5EN1A

Crystal structure of hnrnpa2b1 in complex with rna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
184
structure length
184
Chain Sequence
RKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Heterogeneous nuclear ribonucleoproteins A2/B1
publication title Molecular basis for the specific and multivariant recognitions of RNA substrates by human hnRNP A2/B1
doi rcsb
source organism Homo sapiens
total genus 44
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5en1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5en1A02
1FJCA 1FT8A 4Y00A 4YOEA 4TU7A 2MQOA 4C4WA 3UCUP 4QU7A 5MLCV 3P5TL 5GVQA 2DITA 3G4SS 5GAHU 2RT3A 2N7CA 2PE8A 5BJRA 3I56S 2VOOA 2DNHA 3OW2R 3NNHA 2LEAA 5LXYA 3UCZP 1WG1A 2LA4A 1U1MA 4CH1A 1K8AT 2KFYA 3G8SA 3D2WA 2DNZA 2EVZA 3J7YU 2DNKA 2DH7A 1VQOS 1FJ7A 3TO8A 2O3DA 4ZKAA 3R1HA 2KU7A 2U2FA 3K0JA 2DGUA 1DRZA 4CH0S 2RVJA 4W92B 1SJFA 2QEXS 2DNOA 2YWKA 5DM6Q 3SXLA 2KI2A 2DNLA 2KVIA 5DDRC 3RW6A 1PGZA 1N52B 3CMES 2RU3A 2KXHA 2HGNA 3P6YC 3P49B 1WI8A 5IM0A 2RS2A 1G2EA 4WFNQ 2GO9A 3CF5Q 1QVGR 3BO3A 5IM0B 1FHTA 3S7RA 2KH9A 2MQNA 1D8ZA 2PEHA 3UD4P 2QFJA 2RQ4A 4WFBQ 2L41A 1F9FA 3MD3A 1WWHA 3IRWP 1DZ5A 2DO4A 4PRFA 1KD1T 2MY8A 1S79A 2MKCA 2CPJA 1VQPS 2GHPA 1X5PA 5EN1A 2I2YA 3FEXB 2L08A 3CCJS 1H6KX 2AYMA 2M70A 3DLLQ 5D77A 2MXYA 2OTJS 2DHSA 2F9DA 3CCQS 4WKRA 2ZJQQ 2J0SD 1AUDA 1X5SA 2CQCA 3MI7X 3MUTP 1X4BA 3BEGB 2CQIA 1SJQA 2LCWA 5GAEU 2J0QD 3CCUS 3VAHA 3HI9A 1Q82T 3ULHA 3CC7S 2L9WA 2MKIA 2XB2D 2DGWA 3CPWR 3THTA 1VC6A 2CQGA 1WF2A 3MXHP 4QU6A 2NZ4A 4WF9Q 4PKDB 2LEBA 1P27B 2DGXA 2E5JA 2MZTA 3VF0B 4TU9A 2M0GB 2DHAA 3JB9k 1U1NA 3S8SA 2LXUA 2MZJA 1X4GA 3EGNA 3VAGA 2ZJRQ 2X1BA 4QQBA 2LQ5A 2MHNA 3NS6A 2XSFA 5LSLA 1YJ9S 3UCGA 2VONA 4CQ1A 5DDPC 2U1AA 1NU4A 2LMIA 1OWXA 2Q79A 2DISA 2MQPA 3G6ES 3NNCA 1WEZA 2MSTA 2FHOB 2CJKA 2FY1A 2E5IA 1N88A 1ZH5A 1HD1A 2D9OA 1NJIT 1M1KT 1OO0B 1K73T 1SJRA 2DNRA 3BS9A 1WG4A 3UD3P 3CUNA 2DNPA 1YTYA 1YIJS 2RS8A 2CQ4A 4PR6A 1VQ7S 5DETA 1L3KA 2M8HA 2CPZA 2XNQA 2DK2A 1U1RA 1M5VC 4WCEQ 2FC8A 2HVZA 2CQDA 4A8XA 2LKZA 3MUMP 4CIOA 5CYJA 4IUFA 3CD6S 2KHCA 4OZ0A 1O0PA 1VC0A 1H2TZ 4IOAQ 3V4MA 2AYBA 2MZSA 3MDFA 1M5OC 1KOHA 1X4AA 2X1FA 1WHVA 1KOOA 3EX7B 2VODA 3HHNB 1B7FA 4TLQA 2LA6A 5H1SV 1WHWA 2LYVA 5HO4A 3H2UB 3THPA 1A9NB 1SXLA 5LJ5Y 2DGQA 4FXVA 3CCVS 2RUGA 3FEYB 2DGOA 1NO8A 4Y0FA 1WG5A 2E5HA 2MYFA 2JVOA 3IWNC 1FO1A 4J5OA 2F3JA 2M4MA 1X4EA 1X4HA 2X1AA 1JJ2R 2EK6A 2KM8C 3CC2S 2K8GA 3VAFA 2OIHA 3TP2A 3PIPQ 4EGLA 5GADU 3LQVA 2HGLA 3TYTA 1W2BR 2JRSA 2DH9A 2N3LA 2MY7A 3CMAS 1X5OA 2KN4A 2KT5A 1X0FA 2DO0A 2DHXA 4V19X 3CTRA 1SJ3P 2J76E 1DHMA 2LXIA 5LSOA 2B0GA 2RRBA 3MUVP 4U67Q 2DIVA 2QA4S 1X5TA 1X4FA 1RKJA 3BO4A 3VAKA 2UP1A 1H2VZ 2X1GA 2SXLA 1HA1A 2DH8A 1WTBA 2RRAA 2AYGA 1VQ4S 2ADBA 2WBRA 3DXBA 4TU8A 2CQPA 2N82B 2M2BA 3MOJB 5HL7Q 2KG1A 1SJ4P 4ERDA 1Q7YT 1IQTA 2LECA 4WFAQ 1XN9A 3BO2A 1R8HA 2JX2A 4UY8T 1WHYA 1VBZA 2MJNA 2MQMA 5IFMA 2YH1A 4BS2A 2CPHA 5DM7Q 5GMKa 2VOPA 5GAGU 3PIOQ 3R27A 1X4DA 1VQLS 1VQ6S 1VQNS 2MGZA 3RW7A 2XS5A 3B4MA 3N9UC 1FJEB 1ZZFA 2MKJA 2ERRA 3VAIA 2CPXA 5IQQA 4IOCQ 4LJMA 4YUDA 2A3JA 2G0CA 1VQ9S 1CVJA 2OSRA 1UFWA 4LIRA 1WF0A 2MQQA 2MZ1A 3NMRA 3US5A 1KQSR 1N54B 1U6FA 1WEXA 4QPTA 3L3CA 3R1LA 3VAJA 2BZ2A 1BY9A 2E5GA 5DDOC 4FXWA 2CPFA 2MMYA 3SDEA 4RU2A 4WIIA 2HYIB 4C7QA 3I55S 2K3KA 1JJ4A 3P3DA 2YH0A 2XNRA 1WI6A 3SDEB 2CPIA 2MKSA 1FNXH 2OSQA 2CQBA 1U6BA 2DB1A 1VC5A 2HZCA 1N8RT 1YJNS 1UW4A 2JWNA 1U1QA 1KC8T 1YHQS 1WF1A 3H2VE 3S6EA 2XS7A 3G8TA 4W90B 1YJWS 2DGTA 1ZZNA 2I38A 1S72S 2M52A 4F25A 5ITHA 2BOPA 1VBXA 5DDQC 5LJ3Y 2AD9A 2KG0A 1M90T 5FJ4A 1X4CA 1JMTA 3MURP 3CC4S 1WELA 1U1KA 1OPIA 1QM9A 2CPEA 2DNYA 3Q2TC 2DNGA 2ZJPQ 1VQKS 2M88A 1OIAA 1U1OA 2KYXA 3MD1A 2DNMA 5JVHQ 2KM8B 3CULA 4Z2XA 1U1LA 4F02A 4OZ1A 2DHGA 1YITS 2CPDA 3ZZZA 2V94A 2CQ1A 3CCSS 3Q2SC 1U2FA 2DIUA 2N3OA 4YB1P 1M5KC 1Q81T 1YWXA 2YTCA 2MSSA 1VQ8S 2J8AA 2XS2A 3NS5A 3U1LA 3UWTA 5CXTA 2G1DA 2RQCA 3EGZA 3NNAA 2FPHX 1YI2S 5D78A 2D9PA 4LMZA 4UQTA 2MKKA 2EK1A 2CQ3A 2KRRA 2MPUA 1FXLA 1A7GE 2CQ2A 3CCMS 5JVGQ 2NLWA 2RNEA 3CCRS 1VBYA 2ADCA 3LPYA 1P1TA 3G96A 2FC9A 1WEYA 2MZQA 1VQMS 1HL6A 2KRBA 1HD0A 2DNNA 1M5PC 3CXCR 2M9KA 3CCLS 4ED5A 1DBDA 2E44A 3VAMA 1U1PA 3J7ZT 4M5DB 2HGMA 1H2UX 3S01A 2DNQA 1URNA 2M8DB 2AYEA 2MQLA 5CA5A 2KXNB 2OJ3A 2MJUA 2YKAA 4P6QA 2MKHA 3B4DA 2MGZB 3G71S 2MZRA 2D3OR 2CPYA 1R8PA 1WHXA 3U1MA 3VALA 4F26A 2MB0B 3SMZA 4C0OC 2JVRA 1VQ5S 1QVFR 1RK8A 1JJHA 3CCES 2KXFA 2DGVA 2M7SA 2F9JA 3G9CA 2CQHA 4IO9Q 1Q86T 2CQ0A 2OTLS 1UP1A 1D9AA 1PO6A 2DGSA 1K9MT 1UAWA 2G4BA 3ZZYA 5LXRA 3UE2A
chains in the Genus database with same CATH superfamily
