3MZIA

Crystallographic structure of the pseudo-signaling state of the bluf photoreceptor pixd (slr1694) y8f mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
SLYRLIFSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNETYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRPSAMDPEQCLNFLLDIAKIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Activator of photopigment and puc expression
publication title Mutational and Structural Studies of the PixD BLUF Output Signal That Affects Light-Regulated Interactions with PixE.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 29
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mziA01
3MCSA 2K1RA 2CRLA 2OKQA 1KQKA 5IXUA 3TNVA 3BF4A 1SB6A 2KYZA 4EFAC 2BJDA 1FE0A 3BGUA 2ZDPA 3BR8A 1MWZA 1Y3KA 3LO3A 1FE4A 4ZOSA 1YJUA 1W2IA 2K7JA 5K9FA 1OQ3A 3WDOA 2FTRA 5B0DA 1AFJA 1Y9OA 3KKFA 1ULRA 3KG1A 4DN9A 1XBWA 1FEEA 2JDJA 2N4DA 3FRYA 3K7RA 2LQBA 2BJEA 5B0FA 2OD4A 2RILA 5F0UA 2G9OA 2VV5A 3LGNA 3GZ7A 1WD6A 1YJTA 1S6OA 2HFNA 2OD6A 2XMWA 4OJ1A 2AJ1A 2ASYA 3HDSA 1FVSA 2FB0A 4HL9A 2IYIA 4OIXA 2OMOA 5A6WA 5B08A 4Y2KA 2HLUA 2RSQA 1S6UA 2IFXA 4NL5A 3HHLB 1TL5A 1QUPA 1SI9A 3MZIA 5B0GA 4OJHA 4A48A 1FESA 2GA7A 3HF5A 3DXSX 1TL4A 2HFOA 2W4PA 3FMBA 2LQ9A 1JK9B 2OFGX 5F0WA 1OQ6A 5T7LB 3KG0A 1FVQA 1Y3JA 3LGMA 2QLWA 1LQ9A 3BN7A 4A47A 5A6PA 2XMMA 2OAUA 1CPZA 1URRA 3HHLA 1N5QA 1Q8BA 1X0PA 2GV1A 2AW0A 3TRGA 3E8OA 1K0VA 5T7LA 2K7KA 4HI2A 2XMKA 1CC7A 2XMVA 3HX9A 4Y2IA 2QLXA 1GXUA 1VQSA 3T9NA 2XMUA 1AW0A 1N5TA 2GGPB 4HI1A 4FNHA 1P6TA 2ROEA 2BBEA 1Y0HA 3BDEA 3FGVA 4HH1A 4NPOA 4HH0A 2XMTA 1CC8A 1IUJA 2HLTA 2KT2A 2N4CA 2XMJA 3KNGA 2QIFA 2LDIA 1N5VA 1YG0A 1TZ0A 4DPOA 2RU9A 5B0BA 2GGPA 1MWYA 3IWXA 2EW9A 3IWLA 4QOTA 4Y2MA 1TR0A 4YEAA 4F67A 1FD8A 2K2PA 2ROPA 2W4DA 1GXTA 5KAKA 5B09A 3BM7A 2HQIA 3HFKA 3BB5A 2KT3A 4FNIA 2IYGA 2GCFA 2N7YA 1OSDA 2KKHA 4A46A 1OPZA 4Q2LA 4OJ3A 2ACYA 2FIUA 2PGCA 2VH7A 1X8DA 3UDCA 2QYCA 2BUNA 3F44A 4U9RA 2ZDOA 3HHLC 1R6YA 1X7VA 4A4JA 3HHLD 3CJKB 2BYCA 5B0EA 2FHMA 2W4CA 1Q8LA 1AFIA 3VTIA 2ROGA 1RJJA 3I9ZA 3QGPA 1VQYA 2OFHX 2OP5A 2AJ0A 2HIQA 2RMLA 3DCAA 4ZA1A 4Q2MA 4YDXA 4OJGA 2GO8A 2LXFA 1YRXA 2AP6A 1TUVA 2K1RB 3QMQA 3CJKA 2Q3PA 1YJVA 1U7LA 2PD1A 1N5SA 1KVJA 1P8GA 1KVIA 5B0CA 1SQEA 5B0AA 3TOQA 1V3ZA 2L3MA 1JWWA 1Q4RA 2GFFA 1APSA 1YJRA 1Q53A 4DL0C
chains in the Genus database with same CATH superfamily
4I2PB 4PYAA 4KFBA 3BN4A 4KGXB 3D4JA 3LANA 4QR0A 2V63A 1WC6A 4ECQA 3U27A 3K5MA 2BDPA 5L1IA 2FVCA 4PQUA 2VV5A 3DLLQ 3DOKA 3IBFB 3ZXWA 2BXJA 2CQDA 5CA5A 2UV8G 2EFVA 4A48A 4JI5J 2AJ2A 2DXEA 2QLWA 3BN7A 2JEGA 3HHEA 1D1UA 3KLGB 3K5OA 4A8MP 2KHCA 3V6JA 2YQ3A 1XMQJ 1VQSA 4H4OB 3PG9A 2PSZA 4WU3A 4DV3J 4K4TA 4LBIA 1HWLA 1RDRA 4PZVA 2K2PA 3PHTA 2VHGA 4J9UE 3I96A 4ECWA 4LVOP 3RBZA 3W2WA 4Q8EA 3WBZA 1NAQA 2QJ3A 2ZJRQ 5C25B 2ATCB 2FLNA 1DBDA 4W98A 3C6TB 2CKWA 4J90A 4GMKA 4HACA 3JSBA 4PXDA 4CRJA 2C2ZB 4M5JA 2H4WB 3DRSB 2GFFA 1ZAWA 1NLKL 4XK8C 1TL1B 2WVEA 1HMVA 4DFPA 3D6HB 1QDUB 4PXBA 2UVWA 1MSWD 5KFCA 2G1HA 4DR5J 3F56A 4O3RA 3CD5A 2HHUA 3EDRB 3TVYA 2YNFB 2OMOA 1VJQA 1YZ7A 1XTZA 5IOLA 4QIGA 3ETOA 3T5LA 2VBYA 2JLEA 2P6TA 5CYMB 1RTZA 3I6PA 2XMMA 1NH7A 2UU9F 2MKHA 2COLA 1J5OA 2R7TA 3B78A 3US5A 3WQPA 2QMXA 3DOMA 4WIQA 4ZIWA 5IT9U 1NM2A 3NG8A 4ECYA 1S12A 1S1UB 2ACYA 4WU2A 3DI6A 2J7UA 2R42A 1HLWA 2W1BA 1TELA 2O66A 4LF6F 4FVCA 1NPPA 2HHQA 1SV5B 5FIIA 3KK2B 3BPSP 2LECA 4NLXA 2J0XA 3IC1A 1URNA 2MZTA 2BE7D 3QO9B 1DJ0A 1RLDA 5I42A 2MLXA 4IO9Q 1RAIB 2DKOB 4XPCA 2Y9HA 1Q82T 1P1TA 1FDAA 4QCLA 2VG5B 1W25A 3J7YU 3QWPA 3LP2B 1URRA 1AB8A 3TRGA 1U26A 1NK9A 3ILIA 4IDKB 4FNHA 3K59A 4B9TA 3UW1A 4HTJA 3N6LA 3NAIA 2YX1A 1SH0A 2CVIA 4EO8A 1HYSB 2D69A 2HKEA 1F5AA 4LF7J 1U49A 3I0RB 1KR4A 2EWHA 5B7WA 3T1AA 3LP1B 2FQQB 5KT3A 5DRKA 1NSQA 2MLYA 3BREA 3KOAA 1NJXA 3W60A 1QM9A 3OQ2A 4NWBA 3L7OA 2QO3A 1TKZA 2CJKA 2QTWA 1FE0A 3HFZB 2KG1A 4I6AA 4CLLA 2ZNZA 3RBXA 1VGYA 1DRZA 4WFAQ 4ZJQA 4X4VA 1FRMA 1KOHA 4X2BA 2YNGB 5HVHA 2JOQA 1LEOA 4JI6J 3HD1A 3IM9A 2VQFJ 3CDUA 3DNCA 5K20B 4UOGA 1U47A 3RRKA 4DS4A 2BBEA 2JL9A 3ISND 1Q8KA 3T5JA 4OZ0A 2Y8WA 1SL0A 2CG8A 3QZ8A 4RNNA 5D3GB 1I94F 5DQHA 2ZH2A 5CD4H 3AA8A 4J5OA 3MMAA 2OEJA 1IKYA 1VQOS 1YBUA 5J2MA 3OFFA 3MPVA 1H2TZ 4HHHA 2WW8A 3GCXP 4WZMA 1M1HA 2PD1A 4CLSA 3Q8UA 8ATCB 4KQZA 4RBUA 4ZOSA 3CD6S 4R25A 4JOUA 3HJVA 3KG1A 2HNYA 5T41A 1XBWA 4DN9A 3QLHB 4BS2A 3DLGA 1J5EF 3TX8A 4MIWA 1R0CB 3WHIA 2KJVA 3JTNA 2HPUA 3TAMA 4U96A 1SQGA 4CT8A 1TL7A 2DGTA 2DVIA 1FFGB 1KSPA 2VFTA 1UAWA 3UWTA 3KG4A 1AW0A 3OLBA 1WTBA 4YDDB 2DNKA 3GYXB 1KVKA 1XR6A 1KTVA 3H4BA 3MURP 2W24A 1WDTA 1LW2A 5HO4A 3M32A 4H4KA 2M88A 2JSXA 2Z2YB 2J8AA 4RW6A 3KNAA 2GQQA 2VH7A 5DG7A 1NK7A 4RLEA 2HG4A 5HMYA 1EX8A 2Y3YA 3MM6A 4ZPDA 3FFIB 1NKEA 4OMFG 1DTQA 4NLQA 2OGUA 4M5DB 2QLBB 3HK2A 2VC0A 1HNIB 1TVRA 2YH1A 4NXNJ 6FD1A 1OIAA 2R8GA 1BQNA 3PXGa 2LQJA 3T6BA 5IT9Y 4OX9F 3D9BA 3SV4A 1IM4A 1TUWA 2V68A 2EKNA 2J0QD 2R9LA 5J1EB 3G6VA 2ZD1A 3PNIA 3SXLA 1RTDB 2UVUA 4BWMA 1S1VA 2B8QA 1V9OA 1YX2A 5ADZA 1UVJA 3G2XA 4R5PA 2R7XA 4C7QA 2HVEA 1N6QA 2QLXA 5D4OA 1HNVB 4WYLA 1UWAA 3FBBA 1M5KC 