3MZIA

Crystallographic structure of the pseudo-signaling state of the bluf photoreceptor pixd (slr1694) y8f mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
SLYRLIFSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNETYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRPSAMDPEQCLNFLLDIAKIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activator of photopigment and puc expression
publication title Mutational and Structural Studies of the PixD BLUF Output Signal That Affects Light-Regulated Interactions with PixE.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Protein binding
total genus 29
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mziA01
3KG1A 1TZ0A 2AP6A 5B0EA 2KT2A 2QYCA 3K7RA 1YRXA 1W2IA 2ZDOA 3QGPA 2LXFA 1APSA 1Y9OA 2FHMA 1TL4A 1OQ6A 1Q4RA 4ZA1A 2PGCA 3DCAA 1FEEA 2OAUA 1JWWA 2XMJA 2XMUA 1ULRA 2LQ9A 3MZIA 4OIXA 2RU9A 3MCSA 2GV1A 3LGNA 4QOTA 2LQBA 3KKFA 2OKQA 4A4JA 4DL0C 1V3ZA 2BBEA 3HHLA 4EFAC 2VV5A 1URRA 1X0PA 1YJUA 2G9OA 3HHLD 2GA7A 1TUVA 1MWYA 1FE0A 1N5VA 3HX9A 3BDEA 3E8OA 3CJKA 1YJVA 2K1RA 2HLTA 2N4CA 1N5TA 2N7YA 4FNIA 2XMMA 5B0FA 5T7LB 2ACYA 5F0UA 2K7JA 2W4CA 5B0AA 2ROEA 2OFHX 3HFKA 1KQKA 1RJJA 2PD1A 4NL5A 1FVSA 1FESA 3FMBA 2JDJA 2KYZA 3HHLC 4OJGA 2CRLA 2QLXA 3HDSA 2Q3PA 3BR8A 2OP5A 2XMTA 4HH0A 1TR0A 2GFFA 2HFNA 1Q8BA 2XMWA 2RILA 4FNHA 2RMLA 1K0VA 2BJDA 5A6WA 4A46A 2HFOA 2W4DA 2HIQA 4DPOA 2K7KA 1VQYA 2QLWA 2FIUA 1IUJA 1FE4A 1VQSA 3IWLA 3HHLB 1Q8LA 1Q53A 2GO8A 4U9RA 2IFXA 2IYIA 5KAKA 3BB5A 1N5QA 2HLUA 1X8DA 3BF4A 2FB0A 2OD6A 2IYGA 2K1RB 1P6TA 3BM7A 1SQEA 5A6PA 2BYCA 3BGUA 3HF5A 1CC8A 3LO3A 2KT3A 1Y0HA 5B0GA 2ZDPA 4HH1A 1XBWA 4ZOSA 1FVQA 4HI2A 2BJEA 4F67A 4OJHA 2GCFA 1WD6A 1CPZA 3T9NA 2QIFA 2FTRA 3IWXA 1U7LA 3F44A 3KG0A 4DN9A 2ASYA 2OD4A 4Q2LA 5IXUA 4Q2MA 2KKHA 2VH7A 1OSDA 4YEAA 2AJ0A 2GGPA 1MWZA 2XMKA 1P8GA 5B0CA 1SB6A 1SI9A 2AW0A 1AFIA 5B0DA 1QUPA 2N4DA 3QMQA 3KNGA 3DXSX 1KVJA 1YJTA 2BUNA 3CJKB 1AFJA 1YG0A 3I9ZA 3VTIA 5B08A 1OQ3A 2HQIA 4Y2IA 1X7VA 2RSQA 4A48A 3WDOA 2LDIA 4OJ3A 1S6UA 2XMVA 5B09A 1N5SA 2AJ1A 3FRYA 1FD8A 1S6OA 4OJ1A 5K9FA 4HL9A 4Y2MA 5B0BA 3FGVA 2OFGX 2ROGA 4YDXA 1CC7A 1GXTA 3LGMA 2OMOA 2EW9A 1R6YA 1YJRA 1GXUA 1KVIA 1LQ9A 5F0WA 1Y3KA 2ROPA 3TRGA 3TOQA 3UDCA 1JK9B 3TNVA 2L3MA 4HI1A 1TL5A 5T7LA 1AW0A 2GGPB 1OPZA 4A47A 4NPOA 3GZ7A 2K2PA 1Y3JA 2W4PA 3BN7A 4Y2KA
chains in the Genus database with same CATH superfamily
3KLVA 2FHMA 3G82B 4NA3A 1RABB 2Y1RI 3MOJB 1R3NA 1F9EB 4UOHA 5ETPA 4C0BA 1GQEA 2G1DA 2XCPA 2WK4A 1MNEA 1WKKA 3TARA 1UMJA 3BQ0A 2BJ9A 3BSCA 4OV1A 4PXEA 2ZZNA 1GMWD 1GMVA 4QR1A 3T5HA 1TR0A 3GYGA 2HIQA 5DQGA 3LH2S 2IYIA 1QVGR 4U96A 3OL9A 1GXLA 1N33F 1UVNA 3J7AN 3BPDA 4DUTA 4OZ2A 3C46A 1OY9A 4P71A 4C8ZA 2GW8A 4JI2F 2HPUA 2CWKA 4FVMA 4U95A 3EGZA 1RTIA 4P10A 1BQNA 3MEDB 3JSRA 3M30B 2FHKA 2VD3A 2DHHA 4M1KA 4C8MA 1JJ4A 3QZ8A 3KG4A 4M5LA 1KVIA 4ED0A 3UDEA 1NZ8A 5J1PA 1HD1A 1VRTA 4F4YA 2V6AA 2VZ9A 1ZZNA 3QRRA 4LBPA 5J2QA 2AU0A 2AHOB 3GCWP 1H2UX 3I5CA 2OO4A 4RW8B 5B7WA 3M6UA 4LFCJ 3CJKA 1RWKB 1O6XA 4ZCKA 2XCAA 1EIYB 4DSKA 1Q8KA 2DVIA 4ED7A 3W62A 4KH0B 1PAUB 2B9YA 4RNOA 3H25A 4WE1B 1P27B 2BQ3A 3JTPA 1JIHA 4UOFA 4N8OA 5A6PA 5H1SV 4GC7A 1VRQC 2NXNA 1U8SA 4YY3F 4CI0B 5HP1A 3NGSA 3BBCA 2KFYA 2DCLA 5CYMB 4WKYA 4DR1F 2UVUA 5ETNA 2PC6A 1KP6A 1S6QA 1N52B 1SB6A 4GKJJ 3GU0A 1X9WA 1L3KA 2MPUA 2PFFB 3D0HE 1PGZA 1RWNB 5K9FA 4ZVGA 5LSRA 1CEZA 3FEXB 4L75A 2CPDA 4OQJA 5IC4B 1TQLA 1FRHA 1UAWA 2JWNA 4MIAA 2EK6A 4C0HA 1YRXA 4IH6A 4AQYJ 3W64A 3GIKA 5LMUJ 4OIXA 3ZZ0A 2CNNB 2PFDA 1URRA 1LKZA 2W9AA 2FGOA 2GMHA 3OJSA 1RLCL 3BSNA 3HD2A 2WBRA 3CDWA 1PYOB 1HBOA 1PBUA 5FLXU 4X66F 2DGSA 2FIUA 2CWXA 4U9RA 3IRXA 1A0OB 3VR1A 3NGDA 1LW2B 3HFZB 2WZ1A 1CSJA 2O67A 5F9LA 4B9MA 5CD4A 2PN6A 3A12A 2CAJA 3KDOA 3BSAA 2CVIA 1B99A 4URSA 3GONA 4LR9A 2FZGB 5K14A 2P9GA 1NDCA 2CPXA 5AXLA 2HNDA 3A13A 3ZZUA 4MK7A 3GJTB 4U7UD 1N88A 2VU5A 3HULA 2ATCB 1EETB 5EHHA 3PW2A 5DJBA 5A8WB 4ECXA 4PUOA 3IXQA 5B0BA 1EKSA 2I0XA 3LAKA 1SJ1A 4ED2A 1YHQS 2W1BA 1GMWA 5GVQA 3UDLA 3GPAA 3QYYA 4HDHA 1S77D 1ZPWX 1VI7A 3N5FA 2O5DA 1S1WB 5E3PA 2VG7A 2CJ9A 3PFEA 5G0RB 2FVQA 1D9FA 4W90B 1NDKA 3HDSA 1RAOA 2HK3A 2AD9A 2NZ4A 1KOOA 3QJLA 3OSNA 5BYQA 3O1LA 4DCJB 2ILYA 5ETTA 5HQ8A 2YH1A 1N4LA 2W9CA 3FRZA 3KHHA 4HVZA 1FDDA 2E1RA 3WBZA 3IGNA 4MMOA 2GCFA 3VVUA 1IBKJ 2B8QA 2OD4A 4P7VA 4WFZA 1UWBA 1TAQA 4X62F 1SC1B 4ZLNA 1T94A 2NS1B 1OYEA 2DJWA 4NXMF 3IBCB 1DTTB 1SXLA 3DM2B 2AJ2A 1R7IA 4QR2A 4I2PB 5C24B 3N9UC 5E33A 3VAKA 2M88A 1JK9B 2Y3YA 2UU9F 3SZ2A 2W4PA 2MQNA 5F8MA 1SUQA 4ED8A 2EFQA 2Z2ZA 3CCRS 1X9SA 1JWWA 4QOTA 2NPIA 2KO1A 2ERRA 3Q8VA 3QO9B 5HSPA 3I32A 4EK2A 1ITPA 2X3GA 2PMHA 3N79A 4WTYA 3GFHA 3DOLA 3J7Z5 3PEJA 4Q0BB 2DGVA 1KR4A 5AE2A 4FYYB 1Q8LA 2DHXA 3IA0A 2ZOFA 3F73A 4MK9A 1XTZA 3V6KA 2DHGA 1UWAA 4CLZA 1TTHB 3MCMA 3WZ0A 3DHXA 1VR6A 3LP1A 2EG2A 1EJ7L 4ZHRA 3L9ZA 2FUG9 3HPOA 4K4XA 2V63A 4Q2MA 2Y0SD 3IR6B 4LR8A 2DXFA 4RW7B 3AH6A 4QIGA 2JLFA 3RR7A 3G82A 2XULA 2A0FB 3VGUA 4O3RA 1NJZA 3JS9A 5HVFA 1U09A 1NK4A 3L4BC 4C8NA 5HO4A 3KK3B 1CBKA 2OAUA 4DHVA 1LK5A 3PFOA 3SCIE 1VBXA 3DRSB 2X7IA 