1RT6A 3DI6A 2XWYA 2YNGB 5DGAA 2V50A 4OZNA 2UXCJ 1UZDA 4URQU 4TVAB 1OY8A 2V4JA 3OW2R 3EDQB 1K8AT 3G8SA 4ZCKA 4WWSA 4I6YA 2F4VJ 1Y5IB 1D09B 3K0JA 3N01A 4DL3A 2HLUA 1F5BA 5DM6Q 2HMIB 4K4UA 1WACA 1H98A 3IM8A 2R8GA 3D0IE 2ZBQA 2CADA 1QVGR 4G6VB 1X7VA 3TVKA 3PFOA 3MD3A 4M63A 1GQEA 3HFKA 5D4PA 1VFJA 3QSYB 3OJUA 2R2SA 3RG6A 3CCJS 1HQ2A 1ZA1B 2AYMA 4O3SA 2DHSA 2ZJQQ 5I4MA 2CQIA 4ES3A 2RF2A 4XIUA 2MQ8A 1T9XA 2UXDF 4AL6A 3HCXA 4OX9J 3NAHA 1CBKA 1T05A 1GMUA 3MF5A 3I6PA 1KSPA 3C2PA 4QQBA 4WXOA 4DUTA 4NI2B 3UCGA 4BWJA 1NU4A 5CABA 1JLEA 2BEFA 3KDOA 1HD1A 3UD3P 1ZAVA 3AAWB 3CNQP 3I9ZA 2BRKA 4HHUA 4YHHF 5L39A 2FLLA 4MFBB 2QFIA 4IFYA 3H42A 2DR8A 3PW4A 1X4AA 3VVTA 2X1FA 4XDCA 1FKPA 4OYMA 3H2UB 2BQRA 4N47A 4OZ2A 1F3VA 3I0SB 4KSEB 2IBOA 5AXMA 5EWEA 3MAAA 3AXKA 2F3JA 5MAOA 3B6BA 5A2QU 2X1AA 5F8HA 4H4OA 3IBFB 5GAHI 3T1YF 3DRRA 4QWAA 3D28A 2NUHA 4F67A 2J0WA 4Q0BA 4ILMA 1LXJA 3EZUA 5D0EA 1SL2A 2PFDA 2Q3PA 4PYAA 2FIUA 4U67Q 1L3TA 2JC0A 2CG8A 3HULA 2HRTA 3FDSA 4NOHA 4U8VA 1FA0A 4C48A 1S9GA 3MEGA 3MOJB 5ETPA 4HYKA 3KLVA 3P8BB 3QZ7A 1XN9A 4P2MA 3QAUA 3KK3B 2FJWA 2NSBA 5DGBA 4F4WA 2D3UA 4BS2A 2XYPB 4RWXA 2LU2A 3N9UC 4LJMA 2QSWA 1WF0A 2NYHA 2YWEA 3THVA 4DPTA 4WBFA 3I32A 4RW7B 2AGQA 3JQKA 2MKSA 2EKYA 3FBFA 1FNXH 2OSQA 4O4GA 1VMBA 2JWNA 4N5SA 3NS7B 3BGOP 4JI1F 3H2VE 2ILYA 1VS3A 1WOOA 2DGTA 4J9PA 3GFYA 3LF0A 3KK1B 1YX2A 3R6GB 4I69A 4LF6F 1JMTA 3T1YJ 4OYBA 2DR9A 1QM9A 2CPEA 3PJWA 2DNGA 2ZVSA 3IXQA 2VG5B 1OIAA 1U1OA 5JVHQ 2FY8A 3DYAA 2ZM6F 5B7WA 4DU8A 2HWHA 1MWYA 4GKJF 1CS4B 4NX9A 4ZP7A 1MROA 3CCSS 2N3OA 2XM3A 4ICLA 3ISZA 3CJ0A 1VQ8S 3NS5A 3LALA 1FESA 4X62F 2D9PA 2ZC4A 3R2CJ 2W7PA 2MPUA 4QR2A 5H9EJ 5K14A 1RTJB 3RBXA 1S48A 4JB8B 2X3GA 1HBMB 3G96A 1QY7A 3OD2A 3FQLA 2OEMA 1ZPVA 4MIAA 2FDNA 4ED5A 1T7PA 2M3DA 7FD1A 2D69A 5BYSA 2I5JB 4OJ1A 4H4MA 1ACMB 3X3UA 5M2RA 4DL5A 3QGPA 4JI1J 3G9CA 3CIMA 3NOGA 1NMEB 5HVGA 4IOBA 5CYQB 3OL7A 3JQJA 4OHZA 1IN0A 4LF6J 3M2RA 4Y00A 2P8IA 3UCUP 3H40A 1H73A 3KHHA 2LEPA 4ED8A 3DLEB 5A8WA 2BOAA 2B6AA 4OV1A 3BM7A 2MLZA 2KFYA 3CJ8A 5ETSA 3N6LA 1JLGA 3GILA 2U2FA 4QPXA 1X9WA 4OZ3A 2DCLA 4P74A 1LFPA 1IJFB 2QLFB 2RSQA 4B08A 4IH6A 3RU0A 5L46A 1RBAA 2HHWA 4E0DA 3P49B 5BR8F 4USKA 1QAXA 5A6WA 3T5KA 3HT3A 3LGMA 1RHMB 3KLIA 2OMLA 4CNYA 3KLFA 4Q8FA 1FKOB 2IM2A 2DY9A 1JXEA 2BVZA 2GHPA 1U4BA 3ET6A 4X4RA 4DV4J 3HVTB 1S10A 3C14A 3E8OA 1YJUA 1RB0A 2JEFA 4NYOA 1WSVA 2ZITA 3ILOA 4I67A 1AB8A 2GNKA 1LWEA 1P27B 2DGXA 4KHMA 3TAMA 2N4CA 2ATCB 2DHAA 2CWXA 2Z2ZA 4GC7A 3EGNA 3NS6A 2EC2A 2ZUAA 4MYUA 3F41A 2F65A 2B9EA 2E5IA 3MR7A 3HP6A 2WSCC 4C9DA 4PR6A 1FE0A 4U9RA 3K5OA 2ZOGA 3T41A 2DK2A 4RL1A 3HX9A 5K8NA 3OJSA 3QT7A 1H72C 1OY6A 2C22A 3AJ1A 1FVQA 2R8HA 1HI8A 3KFWX 2GW8A 1H2TZ 3MM8A 3DM2A 2AYBA 5T7LB 3EVOA 2UUWA 5FDLB 2VPZB 2P9GA 1BMQB 2IMWP 2DPJA 3KMQA 1Z1ZA 2VL1A 1Y11A 4Q2MA 5ETOA 4ES2A 3NXZA 5BR8J 3SQOP 4FXVA 2HFVA 3DLJA 2DGOA 2YNFA 2CG4A 2L48A 4R5PB 3QT5A 3W62A 5DQHA 4U7CA 4QWCA 3TA0A 2BX6A 3FBBA 2K8GA 2E29A 2GS8A 3EYZA 2YKNB 3VGSA 3OT9A 2HS4A 1B0VA 5D3GB 2DRDA 1E6VB 3N6MA 4ZJQA 3CTRA 1IBCB 3TUIC 4DL6A 4D3GA 1SBRA 3VGUA 2HPUA 4DUZJ 3BH7B 1Q8LA 8AT1B 3BO4A 3VTIA 3D0HE 1H2VZ 4FF2A 3DOLB 4TU8A 4CRJA 3IA0A 1HQEA 2ZH3A 1DAXA 2J6SA 2HNDA 1EARA 1AXQA 4UY8T 3W60A 4YY3F 1HW9A 2VOPA 3OVAA 1B4SA 4YUDA 3OLAA 2G0CA 1S6PB 1EB0A 3NMRA 1N5YB 4QPTA 5DDOC 2WRMA 3SDEA 1YRXA 1VJWA 4CLWA 3GV7B 1HIYA 1GX6A 5HAOA 3GYNA 2DB1A 2Y8WA 5T41A 1QUVA 2QZ8A 4ECSA 4NLOA 1DTQB 3CEDA 3H25A 5KFPA 3CJRA 4O44A 1VI7A 3NWGA 4K5SA 2QLBB 1KHWA 4PWWA 3FBEA 3BDEA 5LJ3Y 5CD4A 3N79A 1SKSA 1R89A 4ZS6A 4YQWA 2HQIA 2JEIA 2C3MA 3QNWB 1VHIA 2O5DA 3V6KA 5C7PA 3D1OA 4DL0C 4FPIA 1NUEA 1RAEB 3M6WA 2PT0A 2AGPA 3ZZZA 4N7TA 3GSDA 1BQNB 2FHJA 4YB1P 3EDRB 3MM9A 2W01A 1JKHA 4P2XA 3G6YA 1OSDA 1CULB 1EETA 4JI2J 3LA0A 3W2VA 2DEJA 1HWIA 4LRAA 1LWCA 1VR6A 3HZGA 4YY3J 4USWA 2MZQA 4PXBA 2B4OA 1Z2ZA 2PMWA 2DNNA 4J9UE 2AGOA 1T8EA 1WDTA 1RAAB 1B7YB 5EWFA 5HI7A 3F0NA 2V2KA 4Y34A 5E7OB 4PYDA 3PV8A 3FJ2A 1Y9OA 3MFIA 4ZIVA 2KXFA 1F9HA 3CSKA 2DGVA 4DSIA 2GX8A 4IO9Q 5J1EA 1KBRA 1TL3B 3E01A 2MLXA 1KNZA 1NM2A 4DV1F 2B3TB 3D6HB 3FFIB 1RT1B 2BV3A 2KTQA 4TU7A 1IR0A 2DITA 3MMJA 2FHKA 1QAJA 1XNRF 3TZZA 2RT3A 2VFTA 3IM9A 2WONB 1JB0C 3Q8UA 3BJYA 3O3LA 3DCAA 1PCAA 5D0GA 1WOSA 4YDDB 1FDDA 3V6HA 5HATA 2FVPA 1D8YA 1JLCB 4WXWA 5D15A 1CJVA 3RW6A 1N52B 4LQ9A 3P96A 2YPZA 4K2XA 3PRVA 4ZCIA 4ED7A 4ED6A 3W66A 4ECZA 4DSEA 3C19A 4WFNQ 4A47A 2N7YA 2HK2A 1WKKA 4X65J 2EKNA 2ROEA 2C2MB 3MMCA 2AP6A 2L08A 1R31A 2XG8A 2GFFA 4WZMA 1SL0A 2WVCA 3KYLA 3VWSA 2J9DA 2ZOMA 1HR0F 1NDPA 2FTRA 3OL9A 2VPYB 2FVSA 1C0UA 3NGUA 3TVZA 4J9LA 2E5JA 1UVLA 1UFKA 1LV5A 3G87A 1Y10A 3VAGA 4DV1J 2VQFF 4DR7J 3NRBA 2NSCA 5KFOA 5KOXA 1IR1A 4ANCA 1VK3A 2LQ9A 2BJ8A 4C2MA 3GONA 2CQ4A 1NNDA 4KH1B 4AXJA 1M5VC 1NPKA 4DV3F 5HLFA 2LQBA 1S1WB 3CJKB 3LPEA 2E1MC 1O0PA 3J81Y 1IJEB 3MDFA 2UVWA 2VODA 2EPIA 5KFSA 2GQ2A 4W98A 2HVHA 4F04B 1S57A 3N4WA 1S1VA 2RUGA 5KAKA 4Y0FA 3C15B 1WG5A 2E5HA 2MYFA 3W9JA 4N77A 3N6NA 3BQ0A 3BSNA 4DR5F 2EK6A 3R97A 2Z8QA 1QSYA 2VQEJ 2YNHB 1M1GA 2KDOA 3PCOB 3R6LB 1W2BR 4K50A 2K7JA 1MU2B 2C2KB 2JLFA 2VG7B 4IFVB 4O0NA 1HR0J 2BA9A 4GO7X 3BR8A 2HHQA 1N32F 2J76E 1HNVB 4HI2A 2B0GA 3V4IA 3PW7A 2RUSA 4WU3A 2C1EB 4UTGA 2BM0A 2Y3YA 4ES1A 2OLWA 2VQFJ 1FRMA 2A6MA 2CDQA 2C3UA 3TQ1A 2PD1A 1WC4A 3BV8A 4WFAQ 3KK3A 4WFZA 2GMLA 1PJ7A 5GAGU 3DOMB 2G2OA 3A8IA 5E3RA 3B4MA 3NP5A 2ERRA 2CPXA 4HT5A 1PBUA 3I31A 4LIWA 1U6FA 5GAEI 4RW7A 2XBPA 4K8RA 4NLSA 1FD2A 1WI6A 3K7RA 2CPIA 2PGCA 1H7WA 3KNGA 1N8RT 2B4UA 1LWFA 1YHQS 3GFXA 2VD3A 