4LFBJ

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lfbJ00
4PWWA 1J5EJ 4DV5J 4V1Ak 4KYZA 4DUYJ 3T1YJ 2UXCJ 4B3TJ 1HNWJ 4DR5J 4DV3J 2UUAJ 1N34J 4YY3J 5FLXU 4GKJJ 4X65J 2E5LJ 4JI2J 2KL8A 2VQEJ 3J81U 3D3CJ 2UU9J 4DR7J 1N36J 4LF6J 2MQ8A 4OX9J 3J7AN 5AJ3J 2UUCJ 3R2DJ 4DR2J 4DUZJ 4DV6J 5IT9U 4JI3J 1XNQJ 4LF4J 4X66J 4JV5J 1IBMJ 2F4VJ 5IWAJ 4JI7J 4LFBJ 4NXNJ 4HHUA 3JAMU 4DR4J 1I94J 3D3BJ 4DV7J 4JI4J 1XMQJ 4JI8J 4NEZA 5LMNJ 2ZM6J 4B3RJ 3IMQJ 4JI0J 4LFCJ 1N32J 4KY3A 4JI5J 4LF7J 4JI1J 4LF5J 2MTLA 4DV2J 4DR3J 4LF8J 1HNXJ 4LFAJ 1HR0J 4LF9J 5A2QU 4AQYJ 4X64J 4DV4J 3R2CJ 2MEWA 2VQFJ 3W1YC 3J80U 4NEYA 4DV1J 1XNRJ 1N33J 2UXDJ 4DV0J 4B3SJ 1XMOJ 1IBLJ 4K0KJ 3T1HJ 1FJGJ 4YHHJ 4DR6J 4GKKJ 4KHPJ 2UXBJ 4JI6J 4RJVA 5BR8J 3OTOJ 4DR1J 1IBKJ 1HNZJ 5LM7E 2UUBJ 5LMUJ 4NXMJ 2HHHJ 4X62J 4JYAJ 4B3MJ 2KVQE
chains in the Genus database with same CATH superfamily
5LMUF 2VQEF 4O4GA 2YWFA 3A12A 3FEXB 1SL0A 2FVQA 1RACB 4B3TJ 1FRMA 2UUAJ 1GMUA 1YRXA 5CYQB 2VDIA 3EX7B 4XDDA 2ZBRA 2JEIA 3AXMA 4KPCA 1UFWA 3QPIA 3ENVA 3K89A 1HBOA 2W2OP 2E7XA 4B9VA 1S0NA 3MM5A 5IT9U 4KKOB 3R1HA 1ROFA 4JV5J 2CRLA 2F4VJ 5F0WA 2C1EB 2HFNA 3U02A 4R0JA 4OHZA 2R7TA 4X4QA 2CXEA 4JI1J 3GR1A 5HI7A 3HHNB 2K3KA 1XMOF 4DZDA 2DNYA 2BUNA 4UUXA 3MEGA 4BWMA 2UXDJ 1YJVA 3I82A 4ZPTR 2VJUA 1XN9A 1IBCB 2C2OB 5K20B 4JP8A 3EGNA 2KDOA 2B8PA 5HANA 2E1MC 2HHHJ 1CJTB 3FCHA 1C0UA 4TYAA 3FMBA 2F8MA 4W90B 4DR5J 4UOGA 3HD1A 2WVFA 1EP4A 4CH0S 5KFJA 4NWBA 1N0UA 1SCJB 3HHEA 1MG7A 4I2PA 1U0HA 4FP9A 4DMZA 1RTDB 3EDQB 1BXNA 3EVOA 5I3QA 4F8RA 2M0GB 1OQ6A 4K4YA 5KFZA 4NPOA 5HVGA 2FVSA 3PG9A 1Y0HA 4MKVA 4IDKA 5J2QA 2AZ1A 1X4AA 3CJSA 2IYIA 2VPYB 3MFIA 1S6OA 4MK7A 5GADI 2IDLA 5LSRA 3DOLA 2B5JA 4M5LA 3NGSA 4ZVSB 1PIEA 2DGTA 3AB4B 3H4BA 3G82A 2GHPA 2Q1LA 3MMJA 3HVRA 4HH0A 4QIGA 2XSFA 5HROB 1S77D 1BHNA 2NXCA 3ZZOA 3T9ZA 2DGUA 4JV1A 2BKNA 2ROGA 4XIUA 1U2FA 1JXEA 3CCRS 2O3DA 3B78A 3KK2A 3TA1A 2PGCA 4YR3A 3DRPA 2RDIA 3MPUB 2JLGA 4U8YA 3HO1A 4ZCKA 5MAOA 3RBDA 2QV6A 1VC0A 1JLFA 3VCDA 4C3LA 3KLEA 4USUA 1RA6A 3C2PA 4ES1A 4F4YA 1OY9A 3HHKA 1DTTB 2ZD1A 3DOMB 4UZCA 4B3SF 4HTIA 1UVNA 1JJ4A 4EWTA 2YX1A 4LUBA 4X64J 2KVIA 3PX6A 2XZWA 1WOPA 1IQZA 3SV3A 1DURA 1ZZNA 2VPWB 3K7RA 5D15A 1CVJA 2A2CA 4KGKA 1S7HA 3RTVA 5AE1A 4NXMJ 2Z57B 1RAHB 3DLHA 1WI8A 1VCTA 4B3MJ 3F0NA 3TVYA 3MR2A 2UXCJ 9RUBA 3R7BB 3VAMA 4AE5A 2B4VA 2J9DE 4BC7A 1Y11A 4NYOA 4F04B 2VFTA 3MMAB 4ECQA 1JLBB 4DV6F 1EIYB 4F02A 3QT8A 4Q8EA 4K7QA 3ZNJ1 2G2YA 1XR6A 3D28A 1SKWA 1B64A 2YXLA 1HHTP 4JI7F 2XWXA 1F3VA 1BLUA 1FFWB 4TVAB 4EBDA 3BN4A 4KR0B 3QO9B 5E5NA 4O44B 3L7UA 2G9OA 2XS2A 5D4NA 3OVSA 2MLXA 1HARA 1F5CA 3HFKA 3DLKA 2Z2YB 4C2MA 4DL6A 5KFVA 2MHNA 1TK8A 2H4YB 5J1EB 4O3NA 4YMEA 3W8PA 4LF7F 3V6DA 5E3QA 2AGOA 4CRJA 3OTBA 3OD2A 2C28A 3WHIA 4QWEA 2JL9A 2YBVA 3PHTA 2RHSB 4KH0B 1YRUA 2ZUGA 2EVZA 2Z0GA 5CAAA 2ERRA 2Q66A 3R97A 4DUYJ 3NRBA 4RW6A 4H4KA 3OFEA 2CNNB 1YGYA 4AL5A 4A8WA 2NCKL 3D0IE 1TZ0A 3ZTSA 1HQEA 3ADAC 4RW9A 1VBZA 3G6VA 1KQKA 3M1VB 3OVBA 2YKOA 3GYNA 1DTQA 5DDOC 2DD8S 4C8NA 4WK1A 3OQ2A 3DLJA 3CMQA 4O0NA 1RXOB 1FWKA 3RB4A 2CNLB 1FJEB 3OVAA 4NXNJ 5I3UB 1IN0A 2GHVC 3B8HA 4DJBA 1XTZA 2HBQB 2HQ3A 3W5XA 3WIUA 4OI6A 2DO4A 4RWWA 4CNZA 2F65A 2ZJRQ 4DHVA 4B9MA 4ZVOB 3W2VA 2Z2LA 2OEKA 1X5PA 2VKZG 4HACA 2F8HA 1WC0A 2YWGA 3CCLS 3BGRB 1VRTB 3GIKA 5HAOA 5E3AA 4J9OA 3MFHA 4K0KF 2QSFA 4LSZB 4EO6A 3GQCA 3LPYA 4GKJF 2GGPB 4RO0A 4RUAA 1R8PA 1RTJB 3FBFA 1T03B 1RTIB 4F0KA 5CABA 3LAKA 1C4CA 3MHYA 1DRZA 1KBRA 5T7LB 4OI0A 1X0PA 2OGUA 4CO3A 1PYSB 3US5A 1TK5A 4LF6J 4I6YA 2MMYA 5EHHA 3ELHA 3PYEA 1JK9B 7AT1B 4DL3A 3R5AA 2OSQA 2CQ1A 2UVRA 3JSBA 1PC5A 3MD1A 3R27A 2UP1A 2GIQA 3OXLA 4WZMA 3EUNA 2P9GA 1QD1A 1R0CB 2HRUA 4MAKA 5GADU 3SCKE 3VGTA 2HVIA 2L3MA 3OSPA 2UV8A 4IG3B 5KFKA 3CUNA 3C8YA 1U49A 1U8WA 4OHVA 1FK9A 2HG4A 5BR8J 3JYTA 1MROA 4RZRA 5I3PA 4CDIA 2IJFA 5B0GA 3AHPA 3M8ZA 1RHKB 1YZ6A 2Z30B 3SQGA 3CXCR 1LK5A 2AYGA 3I56S 2MZRA 2X3GA 3ILOA 3MMCA 2COLA 2VG5B 2AX1A 2VOOA 3MOZA 4B9NA 1LV5A 4RW4A 2FQQB 2JSXA 5F9LA 3AFGA 2KYXA 2BVZA 3W2WA 1N36F 3MAHA 3EPGA 4Q43A 4RBUA 3BKFA 1U2RA 1TL3B 5A8WA 1R8CA 5A8RA 4ZDNA 1OMSA 1EARA 4OZ0A 2OPSB 2DHAA 1N32J 4DCOB 4YP3A 2PMHA 3BQ0A 3MAQA 2V9KA 1IKWB 4WE1A 3HSJA 4NCBA 4LF9J 1MMNA 4ATNA 3JQKA 2OPPB 2ZH1A 4LRCA 4FYYB 3HK2A 4ECTA 1UWBA 2GNKA 3OBIA 3DI6B 4N41A 2V6AA 1G4CA 3HFZB 4DV1F 3FBBA 4FPIA 2IMWP 2ZDPA 4F67A 4X4VA 1V3RA 4A8SA 2HQGA 1S48A 3PDNA 1L3VA 1KRPA 1VYAA 1B7YB 4JYAF 1LW0B 2FHOB 1Q5VA 5IC6B 5MLCV 4AXIA 5LXRA 1SUQA 1SIWB 3AH6A 3ZZRA 2ALYB 2FGCA 2FHKA 1P9YA 1VI7A 4AXJA 4GO7X 3CD5A 2DGSA 3PYFA 3UD4P 3DFEA 4MK9A 4X4NA 4F0MA 1KQSR 4ZKAA 4J9LA 2RRNA 1DARA 2EKNA 3IMQJ 3RAMA 4DR3J 1YI2S 2ILYA 2HIYA 2LKZA 1GFWB 4IRCA 3UD5A 1M1KT 4ENOA 1M5OC 1UAWA 4DPOA 2CPYA 1Q7LB 1U09A 1RT2B 3CDAA 2DH9A 4NRTA 2G0IA 2W4CA 3W9HA 1XJWB 1LWEB 1VQ8S 4EU0A 1D8YA 2JEJA 4RUBA 1UJ5A 5E3CA 4LR9A 3A3OB 3LALA 3DXBA 3Q8QB 4F4AA 5DQGA 2IA6A 1RBLA 2F8EX 1HPZA 1S1XA 3ICLA 3UW1A 5IM0A 2OPRB 1RWUA 2B43A 3ENQA 1JLGA 2NSCA 1D9DA 4RWXA 4ZN1A 4NLVA 3EVWA 1KC8T 5LMNF 3KJVB 3PXGa 2RD5C 2KXFA 2KT2A 3HP6A 1YBTA 4CTAA 4AL6A 2EPIA 3P49B 1RT6A 4IFVA 4X4UA 4OI2A 4DN9A 3HPOA 4DFKA 1KN6A 3LOUA 3UO0A 3V6KA 3LO3A 5DG8A 4KY3A 2MTLA 3V5RA 2W2QP 3PEHA 1HBUB 4PG6A 2MDAA 1KLMA 3QT6A 4PZVA 4C7QA 1P6TA 3F56A 1RHQB 1FD8A 4DL2A 4DX8H 1FT8A 2HWIA 3Q24A 4WF9Q 5LT5A 3EPIA 3PM9A 3OTOJ 3BGLA 2UZAA 2KU7A 2MKYA 1X8DA 1M90T 2RF2A 5J2PA 1G7CB 4EBCA 2C42A 3C6TB 3PKMA 1HW8A 3OT9A 4ED6A 2PFDA 1UVMA 4KFBA 2CDRB 1O5JA 1HBMB 2JJ4D 3DOKA 1VR6A 1I3OB 2FJBB 2NSBA 2RH3A 4WXWA 4DCPB 4DG1A 2WSEC 3DLEB 5KG3A 2DKOB 3FC9A 1W26A 4ZIVA 2K2PA 4AYBD 2W9AA 4MIWA 1E6YA 2B9YA 3G6YA 2MGZA 3LP0B 5AT1B 1JLCB 5KFMA 1S1UB 1T9YA 3SFUA 4CLPA 4OX7A 2YWKA 4TYBA 2DCUB 3H5YA 3TJ8A 3IG1A 2LYVA 2Y0BB 4B3RF 3I5CA 1WORA 3FQKA 5JVHQ 3RAQA 3MPDA 5KFTA 2BA9A 1FFSB 3E01B 2CQ4A 3PNIA 3W1YC 4NEYA 3QWPA 4UQGA 1IBLJ 3L7PA 4LSNB 2UXBJ 4WZQA 3S01A 4KC5A 2HGLA 2GVZB 4GVBB 3QGIA 3H42A 4NLSA 5K8NA 1N56A 2BE9B 4K4TA 3WX8A 3LW5C 5H9FJ 1BQNA 2VPZB 5DS7A 1VRUA 4KHMA 3I0SA 4JI2J 2J9DA 1VBKA 1LWCA 1KHWA 3FKBA 3Q89A 1CQMA 1YJWS 1JKHB 2DRDA 1TV6B 2W4PA 3LA0A 1H73A 1I5OB 1PJ7A 4CZCA 4NA1A 3VAHA 2R8HA 1R0AB 1FJ7A 2MLZA 1VIXA 2FTRA 3JXOA 3DLLQ 2M4MA 3GFHA 3N6MA 2DXEA 3I4PA 1RADB 1HYSB 3IAS9 3R5GA 3I31A 2Q43A 4W92B 1GT8A 3HVTB 2EFQA 3EGZA 1TFWA 1NMEB 3TW0A 4EZ6A 1LWXA 3M8PB 3I9V9 3NP5A 2QMXA 1GNKA 2ACYA 3POTB 5KFIA 4CLUA 5AE3A 2MY8A 2K1RB 4LRFA 3PR5B 2J0XA 3T1YJ 1F60B 5DZ7A 4C8ZA 3TANA 4TY9A 3RR8A 2XG8A 1M5SA 3D9BA 2HFSA 3S1TA 2VZ9A 1UA0A 1SJRA 3R6LB 3KLIA 1MU2A 2Q6BA 2FHMA 4KAIA 1X0FA 2J76E 3PY8A 2ZBIA 1JJCB 1SH0A 3WC0A 3CJ4A 3CC7S 3GLJA 1VRQC 1AYEA 1HI8A 1RK8A 3KNGA 4I4BA 2XQCA 4NA3A 3OL9A 2NQPA 3Q2TC 4Q0BA 3TR5A 4P7VA 3AQOA 1NDKA 4J91A 4LFAJ 3RR7A 4C6AA 4M5GA 4X4OA 4XO0A 1RWWB 1R8HA 4GO5X 3IAM9 1X4BA 4HR2A 1NDCA 4RNOA 3V4IB 3D5MA 1DBDA 1T95A 4OV1A 3A8JA 3PV8A 5RUBA 4CLFA 3I0RB 2B9EA 4NLWA 4DFMA 1BE4A 4JV0A 2D3ZA 3NWRA 4CO1A 5AJ3F 2P8IA 3QIPB 4OFZA 3PZPA 3DRYA 3KLFB 2H3EB 1TKZA 1FDAA 3GJQB 1FTCA 2PMWA 4WCEQ 3J7ZT 1VQ6S 4Y2AA 4WXOA 4C11B 2VC0A 1OSDA 3V81A 4NMLA 2XY5A 2N7CA 1S10A 1QE1B 3MCMA 1HNVB 4GC6A 3RRGA 3MR7A 2VFSA 2CQ3A 1U1QA 4GKKF 4E8UA 3MGJA 3VVTA 1VMBA 5J2MB 5CYQA 4QZVB 1JXVA 4U6PA 3CCSS 3SV4A 2CJKA 2GAHC 3TVZA 4KKOA 4OMFG 3MR5A 1S6PB 4KT0C 2DHHA 4URQU 3HJVA 2VBZA 5D6GA 3BN7A 2XMJA 1FRJA 1O6XA 3L9ZA 2EBGA 2IDEA 3ETMA 2OTJS 4OZ1A 3J7YI 4WYWA 2CPHA 5M2PA 1RT1B 3TAMB 1HHSA 3MEDB 2V94A 3UVJB 2RRAA 5D0RA 3O2IA 2DRAA 1FNMA 1RWMB 3SSSA 2DHXA 1XIQA 4ES2A 4LF8F 3GWCA 1REVA 1FNXH 2XTJP 2YNFB 2YKAA 1IWAA 1CJTA 1NSPA 4F26A 3BH6B 2FZCB 4DV7F 1SC3B 2MQQA 1PBAA 3R5DA 3DU5A 3GIMA 1T05A 4MYUA 2CZ4A 4PAAA 1M1GA 4KPYA 2LMIA 5HMXA 1EZZB 1T3NA 1SQGA 1HNIB 4IOCQ 4UF4A 1RTDA 2FHJD 2PEHA 2ZKTA 5IT4A 1TL1B 1PBUA 3W9JA 3N0VA 3BM7A 3OTCA 2VHGA 3ZTRA 4ED8A 2F63A 1YJUA 1NKBA 2HIQA 4MKBA 5L1JA 1NCLA 2X7IA 1H2TZ 5B0BA 2UVVA 1WKLA 3IN5A 2BR0A 2YPZA 4JV2A 2HZAA 1RWOB 5FD1A 4IOBA 1OSCA 4J37A 2ASDA 2ZM6F 4RX6A 4PABA 4F25A 2V4JB 1RI7A 1HD1A 1C2PA 3DN9A 1JJ2R 4B17A 2CFXA 2FVRA 2ZH5A 2QFJA 3VQTA 5HROA 2WCXA 5KFQA 4WFXA 1N5YA 3UR0A 3ZZZA 2OD4A 2NS1B 3CCZA 1ZA1B 2XMVA 2AW0A 2YNIA 1WC4A 3KXDA 1C0TB 3HF5A 4N77A 1FRHA 3ITHB 2IRUA 2JX2A 4C48A 3MEGB 1B0VA 2BV3A 1LK7A 1R0BG 4ZPDA 1RB0A 1VC5A 1YVFA 8RUCA 1V3SA 4AL7A 4FKXA 2MKJA 3RBEA 3NMRA 3CJKB 2VQEJ 4ZCLA 3P6YC 3R7SB 1N88A 3VWSA 3DOMA 4ZVQB 2BJEA 4C9DA 4BLGA 3QIDA 4X66F 2BZ2A 1HL6A 1HWIA 1R89A 2EFOA 3H40A 1Q79A 2EXUA 4DL5A 2KXNB 2W8LA 3K57A 2MKKA 1QAYA 1U0HB 5DGBA 1TKXA 2H1YA 2H65B 4RKUC 2H5IB 4ETXA 4OV6A 2Q79A 1FKOA 2D9OA 1RYRA 1WHXA 1XR5A 2I8EA 3LWLA 5KFGA 2KM8C 4C8KA 2XCAA 4RL1A 4P75A 2B4UA 4Q7AA 4WPAA 4TU8A 3RAXA 4A47A 3FGVA 2QLBB 5DRKA 1NK8A 3OL6A 2VOPA 5J2QB 2FUG9 2RNEA 2E1PA 2CJXB 3MMAA 5KG0A 1JLBA 3TJ9A 4ZVTB 1XMOJ 4M5HA 2ZWPA 4MK8A 3VZHA 4UOHA 4FNIA 4N47A 5KFLA 2B5JB 2DH7A 3QO9A 3N5FA 2M70A 2BRKA 2KVQE 1OWXA 3Q8RB 2V2KA 2HFUA 1URRA 2GIFA 3AOAA 4MH8A 4WYLA 1NK0A 3NBPB 3PVXA 2R7QA 2DGOA 5KFFA 3M30A 3J81U 4ED5A 1R27B 3H25A 3LQVA 3M32B 5CH7B 2ASJA 1QUPA 3EXCX 1SH3A 2W8KA 4IYQA 4ZMMA 3KK2B 1SC4B 3DRPB 3C66A 5ETLA 4UW2A 4PEOA 4X4SA 4QR1A 5I4MA 2RU3A 5IV4A 3NWGA 2O67A 3LPEA 2V67A 3TZWA 4DV4F 1JLFB 2Z58B 2G1HA 1NUEA 2W24A 4J9KA 3KLEB 1A9NB 3CJRA 3M05A 2D1CA 1JLAB 4OYWA 2KM8B 4D3HA 1K1QA 3PFOA 3M1VA 4QYZJ 3PX0A 1SJ1A 3H8YA 2V69A 2QA4S 4KHPF 2DYAA 3TEGA 3C16A 2XNRA 3JSYA 3CJ5A 3PFEA 2HNZB 4QR0A 4V1Ak 5K5MA 1YTYA 5I3UA 2GV1A 2IAJB 1FA0A 3RJMB 1DAXA 4IH7A 1KQFB 3J7YU 2V8HA 2QA1A 4QR2A 5DDRC 2I1RA 3I9ZA 3AOBA 2ROEA 3H2LA 3NNCA 3TI0A 4KB7A 5B09A 1NK6A 5IWAJ 3T3FA 4DV2F 1WEXA 1Y4ZB 3BGRA 1QY7A 5D8HB 2KKHA 4QWCA 2N4CA 2Q3PA 4AQYF 2ATCB 1LNQA 3ILJA 2GMLA 2JVOA 4F3MA 2EFGA 1FDDA 2M3DA 1M5PC 1W2IA 2DNMA 1T03A 1L3TA 2HLUA 2WW8A 4ES3A 1VQ7S 2QX0A 4DR1F 2NZCA 4CLTA 5T7LA 2HS3A 4B3SJ 5KFCA 3W9IA 1WOOA 3CCMS 3KK1A 3V6DB 1S9EB 3W65A 3M8QB 3HLUA 1V3ZA 2FGOA 2WVDA 2IVFB 5KT2A 4CLLA 4DUTA 4QU6A 3MUVP 4HTJA 3G8SA 2MQPA 3VV2B 2VDHA 3CNQP 4WFAQ 3ZO7A 4ZLJA 2JNJA 1WD6A 4CO4A 3DMJB 3NG8A 4LSLB 4DV6J 4IG3A 4RW9B 2C3YA 1YSJA 5ETMA 2AEFA 5IQQA 4JI7J 1WKKA 4B3OA 4NMXA 2HGNA 4M63A 4LF2A 1KHVA 2HK2A 4O23A 2HNDB 4ILMA 2OPQB 5EX3A 3J80U 1KP6A 2VG5A 3CCWA 3LTOA 3UD3P 1UFKA 4FPRA 1X9SA 2POKA 3E3XA 1U1OA 2PIIA 2CJ9A 4YY3F 4HACB 4XAKA 3HD2A 2PSZA 3QLHA 1TL3A 3M8YA 2JHEA 1KNZA 1QVFR 2D3OR 4ZPVR 