1WKJA

Crystal structure of nucleoside diphosphate kinase from thermus thermophilus hb8
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
137
structure length
137
Chain Sequence
MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords nucleoside diphosphate kinase
publication title Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 43
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1wkjA00
4ENOA 3VGTA 4F36A 1W7WA 3NGUA 5IOLA 1NUEA 3EMTA 4DZ6A 1WKJA 1BUXA 3BBCA 3BH7B 3VVUA 1F6TA 2AZ3A 4FKXA 1NCLA 3R9LA 3FBBA 3FCWA 4KPCA 1PKUA 4DI6A 1LEOA 1VYAA 3ZTPA 3FKBA 3Q8UA 1NDCA 3WX8A 3BBFA 2DXDA 1JXVA 4UOFA 1MN7A 3JS9A 3Q83A 3ELHA 3GP9A 4O0NA 1WKLA 3Q8YA 3B54A 3EJMA 2BEFA 3Q86A 1NDPA 3FBEA 3EVMA 3VVTA 1XIQA 1ZS6A 1S5ZA 5C7PA 1U8WA 4WBFA 4F4AA 3FBFA 1BHNA 1XQIA 1LWXA 2DY9A 4C6AA 1UCNA 1K44A 1BE4A 1EHWA 3FC9A 3VGUA 2CWKA 2DXEA 3EVWA 3ZTQA 1NPKA 2BX6A 4FKYA 3GPAA 1B99A 3NGTA 3DKDA 3EM1A 1NSQA 1KDNA 2B8PA 4ANEA 2VU5A 4EK2A 3EVOA 3MPDA 2ZUAA 4W98A 3ETMA 5CAAA 3VGSA 2HVDA 2NCKL 3FCVA 3VGVA 1NB2A 3DDIA 2HVEA 5BXIA 3NGRA 1S57A 2AZ1A 3ZTRA 3ZTOA 4S0MA 2HURA 3Q8VA 1NDLA 4HR2A 4ANDA 2DXFA 1NSPA 3PRVA 3ZTSA 3FBCA 3L7UA 4CP5A 2DYAA 3EICA 3NGSA 4UOHA 1NDKA 3ENAA 1HLWA 1NSKL 3B6BA 3G2XA 1NHKL 1PAEX 1B4SA 1MN9A 1F3FA 4ANCA 3Q89A 3BBBA 4UOGA 4DUTA 2B8QA 1HHQA 1HIYA 3BH6B 3EE3A 1NLKL 1WKKA 3PJ9A 5CABA 1S59A
chains in the Genus database with same CATH superfamily
4P7VA 2I1RA 1BD6A 2DRBA 1U2FA 4ECQA 2GJ2A 2UXBJ 3UVJA 4XTTA 1RT1B 4J9QA 2DBBA 4XDDA 4O3NA 3RBDA 3J7YI 1YTYA 3M6VA 2P2CB 4LFAJ 2DHAA 5J1EA 3M9MB 2K1RA 1VRTB 3IBFB 4DR7J 2QA4S 4ZCKA 3CCQS 2HFVA 4OHVA 3VV2B 4K4TA 3IWNC 4DSKA 1HNVB 4F4WA 3OJSA 3PO4A 3ENVA 4RW8A 4B3OA 4C8OA 3UDVA 3FC9A 3HKZD 1U24A 2V4RA 2DKOB 3SYZA 3PEHA 2HHUA 1QAXA 1GTHA 1UFLA 2ZH3A 3HULA 2V0NA 1YI2S 1IBMF 1FD8A 3U7JA 2WVBA 2CDRB 2YX7A 2X51A 4IH7A 4QU6A 4PQAA 4MFBA 1WOOA 2VDHA 3MUMP 1XNRF 4LRBA 3I56S 4JV2A 2F4VJ 1APSA 2IM3A 3BBCA 4HKQA 4OYAA 4EZ9A 1LK7A 2CJKA 1N33F 4USVA 2A18A 4IDKA 3DDKA 5HQ8A 4OV6A 2XY7A 2DNPA 3BO2A 1E6YB 5G0RB 5KFJA 2P9CA 2MGZA 2XHWA 4P52A 4OZ1A 4GKKJ 2D9OA 1J5OB 3M8QB 2EKYA 1U48A 4FYVB 2YWEA 2HHXA 4DU8A 1LNQA 3V4MA 2GC8A 1NBEB 5CZXA 9ATCB 2EI5A 1N5VA 1OPIA 1NSQA 2B56A 2X1GA 3V4IA 2AF6A 4YMEA 4MKAA 1VLYA 2BANA 4JI5J 3EGZA 1S6QA 2CPFA 5D3GB 5KG4A 4F4XA 1R8PA 3KTQA 4AXJA 3V81B 2XQCA 3BBBA 3PX4A 1FWKA 1Q95G 4CNYA 1S6PB 3QSYB 3RRKA 1S4EA 3GCXP 1U1MA 3VCDA 4HL9A 3GV8B 2QTWA 3KLHB 5JVGQ 1T0TV 1WC4A 3D5MA 2GZOA 3UCZP 5DG7A 2ZH6A 3QO9B 2IHR1 4ZLPA 4JI6J 5IXUA 1SJ3P 4OI0A 2RDIA 1C4AA 1SL2A 4Y2MA 4RU9A 1VISA 1TFWA 5A8WB 1LOUA 2HHPA 6FD1A 1FE4A 3TWZA 5FJ4A 3I55S 1FDDA 1LWXA 2DNKA 1LWEA 1M90T 1IR2A 1X4GA 3RBZA 1DY3A 2DXEA 3Q8RB 1NPKA 1S12A 1U7LA 4M5GA 2ZUAA 3LH2S 2AGQA 3G8SA 2AMCB 1NKEA 4UQGA 3OFGA 3FMWA 2CKWA 3PRVA 2HW3A 1JLGB 3CF5Q 2MQQA 5ETKA 3KUEA 5J1NA 3QZ7A 4ED0A 2RJZA 1CG2A 5FLXY 2AD9A 1CBKA 2EK1A 3KLVA 2UUAF 4DXLA 3FEXB 2MQNA 1OQ3A 1CJKA 2FJEB 3QGHA 5LXYA 4YR3A 3GTYX 2FJVA 3MM6A 1ICEB 2WVFA 2C42A 1AXQA 1QAYA 4CDIA 2G13A 3HJFA 5F8HA 2JEGA 3P5TL 3NRBA 1V5IB 1UZDA 1GAOA 2GMJA 2DB1A 2GAHC 3TQ1A 2H9ZA 1DRZA 2JHEA 3VALA 4RW9A 2BYCA 2ZEJA 4OLPA 1FXDA 2D41A 2IIHA 2GO9A 1U2RA 2PMWA 3ZZTA 5CZVA 1D8YA 4PWDB 1R8HA 2XNQA 1XBWA 4YUDA 2WVEA 2D3OR 1B0TA 2I2YA 2CVEA 4Q0BB 4ELVA 4CYUA 4U95A 1ZA1B 4P2MA 5CA5A 1EKSA 3MTKA 2QN6B 2VBYA 3T9NA 4DX5A 2WAQD 3GYXB 1PJ5A 2PI5A 4QQBA 1NHVA 4GMKA 4UF4A 3W66A 1Q5VA 3QYYA 4ERDA 3VAKA 2AJ4A 5CYMB 2CQIA 5G4DA 3MMAB 3FBBA 2FHOB 2WSEC 1V6HA 2MQOA 1NDCA 1SJ1A 2HNDA 3ELHA 5D15A 3KK1A 2ZKTA 2J7KA 1TKZA 2BJ7A 2MQMA 2W9BA 4FXVA 2LLZA 3A8IA 2BACA 1KQKA 3Q8PB 1Q79A 1UJ6A 3CIMA 4JOUA 4LF2A 1O51A 1RA7A 2BZ2A 2R7VA 3W9HA 2ZVSA 1BWEA 1TL7B 2ZITA 4NCGA 2IBOA 2PA8D 2FVRA 3DC2A 4W98A 3PIPQ 2NR0A 2HGLA 3US5A 4I0WA 1VQ9S 4M8LA 5GVQA 2JC1A 2NLWA 4JYAJ 5ETOA 3DLLQ 1OY9A 1WG4A 4I2QB 2V50A 2Y0SD 1LXJA 4FVMA 3G2XA 3PHEA 4K7QA 1PAEX 4RWWA 1RWXB 2Z56B 1WF0A 4R5PA 3DXSX 4L6V3 2CQ0A 4O3RA 1T02A 4DFJA 1EX8A 2E9RX 1QDUB 3AOAA 1U1NA 3ZFVA 4E2FB 3T6JA 3PFOA 2UXBF 1FA0A 3OUYB 4N7TA 3AD7C 4Q5VA 1D3WA 4M5NA 1U45A 1P9QC 1HQEA 2F8EX 4ELUA 4F2RA 4BS2A 4QZVB 3V6HA 1JJHA 4DR7F 5HANA 4NZ0A 3OXFA 3DLBA 3G87A 3BV8A 2DNNA 2YWFA 4XPCA 1Y5NB 1BQNA 4DN0A 3K2YA 2XSJA 2ABYA 3W63A 2RQKA 2DNZA 3I5BA 3THPA 4E8UA 2X3DA 4LRCA 4LR8A 1YG0A 2O5DA 4KO0B 1X0PA 2D9PA 3VGVA 1IM6A 3AJDA 2UVWA 4M5DB 1NAQA 1JLBB 3Q8VA 2C2RA 3HFVA 3LF0A 4YN3B 4FXWA 3HLUA 2G2YA 4GVBB 1KHVA 3OR1B 5K9FA 2C2NA 4ZPBA 1PCAA 1IBKF 1FD2A 4ES1A 4NYOA 1VK8A 1W25A 3N79A 1YJWS 3CCJS 3D6HB 3RAXA 3VAIA 3H42A 1FFSB 2FHJD 3PJXA 4RJVA 2F4VF 3J81Y 3KUHA 1N34J 3CD6S 4TN2A 4ZP9A 1F60B 3MTJA 3BO4A 5EDWA 3NS6A 3VWSA 1RWUA 4NZ7A 1RK8A 2LXFA 4EI2A 4UY85 2DK2A 1EAYC 1IVZA 2IA0A 4FF3A 1N36J 2DY9A 1JKHB 3J80U 4Q44A 2OUGA 2U2FA 1D9DA 2Q79A 3CJ3A 1HNIB 1WHVA 2CZ9A 4GO5X 2NZ4A 3A3OB 4WK1A 4J9UE 4JI5F 5KFEA 3JTPA 1R3NA 4UW2A 1NK4A 3IRXA 1FNXH 5EN1A 3NWGA 3D1OA 2MZTA 3QIPA 2C2ZB 2GVDB 3IC1A 2BR0A 4LSLA 2JX2A 1HHQA 2YH1A 4NLWA 2KT3A 2B6AB 2U1AA 3I0SB 5I3UA 2XO6A 2VUGA 2DNMA 5BYSA 2BJ1A 3M30A 2B9EA 3K8VA 3CW2C 3JSRA 4NXMJ 4QU7A 2R7OA 3TEGA 1N32J 2OJ3A 1UA1A 3N6LA 4ZDNA 1GNKA 1ZH5A 4DSIA 1JXEA 5EHHA 4HI2A 2HBRB 1S1UA 3PTWA 3MCNA 3SV3A 1A6LA 2NUUG 3DHXA 5F8IA 4ECYA 3MPDA 2UUWA 2GAGC 1RHJB 1RAHB 1S1VA 4DR2J 1BC6A 1XTZA 3U27A 2QLXA 3TP2A 2YX4A 1TL3B 1F3FA 2FY8A 2D3ZA 2UUTA 4F0HA 3MM8B 4KC5A 1HIYA 3BH6B 5BYRA 1VHIA 3MM9A 2RRAA 3J7ZT 4CRJA 3BGOP 3HZGA 5M2PA 2BJEA 1SJRA 5CYQA 3UPFA 3MR7A 2V68A 1UW9A 1GK8A 3C2PA 4NLOA 3RB6A 2OD6A 2HK3A 2AJ1A 2H48B 3SXLA 3WQPA 3M2VA 3Q86A 1XN9A 2ZFHA 1JJ2R 1X4FA 2D69A 5J2PA 4O3OA 1S1TB 4C11B 3RR8A 2J6UA 2ADBA 3OSPA 1OO0B 3FCHA 1PG5B 2JH3A 4WU2A 2PMHA 3VQTA 3DLEB 1BMQB 4IFYB 3B78A 5HQLA 2P9GA 5HATA 3FK4A 2BE2A 1NB2A 1C1BB 2RQMA 1KHWA 3D6FB 1S4FA 4CTAB 2ZBPA 3VTIA 4C8KA 5D4OA 5B7WA 5HAOA 4Q43A 1DTQB 2XY6A 5C42B 3I87A 3KXDA 4NPOA 4LJMA 2RE1A 2WOMB 3M8QA 1KLNA 3OL9A 3AY0A 4WP9A 4MK8A 4MIWA 2Z2MA 3H5XA 3HHEA 4B3RJ 4EWTA 3DGVA 3UD3P 2KJVA 3PEJA 3IS9A 4RUHA 2RU9A 4R8UB 5KFHA 1TP7A 5KG7A 3PRBA 3QQCD 4B3SJ 3NCRA 3WC2A 4ZN3A 4OZ3A 4C9DA 1PBAA 4WIQA 3RZAA 4OYBA 3KLHA 3KLIB 2MXYA 4DPUA 2CWKA 2J9EA 3VAGA 2EFNA 3KG1A 1SH0A 4KH1B 2EFVA 3QAUA 2DRDA 4PAAA 2VU5A 1JB0C 1GMWD 2Z57B 3ETMA 2NCKL 3JQKA 1FDBA 5B0GA 3MUTP 2VICA 1U25A 1CJVA 3P5BP 2MKHA 5LMUF 5KFLA 2EC2A 1B0VA 1ZBTA 2VV5A 3MM7B 1LK5A 2ROGA 4DBQA 1HBUB 1IKVB 5IWAF 4AL6A 3MM5A 3NGKA 1YDLA 1H98A 5J2QB 2D3O1 2MDAA 3D66A 2L41A 4WCEQ 3DGPB 3CMQA 4KGKA 5HL7Q 4GKJJ 4AUKA 1G6BA 3HPOA 4ZVOB 4RW4A 1FKPB 2RB7A 2PN6A 2IRXA 1I94J 3V5RA 2AYGA 3SQOP 1GT8A 2M3DA 3O2IA 2HNZA 4ECWA 5DM6Q 3T3FA 3A13A 3CCSS 4L73A 1X4HA 2M8HA 3JYTA 4DSFA 1B99A 4MKBA 4CLPA 3JTNA 3R7NB 2V69A 3H5UA 4YFUA 2V6AA 3VR1A 1HFEL 3HDSA 2V8VA 3Q8SB 1X31C 5MAOA 3FSYA 2RS8A 1DTTB 3EICA 1AB8A 4CNZA 4NLQA 5DQHA 1RSCA 3LWMA 3KLGB 2O67A 1XR7A 4NX9A 4GC6A 2OLWA 4EYIB 2KZMA 3R1LA 3PYGA 1ZTWA 3O5TB 4FN5A 5J2MA 3CC2S 5KFVA 2NXEA 3KLFA 1TKXB 4DPXA 2E5LJ 2CJBA 4ZOSA 5KFTA 2UVUA 3BYPA 5D4LA 3P4UB 5EWEA 1N34F 3KMQA 2ALZA 2F3JA 3PFEA 4R0JA 2AYBA 1FRKA 2DXDA 4CO0A 3NNHA 2DIUA 3FNNA 2MB0B 1M5PC 4YS2A 3MPWA 4DPYA 3CO9A 4OHYA 3H90A 4A8QA 2CIMA 4IG0B 2OFGX 3KLEB 1U1LA 1N36F 5J1PA 1S1XA 1FKOB 1RGVA 2OPSA 2L3MA 2XO7A 5CYMA 4LFBJ 1YX2A 2O1PA 5L1LA 2H51B 1N0UA 2XCPA 4GC7A 2LCWA 4WP8A 4YR2A 2ZC4A 2GJIA 2MKSA 1LW0B 2GCFA 1MW7A 2FPHX 1WC3A 3SMZA 4LUBA 1TVRA 1YRXA 2OTJS 2XS5A 3DYAA 4OZ0A 2QYGA 2WONA 4DX8H 3LO3A 2Y1LB 2QL5B 1T9XA 4NI2B 1W2BR 1B0PA 3TI0A 2C3MA 3CCZA 1VR6A 2Z8QA 4C8ZA 3G6XA 4CO1A 1T05B 1VYAA 1HPZA 2CNLB 4NXMF 1RHKB 1H7XA 2R7WA 1N32F 5LL6d 3TZWA 1I1GA 1YLXA 1BQMB 4WJBA 2CQDA 1CJUB 5KG5A 2AYMA 4F67A 3AH6A 1NKBA 5IC6B 2QLWA 4FP9A 4F02A 1YZ6A 2IAJA 2F9JA 3BGLA 2WVDA 4WIIA 1QSSA 3DFEA 5T14A 2BRKA 5CHCB 3HD1A 2ZJPQ 4DL0C 4F0MA 3JAMU 1OPZA 1ZM3A 2DNHA 3RB4A 4M5JA 4J37A 2F8MA 4ZKAA 4C0HA 2MYFA 1X4DA 4DV2J 3UD5A 1QAJA 3CIZA 4UZBA 4MYUA 1JNRB 2GIQA 2RDDA 4ED7A 2CQ1A 4WPAA 1NB7A 3ET6B 3PR4A 4NLUA 5DQIA 3I6PA 2XB2D 3FDSA 4OX9J 3CDAA 5KAKA 2HVHA 3DI6A 1J5EJ 1FO1A 1NJYA 3KG0A 4KO0A 1TL5A 3LGMA 3WX8A 4OV1A 3MUVP 1VQ4S 2FZCB 1XK8A 5C25A 3UFCX 2ZJQQ 3KFWX 2CG8A 2BW2A 1NXIA 1MMLA 2Z2YB 2MKKA 1RWVB 3CD7A 1S0MA 1I51B 4EEYA 1RT3A 2KYZA 3W1YC 1RACB 3LW5C 4J9OA 3J80Y 4QYRA 1OSCA 5IT9U 4L3NA 4UY8T 1R6VA 4ZVFA 2SXLA 1HBNA 1T9VA 1HW8A 2CDQA 1TKTA 4I69A 4KHPJ 3RU0A 4DDFA 4USJC 4S0MA 2R7RA 1NDLA 3QRPA 3HSDA 3GCWP 4DLEA 2VQFJ 5HK4A 3B6BA 3R1HA 1VQ8S 1WUUA 5ADZA 1TL1A 1NH7A 2XLJA 3DM2A 1NU4A 4F50A 1BGXT 1GXUA 3LP2B 3PJ9A 3UO0A 4DF4A 3GV7B 3VGTA 1JJ4A 2JFDA 3ZO7A 4Y2AA 1OYDA 4I56A 3PVXA 3SQGB 4ZJLA 3M6WA 1SUQB 5IM0B 4IR1A 3NL0A 3M8PB 1T11A 2GJFA 4ZCIA 1C0UB 1C1CB 4NCAA 1T9YA 2XMMA 2VG5A 2UXDJ 4NL5A 1AZSB 1XERA 4QOTA 3GWCA 2WVCA 1XR5A 1H2VZ 2RQCA 3NS7B 5I3QA 2FHMA 3I0SA 7FDRA 1FVSA 2WCXA 2O66A 2GHWA 2FJAB 4DR5J 1XNQJ 5LM7E 6FDRA 2N7CA 3LGHA 3G71S 2HBYB 2W2NP 4DV4J 2XBPA 2F8HA 1NJXA 2W25A 1YRUA 2VG6B 2OPQB 2M52A 2UV8A 4DUZJ 2VKRA 5CABA 2N7YA 1RWPB 3TZYA 4A8SA 1IXKA 2RDJA 1B7FA 2JSXA 3CJKA 1S9GA 1UZHA 2QIFA 4DI6A 4W92B 4HI1A 4A8YA 3A8KA 4GKJF 4OQJA 2HPUA 2UP1A 2FY1A 1UVLA 2PSZA 3M9OB 3E8OA 4HDHA 2JJ4D 4EO6A 2E9TA 2HRUA 4M95A 1JLQB 4YOEA 3HVWA 2DO4A 3W7BA 3H7HB 5LOQA 3NBPB 4WKYA 4QWEA 5F0WA 2V2QA 2YKNA 1QJHA 4C48A 1WTFA 4G6VB 1FK9B 3SFUA 2JRSA 4DS4A 3MR2A 4M94A 4CLYA 4O44B 3L7UA 1E6VB 5CD4H 1NDKA 2H54B 1YJTA 5AJ3F 5D0HA 2H5EA 5GAEI 3LA0A 2XGQA 2PIIA 4C11A 2JVOA 3EUNA 2QO3A 3ISNC 2YNGB 3CJRA 3WC0A 2E5LF 3BQ0A 5F8NA 4CO2A 3KUGA 2E7WA 2ZD1A 1QUVA 3H4DA 3HHLA 4Y34A 3BQ2A 4CTAA 1Q8KA 4DJBA 3J7AN 4KFBB 3TJAA 3MD3A 3KJQB 2CPXA 4USHA 1NK6A 3QT5A 2WOMA 3V6JA 4QPXA 3N6NA 4DPWA 2GGPA 1WG1A 3MURP 3BYRA 3M05A 4CLWA 3BEGB 1N48A 4LFBF 4CLFA 3GFZA 3B4MA 2KXFA 3ZTSA 4AXIA 4ED1A 1G1XA 2WSFC 3ONQA 4PPZA 1Y5IB 2HQCA 1NZ8A 1N56A 1VQYA 2HFUA 2DGWA 2L9NA 3G9CA 2V94A 3FQKA 3G8TA 2BQRA 1X8DA 4FZVA 3MECA 3T1HJ 1FNOA 3C14B 1F5BA 1RTJB 8AT1B 3QJJA 1QTNB 4LSNB 3LALA 2Y9HA 1U4BA 1UVIA 1JXVA 3ZZZA 2AW0A 5AXNA 4C7QA 3EPIA 3GP9A 2G4BA 1X5SA 8RUCA 1S48A 2KKHA 3TRGA 3BR9A 2R8KA 2R7TA 4ZPCA 3GLJA 5HMWA 3AODA 2W1BA 3JXOA 1IKYA 1S5ZA 3OHBA 2XMWA 1HBUA 1N5YB 3TAPA 1F5AA 5B08A 2CQPA 1CULB 3TAMB 5J2QA 5AXMA 4IRKA 2RHQB 1WHWA 4JB8B 4OJ3A 1SV5B 5C24A 1JLFA 3CMES 1R0CB 4ICLA 3MEEB 2XYGB 1UA0A 4I2PB 1XMBA 2WTFA 4Z2XA 2F7VA 1REVB 4DV2F 3D6MB 1KVJA 5HP1A 1KR4A 2VL1A 3M2RB 2ZH7A 2J9DE 3T5JA 1WHYA 4DL7A 2HWTA 4B9VA 2HZAA 2KHDA 4CWBA 2P6SA 4HTIA 1OSDA 1TU0B 4LBPA 2E5HA 2KL8A 1GXLA 3MZIA 2DH8A 3IXQA 2UVRA 