4LFBJ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lfbJ00
3W1YC 3D3CJ 4X66J 2UUAJ 2HHHJ 2MTLA 4OX9J 4DR6J 5A2QU 4DR5J 3JAMU 4LF8J 3J7AN 3D3BJ 5LMUJ 4DV7J 3IMQJ 3T1YJ 4JYAJ 2ZM6J 4DR1J 4AQYJ 1HNXJ 3T1HJ 4PWWA 1J5EJ 1HNZJ 4K0KJ 4GKKJ 4LF4J 4JI8J 4JI4J 5LM7E 4V1Ak 4DR3J 4DUYJ 4DV1J 2E5LJ 4RJVA 4JI7J 4DV3J 4GKJJ 4DV2J 3R2DJ 2UXBJ 4JI3J 2VQFJ 4KYZA 4DV5J 4DR7J 1IBLJ 4NEYA 4LFAJ 4DR2J 3J80U 4JI5J 1HNWJ 4KY3A 2UUCJ 2VQEJ 5FLXU 4YHHJ 1XMOJ 4NXMJ 4JI6J 2UXDJ 4YY3J 4DV6J 4B3SJ 4X64J 2KL8A 1IBMJ 4HHUA 1XNQJ 2MEWA 1N36J 4JI2J 2KVQE 5LMNJ 1I94J 4DR4J 4X65J 4B3RJ 1N34J 4X62J 2UU9J 4B3TJ 2UXCJ 4DV4J 3J81U 4LF5J 1N32J 4DV0J 4B3MJ 1XMQJ 3R2CJ 5IWAJ 4JI0J 4LFBJ 4JV5J 5BR8J 5AJ3J 2MQ8A 1N33J 4NEZA 1IBKJ 4DUZJ 1FJGJ 2F4VJ 4KHPJ 1XNRJ 4LF7J 3OTOJ 4LFCJ 4JI1J 1HR0J 5IT9U 4LF6J 4NXNJ 2UUBJ 4LF9J
chains in the Genus database with same CATH superfamily
3TVKA 2MQPA 2ATLA 2FY8A 4ELUA 1GXTA 2QFIA 3BF4A 3A8IA 3QT7A 3UD4P 4ZDNA 1HNXF 3D7SB 3M8PB 4KFBB 2WSFC 1FEHA 2CWXA 1K47A 3UR3C 1DRZA 1X0FA 4FF1A 1N36F 1S4EA 4P2XA 4DSFA 2FC8A 2OFHX 3RBDA 1NK0A 2XYGB 2HZAA 5KFQA 3WDOA 1IBLJ 3MM5B 3GV8B 2PT0A 5HMXA 5HO4A 3ZNUA 4Q0BA 1Y00A 2KXHA 4RBTA 1RLDA 1RZMA 2FHMA 5G0RA 3LP2B 4PXCA 2OI2A 2ZD1A 3VALA 1Q8KA 3ZXWA 1YLXA 5IQQA 1FDAA 2BJ8A 2XY5A 4TQRA 1A0OB 1HBUA 2OTJS 2MZRA 2MLXA 2GQ2A 2QSWA 5C2CA 3PR4A 2HHSA 1WOSA 2HWHA 5IQ6A 1RYRA 2KN4A 4C0OC 3KFWX 3RAMA 2JVOA 1FJ7A 3SCLE 4CI0B 1JX4A 2OO4A 5KT7A 2EFVA 3GIMA 3QGPA 2IM0A 3OXGA 2UUCF 1GT8A 2KTQA 3QFHA 2MQLA 2H48B 4YY3F 4GKKJ 2AJ4A 1X9MA 2AYMA 4LRDA 3VQSA 2ILZA 3ILJA 3P49B 2DK2A 2VOPA 4G1PA 1TK8A 2P6SA 1N5TA 1QM9A 2YNIB 1KHWA 2XI2A 3H5UA 1H0HB 3FBCA 1S1XB 3W5XA 1ACMB 2DITA 2EC0A 5FDLA 1D09B 4ILLA 2CA9A 3DOMB 3B4DA 4OJGA 2WZ1A 5F41A 1U1PA 1RT3B 2GGPB 1NAQA 3NP5A 2NREA 3A13A 3FSYA 3GLJA 4QW9A 1TKZB 2B43A 2X1GA 2PE8A 3V81B 5IXUA 3CEDA 1VK3A 3C6TB 2LU2A 2VONA 2E9RX 2D74B 4A4JA 3N6MA 4WU2A 4GKJJ 3KK3B 3JYTB 1YK9A 2KZZA 5J1PA 1RHMB 2V2QA 2FGCA 3FC9A 2YNHB 5DGBA 3N9UC 5K8OA 5CYMA 4C8ZA 3A3OB 4NLGA 1Q1KA 2I0XA 5CYJA 1MMNA 1VIXA 1K9MT 3NMAA 4JI4J 4Y65A 2K3KA 3G6ES 5EDWA 3VAHA 1IBLF 1T9XA 5HATA 4B3TF 2ZJPQ 3ISND 3C8YA 2CQPA 4Q2LA 4I7FB 3WX4A 2KT3A 5KFZA 2I38A 1FNXH 3CD0A 5EWEA 1VQMS 2BQUA 2KB2A 2WK4A 1Q82T 2DTJA 3N5BA 2P6TA 4HH0A 1ZM3A 2FZCB 2J6UA 5L1JA 1LK7A 1VC5A 2W8LA 2DGSA 4G1QA 3D28A 4C0BA 2DGQA 1KNZA 3KJFB 5LXRA 4GVBA 4M8LA 2XSJB 2HBQB 1PYTA 1RISA 3CCZA 5J2PA 2QV6A 1P6TA 3G2XA 2GMJA 2XWYA 2DH9A 4GKKF 1VI7A 3L7UA 4IFYA 2HNZA 4N76A 4NRUA 4ILMA 4A47A 4DV1J 2XY6A 4RU2A 2PEBA 2KYZA 3PDNA 2ZZMA 3GJSB 1FKPB 3GILA 2KZMA 1TELA 2KDOA 4C6AA 1AA1B 1TK5A 1SKRA 3KK1A 2PI5A 4LRAA 1G4CA 3KMSA 2L48A 2WAQD 1T9WA 1T94A 3KJVB 2LFVA 5DG7A 4TY8A 2W2MP 3QQCD 5DM6Q 2MKYA 5HP1A 1H74A 1R8HA 1CC8A 5J2NA 1X5TA 1QJHA 3C16B 4GKJF 3ZNJ1 1NSAA 1TL7B 1DY3A 3I4PA 2E1CA 5T41A 1AUSL 5I42B 1OS5A 1TL4A 2EFPA 2O5DA 3JB9k 2XULA 2AYEA 4KJIA 1V3RA 4CLSA 1PGZA 4OI4A 4I64A 1SV5B 4CIOA 1W26A 4EBDA 4TN2A 2C3YA 3S1TA 2IYIA 5IOLA 2B0GA 2A2CA 5E3RA 1SKUB 3D4JA 4DZDA 2PD1A 3D66A 2LXFA 2F63A 2QMUB 4EUVA 1LWCB 1JLCB 4L74A 7FD1A 1QD1A 3DOLA 1H2TZ 3V4MA 4UTGA 4DX7A 3DRPB 5F8HA 1MWQA 4ECRA 1FKOB 4U96A 2BYCA 2IVYA 2BEFA 2R3VA 1VQ5S 1CJTA 5HI7A 4FBTA 1N0VC 1IJFB 1C4CA 2XWXA 5IWAJ 3LWLA 4G65A 4WTYA 1RAEB 2VFSA 2BJEA 1RWVB 3GIKA 1HQ2A 5BYRA 5F9LA 1XJWB 1R31A 2LMIA 2R7XA 4DSEA 2AKWB 5J1EB 2DCUB 2D1CA 3GFZA 1PJ7A 4DU8A 3Q8PB 2BM0A 4CH7A 2HBRB 1B7YB 5A0YA 2CQBA 1MN7A 4A8KA 3MEEA 2VG6B 4Q45A 3HVTB 4ZP6A 1IKWB 4Y2CA 2YH0A 1U1OA 1B99A 1YKWA 4DR4F 5LJ5Y 3M6VA 3CULA 1OO0B 3K59A 2HQFA 5KFKA 3DRSB 4URGA 2V50A 2KXNB 5KG6A 2YNFB 1RDRA 2Y1LB 2LKZA 2XMJA 2ZBQA 1NK5A 1RTJA 5L38A 2PMWA 1KTQA 3KJQB 1VHIA 4QIEA 1XC9A 3K58A 1EQMA 4OI1A 3AOCA 1RTZA 3CDAA 3TZWA 4DR1F 3IA0A 2F4VJ 1LW2A 4MIWA 3EJMA 1U2RA 1FFWB 5DDPC 3OUYA 2CUYA 2VPZB 4P7TA 5I4MA 4RW9B 2Q6BA 2YKNA 4DPXA 2R8HA 1G7CB 3KG0A 1N5QA 2PIIA 1C0UA 4R0EA 2RS2A 4MK9A 3UCUP 1JK9B 1ZPWX 1KVJA 2ZUGA 4ZHRA 1NU4A 3PW0A 3GQCA 2HURA 3T5JA 3AB2B 2UXBJ 1NLKL 4IR9A 4HT5A 1IR1A 3N5FA 3US5A 2RHQB 3FQKA 4CO2A 3KYLA 5A8WB 2VUGA 2YXLA 3M8PA 4KFBA 4HHUA 4U7UD 1HKAA 4EO6A 1HWJA 5DJBA 3THVA 4BDPA 3OLAA 1XK8A 2MYFA 3H2UB 2L9DA 1OSDA 2W2QP 3HI9A 1U1NA 3J81U 3JSYA 4O3NA 3RW6A 2W01A 1S10A 2XO6A 3MM5A 1G1XA 3MAQA 2HKEA 3GR1A 1HR0J 5BYQA 4B9UA 1QTMA 3LP2A 3UQSA 4JI8F 4LSNB 2GQQA 5CAAA 2WONB 3PEJA 1KQFB 2AJ2A 4DV2F 3DLJA 1REVB 3R6GB 2IDEA 2Z4PA 1NH8A 4ZN3A 3IM8A 1T8EA 3BH7B 1WDDA 4K4UA 4K4VA 3GJQB 4FP9A 2FVPA 5DM7Q 4KH1B 4MKYA 4PWDB 2OPRB 2R7VA 2MQMA 4M5LA 3MR5A 3R5GA 3GMGA 2ZH7A 3IM9A 1VHFA 4P7VA 1HHSA 2R42A 3D6TB 1BWVA 1FRKA 4CCHA 3N6NA 5I3PA 2DGXA 5DLFA 1MN9A 3GR0A 3P6YC 2HYIB 2WBMA 3LGNA 3VAFA 4F4AA 4QIFA 4P52A 3SI8A 4BHQA 2VICA 4B02A 4USMA 4QYZJ 1TMJA 3A8EA 4RX6A 3FKBA 2F1FA 4OLOA 2YNIA 1YTYA 2E5HA 3R1LA 5H9EK 1S1XA 2CVIA 1IBKJ 5KG4A 3MAAB 2ZHBA 1PYOB 3DOMA 3H5XA 4BS2A 3SFUA 2WRMA 2ADBA 2BM1A 2DRBA 2JWNA 3MUMP 2J5AA 1N5SA 2DNHA 1LOUA 1V5IB 1XBWA 4J91A 4P2FA 1RT3A 2GGPA 3WIVA 1TV6B 4ED2A 2MXYA 2E66A 4FDFA 3KG1A 4RWWA 1NKCA 3V81A 1NHUA 2RJZA 3C6TA 1HNVB 4ZKAA 3CC2S 3TVZA 3KK3A 5ETQA 1HD0A 1NK8A 3JYTA 1UTAA 1Q7LB 2YNHA 3K0JA 2I6WA 4ZPWR 3CD7A 3CDBA 5JVGQ 5HL7Q 3Q22A 1TFWA 1HI1A 5EX0A 3FJ2A 2K1RB 1MWZA 1FE0A 3BDEA 4B9MA 1RAOA 1WC4A 1WHXA 3M6WA 2OEKA 4C8KA 2VBZA 2DY1A 3EMTA 1GEHA 2Z0GA 2ZC4A 5H9FJ 3KMQA 5C25B 2AX0A 4PQAA 5AXLA 1TR0A 2VA3A 1HR0F 2B8PA 5DQGA 2RQCA 4I7FA 3MWBA 2MKKA 1TK0A 1F5BA 3OSPA 2ZUAA 5EWFA 5F0UA 4KRWA 4Y2KA 4DV3F 3GIIA 3PHTA 1B3TA 4IQXA 3E8OA 2HVEA 4DR7F 3BSAA 4AQYJ 2CNLB 3SCJE 5AE2A 1TKDA 1NJWA 5KFOA 4WIQA 1XR7A 3K8WA 4C98A 2V4RA 3M6UA 5L1KA 5MAOA 2VASA 3ZC4A 1WG4A 3OFHA 3UDEA 1NJIT 4NLPA 5RUBA 1SC3B 1VISA 2FZGB 2XSJA 4CLPA 1S77D 1RBLA 4B3MF 1Q78A 2FGOA 4DSKA 5ETLA 1Q79A 2LYVA 2ZH1A 1C1BB 4LF1A 4OYIA 2DNZA 1WWHA 1KSPA 2R8KA 2MQOA 2NZCA 5A8KB 3WBZA 4ENOA 2XBPA 3ULHA 1FNOA 1S59A 4DOZA 1XMQJ 1FKPA 4KO0B 1WNEA 3R7BB 4JV5J 2E9TA 3B6BA 5D0HA 5I3UB 4PAAA 1RWUA 3Q24A 3D2WA 4LFCJ 4PPDA 4ZCKA 3UNYA 3OFFA 3R6LB 3IG1B 4WWSA 2MQNA 1RT6B 1FE4A 1UETA 2HS4A 1IN0A 3KJVA 3LP1B 1ZOTA 2Q1LA 1HMVB 3RU0A 1YJUA 4RLEA 2VC0A 1NPPA 4F0KA 5C24B 2BZ2A 2M2BA 2DR8A 5EX3A 4OZ5A 4TU9A 4NI2B 3C16A 4QR2A 4FYWB 3HHKA 4CT8A 5EN1A 1FKAF 2GIRA 3B8HA 5F8GA 5I42A 1OQ6A 4P71A 4G1IA 5D78A 2ZVIA 2LA6A 2DNGA 3AJDA 2L9WA 5LXYA 1N33F 5A76A 1SV5A 3PRBA 4LF2A 2OSQA 3DDNA 1RSCA 3TZXA 5HSPA 1BQNB 1L3VA 3G71S 5J2MB 2ZKUA 2MDAA 4F2SA 4NMLA 1LWCA 1R3NA 1JLCA 4DUZJ 2B6AB 4LIWA 1ITPA 1NB7A 2XMUA 1AB8A 1WEXA 3DRPA 4FNIA 1FKOA 1X5OA 4CNZA 2HHHJ 3IAM9 1KFDA 4ZPVR 1RWKB 5A2QU 2GV1A 4WF9Q 5A2QY 1F9HA 4OYZA 4W90B 3AY0A 2J76E 5JVHQ 2KVIA 2OAUA 2H5JB 2DO0A 2CPJA 4ED6A 1REGX 5J1EA 2DXDA 3H98A 1A6LA 4WTOB 1Q16B 2DGUA 2EFGA 4F3MA 5GMEA 2VG6A 1DQ9A 3HVTA 2CJXB 4JI1F 2OJ3A 3KNAA 1IKWA 1NCLA 2E7XA 2GA7A 5SZTA 1AXQA 1NHVA 3A3NB 2XY7A 2LXUA 3DRSA 4CZCA 3TJAA 1KN6A 2B9YA 2HNDB 1RP5A 2YNFA 4NEZA 2N3LA 4CO5A 3GJRB 1ZZFA 4L6V3 1OSCA 3GWCA 1Q53A 5GADU 4E0DA 1KBRA 3CW2C 3IN5A 2CJYB 3OLBA 2HGLA 4UOFA 3Q8UA 2DR6A 4EYIB 1SCJB 4UUWA 3A3PB 3QPIA 5LMNF 2R8GA 3BO4A 1B64A 1T05B 4RW9A 3CD6S 1M5PC 2JEIA 4XK8C 4F4ZA 4EMDA 3RZAA 2FVSA 1TTHB 2RNEA 4X4OA 3F0NA 1S0VA 2QGFB 1HHTP 3TR5A 3EXYA 3W9IA 2LA4A 2V8PA 2F8EX 3QT6A 5SUHA 1D3WA 1ZA2B 3BBCA 3JSRA 2RDIA 5A8WA 1KQKA 2UV8A 4YN3B 1S76D 2UUBJ 2FLOA 4FYYB 2GZOA 3ISZA 3FCHA 4ZJQA 1QVFR 1D1UA 3R3TA 2IMOA 5M2RA 2HVDA 2HWIA 3W66A 4OZ0A 3I5CA 3CCJS 4U8VA 3HHLD 4LFAF 4ANCA 5HQMA 3VGUA 2QO3A 2OPPB 3R5AA 4ZVQB 2FHOB 3U02A 4OX8A 3D0GE 4CH0S 3R5DA 4QOTA 3OVBA 2PN6A 2XM3A 4LSNA 2WONA 1DBDA 5DZ6A 2KKHA 3J7ZT 4KE5A 2Y8YA 1REVA 3GSIA 3I9V9 1BLUA 3DI6B 4USTA 5FLXU 1XMOJ 4C7QA 1JXLA 3E3XA 6FDRA 5FLXY 2DGTA 2YWGA 3M7VA 1HBMB 4PWDA 2OPRA 3EGWB 1S6PB 3OJSA 3NS6A 2GMHA 4JUZA 1IQTA 4ES2A 5ETPA 4CO1A 1Y5NB 4OV6A 3UWTA 4QU6A 4NL5A 3KKFA 1G3OA 3I82A 1UFKA 4O0NA 4DPWA 4LF6J 1W7WA 3CWJA 2R7QA 1GMWD 3F56A 2G2ZA 3CTRA 3HLUA 2X1BA 4FN5A 1RAGB 2M8HA 4NYZA 1FTRA 4F0HA 4PZVA 4O3OA 3MAAA 1JLAB 1FFGB 3NNAA 3U1NA 3MEDB 2MLZA 3PX4A 2J7UA 2XHCA 1VCTA 3W63A 1FERA 5B0DA 3M9NB 3MEKA 1SH0A 1TV6A 5L1IA 2ZWOA 3M8RA 3SQGB 3QWPA 3S01A 3OTEA 1S49A 4DFMA 5CCMA 1HNVA 3W2VB 1ZS6A 4D3HA 4MKBA 2RS8A 1S99A 2FZKB 4JV2A 4N56A 5ITHA 2HHWA 2BJ1A 2YX7A 3OQ2A 4DCOB 2O1PA 2K1RA 2CJKA 1FWPA 4WP3A 3CJ0A 2CXEA 4DR5J 2YWKA 3KWMA 1Q7YT 4C8YA 3T1YJ 4JP8A 2I5JB 3TX8A 2HRTA 4B9VA 1NDPA 5C25A 4J9SA 2HW3A 2RF2B 1U25A 4KGVB 1NDCA 2C3UA 4PCQA 5CCLA 4NLDA 4F67A 4R8UB 1WC5A 3MD3A 5LOQA 1XMOF 1X4BA 3TAPA 1YJTA 2XMTA 2YWHA 3NY0A 1S6QB 4KAIA 2B5JB 2OH2A 2OGUA 3OW2R 1WOOA 2CRLA 4ZVTB 2HMIB 2E1RA 3IWXA 1FWKA 3NOGA 3KOAA 3BSNA 4AXJA 1X4DA 2ZFHA 4Q44A 2ATCB 5AJ3J 2CG4A 3SXLA 4KHPJ 3PG9A 2OLWA 4DG1B 2RRNA 1HARA 1C1BA 2RRBA 5KFPA 4LIRA 5A8KA 1WEYA 4JI3F 1WC6A 3DOKB 3H5SA 2C22A 2BKPA 4KO0A 5IM0B 3ENQA 2D7SA 3PIOQ 3HP6A 5I3UA 2W1BA 2QIFA 3CJ8A 5LM7E 4USWA 1GXUA 3IG1A 1RT6A 4BBYA 1S1UB 3FQLA 4URQU 3LP1A 1IM4A 2AYBA 1RQ0A 3MPDA 4K4TA 1HMVA 2YVSA 1JB0C 2UXCF 1VS3A 5HVFA 1TUGB 4F0MA 1VC0A 2YNGB 5C24A 1FESA 4UY8T 4P6QA 4NI2A 2BABA 2QMXA 1RADB 1HW9A 4OZLA 2HK2A 3NS5A 2GQCA 1U1KA 4CH1A 3OHAA 1Y9OA 2XS2A 3DN9A 2MY8A 2VBYA 4LVOP 1I6JA 4PYDA 2B4UA 3W62A 3CB4A 2EKNA 3LQVA 1BQNA 1SB6A 4X4RA 5KT6A 4LF8J 3PJ9A 4IUFA 3QT8A 2C2RA 2DKOB 1YWXA 2CQHA 4P9SA 2VJVA 1JNRB 1KONA 1HNZJ 3ETMA 3GYGA 2B6AA 2VHGA 4LF4J 2IHR1 3TARA 1T11A 4ZITA 3GPAA 1CLFA 3RBXA 4PG5A 1S9FA 2OMLA 2JFDA 4YB5A 2CQ0A 2C2MB 3MMCB 1B0VA 3EZ5A 3I0RB 4B08A 1RT2A 4LBPA 2HRUA 5KT3A 1ZTWA 4PQUB 3ZTSA 3ZZYA 4DCPB 4C97A 4ZVPB 5IT4A 2B51A 4RUCA 4KHPF 2OFGX 2DPIA 1RWNB 1S9GB 1KHVA 2C2EA 1HW8A 3GCWP 3HHEA 1F0XA 3W5YA 5CABA 1FXDA 4L76A 1SC6A 5ETVA 1GNKA 2DNQA 2HNDA 3GYXB 4I56A 3H90A 3NGKA 1O8BA 1VFJA 4NLUA 4JI7J 4QWCA 1WC0A 2GCFA 2JRSA 2QLJB 2LDIA 4NA1A 2NUHA 4RNHA 3T19A 3NWRA 2UU9F 1RT4B 4HHJA 5E3CA 3FK4A 1JXVA 4ZP7A 2N82B 3VHQA 2MQQA 3HCXA 4B3SJ 2LXIA 5AE1A 3M2VB 4X84A 3OFEA 5L9NA 1NO8A 5L1LA 3RUBL 3ADAC 2V9WA 1NDKA 2IM2A 4C0HA 1T05A 1R8PA 2D9OA 2FJDB 4ZK7M 3L7OA 1WTBA 3HM9A 4YEAA 3Q23A 3AHPA 3CIZA 2YQ0A 4TYBA 4HACB 1R27B 4C3KA 1S0NA 3OXLA 1FRMA 1J27A 3LP0B 4DR2F 1Z2ZA 3CCLS 3IWNC 4X4VA 4PPZA 2MLYA 2HHVA 4A8WA 3TVYA 3X1LB 3G86A 4PXEA 3TUJC 2OPSB 4K59A 3GIRA 4K4YA 2A1BA 3CCMS 1VR6A 3CGIA 1RGVA 3W9HA 1RHQB 1WF2A 1JWWA 2MY7A 4CNYA 2FYXA 2OPPA 2O01C 4OZJA 4TQSA 3M4XA 4LF7F 1VJQA 4IFVB 3FSIA 2W24A 3SFGA 4NA3A 