 2V67A 2CZ4A 2HQGA 2E1RA 1CJTB 4LRCA 4OX9F 5L38A 3X3UA 1Q82T 1KONA 1T95A 2WHOA 4KV8B 1YVFA 3DOMA 4ED7A 1SIWB 4LIWA 4DR4J 4K4WA 1UVLA 2GIQA 1N33J 1FTRA 5M2UA 5JVHQ 1ZM2A 4FXWA 4PAAA 2WTFA 2QA2A 3HZGA 4ZVTB 2R7XA 2G13A 2Y3YA 2HQDA 3GYGA 4NYZA 1A7GE 4E98A 1S4FA 4X84A 1RZMA 3K89A 4U7UK 3R7NB 4CLUA 2FY1A 3RR8A 3H98A 2MXYA 1WF2A 4OMFG 4WU2A 3HVRA 2MLYA 3VAJA 2BE2A 1O51A 4TKTA 9RUBA 4X62J 2XI3A 4A8WA 3RU0A 1URRA 3AODA 1I6JA 1JLQB 5K8OA 4B9MA 5DRKA 5I4MA 2DY1A 2N4CA 3FZBA 1SL1A 1FWPA 1T9UA 3MAHA 3DKDA 3B4DA 1FE4A 3MCNA 1RCOB 3R7BB 4F4XA 3GIIA 4IG3B 1RHJB 1HWKA 1RT3B 3KHGA 3IA0A 2JSXA 4HT5A 3VGVA 3W9JA 1GH8A 2XMKA 3CD7A 3CCWA 2R8JA 2IMWP 4ED6A 5GAGI 4PUOA 4ED5A 1RT2A 1R7IA 1SQFA 4KT0C 1NB7A 4JI7J 5KFJA 3EUNA 4OJ3A 3UI3A 3US5A 1TL1B 1R89A 4TXSA 3S1TA 3RRHA 4CLWA 3KTQA 4WP3A 5GAGU 2IJFA 3Q86A 5B08A 2MQPA 3Q0AA 4IFYA 2XO7A 1XNRF 1HQ2A 1A9NB 3I6PA 4RW8A 1SPBP 1X5PA 2HSEB 5FLXY 1KBRA 2RU9A 4QIWD 5F3TA 2IAJA 2BX6A 4OZ1A 4TQSA 4DR5J 1T11A 1ZM4A 1UCNA 2W2OP 3DC2A 4L3KA 1NK6A 2CKWA 2MLZA 3OR1B 1RAEB 4HI1A 3UNGC 4K4TA 2FJVA 5GADI 1N56A 3BPDA 3VAGA 4GMKA 5A8RA 4HR2A 1QUVA 4J9VA 4Q7AA 1FRXA 3A1YG 2B4VA 2CNOB 5DM6Q 4RNOA 5C5JA 4CLLA 1T9WA 1WUUA 1WDDA 4OI6A 5GADU 6FD1A 1RHKB 3P3DA 1S4EA 3KNGA 2QFJA 1M5SA 4F3QA 4IG0A 1PJ7A 1XERA 3R5JB 4YB1P 3T5KA 4LFCJ 3KHHA 3PHTA 3W5ZA 3LANA 1CJKB 4OZLA 1F2HA 1CJUA 4CM0A 3K5MA 1S12A 2B8PA 2G0CA 2YNIB 2PI4A 4LF7J 2B43A 2QG9B 4N76A 2G0IA 3IGVA 1WHVA 2MZTA 2QLWA 4NLSA 4OYIA 4O3PA 3UNYA 3GTYX 3QRRA 5E33A 1RTDA 4GKKJ 4L6V3 1FRLA 3AT1B 5IV4A 1QAJA 1TKXA 4JI2F 2GHVC 2LMIA 2XYPB 2YNIA 3W5XA 3J81Y 2UXDF 1WC1A 2PEBA 3ZZ0A 3FSXA 1H6KX 2XCAA 1TFYA 4IRCA 1NSAA 2D3ZA 1U0SA 4R5PA 5AJ3J 3ONQA 2RSQA 4BS2A 3EGVA 1YX2A 1VQ7S 4DJBA 1REVA 3EX7B 2F8EX 2OPPA 1N54B 3J80U 4ZVGA 3H25A 1FJEB 4ZK7M 3R8YA 4DQSA 2WONA 3OTDA 1TQLA 2BKNA 5LMNJ 4JI5F 4M5HA 1TKTB 3PX4A 4ZMMA 3IBFB 1JNRB 1RT1B 2AQ4A 1M1HA 2DGQA 2AKWB 1X7VA 2XC9A 2RB7A 4GRSA 3V81A 2I0XA 2LXUA 1RACB 4QIVA 3JTNA 1LV5A 1FXDA 2V94A 4WYWA 4WU3A 1VRTB 4UT4A 4UY8T 1RUSA 2DHXA 4ICLB 1CJVA 2P9EA 1WHYA 2LVWA 3LGNA 2BQRA 4RO0A 3QRQA 2VG6A 3FQLA 3UDLA 5L9NA 2MPUA 5KG0A 4RNFA 5DDOC 3HPOA 2Y8WA 1WTFA 3NBPA 2F63A 2RS2A 4ZVQB 3CJ8A 2E5JA 1FDAA 1TAQA 2CDRB 2YNFB 3W9HA 4IRKA 4YS2A 2ZBCA 4ZVRB 3OVAA 3RRKA 2OPRB 3D54A 2ZBRA 2DRAA 1TV6B 2WVCA 4NX9A 3IXQA 4IOBA 4DR1F 1NK8A 1FJ7A 1HNVA 3HVAA 4I69A 1TAUA 2M0GB 2SXLA 1GXLA 2DEJA 5CA5A 5F8LA 2FGOA 3T5JA 2F40A 4OYAA 2XMJA 5AJ3F 4ECZA 3GFXA 4A48A 4JI7F 3T3FA 3CJKB 2Z8QA 3QMQA 4KGXB 5B0BA 3UPFA 3IO1A 4JV0A 4C0BA 3SV3A 4CO5A 1AUDA 4KPYA 3AFGA 2ZH7A 