5F41A 4I2QB 2YKAA 2BKOA 2L9DA 3CCQS 2ZUGA 3PNIA 4O4RA 5T7LB 4JI8J 1T02A 1U47A 3HVRA 2YKOA 1Q16B 2WVFA 5CH7B 1RTZA 1Y4ZB 1QM9A 3SDEA 1HQUA 4CM0A 3MPUB 2IAJB 1PJ7A 4KHMA 2GVZA 5KG0A 1NPKA 1T05A 1CC8A 3IC1A 3M30A 1REVB 2UUBJ 4RJVA 5L1JA 2ZM6J 1F5BA 1Y5LB 1S12A 1NO8A 3DNCA 2RQKA 1CJTA 2DR8A 1IQZA 5GADU 5B0CA 1WC4A 2EBGA 1NPRA 3D1HA 2RHQB 3KFWX 2XYHB 4H4KC 1HNZJ 4DS4A 2QE5A 1H74A 1XERA 2H5EA 4NYOA 2KHCA 1M0SA 3QLHB 3KG1A 4J9MA 1RT2A 2WVCA 2V8HA 5HL7Q 3E51A 5DM6Q 2Z4PA 1PCAA 3SV3A 1HD0A 5KFFA 2LVWA 3IP0A 1UA1A 4FF1A 1NDPA 4WE1A 1VHIA 5F8HA 1U2RA 4JV2A 3W2WB 1MW7A 2XC9A 2IMWP 1VLYA 2C3OA 5CCMA 3FCHA 2ZVIA 4LF9J 1X9MA 4ICLB 2OSQA 3CC2S 2HHUA 5CYMA 2YBVA 3W61A 2QLWA 4IDKA 2CJKA 1YJWS 2OPQB 1HPZB 4LF4J 2RE1A 1X5OA 3GJQB 1NJXA 4P73A 4NXNJ 1IJFB 5HATA 1VBZA 4YEAA 2AJ0A 3ZZOA 3CCLS 1PG5B 2R4FA 5KG3A 4LFCF 3PO4A 2E1MC 1QAYA 1NKBA 3GYNA 2B56A 1RT6B 3IMQJ 2DPJA 4FXDA 4QWAA 3P8BB 5GAEU 3MR3A 4RW6B 2K2PA 4UQTA 2QJ3A 2NLWA 1WNEA 1JLEA 3I0SB 2LQ9A 1S1TB 4A4JA 2OGUA 2E5HA 5KFBA 2RIJA 2G9OA 3ET6B 2R9LA 1LW2A 3RBZA 1S4EA 1N5TA 1H7WA 2XMAA 4GKJF 2YQ1A 2Y8WA 1Q53A 2ASDA 3CCZA 3R2CJ 4WK1A 4DR7J 5IOLA 5D0HA 3FBCA 3LPEA 1EETA 2L41A 5A8WA 4HI2A 1W7WA 3P4UB 4AQYF 4NE9C 2H51B 2MQ8A 3G8TA 5LMUF 1D09B 4ELUA 2DY9A 2BZ2A 2CFXA 4NWBA 1RBAA 1W25A 5ETMA 1VRUA 3D3BJ 4Z7CA 3M2UB 1S0OA 2ADBA 3RB3A 4WFBQ 2RHSB 1S1WA 1I3OB 2XGPA 5HVGA 5G0RA 1F60B 4WZMA 1H6KX 2I1RA 2HHHJ 4YQWA 1HQEB 4TLRA 5F8GA 3UNGC 1TL3B 4WXOA 2YNFB 2D69A 1FTRA 1RXOB 4RR5A 2DGOA 2HVZA 4QWDA 1HW9A 2OUGA 1HBNB 1J5EJ 3N5BA 2W7PA 2CRLA 1CG2A 1FF2A 3QT8A 2Q3PA 2OP5A 5D8HB 2NR0A 1FKOA 3H40A 2FZCB 3PO5A 3V5RA 4DR3J 1Q7YT 4PWDB 2WOMB 4ECWA 1QVFR 1DTTA 3DM2A 3PW4A 2JVOA 2HFSA 3Q22A 4LRAA 1H2VZ 1PC4A 1S1UB 1XNRJ 2D9PA 3T5KA 4M5MA 2XTJP 2ZNZA 3TVKA 4FF4A 2F4VJ 2OELA 2V4JB 5MAOA 2WSEC 3RRKA 4B08A 1KVKA 4K5RA 2E5IA 4CH0S 4CLPA 1HNIA 1B7FA 1MMLA 3KUEA 4B02A 1BY9A 2G0JA 4NYZA 4Q0BA 2DITA 3HKWA 2I8EA 2R2SA 1IBKF 2M70A 3TA0A 3VCDA 4UTGA 5T41A 2LQ8A 3LWMA 2NXJA 3D0IE 3JTOA 1YZ6A 3AOCA 5HK4A 2W4DA 4B17A 1ZETA 3KJQB 3OW2R 4DF8A 4HHJA 5GADI 1DTQB 4X4VA 4RW7A 4MYUA 4OYBA 4H54A 2ZH1A 1QLNA 4LRDA 5GMKa 1UZHA 2HW3A 4KFBB 2LU1A 3H5UA 3DLEB 2D3ZA 2CADA 4ZVQB 3AOBA 1N5YA 4ZVEA 3H20A 1F6TA 4M5KA 4DZ6A 5HJXA 3CVKA 3KK3A 4WBFA 1L3TA 2ZE2B 3U1NA 4F25A 2CNLB 5J1NA 4F3MA 2AIRB 4HI1A 5T7LA 3BN7A 4LMZA 2HQCA 2ZJQQ 5FJ4A 4KPYA 5KT4A 1Q4RA 1WG5A 3EJMA 1S6PA 3EVWA 2KFZA 1Q79A 3QAUA 1NMEB 4G1IA 3E01B 1T9UA 4FVCA 2B6AA 2IAJA 2ZKTA 3CXCR 1RUSA 5KFWA 2N7YA 2VBYA 2VB6A 1TMMA 3MUMP 2ASLA 1YX2A 4Q7AA 3GIMA 1REVA 2ZJRQ 2WAQD 2RAQA 5C5JA 3FNNA 1K44A 5C42B 2VFVA 1ZA2B 2U1AA 2UXBJ 3KLHA 2CQGA 4IQXA 2I38A 3HK2A 1I51B 1RTDA 3CCES 2GHVC 3DRXA 1S5ZA 5GAEI 5DLFA 2ZOGA 2AV5A 1WOOA 3QLHA 5HBMB 1CJKB 4JI8F 4FYDA 1SV5B 5KFYA 1QJHA 5KFQA 1RWUA 2LXIA 1OWXA 1UJ6A 3IBWA 4PQAA 2ZKUA 3DLHA 3A1YG 1U6ZA 3H5XA 3TZWA 4B9UA 1TZ0A 1VISA 4IUFA 1FKAF 2F65A 4YR3A 2QLJB 3NAIA 4ICLA 5KFOA 3ETOA 3FSXA 3OUYA 2KU7A 4TU9A 2F8EX 2DH9A 5FIIA 3CDEA 2UUBF 3C66A 4I7FA 5BJRA 1YLXA 1HNWJ 1DZ5A 2ZHAA 2OPQA 1HPZA 4EMDA 2K7JA 4PYAA 2EC0A 3T41A 4DCOB 2FLNA 3J7YU 1UVKA 3OFEA 1X31C 4BS2A 3NEKA 1C0TB 1OJ4A 5IM0B 4P2MA 1HNZF 2G13A 5LJ5Y 3BM7A 4FP9A 2BYCA 4J9LA 3RR8A 4E98A 1TL1B 3MMJA 1JQGA 1P9YA 2K3IA 8RUCA 2Z2MA 4X64F 4PEOA 5DZ6A 4ZPVR 3KTQA 2CPFA 4D3GA 4C11A 4P2XA 1HR0J 4RW6A 4UY85 1OQ3A 3MUTP 1C1CB 3I0SA 3TANA 1M5OC 2AT1B 4CLWA 4LF9F 4KGMA 3ET6A 4AYBD 5F0WA 1NJIT 4L73A 4DF4A 3BBFA 4NOHA 4UF4A 4ZA1A 4U7UK 2RRBA 2Z58B 4NXNF 4BBYA 4OYPA 1C1BA 4GRSA 2CQ4A 4GVBB 4O3SA 4HDGA 2V0NA 1GK8A 3OR2B 3HSZA 3V2UC 4ELVA 4U8YA 4G1QB 2OPPB 3TR5A 5F8LA 4KO0B 4P74A 2KT3A 2ZITA 3EX7B 1JLCA 4ZVUB 3CCSS 3EGNA 3QWPA 4OYZA 3CC4S 1BUXA 1KTQA 1AROP 1HQEA 2HQIA 2MEWA 3CIMA 1TL3A 2YNFA 4AE5A 3NLCA 1G1XA 4QYZJ 4ZPWR 1HBNA 2GJIA 1UW4A 1HL6A 4UZCA 2VPYB 1XR5A 1FTCA 1N0UA 3SI8A 4DR7F 2BQRA 3DCAA 5E41A 3PW0A 2V2VA 2DEJA 1V6HA 3NBPB 5CA5A 3THPA 1K8AT 3NWGA 2WOMA 1SQGA 1KQKA 1SJRA 2FLOA 1RYSA 3ILLA 3M6VA 2HHTA 3BV8A 3ZO7A 3TAQA 3NNCA 1VQYA 1DY3A 2PI5A 1RA7A 1OYDA 4I6YA 1RACB 4Y2CA 2HHHF 2V4JA 2A1BA 1L3VA 3E2EA 1SIWB 1CJUB 2ZJPQ 1WF0A 2HSEB 3K2YA 5CD4H 2DO4A 8AT1B 4K2XA 3KLFB 4QU7A 4IQMA 3DYAB 1J5EF 4J90A 3AXKA 2J7KA 2UUTA 1R8BA 3CJ8A 2WW8A 1WHWA 2BEFA 3UDCA 5A2QU 1TL5A 2HS0A 3CCMS 2KT2A 2KXFA 1APSA 4KRWA 2DPIA 1X4BA 4DR3F 3D28A 1N56A 3GG0A 1UVJA 4DL0C 4I1TA 3D0GE 3M9NB 1DTQA 3U1LA 2GQCA 1XNRF 1YRUA 3J81U 3VALA 3QQCD 4J9NA 3V6JA 1KD1T 1NJYA 3DLEA 3I5AA 4OMFG 5FDLB 2F4VF 5A6WA 2UV8A 2K7KA 1S9GA 5KAKA 2NXUA 2DR7A 3M8RA 3M9MB 2ZE2A 2K1RB 2KFNA 4M5IA 2VKRA 4OI4A 3P5TL 3OVSA 4FBUA 2DGUA 4JV1A 3DGPA 2FDNA 2ZZMA 3VZIA 2YH0A 3UR3C 4ILLA 4OZ0A 2Q1LA 1S0VA 2CJXB 1UEKA 3NGKA 2H48B 1NKCA 3J7YI 3PYFA 4HACB 2N7CA 4A8YA 1TK0A 1PAEX 2B3TB 1KQGB 5C42A 1TKDA 4H4MB 2VOPA 4RWXA 4IYQA 4CO5A 3M9OB 1Q5YA 2YX7A 3SCJE 3ZZRA 1XJWB 2MKKA 1RT3B 3RB4A 4CTAB 5CYQB 2VONA 1GX6A 1F3VA 4HT5A 1VOMA 2GIRA 4V19X 4DR2F 3BKTA 3B8HA 2NXCA 3H42A 2CA9A 5HBMA 3THVA 1CJKA 3G87A 1NH7A 2AZ3A 1HYSB 4BWJA 3GILA 3M32B 3TO8A 1SV5A 1SKRA 4X4NA 2JLGA 2FTRA 2CPEA 5IZHA 2A2DA 2AJ4A 2J0QD 3N4WA 2BUNA 1A7GE 