4LFBJ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lfbJ00
4YHHJ 4K0KJ 3R2CJ 4DUYJ 4LFCJ 4JI6J 4V1Ak 4DR3J 4DV1J 3R2DJ 1XNRJ 3OTOJ 4JI3J 1N36J 1J5EJ 2UXBJ 1IBLJ 2KL8A 4DV6J 4X62J 4LF4J 2E5LJ 4RJVA 4NXMJ 5LMUJ 1I94J 4NXNJ 2MEWA 1XMQJ 1IBKJ 4JI8J 1N32J 4DV4J 4DUZJ 4LFBJ 4DR4J 5IWAJ 4DV2J 5LMNJ 2VQFJ 4B3RJ 5LM7E 4DR1J 5A2QU 3J81U 4YY3J 2VQEJ 4KY3A 2UUAJ 4B3MJ 4LF6J 4DR2J 4HHUA 4JI1J 4DV3J 4NEZA 4OX9J 5IT9U 3W1YC 4X64J 4AQYJ 4JYAJ 4NEYA 1N34J 5AJ3J 2HHHJ 1XNQJ 3J7AN 5BR8J 2KVQE 1HNZJ 2F4VJ 2ZM6J 4DV5J 1XMOJ 1N33J 4JI7J 1HR0J 4JI0J 1IBMJ 4GKKJ 4X65J 4LF5J 2MQ8A 4PWWA 2UU9J 5FLXU 3J80U 4DV0J 2UXCJ 2UUBJ 4LF7J 4X66J 4KYZA 4JI5J 1HNXJ 3JAMU 3IMQJ 4LF8J 4JV5J 4DR7J 4JI2J 2UXDJ 4DR6J 4KHPJ 3D3CJ 2MTLA 1HNWJ 3D3BJ 4GKJJ 2UUCJ 4LF9J 3T1HJ 4DR5J 4JI4J 3T1YJ 4DV7J 4B3TJ 4LFAJ 1FJGJ 4B3SJ
chains in the Genus database with same CATH superfamily
1FK9A 2DIUA 4EBCA 4NOHA 4NX9A 5D0GA 2XZDB 3M6UA 2XMTA 5MAOA 1VC5A 2ZE2B 1ROFA 4FBTA 3D0HE 4QJVA 4NLTA 3ITHA 4OQJA 1S1XB 3HVTB 1FVSA 1OO0B 2ILYA 2M8HA 2IBKA 2V4QA 3BEGB 2HZCA 2BOPA 1KVKA 3MR5A 5EGYA 4IYQA 2D3O1 4YY3J 2QMXA 1TKTB 5ETQA 1KDNA 2ILZA 2V5HG 1RLCL 5B08A 4DSEA 4TKTA 1N5TA 3J7AN 4QIWD 1PBAA 1M1GA 4KFBA 3H2LA 2MSTA 4OI2A 3NCPA 1KD1T 1TUVA 1ICEB 3MM5B 3B8HA 1X0FA 1NRKA 3QPIA 1VS3A 1X9SA 1AFIA 2CFXA 2UVVA 2ZH6A 2DR7A 3GV5B 2XSJA 1RAEB 5D4NA 2PMZD 4O0NA 4FXVA 2VIHA 2ZVIA 8ATCB 5GMKa 3C14B 3OVBA 3CDEA 3M30B 4OV6A 5F9LA 1RU2A 4FPIA 3GIKA 4ECTA 4OI0A 1RBLA 2VONA 1T05A 3DI6B 4CO3A 4ECXA 4JBCA 2KVIA 3T6BA 2IFXA 3LF0A 4ZOSA 4YB7A 2DKOB 5CYJA 2FLOA 1FF2A 3M9NB 3CD7A 2YH1A 5C7PA 4Q8EA 1EX8A 3MFIA 2KXFA 2H54B 4CLZA 5L8RC 4IQXA 2BZ2A 3F56A 5K5MA 2CZ4A 1S76D 4GKKF 1FRIA 1I51B 5KT6A 4LF5J 3TAPA 1HMVA 2PT0A 3W3SA 3WC0A 2D41A 3D4JA 5GAGU 2YKMA 4GO5X 2ZFHA 3MUTP 3W61A 2XZTB 3GB0A 4O44B 4YHHJ 1QTMA 2HFVA 2R8IA 2LVWA 5BYRA 4O3PA 4OJ1A 1XNRJ 1ZZNA 3SI8A 1TKXA 1Y00A 4LF6F 2LCWA 4OYXA 3CXCR 3UQSA 5E7OB 3OW2R 4IG3B 1GNKA 3HHNB 3HP6A 1S9FA 3KLHB 4RW4A 4I69A 2KYXA 1SKUB 1FE0A 1M5SA 3SCJE 2E7XA 1P27B 3NRBA 4Q45A 4ZP7A 3MD3A 3BYPA 1EQMA 3C15B 1Q0NA 3PKYA 2UUCF 1H2VZ 1TP7A 1ULRA 1OQ3A 2GVDA 1S6QB 2J76E 2RD5C 1KRPA 3IM9A 1WG4A 2UP1A 1X7VA 1RLDA 5B0BA 2UXBF 2ATLA 1TK8A 5H9EK 1D8YA 4M5IA 1F2GA 1X4HA 1Y5NB 1C4AA 2ALZA 1SKRA 1V9OA 5H9FJ 3R5AA 5ETPA 5KFAA 1XERA 4IFVB 4X4OA 4QWEA 4ZLNA 1O5JA 4DX5A 4F8RA 2PMHA 1X4FA 2DNQA 2BYCA 1S9GA 1LFPA 1FXDA 3VQTA 5A6PA 2RRNA 3BBCA 2BUNA 2R7OA 3V6KA 1IM4A 3KHRA 3PRBA 2BBEA 1RWMB 3BH7B 4ZPAA 3RU0A 4ZJQA 4PUOA 3BV8A 2W7PA 1WHVA 2QN6B 3FZBA 3B4MA 1KONA 5DLGA 4ZVEA 2HNDB 2HNZB 2KH9A 3GJTB 5BR8J 1Q95G 5HVHA 2GO8A 4M5LA 1FRJA 3I5AA 3L7OA 5KFDA 5K8PA 1IBMJ 4WFAQ 5SZTA 1HIYA 4M5MA 3OD2A 1CJTB 2CQ0A 2F5GA 2NXEA 1KHVA 4JV5J 3P45B 2F1FA 2GZOA 1UPMB 3V6DA 3HD1A 5KFTA 3GIIA 3A8IA 2MB0B 2J9EA 1EETA 3MDFA 4C3LA 3KG0A 4OZ3A 2OTLS 1PJ7A 2FVQA 2ZITA 3QATA 1Z1ZA 1RAGB 4RU9A 2KRRA 2QLXA 4PWDB 3BSCA 1JJHA 1B0PA 4FKYA 4DV3F 3R5BA 1D9FA 3EPGA 4KAIA 1GMWD 3P49B 1S1WB 3AH6A 2A0FB 1OJ4A 4N56A 4B3RF 3KNGA 4DN9A 5DJBA 2DNRA 4KQZA 4ECYA 5DETA 2UUAF 1PIEA 3TX8A 5RUBA 3LA0A 3M2UB 2R8HA 2VASA 4PCQA 4J9OA 2JNJA 1VQOS 4QR2A 4RW8B 4Q8FA 1UEKA 3TI0A 2BANA 3IS9B 1XMOJ 3N9UC 4FKXA 2RF2A 4ETZA 1MN9A 2DIVA 3G8SA 2B43A 4LFCF 2V94A 4PRFA 1NB7A 4ITSA 4F04B 3DLGB 4KHPF 5DQHA 1HWKA 3O3LA 3OQ2A 2XG8A 5I42A 2FZKB 4F67A 1RT3A 2BDPA 3MCNA 3LWMA 1RABB 4FP9A 2RU9A 3WQPA 4OJ3A 3IGVA 3IP0A 2PSZA 4B3MF 5AE1A 2OIHA 1O0PA 1Z4UA 3KUGA 2OTJS 4X4UA 2CPDA 2VFUA 1NCLA 1FE4A 1IR0A 3P8BB 2YPYA 4R5PB 1X5PA 2R2UA 4OMFG 5KFZA 4G1QA 4ID5B 4DR2J 4QCLA 1VR6A 4DL2A 3PZPA 2AP6A 4NEYA 4LF8F 1TL7B 3PW5A 1HFEL 3AA9A 2HVZA 3G2XA 5HI7A 1J27A 4Q0BB 2B6AA 2ZH8A 4DSKA 1WKKA 2NXJA 2KTQA 1TKDA 3N0VA 3EGVA 3IBFB 2UU9J 1LNQA 3BBBA 2JFKA 4IO9Q 4A8XA 4USHA 4Q44A 1SQFA 4Y2KA 1VBZA 1L3SA 3H25A 3KHHA 2O5DA 4UTGA 5J1EA 4ECVA 2K7JA 3W9IA 2HGLA 2QA4S 2E44A 2V6AA 4ECWA 2IMWP 3IAM9 3CPWR 3HHLA 4KGXB 4DQSA 1SPBP 1HHTP 3KLVA 4Z37A 2VG7A 4WFZA 1CJUA 2DRBA 2V8VA 3R2DJ 2HVDA 2FJBB 3LH2S 4OX8A 4ZLJA 3EM1A 2Q66A 1BUXA 4B9NA 3L3CA 1TL1A 2WTFA 2VPWB 2DISA 4LVNP 3EPIA 3GQCA 4I6AA 4DR1F 2AYEA 4HEA9 2ZBQA 4K59A 3O8WA 5E2QA 3ZZ0A 5F0UA 1JJ4A 3MR6A 1HWUA 1FX2A 3CJKB 4FYXB 1RTIA 4C11B 2X7IA 4OYBA 3I32A 4JYAJ 2K2PA 3QRPA 4B08A 3H5YA 3KLGB 1CEZA 1MMDA 1H3DA 5T7LB 3ENAA 3NY0A 1DTTB 4UOHA 1MU2B 1B7FA 3GONA 4ZP8A 3OPKA 3GP9A 3H5UA 4UQGA 2WONA 1HBNA 4RW6B 4WK3A 3BR8A 5C25B 3OXFA 2GJFA 5FLXU 1FJ7A 4A4JA 4K4SA 4QW9A 3FBFA 2XSFA 3CIMA 4DG1A 1SB6A 4BWMA 4LVOP 2MJUA 3BKFA 4DZ6A 4KKOA 2ZBRA 3CCMS 4DN0A 1FD8A 4M5DB 1Q5YA 4YY3F 2DGSA 4Z7CA 2J6UA 5FDLB 3FFIB 3DGPA 4Y28C 3BJYA 5IOLA 1I94J 1RK8A 3NS7B 2XYPB 2DCUB 3EMTA 4FF3A 1KVIA 1WI6A 4ENOA 2AJ4A 3ZNJ1 1SUQA 4XIUA 2HBQB 3J81U 4DL6A 1RGVA 3LUYA 3I31A 2RAQA 5HBMA 2DNYA 3NXZA 4B02A 2KDOA 1EQ0A 2HHQA 3DLKB 1PYOB 3UD3P 1NK9A 4JV0A 3K17A 3T5JA 2F4VJ 4ECUA 4PXEA 3EVOA 4DPYA 1XN9A 3NBPB 2POKA 4RLEA 4Q43A 2LQ8A 3IMQJ 2OSRA 1FK9B 1RU1A 3FBEA 4BDPA 4F3MA 4E8UA 4K4WA 2DGVA 4KGZB 3ITHB 2RVJA 2HQ3A 3K2YA 1JB0C 3HCXA 1T9VA 3M2VA 4C48A 2GMLA 1TFWA 3K8VA 2VC1A 2XHWA 3BN7A 3MUMP 5HLFA 1LW0A 2E7VA 1JNZB 4WZMA 4NYOA 3JYTA 4USTA 5LM7E 2XS7A 1ELOA 7FD1A 4QIGA 1R8PA 2BV3A 4P7TA 4LF5F 4KFBB 3SFUA 2GS8A 2V63A 3OTEA 4O3NA 3BH6B 1VQ5S 2IHR1 3RB4A 1RA7A 3B6BA 2C2DA 4GMKA 2CNNB 1ACMB 3CMES 1QY7A 2JEFA 1P1LA 2XSJB 4YHHF 2FJAB 3HULA 2YNFA 1TFYA 1XR7A 3R5GA 3H59A 2OD4A 3UDCA 1XNRF 1QM9A 2HLUA 1KOHA 3J7A1 2MKHA 1UCNA 1R8CA 3AB2B 4CDIA 3M8PB 2G0IA 5E3QA 2FJXA 3UO0A 1RADB 2LU2A 1T05B 1KN6A 2RHSB 1U2FA 3A1YG 1AW0A 3I4PA 3MM9A 2CJBA 2Y3YA 4FNIA 2VH7A 4Y6IA 2ZJQQ 1T0TV 1N54B 2VDIA 4L72B 1V5IB 1RP5A 4CH7A 3DOKA 3I9V9 1FTCA 4ED7A 2MHEA 1N5SA 4WPAA 3MD1A 4TY9A 2AJQA 1N34J 2VJUA 2MHNA 2BJ1A 4G3IA 5ETRA 4OX6A 2EXUA 3RB3A 1HMVB 4JI7F 4LSNA 1B0TA 4N7TA 2HFNA 1TQLA 5JUMA 1F9FA 2YKMB 1BMQB 2VF3A 3ZTQA 3BO3A 4CM2A 4MJKA 2NPFA 1WELA 2ZBIA 4A48A 4DFPA 2XBPA 2Z56B 4DCOB 3GV7B 3RGIA 1TKXB 2IDLA 2BOAA 1U1PA 2CQCA 1RISA 4KHRA 3VZHA 2RMLA 1FWLA 3A3PB 1X0PA 1WC4A 3OSNA 2CPIA 3ZO7A 1UEUA 3MMJA 4RW4B 2B3TB 2HEKA 2B9XA 3MPWA 3R7NB 2MEWA 3C16A 1CJVA 2HMIA 2ACYA 1B4SA 4NCBA 3AB4B 2L08A 1OSDA 4YDDB 3S1TA 3WIUA 2Q3PA 1QJHA 3SDEA 4ZN3A 5KFNA 5DGAA 2Y1JA 2GVDB 1R0AA 4JV5F 1JLCA 4TQRA 3W64A 5B09A 1AFJA 5HSPA 3QQCD 1NSAA 1Q53A 1JXLA 1T02A 3HK2A 4H54A 1GAOA 2CRLA 5CZVA 2RE1A 2F3JA 3T3FA 9ATCB 3VALA 3TA1A 1RI7A 1MWZA 1S9GB 5KT3A 4QIVA 2ZD1A 1Y0HA 1DLOA 3H42A 1S97A 5KFUA 3MM6A 3TUZC 2OJ3A 2RUGA 3VVTA 2MKCA 1RWOB 4YFUA 4B9TA 3L09A 1UJ6A 2OMLA 5CD4H 5J1PA 4NXNJ 1Z2LA 2E29A 5LXYA 4PUOB 4X4TA 2ZHBA 3PTWA 1M1HA 2FQQB 4YMEA 4U9RA 2FLPA 1WUUA 3NP5A 4GVBA 4F4ZA 1RACB 3VGUA 3CJRA 4YS2A 2QA4G 4ECQA 2AQ4A 5E0OA 5DQGA 1RYSA 3ILJA 5ETLA 4LMZA 1PBUA 2NZ4A 3M8ZA 4MT1A 3QGPA 2YKOA 1WG1A 2YX1A 4YUDA 3Q8RB 3EWGA 3ZFVA 3H4DA 1A9NB 2L9DA 2H5EA 1EETB 1RAIB 4R25A 4ZP6A 2HQGA 1IR1A 4DR5J 2RS8A 3OVAA 2XMAA 3A3OB 1GXUA 2MZ1A 1OQ6A 3KUEA 1VLYA 2E9ZA 4XTTA 2MZRA 3PJ9A 2JLEA 3DHXA 2BKNA 1YRUA 4WF9Q 4C0BA 4ZIWA 4DR2F 1LWFA 4CO5A 1FERA 2A2DA 3GCXP 2QG9B 1G4CA 3MF5A 2RUSA 1HA1A 3GIRA 4DPUA 2P6TA 3L7UA 5KFFA 2O3DA 5F8JA 5HANA 1WF2A 4UOFA 1RQ0A 1X5SA 5HMWA 2BANB 5K8OA 3Q24A 3FEXB 1U6FA 2NXCA 2DXEA 3P5TL 1IM6A 1S48A 4KPYA 4X2BA 4RX6A 3QT8A 1I5OB 1QTNB 4JI0F 3AXMA 1W26A 2W9CA 3KK2A 4HL9A 5I42B 1WHXA 2AYGA 1DAXA 2Z57B 3DC2A 4PG8A 2CXEA 1RT3B 4O23A 3DOMA 4DSLA 3VAGA 2M70A 1KS2A 5H9EJ 3J7Z5 4B3TJ 4USIA 7AT1B 2IMOA 3MEGA 4EI2A 4M95A 3TNVA 2HK3A 4DV1F 1X9MA 3CIZA 1WEYA 5CYQA 1IBLF 1WSRA 1NKBA 5A0YB 2DGTA 1K0TA 3MUVP 4M1KA 2CVEA 2PO4A 1FNMA 4JYAF 4G1QB 5HP1A 1X31C 5KG3A 5BYSA 1O51A 2AEMA 1QSSA 1ZA1B 2CWXA 1Q82T 1XJWB 3D5MA 2GNKA 2B6AB 1JX4A 1VRQC 1UW4A 1U1RA 4EO6A 4ZN1A 2XYGB 3PCOB 1FO1A 2ZBPA 3N28A 2CJ9A 1IKVA 5BJRA 2X1AA 2OMOA 1NJXA 4DOZA 4HR2A 4X65J 5J1EB 1JXEA 3OFGA 1S7HA 3IM8A 2YVSA 1MG7A 3HHLB 4OYZA 3FBBA 1VQ8S 3MMAA 2VG7B 1CJUB 1UAWA 1M0SA 1B64A 5E41A 1I94F 1NZAA 3SEOA 1SH2A 2UV8G 1TL1B 2C2MB 4WTYA 3TQEA 1OY9A 2QV6A 4ZPVR 2XMKA 3LP0A 4KGVB 4CRJA 2E1RA 1JLBA 2XY7A 4OIXA 2Y8YA 4BS2A 4UZBA 1M5KC 1RTIB 4UY85 2M0GB 2F4VF 3DXSX 2W24A 3FKBA 2R3VA 4O3QA 1MWQA 1RT4A 4PYAA 2RJZA 1Q1KA 3NMRA 4UF4A 1RT2A 3HKWA 3AAWB 2BQUA 2WONB 1HBNB 4ED2A 2FVRA 2ZBCA 2CPZA 3W2WA 4DL4A 1SL0A 2C3MA 2WW8A 4F36A 4DG1B 2YQ1A 1G7CB 2GX8A 1U1MA 4QWBA 3ZZZA 1MN7A 4E2FB 3HX9A 2R7WA 3JAMU 4LRDA 5DRKA 1L3KA 2D9OA 4G1PA 2QO3A 2YKQA 3M8WA 3R8YA 2L41A 3R9LA 1RT1A 1LV5A 3R3TA 4DUYJ 4TU8A 3I4HX 2OPRA 3DGPB 4KHMA 5F8LA 5KFLA 5KFJA 1SXLA 2MY8A 2EFNA 1U09A 1FFSB 1AA1B 3SCLE 5LMUJ 3EUNA 2J7UA 1SUQB 1P9YA 4G65A 2GQ2A 5HBMB 2K7KA 3OHAA 3SV4A 4NA3A 3DXBA 1UZDA 1NO8A 5A2QU 4CT8A 4WXWA 2DBBA 5EWGA 4ZVOB 2CYYA 2LDIA 2ZEJA 3U02A 4QR1A 5DGBA 4I6WA 3MR3A 3ZTRA 4FBUA 3GJRB 4F2RA 1C1CA 1XK8A 5DLFA 5F0WA 2L9WA 3POTA 2R9LA 4LR7A 4EWTA 5HMZA 2QIFA 2HHPA 3GYXB 5HMXA 4D3GA 5HL7Q 4JB8B 4YR0A 4J9LA 2WVCA 2HS3A 2BE7D 1R6VA 2FJEB 3NGUA 5KFKA 2W25A 3GSDA 3TZWA 3M2VB 3CF5Q 1T9TA 4LREA 4P9SA 5HLFB 1LW0B 3UR3C 4A8WA 3JYTB 1ZS6A 1UVIA 2QTWA 4Q5VA 1N34F 1HHQA 4OZ0A 2MSSA 2V69A 1RAFB 3UE2A 2PDAA 4QU6A 2YQ3A 1D8ZA 5L38A 3EJMA 1QD1A 4NE9C 2KG1A 1JLEA 4C7QA 1LQ9A 2AGQA 2KKHA 1MW7A 2CJQA 2EKNA 3CCZA 3WX4A 2EWHA 4RW7A 2YNFB 4L6V3 4TLRA 4ZHRA 2CNOB 2OI2A 3HHLC 4ZP9A 5ETTA 1N0VC 2QA2A 3EZUA 2HPUA 1WDTA 2LP4A 4DQIA 1RYRA 4EBDA 4BWJA 5B0CA 3MECA 3ZTSA 4KBIA 3PYGA 1GTHA 5GAGI 3P96A 2V2VA 1CVJA 3AOCA 2CQ2A 3MM9B 4R8UB 3PX4A 3D1HA 3I5BA 1HLWA 5G4DA 1SKSA 3ENWA 4JI3J 4C97A 2H65B 2HQIA 1FJCA 3DOKB 4IRDA 3U1NA 2Q6CA 3AD7C 4K4XA 2CQ4A 3MAAA 1SJFA 1Y9OA 1NJZA 2AF6A 3D0GE 3BGLA 1T7PA 1YQHA 3FC9A 1ZM4A 2H5JB 1RHJB 3G9CA 4JOUA 1YJ9S 2XULA 4FYDA 4DCJB 1D0EA 3THPA 3QZ8A 1RAHB 2WCXA 5HVFA 5L1JA 4ED3A 4O4RA 4OV1A 1IJFB 4F0MA 5HROA 2B5JA 4U8YA 4DSIA 1U8SA 4D3HA 3C46A 4HLBA 4DUTA 2LMIA 2R4FA 3BM7A 2M4MA 2LFVA 4B9LA 2VOPA 4U67Q 1YZ7A 1UWBA 5CYMA 3ZZYA 1UMJA 4HT7A 5KFCA 4USMA 4TYBA 4ANDA 3C16B 3TJ9A 1CJVB 2HMIB 2CPXA 4PAAA 3LQVA 1U45A 2BVZA 4WIIA 1RWXB 2H48B 2D9PA 1NKEA 3MCMA 4DV4J 2LA6A 5D0EA 4CNYA 3MMCB 3CCRS 1WTBA 2WRMA 1OMSA 1R0AB 2MQNA 1JLCB 3MEDA 1H7XA 2HG4A 2Z8QA 2C3OA 4N8NA 4LSLA 5KT5A 2U1AA 4KPCA 1CULB 8AT1B 4ID8A 4WP8A 2GAGC 1ZYQA 4CLWA 4DR5F 1NK6A 2BACA 4P2FA 4ED0A 2KZZA 4PWWA 4M5GA 1SV5A 5I3PA 4XPCA 4DR7F 2LKZA 2ZD1B 1DLOB 4QQBA 3MM6B 2R7TA 2FVPA 2HSEB 2R7SA 2W9BA 1SVDA 1YJRA 4Y2AA 4P52A 3IBWA 1HI0P 1X60A 2ZUAA 3HVTA 