3LP0A 4O44A 3OHBA 2BR0A 4YEAA 5HROB 2M8HA 3RRHA 2PEHA 3PIPQ 2VOPA 5C24B 4FS2A 2MQNA 3TA2A 3GYNA 3KLHA 1CQNA 4ECRA 2XCAA 2CNOB 2XWYA 2ZHBA 2ILYA 1V5VA 1ELOA 1KQKA 1WUUA 4R0EA 3BR8A 1YJUA 3PKYA 4JV2A 1FJGJ 4ECXA 3TWZA 3CE8A 3FZBA 1F9FA 1FKOA 2OTJS 4KJIA 4HHUA 1S6PB 3TUZC 3CC7S 3LALA 1D9AA 2GIQA 3EGNA 4DV6F 2RDIA 2NYIA 4OFZA 2MGZB 2IC3B 4YOEA 1G7CB 3CB4A 1C0TB 2DB1A 2HZVA 1NUEA 1V3SA 2ZKTA 5T14A 3DDNA 2DR9A 2KJWA 3WC0A 1SKSA 4B3SJ 1XNQJ 2IJFA 4F2RA 1T02A 3TZYA 1TAUA 3LA0A 2X1GA 1RHQB 2KDOA 2X1BA 2OP5A 2ZH4A 3DN9A 1KQSR 4K4XA 2HWHA 2M2BA 3ZTPA 1YJRA 4LR8A 2VPWB 3I5AA 2M8DB 2FPHX 1A6LA 2ZM6F 2DH7A 3OSNA 2F5GA 1HI8A 4BC7A 3H2VE 1RCOB 1R27B 4C0BA 2DGUA 2I38A 1HWKA 3GZ7A 4KR0B 5F3ZA 4DX6A 4DPUA 4Q45A 1Q5VA 1EIYB 1VQ6S 3KTQA 1D9DA 2FVQA 3SMZA 3QT7A 1FVQA 2MHNA 1AZSB 5BR8F 2M5YA 1DHMA 3PACA 4X62F 1HW9A 1IBMF 4C6AA 2LVWA 4AL5A 3AT1B 1P6TA 1T9VA 4ZPTR 3BGOP 1JLGB 3KNGA 3KUGA 3MPYA 4KBIA 2CQPA 5LSOA 1TR0A 4NA3A 2AD9A 5B09A 2CZ9A 4KAIA 2DGWA 1JXEA 2BJ8A 1RI7A 2DNLA 5E33A 1VQ8S 4A4JA 2HGNA 2UXDJ 3EZOA 1U4BA 1I3OB 4KGVB 5DZ6A 2AJ4A 1YJ7A 1REVB 3CTRA 3ONQA 4DEZA 4RWWA 2A6OA 1U2RA 2VDIA 2Y1RI 2DO0A 3OUYA 1IWGA 1K8AT 4C48A 4DX5A 4NI2A 4H4MB 3ENWA 2OPQB 1VI7A 4GC7A 2LFVA 2UXBF 2EG1A 2UUWA 1KC8T 4OJHA 1PILA 4CO0A 1JK9B 2NXEA 3QQCD 2XBPA 5KT7A 4ED3A 2AW0A 2HAIA 4DG1B 2IDLA 4U8VA 4RUBA 1KFSA 6AT1B 3BSCA 1CJVA 4X4SA 1H7XA 4F4YA 2K3KA 3TVZA 4RX6A 4OV1A 4NCBA 1AROP 1F60B 4LREA 1HWJA 2J76E 4X66J 2IY5B 3I0SB 3F44A 4G1IA 4TVAB 2PI4A 2ZBPA 3D3BJ 2E9ZA 4TN2A 4UZBA 4LVNP 3KLFA 4A8QA 2CPJA 3Q8VA 3CSKA 3FRZA 2O01C 2RAQA 3TOQA 4OYMA 5KFNA 1UEVA 2AGQA 5HL7Q 2W2PP 3GIJA 7FD1A 3BGUA 1DARA 3ENQA 3DOLB 1HNWJ 1HQEB 2VG7A 2OMLA 1QAXA 2RILA 4V19X 1UW4A 4EU0A 2DRDA 4LRAA 1WEXA 1TKTA 4USUA 1AT1B 3TZXA 1VK8A 5F8NA 2XB2D 1K9MT 1VC0A 2YKMB 3PVXA 4ZLNA 1Z4UA 2J0SD 4DN0A 4GRSA 3C19A 3CJ3A 3T1HF 1TTHB 1XIQA 3RAXA 2UUBF 3NOCA 1Q8BA 3A1YG 1KS2A 3RZAA 1MROB 5KFWA 1N5VA 2AYGA 4M5MA 1IQTA 4LF5F 3MM8A 1S97A 4X65J 1R31A 2MQQA 1OY6A 1FTRA 4O0NA 2FY8A 1BQMB 1RWUA 4XDCA 2Y1IA 1S0NA 4CTAB 1NU4A 2CPIA 1NK8A 3PW2A 4DQSA 3AFGA 2MB0B 4IG0A 3CCMS 2FJWA 4UQGA 1WWHA 1Q95G 2YWWA 3RBEA 2HGMA 2L3MA 2KU7A 3MCSA 2ZH3A 3GR1A 4AXJA 1Y5IB 2R3VA 2JWNA 2ZE2A 5KFEA 3DM2B 4KV8A 2CJQA 4K8RA 2HFNA 4OJ1A 1LK7A 2QA4G 2W2NP 4P7VA 1FERA 5H9FK 3ZTQA 4CLPA 5KFQA 5KFBA 3AA9A 1N5QA 4JI7J 3NS5A 5KFHA 2XSJA 4EYIB 1RLCL 1HBUA 2MKKA 2I5JA 4X4QA 2JVOA 3B6BA 4USHA 3J81U 3HVTA 4B9UA 2WVFA 2KG0A 1XMOF 2ABYA 4F3OA 1TL3A 1RT5A 2H65B 2VJUA 4RU2A 2K1RB 3D6MB 5DETA 4KY3A 4C2MA 2MKJA 3OLAA 1A9NB 4TY8B 2OPRB 4DUYF 1WC3A 3T1YF 2ATLA 4EO6A 1XWLA 4NEZA 4EZ9A 1YK9A 2HURA 5KFJA 2H1YA 4USWA 1KWMA 1RK8A 2VUGA 1Q78A 4Z7YA 3UR0A 5CABA 3IRXB 1H2VZ 2B4UA 2QG9B 2LQ9A 2MYFA 3HHLA 4PABA 1R6VA 2I2YA 3GLJA 4LF8F 3UQSA 3MFHA 4Z2XA 1FF2A 2D7SA 4FF1A 3GG1A 1DURA 4XIUA 2DT9A 1X4AA 2KT3A 3V6KA 3DLKA 3OV7A 2KXFA 3MM9B 4CDIA 2DRAA 1IKVB 3J7AN 5D8HB 3VTIA 2BMBA 2ZZTA 2RH3A 4LBPA 1FTCA 1ZS6A 4YB1P 4FPRA 4Y6IA 1OY8A 2OPSA 3MUTP 3F73A 3UN3A 4YHHF 1WC1A 1RUSA 3QRQA 2CJAA 2MY7A 4C8MA 3PY8A 4M63A 5JMNA 2IAJB 4Q7AA 1IM6A 1R43A 3KLEB 5IS2A 4LMZA 4JUZA 3C3LA 1IN0A 2JDJA 4AL7A 2RE1A 3AOCA 4YR2A 2AV5A 2JC1A 5DG8A 4AD6A 2AZ1A 4FN5A 5D0EA 5ETKA 1IVZA 3K5NA 2RKIB 2XZTB 3EYZA 2IM0A 4KH0B 3SBMA 4NRTA 4K5RA 5KFDA 3RR8A 3QIPB 4P2MA 3MAHA 1RHKB 4MK8A 3MM5A 2JEFA 3PYGA 1HHSA 1EKSA 4B9SA 2MKSA 1OPIA 3GFXA 2B6AA 2EKYA 2KZMA 3O6QA 2KRRA 4IFVA 4NMXA 3NCRA 1X8DA 4NEYA 4G3IA 1XNRF 4M5IA 3SCJE 4DJBA 2WBRA 5DG9A 1U02A 2ZJQQ 4OJGA 3PFEA 1HL6A 3NCPA 1DLOB 3FCWA 5DDPC 1U1RA 2CAJA 3VGSA 3V6HA 5KFUA 1PSDA 3LO3A 3AD9C 3QRRA 2RQMA 1PAUB 1TQLA 4ZJLA 2XO7A 3D54A 1D3WA 5KFZA 1BUXA 2HQGA 2W8KA 2D74B 1VQ9S 2YWHA 2HMIB 4Q44A 1RU1A 4HL9A 4J9QA 2GVZB 3BV8A 1HBNA 2W01A 4Y28C 5G0RA 3MECB 4YB5A 4EI2A 1WKKA 3HLUA 2XI3A 2FHOB 2MZ1A 1FX2A 1WOOA 3B4MA 3QGGA 5CYQB 3IRWP 3W5YA 4PRFA 4GO5X 4IOAQ 1FI4A 3IAM9 3NGRA 2IM1A 3CJTA 4C8LA 1LW0A 1PC5A 2C28A 4BHQA 1BHNA 3W62A 1AFIA 3G9CA 3QYYA 3WZ0A 4ZK7M 1FT8A 4I64A 3ENVA 1XERA 1X5TA 2AYBA 1NHUA 1VJWA 4JI3F 3FVYA 5KG6A 1M1GA 3ET6B 2AU0A 2FVSA 3D1HA 2HIYA 1FRKA 3J81Y 1CQMA 4K4ZA 1E6VB 4I7FB 4KGKA 4RPFA 2UUCJ 4ELUA 2IMOA 1ZPWX 2BW7A 2IYIA 2HHSA 2GZOA 1NXIA 1FDBA 3RTVA 1NRKA 2B9EA 3HULA 1Y7PA 1S0MA 2CQ4A 3T19A 4NPOA 4FXWA 4OZLA 2N4CA 3DRPA 1S6QA 5DZ7A 2PMHA 3P4UB 4LSLA 3OL6A 3G8SA 4DDFA 1ZTWA 4JI2J 1XJWB 4FYXB 3OL8A 1HBMB 2CJYB 3JTOA 1KHWA 5AJ3F 4RUAA 2HQDA 1N5SA 2V2QA 2V8VA 3VQTA 4W92B 2U2FA 2UZAA 4IG3A 3PYFA 1CJUA 1B64A 2M52A 4P6QA 5E3QA 3A8KA 3PDNA 1WI8A 3FNNA 2ALYB 3UR3C 4OX7A 4ECVA 2XMWA 2VQEJ 2XY7A 1OO0B 4ZVQB 2ZBCA 3DMJB 4Q0BB 4U7UD 2XGPA 4K4VA 2QA4S 2HFOA 2W4PA 5LL6d 4JV5J 1PYOB 2RHQB 4IKAA 3H20A 2EPIA 4X64F 4AQYF 1X9WA 2P8IA 4RW4A 2KYXA 5A0YA 5KFKA 4FBUA 5KOXA 2CJ9A 5DGBA 4HDHA 5DLGA 3EPGA 2RU3A 3EWGA 3UDCA 4F4XA 3G96A 1R89A 1FA0A 2EXUA 3GMGA 5K8NA 3I9ZA 1BY9A 4USJC 1FFSB 2HNDB 4KFBB 1UW9A 3MR6A 1VBXA 2P9GA 2FDNA 4NYZA 2Y1LB 3VZIA 4AXIA 1D09B 2ZDPA 1U2CA 1UZHA 3EJMA 3MEKA 3NXZA 1S1XB 4ZITA 4PQUB 4K50A 3DOKB 4CO5A 2VD3A 4KE5A 2MXYA 3KXDA 2WCXA 3DHWC 1WD6A 2EBEA 2ZH7A 2NSCA 2KM8B 