1WKJA

Crystal structure of nucleoside diphosphate kinase from thermus thermophilus hb8
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
137
structure length
137
Chain Sequence
b'MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nucleoside diphosphate kinase
publication title Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 43
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1wkjA00
3DKDA 3EVWA 2NCKL 3Q8VA 3FC9A 1NLKL 1JXVA 1S5ZA 5IOLA 1S59A 3NGTA 1WKKA 3BBFA 5BXIA 3FBBA 1MN9A 5C7PA 4CP5A 3EE3A 3B6BA 4FKYA 2DYAA 1ZS6A 1B4SA 1HLWA 3EMTA 3FBFA 3R9LA 4EK2A 3EJMA 4KPCA 1WKJA 1NSKL 2DXDA 2HVEA 3ETMA 4DZ6A 3Q83A 2DXFA 3DDIA 1PKUA 1VYAA 5CAAA 3WX8A 4F36A 1HHQA 1NPKA 2HVDA 5CABA 1PAEX 1S57A 3BBCA 4HR2A 4UOFA 1NUEA 1NHKL 1NDKA 3ZTSA 3EVMA 3ENAA 4ANDA 2B8QA 3FBEA 1UCNA 2DXEA 1NSPA 4W98A 2DY9A 3VGUA 3FCVA 3PRVA 4F4AA 3NGUA 3G2XA 1BUXA 1BE4A 4ANCA 1NSQA 3BH7B 3FCWA 3PJ9A 2BEFA 4WBFA 4C6AA 2B8PA 3GPAA 3Q8UA 3VVUA 1NDCA 1WKLA 2VU5A 3ZTOA 2AZ3A 3NGRA 3NGSA 3VVTA 3ZTQA 1LEOA 3EM1A 3MPDA 3L7UA 3EVOA 3ZTRA 3FKBA 3Q89A 1NCLA 4DUTA 1NDPA 1KDNA 4UOGA 3BBBA 1HIYA 4ENOA 1B99A 3Q86A 2CWKA 3GP9A 4ANEA 1F3FA 1W7WA 1NDLA 3VGTA 4UOHA 2ZUAA 4FKXA 3BH6B 1NB2A 1U8WA 2AZ1A 4O0NA 2HURA 1BHNA 1K44A 3ELHA 3Q8YA 1MN7A 1XQIA 3ZTPA 1XIQA 3FBCA 2BX6A 3JS9A 4S0MA 3VGSA 1F6TA 1EHWA 1LWXA 3B54A 3EICA 3VGVA 4DI6A
chains in the Genus database with same CATH superfamily
2M70A 2E29A 2EFPA 3L09A 5KFRA 3RBXA 4OZ5A 4PQAA 4DPYA 2G0JA 2QA1A 1JLFA 5GADI 3PYFA 2GVZA 5B09A 4C8OA 5DETA 1B0PA 1REVB 4J37A 4X4VA 3KJVB 4EI2A 2CQCA 3O3LA 4DF8A 4ED5A 4LVOP 3I55S 2FY1A 4FBUA 2GQCA 2G2ZA 1HR0J 1NUEA 5HROB 2LQ5A 1JLQA 5HMXA 5F0UA 4LF9J 2B8QA 3MUVP 2X1FA 4W98A 3ZFVA 2V8GA 2RS2A 3S6EA 4G3IA 4DS4A 5E5NA 4X4OA 3H2UB 1WJ9A 2QA4S 4ZVRB 3RBEA 3BGLA 4YHHF 1SV5B 2L08A 3CUNA 1RWUA 1T9VA 1RA7A 3TAMB 2JHEA 4WTOB 4TKTA 2LQ9A 5FLXY 1SC4B 3BB5A 1UFWA 2JLGA 2EPIA 1WF2A 4ED6A 2W9AA 4OFZA 1U4BA 3CMQA 5CA5A 3J81U 1FKOB 1TK8A 1WDDA 3BBFA 5BXIA 1XR6A 2FLLA 3HKWA 2IMWP 3KDOA 2AU0A 4TY8A 3IRWP 2J7WA 1X31C 5HQMA 3BM7A 3IRXA 5ETRA 3I9V9 1VMBA 1RT4A 2JWNA 3R7NB 2H9ZA 1Y9OA 2WB1D 5M2RA 4CO0A 1V5IB 1L5UA 5KFIA 4X62J 4O3RA 2HKEA 3LOUA 1SQFA 3I5AA 3F41A 4QBUA 3JYTB 4QWAA 5DG9A 1HHTP 3R6LB 1UW9A 4F3OA 2OPQA 4URGA 1URRA 3V6DB 2YNIA 1VHIA 4CDIA 3M8ZA 2VG6A 3DI6B 2GJ2A 5T14A 1FFSB 4O4GA 1KFDA 1E6VA 3THPA 1N88A 4HACB 2OTJS 2K2PA 2JZ5A 4NLTA 2W4DA 1RISA 2KO1A 1FXLA 2B51A 1Z2ZA 1FJCA 5A0YB 4HTJA 3EGVA 1V6HA 3U27A 5L1IA 2V6AA 3KYLA 3HHKA 1JNRB 2YX4A 5D6GA 1HNXF 4DPWA 1NSKL 4J9RA 2WK4A 1LK5A 3VF0B 2YKMA 3OBIA 4U8VA 1SJ4P 3MMBA 1XMOJ 4ERDA 1IR0A 2AEJA 1JKHA 3N6LA 2PD1A 4LIWA 2A3JA 2EK1A 3HD1A 2MZRA 2VQFF 3BH7B 2X51A 3KUHA 6FD1A 3MM8B 4ZJLA 3GR1A 4UQTA 1R43A 1HQ2A 2RKIA 2W9CA 4U95A 3MCSA 1VQ9S 1VI7A 2QSWA 2ZBIA 4ECQA 2Q3PA 1TUGB 4F2SA 3ZZPA 2FHKA 2EW9A 1KHWA 3CJ8A 4IR9A 1NBEB 3LTOA 1HNZJ 4J9MA 4YUDA 1FJEB 4RKUC 1BY9A 4ZLPA 1C0UB 3N6MA 2YNGA 4IRKA 4PEOA 3AH6A 1NO8A 1C2PA 2KFZA 2E1RA 2OD4A 1R89A 3CMAS 3ENQA 2QV6A 1XERA 4OJGA 2OAUA 1SL2A 2UXCF 1OS5A 3DYAB 1TZ0A 5E3QA 3NS6A 2HFSA 3SV4A 1XJWB 5CHCB 1S6QB 1JLGB 3C16A 2I5JB 4QZVB 1VIOA 2R7VA 3M7VA 1SL0A 2XHCA 3PJWA 5D4NA 2ASDA 4O44B 5I3UB 4WBFA 1HPZB 3G71S 1TKTB 4ILLA 2JEJA 4FZVA 4PYDA 3WHIA 2IY5B 4NZ6A 2FGOA 3OUYA 4JBCA 1S48A 4NLVA 1FNMA 4OV1A 5I42A 4EZ6A 5GMEA 4KIAA 3ZO7A 4B9UA 2CPYA 2BACA 5KFDA 4ZPDA 5H9FK 2EEYA 2E1MC 3BDEA 2XMKA 2RB7A 2VUGA 5A76A 1F2GA 3EGWB 3CJ2A 3D7SB 1YI2S 2X3DA 4RNOA 2CG4A 3I6PA 2QE5A 4NCAA 1C4CA 2Y3YA 5L38A 4I69A 3DHWC 2HFNA 4ZVFA 3A1YG 1R6YA 2EC2A 3AD8C 3TR5A 1IKVB 2YKNB 2AD9A 2DB1A 4LSNB 5D0EA 2J0SD 5F3TA 5AE2A 2YWWA 3BPDA 2RILA 4WP8A 2DRAA 3W7BA 3C14A 1X7VA 3K5NA 2H65B 3GIIA 3KHLA 1WI8A 2FVPA 4ECYA 4B02A 4EWTA 3M2UB 1J5OA 3QJJA 1CULB 2NLWA 4C8ZA 2V8PA 2VC0A 2QLWA 1FFGB 3TA2A 2RMLA 1VBYA 3GZ7A 3NS7B 4PXEA 2FQQB 1TV6B 4WWSA 2W25A 1N36J 2GA7A 4JP8A 1HKAA 5KOWA 2VFRA 3FUYA 1U24A 3M8YA 3M32B 4IOCQ 3RB4A 3QIPA 3R1LA 3KLEA 1KHVA 3CJ3A 4H4OB 4G1PA 2BRKA 1ZPVA 5KFPA 4HHUA 1C0TB 1NK4A 1JJHA 4CYUA 1QLNA 1Q8KA 2KG0A 1OSCA 5HI7A 3EX7B 1TFYA 1H73A 3ZNJ1 4NOHA 2MQQA 3JSYA 2RRNA 1S1VB 2R8KA 3L95X 2LFVA 3D0GE 3AA9A 1SC1B 3HF5A 4O3OA 3JTNA 5J1EB 1T05B 2RF2A 4J9SA 2LLZA 4KY3A 5HJXA 4OZ3A 4LSZB 1G4CA 2BUNA 1PG5B 2AHOB 1KRPA 3J7YU 2PT0A 5LMUF 5D77A 1LXNA 5LSLA 4CO4A 2V63A 3GFYA 1RHMB 1LW0A 3QT6A 3OJUA 4I68A 3GLJA 4JI5F 1WHVA 2HPUA 4A47A 5FLXU 3PX6A 1JLGA 2F3JA 1MROB 3C66A 3HZGA 5G4DA 2MLYA 3QRPA 1S59A 4YDDB 5IC6B 1P1LA 1SKRA 2RU9A 2ROGA 1RT1B 2DIVA 4OYOA 3VAKA 2QEXS 1OQ6A 3D6HB 5I3PA 4UTGA 1SUQA 4NLSA 1TL5A 2R42A 2E9RX 4M8LA 3QSIA 2AKWB 4FS2A 1RWVB 1FE0A 4HDGA 3OTEA 4OX7A 5BYSA 3FRYA 1HI1A 3MTJA 3ZZYA 3P5TL 3G87A 4JI4F 2MSTA 2CQDA 3LW5C 2KFNA 3A8JA 1NXIA 3GPAA 3DOKB 4LFCF 1Q7YT 4ECXA 2HZVA 1RYRA 4ID5A 3LGHA 4RNNA 1SPBP 4IDKB 1NPPA 3AD7C 2X1AA 2LXUA 2DGWA 2E7XA 3OTCA 1YBUA 4AQYJ 4HI1A 4DV5J 2V9WA 1PGZA 3MCNA 2BE2B 2CQGA 3PRDA 2VBXA 4KV8A 3KKFA 2VICA 2RNEA 1RTHA 3FEZA 3KG1A 3W64A 4DV0J 1J5EF 1FVSA 3TA0A 3LUYA 2OPRA 2JC1A 1HW9A 3FQLA 2HLUA 3QGHA 3RAMA 1HWLA 1KD1T 2ZVIA 2ZZNA 2P6SA 3B4DA 1PAUB 3KMQA 2Q6CA 3QFHA 1NDKA 3M8SA 2QRRA 4D3GA 3K58A 3UVJA 1DZ5A 1RTJA 2PO4A 4KBIA 2DY9A 1JJ2R 2E44A 5CH7B 4AL7A 3DLEA 4UZBA 2WRMA 2FHMA 2ACYA 1F5CA 4ZP9A 1Z1ZA 1FD8A 4P72A 3UCUP 5CCMA 3R5AA 4RLEA 3D67A 1HI0P 4NLYA 2IVYA 1WI6A 2JEFA 4R25A 1U09A 3KHGA 1U1NA 4IH7A 3DDNA 2EKYA 2I2YA 3KNGA 4B3RF 3J7Z5 2CKWA 1GFWB 1OPIA 1VHFA 1S1VA 3ZC4A 4OI4A 5C2CA 5F41A 3IS9A 4BC9A 4N41A 2R4FA 5A8KA 2AGPA 2VV5A 3I87A 4LVNP 3O5TB 4TNOA 4NLWA 4DR5F 1KFSA 3KTQA 1HBNA 5KFOA 5C24A 1X9MA 5J1NA 3W2VA 1S0MA 3PO4A 2PI4A 3C6TB 5F3ZA 4XO0A 4Y00A 2IA6A 2W2PP 4RW7B 1V3ZA 1HNXJ 2K1RA 3SDEB 1WF1A 1XMQJ 1QVFR 4XDCA 1N33J 2RQKA 2Z0GA 1RTIA 2VHGA 1S0NA 2MJNA 3VV2B 4OYWA 1CLFA 1MWQA 1YBAA 4MKVA 4QIFA 5AJ3J 4C8KA 4Q43A 4Q0BB 1KWMA 1ZPWX 1H7XA 2QA2A 1RT1A 5LMNJ 3QT8A 5KG0A 4O0NA 1HWIA 2HLTA 2HURA 2FJBB 4NX9A 2FD2A 4I2PA 1ZAWA 2K3KA 4WYWA 2YH0A 1WSRA 4X4QA 2XMJA 3B54A 4FBTA 3EICA 5KT6A 1SQGA 3DLKA 1FWKA 5KFZA 1WC6A 4TU8A 3AOAA 3CD7A 1TL7B 5DG8A 2NS1B 3LAKA 4KPCA 1RWWB 1ZM9A 2HBZB 2CQ2A 3FFIA 3W9IA 3BQ1A 3BKUA 4QOTA 4CTAB 1JJ4A 4XDDA 5C42B 4FYVB 1CJTB 3OL9A 1I94F 1X0PA 2GCFA 3PYGA 1VQ6S 2KB2A 2C2ZB 2PEBA 1KSPA 1TAQA 2NXEA 4I6YA 3L7UA 4CZCA 1GT8A 2QL7B 2IDLA 5U47A 3F73A 3E01A 2RS8A 2OFHX 4OX9F 5JXSA 3DM2B 1LNQA 4WE1A 1SJ1A 1VQ7S 3MD1A 3DXBA 4J7CA 3UDLA 4IO9Q 5CCLA 4WIIA 3TNVA 3FQKA 4IH5A 5KTQA 1KVIA 2ZBCA 4KH1B 1S4EA 3BO2A 1FKAF 5SUHA 2ZUGA 5DS7A 4K4WA 4K5RA 3OTOJ 1MN9A 4ZN1A 4C3MA 1S7IA 4DU8A 4W90B 3OV7A 2BJEA 1N32F 4Z7YA 2BM1A 3IWXA 1R8HA 3BSCA 4HL9A 1N5YA 3RBDA 4J91A 1Y0HA 1PKUA 2FVQA 3TVZA 3KK1B 1S1TB 3BZQA 1M5PC 1FE4A 2EG2A 4KTQA 3KDNA 4V19J 1AYEA 2AJ4A 1S9GB 5DZ6A 4OZJA 2WHOA 2JJ4D 2RUSA 1L3KA 4C2MA 3KJQB 4CIOA 3NAIA 2QFJA 4QWEA 5IV3A 3JSBA 1HBUB 4FYXB 2H4WB 1ZZFA 4WCEQ 1U1QA 3RR7A 2B4OA 4J9NA 4DL7A 1JXLA 1B3TA 1EKSA 5KFXA 1X9SA 2PA8D 1F5AA 4IRDA 1T9UA 1CC7A 4DG1A 3RG6A 1CQNA 1PC5A 1RK8A 3ZTPA 1ZH5A 1C1BA 3MAAA 1KLMB 3PW2A 1F9HA 1RADB 2ZNZA 2VG5A 2QN6B 2CPHA 1HQEB 4DV7F 4DZDA 3HHLA 3G8TA 2GGPA 5B0BA 5IS2A 3ENVA 3EJMA 4LF6J 4ZHRB 3A8KA 3BSOA 2B4PA 3ILLA 1RT7A 3IG1B 4XPCA 2P9CA 5KFAA 3WX8A 1QTMA 3QNWB 2OTLS 3D3CJ 2D3ZA 2OSRA 4L73A 1X4EA 5KG7A 3VAIA 4NXNF 2QG9B 2KU7A 2H48B 4Y3CA 2VKZG 4P2FA 4M5IA 4DV6F 2PI5A 2VU5A 3W66A 1EP4B 4XAKA 2RQ4A 4XK8C 3T1YF 4LF2A 5C25B 2E1CA 4OMFG 1X4BA 4USHA 2ZZTA 1CQMA 2MKHA 1EZZB 3TRGA 1L3SA 5LXRA 1TL1B 4KKOB 1VQLS 1M1HA 3F44A 1VRUA 5G0RA 2DGOA 2RJZA 2V2QA 1GX6A 2H51B 1KOHA 4DL0C 3OVBA 4PR6A 1NLKL 5GAEU 4Q8FA 1M5HA 4P73A 2ZH2A 2B43A 2HGNA 3PW5A 4JI5J 1NM2A 5HVGA 2CPEA 2GO8A 3DRXA 2IC3A 3H5SA 3HHNB 4NLPA 1FWPA 3EGZA 2Z2YB 4CNZA 2ZWOA 4EZ9A 4NA2A 2NSCA 2JVRA 1TAUA 4ATNA 2VL1A 1B0TA 4BBYA 2OKQA 1UJ4A 3IAS9 3W61A 1FRHA 2OD6A 2YKPA 1CJKA 4F4ZA 2V8HA 1IBKJ 4B3TJ 1FDBA 4O3QA 1JQGA 3G8SA 1M5OC 4RUAA 3V81A 2KT3A 1N5SA 1HQUA 1W2IA 5F8LA 5J2PA 2JFKA 3Q8PB 2DHHA 2BZ2A 5K14B 3T5HA 2HNYB 1VQKS 2MZ1A 3E2EA 1U8SA 1MN7A 4KHPJ 3WBZA 5HN0A 2MGZA 4L3KA 4JV2A 1X60A 5B0AA 4NMLA 2EFGA 1XC9A 1FI4A 3MEEB 5E33A 3FC9A 2V5HG 4CM0A 2UXDF 1RT2B 2WSCC 2F5GA 2D9OA 4R8UA 2R7WA 1HD0A 2YKOA 1IWGA 4M5JA 3TW0A 4DQQA 2WVFA 3M6UA 2KM8C 2ALYB 2F8MA 1D3WA 1UJ6A 2W7OA 4RUHA 3PTWA 4OI3A 4ZPAA 1QAJA 4CH0S 3EYZA 2BKNA 3MM7B 4GKJJ 4PWDB 2GVDB 3V4IB 1JLBB 3BEGB 4RNHA 4K8RA 4B3MF 3M30A 4DFPA 2Y8YA 4B9NA 4FF2A 3FVYA 4DFJA 1ICEB 2P9GA 1LWEB 3EVOA 4TVAB 4I7FB 2OEKA 1X4DA 1NMEB 1YJVA 2DEIA 5I4MA 5BR8F 3IR6B 5D0HA 3AXKA 5M2PA 2B5JA 4PWUA 4F2RA 5KFGA 2N82B 2MKJA 3I0SA 3PW7A 1I1GA 5KFCA 1YSJA 3TJAA 4BWMA 1X4GA 1FXRA 2W2NP 4E98A 1T3NA 1Q16B 3NOCA 3TVKA 4FKYA 3TZYA 4BS2A 2Z4PA 3D0IE 2BJDA 4A8XA 2ATCB 2HHPA 4CLKA 4QYZK 2R3VA 3MWBA 3HVTA 4GMKA 3GFHA 2KRRA 1Q78A 4DV1F 2ZE2B 4PKDB 3Q23A 4TYAA 1X8DA 3JTPA 2QO3A 3KUEA 1GH8A 2AQ4A 1NJZA 4LF8F 3M6WA 3HM9A 1YWXA 3G2XA 2BE9B 2WONB 4CO5A 4DR5J 3OSPA 2MKIA 3P45B 2XGPA 4LT6A 3R8YA 1PYTA 3FKBA 3W5XA 4WFNQ 2OPPA 5DGAA 1N54B 2DO0A 2W01A 4QIWD 4CT9A 1WEXA 3OHBA 5FDLA 3MOJB 2ZC3A 3MM9A 3FCHA 2AX1A 3DOLB 4HT7A 3N4WA 4PCQA 5GVQA 1U26A 2HRTA 2HHUA 1Z2LA 3N5FA 4IFYB 1A0OB 2B9XA 3BGOP 1U6BA 1VK3A 3OR2A 1T11A 2DNMA 2UUAF 3Q8RB 1KC8T 1N34J 1FRLA 2OPSA 2KT2A 2XMTA 2GIRA 5CAAA 4HKQA 4A8MP 2Z56B 5DQHA 4B3OA 1PIEA 4YS2A 1PC4A 4UOFA 4J9LA 1FJ7A 5DZ7A 2CJKA 5K8PA 3UD3P 4LFBF 3SYZA 1NNDA 3QO9B 2QSFA 3MEKA 2V4RA 4GC6A 4DFKA 3DGPB 2GW8A 3QPIA 2OMOA 1HMVA 2C22A 1PJ6A 5KT4A 1I94J 4K4TA 1NJXA 4MAKA 5AT1B 1U02A 3QLHA 1H74A 1YJNS 2CQIA 2W24A 1S10A 4E0DA 3AJDA 3KJFB 5KG5A 4ALZA 5F9LA 3CCRS 3M1VB 4RPFA 3ELHA 1G2EA 3OW2R 2XLKA 2FJXA 1RTDA 3KHHA 3VQSA 3CDBA 3RYLA 1RGVA 2YQ3A 3QAEA 1VBZA 2VPWB 2MDAA 5H9EK 4V19X 4LF1A 4X65F 4N76A 3SXLA 1U1PA 5D15A 3DLLQ 1ZS6A 4B3SF 4ZK7M 2KRBA 2KT5A 3B78A 1FKPB 3AQOA 1P9QC 3C3LA 4DUZJ 2IBKA 1K0TA 2H5EA 2C28A 5K8MA 5IXUA 2KFYA 5IT0A 1RHQB 1S0VA 5HMZA 2OGUA 1L3UA 4EFAC 4Y65A 1SCJB 1FO1A 2BKPA 4CNYA 4YMEA 2VONA 2VOPA 3VZHA 4U96A 4HH1A 3CJQA 2RD5C 2XLJA 3KHRA 4XTTA 2XZTB 2GQQA 4KGXB 1Y7PA 4Y2IA 1K8AT 1XIQA 5J2MB 3MGJA 1D9AA 4LBPA 1VR6A 4WFYA 3T1AA 1Y5NB 3OL7A 3TOQA 4JV1A 4WU3A 2KN4A 1OY9A 4JI2J 1HLWA 1D8YA 3FEYB 5EGYA 4GC7A 4Y6IA 4JV5F 3D1HA 3GONA 2B7BB 1VQOS 4R5PA 2QTWA 1UEVA 1VYAA 1NPKA 2E5LF 2HVIA 4ZP7A 5HJYA 2J5AA 2M8DB 2NQPA 1IKYA 3P6YC 5F8JA 2FVCA 2O5DA 1BUXA 3MXHP 4OYIA 3BPSP 4MJKA 3TUJC 2C2NA 2QL5B 2O1PA 1FNOA 1RHRB 2L9WA 4AE5A 2CQBA 4USWA 5DDRC 1XR7A 2E1PA 2DNYA 4MKBA 1YKWA 3VHQA 1VISA 3PYDA 3CO0P 1KQSR 4A8KA 4LREA 5BYRA 1VQPS 