1ITPA 4LF5F 4LRDA 1HI1A 4Y2IA 1KOHA 4CLKA 4F4AA 3T5LA 4A8MP 1NK8A 4FPIA 2MMYA 1JK9B 2HIYA 2ZBRA 1U0HB 3VQSA 3LAMA 1MSWD 2LU2A 4EBEA 2GV1A 3QJLA 4KHPF 3B82A 2QV6A 4HR2A 2R9LA 4WK3A 2WB4A 4NLSA 2VQFF 1EETB 4G1QA 1S0NA 1FE0A 1WC1A 4QIFA 1X5PA 4HHUA 3D28A 1HNWF 4ZVUB 2HAIA 2AGOA 4NLDA 1SI9A 1XC9A 2ZOFA 1FJEB 4WZQA 4L75A 1GX5A 1WWHA 5J2NA 4C8NA 2H3EB 1DFDA 2YKQA 5AE3A 1FNMA 5DETA 4DSLA 1KTQA 3CJ4A 3I0RA 1W2IA 1UTAA 1IQZA 2PMZD 4CO3A 3A3NB 3GZ7A 3PG9A 2QLBB 1LW2B 4G65A 5JXSA 3V2UC 2QRRA 2UXDF 1IM4A 3C66A 1SIWB 3G96A 1RT2B 1BY9A 4PCQA 2UUCJ 3JAMY 4DR5F 1XNQF 2DD8S 2LDYA 3G86A 3ISND 2F65A 2FVQA 5GAHU 2IVMA 2CPIA 2MKJA 4DV4F 2VBXA 2BKNA 5KFIA 3F56A 4RUAA 1VQLS 2X3GA 4J91A 4TLQA 2BE7D 4P72A 4ZVSB 1MN9A 3AB4B 3EWGA 4PZVA 2DGSA 1CJUA 2VIHA 4DUZF 3BGUA 2HYIB 3AA9A 2H65B 3I4HX 1REGX 2FB0A 1WDTA 1U26A 1A7GE 5DM7Q 1RTHB 4ITSA 1HW9A 1FJGJ 1GMUA 2PT0A 5L9XA 4ZPDA 5D4PA 4JV5J 2UXCF 1FHTA 5ETLA 5HQMA 1H3DA 2L48A 2HS3A 3UW1A 1UWBA 3U1MA 3N9UC 3R5CA 5IT9Y 2JWNA 1PILA 5AT1B 2B43A 1R8BA 4MJKA 4OI4A 2HBZB 1EHWA 2E1PA 3HI9A 4B17A 1AW0A 1ZAXA 3L4BC 3QRQA 5HJYA 4CLUA 3BKFA 4CH0S 3C6UB 2JL9A 3CDWA 2CXEA 2ASDA 1S49A 3MXHP 2K2PA 2VFVA 1V3RA 2GQ2A 2ZDPA 4J9NA 4P6QA 1RAIB 3X1LB 3SCKE 2P9EA 2C3PA 4MK9A 1T03A 3ZNJ1 2OHDA 3EXCX 4AL7A 1P8GA 4QWCA 2NXCA 1SKWA 2CUYA 2B7CB 2W2OP 5L38A 3R9LA 1RABB 5SUHA 3WIVA 2ZWPA 4QBUA 3UDCA 1B3TA 2MSTA 1VK3A 4U9RA 1CJTB 2V4JA 1MU2A 2NXJA 2WRMA 4QJVA 2Q6CA 1I3OB 1WF1A 3DRRB 1HNXJ 1KWMA 1S9EA 3H0PA 3R7BB 2VONA 2YNFB 3RG6A 1LWFB 1KONA 5THWA 2KRBA 4ETZA 4OZLA 1UCNA 1R8AA 4YB6A 4F4KA 3H2UB 4UQTA 1RADB 2WZ1A 4DN9A 2AGPA 4YEAA 3W2WA 3TX8A 3DOMA 2V8HA 4RBTA 4USWA 3M8PA 1KLMA 1RB0A 3DRSB 3GFXA 1VQOS 4DR3J 2HHVA 3BGRB 4HH1A 5B0FA 2ATLA 1Q0NA 1RTDA 4DCPB 1FRXA 3KHHA 1MNEA 1JXLA 5C2GA 1LKZA 1YRTA 5KFCA 2B9XA 3MMCB 2FVCA 1AYEA 2W4DA 4LRAA 1VGYA 2PC6A 4J5OA 2R2RA 3T1HF 3GYNA 2E7XA 2M7SA 1YZ7A 3BF4A 5L1IA 2HBQB 3BBFA 4RUBA 3TUIC 2RS2A 1S7IA 2VG6A 1Y7PA 1VOMA 2DTJA 4MKVA 5C7PA 1IJFB 3DLKA 2CZ4A 1FWLA 2HHHJ 1ZAVA 3HSGA 4WE1A 4HHJA 4LQ9A 2MLZA 2XLIA 1BE4A 1ZYQA 5KT6A 1O8BA 3LP0B 3I5AA 3Q2SC 4DL2A 3ITHA 4K2JA 4X4VA 2W9CA 3I31A 2OEKA 2E7VA 3FJ2A 2DGUA 2XM3A 4ZHRA 3PZPA 3BSAA 4YY3J 4ZJOA 1N6QB 2GNKA 1N5SA 2QZ8A 2FZKB 4KT0C 4CT8A 2XMUA 1RT4A 4HACB 4K2XA 1QLNA 3NS5A 1JLQA 4QIEA 1S59A 1H6KX 1G4CA 2NPIA 2O01C 3PNIA 3M32A 5E3RA 1U1PA 5B0CA 3MAQA 1JWWA 4NMXA 2J7UA 4U67Q 1KSPA 2BVZA 5K14B 3MDFA 4O44A 4ECTA 1Y0HA 2BEFA 1UWAA 1TR0A 4B9SA 2DGXA 2G0CA 2N4CA 4KE5A 2X1BA 1Y4ZB 2V9KA 2J6SA 5LSLA 3K5LA 4IRCA 1MROB 3D67A 2FJDB 5LSRA 3D4JA 2IY5B 3ZC4A 2F40A 2R3VA 2RIJA 5F8LA 2ZNYA 1VBZA 4C8YA 2BQ3A 4A47A 2DYAA 1RTZA 4WFNQ 4IQMA 2Y1RI 1JLEA 4JI4J 3CJ2A 4M5MA 1RBAA 3C6TB 1UKUA 1NHUA 4A8KA 5KFDA 4O4GA 3H2VE 3P96A 4NE9C 2V9WA 1VS3A 2YQ0A 5IOLA 3K5PA 2DT9A 1U6BA 3TQEA 1QM9A 4RW6A 1KN6A 1FJ7A 1TK8A 4KH0B 4CLLA 3D0GE 3GU0A 1UEKA 3CTRA 2ZE2A 3BO3A 3ISZA 4FXDA 2B0GA 4C2MA 2C3UA 4PUOB 3FBEA 7AT1B 4KRWA 5HI7A 3KKFA 1PGZA 2VG7A 3MR3A 1K73T 3JSMA 4KHRA 3OD2A 5HROB 5K8PA 3RJMB 4RO0A 4DR6J 5HLFB 1OWXA 3K5NA 4X64J 4Q45A 1F0XA 2UUCF 3DU5A 1Q81T 1Z1ZA 2ATCB 3HK2A 2ILZA 1WHXA 3R27A 1Q16B 3M2UA 4ID8A 3R6GB 5K20B 2J76E 2VFTA 1EP4B 2LQ9A 2DGOA 3ZZRA 3AHPA 2DO0A 3V6KA 3HD2A 3C15A 2C3OA 2QA4G 3AD9C 5IQ6A 4WFBQ 1NCLA 1YKWA 1RTIA 3H2LA 3T1YJ 3DOLA 4UOCA 2XULA 5HMXA 4TLRA 5AXLA 3MEEA 2ZVIA 4WTOB 1F2HA 1SH2A 4I2PA 3K58A 1Y9OA 2HMIB 4LVNP 4MTPA 1ZS6A 4Z7CA 2ZOGA 3GR1A 4ZVGA 4PQUA 1UVMA 1UEVA 3LP1A 4DHVA 1VRUA 3M2RA 2ZC3A 2B8PA 2DCLA 3CCRS 1JLAA 1KVIA 4OLOA 4DU7A 3BPSP 1VQNS 3D1QA 5KFMA 4LBHA 2YKPA 1L3VA 3BDPA 4QPTA 5A0YB 3M8WA 1RXOB 3DLGB 3BDEA 3ZZYA 1IR1A 1UFKA 2BE9B 1Y5LB 1ZAWA 5A8KA 4IR9A 2GFFA 2FJBB 1KBRA 1WEZA 4ZCMA 1PYOB 4ES3A 3OR2A 4RLEA 5HO4A 1ZM4A 2GW8A 4BWJA 2VB6A 3NY0A 4O3QA 1HBOA 4OHWA 2OSRA 1PKUA 3RB0A 4LF1A 3K5OA 1LEOA 1UFWA 2CJAA 3JTOA 3HXMA 1UEUA 2DNRA 3QAEA 1EIYB 2Y8WA 1HNXF 1T9WA 1AROP 1HMVB 1FEHA 1HI8A 1RT5A 2J7WA 1AUDA 2IBKA 1UETA 3SEOA 3GJQB 3J81j 2JEIA 4FNHA 2ZZNA 1FXLA 3CPWR 4NWBA 3B8HA 1ZTTA 3QT6A 4N47A 1WEYA 4K4VA 4ZVEA 3C16B 2C28A 3SDEB 4A46A 2N3LA 2QT7A 4ZMMA 3JB9k 4DR3F 1BWVA 2HEKA 4KSEB 4BDPA 1F9EB 3I96A 5GADU 2R42A 2FC8A 4P7TA 1IKXB 5KFGA 4P10A 1UVJA 4OI1A 2DNLA 2IDEA 1S6OA 1JJCB 4KV8B 5DDQC 3SV4A 1T9UA 2C1EB 2HG4A 3GSIA 2LU1A 3GJTB 3T41A 4J9SA 4LF9J 4OZ5A 4RZRA 3JQMA 1WELA 4IFVA 3L7PA 2BM1A 2R8GA 1XQIA 3HHDA 2KU7A 4TNOA 4ZLJA 1HYSA 2Z30B 1WSVA 3EZOA 3RBEA 5EUHA 4H4KC 4CZCA 4KGXB 2AU0A 1N5QA 4QWBA 3C46A 1VIOA 1IWAA 3EXYA 4YY3F 3POTB 4W90B 5ETMA 2B8QA 1T9TA 3NOGA 2BJ3A 1FEEA 4CCHA 3RUBL 4YHHJ 3IAM9 3BM7A 4KHMA 4TXSA 2GQCA 1F6TA 3Q8QB 5D0RA 3KHRA 1HQUB 3AA8A 1TV6A 2GA7A 3N6MA 5L8RC 4ZIVA 5DGBA 3ZZPA 4DCJB 2ZZMA 5M2RA 1DAXA 5KT4A 3SFGA 3KG4A 4AE5A 2FVSA 3DMJB 4LF4J 1JLCB 4G1PA 4FS1A 2K06A 3I4PA 1D8ZA 3QMQA 1KNZA 1X9SA 1Q7YT 4ID5A 3LWLA 1CS4B 4RBVA 4PRFA 1CVJA 1D9FA 4H4MA 3LGNA 1X7VA 3M8YA 4C4WA 3MAHA 5I42B 4KKOA 3LANA 3NOCA 4N56A 3H40A 5GMDA 3VAMA 4CQ1A 4K4ZA 1SC1B 2HVZA 3FBCA 4FBTA 2VFSA 3RGIA 4RW7B 1U1OA 3H59A 4JI4F 2JDJA 2OEJA 2PFFB 2E1MC 2WB1D 1Z4UA 4ZPAA 1RZMA 5F41A 2I0XA 1JNZB 4JI7J 2IM2A 5EGYA 2EFPA 3PYFA 3IWLA 3MFHA 1IUJA 2HAFA 3D54A 1KS2A 3Q22A 1RDRA 1AFJA 2HZCA 1BXNA 3M9NB 1YSJA 4LBIA 1Q8LA 3PRDA 4KTQA 3NCPA 4UUXA 4O0NA 3QPIA 2B9YA 5FDLB 4MYTA 3NNCA 2ZM6J 4DFPA 2QSWA 4DV0J 2PDAA 1RT7B 4LR9A 4G3IA 3FZBA 4ECVA 1H38A 3PJWA 3PW0A 1AT1B 3MI7X 3WBZA 4DUYF 5DJBA 1TMJA 3MEDB 1RHRB 2Q6BA 1CLFA 2NREA 3NGRA 4FPRA 5DGAA 2MKYA 2DR6A 1R31A 2MQLA 3K5MA 3UVJB 1M5SA 1SC3B 2J9DA 1U0SA 4B9UA 2G2ZA 4UOGA 4BCAA 3NKYA 4RR5A 2JLFA 2RILA 3CD0A 1RAAB 2HQIA 5J1EB 5CCMA 2K1RB 1R0AA 3MMBA 4QW9A 2MZ1A 3VVUA 4URGA 4NCBA 3T1YF 1IKWA 4Y6IA 4JI0J 2BQUA 4RNHA 4B3OB 4FYXB 4ED5A 2XHCA 2W7OA 1TTHB 5KFUA 3I32A 1I6JA 1ROFA 1DZ5A 4F3OA 3I9ZA 3OVBA 2FC9A 4QWAA 1LV5A 4DV1J 2UZAA 2QFJA 1NSAA 3BN4A 1NK5A 4FBUA 1PO6A 1NRKA 4DQIA 3ZTQA 2CG4A 1FRLA 4HTJA 2XZTB 4MFBB 3X3UA 4X66J 2ZBCA 1BQXA 5KFQA 1ZETA 4OJGA 1S57A 4WFZA 2CQCA 2J5AA 5KFXA 4NXNJ 1CC7A 3D68A 2Y8YA 1RBOB 1NHKL 3AXMA 4LFCF 3D3CJ 4J9MA 4IDKB 2CPZA 4F2SA 4EUVA 1SQFA 4PXBA 4IUFA 4JI8J 2YNIB 5DG8A 3D6TB 2IM0A 2MGZB 4IOBA 1RKJA 1FKAF 2C2KB 1RHUB 2W8KA 1O6XA 1O0PA 4ED4A 3OTBA 1M0SA 4OI2A 5DO2A 5U47A 1F9FA 4MK7A 1SQGA 1WKLA 1WF2A 2PEHA 3F44A 1F5CA 2DHHA 5KG1A 3V4IB 4HT7A 2BANB 3W5YA 1S6QB 4WYLA 2YBVA 3M8SA 5ETPA 4C0OC 4TY9A 4B02A 2WSCC 2EFOA 3CJTA 4KIAA 2XNRA 3CC4S 4P2XA 5HBMA 3RAQA 5E3PA 4ZP8A 2F9DA 4M5LA 2FZGB 1D1UA 4I7FB 4OYMA 5A76A 2BKPA 2GVZA 2LKZA 3CCWA 4AT1B 4LFAF 1W7WA 4DS5A 5ETTA 4Z7YA 4C97A 3G6ES 5D4NA 3SZ2A 2ZOMA 3KK3B 5A8RB 1YITS 3GG0A 2AP6A 2J8AA 2RKIA 4DR1J 1S1WB 2LXIA 1V9OA 3Q83A 5KFFA 3Q8YA 2C2OB 2HK2A 3HP6A 1NK9A 1KRPA 3R2DJ 2QSFA 3CCVS 1H7WA 4X65J 3EZ5A 2BXJA 4LF9F 2KHCA 4ZJQA 1JX4A 3PW5A 1SQEA 3KDNA 4DL3A 1GH8A 3MPYA 4OFZA 2IVFB 2XCAA 1M1KT 3F41A 3VAJA 4E0DA 1EB0A 1DQ9A 4M1KA 3ZTOA 4Z37A 4O3SA 2DPJA 4I64A 3V6DA 2QA2A 2DEIA 1CJKB 2OGUA 3Q89A 3RAMA 1S9FA 5EWFA 3MM6B 2CJYB 4MIAA 3P45B 2EG1A 2LA6A 1WACA 2C2EA 4YHHF 4AD6A 1M1GA 2XMTA 2CAJA 4WXOA 4GKKF 2ZHBA 2ADCA 4ECZA 2G2OA 3DLJA 2W24A 2ZH8A 2UU9J 4L3KA 4M5KA 4FYDA 4B3MJ 4LF4F 4D3GA 3QIDA 1GEHA 4DG1A 1F3VA 3CVKA 5A0YA 3OFFA 1N0VC 2FUG9 2H4YB 4CYUB 1VJWA 3PW7A 1CQNA 4AL5A 2ERRA 1ZZNA 1SL0A 2MHNA 2CRLA 2XMVA 4BC9A 1WTBA 3TA0A 4DX6A 4BLGA 4LVOP 4DL5A 5A6PA 3MEGA 1PJ7A 5IT4A 4ANDA 4YR0A 1RYRA 2XMAA 4OX6A 4U6PA 4JI2J 3OFEA 2HHSA 2V8GA 2QMUB 3IR5B 3K57A 1OY6A 5KFBA 3W2VA 4JI6F 1HMVA 4RU2A 4TU9A 4PEOA 3AOBA 2M2BA 4J9PA 4JI7F 3UE2A 3KK1B 3R3TA 5L39A 1FTRA 1HL6A 4X84A 2W9BB 5MLCV 4U7CA 1HBMA 3JQJA 2HWIA 2C3YA 2AJQA 1UVKA 3F73A 1Q53A 2NZCA 3MM8A 2GX8A 4DL6A 2OD4A 1HA1A 4PYDA 1HKAA 2QA1A 2FD2A 2G1HA 4B08A 1LXNA 4NCGB 1RT1A 2WBRA 2W01A 2ZM6F 5T7LB 4DV0F 1S6UA 1NPRA 1VRTA 5KOXA 3CULA 2F1FA 2YQ1A 2OPPB 4QYZK 3NG8A 1S0OA 1IKXA 4NLGA 4P75A 4NLXA 4WKRA 1VC6A 2YQ3A 4R5PB 2HVDA 2YTCA 2VASA 2ZHAA 1HNVA 5E3AA 2J8SA 2VOOA 4ECRA 3CJ8A 2RU3A 4JV0A 2DNYA 2ROEA 2ZNZA 3FEYB 3QWUA 2BUNA 1UPPA 3AFGA 1VQ5S 3G82B 1HQEB 4YDXA 1S99A 3AXKA 5DRKA 4ED8A 3P6YC 1YJ9S 5DZ7A 5KFOA 3BSOA 3N0VA 1BQNB 4KPCA 4OZNA 3GIKA 2FLOA 3MOJB 1TFYA 2QLJB 4K8RA 1QE1B 4JI0F 4TQSA 1F9HA 2KFZA 4W4MA 3IG1B 3OW2R 2AIRB 2MLYA 3W62A 1P1TA 3SIPB 4KPYA 4WBFA 1YHQS 4UTGA 3L7OA 3KNGA 2ZH5A 2IC3B 4C6AA 2XWXA 4NLRA 1E6YA 2E29A 5G0RA 4DZDA 1FDNA 2A3JA 1WI8A 3GFYA 3RYLA 4ANEA 2R4FA 3UN5A 3DLHA 4Y65A 3CCMS 1VMBA 3IO1A 1J5OA 4X66F 2FYXA 4X4NA 1HWKA 4F8RA 2JLGA 4NXNF 4ZLLA 2CJXB 3CJSA 3NEKA 5D3GA 3FMBA 3NGUA 4RWXA 4JI8F 3OLAA 3V81A 3THTA 2QX0A 3CJ0A 4FVCA 4EZ6A 2IMOA 1S6PA 2J9CA 3VAHA 2DPIA 4PG8A 4BHQA 2DHXA 3QT7A 3JS9A 4MKYA 2J0QD 3QATA 3QO9A 2KYXA 3CDUA 1B64A 2A6OA 4H4OB 1RWOB 3FFIB 3VHQA 3D7SB 5A8WA 3IR6B 4JYAF 3DRPB 5EWGA 3IWXA 1TUWA 2ZDOA 3QIPB 4A48A 4I6YA 4LSLB 3IGNA 2BKOA 4NA3A 4NMLA 4OYWA 5I3UB 1FRMA 4QW8A 3ZZ0A 1B4SA 4QIGA 1J2VA 5AXKA 4OJ1A 3LOUA 2V5HG 2XZWA 1JLGA 3CDEA 4X2BA 1BUXA 4I6WA 2AWZA 2FLNA 2DR7A 2FDNA 2VHGA 1N4LA 3HKWA 4WWSA 5F8MA 4DR1F 1S1UB 4NYPA 5GAGU 2JOQA 3GQCA 1SKRA 2FJWA 2YWGA 3KMSA 2JC0A 1S1VB 3AT1B 3U1LA 4X65F 1PYSB 3DHWC 4UT4A 5K8OA 2PA3A 2C22A 2BDPA 1QSYA 1TAQA 4QIWD 2EG2A 2A2DA 4LF8J 3AJ2A 1SKUB 4DX7A 1URNA 3K17A 3MM9B 3QJPA 4RX6A 2DITA 4PWDA 2G0IA 1RCXB 5CYQB 4Q0BA 1BLUA 4FYYB 2HNYB 3T19A 3O8WA 1UL3A 3M2VB 2D1CA 4ZCLA 1IBKJ 3SSQA 1K1SA 1X5TA 5J2PB 1QAIA 3C3LA 2ASYA 2AHOB 3J7Z5 1FT8A 2ASLA 2UU9F 4TYAA 3HHLD 4P2SA 2LEPA 4YP3A 3BGFA 2VKZG 1VBYA 4I1TA 3EJMA 4B3MF 1S72S 2HS0A 3MMAA 3TVYA 3EVMA 1B70B 1SVDA 5HMYA 5KT7A 3EGNA 2KXHA 2BE2B 5L1JA 5ITHA 3UNGC 1ELOA 2YNIA 1UP1A 1EKRA 4P74A 4Y2CA 2IYIA 5KT5A 2NYIA 4UZCA 3H5YA 5K8MA 3DN9A 1NH8A 2QFIA 1TL4A 2XGPA 3ENAA 2DNGA 4Q7AA 3GONA 1U1QA 1TL7A 4IO1A 2XC9A 4JI2F 3IS9B 5F8GA 5B0BA 1OQ6A 1IWGA 3Q24A 3AAWB 4I2QA 1WOPA 3I82A 3OTEA 4I6AA 1JQGA 4LMZA 3FKBA 5L9NA 3OL7A 1RISA 4ZS6A 4ZVTB 3ILOA 1P6TA 4QWDA 3D2WA 4OYXA 1FF2A 3TZZA 5LSOA 1RJJA 3OUYA 4K5RA 4I7FA 3UWTA 4ZVQB 2HKEA 3MOZA 4DR2F 4X62J 2KFYA 4CO5A 4RPFA 1CJVB 2VBWA 3A12A 2CNOB 1FFWB 3VGUA 4CH7A 3KK3A 2L9DA 1L3UA 5A8RA 4N77A 3VGSA 5GMKa 2KTQA 3HF5A 1S1WA 2X1FA 2QYCA 3MM5B 5D77A 4IKAA 3CD5A 1DQ8A 1R0BG 3GSDA 4AFFA 1H0HB 2XS7A 2QLFB 4V19J 2D74B 4KY3A 4Q2MA 4M5DA 3IRWP 1JLBA 2MKCA 3Q0AA 4WP3A 4LSZB 3BR8A 4ZPTR 3W8GA 4GVBA 4RW4B 3OR1A 3HZEA 5LJ3Y 4C8MA 2QL7B 4IG3B 2IA6A 3J7YU 1RBLA 1RUSA 3FUYA 1YJNS 2HNZB 1MN7A 1U6ZA 1T95A 2ACYA 4EMDA 4FF4A 2Q66A 3O44A 5DLGA 4NEZA 3TAQA 4J9KA 1R89A 3GIMA 4L72B 3HHKA 3JYTB 4RBUA 4J9RA 3MAAB 3TJ8A 5C5JA 1U8WA 2XS2A 3OVSA 1EQMA 1DBDA 2KVQE 