1WKJA

Crystal structure of nucleoside diphosphate kinase from thermus thermophilus hb8
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
137
structure length
137
Chain Sequence
MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords nucleoside diphosphate kinase
total genus 43
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1wkjA00
1BUXA 1XQIA 1LWXA 3BBCA 4W98A 4ANCA 1NSKL 2HVDA 3NGTA 3VVUA 3EM1A 1F6TA 3MPDA 3GPAA 4EK2A 3Q8UA 5C7PA 1NLKL 2AZ1A 2HURA 3FC9A 1NHKL 3BH6B 3BBFA 4DI6A 4ENOA 2B8PA 5CAAA 1S5ZA 2BEFA 1WKJA 2DXDA 1BHNA 1S57A 1B4SA 3JS9A 3Q89A 3ZTOA 2VU5A 3ELHA 4DZ6A 1K44A 1PKUA 3DDIA 4ANEA 3VGVA 3NGSA 3ENAA 2ZUAA 3B54A 3PRVA 3WX8A 2DYAA 3PJ9A 1ZS6A 3ZTQA 4F36A 1XIQA 1PAEX 1S59A 1WKLA 2NCKL 1UCNA 3EMTA 4UOHA 3ZTSA 3ETMA 1NDPA 2B8QA 3ZTPA 4KPCA 4FKXA 1EHWA 1WKKA 3FBCA 3R9LA 3BH7B 3FBEA 3L7UA 3Q8YA 1NUEA 3FBFA 5IOLA 2AZ3A 1VYAA 2BX6A 3FBBA 1MN9A 1U8WA 1NPKA 3VVTA 2HVEA 1NCLA 3Q86A 1NSPA 3Q83A 3NGRA 1HHQA 3EVWA 3VGUA 1BE4A 3EICA 3VGTA 4CP5A 3FKBA 3G2XA 3FCWA 1HIYA 3DKDA 1W7WA 4C6AA 4UOGA 1NB2A 3NGUA 4DUTA 5CABA 1NDCA 2DXFA 1F3FA 3GP9A 3ZTRA 3BBBA 1JXVA 4WBFA 3EVMA 1NDKA 4F4AA 1LEOA 5BXIA 1B99A 2DY9A 3B6BA 1NDLA 2CWKA 1NSQA 3VGSA 3EJMA 4HR2A 1MN7A 4O0NA 3Q8VA 4UOFA 1KDNA 4FKYA 4ANDA 3FCVA 4S0MA 1HLWA 3EVOA 2DXEA 3EE3A
chains in the Genus database with same CATH superfamily
3MURP 2GAHC 1RTDA 1G6BA 4G1QA 1BQNB 4YS2A 5I3PA 2AGQA 4QIGA 1X5TA 3UQSA 3DMJB 1RTHB 2D9PA 1UW4A 3GJRB 3KNAA 1XWLA 1Y5IB 2QO3A 4LRFA 1X9MA 2Q43A 3CDAA 3D7SB 2G2OA 4BC7A 3OSNA 3ENVA 2OTLS 4FYXB 2D7SA 5KFLA 4CM0A 1KHWA 1RWOB 3M1VB 3RAQA 3C6UB 2K1RA 1OSDA 1QY7A 1R0BG 2A2CA 3GJSB 3C15A 3IMQJ 1SH3A 4Y65A 5T14A 5BR8J 1FRMA 2UXBJ 3D66A 4FYWB 2ERRA 2PI4A 1Q5YA 2QL9B 4HHJA 1OY9A 4I0WA 1HNWF 2KDOA 5DLFA 3I6PA 2MY8A 2K8GA 2KHDA 3DRPB 3SCKE 1RAEB 2K3KA 2E7WA 5FDLB 4YB1P 1RWWB 4OYMA 5AE2A 3DLBA 5B0DA 6FDRA 4FYDA 1VRTA 4LBHA 5IT4A 4X66J 2KH9A 4RZRA 2RQ4A 4ECUA 1C4CA 1WHYA 4OX9F 1VBZA 5E33A 1DQ8A 2RQKA 1PYOB 4DFKA 1NBEB 1L3KA 4C8LA 4NZ6A 2J9CA 4U96A 3MAAB 3QSIA 2HFOA 3B4DA 1LWEA 4TNOA 5M2UA 4C7QA 1PBAA 1V9OA 1XIQA 3IBFB 2L41A 1SJRA 2E29A 2HFSA 3QYYA 5CYQB 5HBMA 2EFQA 5ETNA 4DN0A 4ZHRB 2XO6A 4DLEA 3LP0B 4X64J 2BQRA 4L3NA 2YWGA 4DL7A 3BSNA 2NLWA 2ZZNA 3CEDA 4USTA 4KPCA 1U25A 1S9GA 4WZQA 1SV5B 3DI6A 2XLKA 2O66A 2NXNA 4MYTA 3TUIC 4B3TF 4NCBA 2D3ZA 4DCPB 1KWMA 2HQFA 1QTMA 2V50A 3FBEA 1FK9A 1QSLA 3ISZA 2D9OA 5CZXA 2DEJA 2DVIA 1Z2LA 3MPUB 4CO5A 3O8WA 1S9EA 4ILRA 3I31A 1YJ7A 4LF8J 2BX6A 4QWEA 1MN9A 4DQPA 4DWIA 3DXSX 1D0EA 3D28A 2P2CB 4JI8J 1YBAA 2KZMA 3MEDB 3RB0A 4OHYA 3OR1B 4LSNA 4KH1B 3L7OA 4FXVA 2NPFA 4J9PA 3FRZA 1B70B 3NGRA 2DNKA 2MHNA 4URQU 1R8BA 4HT5A 1CBKA 3QT6A 2VPZB 4OL8A 2RH3A 3NAIA 4DV3F 5KFDA 2ZHAA 1C0UB 2MEWA 5SUHA 2KI2A 4DJBA 1KVKA 3GONA 1RWUA 2PMZD 4YR3A 3Q8SB 1X9SA 2BJDA 1NEEA 3A8EA 2M8HA 5K14B 3GCWP 3W9JA 3VAHA 3HHEA 5GMDA 4YQWA 5J2NA 3V6DA 3P6YC 5LT5A 4WP3A 2MQMA 5DRKA 1HNZF 1IKXA 4ZP6A 1H72C 2EPIA 4AFFA 1H2VZ 1VI7A 1PJ6A 2ZE2B 4XK8C 2MQPA 3VQTA 4HL9A 5FJ4A 5GAGI 2OLWA 3KDOA 2KFZA 1O8BA 1U26A 2BE2B 1NDLA 2CWKA 2X7IA 2W1BA 1IWAA 4K4YA 1YVFA 2W4DA 4LR7A 2JEGA 4DG1A 1QTNB 4NLSA 3LUYA 2R8IA 3RB3A 1KEKA 3AOBA 1Q8BA 3L9ZA 1RI7A 2LQ9A 2X1FA 1ZM4A 3BPSP 1PILA 3M6VA 4IQMA 4J9LA 2HS0A 2CQGA 3MECA 1S6QA 2DNMA 1YSJA 2K7KA 5IT0A 1XMOJ 1NJIT 4NLXA 2DGUA 3RJMB 1B64A 2WSFC 3JTOA 2JNJA 1M1HA 4WKYA 3TANA 3UR3C 4F0MA 1I94J 1CLFA 4YN3B 2CZVC 4UY8T 1BQNA 2QL7B 3PYDA 4M5DB 4RBTA 3U7JA 2VG6A 3QATA 4I68A 3VV2B 1S0VA 3KKFA 2RVJA 2HFUA 1IBCB 2GAGC 4OV6A 4DR3F 4DLGA 2ATCB 6FD1A 2OAUA 3PW7A 4PUOB 1OYDA 3TAQA 1BQXA 1WTBA 4OMFG 1I5OB 1RAOA 3EZOA 1H98A 4PXBA 4NCGB 5DO2A 4Q44A 3OVAA 1DFDA 3EUNA 3TZZA 4RU9A 3D0HE 2U2FA 3KHLA 3MPYA 2FHMA 4LF5F 2VG7B 3QGHA 1Q0NA 1RCOB 4IYQA 1H6KX 2MZQA 4FNHA 5KFXA 2VJUA 1MWZA 4C8MA 3NP5A 1XK8A 2R7UA 2UUAF 1S5ZA 4WIIA 2V67A 4DPUA 4JI7J 1RWKB 5F8NA 4QWBA 2KXNB 4KE5A 3I5AA 4IUFA 1KFDA 8ATCB 2YX1A 1EP4B 3DDIA 4L6V3 5U47A 3VGVA 4WK3A 4AD6A 3NCRA 3SFUA 2MKCA 1WC3A 3TZYA 1D8ZA 3MUMP 1JX4A 2M88A 3QGPA 1GNKA 3WX8A 4JV1A 2YY3A 2JFKA 2V8PA 2VPXB 4NI2B 1RBAA 4X4PA 2XYPB 3FUYA 3MEDA 3DDKA 3T1HF 1U1OA 4NXNF 2CUYA 2PFFB 1LWCA 2D1CA 3NWRA 4NOHA 1H74A 1X4AA 2OO4A 1MLAA 3KDNA 3RBXA 3OL8A 2ZWOA 1EJ7L 2W7PA 4IKAA 4K0KJ 3CJ2A 4CO1A 5EWEA 2QLFB 3PFOA 1S6PA 4FKXA 3BO4A 4F2SA 3W3SA 3A3PB 2VBWA 3E01B 2D3O1 2ZJRQ 1ACMB 1YBUA 2BKNA 1YJNS 1W2BR 1HI0P 4X4OA 4PUOA 4LMZA 1R6YA 2QFJA 2EFOA 3G82A 2KT3A 2R2UA 4DV4F 2N4CA 1T9VA 2BW2A 3L7UA 2B4VA 2K1RB 2XY6A 1WHVA 2CWXA 3CB4A 1NRKA 2I9SA 2J6TA 4WYWA 3OTOF 4DR6J 3J81U 4ECRA 1ZAVA 4HVZA 4ZVEA 1SPBP 3AQOA 2LMIA 2AJ4A 1F2HA 4H4KC 4QU7A 1NK5A 4HACA 3JYTB 1UWBB 1S1UB 3N6NA 4EYIB 1G4CA 4LREA 2VHGA 3DLLQ 1NMEB 3AXMA 3DHXA 4ZMMA 3PHTA 3DLKA 2R42A 2VQEF 1HBMA 3IAM9 2YNHA 1VRTB 1RT3B 3JSBA 4X62F 1NK7A 1SL0A 4F4KA 1N5YB 2IIHA 3CO0P 3CDEA 2OHDA 3Q2SC 3SCIE 4PWDA 4DUTA 3HFKA 4LR8A 4NLUA 1U48A 1Q95G 1F3FA 4OZ3A 4ZKAA 3PW2A 3FMBA 2UZAA 2YKNB 3BREA 3MAHA 3MMBA 1IKXB 4RWWA 1HNXJ 3CCZA 1PO6A 5C25A 2X51A 1R31A 1L5UA 2DPJA 1T0TV 1Y9OA 1U0HB 3IM9A 3W5ZA 3H2LA 1VK3A 1MROA 3S01A 1S79A 2GVZA 4M5GA 3CMES 3PKMA 4LJMA 2XNQA 2ZNZA 4CT9A 4Q0BA 5KFPA 1ULRA 3R27A 4X4UA 2DK2A 5LSOA 3ITHA 3TQ1A 2AEMA 3IRXA 1T9XA 1NK9A 1TV6B 2E1AA 2F5GA 2VC1A 3M9OB 4IFYA 3R7SB 1SB6A 2BA9A 3EGVA 3I5CA 3OR1A 3OTBA 3O44A 3VWSA 3GB0A 4ZCMA 1LWFB 3G6YA 4DR6F 4C4WA 1RTJB 5D15A 4KGVB 3B4MA 2ROEA 1JLGB 1WG5A 2X3DA 2ZVIA 4M63A 4QZVB 2HFZA 4HI2A 4ZLPA 2Y1RI 3HHDA 4B3SF 4LF7F 1UWBA 2GQCA 4DL2A 1S97A 2MTLA 1EARA 2HMIB 4QYRA 4QWDA 2W9CA 2C2EA 2YXLA 3MEKA 1NLKL 3EYZA 2B43A 3QJJA 4NA1A 4IH5A 1EKRA 5BYQA 4YDXA 2Y0BB 3QLHB 2B9WA 4MT1A 3IAS9 4JV5J 4V19J 4LSNB 2PI5A 3MD3A 3D4JA 1XTZA 2IM0A 3M8QB 3L3CA 5IS2A 4LFBF 1RJJA 1RAAB 2VG5B 1W2IA 2VFUA 2MLYA 2F40A 4I6WA 2G0CA 1UZHA 2AMCB 4EI2A 4RUCA 2MMYA 2AP6A 1X7VA 1HWLA 4LRDA 4BHQA 4O0IA 2UUBJ 2VFVA 2EG1A 2RHQB 2YNGA 3GJTB 1F9FA 3GFYA 2Y1IA 4R25A 3NGSA 5CD4A 4GKKJ 1PC4A 4QCLA 5J1PA 3W7BA 5HVHA 1DJ0A 1FRXA 2CRLA 2HBQB 2OI2A 4C8ZA 1CJTB 1ZS6A 2OKQA 4QR2A 2RQMA 3KJQB 1FNOA 3P96A 2D41A 4PCQA 4JI2F 4U7CA 3AT1B 1J5EJ 2F65A 1N5SA 4H4MB 4WFXA 4ZHRA 5HBMB 1YJUA 1RXOB 1UETA 1J2VA 1CC7A 3CVKA 3N9UC 1JLBA 4U8YA 2W4PA 3X3UA 5DGBA 3K57A 3CCRS 1LW0A 3TAPA 1QSSA 1UVMA 4PQUB 1BC6A 4B9MA 1IKWB 2QGFB 1WKKA 2LVWA 4IG0A 3FBCA 1UMJA 4K0KF 4X4TA 4FPRA 1VQKS 2HHHJ 1F5BA 4M5JA 1ELOA 2AEFA 4DG1B 4X4SA 2XB2D 4CT8A 1N48A 2ZNYA 2AZ3A 1JLCA 3I0SA 1CJTA 1SKRA 4PWDB 4CNZA 4Z7YA 4WFBQ 2CJAA 1HQUB 1NSPA 2O1PA 3LGMA 3HDSA 3QIDA 1D9FA 3WIUA 4DV7F 3H98A 3PO5A 2ZDOA 2K3IA 4M5DA 1S1UA 2E44A 1IKYA 2KN4A 3R5AA 4Q7AA 3SV4A 3V6JA 3LO3A 1C0TA 3GYGA 3DRXA 1XNRF 1S0MA 1PIEA 3GG1A 2CQ3A 3OQ2A 3KG0A 2NZCA 1VK8A 3M7VA 2VKZG 1UWAA 2UXBF 1JLAA 1J5OA 1PJ5A 5T7LB 4DV2J 2DNOA 3DFEA 3AB4B 3D1OA 3FVYA 1T9UA 4URSA 4F7VA 5DGAA 1WC4A 4MH8A 3TVYA 1V3SA 4EU0A 3KOAA 3S1TA 3SEOA 4ZS6A 2R8JA 3BPDA 3POTB 3R97A 1Y0HA 1VRUB 2GVDB 2HNYA 4IDKB 1LW2B 2AYBA 2VFTA 1U09A 4I69A 3BS9A 3LWLA 4KHMA 2VOPA 2HEKA 2QMUB 3AHPA 3BZQA 2MGZB 2BE7D 5KFIA 4BWMA 1KQKA 4EO6A 5J2NB 2V2QA 4DSJA 5HQLA 2MXYA 3H5SA 5K14A 2HVIA 4LFAF 3GV8B 3G6ES 4ER8A 3I96A 2DIVA 9RUBA 2BRKA 3ZZZA 4DCJB 3J7YU 2KG1A 3LP0A 4WFAQ 2QA2A 4K4WA 2NSCA 2DNRA 3QFHA 4K5RA 3A8IA 1FJEB 3OW2R 4ANCA 5DDOC 1JLGA 4ZJLA 1ICEB 3L09A 3VVUA 4QW9A 3H4BA 4A8KA 1Q53A 5FIIA 1VJQA 4USIA 1DHMA 2HS3A 5EHHA 1F6TA 3QRPA 4JI1J 3FDSA 4WE1B 4K4VA 3DLGA 5C7PA 1N36J 8AT1B 4HH1A 4E8UA 2QTWA 1U2FA 5KFZA 3ZZPA 4O3PA 2E66A 2L08A 4AQYF 3HJFA 1OS5A 5AJ3F 1WSVA 4X4VA 4CO3A 4KGXB 3QT7A 3T5LA 5F41A 1S1WB 1CJVB 1UVLA 2VB6A 1JLFB 2PD1A 2HZAA 2DXDA 4M5NA 5DZ6A 3SCJE 4ECSA 2UVWA 2HHXA 2RQCA 2DEIA 3M2VB 2VL1A 4CZCA 2OFGX 1PSDA 5ETQA 3I4HX 2YVSA 1JJHA 1WI6A 4CLPA 1B0VA 3W5YA 2IA0A 2EKYA 2IC3A 1H2UX 1FCAA 1VOMA 3B54A 4QWCA 4HYKA 1H73A 1RT6B 3CW2C 4DU8A 1IVZA 4PRFA 1N54B 2A18A 3HULA 3W9HA 4XPEA 4E2FB 2F4VJ 3CCLS 1S59A 1U0HA 5JVGQ 4DR3J 1PGZA 2BW7A 2XM3A 1S1VB 1RTDB 5C42B 4C0BA 2IBKA 1Q82T 1WDDA 1OQ6A 1XEZA 4F0HA 1VQPS 2V63A 1MMDA 3RGIA 4TY8B 3M2UB 1TU0B 3KNGA 5KG3A 5IWAJ 1T03A 2QYCA 2CA9A 4ZVHA 1DTTB 2G1DA 2NYIA 4N76A 2HAFA 2H5IB 1HNVB 1H7WA 2B51A 4ATNA 2XHCA 3GIKA 2JZ5A 2U1AA 2I5JA 4USKA 4WFYA 4P74A 1KS2A 2WSEC 3L7PA 3VGTA 1KRPA 1CEZA 2KXHA 5F8LA 1VLYA 2LDIA 1XJWB 1WD6A 1SXLA 2UVRA 2IMWP 1K1QA 3W60A 3K5OA 2JH3A 4WTOB 2FLNA 3UD4P 1BGXT 2OPPA 3PYGA 2J6SA 4RUBA 2JLGA 1WOOA 2QN6B 1TP7A 2DGVA 3WX4A 3B78A 1EIYB 3FFIA 3I9V9 3FEXB 1J27A 3OHAA 4NXMF 1UVJA 1N56A 2GMLA 5CCMA 5K8PA 2HLUA 3PIPQ 2IYGA 2R3VA 3KLHB 3PW5A 3P4UB 1FWKA 1GMVA 1WI8A 2B6AA 3PG9A 4GO5X 2CKWA 2B4OA 2AGOA 2CPJA 3K0JA 1REGX 1SV5A 1H3DA 2DO0A 2FJEB 2MJNA 3B82A 1KN6A 4AXJA 3H2UB 4P73A 1FKAF 4IO9Q 5DDQC 1VQMS 2RUGA 1DBDA 1Q79A 2GHPA 3PHEA 4A8XA 3N5BA 2Z56B 2E7VA 2QL5B 4TY8A 4B9LA 1ZM9A 2ZOMA 2MZJA 2FY1A 3T5HA 1UVNA 4O4GA 2OEJA 1FX4A 1HQUA 3K89A 5H9FJ 3JSRA 4ZPTR 4FXDA 2DBBA 2FVRA 1Q8LA 4Q2MA 3IGNA 4DHVA 2MQQA 5DQHA 3PW4A 1FNXH 4DX6A 3R5BA 1SUQA 5F8HA 1IJEB 2VA2A 1M5OC 3IS9A 4DXLA 2WAQD 1X4EA 2PEBA 2RDDA 5KT5A 1UKUA 4LF6J 2RD5C 3EM1A 2O3DA 3QWUA 2IC3B 3MWBA 4EYHB 2R7SA 1SC1B 1DTQA 3T1YJ 3NNHA 1F9HA 3NG8A 1HA1A 2CQPA 4NLRA 4PWUA 3PXGa 5AXKA 3C6UA 2KO1A 2HHQA 4R5PA 3RBDA 2HS4A 2C42A 2LQ8A 1N36F 1FTRA 1RLCL 2IM2A 1YQHA 4QBUA 2OTJS 2VV5A 4GMKA 4OI3A 4OIXA 4YB7A 1L3VA 2UVVA 2YWHA 5RUBA 2R7TA 5A6PA 4WPAA 1F2GA 2CIMA 3Q89A 3W1YC 2FQQB 1RB0A 3ZTOA 4ECTA 4AUKA 1MU2A 2FVSA 5L39A 5F8MA 4DL4A 2KB2A 3AD9C 5F0UA 4ANEA 4DPYA 2R8KA 3CDWA 2C3YA 3ISNC 2CZ4A 2YH0A 2ZBQA 5D0RA 5LSLA 1Y5LB 1W26A 3W9IA 1APSA 4OZJA 4X65J 3T5JA 5LMUJ 1RACB 2DCLA 4CNYA 1SQFA 2QG9B 2WBRA 4ZK7M 2UVUA 4GC7A 4G65A 4Q8EA 2MQ8A 3UE2A 5ETOA 2ZBCA 2UUBF 5CZVA 2KRBA 1K0VA 4KQZA 7AT1B 1X4BA 4EUVA 2FIUA 4DUYJ 5DDPC 4OI1A 2HHHF 4P6QA 2YNIA 3AOCA 4YR0A 2HGMA 1I94F 1VBKA 1Q7LB 2BM1A 3PVXA 2JVOA 5GADI 3CPWR 4AL6A 3KHRA 3KG4A 1XR5A 2A2DA 2FLOA 2RRNA 3LQVA 3PNIA 2HQIA 2UXDJ 2AV5A 3OL7A 4JYAF 5KT6A 4ZVUB 2DKOB 4MTPA 2YWKA 3U1LA 2CYYA 3CJKA 3Q8YA 3U1NA 3CJTA 4ZCIA 3PW0A 3FBFA 1VFJA 5HLFB 1YRXA 3PEHA 4BS2A 5J2MB 4NYOA 3H20A 3AH6A 3CCSS 1SQGA 3VVTA 4OI4A 3OTDA 3HO1A 2GIRA 5D0EA 2ASLA 5CHCB 1KTQA 4GKKF 3CXCR 1TKZB 3CDUA 3RRHA 1HWIA 5C2CA 1XMQJ 2HWTA 3W63A 1XR6A 5IC6B 5A8KA 5LM7E 1YI2S 4GKJF 3IXQA 5J2PB 7FD1A 2KFYA 3DOMA 2BE9B 1OMSA 4JBCA 1HNZJ 3A4TA 3OR2B 4DCOB 3K7RA 1IM4A 2CPXA 3DGVA 3P5BP 4UOGA 3NNAA 4A47A 4C3LA 3VAFA 5F8JA 4Y3CA 5CD4H 2CPEA 2I0XA 5JXSA 3BGRA 5CABA 2W2PP 4ZPAA 4F4XA 3C15B 1KQSR 4RO0A 3TX8A 3GV7B 3G9CA 5ETLA 5IM0B 2X1BA 1T9YA 