2OELA 3HT0A 1CVJA 4NASA 3POTA 5LT5A 4ZN3A 5ETRA 4N5SA 4J5OA 3AQPA 2OHDA 4U67Q 2V34A 1HKAA 2V69A 2FVCA 4DV1F 4JI0F 4JI3J 4V19J 2FJEB 3EGWB 3LGHA 1IKVB 3FRZA 4L3NA 2HFSA 4LVOP 2JLGA 2UUAF 3FFIA 3OXLA 4ZJQA 2NXUA 2XWYA 2IYIA 1UEVA 2AV5A 4A8MP 3N6LA 4DSLA 4X4PA 3IWXA 3UQSA 3DRRA 4HTIA 4NLVA 3MM6A 1K8AT 5A0YA 2UZAA 2GHPA 3A8KA 5DZ6A 4RW9A 3G96A 2JJ4D 1DTTA 3ZFVA 1TTHB 3EVOA 5LMUF 2N7YA 1QM9A 3G87A 1GMVA 5KT6A 3TUPA 5C25A 1FFGB 2WCXA 3CPWR 1BQNA 2CPXA 2POKA 4OZ3A 4BCAA 3MD1A 5BYRA 4USMA 1TKDA 1NKEA 3R7SB 3C14A 2CRLA 3DRPB 3TX0A 3P5BP 3QFWA 4PWWA 3GIKA 4KYZA 3DRYA 1G4CA 2YKQA 3O6QA 3NOGA 4NZ0A 5G4DA 4N56A 3Q23A 3JYTA 3U27A 3W8GA 3FCWA 4LSZB 5CZXA 2BKOA 2P8IA 2V8GA 5B0AA 5CCLA 2P6SA 2W9BA 3BJYA 4U9RA 4F04B 2BZ2A 4EEYA 4DWIA 1G1XA 1LWXA 1FKOB 2YWEA 4YY3F 2EWHA 1NCLA 1Q1KA 4RR5A 4GVBB 1FKPB 3DLKA 2DNNA 4FKYA 3IBCB 4DUYF 1S76D 1ZM9A 2Y9HA 4JYAF 1XIQA 3H4BA 4KFBA 3W9IA 4F7VA 2B51A 1FFSB 4RUHA 3JQJA 5J1EA 5KG4A 3RR7A 4FF3A 3LOUA 5FJ4A 3MEGB 3HX9A 1FKAF 2RKIB 3IR6B 5L9XA 5CXTA 3X1LB 2HMIA 4YOEA 4H4OA 1RTIB 4HDGA 2JEGA 4OHWA 2KO1A 1HHQA 3DMJA 3ETOA 4P73A 5KFNA 2VQFJ 4YDDB 2EG1A 1YGYA 1FDNA 2KJWA 1RWMB 5D4LA 2FUG9 4NLYA 1RTHA 2O67A 1NAQA 2HBZB 3H5YA 3OFGA 2PGCA 2DXFA 3MPDA 2BM0A 1KLMB 1VHIA 2AEFA 2C2NA 2MKSA 2V68A 2RH3A 1RWUA 4LSLB 4O0IA 1WG1A 2PSZA 3BREA 3B6BA 1Y7PA 3PNIA 3IWLA 1DQ8A 2E7XA 3U1MA 4ZVUB 3ZXWA 3CC4S 3QJPA 1XWLA 4H4MA 4M5LA 1SKRA 3BKUA 2R7SA 2DK2A 3W8PA 2NYHA 3WC0A 4WKYA 1N32F 1LWEA 3H2LA 4L74A 4DUZJ 1TK5A 3SQOP 2V2KA 4I2QA 4ZP6A 2UXCJ 1IXKA 4WP8A 2IVYA 1Q95G 3TZXA 1B70B 2DR6A 4B9SA 3AY0A 1S9GA 2RNEA 1UEKA 4YB7A 4DU8A 3V6KA 4K50A 4NCGB 2BJ9A 2XSJA 2XMAA 2CQ1A 3Q8UA 4DV5F 2J7WA 4OZ5A 3ILLA 3VF0B 4Y0FA 2W9BB 1YIJS 1U2RA 1ZPWX 2HBRB 4ELVA 1SBRA 3QJLA 1F2GA 4YR2A 1G3OA 2M8HA 3ZZZA 3KLGA 5B09A 2ZITA 1HBOA 4CT8A 1PILA 2OI2A 4C7QA 3FNNA 1FCAA 1L3TA 1TUWA 4FYWB 2VPWB 5DQGA 3C15B 2G4BA 3DU5A 1ZTWA 2C28A 1LWCB 1KWMA 2RAQA 3KJFB 3WHIA 1NJZA 2R2RA 1S9GB 2WZ1A 2UXDJ 4CTAA 2I9SA 1VRTA 2B4UA 4KBIA 1MROA 1VQNS 2CJ9A 1P1LA 5KFBA 1KVKA 1N52B 1FVSA 2Q66A 3CD6S 5CZVA 3UCUP 2NUHA 2BW7A 1XBWA 4J7CA 2Q6CA 5ETPA 1BD6A 2MZSA 6FDRA 4RW8B 2CWKA 2D41A 4HHJA 4FBTA 1UZHA 3QGPA 1HBNB 3P45B 1RA6A 1WKLA 3K5NA 3PZPA 1T03A 1TU0B 2F7VA 4PQUB 5KFYA 3VGTA 4EBEA 2QLBB 3V4IB 1JX4A 2CXEA 4F50A 2MQLA 3M9OB 1YTYA 2Z2ZA 3GB0A 3OR1A 1D09B 2H4WB 1G2EA 3ZZRA 4C4WA 2KG0A 1O8BA 1YJ9S 2MGZA 2BE2B 1MWYA 1WSRA 2K1RA 3GYXB 5T7LB 4RU9A 4U7CA 4NCAA 3J81U 1KLNA 5D0RA 3BBBA 2AZ3A 4OYMA 2XMTA 3MOZA 3OFFA 3MURP 1PCAA 2CZVC 4MFBA 1FFWB 4E2FB 1T9YA 2CQPA 3SFGA 2IDLA 1LFPA 