3TARA 2AQ4A 1OS5A 2V2VA 5DG9A 1WORA 4HDGA 2Z4PA 1TELA 4MAKA 5KFSA 3DDIA 1G2EA 1UVNA 1WOSA 5J2MB 5D8HB 4P73A 4X4OA 3KLFB 3MR6A 1JKHA 4TQRA 2VD3A 3DOKB 3CJQA 4B3RF 4IH6A 1HNIA 5FD1A 5DS7A 3K8WA 3BN7A 1FWPA 2JLEA 2ZH9A 2HLTA 1YQHA 2AKWB 4LT6A 4B3SF 2HQ3A 2DHGA 1G7CB 1X4CA 5HVGA 5ETNA 2FGOA 3U1NA 4Q8EA 2GVDA 2K3IA 3OFHA 2OSQA 2R2TA 4G1IA 2B6AA 2H4WB 1S1XB 2P8IA 2GIFA 2OPSB 3GILA 4CO4A 3WX4A 2CWXA 2A0FB 4DV6J 3IAS9 4LR7A 5CXTA 1XJWB 1XMOJ 2QGFB 5H1SV 3RRHA 3DNCA 4C3KA 1TVRB 3BKUA 3BSCA 3DYAB 4C8LA 1RU1A 2WONB 3O3LA 4LREA 5KFRA 4DFKA 2W2QP 3G6VA 3HT0A 2BOPA 4QYZJ 1YJVA 2DGQA 1NSKL 2VQEJ 4A8XA 5F9LA 1R8CA 3R8YA 4EBDA 2KM8B 1SKSA 4MH8A 3SSSA 3TYTA 1HPZB 5IS2A 5T7LA 4V19X 3GV5B 5LMUJ 2R2SA 4M63A 3EZUA 5K5MA 2OPPA 2MZQA 2RF2B 3QGPA 4FKXA 1TL3A 2VFUA 1I94F 3IA0A 5IWAJ 2HFOA 3FGVA 2VZ9A 8ATCB 2K7JA 2BBEA 2CFXA 4L76A 2IAJB 1Q78A 4Q8FA 2GQQA 3H25A 3FZ2A 4O4RA 2VC1A 2AX1A 4K5SA 2VA2A 3G82A 4M5HA 1TUGB 1H74A 2YWHA 2WHOA 5B0DA 4CLZA 3PKYA 3GIIA 3IM8A 3L09A 1KOOA 4ZITA 2OPRB 1RU2A 1S1TA 3TO8A 5KT3A 4LF8F 2IJRA 3R2CJ 1QE1A 4ED6A 4LRFA 3IG1A 5ETQA 3EX7B 3DI6B 3DLEA 4ZN1A 4IFYA 4WTYA 4J9LA 2EPIA 1WC5A 4F4ZA 2H1YA 2IRYA 5F3ZA 1C1BA 5C25B 3HO1A 2IC3A 4J90A 1NJIT 2BW7A 3UNYA 2YNHB 1MG7A 2NQPA 2MJNA 1RA6A 1QVGR 1DTQA 1RT3B 3UN2A 3OTCA 3LQVA 4GVLA 5C42A 5E2QA 1KKHA 1Y00A 3D3BJ 3EPGA 3KNAA 2ILYA 2RRBA 4IRDA 2XY5A 4TU8A 2HGNA 3U02A 1HBNB 1DURA 4RNNA 1TKTB 1DARA 2EWHA 3MCMA 4R8UA 4MT1A 2OFHX 4H54A 3NMAA 5JVHQ 1VQ6S 4JP8A 2C2MB 1WEXA 1OYEA 3UQSA 1TL1B 1PIEA 1VBKA 3DM2B 2HGMA 5GAHI 4NZ6A 2LQ5A 2WK4A 2I9SA 1NSPA 3OQ2A 3KLIA 2ZH2A 2P5VA 3H8YA 4K4WA 3AD8C 4QIVA 4ILMA 2PI4A 4H4OA 4PXCA 5D78A 3KOAA 4NLVA 2DR8A 3M6XA 3FFIA 2CJ9A 3DRPA 4U96A 1UMJA 3MM7A 2NXNA 5KFWA 2VG5B 4DSJA 1IKVA 1DJ0A 4ATNA 3H4BA 3PIOQ 1SH3A 5KG3A 3ETOA 1MWQA 5DLFA 1VQSA 1NDPA 3A4TA 2MZJA 3CJ5A 2ACMA 3DGPA 4K0KJ 4ALZA 3N01A 1VHFA 4Y2KA 4WFYA 1UJ5A 4PPDA 3T9ZA 5B0EA 1TKDA 1RT6B 4X62F 4ETXA 1EQ0A 3E51A 4ILLA 5D0GA 1FKPA 5KFKA 1SPBP 2OTLS 3W9JA 1HHTP 3MFIA 5ETRA 3A8EA 4F04B 3KHLA 3TEHB 4USUA 3CJKB 1H2UX 3M8RA 4OX9F 1S9GB 1HHSA 1GQEA 2V67A 2J0WA 1J5EF 1FFGB 3QT8A 3UCGA 2RVJA 5LJ5Y 3MMJA 3OVAA 1S77D 4PG4A 3CDBA 4LF6J 1NUEA 1DTTA 3FRYA 3BH7B 3KLGA 4IOAQ 1FRJA 1FCAA 1S79A 1P27B 1Z2LA 3T1AA 2OMLA 1TKXA 2HHWA 2AYEA 2V2KA 4DQPA 2WW8A 3TX0A 3B54A 4Y00A 2YKNB 2RRNA 3RTVA 1PJ6A 3VVTA 4U7UD 5SZTA 4ZVPB 1IBCB 4KAIA 2HNYA 3CE8A 3RRGA 2RSQA 4NRUA 3EVOA 4USIA 2J0SD 4IG0A 3KLEA 4KJIA 3N5FA 5JMNA 3QFHA 2ZH1A 2VJUA 4QR1A 1FKOA 1NKCA 4KBIA 4ZA1A 4ANCA 2KFNA 1UPMB 1U8SA 2OI2A 1SB6A 2ZD1B 4USKA 2R8HA 1KQGB 4LIRA 4IO9Q 2ZUGA 3OXLA 3HHLB 4K4YA 3KJFB 1LW0A 2EEYA 2KJWA 1R43A 1TK5A 1FXRA 3SI8A 1FX2A 3ILJA 2V8DA 4A4JA 4O0IA 3UR3C 2DJWA 3HMJG 1VC0A 2VC0A 3QZ8A 2I5JB 3A1YG 4NI2A 1TAUA 4DQQA 2GGPB 2J0XA 1RP5A 2YPYA 2Q43A 1YIJS 4EBCA 4PWWA 4DV6F 1T05A 4ED3A 3C8YA 4DLGA 3I5CA 1RWMB 2ALYB 4U8VA 3W61A 1VI7A 2W9AA 4H4KA 1V3ZA 1N8RT 1BQMA 4DFMA 1XMOF 2EC0A 5AE1A 4NA2A 3DRXA 2BV3A 4BWMA 1F2GA 3MECB 1U2CA 1FVQA 2DISA 3TANA 2B51A 2GHPA 1H72C 4C3LA 3NMRA 2VQEF 1OJ4A 3UI3A 1Q8BA 3CNQP 2LXUA 3H98A 1UJ4A 2W8LA 1U02A 1XMQJ 3HVRA 2W7AA 1NNDA 1IKYB 1LWCB 3KDOA 5KFPA 2AJ0A 3BREA 3ET6A 4N8OA 3W3SA 1YJUA 4ER8A 3OTDA 1VLOA 3P3DA 4DPOA 5EX3A 1Q1KA 4EU0A 5IV4A 5C24B 1JLFB 3MWBA 2IJNA 4GO7X 4ICLB 2YVSA 2HFZA 3LPYA 1K44A 3TVZA 1VQ7S 4GRSA 5KFZA 4E98A 2MY7A 2W4CA 3UN3A 2RT3A 2Z58B 2W2MP 1RWWB 2G0JA 4KB7A 4IG3A 4TYBA 3BSNA 5HP1B 2D7SA 1DQAA 2RNEA 2HS4A 2BMBA 2YWKA 3DRYA 4UOHA 2OELA 3BPDA 3MAAA 4DUTA 2LDIA 2AX0A 4OZJA 3PW4A 4YB5A 2NUHA 1X0FA 5E3QA 4RNOA 5AJ3J 4ECSA 2FHJA 1K47A 1TK0A 3HFZB 1CC8A 2ZBQA 3KWMA 2A10A 3Q2TC 4X4PA 2FTRA 2AJ2A 4ZP7A 1FESA 2ZBIA 4BBYA 1F1BB 1S97A 2HSEB 3LP2A 1HWUA 4P71A 4KQZA 1QVFR 2LA4A 1UW4A 1VIXA 3NNAA 3DOKA 5E3CA 3SQGA 1NM2A 2E9ZA 1SUQA 3LTOA 2IVYA 5IM0A 2VJVA 4USMA 4CI0B 2EBGA 2XSFA 2B7BB 1U49A 4YB1P 3CO0P 1C0UA 1C1CA 4G1QB 4ZVRB 3ENWA 3QFWA 2CQ2A 4K4SA 4U8YA 4EK2A 5KT2A 3QGGA 1NMEB 2MJUA 1AZSA 4OI3A 1VBXA 1WG5A 3PY8A 3W65A 4OI6A 1SCJB 3H20A 2KXNB 3NAHA 3KJVB 2E66A 2IM1A 1IR0A 1SIZA 5J2NB 1XWLA 2KVIA 5DZ6A 4FNIA 3HCXA 3KJNB 2WBMA 4O3PA 1ZZFA 3F0NA 5E0OA 1M1HA 3I0RB 2L9WA 4K4XA 2HFNA 4J9VA 2OAUA 4ZP6A 1NO8A 5CD4A 2IYGA 4MMOA 3OV7A 2QMWA 2OPQA 3OL6A 1ZPWX 4NASA 2EXUA 3TZXA 3RBXA 4C98A 3TOQA 3K0JA 1N52B 4B3TJ 4OX7A 3S8SA 2FJXA 3EYZA 5AE2A 1ZOTA 1SL1A 1PBUA 4K0KF 4P2FA 4FDFA 2IDLA 2EW9A 5HN0A 4QR0A 3KHGA 3IBWA 2KT2A 2BJ9A 3QLHB 1N88A 3CT9A 2RF2A 3R7SB 4OYOA 2F5GA 3L9ZA 4K50A 2M0GB 3GJSB 3NGDA 1WNEA 3ZNUA 2IJFA 4QR2A 1I5OB 3JSYA 1V3SA 2XG8A 4F3QA 2PEBA 1IQTA 3NBPA 5A6WA 2OEMA 3QRRA 3CWJA 5H9EK 3TA2A 2CVIA 1FK9A 2QL9B 1C4CA 2GIRA 1EZZB 1IBLJ 3UDEA 5JJBA 2W2PP 3CC7S 2MLXA 1RAGB 3TA1A 4LF6F 4KYZA 1E6VA 3SCLE 3FSIA 4ECXA 1VQPS 1H73A 3ZZUA 1UWBB 2B4PA 3PO5A 5IFMA 3DDNA 1G3OA 3TR5A 4LIWA 4ELTA 2OPRA 1NJWA 2H5IB 4XAKA 3KK2B 1FJCA 2HZVA 1Q86T 4OYPA 2YNGA 2YKAA 1L3KA 1DLOB 1KTVA 3TJ9A 3R5AA 1WC6A 4KGMA 2PE8A 1HD1A 3MF5A 4F7VA 3CSKA 3BZQA 4HHHA 2BX6A 4KFBA 3PCOB 4LF5J 1YJRA 2YNHA 4PG6A 1T03B 4CIOA 1CQMA 2O3DA 3R6LB 3WDOA 4N5SA 2DXFA 1AFIA 5JUMA 3NGSA 4CT9A 4PABA 3IMQJ 1KQSR 3VZIA 2KT5A 1K0VA 5GADI 5M2UA 2LQJA 2LVWA 3OSNA 3M8ZA 2V4JB 1MU2B 2HIQA 2RD5C 1WKJA 4DF8A 1ZM2A 1WC0A 1S9EB 3HT3A 2V4QA 4B9NA 2HQGA 1HNWJ 5CQGA 1VRQC 1KEKA 5L46A 4TKTA 3SSRA 4EFAC 2E5GA 2MHEA 4YB7A 3C14A 1RTJA 1Q5YA 4LSNA 2PO4A 2YKOA 4OIXA 3NWRA 5EX0A 3K7RA 3W2WB 2BOAA 3I9V9 1K9MT 3DOMB 1HD0A 1P1LA 2ZZTA 4WZMA 1KLMB 2AJFE 3AJ1A 2YY3A 3GPAA 1GMWA 1KDNA 3IFEA 1HR0J 4C0BA 2OH2A 1RTDB 2DH9A 1KP6A 3MGJA 1N5YA 2HRTA 4AQYJ 3ZZOA 2A2CA 4EO8A 1MWYA 5L1KA 1CULA 3TAMA 1ULRA 1HLWA 1L3SA 4DMZA 4F0KA 5ETSA 4LQ3A 3NCQA 1SV5A 1FJGF 4DV7J 4A8OA 2EVZA 2I8EA 6AT1B 1RT6A 4JV5F 1C2PA 2QG9B 3CCTA 1XMQF 3PX6A 1REVA 2XYHB 3R5DA 1T7PA 3DLKB 3Q8UA 2RAQA 2BM0A 2UUBJ 4R0EA 4OX8A 3S01A 2N3OA 4WE1B 2KN4A 3QWPA 2R7UA 1S76D 1Q7LB 2EBEA 1X5OA 1B7YB 2LECA 3ITHB 1YGYA 3FBFA 4B9MA 2W9CB 3NXZA 1U6FA 2UXCJ 3GIRA 5F0UA 2DR9A 2RMLA 2FVPA 4Y0FA 4D3HA 4ZHRB 4A8FA 4F26A 3PM9A 3NGTA 1JIHA 2LEBA 1IN0A 1YBUA 1RT4B 3ULHA 1YBAA 1QY7A 2WW4A 2ZKUA 3QSIA 2QEXS 3T6BA 1RKIA 4F4YA 1EARA 1Y11A 2YKMB 3LAKA 3GYGA 3M32B 1L5UA 2XLKA 2RQ4A 1U0HA 1ZA2B 5ETVA 1S7HA 1T3OA 1Q82T 3TVKA 3FQLA 4OHZA 2R8IA 1NK0A 1CEZA 3EE3A 3E3XA 2QE5A 2XI3A 4CM2A 1VCTA 1EETA 3EDQB 2FLPA 2CPYA 1KVKA 2JVRA 2YXLA 3FCWA 3JSBA 1X9WA 1VJQA 2VODA 3ZTPA 2KZZA 3HVAA 4NRTA 1SJQA 1FRHA 1H2TZ 1HWLA 4N8NA 3GR0A 4HT5A 3M4XA 1K0TA 2ROPA 4ZIWA 4A8WA 1Z2ZA 3MD1A 1V5VA 3OJUA 4DOZA 4FF1A 4ZK7M 2B3TB 3QGIA 1JLEB 4XIUA 3OPKA 2IMWP 3PX0A 4PKDB 1S10A 1LW2A 4TY8B 1UAWA 2KI2A 5CH7B 2XMKA 2MTLA 4O4GB 1HWJA 5E7OB 1RCOB 1KQFB 4CLSA 5CCLA 3VF0B 2FLLA 1RT2A 2I5JA 2LMIA 2X1AA 4XK8C 2BABA 4DL4A 3J7A1 2MPUA 4RW6B 4OHXA 3R5BA 2E1AA 4F3MA 3RB3A 3GB0A 5KG6A 2ZE2B 3VZHA 4DV3J 2KH9A 1C0TB 3W60A 4B9LA 5C2CA 1M5OC 3PYEA 3MEKA 3PYDA 2IFXA 2CJQA 2VG7B 3JSMB 3O6QA 2HHHF 4X4RA 1RAJA 2LQ8A 2RH3A 4B3TF 1RTHA 2LFVA 1K8AT 1XIQA 3OT9A 2EFQA 3E01B 3FEZA 2P6TA 4WFAQ 2VPXB 3M2UB 5IQQA 3PACA 1QSLA 1SC4B 2ZH4A 3DKDA 5IZHA 3PXGa 4NEYA 1LWCA 4C3MA 2HVEA 2B5JB 4X4TA 3QBCA 4ZPWR 2NSCA 2G9OA 3C15B 1WD6A 1NPPA 3S6EA 2Y0BB 3A3PB 1RE1B 1RTIB 5IT0A 1XEZA 2N82B 3DOLB 3C6UA 2V2ZA 2POKA 3ILLA 3MHYA 1IBLF 1HARA 1URRA 1NK7A 4TU7A 1A9NB 1RAFB 2NYHA 4FYWB 3CCLS 4DQRA 1TQLA 3CB4A 5B0AA 2RUSA 4WYWA 1TZ0A 2ASJA 1SBRA 3MR5A 4UOFA 4PQUB 3AOCA 1FDAA 3LP1B 1M5HA 1VRUB 2VBZA 3W8PA 2ZWOA 4CH1A 1NZAA 3DXBA 2HHTA 1JLAB 2CNKB 1HNZJ 4FF2A 4PXEA 5RUBA 2LP4A 1O5JA 1GTEA 3L3CA 1ZM9A 4IQXA 1CJTA 2MZRA 2CPDA 3KYLA 3TW0A 4EGLA 3DRRA 3OL8A 2XI2A 2YNFA 5CYJA 1LWFA 4KR0B 7FD1A 2E1RA 5A8KB 1EJ7L 3K59A 1TUVA 2Q3PA 3OXGA 3GMGA 3OR2B 3L95X 1HBOB 1U1RA 3HJVA 1HI0P 5H9FK 2NPFA 5LXRA 1R6YA 1NEEA 5GAEU 2XTJP 3EGVA 3PKMA 3DRSA 2KG0A 2LQBA 3BGRA 1RAEB 5KFNA 3M6UA 4ILRA 2CPEA 2W7PA 1N5TA 2JEFA 2GO8A 1RT5B 2M8DB 3MMCA 5IC4B 2M70A 4DEZA 2R7XA 3KJVA 4DR6F 1AUSL 1R27B 2FIUA 4X64F 1RWNB 1RQ0A 2IPOB 1YWXA 2R8JA 1R7IA 2AV5A 2N4DA 3M7VA 4YQWA 3HVTB 5A2QU 3M1VB 1KFDA 1KC8T 4USTA 1X4AA 1ACMB 4UUWA 4DR4J 2VF3A 2Z0GA 4HLBA 1HR0F 4JI1J 2PGCA 2DRAA 2B4VA 4AQYF 3PR5B 3NP5A 4WU3A 2K8GA 2EKNA 3K89A 3LP0A 5E33A 3MPUB 4ZPVR 1GMVA 3C19A 1GXTA 2I38A 3S7RA 3HM9A 1WKKA 3NLCA 4EYHB 4RW8B 4JI3J 3TNVA 4DV7F 4HH0A 2MKIA 3EMTA 3THVA 3PDNA 3QLHA 3UD4P 1N6QA 3HSJA 4PYAA 5H9EJ 4YDDB 3N5BA 1FI4A 4IFVB 4HACA 2JNJA 1SXLA 2MEWA 2FGCA 4OYIA 3T5KA 2UUBF 3D9BA 2KM8C 1HYSB 4PWUA 4X4QA 1D0EA 5BJRA 1XR6A 2JEJA 2XYPB 2E5JA 5LMNJ 4BC7A 1MMNA 2CQBA 2OIHA 2B4UA 5K14A 3SBMA 4V1Ak 1RAOA 3T5HA 3GE9A 2NS1B 3QNWB 5DQGA 3EDRB 5BYQA 3OLBA 2RHSB 2DH7A 4P9SA 4FS2A 1WDDA 5HMZA 4NA1A 3DCAA 3ZTRA 4RKUC 1CSJA 1MROA 3KK2A 5F3TA 1VDHA 1FTCA 2DEJA 2Z2ZA 3AQOA 2KG1A 1DLOA 2CADA 3ENQA 2F4FA 3HFKA 5KFYA 1TV6B 1M5KC 4OMFG 3WHIA 2X7IA 2IRUA 3FVYA 2DR5A 1X4BA 2CPHA 2DHSA 4OYZA 5E41A 2OP5A 2AEMA 2MQ8A 4NLYA 4DZ6A 3D1HA 3CUNA 5HVFA 3W64A 4K59A 4LF7J 1P9YA 2ZHOA 4ID5B 3C6TA 5K8NA 2EK6A 4L74A 2QMXA 1U09A 1LFPA 2G1DA 2VFRA 3CGIA 4H4MB 1QTMA 4RUCA 3D0IE 2M9KA 4KKOB 4DV5J 2E5IA 1X60A 3N28A 3O1LA 4OJHA 2DNOA 3UR0A 4PUOA 2M5YA 4ZVHA 5BR8J 2F63A 3OTOJ 2HQFA 4QCLA 2VH7A 1Y3KA 1K1QA 5HROA 3ZXWA 4HVZA 1J27A 4NLPA 3HX9A 2YX1A 5HLFA 2APOA 2CQGA 3NAIA 1CPZA 2K3KA 2HWHA 3N4WA 2CQ4A 3WIUA 1HWIA 2Y1JA 1LWEB 2UV8G 3ICLA 3RW7A 4ENOA 4I67A 2GS8A 3MCSA 1PSDA 1AA1B 1YVFA 2AZ3A 4DV3F 4JBCA 1EP4A 1FX4A 1YK9A 3P49B 5DDRC 3UCUP 2V63A 3A8JA 3TUPA 3FSXA 2HHQA 3E2EA 2A6MA 1RLCL 2FHKA 3R5JB 5D0EA 3VAFA 2VDIA 1BHNA 1YJ7A 5HJXA 5KG0A 4TVAB 4HYKA 5F8JA 2BRLA 4N76A 1RI7A 4K4UA 2HMIA 1RLDA 1PC4A 1U1KA 5B09A 3R97A 2AEFA 3GJRB 5BXIA 4PG7A 1IBMJ 2HURA 3GFHA 2PFDA 2DIVA 2LEAA 1R0AB 3MMBB 1ZPVA 2CPJA 2DCUB 4RW9B 1RHMB 3BQ1A 2B4OA 2DGVA 4URSA 5DDOC 1IKWB 1XNRJ 5FLXU 5IV3A 5I4MA 2XEXA 2VPWB 3RW6A 4B9TA 1N33J 5E5NA 3TUJC 3IP0A 3DLGA 4NYZA 1Y3JA 4RNMA 3WZ0A 3MPVA 3IR7B 4X4UA 1OMSA 2KRRA 3PV8A 3CCES 1X9MA 1KFSA 2I6WA 3W5ZA 3BB5A 4ES2A 2Y1IA 1DHMA 1WJ9A 2YKMA 4XO0A 1KD1T 3ILIA 4N41A 4ECUA 4PG5A 1MWZA 4KGZB 4IYQA 2NXUA 1HNZF 3CCUS 4I4BA 4CM0A 1U47A 5F9NA 3LPEA 3IBCB 1FRIA 3MCOA 2A1BA 4I68A 3CEDA 4DQSA 2LYVA 2KDOA 3P8BB 1GFWB 2AZ1A 2HNDB 1SJFA 3GIJA 2UVVA 5KTQA 1TKZB 2CNNB 2DGTA 2HQDA 5LT5A 4DPTA 1VQKS 3C16A 3SDEA 4CLTA 4URQU 4XPEA 2FQQB 3Q23A 1OY8A 3SCJE 4TY8A 1Y10A 1T94A 1M5VC 5GAGI 9RUBA 1LQ9A 1T3NA 1TMMA 1SJ4P 2GMHA 4ZLNA 4WXWA 2V8PA 1OIAA 3HHLC 2HLUA 1T8EA 4NOHA 4M5IA 5I3PA 4KV8A 1SC6A 2E1CA 5HBMB 2JFKA 2D3UA 1N54B 3SCIE 2GMLA 4NLTA 4HEA9 1QUPA 2CZVC 1C0TA 2BJ8A 3EM1A 5T41A 4DR4F 1RYSA 2GVZB 2CQHA 5CAAA 4DWIA 1D09B 4JI1F 2KB2A 3OBIA 2VA3A 2DY1A 4CP5A 4DUYJ 1YBTA 2L08A 2B9WA 2BJDA 3G6YA 4MIBA 2CQ3A 2RKIB 2BA9A 3H5SA 2OO4A 2XSJB 5FIIA 4X4SA 3ADAC 2UUAJ 1D9AA 1PC5A 3E01A 4Q2LA 1IJEB 2HFSA 3W9IA 1WI6A 3AB2B 4F36A 4JI3F 2J6TA 3G8QA 2Q1LA 4WFXA 2R7SA 3POTA 2YWWA 2XZDB 4IOCQ 4WF9Q 2RUGA 2Y3YA 2B5JA 4DV1F 2K7KA 2CYYA 4Y28C 3CXCR 4PR6A 2CA9A 2XWYA 2VPYB 2MQPA 2JZ5A 5DDPC 1HQUA 2E44A 3BKTA 2MY8A 4RL1A 3UDLA 2Z2LA 5LMNF 4F25A 1A0OB 2PD1A 2DNQA 3TUZC 4DCOB 2VPZB 4PXDA 2R7QA 3RR7A 3HHNB 3V6DB 4IH5A 3DMJA 3EGWB 1JLCA 4FKYA 1PAUB 1RHQB 3FRZA 5KG2A 3W5XA 2C2DA 1CS4A 2EFGA 2OKQA 3R5GA 1MLAA 4AYBD 4R25A 5I42A 1GX6A 2HRYA 3S1TA 2AT1B 3AQPA 3OHAA 2V34A 2NSBA 5HSPA 3CMAS 2H5JB 2M4MA 3IGVA 2YPZA 3IN5A 2XMJA 2R2UA 4RW7A 4DSEA 1VQMS 4LFCJ 4O23A 1S0VA 2AEJA 3BS9A 4XDCA 2ZJRQ 4ED2A 4DG1B 4LF7F 5H9FJ 3BJYA 3D0HE 1JMTA 3J81U 2HVIA 1PYTA 5KOWA 5GMEA 2KO1A 3GG1A 1RWKB 1QD1A 3IM9A 3IRXB 3DU6A 4DV5F 1LFWA 2QC3A 5A2QY 2GHVC 2YH0A 4Y3CA 2M88A 2QJ3A 1VFJA 3MEGB 3EVWA 2MZSA 3M30B 2MSSA 1X4EA 1W26A 3B4DA 5FDLA 1Q4RA 4KGVB 3W2VB 5BR8F 3FCVA 5KFAA 3OTOF 1RT7A 3G4SS 5HVHA 1WSRA 5D6GA 2VOPA 4OL8A 1Q8IA 1NJZA 2DVIA 4RNFA 1HBMB 3HSZA 4J7CA 4U7UK 1L3TA 4JUZA 2OMOA 1MMDA 4JV1A 3MEDA 2COLA 1HQ2A 1VC5A 1NLKL 3PHTA 4OZ2A 3HVTA 3PW2A 2W4PA 1FERA 3LUYA 3M1VA