5D0GA 5A6WA 4YB5A 2JC1A 4Q8FA 4Y2KA 5KFWA 1VHFA 4RR5A 3X1LB 1S7IA 1G3OA 2B5JA 1CJKA 1X4HA 2FD2A 2YKQA 4B3SJ 5LOQA 2VFRA 3B6BA 2HIYA 3POTA 3W2WA 3IS9B 4X4RA 3PDNA 4EBCA 1X9WA 4H4OB 4G1PA 3Q8VA 4MFBA 3I0RB 4UT4A 1DTQB 4RW4A 1FJ7A 3I87A 5KFKA 4ZP8A 1RWPB 2W7AA 2KYZA 2AJQA 3QNWB 1NH8A 1SC3B 3DRPA 3M8YA 5K8MA 3MM9A 1YKWA 5DETA 4H4MA 4PG5A 3K58A 4IG3A 1FDDA 2V5HG 4LR9A 4RW7B 2LFVA 3BBCA 4NX9A 3LWMA 3A1YG 2JHEA 3ZZUA 1E6YA 1Q78A 2A0FB 2RRAA 2FJVA 4DV1F 4JI0F 3GYNA 5HMYA 3GPAA 1FA0A 1HMVA 4USVA 4Z2XA 2L48A 2CQ1A 4OHZA 4J9NA 2ZC3A 1URNA 2RAQA 3PZPA 2AJFE 3TAMB 2CQIA 4RUAA 2GMJA 1IJFB 1DRZA 1NHKL 2DHGA 2DHXA 3MMAA 5H9EK 4DI6A 1FRIA 2O01C 3GFZA 4G1QB 3QAEA 2KZZA 1HPZA 2FHJD 3MM7A 1ZPVA 1JK9B 2DY1A 1HQEA 2MZTA 1YDLA 3CGIA 3ILJA 1UJ5A 1LK7A 4UUWA 2Y9HA 1U2CA 1WF2A 3ELHA 2CQ0A 3WZ0A 1K44A 1WEYA 2ASYA 4Q2LA 3T19A 1LFWA 4RNHA 2B9EA 4Y6IA 3CJ5A 1RT5B 3GWCA 4OYBA 4RKUC 1HNIA 3GYXB 3H4DA 4USWA 1YZ6A 2O5DA 2YPZA 1VDHA 3HM9A 4NEYA 2VC0A 1WG1A 4ELVA 1ITPA 2ZH2A 2VQFJ 4PPDA 3D68A 2JEFA 1WF0A 3R5JB 1V5VA 1KP6A 1PAEX 2PA8D 4KGZB 4NYZA 5B0CA 4U67Q 4NLOA 1G7CB 4UOHA 2ATLA 1KD1T 4B9TA 1SJ4P 2O67A 2B6AB 2PA3A 1JJ4A 3K59A 1LWFA 2V8GA 3BGFA 1K8AT 4N41A 2ZH7A 4KHRA 4O44A 3T9ZA 3LTOA 3M8PA 4OV1A 1VRUA 4ED6A 4LF7J 2CPDA 3BGUA 4Y2MA 4RW6B 3M4XA 3OLBA 3CIZA 2M52A 2V8VA 1VQLS 2IM3A 4DPOA 3OUYA 2DO4A 3CD7A 3VAIA 2ADBA 2NXCA 2J7KA 3NLCA 4A8FA 4QPXA 3D6FB 2AD9A 4K4UA 3M2UA 3CD5A 1U8WA 2JLEA 4LQ3A 1U6ZA 2F4FA 3Q24A 3GSDA 2BQ3A 2B7BB 1E6VB 4A8SA 4DR5F 3HP6A 1PCAA 2QRRA 4K4TA 4B3TJ 3IO1A 1FWLA 3VAGA 2AGPA 1LQ9A 3EICA 3KJNB 4ZN1A 3FKBA 4CCHA 1RTIB 5AXMA 2IDEA 1S1VA 5B09A 3SYZA 4GRSA 2ZKUA 3C16A 5A0YA 4YHHJ 2BM0A 1RT1A 2MKYA 4N56A 2ZH3A 1IQTA 4LVNP 2JLFA 5LJ5Y 3EXYA 5ETMA 2YH1A 2AQ4A 2G0IA 1RT3A 4IRCA 3DGPA 5BYSA 1NDCA 2GNKA 2P6TA 2J0QD 2FJDB 2KM8B 4RW8A 4YY3F 2AEJA 2LCWA 3GE9A 5C25B 3V81B 3M32A 4GVLA 2YKNA 2B9YA 2I1RA 5B0GA 3TUPA 2WVEA 3AOAA 2HHWA 3V6DB 3K8WA 3NMRA 1F9EB 1JLFA 4OHVA 4F4AA 3Q22A 5ETKA 3H25A 3MM5B 3HHLA 4USMA 5IV3A 2OMOA 2FB0A 1TVRB 3CUNA 4FXWA 2PEHA 1C0UA 2F63A 3K8VA 2J8SA 4QWAA 3KK3A 4TYAA 1RADB 1S6UA 4USHA 1VR6A 2B56A 5AXLA 3MR2A 1RU2A 3T9NA 3CC2S 5KFEA 1U49A 4C97A 1FKPA 1C4AA 3MXHP 2Z0GA 4ECVA 4P2FA 1E6VA 2J9DE 2BYCA 2AX1A 2ILYA 2XULA 4DOZA 4L3KA 4TU8A 3RB6A 1CVJA 3CE8A 1MWYA 2OUGA 3EE3A 4ZVQB 1J5OB 1LWCB 4AL7A 2LKZA 1T8EA 1C1BB 3O2IA 3VCDA 2HVDA 2CJ9A 2KVIA 3NGTA 4DUZF 3N79A 2DRBA 1VQ6S 2PO4A 3G82B 3BSAA 4K59A 2GQ2A 2D3UA 1YJ9S 2N4DA 4OYOA 2UUAJ 3BDPA 3OFHA 1IR1A 2DT9A 3BGOP 4I7FB 1N5VA 5IZHA 1ZM3A 5F8GA 4DV5J 1U1MA 2RKIB 4FBUA 3P5TL 1EETA 1KOOA 2EVZA 4K4XA 2R2TA 2JC0A 3MCNA 4Q45A 5I3UA 3PV8A 1F0XA 1UJ6A 3GIIA 2VF3A 2W9BB 1ZH5A 3BH6B 3BBFA 2V2ZA 1MMLA 2LXUA 4CH7A 2VQFF 4XO0A 2IRYA 1TK5A 3QT5A 2D69A 5EX3A 2EBGA 2K06A 2OPRB 5ETTA 5HMZA 2JL9A 1S57A 1P6TA 3JS9A 2EFNA 1RT5A 2OP5A 3HHKA 4JI5F 4F02A 1O0PA 2F9DA 5HVFA 3HSGA 4PXEA 1YRUA 3NOGA 3UO0A 1AW0A 3CWJA 9ATCB 3ONQA 2PFDA 4TKTA 2WSCC 5IQ6A 1TVRA 1KONA 4RNOA 2BVZA 3THVA 3UDEA 5I4MA 2KRRA 1XMOF 4EZ6A 3L95X 1LFPA 4PYAA 4DV0J 4EEYA 1IBMF 2N7YA 4KFBA 1RBOB 2A6MA 1Q7YT 4JI3J 2B3TB 2VG7A 3N6MA 4LF6F 2R9LA 3D5MA 4TY9A 2ZBRA 4DQSA 3R1LA 1S12A 4BCAA 5GAHI 5DQGA 3GZ7A 4KT0C 5K8NA 1OWXA 2HVHA 5D77A 1FWPA 2DCUB 4IG0B 4OJGA 1SL1A 2HBRB 3SQOP 3PEJA 2W8LA 2AJ0A 4QOTA 3W65A 1JLBB 2CQCA 3R9LA 4OHWA 1JLCB 1RT1B 1WHWA 2YKMA 3ET6B 2ZJPQ 1NO8A 4CLSA 2BJ8A 3Q8QB 5GMKa 2XO7A 4IOCQ 2CJBA 1K73T 4OJHA 4ALZA 1XBWA 2G2ZA 4QU6A 1UA0A 3QZ8A 1Q8KA 1AB8A 1RHUB 2UXCJ 2R7OA 1F1BB 1CULB 3CNQP 1U1KA 2AX0A 1LW0B 1U6FA 2AIRB 4F4YA 1N8RT 5A8RB 4PQUA 1SBRA 3VGUA 3IN5A 1RSCA 2E7XA 1KLMB 5D4LA 2FLPA 5ETRA 1SKUB 2G2YA 4JV5F 2RS2A 1BWVA 1KOHA 1R8AA 1HBOA 1NSAA 1IR0A 1RT2B 2IMOA 1RUSA 1CJUA 1RAGB 3AFGA 3NS6A 5E3CA 2HVZA 4CLYA 3M2RB 2XTJP 2BV3A 3JAMU 4OI0A 1GK8A 1NB2A 4DV5F 4FDFA 3ETOA 4KTQA 3MECB 4I2PA 2GQQA 4RPFA 5KG4A 2XLIA 4RWXA 1GXTA 4WU2A 3BGLA 3KHGA 1M5PC 2KT2A 1VQ9S 1HBUA 2AYGA 1FDAA 4OYAA 3ZZTA 4KY3A 4FF2A 3AY0A 4WTYA 3HD2A 2CQBA 5J1EA 3ILLA 3M8QA 3LOUA 2XEXA 3HF5A 4DUZJ 1M5SA 2A1BA 3ZZYA 4DR1J 1CSJA 1TKTA 2RDJA 1T11A 2H65B 2H3EB 4A8OA 5J2PA 1XNQJ 4IOAQ 2YNGB 1VMBA 2C22A 1JNRB 1RHJB 3CTRA 3OTOJ 1NJWA 2CAJA 4ECZA 3AA9A 2EFVA 4MK7A 4FF3A 2YKOA 4IRDA 1XNQF 2OELA 2JOQA 3FSYA 3G96A 1HLWA 5KFYA 1JLQB 4KPYA 2C2RA 5HMWA 4JI6F 5KT7A 1JKHB 1Q81T 5IT9U 3TWZA 4O44B 3TJ9A 1U6BA 5ETSA 4LF9F 1KLMA 3TUZC 4LIRA 2JJ4D 3PX6A 3M30A 2CPYA 2DNPA 1MROB 3AD8C 3IFEA 5B0FA 5SZTA 4NXNJ 5C24B 5KFRA 2YKAA 3WIVA 4HHHA 2CJKA 4PXCA 3KLEB 3H5XA 3PY8A 3QIPA 1HNXF 2XYHB 3FC9A 1S9EB 3ZO7A 1HBUB 3CCTA 3TW0A 3DOKA 4KKOB 2B8PA 2HQCA 3D6TB 4NEZA 3TA2A 4L75A 1GX5A 3WBZA 4DMZA 1S4EA 1WELA 5H1SV 3KK2A 4JI0J 2L3MA 2WVCA 1RWMB 4CYUA 3AD7C 5C5JA 3WC2A 3CDBA 3TEGA 4TU9A 2Q6BA 1T9TA 2HBZB 3KJFB 4ED2A 5KG1A 3MM7B 3UW1A 2J0SD 4DZ6A 1NH7A 1TL1B 2M7SA 5KFUA 3IGVA 2Q3PA 3D0GE 5KG2A 5KG6A 4Y0FA 4RU2A 4ZJQA 5F3TA 3D1QA 3NEKA 2BJ9A 2VICA 1NK4A 4FBTA 1N5QA 3C6TB 3IG1B 3RW6A 3CCWA 3CULA 3DC2A 1LWEB 2M2BA 1S1XA 1FEEA 1OIAA 4G6VB 4IO1A 1QSYA 1XNRJ 2DR5A 1S1TA 4ZCKA 2HYIB 4DR7F 2LP4A 5IM0A 2BABA 3JAMY 4ECQA 3C3LA 3GIMA 4ZOSA 3MDFA 4KJIA 3U02A 2FHJA 4EO8A 2C28A 2XWXA 4OZ0A 2BOPA 3I82A 2QX0A 2RF2B 1NU4A 2RB7A 4KO0A 5THWA 2CADA 1KC8T 4WP9A 1RGVA 3RAXA 3FNNA 2FPHX 3RTVA 3TVZA 1NPPA 2QC3A 5JMNA 4C3MA 2OMLA 3D54A 3FZ2A 4NLWA 4J9MA 2FUG9 2GO9A 3T1HJ 1HQ2A 2DD8S 1QJHA 2ACMA 3R2DJ 2NXJA 3FBBA 1RU1A 3DXBA 2QLXA 3K2YA 2EXUA 1NPRA 1OY6A 4R0EA 5LXRA 3KYLA 2ZH6A 1NCLA 3CJ8A 2UV8A 5EWFA 4JV2A 3M8SA 2CFXA 1S76D 1U02A 2HAIA 3KK1B 4KYZA 1FD2A 1U7LA 2HWHA 3DMJA 2E1PA 3BR8A 1EP4A 5ADZA 2BJ7A 3MZIA 4I1TA 5L1LA 1GTHA 2OD6A 5KFSA 1VISA 1HWKA 3UWTA 1WWHA 5L1IA 2NZ4A 2AKWB 2GZOA 5I3UB 3U27A 5B0AA 1IR2A 3K5NA 1RTZA 5DLGA 4B02A 4I7FA 1AROP 4DFJA 1DURA 4B3MJ 4LF1A 4NLQA 2G9OA 2POKA 1V3RA 3CJQA 2F9JA 4QW8A 3UFCX 4R0JA 4ID5A 1R0AB 1HFEL 3KLHA 4BLGA 2KM8C 3SV3A 4M5LA 2ZDPA 1WNEA 2PT0A 2H48B 2HNDB 2VKRA 2VJVA 1JXVA 1HHSA 4UZBA 2COLA 2N3LA 2HLTA 3MR5A 4ES1A 5BXIA 1GAOA 3CCQS 3BR9A 3OFEA 5HATA 1DZ5A 3D0IE 3IBCB 4C8KA 3E2EA 2OPPB 3LPYA 1JMTA 4PAAA 4C11B 4FS2A 2W01A 4ZP9A 4Y28C 3GILA 2OD4A 3CJ4A 3SQGB 3LP2A 2XQCA 3TJ8A 3O1LA 3W5XA 2ZH1A 4U8VA 3SFGA 3FQKA 5HL7Q 4R8UA 1TKTB 3BYPA 4ES3A 3A12A 2HW3A 2RIJA 3TAMA 4YOEA 4ZA1A 2GC8A 4O23A 5KFMA 5LMNJ 4LSZB 2DR9A 2AU0A 3UN3A 2H1YA 3IRWP 1ZBTA 1UFLA 3JTPA 3K5PA 2MZSA 1SKSA 2E5LF 4OX9J 4ZVGA 3E8OA 4XIUA 5KFOA 1X4DA 1JQGA 2FC9A 1BUXA 2ZFHA 1AUSL 2M3DA 3LANA 5HJXA 2K2PA 2OFHX 4W98A 1U4BA 4I64A 1HBNB 1RISA 2CNLB 4DL3A 1A7GE 4I4BA 1WSRA 3ZNJ1 5AXNA 4YP3A 3EPGA 1D9DA 4N7TA 5LL6d 1ZA2B 1HW8A 3MPDA 4D3GA 3KLIA 4ZVSB 1NJYA 2V4JA 1R3NA 1N0VC 5E3QA 2YNHB 1H38A 3KLFA 3CD6S 3I0RA 4R5PB 1T3NA 2FY8A 2VBZA 5F9LA 2QA4S 1GQEA 4ED7A 5KTQA 3C2PA 1WEXA 1YBTA 2CPFA 5LMUF 4Q5VA 1UPMB 5KFAA 2Z4PA 1CULA 3CSKA 1CJKB 2AYMA 1WKJA 1X31C 2B5JB 5L8RC 2E9ZA 5C2GA 1K47A 1B4SA 4CIOA 1U1PA 4MIWA 4KGMA 2BJ1A 1X8DA 2IBOA 4YDDB 1OJ4A 2VU5A 3J7Z5 3HPOA 4B3RF 3TNVA 2GJIA 3ZZRA 4ICLA 1QM9A 3LP2B 5HQMA 4B9VA 2ZD1A 2Z2LA 5LJ3Y 1NZAA 3I4PA 3PR4A 5GMEA 3HLUA 3E3XA 3TQEA 5ETPA 1WG4A 2WB4A 3G8SA 4JYAJ 1YGYA 3J7A1 4M5MA 1P8GA 5B0EA 1MG7A 2KVQE 2UXDF 3A3OB 3BN4A 2EK6A 5DG7A 2NCKL 5K20B 4J9RA 2FJXA 4J37A 3LP1B 1Q1KA 2GMHA 2IAJB 2IYIA 1Y11A 1UFWA 2MKSA 5GAEU 4ED0A 3GLJA 1Y3KA 1R8PA 2WW8A 1FI4A 4XPCA 1EHWA 4MKBA 2YQ3A 3HKZD 2PDAA 4DX7A 3DRSB 1HL6A 4IQXA 1D8YA 3Q0AA 1RWNB 4C98A 3HFZB 2IRUA 5FD1A 1QAIA 4HLBA 1AZSB 1UL3A 3BV8A 3F44A 4PXDA 1QVFR 3CJKB 2GO8A 2LYVA 5IOLA 1WC1A 3OXFA 4V19X 2MYFA 3ZZ0A 4NMLA 3TZWA 1BMQB 4WKRA 1JWWA 1P27B 4AYBD 2B9XA 2HHSA 5CYJA 3M8ZA 2CNKB 1SKWA 2WBMA 1YTYA 4WU3A 4OX7A 1S7HA 1FJCA 3HHLC 1PC5A 3NS5A 3R7BB 3TEHB 5KFFA 5HJYA 2XS2A 3PRDA 2MQLA 4NA2A 1JJCB 3KUEA 2IAJA 1FNMA 3FCWA 4KIAA 5ETVA 3GIRA 4DPTA 1HIYA 4DUYF 3SZ2A 1DQ9A 2GVDA 2HNYB 4IDKA 4C6AA 4ID5B 4DV6J 3CC7S 2ROPA 5DG9A 1OPIA 3CIMA 1MSWD 4K4ZA 1SH0A 3J80Y 1I51B 3LPEA 3AJ1A 4MIAA 3J7AN 1RHMB 1VQ4S 1RT4B 2SXLA 3ZTRA 2ROGA 4I6YA 1KLNA 2NR0A 1NKEA 4AXIA 4CLKA 2V34A 3MUTP 4DL5A 1T05A 4ETXA 5A2QU 5IFMA 5CYQA 2R7XA 3MM9B 4OLPA 4WIQA 3T6BA 3ZC4A 4F4ZA 3OJSA 2EBEA 3VGSA 1ZM2A 2DHSA 2J9EA 1NZ8A 1T02A 4CTAB 3NBPA 5K8OA 3BO3A 1HR0J 5E2QA 2XGPA 4OYXA 1S77D 1KDNA 4OJ1A 1TMMA 4MFBB 4P52A 4AE5A 4EFAC 3UPFA 3QZ7A 4QR1A 2DH8A 3FCVA 3KLFB 4B3OA 2MHEA 3MOZA 3UVJB 3SMZA 2V4JB 1S1XB 4U6PA 2ADCA 3QJPA 3JQJA 5HN0A 1O6XA 4BDPA 3MEEB 1IBKF 3DNCA 3GMGA 3N28A 2DNNA 3OTEA 3QFWA 5KG0A 4F50A 1RT7A 4DDFA 4RNNA 3PTWA 2RF2A 1TFWA 2ALZA 2FYXA 2M9KA 5KFBA 3LAMA 3FJ2A 5GAGU 3DLGB 1TUWA 2H51B 4ZLNA 2FHOB 3KHHA 2WVFA 2YX4A 3M1VA 4P72A 1FDNA 1I1GA 1JXEA 2PE8A 2G4BA 1CQMA 1T3OA 1KQFB 2VOOA 3QMQA 5DS7A 2CXEA 2ZZTA 4XTTA 4QQBA 3WC0A 3MEGB 1NKBA 2XNRA 1RLDA 1GXLA 2CQ4A 5J2QA 4NZ7A 1X4FA 3KLGA 2XMVA 1BQMA 1FD8A 4YY3J 3EX7B 4IFVA 1JKHA 2HWIA 1ZETA 4LRBA 1FDBA 1N34F 4F2RA 3BN7A 1JLQA 5EDWA 2NXEA 2FJBB 3IP0A 4WJBA 4DSFA 1FE0A 1OSCA 2BEFA 2LQBA 2EFGA 2XG8A 4ZP7A 4CO0A 1QLNA 1BHNA 2EW9A 2P5VA 4DR4F 1X60A 2RSQA 5D3GB 3KK2B 4A8YA 5HP1A 3AJ2A 2E1MC 1PJ7A 1BLUA 2E1RA 4ZVFA 3FSIA 4ZVTB 5HLFA 1LW2A 2FDNA 2VASA 3ENAA 2CVIA 2ZUAA 2OSQA 4M5HA 4RW6A 4AQYJ 3TI0A 4IRKA 3BDEA 2FTRA 3G8QA 3MGJA 2XMJA 1DLOB 4P71A 3FMWA 2EG2A 2MLXA 3HVWA 2CPHA 2HQGA 2OJ3A 3QLHA 3QO9A 2VIHA 5T7LA 3HZGA 3OFFA 3D6MB 1Y00A 5HAOA 5I42A 2I2YA 2DGWA 4KBIA 3NY0A 1KR4A 2H9ZA 1SVDA 3WHIA 1U1RA 2B8QA 3EZ5A 1VQ7S 3HD1A 3E51A 2Z57B 3M2RA 1B0TA 4PR6A 3MM8B 2H4YB 1GXUA 1FFSB 8RUCA 2LEBA 2DITA 1WC5A 1GX6A 2L9WA 3BH7B 3FCHA 2ZUGA 1RA7A 3QWPA 4J9UE 5KAKA 3RBZA 3HXMA 1K1SA 4LFCF 4EBDA 1FJGJ 4P2SA 3QT8A 2NREA 1ZA1B 2F3JA 4I2PB 4KHPJ 1HYSB 2Y1LB 3D1HA 2EI5A 1NPKA 1Y3JA 2ZBPA 5M2PA 3QGGA 1RKJA 3NL0A 1C1CA 1VQSA 1S6OA 4ZJOA 3F0NA 1ZTWA 1IBLF 2KTQA 1CJUB 3HVAA 5KFVA 2AJ1A 3NS7B 1M1KT 1M5HA 3KFWX 4TQSA 1YJWS 4CRJA 1HD1A 2HK2A 1TMJA 2N82B 1RAJA 4DR4J 4CTAA 1YRTA 1S0NA 2VODA 4ZCLA 1R27B 2D3OR 1HKAA 2OIHA 1HMVB 2XMUA 4ED8A 4DSLA 2XS5A 1RT6A 3ADAC 4NXMJ 1FRJA 3FEZA 1N32J 2P9GA 2HGLA 2CQHA 4HI1A 2JDJA 3G71S 1NK8A 2F8EX 4Q43A 2LEAA 4DV6F 2C2ZB 3I0SB 2XGQA 3NCPA 5KT2A 5HK4A 3GJQB 1Q86T 4I67A 3KWMA 2OPQA 5IV4A 1RT7B 5CH7B 3MR3A 1S10A 1U24A 1M5KC 1UEVA 5AE3A 5F9NA 1RK8A 4OHXA 4RJVA 2R7QA 3MMJA 3P45B 4O3RA 2DJWA 1AT1B 3NKYA 4PG4A 1ZAWA 4BBYA 4JOUA 3EPIA 2OPSB 2BANA 5DQIA 1T9WA 5L1KA 4GO7X 3EJMA 1QVGR 3NBPB 3AB2B 2XHWA 3MPWA 2DGOA 5CYMB 4Y00A 3J81Y 4WK1A 4G1IA 3BM7A 1WDTA 1TUVA 3KLEA 2R7VA 3CJ0A 4FYVB 2OH2A 2G0JA 2H4WB 2M8DB 3B8HA 1VGYA 4K7QA 1VQ8S 3V4MA 4QYZJ 1VHIA 4ILLA 2J0WA 3M30B 3IR6B 3ISND 