1WKJA

Crystal structure of nucleoside diphosphate kinase from thermus thermophilus hb8
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
137
structure length
137
Chain Sequence
MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords nucleoside diphosphate kinase
total genus 43
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1wkjA00
4DI6A 1F6TA 3MPDA 3EVMA 1WKKA 3Q83A 3DDIA 4S0MA 1PKUA 5IOLA 1HLWA 2HVEA 5C7PA 2HVDA 3VGSA 1LWXA 4CP5A 3BH7B 1UCNA 1B99A 3FBBA 3EJMA 1NDCA 3ENAA 2NCKL 1WKJA 3EICA 1NUEA 1NDLA 3BBFA 4W98A 5CAAA 1F3FA 3NGSA 1NPKA 3FBFA 3JS9A 3EMTA 3R9LA 1BE4A 1WKLA 1MN7A 1W7WA 2CWKA 3VGTA 1NSKL 1ZS6A 4UOGA 3NGUA 2DXDA 3NGTA 3EE3A 2AZ1A 3BBBA 5BXIA 2DXEA 4F4AA 1BUXA 2BEFA 2BX6A 4KPCA 1XQIA 4FKYA 1LEOA 3EVOA 3Q86A 4ANCA 1XIQA 5CABA 3L7UA 3BH6B 1VYAA 4FKXA 2B8QA 4ANDA 1NDPA 4ENOA 3ZTQA 3B54A 3ZTSA 1NDKA 3FBEA 3ZTOA 3VVUA 2VU5A 2HURA 2DYAA 1BHNA 1NB2A 1NHKL 2DY9A 3FC9A 3PRVA 3VGVA 3ETMA 1HIYA 3VVTA 2DXFA 3Q8YA 4DZ6A 4C6AA 2ZUAA 3FCWA 1NLKL 4O0NA 1NSPA 1PAEX 4DUTA 3GPAA 3DKDA 3B6BA 3Q8UA 3EVWA 2AZ3A 1EHWA 3G2XA 1U8WA 1MN9A 1S5ZA 1S57A 3EM1A 3ZTRA 4UOFA 4HR2A 3FCVA 1K44A 1B4SA 3NGRA 4UOHA 1HHQA 4WBFA 1JXVA 3Q8VA 3VGUA 3FKBA 3BBCA 4F36A 3WX8A 4ANEA 1S59A 3Q89A 2B8PA 4EK2A 3FBCA 3GP9A 1NCLA 3ZTPA 3ELHA 1KDNA 3PJ9A 1NSQA
chains in the Genus database with same CATH superfamily
1DAXA 1UMJA 3ENWA 1RACB 1VLYA 2JRSA 1U49A 4F2SA 5D3GB 4RW8B 1C4AA 4C3KA 5AE2A 5GAHI 4C11B 5LXRA 3UD4P 1N8RT 2QV6A 5K8NA 2XMWA 3DHWC 3PJWA 1HW8A 2GQCA 2GIQA 2FJXA 3DLGB 1RT2B 2DHXA 4CP5A 1NSAA 1N32J 3FSXA 2D3ZA 2G0JA 4F4KA 1UVIA 4NMLA 3QRRA 1RCOB 3Q8SB 1B99A 2QSWA 1SH3A 3FBBA 3C6TB 3M6WA 2VPWB 4NYZA 3WDOA 3OVSA 2FB0A 1MU2A 1VQNS 1C1BA 2DO4A 3KUGA 2J0WA 2R7OA 1CJKB 2KFNA 5E7OB 5JJBA 5GAHU 3G6XA 2ZM6J 1FX2A 4OI1A 3QZ7A 2J8SA 3TUJC 1N5QA 1RWWB 2XQCA 2KH9A 4PKDB 3M9MB 1IXKA 2LEPA 4J37A 3C3LA 2HK2A 1N5SA 3R9LA 3M30B 2R2RA 2V69A 2VIHA 4FYDA 2KN4A 4OI4A 4R25A 3TAQA 3O1LA 2E1PA 4ZVSB 1U1QA 4RJVA 2CADA 3J81Y 1FJCA 4I6WA 4MT1A 1S1UB 2YXLA 3FK4A 1XMQF 4M5DB 2QC3A 5DG9A 1S6PA 2G1HA 2Y3YA 5F3TA 3CWJA 3KDNA 2DNPA 2HAFA 1RA7A 4G65A 3B78A 2FHJD 2LU1A 4OI2A 2AZ1A 4RR5A 1C2PA 3FUYA 2LQ8A 2VBYA 5E3CA 1X9WA 2R7RA 4JI1F 1YITS 1WSRA 4JV5J 1HFEL 1S9EB 2V34A 1T9XA 3TZWA 3A13A 4UZCA 2C1EB 3WZ0A 1EARA 1X5OA 5J2MA 2E44A 2L3MA 1ZZNA 2XMUA 2IY5B 1AT1B 1WDDA 1FO1A 3FZBA 2Y1JA 2DVIA 4AQYF 4B3OA 2HK3A 2MKCA 4QWAA 4JV2A 4PWDA 3M2UB 1JXEA 1RLDA 1PC4A 2GX8A 3P5BP 1RWUA 2AW0A 3VWSA 2VFRA 1LWEB 3IAM9 3SCLE 2X3DA 2OPRA 1N5VA 4C6AA 1JX4A 1N54B 4WFBQ 1CJVA 1A6LA 3G6ES 3OFHA 3W9IA 3VCDA 4N8OA 3ITHB 4QWBA 5HMXA 1RHUB 2W2PP 4B02A 1NSPA 4P72A 4YHHF 4IRKA 1QY7A 3GIMA 4K4WA 2P6TA 2VG6A 5GAEU 2RVJA 5EHHA 2PMHA 2ROPA 3BYPA 5IM0A 2F63A 2RKIA 4WKYA 4DR2F 1W2BR 2KYZA 3N01A 4QYZJ 3W5ZA 1RWXB 2Z4PA 4GO5X 2HGMA 1J27A 1EQMA 3D6TB 3I9V9 3HM9A 3M8WA 2GVDA 1F5AA 4DUYF 1TVRB 3D3CJ 3NGRA 2IRUA 3QMQA 1H98A 5L1LA 4JI8F 3KOAA 1FE0A 4F0MA 3A1YG 2V5HG 4P10A 1YJVA 4WTYA 5GAEI 4ELTA 4JI7J 4CM0A 2JH3A 2B51A 1NK6A 1K8AT 1X4FA 2CNOB 5KFSA 4DG1A 3VQTA 3R7BB 2JEGA 2KU7A 3MEKA 3MECA 2FQQB 4OYMA 3S7RA 4J9SA 1JXLA 3ET6A 3EXYA 3PRDA 3A3PB 4OV1A 1JLCB 2C2EA 1FD2A 2HNYB 3JAMY 1VQOS 3PG9A 3NNCA 1NU4A 1OY6A 3H5SA 1U0HB 4ZS6A 3KLGA 3MPDA 4YY3F 1QSLA 1WORA 3KK3A 5DM7Q 2HRTA 2VBWA 4QYRA 3Q83A 2CPEA 2YQ0A 4FYWB 3M8QB 3CCES 3BM7A 3POTA 3I6PA 3SI8A 4R8UB 2HVIA 1VISA 1Q8KA 1SC3B 3R6LB 4HT5A 1C0TA 2J9DA 4BLGA 4ED6A 2OPRB 3BSNA 4DL4A 3OXFA 3QPIA 5GMDA 1KQSR 4DPWA 3JB9k 1RTDB 2MZQA 2YY3A 3T19A 4X62F 3U1NA 4NE9C 5L8RC 5L39A 3VR1A 2R7TA 2DNHA 4UZBA 3M2RB 2OELA 1N4LA 1VQKS 1T95A 4V19X 2DR7A 2CA9A 2YPZA 4K0KJ 3BKUA 1NJXA 3FVYA 3CCSS 5ETKA 4B3MJ 1IJEB 1LW2B 2IYIA 4M8LA 3UDVA 3CMES 5D15A 1DTQA 5GADU 2HWIA 1RU2A 2R4FA 2V4QA 1F5BA 2O5DA 4FPRA 2CQ1A 3MR5A 2IM3A 1NJYA 2E9TA 4UOGA 3EX7B 1CLFA 4NPOA 4ALZA 3GIKA 2GAGC 2QIFA 3LP2B 1RHJB 5KFVA 3L4BC 3NGTA 1IKYB 3EE3A 4TKTA 2IDLA 3J7ZT 2DR5A 5IT0A 2IA6A 4W90B 1J5EJ 3Q8PB 1WF2A 4F4AA 3GONA 5B0GA 5A76A 5GADI 3KK2B 3CCMS 1WACA 2HEKA 4RPFA 1FKOB 2KVQE 1X5TA 4G1QA 4LRCA 2WSEC 4F02A 3KLIA 4F04B 2R8IA 2B3TB 4F50A 1PBAA 2YX4A 2AGPA 4IOAQ 1WEXA 2LQ5A 4WU3A 4L76A 2ZH7A 2ZZMA 2CJKA 2RDDA 3MXHP 2DR6A 4KGKA 4DV0J 1X4CA 3PW7A 4B9MA 4YMEA 3GJTB 2BRLA 2CQHA 1TUVA 3EWGA 4WFXA 4ZP6A 5KOXA 5KT4A 3VALA 2XY7A 3RBDA 2E5LJ 1C1BB 1ZAXA 1FK9B 2C2RA 3KMSA 1LW0B 5G4DA 2HNDA 2DYAA 3C6TA 3PEHA 4DV3J 4DFKA 2RNEA 3MPWA 4TN2A 1VLOA 2XMJA 4CIOA 2HHVA 3EDRB 2C28A 1NPRA 5E3PA 2EPIA 3NAIA 2AMCB 4F3MA 2E1MC 2JC1A 1NJWA 2I6WA 5HO4A 3BQ1A 3LWLA 4CO4A 3EGNA 2M3DA 3B8HA 1PO6A 5DZ6A 1SBRA 3OD2A 4EZ9A 1RKIA 1YSJA 1JJCB 3C15A 4WXWA 5SZTA 1WTFA 1JLEA 2M5YA 5FD1A 3O2IA 3EGWB 3BSAA 3GWCA 4M95A 1GEHA 1UJ4A 3ZO7A 3OTOF 1U8WA 1RT6A 1RBAA 1LWFB 4IDKA 4B3MF 3FMWA 1H2VZ 2OH2A 1UVLA 4TY8B 1CS4B 5AXMA 1TKTA 2OTJS 3BN7A 1FRXA 3E8OA 3IP0A 5MLCV 3PRBA 1KS2A 1HI8A 4RW9A 4ZPAA 2NREA 1R6YA 3PIOQ 1NXIA 1X0PA 2V63A 2E1CA 1G6BA 3KTQA 2IC3A 3WX8A 1KLNA 2IJFA 3AOAA 4G1IA 2HHUA 2GIFA 1NJIT 5HQ8A 1XMQJ 1SUQB 1Y7PA 1IM4A 2KJVA 1UAWA 4IOBA 1LV5A 2RUSA 2OPPB 2IBKA 1B7FA 4U7CA 2XY6A 2OSQA 2V2KA 3NGKA 2C42A 2W4DA 2R3VA 3ZNJ1 3UCGA 2I0XA 1FWKA 3KJVB 2CPXA 2UUCJ 1NSQA 2VA3A 1DARA 5F3ZA 1T02A 4ZVHA 2N82B 3D1QA 5H9EK 3R2CJ 4DR1F 3M32B 3TOQA 4YS2A 2LKZA 9RUBA 5IV4A 3H40A 4DV7F 1YWXA 2XM3A 3MR6A 4J9NA 3PZPA 5D0EA 3THTA 5A8RB 1RA6A 4KTQA 4RNOA 2YBVA 1SUQA 3ILJA 1ICEB 4UW2A 4M5JA 4AQYJ 1R0AB 1D0EA 2YX7A 2FHOB 4FZVA 2HHWA 4OMFG 1LK7A 2ATCB 4A48A 4ED4A 3ISND 1U09A 3M8PA 2CNNB 1NDCA 1TL4A 2CPYA 3GIRA 4PYDA 3EXCX 2VBZA 1C0UB 1R3NA 4I1TA 2H1YA 2XNQA 2CQGA 3GYGA 5A8WB 3OW2R 3EUNA 2R2UA 3UN2A 1KC8T 3QRQA 4K4SA 1TELA 2GHPA 2B9YA 2F4FA 3QT5A 5HANA 1KFDA 1CC8A 4ED1A 4W92B 2H51B 2RDJA 4LSNA 3P49B 2EKNA 5DO2A 4OZ3A 4TY8A 1NBEB 2BOAA 2D1CA 3K2YA 4DCJB 4LF7J 4K4ZA 2CQ2A 2QL5B 1FNMA 1O51A 2LQ9A 2RT3A 3DMJA 2M88A 4WXOA 5J1NA 1Q82T 1SV5B 4Y3CA 1NEEA 2D3UA 2X1GA 2RMLA 4CLKA 1PJ7A 2YX1A 2JEFA 3ET6B 2H5JB 2PMWA 2VODA 2R7VA 4FS1A 3HLUA 1PYOB 3LPEA 3TA0A 1VQ5S 3PO4A 4JI3J 4CQ1A 4F26A 1W26A 3CPWR 2JDJA 3ZC4A 4EWTA 1JNRB 4GKJF 2K8GA 1WC0A 2DJWA 5F9LA 1YJNS 1AYEA 3KLFA 2ZD1B 3CC7S 3HHNB 5IXUA 3A4TA 4PXEA 3M9OB 3JTOA 4AXJA 2D9OA 4JV5F 4U8VA 5IM0B 1RDRA 3V6JA 1OSCA 4FKXA 5IS2A 3I31A 1OS5A 2Y8WA 2VPZB 1S7IA 2Z8QA 3R5CA 3AD8C 4NLYA 3CIMA 1SVDA 3ILOA 4LR9A 4FXWA 4IQMA 4ZOSA 3BO3A 2D69A 2HNYA 4LIWA 2CVEA 2AKWB 2I9SA 4TLRA 1GX5A 4C98A 2CPHA 1NNDA 1EP4A 3BGRB 2HURA 4PZVA 1RT5A 1RHRB 4FS2A 2VKRA 3NOGA 4QQBA 4DEZA 1XMOJ 1URRA 4AL5A 4RW7A 1MWQA 5FDLB 5IWAF 3HFVA 5LT5A 4DBQA 5HMYA 1S0MA 4CCHA 3KLHB 3RW6A 3UDLA 3AFGA 3DRSB 4OYOA 4RBUA 3UWTA 3H20A 4ECSA 3PX6A 1NJZA 2BYCA 4X64F 1KNZA 1PAEX 4MKVA 1Q95G 1IR1A 2B9EA 5E3QA 4DUTA 1LW2A 3Q8UA 5IZHA 4QYZK 1ITPA 2FVPA 1UW9A 1U2FA 3QAEA 1OPIA 1U0HA 2J8AA 4KBIA 4QZVB 1SKRA 4ED5A 5D4LA 3WX4A 2LVWA 3DRYA 3D5MA 4N77A 1J5OA 5D0RA 3IM9A 1XNRF 2OFHX 3ZTRA 3VQSA 3Q2SC 4DFPA 1Q81T 1HNWF 3HJFA 3MMBA 2X3GA 4QR2A 1P1LA 3W2WA 1L3KA 3OSNA 5C42A 2NZCA 1HHQA 4HTJA 2QSFA 1AB8A 3VGUA 2GS8A 2IJNA 4F36A 5LSRA 3NOCA 1KTQA 3HD2A 1WWHA 4HHJA 4OHVA 3Q89A 5KG5A 2CRLA 2MKKA 4DN9A 3IR5B 2H5EA 3LUYA 2OPSA 1VRQC 2Z2ZA 3WQPA 4L72B 2ADBA 4Y2MA 5ETSA 3HULA 4X4QA 2V8VA 2JX2A 4OYBA 4DI6A 5KFCA 4I68A 3LANA 4HH0A 2JL9A 2Y0SD 3DMJB 4RUCA 2G4BA 1WC6A 2GO8A 3MAAB 5CZVA 5HK4A 2O1PA 3DOLA 2HHQA 4ED8A 1LQ9A 2HBZB 3R7NB 4CT9A 2RD5C 3AY0A 4HI1A 5G0RA 3G8QA 5D0GA 4R5PB 1X5PA 4DSIA 3E3XA 5ETMA 5KG6A 3E01B 2HQCA 2ZFHA 1MWZA 2IAJB 2XCPA 4IRDA 2C3YA 4RU2A 1WOOA 2QL7B 3C6UB 3BN4A 3EJMA 2K7JA 3OFEA 2FDNA 1TU0B 5EWFA 1NZAA 3BSCA 4WJBA 1A7GE 3A8JA 3CE8A 4LRAA 3BGLA 1TL5A 1FCAA 2NXUA 1UTAA 3DOMA 4DL5A 3MDFA 2MGZB 5KFHA 3MR7A 4DCPB 4JI3F 2AEJA 3CJSA 3G87A 4QU6A 2F1FA 5LXYA 1DFDA 2UUTA 3BS9A 4YB6A 2HHTA 1C1CA 1R8AA 1HD0A 2JVRA 3A3NB 3R5AA 3AXMA 3T5KA 2HPUA 4EEYA 1NSKL 4OYPA 3L9ZA 3NS7B 2W24A 3HKZD 1U8SA 4IG3B 3P45B 2FZKB 5C2CA 3Q2TC 4CT8A 2FVQA 1UA0A 3H2VE 4IH5A 5B09A 4I4BA 8ATCB 2V67A 1HWIA 3ZNUA 4X4PA 1OY9A 2B4UA 4KIAA 4RW6B 3QJPA 5K14B 2FYXA 1G7CB 2RDIA 4ID5B 1M5KC 4IG0B 1T9TA 5KFKA 2YKAA 3FQKA 1LEOA 2OP5A 2XS7A 3HHEA 1U1MA 1FNOA 4C8OA 4Y28C 5ETLA 1U0SA 3OJSA 2KHCA 3TEHB 3KYLA 2JNJA 3AD7C 1WG5A 1WDTA 1FDNA 3GU0A 4ZVTB 1CBKA 4KV8B 4FVCA 2CWXA 2M8HA 3GG1A 4JOUA 2ZHAA 2J0SD 5KFPA 1R8PA 1M5VC 2ZITA 3N79A 3CSKA 3C16A 4I2PA 3KJVA 4U67Q 1K1QA 3D54A 4ZVUB 3SQGA 2OAUA 5C25A 4Q45A 2EI5A 3M8PB 2ZD1A 5ADZA 4YB1P 3HI9A 2GV1A 1JLQB 2CVIA 1VQPS 2XSFA 4L73A 3VVTA 3MFHA 1CJUB 4DV4J 3CXCR 4NA3A 2DD8S 3LGNA 1UFWA 2UUCF 4FBUA 5L9NA 4K4VA 2KKHA 4NZ7A 2BMBA 1ZZFA 5EN1A 2YKNA 1TAQA 2GVDB 1VFJA 2YNFA 3TJAA 4CTAA 2R2TA 2VJUA 2Q1LA 3QGHA 2D41A 5HAOA 3SQGB 5C25B 4DS4A 3V4IA 1B3TA 4H54A 1H38A 4DV7J 1NMEB 3D66A 2WAQD 4PWUA 2XC9A 4C8YA 2NXJA 4F4YA 4PPZA 1RTIA 3W7BA 1OYDA 5J2QB 2IVFB 1RISA 1U45A 2DCLA 3N5BA 4YDXA 4QW9A 2YH1A 2DNOA 4AL7A 1T9YA 4OHWA 3W1YC 1I6JA 2FLPA 4MKBA 3KLHA 3K58A 5DJBA 3FDSA 5JUMA 1F1BB 3QIPB 1M5OC 3GE9A 1RADB 1UZDA 2MJNA 2YNFB 4WBFA 4CTAB 1VRTB 4PUOA 3DRXA 2O01C 4TU8A 2Z2YB 2ZC3A 1Q5VA 2FY8A 2ZOFA 4OYAA 2B9XA 2E7VA 2GNKA 4HLBA 4USIA 3CCRS 1FRJA 1IBLJ 3V81A 2CPIA 1HBUA 2HGLA 2BACA 1SKSA 1YQHA 4KHPJ 2KYXA 2ZH2A 2ZUGA 2LXFA 2HWHA 3PO5A 1KDNA 2HS0A 3JYTA 3ZZZA 2ZH3A 1K0TA 3KNAA 2XMVA 2J5AA 2O67A 3M2VA 4E0DA 3EZ5A 1HHSA 2C3UA 3CJTA 1WHVA 1UVKA 3DXBA 4ETXA 1G4CA 4OYXA 4OX6A 3KHGA 2QA1A 1QDUB 5KFGA 3BPDA 3CD6S 2QX0A 1U6ZA 2MQNA 2W25A 4ES2A 4M94A 1E6YA 2DNNA 2HVEA 3UFCX 4MKYA 2XB2D 4X66F 1FHTA 2DB1A 4LFCF 2NSCA 4A4JA 1FFGB 2KI2A 4DSEA 1N5YA 2CQDA 3IGNA 4PG5A 5BR8J 1UVNA 3SEOA 1UW4A 3DRRB 2XHCA 5J2NA 2WVDA 3DFEA 1SL2A 4JI4J 2FLOA 4NI2A 2Q79A 2LXIA 3HCXA 3KFWX 3MM8A 4LF6F 4C3MA 5FJ4A 1RT5B 3BV8A 3HVAA 3WC0A 5KT7A 1YHQS 2XHWA 2JC0A 3AT1B 5ETVA 4JP8A 2Z2MA 4ZHRB 4BWJA 3VZHA 2MQ8A 4NLVA 4H4KC 1VOMA 4ID8A 5FIIA 3PYEA 4EYIB 4XK8C 5DQIA 1Q1KA 1FFSB 1XN9A 1ROFA 3T5LA 2IHR1 1T11A 4BWMA 1HNZJ 1M1GA 3BGUA 3L09A 3KK2A 5IT9Y 3OTCA 1N33F 1B64A 3MOZA 2VOOA 1SC4B 4ZJQA 4L6V3 2WZ1A 3TUIC 2Y0BB 2A0FB 4EBCA 2P9CA 1PSDA 1U6FA 2COLA 2VG7A 3HDSA 3BQ0A 3M2RA 1VQMS 1P27B 1YJ9S 1YJWS 2MLZA 1TL1B 4LF2A 4QWCA 3QWPA 2XLIA 3R1LA 1A0OB 3ILIA 1MW7A 4IH7A 1QAXA 1RABB 5K20B 2MKSA 3BBBA 3LP1A 1CJUA 1NK9A 1WNEA 1XTZA 1SKUB 3JXOA 2VFUA 2D7SA 5C42B 3D68A 2B9WA 3NP5A 4V1Ak 3SQOP 3M9NB 3RB6A 1R8HA 1ZM2A 4I67A 2VOPA 1XNRJ 5ETPA 4DFJA 5D3GA 1AROP 3KHHA 4P2SA 1HWJA 2O66A 3CD7A 3HSJA 2A10A 1RJJA 5EWGA 3LF0A 2FGCA 4PXDA 3UO0A 5LL6d 1KEKA 2W7AA 5K8OA 5DQGA 3HHLC 2XULA 3UVJB 3N6NA 2CJ9A 3LGHA 3MAQA 2M7SA 