2RHQB 4DSEA 3VVTA 3NGSA 4I2PA 4QU7A 4EO6A 4KHPJ 1FRMA 3QRPA 3P4UB 3WX4A 2HHPA 3AA8A 3C3LA 4G65A 3TUZC 2I5JA 3M1VB 4QR0A 1VBYA 4O0NA 4B02A 4KRWA 2CNNB 1AZSB 2CVEA 3PTWA 4LVNP 2KM8B 2U2FA 2HVDA 4EUVA 5L46A 3CO0P 2R7WA 2VQEJ 3CJRA 4JV1A 1KOOA 4DSFA 3EXYA 1VGYA 1RHMB 2RF2B 3E8OA 1DTQB 3GP9A 1DQAA 5F41A 3RBXA 4DMZA 2Q79A 5HROA 3KOAA 2HGLA 1Z2LA 4ZN1A 1N48A 1I94F 1JLEB 2C3OA 1J5OB 4NI2B 2WBMA 2G2YA 5AE2A 4L75A 3HHLA 2DGTA 3SCIE 1UPMB 3RB4A 2XNQA 2NPFA 4K4YA 2V8DA 3D5MA 3OFHA 2OPRA 2O1PA 2CIMA 3HI9A 1Q4RA 5J2MA 1U1MA 4OX7A 2XEXA 3KJQB 4OX8A 1DTTB 4UTGA 3D0GE 2OPQB 3MM8A 5J1EB 2W2MP 2KFYA 3PW0A 1DHMA 1XNQJ 1CJKA 2GIRA 2E9TA 2C3YA 2MKHA 5EN1A 4NLWA 5B0CA 4MKAA 1VISA 1DRZA 1RSCA 3C14B 3N79A 3WX8A 3GCXP 4DEZA 3E01A 5HMZA 4QWEA 4FF2A 1LOUA 3RBZA 4UY85 4ICLA 3MXHP 2WOMB 4NZ6A 4Y28C 3EDRB 2DNLA 5HJXA 1SQEA 3M2RA 3THPA 4Y00A 2OH2A 4ZDNA 8AT1B 5K8MA 3KMSA 2ZDPA 1VYAA 1HIYA 2CAJA 3HO1A 1UWBA 2HS3A 3B78A 4I6WA 2ZH5A 3MMAA 3QO9B 4Q8FA 2FZCB 2DNZA 3C8YA 3KG4A 3MAQA 3VAKA 1EKSA 2WW8A 3IG1A 4P75A 4DR3J 1XMOF 3HSGA 1MLAA 4J9LA 2ILZA 2ZHAA 1UFKA 1V5IB 2ASYA 2LECA 4N77A 3T1YJ 1REVB 3KLFA 1TMMA 2YWGA 4LSNB 1H98A 1HNZF 2KT3A 3LW5C 4B3OB 4LQ9A 4NLRA 2V4JB 1J2VA 2VG5A 2YWKA 2FZKB 1VK3A 1AFIA 1FT8A 4QWAA 3BGLA 4FYYB 4JV5F 2V9KA 3ELHA 3ZTSA 3MEKA 3W66A 1OS5A 2B9YA 3MUVP 3KJVB 1S1UB 2D69A 4HEA9 1K44A 1OPIA 4ATNA 4YQWA 4BDPA 2IJRA 1FXRA 3N01A 4WFZA 1JB0C 3EVMA 4OYXA 4ZPVR 1Q5YA 4X64J 3H5XA 4FDFA 1Q7LB 2VJVA 3MZIA 4O3QA 5KG3A 2X1AA 5GVQA 2MJUA 3U1LA 1N6QA 4B3RJ 3GV5B 3KXDA 3NXZA 4DV4F 1LFWA 2R2TA 1X4BA 2DNOA 3MR7A 4CCHA 4UOHA 4FYDA 2OEKA 3Q8SB 1N32J 2PE8A 4ED2A 3R5DA 4AYBD 3ITHA 3CDUA 3N28A 4ELUA 1FDDA 4DL6A 1HNVB 4RW4B 3RZAA 1SKUB 4ERDA 3PFOA 4BC9A 3H40A 4H4KA 2WVDA 2R7OA 1W2IA 3OFEA 1YJTA 1NLKL 1VDHA 5F3ZA 4DFPA 3GPAA 1U0HB 4WK3A 3F73A 5LMUJ 4F4ZA 3BDEA 2J8SA 2YWWA 4ZPAA 2JZ5A 2HNZA 3TVKA 1HQEA 3BSCA 3D6MB 1T9VA 1RWPB 3UR3C 4QWCA 1JLBB 1GEHA 5CYQB 1BY9A 1QE1A 2ZM6J 1NHKL 2DXEA 4AL7A 5IT0A 3IG1B 1WTBA 2HW3A 2RRNA 1LWCA 2EPIA 1PBUA 2IPOB 5IC6B 2H51B 3WBZA 5CYQA 5J2PA 1VQ6S 2ZE2A 1K73T 5A8WB 4JB8B 2R7VA 3BYPA 3SEOA 3UD3P 4X4OA 3GWCA 4O3NA 4OZ0A 2H5EA 4KH1B 4RWWA 4CNYA 4TU7A 2OEJA 3QT5A 1RYSA 4QIGA 4WKRA 3MFHA 3DGPB 3CCSS 2IM1A 2OIHA 2CJXB 4BWMA 2YH1A 1RT3A 3GILA 1SH0A 3J7A1 3KLIA 3PYEA 4MK7A 1UJ4A 1O6XA 1RA7A 2DHAA 1OQ3A 1VCTA 3JXOA 2ZJQQ 3H2UB 2ZOMA 2QA4G 3FEZA 1BQNB 5HN0A 1KEKA 5H1SV 4HHUA 3U7JA 3GG0A 2UUCJ 3GG1A 3C66A 4GKKF 1VQYA 2DKOB 3ETMA 3KLIB 5H9EJ 1RWNB 2VH7A 3GR0A 4Y2IA 3LAKA 1NO8A 2M4MA 5DM7Q 2YNHA 2XLKA 3I82A 2HHWA 4XIUA 1QD1A 1RP5A 