2RD5C 1ZETA 4J9OA 1F3FA 4RWXA 1DQAA 4DV0J 4LRBA 3R2CJ 4RW6B 4O0IA 3DI6A 2ZJRQ 4ED5A 2P8IA 1VRUB 2YKMB 2OEMA 1K8AT 1HBMA 1AROP 4K0KF 3PW5A 1KP6A 3D3CJ 1S6PA 2BJDA 4OZ1A 4RL1A 1S0MA 2GS8A 2UVVA 3DKDA 3F73A 3VAGA 1NZAA 1R7IA 4Y3CA 1NK9A 4LVNP 5L8RC 2V8VA 5KOWA 1QSYA 4PG4A 3K57A 3CC7S 2EG2A 3RAQA 1B7FA 4QWAA 3PJWA 4JI7F 2M88A 4BWMA 3U7JA 3FCVA 8RUCA 1KR4A 1N34F 3BM7A 3BYPA 3ZTQA 5CZVA 4OI3A 3MR6A 1RXOB 3AA9A 4B3SF 3AB4B 1B0PA 3QZ8A 4MK8A 5IZHA 3OR2B 2MEWA 2WSCC 3PEHA 3KLEB 2E5JA 4TLQA 4NLSA 1JLAA 3VVUA 2M7SA 1NXIA 3EVMA 3MEDA 5D4OA 4X62J 2NSBA 5D15A 3HD2A 3RW7A 2BKOA 1E6VB 3EDQB 1Q81T 3PY8A 3SQGA 5DDOC 4Y2AA 1RUSA 4URSA 1IBCB 2Y1JA 1JMTA 3LAKA 1EARA 3W2VA 3ENWA 3VF0B 2PFDA 1YVFA 4YOEA 2B4VA 3JQJA 2RVJA 4RR5A 4H4KA 2JSXA 3ZZUA 2RDDA 3V6KA 1SKSA 2B3TB 2BRKA 4JOUA 3NWGA 3FNNA 1N56A 2E44A 2JX2A 4JI6F 3J7YU 2JLEA 3MCNA 5GAGI 2HEKA 2R2SA 2QLXA 4O4GB 2MKSA 2CNOB 2AQ4A 1W2BR 3BV8A 3HFVA 3HK2A 3ILOA 1U0HB 1ZTTA 3TUIC 1HPZB 4NEYA 4J9UE 4RZRA 1RTDB 2COLA 4KY3A 3HSJA 3RG6A 2I5JA 2UXDJ 1OPZA 3PYDA 2RF2A 1CQMA 3PX0A 6AT1B 3Q8QB 3DHWC 2P9GA 1ZPVA 3CJSA 1NRKA 3LH2S 4ZPBA 1TL5A 1YHQS 1VQOS 4R8UA 3MAHA 1QTNB 3DRXA 1VDHA 1PJ6A 1YJWS 2AHOB 2N7YA 3BB5A 2DXEA 1S6QA 1JKHB 3UVJB 2N3OA 1QSSA 4RNMA 1Z1ZA 2B5JA 4DS5A 1T9VA 4J5OA 4ZCLA 2UUAJ 4AD6A 2W7PA 3P3DA 1SL1A 2HMIA 1IKVB 2M52A 4ED0A 2ASLA 4QYRA 4CWBA 4YR2A 5HAOA 3BPSP 1LK5A 4C9DA 5KFSA 1RHKB 4RU9A 1WF1A 2ZC3A 4V1Ak 4DG1A 5KFVA 1LQ9A 2RU3A 2HQIA 2XSFA 2AW0A 4KYZA 4LR8A 4X4QA 2HVHA 2M4MA 2QEXS 2LEAA 1N32F 2E1AA 4PG8A 4TVAB 4EZ6A 3DOKA 4ZVFA 5IM0A 5BJRA 3TI0A 2AEFA 5CXTA 5JJBA 2DT9A 3MECB 4X62F 3OR1B 1BQXA 1S1UA 2ZJQQ 1M5VC 3R97A 4OFZA 5KTQA 4ZCIA 5DGAA 3C19A 2HAIA 4GVLA 4M5NA 2YNGA 4O3QA 4P2SA 1XR6A 1RWMB 1TZ0A 2VZ9A 2M3DA 5DETA 2FVCA 4KKOB 3CSKA 2A0FB 3QIPB 5B0GA 1X4FA 2LU1A 3T1HJ 4YR3A 1I1GA 1J5EJ 3PJXA 4PWUA 3MUTP 2NXCA 4RUAA 2XI3A 1RKJA 4USVA 4A48A 5L46A 3P8BB 2K8GA 3QMQA 1S12A 3NCPA 2JJ4D 1N5YB 1TKTB 2UUWA 1Y4ZB 3UCGA 3JS9A 3W3SA 1LXJA 2VFRA 2UXDF 2DNPA 3AXMA 2KL8A 1PG5B 4ED8A 1IBMJ 4K2JA 3CE8A 3PACA 3M9OB 2DHXA 2AIRB 3MEGB 4P72A 1VBYA 3GSDA 1QUVA 5KFDA 5LSLA 3C15B 4E8UA 1VQ9S 2Y0BB 3HVAA 3W5ZA 5K20B 2FC9A 5HMZA 5B08A 3MMCA 2UUTA 2VPXB 2VKZG 3T9ZA 3I0RA 2UUAF 4XTTA 3TAMB 3OJUA 4K5SA 2AD9A 2ZBIA 3LUYA 5CH7B 4PQUA 4I2PB 4U9RA 5AT1B 4A8XA 4M5JA 4Z7CA 1ICEB 4S0MA 2BOPA 2L08A 5DZ7A 4OZ2A 5KFAA 2C2ZB 1S9GA 2O3DA 5G4DA 2LLZA 1T9UA 5E33A 4WKRA 5KG3A 4M5IA 2UVRA 4Z37A 3C14B 2Y9HA 1VLOA 2BACA 2V94A 3QJPA 3SSRA 3DLGB 5JMNA 1SJQA 2OD4A 2DGWA 2QA2A 4CRJA 5KG2A 2RT3A 2K7KA 3FZ2A 2XCPA 3LW5C 1CVJA 4NZ6A 1NJXA 1RT4A 2C2DA 2RAQA 5KFXA 5KFHA 1SXLA 1X7VA 4FPIA 3FEYB 1NM2A 2ZOMA 3M2VA 2D3ZA 3PM9A 2EFQA 5KFGA 3DGVA 1KWMA 4I1TA 2KI2A 3JSMB 5GAHI 1M5SA 2U2FA 3ZZ0A 1I3OB 2POKA 1LV5A 3T1HF 3BGUA 3Q2SC 4XAKA 2A3JA 2HPUA 1FNMA 2H5IB 1JLEB 2J6TA 2D41A 1Q5VA 2HFVA 3EGZA 4MIBA 4HACA 2P2CB 4MMOA 2NS1B 3MOZA 3I0SB 4JI5J 4H4OB 3LP0A 5DDRC 3MHYA 4PG6A 1O6XA 1U4BA 1EKRA 4A46A 3TEHB 1IR0A 1H2VZ 3HHLB 2HQDA 2XB2D 2ZHAA 1IJEB 3SCKE 2OPSA 4Y34A 4ED7A 4WP9A 3SV3A 3SDEB 2XLKA 2IM3A 1CULB 2VV5A 1YSJA 1M1HA 2BQRA 4WYWA 2VB6A 1U8WA 3SZ2A 4HI1A 2CPYA 2AP6A 3G82B 4C3LA 4IFVA 4FKXA 3LGHA 3MCMA 3IRXB 3KTQA 1CC7A 1EETB 2CPEA 2IA0A 1NB2A 3J7A1 3G4SS 2VOOA 1DHMA 2JVRA 3BBBA 2ZM6J 2KG1A 3V4IB 2HAFA 2X51A 4RW6A 2OUGA 5HVGA 4KGZB 1Z4UA 4KR0B 3K5LA 4KV8B 1VRUA 4IH6A 2YKMA 1JQGA 4KGKA 2MHEA 1GFWB 5C7PA 3NNCA 3R8YA 4J9VA 2ALZA 3TEGA 4IQMA 4ELTA 4NX9A 1CEZA 2ALYB 3KHHA 4UOCA 1WHWA 3OTOF 3D6HB 3TNVA 4NASA 4RNOA 2DIVA 1UVNA 2R2RA 2VJUA 2FB0A 4K4ZA 1YJ7A 4DV4J 1RBAA 3HVWA 1SJ4P 3LPEA 4DPTA 2GHWA 4DL6A 1KKHA 2MQ8A 1RABB 3OR2A 2C1EB 3KLEA 2BJ3A 2ZH4A 2JEJA 6FD1A 4OX9J 3G8QA 3CF5Q 4ID8A 3BGRB 1LKZA 2V63A 1MMDA 3BGLA 4IOBA 1VQ6S 1EX8A 5D6GA 2BE7D 1E6VA 5HLFB 2GHPA 4GMKA 4Q7AA 4NXMF 3WX8A 1TUVA 4DR3J 2VF3A 4J9MA 1DARA 1U1LA 1NSPA 2ZDPA 1NHKL 1AT1B 2Z2LA 4RBUA 3RGIA 1U1MA 1U7LA 2XNQA 3FCWA 2B7BB 4FZVA 4OHYA 4O4GA 2A2DA 3K5NA 4WBFA 1DQ8A 2CQ2A 3UFCX 1N6QB 1U0HA 3HSDA 1QSLA 1HPZA 1M90T 3N01A 4AUKA 1RTDA 5KT4A 4LFBJ 3CCUS 3ZZOA 2U1AA 2V67A 3RB3A 2XMMA 4IG3B 3G6YA 4FXVA 4NLOA 3W1YC 3DLEB 4DUYF 2IMWP 2R7WA 4DR6J 2FDNA 2FJVA 3DMJB 2IPOB 1S0OA 1HA1A 3B78A 3QATA 3ILLA 3KG4A 1NZ8A 4MH8A 4J90A 3FRZA 3KK2B 4ZN1A 4WIIA 1MG7A 1U02A 4O3RA 5JXSA 4NRTA 2VFUA 2AV5A 1JKHA 3UVJA 2XHWA 4XIUA 1WEZA 3H25A 4XDCA 2MZ1A 2M70A 3M05A 3UN3A 1GX6A 3D6FB 5MLCV 3LO3A 2NSCA 3Q8RB 2KHDA 4AE5A 9RUBA 1W25A 2KVQE 4OIXA 4USHA 3HD1A 4J37A 4LF9F 1VQPS 1M0SA 4DFKA 1DLOB 3EICA 2QSFA 4I2QB 5ETSA 2E5GA 1FJGJ 3LF0A 1F6TA 4QYZK 4C11B 4NXNJ 3FBFA 2AJ0A 2C3OA 1WI6A 3MECA 1SL0A 3MM6B 2F8MA 3OR1A 2VH7A 1V3SA 3EXCX 2AWZA 4DV7J 3IO1A 2V4QA 2AJQA 3OL7A 4P2MA 4M5MA 1H6KX 1YJRA 1VIOA 3H7HB 2F9JA 1LWEB 4U95A 5KFNA 2DNLA 3TQ1A 1ROFA 1CS4B 4HKQA 1RHUB 3ICLA 2BJ9A 2M5YA 4NCGB 1C2PA 1RB0A 3VGTA 1FEEA 3AQOA 4IO1A 4KKOA 4ZLPA 1HL6A 1R8BA 1U6FA 1H72C 3QIPA 3DNCA 3NXZA 3FSXA 1N54B 4NYOA 1V3ZA 4IDKB 3TW0A 2ZOGA 3MFHA 4H4MB 2XGQA 2CIMA 1WC3A 2X3GA 2O66A 3TA2A 3CO0P 3OV7A 5HJYA 5HJXA 4O44B 1N5YA 1TKTA 3BPDA 1RCOB 4KPYA 4LFBF 2HQ3A 4JI0J 5LJ3Y 1OQ3A 3I5AA 2KRBA 1SVDA 1CG2A 2V2KA 4M5HA 2KJVA 3RB0A 4X66J 2KXFA 3NGSA 2IDLA 5H9FK 3MEGA 3VVTA 1LEOA 4MT1A 4LQ9A 1HWKA 4J9LA 4DS4A 3K5PA 3C15A 1D9DA 1Q8LA 2E7WA 2YY3A 2HZCA 1L3KA 3AJ2A 1UAWA 1V9OA 2LEPA 2E5LJ 3TAMA 3R2DJ 4HDHA 4OHXA 2BMBA 2V34A 1YG0A 4I2PA 2VQFJ 1FD8A 1PBAA 3B4MA 1TAUA 2XC9A 2ROGA 2BXJA 4EZ9A 4JV1A 2GVZB 4MK7A 2C2NA 3C66A 1E6YB 2HFNA 1XNQJ 4HT7A 4L73A 1YRXA 2CWKA 4YB7A 1R6YA 4F3QA 3KLIB 1C0TB 1R6VA 4J9PA 2HQGA 2VFTA 2FHJD 2ZKTA 2W2PP 3C14A 2VD3A 3CCQS 3U1LA 1FJGF 4R25A 3G8SA 3CPWR 3IAS9 5CHCB 3DLGA 3D6MB 3AT1B 4QWEA 1TL1B 4JI4F 2GW8A 1X9SA 3V6JA 2W2NP 2EEYA 4USUA 4MKAA 4USIA 4KIAA 4DV7F 1DTTB 4PRFA 2Q3PA 2GIFA 4A8OA 4H4KC 1XN9A 2Q43A 4NLQA 4FF4A 1UVKA 1FXLA 1S57A 3M30A 2L41A 1IKYB 1UPMB 1X5SA 2KH9A 4NZ7A 1UEVA 3ISNC 5C5JA 4EGLA 1QAJA 3BGFA 3A4TA 3JSMA 2XG8A 3DXSX 3MFIA 1M5OC 4I67A 3FUYA 4TY9A 3N79A 5IS2A 4DV6J 3O3LA 4DDFA 3QGIA 3OD2A 1JLEA 1Q5YA 3K17A 3PYEA 3NGUA 3HF5A 3W65A 4OJ1A 2N7CA 2PGCA 3S6EA 3D1HA 3I0SA 4NE9C 5IFMA 4H4OA 2J0SD 2MSTA 4DCJB 1XERA 1VQ4S 2QZ8A 1RWWB 3KLVA 3UI3A 2FQQB 2VKRA 3GIJA 3HHLA 1Q8IA 4L3NA 2XCAA 3R7SB 2OIHA 2A10A 3PFOA 1RCXB 4DV1F 3HXMA 4HDGA 2GFFA 3DRRB 1HYSB 3UPFA 1DTQB 4DEZA 3SDEA 1CULA 2G1DA 2VC1A 3SSQA 3QGHA 3QYYA 2K06A 3HSZA 3G82A 5KOXA 3IRXA 1EETA 2H54B 1U24A 2K3IA 3I32A 1HNWJ 2IY5B 5E41A 3CUNA 3V4IA 2XGPA 2NYIA 5GAEU 1RT5B 2BQ3A 4MFBB 3MTKA 3BKTA 1I94J 3SMZA 4KV8A 4X65J 2DHHA 1BHNA 1SL2A 1UA1A 2ZITA 4B3RJ 1BUXA 2V6AA 3BO2A 2EFOA 2MZTA 2P9EA 4PXDA 2ASJA 4BWJA 3QFWA 2MGZB 5HMYA 4CLWA 3V2UC 1GMWA 1RU1A 5CYQB 1BQMB 1GK8A 2A6OA 4ZIWA 4RW4B 3ET6B 3VGVA 2QLWA 4XPEA 5EGYA 2WB1D 4LSLB 4P73A 5LMUJ 1ZAVA 4DJBA 3CCWA 2CQGA 2AGPA 5D4PA 2B7CB 3HULA 3L4BC 4NLVA 4CM2A 2IRYA 4OQJA 4AL7A 1UW9A 3BGRA 1LWFB 4DBQA 3IBFB 2ACYA 3AOBA 2IIHA 4AL6A 2HFSA 3AQPA 1N4LA 5L9XA 5IWAF 3KLFB 4ECQA 4Y2IA 5HLFA 1NJZA 5IV3A 4K8RA 1Y3JA 3CCSS 2LQBA 1DAXA 3TO8A 2CJ9A 4NMXA 1X4AA 2CQDA 3PX6A 4ZVSB 2HBYB 1U48A 3PKMA 2HG4A 3HO1A 3IXQA 5E3PA 1FA0A 2BBEA 4ZPDA 4LRCA 3KXDA 1WOPA 2XMAA 2P5VA 4ZA1A 4ED1A 2B4OA 4ID5B 1N6QA 1PCAA 3Q8YA 4AL5A 4FYDA 1V5VA 1KTVA 3AJ1A 2HBZB 2WCXA 1Y10A 3THPA 3QSYB 2FUG9 2VBXA 2RIJA 3JSBA 4K7QA 1UWBB 4MJKA 4IG3A 2YTCA 3DLEA 3I9ZA 2IVMA 1PIEA 1F2HA 2IFXA 2JL9A 2RMLA 1XR5A 4DV5J 1HNWF 3DMJA 1K0TA 1NK4A 3DXBA 4QR0A 1APSA 5D0EA 2CDRB 2GO8A 3QJJA 1WKLA 4GO5X 2ACMA 3KK2A 2F4VF 1I94F 4DX6A 3BKFA 4I4BA 4B3RF 2L3MA 2EI5A 1CQNA 4NYPA 4ED4A 2Z2YB 5DO2A 4KHRA 2CNKB 3LA0A 1OWXA 2DVIA 3KHRA 4X4SA 2PSZA 3LALA 2EK6A 1XNRJ 4M1KA 1TKZA 2RUGA 3HKZD 2R7UA 3D54A 1SPBP 2RILA 4O3SA 1F1BB 3C6UB 3DDKA 2J7KA 1SIZA 1L5UA 3C2PA 2UXBF 4EWTA 3OBIA 1VMBA 3PV8A 4I2QA 5F8LA 2BUNA 4U6PA 4PWWA 5L39A 3GV7B 3BEGB 1IUJA 2ZDOA 1YDLA 4C11A 3HT0A 4E98A 3R27A 3H8YA 2JNJA 1VJWA 3MM6A 3EDRB 4RW7B 4WFZA 3CDUA 5D4NA 3PO4A 2I9SA 3MR3A 2NYHA 2W4CA 3PIPQ 3BBFA 1N36J 3RR7A 4FKYA 1Y7PA 3OXFA 1LWEA 2W25A 3T9NA 2J0QD 1ZH5A 5E3QA 1CS4A 2LDYA 3LTOA 4NCGA 5KFRA 1SJFA 3NAHA 5B0CA 4DZ6A 1YRUA 4F4WA 4TXSA 2VU5A 4C8NA 1M5HA 3FDSA 3QLHB 3AD7C 4IDKA 1KDNA 1R8CA 5HK4A 1UZDA 3KJNB 1N5VA 4H4MA 2IAJB 5HN0A 3M32B 2DNOA 3MR7A 3EGNA 1SJ3P 4DQSA 1X4HA 1PYSB 4O44A 3MZIA 3CVKA 3BQ0A 1FD2A 1VQNS 1CJKB 3NS7B 5B0FA 5GMKa 1T7PA 5KFEA 1FDNA 3MOJB 2Y0SD 1K1SA 4DL3A 3ZTPA 3TP2A 1D9AA 1BWEA 1N52B 4YR0A 4DV5F 3V6HA 4M63A 2G1HA 2UUCJ 4YY3J 2J7WA 1UJ6A 5I3QA 3D1OA 2ZNZA 1IBKF 3BSCA 2OHDA 4CP5A 3DM2B 3JXOA 4OYPA 2IM1A 1UVLA 4ER8A 1Y0HA 4DQIA 1F5AA 2BW2A 3M8WA 5KFCA 4FPRA 2FPHX 2EBGA 2F8HA 4N5SA 2GVZA 1E6YA 2H51B 2IJRA 2I2YA 2JOQA 2ASYA 4CLKA 3OL8A 2NPFA 2AZ1A 2HK3A 3RTVA 3KLIA 1C0TA 1TL7A 2HZVA 3BR8A 1BC6A 1G2EA 3EYZA 1U49A 2NZ4A 2BJ7A 3EE3A 2B8QA 1TL1A 2WSEC 4R0JA 4CYUB 1C1CB 3IBCB 3A12A 3H42A 4NZ0A 1EJ7L 4KGXB 4USJC 4A8YA 4J9KA 1DTTA 1RK8A 2QN6B 4CLYA 4X64J 3CIMA 3PZPA 3OL9A 2QYCA 4WFNQ 2GC8A 3GFXA 1YJ9S 2C3PA 5EHHA 1IKYA 1BXNA 1AFIA 2D69A 4B3TJ 2RRAA 4V19X 2HLUA 2GJFA 2JFKA 4AQYF 1JIHA 1TKXB 1RA7A 1LFPA 1SQFA 2BR0A 3OHBA 3E51A 1QUPA 2XMKA 1NK6A 2ZHOA 3PR5B 4F8RA 4TNOA 1WKKA 3AFGA 2QL7B 1NPKA 2M9KA 2GHVC 2E29A 5A8RB 2VG7B 1UJ5A 3TJ8A 1PAEX 3K8VA 4DUTA 2WOMB 4WCEQ 4P75A 3MMBB 3WC0A 2M0GB 2MJNA 2CPDA 4UW2A 4M95A 2DHSA 5E5NA 3D0IE 4NWBA 3KHLA 1KOHA 2J9CA 2JLFA 4KGMA 3DRRA 5D0RA 4FVMA 3J80U 1HYSA 1DTQA 1ULRA 5D8HB 3CDEA 1XMQF 4A8MP 3J80Y 3BGOP 3HPOA 4W98A 2NXJA 4JV5F 1LXNA 3PRVA 3O5TB 2QYGA 4LFCF 5HROB 3EM1A 2DNYA 5T7LB 1B0TA 3KDOA 3DLBA 2P9CA 1FF2A 2OSRA 4RBVA 1YJVA 2JHEA 1S1WB 4B9TA 4QPTA 1RT5A 1L3UA 4ECZA 4MFBA 3C3LA 3CC4S 2MTLA 2BKNA 1FHTA 2F5GA 3PW2A 4RW8B 4DFJA 1PJ5A 2MGZA 1VQ7S 2ZZNA 2I8EA 4K5RA 2ERRA 1NMEB 3CNQP 2QE5A 5CYQA 4DN0A 1BQMA 4QCLA 2C28A 1X31C 4Z7YA 1ZAWA 3JTPA 4RW4A 3ET6A 2KT5A 3IWLA 3DCAA 3T6JA 4X4NA 4W4MA 1HWIA 2MHNA 3MM9B 4LSLA 3DDIA 2RQKA 3MMAB 3M2RB 1RHRB 2NXEA 4X64F 3PRDA 4QIVA 1ZBTA 2CPIA 4DUZF 5EWGA 1FT8A 4YB1P 1VQKS 1WUUA 1RWXB 2HHHF 2B56A 4DL2A 4WE1B 2D9PA 2HHQA 4PUOB 1LWFA 1DZ5A 3OFGA 3EX7B 3T6BA 5HQ8A 1HLWA 5CD4A 2K2PA 3KLFA 2J8SA 1WSVA 3LAMA 4DL4A 4DSJA 1GTHA 3ILIA 5CQGA 3ZTOA 3QWUA 1NSQA 1F9FA 1XWLA 4I6WA 4HR2A 2ZZTA 4YQWA 4P10A 1YQHA 1K73T 3CCRS 3THTA 3UDCA 1SI9A 3HX9A 4R5PB 1YJNS 4GO7X 3ONQA 2W4PA 5CD4H 4IH7A 5DG8A 5KFUA 1HBNB 3CXCR 3JTNA 4ID5A 1NNDA 4F02A 2ABYA 1OMSA 4F04B 3R7NB 