chains in the Genus database with same CATH topology
4ENOA 3VGTA 4F36A 1W7WA 3NGUA 5IOLA 1NUEA 3EMTA 4DZ6A 1WKJA 1BUXA 3BBCA 3BH7B 3VVUA 1F6TA 2AZ3A 4FKXA 1NCLA 3R9LA 3FBBA 3FCWA 4KPCA 1PKUA 4DI6A 1LEOA 1VYAA 3ZTPA 3FKBA 3Q8UA 1NDCA 3WX8A 3BBFA 2DXDA 1JXVA 4UOFA 1MN7A 3JS9A 3Q83A 3ELHA 3GP9A 4O0NA 1WKLA 3Q8YA 3B54A 3EJMA 2BEFA 3Q86A 1NDPA 3FBEA 3EVMA 3VVTA 1XIQA 1ZS6A 1S5ZA 5C7PA 1U8WA 4WBFA 4F4AA 3FBFA 1BHNA 1XQIA 1LWXA 2DY9A 4C6AA 1UCNA 1K44A 1BE4A 1EHWA 3FC9A 3VGUA 2CWKA 2DXEA 3EVWA 3ZTQA 1NPKA 2BX6A 4FKYA 3GPAA 1B99A 3NGTA 3DKDA 3EM1A 1NSQA 1KDNA 2B8PA 4ANEA 2VU5A 4EK2A 3EVOA 3MPDA 2ZUAA 4W98A 3ETMA 5CAAA 3VGSA 2HVDA 2NCKL 3FCVA 3VGVA 1NB2A 3DDIA 2HVEA 5BXIA 3NGRA 1S57A 2AZ1A 3ZTRA 3ZTOA 4S0MA 2HURA 3Q8VA 1NDLA 4HR2A 4ANDA 2DXFA 1NSPA 3PRVA 3ZTSA 3FBCA 3L7UA 4CP5A 2DYAA 3EICA 3NGSA 4UOHA 1NDKA 3ENAA 1HLWA 1NSKL 3B6BA 3G2XA 1NHKL 1PAEX 1B4SA 1MN9A 1F3FA 4ANCA 3Q89A 3BBBA 4UOGA 4DUTA 2B8QA 1HHQA 1HIYA 3BH6B 3EE3A 1NLKL 1WKKA 3PJ9A 5CABA 1S59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENO A;  3VGT A;  4F36 A;  1W7W A;  3NGU A;  5IOL A;  1NUE A;  3EMT A;  4DZ6 A;  1WKJ A;  1BUX A;  3BBC A;  3BH7 B;  3VVU A;  1F6T A;  2AZ3 A;  4FKX A;  1NCL A;  3R9L A;  3FBB A;  3FCW A;  4KPC A;  1PKU A;  4DI6 A;  1LEO A;  1VYA A;  3ZTP A;  3FKB A;  3Q8U A;  1NDC A;  3WX8 A;  3BBF A;  2DXD A;  1JXV A;  4UOF A;  1MN7 A;  3JS9 A;  3Q83 A;  3ELH A;  3GP9 A;  4O0N A;  1WKL A;  3Q8Y A;  3B54 A;  3EJM A;  2BEF A;  3Q86 A;  1NDP A;  3FBE A;  3EVM A;  3VVT A;  1XIQ A;  1ZS6 A;  1S5Z A;  5C7P A;  1U8W A;  4WBF A;  4F4A A;  3FBF A;  1BHN A;  1XQI A;  1LWX A;  2DY9 A;  4C6A A;  1UCN A;  1K44 A;  1BE4 A;  1EHW A;  3FC9 A;  3VGU A;  2CWK A;  2DXE A;  3EVW A;  3ZTQ A;  1NPK A;  2BX6 A;  4FKY A;  3GPA A;  1B99 A;  3NGT A;  3DKD A;  3EM1 A;  1NSQ A;  1KDN A;  2B8P A;  4ANE A;  2VU5 A;  4EK2 A;  3EVO A;  3MPD A;  2ZUA A;  4W98 A;  3ETM A;  5CAA A;  3VGS A;  2HVD A;  2NCK L;  3FCV A;  3VGV A;  1NB2 A;  3DDI A;  2HVE A;  5BXI A;  3NGR A;  1S57 A;  2AZ1 A;  3ZTR A;  3ZTO A;  4S0M A;  2HUR A;  3Q8V A;  1NDL A;  4HR2 A;  4AND A;  2DXF A;  1NSP A;  3PRV A;  3ZTS A;  3FBC A;  3L7U A;  4CP5 A;  2DYA A;  3EIC A;  3NGS A;  4UOH A;  1NDK A;  3ENA A;  1HLW A;  1NSK L;  3B6B A;  3G2X A;  1NHK L;  1PAE X;  1B4S A;  1MN9 A;  1F3F A;  4ANC A;  3Q89 A;  3BBB A;  4UOG A;  4DUT A;  2B8Q A;  1HHQ A;  1HIY A;  3BH6 B;  3EE3 A;  1NLK L;  1WKK A;  3PJ9 A;  5CAB A;  1S59 A; 
#chains in the Genus database with same CATH topology
 4P7V A;  2I1R A;  1BD6 A;  2DRB A;  1U2F A;  4ECQ A;  2GJ2 A;  2UXB J;  3UVJ A;  4XTT A;  1RT1 B;  4J9Q A;  2DBB A;  4XDD A;  4O3N A;  3RBD A;  3J7Y I;  1YTY A;  3M6V A;  2P2C B;  4LFA J;  2DHA A;  5J1E A;  3M9M B;  2K1R A;  1VRT B;  3IBF B;  4DR7 J;  2QA4 S;  4ZCK A;  3CCQ S;  2HFV A;  4OHV A;  3VV2 B;  4K4T A;  3IWN C;  4DSK A;  1HNV B;  4F4W A;  3OJS A;  3PO4 A;  3ENV A;  4RW8 A;  4B3O A;  4C8O A;  3UDV A;  3FC9 A;  3HKZ D;  1U24 A;  2V4R A;  2DKO B;  3SYZ A;  3PEH A;  2HHU A;  1QAX A;  1GTH A;  1UFL A;  2ZH3 A;  3HUL A;  2V0N A;  1YI2 S;  1IBM F;  1FD8 A;  3U7J A;  2WVB A;  2CDR B;  2YX7 A;  2X51 A;  4IH7 A;  4QU6 A;  4PQA A;  4MFB A;  1WOO A;  2VDH A;  3MUM P;  1XNR F;  4LRB A;  3I56 S;  4JV2 A;  2F4V J;  1APS A;  2IM3 A;  3BBC A;  4HKQ A;  4OYA A;  4EZ9 A;  1LK7 A;  2CJK A;  1N33 F;  4USV A;  2A18 A;  4IDK A;  3DDK A;  5HQ8 A;  4OV6 A;  2XY7 A;  2DNP A;  3BO2 A;  1E6Y B;  5G0R B;  5KFJ A;  2P9C A;  2MGZ A;  2XHW A;  4P52 A;  4OZ1 A;  4GKK J;  2D9O A;  1J5O B;  3M8Q B;  2EKY A;  1U48 A;  4FYV B;  2YWE A;  2HHX A;  4DU8 A;  1LNQ A;  3V4M A;  2GC8 A;  1NBE B;  5CZX A;  9ATC B;  2EI5 A;  1N5V A;  1OPI A;  1NSQ A;  2B56 A;  2X1G A;  3V4I A;  2AF6 A;  4YME A;  4MKA A;  1VLY A;  2BAN A;  4JI5 J;  3EGZ A;  1S6Q A;  2CPF A;  5D3G B;  5KG4 A;  4F4X A;  1R8P A;  3KTQ A;  4AXJ A;  3V81 B;  2XQC A;  3BBB A;  3PX4 A;  1FWK A;  1Q95 G;  4CNY A;  1S6P B;  3QSY B;  3RRK A;  1S4E A;  3GCX P;  1U1M A;  3VCD A;  4HL9 A;  3GV8 B;  2QTW A;  3KLH B;  5JVG Q;  1T0T V;  1WC4 A;  3D5M A;  2GZO A;  3UCZ P;  5DG7 A;  2ZH6 A;  3QO9 B;  2IHR 1;  4ZLP A;  4JI6 J;  5IXU A;  1SJ3 P;  4OI0 A;  2RDI A;  1C4A A;  1SL2 A;  4Y2M A;  4RU9 A;  1VIS A;  1TFW A;  5A8W B;  1LOU A;  2HHP A;  6FD1 A;  1FE4 A;  3TWZ A;  5FJ4 A;  3I55 S;  1FDD A;  1LWX A;  2DNK A;  1LWE A;  1M90 T;  1IR2 A;  1X4G A;  3RBZ A;  1DY3 A;  2DXE A;  3Q8R B;  1NPK A;  1S12 A;  1U7L A;  4M5G A;  2ZUA A;  3LH2 S;  2AGQ A;  3G8S A;  2AMC B;  1NKE A;  4UQG A;  3OFG A;  3FMW A;  2CKW A;  3PRV A;  2HW3 A;  1JLG B;  3CF5 Q;  2MQQ A;  5ETK A;  3KUE A;  5J1N A;  3QZ7 A;  4ED0 A;  2RJZ A;  1CG2 A;  5FLX Y;  2AD9 A;  1CBK A;  2EK1 A;  3KLV A;  2UUA F;  4DXL A;  3FEX B;  2MQN A;  1OQ3 A;  1CJK A;  2FJE B;  3QGH A;  5LXY A;  4YR3 A;  3GTY X;  2FJV A;  3MM6 A;  1ICE B;  2WVF A;  2C42 A;  1AXQ A;  1QAY A;  4CDI A;  2G13 A;  3HJF A;  5F8H A;  2JEG A;  3P5T L;  3NRB A;  1V5I B;  1UZD A;  1GAO A;  2GMJ A;  2DB1 A;  2GAH C;  3TQ1 A;  2H9Z A;  1DRZ A;  2JHE A;  3VAL A;  4RW9 A;  2BYC A;  2ZEJ A;  4OLP A;  1FXD A;  2D41 A;  2IIH A;  2GO9 A;  1U2R A;  2PMW A;  3ZZT A;  5CZV A;  1D8Y A;  4PWD B;  1R8H A;  2XNQ A;  1XBW A;  4YUD A;  2WVE A;  2D3O R;  1B0T A;  2I2Y A;  2CVE A;  4Q0B B;  4ELV A;  4CYU A;  4U95 A;  1ZA1 B;  4P2M A;  5CA5 A;  1EKS A;  3MTK A;  2QN6 B;  2VBY A;  3T9N A;  4DX5 A;  2WAQ D;  3GYX B;  1PJ5 A;  2PI5 A;  4QQB A;  1NHV A;  4GMK A;  4UF4 A;  3W66 A;  1Q5V A;  3QYY A;  4ERD A;  3VAK A;  2AJ4 A;  5CYM B;  2CQI A;  5G4D A;  3MMA B;  3FBB A;  2FHO B;  2WSE C;  1V6H A;  2MQO A;  1NDC A;  1SJ1 A;  2HND A;  3ELH A;  5D15 A;  3KK1 A;  2ZKT A;  2J7K A;  1TKZ A;  2BJ7 A;  2MQM A;  2W9B A;  4FXV A;  2LLZ A;  3A8I A;  2BAC A;  1KQK A;  3Q8P B;  1Q79 A;  1UJ6 A;  3CIM A;  4JOU A;  4LF2 A;  1O51 A;  1RA7 A;  2BZ2 A;  2R7V A;  3W9H A;  2ZVS A;  1BWE A;  1TL7 B;  2ZIT A;  4NCG A;  2IBO A;  2PA8 D;  2FVR A;  3DC2 A;  4W98 A;  3PIP Q;  2NR0 A;  2HGL A;  3US5 A;  4I0W A;  1VQ9 S;  4M8L A;  5GVQ A;  2JC1 A;  2NLW A;  4JYA J;  5ETO A;  3DLL Q;  1OY9 A;  1WG4 A;  4I2Q B;  2V50 A;  2Y0S D;  1LXJ A;  4FVM A;  3G2X A;  3PHE A;  4K7Q A;  1PAE X;  4RWW A;  1RWX B;  2Z56 B;  1WF0 A;  4R5P A;  3DXS X;  4L6V 3;  2CQ0 A;  4O3R A;  1T02 A;  4DFJ A;  1EX8 A;  2E9R X;  1QDU B;  3AOA A;  1U1N A;  3ZFV A;  4E2F B;  3T6J A;  3PFO A;  2UXB F;  1FA0 A;  3OUY B;  4N7T A;  3AD7 C;  4Q5V A;  1D3W A;  4M5N A;  1U45 A;  1P9Q C;  1HQE A;  2F8E X;  4ELU A;  4F2R A;  4BS2 A;  4QZV B;  3V6H A;  1JJH A;  4DR7 F;  5HAN A;  4NZ0 A;  3OXF A;  3DLB A;  3G87 A;  3BV8 A;  2DNN A;  2YWF A;  4XPC A;  1Y5N B;  1BQN A;  4DN0 A;  3K2Y A;  2XSJ A;  2ABY A;  3W63 A;  2RQK A;  2DNZ A;  3I5B A;  3THP A;  4E8U A;  2X3D A;  4LRC A;  4LR8 A;  1YG0 A;  2O5D A;  4KO0 B;  1X0P A;  2D9P A;  3VGV A;  1IM6 A;  3AJD A;  2UVW A;  4M5D B;  1NAQ A;  1JLB B;  3Q8V A;  2C2R A;  3HFV A;  3LF0 A;  4YN3 B;  4FXW A;  3HLU A;  2G2Y A;  4GVB B;  1KHV A;  3OR1 B;  5K9F A;  2C2N A;  4ZPB A;  1PCA A;  1IBK F;  1FD2 A;  4ES1 A;  4NYO A;  1VK8 A;  1W25 A;  3N79 A;  1YJW S;  3CCJ S;  3D6H B;  3RAX A;  3VAI A;  3H42 A;  1FFS B;  2FHJ D;  3PJX A;  4RJV A;  2F4V F;  3J81 Y;  3KUH A;  1N34 J;  3CD6 S;  4TN2 A;  4ZP9 A;  1F60 B;  3MTJ A;  3BO4 A;  5EDW A;  3NS6 A;  3VWS A;  1RWU A;  4NZ7 A;  1RK8 A;  2LXF A;  4EI2 A;  4UY8 5;  2DK2 A;  1EAY C;  1IVZ A;  2IA0 A;  4FF3 A;  1N36 J;  2DY9 A;  1JKH B;  3J80 U;  4Q44 A;  2OUG A;  2U2F A;  1D9D A;  2Q79 A;  3CJ3 A;  1HNI B;  1WHV A;  2CZ9 A;  4GO5 X;  2NZ4 A;  3A3O B;  4WK1 A;  4J9U E;  4JI5 F;  5KFE A;  3JTP A;  1R3N A;  4UW2 A;  1NK4 A;  3IRX A;  1FNX H;  5EN1 A;  3NWG A;  3D1O A;  2MZT A;  3QIP A;  2C2Z B;  2GVD B;  3IC1 A;  2BR0 A;  4LSL A;  2JX2 A;  1HHQ A;  2YH1 A;  4NLW A;  2KT3 A;  2B6A B;  2U1A A;  3I0S B;  5I3U A;  2XO6 A;  2VUG A;  2DNM A;  5BYS A;  2BJ1 A;  3M30 A;  2B9E A;  3K8V A;  3CW2 C;  3JSR A;  4NXM J;  4QU7 A;  2R7O A;  3TEG A;  1N32 J;  2OJ3 A;  1UA1 A;  3N6L A;  4ZDN A;  1GNK A;  1ZH5 A;  4DSI A;  1JXE A;  5EHH A;  4HI2 A;  2HBR B;  1S1U A;  3PTW A;  3MCN A;  3SV3 A;  1A6L A;  2NUU G;  3DHX A;  5F8I A;  4ECY A;  3MPD A;  2UUW A;  2GAG C;  1RHJ B;  1RAH B;  1S1V A;  4DR2 J;  1BC6 A;  1XTZ A;  3U27 A;  2QLX A;  3TP2 A;  2YX4 A;  1TL3 B;  1F3F A;  2FY8 A;  2D3Z A;  2UUT A;  4F0H A;  3MM8 B;  4KC5 A;  1HIY A;  3BH6 B;  5BYR A;  1VHI A;  3MM9 A;  2RRA A;  3J7Z T;  4CRJ A;  3BGO P;  3HZG A;  5M2P A;  2BJE A;  1SJR A;  5CYQ A;  3UPF A;  3MR7 A;  2V68 A;  1UW9 A;  1GK8 A;  3C2P A;  4NLO A;  3RB6 A;  2OD6 A;  2HK3 A;  2AJ1 A;  2H48 B;  3SXL A;  3WQP A;  3M2V A;  3Q86 A;  1XN9 A;  2ZFH A;  1JJ2 R;  1X4F A;  2D69 A;  5J2P A;  4O3O A;  1S1T B;  4C11 B;  3RR8 A;  2J6U A;  2ADB A;  3OSP A;  1OO0 B;  3FCH A;  1PG5 B;  2JH3 A;  4WU2 A;  2PMH A;  3VQT A;  3DLE B;  1BMQ B;  4IFY B;  3B78 A;  5HQL A;  2P9G A;  5HAT A;  3FK4 A;  2BE2 A;  1NB2 A;  1C1B B;  2RQM A;  1KHW A;  3D6F B;  1S4F A;  4CTA B;  2ZBP A;  3VTI A;  4C8K A;  5D4O A;  5B7W A;  5HAO A;  4Q43 