2C2KB 2M0GB 3IG1B 4ZCLA 3BGOP 4TNOA 1F5AA 4N7TA 1BMQB 4EI2A 4NCGB 5DQHA 2OEKA 4TU8A 4IG0B 2YWFA 2UXBF 4X4UA 1KBRA 1FDNA 1EKRA 3M8WA 1C0TA 3G4SS 5IM0A 1FXLA 4DUYJ 4JYAF 5F0UA 2KB2A 2QMUB 5KT6A 3BO3A 4B3TJ 2GVDB 4O4GA 2AF6A 2DH8A 4PG6A 2C28A 1RWXB 3PX0A 2H65B 8ATCB 5JVHQ 1U0SA 3CO0P 4QWEA 1U02A 3CCTA 5EN1A 4B9NA 1XBWA 1S76D 1FKPB 4KT0C 4A8WA 3IS9B 4WWSA 1YTYA 4PPDA 3TEGA 1KLNA 3VAMA 1SI9A 1E6VB 3PVXA 2XNQA 2W24A 1HNWF 2EK1A 1PJ6A 2DHSA 4RKUC 2CIMA 2KM8C 4OJ1A 1FWPA 1SJ3P 1ZM2A 5M2RA 3P5BP 4GVBA 2CG8A 3EZOA 3OR2A 4DCPB 1K1SA 4LF2A 2LEBA 3B6BA 4P75A 4G1QA 2OPPA 4CNZA 2FJXA 5HN0A 4A8MP 4KO0A 2C42A 2KYXA 3K5MA 1FK9B 1HR0F 3CJ3A 1N6QB 3OR1B 1D0EA 3EDQB 1JLGB 2RILA 5LMNJ 5J2NB 3RTVA 2IPOB 1MROB 2BXJA 2R8IA 3TYTA 2PSZA 1AZSB 4XIUA 5IC6B 3I9V9 3FCWA 4F4KA 3TZZA 2G2OA 2BJEA 4Y00A 3LP2B 4ES1A 2F4FA 2WVDA 4LSZB 2OPSB 2GHPA 5I3PA 1X7VA 3K59A 3QGGA 4RU9A 5DG8A 2BE7D 3ZNUA 3NBPA 3EE3A 4TLQA 3B78A 1CS4B 1YJRA 1GXUA 3MD1A 3D66A 3TRGA 2VJUA 3D6FB 3M2VB 2ZDOA 4MTPA 2HRYA 4F36A 3IBFB 1N48A 3GFXA 3TUIC 4ECZA 2HHPA 1NKEA 4JI3J 3KYLA 1RDRA 5K5MA 3OLBA 3Q89A 5D4LA 4C8LA 2XYPB 4MIBA 3TQEA 1VQ9S 3Q24A 4GKKJ 3DU5A 3NNAA 2P8IA 4PZVA 1RT5B 1CJUA 4LUBA 2E5JA 4ANEA 3ICLA 3J80U 3KLFA 2ZOMA 2LEAA 4R8UB 5D6GA 3D7SB 2ZHOA 3F41A 2DKOB 3WIVA 4E8UA 4W4MA 1BGXT 2V8VA 2IM0A 2BRLA 4OHWA 3AD9C 3RW6A 4CLTA 2YNHB 5D77A 4O3QA 2XEXA 3MM7A 5A8RA 1HLWA 3H2UB 5AXNA 3C3LA 3G6VA 2EKNA 2F63A 1NCLA 4LF6J 1LWXA 4RW9B 2V67A 2MHEA 3R2DJ 4RZRA 2NREA 2RVJA 5E0OA 4XO0A 1B0TA 3WC2A 2LMIA 3MCOA 5EGYA 1TUVA 4RW4A 3Q8RB 2K1RA 2LU2A 2R7UA 4NMXA 2IM2A 4M95A 4USHA 5HQLA 3PRVA 3VAGA 2NSBA 3NNHA 4JI4J 1HBMB 1IBLF 4CNYA 2M9KA 3PIPQ 3HSDA 1UPPA 5JMNA 2MLZA 3SSQA 1WC1A 2NUHA 5C25A 3J80Y 2XWYA 4HACA 2HQDA 4AL7A 5B08A 3AJ1A 1S10A 5CCLA 3AQOA 2AEFA 2PA3A 1S6OA 2C2EA 1ZTTA 2KL8A 4ANCA 2GMLA 4H4MA 4HL9A 5K8MA 2A3JA 2EFGA 2RNEA 4OLOA 2LYVA 2FY8A 1FDAA 2GX8A 4FN5A 4PKDB 3IN5A 2L08A 3PR4A 1RT3A 4R25A 2V50A 4CTAA 2RS8A 5CYQA 1D8ZA 1G2EA 2IC3B 1MN7A 1UZDA 4FNIA 4WIQA 3FKBA 3HZEA 3R1LA 3EMTA 1LOUA 4OYWA 4DV5F 3NS6A 4ZJLA 3NP5A 3KLEB 1RYRA 3M32A 1NB2A 3UI3A 4OJGA 2JL9A 3EM1A 2ZC4A 4CWBA 1JNRB 2QZ8A 3QSIA 3JSYA 4NLYA 4DMZA 2DB1A 2G2ZA 1ZM4A 4IOAQ 2NXEA 3IG1A 3R6LB 3ENQA 3TJ8A 4MKVA 3PRDA 2XS2A 4Q2LA 4NCGA 4EZ6A 3MTJA 4OHYA 4IG0A 2HQFA 2XO6A 2BABA 5EWGA 4FS1A 4A48A 2H4YB 2ZBCA 2OSRA 1YQHA 3W8PA 1J5OB 3G6XA 4TYAA 3KHLA 2ADCA 4A8KA 2RH3A 4I6WA 4DLEA 5K20B 3VAHA 4K50A 2HKEA 2GVDA 5IXUA 1TV6A 1WG4A 4U8VA 4I64A 3ZNJ1 4JP8A 5ETQA 1RB0A 3MTKA 4BWMA 3HCXA 1X60A 3CDAA 4DQQA 3I96A 4DPYA 5I42B 2IRYA 3I82A 4OX9J 1XMBA 1MLAA 2JHEA 2GIFA 2O1PA 3ONQA 4G65A 1H38A 1VQPS 3KK1B 7FDRA 4FYVB 2MTLA 2YVSA 1E6VA 5H9EJ 3W2VA 5KG7A 4FPIA 1ROFA 5L1LA 1PKUA 2QSWA 3MAAB 4AT1B 4FF3A 1NK5A 4UW2A 4DUYF 4F7VA 1KVJA 1E6YB 1PYSB 3AQPA 4B3TF 2KXHA 3G8SA 2YNIB 2Z0GA 4Z37A 4GO7X 2V34A 3UCGA 2X1FA 1FK9A 1QE1B 2D9OA 2HS4A 4LREA 1Y3JA 4EBDA 1S1XB 3OR1A 5L39A 3V6HA 3I6PA 3BYRA 3UE2A 1T9YA 1JLGA 2CZ4A 1ULRA 1H73A 1QAIA 5J2NA 2VG6B 1JLAB 2YKQA 1H2TZ 2JRSA 1MROA 1XWLA 4A8QA 1FDBA 3HHLD 1NHVA 3ILOA 2MXYA 3KNAA 3FBBA 3LW5C 4DR6J 2HWTA 4EBEA 3L7UA 1KS2A 2LFVA 2XZDB 1WWHA 2W8KA 3LUYA 2YKPA 1VYAA 1UEVA 4ZLPA 3W8GA 3T1HF 3W5XA 3BBBA 3FEZA 2D3OR 4DV6J 4HH1A 4URGA 1FO1A 4ZOSA 2KVIA 3UO0A 3ZZYA 1MMDA 2IBOA 1CS4A 3H8YA 1RP5A 4P72A 1PYTA 2ZH6A 1RAHB 2VBZA 3M2VA 3KK2A 3AHPA 2Z30B 1S0NA 2MY7A 5KFCA 2DISA 2QC3A 3W1YC 2V8PA 2EFNA 3P45B 3PHEA 1R31A 4ED1A 3IO1A 1NLKL 1YSJA 1FRJA 5LMNF 5IT4A 2Y1IA 3W3SA 3NGUA 5CAAA 3CJQA 1RT5A 3U27A 3MECB 3EDRB 2XBPA 4LSLA 3FFIB 5E5NA 4R8UA 4TYBA 2JVRA 5IT0A 1VFJA 2HHSA 2R7QA 4QIVA 2ZBRA 2KYZA 1RAGB 2HIYA 4F50A 2BANB 5BR8J 1NUEA 5HLFB 1J27A 5EX0A 3D6HB 3GWCA 4C97A 5MLCV 1JXEA 4RWWA 1LWCA 4C0OC 1B4SA 3FZBA 1G6BA 3GMGA 2DNRA 5DRKA 2B0GA 3V4IA 2GNKA 1RWVB 1U0HB 3RGIA 3DXBA 4RW9A 4NLDA 4G6VB 2KZZA 1LEOA 1JLBB 1KNZA 1M1GA 2ZH8A 2VHGA 4GKKF 2BOAA 2OTJS 2BRKA 3HZGA 3EZ5A 3MDFA 4KC5A 2GJ2A 2HMIB 4NPOA 1R27B 2FC9A 2V94A 4NLTA 3JAMY 4DPUA 1FFGB 1YJ9S 1A6LA 1H3DA 3CMAS 4EU0A 1BWEA 3R5AA 2Y0BB 2UUAJ 1O5JA 1Q1KA 2HZVA 3DOKB 4KGXB 4UUWA 1HBMA 1MWQA 3L7PA 4Q43A 3OJUA 2QL5B 3JB9k 4OZLA 2MKJA 3ITHA 3L7OA 2XLKA 2MZQA 5L38A 2VPXB 4OYIA 3EXCX 1S1VB 1T3OA 4PXDA 3MPVA 3QSYB 3PKYA 1YBUA 1KN6A 4Y34A 2C2DA 4EYHB 3GR1A 2VFSA 4X84A 2C2MB 2F8MA 4LF6F 2MSTA 1F5CA 2HNZB 1H72C 3DMJB 2Z2YB 5IFMA 3MXHP 2B43A 3CJ4A 5CABA 3BO2A 2PEHA 2X1BA 5KT2A 4OHZA 3W63A 2FHOB 3KWMA 1RLDA 4DEZA 1U48A 4FF2A 4QCLA 3SV4A 2IC3A 3OHBA 2UVRA 2YWHA 3D1OA 1IR1A 2DGXA 3QPIA 4N41A 4J9PA 3AA8A 4PCQA 2NSCA 3CWJA 3ZC4A 4R5PB 1VC6A 3KLEA 3QRQA 4JI4F 1W2IA 1NSQA 5GAGI 1YJNS 3POTA 1ZH5A 1JJCB 1RE1B 2UU9J 1L3UA 4DJBA 3GFYA 5LOQA 5A8KB 2ROEA 3DLKB 4HEA9 4OYAA 4ETXA 3QJJA 2HVEA 5KFZA 1WDDA 4OYOA 4NEYA 5I3UB 3SMZA 2LQJA 2QLFB 3I0RA 2IVYA 2IA0A 4DQRA 1TKTB 3C6TB 2L9WA 1J5OA 3ADAC 2ALYB 4X4TA 2RUGA 2IDEA 2KRBA 5F8NA 2F8HA 4ZVHA 3NS5A 4WP3A 4P9SA 2DIVA 1FFWB 2EPIA 1Z2ZA 3IFEA 2YWGA 1NB7A 3M6WA 4J9SA 1N5SA 1Q5VA 2Q6CA 4B9TA 2KTQA 4ZMMA 2OEMA 1S97A 3FDSA 4XDCA 3QT6A 1DQAA 3ENWA 3JQJA 3NGTA 1AFJA 5B0EA 4WFYA 3D2WA 5DDRC 3JXOA 3G71S 4X65J 