2OPSA 4X4RA 2FY8A 2HKEA 2KL8A 3TEHB 4OZLA 3G87A 2GJFA 4MKYA 5KG6A 3OXFA 1IKWA 4DQIA 1I94F 2XYPB 2OPPA 2HRTA 2B56A 1S72S 4OJGA 3DI6A 2RILA 3NGTA 4J9RA 2DNNA 4P2MA 2LP4A 3IC1A 2XSJA 1RWPB 4QOTA 3VAGA 4QWAA 5LL6d 4DDFA 1DQAA 2K06A 1LW0A 3MEEB 4W4MA 5A0YB 5KG1A 4QPXA 5F9NA 4CQ1A 4PCQA 4F3OA 1Z2ZA 1BQMA 3C6UB 2JLEA 1H2UX 2IM1A 5LXYA 2OSRA 2Z4PA 5ITHA 3WBZA 4L3KA 1FK9B 3G2XA 3TARA 3AAWB 2F9DA 1NHKL 1FWLA 3CJQA 2IBKA 4J9UE 5B0AA 5DO2A 3EZ5A 3GPAA 4GKJJ 2F1FA 2VFVA 1LKZA 4K50A 1U6ZA 1Y9OA 1HNWF 4PQUB 3QGHA 4J5OA 1TUVA 2HVHA 5D78A 1F9EB 3GJRB 3CCTA 4PXEA 2W1BA 5LJ5Y 4JI8F 3OR1B 1S49A 1RT2A 2BYCA 4RW4B 3UWTA 5EN1A 4NLDA 3RW6A 3PCOB 2EG1A 1RUSA 3BGFA 3OW2R 5A8WB 2F40A 1S59A 5T14A 1EB0A 1AFJA 4ZP7A 4URGA 2BM0A 2IJRA 3VQSA 3KJQB 2PD1A 2QT7A 1ZOTA 4UT4A 2YX4A 4O3PA 3L4BC 4C8LA 2DO0A 1KDNA 2DITA 1Q16B 4NI2B 4AFFA 2CNKB 3IFEA 3CF5Q 5IQ6A 1W7WA 3CDUA 4HHJA 3TNVA 2VBWA 3PKYA 5EUHA 1V6HA 2HAIA 4P74A 4NZ0A 4P2FA 4OX9F 1RAFB 2V5HG 1SQEA 3EVMA 5IT9Y 2GA7A 2ZOFA 3OJUA 1URNA 5FLXY 3HMJG 1HBUA 4J9VA 2ZBQA 3M6XA 2K8GA 1XMQF 2VD3A 5GMDA 2UU9F 1I6JA 2KT3A 4U7CA 2CWXA 2JDJA 4CIOA 4X2BA 3D0HE 2XGQA 3IGNA 3O3LA 3RRKA 3TX0A 3M2VB 2AWZA 5A6WA 1UMJA 1FXDA 3AOCA 3M4XA 5GAEI 3C6TA 3QGGA 4C8OA 1GMVA 2CQCA 3I87A 5E41A 4WFZA 3BO4A 4UUWA 1HBMA 4OYMA 2E9ZA 3FRYA 2XS5A 2M2BA 2P6SA 3DLEA 3UFCX 3AD8C 1J2VA 2CDQA 4ZJOA 2Z2MA 3VGVA 3Q86A 2PN6A 4H54A 2UVWA 3H59A 1UW9A 2LEAA 1JLCA 1PJ6A 2BJ7A 1Y00A 1QDUB 5EGYA 2MKCA 1WOSA 2Y9HA 2UUAF 3KUEA 4JI3F 4OLPA 3CSKA 1HPZB 2DIVA 5BYSA 4L74A 3E01A 1WELA 2ZC4A 1C4AA 1YKWA 2CQBA 2J6TA 3A4TA 3UE2A 3BSAA 1ACMB 2MYFA 4LSNA 4YS2A 2VFUA 5L38A 2HHUA 3QSYB 2GVZA 4GVBA 1I51B 1HFEL 3NOCA 4CTAB 1RT6B 4IFVB 5HQMA 2BKPA 4KIAA 1VHFA 3K0JA 3KOAA 2LA6A 1QAIA 3LGNA 1SC6A 4HYKA 1U02A 4WWSA 4JOUA 1N8RT 4E2FB 3MMBA 4A8FA 1MWZA 1BMQB 1RAAB 1TR0A 4OJHA 2MZSA 2DGWA 4DV0J 1HI0P 5CQGA 3B6BA 4AUKA 1KLMB 5IC4B 2GX8A 4EMDA 1JKHA 1NJIT 4TLRA 3W66A 2HHHF 4XPEA 2IY5B 1R0AA 4QBUA 2ZZNA 1YX2A 1HYSA 3JTNA 2NUHA 3TP2A 3FZ2A 3T1AA 5J1NA 2YKMB 1RSCA 3HVTA 1L5UA 4G3IA 4WFBQ 1NK9A 3FCWA 5A8KB 4I6AA 2BMBA 2E9RX 3M8PA 2EWHA 3GILA 4DG1B 2BANB 1YWXA 4J9NA 3POTA 2R7XA 1RT7B 5LMNJ 3BH7B 4ILLA 2K1RA 3C19A 1E6YB 2Y8YA 2QL5B 1UVKA 2AJ1A 3G8QA 2HS4A 1AFIA 1JNRB 2K7KA 3IRWP 4ZIWA 3KFWX 3CW2C 4P2XA 2UUBF 2FB0A 5AXKA 4ZN3A 1EHWA 4OHWA 1FJGJ 4L75A 3MAAA 2ZBPA 4G6VB 2ZH7A 3H98A 2V8VA 2ZZMA 1EKSA 4R5PB 4LBHA 1M5VC 5ETRA 1RU2A 4R8UB 3ZZPA 4TQSA 2HYIB 1VQNS 3GSIA 3M6UA 3FQLA 4DF4A 3A3NB 1UP1A 3GMGA 1VRUB 4OX8A 3I0SB 3HFVA 3BSNA 2AZ3A 2H48B 1HWKA 3HCXA 1HHQA 2V2QA 2NR0A 3LP1B 3BPDA 4LFBJ 3V4IA 1DZ5A 4H4MB 1Q7YT 5JXSA 4G1QB 4YDDB 2WB1D 2O5DA 4QIVA 1LXNA 5E2QA 4I69A 3PYDA 2BXJA 2DISA 3I0RA 2DEJA 2I6WA 3DM2B 3OPKA 2WAQD 3BJYA 1EETB 3CDWA 3QIPA 4X64F 2HSEB 2R2UA 2BX6A 3KLFA 4L76A 2BJ3A 4NCAA 1YBAA 4C0OC 3AY0A 9ATCB 1XC9A 3BB5A 4DV5J 4KYZA 4C11A 3FFIB 2X1BA 5SUHA 1EJ7L 2HBYB 4PKDB 3TQEA 5HQLA 2UXCF 3D6HB 4DR2F 3ONQA 3BDEA 3UDEA 3GCWP 1QE1A 3A8KA 4HI1A 4FYVB 2J6SA 4I0WA 4IR9A 4ED2A 3CGIA 3ENWA 1TKDA 3DHWC 5LJ3Y 5J2MA 1X4CA 4I1TA 1NK5A 2L9WA 2PA8D 4QU7A 4WKRA 1AA1B 4WP8A 4PR6A 1R8BA 3P3DA 5H9FK 3SCJE 3UNYA 4FVCA 4DI6A 5GAEU 1S6PA 2W7AA 4Q0BB 2ATLA 1QTMA 1NJXA 1LOUA 3FZBA 2MXYA 4CI0B 4USMA 3GZ7A 3M9OB 2RSQA 3QMQA 1X5OA 2AF6A 2IRXA 3BR9A 1VJWA 3R5CA 5AXLA 1RT1A 1KS2A 3TAMA 1Q4RA 3MEDA 4NLOA 3FEYB 1N34F 1YITS 1MN7A 4Y2CA 2RDDA 4U96A 3DNCA 2A6OA 1WEZA 2FLOA 4OZ2A 2E66A 2IBOA 3GE9A 2YNFA 2UVUA 2C2NA 4DX7A 3K8WA 2V4RA 4DN0A 3O44A 3J7AN 2DCLA 2W2MP 4O3SA 4Q2LA 5KFYA 1SJ4P 3NGKA 3IWXA 3RYLA 2HHTA 2YKQA 1IWGA 4MFBB 1TKZB 1YQHA 3BYPA 5DG9A 4DL4A 1X4GA 4NXNF 1TL7B 3CVKA 1TL1A 3QATA 1RDRA 1WDDA 3GYGA 1RJJA 3ZFVA 3G71S 2BM1A 1TFYA 2PA3A 4O3RA 1HLWA 1WSRA 1Q82T 3MTJA 3EGWB 2HURA 3D1OA 3PRBA 4DV3F 3M6WA 3RB6A 5K8PA 2V4JA 2HPUA 1QTNB 4HT5A 2OELA 2V34A 3AA8A 2LA4A 4Y28C 1EQ0A 5FLXU 4NLUA 1PGZA 2MSSA 5KFXA 1X9MA 1LWFB 2GO9A 2LQ5A 3OFGA 2K3IA 3HZEA 1N5SA 3OHBA 2C2RA 4LIWA 1H7XA 5BXIA 5AJ3J 3BEGB 2XMKA 3W8GA 3PJWA 1VQKS 4LF6F 1C0TA 4N5SA 2Z8QA 1KWMA 3ITHA 2XMAA 4LF5F 2VONA 2EBEA 2KFZA 1MMDA 5CZVA 1VS3A 1W25A 2PMZD 2ZKUA 2VASA 1KKHA 3TWZA 2VFRA 2M8DB 3CT9A 5M2RA 1REVB 4KBIA 1TVRB 4N76A 3CB4A 4ZOSA 1WF2A 2MSTA 2OI2A 1RAJA 1Y3JA 2OFHX 3CJKA 2PI4A 2ZC3A 3D1QA 2V4QA 3CCVS 2D7SA 1T05B 5HATA 3DLBA 5F8GA 5KT4A 4GKKJ 4PG4A 3K5OA 3P5BP 4KQZA 2DPIA 3S7RA 1G2EA 2BRLA 1VFJA 1ZBTA 3CJ8A 4CT9A 3HX9A 5U47A 4HEA9 5C7PA 2BQ3A 3W3SA 3NXZA 5D4LA 3KJNB 3KLHA 4FS1A 1C1CB 2XYGB 4DR7F 3VTIA 7FD1A 3M9MB 3OR2B 1C1BB 3KMQA 5AE2A 1U45A 1F9FA 4DQSA 4NL5A 3GU0A 3IBWA 4A8MP 2VC1A 1F2GA 1TUGB 4HH1A 4RBVA 3R2DJ 3MOJB 2KO1A 4RPFA 3FMWA 4C98A 1ZAVA 3W60A 4K4WA 3T5LA 1PSDA 3DKDA 4CWBA 4JI0J 3LANA 5IS2A 3MZIA 5G0RB 2VIHA 3NL0A 1VQ5S 4LF8J 1FESA 1FVSA 2HK3A 2P9CA 1N32F 1H98A 4A8YA 4ELVA 2QMWA 4JI6F 3J7Z5 4M5NA 4F0HA 2M5YA 4ICLB 3K58A 2LQJA 3NBPA 4LF9F 2XI2A 1N5YB 1S76D 2KFYA 2YNIB 1NPRA 3DRSA 3MCOA 3M32A 4CLKA 1RBAA 4F2SA 1BWEA 1CBKA 2CPXA 3H4DA 3G6ES 3AA9A 4IR1A 2XB2D 3QFHA 1GH8A 5LSOA 1U47A 3IR5B 2ZHOA 3RBXA 2MZQA 1FX4A 4DQRA 2GW8A 3A8EA 1H74A 2YPYA 3M7VA 1MWYA 1JLAA 8AT1B 2R4FA 2V63A 1VQYA 2YQ1A 5C2CA 2ZM6J 2WONB 1X5TA 1TKXB 2HZCA 2MKHA 1FKOB 2HNZA 3THPA 3IWLA 2MZ1A 4F36A 2Y8WA 1RLDA 2V0NA 1LXJA 2IAJA 2YWHA 3WIVA 3MR3A 1ZH5A 4UY8T 4BDPA 1R3NA 5ETKA 3PW4A 1VK3A 1WEYA 1HNZJ 2H5EA 2LXFA 1FERA 2B4OA 2OUGA 1JNZB 4OJ1A 4YB6A 1Q8IA 2D3O1 1Q86T 3RUBL 1FFGB 3P5TL 1WTBA 2XHWA 1IKXA 2F4FA 2LDYA 1U1PA 1YLXA 2VH7A 3FEZA 4B02A 1NH7A 3ULHA 2BEFA 1UFLA 4L3NA 4KGXB 2V8DA 3KHHA 3M30B 1WTFA 5AXNA 2IM0A 1XNQJ 4X66J 1UVIA 3GSDA 2O1PA 2ZH6A 1T3OA 1S9EA 2R8IA 3M8QA 2ZWOA 4UTGA 2DNHA 3LP2B 5DLGA 1F3FA 1X60A 1CSJA 4USIA 3R7NB 2EFPA 4Z37A 3GR0A 3GJTB 4DQPA 1TAQA 1X31C 1RAEB 2MQLA 2XBPA 2WK4A 5JUMA 4CH7A 2ZDOA 3R9LA 3W5YA 1SJQA 1NAQA 3QRPA 4X62F 2BJDA 3DMJA 2M8HA 5CD4H 4DR6J 1K1SA 2BKOA 1U8SA 4K5SA 1X7VA 5DETA 5K8OA 1FRLA 4RW7B 4YR2A 4LSLA 2FLPA 3OTOF 1TUWA 2VU5A 4TU7A 4YOEA 4C3KA 3OHAA 2MKSA 1HI1A 4KO0A 2NXEA 4C97A 3C16B 3PO4A 1WJ9A 4PXBA 5EDWA 3QJLA 1RCOB 1KR4A 1D9AA 1F0XA 2RT3A 2DNQA 1RP5A 4NCGB 3F73A 2XMTA 2LCWA 3M2RA 2HNDA 1FDNA 2I38A 2FVPA 5KG7A 4WTYA 2OPQA 3KJFB 2E1RA 2JWNA 2KZZA 4IO9Q 3V4MA 1XERA 3KKFA 4X84A 4HDHA 1TAUA 3FSIA 3I55S 1QVGR 4OYOA 5L39A 1GX6A 3MPYA 3FSXA 5LOQA 4OYXA 4D3GA 4DV4J 5KOWA 1K0VA 3VAIA 4OYAA 3D67A 2P2CB 1IQTA 2GQ2A 2CPFA 5HLFB 1HWJA 2J8SA 4N56A 5HL7Q 4Y65A 1APSA 4R25A 2DIUA 2DH8A 5L1KA 2V9WA 3KK1B 4F2RA 3BF4A 5IV3A 2MZJA 3WQPA 2AIRB 4LT6A 3MF5A 3M6VA 3CJTA 2DR7A 2UUTA 4DWIA 2V50A 3UCUP 3D3CJ 4PXCA 3TUJC 1PAUB 3MEEA 4ECVA 3QJJA 5A0YA 4QYZK 1QJHA 2BJ9A 3T19A 1B7FA 2QA2A 4OJ3A 2Y0SD 4AD6A 3GFZA 6FDRA 3KK3B 3C6UA 1HR0F 1PAEX 1VGYA 3MM7B 3BREA 5HP1B 4B3OB 4HKQA 4DV2J 1XNRF 2DBBA 3QAUA 2EK1A 2XM3A 4YB5A 4ECXA 2W2PP 4KSEB 4AQYJ 3R2CJ 4ECYA 3OSNA 2G0CA 3T6BA 3BGUA 2JVRA 2WHOA 5BYQA 4PQUA 3SIPB 1S9GB 1CJVB 1IVZA 2FHJA 5CA5A 4NE9C 3V2UC 3E8OA 4DR1J 3VGUA 4DL7A 1AB8A 1JJHA 5KT5A 2AGPA 3OR1A 2CPDA 2C3UA 2I5JB 4A8XA 4NA2A 2M88A 1S0VA 4AT1B 3SDEB 3A1YG 2HWHA 5BYRA 4ZHRB 3H2VE 1ZS6A 3CJ2A 4LQ3A 3QLHB 1IKVB 2CPIA 3NY0A 3VHQA 3HHDA 2C3PA 4TN2A 7FDRA 5D0HA 4ZLLA 2HBRB 5L9NA 5ETPA 1RE1B 1QLNA 3HM9A 1ZM3A 3TAQA 4ZITA 4JI5F 6AT1B 4QIEA 5KFRA 1S0OA 1SKSA 1RU1A 4NI2A 2HEKA 4WU3A 2VQFF 2QN6B 1NJZA 2JC1A 4I64A 2XSJB 4IH5A 1CPZA 3KHRA 3HVAA 1SPBP 2YX7A 2H4WB 3GTYX 4ID5B 1ZPWX 2LQBA 4K2XA 1NU4A 1XBWA 1FTRA 2HHPA 1BQMB 2RB7A 3CO9A 2E5LF 3IA0A 3VAKA 4USHA 2B6AA 4OYBA 3TVKA 2LU2A 2KRBA 4YY3J 1PYOB 3BS9A 2Q6CA 3BGOP 1D09B 3M2VA 1TU0B 3DGPB 4A8OA 1JXLA 3T6JA 3MM9B 4F4KA 2V8GA 1UJ6A 3KMSA 3NKYA 4ZJQA 2ZNZA 4U7UD 4B9TA 1NSKL 3L3CA 3SZ2A 2ZHBA 2OAUA 1RT5B 1I94J 4EFAC 1VQ9S 4Y3CA 3IBCB 2KHDA 2W01A 5B7WA 3B4DA 4Q44A 2XZTB 4EYIB 4CYUB 2XZDB 3SI8A 3H0PA 4ZVFA 2JOQA 1OPZA 1PJ5A 4G1PA 4HDGA 2RUGA 2AEJA 4NLRA 2DNRA 4NRUA 1H2VZ 3IRXA 5D0EA 2QSWA 1BWVA 1HMVB 3FVYA 2FY1A 2ABYA 2MZTA 2DXFA 1RZMA 3C15B 2CA9A 1VQMS 4FNHA 2RUSA 4OI3A 5K14B 1WI6A 1AUDA 2VV5A 1FE0A 5JJBA 2HMIB 2DGXA 1A6LA 2HZVA 2AYMA 2E5GA 3VVUA 5D4OA 4IG0B 1B3TA 3MWBA 2JEFA 1T9XA 3QAEA 1YDLA 2RKIB 1NDLA 2GVDB 4JI8J 2QLXA 3VZIA 5HJXA 1S99A 2R9LA 2GHWA 4M95A 2HQCA 1ZAWA 1NHUA 5JVGQ 5A2QU 4M5DB 2LXUA 3J81j 4IUFA 5ETSA 3N6NA 2XNQA 2B0GA 2YKMA 3Q2SC 2XY6A 3QT5A 5J2NB 3TX8A 1NXIA 2KG1A 4NZ7A 2W9BB 5LSLA 5A8KA 3VAFA 4F4WA 2CQGA 1V5VA 3MECA 2BANA 4KGMA 3QFWA 2KN4A 2CWKA 1RT7A 1CC8A 4P2SA 3C14A 4OI1A 3ZTQA 1NB7A 5ETTA 1M5KC 3AJ2A 5FJ4A 2YKNB 3CD6S 3JS9A 2ZBCA 2HS0A 3RZAA 2QTWA 1CG2A 1WUUA 4OX9J 3I96A 1NK4A 1SJ3P 3H5UA 4DUZJ 2OMOA 4WFNQ 3GV7B 4TY8B 4NLGA 1HBNB 5KTQA 4OYPA 2IVMA 4OYZA 1IBMJ 1U1RA 2OEJA 4FF1A 4A4JA 2ASLA 4RNMA 2RQ4A 3ZTOA 2QMUB 3N5BA 2U1AA 1GQEA 1XMQJ 3JSMA 4DCJB 3IWNC 1T9VA 4R5PA 5A76A 1FDBA 1YK9A 2VG6A 2R7RA 1H7WA 1Q95G 1QSLA 4R8UA 1O8BA 1Q81T 2C3MA 1AT1B 4Z7YA 2QA4G 2HBZB 3NS7B 1P1TA 1TL5A 4QQBA 3SYZA 1F6TA 3MMBB 1Q78A 3UN2A 4DSFA 2WVEA 1VISA 2AJ4A 1FXRA 1ZAXA 3TJAA 3Q8PB 1SQFA 3TUZC 3LP1A 1U7LA 3QRQA 1N5TA 1H0HB 1Y10A 4EEYA 1K0TA 2LDIA 4H4MA 3OLBA 3J81Y 2IA0A 1R43A 4G1QA 5HK4A 2H54B 1VDHA 3ZNUA 5CYJA 1RT3B 4A46A 4NYPA 4RUHA 5E33A 3TAPA 1K73T 2XO7A 2IMOA 3HVWA 3DM2A 1PKUA 1NPPA 1VJQA 2AJ2A 4JI3J 1EETA 3QSIA 4LFCF 5F8LA 2BW7A 1CJUB 5CZXA 3FSYA 5DQIA 1YRTA 3DLGA 1SVDA 3BYRA 3FFIA 1U1NA 4B9UA 1R31A 1GXUA 1RISA 4FYXB 2HFZA 2JH3A 2A3JA 4Y2KA 3QNWB 4RJVA 2FZKB 2ILZA 3OUYB 2XYHB 2EC0A 3DRRB 4LR8A 3MAAB 2HLTA 1FHTA 4BBYA 4OIXA 4ECSA 3CMAS 3GIIA 1HIYA 3D54A 1X4FA 2ZZTA 4PUOA 3EYZA 3HSGA 3KG4A 2VL1A 4Y0FA 4S0MA 4DU7A 3MUMP 1R6VA 1VHIA 4ECZA 4A48A 1WHYA 1RGVA 3PJXA 4HHUA 2J7WA 8ATCB 5C42B 1HD0A 4PWDA 3IGVA 4NEZA 2RQCA 5F8IA 1CS4B 2JFDA 4PG5A 5B0FA 4Q45A 2WOMA 5KFDA 2LFVA 5CCMA 1OO0B 2RIJA 4I68A 3TZYA 3ET6B 2CYYA 1LFWA 4N8OA 4ED3A 3A3PB 2LQ9A 1JIHA 5B0EA 5LM7E 2UUBJ 2IPOB 2KZMA 2DJWA 4NYZA 1RWXB 3PW0A 4MFBA 4ZVPB 4X65F 4QWBA 4QJVA 4V19X 1M1HA 3I4HX 1TL7A 4Y00A 3TO8A 4QCLA 3Q8VA 4LF4F 3RG6A 2ASYA 4K8RA 3V6JA 2ZITA 2D3UA 2KB2A 4WIIA 3VAJA 2OHDA 3G4SS 1GMWD 3CIZA 2ZH3A 4IH6A 5CYMB 5KT6A 2GQQA 1E6VB 3G8TA 1PYTA 2YH1A 2DR8A 5IWAF 2F5GA 4NLPA 1RT4B 4J9QA 1ZTTA 4YB7A 3J80Y 2AJQA 5GMKa 4K4ZA 1TK0A 1SH2A 3QQCD 1S1WB 4IOAQ 5M2UA 3D1HA 3O1LA 2EFVA 1LWFA 2KJWA 3FBCA 2LEPA 4USWA 2DGQA 2YY3A 2DEIA 3TA0A 1Q0NA 3GFXA 2RU9A 4FN5A 4DSJA 3D2WA 1UTAA 1S1VB 1K47A 2UUWA 4M5MA 3L95X 2MLYA 2QG9B 1SI9A 2WBMA 4PPDA 1K9MT 1N48A 3FK4A 