4NL5A 3U1LA 2R7RA 1QUPA 2BZ2A 2GMLA 4DFKA 2WOMA 3T5KA 1SL1A 4MH8A 5AXLA 2QEXS 2RDDA 4B3RF 1T11A 4DV5F 3H0PA 4NLDA 1RAEB 1OWXA 5E0OA 2R8HA 3BO3A 4ZIVA 4JYAJ 3W2WB 5KFGA 2AJFE 1UL3A 3LWLA 1UFKA 2XY5A 2DJWA 4Q2LA 4L74A 5EDWA 4HT7A 1O51A 4W90B 4HACB 2QSWA 1GTEA 2QL5B 1H98A 3LH2S 1HMVB 1T9UA 2XYHB 2WVBA 3DRRB 4DL7A 1B0VA 2HFZA 3ZNJ1 3BDPA 2VKRA 1TP7A 1QTMA 5B0DA 4MKYA 2X1AA 5ETMA 1PBUA 1IBLF 4CH0S 1XEZA 2YVSA 5KFTA 2QLFB 5B0FA 3CWJA 3I9V9 3M8SA 2HVHA 4N47A 2DNOA 3P96A 2FHJD 4DUZF 1XMBA 1F2GA 1J5OB 2OSQA 4CLUA 3GPAA 1IBKF 5A8RB 3DOMB 2DH8A 2LKZA 1UP1A 3QNWB 3DXBA 1JXVA 4OI3A 1Y0HA 3KHRA 3C6UB 5E3AA 2O67A 1FD8A 1WF2A 2R4FA 3DI6B 3AB2B 2PC6A 5K14B 4DR6F 4TNOA 1GMUA 3EPIA 1Q5YA 4PWUA 5D4PA 1FJCA 2DH9A 2XZDB 1RAJA 3FSXA 1JXLA 1NZ8A 4AE5A 3H7HB 1NB2A 3CCES 3B4DA 2DHSA 5CAAA 3TZZA 5I42B 3PJ9A 3ENAA 3A8IA 1N56A 1Q8IA 2XTJP 1VHFA 1XR7A 2QV6A 5LMNJ 1MU2B 2EC0A 2Z8QA 3SSQA 4O3NA 2OD6A 2DHAA 4KT0C 2DY9A 1CULA 2Y0SD 2L41A 5KFYA 4URQU 2OFGX 1BGXT 2A6MA 4NYPA 5F8GA 1X0PA 2VU5A 3EGWB 2DISA 4WXOA 4UOCA 5I3UA 1FRHA 2WBMA 5E41A 2DNNA 2ZVIA 1C1BB 1RWVB 3DC2A 4LSNB 5IM0A 1RJJA 3H2LA 3MMCA 5U47A 4CZCA 2M7SA 3CMES 1KVIA 1TKZB 1KEKA 3FJ2A 3ZTRA 3ZZTA 2XYPB 3Q22A 5DQGA 2ADCA 2X3DA 1M0SA 2VBZA 2OHDA 4ER8A 2PFFB 2RIJA 3R2CJ 3QGHA 1MNEA 3CF5Q 4FPIA 3TA0A 1AA1B 3FMBA 1G4CA 5L9NA 2OAUA 4DV3F 3SI8A 2POKA 4DMZA 3NMRA 2HRUA 2V69A 3RR7A 2N3LA 3HMJG 3OT9A 5D0GA 4IOBA 2MTLA 3JXOA 2GGPA 3MMAB 3BKUA 3EDQB 2P2CB 1IKYB 5HATA 3MUMP 2C2KB 5HSPA 3W9IA 2KKHA 2HGLA 5J2MB 2RQKA 1NJYA 2C3OA 4K2XA 1EKRA 1NNDA 4LRFA 3M2RA 3ITHA 4I56A 1RT2A 3RU0A 1SUQA 4HR2A 3QGPA 1BQXA 3ETMA 1BC6A 3R2DJ 3R9LA 2E1RA 2IPOB 2IJRA 1JLCA 3OXFA 3HHKA 4WYWA 1WHVA 2OKQA 4YQWA 2FVPA 4MT1A 2HNYB 4EYHB 1WOPA 2HFUA 3DLGB 2E29A 1WF0A 1Y00A 3EVMA 3LQVA 5HJXA 3A13A 3NS6A 1S6OA 4ENOA 3TAMB 1SXLA 4DUTA 4QIFA 5D15A 4KHPJ 4FVMA 1FWKA 2C3PA 2PI5A 3S8SA 3BEGB 5EWGA 1KOOA 4ZVHA 4LF6J 1NK5A 1CJTB 3C46A 1XN9A 2IJNA 5LT5A 1S0VA 2WK4A 3M32B 2HRTA 3R5DA 3FGVA 3CO0P 3KMQA 1ZH5A 2BM1A 5M2RA 1NPRA 1LNQA 3MM6B 4OYZA 1UVMA 2BW2A 4GKKF 1DTQB 2ALZA 1VC5A 1RSCA 2GS8A 1Y4ZB 3PM9A 5ETPA 4D3GA 4N8NA 4NOHA 4I2QA 2HIQA 1RTIA 3JTPA 2CVEA 1BQNB 4F0HA 1APSA 1M5SA 1SIWB 3VALA 5FD1A 3POTB 3SCLE 2BACA 1AFJA 2ZNYA 4MK7A 5I4MA 2ZD1B 5K8PA 5FLXU 1RT3A 4OZNA 2BJ1A 1UETA 1S1VB 2A1BA 1IKXA 2YX7A 1RE1B 1SI9A 7FDRA 4R5PB 4C0HA 1E6YA 4RW8A 3LGMA 1VHIA 1LFPA 1MMLA 1X4GA 3AH6A 4K5SA 1HW8A 3K5PA 4LF7F 1TFYA 3LP0B 1MW7A 4O44B 2XZWA 2OI2A 3J7ZT 1NB7A 2Y8YA 3GIIA 3A3NB 3PRDA 3L7PA 4ED7A 1MWQA 1NO8A 5DM6Q 1HR0F 3HJFA 1G6BA 1B7YB 3QFWA 1R0AA 3GU0A 3KLHB 2J7WA 1YBTA 5EN1A 2KVQE 4ATNA 2FHMA 4X4RA 1NDLA 4O23A 3R27A 1I6JA 3NEKA 3VAMA 3M2UB 2OFHX 1RU2A 4XO0A 2J9CA 4XTTA 2ZH6A 1RT6A 4RO0A 3GR0A 3LOUA 3S7RA 3P5BP 3ZZUA 3D68A 1H73A 1ITPA 1GT8A 3UD5A 3DLHA 1YRUA 3HVAA 4ZVSB 4FDFA 1PGZA 4DCOB 4X84A 2F65A 1FKOB 4WZQA 1I94J 4UZCA 1N4LA 1FXRA 4JI6F 4FYWB 2VQFF 2XLJA 1D8YA 4G65A 1NSAA 4I4BA 4PG5A 4LQ9A 3HSGA 2AZ3A 3P6YC 2B7BB 2YQ0A 1Y11A 3AD7C 3GB0A 2K7KA 1NEEA 4FKYA 4HI1A 3NS7B 3TARA 4RKUC 4CH1A 2WSCC 4YN3B 4CQ1A 2YNFA 5KFMA 1B99A 4K0KF 4DV7F 3X1LB 2HQ3A 3IBCB 3AB4B 3A3OB 5LMUJ 2ZBIA 2DNQA 3WX4A 1S57A 2CA9A 2UXCF 3V5RA 1R7IA 1BE4A 4RNOA 1S7HA 2R8IA 3CIZA 5DQIA 2I8EA 4OYXA 1X4FA 2ZOGA 4WFNQ 3KKFA 5FDLA 5IT0A 4QQBA 3N9UC 1K44A 4TU7A 5C5JA 4F2SA 4WIIA 2J6UA 3HHDA 2CQIA 1U6ZA 5HAOA 4J9KA 1SVDA 1Q7YT 2RT3A 2GA7A 4IO1A 1S49A 4MMOA 2E66A 3Q86A 3H8YA 1EQ0A 2N7CA 2WSEC 2ZITA 2F7VA 4O0IA 4WP9A 4DX8H 3H5UA 3MFIA 3MR2A 4OX9J 3P45B 2XQCA 3AXKA 3HHLD 4YS2A 4ES3A 3C14A 4A8SA 4IDKA 1SKRA 3GJTB 4ZP7A 3H5SA 2PN6A 3A3PB 5AXMA 5LM7E 1RYSA 2HEKA 4O3OA 5KFIA 4OX6A 1KN6A 4FP9A 3OUYB 4O3SA 3HI9A 2E44A 2Y0BB 5CH7B 2GQ2A 1DY3A 4M95A 1T0TV 3M8ZA 4NI2B 2F4VJ 4RUCA 3VGUA 2CJBA 4PQAA 4WPAA 3MTKA 3C16A 3IR7B 3AY0A 5E3CA 4RW9A 2QGFB 1MN9A 4QIEA 1U8WA 5L8RC 2FVRA 1VBYA 1K73T 1B7FA 4CM2A 2AGPA 4EBDA 1X9MA 4DSIA 3DYAA 2RF2A 5GAEI 4L73A 3OTOJ 4ICLB 2F8MA 1YRTA 1JLAA 2V9KA 2A3JA 3IWXA 2LA6A 2DEIA 5FLXY 1NKCA 2YH0A 4L3NA 1RISA 4QBUA 4NZ7A 1DZ5A 3JAMU 3ADAC 5DJBA 3RJMB 3KLFB 1UJ6A 1JNRB 4D3HA 4U9RA 1RWKB 1RA7A 3OXLA 1G1XA 4H54A 1FJGF 4DV6J 3MR5A 4I1TA 4ZJOA 1SH2A 5HK4A 2CQCA 1WACA 4DF4A 4HVZA 3R5BA 2VG7B 2WZ1A 2PFDA 2MSSA 3IO1A 2IHR1 4JI0F 2FJBB 5EWFA 4HHJA 5L46A 1TKTB 4MTPA 4B3OA 2OSRA 5KG2A 3Q23A 4X4NA 3CDWA 4ILLA 3LPEA 1UFLA 1QJHA 4WFXA 4CLTA 1GK8A 3T3FA 2ZBRA 4LFAJ 4QYRA 2W7AA 3RBDA 4B3SF 1XNQF 3QJJA 2V94A 2ZM6J 3QLHA 3PEHA 3MM8B 3CCUS 4NLSA 1UPPA 4Y2CA 3DDKA 4CO2A 3SCKE 3QBCA 3OSPA 4FYDA 3AJ1A 2DNMA 2O5DA 4IG0B 1GFWB 4E98A 1JLQA 5I3QA 1BWVA 3OTCA 2YPZA 3LF0A 1B0PA 3RB3A 5BR8J 4ETXA 1T9XA 5KG4A 1LXNA 5B0CA 2HRYA 4X62J 2UVVA 4U7CA 2RNEA 2GHVC 4KYZA 2ZE2B 1UVKA 4KV8B 3NL0A 3QATA 4N8OA 2VFUA 2KO1A 2JLGA 2ZZNA 3IM8A 2VASA 1TK8A 4QWEA 3PZPA 1U2FA 4K7QA 3PTWA 1D9FA 1ZAVA 1C4CA 1FRLA 5A76A 3EGVA 4ZCIA 9RUBA 2R7OA 1TL4A 4I67A 5HJYA 4TQSA 1HBUB 1Y10A 2I5JB 2MKCA 2WB1D 2XHWA 1S59A 3MI7X 5C42A 4B3TF 2C42A 3TR5A 1O5JA 2QSFA 4OX8A 4UOFA 1IXKA 1QSLA 2EFGA 1TL3B 4RJVA 1RT5B 2VL1A 4ED5A 1WORA 2KM8C 2VZ9A 1R8CA 2FHKA 2ZH1A 4CM0A 1OJ4A 2MQPA 1HNVA 