1LWXA 1TL7B 1FXDA 3IR5B 1T7PA 1R7IA 3T41A 2GFFA 1HI8A 4J9KA 5H9FK 3RG6A 1TL4A 4ECWA 4OX8A 4ZDNA 3PYEA 1F5AA 1JLEA 3H8YA 3ENQA 4OI2A 4DN9A 1N6QB 3CMQA 1GMWA 2XS7A 4AL5A 2BKOA 3HI9A 3MCMA 4N77A 2N3OA 1FXLA 4U95A 1IQZA 4M8LA 1PYTA 2W2QP 3IA0A 2JWNA 4LRAA 1VIXA 5HANA 6AT1B 3PR5B 1HWJA 2AZ1A 2HURA 2W9BA 1H7XA 3TP2A 1TUGB 2XSJB 3W2VA 1FKOB 2CJYB 4CO4A 5K5MA 2M5YA 4OYPA 2CZ9A 3BQ1A 2OSRA 2IM1A 3SSRA 3HX9A 3C66A 2XCAA 3GR1A 1QD1A 3R5GA 5E7OB 3BKFA 4F0KA 3KUHA 3MR7A 4HHUA 4MK8A 1FXRA 3IBWA 4QYZK 1P1TA 2EKNA 3VALA 1SJFA 1I3OB 3WDOA 3MTJA 3R3TA 1KVIA 2GV1A 3DLJA 1GFWB 3H0PA 1AUDA 2UUCF 4WXOA 5IT9Y 4OZ5A 2XZWA 4ICLB 2DNYA 1L3UA 2Q79A 4L72B 4WYLA 3GIJA 3KLVA 3V4IB 4Q0BB 4YUDA 5LXYA 1YJRA 2BACA 3PRVA 4NPOA 4Y34A 4UQGA 4JI4F 4G3IA 1KNZA 1PBUA 3PJ9A 2Q66A 5KOWA 3HK2A 3VTIA 1RYSA 1DLOA 1U0SA 2W25A 2YWFA 4KHPF 1TAUA 1K0TA 3M32B 1UCNA 1D09B 1U2RA 2FJAB 2C3PA 2V6AA 2Z58B 3DOLA 3NAHA 3LP1A 3M2VA 3OTCA 2NPIA 4LF9J 1O5JA 3VAMA 1ZZNA 1A9NB 1LKZA 1H2TZ 5A8RA 1CPZA 3HHNB 1LXNA 2CNOB 5BJRA 5D4PA 2G1HA 2VZ9A 3DLEB 4B3RJ 3FEYB 2NUHA 4NLVA 4OX6A 5E5NA 3BSOA 1RKIA 3QIPB 1NUEA 1URRA 5FLXU 1KKHA 3LGNA 3BF4A 1BD6A 4IFVB 2DIUA 4I6AA 2DNHA 1VYAA 1QUPA 2HRTA 4A48A 1L3SA 3H2VE 2C2NA 1XC9A 3ILOA 2LECA 2IY5B 4Z37A 3DRRB 3EGNA 1REVA 2GJ2A 1ROFA 4MKYA 2WW4A 1HBMB 1WEZA 2V8HA 3BB5A 4OZ2A 4TU7A 3OT9A 4ECYA 4HDGA 1JIHA 3M8WA 1G1XA 4R8UB 2DGXA 3EDQB 3V2UC 2BRLA 2HHPA 2W4CA 3PYFA 2L9NA 4NZ0A 2DR6A 4JI2J 2E9RX 3M8PB 2Z2MA 4BC9A 2XYGB 4WF9Q 2V68A 3DLEA 3JTNA 4OJ3A 3HSDA 2VPYB 2BQUA 4NMXA 2W2NP 1JJ2R 1OY8A 4EMDA 1UP1A 2P9EA 3A8KA 3UR0A 3BBBA 3H42A 5CXTA 1RA6A 3UCZP 3JXOA 4ERDA 2XCPA 3JQMA 1R43A 4PABA 2V4QA 1N88A 2R7WA 4MJKA 1BXNA 1WUUA 4ZN3A 4PYDA 1AA1B 1M0SA 2UU9F 3M6XA 1UW9A 2UV8G 1JXLA 2E1CA 1AFIA 3HSZA 1S6PB 3UDVA 5DZ7A 2G13A 2LDYA 4C48A 4FVMA 5CCLA 2MZ1A 2MB0B 4DFPA 2P9CA 3R6LB 4RLEA 4CQ1A 2P8IA 1RHRB 1UVKA 2WK4A 3GG0A 4OYZA 1S9FA 1KVJA 4QIFA 1A0OB 4WFZA 2W9CB 2QJ3A 5MLCV 4DR5J 1Q16B 1IN0A 2MKKA 2W24A 3D3CJ 1Y4ZB 2WCXA 5DDRC 2XLJA 4M94A 2VFSA 3EVOA 2HRUA 2BXJA 2YPYA 4OYIA 2ZWPA 4WFNQ 2ZZMA 5I3QA 3RW7A 1WTFA 1LK5A 2KG0A 4UY85 4XAKA 3R7NB 1QAXA 2E5HA 2QMXA 1TL7A 4CH1A 3J81j 1S99A 4X2BA 3TJAA 4KV8A 2BBEA 4IH7A 3I56S 4JI7F 4L76A 3ZFVA 3Q8UA 4IH6A 1R6VA 3PJWA 2Z2YB 4C3KA 4PZVA 1WC0A 2HHTA 4IR9A 2J7UA 1CG2A 4OI6A 1HNIB 1OPZA 3KLGB 1DARA 2JFDA 2E5GA 3OXGA 4F3MA 4N8OA 4P9SA 4NCGA 4C0HA 1JLAB 2IJRA 4OZNA 2ZITA 4NWBA 4LUBA 4CLLA 3CT9A 4MAKA 4ED1A 3DRSA 3NMAA 5J1NA 2AF6A 2YX7A 4J90A 2MJUA 2VG6B 4FNIA 2V2KA 2EC0A 1GMWD 2ZOGA 1UAWA 1HBOB 2BZ2A 2GGPA 5CYMA 3F41A 3W2WB 3DHWC 2MZRA 3I32A 2CJXB 1VLOA 4CI0B 2JSXA 1HI1A 2MSSA 5E3PA 3R1HA 2VUGA 2RJZA 1N5YA 1R8CA 2DYAA 2JRSA 2LXIA 4M1KA 3QAUA 4B9UA 4PG6A 4JV0A 2UUWA 4DX8H 2QLWA 4F36A 4J9SA 3HT0A 1SJ3P 4EZ9A 1WKLA 4QR0A 4UOCA 3EMTA 3OBIA 3VZIA 3P3DA 2MQOA 4DV2F 3PCOB 3ZTSA 3C16B 2OPQB 4M5IA 5A0YB 1K9MT 3TZXA 3ETMA 4RW7A 1WJ9A 1NDPA 1S1TB 2P6SA 2JVRA 3VQSA 1L3TA 4F8RA 3K17A 4YR2A 4QIVA 2QIFA 1RYRA 2OPRA 1IWGA 4JI6J 5GAEI 3BQ0A 2B7CB 1YG0A 3C6TA 3IG1A 3M9MB 4DV0F 4LF2A 3TRGA 2WONB 2WVDA 4PG7A 4ZLJA 2ZJQQ 3PFEA 5L46A 4X64F 3I5BA 4TLRA 2WZ1A 1LXJA 2FVQA 2RS8A 2ASDA 3FRYA 4PWWA 3PM9A 4TN2A 4DQQA 3DLHA 1CC8A 2QZ8A 3Q8PB 1TR0A 4NCAA 4ED5A 1YLXA 1P1LA 2KYXA 2MY7A 2RT3A 4DFMA 2C3UA 1SCJB 1HHQA 2QSFA 1UEKA 2HNDA 3EVWA 1BE4A 4DSIA 3DOMB 3A13A 2M0GB 1TKXB 2RE1A 5D6GA 2ZM6F 1TKZA 1YHQS 2PMWA 3DKDA 1SC6A 3A8JA 4ZPWR 1YJTA 3R8YA 2UUTA 2MSTA 1HW9A 5JUMA 3CMAS 3BGRB 2HMIA 1QE1A 4RW9B 1S72S 4NRTA 2E5IA 5E41A 2FVPA 1RAFB 4NL5A 1U1QA 5J2MA 1BQMB 1MWQA 2HQDA 4J7CA 4ID8A 4PQAA 2C1EB 4K2XA 4FS1A 4NLTA 2DH7A 1VJWA 1TELA 1TK0A 4J91A 4YHHF 2JX2A 2UUCJ 4O3SA 3MMCB 3MM5A 4LQ9A 4AT1B 1Z1ZA 3M8RA 3OPKA 4ILMA 4O3QA 3DI6B 2DY9A 4A4JA 4DR2J 2XY5A 4J9OA 1ZOTA 2BDPA 1NSQA 3FGVA 4X84A 3VF0B 4N8NA 3ZZOA 1TZ0A 2IRXA 2J8AA 3JSMB 2QSWA 1TKXA 2EK1A 1X0FA 4M95A 4NLDA 4RBUA 3ITHB 2GX8A 1CQNA 3QRRA 2EEYA 3HZEA 3TUJC 1Q8IA 3F73A 2MDAA 3EWGA 3MEGA 1RAHB 4NYPA 3GQCA 2AJ2A 3SDEA 2JEIA 3DRRA 1X0PA 2YQ0A 3F56A 2VPWB 1NXIA 3LAKA 5JVHQ 1Q5VA 2IDLA 4USUA 1VQOS 1HARA 1RTIA 2J5AA 2RMLA 3KG1A 4CH0S 4RNFA 4DF8A 4C9DA 1VBXA 2CPIA 5HROB 1KFSA 2V69A 3OL9A 2HQ3A 4NLPA 2B4UA 4RL1A 5J2QB 2C2OB 2DGSA 2ASJA 4TQRA 1NHVA 1GTEA 5KFQA 5A2QY 3UI3A 1UJ4A 3RUBL 4KSEB 2XZDB 3MPVA 1FRHA 3CF5Q 1EQ0A 2HHUA 1RT4A 5EN1A 4EWTA 5E0OA 4N47A 3NXZA 2CQ2A 3V6KA 2XI2A 4B3MF 3RRKA 4QPTA 5LSRA 3TA1A 3AQPA 2IPOB 2XWYA 3W8PA 1NK0A 4HTIA 4DU7A 2LEPA 3CCJS 1RTHA 2B0GA 2NYHA 2PMHA 3RAMA 3ENWA 3SCLE 2YTCA 4FYYB 1PKUA 2J0XA 4XDDA 2GHVC 3JB9k 2ZH9A 4UW2A 1Z2ZA 3V6HA 2YWEA 2EWHA 4YEAA 4TYBA 5F3ZA 1DQAA 2NSBA 3BYRA 4O4GB 3SDEB 5GAHU 2DR7A 3HKWA 2MPUA 2W2OP 3S7RA 1NAQA 5DM7Q 3H5UA 5MAOA 2R8GA 1SJQA 2GIFA 3UNYA 4C11A 1TL1A 1AYEA 3ZTPA 2HRYA 4GVBB 2W7OA 1N33J 2F7VA 1N33F 4LBIA 4CYUB 4K8RA 3QSYB 2E9TA 3FQLA 3KJVA 4X4NA 1VCTA 2QMWA 3W8GA 3AAWB 4DSKA 1RABB 5ITHA 3RRGA 4WZMA 2HZCA 3OSPA 1FK9B 4CM2A 3TO8A 1FT8A 1SQEA 2CG8A 1JNZB 4DPWA 2KKHA 1HWUA 2WB1D 4DS4A 2RNEA 1X5PA 2DGTA 3BEGB 2YKPA 3I9ZA 5J1EB 1GMUA 2HSEB 1HNVA 3UD5A 3Q86A 5KG7A 5LMNF 3H5YA 7FDRA 2E5JA 1OO0B 2ZEJA 1E6YB 3DU6A 1FTCA 3T1AA 1S0OA 1VC5A 4CP5A 2V0NA 4MIBA 3PX4A 2QYGA 3G2XA 4KV8B 3G8TA 4FP9A 2FZGB 2F8MA 2WOMA 2IVMA 3MUVP 4DPXA 1D3WA 3LW5C 4UF4A 3DU5A 4JI5J 1AFJA 1W7WA 1FEHA 4LSLB 3SIPB 1N52B 1UFKA 3AA8A 3W66A 2HHVA 3FFIB 2UXCF 5HQ8A 3R6GB 2QEXS 3NGUA 1B7YB 1GEHA 3S6EA 5KG5A 3SI8A 4J9QA 2QLBB 5BR8F 3GP9A 4NRUA 1PAUB 2FGOA 2LLZA 3RR8A 4DV3J 3MMAB 1T95A 4IR1A 1WC6A 5FLXY 2QV6A 2DTJA 5FDLA 1WOSA 3BJYA 4RW8B 2Z30B 1LV5A 3Q2TC 3OV7A 4FF4A 4K50A 1NDKA 2BUNA 2YNFA 1TQLA 1NK6A 2CQDA 2H54B 4KO0B 1U45A 1I6JA 3EDRB 2E5LJ 2B4PA 4UZCA 1TV6A 1YIJS 3NNCA 4H4KA 3LF0A 2ZOFA 4HH0A 3UNGC 2DH9A 4DS5A 1X5SA 1UA1A 1TFYA 2Y8YA 3C46A 3N4WA 3MF5A 1VRQC 4EBEA 4ANDA 2FZKB 3RB4A 1B7FA 1TKDA 3OJUA 1VIOA 1C1CB 2QA1A 2IHR1 2ZVSA 3TOQA 2XBPA 5HROA 4OYWA 2HFNA 4ZPBA 3DOLB 3D6HB 3H40A 1S4FA 4RUHA 5A8KB 5C42A 3EGZA 2OEMA 4KRWA 1FO1A 1NSKL 1RT2A 1SUQB 3H90A 2I6WA 3MD1A 3OLAA 4C8OA 2Y3YA 2CDQA 4WP8A 3QQCD 1P9QC 1LOUA 1D1UA 5D8HB 3QGIA 3CJSA 4PPZA 1FVSA 3DLKB 3DOKB 2N7CA 2ZH8A 2C2MB 2AW0A 4O3OA 4WCEQ 1U1NA 1CS4A 3MI7X 5IQQA 4DBQA 3CO9A 1T94A 3P8BB 4JI3F 1W25A 5D4OA 2D74B 2RHSB 2C2DA 1TTHB 5CAAA 2M4MA 3NCQA 2DR8A 1F5CA 2FJWA 4XDCA 1EQMA 3C14B 4X62J 2Y8WA 4YB6A 2W8KA 4LF4J 2ABYA 2YNIB 2IVFB 1N4LA 2V8DA 5KFJA 4HKQA 4I2QB 3AODA 2YWWA 3ICLA 4LIWA 3OUYB 3GTYX 1N34J 3PIOQ 1F60B 4LF5J 4DEZA 4NASA 1WOPA 3QBCA 2HBYB 4O4RA 4OLOA 1QE1B 3FSXA 4RW9A 3SBMA 4WWSA 4YFUA 3KJVB 2XZTB 4KFBB 1ZPWX 2Q6CA 2HKEA 4F26A 5AT1B 2VONA 4K2JA 2FHKA 2R2SA 3ZTQA 1X5OA 1R8HA 4PEOA 3NGDA 2LXFA 3ULHA 1PG5B 2PIIA 3MMCA 4ZPVR 4U7UK 2RRBA 2XSJA 4KC5A 3PACA 3D2WA 3EZUA 5EX0A 2VH7A 3HMJG 1N0UA 2J6UA 4GKJJ 2HPUA 3JQKA 5KFGA 4CO2A 3PKYA 1N5TA 3KK1A 3HT3A 4B9SA 1JLEB 5KFNA 1RCXB 2WHOA 4DQRA 1ZTTA 5B7WA 4MKAA 1S9GB 4MYUA 3U1MA 3KK3B 2XMTA 4Y2IA 4FPIA 1Z4UA 3OHBA 1FKOA 5H9EJ 2WONA 4KR0B 5BYRA 2HZVA 5K9FA 2QE5A 5L9NA 2KFNA 4L73A 2DNZA 1HQEB 2ZH4A 1SJ1A 2LA6A 3MAAA 2MKIA 3G4SS 1NKCA 2CPZA 2ZHBA 4ZPDA 4TVAB 3K5LA 4F25A 3SXLA 5F8IA 2IJNA 4P2XA 4RBVA 4B17A 1VC0A 2BJEA 2L9DA 2V2VA 4HEA9 4H4OA 2VBXA 2R8HA 2OPSA 1MU2B 3BQ2A 1IBLJ 3LALA 2FC8A 3I55S 4C8YA 3DYAA 3KMSA 2J9DA 1X4GA 3T3FA 2DXFA 4JI1F 3UN5A 4ELTA 5A8WB 2XSFA 3QRQA 2ZM6J 3N01A 2CJQA 2FZCB 2MLZA 4KGKA 4WBFA 1KTVA 1N32F 1YWXA 3M6WA 1XMQF 3MFHA 4MKVA 2A3JA 3HVTB 3MCOA 5A76A 1IKWA 3ZXWA 1B99A 1SIZA 2BANB 1FVQA 2XMMA 4LFAJ 5AE1A 5KFTA 3HSJA 1M5VC 4RW4B 3C19A 1IXKA 2GA7A 4P10A 4O0NA 4ZVOB 3Q8RB 4UOFA 1V6HA 3W62A 4F04B 1FX2A 2H5JB 2X1AA 1M1GA 2PN6A 2BOAA 4FKYA 2DNGA 2NUUG 1QAYA 2J7WA 3CCUS 2UP1A 2QLJB 2VDHA 3JSMA 5E3RA 2WVBA 4JUZA 4ZIVA 5GVQA 3W64A 3RBEA 1X4CA 2DB1A 4JI8F 2XMKA 4C2MA 2W9AA 4JB8B 4J9VA 1TL3B 4DR2F 2ZE2A 1RZMA 2GS8A 2FGCA 3DDNA 4W90B 2C3OA 5I42B 4URGA 4TLQA 5HMXA 2Q1LA 3KMQA 2DGQA 4ZITA 2LA4A 3UD3P 1MW7A 2QFIA 1FRLA 1SL2A 2VG5A 3V5RA 4A8WA 3BKTA 3IWLA 5L38A 2V4RA 1J5EF 1UVIA 3ILIA 1M90T 4PG8A 1P9YA 2OGUA 3M05A 4NE9C 4ETZA 1LNQA 2V94A 1DTTA 3TARA 1TK8A 1V3ZA 2GW8A 2Y1JA 2HFVA 3GFXA 4P7TA 2J76E 1TL3A 3RYLA 4ENOA 2WTFA 4DL0C 1WORA 2WRMA 3TVKA 1UEUA 2XMAA 3M9NB 1ZYQA 1HPZB 3THPA 4JI4J 1SI9A 2UU9J 4V1Ak 4ZVRB 3MM8A 2ZC4A 4LT6A 1VBYA 5CA5A 2GJFA 2ILZA 4ES2A 3J7ZT 1C1BA 1KBRA 4EGLA 1C2PA 4I2QA 4YMEA 1A6LA 5DG8A 2DNQA 4CLFA 4ZLLA 4A8QA 1QUVA 4LF4F 3OD2A 1KSPA 2ACYA 5KT3A 5L9XA 1IKVA 4FVCA 4RX6A 1FERA 2I5JB 2R2RA 3IWNC 3G6VA 4LFCJ 3CCVS 2F1FA 5GADU 4IG3B 3CCES 2CVEA 3DM2A 2DPIA 1FJGF 4ED3A 1Q4RA 2KHCA 2EC2A 2IFXA 3R2CJ 5CQGA 2ZBIA 4DV1J 1U1LA 1CJVA 1T03B 5D3GA 2GVZB 4F67A 2MKHA 3MOJB 2KL8A 2XI3A 3KLIB 4OQJA 4A46A 2NS1B 2M70A 2AHOB 3C8YA 1NJXA 3DN9A 2DISA 1VQNS 3A3NB 1BY9A 3MMBB 2DRDA 1TL5A 2GGPB 4UUXA 3K5MA 2RU9A 2BR0A 3IC1A 4K5SA 1GT8A 2RILA 4M5KA 5A8WA 4ECXA 1Y7PA 4FZVA 3TA0A 4OZ1A 3T5KA 2HVEA 4DR1F 4LBPA 1FF2A 4P7VA 2A10A 2QT7A 1FHTA 1KQGB 1V5IB 2BMBA 1T05B 3PRBA 1VQYA 1UZDA 3HVTA 1FRKA 4UTGA 1WHXA 4E0DA 2W2MP 4LVOP 4CLZA 3GU0A 3HJVA 4E98A 5L1JA 2VD3A 2HIQA 3TX0A 4DX5A 3DCAA 1H0HB 1D9AA 1NM2A 1XMBA 3FZBA 4F3QA 4L74A 4PKDB 2RU3A 3MAQA 4OFZA 2APOA 4NLGA 2YKMB 3ET6A 4W4MA 5HSPA 2HG4A 3FK4A 3GV5B 1S49A 5E3AA 1DAXA 3MEEA 5G0RB 4FF1A 3UDLA 4ELUA 1SH2A 3NRBA 1HYSA 4B3OB 5KFCA 1NB7A 3HFVA 1PYSB 3T1YF 2AT1B 1F3VA 1RHQB 2C3MA 4O3NA 3PO4A 1R0AA 2ZHOA 4KAIA 4N5SA 1SIWB 3GSIA 4C0OC 2K7JA 3OFGA 4HDHA 3GR0A 3JYTA 1N6QA 3KTQA 1QAJA 1U8SA 1VS3A 1ZZFA 3E01A 3G87A 4HACB 5DM6Q 4LFBJ 2NQPA 1SC4B 3AJDA 1Y5NB 3ZNUA 1MN7A 2DHHA 1AZSA 2WOMB 3W2VB 3RR7A 3V4IA 2HNZB 4USJC 4KB7A 5F0WA 3SSSA 4MK9A 5JJBA 2XC9A 2AYEA 2RDIA 3US5A 5G0RA 2A6OA 3LH2S 3MCSA 1IBKJ 5EGYA 1EETB 2EFPA 2GIQA 2VBYA 3G86A 1R89A 2KT5A 3OXLA 1FKPB 4S0MA 4X65F 4DQIA 1RQ0A 4HT7A 1RWVB 3N5FA 2DNLA 4U9RA 3THTA 3S8SA 1XR7A 4QIEA 4DL6A 1XQIA 2HGNA 4CWBA 1HNWJ 1NHUA 3D67A 5HO4A 1MMNA 3VHQA 1EAYC 1RBLA 1U47A 2BJ3A 4CLWA 1HR0F 4ZIWA 5HP1B 3R5CA 1BWEA 3R5DA 1RTJA 4IOBA 3O5TB 4DR7J 3QPIA 1OYEA 2R4FA 2MQNA 5M2RA 3BO2A 2VDIA 2DRAA 2F4VF 2QA4G 2RKIA 3JSYA 3WQPA 4EK2A 3G6XA 2LU1A 4NI2A 2V9KA 4C8NA 3J80U 4DF4A 1EB0A 1XERA 1YJVA 2Z8QA 4CLUA 4KH0B 3L4BC 3V81A 1EX8A 4X4QA 1VQ5S 4B9NA 3P49B 2RUSA 2CG4A 4ZPCA 4GC6A 4MMOA 1RP5A 1HD0A 1XN9A 4H54A 4D3HA 3UCUP 2Y0SD 3BKUA 1VC6A 1FESA 1QDUB 1REVB 2ZKTA 3HHLB 3OVSA 3HCXA 4Z7CA 2F8HA 4P2MA 4WXWA 3CCMS 4U7UD 1B0PA 3PJXA 3VAKA 1AXQA 2ZD1B 3LGHA 3CJ3A 5D0HA 4RNMA 3OL6A 3QJLA 5AJ3J 3MM6B 2BE2A 2ZH5A 3KXDA 1ZAXA 1CS4B 2KXFA 1Y10A 1IKVB 2DHAA 3BSCA 1YK9A 2GHWA 3DYAB 1S6QB 5HVGA 3DGPB 4ZVPB 2BKPA 4FN5A 3TYTA 3H7HB 1S1WA 2IA6A 3MTKA 3M6UA 4KKOA 3UN2A 4QJVA 3N6LA 2IJFA 3VZHA 4TXSA 5IWAF 3DM2B 2PSZA 1RE1B 4I56A 3VAJA 3W61A 4JP8A 1RHKB 3CJRA 5B0BA 2HK3A 4LSLA 1O51A 5KFHA 2KJVA 5KOXA 1DY3A 5C24A 2OEKA 1WF1A 4J5OA 3OVBA 5T41A 3AXKA 4Y2CA 3MM6A 4F4WA 1B3TA 1S48A 2X3GA 3HHLD 1NNDA 1IM6A 4DSEA 3O3LA 2X1GA 4UQTA 1UTAA 2VA3A 1MNEA 2GCFA 5IC4B 3RU0A 2XY7A 1GH8A 4ITSA 1JB0C 1R0CB 1FFGB 1RAIB 3H59A 3MHYA 4NLYA 4DV4J 1G2EA 1YX2A 2PC6A 3Q83A 3GCXP 4Y2AA 3OR2A 1FE4A 2YNFB 3IWXA 4B08A 2H5EA 4NA3A 5B08A 4X66F 1EKSA 1HBNA 1EZZB 2MGZA 3UDCA 2PGCA 4CLTA 3SQGA 4CDIA 2FLLA 1RDRA 3CD0A 3NOCA 3EXCX 2AWZA 3KUGA 5IXUA 4WE1A 3DRYA 4IFYB 2YBVA 1FFWB 3RZAA 2ALYB 3GFHA 1IBMJ 2JEJA 2C2KB 4W92B 4QIWD 4LF8F 3IRXB 1TAQA 4K4SA 3HVRA 4F3OA 2YQ1A 3PX0A 4A8MP 2LU2A 2CDRB 3LA0A 4DZDA 2VQEJ 1YZ7A 3MFIA 3Q23A 1WACA 3TR5A 2V9WA 3MR6A 3D3BJ 2XMWA 5D78A 1OQ3A 3D9BA 4P75A 3EVMA 3O6QA 3QO9B 3C14A 2NXUA 1LEOA 4DV7J 4BWJA 2CNNB 4OZLA 1IUJA 2FVCA 2R7RA 5DJBA 1C0TB 3SSQA 5D4NA 2I8EA 4GVBA 1YITS 4HR2A 2HNZA 4HTJA 2LQ5A 5EWGA 2I38A 1IKYB 4LRCA 1KHVA 1NJZA 3IR7B 3NWGA 4ED4A 3NGKA 2Z2ZA 5EUHA 3J7YI 3T6JA 3VR1A 2IVYA 2KU7A 3EGWB 1HHTP 3UVJA 1UPPA 3IM8A 5G4DA 2MKJA 5HI7A 3UCGA 2DXEA 2LQJA 2KJWA 1RWXB 5KT4A 3CC4S 3N0VA
