4LFBJ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lfbJ00
2UUAJ 3D3CJ 2F4VJ 5LM7E 4DUZJ 2UU9J 4DV6J 1N34J 4KYZA 4X62J 1IBLJ 4LF6J 4B3RJ 3OTOJ 4DV3J 4RJVA 4DV1J 3T1HJ 4GKKJ 1N33J 2UUBJ 4NEYA 4JI1J 5IT9U 4K0KJ 4DR2J 4DV5J 4B3MJ 3R2CJ 1XNQJ 4HHUA 4GKJJ 4LF4J 4JI8J 2UXBJ 1FJGJ 1HNZJ 4LFAJ 4DR1J 2HHHJ 4DR5J 4JV5J 3R2DJ 1IBMJ 2KVQE 4X65J 5A2QU 4B3SJ 3D3BJ 3W1YC 4DUYJ 1XNRJ 2UXCJ 5IWAJ 4KY3A 4X64J 4JI5J 2MTLA 4OX9J 4JI3J 4NXNJ 4KHPJ 4YY3J 1XMQJ 2MQ8A 3T1YJ 1J5EJ 4B3TJ 1N32J 1XMOJ 4DV0J 4JI7J 3J7AN 1N36J 1HNXJ 4LFBJ 4NXMJ 4JI6J 4DR7J 3J81U 4LF8J 5LMUJ 5AJ3J 5LMNJ 4LF9J 2E5LJ 4JYAJ 2VQFJ 4DV7J 4AQYJ 3IMQJ 4PWWA 5BR8J 1HR0J 4LFCJ 4JI0J 4X66J 2KL8A 4JI4J 1IBKJ 2VQEJ 3JAMU 4DV4J 3J80U 1HNWJ 4V1Ak 4DV2J 2UXDJ 4NEZA 4DR4J 4DR3J 2ZM6J 4YHHJ 4DR6J 4LF7J 4JI2J 4LF5J 2UUCJ 5FLXU 1I94J 2MEWA
chains in the Genus database with same CATH superfamily
2CQBA 3MM9A 3T6JA 3I87A 4PKDB 4IH5A 3PRBA 5KFEA 1HPZA 2IMWP 2DNNA 1MMLA 2CJBA 2HZVA 3ZTOA 2ZH4A 1KQSR 2F65A 2F4FA 3T5LA 2YNHA 3ICLA 5HANA 1F1BB 1TP7A 5CYMB 2VBXA 1FCAA 1RACB 2Q1LA 1T0TV 3D9BA 2W8LA 2JJ4D 4ZKAA 3ZZYA 4NLXA 2I9SA 5KT2A 3H5SA 4LSNB 1C2PA 1HWKA 1S7HA 3MURP 1Q8IA 5F8GA 4DL4A 2HQ3A 1PC5A 2QLXA 4LIWA 2EFQA 2G2OA 3LP0B 1VI7A 3HHDA 1FE0A 4NPOA 2X3DA 2KHCA 4MAKA 1X4BA 1U1KA 1VC6A 1IKYA 4PWDA 2RDIA 3D6HB 2FTRA 2CJXB 2C2RA 4DBQA 2H3EB 4BCAA 4O3QA 1GT8A 1O6XA 4RUCA 4X62J 3T5HA 4LF6J 2EFGA 4DR7F 2VG7A 3ISZA 4QU7A 2KRRA 1XMBA 3CCTA 3J7Z5 1KOOA 4L3KA 3TUJC 1U25A 3R9LA 1QSYA 2IM2A 1H0HB 3VAKA 2G1HA 2ZJQQ 3PRDA 2RD5C 2XY5A 1CULA 3Q22A 2OO4A 3UWTA 4KHMA 1HYSA 5F0UA 3BSCA 2UU9F 4KE5A 3L09A 3NLCA 2BE2B 4NZ0A 5GADU 2WOMB 3Q83A 5D4LA 2P9GA 4C4WA 3FEYB 1YBAA 5HROB 4WZQA 4QIEA 2BKNA 3D6MB 3C19A 4I7FB 1BE4A 1WTFA 1PCAA 2R2RA 5CYQA 2RQCA 3V6KA 4UOGA 4G1PA 5HVHA 1X0FA 2UXBF 5F3TA 1IKWB 2WW8A 4RU2A 4JI6F 3KG0A 3OTOJ 4K4VA 3N6NA 3I55S 5E3AA 4OI4A 5HN0A 2CG8A 4LBPA 2L08A 1S77D 1BQXA 3TAMB 1OSCA 1FEEA 4N47A 3EWGA 1J2VA 4QR0A 2Y0SD 3SQGB 3SFUA 2ZBIA 2ASJA 1ZTWA 4C8OA 4K4XA 4GKKF 3IGNA 2GVDA 4K59A 3KJFB 5I3PA 1RTHA 1O51A 4FF4A 2GW8A 1HNVB 2R7XA 2BR0A 3DRPA 1Z1ZA 1YJ7A 2ZHAA 4KR0B 2V4JB 3UCZP 1WF1A 4JYAJ 4RX6A 5KT7A 2YQ0A 3Q8VA 3CJKA 2JFDA 3FQKA 3T1AA 1G3OA 5KFIA 3MM9B 4R0JA 2ZM6J 3KLEB 3J7YU 1HPZB 5T7LB 5KG2A 1VCTA 1GTHA 4DV0F 3EXYA 3DRYA 3IRXA 4JP8A 3KHGA 3CT9A 1C0TB 3BS9A 1D9FA 1NSAA 2VQFF 4J7CA 4NLTA 4MJKA 2CNNB 1AZSB 2FGCA 2EWHA 4KRWA 2GA7A 1LXNA 2ADCA 1T03B 3EXCX 1FRXA 3DRSA 4DUYJ 3UN3A 4C2MA 4CLLA 3N6LA 4RW8B 3CNQP 5KG5A 3MEEA 3CW2C 1FRIA 2ASYA 1EZZB 4HHJA 3ZFVA 4IDKA 4C8YA 2AU0A 2VODA 4OZ0A 2M70A 3A8EA 1QDUB 3NS5A 1S97A 3HKZD 4NA2A 4PWWA 1SXLA 2VC1A 3UD5A 1JWWA 4DZ6A 4RWWA 4RW7A 4OZ2A 4FPIA 4RW4A 5HQ8A 1DBDA 3AQOA 2HK3A 1EARA 1RTZA 2P6TA 4Y2MA 3EZOA 1MU2B 4Q2MA 2A6OA 2BQUA 1B7FA 3GJSB 2RRNA 4GVBA 3DMJA 1ZZNA 2FPHX 1JKHA 3THTA 3AHPA 4TY8A 1W7WA 3PG9A 1RAAB 3LH2S 2OPQA 4I64A 4QWEA 3BSOA 3NRBA 4F4AA 2W9AA 4EMDA 4H4OB 3OJUA 1JXVA 3OXGA 3PR5B 4ECZA 1OPZA 1KFSA 3EGWB 3PW7A 3HHLD 1UA1A 4DL3A 3CD7A 3KUGA 2KDOA 2QT7A 1S79A 2DNOA 3LAMA 1N5SA 4PYAA 3F44A 4LF1A 2FZCB 2DGVA 3KWMA 3G8SA 7AT1B 2ABYA 3I6PA 3RTVA 2C3MA 2KYXA 2W2OP 3M8RA 4J91A 3IBFB 2GIQA 2P8IA 4XO0A 3OT9A 4LIRA 3E01B 4ATNA 4X4SA 1NEEA 1HNWJ 2BJ1A 4HT5A 1X8DA 3HULA 1HWUA 3TWZA 4PG4A 2MSTA 4PQUB 3LAKA 1T8EA 1K1QA 2I0XA 3DOLA 5KFWA 4IFYA 2D69A 1NKBA 5E3PA 4HTJA 4O0IA 5CD4A 4JV1A 5IFMA 4ES1A 3DYAA 2XULA 3M1VA 5THWA 4URGA 5SUHA 2XCAA 2ZD1A 4I6AA 2VDHA 1VJQA 1KWMA 5IOLA 1ZOTA 2B4PA 1C0UB 3QWUA 2CPIA 2YX4A 2GVDB 2OJ3A 2J6TA 4F0MA 3FJ2A 1N34F 5GAEI 3H20A 3D0HE 3BM7A 3OHAA 3J7AN 1B0VA 1BGXT 3BEGB 4WFAQ 2HHWA 2HW3A 3CJKB 3VWSA 2ACMA 1PJ6A 4JUZA 1YRXA 3BJYA 4PG5A 4UZBA 4J9MA 2FVSA 2AGPA 2ZE2B 1V5IB 5HP1B 1Y3JA 2DH8A 3QZ7A 4ZK7M 1Q0NA 2ZBPA 2V34A 2BYCA 5CCLA 3PX6A 3BPSP 3A3NB 2XY7A 1WOOA 2OPRB 3CJ5A 3K5OA 3A13A 4K0KJ 1ICEB 3H98A 4JI3F 4A4JA 4WK3A 1KDNA 3GZ7A 2LEBA 1EETA 3O6QA 1FXRA 2MXYA 2B4OA 5D0GA 2K3IA 1LK7A 3OW2R 1QAJA 2Y8YA 4YP3A 2XQCA 4Q2LA 4P52A 2NSBA 2OFHX 3OR2A 3HK2A 4DR4F 3CULA 4QJVA 2ACYA 5M2UA 5K20B 2VL1A 4C8MA 2JZ5A 2XHWA 4CH1A 4WTYA 1RAEB 3VCDA 4RW7B 2CPFA 3AY0A 3MEDB 4GO5X 1R3NA 4KIAA 3CMES 2EVZA 1X5PA 4PCQA 4R8UA 3KJNB 2B3TB 1YVFA 3R27A 2V8DA 3MMCB 3NWGA 5B0AA 4DUZJ 3LTOA 4CLKA 3GB0A 1S6PB 3CCVS 4FNIA 2QJ3A 1DAXA 3SCKE 4JI1J 1MWYA 5LMNF 4MKAA 3UR0A 5BYSA 4L73A 3IM8A 3MM5B 3CJSA 1VQ8S 3JQMA 4XK8C 1AW0A 1RI7A 3KK1B 2Y1JA 1URNA 1FDDA 2AP6A 4X64J 1REVB 1HBOA 1U02A 2DPIA 2ALZA 4UUWA 4U6PA 1UEVA 4MIWA 4URSA 1CC7A 3TUZC 2QA4S 2HFUA 3U1MA 5KT5A 1RISA 3QLHA 4NYZA 3NKYA 4DR1F 3WIUA 3CTRA 3PACA 2ADBA 3C6UA 2AF6A 5KFFA 4P71A 5BR8J 2EC0A 4USVA 2HGMA 3X1LB 4IOBA 1ZM3A 1LOUA 2CQ0A 1NB7A 2FIUA 4WWSA 2XSJA 4Q43A 3HSJA 4QWBA 2LKZA 1PBAA 2Q66A 4IFVA 1ZA2B 2ZD1B 3FDSA 5AJ3F 2YWEA 5DLFA 4NRTA 1LW0B 3W66A 3OFGA 1VLYA 4JI0F 1PG5B 2XMKA 3PFEA 5C24A 3I96A 3SSQA 1TFWA 2JL9A 3CSKA 4DV2F 4CLYA 3PDNA 2X3GA 3BGFA 2NREA 1FDNA 1VQNS 3AA9A 5B0FA 5GMDA 1VQ6S 2CKWA 1UJ6A 4R0EA 2VBWA 3HD2A 1N33F 3A1YG 1HQEB 1RADB 5RUBA 3HCXA 4F36A 2DCLA 4OL8A 1H2TZ 1KC8T 1OO0B 1U09A 1HWLA 2JC0A 2YX1A 4UY85 2OSRA 4U9RA 3MEGA 2COLA 1JJ4A 2D41A 3W62A 1Y10A 3MWBA 2PE8A 3NL0A 3LP2B 2ZUAA 3LGHA 5LM7E 1ZYQA 1N36F 3JQKA 2WCXA 2M7SA 2E9RX 1TK0A 4TLQA 4KGVB 2MGZB 4AT1B 1QUVA 1WHXA 2ZZTA 3B8HA 2B8QA 2E5HA 2E5LF 1VK8A 4KHPF 2DR5A 3CD5A 4GKJJ 3ZZRA 2ZHBA 5KG7A 4PXCA 2PI5A 1TV6B 2MY7A 1JLAA 5E7OB 1UJ4A 1FJ7A 4CM0A 3NG8A 5L1IA 4YB1P 3G71S 3GV8B 1KLMA 2UZAA 3ZZOA 4DFPA 3K5LA 4FF2A 4FNHA 1UEKA 2HNZA 5L1LA 4P7VA 3FZ2A 4J9SA 1XN9A 4ZIWA 1SL0A 1UA0A 2K1RA 1J5EJ 3I82A 5GAHI 1TQLA 1L3KA 3GPAA 2J7UA 4XPEA 3L3CA 4DS5A 2HWTA 1NDKA 3IWLA 1SVDA 2W25A 4YR0A 3M2VA 4OMFG 1NB2A 1S5ZA 2GNKA 4MKVA 3EM1A 2N4CA 3D7SB 2J7WA 2EFPA 4YOEA 4A48A 2ZKTA 4AYBD 4EU0A 1XC9A 3G82B 2UVUA 3JTNA 3UPFA 1EP4B 2CA9A 2XZDB 1CPZA 2ZKUA 3GYXB 3ULHA 3HHNB 4UOHA 5CHCB 2AX0A 1TUWA 3FCHA 4OYAA 1F0XA 4K4ZA 2CQGA 3VQTA 1HBOB 2RRBA 3D68A 2XO6A 3QRPA 3BGLA 1PJ7A 1UTAA 1Y7PA 2YKMB 2ERRA 2BMBA 2CXEA 4ZLNA 3C6TB 3QLHB 1FX4A 4LBHA 4KGKA 1X60A 3HHLA 1S72S 3NS7B 3CO0P 2AZ3A 1NMEB 3ZTSA 3OPKA 3C15B 3H4BA 2CNKB 2GVZA 5HAOA 1QAIA 1VMBA 3B78A 4EBCA 4YDXA 2C3YA 4ED8A 5HO4A 1D0EA 1IM6A 4IH7A 5L8RC 5L1JA 2GGPA 4M5DA 3GR1A 3OUYA 3QMQA 2EBEA 4IOCQ 2M8DB 4DL2A 1Q8LA 3AB2B 3FSYA 3Q8YA 3TJ9A 2YWWA 5DRKA 1ZTTA 3QGHA 1CJKA 5ETPA 4LF9F 3MMBB 4QIVA 4I6YA 1FKPB 3TEHB 4YB6A 1CJUA 3BQ1A 3DLGA 1U1MA 1JXEA 4L6V3 4FDFA 3EGNA 1TKDA 1DLOA 2HEKA 2XMWA 1NAQA 2QLBB 2DPJA 2NYHA 4OYOA 5DZ6A 3VAFA 2DEJA 2MMYA 1R89A 3AQPA 3CCSS 2E1AA 3SV3A 2IM1A 4GC6A 2CWXA 3W65A 1U0HA 4NZ6A 4TN2A 1UEUA 2VU5A 2VV5A 4LRDA 5E33A 2IDEA 4RLEA 4V1Ak 4ECVA 2Z0GA 1XMOF 3RR8A 2WTFA 1M1HA 2FC8A 4PUOB 1JLAB 3VQSA 4ZP8A 4ZA1A 3D4JA 3R2CJ 3SSSA 1NK7A 2UXBJ 2QX0A 2QV6A 3E3XA 4ED4A 2Q6CA 4O44A 2BZ2A 1KEKA 4YHHF 2KG0A 1SH2A 3GSDA 5HK4A 2UXCJ 1WORA 2F4VF 3KNGA 4IRKA 5A0YA 5CQGA 1HLWA 3DLEA 3FEXB 1VRTB 2Z4PA 2CPDA 3EYZA 2H54B 2LEPA 1MLAA 2DHSA 2BKOA 3L4BC 1U7LA 2OKQA 3NY0A 4CYUA 1HIYA 3GJQB 1VHFA 2KL8A 2W9CA 1K0TA 1RWKB 1FTRA 2FY8A 3PX0A 3GIMA 4NLGA 3G2XA 1UCNA 5HMYA 3ET6B 4ZITA 2IC3B 4JI7F 3UQSA 2F8EX 3VGVA 1XK8A 4DV6J 1GMUA 2MZSA 2R8JA 3EZUA 2GO8A 3HFVA 5KFKA 2CQDA 5CZXA 1SL1A 3RR7A 1C4CA 3B54A 1JLFB 1KKHA 4M5IA 1PAEX 2IA6A 2FVPA 3IS9B 2IM0A 1XNRJ 3HHLB 2FHJD 1IKXA 3AXKA 5C2CA 4BBYA 1IBLF 3TA2A 1HI0P 1IBKF 2NXCA 2X7IA 2GVZB 1UVMA 3MAHA 1S0VA 1SUQB 1BUXA 4U7CA 2QIFA 3BV8A 3Q8RB 2GGPB 3EZ5A 1YLXA 3OUYB 5K8OA 3MR3A 2ZDPA 2W2QP 4NLVA 1B64A 2YPYA 4LSZB 2ZZNA 1GEHA 3CCES 3EICA 3NOGA 2AGOA 1S1VA 4EBDA 1CJKB 1X0PA 3NP5A 5IXUA 1UVLA 1J27A 1RT3B 1CJUB 1WSRA 2RMLA 2HVDA 2H51B 2XB2D 2HAFA 3HHLC 1S1UA 1NJYA 2YQ1A 2RF2B 2DT9A 3IO1A 4IQMA 3PHEA 4DOZA 3TJAA 1CVJA 3LQVA 1PGZA 1QUPA 3S7RA 4O3SA 3FMBA 1NKEA 5LXRA 3BGRA 5HATA 3KDOA 3C46A 3DCAA 3DU6A 4DR3F 5DM6Q 4KKOA 3DN9A 1HWJA 3CMQA 3MCMA 4RW9A 4RWXA 2J9DA 3TA1A 2QRRA 4OYWA 4J9QA 3HXMA 1JLEA 3BPDA 4YDDB 4L75A 5KFZA 3P6YC 1G4CA 4CO3A 4I2PA 4B9SA 1S9FA 2CJ9A 3GIJA 2KXHA 1UETA 1AXQA 4IO1A 5F41A 2HRUA 4MFBA 2E1MC 2L9WA 5C25A 4X4RA 5DQIA 3IWXA 1C4AA 4B3MJ 3C3LA 1E6VA 2J0XA 3PYGA 3UDCA 1RT7A 1FVQA 2CVEA 1Y3KA 5KT3A 1HBMA 3HVTA 3VGTA 1BY9A 4CO1A 3H42A 2V69A 1S10A 1B70B 4DX7A 1FWKA 4HLBA 2XGQA 2FUG9 4KAIA 2W24A 4J37A 4DDFA 3M8SA 2V4RA 2DHXA 4CLUA 1NM2A 3NOCA 1TL3A 2M3DA 2W9CB 1RHMB 4HH0A 2XLJA 4DV7J 1Q4RA 1UJ5A 4K2JA 4DSJA 2DNRA 2IY5B 1U47A 3KLFB 4NMXA 5DJBA 3P5BP 3N6MA 4ILRA 3CCJS 2UUCJ 1DQ8A 5KFXA 3N79A 5DG9A 3RG6A 3CCQS 3O1LA 2ZBQA 3NGKA 1QY7A 2VFRA 2M5YA 2PC6A 2RUGA 4ELVA 3VAJA 4RNHA 1D1UA 1P1LA 3HSZA 4I2QA 3ZZ0A 2XMAA 2QEXS 1N5VA 2R3VA 3A8IA 3M8QB 4EYHB 2MKJA 4PG7A 3QAUA 5C7PA 4JI3J 4NLYA 2B43A 4WU2A 4FYDA 2V67A 4J9LA 2VONA 4L74A 4ZCIA 3TAPA 3DOKA 1JLCA 3GYNA 3UO0A 2DR8A 4QW8A 3GR0A 2HS3A 1RTDB 2WB1D 1GXTA 2IRYA 2ZNZA 2LU1A 1RTJB 1G6BA 3SXLA 4Q0BA 3QFHA 1FNOA 2BDPA 3C66A 4QIWD 2WVDA 4UOCA 4FPRA 4DR4J 4MKYA 2RNEA 2WB4A 2VH7A 1WELA 4R25A 4A8YA 1UW9A 2JFKA 3P96A 4NLQA 4UQTA 4NLUA 3OBIA 1Q78A 2HHQA 1S1UB 4USUA 5KG4A 4FYYB 1UFWA 1WF2A 4IH6A 4KT0C 2J0WA 1E6YA 5EDWA 2CQ4A 3HLUA 5E5NA 2RKIA 2B4VA 5FJ4A 2CPHA 2QSFA 1KQFB 4BWMA 1WD6A 1XBWA 1Q79A 1WWHA 3L95X 4KO0A 1D9AA 1M90T 4F67A 3OFEA 4EYIB 1A9NB 1RXOB 4ES3A 1SJQA 4ZHRA 3TX0A 2UV8G 4KKOB 4X62F 1F5CA 3T9ZA 2VQEF 2Z30B 5J2NA 1Y5LB 2R7TA 3AA8A 4OZ3A 2OPSA 3PEHA 4GMKA 1KTQA 1M5PC 3SEOA 1NK9A 4CLTA 1VQ9S 2R7OA 2J0QD 4LREA 3LGMA 4I2PB 1EIYB 3QT7A 2MQMA 4LF4F 1C1BA 2ZH3A 3TZYA 3VAMA 5C25B 4OFZA 4DL0C 4BC9A 4NCGB 1XIQA 2JOQA 3M30A 4OLPA 2XC9A 2A2CA 3DLLQ 2FVRA 1DTTA 3HVTB 1S1TA 1FTCA 3QGPA 2HSEB 3SCIE 4Q8FA 2WVEA 2B5JA 3C16A 3CJQA 3M9MB 3ILLA 2AWZA 3D0IE 2KO1A 2QA4G 3SYZA 2JC1A 5LT5A 3OTOF 1T9XA 1XMQJ 3T1YJ 3OSPA 3U02A 2J9EA 1TL3B 1RWOB 2FLNA 3V5RA 3FCWA 2C3UA 4IG3B 2R42A 3W61A 3BZQA 3CJTA 4DL7A 3G96A 5KFVA 1JLBA 1ZA1B 5KTQA 2EBGA 4AUKA 3MMJA 1WI8A 2P9EA 1TKZA 3M8PB 3QJPA 4RBVA 3U7JA 4EI2A 2FD2A 2P6SA 1FJEB 3GTYX 3JSMA 4DQRA 1TL1A 4TYAA 2WSEC 3QIPB 2AEJA 1P9YA 2HWHA 1XR5A 2W9BA 5KFSA 3DRRB 3OJSA 1LWCB 2B6AA 3QNWB 2OD4A 2YNFB 2AX1A 4A8WA 3QRQA 1JLGB 5IQ6A 5JXSA 2VIHA 5AT1B 4KHPJ 3LP1A 2VPXB 3MCNA 4DV4F 3O3LA 1RBOB 3PR4A 2CQIA 2FHJA 1UZDA 4LFBJ 2BEFA 4KSEB 4F0HA 2QYGA 3L7OA 4C0BA 4S0MA 1SC3B 4Q0BB 3MAAB 3DLHA 3THPA 4NLWA 4ZP6A 1YBUA 3B6BA 3K89A 2AJ4A 2Y0BB 5H9FJ 5B08A 4DR6J 2B51A 3TYTA 3CMAS 5K8MA 5DDPC 3HSGA 2BOAA 2BJ3A 2WHOA 4M5KA 2YWHA 