2RMLA 1LOUA 4GKJF 3GCWP 2AP6A 4OV6A 2HZCA 1RTHA 4WXWA 2HBYB 8AT1B 4U95A 4CIOA 3BF4A 1WELA 3H90A 4DZDA 2NQPA 2H4YB 3KLIB 2RD5C 3TJ8A 1GAOA 3DGVA 3SZ2A 1VC6A 3CPWR 2D3OR 1WSVA 4X4OA 3N5FA 3W63A 3HHLB 4UQTA 4OI4A 3CJ8A 2XO6A 5ETSA 4QYZJ 4X66F 1SCJB 2KHDA 4QR2A 3W3SA 3PX4A 4C97A 4ZPCA 1HQ2A 3FUYA 3D3CJ 2H54B 4LT6A 5EUHA 4QOTA 2KN4A 1ZZNA 1WEYA 2PO4A 1X4CA 4ZVOB 8RUCA 2E5HA 4BC9A 3MCNA 2Z30B 3S01A 3UDVA 2OPSB 3SSSA 3BJYA 2DNPA 5MAOA 3GSDA 4RU9A 2UUBJ 2MEWA 4B02A 3MR3A 5AE2A 2YQ1A 1Q4RA 2KB2A 3LGHA 4K59A 2Z2MA 1YJ9S 4LF5J 4KHRA 3EZ5A 1C0UA 3FQLA 3I55S 2J9EA 2OTLS 1YITS 2KZZA 4DL3A 4BDPA 1MMDA 3JAMY 4KGZB 1YJTA 3IR6B 5BJRA 1GH8A 3HFVA 1S6UA 4IH6A 1H6KX 5A6PA 3MM5B 4UUWA 1SJ4P 2LP4A 2CDRB 3E8OA 4X65F 5HQMA 1QD1A 4TKTA 3ZZOA 4HI2A 3VR1A 1S99A 1DQ9A 4LQ3A 4O4GA 2C3UA 1N5TA 3Q89A 2JC0A 3GJSB 2XM3A 2G1DA 2B6AB 4ZCLA 4IFVB 2HHHF 4FS1A 1RT7A 3CJ0A 3HSDA 1Q1KA 1O8BA 5KFFA 3G6YA 2BQUA 5GAGI 1AZSA 5D78A 3TJ9A 3D0GE 3RGIA 3OR1B 3IP0A 5THWA 1HI0P 1HKAA 2AGOA 2YBVA 4P52A 5DDRC 1JLGA 4F50A 4WFZA 1HNZF 1TUGB 4ZMMA 4WE1A 4M5KA 1N33J 2ZOFA 1NKBA 3KJVB 1YZ6A 1P9YA 2GMHA 4LIWA 1QTNB 5ETNA 2P5VA 2DGXA 3DFEA 1XMOJ 1VQ4S 2V5HG 4JI7F 3GFHA 2CQGA 3CJRA 1YVFA 1HBNB 2I1RA 5G0RB 4Y2KA 1REVA 4Z7CA 3NBPA 3UNYA 1OQ6A 3KG0A 2GVDA 1TKDA 3FEZA 1ZAXA 2MQOA 3V81A 4JBCA 2YNIA 3E51A 1GXUA 2QLJB 4P73A 1LWFA 3T1YJ 1UEUA 1TK5A 3W7BA 5B0BA 1LW0B 1T3OA 3BO2A 3FC9A 4OZ1A 3OFHA 4DPWA 3CULA 2W2QP 3D67A 2WW4A 4OZ3A 2BQRA 4UY8T 3R6LB 3MCMA 2ZBQA 3HZGA 4LF9F 5J2PA 3KK1B 1QAIA 1RT4B 4DU7A 4IH7A 2OEKA 1U1KA 2ZHAA 1JJ2R 3J81j 3HZEA 4DHVA 3Q8PB 1ZYQA 4OHYA 4ZN1A 2I9SA 5KG1A 2PT0A 4F4AA 1X5SA 3AOBA 3RW7A 4DR4J 5D0RA 2KFYA 1FCAA 3H59A 4ZVFA 1WC0A 5IQQA 1RAAB 4YHHJ 4JI4F 4QZVB 2IBKA 3MEEA 1VQNS 3DRPB 1HQEA 1SJ1A 4LSLB 2ZH8A 4DR7F 3M9MB 5CXTA 2R7VA 5LJ5Y 2L48A 1VRQC 2IYGA 2B0GA 1XK8A 1FJ7A 2HW3A 3EUNA 4U67Q 1HIYA 2CPHA 3IA0A 2PE8A 3HT3A 1U09A 4P10A 2IBOA 4IG3B 1G2EA 1CJUB 4HKQA 3IR5B 3D6TB 1OYEA 3MOZA 2CADA 1KTQA 4ID8A 1S76D 2DGOA 1JLBA 2HK2A 2W7OA 3SIPB 4H4KC 4DBQA 3VAHA 1EP4A 5CCLA 4Y65A 1P27B 4OYWA 3JYTB 3TP2A 4CTAA 1I1GA 3QGIA 1KRPA 3LTOA 2EFPA 1NJZA 5ETTA 2OPPA 3O3LA 4JI1F 5A6WA 2HLUA 4NLWA 3UO0A 3S1TA 2L9WA 4NLRA 2Z56B 1FFWB 3ZZPA 4DI6A 4EZ6A 1YKWA 5A8KA 3R8YA 3QJPA 4URSA 4HTIA 2CZ4A 1F9EB 4RW4B 4IFYB 3GP9A 1M1KT 5A0YB 1Y5NB 4C11A 1VRTA 4G1PA 2B7CB 4YY3J 3PRBA 4LRCA 3OD2A 4QPTA 2FHJA 1RWPB 2QMWA 2UUTA 3PYDA 4CO3A 3IGVA 2WRMA 4F36A 3R97A 1GTHA 2UVRA 1QVGR 4DR3F 1ZETA 2AJ0A 3DCAA 2F9JA 1TK0A 1W2BR 4YB6A 3DGPA 2JJ4D 4DPXA 1JKHB 1F5BA 4M5LA 2VA2A 2PDAA 1DTTA 5H9EJ 1VMBA 3ZO7A 4TQRA 3F41A 2XULA 3VGTA 4ED1A 4E0DA 2R2UA 1YI2S 1RHMB 2WOMB 2LCWA 2F40A 1R8BA 2PMZD 2CPXA 3BYRA 2YWFA 3PCOB 1A7GE 4USVA 4FXVA 3G6XA 4P2FA 3CCSS 3K5LA 2WONB 3EXCX 2XMKA 4K4UA 6FDRA 2J5AA 2MLZA 3R7NB 4B9VA 4NRUA 2NYHA 2ZOMA 4FKXA 2MPUA 3NNAA 4M5NA 3CDEA 2DHGA 2HQIA 1VQ5S 2DXFA 3MEGA 5J2NB 4A8OA 3H25A 3OVAA 3MAAB 3UD3P 3UN5A 4RUHA 4J9PA 4NLUA 1VQPS 4U7UK 4A8YA 5KFRA 3CJKA 5BYRA 2HVZA 3ELHA 1JIHA 3AODA 1EZZB 2CPEA 3HD2A 2UUCF 3TO8A 1S9FA 3MM9A 4DV0J 4F8RA 3M8QA 3PRVA 3L7UA 3BGLA 1O6XA 3J7Z5 4JB8B 3I31A 4CLWA 5B08A 1CVJA 3NLCA 1UA0A 3I87A 2APOA 1KHVA 1RTJA 3CXCR 4MKAA 3TANA 4XPEA 2JNJA 5DDOC 4FF4A 3TQ1A 2KFNA 2V8DA 4M5HA 1FK9B 1N36J 1OMSA 3BGFA 2RHSB 2V4RA 3UCUP 1JB0C 1I51B 4EUVA 1Z2ZA 4CLFA 1HPZA 1UEKA 1H74A 1TV6A 2H3EB 3VHQA 5IV3A 4X4PA 2FIUA 4KRWA 1NSKL 5A8WA 3QIPA 1UMJA 1WF1A 3C2PA 4QWCA 3MPWA 2JEIA 2NS1B 5C2CA 4ZKAA 5ITHA 4NLTA 2H48B 2FYXA 2PA8D 2VQEF 3UD4P 1S9EA 4ELTA 2D1CA 1W2IA 3PYEA 4KKOB 2RS2A 1RAHB 1CULB 5HBMA 1SC4B 3LGNA 2MHEA 4MKBA 2B4VA 3I5BA 2BKPA 4IOCQ 1DLOA 1H2UX 2VC1A 2WHOA 3FEYB 1Y3JA 1UWBA 1VRUA 4QR1A 2XHCA 3BSNA 3HX9A 1K47A 4NA2A 3RAQA 3BQ0A 5CZXA 1WHWA 2WVCA 4I6YA 5GADU 1F9HA 3FBCA 2NREA 4UOHA 1BLUA 5HQ8A 5E2QA 1Q86T 5IM0B 3MECA 2GC8A 1IJFB 3MMCB 4ANCA 4MK9A 3R5JB 3SSRA 2GJFA 1D8ZA 1VQYA 1N0UA 1TFWA 2GHWA 3W61A 1D0EA 2NCKL 2LLZA 3CDBA 5HMZA 2LQ5A 4KO0A 1N52B 3M2VA 2QA2A 4TLRA 3W1YC 5F8JA 2O3DA 1WC5A 3BS9A 2W9BB 3BGRA 2R2RA 2CQBA 5E7OB 3W2VA 4QWAA 3NGSA 3CCQS 5I3PA 3W9HA 2MZRA 3MPUB 3EXYA 4FYVB 1PYTA 4JYAF 2V2ZA 4PG6A 4ZPWR 2E9RX 2J6TA 2LXUA 2ACMA 3GG0A 2GGPB 3QSIA 4N77A 2NUHA 4P2XA 2KT2A 1X4HA 1E6VA 1YG0A 3VCDA 2HVIA 3GE9A 3OJSA 2V8HA 3M2RB 5LOQA 3ITHB 3QZ7A 2CJXB 5AE1A 1RT2B 1SUQB 4B3MF 4C8NA 4ZPVR 3GV7B 5B0EA 4J9SA 4DUZJ 1RT1B 3K8VA 1JLCB 4X4TA 1GMVA 4ZCMA 2GO8A 2LXFA 2AX0A 2GX8A 1IBKJ 2BJ9A 5HI7A 4WBFA 3TNVA 1N8RT 1HBOA 4Y0FA 1Y3KA 3MWBA 1REGX 4CLYA 2HK3A 1Y5LB 1VBKA 3NCQA 2B3TB 2DO4A 2EK6A 4DL2A 2C2RA 2BJEA 2ZH9A 5DM7Q 3Q83A 4DR6J 2QZ8A 2IA0A 1S0OA 2IRYA 5J1NA 2YWGA 3FMWA 1CJKB 3AQPA 3W5ZA 4USTA 3JSMA 3N28A 4TU9A 3M30A 2V2VA 4PUOA 2UUAF 1ZOTA 2VIHA 5T7LA 4DV1F 5IFMA 3KJNB 4LF2A 4MIBA 4PAAA 3C66A 1VCTA 1IJEB 4A8KA 1GNKA 4C98A 2HS4A 4E2FB 1PCAA 2BANA 1JLFA 1M5OC 1RTIB 3M6UA 2EBGA 3CC2S 2Y1JA 2XEXA 3J80U 1SC3B 1UPMB 1FRXA 4Y34A 2NXUA 3UE2A 1EETA 2OJ3A 4CP5A 5F3TA 4PPDA 1LWCA 1W7WA 2J8SA 1RWWB 3FQKA 1RT3B 3I4PA 4RWXA 4F02A 5EHHA 2K7JA 4ED4A 3IG1A 3D0HE 2LMIA 2XSFA 4OZ2A 5AT1B 1IKXB 1PYSB 3KK3A 2AYEA 2YKPA 2HNDA 1E6YB 