3MD3A 3TUIC 1HHSA 3U1MA 1B70B 1WKKA 1RU1A 2BW7A 1BQMA 3NBPA 2DKOB 1UA1A 1T94A 2C3UA 3CF5Q 1E6YB 2LA4A 1RXOB 3AOBA 3BO3A 4DV2F 3FBFA 2IAJB 2W9BB 2QIFA 3K59A 2IBOA 1KVJA 3L7PA 4JI0J 4QWBA 4HEA9 2N4DA 4OYXA 1EARA 1JLEA 4ECUA 4OX8A 4NZ7A 4NLXA 1WEZA 4ECWA 3TZXA 3NGUA 4ZMMA 3MURP 2B56A 3OJSA 5KT2A 1WOPA 3W9HA 1ZA1B 1K1SA 4L3NA 1YGYA 3PIOQ 4C3KA 3MR2A 4IO1A 2BW2A 4KE5A 3R97A 3X3UA 5HO4A 1NHUA 3LH2S 3N01A 4Q2LA 2DH8A 2RQCA 1Q7LB 2LMIA 3G6ES 5MLCV 4CCHA 3C6UB 2HMIB 1DURA 3SSRA 3MMAA 2QGFB 2MZQA 4TY9A 2ZD1B 4M63A 3HLUA 1RZMA 3VGVA 4CLPA 2VG7B 1YZ6A 2FC8A 2C2EA 1FHTA 1TMMA 2DCUB 1HARA 2V9KA 2DNRA 1B4SA 2GMHA 2FVRA 1AA1B 2EBEA 4ZVOB 2F4VJ 4QU7A 4FVMA 5ETPA 2XI2A 3VTIA 2UXDJ 4FYWB 3M05A 3MCOA 2XSJB 2LEAA 1NKBA 1TUVA 2F9DA 4XPEA 1RDRA 3TEHB 3P96A 3WX4A 4RBUA 4H54A 2V0NA 4OI0A 3VVTA 3DRSA 1RAIB 2ILZA 4RW9A 4C98A 4M5MA 4R0JA 3BN4A 4ES1A 3W2WA 4KGMA 4GVBB 4WPAA 1XBWA 2B0GA 2LEBA 4YQWA 2KKHA 4MK7A 2VZ9A 1UVNA 4Q2MA 4QJVA 4TU9A 1MMNA 2CQ4A 4YEAA 3H42A 1QY7A 1N5TA 2MMYA 2NCKL 2D74B 2KJWA 2XG8A 5BR8J 1X5TA 3N5BA 2V4JA 1O51A 2NZCA 2ZVSA 5A6WA 1NJYA 3NXZA 1FD2A 1Q8IA 2ZM6F 2XY5A 2HHTA 1CJUA 1GX5A 2HVDA 1R8AA 2K3IA 3M8QB 5HMWA 5KG4A 3G4SS 4Z37A 4IOBA 4RJVA 3MR3A 2C2OB 3KUGA 3V6HA 1SIZA 1UA0A 5ETOA 3Q24A 4ED1A 4RW4A 1KTQA 2BOPA 3MMCA 1T95A 2E9TA 2JRSA 1VJQA 1B99A 2GC8A 5A8RA 4WP3A 1R7IA 1OY8A 2UP1A 3KLGB 1C4AA 4G1QA 1FDAA 1Y11A 4NCBA 4Q7AA 3TX0A 4ZLLA 1FEEA 2HHQA 2R7XA 2Y1RI 3SQGB 1XNQJ 5F8GA 1HBMA 4CO3A 1IKWA 3SCJE 2BRLA 1HNVA 4NA3A 3OL8A 2XZDB 1JXEA 2CPZA 2LP4A 4F3MA 4DCOB 1XMBA 3KLHB 2PIIA 2LU1A 4OZLA 3Q83A 4USMA 2C2MB 2UVRA 3BKTA 2M0GB 1Q79A 2JFDA 4P71A 3V6KA 3GJSB 3J7AN 4F36A 3VAHA 3FEXB 4F8RA 3GG0A 2XB2D 2R2SA 5EWFA 4V1Ak 4N56A 1JLCB 2GMJA 1D0EA 3GFXA 2QX0A 4X4NA 3PCOB 4DR1F 3CCLS 5KG2A 1MLAA 2Z2ZA 1R0AB 1M1GA 2HVHA 3UI3A 3D1QA 4B9MA 4CH1A 5IQ6A 2HGMA 2D3OR 4ICLB 4DR3J 4JI7F 5IZHA 4F4XA 4TQRA 4M5DA 1Y3JA 3E51A 1PBUA 5LOQA 1KTVA 2I38A 4R0EA 3X1LB 3T9ZA 1HD1A 1RJJA 2MKYA 4OV6A 2R8GA 4DDFA 2CUYA 4CLSA 1ZM4A 4LF4F 3AOCA 4C97A 4USVA 4ITSA 3SCKE 3UFCX 2M2BA 1GMVA 4RR5A 5C7PA 1DTQB 2ZBPA 2R9LA 3HX9A 1WELA 3J7YI 4DR7J 3I82A 2COLA 1F2HA 3EMTA 1LV5A 4WJBA 3D1OA 3TWZA 1IR2A 4P2MA 4LR7A 3ZZZA 2VDHA 3CJRA 4MT1A 1RQ0A 5JMNA 1U49A 2QT7A 2WVEA 3UN3A 3AB4B 1R31A 3PW4A 1UWAA 3MEDA 3EVMA 1EB0A 1QVGR 4IQMA 4DN9A 5CYMB 4B3SJ 1FK9A 2QYGA 3UCZP 2V8VA 3KWMA 2X1BA 3DRPA 1HBOA 1UMJA 4NA1A 3HHLD 2GMLA 2MQMA 3KLFA 3D9BA 3CCES 4Z2XA 2UUBF 1LW2A 1S79A 4QR2A 4OLPA 4ZS6A 3BH6B 1UKUA 4IFVA 2HQGA 1N0VC 4DLGA 1WF0A 1OY6A 2KZMA 1DQAA 3MUTP 1RWNB 2HBQB 4A4JA 4RWWA 1S6PA 1KQGB 1LWFA 2WCXA 3NGTA 3TZZA 4BCAA 3IXQA 2R7RA 4Q44A 4PPDA 4IG3B 1UWBB 1V3SA 3R9LA 2PMZD 4DR6F 4QIVA 3H25A 4K5SA 3SSQA 2NXCA 1CS4A 3JXOA 3CCQS 2FLNA 1RBOB 3A8IA 3KK3B 1B0VA 2DNPA 2GJFA 2C2KB 1KOOA 5IC4B 1FRKA 2R8HA 3TVYA 1NSPA 2HAIA 3I32A 4JI8F 3D5MA 4JV5J 2QLBB 2HFZA 2VJUA 3CJTA 3RB3A 1UVJA 4BC7A 3OSNA 4ELTA 2BDPA 2E5LJ 2HZAA 2AJ1A 1EJ7L 4USUA 2DBBA 1LFPA 3M8RA 3T5KA 1JB0C 3CW2C 3UPFA 4U8YA 1TL3A 2XWYA 3ITHB 4NYOA 3HCXA 3VCDA 5GAGU 2CZ9A 1S9EB 4DV3F 4OX6A 3DLGB 1P6TA 3HHLC 3CWJA 4USIA 2RRAA 3UO0A 2AJ2A 1LFWA 2J6TA 4N8NA 3C15B 3WDOA 2WOMB 4A8OA 2ZJRQ 1CJVA 4ECSA 2J9DE 4C3LA 2J7KA 1KQFB 1S7HA 3LF0A 4AXJA 2YPZA 2P8IA 4Y28C 2CAJA 4CLYA 5ITHA 1K9MT 4K7QA 5ETVA 3SI8A 3M2RA 1QUPA 3QMQA 4AD6A 1X4FA 1S1UB 2ZBRA 1JJCB 3UNYA 1GMWA 2HFUA 1RKIA 1VS3A 4HHHA 3TEGA 3OVSA 3QJLA 1NK0A 3NOGA 4C0BA 5THWA 2F8EX 4PQUA 3NGRA 2AIRB 4K50A 5DDPC 3MUMP 5LJ3Y 4JI3J 4DSIA 5F9NA 1R0BG 3PX4A 2ZUAA 4M5LA 1AFIA 3HSDA 3A3PB 1U45A 2YWKA 1WNEA 1LWXA 4OL8A 3DC2A 2ASJA 1FJGF 4OYPA 2XWXA 4NCGB 3DHXA 1AZSA 1U47A 4ZVTB 3PG9A 4LRAA 2IYGA 2R7OA 1MMDA 2JNJA 4C8NA 2G13A 3KK2B 2FLPA 1RWMB 4FNIA 3JSMA 1ULRA 3GB0A 1NK6A 4K4ZA 4QWCA 2DO4A 5IWAF 1X4HA 2VBYA 4LF5F 2HK3A 1WUUA 3H90A 1WC3A 2VIHA 2AJFE 1ZA2B 4RW8B 4UQGA 2WBRA 1IR1A 1TVRB 4GO7X 1SXLA 2MB0B 4WXOA 1HNWJ 5L1KA 4TYBA 3VAGA 3H98A 2Y1LB 4DCJB 9RUBA 2RUGA 1N48A 1U8WA 4MFBA 4LF7J 4K0KJ 1OMSA 2MQOA 1K44A 2ZHAA 4TLRA 1D9DA 1CSJA 2PA3A 5HBMB 1DTTB 1U1MA 2K06A 3AXMA 3AODA 3O44A 3DKDA 3Q8VA 2DNNA 4LSLA 4I2QA 4DMZA 5HVHA 4OJ1A 1NKCA 3R7SB 2KYZA 4OLOA 4DLEA 1FXDA 2XC9A 3M9OB 3P8BB 5IQQA 2RDIA 4X4UA 3T5JA 3W1YC 3MPVA 1GK8A 4O3PA 4NLUA 4KSEB 4Y2CA 3GIRA 3NY0A 1G1XA 2YNHA 1RT5B 2VA2A 4AXIA 4GKKJ 5EX3A 1VRTB 4F3QA 4CLTA 4I0WA 3S01A 3TQ1A 1SI9A 4JYAJ 2YWFA 3HD2A 1T0TV 1RBAA 2BA9A 1TKXA 2DGUA 1PO6A 3RB6A 3KLIA 3ZTOA 3DGVA 1ZZNA 2IVMA 2QZ8A 1VJWA 1YJWS 5A6PA 3N0VA 1NB2A 3G82B 3G9CA 1RUSA 1FX4A 2XCPA 4M5NA 3ET6B 2GZOA 1S9FA 3M2VB 1O5JA 5KT7A 4PABA 2E5HA 4OHWA 3ISZA 3NGKA 2JLFA 2HBRB 3IR5B 3LP0B 4ECRA 2XHWA 2V2VA 3OR1A 1KBRA 1SH0A 1DAXA 2Y1JA 2DT9A 5KT3A 2V34A 3HPOA 3US5A 4NLRA 4H4MB 4ZN3A 3RUBL 3UDEA 2XS5A 1MU2A 1IKXB 2B9WA 1OQ3A 2M9KA 3VQTA 1FVQA 5A8WB 2QC3A 5B0GA 1IVZA 3ZXWA 1H38A 3HT3A 3H4BA 2YY3A 1YJ9S 1K47A 3O1LA 3MM6B 4YR2A 4ZCLA 1HIYA 1U7LA 2L3MA 5D8HB 4ELUA 2ZH3A 2YNFA 2BABA 2JSXA 1S1XA 2V4QA 2HHSA 4BHQA 1T03B 5BJRA 3Q8QB 1WC5A 2RDDA 2DJWA 4JI7J 3HFKA 3RW7A 1ZBTA 2MY8A 4DPXA 3B82A 4C48A 2UUWA 3MTKA 5L9NA 2DHSA 5T7LA 4OI1A 2DNGA 4C0OC 2ADBA 1TMJA 1MMLA 2BM0A 1FERA 2E5IA 3K5MA 4LF4J 2VFVA 4F4YA 1IBMF 2J9CA 3M8PA 1ACMB 1GNKA 1PJ5A 4Y2MA 4YY3J 4PYAA 2NPIA 5GAEI 3GYGA 3PX0A 2FYXA 2PC6A 3JAMU 1TKZB 2W2MP 4NMXA 1WHXA 2A1BA 2V94A 4U6PA 3KJNB 1KP6A 4C11A 1RWOB 1ZM2A 2Y1IA 1EETA 4NYPA 3VGTA 1UETA 2MJUA 2AJ0A 3PW0A 5HP1B 2IFXA 1BD6A 1FA0A 3K5LA 3GWCA 2HSEB 2WBMA 3W9JA 4A8QA 1V5VA 1SH2A 3DOMA 2G1HA 4HTIA 2I0XA 9ATCB 3DMJA 1FNXH 1WG4A 1XNRF 5E3AA 1N6QB 4DS5A 4DUYF 5KFEA 3MM5B 4A8WA 1VRTA 3BGRA 2XS7A 2DCLA 4KFBA 3K7RA 3RAXA 3PEHA 4RBVA 4NL5A 2XYGB 2P2CB 1X5PA 3NGDA 3BBCA 4HR2A 1U1KA 3DNCA 3HK2A 4NRUA 3HVWA 2BR0A 2WTFA 4FXWA 1MWYA 2CG8A 4DL3A 2LYVA 4RWXA 4DR6J 1HNIB 2LCWA 1RAGB 4HHJA 1REVA 2B8PA 4J9PA 1Q86T 2YQ0A 3KJVA 3OFGA 4NLGA 4IYQA 4C8LA 2XO7A 4YB5A 3H59A 3POTB 2HQIA 5L46A 3M2VA 2VDIA 2D3O1 2UU9F 4N47A 3LP2B 5KFBA 2ZWPA 4RU2A 5HROA 1U0HB 4F04B 1YITS 4CRJA 4F4WA 4MK9A 1U1LA 2DHAA 2QYCA 1JX4A 2B6AB 4QR1A 3OXLA 2GS8A 2CDRB 4UY85 3CD6S 1HYSB 5B7WA 2R2UA 1QE1B 2MEWA 2HWIA 3HHEA 1TTHB 3QGPA 2OI2A 1SV5A 4M5KA 3FBBA 3TAMA 1S1WB 4DL5A 4OJ3A 2O3DA 3UNGC 2GJIA 3IFEA 2E66A 2KI2A 5L1LA 2UXBF 4G1IA 4LBIA 1XWLA 2CDQA 3JTOA 3GCXP 1RB0A 1FKOA 3CNQP 1IBLF 3BYPA 4F67A 3T1HF 1SJ3P 3GYNA 1Q53A 3VVUA 4Q45A 5C2GA 1AUSL 2HZCA 3CJKB 2ZH6A 4NE9C 3QT5A 2DK2A 2N3LA 3LP1B 3K17A 4DQPA 3K8WA 1RT3B 3TJ8A 4WIQA 1YJ7A 1YK9A 1F6TA 1FFWB 4MH8A 3OFEA 4IR1A 1KS2A 4KR0B 2C1EB 3Q22A 3H0PA 4BLGA 3JYTA 5ETLA 3CXCR 5AXNA 1LKZA 3V6DA 4X64F 4LMZA 4QU6A 3DI6A 4WKRA 2CWXA 1HR0F 2QMUB 4HACA 1RWXB 4LF9F 4LUBA 5A0YA 4DR2J 4IG0B 2G0IA 2CXEA 4ZVSB 3WIVA 4X4RA 3TUZC 2YTCA 2BYCA 2BMBA 5HLFB 2HNZB 3Q2TC 3FNNA 3MEGB 4CWBA 2AYMA 1CBKA 2FHOB 1KDNA 2BOAA 3W5ZA 4O4RA 4RW6B 2C2RA 3IP0A 5L9XA 2NZ4A 1SQEA 1RLDA 2DGQA 2WVCA 2CZ4A 3FZBA 4FPRA 4LRDA 4LFAF 1TL4A 2NXUA 4DV4F 5IM0B 2GAHC 3IO1A 4NPOA 1EHWA 4C7QA 3MM8A 2HBYB 2CA9A 3IN5A 1RT6B 2YVSA 5J2QB 3ZZOA 1L3VA 1BQNB 3L7OA 5GAHU 1AUDA 2KH9A 1C1CB 3LWLA 3OL6A 1D9FA 4ZA1A 4OHYA 2HS4A 1NHKL 2FJAB 1C0UA 3FJ2A 1S0OA 2Y9HA 2HQCA 4EMDA 4WK3A 2HHXA 2F1FA 2AV5A 2OELA 2H5JB 3M6VA 3J7ZT 3LALA 2CJ9A 2ZC4A 3NL0A 2PFFB 5CYQB 5J2NB 3DYAA 1ZETA 3CD0A 1S6QA 4Y2AA 4KO0B 4UOGA 3CMES 3OTDA 4ENOA 2O67A 5ETMA 2I5JA 3I96A 1AT1B 3I0RB 3BN7A 3BGFA 2Q6BA 4DL2A 2NREA 4PUOB 5D3GB 4KH0B 4EYHB 4X66J 2HQ3A 1TUWA 3VZIA 4O44A 1UW4A 5I3UA 2ERRA 2FUG9 1HPZA 1CVJA 3LA0A 1A7GE 3DU5A 2DPJA 1TKTA 3UD4P 4KPYA 4OYBA 2XMMA 2FPHX 3D28A 3T5LA 3CC4S 2WSFC 2DD8S 5SZTA 3A13A 4JI6F 5IT9U 3MR7A 1JLAB 2VF3A 2RDJA 3E3XA 2B4VA 4PG4A 2KG1A 2AJQA 3CJKA 3NMRA 3NNCA 4NI2B 3GCWP 2J8SA 4I56A 2Z2LA 1LWCB 3EXCX 1QTNB 2BE7D 2HRYA 1RHJB 1H2TZ 4ZVEA 4QWDA 4WFZA 2G1DA 1Q8LA 3ETOA 2PDAA 3CDEA 2VODA 3ILOA 3OXFA 5CQGA 2EKNA 4YHHJ 3ILJA 1X5SA 1TQLA 2XO6A 2VFUA 1IKVA 4FKXA 2YKNA 4ZIVA 2KVQE 4LSNA 1N5QA 3IBFB 2UUCF 1PBAA 5KFHA 1HNZF 3G8QA 1URNA 3MECB 1UVIA 1J27A 5KFTA 1S77D 1M5SA 3W8GA 4MIWA 3LAMA 2V50A 2B4UA 1IBCB 1Q8BA 4RUCA 3M2UA 1DLOB 1CULA 2VPZB 1WTBA 3RBZA 2HRUA 2RHSB 3NRBA 2HAFA 4NEYA 1FRJA 2AGOA 3FRZA 4PG8A 1TV6A 3TX8A 1Y5LB 3CIZA 4F0MA 3M32A 3OPKA 2HS0A 3QGGA 1S49A 2XY7A 3L4BC 4H4OA 1IM6A 4DL6A 3EZ5A 3OD2A 1C0TA 3GV5B 5ETKA 2ZDPA 4QPXA 1IUJA 1JLFB 2MKCA 5ETQA 4LQ9A 2GVZB 3DLJA 2CQHA 2HFOA 3AB2B 2EG1A 3D54A 1YVFA 2BBEA 1W2BR 5J1EA 4QW8A 1T05A 1WC4A 2KM8B 2YWEA 3UN2A 4WZQA 2VASA 3SBMA 2QLXA 2W2OP 1JLQB 3I5BA 1S76D 1OJ4A 4LQ3A 3WC2A 2AEMA 3MPWA 4HLBA 3PKYA 2I1RA 4IKAA 4F0HA 1FRMA 4ZCMA 1RAFB 4B9LA 1K1QA 2DNQA 3R2CJ 3DCAA 3EPGA 3GJQB 3MPUB 3TP2A 1MROA 2GFFA 3G96A 1NJWA 4WXWA 3I0RA 2DXEA 3V5RA 1F5BA 4F50A 1ITPA 3PRVA 4TN2A 3RJMB 1S6UA 3QWPA 2VQFJ 5DDOC 3IMQJ 3EM1A 4IOAQ 1U6FA 1QDUB 1NHVA 2CPXA 5AXMA 4HDHA 1NDLA 3P3DA 3DU6A 5KFFA 4TY8B 1I6JA 2IYIA 1N36F 1RABB 2OSQA 4I4BA 1VCTA 5HMYA 3DOKA 1GMWD 3IRXB 3J81j 4ES2A 1RBLA 1YLXA 1PCAA 1RT4B 4YFUA 2R2TA 4IDKA 3NCPA 2R8IA 3MZIA 2W4CA 1MSWD 2XULA 4EYIB 4U67Q 2CPIA 4MK8A 4C4WA 3WC0A 2XZWA 1YRTA 4TXSA 4FS1A 2NYHA 2UXCJ 2BE2A 1Q4RA 4MIAA 5F0WA 4NLQA 2BKOA 3LGMA 1SKUB 3M9MB 2X3GA 3PRBA 2OPQB 3IWLA 2YNIB 2VG6B 3NNHA 3UE2A 2RAQA 1VGYA 4O4GB 3AFGA 2A2CA 3AHPA 4KT0C 1E6VB 4AL6A 4LR8A 3FCWA 4GVLA 3FMBA 1OWXA 2Z30B 5HANA 2YX1A 2CQ3A 1UFKA 1OIAA 2Q1LA 2DY1A 1WG1A 4U9RA 2W7AA 1YTYA 1TP7A 2N3OA 1F3VA 4MYTA 2YKMB 1JNZB 2MZJA 3VGSA 3MMBB 4PZVA 2XQCA 4K4SA 1WHYA 1H7WA 2IJFA 1JKHB 4C0HA 4RZRA 1M0SA 1WACA 5KFNA 1UTAA 2DXDA 2AEFA 2RKIB 2W9CB 1RKJA 5AE1A 4ED2A 1YDLA 5CABA 5B0CA 1B7YB 5JVHQ 2WVDA 4FXDA 3MOZA 2R2RA 2Y8WA 4F26A 4X64J 3K57A 2IHR1 1CEZA 1HWJA 4F25A 2YNGB 2XSFA 1H2VZ 1A6LA 2XYHB 3BR9A 1IXKA 1KKHA 4X84A 4H4KA 2KDOA 4K59A 3MFHA 4AQYF 3RW6A 3C6TA 4DV5F 5IV4A 2XS2A 4NXMF 4J9OA 1Z4UA 3ILIA 4J5OA 4BWJA 4RW7A 4FYDA 3SFGA 5DJBA 2KL8A 3SDEA 3LGNA 3C16B 4DV0F 4CQ1A 3HMJG 3IA0A 3H5XA 3QFWA 4QCLA 1N56A 2KHCA 2ROPA 4Q0BA 5CD4A 4K4VA 4LFAJ 2OP5A 4DV4J 1K0VA 3CTRA 5DLGA 5HQLA 4DSJA 3ETMA 3O6QA 1WC0A 3SEOA 5AXLA 2L9DA 1HHQA 4C8YA 2DR6A 8AT1B 3M8WA 3OUYB 2FDNA 5EHHA 3T9NA 5CYJA 1AB8A 2PFDA 4DSFA 3U1LA 5I42B 1Q1KA 4DSEA 3GG1A 3H4DA 4JI1F 1TL7A 2DRBA 3W63A 1SJRA 4AUKA 2FTRA 3TZWA 3ZTRA 4CTAA 4Y2KA 3FDSA 4UW2A 5C42A 4MIBA 1M1KT 1CJTA 5LMUJ 3Q86A 1QAYA 5MAOA 4AFFA 3QZ7A 2QLFB 3CT9A 2AW0A 3PJXA 1RCXB 5B0FA 1SL1A 2IRXA 3PYEA 2W2QP 3CIMA 3PFOA 2MTLA 1EKRA 1JXVA 1RHKB 4O0IA 1S5ZA 5K5MA 4K4YA 1K73T 2RQMA 4ZKAA 2BXJA 2DGVA 1FWLA 3V2UC 2J0QD 1RE1B 3NP5A 4DEZA 3CB4A 3DM2A 2XNQA 3EZOA 3C14B 2HVEA 3GU0A 2VQEF 2H5IB 3BV8A 