chains in the Genus database with same CATH topology
1BUXA 1XQIA 1LWXA 3BBCA 4W98A 4ANCA 1NSKL 2HVDA 3NGTA 3VVUA 3EM1A 1F6TA 3MPDA 3GPAA 4EK2A 3Q8UA 5C7PA 1NLKL 2AZ1A 2HURA 3FC9A 1NHKL 3BH6B 3BBFA 4DI6A 4ENOA 2B8PA 5CAAA 1S5ZA 2BEFA 1WKJA 2DXDA 1BHNA 1S57A 1B4SA 3JS9A 3Q89A 3ZTOA 2VU5A 3ELHA 4DZ6A 1K44A 1PKUA 3DDIA 4ANEA 3VGVA 3NGSA 3ENAA 2ZUAA 3B54A 3PRVA 3WX8A 2DYAA 3PJ9A 1ZS6A 3ZTQA 4F36A 1XIQA 1PAEX 1S59A 1WKLA 2NCKL 1UCNA 3EMTA 4UOHA 3ZTSA 3ETMA 1NDPA 2B8QA 3ZTPA 4KPCA 4FKXA 1EHWA 1WKKA 3FBCA 3R9LA 3BH7B 3FBEA 3L7UA 3Q8YA 1NUEA 3FBFA 5IOLA 2AZ3A 1VYAA 2BX6A 3FBBA 1MN9A 1U8WA 1NPKA 3VVTA 2HVEA 1NCLA 3Q86A 1NSPA 3Q83A 3NGRA 1HHQA 3EVWA 3VGUA 1BE4A 3EICA 3VGTA 4CP5A 3FKBA 3G2XA 3FCWA 1HIYA 3DKDA 1W7WA 4C6AA 4UOGA 1NB2A 3NGUA 4DUTA 5CABA 1NDCA 2DXFA 1F3FA 3GP9A 3ZTRA 3BBBA 1JXVA 4WBFA 3EVMA 1NDKA 4F4AA 1LEOA 5BXIA 1B99A 2DY9A 3B6BA 1NDLA 2CWKA 1NSQA 3VGSA 3EJMA 4HR2A 1MN7A 4O0NA 3Q8VA 4UOFA 1KDNA 4FKYA 4ANDA 3FCVA 4S0MA 1HLWA 3EVOA 2DXEA 3EE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUX A;  1XQI A;  1LWX A;  3BBC A;  4W98 A;  4ANC A;  1NSK L;  2HVD A;  3NGT A;  3VVU A;  3EM1 A;  1F6T A;  3MPD A;  3GPA A;  4EK2 A;  3Q8U A;  5C7P A;  1NLK L;  2AZ1 A;  2HUR A;  3FC9 A;  1NHK L;  3BH6 B;  3BBF A;  4DI6 A;  4ENO A;  2B8P A;  5CAA A;  1S5Z A;  2BEF A;  1WKJ A;  2DXD A;  1BHN A;  1S57 A;  1B4S A;  3JS9 A;  3Q89 A;  3ZTO A;  2VU5 A;  3ELH A;  4DZ6 A;  1K44 A;  1PKU A;  3DDI A;  4ANE A;  3VGV A;  3NGS A;  3ENA A;  2ZUA A;  3B54 A;  3PRV A;  3WX8 A;  2DYA A;  3PJ9 A;  1ZS6 A;  3ZTQ A;  4F36 A;  1XIQ A;  1PAE X;  1S59 A;  1WKL A;  2NCK L;  1UCN A;  3EMT A;  4UOH A;  3ZTS A;  3ETM A;  1NDP A;  2B8Q A;  3ZTP A;  4KPC A;  4FKX A;  1EHW A;  1WKK A;  3FBC A;  3R9L A;  3BH7 B;  3FBE A;  3L7U A;  3Q8Y A;  1NUE A;  3FBF A;  5IOL A;  2AZ3 A;  1VYA A;  2BX6 A;  3FBB A;  1MN9 A;  1U8W A;  1NPK A;  3VVT A;  2HVE A;  1NCL A;  3Q86 A;  1NSP A;  3Q83 A;  3NGR A;  1HHQ A;  3EVW A;  3VGU A;  1BE4 A;  3EIC A;  3VGT A;  4CP5 A;  3FKB A;  3G2X A;  3FCW A;  1HIY A;  3DKD A;  1W7W A;  4C6A A;  4UOG A;  1NB2 A;  3NGU A;  4DUT A;  5CAB A;  1NDC A;  2DXF A;  1F3F A;  3GP9 A;  3ZTR A;  3BBB A;  1JXV A;  4WBF A;  3EVM A;  1NDK A;  4F4A A;  1LEO A;  5BXI A;  1B99 A;  2DY9 A;  3B6B A;  1NDL A;  2CWK A;  1NSQ A;  3VGS A;  3EJM A;  4HR2 A;  1MN7 A;  4O0N A;  3Q8V A;  4UOF A;  1KDN A;  4FKY A;  4AND A;  3FCV A;  4S0M A;  1HLW A;  3EVO A;  2DXE A;  3EE3 A; 
#chains in the Genus database with same CATH topology
 3MUR P;  2GAH C;  1RTD A;  1G6B A;  4G1Q A;  1BQN B;  4YS2 A;  5I3P A;  2AGQ A;  4QIG A;  1X5T A;  3UQS A;  3DMJ B;  1RTH B;  2D9P A;  1UW4 A;  3GJR B;  3KNA A;  1XWL A;  1Y5I B;  2QO3 A;  4LRF A;  1X9M A;  2Q43 A;  3CDA A;  3D7S B;  2G2O A;  4BC7 A;  3OSN A;  3ENV A;  2OTL S;  4FYX B;  2D7S A;  5KFL A;  4CM0 A;  1KHW A;  1RWO B;  3M1V B;  3RAQ A;  3C6U B;  2K1R A;  1OSD A;  1QY7 A;  1R0B G;  2A2C A;  3GJS B;  3C15 A;  3IMQ J;  1SH3 A;  4Y65 A;  5T14 A;  5BR8 J;  1FRM A;  2UXB J;  3D66 A;  4FYW B;  2ERR A;  2PI4 A;  1Q5Y A;  2QL9 B;  4HHJ A;  1OY9 A;  4I0W A;  1HNW F;  2KDO A;  5DLF A;  3I6P A;  2MY8 A;  2K8G A;  2KHD A;  3DRP B;  3SCK E;  1RAE B;  2K3K A;  2E7W A;  5FDL B;  4YB1 P;  1RWW B;  4OYM A;  5AE2 A;  3DLB A;  5B0D A;  6FDR A;  4FYD A;  1VRT A;  4LBH A;  5IT4 A;  4X66 J;  2KH9 A;  4RZR A;  2RQ4 A;  4ECU A;  1C4C A;  1WHY A;  4OX9 F;  1VBZ A;  5E33 A;  1DQ8 A;  2RQK A;  1PYO B;  4DFK A;  1NBE B;  1L3K A;  4C8L A;  4NZ6 A;  2J9C A;  4U96 A;  3MAA B;  3QSI A;  2HFO A;  3B4D A;  1LWE A;  4TNO A;  5M2U A;  4C7Q A;  1PBA A;  1V9O A;  1XIQ A;  3IBF B;  2L41 A;  1SJR A;  2E29 A;  2HFS A;  3QYY A;  5CYQ B;  5HBM A;  2EFQ A;  5ETN A;  4DN0 A;  4ZHR B;  2XO6 A;  4DLE A;  3LP0 B;  4X64 J;  2BQR A;  4L3N A;  2YWG A;  4DL7 A;  3BSN A;  2NLW A;  2ZZN A;  3CED A;  4UST A;  4KPC A;  1U25 A;  1S9G A;  4WZQ A;  1SV5 B;  3DI6 A;  2XLK A;  2O66 A;  2NXN A;  4MYT A;  3TUI C;  4B3T F;  4NCB A;  2D3Z A;  4DCP B;  1KWM A;  2HQF A;  1QTM A;  2V50 A;  3FBE A;  1FK9 A;  1QSL A;  3ISZ A;  2D9O A;  5CZX A;  2DEJ A;  2DVI A;  1Z2L A;  3MPU B;  4CO5 A;  3O8W A;  1S9E A;  4ILR A;  3I31 A;  1YJ7 A;  4LF8 J;  2BX6 A;  4QWE A;  1MN9 A;  4DQP A;  4DWI A;  3DXS X;  1D0E A;  3D28 A;  2P2C B;  4JI8 J;  1YBA A;  2KZM A;  3MED B;  3RB0 A;  4OHY A;  3OR1 B;  4LSN A;  4KH1 B;  3L7O A;  4FXV A;  2NPF A;  4J9P A;  3FRZ A;  1B70 B;  3NGR A;  2DNK A;  2MHN A;  4URQ U;  1R8B A;  4HT5 A;  1CBK A;  3QT6 A;  2VPZ B;  4OL8 A;  2RH3 A;  3NAI A;  4DV3 F;  5KFD A;  2ZHA A;  1C0U B;  2MEW A;  5SUH A;  2KI2 A;  4DJB A;  1KVK A;  3GON A;  1RWU A;  2PMZ D;  4YR3 A;  3Q8S B;  1X9S A;  2BJD A;  1NEE A;  3A8E A;  2M8H A;  5K14 B;  3GCW P;  3W9J A;  3VAH A;  3HHE A;  5GMD A;  4YQW A;  5J2N A;  3V6D A;  3P6Y C;  5LT5 A;  4WP3 A;  2MQM A;  5DRK A;  1HNZ F;  1IKX A;  4ZP6 A;  1H72 C;  2EPI A;  4AFF A;  1H2V Z;  1VI7 A;  1PJ6 A;  2ZE2 B;  4XK8 C;  2MQP A;  3VQT A;  4HL9 A;  5FJ4 A;  5GAG I;  2OLW A;  3KDO A;  2KFZ A;  1O8B A;  1U26 A;  2BE2 B;  1NDL A;  2CWK A;  2X7I A;  2W1B A;  1IWA A;  4K4Y A;  1YVF A;  2W4D A;  4LR7 A;  2JEG A;  4DG1 A;  1QTN B;  4NLS A;  3LUY A;  2R8I A;  3RB3 A;  1KEK A;  3AOB A;  1Q8B A;  3L9Z A;  1RI7 A;  2LQ9 A;  2X1F A;  1ZM4 A;  3BPS P;  1PIL A;  3M6V A;  4IQM A;  4J9L A;  2HS0 A;  2CQG A;  3MEC A;  1S6Q A;  2DNM A;  1YSJ A;  2K7K A;  5IT0 A;  1XMO J;  1NJI T;  4NLX A;  2DGU A;  3RJM B;  1B64 A;  2WSF C;  3JTO A;  2JNJ A;  1M1H A;  4WKY A;  3TAN A;  3UR3 C;  4F0M A;  1I94 J;  1CLF A;  4YN3 B;  2CZV C;  4UY8 T;  1BQN A;  2QL7 B;  3PYD A;  4M5D B;  4RBT A;  3U7J A;  2VG6 A;  3QAT A;  4I68 A;  3VV2 B;  1S0V A;  3KKF A;  2RVJ A;  2HFU A;  1IBC B;  2GAG C;  4OV6 A;  4DR3 F;  4DLG A;  2ATC B;  6FD1 A;  2OAU A;  3PW7 A;  4PUO B;  1OYD A;  3TAQ A;  1BQX A;  1WTB A;  4OMF G;  1I5O B;  1RAO A;  3EZO A;  1H98 A;  4PXB A;  4NCG B;  5DO2 A;  4Q44 A;  3OVA A;  1DFD A;  3EUN A;  3TZZ A;  4RU9 A;  3D0H E;  2U2F A;  3KHL A;  3MPY A;  2FHM A;  4LF5 F;  2VG7 B;  3QGH A;  1Q0N A;  1RCO B;  4IYQ A;  1H6K X;  2MZQ A;  4FNH A;  5KFX A;  2VJU A;  1MWZ A;  4C8M A;  3NP5 A;  1XK8 A;  2R7U A;  2UUA F;  1S5Z A;  4WII A;  2V67 A;  4DPU A;  4JI7 J;  1RWK B;  5F8N A;  4QWB A;  2KXN B;  4KE5 A;  3I5A A;  4IUF A;  1KFD A;  8ATC B;  2YX1 A;  1EP4 B;  3DDI A;  4L6V 3;  5U47 A;  3VGV A;  4WK3 A;  4AD6 A;  3NCR A;  3SFU A;  2MKC A;  1WC3 A;  3TZY A;  1D8Z A;  3MUM P;  1JX4 A;  2M88 A;  3QGP A;  1GNK A;  3WX8 A;  4JV1 A;  2YY3 A;  2JFK A;  2V8P A;  2VPX B;  4NI2 B;  1RBA A;  4X4P A;  2XYP B;  3FUY A;  3MED A;  3DDK A;  3T1H F;  1U1O A;  4NXN F;  2CUY A;  2PFF B;  1LWC A;  2D1C A;  3NWR A;  4NOH A;  1H74 A;  1X4A A;  2OO4 A;  1MLA A;  3KDN A;  3RBX A;  3OL8 A;  2ZWO A;  1EJ7 L;  2W7P A;  4IKA A;  4K0K J;  3CJ2 A;  4CO1 A;  5EWE A;  2QLF B;  3PFO A;  1S6P A;  4FKX A;  3BO4 A;  4F2S A;  3W3S A;  3A3P B;  2VBW A;  3E01 B;  2D3O 1;  2ZJR Q;  1ACM B;  1YBU A;  2BKN A;  1YJN S;  1W2B R;  1HI0 P;  4X4O A;  4PUO A;  4LMZ A;  1R6Y A;  2QFJ A;  2EFO A;  3G82 A;  2KT3 A;  2R2U A;  4DV4 F;  2N4C A;  1T9V A;  2BW2 A;  3L7U A;  2B4V A;  2K1R B;  2XY6 A;  1WHV A;  2CWX A;  3CB4 A;  1NRK A;  2I9S A;  2J6T A;  4WYW A;  3OTO F;  4DR6 J;  3J81 U;  4ECR A;  1ZAV A;  4HVZ A;  4ZVE A;  1SPB P;  3AQO A;  2LMI A;  2AJ4 A;  1F2H A;  4H4K C;  4QU7 A;  1NK5 A;  4HAC A;  3JYT B;  1UWB B;  1S1U B;  3N6N A;  4EYI B;  1G4C A;  4LRE A;  2VHG A;  3DLL Q;  1NME B;  3AXM A;  3DHX A;  4ZMM A;  3PHT A;  3DLK A;  2R42 A;  2VQE F;  1HBM A;  3IAM 9;  2YNH A;  1VRT B;  1RT3 B;  3JSB A;  4X62 F;  1NK7 A;  1SL0 A;  4F4K A;  1N5Y B;  2IIH A;  3CO0 P;  3CDE A;  2OHD A;  3Q2S C;  3SCI E;  4PWD A;  4DUT A;  3HFK A;  4LR8 A;  4NLU A;  1U48 A;  1Q95 G;  1F3F A;  4OZ3 A;  4ZKA A;  3PW2 A;  3FMB A;  2UZA A;  2YKN B;  3BRE A;  3MAH A;  3MMB A;  1IKX B;  4RWW A;  1HNX J;  3CCZ A;  1PO6 A;  5C25 A;  2X51 A;  1R31 A;  1L5U A;  2DPJ A;  1T0T V;  1Y9O A;  1U0H B;  3IM9 A;  3W5Z A;  3H2L A;  1VK3 A;  1MRO A;  3S01 A;  1S79 A;  2GVZ A;  4M5G A;  3CME S;  3PKM A;  4LJM A;  2XNQ A;  2ZNZ A;  4CT9 A;  4Q0B A;  5KFP A;  1ULR A;  3R27 A;  4X4U A;  2DK2 A;  5LSO A;  3ITH A;  3TQ1 A;  2AEM A;  3IRX A;  1T9X A;  1NK9 A;  1TV6 B;  2E1A A;  2F5G A;  2VC1 A;  3M9O B;  4IFY A;  3R7S B;  1SB6 A;  2BA9 A;  3EGV A;  3I5C A;  3OR1 A;  3OTB A;  3O44 A;  3VWS A;  3GB0 A;  4ZCM A;  1LWF B;  3G6Y A;  4DR6 F;  4C4W A;  1RTJ B;  5D15 A;  4KGV B;  3B4M A;  2ROE A;  1JLG B;  1WG5 A;  2X3D A;  2ZVI A;  4M63 A;  4QZV B;  2HFZ A;  4HI2 A;  4ZLP A;  2Y1R I;  3HHD A;  4B3S F;  4LF7 F;  1UWB A;  2GQC A;  4DL2 A;  1S97 A;  2MTL A;  1EAR A;  2HMI B;  4QYR A;  4QWD A;  2W9C A;  2C2E A;  2YXL A;  3MEK A;  1NLK L;  3EYZ A;  2B43 A;  3QJJ A;  4NA1 A;  4IH5 A;  1EKR A;  5BYQ A;  4YDX A;  2Y0B B;  3QLH B;  2B9W A;  4MT1 A;  3IAS 9;  4JV5 J;  4V19 J;  4LSN B;  2PI5 A;  3MD3 A;  3D4J A;  1XTZ A;  2IM0 A;  3M8Q B;  3L3C A;  5IS2 A;  4LFB F;  1RJJ A;  1RAA B;  2VG5 B;  1W2I A;  2VFU A;  2MLY A;  2F40 A;  4I6W A;  2G0C A;  1UZH A;  2AMC B;  