5KFCA 4RW8B 4W90B 5KFQA 2QL9B 2V4RA 2RAQA 4WP9A 2OPQB 4KHPF 1SH2A 4E2FB 2CKWA 1M90T 1KLMB 2HWTA 2ACMA 5HQLA 1BQMB 1MG7A 1OPIA 1SQGA 2Z0GA 4Z7CA 4FF1A 4F36A 2HIYA 1LK5A 3ZO7A 2WTFA 5EHHA 4ZCLA 3D67A 1BE4A 2HQ3A 3Q2SC 2DIUA 2VC1A 4J9KA 3R5BA 4NLDA 4MMOA 3R3TA 3MR5A 2XY7A 2HFZA 5I3UA 1S59A 4LRBA 5C24B 3ISND 2UUCF 1UKUA 3RGIA 4O0IA 4NYZA 4DSJA 2F40A 2CQ3A 2GAGC 4B3SJ 3PZPA 2UU9F 4X64F 2LP4A 1HBOA 2IM0A 2NXUA 3EPGA 4I1TA 3BGRB 4OX8A 2POKA 2VB6A 5J2MA 4CTAA 1GXTA 4ZVGA 3CDUA 3EMTA 2IM1A 2MZRA 1ZTTA 1ZAWA 1HI0P 1R8PA 3A12A 4ECUA 4LF1A 3UR3C 3O2IA 1XMBA 1PYSB 2Y1RI 3AOCA 2QMWA 1RK8A 3VQTA 3ADAC 3ZTQA 2CQ0A 4P7VA 1KVKA 2HLTA 2ZDPA 2IC3A 2JL9A 3R5AA 1TFYA 1UZHA 3OV7A 3AB4B 4JI3J 3AA9A 2GA7A 2PE8A 5BJRA 2DNHA 2OH2A 1UCNA 3QIDA 3R5GA 3UCZP 4A8OA 2UUBJ 2V63A 1NLKL 3EZOA 3D2WA 1WDDA 5J2QB 3J7YU 5B0FA 1FJ7A 3PHTA 4N8OA 2RVJA 3M8ZA 5KFRA 4UY85 2DNOA 1CJKA 5EX3A 1GTEA 2BKNA 3SXLA 2DNLA 4LSZB 4RBUA 3MMBB 3JAMU 3W1YC 1MMLA 1TV6B 3V6DA 1U8WA 2OPRB 2UU9J 5DG7A 1NZAA 2NREA 1B0TA 2DBBA 3IN5A 1L5UA 5E3PA 1X5PA 2I2YA 3JAMY 1KEKA 2M70A 2DCUB 3F44A 2ZH6A 2JFDA 3TVYA 4ANEA 4RNNA 1X5SA 3I5BA 3DRPA 3MI7X 2B8PA 1WC1A 5DZ6A 1Q82T 3HSGA 1VC6A 4WE1A 4DR6F 4WF9Q 4OYOA 2MZTA 3HD1A 3LAKA 1FDBA 1S4EA 1S1XB 2KZZA 5IT9U 1HYSB 4X4OA 4USVA 3S8SA 3POTB 3GP9A 2OFGX 5DO2A 4DCJB 3HK2A 1Y5LB 1SKRA 4U8YA 2P2CB 1JIHA 4JV5J 3QSIA 4EK2A 5IT9Y 1Y0HA 1X31C 4B9NA 3MUMP 2HZVA 1K0VA 5T7LA 2CZ4A 3QIPB 5CYJA 1S0VA 4USHA 1DARA 3ZZTA 5AJ3F 5HO4A 1HWLA 2H5IB 3CCVS 4R5PA 2WK4A 5AXNA 2V9KA 1YRTA 3LAMA 4MT1A 1FO1A 3N5FA 2EWHA 4IQXA 3DLKB 2DKOB 3CWJA 3D3CJ 4EGLA 3FGVA 2GC8A 1F3FA 2OPPB 4MYTA 4FF4A 1F60B 1X5OA 5KFBA 3MPDA 3GMGA 5KT5A 2DO0A 4ECQA 2G13A 4M95A 3PRDA 4K4WA 1B70B 2KVQE 3DOLA 2DH8A 4YR2A 2GGPA 1C1BB 3PYDA 1HBNB 3Q23A 2BE9B 1EP4B 2GV1A 4OHYA 4MAKA 3C8YA 2LECA 4XTTA 3Q24A 5GMKa 1VQLS 3X1LB 2HG4A 3NBPA 1S6PA 3DN9A 2MKJA 3S1TA 2OSRA 3JS9A 1KQSR 2YKMA 3D1QA 2AJ1A 3TW0A 5HJYA 4ZPCA 1RAJA 4I64A 3M8PB 2B43A 3OTOJ 1JJ4A 2XGPA 5AJ3J 3R5JB 3BSAA 2KO1A 2Q1LA 3UD5A 1HWUA 4QCLA 1TMMA 4HHJA 4V19J 2JJ4D 1V3RA 5DDQC 1RWNB 4UUXA 2AD9A 1RLDA 3T1HF 4KE5A 2C2DA 4UW2A 3LW5C 4JI5J 3Q2TC 1N34F 2PEBA 1YJRA 3U1NA 4Y2AA 5I42B 4CT8A 4F02A 4NXNF 1HNIB 1CULA 1NH7A 4UZBA 4RO0A 1F1BB 3ITHA 2FVQA 1N36J 1N5SA 3OL8A 2BJ3A 1B64A 4B3MF 4DG1A 2KRBA 5IWAJ 3C6UA 3CCLS 4LR8A 2CZ9A 4FYVB 4I56A 2HBYB 2WZ1A 4KB7A 4IRKA 2RKIB 4JI8J 1ZYQA 4GO5X 1HPZB 3VALA 2ASDA 5C42A 2JVRA 1T94A 1TL3A 2OTLS 1FRKA 1D9FA 2DTJA 3V5RA 2D1CA 4OI0A 1UP1A 2DGSA 2QV6A 3ZZYA 1RT1A 1BGXT 3Q0AA 4KJIA 4NWBA 2A2CA 1FT8A 1AUSL 1IVZA 3TX8A 4OZJA 1JK9B 1HQUB 2WAQD 4NXNJ 5D4LA 3T9ZA 3HVWA 2DGUA 2UV8G 4C3KA 3OTCA 2FGCA 2Y0BB 2UUAF 1J5EJ 1JLCA 1VRQC 1RT7A 4IG3B 1RT4B 1TVRA 3UDLA 4IYQA 1UWBA 2BUNA 2R3VA 2HQDA 2KH9A 1VLOA 4DS4A 4M5GA 1TKZB 4PRFA 3F56A 2NZCA 2HHHJ 2HQCA 1JLAB 2E9ZA 2CPJA 3VHQA 1PG5B 2VBXA 3OXGA 4UOCA 4FF3A 3GG1A 5KT2A 2F9DA 2J0SD 4M5IA 4X4TA 2V9WA 1PILA 4BCAA 3DLGA 3NY0A 1CC8A 2NZ4A 4PKDB 1U2RA 3JYTB 3C66A 4IKAA 5CH7B 1X4GA 4QZVB 4TXSA 4USIA 3UVJB 2C28A 2GO8A 2QE5A 5LMUF 2OEJA 4ANDA 2YNIB 3A3NB 3G6ES 3HD2A 2FHOB 3KLEA 2FY1A 4DV0J 1NJIT 2HS0A 3BS9A 5AE3A 2QIFA 1M0SA 5DETA 1ZM3A 1TUGB 3QRQA 1RAIB 4OI2A 5F9LA 3CJQA 3PW2A 2PSZA 3CJKA 4B3RJ 4L6V3 4NCBA 4NZ0A 3AOAA 2R4FA 2F8HA 2UVUA 1IBLJ 4DSKA 5T14A 1WC0A 1DLOA 1IWGA 4CLSA 1RCOB 4K4VA 4M5JA 3FEYB 2M5YA 1VRTB 2VDIA 1FD8A 1T9TA 1ROFA 4LSNB 1FK9B 4Y3CA 1EX8A 3HJFA 1F5CA 2VKRA 3A8KA 2V8DA 1MU2A 1XMOF 1W7WA 2AEJA 2VG7A 3I87A 1V6HA 1RHKB 3EPIA 2C2EA 5EUHA 1FDNA 2DHXA 4DLGA 1IQZA 2DIVA 2F8EX 1SJ1A 4Y65A 3GIJA 3DDNA 1HA1A 2RHSB 1HNZF 2AYGA 2CQPA 3MAHA 5F0UA 3WZ0A 4Q5VA 3KLHA 2YBVA 1AFJA 1XEZA 2JHEA 1RWUA 1VBKA 2DXEA 3GJQB 2WHOA 4FXWA 4CLLA 3NCQA 1GH8A 4OI4A 1WORA 4O3NA 5F8MA 1S49A 3QGIA 2YWFA 6FDRA 2Z2LA 2DR6A 1YJNS 2HBZB 1U8SA 3G2XA 3FSYA 4RW8A 4Q45A 3NAIA 4ED2A 1U0SA 1O5JA 2HZAA 2OPQA 1YJWS 3M32B 1R0AB 3DXSX 2WVEA 2VG6B 5F8JA 2Q6CA 4OV6A 5E3QA 1N48A 4UOHA 4X4SA 1BQMA 1DY3A 3JTNA 4DUYJ 3D66A 4WYWA 1N33F 2KYXA 2DNMA 2Y1LB 4FN5A 3CIZA 2Z57B 4B02A 1HHTP 4Z7YA 4NEZA 3W3SA 4QIWD 1N4LA 5E2QA 5C24A 2UXBJ 5DG8A 3CMQA 4M5LA 1SC4B 5U47A 1N6QA 2FVCA 1YJ7A 1A7GE 5D4NA 2PMZD 5JVGQ 3HHLC 2RNEA 3DGPB 3GIMA 3CCRS 1EQ0A 1VBYA 4Y28C 4NLTA 2FC9A 4CI0B 4OYWA 1VQMS 3BGRA 2E5LJ 3C16B 3DRSB 2J9CA 1OY9A 3J7ZT 2GIQA 3A3PB 5J1PA 4AQYF 4OZLA 4F26A 2MB0B 4K0KJ 4I7FA 1UW9A 2RRNA 5A0YB 5A8RA 1XNQF 2XTJP 5C2GA 4CCHA 3LUYA 4DPWA 1U6ZA 2V2QA 4YOEA 5C25B 4AT1B 4DL7A 5EX0A 4JI6F 3Q8VA 1XMQJ 2CA9A 1EHWA 4NPOA 5J2QA 4DDFA 1VQOS 2R8JA 4ED4A 4ZPDA 1FERA 4LRFA 3H5SA 5LMNF 1NHKL 3BN7A 1B99A 4C11A 3QGHA 2C2ZB 3MMBA 2NPFA 2JLGA 4CM2A 5DDRC 4F4XA 1HLWA 2G9OA 2AW0A 4L75A 2XY6A 4CO1A 2CJBA 3BO3A 2IAJB 4U6PA 2FQQB 3GYGA 3E2EA 2L41A 4Y2IA 4L72B 2XZWA 3BREA 3L7PA 2DY1A 3QJPA 3OTBA 3IS9B 4ZPWR 4DPXA 3RBEA 4AQYJ 4XK8C 1Q8KA 4AYBD 1MMDA 4YS2A 3HVAA 5D4OA 4NXMF 4BLGA 2OI2A 3CPWR 2VF3A 3DMJB 4MH8A 3OHAA 4LF4F 3GQCA 1WF2A 4FNIA 3D54A 4PXDA 5HROB 4IR1A 1HYSA 3VF0B 4TU9A 3TZXA 4FS1A 1Q95G 1JLFA 2ZJRQ 2FGOA 1P8GA 4CNZA 2XSFA 1GTHA 4BWMA 4WK1A 4JI6J 4DCOB 4DPUA 3NL0A 4WKYA 