A;  1DTQ B;  2XY6 A;  5C42 B;  3I87 A;  3KXD A;  4NPO A;  4LJM A;  2RE1 A;  2WOM B;  3M8Q A;  1KLN A;  3OL9 A;  3AY0 A;  4WP9 A;  4MK8 A;  4MIW A;  2Z2M A;  3H5X A;  3HHE A;  4B3R J;  4EWT A;  3DGV A;  3UD3 P;  2KJV A;  3PEJ A;  3IS9 A;  4RUH A;  2RU9 A;  4R8U B;  5KFH A;  1TP7 A;  5KG7 A;  3PRB A;  3QQC D;  4B3S J;  3NCR A;  3WC2 A;  4ZN3 A;  4OZ3 A;  4C9D A;  1PBA A;  4WIQ A;  3RZA A;  4OYB A;  3KLH A;  3KLI B;  2MXY A;  4DPU A;  2CWK A;  2J9E A;  3VAG A;  2EFN A;  3KG1 A;  1SH0 A;  4KH1 B;  2EFV A;  3QAU A;  2DRD A;  4PAA A;  2VU5 A;  1JB0 C;  1GMW D;  2Z57 B;  3ETM A;  2NCK L;  3JQK A;  1FDB A;  5B0G A;  3MUT P;  2VIC A;  1U25 A;  1CJV A;  3P5B P;  2MKH A;  5LMU F;  5KFL A;  2EC2 A;  1B0V A;  1ZBT A;  2VV5 A;  3MM7 B;  1LK5 A;  2ROG A;  4DBQ A;  1HBU B;  1IKV B;  5IWA F;  4AL6 A;  3MM5 A;  3NGK A;  1YDL A;  1H98 A;  5J2Q B;  2D3O 1;  2MDA A;  3D66 A;  2L41 A;  4WCE Q;  3DGP B;  3CMQ A;  4KGK A;  5HL7 Q;  4GKJ J;  4AUK A;  1G6B A;  3HPO A;  4ZVO B;  4RW4 A;  1FKP B;  2RB7 A;  2PN6 A;  2IRX A;  1I94 J;  3V5R A;  2AYG A;  3SQO P;  1GT8 A;  2M3D A;  3O2I A;  2HNZ A;  4ECW A;  5DM6 Q;  3T3F A;  3A13 A;  3CCS S;  4L73 A;  1X4H A;  2M8H A;  3JYT A;  4DSF A;  1B99 A;  4MKB A;  4CLP A;  3JTN A;  3R7N B;  2V69 A;  3H5U A;  4YFU A;  2V6A A;  3VR1 A;  1HFE L;  3HDS A;  2V8V A;  3Q8S B;  1X31 C;  5MAO A;  3FSY A;  2RS8 A;  1DTT B;  3EIC A;  1AB8 A;  4CNZ A;  4NLQ A;  5DQH A;  1RSC A;  3LWM A;  3KLG B;  2O67 A;  1XR7 A;  4NX9 A;  4GC6 A;  2OLW A;  4EYI B;  2KZM A;  3R1L A;  3PYG A;  1ZTW A;  3O5T B;  4FN5 A;  5J2M A;  3CC2 S;  5KFV A;  2NXE A;  3KLF A;  1TKX B;  4DPX A;  2E5L J;  2CJB A;  4ZOS A;  5KFT A;  2UVU A;  3BYP A;  5D4L A;  3P4U B;  5EWE A;  1N34 F;  3KMQ A;  2ALZ A;  2F3J A;  3PFE A;  4R0J A;  2AYB A;  1FRK A;  2DXD A;  4CO0 A;  3NNH A;  2DIU A;  3FNN A;  2MB0 B;  1M5P C;  4YS2 A;  3MPW A;  4DPY A;  3CO9 A;  4OHY A;  3H90 A;  4A8Q A;  2CIM A;  4IG0 B;  2OFG X;  3KLE B;  1U1L A;  1N36 F;  5J1P A;  1S1X A;  1FKO B;  1RGV A;  2OPS A;  2L3M A;  2XO7 A;  5CYM A;  4LFB J;  1YX2 A;  2O1P A;  5L1L A;  2H51 B;  1N0U A;  2XCP A;  4GC7 A;  2LCW A;  4WP8 A;  4YR2 A;  2ZC4 A;  2GJI A;  2MKS A;  1LW0 B;  2GCF A;  1MW7 A;  2FPH X;  1WC3 A;  3SMZ A;  4LUB A;  1TVR A;  1YRX A;  2OTJ S;  2XS5 A;  3DYA A;  4OZ0 A;  2QYG A;  2WON A;  4DX8 H;  3LO3 A;  2Y1L B;  2QL5 B;  1T9X A;  4NI2 B;  1W2B R;  1B0P A;  3TI0 A;  2C3M A;  3CCZ A;  1VR6 A;  2Z8Q A;  4C8Z A;  3G6X A;  4CO1 A;  1T05 B;  1VYA A;  1HPZ A;  2CNL B;  4NXM F;  1RHK B;  1H7X A;  2R7W A;  1N32 F;  5LL6 d;  3TZW A;  1I1G A;  1YLX A;  1BQM B;  4WJB A;  2CQD A;  1CJU B;  5KG5 A;  2AYM A;  4F67 A;  3AH6 A;  1NKB A;  5IC6 B;  2QLW A;  4FP9 A;  4F02 A;  1YZ6 A;  2IAJ A;  2F9J A;  3BGL A;  2WVD A;  4WII A;  1QSS A;  3DFE A;  5T14 A;  2BRK A;  5CHC B;  3HD1 A;  2ZJP Q;  4DL0 C;  4F0M A;  3JAM U;  1OPZ A;  1ZM3 A;  2DNH A;  3RB4 A;  4M5J A;  4J37 A;  2F8M A;  4ZKA A;  4C0H A;  2MYF A;  1X4D A;  4DV2 J;  3UD5 A;  1QAJ A;  3CIZ A;  4UZB A;  4MYU A;  1JNR B;  2GIQ A;  2RDD A;  4ED7 A;  2CQ1 A;  4WPA A;  1NB7 A;  3ET6 B;  3PR4 A;  4NLU A;  5DQI A;  3I6P A;  2XB2 D;  3FDS A;  4OX9 J;  3CDA A;  5KAK A;  2HVH A;  3DI6 A;  1J5E J;  1FO1 A;  1NJY A;  3KG0 A;  4KO0 A;  1TL5 A;  3LGM A;  3WX8 A;  4OV1 A;  3MUV P;  1VQ4 S;  2FZC B;  1XK8 A;  5C25 A;  3UFC X;  2ZJQ Q;  3KFW X;  2CG8 A;  2BW2 A;  1NXI A;  1MML A;  2Z2Y B;  2MKK A;  1RWV B;  3CD7 A;  1S0M A;  1I51 B;  4EEY A;  1RT3 A;  2KYZ A;  3W1Y C;  1RAC B;  3LW5 C;  4J9O A;  3J80 Y;  4QYR A;  1OSC A;  5IT9 U;  4L3N A;  4UY8 T;  1R6V A;  4ZVF A;  2SXL A;  1HBN A;  1T9V A;  1HW8 A;  2CDQ A;  1TKT A;  4I69 A;  4KHP J;  3RU0 A;  4DDF A;  4USJ C;  4S0M A;  2R7R A;  1NDL A;  3QRP A;  3HSD A;  3GCW P;  4DLE A;  2VQF J;  5HK4 A;  3B6B A;  3R1H A;  1VQ8 S;  1WUU A;  5ADZ A;  1TL1 A;  1NH7 A;  2XLJ A;  3DM2 A;  1NU4 A;  4F50 A;  1BGX T;  1GXU A;  3LP2 B;  3PJ9 A;  3UO0 A;  4DF4 A;  3GV7 B;  3VGT A;  1JJ4 A;  2JFD A;  3ZO7 A;  4Y2A A;  1OYD A;  4I56 A;  3PVX A;  3SQG B;  4ZJL A;  3M6W A;  1SUQ B;  5IM0 B;  4IR1 A;  3NL0 A;  3M8P B;  1T11 A;  2GJF A;  4ZCI A;  1C0U B;  1C1C B;  4NCA A;  1T9Y A;  2XMM A;  2VG5 A;  2UXD J;  4NL5 A;  1AZS B;  1XER A;  4QOT A;  3GWC A;  2WVC A;  1XR5 A;  1H2V Z;  2RQC A;  3NS7 B;  5I3Q A;  2FHM A;  3I0S A;  7FDR A;  1FVS A;  2WCX A;  2O66 A;  2GHW A;  2FJA B;  4DR5 J;  1XNQ J;  5LM7 E;  6FDR A;  2N7C A;  3LGH A;  3G71 S;  2HBY B;  2W2N P;  4DV4 J;  2XBP A;  2F8H A;  1NJX A;  2W25 A;  1YRU A;  2VG6 B;  2OPQ B;  2M52 A;  2UV8 A;  4DUZ J;  2VKR A;  5CAB A;  2N7Y A;  1RWP B;  3TZY A;  4A8S A;  1IXK A;  2RDJ A;  1B7F A;  2JSX A;  3CJK A;  1S9G A;  1UZH A;  2QIF A;  4DI6 A;  4W92 B;  4HI1 A;  4A8Y A;  3A8K A;  4GKJ F;  4OQJ A;  2HPU A;  2UP1 A;  2FY1 A;  1UVL A;  2PSZ A;  3M9O B;  3E8O A;  4HDH A;  2JJ4 D;  4EO6 A;  2E9T A;  2HRU A;  4M95 A;  1JLQ B;  4YOE A;  3HVW A;  2DO4 A;  3W7B A;  3H7H B;  5LOQ A;  3NBP B;  4WKY A;  4QWE A;  5F0W A;  2V2Q A;  2YKN A;  1QJH A;  4C48 A;  1WTF A;  4G6V B;  1FK9 B;  3SFU A;  2JRS A;  4DS4 A;  3MR2 A;  4M94 A;  4CLY A;  4O44 B;  3L7U A;  1E6V B;  5CD4 H;  1NDK A;  2H54 B;  1YJT A;  5AJ3 F;  5D0H A;  2H5E A;  5GAE I;  3LA0 A;  2XGQ A;  2PII A;  4C11 A;  2JVO A;  3EUN A;  2QO3 A;  3ISN C;  2YNG B;  3CJR A;  3WC0 A;  2E5L F;  3BQ0 A;  5F8N A;  4CO2 A;  3KUG A;  2E7W A;  2ZD1 A;  1QUV A;  3H4D A;  3HHL A;  4Y34 A;  3BQ2 A;  4CTA A;  1Q8K A;  4DJB A;  3J7A N;  4KFB B;  3TJA A;  3MD3 A;  3KJQ B;  2CPX A;  4USH A;  1NK6 A;  3QT5 A;  2WOM A;  3V6J A;  4QPX A;  3N6N A;  4DPW A;  2GGP A;  1WG1 A;  3MUR P;  3BYR A;  3M05 A;  4CLW A;  3BEG B;  1N48 A;  4LFB F;  4CLF A;  3GFZ A;  3B4M A;  2KXF A;  3ZTS A;  4AXI A;  4ED1 A;  1G1X A;  2WSF C;  3ONQ A;  4PPZ A;  1Y5I B;  2HQC A;  1NZ8 A;  1N56 A;  1VQY A;  2HFU A;  2DGW A;  2L9N A;  3G9C A;  2V94 A;  3FQK A;  3G8T A;  2BQR A;  1X8D A;  4FZV A;  3MEC A;  3T1H J;  1FNO A;  3C14 B;  1F5B A;  1RTJ B;  8AT1 B;  3QJJ A;  1QTN B;  4LSN B;  3LAL A;  2Y9H A;  1U4B A;  1UVI A;  1JXV A;  3ZZZ A;  2AW0 A;  5AXN A;  4C7Q A;  3EPI A;  3GP9 A;  2G4B A;  1X5S A;  8RUC A;  1S48 A;  2KKH A;  3TRG A;  3BR9 A;  2R8K A;  2R7T A;  4ZPC A;  3GLJ A;  5HMW A;  3AOD A;  2W1B A;  3JXO A;  1IKY A;  1S5Z A;  3OHB A;  2XMW A;  1HBU A;  1N5Y B;  3TAP A;  1F5A A;  5B08 A;  2CQP A;  1CUL B;  3TAM B;  5J2Q A;  5AXM A;  4IRK A;  2RHQ B;  1WHW A;  4JB8 B;  4OJ3 A;  1SV5 B;  5C24 A;  1JLF A;  3CME S;  1R0C B;  4ICL A;  3MEE B;  2XYG B;  1UA0 A;  4I2P B;  1XMB A;  2WTF A;  4Z2X A;  2F7V A;  1REV B;  4DV2 F;  3D6M B;  1KVJ A;  5HP1 A;  1KR4 A;  2VL1 A;  3M2R B;  2ZH7 A;  2J9D E;  3T5J A;  1WHY A;  4DL7 A;  2HWT A;  4B9V A;  2HZA A;  2KHD A;  4CWB A;  2P6S A;  4HTI A;  1OSD A;  1TU0 B;  4LBP A;  2E5H A;  2KL8 A;  1GXL A;  3MZI A;  2DH8 A;  3IXQ A;  2UVR A;  1ITP A;  4LF5 F;  4LRD A;  1HI1 A;  4Y2I A;  1KOH A;  4CLK A;  4F4A A;  3T5L A;  4A8M P;  1NK8 A;  4FPI A;  2MMY A;  1JK9 B;  2HIY A;  2ZBR A;  1U0H B;  3VQS A;  3LAM A;  1MSW D;  2LU2 A;  4EBE A;  2GV1 A;  3QJL A;  4KHP F;  3B82 A;  2QV6 A;  4HR2 A;  2R9L A;  4WK3 A;  2WB4 A;  4NLS A;  2VQF F;  1EET B;  4G1Q A;  1S0N A;  1FE0 A;  1WC1 A;  4QIF A;  1X5P A;  4HHU A;  3D28 A;  1HNW F;  4ZVU B;  2HAI A;  2AGO A;  4NLD A;  1SI9 A;  1XC9 A;  2ZOF A;  1FJE B;  4WZQ A;  4L75 A;  1GX5 A;  1WWH A;  5J2N A;  4C8N A;  2H3E B;  1DFD A;  2YKQ A;  5AE3 A;  1FNM A;  5DET A;  4DSL A;  1KTQ A;  3CJ4 A;  3I0R A;  1W2I A;  1UTA A;  1IQZ A;  2PMZ D;  4CO3 A;  3A3N B;  3GZ7 A;  3PG9 A;  2QLB B;  1LW2 B;  4G65 A;  5JXS A;  3V2U C;  2QRR A;  2UXD F;  1IM4 A;  3C66 A;  1SIW B;  3G96 A;  1RT2 B;  1BY9 A;  4PCQ A;  2UUC J;  3JAM Y;  4DR5 F;  1XNQ F;  2DD8 S;  2LDY A;  3G86 A;  3ISN D;  2F65 A;  2FVQ A;  5GAH U;  2IVM A;  2CPI A;  2MKJ A;  4DV4 F;  2VBX A;  2BKN A;  5KFI A;  3F56 A;  4RUA A;  1VQL S;  2X3G A;  4J91 A;  4TLQ A;  2BE7 D;  4P72 A;  4ZVS B;  1MN9 A;  3AB4 B;  3EWG A;  4PZV A;  2DGS A;  1CJU A;  2VIH A;  4DUZ F;  3BGU A;  2HYI B;  3AA9 A;  2H65 B;  3I4H X;  1REG X;  2FB0 A;  1WDT A;  1U26 A;  1A7G E;  5DM7 Q;  1RTH B;  4ITS A;  1HW9 A;  1FJG J;  1GMU A;  2PT0 A;  5L9X A;  4ZPD A;  5D4P A;  4JV5 J;  2UXC F;  1FHT A;  5ETL A;  5HQM A;  1H3D A;  2L48 A;  2HS3 A;  3UW1 A;  1UWB A;  3U1M A;  3N9U C;  3R5C A;  5IT9 Y;  2JWN A;  1PIL A;  5AT1 B;  2B43 A;  1R8B A;  4MJK A;  4OI4 A;  2HBZ B;  1EHW A;  2E1P A;  3HI9 A;  4B17 A;  1AW0 A;  1ZAX A;  3L4B C;  3QRQ A;  5HJY A;  4CLU A;  3BKF A;  4CH0 S;  3C6U B;  2JL9 A;  3CDW A;  2CXE A;  2ASD A;  1S49 A;  3MXH P;  2K2P A;  2VFV A;  1V3R A;  2GQ2 A;  2ZDP A;  4J9N A;  4P6Q A;  1RAI B;  3X1L B;  3SCK E;  2P9E A;  2C3P A;  4MK9 A;  1T03 A;  3ZNJ 1;  2OHD A;  3EXC X;  4AL7 A;  1P8G A;  4QWC A;  2NXC A;  1SKW A;  2CUY A;  2B7C B;  2W2O P;  5L38 A;  3R9L A;  1RAB B;  5SUH A;  3WIV A;  2ZWP A;  4QBU A;  3UDC A;  1B3T A;  2MST A;  1VK3 A;  4U9R A;  1CJT B;  2V4J A;  1MU2 A;  2NXJ A;  2WRM A;  4QJV A;  2Q6C A;  1I3O B;  1WF1 A;  3DRR B;  1HNX J;  1KWM A;  1S9E A;  3H0P A;  3R7B B;  2VON A;  2YNF B;  3RG6 A;  1LWF B;  1KON A;  5THW A;  2KRB A;  4ETZ A;  4OZL A;  1UCN A;  1R8A A;  4YB6 A;  4F4K A;  3H2U B;  4UQT A;  1RAD B;  2WZ1 A;  4DN9 A;  2AGP A;  4YEA A;  3W2W A;  3TX8 A;  3DOM A;  2V8H A;  4RBT A;  4USW A;  3M8P A;  1KLM A;  1RB0 A;  3DRS B;  3GFX A;  1VQO S;  4DR3 J;  2HHV A;  3BGR B;  4HH1 A;  5B0F A;  2ATL A;  1Q0N A;  1RTD A;  4DCP B;  1FRX A;  3KHH A;  1MNE A;  1JXL A;  5C2G A;  1LKZ A;  1YRT A;  5KFC A;  2B9X A;  3MMC B;  2FVC A;  1AYE A;  2W4D A;  4LRA A;  1VGY A;  2PC6 A;  4J5O A;  2R2R A;  3T1H F;  3GYN A;  2E7X A;  2M7S A;  1YZ7 A;  3BF4 A;  5L1I A;  2HBQ B;  3BBF A;  4RUB A;  3TUI C;  2RS2 A;  1S7I A;  2VG6 A;  1Y7P A;  1VOM A;  2DTJ A;  4MKV A;  5C7P A;  1IJF B;  3DLK A;  2CZ4 A;  1FWL A;  2HHH J;  1ZAV A;  3HSG A;  4WE1 A;  4HHJ A;  4LQ9 A;  2MLZ A;  2XLI A;  1BE4 A;  1ZYQ A;  5KT6 A;  1O8B A;  3LP0 B;  3I5A A;  3Q2S C;  4DL2 A;  3ITH A;  4K2J A;  4X4V A;  2W9C A;  3I31 A;  2OEK A;  2E7V A;  3FJ2 A;  2DGU A;  2XM3 A;  4ZHR A;  3PZP A;  3BSA A;  4YY3 J;  4ZJO A;  1N6Q B;  2GNK A;  1N5S A;  2QZ8 A;  2FZK B;  4KT0 C;  4CT8 A;  2XMU A;  1RT4 A;  4HAC B;  4K2X A;  1QLN A;  3NS5 A;  1JLQ A;  4QIE A;  1S59 A;  1H6K X;  1G4C A;  2NPI A;  2O01 C;  3PNI A;  3M32 A;  