1RKIA 2ZH4A 1LQ9A 1TVRA 2W4DA 1RAIB 2EEYA 2R3VA 2V2ZA 2YVSA 2KI2A 4WTOB 2UUCJ 4DR2J 1UL3A 4DZ6A 4H4OB 2OTLS 1M0SA 1FI4A 3KDOA 1R8AA 4FF2A 2QJ3A 2CJBA 5D0GA 4P10A 2ZNYA 3IXQA 4PG7A 2WVCA 4QPTA 2JRSA 1F5BA 1SV5A 1JMTA 4U9RA 2RRBA 1C1CA 3V6HA 3BBBA 2MQOA 5E3RA 3CULA 3OR2A 1F2HA 3BDPA 1IBKF 4FXVA 1C1BA 3HXMA 3QWUA 4J9MA 1RWKB 4RW8B 2R7WA 3T1HJ 1FKPA 2EG2A 3ZZUA 2VG7B 2NLWA 4I2QB 1J27A 1B99A 1YG0A 1H6KX 1K44A 3DC2A 4K5RA 3GCXP 4Q5VA 4CNYA 4DSKA 2CZVC 3GV5B 4MMOA 3PO5A 1N34J 3EMTA 3JTOA 4ZA1A 1X9WA 3U1NA 2XGPA 2VODA 2GC8A 1T02A 5G0RA 3N28A 1ITPA 5ETOA 3H5SA 1R7IA 1KLNA 1UCNA 4O3OA 4FZVA 1N4LA 4ICLA 2BBEA 1UEKA 2HRYA 3DYAB 1M5HA 4QW8A 1PC4A 1ULRA 1U1MA 1L3UA 1FEEA 1PG5B 5F3TA 2ZEJA 1NB2A 2W9CB 3CC2S 4XPCA 3MM6A 3MCSA 4IO1A 2DT9A 4ZP6A 1KVIA 3AJ1A 2IVYA 3FBEA 2VA3A 3N01A 1KTQA 1SC1B 4MT1A 5L1LA 3QGPA 1FEHA 5DM7Q 1HQ2A 1Y5NB 2YNGA 2R7VA 5LMUJ 4BCAA 3IR7B 5C5JA 4KV8A 2QLWA 4Q8FA 2XWYA 1WF1A 3RBZA 3R6GB 4XTTA 1S6UA 5J1PA 2M9KA 4ED1A 2CJQA 4DV3J 3UI3A 2XMUA 2WONA 1LEOA 3KLHB 1UWAA 2H5JB 3N6LA 3D0GE 2X3DA 4USTA 4UQTA 1CQNA 3Q8YA 2QGFB 1RLCL 4DPTA 1KEKA 2P5VA 3UQSA 1MMLA 3W63A 4IRDA 1G1XA 3HT3A 2QE5A 1IR2A 1YZ7A 2MY7A 5HVFA 1KFDA 1EAYC 2PFFB 3I5BA 4LF5J 3IO1A 4OLOA 1N0VC 1LW2A 1YIJS 3CDBA 2E29A 4DX5A 3PX4A 3I5AA 1SXLA 2GZOA 3N79A 4TLQA 2FJEB 3ZTPA 3BO2A 2CG8A 3R5JB 2YTCA 4Y6IA 2KHCA 1S6QB 2GMHA 3MPVA 4CLZA 4J9SA 1GXTA 4LVOP 3DRSB 3BSOA 2Y3YA 2F9JA 3MDFA 3HI9A 3LP2A 3U7JA 1JLEA 1CLFA 5HN0A 1BGXT 5C25B 1KVJA 3IP0A 1FWPA 4DR7J 2X1AA 2ZH9A 1UZDA 3ISND 4JI4F 1N5QA 3HHLD 2ROPA 4KE5A 3C3LA 2J6UA 1D0EA 1BD6A 3IR6B 1X4HA 2MB0B 3G96A 1N6QB 2CPEA 3TQ1A 4RW7A 3X3UA 4YUDA 5KFWA 1IM6A 2BABA 2JLFA 1I1GA 2G2ZA 3EZUA 2EFNA 2AYEA 1PCAA 3KUHA 1CJKB 1BUXA 2QFIA 3MUTP 3OTEA 4BHQA 1NJYA 4ZJLA 5KFBA 3KHGA 1DLOB 5ETQA 3H7HB 2I0XA 2L41A 2XULA 4BS2A 4JI6J 4NCGA 2NPIA 3RU0A 5KFAA 2N4DA 4L72B 2MQMA 1S12A 2RS8A 4K4UA 3PTWA 2LECA 2OH2A 3I32A 3WX4A 4OHXA 4CLYA 3D6TB 3OXGA 1ZM4A 1XQIA 4ELUA 1TL4A 3AB2B 2CPJA 2L9NA 1IKXB 3UR3C 2FJWA 1Q1KA 4DSIA 5A6PA 3CDEA 2RJZA 4QW9A 3B82A 5HLFA 3ETOA 3T5JA 3G86A 4XDCA 4I56A 2GAGC 4ELTA 4MYTA 3MM8A 4ANEA 2DR9A 4OZJA 2IC3B 4LREA 4MJKA 2XEXA 3E2EA 1IKYB 1LFPA 1B0TA 1S9FA 1YJ9S 1RHJB 4LRAA 5C2GA 2HVDA 4DV0F 2AKWB 3UN5A 2DR6A 2XCPA 4NZ6A 1JLQB 4PWWA 2EK6A 4OZ5A 2KG0A 2DNLA 1CULA 4F7VA 1RWVB 3KK3A 1T9UA 2FC9A 2GFFA 1WC1A 1IR0A 4CO2A 2A18A 4KTQA 3MM7A 2HQFA 3M2UB 5HP1A 3DU6A 1MNEA 4KO0B 4Y2MA 2G1DA 4J9PA 2LQ8A 4DR4F 5HVHA 2OP5A 1WG4A 3N9UC 1J5OB 2DHGA 3VALA 4RNHA 2A6MA 2A10A 4IQXA 4KRWA 2C22A 1S9GA 3LH2S 3M2RB 4RR5A 1CJVA 3BKUA 4ZCMA 1U6BA 1GTHA 5GMEA 2KFNA 2ZVIA 4L6V3 2FZGB 4P72A 4WKYA 2I5JA 2E7WA 4LF7J 2OMLA 1TQLA 1H38A 4J7CA 2PDAA 2YNHB 4K59A 1N5VA 5HMYA 2MJUA 3SDEA 3F41A 5H9EJ 4DOZA 4OX6A 3D6FB 4ZHRA 4DL0C 2MEWA 4CH1A 2K7JA 1IKVA 2B4PA 3K5MA 1J5EF 1RABB 3HDSA 2FJXA 1FJGF 4X62J 3ZZTA 1RA7A 3PW5A 1Y7PA 4CM2A 3A8IA 4ZVGA 3VR1A 1BQXA 2KT5A 2NPFA 2XC9A 2BJ1A 2X1FA 4C3MA 1WHWA 3DDNA 2F3JA 2V8PA 2OEMA 4UY85 1HWUA 4C4WA 4ZPAA 3K5NA 1A7GE 5GAGI 2BE2B 2AJ0A 3S8SA 2BOAA 4ID5A 3TZZA 5CCLA 4FDFA 3A13A 4LIRA 3HZGA 4LFBF 2XLJA 2W7OA 2L48A 3QYYA 3EJMA 5D4PA 3BZQA 1N33F 2D74B 3P45B 1P9QC 4YHHF 3U1LA 3D66A 4PYDA 4RBTA 2JFKA 1X4EA 4K0KJ 5FIIA 4ILRA 2DK2A 3DGPA 1UJ4A 2CQ0A 3DCAA 4PXDA 3MM9A 2E1CA 4USJC 3P4UB 2WRMA 2DPJA 2AU0A 4O3QA 3R8YA 5KFNA 1VC6A 2FJVA 4CT8A 1U2CA 1RT5A 3N4WA 3OTDA 2HHSA 4KGVB 5EX0A 4OL8A 4DV5F 4K4XA 4M1KA 2IFXA 1TMJA 4USKA 2E1AA 3HSDA 3K5PA 4CYUA 1WF0A 1NRKA 2CQPA 2FPHX 1KD1T 5KFEA 2JZ5A 4M5IA 2D69A 2N3LA 4N8NA 1MLAA 4M8LA 1Q8LA 2G13A 4CO5A 3AXKA 4K4VA 2FJDB 2EKYA 4ED4A 1HMVA 4V19J 2VB6A 1V5IB 3PHEA 3SMZA 3FUYA 3C15A 2ACMA 2CUYA 1MSWD 5IFMA 1QSYA 1HR0J 3NNHA 4DS5A 3I6PA 4FVMA 1XNRJ 4HLBA 5K14A 5FDLA 5THWA 3CCUS 1U0SA 3TA2A 1DQ9A 1RAGB 5HBMB 3LF0A 3MURP 2RE1A 3LGHA 2HMIA 1OYDA 1RYSA 4UOCA 3PACA 4IG0A 2XI3A 2CJYB 2QYGA 2AP6A 3RGIA 2IRYA 2RKIA 2GVDA 4C0BA 4E98A 3GJSB 4ANCA 5KFUA 3FNNA 4I7FB 4ZVUB 1SKUB 1FRIA 2B6AB 1KVKA 1NSQA 2MJNA 2R42A 1RTHB 1N36J 3OFHA 2J0WA 1FX2A 2Y1JA 4M5DA 1KOOA 2DXDA 1SJFA 3EGVA 1FJCA 2Y1IA 3KLGB 4ANDA 4DPYA 3ISNC 1HNXF 4LVNP 1KOHA 3HHLC 5J2NA 2AX0A 2W9BA 2DTJA 5HMZA 2PEBA 4JI5J 4FYWB 3NCPA 1HQUB 3PR4A 1U24A 3ILLA 3NNAA 2GCFA 2J7KA 1D9FA 1NPKA 3BO3A 3RB3A 2VQFJ 5F8HA 2YKNA 4DV1J 1WNEA 4IRKA 3U27A 4DFPA 4B3TF 3R1LA 4GMKA 4DSLA 2ADCA 4JYAJ 3GIJA 3JQMA 5KG4A 4TY8A 1HBNA 4URSA 2B8QA 3JSRA 1WC6A 2HNYA 3IRXB 1OYEA 1AZSB 3EE3A 3EM1A 3FRZA 4X4TA 2E5LJ 2HWTA 5C24A 1U6FA 1S1TA 1WHVA 2DNPA 2ZJPQ 4JV5F 2F4VF 3KG1A 3K59A 4PQAA 3NLCA 4OHYA 4JB8B 5ADZA 3M9NB 1XEZA 4JI1F 2LEBA 2C2MB 3D3BJ 4OZ3A 3M8WA 3ZZ0A 5BJRA 1NEEA 1TKTB 4MTPA 3R5BA 1OY6A 2UXDF 2GMJA 3HHLB 5KG5A 4FBTA 2CNOB 3NGRA 4YDXA 2DNOA 5I42A 2FYXA 1UKUA 1GEHA 1VOMA 1RT3A 2HW3A 4C0HA 2OIHA 5IOLA 1VK8A 1U1LA 4WU2A 4WBFA 1SBRA 4BWJA 1GK8A 4PG8A 4WP3A 4DR5F 5AXMA 5ETVA 4P9SA 4ITSA 4TU9A 2MPUA 5IXUA 1TELA 4FF3A 2AJFE 3IS9B 3BBCA 2Z56B 1CJUA 4ZP9A 4HT7A 3K5LA 1MWQA 1UW4A 2DHSA 1N52B 2ZE2B 1F5AA 3MECB 1RWNB 2HHQA 2C2ZB 1V9OA 3C14B 5GAGU 1HKAA 2IM2A 3MCNA 3ZC4A 3ENAA 1IM4A 2P9EA 3PW2A 5DGAA 2Z2ZA 4P7TA 3CJ0A 3TOQA 2CG4A 4LBIA 3T9NA 4DEZA 3GB0A 2ZUAA 3QT7A 5G4DA 4MIBA 3OUYA 1DJ0A 3DRRA 2YKPA 3BKTA 2HHXA 5D3GB 1FCAA 3RW7A 4LR7A 3JSMB 2RS2A 4X4PA 2GJ2A 4JI0F 1HW9A 2VG6B 3KYLA 3H20A 2CAJA 5F8MA 2E5JA 2CZ9A 2M7SA 4TKTA 5L8RC 2R7UA 5L1IA 2R7SA 2JEGA 2VUGA 5GVQA 1NKEA 3FJ2A 3KG0A 1OS5A 4IFYB 1P27B 4ZPBA 1T9WA 4L73A 1Q8BA 4M5KA 5C42A 4IKAA 3MTKA 2J7UA 1CS4A 5CHCB 1ELOA 2NYIA 3ZZYA 1WSVA 3ET6A 3EZOA 2C2KB 1RBOB 4P71A 4O4GB 3FDSA 2KH9A 2A0FB 3H5XA 3M8RA 4LRBA 3ISZA 3D6MB 3DDIA 4B3RJ 4PYAA 1VQ4S 1D8ZA 2E5IA 4NLYA 1RCXB 2PI5A 5SZTA 1UA1A 1HBOB 1T94A 3DLGB 1WG1A 3MM5B 4NXMF 3TYTA 4ED7A 3IM8A 5HJYA 4B3MF 2QLJB 3G6XA 4ID8A 1X5SA 4FF4A 2J8AA 4O4RA 5F3ZA 2QIFA 2R2SA 3CMES 1IJEB 5HO4A 1KQGB 1HNZF 4EUVA 2QO3A 5CYMA 1E6VA 5DJBA 1S79A 2QRRA 2O01C 3W61A 2OLWA 2OD6A 2IIHA 2YWEA 1AW0A 3GP9A 3O5TB 3P8BB 1S5ZA 1RT4A 4NLTA 3MXHP 3KNAA 2YQ0A 2RQKA 1IUJA 2Y1LB 4PUOB 1SL2A 3RB0A 1S1WA 4GRSA 1C0UB 1WACA 3GYXB 1DTTA 1XNQF 4HL9A 4LFCJ 1EP4B 4F4XA 2VKRA 4PWDB 1S1VA 2NXUA 4I2PB 1DY3A 4EGLA 2R8GA 1BY9A 1JX4A 5K9FA 3NMAA 2R7OA 4ALZA 4LF1A 3U1MA 1FKAF 2WOMB 4EK2A 5KOXA 1WWHA 4OI4A 4FKYA 2M52A 1IR1A 4DUYF 1UZHA 4K4SA 2DY1A 4RLEA 1OIAA 4H4OA 2OKQA 4DR6F 5K8MA 5KG2A 4IDKB 3LWMA 1VBYA 1NBEB 2BW2A 2FDNA 3BQ2A 3BSCA 3SSQA 1CEZA 1WC5A 4C8MA 3ILIA 1XK8A 2ZJQQ 3DOLB 4O44A 2V68A 3Q22A 2WSCC 4ZPWR 2AQ4A 4RUCA 3MD3A 5HSPA 3C46A 3G82B 4TQRA 4DLGA 3F44A 5EWGA 1UVJA 3SCIE 4RW8A 5F8NA 4Q2MA 5J1EA 2HVZA 2VG7A 4I2QA 3PRVA 4ZVHA 4BC9A 4YB1P 2CIMA 3ZXWA 4P73A 3CJ3A 4WP9A 1G3OA 2U2FA 3UCZP 2ZVSA 3SCLE 3LGMA 4Y34A 4O0IA 1ZETA 4DLEA 4ECRA 1OQ3A 4FXWA 4I67A 2R2RA 5IZHA 1JQGA 1U4BA 2BQRA 5IT0A 3DYAA 1L3SA 2ZD1B 1R6YA 1JWWA 5E3PA 3P96A 2W9CA 1EX8A 5KFHA 4X65J 1A0OB 1GXLA 2HFVA 3GIRA 1ICEB 2EC2A 1S97A 4H4KC 4ECWA 1D1UA 3CE8A 4XK8C 2IJNA 4LF4J 4F3QA 5B0CA 2DVIA 3AD9C 2BACA 3Q0AA 4PWUA 3DRXA 2AEMA 1GX5A 2PT0A 4M5JA 3KTQA 4I6WA 3WDOA 1ZM9A 4U95A 1RHRB 1KFSA 5BR8F 4G65A 1VRTA 2E5HA 3G9CA 1YJTA 3JQJA 1SV5B 2RAQA 4DFJA 4YQWA 4HHHA 4KHRA 2GGPA 3DLKB 3QZ8A 2HHWA 1RTJA 5E7OB 3CCQS 1RTIA 4F50A 1FKPB 1AXQA 5HQ8A 1G6BA 5L46A 2JC0A 2FD2A 3K8VA 3EICA 5B0DA 3CCES 1Y5IB 3CC4S 3T41A 4ZPCA 2NREA 1L3KA 2D9PA 2PO4A 1HA1A 4DPWA 4LJMA 1TP7A 4DV7J 4RW6B 1NZ8A 2UV8G 3MPWA 5KFSA 4PRFA 4B9LA 1S4EA 1S6QA 1WKJA 3HULA 2E9TA 4GVLA 1HQEB 1DFDA 4WFYA 4A8KA 1DTQB 1N54B 3MM6B 2FVCA 4CLWA 3LAMA 2DNZA 1ZPVA 3UDCA 2B9WA 2LVWA 4USVA 2DY9A 5C25A 2RVJA 5H1SV 1B70B 1H72C 4IQMA 4CP5A 2J9EA 2B3TB 2BE7D 3Q83A 1IBKJ 4DBQA 3LUYA 2I2YA 1Q8KA 3CEDA 1YBUA 2CVIA 3SBMA 2YNGB 1EQMA 1HWLA 1N6QA 2F7VA 3NS5A 4KV8B 2W25A 3W2VB 2AYBA 1VLYA 3WC2A 3RRHA 2VPXB 4ERDA 5DQHA 3DDKA 3GG0A 3OV7A 4C8YA 1CJKA 2O66A 2CQDA 3B54A 1FO1A 3O8WA 2NXNA 1KONA 2YQ3A 1DLOA 2DB1A 4DR3F 3CWJA 2VBYA 2BDPA 3JTPA 2AD9A 2FIUA 5A2QY 4U7UK 3JAMY 1AUSL 2DR5A 1MW7A 4FXDA 3NGUA 4P52A 2WBRA 5DDPC 5L9XA 1S7IA 2FC8A 2BJ8A 1RQ0A 1XR7A 2VF3A 1LW2B 1ZM2A 1XMBA 2H51B 3CD7A 4ZS6A 3B4MA 1VQLS 2CPZA 3SSRA 3SQOP 1RHUB 2KJVA 2ZH2A 2RHQB 2R8KA 3E51A 2HAFA 4Z7CA 2X51A 5E0OA 2B51A 3OL7A 1JLEB 1WDTA 1IXKA 4JBCA 2QC3A 2AV5A 3JYTB 2IC3A 1MROB 4G1IA 1YHQS 1Y5LB 2NUUG 4CM0A 1RAOA 1H3DA 1IKYA 1K8AT 5JMNA 5KFPA 1NHVA 2HFOA 3QJPA 4HI2A 2OFGX 3SQGB 3EWGA 4QIFA 2OO4A 1YJRA 1Z4UA 1ZZFA 1SIZA 1T11A 2CKWA 2MKIA 3MMCB 1JLQA 3R3TA 4E0DA 3AJDA 2WTFA 2C3OA 2HHVA 1NZAA 3BR8A 4EI2A 4OQJA 1NH8A 1LWEA 3W2WB 2DGVA 5F41A 3M2UA 4KH1B 4EZ9A 4A8QA 2J0SD 1PILA 3PYGA 4WIQA 2RMLA 1GAOA 3THTA 4EBEA 1VBXA 5ETNA 5A8RB 1JB0C 4DQQA 3AD7C 4FYDA 4EYHB 1J5OA 2AT1B 2XS7A 1P1LA 3NEKA 1UETA 4WE1B 3TUPA 2OPRA 1YJNS 2PC6A 1XWLA 6FD1A 3Q23A 2G0JA 1NM2A 2QL7B 2YH0A 4F4ZA 2A1BA 1UWBB 3KJVA 5DM6Q 2YNHA 1FRKA 3W62A 4NX9A 1GMWA 1UPMB 2W2NP 4ZVRB 1OPIA 2NYHA 2XLKA 3H2UB 3W5ZA 4ZP8A 2WSFC 3CIMA 4DUZF 2G2OA 4JI4J 1SUQB 1IBMF 4NLQA 1QSSA 4ZK7M 1T9TA 1IBLF 2LXIA 2KYZA 4OZNA 2UXBF 4ZVEA 3MI7X 5HMWA 3HSZA 2CQHA 3GFYA 3HJFA 5F8JA 3NOGA 3MM8B 4ZCIA 2CVEA 2N82B 2SXLA 4KHPJ 4TNOA 2AGQA 2LLZA 5GAHI 5CXTA 2HQIA 2BE2A 2R8JA 3M8SA 4JI2F 5KFOA 1FNOA 3TZXA 4KJIA 1F1BB 3SFGA 4DPUA 5EWFA 2XMWA 3TRGA 1REGX 4ZLPA 4WK3A 5B08A 1CULB 2QYCA 3NGDA 2ZH8A 3UCGA 2J5AA 1RHMB 1KSPA 3UDVA 2VBXA 4FS2A 4DU8A 1S4FA 1IJFB 2I9SA 3LP0A 2DRBA 3EDRB 1S1UA 1W2BR 2MHEA 4DPXA 2XLIA 3X1LB 3D7SB 5D77A 1T0TV 4MKAA 1NDPA 1S1XB 4W98A 1NK7A 5IM0B 2DNGA 5DG7A 1JLGB 2IYGA 2QEXS 2CQIA 3PEJA 5DZ6A 3T5HA 2J9CA 3IBFB 2ZFHA 2ALZA 1T8EA 3QRRA 4DF8A 2GJIA 1FD2A 4R0EA 1FE4A 2AHOB 3GONA 1WG5A 2X1GA 3T1YF 1UVLA 2NZ4A 3CPWR 3CD0A 2R2TA 3SXLA 1Q53A 2VICA 4ER8A 1VLOA 4K2JA 2B9XA 4ED0A 1BC6A 1QAJA 4U67Q 2GIRA 1T7PA 2AMCB 4NASA 4DX6A 1TV6A 1P8GA 3Q8UA 2GS8A 3VGSA 2VJVA 1U26A 4ZLNA 1TTHB 2FLLA 3CTRA 4GC7A 1TMMA 1Z2LA 3PJ9A 2BOPA 3KHLA 2FLNA 1D3WA 4DR4J 2RF2B 5J2PB 2N7YA 1NLKL 5HBMA 4LFAF 3NS6A 3O6QA 3BBFA 1OY8A 4KFBB 3UDLA 4U8VA 3BPSP 3T5KA 3DOKB 1S0MA 3OL8A 3KDNA 5F0UA 4I7FA 4RNNA 3PRDA 1NJWA 1U25A 2L9DA 2EW9A 2MGZB 2IHR1 2QLFB 2W7PA 1RTHA 3Q8SB 3CCJS 1FRXA 3UPFA 1SB6A 2HGMA 4LBPA 3WZ0A 1UEVA 2KRRA 2BQUA 2ZOGA 2XY7A 1RTZA 1FXLA 3KLGA 4B9SA 2E7VA 1J5EJ 2CQ2A 2RQMA 3IG1B 1VQSA 2KXHA 1QUVA 3J7A1 4QIWD 1X4DA 4TXSA 3W7BA 5H9EK 1HQUA 1VIOA 5DDQC 4QYRA 2ZOMA 3K2YA 1NKCA 3AODA 3K17A 2J0QD 3IM9A 4KGZB 4Y2IA 3PIOQ 3MEKA 4YN3B 1BQNB 5EWEA 3NCQA 3HT0A 1RKJA 1LWCB 2H9ZA 3KUGA 1UPPA 1Y3KA 3GG1A 3AT1B 1F9HA 1AZSA 1NSAA 2MQNA 1VQPS 1N33J 2G4BA 4YHHJ 1O0PA 2NXJA 4LMZA 1DQ8A 2KTQA 4JUZA 2XMMA 4CLSA 3NAIA 5FDLB 1U48A 5KAKA 2DNKA 4DSEA 1YJ7A 3QZ7A 2V2VA 4QWDA 2B7BB 3UNGC 3TUIC 2RDJA 1HNWJ 1S57A 2PE8A 3FCVA 3KLVA 1EKRA 1ZYQA 4B08A 2OJ3A 1TKTA 1B4SA 1UEUA 1AROP 1Z1ZA 3GV8B 1SL1A 2MQ8A 3HHLA 4Z2XA 4J90A 2ADBA 3DHXA 1ZA2B 3BV8A 2GO8A 2B7CB 2VA2A 3QBCA 2WVBA 2UUCF 3H90A 2XHCA 3JAMU 1U1KA 1QM9A 4UOFA 2EI5A 1CC7A 1HNVA 1ZTWA 3PW7A 5KT7A 2HVEA 2QL9B 1Q5YA 3EXYA 4N7TA 2Y1RI 4MIAA 3CO0P 3SEOA 2N3OA 2HQDA 1KTVA 3IS9A 2FJAB 3KLIB 1MU2B 1B0PA 1GTEA 4ETZA 2ZE2A 3PIPQ 4RNFA 2WZ1A 3KWMA 1WC3A 5GAHU 5DLFA 2XO6A 4NOHA 4YEAA 3T1HF 1SKRA 3DXSX 4DS4A 4HVZA 4FBUA 5CD4A 2GQCA 3DGVA 1O51A 2LU1A 4LQ9A 2C2DA 3THVA 1NO8A 4LRDA 3D68A 2YWWA 1PO6A 5D3GA 2HNYB 3L09A 3UVJA 4M94A 3NAHA 1FVQA 2CJAA 2UU9J 3OJSA 5KT3A 4RU9A 4OYIA 1OJ4A 2WW4A 2D41A 5C24B 3L7OA 2E44A 1DHMA 4EO8A 1S1TB 2CADA 3JB9k 4RU2A 3S6EA 1QAXA 4CCHA 4YFUA 4YR0A 2L08A 2P6TA 4CO0A 3OLAA 2APOA 4IFYA 1NNDA 1HNXJ 1FF2A 3AQPA 2QZ8A 4ECUA 3HKWA 3MR6A 3W64A 2IM3A 4PPZA 3UN3A 3BQ1A 1HNIA 3OFFA 4DXLA 1VQOS 2C2EA 2WB4A 4WJBA 5I42B 1MN9A 3V81B 3NCRA 4P6QA 5T41A 4UZBA 2A2DA 3D4JA 3VF0B 4NLXA 2ZHAA 3HKZD