5GADI 2HS0A 4DR4J 3VZHA 1AW0A 1KS2A 1UWBA 3DU6A 1EQ0A 1SJ1A 2H3EB 3NAIA 1MSWD 5HVHA 2IC3B 3U27A 5JUMA 2BANB 3H0PA 2CQ3A 2NXUA 4Y0FA 1XMBA 2JEFA 3I55S 2GX8A 4CTAB 1U6ZA 4A8SA 4DHVA 3L09A 4ZLLA 5J1NA 1TQLA 4DR1J 3ZFVA 3CMES 3CCES 3M8ZA 4DF4A 1Q0NA 1U2FA 1VQYA 2R8IA 1T0TV 4F2RA 4I6YA 1KQSR 2W9CB 4RNFA 3C6UA 5E0OA 4WP8A 1WTFA 3FVYA 2VDIA 2YWEA 2LVWA 2FVRA 3OT9A 1B4SA 1NSKL 4ALZA 4F50A 4N7TA 1EZZB 1VBXA 2EK1A 2J0WA 3TYTA 4DX8H 2KM8C 1MU2B 4PG7A 2YPYA 4Q8FA 2Q66A 3BQ2A 2MKCA 3NNHA 2UUBF 5K8MA 4N41A 2ROEA 1WG5A 2AT1B 2A18A 1SIWB 2NQPA 4KC5A 3K5OA 3E2EA 4RW7A 1MROB 4B3OB 1WC1A 4M5GA 1AZSB 2LECA 2XLJA 2PMZD 2BVZA 2EVZA 3DRYA 3HHLC 4QBUA 1NH7A 4DI6A 2OTLS 4OMFG 3O2IA 3H59A 4KB7A 1JJHA 1T9YA 1EAYC 2HGMA 1UA0A 3QLHA 3I5BA 2XTJP 1T02A 3SBMA 4F4KA 4JI8J 4HTIA 3L95X 2IAJA 1S7HA 3M32A 3TUZC 4DV2J 3BN7A 2HHXA 3EVWA 4UQTA 3IR5B 5A6PA 4LUBA 1FDDA 1U1QA 5KFYA 1CJKA 1FVQA 3WQPA 2CAJA 1SH3A 4PXBA 2V8GA 2CPHA 3T41A 2CQCA 4LF6F 4CO4A 4WFYA 3OVSA 1EKSA 3W60A 5DG9A 1S72S 3A8JA 2IA6A 1X4GA 4CLFA 3HHDA 4WJBA 1JLBB 5K8PA 1CSJA 3CJ5A 4K4XA 4AXIA 1FJCA 3NBPB 2OP5A 4ZPAA 2GMLA 3PO5A 1C4AA 5A6WA 1XEZA 3W64A 3DM2A 3CD5A 2D3UA 3V5RA 2FJWA 4LR9A 3GTYX 4ZVOB 4OHVA 1MWYA 2ILYA 1SQEA 2CQIA 1F9EB 4NOHA 5F0WA 2Y1RI 1S1VB 3D68A 1S79A 3UD5A 3IGVA 4O4RA 2Z56B 3X3UA 1OIAA 4AYBD 3FMBA 2F7VA 3H2LA 2QL9B 2G9OA 3W7BA 5AXMA 2FD2A 3IS9B 5KT2A 3V6DB 2QG9B 2GO9A 4F36A 3PHEA 1HNIB 4Y6IA 4DN9A 4ZP9A 1WHYA 3TZYA 4ECYA 4OYWA 3FGVA 4KH0B 2X7IA 1P27B 1BY9A 4A8QA 4ZLNA 4LSZB 3HDSA 3VR1A 4DL7A 3GFYA 4CLTA 5KFTA 3ENAA 1RAIB 4CYUA 2DNRA 1C1CA 4DR5F 3OVAA 3K2YA 3T1YF 5J2MA 2VPYB 4WU3A 1KVKA 2LCWA 3FMWA 5AE3A 1H7XA 2YWWA 3EGVA 1RHJB 4IRKA 3NLCA 2W9AA 4FS1A 3J81Y 2J6SA 3UO0A 4OHWA 2K7JA 1FRXA 1W2IA 4TU7A 4NLWA 2DEJA 3MCOA 1MMLA 2HFOA 5B0BA 3FEXB 4DQQA 1NKEA 5H1SV 1TKXA 2AJ1A 3CJ2A 2OPQB 3MDFA 2ZH2A 3GG0A 3CMQA 5CZXA 4DV3J 2V5HG 2WVEA 1M1KT 1ZAXA 2OMOA 2RSQA 3HZEA 4NLRA 4DR7J 4K50A 1S9EB 1RBOB 5B0EA 1HWLA 1NKBA 5A8RA 2DJWA 2VG7A 5THWA 2WOMA 2DR5A 5AJ3F 1P1LA 2DO4A 3MMBA 1D9FA 3AA8A 4USKA 3A8KA 2YBVA 3MPUB 4OX6A 5F3TA 3CJKB 4DU7A 4LF5J 1JLFB 2WVDA 3Q86A 4B3MJ 2LQ9A 2AJFE 3NOCA 4U8YA 4IKAA 1T3OA 3CO9A 1KLMB 5IT9U 3GE9A 1R0AB 3NRBA 5HROA 1ZZNA 5IT9Y 5E2QA 4U67Q 4IOAQ 2VDHA 4ZP8A 2WHOA 2V9KA 2FHKA 4HEA9 5T7LA 1HBOB 4YMEA 2R7OA 3IMQJ 3NGRA 1UVIA 1UEKA 4FS2A 2XZDB 1S1WA 1JJ2R 3EWGA 1YBTA 3H2VE 4MAKA 2KT2A 3MPVA 2DGVA 5BYSA 2H4YB 3MF5A 1AFJA 4RW8A 2X3DA 2DBBA 3QBCA 3S7RA 4UUXA 4QQBA 4Z2XA 4OYMA 1WKJA 2UZAA 3I31A 4DPUA 3W2WB 3MI7X 2N4DA 3DLLQ 4ES1A 3IBWA 1NDLA 3FRYA 1X4EA 4ZOSA 5M2PA 2VPWB 2GVDB 3BH6B 1D8ZA 3OTBA 4LF8F 4ICLB 2EBEA 3MM9A 3MMAA 3M2RA 1ZA1B 1RTHB 1N33J 1IM6A 3NL0A 2GAHC 4ETXA 1HNZF 2VL1A 2ZH9A 2OKQA 2W2OP 4LF4F 1SJRA 3ZZRA 1TU0B 1YBAA 2RQ4A 4O23A 1HQUB 5IC6B 3MPYA 1TVRB 4WE1A 1FRLA 4JYAJ 4PUOA 3QRQA 1PAUB 5FIIA 3PXGa 3ITHB 3DHXA 2WW8A 3CJQA 1RLCL 2ZH6A 3P5TL 4IH5A 3MUVP 2ZH5A 2DCLA 4QIWD 2HHPA 5KT5A 3T5KA 1IXKA 2H9ZA 3M2UB 3TJ9A 4ATNA 3HHNB 4PYAA 1S1TB 5KG0A 3UNGC 2R7RA 4ZJOA 4FYXB 3VGSA 5F3ZA 4ITSA 1H2UX 2CJQA 2JC0A 5K5MA 3BO3A 1F60B 2ZOFA 4DPYA 1YITS 1L3SA 5F8NA 2YKPA 2CDQA 1LNQA 4R5PA 2FJXA 3Q8VA 4PKDB 4IRCA 1UW4A 4LF5F 2J9DA 3QRPA 1HBNA 4QIGA 3RAXA 2AGOA 1QAXA 3AD8C 5FJ4A 4EBCA 3JQMA 4Y2MA 1QAYA 3QSIA 2R2UA 4JI1J 2DYAA 7FDRA 1J5OB 4WKYA 4LJMA 3K5MA 1R89A 4AT1B 3RBZA 4RUHA 3HVRA 4ZMMA 3E01B 2PC6A 4F3OA 5KFIA 2XZTB 5KFMA 4GC6A 2IC3A 2C2OB 2BANA 1IWAA 1GTEA 1X4CA 4ZS6A 5BXIA 4YB6A 4ZPTR 4RPFA 2MZJA 3MM8B 3NCQA 2R4FA 2X1AA 4CTAA 3VAJA 5CA5A 4OI2A 4ECVA 2F9DA 4JV0A 4F25A 1WELA 1HD1A 2Z30B 3PNIA 3TX0A 2ZH8A 1FCAA 4QW8A 5LMNJ 3ZTRA 1YZ7A 1Z2LA 1ZM4A 3GG1A 2W9CA 2FJBB 4L3KA 1Q4RA 3KNGA 4C48A 1MU2A 3RR8A 2HQCA 1NPRA 3L3CA 3BZQA 3NKYA 4ANEA 3FZBA 4UOHA 3UR0A 1OYDA 1MW7A 1X8DA 1QAIA 3SSSA 4HYKA 1U45A 2EC2A 4JYAF 2B9WA 2QJ3A 2QC3A 2F40A 5J2QB 4WK1A 1MROA 3FFIB 4I68A 4B3OA 5C42B 5D3GB 3RRHA 1IVZA 4ELVA 3QO9B 1AZSA 1SC4B 2QTWA 4FBUA 2NXNA 2CFXA 4Y00A 1BD6A 2BE2B 1PBUA 4LFAJ 1KFSA 4DV0F 2H4WB 4F7VA 1R0CB 1FI4A 3OTDA 1RT2B 3ZZZA 3RRKA 5U47A 1UL3A 4JI2J 3JTOA 5K8NA 4L75A 4OZNA 4ECXA 2IJNA 4OZ3A 4OYBA 1Q86T 1KC8T 2R7TA 1CJUB 2Z2ZA 3GJTB 2M8DB 4X4UA 3EPIA 2CNNB 5BR8J 2XNRA 1SUQB 4OJHA 2KFZA 1EP4B 4ZCMA 1GMVA 3BREA 3KUEA 2HNYB 3C46A 1SKWA 3H5YA 5KAKA 2RHSB 3D3BJ 1QY7A 3J7Z5 3M8YA 4Q43A 1JLBA 2YX4A 2IJFA 5AXNA 1V6HA 4IOCQ 3NBPA 2C2KB 1RAAB 1RACB 4XO0A 3N4WA 5DLGA 4OV1A 3G9CA 4NA2A 3PVXA 2UP1A 1RE1B 3DC2A 4L72B 4WFAQ 3W8GA 1FRIA 1FK9B 1S1VA 2W4DA 3BKUA 4PABA 3TUPA 1RTIB 2V4JB 3O44A 4MIAA 2AU0A 2HSEB 1T9TA 2KO1A 4FF2A 2FHJA 4XPCA 1RAJA 3HFZB 2X1FA 4FVCA 2Y1IA 3PYFA 3VTIA 3IS9A 4N47A 3V6DA 1VOMA 1WDTA 1YI2S 1J2VA 2XO7A 3J7YI 1JNZB 4PR6A 1HNIA 2DB1A 3R9LA 4YFUA 3IR6B 2G2YA 3OTCA 3PW7A 2CVEA 2EFNA 2A6MA 5LSOA 2HFUA 5ETTA 1AYEA 4C4WA 4WZMA 2CPZA 3MCSA 1CJVB 2EKYA 2MMYA 1YZ6A 2DNMA 1UPPA 2CPXA 3D67A 2EG1A 2DXFA 1O5JA 1OY6A 4EU0A 3ZZPA 3M8SA 4RUBA 2VODA 1VRQC 3GCXP 2C3MA 4K2XA 4YS2A 3MMJA 2UVWA 1WG1A 3I6PA 4GRSA 3I87A 4ZLJA 2OELA 3MM7B 3DGPB 2PFFB 1OJ4A 7AT1B 1D8YA 4YHHJ 1WF0A 3KDNA 1URRA 5EUHA 1KD1T 2YPZA 3HMJG 4HH1A 4JI2F 5H9EJ 2HGNA 4UT4A 3IP0A 2OPQA 2DNKA 4K4SA 4Q8EA 2DISA 4DQRA 1F3VA 2G4BA 2R8JA 1S9EA 5BR8F 3P96A 5KFWA 2XS7A 4F26A 3LOUA 4UZBA 2MPUA 1U1RA 2XMVA 3HSGA 4LBHA 4BC9A 3POTB 4IYQA 2YKOA 3L7PA 2R7SA 2FTRA 1BE4A 1FFSB 1CBKA 1SC1B 3CJKA 1P9YA 3A1YG 1SQGA 2IVFB 1JLFA 3NMRA 4C8OA 1OPIA 2PI4A 1RA6A 2ZWPA 4DSLA 1F5CA 4NPOA 3I96A 1H7WA 2QLBB 3NG8A 2I1RA 4DPOA 1KLMA 5ADZA 2DR9A 4ZVEA 2NLWA 1R0AA 4K4WA 3U1MA 2MKJA 1X0PA 3UN2A 4JI3J 1HBOA 5KFLA 3BR9A 3IC1A 1JLQB 2VIHA 2E1MC 3GV5B 4QWDA 2E5IA 2PA3A 3F44A 2E1PA 1IKXB 2PDAA 5DRKA 2UXCJ 1NUEA 3KUHA 3OL6A 2H1YA 1LFWA 1MLAA 1HWUA 3RB6A 1U26A 3DLHA 4HHHA 1Y5LB 4UQGA 4ECUA 4Q5VA 1VLYA 4WK3A 4OHZA 1J5EF 4EFAC 4LT6A 3W2WA 3VV2B 3UW1A 3BDPA 3MD1A 1MNEA 4BC7A 2GVDA 2G0IA 1TL3B 2CQ1A 2IBOA 4ICLA 3O6QA 1T03B 2VG5B 3ENVA 1BMQB 1RTHA 1UVMA 2AGQA 1N8RT 2HFZA 2BV3A 2PMHA 3Q83A 1IBMF 2BW7A 4UY85 3CJRA 2ROPA 4W92B 3NGTA 1B70B 1HQUA 1TVRA 2RU9A 4X4PA 4YHHF 2ZEJA 3RBEA 4XDDA 1JJ4A 4KSEB 3P45B 3ITHA 3FEZA 4DQPA 1ZYQA 2R9LA 3BQ1A 3IFEA 2V2VA 5K9FA 1VBZA 4FYVB 1GH8A 4CO3A 2ZBCA 3EVOA 3M2UA 3G8TA 2ZBPA 2ZNYA 1S1TA 1WJ9A 4HTJA 1GXLA 2NPIA 1XQIA 1HIYA 2O67A 5ETMA 1Y11A 2GNKA 2AZ3A 4LQ3A 3HT3A 4IRDA 2DY9A 4OL8A 4M5DB 1O0PA 2CJAA 4KBIA 1VC6A 4Q2MA 2BX6A 2DGOA 1NBEB 4QZVB 3EZUA 1HHQA 1EHWA 4DXLA 1J5OA 4RJVA 3G6VA 2NCKL 4F4XA 1VQ8S 4FF3A 3E01A 3HKWA 2VQEJ 1KQGB 2GJIA 3DYAB 4IG0B 2IRUA 3NEKA 3QT5A 1XIQA 1U8SA 1URNA 3MM8A 4KHMA 3Q2TC 2UU9J 1JJCB 2KG0A 2UV8G 3TA0A 2F65A 4I0WA 5LL6d 2V8DA 4DLGA 2QT7A 1TAQA 1RT1B 4RNNA 1P8GA 1R8AA 1UZHA 3UDLA 2AEMA 2W8KA 2MKHA 2H65B 2HHTA 1RKIA 5ETNA 2QRRA 3MPWA 3UN5A 4QWBA 3VZIA 2HIQA 3SIPB 4JI5F 3BJYA 2V8HA 2ZE2B 2FJEB 5HQLA 2CKWA 4CM0A 4OLPA 2MZSA 1QE1B 2KYXA 3UDVA 3CDWA 4OJ3A 3QNWB 2ADCA 4DR2J 4OI6A 2Z57B 3KLGB 4DL5A 4MYUA 2Q6CA 5J2QA 2YQ1A 3FFIA 5C42A 5D3GA 3MGJA 1RYSA 3M1VB 4YP3A 3QO9A 4ZVHA 4V19J 3N6LA 2AX1A 4OX7A 3BS9A 4C8MA 5E3AA 3T5HA 2HRYA 3R5BA 3DLKB 3NGDA 1U2CA 2BE2A 2DD8S 3QAEA 3MURP 1LW0B 2ZM6F 2WVCA 4LF7J 1VRTB 1LWXA 2HS3A 3RYLA 2IBKA 3FBEA 1WHVA 2RKIB 2AF6A 2RH3A 3CJTA 1AUDA 1WSRA 4WFXA 1CJUA 4NLXA 1OY9A 1IKVA 3QIDA 4G3IA 4B17A 1WACA 4K0KJ 1SUQA 2ZBRA 4BCAA 2FJAB 2C42A 1EP4A 2EWHA 2HNYA 3PKYA 4QJVA 2AEJA 2YKAA 3DU5A 1PO6A 3AAWB 5B0AA 2VQEF 4ED3A 4DV4F 1WORA 4KT0C 4ECWA 2DH8A 2R2TA 1OY8A 5ETKA 3M8QB 5ETRA 1FXRA 2V0NA 2MKIA 4HLBA 2AYGA 3GP9A 2DEIA 5HBMB 3WIUA 2QL5B 2NUUG 1N34J 3HFKA 2KU7A 4OX9F 3PFEA 2YX1A 2BRLA 4M5KA 3HJFA 3IRWP 2DHAA 3TOQA 2OD6A 1BGXT 1FK9A 1S7IA 1TFYA 3LGMA 1RTIA 2V4JA 2E7VA 1SH2A 5K14B 5M2UA 2W9BB 2PEHA 3CCTA 1TP7A 3KLHB 3WZ0A 4DR3F 5GMDA 3H40A 2CQ4A 5D77A 1SBRA 1NEEA 3JAMU 1P9QC 1H73A 3Q89A 3BSOA 3JAMY 3K7RA 1FRJA 4HI2A 4J7CA 2KHCA 3ETOA 4LMZA 1FO1A 3SYZA 3IGNA 2G13A 2QFJA 4FXDA 2DRAA 4I69A 3MR2A 1K0VA 1CJVA 4MTPA 1KRPA 4OYOA 5FD1A 2GAGC 4IO9Q 3L9ZA 3UCZP 2JC1A 3EZOA 4JI6J 4U7CA 2XLIA 2CZ4A 2KFNA 3GFHA 1Y3KA 4UF4A 1U0SA 3QAUA 3RRGA 4ECTA 3PYGA 5GAGU 4IR1A 4LRFA 2CJBA 1I5OB 4DR6F 1RI7A 3MM7A 3DGPA 2EXUA 2ZVSA 1JLGB 4JB8B 4EK2A 1HQEB 1FJEB 3I56S 2DRDA 2N4CA 1I51B 1UFLA 4ZJLA 5ETOA 2DR7A 4MYTA 3VAMA 1XTZA 3OSNA 3K89A 2FIUA 1VGYA 1RT7B 8AT1B 2QLFB 1QDUB 2FLLA 2QA1A 1UEUA 2J9EA 4FNHA 1U47A 2DPJA 3KUGA 4M94A 2LQ5A 3AH6A 4GC7A 2B9EA 3F41A 2W7AA 3POTA 1RWOB 2AMCB 4WXWA 4TYAA 3VQTA 3HZGA 3P4UB 4Y28C 1H38A 2WVBA 3CJ4A 1YIJS 9ATCB 1YGYA 5F8MA 4RKUC 5F9NA 1RU2A 1HFEL 2CPFA 4H54A 3AODA 3TQEA 3M9MB 2RUSA 4CLZA 3PW4A 1UFWA 2WB4A 1WD6A 3W8PA 4NXNF 1T95A 3OPKA 2XZWA 4JBCA 3M6XA 1TMMA 2YH1A 2RQMA 2LQ8A 3MTJA 1N32J 3J81j 3PCOB 4QR1A 4DMZA 2Z2MA 3AD9C 1KLNA 1JLQA 4CDIA 5DDQC 2LQJA 1S48A 3BYRA 3D0HE 2YKQA 3SV4A 1IQZA 3TANA 4ANDA 3RJMB 2J8AA 1IKXA 3TZZA 2CADA 5KFFA 4WFBQ 1S6OA 3QGGA 4Q0BB 2B4PA 3GZ7A 3CJ3A 2KFYA 5G0RB 2OEJA 1YX2A 4TLRA 3VAIA 2ZD1B 2Y3YA 3ZO7A 4KPCA 2J9DE 3GONA 2HHUA 1S5ZA 3EPGA 1R43A 1HBUB 2KRRA 3W9JA 4J9RA 1UWAA 1TL3A 3Q8SB 1Y5IB 3GB0A 5DQIA 1T03A 4JI0F 2VG5A 1UP1A 1QVGR 1N88A 2YQ3A 3HJVA 4EBEA 5KG7A 4HL9A 4MKVA 1VQSA 5HANA 4X66F 2UVUA 3TRGA 4QU7A 2L9NA 4TU8A 1FDBA 1UKUA 4ILRA 1M5KC 3W61A 2LP4A 5T14A 4B9LA 2XMWA 3LANA 1IR2A 2E5LF 1EB0A 3AOAA 2ASDA 2JDJA 3PTWA 4YDXA 1NK7A 2VQFF 3G96A 1H98A 2HVIA 4FXWA 1Q95G 5FDLB 4U7UK 4YUDA 1DJ0A 3R5CA 1RAHB 2CZ9A 3R1HA 1XNQF 1KVIA 3SCIE 4EEYA 2HWTA 4YDDB 1PSDA 2QX0A 4OYAA 4ECSA 4M5DA 1FX2A 2WTFA 1PC5A 3T3FA 3QJLA 2E9ZA 3D9BA 1PILA 1X5PA 1JXEA 2WBRA 1K1QA 1EIYB 2VA2A 4D3GA 3WC2A 3H20A 3VWSA 5B7WA 2FLNA 5LT5A 2EW9A 3GYNA 4LR7A 5CYMB 4DSIA 1G6BA 4RO0A 3T1AA 5KG5A 1FRHA 3DYAA 4IG0A 1FTCA 4N8OA 3FBBA 1U6BA 4WPAA 2RE1A 3I4HX 3Q0AA 4KQZA 4ZIVA 1QLNA 1A9NB 1KEKA 4WYLA 2Z8QA 5GVQA 1A7GE 5IT0A 1X9WA 1RT1A 1FWLA 4DV6F 2G0JA 2KJWA 4O3PA 4AFFA 1VK8A 4DFPA 4TKTA 1GX5A 3R5JB 1HI0P 4C3MA 4A8FA 4DX5A 2VFVA 1UVJA 4C8LA 4EI2A 4UOGA 4G1QB 5GAHU 1S97A 3S8SA 2DIUA 2V68A 2ZE2A 1S6UA 2FY1A 4C2MA 2BOAA 2BE9B 4GVBB 2XS5A 4UZCA 3G87A 4CQ1A 3SEOA 1QE1A 4CLLA 4LREA 4CT9A 2GJ2A 1YBUA 1VQLS 2W7OA 1KOOA 3MXHP 3D5MA 2FVQA 2QMWA 3T5LA 5J2PB 2IYGA 2XYPB 1N0UA 3TAQA 3CCVS 3KLGA 3UD3P 3IR7B 4N8NA 1YRTA 1CPZA 4IFYB 2H5EA 5LSRA 2HNZB 3M1VA 2JZ5A 2QA4S 3DFEA 2HLTA 5HMWA 4NLYA 2EPIA 5GAEI 3DLKA 2HVZA 2MZQA 4G6VB 1GAOA 3KK1B 2JH3A 1LW0A 4ZPCA 3KHGA 1N48A 2NR0A 1VRTA 4N77A 4ZVUB 2RKIA 2ZH3A 4X65F 1GMUA 4TY8B 2PA8D 2IRXA 5HP1B 1OYEA 2XQCA 2WW4A 4CLUA 1PKUA 3B54A 3D1QA 5J2NB 3N0VA 3N28A 4J9NA 8ATCB 2V69A 4ERDA 3QZ7A 2DH7A 4DL0C 1T3NA 3TWZA 4B9NA 2RDJA 3B82A 4ETZA 4OI0A 2DNNA 3G6XA 4DLEA 5LMUF 4PEOA 5AXKA 1DLOA 3P5BP 1UMJA 4DWIA 3OTOJ 3M8QA 1RAFB 2JLGA 3UE2A 2CZVC 4OYXA 2MB0B 4LBIA 1TUWA 4WZQA 5HBMA 3NCRA 2V2ZA 3J7AN 3H4DA 3O8WA 2F3JA 1GQEA 4NLTA 3DOLB 3RB4A 1Q8BA 5B09A 4HVZA 4P74A 4J9QA 1HNXJ 2XEXA 2QA4G 3M30B 1HI8A 2G0CA 2PO4A 4BLGA 4NCBA 5K14A 2BDPA 5DQHA 2W9BA 1CJTB 3SQOP 4F4YA 1H3DA 3KLHA 5KG1A 2D3O1 2KM8B 1L3TA 1DFDA 2CG8A 1K44A 1FX4A 4NXMJ 3LPYA 1R0BG 2XYHB 2CYYA 2D3OR 4NCAA 1M1GA 4X4TA 3O1LA 2MSSA 1U09A 3GU0A 3LWMA 2YWFA 4KTQA 2FLPA 5A0YB 4X2BA 4E2FB 2J0XA 2APOA 5D0GA 3MEEB 2MJUA 2Y8WA 4ES3A 5E7OB 1F2GA 3EUNA 3BN4A 5KFJA 1UJ4A 3WHIA 3ELHA 1S4FA 4EYHB 2SXLA 3VAKA 1RJJA 2RB7A 5C2GA 3H4BA 5DS7A 1DURA 2JEGA 1JLGA 1ZM9A 1HQEA 4ZVGA 1RTJB 2Q79A 3CMAS 4WXOA 4DUYJ 4CO0A 2Z58B 1VBKA 1IWGA 3JQKA 1O51A 4B9SA 1D0EA 5D4LA 2G2OA 1RT7A 5IC4B 3VCDA 3ZZTA 4I6AA 3AXKA 1WI8A 1ZM2A 1LW2B 1VYAA 4EO8A 3QRRA 1FVSA 1UCNA 3TA1A 1RWPB 1XNRF 2BA9A 4QPXA 2HIYA 4ZVRB 2GIQA 2DHGA 3OUYB 2B9XA 3CT9A 2F4FA 5F8JA 1ELOA 5KFBA 2YKNB 1PC4A 2LEBA 1C0UB 2WVFA 5F8IA 4DF8A 4ZHRB 5IV4A 1X60A 2VBWA 4LF9J 1P1TA 1NJYA