5B0GA 3VCDA 4NLYA 3OR1A 5H9FJ 4DXLA 1RHQB 1WOPA 3SSRA 3WC2A 4DX6A 5KFMA 1U24A 4EBEA 4IOAQ 1KS2A 3DOKB 1VC0A 1V3ZA 3OBIA 1FWPA 2LYVA 2OPSB 4EZ6A 3AHPA 1EZZB 2F4FA 1S1UB 2FJDB 5L1LA 1SXLA 5J2NB 3W5XA 3M4XA 4ZVOB 4ZVRB 1R0BG 4J9SA 3H2LA 3PY8A 1QE1B 1X4EA 3M6VA 5G4DA 3U27A 3TYTA 4GVBA 2CRLA 2JRSA 4ILRA 4KRWA 3KLGB 2W4PA 2AJ0A 2KN4A 3RB4A 2R7SA 3CW2C 3RTVA 1GMVA 2OHDA 3MEEB 1RTDB 2BJ1A 2AJ4A 2OKQA 3PNIA 2BKPA 4XPCA 2W8KA 2X1GA 5LL6d 1H38A 3KG1A 1WTBA 1HBNA 4I2PA 1EP4A 2XMVA 2YWWA 3IAM9 4G1PA 3SBMA 2R7RA 4ERDA 1IQTA 1VIOA 2AJFE 2EFPA 1SVDA 1HBUB 2CXEA 4OI6A 3MTKA 4NE9C 3PIOQ 5ETTA 4NLPA 2VU5A 4LFAJ 4FPRA 4DQRA 3ZTOA 2A3JA 1WEXA 3R1LA 1RA7A 4KGXB 2A0FB 4WIIA 1C2PA 5KFWA 3UI3A 4ZHRB 1IKWB 1TK8A 1GMWD 2K06A 1E6YB 2I6WA 4RJVA 5IC4B 3TAQA 2XWXA 5HMWA 3ONQA 3M2UB 3KG4A 2KJWA 3RB0A 1FE4A 4DJBA 1G3OA 1UEKA 3TUZC 1U0HA 1U1KA 1RAGB 2DNYA 1Y00A 3L95X 2ZJPQ 1FRIA 5I42A 4X4VA 1RBLA 1U09A 2XMJA 4ID5B 1IBKJ 2V94A 1HNIA 3M7VA 4RUBA 3NG8A 2VA3A 3CD7A 2BE7D 1S4FA 1RP5A 4DR2F 4NA1A 3PW0A 2W9BB 1MSWD 2FHJD 3FSXA 4NA2A 2XC9A 1UVIA 5ETVA 1DFDA 2OAUA 2P9CA 3DDKA 2I0XA 2RKIA 4HTJA 3S01A 2YKAA 1HPZA 2MGZB 2N4DA 1D0EA 3U1MA 3BSOA 1AZSA 1VQ5S 2C3PA 1C4CA 2IJFA 2Y1JA 2LQ8A 2W4DA 4UOGA 1X8DA 4MIBA 4LF9F 3O5TB 2BQUA 1NEEA 3GJSB 1NKCA 1JLQA 2VIHA 3R5DA 5B0DA 2KT3A 3LOUA 3MCMA 3W65A 3BKUA 4K7QA 5GAGI 2NXCA 2NXEA 3P5TL 4FXDA 1BHNA 1CLFA 2N7CA 4H54A 3NNHA 2LA4A 2KFNA 1I94F 3M30A 2DH7A 3AOBA 3TO8A 3EVMA 1TK5A 1NSAA 3W64A 2QEXS 3JSMB 3CDWA 4IG0A 4IG3A 2AJ2A 1RTIB 5DS7A 1SC6A 3LP2B 2KXHA 3P6YC 3FKBA 1WI8A 3NEKA 2FJXA 4B9TA 1IM6A 3FQKA 3QYYA 2Q66A 5HQMA 1NRKA 3IRWP 1JLAA 4LBIA 3IC1A 1MW7A 1XR6A 2MY8A 3KJNB 4FS2A 1S79A 1KD1T 4FYDA 3M8QB 3NOCA 4WPAA 3LGNA 2QX0A 2VICA 4LF5J 1S6OA 5ETKA 2EEYA 3H5XA 5GADI 4WKRA 4KGKA 2CQCA 4NRUA 4HEA9 2BANA 2W2QP 3O1LA 2G2ZA 4Y2MA 2XMMA 1G6BA 3ULHA 2BMBA 1PYOB 1S5ZA 3EJMA 3SCKE 2E1CA 3NWRA 4FDFA 2G0IA 3GJTB 4ECYA 3H5UA 1CG2A 3UVJA 1FWLA 2KZMA 3OR2A 1WUUA 1CQNA 2MHNA 1TL7B 2EI5A 2YNIA 4KR0B 2U1AA 2LMIA 2MSTA 4C3LA 1REVB 3K5LA 3K59A 2D9OA 4YB5A 3PJXA 3UPFA 1OS5A 2V0NA 2WW4A 5EWGA 2FC8A 4DN0A 1GXUA 4ZP9A 1CJTB 5B08A 3ILLA 2KHCA 1A0OB 1X60A 3K2YA 2G2YA 1LWXA 2LLZA 2XZDB 3FCHA 1MN7A 3J7Z5 3OUYA 4EO6A 4OJHA 4KHRA 4MKVA 4OHWA 4QIVA 2QLWA 1U25A 1HNWJ 4OYAA 1T02A 3MEKA 5C2CA 3R7BB 3QFHA 1RYSA 4B3TF 1Z4UA 3RR8A 2OMOA 2OIHA 3HDSA 3LQVA 4YN3B 2D74B 2N3LA 3QMQA 1SUQB 3WDOA 3SCLE 1GAOA 3J7YI 4M5HA 1NHUA 5JMNA 1R3NA 3QO9A 5AE2A 2ZHBA 1KLNA 1N5VA 2Y9HA 2V8HA 3KUHA 2E9TA 5IZHA 4IH5A 4UQGA 4RUCA 1NDLA 3G82B 2RILA 2VBZA 2XLKA 4MKBA 4B9SA 4TY8A 1IBMJ 4ED1A 1YZ6A 4QW9A 3K5NA 4HACB 2J6UA 1LK7A 4R8UB 2YH1A 3SI8A 4A8FA 2CPHA 2XS5A 2X7IA 3AD9C 1R43A 1WSRA 4U96A 1O51A 4CH7A 3VQSA 3TZWA 4FVMA 4F50A 1HMVB 5AE1A 2R2RA 1C1CB 1NK5A 2K3IA 4P72A 2CJXB 1URRA 4KQZA 4AD6A 3B78A 2X3DA 1RHRB 1NB7A 3H90A 4WFYA 8RUCA 1JLBA 2J7WA 4KV8B 4IH7A 2VG6A 3OL6A 3RAQA 3LP1A 4W4MA 3CJ2A 2ASLA 5L1JA 1Y5NB 2YY3A 1PIEA 2UUTA 2F63A 3L7OA 4RLEA 4C0BA 4DQPA 2V34A 4X66J 3MFHA 3JSBA 4Z2XA 1KN6A 1C0TB 3P5BP 4RKUC 1FFWB 1RT3B 4M5KA 3RYLA 2W25A 3SQGB 1ITPA 2IFXA 3FCWA 2K7KA 2FVRA 2ZDOA 4ILLA 4R0JA 1YQHA 3ILJA 2HAFA 2KRRA 4I2QB 4KH0B 4PG8A 5KFEA 5G0RA 1RGVA 2RD5C 1FX4A 4KTQA 4XAKA 3DRSA 4DV5J 1HL6A 1TKXB 2FZKB 2ZH8A 3UDEA 3CXCR 2BDPA 2XLIA 2XI2A 4M5DB 3FMBA 1H2UX 3PR5B 3C3LA 1URNA 3OLBA 3T5LA 2V5HG 1HFEL 1TUWA 4C8OA 2XSJB 1RT5B 4A8SA 1SIWB 1JJHA 4ZLPA 4N8NA 4DEZA 1HWJA 1D9AA 3UO0A 1M5SA 5L9NA 2WOMB 4ELTA 1CQMA 2QYGA 2IBKA 3VGVA 2VA2A 4CYUB 2AF6A 5KG6A 2ZFHA 4X84A 2I9SA 2LEAA 3RRHA 1CPZA 1WG1A 3D4JA 1RWPB 5F41A 4F3MA 2ZD1A 2R7TA 4Q8EA 2V8PA 4RUHA 4Q43A 2FJBB 4PXEA 2PFFB 4GMKA 3P4UB 2KVIA 3EE3A 5KFJA 2IAJA 5DRKA 3ZNJ1 2ALZA 1EKSA 1F9FA 2B5JB 5KG1A 1WTFA 4F4YA 3IS9A 1RTHA 1VQPS 3I4PA 5EN1A 3PYFA 1LW0B 1UPPA 5D77A 2UXDJ 4QWEA 2PO4A 4YR3A 4C97A 2HNYA 3BGFA 1M5HA 1VJQA 4H4KA 5KTQA 3DMJA 2CZVC 4JI7F 1NSKL 2XMAA 3JXOA 4HT7A 4DV7F 3P45B 3RR7A 4KY3A 3FMWA 1U48A 2E7XA 4GKKF 3TQEA 1VISA 4YHHJ 4LSLB 3BDPA 3D7SB 4TYAA 1S77D 2RDIA 2ROGA 3IBCB 5KG0A 2R2UA 4DFPA 4ZP8A 4PG4A 4CO5A 3U02A 1RT6B 2NPIA 4A8YA 1QTMA 4B3OB 2R7VA 5K5MA 2CQDA 2LKZA 4MKYA 1UFLA 3DOKA 2V4JB 3K17A 2W2OP 1KOOA 3EX7B 5DZ7A 4FBTA 2YQ1A 2MKYA 3CD5A 3IR6B 1PJ5A 3MMAA 3KJVB 3I0RA 3PRBA 4FVCA 1NO8A 1QE1A 2FZGB 5KG7A 1LEOA 3GWCA 1FJGF 1FNMA 3GPAA 2IRUA 1S0NA 3TP2A 3MM6A 3QGGA 3L9ZA 4LVNP 4YB6A 3GJRB 5AXKA 3HSZA 1W2IA 3MEEA 4OMFG 1RWMB 1SKUB 4FYWB 1SJ3P 3GIKA 3GFHA 3K8VA 4ED3A 4KO0A 3Q83A 2EBGA 3ZXWA 3HXMA 2RF2B 1BD6A 3LTOA 3PR4A 4JI4F 2CJAA 2C2RA 5HVFA 2V67A 1T05B 1HBUA 2JX2A 5DM7Q 2KJVA 1X4DA 2XMKA 3KNAA 1G4CA 1VQ6S 4DV6F 4ZA1A 1ZZFA 3M1VA 2ZWPA 1KQKA 1UFWA 2ROPA 1K0TA 1JLEB 1TL5A 2E5GA 4USUA 4QBUA 4BBYA 3QLHA 1H3DA 4DL4A 3I55S 4ZHRA 1FRLA 3W8GA 3PM9A 2CQBA 1SH3A 2FLNA 3MTJA 2JLEA 2NS1B 3M2UA 3K57A 2XS7A 3G8TA 4RNOA 5A8KA 1ZZNA 2I38A 2R7UA 1TK0A 1WNEA 1LOUA 1FKPB 1VBXA 4JYAF 4DV2F 3H4BA 2ZM6J 4ZN1A 4GKJJ 4DX8H 1RHJB 3W5YA 2M88A 1CSJA 4ID5A 3CO9A 4IRDA 4ZK7M 1YITS 1NJZA 4RNHA 4X62J 5I3QA 5H9FK 3DRRB 2A6OA 1SL1A 4QWBA 3M8RA 2J8AA 3ZNUA 1FF2A 4Q0BB 2ZH2A 4N41A 2FPHX 