1SVDA 5L8RC 4BCAA 3KK1A 4KH1B 3OVAA 2RDJA 4XPCA 2AX1A 3GG1A 2DGTA 2D3UA 3MUVP 3R5CA 1IKXB 2KDOA 2CPJA 3OTEA 4ED6A 4I56A 1R6VA 2DT9A 1TP7A 4USTA 2XMTA 3MAAA 4JI5J 4A8SA 4Z7YA 4AXIA 1I6JA 1CQMA 2K3KA 1EHWA 2HVIA 1KWMA 5KT5A 1WG1A 2IYGA 4X4PA 4K4VA 1JKHB 2C1EB 5IQ6A 2QA1A 5ETLA 2BKPA 3M8SA 2QIFA 1KHWA 3NL0A 1UPMB 1QE1A 2V4QA 3ISND 1YKWA 3I9ZA 2DXEA 4OX9F 3VAFA 2GQQA 3IR7B 3SIPB 1JLAA 4B3RJ 3DKDA 3T6BA 1ICEB 1F2GA 1F9FA 6FD1A 3IAM9 3DDKA 5E3RA 2NCKL 3ILJA 2JEFA 4DU7A 4Z2XA 4XK8C 2Z57B 1XC9A 2FVRA 3X3UA 1VDHA 1AA1B 3MMBA 4WPAA 3DHWC 3W7BA 3R3TA 2OFHX 2ZVSA 2J8SA 3BDPA 4CO3A 3D1QA 4DQIA 4HYKA 1NK6A 4JI0F 2HFVA 2JH3A 2E44A 2CPHA 4MJKA 5AXKA 5KOXA 5A0YB 3C14A 2HHXA 4DV7J 4QZVB 1U1KA 3C6UB 3PRBA 4MKAA 3IGVA 4ZPBA 3L09A 3UD5A 3DLLQ 3LF0A 3FSYA 4KHRA 1N36J 2CQDA 3G6YA 3OXGA 2RRNA 4OX7A 4K4YA 4B3OA 2YPZA 4DR6F 3MECA 5B09A 2OMLA 4UT4A 2PMWA 2MHNA 2V2QA 2WB4A 3FFIA 2ASJA 2R7WA 3RZAA 5L46A 2MZTA 2MKIA 2W2QP 3RJMB 4GC6A 4NLPA 1TL4A 2X1GA 1ZM9A 4CO2A 4DV6F 4X2BA 5HLFA 3RB0A 4KPCA 4RLEA 3RRHA 3HXMA 1FE0A 2MKYA 3T1YJ 3H5SA 2WBMA 1W2BR 1RAIB 4NL5A 3OLAA 1U0HA 1BQMB 4QBUA 4LBIA 4FNHA 2YPYA 4DG1B 3OTOJ 2DD8S 4K8RA 4PG8A 4B9LA 1JLBA 5D3GB 4I68A 3U02A 1T9WA 2CPZA 4X4RA 1R0AB 5K8PA 2EVZA 4QW9A 4RX6A 4RNMA 3A3PB 2DRAA 2Y1JA 2XGQA 5HMXA 3MEEA 1FX2A 2HMIA 5CZXA 2N4DA 2IBKA 1U6FA 3OL8A 3R6GB 1WEXA 3WDOA 2R7SA 1B0PA 2G1HA 4DS5A 1RHJB 5BR8F 3DOKA 4USWA 1LXNA 3TJ9A 1OSCA 4WYLA 2VC0A 4CZCA 4QQBA 2PT0A 3K7RA 2XHWA 2CQHA 4PAAA 2IVMA 2MKHA 2FLLA 2GV1A 3D9BA 5KT7A 2WVEA 3NRBA 2R7RA 2J76E 4DUZJ 4QR0A 1UCNA 1N5VA 1NBEB 4WU3A 5E3QA 2F40A 2HNZA 1R8PA 1UEUA 3DMJA 1L3SA 4HH0A 2HG4A 2XMWA 2DNZA 3BKFA 3M8PB 4UOCA 2B4UA 1X4GA 2ZD1B 1X0FA 1HA1A 3ENVA 1O51A 5J1EA 3LANA 4FS2A 1NU4A 1NSAA 3MFIA 4OI3A 2HNYA 5KFKA 4IRDA 2FYXA 4DN9A 2ASYA 3JYTA 3EPGA 3GTYX 2UUAF 4R5PA 2V9KA 4IRCA 3FSIA 2FQQB 1XIQA 1ZBTA 1VGYA 2JFDA 4L3KA 3KXDA 5BXIA 1NHUA 3SXLA 4NRTA 1B0VA 2V8DA 2WSFC 5DLGA 3IWNC 2YWWA 5M2PA 1EP4B 4J5OA 5A8KA 1RHMB 1AW0A 2VDIA 1YGYA 1KFDA 3DLKA 4M5DB 4NCAA 1J2VA 3DGVA 4NLQA 4NI2B 5D0EA 5I3UA 1EQMA 2VFTA 3GIRA 3QT5A 1MN9A 4RL1A 3CJSA 4NLXA 1ZTWA 1TKTA 3C6TA 2AGQA 1CULA 1WORA 2KJWA 5FLXY 4TQRA 4PG7A 3R5JB 1AUSL 4DLGA 1S9EB 3A8IA 4DV2J 3JSMB 3TZXA 4RUHA 1WC3A 2UV8G 4WYWA 1NH8A 2WW4A 3H98A 1HW8A 2V2KA 4K59A 3UFCX 5J2MB 2WTFA 3FGVA 1SQFA 1SPBP 1LV5A 1JJ2R 3MM9B 4XTTA 1IKXA 3DDNA 1T11A 3KUGA 3OTDA 4I67A 5CXTA 1OY6A 4YMEA 4CO0A 3WX8A 1GAOA 2X51A 1ZA1B 2IVFB 2FGCA 3QZ7A 4ZS6A 3PR5B 5EUHA 1JKHA 2DY1A 3C19A 2P9CA 4CP5A 2M8HA 3QNWB 3N01A 2YKMB 1Q7LB 2B8PA 4HHHA 4IH5A 4F26A 2IY5B 2E5GA 4QU6A 1GTEA 3UN3A 4NEZA 2A6OA 7AT1B 3CUNA 1X5PA 4X65F 3UW1A 1VJQA 3MR6A 2PE8A 2FJDB 1VQ6S 1M5SA 1Y10A 2H3EB 3UWTA 5KFSA 4OZ3A 3P96A 4JI5F 4MFBB 4YDDB 4ES3A 2ZH9A 3T5JA 4OZNA 1FI4A 2H9ZA 3TEHB 1BLUA 1OY8A 4O3NA 4IRKA 4N76A 2CYYA 3MURP 5DG9A 5F3ZA 3QIDA 5IV3A 1IN0A 1AB8A 4QJVA 1G7CB 2J0WA 3K57A 4ERDA 1I94J 3MEDA 2WRMA 3Q8UA 5D0GA 3C6UA 4NLRA 2HFUA 4OI0A 4BDPA 2J6UA 4B3RF 9RUBA 4LRBA 2I9SA 2PA8D 4G3IA 2QL9B 4PYDA 3VQTA 3TWZA 4FYXB 1T3NA 2EKYA 3IM9A 1VQOS 2E7XA 2RT3A 4ECUA 3MD3A 4C8OA 4RW8A 1WEZA 4YB5A 2BVZA 2BJ1A 2RUSA 4QYZK 1WOSA 4MYTA 4Q5VA 2JC1A 4WJBA 4X64J 3R7BB 4N5SA 2XMVA 1RKJA 1AUDA 1YK9A 3MM8B 1WELA 2VA3A 2PMZD 3AY0A 2H5JB 3GR0A 3BQ1A 2J7WA 2R7OA 1D9DA 4KHPJ 2UVWA 1OMSA 3KKFA 3HJVA 1CQNA 1TU0B 2FY1A 1KRPA 4DV7F 2EXUA 4L6V3 1KEKA 2J5AA 1LXJA 3PJWA 3WHIA 1RADB 3D54A 1N36F 2YKNB 2R7XA 5K8NA 1R0AA 4F8RA 5AE3A 3SSSA 1BQNB 2MLYA 4HTIA 2OI2A 3TUPA 2GO9A 3LWLA 4QW8A 3FBEA 2EG1A 3H2VE 1FE4A 1F2HA 3TA1A 3GCXP 4F4WA 1REGX 3AJ2A 3G2XA 2MZ1A 4AL6A 2BJ3A 1VRTB 2E5LJ 1BQXA 4CLUA 1DBDA 1OSDA 2DEIA 1SH3A 3OVBA 2KXNB 1AFIA 1TFWA 2P6TA 3CJKB 2IA6A 2CNKB 3T1YF 4XAKA 2VPWB 2R8HA 2QO3A 4NZ6A 2CJQA 2B4OA 5KFTA 3M7VA 3A8KA 4F0MA 1O0PA 2E9TA 3OTOF 1KDNA 2YNGB 3Q8QB 2M8DB 3A8EA 1WHVA 2OKQA 3M8PA 3T1AA 1KOHA 3G96A 1V3ZA 3V4MA 1H0HB 4C2MA 3BS9A 5AXMA 1BHNA 3BDEA 1F9HA 5GMDA 2ZD1A 4NZ7A 2H1YA 1FESA 4M94A 1VQ5S 4Y6IA 2W2MP 3ZTQA 3THTA 4RUAA 1IUJA 3MFHA 3BN4A 4MKYA 4LFBJ 2OD6A 1UW9A 3VZHA 4HLBA 2IDLA 2ZDPA 1TAUA 1UP1A 2JZ5A 1U24A 3TP2A 2XQCA 1IM4A 3M8QB 3T9NA 4UUXA 2HK2A 4USKA 1EP4A 1MWZA 4ZVOB 1JLFB 4DUZF 3KNGA 4XDDA 3DLGB 1F3FA 4N77A 2BQUA 3SQGB 2W9BB 1HBOB 3KUHA 4ETZA 1KTVA 3GP9A 2D74B 3IRXB 3PXGa 5EDWA 4N8NA 2PDAA 2VIHA 1FJ7A 4DSIA 3W9JA 1Q81T 3CCVS 4C8YA 4GMKA 1L5UA 3H59A 2RQCA 1S9EA 2I2YA 3JSMA 1NM2A 3WX4A 1Q0NA 1SIZA 5IWAJ 1ACMB 4ES2A 4KB7A 2W25A 2HNDB 1VHFA 4ED5A 2MLXA 4I2PA 4ENOA 5C24A 1Q8BA 2N3LA 1X8DA 4F4XA 2E1CA 2Y9HA 4PRFA 4KR0B 1OIAA 2HVDA 3QO9A 4I4BA 4ILRA 5J2MA 2MB0B 2FZKB 1WC0A 3V6DB 3MM9A 1U25A 4C3KA 2VG7B 4Y65A 4PG5A 1SCJB 4G1PA 2DGWA 4LF7J 3OBIA 5H9FK 2OTLS 4USIA 4Y0FA 2HBYB 3UR0A 4DDFA 3GV8B 4WIIA 5C2GA 1P1LA 3AT1B 4JI1J 1M5PC 2QSFA 3O5TB 2IHR1 2FJBB 4LFAJ 2O3DA 3D68A 4DV2F 3PW5A 3BQ2A 1FJEB 2W9CB 2CJBA 1WHYA 2DH7A 2YKMA 4LSNB 1BC6A 1VIXA 4IKAA 2ACYA 5I4MA 3CJ5A 3D6TB 3B82A 4KE5A 2WVBA 3MR7A 4JUZA 3CULA 1UKUA 4A46A 1IKVB 3DLBA 5HVHA 1DRZA 1FNMA 3VF0B 2ZEJA 2HLUA 4ZKAA 1UFLA 1UA0A 2YQ3A 1IWAA 3PIOQ 4CLKA 1WJ9A 3HF5A 1RKIA 3BH7B 3VQSA 4QIWD 