3NBPA 4OHZA 1VQLS 5L39A 3K59A 1L3UA 4KO0B 3M6WA 4WF9Q 3T41A 1RU2A 1HMVA 1WEXA 2VDIA 4RNFA 1RHKB 4O3NA 4WIQA 3KLGB 5L46A 3PKMA 4M94A 2OPSB 3D54A 2W4PA 6AT1B 2FJXA 2XG8A 4CIOA 2MZ1A 5DQHA 4KGMA 4NYOA 1NDLA 4M5JA 4AXJA 4DU7A 3KMQA 2DNHA 2U1AA 4CTAB 1C1BB 3HF5A 4ED0A 3GQCA 2XGPA 4F4KA 1M5VC 1UVJA 4QQBA 4ZLLA 5KG1A 4TVAB 4WK1A 2QG9B 1S1TB 4NRUA 4YUDA 5FD1A 1RDRA 2VG5A 4IQXA 4K4SA 2Z56B 3DLKB 1U4BA 4CH7A 3QQCD 3TZXA 1Y5IB 3BGOP 3NGTA 3C16B 1RBAA 1FJGJ 3UVJB 1Q82T 1S6QB 2VD3A 2HHHJ 4C11A 1HNWF 2MHNA 2DHAA 4J5OA 2ZWOA 5DLGA 4L3NA 4C48A 2RJZA 3JTPA 4QR2A 1NLKL 3G4SS 2DR9A 1RT6A 3QT5A 1GMWD 1HD0A 3ZZTA 3I56S 2B4UA 1F60B 3GFZA 3P4UB 4MKBA 3OVSA 2GHVC 3BB5A 1TKZB 5KFAA 3D1QA 4EZ6A 1VYAA 1NZAA 1Q8BA 1SJ1A 1RT5A 1NK8A 4ES2A 2WONB 3TUPA 1HL6A 1AB8A 1W25A 1N88A 1HBUA 2DBBA 4PXEA 4WFXA 4QR1A 2AT1B 2CJKA 3TJ8A 1RKIA 2GCFA 2CJQA 2AYMA 4HACA 2YNGA 3LALA 3OLAA 4C3MA 1S12A 1FFGB 4ECWA 1LK5A 4Y34A 8ATCB 1FKOB 2R9LA 1O0PA 3LW5C 2FJVA 2VPYB 5HLFA 3JSBA 2DGXA 3MECA 1NXIA 4WFBQ 1DARA 2KZMA 3HT0A 2CQ3A 4YB7A 5J2PB 1LWEA 3HZGA 5B0EA 1FWLA 2R8GA 4M95A 4JI5J 3ZTPA 1EB0A 1S59A 5GAGI 4B3TJ 2FJDB 1RCOB 3GP9A 4FF3A 4ZVEA 2XMTA 5EN1A 3VVUA 1MNEA 4CLSA 4ZPTR 3W5YA 2JEFA 4KGXB 5H9EK 4FS2A 1GNKA 2IJFA 3FNNA 3QGGA 4FBTA 2A10A 4GO7X 5H1SV 2KVIA 1B0TA 4TYBA 1YJNS 3OFHA 2HVZA 3K2YA 3FEZA 2PIIA 2R7UA 2CQ2A 3J81j 2G4BA 4OI0A 1J5OA 1OJ4A 2O67A 2ZOMA 1YITS 1HMVB 1X4GA 4MMOA 1N5YA 4NA3A 5EX3A 1PAUB 4ICLB 4KV8A 4HH1A 1VBYA 2HMIB 1NK4A 1BQNA 5FIIA 3OXLA 4WE1A 1ITPA 1DTQA 2K8GA 1WSVA 4DUZF 3SQOP 2MLYA 1MMDA 2A18A 4N41A 1ZBTA 4ZS6A 2C2EA 2YNIA 1GQEA 4JI1F 2K3KA 3CD6S 3G6VA 2CPZA 2DHHA 3M9NB 2HRYA 3MXHP 4ZN1A 2IYIA 1MWZA 2QLJB 1GH8A 4DSIA 1UVIA 2I1RA 3CC2S 3OHBA 3D67A 1IBKJ 4X64F 4DFMA 4EZ9A 2ZC3A 2ZJPQ 2XMVA 1G1XA 4UQGA 2RILA 2JVRA 4TU8A 2DO4A 2VFVA 2ASLA 1F3VA 3QSYB 4A47A 1NUEA 2QYCA 3VAGA 3V6DB 3MGJA 5HSPA 3BBCA 3JTOA 4DSKA 1GTEA 4WZMA 5BR8F 4TQRA 1OMSA 1XJWB 4Y2AA 1NHVA 1YJTA 3CUNA 1R6YA 3R5DA 2VA2A 1EQMA 4QW9A 4K7QA 1NRKA 3UDLA 2HBRB 4DLGA 1BQMA 4QWCA 1H7XA 2DTJA 1FX2A 2G2ZA 3I9V9 2NYIA 1KD1T 3OL9A 2ZOFA 3W2WA 3W64A 1NH7A 1HBUB 2AEFA 3RBDA 4Y65A 1LXJA 2GS8A 5A8WA 3VAHA 3EGVA 1SKWA 4HACB 2KFNA 3A12A 1U6ZA 4DR3J 3N5BA 4CO2A 4TXSA 3M6XA 1Q5YA 3EE3A 2AQ4A 5I42A 5H9EJ 1HQUB 1SV5A 1X31C 4F2RA 1S9EB 2KZZA 4J9VA 2MLXA 5DM7Q 4FF1A 1HARA 3ENWA 1JLQA 1BWVA 1LWEB 4F3OA 2DIUA 1WUUA 3EGZA 4HTIA 5ITHA 2J5AA 5A8RB 4G1QA 2YKNA 2ZVSA 5I3UB 4JV5J 2Z58B 3TUIC 2GO9A 3T6BA 2P9CA 4ZJOA 2H5JB 1T02A 1NPKA 2NXUA 4QYZK 2CADA 1HNIA 2VF3A 2HNYB 2F8MA 2OEMA 3TVYA 2GHPA 5K14B 3CDWA 3KLHA 3I5AA 5J1NA 2VB6A 2VUGA 3Q8PB 4GKJF 5I4MA 4Z37A 2V68A 1CEZA 3TP2A 3H90A 2FC9A 4J90A 3HT3A 4X84A 1OSDA 4JI4J 2VICA 3J7A1 2MQPA 3H2LA 3IBWA 3R8YA 1CS4A 3KUHA 1AFIA 1J5EF 3MTJA 1R8PA 1BLUA 2X1FA 2GJFA 3H0PA 3MFHA 5IM0A 3MI7X 4AD6A 2H5EA 4ZN3A 3I5BA 2Q6BA 2DGSA 2M2BA 2ZDOA 3OV7A 1OQ3A 3T1HJ 2NQPA 3VR1A 3T5JA 4UW2A 2HFVA 3DLBA 2VASA 1BQNB 1NJXA 4X4TA 1QTMA 1JMTA 2GIRA 4TKTA 4I69A 1D8YA 4ID5A 2Z2MA 2FJBB 4UF4A 4G1IA 4WFZA 3CJ3A 4RBTA 3BH6B 4OZ5A 2IBOA 2KKHA 1WC5A 2QO3A 2IRXA 5SZTA 4LRCA 3AOBA 1RYSA 2KN4A 2EKYA 4AQYF 2NUHA 4OX9J 2APOA 1M5KC 4R5PB 3TQ1A 2LECA 5JVGQ 4KPYA 1IQTA 1OWXA 3H25A 2HLUA 2L9NA 3P5TL 2AJQA 1A7GE 3GLJA 1V5VA 4ZVGA 1V3SA 3IAM9 3IN5A 2JEGA 3IBCB 1FVSA 3HJVA 1UZHA 1Y5NB 3NGRA 3DNCA 2MSSA 1F2HA 3A8KA 3HX9A 2NZCA 3PIPQ 4PRFA 1XEZA 3QO9A 2PGCA 4H4MB 1M5OC 2MKHA 1P1TA 1RT1B 1ZPWX 4M5HA 1HBNA 3MM6A 1FEHA 4LSLA 5KFNA 3THVA 1JB0C 3UD4P 4O0NA 1Q95G 3K58A 1WF0A 4ZJLA 1NK5A 2QA1A 3CCLS 2VPWB 1VQ7S 2C1EB 1S1XA 4V19X 4I56A 1CJTB 3MEKA 5J1EA 2DK2A 4OX7A 3SDEB 3K57A 3MOJB 2DGUA 3DI6B 3R2DJ 2A3JA 2FZKB 2XO7A 3PNIA 3M2RB 2VFTA 3MOZA 2V4QA 2RS2A 4B9MA 3C14A 2ZH6A 2AD9A 1SQGA 4ZPVR 2RS8A 3MD1A 1WG5A 3QT8A 3GFHA 2W01A 2L41A 3PJXA 1R0CB 2MZJA 4TU9A 4UZCA 1N32J 3IG1A 3AXMA 2JDJA 2V2ZA 3Q2TC 4HT7A 1GMWA 3M8ZA 2PMZD 4QU6A 2P5VA 2X1BA 1HR0J 1UPMB 2WVBA 2VQEJ 4PYDA 4LQ3A 4WCEQ 3LOUA 1YJWS 2UXDJ 2RUSA 2HGLA 2EK1A 1SKSA 3SSRA 3I0SB 2OH2A 3IP0A 1WHVA 2YWFA 1CSJA 5ETSA 4X4UA 4HL9A 5LSRA 3MR2A 3MUTP 4ED6A 3L7UA 2B9WA 3PM9A 3FGVA 3MM8B 1KQKA 4N8NA 2W1BA 1LV5A 4LF4J 1ZS6A 1TAUA 1C1CA 5JVHQ 2MJUA 2B7CB 3HVRA 4OYBA 1WACA 1WTBA 2VZ9A 1FRJA 2DXEA 5GADI 3MPDA 2MKIA 4B08A 3ILJA 3AB4B 3GYGA 2MTLA 1TKTB 2CPJA 5ADZA 1YKWA 3HM9A 4YS2A 3FFIA 3H2UB 2HLTA 2CPYA 2ZH1A 2JNJA 5F8JA 2Z57B 4HDGA 3ILOA 3LPYA 2YY3A 3ETMA 1HKAA 2GMLA 3RGIA 1FK9A 3NAIA 1XQIA 5A6PA 2UXCF 3A8JA 1AROP 2LU2A 2W7OA 3M7VA 5J2QA 1NO8A 1BXNA 1TKXA 2AYEA 2FLOA 1SKRA 3FBCA 2CJAA 3AAWB 1R8HA 3KK3B 4UTGA 2WSFC 1VQSA 3DGPA 1FERA 1SH0A 1RAOA 4ID5B 2B8PA 2PN6A 2RT3A 3IC1A 2OHDA 3V4IB 5DGAA 3DM2A 4DLEA 1IKVA 4F02A 2W2PP 2CDQA 1X5SA 7FDRA 4OYIA 2D7SA 2BANA 3TR5A 1DZ5A 3R5GA 3POTB 4B3SJ 4DF8A 5T41A 3D2WA 3Q8SB 4DV6F 5D0HA 3CCRS 2IRUA 5M2PA 2HVIA 4C6AA 4YY3J 2X51A 1I5OB 4XAKA 3W60A 1H6KX 3X3UA 3BBBA 4P10A 4N8OA 4RW6A 2H48B 4CO4A 1ZAWA 5E41A 5F8HA 1TU0B 5IT0A 1Q16B 4Z7CA 4DPTA 3KK2A 1S49A 3J7YI 3UFCX 2YNHB 2C2ZB 4C3KA 4I4BA 4EK2A 3BQ2A 2AJ1A 1XNRF 2G2YA 4DV4J 1AUSL 3K5PA 1U49A 4IUFA 1OQ6A 1EKSA 4MT1A 4OJ3A 4NLOA 3QAEA 4F8RA 4MK9A 4WP9A 4O4GA 1S6OA 1RE1B 1WKJA 1ROFA 2V2KA 2MKYA 4ELUA 4XTTA 5CAAA 2PMWA 2B7BB 2HAIA 3R97A 5F9LA 2FLLA 3HPOA 2C2KB 2XYGB 3NMRA 2KXNB 2B9EA 1N6QA 4C97A 3PKYA 1Q5VA 4EO8A 1SBRA 3OR1A 4USIA 3R5AA 1IKYB 4PWDB 1K73T 2RSQA 2G0JA 5DZ7A 3EVWA 4JV2A 2KM8B 1PYTA 4PAAA 3HVAA 2Y1IA 1FESA 4USJC 4LR8A 2IJRA 1RHJB 2KXFA 2LDIA 2UUWA 2Y1RI 5D4OA 2VG7B 2QMUB 2HVHA 4F0KA 1SKUB 1TL7A 2IIHA 1RHRB 2HYIB 1T9VA 3I0RA 4OHWA 3R6LB 3R3TA 1GAOA 4F04B 1NJIT 5FLXU 5G4DA 1CULB 4K5SA 1IR1A 2OI2A 1HYSB 2GAGC 4A8OA 3KJVA 2J6UA 3MAQA 4ILMA 2J8AA 1MMNA 1AYEA 1WHYA 4PQAA 2XWXA 1T9TA 2XZWA 4FYWB 4ALZA 2V0NA 3WX8A 2G9OA 3W9JA 1BC6A 2KM8C 1NPPA 2YQ3A 3FFIB 4ZCKA 5CYQB 5L9XA 2KJVA 4NI2A 1DQ9A 3L7PA 4Q5VA 2HHSA 1TVRA 2FY1A 2MQ8A 1U1QA 3GMGA 1CJVA 2OD6A 4B3MF 1JJHA 1U1RA 2WBRA 4PG8A 1FRLA 4ZCMA 2BJ9A 2UUTA 3M8YA 3RRGA 1DQAA 1ZM9A 1N4LA 2EI5A 3FMWA 1KQGB 1F5AA 3GIRA 3D3CJ 3SIPB 5E3RA 1OS5A 1RWVB 2PEBA 4B17A 2IYGA 1LFWA 3ISNC 5KFYA 2XNQA 2RQKA 3EDRB 3MCSA 2QLFB 4DR2J 5FLXY 1RTHB 2HRTA 2JEJA 2JWNA 4DV7F 3EMTA 3W2VA 3RU0A 3DRPB 1S57A 1ZH5A 2ROPA 2HIQA 3ZZPA 5DGBA 2EFOA 1LW2A 2UUCF 1EJ7L 3W1YC 5IT4A 1M5SA 4BDPA 1U24A 4PG6A 2DO0A 3IAS9 1TR0A 1DFDA 3U1LA 3RRKA 3VF0B 4F4XA 1SCJB 2IAJA 1FA0A 3PW0A 4DFKA 1T7PA 3PXGa 3KK2B 2EFNA 3TA0A 2W4DA 4WJBA 1T9WA 4N77A 4ETXA 3CWJA 3IRXB 2CQCA 2H1YA 3MM7A 4ZVOB 5F9NA 4PZVA 4MK7A 3BH7B 1KR4A 2M9KA 3JAMU 1XWLA 5D4NA 1MWQA 4LRBA 3AD8C 3PYDA 1SQFA 4EO6A 3DRSB 3N4WA 3N9UC 4HKQA 3RZAA 4YR3A 2RAQA 2YX7A 3MEEB 1N6QB 2AJ2A 2BQRA 2ROEA 2DGOA 2QL9B 4U95A 4IDKB 1RSCA 1YSJA 4QZVB 2A1BA 3V81A 2FVCA 4B3OA 3CE8A 3VAIA 4KFBA 5HQMA 3HMJG 4FZVA 5F0WA 4AL7A 1S76D 1U0SA 3JYTA 2OGUA 3BN4A 3TEGA 5CABA 2ZH7A 1QM9A 4OI3A 4RW4B 2LFVA 4LQ9A 1SI9A 4U8YA 2HZCA 3W3SA 4X4NA 4RUAA 5KFJA 3TNVA 3H59A 4DN9A 1S1WA 3OTCA 3BKTA 4O23A 4GVBB 3DMJB 1JKHB 2QL7B 4TY8B 1TAQA 2OPQB 1PYSB 1URRA 1VRUA 5CA5A 4KH0B 4CP5A 2GC8A 3LO3A 1T9UA 3KUEA 2LEAA 2V9KA 4LF7J 3I4PA 3VV2B 3M2UA 1HD1A 3PX4A 3WHIA 1YJ9S 4C8KA 1R8CA 2L3MA 2ZJRQ 1RAFB 3JAMY 4F26A 2NXNA 3DOMA 3HFZB 1W2BR 1FJCA 4CRJA 3HSDA 3WC2A 1A0OB 2RE1A 2VJUA 3E8OA 4PXDA 5GMKa 2XS7A 3B82A 1TUVA 1V6HA 1NHKL 2DNGA 4LF2A 2VKZG 1MSWD 3QJLA 2DJWA 2PI4A 3VZHA 2IFXA 1VQKS 4BWJA 1IBCB 2FHMA 2IPOB 4FYVB 2E1CA 5CYMA 5IV3A 4CH0S 3DOLB 2VOOA 4E8UA 3ZC4A 4IFYB 1LKZA 3RW7A 3NGUA 3G87A 4CWBA 3CCUS 2C28A 2DD8S 3DYAB 3M1VB 4JV0A 2MQQA 3P49B 2GQQA 1VK3A 2M0GB 4LSNA 2L48A 3CEDA 1WC0A 5K5MA 4C0OC 1XMQF 3T1YF 2R7SA 2RU3A 2ZWPA 3V6JA 5KT4A 3W2VB 1X4EA 3CB4A 2HWIA 4CZCA 2V6AA 4F3QA 4ZVQB 5DDRC 2XM3A 2I8EA 2UVRA 4QIGA 1RBLA 4YQWA 3MR6A 2HGNA 2BRLA 1HNXF 5KFRA 2XI3A 3W5XA 4LF8F 2U2FA 1GX5A 4NA1A 3D66A 4TNOA 5HBMA 5KAKA 2LA4A 5DG7A 4DSEA 4W98A 1K44A 2QN6B 2H9ZA 1SJFA 2KH9A 3RB4A 2RH3A 5HVGA 5E2QA 2PT0A 2ZH2A 3F56A 3MM7B 3T3FA 4DX8H 1RWMB 3KHHA 4HR2A 5AXKA 3MPYA 3ZZZA 3UCUP 2MB0B 3CD0A 4CO0A 1IUJA 2W7AA 3KG4A 4A8XA 5F8NA 2MLZA 2MY8A 4ZPDA 3OVBA 2HNDA 3KHRA 1EETB 2BE2A 2EFVA 3BKUA 1M0SA 2IM3A 2MKSA 1HHSA 4LFBF 2JEIA 1X4HA 5HROA 3OR2B 1WKLA 1F6TA 2EG2A 1OY8A 4K2XA 4ECYA 4HHUA 1Q86T 4LUBA 4Y0FA 4NZ7A 1NJZA 3K0JA 3PYFA 1YRUA 4DR6F 3LGNA 3TVZA 1VQ5S 3QPIA 3W5ZA 3T5KA 1IKWA 3CC7S 1VQYA 1S0MA 1S1WB 3H5UA 4R8UB 2R8HA 5D6GA 3Q8QB 1X4FA 2DGQA 1HHQA 2KYZA 1GK8A 3HFKA 2Y1LB 3HJFA 3LUYA 1T05A 3VGSA 1VOMA 3TAMA 2F8HA 3BSAA 2N4DA 4CQ1A 3GONA 4AQYJ 2PA8D 2LQ9A 4WFNQ 4X2BA 3G6YA 5B0GA 2CYYA 4AXIA 3JB9k 1KHWA 2NSCA 1HNVA 3DXBA 2DXFA 6FD1A 3R7BB 2DB1A 5CYJA 1SQEA 2V4JA 3U27A 2MHEA 2OSQA 2XHCA 3PTWA 2O5DA 2E7WA 1RGVA 3BSNA 3PCOB 3SZ2A 3CIZA 3CCWA 1RTIA 4ZLPA 4TU7A 3KLEA 5T7LA 3TX8A 1N48A 4DFJA 2XMJA 4OZJA 3C6UB 2RHQB 4QOTA 2VA3A 2YTCA 3K8WA 2GX8A 2I5JA 4Y6IA 1VC5A 1RWPB 1C0TA 3VALA 2XSJB 3J7ZT 3LWMA 3DLJA 2W2MP 1G7CB 1AZSA 2Q79A 1FJGF 4IFVB 1YTYA 2HHHF 2DR7A 1UVKA 1T03A 2DRBA 4MYTA 4F4WA 4WPAA 1IWGA 2E9TA 2HK2A 1SJ4P 3R5CA 5C24B 4RW8A 3G8QA 1VR6A 4OV1A 4XPCA 1YJUA 3VGUA 2DYAA 2FDNA 2KFYA 3N5FA 3RJMB 4DQSA 1X9MA 2QGFB 2XS5A 1Z2ZA 2C3PA 4BHQA 5HJYA 3D28A 4RUBA 2UUBJ 1QAXA 2CZVC 4HDHA 2D9PA 5EUHA 1EX8A 4ZMMA 1XNQJ 1U26A 1RYRA 3UD3P 5B09A 1TUGB 2UVVA 3RAQA 5HBMB 3GJTB 1RWXB 4QPXA 1PSDA 1YG0A 4ZVSB 1MU2A 3MEGB 2XSFA 5IWAJ 4CLZA 3HD1A 1KBRA 4DQIA 5K9FA 1S6UA 3P45B 1QTNB 2NS1B 1RA6A 2D3UA 4KQZA 1JNZB 1OPIA 3CJ0A 3WDOA 1Q7LB 4H4OA 4CO5A 1Q7YT 3QRRA 3MDFA 4ZVFA 2HNDB 3TRGA 3ZTQA 2MZTA 3QGIA 3TOQA 2LQ5A 4F4YA 2JX2A 1KVIA 2L9DA 4JI5F 1QJHA 3GG1A 1HI8A 2ZH8A 5ETMA 4LF5J 2G0IA 2E7XA 2HG4A 1KLMB 4B3TF 1IN0A 3GIKA 2DNZA 3KFWX 2HNZB 4KYZA 1KFDA 3AT1B 1VIXA 2K1RB 3NNAA 5EWFA 3E01A 3G8TA 4IG0A 4DI6A 5D0RA 4JI8J 1PO6A 4DPXA 1HNZJ 3NMAA 1WNEA 1KVKA 3GFYA 3TW0A 1CBKA 3PO4A 5C5JA 4P2FA 1D09B 3M2VB 4PQUA 3RB3A 2HPUA 1T05B 2DY1A 5L1KA 4NXNJ 4DU8A 2CDRB 4LVNP 4ELTA 1R43A 4C8LA 3UN5A 4B9TA 3UDEA 1WJ9A 2UUAF 2MQOA 1B4SA 4K4YA 1C0UA 1L3VA 4FKYA 4NYPA 3UI3A 5KG6A 2BV3A 2C2MB 4WYWA 3F73A 4OYPA 5KFLA 4B02A 4U7UD 4K8RA 1YX2A 2DKOB 2E1RA 4DSFA 4M8LA 1RTIB 4NLPA 4KPCA 2A6MA 3CPWR 2H65B 4NLSA 2F63A 5GVQA 3I31A 2BJEA 2HURA 2MZRA 3ZTRA 2ZE2A 4IRCA 5HP1A 2N82B 4DR5J 4JB8B 4LRAA 2PA3A 2LCWA 3GU0A 2I5JB 1H73A 4F3MA 1U48A 4QPTA 4OX6A 3JSYA 2DH7A 4ECTA 5IC4B 2OPRA 1Q8KA 3GWCA 1KNZA 1V9OA 4M5DB 3E51A 2KT2A 4DEZA 4ZIVA 1G2EA 3BN7A 3WX4A 3B4MA 2XS2A 