3OTDA 3GILA 3ZTOA 3IR6B 2YVSA 3U02A 1KQFB 2H9ZA 2N7YA 2J7UA 1YBTA 2YWHA 2BM1A 2V2ZA 3VVUA 3OUYB 1SKWA 4J91A 1NO8A 3SSSA 4J9LA 1NHKL 4M5NA 4ZJLA 1LXNA 5B0DA 2IM0A 4WFAQ 1VQSA 4OL8A 1RBLA 2FZGB 1BWVA 2EEYA 2P2CB 3A12A 5F8HA 3RB4A 1SIZA 2AV5A 2DH8A 3HFKA 2BRKA 3CJKA 2ZKTA 3CJ2A 4O0NA 4Q43A 3IC1A 3M8RA 4I6AA 2YH0A 2ALYB 2CJAA 2AX0A 4J9PA 1HA1A 2ZBQA 4ZPTR 3TANA 4OX7A 3R97A 1JJ4A 1S9FA 4DR3J 2VZ9A 3NMAA 3US5A 3HP6A 4DR6J 2IFXA 4LSLA 4XAKA 2QN6B 2APOA 3VAFA 2AWZA 2CXEA 2WK4A 3I0SA 5K8MA 2FJDB 3MPVA 4ZPCA 1N0UA 2HNZB 2HFNA 2J0XA 3C8YA 4AL6A 2PGCA 1U1NA 1WF1A 2BE9B 1S6QA 2E5JA 5CYMB 3CJKB 1JXVA 2NXEA 4CO3A 2QGFB 3JSMA 4GMKA 2ZH1A 1K9MT 1JK9B 4WE1A 4AT1B 4DR5J 1S59A 2ILYA 4TU9A 4DPUA 2B8PA 2MPUA 3BGOP 4EK2A 3AHPA 4A8XA 5KFMA 1Y10A 4JI1J 2VPYB 3LWMA 2AJ0A 1YGYA 2M8DB 2VONA 2VFTA 3ZTPA 3AAWB 4NEZA 4X66J 2W9CA 3CDAA 1Q79A 1UZHA 3AQOA 4XO0A 4DV6F 4DS5A 2HBRB 2J6UA 4AE5A 2LU2A 3I0RA 3M30A 4JI5F 4IR1A 4DR2J 2HQ3A 5BR8F 3HFZB 5EWEA 4A46A 1WKKA 4DPXA 4IFYA 4LBIA 1JLFB 2ZOGA 2H54B 1HBOB 2KTQA 2HZCA 1YTYA 3BO4A 2DHSA 5I42B 1JLGA 2HVDA 1I51B 3N28A 4LFAJ 1OJ4A 2EKYA 8AT1B 3IS9A 2BA9A 3JQJA 1IBMJ 1BWEA 3LP2A 1K1SA 3F41A 3HF5A 1B7YB 4YY3J 5KFDA 1XERA 2XMTA 1TUGB 3HHLA 3N6MA 4CNYA 2BR0A 1M5HA 4YN3B 3K5PA 1N56A 4BHQA 4EU0A 3PJXA 4USHA 3TYTA 2X7IA 1R0BG 4CH1A 1HNVA 1XWLA 1F3FA 3C66A 4RX6A 4U9RA 4TU7A 4KFBA 4DV4F 1CULB 3AB2B 5A8RA 2JLFA 4TNOA 3TJ9A 1RHQB 3A8KA 4KGZB 1WEYA 4M5HA 4QPTA 2GHWA 3I0SB 5F8MA 5D78A 5J2MB 2MZTA 2ZDOA 1ZOTA 3R5JB 1BD6A 2IVYA 2V2QA 1QAYA 4O4GA 1EJ7L 4MH8A 1HQEA 2ZOMA 4ZCIA 2UUAJ 3CTRA 3CF5Q 4DR4F 4NLSA 2YTCA 5KFXA 3CJ0A 3SV3A 1XC9A 4JV1A 5AT1B 1RT3A 1TMMA 4ZLLA 4JYAJ 3MMJA 6FDRA 1TL7B 1YDLA 4KO0B 4W4MA 5T41A 3DGVA 3Q8RB 4F4ZA 4IOCQ 1NB7A 2HHXA 5J2PA 5BXIA 4YFUA 7AT1B 1F2GA 1IUJA 1TKXA 3TX0A 2YNIB 4U7UD 1R0AA 5ETNA 3AB4B 2JFDA 4O3OA 2XI3A 4Z7CA 4YR2A 3K0JA 1SV5A 3PW2A 1ZH5A 1U7LA 4OYIA 2KT2A 1KLMB 1FDBA 3BH6B 1VK3A 3CW2C 4LIRA 4USMA 5HMZA 2AGQA 2XS2A 3HK2A 4DR7J 3O6QA 5CYQB 1LWFA 3MMAB 2M4MA 4IDKB 4CLUA 5J1EB 2HGNA 4B9VA 2WB1D 4M5KA 3LH2S 5GAGI 2HHHJ 2W2QP 3QLHB 4IFVB 2RH3A 1NHUA 4CLPA 3DYAB 1VI7A 6AT1B 2QRRA 2QMWA 2Z56B 4HI2A 3W9HA 4DL2A 3MCNA 4QOTA 5CZXA 4B3SJ 4DV5J 1YIJS 2I38A 4USVA 2EFOA 2YNGB 1VQYA 2FJBB 4CO5A 1REVA 3RG6A 2W2MP 3UR3C 5H9FJ 1YX2A 2VDHA 1V9OA 3MMCB 1QLNA 1BXNA 4N56A 2DK2A 4NRUA 2WHOA 1YZ7A 3LALA 1FXLA 5LOQA 2RF2B 2IM2A 3DYAA 2QLXA 4MK9A 1T9WA 4C3LA 2E5LF 4MJKA 3LO3A 3G96A 2AEFA 4OZ5A 2NZ4A 2MHEA 2V4JA 2W2NP 3NKYA 2PA3A 2Z2LA 4NOHA 4NYPA 2FIUA 4M63A 5I3QA 4IKAA 4OV6A 4LUBA 4PQAA 2SXLA 1YRXA 4HVZA 3PIPQ 3OL7A 3JQKA 4EYHB 2GMHA 4HR2A 4UOFA 4OHZA 1B0VA 4O4RA 4A8QA 1K44A 1DQ8A 2V2VA 3OJUA 3D6FB 4LFBF 3MTKA 2ZH6A 3W5YA 4IR9A 1LKZA 5J2PB 2LCWA 4X65F 4YUDA 5B08A 1M1HA 1LXJA 3QWUA 4NI2B 2FGOA 4Q44A 2OEJA 1DTTA 3FRYA 3RZAA 4PWDB 2R8HA 4NCGA 2DGVA 4L3KA 1URNA 2A2DA 1N88A 2NSBA 2DNMA 2VASA 4P71A 3T9ZA 3CGIA 5AE3A 4FYVB 4DL3A 1PCAA 3TP2A 4KPYA 3EVMA 4MIBA 3W8GA 4O4GB 2JSXA 2QTWA 5IQ6A 3UE2A 4DFMA 2V0NA 1YBUA 3IN5A 2UXDF 1SQGA 1BC6A 4H4MA 4DL0C 5B0EA 5BYSA 4OZNA 5HQLA 3KLVA 1WI6A 3CULA 2VQEF 5F41A 2MLXA 3R5BA 3H25A 4DZDA 1FEEA 2WBMA 3PX4A 1EKRA 3L7PA 3TZZA 1IKWB 2YKPA 2UXCF 2NPIA 2FC8A 1YVFA 2XGQA 1T0TV 2OGUA 1HBOA 1WHXA 2B43A 5CAAA 2L41A 4MYTA 3ZZUA 3PR5B 3BO2A 1N6QB 1U1LA 3TA1A 1HNZF 1P1TA 1CS4A 3OBIA 3EMTA 1T3NA 3OHBA 2ZH4A 5E33A 4C8LA 1I1GA 4BDPA 2KM8B 3WHIA 2CWKA 1TAUA 2JLEA 4ZLPA 1XR5A 3IMQJ 4QW8A 3RRKA 2VJVA 2C2DA 1HYSA 3M8YA 5A8KB 1JLCA 1YG0A 2UUWA 4UUXA 4FXDA 1WG4A 4JI2J 1GQEA 4L3NA 5EGYA 2D3OR 1RBOB 1AZSB 4GVLA 3MCOA 5THWA 5LMUF 1SCJB 2CYYA 2H4YB 3I5AA 3OVAA 3ZZTA 4NLUA 1QM9A 3SCJE 1KVIA 4K50A 2HNZA 3RR7A 1FDAA 4ICLA 1FTCA 1S6QB 5CYMA 1HQUA 3JSMB 1G2EA 2MSTA 2V50A 2HG4A 1KVKA 3A8IA 3MR3A 3SFUA 3DOLB 4DX5A 4LF7F 1LWCB 2JEIA 1P8GA 5CH7B 2WW8A 4ENOA 2MQOA 2K1RA 1SB6A 4GC7A 3IWNC 2HRYA 1S12A 3UN5A 2KXFA 3TNVA 1JLAB 4NLXA 4DJBA 4DXLA 5L1IA 3H59A 1TKXB 2KL8A 2HZVA 4RW6A 2GVZA 2D3O1 5KFTA 3KJFB 1ELOA 1BQMB 1X60A 3MPYA 1KRPA 1H7WA 2Y1LB 4EFAC 2VKZG 2J6SA 3DN9A 2A1BA 2XBPA 2YPYA 3Q8YA 4ZLJA 5KFUA 5E3AA 4KHMA 2EFNA 1UPPA 3OTBA 6FD1A 3UR0A 5JVHQ 1LWEA 2XLKA 4LF9J 3P3DA 4LVOP 2QZ8A 2UVRA 2CZ9A 3OR1A 3B6BA 1RSCA 5IFMA 3EVWA 4GKKJ 3ZZYA 1IM6A 2G2YA 2QYGA 3PYFA 4CRJA 5HSPA 1S0VA 5BYRA 4DHVA 5KFQA 5B0FA 2ZC4A 2LA6A 1JLEB 5IWAJ 5ETRA 1HNVB 3HMJG 2ZJQQ 3D6HB 1YKWA 1U2CA 2KZZA 1RHKB 1CULA 3UPFA 1X4EA 2XGPA 4DV0F 1RKJA 3MM6A 1NRKA 2VC1A 5DS7A 3U7JA 1QTMA 1BQXA 2VFVA 1FRIA 3AJ1A 1FX4A 2OEKA 2ZWOA 4DWIA 1CJTB 1YZ6A 4ZVGA 2Z0GA 5KFOA 3TUZC 4QCLA 5F8JA 2IMWP 4J9RA 4KH1B 1IBLF 1QAIA 1Y5NB 2J76E 5KFAA 5CCMA 2XMMA 2W7PA 3TAMA 4ED2A 4NLQA 1S1UA 3MMAA 2CPZA 3MPUB 3ZFVA 3KUHA 1X4GA 2B6AB 3NS5A 4WYWA 1FFWB 2FJAB 4ZN3A 2XY5A 2DGOA 1FT8A 2BE2B 2AU0A 4PQUB 1D9AA 1T9VA 5EX3A 1LFWA 3MM5B 4L75A 4OJGA 4URGA 4C8MA 2XMAA 3PKMA 2UXBF 1LFPA 5IOLA 4EBDA 3DLEB 2YQ1A 4O3PA 2DT9A 1LWXA 2KT5A 2XO7A 4C48A 3LAKA 1RLCL 5LJ3Y 3SCIE 4TQRA 1R8BA 1UA1A 5FLXU 1EB0A 1Q78A 1R89A 4XDDA 5J2NB 4I69A 3NBPA 1TP7A 3EICA 4ZCLA 3ULHA 2W4PA 4CLYA 4QWDA 2BQRA 3TI0A 2GJIA 3R5GA 1NPPA 2OKQA 4WFZA 1S77D 2GW8A 2IMOA 2AP6A 4L74A 4CM2A 4IO1A 3NGSA 2GQQA 4P6QA 3J81j 1E6YB 3J80Y 2YNHB 2OD6A 1Q53A 2CJYB 4HACB 4QIFA 2E7WA 3M1VA 5I3UA 1WKLA 2WVEA 2XSJB 2VBXA 3K8VA 3MZIA 4NRTA 5IC6B 3PKYA 4F3QA 3NGDA 2RHSB 1L3TA 2DGUA 2AYMA 1Q5YA 2ILZA 3CJ5A 2PI5A 5JVGQ 3QSIA 1HMVB 4LF5F 1ZS6A 1S79A 2IM1A 2RJZA 2ZNYA 5KG0A 1DHMA 2E1RA 4DL6A 4KGVB 5T7LA 3K8WA 3BDPA 3P4UB 4ZK7M 5K9FA 1DTTB 3EZUA 3O5TB 3V81B 1HL6A 1RT7A 4KSEB 2GZOA 4XDCA 2LEBA 5HLFB 4ECYA 1QVFR 1WJ9A 4RW7B 4P7TA 3LGMA 3TARA 4HEA9 3JTPA 1BUXA 4KRWA 1N33J 1NK8A 3ONQA 1HMVA 1TZ0A 5C5JA 3MF5A 3N0VA 3LW5C 3PEJA 4K4YA 1T03A 2V9WA 1PILA 3LA0A 3FEYB 3CVKA 2XZWA 4JB8B 2GGPA 4AXIA 4CH0S 4XTTA 3MFIA 2E1AA 1I5OB 2B4PA 4K59A 4KGXB 1GXUA 3B54A 3IBFB 2X1BA 3TZYA 2ZE2B 3L95X 2R7WA 1JKHB 4UTGA 2HLTA 1NKBA 3IR7B 1F2HA 2CPFA 5KFZA 3J7YI 4ILRA 1ZTWA 1PYSB 1P6TA 2BANB 2FJVA 1TMJA 2W1BA 3I9ZA 1NAQA 4FDFA 2VHGA 3PRVA 2DY9A 2DEIA 4H4KA 5SUHA 2MZRA 3T41A 4H4OB 3P5TL 2DXFA 4WWSA 2HNDB 2ZUAA 4O23A 4CWBA 2VQEJ 1H2UX 2YWEA 5C24A 3IAS9 2C3PA 1CQNA 1S9GA 1OY8A 3SCKE 1RTHA 1HNXJ 3MUMP 5C2GA 1ZA2B 4OZ1A 3RGIA 2ZHBA 1MWYA 2HMIB 5F0WA 1KVJA 2OMLA 1VR6A 3V6DB 1OQ3A 4CH7A 4NXMF 2LFVA 3BZQA 1HNIB 4RUHA 1S5ZA 2XO6A 4PQUA 1RT6B 4URSA 3KWMA 2ERRA 4DF4A 4K8RA 4Y2KA 4X4OA 1CJKA 1N6QA 3FEXB 2LDIA 3MM7B 5KT2A 1FTRA 1OWXA 2MTLA 4ILMA 2Z30B 1S1WB 2KXNB 2CJBA 2WRMA 5DLGA 3DNCA 3WIUA 4BCAA 4LRDA 4OI6A 5E3RA 2DY1A 3IBCB 4PWWA 2ZH9A 4F67A 3VAGA 2Y1RI 2MSSA 2ASYA 4X84A 4D3HA 1OSDA 3PACA 1EETA 3THVA 2H3EB 1FWLA 2AJQA 1RQ0A 3W64A 1TUWA 4FN5A 1VQ9S 4RW8A 3FFIA 2JZ5A 4ZCMA 2QLWA 3BKFA 3KUEA 2IJRA 3MAHA 5CD4H 4MYUA 2KG1A 1X5SA 2B5JA 2HFZA 4I2QB 3I32A 4M5IA 2MGZA 4ZP7A 3QT8A 4IYQA 1WD6A 3S6EA 2N7CA 5B0AA 2G2ZA 1GMWA 1RE1B 4NLGA 4ILLA 3DI6A 3MD3A 4DU8A 1HQ2A 3Q24A 3ETOA 2HSEB 3VGSA 5CHCB 3ISZA 4F4WA 4G3IA 1WUUA 1T7PA 1QUVA 3C46A 4YQWA 3IFEA 5IV3A 3Q8QB 4ELVA 5HLFA 1WC5A 3ENAA 2RILA 2F40A 1NM2A 1ZAVA 4EGLA 1RT4B 2NUUG 4DV1J 3SV4A 2MHNA 5GMKa 4HTIA 4WCEQ 3RR8A 4PXCA 3R6GB 3HPOA 4B9TA 3OQ2A 1WG1A 1PG5B 5KFFA 1HNIA 3BR9A 1GXLA 2A6OA 2A6MA 1T3OA 2GGPB 4O0IA 1RK8A 1JLBB 2F8HA 2FHMA 2M70A 2NXCA 3A8EA 5GVQA 4GC6A 1MROB 3N4WA 3U27A 2GCFA 1W7WA 3GJQB 1D9DA 1VHIA 3I0RB 1XEZA 4CDIA 1KD1T 2MXYA 4NXNJ 2UVWA 4LQ3A 5D8HB 5DQHA 4NLOA 4ZVEA 4DOZA 3PW5A 1NKCA 2KVIA 1QVGR 4LFCJ 3TAMB 4DSJA 2DIUA 2BKNA 4LREA 2I5JA 4NLRA 2PDAA 3HVWA 2DXDA 2DIVA 3Q22A 3VAMA 3RB3A 1VQLS 4Y0FA 1RCXB 2KDOA 4KHRA 3S1TA 2EC2A 1ZAWA 3I4PA 3EGZA 4Q8FA 4UF4A 2ZM6F 2PA8D 2XYPB 2HFOA 4LRBA 3JSYA 3B82A 3Q23A 3VV2B 4A8OA 2AYBA 2YKMB 3QQCD 3SIPB 4FBTA 1DQ9A 1VBYA 3BSOA 1U25A 3CDWA 2N4DA 4KFBB 3CCWA 3EDQB 3DLKA 1X0FA 4N41A 2CKWA 4QR1A 3FBEA 4LSNB 3PY8A 2C3OA 2VC0A 2UUBF 2O3DA 3AA9A 1WELA 1DJ0A 4JBCA 2FD2A 3ENQA 3HHKA 4N7TA 3KHRA 4EMDA 1CC7A 2R2SA 1CPZA 4UY85 1NB2A 3HT0A 3DGPB 2PD1A 1HBMB 1SC6A 1ZA1B 3ETMA 2E29A 4NLTA 4R0EA 4TYAA 1SJRA 2JFKA 2DPIA 2UVUA 5FDLA 3QT6A 1SJQA 4WTOB 2GQ2A 4IO9Q 3QGIA 4FF3A 1Q4RA 2ROGA 1GFWB 3VAKA 3D1OA 3DLKB 2GAHC 1Q8BA 1EZZB 1FE4A 2DO0A 3DKDA 3M1VB 5I3UB 2R7UA 2XG8A 2HFUA 2D9PA 4U96A 1NK0A 4LF9F 2HFSA 1S1TB 3OLBA 4ZP9A 4RUBA 1I94J 1S72S 2XZTB 2OHDA 1U1RA 3PHEA 1ZPVA 4J9MA 4O3SA 2EK6A 2VG6B 1YBAA 3BYRA 5EUHA 1Y5IB 3NCPA 3HVRA 4C9DA 1YJTA 1IKXA 1JB0C 5KFWA 1YLXA 4NCGB 3V5RA 4F0HA 4YHHJ 4ECQA 1CEZA 1Z2ZA 3KDOA 3R2DJ 1N5YB 1YJRA 2OPQB 3Q8VA 1XR7A 2BKPA 2ROEA 3BBCA 5B7WA 1CJVB 1MLAA 2L9DA 4MK8A 4ANEA 4DR3F 2RAQA 3BQ2A 2R8JA 4QU7A 3HHLD 4USJC 4U6PA 2KT3A 2AX1A 3LTOA 1RTZA 3C16B 2CJQA 2F3JA 4I2PB 1V6HA 4P9SA 3MEGB 1CG2A 1HI1A 4WPAA 4PR6A 2ZE2A 3JTNA 1S0OA 1TFYA 5D0HA 4X4VA 2AJ2A 2B56A 2HHPA 2YWGA 3IRXB 4OHXA 2MQQA 4B9LA 1WC4A 3POTB 2OO4A 4KGMA 3PVXA 3OR2B 4RW4B 3WBZA 2J9CA 4K0KF 2N4CA 1UFLA 1MROA 3NY0A 2U1AA 2LEAA 1HWUA 4KYZA 1UJ6A 4HH1A 2AF6A 3DDIA 3HO1A 2V8DA 2EFGA 4CLZA 2KG0A 2ASLA 4Y2AA 1PKUA 4C0OC 4BS2A 2VUGA 3PV8A 1RTHB 1NHVA 3BH7B 2XLJA 2QEXS 3MGJA 1C0UA 2E7XA 3NCRA 3NLCA 1TL7A 2EG2A 4KO0A 5A8WA 3G6YA 3RAXA 4HDGA 1N52B 3DLGA 3CCQS 3JAMU 1U24A 4O44B 1IWGA 1RYRA 4MIAA 1HWLA 1FA0A 1X7VA 4WP9A 4X2BA 4W98A 3I55S 1U6BA 5HP1A 1VHFA 1Y5LB 3G82A 2EXUA 4LSLB 3TA2A 3FBFA 4ZIWA 5KT5A 1VC6A 1QAJA 1KFSA 5J1PA 3I56S 1FJGJ 5M2PA 1IVZA 2IRYA 3J7Z5 1YJUA 5CYQA 4QR0A 2DGXA 5J1EA 1XK8A 3OL6A 2NQPA 1QUPA 5KT3A 3QYYA 1U48A 2J9EA 4ZHRA 4FF2A 1MMDA 5B0CA 1KOOA 1SPBP 3BR8A 2ZVSA 4Z7YA 2MZJA 4ZA1A 2J0QD 2PI4A 4LQ9A 4LFAF 3J7AN 1TQLA 3HHDA 5KFYA 4CO1A 4Z37A 2A18A 5KTQA 4B3TJ 5D4PA 5MAOA 5BYQA 1T03B 1F0XA 1KR4A 4NA1A 2BJ7A 1FNXH 1V3RA 1VJQA 4WP3A 3MM7A 4ZCKA 1VCTA 4P74A 4R8UA 2BEFA 2ZHOA 1GTEA 1S1WA 4YB7A 2NPFA 4RW9B 2DNZA 3EVOA 3Q86A 4N8NA 3MUVP 3DI6B 5CABA 3PR4A 2XCAA 2KO1A 5CYJA 4I7FA 1DTQB 2B0GA 4NLDA 3GR0A 2PMZD 2B8QA 4DF8A 3QSYB 5A6WA 2ACYA 5K5MA 3W9JA 1GT8A 3GSIA 3DOMB 1KBRA 2AIRB 2OUGA 3CO0P 3J81U 4FF4A 2AHOB 1XNQJ 1XBWA 2JLGA 2VICA 2Q43A 2VU5A 3OL8A 1KONA 2V94A 2EFPA 2DR8A 1D9FA 3NRBA 1PJ5A 2BJEA 4O44A 1NH8A 2MB0B 1JLQA 4DR7F 3H4DA 2C2NA 1PC5A 1IQTA 2IC3B 3D0GE 3CD5A 3S8SA 1BMQB 1AUSL 4MTPA 2Q6CA 1X9SA 1OQ6A 4MK7A 4ECVA 2YWFA 4M5DA 3MURP 2GFFA 4PG7A 1TK8A 5G0RB 2V8GA 4DX7A 3QIDA 2OTLS 3QJJA 4OHYA 3HXMA 1HNXF 3CCUS 4KAIA 1KWMA 2JWNA 1R43A 4IFYB 3C2PA 2CAJA 2CG4A 2OMOA 5DDRC 5AXNA 1RTIB 4OQJA 3DLHA 3UDCA 1UPMB 3V6DA 4DX6A 2ZEJA 4IG0A 5DM6Q 5KFNA 2XTJP 2OFGX 2KM8C 2XWYA 3QJLA 1B4SA 4DR4J 2G1DA 3PM9A 2MY7A 4K2JA 2WB4A 5IC4B 2HFVA 4K5SA 3SDEA 4B9UA 3OFGA 5CD4A 1VRTA 