1HMVB 3TVZA 4CLYA 3DRSA 1RTHB 4I2QA 4Q45A 4DR2J 2FVPA 1S7HA 4FPRA 1D1UA 1N32J 4MFBA 4EUVA 3TW0A 3W9IA 2B4VA 1RHKB 2CKWA 4M8LA 2KH9A 3FRYA 3R5GA 3OPKA 4DI6A 1NEEA 2JNJA 4RUCA 2DNKA 3CB4A 3V81B 2EFPA 5L1IA 1Y7PA 1NPPA 3A4TA 2JJ4D 1KHVA 3BGFA 5KG4A 1BD6A 4WTOB 1S7IA 3K8VA 4ELTA 3IR5B 1K0VA 4AXJA 4P2SA 4JYAJ 2JLEA 3S6EA 3K17A 1Q86T 1S99A 2E7VA 4CH7A 4R0EA 4Q8EA 3MM8A 2CNOB 3AD7C 1RWOB 2B9WA 4B3MJ 4HT7A 2ZHBA 2VH7A 3W2WA 2XMKA 4J9UE 2XS7A 4ZLJA 1B70B 4HR2A 2AYEA 1I94F 3Q86A 1I1GA 5DS7A 4N47A 3SDEB 3C16B 3LGHA 1HQUB 4OFZA 2U2FA 3LPYA 5KFPA 1HIYA 2YKNA 2GVZB 1U1LA 3PYDA 1ZYQA 1T05B 1D8YA 2DTJA 5D78A 4QPTA 2CJAA 2QYGA 2AEMA 1CJTB 1LFPA 3KJVB 2W4CA 5B0AA 3J7ZT 3HFKA 2PD1A 3PG9A 5DG7A 1RA6A 1RT6A 3NXZA 2HGMA 5AE1A 3Q8YA 4LQ9A 1SKWA 2XO7A 1SL1A 2N3OA 4NASA 3J81j 3BB5A 3K58A 3P3DA 3GV7B 5EWFA 2JEJA 2W8LA 4CCHA 4CLFA 1N0VC 1RT2B 1S1TA 2E66A 1QTMA 4YR0A 3PJ9A 2YQ0A 3OFHA 1RAJA 4KHPF 3UCZP 1TKZB 1BWVA 3SSRA 4ILMA 3JTNA 2Y1LB 2YNGA 1CVJA 2R2RA 3UN2A 2B9XA 4ED4A 2V5HG 2HURA 3EUNA 5CQGA 1S49A 1JX4A 4ZP6A 2X3DA 4IDKB 2QX0A 2YWKA 3DU6A 2J0XA 3N6MA 2ZUAA 2AQ4A 5T14A 2VQEF 3RAQA 4DSLA 1OQ6A 3PX6A 4L74A 3ILIA 4OHXA 1DFDA 4ZP9A 3MZIA 4MK8A 1Y5IB 5C2CA 2LQBA 1R8HA 4TU7A 2BR0A 2VV5A 2E5LF 5DDOC 2GA7A 2YY3A 4USJC 2OPRB 1T9XA 2MQPA 3M2UA 4KV8B 3M8QA 4BC7A 3DRPB 5HAOA 5L9NA 2B51A 3H5YA 3HHKA 2RU3A 1JLFA 4KBIA 3UDVA 2EI5A 3DLGA 3RBXA 4ANDA 1U49A 2WCXA 1VK3A 1VQMS 4PR6A 4C9DA 1JLEB 3DI6B 3SQGA 2W9BA 4WFNQ 2RRAA 1RHRB 2D1CA 1FHTA 2J6TA 1IBCB 3G6ES 1YJTA 1TVRB 2EFVA 1TMJA 3CGIA 3PV8A 4OZ1A 4F3OA 2P2CB 1GTHA 2DNQA 2PI4A 2APOA 1R6YA 1RISA 4WFAQ 4PWDA 2ZC3A 3BKUA 1X4AA 4LFBF 4YFUA 1S1UA 3BGRB 4KJIA 4X4QA 4WCEQ 3KLGB 1Q95G 3PTWA 3BH6B 4Y3CA 4K0KJ 2EC2A 2C2RA 3N6NA 1RT1B 4OX8A 3K89A 2IM3A 1Z4UA 1NSKL 1VRUB 1T9VA 4S0MA 4RO0A 3V6DA 1FRIA 1HHTP 2F7VA 5KFJA 3LO3A 3LTOA 3GE9A 3AB2B 3ELHA 1JNZB 2VKZG 4ZP8A 1YITS 4UZBA 1IBLJ 1YDLA 2AJFE 5DETA 2FJEB 3HM9A 3OT9A 1P8GA 1CJVB 4OX6A 5IWAF 3O6QA 1HNXJ 1DQ9A 1WI6A 2KG1A 4LSNA 4W98A 1RTJB 4DL7A 5KG6A 2RQMA 1FKOB 4A47A 2HFZA 1M1KT 2DR6A 2AP6A 4ECQA 4CQ1A 2MZRA 4KFBA 4DV0J 1FEEA 4DL6A 2ZBQA 3PKMA 1IKVA 1X5SA 2ZH7A 2QMWA 4EFAC 2DIUA 2WONB 2LECA 1S57A 1MWYA 1SKSA 4J91A 4EO8A 2DNNA 2QV6A 1HMVA 3TUZC 3M8YA 4P6QA 1RTHA 1GEHA 2HRUA 1FNOA 5H9EK 3NCQA 2UP1A 4JI7J 4LF7F 2RMLA 3NKYA 3VWSA 1V5IB 3EVMA 5HROB 5DGAA 4DV5J 1UL3A 3L95X 1HNIB 4NLVA 3GFZA 4CLLA 3NWRA 4L72B 1H7XA 7FD1A 1KKHA 2W2PP 4JI1F 2WB1D 1M5HA 4LFAF 2LQ5A 3E01A 3SBMA 3OQ2A 3UN5A 1DAXA 4F0KA 4J7CA 3G9CA 4URQU 2I6WA 2BDPA 3CJ2A 1RT7B 1B3TA 3V81A 5HQMA 4ZVSB 1IKWB 3TOQA 2K8GA 5A2QY 4OI6A 4DN0A 4A8XA 4MH8A 1RAEB 2JEGA 3CIZA 2A18A 4YB6A 3ZZPA 2HVHA 4FDFA 1DLOB 3TAMB 5U47A 1C4CA 3HLUA 1IR2A 2V69A 4OYMA 2XSJB 1N5YB 3J81Y 1FERA 5DGBA 1N32F 2NYHA 3FJ2A 5ITHA 3B54A 1TK8A 4J9QA 4DX5A 3D3CJ 3MMAB 3OFFA 1FWKA 3CJTA 3MWBA 3HT0A 4J9VA 2RF2B 1WTFA 1FRKA 3HSGA 2DCUB 4ZPTR 4IOBA 1K47A 5ADZA 3HO1A 1VQKS 1VJWA 1S6PB 1LWEB 2H4WB 3C16A 1QDUB 1EZZB 3ZTRA 2B6AB 4ZITA 5H9FJ 4BHQA 2FHJD 3K0JA 4JOUA 4LVOP 3CTRA 1KLMB 2UXDJ 2LDIA 3NG8A 3FVYA 5EX3A 2AGOA 1Y11A 3HSJA 2A6MA 4UQGA 1HWJA 2QGFB 4AD6A 3C2PA 3KJVA 1OPZA 3EYZA 1A9NB 2ZBIA 1XMQJ 2KG0A 4F4ZA 3PZPA 1TL1A 5ETOA 1DARA 3QIPB 1SH0A 3PY8A 3KLHB 4EBCA 1VBYA 3CJ0A 2BX6A 1RTDB 2HGNA 4B3MF 4C8KA 1C1CA 1HKAA 4WF9Q 2GAGC 3M05A 4KSEB 3M8ZA 1PJ5A 4RBTA 2RD5C 4DBQA 1VQSA 1TKZA 2IFXA 5KFLA 2IRUA 3VGSA 3MPWA 1MSWD 2CDQA 1SC6A 1Q82T 1FRLA 3RW7A 3T1HJ 2RDIA 2HS3A 3OUYB 2VG5B 1SJFA 5LL6d 5G4DA 4I7FB 5CYJA 4LIRA 4WFXA 5DM7Q 2FVCA 2ZH5A 1C2PA 1M5VC 2AWZA 4C4WA 4OYXA 3Q8SB 1LW0B 1S6UA 1H98A 2VBXA 4OZJA 2V2ZA 3A3NB 1QUVA 3D4JA 3UPFA 4ZK7M 2EW9A 1DJ0A 2MY8A 2OPRA 1NK8A 2HYIB 4KV8A 4DR4J 4DX6A 1HWLA 2VFRA 5D4PA 4DXLA 3DRPA 4IH7A 3CF5Q 4EEYA 5DO2A 1IXKA 2F3JA 6AT1B 3HX9A 4C11B 3RB6A 1FA0A 4DOZA 3T3FA 1WHXA 2QA4S 3DI6A 2E9ZA 4IFYB 3CC7S 3MOZA 2CVEA 1CLFA 4O3PA 2BMBA 3BZQA 1TVRA 2BE2B 2CQBA 3EICA 5LT5A 3DRRB 4ZLLA 4NLOA 3B4DA 5JVGQ 1F0XA 2IJFA 3SCLE 2ZH4A 4ZPDA 2MSSA 3OFGA 2DRBA 4K7QA 4ER8A 1C1BB 1ZAVA 4Q44A 1SH2A 4ZCMA 3BGRA 4ZCIA 4FBTA 4CT9A 1RU1A 3KLGA 1WUUA 2OHDA 2VA2A 1X4HA 2ROGA 3RYLA 5HI7A 5KG2A 2MKSA 5AJ3J 3TI0A 1FRXA 1V5VA 5IT9U 1RT1A 1U2FA 3GZ7A 2OIHA 1NAQA 2B4PA 1GT8A 3LALA 2XMJA 5HJYA 3H0PA 3LQVA 3PHTA 1JLCB 2VJVA 5ETKA 1D9AA 3FUYA 3CEDA 3GLJA 2HAIA 2BW2A 3DYAA 3RG6A 3A8JA 2V4RA 5KTQA 4HHUA 4M63A 1JB0C 1ZZFA 2ATLA 3I4PA 2FHJA 2R2TA 3QFWA 4USVA 2VDHA 2XLIA 1CJVA 3MPYA 1P6TA 3N28A 1SQEA 4OZ5A 3PX4A 3HD1A 1U2CA 3I87A 2LDYA 3CW2C 1JXLA 2F9DA 4KGVB 3IWXA 3BSOA 1RTJA 2BM1A 5KOWA 1R8AA 4UY8T 4DL4A 1QSYA 3CCUS 4K0KF 4WXWA 5ETVA 4ZIWA 3OV7A 5FDLA 3MR5A 5KFIA 1HFEL 1JJHA 2M2BA 4YDXA 2WONA 5F8IA 1QSSA 3UVJB 1FCAA 2C2OB 2FLPA 2J9EA 4NMLA 4Y2KA 1S48A 1RCOB 2OJ3A 4ECTA 3CD7A 1XNQJ 4IO1A 1SKUB 3T9ZA 1RQ0A 4K4TA 5HROA 1U4BA 3KLIB 4WK3A 5JJBA 5IT9Y 4ECVA 1VS3A 2QFIA 3KMQA 3HHLC 4WKRA 4IG3B 1U6BA 1HNXF 2XZWA 3BJYA 2J0SD 3OTCA 2C2NA 4NLWA 9ATCB 1RT7A 5B0GA 1IQTA 3BPSP 2H54B 1RGVA 4F02A 3HVAA 4JB8B 4DV0F 1IKWA 4PXCA 1PILA 2KKHA 2YWEA 2ACMA 4DFJA 3CMQA 3QJPA 4ZN3A 5HMWA 4TY8B 2DNPA 4YHHJ 3R1HA 3AA9A 4ZPAA 