4RW8B 2MJUA 2FB0A 1RHJB 2NPIA 3G82A 3NRBA 2Q6BA 4KIAA 1X4DA 2BRLA 3N6MA 4WJBA 3SQGA 3MUVP 4QW9A 2XS2A 5F8HA 1WJ9A 1T05A 2XS7A 1S1XA 3HT0A 5DS7A 3KHHA 2JFDA 1VQKS 2LU1A 3OXGA 3MTJA 2XS5A 2RU9A 1NH8A 1R0AB 3EVWA 3QAEA 3BQ2A 3GONA 4YMEA 2HZAA 3N4WA 5EWEA 4J9LA 1KQGB 3HHLC 4DF8A 2YKNB 3P3DA 3ZZ0A 3U7JA 1FDDA 1RT6B 4DSJA 2NZCA 3ILLA 1RP5A 4DFMA 3QMQA 1NCLA 5HLFA 1V3ZA 3ZFVA 2JZ5A 4J9MA 2C2OB 2BV3A 4QIWD 5IXUA 5L1KA 2E1MC 3KJFB 1ICEB 1AUSL 5J2QA 2DNRA 3VGVA 4BBYA 3M8PA 1NPKA 2VPZB 3PV8A 4J9OA 1PJ5A 1FESA 3DRRA 4L76A 3TEGA 4G1QA 3AJDA 2F1FA 4KB7A 2HFVA 4NE9C 2E7XA 1B4SA 2AEMA 1NZAA 3PEJA 3AHPA 3CVKA 1TKXA 1KLMA 3TEHB 1VLYA 1UVIA 3M9NB 3E01A 1C1CA 5GAHU 2Z58B 3BB5A 2AEJA 2DITA 1OPZA 1YGYA 5A8RA 2C2DA 1IR0A 1YJVA 3CCLS 3C6UA 1GX5A 2PA3A 5FDLB 5CHCB 5L1LA 4YFUA 1VDHA 4CLZA 3CCRS 5DLFA 2DPJA 2D9PA 4KHPF 4YR0A 5K14A 3O2IA 3SYZA 2KL8A 3RB4A 4I69A 1RWMB 2FD2A 3L95X 3S6EA 2FC9A 3JQKA 3ILOA 4GKKJ 1S79A 5K5MA 3TYTA 2DCLA 2IFXA 4CNZA 1SJRA 4TXSA 1ZM2A 2CQ3A 4JP8A 4IYQA 3D66A 5LXYA 2QL7B 4K4SA 3H2UB 3LUYA 2GV1A 2MQLA 3NNCA 3UVJA 2B9YA 3K8WA 1U0HA 1Q7LB 4OL8A 3AJ2A 3VAGA 1MU2A 3A12A 4P75A 2F4FA 1L3TA 3CD7A 2NLWA 4CLKA 3GFZA 4ZP6A 2XMAA 4ZCKA 3PO4A 3SDEA 1JLEA 2F9DA 3M9OB 4J9NA 1UJ4A 4J9VA 3C14B 1PAEX 2YXLA 2Z0GA 3W65A 1RHRB 4L75A 1YSJA 5HN0A 1SBRA 4NXMJ 3BO4A 3TI0A 4Q8FA 1NK6A 3CEDA 1KVJA 2QE5A 1N34J 4A8FA 4NLPA 3VF0B 2R7UA 2FUG9 4NCGA 4MYTA 2HNZB 3OTDA 4EFAC 1MWZA 1C1BA 1WC4A 4NASA 4CNYA 3C16B 1WNEA 4F0KA 4RW9B 1HR0J 4LSNA 4P72A 1U1PA 2X3GA 4LUBA 1WKJA 4TU8A 2V0NA 3DDIA 2ASYA 3OL7A 1GMWA 5D4LA 2EFNA 3J80Y 2JLFA 4ZHRA 4OHXA 3HVWA 3V4IB 5JUMA 3DYAB 5D4NA 2DNHA 2RF2B 2GJIA 1QE1B 3MMBA 4UF4A 3PKMA 1U0SA 1JLAB 5KG3A 2RQCA 4DSFA 2BE2A 2HLTA 1U6BA 2P9CA 3BSAA 4DPOA 3J7A1 4DV4J 2FJVA 3TVKA 1S72S 3GFYA 2FGCA 3M1VA 3C8YA 1SPBP 3G6ES 2QT7A 3M7VA 2QYCA 2LXIA 2ZDOA 3VAIA 1FKAF 3NWGA 4ID5A 2WSFC 5D6GA 5LXRA 4QU7A 3HKZD 1FRJA 5L1JA 1YRXA 4LRDA 5B0AA 1VR6A 2L9DA 4F3QA 2C22A 2JH3A 1VQMS 1KD1T 3U02A 4DR1F 4FF2A 3BKFA 4UT4A 4LFCJ 5IWAF 4B3OB 5CD4A 1R0BG 2HBZB 1FEEA 1EB0A 3I4HX 3JQJA 1X0FA 3DRYA 1CSJA 3K58A 4K0KJ 4DV7J 2MMYA 3IS9A 2BOAA 2BKNA 4RBTA 3MZIA 3UCGA 1RBAA 2UXCJ 2W9CA 1N32F 2HHVA 1HQUA 4OLOA 4WTOB 2V6AA 3TUPA 2E7VA 1U48A 1YWXA 3DLEA 4UY85 3OVBA 1NBEB 2UV8A 3IAS9 2LDIA 3G8TA 2ZJPQ 3WC2A 3OR2A 3O44A 1MWYA 5LMUF 3BBBA 3R1LA 3IWLA 2QMUB 2W4DA 3WIUA 1SJFA 1YIJS 4A8WA 1CS4A 1JLQB 2WB4A 2JRSA 2I6WA 3QSYB 1CJTA 3K2YA 4C8ZA 3EVOA 5F8MA 3THTA 4LFBJ 1KFDA 2XWXA 1DAXA 3L3CA 5BXIA 4PKDB 4RL1A 5GADI 2GJ2A 4GC6A 1VLOA 2CQHA 4A8XA 4F67A 2XLKA 2CYYA 3PO5A 4KGMA 2HVDA 3AD8C 4C8KA 4C9DA 4LR9A 2G9OA 1J2VA 3ZTSA 4N7TA 2AJ1A 2E5JA 3N01A 4CYUA 4URGA 1VK3A 4L3KA 5F0WA 3BSOA 2JVRA 4ES1A 5HVGA 2CG4A 3OTEA 3POTA 1B70B 1CPZA 2X1FA 4LIRA 4RW7A 3T41A 3HSJA 3LAKA 2FJAB 5C42B 1KBRA 2MQ8A 4DL6A 3BDEA 3GIMA 1Q81T 3V6DB 4FXDA 2AYMA 4P7TA 3Q0AA 3IGNA 2FJDB 2B5JA 4ECSA 1NMEB 2VDHA 4ZLJA 1WI6A 2HYIB 5MLCV 2QA1A 3KMSA 3CMQA 3OVSA 4DSLA 1RTHB 2F4VF 3D7SB 2HFSA 1YJWS 2Q3PA 3M6WA 4OZJA 3K0JA 4DR2J 4BCAA 4N41A 3QT6A 2BJ3A 2M70A 2VONA 4ZVPB 1VIOA 1F3FA 3VV2B 2A0FB 3H40A 5HQLA 4OYIA 2EVZA 1T7PA 3LPYA 3M2UA 3UFCX 2CXEA 2G0CA 4IR9A 4KHMA 1NJIT 1R8HA 2Q43A 3GQCA 4OYOA 3OTOF 1L3SA 1GQEA 2HHXA 4CH7A 1S4EA 1S77D 2DY1A 1VBZA 3FKBA 1CC7A 1HNXJ 3TA1A 2K8GA 3KDNA 2ASLA 5BYQA 2XC9A 4JI0J 2G2YA 4RNHA 1S1TA 3NWRA 4I68A 4MYUA 2DPIA 2GCFA 5HP1A 3TZWA 2IM3A 4JI8F 3FCVA 3DU5A 2U1AA 4B08A 5IZHA 4PWDA 1WTFA 4PR6A 4YDXA 5GAEU 4PPZA 1P8GA 2Z2LA 5L38A 1SQEA 3UPFA 2M9KA 5AE3A 1TMMA 2VKZG 1U24A 2CDQA 1C0UB 2E5LF 4BWJA 4LF4J 2HQCA 1FXLA 2DXDA 2OUGA 1U45A 1JJHA 2RS8A 2GHPA 3CGIA 4F4ZA 3NNHA 4LFAF 1L3KA 1VOMA 4ED2A 3VVTA 4CT9A 3ISNC 4GVLA 4ERDA 1SL2A 3HDSA 3FEXB 4Y2AA 1RAGB 1S9GA 1ZM3A 2FZKB 3A8EA 4K2JA 4C8OA 1RAFB 4R8UA 4O4GB 3FBFA 4OI1A 4C3KA 2AMCB 3KFWX 2H9ZA 2DHHA 5H1SV 2IRUA 3D1QA 4OI6A 1VQ7S 1NHVA 3ZC4A 1RT7B 2J9DE 2E9TA 4MFBA 4RBVA 4DV2J 3KJQB 1N88A 1VYAA 1ZZFA 4YP3A 3NGTA 2GNKA 4AUKA 4E8UA 1IKWA 2R8KA 2XNRA 5BYSA 2W4CA 2BE9B 9ATCB 2RUSA 3QJLA 1W26A 4WE1B 3GJRB 2W2MP 2DR6A 3VWSA 2YKAA 2IM2A 2ZC3A 3FSYA 4B3TJ 3EX7B 2DNYA 2N4DA 3C15A 1JJCB 3HP6A 4QJVA 1FWLA 3NBPB 2UP1A 5EX3A 4OHWA 4RNMA 1J27A 3GYGA 4CI0B 2GVDB 1T94A 3V81B 3I5CA 2KRBA 1CG2A 4GKJJ 2YNIB 2HHTA 2ERRA 5IC6B 4WK3A 1LWFB 1Z1ZA 5GMDA 3IWNC 2ZVSA 3D5MA 1VS3A 2HS3A 1IR1A 3OFGA 1V5IB 3MM7A 4DSEA 2P9EA 3P8BB 2X51A 2ZEJA 1R6YA 2FGOA 3E2EA 5J2PB 1X7VA 1F6TA 1RYRA 3D6FB 1B0TA 1IQZA 2CQ0A 4JI5F 1T03A 2NUUG 3M05A 1U7LA 1GX6A 4ICLA 1M5HA 1NDKA 4Y3CA 2Z4PA 5SZTA 3DRXA 5GAHI 1XMQF 2V4JA 2LU2A 3JB9k 3EICA 5E3PA 1R3NA 1HARA 1R8PA 4YR3A 3PHEA 1Y9OA 4EGLA 1FKPA 1FO1A 5F8IA 4L6V3 3H98A 2MZSA 4N76A 5F0UA 2LQ8A 1RACB 4M8LA 4BLGA 2EI5A 5HVFA 1XQIA 1RWNB 3KDOA 4DCJB 3MEEB 2CPYA 4DLGA 3PW4A 1NDPA 1PKUA 2OELA 1WDDA 4NZ0A 4ANDA 5KFPA 1QLNA 5CQGA 3MEDA 2NXNA 1ZPVA 1T9YA 3LAMA 2R8JA 2UU9J 1AXQA 4DR5F 5H9FJ 1X4BA 4C0OC 4FF3A 1N5YA 3N5BA 4ZP8A 5DDQC 5D77A 2M4MA 4P2SA 4JV0A 3PW0A 4LSZB 2Z57B 1JLBB 2E5GA 1EP4B 2HBQB 5RUBA 2MY8A 2NSBA 2VG6A 1TL7B 3J7YI 2BJDA 2HHHJ 3MR7A 1ROFA 5E3RA 2IMWP 2MZQA 2OPPB 3FRYA 4M94A 