4HH0A 2QYGA 3R7BB 3TO8A 3QIPA 4EZ6A 2IYGA 3F0NA 3K5MA 2ATCB 3S7RA 3KTQA 1XMQJ 1PC4A 5D0HA 4HI2A 2C28A 5C42A 4L73A 1H0HB 3CEDA 4OX9J 4IOAQ 3QAUA 3DLLQ 3FNNA 1U48A 4ZPBA 4TNOA 4Q2MA 3GYGA 1F60B 2QLJB 5KFVA 4A8OA 4N41A 1NJWA 4ZMMA 3AJ2A 1WTFA 4L74A 3FVYA 3TJAA 3J80U 5AXNA 1RAJA 3ET6A 1JIHA 4DWIA 3C14A 3PG9A 3QFHA 1M5VC 1NK0A 5KFEA 1VQ9S 2DHAA 5C5JA 2HFOA 3PV8A 4Y3CA 2DNOA 1H72C 5KTQA 2Z2LA 3DU5A 4ES3A 2DNMA 1X4GA 3TARA 2VFVA 3EXYA 5E5NA 3UN2A 1JLFA 3R5JB 3DDKA 4HHJA 2PEBA 4X65F 5L9NA 2DRDA 2W9CB 3KK2B 1ZETA 4RNHA 1WWHA 3OSPA 2XWXA 2MPUA 4KJIA 4PABA 3W9JA 3FQLA 2QE5A 2PI5A 1VBXA 4QW8A 3TEGA 2UXDF 3VAHA 3MEGB 3K7RA 3K59A 4OX7A 1NDLA 4RWWA 4OYWA 3T9NA 4J9MA 1VI7A 5CYQB 1S79A 4JI6J 2JRSA 5HP1B 1YBTA 3RR8A 1IKXA 2DRAA 2DY1A 4ZLPA 1Y4ZB 4C0OC 3GZ7A 1SC6A 2VU5A 1T9WA 1J5OA 3OFHA 2IBOA 3MPUB 3QT7A 4K7QA 3LOUA 5E3RA 4OJHA 5L9XA 1ZZFA 3P4UB 4L75A 4CQ1A 3PR4A 4OZ5A 3O2IA 1IKVB 2JSXA 2E5JA 4WXOA 4EYIB 4QYZJ 4NA2A 3PM9A 2NCKL 4PG6A 4ZJOA 2JVOA 1JLQA 4DPWA 4GKKJ 3MMAB 2UXCF 1VFJA 3LP1A 2CQDA 2CZ9A 1PJ6A 3HSDA 1S9EA 3NGRA 3TZYA 2FTRA 3PYEA 5L46A 3ILIA 2BEFA 3LP0B 5D3GA 1JLBB 4PG5A 3PVXA 2OAUA 4PG4A 3GTYX 4GRSA 3SIPB 5CCMA 4KT0C 2EBGA 3VR1A 1RT4B 4CWBA 1WACA 1V3SA 2DR5A 1NB2A 2DXDA 1RT2B 3D9BA 2HVIA 4A8FA 1U49A 1RT6A 3W5XA 2KT5A 3W2WB 3JTNA 4JI1J 2BX6A 3Q8SB 2G13A 2E9RX 1EJ7L 5DDOC 3K57A 5KFIA 5LSRA 2ZH5A 1N33J 1SQGA 1HNIA 5C24A 3QLHB 1SIZA 3BO4A 1B70B 2B51A 4XO0A 2LDYA 2IVYA 3TA2A 2KRBA 2OPRB 2K06A 4U6PA 4PKDB 1YBAA 3MAQA 1YI2S 1WKLA 4KH1B 1A7GE 4CZCA 2GV1A 4Y2CA 1M5OC 4IG0A 3TAMA 1SH3A 2HW3A 3TVYA 3CT9A 4K5RA 4BC9A 4ZCLA 3DRYA 1U26A 2CPFA 4IQMA 5D6GA 1N32J 3OTCA 1VQ6S 3VTIA 2E1CA 2J6TA 2LEAA 3M8SA 3LTOA 2YNHA 3SXLA 1WOPA 2P8IA 3C2PA 2KT2A 4DPXA 5SUHA 4AQYJ 3BF4A 1Y11A 1C1CB 1EARA 3POTB 4EYHB 2RQMA 4ELVA 2HRUA 2K1RA 4C8OA 2CPEA 2NREA 1UL3A 1NHVA 2FY1A 1RCXB 3ZZPA 4WFNQ 3TWZA 4QWDA 3BBFA 1GH8A 4UT4A 4FZVA 4JI3F 4H4KA 3EGZA 3JTPA 4W90B 1Q8LA 5JJBA 1KQKA 3TYTA 1JMTA 1NSKL 2FC9A 1JLAA 5GAEU 3PW2A 2E5HA 3CCQS 2DHXA 2B56A 4NL5A 2GO9A 1NAQA 1HBMA 1T3OA 3LALA 4QIEA 3DGVA 4TU9A 1S0VA 3DRXA 4ECRA 2XNQA 2XYHB 2HIYA 2GIRA 2ZDPA 3FMBA 2B4VA 5E3AA 1QAXA 2HGNA 1JLEB 3W62A 4KTQA 2WVDA 4B3RJ 4DJBA 4RW7B 2UUAJ 5D77A 4ZHRB 4NLQA 1F2HA 2NPIA 3D66A 1LEOA 3IR5B 3PRVA 3L95X 2FIUA 4N77A 2IAJA 2MLZA 2OKQA 3U7JA 2DITA 4QBUA 3WDOA 3IGNA 3I5CA 4FNHA 3H7HB 3MECB 1HW9A 1LWEA 2A10A 2ZC3A 3R5CA 1RT7A 2N3OA 4X66J 3BPDA 2XI2A 1JJCB 3EXCX 3HSGA 3QWPA 4KHPJ 4C9DA 4GO7X 2EK1A 3OR1A 1LWCA 1N52B 4JI4J 3JQMA 3GPAA 4HKQA 3X1LB 4DV4F 3DKDA 2APOA 4NLGA 3ONQA 1RJJA 4J9RA 2FD2A 2Z2ZA 4UQTA 1MNEA 3OXGA 2KXHA 2X1BA 3MAAB 2I9SA 4G6VB 4OZNA 1IBKJ 4JI8J 4DUZF 5ETNA 3K8WA 2F4FA 3KLIA 3PW7A 1FRHA 2DJWA 5GADU 1NKCA 3UDVA 3OL7A 3B78A 2MJNA 3S01A 2VA3A 2EK6A 3PYFA 1B7YB 2DR8A 3ZC4A 4BC7A 1G3OA 4RW6A 2F8HA 4F7VA 1U25A 2AGOA 3SBMA 2GA7A 2XMJA 5HROB 2B5JB 5CQGA 1ZOTA 3PXGa 1JNRB 6FDRA 2W2MP 1PG5B 2MYFA 3TAQA 3T9ZA 3BS9A 1FNXH 3EDQB 1IWAA 5C2CA 5DZ6A 1GT8A 4X4RA 1XR5A 2V0NA 1CPZA 3JTOA 3E01A 3FBCA 3IC1A 4GKJJ 1UWBB 3DLBA 5CYMB 2QMUB 2B7BB 1XMQF 1K47A 4YDXA 2BR0A 4WP3A 1HPZA 2E7WA 3J7YU 4P2SA 3THTA 2EBEA 4DFKA 1DARA 5IT9Y 3CJQA 1T9UA 4L3KA 2FUG9 4OX9F 2XGQA 2ZZNA 3MXHP 4M5JA 3OUYA 3MEDB 5DDPC 1GMVA 4OZ2A 2VQFF 1BLUA 2KHCA 3HVWA 4Z7YA 4HTIA 4G1IA 4CO0A 2B9WA 4DR1J 4KO0A 1NK5A 2XMUA 4OHXA 2DT9A 1SJRA 4AYBD 2FLNA 4WK1A 1IWGA 1P9QC 2Z0GA 5BXIA 2HNYA 2KI2A 1SV5B 4DDFA 2Z2MA 3MCSA 1EIYB 1VLOA 2BQ3A 4K2XA 3ILOA 5JXSA 5KG5A 3PIPQ 2XM3A 1BD6A 3NL0A 2BKOA 4LF7J 1GX5A 4LRFA 2VHGA 4A8KA 2W9BB 1NJIT 2BE2A 1HW8A 3OHBA 4HDGA 3QGIA 1EKSA 3CCJS 2E1PA 1V3ZA 1F3FA 3BSNA 2XGPA 3QIPB 3CNQP 2HFZA 4C8YA 1H73A 1N56A 2ZZMA 4I68A 3G71S 2WK4A 2OP5A 1PAUB 4ED6A 2RB7A 5C42B 4LSZB 2QA1A 2HWIA 3TOQA 3VGVA 1TMMA 4UW2A 3DOLA 2BRKA 2D7SA 3U1MA 2NUHA 1AUDA 5AT1B 4DPOA 2ZNZA 2OHDA 3VCDA 3SSQA 3UNYA 4YOEA 4K4ZA 3ET6B 1WORA 4LRBA 2XLKA 3R27A 2AYBA 4CNZA 4JI6F 3M8YA 4DV0J 4Y2MA 1FKPA 5KFXA 3N4WA 1TU0B 3M8PA 2EEYA 2MZQA 3D3BJ 2AT1B 2CJXB 4EZ9A 2PA8D 3DLEA 5CAAA 2CG4A 3CJ4A 8RUCA 3U1LA 1VBYA 2CPHA 3VGSA 3LP2A 4ZCKA 3DRSA 3CJTA 3ZZTA 3T41A 5HMYA 2HIQA 3HVAA 5J2NA 2UVRA 4V19X 2O67A 1XQIA 1LK5A 4LBIA 4LF4F 3H4BA 1JQGA 3M6WA 1SI9A 4OHYA 2G9OA 5IQQA 1JLFB 3F73A 1Q7YT 2RU3A 1G1XA 2BABA 1R43A 2N3LA 1T11A 2DPJA 1I1GA 1TUWA 3W8PA 3IRXA 3EDRB 3CCWA 4USVA 3MZIA 1FA0A 1UFKA 1X4CA 1S57A 2JJ4D 5K8NA 5I4MA 3HKZD 1TL4A 2LQBA 4ZVSB 3TX0A 3C6TA 2HYIB 3T6JA 1PSDA 1G6BA 4LF1A 2MQMA 3TRGA 4M94A 1RHUB 3FDSA 1KC8T 1CQMA 1D9AA 4J37A 4LRAA 1FFGB 4TU7A 1Q8KA 2GVZA 1K9MT 4LF9F 3FEYB 4U7UK 1IKXB 2E1MC 3T5LA 5IQ6A 3JQKA 3RW7A 1WNEA 3G96A 3QT6A 1J5OB 1SL1A 1RWNB 4JI1F 2ZVSA 3FEZA 2MKYA 3SV3A 2JOQA 3TVZA 2V67A 2C2OB 2V4JA 1DQAA 3BYRA 1N33F 3U27A 2FGCA 4LR9A 1ITPA 1FDBA 3GIJA 3GIMA 2FHMA 3KJVA 4RW9A 2V2ZA 3NGDA 3Q8PB 1JLQB 2BA9A 1RHQB 4OZ1A 5IV3A 2GQQA 1DBDA 3CO0P 1HNZJ 3LP1B 2IVFB 1Q7LB 4JI7J 3FMWA 1KSPA 1FI4A 1S9EB 3AODA 3H40A 1NPKA 4ALZA 2X51A 1U1KA 3W63A 1FRLA 3PDNA 2RRBA 4R0EA 2DGUA 4DL0C 1N4LA 5D3GB 3AJDA 3T1HJ 4DF8A 2LQ9A 2ALYB 2B9YA 1FT8A 2EFGA 1N32F 3HZEA 1UKUA 1YJWS 4NCGA 2DNGA 5EHHA 1JKHA 1YKWA 4OZJA 1UVKA 1N48A 3M6XA 4AQYF 4O3OA 2H4WB 1RT6B 1AXQA 2Z58B 4Q2LA 3AJ1A 3H5SA 3ZNUA 2OGUA 4RUHA 1GTEA 3MM7A 2F8MA 4P72A 1BGXT 4YP3A 4NYZA 1HNIB 4WIQA 4IRCA 5C24B 3CWJA 4KGMA 2ADCA 5L1KA 3B54A 3UD4P 2YKNA 1KLMA 2QLFB 2WZ1A 3M8RA 2GMJA 1TL3A 4RNNA 3GU0A 2FHKA 3H5XA 3IR7B 5DM7Q 4IR1A 2NXUA 4OI3A 2CG8A 4A46A 1B3TA 2LXUA 4B3SF 4IG0B 3TAMB 1UP1A 3ILLA 3AFGA 5DQIA 2MKKA 2F40A 1WC5A 1VJWA 2YWWA 2KL8A 4TVAB 3IRWP 4ZPCA 1S5ZA 1ZTTA 1M90T 2MQPA 2YNHB 2DHHA 2L9NA 2VFSA 3BSOA 4TQSA 2A2CA 3GFXA 4E0DA 3HSZA 2LQ5A 4DSFA 3BGOP 1R3NA 2QGFB 3D7SB 2YNIA 5A76A 3OLBA 4X64J 4X66F 4MK7A 3V4MA 4RBUA 2K1RB 3SSSA 2J0XA 3PFEA 1CSJA 1WHWA 2P9GA 5J2PA 4B9UA 4JI4F 1S0NA 3R7SB 2HAFA 4RUAA 2R2TA 3RG6A 5KG4A 1GQEA 5HK4A 4DL5A 1C4CA 2XNRA 1YRTA 3D1QA 5F41A 2CQIA 2JLFA 5M2PA 1JLAB 1SC4B 4IR9A 3TZZA 3KG4A 2OLWA 1TR0A 1IBKF 1HBMB 4JI8F 1YWXA 4N47A 3M32A 5A0YA 2BXJA 1DTQB 4B9SA 3NGTA 3C6UA 2W4CA 4MIAA 3V4IA 2R42A 1V5VA 2CQPA 2E5LJ 1IR2A 3CC4S 4S0MA 3VVUA 2VFRA 2C2KB 1AYEA 1U4BA 2ADBA 2E66A 2HVEA 3UFCX 2MZSA 1FX4A 2Y1RI 2RILA 1H7WA 5K20B 2IAJB 2VQEJ 4EBEA 2A1BA 1Y5LB 1TAQA 4I64A 1PJ5A 1S49A 4YEAA 1U24A 1YJ7A 2DNLA 4J9UE 4CTAA 2H4YB 2GIFA 3LGNA 1HNVA 2OPSA 1LWEB 4GKJF 1HQUA 1RT7B 4MAKA 1FRMA 1TKZA 1FDNA 2HGMA 4JI0J 3G8QA 5LSOA 4Y00A 2ZH2A 4AXJA 3OR1B 1LWCB 4ANCA 1VK8A 4QIFA 1HNXF 1F1BB 4MKVA 1YX2A 3VQSA 1FEEA 4ZA1A 4LQ3A 1IXKA 2VJVA 2XC9A 4F4WA 1ZPWX 3T1YJ 1U47A 3R2CJ 4CH0S 1VHFA 2CWKA 3PO4A 4YQWA 3KK1A 1FHTA 4DV1J 1GK8A 3M2RA 1FJEB 2JX2A 1X9WA 3NCQA 5GMDA 3RB0A 1IBLJ 3I9ZA 4WBFA 1FD2A 1RZMA 1OIAA 3KLIB 2NLWA 3LO3A 5IV4A 2NYHA 3OXLA 2ABYA 1ZBTA 1UA1A 5E33A 3KKFA 1N88A 4ZPWR 1UJ4A 4A8MP 2AJ1A 5IWAJ 2HQFA 2QLBB 4C2MA 3K5OA 3VWSA 2QX0A 4LR8A 3ZZRA 2RT3A 1RTJA 3F44A 2OH2A 2IA6A 3GYNA 4LF7F 5ETKA 5KT2A 2CQHA 4XDDA 5KG1A 4NLYA 2L3MA 1S59A 2W2OP 2QC3A 4J9PA 3PEHA 5KFBA 2HZAA 2CKWA 2IDEA 3E01B 3PKMA 5D8HB 4QOTA 4ER8A 1FEHA 1BQNA 3A12A 1EKRA 1DRZA 3E2EA 1HPZB 2RIJA 5DG8A 1S99A 5KFWA 4NLDA 1NPRA 2ZH9A 4GC7A 4XK8C 4OJGA 4NRUA 1CS4A 2ERRA 4EUVA 3OUYB 3C8YA 4AT1B 1YBUA 1N36J 5IT4A 3OFEA 3OVSA 1TELA 4KO0B 3KUHA 2GIQA 1YRXA 3QT5A 4LFBJ 2W2QP 4F3OA 1X4DA 2KHDA 5F9NA 2P5VA 5EUHA 1KNZA 3UPFA 2HNYB 2B8PA 2AZ1A 3LAMA 4H4KC 4UUWA 4DV0F 1HYSA 5AXKA 2DR6A 1UVMA 5D15A 2GCFA 3GE9A 2I8EA 2K8GA 3LAKA 3JS9A 2MQLA 2JH3A 3NLCA 4AD6A 1TVRA 3AY0A 3OLAA 3GLJA 4I56A 1OYDA 1YZ6A 1D09B 2BE2B 4F26A 2J7KA 4WJBA 2VFTA 3D1OA 4RWXA 1VRTA 2OPPB 3GCWP 3QSYB 3HLUA 3SFGA 2ZWOA 4CLPA 4PQUA 1E6VA 2XB2D 4LQ9A 4RKUC 5K8MA 1Q16B 1WC3A 4ZVRB 3O1LA 2KO1A 1VHIA 2Y0BB 5KG0A 4ZCIA 2W7AA 3DOLB 1EAYC 1OPZA 3T5HA 9RUBA 4ZJLA 4KE5A 2YQ0A 3NNCA 4EGLA 2EKYA 2GMHA 1V6HA 3NWRA 5GAHU 3I6PA 1S72S 2DEIA 2JC0A 3K5LA 2DNHA 3OV7A 1F5CA 4O3RA 2MLXA 2D1CA 4K4VA 3E3XA 5KFMA 2HHHJ 3HFZB 1TZ0A 3NGSA 2X3GA 3HVRA 1FKPB 2QRRA 3LGMA 5HJYA 1U7LA 2AJ0A 1WC0A 1YLXA 3W65A 1IKYA 1AUSL 2OELA 2J0WA 3DRPB 2AD9A 2UUBJ 3DLEB 1WD6A 3WZ0A 1IN0A 1S4FA 3TUIC 2VBXA 2FJDB 4AE5A 3KG1A 3LP2B 5F8GA 3DRSB 4R8UA 2HFUA 5J2NB 2KJVA 4OI4A 1S77D 2IY5B 2F7VA 1PYTA 2MKSA 4AXIA 2RS2A 1RA6A 5A8WA 3OTOF 3IRXB 4IOBA 1BY9A 1U2CA 2M2BA 1QSYA 4MK8A 3Q86A 3KLFA 2OEMA 1HNZF 4ZVGA 2HURA 2M5YA 3C6TB 4QWAA 5E3PA 1LK7A 3BB5A 4N5SA 1JXVA 4DMZA 3PY8A 2Z30B 4A8QA 5KFGA 4OYPA 1NDCA 1Q8IA 2WB1D 4DI6A 3CB4A 2LYVA 2WOMA 3S6EA 3T1HF 3KYLA 3CMQA 4CCHA 4KRWA 2DR9A 2GVZB 5DM6Q 4IRKA 2QSWA 3TUPA 4YR3A 3R97A 4JI2F 2BE9B 2ZH4A 1T03A 5HQMA 1HNWJ 4RBVA 2IM0A 1URNA 2UUWA 1U8WA 3BKUA 2CQ1A 1EZZB 3GFZA 3BPSP 2GW8A 1IQZA 2VG6A 1WOSA 2V4JB 2AKWB 3MMCA 2CJAA 4K4TA 2AIRB 3K5PA 1EHWA 5FIIA 3KJVB 4RW9B 4ED1A 5HVGA 4J9QA 3AQPA 1UTAA 1TK5A 3F41A 1CULA 3JSBA 2DH8A 2LEPA 1U0HA 4FS1A 5DS7A 3GFYA 3B4DA 5KFHA 5I3QA 1RTDA 1EB0A 5IS2A 2ZM6J 3CDUA 2YX4A 2C3UA 4NZ7A 3EYZA 4IH7A 2B9EA 2HK2A 3IWLA 1R8HA 3DYAA 4CIOA 4LIWA 3UDEA 1NLKL 3QJPA 2IM3A 1N5QA 4NCGB 5KG6A 1JKHB 1DFDA 3HDSA 1APSA 2WBRA 4P2XA 1RT5A 2C2RA 3KJQB 2V8GA 4NYPA 2O66A 1MROA 5B7WA 4RJVA 4X64F 1S1VA 2XLIA 4P2MA 3KDNA 2LXIA 4CLKA 3ZXWA 4TLQA 3T1AA 4JV1A 4QYZK 4P71A 3MM7B 2VUGA 2DGQA 1R6YA 3KLEA 5A8KA 1VIXA 1VQYA 1QLNA 2DY9A 2YKNB 3RB6A 1KLMB 3EZ5A 2HVHA 4FYVB 2KVQE 3RYLA 4EO8A 1TL3B 1L3VA 3LANA 4P6QA 3Q22A 4MYTA 3FCVA 1NH8A 1RKIA 2DNNA 1O6XA 4J91A 3I56S 2E9TA 4FXDA 1RWVB 4DR7J 2FZGB 2KFYA 5KFRA 3D6TB 2E5LF 4U7UD 3UVJA 1R8BA 2IM2A 2HHTA 4LFAJ 1QUPA 1WC6A 4FF1A 1BXNA 4X4QA 3CTRA 3A8EA 3M8QA 5GAEI 3RBDA 4ZVHA 2VQEF 4WE1A 3V81A 2YNIB 4B9VA 2RQCA 3MR7A 1RCOB 3OR2A 1IQTA 3QNWB 3H2VE 1S1TA 5FLXY 1SH0A 5LJ3Y 1LKZA 5LOQA 1FDAA 3PHEA 4HHUA 3SCKE 4IDKA 3BR9A 1C1BA 5J2PB 4DFMA 4ECZA 3A4TA 2LU1A 3D6HB 1Y10A 1U1NA 5IM0A 1WEXA 1B99A 4NI2A 3RUBL 5CCLA 2Q6BA 1VQSA 3H20A 3OTBA 3T1YF 1HR0F 2AMCB 1F0XA 3AHPA 2XS5A 2G0CA 3L4BC 1HBUA 3RRHA 2HWTA 2J0QD 3NWGA 4C8NA 3M32B 1XC9A 4NLUA 3C6UB 1HI1A 2IRXA 2IC3A 3M9OB 2GGPA 3IAS9 3V4IB 4L76A 2VC0A 1ZM2A 3AXKA 2ZJPQ 5IWAF 2LEBA 3J81Y 3UI3A 2BJDA 5EN1A 4YB1P 2ROEA 3V6JA 3OL8A 2DO4A 5J2QB 2BJEA 3DM2A 3QMQA 4JV2A 4AUKA 5KFOA 2NZCA 2DNKA 1C0TB 4B3OA 4OHVA 4WP9A 1S0OA 2FY8A 5JVGQ 4CTAB 1C2PA 1Q4RA 1KHWA 2ZDOA 2EC0A 1HNVB 3P6YC 2OPSB 1HQUB 3GILA 4C0HA 3N5BA 1TKZB 5GADI 3QZ7A 3CJ3A 1S4EA 3RRKA 1R89A 2XS2A 4ZVFA 1D1UA 2VKZG 2EC2A 4USWA 3QRRA 2UVWA 4PYDA 4I2PA 4QZVB 