4OZNA 3OTDA 5CXTA 4KTQA 1ZAXA 4NWBA 4MTPA 3UR3C 1R8AA 4WKRA 3I4HX 4A8FA 3J80U 3DLGB 3NNCA 4JBCA 3BREA 1HFEL 4ECRA 1I94J 1KLNA 4QWDA 3UE2A 1DLOB 1WEYA 2E44A 4P6QA 2DEIA 4H4KA 4L76A 3SFGA 2G1DA 4J9PA 4J9OA 3MEDA 2V63A 2SXLA 5AE3A 1OIAA 5D0EA 2XTJP 3HP6A 2BXJA 3UN2A 4LFAJ 1U0HB 1IQZA 1IBMJ 1GFWB 4K4TA 2UVWA 3MMCA 3CJ2A 1S6PA 2Y3YA 2G13A 3QSIA 4FBUA 4ED2A 2X1GA 4F50A 1PBUA 4X4PA 3TARA 2H5IB 1HI1A 3M6VA 3QBCA 3OTEA 3MM5A 3EDQB 1SPBP 4WP8A 3KLIA 2OAUA 4MYUA 2I2YA 3UDVA 5AXNA 2C2NA 4ED1A 3KK1A 1FDBA 4JV5F 4Y00A 2DNLA 1N52B 3EPGA 3NGDA 1QVFR 2DRDA 2CZ9A 1REVA 2E5JA 2KFZA 3EUNA 4P7TA 3BR8A 4O44B 1WG4A 2NPFA 3D1OA 4M63A 4WIIA 2D1CA 4CLFA 3J80Y 4IG0B 5A0YB 3DLEB 1LEOA 2B9XA 4ZLJA 1VISA 3NCRA 1H7WA 1OYEA 4AE5A 4JI4F 3T19A 1HW9A 4OI1A 1O8BA 1NPRA 3MF5A 3FCVA 1K47A 4U96A 2C2DA 3PEJA 4CYUB 2CNOB 3IR6B 2QFIA 1H2UX 4FVMA 2YVSA 1RWWB 2Q3PA 1EHWA 4EBEA 1NDCA 2IA0A 1RHUB 3DKDA 3T1HF 3ELHA 3NWRA 4WTOB 3RRHA 2GMJA 1LW0A 2PEHA 5KT6A 5GAEU 2HQFA 2J8SA 4I67A 1NHUA 2I38A 2AIRB 3U1NA 4CM2A 1U8SA 2BE9B 1FXDA 2HFSA 4ECQA 1Q81T 2OPPA 1QVGR 4DV5F 4OX9F 2XYPB 1HQEA 3GCWP 4K5RA 2OEKA 3TVKA 3FBFA 4OI2A 2QA2A 8RUCA 4OYZA 4Z2XA 1IKXB 3MUMP 2RIJA 4EUVA 1RK8A 2MJNA 4DPUA 5KFMA 5ETTA 3VTIA 3SBMA 1U1NA 3PYEA 2CZ4A 1RAJA 5K8PA 1GXUA 3Q0AA 2BX6A 3Q86A 4Y28C 2XZTB 4P9SA 1QAYA 4MIBA 4X65J 3C2PA 1RLCL 3LP2A 2LYVA 4RL1A 3DDKA 4M5NA 3KDNA 3WBZA 3BYPA 4DUTA 2MGZA 3OL8A 2HQCA 2HBQB 2FLPA 2Y8WA 3GSIA 1S1VB 3BGUA 1TV6A 1XERA 2W8KA 2XI2A 3FZBA 4NCBA 3IWNC 3BBFA 1PILA 2EW9A 3S8SA 1WDDA 3IFEA 4NMLA 1I1GA 2WBMA 1Z2LA 2IVMA 4Q8EA 1FE4A 1N32F 2LXIA 2F7VA 3MUVP 1LQ9A 4OHYA 4DV3J 2QTWA 4DV1J 3GV7B 3BGRB 4FXDA 4NEYA 3CF5Q 2VBYA 4DZDA 5KG3A 5EWEA 4IR9A 2JLEA 1HR0F 2ZH9A 2VPZB 3MD3A 3M6UA 4RW9B 4J9RA 2UXDF 5FDLA 1FI4A 4ZVUB 1IWAA 2WVFA 4HI1A 1ELOA 3G6ES 2NPIA 4NL5A 1JLEB 1R31A 4DG1A 3G82A 3UW1A 5EX0A 2HHUA 4IKAA 1EP4A 4M1KA 3KLIB 2W4CA 3OL7A 1R27B 1AT1B 5D4PA 1UMJA 3ITHA 1WC4A 4MFBB 3V4MA 3FK4A 5C2GA 2R8IA 4ECXA 2QE5A 3TZWA 4H4KC 1X4CA 4N56A 1E6VB 3KTQA 5D15A 1RT7B 1RP5A 3CIMA 2YKMA 5IZHA 1I51B 4LMZA 1HBMB 4UT4A 3C6TA 4K4UA 4ED3A 4LRFA 4JI2J 2YKOA 4QBUA 3BO2A 4CNZA 1LFPA 3C15A 4UY8T 1AFJA 1BMQB 1JJ2R 1YRTA 1P27B 2GQCA 1N0VC 3T9NA 2V2QA 4NLRA 4RNOA 1S0OA 1TFYA 2ILYA 1KTVA 3ZNJ1 3AJ2A 4OZLA 2VBZA 2VFSA 4YMEA 4V19J 3GCXP 4TQSA 1S0NA 3EVOA 1IJEB 4CT8A 3RBEA 2N7CA 2CRLA 3M4XA 2O66A 5HMWA 5KFPA 4OZ1A 2JRSA 2E1PA 3MMBA 3IR7B 1FKPA 5KFDA 1HNXJ 2AW0A 2OPPB 4LF8J 3UCGA 3R5BA 2OUGA 1ULRA 4B3SF 3K5NA 2RDJA 3CJRA 4LFCJ 4I2QB 2OMLA 1YJRA 2FZGB 4YY3F 1SJ3P 1I3OB 2D3O1 2W7PA 3BDPA 1R0BG 5KOWA 4QIFA 1U2FA 5MAOA 1YHQS 1HQ2A 4Y2IA 3PV8A 1B99A 5LXYA 3WIVA 2BJ7A 1OY9A 4OX8A 1RLDA 3DOKB 3FVYA 3QT6A 1JLCB 4FP9A 2HQGA 4YFUA 3QIDA 1VQOS 2KVQE 3S01A 2VG6A 3S6EA 2E29A 3ENVA 4K4WA 2EXUA 3QATA 4ZOSA 4Q44A 2FHKA 3PFOA 3FQLA 4YN3B 4PUOA 2CG4A 2JLFA 1U45A 4DS4A 4C7QA 2FJWA 2BUNA 2XLIA 2GFFA 2D74B 5KFHA 5LMUJ 3AOAA 5GAHU 1NH8A 1U1LA 2HHPA 2J6SA 1E6YB 1W26A 4KC5A 2RKIB 3D6TB 1VBXA 1YWXA 1Y9OA 2EK6A 2ZITA 1VRTA 4DN0A 4ZPBA 5DG8A 2BRKA 3SV4A 1U1PA 1JJCB 2CAJA 1YI2S 3FBEA 5BYRA 3CJ8A 4ZHRB 3TZZA 2GAHC 3F41A 4B3RJ 2BE7D 1R6VA 1WDTA 4USHA 4A8MP 3TANA 1X5TA 1FHTA 4BLGA 5FDLB 5J2NB 4L72B 1M1KT 1OY6A 1ZAVA 4DCOB 2EPIA 4DG1B 4E98A 1D8ZA 4NXMF 2POKA 2KT5A 3OQ2A 5A2QU 3ZNUA 3ET6A 5HL7Q 5DDOC 2IC3A 2GIFA 4ANEA 4JOUA 2E66A 5DS7A 2AHOB 2V2VA 3FSIA 1WI6A 2CIMA 3PW5A 1T11A 3ITHB 4O4RA 4ED5A 1RAGB 2FQQB 4OYMA 1Y0HA 2B0GA 4RNMA 3J81U 2ATCB 3M30B 2ZZMA 3BQ0A 1JLFA 1DTTB 2DR6A 2MQLA 1UWAA 2C3OA 2AV5A 3IS9A 1UW4A 4LBIA 4AL6A 2GQ2A 4RR5A 2V50A 2YBVA 2B5JB 3H5XA 3SCJE 3AD9C 2YH1A 4WP3A 1SUQA 3IXQA 5D78A 4NE9C 4QYRA 4OQJA 1LWXA 1B7YB 3PZPA 1IXKA 4OYXA 4ZCLA 1PC4A 4MK8A 3BR9A 1NCLA 5J2MA 2N3OA 2XNRA 4IO9Q 2V9WA 1CLFA 5HI7A 1JLBB 1FD8A 2R7RA 4IOAQ 3CDUA 2R2UA 4FXWA 4EEYA 4DMZA 1X9WA 3GFXA 4C98A 2E5GA 1RT3A 3JSMB 4I68A 5A2QY 2Y9HA 4DR2F 1FKAF 2P2CB 2A2DA 5U47A 3BO4A 1RWNB 3R1LA 4N76A 1X7VA 1TL1B 1FXLA 3M05A 2YKAA 4YEAA 4DR7J 1YBTA 3PIOQ 3NEKA 4ZPAA 5D3GA 1VIOA 4P2MA 9RUBA 2RF2A 1FD2A 2V94A 3A3OB 5M2RA 2W9BB 1V3RA 1EQ0A 2QL5B 2BABA 4FVCA 2OTJS 3J81Y 2DNYA 3KG1A 1LNQA 2QMWA 3TI0A 2B6AB 2KTQA 3D0GE 3AFGA 1SIWB 1VBZA 4OJHA 2UU9J 1B0PA 3LP1B 2F40A 2ASDA 2VG6B 3LF0A 3NS6A 4F7VA 3PJWA 3MPVA 1RAIB 5D77A 2MYFA 4RUHA 4G65A 5KFQA 1NK0A 4RPFA 2E7VA 1T3NA 1RQ0A 2DNQA 5HMZA 1H2VZ 3H40A 2HQIA 2MKCA 4ZVRB 3Q2SC 4USMA 4N5SA 6FDRA 1ZPVA 4N7TA 2IBKA 1SC1B 3D1HA 1K1SA 2BM1A 4JI6J 2ZBRA 3NBPB 5LSLA 1FDAA 3BYRA 2R2TA 1D3WA 1XTZA 3R7SB 3D6FB 4Q45A 4YB5A 5DQGA 3W9IA 1N54B 1IR2A 3NNHA 4NEZA 1P8GA 2LVWA 2CJYB 5DDQC 2KJWA 2UUAJ 3GE9A 2YPZA 2FB0A 4C8NA 1VJWA 5KFCA 2NXEA 4GKKJ 1BWEA 1YQHA 2A0FB 5MLCV 2K06A 4ID8A 5AXMA 1H98A 3KLFA 4GC7A 5DETA 2LDYA 4LF7F 1KVJA 1VBKA 2HBZB 2WVCA 5F8IA 2V8GA 2NZ4A 3OTBA 1RT2A 3P3DA 2CQPA 4FYXB 4F4ZA 3SMZA 4DV0J 2LA6A 2VG5B 3OLBA 1UAWA 2DGTA 3GG0A 1JXLA 5LSOA 1TMMA 2CVIA 3ZO7A 1VHIA 2VQFJ 3N0VA 2DH9A 1CC8A 3M8QA 2UP1A 1PJ5A 2R8KA 3TQEA 4ILLA 4C11B 4OJGA 3TAQA 2V5HG 3O44A 1VFJA 2E9ZA 2MEWA 3AJ1A 2BOPA 3OSNA 4AFFA 5J2MB 2DITA 1ZM4A 1RB0A 2DRAA 1RT6B 1RTDA 2XCPA 2XMMA 4KH1B 1RTJA 3CCMS 3G9CA 4PXBA 3KJQB 1NKCA 2AJFE 1F9EB 2DIVA 1RT5B 3KKFA 5LL6d 1N0UA 4DCPB 4C3LA 2WAQD 2K7JA 5D3GB 4WU3A 3MR7A 3H7HB 2YNGB 2IHR1 3GV5B 4WXWA 3FKBA 1VGYA 2OEJA 5LOQA 2DY9A 3ONQA 3EPIA 4I6WA 4ZP9A 4ED7A 5HLFB 1X5OA 4OLOA 3MECB 2HHVA 4P2XA 2LXUA 4OHVA 4ERDA 4DXLA 2UV8A 4URQU 2XWYA 4ETZA 3RB6A 3AD7C 4BC7A 1AUDA 3CO9A 3I9ZA 4B9NA 5A8KA 4ANDA 3O2IA 2WZ1A 2PSZA 1R0AA 4X4VA 1NDPA 1PKUA 3A4TA 3H2VE 3H5YA 3FSXA 3RUBL 2AYGA 2LP4A 1TL4A 4HVZA 5KFOA 4NCAA 4ZPWR 5GMEA 2YKPA 5B0CA 2K7KA 4RU9A 4NCGA 2F9DA 4WFYA 2FVQA 4DQPA 1NBEB 3KHLA 1PIEA 2O01C 2BVZA 3QJJA 1GX6A 1J5OB 2RQ4A 1JX4A 1N5YB 3BDEA 5K8NA 2QMXA 2HIYA 4KV8B 2ZNYA 1WC1A 4ECUA 2J0SD 1IVZA 1SJRA 2NUUG 4P75A 4WE1B 4ER8A 4ZDNA 1DTQB 4C9DA 2AEMA 1NZ8A 4IG3A 1N34J 5KG0A 4LR9A 2M8HA 4DCJB 4X4OA 1HW8A 2IVYA 3US5A 1HA1A 2YNIB 1IM4A 1UFKA 4DV5J 1FRKA 1W2IA 2Z2ZA 4DL5A 4ZVTB 4DX5A 2GMHA 3H4DA 1IR0A 3KXDA 3M8PA 2LMIA 1VQPS 1WHWA 1RT2B 1L3SA 4Y2CA 2JVOA 2CFXA 3OXFA 2IMOA 3RBXA 1RZMA 4X66F 1PYOB 3QIPA 3MMAA 5C42A 1FNXH 2H4WB 1RJJA 3DRRA 4WYLA 2RHSB 1VQ4S 4MIAA 2MPUA 2RVJA 3DHWC 1LWCA 2OMOA 2DCUB 3FRYA 2FYXA 2R7QA 4PR6A 4ANCA 4XIUA 2YNFA 1NK6A 3OL6A 3GILA 4HI2A 3VHQA 2JLGA 1JLGA 1DURA 4O3RA 1FF2A 2MZQA 5KFBA 3LA0A 4H54A 2V8HA 2J9CA 2GZOA 4XDCA 2R4FA 1Q1KA 1RKJA 1APSA 4WXOA 4A8QA 2O1PA 3MAAA 1AA1B 3IRWP 1BQMB 3PVXA 4USWA 5DO2A 3QZ8A 1KS2A 1B3TA 2GJ2A 3W2WB 1L5UA 2R7VA 1YK9A 1U6BA 3M9OB 3D3BJ 5EWGA 2YXLA 5A8WB 1QD1A 4RNNA 4QYZJ 2BM0A 4RKUC 2ZOGA 2CPXA 3CDEA 1NSQA 2UUBF 4RO0A 1X4DA 5IC6B 1U2CA 1XNQF 3CDAA 4EWTA 3AJDA 5I42B 3EX7B 1SV5B 5KFGA 3SI8A 2CQ1A 1SB6A 3M32A 5LMNJ 4LF6F 1JLQB 3NAHA 1HWIA 1OYDA 4KHRA 5IWAF 5H9FK 1VRQC 4OI6A 3KLGA 1XR6A 2J76E 1UWBA 3B4DA 3C8YA 2E5IA 3L9ZA 4MH8A 3R1HA 2FHOB 4G1QB 2YKNB 3KNAA 5A8KB 2DISA 4USTA 4ZVPB 1S9GA 4KB7A 1R0AB 1HNIB 2WRMA 3LWLA 4USKA 2R7WA 3WZ0A 1YZ7A 8AT1B 5HJXA 4YR2A 3QFWA 4CTAA 1P9QC 3KLHB 3NXZA 4NLDA 4DR1J 3N28A 5KFUA 2OLWA 2KG1A 1EAYC 2KRBA 2WSCC 4LF5F 2ALYB 4Y2KA 2V8VA 3DRXA 4U7UK 2ATLA 3PRVA 1WKKA 3ENQA 5IS2A 2YWKA 3DLKA 2VJVA 2CPEA 4W92B 1CS4B 4ZPCA 1KOHA 2QC3A 2BBEA 1MN9A 3LANA 3O8WA 2AYBA 3R5JB 2M88A 2OTLS 5IM0B 3UVJA 4JI8F 5HVFA 1S6QA 3BO3A 2MKKA 1HNZF 4PEOA 4D3GA 5AJ3J 2B56A 3K5MA 4DHVA 1BHNA 4JI0J 2XY6A 4DV2J 1H38A 2ZHOA 2J9DE 1Q53A 5G0RA 4KBIA 4NXNF 1NNDA 2M4MA 3MPUB 2RDDA 4HYKA 3NCPA 4LT6A 1UFLA 2C22A 3MHYA 2M52A 1WC3A 2BW2A 1N56A 3ZZUA 1N33J 3MCOA 1F3FA 1FO1A 2EC2A 1YJVA 2WONA 4DL6A 2F3JA 3D5MA 1S7IA 2XYHB 5BXIA 5J1PA 3DHXA 2QLWA 3RAXA 2I6WA 2DVIA 2DHGA 3MMAB 5F8LA 4JYAF 5C42B 3QO9B 1SL2A 1CQNA 4GRSA 2VOPA 1YDLA 1SH3A 3V6HA 1FKOA 2HS0A 3FBBA 3ETOA 3E2EA 2ZM6F 1HBNB 3MM6B 5EGYA 2XBPA 4LSLB 2X1AA 1N36J 2HZAA 1F9FA 3ZXWA 3CCZA 4NOHA 1H72C 1D9DA 2F9JA 2CNLB 1TZ0A 4DR5F 2E5LJ 5J2PA 3V2UC 3IMQJ 1S1XB 1FNMA 1WG1A 2QFJA 5J1EB 2DNMA 2VKRA 3EVMA 2B9YA 1RHQB 2D3ZA 2AMCB 1NJWA 3IM9A 3JS9A 3C14B 2AZ1A 1N5TA 2AJ0A 5ETQA 1ZM2A 3W8PA 4TLRA 4DUYF 4E0DA 4G3IA 3IGVA 2AKWB 3HZEA 3PJ9A 4DF4A 3IG1B 1KSPA 1I6JA 4RBUA 4QCLA 1S99A 4UOFA 4LVOP 4Y3CA 4IR1A 3PW4A 1TTHB 2MDAA 3MTKA 3HO1A 1I94F 1VLOA 2EG1A 2JSXA 5ETKA 1T94A 1BD6A 2ZVIA 2FJAB 3Q89A 2YWGA 4ECSA 4J9KA 1U8WA 5IV4A 1GXLA 3DU5A 3M32B 4A8SA 1Z4UA 2DXDA 4NXMJ 4ICLA 1FRMA 4LFAF 2HMIA 1YZ6A 4ENOA 2WW4A 3CXCR 2R2SA 1UWBB 1X4AA 3Q23A 1IBMF 4FXVA 1MW7A 5CH7B 3DDIA 1C1CB 5JJBA 1TK5A 3DGVA 2MQNA 1S9GB 2RRAA 1L3TA 3KLVA 4KGZB 5KFTA 3JSRA 1CQMA 4I0WA 2Z2LA 9ATCB 1O5JA 1FWPA 3WC0A 4CNYA 4P72A 1RWUA 2VC0A 2HFNA 2NCKL 2Q43A 2PDAA 1DHMA 2KU7A 3ENAA 4UUXA 1N5QA 2HKEA 5ETNA 1LWFA 2HS4A 4Z7YA 2OFGX 1X9SA 2QSWA 1FK9B 2RU9A 5JMNA 2OIHA 2HFZA 5CCMA 5A6WA 5J2QB 3G6XA 3R7NB 1TKXB 3V6DA 1EKRA 2BKPA 3DXSX 3GIIA 4D3HA 1IJFB 1TL5A 2F5GA 5AE2A 4OV6A 3DGPB 2ZBCA 3RW6A 4LF9J 5G0RB 4U8VA 1RA7A 1F9HA 5ETVA 2D9OA 5B7WA 3DM2B 4Q7AA 1IKVB 4P2SA 2BANB 4CLWA 1MROA 4OHXA 5KOXA 3SCLE 1UPPA 4GVLA 3ADAC 2BW7A 5BJRA 1SC4B 3AH6A 2LXFA 1TK8A 2J7KA 4LR7A 2O3DA 3G86A 4XDDA 4EFAC 5IT9U 3AOCA 1K8AT 2PO4A 2IJNA 3QYYA 1QLNA 5CD4H 2GV1A 4RW6B 5L38A 2LLZA 2CUYA 3KOAA 4IRDA 1Y4ZB 1T95A 1A6LA 5F3ZA 2Z2YB 1U2RA 3KMSA 1F5BA 4TY9A 4FKXA 1HQUA 1S9EA 3OVAA 3ISND 1K0VA 2KT3A 4PPDA 1FRHA 1XMOJ 5AXLA 4O4GB 3I32A 5LJ3Y 3HDSA 5ETLA 2FJEB 1QE1A 2DNPA 5GAGU 1H3DA 4OIXA 2HVEA 3PY8A 2XMUA 3O5TB 2ILZA 5A8RA 4AL5A 2ZFHA 5I3UA 1NU4A 3BKFA 2Z8QA 2LQBA 3Q24A 4X65F 4K0KF 3RB0A 1REGX 4KJIA 3HKWA 2HNYA 5B0DA 4PPZA 1GMVA 2F1FA 4ITSA 4YHHJ 1V3ZA 5K14A 3OR1B 5E3QA 5E3CA 2ZC4A 1KRPA 2F4VJ 1QSSA 4J9UE 2BQ3A 2XEXA 2VHGA 4CT9A 2IVFB 4F2SA 2ZUGA 4BS2A 3BF4A 1KN6A 2PFFB 3FRZA 4EGLA 2C42A 3OFFA 1JIHA 5B0BA 2BACA 5IT9Y 4W4MA 3IR5B 3DFEA 1TL7B 4NX9A 3HI9A 3Q8UA 3PO5A 4DPYA 3H8YA 3I0RB 1KONA 4DV3F 2GJIA 4DV1F 4WBFA 2HFOA 1FT8A 5E0OA 5HQLA 4JI7J 2VFUA 2IDLA 3LPEA 3KJVB 1DJ0A 4FS1A 4B9LA 3CDBA 4A8KA 1JQGA 2JH3A 4NASA 2DNKA 1Y11A 3PHTA 4A46A 4G6VB 3UNYA 5BYQA 1MN7A 4R5PA 3K7RA 4B9UA 4RZRA 3NGSA 4E2FB 1R8BA 1K9MT 3WQPA 1QSLA 2NXJA 4NI2B 1IBLJ 1RABB 1RT4A 1TVRB 1LWFB 1TMJA 1CJVB 1HHTP 1S4EA 3K8VA 5LJ5Y 2AGQA 4P74A 3F0NA 1KP6A 4H4MA 1VC0A 3N01A 7FD1A 4JI2F 3I5CA 1RT1A 4F25A 1S48A 4KY3A 1N8RT 1CG2A 4HHHA 2CQHA 2CWKA 3HHKA 3MFIA 3HHEA 2PMHA 3VZIA 1FFSB 3CC4S 4M5GA 2PFDA 2KI2A 2EEYA 1DRZA 1RCXB 2NLWA 1CJTA 5F8MA 3SDEA 3DI6A 4QWAA 3MPWA 3S1TA 1SC6A 3M2RA 1YIJS 3LP0A 4PABA 3IA0A 1JK9B 1MROB 3RYLA 5T14A 1WOPA 1VQMS 5CZVA 1M5HA 1LW2B 1WEZA 4CLPA 4CI0B 3HVWA 3OD2A 3EJMA 1RU1A 2HHXA 4DQQA 2V8PA 1Y00A 3DDNA 1U1OA 2C2OB 2KHDA 1H74A 4P73A 1F2GA 3AODA 1UVNA 2IAJB 1JNRB 2OP5A 4PWUA 4IYQA 1UP1A 2XLKA 1KHVA 4LFCF 5A76A 3VVTA 2H4YB 2N7YA 4DSLA 3A3PB 3W8GA 3I0SA 1MG7A 4LJMA 2G0CA 3JXOA 2RB7A 3DC2A 3CVKA 1YGYA 2K2PA 3KYLA 1QE1B 2W2NP 1R7IA 3W9HA 4DWIA 3RBZA 5JUMA 2LQ8A 3MM8A 4M5MA 3W63A 1T3OA 4CDIA 1M1GA 5EHHA 4DJBA 4O3PA 1RUSA 3FUYA 4O3OA 2GHWA 2WOMA 4DPWA 2N3LA 1VS3A 5D8HB 5AE1A 4B9VA 3V81B 3NCQA 4B3OB 1FFWB 4I1TA 3TO8A 3K17A 1TKTA 1ACMB 2BJDA 1SIZA 2ROGA 4KFBB 3FC9A 4I7FA 2YH0A 2HBYB 2OELA 2FGOA 3JYTB 2WK4A 2BA9A 3GJRB 4DX6A 1T9YA 3ILIA 1WC6A 2YKQA 4RJVA 4ZJQA 1NSPA 5LMUF 1UKUA 1ZZFA 2PD1A 2NR0A 4K50A 1NSKL 4FN5A 1DY3A 1RAHB 1U6FA 2HHTA 2LQJA 2HQDA 5ETRA 3RAMA 4ZP7A 3QWPA 1UL3A 1ZETA 3UNGC 4CCHA 4DPOA 1VRUB 1VDHA 4U67Q 3CJ4A 4M5LA 4J9NA 3KK3A 2ZEJA 5ETOA 4B3RF 4X4QA 5IQQA 3M2UB 4HEA9 3SQGA 2EKNA 3W7BA 3CGIA 4C0HA 2KB2A 3V4IA 4ZVHA 5HMXA 3DOMB 4C8ZA 1TELA 1S4FA 2QZ8A 2DGWA 3PW2A 3MZIA 1XR7A 5I3QA 5L9NA 4WKYA 3POTA 4W90B 4OJ1A 1P6TA 4X66J 3M8WA 2BJ8A 2D3OR 3JQJA 3R6GB 3MR5A 3P8BB 1WOSA 1RT4B 2ZH5A 2JHEA 2RQMA