4EI2 A;  4RUC A;  2MMY A;  2AP6 A;  1X7V A;  1HWL A;  4LRD A;  4BHQ A;  4O0I A;  2UUB J;  2VFV A;  2EG1 A;  2RHQ B;  2YNG A;  3GJT B;  1F9F A;  3GFY A;  2Y1I A;  4R25 A;  3NGS A;  5CD4 A;  4GKK J;  1PC4 A;  4QCL A;  5J1P A;  3W7B A;  5HVH A;  1DJ0 A;  1FRX A;  2CRL A;  2HBQ B;  2OI2 A;  4C8Z A;  1CJT B;  1ZS6 A;  2OKQ A;  4QR2 A;  2RQM A;  3KJQ B;  1FNO A;  3P96 A;  2D41 A;  4PCQ A;  4JI2 F;  4U7C A;  3AT1 B;  1J5E J;  2F65 A;  1N5S A;  4H4M B;  4WFX A;  4ZHR A;  5HBM B;  1YJU A;  1RXO B;  1UET A;  1J2V A;  1CC7 A;  3CVK A;  3N9U C;  1JLB A;  4U8Y A;  2W4P A;  3X3U A;  5DGB A;  3K57 A;  3CCR S;  1LW0 A;  3TAP A;  1QSS A;  1UVM A;  4PQU B;  1BC6 A;  4B9M A;  1IKW B;  2QGF B;  1WKK A;  2LVW A;  4IG0 A;  3FBC A;  1UMJ A;  4K0K F;  4X4T A;  4FPR A;  1VQK S;  2HHH J;  1F5B A;  4M5J A;  1ELO A;  2AEF A;  4DG1 B;  4X4S A;  2XB2 D;  4CT8 A;  1N48 A;  2ZNY A;  2AZ3 A;  1JLC A;  3I0S A;  1CJT A;  1SKR A;  4PWD B;  4CNZ A;  4Z7Y A;  4WFB Q;  2CJA A;  1HQU B;  1NSP A;  2O1P A;  3LGM A;  3HDS A;  3QID A;  1D9F A;  3WIU A;  4DV7 F;  3H98 A;  3PO5 A;  2ZDO A;  2K3I A;  4M5D A;  1S1U A;  2E44 A;  1IKY A;  2KN4 A;  3R5A A;  4Q7A A;  3SV4 A;  3V6J A;  3LO3 A;  1C0T A;  3GYG A;  3DRX A;  1XNR F;  1S0M A;  1PIE A;  3GG1 A;  2CQ3 A;  3OQ2 A;  3KG0 A;  2NZC A;  1VK8 A;  3M7V A;  2VKZ G;  1UWA A;  2UXB F;  1JLA A;  1J5O A;  1PJ5 A;  5T7L B;  4DV2 J;  2DNO A;  3DFE A;  3AB4 B;  3D1O A;  3FVY A;  1T9U A;  4URS A;  4F7V A;  5DGA A;  1WC4 A;  4MH8 A;  3TVY A;  1V3S A;  4EU0 A;  3KOA A;  3S1T A;  3SEO A;  4ZS6 A;  2R8J A;  3BPD A;  3POT B;  3R97 A;  1Y0H A;  1VRU B;  2GVD B;  2HNY A;  4IDK B;  1LW2 B;  2AYB A;  2VFT A;  1U09 A;  4I69 A;  3BS9 A;  3LWL A;  4KHM A;  2VOP A;  2HEK A;  2QMU B;  3AHP A;  3BZQ A;  2MGZ B;  2BE7 D;  5KFI A;  4BWM A;  1KQK A;  4EO6 A;  5J2N B;  2V2Q A;  4DSJ A;  5HQL A;  2MXY A;  3H5S A;  5K14 A;  2HVI A;  4LFA F;  3GV8 B;  3G6E S;  4ER8 A;  3I96 A;  2DIV A;  9RUB A;  2BRK A;  3ZZZ A;  4DCJ B;  3J7Y U;  2KG1 A;  3LP0 A;  4WFA Q;  2QA2 A;  4K4W A;  2NSC A;  2DNR A;  3QFH A;  4K5R A;  3A8I A;  1FJE B;  3OW2 R;  4ANC A;  5DDO C;  1JLG A;  4ZJL A;  1ICE B;  3L09 A;  3VVU A;  4QW9 A;  3H4B A;  4A8K A;  1Q53 A;  5FII A;  1VJQ A;  4USI A;  1DHM A;  2HS3 A;  5EHH A;  1F6T A;  3QRP A;  4JI1 J;  3FDS A;  4WE1 B;  4K4V A;  3DLG A;  5C7P A;  1N36 J;  8AT1 B;  4HH1 A;  4E8U A;  2QTW A;  1U2F A;  5KFZ A;  3ZZP A;  4O3P A;  2E66 A;  2L08 A;  4AQY F;  3HJF A;  1OS5 A;  5AJ3 F;  1WSV A;  4X4V A;  4CO3 A;  4KGX B;  3QT7 A;  3T5L A;  5F41 A;  1S1W B;  1CJV B;  1UVL A;  2VB6 A;  1JLF B;  2PD1 A;  2HZA A;  2DXD A;  4M5N A;  5DZ6 A;  3SCJ E;  4ECS A;  2UVW A;  2HHX A;  2RQC A;  2DEI A;  3M2V B;  2VL1 A;  4CZC A;  2OFG X;  1PSD A;  5ETQ A;  3I4H X;  2YVS A;  1JJH A;  1WI6 A;  4CLP A;  1B0V A;  3W5Y A;  2IA0 A;  2EKY A;  2IC3 A;  1H2U X;  1FCA A;  1VOM A;  3B54 A;  4QWC A;  4HYK A;  1H73 A;  1RT6 B;  3CW2 C;  4DU8 A;  1IVZ A;  4PRF A;  1N54 B;  2A18 A;  3HUL A;  3W9H A;  4XPE A;  4E2F B;  2F4V J;  3CCL S;  1S59 A;  1U0H A;  5JVG Q;  4DR3 J;  1PGZ A;  2BW7 A;  2XM3 A;  1S1V B;  1RTD B;  5C42 B;  4C0B A;  2IBK A;  1Q82 T;  1WDD A;  1OQ6 A;  1XEZ A;  4F0H A;  1VQP S;  2V63 A;  1MMD A;  3RGI A;  4TY8 B;  3M2U B;  1TU0 B;  3KNG A;  5KG3 A;  5IWA J;  1T03 A;  2QYC A;  2CA9 A;  4ZVH A;  1DTT B;  2G1D A;  2NYI A;  4N76 A;  2HAF A;  2H5I B;  1HNV B;  1H7W A;  2B51 A;  4ATN A;  2XHC A;  3GIK A;  2JZ5 A;  2U1A A;  2I5J A;  4USK A;  4WFY A;  4P74 A;  1KS2 A;  2WSE C;  3L7P A;  3VGT A;  1KRP A;  1CEZ A;  2KXH A;  5F8L A;  1VLY A;  2LDI A;  1XJW B;  1WD6 A;  1SXL A;  2UVR A;  2IMW P;  1K1Q A;  3W60 A;  3K5O A;  2JH3 A;  4WTO B;  2FLN A;  3UD4 P;  1BGX T;  2OPP A;  3PYG A;  2J6S A;  4RUB A;  2JLG A;  1WOO A;  2QN6 B;  1TP7 A;  2DGV A;  3WX4 A;  3B78 A;  1EIY B;  3FFI A;  3I9V 9;  3FEX B;  1J27 A;  3OHA A;  4NXM F;  1UVJ A;  1N56 A;  2GML A;  5CCM A;  5K8P A;  2HLU A;  3PIP Q;  2IYG A;  2R3V A;  3KLH B;  3PW5 A;  3P4U B;  1FWK A;  1GMV A;  1WI8 A;  2B6A A;  3PG9 A;  4GO5 X;  2CKW A;  2B4O A;  2AGO A;  2CPJ A;  3K0J A;  1REG X;  1SV5 A;  1H3D A;  2DO0 A;  2FJE B;  2MJN A;  3B82 A;  1KN6 A;  4AXJ A;  3H2U B;  4P73 A;  1FKA F;  4IO9 Q;  5DDQ C;  1VQM S;  2RUG A;  1DBD A;  1Q79 A;  2GHP A;  3PHE A;  4A8X A;  3N5B A;  2Z56 B;  2E7V A;  2QL5 B;  4TY8 A;  4B9L A;  1ZM9 A;  2ZOM A;  2MZJ A;  2FY1 A;  3T5H A;  1UVN A;  4O4G A;  2OEJ A;  1FX4 A;  1HQU A;  3K89 A;  5H9F J;  3JSR A;  4ZPT R;  4FXD A;  2DBB A;  2FVR A;  1Q8L A;  4Q2M A;  3IGN A;  4DHV A;  2MQQ A;  5DQH A;  3PW4 A;  1FNX H;  4DX6 A;  3R5B A;  1SUQ A;  5F8H A;  1IJE B;  2VA2 A;  1M5O C;  3IS9 A;  4DXL A;  2WAQ D;  1X4E A;  2PEB A;  2RDD A;  5KT5 A;  1UKU A;  4LF6 J;  2RD5 C;  3EM1 A;  2O3D A;  3QWU A;  2IC3 B;  3MWB A;  4EYH B;  2R7S A;  1SC1 B;  1DTQ A;  3T1Y J;  3NNH A;  1F9H A;  3NG8 A;  1HA1 A;  2CQP A;  4NLR A;  4PWU A;  3PXG a;  5AXK A;  3C6U A;  2KO1 A;  2HHQ A;  4R5P A;  3RBD A;  2HS4 A;  2C42 A;  2LQ8 A;  1N36 F;  1FTR A;  1RLC L;  2IM2 A;  1YQH A;  4QBU A;  2OTJ S;  2VV5 A;  4GMK A;  4OI3 A;  4OIX A;  4YB7 A;  1L3V A;  2UVV A;  2YWH A;  5RUB A;  2R7T A;  5A6P A;  4WPA A;  1F2G A;  2CIM A;  3Q89 A;  3W1Y C;  2FQQ B;  1RB0 A;  3ZTO A;  4ECT A;  4AUK A;  1MU2 A;  2FVS A;  5L39 A;  5F8M A;  4DL4 A;  2KB2 A;  3AD9 C;  5F0U A;  4ANE A;  4DPY A;  2R8K A;  3CDW A;  2C3Y A;  3ISN C;  2CZ4 A;  2YH0 A;  2ZBQ A;  5D0R A;  5LSL A;  1Y5L B;  1W26 A;  3W9I A;  1APS A;  4OZJ A;  4X65 J;  3T5J A;  5LMU J;  1RAC B;  2DCL A;  4CNY A;  1SQF A;  2QG9 B;  2WBR A;  4ZK7 M;  2UVU A;  4GC7 A;  4G65 A;  4Q8E A;  2MQ8 A;  3UE2 A;  5ETO A;  2ZBC A;  2UUB F;  5CZV A;  2KRB A;  1K0V A;  4KQZ A;  7AT1 B;  1X4B A;  4EUV A;  2FIU A;  4DUY J;  5DDP C;  4OI1 A;  2HHH F;  4P6Q A;  2YNI A;  3AOC A;  4YR0 A;  2HGM A;  1I94 F;  1VBK A;  1Q7L B;  2BM1 A;  3PVX A;  2JVO A;  5GAD I;  3CPW R;  4AL6 A;  3KHR A;  3KG4 A;  1XR5 A;  2A2D A;  2FLO A;  2RRN A;  3LQV A;  3PNI A;  2HQI A;  2UXD J;  2AV5 A;  3OL7 A;  4JYA F;  5KT6 A;  4ZVU B;  2DKO B;  4MTP A;  2YWK A;  3U1L A;  2CYY A;  3CJK A;  3Q8Y A;  3U1N A;  3CJT A;  4ZCI A;  3PW0 A;  3FBF A;  1VFJ A;  5HLF B;  1YRX A;  3PEH A;  4BS2 A;  5J2M B;  4NYO A;  3H20 A;  3AH6 A;  3CCS S;  1SQG A;  3VVT A;  4OI4 A;  3OTD A;  3HO1 A;  2GIR A;  5D0E A;  2ASL A;  5CHC B;  1KTQ A;  4GKK F;  3CXC R;  1TKZ B;  3CDU A;  3RRH A;  1HWI A;  5C2C A;  1XMQ J;  2HWT A;  3W63 A;  1XR6 A;  5IC6 B;  5A8K A;  5LM7 E;  1YI2 S;  4GKJ F;  3IXQ A;  5J2P B;  7FD1 A;  2KFY A;  3DOM A;  2BE9 B;  1OMS A;  4JBC A;  1HNZ J;  3A4T A;  3OR2 B;  4DCO B;  3K7R A;  1IM4 A;  2CPX A;  3DGV A;  3P5B P;  4UOG A;  3NNA A;  4A47 A;  4C3L A;  3VAF A;  5F8J A;  4Y3C A;  5CD4 H;  2CPE A;  2I0X A;  5JXS A;  3BGR A;  5CAB A;  2W2P P;  4ZPA A;  4F4X A;  3C15 B;  1KQS R;  4RO0 A;  3TX8 A;  3GV7 B;  3G9C A;  5ETL A;  5IM0 B;  2X1B A;  1T9Y A;  5D0G A;  5A6W A;  4YB5 A;  2JC1 A;  4Q8F A;  4Y2K A;  5KFW A;  1VHF A;  4RR5 A;  3X1L B;  1S7I A;  1G3O A;  2B5J A;  1CJK A;  1X4H A;  2FD2 A;  2YKQ A;  4B3S J;  5LOQ A;  2VFR A;  3B6B A;  2HIY A;  3POT A;  3W2W A;  3IS9 B;  4X4R A;  3PDN A;  4EBC A;  1X9W A;  4H4O B;  4G1P A;  3Q8V A;  4MFB A;  3I0R B;  4UT4 A;  1DTQ B;  4RW4 A;  1FJ7 A;  3I87 A;  5KFK A;  4ZP8 A;  1RWP B;  2W7A A;  2KYZ A;  2AJQ A;  3QNW B;  1NH8 A;  1SC3 B;  3DRP A;  3M8Y A;  5K8M A;  3MM9 A;  1YKW A;  5DET A;  4H4M A;  4PG5 A;  3K58 A;  4IG3 A;  1FDD A;  2V5H G;  4LR9 A;  4RW7 B;  2LFV A;  3BBC A;  4NX9 A;  3LWM A;  3A1Y G;  2JHE A;  3ZZU A;  1E6Y A;  1Q78 A;  2A0F B;  2RRA A;  2FJV A;  4DV1 F;  4JI0 F;  3GYN A;  5HMY A;  3GPA A;  1FA0 A;  1HMV A;  4USV A;  4Z2X A;  2L48 A;  2CQ1 A;  4OHZ A;  4J9N A;  2ZC3 A;  1URN A;  2RAQ A;  3PZP A;  2AJF E;  3TAM B;  2CQI A;  4RUA A;  2GMJ A;  1IJF B;  1DRZ A;  1NHK L;  2DHG A;  2DHX A;  3MMA A;  5H9E K;  4DI6 A;  1FRI A;  2O01 C;  3GFZ A;  4G1Q B;  3QAE A;  2KZZ A;  1HPZ A;  2FHJ D;  3MM7 A;  1ZPV A;  1JK9 B;  2DY1 A;  1HQE A;  2MZT A;  1YDL A;  3CGI A;  3ILJ A;  1UJ5 A;  1LK7 A;  4UUW A;  2Y9H A;  1U2C A;  1WF2 A;  3ELH A;  2CQ0 A;  3WZ0 A;  1K44 A;  1WEY A;  2ASY A;  4Q2L A;  3T19 A;  1LFW A;  4RNH A;  2B9E A;  4Y6I A;  3CJ5 A;  1RT5 B;  3GWC A;  4OYB A;  4RKU C;  1HNI A;  3GYX B;  3H4D A;  4USW A;  1YZ6 A;  2O5D A;  2YPZ A;  1VDH A;  3HM9 A;  4NEY A;  2VC0 A;  1WG1 A;  4ELV A;  1ITP A;  2ZH2 A;  2VQF J;  4PPD A;  3D68 A;  2JEF A;  1WF0 A;  3R5J B;  1V5V A;  1KP6 A;  1PAE X;  2PA8 D;  4KGZ B;  4NYZ A;  5B0C A;  4U67 Q;  4NLO A;  1G7C B;  4UOH A;  2ATL A;  1KD1 T;  4B9T A;  1SJ4 P;  2O67 A;  2B6A B;  2PA3 A;  1JJ4 A;  3K59 A;  1LWF A;  2V8G A;  3BGF A;  1K8A T;  4N41 A;  2ZH7 A;  4KHR A;  4O44 A;  3T9Z A;  3LTO A;  3M8P A;  4OV1 A;  1VRU A;  4ED6 A;  4LF7 J;  2CPD A;  3BGU A;  4Y2M A;  4RW6 B;  3M4X A;  3OLB A;  3CIZ A;  2M52 A;  2V8V A;  1VQL S;  2IM3 A;  4DPO A;  3OUY A;  2DO4 A;  3CD7 A;  3VAI A;  2ADB A;  2NXC A;  2J7K A;  3NLC A;  4A8F A;  4QPX A;  3D6F B;  2AD9 A;  4K4U A;  3M2U A;  3CD5 A;  1U8W A;  2JLE A;  4LQ3 A;  1U6Z A;  2F4F A;  3Q24 A;  3GSD A;  2BQ3 A;  2B7B B;  1E6V B;  4A8S A;  4DR5 F;  3HP6 A;  1PCA A;  2QRR A;  4K4T A;  4B3T J;  3IO1 A;  1FWL A;  3VAG A;  2AGP A;  1LQ9 A;  3EIC A;  3KJN B;  4ZN1 A;  3FKB A;  4CCH A;  1RTI B;  5AXM A;  2IDE A;  1S1V A;  5B09 A;  3SYZ A;  4GRS A;  2ZKU A;  3C16 A;  5A0Y A;  4YHH J;  2BM0 A;  1RT1 A;  2MKY A;  4N56 A;  2ZH3 A;  1IQT A;  4LVN P;  2JLF A;  5LJ5 Y;  3EXY A;  5ETM A;  2YH1 A;  2AQ4 A;  2G0I A;  1RT3 A;  4IRC A;  3DGP A;  5BYS A;  1NDC A;  2GNK A;  2P6T A;  2J0Q D;  2FJD B;  2KM8 B;  4RW8 A;  4YY3 F;  2AEJ A;  2LCW A;  3GE9 A;  5C25 B;  3V81 B;  3M32 A;  4GVL A;  2YKN A;  2B9Y A;  2I1R A;  5B0G A;  3TUP A;  2WVE A;  3AOA A;  2HHW A;  3V6D B;  3K8W A;  3NMR A;  1F9E B;  1JLF A;  4OHV A;  4F4A A;  3Q22 A;  5ETK A;  3H25 A;  3MM5 B;  3HHL A;  4USM A;  5IV3 A;  2OMO A;  2FB0 A;  1TVR B;  3CUN A;  4FXW A;  2PEH A;  1C0U A;  2F63 A;  3K8V A;  2J8S A;  4QWA A;  3KK3 A;  4TYA A;  1RAD B;  1S6U A;  4USH A;  1VR6 A;  2B56 A;  5AXL A;  3MR2 A;  1RU2 A;  3T9N A;  3CC2 S;  5KFE A;  1U49 A;  4C97 A;  1FKP A;  1C4A A;  3MXH P;  2Z0G A;  4ECV A;  4P2F A;  1E6V A;  2J9D E;  2BYC A;  2AX1 A;  2ILY A;  2XUL A;  4DOZ A;  4L3K A;  4TU8 A;  3RB6 A;  1CVJ A;  3CE8 A;  1MWY A;  2OUG