chains in the Genus database with same CATH topology
3W1YC 3D3CJ 4X66J 2UUAJ 2HHHJ 2MTLA 4OX9J 4DR6J 5A2QU 4DR5J 3JAMU 4LF8J 3J7AN 3D3BJ 5LMUJ 4DV7J 3IMQJ 3T1YJ 4JYAJ 2ZM6J 4DR1J 4AQYJ 1HNXJ 3T1HJ 4PWWA 1J5EJ 1HNZJ 4K0KJ 4GKKJ 4LF4J 4JI8J 4JI4J 5LM7E 4V1Ak 4DR3J 4DUYJ 4DV1J 2E5LJ 4RJVA 4JI7J 4DV3J 4GKJJ 4DV2J 3R2DJ 2UXBJ 4JI3J 2VQFJ 4KYZA 4DV5J 4DR7J 1IBLJ 4NEYA 4LFAJ 4DR2J 3J80U 4JI5J 1HNWJ 4KY3A 2UUCJ 2VQEJ 5FLXU 4YHHJ 1XMOJ 4NXMJ 4JI6J 2UXDJ 4YY3J 4DV6J 4B3SJ 4X64J 2KL8A 1IBMJ 4HHUA 1XNQJ 2MEWA 1N36J 4JI2J 2KVQE 5LMNJ 1I94J 4DR4J 4X65J 4B3RJ 1N34J 4X62J 2UU9J 4B3TJ 2UXCJ 4DV4J 3J81U 4LF5J 1N32J 4DV0J 4B3MJ 1XMQJ 3R2CJ 5IWAJ 4JI0J 4LFBJ 4JV5J 5BR8J 5AJ3J 2MQ8A 1N33J 4NEZA 1IBKJ 4DUZJ 1FJGJ 2F4VJ 4KHPJ 1XNRJ 4LF7J 3OTOJ 4LFCJ 4JI1J 1HR0J 5IT9U 4LF6J 4NXNJ 2UUBJ 4LF9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1Y C;  3D3C J;  4X66 J;  2UUA J;  2HHH J;  2MTL A;  4OX9 J;  4DR6 J;  5A2Q U;  4DR5 J;  3JAM U;  4LF8 J;  3J7A N;  3D3B J;  5LMU J;  4DV7 J;  3IMQ J;  3T1Y J;  4JYA J;  2ZM6 J;  4DR1 J;  4AQY J;  1HNX J;  3T1H J;  4PWW A;  1J5E J;  1HNZ J;  4K0K J;  4GKK J;  4LF4 J;  4JI8 J;  4JI4 J;  5LM7 E;  4V1A k;  4DR3 J;  4DUY J;  4DV1 J;  2E5L J;  4RJV A;  4JI7 J;  4DV3 J;  4GKJ J;  4DV2 J;  3R2D J;  2UXB J;  4JI3 J;  2VQF J;  4KYZ A;  4DV5 J;  4DR7 J;  1IBL J;  4NEY A;  4LFA J;  4DR2 J;  3J80 U;  4JI5 J;  1HNW J;  4KY3 A;  2UUC J;  2VQE J;  5FLX U;  4YHH J;  1XMO J;  4NXM J;  4JI6 J;  2UXD J;  4YY3 J;  4DV6 J;  4B3S J;  4X64 J;  2KL8 A;  1IBM J;  4HHU A;  1XNQ J;  2MEW A;  1N36 J;  4JI2 J;  2KVQ E;  5LMN J;  1I94 J;  4DR4 J;  4X65 J;  4B3R J;  1N34 J;  4X62 J;  2UU9 J;  4B3T J;  2UXC J;  4DV4 J;  3J81 U;  4LF5 J;  1N32 J;  4DV0 J;  4B3M J;  1XMQ J;  3R2C J;  5IWA J;  4JI0 J;  4LFB J;  4JV5 J;  5BR8 J;  5AJ3 J;  2MQ8 A;  1N33 J;  4NEZ A;  1IBK J;  4DUZ J;  1FJG J;  2F4V J;  4KHP J;  1XNR J;  4LF7 J;  3OTO J;  4LFC J;  4JI1 J;  1HR0 J;  5IT9 U;  4LF6 J;  4NXN J;  2UUB J;  4LF9 J; 
#chains in the Genus database with same CATH topology
 3TVK A;  2MQP A;  2ATL A;  2FY8 A;  4ELU A;  1GXT A;  2QFI A;  3BF4 A;  3A8I A;  3QT7 A;  3UD4 P;  4ZDN A;  1HNX F;  3D7S B;  3M8P B;  4KFB B;  2WSF C;  1FEH A;  2CWX A;  1K47 A;  3UR3 C;  1DRZ A;  1X0F A;  4FF1 A;  1N36 F;  1S4E A;  4P2X A;  4DSF A;  2FC8 A;  2OFH X;  3RBD A;  1NK0 A;  2XYG B;  2HZA A;  5KFQ A;  3WDO A;  1IBL J;  3MM5 B;  3GV8 B;  2PT0 A;  5HMX A;  5HO4 A;  3ZNU A;  4Q0B A;  1Y00 A;  2KXH A;  4RBT A;  1RLD A;  1RZM A;  2FHM A;  5G0R A;  3LP2 B;  4PXC A;  2OI2 A;  2ZD1 A;  3VAL A;  1Q8K A;  3ZXW A;  1YLX A;  5IQQ A;  1FDA A;  2BJ8 A;  2XY5 A;  4TQR A;  1A0O B;  1HBU A;  2OTJ S;  2MZR A;  2MLX A;  2GQ2 A;  2QSW A;  5C2C A;  3PR4 A;  2HHS A;  1WOS A;  2HWH A;  5IQ6 A;  1RYR A;  2KN4 A;  4C0O C;  3KFW X;  3RAM A;  2JVO A;  1FJ7 A;  3SCL E;  4CI0 B;  1JX4 A;  2OO4 A;  5KT7 A;  2EFV A;  3GIM A;  3QGP A;  2IM0 A;  3OXG A;  2UUC F;  1GT8 A;  2KTQ A;  3QFH A;  2MQL A;  2H48 B;  4YY3 F;  4GKK J;  2AJ4 A;  1X9M A;  2AYM A;  4LRD A;  3VQS A;  2ILZ A;  3ILJ A;  3P49 B;  2DK2 A;  2VOP A;  4G1P A;  1TK8 A;  2P6S A;  1N5T A;  1QM9 A;  2YNI B;  1KHW A;  2XI2 A;  3H5U A;  1H0H B;  3FBC A;  1S1X B;  3W5X A;  1ACM B;  2DIT A;  2EC0 A;  5FDL A;  1D09 B;  4ILL A;  2CA9 A;  3DOM B;  3B4D A;  4OJG A;  2WZ1 A;  5F41 A;  1U1P A;  1RT3 B;  2GGP B;  1NAQ A;  3NP5 A;  2NRE A;  3A13 A;  3FSY A;  3GLJ A;  4QW9 A;  1TKZ B;  2B43 A;  2X1G A;  2PE8 A;  3V81 B;  5IXU A;  3CED A;  1VK3 A;  3C6T B;  2LU2 A;  2VON A;  2E9R X;  2D74 B;  4A4J A;  3N6M A;  4WU2 A;  4GKJ J;  3KK3 B;  3JYT B;  1YK9 A;  2KZZ A;  5J1P A;  1RHM B;  2V2Q A;  2FGC A;  3FC9 A;  2YNH B;  5DGB A;  3N9U C;  5K8O A;  5CYM A;  4C8Z A;  3A3O B;  4NLG A;  1Q1K A;  2I0X A;  5CYJ A;  1MMN A;  1VIX A;  1K9M T;  3NMA A;  4JI4 J;  4Y65 A;  2K3K A;  3G6E S;  5EDW A;  3VAH A;  1IBL F;  1T9X A;  5HAT A;  4B3T F;  2ZJP Q;  3ISN D;  3C8Y A;  2CQP A;  4Q2L A;  4I7F B;  3WX4 A;  2KT3 A;  5KFZ A;  2I38 A;  1FNX H;  3CD0 A;  5EWE A;  1VQM S;  2BQU A;  2KB2 A;  2WK4 A;  1Q82 T;  2DTJ A;  3N5B A;  2P6T A;  4HH0 A;  1ZM3 A;  2FZC B;  2J6U A;  5L1J A;  1LK7 A;  1VC5 A;  2W8L A;  2DGS A;  4G1Q A;  3D28 A;  4C0B A;  2DGQ A;  1KNZ A;  3KJF B;  5LXR A;  4GVB A;  4M8L A;  2XSJ B;  2HBQ B;  1PYT A;  1RIS A;  3CCZ A;  5J2P A;  2QV6 A;  1P6T A;  3G2X A;  2GMJ A;  2XWY A;  2DH9 A;  4GKK F;  1VI7 A;  3L7U A;  4IFY A;  2HNZ A;  4N76 A;  4NRU A;  4ILM A;  4A47 A;  4DV1 J;  2XY6 A;  4RU2 A;  2PEB A;  2KYZ A;  3PDN A;  2ZZM A;  3GJS B;  1FKP B;  3GIL A;  2KZM A;  1TEL A;  2KDO A;  4C6A A;  1AA1 B;  1TK5 A;  1SKR A;  3KK1 A;  2PI5 A;  4LRA A;  1G4C A;  3KMS A;  2L48 A;  2WAQ D;  1T9W A;  1T94 A;  3KJV B;  2LFV A;  5DG7 A;  4TY8 A;  2W2M P;  3QQC D;  5DM6 Q;  2MKY A;  5HP1 A;  1H74 A;  1R8H A;  1CC8 A;  5J2N A;  1X5T A;  1QJH A;  3C16 B;  4GKJ F;  3ZNJ 1;  1NSA A;  1TL7 B;  1DY3 A;  3I4P A;  2E1C A;  5T41 A;  1AUS L;  5I42 B;  1OS5 A;  1TL4 A;  2EFP A;  2O5D A;  3JB9 k;  2XUL A;  2AYE A;  4KJI A;  1V3R A;  4CLS A;  1PGZ A;  4OI4 A;  4I64 A;  1SV5 B;  4CIO A;  1W26 A;  4EBD A;  4TN2 A;  2C3Y A;  3S1T A;  2IYI A;  5IOL A;  2B0G A;  2A2C A;  5E3R A;  1SKU B;  3D4J A;  4DZD A;  2PD1 A;  3D66 A;  2LXF A;  2F63 A;  2QMU B;  4EUV A;  1LWC B;  1JLC B;  4L74 A;  7FD1 A;  1QD1 A;  3DOL A;  1H2T Z;  3V4M A;  4UTG A;  4DX7 A;  3DRP B;  5F8H A;  1MWQ A;  4ECR A;  1FKO B;  4U96 A;  2BYC A;  2IVY A;  2BEF A;  2R3V A;  1VQ5 S;  1CJT A;  5HI7 A;  4FBT A;  1N0V C;  1IJF B;  1C4C A;  2XWX A;  5IWA J;  3LWL A;  4G65 A;  4WTY A;  1RAE B;  2VFS A;  2BJE A;  1RWV B;  3GIK A;  1HQ2 A;  5BYR A;  5F9L A;  1XJW B;  1R31 A;  2LMI A;  2R7X A;  4DSE A;  2AKW B;  5J1E B;  2DCU B;  2D1C A;  3GFZ A;  1PJ7 A;  4DU8 A;  3Q8P B;  2BM0 A;  4CH7 A;  2HBR B;  1B7Y B;  5A0Y A;  2CQB A;  1MN7 A;  4A8K A;  3MEE A;  2VG6 B;  4Q45 A;  3HVT B;  4ZP6 A;  1IKW B;  4Y2C A;  2YH0 A;  1U1O A;  1B99 A;  1YKW A;  4DR4 F;  5LJ5 Y;  3M6V A;  3CUL A;  1OO0 B;  3K59 A;  2HQF A;  5KFK A;  3DRS B;  4URG A;  2V50 A;  2KXN B;  5KG6 A;  2YNF B;  1RDR A;  2Y1L B;  2LKZ A;  2XMJ A;  2ZBQ A;  1NK5 A;  1RTJ A;  5L38 A;  2PMW A;  1KTQ A;  3KJQ B;  1VHI A;  4QIE A;  1XC9 A;  3K58 A;  1EQM A;  4OI1 A;  3AOC A;  1RTZ A;  3CDA A;  3TZW A;  4DR1 F;  3IA0 A;  2F4V J;  1LW2 A;  4MIW A;  3EJM A;  1U2R A;  1FFW B;  5DDP C;  3OUY A;  2CUY A;  2VPZ B;  4P7T A;  5I4M A;  4RW9 B;  2Q6B A;  2YKN A;  4DPX A;  2R8H A;  1G7C B;  3KG0 A;  1N5Q A;  2PII A;  1C0U A;  4R0E A;  2RS2 A;  4MK9 A;  3UCU P;  1JK9 B;  1ZPW X;  1KVJ A;  2ZUG A;  4ZHR A;  1NU4 A;  3PW0 A;  3GQC A;  2HUR A;  3T5J A;  3AB2 B;  2UXB J;  1NLK L;  4IR9 A;  4HT5 A;  1IR1 A;  3N5F A;  3US5 A;  2RHQ B;  3FQK A;  4CO2 A;  3KYL A;  5A8W B;  2VUG A;  2YXL A;  3M8P A;  4KFB A;  4HHU A;  4U7U D;  1HKA A;  4EO6 A;  1HWJ A;  5DJB A;  3THV A;  4BDP A;  3OLA A;  1XK8 A;  2MYF A;  3H2U B;  2L9D A;  1OSD A;  2W2Q P;  3HI9 A;  1U1N A;  3J81 U;  3JSY A;  4O3N A;  3RW6 A;  2W01 A;  1S10 A;  2XO6 A;  3MM5 A;  1G1X A;  3MAQ A;  2HKE A;  3GR1 A;  1HR0 J;  5BYQ A;  4B9U A;  1QTM A;  3LP2 A;  3UQS A;  4JI8 F;  4LSN B;  2GQQ A;  5CAA A;  2WON B;  3PEJ A;  1KQF B;  2AJ2 A;  4DV2 F;  3DLJ A;  1REV B;  3R6G B;  2IDE A;  2Z4P A;  1NH8 A;  4ZN3 A;  3IM8 A;  1T8E A;  3BH7 B;  1WDD A;  4K4U A;  4K4V A;  3GJQ B;  4FP9 A;  2FVP A;  5DM7 Q;  4KH1 B;  4MKY A;  4PWD B;  2OPR B;  2R7V A;  2MQM A;  4M5L A;  3MR5 A;  3R5G A;  3GMG A;  2ZH7 A;  3IM9 A;  1VHF A;  4P7V A;  1HHS A;  2R42 A;  3D6T B;  1BWV A;  1FRK A;  4CCH A;  3N6N A;  5I3P A;  2DGX A;  5DLF A;  1MN9 A;  3GR0 A;  3P6Y C;  2HYI B;  2WBM A;  3LGN A;  3VAF A;  4F4A A;  4QIF A;  4P52 A;  3SI8 A;  4BHQ A;  2VIC A;  4B02 A;  4USM A;  4QYZ J;  1TMJ A;  3A8E A;  4RX6 A;  3FKB A;  2F1F A;  4OLO A;  2YNI A;  1YTY A;  2E5H A;  3R1L A;  5H9E K;  1S1X A;  2CVI A;  1IBK J;  5KG4 A;  3MAA B;  2ZHB A;  1PYO B;  3DOM A;  3H5X A;  4BS2 A;  3SFU A;  2WRM A;  2ADB A;  2BM1 A;  2DRB A;  2JWN A;  3MUM P;  2J5A A;  1N5S A;  2DNH A;  1LOU A;  1V5I B;  1XBW A;  4J91 A;  4P2F A;  1RT3 A;  2GGP A;  3WIV A;  1TV6 B;  4ED2 A;  2MXY A;  2E66 A;  4FDF A;  3KG1 A;  4RWW A;  1NKC A;  3V81 A;  1NHU A;  2RJZ A;  3C6T A;  1HNV B;  4ZKA A;  3CC2 S;  3TVZ A;  3KK3 A;  5ETQ A;  1HD0 A;  1NK8 A;  3JYT A;  1UTA A;  1Q7L B;  2YNH A;  3K0J A;  2I6W A;  4ZPW R;  3CD7 A;  3CDB A;  5JVG Q;  5HL7 Q;  3Q22 A;  1TFW A;  1HI1 A;  5EX0 A;  3FJ2 A;  2K1R B;  1MWZ A;  1FE0 A;  3BDE A;  4B9M A;  1RAO A;  1WC4 A;  1WHX A;  3M6W A;  2OEK A;  4C8K A;  2VBZ A;  2DY1 A;  3EMT A;  1GEH A;  2Z0G A;  2ZC4 A;  5H9F J;  3KMQ A;  5C25 B;  2AX0 A;  4PQA A;  5AXL A;  1TR0 A;  2VA3 A;  1HR0 F;  2B8P A;  5DQG A;  2RQC A;  4I7F A;  3MWB A;  2MKK A;  1TK0 A;  1F5B A;  3OSP A;  2ZUA A;  5EWF A;  5F0U A;  4KRW A;  4Y2K A;  4DV3 F;  3GII A;  3PHT A;  1B3T A;  4IQX A;  3E8O A;  2HVE A;  4DR7 F;  3BSA A;  4AQY J;  2CNL B;  3SCJ E;  5AE2 