3KFWX 1YJUA 1F9FA 1J5OB 2ZEJA 1FTRA 5ETTA 2IPOB 2D69A 1DJ0A 2EK6A 4JI6J 1IN0A 4JI4J 2FHJA 3HP6A 4J9KA 1NJIT 1HWKA 1XMQF 1BE4A 1VK8A 1N33F 2DNLA 4C6AA 1AXQA 3MDFA 4LFCJ 5KFUA 1EX8A 3DFEA 5AJ3F 3QIPB 3KK1A 3S8SA 1NK9A 1S1TA 3KLEB 3B4MA 4X4TA 4ANEA 5M2UA 5LMNF 4JOUA 3GJTB 2AX0A 2MQPA 1S9GA 3FSIA 4CYUB 4RBTA 3LQVA 2ZKTA 3CCSS 4PAAA 4MYUA 1ZTTA 1YRUA 1X9WA 3JQMA 3R5CA 1HBUA 3R1HA 1J5EJ 2XM3A 2J6UA 3K0JA 1OPZA 2W1BA 2F4FA 3SV3A 2RF2B 4P9SA 1OYEA 2UUCJ 4YR0A 2PSZA 3I4PA 2KXHA 1XEZA 2DGXA 2VJVA 4OHVA 4N77A 2RIJA 2CRLA 2OHDA 2N7CA 1NZ8A 2K8GA 5GAGI 2BANB 1KLMA 3TARA 1GXTA 1DQ9A 3BSNA 3CEDA 1LW0B 4RO0A 1HQEA 5CD4H 2H4YB 4ECTA 5H9FJ 4ZHRA 1LQ9A 3DN9A 2JOQA 3UR3C 4O3SA 3IG1A 3TANA 4UT4A 2EC0A 4P7VA 2WW4A 2UZAA 5KAKA 4ED0A 3I4HX 1SH3A 4DX8H 2ZNYA 2W7PA 3L9ZA 2BJ7A 3AQPA 3T19A 5HSPA 3LWMA 4DBQA 3MFIA 1SVDA 1SUQB 3PEJA 4X4PA 2WZ1A 4DCPB 1VC6A 2I9SA 1KEKA 3CD5A 3KOAA 4B3RJ 3HDSA 2FLOA 5E3RA 1EP4A 2CFXA 3A4TA 1RAHB 5C25A 3OTOF 2XY6A 2N4CA 4B9SA 2U1AA 3BQ0A 3PIPQ 4MMOA 5E0OA 3IM8A 1KQKA 1TL1A 3AY0A 4KKOA 2A0FB 8ATCB 4M1KA 5D4LA 4ID5B 1T9TA 3VAFA 1BWEA 4USTA 2R7UA 1QSSA 4IRCA 3K8VA 4KGZB 2Q66A 3LANA 5GMKa 3W8PA 2HIYA 4P2XA 2AGQA 4KAIA 4FDFA 4KV8B 3PKMA 1RTHB 3MCMA 4HI2A 3QRRA 2OPRB 2GHVC 5EDWA 4TLQA 4K4XA 1BWVA 4RNMA 2YBVA 4TU7A 2YXLA 3QRQA 1VQ5S 4DHVA 3PR4A 3QIDA 4WK1A 3OTBA 2DTJA 1RI7A 3UN5A 4J9QA 3GFZA 2FZCB 4AL5A 2PMHA 4O23A 5B08A 3UVJB 1RTJB 1S72S 3QBCA 2ZH5A 2RSQA 3DLEB 1RHUB 3RAQA 5K14A 1V3RA 5HQ8A 4LF6F 2JVOA 1T9WA 2HNYA 1GXLA 2XMAA 3MI7X 4L76A 1HWUA 4ED8A 2JEGA 4DPUA 2CJAA 3D0HE 2GX8A 4AT1B 4K2XA 3VR1A 2DGTA 3MEEA 2AF6A 3FBEA 3CCTA 2HHWA 1VQNS 2AYGA 1P27B 3QATA 4DR4F 1IWAA 1RT2A 5JJBA 3VALA 5ETNA 3Q8UA 1XN9A 3HSJA 2DNZA 4DUTA 3FK4A 2HHHF 3IWNC 3U02A 1NH8A 1ZM3A 3IS9B 5F8HA 5K8NA 5LM7E 2XMUA 1H6KX 4OX9J 3MM7A 4UUWA 6FDRA 4PWDA 5A8KB 3CJSA 1HL6A 1RAAB 4WU2A 2FB0A 4PG7A 2GVDA 3V4IA 1JLBA 1KLNA 2EFQA 1HBNB 2BX6A 5C24B 1AFJA 3T3FA 2BANA 5KFSA 3W2VB 1LWEA 4ZVHA 3NS5A 1UP1A 4I7FA 2K1RB 4OHZA 1N32J 5KFVA 1SKSA 2FJWA 2ZFHA 1U6ZA 1RTIB 2ASYA 2B9YA 1YX2A 4M94A 4YN3B 5AE3A 5DM7Q 2C3PA 3BR8A 3QYYA 3I5CA 2NUUG 2H1YA 1SJQA 3TAQA 4NRTA 5EX0A 4ZPVR 4U7UD 3MMJA 3N28A 4I2PB 1IBKF 4B3TF 5LL6d 1UVMA 1PYOB 3NGSA 1Y4ZB 3DLKB 1IJFB 1FEHA 4ZVGA 3OFHA 2VBZA 3SCLE 4Q8EA 3D3BJ 2XGQA 4WFXA 2ZE2A 3FFIB 5KG6A 1IQTA 4KHPF 2WONA 2F8HA 3QWUA 3TI0A 5DGBA 5HAOA 2LXFA 1LOUA 3UDVA 2F9JA 4DV7J 2EFOA 5AXKA 3AJ2A 4NXMJ 1R27B 2KZZA 4ZCIA 2DNKA 4DX6A 2K7JA 2CNNB 2ABYA 3DOLA 3K5OA 3E01B 5KOXA 4GKJF 2FC9A 3ENAA 3T41A 4NXNJ 6AT1B 4IFYA 4WE1B 1A9NB 5LSOA 3MF5A 1TFWA 2DHGA 1SBRA 1H98A 2ZDOA 5KFQA 4DV6J 2ZKUA 2HIQA 2LEPA 3T1YJ 3C2PA 3N9UC 1QJHA 3BQ2A 3FZ2A 2CQ0A 2CJBA 3S7RA 4UOHA 4JI1J 2CIMA 4RX6A 1N5YB 3QO9A 1BHNA 4X4SA 3WIUA 5D0RA 2FZGB 3DGPA 2VBWA 3CSKA 2DNHA 2M88A 5DM6Q 4ID8A 2PN6A 2ZBQA 4FN5A 4E8UA 4OI6A 4CH7A 4Q5VA 4I6WA 3CCZA 3KMSA 2HG4A 3W60A 1ZAXA 4P75A 3M1VA 3NAHA 4EUVA 3P5BP 1NK5A 3MR5A 1U2FA 1MWZA 3EGNA 3KNAA 1NZAA 2BJ9A 2RT3A 4DG1B 1MG7A 2RH3A 5F8MA 4PXDA 3FMWA 1C1BB 2VQEJ 3GV8B 3MAAB 4ECZA 1FKPA 1WKLA 2VG5B 5HL7Q 3W62A 3HHLB 5LT5A 4K2JA 1CG2A 1YJRA 2GGPB 5T41A 2QFIA 1U1OA 1ROFA 2C42A 2D7SA 1NH7A 4OHXA 1RT7B 1T9YA 3Q8SB 2HQDA 2MHNA 4RUBA 3K5PA 2MXYA 4G6VB 3RB0A 2RRBA 2BJ8A 1WD6A 2ZH8A 2M8HA 3EE3A 3NMAA 3A3OB 2DYAA 3CCUS 2DR8A 1V9OA 2X7IA 1N34F 1B64A 4O3NA 3PY8A 2MY7A 5J2MA 2B7CB 4ZOSA 4LIRA 2N7YA 1D1UA 2CQ1A 1UEKA 2E1AA 3R27A 3NWGA 1UCNA 5KFLA 1VRUB 1U48A 5G0RB 2V69A 3CCVS 2A2DA 2FGCA 3A8EA 4B3MJ 2XNRA 2HS3A 4KRWA 2IM2A 4KHMA 2IRYA 1X5OA 5HK4A 3QGIA 5D78A 4P74A 3OHAA 4P52A 2CJYB 2RVJA 2IC3B 7FD1A 2MLXA 2W8LA 5CZXA 2CJXB 3PR5B 2ZOFA 3GR0A 3IBCB 2ZH7A 3O2IA 2OEMA 1O0PA 3EXYA 3CC7S 2UVUA 2DR7A 2Y0BB 1CJKB 4ECVA 3I9ZA 1UJ5A 2ZJQQ 2F63A 3RRGA 2IM3A 4DUZF 3V81B 3ULHA 4LRFA 4M95A 1HQUB 5K9FA 3Q0AA 5J2PB 2XTJP 3AA8A 1VQMS 2L41A 2OIHA 3MPYA 1RAEB 4DV1J 1UVLA 2DR9A 1TU0B 4WKYA 4LF8J 3CO9A 1YRXA 4ANCA 1E6YA 1FRIA 2MGZB 2VFSA 2IAJA 2W9BA 1FX2A 2CNOB 5GADU 1HW8A 4M5HA 4R8UB 4CLZA 1T02A 3CPWR 2RU3A 4DX5A 2KTQA 3Q8YA 1I5OB 5B0DA 4PRFA 2JC0A 2VH7A 3PM9A 2GHWA 2F40A 1WOOA 1U25A 3NEKA 1U2CA 4JI2F 3D6TB 5JUMA 4RL1A 3M30B 3MHYA 4HVZA 1UEUA 2UUAJ 2VFTA 1RSCA 3PO5A 4RU9A 3W65A 4ETXA 3C6UA 3GSIA 2HMIA 2MKSA 2ZD1A 1KVKA 2V68A 2VG7A 2KXNB 2B5JB 2MQLA 4LFBJ 5E3CA 3I0SB 1RP5A 4KHRA 2K7KA 2CPFA 3TA1A 2M7SA 3CDAA 2H3EB 2GIQA 5GAHI 4P10A 2AZ3A 3ZTQA 1DHMA 2NUHA 4ZITA 2MHEA 1RWPB 4NLDA 3ZZ0A 4YB6A 3BBBA 4DR4J 3B8HA 2XSJA 2E5GA 4J90A 1SC3B 4ER8A 1H72C 3CDUA 4LBHA 3H2LA 3HVTB 2XYPB 2NPFA 2HHHJ 2KVIA 2Z2MA 4MTPA 1ZTWA 1G7CB 3CJ0A 4L6V3 1VRQC 4N7TA 5LJ5Y 4MKAA 4K4UA 2F65A 4X65J 5C5JA 4GVBA 2VA3A 4A8FA 5IT4A 5I3QA 4JB8B 4JI0F 2KYXA 2OPPB 4KQZA 2V67A 2A6MA 4ZDNA 5K20B 1R8CA 2PGCA 1Q82T 4QIEA 5FDLB 5KFYA 3NCRA 2RE1A 3P4UB 3MM9B 3SCIE 2C3OA 2ZH9A 4Y34A 2HGLA 3PV8A 3QSYB 4EEYA 1L3TA 2XI3A 1O8BA 4C9DA 4OYZA 1XTZA 1NDPA 2GQ2A 1SB6A 3M8QA 2JDJA 3GYXB 3OR2B 5DLFA 2OPSB 3HVAA 4TQSA 3CC2S 3UD5A 4B3OB 3DXSX 3SFUA 3DRRB 4F0KA 5D0GA 1NPRA 4FYYB 1HMVB 3JAMY 5EWEA 4USKA 3G6XA 3KLGA 2F4VF 2OJ3A 3QLHB 3HULA 3OXGA 3GILA 3LPEA 1FCAA 3SQGA 2QMWA 2FIUA 1WG5A 3FCVA 2J6SA 4F02A 1RTDB 3RTVA 2F7VA 2OLWA 3HZEA 3HSGA 3PXGa 3KLHA 1D09B 2E7WA 3GQCA 1B7FA 4H4KC 3BYRA 4ED7A 4KC5A 1ZYQA 4QYZJ 1DQ8A 3BF4A 4ZPBA 5FD1A 4KB7A 3DLBA 1JLCA 2B3TB 3AJ1A 4WFAQ 1AROP 3R5GA 2FVSA 3KG0A 1S12A 2FHJD 4CLWA 5FJ4A 1R0AA 2LKZA 1IQZA 4ZP6A 2XMWA 3NLCA 1GTHA 4ICLA 1SJFA 3B6BA 1GQEA 3K2YA 4ED3A 2XLIA 4EK2A 2O01C 4DV2J 3EUNA 3JQKA 4EO8A 1APSA 1H2UX 3SSSA 4OZ2A 3GV7B 2ROEA 4OYMA 2FJVA 3BO4A 3VWSA 4CI0B 1WOSA 2ZH1A 2V2ZA 4WZMA 3QQCD 2ZJPQ 2R8JA 3TYTA 2M52A 2R7TA 1MW7A 2I6WA 1DTQA 1TR0A 4YB7A 3RU0A 3PJ9A 3PNIA 2M4MA 1VOMA 1XK8A 1WSVA 3HJFA 3KLVA 1OSDA 5HVFA 4YOEA 3G86A 2J0WA 5H1SV 4MKYA 4ZVPB 4NYZA 4PPZA 3HO1A 1FDDA 1QUVA 2IRUA 3OQ2A 5CYMA 2YWHA 4R5PB 2MLZA 2P5VA 3I31A 2IDEA 3R7BB 1XQIA 1UZHA 2I8EA 3MAHA 4DN0A 1FF2A 1Y00A 2ACMA 2CZVC 4S0MA 1XNQF 3MR6A 2HFVA 1N4LA 1IKYB 1FDNA 1TELA 1FRXA 4DSLA 4LJMA 1GAOA 1VBXA 3M9NB 3RRKA 4P6QA 3LPYA 4QIGA 2P9EA 1UVKA 2B9EA 2FJDB 4CLLA 2KHDA 2OMLA 3TUPA 4BDPA 3HSZA 1F1BB 4L75A 2BJ1A 4CO2A 3QT7A 3D6FB 1U1RA 2DH9A 1RYSA 4WYLA 3FSXA 2IM0A 3VGUA 2YKAA 1FTCA 3WQPA 2DR5A 3CVKA 1NSQA 4IG3A 5H9EJ 1UWBA 1P9YA 4DF4A 3WZ0A 3DRRA 3KK3A 4EBEA 3ADAC 4DR3F 1QAXA 1BQMB 2L48A 3IC1A 3NBPB 4A48A 3MAQA 2Z8QA 1WHWA 3GP9A 1VLOA 2HW3A 1X4AA 1REGX 4ILMA 1NKEA 1VC5A 2XEXA 3W5YA 4B9TA 1JLEB 4OJHA 5RUBA 1VIXA 5IOLA 4ED4A 1D8ZA 3TQEA 1VQ8S 4DR7F 3GIJA 2GV1A 2HNDB 3BREA 4LRBA 4DU7A 1LXJA 3ITHA 3JQJA 3ZZUA 4XIUA 4IUFA 2ZM6J 1S9EA 1R6VA 3U7JA 3DLGA 3F56A 4QQBA 5KG3A 2R7QA 3R5DA 2PEHA 3BS9A 3FGVA 3C15A 2Z57B 2GO9A 2WOMA 2C3YA 5E3PA 1S97A 2D3UA 4F4AA 1EIYB 4QW9A 3MMAB 1BC6A 3C19A 3UDCA 2HVZA 4DX7A 1VQ4S 2CPDA 4DQRA 1BQXA 1VQYA 1NU4A 5ETSA 3N79A 3IBWA 4FPIA 2VB6A 1S1UA 3H8YA 2BVZA 4UUXA 1UPMB 2U2FA 4GRSA 5CZVA 2YH1A 1OYDA 3D66A 3EVWA 4EU0A 1T3OA 3J80Y 2C2DA 3D4JA 4DL4A 5E2QA 3H5YA 2D41A 2NXJA 2GHPA 1VDHA 2MZSA 3IR7B 2DGSA 1TK5A 5E41A 1Q5YA 3DRSB 1N0UA 4RW9B 4B08A 3U1NA 2JEIA 2GIFA 1SC6A 4JV0A 3Q2SC 3W2WB 3NKYA 1DFDA 4ANDA 5KFJA 4DOZA 4IH6A 4NCGA 2J76E 1O6XA 1RA6A 4DR1J 4UY8T 4CLUA 1NDCA 1GTEA 3F0NA 4ZLJA 1FT8A 3AD9C 5LSRA 2V4JB 1M5VC 1R8PA 4WTYA 3KK2A 5DDQC 4FF1A 5IFMA 1F3FA 1T9XA 2JLEA 2V8DA 2AT1B 7AT1B 1BLUA 5IT9Y 3R3TA 2IIHA 3L3CA 2FY8A 1R0CB 2DEJA 1CJUB 2NSBA 2UV8G 2EWHA 1PSDA 4PG6A 4DQSA 1ELOA 5KFKA 2A18A 4RW8A 4CM2A 4IQXA 3H40A 2AYBA 1TVRA 3IM9A 4KYZA 1S6OA 4A8SA 4DFMA 2W8KA 3NWRA 4WFBQ 5DG7A 1I3OB 1MNEA 4RW4B 1XR5A 1N8RT 3DDIA 4L72B 5HBMA 3MMCB 1DTTA 2LDIA 3QAUA 3ZZRA 1IM4A 1S57A 4WF9Q 2VOOA 3DDKA 5D4PA 4HYKA 1PYSB 2NYIA 5A8RB 3QZ8A 4G1QB 1H0HB 1YIJS 2AP6A 2G2OA 2CVIA 1QAIA 3M4XA 3MPDA 1HBMB 4OI2A 1IKWB 4JI3F 1HNVB 1Q5VA 3D2WA 2DITA 2UUBJ 1P8GA 4ILRA 4YB1P 1RT5A 2MQNA 1HFEL 2HNDA 2AZ1A 2MPUA 1Q0NA 1GXUA 1WWHA 3T6JA 2JL9A 4LR9A 3NG8A 1VQSA 5BYQA 2CVEA 3FSYA 4WP9A 3GJRB 2IM1A 4ZJQA 2ZHBA 1NB7A 3N6NA 1G6BA 2D9PA 2MKKA 5GMDA 1JWWA 3G82A 2L9NA 3CCMS 1OO0B 1WKJA 4F4KA 4C8MA 3CJ5A 1PJ7A 4U7CA 1RCOB 3CCWA 4ZJOA 5EUHA 3ET6A 4I67A 2SXLA 2YPYA 3HI9A 4M5DB 1RWKB 2CNLB 4YDXA 3A12A 1N5VA 4JI8J 2BQRA 3THVA 2PMWA 3DLHA 1YQHA 4A46A 5DQIA 2HK2A 1NEEA 1LEOA 3LP0A 2CNKB 1RLCL 1T7PA 1HNWF 1EQ0A 4I1TA 2H54B 3O8WA 3W3SA 5L39A 4OQJA 4LF7F 4K0KF 4H4MA 1QSYA 3GMGA 1IKXA 3EDRB 5E7OB 3R6GB 2LA6A 4ZP8A 3G6YA 2ZH4A 5A8WA 3JS9A 4CO1A 2ZITA 4DV3J 5DO2A 3MEDB 3RZAA 1RACB 1FK9B 2CYYA 3ISND 3MM6A 4I6AA 3OT9A 4FXVA 4CP5A 3PVXA 2ZOMA 3DRPB 1HBOB 2ZOGA 4CLFA 2LDYA 1DBDA 3KLFB 4Z7CA 4DZ6A 2YWGA 2EFVA 2O66A 1T03A 4ZVQB 3E8OA 1N52B 3DRYA 1U2RA 2LU2A 7FDRA 2OH2A 1LW2B 2HHVA 1NRKA 1UZDA 5L8RC 4GKKF 3OVAA 1YJTA 2EI5A 2X1GA 3IAM9 2EBGA 4IFVB 1EQMA 4JYAF 3SIPB 3TO8A 2UVVA 4N5SA 1ZAVA 4D3HA 5JVGQ 2E9ZA 2QLJB 1BMQB 2WW8A 1S6PB 3V4MA 1X0FA 4ZLNA 1LWFB 2APOA 2IMOA 3THTA 2DIUA 4ES3A 3EZUA 4UOCA 1AW0A 2Y0SD 1JMTA 5L1JA 5A2QY 5CXTA 1DY3A 2Q43A 1CS4B 2QJ3A 4PXCA 1TKZA 3OLBA 1YG0A 2VPXB 3NNAA 2M5YA 3GIKA 3I56S 2BQ3A 3ZZTA 1FJGJ 2KXFA 2WAQD 2C3MA 4NLOA 1KN6A 1I51B 4I64A 2QMXA 5HP1A 1W26A 1YZ7A 1VLYA 4GO5X 3HHDA 2LQBA 1PAEX 3CJ4A 1WORA 2IJNA 1M90T 5KFWA 4ZPWR 1TK0A 1N6QA 2CPJA 2G9OA 1F60B 3UWTA 2UVWA 4EO6A 1TL3B 3MM5A 3PHTA 3GTYX 5IWAJ 4LF5J 3ISNC 5KT5A 3IGVA 1WTFA 2J0XA 2A6OA 3TAPA 1R8BA 4KJIA 2E7VA 3SMZA 4B9VA 2GNKA 2Z58B 2EVZA 4B17A 4ZVUB 1CJVB 1GEHA 2CJQA 2KJVA 2WB4A 2GAGC 3K89A 1PILA 3PDNA 5ADZA 2DNOA 1M5KC 3R5BA 4QYRA 2EFNA 4QR0A 4FVCA 3R2DJ 1HNIA 2J7UA 2XCAA 2UUTA 3FBCA 1BGXT 1ZOTA 4DI6A 3M2RB 4EBCA 3RR8A 2VKRA 3POTA 1VFJA 3J80U 4NEZA 3LP2A 1U0HA 2R7SA 2VPYB 4PG5A 3EPIA 4PQUB 3HT0A 4P7TA 2BQUA 4AYBD 4QPTA 3CE8A 5KG1A 1Y5IB 2B6AA 1VC0A 3EDQB 4X62F 2BV3A 2HYIB 2XMVA 1HYSA 3ZTSA 1UFLA 4URSA 1QE1A 4HH0A 4YY3F 3SQOP 4KGVB 2NR0A 3UW1A 5KFMA 3LO3A 1H3DA 1S1WA 3CGIA 2YQ1A 3C46A 1DARA 2ZZMA 4DJBA 2AMCB 2J9DA 1W25A 2OEJA 2E5JA 1P1TA 2AYEA 4NWBA 2OUGA 1QSLA 3EWGA 1AZSB 5B0EA 2G4BA 3BGUA 2BJ3A 3C8YA 3JSMB 1UL3A 3J81Y 4FF3A 2LQ8A 2UV8A 2DHXA 3RRHA 3A3NB 4ELVA 1Q95G 1XMOF 4OYAA 4DXLA 2YKQA 3LP1A 2YX7A 4ETZA 2HWHA 2DXFA 1UPPA 1YBTA 2DRDA 2J8AA 1HA1A 3GSDA 4ZCKA 4HT5A 1RT3A 1S99A 4ZIWA 1Q81T 4OIXA 2IJRA 2VD3A 4YP3A 4M5GA 2LVWA 4MFBB 3HVRA 3ICLA 2ADCA 4DPOA 1CPZA 2IVFB 4A8YA 5EN1A 1RAOA 2PE8A 4CT8A 1JK9B 2MYFA 1FESA 4LSLB 1JIHA 4I2QB 2CQPA 2P6TA 3AT1B 1IJEB 1SIWB 4G65A 4IG0A 3AAWB 1CC8A 2WSEC 3HXMA 5HLFA 1HI8A 4EGLA 2YNHB 3VAMA 4YR3A 2HNZA 3HFZB 3BKFA 3CCJS 3MEGA 2XBPA 5EWGA 1Y10A 1WC1A 3T6BA 1NK7A 4RW6A 2A10A 3G6VA 1LK7A 2CADA 2DPIA 1TKXB 4PWWA 1F0XA 2MQ8A 3KLIB 5F8NA 1Y3KA 4DSKA 1T8EA 1KNZA 5IM0A 2MZTA 3TJ9A 4NZ0A 1RT6A 1IBMJ 3BSAA 5J2QA 3HKZD 3PZPA 1DRZA 1UAWA 1BQNA 2FJEB 5J1PA 2HQFA 1RU2A 1KONA 2NXNA 1C1CA 1U0SA 3PACA 2HEKA 3V6JA 1R3NA 4KGKA 1WEYA 1NCLA 4W92B 3PFEA 1SKWA 1W7WA 1NAQA 3UCGA 4OZ1A 2LECA 5DQGA 2OFGX 5DRKA 8RUCA 3VAJA 2J9EA 3OR1B 1WDTA 3HFVA 2HWTA 4L74A 3GE9A 3P49B 2MSSA 3BDPA 5CYQA 5J2NA 1EAYC 4DPTA 1XNRJ 1MU2B 1NSAA 2WVBA 4KO0A 4DUYJ 4RNFA 2ILYA 2DVIA 5F8IA 1F9EB 4E2FB 4DQIA 4PUOA 3JSRA 5D3GA 2AWZA 5D4OA 3H20A 2LQJA 4NASA 2ASLA 3H2VE 3H7HB 3UR0A 2RHQB 2YNFB 2W4PA 4N8OA 4DR2F 3KG4A 2EXUA 1S1XB 2DH7A 4P2SA 5HATA 3ONQA 2G2YA 4ZPCA 1X4CA 2BEFA 4OZ0A 1BXNA 3RGIA 1JLAA 1G3OA 1QM9A 3NCQA 3JB9k 4X2BA 3HJVA 4NI2A 2UU9J 4LRCA 5T7LB 1LWCA 5LXYA 1J2VA 2D1CA 2LXIA 1GMUA 4J9VA 5A2QU 2ATLA 2G0CA 4OZNA 4W4MA 4PXBA 3D6MB 1KR4A 1TKDA 2QL9B 3QJPA 2DISA 3M8PB 1YHQS 4ZPTR 3ENWA 4DWIA 5FIIA 3OFFA 4J9UE 3UQSA 4FF4A 4C11B 2UXBJ 1EETB 3MECA 5K8OA 3SZ2A 3PHEA 2M3DA 2JH3A 3OLAA 1IBLJ 4USJC 2ALZA 1DLOA 3DOMB 1NK8A 1S4FA 2POKA 3T1HJ 3KXDA 4FP9A 3DMJB 3IGNA 4Y0FA 3M6XA 1VBKA 4URQU 2VC1A 2V2KA 3Q89A 3ZNUA 2QA4G 2FZKB 4JUZA 3BGRB 2IA0A 4U7UK 2CWKA 3CDWA 3H5UA 2JX2A 4KFBB 3R5JB 4EBDA 3CULA 4X66F 1RTZA 4FNHA 4F7VA 3GIMA 2Q79A 3S1TA 1RAJA 4UZCA 3J7A1 2OO4A 3D68A 4UF4A 1QD1A 3BJYA 2ZHOA