3ICLA 4DX8H 5KOWA 4GO7X 1CJTA 1FERA 2DNRA 2QMXA 4LSZB 3KLEB 3KG0A 4RNMA 4DCOB 1NK7A 3IM8A 2PE8A 2YWKA 5ETOA 1D3WA 1LW0A 1Z1ZA 1FRMA 1HW9A 1RAOA 1YRTA 2LMIA 2WOMB 3KNGA 3M32A 1W2IA 3H2UB 1IJFB 4QIWD 4USKA 1GH8A 4DL7A 5HI7A 4C11A 4IFVA 5F0UA 4E2FB 2B7CB 1RGVA 3AH6A 2DGTA 2C3MA 3PHTA 3JYTB 1V3SA 4ZN1A 2IBOA 4DQSA 3V4IB 4R0JA 4Z2XA 3X3UA 4CLFA 3KK1A 3BB5A 1IBKF 2BKOA 2W8LA 2RRNA 1D8YA 1HLWA 3T1HF 4BC9A 1KOHA 5C7PA 2WOMA 3C6UA 2C2KB 4C4WA 2LDYA 2YQ3A 2WONA 4DR6F 4DUYJ 1H0HB 4MKAA 3FMBA 4ZPWR 1RI7A 1R27B 1TV6A 3M4XA 3QT7A 1UEKA 1OIAA 4U7UK 2GC8A 1Y11A 3QIPA 4Q7AA 4OZ2A 2NCKL 4WZMA 2NLWA 1K47A 4OZJA 3TQ1A 3DU6A 3IS9B 3K5LA 1RTJA 4JI6J 1NDLA 3KJNB 4RBTA 4NCAA 2MQMA 1VQ6S 3DDKA 1EX8A 3AOBA 3M2UA 1NPKA 2RS8A 4YR0A 1DZ5A 1S1VB 1L3VA 2DBBA 3NXZA 3DM2B 4G6VB 3ADAC 2DNQA 1U2RA 2DNKA 3MM9A 4RZRA 4ZMMA 4A47A 2RRBA 1SL0A 4TY9A 3RB0A 4JI5J 2BVZA 3F44A 1FJEB 4LVNP 3TVZA 3R8YA 3QZ8A 5CCLA 2UVVA 1VRUA 3DDNA 4WP8A 3D1HA 1KP6A 4CYUB 2L08A 3EPIA 2AGOA 1RWNB 1F60B 2MKJA 2MZSA 3MEGA 4YEAA 2BJ9A 2QA4G 4KQZA 1MMNA 1KTVA 2IDEA 3NGUA 1U1KA 1D1UA 1REVB 1RT3B 4I56A 2HAIA 4ETZA 3QFHA 3TVKA 1IKXB 3TUPA 1TL1A 4TVAB 1LNQA 1C0TB 2HIYA 4KPCA 4XPEA 3UCZP 1GXTA 3GTYX 1XIQA 3GFHA 1AA1B 3FZ2A 2MKHA 3NCQA 2MKIA 2FJEB 2F9JA 3A3OB 1S1TA 2WVCA 3FEZA 1HHTP 1CVJA 3UDEA 4Y34A 2HS4A 5F8IA 3F73A 2AD9A 2ZVIA 1QE1A 1UL3A 2HWTA 4P7VA 2DEJA 1KLMA 4ZVQB 3QFWA 4NWBA 3NWRA 1B0PA 4J90A 4C7QA 4A8YA 4JI0F 2MZ1A 4B9NA 4XIUA 2QA2A 3C14B 1M5PC 3MECB 1BHNA 3M6VA 1X4DA 3CCZA 1F9EB 2KFZA 1NK4A 2AYGA 2F5GA 1EP4B 1FF2A 1NLKL 1SQEA 4LF8J 3RJMB 2ASDA 4ERDA 2CNLB 2QLJB 1PBUA 2NUHA 3M8QA 3QGGA 1TL3B 4USTA 5A6PA 3GPAA 4U8YA 5HVHA 1J5EF 2PT0A 3G8TA 4HACA 1XJWB 2J7KA 3MMBB 2LQJA 2OD4A 4B3RJ 2EFVA 1XMOF 4Q2LA 4QIGA 2BDPA 2V68A 3J7A1 3RBXA 1WHYA 3W2VB 3MUTP 4ES1A 2HLUA 4LF4F 4P2FA 2LP4A 4PPDA 3KLFB 1S4EA 1H3DA 1E6VB 1VGYA 3GB0A 1TKZA 4C97A 1J2VA 1VC5A 1RAIB 1TL3A 1WOSA 3QBCA 3VHQA 5JMNA 2XS5A 3D0IE 3H2LA 1HBUB 3KKFA 4ICLB 1H2TZ 1VBZA 3AJ2A 2QO3A 2F8MA 2RU3A 2V8PA 3DU5A 2H48B 2IYGA 3HVTA 4WK1A 2BANA 5HJXA 3VAHA 5E0OA 4KJIA 3H8YA 3WIVA 1RAGB 2B7BB 4X64J 4ZLNA 4I0WA 1IR2A 1DRZA 1IWAA 3BGRA 5DGAA 3ELHA 1N48A 1HPZA 5ETQA 2R7XA 1S1XB 1HR0F 2BABA 5D4OA 1V5IB 3KLGB 3F0NA 5KG7A 2BBEA 2CPDA 1Q7LB 3DM2A 1VBXA 4F25A 3OLAA 3GYNA 2DR9A 5LSLA 1YI2S 5CXTA 1SJ4P 2RSQA 3OR2A 4UQTA 3OXLA 3D0HE 2WCXA 1I3OB 2HMIA 2CQPA 4B3TF 4EZ6A 1XMBA 1UWBB 2VQFJ 5AXLA 4RLEA 4YDDB 4J9VA 2JOQA 4ECXA 4HHHA 4B9SA 3T6BA 3D3BJ 4LT6A 5KG3A 4KY3A 3VTIA 2EC0A 3NNAA 3ENVA 4FPIA 5C24B 4DUZJ 1MU2B 3GV8B 1RU1A 4HYKA 3M6UA 1QSSA 4OLPA 4AYBD 2JEJA 2DGQA 1RXOB 4NZ0A 2CG8A 1ACMB 4DPOA 3IRWP 4NEYA 2ATLA 3IG1B 1B70B 4X65J 1DURA 3W2WB 2FTRA 4LF8F 5IT4A 2K3KA 3BBFA 1FJGF 3CB4A 2Z58B 1XR6A 1FVQA 1OMSA 2MKYA 2P6SA 5DRKA 3PW4A 4Y2IA 4CO2A 2RRAA 3ZZRA 1Y9OA 4LBHA 2QLFB 1BE4A 3DLBA 1FKAF 4LJMA 3FFIB 4JI8J 5E41A 4DMZA 2FLLA 3B4DA 4D3GA 2UXBJ 4X4NA 2VL1A 3MWBA 3KLEA 3VGTA 1Y3JA 2K06A 5DG8A 3BPSP 1WTBA 1SXLA 2GHVC 2CQ3A 4DLEA 1F9HA 5LM7E 5H1SV 3QO9A 2CZ4A 2ASJA 3V2UC 2E9RX 2P8IA 5ITHA 1FI4A 2K7KA 2QA4S 2BW2A 2BQ3A 2EVZA 4DSKA 3I96A 3K89A 3U1MA 3FJ2A 3BJYA 4P73A 5I42A 3RYLA 1L5UA 2UV8G 1IBCB 3TEGA 3M6XA 3G6VA 4JI0J 1M90T 3HKWA 4B3OB 3R3TA 3NMRA 1TKTB 4OIXA 2WVBA 3V4MA 2QJ3A 5EDWA 4MAKA 4CZCA 3AOCA 5RUBA 2FZCB 3BKTA 2Q6BA 2Y9HA 4M5MA 4A8FA 2F4VJ 2MLYA 4UUWA 1U26A 3SBMA 3TRGA 4NZ6A 5A0YB 2ZH8A 5HL7Q 4RO0A 3K5NA 1RAHB 1YK9A 2YKNB 3AODA 3HSZA 4Y6IA 2W7OA 2FY1A 4MFBA 5HJYA 4RWWA 1HIYA 2WVFA 2RS2A 4QPXA 1RT2A 2XEXA 1GNKA 4DPTA 4ZKAA 5HQMA 1VC0A 2QFIA 5E2QA 2PSZA 4OI3A 2W9BA 2ZZTA 2CQIA 3FCWA 4J5OA 5DLFA 5L46A 4Q0BB 5ETTA 2R7SA 5LMNF 4DQPA 1IBKJ 2HHSA 1MG7A 2AZ3A 2OLWA 3OT9A 2H4WB 3H98A 4CI0B 2EWHA 3S01A 2HBQB 1Z4UA 1IR0A 3SSQA 1U47A 4C0BA 2ALZA 3GFXA 2ZH5A 1H73A 3CEDA 1T9UA 1W25A 2AYEA 4ID5A 1U4BA 4PYAA 5E5NA 3RU0A 3MM8B 1RWOB 4X4TA 3H90A 1S97A 3AXKA 1TR0A 3T6JA 4RU9A 4URQU 3M8ZA 2FC9A 1RAEB 2DPJA 4ECUA 4DG1B 4DQRA 2IIHA 1TKDA 4OI0A 3I5CA 4O3QA 4OYWA 3CT9A 4PAAA 3FBCA 1M0SA 4ED0A 3QATA 4JV0A 3D9BA 2YNGA 1UKUA 3GFZA 1NCLA 1RZMA 2QYCA 3MR2A 5L1JA 4RL1A 2VDIA 2ZBIA 1TKZB 4C8ZA 2V6AA 2X1FA 1T05B 3GCWP 3ZZPA 1Y0HA 2LA4A 4NXMJ 4DUZF 4HT7A 1ZETA 1RAAB 4JI2F 3BF4A 4WFNQ 1VQ8S 1ZPWX 2VV5A 3CUNA 3MTJA 4OYZA 2PEHA 4HKQA 1BGXT 1Z2LA 2HQIA 2H65B 1JJ2R 4F2RA 5HP1B 3D28A 3HHLB 3UNYA 4LFBJ 5M2UA 1V5VA 1RTDA 9ATCB 3D4JA 2QFJA 4OX9J 1JMTA 2VD3A 3K5OA 3MEDA 5KFRA 1BY9A 3CIZA 3U1LA 1RT7B 2MYFA 1KHWA 2OJ3A 5LSOA 4F3OA 1O6XA 4IRCA 4ZITA 1KQGB 2KZMA 3QLHA 2BV3A 2ZDPA 4TYBA 5LMNJ 3UCUP 2OIHA 1G1XA 2GMJA 2HQGA 1ZM9A 2KXHA 2RQ4A 3D7SB 3IWXA 4C8KA 4WKRA 1SH0A 3M05A 3NNHA 2CDQA 2X1AA 1VDHA 1FKPB 3DRPA 3KK3B 4ATNA 3IRXA 4DLGA 2YNHA 4GKKF 1RP5A 2UU9F 1P9QC 4GVBA 3PYGA 1FDDA 2FLNA 1IKYA 2HKEA 3DRRA 1O8BA 4LF4J 2JHEA 1AFIA 2Y8YA 2M52A 2VA2A 2W01A 2DCUB 5T7LB 2XWXA 2XMKA 3SXLA 3GMGA 3CMAS 3MI7X 4NCBA 3TWZA 1ZBTA 3DHXA 2BJDA 4KKOA 4ER8A 4N47A 2ZBCA 3TVYA 3MD1A 4GVBB 5HVFA 1VQ4S 3O3LA 1SI9A 2A2CA 1J5OB 1AW0A 1UWBA 1D8ZA 2NYHA 4Q8EA 2PC6A 4UY8T 3GZ7A 2ZJRQ 2FJWA 3FSYA 4PG6A 3CMQA 1SJ3P 4Q0BA 3BEGB 2NXNA 4IH6A 1JNZB 2V9KA 3B4MA 3G82B 4EO8A 1FXDA 1MNEA 1Q8IA 3GJRB 5HATA 1HR0J 2BE7D 1ZYQA 2ZKUA 1UEUA 1S1XA 2OPPA 3LOUA 1KSPA 3IG1A 4K2XA 5D4NA 4OZ0A 2I2YA 1SH2A 4UOCA 1WEZA 3G71S 1X9MA 1ULRA 2ADCA 1EKSA 4ZJOA 3W8PA 1KQKA 2FHJA 2J9DE 3VGVA 3C14A 3HVTB 4I6YA 4Q5VA 3GV5B 4OLOA 4DR5F 2GVZB 4ECRA 2M2BA 3OUYA 4WE1B 3E2EA 1R8CA 1MSWD 4QWEA 3G86A 1FESA 1FRKA 4RNHA 2EBEA 3VZIA 1N34F 2UUBJ 4YOEA 3IO1A 2DTJA 2MQLA 3OL9A 3VAJA 3D2WA 3PNIA 2NR0A 4K5RA 1LK5A 4JI7F 1MN9A 3I82A 4EI2A 3EM1A 1UETA 1H7XA 3AJDA 4JUZA 4RBVA 4B3RF 1HQUB 3KG4A 3CO9A 2Y1IA 1X4HA 4QIVA 1IKVB 3PCOB 2DNLA 5F8NA 2UU9J 1FJ7A 1K0VA 3TQEA 4CLWA 1APSA 2G0IA 5HBMB 3RW7A 4X4RA 1FXRA 3K17A 4WF9Q 2I1RA 2G2OA 1QTNB 2HS3A 3OSPA 2AEMA 1HD1A 2HYIB 5DGBA 2XZDB 1D09B 3TW0A 2HVZA 5KFLA 4QJVA 3CJ4A 5CA5A 1T94A 1X31C 5DZ7A 3Q0AA 4PUOB 3M7VA 1F9FA 3ZZOA 2CIMA 2AJFE 4DN0A 2OI2A 1OO0B 3HSGA 2PO4A 5A8KA 3OHAA 3OV7A 4U95A 3DOKA 2RE1A 5F8LA 4GRSA 4M1KA 3GV7B 3MAAA 4CLTA 4X62J 2GO9A 4OX9F 1FKPA 3DRPB 1C4CA 1GMUA 3I87A 2BE2A 1S6UA 3JSBA 3KLIB 3OR1B 5AJ3J 1JIHA 2W9CB 1RT1B 4S0MA 2GJ2A 4TXSA 1RTJB 1NKEA 2BXJA 1G3OA 5K14A 2EK1A 3THPA 3H5XA 1RWKB 4TLQA 4WFYA 3RBZA 5F8GA 1RUSA 3KHLA 1RHMB 1IKWA 4DSFA 4GKJJ 2DHGA 1HNWJ 2DGSA 2WONB 2PFDA 2J7WA 2P9GA 4NYOA 1TV6B 2XYHB 5H9EJ 2CFXA 3PFOA 1VBKA 4M5LA 1WKJA 3HD1A 2G13A 1BQNA 2PIIA 1S6PB 3TX8A 3ZXWA 3T1HJ 3DLLQ 3HT3A 1Q8LA 2DHHA 4V19J 5D77A 2MY8A 2A3JA 2MMYA 2QE5A 4KHPF 2X51A 5KFBA 3T5JA 4ZPBA 1HYSB 4ED7A 2VPXB 5L1KA 2GIRA 1I94F 1R31A 1TTHB 2BJ8A 2IA0A 4NLWA 3W65A 3MM9B 1JLBA 3CC4S 5KT6A 3EYZA 4B08A 3UN3A 1N5TA 1BQNB 2ZZNA 3GYXB 4MMOA 4E98A 3CDBA 2YWWA 3E51A 2KRRA 1PIEA 2P5VA 2L48A 3D67A 2ZBPA 3EZOA 3I4HX 4DV5F 3PW0A 3DGPA 5AXKA 5I3PA 3FSIA 2K2PA 2VG7B 3EPGA 1HBMA 3QO9B 2DXEA 2CQ4A 1YJ7A 3P96A 3GIIA 3GCXP 1GMVA 3T1YF 4B3SF 3DXSX 4AUKA 2DNGA 2Q3PA 3FQLA 4FKYA 2K1RB 4ANCA 2RQKA 1S99A 2AJ4A 1JLAA 1NK5A 3KK1B 1HQEB 1UEVA 1VYAA 2Z57B 4NASA 4PCQA 5GMEA 1NDPA 2DHAA 3JQMA 4OZLA 3M8SA 4PRFA 1GAOA 4WIIA 2J6TA 3CJQA 4CLSA 3C15B 4A8KA 1VJWA 3IBWA 3RBEA 1L3UA 2YKMA 4UT4A 1AFJA 1WI8A 2OPSB 1PAUB 4KKOB 1U1PA 1S9EA 5DDPC 4PEOA 2KRBA 1JJHA 2PEBA 5A2QU 3PYDA 2QL9B 2RF2A 4KB7A 2FUG9 3OTOJ 4LRFA 3R1HA 4NXNF 3FC9A 3MEEA 2GA7A 3N5FA 1FVSA 2R42A 4OFZA 3UW1A 4DZ6A 5I4MA 4ECWA 1TK5A 4H4OA 4P52A 4MFBB 2RQMA 1WOPA 1OPZA 2BJ1A 3W60A 1WC1A 2DKOB 2D74B 4ELUA 1IN0A 1FD8A 3FCHA 4OX8A 2QG9B 1WF0A 2W9AA 3DLEA 1S7HA 2G9OA 3CNQP 4K7QA 2RKIB 3GJSB 3G2XA 1VMBA 5F9NA 2KFYA 1SQFA 2FVSA 2DRAA 4FVMA 2PN6A 1WSVA 1R0CB 3FNNA 1EAYC 5FLXY 4CO0A 4RW4A 3MOJB 1REGX 2CJXB 2DITA 3FCVA 3ITHA 4LR8A 4M5GA 2WTFA 2UXDJ 1S48A 1HBNB 1H6KX 4KH0B 2YKQA 1SJFA 1X4AA 4I64A 3IXQA 4DV1F 1U1OA 2HVHA 4WZQA 2LLZA 1GK8A 5KG1A 2IPOB 3MEDB 3W5XA 4DR1J 3NS6A 1CSJA 2KJWA 2VB6A 4P2MA 1Y4ZB 4IQXA 1QD1A 2CDRB 4YB5A 2OPQA 4E8UA 1C1CB 1JWWA 2ACMA 3GP9A 4USWA 4EO6A 3KJQB 3FRZA 1QE1B 1E6VA 3PJ9A 4NLPA 2EW9A 4H4MB 5BJRA 2V4RA 2N3LA 2QT7A 3G9CA 2M9KA 1UP1A 1O5JA 4FF1A 1PYTA 3GG0A 5HROB 2C2MB 2BOPA 3K7RA 2HZAA 1EQ0A 3J80U 2AJ1A 1GX6A 2R8GA 1N32F 2B5JB 4I2QA 3RAMA 1XNQF 1OYEA 2KHDA 4O3NA 2GJFA 2DH7A 3CCVS 3K5MA 4OJHA 4F4XA 4ZVPB 1ZTTA 3NG8A 2NYIA 2MEWA 3NBPB 5HVGA 1PGZA 1UCNA 1AZSA 1ZM3A 5L9XA 5DETA 3UI3A 2ZBRA 3OVBA 4Y2CA 4F0KA 2WSFC 1NUEA 2VH7A 4N5SA 1JKHA 2M0GB 2AT1B 3H5UA 1F5CA 5CQGA 3TAPA 1HKAA 2RIJA 3GFYA 2CZVC 3TR5A 2BJ3A 4DQIA 1FRLA 1UFKA 3H42A 3MCMA 4R5PA 1FRHA 3DC2A 1HPZB 3W63A 1LWCA 1FKOA 1MN7A 4WIQA 4WK3A 1DLOA 4ZPVR 4A8MP 3LPYA 3AD9C 5KG2A 3LP0B 4UQGA 3X1LB 3T1YJ 3W62A 5IQQA 3O44A 2JVOA 2JJ4D 1VIOA 2OSRA 2ZNZA 4B17A 3ISNC 4DU7A 3HZEA 2V8HA 4K4TA 2POKA 1FK9A 2C22A 3KG1A 5B0BA 2I5JB 3IGVA 1N36J 3CJ3A 2VFSA 5LJ5Y 2BX6A 5HBMA 3T5HA 4NMXA 5A0YA 1Y3KA 4PXBA 1S49A 1VRUB 3BDEA 4CYUA 4KV8A 3L7UA 3CCLS 1RT1A 3TZXA 3J7YU 2WSCC 4PG4A 2VF3A 3CC2S 2CQBA 2PFFB 1HARA 3ZZ0A 5KFIA 3QAUA 3W2VA 3ZTQA 1VIXA 2R8KA 1DQAA 4X4UA 4I7FB 3W66A 3KMQA 4Q2MA 5JXSA 2N3OA 4DV2J 1EETB 1FEHA 1P9YA 3RUBL 3L7OA 3G4SS 2DRBA 4G1QB 2QLBB 2DGWA 1HWKA 2XI2A 3IWLA 3R5DA 4BBYA 1Y00A 4DQQA 3SYZA 4K4UA 4A8WA 3SDEB 2CQCA 4J9UE 1A9NB 2LECA 5K8PA 2AQ4A 2IVMA 1QJHA 1AXQA 1LOUA 1BQMA 4JI6F 2C2ZB 4ZVRB 3UD5A 4K4XA 4O3RA 1UVJA 5EX0A 2F4VF 1V3ZA 2I8EA 1WC3A 2CPJA 2BZ2A 3OTEA 3H5YA 1EHWA 3LAMA 3CJRA 4XPCA 3K57A 2F7VA 1SL1A 1TFWA 2HW3A 4EUVA 1EIYB 3R7SB 3T3FA 4C2MA 2EG1A 3LQVA 5U47A 4J9KA 1CQMA 2DH9A 3TJ8A 1GTHA 1ZM4A 2EFQA 3W61A 5HROA 1Q86T 3T1AA 2HBYB 3VAIA 4LR7A 4DSLA 2G0CA 2E9ZA 4OJ3A 5KG4A 4ES3A 2GMLA 2E5GA 4UOHA 2W9BB 1RWMB 4NA2A 4CNZA 1DY3A 4YR3A 3AA8A 1TK0A 4X4SA 3TO8A 2HHHF 4RWXA 4RKUC 3UNGC 1KKHA 3WC2A 2ZWPA 3GQCA 3MM6B 3HJVA 4ECTA 2HQFA 2MJUA 4Y65A 3H0PA 5D6GA 1UVMA 5DG7A 1RB0A 3E01A 4C0HA 5T14A 2L9WA 3SMZA 3PXGa 3MM5A 4LBPA 1R7IA 4FNHA 1S10A 4CLLA 4OJ1A 4P2XA 3EGVA 1BLUA 2LQBA 1F6TA 1RAJA 2B4VA 2FVRA 2IRXA 1JLFA 3HZGA 3DOKB 2RHQB 3IA0A 4AD6A 5HN0A 3L3CA 2F65A 5J2QA 4JYAF 1VK8A 3BREA 3H4BA 3SZ2A 5AE1A 3OXGA 2B6AA 3N6LA 5IT9U 2BW7A 2YNIA 2V4JB 3GIJA 4LF1A 4RUAA 4DV2F 2NS1B 1Q16B 4LF5J 5AJ3F 2L9NA 3FGVA 4KE5A 1X8DA 1RT4A 2B4OA 4QIEA 1X4BA 3ILLA 2RUGA 2BQUA 1Q0NA 3DCAA 4USUA 4FYYB 3QGPA 4QBUA 3NAHA 3QNWB 4F8RA 4IUFA 2FPHX 2VQFF 3RRGA 3G8SA 3HSDA 2XSJA 3CD0A 3I5BA 1TVRA 4AFFA 1Q7YT 4J7CA 2MQPA 3JS9A 4C8NA 1B0TA 4J9QA 1WHWA 4ZDNA 4WU2A 1RYSA 3OFFA 4PG8A 3DLJA 1S6OA 4DV6J 2DNYA 3CJ8A 3V6KA 3QRPA 1H74A 3JSRA 1S1VA 2UV8A 5DDQC 1T05A 2MDAA 1N36F 2UP1A 1UWAA 1T8EA 1SC1B 2HIQA 3P6YC 2VG5B 5KFJA 5L38A 2E66A 3VF0B 3NWGA 3GSDA 3DRSA 4F7VA 5KFEA 5H9FK 2IAJA 2ZJPQ 3C19A 3GLJA 2WBRA 3HX9A 4HL9A 8RUCA 1U02A 1NZ8A 2CNKB 2DISA 1HBNA 4NL5A 4BC7A 2F8EX 5HMWA 5A2QY 2BUNA 2BM0A 3KXDA 1IBMF 2XNRA 2OEMA 1YRUA 2R7QA 1XQIA 2RQCA 4ZVOB 2VG5A 4KR0B 4RNNA 1SIWB 2U2FA 3R27A 1PJ6A 4TQSA 1L3SA 2UXCJ 4HDHA 3RRHA 2UZAA 4FXVA 1JQGA 1RAFB 1FWPA 4Y00A 3UVJA 4DPYA 1RWPB 4ANDA 2CQ0A 2P9EA 3NEKA 4ZIVA 4YP3A 1VS3A 3ZTSA 1S0NA 1NDKA 3F56A 3M2VB 4G1PA 1SJ1A 3PTWA 4A8SA 2QMUB 1RWVB 1H72C 2C2OB 3CCJS 3SFGA 2RB7A 3SSRA 2E5HA 2EBGA 4ED3A 3RAQA 1VQ7S 1AUDA 1S9GB 1N0VC 3MMCA 4ZPDA 2W8KA 3MHYA 1QSYA 3CDUA 1R6VA 4ECZA 1M1KT 5DDOC 1S76D 3H7HB 3LP1B 3PX0A 3MEEB 1HI0P 3W3SA 4MIWA 5LMUJ 3PFEA 4LF6J 4LMZA 5GAGU 1O0PA 2DRDA 3P8BB 4HHUA 4KT0C 4KC5A 1MMLA 1M5SA 2W2OP 4ITSA 4ZVFA 1S4FA 4P75A 4RNFA 2CUYA 1JLGB 2H5IB 4PABA 4ZP8A 7FDRA 4J9OA 3LP0A 2WW4A 3OPKA 2F9DA 3CCTA 1IQZA 1DLOB 3N9UC 2ABYA 2XYGB 1KN6A 2YKOA 3UQSA 2Q66A 1S57A 4WYLA 1KHVA 4FYXB 4N76A 1UJ5A 3T9NA 2HRUA 5M2RA 1DBDA 3UD3P 1GMWD 2FVCA 3MCSA 1F3VA 4FNIA 3PDNA 4EBEA 3V6HA 1N34J 3NL0A 2LYVA 3AQPA 3CDEA 4FP9A 4DDFA 3GR1A 3FKBA 2E5IA 5KAKA 2R9LA 4IG3A 2LXUA 4JI4F 2K3IA 3D6MB 2FHKA 4NX9A 4DV3F 2HQDA 3RTVA 2RU9A 1K73T 7FD1A 1NH7A 3K59A 3O8WA 2W4CA 2KB2A 3BGFA 1IKVA 2UUAF