chains in the Genus database with same CATH topology
2UUAJ 3D3CJ 2F4VJ 5LM7E 4DUZJ 2UU9J 4DV6J 1N34J 4KYZA 4X62J 1IBLJ 4LF6J 4B3RJ 3OTOJ 4DV3J 4RJVA 4DV1J 3T1HJ 4GKKJ 1N33J 2UUBJ 4NEYA 4JI1J 5IT9U 4K0KJ 4DR2J 4DV5J 4B3MJ 3R2CJ 1XNQJ 4HHUA 4GKJJ 4LF4J 4JI8J 2UXBJ 1FJGJ 1HNZJ 4LFAJ 4DR1J 2HHHJ 4DR5J 4JV5J 3R2DJ 1IBMJ 2KVQE 4X65J 5A2QU 4B3SJ 3D3BJ 3W1YC 4DUYJ 1XNRJ 2UXCJ 5IWAJ 4KY3A 4X64J 4JI5J 2MTLA 4OX9J 4JI3J 4NXNJ 4KHPJ 4YY3J 1XMQJ 2MQ8A 3T1YJ 1J5EJ 4B3TJ 1N32J 1XMOJ 4DV0J 4JI7J 3J7AN 1N36J 1HNXJ 4LFBJ 4NXMJ 4JI6J 4DR7J 3J81U 4LF8J 5LMUJ 5AJ3J 5LMNJ 4LF9J 2E5LJ 4JYAJ 2VQFJ 4DV7J 4AQYJ 3IMQJ 4PWWA 5BR8J 1HR0J 4LFCJ 4JI0J 4X66J 2KL8A 4JI4J 1IBKJ 2VQEJ 3JAMU 4DV4J 3J80U 1HNWJ 4V1Ak 4DV2J 2UXDJ 4NEZA 4DR4J 4DR3J 2ZM6J 4YHHJ 4DR6J 4LF7J 4JI2J 4LF5J 2UUCJ 5FLXU 1I94J 2MEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA J;  3D3C J;  2F4V J;  5LM7 E;  4DUZ J;  2UU9 J;  4DV6 J;  1N34 J;  4KYZ A;  4X62 J;  1IBL J;  4LF6 J;  4B3R J;  3OTO J;  4DV3 J;  4RJV A;  4DV1 J;  3T1H J;  4GKK J;  1N33 J;  2UUB J;  4NEY A;  4JI1 J;  5IT9 U;  4K0K J;  4DR2 J;  4DV5 J;  4B3M J;  3R2C J;  1XNQ J;  4HHU A;  4GKJ J;  4LF4 J;  4JI8 J;  2UXB J;  1FJG J;  1HNZ J;  4LFA J;  4DR1 J;  2HHH J;  4DR5 J;  4JV5 J;  3R2D J;  1IBM J;  2KVQ E;  4X65 J;  5A2Q U;  4B3S J;  3D3B J;  3W1Y C;  4DUY J;  1XNR J;  2UXC J;  5IWA J;  4KY3 A;  4X64 J;  4JI5 J;  2MTL A;  4OX9 J;  4JI3 J;  4NXN J;  4KHP J;  4YY3 J;  1XMQ J;  2MQ8 A;  3T1Y J;  1J5E J;  4B3T J;  1N32 J;  1XMO J;  4DV0 J;  4JI7 J;  3J7A N;  1N36 J;  1HNX J;  4LFB J;  4NXM J;  4JI6 J;  4DR7 J;  3J81 U;  4LF8 J;  5LMU J;  5AJ3 J;  5LMN J;  4LF9 J;  2E5L J;  4JYA J;  2VQF J;  4DV7 J;  4AQY J;  3IMQ J;  4PWW A;  5BR8 J;  1HR0 J;  4LFC J;  4JI0 J;  4X66 J;  2KL8 A;  4JI4 J;  1IBK J;  2VQE J;  3JAM U;  4DV4 J;  3J80 U;  1HNW J;  4V1A k;  4DV2 J;  2UXD J;  4NEZ A;  4DR4 J;  4DR3 J;  2ZM6 J;  4YHH J;  4DR6 J;  4LF7 J;  4JI2 J;  4LF5 J;  2UUC J;  5FLX U;  1I94 J;  2MEW A; 
#chains in the Genus database with same CATH topology
 2CQB A;  3MM9 A;  3T6J A;  3I87 A;  4PKD B;  4IH5 A;  3PRB A;  5KFE A;  1HPZ A;  2IMW P;  2DNN A;  1MML A;  2CJB A;  2HZV A;  3ZTO A;  2ZH4 A;  1KQS R;  2F65 A;  2F4F A;  3T5L A;  2YNH A;  3ICL A;  5HAN A;  1F1B B;  1TP7 A;  5CYM B;  2VBX A;  1FCA A;  1RAC B;  2Q1L A;  1T0T V;  3D9B A;  2W8L A;  2JJ4 D;  4ZKA A;  3ZZY A;  4NLX A;  2I9S A;  5KT2 A;  3H5S A;  4LSN B;  1C2P A;  1HWK A;  1S7H A;  3MUR P;  1Q8I A;  5F8G A;  4DL4 A;  2HQ3 A;  1PC5 A;  2QLX A;  4LIW A;  2EFQ A;  2G2O A;  3LP0 B;  1VI7 A;  3HHD A;  1FE0 A;  4NPO A;  2X3D A;  2KHC A;  4MAK A;  1X4B A;  1U1K A;  1VC6 A;  1IKY A;  4PWD A;  2RDI A;  3D6H B;  2FTR A;  2CJX B;  2C2R A;  4DBQ A;  2H3E B;  4BCA A;  4O3Q A;  1GT8 A;  1O6X A;  4RUC A;  4X62 J;  3T5H A;  4LF6 J;  2EFG A;  4DR7 F;  2VG7 A;  3ISZ A;  4QU7 A;  2KRR A;  1XMB A;  3CCT A;  3J7Z 5;  1KOO A;  4L3K A;  3TUJ C;  1U25 A;  3R9L A;  1QSY A;  2IM2 A;  1H0H B;  3VAK A;  2G1H A;  2ZJQ Q;  3PRD A;  2RD5 C;  2XY5 A;  1CUL A;  3Q22 A;  2OO4 A;  3UWT A;  4KHM A;  1HYS A;  5F0U A;  3BSC A;  2UU9 F;  4KE5 A;  3L09 A;  3NLC A;  2BE2 B;  4NZ0 A;  5GAD U;  2WOM B;  3Q83 A;  5D4L A;  2P9G A;  4C4W A;  3FEY B;  1YBA A;  5HRO B;  4WZQ A;  4QIE A;  2BKN A;  3D6M B;  3C19 A;  4I7F B;  1BE4 A;  1WTF A;  1PCA A;  2R2R A;  5CYQ A;  2RQC A;  3V6K A;  4UOG A;  4G1P A;  5HVH A;  1X0F A;  2UXB F;  5F3T A;  1IKW B;  2WW8 A;  4RU2 A;  4JI6 F;  3KG0 A;  3OTO J;  4K4V A;  3N6N A;  3I55 S;  5E3A A;  4OI4 A;  5HN0 A;  2CG8 A;  4LBP A;  2L08 A;  1S77 D;  1BQX A;  3TAM B;  1OSC A;  1FEE A;  4N47 A;  3EWG A;  1J2V A;  4QR0 A;  2Y0S D;  3SQG B;  3SFU A;  2ZBI A;  2ASJ A;  1ZTW A;  4C8O A;  4K4X A;  4GKK F;  3IGN A;  2GVD A;  4K59 A;  3KJF B;  5I3P A;  1RTH A;  1O51 A;  4FF4 A;  2GW8 A;  1HNV B;  2R7X A;  2BR0 A;  3DRP A;  1Z1Z A;  1YJ7 A;  2ZHA A;  4KR0 B;  2V4J B;  3UCZ P;  1WF1 A;  4JYA J;  4RX6 A;  5KT7 A;  2YQ0 A;  3Q8V A;  3CJK A;  2JFD A;  3FQK A;  3T1A A;  1G3O A;  5KFI A;  3MM9 B;  4R0J A;  2ZM6 J;  3KLE B;  3J7Y U;  1HPZ B;  5T7L B;  5KG2 A;  1VCT A;  1GTH A;  4DV0 F;  3EXY A;  3DRY A;  3IRX A;  4JP8 A;  3KHG A;  3CT9 A;  1C0T B;  3BS9 A;  1D9F A;  1NSA A;  2VQF F;  4J7C A;  4NLT A;  4MJK A;  2CNN B;  1AZS B;  2FGC A;  2EWH A;  4KRW A;  2GA7 A;  1LXN A;  2ADC A;  1T03 B;  3EXC X;  1FRX A;  3DRS A;  4DUY J;  3UN3 A;  4C2M A;  4CLL A;  3N6L A;  4RW8 B;  3CNQ P;  5KG5 A;  3MEE A;  3CW2 C;  1FRI A;  2ASY A;  1EZZ B;  4HHJ A;  3ZFV A;  4IDK A;  4C8Y A;  2AU0 A;  2VOD A;  4OZ0 A;  2M70 A;  3A8E A;  1QDU B;  3NS5 A;  1S97 A;  3HKZ D;  4NA2 A;  4PWW A;  1SXL A;  2VC1 A;  3UD5 A;  1JWW A;  4DZ6 A;  4RWW A;  4RW7 A;  4OZ2 A;  4FPI A;  4RW4 A;  5HQ8 A;  1DBD A;  3AQO A;  2HK3 A;  1EAR A;  1RTZ A;  2P6T A;  4Y2M A;  3EZO A;  1MU2 B;  4Q2M A;  2A6O A;  2BQU A;  1B7F A;  3GJS B;  2RRN A;  4GVB A;  3DMJ A;  1ZZN A;  2FPH X;  1JKH A;  3THT A;  3AHP A;  4TY8 A;  1W7W A;  3PG9 A;  1RAA B;  3LH2 S;  2OPQ A;  4I64 A;  4QWE A;  3BSO A;  3NRB A;  4F4A A;  2W9A A;  4EMD A;  4H4O B;  3OJU A;  1JXV A;  3OXG A;  3PR5 B;  4ECZ A;  1OPZ A;  1KFS A;  3EGW B;  3PW7 A;  3HHL D;  1UA1 A;  4DL3 A;  3CD7 A;  3KUG A;  2KDO A;  2QT7 A;  1S79 A;  2DNO A;  3LAM A;  1N5S A;  4PYA A;  3F44 A;  4LF1 A;  2FZC B;  2DGV A;  3KWM A;  3G8S A;  7AT1 B;  2ABY A;  3I6P A;  3RTV A;  2C3M A;  2KYX A;  2W2O P;  3M8R A;  4J91 A;  3IBF B;  2GIQ A;  2P8I A;  4XO0 A;  3OT9 A;  4LIR A;  3E01 B;  4ATN A;  4X4S A;  1NEE A;  1HNW J;  2BJ1 A;  4HT5 A;  1X8D A;  3HUL A;  1HWU A;  3TWZ A;  4PG4 A;  2MST A;  4PQU B;  3LAK A;  1T8E A;  1K1Q A;  2I0X A;  3DOL A;  5KFW A;  4IFY A;  2D69 A;  1NKB A;  5E3P A;  4HTJ A;  4O0I A;  5CD4 A;  4JV1 A;  5IFM A;  4ES1 A;  3DYA A;  2XUL A;  3M1V A;  5THW A;  4URG A;  5SUH A;  2XCA A;  2ZD1 A;  4I6A A;  2VDH A;  1VJQ A;  1KWM A;  5IOL A;  1ZOT A;  2B4P A;  1C0U B;  3QWU A;  2CPI A;  2YX4 A;  2GVD B;  2OJ3 A;  2J6T A;  4F0M A;  3FJ2 A;  1N34 F;  5GAE I;  3H20 A;  3D0H E;  3BM7 A;  3OHA A;  3J7A N;  1B0V A;  1BGX T;  3BEG B;  4WFA Q;  2HHW A;  2HW3 A;  3CJK B;  3VWS A;  2ACM A;  1PJ6 A;  4JUZ A;  1YRX A;  3BJY A;  4PG5 A;  4UZB A;  4J9M A;  2FVS A;  2AGP A;  2ZE2 B;  1V5I B;  5HP1 B;  1Y3J A;  2DH8 A;  3QZ7 A;  4ZK7 M;  1Q0N A;  2ZBP A;  2V34 A;  2BYC A;  5CCL A;  3PX6 A;  3BPS P;  3A3N B;  2XY7 A;  1WOO A;  2OPR B;  3CJ5 A;  3K5O A;  3A13 A;  4K0K J;  1ICE B;  3H98 A;  4JI3 F;  4A4J A;  4WK3 A;  1KDN A;  3GZ7 A;  2LEB A;  1EET A;  3O6Q A;  1FXR A;  2MXY A;  2B4O A;  5D0G A;  2K3I A;  1LK7 A;  3OW2 R;  1QAJ A;  2Y8Y A;  4YP3 A;  2XQC A;  4Q2L A;  4P52 A;  2NSB A;  2OFH X;  3OR2 A;  3HK2 A;  4DR4 F;  3CUL A;  4QJV A;  2ACY A;  5M2U A;  5K20 B;  2VL1 A;  4C8M A;  2JZ5 A;  2XHW A;  4CH1 A;  4WTY A;  1RAE B;  3VCD A;  4RW7 B;  2CPF A;  3AY0 A;  3MED B;  4GO5 X;  1R3N A;  4KIA A;  3CME S;  2EVZ A;  1X5P A;  4PCQ A;  4R8U A;  3KJN B;  2B3T B;  1YVF A;  3R27 A;  2V8D A;  3MMC B;  3NWG A;  5B0A A;  4DUZ J;  3LTO A;  4CLK A;  3GB0 A;  1S6P B;  3CCV S;  4FNI A;  2QJ3 A;  1DAX A;  3SCK E;  4JI1 J;  1MWY A;  5LMN F;  4MKA A;  3UR0 A;  5BYS A;  4L73 A;  3IM8 A;  3MM5 B;  3CJS A;  1VQ8 S;  3JQM A;  4XK8 C;  1AW0 A;  1RI7 A;  3KK1 B;  2Y1J A;  1URN A;  1FDD A;  2AP6 A;  4X64 J;  1REV B;  1HBO A;  1U02 A;  2DPI A;  2ALZ A;  4UUW A;  4U6P A;  1UEV A;  4MIW A;  4URS A;  1CC7 A;  3TUZ C;  2QA4 S;  2HFU A;  3U1M A;  5KT5 A;  1RIS A;  3QLH A;  4NYZ A;  3NKY A;  4DR1 F;  3WIU A;  3CTR A;  3PAC A;  2ADB A;  3C6U A;  2AF6 A;  5KFF A;  4P71 A;  5BR8 J;  2EC0 A;  4USV A;  2HGM A;  3X1L B;  4IOB A;  1ZM3 A;  1LOU A;  2CQ0 A;  1NB7 A;  2FIU A;  4WWS A;  2XSJ A;  4Q43 A;  3HSJ A;  4QWB A;  2LKZ A;  1PBA A;  2Q66 A;  4IFV A;  1ZA2 B;  2ZD1 B;  3FDS A;  5AJ3 F;  2YWE A;  5DLF A;  4NRT A;  1LW0 B;  3W66 A;  3OFG A;  1VLY A;  4JI0 F;  1PG5 B;  2XMK A;  3PFE A;  5C24 A;  3I96 A;  3SSQ A;  1TFW A;  2JL9 A;  3CSK A;  4DV2 F;  4CLY A;  3PDN A;  2X3G A;  3BGF A;  2NRE A;  1FDN A;  1VQN S;  3AA9 A;  5B0F A;  5GMD A;  1VQ6 S;  2CKW A;  1UJ6 A;  4R0E A;  2VBW A;  3HD2 A;  1N33 F;  3A1Y G;  1HQE B;  1RAD B;  5RUB A;  3HCX A;  4F36 A;  2DCL A;  4OL8 A;  1H2T Z;  1KC8 T;  1OO0 B;  1U09 A;  1HWL A;  2JC0 A;  2YX1 A;  4UY8 5;  2OSR A;  4U9R A;  3MEG A;  2COL A;  1JJ4 A;  2D41 A;  3W62 A;  1Y10 A;  3MWB A;  2PE8 A;  3NL0 A;  3LP2 B;  2ZUA A;  3LGH A;  5LM7 E;  1ZYQ A;  1N36 F;  3JQK A;  2WCX A;  2M7S A;  2E9R X;  1TK0 A;  4TLQ A;  4KGV B;  2MGZ B;  4AT1 B;  1QUV A;  1WHX A;  2ZZT A;  3B8H A;  2B8Q A;  2E5H A;  2E5L F;  1VK8 A;  4KHP F;  2DR5 A;  3CD5 A;  4GKJ J;  3ZZR A;  2ZHB A;  5KG7 A;  4PXC A;  2PI5 A;  1TV6 B;  2MY7 A;  1JLA A;  5E7O B;  1UJ4 A;  1FJ7 A;  4CM0 A;  3NG8 A;  5L1I A;  4YB1 P;  3G71 S;  3GV8 B;  1KLM A;  2UZA A;  3ZZO A;  4DFP A;  3K5L A;  4FF2 A;  4FNH A;  1UEK A;  2HNZ A;  5L1L A;  4P7V A;  3FZ2 A;  4J9S A;  1XN9 A;  4ZIW A;  1SL0 A;  1UA0 A;  2K1R A;  