2D7SA 4FZVA 5CZVA 2VC1A 4LF8J 1DLOA 3TAMA 1T0TV 1R0BG 3EVOA 4QIEA 2VPZB 4JI7F 2EBEA 2XSJA 1Y3KA 3KOAA 1YVFA 1S9GB 2VASA 1RK8A 4LQ3A 2LA4A 2MQOA 1HYSA 2N82B 1MMNA 3MMAA 4DFKA 1R8CA 3EPIA 4XPEA 2RF2A 2Q66A 3HI9A 3DLJA 3DGPB 2Y8YA 3ZTOA 2UXCJ 1Y00A 1UETA 1NK9A 2XI2A 4KIAA 2P5VA 3ULHA 1LWEA 3KMSA 3WQPA 4QYRA 2MQQA 4KKOB 1KQFB 2QEXS 1KLMA 4ECYA 3NAHA 3K5LA 2HHWA 2XSFA 2IJNA 1R89A 3TX0A 3HJFA 3CE8A 3Q8PB 2LXUA 5E3AA 3SFGA 4C7QA 4NLUA 3QIPA 4NLGA 2ZWOA 3PACA 2CQ0A 1RWPB 2KT5A 2LLZA 4DV4J 2H5IB 4QWCA 4M5JA 4BC9A 1FX4A 4MKBA 1XN9A 1FKPA 5GAGU 4DPWA 3IS9A 1QTNB 3W5ZA 4ZPCA 3J7A1 3MAQA 4A8FA 3H2LA 1GH8A 2DO0A 4OL8A 1NDLA 2FPHX 4YN3B 1FVSA 3B4MA 5E3CA 2QLXA 1P9QC 2UXDF 2VG5A 2YX4A 4PQUB 3IRWP 2ZM6F 4H4KA 3H4DA 1UFWA 2J9DE 5KFHA 1LFWA 4K4WA 4JI0J 3R7NB 4PXBA 1LW0A 1DQ8A 1XMQF 3NOCA 3VVTA 3FBFA 3MI7X 1C0UB 2NYIA 2W7OA 2QA4G 3QAEA 2XHCA 3H4BA 1N6QA 1RSCA 2X1AA 3TA2A 2JEIA 5BYSA 4O4GB 3EGWB 5JUMA 4ZP7A 2XLJA 2IIHA 2XS5A 2UUCJ 1AZSA 3MCNA 5LXYA 2QRRA 3A3OB 4IFYA 2OEJA 4IR9A 3LP2A 1OO0B 2B7CB 2MJNA 3OL6A 2HBQB 2R8KA 5ETRA 2OPSA 1NJWA 1OPIA 2BE2A 3AXMA 1O8BA 3DRRA 2HQGA 2C22A 3N0VA 4L3NA 2GC8A 4JI6J 4LF4F 1R0CB 2E7WA 1WDTA 3M2RB 3W60A 3I31A 1S0MA 1X4EA 2J6SA 4KQZA 5KFRA 3R5DA 1T03B 2R8JA 3PYGA 1RAFB 3SEOA 2VICA 3MM5B 4DV1J 4DR4F 1K9MT 4YOEA 3GJRB 2DXDA 4L76A 1G4CA 3VTIA 3K5NA 3F56A 3GIIA 4DQPA 3TUJC 3PCOB 1OS5A 1WC6A 2G4BA 1UJ4A 5M2UA 2V8GA 2VODA 1IR0A 4YB1P 4IFVB 4JV5J 3W65A 1B64A 3Q0AA 3D5MA 4NCBA 2VL1A 2YNHA 3K5PA 3E8OA 1HI0P 3SCKE 1WKJA 2KHDA 3FEYB 4PABA 3OHAA 3AAWB 2JC0A 1S79A 4CM2A 1WSVA 5HANA 2HFNA 1P1TA 4RBUA 5BYRA 1YBTA 1RHQB 3H90A 3OXLA 2HWIA 5AJ3F 5AT1B 2CZ9A 2PO4A 3U1MA 1HHQA 2J8AA 1RU2A 3LP0B 2FVSA 3CSKA 1TELA 3SQOP 3VAIA 2QTWA 3HT3A 4ITSA 5F3TA 5C7PA 3UVJA 1U1NA 2ABYA 2XNRA 3OD2A 3HKZD 2XM3A 1S72S 4NX9A 1NZAA 1FXRA 3MPDA 2VF3A 3ISNC 1UFKA 3EXYA 3HVTB 1YJ7A 4MAKA 1CC7A 3KLIA 2B5JB 2IMOA 3Q23A 2BE9B 1SJ4P 1RAAB 2XI3A 2G0CA 3CCJS 4DL5A 4QIFA 5KFDA 2FJWA 4IG3A 1FNXH 2VUGA 2AMCB 2XG8A 1MG7A 1U1MA 4M5HA 4RUBA 3QRPA 4QWBA 1BXNA 2CQ3A 4OI1A 4DL2A 2R7VA 4F2RA 1B7YB 3G86A 3D6MB 3QWUA 3MM7B 1RT4B 5A8RB 2GFFA 1RWWB 1QAXA 4YR2A 2HFOA 4P2FA 2B9EA 3D67A 2DNGA 2BOPA 1UVIA 4TY9A 3RBDA 2GIQA 4K2JA 1S4FA 3ENAA 1VQLS 3MM6B 4TY8A 5F8JA 5GAHU 3I55S 1XNQF 2MGZB 3RAXA 4ZN1A 6FDRA 3MMCB 4RW4B 1GX5A 2HWHA 5KFEA 4LF5J 3O2IA 2HEKA 3ZZZA 3HHDA 1QSLA 5FD1A 2OFGX 2BW7A 3DFEA 2OMOA 1U1OA 2F5GA 1X4CA 4DV3J 3HVWA 2HGLA 1VQNS 5L1KA 1FD2A 1IBMJ 2QYCA 3I4HX 5E2QA 3SYZA 2YX1A 4EZ9A 1JLQB 4H4OB 1HI1A 2K06A 1UTAA 2QT7A 1DURA 4LJMA 4K4ZA 3SFUA 4YUDA 4KKOA 3TQ1A 3DOMB 2DHAA 1FJCA 5EWEA 5C25B 2AYBA 2HAFA 1TL7B 4N56A 1PC5A 1VK8A 5HMZA 2JDJA 2W2OP 3LAMA 2C3UA 4YHHF 2IRXA 3CDUA 1SL2A 2AYGA 1ZOTA 2BJ8A 4LF8F 1V9OA 2QLBB 2J9DA 2W2NP 2JFKA 2LP4A 1WF2A 4Y2AA 4EWTA 4BLGA 1DHMA 3JQMA 1URNA 3R9LA 4WP9A 4OJHA 5I42A 2M7SA 4DR5J 2YXLA 2CQPA 3NMAA 5SZTA 3Q83A 4DFMA 1YG0A 1I5OB 4IO9Q 3CNQP 3WIUA 2UXCF 2JOQA 4AFFA 4OI2A 1HI8A 1FD8A 1IJEB 4V1Ak 3LGMA 4J9KA 2GZOA 2L3MA 2FJAB 1XMOJ 2KZMA 4IR1A 2Z8QA 1RI7A 3OXFA 2QA2A 2F1FA 5E7OB 4EYIB 4CO1A 4PQUA 3M1VB 3GIJA 1UJ5A 1X0PA 1YJUA 3CD0A 4J9OA 4DX7A 3CPWR 1HQ2A 1E6YA 3DN9A 2I5JB 2YNIA 1C0UA 2QMXA 4DPOA 3FCVA 1NK0A 3OL7A 1N5QA 1S1XA 5JXSA 2CXEA 3NOGA 1TUWA 4DV4F 1SJQA 4PWWA 3R97A 1TV6B 2VG6A 4FYWB 3UCUP 3IM8A 4CRJA 1Z2LA 4NA2A 2PIIA 1X4FA 1W26A 4F04B 2V68A 3DXSX 4ZDNA 2KN4A 2EEYA 5HMYA 2AJ1A 1XR6A 1T9TA 5D15A 2RS2A 1GFWB 2WHOA 1KONA 2C3PA 2BJ7A 1U8WA 4I0WA 3RRGA 1NXIA 3W2VB 3S1TA 2ZH3A 2RDDA 3M2RA 1U26A 5F9NA 1T03A 2AX0A 4ZVTB 3AOAA 1N34J 5DDQC 1NK7A 4DZDA 3MEKA 1FEHA 3KDNA 1WTBA 2XB2D 3S7RA 3MM5A 4O0NA 1SL0A 2AGPA 2Q43A 4K4UA 2W7AA 3HP6A 2WSCC 2UUCF 1RCXB 2CPYA 4O3OA 3KHGA 2B7BB 5D4OA 1EQ0A 2RKIB 3RU0A 5KFGA 1FJGJ 2KM8B 4EO6A 4IFVA 4Y28C 5LM7E 2R3VA 3GV5B 2W01A 4K5SA 2BANA 3MEGB 1X5TA 1U1PA 1HNVB 1AYEA 1LNQA 4FXWA 3H7HB 4JI6F 4RNFA 3QGIA 5DDPC 4DSJA 2GAHC 1KSPA 2ZFHA 2FJVA 2VQFJ 2DK2A 2GHWA 4PPZA 2J9CA 4DV1F 1U1RA 3O44A 2XWXA 4LF1A 1YWXA 5A76A 1BE4A 4U67Q 2C2ZB 1F1BB 2LCWA 4ZVRB 4CDIA 1EAYC 5J2PB 5GAHI 3KK2B 3FC9A 3LP0A 3BR8A 4ID5B 2LKZA 4NRUA 4ID8A 4CH1A 4KAIA 4O0IA 4NZ0A 1TKXB 1WC5A 4WU2A 2BA9A 4B3SJ 2R2UA 4OHVA 4JV5F 4DQSA 2RQ4A 2HHVA 3HVTA 4YS2A 3KG0A 2B5JA 1R43A 3P49B 1SC4B 2ZWPA 1XK8A 1NNDA 4LSLB 4B9VA 2AZ1A 2KJVA 4A8OA 3TAPA 2DGQA 4I6AA 1S1VA 1T95A 2MDAA 2OH2A 4RNHA 3M4XA 1U45A 1X4DA 2JX2A 4YB7A 3NGRA 1V3RA 1LWCB 3AB4B 2LXFA 1VLOA 1RT4A 5KFAA 4TKTA 3U7JA 3V4IB 3R7SB 3UQSA 5KFNA 2R8GA 4PG4A 5B0FA 3G8QA 2M52A 3PM9A 3MM6A 4O23A 4USMA 3RBEA 4GO5X 1VQ7S 2G0IA 2POKA 4I69A 3GYXB 2MGZA 1GNKA 5KFUA 3MMCA 4R0JA 2LA6A 3DDIA 3VV2B 1K1QA 1T8EA 1Y0HA 4C3LA 2BM0A 3UNYA 3KJNB 2A10A 1WD6A 3DRYA 2MZSA 5KG5A 3ISZA 2DR9A 3MAHA 4JBCA 3X1LB 2E1PA 4M5NA 2PEBA 4TN2A 5KT3A 1IM6A 1ZAWA 1HBUB 1JLQA 3ZTSA 4H4OA 4YP3A 3ITHB 3MHYA 3QATA 2Q6BA 2Q79A 3DOMA 1TUGB 5IS2A 2GGPB 3QMQA 1TL7A 2RB7A 4E0DA 3QGPA 1N8RT 3MGJA 1EB0A 2XY6A 1ZPVA 4X4OA 4ZJOA 2UZAA 5LSOA 1YJVA 2HLTA 3ZTPA 2CG4A 1HWKA 1S9FA 3FMWA 3GSIA 3W66A 3C15B 4LRCA 3NY0A 1WKLA 4LF5F 1VCTA 3HHLB 1IKYB 2HRTA 4ZJQA 4TXSA 1VQ4S 2GJFA 4CLSA 4DV3F 