chains in the Genus database with same CATH topology
3DKDA 3EVWA 2NCKL 3Q8VA 3FC9A 1NLKL 1JXVA 1S5ZA 5IOLA 1S59A 3NGTA 1WKKA 3BBFA 5BXIA 3FBBA 1MN9A 5C7PA 4CP5A 3EE3A 3B6BA 4FKYA 2DYAA 1ZS6A 1B4SA 1HLWA 3EMTA 3FBFA 3R9LA 4EK2A 3EJMA 4KPCA 1WKJA 1NSKL 2DXDA 2HVEA 3ETMA 4DZ6A 3Q83A 2DXFA 3DDIA 1PKUA 1VYAA 5CAAA 3WX8A 4F36A 1HHQA 1NPKA 2HVDA 5CABA 1PAEX 1S57A 3BBCA 4HR2A 4UOFA 1NUEA 1NHKL 1NDKA 3ZTSA 3EVMA 3ENAA 4ANDA 2B8QA 3FBEA 1UCNA 2DXEA 1NSPA 4W98A 2DY9A 3VGUA 3FCVA 3PRVA 4F4AA 3NGUA 3G2XA 1BUXA 1BE4A 4ANCA 1NSQA 3BH7B 3FCWA 3PJ9A 2BEFA 4WBFA 4C6AA 2B8PA 3GPAA 3Q8UA 3VVUA 1NDCA 1WKLA 2VU5A 3ZTOA 2AZ3A 3NGRA 3NGSA 3VVTA 3ZTQA 1LEOA 3EM1A 3MPDA 3L7UA 3EVOA 3ZTRA 3FKBA 3Q89A 1NCLA 4DUTA 1NDPA 1KDNA 4UOGA 3BBBA 1HIYA 4ENOA 1B99A 3Q86A 2CWKA 3GP9A 4ANEA 1F3FA 1W7WA 1NDLA 3VGTA 4UOHA 2ZUAA 4FKXA 3BH6B 1NB2A 1U8WA 2AZ1A 4O0NA 2HURA 1BHNA 1K44A 3ELHA 3Q8YA 1MN7A 1XQIA 3ZTPA 1XIQA 3FBCA 2BX6A 3JS9A 4S0MA 3VGSA 1F6TA 1EHWA 1LWXA 3B54A 3EICA 3VGVA 4DI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKD A;  3EVW A;  2NCK L;  3Q8V A;  3FC9 A;  1NLK L;  1JXV A;  1S5Z A;  5IOL A;  1S59 A;  3NGT A;  1WKK A;  3BBF A;  5BXI A;  3FBB A;  1MN9 A;  5C7P A;  4CP5 A;  3EE3 A;  3B6B A;  4FKY A;  2DYA A;  1ZS6 A;  1B4S A;  1HLW A;  3EMT A;  3FBF A;  3R9L A;  4EK2 A;  3EJM A;  4KPC A;  1WKJ A;  1NSK L;  2DXD A;  2HVE A;  3ETM A;  4DZ6 A;  3Q83 A;  2DXF A;  3DDI A;  1PKU A;  1VYA A;  5CAA A;  3WX8 A;  4F36 A;  1HHQ A;  1NPK A;  2HVD A;  5CAB A;  1PAE X;  1S57 A;  3BBC A;  4HR2 A;  4UOF A;  1NUE A;  1NHK L;  1NDK A;  3ZTS A;  3EVM A;  3ENA A;  4AND A;  2B8Q A;  3FBE A;  1UCN A;  2DXE A;  1NSP A;  4W98 A;  2DY9 A;  3VGU A;  3FCV A;  3PRV A;  4F4A A;  3NGU A;  3G2X A;  1BUX A;  1BE4 A;  4ANC A;  1NSQ A;  3BH7 B;  3FCW A;  3PJ9 A;  2BEF A;  4WBF A;  4C6A A;  2B8P A;  3GPA A;  3Q8U A;  3VVU A;  1NDC A;  1WKL A;  2VU5 A;  3ZTO A;  2AZ3 A;  3NGR A;  3NGS A;  3VVT A;  3ZTQ A;  1LEO A;  3EM1 A;  3MPD A;  3L7U A;  3EVO A;  3ZTR A;  3FKB A;  3Q89 A;  1NCL A;  4DUT A;  1NDP A;  1KDN A;  4UOG A;  3BBB A;  1HIY A;  4ENO A;  1B99 A;  3Q86 A;  2CWK A;  3GP9 A;  4ANE A;  1F3F A;  1W7W A;  1NDL A;  3VGT A;  4UOH A;  2ZUA A;  4FKX A;  3BH6 B;  1NB2 A;  1U8W A;  2AZ1 A;  4O0N A;  2HUR A;  1BHN A;  1K44 A;  3ELH A;  3Q8Y A;  1MN7 A;  1XQI A;  3ZTP A;  1XIQ A;  3FBC A;  2BX6 A;  3JS9 A;  4S0M A;  3VGS A;  1F6T A;  1EHW A;  1LWX A;  3B54 A;  3EIC A;  3VGV A;  4DI6 A; 
#chains in the Genus database with same CATH topology
 2M70 A;  2E29 A;  2EFP A;  3L09 A;  5KFR A;  3RBX A;  4OZ5 A;  4PQA A;  4DPY A;  2G0J A;  2QA1 A;  1JLF A;  5GAD I;  3PYF A;  2GVZ A;  5B09 A;  4C8O A;  5DET A;  1B0P A;  1REV B;  4J37 A;  4X4V A;  3KJV B;  4EI2 A;  2CQC A;  3O3L A;  4DF8 A;  4ED5 A;  4LVO P;  3I55 S;  2FY1 A;  4FBU A;  2GQC A;  2G2Z A;  1HR0 J;  1NUE A;  5HRO B;  2LQ5 A;  1JLQ A;  5HMX A;  5F0U A;  4LF9 J;  2B8Q A;  3MUV P;  2X1F A;  4W98 A;  3ZFV A;  2V8G A;  2RS2 A;  3S6E A;  4G3I A;  4DS4 A;  5E5N A;  4X4O A;  3H2U B;  1WJ9 A;  2QA4 S;  4ZVR B;  3RBE A;  3BGL A;  4YHH F;  1SV5 B;  2L08 A;  3CUN A;  1RWU A;  1T9V A;  1RA7 A;  3TAM B;  2JHE A;  4WTO B;  4TKT A;  2LQ9 A;  5FLX Y;  1SC4 B;  3BB5 A;  1UFW A;  2JLG A;  2EPI A;  1WF2 A;  4ED6 A;  2W9A A;  4OFZ A;  1U4B A;  3CMQ A;  5CA5 A;  3J81 U;  1FKO B;  1TK8 A;  1WDD A;  3BBF A;  5BXI A;  1XR6 A;  2FLL A;  3HKW A;  2IMW P;  3KDO A;  2AU0 A;  4TY8 A;  3IRW P;  2J7W A;  1X31 C;  5HQM A;  3BM7 A;  3IRX A;  5ETR A;  3I9V 9;  1VMB A;  1RT4 A;  2JWN A;  3R7N B;  2H9Z A;  1Y9O A;  2WB1 D;  5M2R A;  4CO0 A;  1V5I B;  1L5U A;  5KFI A;  4X62 J;  4O3R A;  2HKE A;  3LOU A;  1SQF A;  3I5A A;  3F41 A;  4QBU A;  3JYT B;  4QWA A;  5DG9 A;  1HHT P;  3R6L B;  1UW9 A;  4F3O A;  2OPQ A;  4URG A;  1URR A;  3V6D B;  2YNI A;  1VHI A;  4CDI A;  3M8Z A;  2VG6 A;  3DI6 B;  2GJ2 A;  5T14 A;  1FFS B;  4O4G A;  1KFD A;  1E6V A;  3THP A;  1N88 A;  4HAC B;  2OTJ S;  2K2P A;  2JZ5 A;  4NLT A;  2W4D A;  1RIS A;  2KO1 A;  1FXL A;  2B51 A;  1Z2Z A;  1FJC A;  5A0Y B;  4HTJ A;  3EGV A;  1V6H A;  3U27 A;  5L1I A;  2V6A A;  3KYL A;  3HHK A;  1JNR B;  2YX4 A;  5D6G A;  1HNX F;  4DPW A;  1NSK L;  4J9R A;  2WK4 A;  1LK5 A;  3VF0 B;  2YKM A;  3OBI A;  4U8V A;  1SJ4 P;  3MMB A;  1XMO J;  4ERD A;  1IR0 A;  2AEJ A;  1JKH A;  3N6L A;  2PD1 A;  4LIW A;  2A3J A;  2EK1 A;  3HD1 A;  2MZR A;  2VQF F;  3BH7 B;  2X51 A;  3KUH A;  6FD1 A;  3MM8 B;  4ZJL A;  3GR1 A;  4UQT A;  1R43 A;  1HQ2 A;  2RKI A;  2W9C A;  4U95 A;  3MCS A;  1VQ9 S;  1VI7 A;  2QSW A;  2ZBI A;  4ECQ A;  2Q3P A;  1TUG B;  4F2S A;  3ZZP A;  2FHK A;  2EW9 A;  1KHW A;  3CJ8 A;  4IR9 A;  1NBE B;  3LTO A;  1HNZ J;  4J9M A;  4YUD A;  1FJE B;  4RKU C;  1BY9 A;  4ZLP A;  1C0U B;  3N6M A;  2YNG A;  4IRK A;  4PEO A;  3AH6 A;  1NO8 A;  1C2P A;  2KFZ A;  2E1R A;  2OD4 A;  1R89 A;  3CMA S;  3ENQ A;  2QV6 A;  1XER A;  4OJG A;  2OAU A;  1SL2 A;  2UXC F;  1OS5 A;  3DYA B;  1TZ0 A;  5E3Q A;  3NS6 A;  2HFS A;  3SV4 A;  1XJW B;  5CHC B;  1S6Q B;  1JLG B;  3C16 A;  2I5J B;  4QZV B;  1VIO A;  2R7V A;  3M7V A;  1SL0 A;  2XHC A;  3PJW A;  5D4N A;  2ASD A;  4O44 B;  5I3U B;  4WBF A;  1HPZ B;  3G71 S;  1TKT B;  4ILL A;  2JEJ A;  4FZV A;  4PYD A;  3WHI A;  2IY5 B;  4NZ6 A;  2FGO A;  3OUY A;  4JBC A;  1S48 A;  4NLV A;  1FNM A;  4OV1 A;  5I42 A;  4EZ6 A;  5GME A;  4KIA A;  3ZO7 A;  4B9U A;  2CPY A;  2BAC A;  5KFD A;  4ZPD A;  5H9F K;  2EEY A;  2E1M C;  3BDE A;  2XMK A;  2RB7 A;  2VUG A;  5A76 A;  1F2G A;  3EGW B;  3CJ2 A;  3D7S B;  1YI2 S;  2X3D A;  4RNO A;  2CG4 A;  3I6P A;  2QE5 A;  4NCA A;  1C4C A;  2Y3Y A;  5L38 A;  4I69 A;  3DHW C;  2HFN A;  4ZVF A;  3A1Y G;  1R6Y A;  2EC2 A;  3AD8 C;  3TR5 A;  1IKV B;  2YKN B;  2AD9 A;  2DB1 A;  4LSN B;  5D0E A;  2J0S D;  5F3T A;  5AE2 A;  2YWW A;  3BPD A;  2RIL A;  4WP8 A;  2DRA A;  3W7B A;  3C14 A;  1X7V A;  3K5N A;  2H65 B;  3GII A;  3KHL A;  1WI8 A;  2FVP A;  4ECY A;  4B02 A;  4EWT A;  3M2U B;  1J5O A;  3QJJ A;  1CUL B;  2NLW A;  4C8Z A;  2V8P A;  2VC0 A;  2QLW A;  1FFG B;  3TA2 A;  2RML A;  1VBY A;  3GZ7 A;  3NS7 B;  4PXE A;  2FQQ B;  1TV6 B;  4WWS A;  2W25 A;  1N36 J;  2GA7 A;  4JP8 A;  1HKA A;  5KOW A;  2VFR A;  3FUY A;  1U24 A;  3M8Y A;  3M32 B;  4IOC Q;  3RB4 A;  3QIP A;  3R1L A;  3KLE A;  1KHV A;  3CJ3 A;  4H4O B;  4G1P A;  2BRK A;  1ZPV A;  5KFP A;  4HHU A;  1C0T B;  1NK4 A;  1JJH A;  4CYU A;  1QLN A;  1Q8K A;  2KG0 A;  1OSC A;  5HI7 A;  3EX7 B;  1TFY A;  1H73 A;  3ZNJ 1;  4NOH A;  2MQQ A;  3JSY A;  2RRN A;  1S1V B;  2R8K A;  3L95 X;  2LFV A;  3D0G E;  3AA9 A;  1SC1 B;  3HF5 A;  4O3O A;  3JTN A;  5J1E B;  1T05 B;  2RF2 A;  4J9S A;  2LLZ A;  4KY3 A;  5HJX A;  4OZ3 A;  4LSZ B;  1G4C A;  2BUN A;  1PG5 B;  2AHO B;  1KRP A;  3J7Y U;  2PT0 A;  5LMU F;  5D77 A;  1LXN A;  5LSL A;  4CO4 A;  2V63 A;  3GFY A;  1RHM B;  1LW0 A;  3QT6 A;  3OJU A;  4I68 A;  3GLJ A;  4JI5 F;  1WHV A;  2HPU A;  4A47 A;  5FLX U;  3PX6 A;  1JLG A;  2F3J A;  1MRO B;  3C66 A;  3HZG A;  5G4D A;  2MLY A;  3QRP A;  1S59 A;  4YDD B;  5IC6 B;  1P1L A;  1SKR A;  2RU9 A;  2ROG A;  1RT1 B;  2DIV A;  4OYO A;  3VAK A;  2QEX S;  1OQ6 A;  3D6H B;  5I3P A;  4UTG A;  1SUQ A;  4NLS A;  1TL5 A;  2R42 A;  2E9R X;  4M8L A;  3QSI A;  2AKW B;  4FS2 A;  1RWV B;  1FE0 A;  4HDG A;  3OTE A;  4OX7 A;  5BYS A;  3FRY A;  1HI1 A;  3MTJ A;  3ZZY A;  3P5T L;  3G87 A;  4JI4 F;  2MST A;  2CQD A;  3LW5 C;  2KFN A;  3A8J A;  1NXI A;  3GPA A;  3DOK B;  4LFC F;  1Q7Y T;  4ECX A;  2HZV A;  1RYR A;  4ID5 A;  3LGH A;  4RNN A;  1SPB P;  4IDK B;  1NPP A;  3AD7 C;  2X1A A;  2LXU A;  2DGW A;  2E7X A;  3OTC A;  1YBU A;  4AQY J;  4HI1 A;  4DV5 J;  2V9W A;  1PGZ A;  3MCN A;  2BE2 B;  2CQG A;  3PRD A;  2VBX A;  4KV8 A;  3KKF A;  2VIC A;  2RNE A;  1RTH A;  3FEZ A;  3KG1 A;  3W64 A;  4DV0 J;  1J5E F;  1FVS A;  3TA0 A;  3LUY A;  2OPR A;  2JC1 A;  1HW9 A;  3FQL A;  2HLU A;  3QGH A;  3RAM A;  1HWL A;  1KD1 T;  2ZVI A;  2ZZN A;  2P6S A;  3B4D A;  1PAU B;  3KMQ A;  2Q6C A;  3QFH A;  1NDK A;  3M8S A;  2QRR A;  4D3G A;  3K58 A;  3UVJ A;  1DZ5 A;  1RTJ A;  2PO4 A;  4KBI A;  2DY9 A;  1JJ2 R;  2E44 A;  5CH7 B;  4AL7 A;  3DLE A;  4UZB A;  2WRM A;  2FHM A;  2ACY A;  1F5C A;  4ZP9 A;  1Z1Z A;  1FD8 A;  4P72 A;  3UCU P;  5CCM A;  3R5A A;  4RLE A;  3D67 A;  1HI0 P;  4NLY A;  2IVY A;  1WI6 A;  2JEF A;  4R25 A;  1U09 A;  3KHG A;  1U1N A;  4IH7 A;  3DDN A;  2EKY A;  2I2Y A;  3KNG A;  4B3R F;  3J7Z 5;  2CKW A;  1GFW B;  1OPI A;  1VHF A;  1S1V A;  3ZC4 A;  4OI4 A;  5C2C A;  5F41 A;  3IS9 A;  4BC9 A;  4N41 A;  2R4F A;  5A8K A;  2AGP A;  2VV5 A;  3I87 A;  4LVN P;  3O5T B;  4TNO A;  4NLW A;  4DR5 F;  1KFS A;  3KTQ A;  1HBN A;  5KFO A;  5C24 A;  1X9M A;  5J1N A;  3W2V A;  1S0M A;  3PO4 A;  2PI4 A;  3C6T B;  5F3Z A;  4XO0 A;  4Y00 A;  2IA6 A;  2W2P P;  4RW7 B;  1V3Z A;  1HNX J;  2K1R A;  3SDE B;  1WF1 A;  1XMQ J;  1QVF R;  4XDC A;  1N33 J;  2RQK A;  2Z0G A;  1RTI A;  2VHG A;  1S0N A;  2MJN A;  3VV2 B;  4OYW A;  1CLF A;  1MWQ A;  1YBA A;  4MKV A;  4QIF A;  5AJ3 J;  4C8K A;  4Q43 A;  4Q0B B;  1KWM A;  