chains in the Genus database with same CATH topology
4PWWA 1J5EJ 4DV5J 4V1Ak 4KYZA 4DUYJ 3T1YJ 2UXCJ 4B3TJ 1HNWJ 4DR5J 4DV3J 2UUAJ 1N34J 4YY3J 5FLXU 4GKJJ 4X65J 2E5LJ 4JI2J 2KL8A 2VQEJ 3J81U 3D3CJ 2UU9J 4DR7J 1N36J 4LF6J 2MQ8A 4OX9J 3J7AN 5AJ3J 2UUCJ 3R2DJ 4DR2J 4DUZJ 4DV6J 5IT9U 4JI3J 1XNQJ 4LF4J 4X66J 4JV5J 1IBMJ 2F4VJ 5IWAJ 4JI7J 4LFBJ 4NXNJ 4HHUA 3JAMU 4DR4J 1I94J 3D3BJ 4DV7J 4JI4J 1XMQJ 4JI8J 4NEZA 5LMNJ 2ZM6J 4B3RJ 3IMQJ 4JI0J 4LFCJ 1N32J 4KY3A 4JI5J 4LF7J 4JI1J 4LF5J 2MTLA 4DV2J 4DR3J 4LF8J 1HNXJ 4LFAJ 1HR0J 4LF9J 5A2QU 4AQYJ 4X64J 4DV4J 3R2CJ 2MEWA 2VQFJ 3W1YC 3J80U 4NEYA 4DV1J 1XNRJ 1N33J 2UXDJ 4DV0J 4B3SJ 1XMOJ 1IBLJ 4K0KJ 3T1HJ 1FJGJ 4YHHJ 4DR6J 4GKKJ 4KHPJ 2UXBJ 4JI6J 4RJVA 5BR8J 3OTOJ 4DR1J 1IBKJ 1HNZJ 5LM7E 2UUBJ 5LMUJ 4NXMJ 2HHHJ 4X62J 4JYAJ 4B3MJ 2KVQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWW A;  1J5E J;  4DV5 J;  4V1A k;  4KYZ A;  4DUY J;  3T1Y J;  2UXC J;  4B3T J;  1HNW J;  4DR5 J;  4DV3 J;  2UUA J;  1N34 J;  4YY3 J;  5FLX U;  4GKJ J;  4X65 J;  2E5L J;  4JI2 J;  2KL8 A;  2VQE J;  3J81 U;  3D3C J;  2UU9 J;  4DR7 J;  1N36 J;  4LF6 J;  2MQ8 A;  4OX9 J;  3J7A N;  5AJ3 J;  2UUC J;  3R2D J;  4DR2 J;  4DUZ J;  4DV6 J;  5IT9 U;  4JI3 J;  1XNQ J;  4LF4 J;  4X66 J;  4JV5 J;  1IBM J;  2F4V J;  5IWA J;  4JI7 J;  4LFB J;  4NXN J;  4HHU A;  3JAM U;  4DR4 J;  1I94 J;  3D3B J;  4DV7 J;  4JI4 J;  1XMQ J;  4JI8 J;  4NEZ A;  5LMN J;  2ZM6 J;  4B3R J;  3IMQ J;  4JI0 J;  4LFC J;  1N32 J;  4KY3 A;  4JI5 J;  4LF7 J;  4JI1 J;  4LF5 J;  2MTL A;  4DV2 J;  4DR3 J;  4LF8 J;  1HNX J;  4LFA J;  1HR0 J;  4LF9 J;  5A2Q U;  4AQY J;  4X64 J;  4DV4 J;  3R2C J;  2MEW A;  2VQF J;  3W1Y C;  3J80 U;  4NEY A;  4DV1 J;  1XNR J;  1N33 J;  2UXD J;  4DV0 J;  4B3S J;  1XMO J;  1IBL J;  4K0K J;  3T1H J;  1FJG J;  4YHH J;  4DR6 J;  4GKK J;  4KHP J;  2UXB J;  4JI6 J;  4RJV A;  5BR8 J;  3OTO J;  4DR1 J;  1IBK J;  1HNZ J;  5LM7 E;  2UUB J;  5LMU J;  4NXM J;  2HHH J;  4X62 J;  4JYA J;  4B3M J;  2KVQ E; 
#chains in the Genus database with same CATH topology
 5LMU F;  2VQE F;  4O4G A;  2YWF A;  3A12 A;  3FEX B;  1SL0 A;  2FVQ A;  1RAC B;  4B3T J;  1FRM A;  2UUA J;  1GMU A;  1YRX A;  5CYQ B;  2VDI A;  3EX7 B;  4XDD A;  2ZBR A;  2JEI A;  3AXM A;  4KPC A;  1UFW A;  3QPI A;  3ENV A;  3K89 A;  1HBO A;  2W2O P;  2E7X A;  4B9V A;  1S0N A;  3MM5 A;  5IT9 U;  4KKO B;  3R1H A;  1ROF A;  4JV5 J;  2CRL A;  2F4V J;  5F0W A;  2C1E B;  2HFN A;  3U02 A;  4R0J A;  4OHZ A;  2R7T A;  4X4Q A;  2CXE A;  4JI1 J;  3GR1 A;  5HI7 A;  3HHN B;  2K3K A;  1XMO F;  4DZD A;  2DNY A;  2BUN A;  4UUX A;  3MEG A;  4BWM A;  2UXD J;  1YJV A;  3I82 A;  4ZPT R;  2VJU A;  1XN9 A;  1IBC B;  2C2O B;  5K20 B;  4JP8 A;  3EGN A;  2KDO A;  2B8P A;  5HAN A;  2E1M C;  2HHH J;  1CJT B;  3FCH A;  1C0U A;  4TYA A;  3FMB A;  2F8M A;  4W90 B;  4DR5 J;  4UOG A;  3HD1 A;  2WVF A;  1EP4 A;  4CH0 S;  5KFJ A;  4NWB A;  1N0U A;  1SCJ B;  3HHE A;  1MG7 A;  4I2P A;  1U0H A;  4FP9 A;  4DMZ A;  1RTD B;  3EDQ B;  1BXN A;  3EVO A;  5I3Q A;  4F8R A;  2M0G B;  1OQ6 A;  4K4Y A;  5KFZ A;  4NPO A;  5HVG A;  2FVS A;  3PG9 A;  1Y0H A;  4MKV A;  4IDK A;  5J2Q A;  2AZ1 A;  1X4A A;  3CJS A;  2IYI A;  2VPY B;  3MFI A;  1S6O A;  4MK7 A;  5GAD I;  2IDL A;  5LSR A;  3DOL A;  2B5J A;  4M5L A;  3NGS A;  4ZVS B;  1PIE A;  2DGT A;  3AB4 B;  3H4B A;  3G82 A;  2GHP A;  2Q1L A;  3MMJ A;  3HVR A;  4HH0 A;  4QIG A;  2XSF A;  5HRO B;  1S77 D;  1BHN A;  2NXC A;  3ZZO A;  3T9Z A;  2DGU A;  4JV1 A;  2BKN A;  2ROG A;  4XIU A;  1U2F A;  1JXE A;  3CCR S;  2O3D A;  3B78 A;  3KK2 A;  3TA1 A;  2PGC A;  4YR3 A;  3DRP A;  2RDI A;  3MPU B;  2JLG A;  4U8Y A;  3HO1 A;  4ZCK A;  5MAO A;  3RBD A;  2QV6 A;  1VC0 A;  1JLF A;  3VCD A;  4C3L A;  3KLE A;  4USU A;  1RA6 A;  3C2P A;  4ES1 A;  4F4Y A;  1OY9 A;  3HHK A;  1DTT B;  2ZD1 A;  3DOM B;  4UZC A;  4B3S F;  4HTI A;  1UVN A;  1JJ4 A;  4EWT A;  2YX1 A;  4LUB A;  4X64 J;  2KVI A;  3PX6 A;  2XZW A;  1WOP A;  1IQZ A;  3SV3 A;  1DUR A;  1ZZN A;  2VPW B;  3K7R A;  5D15 A;  1CVJ A;  2A2C A;  4KGK A;  1S7H A;  3RTV A;  5AE1 A;  4NXM J;  2Z57 B;  1RAH B;  3DLH A;  1WI8 A;  1VCT A;  4B3M J;  3F0N A;  3TVY A;  3MR2 A;  2UXC J;  9RUB A;  3R7B B;  3VAM A;  4AE5 A;  2B4V A;  2J9D E;  4BC7 A;  1Y11 A;  4NYO A;  4F04 B;  2VFT A;  3MMA B;  4ECQ A;  1JLB B;  4DV6 F;  1EIY B;  4F02 A;  3QT8 A;  4Q8E A;  4K7Q A;  3ZNJ 1;  2G2Y A;  1XR6 A;  3D28 A;  1SKW A;  1B64 A;  2YXL A;  1HHT P;  4JI7 F;  2XWX A;  1F3V A;  1BLU A;  1FFW B;  4TVA B;  4EBD A;  3BN4 A;  4KR0 B;  3QO9 B;  5E5N A;  4O44 B;  3L7U A;  2G9O A;  2XS2 A;  5D4N A;  3OVS A;  2MLX A;  1HAR A;  1F5C A;  3HFK A;  3DLK A;  2Z2Y B;  4C2M A;  4DL6 A;  5KFV A;  2MHN A;  1TK8 A;  2H4Y B;  5J1E B;  4O3N A;  4YME A;  3W8P A;  4LF7 F;  3V6D A;  5E3Q A;  2AGO A;  4CRJ A;  3OTB A;  3OD2 A;  2C28 A;  3WHI A;  4QWE A;  2JL9 A;  2YBV A;  3PHT A;  2RHS B;  4KH0 B;  1YRU A;  2ZUG A;  2EVZ A;  2Z0G A;  5CAA A;  2ERR A;  2Q66 A;  3R97 A;  4DUY J;  3NRB A;  4RW6 A;  4H4K A;  3OFE A;  2CNN B;  1YGY A;  4AL5 A;  4A8W A;  2NCK L;  3D0I E;  1TZ0 A;  3ZTS A;  1HQE A;  3ADA C;  4RW9 A;  1VBZ A;  3G6V A;  1KQK A;  3M1V B;  3OVB A;  2YKO A;  3GYN A;  1DTQ A;  5DDO C;  2DD8 S;  4C8N A;  4WK1 A;  3OQ2 A;  3DLJ A;  3CMQ A;  4O0N A;  1RXO B;  1FWK A;  3RB4 A;  2CNL B;  1FJE B;  3OVA A;  4NXN J;  5I3U B;  1IN0 A;  2GHV C;  3B8H A;  4DJB A;  1XTZ A;  2HBQ B;  2HQ3 A;  3W5X A;  3WIU A;  4OI6 A;  2DO4 A;  4RWW A;  4CNZ A;  2F65 A;  2ZJR Q;  4DHV A;  4B9M A;  4ZVO B;  3W2V A;  2Z2L A;  2OEK A;  1X5P A;  2VKZ G;  4HAC A;  2F8H A;  1WC0 A;  2YWG A;  3CCL S;  3BGR B;  1VRT B;  3GIK A;  5HAO A;  5E3A A;  4J9O A;  3MFH A;  4K0K F;  2QSF A;  4LSZ B;  4EO6 A;  3GQC A;  3LPY A;  4GKJ F;  2GGP B;  4RO0 A;  4RUA A;  1R8P A;  1RTJ B;  3FBF A;  1T03 B;  1RTI B;  4F0K A;  5CAB A;  3LAK A;  1C4C A;  3MHY A;  1DRZ A;  1KBR A;  5T7L B;  4OI0 A;  1X0P A;  2OGU A;  4CO3 A;  1PYS B;  3US5 A;  1TK5 A;  4LF6 J;  4I6Y A;  2MMY A;  5EHH A;  3ELH A;  3PYE A;  1JK9 B;  7AT1 B;  4DL3 A;  3R5A A;  2OSQ A;  2CQ1 A;  2UVR A;  3JSB A;  1PC5 A;  3MD1 A;  3R27 A;  2UP1 A;  2GIQ A;  3OXL A;  4WZM A;  3EUN A;  2P9G A;  1QD1 A;  1R0C B;  2HRU A;  4MAK A;  5GAD U;  3SCK E;  3VGT A;  2HVI A;  2L3M A;  3OSP A;  2UV8 A;  4IG3 B;  5KFK A;  3CUN A;  3C8Y A;  1U49 A;  1U8W A;  4OHV A;  1FK9 A;  2HG4 A;  5BR8 J;  3JYT A;  1MRO A;  4RZR A;  5I3P A;  4CDI A;  2IJF A;  5B0G A;  3AHP A;  3M8Z A;  1RHK B;  1YZ6 A;  2Z30 B;  3SQG A;  3CXC R;  1LK5 A;  2AYG A;  3I56 S;  2MZR A;  2X3G A;  3ILO A;  3MMC A;  2COL A;  2VG5 B;  2AX1 A;  2VOO A;  3MOZ A;  4B9N A;  1LV5 A;  4RW4 A;  2FQQ B;  2JSX A;  5F9L A;  3AFG A;  2KYX A;  2BVZ A;  3W2W A;  1N36 F;  3MAH A;  3EPG A;  4Q43 A;  4RBU A;  3BKF A;  1U2R A;  1TL3 B;  5A8W A;  1R8C A;  5A8R A;  4ZDN A;  1OMS A;  1EAR A;  4OZ0 A;  2OPS B;  2DHA A;  1N32 J;  4DCO B;  4YP3 A;  2PMH A;  3BQ0 A;  3MAQ A;  2V9K A;  1IKW B;  4WE1 A;  3HSJ A;  4NCB A;  4LF9 J;  1MMN A;  4ATN A;  3JQK A;  2OPP B;  2ZH1 A;  4LRC A;  4FYY B;  3HK2 A;  4ECT A;  1UWB A;  2GNK A;  3OBI A;  3DI6 B;  4N41 A;  2V6A A;  1G4C A;  3HFZ B;  4DV1 F;  3FBB A;  4FPI A;  2IMW P;  2ZDP A;  4F67 A;  4X4V A;  1V3R A;  4A8S A;  2HQG A;  1S48 A;  3PDN A;  1L3V A;  1KRP A;  1VYA A;  1B7Y B;  4JYA F;  1LW0 B;  2FHO B;  1Q5V A;  5IC6 B;  5MLC V;  4AXI A;  5LXR A;  1SUQ A;  1SIW B;  3AH6 A;  3ZZR A;  2ALY B;  2FGC A;  2FHK A;  1P9Y A;  1VI7 A;  4AXJ A;  4GO7 X;  3CD5 A;  2DGS A;  3PYF A;  3UD4 P;  3DFE A;  4MK9 A;  4X4N A;  4F0M A;  1KQS R;  4ZKA A;  4J9L A;  2RRN A;  1DAR A;  2EKN A;  3IMQ J;  3RAM A;  4DR3 J;  1YI2 S;  2ILY A;  2HIY A;  2LKZ A;  1GFW B;  4IRC A;  3UD5 A;  1M1K T;  4ENO A;  1M5O C;  1UAW A;  4DPO A;  2CPY A;  1Q7L B;  1U09 A;  1RT2 B;  3CDA A;  2DH9 A;  4NRT A;  2G0I A;  2W4C A;  3W9H A;  1XJW B;  1LWE B;  1VQ8 S;  4EU0 A;  1D8Y A;  2JEJ A;  4RUB A;  1UJ5 A;  5E3C A;  4LR9 A;  3A3O B;  3LAL A;  3DXB A;  3Q8Q B;  4F4A A;  5DQG A;  2IA6 A;  1RBL A;  2F8E X;  1HPZ A;  1S1X A;  3ICL A;  3UW1 A;  5IM0 A;  2OPR B;  1RWU A;  2B43 A;  3ENQ A;  1JLG A;  2NSC A;  1D9D A;  4RWX A;  4ZN1 A;  4NLV A;  3EVW A;  1KC8 T;  5LMN F;  3KJV B;  3PXG a;  2RD5 C;  2KXF A;  2KT2 A;  3HP6 A;  1YBT A;  4CTA A;  4AL6 A;  2EPI A;  3P49 B;  1RT6 A;  4IFV A;  4X4U A;  4OI2 A;  4DN9 A;  3HPO A;  4DFK A;  1KN6 A;  3LOU A;  3UO0 A;  3V6K A;  3LO3 A;  5DG8 A;  4KY3 A;  2MTL A;  3V5R A;  2W2Q P;  3PEH A;  1HBU B;  4PG6 A;  2MDA A;  1KLM A;  3QT6 A;  4PZV A;  4C7Q A;  1P6T A;  3F56 A;  1RHQ B;  1FD8 A;  4DL2 A;  4DX8 H;  1FT8 A;  2HWI A;  3Q24 A;  4WF9 Q;  5LT5 A;  3EPI A;  3PM9 A;  3OTO J;  3BGL A;  2UZA A;  2KU7 A;  2MKY A;  1X8D A;  1M90 T;  2RF2 A;  5J2P A;  1G7C B;  4EBC A;  2C42 A;  3C6T B;  3PKM A;  1HW8 A;  3OT9 A;  4ED6 A;  2PFD A;  1UVM A;  4KFB A;  2CDR B;  1O5J A;  1HBM B;  2JJ4 D;  3DOK A;  1VR6 A;  1I3O B;  2FJB B;  2NSB A;  2RH3 A;  4WXW A;  4DCP B;  4DG1 