2JFKA 2WRMA 2ZBQA 1N88A 1TKXB 1U1PA 2B7CB 3MPVA 3O44A 1SUQA 1CS4A 1FRHA 1OPZA 5THWA 2LDIA 1H72C 4ALZA 3M8RA 2JH3A 1F9EB 2I2YA 2VBZA 3OT9A 4IOAQ 1KHVA 2HHQA 3ZZYA 3S8SA 2CQBA 5IM0B 1YRXA 1CSJA 2ABYA 3OJSA 1IBKJ 3QSIA 4IH6A 4RBUA 1QTNB 1RHRB 4CLKA 3ENQA 4C11B 4NRTA 4O23A 3I0RA 3M2VB 1HLWA 2CQGA 2ZHBA 1SL0A 1HQEB 4NXNF 3NMAA 3SCJE 3RBDA 1MWQA 1NH8A 1RAJA 1RHUB 1W26A 3EWGA 3G6VA 4NXMF 2OUGA 2RMLA 3D1HA 3HD1A 1FNMA 3IS9B 1RXOB 3OL6A 1N5YB 2JVOA 2Y1IA 1Y10A 3RGIA 2PC6A 4CO0A 2VHGA 2GIFA 4J9OA 4PG5A 3CW2C 4WIQA 1UFLA 3CCES 2MKCA 4M8LA 2BV3A 2OTLS 2GQCA 2EG2A 4DV6J 3F0NA 4W4MA 2BRKA 1Q8BA 1UTAA 4P2SA 4ZJLA 4JI8J 2QLJB 2B9EA 2AW0A 1S6UA 2YKAA 2QMXA 3JSBA 3GE9A 4ES3A 3G8TA 2DISA 1I94J 4CLZA 2R7UA 3TP2A 2VB6A 3JSMA 2JX2A 3CJTA 3KLEB 1QUPA 2F4VJ 4K4ZA 3OL9A 3EJMA 2GQQA 4KKOB 1KQFB 2LQ9A 4QWDA 5D0GA 2JEIA 1FNOA 3CJ5A 3KLFB 4G1QB 4KIAA 3TNVA 1RAGB 3A3PB 4Q5VA 1VBZA 1WG4A 4DOZA 5D4OA 4Q8EA 2W8KA 1SC3B 3ADAC 1SXLA 1RTJA 4TYAA 4R8UB 2XM3A 4DU7A 2L41A 4HKQA 3CMES 2VU5A 3CSKA 2PD1A 4F25A 2LXFA 3THTA 2FVRA 1QLNA 2HFVA 4PEOA 4R0EA 3V2UC 3M9NB 2HG4A 1NK4A 4HHHA 2OJ3A 4MKYA 1I51B 4UF4A 1GXUA 1VQSA 2C2ZB 1X4CA 4F36A 3CUNA 4B3RF 2WVFA 1EJ7L 2FHJD 2YQ0A 4RBVA 3W62A 3MR3A 4J9KA 2DHSA 1VQ5S 2R8HA 2Y1JA 2AJ0A 1XJWB 1RAOA 2BXJA 3NAHA 1SCJB 4WWSA 2RJZA 1JJ4A 4B9NA 4ZPTR 2BR0A 4M5DB 1PYTA 2DNRA 3Q8RB 5HLFA 1X9WA 1LW0A 1YG0A 5SZTA 2WK4A 3EPIA 1LWFA 3FEXB 5JXSA 4CO2A 5C2CA 2ZDOA 1EB0A 1NK5A 1OJ4A 2GJIA 2HNYA 1HR0F 1JIHA 1X60A 1E6YB 4F3OA 3VAHA 2DO4A 4D3GA 3NL0A 2F8HA 3EGNA 2VKZG 4QIEA 3ILJA 1D9FA 2V8VA 1L3SA 4A8SA 1U49A 1I5OB 2MY7A 2OSQA 3KYLA 2HS4A 4USKA 1B4SA 1O0PA 4F0MA 2HQIA 3UCZP 2PI5A 2GHWA 4WCEQ 1FVQA 3RAQA 1GAOA 5ETMA 2M7SA 2DPJA 2QTWA 1OWXA 1WOPA 1Y9OA 4FBUA 2Y1RI 4M5MA 1MMDA 1U48A 1C1BB 1I3OB 2HIQA 3QJJA 1WC4A 1EIYB 4DL3A 1HNWJ 4K5SA 4ANCA 4PWDB 1KTQA 2HRYA 3HHLB 2B8QA 4CM2A 2R8IA 2L08A 3QZ7A 2OEMA 4C9DA 1RTHB 4KJIA 2VBYA 2AWZA 5DGBA 1QVGR 2XNRA 1U6FA 3PV8A 1RE1B 4XAKA 1JLCA 2IDEA 3NS5A 3OR2A 1T9XA 4RNNA 2HWTA 1YJVA 2XS5A 1C1CB 1WOOA 1OO0B 3RBEA 2H9ZA 1R0CB 5DG9A 1JJ2R 2VL1A 2UXCF 4RW6A 1SKWA 1R6VA 2HQFA 1F5AA 4JUZA 1U1KA 2JL9A 5J2PB 2UUWA 2VG7B 2IVFB 2JOQA 2GV1A 3HHEA 5KFEA 2YPZA 1SIZA 3QT6A 4ZHRB 1FRKA 2H65B 2IBOA 4L73A 2AYBA 1X4AA 2E1AA 3B54A 3C6TB 2ACMA 4DR4F 2R2UA 3R2CJ 4DPYA 2VBXA 4DX8H 2KXNB 3NGKA 3OTOJ 3EXCX 1LK5A 4ZS6A 1VC6A 3AOAA 4RJVA 3DDKA 3UR0A 2O01C 1HBUB 5HSPA 4C8ZA 3AD8C 2NREA 4ECXA 5C24A 2GMLA 4IQXA 3NGUA 3I55S 1SH3A 4Z7YA 5KFGA 3DGPA 3M8SA 4V1Ak 2GNKA 2ZM6F 2HHHF 5KFKA 1WI6A 4UZBA 1HQUA 3TR5A 4MK9A 4OFZA 2IYGA 4ZITA 