2XCPA 1BWEA 1IXKA 2H65B 4LMZA 1UVKA 1FDAA 4C8YA 4E98A 2NLWA 5LOQA 3LPYA 1KR4A 2WVDA 3I4HX 3ZZUA 3W7BA 1SQEA 2VHGA 4YB7A 3HHKA 4NRTA 1S9GB 3MEGB 1AFIA 1FKAF 2OO4A 5CYMB 4P73A 3LGHA 3O6QA 4DL2A 4JV2A 2WVFA 3GR0A 3H4DA 1TFWA 2KXNB 4TN2A 3CDBA 4LF2A 3Q86A 1F5AA 3C6TA 3SSQA 2Z58B 4QYZK 2PA8D 4DZDA 6AT1B 1C4AA 1Q86T 3PVXA 4ZVPB 3WX8A 4O4GB 4QJVA 3DRYA 4DV2J 4JYAJ 4CO4A 4A4JA 1FJCA 2GVDA 2AQ4A 1CJUA 5MLCV 4WU2A 2H5EA 2VBYA 3G4SS 3CJ3A 5J2PA 4DR1F 2Y8YA 2IA0A 2BYCA 1UEUA 1TAUA 1VQSA 5K20B 1UEVA 2D41A 2ACYA 2YWHA 4FNHA 3GYXB 2EFVA 1U45A 4ZKAA 4JOUA 4A8QA 2XMTA 1KQFB 3LP2A 1NKEA 1PGZA 1MROB 4C98A 2RU3A 3M8YA 1U26A 5DQGA 2ZNYA 3LH2S 2RS2A 4NCAA 1VQYA 5E3AA 3AH6A 3FZBA 3S7RA 4ZP6A 3T5HA 3E3XA 4KBIA 1ZS6A 4TY9A 2HBRB 5K14B 1QAYA 4DR3F 3PACA 1NJWA 4OL8A 4OI1A 5E41A 3BEGB 2AEMA 5KFKA 4ITSA 2R8IA 2L9WA 4ZLNA 4Q44A 2ZBRA 2LEBA 4PG5A 1R6VA 3MM7B 4FBUA 4RX6A 2R7XA 4H4MB 3BQ2A 3AXMA 3J81j 4QIGA 1LW2A 5LSLA 2W8LA 2YX7A 2HVEA 1REVA 5B0EA 1LFWA 1OO0B 1GEHA 4OFZA 4HL9A 2PN6A 3M2RB 4NCGA 5HQ8A 3BSCA 3SCIE 2GIFA 1CJTA 2CNLB 5F8LA 2XHWA 4CIOA 1R8CA 3WBZA 3DHXA 2MZSA 3H20A 1UMJA 1WHVA 1B7FA 2V6AA 1IKXB 5IC6B 3THPA 5A6PA 2RE1A 5F9NA 1FWKA 4ELUA 2NUUG 2JVOA 4J5OA 1P9QC 2IM3A 1BWVA 4DQSA 4LFBF 3BKFA 3FC9A 4OX7A 3TRGA 3D68A 1FFSB 3KLFB 1BC6A 1SV5A 2VFVA 4HDHA 3FK4A 5KFXA 3ET6B 1IKVA 2KYZA 3C14B 1NHVA 1RWVB 1NZ8A 1XTZA 2J9DE 4J9RA 4KGVB 3BYPA 1RT2A 2HBQB 1LWEB 4HACA 4ETXA 3FRYA 2XZTB 4R8UA 3BO2A 2BRLA 4WP3A 3O8WA 4K4XA 3BKTA 1WHYA 2MJNA 3HHLD 4QW8A 3MECA 2Y0SD 2H51B 3LP0A 4PQUB 1HMVA 3GR1A 2GQCA 3GLJA 1N54B 2FB0A 5B0CA 1C1CA 5KG2A 1RI7A 3I5CA 2XNRA 1Q5YA 3MPYA 1YRUA 2P6SA 5KFYA 2FUG9 2YNGA 5EGYA 1NBEB 3BH6B 3DM2B 3S6EA 1RXOB 4O3QA 2QO3A 2M52A 4F25A 3HSJA 1NKBA 2IJNA 2IHR1 2YNFB 2EXUA 1QD1A 3TZYA 3MD1A 1C0TA 3MPVA 2HMIA 5AT1B 4RWWA 2VPXB 1B0PA 2G0JA 3SQGA 4EI2A 2R7QA 2CJYB 2B9XA 1S1TB 1EKRA 4QWDA 1SPBP 1RWXB 4LFCF 3HM9A 1D9DA 4I2QA 2D7SA 1PAUB 2MKKA 4EWTA 1ZETA 5K8OA 5HP1B 2MTLA 3CVKA 1YZ7A 4ATNA 4LF7F 3VGTA 3EGWB 2AHOB 5KFVA 4TQSA 3AFGA 1HQEB 2OGUA 1UVNA 2M9KA 2E44A 5ETNA 3OSNA 2DNQA 3UR0A 2DR7A 3ELHA 2MJUA 5ADZA 2MKHA 3ENWA 1REGX 2XSJA 3JSRA 1ICEB 2VBWA 5M2PA 4NI2A 2BKOA 4ZVTB 4K4ZA 2IVMA 3GSIA 3MM5B 1LKZA 4MK9A 3J81U 3M9NB 3TR5A 1PO6A 1XNRJ 2Y1IA 1UAWA 1TR0A 2WOMA 2CJQA 4EUVA 4X4QA 2AJQA 1CC7A 4CYUA 4MFBA 4QU7A 5GVQA 2VJUA 3HT0A 1U1MA 2UXCF 5L1IA 3CDAA 4DFJA 3SV3A 1JX4A 3I0SA 4ENOA 4QOTA 2RB7A 4RNMA 2F4VF 1FNOA 2ZNZA 2HRYA 1EIYB 3MM9B 2H54B 2MQNA 4UF4A 1EETB 4WFBQ 1FTRA 2JNJA 2GHVC 3SFUA 1U47A 2MKCA 1LW0A 5F8GA 4P75A 3BQ1A 3H98A 3MUTP 3ZZRA 2D3O1 1HNXF 5KFHA 3NGTA 4TNOA 2UVVA 2JFKA 3VAHA 3HI9A 3CC7S 4LT6A 1XQIA 4ECTA 3QAEA 1HHSA 2J0XA 3N5BA 2YQ3A 1TELA 3H59A 2COLA 4AFFA 1D3WA 3MR3A 4QIFA 3PTWA 3IBWA 1KVJA 4DV3J 3E01B 2R9LA 5ETQA 5FD1A 1BXNA 1YTYA 4B3OA 1YJVA 4C0HA 2UVRA 3N28A 2HVZA 4A8XA 4PAAA 3UDCA 1KVIA 3KK1A 4P7TA 3NCPA 3KJVA 4J37A 3ENVA 4DR5J 1XR7A 4C3MA 5L38A 1EJ7L 4WIQA 4KYZA 4CO0A 1ULRA 1IM4A 2LXFA 3AY0A 2VG5A 1CJVB 2M4MA 3K58A 2QL7B 4WTOB 2KM8C 1CS4A 2RDDA 1S9EB 5GADU 2XLJA 4O3OA 1N32J 2MY7A 1HNXJ 5ETLA 4DFKA 2EG1A 2V69A 3MMCB 4OYIA 1QJHA 5CQGA 1LNQA 1RTJA 4TLRA 2HIQA 2NQPA 1RU2A 1RKJA 3VAKA 1T03B 1M1HA 1HBMA 1DJ0A 4I0WA 1C0UB 5HL7Q 3EZ5A 4MIWA 4P2SA 1VBZA 2OELA 3TX0A 2I5JA 4ZJLA 4RZRA 2ZZTA 3G86A 4RUAA 4IOCQ 4IQMA 3QRPA 4X2BA 2MQQA 2LU1A 3L3CA 1SKWA 2LVWA 1PYTA 2HRUA 2MMYA 3SV4A 2HYIB 3AQPA 2K3KA 5CYQA 1DTTB 2CIMA 1JNZB 2H3EB 1WC3A 5F3ZA 1OYDA 5HLFB 2XO6A 4KHPJ 3C46A 1UW4A 4ZOSA 1KC8T 4DX7A 2F7VA 4I6AA 2IA6A 4U7UD 4XDDA 5CZXA 1RU1A 4DSFA 3T3FA 1S99A 1VDHA 4AE5A 3BBCA 2DYAA 3DLEA 3OTEA 2KG0A 4ETZA 4GRSA 2HK3A 1S1VB 4Z37A 5JJBA 3D0GE 3L09A 2KM8B 2ZE2B 1H74A 3DRXA 3A13A 3W9IA 3AJDA 1U1LA 9ATCB 2DHGA 3NGRA 4DX5A 3QATA 2QA2A 3K5MA 2UUCJ 4PXCA 1RADB 5KT3A 1JXVA 5E3CA 4X64J 2GJIA 3NMAA 2B7BB 1UVJA 1FKOA 3Q8YA 5A2QY 1EQMA 3V4IB 2QA4G 5HJXA 3CCMS 2IYGA 2KFZA 3TEHB 4F0MA 3HVTA 1FRXA 1S0MA 4XPEA 2XMWA 1FVSA 1WEYA 5CYMA 3B54A 4EYIB 3FNNA 3HKZD 4ZJOA 1Q4RA 5CA5A 2H4YB 3B4DA 2CPYA 1NK8A 4ZVEA 1HKAA 1LXNA 3OSPA 3CCES 4HKQA 2ZC3A 5H9EK 1IUJA 2HAIA 2HHSA 4CP5A 3UE2A 3KHRA 5A76A 1LWFB 2FYXA 3CD0A 4AL7A 3Q8SB 2VOOA 3FUYA 5FDLA 1AROP 2C3OA 3DHWC 2DNZA 1KP6A 2RIJA 2ZH4A 2ZBPA 2IDLA 3TANA 5KOWA 3FCVA 2ZKUA 3NLCA 3MGJA 2FJVA 1L3UA 2HGNA 3EUNA 4I68A 4M5MA 2ASYA 1MMNA 4EFAC 5I3UB 1D8ZA 3OXFA 2YKNA 4JBCA 2HKEA 5D3GA 1E6VA 2CNNB 4QYRA 4B17A 1RUSA 1J5OB 3MWBA 1Q16B 2CJ9A 3MCSA 1MN9A 3DLLQ 2I8EA 4CT9A 4DR6J 4U7UK 1HBOB 2HQFA 3W8PA 4LR7A 3HJVA 3GFZA 1RAFB 2OFHX 2DVIA 2XB2D 4DV4F 5J2MB 5ETRA 4CTAB 4O3RA 3IGNA 4C8KA 4QU6A 3MM7A 1AA1B 1RBOB 4DZ6A 3IWXA 3GIRA 2BJ9A 2DXFA 2GMJA 3CDEA 1TUVA 3ZTSA 4DPYA 4WTYA 4RBVA 3F73A 4J9QA 4A8WA 4L74A 3HLUA 3RB6A 1RWKB 2QC3A 3KWMA 1N5YA 1YSJA 2XQCA 4HVZA 5KFGA 1O6XA 1M1KT 4YEAA 3PX0A 4RBTA 2L9NA 1L3KA 2IC3B 5J1NA 5GMEA 2ZH7A 1DTQA 1JNRB 4IUFA 3W2WB 2HHTA 3L7UA 1IKXA 4NYPA 3R9LA 2WVBA 2VZ9A 1KFSA 4ZPTR 2V68A 3EGVA 2HHVA 1CJKB 4NLVA 4P71A 2PA3A 4URGA 4IR9A 1RHUB 1X9SA 1JJ2R 3CC2S 3V6DB 1U7LA 3Q8PB 3JTOA 4IDKB 1JQGA 1BQNA 3L4BC 1ZM2A 3VR1A 2DH9A 2Q6BA 2QMUB 