chains in the Genus database with same CATH topology
4DI6A 1F6TA 3MPDA 3EVMA 1WKKA 3Q83A 3DDIA 4S0MA 1PKUA 5IOLA 1HLWA 2HVEA 5C7PA 2HVDA 3VGSA 1LWXA 4CP5A 3BH7B 1UCNA 1B99A 3FBBA 3EJMA 1NDCA 3ENAA 2NCKL 1WKJA 3EICA 1NUEA 1NDLA 3BBFA 4W98A 5CAAA 1F3FA 3NGSA 1NPKA 3FBFA 3JS9A 3EMTA 3R9LA 1BE4A 1WKLA 1MN7A 1W7WA 2CWKA 3VGTA 1NSKL 1ZS6A 4UOGA 3NGUA 2DXDA 3NGTA 3EE3A 2AZ1A 3BBBA 5BXIA 2DXEA 4F4AA 1BUXA 2BEFA 2BX6A 4KPCA 1XQIA 4FKYA 1LEOA 3EVOA 3Q86A 4ANCA 1XIQA 5CABA 3L7UA 3BH6B 1VYAA 4FKXA 2B8QA 4ANDA 1NDPA 4ENOA 3ZTQA 3B54A 3ZTSA 1NDKA 3FBEA 3ZTOA 3VVUA 2VU5A 2HURA 2DYAA 1BHNA 1NB2A 1NHKL 2DY9A 3FC9A 3PRVA 3VGVA 3ETMA 1HIYA 3VVTA 2DXFA 3Q8YA 4DZ6A 4C6AA 2ZUAA 3FCWA 1NLKL 4O0NA 1NSPA 1PAEX 4DUTA 3GPAA 3DKDA 3B6BA 3Q8UA 3EVWA 2AZ3A 1EHWA 3G2XA 1U8WA 1MN9A 1S5ZA 1S57A 3EM1A 3ZTRA 4UOFA 4HR2A 3FCVA 1K44A 1B4SA 3NGRA 4UOHA 1HHQA 4WBFA 1JXVA 3Q8VA 3VGUA 3FKBA 3BBCA 4F36A 3WX8A 4ANEA 1S59A 3Q89A 2B8PA 4EK2A 3FBCA 3GP9A 1NCLA 3ZTPA 3ELHA 1KDNA 3PJ9A 1NSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI6 A;  1F6T A;  3MPD A;  3EVM A;  1WKK A;  3Q83 A;  3DDI A;  4S0M A;  1PKU A;  5IOL A;  1HLW A;  2HVE A;  5C7P A;  2HVD A;  3VGS A;  1LWX A;  4CP5 A;  3BH7 B;  1UCN A;  1B99 A;  3FBB A;  3EJM A;  1NDC A;  3ENA A;  2NCK L;  1WKJ A;  3EIC A;  1NUE A;  1NDL A;  3BBF A;  4W98 A;  5CAA A;  1F3F A;  3NGS A;  1NPK A;  3FBF A;  3JS9 A;  3EMT A;  3R9L A;  1BE4 A;  1WKL A;  1MN7 A;  1W7W A;  2CWK A;  3VGT A;  1NSK L;  1ZS6 A;  4UOG A;  3NGU A;  2DXD A;  3NGT A;  3EE3 A;  2AZ1 A;  3BBB A;  5BXI A;  2DXE A;  4F4A A;  1BUX A;  2BEF A;  2BX6 A;  4KPC A;  1XQI A;  4FKY A;  1LEO A;  3EVO A;  3Q86 A;  4ANC A;  1XIQ A;  5CAB A;  3L7U A;  3BH6 B;  1VYA A;  4FKX A;  2B8Q A;  4AND A;  1NDP A;  4ENO A;  3ZTQ A;  3B54 A;  3ZTS A;  1NDK A;  3FBE A;  3ZTO A;  3VVU A;  2VU5 A;  2HUR A;  2DYA A;  1BHN A;  1NB2 A;  1NHK L;  2DY9 A;  3FC9 A;  3PRV A;  3VGV A;  3ETM A;  1HIY A;  3VVT A;  2DXF A;  3Q8Y A;  4DZ6 A;  4C6A A;  2ZUA A;  3FCW A;  1NLK L;  4O0N A;  1NSP A;  1PAE X;  4DUT A;  3GPA A;  3DKD A;  3B6B A;  3Q8U A;  3EVW A;  2AZ3 A;  1EHW A;  3G2X A;  1U8W A;  1MN9 A;  1S5Z A;  1S57 A;  3EM1 A;  3ZTR A;  4UOF A;  4HR2 A;  3FCV A;  1K44 A;  1B4S A;  3NGR A;  4UOH A;  1HHQ A;  4WBF A;  1JXV A;  3Q8V A;  3VGU A;  3FKB A;  3BBC A;  4F36 A;  3WX8 A;  4ANE A;  1S59 A;  3Q89 A;  2B8P A;  4EK2 A;  3FBC A;  3GP9 A;  1NCL A;  3ZTP A;  3ELH A;  1KDN A;  3PJ9 A;  1NSQ A; 
#chains in the Genus database with same CATH topology
 1DAX A;  1UMJ A;  3ENW A;  1RAC B;  1VLY A;  2JRS A;  1U49 A;  4F2S A;  5D3G B;  4RW8 B;  1C4A A;  4C3K A;  5AE2 A;  5GAH I;  4C11 B;  5LXR A;  3UD4 P;  1N8R T;  2QV6 A;  5K8N A;  2XMW A;  3DHW C;  3PJW A;  1HW8 A;  2GQC A;  2GIQ A;  2FJX A;  3DLG B;  1RT2 B;  2DHX A;  4CP5 A;  1NSA A;  1N32 J;  3FSX A;  2D3Z A;  2G0J A;  4F4K A;  1UVI A;  4NML A;  3QRR A;  1RCO B;  3Q8S B;  1B99 A;  2QSW A;  1SH3 A;  3FBB A;  3C6T B;  3M6W A;  2VPW B;  4NYZ A;  3WDO A;  3OVS A;  2FB0 A;  1MU2 A;  1VQN S;  1C1B A;  2DO4 A;  3KUG A;  2J0W A;  2R7O A;  1CJK B;  2KFN A;  5E7O B;  5JJB A;  5GAH U;  3G6X A;  2ZM6 J;  1FX2 A;  4OI1 A;  3QZ7 A;  2J8S A;  3TUJ C;  1N5Q A;  1RWW B;  2XQC A;  2KH9 A;  4PKD B;  3M9M B;  1IXK A;  2LEP A;  4J37 A;  3C3L A;  2HK2 A;  1N5S A;  3R9L A;  3M30 B;  2R2R A;  2V69 A;  2VIH A;  4FYD A;  2KN4 A;  4OI4 A;  4R25 A;  3TAQ A;  3O1L A;  2E1P A;  4ZVS B;  1U1Q A;  4RJV A;  2CAD A;  3J81 Y;  1FJC A;  4I6W A;  4MT1 A;  1S1U B;  2YXL A;  3FK4 A;  1XMQ F;  4M5D B;  2QC3 A;  5DG9 A;  1S6P A;  2G1H A;  2Y3Y A;  5F3T A;  3CWJ A;  3KDN A;  2DNP A;  2HAF A;  1RA7 A;  4G65 A;  3B78 A;  2FHJ D;  2LU1 A;  4OI2 A;  2AZ1 A;  4RR5 A;  1C2P A;  3FUY A;  2LQ8 A;  2VBY A;  5E3C A;  1X9W A;  2R7R A;  4JI1 F;  1YIT S;  1WSR A;  4JV5 J;  1HFE L;  1S9E B;  2V34 A;  1T9X A;  3TZW A;  3A13 A;  4UZC A;  2C1E B;  3WZ0 A;  1EAR A;  1X5O A;  5J2M A;  2E44 A;  2L3M A;  1ZZN A;  2XMU A;  2IY5 B;  1AT1 B;  1WDD A;  1FO1 A;  3FZB A;  2Y1J A;  2DVI A;  4AQY F;  4B3O A;  2HK3 A;  2MKC A;  4QWA A;  4JV2 A;  4PWD A;  3M2U B;  1JXE A;  1RLD A;  1PC4 A;  2GX8 A;  3P5B P;  1RWU A;  2AW0 A;  3VWS A;  2VFR A;  1LWE B;  3IAM 9;  3SCL E;  2X3D A;  2OPR A;  1N5V A;  4C6A A;  1JX4 A;  1N54 B;  4WFB Q;  1CJV A;  1A6L A;  3G6E S;  3OFH A;  3W9I A;  3VCD A;  4N8O A;  3ITH B;  4QWB A;  5HMX A;  1RHU B;  2W2P P;  4B02 A;  1NSP A;  4P72 A;  4YHH F;  4IRK A;  1QY7 A;  3GIM A;  4K4W A;  2P6T A;  2VG6 A;  5GAE U;  2RVJ A;  5EHH A;  2PMH A;  2ROP A;  3BYP A;  5IM0 A;  2F63 A;  2RKI A;  4WKY A;  4DR2 F;  1W2B R;  2KYZ A;  3N01 A;  4QYZ J;  3W5Z A;  1RWX B;  2Z4P A;  4GO5 X;  2HGM A;  1J27 A;  1EQM A;  3D6T B;  3I9V 9;  3HM9 A;  3M8W A;  2GVD A;  1F5A A;  4DUY F;  1TVR B;  3D3C J;  3NGR A;  2IRU A;  3QMQ A;  1H98 A;  5L1L A;  4JI8 F;  3KOA A;  1FE0 A;  4F0M A;  3A1Y G;  2V5H G;  4P10 A;  1YJV A;  4WTY A;  5GAE I;  4ELT A;  4JI7 J;  4CM0 A;  2JH3 A;  2B51 A;  1NK6 A;  1K8A T;  1X4F A;  2CNO B;  5KFS A;  4DG1 A;  3VQT A;  3R7B B;  2JEG A;  2KU7 A;  3MEK A;  3MEC A;  2FQQ B;  4OYM A;  3S7R A;  4J9S A;  1JXL A;  3ET6 A;  3EXY A;  3PRD A;  3A3P B;  4OV1 A;  1JLC B;  2C2E A;  1FD2 A;  2HNY B;  3JAM Y;  1VQO S;  3PG9 A;  3NNC A;  1NU4 A;  1OY6 A;  3H5S A;  1U0H B;  4ZS6 A;  3KLG A;  3MPD A;  4YY3 F;  1QSL A;  1WOR A;  3KK3 A;  5DM7 Q;  2HRT A;  2VBW A;  4QYR A;  3Q83 A;  2CPE A;  2YQ0 A;  4FYW B;  3M8Q B;  3CCE S;  3BM7 A;  3POT A;  3I6P A;  3SI8 A;  4R8U B;  2HVI A;  1VIS A;  1Q8K A;  1SC3 B;  3R6L B;  4HT5 A;  1C0T A;  2J9D A;  4BLG A;  4ED6 A;  2OPR B;  3BSN A;  4DL4 A;  3OXF A;  3QPI A;  5GMD A;  1KQS R;  4DPW A;  3JB9 k;  1RTD B;  2MZQ A;  2YY3 A;  3T19 A;  4X62 F;  3U1N A;  4NE9 C;  5L8R C;  5L39 A;  3VR1 A;  2R7T A;  2DNH A;  4UZB A;  3M2R B;  2OEL A;  1N4L A;  1VQK S;  1T95 A;  4V19 X;  2DR7 A;  2CA9 A;  2YPZ A;  4K0K J;  3BKU A;  1NJX A;  3FVY A;  3CCS S;  5ETK A;  4B3M J;  1IJE B;  1LW2 B;  2IYI A;  4M8L A;  3UDV A;  3CME S;  5D15 A;  1DTQ A;  5GAD U;  2HWI A;  1RU2 A;  2R4F A;  2V4Q A;  1F5B A;  2O5D A;  4FPR A;  2CQ1 A;  3MR5 A;  2IM3 A;  1NJY A;  2E9T A;  4UOG A;  3EX7 B;  1CLF A;  4NPO A;  4ALZ A;  3GIK A;  2GAG C;  2QIF A;  3LP2 B;  1RHJ B;  5KFV A;  3L4B C;  3NGT A;  1IKY B;  3EE3 A;  4TKT A;  2IDL A;  3J7Z T;  2DR5 A;  5IT0 A;  2IA6 A;  4W90 B;  1J5E J;  3Q8P B;  1WF2 A;  4F4A A;  3GON A;  5B0G A;  5A76 A;  5GAD I;  3KK2 B;  3CCM S;  1WAC A;  2HEK A;  4RPF A;  1FKO B;  2KVQ E;  1X5T A;  4G1Q A;  4LRC A;  2WSE C;  4F02 A;  3KLI A;  4F04 B;  2R8I A;  2B3T B;  4F50 A;  1PBA A;  2YX4 A;  2AGP A;  4IOA Q;  1WEX A;  2LQ5 A;  4WU3 A;  4L76 A;  2ZH7 A;  2ZZM A;  2CJK A;  2RDD A;  3MXH P;  2DR6 A;  4KGK A;  4DV0 J;  1X4C A;  3PW7 A;  4B9M A;  4YME A;  3GJT B;  2BRL A;  2CQH A;  1TUV A;  3EWG A;  4WFX A;  4ZP6 A;  5KOX A;  5KT4 A;  3VAL A;  2XY7 A;  3RBD A;  2E5L J;  1C1B B;  1ZAX A;  1FK9 B;  2C2R A;  3KMS A;  1LW0 B;  5G4D A;  2HND A;  2DYA A;  3C6T A;  3PEH A;  4DV3 J;  4DFK A;  2RNE A;  3MPW A;  4TN2 A;  1VLO A;  2XMJ A;  4CIO A;  2HHV A;  3EDR B;  2C28 A;  1NPR A;  5E3P A;  2EPI A;  3NAI A;  2AMC B;  4F3M A;  2E1M C;  2JC1 A;  1NJW A;  2I6W A;  5HO4 A;  3BQ1 A;  3LWL A;  4CO4 A;  3EGN A;  2M3D A;  3B8H A;  1PO6 A;  5DZ6 A;  1SBR A;  3OD2 A;  4EZ9 A;  1RKI A;  1YSJ A;  1JJC B;  3C15 A;  4WXW A;  5SZT A;  1WTF A;  1JLE A;  2M5Y A;  5FD1 A;  3O2I A;  3EGW B;  3BSA A;  3GWC A;  4M95 A;  1GEH A;  1UJ4 A;  3ZO7 A;  3OTO F;  1U8W A;  1RT6 A;  1RBA A;  1LWF B;  4IDK A;  4B3M F;  3FMW A;  1H2V Z;  2OH2 A;  1UVL A;  4TY8 B;  1CS4 B;  5AXM A;  1TKT A;  2OTJ S;  3BN7 A;  1FRX A;  3E8O A;  3IP0 A;  5MLC V;  3PRB A;  1KS2 A;  1HI8 A;  4RW9 A;  4ZPA A;  2NRE A;  1R6Y A;  3PIO Q;  1NXI A;  1X0P A;  2V63 A;  2E1C A;  1G6B A;  3KTQ A;  2IC3 A;  3WX8 A;  1KLN A;  2IJF A;  3AOA A;  4G1I A;  2HHU A;  2GIF A;  1NJI T;  5HQ8 A;  1XMQ J;  1SUQ B;  1Y7P A;  1IM4 A;  2KJV A;  1UAW A;  4IOB A;  1LV5 A;  2RUS A;  2OPP B;  2IBK A;  1B7F A;  4U7C A;  2XY6 A;  2OSQ A;  2V2K A;  3NGK A;  2C42 A;  2W4D A;  2R3V A;  3ZNJ 1;  3UCG A;  2I0X A;  1FWK A;  3KJV B;  2CPX A;  2UUC J;  1NSQ A;  2VA3 A;  1DAR A;  5F3Z A;  1T02 A;  4ZVH A;  2N82 B;  3D1Q A;  5H9E K;  3R2C J;  4DR1 F;  3M32 B;  3TOQ A;  4YS2 A;  2LKZ A;  9RUB A;  5IV4 A;  3H40 A;  4DV7 F;  1YWX A;  2XM3 A;  3MR6 A;  4J9N A;  3PZP A;  5D0E A;  3THT A;  5A8R B;  1RA6 A;  4KTQ A;  4RNO A;  2YBV A;  1SUQ A;  3ILJ A;  1ICE B;  4UW2 A;  4M5J A;  4AQY J;  1R0A B;  1D0E A;  2YX7 A;  2FHO B;  4FZV A;  2HHW A;  4OMF G;  1LK7 A;  2ATC B;  4A48 A;  4ED4 A;  3ISN D;  1U09 A;  3M8P A;  2CNN B;  1NDC A;  1TL4 A;  2CPY A;  3GIR A;  4PYD A;  3EXC X;  2VBZ A;  1C0U B;  1R3N A;  4I1T A;  2H1Y A;  2XNQ A;  2CQG A;  3GYG A;  5A8W B;  3OW2 R;  3EUN A;  2R2U A;  3UN2 A;  1KC8 T;  3QRQ A;  4K4S A;  1TEL A;  2GHP A;  2B9Y A;  2F4F A;  3QT5 A;  5HAN A;  1KFD A;  1CC8 A;  4ED1 A;  4W92 B;  2H51 B;  2RDJ A;  4LSN A;  3P49 B;  2EKN A;  5DO2 A;  4OZ3 A;  4TY8 A;  1NBE B;  2BOA A;  2D1C A;  3K2Y A;  4DCJ B;  4LF7 J;  4K4Z A;  