2MQ8A 2SXLA 1QAYA 5IC4B 2CUYA 4QPXA 3DHWC 2IJFA 3PX0A 3NCRA 2QLWA 3QO9A 1N36F 2UXDJ 2FB0A 3C3LA 1SJ4P 3AOAA 4OYOA 4ZK7M 3KK1B 4FXWA 3M2RB 4ZPDA 4LFBF 2YTCA 2J7WA 3MI7X 3W2VA 1NEEA 2Y0SD 1PILA 1L3UA 2PFFB 2R8GA 1XBWA 2V2KA 3J7YI 3UWTA 2YNGA 3CJ2A 4CYUA 1TK0A 1D9DA 3KHGA 2XHCA 2D3ZA 1RTJB 3MOZA 4H4MA 1U0SA 4DV2J 4OYIA 5GVQA 4MKBA 2VODA 4DFJA 1VDHA 4LRCA 1X4BA 4PZVA 4WZQA 4TY8B 2W8LA 2AU0A 1KOOA 4I2QA 1CJKA 3KMQA 2DXFA 4WKYA 2I5JA 4ILLA 2Q43A 3ULHA 2A6MA 3QLHA 2HHXA 4DV5J 1NM2A 1BQNB 1VBKA 2EFOA 3L9ZA 2KM8B 2ASDA 4MMOA 2HS0A 2UXCJ 3GR1A 5LJ5Y 4I7FA 1WF1A 4OL8A 2YKAA 4MIWA 5LT5A 2VV5A 2A18A 1R0CB 3G6YA 1S7IA 2AYMA 3NG8A 3K0JA 1CS4B 5ETSA 3DLHA 2J5AA 1N0UA 4K0KJ 3QSIA 2ZHOA 4RL1A 5THWA 5B0FA 2RQ4A 2F9JA 3CCSS 1BQXA 2HLTA 2QFIA 3JSYA 2FHOB 1T9YA 2HHHF 1QE1A 3DMJA 1HYSB 4M5KA 4HYKA 2FVCA 3MCOA 4RPFA 4O4GA 2RDJA 1CQNA 1IVZA 2HHWA 2B4PA 2UUBF 3VV2B 1TVRB 5I3UA 5C2GA 2VPXB 3HPOA 4C98A 1VRUA 5CH7B 2AJFE 3K89A 3KWMA 2A6OA 4ICLA 4IH5A 4DU7A 4E98A 1VRTB 2HQCA 1CC7A 3BSAA 3NGKA 4KYZA 4ELTA 2AW0A 4K50A 3Q2TC 3ZTPA 4TYAA 1XEZA 2XZWA 3PEJA 4PQUB 4DR6J 1E6VB 2DGXA 2XO6A 1R27B 2B7CB 3H90A 5F3TA 2WSFC 3VAKA 2V34A 3RW6A 2FDNA 1Y7PA 1U02A 4NLVA 5KFQA 4DEZA 5U47A 1VC6A 2YY3A 4K4YA 4DQQA 4DR3J 3G87A 4LJMA 2YWKA 3UNGC 2YWEA 1KBRA 2GJIA 1CBKA 2XCAA 3NOGA 4YB6A 3HT3A 3QGHA 1KQFB 3G86A 4DSJA 3WX8A 1W2IA 3X3UA 3N01A 4KV8A 2IRUA 5H1SV 4C8KA 5L39A 4ILMA 1RAAB 4DZDA 4X4VA 2V8DA 4ATNA 4RBTA 3TR5A 1IKYB 2CPYA 5DG9A 1HNWF 3R5DA 2HWHA 2EI5A 3VAIA 2FVSA 4CP5A 3W7BA 2YPZA 1GXLA 2PEHA 1LWXA 4FYYB 2R7VA 3ISZA 2FHJA 2J8SA 2HBZB 4ZVUB 4KC5A 5AXMA 1FNOA 1FKOA 1RTHB 3D3CJ 2PI4A 4W4MA 3V6HA 1KFDA 4CH1A 1JK9B 1FESA 5A8WB 2LECA 2DH7A 1NJYA 3VAJA 3A8KA 2PE8A 2DEJA 2M8DB 3HO1A 2XMVA 3V2UC 3HZGA 3RAMA 3D2WA 3KLFB 3UCUP 4X62J 1NDKA 1OY6A 2N7CA 1FWKA 4DLEA 2V2QA 2P2CB 2N4CA 1YGYA 1TMJA 3US5A 1YG0A 1DHMA 2ZM6F 4F3QA 1CG2A 2RRAA 4CO1A 1F9EB 2DNZA 3A13A 3SQGB 5F8MA 3SMZA 2WOMB 2VPZB 2KM8C 1LW2A 2I6WA 4NA1A 4LUBA 5AJ3J 3CULA 2JC1A 1SJ1A 1RBAA 1T03B 4HVZA 4L3NA 3PO5A 1I6JA 2BKPA 4NLPA 1P1TA 1REVA 4W98A 4A8YA 3VZIA 1R7IA 1BWEA 3I87A 2VG6B 2G1DA 2R7QA 1WF0A 3AQOA 2FLLA 4IFYA 3LW5C 3BQ1A 1A0OB 2CDQA 2DGWA 4X4PA 1X5TA 4PXDA 3A8JA 3O5TB 2VBZA 2ZZTA 4MYUA 3NEKA 4ZIVA 4DF4A 2G1HA 3FCHA 4OZLA 1SC3B 3Q89A 3OL6A 4DUZJ 2JZ5A 5D4OA 1U0HB 4RNFA 1UZHA 1VISA 3D28A 3HSJA 2YBVA 1RTDB 3CVKA 3UDLA 4I1TA 4NMXA 1Q8BA 1H6KX 4XDCA 1K8AT 4Y2IA 1S6UA 5D78A 1JJ2R 3DYAB 3FUYA 2YWGA 3I0RA 4LFAF 2LA4A 2PGCA 3EGWB 2J9DA 2I2YA 2BJ8A 4HT5A 2AX1A 3BQ0A 1RT5B 2G4BA 3HFKA 5M2RA 1QSLA 1FJGJ 1MROB 3BDPA 4KSEB 3CC7S 4KIAA 1S1VB 3RRGA 1F3VA 1JWWA 4OYAA 3S8SA 4NXMJ 1PO6A 3Q0AA 4F4XA 2B0GA 4UOGA 3ETOA 5K9FA 2LLZA 3KLEB 2DHSA 5A8KB 2VQFJ 3PW4A 4KR0B 2KU7A 4C8ZA 2W8KA 2DPIA 4MKYA 1NK7A 4GC6A 1NH7A 2G0JA 1FRXA 3MFHA 4XPEA 4AFFA 4DX7A 3CD5A 3AT1B 3BGRA 3R6GB 3VAMA 3I0SA 3PJXA 3W8GA 2BJ3A 4HHHA 3H98A 2ZH7A 5HQ8A 4ZVPB 2P9EA 2W4DA 2W2NP 2FPHX 1QDUB 3JXOA 4WFXA 3UVJB 3KFWX 2HS4A 2A3JA 1H38A 3CJ0A 5L1IA 2V8HA 1F5BA 3M8QB 1DY3A 3CDBA 2H51B 4WE1B 3M05A 5JMNA 1VC0A 1N8RT 3UCGA 4WWSA 1ZAVA 2I0XA 3V81B 1BHNA 3FQKA 2WSCC 1HWJA 4K4UA 1HL6A 3CSKA 2XQCA 1Q79A 1DURA 4URGA 2AWZA 3FK4A 3OR2B 1K0VA 1S1UA 4WKRA 5K14A 1KEKA 1S1TB 1WJ9A 2P9CA 3Q8YA 2J9CA 4IDKB 3HF5A 1C1BB 1UPPA 2V50A 5IT0A 3PW0A 3Q8QB 5IM0B 4NI2B 2AJ2A 3JAMY 2UZAA 3CCUS 2FJVA 2WW4A 3HHLD 3DDNA 3MGJA 4F4KA 4LBHA 4DPTA 1BQMA 5BR8F 4OLOA 1HBUB 3FSYA 1HKAA 2QYCA 1CLFA 1IBMF 2AEFA 3DN9A 4DQPA 4TN2A 3BN4A 4U8VA 2IC3B 1OS5A 2PMWA 4K5SA 1VQMS 2GGPB 5D4LA 2IYIA 2R7XA 1VOMA 2CADA 4J9VA 1UWAA 3MPDA 3IN5A 4XAKA 2Y8WA 4DV2F 5A2QY 1DQ9A 3DM2B 2AV5A 2V9WA 1WOOA 3MM8A 2RQKA 4B3OB 4LF4J 1X4EA 5CHCB 2ZH1A 1VQNS 3G6VA 5KG2A 3G6ES 1MWYA 3O44A 5F8HA 4ZPTR 2VKRA 5CA5A 3NKYA 4OHZA 4QYRA 2DH9A 5JVHQ 2D3OR 4DV5F 4WCEQ 1ZM3A 2YXLA 4F0KA 3EICA 3C19A 4M5NA 3QGGA 2MMYA 3GSIA 3VAFA 2K3IA 2JDJA 4ERDA 5KT7A 2E5IA 1FWPA 4JUZA 3NS6A 2R7RA 4I2PB 3BDEA 3FCWA 2XLJA 3I96A 5HJXA 1XMOF 3W60A 3D54A 3J7ZT 4A8SA 2J8AA 3QO9B 4K0KF 2AX0A 2B4OA 1XMBA 5KT4A 3GMGA 1XR6A 2VA2A 1JLGA 4CI0B 1I3OB 1UETA 3NMAA 2VG5A 2CDRB 3W2VB 4LF9J 1FFWB 1SIWB 1X5OA 4U95A 4QR0A 5ADZA 4B9MA 4CLLA 3V6DB 2C22A 4NZ6A 1HBOA 2YNGB 1RE1B 4CYUB 1N5YA 4F4YA 4N8OA 1S6PA 2V8PA 3NS5A 4X4SA 3K5NA 4H4MB 3M6VA 3CD6S 5J2MA 5T14A 3LPYA 3OBIA 3P3DA 2MKIA 2IA0A 2V68A 2BM0A 2C42A 4F50A 4I2QB 4OHWA 1CJKB 2DB1A 2KFZA 4KY3A 2I5JB 3A3NB 3N6MA 3QFWA 3T19A 5L1LA 2EFPA 3UD5A 1K73T 5DG7A 5A8RA 1C0UA 2LXFA 2DYAA 4DR6F 3Q83A 3QRQA 1F9HA 2R8KA 4I7FB 4DHVA 4ZVQB 3PX6A 3BGFA 1RBOB 2UU9F 3IG1A 4NLSA 3GG0A 2I38A 5CD4A 4CLYA 4USJC 4DR3F 2XEXA 2RF2B 4JI5J 4F0HA 4U7CA 1UVLA 2BW7A 1Q5VA 2EG2A 1PGZA 2OEKA 5F8IA 2F9DA 2VBWA 2G2ZA 3CDWA 1RWPB 4UY8T 3HJFA 5DDRC 2GHPA 3Q23A 1QE1B 3DMJB 4J90A 2ZKUA 2NXNA 4C8MA 3LPEA 2JLGA 3D6FB 3PIOQ 2ZOFA 4WYLA 2QT7A 2ZH3A 5MLCV 5G0RA 3EX7B 4O4GB 4NLOA 4P74A 3VHQA 3T5KA 1NBEB 1U2RA 4ELUA 2JEJA 5I3UB 3DLJA 2XMMA 5GAHI 1VRUB 2C3YA 2L48A 1YVFA 4PWUA 3V5RA 1ZAWA 2M52A 1SBRA 4AL7A 4ICLB 5ETMA 2HFSA 1RHRB 5ETVA 1OPIA 2VPYB 1DJ0A 3WBZA 3I55S 1M1KT 3FZ2A 1MLAA 1RHKB 1XIQA 1HI8A 3UR0A 1R31A 3E8OA 1WC1A 3W5YA 5KOXA 2YWFA 3PACA 1NU4A 4CT9A 2EFVA 2EVZA 1XTZA 3GFHA 4F2SA 4IH6A 4F02A 4X62F 2EW9A 2GFFA 1KP6A 1HWLA 1QVGR 1DTQA 1YDLA 4QWCA 3W1YC 3D0IE 1Q86T 4B3SJ 1RXOB 2C2ZB 4N76A 2MZJA 2BM1A 4DS5A 3TZXA 1S0MA 3OJUA 1SKWA 1T94A 5ETOA 4UUXA 1AZSA 3H0PA 4KV8B 1KQSR 1OWXA 2HAIA 3P5BP 3ENQA 2GJ2A 4WTOB 5KG7A 1D3WA 4ZCMA 5AJ3F 2HRTA 2WHOA 4ES2A 2UV8A 3SCIE 3PNIA 2MGZA 1UVNA 1BC6A 3O6QA 4FVCA 1J2VA 2MZTA 5E3CA 2NYIA 5T41A 4QPTA 1REGX 1V3RA 4Y0FA 4KGKA 3HM9A 3KOAA 2PC6A 5M2UA 3GV8B 3UN5A 1AB8A 1FKOB 3ADAC 5KFSA 2W7OA 2R7UA 3W9HA 1Z2ZA 1HWIA 2GHWA 3R1HA 4NRTA 4DCPB 1ZA2B 1KVJA 5IFMA 4ILRA 2HRYA 3G82A 2KB2A 1FKAF 2HHVA 4F25A 4OFZA 3KJNB 3DRRA 3HD2A 4BLGA 2IM1A 2ASJA 4KKOB 4NPOA 1WKJA 1K44A 2RKIA 3JSMA 1U1LA 5CABA 1ZAXA 1VMBA 2ZJRQ 1LW2B 2JWNA 1RTZA 5DO2A 4HI1A 3ZTOA 4DL7A 2Z2YB 3J80Y 4DX8H 5HN0A 1B0VA 4M63A 3KK3A 3AOBA 1XNQJ 2XTJP 4HTJA 4WFYA 4CO2A 2RH3A 1RHMB 3EVMA 4PPZA 4RNMA 2OFHX 2W4PA 3AD9C 2O01C 3MPVA 2KJWA 4DS4A 3H8YA 1FJGF 2FZCB 2WSEC 1REVB 4BHQA 1OY8A 2QL9B 4UZCA 3CC2S 2IVMA 1Q78A 2VL1A 1HNXJ 1NHUA 2M9KA 1KLNA 3K58A 3H2UB 4IFYB 4J9KA 4MFBA 4NXMF 3MEEA 3HT0A 5EX3A 1U1QA 4DV7J 4CO4A 2JFDA 4DBQA 4AL5A 2M3DA 3Q2SC 2AEJA 1PCAA 3D67A 4V1Ak 1W7WA 2D3UA 3CMAS 3IO1A 2BRLA 4ED5A 3UW1A 2CNKB 3GJSB 3MMBA 1KQGB 1X8DA 2CQBA 2QMWA 4U96A 1NK8A 2XO7A 4DR4J 2B4UA 2ZOMA 5DZ7A 5FJ4A 4HH1A 1RWWB 1H2UX 1YK9A 4ZS6A 3W66A 5B0EA 3ETMA 1S6OA 2P6SA 1WDDA 1L3TA 3QJLA 1S10A 1GMWA 5HAOA 3RBEA 3I0RB 1OSCA 4FS2A 2WAQD 3MAHA 2NSCA 2MKJA 1R8AA 5EX0A 1SJ3P 4WYWA 5D4PA 1Q81T 4O3SA 4ANEA 5D0RA 2OPPA 3CJ8A 3BKTA 1A6LA 2C2NA 4P73A 3CJ5A 4URQU 1UJ5A 2WB4A 4FVMA 1DQ8A 2UUTA 4C4WA 2DHGA 3TQ1A 1ZTWA 4OI6A 1FXRA 2X3DA 3M1VA 4PPDA 3MTKA 4HACA 2J9DE 3SYZA 4P75A 4PR6A 2H5IB 2YWHA 1T9XA 4WU2A 2CAJA 5EDWA 2DGOA 4OYMA 2OPQA 4EFAC 2DCLA 3MHYA 4RU2A 2VZ9A 2G2YA 1MSWD 3GJQB 3LWLA 4OLPA 1BWVA 5B0AA 2QL7B 1TL5A 4OI1A 5LMNJ 2NQPA 3NNHA 1RAOA 1URRA 1KR4A 4BBYA 3BGRB 1NK4A 1MMLA 4NMLA 3I0SB 2EFQA 4DLGA 4EEYA 2NR0A 4R0JA 3RJMB 4BCAA 4ECSA 3WIVA 1IKWA 3FSXA 1WHYA 1P6TA 2YKPA 3PJWA 3BZQA 3DRPA 2GC8A 2HBYB 3CDAA 2I1RA 2PD1A 1NPPA 2NUUG 3PHTA 4MH8A 1EP4A 1WI8A 4LSNB 2FC8A 3Q8UA 2HHUA 4Y34A 1VQ4S 2PA3A 1UFWA 2ZHAA 4V19J 1YJVA 2M7SA 4ZDNA 3CJSA 2C1EB 2KFNA 2HBRB 3BO2A 3IWNC 4IO1A 4I6YA 2EPIA 4ZLLA 3ZZOA 2CZVC 5A6WA 1S1UB 5K14B 4J7CA 2IJNA 3CW2C 1YTYA 3FGVA 2QZ8A 4MIBA 4RUCA 4IUFA 3C66A 4NXNF 1S12A 4C8LA 1VJQA 2ZOGA 1BQMB 1QAJA 1E6YA 3TW0A 1UEVA 2WVBA 2COLA 1H98A 1N6QA 2XY5A 3SDEB 4Q7AA 3NAIA 1LXNA 3VF0B 3MWBA 2ASYA 2NS1B 3IXQA 5LSLA 4I67A 4X4NA 1NDPA 2VD3A 1YSJA 2JEIA 4WFBQ 1UVJA 1TAUA 1HQEA 5KOWA 5KFPA 2DK2A 4C6AA 4H4OA 1TV6A 3TVKA 3EZOA 1TUGB 3KDOA 3MM8B 2OFGX 2GHVC 1H74A 3MR2A 1N5VA 3OTOJ 2VB6A 1J5EJ 4DV6J 1WEZA 2CIMA 4URSA 2Y1IA 3L7PA 3ZZUA 3KNAA 2ZE2A 3HI9A 4JP8A 5EWFA 1S1XA 1IBCB 4M5HA 5KFYA 3BQ2A 1NXIA 3HMJG 4JI5F 2VDHA 4IOCQ 1FCAA 2PN6A 2D74B 4GVBB 1TKTA 1Y5IB 3M9MB 3ISNC 3LGHA 1HARA 4FPRA 3SSRA 3D6MB 1JLGB 1FRKA 2VG5B 2OD6A 2GQCA 4CM0A 2V4RA 3NOCA 4NLRA 4ED8A 6FD1A 1PAEX 3MM5A 4X84A 4JI2J 2KT3A 1NNDA 1HBOB 2JVRA 1QAIA 1U1OA 2CQGA 1N5YB 4B3TF 1GMUA 1S6PB 1NSPA 5B0DA 1M5HA 2CA9A 5J2MB 2BMBA 5H9FK 1IJEB 3N6LA 3OTDA 2QFJA 1M5PC 4RR5A 2H9ZA 2JL9A 2VBYA 1Y3JA 1F5AA 3M30A 3MOJB 1DZ5A 1LWFB 4QU7A 1O8BA 1PKUA 3CE8A 5A8RB 1C0UB 3DI6A 1PC5A 3EGNA 1KTQA 4YN3B 3HHKA 3N79A 5IT9U 1T95A 2XI3A 1MMNA 3GR0A 3IG1B 4FF2A 4LF2A 1FVQA 4K2JA 3PFOA 3M4XA 4EMDA 1T8EA 3TUJC 2N82B 2R2SA 1H2TZ 3TA0A 2VICA 3TANA 3DFEA 2B8QA 2XWYA 3R6LB 4WU3A 2Q79A 3N5FA 3WC2A 3AD8C 1L5UA 1KTVA 2RDIA 3QAEA 1UFLA 3DOMB 1YJUA 3RBXA 3RAQA 2CJYB 2BW2A 3CD0A 4J9SA 4RUBA 4DU8A 5G0RB 1RWKB 4O44A 3OJSA 2CVIA 2K3KA 2XCPA 2FGOA 2D69A 1SC1B 4UOCA 1SCJB 2AZ3A 3HFVA 4RNOA 3UN3A 3IWXA 3SZ2A 1NSQA 4USKA 2HKEA 2FJWA 4LBPA 1K1QA 4P10A 4IG3A 1R0BG 3KLHA 5J1NA 2H1YA 4NLWA 2FHJD 4PEOA 1VIOA 4ZITA 3THVA 4I0WA 1SQEA 4KH0B 4FF4A 1RB0A 1QVFR 2Y1LB 2ZKTA 4MKAA 3OL9A 4Y65A 3C15A 3RAXA 1KWMA 5BYQA 3AA8A 1S6QA 1GXTA 2M88A 1VQLS 4IKAA 3IA0A 2DD8S 2ZNYA 4MK9A 4J9NA 4CLSA 1NHKL 3I82A 1CC8A 3MEKA 5HATA 4DUYF 2EG1A 1U6ZA 2KYZA 2RHQB 1AZSB 5CZXA 4GVLA 5J2QA 1W25A 4NCAA 2HHSA 3GG1A 1LOUA 4IFVA 1C0TA 4MTPA 2VOOA 2ZWPA 4KB7A 5LMUF 3HXMA 3HHEA 2MGZB 2R2RA 2F8EX 4ED4A 3WHIA 1XNQF 5EWEA 2IRYA 1ZM9A 2Y9HA 2YX7A 3G4SS 1VQKS 5GMEA 4ES1A 2MDAA 5CXTA 4CLTA 3G6XA 4LF6J 4LIRA 2WVFA 3UCZP 4NWBA 2W01A 4RO0A 2E5GA 4J5OA 5FD1A 5AE3A 3DDIA 1HHSA 2XY6A 4C3KA 4DV7F 2H3EB 1HR0J 2PIIA 1AT1B 2HNDA 2HNZA 3DU6A 3KHLA 3QIDA 3QBCA 1WSVA 1BE4A 3G82B 2KN4A 2NSBA 2UUCJ 3RZAA 1CJTA 2CNLB 3B82A 5AE2A 3DRRB 1VQPS 4DR4F 3EVWA 1P8GA 1RT1B 2RKIB 3JSMB 1ZH5A 4CLFA 2E1AA 2ASLA 2UXBJ 3CCLS 3DNCA 2OEJA 2Z4PA 3NNAA 2MQQA 5B0GA 1NUEA 1YITS 3OFFA 4PWDA 4TY8A 3Q8VA 3KK3B 2WBMA 1IUJA 1T3NA 2WVEA 2ZUGA 4C3MA 3OT9A 4EU0A 1S1WA 1GEHA 4Z2XA 4PQAA 2RSQA 2F65A 1NMEB 4DXLA 2MQOA 3M2UA 3MPYA 1HD1A 1VYAA 5LXRA 2KZMA 4RW8A 4FYWB 2F63A 2CPJA 3ISND 3IS9A 4F4AA 1FTRA 4MFBB 3TEHB 1VQ7S 3PRDA 3ELHA 3MEEB 1LXJA 2FYXA 3FJ2A 2C3PA 2RDDA 3JSRA 3DLGA 2HQDA 2QJ3A 1NZ8A 1FXLA 5F8NA 1FDDA 2PFDA 5LMNF 4NASA 3MMBB 4LT6A 2X1FA 1K1SA 4NLXA 1VCTA 2UVUA 3J81j 1OYEA 4PG7A 4O0IA 2JEGA 2GAHC 2BJ7A 1ZPVA 5HO4A 3MURP 3EE3A 3CCES 3QWUA 5AXLA 3BGUA 1UA0A 2OUGA 2KXNB 2OSQA 3FRZA 3HJVA 2ZC4A 3TP2A 2N7YA 1UW9A 4DV3J 4R5PA 3PR5B 4HDHA 2KG0A 1VK3A 4ID5A 5DDQC 1WG5A 2AGPA 1Y3KA 1RWUA 1TL7A 2IJRA 2R8JA 2ACMA 4FDFA 3CGIA 3M1VB 4Q0BA 2QL5B 2OO4A 2QSFA 4HACB 3IFEA 2YH0A 3NAHA 3RTVA 1RDRA 2G2OA 1SL2A 3TJ8A 3MTJA 4P7VA 2OPQB 5IXUA 3IBCB 2MXYA 3DCAA 2C2EA 4LFCJ 3HHDA 5IZHA 2JHEA 2Q1LA 4A47A 2XMWA 4PXBA 2CQ3A 1GFWB 3CUNA 3ICLA 4DX6A 3M7VA 7FDRA 3FSIA 3CCVS 2RNEA 4NZ0A 4B3MJ 1IKWB 4EK2A 2LQJA 4ZKAA 4NEZA 4DQRA 2CJKA 4ETXA 1EP4B 3CJKA 3CCTA 4TXSA 4C11A 1KFSA 2IIHA 3QYYA 1W2BR 3D68A 1VGYA 1X4AA 3IR6B 3SQOP 1RKJA 1LFWA 1RTHA 3BREA 3KLGA 3KMSA 2AHOB 1G2EA 1SJQA 5F3ZA 5T7LA 4YB5A 2QEXS 3KJFB 1DTTA 3FRYA 1MU2A 2BJ9A 2X1GA 4LF8J 4DL3A 3VGTA 1J5EF 5C25A 4W92B 2MTLA 4DV6F 1YIJS 2DNPA 2O1PA 1F6TA 4CLUA 1TTHB 2J0SD 1KKHA 5LL6d 2DTJA 1RUSA 3R1LA 3W5ZA 2U2FA 4K8RA 1YJTA 3PYDA 3JB9k 2DO0A 3RBZA 2ROPA 4M5DA 1RSCA 4FN5A 1PYSB 3E51A 1HQ2A 3SQGA 2DVIA 1E6YB 1U6BA 5FDLA 5HQLA 3FFIA 1XWLA 4B17A 5KAKA 1N6QB 4M8LA 3CO9A 1QUVA 2BQRA 1AROP 4PXCA 2N4DA 2IPOB 6AT1B 3QJJA 1HD0A 1YHQS 2MLYA 4YR2A 4USUA 5IC6B 2ROGA 3DLKA 3JQJA 4LSLB 2MY7A 2W1BA 3GWCA 1HQEB 3RR7A 1GX6A 3ENVA 4H4OB 4I4BA 1TV6B 3N6NA 4ZVTB 2J6SA 2W9AA 3G8TA 2HZVA 4AL6A 4RZRA 3KXDA 1YJNS 3NBPA 2W2PP 5ITHA 2V9KA