1ZPW X;  1H7X A;  2QA2 A;  1RT1 A;  5LMN J;  3QT8 A;  5KG0 A;  4O0N A;  1HWI A;  2HLT A;  2HUR A;  2FJB B;  4NX9 A;  2FD2 A;  4I2P A;  1ZAW A;  2K3K A;  4WYW A;  2YH0 A;  1WSR A;  4X4Q A;  2XMJ A;  3B54 A;  4FBT A;  3EIC A;  5KT6 A;  1SQG A;  3DLK A;  1FWK A;  5KFZ A;  1WC6 A;  4TU8 A;  3AOA A;  3CD7 A;  1TL7 B;  5DG8 A;  2NS1 B;  3LAK A;  4KPC A;  1RWW B;  1ZM9 A;  2HBZ B;  2CQ2 A;  3FFI A;  3W9I A;  3BQ1 A;  3BKU A;  4QOT A;  4CTA B;  1JJ4 A;  4XDD A;  5C42 B;  4FYV B;  1CJT B;  3OL9 A;  1I94 F;  1X0P A;  2GCF A;  3PYG A;  1VQ6 S;  2KB2 A;  2C2Z B;  2PEB A;  1KSP A;  1TAQ A;  2NXE A;  4I6Y A;  3L7U A;  4CZC A;  1GT8 A;  2QL7 B;  2IDL A;  5U47 A;  3F73 A;  3E01 A;  2RS8 A;  2OFH X;  4OX9 F;  5JXS A;  3DM2 B;  1LNQ A;  4WE1 A;  1SJ1 A;  1VQ7 S;  3MD1 A;  3DXB A;  4J7C A;  3UDL A;  4IO9 Q;  5CCL A;  4WII A;  3TNV A;  3FQK A;  4IH5 A;  5KTQ A;  1KVI A;  2ZBC A;  4KH1 B;  1S4E A;  3BO2 A;  1FKA F;  5SUH A;  2ZUG A;  5DS7 A;  4K4W A;  4K5R A;  3OTO J;  1MN9 A;  4ZN1 A;  4C3M A;  1S7I A;  4DU8 A;  4W90 B;  3OV7 A;  2BJE A;  1N32 F;  4Z7Y A;  2BM1 A;  3IWX A;  1R8H A;  3BSC A;  4HL9 A;  1N5Y A;  3RBD A;  4J91 A;  1Y0H A;  1PKU A;  2FVQ A;  3TVZ A;  3KK1 B;  1S1T B;  3BZQ A;  1M5P C;  1FE4 A;  2EG2 A;  4KTQ A;  3KDN A;  4V19 J;  1AYE A;  2AJ4 A;  1S9G B;  5DZ6 A;  4OZJ A;  2WHO A;  2JJ4 D;  2RUS A;  1L3K A;  4C2M A;  3KJQ B;  4CIO A;  3NAI A;  2QFJ A;  4QWE A;  5IV3 A;  3JSB A;  1HBU B;  4FYX B;  2H4W B;  1ZZF A;  4WCE Q;  1U1Q A;  3RR7 A;  2B4O A;  4J9N A;  4DL7 A;  1JXL A;  1B3T A;  1EKS A;  5KFX A;  1X9S A;  2PA8 D;  1F5A A;  4IRD A;  1T9U A;  1CC7 A;  4DG1 A;  3RG6 A;  1CQN A;  1PC5 A;  1RK8 A;  3ZTP A;  1ZH5 A;  1C1B A;  3MAA A;  1KLM B;  3PW2 A;  1F9H A;  1RAD B;  2ZNZ A;  2VG5 A;  2QN6 B;  2CPH A;  1HQE B;  4DV7 F;  4DZD A;  3HHL A;  3G8T A;  2GGP A;  5B0B A;  5IS2 A;  3ENV A;  3EJM A;  4LF6 J;  4ZHR B;  3A8K A;  3BSO A;  2B4P A;  3ILL A;  1RT7 A;  3IG1 B;  4XPC A;  2P9C A;  5KFA A;  3WX8 A;  1QTM A;  3QNW B;  2OTL S;  3D3C J;  2D3Z A;  2OSR A;  4L73 A;  1X4E A;  5KG7 A;  3VAI A;  4NXN F;  2QG9 B;  2KU7 A;  2H48 B;  4Y3C A;  2VKZ G;  4P2F A;  4M5I A;  4DV6 F;  2PI5 A;  2VU5 A;  3W66 A;  1EP4 B;  4XAK A;  2RQ4 A;  4XK8 C;  3T1Y F;  4LF2 A;  5C25 B;  2E1C A;  4OMF G;  1X4B A;  4USH A;  2ZZT A;  1CQM A;  2MKH A;  1EZZ B;  3TRG A;  1L3S A;  5LXR A;  1TL1 B;  4KKO B;  1VQL S;  1M1H A;  3F44 A;  1VRU A;  5G0R A;  2DGO A;  2RJZ A;  2V2Q A;  1GX6 A;  2H51 B;  1KOH A;  4DL0 C;  3OVB A;  4PR6 A;  1NLK L;  5GAE U;  4Q8F A;  1M5H A;  4P73 A;  2ZH2 A;  2B43 A;  2HGN A;  3PW5 A;  4JI5 J;  1NM2 A;  5HVG A;  2CPE A;  2GO8 A;  3DRX A;  2IC3 A;  3H5S A;  3HHN B;  4NLP A;  1FWP A;  3EGZ A;  2Z2Y B;  4CNZ A;  2ZWO A;  4EZ9 A;  4NA2 A;  2NSC A;  2JVR A;  1TAU A;  4ATN A;  2VL1 A;  1B0T A;  4BBY A;  2OKQ A;  1UJ4 A;  3IAS 9;  3W61 A;  1FRH A;  2OD6 A;  2YKP A;  1CJK A;  4F4Z A;  2V8H A;  1IBK J;  4B3T J;  1FDB A;  4O3Q A;  1JQG A;  3G8S A;  1M5O C;  4RUA A;  3V81 A;  2KT3 A;  1N5S A;  1HQU A;  1W2I A;  5F8L A;  5J2P A;  2JFK A;  3Q8P B;  2DHH A;  2BZ2 A;  5K14 B;  3T5H A;  2HNY B;  1VQK S;  2MZ1 A;  3E2E A;  1U8S A;  1MN7 A;  4KHP J;  3WBZ A;  5HN0 A;  2MGZ A;  4L3K A;  4JV2 A;  1X60 A;  5B0A A;  4NML A;  2EFG A;  1XC9 A;  1FI4 A;  3MEE B;  5E33 A;  3FC9 A;  2V5H G;  4CM0 A;  2UXD F;  1RT2 B;  2WSC C;  2F5G A;  2D9O A;  4R8U A;  2R7W A;  1HD0 A;  2YKO A;  1IWG A;  4M5J A;  3TW0 A;  4DQQ A;  2WVF A;  3M6U A;  2KM8 C;  2ALY B;  2F8M A;  1D3W A;  1UJ6 A;  2W7O A;  4RUH A;  3PTW A;  4OI3 A;  4ZPA A;  1QAJ A;  4CH0 S;  3EYZ A;  2BKN A;  3MM7 B;  4GKJ J;  4PWD B;  2GVD B;  3V4I B;  1JLB B;  3BEG B;  4RNH A;  4K8R A;  4B3M F;  3M30 A;  4DFP A;  2Y8Y A;  4B9N A;  4FF2 A;  3FVY A;  4DFJ A;  1ICE B;  2P9G A;  1LWE B;  3EVO A;  4TVA B;  4I7F B;  2OEK A;  1X4D A;  1NME B;  1YJV A;  2DEI A;  5I4M A;  5BR8 F;  3IR6 B;  5D0H A;  3AXK A;  5M2P A;  2B5J A;  4PWU A;  4F2R A;  5KFG A;  2N82 B;  2MKJ A;  3I0S A;  3PW7 A;  1I1G A;  5KFC A;  1YSJ A;  3TJA A;  4BWM A;  1X4G A;  1FXR A;  2W2N P;  4E98 A;  1T3N A;  1Q16 B;  3NOC A;  3TVK A;  4FKY A;  3TZY A;  4BS2 A;  2Z4P A;  3D0I E;  2BJD A;  4A8X A;  2ATC B;  2HHP A;  4CLK A;  4QYZ K;  2R3V A;  3MWB A;  3HVT A;  4GMK A;  3GFH A;  2KRR A;  1Q78 A;  4DV1 F;  2ZE2 B;  4PKD B;  3Q23 A;  4TYA A;  1X8D A;  3JTP A;  2QO3 A;  3KUE A;  1GH8 A;  2AQ4 A;  1NJZ A;  4LF8 F;  3M6W A;  3HM9 A;  1YWX A;  3G2X A;  2BE9 B;  2WON B;  4CO5 A;  4DR5 J;  3OSP A;  2MKI A;  3P45 B;  2XGP A;  4LT6 A;  3R8Y A;  1PYT A;  3FKB A;  3W5X A;  4WFN Q;  2OPP A;  5DGA A;  1N54 B;  2DO0 A;  2W01 A;  4QIW D;  4CT9 A;  1WEX A;  3OHB A;  5FDL A;  3MOJ B;  2ZC3 A;  3MM9 A;  3FCH A;  2AX1 A;  3DOL B;  4HT7 A;  3N4W A;  4PCQ A;  5GVQ A;  1U26 A;  2HRT A;  2HHU A;  1Z2L A;  3N5F A;  4IFY B;  1A0O B;  2B9X A;  3BGO P;  1U6B A;  1VK3 A;  3OR2 A;  1T11 A;  2DNM A;  2UUA F;  3Q8R B;  1KC8 T;  1N34 J;  1FRL A;  2OPS A;  2KT2 A;  2XMT A;  2GIR A;  5CAA A;  4HKQ A;  4A8M P;  2Z56 B;  5DQH A;  4B3O A;  1PIE A;  4YS2 A;  1PC4 A;  4UOF A;  4J9L A;  1FJ7 A;  5DZ7 A;  2CJK A;  5K8P A;  3UD3 P;  4LFB F;  3SYZ A;  1NND A;  3QO9 B;  2QSF A;  3MEK A;  2V4R A;  4GC6 A;  4DFK A;  3DGP B;  2GW8 A;  3QPI A;  2OMO A;  1HMV A;  2C22 A;  1PJ6 A;  5KT4 A;  1I94 J;  4K4T A;  1NJX A;  4MAK A;  5AT1 B;  1U02 A;  3QLH A;  1H74 A;  1YJN S;  2CQI A;  2W24 A;  1S10 A;  4E0D A;  3AJD A;  3KJF B;  5KG5 A;  4ALZ A;  5F9L A;  3CCR S;  3M1V B;  4RPF A;  3ELH A;  1G2E A;  3OW2 R;  2XLK A;  2FJX A;  1RTD A;  3KHH A;  3VQS A;  3CDB A;  3RYL A;  1RGV A;  2YQ3 A;  3QAE A;  1VBZ A;  2VPW B;  2MDA A;  5H9E K;  4V19 X;  4LF1 A;  4X65 F;  4N76 A;  3SXL A;  1U1P A;  5D15 A;  3DLL Q;  1ZS6 A;  4B3S F;  4ZK7 M;  2KRB A;  2KT5 A;  3B78 A;  1FKP B;  3AQO A;  1P9Q C;  3C3L A;  4DUZ J;  2IBK A;  1K0T A;  2H5E A;  2C28 A;  5K8M A;  5IXU A;  2KFY A;  5IT0 A;  1RHQ B;  1S0V A;  5HMZ A;  2OGU A;  1L3U A;  4EFA C;  4Y65 A;  1SCJ B;  1FO1 A;  2BKP A;  4CNY A;  4YME A;  2VON A;  2VOP A;  3VZH A;  4U96 A;  4HH1 A;  3CJQ A;  2RD5 C;  2XLJ A;  3KHR A;  4XTT A;  2XZT B;  2GQQ A;  4KGX B;  1Y7P A;  4Y2I A;  1K8A T;  1XIQ A;  5J2M B;  3MGJ A;  1D9A A;  4LBP A;  1VR6 A;  4WFY A;  3T1A A;  1Y5N B;  3OL7 A;  3TOQ A;  4JV1 A;  4WU3 A;  2KN4 A;  1OY9 A;  4JI2 J;  1HLW A;  1D8Y A;  3FEY B;  5EGY A;  4GC7 A;  4Y6I A;  4JV5 F;  3D1H A;  3GON A;  2B7B B;  1VQO S;  4R5P A;  2QTW A;  1UEV A;  1VYA A;  1NPK A;  2E5L F;  2HVI A;  4ZP7 A;  5HJY A;  2J5A A;  2M8D B;  2NQP A;  1IKY A;  3P6Y C;  5F8J A;  2FVC A;  2O5D A;  1BUX A;  3MXH P;  4OYI A;  3BPS P;  4MJK A;  3TUJ C;  2C2N A;  2QL5 B;  2O1P A;  1FNO A;  1RHR B;  2L9W A;  4AE5 A;  2CQB A;  4USW A;  5DDR C;  1XR7 A;  2E1P A;  2DNY A;  4MKB A;  1YKW A;  3VHQ A;  1VIS A;  3PYD A;  3CO0 P;  1KQS R;  4A8K A;  4LRE A;  5BYR A;  1VQP S;  3MD3 A;  3TUI C;  1HHS A;  3U1M A;  1B70 B;  1WKK A;  1RU1 A;  2BW7 A;  1BQM A;  3NBP A;  2DKO B;  1UA1 A;  1T94 A;  2C3U A;  3CF5 Q;  1E6Y B;  2LA4 A;  1RXO B;  3AOB A;  3BO3 A;  4DV2 F;  3FBF A;  2IAJ B;  2W9B B;  2QIF A;  3K59 A;  2IBO A;  1KVJ A;  3L7P A;  4JI0 J;  4QWB A;  4HEA 9;  2N4D A;  4OYX A;  1EAR A;  1JLE A;  4ECU A;  4OX8 A;  4NZ7 A;  4NLX A;  1WEZ A;  4ECW A;  3TZX A;  3NGU A;  4ZMM A;  3MUR P;  2B56 A;  3OJS A;  5KT2 A;  1WOP A;  3W9H A;  1ZA1 B;  1K1S A;  4L3N A;  1YGY A;  3PIO Q;  4C3K A;  3MR2 A;  4IO1 A;  2BW2 A;  4KE5 A;  3R97 A;  3X3U A;  5HO4 A;  1NHU A;  3LH2 S;  3N01 A;  4Q2L A;  2DH8 A;  2RQC A;  1Q7L B;  2LMI A;  3G6E S;  5MLC V;  4CCH A;  3C6U B;  2HMI B;  1DUR A;  3SSR A;  3MMA A;  2QGF B;  2MZQ A;  4TY9 A;  2ZD1 B;  4M63 A;  3HLU A;  1RZM A;  3VGV A;  4CLP A;  2VG7 B;  1YZ6 A;  2FC8 A;  2C2E A;  1FHT A;  1TMM A;  2DCU B;  1HAR A;  2V9K A;  2DNR A;  1B4S A;  2GMH A;  2FVR A;  1AA1 B;  2EBE A;  4ZVO B;  2F4V J;  4QU7 A;  4FVM A;  5ETP A;  2XI2 A;  3VTI A;  2UXD J;  4FYW B;  3M05 A;  3MCO A;  2XSJ B;  2LEA A;  1NKB A;  1TUV A;  2F9D A;  4XPE A;  1RDR A;  3TEH B;  3P96 A;  3WX4 A;  4RBU A;  4H54 A;  2V0N A;  4OI0 A;  3VVT A;  3DRS A;  1RAI B;  2ILZ A;  4RW9 A;  4C98 A;  4M5M A;  4R0J A;  3BN4 A;  4ES1 A;  3W2W A;  4KGM A;  4GVB B;  4WPA A;  1XBW A;  2B0G A;  2LEB A;  4YQW A;  2KKH A;  4MK7 A;  2VZ9 A;  1UVN A;  4Q2M A;  4QJV A;  4TU9 A;  1MMN A;  2CQ4 A;  4YEA A;  3H42 A;  1QY7 A;  1N5T A;  2MMY A;  2NCK L;  2D74 B;  2KJW A;  2XG8 A;  5BR8 J;  1X5T A;  3N5B A;  2V4J A;  1O51 A;  2NZC A;  2ZVS A;  5A6W A;  1NJY A;  3NXZ A;  1FD2 A;  1Q8I A;  2ZM6 F;  2XY5 A;  2HHT A;  1CJU A;  1GX5 A;  2HVD A;  1R8A A;  2K3I A;  3M8Q B;  5HMW A;  5KG4 A;  3G4S S;  4Z37 A;  4IOB A;  4RJV A;  3MR3 A;  2C2O B;  3KUG A;  3V6H A;  1SIZ A;  1UA0 A;  5ETO A;  3Q24 A;  4ED1 A;  4RW4 A;  1KTQ A;  2BOP A;  3MMC A;  1T95 A;  2E9T A;  2JRS A;  1VJQ A;  1B99 A;  2GC8 A;  5A8R A;  4WP3 A;  1R7I A;  1OY8 A;  2UP1 A;  3KLG B;  1C4A A;  4G1Q A;  1FDA A;  1Y11 A;  4NCB A;  4Q7A A;  3TX0 A;  4ZLL A;  1FEE A;  2HHQ A;  2R7X A;  2Y1R I;  3SQG B;  1XNQ J;  5F8G A;  1HBM A;  4CO3 A;  1IKW A;  3SCJ E;  2BRL A;  1HNV A;  4NA3 A;  3OL8 A;  2XZD B;  1JXE A;  2CPZ A;  2LP4 A;  4F3M A;  4DCO B;  1XMB A;  3KLH B;  2PII A;  2LU1 A;  4OZL A;  3Q83 A;  4USM A;  2C2M B;  2UVR A;  3BKT A;  2M0G B;  1Q79 A;  2JFD A;  4P71 A;  3V6K A;  3GJS B;  3J7A N;  4F36 A;  3VAH A;  3FEX B;  4F8R A;  3GG0 A;  2XB2 D;  2R2S A;  5EWF A;  4V1A k;  4N56 A;  1JLC B;  2GMJ A;  1D0E A;  3GFX A;  2QX0 A;  4X4N A;  3PCO B;  4DR1 F;  3CCL S;  5KG2 A;  1MLA A;  2Z2Z A;  1R0A B;  1M1G A;  2HVH A;  3UI3 A;  3D1Q A;  4B9M A;  4CH1 A;  5IQ6 A;  2HGM A;  2D3O R;  4ICL B;  4DR3 J;  4JI7 F;  5IZH A;  4F4X A;  4TQR A;  4M5D A;  1Y3J A;  3E51 A;  1PBU A;  5LOQ A;  1KTV A;  2I38 A;  4R0E A;  3X1L B;  3T9Z A;  1HD1 A;  1RJJ A;  2MKY A;  4OV6 A;  2R8G A;  4DDF A;  2CUY A;  4CLS A;  1ZM4 A;  4LF4 F;  3AOC A;  4C97 A;  4USV A;  4ITS A;  3SCK E;  3UFC X;  2M2B A;  1GMV A;  4RR5 A;  5C7P A;  1DTQ B;  2ZBP A;  2R9L A;  3HX9 A;  1WEL A;  3J7Y I;  4DR7 J;  3I82 A;  2COL A;  1F2H A;  3EMT A;  1LV5 A;  4WJB A;  3D1O A;  3TWZ A;  1IR2 A;  4P2M A;  4LR7 A;  3ZZZ A;  2VDH A;  3CJR A;  4MT1 A;  1RQ0 A;  5JMN A;  1U49 A;  2QT7 A;  2WVE A;  3UN3 A;  3AB4 B;  1R31 A;  3PW4 A;  1UWA A;  3MED A;  3EVM A;  1EB0 A;  1QVG R;  4IQM A;  4DN9 A;  5CYM B;  4B3S J;  