A;  1TKD A;  1NJW A;  5KFO A;  4WIQ A;  1XR7 A;  3K8W A;  4C98 A;  2V4R A;  3M6U A;  5L1K A;  5MAO A;  2VAS A;  3ZC4 A;  1WG4 A;  3OFH A;  3UDE A;  1NJI T;  4NLP A;  5RUB A;  1SC3 B;  1VIS A;  2FZG B;  2XSJ A;  4CLP A;  1S77 D;  1RBL A;  4B3M F;  1Q78 A;  2FGO A;  4DSK A;  5ETL A;  1Q79 A;  2LYV A;  2ZH1 A;  1C1B B;  4LF1 A;  4OYI A;  2DNZ A;  1WWH A;  1KSP A;  2R8K A;  2MQO A;  2NZC A;  5A8K B;  3WBZ A;  4ENO A;  2XBP A;  3ULH A;  1FNO A;  1S59 A;  4DOZ A;  1XMQ J;  1FKP A;  4KO0 B;  1WNE A;  3R7B B;  4JV5 J;  2E9T A;  3B6B A;  5D0H A;  5I3U B;  4PAA A;  1RWU A;  3Q24 A;  3D2W A;  4LFC J;  4PPD A;  4ZCK A;  3UNY A;  3OFF A;  3R6L B;  3IG1 B;  4WWS A;  2MQN A;  1RT6 B;  1FE4 A;  1UET A;  2HS4 A;  1IN0 A;  3KJV A;  3LP1 B;  1ZOT A;  2Q1L A;  1HMV B;  3RU0 A;  1YJU A;  4RLE A;  2VC0 A;  1NPP A;  4F0K A;  5C24 B;  2BZ2 A;  2M2B A;  2DR8 A;  5EX3 A;  4OZ5 A;  4TU9 A;  4NI2 B;  3C16 A;  4QR2 A;  4FYW B;  3HHK A;  4CT8 A;  5EN1 A;  1FKA F;  2GIR A;  3B8H A;  5F8G A;  5I42 A;  1OQ6 A;  4P71 A;  4G1I A;  5D78 A;  2ZVI A;  2LA6 A;  2DNG A;  3AJD A;  2L9W A;  5LXY A;  1N33 F;  5A76 A;  1SV5 A;  3PRB A;  4LF2 A;  2OSQ A;  3DDN A;  1RSC A;  3TZX A;  5HSP A;  1BQN B;  1L3V A;  3G71 S;  5J2M B;  2ZKU A;  2MDA A;  4F2S A;  4NML A;  1LWC A;  1R3N A;  1JLC A;  4DUZ J;  2B6A B;  4LIW A;  1ITP A;  1NB7 A;  2XMU A;  1AB8 A;  1WEX A;  3DRP A;  4FNI A;  1FKO A;  1X5O A;  4CNZ A;  2HHH J;  3IAM 9;  1KFD A;  4ZPV R;  1RWK B;  5A2Q U;  2GV1 A;  4WF9 Q;  5A2Q Y;  1F9H A;  4OYZ A;  4W90 B;  3AY0 A;  2J76 E;  5JVH Q;  2KVI A;  2OAU A;  2H5J B;  2DO0 A;  2CPJ A;  4ED6 A;  1REG X;  5J1E A;  2DXD A;  3H98 A;  1A6L A;  4WTO B;  1Q16 B;  2DGU A;  2EFG A;  4F3M A;  5GME A;  2VG6 A;  1DQ9 A;  3HVT A;  2CJX B;  4JI1 F;  2OJ3 A;  3KNA A;  1IKW A;  1NCL A;  2E7X A;  2GA7 A;  5SZT A;  1AXQ A;  1NHV A;  3A3N B;  2XY7 A;  2LXU A;  3DRS A;  4CZC A;  3TJA A;  1KN6 A;  2B9Y A;  2HND B;  1RP5 A;  2YNF A;  4NEZ A;  2N3L A;  4CO5 A;  3GJR B;  1ZZF A;  4L6V 3;  1OSC A;  3GWC A;  1Q53 A;  5GAD U;  4E0D A;  1KBR A;  3CW2 C;  3IN5 A;  2CJY B;  3OLB A;  2HGL A;  4UOF A;  3Q8U A;  2DR6 A;  4EYI B;  1SCJ B;  4UUW A;  3A3P B;  3QPI A;  5LMN F;  2R8G A;  3BO4 A;  1B64 A;  1T05 B;  4RW9 A;  3CD6 S;  1M5P C;  2JEI A;  4XK8 C;  4F4Z A;  4EMD A;  3RZA A;  2FVS A;  1TTH B;  2RNE A;  4X4O A;  3F0N A;  1S0V A;  2QGF B;  1HHT P;  3TR5 A;  3EXY A;  3W9I A;  2LA4 A;  2V8P A;  2F8E X;  3QT6 A;  5SUH A;  1D3W A;  1ZA2 B;  3BBC A;  3JSR A;  2RDI A;  5A8W A;  1KQK A;  2UV8 A;  4YN3 B;  1S76 D;  2UUB J;  2FLO A;  4FYY B;  2GZO A;  3ISZ A;  3FCH A;  4ZJQ A;  1QVF R;  1D1U A;  3R3T A;  2IMO A;  5M2R A;  2HVD A;  2HWI A;  3W66 A;  4OZ0 A;  3I5C A;  3CCJ S;  4U8V A;  3HHL D;  4LFA F;  4ANC A;  5HQM A;  3VGU A;  2QO3 A;  2OPP B;  3R5A A;  4ZVQ B;  2FHO B;  3U02 A;  4OX8 A;  3D0G E;  4CH0 S;  3R5D A;  4QOT A;  3OVB A;  2PN6 A;  2XM3 A;  4LSN A;  2WON A;  1DBD A;  5DZ6 A;  2KKH A;  3J7Z T;  4KE5 A;  2Y8Y A;  1REV A;  3GSI A;  3I9V 9;  1BLU A;  3DI6 B;  4UST A;  5FLX U;  1XMO J;  4C7Q A;  1JXL A;  3E3X A;  6FDR A;  5FLX Y;  2DGT A;  2YWG A;  3M7V A;  1HBM B;  4PWD A;  2OPR A;  3EGW B;  1S6P B;  3OJS A;  3NS6 A;  2GMH A;  4JUZ A;  1IQT A;  4ES2 A;  5ETP A;  4CO1 A;  1Y5N B;  4OV6 A;  3UWT A;  4QU6 A;  4NL5 A;  3KKF A;  1G3O A;  3I82 A;  1UFK A;  4O0N A;  4DPW A;  4LF6 J;  1W7W A;  3CWJ A;  2R7Q A;  1GMW D;  3F56 A;  2G2Z A;  3CTR A;  3HLU A;  2X1B A;  4FN5 A;  1RAG B;  2M8H A;  4NYZ A;  1FTR A;  4F0H A;  4PZV A;  4O3O A;  3MAA A;  1JLA B;  1FFG B;  3NNA A;  3U1N A;  3MED B;  2MLZ A;  3PX4 A;  2J7U A;  2XHC A;  1VCT A;  3W63 A;  1FER A;  5B0D A;  3M9N B;  3MEK A;  1SH0 A;  1TV6 A;  5L1I A;  2ZWO A;  3M8R A;  3SQG B;  3QWP A;  3S01 A;  3OTE A;  1S49 A;  4DFM A;  5CCM A;  1HNV A;  3W2V B;  1ZS6 A;  4D3H A;  4MKB A;  2RS8 A;  1S99 A;  2FZK B;  4JV2 A;  4N56 A;  5ITH A;  2HHW A;  2BJ1 A;  2YX7 A;  3OQ2 A;  4DCO B;  2O1P A;  2K1R A;  2CJK A;  1FWP A;  4WP3 A;  3CJ0 A;  2CXE A;  4DR5 J;  2YWK A;  3KWM A;  1Q7Y T;  4C8Y A;  3T1Y J;  4JP8 A;  2I5J B;  3TX8 A;  2HRT A;  4B9V A;  1NDP A;  5C25 A;  4J9S A;  2HW3 A;  2RF2 B;  1U25 A;  4KGV B;  1NDC A;  2C3U A;  4PCQ A;  5CCL A;  4NLD A;  4F67 A;  4R8U B;  1WC5 A;  3MD3 A;  5LOQ A;  1XMO F;  1X4B A;  3TAP A;  1YJT A;  2XMT A;  2YWH A;  3NY0 A;  1S6Q B;  4KAI A;  2B5J B;  2OH2 A;  2OGU A;  3OW2 R;  1WOO A;  2CRL A;  4ZVT B;  2HMI B;  2E1R A;  3IWX A;  1FWK A;  3NOG A;  3KOA A;  3BSN A;  4AXJ A;  1X4D A;  2ZFH A;  4Q44 A;  2ATC B;  5AJ3 J;  2CG4 A;  3SXL A;  4KHP J;  3PG9 A;  2OLW A;  4DG1 B;  2RRN A;  1HAR A;  1C1B A;  2RRB A;  5KFP A;  4LIR A;  5A8K A;  1WEY A;  4JI3 F;  1WC6 A;  3DOK B;  3H5S A;  2C22 A;  2BKP A;  4KO0 A;  5IM0 B;  3ENQ A;  2D7S A;  3PIO Q;  3HP6 A;  5I3U A;  2W1B A;  2QIF A;  3CJ8 A;  5LM7 E;  4USW A;  1GXU A;  3IG1 A;  1RT6 A;  4BBY A;  1S1U B;  3FQL A;  4URQ U;  3LP1 A;  1IM4 A;  2AYB A;  1RQ0 A;  3MPD A;  4K4T A;  1HMV A;  2YVS A;  1JB0 C;  2UXC F;  1VS3 A;  5HVF A;  1TUG B;  4F0M A;  1VC0 A;  2YNG B;  5C24 A;  1FES A;  4UY8 T;  4P6Q A;  4NI2 A;  2BAB A;  2QMX A;  1RAD B;  1HW9 A;  4OZL A;  2HK2 A;  3NS5 A;  2GQC A;  1U1K A;  4CH1 A;  3OHA A;  1Y9O A;  2XS2 A;  3DN9 A;  2MY8 A;  2VBY A;  4LVO P;  1I6J A;  4PYD A;  2B4U A;  3W62 A;  3CB4 A;  2EKN A;  3LQV A;  1BQN A;  1SB6 A;  4X4R A;  5KT6 A;  4LF8 J;  3PJ9 A;  4IUF A;  3QT8 A;  2C2R A;  2DKO B;  1YWX A;  2CQH A;  4P9S A;  2VJV A;  1JNR B;  1KON A;  1HNZ J;  3ETM A;  3GYG A;  2B6A A;  2VHG A;  4LF4 J;  2IHR 1;  3TAR A;  1T11 A;  4ZIT A;  3GPA A;  1CLF A;  3RBX A;  4PG5 A;  1S9F A;  2OML A;  2JFD A;  4YB5 A;  2CQ0 A;  2C2M B;  3MMC B;  1B0V A;  3EZ5 A;  3I0R B;  4B08 A;  1RT2 A;  4LBP A;  2HRU A;  5KT3 A;  1ZTW A;  4PQU B;  3ZTS A;  3ZZY A;  4DCP B;  4C97 A;  4ZVP B;  5IT4 A;  2B51 A;  4RUC A;  4KHP F;  2OFG X;  2DPI A;  1RWN B;  1S9G B;  1KHV A;  2C2E A;  1HW8 A;  3GCW P;  3HHE A;  1F0X A;  3W5Y A;  5CAB A;  1FXD A;  4L76 A;  1SC6 A;  5ETV A;  1GNK A;  2DNQ A;  2HND A;  3GYX B;  4I56 A;  3H90 A;  3NGK A;  1O8B A;  1VFJ A;  4NLU A;  4JI7 J;  4QWC A;  1WC0 A;  2GCF A;  2JRS A;  2QLJ B;  2LDI A;  4NA1 A;  2NUH A;  4RNH A;  3T19 A;  3NWR A;  2UU9 F;  1RT4 B;  4HHJ A;  5E3C A;  3FK4 A;  1JXV A;  4ZP7 A;  2N82 B;  3VHQ A;  2MQQ A;  3HCX A;  4B3S J;  2LXI A;  5AE1 A;  3M2V B;  4X84 A;  3OFE A;  5L9N A;  1NO8 A;  5L1L A;  3RUB L;  3ADA C;  2V9W A;  1NDK A;  2IM2 A;  4C0H A;  1T05 A;  1R8P A;  2D9O A;  2FJD B;  4ZK7 M;  3L7O A;  1WTB A;  3HM9 A;  4YEA A;  3Q23 A;  3AHP A;  3CIZ A;  2YQ0 A;  4TYB A;  4HAC B;  1R27 B;  4C3K A;  1S0N A;  3OXL A;  1FRM A;  1J27 A;  3LP0 B;  4DR2 F;  1Z2Z A;  3CCL S;  3IWN C;  4X4V A;  4PPZ A;  2MLY A;  2HHV A;  4A8W A;  3TVY A;  3X1L B;  3G86 A;  4PXE A;  3TUJ C;  2OPS B;  4K59 A;  3GIR A;  4K4Y A;  2A1B A;  3CCM S;  1VR6 A;  3CGI A;  1RGV A;  3W9H A;  1RHQ B;  1WF2 A;  1JWW A;  2MY7 A;  4CNY A;  2FYX A;  2OPP A;  2O01 C;  4OZJ A;  4TQS A;  3M4X A;  4LF7 F;  1VJQ A;  4IFV B;  3FSI A;  2W24 A;  3SFG A;  4NA3 A;  2RD5 C;  1ZET A;  4J9O A;  1F3F A;  4RWX A;  1DQA A;  4DV0 J;  4LRB A;  3R2C J;  4RW6 B;  4O0I A;  3DI6 A;  2ZJR Q;  4ED5 A;  2P8I A;  1VRU B;  2YKM B;  2OEM A;  1K8A T;  1HBM A;  1ARO P;  4K0K F;  3PW5 A;  1KP6 A;  3D3C J;  1S6P A;  2BJD A;  4OZ1 A;  4RL1 A;  1S0M A;  2GS8 A;  2UVV A;  3DKD A;  3F73 A;  3VAG A;  1NZA A;  1R7I A;  4Y3C A;  1NK9 A;  4LVN P;  5L8R C;  2V8V A;  5KOW A;  1QSY A;  4PG4 A;  3K57 A;  3CC7 S;  2EG2 A;  3RAQ A;  1B7F A;  4QWA A;  3PJW A;  4JI7 F;  2M88 A;  4BWM A;  3U7J A;  3FCV A;  8RUC A;  1KR4 A;  1N34 F;  3BM7 A;  3BYP A;  3ZTQ A;  5CZV A;  4OI3 A;  3MR6 A;  1RXO B;  3AA9 A;  4B3S F;  3AB4 B;  1B0P A;  3QZ8 A;  4MK8 A;  5IZH A;  3OR2 B;  2MEW A;  2WSC C;  3PEH A;  3KLE B;  2E5J A;  4TLQ A;  4NLS A;  1JLA A;  3VVU A;  2M7S A;  1NXI A;  3EVM A;  3MED A;  5D4O A;  4X62 J;  2NSB A;  5D15 A;  3HD2 A;  3RW7 A;  2BKO A;  1E6V B;  3EDQ B;  1Q81 T;  3PY8 A;  3SQG A;  5DDO C;  4Y2A A;  1RUS A;  4URS A;  1IBC B;  2Y1J A;  1JMT A;  3LAK A;  1EAR A;  3W2V A;  3ENW A;  3VF0 B;  2PFD A;  1YVF A;  4YOE A;  2B4V A;  3JQJ A;  2RVJ A;  4RR5 A;  4H4K A;  2JSX A;  3ZZU A;  2RDD A;  3V6K A;  1SKS A;  2B3T B;  2BRK A;  4JOU A;  3NWG A;  3FNN A;  1N56 A;  2E44 A;  2JX2 A;  4JI6 F;  3J7Y U;  2JLE A;  3MCN A;  5GAG I;  2HEK A;  2R2S A;  2QLX A;  4O4G B;  2MKS A;  2CNO B;  2AQ4 A;  1W2B R;  3BV8 A;  3HFV A;  3HK2 A;  3ILO A;  1U0H B;  1ZTT A;  3TUI C;  1HPZ B;  4NEY A;  4J9U E;  4RZR A;  1RTD B;  2COL A;  4KY3 A;  3HSJ A;  3RG6 A;  2I5J A;  2UXD J;  1OPZ A;  3PYD A;  2RF2 A;  1CQM A;  3PX0 A;  6AT1 B;  3Q8Q B;  3DHW C;  2P9G A;  1ZPV A;  3CJS A;  1NRK A;  3LH2 S;  4ZPB A;  1TL5 A;  1YHQ S;  1VQO S;  4R8U A;  3MAH A;  1QTN B;  3DRX A;  1VDH A;  1PJ6 A;  1YJW S;  2AHO B;  2N7Y A;  3BB5 A;  2DXE A;  1S6Q A;  1JKH B;  3UVJ B;  2N3O A;  1QSS A;  4RNM A;  1Z1Z A;  2B5J A;  4DS5 A;  1T9V A;  4J5O A;  4ZCL A;  2UUA J;  4AD6 A;  2W7P A;  3P3D A;  1SL1 A;  2HMI A;  1IKV B;  2M52 A;  4ED0 A;  2ASL A;  4QYR A;  4CWB A;  4YR2 A;  5HAO A;  3BPS P;  1LK5 A;  4C9D A;  5KFS A;  1RHK B;  4RU9 A;  1WF1 A;  2ZC3 A;  4V1A k;  4DG1 A;  5KFV A;  1LQ9 A;  2RU3 A;  2HQI A;  2XSF A;  2AW0 A;  4KYZ A;  4LR8 A;  4X4Q A;  2HVH A;  2M4M A;  2QEX S;  2LEA A;  1N32 F;  2E1A A;  4PG8 A;  4TVA B;  4EZ6 A;  3DOK A;  4ZVF A;  5IM0 A;  5BJR A;  3TI0 A;  2AEF A;  5CXT A;  5JJB A;  2DT9 A;  3MEC B;  4X62 F;  3OR1 B;  1BQX A;  1S1U A;  2ZJQ Q;  1M5V C;  3R97 A;  4OFZ A;  5KTQ A;  4ZCI A;  5DGA A;  3C19 A;  2HAI A;  4GVL A;  4M5N A;  2YNG A;  4O3Q A;  4P2S A;  1XR6 A;  1RWM B;  1TZ0 A;  2VZ9 A;  2M3D A;  5DET A;  2FVC A;  4KKO B;  3CSK A;  2A0F B;  3QIP B;  5B0G A;  1X4F A;  2LU1 A;  3T1H J;  4YR3 A;  1I1G A;  1J5E J;  3PJX A;  4PWU A;  3MUT P;  2NXC A;  4RUA A;  2XI3 A;  1RKJ A;  4USV A;  4A48 A;  5L46 A;  3P8B B;  2K8G A;  3QMQ A;  1S12 A;  3NCP A;  2JJ4 D;  1N5Y B;  1TKT B;  2UUW A;  1Y4Z B;  3UCG A;  3JS9 A;  3W3S A;  1LXJ A;  2VFR A;  2UXD F;  2DNP A;  3AXM A;  2KL8 A;  1PG5 B;  4ED8 A;  1IBM J;  4K2J A;  3CE8 A;  3PAC A;  3M9O B;  2DHX A;  2AIR B;  3MEG B;  4P72 A;  1VBY