chains in the Genus database with same CATH topology
4YHHJ 4K0KJ 3R2CJ 4DUYJ 4LFCJ 4JI6J 4V1Ak 4DR3J 4DV1J 3R2DJ 1XNRJ 3OTOJ 4JI3J 1N36J 1J5EJ 2UXBJ 1IBLJ 2KL8A 4DV6J 4X62J 4LF4J 2E5LJ 4RJVA 4NXMJ 5LMUJ 1I94J 4NXNJ 2MEWA 1XMQJ 1IBKJ 4JI8J 1N32J 4DV4J 4DUZJ 4LFBJ 4DR4J 5IWAJ 4DV2J 5LMNJ 2VQFJ 4B3RJ 5LM7E 4DR1J 5A2QU 3J81U 4YY3J 2VQEJ 4KY3A 2UUAJ 4B3MJ 4LF6J 4DR2J 4HHUA 4JI1J 4DV3J 4NEZA 4OX9J 5IT9U 3W1YC 4X64J 4AQYJ 4JYAJ 4NEYA 1N34J 5AJ3J 2HHHJ 1XNQJ 3J7AN 5BR8J 2KVQE 1HNZJ 2F4VJ 2ZM6J 4DV5J 1XMOJ 1N33J 4JI7J 1HR0J 4JI0J 1IBMJ 4GKKJ 4X65J 4LF5J 2MQ8A 4PWWA 2UU9J 5FLXU 3J80U 4DV0J 2UXCJ 2UUBJ 4LF7J 4X66J 4KYZA 4JI5J 1HNXJ 3JAMU 3IMQJ 4LF8J 4JV5J 4DR7J 4JI2J 2UXDJ 4DR6J 4KHPJ 3D3CJ 2MTLA 1HNWJ 3D3BJ 4GKJJ 2UUCJ 4LF9J 3T1HJ 4DR5J 4JI4J 3T1YJ 4DV7J 4B3TJ 4LFAJ 1FJGJ 4B3SJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH J;  4K0K J;  3R2C J;  4DUY J;  4LFC J;  4JI6 J;  4V1A k;  4DR3 J;  4DV1 J;  3R2D J;  1XNR J;  3OTO J;  4JI3 J;  1N36 J;  1J5E J;  2UXB J;  1IBL J;  2KL8 A;  4DV6 J;  4X62 J;  4LF4 J;  2E5L J;  4RJV A;  4NXM J;  5LMU J;  1I94 J;  4NXN J;  2MEW A;  1XMQ J;  1IBK J;  4JI8 J;  1N32 J;  4DV4 J;  4DUZ J;  4LFB J;  4DR4 J;  5IWA J;  4DV2 J;  5LMN J;  2VQF J;  4B3R J;  5LM7 E;  4DR1 J;  5A2Q U;  3J81 U;  4YY3 J;  2VQE J;  4KY3 A;  2UUA J;  4B3M J;  4LF6 J;  4DR2 J;  4HHU A;  4JI1 J;  4DV3 J;  4NEZ A;  4OX9 J;  5IT9 U;  3W1Y C;  4X64 J;  4AQY J;  4JYA J;  4NEY A;  1N34 J;  5AJ3 J;  2HHH J;  1XNQ J;  3J7A N;  5BR8 J;  2KVQ E;  1HNZ J;  2F4V J;  2ZM6 J;  4DV5 J;  1XMO J;  1N33 J;  4JI7 J;  1HR0 J;  4JI0 J;  1IBM J;  4GKK J;  4X65 J;  4LF5 J;  2MQ8 A;  4PWW A;  2UU9 J;  5FLX U;  3J80 U;  4DV0 J;  2UXC J;  2UUB J;  4LF7 J;  4X66 J;  4KYZ A;  4JI5 J;  1HNX J;  3JAM U;  3IMQ J;  4LF8 J;  4JV5 J;  4DR7 J;  4JI2 J;  2UXD J;  4DR6 J;  4KHP J;  3D3C J;  2MTL A;  1HNW J;  3D3B J;  4GKJ J;  2UUC J;  4LF9 J;  3T1H J;  4DR5 J;  4JI4 J;  3T1Y J;  4DV7 J;  4B3T J;  4LFA J;  1FJG J;  4B3S J; 
#chains in the Genus database with same CATH topology
 1FK9 A;  2DIU A;  4EBC A;  4NOH A;  4NX9 A;  5D0G A;  2XZD B;  3M6U A;  2XMT A;  5MAO A;  1VC5 A;  2ZE2 B;  1ROF A;  4FBT A;  3D0H E;  4QJV A;  4NLT A;  3ITH A;  4OQJ A;  1S1X B;  3HVT B;  1FVS A;  1OO0 B;  2ILY A;  2M8H A;  2IBK A;  2V4Q A;  3BEG B;  2HZC A;  2BOP A;  1KVK A;  3MR5 A;  5EGY A;  4IYQ A;  2D3O 1;  4YY3 J;  2QMX A;  1TKT B;  5ETQ A;  1KDN A;  2ILZ A;  2V5H G;  1RLC L;  5B08 A;  4DSE A;  4TKT A;  1N5T A;  3J7A N;  4QIW D;  1PBA A;  1M1G A;  4KFB A;  3H2L A;  2MST A;  4OI2 A;  3NCP A;  1KD1 T;  1TUV A;  1ICE B;  3MM5 B;  3B8H A;  1X0F A;  1NRK A;  3QPI A;  1VS3 A;  1X9S A;  1AFI A;  2CFX A;  2UVV A;  2ZH6 A;  2DR7 A;  3GV5 B;  2XSJ A;  1RAE B;  5D4N A;  2PMZ D;  4O0N A;  4FXV A;  2VIH A;  2ZVI A;  8ATC B;  5GMK a;  3C14 B;  3OVB A;  3CDE A;  3M30 B;  4OV6 A;  5F9L A;  1RU2 A;  4FPI A;  3GIK A;  4ECT A;  4OI0 A;  1RBL A;  2VON A;  1T05 A;  3DI6 B;  4CO3 A;  4ECX A;  4JBC A;  2KVI A;  3T6B A;  2IFX A;  3LF0 A;  4ZOS A;  4YB7 A;  2DKO B;  5CYJ A;  2FLO A;  1FF2 A;  3M9N B;  3CD7 A;  2YH1 A;  5C7P A;  4Q8E A;  1EX8 A;  3MFI A;  2KXF A;  2H54 B;  4CLZ A;  5L8R C;  4IQX A;  2BZ2 A;  3F56 A;  5K5M A;  2CZ4 A;  1S76 D;  4GKK F;  1FRI A;  1I51 B;  5KT6 A;  4LF5 J;  3TAP A;  1HMV A;  2PT0 A;  3W3S A;  3WC0 A;  2D41 A;  3D4J A;  5GAG U;  2YKM A;  4GO5 X;  2ZFH A;  3MUT P;  3W61 A;  2XZT B;  3GB0 A;  4O44 B;  4YHH J;  1QTM A;  2HFV A;  2R8I A;  2LVW A;  5BYR A;  4O3P A;  4OJ1 A;  1XNR J;  1ZZN A;  3SI8 A;  1TKX A;  1Y00 A;  4LF6 F;  2LCW A;  4OYX A;  3CXC R;  3UQS A;  5E7O B;  3OW2 R;  4IG3 B;  1GNK A;  3HHN B;  3HP6 A;  1S9F A;  3KLH B;  4RW4 A;  4I69 A;  2KYX A;  1SKU B;  1FE0 A;  1M5S A;  3SCJ E;  2E7X A;  1P27 B;  3NRB A;  4Q45 A;  4ZP7 A;  3MD3 A;  3BYP A;  1EQM A;  3C15 B;  1Q0N A;  3PKY A;  2UUC F;  1H2V Z;  1TP7 A;  1ULR A;  1OQ3 A;  2GVD A;  1S6Q B;  2J76 E;  2RD5 C;  1KRP A;  3IM9 A;  1WG4 A;  2UP1 A;  1X7V A;  1RLD A;  5B0B A;  2UXB F;  2ATL A;  1TK8 A;  5H9E K;  1D8Y A;  4M5I A;  1F2G A;  1X4H A;  1Y5N B;  1C4A A;  2ALZ A;  1SKR A;  1V9O A;  5H9F J;  3R5A A;  5ETP A;  5KFA A;  1XER A;  4IFV B;  4X4O A;  4QWE A;  4ZLN A;  1O5J A;  4DX5 A;  4F8R A;  2PMH A;  1X4F A;  2DNQ A;  2BYC A;  1S9G A;  1LFP A;  1FXD A;  3VQT A;  5A6P A;  2RRN A;  3BBC A;  2BUN A;  2R7O A;  3V6K A;  1IM4 A;  3KHR A;  3PRB A;  2BBE A;  1RWM B;  3BH7 B;  4ZPA A;  3RU0 A;  4ZJQ A;  4PUO A;  3BV8 A;  2W7P A;  1WHV A;  2QN6 B;  3FZB A;  3B4M A;  1KON A;  5DLG A;  4ZVE A;  2HND B;  2HNZ B;  2KH9 A;  3GJT B;  5BR8 J;  1Q95 G;  5HVH A;  2GO8 A;  4M5L A;  1FRJ A;  3I5A A;  3L7O A;  5KFD A;  5K8P A;  1IBM J;  4WFA Q;  5SZT A;  1HIY A;  4M5M A;  3OD2 A;  1CJT B;  2CQ0 A;  2F5G A;  2NXE A;  1KHV A;  4JV5 J;  3P45 B;  2F1F A;  2GZO A;  1UPM B;  3V6D A;  3HD1 A;  5KFT A;  3GII A;  3A8I A;  2MB0 B;  2J9E A;  1EET A;  3MDF A;  4C3L A;  3KG0 A;  4OZ3 A;  2OTL S;  1PJ7 A;  2FVQ A;  2ZIT A;  3QAT A;  1Z1Z A;  1RAG B;  4RU9 A;  2KRR A;  2QLX A;  4PWD B;  3BSC A;  1JJH A;  1B0P A;  4FKY A;  4DV3 F;  3R5B A;  1D9F A;  3EPG A;  4KAI A;  1GMW D;  3P49 B;  1S1W B;  3AH6 A;  2A0F B;  1OJ4 A;  4N56 A;  4B3R F;  3KNG A;  4DN9 A;  5DJB A;  2DNR A;  4KQZ A;  4ECY A;  5DET A;  2UUA F;  1PIE A;  3TX8 A;  5RUB A;  3LA0 A;  3M2U B;  2R8H A;  2VAS A;  4PCQ A;  4J9O A;  2JNJ A;  1VQO S;  4QR2 A;  4RW8 B;  4Q8F A;  1UEK A;  3TI0 A;  2BAN A;  3IS9 B;  1XMO J;  3N9U C;  4FKX A;  2RF2 A;  4ETZ A;  1MN9 A;  2DIV A;  3G8S A;  2B43 A;  4LFC F;  2V94 A;  4PRF A;  1NB7 A;  4ITS A;  4F04 B;  3DLG B;  4KHP F;  5DQH A;  1HWK A;  3O3L A;  3OQ2 A;  2XG8 A;  5I42 A;  2FZK B;  4F67 A;  1RT3 A;  2BDP A;  3MCN A;  3LWM A;  1RAB B;  4FP9 A;  2RU9 A;  3WQP A;  4OJ3 A;  3IGV A;  3IP0 A;  2PSZ A;  4B3M F;  5AE1 A;  2OIH A;  1O0P A;  1Z4U A;  3KUG A;  2OTJ S;  4X4U A;  2CPD A;  2VFU A;  1NCL A;  1FE4 A;  1IR0 A;  3P8B B;  2YPY A;  4R5P B;  1X5P A;  2R2U A;  4OMF G;  5KFZ A;  4G1Q A;  4ID5 B;  4DR2 J;  4QCL A;  1VR6 A;  4DL2 A;  3PZP A;  2AP6 A;  4NEY A;  4LF8 F;  1TL7 B;  3PW5 A;  1HFE L;  3AA9 A;  2HVZ A;  3G2X A;  5HI7 A;  1J27 A;  4Q0B B;  2B6A A;  2ZH8 A;  4DSK A;  1WKK A;  2NXJ A;  2KTQ A;  1TKD A;  3N0V A;  3EGV A;  3IBF B;  2UU9 J;  1LNQ A;  3BBB A;  2JFK A;  4IO9 Q;  4A8X A;  4USH A;  4Q44 A;  1SQF A;  4Y2K A;  1VBZ A;  1L3S A;  3H25 A;  3KHH A;  2O5D A;  4UTG A;  5J1E A;  4ECV A;  2K7J A;  3W9I A;  2HGL A;  2QA4 S;  2E44 A;  2V6A A;  4ECW A;  2IMW P;  3IAM 9;  3CPW R;  3HHL A;  4KGX B;  4DQS A;  1SPB P;  1HHT P;  3KLV A;  4Z37 A;  2VG7 A;  4WFZ A;  1CJU A;  2DRB A;  2V8V A;  3R2D J;  2HVD A;  2FJB B;  3LH2 S;  4OX8 A;  4ZLJ A;  3EM1 A;  2Q66 A;  1BUX A;  4B9N A;  3L3C A;  1TL1 A;  2WTF A;  2VPW B;  2DIS A;  4LVN P;  3EPI A;  3GQC A;  4I6A A;  4DR1 F;  2AYE A;  4HEA 9;  2ZBQ A;  4K59 A;  3O8W A;  5E2Q A;  3ZZ0 A;  5F0U A;  1JJ4 A;  3MR6 A;  1HWU A;  1FX2 A;  3CJK B;  4FYX B;  1RTI A;  4C11 B;  2X7I A;  4OYB A;  3I32 A;  4JYA J;  2K2P A;  3QRP A;  4B08 A;  3H5Y A;  3KLG B;  1CEZ A;  1MMD A;  1H3D A;  5T7L B;  3ENA A;  3NY0 A;  1DTT B;  4UOH A;  1MU2 B;  1B7F A;  3GON A;  4ZP8 A;  3OPK A;  3GP9 A;  3H5U A;  4UQG A;  2WON A;  1HBN A;  4RW6 B;  4WK3 A;  3BR8 A;  5C25 B;  3OXF A;  2GJF A;  5FLX U;  1FJ7 A;  4A4J A;  4K4S A;  4QW9 A;  3FBF A;  2XSF A;  3CIM A;  4DG1 A;  1SB6 A;  4BWM A;  4LVO P;  2MJU A;  3BKF A;  4DZ6 A;  4KKO A;  2ZBR A;  3CCM S;  4DN0 A;  1FD8 A;  4M5D B;  1Q5Y A;  4YY3 F;  2DGS A;  4Z7C A;  2J6U A;  5FDL B;  3FFI B;  3DGP A;  4Y28 C;  3BJY A;  5IOL A;  1I94 J;  1RK8 A;  3NS7 B;  2XYP B;  2DCU B;  3EMT A;  4FF3 A;  1KVI A;  1WI6 A;  4ENO A;  2AJ4 A;  3ZNJ 1;  1SUQ A;  4XIU A;  2HBQ B;  3J81 U;  4DL6 A;  1RGV A;  3LUY A;  3I31 A;  2RAQ A;  5HBM A;  2DNY A;  3NXZ A;  4B02 A;  2KDO A;  1EQ0 A;  2HHQ A;  3DLK B;  1PYO B;  3UD3 P;  1NK9 A;  4JV0 A;  3K17 A;  3T5J A;  2F4V J;  4ECU A;  4PXE A;  3EVO A;  4DPY A;  1XN9 A;  3NBP B;  2POK A;  4RLE A;  4Q43 A;  2LQ8 A;  3IMQ J;  2OSR A;  1FK9 B;  1RU1 A;  3FBE A;  4BDP A;  4F3M A;  4E8U A;  4K4W A;  2DGV A;  4KGZ B;  3ITH B;  2RVJ A;  2HQ3 A;  3K2Y A;  1JB0 C;  3HCX A;  1T9V A;  3M2V A;  4C48 A;  2GML A;  1TFW A;  3K8V A;  2VC1 A;  2XHW A;  3BN7 A;  3MUM P;  5HLF A;  1LW0 A;  2E7V A;  1JNZ B;  4WZM A;  4NYO A;  3JYT A;  4UST A;  5LM7 E;  2XS7 A;  1ELO A;  7FD1 A;  4QIG A;  1R8P A;  2BV3 A;  4P7T A;  4LF5 F;  4KFB B;  3SFU A;  2GS8 A;  2V63 A;  3OTE A;  4O3N A;  3BH6 B;  1VQ5 S;  2IHR 1;  3RB4 A;  1RA7 A;  3B6B A;  2C2D A;  4GMK A;  2CNN B;  1ACM B;  3CME S;  1QY7 A;  2JEF A;  1P1L A;  2XSJ B;  4YHH F;  2FJA B;  3HUL A;  2YNF A;  1TFY A;  1XR7 A;  3R5G A;  3H59 A;  2OD4 A;  3UDC A;  1XNR F;  1QM9 A;  2HLU A;  1KOH A;  3J7A 1;  2MKH A;  1UCN A;  1R8C A;  3AB2 B;  4CDI A;  3M8P B;  2G0I A;  5E3Q A;  2FJX A;  3UO0 A;  1RAD B;  2LU2 A;  1T05 B;  1KN6 A;  2RHS B;  1U2F A;  3A1Y G;  1AW0 A;  3I4P A;  3MM9 A;  