4YFUA 7FDRA 2LXIA 4J9NA 2HVDA 2XI3A 4O4RA 2QA4S 3AODA 2YWGA 3DDIA 3DFEA 3DRPB 1NB2A 3R7NB 3ETMA 3BB5A 5DJBA 2CWKA 2UV8A 4PPZA 2X51A 1FXRA 4WE1B 4DUZF 1NK7A 1F6TA 2VUGA 2IRYA 2GJFA 1L3SA 4O23A 2EBEA 3BPSP 4M94A 4KAIA 4I4BA 4AL5A 1Y7PA 4K4TA 3GU0A 1HW8A 4PQUA 2BACA 5L8RC 1YG0A 1ZOTA 2YKQA 2QGFB 3D5MA 2E66A 1F2GA 3EWGA 4RU2A 2ZOFA 4OLOA 3TAPA 3FFIA 3GV5B 3KK2B 5K8MA 1RZMA 2VKZG 5FIIA 5LM7E 3T1HJ 4UUWA 3A8JA 4NLRA 2C3YA 2WONA 1N34J 2EC0A 3ETOA 2JC1A 3MURP 3CC4S 3IG1B 1T3OA 2ALYB 4M1KA 4PABA 4B9LA 3ZZOA 4ZVQB 5DLFA 1S1TA 1FTCA 3PEJA 2RDJA 2GVZB 1YWXA 5B0AA 5CXTA 3RRGA 1SI9A 3EGZA 5KFFA 1VHFA 4B3MJ 5HP1A 5DQIA 2EK1A 2V8VA 1FXLA 1N0UA 2W9CB 2GGPB 2NXJA 4JI2F 1FEEA 5ETMA 1TL1B 3BN4A 3PO5A 1SQFA 4P6QA 1GMWA 3NBPB 5KG5A 1WHXA 4CWBA 4DF4A 3PW5A 1XK8A 4C0OC 4NEYA 2YKMB 3MM5A 5HVHA 2F9JA 2O67A 1WC6A 1QAIA 1LQ9A 1K9MT 4RU9A 2ZZMA 1NPPA 3KMSA 4CLKA 2ILZA 3HPOA 4C4WA 2IMOA 1ZM4A 1S1WA 3W5ZA 2A1BA 2UUAJ 5KFZA 3NGKA 2DNKA 4G1IA 1UWAA 4KGMA 2O3DA 5IV4A 3QZ8A 2YXLA 5KG3A 2ABYA 1SJFA 2BR0A 3C15A 1GNKA 1FI4A 5GMDA 5EDWA 4IO1A 1HWKA 1FEHA 1TZ0A 5SUHA 2YNHA 4X4NA 3R8YA 4DU7A 2RQ4A 1UPMB 3ITHB 4IFVA 2Z2YB 2DEIA 3EXCX 2DHHA 3KKFA 1HNVA 3FEXB 1T11A 1KQGB 5HBMB 3U7JA 4Q7AA 4X65F 4K4YA 3QPIA 2OTJS 3M6XA 2O66A 4DG1B 2BXJA 3C6UB 2LCWA 2J0QD 3CCUS 1XWLA 3PO4A 2DGWA 2CQGA 2MDAA 1S9FA 2AEFA 3MXHP 2VJVA 3GCWP 4R25A 5LMUJ 4F7VA 3O44A 4BC9A 1JJCB 2Z4PA 2MZJA 1YKWA 3HSDA 1XJWB 1UJ5A 2IJRA 2X1BA 3DOMA 5C42B 2XYHB 2HVIA 4P9SA 4ZPAA 5DDPC 1OWXA 2DISA 3OTDA 1UETA 4G1QB 4DR7F 2VDHA 3GV8B 1XR5A 5JXSA 1U1RA 1SH0A 2JSXA 2EW9A 2AT1B 1XIQA 2H5JB 1OSCA 5H1SV 4USTA 2Q43A 3LO3A 4JI0F 1KLMA 1Q1KA 3WC0A 2B8QA 2K1RB 4C8MA 1NSQA 2QT7A 4DBQA 1XMOJ 1RT7B 4WJBA 2H48B 5D0RA 1TVRB 5E0OA 4V1Ak 2HFNA 1S9EA 1UWBB 3RBZA 3UNYA 3PIPQ 1RKIA 3JSYA 3M2VB 1KWMA 5FLXU 2KB2A 3WIUA 4OYPA 1F2HA 2C42A 2VQEF 1RAHB 4EEYA 1YVFA 3IFEA 4ZPVR 1HNZJ 4PUOB 2HQGA 3MUVP 1T95A 4J90A 1SIZA 1X5TA 2AIRB 1T03A 3M6UA 4CO3A 2CVIA 1J2VA 1K1SA 3EM1A 1NAQA 4LQ3A 5FLXY 2PMHA 3DXBA 2OP5A 3DLGB 3HVRA 4RW9B 4OJ3A 2XCAA 2H1YA 3JTPA 1YJTA 4J7CA 2ZH1A 1NDKA 2YPYA 3MR2A 4QIEA 4LIRA 4PQAA 5LSRA 3KLEB 2BZ2A 4CLUA 1RQ0A 1DTTA 4C7QA 2E1AA 2O01C 3HHDA 4J9MA 4ZVSB 2FLOA 4DPOA 4JI0J 2WBMA 3GB0A 2HZCA 2CYYA 2ZH5A 3K5PA 1N33J 5HK4A 1DLOB 3CCTA 1J27A 2R2TA 5IT0A 2ZE2A 5F8NA 2GJ2A 2ZHOA 2G1HA 3SIPB 3TUPA 1TV6A 4MK8A 5E33A 2OPRA 1Q81T 2AKWB 2YTCA 4BHQA 1ELOA 4C8LA 1OQ3A 3UWTA 3SCJE 4UOFA 3NGDA 1YI2S 5D78A 5KFTA 2W7AA 1TKTB 3HFZB 3HHLB 2J8SA 1APSA 5D6GA 4G3IA 4CO2A 1HD0A 4B3SF 3DLHA 2JZ5A 2R8KA 2HS3A 3VV2B 4J9OA 3KLHB 5KFLA 1QSSA 4HR2A 3TI0A 2LQJA 2MQLA 1S1XA 2QN6B 3BGLA 2JEJA 1XBWA 3POTA 1XNQJ 4ELVA 4OHXA 3PX4A 2YX1A 1T9UA 2FLPA 2YQ0A 4PWUA 3HKWA 3RB3A 3G8QA 3RZAA 1U2CA 5LXRA 3ENAA 1Q8IA 4O3PA 3SZ2A 2HEKA 1U02A 2HSEB 2ASJA 1OJ4A 2V4QA 4QR1A 3QIPA 5LMNJ 1VK8A 3I56S 2EFOA 4YMEA 1MWQA 3DKDA 2IPOB 2KHDA 3UW1A 3IAS9 1P6TA 2EVZA 2E7VA 1VLYA 4JI3F 1R7IA 3MR6A 4W92B 2YWKA 2UUBF 2FHMA 2W4CA 3W9HA 1VYAA 2WSEC 4BC7A 2CFXA 2Z30B 2O1PA 4JP8A 3DLKA 3PDNA 5HMZA 1G2EA 2GO9A 3A3OB 2OPPA 5IM0B 3G6XA 2F1FA 4ID8A 2RH3A 4CZCA 2PEHA 4PG6A 2IVFB 2HFSA 1MWZA 2ZBCA 4D3HA 1N6QB 3PYGA 4WFXA 1J5OA 4CLPA 4DCPB 2MEWA 3MOZA 4NXMJ 3AT1B 2CNKB 4LF4J 4TKTA 2ATLA 1IKYB 1AUDA 3QWUA 3DNCA 5IT4A 1VRUB 1H7XA 1C1BA 3CB4A 3BZQA 4F2SA 4CM0A 4AXIA 4ZLLA 3KTQA 3MAQA 2BBEA 1Q5VA 2M0GB 3EXYA 1A6LA 2CNOB 3UFCX 4NMXA 4I7FB 1N5TA 2K2PA 4KC5A 3TWZA 3NNCA 2CJKA 5A8RB 3PEHA 4FP9A 1YBUA 1GXLA 2DNPA 3M8PA 1YIJS 2IDEA 2XNQA 1S0OA 5IV3A 3D6MB 5L1KA 3KHLA 2DRBA 3PKMA 2AX0A 3W2WA 3CD6S 2XGQA 3V4MA 4JV5F 3M8WA 1KOHA 1VOMA 4NLQA 2OD6A 5I3PA 4C11B 3QJLA 3B8HA 2JEGA 5IXUA 3ICLA 5B09A 4WZQA 4IDKA 1I51B 4ZCMA 4PCQA 1TU0B 2HGLA 1B3TA 3CMAS 3VZHA 4ZN3A 1TTHB 3LWMA 2ZWOA 2RRBA 1PC5A 4HDGA 4F0KA 1UL3A 1XC9A 4HH0A 1OYEA 3T19A 5KG4A 4NASA 3V2UC 2ADBA 3MPWA 4C8ZA 3WX4A 1S7IA 1RCXB 4MJKA 4RW6B 1Y3JA 3T9NA 4ZVHA 1JLFB 3R27A 1VQNS 3RW7A 1FJEB 1HI1A 1CVJA 9RUBA 4DOZA 2J9EA 3OR1B 4F2RA 2ZH9A 4NZ7A 1CEZA 3MCNA 3KK2A 1VC5A 3AA8A 1U1QA 4PWDB 3D1HA 3OTOF 3J7A1 3TNVA 4A8KA 2HFOA 2QJ3A 1HQUA 4JUZA 5JUMA 3IG1A 4FYYB 1X4CA 1WELA 3T6JA 2LDIA 1HARA 2LDYA 3K89A 3IRXB 3CULA 3J80U 4OZ1A 1RT4A 3MEDB 4OQJA 4YR0A 4JI5F 2GVZA 4B9VA 4GVBB 3A4TA 3FBCA 4HI1A 3TJ9A 2MSSA 4DR2J 4BDPA 4M5NA 2RQCA 1U49A 1TKZA 4KT0C 3R7SB 3E51A 3J80Y 3BBBA 4NA3A 2NCKL 3ZFVA 2W9CA 2ADCA 4I2PB 1W26A 4DS5A 1N36F 2A10A 1S6UA 1TL1A 1DBDA 5AXLA 3R5CA 2H9ZA 2VPWB 2HHXA 3MZIA 2M8DB 3MCOA 5IWAF 3JYTA 1SC1B 1G7CB 3IO1A 3QRRA 4LF9J 3SEOA 4JV0A 2OD4A 1QVFR 1TMJA 2M7SA 3KHGA 3IR7B 2CQHA 2HHPA 4JI8F 4C8NA 4DF8A 3KG0A 2W7OA 4KKOB 4OHVA 1I6JA 3TA1A 5KFUA 4NZ6A 2MQOA 1VCTA 1I94J 5DLGA 4A46A 5GAHU 2C2NA 3N0VA 3LWLA 4MKAA 5LXYA 3TJ8A 6FD1A 1U0HB 3SYZA 3AD8C 4ZIWA 4ECXA 3QT6A 1DRZA 5KFIA 3FEZA 1NDCA 1VRTA 3Q8QB 4OLPA 2UZAA 3TARA 4Q2LA 3LANA 2EFQA 3NKYA 3OFEA 1TAQA 4LSNA 3BGUA 1FK9A 3KOAA 3D3BJ 4ZVUB 1J5EF 3NCRA 3M9OB 2DXDA 3UD4P 2QFJA 2P5VA 3W63A 3OVBA 2BJ7A 2DO4A 3K8WA 4OIXA 5HBMA 5KT4A 1H6KX 2JOQA 4I6WA 3CCQS 2HHHF 1SJQA 3JQMA 1KTVA 4DN9A 1WD6A 2CAJA 1X9MA 2BM1A 2QYCA 4P52A 1U1NA 