3IRXB 3PW7A 1F60B 3ENWA 2ZKTA 1NKCA 4B3MJ 4DDFA 4GC7A 2AZ1A 1MN7A 1QAYA 2A10A 1S6OA 1ZAXA 4NMLA 4DX5A 4KGKA 2XZWA 3HHLD 1WKKA 1Q8KA 2F65A 1RT2B 4YEAA 3TZZA 2ROGA 2NR0A 1S97A 4DV2F 4BWJA 4ZPWR 4WIIA 3N4WA 3TA0A 2BM1A 4ZVPB 2FLOA 4C3LA 2FJAB 2AEMA 3AOBA 4HVZA 4O44B 2VOOA 1RCXB 1KFDA 3G8QA 2AJQA 2NLWA 5K14B 5C42B 1IKYB 4B9LA 3OTCA 4FNHA 2B6AB 4X4TA 2B5JA 2J8AA 3Q8QB 4HACB 3CCTA 6AT1B 2ROEA 3CCUS 4BC7A 1FJGJ 2HK3A 2K7JA 2R7TA 2ZWPA 3DM2A 1C4AA 5EWEA 3PO5A 1JLQA 3CJ4A 4DR5F 1R6YA 4DPUA 2XY5A 4OHYA 1U6BA 4IDKA 4R8UA 3DYAA 4CYUB 3KG0A 4DCOB 2VODA 3AJDA 2XHCA 2QYGA 4LRFA 2GGPB 2JWNA 3BH7B 3D1QA 2KXHA 3BB5A 2EFQA 5GMKa 1S10A 1PAEX 2QEXS 2RDIA 3O3LA 1UJ5A 3CIZA 3M2UA 3S01A 2OTJS 3BGOP 1X5SA 3PM9A 4IFVB 4PUOB 3PRVA 3IWNC 1Q5VA 5KG1A 4KTQA 4GC6A 1YRTA 3FC9A 1WF0A 2ALYB 2MHEA 2RDDA 2ZD1A 3FBEA 1B7FA 3Q83A 4U8VA 2J0XA 3ET6A 2HHVA 4FP9A 1U1NA 2GC8A 2C2EA 1S5ZA 1UVNA 2DNGA 3PYGA 3D3CJ 3HP6A 1CC8A 3IRXA 4UUXA 2HNDA 2HBYB 2IM0A 4K4SA 4KGVB 1QY7A 1RABB 1U24A 4LQ3A 1P8GA 2R4FA 3CCJS 1ZOTA 3D28A 3N6MA 4FS1A 3EGZA 3O2IA 3RB6A 2EI5A 1ROFA 2CJAA 1Q86T 3V6JA 3DLGB 4O4RA 5KG6A 5K5MA 2HZVA 2IBKA 4AT1B 1R3NA 2DD8S 2C2MB 3NWGA 3VV2B 2J7KA 2OMLA 1S1UA 1S1VB 1TKZB 3G82B 2EFGA 1TL7B 2YNGA 3AD9C 4M5DA 1UKUA 1ZM3A 3A3OB 1P9QC 2GO9A 3DDIA 4ZOSA 2EFVA 3V6HA 2DVIA 4ILMA 2DXDA 1IWAA 3AJ2A 3TUIC 3KLEA 2FGCA 3L4BC 2FHJA 3TANA 1C0UA 4DQIA 1V3RA 3DLEB 5KG2A 2HHUA 4OLOA 1IR2A 1IR1A 3KK2B 4FPIA 3CJ3A 5A8WA 3BYRA 4NMXA 1GMWD 2C1EB 1N33F 1ZAWA 2H5IB 1U47A 3QIDA 4MKVA 1E6VA 1FRJA 1LXNA 2BA9A 2E5LJ 2YKNA 2XSFA 3KNAA 1KTVA 2ZOFA 3IR5B 2RD5C 4EYHB 1WHXA 1S9FA 1FEEA 4FKXA 5HBMA 5I42B 1S7IA 4HTJA 3J81j 3ISND 3OTOF 3VALA 4A8YA 1R0AA 4NXMJ 4ELTA 2YKNB 2OPPB 4I68A 1VJWA 3MMCA 3W2WA 3PVXA 4PG8A 1HNXJ 2VFTA 3CCVS 4MYUA 3GLJA 1AUSL 3PKYA 3T6BA 4NCBA 3UE2A 3OUYA 3IMQJ 2GX8A 1NH7A 1HBUA 2F9DA 1VRUB 2DNKA 3FSYA 1SJRA 3L7PA 3VZHA 4I4BA 2FC9A 3G86A 3F41A 3MTKA 3DCAA 4DL5A 5T14A 3OSNA 3R2DJ 5LOQA 5FDLA 3GIRA 5IXUA 4FVCA 4ZP9A 4OHVA 3T41A 5KG5A 2FLNA 4ZHRA 2VKRA 3UDEA 3LAMA 4L72B 3POTB 1CJVB 3K5PA 4UQGA 1GFWB 1Q8IA 4K7QA 4J9QA 4IRDA 3R6LB 1PO6A 4PQUA 2KG1A 4C8KA 4LRBA 4B3SF 3Q8YA 1V5VA 2MSSA 1A6LA 3Q8VA 3VZIA 2UUCF 4LF5J 4IYQA 4OX6A 2H3EB 2L48A 4CLPA 2W9CA 3NBPB 2W4CA 2YKPA 2Q43A 3LP0A 2PEHA 1RHQB 3G6YA 2UUBF 1OSDA 1K1QA 2XI2A 3W65A 4DL0C 5KTQA 4DUZF 1EARA 1ZBTA 2EFOA 1NHUA 2ZOGA 2LEAA 2W25A 5SUHA 5LSLA 2B9XA 2XYHB 1D9DA 3HMJG 2CPYA 2J0QD 2HBQB 2LQ8A 4QYZJ 1WC6A 2E7WA 3C6UB 3GIJA 3BN4A 3CTRA 1RADB 1F9HA 4J91A 1R27B 5J2QB 1T8EA 2L3MA 3K8VA 3LPYA 4UOFA 1VQ9S 1M5VC 1B0VA 3DOKA 