A;  3GSD A;  1QUV A;  5KFD A;  5LSL A;  3C15 B;  4E8U A;  1VQ9 S;  2Y0B B;  3HVA A;  3W5Z A;  5K20 B;  2FC9 A;  5HMZ A;  5B08 A;  3MMC A;  2UUT A;  2VPX B;  2VKZ G;  3T9Z A;  3I0R A;  2UUA F;  4XTT A;  3TAM B;  3OJU A;  4K5S A;  2AD9 A;  2ZBI A;  3LUY A;  5CH7 B;  4PQU A;  4I2P B;  4U9R A;  5AT1 B;  4A8X A;  4M5J A;  4Z7C A;  1ICE B;  4S0M A;  2BOP A;  2L08 A;  5DZ7 A;  4OZ2 A;  5KFA A;  2C2Z B;  1S9G A;  2O3D A;  5G4D A;  2LLZ A;  1T9U A;  5E33 A;  4WKR A;  5KG3 A;  4M5I A;  2UVR A;  4Z37 A;  3C14 B;  2Y9H A;  1VLO A;  2BAC A;  2V94 A;  3QJP A;  3SSR A;  3DLG B;  5JMN A;  1SJQ A;  2OD4 A;  2DGW A;  2QA2 A;  4CRJ A;  5KG2 A;  2RT3 A;  2K7K A;  3FZ2 A;  2XCP A;  3LW5 C;  1CVJ A;  4NZ6 A;  1NJX A;  1RT4 A;  2C2D A;  2RAQ A;  5KFX A;  5KFH A;  1SXL A;  1X7V A;  4FPI A;  3FEY B;  1NM2 A;  2ZOM A;  3M2V A;  2D3Z A;  3PM9 A;  2EFQ A;  5KFG A;  3DGV A;  1KWM A;  4I1T A;  2KI2 A;  3JSM B;  5GAH I;  1M5S A;  2U2F A;  3ZZ0 A;  1I3O B;  2POK A;  1LV5 A;  3T1H F;  3BGU A;  3Q2S C;  4XAK A;  2A3J A;  2HPU A;  1FNM A;  2H5I B;  1JLE B;  2J6T A;  2D41 A;  1Q5V A;  2HFV A;  3EGZ A;  4MIB A;  4HAC A;  2P2C B;  4MMO A;  2NS1 B;  3MOZ A;  3I0S B;  4JI5 J;  4H4O B;  3LP0 A;  5DDR C;  3MHY A;  4PG6 A;  1O6X A;  1U4B A;  1EKR A;  4A46 A;  3TEH B;  1IR0 A;  1H2V Z;  3HHL B;  2HQD A;  2XB2 D;  2ZHA A;  1IJE B;  3SCK E;  2OPS A;  4Y34 A;  4ED7 A;  4WP9 A;  3SV3 A;  3SDE B;  2XLK A;  2IM3 A;  1CUL B;  2VV5 A;  1YSJ A;  1M1H A;  2BQR A;  4WYW A;  2VB6 A;  1U8W A;  3SZ2 A;  4HI1 A;  2CPY A;  2AP6 A;  3G82 B;  4C3L A;  4IFV A;  4FKX A;  3LGH A;  3MCM A;  3IRX B;  3KTQ A;  1CC7 A;  1EET B;  2CPE A;  2IA0 A;  1NB2 A;  3J7A 1;  3G4S S;  2VOO A;  1DHM A;  2JVR A;  3BBB A;  2ZM6 J;  2KG1 A;  3V4I B;  2HAF A;  2X51 A;  4RW6 A;  2OUG A;  5HVG A;  4KGZ B;  1Z4U A;  4KR0 B;  3K5L A;  4KV8 B;  1VRU A;  4IH6 A;  2YKM A;  1JQG A;  4KGK A;  2MHE A;  1GFW B;  5C7P A;  3NNC A;  3R8Y A;  4J9V A;  2ALZ A;  3TEG A;  4IQM A;  4ELT A;  4NX9 A;  1CEZ A;  2ALY B;  3KHH A;  4UOC A;  1WHW A;  3OTO F;  3D6H B;  3TNV A;  4NAS A;  4RNO A;  2DIV A;  1UVN A;  2R2R A;  2VJU A;  2FB0 A;  4K4Z A;  1YJ7 A;  4DV4 J;  1RBA A;  3HVW A;  1SJ4 P;  3LPE A;  4DPT A;  2GHW A;  4DL6 A;  1KKH A;  2MQ8 A;  1RAB B;  3OR2 A;  2C1E B;  3KLE A;  2BJ3 A;  2ZH4 A;  2JEJ A;  6FD1 A;  4OX9 J;  3G8Q A;  3CF5 Q;  4ID8 A;  3BGR B;  1LKZ A;  2V63 A;  1MMD A;  3BGL A;  4IOB A;  1VQ6 S;  1EX8 A;  5D6G A;  2BE7 D;  1E6V A;  5HLF B;  2GHP A;  4GMK A;  4Q7A A;  4NXM F;  3WX8 A;  1TUV A;  4DR3 J;  2VF3 A;  4J9M A;  1DAR A;  1U1L A;  1NSP A;  2ZDP A;  1NHK L;  1AT1 B;  2Z2L A;  4RBU A;  3RGI A;  1U1M A;  1U7L A;  2XNQ A;  3FCW A;  2B7B B;  4FZV A;  4OHY A;  4O4G A;  2A2D A;  3K5N A;  4WBF A;  1DQ8 A;  2CQ2 A;  3UFC X;  1N6Q B;  1U0H A;  3HSD A;  1QSL A;  1HPZ A;  1M90 T;  3N01 A;  4AUK A;  1RTD A;  5KT4 A;  4LFB J;  3CCU S;  3ZZO A;  2U1A A;  2V67 A;  3RB3 A;  2XMM A;  4IG3 B;  3G6Y A;  4FXV A;  4NLO A;  3W1Y C;  3DLE B;  4DUY F;  2IMW P;  2R7W A;  4DR6 J;  2FDN A;  2FJV A;  3DMJ B;  2IPO B;  1S0O A;  1HA1 A;  3B78 A;  3QAT A;  3ILL A;  3KG4 A;  1NZ8 A;  4MH8 A;  4J90 A;  3FRZ A;  3KK2 B;  4ZN1 A;  4WII A;  1MG7 A;  1U02 A;  4O3R A;  5JXS A;  4NRT A;  2VFU A;  2AV5 A;  1JKH A;  3UVJ A;  2XHW A;  4XIU A;  1WEZ A;  3H25 A;  4XDC A;  2MZ1 A;  2M70 A;  3M05 A;  3UN3 A;  1GX6 A;  3D6F B;  5MLC V;  3LO3 A;  2NSC A;  3Q8R B;  2KHD A;  4AE5 A;  9RUB A;  1W25 A;  2KVQ E;  4OIX A;  4USH A;  3HD1 A;  4J37 A;  4LF9 F;  1VQP S;  1M0S A;  4DFK A;  1DLO B;  3EIC A;  2QSF A;  4I2Q B;  5ETS A;  2E5G A;  1FJG J;  3LF0 A;  1F6T A;  4QYZ K;  4C11 B;  4NXN J;  3FBF A;  2AJ0 A;  2C3O A;  1WI6 A;  3MEC A;  1SL0 A;  3MM6 B;  2F8M A;  3OR1 A;  2VH7 A;  1V3S A;  3EXC X;  2AWZ A;  4DV7 J;  3IO1 A;  2V4Q A;  2AJQ A;  3OL7 A;  4P2M A;  4M5M A;  1H6K X;  1YJR A;  1VIO A;  3H7H B;  2F9J A;  1LWE B;  4U95 A;  5KFN A;  2DNL A;  3TQ1 A;  1ROF A;  1CS4 B;  4HKQ A;  1RHU B;  3ICL A;  2BJ9 A;  2M5Y A;  4NCG B;  1C2P A;  1RB0 A;  3VGT A;  1FEE A;  3AQO A;  4IO1 A;  4KKO A;  4ZLP A;  1HL6 A;  1R8B A;  1U6F A;  1H72 C;  3QIP A;  3DNC A;  3NXZ A;  3FSX A;  1N54 B;  4NYO A;  1V3Z A;  4IDK B;  3TW0 A;  2ZOG A;  3MFH A;  4H4M B;  2XGQ A;  2CIM A;  1WC3 A;  2X3G A;  2O66 A;  3TA2 A;  3CO0 P;  3OV7 A;  5HJY A;  5HJX A;  4O44 B;  1N5Y A;  1TKT A;  3BPD A;  1RCO B;  4KPY A;  4LFB F;  2HQ3 A;  4JI0 J;  5LJ3 Y;  1OQ3 A;  3I5A A;  2KRB A;  1SVD A;  1CG2 A;  2V2K A;  4M5H A;  2KJV A;  3RB0 A;  4X66 J;  2KXF A;  3NGS A;  2IDL A;  5H9F K;  3MEG A;  3VVT A;  1LEO A;  4MT1 A;  4LQ9 A;  1HWK A;  4J9L A;  4DS4 A;  3K5P A;  3C15 A;  1D9D A;  1Q8L A;  2E7W A;  2YY3 A;  2HZC A;  1L3K A;  3AJ2 A;  1UAW A;  1V9O A;  2LEP A;  2E5L J;  3TAM A;  3R2D J;  4HDH A;  4OHX A;  2BMB A;  2V34 A;  1YG0 A;  4I2P A;  2VQF J;  1FD8 A;  1PBA A;  3B4M A;  1TAU A;  2XC9 A;  2ROG A;  2BXJ A;  4EZ9 A;  4JV1 A;  2GVZ B;  4MK7 A;  2C2N A;  3C66 A;  1E6Y B;  2HFN A;  1XNQ J;  4HT7 A;  4L73 A;  1YRX A;  2CWK A;  4YB7 A;  1R6Y A;  4F3Q A;  3KLI B;  1C0T B;  1R6V A;  4J9P A;  2HQG A;  2VFT A;  2FHJ D;  2ZKT A;  2W2P P;  3C14 A;  2VD3 A;  3CCQ S;  3U1L A;  1FJG F;  4R25 A;  3G8S A;  3CPW R;  3IAS 9;  5CHC B;  3DLG A;  3D6M B;  3AT1 B;  4QWE A;  1TL1 B;  4JI4 F;  2GW8 A;  1X9S A;  3V6J A;  2W2N P;  2EEY A;  4USU A;  4MKA A;  4USI A;  4KIA A;  4DV7 F;  1DTT B;  4PRF A;  2Q3P A;  2GIF A;  4A8O A;  4H4K C;  1XN9 A;  2Q43 A;  4NLQ A;  4FF4 A;  1UVK A;  1FXL A;  1S57 A;  3M30 A;  2L41 A;  1IKY B;  1UPM B;  1X5S A;  2KH9 A;  4NZ7 A;  1UEV A;  3ISN C;  5C5J A;  4EGL A;  1QAJ A;  3BGF A;  3A4T A;  3JSM A;  2XG8 A;  3DXS X;  3MFI A;  1M5O C;  4I67 A;  3FUY A;  4TY9 A;  3N79 A;  5IS2 A;  4DV6 J;  3O3L A;  4DDF A;  3QGI A;  3OD2 A;  1JLE A;  1Q5Y A;  3K17 A;  3PYE A;  3NGU A;  3HF5 A;  3W65 A;  4OJ1 A;  2N7C A;  2PGC A;  3S6E A;  3D1H A;  3I0S A;  4NE9 C;  5IFM A;  4H4O A;  2J0S D;  2MST A;  4DCJ B;  1XER A;  1VQ4 S;  2QZ8 A;  1RWW B;  3KLV A;  3UI3 A;  2FQQ B;  2VKR A;  3GIJ A;  3HHL A;  1Q8I A;  4L3N A;  2XCA A;  3R7S B;  2OIH A;  2A10 A;  3PFO A;  1RCX B;  4DV1 F;  3HXM A;  4HDG A;  2GFF A;  3DRR B;  1HYS B;  3UPF A;  1DTQ B;  4DEZ A;  3SDE A;  1CUL A;  2G1D A;  2VC1 A;  3SSQ A;  3QGH A;  3QYY A;  2K06 A;  3HSZ A;  3G82 A;  5KOX A;  3IRX A;  1EET A;  2H54 B;  1U24 A;  2K3I A;  3I32 A;  1HNW J;  2IY5 B;  5E41 A;  3CUN A;  3V4I A;  2XGP A;  2NYI A;  5GAE U;  1RT5 B;  2BQ3 A;  4MFB B;  3MTK A;  3BKT A;  1I94 J;  3SMZ A;  4KV8 A;  4X65 J;  2DHH A;  1BHN A;  1SL2 A;  1UA1 A;  2ZIT A;  4B3R J;  1BUX A;  2V6A A;  3BO2 A;  2EFO A;  2MZT A;  2P9E A;  4PXD A;  2ASJ A;  4BWJ A;  3QFW A;  2MGZ B;  5HMY A;  4CLW A;  3V2U C;  1GMW A;  1RU1 A;  5CYQ B;  1BQM B;  1GK8 A;  2A6O A;  4ZIW A;  4RW4 B;  3ET6 B;  3VGV A;  2QLW A;  4XPE A;  5EGY A;  2WB1 D;  4LSL B;  4P73 A;  5LMU J;  1ZAV A;  4DJB A;  3CCW A;  2CQG A;  2AGP A;  5D4P A;  2B7C B;  3HUL A;  3L4B C;  4NLV A;  4CM2 A;  2IRY A;  4OQJ A;  4AL7 A;  1UW9 A;  3BGR A;  1LWF B;  4DBQ A;  3IBF B;  2ACY A;  3AOB A;  2IIH A;  4AL6 A;  2HFS A;  3AQP A;  1N4L A;  5L9X A;  5IWA F;  3KLF B;  4ECQ A;  4Y2I A;  5HLF A;  1NJZ A;  5IV3 A;  4K8R A;  1Y3J A;  3CCS S;  2LQB A;  1DAX A;  3TO8 A;  2CJ9 A;  4NMX A;  1X4A A;  2CQD A;  3PX6 A;  4ZVS B;  2HBY B;  1U48 A;  3PKM A;  2HG4 A;  3HO1 A;  3IXQ A;  5E3P A;  1FA0 A;  2BBE A;  4ZPD A;  4LRC A;  3KXD A;  1WOP A;  2XMA A;  2P5V A;  4ZA1 A;  4ED1 A;  2B4O A;  4ID5 B;  1N6Q A;  1PCA A;  3Q8Y A;  4AL5 A;  4FYD A;  1V5V A;  1KTV A;  3AJ1 A;  2HBZ B;  2WCX A;  1Y10 A;  3THP A;  3QSY B;  2FUG 9;  2VBX A;  2RIJ A;  3JSB A;  4K7Q A;  1UWB B;  4MJK A;  4IG3 A;  2YTC A;  3DLE A;  3I9Z A;  2IVM A;  1PIE A;  1F2H A;  2IFX A;  2JL9 A;  2RML A;  1XR5 A;  4DV5 J;  1HNW F;  3DMJ A;  1K0T A;  1NK4 A;  3DXB A;  4QR0 A;  1APS A;  5D0E A;  2CDR B;  2GO8 A;  3QJJ A;  1WKL A;  4GO5 X;  2ACM A;  3KK2 A;  2F4V F;  1I94 F;  4DX6 A;  3BKF A;  4I4B A;  4B3R F;  2L3M A;  2EI5 A;  1CQN A;  4NYP A;  4ED4 A;  2Z2Y B;  5DO2 A;  4KHR A;  2CNK B;  3LA0 A;  1OWX A;  2DVI A;  3KHR A;  4X4S A;  2PSZ A;  3LAL A;  2EK6 A;  1XNR J;  4M1K A;  1TKZ A;  2RUG A;  3HKZ D;  2R7U A;  3D54 A;  1SPB P;  2RIL A;  4O3S A;  1F1B B;  3C6U B;  3DDK A;  2J7K A;  1SIZ A;  1L5U A;  3C2P A;  2UXB F;  4EWT A;  3OBI A;  1VMB A;  3PV8 A;  4I2Q A;  5F8L A;  2BUN A;  4U6P A;  4PWW A;  5L39 A;  3GV7 B;  3BEG B;  1IUJ A;  2ZDO A;  1YDL A;  4C11 A;  3HT0 A;  4E98 A;  3R27 A;  3H8Y A;  2JNJ A;  1VJW A;  3MM6 A;  3EDR B;  4RW7 B;  4WFZ A;  3CDU A;  5D4N A;  3PO4 A;  2I9S A;  3MR3 A;  2NYH A;  2W4C A;  3PIP Q;  3BBF A;  1N36 J;  3RR7 A;  4FKY A;  1Y7P A;  3OXF A;  1LWE A;  2W25 A;  3T9N A;  2J0Q D;  1ZH5 A;  5E3Q A;  1CS4 A;  2LDY A;  3LTO A;  4NCG A;  5KFR A;  1SJF A;  3NAH A;  5B0C A;  4DZ6 A;  1YRU A;  4F4W A;  4TXS A;  2VU5 A;  4C8N A;  1M5H A;  3FDS A;  3QLH B;  3AD7 C;  4IDK A;  1KDN A;  1R8C A;  5HK4 A;  1UZD A;  3KJN B;  1N5V A;  4H4M A;  2IAJ B;  5HN0 A;  3M32 B;  2DNO A;  3MR7 A;  3EGN A;  1SJ3 P;  4DQS A;  1X4H A;  1PYS B;  4O44 A;  3MZI A;  3CVK A;  3BQ0 A;  1FD2 A;  1VQN S;  1CJK B;  3NS7 B;  5B0F A;  5GMK a;  1T7P A;  5KFE A;  1FDN A;  3MOJ B;  2Y0S D;  1K1S A;  4DL3 A;  3ZTP A;  3TP2 A;  1D9A A;  1BWE A;  1N52 B;  4YR0 A;  4DV5 F;  3V6H A;  4M63 A;  2G1H A;  2UUC J;  4YY3 J;  2J7W A;  1UJ6 A;  5I3Q A;  3D1O A;  2ZNZ A;  1IBK F;  3BSC A;  2OHD A;  4CP5 A;  3DM2 B;  3JXO A;  4OYP A;  2IM1 A;  1UVL A;  4ER8 A;  1Y0H A;  4DQI A;  1F5A A;  2BW2 A;  3M8W A;  5KFC A;  4FPR A;  2FPH X;  2EBG A;  2F8H A;  4N5S A;  2GVZ A;  1E6Y A;  2H51 B;  2IJR A;  2I2Y A;  2JOQ A;  2ASY A;  4CLK A;  3OL8 A;  2NPF A;  2AZ1 A;  2HK3 A;  3RTV A;  3KLI A;  1C0T A;  1TL7 A;  2HZV A;  3BR8 A;  1BC6 A;  1G2E A;  3EYZ A;  1U49 A;  2NZ4 A;  2BJ7 A;  3EE3 A;  2B8Q A;  1TL1 A;  2WSE C;  4R0J A;  4CYU B;  1C1C B;  3IBC B;  3A12 A;  3H42 A;  4NZ0 A;  1EJ7 L;  4KGX B;  4USJ C;  4A8Y A;  4J9K A;  1DTT A;  1RK8 A;  2QN6 B;  4CLY A;  4X64 J;  3CIM A;  3PZP A;  3OL9 A;  2QYC A;  4WFN Q;  2GC8 A;  3GFX A;  1YJ9 S;  2C3P A;  5EHH A;  1IKY A;  1BXN A;  1AFI A;  2D69 A;  4B3T J;  2RRA A;  4V19 X;  2HLU A;  2GJF