2LXUA 1BLUA 1AZSB 2LQ5A 1P1LA 3T6BA 4EZ9A 2Q79A 3ZC4A 1YBTA 2MQPA 4L76A 4G1QA 5KFDA 1EAYC 2RQMA 4DQIA 4KFBB 5F8IA 1S6QB 5CZVA 1JLQB 2RS8A 1VQ7S 2M8HA 2J6TA 2E1RA 2W2MP 2VC0A 4WCEQ 5CCLA 2IVYA 4DV0F 1VIXA 1KDNA 4KPYA 2R7OA 4DSLA 1RDRA 1M5OC 1NCLA 3M32A 1RABB 4LUBA 1R0AA 5D0HA 3M30B 4B3RF 1YK9A 2RMLA 4B3TJ 2K1RA 4ECVA 2AZ1A 2VFSA 5LJ5Y 1IBLF 1UVMA 4IG0B 2V2VA 1NK9A 2L3MA 1F0XA 2QG9B 1TKDA 3FSIA 1R27B 4FYXB 4KGZB 4AUKA 3M2VA 3WHIA 2D3ZA 5D8HB 4C6AA 2KT5A 2AV5A 4V19X 4PUOA 1YDLA 3FRZA 3PFEA 1DHMA 4A8MP 3DGPA 2HNZB 2BANB 3V81B 2RRAA 1VQ4S 2N82B 3QJJA 2M2BA 3C16A 4EU0A 5K9FA 4RW9A 2KG1A 5SZTA 4EBDA 3HFVA 3GCXP 1PAEX 2QA1A 3GTYX 3KJFB 1PBAA 1FFGB 3OR2B 2J5AA 3BBFA 3VAIA 5IQQA 1VQ9S 2NR0A 4ALZA 3US5A 2ZUGA 3OQ2A 2RHQB 3VAJA 2XHCA 2CPFA 5A0YA 2C2OB 3VVUA 3AB2B 1UTAA 3IGVA 2RJZA 2BW2A 4E8UA 5C25A 3AQOA 1VGYA 1K44A 1K47A 1S12A 2KL8A 5RUBA 1S72S 1RAOA 1X0PA 3OUYB 2IRXA 4OYXA 5FJ4A 1K1QA 2DJWA 2YVSA 3Q8RB 2BJEA 3SFGA 1O8BA 4DUYF 2J7KA 2ZEJA 1U2FA 2CVEA 1L3VA 1M5KC 3OHBA 4J91A 2ZVIA 3RRKA 3QBCA 3MPUB 3U1LA 1NJYA 2E7WA 4RW4B 3NNAA 1TKTA 3QO9B 1R8AA 2BE2B 5KT7A 3HHLA 2DT9A 2CQ2A 2P6TA 2UXBF 2W2PP 4N56A 1P1TA 3OXLA 1FRHA 4IRCA 1AYEA 1QSLA 3PJ9A 4TY8B 4CDIA 1U1PA 4KIAA 5HROA 4F4KA 1W25A 1JWWA 2AYEA 3TEGA 1V5VA 2E5LF 5LT5A 4LBPA 5L9XA 1S97A 2RU9A 4DWIA 4NLUA 5HN0A 4K4SA 2Z2MA 5KFNA 1AT1B 1HHQA 2V2ZA 3CJTA 1KONA 4WYLA 4K0KF 4FKXA 4DI6A 4Y2KA 1ZPWX 1BQXA 1JLBB 2CUYA 2KT2A 2FZCB 3OFGA 5HMXA 3DI6B 2QL5B 1DQAA 1QTNB 1FX2A 4J9VA 3M05A 4YP3A 3D9BA 1H0HB 3LP1B 4CH1A 2OPSA 2HURA 1S1UA 1XMQF 2KU7A 1PC4A 2XMUA 1G1XA 5J2NA 3HF5A 3ENQA 1RSCA 2BJDA 3CMES 4F4ZA 4CLFA 4PG7A 5IM0A 2QRRA 4YDXA 1FHTA 2ZHAA 4DLEA 3KLGA 1YGYA 1DZ5A 1WWHA 3TJAA 4CLTA 1RLCL 3I5AA 2EFNA 5G0RB 1RTDA 4JI7J 5BXIA 4USMA 1IKYA 3RAMA 2MXYA 2ZBIA 4DV7J 2AX1A 4LVOP 5HSPA 1T0TV 1VRUA 2YKOA 4S0MA 2VH7A 4PEOA 1PKUA 2PI4A 4H4KC 4HHHA 2AU0A 4K2JA 3CCZA 3THTA 3OFFA 2BW7A 4F3OA 4GKKJ 3GG0A 1WKLA 1S76D 3GE9A 4Y2CA 3JB9k 2F5GA 4N76A 3HHEA 4TYBA 1T3NA 1YJ9S 1UA1A 2VONA 4OZ5A 1OMSA 1N88A 7AT1B 1K73T 4FKYA 1WG4A 3CUNA 1I3OB 1OQ6A 2CPZA 3J7AN 3IWLA 1SCJB 1IKWA 3M9MB 1E6YA 4IFYB 1RISA 4OZ0A 3FVYA 4ED0A 3DU5A 2ZZNA 1NSPA 3HHNB 4TLQA 4K5RA 1FJGJ 1A9NB 2ZD1B 2XYGB 2DGQA 1Q78A 3I96A 3MAAB 2GMHA 3A8EA 5DG9A 3I9V9 1WKJA 2VASA 1ZTWA 2IY5B 3SSSA 4G65A 5F3TA 4H4OB 4JV1A 2W24A 4RPFA 2FD2A 4DHVA 4EO8A 1X0FA 1V9OA 1NXIA 1RTHB 4CLYA 4UT4A 2V8GA 5THWA 4JI4J 2AWZA 2W9BA 1OPZA 2BABA 2HNYB 1X4FA 1MLAA 2CDRB 1YBAA 4DV6J 1SJ4P 4RW6A 1FCAA 3CT9A 3RAXA 1Q7LB 4RR5A 8ATCB 1TL4A 5BYRA 2A2DA 5CHCB 3H7HB 5IFMA 1AW0A 2DD8S 3QQCD 2MGZA 2YX4A 2WB1D 1YLXA 2GCFA 2MZ1A 4ZPBA 1Y3KA 1SB6A 2WB4A 3KUEA 1R8BA 2I1RA 1QUPA 3TOQA 1S7HA 5E5NA 4LFAF 1WJ9A 2YH0A 5IOLA 1P9YA 4OI3A 4L3NA 4DMZA 1U6BA 1Z2LA 4PWDA 1Y4ZB 2DRAA 3DC2A 1QDUB 2XY5A 2ZKTA 4OYZA 3OFHA 4DFMA 2B7CB 5CAAA 5ITHA 1ZAXA 3WQPA 2WSFC 2MHEA 3MHYA 3B82A 1T9WA 3MMAB 3I0RB 3ILIA 4ZMMA 3IRXA 2RQKA 3KDNA 3JSMA 4P2FA 3H0PA 3BYRA 1RJJA 3KJQB 3MEDA 3CO0P 4LR9A 1RTIA 3DYAB 3PX6A 3MM6B 5CD4H 3QFWA 3TA2A 4OJGA 2W2NP 2QLXA 3T5JA 1RYRA 4B9MA 1GT8A 4ICLB 2XS2A 2G1DA 1IBKF 2YKPA 4QYZJ 4UQTA 2HW3A 3M8QA 4K59A 4KO0B 4F0HA 2VFUA 4NLGA 1UA0A 1GK8A 3IP0A 4PPDA 1M5PC 3ZZPA 4NL5A 1RTZA 3VAMA 3OPKA 1NK4A 1NPRA 1SC3B 2HGMA 1ZM9A 1RA6A 2XEXA 3HO1A 2B56A 2IYIA 2OJ3A 3KXDA 2B4VA 3QT8A 2W9AA 2D3OR 5KFAA 3M1VB 2W1BA 4LRDA 1JXLA 1TL7A 4ECWA 3EVWA 4U95A 2FJAB 3QLHB 2AZ3A 2F8MA 4KKOA 4ZITA 4DR1J 3BR9A 2AMCB 1R6YA 4ZLJA 3RUBL 3G6VA 5C5JA 5A8KB 5K8PA 2GQQA 5A8WB 1XERA 2B6AB 5HANA 4HH1A 5F0WA 4B9UA 4PZVA 3R1HA 4CH0S 1JLGB 3R2DJ 4NLWA 3PG9A 3ISNC 2B4PA 4RNFA 2KI2A 2DR5A 3HMJG 2B51A 4LREA 3AJ2A 3UN3A 4CLZA 3A1YG 1F9EB 1R0CB 1KHVA 3RBDA 2WW8A 1RWOB 1NK0A 3CF5Q 4UZCA 4DR3J 1SUQA 2B9WA 4LBHA 1FXDA 4ZVFA 3KLIB 4M8LA 3PHEA 2VV5A 3Q22A 4DQQA 3KUGA 2APOA 3G82A 2L9DA 1X4BA 3H5YA 3UQSA 5GAEU 1N56A 1N5QA 5IQ6A 2MKIA 4LF5F 2NXNA 1D1UA 2GHWA 2WCXA 3TAMB 3CJ5A 3PKYA 4GC6A 3C6TB 4FZVA 5HMYA 2XULA 5IS2A 4CQ1A 2JDJA 1NK6A 1WEZA 2E9RX 3H8YA 2QTWA 4KFBA 1ZH5A 1S6QA 3AD7C 3IMQJ 3TUJC 1SJRA 2DNRA 2HHUA 2HWIA 3CJSA 4KPCA 2GVDB 3ZTPA 2Z56B 1Q53A 1CJUB 3T1AA 5J2PB 1ZA2B 3HZEA 2GAHC 4F8RA 4KV8A 3MM8B 5CCMA 2LA6A 1WHWA 2OUGA 4L3KA 2PIIA 1FRJA 4EMDA 3I82A 4LFBJ 1ZBTA 1KFDA 1Q0NA 5KT6A 1T9YA 3NGSA 3D6TB 1I1GA 3PXGa 3IWNC 1NH8A 1RE1B 4L73A 1IR2A 1X4HA 4MTPA 3IR5B 2FJEB 4WP8A 3VAFA 5BYQA 2OEKA 1HNWF 1RT3A 4A48A 1KKHA 3CCWA 2B9YA 3OVSA 3EICA 3UNGC 1RWWB 3DGVA 4ECRA 1T9VA 2HFUA 4HTIA 2QSFA 4LF8F 3CE8A 5LSOA 3GZ7A 1Q79A 2EFGA 4X4UA 4DR4F 2HNZA 1PSDA 1TP7A 4MK7A 1DQ8A 4ER8A 3V81A 4NLXA 2UP1A 2J7UA 2SXLA 2WBRA 1TKXA 2NYIA 1Q7YT 1QLNA 4M5DA 2PI5A 1R8HA 3W61A 1DURA 2MQMA 2HNDB 2VFRA 3FZ2A 3GIIA 1NJXA 3D6FB 1IBMF 2A18A 1GFWB 1LW2B 1RT5A 3BPDA 3ZZ0A 3CGIA 1BUXA 2KKHA 1BY9A 2R42A 4HLBA 3P3DA 3SDEB 1TQLA 4NCGB 1DQ9A 2H4WB 4URSA 4QR0A 1MNEA 3WIVA 1WF1A 4EYHB 3DU6A 4O44B 1PJ6A 2BOPA 4LRCA 3PYEA 4USJC 1RACB 3ZTRA 2PDAA 1I5OB 2LFVA 3VZIA 1VQKS 2R7WA 4LF8J 2CPDA 4OX6A 2CQ1A 1IWAA 4LFCJ 3QWPA 2PC6A 2MLYA 4DR4J 4X66F 2GIRA 2QMXA 1KRPA 3BF4A 3Q89A 4RW4A 4LF7J 1JKHB 4P10A 1UJ6A 1V5IB 1SV5B 3UN2A 2B5JA 2BE2A 1KTQA 4ZDNA 5M2UA 1IKVB 4X4PA 3M8SA 1V3SA 3UDVA 4GVLA 1Q8BA 3V6JA 3W2VB 2JH3A 2E1PA 4TQRA 1LWCB 4WK3A 3DLBA 2DPIA 2P9EA 1RT2B 4NMLA 3CJ4A 2XO7A 4XO0A 2GZOA 4R0EA 2IIHA 4DV5F 1GX5A 5B0BA 1UJ4A 4F3QA 3MECB 3G71S 3RJMB 1WC5A 4EBCA 3SMZA 3LP0B 4OX9F 4F4AA 2BQ3A 4Y6IA 1N0VC 4LSLA 5J1EB 2EG2A 2G4BA 2QLJB 3UN5A