1J5E J;  3I82 A;  5GAH I;  1TQL A;  1L3K A;  3GPA A;  2J7U A;  4XPE A;  3L3C A;  4DS5 A;  2HWT A;  1NDK A;  3IWL A;  1SVD A;  2W25 A;  4YR0 A;  3M2V A;  4OMF G;  1NB2 A;  1S5Z A;  2GNK A;  4MKV A;  3EM1 A;  2N4C A;  3D7S B;  2J7W A;  2EFP A;  4YOE A;  4A48 A;  2ZKT A;  4AYB D;  4EU0 A;  1XC9 A;  3G82 B;  2UVU A;  3JTN A;  3UPF A;  1EP4 B;  2CA9 A;  2XZD B;  1CPZ A;  2ZKU A;  3GYX B;  3ULH A;  3HHN B;  4UOH A;  5CHC B;  2AX0 A;  1TUW A;  3FCH A;  4OYA A;  1F0X A;  4K4Z A;  2CQG A;  3VQT A;  1HBO B;  2RRB A;  3D68 A;  2XO6 A;  3QRP A;  3BGL A;  1PJ7 A;  1UTA A;  1Y7P A;  2YKM B;  2ERR A;  2BMB A;  2CXE A;  4ZLN A;  3C6T B;  3QLH B;  1FX4 A;  4LBH A;  4KGK A;  1X60 A;  3HHL A;  1S72 S;  3NS7 B;  3CO0 P;  2AZ3 A;  1NME B;  3ZTS A;  3OPK A;  3C15 B;  3H4B A;  2CNK B;  2GVZ A;  5HAO A;  1QAI A;  1VMB A;  3B78 A;  4EBC A;  4YDX A;  2C3Y A;  4ED8 A;  5HO4 A;  1D0E A;  1IM6 A;  4IH7 A;  5L8R C;  5L1J A;  2GGP A;  4M5D A;  3GR1 A;  3OUY A;  3QMQ A;  2EBE A;  4IOC Q;  2M8D B;  4DL2 A;  1Q8L A;  3AB2 B;  3FSY A;  3Q8Y A;  3TJ9 A;  2YWW A;  5DRK A;  1ZTT A;  3QGH A;  1CJK A;  5ETP A;  4LF9 F;  3MMB B;  4QIV A;  4I6Y A;  1FKP B;  3TEH B;  4YB6 A;  1CJU A;  3BQ1 A;  3DLG A;  1U1M A;  1JXE A;  4L6V 3;  4FDF A;  3EGN A;  1TKD A;  1DLO A;  2HEK A;  2XMW A;  1NAQ A;  2QLB B;  2DPJ A;  2NYH A;  4OYO A;  5DZ6 A;  3VAF A;  2DEJ A;  2MMY A;  1R89 A;  3AQP A;  3CCS S;  2E1A A;  3SV3 A;  2IM1 A;  4GC6 A;  2CWX A;  3W65 A;  1U0H A;  4NZ6 A;  4TN2 A;  1UEU A;  2VU5 A;  2VV5 A;  4LRD A;  5E33 A;  2IDE A;  4RLE A;  4V1A k;  4ECV A;  2Z0G A;  1XMO F;  3RR8 A;  2WTF A;  1M1H A;  2FC8 A;  4PUO B;  1JLA B;  3VQS A;  4ZP8 A;  4ZA1 A;  3D4J A;  3R2C J;  3SSS A;  1NK7 A;  2UXB J;  2QX0 A;  2QV6 A;  3E3X A;  4ED4 A;  2Q6C A;  4O44 A;  2BZ2 A;  1KEK A;  4YHH F;  2KG0 A;  1SH2 A;  3GSD A;  5HK4 A;  2UXC J;  1WOR A;  2F4V F;  3KNG A;  4IRK A;  5A0Y A;  5CQG A;  1HLW A;  3DLE A;  3FEX B;  1VRT B;  2Z4P A;  2CPD A;  3EYZ A;  2H54 B;  2LEP A;  1MLA A;  2DHS A;  2BKO A;  3L4B C;  1U7L A;  2OKQ A;  3NY0 A;  4CYU A;  1HIY A;  3GJQ B;  1VHF A;  2KL8 A;  2W9C A;  1K0T A;  1RWK B;  1FTR A;  2FY8 A;  3PX0 A;  3GIM A;  4NLG A;  3G2X A;  1UCN A;  5HMY A;  3ET6 B;  4ZIT A;  2IC3 B;  4JI7 F;  3UQS A;  2F8E X;  3VGV A;  1XK8 A;  4DV6 J;  1GMU A;  2MZS A;  2R8J A;  3EZU A;  2GO8 A;  3HFV A;  5KFK A;  2CQD A;  5CZX A;  1SL1 A;  3RR7 A;  1C4C A;  3B54 A;  1JLF B;  1KKH A;  4M5I A;  1PAE X;  2IA6 A;  2FVP A;  3IS9 B;  2IM0 A;  1XNR J;  3HHL B;  2FHJ D;  1IKX A;  3AXK A;  5C2C A;  4BBY A;  1IBL F;  3TA2 A;  1HI0 P;  1IBK F;  2NXC A;  2X7I A;  2GVZ B;  1UVM A;  3MAH A;  1S0V A;  1SUQ B;  1BUX A;  4U7C A;  2QIF A;  3BV8 A;  3Q8R B;  2GGP B;  3EZ5 A;  1YLX A;  3OUY B;  5K8O A;  3MR3 A;  2ZDP A;  2W2Q P;  4NLV A;  1B64 A;  2YPY A;  4LSZ B;  2ZZN A;  1GEH A;  3CCE S;  3EIC A;  3NOG A;  2AGO A;  1S1V A;  4EBD A;  1CJK B;  1X0P A;  3NP5 A;  5IXU A;  1UVL A;  1J27 A;  1RT3 B;  1CJU B;  1WSR A;  2RML A;  2HVD A;  2H51 B;  2XB2 D;  2HAF A;  3HHL C;  1S1U A;  1NJY A;  2YQ1 A;  2RF2 B;  2DT9 A;  3IO1 A;  4IQM A;  3PHE A;  4DOZ A;  3TJA A;  1CVJ A;  3LQV A;  1PGZ A;  1QUP A;  3S7R A;  4O3S A;  3FMB A;  1NKE A;  5LXR A;  3BGR A;  5HAT A;  3KDO A;  3C46 A;  3DCA A;  3DU6 A;  4DR3 F;  5DM6 Q;  4KKO A;  3DN9 A;  1HWJ A;  3CMQ A;  3MCM A;  4RW9 A;  4RWX A;  2J9D A;  3TA1 A;  2QRR A;  4OYW A;  4J9Q A;  3HXM A;  1JLE A;  3BPD A;  4YDD B;  4L75 A;  5KFZ A;  3P6Y C;  1G4C A;  4CO3 A;  4I2P A;  4B9S A;  1S9F A;  2CJ9 A;  3GIJ A;  2KXH A;  1UET A;  1AXQ A;  4IO1 A;  5F41 A;  2HRU A;  4MFB A;  2E1M C;  2L9W A;  5C25 A;  4X4R A;  5DQI A;  3IWX A;  1C4A A;  4B3M J;  3C3L A;  1E6V A;  2J0X A;  3PYG A;  3UDC A;  1RT7 A;  1FVQ A;  2CVE A;  1Y3K A;  5KT3 A;  1HBM A;  3HVT A;  3VGT A;  1BY9 A;  4CO1 A;  3H42 A;  2V69 A;  1S10 A;  1B70 B;  4DX7 A;  1FWK A;  4HLB A;  2XGQ A;  2FUG 9;  4KAI A;  2W24 A;  4J37 A;  4DDF A;  3M8S A;  2V4R A;  2DHX A;  4CLU A;  1NM2 A;  3NOC A;  1TL3 A;  2M3D A;  2W9C B;  1RHM B;  4HH0 A;  2XLJ A;  4DV7 J;  1Q4R A;  1UJ5 A;  4K2J A;  4DSJ A;  2DNR A;  2IY5 B;  1U47 A;  3KLF B;  4NMX A;  5DJB A;  3P5B P;  3N6M A;  4ILR A;  3CCJ S;  2UUC J;  1DQ8 A;  5KFX A;  3N79 A;  5DG9 A;  3RG6 A;  3CCQ S;  3O1L A;  2ZBQ A;  3NGK A;  1QY7 A;  2VFR A;  2M5Y A;  2PC6 A;  2RUG A;  4ELV A;  3VAJ A;  4RNH A;  1D1U A;  1P1L A;  3HSZ A;  4I2Q A;  3ZZ0 A;  2XMA A;  2QEX S;  1N5V A;  2R3V A;  3A8I A;  3M8Q B;  4EYH B;  2MKJ A;  4PG7 A;  3QAU A;  5C7P A;  4JI3 J;  4NLY A;  2B43 A;  4WU2 A;  4FYD A;  2V67 A;  4J9L A;  2VON A;  4L74 A;  4ZCI A;  3TAP A;  3DOK A;  1JLC A;  3GYN A;  3UO0 A;  2DR8 A;  4QW8 A;  3GR0 A;  2HS3 A;  1RTD B;  2WB1 D;  1GXT A;  2IRY A;  2ZNZ A;  2LU1 A;  1RTJ B;  1G6B A;  3SXL A;  4Q0B A;  3QFH A;  1FNO A;  2BDP A;  3C66 A;  4QIW D;  2WVD A;  4UOC A;  4FPR A;  4DR4 J;  4MKY A;  2RNE A;  2WB4 A;  2VH7 A;  1WEL A;  4R25 A;  4A8Y A;  1UW9 A;  2JFK A;  3P96 A;  4NLQ A;  4UQT A;  4NLU A;  3OBI A;  1Q78 A;  2HHQ A;  1S1U B;  4USU A;  5KG4 A;  4FYY B;  1UFW A;  1WF2 A;  4IH6 A;  4KT0 C;  2J0W A;  1E6Y A;  5EDW A;  2CQ4 A;  3HLU A;  5E5N A;  2RKI A;  2B4V A;  5FJ4 A;  2CPH A;  2QSF A;  1KQF B;  4BWM A;  1WD6 A;  1XBW A;  1Q79 A;  1WWH A;  3L95 X;  4KO0 A;  1D9A A;  1M90 T;  4F67 A;  3OFE A;  4EYI B;  1A9N B;  1RXO B;  4ES3 A;  1SJQ A;  4ZHR A;  3TX0 A;  2UV8 G;  4KKO B;  4X62 F;  1F5C A;  3T9Z A;  2VQE F;  2Z30 B;  5J2N A;  1Y5L B;  2R7T A;  3AA8 A;  4OZ3 A;  2OPS A;  3PEH A;  4GMK A;  1KTQ A;  1M5P C;  3SEO A;  1NK9 A;  4CLT A;  1VQ9 S;  2R7O A;  2J0Q D;  4LRE A;  3LGM A;  4I2P B;  1EIY B;  3QT7 A;  2MQM A;  4LF4 F;  1C1B A;  2ZH3 A;  3TZY A;  3VAM A;  5C25 B;  4OFZ A;  4DL0 C;  4BC9 A;  4NCG B;  1XIQ A;  2JOQ A;  3M30 A;  4OLP A;  2XC9 A;  2A2C A;  3DLL Q;  2FVR A;  1DTT A;  3HVT B;  1S1T A;  1FTC A;  3QGP A;  2HSE B;  3SCI E;  4Q8F A;  2WVE A;  2B5J A;  3C16 A;  3CJQ A;  3M9M B;  3ILL A;  2AWZ A;  3D0I E;  2KO1 A;  2QA4 G;  3SYZ A;  2JC1 A;  5LT5 A;  3OTO F;  1T9X A;  1XMQ J;  3T1Y J;  3OSP A;  3U02 A;  2J9E A;  1TL3 B;  1RWO B;  2FLN A;  3V5R A;  3FCW A;  2C3U A;  4IG3 B;  2R42 A;  3W61 A;  3BZQ A;  3CJT A;  4DL7 A;  3G96 A;  5KFV A;  1JLB A;  1ZA1 B;  5KTQ A;  2EBG A;  4AUK A;  3MMJ A;  1WI8 A;  2P9E A;  1TKZ A;  3M8P B;  3QJP A;  4RBV A;  3U7J A;  4EI2 A;  2FD2 A;  2P6S A;  1FJE B;  3GTY X;  3JSM A;  4DQR A;  1TL1 A;  4TYA A;  2WSE C;  3QIP B;  2AEJ A;  1P9Y A;  2HWH A;  1XR5 A;  2W9B A;  5KFS A;  3DRR B;  3OJS A;  1LWC B;  2B6A A;  3QNW B;  2OD4 A;  2YNF B;  2AX1 A;  4A8W A;  3QRQ A;  1JLG B;  5IQ6 A;  5JXS A;  2VIH A;  5AT1 B;  4KHP J;  3LP1 A;  2VPX B;  3MCN A;  4DV4 F;  3O3L A;  1RBO B;  3PR4 A;  2CQI A;  2FHJ A;  1UZD A;  4LFB J;  2BEF A;  4KSE B;  4F0H A;  2QYG A;  3L7O A;  4C0B A;  4S0M A;  1SC3 B;  4Q0B B;  3MAA B;  3DLH A;  3THP A;  4NLW A;  4ZP6 A;  1YBU A;  3B6B A;  3K89 A;  2AJ4 A;  2Y0B B;  5H9F J;  5B08 A;  4DR6 J;  2B51 A;  3TYT A;  3CMA S;  5K8M A;  5DDP C;  3HSG A;  2BOA A;  2BJ3 A;  2WHO A;  4M5K A;  2YWH A;  3NBP A;  4OHZ A;  1VQL S;  5L39 A;  3K59 A;  1L3U A;  4KO0 B;  3M6W A;  4WF9 Q;  3T41 A;  1RU2 A;  1HMV A;  1WEX A;  2VDI A;  4RNF A;  1RHK B;  4O3N A;  4WIQ A;  3KLG B;  5L46 A;  3PKM A;  4M94 A;  2OPS B;  3D54 A;  2W4P A;  6AT1 B;  2FJX A;  2XG8 A;  4CIO A;  2MZ1 A;  5DQH A;  4KGM A;  4NYO A;  1NDL A;  4M5J A;  4AXJ A;  4DU7 A;  3KMQ A;  2DNH A;  2U1A A;  4CTA B;  1C1B B;  3HF5 A;  4ED0 A;  3GQC A;  2XGP A;  4F4K A;  1M5V C;  1UVJ A;  4QQB A;  4ZLL A;  5KG1 A;  4TVA B;  4WK1 A;  2QG9 B;  1S1T B;  4NRU A;  4YUD A;  5FD1 A;  1RDR A;  2VG5 A;  4IQX A;  4K4S A;  2Z56 B;  3DLK B;  1U4B A;  4CH7 A;  3QQC D;  3TZX A;  1Y5I B;  3BGO P;  3NGT A;  3C16 B;  1RBA A;  1FJG J;  3UVJ B;  1Q82 T;  1S6Q B;  2VD3 A;  2HHH J;  4C11 A;  1HNW F;  2MHN A;  2DHA A;  4J5O A;  2ZWO A;  5DLG A;  4L3N A;  4C48 A;  2RJZ A;  3JTP A;  4QR2 A;  1NLK L;  3G4S S;  2DR9 A;  1RT6 A;  3QT5 A;  1GMW D;  1HD0 A;  3ZZT A;  3I56 S;  2B4U A;  1F60 B;  3GFZ A;  3P4U B;  4MKB A;  3OVS A;  2GHV C;  3BB5 A;  1TKZ B;  5KFA A;  3D1Q A;  4EZ6 A;  1VYA A;  1NZA A;  1Q8B A;  1SJ1 A;  1RT5 A;  1NK8 A;  4ES2 A;  2WON B;  3TUP A;  1HL6 A;  1AB8 A;  1W25 A;  1N88 A;  1HBU A;  2DBB A;  4PXE A;  4WFX A;  4QR1 A;  2AT1 B;  2CJK A;  3TJ8 A;  1RKI A;  2GCF A;  2CJQ A;  2AYM A;  4HAC A;  2YNG A;  3LAL A;  3OLA A;  4C3M A;  1S12 A;  1FFG B;  4ECW A;  1LK5 A;  4Y34 A;  8ATC B;  1FKO B;  2R9L A;  1O0P A;  3LW5 C;  2FJV A;  2VPY B;  5HLF A;  3JSB A;  2DGX A;  3MEC A;  1NXI A;  4WFB Q;  1DAR A;  2KZM A;  3HT0 A;  2CQ3 A;  4YB7 A;  5J2P B;  1LWE A;  3HZG A;  5B0E A;  1FWL A;  2R8G A;  4M95 A;  4JI5 J;  3ZTP A;  1EB0 A;  1S59 A;  5GAG I;  4B3T J;  2FJD B;  1RCO B;  3GP9 A;  4FF3 A;  4ZVE A;  2XMT A;  5EN1 A;  3VVU A;  1MNE A;  4CLS A;  4ZPT R;  3W5Y A;  2JEF A;  4KGX B;  5H9E K;  4FS2 A;  1GNK A;  2IJF A;  3FNN A;  3QGG A;  4FBT A;  2A10 A;  4GO7 X;  5H1S V;  2KVI A;  1B0T A;  4TYB A;  1YJN S;  3OFH A;  2HVZ A;  3K2Y A;  3FEZ A;  2PII A;  2R7U A;  2CQ2 A;  3J81 j;  2G4B A;  4OI0 A;  1J5O A;  1OJ4 A;  2O67 A;  2ZOM A;  1YIT S;  1HMV B;  1X4G A;  4MMO A;  1N5Y A;  4NA3 A;  5EX3 A;  1PAU B;  4ICL B;  4KV8 A;  4HH1 A;  1VBY A;  2HMI B;  1NK4 A;  1BQN A;  5FII A;  3OXL A;  4WE1 A;  1ITP A;  1DTQ A;  2K8G A;  1WSV A;  4DUZ F;  3SQO P;  2MLY A;  1MMD A;  2A18 A;  4N41 A;  1ZBT A;  4ZS6 A;  2C2E A;  2YNI A;  1GQE A;  4JI1 F;  2K3K A;  3CD6 S;  3G6V A;  2CPZ A;  2DHH A;  3M9N B;  2HRY A;  3MXH P;  4ZN1 A;  2IYI A;  1MWZ A;  2QLJ B;  1GH8 A;  4DSI A;  1UVI A;  2I1R A;  3CC2 S;  3OHB A;  3D67 A;  1IBK J;  4X64 F;  4DFM A;  4EZ9 A;  2ZC3 A;  2ZJP Q;  2XMV A;  1G1X A;  4UQG A;  2RIL A;  2JVR A;  4TU8 A;  2DO4 A;  2VFV A;  2ASL A;  1F3V A;  3QSY B;  4A47 A;  1NUE A;  2QYC A;  3VAG A;  3V6D B;  3MGJ A;  5HSP A;  3BBC A;  3JTO A;  4DSK A;  1GTE A;  4WZM A;  5BR8 F;  4TQR A;  1OMS A;  1XJW B;  4Y2A A;  1NHV A;  1YJT A;  3CUN A;  1R6Y A;  3R5D A;  2VA2 A;  1EQM A;  4QW9 A;  4K7Q A;  1NRK A;  3UDL A;  2HBR B;  4DLG A;  1BQM A;  4QWC A;  1H7X A;  2DTJ A;  1FX2 A;  2G2Z A;  3I9V 9;  2NYI A;  1KD1 T;  3OL9 A;  2ZOF A;  3W2W A;  