1FK9 A;  2QYG A;  3UCZ P;  2V8V A;  3KWM A;  2X1B A;  3DRP A;  1HBO A;  1UMJ A;  4NA1 A;  3HHL D;  2GML A;  2MQM A;  3KLF A;  3D9B A;  3CCE S;  4Z2X A;  2UUB F;  1LW2 A;  1S79 A;  4QR2 A;  4OLP A;  4ZS6 A;  3BH6 B;  1UKU A;  4IFV A;  2HQG A;  1N0V C;  4DLG A;  1WF0 A;  1OY6 A;  2KZM A;  1DQA A;  3MUT P;  1RWN B;  2HBQ B;  4A4J A;  4RWW A;  1S6P A;  1KQG B;  1LWF A;  2WCX A;  3NGT A;  3TZZ A;  4BCA A;  3IXQ A;  2R7R A;  4Q44 A;  4PPD A;  4IG3 B;  1UWB B;  1V3S A;  3R9L A;  2PMZ D;  4DR6 F;  4QIV A;  3H25 A;  4K5S A;  3SSQ A;  2NXC A;  1CS4 A;  3JXO A;  3CCQ S;  2FLN A;  1RBO B;  3A8I A;  3KK3 B;  1B0V A;  2DNP A;  2GJF A;  2C2K B;  1KOO A;  5IC4 B;  1FRK A;  2R8H A;  3TVY A;  1NSP A;  2HAI A;  3I32 A;  4JI8 F;  3D5M A;  4JV5 J;  2QLB B;  2HFZ A;  2VJU A;  3CJT A;  3RB3 A;  1UVJ A;  4BC7 A;  3OSN A;  4ELT A;  2BDP A;  2E5L J;  2HZA A;  2AJ1 A;  1EJ7 L;  4USU A;  2DBB A;  1LFP A;  3M8R A;  3T5K A;  1JB0 C;  3CW2 C;  3UPF A;  4U8Y A;  1TL3 A;  2XWY A;  3ITH B;  4NYO A;  3HCX A;  3VCD A;  5GAG U;  2CZ9 A;  1S9E B;  4DV3 F;  4OX6 A;  3DLG B;  1P6T A;  3HHL C;  3CWJ A;  4USI A;  2RRA A;  3UO0 A;  2AJ2 A;  1LFW A;  2J6T A;  4N8N A;  3C15 B;  3WDO A;  2WOM B;  4A8O A;  2ZJR Q;  1CJV A;  4ECS A;  2J9D E;  4C3L A;  2J7K A;  1KQF B;  1S7H A;  3LF0 A;  4AXJ A;  2YPZ A;  2P8I A;  4Y28 C;  2CAJ A;  4CLY A;  5ITH A;  1K9M T;  4K7Q A;  5ETV A;  3SI8 A;  3M2R A;  1QUP A;  3QMQ A;  4AD6 A;  1X4F A;  1S1U B;  2ZBR A;  1JJC B;  3UNY A;  1GMW A;  2HFU A;  1RKI A;  1VS3 A;  4HHH A;  3TEG A;  3OVS A;  3QJL A;  1NK0 A;  3NOG A;  4C0B A;  5THW A;  2F8E X;  4PQU A;  3NGR A;  2AIR B;  4K50 A;  5DDP C;  3MUM P;  5LJ3 Y;  4JI3 J;  4DSI A;  5F9N A;  1R0B G;  3PX4 A;  2ZUA A;  4M5L A;  1AFI A;  3HSD A;  3A3P B;  1U45 A;  2YWK A;  1WNE A;  1LWX A;  4OL8 A;  3DC2 A;  2ASJ A;  1FJG F;  4OYP A;  2XWX A;  4NCG B;  3DHX A;  1AZS A;  1U47 A;  4ZVT B;  3PG9 A;  4LRA A;  2IYG A;  2R7O A;  1MMD A;  2JNJ A;  4C8N A;  2G13 A;  3KK2 B;  2FLP A;  1RWM B;  4FNI A;  3JSM A;  1ULR A;  3GB0 A;  1NK6 A;  4K4Z A;  4QWC A;  2DO4 A;  5IWA F;  1X4H A;  2VBY A;  4LF5 F;  2HK3 A;  1WUU A;  3H90 A;  1WC3 A;  2VIH A;  2AJF E;  1ZA2 B;  4RW8 B;  4UQG A;  2WBR A;  1IR1 A;  1TVR B;  4GO7 X;  1SXL A;  2MB0 B;  4WXO A;  1HNW J;  5L1K A;  4TYB A;  3VAG A;  3H98 A;  2Y1L B;  4DCJ B;  9RUB A;  2RUG A;  1N48 A;  1U8W A;  4MFB A;  4LF7 J;  4K0K J;  1OMS A;  2MQO A;  1K44 A;  2ZHA A;  4TLR A;  1D9D A;  1CSJ A;  2PA3 A;  5HBM B;  1DTT B;  1U1M A;  2K06 A;  3AXM A;  3AOD A;  3O44 A;  3DKD A;  3Q8V A;  2DNN A;  4LSL A;  4I2Q A;  4DMZ A;  5HVH A;  4OJ1 A;  1NKC A;  3R7S B;  2KYZ A;  4OLO A;  4DLE A;  1FXD A;  2XC9 A;  3M9O B;  3P8B B;  5IQQ A;  2RDI A;  4X4U A;  3T5J A;  3W1Y C;  3MPV A;  1GK8 A;  4O3P A;  4NLU A;  4KSE B;  4Y2C A;  3GIR A;  3NY0 A;  1G1X A;  2YNH A;  1RT5 B;  2VA2 A;  4AXI A;  4GKK J;  5EX3 A;  1VRT B;  4F3Q A;  4CLT A;  4I0W A;  3S01 A;  3TQ1 A;  1SI9 A;  4JYA J;  2YWF A;  3HD2 A;  1T0T V;  1RBA A;  2BA9 A;  1TKX A;  2DGU A;  1PO6 A;  3RB6 A;  3KLI A;  3ZTO A;  3DGV A;  1ZZN A;  2IVM A;  2QZ8 A;  1VJW A;  1YJW S;  5A6P A;  3N0V A;  1NB2 A;  3G82 B;  3G9C A;  1RUS A;  1FX4 A;  2XCP A;  4M5N A;  3ET6 B;  2GZO A;  1S9F A;  3M2V B;  1O5J A;  5KT7 A;  4PAB A;  2E5H A;  4OHW A;  3ISZ A;  3NGK A;  2JLF A;  2HBR B;  3IR5 B;  3LP0 B;  4ECR A;  2XHW A;  2V2V A;  3OR1 A;  1KBR A;  1SH0 A;  1DAX A;  2Y1J A;  2DT9 A;  5KT3 A;  2V34 A;  3HPO A;  3US5 A;  4NLR A;  4H4M B;  4ZN3 A;  3RUB L;  3UDE A;  2XS5 A;  1MU2 A;  1IKX B;  2B9W A;  1OQ3 A;  2M9K A;  3VQT A;  1FVQ A;  5A8W B;  2QC3 A;  5B0G A;  1IVZ A;  3ZXW A;  1H38 A;  3HT3 A;  3H4B A;  2YY3 A;  1YJ9 S;  1K47 A;  3O1L A;  3MM6 B;  4YR2 A;  4ZCL A;  1HIY A;  1U7L A;  2L3M A;  5D8H B;  4ELU A;  2ZH3 A;  2YNF A;  2BAB A;  2JSX A;  1S1X A;  2V4Q A;  2HHS A;  4BHQ A;  1T03 B;  5BJR A;  3Q8Q B;  1WC5 A;  2RDD A;  2DJW A;  4JI7 J;  3HFK A;  3RW7 A;  1ZBT A;  2MY8 A;  4DPX A;  3B82 A;  4C48 A;  2UUW A;  3MTK A;  5L9N A;  2DHS A;  5T7L A;  4OI1 A;  2DNG A;  4C0O C;  2ADB A;  1TMJ A;  1MML A;  2BM0 A;  1FER A;  2E5I A;  3K5M A;  4LF4 J;  2VFV A;  4F4Y A;  1IBM F;  2J9C A;  3M8P A;  1ACM B;  1GNK A;  1PJ5 A;  4Y2M A;  4YY3 J;  4PYA A;  2NPI A;  5GAE I;  3GYG A;  3PX0 A;  2FYX A;  2PC6 A;  3JAM U;  1TKZ B;  2W2M P;  4NMX A;  1WHX A;  2A1B A;  2V94 A;  4U6P A;  3KJN B;  1KP6 A;  4C11 A;  1RWO B;  1ZM2 A;  2Y1I A;  1EET A;  4NYP A;  3VGT A;  1UET A;  2MJU A;  2AJ0 A;  3PW0 A;  5HP1 B;  2IFX A;  1BD6 A;  1FA0 A;  3K5L A;  3GWC A;  2HSE B;  2WBM A;  3W9J A;  4A8Q A;  1V5V A;  1SH2 A;  3DOM A;  2G1H A;  4HTI A;  2I0X A;  9ATC B;  3DMJ A;  1FNX H;  1WG4 A;  1XNR F;  5E3A A;  1N6Q B;  4DS5 A;  4DUY F;  5KFE A;  3MM5 B;  4A8W A;  1VRT A;  3BGR A;  2XS7 A;  2DCL A;  4KFB A;  3K7R A;  3RAX A;  3PEH A;  4RBV A;  4NL5 A;  2XYG B;  2P2C B;  1X5P A;  3NGD A;  3BBC A;  4HR2 A;  1U1K A;  3DNC A;  3HK2 A;  4NRU A;  3HVW A;  2BR0 A;  2WTF A;  4FXW A;  1MWY A;  2CG8 A;  4DL3 A;  2LYV A;  4RWX A;  4DR6 J;  1HNI B;  2LCW A;  1RAG B;  4HHJ A;  1REV A;  2B8P A;  4J9P A;  1Q86 T;  2YQ0 A;  3KJV A;  3OFG A;  4NLG A;  4IYQ A;  4C8L A;  2XO7 A;  4YB5 A;  3H59 A;  3POT B;  2HQI A;  5L46 A;  3M2V A;  2VDI A;  2D3O 1;  2UU9 F;  4N47 A;  3LP2 B;  5KFB A;  2ZWP A;  4RU2 A;  5HRO A;  1U0H B;  4F04 B;  1YIT S;  4CRJ A;  4F4W A;  4MK9 A;  1U1L A;  2DHA A;  2QYC A;  1JX4 A;  2B6A B;  4QR1 A;  3OXL A;  2GS8 A;  2CDR B;  4UY8 5;  3CD6 S;  1HYS B;  5B7W A;  2R2U A;  1QE1 B;  2MEW A;  2HWI A;  3HHE A;  1TTH B;  3QGP A;  2OI2 A;  1SV5 A;  4M5K A;  3FBB A;  3TAM A;  1S1W B;  4DL5 A;  4OJ3 A;  2O3D A;  3UNG C;  2GJI A;  3IFE A;  2E66 A;  2KI2 A;  5L1L A;  2UXB F;  4G1I A;  4LBI A;  1XWL A;  2CDQ A;  3JTO A;  3GCX P;  1RB0 A;  1FKO A;  3CNQ P;  1IBL F;  3BYP A;  4F67 A;  3T1H F;  1SJ3 P;  3GYN A;  1Q53 A;  3VVU A;  4Q45 A;  5C2G A;  1AUS L;  2HZC A;  3CJK B;  2ZH6 A;  4NE9 C;  3QT5 A;  2DK2 A;  2N3L A;  3LP1 B;  3K17 A;  4DQP A;  3K8W A;  1RT3 B;  3TJ8 A;  4WIQ A;  1YJ7 A;  1YK9 A;  1F6T A;  1FFW B;  4MH8 A;  3OFE A;  4IR1 A;  1KS2 A;  4KR0 B;  2C1E B;  3Q22 A;  3H0P A;  4BLG A;  3JYT A;  5ETL A;  3CXC R;  5AXN A;  1LKZ A;  3V6D A;  4X64 F;  4LMZ A;  4QU6 A;  3DI6 A;  4WKR A;  2CWX A;  1HR0 F;  2QMU B;  4HAC A;  1RWX B;  4LF9 F;  4LUB A;  5A0Y A;  4DR2 J;  4IG0 B;  2G0I A;  2CXE A;  4ZVS B;  3WIV A;  4X4R A;  3TUZ C;  2YTC A;  2BYC A;  2BMB A;  5HLF B;  2HNZ B;  3Q2T C;  3FNN A;  3MEG B;  4CWB A;  2AYM A;  1CBK A;  2FHO B;  1KDN A;  2BOA A;  3W5Z A;  4O4R A;  4RW6 B;  2C2R A;  3IP0 A;  5L9X A;  2NZ4 A;  1SQE A;  1RLD A;  2DGQ A;  2WVC A;  2CZ4 A;  3FZB A;  4FPR A;  4LRD A;  4LFA F;  1TL4 A;  2NXU A;  4DV4 F;  5IM0 B;  2GAH C;  3IO1 A;  4NPO A;  1EHW A;  4C7Q A;  3MM8 A;  2HBY B;  2CA9 A;  3IN5 A;  1RT6 B;  2YVS A;  5J2Q B;  3ZZO A;  1L3V A;  1BQN B;  3L7O A;  5GAH U;  1AUD A;  2KH9 A;  1C1C B;  3LWL A;  3OL6 A;  1D9F A;  4ZA1 A;  4OHY A;  2HS4 A;  1NHK L;  2FJA B;  1C0U A;  3FJ2 A;  1S0O A;  2Y9H A;  2HQC A;  4EMD A;  4WK3 A;  2HHX A;  2F1F A;  2AV5 A;  2OEL A;  2H5J B;  3M6V A;  3J7Z T;  3LAL A;  2CJ9 A;  2ZC4 A;  3NL0 A;  2PFF B;  5CYQ B;  5J2N B;  3DYA A;  1ZET A;  3CD0 A;  1S6Q A;  4Y2A A;  4KO0 B;  4UOG A;  3CME S;  3OTD A;  4ENO A;  2O67 A;  5ETM A;  2I5J A;  3I96 A;  1AT1 B;  3I0R B;  3BN7 A;  3BGF A;  2Q6B A;  4DL2 A;  2NRE A;  4PUO B;  5D3G B;  4KH0 B;  4EYH B;  4X66 J;  2HQ3 A;  1TUW A;  3VZI A;  4O44 A;  1UW4 A;  5I3U A;  2ERR A;  2FUG 9;  1HPZ A;  1CVJ A;  3LA0 A;  1A7G E;  3DU5 A;  2DPJ A;  1TKT A;  3UD4 P;  4KPY A;  4OYB A;  2XMM A;  2FPH X;  3D28 A;  3T5L A;  3CC4 S;  2WSF C;  2DD8 S;  5SZT A;  3A13 A;  4JI6 F;  5IT9 U;  3MR7 A;  1JLA B;  2VF3 A;  2RDJ A;  3E3X A;  2B4V A;  4PG4 A;  2KG1 A;  2AJQ A;  3CJK A;  3NMR A;  3NNC A;  4NI2 B;  3GCW P;  2J8S A;  4I56 A;  2Z2L A;  1LWC B;  3EXC X;  1QTN B;  2BE7 D;  2HRY A;  1RHJ B;  1H2T Z;  4ZVE A;  4QWD A;  4WFZ A;  2G1D A;  1Q8L A;  3ETO A;  2PDA A;  3CDE A;  2VOD A;  3ILO A;  3OXF A;  5CQG A;  2EKN A;  4YHH J;  3ILJ A;  1X5S A;  1TQL A;  2XO6 A;  2VFU A;  1IKV A;  4FKX A;  2YKN A;  4ZIV A;  2KVQ E;  4LSN A;  1N5Q A;  3IBF B;  2UUC F;  1PBA A;  5KFH A;  1HNZ F;  3G8Q A;  1URN A;  3MEC B;  1UVI A;  1J27 A;  5KFT A;  1S77 D;  1M5S A;  3W8G A;  4MIW A;  3LAM A;  2V50 A;  2B4U A;  1IBC B;  1Q8B A;  4RUC A;  3M2U A;  1DLO B;  1CUL A;  2VPZ B;  1WTB A;  3RBZ A;  2HRU A;  2RHS B;  3NRB A;  2HAF A;  4NEY A;  1FRJ A;  2AGO A;  3FRZ A;  4PG8 A;  1TV6 A;  3TX8 A;  1Y5L B;  3CIZ A;  4F0M A;  3M32 A;  3OPK A;  2HS0 A;  3QGG A;  1S49 A;  2XY7 A;  3L4B C;  4H4O A;  1IM6 A;  4DL6 A;  3EZ5 A;  3OD2 A;  1C0T A;  3GV5 B;  5ETK A;  2ZDP A;  4QPX A;  1IUJ A;  1JLF B;  2MKC A;  5ETQ A;  4LQ9 A;  2GVZ B;  3DLJ A;  2CQH A;  2HFO A;  3AB2 B;  2EG1 A;  3D54 A;  1YVF A;  2BBE A;  1W2B R;  5J1E A;  4QW8 A;  1T05 A;  1WC4 A;  2KM8 B;  2YWE A;  3UN2 A;  4WZQ A;  2VAS A;  3SBM A;  2QLX A;  2W2O P;  1JLQ B;  3I5B A;  1S76 D;  1OJ4 A;  4LQ3 A;  3WC2 A;  2AEM A;  3MPW A;  4HLB A;  3PKY A;  2I1R A;  4IKA A;  4F0H A;  1FRM A;  4ZCM A;  1RAF B;  4B9L A;  1K1Q A;  2DNQ A;  3R2C J;  3DCA A;  3EPG A;  3GJQ B;  3MPU B;  3TP2 A;  1MRO A;  2GFF A;  3G96 A;  1NJW A;  4WXW A;  3I0R A;  2DXE A;  3V5R A;  1F5B A;  4F50 A;  1ITP A;  3PRV A;  4TN2 A;  3RJM B;  1S6U A;  3QWP A;  2VQF J;  5DDO C;  3IMQ J;  3EM1 A;  4IOA Q;  1U6F A;  1QDU B;  1NHV A;  2CPX A;  5AXM A;  4HDH A;  1NDL A;  3P3D A;  3DU6 A;  5KFF A;  4TY8 B;  1I6J A;  2IYI A;  1N36 F;  1RAB B;  2OSQ A;  4I4B A;  1VCT A;  5HMY A;  3DOK A;  1GMW D;  3IRX B;  3J81 j;  4ES2 A;  1RBL A;  1YLX A;  1PCA A;  1RT4 B;  4YFU A;  2R2T A;  4IDK A;  3NCP A;  2R8I A;  3MZI A;  2W4C A;  1MSW D;  2XUL A;  4EYI B;  4U67 Q;  2CPI A;  4MK8 A;  4C4W A;  3WC0 A;  2XZW A;  1YRT A;  4TXS A;  4FS1 A;  2NYH A;  2UXC J;  2BE2 A;  1Q4R A;  4MIA A;  5F0W A;  4NLQ A;  2BKO A;  3LGM A;  1SKU B;  3M9M B;  2X3G A;  3PRB A;  2OPQ B;  3IWL A;  2YNI B;  2VG6 B;  3NNH A;  3UE2 A;  2RAQ A;  1VGY A;  4O4G B;  3AFG A;  2A2C A;  3AHP A;  4KT0 C;  1E6V B;  4AL6 A;  4LR8 A;  3FCW A;  4GVL A;  3FMB A;  1OWX A;  2Z30 B;  5HAN A;  2YX1 A;  2CQ3 A;  1UFK A;  1OIA A;  2Q1L A;  2DY1 A;  1WG1 A;  4U9R A;  2W7A A;  1YTY A;  1TP7 A;  2N3O A;  1F3V A;  4MYT A;  2YKM B;  1JNZ B;  2MZJ A;  3VGS A;  3MMB