A;  3EE3 A;  4ZVQ B;  1J5O B;  1LWC B;  4AL7 A;  2LKZ A;  1T8E A;  1C1B B;  3O2I A;  3VCD A;  2HVD A;  2CJ9 A;  2KVI A;  3NGT A;  4DUZ F;  3N79 A;  2DRB A;  1VQ6 S;  2PO4 A;  3G82 B;  3BSA A;  4K59 A;  2GQ2 A;  2D3U A;  1YJ9 S;  2N4D A;  4OYO A;  2UUA J;  3BDP A;  3OFH A;  1IR1 A;  2DT9 A;  3BGO P;  4I7F B;  1N5V A;  5IZH A;  1ZM3 A;  5F8G A;  4DV5 J;  1U1M A;  2RKI B;  4FBU A;  3P5T L;  1EET A;  1KOO A;  2EVZ A;  4K4X A;  2R2T A;  2JC0 A;  3MCN A;  4Q45 A;  5I3U A;  3PV8 A;  1F0X A;  1UJ6 A;  3GII A;  2VF3 A;  2W9B B;  1ZH5 A;  3BH6 B;  3BBF A;  2V2Z A;  1MML A;  2LXU A;  4CH7 A;  2VQF F;  4XO0 A;  2IRY A;  1TK5 A;  3QT5 A;  2D69 A;  5EX3 A;  2EBG A;  2K06 A;  2OPR B;  5ETT A;  5HMZ A;  2JL9 A;  1S57 A;  1P6T A;  3JS9 A;  2EFN A;  1RT5 A;  2OP5 A;  3HHK A;  4JI5 F;  4F02 A;  1O0P A;  2F9D A;  5HVF A;  3HSG A;  4PXE A;  1YRU A;  3NOG A;  3UO0 A;  1AW0 A;  3CWJ A;  9ATC B;  3ONQ A;  2PFD A;  4TKT A;  2WSC C;  5IQ6 A;  1TVR A;  1KON A;  4RNO A;  2BVZ A;  3THV A;  3UDE A;  5I4M A;  2KRR A;  1XMO F;  4EZ6 A;  3L95 X;  1LFP A;  4PYA A;  4DV0 J;  4EEY A;  1IBM F;  2N7Y A;  4KFB A;  1RBO B;  2A6M A;  1Q7Y T;  4JI3 J;  2B3T B;  2VG7 A;  3N6M A;  4LF6 F;  2R9L A;  3D5M A;  4TY9 A;  2ZBR A;  4DQS A;  3R1L A;  1S12 A;  4BCA A;  5GAH I;  5DQG A;  3GZ7 A;  4KT0 C;  5K8N A;  1OWX A;  2HVH A;  5D77 A;  1FWP A;  2DCU B;  4IG0 B;  4OJG A;  1SL1 A;  2HBR B;  3SQO P;  3PEJ A;  2W8L A;  2AJ0 A;  4QOT A;  3W65 A;  1JLB B;  2CQC A;  3R9L A;  4OHW A;  1JLC B;  1RT1 B;  1WHW A;  2YKM A;  3ET6 B;  2ZJP Q;  1NO8 A;  4CLS A;  2BJ8 A;  3Q8Q B;  5GMK a;  2XO7 A;  4IOC Q;  2CJB A;  1K73 T;  4OJH A;  4ALZ A;  1XBW A;  2G2Z A;  4QU6 A;  1UA0 A;  3QZ8 A;  1Q8K A;  1AB8 A;  1RHU B;  2UXC J;  2R7O A;  1F1B B;  1CUL B;  3CNQ P;  1U1K A;  2AX0 A;  1LW0 B;  1U6F A;  2AIR B;  4F4Y A;  1N8R T;  5A8R B;  4PQU A;  1SBR A;  3VGU A;  3IN5 A;  1RSC A;  2E7X A;  1KLM B;  5D4L A;  2FLP A;  5ETR A;  1SKU B;  2G2Y A;  4JV5 F;  2RS2 A;  1BWV A;  1KOH A;  1R8A A;  1HBO A;  1NSA A;  1IR0 A;  1RT2 B;  2IMO A;  1RUS A;  1CJU A;  1RAG B;  3AFG A;  3NS6 A;  5E3C A;  2HVZ A;  4CLY A;  3M2R B;  2XTJ P;  2BV3 A;  3JAM U;  4OI0 A;  1GK8 A;  1NB2 A;  4DV5 F;  4FDF A;  3ETO A;  4KTQ A;  3MEC B;  4I2P A;  2GQQ A;  4RPF A;  5KG4 A;  2XLI A;  4RWX A;  1GXT A;  4WU2 A;  3BGL A;  3KHG A;  1M5P C;  2KT2 A;  1VQ9 S;  1HBU A;  2AYG A;  1FDA A;  4OYA A;  3ZZT A;  4KY3 A;  4FF2 A;  3AY0 A;  4WTY A;  3HD2 A;  2CQB A;  5J1E A;  3ILL A;  3M8Q A;  3LOU A;  2XEX A;  3HF5 A;  4DUZ J;  1M5S A;  2A1B A;  3ZZY A;  4DR1 J;  1CSJ A;  1TKT A;  2RDJ A;  1T11 A;  2H65 B;  2H3E B;  4A8O A;  5J2P A;  1XNQ J;  4IOA Q;  2YNG B;  1VMB A;  2C22 A;  1JNR B;  1RHJ B;  3CTR A;  3OTO J;  1NJW A;  2CAJ A;  4ECZ A;  3AA9 A;  2EFV A;  4MK7 A;  4FF3 A;  2YKO A;  4IRD A;  1XNQ F;  2OEL A;  2JOQ A;  3FSY A;  3G96 A;  1HLW A;  5KFY A;  1JLQ B;  4KPY A;  2C2R A;  5HMW A;  4JI6 F;  5KT7 A;  1JKH B;  1Q81 T;  5IT9 U;  3TWZ A;  4O44 B;  3TJ9 A;  1U6B A;  5ETS A;  4LF9 F;  1KLM A;  3TUZ C;  4LIR A;  2JJ4 D;  3PX6 A;  3M30 A;  2CPY A;  2DNP A;  1MRO B;  3AD8 C;  3IFE A;  5B0F A;  5SZT A;  4NXN J;  5C24 B;  5KFR A;  2YKA A;  3WIV A;  4HHH A;  2CJK A;  4PXC A;  3KLE B;  3H5X A;  3PY8 A;  3QIP A;  1HNX F;  2XYH B;  3FC9 A;  1S9E B;  3ZO7 A;  1HBU B;  3CCT A;  3TW0 A;  3DOK A;  4KKO B;  2B8P A;  2HQC A;  3D6T B;  4NEZ A;  3TA2 A;  4L75 A;  1GX5 A;  3WBZ A;  4DMZ A;  1S4E A;  1WEL A;  5H1S V;  3KK2 A;  4JI0 J;  2L3M A;  2WVC A;  1RWM B;  4CYU A;  3AD7 C;  5C5J A;  3WC2 A;  3CDB A;  3TEG A;  4TU9 A;  2Q6B A;  1T9T A;  2HBZ B;  3KJF B;  4ED2 A;  5KG1 A;  3MM7 B;  3UW1 A;  2J0S D;  4DZ6 A;  1NH7 A;  1TL1 B;  2M7S A;  5KFU A;  3IGV A;  2Q3P A;  3D0G E;  5KG2 A;  5KG6 A;  4Y0F A;  4RU2 A;  4ZJQ A;  5F3T A;  3D1Q A;  3NEK A;  2BJ9 A;  2VIC A;  1NK4 A;  4FBT A;  1N5Q A;  3C6T B;  3IG1 B;  3RW6 A;  3CCW A;  3CUL A;  3DC2 A;  1LWE B;  2M2B A;  1S1X A;  1FEE A;  1OIA A;  4G6V B;  4IO1 A;  1QSY A;  1XNR J;  2DR5 A;  1S1T A;  4ZCK A;  2HYI B;  4DR7 F;  2LP4 A;  5IM0 A;  2BAB A;  3JAM Y;  4ECQ A;  3C3L A;  3GIM A;  4ZOS A;  3MDF A;  4KJI A;  3U02 A;  2FHJ A;  4EO8 A;  2C28 A;  2XWX A;  4OZ0 A;  2BOP A;  3I82 A;  2QX0 A;  2RF2 B;  1NU4 A;  2RB7 A;  4KO0 A;  5THW A;  2CAD A;  1KC8 T;  4WP9 A;  1RGV A;  3RAX A;  3FNN A;  2FPH X;  3RTV A;  3TVZ A;  1NPP A;  2QC3 A;  5JMN A;  4C3M A;  2OML A;  3D54 A;  3FZ2 A;  4NLW A;  4J9M A;  2FUG 9;  2GO9 A;  3T1H J;  1HQ2 A;  2DD8 S;  1QJH A;  2ACM A;  3R2D J;  2NXJ A;  3FBB A;  1RU1 A;  3DXB A;  2QLX A;  3K2Y A;  2EXU A;  1NPR A;  1OY6 A;  4R0E A;  5LXR A;  3KYL A;  2ZH6 A;  1NCL A;  3CJ8 A;  2UV8 A;  5EWF A;  4JV2 A;  3M8S A;  2CFX A;  1S76 D;  1U02 A;  2HAI A;  3KK1 B;  4KYZ A;  1FD2 A;  1U7L A;  2HWH A;  3DMJ A;  2E1P A;  3BR8 A;  1EP4 A;  5ADZ A;  2BJ7 A;  3MZI A;  4I1T A;  5L1L A;  1GTH A;  2OD6 A;  5KFS A;  1VIS A;  1HWK A;  3UWT A;  1WWH A;  5L1I A;  2NZ4 A;  2AKW B;  2GZO A;  5I3U B;  3U27 A;  5B0A A;  1IR2 A;  3K5N A;  1RTZ A;  5DLG A;  4B02 A;  4I7F A;  1ARO P;  4DFJ A;  1DUR A;  4B3M J;  4LF1 A;  4NLQ A;  2G9O A;  2POK A;  1V3R A;  3CJQ A;  2F9J A;  4QW8 A;  3UFC X;  4R0J A;  4ID5 A;  1R0A B;  1HFE L;  3KLH A;  4BLG A;  2KM8 C;  3SV3 A;  4M5L A;  2ZDP A;  1WNE A;  2PT0 A;  2H48 B;  2HND B;  2VKR A;  2VJV A;  1JXV A;  1HHS A;  4UZB A;  2COL A;  2N3L A;  2HLT A;  3MR5 A;  4ES1 A;  5BXI A;  1GAO A;  3CCQ S;  3BR9 A;  3OFE A;  5HAT A;  1DZ5 A;  3D0I E;  3IBC B;  4C8K A;  3E2E A;  2OPP B;  3LPY A;  1JMT A;  4PAA A;  4C11 B;  4FS2 A;  2W01 A;  4ZP9 A;  4Y28 C;  3GIL A;  2OD4 A;  3CJ4 A;  3SQG B;  3LP2 A;  2XQC A;  3TJ8 A;  3O1L A;  3W5X A;  2ZH1 A;  4U8V A;  3SFG A;  3FQK A;  5HL7 Q;  4R8U A;  1TKT B;  3BYP A;  4ES3 A;  3A12 A;  2HW3 A;  2RIJ A;  3TAM A;  4YOE A;  4ZA1 A;  2GC8 A;  4O23 A;  5KFM A;  5LMN J;  4LSZ B;  2DR9 A;  2AU0 A;  3UN3 A;  2H1Y A;  3IRW P;  1ZBT A;  1UFL A;  3JTP A;  3K5P A;  2MZS A;  1SKS A;  2E5L F;  4OX9 J;  4ZVG A;  3E8O A;  4XIU A;  5KFO A;  1X4D A;  1JQG A;  2FC9 A;  1BUX A;  2ZFH A;  1AUS L;  2M3D A;  3LAN A;  5HJX A;  2K2P A;  2OFH X;  4W98 A;  1U4B A;  4I64 A;  1HBN B;  1RIS A;  2CNL B;  4DL3 A;  1A7G E;  4I4B A;  1WSR A;  3ZNJ 1;  5AXN A;  4YP3 A;  3EPG A;  1D9D A;  4N7T A;  5LL6 d;  1ZA2 B;  1HW8 A;  3MPD A;  4D3G A;  3KLI A;  4ZVS B;  1NJY A;  2V4J A;  1R3N A;  1N0V C;  5E3Q A;  2YNH B;  1H38 A;  3KLF A;  3CD6 S;  3I0R A;  4R5P B;  1T3N A;  2FY8 A;  2VBZ A;  5F9L A;  2QA4 S;  1GQE A;  4ED7 A;  5KTQ A;  3C2P A;  1WEX A;  1YBT A;  2CPF A;  5LMU F;  4Q5V A;  1UPM B;  5KFA A;  2Z4P A;  1CUL A;  3CSK A;  1CJK B;  2AYM A;  1WKJ A;  1X31 C;  2B5J B;  5L8R C;  2E9Z A;  5C2G A;  1K47 A;  1B4S A;  4CIO A;  1U1P A;  4MIW A;  4KGM A;  2BJ1 A;  1X8D A;  2IBO A;  4YDD B;  1OJ4 A;  2VU5 A;  3J7Z 5;  3HPO A;  4B3R F;  3TNV A;  2GJI A;  3ZZR A;  4ICL A;  1QM9 A;  3LP2 B;  5HQM A;  4B9V A;  2ZD1 A;  2Z2L A;  5LJ3 Y;  1NZA A;  3I4P A;  3PR4 A;  5GME A;  3HLU A;  3E3X A;  3TQE A;  5ETP A;  1WG4 A;  2WB4 A;  3G8S A;  4JYA J;  1YGY A;  3J7A 1;  4M5M A;  1P8G A;  5B0E A;  1MG7 A;  2KVQ E;  2UXD F;  3A3O B;  3BN4 A;  2EK6 A;  5DG7 A;  2NCK L;  5K20 B;  4J9R A;  2FJX A;  4J37 A;  3LP1 B;  1Q1K A;  2GMH A;  2IAJ B;  2IYI A;  1Y11 A;  1UFW A;  2MKS A;  5GAE U;  4ED0 A;  3GLJ A;  1Y3K A;  1R8P A;  2WW8 A;  1FI4 A;  4XPC A;  1EHW A;  4MKB A;  2YQ3 A;  3HKZ D;  2PDA A;  4DX7 A;  3DRS B;  1HL6 A;  4IQX A;  1D8Y A;  3Q0A A;  1RWN B;  4C98 A;  3HFZ B;  2IRU A;  5FD1 A;  1QAI A;  4HLB A;  1AZS B;  1UL3 A;  3BV8 A;  3F44 A;  4PXD A;  1QVF R;  3CJK B;  2GO8 A;  2LYV A;  5IOL A;  1WC1 A;  3OXF A;  4V19 X;  2MYF A;  3ZZ0 A;  4NML A;  3TZW A;  1BMQ B;  4WKR A;  1JWW A;  1P27 B;  4AYB D;  2B9X A;  2HHS A;  5CYJ A;  3M8Z A;  2CNK B;  1SKW A;  2WBM A;  1YTY A;  4WU3 A;  4OX7 A;  1S7H A;  1FJC A;  3HHL C;  1PC5 A;  3NS5 A;  3R7B B;  3TEH B;  5KFF A;  5HJY A;  2XS2 A;  3PRD A;  2MQL A;  4NA2 A;  1JJC B;  3KUE A;  2IAJ A;  1FNM A;  3FCW A;  4KIA A;  5ETV A;  3GIR A;  4DPT A;  1HIY A;  4DUY F;  3SZ2 A;  1DQ9 A;  2GVD A;  2HNY B;  4IDK A;  4C6A A;  4ID5 B;  4DV6 J;  3CC7 S;  2ROP A;  5DG9 A;  1OPI A;  3CIM A;  1MSW D;  4K4Z A;  1SH0 A;  3J80 Y;  1I51 B;  3LPE A;  3AJ1 A;  4MIA A;  3J7A N;  1RHM B;  1VQ4 S;  1RT4 B;  2SXL A;  3ZTR A;  2ROG A;  4I6Y A;  1KLN A;  2NR0 A;  1NKE A;  4AXI A;  4CLK A;  2V34 A;  3MUT P;  4DL5 A;  1T05 A;  4ETX A;  5A2Q U;  5IFM A;  5CYQ A;  2R7X A;  3MM9 B;  4OLP A;  4WIQ A;  3T6B A;  3ZC4 A;  4F4Z A;  3OJS A;  2EBE A;  3VGS A;  1ZM2 A;  2DHS A;  2J9E A;  1NZ8 A;  1T02 A;  4CTA B;  3NBP A;  5K8O A;  3BO3 A;  1HR0 J;  5E2Q A;  2XGP A;  4OYX A;  1S77 D;  1KDN A;  4OJ1 A;  1TMM A;  4MFB B;  4P52 A;  4AE5 A;  4EFA C;  3UPF A;  3QZ7 A;  4QR1 A;  2DH8 A;  3FCV A;  3KLF B;  4B3O A;  2MHE A;  3MOZ A;  3UVJ B;  3SMZ A;  2V4J B;  1S1X B;  4U6P A;  2ADC A;  3QJP A;  3JQJ A;  5HN0 A;  1O6X A;  4BDP A;  3MEE B;  1IBK F;  3DNC A;  3GMG A;  3N28 A;  2DNN A;  3OTE A;  3QFW A;  5KG0 A;  4F50 A;  1RT7 A;  4DDF A;  4RNN A;  3PTW A;  2RF2 A;  1TFW A;  2ALZ A;  2FYX A;  2M9K A;  5KFB A;  3LAM A;  3FJ2 A;  5GAG U;  3DLG B;  1TUW A;  2H51 B;  4ZLN A;  2FHO B;  3KHH A;  2WVF A;  2YX4 A;  3M1V A;  4P72 A;  1FDN A;  1I1G A;  1JXE A;  2PE8 A;  2G4B A;  1CQM A;  1T3O A;  1KQF B;  2VOO A;  3QMQ A;  5DS7 A;  2CXE A;  2ZZT A;  4XTT A;  4QQB A;  3WC0 A;  3MEG B;  1NKB A;  2XNR A;  1RLD A;  1GXL A;  2CQ4 A;  5J2Q A;  4NZ7 A;  1X4F A;  3KLG A;  2XMV A;  1BQM A;  1FD8 A;  4YY3 J;  3EX7 B;  4IFV A;  1JKH A;  2HWI A;  1ZET A;  4LRB A;  1FDB A;  1N34 F;  4F2R A;  3BN7 A;  1JLQ A;  5EDW A;  2NXE A;  2FJB B;  3IP0 A;  4WJB A;  4DSF A;  1FE0 A;  1OSC A;  2BEF A;  2LQB A;  2EFG A;  2XG8 A;  4ZP7 A;  4CO0 A;  1QLN A;  1BHN A;  2EW9 A;  2P5V A;  4DR4 F;  1X60 A;  2RSQ A;  5D3G B;  3KK2 B;  4A8Y A;  5HP1 A;  3AJ2 A;  2E1M C;  1PJ7 A;  1BLU A;  2E1R A;  4ZVF A;  3FSI A;  4ZVT B;  5HLF A;  1LW2 A;  2FDN A;  2VAS A;  3ENA A;  2CVI A;  2ZUA A;  2OSQ A;  4M5H A;  4RW6 A;  4AQY J;  3TI0 A;  4IRK A;  3BDE A;  2FTR A;  3G8Q A;  3MGJ A;  2XMJ A;  1DLO B;  4P71 A;  3FMW A;  2EG2 A;  2MLX A;  3HVW A;  2CPH A;  2HQG A;  2OJ3 A;  3QLH A;  3QO9 A;  2VIH A;  5T7L A;  3HZG A;  3OFF A;  3D6M B;  1Y00 A;  5HAO A;  5I42 A;  2I2Y A;  2DGW A;  4KBI A;  3NY0 A;  1KR4 A;  2H9Z A;  