5E3R A;  1U1P A;  5B0C A;  3MAQ A;  1JWW A;  4NMX A;  2J7U A;  4U67 Q;  1KSP A;  2BVZ A;  5K14 B;  3MDF A;  4O44 A;  4ECT A;  1Y0H A;  2BEF A;  1UWA A;  1TR0 A;  4B9S A;  2DGX A;  2G0C A;  2N4C A;  4KE5 A;  2X1B A;  1Y4Z B;  2V9K A;  2J6S A;  5LSL A;  3K5L A;  4IRC A;  1MRO B;  3D67 A;  2FJD B;  5LSR A;  3D4J A;  2IY5 B;  3ZC4 A;  2F40 A;  2R3V A;  2RIJ A;  5F8L A;  2ZNY A;  1VBZ A;  4C8Y A;  2BQ3 A;  4A47 A;  2DYA A;  1RTZ A;  4WFN Q;  4IQM A;  2Y1R I;  1JLE A;  4JI4 J;  3CJ2 A;  4M5M A;  1RBA A;  3C6T B;  1UKU A;  1NHU A;  4A8K A;  5KFD A;  4O4G A;  3H2V E;  3P96 A;  4NE9 C;  2V9W A;  1VS3 A;  2YQ0 A;  5IOL A;  3K5P A;  2DT9 A;  1U6B A;  3TQE A;  1QM9 A;  4RW6 A;  1KN6 A;  1FJ7 A;  1TK8 A;  4KH0 B;  4CLL A;  3D0G E;  3GU0 A;  1UEK A;  3CTR A;  2ZE2 A;  3BO3 A;  3ISZ A;  4FXD A;  2B0G A;  4C2M A;  2C3U A;  4PUO B;  3FBE A;  7AT1 B;  4KRW A;  5HI7 A;  3KKF A;  1PGZ A;  2VG7 A;  3MR3 A;  1K73 T;  3JSM A;  4KHR A;  3OD2 A;  5HRO B;  5K8P A;  3RJM B;  4RO0 A;  4DR6 J;  5HLF B;  1OWX A;  3K5N A;  4X64 J;  4Q45 A;  1F0X A;  2UUC F;  3DU5 A;  1Q81 T;  1Z1Z A;  2ATC B;  3HK2 A;  2ILZ A;  1WHX A;  3R27 A;  1Q16 B;  3M2U A;  4ID8 A;  3R6G B;  5K20 B;  2J76 E;  2VFT A;  1EP4 B;  2LQ9 A;  2DGO A;  3ZZR A;  3AHP A;  2DO0 A;  3V6K A;  3HD2 A;  3C15 A;  2C3O A;  2QA4 G;  3AD9 C;  5IQ6 A;  4WFB Q;  1NCL A;  1YKW A;  1RTI A;  3H2L A;  3T1Y J;  3DOL A;  4UOC A;  2XUL A;  5HMX A;  4TLR A;  5AXL A;  3MEE A;  2ZVI A;  4WTO B;  1F2H A;  1SH2 A;  4I2P A;  3K58 A;  1Y9O A;  2HMI B;  4LVN P;  4MTP A;  1ZS6 A;  4Z7C A;  2ZOG A;  3GR1 A;  4ZVG A;  4PQU A;  1UVM A;  1UEV A;  3LP1 A;  4DHV A;  1VRU A;  3M2R A;  2ZC3 A;  2B8P A;  2DCL A;  3CCR S;  1JLA A;  1KVI A;  4OLO A;  4DU7 A;  3BPS P;  1VQN S;  3D1Q A;  5KFM A;  4LBH A;  2YKP A;  1L3V A;  3BDP A;  4QPT A;  5A0Y B;  3M8W A;  1RXO B;  3DLG B;  3BDE A;  3ZZY A;  1IR1 A;  1UFK A;  2BE9 B;  1Y5L B;  1ZAW A;  5A8K A;  4IR9 A;  2GFF A;  2FJB B;  1KBR A;  1WEZ A;  4ZCM A;  1PYO B;  4ES3 A;  3OR2 A;  4RLE A;  5HO4 A;  1ZM4 A;  2GW8 A;  4BWJ A;  2VB6 A;  3NY0 A;  4O3Q A;  1HBO A;  4OHW A;  2OSR A;  1PKU A;  3RB0 A;  4LF1 A;  3K5O A;  1LEO A;  1UFW A;  2CJA A;  3JTO A;  3HXM A;  1UEU A;  2DNR A;  3QAE A;  1EIY B;  2Y8W A;  1HNX F;  1T9W A;  1ARO P;  1HMV B;  1FEH A;  1HI8 A;  1RT5 A;  2J7W A;  1AUD A;  2IBK A;  1UET A;  3SEO A;  3GJQ B;  3J81 j;  2JEI A;  4FNH A;  2ZZN A;  1FXL A;  3CPW R;  4NWB A;  3B8H A;  1ZTT A;  3QT6 A;  4N47 A;  1WEY A;  4K4V A;  4ZVE A;  3C16 B;  2C28 A;  3SDE B;  4A46 A;  2N3L A;  2QT7 A;  4ZMM A;  3JB9 k;  4DR3 F;  1BWV A;  2HEK A;  4KSE B;  4BDP A;  1F9E B;  3I96 A;  5GAD U;  2R42 A;  2FC8 A;  4P7T A;  1IKX B;  5KFG A;  4P10 A;  1UVJ A;  4OI1 A;  2DNL A;  2IDE A;  1S6O A;  1JJC B;  4KV8 B;  5DDQ C;  3SV4 A;  1T9U A;  2C1E B;  2HG4 A;  3GSI A;  2LU1 A;  3GJT B;  3T41 A;  4J9S A;  4LF9 J;  4OZ5 A;  4RZR A;  3JQM A;  1WEL A;  4IFV A;  3L7P A;  2BM1 A;  2R8G A;  1XQI A;  3HHD A;  2KU7 A;  4TNO A;  4ZLJ A;  1HYS A;  2Z30 B;  1WSV A;  3EZO A;  3RBE A;  5EUH A;  4H4K C;  4CZC A;  4KGX B;  2AU0 A;  1N5Q A;  4QWB A;  3C46 A;  1VIO A;  1IWA A;  3EXY A;  4YY3 F;  3POT B;  4W90 B;  5ETM A;  2B8Q A;  1T9T A;  3NOG A;  2BJ3 A;  1FEE A;  4CCH A;  3RUB L;  4YHH J;  3IAM 9;  3BM7 A;  4KHM A;  4TXS A;  2GQC A;  1F6T A;  3Q8Q B;  5D0R A;  3KHR A;  1HQU B;  3AA8 A;  1TV6 A;  2GA7 A;  3N6M A;  5L8R C;  4ZIV A;  5DGB A;  3ZZP A;  4DCJ B;  2ZZM A;  5M2R A;  1DAX A;  5KT4 A;  3SFG A;  3KG4 A;  4AE5 A;  2FVS A;  3DMJ B;  4LF4 J;  1JLC B;  4G1P A;  4FS1 A;  2K06 A;  3I4P A;  1D8Z A;  3QMQ A;  1KNZ A;  1X9S A;  1Q7Y T;  4ID5 A;  3LWL A;  1CS4 B;  4RBV A;  4PRF A;  1CVJ A;  1D9F A;  4H4M A;  3LGN A;  1X7V A;  3M8Y A;  4C4W A;  3MAH A;  5I42 B;  4KKO A;  3LAN A;  3NOC A;  4N56 A;  3H40 A;  5GMD A;  3VAM A;  4CQ1 A;  4K4Z A;  1SC1 B;  2HVZ A;  3FBC A;  4FBT A;  2VFS A;  3RGI A;  4RW7 B;  1U1O A;  3H59 A;  4JI4 F;  2JDJ A;  2OEJ A;  2PFF B;  2E1M C;  2WB1 D;  1Z4U A;  4ZPA A;  1RZM A;  5F41 A;  2I0X A;  1JNZ B;  4JI7 J;  2IM2 A;  5EGY A;  2EFP A;  3PYF A;  3IWL A;  3MFH A;  1IUJ A;  2HAF A;  3D54 A;  1KS2 A;  3Q22 A;  1RDR A;  1AFJ A;  2HZC A;  1BXN A;  3M9N B;  1YSJ A;  4LBI A;  1Q8L A;  3PRD A;  4KTQ A;  3NCP A;  4UUX A;  4O0N A;  3QPI A;  2B9Y A;  5FDL B;  4MYT A;  3NNC A;  2ZM6 J;  4DFP A;  2QSW A;  4DV0 J;  2PDA A;  1RT7 B;  4LR9 A;  4G3I A;  3FZB A;  4ECV A;  1H38 A;  3PJW A;  3PW0 A;  1AT1 B;  3MI7 X;  3WBZ A;  4DUY F;  5DJB A;  1TMJ A;  3MED B;  1RHR B;  2Q6B A;  1CLF A;  2NRE A;  3NGR A;  4FPR A;  5DGA A;  2MKY A;  2DR6 A;  1R31 A;  2MQL A;  3K5M A;  3UVJ B;  1M5S A;  1SC3 B;  2J9D A;  1U0S A;  4B9U A;  2G2Z A;  4UOG A;  4BCA A;  3NKY A;  4RR5 A;  2JLF A;  2RIL A;  3CD0 A;  1RAA B;  2HQI A;  5J1E B;  5CCM A;  2K1R B;  1R0A A;  3MMB A;  4QW9 A;  2MZ1 A;  3VVU A;  4URG A;  4NCB A;  3T1Y F;  1IKW A;  4Y6I A;  4JI0 J;  2BQU A;  4RNH A;  4B3O B;  4FYX B;  4ED5 A;  2XHC A;  2W7O A;  1TTH B;  5KFU A;  3I32 A;  1I6J A;  1ROF A;  1DZ5 A;  4F3O A;  3I9Z A;  3OVB A;  2FC9 A;  4QWA A;  1LV5 A;  4DV1 J;  2UZA A;  2QFJ A;  1NSA A;  3BN4 A;  1NK5 A;  4FBU A;  1PO6 A;  1NRK A;  4DQI A;  3ZTQ A;  2CG4 A;  1FRL A;  4HTJ A;  2XZT B;  4MFB B;  3X3U A;  4X66 J;  2ZBC A;  1BQX A;  5KFQ A;  1ZET A;  4OJG A;  1S57 A;  4WFZ A;  2CQC A;  2J5A A;  5KFX A;  4NXN J;  1CC7 A;  3D68 A;  2Y8Y A;  1RBO B;  1NHK L;  3AXM A;  4LFC F;  3D3C J;  4J9M A;  4IDK B;  2CPZ A;  4F2S A;  4EUV A;  1SQF A;  4PXB A;  4IUF A;  4JI8 J;  2YNI B;  5DG8 A;  3D6T B;  2IM0 A;  2MGZ B;  4IOB A;  1RKJ A;  1FKA F;  2C2K B;  1RHU B;  2W8K A;  1O6X A;  1O0P A;  4ED4 A;  3OTB A;  1M0S A;  4OI2 A;  5DO2 A;  5U47 A;  1F9F A;  4MK7 A;  1SQG A;  1WKL A;  1WF2 A;  2PEH A;  3F44 A;  1F5C A;  2DHH A;  5KG1 A;  3V4I B;  4HT7 A;  2BAN B;  3W5Y A;  1S6Q B;  4WYL A;  2YBV A;  3M8S A;  5ETP A;  4C0O C;  4TY9 A;  4B02 A;  2WSC C;  2EFO A;  3CJT A;  4KIA A;  2XNR A;  3CC4 S;  4P2X A;  5HBM A;  3RAQ A;  5E3P A;  4ZP8 A;  2F9D A;  4M5L A;  2FZG B;  1D1U A;  4I7F B;  4OYM A;  5A76 A;  2BKP A;  2GVZ A;  2LKZ A;  3CCW A;  4AT1 B;  4LFA F;  1W7W A;  4DS5 A;  5ETT A;  4Z7Y A;  4C97 A;  3G6E S;  5D4N A;  3SZ2 A;  2ZOM A;  3KK3 B;  5A8R B;  1YIT S;  3GG0 A;  2AP6 A;  2J8A A;  2RKI A;  4DR1 J;  1S1W B;  2LXI A;  1V9O A;  3Q83 A;  5KFF A;  3Q8Y A;  2C2O B;  2HK2 A;  3HP6 A;  1NK9 A;  1KRP A;  3R2D J;  2QSF A;  3CCV S;  1H7W A;  4X65 J;  3EZ5 A;  2BXJ A;  4LF9 F;  2KHC A;  4ZJQ A;  1JX4 A;  3PW5 A;  1SQE A;  3KDN A;  4DL3 A;  1GH8 A;  3MPY A;  4OFZ A;  2IVF B;  2XCA A;  1M1K T;  3F41 A;  3VAJ A;  4E0D A;  1EB0 A;  1DQ9 A;  4M1K A;  3ZTO A;  4Z37 A;  4O3S A;  2DPJ A;  4I64 A;  3V6D A;  2QA2 A;  2DEI A;  1CJK B;  2OGU A;  3Q89 A;  3RAM A;  1S9F A;  5EWF A;  3MM6 B;  2CJY B;  4MIA A;  3P45 B;  2EG1 A;  2LA6 A;  1WAC A;  2C2E A;  4YHH F;  4AD6 A;  1M1G A;  2XMT A;  2CAJ A;  4WXO A;  4GKK F;  2ZHB A;  2ADC A;  4ECZ A;  2G2O A;  3DLJ A;  2W24 A;  2ZH8 A;  2UU9 J;  4L3K A;  4M5K A;  4FYD A;  4B3M J;  4LF4 F;  4D3G A;  3QID A;  1GEH A;  4DG1 A;  1F3V A;  3CVK A;  5A0Y A;  3OFF A;  1N0V C;  2FUG 9;  2H4Y B;  4CYU B;  1VJW A;  3PW7 A;  1CQN A;  4AL5 A;  2ERR A;  1ZZN A;  1SL0 A;  2MHN A;  2CRL A;  2XMV A;  4BC9 A;  1WTB A;  3TA0 A;  4DX6 A;  4BLG A;  4LVO P;  4DL5 A;  5A6P A;  3MEG A;  1PJ7 A;  5IT4 A;  4AND A;  4YR0 A;  1RYR A;  2XMA A;  4OX6 A;  4U6P A;  4JI2 J;  3OFE A;  2HHS A;  2V8G A;  2QMU B;  3IR5 B;  3K57 A;  1OY6 A;  5KFB A;  3W2V A;  4JI6 F;  1HMV A;  4RU2 A;  4TU9 A;  4PEO A;  3AOB A;  2M2B A;  4J9P A;  4JI7 F;  3UE2 A;  3KK1 B;  3R3T A;  5L39 A;  1FTR A;  1HL6 A;  4X84 A;  2W9B B;  5MLC V;  4U7C A;  1HBM A;  3JQJ A;  2HWI A;  2C3Y A;  2AJQ A;  1UVK A;  3F73 A;  1Q53 A;  2NZC A;  3MM8 A;  2GX8 A;  4DL6 A;  2OD4 A;  1HA1 A;  4PYD A;  1HKA A;  2QA1 A;  2FD2 A;  2G1H A;  4B08 A;  1LXN A;  4NCG B;  1RT1 A;  2WBR A;  2W01 A;  2ZM6 F;  5T7L B;  4DV0 F;  1S6U A;  1NPR A;  1VRT A;  5KOX A;  3CUL A;  2F1F A;  2YQ1 A;  2OPP B;  4QYZ K;  3NG8 A;  1S0O A;  1IKX A;  4NLG A;  4P75 A;  4NLX A;  4WKR A;  1VC6 A;  2YQ3 A;  4R5P B;  2HVD A;  2YTC A;  2VAS A;  2ZHA A;  1HNV A;  5E3A A;  2J8S A;  2VOO A;  4ECR A;  3CJ8 A;  2RU3 A;  4JV0 A;  2DNY A;  2ROE A;  2ZNZ A;  3FEY B;  3QWU A;  2BUN A;  1UPP A;  3AFG A;  1VQ5 S;  3G82 B;  1HQE B;  4YDX A;  1S99 A;  3AXK A;  5DRK A;  4ED8 A;  3P6Y C;  1YJ9 S;  5DZ7 A;  5KFO A;  3BSO A;  3N0V A;  1BQN B;  4KPC A;  4OZN A;  3GIK A;  2FLO A;  3MOJ B;  1TFY A;  2QLJ B;  4K8R A;  1QE1 B;  4JI0 F;  4TQS A;  1F9H A;  2KFZ A;  4W4M A;  3IG1 B;  3OW2 R;  2AIR B;  2MLY A;  3W62 A;  1P1T A;  3SIP B;  4KPY A;  4WBF A;  1YHQ S;  4UTG A;  3L7O A;  3KNG A;  2ZH5 A;  2IC3 B;  4C6A A;  2XWX A;  4NLR A;  1E6Y A;  2E29 A;  5G0R A;  4DZD A;  1FDN A;  2A3J A;  1WI8 A;  3GFY A;  3RYL A;  4ANE A;  2R4F A;  3UN5 A;  3DLH A;  4Y65 A;  3CCM S;  1VMB A;  3IO1 A;  1J5O A;  4X66 F;  2FYX A;  4X4N A;  1HWK A;  4F8R A;  2JLG A;  4NXN F;  4ZLL A;  2CJX B;  3CJS A;  3NEK A;  5D3G A;  3FMB A;  3NGU A;  4RWX A;  4JI8 F;  3OLA A;  3V81 A;  3THT A;  2QX0 A;  3CJ0 A;  4FVC A;  4EZ6 A;  2IMO A;  1S6P A;  2J9C A;  3VAH A;  2DPI A;  4PG8 A;  4BHQ A;  2DHX A;  3QT7 A;  3JS9 A;  4MKY A;  2J0Q D;  3QAT A;  3QO9 A;  2KYX A;  3CDU A;  1B64 A;  2A6O A;  4H4O B;  1RWO B;  3FFI B;  3VHQ A;  3D7S B;  5A8W A;  3IR6 B;  4JYA F;  3DRP B;  5EWG A;  3IWX A;  1TUW A;  2ZDO A;  3QIP B;  4A48 A;  4I6Y A;  4LSL B;  3IGN A;  2BKO A;  4NA3 A;  4NML A;  4OYW A;  5I3U B;  1FRM A;  4QW8 A;  3ZZ0 A;  1B4S A;  4QIG A;  1J2V A;  5AXK A;  4OJ1 A;  3LOU A;  2V5H G;  2XZW A;  1JLG A;  3CDE A;  4X2B A;  1BUX A;  4I6W A;  2AWZ A;  2FLN A;  2DR7 A;  2FDN A;  2VHG A;  1N4L A;  3HKW A;  4WWS A;  5F8M A;  4DR1 F;  1S1U B;  4NYP A;  5GAG U;  2JOQ A;  3GQC A;  1SKR A;  2FJW A;  2YWG A;  3KMS A;  2JC0 A;  1S1V B;  3AT1 B;  3U1L A;  4X65 F;  1PYS B;  3DHW C;  4UT4 A;  5K8O A;  2PA3 A;  2C22 A;  2BDP A;  1QSY A;  1TAQ A;  4QIW D;  2EG2 A;  2A2D A;  4LF8 J;  3AJ2 A;  1SKU B;  4DX7 A;  1URN A;  3K17 A;  3MM9 B;  3QJP A;  4RX6 A;  2DIT A;  4PWD A;  2G0I A;  1RCX B;  5CYQ B;  4Q0B A;  1BLU A;  4FYY B;  2HNY B;  3T19 A;  3O8W A;  1UL3 A;  3M2V B;  2D1C A;  4ZCL A;  1IBK J;  3SSQ A;  1K1S A;  1X5T A;  5J2P B;  1QAI A;  3C3L A;  2ASY A;  2AHO B;  3J7Z 5;  1FT8 A;  2ASL A;  