2DR5A 2R7TA 2JSXA 1IBMF 3VAJA 3QT7A 3POTB 2R42A 2XYGB 3GB0A 1HWUA 2XY7A 2FD2A 2IM1A 3M1VA 2COLA 1ELOA 2RJZA 3CJRA 3TX8A 4X4SA 2L9NA 3VHQA 4KTQA 4EGLA 2MKCA 2I5JA 2MQLA 3I0RB 1Y9OA 4WP8A 4CYUB 4V19J 4DSEA 3LGNA 4U6PA 1VC0A 4USUA 3TZYA 3BEGB 4DR5F 2GS8A 1VQ8S 3FMBA 3FQKA 2QFJA 3MF5A 4MT1A 2AKWB 4RU2A 3IAS9 4JV0A 1JXVA 4DX8H 3MR2A 4Q8FA 4P52A 1K73T 4K4SA 3CDBA 2NQPA 3HHEA 4O44B 4C6AA 2LEPA 1XMOF 3BO4A 5DZ7A 2ILZA 3AFGA 2BKNA 3AD8C 4RBVA 4QPXA 3ZFVA 3R27A 3PW7A 2IJRA 5GMEA 3WC0A 1RBOB 2O01C 1K0TA 3PJXA 3CCWA 4AL5A 1MU2B 2RSQA 3VGVA 1LWFB 3PYEA 4ED3A 1VBKA 2D3O1 4FXVA 3BGLA 1LQ9A 2ROPA 2M5YA 2FC8A 1N33J 5A0YA 3O3LA 3ZXWA 4KY3A 2QL7B 4NYPA 2OLWA 2HQ3A 2YTCA 1ZAXA 4JI2J 3CD6S 3MCSA 4PWUA 2VOOA 2MYFA 3FQLA 2EFOA 1EARA 3E3XA 1RZMA 2CUYA 1NSPA 1HHSA 4CO4A 5KFXA 2RKIA 2VFUA 4ZVPB 3BYPA 3GSDA 1FWLA 1WACA 1Q78A 3BF4A 2FB0A 3VGTA 4FKYA 4ATNA 1SC3B 2G2YA 4DU8A 2C3YA 3MEGA 4CIOA 1HNVA 3UD4P 2D41A 1CPZA 3HHNB 2M3DA 4MIWA 1RHUB 3AJDA 1WOPA 1T7PA 2E1AA 4NA1A 4TVAB 1YZ7A 3S01A 4D3HA 2DBBA 3MMBB 2V9WA 1M5KC 1N34F 1BQMA 5L9XA 3GQCA 4DG1A 1XEZA 1PBAA 1C4AA 5RUBA 1GXTA 2NPFA 2CPIA 2J7UA 1WI8A 5D3GA 1RTIB 4YY3J 3GJSB 4DL3A 3JAMU 5J2PA 1RBLA 3C14B 1FT8A 4ID5A 1WEYA 4DR1J 2RU9A 3NS7B 3EZUA 4RPFA 4GVLA 2BACA 1TKXA 4AUKA 2VQEJ 2DRDA 3QFHA 2XMMA 3T5LA 1FJGF 3JQKA 2M4MA 4B3OB 2MZJA 1PSDA 2ZNYA 4NLSA 2BJDA 5J2QB 3CO9A 2Z56B 3IWLA 2GO8A 3W5YA 3FK4A 4C48A 4KGZB 3L3CA 5IQQA 1VC5A 5I3QA 4KYZA 1VMBA 3JSBA 2VQFF 3FZ2A 4DPXA 1QUPA 2A2CA 1AT1B 1QY7A 3TVYA 5SUHA 1M90T 3W9HA 4J9RA 4X66J 4OJ3A 2L48A 3T19A 3BR9A 2NZCA 1Z1ZA 5HP1B 5LSLA 2CQ2A 1KC8T 1S6QB 1IWGA 3KJFB 3PDNA 4Y2MA 2ZBPA 1UVMA 2P6SA 4JI3F 2AYMA 1D3WA 4B3SF 1FFSB 2KRRA 1FXDA 2BBEA 1M1HA 2Z2LA 1EX8A 2MQMA 4DWIA 3T6JA 4F3QA 2N4CA 2ZH2A 3MEEB 1XR7A 3ETMA 1SBRA 1KQSR 1FRMA 4CT8A 1ZS6A 4M5DA 4ECRA 3Q2SC 2CQ1A 4DSFA 4C3MA 1HBUA 1WF1A 1QAJA 4NI2A 4LVNP 4LRFA 1Q8IA 1IVZA 1XQIA 3I5BA 1KFSA 2GGPA 2F9JA 5B0DA 2ZZTA 2P9EA 3CT9A 3N6LA 4F2SA 3F0NA 1PO6A 2GQ2A 3Q2TC 1QD1A 2MJUA 5K14B 4HTJA 4W92B 2HZAA 1YBAA 2QG9B 3LOUA 2XY5A 3UD3P 4M5GA 2PGCA 2DNYA 5KFVA 1YI2S 2MMYA 3C15A 5J1EB 4X62J 4PUOB 2HNYB 3HHLA 4UOGA 1IKYA 4U7CA 4NXMJ 1VIOA 4DFPA 3JYTB 1WSRA 2SXLA 1PIEA 2DYAA 5CHCB 4ALZA 1YIJS 3C8YA 2HBZB 2KI2A 2O66A 3TJAA 1Y5NB 2CJYB 4LBHA 3CMES 3ZZTA 1AXQA 2QN6B 3S8SA 4LR7A 5IV4A 3RAMA 3BGUA 3K5OA 2DNOA 2HHQA 3R5BA 1FVQA 3R8YA 4F67A 2UVVA 1G3OA 3F44A 5K8OA 1NRKA 2CZVC 1TK5A 2UUWA 3HFVA 1GMUA 2AJQA 3QGHA 2XZTB 3K8WA 5KG1A 1HWIA 4Y2IA 3NMRA 3AODA 4CYUA 4ZIVA 5THWA 3EWGA 4F4AA 1UVLA 4DPTA 1RWMB 4E2FB 1CULB 2CDRB 5KFMA 1U1QA 2EWHA 1HARA 2KVQE 1UWBB 4P7TA 5LJ3Y 1NHKL 2ALZA 4TQSA 3DC2A 4F0HA 4ECSA 2VBWA 2NUUG 2DNMA 3EGVA 4LIWA 3QBCA 2XMUA 3P6YC 3BREA 1TFYA 3LA0A 5D0RA 3OSPA 3KHRA 3NCPA 2CQIA 4O44A 4RNNA 4HKQA 1N54B 1RJJA 1SUQB 3O8WA 2E29A 4J37A 3OTBA 4C98A 4B9SA 3M6XA 1MU2A 5ETSA 4LT6A 1LWFA 3NCRA 1JMTA 3DOLB 1YRTA 3I56S 5D4NA 2AEJA 4WZQA 1LK7A 1U7LA 1V3SA 4ZVFA 2CQCA 3CD5A 2DNLA 2AW0A 2DNHA 5DQIA 4FKXA 3US5A 3RUBL 2GMJA 2HBRB 5LXRA 4OLPA 3LP1B 2E9RX 1ZM3A 4ZHRB 2HZCA 3PEHA 4KGKA 3HMJG 2C3MA 1S59A 4IOCQ 3TNVA 4OV6A 2BV3A
chains in the Genus database with same CATH topology
2H9ZA 4X4UA 4BC9A 3KLVA 1BLUA 2FHMA 4MKBA 4O3NA 1XN9A 1FKPA 4NA3A 2CYYA 3MURP 4IRKA 4N76A 5GAGU 1FDNA 5DG9A 3IS9A 5F3ZA 2Y1RI 3MOJB 1R3NA 3QIDA 1IN0A 1C0TA 4ZPCA 3J7A1 3MAQA 4A8FA 3G4SS 5IM0A 4C0BA 1GQEA 1FXLA 3H2LA 4QJVA 2G1DA 2XCPA 1GH8A 2WK4A 1MNEA 1G7CB 2DO0A 2J0WA 3TARA 3K57A 4JYAF 4OL8A 4ERDA 1UMJA 5F0UA 2KB2A 2FPHX 3BQ0A 3BSCA 5KT6A 3BO3A 4OV1A 4PXEA 4O4GA 3MEDA 2AF6A 1FVSA 2DH8A 2WRMA 2ZZNA 4PG6A 3B4MA 2C28A 5E3CA 2QLXA 3PX0A 1P9QC 4QR1A 3T5HA 1TR0A 3C6UA 4NLRA 2UXDF 2VG5A 2YX4A 4PQUB 2HIQA 4OI0A 4BDPA 5DQGA 3LH2S 2J6UA 4B3RF 5JVHQ 3IRWP 2IYIA 2ZM6F 4H4KA 3H4DA 1UFWA 1QVGR 4QWEA 2J9DE 5KFHA 3OL9A 1GXLA 1LFWA 3CCTA 4K4WA 2I9SA 4PXBA 1LW0A 1DQ8A 1UVNA 1N33F 5EN1A 4B9NA 2PA8D 1XBWA 1XMQF 4G3IA 3VQTA 3C46A 1S76D 1T3NA 1FKPB 3MI7X 1C0UB 2EKYA 4KT0C 4C8ZA 1VQOS 2GW8A 4JI2F 4A8WA 2NYIA 3IS9B 2E7XA 2RT3A 2W7OA 2HPUA 4PPDA 3MD3A 4ECUA 4RW8A 1WEZA 1YTYA 4C8OA 4YB5A 1KLNA 2QA4G 3QAEA 4FVMA 3VAMA 2BVZA 3EGZA 1SI9A 1RTIA 1E6VB 3PVXA 3H4BA 2XNQA 1N6QA 2W24A 2X1AA 1HNWF 4MYTA 3TA2A 4Q5VA 2EK1A 2JEIA 2JC1A 4WJBA 1BQNA 5BYSA 4O4GB 2DHSA 2XMVA 3JSRA 3M30B 2FHKA 3MEDB 4RKUC 2CIMA 2VD3A 4N5SA 1RKJA 1AUDA 3EGWB 2KM8C 4OJ1A 4M1KA 4C8MA 1JJ4A 3MM8B 1WELA 2VA3A 2PMZD 5JUMA 3QZ8A 3KG4A 1KVIA 3AY0A 1SJ3P 4ZP7A 2XLJA 1ZM2A 5M2RA 2XS5A 4ED0A 3GR0A 3BQ1A 5LXYA 2QRRA 2J7WA 2R7OA 5J1PA 1HD1A 3OR2A 4IFYA 1VRTA 4F4YA 4IR9A 3LP2A 2VZ9A 1ZZNA 1K1SA 1D9DA 1OO0B 2UVWA 2B7CB 2LEBA 3KKFA 2MJNA 5J2QA 2AU0A 3OL6A 1CQNA 2R8KA 4G1QA 1H2UX 2OPPA 3I5CA 4CNZA 4DV7F 2FY1A 1KRPA 4L6V3 2OPSA 2OO4A 1NJWA 1KEKA 2FJXA 2J5AA 5HN0A 1LXJA 4RW8B 4A8MP 5B7WA 3M6UA 1OPIA 3CJKA 2BE2A 4ZCKA 4KO0A 2C42A 2KYXA 3K5MA 1FK9B 1O8BA 3DRRA 3PJWA 3D54A 2C22A 2XCAA 3N0VA 1HR0F 3CJ3A 1N36F 1N6QB 2YKNB 3OR1B 2R7XA 5K8NA 4L3NA 1R0AA 4DSKA 4F8RA 2DVIA 1D0EA 5AE3A 2GC8A 1JLGB 3SSSA 4ED7A 2E7WA 1BQNB 4LF4F 3M2RB 3I31A 2RILA 4HTIA 1S0MA 2GO9A 1X4EA 3LWLA 4QW8A 