A;  2WSE C;  3DLE B;  5KG3 A;  2DKO B;  3FC9 A;  1W26 A;  4ZIV A;  2K2P A;  4AYB D;  2W9A A;  4MIW A;  1E6Y A;  2B9Y A;  3G6Y A;  2MGZ A;  3LP0 B;  5AT1 B;  1JLC B;  5KFM A;  1S1U B;  1T9Y A;  3SFU A;  4CLP A;  4OX7 A;  2YWK A;  4TYB A;  2DCU B;  3H5Y A;  3TJ8 A;  3IG1 A;  2LYV A;  2Y0B B;  4B3R F;  3I5C A;  1WOR A;  3FQK A;  5JVH Q;  3RAQ A;  3MPD A;  5KFT A;  2BA9 A;  1FFS B;  3E01 B;  2CQ4 A;  3PNI A;  3W1Y C;  4NEY A;  3QWP A;  4UQG A;  1IBL J;  3L7P A;  4LSN B;  2UXB J;  4WZQ A;  3S01 A;  4KC5 A;  2HGL A;  2GVZ B;  4GVB B;  3QGI A;  3H42 A;  4NLS A;  5K8N A;  1N56 A;  2BE9 B;  4K4T A;  3WX8 A;  3LW5 C;  5H9F J;  1BQN A;  2VPZ B;  5DS7 A;  1VRU A;  4KHM A;  3I0S A;  4JI2 J;  2J9D A;  1VBK A;  1LWC A;  1KHW A;  3FKB A;  3Q89 A;  1CQM A;  1YJW S;  1JKH B;  2DRD A;  1TV6 B;  2W4P A;  3LA0 A;  1H73 A;  1I5O B;  1PJ7 A;  4CZC A;  4NA1 A;  3VAH A;  2R8H A;  1R0A B;  1FJ7 A;  2MLZ A;  1VIX A;  2FTR A;  3JXO A;  3DLL Q;  2M4M A;  3GFH A;  3N6M A;  2DXE A;  3I4P A;  1RAD B;  1HYS B;  3IAS 9;  3R5G A;  3I31 A;  2Q43 A;  4W92 B;  1GT8 A;  3HVT B;  2EFQ A;  3EGZ A;  1TFW A;  1NME B;  3TW0 A;  4EZ6 A;  1LWX A;  3M8P B;  3I9V 9;  3NP5 A;  2QMX A;  1GNK A;  2ACY A;  3POT B;  5KFI A;  4CLU A;  5AE3 A;  2MY8 A;  2K1R B;  4LRF A;  3PR5 B;  2J0X A;  3T1Y J;  1F60 B;  5DZ7 A;  4C8Z A;  3TAN A;  4TY9 A;  3RR8 A;  2XG8 A;  1M5S A;  3D9B A;  2HFS A;  3S1T A;  2VZ9 A;  1UA0 A;  1SJR A;  3R6L B;  3KLI A;  1MU2 A;  2Q6B A;  2FHM A;  4KAI A;  1X0F A;  2J76 E;  3PY8 A;  2ZBI A;  1JJC B;  1SH0 A;  3WC0 A;  3CJ4 A;  3CC7 S;  3GLJ A;  1VRQ C;  1AYE A;  1HI8 A;  1RK8 A;  3KNG A;  4I4B A;  2XQC A;  4NA3 A;  3OL9 A;  2NQP A;  3Q2T C;  4Q0B A;  3TR5 A;  4P7V A;  3AQO A;  1NDK A;  4J91 A;  4LFA J;  3RR7 A;  4C6A A;  4M5G A;  4X4O A;  4XO0 A;  1RWW B;  1R8H A;  4GO5 X;  3IAM 9;  1X4B A;  4HR2 A;  1NDC A;  4RNO A;  3V4I B;  3D5M A;  1DBD A;  1T95 A;  4OV1 A;  3A8J A;  3PV8 A;  5RUB A;  4CLF A;  3I0R B;  2B9E A;  4NLW A;  4DFM A;  1BE4 A;  4JV0 A;  2D3Z A;  3NWR A;  4CO1 A;  5AJ3 F;  2P8I A;  3QIP B;  4OFZ A;  3PZP A;  3DRY A;  3KLF B;  2H3E B;  1TKZ A;  1FDA A;  3GJQ B;  1FTC A;  2PMW A;  4WCE Q;  3J7Z T;  1VQ6 S;  4Y2A A;  4WXO A;  4C11 B;  2VC0 A;  1OSD A;  3V81 A;  4NML A;  2XY5 A;  2N7C A;  1S10 A;  1QE1 B;  3MCM A;  1HNV B;  4GC6 A;  3RRG A;  3MR7 A;  2VFS A;  2CQ3 A;  1U1Q A;  4GKK F;  4E8U A;  3MGJ A;  3VVT A;  1VMB A;  5J2M B;  5CYQ A;  4QZV B;  1JXV A;  4U6P A;  3CCS S;  3SV4 A;  2CJK A;  2GAH C;  3TVZ A;  4KKO A;  4OMF G;  3MR5 A;  1S6P B;  4KT0 C;  2DHH A;  4URQ U;  3HJV A;  2VBZ A;  5D6G A;  3BN7 A;  2XMJ A;  1FRJ A;  1O6X A;  3L9Z A;  2EBG A;  2IDE A;  3ETM A;  2OTJ S;  4OZ1 A;  3J7Y I;  4WYW A;  2CPH A;  5M2P A;  1RT1 B;  3TAM B;  1HHS A;  3MED B;  2V94 A;  3UVJ B;  2RRA A;  5D0R A;  3O2I A;  2DRA A;  1FNM A;  1RWM B;  3SSS A;  2DHX A;  1XIQ A;  4ES2 A;  4LF8 F;  3GWC A;  1REV A;  1FNX H;  2XTJ P;  2YNF B;  2YKA A;  1IWA A;  1CJT A;  1NSP A;  4F26 A;  3BH6 B;  2FZC B;  4DV7 F;  1SC3 B;  2MQQ A;  1PBA A;  3R5D A;  3DU5 A;  3GIM A;  1T05 A;  4MYU A;  2CZ4 A;  4PAA A;  1M1G A;  4KPY A;  2LMI A;  5HMX A;  1EZZ B;  1T3N A;  1SQG A;  1HNI B;  4IOC Q;  4UF4 A;  1RTD A;  2FHJ D;  2PEH A;  2ZKT A;  5IT4 A;  1TL1 B;  1PBU A;  3W9J A;  3N0V A;  3BM7 A;  3OTC A;  2VHG A;  3ZTR A;  4ED8 A;  2F63 A;  1YJU A;  1NKB A;  2HIQ A;  4MKB A;  5L1J A;  1NCL A;  2X7I A;  1H2T Z;  5B0B A;  2UVV A;  1WKL A;  3IN5 A;  2BR0 A;  2YPZ A;  4JV2 A;  2HZA A;  1RWO B;  5FD1 A;  4IOB A;  1OSC A;  4J37 A;  2ASD A;  2ZM6 F;  4RX6 A;  4PAB A;  4F25 A;  2V4J B;  1RI7 A;  1HD1 A;  1C2P A;  3DN9 A;  1JJ2 R;  4B17 A;  2CFX A;  2FVR A;  2ZH5 A;  2QFJ A;  3VQT A;  5HRO A;  2WCX A;  5KFQ A;  4WFX A;  1N5Y A;  3UR0 A;  3ZZZ A;  2OD4 A;  2NS1 B;  3CCZ A;  1ZA1 B;  2XMV A;  2AW0 A;  2YNI A;  1WC4 A;  3KXD A;  1C0T B;  3HF5 A;  4N77 A;  1FRH A;  3ITH B;  2IRU A;  2JX2 A;  4C48 A;  3MEG B;  1B0V A;  2BV3 A;  1LK7 A;  1R0B G;  4ZPD A;  1RB0 A;  1VC5 A;  1YVF A;  8RUC A;  1V3S A;  4AL7 A;  4FKX A;  2MKJ A;  3RBE A;  3NMR A;  3CJK B;  2VQE J;  4ZCL A;  3P6Y C;  3R7S B;  1N88 A;  3VWS A;  3DOM A;  4ZVQ B;  2BJE A;  4C9D A;  4BLG A;  3QID A;  4X66 F;  2BZ2 A;  1HL6 A;  1HWI A;  1R89 A;  2EFO A;  3H40 A;  1Q79 A;  2EXU A;  4DL5 A;  2KXN B;  2W8L A;  3K57 A;  2MKK A;  1QAY A;  1U0H B;  5DGB A;  1TKX A;  2H1Y A;  2H65 B;  4RKU C;  2H5I B;  4ETX A;  4OV6 A;  2Q79 A;  1FKO A;  2D9O A;  1RYR A;  1WHX A;  1XR5 A;  2I8E A;  3LWL A;  5KFG A;  2KM8 C;  4C8K A;  2XCA A;  4RL1 A;  4P75 A;  2B4U A;  4Q7A A;  4WPA A;  4TU8 A;  3RAX A;  4A47 A;  3FGV A;  2QLB B;  5DRK A;  1NK8 A;  3OL6 A;  2VOP A;  5J2Q B;  2FUG 9;  2RNE A;  2E1P A;  2CJX B;  3MMA A;  5KG0 A;  1JLB A;  3TJ9 A;  4ZVT B;  1XMO J;  4M5H A;  2ZWP A;  4MK8 A;  3VZH A;  4UOH A;  4FNI A;  4N47 A;  5KFL A;  2B5J B;  2DH7 A;  3QO9 A;  3N5F A;  2M70 A;  2BRK A;  2KVQ E;  1OWX A;  3Q8R B;  2V2K A;  2HFU A;  1URR A;  2GIF A;  3AOA A;  4MH8 A;  4WYL A;  1NK0 A;  3NBP B;  3PVX A;  2R7Q A;  2DGO A;  5KFF A;  3M30 A;  3J81 U;  4ED5 A;  1R27 B;  3H25 A;  3LQV A;  3M32 B;  5CH7 B;  2ASJ A;  1QUP A;  3EXC X;  1SH3 A;  2W8K A;  4IYQ A;  4ZMM A;  3KK2 B;  1SC4 B;  3DRP B;  3C66 A;  5ETL A;  4UW2 A;  4PEO A;  4X4S A;  4QR1 A;  5I4M A;  2RU3 A;  5IV4 A;  3NWG A;  2O67 A;  3LPE A;  2V67 A;  3TZW A;  4DV4 F;  1JLF B;  2Z58 B;  2G1H A;  1NUE A;  2W24 A;  4J9K A;  3KLE B;  1A9N B;  3CJR A;  3M05 A;  2D1C A;  1JLA B;  4OYW A;  2KM8 B;  4D3H A;  1K1Q A;  3PFO A;  3M1V A;  4QYZ J;  3PX0 A;  1SJ1 A;  3H8Y A;  2V69 A;  2QA4 S;  4KHP F;  2DYA A;  3TEG A;  3C16 A;  2XNR A;  3JSY A;  3CJ5 A;  3PFE A;  2HNZ B;  4QR0 A;  4V1A k;  5K5M A;  1YTY A;  5I3U A;  2GV1 A;  2IAJ B;  1FA0 A;  3RJM B;  1DAX A;  4IH7 A;  1KQF B;  3J7Y U;  2V8H A;  2QA1 A;  4QR2 A;  5DDR C;  2I1R A;  3I9Z A;  3AOB A;  2ROE A;  3H2L A;  3NNC A;  3TI0 A;  4KB7 A;  5B09 A;  1NK6 A;  5IWA J;  3T3F A;  4DV2 F;  1WEX A;  1Y4Z B;  3BGR A;  1QY7 A;  5D8H B;  2KKH A;  4QWC A;  2N4C A;  2Q3P A;  4AQY F;  2ATC B;  1LNQ A;  3ILJ A;  2GML A;  2JVO A;  4F3M A;  2EFG A;  1FDD A;  2M3D A;  1M5P C;  1W2I A;  2DNM A;  1T03 A;  1L3T A;  2HLU A;  2WW8 A;  4ES3 A;  1VQ7 S;  2QX0 A;  4DR1 F;  2NZC A;  4CLT A;  5T7L A;  2HS3 A;  4B3S J;  5KFC A;  3W9I A;  1WOO A;  3CCM S;  3KK1 A;  3V6D B;  1S9E B;  3W65 A;  3M8Q B;  3HLU A;  1V3Z A;  2FGO A;  2WVD A;  2IVF B;  5KT2 A;  4CLL A;  4DUT A;  4QU6 A;  3MUV P;  4HTJ A;  3G8S A;  2MQP A;  3VV2 B;  2VDH A;  3CNQ P;  4WFA Q;  3ZO7 A;  4ZLJ A;  2JNJ A;  1WD6 A;  4CO4 A;  3DMJ B;  3NG8 A;  4LSL B;  4DV6 J;  4IG3 A;  4RW9 B;  2C3Y A;  1YSJ A;  5ETM A;  2AEF A;  5IQQ A;  4JI7 J;  1WKK A;  4B3O A;  4NMX A;  2HGN A;  4M63 A;  4LF2 A;  1KHV A;  2HK2 A;  4O23 A;  2HND B;  4ILM A;  2OPQ B;  5EX3 A;  3J80 U;  1KP6 A;  2VG5 A;  3CCW A;  3LTO A;  3UD3 P;  1UFK A;  4FPR A;  1X9S A;  2POK A;  3E3X A;  1U1O A;  2PII A;  2CJ9 A;  4YY3 F;  4HAC B;  4XAK A;  3HD2 A;  2PSZ A;  3QLH A;  1TL3 A;  3M8Y A;  2JHE A;  1KNZ A;  1QVF R;  2D3O R;  4ZPV R;  2OPS A;  4X4R A;  2FY8 A;  2HKE A;  2KL8 A;  3TEH B;  4OZL A;  3G87 A;  2GJF A;  4MKY A;  5KG6 A;  3OXF A;  1IKW A;  4DQI A;  1I94 F;  2XYP B;  2OPP A;  2HRT A;  2B56 A;  1S72 S;  4OJG A;  3DI6 A;  2RIL A;  3NGT A;  4J9R A;  2DNN A;  4P2M A;  2LP4 A;  3IC1 A;  2XSJ A;  1RWP B;  4QOT A;  3VAG A;  4QWA A;  5LL6 d;  4DDF A;  1DQA A;  2K06 A;  1LW0 A;  3MEE B;  4W4M A;  5A0Y B;  5KG1 A;  4QPX A;  5F9N A;  4CQ1 A;  4PCQ A;  4F3O A;  1Z2Z A;  1BQM A;  3C6U B;  2JLE A;  1H2U X;  2IM1 A;  5LXY A;  2OSR A;  2Z4P A;  5ITH A;  3WBZ A;  4L3K A;  1FK9 B;  3G2X A;  3TAR A;  3AAW B;  2F9D A;  1NHK L;  1FWL A;  3CJQ A;  2IBK A;  4J9U E;  5B0A A;  5DO2 A;  3EZ5 A;  3GPA A;  4GKJ J;  2F1F A;  2VFV A;  1LKZ A;  4K50 A;  1U6Z A;  1Y9O A;  1HNW F;  4PQU B;  3QGH A;  4J5O A;  1TUV A;  2HVH A;  5D78 A;  1F9E B;  3GJR B;  3CCT A;  4PXE A;  2W1B A;  5LJ5 Y;  4JI8 F;  3OR1 B;  1S49 A;  1RT2 A;  2BYC A;  4RW4 B;  3UWT A;  5EN1 A;  4NLD A;  3RW6 A;  3PCO B;  2EG1 A;  1RUS A;  3BGF A;  3OW2 R;  5A8W B;  2F40 A;  1S59 A;  5T14 A;  1EB0 A;  1AFJ A;  4ZP7 A;  4URG A;  2BM0 A;  2IJR A;  3VQS A;  3KJQ B;  2PD1 A;  2QT7 A;  1ZOT A;  4UT4 A;  2YX4 A;  4O3P A;  3L4B C;  4C8L A;  2DO0 A;  1KDN A;  2DIT A;  1Q16 B;  4NI2 B;  4AFF A;  2CNK B;  3IFE A;  3CF5 Q;  5IQ6 A;  1W7W A;  3CDU A;  4HHJ A;  3TNV A;  2VBW A;  3PKY A;  5EUH A;  1V6H A;  2HAI A;  4P74 A;  4NZ0 A;  4P2F A;  4OX9 F;  1RAF B;  2V5H G;  1SQE A;  3EVM A;  5IT9 Y;  2GA7 A;  2ZOF A;  3OJU A;  1URN A;  5FLX Y;  3HMJ G;  1HBU A;  4J9V A;  2ZBQ A;  3M6X A;  2K8G A;  1XMQ F;  2VD3 A;  5GMD A;  2UU9 F;  1I6J A;  2KT3 A;  4U7C A;  2CWX A;  2JDJ A;  4CIO A;  4X2B A;  3D0H E;  2XGQ A;  3IGN A;  3O3L A;  3RRK A;  3TX0 A;  3M2V B;  2AWZ A;  5A6W A;  1UMJ A;  1FXD A;  3AOC A;  3M4X A;  5GAE I;  3C6T A;  3QGG A;  4C8O A;  1GMV A;  2CQC A;  3I87 A;  5E41 A;  4WFZ A;  3BO4 A;  4UUW A;  1HBM A;  4OYM A;  2E9Z A;  3FRY A;  2XS5 A;  2M2B A;  2P6S A;  3DLE A;  3UFC X;  3AD8 C;  1J2V A;  2CDQ A;  4ZJO A;  2Z2M A;  3VGV A;  3Q86 A;  2PN6 A;  4H54 A;  2UVW A;  3H59 A;  1UW9 A;  2LEA A;  1JLC A;  1PJ6 A;  2BJ7 A;  1Y00 A;  1QDU B;  5EGY A;  2MKC A;  1WOS A;  2Y9H A;  2UUA F;  3KUE A;  4JI3 F;  4OLP A;  3CSK A;  1HPZ B;  2DIV A;  5BYS A;  4L74 A;  3E01 A;  1WEL A;  2ZC4 A;  1C4A A;  1YKW A;  2CQB A;  2J6T A;  3A4T A;  3UE2 A;  3BSA A;  1ACM B;  2MYF A;  4LSN A;  4YS2 A;  2VFU A;  5L38 A;  2HHU A;  3QSY B;  2GVZ A;  4GVB A;  1I51 B;  1HFE L;  3NOC A;  4CTA B;  1RT6 B;  4IFV B;  5HQM A;  2BKP A;  4KIA A;  1VHF A;  3K0J A;  3KOA A;  2LA6 A;  1QAI A;  3LGN A;  1SC6 A;  4HYK A;  1U02 A;  4WWS A;  4JOU A;  1N8R T;  4E2F B;  3MMB A;  4A8F A;  1MWZ A;  1BMQ B;  1RAA B;  1TR0 A;  4OJH A;  2MZS A;  2DGW A;  4DV0 J;  1HI0 P;  5CQG A;  3B6B A;  4AUK A;  1KLM B;  5IC4 B;  2GX8 A;  4EMD A;  1JKH A;  1NJI T;  4TLR A;  3W66 A;  2HHH F;  4XPE A;  2IY5 B;  1R0A A;  4QBU A;  2ZZN A;  1YX2 A;  1HYS A;  3JTN A;  2NUH A;  3TP2 A;  3FZ2 A;  3T1A A;  5J1N A;  2YKM B;  1RSC A;  3HVT A;  1L5U A;  4G3I A;  4WFB Q;  1NK9 A;  3FCW A;  5A8K B;  4I6A A;  2BMB A;  2E9R