A;  2JFK A;  4AQY F;  1JIH A;  1TKX B;  1RA7 A;  1LFP A;  1SQF A;  2BR0 A;  3OHB A;  3E51 A;  1QUP A;  2XMK A;  1NK6 A;  2ZHO A;  3PR5 B;  4F8R A;  4TNO A;  1WKK A;  3AFG A;  2QL7 B;  1NPK A;  2M9K A;  2GHV C;  2E29 A;  5A8R B;  2VG7 B;  1UJ5 A;  3TJ8 A;  1PAE X;  3K8V A;  4DUT A;  2WOM B;  4WCE Q;  4P75 A;  3MMB B;  3WC0 A;  2M0G B;  2MJN A;  2CPD A;  4UW2 A;  4M95 A;  2DHS A;  5E5N A;  3D0I E;  4NWB A;  3KHL A;  1KOH A;  2J9C A;  2JLF A;  4KGM A;  3DRR A;  5D0R A;  4FVM A;  3J80 U;  1HYS A;  1DTQ A;  1ULR A;  5D8H B;  3CDE A;  1XMQ F;  4A8M P;  3J80 Y;  3BGO P;  3HPO A;  4W98 A;  2NXJ A;  4JV5 F;  1LXN A;  3PRV A;  3O5T B;  2QYG A;  4LFC F;  5HRO B;  3EM1 A;  2DNY A;  5T7L B;  1B0T A;  3KDO A;  3DLB A;  2P9C A;  1FF2 A;  2OSR A;  4RBV A;  1YJV A;  2JHE A;  1S1W B;  4B9T A;  4QPT A;  1RT5 A;  1L3U A;  4ECZ A;  4MFB A;  3C3L A;  3CC4 S;  2MTL A;  2BKN A;  1FHT A;  2F5G A;  3PW2 A;  4RW8 B;  4DFJ A;  1PJ5 A;  2MGZ A;  1VQ7 S;  2ZZN A;  2I8E A;  4K5R A;  2ERR A;  1NME B;  3CNQ P;  2QE5 A;  5CYQ A;  4DN0 A;  1BQM A;  4QCL A;  2C28 A;  1X31 C;  4Z7Y A;  1ZAW A;  3JTP A;  4RW4 A;  3ET6 A;  2KT5 A;  3IWL A;  3DCA A;  3T6J A;  4X4N A;  4W4M A;  1HWI A;  2MHN A;  3MM9 B;  4LSL A;  3DDI A;  2RQK A;  3MMA B;  3M2R B;  1RHR B;  2NXE A;  4X64 F;  3PRD A;  4QIV A;  1ZBT A;  2CPI A;  4DUZ F;  5EWG A;  1FT8 A;  4YB1 P;  1VQK S;  1WUU A;  1RWX B;  2HHH F;  2B56 A;  4DL2 A;  4WE1 B;  2D9P A;  2HHQ A;  4PUO B;  1LWF A;  1DZ5 A;  3OFG A;  3EX7 B;  3T6B A;  5HQ8 A;  1HLW A;  5CD4 A;  2K2P A;  3KLF A;  2J8S A;  1WSV A;  3LAM A;  4DL4 A;  4DSJ A;  1GTH A;  3ILI A;  5CQG A;  3ZTO A;  3QWU A;  1NSQ A;  1F9F A;  1XWL A;  4I6W A;  4HR2 A;  2ZZT A;  4YQW A;  4P10 A;  1YQH A;  1K73 T;  3CCR S;  3THT A;  3UDC A;  1SI9 A;  3HX9 A;  4R5P B;  1YJN S;  4GO7 X;  3ONQ A;  2W4P A;  5CD4 H;  4IH7 A;  5DG8 A;  5KFU A;  1HBN B;  3CXC R;  3JTN A;  4ID5 A;  1NND A;  4F02 A;  2ABY A;  1OMS A;  4F04 B;  3R7N B;  5GAD I;  2HS0 A;  4DR4 J;  3VZH A;  1AW0 A;  1KS2 A;  1UWB A;  3DU6 A;  1EQ0 A;  1SJ1 A;  2H3E B;  3NAI A;  1MSW D;  5HVH A;  2IC3 B;  3U27 A;  5JUM A;  2BAN B;  3H0P A;  2CQ3 A;  2NXU A;  4Y0F A;  1XMB A;  2JEF A;  3I55 S;  2GX8 A;  4CTA B;  1U6Z A;  4A8S A;  4DHV A;  3L09 A;  4ZLL A;  5J1N A;  1TQL A;  4DR1 J;  3ZFV A;  3CME S;  3CCE S;  3M8Z A;  4DF4 A;  1Q0N A;  1U2F A;  1VQY A;  2R8I A;  1T0T V;  4F2R A;  4I6Y A;  1KQS R;  2W9C B;  4RNF A;  3C6U A;  5E0O A;  4WP8 A;  1WTF A;  3FVY A;  2VDI A;  2YWE A;  2LVW A;  2FVR A;  3OT9 A;  1B4S A;  1NSK L;  4ALZ A;  4F50 A;  4N7T A;  1EZZ B;  1VBX A;  2EK1 A;  2J0W A;  3TYT A;  4DX8 H;  2KM8 C;  1MU2 B;  4PG7 A;  2YPY A;  4Q8F A;  2Q66 A;  3BQ2 A;  2MKC A;  3NNH A;  2UUB F;  5K8M A;  4N41 A;  2ROE A;  1WG5 A;  2AT1 B;  2A18 A;  1SIW B;  2NQP A;  4KC5 A;  3K5O A;  3E2E A;  4RW7 A;  1MRO B;  4B3O B;  1WC1 A;  4M5G A;  1AZS B;  2LEC A;  2XLJ A;  2PMZ D;  2BVZ A;  2EVZ A;  3DRY A;  3HHL C;  4QBU A;  1NH7 A;  4DI6 A;  2OTL S;  4OMF G;  3O2I A;  3H59 A;  4KB7 A;  1JJH A;  1T9Y A;  1EAY C;  2HGM A;  1UA0 A;  3QLH A;  3I5B A;  2XTJ P;  1T02 A;  3SBM A;  4F4K A;  4JI8 J;  4HTI A;  3L95 X;  2IAJ A;  1S7H A;  3M32 A;  3TUZ C;  4DV2 J;  3BN7 A;  2HHX A;  3EVW A;  4UQT A;  3IR5 B;  5A6P A;  4LUB A;  1FDD A;  1U1Q A;  5KFY A;  1CJK A;  1FVQ A;  3WQP A;  2CAJ A;  1SH3 A;  4PXB A;  2V8G A;  2CPH A;  3T41 A;  2CQC A;  4LF6 F;  4CO4 A;  4WFY A;  3OVS A;  1EKS A;  3W60 A;  5DG9 A;  1S72 S;  3A8J A;  2IA6 A;  1X4G A;  4CLF A;  3HHD A;  4WJB A;  1JLB B;  5K8P A;  1CSJ A;  3CJ5 A;  4K4X A;  4AXI A;  1FJC A;  3NBP B;  2OP5 A;  4ZPA A;  2GML A;  3PO5 A;  1C4A A;  5A6W A;  1XEZ A;  3W64 A;  3DM2 A;  3CD5 A;  2D3U A;  3V5R A;  2FJW A;  4LR9 A;  3GTY X;  4ZVO B;  4OHV A;  1MWY A;  2ILY A;  1SQE A;  2CQI A;  1F9E B;  4NOH A;  5F0W A;  2Y1R I;  1S1V B;  3D68 A;  1S79 A;  3UD5 A;  3IGV A;  4O4R A;  2Z56 B;  3X3U A;  1OIA A;  4AYB D;  3FMB A;  2F7V A;  3H2L A;  2QL9 B;  2G9O A;  3W7B A;  5AXM A;  2FD2 A;  3IS9 B;  5KT2 A;  3V6D B;  2QG9 B;  2GO9 A;  4F36 A;  3PHE A;  1HNI B;  4Y6I A;  4DN9 A;  4ZP9 A;  1WHY A;  3TZY A;  4ECY A;  4OYW A;  3FGV A;  4KH0 B;  2X7I A;  1P27 B;  1BY9 A;  4A8Q A;  4ZLN A;  4LSZ B;  3HDS A;  3VR1 A;  4DL7 A;  3GFY A;  4CLT A;  5KFT A;  3ENA A;  1RAI B;  4CYU A;  2DNR A;  1C1C A;  4DR5 F;  3OVA A;  3K2Y A;  3T1Y F;  5J2M A;  2VPY B;  4WU3 A;  1KVK A;  2LCW A;  3FMW A;  5AE3 A;  1H7X A;  2YWW A;  3EGV A;  1RHJ B;  4IRK A;  3NLC A;  2W9A A;  4FS1 A;  3J81 Y;  2J6S A;  3UO0 A;  4OHW A;  2K7J A;  1FRX A;  1W2I A;  4TU7 A;  4NLW A;  2DEJ A;  3MCO A;  1MML A;  2HFO A;  5B0B A;  3FEX B;  4DQQ A;  1NKE A;  5H1S V;  1TKX A;  2AJ1 A;  3CJ2 A;  2OPQ B;  3MDF A;  2ZH2 A;  3GG0 A;  3CMQ A;  5CZX A;  4DV3 J;  2V5H G;  2WVE A;  1M1K T;  1ZAX A;  2OMO A;  2RSQ A;  3HZE A;  4NLR A;  4DR7 J;  4K50 A;  1S9E B;  1RBO B;  5B0E A;  1HWL A;  1NKB A;  5A8R A;  2DJW A;  2VG7 A;  5THW A;  2WOM A;  2DR5 A;  5AJ3 F;  1P1L A;  2DO4 A;  3MMB A;  1D9F A;  3AA8 A;  4USK A;  3A8K A;  2YBV A;  3MPU B;  4OX6 A;  5F3T A;  3CJK B;  4DU7 A;  4LF5 J;  1JLF B;  2WVD A;  3Q86 A;  4B3M J;  2LQ9 A;  2AJF E;  3NOC A;  4U8Y A;  4IKA A;  1T3O A;  3CO9 A;  1KLM B;  5IT9 U;  3GE9 A;  1R0A B;  3NRB A;  5HRO A;  1ZZN A;  5IT9 Y;  5E2Q A;  4U67 Q;  4IOA Q;  2VDH A;  4ZP8 A;  2WHO A;  2V9K A;  2FHK A;  4HEA 9;  5T7L A;  1HBO B;  4YME A;  2R7O A;  3IMQ J;  3NGR A;  1UVI A;  1UEK A;  4FS2 A;  2XZD B;  1S1W A;  1JJ2 R;  3EWG A;  1YBT A;  3H2V E;  4MAK A;  2KT2 A;  3MPV A;  2DGV A;  5BYS A;  2H4Y B;  3MF5 A;  1AFJ A;  4RW8 A;  2X3D A;  2DBB A;  3QBC A;  3S7R A;  4UUX A;  4QQB A;  4Z2X A;  4OYM A;  1WKJ A;  2UZA A;  3I31 A;  4DPU A;  3W2W B;  3MI7 X;  2N4D A;  3DLL Q;  4ES1 A;  3IBW A;  1NDL A;  3FRY A;  1X4E A;  4ZOS A;  5M2P A;  2VPW B;  2GVD B;  3BH6 B;  1D8Z A;  3OTB A;  4LF8 F;  4ICL B;  2EBE A;  3MM9 A;  3MMA A;  3M2R A;  1ZA1 B;  1RTH B;  1N33 J;  1IM6 A;  3NL0 A;  2GAH C;  4ETX A;  1HNZ F;  2VL1 A;  2ZH9 A;  2OKQ A;  2W2O P;  4LF4 F;  1SJR A;  3ZZR A;  1TU0 B;  1YBA A;  2RQ4 A;  4O23 A;  1HQU B;  5IC6 B;  3MPY A;  1TVR B;  4WE1 A;  1FRL A;  4JYA J;  4PUO A;  3QRQ A;  1PAU B;  5FII A;  3PXG a;  3ITH B;  3DHX A;  2WW8 A;  3CJQ A;  1RLC L;  2ZH6 A;  3P5T L;  4IH5 A;  3MUV P;  2ZH5 A;  2DCL A;  4QIW D;  2HHP A;  5KT5 A;  3T5K A;  1IXK A;  2H9Z A;  3M2U B;  3TJ9 A;  4ATN A;  3HHN B;  4PYA A;  1S1T B;  5KG0 A;  3UNG C;  2R7R A;  4ZJO A;  4FYX B;  3VGS A;  5F3Z A;  4ITS A;  1H2U X;  2CJQ A;  2JC0 A;  5K5M A;  3BO3 A;  1F60 B;  2ZOF A;  4DPY A;  1YIT S;  1L3S A;  5F8N A;  2YKP A;  2CDQ A;  1LNQ A;  4R5P A;  2FJX A;  3Q8V A;  4PKD B;  4IRC A;  1UW4 A;  4LF5 F;  2J9D A;  3QRP A;  1HBN A;  4QIG A;  3RAX A;  2AGO A;  1QAX A;  3AD8 C;  5FJ4 A;  4EBC A;  3JQM A;  4Y2M A;  1QAY A;  3QSI A;  2R2U A;  4JI1 J;  2DYA A;  7FDR A;  1J5O B;  4WKY A;  4LJM A;  3K5M A;  1R89 A;  4AT1 B;  3RBZ A;  4RUH A;  3HVR A;  4ZMM A;  3E01 B;  2PC6 A;  4F3O A;  5KFI A;  2XZT B;  5KFM A;  4GC6 A;  2IC3 A;  2C2O B;  2BAN A;  1IWA A;  1GTE A;  1X4C A;  4ZS6 A;  5BXI A;  4YB6 A;  4ZPT R;  4RPF A;  2MZJ A;  3MM8 B;  3NCQ A;  2R4F A;  2X1A A;  4CTA A;  3VAJ A;  5CA5 A;  4OI2 A;  4ECV A;  2F9D A;  4JV0 A;  4F25 A;  1WEL A;  1HD1 A;  2Z30 B;  3PNI A;  3TX0 A;  2ZH8 A;  1FCA A;  4QW8 A;  5LMN J;  3ZTR A;  1YZ7 A;  1Z2L A;  1ZM4 A;  3GG1 A;  2W9C A;  2FJB B;  4L3K A;  1Q4R A;  3KNG A;  4C48 A;  1MU2 A;  3RR8 A;  2HQC A;  1NPR A;  3L3C A;  3BZQ A;  3NKY A;  4ANE A;  3FZB A;  4UOH A;  3UR0 A;  1OYD A;  1MW7 A;  1X8D A;  1QAI A;  3SSS A;  4HYK A;  1U45 A;  2EC2 A;  4JYA F;  2B9W A;  2QJ3 A;  2QC3 A;  2F40 A;  5J2Q B;  4WK1 A;  1MRO A;  3FFI B;  4I68 A;  4B3O A;  5C42 B;  5D3G B;  3RRH A;  1IVZ A;  4ELV A;  3QO9 B;  1AZS A;  1SC4 B;  2QTW A;  4FBU A;  2NXN A;  2CFX A;  4Y00 A;  1BD6 A;  2BE2 B;  1PBU A;  4LFA J;  1KFS A;  4DV0 F;  2H4W B;  4F7V A;  1R0C B;  1FI4 A;  3OTD A;  1RT2 B;  3ZZZ A;  3RRK A;  5U47 A;  1UL3 A;  4JI2 J;  3JTO A;  5K8N A;  4L75 A;  4OZN A;  4ECX A;  2IJN A;  4OZ3 A;  4OYB A;  1Q86 T;  1KC8 T;  2R7T A;  1CJU B;  2Z2Z A;  3GJT B;  2M8D B;  4X4U A;  3EPI A;  2CNN B;  5BR8 J;  2XNR A;  1SUQ B;  4OJH A;  2KFZ A;  1EP4 B;  4ZCM A;  1GMV A;  3BRE A;  3KUE A;  2HNY B;  3C46 A;  1SKW A;  3H5Y A;  5KAK A;  2RHS B;  3D3B J;  1QY7 A;  3J7Z 5;  3M8Y A;  4Q43 A;  1JLB A;  2YX4 A;  2IJF A;  5AXN A;  1V6H A;  4IOC Q;  3NBP A;  2C2K B;  1RAA B;  1RAC B;  4XO0 A;  3N4W A;  5DLG A;  4OV1 A;  3G9C A;  4NA2 A;  3PVX A;  2UP1 A;  1RE1 B;  3DC2 A;  4L72 B;  4WFA Q;  3W8G A;  1FRI A;  1FK9 B;  1S1V A;  2W4D A;  3BKU A;  4PAB A;  3TUP A;  1RTI B;  2V4J B;  3O44 A;  4MIA A;  2AU0 A;  2HSE B;  1T9T A;  2KO1 A;  4FF2 A;  2FHJ A;  4XPC A;  1RAJ A;  3HFZ B;  2X1F A;  4FVC A;  2Y1I A;  3PYF A;  3VTI A;  3IS9 A;  4N47 A;  3V6D A;  1VOM A;  1WDT A;  1YI2 S;  1J2V A;  2XO7 A;  3J7Y I;  1JNZ B;  4PR6 A;  1HNI A;  2DB1 A;  3R9L A;  4YFU A;  3IR6 B;  2G2Y A;  3OTC A;  3PW7 A;  2CVE A;  2EFN A;  2A6M A;  5LSO A;  2HFU A;  5ETT A;  1AYE A;  4C4W A;  4WZM A;  2CPZ A;  3MCS A;  1CJV B;  2EKY A;  2MMY A;  1YZ6 A;  2DNM A;  1UPP A;  2CPX A;  3D67 A;  2EG1 A;  2DXF A;  1O5J A;  1OY6 A;  4EU0 A;  3ZZP A;  3M8S A;  4RUB A;  2VOD A;  1VRQ C;  3GCX P;  2C3M A;  4K2X A;  4YS2 A;  3MMJ A;  2UVW A;  1WG1 A;  3I6P A;  4GRS A;  3I87 A;  4ZLJ A;  2OEL A;  3MM7 B;  3DGP B;  2PFF B;  1OJ4 A;  7AT1 B;  1D8Y A;  4YHH J;  1WF0 A;  3KDN A;  1URR A;  5EUH A;  1KD1 T;  2YPZ A;  3HMJ G;  4HH1 A;  4JI2 F;  5H9E J;  2HGN A;  4UT4 A;  3IP0 A;  2OPQ A;  2DNK A;  4K4S A;  4Q8E A;  2DIS A;  4DQR A;  1F3V A;  2G4B A;  2R8J A;  1S9E A;  5BR8 F;  3P96 A;  5KFW A;  2XS7 A;  4F26 A;  3LOU A;  4UZB A;  2MPU A;  1U1R A;  2XMV A;  3HSG A;  4LBH A;  4BC9 A;  3POT B;  4IYQ A;  2YKO A;  3L7P A;  2R7S A;  2FTR A;  1BE4 A;  1FFS B;  1CBK A;  1SC1 B;  3CJK A;  1P9Y A;  3A1Y G;  1SQG A;  2IVF B;  1JLF A;  3NMR A;  4C8O A;  1OPI A;  2PI4 A;  1RA6 A;  2ZWP A;  4DSL A;  1F5C A;  4NPO A;  3I96 A;  1H7W A;  2QLB B;  3NG8 A;  2I1R A;  4DPO A;  1KLM A;  5ADZ A;  2DR9 A;  4ZVE A;  2NLW A;  1R0A A;  4K4W A;  3U1M A;  2MKJ A;  1X0P A;  3UN2 A;  4JI3 J;  1HBO