4JI1F 4Q0BA 5G0RB 4LRAA 1JLFB 3BV8A 5E7OB 4DQQA 2E5LF 4P72A 4NLXA 3JSRA 2E7VA 4DV5J 1FO1A 1S1WA 1U7LA 2LP4A 4IO1A 2VONA 1KS2A 3C15A 4WF9Q 4U95A 3V4MA 4RUBA 1HWIA 1RT6B 4ECQA 1HR0J 1X31C 1IBCB 2GGPA 4PXBA 2AU0A 1ITPA 1P6TA 4LMZA 3BGUA 4DL4A 1Y4ZB 2WSCC 2GQ2A 3QATA 4URQU 4UOGA 5JJBA 1R8BA 4X4UA 1HA1A 3LWMA 1CULB 1SB6A 3M8ZA 2ZNZA 1RWXB 2UUTA 3I0SA 1BE4A 4KV8A 5AXNA 2C2RA 3SXLA 1U1LA 4WXOA 4AQYF 4OYWA 4IUFA 2MHNA 2EK1A 2HFOA 3VAIA 4H4OB 4JI6J 1LXJA 4NLGA 5C25B 2E5HA 1DTQA 5HROB 1EZZB 2GJ2A 2CPZA 2DNPA 2WOMA 1MN9A 3F56A 1S7HA 2BMBA 1HARA 4U6PA 3MAAA 4X4NA 1NM2A 1T0TV 2OPSA 3M8PB 3ISZA 1P1TA 3GR1A 3LP1A 2DITA 1RAIB 4C8NA 1H0HB 3A12A 1F9FA
chains in the Genus database with same CATH topology
4KHMA 3QAUA 4YB6A 2EW9A 4M94A 3KWMA 1HI1A 3HM9A 1GT8A 4IH5A 4FZVA 1ZZFA 3O1LA 5E2QA 1VIOA 1RI7A 1HNXF 4J9SA 4RW4A 3HDSA 4TY8B 1MMLA 1SJ1A 4LSNA 3VTIA 3I4PA 4ETXA 1QTMA 5IT4A 4TNOA 1C1BA 3KKFA 4C2MA 2DO0A 3LWLA 4ZCKA 4ECTA 5AXKA 2CQIA 4XDDA 3NMRA 2KB2A 5E3AA 4MKBA 3PFEA 2FLLA 2NSCA 3V4IA 3BSNA 2CPIA 1M5HA 2M9KA 3KK3B 1S0OA 4WJBA 4OJGA 5F9NA 3K57A 3I31A 2CVIA 2CPFA 4KSEB 5LXYA 2MGZB 3DLHA 3QIPB 4MIWA 3PEJA 5KFAA 1BQXA 1S1TB 3BO4A 4QW9A 3HF5A 2V0NA 2HFZA 1MWZA 2VG6B 3R1HA 2IRYA 4MAKA 4CTAB 1MU2B 4OQJA 4MFBB 2VOPA 3LF0A 1Y5LB 2FHMA 1X4FA 1UVKA 5D4PA 1XEZA 2NPIA 3TRGA 4JI6F 1EP4B 2FVQA 4OI0A 4ETZA 1Q7YT 2D3OR 3VR1A 3M8PA 1HI8A 5AE3A 4J9PA 4PWDA 3V6DB 5KT3A 3KK2A 3TYTA 2DIVA 1WG5A 2ALZA 1TFWA 3IR7B 2HVIA 2HVHA 2LA4A 2CJQA 1SL2A 3L3CA 4IR1A 3HFKA 2E9ZA 2HGMA 5BR8F 1DLOB 1HD0A 1UEUA 1Z4UA 3VWSA 3OHBA 4TY8A 1Q53A 1WEYA 2E9RX 1RKIA 2HS0A 1HFEL 4ED0A 5EWFA 3SQGA 5ITHA 1Q78A 2APOA 2WBRA 2PT0A 4CH0S 2XY6A 1N5QA 2LXIA 4ZVEA 4PXCA 4E0DA 5I3UB 5J2MB 1KFSA 4F4KA 5E3PA 1UJ6A 4AFFA 4DPOA 3M30A 2MQQA 5CYMA 2N4DA 4NL5A 2G1DA 4WE1A 2HRUA 4EZ9A 3C6TA 3UWTA 1VQPS 5F8HA 3I96A 2D9OA 4I2QB 1K0TA 4DSJA 2EBGA 3H59A 2GCFA 2GMJA 1Z2ZA 1JLBA 2A18A 1RTIA 4DS4A 2DH8A 2LQ5A 4BBYA 2UVUA 4B9VA 3DXBA 5DG7A 2OO4A 1H7WA 3KLGB 5CH7B 3T5HA 1NJXA 1Y00A 4DQRA 5DDQC 2J9CA 1CG2A 4DN9A 2YQ3A 4OL8A 2RIJA 2ACYA 4IO9Q 3IFEA 3PY8A 3BO3A 5IWAF 2AD9A 4IR9A 1IM4A 3MM7A 1SI9A 2UV8G 2DGOA 3DI6A 2OFGX 4ZPDA 2COLA 3HT3A 3RTVA 2OSRA 4OHZA 3EZ5A 5KFUA 3V5RA 1VQOS 3IC1A 2KDOA 4DL2A 4FVMA 3E01B 3Q24A 3HVWA 2UV8A 4NLQA 2ZKUA 5HL7Q 3PW4A 2DHGA 1C0TA 3WZ0A 4IG0B 5D8HB 2D9PA 3HHLC 1FERA 1DZ5A 2B5JB 2QA4S 4OI4A 1OSCA 2M88A 1HD1A 2QYCA 1PSDA 5A2QY 2FC8A 3KK1A 3KFWX 4K4VA 2JHEA 2B4PA 5E3RA 1GXTA 2FHKA 3NS6A 5KFPA 3MEDA 2J7UA 3W2WB 2QRRA 4PXEA 4URGA 1VI7A 3E3XA 3M2VA 5DG8A 2KT5A 3CD5A 2YWFA 2ZJPQ 