2DTJA 2V8GA 4V19J 5A8KB 3CIMA 1LW2B 2YX4A 3CJ2A 4WTYA 2RUGA 4RW6B 4ILMA 4UTGA 4C8YA 4C11B 1HNZJ 1P1LA 3UCZP 1VRTB 5ETLA 1JMTA 3VQSA 2ZFHA 1NJWA 1WHYA 3FSIA 2P6SA 2ZUGA 2ZWOA 1TVRB 5GMKa 3VAFA 3HFKA 3H4DA 4A46A 4NX9A 1S1WA 2EK1A 2V50A 1N33F 1LWEA 3OTBA 3HPOA 3DKDA 3Q8SB 2YNHA 3CCZA 3DGPB 4ZA1A 2M3DA 1L5UA 4EWTA 3ZNUA 4KPCA 4LJMA 4WFYA 5FJ4A 2AX1A 5KT6A 3O5TB 4GVBA 1DTTB 3DHXA 2BQ3A 3Q8QB 1IBCB 5GAGU 2L9NA 4I2PA 4Q5VA 3HKWA 1N6QB 1U1LA 4U8YA 3SEOA 3ZZZA 1FDNA 4MIAA 2Z2ZA 3Q8RB 4LF9J 2BX6A 5G4DA 1KNZA 1KP6A 4Z37A 2VB6A 3BYPA 4B9LA 3KLIA 3VAKA 3TX0A 4DL4A 4PXEA 5F9NA 2GIRA 4F4KA 3R3TA 4ECUA 3KLGA 3RAMA 2ROEA 3PIOQ 2FLOA 2OO4A 1UJ5A 2ASJA 3MEGB 2O1PA 4H4OA 4NLGA 3R5AA 4UW2A 2C2NA 4P9SA 4OJ3A 4ZP9A 5SUHA 5ETQA 1HD1A 3CJKB 1X9SA 2MZJA 5C25A 3NY0A 4JI4J 3GIRA 3C6TA 3BH6B 1SC6A 2I0XA 3UN2A 1FRIA 3M8QB 2IDEA 1EHWA 1YBAA 2BA9A 4YB7A 4DR7J 2QC3A 3DRSA 4N5SA 2AHOB 4DR4F 1ULRA 1TL1A 2LQBA 1BXNA 3EM1A 1RTJB 1M90T 2RSQA 2R7QA 2A10A 3CCTA 4C3MA 3E3XA 3HF5A 3K17A 3T9ZA 2D9OA 3Q8YA 1U1OA 2DYAA 1V3RA 1PIEA 1J5EJ 5CYMA 1S10A 1HWIA 4Y2IA 1SC1B 4USMA 4QU6A 2XMTA 3EE3A 2V8PA 1HPZB 1TV6B 2CPZA 1WSRA 1Q16B 2N7YA 1YJNS 5KFXA 5A8WB 5HANA 4JI1J 2V67A 2QX0A 1S1UA 3CJSA 2MJNA 2ZKUA 4NCAA 3HVRA 3CT9A 2CQ1A 3MXHP 1S9EB 1CEZA 3Q2TC 2WVDA 3PJXA 4EBCA 3N0VA 1SV5A 3QPIA 3KK2A 4QIVA 2FTRA 3I56S 5HBMB 4HT5A 3AQOA 4DX7A 3OR1A 1B3TA 2DNZA 3QO9A 2DEJA 4DPTA 1CBKA 1TAQA 1UWBB 3HCXA 4DR3J 2W2OP 3BBFA 1VRUB 4U6PA 4YY3F 3KJVA 2VFVA 2VG5A 4S0MA 3G86A 4NXNF 3LP2A 3P49B 3ULHA 5K8OA 4ZVTB 5HMXA 3TUIC 3NGUA 5KFLA 2KFZA 3NKYA 1RADB 1EARA 3H42A 1UTAA 3CC4S 3MPDA 2ASDA 1UVNA 4KH1B 2ZWPA 1HYSA 4J9RA 2H5JB 5IV4A 3I0RA 2C2MB 4LRBA 3N79A 3BR9A 2CPDA 4O3PA 4ETZA 3LP1A 4KO0B 3B82A 1PJ7A 2JHEA 3M2VB 1S4FA 2MKIA 3TAQA 3BGRB 3W2VB 3T6JA 2YY3A 2E1AA 4YUDA 2EFQA 1L3VA 1SH3A 2HBRB 1K1SA 2IVFB 4FBTA 1CJVB 2PMWA 2MDAA 3KK1A 1FVSA 1IR2A 1RT4A 2DNGA 4G6VB 3RRGA 1YLXA 4OLPA 2YNGA 1I5OB 2AIRB 2W25A 3T9NA 2XMUA 4DOZA 3GWCA 3JSRA 1K0VA 2G2OA 4P71A 3U1MA 3R1HA 2RDJA 2EC2A 4XAKA 3D2WA 4Y2MA 3G87A 1H3DA 4DCPB 5CYJA 1C2PA 3BM7A 1OSDA 4ALZA 2JEJA 2CFXA 5KG5A 2XCPA 3QRPA 5D3GA 1QSSA 1WG1A 4F04B 2B43A 4F3MA 1UZDA 2D3O1 4DV0F 1HBOB 1HD0A 1AUDA 1IWAA 2MSTA 3PW5A 1RHUB 5KT4A 5K9FA 2QYGA 1OS5A 3M8WA 2J9DA 3NOGA 1QAJA 3F0NA 4IR1A 2L08A 3JSMB 5KFSA 4LBHA 1FX4A 1F1BB 2ZC4A 5LSRA 3M30B 1N36F 1ZM9A 3PR4A 4PUOB 3BKTA 2NPFA 4F26A 5T7LB 4WKRA 2FLPA 1LV5A 5K8MA 1Z2LA 3M8YA 5CZVA 4ILRA 4F7VA 1G3OA 2OEMA 2ZZMA 3JYTA 2E1CA 2XYGB 2BOPA 1MMNA 3CUNA 4CWBA 2BANB 2B4PA 1JLFB 1GMWD 1OY9A 2CPFA 3RG6A 3BZQA 4OYAA 2V4QA 1IBMJ 4NLVA 1FD2A 4DQIA 1KKHA 3G4SS 2A18A 4IFYA 4IRDA 1EETB 2JFKA 3L09A 5JVGQ 1UKUA 3V2UC 3FFIA 1LWCB 1JNZB 1YTYA 2RRNA 4M5DA 1P9QC 3IG1B 1HNIA 2CNNB 2GAHC 2XNQA 2GQCA 2XSJB 2NZ4A 2H5EA 3KK3B 4ECZA 3G82B 4FYYB 1PJ6A 3R6GB 2YTCA 4DQPA 2K06A 1T9WA 3SQGB 3RYLA 1H72C 3W8PA 3NP5A 5J1EA 2LEBA 1Q0NA 3HVTB 1JKHA 2UXDF 1T05B 1RTDA 3I82A 4ELVA 2DRBA 3IFEA 3KYLA 2LDYA 3TAPA 5CCMA 2XGQA 2UXBJ 2BJ7A 4I0WA 4ZVRB 2M0GB 2R7SA 2PEBA 2CWKA 1JQGA 2OH2A 1WEZA 3P5TL 5C2GA 1T8EA 3O8WA 1JJ4A 3W8GA 4HEA9 1ZA2B 1K0TA 2XI2A 5HROA 2IA6A 3M6XA 5C24A 3A8JA 4ZVGA 1Q8LA 5L9XA 5HLFB 2WONA 2X7IA 2J0WA 2AKWB 3HO1A 2D3ZA 3B8HA 4HDGA 3OJUA 1JWWA 4O4RA 1Q53A 4DPYA 1RWOB 3ISZA 1LK5A 5C7PA 5J2QB 5J2NA 3WDOA 4J7CA 3MAAA 3M8PB 3TJAA 2W7PA 2GW8A 4B3MJ 2VF3A 4TLQA 3UDLA 4OYBA 4G1QB 1U8SA 4TYAA 4P74A 2E5IA 5EGYA 3HHNB 3DLKB 4OYPA 1UFWA 2N3OA 2HHWA 1BMQB 1X5PA 1S6PA 2DIVA 2A2DA 3GV5B 1TKXB 1KLMB 3CCVS 5ETRA 4QW8A 3E01B 1C1CB 1T95A 2XMJA 2MGZA 2IC3A 4AYBD 1SKWA 3T1HJ 5HMWA 1VIXA 3NAHA 1KLNA 4L72B 1HNWF 2KXHA 1C0TA 3D1OA 3LWMA 1PO6A 3PFOA 3KHGA 1FK9A 4Q2MA 4DXLA 2FJEB 1X5OA 1U25A 2UUAJ 1MLAA 4NZ6A 3PJWA 3W66A 4DV1J 2IVMA 4B9NA 4ECTA 3SFGA 2RQ4A 3ILJA 3NMAA 4QYZK 5KT5A 1RCXB 3WX8A 3RB0A 1WOSA 5ETOA 2YPYA 1T3NA 2K3IA 2OD4A 2GIFA 2FLLA 2YWEA 3FCHA 2FY1A 1NSPA 1BWEA 3UVJB 1U0HB 3CJ5A 1FXDA 4KKOA 5IC4B 4EBEA 2JX2A 4ZDNA 2B9WA 1FNMA 5L39A 3JS9A 4FZVA 3SDEB 1JLEB 3DLJA 3KUEA 2CQ2A 4M1KA 5JJBA 2OLWA 1VFJA 3X3UA 2AF6A 3M6VA 1RBOB 1QSYA 2GMJA 2WTFA 2VA3A 4ES2A 2KH9A 3G8QA 4ZLPA 3I32A 1TUVA 4NCGB 2CRLA 3PX0A 3UDEA 2VFSA 1OQ3A 2J6SA 1RABB 4QWBA 1U1QA 1DFDA 2BRKA 1H0HB 3JQMA 4IQMA 3EMTA 1OYDA 4H4MA 4ZHRB 1M5VC 4DUYJ 3THPA 4NMLA 2OPQA 4OIXA 5KG7A 2RJZA 1KONA 1RB0A 3MMBB 1NK4A 1RXOB 4PYDA 2BE2B 3L4BC 2W9BA 2FC8A 5EX0A 4WKYA 4C4WA 4DG1A 1CC8A 3M1VB 3D28A 2CNKB 3PX6A 4AT1B 4WP3A 2DGVA 1HI1A 1SIZA 2ZHOA 3QT5A 4B17A 1ACMB 1V6HA 4LF8J 4ID5B 3A4TA 2Q79A 2W9AA 5AXKA 3BPDA 4PG7A 4KPYA 4J37A 2ROGA 3I0SA 2VJVA 4WF9Q 2F8EX 3L9ZA 2DR8A 4QWDA 1O0PA 4IRCA 2E1PA 3OPKA 2KVIA 3OHAA 2DR5A 2DCUB 1T9TA 2WAQD 5D0HA 2NR0A 2KYZA 3CW2C 1WKLA 2A2CA 2GO9A 1ZM4A 4USIA 2GAGC 3OBIA 5KFOA 1UCNA 3EGZA 1GXLA 1YHQS 3IS9B 2BM0A 3DOLA 1RT1A 4QPXA 2AJQA 1S6QB 4ITSA 1CLFA 4R0JA 3MAQA 4EEYA 2Q1LA 2W9CB 2E7WA 1HQUB 3SQOP 2B51A 2DK2A 2VICA 2EEYA 3GV8B 4ZS6A 1HHTP 4A47A 1LQ9A 3DLEB 3FBEA 2YKMA 5M2UA 4B9MA 1DQAA 2DGQA 4DZ6A 1VQLS 2CUYA 5LJ3Y 1WG4A 5A2QU 3OR2B 3Q2SC 4OHVA 4HH1A 1IUJA 3K89A 2DGSA 3CJQA 2F8HA 3W5XA 2VBWA 1CS4B 4ANEA 1MROA 