2CQ2 A;  2QL5 B;  1FNM A;  1O51 A;  2LQ9 A;  2RT3 A;  3DMJ A;  2M88 A;  4WXO A;  5J1N A;  1Q82 T;  1SV5 B;  4Y3C A;  1NEE A;  2D3U A;  2X1G A;  2RML A;  4CLK A;  1PJ7 A;  2YX1 A;  2JEF A;  3ET6 B;  2H5J B;  2PMW A;  2VOD A;  2R7V A;  4FS1 A;  3HLU A;  1PYO B;  3LPE A;  3TA0 A;  1VQ5 S;  3PO4 A;  4JI3 J;  4CQ1 A;  4F26 A;  1W26 A;  3CPW R;  2JDJ A;  3ZC4 A;  4EWT A;  1JNR B;  4GKJ F;  2K8G A;  1WC0 A;  2DJW A;  5F9L A;  1YJN S;  1AYE A;  3KLF A;  2ZD1 B;  3CC7 S;  3HHN B;  5IXU A;  3A4T A;  4PXE A;  3M9O B;  3JTO A;  4AXJ A;  2D9O A;  4JV5 F;  4U8V A;  5IM0 B;  1RDR A;  3V6J A;  1OSC A;  4FKX A;  5IS2 A;  3I31 A;  1OS5 A;  2Y8W A;  2VPZ B;  1S7I A;  2Z8Q A;  3R5C A;  3AD8 C;  4NLY A;  3CIM A;  1SVD A;  3ILO A;  4LR9 A;  4FXW A;  4IQM A;  4ZOS A;  3BO3 A;  2D69 A;  2HNY A;  4LIW A;  2CVE A;  2AKW B;  2I9S A;  4TLR A;  1GX5 A;  4C98 A;  2CPH A;  1NND A;  1EP4 A;  3BGR B;  2HUR A;  4PZV A;  1RT5 A;  1RHR B;  4FS2 A;  2VKR A;  3NOG A;  4QQB A;  4DEZ A;  1XMO J;  1URR A;  4AL5 A;  4RW7 A;  1MWQ A;  5FDL B;  5IWA F;  3HFV A;  5LT5 A;  4DBQ A;  5HMY A;  1S0M A;  4CCH A;  3KLH B;  3RW6 A;  3UDL A;  3AFG A;  3DRS B;  4OYO A;  4RBU A;  3UWT A;  3H20 A;  4ECS A;  3PX6 A;  1NJZ A;  2BYC A;  4X64 F;  1KNZ A;  1PAE X;  4MKV A;  1Q95 G;  1IR1 A;  2B9E A;  5E3Q A;  4DUT A;  1LW2 A;  3Q8U A;  5IZH A;  4QYZ K;  1ITP A;  2FVP A;  1UW9 A;  1U2F A;  3QAE A;  1OPI A;  1U0H A;  2J8A A;  4KBI A;  4QZV B;  1SKR A;  4ED5 A;  5D4L A;  3WX4 A;  2LVW A;  3DRY A;  3D5M A;  4N77 A;  1J5O A;  5D0R A;  3IM9 A;  1XNR F;  2OFH X;  3ZTR A;  3VQS A;  3Q2S C;  4DFP A;  1Q81 T;  1HNW F;  3HJF A;  3MMB A;  2X3G A;  4QR2 A;  1P1L A;  3W2W A;  1L3K A;  3OSN A;  5C42 A;  2NZC A;  1HHQ A;  4HTJ A;  2QSF A;  1AB8 A;  3VGU A;  2GS8 A;  2IJN A;  4F36 A;  5LSR A;  3NOC A;  1KTQ A;  3HD2 A;  1WWH A;  4HHJ A;  4OHV A;  3Q89 A;  5KG5 A;  2CRL A;  2MKK A;  4DN9 A;  3IR5 B;  2H5E A;  3LUY A;  2OPS A;  1VRQ C;  2Z2Z A;  3WQP A;  4L72 B;  2ADB A;  4Y2M A;  5ETS A;  3HUL A;  4X4Q A;  2V8V A;  2JX2 A;  4OYB A;  4DI6 A;  5KFC A;  4I68 A;  3LAN A;  4HH0 A;  2JL9 A;  2Y0S D;  3DMJ B;  4RUC A;  2G4B A;  1WC6 A;  2GO8 A;  3MAA B;  5CZV A;  5HK4 A;  2O1P A;  3DOL A;  2HHQ A;  4ED8 A;  1LQ9 A;  2HBZ B;  3R7N B;  4CT9 A;  2RD5 C;  3AY0 A;  4HI1 A;  5G0R A;  3G8Q A;  5D0G A;  4R5P B;  1X5P A;  4DSI A;  3E3X A;  5ETM A;  5KG6 A;  3E01 B;  2HQC A;  2ZFH A;  1MWZ A;  2IAJ B;  2XCP A;  4IRD A;  2C3Y A;  4RU2 A;  1WOO A;  2QL7 B;  3C6U B;  3BN4 A;  3EJM A;  2K7J A;  3OFE A;  2FDN A;  1TU0 B;  5EWF A;  1NZA A;  3BSC A;  4WJB A;  1A7G E;  3A8J A;  3CE8 A;  4LRA A;  3BGL A;  1TL5 A;  1FCA A;  2NXU A;  1UTA A;  3DOM A;  4DL5 A;  3MDF A;  2MGZ B;  5KFH A;  3MR7 A;  4DCP B;  4JI3 F;  2AEJ A;  3CJS A;  3G87 A;  4QU6 A;  2F1F A;  5LXY A;  1DFD A;  2UUT A;  3BS9 A;  4YB6 A;  2HHT A;  1C1C A;  1R8A A;  1HD0 A;  2JVR A;  3A3N B;  3R5A A;  3AXM A;  3T5K A;  2HPU A;  4EEY A;  1NSK L;  4OYP A;  3L9Z A;  3NS7 B;  2W24 A;  3HKZ D;  1U8S A;  4IG3 B;  3P45 B;  2FZK B;  5C2C A;  3Q2T C;  4CT8 A;  2FVQ A;  1UA0 A;  3H2V E;  4IH5 A;  5B09 A;  4I4B A;  8ATC B;  2V67 A;  1HWI A;  3ZNU A;  4X4P A;  1OY9 A;  2B4U A;  4KIA A;  4RW6 B;  3QJP A;  5K14 B;  2FYX A;  1G7C B;  2RDI A;  4ID5 B;  1M5K C;  4IG0 B;  1T9T A;  5KFK A;  2YKA A;  3FQK A;  1LEO A;  2OP5 A;  2XS7 A;  3HHE A;  1U1M A;  1FNO A;  4C8O A;  4Y28 C;  5ETL A;  1U0S A;  3OJS A;  2KHC A;  3TEH B;  3KYL A;  2JNJ A;  3AD7 C;  1WG5 A;  1WDT A;  1FDN A;  3GU0 A;  4ZVT B;  1CBK A;  4KV8 B;  4FVC A;  2CWX A;  2M8H A;  3GG1 A;  4JOU A;  2ZHA A;  2J0S D;  5KFP A;  1R8P A;  1M5V C;  2ZIT A;  3N79 A;  3CSK A;  3C16 A;  4I2P A;  3KJV A;  4U67 Q;  1K1Q A;  3D54 A;  4ZVU B;  3SQG A;  2OAU A;  5C25 A;  4Q45 A;  2EI5 A;  3M8P B;  2ZD1 A;  5ADZ A;  4YB1 P;  3HI9 A;  2GV1 A;  1JLQ B;  2CVI A;  1VQP S;  2XSF A;  4L73 A;  3VVT A;  3MFH A;  1CJU B;  4DV4 J;  3CXC R;  4NA3 A;  2DD8 S;  3LGN A;  1UFW A;  2UUC F;  4FBU A;  5L9N A;  4K4V A;  2KKH A;  4NZ7 A;  2BMB A;  1ZZF A;  5EN1 A;  2YKN A;  1TAQ A;  2GVD B;  1VFJ A;  2YNF A;  3TJA A;  4CTA A;  2R2T A;  2VJU A;  2Q1L A;  3QGH A;  2D41 A;  5HAO A;  3SQG B;  5C25 B;  4DS4 A;  3V4I A;  1B3T A;  4H54 A;  1H38 A;  4DV7 J;  1NME B;  3D66 A;  2WAQ D;  4PWU A;  2XC9 A;  4C8Y A;  2NXJ A;  4F4Y A;  4PPZ A;  1RTI A;  3W7B A;  1OYD A;  5J2Q B;  2IVF B;  1RIS A;  1U45 A;  2DCL A;  3N5B A;  4YDX A;  4QW9 A;  2YH1 A;  2DNO A;  4AL7 A;  1T9Y A;  4OHW A;  3W1Y C;  1I6J A;  2FLP A;  4MKB A;  3KLH A;  3K58 A;  5DJB A;  3FDS A;  5JUM A;  1F1B B;  3QIP B;  1M5O C;  3GE9 A;  1RAD B;  1UZD A;  2MJN A;  2YNF B;  4WBF A;  4CTA B;  1VRT B;  4PUO A;  3DRX A;  2O01 C;  4TU8 A;  2Z2Y B;  2ZC3 A;  1Q5V A;  2FY8 A;  2ZOF A;  4OYA A;  2B9X A;  2E7V A;  2GNK A;  4HLB A;  4USI A;  3CCR S;  1FRJ A;  1IBL J;  3V81 A;  2CPI A;  1HBU A;  2HGL A;  2BAC A;  1SKS A;  1YQH A;  4KHP J;  2KYX A;  2ZH2 A;  2ZUG A;  2LXF A;  2HWH A;  3PO5 A;  1KDN A;  2HS0 A;  3JYT A;  3ZZZ A;  2ZH3 A;  1K0T A;  3KNA A;  2XMV A;  2J5A A;  2O67 A;  3M2V A;  4E0D A;  3EZ5 A;  1HHS A;  2C3U A;  3CJT A;  1WHV A;  1UVK A;  3DXB A;  4ETX A;  1G4C A;  4OYX A;  4OX6 A;  3KHG A;  2QA1 A;  1QDU B;  5KFG A;  3BPD A;  3CD6 S;  2QX0 A;  1U6Z A;  2MQN A;  2W25 A;  4ES2 A;  4M94 A;  1E6Y A;  2DNN A;  2HVE A;  3UFC X;  4MKY A;  2XB2 D;  4X66 F;  1FHT A;  2DB1 A;  4LFC F;  2NSC A;  4A4J A;  1FFG B;  2KI2 A;  4DSE A;  1N5Y A;  2CQD A;  3IGN A;  4PG5 A;  5BR8 J;  1UVN A;  3SEO A;  1UW4 A;  3DRR B;  2XHC A;  5J2N A;  2WVD A;  3DFE A;  1SL2 A;  4JI4 J;  2FLO A;  4NI2 A;  2Q79 A;  2LXI A;  3HCX A;  3KFW X;  3MM8 A;  4LF6 F;  4C3M A;  5FJ4 A;  1RT5 B;  3BV8 A;  3HVA A;  3WC0 A;  5KT7 A;  1YHQ S;  2XHW A;  2JC0 A;  3AT1 B;  5ETV A;  4JP8 A;  2Z2M A;  4ZHR B;  4BWJ A;  3VZH A;  2MQ8 A;  4NLV A;  4H4K C;  1VOM A;  4ID8 A;  5FII A;  3PYE A;  4EYI B;  4XK8 C;  5DQI A;  1Q1K A;  1FFS B;  1XN9 A;  1ROF A;  3T5L A;  2IHR 1;  1T11 A;  4BWM A;  1HNZ J;  1M1G A;  3BGU A;  3L09 A;  3KK2 A;  5IT9 Y;  3OTC A;  1N33 F;  1B64 A;  3MOZ A;  2VOO A;  1SC4 B;  4ZJQ A;  4L6V 3;  2WZ1 A;  3TUI C;  2Y0B B;  2A0F B;  4EBC A;  2P9C A;  1PSD A;  1U6F A;  2COL A;  2VG7 A;  3HDS A;  3BQ0 A;  3M2R A;  1VQM S;  1P27 B;  1YJ9 S;  1YJW S;  2MLZ A;  1TL1 B;  4LF2 A;  4QWC A;  3QWP A;  2XLI A;  3R1L A;  1A0O B;  3ILI A;  1MW7 A;  4IH7 A;  1QAX A;  1RAB B;  5K20 B;  2MKS A;  3BBB A;  3LP1 A;  1CJU A;  1NK9 A;  1WNE A;  1XTZ A;  1SKU B;  3JXO A;  2VFU A;  2D7S A;  5C42 B;  3D68 A;  2B9W A;  3NP5 A;  4V1A k;  3SQO P;  3M9N B;  3RB6 A;  1R8H A;  1ZM2 A;  4I67 A;  2VOP A;  1XNR J;  5ETP A;  4DFJ A;  5D3G A;  1ARO P;  3KHH A;  4P2S A;  1HWJ A;  2O66 A;  3CD7 A;  3HSJ A;  2A10 A;  1RJJ A;  5EWG A;  3LF0 A;  2FGC A;  4PXD A;  3UO0 A;  5LL6 d;  1KEK A;  2W7A A;  5K8O A;  5DQG A;  3HHL C;  2XUL A;  3UVJ B;  3N6N A;  2CJ9 A;  3LGH A;  3MAQ A;  2M7S A;  3OTD A;  3GIL A;  3ZTO A;  3IR6 B;  2YVS A;  3U02 A;  1KQF B;  2H9Z A;  2N7Y A;  2J7U A;  1YBT A;  2YWH A;  2BM1 A;  2V2Z A;  3VVU A;  3OUY B;  1SKW A;  4J91 A;  1NO8 A;  3SSS A;  4J9L A;  1NHK L;  4M5N A;  4ZJL A;  1LXN A;  5B0D A;  2IM0 A;  4WFA Q;  1VQS A;  4OL8 A;  1RBL A;  2FZG B;  1BWV A;  2EEY A;  2P2C B;  3A12 A;  5F8H A;  3RB4 A;  1SIZ A;  2AV5 A;  2DH8 A;  3HFK A;  2BRK A;  3CJK A;  2ZKT A;  3CJ2 A;  4O0N A;  4Q43 A;  3IC1 A;  3M8R A;  4I6A A;  2YH0 A;  2ALY B;  2CJA A;  2AX0 A;  4J9P A;  1HA1 A;  2ZBQ A;  4ZPT R;  3TAN A;  4OX7 A;  3R97 A;  1JJ4 A;  1S9F A;  4DR3 J;  2VZ9 A;  3NMA A;  3US5 A;  3HP6 A;  4DR6 J;  2IFX A;  4LSL A;  4XAK A;  2QN6 B;  2APO A;  3VAF A;  2AWZ A;  2CXE A;  2WK4 A;  3I0S A;  5K8M A;  2FJD B;  3MPV A;  4ZPC A;  1N0U A;  2HNZ B;  2HFN A;  2J0X A;  3C8Y A;  4AL6 A;  2PGC A;  1U1N A;  1WF1 A;  2BE9 B;  1S6Q A;  2E5J A;  5CYM B;  3CJK B;  1JXV A;  2NXE A;  4CO3 A;  2QGF B;  3JSM A;  4GMK A;  2ZH1 A;  1K9M T;  1JK9 B;  4WE1 A;  4AT1 B;  4DR5 J;  1S59 A;  2ILY A;  4TU9 A;  4DPU A;  2B8P A;  2MPU A;  3BGO P;  4EK2 A;  3AHP A;  4A8X A;  5KFM A;  1Y10 A;  4JI1 J;  2VPY B;  3LWM A;  2AJ0 A;  1YGY A;  2M8D B;  2VON A;  2VFT A;  3ZTP A;  3AAW B;  4NEZ A;  4X66 J;  2W9C A;  3CDA A;  1Q79 A;  1UZH A;  3AQO A;  4XO0 A;  4DV6 F;  4DS5 A;  2HBR B;  2J6U A;  4AE5 A;  2LU2 A;  3I0R A;  3M30 A;  4JI5 F;  4IR1 A;  4DR2 J;  2HQ3 A;  5BR8 F;  3HFZ B;  5EWE A;  4A46 A;  1WKK A;  4DPX A;  4IFY A;  4LBI A;  1JLF B;  2ZOG A;  2H54 B;  1HBO B;  2KTQ A;  2HZC A;  1YTY A;  3BO4 A;  2DHS A;  5I42 B;  1JLG A;  2HVD A;  1I51 B;  3N28 A;  4LFA J;  1OJ4 A;  2EKY A;  8AT1 B;  3IS9 A;  2BA9 A;  3JQJ A;  1IBM J;  1BWE A;  3LP2 A;  1K1S A;  3F41 A;  3HF5 A;  1B7Y B;  4YY3 J;  5KFD A;  1XER A;  2XMT A;  1TUG B;  3HHL A;  3N6M A;  4CNY A;  2BR0 A;  1M5H A;  4YN3 B;  3K5P A;  1N56 A;  4BHQ A;  4EU0 A;  3PJX A;  4USH A;  3TYT A;  2X7I A;  1R0B G;  4CH1 A;  1HNV A;  1XWL A;  1F3F A;  3C66 A;  4RX6 A;  4U9R A;  4TU7 A;  4KFB A;  4DV4 F;  1CUL B;  3AB2 B;  5A8R A;  2JLF A;  4TNO A;  3TJ9 A;  1RHQ B;  3A8K A;  4KGZ B;  1WEY A;  4M5H A;  4QPT A;  2GHW A;  3I0S B;  5F8M A;  5D78 A;  5J2M B;  2MZT A;  2ZDO A;  1ZOT A;  3R5J B;  1BD6 A;  2IVY A;  2V2Q A;  1QAY A;  4O4G A;  1EJ7 L;  4MH8 A;  1HQE A;  2ZOM A;  4ZCI A;  2UUA J;  3CTR A;  3CF5 Q;  4DR4 F;  4NLS A;  2YTC A;  5KFX A;  3CJ0 A;  3SV3 A;  1XC9 A;  4JV1 A;  5AT1 B;  1RT3 A;  1TMM A;  4ZLL A;  4JYA J;  3MMJ A;  6FDR A;  1TL7 B;  1YDL A;  4KO0 B;  4W4M A;  5T41 A;  3DGV A;  3Q8R B;  4F4Z A;  4IOC Q;  1NB7 A;  2HHX A;  5J2P A;  5BXI A;  4YFU A;  7AT1 B;  1F2G A;  1IUJ A;  1TKX A;  3TX0 A;  2YNI B;  4U7U D;  1R0A A;  5ETN A;  3AB4 B;  2JFD A;  4O3O A;  2XI3 A;  4Z7C A;  4YR2 A;  3K0J A;  1SV5 A;  3PW2 A;  1ZH5 A;  1U7L A;  4OYI A;  2KT2 A;  1KLM B;  1FDB A;  3BH6 B;  1VK3 A;  3CW2 C;  4LIR A;  4USM A;  5HMZ A;  2AGQ A;  2XS2 A;  3HK2 A;  4DR7 J;  3O6Q A;  5CYQ B;  1LWF A;  3MMA B;  2M4M A;  4IDK B;  4CLU A;  5J1E B;  2HGN A;  4B9V A;  2WB1 D;  4M5K A;  3LH2 S;  5GAG I;  2HHH J;  2W2Q P;  3QLH B;  4IFV B;  2RH3 A;  1NHU A;  4CLP A;  3DYA B;  1VI7 A;  6AT1 B;  2QRR A;  2QMW A;  2Z56 B;  4HI2 A;  3W9H A;  4DL2 A;  3MCN A;  4QOT A;  5CZX A;  4B3S J;  4DV5 J;  1YIJ S;  2I38 A;  4USV A;  2EFO A;  2YNG B;  1VQY A;  2FJB B;  4CO5 A;  1REV A;  3RG6 A;  2W2M P;  3UR3 C;  5H9F J;  1YX2 A;  2VDH A;  1V9O