2RS8A 3B82A 4PG7A 1VRUA 4ED8A 2DPIA 2W4PA 5A0YB 4QQBA 1FJGF 4UQTA 2ZC4A 4TLRA 3M32B 5BYQA 1H2VZ 3GYNA 4LT6A 1FKOA 4XPCA 3G8SA 3MEDB 3SYZA 4DF8A 3NCRA 4A8FA 1RDRA 4CQ1A 2X1BA 3T6JA 1WD6A 3Q22A 3FGVA 4A47A 3SCKE 1RJJA 2HAIA 1U1QA 4DQPA 2QE5A 4A8OA 2F4VF 4B3TF 3ULHA 3LP0B 3H20A 7FDRA 2J5AA 2VPXB 2J0SD 2B3TB 2RKIA 1K9MT 2KKHA 1NZAA 5B0FA 2K1RB 3AHPA 5T7LA 3PHEA 2X1GA 3RB3A 4JV2A 5DO2A 4C0HA 3MR2A 1U45A 2VQEF 4OJ1A 1YQHA 2VG7A 1Q81T 3CDWA 3E51A 1FKPA 3DLKB 4MJKA 3JSYA 1BGXT 3SMZA 1M90T 1UVIA 4PPDA 5E41A 3MMBB 2I1RA 2DNQA 4QIFA 4R25A 1S1TA 5LJ5Y 1DQ9A 5KFLA 3T1YF 3KK1B 3PKMA 2Q1LA 4DV6F 2KJVA 4RZRA 1MW7A 1R43A 4WXWA 1CPZA 1S49A 3M8QB 1UAWA 1YJRA 4NRUA 1D3WA 3LP1B 2KM8C 2LU2A 3OLAA 4DR3F 1KN6A 2HPUA 3MEEB 4DV7F 4RW7B 3PX0A 3N5FA 2KT2A 2RQ4A 3PRBA 2G9OA 1YSJA 1RT5A 3CGIA 5E5NA 2P9CA 5HBMB 2W8LA 1JKHB 5I42A 3PXGa 2QMWA 3SSQA 3I0SB 4YFUA 3P5TL 2MQOA 3I0RB 4ZKAA 3BGFA 4R5PB 3RW6A 2HHSA 3GFHA 2XHWA 3M8QA 4F02A 3MECB 5H9FJ 3THVA 3J80Y 2BBEA 2UP1A 2FHOB 2VQFF 4J9MA 4AE5A 3NRBA 3W7BA 2F1FA 5DLGA 3R3TA 1QSSA 4F4WA 4AUKA 2XWXA 3MFIA 1QAIA 3NCPA 2E66A 4QW8A 1RQ0A 3LALA 1HHTP 3ICLA 4KB7A 1VLYA 3DOLB 2HZCA 3K8WA 3QPIA 1ZYQA 2FJBB 3OSPA 1B0TA 3I9ZA 3PDNA 2NZ4A 2AGOA 2C42A 1G7CB 3M6WA 3K0JA 2HHTA 2F8MA 5I3QA 4EFAC 1Z1ZA 2ZC3A 4TLQA 4C3KA 1KQSR 1N5TA 5IZHA 3UDCA 1RT1A 1VMBA 2PMHA 1JNZB 2AYEA 5EGYA 4X4SA 1YHQS 3CCLS 1HL6A 1AXQA 4DG1A 4RNHA 1Y3KA 2LA6A 3IS9A 4P6QA 2B9WA 4ZCMA 3MMJA 4FS2A 1IJEB 2JLFA 4N8OA 4RLEA 1NNDA 1GX6A 3KLHA 1L5UA 4DG1B 3I56S 1IQTA 5IQ6A 2X3GA 3OXFA 2V8HA 4I6AA 5ADZA 2QV6A 3OVSA 1K1SA 2IVMA 1JXLA 3CULA 3PW2A 3K5LA 3MM9B 2D7SA 2IRUA 4IQMA 3CMAS 2RQCA 2CQ4A 3CCZA 4ILRA 2FTRA 3TW0A 1H2UX 5KT2A 2VPZB 4HH1A 2XB2D 2ZH6A 3MM9A 2KHDA 2FB0A 2QO3A 3DNCA 1YJNS 1TKTA 1WEZA 2FPHX 2RQKA 3JYTB 2P9GA 2EFNA 1VQKS 3VQSA 4I64A 4LIRA 2E29A 2ERRA 3NP5A 1C0TB 1GNKA 2OLWA 1D0EA 2LCWA 3BF4A 4FF4A 3O8WA 4KGMA 4O44A 1LKZA 3EPGA 4IG3A 4MYTA 3VAFA 2BUNA 4RW9B 5CHCB 4AXJA 5HI7A 4NLDA 1HMVA 2IAJB 4NOHA 1U09A 3DLEA 4DHVA 3CDEA 4JBCA 2YX7A 2YX4A 3HVTA 3QWUA 1HI0P 5KFHA 4YR0A 4NLPA 1PC5A 1U1RA 3NAIA 3SDEA 5CD4H 1HNIB 1HQUB 5CYMB 1R8PA 4C11A 5F8IA 4A8QA 1JLAB 1R8CA 1KLMA 3MTJA 3NNCA 1T94A 2M3DA 2DGVA 1Y3JA 2E5GA 3R5BA 3OJUA 4EU0A 2YNGB 2MYFA 3DDNA 3MWBA 2PN6A 1XNQF 2Y0SD 4EO8A 4R0JA 3MUMP 2YY3A 1VIXA 3MDFA 2KI2A 2XULA 2ZFHA 4PG4A 4Z37A 3HLUA 5T41A 5LXRA 1VQ4S 5MLCV 2JFDA 4KO0B 1S6QB 1WWHA 2MZRA 5L1IA 3RAMA 4A8XA 3D0IE 1S1XB 2CPDA 2EVZA 4MIBA 3M30B 1TK0A 1URNA 3M05A 5GAHU 1VK8A 1U1OA 1VC0A 1X4HA 5I3UA 3I5AA 1TK8A 2E5IA 2RILA 5KFWA 3NNHA 4W92B 1M5PC 