A;  5KFL A;  3BR9 A;  3IC1 A;  1JLQ B;  2VIH A;  2E1M C;  3GV5 B;  4QWD A;  2E5I A;  2PA3 A;  3F44 A;  2E1P A;  1IKX B;  2PDA A;  5DRK A;  2UXC J;  1NUE A;  3KUH A;  3OL6 A;  2H1Y A;  1LFW A;  1MLA A;  1HWU A;  3RB6 A;  1U26 A;  3DLH A;  4HHH A;  1Y5L B;  4UQG A;  4ECU A;  4Q5V A;  1VLY A;  4WK3 A;  4OHZ A;  1J5E F;  4EFA C;  4LT6 A;  3W2W A;  3VV2 B;  3UW1 A;  3BDP A;  3MD1 A;  1MNE A;  4BC7 A;  2GVD A;  2G0I A;  1TL3 B;  2CQ1 A;  2IBO A;  4ICL A;  3O6Q A;  1T03 B;  2VG5 B;  3ENV A;  1BMQ B;  1RTH A;  1UVM A;  2AGQ A;  1N8R T;  2HFZ A;  2BV3 A;  2PMH A;  3Q83 A;  1IBM F;  2BW7 A;  4UY8 5;  3CJR A;  2ROP A;  4W92 B;  3NGT A;  1B70 B;  1HQU A;  1TVR A;  2RU9 A;  4X4P A;  4YHH F;  2ZEJ A;  3RBE A;  4XDD A;  1JJ4 A;  4KSE B;  3P45 B;  3ITH A;  3FEZ A;  4DQP A;  1ZYQ A;  2R9L A;  3BQ1 A;  3IFE A;  2V2V A;  5K9F A;  1VBZ A;  4FYV B;  1GH8 A;  4CO3 A;  2ZBC A;  3EVO A;  3M2U A;  3G8T A;  2ZBP A;  2ZNY A;  1S1T A;  1WJ9 A;  4HTJ A;  1GXL A;  2NPI A;  1XQI A;  1HIY A;  2O67 A;  5ETM A;  1Y11 A;  2GNK A;  2AZ3 A;  4LQ3 A;  3HT3 A;  4IRD A;  2DY9 A;  4OL8 A;  4M5D B;  1O0P A;  2CJA A;  4KBI A;  1VC6 A;  4Q2M A;  2BX6 A;  2DGO A;  1NBE B;  4QZV B;  3EZU A;  1HHQ A;  1EHW A;  4DXL A;  1J5O A;  4RJV A;  3G6V A;  2NCK L;  4F4X A;  1VQ8 S;  4FF3 A;  3E01 A;  3HKW A;  2VQE J;  1KQG B;  2GJI A;  3DYA B;  4IG0 B;  2IRU A;  3NEK A;  3QT5 A;  1XIQ A;  1U8S A;  1URN A;  3MM8 A;  4KHM A;  3Q2T C;  2UU9 J;  1JJC B;  2KG0 A;  2UV8 G;  3TA0 A;  2F65 A;  4I0W A;  5LL6 d;  2V8D A;  4DLG A;  2QT7 A;  1TAQ A;  1RT1 B;  4RNN A;  1P8G A;  1R8A A;  1UZH A;  3UDL A;  2AEM A;  2W8K A;  2MKH A;  2H65 B;  2HHT A;  1RKI A;  5ETN A;  2QRR A;  3MPW A;  3UN5 A;  4QWB A;  3VZI A;  2HIQ A;  3SIP B;  4JI5 F;  3BJY A;  2V8H A;  2ZE2 B;  2FJE B;  5HQL A;  2CKW A;  4CM0 A;  4OLP A;  2MZS A;  1QE1 B;  2KYX A;  3UDV A;  3CDW A;  4OJ3 A;  3QNW B;  2ADC A;  4DR2 J;  4OI6 A;  2Z57 B;  3KLG B;  4DL5 A;  4MYU A;  2Q6C A;  5J2Q A;  2YQ1 A;  3FFI A;  5C42 A;  5D3G A;  3MGJ A;  1RYS A;  3M1V B;  4YP3 A;  3QO9 A;  4ZVH A;  4V19 J;  3N6L A;  2AX1 A;  4OX7 A;  3BS9 A;  4C8M A;  5E3A A;  3T5H A;  2HRY A;  3R5B A;  3DLK B;  3NGD A;  1U2C A;  2BE2 A;  2DD8 S;  3QAE A;  3MUR P;  1LW0 B;  2ZM6 F;  2WVC A;  4LF7 J;  1VRT B;  1LWX A;  2HS3 A;  3RYL A;  2IBK A;  3FBE A;  1WHV A;  2RKI B;  2AF6 A;  2RH3 A;  3CJT A;  1AUD A;  1WSR A;  4WFX A;  1CJU A;  4NLX A;  1OY9 A;  1IKV A;  3QID A;  4G3I A;  4B17 A;  1WAC A;  4K0K J;  1SUQ A;  2ZBR A;  4BCA A;  2FJA B;  2C42 A;  1EP4 A;  2EWH A;  2HNY A;  3PKY A;  4QJV A;  2AEJ A;  2YKA A;  3DU5 A;  1PO6 A;  3AAW B;  5B0A A;  2VQE F;  4ED3 A;  4DV4 F;  1WOR A;  4KT0 C;  4ECW A;  2DH8 A;  2R2T A;  1OY8 A;  5ETK A;  3M8Q B;  5ETR A;  1FXR A;  2V0N A;  2MKI A;  4HLB A;  2AYG A;  3GP9 A;  2DEI A;  5HBM B;  3WIU A;  2QL5 B;  2NUU G;  1N34 J;  3HFK A;  2KU7 A;  4OX9 F;  3PFE A;  2YX1 A;  2BRL A;  4M5K A;  3HJF A;  3IRW P;  2DHA A;  3TOQ A;  2OD6 A;  1BGX T;  1FK9 A;  1S7I A;  1TFY A;  3LGM A;  1RTI A;  2V4J A;  2E7V A;  1SH2 A;  5K14 B;  5M2U A;  2W9B B;  2PEH A;  3CCT A;  1TP7 A;  3KLH B;  3WZ0 A;  4DR3 F;  5GMD A;  3H40 A;  2CQ4 A;  5D77 A;  1SBR A;  1NEE A;  3JAM U;  1P9Q C;  1H73 A;  3Q89 A;  3BSO A;  3JAM Y;  3K7R A;  1FRJ A;  4HI2 A;  4J7C A;  2KHC A;  3ETO A;  4LMZ A;  1FO1 A;  3SYZ A;  3IGN A;  2G13 A;  2QFJ A;  4FXD A;  2DRA A;  4I69 A;  3MR2 A;  1K0V A;  1CJV A;  4MTP A;  1KRP A;  4OYO A;  5FD1 A;  2GAG C;  4IO9 Q;  3L9Z A;  3UCZ P;  2JC1 A;  3EZO A;  4JI6 J;  4U7C A;  2XLI A;  2CZ4 A;  2KFN A;  3GFH A;  1Y3K A;  4UF4 A;  1U0S A;  3QAU A;  3RRG A;  4ECT A;  3PYG A;  5GAG U;  4IR1 A;  4LRF A;  2CJB A;  1I5O B;  4DR6 F;  1RI7 A;  3MM7 A;  3DGP A;  2EXU A;  2ZVS A;  1JLG B;  4JB8 B;  4EK2 A;  1HQE B;  1FJE B;  3I56 S;  2DRD A;  2N4C A;  1I51 B;  1UFL A;  4ZJL A;  5ETO A;  2DR7 A;  4MYT A;  3VAM A;  1XTZ A;  3OSN A;  3K89 A;  2FIU A;  1VGY A;  1RT7 B;  8AT1 B;  2QLF B;  1QDU B;  2FLL A;  2QA1 A;  1UEU A;  2J9E A;  4FNH A;  1U47 A;  2DPJ A;  3KUG A;  4M94 A;  2LQ5 A;  3AH6 A;  4GC7 A;  2B9E A;  3F41 A;  2W7A A;  3POT A;  1RWO B;  2AMC B;  4WXW A;  4TYA A;  3VQT A;  3HZG A;  3P4U B;  4Y28 C;  1H38 A;  2WVB A;  3CJ4 A;  1YIJ S;  9ATC B;  1YGY A;  5F8M A;  4RKU C;  5F9N A;  1RU2 A;  1HFE L;  2CPF A;  4H54 A;  3AOD A;  3TQE A;  3M9M B;  2RUS A;  4CLZ A;  3PW4 A;  1UFW A;  2WB4 A;  1WD6 A;  3W8P A;  4NXN F;  1T95 A;  3OPK A;  2XZW A;  4JBC A;  3M6X A;  1TMM A;  2YH1 A;  2RQM A;  2LQ8 A;  3MTJ A;  1N32 J;  3J81 j;  3PCO B;  4QR1 A;  4DMZ A;  2Z2M A;  3AD9 C;  1KLN A;  1JLQ A;  4CDI A;  5DDQ C;  2LQJ A;  1S48 A;  3BYR A;  3D0H E;  2YKQ A;  3SV4 A;  1IQZ A;  3TAN A;  4AND A;  3RJM B;  2J8A A;  1IKX A;  3TZZ A;  2CAD A;  5KFF A;  4WFB Q;  1S6O A;  3QGG A;  4Q0B B;  2B4P A;  3GZ7 A;  3CJ3 A;  2KFY A;  5G0R B;  2OEJ A;  1YX2 A;  4TLR A;  3VAI A;  2ZD1 B;  2Y3Y A;  3ZO7 A;  4KPC A;  2J9D E;  3GON A;  2HHU A;  1S5Z A;  3EPG A;  1R43 A;  1HBU B;  2KRR A;  3W9J A;  4J9R A;  1UWA A;  1TL3 A;  3Q8S B;  1Y5I B;  3GB0 A;  5DQI A;  1T03 A;  4JI0 F;  2VG5 A;  1UP1 A;  1QVG R;  1N88 A;  2YQ3 A;  3HJV A;  4EBE A;  5KG7 A;  4HL9 A;  4MKV A;  1VQS A;  5HAN A;  4X66 F;  2UVU A;  3TRG A;  4QU7 A;  2L9N A;  4TU8 A;  1FDB A;  1UKU A;  4ILR A;  1M5K C;  3W61 A;  2LP4 A;  5T14 A;  4B9L A;  2XMW A;  3LAN A;  1IR2 A;  2E5L F;  1EB0 A;  3AOA A;  2ASD A;  2JDJ A;  3PTW A;  4YDX A;  1NK7 A;  2VQF F;  3G96 A;  1H98 A;  2HVI A;  4FXW A;  1Q95 G;  5FDL B;  4U7U K;  4YUD A;  1DJ0 A;  3R5C A;  1RAH B;  2CZ9 A;  3R1H A;  1XNQ F;  1KVI A;  3SCI E;  4EEY A;  2HWT A;  4YDD B;  1PSD A;  2QX0 A;  4OYA A;  4ECS A;  4M5D A;  1FX2 A;  2WTF A;  1PC5 A;  3T3F A;  3QJL A;  2E9Z A;  3D9B A;  1PIL A;  1X5P A;  1JXE A;  2WBR A;  1K1Q A;  1EIY B;  2VA2 A;  4D3G A;  3WC2 A;  3H20 A;  3VWS A;  5B7W A;  2FLN A;  5LT5 A;  2EW9 A;  3GYN A;  4LR7 A;  5CYM B;  4DSI A;  1G6B A;  4RO0 A;  3T1A A;  5KG5 A;  1FRH A;  3DYA A;  4IG0 A;  1FTC A;  4N8O A;  3FBB A;  1U6B A;  4WPA A;  2RE1 A;  3I4H X;  3Q0A A;  4KQZ A;  4ZIV A;  1QLN A;  1A9N B;  1KEK A;  4WYL A;  2Z8Q A;  5GVQ A;  1A7G E;  5IT0 A;  1X9W A;  1RT1 A;  1FWL A;  4DV6 F;  2G0J A;  2KJW A;  4O3P A;  4AFF A;  1VK8 A;  4DFP A;  4TKT A;  1GX5 A;  3R5J B;  1HI0 P;  4C3M A;  4A8F A;  4DX5 A;  2VFV A;  1UVJ A;  4C8L A;  4EI2 A;  4UOG A;  4G1Q B;  5GAH U;  1S97 A;  3S8S A;  2DIU A;  2V68 A;  2ZE2 A;  1S6U A;  2FY1 A;  4C2M A;  2BOA A;  2BE9 B;  4GVB B;  2XS5 A;  4UZC A;  3G87 A;  4CQ1 A;  3SEO A;  1QE1 A;  4CLL A;  4LRE A;  4CT9 A;  2GJ2 A;  1YBU A;  1VQL S;  2W7O A;  1KOO A;  3MXH P;  3D5M A;  2FVQ A;  2QMW A;  3T5L A;  5J2P B;  2IYG A;  2XYP B;  1N0U A;  3TAQ A;  3CCV S;  3KLG A;  3UD3 P;  3IR7 B;  4N8N A;  1YRT A;  1CPZ A;  4IFY B;  2H5E A;  5LSR A;  2HNZ B;  3M1V A;  2JZ5 A;  2QA4 S;  3DFE A;  2HLT A;  5HMW A;  4NLY A;  2EPI A;  5GAE I;  3DLK A;  2HVZ A;  2MZQ A;  4G6V B;  1GAO A;  3KK1 B;  2JH3 A;  1LW0 A;  4ZPC A;  3KHG A;  1N48 A;  2NR0 A;  1VRT A;  4N77 A;  4ZVU B;  2RKI A;  2ZH3 A;  4X65 F;  1GMU A;  4TY8 B;  2PA8 D;  2IRX A;  5HP1 B;  1OYE A;  2XQC A;  2WW4 A;  4CLU A;  1PKU A;  3B54 A;  3D1Q A;  5J2N B;  3N0V A;  3N28 A;  4J9N A;  8ATC B;  2V69 A;  4ERD A;  3QZ7 A;  2DH7 A;  4DL0 C;  1T3N A;  3TWZ A;  4B9N A;  2RDJ A;  3B82 A;  4ETZ A;  4OI0 A;  2DNN A;  3G6X A;  4DLE A;  5LMU F;  4PEO A;  5AXK A;  1DLO A;  3P5B P;  1UMJ A;  4DWI A;  3OTO J;  3M8Q A;  1RAF B;  2JLG A;  3UE2 A;  2CZV C;  4OYX A;  2MB0 B;  4LBI A;  1TUW A;  4WZQ A;  5HBM A;  3NCR A;  2V2Z A;  3J7A N;  3H4D A;  3O8W A;  2F3J A;  1GQE A;  4NLT A;  3DOL B;  3RB4 A;  1Q8B A;  5B09 A;  4HVZ A;  4P74 A;  4J9Q A;  1HNX J;  2XEX A;  2QA4 G;  3M30 B;  1HI8 A;  2G0C A;  2PO4 A;  4BLG A;  4NCB A;  5K14 A;  2BDP A;  5DQH A;  2W9B A;  1CJT B;  3SQO P;  4F4Y A;  1H3D A;  3KLH A;  5KG1 A;  2D3O 1;  2KM8 B;  1L3T A;  1DFD A;  2CG8 A;  1K44 A;  1FX4 A;  4NXM J;  3LPY A;  1R0B G;  2XYH B;  2CYY A;  2D3O R;  4NCA A;  1M1G A;  4X4T A;  3O1L A;  2MSS A;  1U09 A;  3GU0 A;  3LWM A;  2YWF A;  4KTQ A;  2FLP A;  5A0Y B;  4X2B A;  4E2F B;  2J0X A;  2APO A;  5D0G A;  3MEE B;  2MJU A;  2Y8W A;  4ES3 A;  5E7O B;  1F2G A;  3EUN A;  3BN4 A;  5KFJ A;  1UJ4 A;  3WHI A;  3ELH A;  1S4F A;  4EYH B;  2SXL A;  3VAK A;  1RJJ A;  2RB7 A;  5C2G A;  3H4B A;  5DS7 A;  1DUR A;  2JEG A;  1JLG A;  1ZM9 A;  1HQE A;  4ZVG A;  1RTJ B;  2Q79 A;  3CMA S;  4WXO A;  4DUY J;  4CO0 A;  2Z58 B;  1VBK A;  1IWG A;  3JQK A;  1O51 A;  4B9S A;  1D0E A;  5D4L A;  2G2O A;  1RT7 A;  5IC4 B;  3VCD A;  3ZZT A;  4I6A A;  3AXK A;  1WI8 A;  1ZM2 A;  1LW2 B;  1VYA A;  4EO8 A;  3QRR A;  1FVS A;  1UCN A;  3TA1 A;  1RWP B;  1XNR F;  2BA9 A;  4QPX A;  2HIY A;  4ZVR B;  2GIQ A;  2DHG A;  3OUY B;  2B9X A;  3CT9 A;  2F4F A;  5F8J A;  1ELO A;  5KFB A;  2YKN B;  1PC4 A;  2LEB A;  1C0U B;  2WVF A;  5F8I A;  4DF8 A;  4ZHR B;  5IV4 A;  1X60 A;  2VBW A;  4LF9 J;  1P1T A;  1NJY A; 
#chains in the Genus database with same CATH homology
 3W1Y C;  3D3C J;  4X66 J;  2UUA J;  2HHH J;  2MTL A;  4OX9 J;  4DR6 J;  5A2Q U;  4DR5 J;  3JAM U;  4LF8 J;  3J7A N;  3D3B J;  5LMU J;  4DV7 J;  3IMQ J;  3T1Y J;  4JYA J;  2ZM6 J;  4DR1 J;  4AQY J;  1HNX J;  3T1H J;  4PWW A;  1J5E J;  1HNZ J;  4K0K J;  4GKK J;  4LF4 J;  4JI8 J;  4JI4 J;  5LM7 E;  4V1A k;  4DR3 J;  4DUY J;  4DV1 J;  2E5L J;  4RJV A;  4JI7 J;  4DV3 J;  4GKJ J;  4DV2 J;  3R2D J;  2UXB J;  4JI3 J;  2VQF J;  4KYZ A;  4DV5 J;  4DR7 J;  1IBL J;  4NEY A;  4LFA J;  4DR2 J;  3J80 U;  4JI5 J;  1HNW J;  4KY3 A;  2UUC J;  2VQE J;  5FLX U;  4YHH J;  1XMO J;  4NXM J;  4JI6 J;  2UXD J;  4YY3 J;  4DV6 J;  4B3S J;  4X64 J;  2KL8 A;  1IBM J;  4HHU A;  1XNQ J;  2MEW A;  1N36 J;  4JI2 J;  2KVQ E;  5LMN J;  1I94 J;  4DR4 J;  4X65 J;  4B3R J;  1N34 J;  4X62 J;  2UU9 J;  4B3T J;  2UXC J;  4DV4 J;  3J81 U;  4LF5 J;  1N32 J;  4DV0 J;  4B3M J;  1XMQ J;  3R2C J;  5IWA J;  4JI0 J;  4LFB J;  4JV5 J;  5BR8 J;  5AJ3 J;  2MQ8 A;  1N33 J;  4NEZ A;  1IBK J;  4DUZ J;  1FJG J;  2F4V J;  4KHP J;  1XNR J;  4LF7 J;  3OTO J;  4LFC J;  4JI1 J;  1HR0 J;  5IT9 U;  4LF6 J;  4NXN J;  2UUB J;  4LF9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...