A;  3MMC B;  1QLN A;  1BXN A;  4N56 A;  2DK2 A;  4NRU A;  2WHO A;  1YZ7 A;  3LAL A;  1FXL A;  5LOQ A;  2RF2 B;  2IM2 A;  3DYA A;  2QLX A;  4MK9 A;  1T9W A;  4C3L A;  2E5L F;  4MJK A;  3LO3 A;  3G96 A;  2AEF A;  4OZ5 A;  2NZ4 A;  2MHE A;  2V4J A;  2W2N P;  3NKY A;  2PA3 A;  2Z2L A;  4NOH A;  4NYP A;  2FIU A;  4M63 A;  5I3Q A;  4IKA A;  4OV6 A;  4LUB A;  4PQA A;  2SXL A;  1YRX A;  4HVZ A;  3PIP Q;  3OL7 A;  3JQK A;  4EYH B;  2GMH A;  4HR2 A;  4UOF A;  4OHZ A;  1B0V A;  4O4R A;  4A8Q A;  1K44 A;  1DQ8 A;  2V2V A;  3OJU A;  3D6F B;  4LFB F;  3MTK A;  2ZH6 A;  3W5Y A;  4IR9 A;  1LKZ A;  5J2P B;  2LCW A;  4X65 F;  4YUD A;  5B08 A;  1M1H A;  1LXJ A;  3QWU A;  4NI2 B;  2FGO A;  4Q44 A;  2OEJ A;  1DTT A;  3FRY A;  3RZA A;  4PWD B;  2R8H A;  4NCG A;  2DGV A;  4L3K A;  1URN A;  2A2D A;  1N88 A;  2NSB A;  2DNM A;  2VAS A;  4P71 A;  3T9Z A;  3CGI A;  5AE3 A;  4FYV B;  4DL3 A;  1PCA A;  3TP2 A;  4KPY A;  3EVM A;  4MIB A;  3W8G A;  4O4G B;  2JSX A;  2QTW A;  5IQ6 A;  3UE2 A;  4DFM A;  2V0N A;  1YBU A;  3IN5 A;  2UXD F;  1SQG A;  1BC6 A;  4H4M A;  4DL0 C;  5B0E A;  5BYS A;  4OZN A;  5HQL A;  3KLV A;  1WI6 A;  3CUL A;  2VQE F;  5F41 A;  2MLX A;  3R5B A;  3H25 A;  4DZD A;  1FEE A;  2WBM A;  3PX4 A;  1EKR A;  3L7P A;  3TZZ A;  1IKW B;  2YKP A;  2UXC F;  2NPI A;  2FC8 A;  1YVF A;  2XGQ A;  1T0T V;  2OGU A;  1HBO A;  1WHX A;  2B43 A;  5CAA A;  2L41 A;  4MYT A;  3ZZU A;  3PR5 B;  3BO2 A;  1N6Q B;  1U1L A;  3TA1 A;  1HNZ F;  1P1T A;  1CS4 A;  3OBI A;  3EMT A;  1T3N A;  3OHB A;  2ZH4 A;  5E33 A;  4C8L A;  1I1G A;  4BDP A;  2KM8 B;  3WHI A;  2CWK A;  1TAU A;  2JLE A;  4ZLP A;  1XR5 A;  3IMQ J;  4QW8 A;  3RRK A;  2VJV A;  2C2D A;  1HYS A;  3M8Y A;  5A8K B;  1JLC A;  1YG0 A;  2UUW A;  4UUX A;  4FXD A;  1WG4 A;  4JI2 J;  1GQE A;  4L3N A;  5EGY A;  2D3O R;  1RBO B;  1AZS B;  4GVL A;  3MCO A;  5THW A;  5LMU F;  1SCJ B;  2CYY A;  2H4Y B;  3I5A A;  3OVA A;  3ZZT A;  4NLU A;  1QM9 A;  3SCJ E;  1KVI A;  4K50 A;  2HNZ A;  3RR7 A;  1FDA A;  4ICL A;  1FTC A;  1S6Q B;  5CYM A;  1HQU A;  3JSM B;  1G2E A;  2MST A;  2V50 A;  2HG4 A;  1KVK A;  3A8I A;  3MR3 A;  3SFU A;  3DOL B;  4DX5 A;  4LF7 F;  1LWC B;  2JEI A;  1P8G A;  5CH7 B;  2WW8 A;  4ENO A;  2MQO A;  2K1R A;  1SB6 A;  4GC7 A;  3IWN C;  2HRY A;  1S12 A;  3UN5 A;  2KXF A;  3TNV A;  1JLA B;  4NLX A;  4DJB A;  4DXL A;  5L1I A;  3H59 A;  1TKX B;  2KL8 A;  2HZV A;  4RW6 A;  2GVZ A;  2D3O 1;  5KFT A;  3KJF B;  1ELO A;  1BQM B;  1X60 A;  3MPY A;  1KRP A;  1H7W A;  2Y1L B;  4EFA C;  2VKZ G;  2J6S A;  3DN9 A;  2A1B A;  2XBP A;  2YPY A;  3Q8Y A;  4ZLJ A;  5KFU A;  5E3A A;  4KHM A;  2EFN A;  1UPP A;  3OTB A;  6FD1 A;  3UR0 A;  5JVH Q;  1LWE A;  2XLK A;  4LF9 J;  3P3D A;  4LVO P;  2QZ8 A;  2UVR A;  2CZ9 A;  3OR1 A;  3B6B A;  1RSC A;  5IFM A;  3EVW A;  4GKK J;  3ZZY A;  1IM6 A;  2G2Y A;  2QYG A;  3PYF A;  4CRJ A;  5HSP A;  1S0V A;  5BYR A;  4DHV A;  5KFQ A;  5B0F A;  2ZC4 A;  2LA6 A;  1JLE B;  5IWA J;  5ETR A;  1HNV B;  3HMJ G;  2ZJQ Q;  3D6H B;  1YKW A;  1U2C A;  2KZZ A;  1RHK B;  1CUL A;  3UPF A;  1X4E A;  2XGP A;  4DV0 F;  1RKJ A;  3MM6 A;  1NRK A;  2VC1 A;  5DS7 A;  3U7J A;  1QTM A;  1BQX A;  2VFV A;  1FRI A;  3AJ1 A;  1FX4 A;  2OEK A;  2ZWO A;  4DWI A;  1CJT B;  1YZ6 A;  4ZVG A;  2Z0G A;  5KFO A;  3TUZ C;  4QCL A;  5F8J A;  2IMW P;  4J9R A;  4KH1 B;  1IBL F;  1QAI A;  1Y5N B;  2J76 E;  5KFA A;  5CCM A;  2XMM A;  2W7P A;  3TAM A;  4ED2 A;  4NLQ A;  1S1U A;  3MMA A;  2CPZ A;  3MPU B;  3ZFV A;  3KUH A;  1X4G A;  2B6A B;  3NS5 A;  4WYW A;  1FFW B;  2FJA B;  4ZN3 A;  2XY5 A;  2DGO A;  1FT8 A;  2BE2 B;  2AU0 A;  4PQU B;  1D9A A;  1T9V A;  5EX3 A;  1LFW A;  3MM5 B;  4L75 A;  4OJG A;  4URG A;  4C8M A;  2XMA A;  3PKM A;  2UXB F;  1LFP A;  5IOL A;  4EBD A;  3DLE B;  2YQ1 A;  4O3P A;  2DT9 A;  1LWX A;  2KT5 A;  2XO7 A;  4C48 A;  3LAK A;  1RLC L;  5LJ3 Y;  3SCI E;  4TQR A;  1R8B A;  1UA1 A;  5FLX U;  1EB0 A;  1Q78 A;  1R89 A;  4XDD A;  5J2N B;  4I69 A;  3NBP A;  1TP7 A;  3EIC A;  4ZCL A;  3ULH A;  2W4P A;  4CLY A;  4QWD A;  2BQR A;  3TI0 A;  2GJI A;  3R5G A;  1NPP A;  2OKQ A;  4WFZ A;  1S77 D;  2GW8 A;  2IMO A;  2AP6 A;  4L74 A;  4CM2 A;  4IO1 A;  3NGS A;  2GQQ A;  4P6Q A;  3J81 j;  1E6Y B;  3J80 Y;  2YNH B;  2OD6 A;  1Q53 A;  2CJY B;  4HAC B;  4QIF A;  2E7W A;  3M1V A;  5I3U A;  1WKL A;  2WVE A;  2XSJ B;  2VBX A;  3K8V A;  3MZI A;  4NRT A;  5IC6 B;  3PKY A;  4F3Q A;  3NGD A;  2RHS B;  1L3T A;  2DGU A;  2AYM A;  1Q5Y A;  2ILZ A;  3CJ5 A;  2PI5 A;  5JVG Q;  3QSI A;  1HMV B;  4LF5 F;  1ZS6 A;  1S79 A;  2IM1 A;  2RJZ A;  2ZNY A;  5KG0 A;  1DHM A;  2E1R A;  4DL6 A;  4KGV B;  5T7L A;  3K8W A;  3BDP A;  3P4U B;  4ZK7 M;  5K9F A;  1DTT B;  3EZU A;  3O5T B;  3V81 B;  1HL6 A;  1RT7 A;  4KSE B;  2GZO A;  4XDC A;  2LEB A;  5HLF B;  4ECY A;  1QVF R;  1WJ9 A;  4RW7 B;  4P7T A;  3LGM A;  3TAR A;  4HEA 9;  3JTP A;  1BUX A;  4KRW A;  1N33 J;  1NK8 A;  3ONQ A;  1HMV A;  1TZ0 A;  5C5J A;  3MF5 A;  3N0V A;  3LW5 C;  3PEJ A;  4K4Y A;  1T03 A;  2V9W A;  1PIL A;  3LA0 A;  3FEY B;  3CVK A;  2XZW A;  4JB8 B;  2GGP A;  4AXI A;  4CH0 S;  4XTT A;  3MFI A;  2E1A A;  1I5O B;  2B4P A;  4K59 A;  4KGX B;  1GXU A;  3B54 A;  3IBF B;  2X1B A;  3TZY A;  2ZE2 B;  3L95 X;  2R7W A;  1JKH B;  4UTG A;  2HLT A;  1NKB A;  3IR7 B;  1F2H A;  2CPF A;  5KFZ A;  3J7Y I;  4ILR A;  1ZTW A;  1PYS B;  1P6T A;  2BAN B;  2FJV A;  1TMJ A;  2W1B A;  3I9Z A;  1NAQ A;  4FDF A;  2VHG A;  3PRV A;  2DY9 A;  2DEI A;  4H4K A;  5SUH A;  2MZR A;  3T41 A;  4H4O B;  3P5T L;  2DXF A;  4WWS A;  2HND B;  2ZUA A;  4O23 A;  4CWB A;  2VQE J;  1H2U X;  2YWE A;  5C24 A;  3IAS 9;  2C3P A;  1CQN A;  1S9G A;  1OY8 A;  3SCK E;  1RTH A;  1HNX J;  3MUM P;  5C2G A;  1ZA2 B;  4OZ1 A;  3RGI A;  2ZHB A;  1MWY A;  2HMI B;  5F0W A;  1KVJ A;  2OML A;  1VR6 A;  3V6D B;  1OQ3 A;  4CH7 A;  4NXM F;  2LFV A;  3BZQ A;  1HNI B;  4RUH A;  1S5Z A;  2XO6 A;  4PQU A;  1RT6 B;  4URS A;  3KWM A;  2ERR A;  4DF4 A;  4K8R A;  4Y2K A;  4X4O A;  1CJK A;  1N6Q A;  3FEX B;  2LDI A;  3MM7 B;  5KT2 A;  1FTR A;  1OWX A;  2MTL A;  4ILM A;  2Z30 B;  1S1W B;  2KXN B;  2CJB A;  2WRM A;  5DLG A;  3DNC A;  3WIU A;  4BCA A;  4LRD A;  4OI6 A;  5E3R A;  2DY1 A;  3IBC B;  4PWW A;  2ZH9 A;  4F67 A;  3VAG A;  2Y1R I;  2MSS A;  2ASY A;  4X84 A;  4D3H A;  1OSD A;  3PAC A;  1EET A;  3THV A;  2H3E B;  1FWL A;  2AJQ A;  1RQ0 A;  3W64 A;  1TUW A;  4FN5 A;  1VQ9 S;  4RW8 A;  3FFI A;  2JZ5 A;  4ZCM A;  2QLW A;  3BKF A;  3KUE A;  2IJR A;  3MAH A;  5CD4 H;  4MYU A;  2KG1 A;  1X5S A;  2B5J A;  2HFZ A;  4I2Q B;  3I32 A;  4M5I A;  2MGZ A;  4ZP7 A;  3QT8 A;  4IYQ A;  1WD6 A;  3S6E A;  2N7C A;  5B0A A;  2G2Z A;  1GMW A;  1RE1 B;  4NLG A;  4ILL A;  3DI6 A;  3MD3 A;  4DU8 A;  1HQ2 A;  3Q24 A;  3ETO A;  2HSE B;  3VGS A;  5CHC B;  3ISZ A;  4F4W A;  4G3I A;  1WUU A;  1T7P A;  1QUV A;  3C46 A;  4YQW A;  3IFE A;  5IV3 A;  3Q8Q B;  4ELV A;  5HLF A;  1WC5 A;  3ENA A;  2RIL A;  2F40 A;  1NM2 A;  1ZAV A;  4EGL A;  1RT4 B;  2NUU G;  4DV1 J;  3SV4 A;  2MHN A;  5GMK a;  4HTI A;  4WCE Q;  3RR8 A;  4PXC A;  3R6G B;  3HPO A;  4B9T A;  3OQ2 A;  1WG1 A;  1PG5 B;  5KFF A;  1HNI A;  3BR9 A;  1GXL A;  2A6O A;  2A6M A;  1T3O A;  2GGP B;  4O0I A;  1RK8 A;  1JLB B;  2F8H A;  2FHM A;  2M70 A;  2NXC A;  3A8E A;  5GVQ A;  4GC6 A;  1MRO B;  3N4W A;  3U27 A;  2GCF A;  1W7W A;  3GJQ B;  1D9D A;  1VHI A;  3I0R B;  1XEZ A;  4CDI A;  1KD1 T;  2MXY A;  4NXN J;  2UVW A;  4LQ3 A;  5D8H B;  5DQH A;  4NLO A;  4ZVE A;  4DOZ A;  3PW5 A;  1NKC A;  2KVI A;  1QVG R;  4LFC J;  3TAM B;  4DSJ A;  2DIU A;  2BKN A;  4LRE A;  2I5J A;  4NLR A;  2PDA A;  3HVW A;  2DXD A;  2DIV A;  3Q22 A;  3VAM A;  3RB3 A;  1VQL S;  4Y0F A;  1RCX B;  2KDO A;  4KHR A;  3S1T A;  2EC2 A;  1ZAW A;  3I4P A;  3EGZ A;  4Q8F A;  4UF4 A;  2ZM6 F;  2PA8 D;  2XYP B;  2HFO A;  4LRB A;  3JSY A;  3B82 A;  3Q23 A;  3VV2 B;  4A8O A;  2AYB A;  2YKM B;  3QQC D;  3SIP B;  4FBT A;  1DQ9 A;  1VBY A;  3BSO A;  1U25 A;  3CDW A;  2N4D A;  4KFB B;  3CCW A;  3EDQ B;  3DLK A;  1X0F A;  4N41 A;  2CKW A;  4QR1 A;  3FBE A;  4LSN B;  3PY8 A;  2C3O A;  2VC0 A;  2UUB F;  2O3D A;  3AA9 A;  1WEL A;  1DJ0 A;  4JBC A;  2FD2 A;  3ENQ A;  3HHK A;  4N7T A;  3KHR A;  4EMD A;  1CC7 A;  2R2S A;  1CPZ A;  4UY8 5;  1NB2 A;  3HT0 A;  3DGP B;  2PD1 A;  1HBM B;  1SC6 A;  1ZA1 B;  3ETM A;  2E29 A;  4NLT A;  4R0E A;  4TYA A;  1SJR A;  2JFK A;  2DPI A;  2UVU A;  5FDL A;  3QT6 A;  1SJQ A;  4WTO B;  2GQ2 A;  4IO9 Q;  3QGI A;  4FF3 A;  1Q4R A;  2ROG A;  1GFW B;  3VAK A;  3D1O A;  3DLK B;  2GAH C;  1Q8B A;  1EZZ B;  1FE4 A;  2DO0 A;  3DKD A;  3M1V B;  5I3U B;  2R7U A;  2XG8 A;  2HFU A;  2D9P A;  4U96 A;  1NK0 A;  4LF9 F;  2HFS A;  1S1T B;  3OLB A;  4ZP9 A;  4RUB A;  1I94 J;  1S72 S;  2XZT B;  2OHD A;  1U1R A;  3PHE A;  1ZPV A;  4J9M A;  4O3S A;  2EK6 A;  2VG6 B;  1YBA A;  3BYR A;  5EUH A;  1Y5I B;  3NCP A;  3HVR A;  4C9D A;  1YJT A;  1IKX A;  1JB0 C;  5KFW A;  1YLX A;  4NCG B;  3V5R A;  4F0H A;  4YHH J;  4ECQ A;  1CEZ A;  1Z2Z A;  3KDO A;  3R2D J;  1N5Y B;  1YJR A;  2OPQ B;  3Q8V A;  1XR7 A;  2BKP A;  2ROE A;  3BBC A;  5B7W A;  1CJV B;  1MLA A;  2L9D A;  4MK8 A;  4ANE A;  4DR3 F;  2RAQ A;  3BQ2 A;  2R8J A;  4QU7 A;  3HHL D;  4USJ C;  4U6P A;  2KT3 A;  2AX1 A;  3LTO A;  1RTZ A;  3C16 B;  2CJQ A;  2F3J A;  4I2P B;  1V6H A;  4P9S A;  3MEG B;  1CG2 A;  1HI1 A;  4WPA A;  4PR6 A;  2ZE2 A;  3JTN A;  1S0O A;  1TFY A;  5D0H A;  4X4V A;  2AJ2 A;  2B56 A;  2HHP A;  2YWG A;  3IRX B;  4OHX A;  2MQQ A;  4B9L A;  1WC4 A;  3POT B;  2OO4 A;  4KGM A;  3PVX A;  3OR2 B;  4RW4 B;  3WBZ A;  2J9C A;  4K0K F;  2N4C A;  1UFL A;  1MRO A;  3NY0 A;  2U1A A;  2LEA A;  1HWU A;  4KYZ A;  1UJ6 A;  4HH1 A;  2AF6 A;  3DDI A;  3HO1 A;  2V8D A;  2EFG A;  4CLZ A;  2KG0 A;  2ASL A;  4Y2A A;  1PKU A;  4C0O C;  4BS2 A;  2VUG A;  3PV8 A;  1RTH B;  1NHV A;  3BH7 B;  2XLJ A;  2QEX S;  3MGJ A;  1C0U A;  2E7X A;  3NCR A;  3NLC A;  1TL7 A;  2EG2 A;  4KO0 A;  5A8W A;  3G6Y A;  3RAX A;  4HDG A;  1N52 B;  3DLG A;  3CCQ S;  3JAM U;  1U24 A;  4O44 B;  1IWG A;  1RYR A;  4MIA A;  1HWL A;  1FA0 A;  1X7V A;  4WP9 A;  4X2B A;  4W98 A;  3I55 S;  1U6B A;  5HP1 A;  1VHF A;  1Y5L B;  3G82 A;  2EXU A;  4LSL B;  3TA2 A;  3FBF A;  4ZIW A;  5KT5 A;  1VC6 A;  1QAJ A;  1KFS A;  5J1P A;  3I56 S;  1FJG J;  5M2P A;  1IVZ A;  2IRY A;  3J7Z 5;  1YJU A;  5CYQ A;  4QR0 A;  