1SVD A;  3WHI A;  1U1R A;  2B8Q A;  3EZ5 A;  1VQ7 S;  3HD1 A;  3E51 A;  2Z57 B;  3M2R A;  1B0T A;  4PR6 A;  3MM8 B;  2H4Y B;  1GXU A;  1FFS B;  8RUC A;  2LEB A;  2DIT A;  1WC5 A;  1GX6 A;  2L9W A;  3BH7 B;  3FCH A;  2ZUG A;  1RA7 A;  3QWP A;  4J9U E;  5KAK A;  3RBZ A;  3HXM A;  1K1S A;  4LFC F;  4EBD A;  1FJG J;  4P2S A;  3QT8 A;  2NRE A;  1ZA1 B;  2F3J A;  4I2P B;  4KHP J;  1HYS B;  2Y1L B;  3D1H A;  2EI5 A;  1NPK A;  1Y3J A;  2ZBP A;  5M2P A;  3QGG A;  1RKJ A;  3NL0 A;  1C1C A;  1VQS A;  1S6O A;  4ZJO A;  3F0N A;  1ZTW A;  1IBL F;  2KTQ A;  1CJU B;  3HVA A;  5KFV A;  2AJ1 A;  3NS7 B;  1M1K T;  1M5H A;  3KFW X;  4TQS A;  1YJW S;  4CRJ A;  1HD1 A;  2HK2 A;  1TMJ A;  2N82 B;  1RAJ A;  4DR4 J;  4CTA A;  1YRT A;  1S0N A;  2VOD A;  4ZCL A;  1R27 B;  2D3O R;  1HKA A;  2OIH A;  1HMV B;  2XMU A;  4ED8 A;  4DSL A;  2XS5 A;  1RT6 A;  3ADA C;  4NXM J;  1FRJ A;  3FEZ A;  1N32 J;  2P9G A;  2HGL A;  2CQH A;  4HI1 A;  2JDJ A;  3G71 S;  1NK8 A;  2F8E X;  4Q43 A;  2LEA A;  4DV6 F;  2C2Z B;  3I0S B;  2XGQ A;  3NCP A;  5KT2 A;  5HK4 A;  3GJQ B;  1Q86 T;  4I67 A;  3KWM A;  2OPQ A;  5IV4 A;  1RT7 B;  5CH7 B;  3MR3 A;  1S10 A;  1U24 A;  1M5K C;  1UEV A;  5AE3 A;  5F9N A;  1RK8 A;  4OHX A;  4RJV A;  2R7Q A;  3MMJ A;  3P45 B;  4O3R A;  2DJW A;  1AT1 B;  3NKY A;  4PG4 A;  1ZAW A;  4BBY A;  4JOU A;  3EPI A;  2OPS B;  2BAN A;  5DQI A;  1T9W A;  5L1K A;  4GO7 X;  3EJM A;  1QVG R;  3NBP B;  3AB2 B;  2XHW A;  3MPW A;  2DGO A;  5CYM B;  4Y00 A;  3J81 Y;  4WK1 A;  4G1I A;  3BM7 A;  1WDT A;  1TUV A;  3KLE A;  2R7V A;  3CJ0 A;  4FYV B;  2OH2 A;  2G0J A;  2H4W B;  2M8D B;  3B8H A;  1VGY A;  4K7Q A;  1VQ8 S;  3V4M A;  4QYZ J;  1VHI A;  4ILL A;  2J0W A;  3M30 B;  3IR6 B;  3ISN D;  1LWX A;  1TL7 B;  1FXD A;  3IR5 B;  1T7P A;  1R7I A;  3T41 A;  2GFF A;  1HI8 A;  4J9K A;  5H9F K;  3RG6 A;  1TL4 A;  4ECW A;  4OX8 A;  4ZDN A;  3PYE A;  1F5A A;  1JLE A;  3H8Y A;  3ENQ A;  4OI2 A;  4DN9 A;  1N6Q B;  3CMQ A;  1GMW A;  2XS7 A;  4AL5 A;  2BKO A;  3HI9 A;  3MCM A;  4N77 A;  2N3O A;  1FXL A;  4U95 A;  1IQZ A;  4M8L A;  1PYT A;  2W2Q P;  3IA0 A;  2JWN A;  4LRA A;  1VIX A;  5HAN A;  6AT1 B;  3PR5 B;  1HWJ A;  2AZ1 A;  2HUR A;  2W9B A;  1H7X A;  3TP2 A;  1TUG B;  2XSJ B;  3W2V A;  1FKO B;  2CJY B;  4CO4 A;  5K5M A;  2M5Y A;  4OYP A;  2CZ9 A;  3BQ1 A;  2OSR A;  2IM1 A;  3SSR A;  3HX9 A;  3C66 A;  2XCA A;  3GR1 A;  1QD1 A;  3R5G A;  5E7O B;  3BKF A;  4F0K A;  3KUH A;  3MR7 A;  4HHU A;  4MK8 A;  1FXR A;  3IBW A;  4QYZ K;  1P1T A;  2EKN A;  3VAL A;  1SJF A;  1I3O B;  3WDO A;  3MTJ A;  3R3T A;  1KVI A;  2GV1 A;  3DLJ A;  1GFW B;  3H0P A;  1AUD A;  2UUC F;  4WXO A;  5IT9 Y;  4OZ5 A;  2XZW A;  4ICL B;  2DNY A;  1L3U A;  2Q79 A;  4L72 B;  4WYL A;  3GIJ A;  3KLV A;  3V4I B;  4Q0B B;  4YUD A;  5LXY A;  1YJR A;  2BAC A;  3PRV A;  4NPO A;  4Y34 A;  4UQG A;  4JI4 F;  4G3I A;  1KNZ A;  1PBU A;  3PJ9 A;  2Q66 A;  5KOW A;  3HK2 A;  3VTI A;  1RYS A;  1DLO A;  1U0S A;  2W25 A;  2YWF A;  4KHP F;  1TAU A;  1K0T A;  3M32 B;  1UCN A;  1D09 B;  1U2R A;  2FJA B;  2C3P A;  2V6A A;  2Z58 B;  3DOL A;  3NAH A;  3LP1 A;  3M2V A;  3OTC A;  2NPI A;  4LF9 J;  1O5J A;  3VAM A;  1ZZN A;  1A9N B;  1LKZ A;  1H2T Z;  5A8R A;  1CPZ A;  3HHN B;  1LXN A;  2CNO B;  5BJR A;  5D4P A;  2G1H A;  2VZ9 A;  3DLE B;  4B3R J;  3FEY B;  2NUH A;  4NLV A;  4OX6 A;  5E5N A;  3BSO A;  1RKI A;  3QIP B;  1NUE A;  1URR A;  5FLX U;  1KKH A;  3LGN A;  3BF4 A;  1BD6 A;  4IFV B;  2DIU A;  4I6A A;  2DNH A;  1VYA A;  1QUP A;  2HRT A;  4A48 A;  1L3S A;  3H2V E;  2C2N A;  1XC9 A;  3ILO A;  2LEC A;  2IY5 B;  4Z37 A;  3DRR B;  3EGN A;  1REV A;  2GJ2 A;  1ROF A;  4MKY A;  2WW4 A;  1HBM B;  1WEZ A;  2V8H A;  3BB5 A;  4OZ2 A;  4TU7 A;  3OT9 A;  4ECY A;  4HDG A;  1JIH A;  3M8W A;  1G1X A;  4R8U B;  2DGX A;  3EDQ B;  3V2U C;  2BRL A;  2HHP A;  2W4C A;  3PYF A;  2L9N A;  4NZ0 A;  2DR6 A;  4JI2 J;  2E9R X;  3M8P B;  2Z2M A;  4BC9 A;  2XYG B;  4WF9 Q;  2V68 A;  3DLE A;  3JTN A;  4OJ3 A;  3HSD A;  2VPY B;  2BQU A;  4NMX A;  2W2N P;  1JJ2 R;  1OY8 A;  4EMD A;  1UP1 A;  2P9E A;  3A8K A;  3UR0 A;  3BBB A;  3H42 A;  5CXT A;  1RA6 A;  3UCZ P;  3JXO A;  4ERD A;  2XCP A;  3JQM A;  1R43 A;  4PAB A;  2V4Q A;  1N88 A;  2R7W A;  4MJK A;  1BXN A;  1WUU A;  4ZN3 A;  4PYD A;  1AA1 B;  1M0S A;  2UU9 F;  3M6X A;  1UW9 A;  2UV8 G;  1JXL A;  2E1C A;  1AFI A;  3HSZ A;  1S6P B;  3UDV A;  5DZ7 A;  2G13 A;  2LDY A;  4C48 A;  4FVM A;  5CCL A;  2MZ1 A;  2MB0 B;  4DFP A;  2P9C A;  3R6L B;  4RLE A;  4CQ1 A;  2P8I A;  1RHR B;  1UVK A;  2WK4 A;  3GG0 A;  4OYZ A;  1S9F A;  1KVJ A;  4QIF A;  1A0O B;  4WFZ A;  2W9C B;  2QJ3 A;  5MLC V;  4DR5 J;  1Q16 B;  1IN0 A;  2MKK A;  2W24 A;  3D3C J;  1Y4Z B;  2WCX A;  5DDR C;  2XLJ A;  4M94 A;  2VFS A;  3EVO A;  2HRU A;  2BXJ A;  2YPY A;  4OYI A;  2ZWP A;  4WFN Q;  2ZZM A;  5I3Q A;  3RW7 A;  1WTF A;  1LK5 A;  2KG0 A;  4UY8 5;  4XAK A;  3R7N B;  1QAX A;  2E5H A;  2QMX A;  1TL7 A;  4CH1 A;  3J81 j;  1S99 A;  4X2B A;  3TJA A;  4KV8 A;  2BBE A;  4IH7 A;  3I56 S;  4JI7 F;  4L76 A;  3ZFV A;  3Q8U A;  4IH6 A;  1R6V A;  3PJW A;  2Z2Y B;  4C3K A;  4PZV A;  1WC0 A;  2HHT A;  4IR9 A;  2J7U A;  1CG2 A;  4OI6 A;  1HNI B;  1OPZ A;  3KLG B;  1DAR A;  2JFD A;  2E5G A;  3OXG A;  4F3M A;  4N8O A;  4P9S A;  4NCG A;  4C0H A;  1JLA B;  2IJR A;  4OZN A;  2ZIT A;  4NWB A;  4LUB A;  4CLL A;  3CT9 A;  4MAK A;  4ED1 A;  3DRS A;  3NMA A;  5J1N A;  2AF6 A;  2YX7 A;  4J90 A;  2MJU A;  2VG6 B;  4FNI A;  2V2K A;  2EC0 A;  1GMW D;  2ZOG A;  1UAW A;  1HBO B;  2BZ2 A;  2GGP A;  5CYM A;  3F41 A;  3W2W B;  3DHW C;  2MZR A;  3I32 A;  2CJX B;  1VLO A;  4CI0 B;  2JSX A;  1HI1 A;  2MSS A;  5E3P A;  3R1H A;  2VUG A;  2RJZ A;  1N5Y A;  1R8C A;  2DYA A;  2JRS A;  2LXI A;  4M1K A;  3QAU A;  4B9U A;  4PG6 A;  4JV0 A;  2UUW A;  4DX8 H;  2QLW A;  4F36 A;  4J9S A;  3HT0 A;  1SJ3 P;  4EZ9 A;  1WKL A;  4QR0 A;  4UOC A;  3EMT A;  3OBI A;  3VZI A;  3P3D A;  2MQO A;  4DV2 F;  3PCO B;  3ZTS A;  3C16 B;  2OPQ B;  4M5I A;  5A0Y B;  1K9M T;  3TZX A;  3ETM A;  4RW7 A;  1WJ9 A;  1NDP A;  1S1T B;  2P6S A;  2JVR A;  3VQS A;  1L3T A;  4F8R A;  3K17 A;  4YR2 A;  4QIV A;  2QIF A;  1RYR A;  2OPR A;  1IWG A;  4JI6 J;  5GAE I;  3BQ0 A;  2B7C B;  1YG0 A;  3C6T A;  3IG1 A;  3M9M B;  4DV0 F;  4LF2 A;  3TRG A;  2WON B;  2WVD A;  4PG7 A;  4ZLJ A;  2ZJQ Q;  3PFE A;  5L46 A;  4X64 F;  3I5B A;  4TLR A;  2WZ1 A;  1LXJ A;  2FVQ A;  2RS8 A;  2ASD A;  3FRY A;  4PWW A;  3PM9 A;  4TN2 A;  4DQQ A;  3DLH A;  1CC8 A;  2QZ8 A;  3Q8P B;  1TR0 A;  4NCA A;  4ED5 A;  1YLX A;  1P1L A;  2KYX A;  2MY7 A;  2RT3 A;  4DFM A;  2C3U A;  1SCJ B;  1HHQ A;  2QSF A;  1UEK A;  2HND A;  3EVW A;  1BE4 A;  4DSI A;  3DOM B;  3A13 A;  2M0G B;  1TKX B;  2RE1 A;  5D6G A;  2ZM6 F;  1TKZ A;  1YHQ S;  2PMW A;  3DKD A;  1SC6 A;  3A8J A;  4ZPW R;  1YJT A;  3R8Y A;  2UUT A;  2MST A;  1HW9 A;  5JUM A;  3CMA S;  3BGR B;  2HMI A;  1QE1 A;  4RW9 B;  1S72 S;  4NRT A;  2E5I A;  5E41 A;  2FVP A;  1RAF B;  4NL5 A;  1U1Q A;  5J2M A;  1BQM B;  1MWQ A;  2HQD A;  4J7C A;  4ID8 A;  4PQA A;  2C1E B;  4K2X A;  4FS1 A;  4NLT A;  2DH7 A;  1VJW A;  1TEL A;  1TK0 A;  4J91 A;  4YHH F;  2JX2 A;  2UUC J;  4O3S A;  3MMC B;  3MM5 A;  4LQ9 A;  4AT1 B;  1Z1Z A;  3M8R A;  3OPK A;  4ILM A;  4O3Q A;  3DI6 B;  2DY9 A;  4A4J A;  4DR2 J;  2XY5 A;  4J9O A;  1ZOT A;  2BDP A;  1NSQ A;  3FGV A;  4X84 A;  3VF0 B;  4N8N A;  3ZZO A;  1TZ0 A;  2IRX A;  2J8A A;  3JSM B;  2QSW A;  1TKX A;  2EK1 A;  1X0F A;  4M95 A;  4NLD A;  4RBU A;  3ITH B;  2GX8 A;  1CQN A;  3QRR A;  2EEY A;  3HZE A;  3TUJ C;  1Q8I A;  3F73 A;  2MDA A;  3EWG A;  3MEG A;  1RAH B;  4NYP A;  3GQC A;  2AJ2 A;  3SDE A;  2JEI A;  3DRR A;  1X0P A;  2YQ0 A;  3F56 A;  2VPW B;  1NXI A;  3LAK A;  5JVH Q;  1Q5V A;  2IDL A;  4USU A;  1VQO S;  1HAR A;  1RTI A;  2J5A A;  2RML A;  3KG1 A;  4CH0 S;  4RNF A;  4DF8 A;  4C9D A;  1VBX A;  2CPI A;  5HRO B;  1KFS A;  2V69 A;  3OL9 A;  2HQ3 A;  4NLP A;  2B4U A;  4RL1 A;  5J2Q B;  2C2O B;  2DGS A;  2ASJ A;  4TQR A;  1NHV A;  1GTE A;  5KFQ A;  5A2Q Y;  3UI3 A;  1UJ4 A;  3RUB L;  4KSE B;  2XZD B;  3MPV A;  1FRH A;  3CF5 Q;  1EQ0 A;  2HHU A;  1RT4 A;  5EN1 A;  4EWT A;  5E0O A;  4N47 A;  3NXZ A;  2CQ2 A;  3V6K A;  2XI2 A;  4B3M F;  3RRK A;  4QPT A;  5LSR A;  3TA1 A;  3AQP A;  2IPO B;  2XWY A;  3W8P A;  1NK0 A;  4HTI A;  4DU7 A;  2LEP A;  3CCJ S;  1RTH A;  2B0G A;  2NYH A;  2PMH A;  3RAM A;  3ENW A;  3SCL E;  2YTC A;  4FYY B;  1PKU A;  2J0X A;  4XDD A;  2GHV C;  3JB9 k;  2ZH9 A;  4UW2 A;  1Z2Z A;  3V6H A;  2YWE A;  2EWH A;  4YEA A;  4TYB A;  5F3Z A;  1DQA A;  2NSB A;  3BYR A;  4O4G B;  3SDE B;  5GAH U;  2DR7 A;  3HKW A;  2MPU A;  2W2O P;  3S7R A;  1NAQ A;  5DM7 Q;  3H5U A;  5MAO A;  2R8G A;  1SJQ A;  2GIF A;  3UNY A;  4C11 A;  1TL1 A;  1AYE A;  3ZTP A;  2HRY A;  4GVB B;  2W7O A;  1N33 J;  2F7V A;  1N33 F;  4LBI A;  4CYU B;  4K8R A;  3QSY B;  2E9T A;  3FQL A;  3KJV A;  4X4N A;  1VCT A;  2QMW A;  3W8G A;  3AAW B;  4DSK A;  1RAB B;  5ITH A;  3RRG A;  4WZM A;  2HZC A;  3OSP A;  1FK9 B;  4CM2 A;  3TO8 A;  1FT8 A;  1SQE A;  2CG8 A;  1JNZ B;  4DPW A;  2KKH A;  1HWU A;  2WB1 D;  4DS4 A;  2RNE A;  1X5P A;  2DGT A;  3BEG B;  2YKP A;  3I9Z A;  5J1E B;  1GMU A;  2HSE B;  1HNV A;  3UD5 A;  3Q86 A;  5KG7 A;  5LMN F;  3H5Y A;  7FDR A;  2E5J A;  1OO0 B;  2ZEJ A;  1E6Y B;  3DU6 A;  1FTC A;  3T1A A;  1S0O A;  1VC5 A;  4CP5 A;  2V0N A;  4MIB A;  3PX4 A;  2QYG A;  3G2X A;  4KV8 B;  3G8T A;  4FP9 A;  2FZG B;  2F8M A;  2WOM A;  2IVM A;  3MUV P;  4DPX A;  1D3W A;  3LW5 C;  4UF4 A;  3DU5 A;  4JI5 J;  1AFJ A;  1W7W A;  1FEH A;  4LSL B;  3SIP B;  1N52 B;  1UFK A;  3AA8 A;  3W66 A;  2HHV A;  3FFI B;  2UXC F;  5HQ8 A;  3R6G B;  2QEX S;  3NGU A;  1B7Y B;  1GEH A;  3S6E A;  5KG5 A;  3SI8 A;  4J9Q A;  2QLB B;  5BR8 F;  3GP9 A;  4NRU A;  1PAU B;  2FGO A;  2LLZ A;  3RR8 A;  4DV3 J;  3MMA B;  1T95 A;  4IR1 A;  1WC6 A;  5FLX Y;  2QV6 A;  2DTJ A;  5FDL A;  1WOS A;  3BJY A;  4RW8 B;  2Z30 B;  1LV5 A;  3Q2T C;  3OV7 A;  4FF4 A;  4K50 A;  1NDK A;  2BUN A;  2YNF A;  1TQL A;  1NK6 A;  2CQD A;  2H54 B;  4KO0 B;  1U45 A;  1I6J A;  3EDR B;  2E5L J;  2B4P A;  4UZC A;  1TV6 A;  1YIJ S;  3NNC A;  4H4K A;  3LF0 A;  2ZOF A;  4HH0 A;  3UNG C;  2DH9 A;  4DS5 A;  1X5S A;  1UA1 A;  1TFY A;  2Y8Y A;  3C46 A;  3N4W A;  3MF5 A;  1VRQ C;  4EBE A;  4AND A;  2FZK B;  3RB4 A;  