X;  3M8P A;  2EWH A;  3GIL A;  4DG1 B;  2BAN B;  1YWX A;  4J9N A;  3POT A;  2R7X A;  1RT7 B;  5LMN J;  3BH7 B;  4ILL A;  2K1R A;  3C19 A;  1E6Y B;  2Y8Y A;  2QL5 B;  1UVK A;  2AJ1 A;  3G8Q A;  2HS4 A;  1AFI A;  1JNR B;  2K7K A;  3IRW P;  4ZIW A;  3KFW X;  3CW2 C;  4P2X A;  2UUB F;  2FB0 A;  5AXK A;  4ZN3 A;  1EHW A;  4OHW A;  1FJG J;  4L75 A;  3MAA A;  2ZBP A;  4G6V B;  2ZH7 A;  3H98 A;  2V8V A;  2ZZM A;  1EKS A;  4R5P B;  4LBH A;  1M5V C;  5ETR A;  1RU2 A;  4R8U B;  3ZZP A;  4TQS A;  2HYI B;  1VQN S;  3GSI A;  3M6U A;  3FQL A;  4DF4 A;  3A3N B;  1UP1 A;  3GMG A;  1VRU B;  4OX8 A;  3I0S B;  3HFV A;  3BSN A;  2AZ3 A;  2H48 B;  1HWK A;  3HCX A;  1HHQ A;  2V2Q A;  2NR0 A;  3LP1 B;  3BPD A;  4LFB J;  3V4I A;  1DZ5 A;  4H4M B;  1Q7Y T;  5JXS A;  4G1Q B;  4YDD B;  2WB1 D;  2O5D A;  4QIV A;  1LXN A;  5E2Q A;  4I69 A;  3PYD A;  2BXJ A;  2DIS A;  3I0R A;  2DEJ A;  2I6W A;  3DM2 B;  3OPK A;  2WAQ D;  3BJY A;  1EET B;  3CDW A;  3QIP A;  4X64 F;  2HSE B;  2R2U A;  2BX6 A;  3KLF A;  4L76 A;  2BJ3 A;  4NCA A;  1YBA A;  4C0O C;  3AY0 A;  9ATC B;  1XC9 A;  3BB5 A;  4DV5 J;  4KYZ A;  4C11 A;  3FFI B;  2X1B A;  5SUH A;  1EJ7 L;  2HBY B;  4PKD B;  3TQE A;  5HQL A;  2UXC F;  3D6H B;  4DR2 F;  3ONQ A;  3BDE A;  3UDE A;  3GCW P;  1QE1 A;  3A8K A;  4HI1 A;  4FYV B;  2J6S A;  4I0W A;  4IR9 A;  4ED2 A;  3CGI A;  3ENW A;  1TKD A;  3DHW C;  5LJ3 Y;  5J2M A;  1X4C A;  4I1T A;  1NK5 A;  2L9W A;  2PA8 D;  4QU7 A;  4WKR A;  1AA1 B;  4WP8 A;  4PR6 A;  1R8B A;  3P3D A;  5H9F K;  3SCJ E;  3UNY A;  4FVC A;  4DI6 A;  5GAE U;  1S6P A;  2W7A A;  4Q0B B;  2ATL A;  1QTM A;  1NJX A;  1LOU A;  3FZB A;  2MXY A;  4CI0 B;  4USM A;  3GZ7 A;  3M9O B;  2RSQ A;  3QMQ A;  1X5O A;  2AF6 A;  2IRX A;  3BR9 A;  1VJW A;  3R5C A;  5AXL A;  1RT1 A;  1KS2 A;  3TAM A;  1Q4R A;  3MED A;  4NLO A;  3FEY B;  1N34 F;  1YIT S;  1MN7 A;  4Y2C A;  2RDD A;  4U96 A;  3DNC A;  2A6O A;  1WEZ A;  2FLO A;  4OZ2 A;  2E66 A;  2IBO A;  3GE9 A;  2YNF A;  2UVU A;  2C2N A;  4DX7 A;  3K8W A;  2V4R A;  4DN0 A;  3O44 A;  3J7A N;  2DCL A;  2W2M P;  4O3S A;  4Q2L A;  5KFY A;  1SJ4 P;  3NGK A;  3IWX A;  3RYL A;  2HHT A;  2YKQ A;  1IWG A;  4MFB B;  1TKZ B;  1YQH A;  3BYP A;  5DG9 A;  4DL4 A;  1X4G A;  4NXN F;  1TL7 B;  3CVK A;  1TL1 A;  3QAT A;  1RDR A;  1WDD A;  3GYG A;  1RJJ A;  3ZFV A;  3G71 S;  2BM1 A;  1TFY A;  2PA3 A;  4O3R A;  1HLW A;  1WSR A;  1Q82 T;  3MTJ A;  3EGW B;  2HUR A;  3D1O A;  3PRB A;  4DV3 F;  3M6W A;  3RB6 A;  5K8P A;  2V4J A;  2HPU A;  1QTN B;  4HT5 A;  2OEL A;  2V34 A;  3AA8 A;  2LA4 A;  4Y28 C;  1EQ0 A;  5FLX U;  4NLU A;  1PGZ A;  2MSS A;  5KFX A;  1X9M A;  1LWF B;  2GO9 A;  2LQ5 A;  3OFG A;  2K3I A;  3HZE A;  1N5S A;  3OHB A;  2C2R A;  4LIW A;  1H7X A;  5BXI A;  5AJ3 J;  3BEG B;  2XMK A;  3W8G A;  3PJW A;  1VQK S;  4LF6 F;  1C0T A;  4N5S A;  2Z8Q A;  1KWM A;  3ITH A;  2XMA A;  4LF5 F;  2VON A;  2EBE A;  2KFZ A;  1MMD A;  5CZV A;  1VS3 A;  1W25 A;  2PMZ D;  2ZKU A;  2VAS A;  1KKH A;  3TWZ A;  2VFR A;  2M8D B;  3CT9 A;  5M2R A;  1REV B;  4KBI A;  1TVR B;  4N76 A;  3CB4 A;  4ZOS A;  1WF2 A;  2MST A;  2OI2 A;  1RAJ A;  1Y3J A;  2OFH X;  3CJK A;  2PI4 A;  2ZC3 A;  3D1Q A;  2V4Q A;  3CCV S;  2D7S A;  1T05 B;  5HAT A;  3DLB A;  5F8G A;  5KT4 A;  4GKK J;  4PG4 A;  3K5O A;  3P5B P;  4KQZ A;  2DPI A;  3S7R A;  1G2E A;  2BRL A;  1VFJ A;  1ZBT A;  3CJ8 A;  4CT9 A;  3HX9 A;  5U47 A;  4HEA 9;  5C7P A;  2BQ3 A;  3W3S A;  3NXZ A;  5D4L A;  3KJN B;  3KLH A;  4FS1 A;  1C1C B;  2XYG B;  4DR7 F;  3VTI A;  7FD1 A;  3M9M B;  3OR2 B;  1C1B B;  3KMQ A;  5AE2 A;  1U45 A;  1F9F A;  4DQS A;  4NL5 A;  3GU0 A;  3IBW A;  4A8M P;  2VC1 A;  1F2G A;  1TUG B;  4HH1 A;  4RBV A;  3R2D J;  3MOJ B;  2KO1 A;  4RPF A;  3FMW A;  4C98 A;  1ZAV A;  3W60 A;  4K4W A;  3T5L A;  1PSD A;  3DKD A;  4CWB A;  4JI0 J;  3LAN A;  5IS2 A;  3MZI A;  5G0R B;  2VIH A;  3NL0 A;  1VQ5 S;  4LF8 J;  1FES A;  1FVS A;  2HK3 A;  2P9C A;  1N32 F;  1H98 A;  4A8Y A;  4ELV A;  2QMW A;  4JI6 F;  3J7Z 5;  4M5N A;  4F0H A;  2M5Y A;  4ICL B;  3K58 A;  2LQJ A;  3NBP A;  4LF9 F;  2XI2 A;  1N5Y B;  1S76 D;  2KFY A;  2YNI B;  1NPR A;  3DRS A;  3MCO A;  3M32 A;  4CLK A;  1RBA A;  4F2S A;  1BWE A;  1CBK A;  2CPX A;  3H4D A;  3G6E S;  3AA9 A;  4IR1 A;  2XB2 D;  3QFH A;  1GH8 A;  5LSO A;  1U47 A;  3IR5 B;  2ZHO A;  3RBX A;  2MZQ A;  1FX4 A;  4DQR A;  2GW8 A;  3A8E A;  1H74 A;  2YPY A;  3M7V A;  1MWY A;  1JLA A;  8AT1 B;  2R4F A;  2V63 A;  1VQY A;  2YQ1 A;  5C2C A;  2ZM6 J;  2WON B;  1X5T A;  1TKX B;  2HZC A;  2MKH A;  1FKO B;  2HNZ A;  3THP A;  3IWL A;  2MZ1 A;  4F36 A;  2Y8W A;  1RLD A;  2V0N A;  1LXJ A;  2IAJ A;  2YWH A;  3WIV A;  3MR3 A;  1ZH5 A;  4UY8 T;  4BDP A;  1R3N A;  5ETK A;  3PW4 A;  1VK3 A;  1WEY A;  1HNZ J;  2H5E A;  2LXF A;  1FER A;  2B4O A;  2OUG A;  1JNZ B;  4OJ1 A;  4YB6 A;  1Q8I A;  2D3O 1;  1Q86 T;  3RUB L;  1FFG B;  3P5T L;  1WTB A;  2XHW A;  1IKX A;  2F4F A;  2LDY A;  1U1P A;  1YLX A;  2VH7 A;  3FEZ A;  4B02 A;  1NH7 A;  3ULH A;  2BEF A;  1UFL A;  4L3N A;  4KGX B;  2V8D A;  3KHH A;  3M30 B;  1WTF A;  5AXN A;  2IM0 A;  1XNQ J;  4X66 J;  1UVI A;  3GSD A;  2O1P A;  2ZH6 A;  1T3O A;  1S9E A;  2R8I A;  3M8Q A;  2ZWO A;  4UTG A;  2DNH A;  3LP2 B;  5DLG A;  1F3F A;  1X60 A;  1CSJ A;  4USI A;  3R7N B;  2EFP A;  4Z37 A;  3GR0 A;  3GJT B;  4DQP A;  1TAQ A;  1X31 C;  1RAE B;  2MQL A;  2XBP A;  2WK4 A;  5JUM A;  4CH7 A;  2ZDO A;  3R9L A;  3W5Y A;  1SJQ A;  1NAQ A;  3QRP A;  4X62 F;  2BJD A;  3DMJ A;  2M8H A;  5CD4 H;  4DR6 J;  1K1S A;  2BKO A;  1U8S A;  4K5S A;  1X7V A;  5DET A;  5K8O A;  1FRL A;  4RW7 B;  4YR2 A;  4LSL A;  2FLP A;  3OTO F;  1TUW A;  2VU5 A;  4TU7 A;  4YOE A;  4C3K A;  3OHA A;  2MKS A;  1HI1 A;  4KO0 A;  2NXE A;  4C97 A;  3C16 B;  3PO4 A;  1WJ9 A;  4PXB A;  5EDW A;  3QJL A;  1RCO B;  1KR4 A;  1D9A A;  1F0X A;  2RT3 A;  2DNQ A;  1RP5 A;  4NCG B;  3F73 A;  2XMT A;  2LCW A;  3M2R A;  2HND A;  1FDN A;  2I38 A;  2FVP A;  5KG7 A;  4WTY A;  2OPQ A;  3KJF B;  2E1R A;  2JWN A;  2KZZ A;  4IO9 Q;  3V4M A;  1XER A;  3KKF A;  4X84 A;  4HDH A;  1TAU A;  3FSI A;  3I55 S;  1QVG R;  4OYO A;  5L39 A;  1GX6 A;  3MPY A;  3FSX A;  5LOQ A;  4OYX A;  4D3G A;  4DV4 J;  5KOW A;  1K0V A;  3VAI A;  4OYA A;  3D67 A;  2P2C B;  1IQT A;  2GQ2 A;  2CPF A;  5HLF B;  1HWJ A;  2J8S A;  4N56 A;  5HL7 Q;  4Y65 A;  1APS A;  4R25 A;  2DIU A;  2DH8 A;  5L1K A;  2V9W A;  3KK1 B;  4F2R A;  3BF4 A;  5IV3 A;  2MZJ A;  3WQP A;  2AIR B;  4LT6 A;  3MF5 A;  3M6V A;  3CJT A;  2DR7 A;  2UUT A;  4DWI A;  2V50 A;  3UCU P;  3D3C J;  4PXC A;  3TUJ C;  1PAU B;  3MEE A;  4ECV A;  3QJJ A;  5A0Y A;  4QYZ K;  1QJH A;  2BJ9 A;  3T19 A;  1B7F A;  2QA2 A;  4OJ3 A;  2Y0S D;  4AD6 A;  3GFZ A;  6FDR A;  3KK3 B;  3C6U A;  1HR0 F;  1PAE X;  1VGY A;  3MM7 B;  3BRE A;  5HP1 B;  4B3O B;  4HKQ A;  4DV2 J;  1XNR F;  2DBB A;  3QAU A;  2EK1 A;  2XM3 A;  4YB5 A;  4ECX A;  2W2P P;  4KSE B;  4AQY J;  3R2C J;  4ECY A;  3OSN A;  2G0C A;  3T6B A;  3BGU A;  2JVR A;  2WHO A;  5BYQ A;  4PQU A;  3SIP B;  1S9G B;  1CJV B;  1IVZ A;  2FHJ A;  5CA5 A;  4NE9 C;  3V2U C;  3E8O A;  4DR1 J;  3VGU A;  4DL7 A;  1AB8 A;  1JJH A;  5KT5 A;  2AGP A;  3OR1 A;  2CPD A;  2C3U A;  2I5J B;  4A8X A;  4NA2 A;  2M88 A;  1S0V A;  4AT1 B;  3SDE B;  3A1Y G;  2HWH A;  5BYR A;  4ZHR B;  3H2V E;  1ZS6 A;  3CJ2 A;  4LQ3 A;  3QLH B;  1IKV B;  2CPI A;  3NY0 A;  3VHQ A;  3HHD A;  2C3P A;  4TN2 A;  7FDR A;  5D0H A;  4ZLL A;  2HBR B;  5L9N A;  5ETP A;  1RE1 B;  1QLN A;  3HM9 A;  1ZM3 A;  3TAQ A;  4ZIT A;  4JI5 F;  6AT1 B;  4QIE A;  5KFR A;  1S0O A;  1SKS A;  1RU1 A;  4NI2 A;  2HEK A;  4WU3 A;  2VQF F;  2QN6 B;  1NJZ A;  2JC1 A;  4I64 A;  2XSJ B;  4IH5 A;  1CPZ A;  3KHR A;  3HVA A;  1SPB P;  2YX7 A;  2H4W B;  3GTY X;  4ID5 B;  1ZPW X;  2LQB A;  4K2X A;  1NU4 A;  1XBW A;  1FTR A;  2HHP A;  1BQM B;  2RB7 A;  3CO9 A;  2E5L F;  3IA0 A;  3VAK A;  4USH A;  2B6A A;  4OYB A;  3TVK A;  2LU2 A;  2KRB A;  4YY3 J;  1PYO B;  3BS9 A;  2Q6C A;  3BGO P;  1D09 B;  3M2V A;  1TU0 B;  3DGP B;  4A8O A;  1JXL A;  3T6J A;  3MM9 B;  4F4K A;  2V8G A;  1UJ6 A;  3KMS A;  3NKY A;  4ZJQ A;  2ZNZ A;  4U7U D;  4B9T A;  1NSK L;  3L3C A;  3SZ2 A;  2ZHB A;  2OAU A;  1RT5 B;  1I94 J;  4EFA C;  1VQ9 S;  4Y3C A;  3IBC B;  2KHD A;  2W01 A;  5B7W A;  3B4D A;  4Q44 A;  2XZT B;  4EYI B;  4CYU B;  2XZD B;  3SI8 A;  3H0P A;  4ZVF A;  2JOQ A;  1OPZ A;  1PJ5 A;  4G1P A;  4HDG A;  2RUG A;  2AEJ A;  4NLR A;  2DNR A;  4NRU A;  1H2V Z;  3IRX A;  5D0E A;  2QSW A;  1BWV A;  1HMV B;  3FVY A;  2FY1 A;  2ABY A;  2MZT A;  2DXF A;  1RZM A;  3C15 B;  2CA9 A;  1VQM S;  4FNH A;  2RUS A;  4OI3 A;  5K14 B;  1WI6 A;  1AUD A;  2VV5 A;  1FE0 A;  5JJB A;  2HMI B;  2DGX A;  1A6L A;  2HZV A;  2AYM A;  2E5G A;  3VVU A;  5D4O A;  4IG0 B;  1B3T A;  3MWB A;  2JEF A;  1T9X A;  3QAE A;  1YDL A;  2RKI B;  1NDL A;  2GVD B;  4JI8 J;  2QLX A;  3VZI A;  5HJX A;  1S99 A;  2R9L A;  2GHW A;  4M95 A;  2HQC A;  1ZAW A;  1NHU A;  5JVG Q;  5A2Q U;  4M5D B;  2LXU A;  3J81 j;  4IUF A;  5ETS A;  3N6N A;  2XNQ A;  2B0G A;  2YKM A;  3Q2S C;  2XY6 A;  3QT5 A;  5J2N B;  3TX8 A;  1NXI A;  2KG1 A;  4NZ7 A;  2W9B B;  5LSL A;  5A8K A;  3VAF A;  4F4W A;  2CQG A;  1V5V A;  3MEC A;  2BAN A;  4KGM A;  3QFW A;  2KN4 A;  2CWK A;  1RT7 A;  1CC8 A;  4P2S A;  3C14 A;  4OI1 A;  3ZTQ A;  1NB7 A;  5ETT A;  1M5K C;  3AJ2 A;  5FJ4 A;  2YKN B;  3CD6 S;  3JS9 A;  2ZBC A;  2HS0 A;  3RZA A;  2QTW A;  1CG2 A;  1WUU A;  4OX9 J;  3I96 A;  1NK4 A;  1SJ3 P;  3H5U A;  4DUZ J;  2OMO A;  4WFN Q;  3GV7 B;  4TY8 B;  4NLG A;  1HBN B;  5KTQ A;  4OYP A;  2IVM A;  4OYZ A;  1IBM J;  1U1R A;  2OEJ A;  4FF1 A;  4A4J A;  2ASL A;  4RNM A;  2RQ4 A;  3ZTO A;  2QMU B;  3N5B A;  2U1A A;  1GQE A;  1XMQ J;  3JSM A;  4DCJ B;  3IWN C;  1T9V A;  4R5P A;  5A76 A;  1FDB A;  1YK9 A;  2VG6 A;  2R7R A;  1H7W A;  1Q95 G;  1QSL A;  4R8U A;  1O8B A;  1Q81 T;  2C3M A;  1AT1 B;  4Z7Y A;  2QA4 G;  2HBZ B;  3NS7 B;  1P1T A;  1TL5 A;  4QQB A;  3SYZ A;  1F6T A;  3MMB B;  1Q78 A;  3UN2 A;  4DSF A;  2WVE A;  1VIS A;  2AJ4 A;  1FXR A;  1ZAX A;  3TJA A;  3Q8P B;  1SQF A;  3TUZ C;  3LP1 A;  1U7L A;  3QRQ A;  1N5T A;  1H0H B;  1Y10 A;  4EEY A;  1K0T A;  2LDI A;  4H4M A;  3OLB A;  3J81 