2DGX A;  5J1E A;  1XK8 A;  3OL6 A;  2NQP A;  1QUP A;  5KT3 A;  3QYY A;  1U48 A;  2J9E A;  4ZHR A;  4FF2 A;  1MMD A;  5B0C A;  1KOO A;  1SPB P;  3BR8 A;  2ZVS A;  4Z7Y A;  2MZJ A;  4ZA1 A;  2J0Q D;  2PI4 A;  4LQ9 A;  4LFA F;  3J7A N;  1TQL A;  3HHD A;  5KFY A;  4CO1 A;  4Z37 A;  2A18 A;  5KTQ A;  4B3T J;  5D4P A;  5MAO A;  5BYQ A;  1T03 B;  1F0X A;  1KR4 A;  4NA1 A;  2BJ7 A;  1FNX H;  1V3R A;  1VJQ A;  4WP3 A;  3MM7 A;  4ZCK A;  1VCT A;  4P74 A;  4R8U A;  2BEF A;  2ZHO A;  1GTE A;  1S1W A;  4YB7 A;  2NPF A;  4RW9 B;  2DNZ A;  3EVO A;  3Q86 A;  4N8N A;  3MUV P;  3DI6 B;  5CAB A;  3PR4 A;  2XCA A;  2KO1 A;  5CYJ A;  4I7F A;  1DTQ B;  2B0G A;  4NLD A;  3GR0 A;  2PMZ D;  2B8Q A;  4DF8 A;  3QSY B;  5A6W A;  2ACY A;  5K5M A;  3W9J A;  1GT8 A;  3GSI A;  3DOM B;  1KBR A;  2AIR B;  2OUG A;  3CO0 P;  3J81 U;  4FF4 A;  2AHO B;  1XNQ J;  1XBW A;  2JLG A;  2VIC A;  2Q43 A;  2VU5 A;  3OL8 A;  1KON A;  2V94 A;  2EFP A;  2DR8 A;  1D9F A;  3NRB A;  1PJ5 A;  2BJE A;  4O44 A;  1NH8 A;  2MB0 B;  1JLQ A;  4DR7 F;  3H4D A;  2C2N A;  1PC5 A;  1IQT A;  2IC3 B;  3D0G E;  3CD5 A;  3S8S A;  1BMQ B;  1AUS L;  4MTP A;  2Q6C A;  1X9S A;  1OQ6 A;  4MK7 A;  4ECV A;  2YWF A;  4M5D A;  3MUR P;  2GFF A;  4PG7 A;  1TK8 A;  5G0R B;  2V8G A;  4DX7 A;  3QID A;  2OTL S;  3QJJ A;  4OHY A;  3HXM A;  1HNX F;  3CCU S;  4KAI A;  1KWM A;  2JWN A;  1R43 A;  4IFY B;  3C2P A;  2CAJ A;  2CG4 A;  2OMO A;  5DDR C;  5AXN A;  1RTI B;  4OQJ A;  3DLH A;  3UDC A;  1UPM B;  3V6D A;  4DX6 A;  2ZEJ A;  4IG0 A;  5DM6 Q;  5KFN A;  2XTJ P;  2OFG X;  2KM8 C;  2XWY A;  3QJL A;  1B4S A;  4DR4 J;  2G1D A;  3PM9 A;  2MY7 A;  4K2J A;  2WB4 A;  5IC4 B;  2HFV A;  4K5S A;  3SDE A;  4B9U A;  3OFG A;  5CD4 A;  1VRT A;  3ICL A;  4DX8 H;  5KOW A;  4GO7 X;  1CJT A;  1FER A;  2DNR A;  2QMX A;  4LSZ B;  3KLE B;  3KG0 A;  4RNM A;  4DCO B;  1NK7 A;  3IM8 A;  2PE8 A;  2YWK A;  5ETO A;  1D3W A;  1LW0 A;  1Z1Z A;  1FRM A;  1HW9 A;  1RAO A;  1YRT A;  2LMI A;  2WOM B;  3KNG A;  3M32 A;  1W2I A;  3H2U B;  1IJF B;  4QIW D;  4USK A;  1GH8 A;  4DL7 A;  5HI7 A;  4C11 A;  4IFV A;  5F0U A;  4E2F B;  2B7C B;  1RGV A;  3AH6 A;  2DGT A;  2C3M A;  3PHT A;  3JYT B;  1V3S A;  4ZN1 A;  2IBO A;  4DQS A;  3V4I B;  4R0J A;  4Z2X A;  3X3U A;  4CLF A;  3KK1 A;  3BB5 A;  1IBK F;  2BKO A;  2W8L A;  2RRN A;  1D8Y A;  1HLW A;  3T1H F;  4BC9 A;  1KOH A;  5C7P A;  2WOM A;  3C6U A;  2C2K B;  4C4W A;  2LDY A;  2YQ3 A;  2WON A;  4DR6 F;  4DUY J;  1H0H B;  4MKA A;  3FMB A;  4ZPW R;  1RI7 A;  1R27 B;  1TV6 A;  3M4X A;  3QT7 A;  1UEK A;  1OIA A;  4U7U K;  2GC8 A;  1Y11 A;  3QIP A;  4Q7A A;  4OZ2 A;  2NCK L;  4WZM A;  2NLW A;  1K47 A;  4OZJ A;  3TQ1 A;  3DU6 A;  3IS9 B;  3K5L A;  1RTJ A;  4JI6 J;  1NDL A;  3KJN B;  4RBT A;  4NCA A;  2MQM A;  1VQ6 S;  3DDK A;  1EX8 A;  3AOB A;  3M2U A;  1NPK A;  2RS8 A;  4YR0 A;  1DZ5 A;  1S1V B;  1L3V A;  2DBB A;  3NXZ A;  3DM2 B;  4G6V B;  3ADA C;  2DNQ A;  1U2R A;  2DNK A;  3MM9 A;  4RZR A;  4ZMM A;  4A47 A;  2RRB A;  1SL0 A;  4TY9 A;  3RB0 A;  4JI5 J;  2BVZ A;  3F44 A;  1FJE B;  4LVN P;  3TVZ A;  3R8Y A;  3QZ8 A;  5CCL A;  2UVV A;  1VRU A;  3DDN A;  4WP8 A;  3D1H A;  1KP6 A;  4CYU B;  2L08 A;  3EPI A;  2AGO A;  1RWN B;  1F60 B;  2MKJ A;  2MZS A;  3MEG A;  4YEA A;  2BJ9 A;  2QA4 G;  4KQZ A;  1MMN A;  1KTV A;  2IDE A;  3NGU A;  1U1K A;  1D1U A;  1REV B;  1RT3 B;  4I56 A;  2HAI A;  4ETZ A;  3QFH A;  3TVK A;  1IKX B;  3TUP A;  1TL1 A;  4TVA B;  1LNQ A;  1C0T B;  2HIY A;  4KPC A;  4XPE A;  3UCZ P;  1GXT A;  3GTY X;  1XIQ A;  3GFH A;  1AA1 B;  3FZ2 A;  2MKH A;  3NCQ A;  2MKI A;  2FJE B;  2F9J A;  3A3O B;  1S1T A;  2WVC A;  3FEZ A;  1HHT P;  1CVJ A;  3UDE A;  4Y34 A;  2HS4 A;  5F8I A;  3F73 A;  2AD9 A;  2ZVI A;  1QE1 A;  1UL3 A;  2HWT A;  4P7V A;  2DEJ A;  1KLM A;  4ZVQ B;  3QFW A;  4NWB A;  3NWR A;  1B0P A;  4J90 A;  4C7Q A;  4A8Y A;  4JI0 F;  2MZ1 A;  4B9N A;  4XIU A;  2QA2 A;  3C14 B;  1M5P C;  3MEC B;  1BHN A;  3M6V A;  1X4D A;  3CCZ A;  1F9E B;  2KFZ A;  1NK4 A;  2AYG A;  2F5G A;  1EP4 B;  1FF2 A;  1NLK L;  1SQE A;  4LF8 J;  3RJM B;  2ASD A;  4ERD A;  2CNL B;  2QLJ B;  1PBU A;  2NUH A;  3M8Q A;  3QGG A;  1TL3 B;  4UST A;  5A6P A;  3GPA A;  4U8Y A;  5HVH A;  1J5E F;  2PT0 A;  3G8T A;  4HAC A;  1XJW B;  2J7K A;  3MMB B;  2LQJ A;  2OD4 A;  4B3R J;  2EFV A;  1XMO F;  4Q2L A;  4QIG A;  2BDP A;  2V68 A;  3J7A 1;  3RBX A;  1WHY A;  3W2V B;  3MUT P;  4ES1 A;  2HLU A;  4LF4 F;  4P2F A;  2LP4 A;  4PPD A;  3KLF B;  1S4E A;  1H3D A;  1E6V B;  1VGY A;  3GB0 A;  1TKZ A;  4C97 A;  1J2V A;  1VC5 A;  1RAI B;  1TL3 A;  1WOS A;  3QBC A;  3VHQ A;  5JMN A;  2XS5 A;  3D0I E;  3H2L A;  1HBU B;  3KKF A;  4ICL B;  1H2T Z;  1VBZ A;  3AJ2 A;  2QO3 A;  2F8M A;  2RU3 A;  2V8P A;  3DU5 A;  2H48 B;  2IYG A;  3HVT A;  4WK1 A;  2BAN A;  5HJX A;  3VAH A;  5E0O A;  4KJI A;  3H8Y A;  3WIV A;  1RAG B;  2B7B B;  4X64 J;  4ZLN A;  4I0W A;  1IR2 A;  1DRZ A;  1IWA A;  3BGR A;  5DGA A;  3ELH A;  1N48 A;  1HPZ A;  5ETQ A;  2R7X A;  1S1X B;  1HR0 F;  2BAB A;  5D4O A;  1V5I B;  3KLG B;  3F0N A;  5KG7 A;  2BBE A;  2CPD A;  1Q7L B;  3DM2 A;  1VBX A;  4F25 A;  3OLA A;  3GYN A;  2DR9 A;  5LSL A;  1YI2 S;  5CXT A;  1SJ4 P;  2RSQ A;  3OR2 A;  4UQT A;  3OXL A;  3D0H E;  2WCX A;  1I3O B;  2HMI A;  2CQP A;  4B3T F;  4EZ6 A;  1XMB A;  1UWB B;  2VQF J;  5AXL A;  4RLE A;  4YDD B;  4J9V A;  2JOQ A;  4ECX A;  4HHH A;  4B9S A;  3T6B A;  3D3B J;  4LT6 A;  5KG3 A;  4KY3 A;  3VTI A;  2EC0 A;  3NNA A;  3ENV A;  4FPI A;  5C24 B;  4DUZ J;  1MU2 B;  3GV8 B;  1RU1 A;  4HYK A;  3M6U A;  1QSS A;  4OLP A;  4AYB D;  2JEJ A;  2DGQ A;  1RXO B;  4NZ0 A;  2CG8 A;  1ACM B;  4DPO A;  3IRW P;  4NEY A;  2ATL A;  3IG1 B;  1B70 B;  4X65 J;  1DUR A;  3W2W B;  2FTR A;  4LF8 F;  5IT4 A;  2K3K A;  3BBF A;  1FJG F;  3CB4 A;  2Z58 B;  1XR6 A;  1FVQ A;  1OMS A;  2MKY A;  2P6S A;  5DRK A;  3PW4 A;  4Y2I A;  4CO2 A;  2RRA A;  3ZZR A;  1Y9O A;  4LBH A;  2QLF B;  1BE4 A;  3DLB A;  1FKA F;  4LJM A;  3FFI B;  4JI8 J;  5E41 A;  4DMZ A;  2FLL A;  3B4D A;  4D3G A;  2UXB J;  4X4N A;  2VL1 A;  3MWB A;  3KLE A;  3VGT A;  1Y3J A;  2K06 A;  5DG8 A;  3BPS P;  1WTB A;  1SXL A;  2GHV C;  2CQ3 A;  4DLE A;  1F9H A;  5LM7 E;  5H1S V;  3QO9 A;  2CZ4 A;  2ASJ A;  3V2U C;  2E9R X;  2P8I A;  5ITH A;  1FI4 A;  2K7K A;  2QA4 S;  2BW2 A;  2BQ3 A;  2EVZ A;  4DSK A;  3I96 A;  3K89 A;  3U1M A;  3FJ2 A;  3BJY A;  4P73 A;  5I42 A;  3RYL A;  1L5U A;  2UV8 G;  1IBC B;  3TEG A;  3M6X A;  3G6V A;  4JI0 J;  1M90 T;  3HKW A;  4B3O B;  3R3T A;  3NMR A;  1TKT B;  4OIX A;  2WVB A;  3V4M A;  2QJ3 A;  5EDW A;  4MAK A;  4CZC A;  3AOC A;  5RUB A;  2FZC B;  3BKT A;  2Q6B A;  2Y9H A;  4M5M A;  4A8F A;  2F4V J;  2MLY A;  4UUW A;  1U26 A;  3SBM A;  3TRG A;  4NZ6 A;  5A0Y B;  2ZH8 A;  5HL7 Q;  4RO0 A;  3K5N A;  1RAH B;  1YK9 A;  2YKN B;  3AOD A;  3HSZ A;  4Y6I A;  2W7O A;  2FY1 A;  4MFB A;  5HJY A;  4RWW A;  1HIY A;  2WVF A;  2RS2 A;  4QPX A;  1RT2 A;  2XEX A;  1GNK A;  4DPT A;  4ZKA A;  5HQM A;  1VC0 A;  2QFI A;  5E2Q A;  2PSZ A;  4OI3 A;  2W9B A;  2ZZT A;  2CQI A;  3FCW A;  4J5O A;  5DLF A;  5L46 A;  4Q0B B;  5ETT A;  2R7S A;  5LMN F;  4DQP A;  1IBK J;  2HHS A;  1MG7 A;  2AZ3 A;  2OLW A;  3OT9 A;  2H4W B;  3H98 A;  4CI0 B;  2EWH A;  3S01 A;  2HBQ B;  1Z4U A;  1IR0 A;  3SSQ A;  1U47 A;  4C0B A;  2ALZ A;  3GFX A;  2ZH5 A;  1H73 A;  3CED A;  1T9U A;  1W25 A;  2AYE A;  4ID5 A;  1U4B A;  4PYA A;  5E5N A;  3RU0 A;  3MM8 B;  1RWO B;  4X4T A;  3H90 A;  1S97 A;  3AXK A;  1TR0 A;  3T6J A;  4RU9 A;  4URQ U;  3M8Z A;  2FC9 A;  1RAE B;  2DPJ A;  4ECU A;  4DG1 B;  4DQR A;  2IIH A;  1TKD A;  4OI0 A;  3I5C A;  4O3Q A;  4OYW A;  3CT9 A;  4PAA A;  3FBC A;  1M0S A;  4ED0 A;  3QAT A;  4JV0 A;  3D9B A;  2YNG A;  1UKU A;  3GFZ A;  1NCL A;  1RZM A;  2QYC A;  3MR2 A;  5L1J A;  4RL1 A;  2VDI A;  2ZBI A;  1TKZ B;  4C8Z A;  2V6A A;  2X1F A;  1T05 B;  3GCW P;  3ZZP A;  1Y0H A;  2LA4 A;  4NXM J;  4DUZ F;  4HT7 A;  1ZET A;  1RAA B;  4JI2 F;  3BF4 A;  4WFN Q;  1VQ8 S;  1ZPW X;  2VV5 A;  3CUN A;  3MTJ A;  4OYZ A;  2PEH A;  4HKQ A;  1BGX T;  1Z2L A;  2HQI A;  2H65 B;  1JJ2 R;  4F2R A;  5HP1 B;  3D28 A;  3HHL B;  3UNY A;  4LFB J;  5M2U A;  1V5V A;  1RTD A;  9ATC B;  3D4J A;  2QFJ A;  4OX9 J;  1JMT A;  2VD3 A;  3K5O A;  3MED A;  5KFR A;  1BY9 A;  3CIZ A;  3U1L A;  1RT7 B;  2MYF A;  1KHW A;  2OJ3 A;  5LSO A;  4F3O A;  1O6X A;  4IRC A;  4ZIT A;  1KQG B;  2KZM A;  3QLH A;  2BV3 A;  2ZDP A;  4TYB A;  5LMN J;  3UCU P;  2OIH A;  1G1X A;  2GMJ A;  2HQG A;  1ZM9 A;  2KXH A;  2RQ4 A;  3D7S B;  3IWX A;  4C8K A;  4WKR A;  1SH0 A;  3M05 A;  3NNH A;  2CDQ A;  2X1A A;  1VDH A;  1FKP B;  3DRP A;  3KK3 B;  4ATN A;  3IRX A;  4DLG A;  2YNH A;  4GKK F;  1RP5 A;  2UU9 F;  1P9Q C;  4GVB A;  3PYG A;  1FDD A;  2FLN A;  1IKY A;  2HKE A;  3DRR A;  1O8B A;  4LF4 J;  2JHE A;  1AFI A;  2Y8Y A;  2M52 A;  2VA2 A;  2W01 A;  2DCU B;  5T7L B;  2XWX A;  2XMK A;  3SXL A;  3GMG A;  3CMA S;  3MI7 X;  4NCB A;  3TWZ A;  1ZBT A;  3DHX A;  2BJD A;  4KKO A;  4ER8 A;  4N47 A;  2ZBC A;  3TVY A;  3MD1 A;  4GVB B;  5HVF A;  1VQ4 S;  3O3L A;  1SI9 A;  2A2C A;  1J5O B;  1AW0 A;  1UWB A;  1D8Z A;  2NYH A;  4Q8E A;  2PC6 A;  4UY8 T;  3GZ7 A;  2ZJR Q;  2FJW A;  3FSY A;  4PG6 A;  3CMQ A;  1SJ3 P;  4Q0B A;  3BEG B;  2NXN A;  4IH6 A;  1JNZ B;  2V9K A;  3B4M A;  3G82 B;  4EO8 A;  1FXD A;  1MNE A;  1Q8I A;  3GJR B;  5HAT A;  1HR0 J;  2BE7 D;  1ZYQ A;  2ZKU A;  1UEU A;  1S1X A;  2OPP A;  3LOU A;  1KSP A;  3IG1 A;  4K2X A;  5D4N A;  4OZ0 A;  2I2Y A;  1SH2 A;  4UOC A;  1WEZ A;  3G71 S;  1X9M A;  1ULR A;  2ADC A;  1EKS A;  4ZJO A;  3W8P A;  1KQK A;  2FHJ A;  2J9D E;  3VGV A;  3C14 A;  3HVT B;  4I6Y A;  4Q5V A;  3GV5 B;  4OLO A;  4DR5 F;  2GVZ B;  4ECR A;  2M2B A;  3OUY A;  4WE1 B;  3E2E A;  1R8C A;  1MSW D;  4QWE A;  3G86 A;  1FES A;  1FRK A;  4RNH A;  2EBE A;  3VZI A;  1N34 F;  2UUB J;  4YOE A;  3IO1 A;  2DTJ A;  2MQL A;  3OL9 A;  3VAJ A;  3D2W A;  3PNI A;  2NR0 A;  4K5R A;  1LK5 A;  4JI7 F;  1MN9 A;  3I82 A;  4EI2 A;  3EM1 A;  1UET A;  1H7X A;  3AJD A;  4JUZ A;  4RBV A;  4B3R F;  1HQU B;  3KG4 A;  3CO9 A;  2Y1I A;  1X4H A;  4QIV A;  1IKV B;  3PCO B;  2DNL A;  5F8N A;  2UU9 J;  1FJ7 A;  1K0V A;  3TQE A;  4CLW A;  1APS A;  2G0I A;  5HBM B;  3RW7 A;  4X4R A;  1FXR A;  3K17 A;  4WF9 Q;  2I1R A;  2G2O A;  1QTN B;  2HS3 A;  3OSP A;  2AEM A;  1HD1 A;  