1B7F A;  1TKD A;  3OJU A;  1VIO A;  1C1C B;  2QA1 A;  2IHR 1;  2ZVS A;  3TOQ A;  2XBP A;  5HRO A;  4OYW A;  2HFN A;  4ZPB A;  3DOL B;  3D6H B;  3H40 A;  1S4F A;  4RUH A;  5A8K B;  5C42 A;  3EGZ A;  2OEM A;  4KRW A;  1FO1 A;  1NSK L;  1RT2 A;  1SUQ B;  3H90 A;  2I6W A;  3MD1 A;  3OLA A;  4C8O A;  2Y3Y A;  2CDQ A;  4WP8 A;  3QQC D;  1P9Q C;  1LOU A;  1D1U A;  5D8H B;  3QGI A;  3CJS A;  4PPZ A;  1FVS A;  3DLK B;  3DOK B;  2N7C A;  2ZH8 A;  2C2M B;  2AW0 A;  4O3O A;  4WCE Q;  1U1N A;  1CS4 A;  3MI7 X;  5IQQ A;  4DBQ A;  3CO9 A;  1T94 A;  3P8B B;  4JI3 F;  1W25 A;  5D4O A;  2D74 B;  2RHS B;  2C2D A;  1TTH B;  5CAA A;  2M4M A;  3NCQ A;  2DR8 A;  1F5C A;  2FJW A;  4XDC A;  1EQM A;  3C14 B;  4X62 J;  2Y8W A;  4YB6 A;  2W8K A;  4LF4 J;  2ABY A;  2YNI B;  2IVF B;  1N4L A;  2V8D A;  5KFJ A;  4HKQ A;  4I2Q B;  3AOD A;  2YWW A;  3ICL A;  4LIW A;  3OUY B;  3GTY X;  1N34 J;  3PIO Q;  1F60 B;  4LF5 J;  4DEZ A;  4NAS A;  1WOP A;  3QBC A;  2HBY B;  4O4R A;  4OLO A;  1QE1 B;  3FSX A;  4RW9 A;  3SBM A;  4WWS A;  4YFU A;  3KJV B;  2XZT B;  4KFB B;  1ZPW X;  2Q6C A;  2HKE A;  4F26 A;  5AT1 B;  2VON A;  4K2J A;  2FHK A;  2R2S A;  3ZTQ A;  1X5O A;  1R8H A;  4PEO A;  3NGD A;  2LXF A;  3ULH A;  1PG5 B;  2PII A;  3MMC A;  4ZPV R;  4U7U K;  2RRB A;  2XSJ A;  4KC5 A;  3PAC A;  3D2W A;  3EZU A;  5EX0 A;  2VH7 A;  3HMJ G;  1N0U A;  2J6U A;  4GKJ J;  2HPU A;  3JQK A;  5KFG A;  4CO2 A;  3PKY A;  1N5T A;  3KK1 A;  3HT3 A;  4B9S A;  1JLE B;  5KFN A;  1RCX B;  2WHO A;  4DQR A;  1ZTT A;  5B7W A;  4MKA A;  1S9G B;  4MYU A;  3U1M A;  3KK3 B;  2XMT A;  4Y2I A;  4FPI A;  1Z4U A;  3OHB A;  1FKO A;  5H9E J;  2WON A;  4KR0 B;  5BYR A;  2HZV A;  5K9F A;  2QE5 A;  5L9N A;  2KFN A;  4L73 A;  2DNZ A;  1HQE B;  2ZH4 A;  1SJ1 A;  2LA6 A;  3MAA A;  2MKI A;  3G4S S;  1NKC A;  2CPZ A;  2ZHB A;  4ZPD A;  4TVA B;  3K5L A;  4F25 A;  3SXL A;  5F8I A;  2IJN A;  4P2X A;  4RBV A;  4B17 A;  1VC0 A;  2BJE A;  2L9D A;  2V2V A;  4HEA 9;  4H4O A;  2VBX A;  2R8H A;  2OPS A;  1MU2 B;  3BQ2 A;  1IBL J;  3LAL A;  2FC8 A;  3I55 S;  4C8Y A;  3DYA A;  3KMS A;  2J9D A;  1X4G A;  3T3F A;  2DXF A;  4JI1 F;  3UN5 A;  4ELT A;  5A8W B;  2XSF A;  3QRQ A;  2ZM6 J;  3N01 A;  2CJQ A;  2FZC B;  2MLZ A;  4KGK A;  4WBF A;  1KTV A;  1N32 F;  1YWX A;  3M6W A;  1XMQ F;  3MFH A;  4MKV A;  2A3J A;  3HVT B;  3MCO A;  5A76 A;  1IKW A;  3ZXW A;  1B99 A;  1SIZ A;  2BAN B;  1FVQ A;  2XMM A;  4LFA J;  5AE1 A;  5KFT A;  3HSJ A;  1M5V C;  4RW4 B;  3C19 A;  1IXK A;  2GA7 A;  4P10 A;  4O0N A;  4ZVO B;  3Q8R B;  4UOF A;  1V6H A;  3W62 A;  4F04 B;  1FX2 A;  2H5J B;  2X1A A;  1M1G A;  2PN6 A;  2BOA A;  4FKY A;  2DNG A;  2NUU G;  1QAY A;  2J7W A;  3CCU S;  2UP1 A;  2QLJ B;  2VDH A;  3JSM A;  5E3R A;  2WVB A;  4JUZ A;  4ZIV A;  5GVQ A;  3W64 A;  3RBE A;  1X4C A;  2DB1 A;  4JI8 F;  2XMK A;  4C2M A;  2W9A A;  4JB8 B;  4J9V A;  1TL3 B;  4DR2 F;  2ZE2 A;  1RZM A;  2GS8 A;  2FGC A;  3DDN A;  4W90 B;  2C3O A;  5I42 B;  4URG A;  4TLQ A;  5HMX A;  2Q1L A;  3KMQ A;  2DGQ A;  4ZIT A;  2LA4 A;  3UD3 P;  1MW7 A;  2QFI A;  1FRL A;  1SL2 A;  2VG5 A;  3V5R A;  4A8W A;  3BKT A;  3IWL A;  5L38 A;  2V4R A;  1J5E F;  1UVI A;  3ILI A;  1M90 T;  4PG8 A;  1P9Y A;  2OGU A;  3M05 A;  4NE9 C;  4ETZ A;  1LNQ A;  2V94 A;  1DTT A;  3TAR A;  1TK8 A;  1V3Z A;  2GW8 A;  2Y1J A;  2HFV A;  3GFX A;  4P7T A;  2J76 E;  1TL3 A;  3RYL A;  4ENO A;  2WTF A;  4DL0 C;  1WOR A;  2WRM A;  3TVK A;  1UEU A;  2XMA A;  3M9N B;  1ZYQ A;  1HPZ B;  3THP A;  4JI4 J;  1SI9 A;  2UU9 J;  4V1A k;  4ZVR B;  3MM8 A;  2ZC4 A;  4LT6 A;  1VBY A;  5CA5 A;  2GJF A;  2ILZ A;  4ES2 A;  3J7Z T;  1C1B A;  1KBR A;  4EGL A;  1C2P A;  4I2Q A;  4YME A;  1A6L A;  5DG8 A;  2DNQ A;  4CLF A;  4ZLL A;  4A8Q A;  1QUV A;  4LF4 F;  3OD2 A;  1KSP A;  2ACY A;  5KT3 A;  5L9X A;  1IKV A;  4FVC A;  4RX6 A;  1FER A;  2I5J B;  2R2R A;  3IWN C;  3G6V A;  4LFC J;  3CCV S;  2F1F A;  5GAD U;  4IG3 B;  3CCE S;  2CVE A;  3DM2 A;  2DPI A;  1FJG F;  4ED3 A;  1Q4R A;  2KHC A;  2EC2 A;  2IFX A;  3R2C J;  5CQG A;  2ZBI A;  4DV1 J;  1U1L A;  1CJV A;  1T03 B;  5D3G A;  2GVZ B;  4F67 A;  2MKH A;  3MOJ B;  2KL8 A;  2XI3 A;  3KLI B;  4OQJ A;  4A46 A;  2NS1 B;  2M70 A;  2AHO B;  3C8Y A;  1NJX A;  3DN9 A;  2DIS A;  1VQN S;  3A3N B;  1BY9 A;  3MMB B;  2DRD A;  1TL5 A;  2GGP B;  4UUX A;  3K5M A;  2RU9 A;  2BR0 A;  3IC1 A;  4K5S A;  1GT8 A;  2RIL A;  4M5K A;  5A8W A;  4ECX A;  1Y7P A;  4FZV A;  3TA0 A;  4OZ1 A;  3T5K A;  2HVE A;  4DR1 F;  4LBP A;  1FF2 A;  4P7V A;  2A10 A;  2QT7 A;  1FHT A;  1KQG B;  1V5I B;  2BMB A;  1T05 B;  3PRB A;  1VQY A;  1UZD A;  3HVT A;  1FRK A;  4UTG A;  1WHX A;  4E0D A;  2W2M P;  4LVO P;  4CLZ A;  3GU0 A;  3HJV A;  4E98 A;  5L1J A;  2VD3 A;  2HIQ A;  3TX0 A;  4DX5 A;  3DCA A;  1H0H B;  1D9A A;  1NM2 A;  1XMB A;  3FZB A;  4F3Q A;  4L74 A;  4PKD B;  2RU3 A;  3MAQ A;  4OFZ A;  2APO A;  4NLG A;  2YKM B;  3ET6 A;  4W4M A;  5HSP A;  2HG4 A;  3FK4 A;  3GV5 B;  1S49 A;  5E3A A;  1DAX A;  3MEE A;  5G0R B;  4FF1 A;  3UDL A;  4ELU A;  1SH2 A;  3NRB A;  1HYS A;  4B3O B;  5KFC A;  1NB7 A;  3HFV A;  1PYS B;  3T1Y F;  2AT1 B;  1F3V A;  1RHQ B;  2C3M A;  4O3N A;  3PO4 A;  1R0A A;  2ZHO A;  4KAI A;  4N5S A;  1SIW B;  3GSI A;  4C0O C;  2K7J A;  3OFG A;  4HDH A;  3GR0 A;  3JYT A;  1N6Q A;  3KTQ A;  1QAJ A;  1U8S A;  1VS3 A;  1ZZF A;  3E01 A;  3G87 A;  4HAC B;  5DM6 Q;  4LFB J;  2NQP A;  1SC4 B;  3AJD A;  1Y5N B;  3ZNU A;  1MN7 A;  2DHH A;  1AZS A;  2WOM B;  3W2V B;  3RR7 A;  3V4I A;  2HNZ B;  4USJ C;  4KB7 A;  5F0W A;  3SSS A;  4MK9 A;  5JJB A;  2XC9 A;  2AYE A;  2RDI A;  3US5 A;  5G0R A;  2A6O A;  3LH2 S;  3MCS A;  1IBK J;  5EGY A;  1EET B;  2EFP A;  2GIQ A;  2VBY A;  3G86 A;  1R89 A;  2KT5 A;  3OXL A;  1FKP B;  4S0M A;  4X65 F;  4DQI A;  1RQ0 A;  4HT7 A;  1RWV B;  3N5F A;  2DNL A;  4U9R A;  3THT A;  3S8S A;  1XR7 A;  4QIE A;  4DL6 A;  1XQI A;  2HGN A;  4CWB A;  1HNW J;  1NHU A;  3D67 A;  5HO4 A;  1MMN A;  3VHQ A;  1EAY C;  1RBL A;  1U47 A;  2BJ3 A;  4CLW A;  1HR0 F;  4ZIW A;  5HP1 B;  3R5C A;  1BWE A;  3R5D A;  1RTJ A;  4IOB A;  3O5T B;  4DR7 J;  3QPI A;  1OYE A;  2R4F A;  2MQN A;  5M2R A;  3BO2 A;  2VDI A;  2DRA A;  2F4V F;  2QA4 G;  2RKI A;  3JSY A;  3WQP A;  4EK2 A;  3G6X A;  2LU1 A;  4NI2 A;  2V9K A;  4C8N A;  3J80 U;  4DF4 A;  1EB0 A;  1XER A;  1YJV A;  2Z8Q A;  4CLU A;  4KH0 B;  3L4B C;  3V81 A;  1EX8 A;  4X4Q A;  1VQ5 S;  4B9N A;  3P49 B;  2RUS A;  2CG4 A;  4ZPC A;  4GC6 A;  4MMO A;  1RP5 A;  1HD0 A;  1XN9 A;  4H54 A;  4D3H A;  3UCU P;  2Y0S D;  3BKU A;  1VC6 A;  1FES A;  1QDU B;  1REV B;  2ZKT A;  3HHL B;  3OVS A;  3HCX A;  4Z7C A;  2F8H A;  4P2M A;  4WXW A;  3CCM S;  4U7U D;  1B0P A;  3PJX A;  3VAK A;  1AXQ A;  2ZD1 B;  3LGH A;  3CJ3 A;  5D0H A;  4RNM A;  3OL6 A;  3QJL A;  5AJ3 J;  3MM6 B;  2BE2 A;  2ZH5 A;  3KXD A;  1ZAX A;  1CS4 B;  2KXF A;  1Y10 A;  1IKV B;  2DHA A;  3BSC A;  1YK9 A;  2GHW A;  3DYA B;  1S6Q B;  5HVG A;  3DGP B;  4ZVP B;  2BKP A;  4FN5 A;  3TYT A;  3H7H B;  1S1W A;  2IA6 A;  3MTK A;  3M6U A;  4KKO A;  3UN2 A;  4QJV A;  3N6L A;  2IJF A;  3VZH A;  4TXS A;  5IWA F;  3DM2 B;  2PSZ A;  1RE1 B;  4I56 A;  3VAJ A;  3W61 A;  4JP8 A;  1RHK B;  3CJR A;  5B0B A;  2HK3 A;  4LSL A;  1O51 A;  5KFH A;  2KJV A;  5KOX A;  1DY3 A;  5C24 A;  2OEK A;  1WF1 A;  4J5O A;  3OVB A;  5T41 A;  3AXK A;  4Y2C A;  3MM6 A;  4F4W A;  1B3T A;  1S48 A;  2X3G A;  3HHL D;  1NND A;  1IM6 A;  4DSE A;  3O3L A;  2X1G A;  4UQT A;  1UTA A;  2VA3 A;  1MNE A;  2GCF A;  5IC4 B;  3RU0 A;  2XY7 A;  1GH8 A;  4ITS A;  1JB0 C;  1R0C B;  1FFG B;  1RAI B;  3H59 A;  3MHY A;  4NLY A;  4DV4 J;  1G2E A;  1YX2 A;  2PC6 A;  3Q83 A;  3GCX P;  4Y2A A;  3OR2 A;  1FE4 A;  2YNF B;  3IWX A;  4B08 A;  2H5E A;  4NA3 A;  5B08 A;  4X66 F;  1EKS A;  1HBN A;  1EZZ B;  2MGZ A;  3UDC A;  2PGC A;  4CLT A;  3SQG A;  4CDI A;  2FLL A;  1RDR A;  3CD0 A;  3NOC A;  3EXC X;  2AWZ A;  3KUG A;  5IXU A;  4WE1 A;  3DRY A;  4IFY B;  2YBV A;  1FFW B;  3RZA A;  2ALY B;  3GFH A;  1IBM J;  2JEJ A;  2C2K B;  4W92 B;  4QIW D;  4LF8 F;  3IRX B;  1TAQ A;  4K4S A;  3HVR A;  4F3O A;  2YQ1 A;  3PX0 A;  4A8M P;  2LU2 A;  2CDR B;  3LA0 A;  4DZD A;  2VQE J;  1YZ7 A;  3MFI A;  3Q23 A;  1WAC A;  3TR5 A;  2V9W A;  3MR6 A;  3D3B J;  2XMW A;  5D78 A;  1OQ3 A;  3D9B A;  4P75 A;  3EVM A;  3O6Q A;  3QO9 B;  3C14 A;  2NXU A;  1LEO A;  4DV7 J;  4BWJ A;  2CNN B;  4OZL A;  1IUJ A;  2FVC A;  2R7R A;  5DJB A;  1C0T B;  3SSQ A;  5D4N A;  2I8E A;  4GVB A;  1YIT S;  4HR2 A;  2HNZ A;  4HTJ A;  2LQ5 A;  5EWG A;  2I38 A;  1IKY B;  4LRC A;  1KHV A;  1NJZ A;  3IR7 B;  3NWG A;  4ED4 A;  3NGK A;  2Z2Z A;  5EUH A;  3J7Y I;  3T6J A;  3VR1 A;  2IVY A;  2KU7 A;  3EGW B;  1HHT P;  3UVJ A;  1UPP A;  3IM8 A;  5G4D A;  2MKJ A;  5HI7 A;  3UCG A;  2DXE A;  2LQJ A;  2KJW A;  1RWX B;  5KT4 A;  3CC4 S;  3N0V A; 
#chains in the Genus database with same CATH homology
 1BUX A;  1XQI A;  1LWX A;  3BBC A;  4W98 A;  4ANC A;  1NSK L;  2HVD A;  3NGT A;  3VVU A;  3EM1 A;  1F6T A;  3MPD A;  3GPA A;  4EK2 A;  3Q8U A;  5C7P A;  1NLK L;  2AZ1 A;  2HUR A;  3FC9 A;  1NHK L;  3BH6 B;  3BBF A;  4DI6 A;  4ENO A;  2B8P A;  5CAA A;  1S5Z A;  2BEF A;  1WKJ A;  2DXD A;  1BHN A;  1S57 A;  1B4S A;  3JS9 A;  3Q89 A;  3ZTO A;  2VU5 A;  3ELH A;  4DZ6 A;  1K44 A;  1PKU A;  3DDI A;  4ANE A;  3VGV A;  3NGS A;  3ENA A;  2ZUA A;  3B54 A;  3PRV A;  3WX8 A;  2DYA A;  3PJ9 A;  1ZS6 A;  3ZTQ A;  4F36 A;  1XIQ A;  1PAE X;  1S59 A;  1WKL A;  2NCK L;  1UCN A;  3EMT A;  4UOH A;  3ZTS A;  3ETM A;  1NDP A;  2B8Q A;  3ZTP A;  4KPC A;  4FKX A;  1EHW A;  1WKK A;  3FBC A;  3R9L A;  3BH7 B;  3FBE A;  3L7U A;  3Q8Y A;  1NUE A;  3FBF A;  5IOL A;  2AZ3 A;  1VYA A;  2BX6 A;  3FBB A;  1MN9 A;  1U8W A;  1NPK A;  3VVT A;  2HVE A;  1NCL A;  3Q86 A;  1NSP A;  3Q83 A;  3NGR A;  1HHQ A;  3EVW A;  3VGU A;  1BE4 A;  3EIC A;  3VGT A;  4CP5 A;  3FKB A;  3G2X A;  3FCW A;  1HIY A;  3DKD A;  1W7W A;  4C6A A;  4UOG A;  1NB2 A;  3NGU A;  4DUT A;  5CAB A;  1NDC A;  2DXF A;  1F3F A;  3GP9 A;  3ZTR A;  3BBB A;  1JXV A;  4WBF A;  3EVM A;  1NDK A;  4F4A A;  1LEO A;  5BXI A;  1B99 A;  2DY9 A;  3B6B A;  1NDL A;  2CWK A;  1NSQ A;  3VGS A;  3EJM A;  4HR2 A;  1MN7 A;  4O0N A;  3Q8V A;  4UOF A;  1KDN A;  4FKY A;  4AND A;  3FCV A;  4S0M A;  1HLW A;  3EVO A;  2DXE A;  3EE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...