Y;  2IA0 A;  1R43 A;  4G1Q A;  5HK4 A;  2H54 B;  1VDH A;  3ZNU A;  5CYJ A;  1RT3 B;  4A46 A;  4NYP A;  4RUH A;  5E33 A;  3TAP A;  1K73 T;  2XO7 A;  2IMO A;  3HVW A;  3DM2 A;  1PKU A;  1NPP A;  1VJQ A;  2AJ2 A;  4JI3 J;  1EET A;  3QSI A;  4LFC F;  5F8L A;  2BW7 A;  1CJU B;  5CZX A;  3FSY A;  5DQI A;  1YRT A;  3DLG A;  1SVD A;  3BYR A;  3FFI A;  1U1N A;  4B9U A;  1R31 A;  1GXU A;  1RIS A;  4FYX B;  2HFZ A;  2JH3 A;  2A3J A;  4Y2K A;  3QNW B;  4RJV A;  2FZK B;  2ILZ A;  3OUY B;  2XYH B;  2EC0 A;  3DRR B;  4LR8 A;  3MAA B;  2HLT A;  1FHT A;  4BBY A;  4OIX A;  4ECS A;  3CMA S;  3GII A;  1HIY A;  3D54 A;  1X4F A;  2ZZT A;  4PUO A;  3EYZ A;  3HSG A;  3KG4 A;  2VL1 A;  4Y0F A;  4S0M A;  4DU7 A;  3MUM P;  1R6V A;  1VHI A;  4ECZ A;  4A48 A;  1WHY A;  1RGV A;  3PJX A;  4HHU A;  2J7W A;  8ATC B;  5C42 B;  1HD0 A;  4PWD A;  3IGV A;  4NEZ A;  2RQC A;  5F8I A;  1CS4 B;  2JFD A;  4PG5 A;  5B0F A;  4Q45 A;  2WOM A;  5KFD A;  2LFV A;  5CCM A;  1OO0 B;  2RIJ A;  4I68 A;  3TZY A;  3ET6 B;  2CYY A;  1LFW A;  4N8O A;  4ED3 A;  3A3P B;  2LQ9 A;  1JIH A;  5B0E A;  5LM7 E;  2UUB J;  2IPO B;  2KZM A;  2DJW A;  4NYZ A;  1RWX B;  3PW0 A;  4MFB A;  4ZVP B;  4X65 F;  4QWB A;  4QJV A;  4V19 X;  1M1H A;  3I4H X;  1TL7 A;  4Y00 A;  3TO8 A;  4QCL A;  3Q8V A;  4LF4 F;  3RG6 A;  2ASY A;  4K8R A;  3V6J A;  2ZIT A;  2D3U A;  2KB2 A;  4WII A;  3VAJ A;  2OHD A;  3G4S S;  1GMW D;  3CIZ A;  2ZH3 A;  4IH6 A;  5CYM B;  5KT6 A;  2GQQ A;  1E6V B;  3G8T A;  1PYT A;  2YH1 A;  2DR8 A;  5IWA F;  2F5G A;  4NLP A;  1RT4 B;  4J9Q A;  1ZTT A;  4YB7 A;  3J80 Y;  2AJQ A;  5GMK a;  4K4Z A;  1TK0 A;  1SH2 A;  3QQC D;  1S1W B;  4IOA Q;  5M2U A;  3D1H A;  3O1L A;  2EFV A;  1LWF A;  2KJW A;  3FBC A;  2LEP A;  4USW A;  2DGQ A;  2YY3 A;  2DEI A;  3TA0 A;  1Q0N A;  3GFX A;  2RU9 A;  4FN5 A;  4DSJ A;  3D2W A;  1UTA A;  1S1V B;  1K47 A;  2UUW A;  4M5M A;  3L95 X;  2MLY A;  2QG9 B;  1SI9 A;  2WBM A;  4PPD A;  1K9M T;  1N48 A;  3FK4 A;  1RKI A;  2ZH4 A;  1LQ9 A;  1TVR A;  2W4D A;  1RAI B;  2EEY A;  2R3V A;  2V2Z A;  2YVS A;  2KI2 A;  4WTO B;  2UUC J;  4DR2 J;  1UL3 A;  4DZ6 A;  4H4O B;  2OTL S;  1M0S A;  1FI4 A;  3KDO A;  1R8A A;  4FF2 A;  2QJ3 A;  2CJB A;  5D0G A;  4P10 A;  2ZNY A;  3IXQ A;  4PG7 A;  2WVC A;  4QPT A;  2JRS A;  1F5B A;  1SV5 A;  1JMT A;  4U9R A;  2RRB A;  1C1C A;  3V6H A;  3BBB A;  2MQO A;  5E3R A;  3CUL A;  3OR2 A;  1F2H A;  3BDP A;  1IBK F;  4FXV A;  1C1B A;  3HXM A;  3QWU A;  4J9M A;  1RWK B;  4RW8 B;  2R7W A;  3T1H J;  1FKP A;  2EG2 A;  3ZZU A;  2VG7 B;  2NLW A;  4I2Q B;  1J27 A;  1B99 A;  1YG0 A;  1H6K X;  1K44 A;  3DC2 A;  4K5R A;  3GCX P;  4Q5V A;  4CNY A;  4DSK A;  2CZV C;  3GV5 B;  4MMO A;  3PO5 A;  1N34 J;  3EMT A;  3JTO A;  4ZA1 A;  1X9W A;  3U1N A;  2XGP A;  2VOD A;  2GC8 A;  1T02 A;  5G0R A;  3N28 A;  1ITP A;  5ETO A;  3H5S A;  1R7I A;  1KLN A;  1UCN A;  4O3O A;  4FZV A;  1N4L A;  4ICL A;  2BBE A;  1UEK A;  2HRY A;  3DYA B;  1M5H A;  4QW8 A;  1PC4 A;  1ULR A;  1U1M A;  1L3U A;  1FEE A;  1PG5 B;  5F3T A;  2ZEJ A;  1NB2 A;  2W9C B;  3CC2 S;  4XPC A;  3MM6 A;  3MCS A;  4IO1 A;  2DT9 A;  4ZP6 A;  1KVI A;  3AJ1 A;  2IVY A;  3FBE A;  2VA3 A;  3N01 A;  1KTQ A;  1SC1 B;  4MT1 A;  5L1L A;  3QGP A;  1FEH A;  5DM7 Q;  1HQ2 A;  1Y5N B;  2YNG A;  2R7V A;  5LMU J;  4BCA A;  3IR7 B;  5C5J A;  4KV8 A;  2QLW A;  4Q8F A;  2XWY A;  1WF1 A;  3RBZ A;  3R6G B;  4XTT A;  1S6U A;  5J1P A;  2M9K A;  4ED1 A;  2CJQ A;  4DV3 J;  3UI3 A;  2XMU A;  2WON A;  1LEO A;  3KLH B;  1UWA A;  2H5J B;  3N6L A;  3D0G E;  2X3D A;  4UST A;  4UQT A;  1CQN A;  3Q8Y A;  2QGF B;  1RLC L;  4DPT A;  1KEK A;  2P5V A;  3UQS A;  1MML A;  3W63 A;  4IRD A;  1G1X A;  3HT3 A;  2QE5 A;  1IR2 A;  1YZ7 A;  2MY7 A;  5HVF A;  1KFD A;  1EAY C;  2PFF B;  3I5B A;  4LF5 J;  3IO1 A;  4OLO A;  1N0V C;  1LW2 A;  1YIJ S;  3CDB A;  2E29 A;  4DX5 A;  3PX4 A;  3I5A A;  1SXL A;  2GZO A;  3N79 A;  4TLQ A;  2FJE B;  3ZTP A;  3BO2 A;  2CG8 A;  3R5J B;  2YTC A;  4Y6I A;  2KHC A;  1S6Q B;  2GMH A;  3MPV A;  4CLZ A;  4J9S A;  1GXT A;  4LVO P;  3DRS B;  3BSO A;  2Y3Y A;  2F9J A;  3MDF A;  3HI9 A;  3LP2 A;  3U7J A;  1JLE A;  1CLF A;  5HN0 A;  1BGX T;  5C25 B;  1KVJ A;  3IP0 A;  1FWP A;  4DR7 J;  2X1A A;  2ZH9 A;  1UZD A;  3ISN D;  4JI4 F;  1N5Q A;  3HHL D;  2ROP A;  4KE5 A;  3C3L A;  2J6U A;  1D0E A;  1BD6 A;  3IR6 B;  1X4H A;  2MB0 B;  3G96 A;  1N6Q B;  2CPE A;  3TQ1 A;  4RW7 A;  3X3U A;  4YUD A;  5KFW A;  1IM6 A;  2BAB A;  2JLF A;  1I1G A;  2G2Z A;  3EZU A;  2EFN A;  2AYE A;  1PCA A;  3KUH A;  1CJK B;  1BUX A;  2QFI A;  3MUT P;  3OTE A;  4BHQ A;  1NJY A;  4ZJL A;  5KFB A;  3KHG A;  1DLO B;  5ETQ A;  3H7H B;  2I0X A;  2L41 A;  2XUL A;  4BS2 A;  4JI6 J;  4NCG A;  2NPI A;  3RU0 A;  5KFA A;  2N4D A;  4L72 B;  2MQM A;  1S12 A;  2RS8 A;  4K4U A;  3PTW A;  2LEC A;  2OH2 A;  3I32 A;  3WX4 A;  4OHX A;  4CLY A;  3D6T B;  3OXG A;  1ZM4 A;  1XQI A;  4ELU A;  1TL4 A;  3AB2 B;  2CPJ A;  2L9N A;  1IKX B;  3UR3 C;  2FJW A;  1Q1K A;  4DSI A;  5A6P A;  3CDE A;  2RJZ A;  4QW9 A;  3B82 A;  5HLF A;  3ETO A;  3T5J A;  3G86 A;  4XDC A;  4I56 A;  2GAG C;  4ELT A;  4MYT A;  3MM8 A;  4ANE A;  2DR9 A;  4OZJ A;  2IC3 B;  4LRE A;  4MJK A;  2XEX A;  3E2E A;  1IKY B;  1LFP A;  1B0T A;  1S9F A;  1YJ9 S;  1RHJ B;  4LRA A;  5C2G A;  2HVD A;  4DV0 F;  2AKW B;  3UN5 A;  2DR6 A;  2XCP A;  4NZ6 A;  1JLQ B;  4PWW A;  2EK6 A;  4OZ5 A;  2KG0 A;  2DNL A;  1CUL A;  4F7V A;  1RWV B;  3KK3 A;  1T9U A;  2FC9 A;  2GFF A;  1WC1 A;  1IR0 A;  4CO2 A;  2A18 A;  4KTQ A;  3MM7 A;  2HQF A;  3M2U B;  5HP1 A;  3DU6 A;  1MNE A;  4KO0 B;  4Y2M A;  2G1D A;  4J9P A;  2LQ8 A;  4DR4 F;  5HVH A;  2OP5 A;  1WG4 A;  3N9U C;  1J5O B;  2DHG A;  3VAL A;  4RNH A;  2A6M A;  2A10 A;  4IQX A;  4KRW A;  2C22 A;  1S9G A;  3LH2 S;  3M2R B;  4RR5 A;  1CJV A;  3BKU A;  4ZCM A;  1U6B A;  1GTH A;  5GME A;  2KFN A;  2ZVI A;  4L6V 3;  2FZG B;  4P72 A;  4WKY A;  2I5J A;  2E7W A;  4LF7 J;  2OML A;  1TQL A;  1H38 A;  4J7C A;  2PDA A;  2YNH B;  4K59 A;  1N5V A;  5HMY A;  2MJU A;  3SDE A;  3F41 A;  5H9E J;  4DOZ A;  4OX6 A;  3D6F B;  4ZHR A;  4DL0 C;  2MEW A;  4CH1 A;  2K7J A;  1IKV A;  2B4P A;  3K5M A;  1J5E F;  1RAB B;  3HDS A;  2FJX A;  1FJG F;  4X62 J;  3ZZT A;  1RA7 A;  3PW5 A;  1Y7P A;  4CM2 A;  3A8I A;  4ZVG A;  3VR1 A;  1BQX A;  2KT5 A;  2NPF A;  2XC9 A;  2BJ1 A;  2X1F A;  4C3M A;  1WHW A;  3DDN A;  2F3J A;  2V8P A;  2OEM A;  4UY8 5;  1HWU A;  4C4W A;  4ZPA A;  3K5N A;  1A7G E;  5GAG I;  2BE2 B;  2AJ0 A;  3S8S A;  2BOA A;  4ID5 A;  3TZZ A;  5CCL A;  4FDF A;  3A13 A;  4LIR A;  3HZG A;  4LFB F;  2XLJ A;  2W7O A;  2L48 A;  3QYY A;  3EJM A;  5D4P A;  3BZQ A;  1N33 F;  2D74 B;  3P45 B;  1P9Q C;  4YHH F;  3U1L A;  3D66 A;  4PYD A;  4RBT A;  2JFK A;  1X4E A;  4K0K J;  5FII A;  4ILR A;  2DK2 A;  3DGP A;  1UJ4 A;  2CQ0 A;  3DCA A;  4PXD A;  3MM9 A;  2E1C A;  4USJ C;  3P4U B;  2WRM A;  2DPJ A;  2AU0 A;  4O3Q A;  3R8Y A;  5KFN A;  1VC6 A;  2FJV A;  4CT8 A;  1U2C A;  1RT5 A;  3N4W A;  3OTD A;  2HHS A;  4KGV B;  5EX0 A;  4OL8 A;  4DV5 F;  4K4X A;  4M1K A;  2IFX A;  1TMJ A;  4USK A;  2E1A A;  3HSD A;  3K5P A;  4CYU A;  1WF0 A;  1NRK A;  2CQP A;  2FPH X;  1KD1 T;  5KFE A;  2JZ5 A;  4M5I A;  2D69 A;  2N3L A;  4N8N A;  1MLA A;  4M8L A;  1Q8L A;  2G13 A;  4CO5 A;  3AXK A;  4K4V A;  2FJD B;  2EKY A;  4ED4 A;  1HMV A;  4V19 J;  2VB6 A;  1V5I B;  3PHE A;  3SMZ A;  3FUY A;  3C15 A;  2ACM A;  2CUY A;  1MSW D;  5IFM A;  1QSY A;  1HR0 J;  3NNH A;  4DS5 A;  3I6P A;  4FVM A;  1XNR J;  4HLB A;  5K14 A;  5FDL A;  5THW A;  3CCU S;  1U0S A;  3TA2 A;  1DQ9 A;  1RAG B;  5HBM B;  3LF0 A;  3MUR P;  2RE1 A;  3LGH A;  2HMI A;  1OYD A;  1RYS A;  4UOC A;  3PAC A;  4IG0 A;  2XI3 A;  2CJY B;  2QYG A;  2AP6 A;  3RGI A;  2IRY A;  2RKI A;  2GVD A;  4C0B A;  4E98 A;  3GJS B;  4ANC A;  5KFU A;  3FNN A;  4I7F B;  4ZVU B;  1SKU B;  1FRI A;  2B6A B;  1KVK A;  1NSQ A;  2MJN A;  2R42 A;  1RTH B;  1N36 J;  3OFH A;  2J0W A;  1FX2 A;  2Y1J A;  4M5D A;  1KOO A;  2DXD A;  1SJF A;  3EGV A;  1FJC A;  2Y1I A;  3KLG B;  4AND A;  4DPY A;  3ISN C;  1HNX F;  4LVN P;  1KOH A;  3HHL C;  5J2N A;  2AX0 A;  2W9B A;  2DTJ A;  5HMZ A;  2PEB A;  4JI5 J;  4FYW B;  3NCP A;  1HQU B;  3PR4 A;  1U24 A;  3ILL A;  3NNA A;  2GCF A;  2J7K A;  1D9F A;  1NPK A;  3BO3 A;  3RB3 A;  2VQF J;  5F8H A;  2YKN A;  4DV1 J;  1WNE A;  4IRK A;  3U27 A;  4DFP A;  4B3T F;  3R1L A;  4GMK A;  4DSL A;  2ADC A;  4JYA J;  3GIJ A;  3JQM A;  5KG4 A;  4TY8 A;  1HBN A;  4URS A;  2B8Q A;  3JSR A;  1WC6 A;  2HNY A;  3IRX B;  1OYE A;  1AZS B;  3EE3 A;  3EM1 A;  3FRZ A;  4X4T A;  2E5L J;  2HWT A;  5C24 A;  1U6F A;  1S1T A;  1WHV A;  2DNP A;  2ZJP Q;  4JV5 F;  2F4V F;  3KG1 A;  3K59 A;  4PQA A;  3NLC A;  4OHY A;  4JB8 B;  5ADZ A;  3M9N B;  1XEZ A;  4JI1 F;  2LEB A;  2C2M B;  3D3B J;  4OZ3 A;  3M8W A;  3ZZ0 A;  5BJR A;  1NEE A;  1TKT B;  4MTP A;  3R5B A;  1OY6 A;  2UXD F;  2GMJ A;  3HHL B;  5KG5 A;  4FBT A;  2CNO B;  3NGR A;  4YDX A;  2DNO A;  5I42 A;  2FYX A;  1UKU A;  1GEH A;  1VOM A;  1RT3 A;  2HW3 A;  4C0H A;  2OIH A;  5IOL A;  1VK8 A;  1U1L A;  4WU2 A;  4WBF A;  1SBR A;  4BWJ A;  1GK8 A;  4PG8 A;  4WP3 A;  4DR5 F;  5AXM A;  5ETV A;  4P9S A;  4ITS A;  4TU9 A;  2MPU A;  5IXU A;  1TEL A;  4FF3 A;  2AJF E;  3IS9 B;  3BBC A;  2Z56 B;  1CJU A;  4ZP9 A;  4HT7 A;  3K5L A;  1MWQ A;  1UW4 A;  2DHS A;  1N52 B;  2ZE2 B;  1F5A A;  3MEC B;  1RWN B;  2HHQ A;  2C2Z B;  1V9O A;  3C14 B;  5GAG U;  1HKA A;  2IM2 A;  3MCN A;  3ZC4 A;  3ENA A;  1IM4 A;  2P9E A;  3PW2 A;  5DGA A;  2Z2Z A;  4P7T A;  3CJ0 A;  3TOQ A;  2CG4 A;  4LBI A;  3T9N A;  4DEZ A;  3GB0 A;  2ZUA A;  3QT7 A;  5G4D A;  4MIB A;  3OUY A;  1DJ0 A;  3DRR A;  2YKP A;  3BKT A;  2HHX A;  5D3G B;  1FCA A;  3RW7 A;  4LR7 A;  3JSM B;  2RS2 A;  4X4P A;  2GJ2 A;  4JI0 F;  1HW9 A;  2VG6 B;  3KYL A;  3H20 A;  2CAJ A;  5F8M A;  2E5J A;  2CZ9 A;  2M7S A;  4TKT A;  5L8R C;  2R7U A;  5L1I A;  2R7S A;  2JEG A;  2VUG A;  5GVQ A;  1NKE A;  3FJ2 A;  3KG0 A;  1OS5 A;  4IFY B;  1P27 B;  4ZPB A;  1T9W A;  4L73 A;  1Q8B A;  4M5K A;  5C42 A;  4IKA A;  3MTK A;  2J7U A;  1CS4 A;  5CHC B;  1ELO A;  2NYI A;  3ZZY A;  1WSV A;  3ET6 A;  3EZO A;  2C2K B;  1RBO B;  4P71 A;  4O4G