5J2NB 2J6SA 2EG1A 3H2VE 2B9YA 3RTVA 1FE4A 4KQZA 4RNOA 4WE1B 3H25A 1MROB 1P27B 5KFRA 2BQ3A 3TA1A 3R5DA 2BXJA 2R8IA 1T03B 3TYTA 3JTPA 1JIHA 4F4WA 4N8OA 5A6PA 2PSZA 5H1SV 3AJ2A 4GC7A 4XIUA 2R8JA 4N41A 2MZ1A 4AL6A 3I9V9 1U8SA 4YY3F 4F4KA 4CI0B 3SEOA 2BJEA 1VRTB 3MM5B 4Y00A 3LP2B 4DR4F 4ES1A 5HP1A 1K9MT 4YOEA 2KFYA 1BQXA 2DCLA 5CYMB 4WKYA 4DR1F 2UVUA 1DBDA 1OSDA 2PC6A 1SH3A 3OVBA 2OPSB 1S6QA 1N52B 1SB6A 2KXNB 1AFIA 1TFWA 2GHPA 5I3PA 2P6TA 3CJKB 2IA6A 3VTIA 1X9WA 1L3KA 1X7VA 3K5NA 3T1YF 4XAKA 3F56A 3K59A 2MPUA 2VPWB 3QGGA 4RU9A 2R8HA 3GIIA 2QO3A 4NZ6A 4DQPA 2PFFB 3D0HE 1PGZA 5DG8A 2CJQA 2B4OA 3TUJC 5KFTA 3NBPA 1OS5A 5K9FA 2G4BA 1UJ4A 4ZVGA 5LSRA 5M2UA 1CEZA 3FEXB 2V8GA 4TLQA 2CPDA 3B78A 3MD1A 1YJRA 1GXUA 4OQJA 2VODA 1IR0A 3TRGA 2E9TA 1O0PA 4YB1P 1TQLA 1FRHA 1UAWA 2JWNA 4MIAA 4IFVB 3OTOF 2EK6A 3M2VB 4C0HA 1YRXA 4IH6A 2ZDOA 2YNGB 4MTPA 2HRYA 3Q8QB 3GIKA 4OIXA 2M8DB 3A8EA 1N48A 1WHVA 2OKQA 3M8PA 3Q0AA 1B64A 3D5MA 4NCBA 3T1AA 1KOHA 2VL1A 3ZZ0A 3G96A 1V3ZA 3V4MA 1URRA 2YNHA 1H0HB 1LKZA 3GFXA 3TUIC 4C2MA 2W9AA 4ECZA 2HHPA 1NKEA 3BS9A 2FGOA 5AXMA 2GMHA 3K5PA 3BDEA 3E8OA 3KYLA 3OJSA 1HI0P 1RDRA 5K5MA 3SCKE 2ZD1A 4NZ7A 3OLBA 3BSNA 5D4LA 4C8LA 2KHDA 3FEYB 1FESA 4MIBA 3OHAA 3AAWB 2JC0A 1S79A 1VQ9S 3Q24A 2WBRA 4M94A 3CDWA 1HBOA 3DU5A 1VQ5S 4Y6IA 3NNAA 1RT5B 2HFNA 1P1TA 3THTA 4X66F 4RUAA 2DGSA 4RBUA 4LUBA 2E5JA 5BYRA 2FIUA 1IUJA 3ICLA 4U9RA 3MFHA 3BN4A 3IRXA 3KLFA 4MKYA 3VR1A 2ZOMA 3NGDA 2LEAA 1LW2B 2OD6A 3OXLA 4R8UB 2HWIA 5D6GA 5AJ3F 2ZHOA 3VZHA 3F41A 4HLBA 1CSJA 2O67A 5F9LA 4B9MA 2ZDPA 1TAUA 2PO4A 1UP1A 2JZ5A 2PN6A 3U1MA 2J8AA 1U24A 3TP2A 4E8UA 3LP0B 2FVSA 1IM4A 3M8QB 4PUOB 3CSKA 3T9NA 4UUXA 3BSAA 1BGXT 2V8VA 2IM0A 2BRLA 2CVIA 4OHWA 3VAIA 4URSA 3HT3A 1EP4A 4ITSA 5F3TA 3RW6A 1U1NA 1MWZA 2YNHB 5D77A 5K14A 2P9GA 1JLFB 2ABYA 2CPXA 5AXLA 4DUZF 4O3QA 2XNRA 3KNGA 3HKZD 2HNDA 4XDDA 3DLGB 3ZZUA 4MK7A 1S72S 4NX9A 1NZAA 1FXRA 1N88A 2XEXA 3MM7A 5A8RA 1EETB 5EHHA 3PW2A 4N77A 5DJBA 2BQUA 5A8WB 3SQGB 2W9BB 3ISNC 4ECXA 3H2UB 4PUOA 3EXYA 1HBOB 3HVTB 3IXQA 5B0BA 4MAKA 5AXNA 4ETZA 1CC7A 3C3LA 3KLIA 2B5JB 1KTVA 2IMOA 3G6VA 2D74B 2I0XA 3LAKA 1SJ1A 3Q23A 4ED2A 1YHQS 3IRXB 3PXGa 5EDWA 4N8NA 1SJ4P 4RW9B 2MHEA 2XI3A 2G0CA 2PDAA 4RZRA 3CCJS 4DL5A 2NREA 2RVJA 4QIFA 5E0OA 5GVQA 5KFDA 3UDLA 4XO0A 1B0TA 3QYYA 2FJWA 1FJ7A 4HDHA 4DSIA 1S77D 1Q81T 4IG3A 3CCVS 1ZPWX 3WC2A 1FNXH 1VI7A 3N5FA 2VUGA 2O5DA 1S1WB 2LMIA 4C8YA 4GMKA 1L5UA 2XG8A 3H59A 2VG7A 5E3PA 2RQCA 2CJ9A 1S9EA 5EGYA 1U1MA 1TUVA 3PFEA 2I2YA 5G0RB 3JSMA 2FVQA 4RW4A 3Q8RB 2K1RA 3WX4A 1SIZA 4ES2A 1D9FA 2LU2A 2R7UA 4KB7A 2W25A 4QWBA 4W90B 2HNDB 2CQ3A 4OI1A 4DL2A 2R7VA 1VHFA 4F2RA 3G86A 4ED5A 2IM2A 3QWUA 3HDSA 4I2PA 4M95A 3MM7B 4USHA 2AD9A 1RT4B 5C24A 5A8RB 2GFFA 2NZ4A 1Q8BA 1QAXA 4YR2A 1KOOA 2N3LA 2HFOA 3QJLA 3OSNA 2DNGA 5BYQA 2BOPA 1UVIA 4TY9A 3VAGA 3O1LA 3RBDA 2NSBA 3NNHA 1X8DA 2GIQA 1S4FA 1HBMB 1IBLF 2ILYA 4CNYA 5HQ8A 4F4XA 2YH1A 1N4LA 1VQLS 3MM6B 4TY8A 2M9KA 3FRZA 2W9CA 3KHHA 4HVZA 1FDDA 2E1CA 5F8JA 2E1RA 3WBZA 3PIPQ 4PRFA 3IGNA 4KR0B 5GAHU 1OIAA 4ILRA 3QO9A 4I4BA 4MMOA 2GCFA 5J2MA 2MB0B 3I55S 3SSQA 1XNQF 4P7VA 2OD4A 3V6DB 3MM9A 2NUHA 1UWBA 4WFZA 1TAQA 1U25A 2MGZB 3RAXA 4C3KA 4X62F 2VG7B 4Y65A 5C25A 3J80Y 2XWYA 6FDRA 4PG5A 1T94A 2NS1B 3MMCB 4RW4B 4AL7A 2DJWA 4G1PA 5B08A 2DGWA 1GX5A 2HWHA 4NXMF 3AJ1A 1S10A 5CCLA 3AQOA 5KFEA 1DTTB 1SXLA 3DM2B 3OBIA 3O2IA 3ZZZA 1R7IA 3HHDA 2PA3A 1S6OA 4QR2A 1ZTTA 2C2EA 4I2PB 2GMLA 4H4MA 4HL9A 4USIA 5FD1A 2OTLS 2OFGX 5C24B 3DFEA 3N9UC 5E33A 5K8MA 4Y0FA 3VAKA 2A3JA 2OMOA 2M88A 4DDFA 3UR0A 3GV8B 4WIIA 1U1OA 1P1LA 1X4CA 1JK9B 2EFGA 2RNEA 1M5PC 3SZ2A 2QSFA 3O5TB 2UU9F 3HVWA 2HGLA 4OLOA 1VQNS 2IHR1 2W4PA 2LYVA 5L1KA 1FD2A 2MQNA 5F8MA 2FJBB 2QYCA 3I4HX 1FDAA 2GX8A 2O3DA 5E2QA 4FN5A 4PKDB 3IN5A 1SUQA 4DV2F 3SYZA 3PW5A 4ED8A 2YX1A 2L08A 3PR4A 2EFQA 3BQ2A 1FJEB 4EZ9A 2W9CB 1JLQB 2CJBA 1WHYA 3CCRS 1X9SA 1JWWA 1RT3A 4H4OB 4QOTA 4R25A 2NPIA 2DH7A 1HI1A 2YKMA 2KO1A 4CTAA 2ERRA 2QT7A 2RS8A 3QO9B 4LSNB 1DURA 5CYQA 4LJMA 1D8ZA 3I32A 1G2EA 2IC3B 1BC6A 4K4ZA 3SFUA 4YUDA 4KKOA 3TQ1A 2X3GA 2DHAA 1FJCA 2PMHA 3N79A 5EWEA 1VIXA 4FNIA 4IKAA 2ACYA 3HZEA 5C25B 3R1LA 2AYBA 1LOUA 5I4MA 3CJ5A 4DV5F 3NS6A 4WTYA 3GFHA 3NP5A 4N56A 3KLEB 1PC5A 3DOLA 1RYRA 1VK8A 3M32A 5HMZA 3J7Z5 2JDJA 3B82A 3PEJA 4KE5A 4OJGA 3UI3A 2JL9A 4JUZA 4Q0BB 3CULA 3LAMA 2DGVA 2C3UA 1UKUA 4YHHF 1KR4A 5AE2A 2IRXA 4A46A 1IKVB 3DLBA 2ZC4A 3CDUA 1JNRB 1SL2A 2AYGA 2QZ8A 1DRZA 1Q8LA 2DHXA 1FNMA 1ZOTA 3VF0B 3IA0A 4LF8F 1V9OA 2ZOFA 2HLUA 2J9DA 3JSYA 4NLYA 4DMZA 4ZKAA 2DB1A 1UFLA 1ZM4A 1UA0A 2JFKA 2YQ3A 3PIOQ 1WF2A 4MK9A 1XTZA 3F73A 3V6KA 2DHGA 3HF5A 3IG1A 4Y2AA 4EWTA 4IOAQ 1RKIA 3VQSA 1DHMA 4QIWD 3ENQA 1HMVB 1URNA 3WZ0A 3DHXA 3TVZA 3LP1A 3DRSA 2EG2A 3PRDA 1RTHB 4OJHA 2XS2A 4ZHRA 4I2QA 4Q45A 2FVPA 2FUG9 3HPOA 5I42A 2M7SA 1S7HA 4FPRA 4Q2LA 4K4XA 4NCGA 4Q2MA 1D1UA 2Y0SD 3IR6B 4MFBA 4EZ6A 4EUVA 2CQPA 3TW0A 3MTJA 4OHYA 4IG0A 3NMAA 4RW7B 3AH6A 5SZTA 2BABA 4QIGA 2B4VA 4DFMA 2JLFA 5EWGA 1YG0A 2CKWA 3RR7A 4FS1A 4A48A 4IO9Q 2ZBCA 2OSRA 2XULA 4M8LA 2KH9A 2UXCF 2JOQA 1YQHA 4AFFA 4OI2A 3FRYA