2CJB A;  2Y3Y A;  4FNI A;  2VH7 A;  4Y6I A;  2ZJQ Q;  1T0T V;  1N54 B;  2VDI A;  4L72 B;  1V5I B;  1RP5 A;  4CH7 A;  3DOK A;  3I9V 9;  1FTC A;  4ED7 A;  2MHE A;  1N5S A;  4WPA A;  3MD1 A;  4TY9 A;  2AJQ A;  1N34 J;  2VJU A;  2MHN A;  2BJ1 A;  4G3I A;  5ETR A;  4OX6 A;  2EXU A;  3RB3 A;  1HMV B;  4JI7 F;  4LSN A;  1B0T A;  4N7T A;  2HFN A;  1TQL A;  5JUM A;  1F9F A;  2YKM B;  1BMQ B;  2VF3 A;  3ZTQ A;  3BO3 A;  4CM2 A;  4MJK A;  2NPF A;  1WEL A;  2ZBI A;  4A48 A;  4DFP A;  2XBP A;  2Z56 B;  4DCO B;  3GV7 B;  3RGI A;  1TKX B;  2IDL A;  2BOA A;  1U1P A;  2CQC A;  1RIS A;  4KHR A;  3VZH A;  2RML A;  1FWL A;  3A3P B;  1X0P A;  1WC4 A;  3OSN A;  2CPI A;  3ZO7 A;  1UEU A;  3MMJ A;  4RW4 B;  2B3T B;  2HEK A;  2B9X A;  3MPW A;  3R7N B;  2MEW A;  3C16 A;  1CJV A;  2HMI A;  2ACY A;  1B4S A;  4NCB A;  3AB4 B;  2L08 A;  1OSD A;  4YDD B;  3S1T A;  3WIU A;  2Q3P A;  1QJH A;  3SDE A;  4ZN3 A;  5KFN A;  5DGA A;  2Y1J A;  2GVD B;  1R0A A;  4JV5 F;  1JLC A;  4TQR A;  3W64 A;  5B09 A;  1AFJ A;  5HSP A;  3QQC D;  1NSA A;  1Q53 A;  1JXL A;  1T02 A;  3HK2 A;  4H54 A;  1GAO A;  2CRL A;  5CZV A;  2RE1 A;  2F3J A;  3T3F A;  9ATC B;  3VAL A;  3TA1 A;  1RI7 A;  1MWZ A;  1S9G B;  5KT3 A;  4QIV A;  2ZD1 A;  1Y0H A;  1DLO A;  3H42 A;  1S97 A;  5KFU A;  3MM6 A;  3TUZ C;  2OJ3 A;  2RUG A;  3VVT A;  2MKC A;  1RWO B;  4YFU A;  4B9T A;  3L09 A;  1UJ6 A;  2OML A;  5CD4 H;  5J1P A;  4NXN J;  1Z2L A;  2E29 A;  5LXY A;  4PUO B;  4X4T A;  2ZHB A;  3PTW A;  1M1H A;  2FQQ B;  4YME A;  4U9R A;  2FLP A;  1WUU A;  3NP5 A;  4GVB A;  4F4Z A;  1RAC B;  3VGU A;  3CJR A;  4YS2 A;  2QA4 G;  4ECQ A;  2AQ4 A;  5E0O A;  5DQG A;  1RYS A;  3ILJ A;  5ETL A;  4LMZ A;  1PBU A;  2NZ4 A;  3M8Z A;  4MT1 A;  3QGP A;  2YKO A;  1WG1 A;  2YX1 A;  4YUD A;  3Q8R B;  3EWG A;  3ZFV A;  3H4D A;  1A9N B;  2L9D A;  2H5E A;  1EET B;  1RAI B;  4R25 A;  4ZP6 A;  2HQG A;  1IR1 A;  4DR5 J;  2RS8 A;  3OVA A;  2XMA A;  3A3O B;  1GXU A;  2MZ1 A;  1OQ6 A;  3KUE A;  1VLY A;  2E9Z A;  4XTT A;  2MZR A;  3PJ9 A;  2JLE A;  3DHX A;  2BKN A;  1YRU A;  4WF9 Q;  4C0B A;  4ZIW A;  4DR2 F;  1LWF A;  4CO5 A;  1FER A;  2A2D A;  3GCX P;  2QG9 B;  1G4C A;  3MF5 A;  2RUS A;  1HA1 A;  3GIR A;  4DPU A;  2P6T A;  3L7U A;  5KFF A;  2O3D A;  5F8J A;  5HAN A;  1WF2 A;  4UOF A;  1RQ0 A;  1X5S A;  5HMW A;  2BAN B;  5K8O A;  3Q24 A;  3FEX B;  1U6F A;  2NXC A;  2DXE A;  3P5T L;  1IM6 A;  1S48 A;  4KPY A;  4X2B A;  4RX6 A;  3QT8 A;  1I5O B;  1QTN B;  4JI0 F;  3AXM A;  1W26 A;  2W9C A;  3KK2 A;  4HL9 A;  5I42 B;  1WHX A;  2AYG A;  1DAX A;  2Z57 B;  3DC2 A;  4PG8 A;  2CXE A;  1RT3 B;  4O23 A;  3DOM A;  4DSL A;  3VAG A;  2M70 A;  1KS2 A;  5H9E J;  3J7Z 5;  4B3T J;  4USI A;  7AT1 B;  2IMO A;  3MEG A;  4EI2 A;  4M95 A;  3TNV A;  2HK3 A;  4DV1 F;  1X9M A;  3CIZ A;  1WEY A;  5CYQ A;  1IBL F;  1WSR A;  1NKB A;  5A0Y B;  2DGT A;  1K0T A;  3MUV P;  4M1K A;  2CVE A;  2PO4 A;  1FNM A;  4JYA F;  4G1Q B;  5HP1 A;  1X31 C;  5KG3 A;  5BYS A;  1O51 A;  2AEM A;  1QSS A;  1ZA1 B;  2CWX A;  1Q82 T;  1XJW B;  3D5M A;  2GNK A;  2B6A B;  1JX4 A;  1VRQ C;  1UW4 A;  1U1R A;  4EO6 A;  4ZN1 A;  2XYG B;  3PCO B;  1FO1 A;  2ZBP A;  3N28 A;  2CJ9 A;  1IKV A;  5BJR A;  2X1A A;  2OMO A;  1NJX A;  4DOZ A;  4HR2 A;  4X65 J;  5J1E B;  1JXE A;  3OFG A;  1S7H A;  3IM8 A;  2YVS A;  1MG7 A;  3HHL B;  4OYZ A;  3FBB A;  1VQ8 S;  3MMA A;  2VG7 B;  1CJU B;  1UAW A;  1M0S A;  1B64 A;  5E41 A;  1I94 F;  1NZA A;  3SEO A;  1SH2 A;  2UV8 G;  1TL1 B;  2C2M B;  4WTY A;  3TQE A;  1OY9 A;  2QV6 A;  4ZPV R;  2XMK A;  3LP0 A;  4KGV B;  4CRJ A;  2E1R A;  1JLB A;  2XY7 A;  4OIX A;  2Y8Y A;  4BS2 A;  4UZB A;  1M5K C;  1RTI B;  4UY8 5;  2M0G B;  2F4V F;  3DXS X;  2W24 A;  3FKB A;  2R3V A;  4O3Q A;  1MWQ A;  1RT4 A;  4PYA A;  2RJZ A;  1Q1K A;  3NMR A;  4UF4 A;  1RT2 A;  3HKW A;  3AAW B;  2BQU A;  2WON B;  1HBN B;  4ED2 A;  2FVR A;  2ZBC A;  2CPZ A;  3W2W A;  4DL4 A;  1SL0 A;  2C3M A;  2WW8 A;  4F36 A;  4DG1 B;  2YQ1 A;  1G7C B;  2GX8 A;  1U1M A;  4QWB A;  3ZZZ A;  1MN7 A;  4E2F B;  3HX9 A;  2R7W A;  3JAM U;  4LRD A;  5DRK A;  1L3K A;  2D9O A;  4G1P A;  2QO3 A;  2YKQ A;  3M8W A;  3R8Y A;  2L41 A;  3R9L A;  1RT1 A;  1LV5 A;  3R3T A;  4DUY J;  4TU8 A;  3I4H X;  2OPR A;  3DGP B;  4KHM A;  5F8L A;  5KFL A;  5KFJ A;  1SXL A;  2MY8 A;  2EFN A;  1U09 A;  1FFS B;  1AA1 B;  3SCL E;  5LMU J;  3EUN A;  2J7U A;  1SUQ B;  1P9Y A;  4G65 A;  2GQ2 A;  5HBM B;  2K7K A;  3OHA A;  3SV4 A;  4NA3 A;  3DXB A;  1UZD A;  1NO8 A;  5A2Q U;  4CT8 A;  4WXW A;  2DBB A;  5EWG A;  4ZVO B;  2CYY A;  2LDI A;  2ZEJ A;  3U02 A;  4QR1 A;  5DGB A;  4I6W A;  3MR3 A;  3ZTR A;  4FBU A;  3GJR B;  4F2R A;  1C1C A;  1XK8 A;  5DLF A;  5F0W A;  2L9W A;  3POT A;  2R9L A;  4LR7 A;  4EWT A;  5HMZ A;  2QIF A;  2HHP A;  3GYX B;  5HMX A;  4D3G A;  5HL7 Q;  4JB8 B;  4YR0 A;  4J9L A;  2WVC A;  2HS3 A;  2BE7 D;  1R6V A;  2FJE B;  3NGU A;  5KFK A;  2W25 A;  3GSD A;  3TZW A;  3M2V B;  3CF5 Q;  1T9T A;  4LRE A;  4P9S A;  5HLF B;  1LW0 B;  3UR3 C;  4A8W A;  3JYT B;  1ZS6 A;  1UVI A;  2QTW A;  4Q5V A;  1N34 F;  1HHQ A;  4OZ0 A;  2MSS A;  2V69 A;  1RAF B;  3UE2 A;  2PDA A;  4QU6 A;  2YQ3 A;  1D8Z A;  5L38 A;  3EJM A;  1QD1 A;  4NE9 C;  2KG1 A;  1JLE A;  4C7Q A;  1LQ9 A;  2AGQ A;  2KKH A;  1MW7 A;  2CJQ A;  2EKN A;  3CCZ A;  3WX4 A;  2EWH A;  4RW7 A;  2YNF B;  4L6V 3;  4TLR A;  4ZHR A;  2CNO B;  2OI2 A;  3HHL C;  4ZP9 A;  5ETT A;  1N0V C;  2QA2 A;  3EZU A;  2HPU A;  1WDT A;  2LP4 A;  4DQI A;  1RYR A;  4EBD A;  4BWJ A;  5B0C A;  3MEC A;  3ZTS A;  4KBI A;  3PYG A;  1GTH A;  5GAG I;  3P96 A;  2V2V A;  1CVJ A;  3AOC A;  2CQ2 A;  3MM9 B;  4R8U B;  3PX4 A;  3D1H A;  3I5B A;  1HLW A;  5G4D A;  1SKS A;  3ENW A;  4JI3 J;  4C97 A;  2H65 B;  2HQI A;  1FJC A;  3DOK B;  4IRD A;  3U1N A;  2Q6C A;  3AD7 C;  4K4X A;  2CQ4 A;  3MAA A;  1SJF A;  1Y9O A;  1NJZ A;  2AF6 A;  3D0G E;  3BGL A;  1T7P A;  1YQH A;  3FC9 A;  1ZM4 A;  2H5J B;  1RHJ B;  3G9C A;  4JOU A;  1YJ9 S;  2XUL A;  4FYD A;  4DCJ B;  1D0E A;  3THP A;  3QZ8 A;  1RAH B;  2WCX A;  5HVF A;  5L1J A;  4ED3 A;  4O4R A;  4OV1 A;  1IJF B;  4F0M A;  5HRO A;  2B5J A;  4U8Y A;  4DSI A;  1U8S A;  4D3H A;  3C46 A;  4HLB A;  4DUT A;  2LMI A;  2R4F A;  3BM7 A;  2M4M A;  2LFV A;  4B9L A;  2VOP A;  4U67 Q;  1YZ7 A;  1UWB A;  5CYM A;  3ZZY A;  1UMJ A;  4HT7 A;  5KFC A;  4USM A;  4TYB A;  4AND A;  3C16 B;  3TJ9 A;  1CJV B;  2HMI B;  2CPX A;  4PAA A;  3LQV A;  1U45 A;  2BVZ A;  4WII A;  1RWX B;  2H48 B;  2D9P A;  1NKE A;  3MCM A;  4DV4 J;  2LA6 A;  5D0E A;  4CNY A;  3MMC B;  3CCR S;  1WTB A;  2WRM A;  1OMS A;  1R0A B;  2MQN A;  1JLC B;  3MED A;  1H7X A;  2HG4 A;  2Z8Q A;  2C3O A;  4N8N A;  4LSL A;  5KT5 A;  2U1A A;  4KPC A;  1CUL B;  8AT1 B;  4ID8 A;  4WP8 A;  2GAG C;  1ZYQ A;  4CLW A;  4DR5 F;  1NK6 A;  2BAC A;  4P2F A;  4ED0 A;  2KZZ A;  4PWW A;  4M5G A;  1SV5 A;  5I3P A;  4XPC A;  4DR7 F;  2LKZ A;  2ZD1 B;  1DLO B;  4QQB A;  3MM6 B;  2R7T A;  2FVP A;  2HSE B;  2R7S A;  2W9B A;  1SVD A;  1YJR A;  4Y2A A;  4P52 A;  3IBW A;  1HI0 P;  1X60 A;  2ZUA A;  3HVT A;  4HH0 A;  2QYG A;  3R7B B;  3TO8 A;  3QIP A;  4EZ6 A;  2IYG A;  3F0N A;  3K5M A;  2ATC B;  3S7R A;  3KTQ A;  1XMQ J;  1PC4 A;  5D0H A;  4HI2 A;  2C28 A;  5C42 A;  4L73 A;  1H0H B;  3CED A;  4OX9 J;  4IOA Q;  3QAU A;  3DLL Q;  3FNN A;  1U48 A;  4ZPB A;  4TNO A;  4Q2M A;  3GYG A;  1F60 B;  2QLJ B;  5KFV A;  4A8O A;  4N41 A;  1NJW A;  4ZMM A;  3AJ2 A;  1WTF A;  4L74 A;  3FVY A;  3TJA A;  3J80 U;  5AXN A;  1RAJ A;  3ET6 A;  1JIH A;  4DWI A;  3C14 A;  3PG9 A;  3QFH A;  1M5V C;  1NK0 A;  5KFE A;  1VQ9 S;  2DHA A;  5C5J A;  2HFO A;  3PV8 A;  4Y3C A;  2DNO A;  1H72 C;  5KTQ A;  2Z2L A;  3DU5 A;  4ES3 A;  2DNM A;  1X4G A;  3TAR A;  2VFV A;  3EXY A;  5E5N A;  3UN2 A;  1JLF A;  3R5J B;  3DDK A;  4HHJ A;  2PEB A;  4X65 F;  5L9N A;  2DRD A;  2W9C B;  3KK2 B;  1ZET A;  4RNH A;  1WWH A;  3OSP A;  2XWX A;  2MPU A;  4KJI A;  4PAB A;  3W9J A;  3FQL A;  2QE5 A;  2PI5 A;  1VBX A;  4QW8 A;  3TEG A;  2UXD F;  3VAH A;  3MEG B;  3K7R A;  3K59 A;  4OX7 A;  1NDL A;  4RWW A;  4OYW A;  3T9N A;  4J9M A;  1VI7 A;  5CYQ B;  1S79 A;  4JI6 J;  2JRS A;  5HP1 B;  1YBT A;  3RR8 A;  1IKX A;  2DRA A;  2DY1 A;  4ZLP A;  1Y4Z B;  4C0O C;  3GZ7 A;  1SC6 A;  2VU5 A;  1T9W A;  1J5O A;  3OFH A;  2IBO A;  3MPU B;  3QT7 A;  4K7Q A;  3LOU A;  5E3R A;  4OJH A;  5L9X A;  1ZZF A;  3P4U B;  4L75 A;  4CQ1 A;  3PR4 A;  4OZ5 A;  3O2I A;  1IKV B;  2JSX A;  2E5J A;  4WXO A;  4EYI B;  4QYZ J;  4NA2 A;  3PM9 A;  2NCK L;  4PG6 A;  4ZJO A;  2JVO A;  1JLQ A;  4DPW A;  4GKK J;  3MMA B;  2UXC F;  1VFJ A;  3LP1 A;  2CQD A;  2CZ9 A;  1PJ6 A;  3HSD A;  1S9E A;  3NGR A;  3TZY A;  2FTR A;  3PYE A;  5L46 A;  3ILI A;  2BEF A;  3LP0 B;  5D3G A;  1JLB B;  4PG5 A;  3PVX A;  2OAU A;  4PG4 A;  3GTY X;  4GRS A;  3SIP B;  5CCM A;  4KT0 C;  2EBG A;  3VR1 A;  1RT4 B;  4CWB A;  1WAC A;  1V3S A;  2DR5 A;  1NB2 A;  2DXD A;  1RT2 B;  3D9B A;  2HVI A;  4A8F A;  1U49 A;  1RT6 A;  3W5X A;  2KT5 A;  3W2W B;  3JTN A;  4JI1 J;  2BX6 A;  3Q8S B;  2G13 A;  2E9R X;  1EJ7 L;  5DDO C;  3K57 A;  5KFI A;  5LSR A;  2ZH5 A;  1N33 J;  1SQG A;  1HNI A;  5C24 A;  3QLH B;  1SIZ A;  3BO4 A;  1B70 B;  2B51 A;  4XO0 A;  2LDY A;  2IVY A;  3TA2 A;  2KRB A;  2OPR B;  2K06 A;  4U6P A;  4PKD B;  1YBA A;  3MAQ A;  1YI2 S;  1WKL A;  4KH1 B;  1A7G E;  4CZC A;  2GV1 A;  4Y2C A;  1M5O C;  4IG0 A;  3TAM A;  1SH3 A;  2HW3 A;  3TVY A;  3CT9 A;  4K5R A;  4BC9 A;  4ZCL A;  3DRY A;  1U26 A;  2CPF A;  4IQM A;  5D6G A;  1N32 J;  3OTC A;  1VQ6 S;  3VTI A;  2E1C A;  2J6T A;  2LEA A;  3M8S A;  3LTO A;  2YNH A;  3SXL A;  1WOP A;  2P8I A;  3C2P A;  2KT2 A;  4DPX A;  5SUH A;  4AQY J;  3BF4 A;  1Y11 A;  1C1C B;  1EAR A;  3POT B;  4EYH B;  2RQM A;  4ELV A;  2HRU A;  2K1R A;  4C8O A;  2CPE A;  2NRE A;  1UL3 A;  1NHV A;  2FY1 A;  1RCX B;  3ZZP A;  4WFN Q;  3TWZ A;  4QWD A;  3BBF A;  1GH8 A;  4UT4 A;  4FZV A;  4JI3 F;  4H4K A;  3EGZ A;  3JTP A;  4W90 B;  1Q8L A;  5JJB A;  1KQK A;  3TYT A;  1JMT A;  1NSK L;  2FC9 A;  1JLA A;  5GAE U;  3PW2 A;  2E5H A;  3CCQ S;  2DHX A;  2B56 A;  4NL5 A;  2GO9 A;  1NAQ A;  1HBM A;  1T3O A;  3LAL A;  4QIE A;  3DGV A;  4TU9 A;  1S0V A;  3DRX A;  