B;  4PZV A;  2XQC A;  4K4S A;  1WHY A;  1H7W A;  2IJF A;  1JKH B;  4C0H A;  4RZR A;  1M0S A;  1WAC A;  5KFN A;  1UTA A;  2DXD A;  2AEF A;  2RKI B;  2W9C B;  1RKJ A;  5AE1 A;  4ED2 A;  1YDL A;  5CAB A;  5B0C A;  1B7Y B;  5JVH Q;  2WVD A;  4FXD A;  3MOZ A;  2R2R A;  2Y8W A;  4F26 A;  4X64 J;  3K57 A;  2IHR 1;  1CEZ A;  1HWJ A;  4F25 A;  2YNG B;  2XSF A;  1H2V Z;  1A6L A;  2XYH B;  3BR9 A;  1IXK A;  1KKH A;  4X84 A;  4H4K A;  2KDO A;  4K59 A;  3MFH A;  4AQY F;  3RW6 A;  3C6T A;  4DV5 F;  5IV4 A;  2XS2 A;  4NXM F;  4J9O A;  1Z4U A;  3ILI A;  4J5O A;  4BWJ A;  4RW7 A;  4FYD A;  3SFG A;  5DJB A;  2KL8 A;  3SDE A;  3LGN A;  3C16 B;  4DV0 F;  4CQ1 A;  3HMJ G;  3IA0 A;  3H5X A;  3QFW A;  4QCL A;  1N56 A;  2KHC A;  2ROP A;  4Q0B A;  5CD4 A;  4K4V A;  4LFA J;  2OP5 A;  4DV4 J;  1K0V A;  3CTR A;  5DLG A;  5HQL A;  4DSJ A;  3ETM A;  3O6Q A;  1WC0 A;  3SEO A;  5AXL A;  2L9D A;  1HHQ A;  4C8Y A;  2DR6 A;  8AT1 B;  3M8W A;  3OUY B;  2FDN A;  5EHH A;  3T9N A;  5CYJ A;  1AB8 A;  2PFD A;  4DSF A;  3U1L A;  5I42 B;  1Q1K A;  4DSE A;  3GG1 A;  3H4D A;  4JI1 F;  1TL7 A;  2DRB A;  3W63 A;  1SJR A;  4AUK A;  2FTR A;  3TZW A;  3ZTR A;  4CTA A;  4Y2K A;  3FDS A;  4UW2 A;  5C42 A;  4MIB A;  1M1K T;  1CJT A;  5LMU J;  3Q86 A;  1QAY A;  5MAO A;  4AFF A;  3QZ7 A;  2QLF B;  3CT9 A;  2AW0 A;  3PJX A;  1RCX B;  5B0F A;  1SL1 A;  2IRX A;  3PYE A;  2W2Q P;  3CIM A;  3PFO A;  2MTL A;  1EKR A;  1JXV A;  1RHK B;  4O0I A;  1S5Z A;  5K5M A;  4K4Y A;  1K73 T;  2RQM A;  4ZKA A;  2BXJ A;  2DGV A;  1FWL A;  3V2U C;  2J0Q D;  1RE1 B;  3NP5 A;  4DEZ A;  3CB4 A;  3DM2 A;  2XNQ A;  3EZO A;  3C14 B;  2HVE A;  3GU0 A;  2VQE F;  2H5I B;  3BV8 A;  3KFW X;  1YJU A;  1F9F A;  1J5O B;  2ZEJ A;  1FTR A;  5ETT A;  2IPO B;  2D69 A;  1DJ0 A;  2EK6 A;  4JI6 J;  1IN0 A;  4JI4 J;  2FHJ A;  3HP6 A;  4J9K A;  1NJI T;  1HWK A;  1XMQ F;  1BE4 A;  1VK8 A;  1N33 F;  2DNL A;  4C6A A;  1AXQ A;  3MDF A;  4LFC J;  5KFU A;  1EX8 A;  3DFE A;  5AJ3 F;  3QIP B;  3KK1 A;  3S8S A;  1NK9 A;  1S1T A;  3KLE B;  3B4M A;  4X4T A;  4ANE A;  5M2U A;  5LMN F;  4JOU A;  3GJT B;  2AX0 A;  2MQP A;  1S9G A;  3FSI A;  4CYU B;  4RBT A;  3LQV A;  2ZKT A;  3CCS S;  4PAA A;  4MYU A;  1ZTT A;  1YRU A;  1X9W A;  3JQM A;  3R5C A;  1HBU A;  3R1H A;  1J5E J;  2XM3 A;  2J6U A;  3K0J A;  1OPZ A;  2W1B A;  2F4F A;  3SV3 A;  2RF2 B;  4P9S A;  1OYE A;  2UUC J;  4YR0 A;  2PSZ A;  3I4P A;  2KXH A;  1XEZ A;  2DGX A;  2VJV A;  4OHV A;  4N77 A;  2RIJ A;  2CRL A;  2OHD A;  2N7C A;  1NZ8 A;  2K8G A;  5GAG I;  2BAN B;  1KLM A;  3TAR A;  1GXT A;  1DQ9 A;  3BSN A;  3CED A;  1LW0 B;  4RO0 A;  1HQE A;  5CD4 H;  2H4Y B;  4ECT A;  5H9F J;  4ZHR A;  1LQ9 A;  3DN9 A;  2JOQ A;  3UR3 C;  4O3S A;  3IG1 A;  3TAN A;  4UT4 A;  2EC0 A;  4P7V A;  2WW4 A;  2UZA A;  5KAK A;  4ED0 A;  3I4H X;  1SH3 A;  4DX8 H;  2ZNY A;  2W7P A;  3L9Z A;  2BJ7 A;  3AQP A;  3T19 A;  5HSP A;  3LWM A;  4DBQ A;  3MFI A;  1SVD A;  1SUQ B;  3PEJ A;  4X4P A;  2WZ1 A;  4DCP B;  1VC6 A;  2I9S A;  1KEK A;  3CD5 A;  3KOA A;  4B3R J;  3HDS A;  2FLO A;  5E3R A;  1EP4 A;  2CFX A;  3A4T A;  1RAH B;  5C25 A;  3OTO F;  2XY6 A;  2N4C A;  4B9S A;  2U1A A;  3BQ0 A;  3PIP Q;  4MMO A;  5E0O A;  3IM8 A;  1KQK A;  1TL1 A;  3AY0 A;  4KKO A;  2A0F B;  8ATC B;  4M1K A;  5D4L A;  4ID5 B;  1T9T A;  3VAF A;  1BWE A;  4UST A;  2R7U A;  1QSS A;  4IRC A;  3K8V A;  4KGZ B;  2Q66 A;  3LAN A;  5GMK a;  3W8P A;  2HIY A;  4P2X A;  2AGQ A;  4KAI A;  4FDF A;  4KV8 B;  3PKM A;  1RTH B;  3MCM A;  4HI2 A;  3QRR A;  2OPR B;  2GHV C;  5EDW A;  4TLQ A;  4K4X A;  1BWV A;  4RNM A;  2YBV A;  4TU7 A;  2YXL A;  3QRQ A;  1VQ5 S;  4DHV A;  3PR4 A;  3QID A;  4WK1 A;  3OTB A;  2DTJ A;  1RI7 A;  3UN5 A;  4J9Q A;  3GFZ A;  2FZC B;  4AL5 A;  2PMH A;  4O23 A;  5B08 A;  3UVJ B;  1RTJ B;  1S72 S;  3QBC A;  2ZH5 A;  2RSQ A;  3DLE B;  1RHU B;  3RAQ A;  5K14 A;  1V3R A;  5HQ8 A;  4LF6 F;  2JVO A;  1T9W A;  2HNY A;  1GXL A;  2XMA A;  3MI7 X;  4L76 A;  1HWU A;  4ED8 A;  2JEG A;  4DPU A;  2CJA A;  3D0H E;  2GX8 A;  4AT1 B;  4K2X A;  3VR1 A;  2DGT A;  3MEE A;  2AF6 A;  3FBE A;  3CCT A;  2HHW A;  1VQN S;  2AYG A;  1P27 B;  3QAT A;  4DR4 F;  1IWA A;  1RT2 A;  5JJB A;  3VAL A;  5ETN A;  3Q8U A;  1XN9 A;  3HSJ A;  2DNZ A;  4DUT A;  3FK4 A;  2HHH F;  3IWN C;  3U02 A;  1NH8 A;  1ZM3 A;  3IS9 B;  5F8H A;  5K8N A;  5LM7 E;  2XMU A;  1H6K X;  4OX9 J;  3MM7 A;  4UUW A;  6FDR A;  4PWD A;  5A8K B;  3CJS A;  1HL6 A;  1RAA B;  4WU2 A;  2FB0 A;  4PG7 A;  2GVD A;  3V4I A;  1JLB A;  1KLN A;  2EFQ A;  1HBN B;  2BX6 A;  5C24 B;  1AFJ A;  3T3F A;  2BAN A;  5KFS A;  3W2V B;  1LWE A;  4ZVH A;  3NS5 A;  1UP1 A;  4I7F A;  2K1R B;  4OHZ A;  1N32 J;  5KFV A;  1SKS A;  2FJW A;  2ZFH A;  1U6Z A;  1RTI B;  2ASY A;  2B9Y A;  1YX2 A;  4M94 A;  4YN3 B;  5AE3 A;  5DM7 Q;  2C3P A;  3BR8 A;  3QYY A;  3I5C A;  2NUU G;  2H1Y A;  1SJQ A;  3TAQ A;  4NRT A;  5EX0 A;  4ZPV R;  4U7U D;  3MMJ A;  3N28 A;  4I2P B;  1IBK F;  4B3T F;  5LL6 d;  1UVM A;  1PYO B;  3NGS A;  1Y4Z B;  3DLK B;  1IJF B;  1FEH A;  4ZVG A;  3OFH A;  2VBZ A;  3SCL E;  4Q8E A;  3D3B J;  2XGQ A;  4WFX A;  2ZE2 A;  3FFI B;  5KG6 A;  1IQT A;  4KHP F;  2WON A;  2F8H A;  3QWU A;  3TI0 A;  5DGB A;  5HAO A;  2LXF A;  1LOU A;  3UDV A;  2F9J A;  4DV7 J;  2EFO A;  5AXK A;  3AJ2 A;  4NXM J;  1R27 B;  2KZZ A;  4ZCI A;  2DNK A;  4DX6 A;  2K7J A;  2CNN B;  2ABY A;  3DOL A;  3K5O A;  3E01 B;  5KOX A;  4GKJ F;  2FC9 A;  3ENA A;  3T41 A;  4NXN J;  6AT1 B;  4IFY A;  4WE1 B;  1A9N B;  5LSO A;  3MF5 A;  1TFW A;  2DHG A;  1SBR A;  1H98 A;  2ZDO A;  5KFQ A;  4DV6 J;  2ZKU A;  2HIQ A;  2LEP A;  3T1Y J;  3C2P A;  3N9U C;  1QJH A;  3BQ2 A;  3FZ2 A;  2CQ0 A;  2CJB A;  3S7R A;  4UOH A;  4JI1 J;  2CIM A;  4RX6 A;  1N5Y B;  3QO9 A;  1BHN A;  4X4S A;  3WIU A;  5D0R A;  2FZG B;  3DGP A;  2VBW A;  3CSK A;  2DNH A;  2M88 A;  5DM6 Q;  4ID8 A;  2PN6 A;  2ZBQ A;  4FN5 A;  4E8U A;  4OI6 A;  4CH7 A;  4Q5V A;  4I6W A;  3CCZ A;  3KMS A;  2HG4 A;  3W60 A;  1ZAX A;  4P75 A;  3M1V A;  3NAH A;  4EUV A;  3P5B P;  1NK5 A;  3MR5 A;  1U2F A;  1MWZ A;  3EGN A;  3KNA A;  1NZA A;  2BJ9 A;  2RT3 A;  4DG1 B;  1MG7 A;  2RH3 A;  5F8M A;  4PXD A;  3FMW A;  1C1B B;  2VQE J;  3GV8 B;  3MAA B;  4ECZ A;  1FKP A;  1WKL A;  2VG5 B;  5HL7 Q;  3W62 A;  3HHL B;  5LT5 A;  4K2J A;  1CG2 A;  1YJR A;  2GGP B;  5T41 A;  2QFI A;  1U1O A;  1ROF A;  2C42 A;  2D7S A;  1NH7 A;  4OHX A;  1RT7 B;  1T9Y A;  3Q8S B;  2HQD A;  2MHN A;  4RUB A;  3K5P A;  2MXY A;  4G6V B;  3RB0 A;  2RRB A;  2BJ8 A;  1WD6 A;  2ZH8 A;  2M8H A;  3EE3 A;  3NMA A;  3A3O B;  2DYA A;  3CCU S;  2DR8 A;  1V9O A;  2X7I A;  1N34 F;  1B64 A;  4O3N A;  3PY8 A;  2MY7 A;  5J2M A;  2B7C B;  4ZOS A;  4LIR A;  2N7Y A;  1D1U A;  2CQ1 A;  1UEK A;  2E1A A;  3R27 A;  3NWG A;  1UCN A;  5KFL A;  1VRU B;  1U48 A;  5G0R B;  2V69 A;  3CCV S;  2A2D A;  2FGC A;  3A8E A;  4B3M J;  2XNR A;  2HS3 A;  4KRW A;  2IM2 A;  4KHM A;  2IRY A;  1X5O A;  5HK4 A;  3QGI A;  5D78 A;  4P74 A;  3OHA A;  4P52 A;  2CJY B;  2RVJ A;  2IC3 B;  7FD1 A;  2MLX A;  2W8L A;  5CZX A;  2CJX B;  3PR5 B;  2ZOF A;  3GR0 A;  3IBC B;  2ZH7 A;  3O2I A;  2OEM A;  1O0P A;  3EXY A;  3CC7 S;  2UVU A;  2DR7 A;  2Y0B B;  1CJK B;  4ECV A;  3I9Z A;  1UJ5 A;  2ZJQ Q;  2F63 A;  3RRG A;  2IM3 A;  4DUZ F;  3V81 B;  3ULH A;  4LRF A;  4M95 A;  1HQU B;  5K9F A;  3Q0A A;  5J2P B;  2XTJ P;  3AA8 A;  1VQM S;  2L41 A;  2OIH A;  3MPY A;  1RAE B;  4DV1 J;  1UVL A;  2DR9 A;  1TU0 B;  4WKY A;  4LF8 J;  3CO9 A;  1YRX A;  4ANC A;  1E6Y A;  1FRI A;  2MGZ B;  2VFS A;  2IAJ A;  2W9B A;  1FX2 A;  2CNO B;  5GAD U;  1HW8 A;  4M5H A;  4R8U B;  4CLZ A;  1T02 A;  3CPW R;  2RU3 A;  4DX5 A;  2KTQ A;  3Q8Y A;  1I5O B;  5B0D A;  4PRF A;  2JC0 A;  2VH7 A;  3PM9 A;  2GHW A;  2F40 A;  1WOO A;  1U25 A;  3NEK A;  1U2C A;  4JI2 F;  3D6T B;  5JUM A;  4RL1 A;  3M30 B;  3MHY A;  4HVZ A;  1UEU A;  2UUA J;  2VFT A;  1RSC A;  3PO5 A;  4RU9 A;  3W65 A;  4ETX A;  3C6U A;  3GSI A;  2HMI A;  2MKS A;  2ZD1 A;  1KVK A;  2V68 A;  2VG7 A;  2KXN B;  2B5J B;  2MQL A;  4LFB J;  5E3C A;  3I0S B;  1RP5 A;  4KHR A;  2K7K A;  2CPF A;  3TA1 A;  2M7S A;  3CDA A;  2H3E B;  2GIQ A;  5GAH I;  4P10 A;  2AZ3 A;  3ZTQ A;  1DHM A;  2NUH A;  4ZIT A;  2MHE A;  1RWP B;  4NLD A;  3ZZ0 A;  4YB6 A;  3BBB A;  4DR4 J;  3B8H A;  2XSJ A;  2E5G A;  4J90 A;  1SC3 B;  4ER8 A;  1H72 C;  3CDU A;  4LBH A;  3H2L A;  3HVT B;  2XYP B;  2NPF A;  2HHH J;  2KVI A;  2Z2M A;  4MTP A;  1ZTW A;  1G7C B;  3CJ0 A;  4L6V 3;  1VRQ C;  4N7T A;  5LJ5 Y;  4MKA A;  4K4U A;  2F65 A;  4X65 J;  5C5J A;  4GVB A;  2VA3 A;  4A8F A;  5IT4 A;  5I3Q A;  4JB8 B;  4JI0 F;  2KYX A;  2OPP B;  4KQZ A;  2V67 A;  2A6M A;  4ZDN A;  5K20 B;  1R8C A;  2PGC A;  1Q82 T;  4QIE A;  5FDL B;  5KFY A;  3NCR A;  2RE1 A;  3P4U B;  3MM9 B;  3SCI E;  2C3O A;  2ZH9 A;  4Y34 A;  2HGL A;  3PV8 A;  3QSY B;  4EEY A;  1L3T A;  2XI3 A;  1O8B A;  4C9D A;  4OYZ A;  1XTZ A;  1NDP A;  2GQ2 A;  1SB6 A;  3M8Q A;  2JDJ A;  3GYX B;  3OR2 B;  5DLF A;  2OPS B;  3HVA A;  4TQS A;  3CC2 S;  3UD5 A;  4B3O B;  3DXS X;  3SFU A;  3DRR B;  4F0K A;  5D0G A;  1NPR A;  4FYY B;  1HMV B;  3JAM Y;  5EWE A;  4USK A;  3G6X A;  3KLG A;  2F4V F;  2OJ3 A;  3QLH B;  3HUL A;  3OXG A;  3GIL A;  3LPE A;  1FCA A;  3SQG A;  2QMW A;  2FIU A;  1WG5 A;  3FCV A;  2J6S A;  4F02 A;  1RTD B;  3RTV A;  2F7V A;  2OLW A;  3HZE A;  3HSG A;  3PXG a;  3KLH A;  1D09 B;  2E7W A;  3GQC A;  1B7F A;  4H4K C;  3BYR A;  4ED7 A;  4KC5 A;  1ZYQ A;  4QYZ J;  1DQ8 A;  3BF4 A;  4ZPB A;  5FD1 A;  4KB7 A;  3DLB A;  1JLC A;  2B3T B;  3AJ1 A;  4WFA Q;  1ARO P;  3R5G A;  2FVS A;  3KG0 A;  1S12 A;  2FHJ D;  4CLW A;  5FJ4 A;  1R0A A;  2LKZ A;  1IQZ A;  4ZP6 A;  2XMW A;  3NLC A;  1GTH A;  4ICL A;  1SJF A;  3B6B A;  1GQE A;  3K2Y A;  4ED3 A;  2XLI A;  4EK2 A;  2O01 C;  4DV2 J;  3EUN A;  3JQK A;  4EO8 A;  1APS A;  1H2U X;  3SSS A;  4OZ2 A;  3GV7 B;  2ROE A;  4OYM A;  2FJV A;  3BO4 A;  3VWS A;  4CI0 B;  1WOS A;  2ZH1 A;  2V2Z A;  4WZM A;  3QQC D;  2ZJP Q;  2R8J A;  3TYT A;  2M52 A;  2R7T A;  1MW7 A;  2I6W A;  1DTQ A;  1TR0 A;  4YB7 A;  3RU0 A;  3PJ9 A;  3PNI A;  2M4M A;  1VOM A;  1XK8 A;  1WSV A;  3HJF A;  3KLV A;  1OSD A;  5HVF A;  4YOE A;  3G86 A;  2J0W A;  5H1S V;  4MKY A;  4ZVP B;  4NYZ A;  4PPZ A;  3HO1 A;  1FDD A;  1QUV A;  2IRU A;  3OQ2 A;  5CYM A;  2YWH A;  4R5P B;  2MLZ A;  2P5V A;  3I31 A;  2IDE