2UU9 F;  4TYA A;  3HHL D;  4P2S A;  2LEP A;  4YP3 A;  3BGF A;  2VKZ G;  1VBY A;  4I1T A;  3EJM A;  4B3M F;  1S72 S;  2HS0 A;  3MMA A;  3TVY A;  3EVM A;  1B70 B;  1SVD A;  5HMY A;  5KT7 A;  3EGN A;  2KXH A;  2BE2 B;  5L1J A;  5ITH A;  3UNG C;  1ELO A;  2YNI A;  1UP1 A;  1EKR A;  4P74 A;  4Y2C A;  2IYI A;  5KT5 A;  2NYI A;  4UZC A;  3H5Y A;  5K8M A;  3DN9 A;  1NH8 A;  2QFI A;  1TL4 A;  2XGP A;  3ENA A;  2DNG A;  4Q7A A;  3GON A;  1U1Q A;  1TL7 A;  4IO1 A;  2XC9 A;  4JI2 F;  3IS9 B;  5F8G A;  5B0B A;  1OQ6 A;  1IWG A;  3Q24 A;  3AAW B;  4I2Q A;  1WOP A;  3I82 A;  3OTE A;  4I6A A;  1JQG A;  4LMZ A;  3FKB A;  5L9N A;  3OL7 A;  1RIS A;  4ZS6 A;  4ZVT B;  3ILO A;  1P6T A;  4QWD A;  3D2W A;  4OYX A;  1FF2 A;  3TZZ A;  5LSO A;  1RJJ A;  3OUY A;  4K5R A;  4I7F A;  3UWT A;  4ZVQ B;  2HKE A;  3MOZ A;  4DR2 F;  4X62 J;  2KFY A;  4CO5 A;  4RPF A;  1CJV B;  2VBW A;  3A12 A;  2CNO B;  1FFW B;  3VGU A;  4CH7 A;  3KK3 A;  2L9D A;  1L3U A;  5A8R A;  4N77 A;  3VGS A;  5GMK a;  2KTQ A;  3HF5 A;  1S1W A;  2X1F A;  2QYC A;  3MM5 B;  5D77 A;  4IKA A;  3CD5 A;  1DQ8 A;  1R0B G;  3GSD A;  4AFF A;  1H0H B;  2XS7 A;  2QLF B;  4V19 J;  2D74 B;  4KY3 A;  4Q2M A;  4M5D A;  3IRW P;  1JLB A;  2MKC A;  3Q0A A;  4WP3 A;  4LSZ B;  3BR8 A;  4ZPT R;  3W8G A;  4GVB A;  4RW4 B;  3OR1 A;  3HZE A;  5LJ3 Y;  4C8M A;  2QL7 B;  4IG3 B;  2IA6 A;  3J7Y U;  1RBL A;  1RUS A;  3FUY A;  1YJN S;  2HNZ B;  1MN7 A;  1U6Z A;  1T95 A;  2ACY A;  4EMD A;  4FF4 A;  2Q66 A;  3O44 A;  5DLG A;  4NEZ A;  3TAQ A;  4J9K A;  1R89 A;  3GIM A;  4L72 B;  3HHK A;  3JYT B;  4RBU A;  4J9R A;  3MAA B;  3TJ8 A;  5C5J A;  1U8W A;  2XS2 A;  3OVS A;  1EQM A;  1DBD A;  2KVQ E;  3TAR A;  2AQ4 A;  1OS5 A;  2V2V A;  5DG9 A;  1WOR A;  4HDG A;  2Z4P A;  1TEL A;  4MAK A;  5KFS A;  3DDI A;  1G2E A;  1UVN A;  1WOS A;  5J2M B;  5D8H B;  4P73 A;  4X4O A;  3KLF B;  3MR6 A;  1JKH A;  4TQR A;  2VD3 A;  3DOK B;  3CJQ A;  4B3R F;  4IH6 A;  1HNI A;  5FD1 A;  5DS7 A;  3K8W A;  3BN7 A;  1FWP A;  2JLE A;  2ZH9 A;  2HLT A;  1YQH A;  2AKW B;  4LT6 A;  4B3S F;  2HQ3 A;  2DHG A;  1G7C B;  1X4C A;  5HVG A;  5ETN A;  2FGO A;  3U1N A;  4Q8E A;  2GVD A;  2K3I A;  3OFH A;  2OSQ A;  2R2T A;  4G1I A;  2B6A A;  2H4W B;  1S1X B;  2P8I A;  2GIF A;  2OPS B;  3GIL A;  4CO4 A;  3WX4 A;  2CWX A;  2A0F B;  4DV6 J;  3IAS 9;  4LR7 A;  5CXT A;  1XJW B;  1XMO J;  2QGF B;  5H1S V;  3RRH A;  3DNC A;  4C3K A;  1TVR B;  3BKU A;  3BSC A;  3DYA B;  4C8L A;  1RU1 A;  2WON B;  3O3L A;  4LRE A;  5KFR A;  4DFK A;  2W2Q P;  3G6V A;  3HT0 A;  2BOP A;  4QYZ J;  1YJV A;  2DGQ A;  1NSK L;  2VQE J;  4A8X A;  5F9L A;  1R8C A;  3R8Y A;  4EBD A;  2KM8 B;  1SKS A;  4MH8 A;  3SSS A;  3TYT A;  1HPZ B;  5IS2 A;  5T7L A;  4V19 X;  3GV5 B;  5LMU J;  2R2S A;  4M63 A;  3EZU A;  5K5M A;  2OPP A;  2MZQ A;  2RF2 B;  3QGP A;  4FKX A;  1TL3 A;  2VFU A;  1I94 F;  3IA0 A;  5IWA J;  2HFO A;  3FGV A;  2VZ9 A;  8ATC B;  2K7J A;  2BBE A;  2CFX A;  4L76 A;  2IAJ B;  1Q78 A;  4Q8F A;  2GQQ A;  3H25 A;  3FZ2 A;  4O4R A;  2VC1 A;  2AX1 A;  4K5S A;  2VA2 A;  3G82 A;  4M5H A;  1TUG B;  1H74 A;  2YWH A;  2WHO A;  5B0D A;  4CLZ A;  3PKY A;  3GII A;  3IM8 A;  3L09 A;  1KOO A;  4ZIT A;  2OPR B;  1RU2 A;  1S1T A;  3TO8 A;  5KT3 A;  4LF8 F;  2IJR A;  3R2C J;  1QE1 A;  4ED6 A;  4LRF A;  3IG1 A;  5ETQ A;  3EX7 B;  3DI6 B;  3DLE A;  4ZN1 A;  4IFY A;  4WTY A;  4J9L A;  2EPI A;  1WC5 A;  4F4Z A;  2H1Y A;  2IRY A;  5F3Z A;  1C1B A;  5C25 B;  3HO1 A;  2IC3 A;  4J90 A;  1NJI T;  2BW7 A;  3UNY A;  2YNH B;  1MG7 A;  2NQP A;  2MJN A;  1RA6 A;  1QVG R;  1DTQ A;  1RT3 B;  3UN2 A;  3OTC A;  3LQV A;  4GVL A;  5C42 A;  5E2Q A;  1KKH A;  1Y00 A;  3D3B J;  3EPG A;  3KNA A;  2ILY A;  2RRB A;  4IRD A;  2XY5 A;  4TU8 A;  2HGN A;  3U02 A;  1HBN B;  1DUR A;  4RNN A;  1TKT B;  1DAR A;  2EWH A;  3MCM A;  4R8U A;  4MT1 A;  2OFH X;  4H54 A;  3NMA A;  5JVH Q;  1VQ6 S;  4JP8 A;  2C2M B;  1WEX A;  1OYE A;  3UQS A;  1TL1 B;  1PIE A;  1VBK A;  3DM2 B;  2HGM A;  5GAH I;  4NZ6 A;  2LQ5 A;  2WK4 A;  2I9S A;  1NSP A;  3OQ2 A;  3KLI A;  2ZH2 A;  2P5V A;  3H8Y A;  4K4W A;  3AD8 C;  4QIV A;  4ILM A;  2PI4 A;  4H4O A;  4PXC A;  5D78 A;  3KOA A;  4NLV A;  2DR8 A;  3M6X A;  3FFI A;  2CJ9 A;  3DRP A;  4U96 A;  1UMJ A;  3MM7 A;  2NXN A;  5KFW A;  2VG5 B;  4DSJ A;  1IKV A;  1DJ0 A;  4ATN A;  3H4B A;  3PIO Q;  1SH3 A;  5KG3 A;  3ETO A;  1MWQ A;  5DLF A;  1VQS A;  1NDP A;  3A4T A;  2MZJ A;  3CJ5 A;  2ACM A;  3DGP A;  4K0K J;  4ALZ A;  3N01 A;  1VHF A;  4Y2K A;  4WFY A;  1UJ5 A;  4PPD A;  3T9Z A;  5B0E A;  1TKD A;  1RT6 B;  4X62 F;  4ETX A;  1EQ0 A;  3E51 A;  4ILL A;  5D0G A;  1FKP A;  5KFK A;  1SPB P;  2OTL S;  3W9J A;  1HHT P;  3MFI A;  5ETR A;  3A8E A;  4F04 B;  3KHL A;  3TEH B;  4USU A;  3CJK B;  1H2U X;  3M8R A;  4OX9 F;  1S9G B;  1HHS A;  1GQE A;  2V67 A;  2J0W A;  1J5E F;  1FFG B;  3QT8 A;  3UCG A;  2RVJ A;  5LJ5 Y;  3MMJ A;  3OVA A;  1S77 D;  4PG4 A;  3CDB A;  4LF6 J;  1NUE A;  1DTT A;  3FRY A;  3BH7 B;  3KLG A;  4IOA Q;  1FRJ A;  1FCA A;  1S79 A;  1P27 B;  1Z2L A;  3T1A A;  2OML A;  1TKX A;  2HHW A;  2AYE A;  2V2K A;  4DQP A;  2WW8 A;  3TX0 A;  3B54 A;  4Y00 A;  2YKN B;  2RRN A;  3RTV A;  1PJ6 A;  3VVT A;  4U7U D;  5SZT A;  4ZVP B;  1IBC B;  4KAI A;  2HNY A;  3CE8 A;  3RRG A;  2RSQ A;  4NRU A;  3EVO A;  4USI A;  2J0S D;  4IG0 A;  3KLE A;  4KJI A;  3N5F A;  5JMN A;  3QFH A;  2ZH1 A;  2VJU A;  4QR1 A;  1FKO A;  1NKC A;  4KBI A;  4ZA1 A;  4ANC A;  2KFN A;  1UPM B;  1U8S A;  2OI2 A;  1SB6 A;  2ZD1 B;  4USK A;  2R8H A;  1KQG B;  4LIR A;  4IO9 Q;  2ZUG A;  3OXL A;  3HHL B;  4K4Y A;  3KJF B;  1LW0 A;  2EEY A;  2KJW A;  1R43 A;  1TK5 A;  1FXR A;  3SI8 A;  1FX2 A;  3ILJ A;  2V8D A;  4A4J A;  4O0I A;  3UR3 C;  2DJW A;  3HMJ G;  1VC0 A;  2VC0 A;  3QZ8 A;  2I5J B;  3A1Y G;  4NI2 A;  1TAU A;  4DQQ A;  2GGP B;  2J0X A;  1RP5 A;  2YPY A;  2Q43 A;  1YIJ S;  4EBC A;  4PWW A;  4DV6 F;  1T05 A;  4ED3 A;  3C8Y A;  4DLG A;  3I5C A;  1RWM B;  2ALY B;  4U8V A;  3W61 A;  1VI7 A;  2W9A A;  4H4K A;  1V3Z A;  1N8R T;  1BQM A;  4DFM A;  1XMO F;  2EC0 A;  5AE1 A;  4NA2 A;  3DRX A;  2BV3 A;  4BWM A;  1F2G A;  3MEC B;  1U2C A;  1FVQ A;  2DIS A;  3TAN A;  2B51 A;  2GHP A;  1H72 C;  4C3L A;  3NMR A;  2VQE F;  1OJ4 A;  3UI3 A;  1Q8B A;  3CNQ P;  2LXU A;  3H98 A;  1UJ4 A;  2W8L A;  1U02 A;  1XMQ J;  3HVR A;  2W7A A;  1NND A;  1IKY B;  1LWC B;  3KDO A;  5KFP A;  2AJ0 A;  3BRE A;  3ET6 A;  4N8O A;  3W3S A;  1YJU A;  4ER8 A;  3OTD A;  1VLO A;  3P3D A;  4DPO A;  5EX3 A;  1Q1K A;  4EU0 A;  5IV4 A;  5C24 B;  1JLF B;  3MWB A;  2IJN A;  4GO7 X;  4ICL B;  2YVS A;  2HFZ A;  3LPY A;  1K44 A;  3TVZ A;  1VQ7 S;  4GRS A;  5KFZ A;  4E98 A;  2MY7 A;  2W4C A;  3UN3 A;  2RT3 A;  2Z58 B;  2W2M P;  1RWW B;  2G0J A;  4KB7 A;  4IG3 A;  4TYB A;  3BSN A;  5HP1 B;  2D7S A;  1DQA A;  2RNE A;  2HS4 A;  2BMB A;  2YWK A;  3DRY A;  4UOH A;  2OEL A;  3BPD A;  3MAA A;  4DUT A;  2LDI A;  2AX0 A;  4OZJ A;  3PW4 A;  4YB5 A;  2NUH A;  1X0F A;  5E3Q A;  4RNO A;  5AJ3 J;  4ECS A;  2FHJ A;  1K47 A;  1TK0 A;  3HFZ B;  1CC8 A;  2ZBQ A;  3KWM A;  2A10 A;  3Q2T C;  4X4P A;  2FTR A;  2AJ2 A;  4ZP7 A;  1FES A;  2ZBI A;  4BBY A;  1F1B B;  1S97 A;  2HSE B;  3LP2 A;  1HWU A;  4P71 A;  4KQZ A;  1QVF R;  2LA4 A;  1UW4 A;  1VIX A;  3NNA A;  3DOK A;  5E3C A;  3SQG A;  1NM2 A;  2E9Z A;  1SUQ A;  3LTO A;  2IVY A;  5IM0 A;  2VJV A;  4USM A;  4CI0 B;  2EBG A;  2XSF A;  2B7B B;  1U49 A;  4YB1 P;  3CO0 P;  1C0U A;  1C1C A;  4G1Q B;  4ZVR B;  3ENW A;  3QFW A;  2CQ2 A;  4K4S A;  4U8Y A;  4EK2 A;  5KT2 A;  3QGG A;  1NME B;  2MJU A;  1AZS A;  4OI3 A;  1VBX A;  1WG5 A;  3PY8 A;  3W65 A;  4OI6 A;  1SCJ B;  3H20 A;  2KXN B;  3NAH A;  3KJV B;  2E66 A;  2IM1 A;  1IR0 A;  1SIZ A;  5J2N B;  1XWL A;  2KVI A;  5DZ6 A;  4FNI A;  3HCX A;  3KJN B;  2WBM A;  4O3P A;  1ZZF A;  3F0N A;  5E0O A;  1M1H A;  3I0R B;  2L9W A;  4K4X A;  2HFN A;  4J9V A;  2OAU A;  4ZP6 A;  1NO8 A;  5CD4 A;  2IYG A;  4MMO A;  3OV7 A;  2QMW A;  2OPQ A;  3OL6 A;  1ZPW X;  4NAS A;  2EXU A;  3TZX A;  3RBX A;  4C98 A;  3TOQ A;  3K0J A;  1N52 B;  4B3T J;  4OX7 A;  3S8S A;  2FJX A;  3EYZ A;  5AE2 A;  1ZOT A;  1SL1 A;  1PBU A;  4K0K F;  4P2F A;  4FDF A;  2IDL A;  2EW9 A;  5HN0 A;  4QR0 A;  3KHG A;  3IBW A;  2KT2 A;  2BJ9 A;  3QLH B;  1N88 A;  3CT9 A;  2RF2 A;  3R7S B;  4OYO A;  2F5G A;  3L9Z A;  4K50 A;  2M0G B;  3GJS B;  3NGD A;  1WNE A;  3ZNU A;  2IJF A;  4QR2 A;  1I5O B;  3JSY A;  1V3S A;  2XG8 A;  4F3Q A;  2PEB A;  1IQT A;  3NBP A;  5A6W A;  2OEM A;  3QRR A;  3CWJ A;  5H9E K;  3TA2 A;  2CVI A;  1FK9 A;  2QL9 B;  1C4C A;  2GIR A;  1EZZ B;  1IBL J;  3UDE A;  5JJB A;  2W2P P;  3CC7 S;  2MLX A;  1RAG B;  3TA1 A;  4LF6 F;  4KYZ A;  1E6V A;  3SCL E;  3FSI A;  4ECX A;  1VQP S;  1H73 A;  3ZZU A;  1UWB B;  2B4P A;  3PO5 A;  5IFM A;  3DDN A;  1G3O A;  3TR5 A;  4LIW A;  4ELT A;  2OPR A;  1NJW A;  2H5I B;  4XAK A;  3KK2 B;  1FJC A;  2HZV A;  1Q86 T;  4OYP A;  2YNG A;  2YKA A;  1L3K A;  1DLO B;  1KTV A;  3TJ9 A;  3R5A A;  1WC6 A;  4KGM A;  2PE8 A;  1HD1 A;  3MF5 A;  4F7V A;  3CSK A;  3BZQ A;  4HHH A;  2BX6 A;  4KFB A;  3PCO B;  4LF5 J;  1YJR A;  2YNH A;  4PG6 A;  1T03 B;  4CIO A;  1CQM A;  2O3D A;  3R6L B;  3WDO A;  4N5S A;  2DXF A;  1AFI A;  5JUM A;  3NGS A;  4CT9 A;  4PAB A;  3IMQ J;  1KQS R;  3VZI A;  2KT5 A;  1K0V A;  5GAD I;  5M2U A;  2LQJ A;  2LVW A;  3OSN A;  3M8Z A;  2V4J B;  1MU2 B;  2HIQ A;  2RD5 C;  1WKJ A;  4DF8 A;  1ZM2 A;  1WC0 A;  1S9E B;  3HT3 A;  2V4Q A;  4B9N A;  2HQG A;  1HNW J;  5CQG A;  1VRQ C;  1KEK A;  5L46 A;  4TKT A;  3SSR A;  4EFA C;  2E5G A;  2MHE A;  4YB7 A;  3C14 A;  1RTJ A;  1Q5Y A;  4LSN A;  2PO4 A;  2YKO A;  4OIX A;  3NWR A;  5EX0 A;  3K7R A;  3W2W B;  2BOA A;  3I9V 9;  1K9M T;  3DOM B;  1HD0 A;  1P1L A;  2ZZT A;  4WZM A;  1KLM B;  2AJF E;  3AJ1 A;  2YY3 A;  3GPA A;  1GMW A;  1KDN A;  3IFE A;  1HR0 J;  4C0B A;  2OH2 A;  1RTD B;  2DH9 A;  1KP6 A;  3MGJ A;  1N5Y A;  2HRT A;  4AQY J;  3ZZO A;  2A2C A;  4EO8 A;  1MWY A;  5L1K A;  1CUL A;  3TAM A;  1ULR A;  1HLW A;  1L3S A;  4DMZ A;  4F0K A;  5ETS A;  4LQ3 A;  3NCQ A;  1SV5 A;  1FJG F;  4DV7 J;  4A8O A;  2EVZ A;  2I8E A;  6AT1 B;  1RT6 A;  4JV5 F;  1C2P A;  2QG9 B;  3CCT A;  1XMQ F;  3PX6 A;  1REV A;  2XYH B;  3R5D A;  1T7P A;  3DLK B;  3Q8U A;  2RAQ A;  2BM0 A;  2UUB J;  4R0E A;  4OX8 A;  3S01 A;  2N3O A;  4WE1 B;  2KN4 A;  3QWP