4ECR A;  2XNQ A;  2XYH B;  2HIY A;  2GIR A;  2ZDP A;  3FMB A;  2B4V A;  5E3A A;  1QAX A;  2HGN A;  1JLE B;  3W62 A;  4KTQ A;  2WVD A;  4B3R J;  4DJB A;  4RW7 B;  2UUA J;  5D77 A;  4ZHR B;  4NLQ A;  1F2H A;  2NPI A;  3D66 A;  1LEO A;  3IR5 B;  3PRV A;  3L95 X;  2FIU A;  4N77 A;  2IAJ A;  2MLZ A;  2OKQ A;  3U7J A;  2DIT A;  4QBU A;  3WDO A;  3IGN A;  3I5C A;  4FNH A;  3H7H B;  3MEC B;  1HW9 A;  1LWE A;  2A10 A;  2ZC3 A;  3R5C A;  1RT7 A;  2N3O A;  4X66 J;  3BPD A;  2XI2 A;  1JJC B;  3EXC X;  3HSG A;  3QWP A;  4KHP J;  4C9D A;  4GO7 X;  2EK1 A;  3OR1 A;  1LWC A;  1N52 B;  4JI4 J;  3JQM A;  3GPA A;  4HKQ A;  3X1L B;  4DV4 F;  3DKD A;  2APO A;  4NLG A;  3ONQ A;  1RJJ A;  4J9R A;  2FD2 A;  2Z2Z A;  4UQT A;  1MNE A;  3OXG A;  2KXH A;  2X1B A;  3MAA B;  2I9S A;  4G6V B;  4OZN A;  1IBK J;  4JI8 J;  4DUZ F;  5ETN A;  3K8W A;  2F4F A;  3KLI A;  3PW7 A;  1FRH A;  2DJW A;  5GAD U;  1NKC A;  3UDV A;  3OL7 A;  3B78 A;  2MJN A;  3S01 A;  2VA3 A;  2EK6 A;  3PYF A;  1B7Y B;  2DR8 A;  3ZC4 A;  4BC7 A;  1G3O A;  4RW6 A;  2F8H A;  4F7V A;  1U25 A;  2AGO A;  3SBM A;  2GA7 A;  2XMJ A;  5HRO B;  2B5J B;  5CQG A;  1ZOT A;  3PXG a;  1JNR B;  6FDR A;  2W2M P;  1PG5 B;  2MYF A;  3TAQ A;  3T9Z A;  3BS9 A;  1FNX H;  3EDQ B;  1IWA A;  5C2C A;  5DZ6 A;  1GT8 A;  4X4R A;  1XR5 A;  2V0N A;  1CPZ A;  3JTO A;  3E01 A;  3FBC A;  3IC1 A;  4GKJ J;  1UWB B;  3DLB A;  5CYM B;  2QMU B;  2B7B B;  1XMQ F;  1K47 A;  4YDX A;  2BR0 A;  4WP3 A;  1HPZ A;  2E7W A;  3J7Y U;  4P2S A;  3THT A;  2EBE A;  4DFK A;  1DAR A;  5IT9 Y;  3CJQ A;  1T9U A;  4L3K A;  2FUG 9;  4OX9 F;  2XGQ A;  2ZZN A;  3MXH P;  4M5J A;  3OUY A;  3MED B;  5DDP C;  1GMV A;  4OZ2 A;  2VQF F;  1BLU A;  2KHC A;  3HVW A;  4Z7Y A;  4HTI A;  4G1I A;  4CO0 A;  2B9W A;  4DR1 J;  4KO0 A;  1NK5 A;  2XMU A;  4OHX A;  2DT9 A;  1SJR A;  4AYB D;  2FLN A;  4WK1 A;  1IWG A;  1P9Q C;  2Z0G A;  5BXI A;  2HNY A;  2KI2 A;  1SV5 B;  4DDF A;  2Z2M A;  3MCS A;  1EIY B;  1VLO A;  2BQ3 A;  4K2X A;  3ILO A;  5JXS A;  5KG5 A;  3PIP Q;  2XM3 A;  1BD6 A;  3NL0 A;  2BKO A;  4LF7 J;  1GX5 A;  4LRF A;  2VHG A;  4A8K A;  2W9B B;  1NJI T;  2BE2 A;  1HW8 A;  3OHB A;  4HDG A;  3QGI A;  1EKS A;  3CCJ S;  2E1P A;  1V3Z A;  1F3F A;  3BSN A;  2XGP A;  3QIP B;  3CNQ P;  2HFZ A;  4C8Y A;  1H73 A;  1N56 A;  2ZZM A;  4I68 A;  3G71 S;  2WK4 A;  2OP5 A;  1PAU B;  4ED6 A;  2RB7 A;  5C42 B;  4LSZ B;  2QA1 A;  2HWI A;  3TOQ A;  3VGV A;  1TMM A;  4UW2 A;  3DOL A;  2BRK A;  2D7S A;  3U1M A;  2NUH A;  1AUD A;  5AT1 B;  4DPO A;  2ZNZ A;  2OHD A;  3VCD A;  3SSQ A;  3UNY A;  4YOE A;  4K4Z A;  3ET6 B;  1WOR A;  4LRB A;  2XLK A;  3R27 A;  2AYB A;  4CNZ A;  4JI6 F;  3M8Y A;  4DV0 J;  4Y2M A;  1FKP A;  5KFX A;  3N4W A;  1TU0 B;  3M8P A;  2EEY A;  2MZQ A;  3D3B J;  2AT1 B;  2CJX B;  4EZ9 A;  2PA8 D;  3DLE A;  5CAA A;  2CG4 A;  3CJ4 A;  8RUC A;  3U1L A;  1VBY A;  2CPH A;  3VGS A;  3LP2 A;  4ZCK A;  3DRS A;  3CJT A;  3ZZT A;  3T41 A;  5HMY A;  2HIQ A;  3HVA A;  5J2N A;  2UVR A;  4V19 X;  2O67 A;  1XQI A;  1LK5 A;  4LBI A;  4LF4 F;  3H4B A;  1JQG A;  3M6W A;  1SI9 A;  4OHY A;  2G9O A;  5IQQ A;  1JLF B;  3F73 A;  1Q7Y T;  2RU3 A;  1G1X A;  2BAB A;  1R43 A;  2N3L A;  1T11 A;  2DPJ A;  1I1G A;  1TUW A;  3W8P A;  3IRX A;  3EDR B;  3CCW A;  4USV A;  3MZI A;  1FA0 A;  1UFK A;  1X4C A;  1S57 A;  2JJ4 D;  5K8N A;  5I4M A;  3HKZ D;  1TL4 A;  2LQB A;  4ZVS B;  3TX0 A;  3C6T A;  2HYI B;  3T6J A;  1PSD A;  1G6B A;  4LF1 A;  2MQM A;  3TRG A;  4M94 A;  1RHU B;  3FDS A;  1KC8 T;  1CQM A;  1D9A A;  4J37 A;  4LRA A;  1FFG B;  4TU7 A;  1Q8K A;  2GVZ A;  1K9M T;  4LF9 F;  3FEY B;  4U7U K;  1IKX B;  2E1M C;  3T5L A;  5IQ6 A;  3JQK A;  3RW7 A;  1WNE A;  3G96 A;  3QT6 A;  1J5O B;  1SL1 A;  1RWN B;  4JI1 F;  2ZVS A;  3FEZ A;  2MKY A;  3SV3 A;  2JOQ A;  3TVZ A;  2V67 A;  2C2O B;  2V4J A;  1DQA A;  3BYR A;  1N33 F;  3U27 A;  2FGC A;  4LR9 A;  1ITP A;  1FDB A;  3GIJ A;  3GIM A;  2FHM A;  3KJV A;  4RW9 A;  2V2Z A;  3NGD A;  3Q8P B;  1JLQ B;  2BA9 A;  1RHQ B;  4OZ1 A;  5IV3 A;  2GQQ A;  1DBD A;  3CO0 P;  1HNZ J;  3LP1 B;  2IVF B;  1Q7L B;  4JI7 J;  3FMW A;  1KSP A;  1FI4 A;  1S9E B;  3AOD A;  3H40 A;  1NPK A;  4ALZ A;  2X51 A;  1U1K A;  3W63 A;  1FRL A;  3PDN A;  2RRB A;  4R0E A;  2DGU A;  4DL0 C;  1N4L A;  5D3G B;  3AJD A;  3T1H J;  4DF8 A;  2LQ9 A;  2ALY B;  2B9Y A;  1FT8 A;  2EFG A;  1N32 F;  3HZE A;  1UKU A;  1YJW S;  4NCG A;  2DNG A;  5EHH A;  1JKH A;  1YKW A;  4OZJ A;  1UVK A;  1N48 A;  3M6X A;  4AQY F;  4O3O A;  2H4W B;  1RT6 B;  1AXQ A;  2Z58 B;  4Q2L A;  3AJ1 A;  3H5S A;  3ZNU A;  2OGU A;  4RUH A;  1GTE A;  3MM7 A;  2F8M A;  4P72 A;  1BGX T;  4YP3 A;  4NYZ A;  1HNI B;  4WIQ A;  4IRC A;  5C24 B;  3CWJ A;  4KGM A;  2ADC A;  5L1K A;  3B54 A;  3UD4 P;  2YKN A;  1KLM A;  2QLF B;  2WZ1 A;  3M8R A;  2GMJ A;  1TL3 A;  4RNN A;  3GU0 A;  2FHK A;  3H5X A;  3IR7 B;  5DM7 Q;  4IR1 A;  2NXU A;  4OI3 A;  2CG8 A;  4A46 A;  1B3T A;  2LXU A;  4B3S F;  4IG0 B;  3TAM B;  1UP1 A;  3ILL A;  3AFG A;  5DQI A;  2MKK A;  2F40 A;  1WC5 A;  1VJW A;  2YWW A;  2KL8 A;  4TVA B;  3IRW P;  4ZPC A;  1S5Z A;  1ZTT A;  1M90 T;  2MQP A;  2YNH B;  2DHH A;  2L9N A;  2VFS A;  3BSO A;  4TQS A;  2A2C A;  3GFX A;  4E0D A;  3HSZ A;  2LQ5 A;  4DSF A;  3BGO P;  1R3N A;  2QGF B;  3D7S B;  2YNI A;  5A76 A;  3OLB A;  4X64 J;  4X66 F;  4MK7 A;  3V4M A;  4RBU A;  2K1R B;  3SSS A;  2J0X A;  3PFE A;  1CSJ A;  1WHW A;  2P9G A;  5J2P A;  4B9U A;  4JI4 F;  1S0N A;  3R7S B;  2HAF A;  4RUA A;  2R2T A;  3RG6 A;  5KG4 A;  1GQE A;  5HK4 A;  4DL5 A;  1C4C A;  2XNR A;  1YRT A;  3D1Q A;  5F41 A;  2CQI A;  2JLF A;  5M2P A;  1JLA B;  1SC4 B;  4IR9 A;  3TZZ A;  3KG4 A;  2OLW A;  1TR0 A;  1IBK F;  1HBM B;  4JI8 F;  1YWX A;  4N47 A;  3M32 A;  5A0Y A;  2BXJ A;  1DTQ B;  4B9S A;  3NGT A;  3C6U A;  2W4C A;  4MIA A;  3V4I A;  2R42 A;  1V5V A;  2CQP A;  2E5L J;  1IR2 A;  3CC4 S;  4S0M A;  3VVU A;  2VFR A;  2C2K B;  1AYE A;  1U4B A;  2ADB A;  2E66 A;  2HVE A;  3UFC X;  2MZS A;  1FX4 A;  2Y1R I;  2RIL A;  1H7W A;  5K20 B;  2IAJ B;  2VQE J;  4EBE A;  2A1B A;  1Y5L B;  1TAQ A;  4I64 A;  1PJ5 A;  1S49 A;  4YEA A;  1U24 A;  1YJ7 A;  2DNL A;  4J9U E;  4CTA A;  2H4Y B;  2GIF A;  3LGN A;  1HNV A;  2OPS A;  1LWE B;  4GKJ F;  1HQU A;  1RT7 B;  4MAK A;  1FRM A;  1TKZ A;  1FDN A;  2HGM A;  4JI0 J;  3G8Q A;  5LSO A;  4Y00 A;  2ZH2 A;  4AXJ A;  3OR1 B;  1LWC B;  4ANC A;  1VK8 A;  4QIF A;  1HNX F;  1F1B B;  4MKV A;  1YX2 A;  3VQS A;  1FEE A;  4ZA1 A;  4LQ3 A;  1IXK A;  2VJV A;  2XC9 A;  4F4W A;  1ZPW X;  3T1Y J;  1U47 A;  3R2C J;  4CH0 S;  1VHF A;  2CWK A;  3PO4 A;  4YQW A;  3KK1 A;  1FHT A;  4DV1 J;  1GK8 A;  3M2R A;  1FJE B;  2JX2 A;  1X9W A;  3NCQ A;  5GMD A;  3RB0 A;  1IBL J;  3I9Z A;  4WBF A;  1FD2 A;  1RZM A;  1OIA A;  3KLI B;  2NLW A;  3LO3 A;  5IV4 A;  2NYH A;  3OXL A;  2ABY A;  1ZBT A;  1UA1 A;  5E33 A;  3KKF A;  1N88 A;  4ZPW R;  1UJ4 A;  4A8M P;  2AJ1 A;  5IWA J;  2HQF A;  2QLB B;  4C2M A;  3K5O A;  3VWS A;  2QX0 A;  4LR8 A;  3ZZR A;  2RT3 A;  1RTJ A;  3F44 A;  2OH2 A;  2IA6 A;  3GYN A;  4LF7 F;  5ETK A;  5KT2 A;  2CQH A;  4XDD A;  5KG1 A;  4NLY A;  2L3M A;  1S59 A;  2W2O P;  2QC3 A;  4J9P A;  3PEH A;  5KFB A;  2HZA A;  2CKW A;  2IDE A;  3E01 B;  3PKM A;  5D8H B;  4QOT A;  4ER8 A;  1FEH A;  1BQN A;  3A12 A;  1EKR A;  1DRZ A;  3E2E A;  1HPZ B;  2RIJ A;  5DG8 A;  1S99 A;  5KFW A;  4NLD A;  1NPR A;  2ZH9 A;  4GC7 A;  4XK8 C;  4OJG A;  4NRU A;  1CS4 A;  2ERR A;  4EUV A;  3OUY B;  3C8Y A;  4AT1 B;  1YBU A;  1N36 J;  5IT4 A;  3OFE A;  3OVS A;  1TEL A;  4KO0 B;  3KUH A;  2GIQ A;  1YRX A;  3QT5 A;  4LFB J;  2W2Q P;  4F3O A;  1X4D A;  2KHD A;  5F9N A;  2P5V A;  5EUH A;  1KNZ A;  3UPF A;  2HNY B;  2B8P A;  2AZ1 A;  3LAM A;  4H4K C;  4UUW A;  4DV0 F;  1HYS A;  5AXK A;  2DR6 A;  1UVM A;  5D15 A;  2GCF A;  3GE9 A;  2I8E A;  2K8G A;  3LAK A;  3JS9 A;  2MQL A;  2JH3 A;  3NLC A;  4AD6 A;  1TVR A;  3AY0 A;  3OLA A;  3GLJ A;  4I56 A;  1OYD A;  1YZ6 A;  1D09 B;  2BE2 B;  4F26 A;  2J7K A;  4WJB A;  2VFT A;  3D1O A;  4RWX A;  1VRT A;  2OPP B;  3GCW P;  3QSY B;  3HLU A;  3SFG A;  2ZWO A;  4CLP A;  4PQU A;  1E6V A;  2XB2 D;  4LQ9 A;  4RKU C;  5K8M A;  1Q16 B;  1WC3 A;  4ZVR B;  3O1L A;  2KO1 A;  1VHI A;  2Y0B B;  5KG0 A;  4ZCI A;  2W7A A;  3DOL B;  1EAY C;  1OPZ A;  3T5H A;  9RUB A;  4ZJL A;  4KE5 A;  2YQ0 A;  3NNC A;  4EGL A;  2EKY A;  2GMH A;  1V6H A;  3NWR A;  5GAH U;  3I6P A;  1S72 S;  2DEI A;  2JC0 A;  3K5L A;  2DNH A;  3OV7 A;  1F5C A;  4O3R A;  2MLX A;  2D1C A;  4K4V A;  3E3X A;  5KFM A;  2HHH J;  3HFZ B;  1TZ0 A;  3NGS A;  2X3G A;  3HVR A;  1FKP B;  2QRR A;  3LGM A;  5HJY A;  1U7L A;  2AJ0 A;  1WC0 A;  1YLX A;  3W65 A;  1IKY A;  1AUS L;  2OEL A;  2J0W A;  3DRP B;  2AD9 A;  2UUB J;  3DLE B;  1WD6 A;  3WZ0 A;  1IN0 A;  1S4F A;  3TUI C;  2VBX A;  2FJD B;  4AE5 A;  3KG1 A;  3LP2 B;  5F8G A;  3DRS B;  4R8U A;  2HFU A;  5J2N B;  2KJV A;  4OI4 A;  1S77 D;  2IY5 B;  2F7V A;  1PYT A;  2MKS A;  4AXI A;  2RS2 A;  1RA6 A;  5A8W A;  3OTO F;  3IRX B;  4IOB A;  1BY9 A;  1U2C A;  2M2B A;  1QSY A;  4MK8 A;  3Q86 A;  3KLF A;  2OEM A;  1HNZ F;  4ZVG A;  2HUR A;  2M5Y A;  3C6T B;  4QWA A;  5E3P A;  1LK7 A;  3BB5 A;  4N5S A;  1JXV A;  4DMZ A;  3PY8 A;  2Z30 B;  4A8Q A;  5KFG A;  4OYP A;  1NDC A;  1Q8I A;  2WB1 D;  4DI6 A;  3CB4 A;  2LYV A;  2WOM A;  3S6E A;  3T1H F;  3KYL A;  3CMQ A;  4CCH A;  4KRW A;  2DR9 A;  2GVZ B;  5DM6 Q;  4IRK A;  2QSW A;  3TUP A;  4YR3 A;  3R97 A;  4JI2 F;  2BE9 B;  2ZH4 A;  1T03 A;  5HQM A;  1HNW J;  4RBV A;  2IM0 A;  1URN A;  2UUW A;  1U8W A;  3BKU A;  2CQ1 A;  1EZZ B;  3GFZ A;  3BPS P;  2GW8 A;  1IQZ A;  2VG6 A;  1WOS A;  2V4J B;  2AKW B;  3MMC A;  2CJA A;  4K4T A;  2AIR B;  3K5P A;  1EHW A;  5FII A;  3KJV B;  4RW9 B;  4ED1 A;  5HVG A;  4J9Q A;  3AQP A;  1UTA A;  1TK5 A;  3F41 A;  1CUL A;  3JSB A;  2DH8 A;  2LEP A;  1U0H A;  4FS1 A;  5DS7 A;  3GFY A;  3B4D A;  5KFH A;  5I3Q A;  1RTD A;  1EB0 A;  5IS2 A;  2ZM6 J;  3CDU A;  2YX4 A;  2C3U A;  4NZ7 A;  3EYZ A;  4IH7 A;  2B9E A;  2HK2 A;  3IWL A;  1R8H A;  3DYA A;  4CIO A;  4LIW A;  3UDE A;  1NLK L;  3QJP A;  2IM3 A;  1N5Q A;  4NCG B;  5KG6 A;  1JKH B;  1DFD A;  3HDS A;  1APS A;  2WBR A;  4P2X A;  