A;  3R7B B;  1XQI A;  1UZH A;  2I8E A;  3MAH A;  4DN0 A;  1FF2 A;  1Y00 A;  2ACM A;  2CZV C;  4S0M A;  1XNQ F;  3MR6 A;  2HFV A;  1N4L A;  1IKY B;  1FDN A;  1TEL A;  1FRX A;  4DSL A;  4LJM A;  1GAO A;  1VBX A;  3M9N B;  3RRK A;  4P6Q A;  3LPY A;  4QIG A;  2P9E A;  1UVK A;  2B9E A;  2FJD B;  4CLL A;  2KHD A;  2OML A;  3TUP A;  4BDP A;  3HSZ A;  1F1B B;  4L75 A;  2BJ1 A;  4CO2 A;  3QT7 A;  3D6F B;  1U1R A;  2DH9 A;  1RYS A;  4WYL A;  3FSX A;  2IM0 A;  3VGU A;  2YKA A;  1FTC A;  3WQP A;  2DR5 A;  3CVK A;  1NSQ A;  4IG3 A;  5H9E J;  1UWB A;  1P9Y A;  4DF4 A;  3WZ0 A;  3DRR A;  3KK3 A;  4EBE A;  3ADA C;  4DR3 F;  1QAX A;  1BQM B;  2L48 A;  3IC1 A;  3NBP B;  4A48 A;  3MAQ A;  2Z8Q A;  1WHW A;  3GP9 A;  1VLO A;  2HW3 A;  1X4A A;  1REG X;  4ILM A;  1NKE A;  1VC5 A;  2XEX A;  3W5Y A;  4B9T A;  1JLE B;  4OJH A;  5RUB A;  1VIX A;  5IOL A;  4ED4 A;  1D8Z A;  3TQE A;  1VQ8 S;  4DR7 F;  3GIJ A;  2GV1 A;  2HND B;  3BRE A;  4LRB A;  4DU7 A;  1LXJ A;  3ITH A;  3JQJ A;  3ZZU A;  4XIU A;  4IUF A;  2ZM6 J;  1S9E A;  1R6V A;  3U7J A;  3DLG A;  3F56 A;  4QQB A;  5KG3 A;  2R7Q A;  3R5D A;  2PEH A;  3BS9 A;  3FGV A;  3C15 A;  2Z57 B;  2GO9 A;  2WOM A;  2C3Y A;  5E3P A;  1S97 A;  2D3U A;  4F4A A;  1EIY B;  4QW9 A;  3MMA B;  1BC6 A;  3C19 A;  3UDC A;  2HVZ A;  4DX7 A;  1VQ4 S;  2CPD A;  4DQR A;  1BQX A;  1VQY A;  1NU4 A;  5ETS A;  3N79 A;  3IBW A;  4FPI A;  2VB6 A;  1S1U A;  3H8Y A;  2BVZ A;  4UUX A;  1UPM B;  2U2F A;  4GRS A;  5CZV A;  2YH1 A;  1OYD A;  3D66 A;  3EVW A;  4EU0 A;  1T3O A;  3J80 Y;  2C2D A;  3D4J A;  4DL4 A;  5E2Q A;  3H5Y A;  2D41 A;  2NXJ A;  2GHP A;  1VDH A;  2MZS A;  3IR7 B;  2DGS A;  1TK5 A;  5E41 A;  1Q5Y A;  3DRS B;  1N0U A;  4RW9 B;  4B08 A;  3U1N A;  2JEI A;  2GIF A;  1SC6 A;  4JV0 A;  3Q2S C;  3W2W B;  3NKY A;  1DFD A;  4AND A;  5KFJ A;  4DOZ A;  4IH6 A;  4NCG A;  2J76 E;  1O6X A;  1RA6 A;  4DR1 J;  4UY8 T;  4CLU A;  1NDC A;  1GTE A;  3F0N A;  4ZLJ A;  1FT8 A;  3AD9 C;  5LSR A;  2V4J B;  1M5V C;  1R8P A;  4WTY A;  3KK2 A;  5DDQ C;  4FF1 A;  5IFM A;  1F3F A;  1T9X A;  2JLE A;  2V8D A;  2AT1 B;  7AT1 B;  1BLU A;  5IT9 Y;  3R3T A;  2IIH A;  3L3C A;  2FY8 A;  1R0C B;  2DEJ A;  1CJU B;  2NSB A;  2UV8 G;  2EWH A;  1PSD A;  4PG6 A;  4DQS A;  1ELO A;  5KFK A;  2A18 A;  4RW8 A;  4CM2 A;  4IQX A;  3H40 A;  2AYB A;  1TVR A;  3IM9 A;  4KYZ A;  1S6O A;  4A8S A;  4DFM A;  2W8K A;  3NWR A;  4WFB Q;  5DG7 A;  1I3O B;  1MNE A;  4RW4 B;  1XR5 A;  1N8R T;  3DDI A;  4L72 B;  5HBM A;  3MMC B;  1DTT A;  2LDI A;  3QAU A;  3ZZR A;  1IM4 A;  1S57 A;  4WF9 Q;  2VOO A;  3DDK A;  5D4P A;  4HYK A;  1PYS B;  2NYI A;  5A8R B;  3QZ8 A;  4G1Q B;  1H0H B;  1YIJ S;  2AP6 A;  2G2O A;  2CVI A;  1QAI A;  3M4X A;  3MPD A;  1HBM B;  4OI2 A;  1IKW B;  4JI3 F;  1HNV B;  1Q5V A;  3D2W A;  2DIT A;  2UUB J;  1P8G A;  4ILR A;  4YB1 P;  1RT5 A;  2MQN A;  1HFE L;  2HND A;  2AZ1 A;  2MPU A;  1Q0N A;  1GXU A;  1WWH A;  3T6J A;  2JL9 A;  4LR9 A;  3NG8 A;  1VQS A;  5BYQ A;  2CVE A;  3FSY A;  4WP9 A;  3GJR B;  2IM1 A;  4ZJQ A;  2ZHB A;  1NB7 A;  3N6N A;  1G6B A;  2D9P A;  2MKK A;  5GMD A;  1JWW A;  3G82 A;  2L9N A;  3CCM S;  1OO0 B;  1WKJ A;  4F4K A;  4C8M A;  3CJ5 A;  1PJ7 A;  4U7C A;  1RCO B;  3CCW A;  4ZJO A;  5EUH A;  3ET6 A;  4I67 A;  2SXL A;  2YPY A;  3HI9 A;  4M5D B;  1RWK B;  2CNL B;  4YDX A;  3A12 A;  1N5V A;  4JI8 J;  2BQR A;  3THV A;  2PMW A;  3DLH A;  1YQH A;  4A46 A;  5DQI A;  2HK2 A;  1NEE A;  1LEO A;  3LP0 A;  2CNK B;  1RLC L;  1T7P A;  1HNW F;  1EQ0 A;  4I1T A;  2H54 B;  3O8W A;  3W3S A;  5L39 A;  4OQJ A;  4LF7 F;  4K0K F;  4H4M A;  1QSY A;  3GMG A;  1IKX A;  3EDR B;  5E7O B;  3R6G B;  2LA6 A;  4ZP8 A;  3G6Y A;  2ZH4 A;  5A8W A;  3JS9 A;  4CO1 A;  2ZIT A;  4DV3 J;  5DO2 A;  3MED B;  3RZA A;  1RAC B;  1FK9 B;  2CYY A;  3ISN D;  3MM6 A;  4I6A A;  3OT9 A;  4FXV A;  4CP5 A;  3PVX A;  2ZOM A;  3DRP B;  1HBO B;  2ZOG A;  4CLF A;  2LDY A;  1DBD A;  3KLF B;  4Z7C A;  4DZ6 A;  2YWG A;  2EFV A;  2O66 A;  1T03 A;  4ZVQ B;  3E8O A;  1N52 B;  3DRY A;  1U2R A;  2LU2 A;  7FDR A;  2OH2 A;  1LW2 B;  2HHV A;  1NRK A;  1UZD A;  5L8R C;  4GKK F;  3OVA A;  1YJT A;  2EI5 A;  2X1G A;  3IAM 9;  2EBG A;  4IFV B;  1EQM A;  4JYA F;  3SIP B;  3TO8 A;  2UVV A;  4N5S A;  1ZAV A;  4D3H A;  5JVG Q;  2E9Z A;  2QLJ B;  1BMQ B;  2WW8 A;  1S6P B;  3V4M A;  1X0F A;  4ZLN A;  1LWF B;  2APO A;  2IMO A;  3THT A;  2DIU A;  4ES3 A;  3EZU A;  4UOC A;  1AW0 A;  2Y0S D;  1JMT A;  5L1J A;  5A2Q Y;  5CXT A;  1DY3 A;  2Q43 A;  1CS4 B;  2QJ3 A;  4PXC A;  1TKZ A;  3OLB A;  1YG0 A;  2VPX B;  3NNA A;  2M5Y A;  3GIK A;  3I56 S;  2BQ3 A;  3ZZT A;  1FJG J;  2KXF A;  2WAQ D;  2C3M A;  4NLO A;  1KN6 A;  1I51 B;  4I64 A;  2QMX A;  5HP1 A;  1W26 A;  1YZ7 A;  1VLY A;  4GO5 X;  3HHD A;  2LQB A;  1PAE X;  3CJ4 A;  1WOR A;  2IJN A;  1M90 T;  5KFW A;  4ZPW R;  1TK0 A;  1N6Q A;  2CPJ A;  2G9O A;  1F60 B;  3UWT A;  2UVW A;  4EO6 A;  1TL3 B;  3MM5 A;  3PHT A;  3GTY X;  5IWA J;  4LF5 J;  3ISN C;  5KT5 A;  3IGV A;  1WTF A;  2J0X A;  2A6O A;  3TAP A;  1R8B A;  4KJI A;  2E7V A;  3SMZ A;  4B9V A;  2GNK A;  2Z58 B;  2EVZ A;  4B17 A;  4ZVU B;  1CJV B;  1GEH A;  2CJQ A;  2KJV A;  2WB4 A;  2GAG C;  3K89 A;  1PIL A;  3PDN A;  5ADZ A;  2DNO A;  1M5K C;  3R5B A;  4QYR A;  2EFN A;  4QR0 A;  4FVC A;  3R2D J;  1HNI A;  2J7U A;  2XCA A;  2UUT A;  3FBC A;  1BGX T;  1ZOT A;  4DI6 A;  3M2R B;  4EBC A;  3RR8 A;  2VKR A;  3POT A;  1VFJ A;  3J80 U;  4NEZ A;  3LP2 A;  1U0H A;  2R7S A;  2VPY B;  4PG5 A;  3EPI A;  4PQU B;  3HT0 A;  4P7T A;  2BQU A;  4AYB D;  4QPT A;  3CE8 A;  5KG1 A;  1Y5I B;  2B6A A;  1VC0 A;  3EDQ B;  4X62 F;  2BV3 A;  2HYI B;  2XMV A;  1HYS A;  3ZTS A;  1UFL A;  4URS A;  1QE1 A;  4HH0 A;  4YY3 F;  3SQO P;  4KGV B;  2NR0 A;  3UW1 A;  5KFM A;  3LO3 A;  1H3D A;  1S1W A;  3CGI A;  2YQ1 A;  3C46 A;  1DAR A;  2ZZM A;  4DJB A;  2AMC B;  2J9D A;  1W25 A;  2OEJ A;  2E5J A;  1P1T A;  2AYE A;  4NWB A;  2OUG A;  1QSL A;  3EWG A;  1AZS B;  5B0E A;  2G4B A;  3BGU A;  2BJ3 A;  3C8Y A;  3JSM B;  1UL3 A;  3J81 Y;  4FF3 A;  2LQ8 A;  2UV8 A;  2DHX A;  3RRH A;  3A3N B;  4ELV A;  1Q95 G;  1XMO F;  4OYA A;  4DXL A;  2YKQ A;  3LP1 A;  2YX7 A;  4ETZ A;  2HWH A;  2DXF A;  1UPP A;  1YBT A;  2DRD A;  2J8A A;  1HA1 A;  3GSD A;  4ZCK A;  4HT5 A;  1RT3 A;  1S99 A;  4ZIW A;  1Q81 T;  4OIX A;  2IJR A;  2VD3 A;  4YP3 A;  4M5G A;  2LVW A;  4MFB B;  3HVR A;  3ICL A;  2ADC A;  4DPO A;  1CPZ A;  2IVF B;  4A8Y A;  5EN1 A;  1RAO A;  2PE8 A;  4CT8 A;  1JK9 B;  2MYF A;  1FES A;  4LSL B;  1JIH A;  4I2Q B;  2CQP A;  2P6T A;  3AT1 B;  1IJE B;  1SIW B;  4G65 A;  4IG0 A;  3AAW B;  1CC8 A;  2WSE C;  3HXM A;  5HLF A;  1HI8 A;  4EGL A;  2YNH B;  3VAM A;  4YR3 A;  2HNZ A;  3HFZ B;  3BKF A;  3CCJ S;  3MEG A;  2XBP A;  5EWG A;  1Y10 A;  1WC1 A;  3T6B A;  1NK7 A;  4RW6 A;  2A10 A;  3G6V A;  1LK7 A;  2CAD A;  2DPI A;  1TKX B;  4PWW A;  1F0X A;  2MQ8 A;  3KLI B;  5F8N A;  1Y3K A;  4DSK A;  1T8E A;  1KNZ A;  5IM0 A;  2MZT A;  3TJ9 A;  4NZ0 A;  1RT6 A;  1IBM J;  3BSA A;  5J2Q A;  3HKZ D;  3PZP A;  1DRZ A;  1UAW A;  1BQN A;  2FJE B;  5J1P A;  2HQF A;  1RU2 A;  1KON A;  2NXN A;  1C1C A;  1U0S A;  3PAC A;  2HEK A;  3V6J A;  1R3N A;  4KGK A;  1WEY A;  1NCL A;  4W92 B;  3PFE A;  1SKW A;  1W7W A;  1NAQ A;  3UCG A;  4OZ1 A;  2LEC A;  5DQG A;  2OFG X;  5DRK A;  8RUC A;  3VAJ A;  2J9E A;  3OR1 B;  1WDT A;  3HFV A;  2HWT A;  4L74 A;  3GE9 A;  3P49 B;  2MSS A;  3BDP A;  5CYQ A;  5J2N A;  1EAY C;  4DPT A;  1XNR J;  1MU2 B;  1NSA A;  2WVB A;  4KO0 A;  4DUY J;  4RNF A;  2ILY A;  2DVI A;  5F8I A;  1F9E B;  4E2F B;  4DQI A;  4PUO A;  3JSR A;  5D3G A;  2AWZ A;  5D4O A;  3H20 A;  2LQJ A;  4NAS A;  2ASL A;  3H2V E;  3H7H B;  3UR0 A;  2RHQ B;  2YNF B;  2W4P A;  4N8O A;  4DR2 F;  3KG4 A;  2EXU A;  1S1X B;  2DH7 A;  4P2S A;  5HAT A;  3ONQ A;  2G2Y A;  4ZPC A;  1X4C A;  2BEF A;  4OZ0 A;  1BXN A;  3RGI A;  1JLA A;  1G3O A;  1QM9 A;  3NCQ A;  3JB9 k;  4X2B A;  3HJV A;  4NI2 A;  2UU9 J;  4LRC A;  5T7L B;  1LWC A;  5LXY A;  1J2V A;  2D1C A;  2LXI A;  1GMU A;  4J9V A;  5A2Q U;  2ATL A;  2G0C A;  4OZN A;  4W4M A;  4PXB A;  3D6M B;  1KR4 A;  1TKD A;  2QL9 B;  3QJP A;  2DIS A;  3M8P B;  1YHQ S;  4ZPT R;  3ENW A;  4DWI A;  5FII A;  3OFF A;  4J9U E;  3UQS A;  4FF4 A;  4C11 B;  2UXB J;  1EET B;  3MEC A;  5K8O A;  3SZ2 A;  3PHE A;  2M3D A;  2JH3 A;  3OLA A;  1IBL J;  4USJ C;  2ALZ A;  1DLO A;  3DOM B;  1NK8 A;  1S4F A;  2POK A;  3T1H J;  3KXD A;  4FP9 A;  3DMJ B;  3IGN A;  4Y0F A;  3M6X A;  1VBK A;  4URQ U;  2VC1 A;  2V2K A;  3Q89 A;  3ZNU A;  2QA4 G;  2FZK B;  4JUZ A;  3BGR B;  2IA0 A;  4U7U K;  2CWK A;  3CDW A;  3H5U A;  2JX2 A;  4KFB B;  3R5J B;  4EBD A;  3CUL A;  4X66 F;  1RTZ A;  4FNH A;  4F7V A;  3GIM A;  2Q79 A;  3S1T A;  1RAJ A;  4UZC A;  3J7A 1;  2OO4 A;  3D68 A;  4UF4 A;  1QD1 A;  3BJY A;  2ZHO A; 
#chains in the Genus database with same CATH homology
 3DKD A;  3EVW A;  2NCK L;  3Q8V A;  3FC9 A;  1NLK L;  1JXV A;  1S5Z A;  5IOL A;  1S59 A;  3NGT A;  1WKK A;  3BBF A;  5BXI A;  3FBB A;  1MN9 A;  5C7P A;  4CP5 A;  3EE3 A;  3B6B A;  4FKY A;  2DYA A;  1ZS6 A;  1B4S A;  1HLW A;  3EMT A;  3FBF A;  3R9L A;  4EK2 A;  3EJM A;  4KPC A;  1WKJ A;  1NSK L;  2DXD A;  2HVE A;  3ETM A;  4DZ6 A;  3Q83 A;  2DXF A;  3DDI A;  1PKU A;  1VYA A;  5CAA A;  3WX8 A;  4F36 A;  1HHQ A;  1NPK A;  2HVD A;  5CAB A;  1PAE X;  1S57 A;  3BBC A;  4HR2 A;  4UOF A;  1NUE A;  1NHK L;  1NDK A;  3ZTS A;  3EVM A;  3ENA A;  4AND A;  2B8Q A;  3FBE A;  1UCN A;  2DXE A;  1NSP A;  4W98 A;  2DY9 A;  3VGU A;  3FCV A;  3PRV A;  4F4A A;  3NGU A;  3G2X A;  1BUX A;  1BE4 A;  4ANC A;  1NSQ A;  3BH7 B;  3FCW A;  3PJ9 A;  2BEF A;  4WBF A;  4C6A A;  2B8P A;  3GPA A;  3Q8U A;  3VVU A;  1NDC A;  1WKL A;  2VU5 A;  3ZTO A;  2AZ3 A;  3NGR A;  3NGS A;  3VVT A;  3ZTQ A;  1LEO A;  3EM1 A;  3MPD A;  3L7U A;  3EVO A;  3ZTR A;  3FKB A;  3Q89 A;  1NCL A;  4DUT A;  1NDP A;  1KDN A;  4UOG A;  3BBB A;  1HIY A;  4ENO A;  1B99 A;  3Q86 A;  2CWK A;  3GP9 A;  4ANE A;  1F3F A;  1W7W A;  1NDL A;  3VGT A;  4UOH A;  2ZUA A;  4FKX A;  3BH6 B;  1NB2 A;  1U8W A;  2AZ1 A;  4O0N A;  2HUR A;  1BHN A;  1K44 A;  3ELH A;  3Q8Y A;  1MN7 A;  1XQI A;  3ZTP A;  1XIQ A;  3FBC A;  2BX6 A;  3JS9 A;  4S0M A;  3VGS A;  1F6T A;  1EHW A;  1LWX A;  3B54 A;  3EIC A;  3VGV A;  4DI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...