5KAKA 1CJKA 2BABA 1KDNA 1U1NA 3TUJC 1XR5A 2QFJA 2IVYA 2CZVC 2BUNA 4RR5A 3QIDA 2V2KA 1BQMA 2F63A 4LF1A 1A0OB 5GMEA 2VBXA 2LEAA 2YWKA 2SXLA 1U1MA 1XNRJ 2LEPA 3N6NA 1VISA 3FK4A 1LKZA 3CMAS 2EFOA 4OI2A 4F4WA 1R8AA 4LR7A 1FE4A 2KXNB 1S48A 3MDFA 3GIKA 2AQ4A 5KTQA 4DU8A 4M5GA 3M8RA 4CYUB 4UUXA 1F0XA 3W64A 4DS5A 2FZCB 4EMDA 3DM2A 3HSZA 1YDLA 2ZH5A 4RW7B 1QVFR 3CDAA 3QFHA 4ZPBA 1NDCA 1HWUA 1RBLA 3IXQA 2V34A 4HH0A 2B5JB 2DD8S 1N0VC 4NXMF 3VZHA 4FNIA 3GILA 2ILZA 3ZZRA 1YQHA 1N34F 3R7SB 3T5HA 4NLYA 5DO2A 2C3MA 2BEFA 1PC4A 4DWIA 1EQMA 2RB7A 2BVZA 4PG4A 5LSLA 2CWXA 4DLEA 2CNLB 3RB6A 4OQJA 2K1RA 4W4MA 1X60A 1HA1A 3MD1A 2YKNA 4TY8A 2OPRA 3QWUA 3KLVA 2C2EA 1UA1A 3MHYA 3BH7B 1RZMA 3IN5A 5F8LA 4JI3J 2KI2A 3DLBA 5B0GA 5JXSA 5J1PA 2HS0A 3D0IE 3KHLA 5E5NA 2B8PA 2B56A 1KQFB 3IRXA 4DV4F 3W9JA 1MG7A 2AT1B 3O1LA 2R7WA 4DR1J 1S1TB 3CJ4A 3LW5C 2LYVA 5IWAJ 4C3LA 4DFJA 1NK0A 2QIFA 4ZVUB 1TZ0A 5HP1B 1X4EA 3PW7A 2EW9A 4I6WA 2W8LA 5H9EK 4AFFA 1QUVA 5AXNA 5JVHQ 4PWDB 2VPYB 4MJKA 1HHQA 1ZTTA 1F5CA 3MMJA 7AT1B 4PXCA 3AXMA 3Q24A 3CCWA 4J91A 1H38A 1FJEB 2VPXB 4LFCF 1N32J 1IKVA 2D41A 3MOJB 3AAWB 1TMJA 2Q6CA 1U6FA 4JV1A 2H5IB 2AEFA 3G71S 3FDSA 3R5GA 4F25A 4IUFA 3VAJA 5AJ3J 3KWMA 2RVJA 1WHXA 4WFBQ 4IQXA 2IAJA 2H51B 1C4AA 3KLEA 2BKOA 2IIHA 4JI2F 1S9GB 1NHKL 2V9WA 3KUHA 2XY6A 3ICLA 4R8UB 4CO4A 1FNXH 2KTQA 2OIHA 2XG8A 3VVUA 2DR7A 1LFWA 3DU6A 2RKIA 1QAYA 4MFBB 1RKJA 2NXCA 2XMVA 4K4YA 2IRXA 3R7BB 2C3YA 4CO1A 4WCEQ 4NLOA 2F3JA 1IKWB 3FZ2A 5KG0A 2ROPA 3UNGC 4LFBF 4X64J 2QFIA 5IQ6A 4AQYJ 1PG5B 1S7IA 4PG8A 3BBCA 4OI0A 1F2HA 3SFUA 4PEOA 5KT2A 1QY7A 1S5ZA 1ZA1B 3R5CA 1H7WA 3K57A 2PIIA 2FJXA 4JV5F 4ED0A 2ZUAA 2VFRA 5A2QY 4DL0C 3NGDA 5KFVA 1FEHA 4ZLLA 3C15B 1JX4A 3UI3A 2HHPA 1F3VA 3RW6A 3THVA 1TU0B 1FHTA 2G2ZA 5I3UB 4TYBA 2HWTA 2QL9B 4USKA 1SJ3P 3RUBL 3GSIA 1EJ7L 4N56A 2HMIA 2HNZA 1RGVA 1L3UA 2GVZA 1SKUB 1RKIA 3IBWA 4KC5A 1WG5A 4V1Ak 1PBAA 3OW2R 3OFEA 2RRBA 3MM7B 3MF5A 4Y00A 4MAKA 3EZUA 1BD6A 1M5PC 4F0MA 3TW0A 2R2TA 4IRKA 3MGJA 4RZRA 4B3RJ 4DV5J 5CYQA 2C1EB 2DBBA 1FWPA 3V4IA 3IMQJ 4CCHA 1T03B 4DR2F 1OSCA 1QE1A 1EAYC 3SCIE 4WP8A 1GEHA 2V4JB 4NA1A 1FNOA 4DQRA 1MN7A 4WWSA 3QT8A 1AYEA 1DQ8A 1SB6A 4HYKA 1RWXB 1FKPB 4AL6A 2G0IA 2RRAA 4GO7X 4OZ5A 5IT4A 4DL5A 2VOOA 2EG2A 2LA4A 4RNFA 3K7RA 4JI8J 3ET6A 4PWWA 2MKYA 2HWIA 1HNXF 3H5YA 4I7FA 1TL5A 4EK2A 3JSYA 3DXSX 1IBLJ 3TQEA 2HSEB 1HFEL 3CO9A 2MQMA 3NGKA 2J7KA 3MEDB 2G4BA 3B54A 3V4MA 2E5LJ 1XC9A 3AOAA 2FZGB 4DQQA 2AWZA 1LWXA 5F9LA 1GXTA 3MCOA 3CCJS 3HM9A 1Q79A 2CIMA 1N5YB 2PGCA 3U1NA 1ZBTA 3M4XA 1SJQA 4ED6A 4LF4F 1HBMA 4XDDA 2DIUA 4PCQA 5KOWA 1X31C 4KTQA 4ZVEA 2VG6B 4TY9A 2G13A 3GTYX 1N54B 3H5XA 3WIVA 2G0JA 4DSKA 2N82B 3CD0A 3QAUA 2DHXA 2XLIA 1SQFA 5F41A 3CNQP 2NXJA 4X4UA 3BQ1A 1N48A 1RQ0A 4DV2F 2YKQA 2YKOA 3DMJA 2QN6B 4Q0BA 3ZZYA 2Q66A 4HLBA 2ADBA 3HXMA 1RA6A 4I2QB 4ED8A 4OHZA 4O3QA 1K1QA 3ZTOA 4KSEB 2HAFA 1S1WB 4NYOA 3MD3A 4IH5A 2B9XA 3GJQB 5LMNF 5KFAA 4MKVA 4WK1A 1LWEB 3OL9A 4Q43A 1UVLA 3PR5B 1RAOA 5M2PA 4ZN3A 2YNHB 2QRRA 3SV3A 2VODA 2BYCA 2D3UA 5DGAA 5GVQA 1LXJA 2B4OA 4GVBB 2HQFA 2R2SA 4ZPAA 5ETVA 4K4WA 3V6DA 2KT5A
chains in the Genus database with same CATH topology
1JKHB 1F5BA 4NYZA 4I2PB 3DHXA 2BQ3A 3Q8QB 2VA2A 4KFBA 2PDAA 3BN4A 3VZIA 4AXIA 5GAGU 2ZDPA 1DTTA 5H9EJ 1VMBA 2L9NA 3LANA 4QR0A 4I2PA 4Q5VA 3MEKA 4TQRA 3HKWA 1S1XB 4PQUB 3F41A 4ECQA 3U27A 1N6QB 4K50A 3DOKB 4CO5A 3K5MA 2XULA 2BDPA 2VD3A 1U1LA 4KE5A 5L1IA 4ED1A 2FVCA 2MXYA 4E0DA 4PQUA 2VV5A 2WCXA 2R2UA 3DHWC 1WD6A 3DLLQ 2EBEA 3SEOA 3DOKA 1YI2S 2ZH7A 3ZZZA 2NSCA 1FDNA 2WOMB 2KM8B 2BXJA 2CQDA 5CA5A 2UV8G 4MIAA 2LCWA 4NL5A 2F40A 3U1LA 2R7RA 1QUPA 2BZ2A 2GMLA 2EFVA 1R8BA 2PMZD 2CPXA 4A48A 3Q8RB 4DFKA 2YWFA 2WOMA 5G4DA 1KNZA 3T5KA 2QLWA 3BN7A 1A7GE 2JEGA 3HHEA 4Z37A 1SL1A 2VB6A 1D1UA 4MH8A 4FXVA 3KLGB 3G6XA 3K5OA 4K4YA 4A8MP 4B9LA 2KHCA 3KLIA 3VAKA 5AXLA 2QEXS 3CCSS 3K5LA 3V6JA 4DL4A 4PXEA 2WONB 3EXCX 5F9NA 2YQ3A 2XMKA 2GIRA 4F4KA 4B3RF 1VQSA 3R3TA 4DV5F 6FDRA 4ECUA 4K4UA 3KLGA 2J5AA 3RAMA 2ROEA 4NLDA 4H4OB 3PIOQ 2FLOA 4B9VA 2OO4A 4NRUA 1OWXA 2ZOMA 5E0OA 2R8HA 3BO3A 1UJ5A 2PSZA 4WU3A 3W2WB 2ASJA 5KFGA 3MEGB 4K4TA 2AJFE 2MPUA 1HWLA 3NNAA 2O1PA 1RDRA 4H4OA 1UL3A 2K2PA 2DHGA 3CDEA 3LWLA 4NLGA 3I96A 2HQIA 4ECWA 3R5AA 4LVOP 4UW2A 1VQ5S 3W2WA 2XY5A 2DJWA 4Q2LA 3MEGA 4OJ3A 5J2NB 4Q8EA 4A8OA 4ZP9A 5EDWA 3H25A 5SUHA 4HT7A 3WBZA 3OVAA 1NAQA 1O51A 3UD3P 1HD1A 4W90B 2ZJRQ 5C25B 4RUHA 3CJKB 2FLNA 2QSWA 4J9PA 4NLUA 1DBDA 1VQPS 1GTEA 1H98A 3C6TB 2CKWA 4U7UK 3LH2S 1X9SA 2MZJA 4GMKA 5C25A 4A8YA 3JSBA 4PXDA 3CJKA 5KFRA 5BYRA 1HMVB 3C6TA 3DRSB 2HVZA 1JIHA 2GFFA 1ZAWA 3DRRB 1SC6A 2I0XA 4DL7A 2CPEA 1B0VA 4XK8C 2HFZA 2UUCF 1TL1B 1FRIA 1HMVA 3M8QB 1YBAA 4DFPA 2BA9A 4YB7A 3BDPA 2VKRA 3DRSA 4N5SA 1TP7A 3TO8A 1QTMA 4DR4F 5B0DA 1S9FA 4PXBA 3MM9A 2UVWA 2X1AA 4MKYA 1MSWD 1ULRA 1TL1A 5KFCA 4F8RA 3M8QA 1IBLF 4CH0S 1XEZA 2YVSA 5KFTA 3BGLA 2LQBA 5B0FA 3F56A 4O3RA 3CD5A 3CWJA 2HHUA 3I9V9 3J7Z5 3M8SA 3TVYA 3I31A 2HVHA 1RTJB 2YNFB 4N47A 2OMOA 1M90T 5B08A 2DNOA 2RSQA 1XTZA 2A10A 2R7QA 1CVJA 4QIGA 3ETOA 3CCTA 2VBYA 3NLCA 2JLEA 3P96A 2FHJD 2P6TA 