1RT5 A;  2C2R A;  3KJQ B;  2V8G A;  4NYP A;  2O66 A;  1MRO A;  5B7W A;  4RJV A;  4X64 F;  1S1V A;  2XLI A;  4P2M A;  3KDN A;  2LXI A;  4CLK A;  3ZXW A;  4TLQ A;  3T1A A;  4JV1 A;  4QYZ K;  4P71 A;  3MM7 B;  2VUG A;  2DGQ A;  1R6Y A;  3KLE A;  5A8K A;  1VIX A;  1VQY A;  1QLN A;  2DY9 A;  2YKN B;  3RB6 A;  1KLM B;  3EZ5 A;  2HVH A;  4FYV B;  2KVQ E;  3RYL A;  4EO8 A;  1TL3 B;  1L3V A;  3LAN A;  4P6Q A;  3Q22 A;  4MYT A;  3FCV A;  1NH8 A;  1RKI A;  2DNN A;  1O6X A;  4J91 A;  3I56 S;  2E9T A;  4FXD A;  1RWV B;  4DR7 J;  2FZG B;  2KFY A;  5KFR A;  3D6T B;  2E5L F;  4U7U D;  3UVJ A;  1R8B A;  2IM2 A;  2HHT A;  4LFA J;  1QUP A;  1WC6 A;  4FF1 A;  1BXN A;  4X4Q A;  3CTR A;  3A8E A;  3M8Q A;  5GAE I;  3RBD A;  4ZVH A;  2VQE F;  4WE1 A;  3V81 A;  2YNI B;  4B9V A;  2RQC A;  3MR7 A;  1RCO B;  3OR2 A;  1IQT A;  3QNW B;  3H2V E;  1S1T A;  5FLX Y;  1SH0 A;  5LJ3 Y;  1LKZ A;  5LOQ A;  1FDA A;  3PHE A;  4HHU A;  3SCK E;  4IDK A;  3BR9 A;  1C1B A;  5J2P B;  4DFM A;  4ECZ A;  3A4T A;  2LU1 A;  3D6H B;  1Y10 A;  1U1N A;  5IM0 A;  1WEX A;  1B99 A;  4NI2 A;  3RUB L;  5CCL A;  2Q6B A;  1VQS A;  3H20 A;  3OTB A;  3T1Y F;  1HR0 F;  2AMC B;  1F0X A;  3AHP A;  2XS5 A;  2G0C A;  3L4B C;  1HBU A;  3RRH A;  2HWT A;  2J0Q D;  3NWG A;  4C8N A;  3M32 B;  1XC9 A;  4NLU A;  3C6U B;  1HI1 A;  2IRX A;  2IC3 A;  3M9O B;  2GGP A;  3IAS 9;  3V4I B;  4L76 A;  2VC0 A;  1ZM2 A;  3AXK A;  2ZJP Q;  5IWA F;  2LEB A;  3J81 Y;  3UI3 A;  2BJD A;  5EN1 A;  4YB1 P;  2ROE A;  3V6J A;  3OL8 A;  2DO4 A;  5J2Q B;  2BJE A;  3DM2 A;  3QMQ A;  4JV2 A;  4AUK A;  5KFO A;  2NZC A;  2DNK A;  1C0T B;  4B3O A;  4OHV A;  4WP9 A;  1S0O A;  2FY8 A;  5JVG Q;  4CTA B;  1C2P A;  1Q4R A;  1KHW A;  2ZDO A;  2EC0 A;  1HNV B;  3P6Y C;  2OPS B;  1HQU B;  3GIL A;  4C0H A;  3N5B A;  1TKZ B;  5GAD I;  3QZ7 A;  3CJ3 A;  1S4E A;  3RRK A;  1R89 A;  2XS2 A;  4ZVF A;  1D1U A;  2VKZ G;  2EC2 A;  4USW A;  3QRR A;  2UVW A;  4PYD A;  4I2P A;  4QZV B;  2MQ8 A;  2SXL A;  1QAY A;  5IC4 B;  2CUY A;  4QPX A;  3DHW C;  2IJF A;  3PX0 A;  3NCR A;  2QLW A;  3QO9 A;  1N36 F;  2UXD J;  2FB0 A;  3C3L A;  1SJ4 P;  3AOA A;  4OYO A;  4ZK7 M;  3KK1 B;  4FXW A;  3M2R B;  4ZPD A;  4LFB F;  2YTC A;  2J7W A;  3MI7 X;  3W2V A;  1NEE A;  2Y0S D;  1PIL A;  1L3U A;  2PFF B;  2R8G A;  1XBW A;  2V2K A;  3J7Y I;  3UWT A;  2YNG A;  3CJ2 A;  4CYU A;  1TK0 A;  1D9D A;  3KHG A;  2XHC A;  2D3Z A;  1RTJ B;  3MOZ A;  4H4M A;  1U0S A;  4DV2 J;  4OYI A;  5GVQ A;  4MKB A;  2VOD A;  4DFJ A;  1VDH A;  4LRC A;  1X4B A;  4PZV A;  4WZQ A;  4TY8 B;  2W8L A;  2AU0 A;  1KOO A;  4I2Q A;  1CJK A;  3KMQ A;  2DXF A;  4WKY A;  2I5J A;  4ILL A;  2Q43 A;  3ULH A;  2A6M A;  3QLH A;  2HHX A;  4DV5 J;  1NM2 A;  1BQN B;  1VBK A;  2EFO A;  3L9Z A;  2KM8 B;  2ASD A;  4MMO A;  2HS0 A;  2UXC J;  3GR1 A;  5LJ5 Y;  4I7F A;  1WF1 A;  4OL8 A;  2YKA A;  4MIW A;  5LT5 A;  2VV5 A;  2A18 A;  1R0C B;  3G6Y A;  1S7I A;  2AYM A;  3NG8 A;  3K0J A;  1CS4 B;  5ETS A;  3DLH A;  2J5A A;  1N0U A;  4K0K J;  3QSI A;  2ZHO A;  4RL1 A;  5THW A;  5B0F A;  2RQ4 A;  2F9J A;  3CCS S;  1BQX A;  2HLT A;  2QFI A;  3JSY A;  2FHO B;  1T9Y A;  2HHH F;  1QE1 A;  3DMJ A;  1HYS B;  4M5K A;  4HYK A;  2FVC A;  3MCO A;  4RPF A;  4O4G A;  2RDJ A;  1CQN A;  1IVZ A;  2HHW A;  2B4P A;  2UUB F;  3VV2 B;  1TVR B;  5I3U A;  5C2G A;  2VPX B;  3HPO A;  4C98 A;  1VRU A;  5CH7 B;  2AJF E;  3K89 A;  3KWM A;  2A6O A;  4ICL A;  4IH5 A;  4DU7 A;  4E98 A;  1VRT B;  2HQC A;  1CC7 A;  3BSA A;  3NGK A;  4KYZ A;  4ELT A;  2AW0 A;  4K50 A;  3Q2T C;  3ZTP A;  4TYA A;  1XEZ A;  2XZW A;  3PEJ A;  4PQU B;  4DR6 J;  1E6V B;  2DGX A;  2XO6 A;  1R27 B;  2B7C B;  3H90 A;  5F3T A;  2WSF C;  3VAK A;  2V34 A;  3RW6 A;  2FDN A;  1Y7P A;  1U02 A;  4NLV A;  5KFQ A;  4DEZ A;  5U47 A;  1VC6 A;  2YY3 A;  4K4Y A;  4DQQ A;  4DR3 J;  3G87 A;  4LJM A;  2YWK A;  3UNG C;  2YWE A;  1KBR A;  2GJI A;  1CBK A;  2XCA A;  3NOG A;  4YB6 A;  3HT3 A;  3QGH A;  1KQF B;  3G86 A;  4DSJ A;  3WX8 A;  1W2I A;  3X3U A;  3N01 A;  4KV8 A;  2IRU A;  5H1S V;  4C8K A;  5L39 A;  4ILM A;  1RAA B;  4DZD A;  4X4V A;  2V8D A;  4ATN A;  4RBT A;  3TR5 A;  1IKY B;  2CPY A;  5DG9 A;  1HNW F;  3R5D A;  2HWH A;  2EI5 A;  3VAI A;  2FVS A;  4CP5 A;  3W7B A;  2YPZ A;  1GXL A;  2PEH A;  1LWX A;  4FYY B;  2R7V A;  3ISZ A;  2FHJ A;  2J8S A;  2HBZ B;  4ZVU B;  4KC5 A;  5AXM A;  1FNO A;  1FKO A;  1RTH B;  3D3C J;  2PI4 A;  4W4M A;  3V6H A;  1KFD A;  4CH1 A;  1JK9 B;  1FES A;  5A8W B;  2LEC A;  2DH7 A;  1NJY A;  3VAJ A;  3A8K A;  2PE8 A;  2DEJ A;  2M8D B;  3HO1 A;  2XMV A;  3V2U C;  3HZG A;  3RAM A;  3D2W A;  3KLF B;  3UCU P;  4X62 J;  1NDK A;  1OY6 A;  2N7C A;  1FWK A;  4DLE A;  2V2Q A;  2P2C B;  2N4C A;  1YGY A;  1TMJ A;  3US5 A;  1YG0 A;  1DHM A;  2ZM6 F;  4F3Q A;  1CG2 A;  2RRA A;  4CO1 A;  1F9E B;  2DNZ A;  3A13 A;  3SQG B;  5F8M A;  3SMZ A;  2WOM B;  2VPZ B;  2KM8 C;  1LW2 A;  2I6W A;  4NA1 A;  4LUB A;  5AJ3 J;  3CUL A;  2JC1 A;  1SJ1 A;  1RBA A;  1T03 B;  4HVZ A;  4L3N A;  3PO5 A;  1I6J A;  2BKP A;  4NLP A;  1P1T A;  1REV A;  4W98 A;  4A8Y A;  3VZI A;  1R7I A;  1BWE A;  3I87 A;  2VG6 B;  2G1D A;  2R7Q A;  1WF0 A;  3AQO A;  2FLL A;  4IFY A;  3LW5 C;  3BQ1 A;  1A0O B;  2CDQ A;  2DGW A;  4X4P A;  1X5T A;  4PXD A;  3A8J A;  3O5T B;  2VBZ A;  2ZZT A;  4MYU A;  3NEK A;  4ZIV A;  4DF4 A;  2G1H A;  3FCH A;  4OZL A;  1SC3 B;  3Q89 A;  3OL6 A;  4DUZ J;  2JZ5 A;  5D4O A;  1U0H B;  4RNF A;  1UZH A;  1VIS A;  3D28 A;  3HSJ A;  2YBV A;  1RTD B;  3CVK A;  3UDL A;  4I1T A;  4NMX A;  1Q8B A;  1H6K X;  4XDC A;  1K8A T;  4Y2I A;  1S6U A;  5D78 A;  1JJ2 R;  3DYA B;  3FUY A;  2YWG A;  3I0R A;  4LFA F;  2LA4 A;  2PGC A;  3EGW B;  2J9D A;  2I2Y A;  2BJ8 A;  4HT5 A;  2AX1 A;  3BQ0 A;  1RT5 B;  2G4B A;  3HFK A;  5M2R A;  1QSL A;  1FJG J;  1MRO B;  3BDP A;  4KSE B;  3CC7 S;  4KIA A;  1S1V B;  3RRG A;  1F3V A;  1JWW A;  4OYA A;  3S8S A;  4NXM J;  1PO6 A;  3Q0A A;  4F4X A;  2B0G A;  4UOG A;  3ETO A;  5K9F A;  2LLZ A;  3KLE B;  2DHS A;  5A8K B;  2VQF J;  3PW4 A;  4KR0 B;  2KU7 A;  4C8Z A;  2W8K A;  2DPI A;  4MKY A;  1NK7 A;  4GC6 A;  1NH7 A;  2G0J A;  1FRX A;  3MFH A;  4XPE A;  4AFF A;  4DX7 A;  3CD5 A;  3AT1 B;  3BGR A;  3R6G B;  3VAM A;  3I0S A;  3PJX A;  3W8G A;  2BJ3 A;  4HHH A;  3H98 A;  2ZH7 A;  5HQ8 A;  4ZVP B;  2P9E A;  2W4D A;  2W2N P;  2FPH X;  1QDU B;  3JXO A;  4WFX A;  3UVJ B;  3KFW X;  2HS4 A;  2A3J A;  1H38 A;  3CJ0 A;  5L1I A;  2V8H A;  1F5B A;  3M8Q B;  1DY3 A;  3CDB A;  2H51 B;  4WE1 B;  3M05 A;  5JMN A;  1VC0 A;  1N8R T;  3UCG A;  4WWS A;  1ZAV A;  2I0X A;  3V81 B;  1BHN A;  3FQK A;  2WSC C;  1HWJ A;  4K4U A;  1HL6 A;  3CSK A;  2XQC A;  1Q79 A;  1DUR A;  4URG A;  2AWZ A;  3FK4 A;  3OR2 B;  1K0V A;  1S1U A;  4WKR A;  5K14 A;  1KEK A;  1S1T B;  1WJ9 A;  2P9C A;  3Q8Y A;  2J9C A;  4IDK B;  3HF5 A;  1C1B B;  1UPP A;  2V50 A;  5IT0 A;  3PW0 A;  3Q8Q B;  5IM0 B;  4NI2 B;  2AJ2 A;  3JAM Y;  2UZA A;  3CCU S;  2FJV A;  2WW4 A;  3HHL D;  3DDN A;  3MGJ A;  4F4K A;  4LBH A;  4DPT A;  1BQM A;  5BR8 F;  4OLO A;  1HBU B;  3FSY A;  1HKA A;  2QYC A;  1CLF A;  1IBM F;  2AEF A;  3DN9 A;  4DQP A;  4TN2 A;  3BN4 A;  4U8V A;  2IC3 B;  1OS5 A;  2PMW A;  4K5S A;  1VQM S;  2GGP B;  5D4L A;  2IYI A;  2R7X A;  1VOM A;  2CAD A;  4J9V A;  1UWA A;  3MPD A;  3IN5 A;  4XAK A;  2Y8W A;  4DV2 F;  5A2Q Y;  1DQ9 A;  3DM2 B;  2AV5 A;  2V9W A;  1WOO A;  3MM8 A;  2RQK A;  4B3O B;  4LF4 J;  1X4E A;  5CHC B;  2ZH1 A;  1VQN S;  3G6V A;  5KG2 A;  3G6E S;  1MWY A;  3O44 A;  5F8H A;  4ZPT R;  2VKR A;  5CA5 A;  3NKY A;  4OHZ A;  4QYR A;  2DH9 A;  5JVH Q;  2D3O R;  4DV5 F;  4WCE Q;  1ZM3 A;  2YXL A;  4F0K A;  3EIC A;  3C19 A;  4M5N A;  3QGG A;  2MMY A;  3GSI A;  3VAF A;  2K3I A;  2JDJ A;  4ERD A;  5KT7 A;  2E5I A;  1FWP A;  4JUZ A;  3NS6 A;  2R7R A;  4I2P B;  3BDE A;  3FCW A;  2XLJ A;  3I96 A;  5HJX A;  1XMO F;  3W60 A;  3D54 A;  3J7Z T;  4A8S A;  2J8A A;  3QO9 B;  4K0K F;  2AX0 A;  2B4O A;  1XMB A;  5KT4 A;  3GMG A;  1XR6 A;  2VA2 A;  1JLG A;  4CI0 B;  1I3O B;  1UET A;  3NMA A;  2VG5 A;  2CDR B;  3W2V B;  4LF9 J;  1FFW B;  1SIW B;  1X5O A;  4U95 A;  4QR0 A;  5ADZ A;  4B9M A;  4CLL A;  3V6D B;  2C22 A;  4NZ6 A;  1HBO A;  2YNG B;  1RE1 B;  4CYU B;  1N5Y A;  4F4Y A;  4N8O A;  1S6P A;  2V8P A;  3NS5 A;  4X4S A;  3K5N A;  4H4M B;  3M6V A;  3CD6 S;  5J2M A;  5T14 A;  3LPY A;  3OBI A;  3P3D A;  2MKI A;  2IA0 A;  2V68 A;  2BM0 A;  2C42 A;  4F50 A;  4I2Q B;  4OHW A;  1CJK B;  2DB1 A;  2KFZ A;  4KY3 A;  2I5J B;  3A3N B;  3N6M A;  3QFW A;  3T19 A;  5L1L A;  2EFP A;  3UD5 A;  1K73 T;  5DG7 A;  5A8R A;  1C0U A;  2LXF A;  2DYA A;  4DR6 F;  3Q83 A;  3QRQ A;  1F9H A;  2R8K A;  4I7F B;  4DHV A;  4ZVQ B;  3PX6 A;  3BGF A;  1RBO B;  2UU9 F;  3IG1 A;  4NLS A;  3GG0 A;  2I38 A;  5CD4 A;  4CLY A;  4USJ C;  4DR3 F;  2XEX A;  2RF2 B;  4JI5 J;  4F0H A;  4U7C A;  1UVL A;  2BW7 A;  1Q5V A;  2EG2 A;  1PGZ A;  2OEK A;  5F8I A;  2F9D A;  2VBW A;  2G2Z A;  3CDW A;  1RWP B;  4UY8 T;  3HJF A;  5DDR C;  2GHP A;  3Q23 A;  1QE1 B;  3DMJ B;  4J90 A;  2ZKU A;  2NXN A;  4C8M A;  3LPE A;  2JLG A;  3D6F B;  3PIO Q;  2ZOF A;  4WYL A;  2QT7 A;  2ZH3 A;  5MLC V;  5G0R A;  3EX7 B;  4O4G B;  4NLO A;  4P74 A;  3VHQ A;  3T5K A;  1NBE B;  1U2R A;  4ELU A;  2JEJ A;  5I3U B;  3DLJ A;  2XMM A;  5GAH I;  1VRU B;  2C3Y A;  2L48 A;  1YVF A;  4PWU A;  3V5R A;  1ZAW A;  2M52 A;  1SBR A;  4AL7 A;  4ICL B;  5ETM A;  2HFS A;  1RHR B;  5ETV A;  1OPI A;  2VPY B;  1DJ0 A;  3WBZ A;  3I55 S;  1M1K T;  3FZ2 A;  1MLA A;  1RHK B;  1XIQ A;  1HI8 A;  3UR0 A;  1R31 A;  3E8O A;  1WC1 A;  3W5Y A;  5KOX A;  2YWF A;  3PAC A;  1NU4 A;  4CT9 A;  2EFV A;  2EVZ A;  1XTZ A;  3GFH A;  4F2S A;  4IH6 A;  4F02 A;  4X62 F;  2EW9 A;  2GFF A;  1KP6 A;  1HWL A;  1QVG R;  1DTQ A;  1YDL A;  4QWC A;  3W1Y C;  3D0I E;  1Q86 T;  4B3S J;  1RXO B;  2C2Z B;  4N76 A;  2MZJ A;  2BM1 A;  4DS5 A;  3TZX A;  1S0M A;  3OJU A;  1SKW A;  1T94 A;  5ETO A;  4UUX A;  1AZS A;  3H0P A;  4KV8 B;  1KQS R;  1OWX A;  2HAI A;  3P5B P;  3ENQ A;  2GJ2 A;  4WTO B;  5KG7 A;  1D3W A;  4ZCM A;  5AJ3 F;  2HRT A;  2WHO A;  4ES2 A;  2UV8 A;  3SCI E;  3PNI A;  2MGZ A;  1UVN A;  1BC6 A;  3O6Q A;  4FVC A;  1J2V A;  2MZT A;  5E3C A;  