A;  2R7U A;  1S76 D;  1Q7L B;  2EBE A;  1X5O A;  1B7Y B;  2LEC A;  3ITH B;  1YGY A;  3FBF A;  4B9M A;  2W9C B;  3NXZ A;  1U6F A;  2UXC J;  3GIR A;  5F0U A;  2DR9 A;  2RML A;  2FVP A;  4Y0F A;  4D3H A;  4ZHR B;  4A8F A;  4F26 A;  3PM9 A;  3NGT A;  1JIH A;  2LEB A;  1IN0 A;  1YBU A;  1RT4 B;  3ULH A;  1YBA A;  1QY7 A;  2WW4 A;  2ZKU A;  3QSI A;  2QEX S;  3T6B A;  1RKI A;  4F4Y A;  1EAR A;  1Y11 A;  2YKM B;  3LAK A;  3GYG A;  3M32 B;  1L5U A;  2XLK A;  2RQ4 A;  1U0H A;  1ZA2 B;  5ETV A;  1S7H A;  1T3O A;  1Q82 T;  3TVK A;  3FQL A;  4OHZ A;  2R8I A;  1NK0 A;  1CEZ A;  3EE3 A;  3E3X A;  2QE5 A;  2XI3 A;  4CM2 A;  1VCT A;  1EET A;  3EDQ B;  2FLP A;  2CPY A;  1KVK A;  2JVR A;  2YXL A;  3FCW A;  3JSB A;  1X9W A;  1VJQ A;  2VOD A;  3ZTP A;  2KZZ A;  3HVA A;  4NRT A;  1SJQ A;  1FRH A;  1H2T Z;  1HWL A;  4N8N A;  3GR0 A;  4HT5 A;  3M4X A;  1K0T A;  2ROP A;  4ZIW A;  4A8W A;  1Z2Z A;  3MD1 A;  1V5V A;  3OJU A;  4DOZ A;  4FF1 A;  4ZK7 M;  2B3T B;  3QGI A;  1JLE B;  4XIU A;  3OPK A;  2IMW P;  3PX0 A;  4PKD B;  1S10 A;  1LW2 A;  4TY8 B;  1UAW A;  2KI2 A;  5CH7 B;  2XMK A;  2MTL A;  4O4G B;  1HWJ A;  5E7O B;  1RCO B;  1KQF B;  4CLS A;  5CCL A;  3VF0 B;  2FLL A;  1RT2 A;  2I5J A;  2LMI A;  2X1A A;  4XK8 C;  2BAB A;  4DL4 A;  3J7A 1;  2MPU A;  4RW6 B;  4OHX A;  3R5B A;  2E1A A;  4F3M A;  3RB3 A;  3GB0 A;  5KG6 A;  2ZE2 B;  3VZH A;  4DV3 J;  2KH9 A;  1C0T B;  3W60 A;  4B9L A;  5C2C A;  1M5O C;  3PYE A;  3MEK A;  3PYD A;  2IFX A;  2CJQ A;  2VG7 B;  3JSM B;  3O6Q A;  2HHH F;  4X4R A;  1RAJ A;  2LQ8 A;  2RH3 A;  4B3T F;  1RTH A;  2LFV A;  1K8A T;  1XIQ A;  3OT9 A;  2EFQ A;  3E01 B;  3FEZ A;  2P6T A;  4WFA Q;  2VPX B;  3M2U B;  5IQQ A;  3PAC A;  1QSL A;  1SC4 B;  2ZH4 A;  3DKD A;  5IZH A;  3PXG a;  4NEY A;  1LWC A;  4C3M A;  2HVE A;  2B5J B;  4X4T A;  3QBC A;  4ZPW R;  2NSC A;  2G9O A;  3C15 B;  1WD6 A;  1NPP A;  3S6E A;  2Y0B B;  3A3P B;  1RE1 B;  1RTI B;  5IT0 A;  1XEZ A;  2N82 B;  3DOL B;  3C6U A;  2V2Z A;  2POK A;  3ILL A;  3MHY A;  1IBL F;  1HAR A;  1URR A;  1NK7 A;  4TU7 A;  1A9N B;  1RAF B;  2NYH A;  4FYW B;  3CCL S;  4DQR A;  1TQL A;  3CB4 A;  5B0A A;  2RUS A;  4WYW A;  1TZ0 A;  2ASJ A;  1SBR A;  3MR5 A;  4UOF A;  4PQU B;  3AOC A;  1FDA A;  3LP1 B;  1M5H A;  1VRU B;  2VBZ A;  3W8P A;  2ZWO A;  4CH1 A;  1NZA A;  3DXB A;  2HHT A;  1JLA B;  2CNK B;  1HNZ J;  4FF2 A;  4PXE A;  5RUB A;  2LP4 A;  1O5J A;  1GTE A;  3L3C A;  1ZM9 A;  4IQX A;  1CJT A;  2MZR A;  2CPD A;  3KYL A;  3TW0 A;  4EGL A;  3DRR A;  3OL8 A;  2XI2 A;  2YNF A;  5CYJ A;  1LWF A;  4KR0 B;  7FD1 A;  2E1R A;  5A8K B;  1EJ7 L;  3K59 A;  1TUV A;  2Q3P A;  3OXG A;  3GMG A;  3OR2 B;  3L95 X;  1HBO B;  1U1R A;  3HJV A;  1HI0 P;  5H9F K;  2NPF A;  5LXR A;  1R6Y A;  1NEE A;  5GAE U;  2XTJ P;  3EGV A;  3PKM A;  3DRS A;  2KG0 A;  2LQB A;  3BGR A;  1RAE B;  5KFN A;  3M6U A;  4ILR A;  2CPE A;  2W7P A;  1N5T A;  2JEF A;  2GO8 A;  1RT5 B;  2M8D B;  3MMC A;  5IC4 B;  2M70 A;  4DEZ A;  2R7X A;  3KJV A;  4DR6 F;  1AUS L;  1R27 B;  2FIU A;  4X64 F;  1RWN B;  1RQ0 A;  2IPO B;  1YWX A;  2R8J A;  1R7I A;  2AV5 A;  2N4D A;  3M7V A;  4YQW A;  3HVT B;  5A2Q U;  3M1V B;  1KFD A;  1KC8 T;  4UST A;  1X4A A;  1ACM B;  4UUW A;  4DR4 J;  2VF3 A;  2Z0G A;  4HLB A;  1HR0 F;  4JI1 J;  2PGC A;  2DRA A;  2B4V A;  4AQY F;  3PR5 B;  3NP5 A;  4WU3 A;  2K8G A;  2EKN A;  3K89 A;  3LP0 A;  5E33 A;  3MPU B;  4ZPV R;  1GMV A;  3C19 A;  1GXT A;  2I38 A;  3S7R A;  3HM9 A;  1WKK A;  3NLC A;  4EYH B;  4RW8 B;  4JI3 J;  3TNV A;  4DV7 F;  4HH0 A;  2MKI A;  3EMT A;  3THV A;  3PDN A;  3QLH A;  3UD4 P;  1N6Q A;  3HSJ A;  4PYA A;  5H9E J;  4YDD B;  3N5B A;  1FI4 A;  4IFV B;  4HAC A;  2JNJ A;  1SXL A;  2MEW A;  2FGC A;  4OYI A;  3T5K A;  2UUB F;  3D9B A;  2KM8 C;  1HYS B;  4PWU A;  4X4Q A;  1D0E A;  5BJR A;  1XR6 A;  2JEJ A;  2XYP B;  2E5J A;  5LMN J;  4BC7 A;  1MMN A;  2CQB A;  2OIH A;  2B4U A;  5K14 A;  3SBM A;  4V1A k;  1RAO A;  3T5H A;  3GE9 A;  2NS1 B;  3QNW B;  5DQG A;  3EDR B;  5BYQ A;  3OLB A;  2RHS B;  2DH7 A;  4P9S A;  4FS2 A;  1WDD A;  5HMZ A;  4NA1 A;  3DCA A;  3ZTR A;  4RKU C;  1CSJ A;  1MRO A;  3KK2 A;  5F3T A;  1VDH A;  1FTC A;  2DEJ A;  2Z2Z A;  3AQO A;  2KG1 A;  1DLO A;  2CAD A;  3ENQ A;  2F4F A;  3HFK A;  5KFY A;  1TV6 B;  1M5K C;  4OMF G;  3WHI A;  2X7I A;  2IRU A;  3FVY A;  2DR5 A;  1X4B A;  2CPH A;  2DHS A;  4OYZ A;  5E41 A;  2OP5 A;  2AEM A;  2MQ8 A;  4NLY A;  4DZ6 A;  3D1H A;  3CUN A;  5HVF A;  3W64 A;  4K59 A;  4LF7 J;  1P9Y A;  2ZHO A;  4ID5 B;  3C6T A;  5K8N A;  2EK6 A;  4L74 A;  2QMX A;  1U09 A;  1LFP A;  2G1D A;  2VFR A;  3CGI A;  4H4M B;  1QTM A;  4RUC A;  3D0I E;  2M9K A;  4KKO B;  4DV5 J;  2E5I A;  1X60 A;  3N28 A;  3O1L A;  4OJH A;  2DNO A;  3UR0 A;  4PUO A;  2M5Y A;  4ZVH A;  5BR8 J;  2F63 A;  3OTO J;  2HQF A;  4QCL A;  2VH7 A;  1Y3K A;  1K1Q A;  5HRO A;  3ZXW A;  4HVZ A;  1J27 A;  4NLP A;  3HX9 A;  2YX1 A;  5HLF A;  2APO A;  2CQG A;  3NAI A;  1CPZ A;  2K3K A;  2HWH A;  3N4W A;  2CQ4 A;  3WIU A;  1HWI A;  2Y1J A;  1LWE B;  2UV8 G;  3ICL A;  3RW7 A;  4ENO A;  4I67 A;  2GS8 A;  3MCS A;  1PSD A;  1AA1 B;  1YVF A;  2AZ3 A;  4DV3 F;  4JBC A;  1EP4 A;  1FX4 A;  1YK9 A;  3P49 B;  5DDR C;  3UCU P;  2V63 A;  3A8J A;  3TUP A;  3FSX A;  2HHQ A;  3E2E A;  2A6M A;  1RLC L;  2FHK A;  3R5J B;  5D0E A;  3VAF A;  2VDI A;  1BHN A;  1YJ7 A;  5HJX A;  5KG0 A;  4TVA B;  4HYK A;  5F8J A;  2BRL A;  4N76 A;  1RI7 A;  4K4U A;  2HMI A;  1RLD A;  1PC4 A;  1U1K A;  5B09 A;  3R97 A;  2AEF A;  3GJR B;  5BXI A;  4PG7 A;  1IBM J;  2HUR A;  3GFH A;  2PFD A;  2DIV A;  2LEA A;  1R0A B;  3MMB B;  1ZPV A;  2CPJ A;  2DCU B;  4RW9 B;  1RHM B;  3BQ1 A;  2B4O A;  2DGV A;  4URS A;  5DDO C;  1IKW B;  1XNR J;  5FLX U;  5IV3 A;  5I4M A;  2XEX A;  2VPW B;  3RW6 A;  4B9T A;  1N33 J;  5E5N A;  3TUJ C;  3IP0 A;  3DLG A;  4NYZ A;  1Y3J A;  4RNM A;  3WZ0 A;  3MPV A;  3IR7 B;  4X4U A;  1OMS A;  2KRR A;  3PV8 A;  3CCE S;  1X9M A;  1KFS A;  2I6W A;  3W5Z A;  3BB5 A;  4ES2 A;  2Y1I A;  1DHM A;  1WJ9 A;  2YKM A;  4XO0 A;  1KD1 T;  3ILI A;  4N41 A;  4ECU A;  4PG5 A;  1MWZ A;  4KGZ B;  4IYQ A;  2NXU A;  1HNZ F;  3CCU S;  4I4B A;  4CM0 A;  1U47 A;  5F9N A;  3LPE A;  3IBC B;  1FRI A;  3MCO A;  2A1B A;  4I68 A;  3CED A;  4DQS A;  2LYV A;  2KDO A;  3P8B B;  1GFW B;  2AZ1 A;  2HND B;  1SJF A;  3GIJ A;  2UVV A;  5KTQ A;  1TKZ B;  2CNN B;  2DGT A;  2HQD A;  5LT5 A;  4DPT A;  1VQK S;  3C16 A;  3SDE A;  4CLT A;  4URQ U;  4XPE A;  2FQQ B;  3Q23 A;  1OY8 A;  3SCJ E;  4TY8 A;  1Y10 A;  1T94 A;  1M5V C;  5GAG I;  9RUB A;  1LQ9 A;  1T3N A;  1TMM A;  1SJ4 P;  2GMH A;  4ZLN A;  4WXW A;  2V8P A;  1OIA A;  3HHL C;  2HLU A;  1T8E A;  4NOH A;  4M5I A;  5I3P A;  4KV8 A;  1SC6 A;  2E1C A;  5HBM B;  2JFK A;  2D3U A;  1N54 B;  3SCI E;  2GML A;  4NLT A;  4HEA 9;  1QUP A;  2CZV C;  1C0T A;  2BJ8 A;  3EM1 A;  5T41 A;  4DR4 F;  1RYS A;  2GVZ B;  2CQH A;  5CAA A;  4DWI A;  1D09 B;  4JI1 F;  2KB2 A;  3OBI A;  2VA3 A;  2DY1 A;  4CP5 A;  4DUY J;  1YBT A;  2L08 A;  2B9W A;  2BJD A;  3G6Y A;  4MIB A;  2CQ3 A;  2RKI B;  2BA9 A;  3H5S A;  2OO4 A;  2XSJ B;  5FII A;  4X4S A;  3ADA C;  2UUA J;  1D9A A;  1PC5 A;  3E01 A;  4Q2L A;  1IJE B;  2HFS A;  3W9I A;  1WI6 A;  3AB2 B;  4F36 A;  4JI3 F;  2J6T A;  3G8Q A;  2Q1L A;  4WFX A;  2R7S A;  3POT A;  2YWW A;  2XZD B;  4IOC Q;  4WF9 Q;  2RUG A;  2Y3Y A;  2B5J A;  4DV1 F;  2K7K A;  2CYY A;  4Y28 C;  3CXC R;  4PR6 A;  2CA9 A;  2XWY A;  2VPY B;  2MQP A;  2JZ5 A;  5DDP C;  1HQU A;  2E44 A;  3BKT A;  2MY8 A;  4RL1 A;  3UDL A;  2Z2L A;  5LMN F;  4F25 A;  1A0O B;  2PD1 A;  2DNQ A;  3TUZ C;  4DCO B;  2VPZ B;  4PXD A;  2R7Q A;  3RR7 A;  3HHN B;  3V6D B;  4IH5 A;  3DMJ A;  3EGW B;  1JLC A;  4FKY A;  1PAU B;  1RHQ B;  3FRZ A;  5KG2 A;  3W5X A;  2C2D A;  1CS4 A;  2EFG A;  2OKQ A;  3R5G A;  1MLA A;  4AYB D;  4R25 A;  5I42 A;  1GX6 A;  2HRY A;  3S1T A;  2AT1 B;  3AQP A;  3OHA A;  2V34 A;  2NSB A;  5HSP A;  3CMA S;  2H5J B;  2M4M A;  3IGV A;  2YPZ A;  3IN5 A;  2XMJ A;  2R2U A;  4RW7 A;  4DSE A;  1VQM S;  4LFC J;  4O23 A;  1S0V A;  2AEJ A;  3BS9 A;  4XDC A;  2ZJR Q;  4ED2 A;  4DG1 B;  4LF7 F;  5H9F J;  3BJY A;  3D0H E;  1JMT A;  3J81 U;  2HVI A;  1PYT A;  5KOW A;  5GME A;  2KO1 A;  3GG1 A;  1RWK B;  1QD1 A;  3IM9 A;  3IRX B;  3DU6 A;  4DV5 F;  1LFW A;  2QC3 A;  5A2Q Y;  2GHV C;  2YH0 A;  4Y3C A;  2M88 A;  2QJ3 A;  1VFJ A;  3MEG B;  3EVW A;  2MZS A;  3M30 B;  2MSS A;  1X4E A;  1W26 A;  3B4D A;  5FDL A;  1Q4R A;  4KGV B;  3W2V B;  5BR8 F;  3FCV A;  5KFA A;  3OTO F;  1RT7 A;  3G4S S;  5HVH A;  1WSR A;  5D6G A;  2VOP A;  4OL8 A;  1Q8I A;  1NJZ A;  2DVI A;  4RNF A;  1HBM B;  3HSZ A;  4J7C A;  4U7U K;  1L3T A;  4JUZ A;  2OMO A;  1MMD A;  4JV1 A;  3MED A;  2COL A;  1HQ2 A;  1VC5 A;  1NLK L;  3PHT A;  4OZ2 A;  3HVT A;  3PW2 A;  2W4P A;  1FER A;  3LUY A;  3M1V A; 
#chains in the Genus database with same CATH homology
 4ENO A;  3VGT A;  4F36 A;  1W7W A;  3NGU A;  5IOL A;  1NUE A;  3EMT A;  4DZ6 A;  1WKJ A;  1BUX A;  3BBC A;  3BH7 B;  3VVU A;  1F6T A;  2AZ3 A;  4FKX A;  1NCL A;  3R9L A;  3FBB A;  3FCW A;  4KPC A;  1PKU A;  4DI6 A;  1LEO A;  1VYA A;  3ZTP A;  3FKB A;  3Q8U A;  1NDC A;  3WX8 A;  3BBF A;  2DXD A;  1JXV A;  4UOF A;  1MN7 A;  3JS9 A;  3Q83 A;  3ELH A;  3GP9 A;  4O0N A;  1WKL A;  3Q8Y A;  3B54 A;  3EJM A;  2BEF A;  3Q86 A;  1NDP A;  3FBE A;  3EVM A;  3VVT A;  1XIQ A;  1ZS6 A;  1S5Z A;  5C7P A;  1U8W A;  4WBF A;  4F4A A;  3FBF A;  1BHN A;  1XQI A;  1LWX A;  2DY9 A;  4C6A A;  1UCN A;  1K44 A;  1BE4 A;  1EHW A;  3FC9 A;  3VGU A;  2CWK A;  2DXE A;  3EVW A;  3ZTQ A;  1NPK A;  2BX6 A;  4FKY A;  3GPA A;  1B99 A;  3NGT A;  3DKD A;  3EM1 A;  1NSQ A;  1KDN A;  2B8P A;  4ANE A;  2VU5 A;  4EK2 A;  3EVO A;  3MPD A;  2ZUA A;  4W98 A;  3ETM A;  5CAA A;  3VGS A;  2HVD A;  2NCK L;  3FCV A;  3VGV A;  1NB2 A;  3DDI A;  2HVE A;  5BXI A;  3NGR A;  1S57 A;  2AZ1 A;  3ZTR A;  3ZTO A;  4S0M A;  2HUR A;  3Q8V A;  1NDL A;  4HR2 A;  4AND A;  2DXF A;  1NSP A;  3PRV A;  3ZTS A;  3FBC A;  3L7U A;  4CP5 A;  2DYA A;  3EIC A;  3NGS A;  4UOH A;  1NDK A;  3ENA A;  1HLW A;  1NSK L;  3B6B A;  3G2X A;  1NHK L;  1PAE X;  1B4S A;  1MN9 A;  1F3F A;  4ANC A;  3Q89 A;  3BBB A;  4UOG A;  4DUT A;  2B8Q A;  1HHQ A;  1HIY A;  3BH6 B;  3EE3 A;  1NLK L;  1WKK A;  3PJ9 A;  5CAB A;  1S59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...