2HYI B;  5DGB A;  2XZD B;  1D09 B;  3TW0 A;  2HVZ A;  5KFL A;  4QJV A;  3CJ4 A;  5CA5 A;  1T94 A;  1X31 C;  5DZ7 A;  3Q0A A;  4PUO B;  3M7V A;  1F9F A;  3ZZO A;  2CIM A;  2AJF E;  4DN0 A;  2OI2 A;  1OO0 B;  3HSG A;  2PO4 A;  5A8K A;  3OHA A;  3OV7 A;  4U95 A;  3DOK A;  2RE1 A;  5F8L A;  4GRS A;  4M1K A;  3GV7 B;  3MAA A;  4CLT A;  4X62 J;  2GO9 A;  4OX9 F;  1FKP A;  3DRP B;  1C4C A;  1GMU A;  3I87 A;  2BE2 A;  1S6U A;  3JSB A;  3KLI B;  3OR1 B;  5AJ3 J;  1JIH A;  2W9C B;  1RT1 B;  4S0M A;  2GJ2 A;  4TXS A;  1RTJ B;  1NKE A;  2BXJ A;  1G3O A;  5K14 A;  2EK1 A;  3THP A;  3H5X A;  1RWK B;  4TLQ A;  4WFY A;  3RBZ A;  5F8G A;  1RUS A;  3KHL A;  1RHM B;  1IKW A;  4DSF A;  4GKJ J;  2DHG A;  1HNW J;  2DGS A;  2WON B;  2PFD A;  2J7W A;  2P9G A;  4NYO A;  1TV6 B;  2XYH B;  5H9E J;  2CFX A;  3PFO A;  1VBK A;  4M5L A;  1WKJ A;  3HD1 A;  2G13 A;  1BQN A;  2PII A;  1S6P B;  3TX8 A;  3ZXW A;  3T1H J;  3DLL Q;  3HT3 A;  1Q8L A;  2DHH A;  4V19 J;  5D77 A;  2MY8 A;  2A3J A;  2MMY A;  2QE5 A;  4KHP F;  2X51 A;  5KFB A;  3T5J A;  4ZPB A;  1HYS B;  4ED7 A;  2VPX B;  5L1K A;  2GIR A;  1I94 F;  1R31 A;  1TTH B;  2BJ8 A;  2IA0 A;  4NLW A;  3W65 A;  3MM9 B;  1JLB A;  3CC4 S;  5KT6 A;  3EYZ A;  4B08 A;  3UN3 A;  1N5T A;  1BQN B;  2ZZN A;  3GYX B;  4MMO A;  4E98 A;  3CDB A;  2YWW A;  3E51 A;  2KRR A;  1PIE A;  2P5V A;  2L48 A;  3D67 A;  2ZBP A;  3EZO A;  3I4H X;  4DV5 F;  3PW0 A;  3DGP A;  5AXK A;  5I3P A;  3FSI A;  2K2P A;  2VG7 B;  3EPG A;  1HBM A;  3QO9 B;  2DXE A;  2CQ4 A;  1YJ7 A;  3P96 A;  3GII A;  3GCX P;  1GMV A;  3T1Y F;  4B3S F;  3DXS X;  4AUK A;  2DNG A;  2Q3P A;  3FQL A;  4FKY A;  2K1R B;  4ANC A;  2RQK A;  1S99 A;  2AJ4 A;  1JLA A;  1NK5 A;  3KK1 B;  1HQE B;  1UEV A;  1VYA A;  2Z57 B;  4NAS A;  4PCQ A;  5GME A;  1NDP A;  2DHA A;  3JQM A;  4OZL A;  3M8S A;  4PRF A;  1GAO A;  4WII A;  2J6T A;  3CJQ A;  4CLS A;  3C15 B;  4A8K A;  1VJW A;  3IBW A;  3RBE A;  1L3U A;  2YKM A;  4UT4 A;  1AFJ A;  1WI8 A;  2OPS B;  1PAU B;  4KKO B;  1U1P A;  1S9E A;  5DDP C;  4PEO A;  2KRB A;  1JJH A;  2PEB A;  5A2Q U;  3PYD A;  2QL9 B;  2RF2 A;  4KB7 A;  2FUG 9;  3OTO J;  4LRF A;  3R1H A;  4NXN F;  3FC9 A;  3MEE A;  2GA7 A;  3N5F A;  1FVS A;  2R42 A;  4OFZ A;  3UW1 A;  4DZ6 A;  5I4M A;  4ECW A;  1TK5 A;  4H4O A;  4P52 A;  4MFB B;  2RQM A;  1WOP A;  1OPZ A;  2BJ1 A;  3W60 A;  1WC1 A;  2DKO B;  2D74 B;  4ELU A;  1IN0 A;  1FD8 A;  3FCH A;  4OX8 A;  2QG9 B;  1WF0 A;  2W9A A;  3DLE A;  1S7H A;  2G9O A;  3CNQ P;  4K7Q A;  2RKI B;  3GJS B;  3G2X A;  1VMB A;  5F9N A;  2KFY A;  1SQF A;  2FVS A;  2DRA A;  4FVM A;  2PN6 A;  1WSV A;  1R0C B;  3FNN A;  1EAY C;  5FLX Y;  4CO0 A;  4RW4 A;  3MOJ B;  1REG X;  2CJX B;  2DIT A;  3FCV A;  3ITH A;  4LR8 A;  4M5G A;  2WTF A;  2UXD J;  1S48 A;  1HBN B;  1H6K X;  4KH0 B;  2YKQ A;  1SJF A;  1X4A A;  4I64 A;  3IXQ A;  4DV1 F;  1U1O A;  2HVH A;  4WZQ A;  2LLZ A;  1GK8 A;  5KG1 A;  2IPO B;  3MED B;  3W5X A;  4DR1 J;  3NS6 A;  1CSJ A;  2KJW A;  2VB6 A;  4P2M A;  1Y4Z B;  4IQX A;  1QD1 A;  2CDR B;  4YB5 A;  2OPQ A;  4E8U A;  1C1C B;  1JWW A;  2ACM A;  3GP9 A;  4USW A;  4EO6 A;  3KJQ B;  3FRZ A;  1QE1 B;  1E6V A;  3PJ9 A;  4NLP A;  2EW9 A;  4H4M B;  5BJR A;  2V4R A;  2N3L A;  2QT7 A;  3G9C A;  2M9K A;  1UP1 A;  1O5J A;  4FF1 A;  1PYT A;  3GG0 A;  5HRO B;  2C2M B;  2BOP A;  3K7R A;  2HZA A;  1EQ0 A;  3J80 U;  2AJ1 A;  1GX6 A;  2R8G A;  1N32 F;  2B5J B;  4I2Q A;  3RAM A;  1XNQ F;  1OYE A;  2KHD A;  4O3N A;  2GJF A;  2DH7 A;  3CCV S;  3K5M A;  4OJH A;  4F4X A;  4ZVP B;  1ZTT A;  3NG8 A;  2NYI A;  2MEW A;  3NBP B;  5HVG A;  1PGZ A;  1UCN A;  1AZS A;  1ZM3 A;  5L9X A;  5DET A;  3UI3 A;  2ZBR A;  3OVB A;  4Y2C A;  4F0K A;  2WSF C;  1NUE A;  2VH7 A;  4N5S A;  1JKH A;  2M0G B;  2AT1 B;  3H5U A;  1F5C A;  5CQG A;  3TAP A;  1HKA A;  2RIJ A;  3GFY A;  2CZV C;  3TR5 A;  2BJ3 A;  4DQI A;  1FRL A;  1UFK A;  3H42 A;  3MCM A;  4R5P A;  1FRH A;  3DC2 A;  1HPZ B;  3W63 A;  1LWC A;  1FKO A;  1MN7 A;  4WIQ A;  4WK3 A;  1DLO A;  4ZPV R;  4A8M P;  3LPY A;  3AD9 C;  5KG2 A;  3LP0 B;  4UQG A;  3X1L B;  3T1Y J;  3W62 A;  5IQQ A;  3O44 A;  2JVO A;  2JJ4 D;  1VIO A;  2OSR A;  2ZNZ A;  4B17 A;  3ISN C;  4DU7 A;  3HZE A;  2V8H A;  4K4T A;  2POK A;  1FK9 A;  2C22 A;  3KG1 A;  5B0B A;  2I5J B;  3IGV A;  1N36 J;  3CJ3 A;  2VFS A;  5LJ5 Y;  2BX6 A;  5HBM A;  3T5H A;  4NMX A;  5A0Y A;  1Y3K A;  4PXB A;  1S49 A;  1VRU B;  3BDE A;  4CYU A;  4KV8 A;  3L7U A;  3CCL S;  1RT1 A;  3TZX A;  3J7Y U;  2WSC C;  4PG4 A;  2VF3 A;  3CC2 S;  2CQB A;  2PFF B;  1HAR A;  3ZZ0 A;  5KFI A;  3QAU A;  3W2V A;  3ZTQ A;  1VIX A;  2R8K A;  1DQA A;  4X4U A;  4I7F B;  3W66 A;  3KMQ A;  4Q2M A;  5JXS A;  2N3O A;  4DV2 J;  1EET B;  1FEH A;  1P9Y A;  3RUB L;  3L7O A;  3G4S S;  2DRB A;  4G1Q B;  2QLB B;  2DGW A;  1HWK A;  2XI2 A;  3IWL A;  3R5D A;  4BBY A;  1Y00 A;  4DQQ A;  3SYZ A;  4K4U A;  4A8W A;  3SDE B;  2CQC A;  4J9U E;  1A9N B;  2LEC A;  5K8P A;  2AQ4 A;  2IVM A;  1QJH A;  1AXQ A;  1LOU A;  1BQM A;  4JI6 F;  2C2Z B;  4ZVR B;  3UD5 A;  4K4X A;  4O3R A;  1UVJ A;  5EX0 A;  2F4V F;  1V3Z A;  2I8E A;  1WC3 A;  2CPJ A;  2BZ2 A;  3OTE A;  3H5Y A;  1EHW A;  3LAM A;  3CJR A;  4XPC A;  3K57 A;  2F7V A;  1SL1 A;  1TFW A;  2HW3 A;  4EUV A;  1EIY B;  3R7S B;  3T3F A;  4C2M A;  2EG1 A;  3LQV A;  5U47 A;  4J9K A;  1CQM A;  2DH9 A;  3TJ8 A;  1GTH A;  1ZM4 A;  2EFQ A;  3W61 A;  5HRO A;  1Q86 T;  3T1A A;  2HBY B;  3VAI A;  4LR7 A;  4DSL A;  2G0C A;  2E9Z A;  4OJ3 A;  5KG4 A;  4ES3 A;  2GML A;  2E5G A;  4UOH A;  2W9B B;  1RWM B;  4NA2 A;  4CNZ A;  1DY3 A;  4YR3 A;  3AA8 A;  1TK0 A;  4X4S A;  3TO8 A;  2HHH F;  4RWX A;  4RKU C;  3UNG C;  1KKH A;  3WC2 A;  2ZWP A;  3GQC A;  3MM6 B;  3HJV A;  4ECT A;  2HQF A;  2MJU A;  4Y65 A;  3H0P A;  5D6G A;  1UVM A;  5DG7 A;  1RB0 A;  3E01 A;  4C0H A;  5T14 A;  2L9W A;  3SMZ A;  3PXG a;  3MM5 A;  4LBP A;  1R7I A;  4FNH A;  1S10 A;  4CLL A;  4OJ1 A;  4P2X A;  3EGV A;  1BLU A;  2LQB A;  1F6T A;  1RAJ A;  2B4V A;  2FVR A;  2IRX A;  1JLF A;  3HZG A;  3DOK B;  2RHQ B;  3IA0 A;  4AD6 A;  5HN0 A;  3L3C A;  2F65 A;  5J2Q A;  4JYA F;  1VK8 A;  3BRE A;  3H4B A;  3SZ2 A;  5AE1 A;  3OXG A;  2B6A A;  3N6L A;  5IT9 U;  2BW7 A;  2YNI A;  2V4J B;  3GIJ A;  4LF1 A;  4RUA A;  4DV2 F;  2NS1 B;  1Q16 B;  4LF5 J;  5AJ3 F;  2L9N A;  3FGV A;  4KE5 A;  1X8D A;  1RT4 A;  2B4O A;  4QIE A;  1X4B A;  3ILL A;  2RUG A;  2BQU A;  1Q0N A;  3DCA A;  4USU A;  4FYY B;  3QGP A;  4QBU A;  3NAH A;  3QNW B;  4F8R A;  4IUF A;  2FPH X;  2VQF F;  3RRG A;  3G8S A;  3HSD A;  2XSJ A;  3CD0 A;  3I5B A;  1TVR A;  4AFF A;  1Q7Y T;  4J7C A;  2MQP A;  3JS9 A;  4C8N A;  1B0T A;  4J9Q A;  1WHW A;  4ZDN A;  4WU2 A;  1RYS A;  3OFF A;  4PG8 A;  3DLJ A;  1S6O A;  4DV6 J;  2DNY A;  3CJ8 A;  3V6K A;  3QRP A;  1H74 A;  3JSR A;  1S1V A;  2UV8 A;  5DDQ C;  1T05 A;  2MDA A;  1N36 F;  2UP1 A;  1UWA A;  1T8E A;  1SC1 B;  2HIQ A;  3P6Y C;  2VG5 B;  5KFJ A;  5L38 A;  2E66 A;  3VF0 B;  3NWG A;  3GSD A;  3DRS A;  4F7V A;  5KFE A;  5H9F K;  2IAJ A;  2ZJP Q;  3C19 A;  3GLJ A;  2WBR A;  3HX9 A;  4HL9 A;  8RUC A;  1U02 A;  1NZ8 A;  2CNK B;  2DIS A;  1HBN A;  4NL5 A;  4BC7 A;  2F8E X;  5HMW A;  5A2Q Y;  2BUN A;  2BM0 A;  3KXD A;  1IBM F;  2XNR A;  2OEM A;  1YRU A;  2R7Q A;  1XQI A;  2RQC A;  4ZVO B;  2VG5 A;  4KR0 B;  4RNN A;  1SIW B;  2U2F A;  3R27 A;  1PJ6 A;  4TQS A;  1L3S A;  2UXC J;  4HDH A;  3RRH A;  2UZA A;  4FXV A;  1JQG A;  1RAF B;  1FWP A;  4Y00 A;  3UVJ A;  4DPY A;  1RWP B;  4AND A;  2CQ0 A;  2P9E A;  3NEK A;  4ZIV A;  4YP3 A;  1VS3 A;  3ZTS A;  1S0N A;  1NDK A;  3F56 A;  3M2V B;  4G1P A;  1SJ1 A;  3PTW A;  4A8S A;  2QMU B;  1RWV B;  1H72 C;  2C2O B;  3CCJ S;  3SFG A;  2RB7 A;  3SSR A;  2E5H A;  2EBG A;  4ED3 A;  3RAQ A;  1VQ7 S;  1AUD A;  1S9G B;  1N0V C;  3MMC A;  4ZPD A;  2W8K A;  3MHY A;  1QSY A;  3CDU A;  1R6V A;  4ECZ A;  1M1K T;  5DDO C;  1S76 D;  3H7H B;  3LP1 B;  3PX0 A;  3MEE B;  1HI0 P;  3W3S A;  4MIW A;  5LMU J;  3PFE A;  4LF6 J;  4LMZ A;  5GAG U;  1O0P A;  2DRD A;  3P8B B;  4HHU A;  4KT0 C;  4KC5 A;  1MML A;  1M5S A;  2W2O P;  4ITS A;  4ZVF A;  1S4F A;  4P75 A;  4RNF A;  2CUY A;  1JLG B;  2H5I B;  4PAB A;  4ZP8 A;  7FDR A;  4J9O A;  3LP0 A;  2WW4 A;  3OPK A;  2F9D A;  3CCT A;  1IQZ A;  1DLO B;  3N9U C;  2ABY A;  2XYG B;  1KN6 A;  2YKO A;  3UQS A;  2Q66 A;  1S57 A;  4WYL A;  1KHV A;  4FYX B;  4N76 A;  1UJ5 A;  3T9N A;  2HRU A;  5M2R A;  1DBD A;  3UD3 P;  1GMW D;  2FVC A;  3MCS A;  1F3V A;  4FNI A;  3PDN A;  4EBE A;  3V6H A;  1N34 J;  3NL0 A;  2LYV A;  3AQP A;  3CDE A;  4FP9 A;  4DDF A;  3GR1 A;  3FKB A;  2E5I A;  5KAK A;  2R9L A;  4IG3 A;  2LXU A;  4JI4 F;  2K3I A;  3D6M B;  2FHK A;  4NX9 A;  4DV3 F;  2HQD A;  3RTV A;  2RU9 A;  1K73 T;  7FD1 A;  1NH7 A;  3K59 A;  3O8W A;  2W4C A;  2KB2 A;  3BGF A;  1IKV A;  2UUA F; 
#chains in the Genus database with same CATH homology
 4DI6 A;  1F6T A;  3MPD A;  3EVM A;  1WKK A;  3Q83 A;  3DDI A;  4S0M A;  1PKU A;  5IOL A;  1HLW A;  2HVE A;  5C7P A;  2HVD A;  3VGS A;  1LWX A;  4CP5 A;  3BH7 B;  1UCN A;  1B99 A;  3FBB A;  3EJM A;  1NDC A;  3ENA A;  2NCK L;  1WKJ A;  3EIC A;  1NUE A;  1NDL A;  3BBF A;  4W98 A;  5CAA A;  1F3F A;  3NGS A;  1NPK A;  3FBF A;  3JS9 A;  3EMT A;  3R9L A;  1BE4 A;  1WKL A;  1MN7 A;  1W7W A;  2CWK A;  3VGT A;  1NSK L;  1ZS6 A;  4UOG A;  3NGU A;  2DXD A;  3NGT A;  3EE3 A;  2AZ1 A;  3BBB A;  5BXI A;  2DXE A;  4F4A A;  1BUX A;  2BEF A;  2BX6 A;  4KPC A;  1XQI A;  4FKY A;  1LEO A;  3EVO A;  3Q86 A;  4ANC A;  1XIQ A;  5CAB A;  3L7U A;  3BH6 B;  1VYA A;  4FKX A;  2B8Q A;  4AND A;  1NDP A;  4ENO A;  3ZTQ A;  3B54 A;  3ZTS A;  1NDK A;  3FBE A;  3ZTO A;  3VVU A;  2VU5 A;  2HUR A;  2DYA A;  1BHN A;  1NB2 A;  1NHK L;  2DY9 A;  3FC9 A;  3PRV A;  3VGV A;  3ETM A;  1HIY A;  3VVT A;  2DXF A;  3Q8Y A;  4DZ6 A;  4C6A A;  2ZUA A;  3FCW A;  1NLK L;  4O0N A;  1NSP A;  1PAE X;  4DUT A;  3GPA A;  3DKD A;  3B6B A;  3Q8U A;  3EVW A;  2AZ3 A;  1EHW A;  3G2X A;  1U8W A;  1MN9 A;  1S5Z A;  1S57 A;  3EM1 A;  3ZTR A;  4UOF A;  4HR2 A;  3FCV A;  1K44 A;  1B4S A;  3NGR A;  4UOH A;  1HHQ A;  4WBF A;  1JXV A;  3Q8V A;  3VGU A;  3FKB A;  3BBC A;  4F36 A;  3WX8 A;  4ANE A;  1S59 A;  3Q89 A;  2B8P A;  4EK2 A;  3FBC A;  3GP9 A;  1NCL A;  3ZTP A;  3ELH A;  1KDN A;  3PJ9 A;  1NSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...