3W64 A;  1NH7 A;  1HBU B;  2AEF A;  3RBD A;  4Y65 A;  1LXJ A;  2GS8 A;  5A8W A;  3VAH A;  3EGV A;  1SKW A;  4HAC B;  2KFN A;  3A12 A;  1U6Z A;  4DR3 J;  3N5B A;  4CO2 A;  4TXS A;  3M6X A;  1Q5Y A;  3EE3 A;  2AQ4 A;  5I42 A;  5H9E J;  1HQU B;  1SV5 A;  1X31 C;  4F2R A;  1S9E B;  2KZZ A;  4J9V A;  2MLX A;  5DM7 Q;  4FF1 A;  1HAR A;  3ENW A;  1JLQ A;  1BWV A;  1LWE B;  4F3O A;  2DIU A;  1WUU A;  3EGZ A;  4HTI A;  5ITH A;  2J5A A;  5A8R B;  4G1Q A;  2YKN A;  2ZVS A;  5I3U B;  4JV5 J;  2Z58 B;  3TUI C;  2GO9 A;  3T6B A;  2P9C A;  4ZJO A;  2H5J B;  1T02 A;  1NPK A;  2NXU A;  4QYZ K;  2CAD A;  1HNI A;  2VF3 A;  2HNY B;  2F8M A;  2OEM A;  3TVY A;  2GHP A;  5K14 B;  3CDW A;  3KLH A;  3I5A A;  5J1N A;  2VB6 A;  2VUG A;  3Q8P B;  4GKJ F;  5I4M A;  4Z37 A;  2V68 A;  1CEZ A;  3TP2 A;  3H90 A;  2FC9 A;  4J90 A;  3HT3 A;  4X84 A;  1OSD A;  4JI4 J;  2VIC A;  3J7A 1;  2MQP A;  3H2L A;  3IBW A;  3R8Y A;  1CS4 A;  3KUH A;  1AFI A;  1J5E F;  3MTJ A;  1R8P A;  1BLU A;  2X1F A;  2GJF A;  3H0P A;  3MFH A;  5IM0 A;  3MI7 X;  4AD6 A;  2H5E A;  4ZN3 A;  3I5B A;  2Q6B A;  2DGS A;  2M2B A;  2ZDO A;  3OV7 A;  1OQ3 A;  3T1H J;  2NQP A;  3VR1 A;  3T5J A;  4UW2 A;  2HFV A;  3DLB A;  2VAS A;  1BQN B;  1NJX A;  4X4T A;  1QTM A;  1JMT A;  2GIR A;  4TKT A;  4I69 A;  1D8Y A;  4ID5 A;  2Z2M A;  2FJB B;  4UF4 A;  4G1I A;  4WFZ A;  3CJ3 A;  4RBT A;  3BH6 B;  4OZ5 A;  2IBO A;  2KKH A;  1WC5 A;  2QO3 A;  2IRX A;  5SZT A;  4LRC A;  3AOB A;  1RYS A;  2KN4 A;  2EKY A;  4AQY F;  2NUH A;  4OX9 J;  2APO A;  1M5K C;  4R5P B;  3TQ1 A;  2LEC A;  5JVG Q;  4KPY A;  1IQT A;  1OWX A;  3H25 A;  2HLU A;  2L9N A;  3P5T L;  2AJQ A;  1A7G E;  3GLJ A;  1V5V A;  4ZVG A;  1V3S A;  3IAM 9;  3IN5 A;  2JEG A;  3IBC B;  1FVS A;  3HJV A;  1UZH A;  1Y5N B;  3NGR A;  3DNC A;  2MSS A;  1F2H A;  3A8K A;  3HX9 A;  2NZC A;  3PIP Q;  4PRF A;  1XEZ A;  3QO9 A;  2PGC A;  4H4M B;  1M5O C;  2MKH A;  1P1T A;  1RT1 B;  1ZPW X;  4M5H A;  1HBN A;  3MM6 A;  1FEH A;  4LSL A;  5KFN A;  3THV A;  1JB0 C;  3UD4 P;  4O0N A;  1Q95 G;  3K58 A;  1WF0 A;  4ZJL A;  1NK5 A;  2QA1 A;  3CCL S;  2VPW B;  1VQ7 S;  2C1E B;  1S1X A;  4V19 X;  4I56 A;  1CJT B;  3MEK A;  5J1E A;  2DK2 A;  4OX7 A;  3SDE B;  3K57 A;  3MOJ B;  2DGU A;  3DI6 B;  3R2D J;  2A3J A;  2FZK B;  2XO7 A;  3PNI A;  3M2R B;  2VFT A;  3MOZ A;  2V4Q A;  2RS2 A;  4B9M A;  3C14 A;  2ZH6 A;  2AD9 A;  1SQG A;  4ZPV R;  2RS8 A;  3MD1 A;  1WG5 A;  3QT8 A;  3GFH A;  2W01 A;  2L41 A;  3PJX A;  1R0C B;  2MZJ A;  4TU9 A;  4UZC A;  1N32 J;  3IG1 A;  3AXM A;  2JDJ A;  2V2Z A;  3Q2T C;  4HT7 A;  1GMW A;  3M8Z A;  2PMZ D;  4QU6 A;  2P5V A;  2X1B A;  1HR0 J;  1UPM B;  2WVB A;  2VQE J;  4PYD A;  4LQ3 A;  4WCE Q;  3LOU A;  1YJW S;  2UXD J;  2RUS A;  2HGL A;  2EK1 A;  1SKS A;  3SSR A;  3I0S B;  2OH2 A;  3IP0 A;  1WHV A;  2YWF A;  1CSJ A;  5ETS A;  4X4U A;  4HL9 A;  5LSR A;  3MR2 A;  3MUT P;  4ED6 A;  3L7U A;  2B9W A;  3PM9 A;  3FGV A;  3MM8 B;  1KQK A;  4N8N A;  2W1B A;  1LV5 A;  4LF4 J;  1ZS6 A;  1TAU A;  1C1C A;  5JVH Q;  2MJU A;  2B7C B;  3HVR A;  4OYB A;  1WAC A;  1WTB A;  2VZ9 A;  1FRJ A;  2DXE A;  5GAD I;  3MPD A;  2MKI A;  4B08 A;  3ILJ A;  3AB4 B;  3GYG A;  2MTL A;  1TKT B;  2CPJ A;  5ADZ A;  1YKW A;  3HM9 A;  4YS2 A;  3FFI A;  3H2U B;  2HLT A;  2CPY A;  2ZH1 A;  2JNJ A;  5F8J A;  2Z57 B;  4HDG A;  3ILO A;  3LPY A;  2YY3 A;  3ETM A;  1HKA A;  2GML A;  3RGI A;  1FK9 A;  3NAI A;  1XQI A;  5A6P A;  2UXC F;  3A8J A;  1ARO P;  2LU2 A;  2W7O A;  3M7V A;  5J2Q A;  1NO8 A;  1BXN A;  1TKX A;  2AYE A;  2FLO A;  1SKR A;  3FBC A;  2CJA A;  3AAW B;  1R8H A;  3KK3 B;  4UTG A;  2WSF C;  1VQS A;  3DGP A;  1FER A;  1SH0 A;  1RAO A;  4ID5 B;  2B8P A;  2PN6 A;  2RT3 A;  3IC1 A;  2OHD A;  3V4I B;  5DGA A;  3DM2 A;  4DLE A;  1IKV A;  4F02 A;  2W2P P;  2CDQ A;  1X5S A;  7FDR A;  4OYI A;  2D7S A;  2BAN A;  3TR5 A;  1DZ5 A;  3R5G A;  3POT B;  4B3S J;  4DF8 A;  5T41 A;  3D2W A;  3Q8S B;  4DV6 F;  5D0H A;  3CCR S;  2IRU A;  5M2P A;  2HVI A;  4C6A A;  4YY3 J;  2X51 A;  1I5O B;  4XAK A;  3W60 A;  1H6K X;  3X3U A;  3BBB A;  4P10 A;  4N8O A;  4RW6 A;  2H48 B;  4CO4 A;  1ZAW A;  5E41 A;  5F8H A;  1TU0 B;  5IT0 A;  1Q16 B;  4Z7C A;  4DPT A;  3KK2 A;  1S49 A;  3J7Y I;  3UFC X;  2YNH B;  2C2Z B;  4C3K A;  4I4B A;  4EK2 A;  3BQ2 A;  2AJ1 A;  1XNR F;  2G2Y A;  4DV4 J;  1AUS L;  3K5P A;  1U49 A;  4IUF A;  1OQ6 A;  1EKS A;  4MT1 A;  4OJ3 A;  4NLO A;  3QAE A;  4F8R A;  4MK9 A;  4WP9 A;  4O4G A;  1S6O A;  1RE1 B;  1WKJ A;  1ROF A;  2V2K A;  2MKY A;  4ELU A;  4XTT A;  5CAA A;  2PMW A;  2B7B B;  2HAI A;  3R97 A;  5F9L A;  2FLL A;  3HPO A;  2C2K B;  2XYG B;  3NMR A;  2KXN B;  2B9E A;  1N6Q A;  4C97 A;  3PKY A;  1Q5V A;  4EO8 A;  1SBR A;  3OR1 A;  4USI A;  3R5A A;  1IKY B;  4PWD B;  1K73 T;  2RSQ A;  2G0J A;  5DZ7 A;  3EVW A;  4JV2 A;  2KM8 B;  1PYT A;  4PAA A;  3HVA A;  2Y1I A;  1FES A;  4USJ C;  4LR8 A;  2IJR A;  1RHJ B;  2KXF A;  2LDI A;  2UUW A;  2Y1R I;  5D4O A;  2VG7 B;  2QMU B;  2HVH A;  4F0K A;  1SKU B;  1TL7 A;  2IIH A;  1RHR B;  2HYI B;  1T9V A;  3I0R A;  4OHW A;  3R6L B;  3R3T A;  1GAO A;  4F04 B;  1NJI T;  5FLX U;  5G4D A;  1CUL B;  4K5S A;  1IR1 A;  2OI2 A;  1HYS B;  2GAG C;  4A8O A;  3KJV A;  2J6U A;  3MAQ A;  4ILM A;  2J8A A;  1MMN A;  1AYE A;  1WHY A;  4PQA A;  2XWX A;  1T9T A;  2XZW A;  4FYW B;  4ALZ A;  2V0N A;  3WX8 A;  2G9O A;  3W9J A;  1BC6 A;  2KM8 C;  1NPP A;  2YQ3 A;  3FFI B;  4ZCK A;  5CYQ B;  5L9X A;  2KJV A;  4NI2 A;  1DQ9 A;  3L7P A;  4Q5V A;  2HHS A;  1TVR A;  2FY1 A;  2MQ8 A;  1U1Q A;  3GMG A;  1CJV A;  2OD6 A;  4B3M F;  1JJH A;  1U1R A;  2WBR A;  4PG8 A;  1FRL A;  4ZCM A;  2BJ9 A;  2UUT A;  3M8Y A;  3RRG A;  1DQA A;  1ZM9 A;  1N4L A;  2EI5 A;  3FMW A;  1KQG B;  1F5A A;  3GIR A;  3D3C J;  3SIP B;  5E3R A;  1OS5 A;  1RWV B;  2PEB A;  4B17 A;  2IYG A;  1LFW A;  3ISN C;  5KFY A;  2XNQ A;  2RQK A;  3EDR B;  3MCS A;  2QLF B;  4DR2 J;  5FLX Y;  1RTH B;  2HRT A;  2JEJ A;  2JWN A;  4DV7 F;  3EMT A;  3W2V A;  3RU0 A;  3DRP B;  1S57 A;  1ZH5 A;  2ROP A;  2HIQ A;  3ZZP A;  5DGB A;  2EFO A;  1LW2 A;  2UUC F;  1EJ7 L;  3W1Y C;  5IT4 A;  1M5S A;  4BDP A;  1U24 A;  4PG6 A;  2DO0 A;  3IAS 9;  1TR0 A;  1DFD A;  3U1L A;  3RRK A;  3VF0 B;  4F4X A;  1SCJ B;  2IAJ A;  1FA0 A;  3PW0 A;  4DFK A;  1T7P A;  3PXG a;  3KK2 B;  2EFN A;  3TA0 A;  2W4D A;  4WJB A;  1T9W A;  4N77 A;  4ETX A;  3CWJ A;  3IRX B;  2CQC A;  2H1Y A;  3MM7 A;  4ZVO B;  5F9N A;  4PZV A;  4MK7 A;  3BH7 B;  1KR4 A;  2M9K A;  3JAM U;  1XWL A;  5D4N A;  1MWQ A;  4LRB A;  3AD8 C;  3PYD A;  1SQF A;  4EO6 A;  3DRS B;  3N4W A;  3N9U C;  4HKQ A;  3RZA A;  4YR3 A;  2RAQ A;  2YX7 A;  3MEE B;  1N6Q B;  2AJ2 A;  2BQR A;  2ROE A;  2DGO A;  2QL9 B;  4U95 A;  4IDK B;  1RSC A;  1YSJ A;  4QZV B;  2A1B A;  3V81 A;  2FVC A;  4B3O A;  3CE8 A;  3VAI A;  4KFB A;  5HQM A;  3HMJ G;  4FZV A;  5F0W A;  4AL7 A;  1S76 D;  1U0S A;  3JYT A;  2OGU A;  3BN4 A;  3TEG A;  5CAB A;  2ZH7 A;  1QM9 A;  4OI3 A;  4RW4 B;  2LFV A;  4LQ9 A;  1SI9 A;  4U8Y A;  2HZC A;  3W3S A;  4X4N A;  4RUA A;  5KFJ A;  3TNV A;  3H59 A;  4DN9 A;  1S1W A;  3OTC A;  3BKT A;  4O23 A;  4GVB B;  3DMJ B;  1JKH B;  2QL7 B;  4TY8 B;  1TAQ A;  2OPQ B;  1PYS B;  1URR A;  1VRU A;  5CA5 A;  4KH0 B;  4CP5 A;  2GC8 A;  3LO3 A;  1T9U A;  3KUE A;  2LEA A;  2V9K A;  4LF7 J;  3I4P A;  3VV2 B;  3M2U A;  1HD1 A;  3PX4 A;  3WHI A;  1YJ9 S;  4C8K A;  1R8C A;  2L3M A;  2ZJR Q;  1RAF B;  3JAM Y;  4F26 A;  2NXN A;  3DOM A;  3HFZ B;  1W2B R;  1FJC A;  4CRJ A;  3HSD A;  3WC2 A;  1A0O B;  2RE1 A;  2VJU A;  3E8O A;  4PXD A;  5GMK a;  2XS7 A;  3B82 A;  1TUV A;  1V6H A;  1NHK L;  2DNG A;  4LF2 A;  2VKZ G;  1MSW D;  3QJL A;  2DJW A;  2PI4 A;  3VZH A;  2IFX A;  1VQK S;  4BWJ A;  1IBC B;  2FHM A;  2IPO B;  4FYV B;  2E1C A;  5CYM A;  5IV3 A;  4CH0 S;  3DOL B;  2VOO A;  4E8U A;  3ZC4 A;  4IFY B;  1LKZ A;  3RW7 A;  3NGU A;  3G87 A;  4CWB A;  3CCU S;  2C28 A;  2DD8 S;  3DYA B;  3M1V B;  4JV0 A;  2MQQ A;  3P49 B;  2GQQ A;  1VK3 A;  2M0G B;  4LSN A;  2L48 A;  3CED A;  1WC0 A;  5K5M A;  4C0O C;  1XMQ F;  3T1Y F;  2R7S A;  2RU3 A;  2ZWP A;  3V6J A;  5KT4 A;  3W2V B;  1X4E A;  3CB4 A;  2HWI A;  4CZC A;  2V6A A;  4F3Q A;  4ZVQ B;  5DDR C;  2XM3 A;  2I8E A;  2UVR A;  4QIG A;  1RBL A;  4YQW A;  3MR6 A;  2HGN A;  2BRL A;  1HNX F;  5KFR A;  2XI3 A;  3W5X A;  4LF8 F;  2U2F A;  1GX5 A;  4NA1 A;  3D66 A;  4TNO A;  5HBM A;  5KAK A;  2LA4 A;  5DG7 A;  4DSE A;  4W98 A;  1K44 A;  2QN6 B;  2H9Z A;  1SJF A;  2KH9 A;  3RB4 A;  2RH3 A;  5HVG A;  5E2Q A;  2PT0 A;  2ZH2 A;  3F56 A;  3MM7 B;  3T3F A;  4DX8 H;  1RWM B;  3KHH A;  4HR2 A;  5AXK A;  3MPY A;  3ZZZ A;  3UCU P;  2MB0 B;  3CD0 A;  4CO0 A;  1IUJ A;  2W7A A;  3KG4 A;  4A8X A;  5F8N A;  2MLZ A;  2MY8 A;  4ZPD A;  3OVB A;  2HND A;  3KHR A;  1EET B;  2BE2 A;  2EFV A;  3BKU A;  1M0S A;  2IM3 A;  2MKS A;  1HHS A;  4LFB F;  2JEI A;  1X4H A;  5HRO A;  3OR2 B;  1WKL A;  1F6T A;  2EG2 A;  1OY8 A;  4K2X A;  4ECY A;  4HHU A;  1Q86 T;  4LUB A;  4Y0F A;  4NZ7 A;  1NJZ A;  3K0J A;  3PYF A;  1YRU A;  4DR6 F;  3LGN A;  3TVZ A;  1VQ5 S;  3QPI A;  3W5Z A;  3T5K A;  1IKW A;  3CC7 S;  1VQY A;  1S0M A;  1S1W B;  3H5U A;  4R8U B;  2R8H A;  5D6G A;  3Q8Q B;  1X4F A;  2DGQ A;  1HHQ A;  2KYZ A;  1GK8 A;  3HFK A;  2Y1L B;  3HJF A;  3LUY A;  1T05 A;  3VGS A;  1VOM A;  3TAM A;  2F8H A;  3BSA A;  2N4D A;  4CQ1 A;  3GON A;  4AQY J;  2PA8 D;  2LQ9 A;  4WFN Q;  4X2B A;  3G6Y A;  5B0G A;  2CYY A;  4AXI A;  3JB9 k;  1KHW A;  2NSC A;  1HNV A;  3DXB A;  2DXF A;  6FD1 A;  3R7B B;  2DB1 A;  5CYJ A;  1SQE A;  2V4J A;  3U27 A;  2MHE A;  2OSQ A;  2XHC A;  3PTW A;  2O5D A;  2E7W A;  1RGV A;  3BSN A;  3PCO B;  3SZ2 A;  3CIZ A;  3CCW A;  1RTI A;  4ZLP A;  4TU7 A;  3KLE A;  5T7L A;  3TX8 A;  1N48 A;  4DFJ A;  2XMJ A;  4OZJ A;  3C6U B;  2RHQ B;  4QOT A;  2VA3 A;  2YTC A;  3K8W A;  2GX8 A;  2I5J A;  4Y6I A;  1VC5 A;  1RWP B;  1C0T A;  3VAL A;  2XSJ B;  3J7Z T;  3LWM A;  3DLJ A;  2W2M P;  1G7C B;  1AZS A;  2Q79 A;  1FJG F;  4IFV B;  1YTY A;  2HHH F;  2DR7 A;  1UVK A;  1T03 A;  2DRB A;  4MYT A;  4F4W A;  4WPA A;  1IWG A;  2E9T A;  2HK2 A;  1SJ4 P;  3R5C A;  5C24 B;  4RW8 A;  3G8Q A;  1VR6 A;  4OV1 A;  4XPC A;  1YJU