chains in the Genus database with same CATH topology
1RT6A 1FJCA 1FT8A 3DI6A 2XWYA 2YNGB 5DGAA 2ASJA 2AQ4A 4OZNA 3TX8A 5MLCV 4WU2A 2H5EA 2VBYA 2V4QA 4URQU 3G4SS 3CJ3A 5J2PA 4OZJA 4QR1A 4DR1F 3QIPA 2IA0A 1JK9B 1VK8A 2BYCA 1UEUA 3I56S 2EFOA 2V4JA 4YMEA 1VQSA 1HQUB 3OW2R 1UEVA 1TAUA 2KHDA 3UW1A 2D41A 3IAS9 2ACYA 1K8AT 2YWHA 3G8SA 4FNHA 3GYXB 1P6TA 4ZCKA 2WAQD 2EVZA 5D4LA 2EFVA 1U45A 3T9ZA 4I6YA 1VLYA 1Y5IB 3HVWA 4ZKAA 4JI3F 3K0JA 1R7IA 2DGUA 3N01A 4JOUA 2UV8G 3MR6A 4W92B 4C3KA 4DL3A 3OTCA 2FGCA 2UUAF 1JLCA 2YWKA 2HLUA 2UUBF 1F5BA 5DM6Q 2FHMA 1RT7A 2HMIB 2W4CA 4A8QA 4IG3B 1RT4B 2XMTA 1KQFB 3LP2A 1NKEA 4K4UA 1PGZA 2WSEC 1MROB 4BC7A 4C98A 2RU3A 1TVRA 2CFXA 1WACA 3UDLA 4IYQA 1U26A 1H98A 5DQGA 2O1PA 3DLKA 2R8GA 3PDNA 3D0IE 2ZNYA 1UWBA 2BUNA 5HMZA 3LH2S 2RS2A 1G2EA 4NCAA 2GO9A 1QVGR 1VQYA 4G6VB 5E3AA 2OPPA 3AH6A 1X7VA 3FZBA 2F1FA 3S7RA 4ZP6A 5IM0B 2KH9A 3TVKA 3G6XA 4ID8A 2RH3A 4CZCA 2PEHA 4PG6A 2IVFB 4DS4A 3T5HA 3E3XA 3PFOA 4KBIA 1TKZB 3MD3A 4M63A 1MWZA 2ZBCA 4PRFA 4D3HA 3F56A 1N6QB 4WFXA 4TY9A 1J5OA 1JLAB 2E9ZA 1GQEA 2CPJA 3HFKA 5D4PA 5K14B 1VFJA 1QAYA 3MOZA 3OJUA 2VBXA 2R2SA 3OXGA 4UOCA 4DR3F 3CCJS 3PACA 1NJWA 2AYMA 4TKTA 4FF3A 3GG1A 5KT2A 4OL8A 4OI1A 4O3SA 2DHSA 2F9DA 2ATLA 1IKYB 2ZJQQ 2J0SD 5E41A 1AUDA 5I4MA 3QWUA 3DNCA 3BEGB 2CQIA 5KFKA 4ES3A 4X4TA 2RF2A 5IT4A 1VRUB 2V9WA 4ITSA 1H7XA 1PILA 4XIUA 2R8IA 2L9WA 1C1BA 3CB4A 3BZQA 4BCAA 4F2SA 2UXDF 3DLGA 4AL6A 4Q44A 1CC8A 4AXIA 3NAHA 4CO4A 2NZ4A 3KTQA 4PKDB 2LEBA 4PG5A 3MAQA 2BBEA 1T05A 3MF5A 3MM7B 4FBUA 1U2RA 2M0GB 3EXYA 3JYTB 1A6LA 3C66A 3I6PA 4RX6A 1KSPA 2R7XA 4IKAA 5CH7B 1X4GA 4H4MB 3BQ2A 4QZVB 3C2PA 4TXSA 4QQBA 4WXOA 4QIGA 4USIA 3UFCX 1LW2A 4I7FB 5LSLA 1N5TA 2W8LA 2C28A 2GO8A 3UCGA 2K2PA 2QE5A 2YX7A 4BWJA 4KC5A 5LMUF 1REVA 2YNIB 1NU4A 3NNCA 3G6ES 5B0EA 5A8RB 2FHOB 2CJKA 1LFWA 3KLEA 2FY1A 1JLEA 1HD1A 3PEHA 1NJIT 1OO0B 4FP9A 2HS0A 3BS9A 3UD3P 1ZAVA 3AAWB 5AE3A 1GXLA 2DNPA 3M8PA 2QIFA 1YIJS 1M0SA 3I9ZA 4OFZA 5DETA 1ZM3A 4HL9A 2BRKA 2XNQA 2PN6A 3M2RB 4NCGA 4OI2A 5HQ8A 3BSCA 3SCIE 5F9LA 4YHHF 3PW2A 5L39A 1S0OA 5L1KA 2FLLA 2PSZA 4MFBB 3CJKA 4L6V3 4IFYA 5F8LA 3KHLA 2XHWA 4NCBA 4NZ0A 2DRBA 3PKMA 2R4FA 2AX0A 3W2WA 4CIOA 1R8CA 3CD6S 2XGQA 2F8HA 3WBZA 2UVUA 3V4MA 4JV5F 3DHXA 2MZSA 3H20A 2DR8A 1UMJA 1KOHA 1X4AA 3PW4A 1WHVA 2X1FA 1B7FA 4DSKA 5T14A 4XDCA 1IKXB 1FKPA 1VOMA 3H2UB 4NLQA 1DLOA 3THPA 5A6PA 2BQRA 4N47A 4K4VA 3FEYB 2M5YA 2OD6A 2RE1A 3I0SB 5I3PA 5F9NA 4KSEB 4C11B 2IBOA 5AXMA 2NUUG 4ELUA 3QJLA 2JVOA 5EWEA 3B8HA 1VRTB 4J5OA 1FD8A 2F3JA 1P9QC 2IM3A 5MAOA 4DQSA 2JEGA 5IXUA 1ROFA 4LSNB 3ICLA 1FK9B 4Y3CA 5B09A 5F8HA 2X1AA 4LFBF 4H4OA 3HJFA 4WZQA 1F5CA 4IDKA 2VKRA 4ZCMA 5GAHI 4OX7A 4PCQA 3T1YF 3DRRA 3TRGA 2V8DA 1MU2A 4QWAA 1XMOF 2HGLA 3D28A 2NUHA 3CMAS 4F67A 2VG7A 2J0WA 3I87A 1V6HA 3KLFB 4Q0BA 3EPIA 2C2EA 5EUHA 1FDNA 2DHXA 3VZHA 4DLGA 1BC6A 4ILMA 1SV5A 1IQZA 1LXJA 3EZUA 2VFVA 4HDHA 3LWMA 1SL2A 5KFXA 1IKVA 2Q3PA 2RRBA 1PC5A 4U67Q 2DIVA 2FIUA 1L3TA 2JC0A 4HDGA 2F8EX 1SJ1A 3FDSA 2KYZA 4Y65A 4NOHA 1UL3A 1XC9A 3GIJA 3DDNA 4HH0A 1HA1A 1NHVA 3T19A 1XTZA 1HNZF 2J9DE 2AYGA 1FA0A 5KG4A 2ADBA 3V2UC 4J9RA 2CQPA 1S9GA 3MAHA 3MEGA 3MPWA 4C8ZA 3MOJB 3WX4A 5F0UA 3WZ0A 4HYKA 1RT2A 1LWEB 4ETXA 3FRYA 4MJKA 4RW6B 4Q5VA 3KLVA 3QZ7A 4R8UA 3KLHA 1XN9A 3BO2A 3QAUA 2BRLA 3O8WA 4K4XA 1WHYA 2MJNA 1Y3JA 3HHLD 3T9NA 4QW8A 3KK3B 2FJWA 2NSBA 5DGBA 4ZVHA 2D3UA 4F4WA 4BS2A 1JLFB 1AFJA 3R27A 4RWXA 1XEZA 1VQNS 3MECA 2JHEA 3RW7A 2LU2A 3N9UC 1FJEB 1RWUA 1HI1A 2Y0SD 4LJMA 2QSWA 1CVJA 1WF0A 3LP0A 4PQUB 1HMVA 3GR1A 2GQCA 1N54B 4DOZA 2WHOA 2FB0A 5B0CA 2YWEA 3THVA 2J9EA 4FXWA 1C1CA 3OR1B 4F2RA 5KG2A 2ZH9A 3NCQA 4NZ7A 1RI7A 3I5CA 2XNRA 3I32A 3MPYA 4RW7B 1CEZA 2AGQA 1GH8A 2MKSA 2EKYA 4OI4A 1FNXH 2OSQA 3KK2A 4O3NA 4O4GA 5F8MA 1VMBA 1YRUA 1S49A 3QGIA 2YWFA 2P6SA 6FDRA 1VC5A 5KFYA 2Z2LA 1YJNS 2FUG9 2JWNA 3AA8A 4N5SA 1U1QA 1U8SA 2YNGA 5EGYA 3FSYA 4PWDB 3D1HA 4RW8A 4JI1F 3OTOF 4Q45A 3H2VE 3DM2B 3NAIA 3J7A1 3S6EA 3TNVA 4ED2A 1O5JA 4A8KA 2ILYA 1VS3A 2OPQA 1YJWS 2HFOA 2DGTA 3M32B 4J9PA 1R0AB 3GFYA 3DXSX 2QO3A 3LF0A 4O3QA 2M52A 3KK1B 4F25A 2VG6B 5F8JA 2Q6CA 1HQUA 5E3QA 4JUZA 1N48A 4X4SA 5JUMA 1NKBA 2IJNA 1BQMA 3IG1A 2IHR1 4I69A 4LF6F 1X4CA 1JMTA 3JTNA 1WELA 2YNFB 2DR9A 1QM9A 2CPEA 4WYWA 3T6JA 3PJWA 2DNGA 2LDIA 2ZVSA 1N33F 1HARA 3IXQA 2VG5B 2LDYA 1OIAA 1U1OA 2KYXA 3IRXB 1C0TA 2DNMA 3MD1A 5JVHQ 4FN5A 3CULA 3DYAA 3MPVA 5B7WA 2ZM6F 2HMIA 3CIZA 2HWHA 4B02A 4OZ1A 1MWYA 1RT4A 4GKJF 3MEDB 4RWWA 4OQJA 4NX9A 2VPXB 1B0PA 4ZP7A 1MROA 3CCSS 4YR0A 4JI5F 3SQGA 1HHTP 4B9VA 2N3OA 2R7QA 4ICLA 2B9XA 1S1TB 3ISZA 4HI1A 3W3SA 2MSSA 3CJ0A 1VQ8S 4BDPA 4QIWD 1N4LA 3NS5A 4QWDA 5E2QA 5C24A 3LALA 1FESA 4X62F 2RQCA 1U49A 5DG8A 4LFCF 3HM9A 1D9DA 1TKZA 2D9PA