3GV8B 3M32A 3ITHB 2N3OA 2BANB 5GAEI 1C4CA 3SI8A 4PR6A 4KHPF 1SC6A 1X5OA 4UOCA 4Y2MA 4DR2F 5J2NA 4FXDA 1FESA 5FIIA 1H7XA 2KRRA 1AW0A 2X1FA 4P7TA 4LF4F 1NJYA 2C3MA 2Q6BA 3MHYA 3FQKA 1FD8A 1UW4A 2HWHA 1IKYA 3IN5A 1YI2S 4DLEA 2L9WA 3QGIA 1FD2A 2UXBF 2ILYA 2NQPA 3BQ2A 1SV5B 5CQGA 3S7RA 3JSMB 3RAXA 4HYKA 2UVWA 1N4LA 1HW8A 1KNZA 5KOWA 4ITSA 2HNYB 1HWLA 4G1IA 1L3UA 5KAKA 3G6XA 1X5TA 2FVPA 1QSYA 3RRGA 1D1UA 3HHNB 2XMWA 3B8HA 1OIAA 2KZZA 1XMBA 1ELOA 1VQ8S 1ZPVA 2DJWA 2HFNA 4USJC 3AQOA 4B17A 3CEDA 4ECWA 1JLGB 2ZNYA 3CT9A 1R8AA 2HNZB 3C6UA 5M2RA 3JAMY 2DR8A 2DNYA 5E3CA 2LEBA 4Z2XA 1UVMA 2FIUA 4I67A 4DS5A 1B0PA 1M5KC 4M1KA 4FPRA 5HMWA 5KFFA 2NUUG 5I3PA 2BYCA 1FNXH 1SKSA 1LQ9A 4EBDA 2DGWA 2IM3A 2CYYA 5J1NA 4WFNQ 1X0PA 3HXMA 4QU6A 2ADCA 2W9CB 3CXCR 1D8ZA 2DBBA 2BANA 3J7Z5 5IM0A 3RW7A 2HHXA 2W24A 2WSEC 1KOHA 1YBAA 2Z2LA 1SUQB 3M2UB 3CIMA 2F9JA 1P27B 3O5TB 2KN4A 3S6EA 2MZ1A 2DRBA 1GTHA 4FXVA 3NNAA 2KYZA 1UMJA 3OL7A 5KFVA 3DOLA 1X9MA 4LFCF 2IC3A 1RT5B 3T19A 4Y3CA 1FK9B 1XR7A 2LLZA 4IH7A 3B4MA 3LUYA 2DR5A 2GW8A 5AXLA 2C3PA 5HO4A 3AA9A 3GFYA 2PA3A 2F3JA 1KR4A 1SJFA 3D1OA 3KG1A 2CPEA 4KFBB 4RBTA 2QEXS 5E3QA 1TR0A 1F0XA 3BQ1A 2L9NA 4IKAA 4J37A 1DJ0A 1EP4A 3VAMA 1U26A 3M6UA 4ID8A 4X4RA 4WZQA 1H2TZ 3SCLE 1F5CA 1HNIA 1TL5A 4ID5A 3J7ZT 1HHSA 1GX5A 1RT4B 4FNIA 2JEJA 3HK2A 2AGQA 1S77D 4Q0BB 4QWBA 1F5BA 1SJ3P 3SSRA 2JVRA 5K14A 4AXIA 1C2PA 2ROPA 2HMIB 5DGAA 1JMTA 3N9UC 2CQ3A 2E44A 3DHXA 3SQGB 3C46A 1MSWD 5KG7A 1LK7A 1TL3A 3DRXA 1LWFB 3CC7S 3MM6B 1R8HA 2J0WA 1N5SA 2R7QA 1S48A 1R0AB 4Q45A 2K3IA 3FEYB 3KJVA 2E1CA 1DAXA 5KFSA 2YWHA 2YKMA 4MTPA 4O4GB 4C0OC 4CZCA 3M4XA 4Q43A 3PR4A 3MPYA 4MH8A 2BOPA 2YH0A 5KFQA 1S0NA 4EWTA 1L3KA 2BABA 4CIOA 4TU9A 4C3MA 5FDLB 2A2DA 1DLOA 1IKVA 2ZUGA 4GO5X 4OI3A 5D77A 5HMYA 4F67A 3FCHA 2JRSA 1IBMF 1ZTTA 2EK6A 2LDYA 2XSJB 4ZPBA 5MAOA 3PIOQ 2XGPA 1E6VB 3LQVA 1MROB 4CI0B 3MI7X 2HQ3A 2RDJA 5KFTA 3TOQA 3PX6A 1W2BR 1CEZA 5BJRA 5EDWA 1U4BA 5KT4A 2CPJA 3GIMA 3MEGA 2V5HG 4OLPA 1JJHA 2GMHA 2A3JA 3MGJA 5J2NB 3HJFA 3AB4B 4K4XA 2K2PA 1VQMS 4RW6B 4K4UA 5B0EA 3M2RB 4ECRA 1KRPA 4G1PA 2IM2A 2J9DE 4GO7X 4LF5F 4O3RA 4K0KF 3AH6A 4YHHF 3BO2A 1LW2B 2AF6A 3HKZD 3GQCA 3I87A 1C1CA 2Z4PA 3DN9A 5DQIA 3RB0A 1IKXB 3MPWA 5A8KA 1T05B 4WZMA 2PMZD 1RT7B 2GA7A 3CDBA 2AYGA 4YP3A 4NYPA 3BR9A 4ES1A 1LW2A 1V9OA 4X62F 4QOTA 3JTOA 3TVYA 2MKIA 1S1WB 4MIAA 2R7RA 2YNHB 4O3OA 1MMNA 3K2YA 1RT7A 1IUJA 1M0SA 3OQ2A 1JKHA 2N82B 1BQMA 1CC7A 1KHWA 2AJFE 3MM5B 2R8GA 1YITS 2IA6A 4WTYA 2DNMA 1IR0A 3UCGA 4RX6A 3AJ1A 2DGSA 1RK8A 2R2SA 4XPEA 2BQUA 2UVRA 1WELA 2BW2A 4A46A