B;  3FDS A;  2KH9 A;  2A0F B;  3H5X A;  3M8R A;  4LRB A;  3ISZ A;  3D6M B;  3DDI A;  4B3R J;  4PYA A;  1VQ4 S;  1D8Z A;  2E5I A;  4NLY A;  1RCX B;  2PI5 A;  5SZT A;  1UA1 A;  1HBO B;  1T94 A;  3DLG B;  1WG1 A;  3MM5 B;  4NXM F;  3TYT A;  4ED7 A;  3IM8 A;  5HJY A;  4B3M F;  2QLJ B;  3G6X A;  4ID8 A;  1X5S A;  4FF4 A;  2J8A A;  4O4R A;  5F3Z A;  2QIF A;  2R2S A;  3CME S;  1IJE B;  5HO4 A;  1KQG B;  1HNZ F;  4EUV A;  2QO3 A;  5CYM A;  1E6V A;  5DJB A;  1S79 A;  2QRR A;  2O01 C;  3W61 A;  2OLW A;  2OD6 A;  2IIH A;  2YWE A;  1AW0 A;  3GP9 A;  3O5T B;  3P8B B;  1S5Z A;  1RT4 A;  4NLT A;  3MXH P;  3KNA A;  2YQ0 A;  2RQK A;  1IUJ A;  2Y1L B;  4PUO B;  1SL2 A;  3RB0 A;  1S1W A;  4GRS A;  1C0U B;  1WAC A;  3GYX B;  1DTT A;  1XNQ F;  4HL9 A;  4LFC J;  1EP4 B;  4F4X A;  2VKR A;  4PWD B;  1S1V A;  2NXU A;  4I2P B;  1DY3 A;  4EGL A;  2R8G A;  1BY9 A;  1JX4 A;  5K9F A;  3NMA A;  2R7O A;  4ALZ A;  4LF1 A;  3U1M A;  1FKA F;  2WOM B;  4EK2 A;  5KOX A;  1WWH A;  4OI4 A;  4FKY A;  2M52 A;  1IR1 A;  4DUY F;  1UZH A;  4K4S A;  2DY1 A;  4RLE A;  1OIA A;  4H4O A;  2OKQ A;  4DR6 F;  5K8M A;  5KG2 A;  4IDK B;  3LWM A;  1VBY A;  1NBE B;  2BW2 A;  2FDN A;  3BQ2 A;  3BSC A;  3SSQ A;  1CEZ A;  1WC5 A;  4C8M A;  3ILI A;  1XK8 A;  2ZJQ Q;  3DOL B;  4O44 A;  2V68 A;  3Q22 A;  2WSC C;  4ZPW R;  2AQ4 A;  4RUC A;  3MD3 A;  5HSP A;  3C46 A;  3G82 B;  4TQR A;  4DLG A;  3F44 A;  5EWG A;  1UVJ A;  3SCI E;  4RW8 A;  5F8N A;  4Q2M A;  5J1E A;  2HVZ A;  2VG7 A;  4I2Q A;  3PRV A;  4ZVH A;  4BC9 A;  4YB1 P;  2CIM A;  3ZXW A;  4P73 A;  3CJ3 A;  4WP9 A;  1G3O A;  2U2F A;  3UCZ P;  2ZVS A;  3SCL E;  3LGM A;  4Y34 A;  4O0I A;  1ZET A;  4DLE A;  4ECR A;  1OQ3 A;  4FXW A;  4I67 A;  2R2R A;  5IZH A;  1JQG A;  1U4B A;  2BQR A;  5IT0 A;  3DYA A;  1L3S A;  2ZD1 B;  1R6Y A;  1JWW A;  5E3P A;  3P96 A;  2W9C A;  1EX8 A;  5KFH A;  4X65 J;  1A0O B;  1GXL A;  2HFV A;  3GIR A;  1ICE B;  2EC2 A;  1S97 A;  4H4K C;  4ECW A;  1D1U A;  3CE8 A;  4XK8 C;  2IJN A;  4LF4 J;  4F3Q A;  5B0C A;  2DVI A;  3AD9 C;  2BAC A;  3Q0A A;  4PWU A;  3DRX A;  2AEM A;  1GX5 A;  2PT0 A;  4M5J A;  3KTQ A;  4I6W A;  3WDO A;  1ZM9 A;  4U95 A;  1RHR B;  1KFS A;  5BR8 F;  4G65 A;  1VRT A;  2E5H A;  3G9C A;  1YJT A;  3JQJ A;  1SV5 B;  2RAQ A;  4DFJ A;  4YQW A;  4HHH A;  4KHR A;  2GGP A;  3DLK B;  3QZ8 A;  2HHW A;  1RTJ A;  5E7O B;  3CCQ S;  1RTI A;  4F50 A;  1FKP B;  1AXQ A;  5HQ8 A;  1G6B A;  5L46 A;  2JC0 A;  2FD2 A;  3K8V A;  3EIC A;  5B0D A;  3CCE S;  1Y5I B;  3CC4 S;  3T41 A;  4ZPC A;  2NRE A;  1L3K A;  2D9P A;  2PO4 A;  1HA1 A;  4DPW A;  4LJM A;  1TP7 A;  4DV7 J;  4RW6 B;  1NZ8 A;  2UV8 G;  3MPW A;  5KFS A;  4PRF A;  4B9L A;  1S4E A;  1S6Q A;  1WKJ A;  3HUL A;  2E9T A;  4GVL A;  1HQE B;  1DFD A;  4WFY A;  4A8K A;  1DTQ B;  1N54 B;  3MM6 B;  2FVC A;  4CLW A;  3LAM A;  2DNZ A;  1ZPV A;  3UDC A;  2B9W A;  2LVW A;  4USV A;  2DY9 A;  5C25 A;  2RVJ A;  5H1S V;  1B70 B;  1H72 C;  4IQM A;  4CP5 A;  2J9E A;  2B3T B;  2BE7 D;  3Q83 A;  1IBK J;  4DBQ A;  3LUY A;  2I2Y A;  1Q8K A;  3CED A;  1YBU A;  2CVI A;  3SBM A;  2YNG B;  1EQM A;  1HWL A;  1N6Q A;  2F7V A;  3NS5 A;  4KV8 B;  2W25 A;  3W2V B;  2AYB A;  1VLY A;  3WC2 A;  3RRH A;  2VPX B;  4ERD A;  5DQH A;  3DDK A;  3GG0 A;  3OV7 A;  4C8Y A;  1CJK A;  2O66 A;  2CQD A;  3B54 A;  1FO1 A;  3O8W A;  2NXN A;  1KON A;  2YQ3 A;  1DLO A;  2DB1 A;  4DR3 F;  3CWJ A;  2VBY A;  2BDP A;  3JTP A;  2AD9 A;  2FIU A;  5A2Q Y;  4U7U K;  3JAM Y;  1AUS L;  2DR5 A;  1MW7 A;  4FXD A;  3NGU A;  4P52 A;  2WBR A;  5DDP C;  5L9X A;  1S7I A;  2FC8 A;  2BJ8 A;  1RQ0 A;  1XR7 A;  2VF3 A;  1LW2 B;  1ZM2 A;  1XMB A;  2H51 B;  3CD7 A;  4ZS6 A;  3B4M A;  1VQL S;  2CPZ A;  3SSR A;  3SQO P;  1RHU B;  2KJV A;  2ZH2 A;  2RHQ B;  2R8K A;  3E51 A;  2HAF A;  4Z7C A;  2X51 A;  5E0O A;  2B51 A;  3OL7 A;  1JLE B;  1WDT A;  1IXK A;  4JBC A;  2QC3 A;  2AV5 A;  3JYT B;  2IC3 A;  1MRO B;  4G1I A;  1YHQ S;  1Y5L B;  2NUU G;  4CM0 A;  1RAO A;  1H3D A;  1IKY A;  1K8A T;  5JMN A;  5KFP A;  1NHV A;  2HFO A;  3QJP A;  4HI2 A;  2OFG X;  3SQG B;  3EWG A;  4QIF A;  2OO4 A;  1YJR A;  1Z4U A;  1ZZF A;  1SIZ A;  1T11 A;  2CKW A;  2MKI A;  3MMC B;  1JLQ A;  3R3T A;  4E0D A;  3AJD A;  2WTF A;  2C3O A;  2HHV A;  1NZA A;  3BR8 A;  4EI2 A;  4OQJ A;  1NH8 A;  1LWE A;  3W2W B;  2DGV A;  5F41 A;  3M2U A;  4KH1 B;  4EZ9 A;  4A8Q A;  2J0S D;  1PIL A;  3PYG A;  4WIQ A;  2RML A;  1GAO A;  3THT A;  4EBE A;  1VBX A;  5ETN A;  5A8R B;  1JB0 C;  4DQQ A;  3AD7 C;  4FYD A;  4EYH B;  1J5O A;  2AT1 B;  2XS7 A;  1P1L A;  3NEK A;  1UET A;  4WE1 B;  3TUP A;  2OPR A;  1YJN S;  2PC6 A;  1XWL A;  6FD1 A;  3Q23 A;  2G0J A;  1NM2 A;  2QL7 B;  2YH0 A;  4F4Z A;  2A1B A;  1UWB B;  3KJV A;  5DM6 Q;  2YNH A;  1FRK A;  3W62 A;  4NX9 A;  1GMW A;  1UPM B;  2W2N P;  4ZVR B;  1OPI A;  2NYH A;  2XLK A;  3H2U B;  3W5Z A;  4ZP8 A;  2WSF C;  3CIM A;  4DUZ F;  2G2O A;  4JI4 J;  1SUQ B;  1IBM F;  4NLQ A;  1QSS A;  4ZK7 M;  1T9T A;  1IBL F;  2LXI A;  2KYZ A;  4OZN A;  2UXB F;  4ZVE A;  3MI7 X;  5HMW A;  3HSZ A;  2CQH A;  3GFY A;  3HJF A;  5F8J A;  3NOG A;  3MM8 B;  4ZCI A;  2CVE A;  2N82 B;  2SXL A;  4KHP J;  4TNO A;  2AGQ A;  2LLZ A;  5GAH I;  5CXT A;  2HQI A;  2BE2 A;  2R8J A;  3M8S A;  4JI2 F;  5KFO A;  1FNO A;  3TZX A;  4KJI A;  1F1B B;  3SFG A;  4DPU A;  5EWF A;  2XMW A;  3TRG A;  1REG X;  4ZLP A;  4WK3 A;  5B08 A;  1CUL B;  2QYC A;  3NGD A;  2ZH8 A;  3UCG A;  2J5A A;  1RHM B;  1KSP A;  3UDV A;  2VBX A;  4FS2 A;  4DU8 A;  1S4F A;  1IJF B;  2I9S A;  3LP0 A;  2DRB A;  3EDR B;  1S1U A;  1W2B R;  2MHE A;  4DPX A;  2XLI A;  3X1L B;  3D7S B;  5D77 A;  1T0T V;  4MKA A;  1NDP A;  1S1X B;  4W98 A;  1NK7 A;  5IM0 B;  2DNG A;  5DG7 A;  1JLG B;  2IYG A;  2QEX S;  2CQI A;  3PEJ A;  5DZ6 A;  3T5H A;  2J9C A;  3IBF B;  2ZFH A;  2ALZ A;  1T8E A;  3QRR A;  4DF8 A;  2GJI A;  1FD2 A;  4R0E A;  1FE4 A;  2AHO B;  3GON A;  1WG5 A;  2X1G A;  3T1Y F;  1UVL A;  2NZ4 A;  3CPW R;  3CD0 A;  2R2T A;  3SXL A;  1Q53 A;  2VIC A;  4ER8 A;  1VLO A;  4K2J A;  2B9X A;  4ED0 A;  1BC6 A;  1QAJ A;  4U67 Q;  2GIR A;  1T7P A;  2AMC B;  4NAS A;  4DX6 A;  1TV6 A;  1P8G A;  3Q8U A;  2GS8 A;  3VGS A;  2VJV A;  1U26 A;  4ZLN A;  1TTH B;  2FLL A;  3CTR A;  4GC7 A;  1TMM A;  1Z2L A;  3PJ9 A;  2BOP A;  3KHL A;  2FLN A;  1D3W A;  4DR4 J;  2RF2 B;  5J2P B;  2N7Y A;  1NLK L;  5HBM A;  4LFA F;  3NS6 A;  3O6Q A;  3BBF A;  1OY8 A;  4KFB B;  3UDL A;  4U8V A;  3BPS P;  3T5K A;  3DOK B;  1S0M A;  3OL8 A;  3KDN A;  5F0U A;  4I7F A;  4RNN A;  3PRD A;  1NJW A;  1U25 A;  2L9D A;  2EW9 A;  2MGZ B;  2IHR 1;  2QLF B;  2W7P A;  1RTH A;  3Q8S B;  3CCJ S;  1FRX A;  3UPF A;  1SB6 A;  2HGM A;  4LBP A;  3WZ0 A;  1UEV A;  2KRR A;  2BQU A;  2ZOG A;  2XY7 A;  1RTZ A;  1FXL A;  3KLG A;  4B9S A;  2E7V A;  1J5E J;  2CQ2 A;  2RQM A;  3IG1 B;  1VQS A;  2KXH A;  1QUV A;  3J7A 1;  4QIW D;  1X4D A;  4TXS A;  3W7B A;  5H9E K;  1HQU A;  1VIO A;  5DDQ C;  4QYR A;  2ZOM A;  3K2Y A;  1NKC A;  3AOD A;  3K17 A;  2J0Q D;  3IM9 A;  4KGZ B;  4Y2I A;  3PIO Q;  3MEK A;  4YN3 B;  1BQN B;  5EWE A;  3NCQ A;  3HT0 A;  1RKJ A;  1LWC B;  2H9Z A;  3KUG A;  1UPP A;  1Y3K A;  3GG1 A;  3AT1 B;  1F9H A;  1AZS A;  1NSA A;  2MQN A;  1VQP S;  1N33 J;  2G4B A;  4YHH J;  1O0P A;  2NXJ A;  4LMZ A;  1DQ8 A;  2KTQ A;  4JUZ A;  2XMM A;  4CLS A;  3NAI A;  5FDL B;  1U48 A;  5KAK A;  2DNK A;  4DSE A;  1YJ7 A;  3QZ7 A;  2V2V A;  4QWD A;  2B7B B;  3UNG C;  3TUI C;  2RDJ A;  1HNW J;  1S57 A;  2PE8 A;  3FCV A;  3KLV A;  1EKR A;  1ZYQ A;  4B08 A;  2OJ3 A;  1TKT A;  1B4S A;  1UEU A;  1ARO P;  1Z1Z A;  3GV8 B;  1SL1 A;  2MQ8 A;  3HHL A;  4Z2X A;  4J90 A;  2ADB A;  3DHX A;  1ZA2 B;  3BV8 A;  2GO8 A;  2B7C B;  2VA2 A;  3QBC A;  2WVB A;  2UUC F;  3H90 A;  2XHC A;  3JAM U;  1U1K A;  1QM9 A;  4UOF A;  2EI5 A;  1CC7 A;  1HNV A;  1ZTW A;  3PW7 A;  5KT7 A;  2HVE A;  2QL9 B;  1Q5Y A;  3EXY A;  4N7T A;  2Y1R I;  4MIA A;  3CO0 P;  3SEO A;  2N3O A;  2HQD A;  1KTV A;  3IS9 A;  2FJA B;  3KLI B;  1MU2 B;  1B0P A;  1GTE A;  4ETZ A;  2ZE2 A;  3PIP Q;  4RNF A;  2WZ1 A;  3KWM A;  1WC3 A;  5GAH U;  5DLF A;  2XO6 A;  4NOH A;  4YEA A;  3T1H F;  1SKR A;  3DXS X;  4DS4 A;  4HVZ A;  4FBU A;  5CD4 A;  2GQC A;  3DGV A;  1O51 A;  2LU1 A;  4LQ9 A;  2C2D A;  3THV A;  1NO8 A;  4LRD A;  3D68 A;  2YWW A;  1PO6 A;  5D3G A;  2HNY B;  3L09 A;  3UVJ A;  4M94 A;  3NAH A;  1FVQ A;  2CJA A;  2UU9 J;  3OJS A;  5KT3 A;  4RU9 A;  4OYI A;  1OJ4 A;  2WW4 A;  2D41 A;  5C24 B;  3L7O A;  2E44 A;  1DHM A;  4EO8 A;  1S1T B;  2CAD A;  3JB9 k;  4RU2 A;  3S6E A;  1QAX A;  4CCH A;  4YFU A;  4YR0 A;  2L08 A;  2P6T A;  4CO0 A;  3OLA A;  2APO A;  4IFY A;  1NND A;  1HNX J;  1FF2 A;  3AQP A;  2QZ8 A;  4ECU A;  3HKW A;  3MR6 A;  3W64 A;  2IM3 A;  4PPZ A;  3UN3 A;  3BQ1 A;  1HNI A;  3OFF A;  4DXL A;  1VQO S;  2C2E A;  2WB4 A;  4WJB A;  5I42 B;  1MN9 A;  3V81 B;  3NCR A;  4P6Q A;  5T41 A;  4UZB A;  2A2D A;  3D4J A;  3VF0 B;  4NLX A;  2ZHA A;  3HKZ D; 
#chains in the Genus database with same CATH homology
 4PWW A;  1J5E J;  4DV5 J;  4V1A k;  4KYZ A;  4DUY J;  3T1Y J;  2UXC J;  4B3T J;  1HNW J;  4DR5 J;  4DV3 J;  2UUA J;  1N34 J;  4YY3 J;  5FLX U;  4GKJ J;  4X65 J;  2E5L J;  4JI2 J;  2KL8 A;  2VQE J;  3J81 U;  3D3C J;  2UU9 J;  4DR7 J;  1N36 J;  4LF6 J;  2MQ8 A;  4OX9 J;  3J7A N;  5AJ3 J;  2UUC J;  3R2D J;  4DR2 J;  4DUZ J;  4DV6 J;  5IT9 U;  4JI3 J;  1XNQ J;  4LF4 J;  4X66 J;  4JV5 J;  1IBM J;  2F4V J;  5IWA J;  4JI7 J;  4LFB J;  4NXN J;  4HHU A;  3JAM U;  4DR4 J;  1I94 J;  3D3B J;  4DV7 J;  4JI4 J;  1XMQ J;  4JI8 J;  4NEZ A;  5LMN J;  2ZM6 J;  4B3R J;  3IMQ J;  4JI0 J;  4LFC J;  1N32 J;  4KY3 A;  4JI5 J;  4LF7 J;  4JI1 J;  4LF5 J;  2MTL A;  4DV2 J;  4DR3 J;  4LF8 J;  1HNX J;  4LFA J;  1HR0 J;  4LF9 J;  5A2Q U;  4AQY J;  4X64 J;  4DV4 J;  3R2C J;  2MEW A;  2VQF J;  3W1Y C;  3J80 U;  4NEY A;  4DV1 J;  1XNR J;  1N33 J;  2UXD J;  4DV0 J;  4B3S J;  1XMO J;  1IBL J;  4K0K J;  3T1H J;  1FJG J;  4YHH J;  4DR6 J;  4GKK J;  4KHP J;  2UXB J;  4JI6 J;  4RJV A;  5BR8 J;  3OTO J;  4DR1 J;  1IBK J;  1HNZ J;  5LM7 E;  2UUB J;  5LMU J;  4NXM J;  2HHH J;  4X62 J;  4JYA J;  4B3M J;  2KVQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...