3E3XA 4C3MA 4DUZF 3HF5A 3I87A 3T9ZA 2D9OA 2APOA 1KHVA 5CYMB 1U1OA 1RTJA 3CXCR 1V3RA 1XMBA 3I6PA 4MKAA 1F2GA 2XMMA 3TANA 1J5OB 1NH7A 2OSQA 4XPEA 3VR1A 2UU9F 1IBKF 2MKHA 5CYMA 1S10A 5A8RB 2DH8A 2LKZA 5DDOC 1HWIA 4FF4A 2COLA 1UP1A 4Y2IA 3TQ1A 1J5OA 2R7TA 2KFNA 3DXBA 2V8DA 1FK9B 3B78A 3US5A 3BGFA 4OI3A 1Y0HA 4QU6A 3KHRA 2XMTA 2QMXA 3DOMA 2V4RA 3UCUP 3C6UB 1HPZB 5E3AA 1JB0C 1TV6B 2O67A 2CPZA 4EUVA 3NG8A 1FD8A 1Z2ZA 1WF2A 2R4FA 3DI6B 1Q16B 2N7YA 1HPZA 3AB2B 5KFXA 1YJNS 2PC6A 5A8WB 1TV6A 4ECYA 1S1UB 2ACYA 4X4PA 2FIUA 5K14B 4KRWA 4WU2A 4DR6F 4TNOA 3DI6A 3EPIA 2J7UA 4PWUA 5D4PA 1FJCA 5A8WA 1S1UA 2DH9A 3QIPA 2MJNA 2ZKUA 1RAJA 3FSXA 1JXLA 1UMJA 1WF1A 3HVRA 3CT9A 4NCAA 2CQ1A 4AE5A 3C2PA 4QWCA 2O66A 3MPWA 3MXHP 4LF6F 4FVCA 2JEIA 2NS1B 2HHQA 1SV5B 4ZKAA 1S9EB 3CCES 1CEZA 5ITHA 4NLTA 5FIIA 3B4DA 2DHSA 3KK2B 3Q2TC 2LECA 4NLXA 2PA8D 3PJXA 5I42B 2VQEF 4EBCA 3N0VA 3UD4P 2J0XA 1SV5A 3IC1A 1S9EA 4ELTA 3QPIA 2D1CA 1URNA 1W2IA 2MZTA 1N56A 3KK2A 4QIVA 2FTRA 3I56S 1Q8IA 3QO9B 5HBMB 1DJ0A 5I42A 4HT5A 4KKOB 1VHFA 2RS2A 1XR7A 2QV6A 1MU2B 3AQOA 2EC0A 3OR1A 2Z8QA 2DNZA 3SSQA 3QO9A 5HBMA 4IO9Q 4O3NA 3LGNA 4XPCA 2OD6A 2DHAA 4KT0C 1Q82T 2MHEA 1P1TA 1TAQA 1FDAA 2Y0SD 2L41A 5KFYA 1UWBB 4MKBA 2B4VA 3I5BA 4URQU 4QCLA 4IOCQ 1DLOA 2VG5B 1H2UX 1W25A 1VRUB 2VC1A 2OFGX 3J7YU 2WHOA 3FEYB 1Y3JA 4U6PA 4YY3F 1BGXT 3KJVA 1UWBA 4NYPA 3QWPA 3LP2B 1URRA 5F8GA 1X0PA 3EGWB 2DISA 3TRGA 2VFVA 2VG5A 1U26A 3G86A 1NK9A 1VRUA 4QR1A 3BSNA 4NXNF 3HX9A 4NA2A 4WXOA 3LP2A 3P49B 4IDKB 3RAQA 3ULHA 4FNHA 4UOCA 5K8OA 3BQ0A 5CZXA 1WHWA 5I3UA 4I6YA 5HMXA 5GADU 3K59A 1FRHA 4B9TA 3TUIC 3UW1A 4HTJA 3N6LA 2WBMA 3NAIA 5E41A 2YX1A 1SH0A 5KFLA 2KFZA 2CVIA 4EO8A 1HYSB 3NKYA 1F5AA 2NREA 1BLUA 2DNNA 3CC4S 1U49A 2ASDA 1UVNA 3I0RB 1C1BB 5HQ8A 5E2QA 1KR4A 1Q86T 5IM0B 1HYSA 3MECA 2GC8A 4J9RA 2EWHA 1IJFB 3MMCB 5B7WA 3DC2A 4LSNB 4MK9A 3SSRA 3T1AA 3I0RA 3LP1B 5IM0A 1RJJA 1D8ZA 1VQYA 3N79A 3H2LA 3MMCA 5KT3A 5U47A 3BR9A 1N0UA 4CZCA 1TFWA 2GHWA 2CPDA 4O3PA 1D0EA 2M7SA 5DRKA 3CMES 1KVIA 4ETZA 3LP1A 4KO0B 3B82A 2JHEA 1TKZB 3BREA 3KOAA 3M2VB 1S4FA 1KEKA 2LLZA 1NJXA 2MKIA 3CDBA 1QM9A 3OQ2A 5HMZA 3TAQA 4NWBA 2LQ5A 3FJ2A 3L7OA 4KO0A 2QO3A 3BGRB 1TKZA 2CJKA 1FE0A 1N52B 3M2VA 3ZZTA 2QA2A 4TLRA 5F8JA 2O3DA 2KG1A 3W2VB 3T6JA 2YY3A 3Q22A 4I6AA 2E1AA 3BS9A 4YUDA 2W9BB 3BGRA 2EFQA 2R2RA 2ZNZA 5DQGA 1L3VA 2ADCA 1SH3A 1M0SA 2CQBA 2VBZA 5E7OB 3W2VA 1K1SA 2IVFB 4QWAA 4FBTA 1VGYA 1DRZA 2MDAA 4WFAQ 2PFFB 2RIJA 3KK1A 4X4VA 3CCQS 1FRMA 3QGHA 1KOHA 4X2BA 1FVSA 5I3PA 1MNEA 1RT4A 2YNGB 2MZRA 3CF5Q 3EXYA 2DNGA 4G6VB 3RRGA 4OLPA 3TA0A 3FMBA 4JYAF 2YNGA 5L9NA 2OAUA 4DV3F 2JOQA 4PG6A 3SI8A 2POKA 4ZPWR 4DMZA 2E9RX 2J6TA 3CDUA 3NMRA 2HRUA 2W25A 2LXUA 3DNCA 3RR7A 2N3LA 3T9NA 3GG0A 3HMJG 2XMUA 1U47A 3RRKA 4DS4A 2GGPB 4N77A 4DOZA 2NUHA 3GWCA 2BBEA 2JL9A 3ISND 3JSRA 1K0VA 2KT2A 1X4HA 1E6VA 1YG0A 4IOBA 3T5JA 4OZ0A 3VCDA 3U1MA 3R1HA 2HVIA 2GGPA 2RDJA 3GE9A 3MMAB 4XAKA 3D2WA 4Y2MA 3EZ5A 1H3DA 5CYJA 1C2PA 3OJSA 3BM7A 1SL0A 1IKYB 2V8HA 3M2RB 4RNNA 3QZ8A 5D3GB 3MUMP 1I94F 5DQHA 3ITHB 3QZ7A 2ZH2A 1OSDA 2HGLA 2KKHA 3AA8A 2RQKA 4J5OA 4ALZA 5AE1A 5J2MB 1RT2B 2C3OA 1NJYA 2JEJA 3MMAA 4K2XA 2CFXA 5KG5A 1SUQB 4B3MF 2XCPA 1NNDA 1IKYA 3M2RA 4C8NA 1VQOS 5D3GA 3ITHA 4I56A 5J2MA 4ZPVR 3GV7B 5B0EA 1RT2A 3MPVA 3OFFA 4J9SA 3RU0A 1QSSA 1WG1A 1H2TZ 2B43A 4F3MA 1SUQA 1RT1B 3K8VA 1JLCB 2WW8A 3QGPA 4X4TA 1BQXA 4ZCMA 4WZMA 1BC6A 4DV0F 2GO8A 2LXFA 2AX0A 2E1RA 2PD1A 2GX8A 1HBOB 1JLCA 3OXFA 3HHKA 5HI7A 4WYWA 1HD0A 1AUDA 2MSTA 3PW5A 1WHVA 4KQZA 2OKQA 4YQWA 2FVPA 3TNVA 1N8RT 1HBOA 5KT4A 2HNYB 4Y0FA 1Y3KA 4RBUA 4ZOSA 4EYHB 3CD6S 5K9FA 3MWBA 4R25A 1Y5LB 4JOUA 1OS5A 3NCQA 3DLGB 2B3TB 2E29A 3KG1A 2HNYA 5T41A 1XBWA 4DN9A 2J9DA 1WF0A 2DO4A 2EK6A 1Y00A 4DL2A 2C2RA 3QLHB 4BS2A 3LQVA 1QAJA 2BJEA 2ZH9A 5DM7Q 4IR1A 3NS6A 3DLGA 2L08A 3JSMB 2QZ8A 1S6OA 1J5EF 5KFSA 3TAMB 2IA0A 3TX8A 1S0OA 2IRYA 1SXLA 5J1NA 2YWGA 4QIFA 4MIWA 2ZC4A 5LSRA 3FMWA 3M30B 4FVMA 2KJVA 1N36F 3AQPA 3JSMA 1ZM9A 3JTNA 2HPUA 3PR4A 2C3PA 3TAMA 3S8SA 2NPFA 3BEGB 2PI5A 4PUOB 4F26A 5EWGA 1KOOA 5T7LB 4WKRA 3N28A 4TU9A 3M30A 4CT8A 4ZVHA 2FLPA 2DGTA 1LV5A 5K8MA 1NK5A 4PUOA 2UUAF 1ZOTA 1Z2LA 2DVIA 3C46A 5T7LA 1XN9A 2IJNA 1KSPA 4DV1F 5IFMA 2VFTA 5CZVA 4ILRA 1UAWA 3UWTA 1G3OA 3KG4A 1AW0A 4MIBA 3OLBA 5LT5A 3C66A 4YDDB 3JYTA 1WTBA 1S0VA 2ZZMA 2DNKA 2WK4A 3GYXB 3M32B 2E1CA 3R5DA 3FGVA 1IJEB 2BOPA 1MMNA 1XR6A 1KTVA 3H4BA 3CUNA 3MURP 4A8KA 1GNKA 4C98A 2BANB 2HS4A 2W24A 3KMQA 5HO4A 1LW2A 2B4PA 3M32A 1JLFB 4YP3A 4H4KA 1ZH5A 2CPFA 2BM1A 2M88A 5M2RA 3BZQA 2JSXA 2J8AA 3MM6B 2BANA 2V4QA 4RW6A 4NLVA 1FD2A 3KNAA 1UVMA 4DQIA 2BW2A 4GKKF 1JLFA 2GQQA 1DTQB 2VH7A 5DG7A 2ALZA 1VC5A 1NK7A 1M5OC 4RLEA 3G4SS 2HG4A 1Y4ZB 3PM9A 1RTIB 2A18A 3M6UA 3MM6A 2EBGA 5HMYA 3CC2S 4IFYA 3FFIB 4ZPDA 1EETB 4IRDA 2JFKA 1NKEA 3L09A 4D3GA 4N8NA 2Y1JA 4NOHA 2XEXA 1DTQA 4OMFG 5JVGQ 4I2QA 4NLQA 1UKUA 1FRXA 3V2UC 2HIQA 1RTIA 4Y34A 2NXUA 3FFIA 3UE2A 1EETA 1LWCB 1JNZB 3JTPA 2CVEA 2OJ3A 1BQNB 4M5DB 1YTYA 3HK2A 2VC0A 1HNIB 1TVRA 2YH1A 1APSA 1M5SA 1SIWB 3VALA 5F3TA 4PPDA 5FD1A 6FD1A 1LWCA 1OIAA 2R8GA