A;  3VGU A;  2DYA A;  2FDN A;  2KFY A;  3N5F A;  3RJM B;  4DQS A;  1X9M A;  2QGF B;  2XS5 A;  1Z2Z A;  2C3P A;  4BHQ A;  5HJY A;  3D28 A;  4RUB A;  2UUB J;  1QAX A;  2CZV C;  4HDH A;  2D9P A;  5EUH A;  1EX8 A;  4ZMM A;  1XNQ J;  1U26 A;  1RYR A;  3UD3 P;  5B09 A;  1TUG B;  2UVV A;  3RAQ A;  5HBM B;  3GJT B;  1RWX B;  4QPX A;  1PSD A;  1YG0 A;  4ZVS B;  1MU2 A;  3MEG B;  2XSF A;  5IWA J;  4CLZ A;  3HD1 A;  1KBR A;  4DQI A;  5K9F A;  1S6U A;  3P45 B;  1QTN B;  2NS1 B;  1RA6 A;  2D3U A;  4KQZ A;  1JNZ B;  1OPI A;  3CJ0 A;  3WDO A;  1Q7L B;  4H4O A;  4CO5 A;  1Q7Y T;  3QRR A;  3MDF A;  4ZVF A;  2HND B;  3TRG A;  3ZTQ A;  2MZT A;  3QGI A;  3TOQ A;  2LQ5 A;  4F4Y A;  2JX2 A;  1KVI A;  2L9D A;  4JI5 F;  1QJH A;  3GG1 A;  1HI8 A;  2ZH8 A;  5ETM A;  4LF5 J;  2G0I A;  2E7X A;  2HG4 A;  1KLM B;  4B3T F;  1IN0 A;  3GIK A;  2DNZ A;  3KFW X;  2HNZ B;  4KYZ A;  1KFD A;  3AT1 B;  1VIX A;  2K1R B;  3NNA A;  5EWF A;  3E01 A;  3G8T A;  4IG0 A;  4DI6 A;  5D0R A;  4JI8 J;  1PO6 A;  4DPX A;  1HNZ J;  3NMA A;  1WNE A;  1KVK A;  3GFY A;  3TW0 A;  1CBK A;  3PO4 A;  5C5J A;  4P2F A;  1D09 B;  3M2V B;  4PQU A;  3RB3 A;  2HPU A;  1T05 B;  2DY1 A;  5L1K A;  4NXN J;  4DU8 A;  2CDR B;  4LVN P;  4ELT A;  1R43 A;  4C8L A;  3UN5 A;  4B9T A;  3UDE A;  1WJ9 A;  2UUA F;  2MQO A;  1B4S A;  4K4Y A;  1C0U A;  1L3V A;  4FKY A;  4NYP A;  3UI3 A;  5KG6 A;  2BV3 A;  2C2M B;  4WYW A;  3F73 A;  4OYP A;  5KFL A;  4B02 A;  4U7U D;  4K8R A;  1YX2 A;  2DKO B;  2E1R A;  4DSF A;  4M8L A;  1RTI B;  4NLP A;  4KPC A;  2A6M A;  3CPW R;  2H65 B;  4NLS A;  2F63 A;  5GVQ A;  3I31 A;  2BJE A;  2HUR A;  2MZR A;  3ZTR A;  2ZE2 A;  4IRC A;  5HP1 A;  2N82 B;  4DR5 J;  4JB8 B;  4LRA A;  2PA3 A;  2LCW A;  3GU0 A;  2I5J B;  1H73 A;  4F3M A;  1U48 A;  4QPT A;  4OX6 A;  3JSY A;  2DH7 A;  4ECT A;  5IC4 B;  2OPR A;  1Q8K A;  3GWC A;  1KNZ A;  1V9O A;  4M5D B;  3E51 A;  2KT2 A;  4DEZ A;  4ZIV A;  1G2E A;  3BN7 A;  3WX4 A;  3B4M A;  2XS2 A;  4OZN A;  3OTD A;  5CXT A;  4KTQ A;  1ZAX A;  4NWB A;  4MTP A;  3UR3 C;  1R8A A;  4WKR A;  3I4H X;  4A8F A;  3J80 U;  3DLG B;  3NNC A;  4JBC A;  3BRE A;  1HFE L;  4ECR A;  1I94 J;  1KLN A;  4QWD A;  3UE2 A;  1DLO B;  1WEY A;  2E44 A;  4P6Q A;  2DEI A;  4H4K A;  4L76 A;  3SFG A;  2G1D A;  4J9P A;  4J9O A;  3MED A;  2V63 A;  2SXL A;  5AE3 A;  1OIA A;  5D0E A;  2XTJ P;  3HP6 A;  2BXJ A;  3UN2 A;  4LFA J;  1U0H B;  1IQZ A;  1IBM J;  1GFW B;  4K4T A;  2UVW A;  3MMC A;  3CJ2 A;  1S6P A;  2Y3Y A;  2G13 A;  3QSI A;  4FBU A;  4ED2 A;  2X1G A;  4F50 A;  1PBU A;  4X4P A;  3TAR A;  2H5I B;  1HI1 A;  3M6V A;  3QBC A;  3OTE A;  3MM5 A;  3EDQ B;  1SPB P;  4WP8 A;  3KLI A;  2OAU A;  4MYU A;  2I2Y A;  3UDV A;  5AXN A;  2C2N A;  4ED1 A;  3KK1 A;  1FDB A;  4JV5 F;  4Y00 A;  2DNL A;  1N52 B;  3EPG A;  3NGD A;  1QVF R;  2DRD A;  2CZ9 A;  1REV A;  2E5J A;  2KFZ A;  3EUN A;  4P7T A;  3BR8 A;  4O44 B;  1WG4 A;  2NPF A;  3D1O A;  4M63 A;  4WII A;  2D1C A;  4CLF A;  3J80 Y;  4IG0 B;  5A0Y B;  3DLE B;  1LEO A;  2B9X A;  4ZLJ A;  1VIS A;  3NCR A;  1H7W A;  1OYE A;  4AE5 A;  4JI4 F;  3T19 A;  1HW9 A;  4OI1 A;  1O8B A;  1NPR A;  3MF5 A;  3FCV A;  1K47 A;  4U96 A;  2C2D A;  3PEJ A;  4CYU B;  2CNO B;  3IR6 B;  2QFI A;  1H2U X;  4FVM A;  2YVS A;  1RWW B;  2Q3P A;  1EHW A;  4EBE A;  1NDC A;  2IA0 A;  1RHU B;  3DKD A;  3T1H F;  3ELH A;  3NWR A;  4WTO B;  3RRH A;  2GMJ A;  1LW0 A;  2PEH A;  5KT6 A;  5GAE U;  2HQF A;  2J8S A;  4I67 A;  1NHU A;  2I38 A;  2AIR B;  3U1N A;  4CM2 A;  1U8S A;  2BE9 B;  1FXD A;  2HFS A;  4ECQ A;  1Q81 T;  2OPP A;  1QVG R;  4DV5 F;  4OX9 F;  2XYP B;  1HQE A;  3GCW P;  4K5R A;  2OEK A;  3TVK A;  3FBF A;  4OI2 A;  2QA2 A;  8RUC A;  4OYZ A;  4Z2X A;  1IKX B;  3MUM P;  2RIJ A;  4EUV A;  1RK8 A;  2MJN A;  4DPU A;  5KFM A;  5ETT A;  3VTI A;  3SBM A;  1U1N A;  3PYE A;  2CZ4 A;  1RAJ A;  5K8P A;  1GXU A;  3Q0A A;  2BX6 A;  3Q86 A;  4Y28 C;  2XZT B;  4P9S A;  1QAY A;  4MIB A;  4X65 J;  3C2P A;  1RLC L;  3LP2 A;  2LYV A;  4RL1 A;  3DDK A;  4M5N A;  3KDN A;  3WBZ A;  3BYP A;  4DUT A;  2MGZ A;  3OL8 A;  2HQC A;  2HBQ B;  2FLP A;  2Y8W A;  3GSI A;  1S1V B;  3BGU A;  1TV6 A;  1XER A;  2W8K A;  2XI2 A;  3FZB A;  4NCB A;  3IWN C;  3BBF A;  1PIL A;  2EW9 A;  3S8S A;  1WDD A;  3IFE A;  4NML A;  1I1G A;  2WBM A;  1Z2L A;  2IVM A;  4Q8E A;  1FE4 A;  1N32 F;  2LXI A;  2F7V A;  3MUV P;  1LQ9 A;  4OHY A;  4DV3 J;  2QTW A;  4DV1 J;  3GV7 B;  3BGR B;  4FXD A;  4NEY A;  3CF5 Q;  2VBY A;  4DZD A;  5KG3 A;  5EWE A;  4IR9 A;  2JLE A;  1HR0 F;  2ZH9 A;  2VPZ B;  3MD3 A;  3M6U A;  4RW9 B;  4J9R A;  2UXD F;  5FDL A;  1FI4 A;  4ZVU B;  1IWA A;  2WVF A;  4HI1 A;  1ELO A;  3G6E S;  2NPI A;  4NL5 A;  1JLE B;  1R31 A;  4DG1 A;  3G82 A;  3UW1 A;  5EX0 A;  2HHU A;  4IKA A;  1EP4 A;  4M1K A;  3KLI B;  2W4C A;  3OL7 A;  1R27 B;  1AT1 B;  5D4P A;  1UMJ A;  3ITH A;  1WC4 A;  4MFB B;  3V4M A;  3FK4 A;  5C2G A;  2R8I A;  4ECX A;  2QE5 A;  3TZW A;  4H4K C;  1X4C A;  4N56 A;  1E6V B;  3KTQ A;  5D15 A;  1RT7 B;  1RP5 A;  3CIM A;  2YKM A;  5IZH A;  1I51 B;  4LMZ A;  1HBM B;  4UT4 A;  3C6T A;  4K4U A;  4ED3 A;  4LRF A;  4JI2 J;  2YKO A;  4QBU A;  3BO2 A;  4CNZ A;  1LFP A;  3C15 A;  4UY8 T;  1AFJ A;  1BMQ B;  1JJ2 R;  1YRT A;  1P27 B;  2GQC A;  1N0V C;  3T9N A;  2V2Q A;  4NLR A;  4RNO A;  1S0O A;  1TFY A;  2ILY A;  1KTV A;  3ZNJ 1;  3AJ2 A;  4OZL A;  2VBZ A;  2VFS A;  4YME A;  4V19 J;  3GCX P;  4TQS A;  1S0N A;  3EVO A;  1IJE B;  4CT8 A;  3RBE A;  2N7C A;  2CRL A;  3M4X A;  2O66 A;  5HMW A;  5KFP A;  4OZ1 A;  2JRS A;  2E1P A;  3MMB A;  3IR7 B;  1FKP A;  5KFD A;  1HNX J;  2AW0 A;  2OPP B;  4LF8 J;  3UCG A;  3R5B A;  2OUG A;  1ULR A;  4B3S F;  3K5N A;  2RDJ A;  3CJR A;  4LFC J;  4I2Q B;  2OML A;  1YJR A;  2FZG B;  4YY3 F;  1SJ3 P;  1I3O B;  2D3O 1;  2W7P A;  3BDP A;  1R0B G;  5KOW A;  4QIF A;  1U2F A;  5MAO A;  1YHQ S;  1HQ2 A;  4Y2I A;  3PV8 A;  1B99 A;  5LXY A;  3WIV A;  2BJ7 A;  1OY9 A;  4OX8 A;  1RLD A;  3DOK B;  3FVY A;  3QT6 A;  1JLC B;  4FP9 A;  2HQG A;  4YFU A;  3QID A;  1VQO S;  2KVQ E;  3S01 A;  2VG6 A;  3S6E A;  2E29 A;  3ENV A;  4K4W A;  2EXU A;  3QAT A;  4ZOS A;  4Q44 A;  2FHK A;  3PFO A;  3FQL A;  4YN3 B;  4PUO A;  2CG4 A;  2JLF A;  1U45 A;  4DS4 A;  4C7Q A;  2FJW A;  2BUN A;  2XLI A;  2GFF A;  2D74 B;  5KFH A;  5LMU J;  3AOA A;  5GAH U;  1NH8 A;  1U1L A;  2HHP A;  2J6S A;  1E6Y B;  1W26 A;  4KC5 A;  2RKI B;  3D6T B;  1VBX A;  1YWX A;  1Y9O A;  2EK6 A;  2ZIT A;  1VRT A;  4DN0 A;  4ZPB A;  5DG8 A;  2BRK A;  3SV4 A;  1U1P A;  1JJC B;  2CAJ A;  1YI2 S;  3FBE A;  5BYR A;  3CJ8 A;  4ZHR B;  3TZZ A;  2GAH C;  3F41 A;  4B3R J;  2BE7 D;  1R6V A;  1WDT A;  4USH A;  4A8M P;  3TAN A;  1X5T A;  1FHT A;  4BLG A;  5FDL B;  5J2N B;  4L72 B;  1M1K T;  1OY6 A;  1ZAV A;  4DCO B;  2EPI A;  4DG1 B;  4E98 A;  1D8Z A;  4NXM F;  2POK A;  2KT5 A;  3OQ2 A;  5A2Q U;  3ZNU A;  3ET6 A;  5HL7 Q;  5DDO C;  2IC3 A;  2GIF A;  4ANE A;  4JOU A;  2E66 A;  5DS7 A;  2AHO B;  2V2V A;  3FSI A;  1WI6 A;  2CIM A;  3PW5 A;  1T11 A;  3ITH B;  4O4R A;  4ED5 A;  1RAG B;  2FQQ B;  4OYM A;  1Y0H A;  2B0G A;  4RNM A;  3J81 U;  2ATC B;  3M30 B;  2ZZM A;  3BQ0 A;  1JLF A;  1DTT B;  2DR6 A;  2MQL A;  1UWA A;  2C3O A;  2AV5 A;  3IS9 A;  1UW4 A;  4LBI A;  4AL6 A;  2GQ2 A;  4RR5 A;  2V50 A;  2YBV A;  2B5J B;  3H5X A;  3SCJ E;  3AD9 C;  2YH1 A;  4WP3 A;  1SUQ A;  3IXQ A;  5D78 A;  4NE9 C;  4QYR A;  4OQJ A;  1LWX A;  1B7Y B;  3PZP A;  1IXK A;  4OYX A;  4ZCL A;  1PC4 A;  4MK8 A;  3BR9 A;  1NCL A;  5J2M A;  2N3O A;  2XNR A;  4IO9 Q;  2V9W A;  1CLF A;  5HI7 A;  1JLB B;  1FD8 A;  2R7R A;  4IOA Q;  3CDU A;  2R2U A;  4FXW A;  4EEY A;  4DMZ A;  1X9W A;  3GFX A;  4C98 A;  2E5G A;  1RT3 A;  3JSM B;  4I68 A;  5A2Q Y;  2Y9H A;  4DR2 F;  1FKA F;  2P2C B;  2A2D A;  5U47 A;  3BO4 A;  1RWN B;  3R1L A;  4N76 A;  1X7V A;  1TL1 B;  1FXL A;  3M05 A;  2YKA A;  4YEA A;  4DR7 J;  1YBT A;  3PIO Q;  3NEK A;  4ZPA A;  5D3G A;  1VIO A;  4P2M A;  9RUB A;  2RF2 A;  1FD2 A;  2V94 A;  3A3O B;  5M2R A;  2W9B B;  1V3R A;  1EQ0 A;  2QL5 B;  2BAB A;  4FVC A;  2OTJ S;  3J81 Y;  2DNY A;  3KG1 A;  1LNQ A;  2QMW A;  3TI0 A;  2B6A B;  2KTQ A;  3D0G E;  3AFG A;  1SIW B;  1VBZ A;  4OJH A;  2UU9 J;  1B0P A;  3LP1 B;  2F40 A;  2ASD A;  2VG6 B;  3LF0 A;  3NS6 A;  4F7V A;  3PJW A;  3MPV A;  1RAI B;  5D77 A;  2MYF A;  4RUH A;  4G65 A;  5KFQ A;  1NK0 A;  4RPF A;  2E7V A;  1T3N A;  1RQ0 A;  2DNQ A;  5HMZ A;  1H2V Z;  3H40 A;  2HQI A;  2MKC A;  4ZVR B;  3Q2S C;  4USM A;  4N5S A;  6FDR A;  1ZPV A;  4N7T A;  2IBK A;  1SC1 B;  3D1H A;  1K1S A;  2BM1 A;  4JI6 J;  2ZBR A;  3NBP B;  5LSL A;  1FDA A;  3BYR A;  2R2T A;  1D3W A;  1XTZ A;  3R7S B;  3D6F B;  4Q45 A;  4YB5 A;  5DQG A;  3W9I A;  1N54 B;  1IR2 A;  3NNH A;  4NEZ A;  1P8G A;  2LVW A;  2CJY B;  5DDQ C;  2KJW A;  2UUA J;  3GE9 A;  2YPZ A;  2FB0 A;  4C8N A;  1VJW A;  5KFC A;  2NXE A;  4GKK J;  1BWE A;  1YQH A;  2A0F B;  5MLC V;  2K06 A;  4ID8 A;  5AXM A;  1H98 A;  3KLF A;  4GC7 A;  5DET A;  2LDY A;  4LF7 F;  1KVJ A;  1VBK A;  2HBZ B;  2WVC A;  5F8I A;  2V8G A;  2NZ4 A;  3OTB A;  1RT2 A;  3P3D A;  2CQP A;  4FYX B;  4F4Z A;  3SMZ A;  4DV0 J;  2LA6 A;  2VG5 B;  3OLB A;  1UAW A;  2DGT A;  3GG0 A;  1JXL A;  5LSO A;  1TMM A;  2CVI A;  3ZO7 A;  1VHI A;  2VQF J;  3N0V A;  2DH9 A;  1CC8 A;  3M8Q A;  2UP1 A;  1PJ5 A;  2R8K A;  3TQE A;  4ILL A;  4C11 B;  4OJG A;  3TAQ A;  2V5H G;  3O44 A;  1VFJ A;  2E9Z A;  2MEW A;  3AJ1 A;  2BOP A;  3OSN A;  4AFF A;  5J2M B;  2DIT A;  1ZM4 A;  1RB0 A;  2DRA A;  1RT6 B;  1RTD A;  2XCP A;  2XMM A;  4KH1 B;  1RTJ A;  3CCM S;  3G9C A;  4PXB A;  3KJQ B;  1NKC A;  2AJF E;  1F9E B;  2DIV A;  1RT5 B;  3KKF A;  5LL6 d;  1N0U A;  4DCP B;  4C3L A;  2WAQ D;  2K7J A;  5D3G B;  4WU3 A;  3MR7 A;  3H7H B;  2YNG B;  2IHR 1;  3GV5 B;  4WXW A;  3FKB A;  1VGY A;  2OEJ A;  5LOQ A;  2DY9 A;  3ONQ A;  3EPI A;  4I6W A;  4ZP9 A;  4ED7 A;  5HLF B;  1X5O A;  4OLO A;  3MEC B;  2HHV A;  4P2X A;  2LXU A;  4OHV A;  4ERD A;  4DXL A;  2UV8 A;  4URQ U;  2XWY A;  4ETZ A;  3RB6 A;  3AD7 C;  4BC7 A;  1AUD A;  3CO9 A;  3I9Z A;  4B9N A;  5A8K A;  4AND A;  3O2I A;  2WZ1 A;  2PSZ A;  1R0A A;  4X4V A;  1NDP A;  1PKU A;  3A4T A;  3H2V E;  3H5Y A;  3FSX