2NYI A;  5T41 A;  4QPT A;  1REG X;  1V3R A;  4Y0F A;  4KGK A;  3HM9 A;  3KOA A;  2PC6 A;  5M2U A;  3GV8 B;  3UN5 A;  1AB8 A;  1FKO B;  3ADA C;  5KFS A;  2W7O A;  2R7U A;  3W9H A;  1Z2Z A;  1HWI A;  2GHW A;  3R1H A;  4NRT A;  4DCP B;  1ZA2 B;  1KVJ A;  5IFM A;  4ILR A;  2HRY A;  3G82 A;  2KB2 A;  1FKA F;  2HHV A;  4F25 A;  4OFZ A;  3KJN B;  3DRR A;  3HD2 A;  4BLG A;  2IM1 A;  2ASJ A;  4KKO B;  4NPO A;  1WKJ A;  1K44 A;  2RKI A;  3JSM A;  1U1L A;  5CAB A;  1ZAX A;  1VMB A;  2ZJR Q;  1LW2 B;  2JWN A;  1RTZ A;  5DO2 A;  4HI1 A;  3ZTO A;  4DL7 A;  2Z2Y B;  3J80 Y;  4DX8 H;  5HN0 A;  1B0V A;  4M63 A;  3KK3 A;  3AOB A;  1XNQ J;  2XTJ P;  4HTJ A;  4WFY A;  4CO2 A;  2RH3 A;  1RHM B;  3EVM A;  4PPZ A;  4RNM A;  2OFH X;  2W4P A;  3AD9 C;  2O01 C;  3MPV A;  2KJW A;  4DS4 A;  3H8Y A;  1FJG F;  2FZC B;  2WSE C;  1REV B;  4BHQ A;  1OY8 A;  2QL9 B;  4UZC A;  3CC2 S;  2IVM A;  1Q78 A;  2VL1 A;  1HNX J;  1NHU A;  2M9K A;  1KLN A;  3K58 A;  3H2U B;  4IFY B;  4J9K A;  4MFB A;  4NXM F;  3MEE A;  3HT0 A;  5EX3 A;  1U1Q A;  4DV7 J;  4CO4 A;  2JFD A;  4DBQ A;  4AL5 A;  2M3D A;  3Q2S C;  2AEJ A;  1PCA A;  3D67 A;  4V1A k;  1W7W A;  2D3U A;  3CMA S;  3IO1 A;  2BRL A;  4ED5 A;  3UW1 A;  2CNK B;  3GJS B;  3MMB A;  1KQG B;  1X8D A;  2CQB A;  2QMW A;  4U96 A;  1NK8 A;  2XO7 A;  4DR4 J;  2B4U A;  2ZOM A;  5DZ7 A;  5FJ4 A;  4HH1 A;  1RWW B;  1H2U X;  1YK9 A;  4ZS6 A;  3W66 A;  5B0E A;  3ETM A;  1S6O A;  2P6S A;  1WDD A;  1L3T A;  3QJL A;  1S10 A;  1GMW A;  5HAO A;  3RBE A;  3I0R B;  1OSC A;  4FS2 A;  2WAQ D;  3MAH A;  2NSC A;  2MKJ A;  1R8A A;  5EX0 A;  1SJ3 P;  4WYW A;  5D4P A;  1Q81 T;  4O3S A;  4ANE A;  5D0R A;  2OPP A;  3CJ8 A;  3BKT A;  1A6L A;  2C2N A;  4P73 A;  3CJ5 A;  4URQ U;  1UJ5 A;  2WB4 A;  4FVM A;  1DQ8 A;  2UUT A;  4C4W A;  2DHG A;  3TQ1 A;  1ZTW A;  4OI6 A;  1FXR A;  2X3D A;  3M1V A;  4PPD A;  3MTK A;  4HAC A;  2J9D E;  3SYZ A;  4P75 A;  4PR6 A;  2H5I B;  2YWH A;  1T9X A;  4WU2 A;  2CAJ A;  5EDW A;  2DGO A;  4OYM A;  2OPQ A;  4EFA C;  2DCL A;  3MHY A;  4RU2 A;  2VZ9 A;  2G2Y A;  1MSW D;  3GJQ B;  3LWL A;  4OLP A;  1BWV A;  5B0A A;  2QL7 B;  1TL5 A;  4OI1 A;  5LMN J;  2NQP A;  3NNH A;  1RAO A;  1URR A;  1KR4 A;  4BBY A;  3BGR B;  1NK4 A;  1MML A;  4NML A;  3I0S B;  2EFQ A;  4DLG A;  4EEY A;  2NR0 A;  4R0J A;  3RJM B;  4BCA A;  4ECS A;  3WIV A;  1IKW A;  3FSX A;  1WHY A;  1P6T A;  2YKP A;  3PJW A;  3BZQ A;  3DRP A;  2GC8 A;  2HBY B;  3CDA A;  2I1R A;  2PD1 A;  1NPP A;  2NUU G;  3PHT A;  4MH8 A;  1EP4 A;  1WI8 A;  4LSN B;  2FC8 A;  3Q8U A;  2HHU A;  4Y34 A;  1VQ4 S;  2PA3 A;  1UFW A;  2ZHA A;  4V19 J;  1YJV A;  2M7S A;  4ZDN A;  3CJS A;  2C1E B;  2KFN A;  2HBR B;  3BO2 A;  3IWN C;  4IO1 A;  4I6Y A;  2EPI A;  4ZLL A;  3ZZO A;  2CZV C;  5A6W A;  1S1U B;  5K14 B;  4J7C A;  2IJN A;  3CW2 C;  1YTY A;  3FGV A;  2QZ8 A;  4MIB A;  4RUC A;  4IUF A;  3C66 A;  4NXN F;  1S12 A;  4C8L A;  1VJQ A;  2ZOG A;  1BQM B;  1QAJ A;  1E6Y A;  3TW0 A;  1UEV A;  2WVB A;  2COL A;  1H98 A;  1N6Q A;  2XY5 A;  3SDE B;  4Q7A A;  3NAI A;  1LXN A;  3VF0 B;  3MWB A;  2ASY A;  2NS1 B;  3IXQ A;  5LSL A;  4I67 A;  4X4N A;  1NDP A;  2VD3 A;  1YSJ A;  2JEI A;  4WFB Q;  1UVJ A;  1TAU A;  1HQE A;  5KOW A;  5KFP A;  2DK2 A;  4C6A A;  4H4O A;  1TV6 A;  3TVK A;  3EZO A;  1TUG B;  3KDO A;  3MM8 B;  2OFG X;  2GHV C;  1H74 A;  3MR2 A;  1N5V A;  3OTO J;  2VB6 A;  1J5E J;  4DV6 J;  1WEZ A;  2CIM A;  4URS A;  2Y1I A;  3L7P A;  3ZZU A;  3KNA A;  2ZE2 A;  3HI9 A;  4JP8 A;  5EWF A;  1S1X A;  1IBC B;  4M5H A;  5KFY A;  3BQ2 A;  1NXI A;  3HMJ G;  4JI5 F;  2VDH A;  4IOC Q;  1FCA A;  2PN6 A;  2D74 B;  4GVB B;  1TKT A;  1Y5I B;  3M9M B;  3ISN C;  3LGH A;  1HAR A;  4FPR A;  3SSR A;  3D6M B;  1JLG B;  1FRK A;  2VG5 B;  2OD6 A;  2GQC A;  4CM0 A;  2V4R A;  3NOC A;  4NLR A;  4ED8 A;  6FD1 A;  1PAE X;  3MM5 A;  4X84 A;  4JI2 J;  2KT3 A;  1NND A;  1HBO B;  2JVR A;  1QAI A;  1U1O A;  2CQG A;  1N5Y B;  4B3T F;  1GMU A;  1S6P B;  1NSP A;  5B0D A;  1M5H A;  2CA9 A;  5J2M B;  2BMB A;  5H9F K;  1IJE B;  3N6L A;  3OTD A;  2QFJ A;  1M5P C;  4RR5 A;  2H9Z A;  2JL9 A;  2VBY A;  1Y3J A;  1F5A A;  3M30 A;  3MOJ B;  1DZ5 A;  1LWF B;  4QU7 A;  1O8B A;  1PKU A;  3CE8 A;  5A8R B;  1C0U B;  3DI6 A;  1PC5 A;  3EGN A;  1KTQ A;  4YN3 B;  3HHK A;  3N79 A;  5IT9 U;  1T95 A;  2XI3 A;  1MMN A;  3GR0 A;  3IG1 B;  4FF2 A;  4LF2 A;  1FVQ A;  4K2J A;  3PFO A;  3M4X A;  4EMD A;  1T8E A;  3TUJ C;  2N82 B;  2R2S A;  1H2T Z;  3TA0 A;  2VIC A;  3TAN A;  3DFE A;  2B8Q A;  2XWY A;  3R6L B;  4WU3 A;  2Q79 A;  3N5F A;  3WC2 A;  3AD8 C;  1L5U A;  1KTV A;  2RDI A;  3QAE A;  1UFL A;  3DOM B;  1YJU A;  3RBX A;  3RAQ A;  2CJY B;  2BW2 A;  3CD0 A;  4J9S A;  4RUB A;  4DU8 A;  5G0R B;  1RWK B;  4O44 A;  3OJS A;  2CVI A;  2K3K A;  2XCP A;  2FGO A;  2D69 A;  1SC1 B;  4UOC A;  1SCJ B;  2AZ3 A;  3HFV A;  4RNO A;  3UN3 A;  3IWX A;  3SZ2 A;  1NSQ A;  4USK A;  2HKE A;  2FJW A;  4LBP A;  1K1Q A;  4P10 A;  4IG3 A;  1R0B G;  3KLH A;  5J1N A;  2H1Y A;  4NLW A;  2FHJ D;  4PEO A;  1VIO A;  4ZIT A;  3THV A;  4I0W A;  1SQE A;  4KH0 B;  4FF4 A;  1RB0 A;  1QVF R;  2Y1L B;  2ZKT A;  4MKA A;  3OL9 A;  4Y65 A;  3C15 A;  3RAX A;  1KWM A;  5BYQ A;  3AA8 A;  1S6Q A;  1GXT A;  2M88 A;  1VQL S;  4IKA A;  3IA0 A;  2DD8 S;  2ZNY A;  4MK9 A;  4J9N A;  4CLS A;  1NHK L;  3I82 A;  1CC8 A;  3MEK A;  5HAT A;  4DUY F;  2EG1 A;  1U6Z A;  2KYZ A;  2RHQ B;  1AZS B;  5CZX A;  4GVL A;  5J2Q A;  1W25 A;  4NCA A;  2HHS A;  3GG1 A;  1LOU A;  4IFV A;  1C0T A;  4MTP A;  2VOO A;  2ZWP A;  4KB7 A;  5LMU F;  3HXM A;  3HHE A;  2MGZ B;  2R2R A;  2F8E X;  4ED4 A;  3WHI A;  1XNQ F;  5EWE A;  2IRY A;  1ZM9 A;  2Y9H A;  2YX7 A;  3G4S S;  1VQK S;  5GME A;  4ES1 A;  2MDA A;  5CXT A;  4CLT A;  3G6X A;  4LF6 J;  4LIR A;  2WVF A;  3UCZ P;  4NWB A;  2W01 A;  4RO0 A;  2E5G A;  4J5O A;  5FD1 A;  5AE3 A;  3DDI A;  1HHS A;  2XY6 A;  4C3K A;  4DV7 F;  2H3E B;  1HR0 J;  2PII A;  1AT1 B;  2HND A;  2HNZ A;  3DU6 A;  3KHL A;  3QID A;  3QBC A;  1WSV A;  1BE4 A;  3G82 B;  2KN4 A;  2NSB A;  2UUC J;  3RZA A;  1CJT A;  2CNL B;  3B82 A;  5AE2 A;  3DRR B;  1VQP S;  4DR4 F;  3EVW A;  1P8G A;  1RT1 B;  2RKI B;  3JSM B;  1ZH5 A;  4CLF A;  2E1A A;  2ASL A;  2UXB J;  3CCL S;  3DNC A;  2OEJ A;  2Z4P A;  3NNA A;  2MQQ A;  5B0G A;  1NUE A;  1YIT S;  3OFF A;  4PWD A;  4TY8 A;  3Q8V A;  3KK3 B;  2WBM A;  1IUJ A;  1T3N A;  2WVE A;  2ZUG A;  4C3M A;  3OT9 A;  4EU0 A;  1S1W A;  1GEH A;  4Z2X A;  4PQA A;  2RSQ A;  2F65 A;  1NME B;  4DXL A;  2MQO A;  3M2U A;  3MPY A;  1HD1 A;  1VYA A;  5LXR A;  2KZM A;  4RW8 A;  4FYW B;  2F63 A;  2CPJ A;  3ISN D;  3IS9 A;  4F4A A;  1FTR A;  4MFB B;  3TEH B;  1VQ7 S;  3PRD A;  3ELH A;  3MEE B;  1LXJ A;  2FYX A;  3FJ2 A;  2C3P A;  2RDD A;  3JSR A;  3DLG A;  2HQD A;  2QJ3 A;  1NZ8 A;  1FXL A;  5F8N A;  1FDD A;  2PFD A;  5LMN F;  4NAS A;  3MMB B;  4LT6 A;  2X1F A;  1K1S A;  4NLX A;  1VCT A;  2UVU A;  3J81 j;  1OYE A;  4PG7 A;  4O0I A;  2JEG A;  2GAH C;  2BJ7 A;  1ZPV A;  5HO4 A;  3MUR P;  3EE3 A;  3CCE S;  3QWU A;  5AXL A;  3BGU A;  1UA0 A;  2OUG A;  2KXN B;  2OSQ A;  3FRZ A;  3HJV A;  2ZC4 A;  3TP2 A;  2N7Y A;  1UW9 A;  4DV3 J;  4R5P A;  3PR5 B;  4HDH A;  2KG0 A;  1VK3 A;  4ID5 A;  5DDQ C;  1WG5 A;  2AGP A;  1Y3K A;  1RWU A;  1TL7 A;  2IJR A;  2R8J A;  2ACM A;  4FDF A;  3CGI A;  3M1V B;  4Q0B A;  2QL5 B;  2OO4 A;  2QSF A;  4HAC B;  3IFE A;  2YH0 A;  3NAH A;  3RTV A;  1RDR A;  2G2O A;  1SL2 A;  3TJ8 A;  3MTJ A;  4P7V A;  2OPQ B;  5IXU A;  3IBC B;  2MXY A;  3DCA A;  2C2E A;  4LFC J;  3HHD A;  5IZH A;  2JHE A;  2Q1L A;  4A47 A;  2XMW A;  4PXB A;  2CQ3 A;  1GFW B;  3CUN A;  3ICL A;  4DX6 A;  3M7V A;  7FDR A;  3FSI A;  3CCV S;  2RNE A;  4NZ0 A;  4B3M J;  1IKW B;  4EK2 A;  2LQJ A;  4ZKA A;  4NEZ A;  4DQR A;  2CJK A;  4ETX A;  1EP4 B;  3CJK A;  3CCT A;  4TXS A;  4C11 A;  1KFS A;  2IIH A;  3QYY A;  1W2B R;  3D68 A;  1VGY A;  1X4A A;  3IR6 B;  3SQO P;  1RKJ A;  1LFW A;  1RTH A;  3BRE A;  3KLG A;  3KMS A;  2AHO B;  1G2E A;  1SJQ A;  5F3Z A;  5T7L A;  4YB5 A;  2QEX S;  3KJF B;  1DTT A;  3FRY A;  1MU2 A;  2BJ9 A;  2X1G A;  4LF8 J;  4DL3 A;  3VGT A;  1J5E F;  5C25 A;  4W92 B;  2MTL A;  4DV6 F;  1YIJ S;  2DNP A;  2O1P A;  1F6T A;  4CLU A;  1TTH B;  2J0S D;  1KKH A;  5LL6 d;  2DTJ A;  1RUS A;  3R1L A;  3W5Z A;  2U2F A;  4K8R A;  1YJT A;  3PYD A;  3JB9 k;  2DO0 A;  3RBZ A;  2ROP A;  4M5D A;  1RSC A;  4FN5 A;  1PYS B;  3E51 A;  1HQ2 A;  3SQG A;  2DVI A;  1E6Y B;  1U6B A;  5FDL A;  5HQL A;  3FFI A;  1XWL A;  4B17 A;  5KAK A;  1N6Q B;  4M8L A;  3CO9 A;  1QUV A;  2BQR A;  1ARO P;  4PXC A;  2N4D A;  2IPO B;  6AT1 B;  3QJJ A;  1HD0 A;  1YHQ S;  2MLY A;  4YR2 A;  4USU A;  5IC6 B;  2ROG A;  3DLK A;  3JQJ A;  4LSL B;  2MY7 A;  2W1B A;  3GWC A;  1HQE B;  3RR7 A;  1GX6 A;  3ENV A;  4H4O B;  4I4B A;  1TV6 B;  3N6N A;  4ZVT B;  2J6S A;  2W9A A;  3G8T A;  2HZV A;  4AL6 A;  4RZR A;  3KXD A;  1YJN S;  3NBP A;  2W2P P;  5ITH A;  2V9K A; 
#chains in the Genus database with same CATH homology
 4YHH J;  4K0K J;  3R2C J;  4DUY J;  4LFC J;  4JI6 J;  4V1A k;  4DR3 J;  4DV1 J;  3R2D J;  1XNR J;  3OTO J;  4JI3 J;  1N36 J;  1J5E J;  2UXB J;  1IBL J;  2KL8 A;  4DV6 J;  4X62 J;  4LF4 J;  2E5L J;  4RJV A;  4NXM J;  5LMU J;  1I94 J;  4NXN J;  2MEW A;  1XMQ J;  1IBK J;  4JI8 J;  1N32 J;  4DV4 J;  4DUZ J;  4LFB J;  4DR4 J;  5IWA J;  4DV2 J;  5LMN J;  2VQF J;  4B3R J;  5LM7 E;  4DR1 J;  5A2Q U;  3J81 U;  4YY3 J;  2VQE J;  4KY3 A;  2UUA J;  4B3M J;  4LF6 J;  4DR2 J;  4HHU A;  4JI1 J;  4DV3 J;  4NEZ A;  4OX9 J;  5IT9 U;  3W1Y C;  4X64 J;  4AQY J;  4JYA J;  4NEY A;  1N34 J;  5AJ3 J;  2HHH J;  1XNQ J;  3J7A N;  5BR8 J;  2KVQ E;  1HNZ J;  2F4V J;  2ZM6 J;  4DV5 J;  1XMO J;  1N33 J;  4JI7 J;  1HR0 J;  4JI0 J;  1IBM J;  4GKK J;  4X65 J;  4LF5 J;  2MQ8 A;  4PWW A;  2UU9 J;  5FLX U;  3J80 U;  4DV0 J;  2UXC J;  2UUB J;  4LF7 J;  4X66 J;  4KYZ A;  4JI5 J;  1HNX J;  3JAM U;  3IMQ J;  4LF8 J;  4JV5 J;  4DR7 J;  4JI2 J;  2UXD J;  4DR6 J;  4KHP J;  3D3C J;  2MTL A;  1HNW J;  3D3B J;  4GKJ J;  2UUC J;  4LF9 J;  3T1H J;  4DR5 J;  4JI4 J;  3T1Y J;  4DV7 J;  4B3T J;  4LFA J;  1FJG J;  4B3S J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...