A;  3RUB L;  2AYG A;  2LP4 A;  1TL4 A;  4HVZ A;  5KFO A;  4NCA A;  4ZPW R;  5GME A;  2YKP A;  5B0C A;  2K7K A;  4RU9 A;  4NCG A;  2F9D A;  4WFY A;  2FVQ A;  4DQP A;  1NBE B;  3KHL A;  1PIE A;  2O01 C;  2BVZ A;  3QJJ A;  1GX6 A;  1J5O B;  2RQ4 A;  1JX4 A;  1N5Y B;  3BDE A;  5K8N A;  2QMX A;  2HIY A;  4KV8 B;  2ZNY A;  1WC1 A;  4ECU A;  2J0S D;  1IVZ A;  1SJR A;  2NUU G;  4P75 A;  4WE1 B;  4ER8 A;  4ZDN A;  1DTQ B;  4C9D A;  2AEM A;  1NZ8 A;  4IG3 A;  1N34 J;  5KG0 A;  4LR9 A;  2M8H A;  4DCJ B;  4X4O A;  1HW8 A;  2IVY A;  3US5 A;  1HA1 A;  2YNI B;  1IM4 A;  1UFK A;  4DV5 J;  1FRK A;  1W2I A;  2Z2Z A;  4DL5 A;  4ZVT B;  4DX5 A;  2GMH A;  3H4D A;  1IR0 A;  3KXD A;  3M8P A;  2LMI A;  1VQP S;  1WHW A;  1RT2 B;  1L3S A;  4Y2C A;  2JVO A;  2CFX A;  3OXF A;  2IMO A;  3RBX A;  1RZM A;  4X66 F;  1PYO B;  3QIP A;  3MMA A;  5C42 A;  1FNX H;  2H4W B;  1RJJ A;  3DRR A;  4WYL A;  2RHS B;  1VQ4 S;  4MIA A;  2MPU A;  2RVJ A;  3DHW C;  1LWC A;  2OMO A;  2DCU B;  3FRY A;  2FYX A;  2R7Q A;  4PR6 A;  4ANC A;  4XIU A;  2YNF A;  1NK6 A;  3OL6 A;  3GIL A;  4HI2 A;  3VHQ A;  2JLG A;  1JLG A;  1DUR A;  4O3R A;  1FF2 A;  2MZQ A;  5KFB A;  3LA0 A;  4H54 A;  2V8H A;  2J9C A;  2GZO A;  4XDC A;  2R4F A;  1Q1K A;  1RKJ A;  1APS A;  4WXO A;  4A8Q A;  2O1P A;  3MAA A;  1AA1 B;  3IRW P;  1BQM B;  3PVX A;  4USW A;  5DO2 A;  3QZ8 A;  1KS2 A;  1B3T A;  2GJ2 A;  3W2W B;  1L5U A;  2R7V A;  1YK9 A;  1U6B A;  3M9O B;  3D3B J;  5EWG A;  2YXL A;  5A8W B;  1QD1 A;  4RNN A;  4QYZ J;  2BM0 A;  4RKU C;  2ZOG A;  2CPX A;  3CDE A;  1NSQ A;  2UUB F;  4RO0 A;  1X4D A;  5IC6 B;  1U2C A;  1XNQ F;  3CDA A;  4EWT A;  3AJD A;  5I42 B;  3EX7 B;  1SV5 B;  5KFG A;  3SI8 A;  2CQ1 A;  1SB6 A;  3M32 A;  5LMN J;  4LF6 F;  1JLQ B;  3NAH A;  1HWI A;  1OYD A;  4KHR A;  5IWA F;  5H9F K;  1VRQ C;  4OI6 A;  3KLG A;  1XR6 A;  2J76 E;  1UWB A;  3B4D A;  3C8Y A;  2E5I A;  3L9Z A;  4MH8 A;  3R1H A;  2FHO B;  4G1Q B;  2YKN B;  3KNA A;  5A8K B;  2DIS A;  4UST A;  4ZVP B;  1S9G A;  4KB7 A;  1R0A B;  1HNI B;  2WRM A;  3LWL A;  4USK A;  2R7W A;  3WZ0 A;  1YZ7 A;  8AT1 B;  5HJX A;  4YR2 A;  3QFW A;  4CTA A;  1P9Q C;  3KLH B;  3NXZ A;  4NLD A;  4DR1 J;  3N28 A;  5KFU A;  2OLW A;  2KG1 A;  1EAY C;  2KRB A;  2WSC C;  4LF5 F;  2ALY B;  4Y2K A;  2V8V A;  3DRX A;  4U7U K;  2ATL A;  3PRV A;  1WKK A;  3ENQ A;  5IS2 A;  2YWK A;  3DLK A;  2VJV A;  2CPE A;  4W92 B;  1CS4 B;  4ZPC A;  1KOH A;  2QC3 A;  2BBE A;  1MN9 A;  3LAN A;  3O8W A;  2AYB A;  3R5J B;  2M88 A;  2OTL S;  5IM0 B;  3UVJ A;  4JI8 F;  5HVF A;  1S6Q A;  3BO3 A;  2MKK A;  1HNZ F;  4PEO A;  4D3G A;  5AJ3 J;  2B56 A;  3K5M A;  4DHV A;  1BHN A;  4JI0 J;  2XY6 A;  4DV2 J;  1H38 A;  2ZHO A;  2J9D E;  1Q53 A;  5G0R A;  4KBI A;  4NXN F;  1NND A;  2M4M A;  3MPU B;  2RDD A;  4HYK A;  3NCP A;  4LT6 A;  1UFL A;  2C22 A;  3MHY A;  2M52 A;  1WC3 A;  2BW2 A;  1N56 A;  3ZZU A;  1N33 J;  3MCO A;  1F3F A;  1FO1 A;  2EC2 A;  1YJV A;  2WON A;  4DL6 A;  2F3J A;  3D5M A;  1S7I A;  2XYH B;  5BXI A;  5J1P A;  3DHX A;  2QLW A;  3RAX A;  2I6W A;  2DVI A;  2DHG A;  3MMA B;  5F8L A;  4JYA F;  5C42 B;  3QO9 B;  1SL2 A;  1CQN A;  4GRS A;  2VOP A;  1YDL A;  1SH3 A;  3V6H A;  1FKO A;  2HS0 A;  3FBB A;  3ETO A;  3E2E A;  2ZM6 F;  1HBN B;  3MM6 B;  5EGY A;  2XBP A;  4LSL B;  2X1A A;  1N36 J;  2HZA A;  1F9F A;  3ZXW A;  3CCZ A;  4NOH A;  1H72 C;  1D9D A;  2F9J A;  2CNL B;  1TZ0 A;  4DR5 F;  2E5L J;  5J2P A;  3V2U C;  3IMQ J;  1S1X B;  1FNM A;  1WG1 A;  2QFJ A;  5J1E B;  2DNM A;  2VKR A;  3EVM A;  2B9Y A;  1RHQ B;  2D3Z A;  2AMC B;  1NJW A;  3IM9 A;  3JS9 A;  3C14 B;  2AZ1 A;  1N5T A;  2AJ0 A;  5ETQ A;  1ZM2 A;  3W8P A;  4TLR A;  4DUY F;  4E0D A;  4G3I A;  3IGV A;  2AKW B;  3HZE A;  3PJ9 A;  4DF4 A;  3IG1 B;  1KSP A;  1I6J A;  4RBU A;  4QCL A;  1S99 A;  4UOF A;  4LVO P;  4Y3C A;  4IR1 A;  3PW4 A;  1TTH B;  2MDA A;  3MTK A;  3HO1 A;  1I94 F;  1VLO A;  2EG1 A;  2JSX A;  5ETK A;  1T94 A;  1BD6 A;  2ZVI A;  2FJA B;  3Q89 A;  2YWG A;  4ECS A;  4J9K A;  1U8W A;  5IV4 A;  1GXL A;  3DU5 A;  3M32 B;  4A8S A;  1Z4U A;  2DXD A;  4NXM J;  4ICL A;  1FRM A;  4LFA F;  2HMI A;  1YZ6 A;  4ENO A;  2WW4 A;  3CXC R;  2R2S A;  1UWB B;  1X4A A;  3Q23 A;  1IBM F;  4FXV A;  1MW7 A;  5CH7 B;  3DDI A;  1C1C B;  5JJB A;  1TK5 A;  3DGV A;  2MQN A;  1S9G B;  2RRA A;  1L3T A;  3KLV A;  4KGZ B;  5KFT A;  3JSR A;  1CQM A;  4I0W A;  2Z2L A;  9ATC B;  1O5J A;  1FWP A;  3WC0 A;  4CNY A;  4P72 A;  1RWU A;  2VC0 A;  2HFN A;  2NCK L;  2Q43 A;  2PDA A;  1DHM A;  2KU7 A;  3ENA A;  4UUX A;  1N5Q A;  2HKE A;  5ETN A;  1LWF A;  2HS4 A;  4Z7Y A;  2OFG X;  1X9S A;  2QSW A;  1FK9 B;  2RU9 A;  5JMN A;  2OIH A;  2HFZ A;  5CCM A;  5A6W A;  5J2Q B;  3G6X A;  3R7N B;  1TKX B;  3V6D A;  1EKR A;  2BKP A;  3DXS X;  3GII A;  4D3H A;  1IJF B;  1TL5 A;  2F5G A;  5AE2 A;  4OV6 A;  3DGP B;  2ZBC A;  3RW6 A;  4LF9 J;  5G0R B;  4U8V A;  1RA7 A;  1F9H A;  5ETV A;  2D9O A;  5B7W A;  3DM2 B;  4Q7A A;  1IKV B;  4P2S A;  2BAN B;  4CLW A;  1MRO A;  4OHX A;  5KOX A;  3SCL E;  1UPP A;  4GVL A;  3ADA C;  2BW7 A;  5BJR A;  1SC4 B;  3AH6 A;  2LXF A;  1TK8 A;  2J7K A;  4LR7 A;  2O3D A;  3G86 A;  4XDD A;  4EFA C;  5IT9 U;  3AOC A;  1K8A T;  2PO4 A;  2IJN A;  3QYY A;  1QLN A;  5CD4 H;  2GV1 A;  4RW6 B;  5L38 A;  2LLZ A;  2CUY A;  3KOA A;  4IRD A;  1Y4Z B;  1T95 A;  1A6L A;  5F3Z A;  2Z2Y B;  1U2R A;  3KMS A;  1F5B A;  4TY9 A;  4FKX A;  1HQU A;  1S9E A;  3OVA A;  3ISN D;  1K0V A;  2KT3 A;  4PPD A;  1FRH A;  1XMO J;  5AXL A;  4O4G B;  3I32 A;  5LJ3 Y;  3HDS A;  5ETL A;  2FJE B;  1QE1 A;  2DNP A;  5GAG U;  1H3D A;  4OIX A;  2HVE A;  3PY8 A;  2XMU A;  3O5T B;  2ILZ A;  5A8R A;  4AL5 A;  2ZFH A;  5I3U A;  1NU4 A;  3BKF A;  2Z8Q A;  2LQB A;  3Q24 A;  4X65 F;  4K0K F;  3RB0 A;  1REG X;  4KJI A;  3HKW A;  2HNY A;  5B0D A;  4PPZ A;  1GMV A;  2F1F A;  4ITS A;  4YHH J;  1V3Z A;  5K14 A;  3OR1 B;  5E3Q A;  5E3C A;  2ZC4 A;  1KRP A;  2F4V J;  1QSS A;  4J9U E;  2BQ3 A;  2XEX A;  2VHG A;  4CT9 A;  2IVF B;  4F2S A;  2ZUG A;  4BS2 A;  3BF4 A;  1KN6 A;  2PFF B;  3FRZ A;  4EGL A;  2C42 A;  3OFF A;  1JIH A;  5B0B A;  2BAC A;  5IT9 Y;  4W4M A;  3IR5 B;  3DFE A;  1TL7 B;  4NX9 A;  3HI9 A;  3Q8U A;  3PO5 A;  4DPY A;  3H8Y A;  3I0R B;  1KON A;  4DV3 F;  2GJI A;  4DV1 F;  4WBF A;  2HFO A;  1FT8 A;  5E0O A;  5HQL A;  4JI7 J;  2VFU A;  2IDL A;  3LPE A;  3KJV B;  1DJ0 A;  4FS1 A;  4B9L A;  3CDB A;  4A8K A;  1JQG A;  2JH3 A;  4NAS A;  2DNK A;  1Y11 A;  3PHT A;  4A46 A;  4G6V B;  3UNY A;  5BYQ A;  1MN7 A;  4R5P A;  3K7R A;  4B9U A;  4RZR A;  3NGS A;  4E2F B;  1R8B A;  1K9M T;  3WQP A;  1QSL A;  2NXJ A;  4NI2 B;  1IBL J;  1RAB B;  1RT4 A;  1TVR B;  1LWF B;  1TMJ A;  1CJV B;  1HHT P;  1S4E A;  3K8V A;  5LJ5 Y;  2AGQ A;  4P74 A;  3F0N A;  1KP6 A;  4H4M A;  1VC0 A;  3N01 A;  7FD1 A;  4JI2 F;  3I5C A;  1RT1 A;  4F25 A;  1S48 A;  4KY3 A;  1N8R T;  1CG2 A;  4HHH A;  2CQH A;  2CWK A;  3HHK A;  3MFI A;  3HHE A;  2PMH A;  3VZI A;  1FFS B;  3CC4 S;  4M5G A;  2PFD A;  2KI2 A;  2EEY A;  1DRZ A;  1RCX B;  2NLW A;  1CJT A;  5F8M A;  3SDE A;  3DI6 A;  4QWA A;  3MPW A;  3S1T A;  1SC6 A;  3M2R A;  1YIJ S;  3LP0 A;  4PAB A;  3IA0 A;  1JK9 B;  1MRO B;  3RYL A;  5T14 A;  1WOP A;  1VQM S;  5CZV A;  1M5H A;  1LW2 B;  1WEZ A;  4CLP A;  4CI0 B;  3HVW A;  3OD2 A;  3EJM A;  1RU1 A;  2HHX A;  4DQQ A;  2V8P A;  1Y00 A;  3DDN A;  1U1O A;  2C2O B;  2KHD A;  1H74 A;  4P73 A;  1F2G A;  3AOD A;  1UVN A;  2IAJ B;  1JNR B;  2OP5 A;  4PWU A;  4IYQ A;  1UP1 A;  2XLK A;  1KHV A;  4LFC F;  5A76 A;  3VVT A;  2H4Y B;  2N7Y A;  4DSL A;  3A3P B;  3W8G A;  3I0S A;  1MG7 A;  4LJM A;  2G0C A;  3JXO A;  2RB7 A;  3DC2 A;  3CVK A;  1YGY A;  2K2P A;  3KYL A;  1QE1 B;  2W2N P;  1R7I A;  3W9H A;  4DWI A;  3RBZ A;  5JUM A;  2LQ8 A;  3MM8 A;  4M5M A;  3W63 A;  1T3O A;  4CDI A;  1M1G A;  5EHH A;  4DJB A;  4O3P A;  1RUS A;  3FUY A;  4O3O A;  2GHW A;  2WOM A;  4DPW A;  2N3L A;  1VS3 A;  5D8H B;  5AE1 A;  4B9V A;  3V81 B;  3NCQ A;  4B3O B;  1FFW B;  4I1T A;  3TO8 A;  3K17 A;  1TKT A;  1ACM B;  2BJD A;  1SIZ A;  2ROG A;  4KFB B;  3FC9 A;  4I7F A;  2YH0 A;  2HBY B;  2OEL A;  2FGO A;  3JYT B;  2WK4 A;  2BA9 A;  3GJR B;  4DX6 A;  1T9Y A;  3ILI A;  1WC6 A;  2YKQ A;  4RJV A;  4ZJQ A;  1NSP A;  5LMU F;  1UKU A;  1ZZF A;  2PD1 A;  2NR0 A;  4K50 A;  1NSK L;  4FN5 A;  1DY3 A;  1RAH B;  1U6F A;  2HHT A;  2LQJ A;  2HQD A;  5ETR A;  3RAM A;  4ZP7 A;  3QWP A;  1UL3 A;  1ZET A;  3UNG C;  4CCH A;  4DPO A;  1VRU B;  1VDH A;  4U67 Q;  3CJ4 A;  4M5L A;  4J9N A;  3KK3 A;  2ZEJ A;  5ETO A;  4B3R F;  4X4Q A;  5IQQ A;  3M2U B;  4HEA 9;  3SQG A;  2EKN A;  3W7B A;  3CGI A;  4C0H A;  2KB2 A;  3V4I A;  4ZVH A;  5HMX A;  3DOM B;  4C8Z A;  1TEL A;  1S4F A;  2QZ8 A;  2DGW A;  3PW2 A;  3MZI A;  1XR7 A;  5I3Q A;  5L9N A;  4WKY A;  3POT A;  4W90 B;  4OJ1 A;  1P6T A;  4X66 J;  3M8W A;  2BJ8 A;  2D3O R;  3JQJ A;  3R6G B;  3MR5 A;  3P8B B;  1WOS A;  1RT4 B;  2ZH5 A;  2JHE A;  2RQM A; 
#chains in the Genus database with same CATH homology
 2UUA J;  3D3C J;  2F4V J;  5LM7 E;  4DUZ J;  2UU9 J;  4DV6 J;  1N34 J;  4KYZ A;  4X62 J;  1IBL J;  4LF6 J;  4B3R J;  3OTO J;  4DV3 J;  4RJV A;  4DV1 J;  3T1H J;  4GKK J;  1N33 J;  2UUB J;  4NEY A;  4JI1 J;  5IT9 U;  4K0K J;  4DR2 J;  4DV5 J;  4B3M J;  3R2C J;  1XNQ J;  4HHU A;  4GKJ J;  4LF4 J;  4JI8 J;  2UXB J;  1FJG J;  1HNZ J;  4LFA J;  4DR1 J;  2HHH J;  4DR5 J;  4JV5 J;  3R2D J;  1IBM J;  2KVQ E;  4X65 J;  5A2Q U;  4B3S J;  3D3B J;  3W1Y C;  4DUY J;  1XNR J;  2UXC J;  5IWA J;  4KY3 A;  4X64 J;  4JI5 J;  2MTL A;  4OX9 J;  4JI3 J;  4NXN J;  4KHP J;  4YY3 J;  1XMQ J;  2MQ8 A;  3T1Y J;  1J5E J;  4B3T J;  1N32 J;  1XMO J;  4DV0 J;  4JI7 J;  3J7A N;  1N36 J;  1HNX J;  4LFB J;  4NXM J;  4JI6 J;  4DR7 J;  3J81 U;  4LF8 J;  5LMU J;  5AJ3 J;  5LMN J;  4LF9 J;  2E5L J;  4JYA J;  2VQF J;  4DV7 J;  4AQY J;  3IMQ J;  4PWW A;  5BR8 J;  1HR0 J;  4LFC J;  4JI0 J;  4X66 J;  2KL8 A;  4JI4 J;  1IBK J;  2VQE J;  3JAM U;  4DV4 J;  3J80 U;  1HNW J;  4V1A k;  4DV2 J;  2UXD J;  4NEZ A;  4DR4 J;  4DR3 J;  2ZM6 J;  4YHH J;  4DR6 J;  4LF7 J;  4JI2 J;  4LF5 J;  2UUC J;  5FLX U;  1I94 J;  2MEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...