3PHTA

Crystal structure of h74a mutant of helicobacter pylori nikr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
115
Chain Sequence
b'IINGYSSRSELVRDMIREKLVEDNWAEDNPNDESKIAVLVVIYDAHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nickel-responsive regulator
publication title Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 29
structure length 115
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3phtA01
2BJ7A 3BKFA 2CADA 2NZCA 2F1FA 2BJ1A 1Q5YA 3BKTA 2HZVA 2WVBA 3QSIA 2PC6A 3PHTA 2FGCA 2WVDA 2CA9A 3BKUA 2BJ8A 2WVEA 2BJ9A 2WVCA 3LGHA 2CAJA 2BJ3A 2WVFA 3OD2A 1Q5VA 2Y3YA 2HZAA
chains in the Genus database with same CATH superfamily
2ZJPQ 4CI0B 3D3BJ 3L95X 2E9ZA 4QOTA 1HWKA 2FJVA 2CFXA 4M5DA 5LXYA 3I5CA 2HVZA 1RCOB 2WRMA 1BD6A 4PAAA 2ZZNA 4Q2LA 3QGIA 2R8GA 2HFOA 3NBPB 4O44B 3PW7A 1SBRA 1VBZA 4HT7A 1RAGB 5K9FA 3D3CJ 2GV1A 2L08A 3O8WA 2OPQB 4X4RA 1VGYA 1W26A 2DH7A 4EYHB 4LFAJ 5D0RA 1LWEA 5E0OA 2IDEA 5GAGI 2QLFB 3OTCA 2MKIA 1KR4A 1RTIB 1TMMA 4C8KA 5G0RB 1RU2A 3H40A 3KLHB 2E1PA 3BDEA 3CCLS 1R0BG 2MTLA 3KMSA 4HH0A 2FLOA 3LUYA 2Z2MA 2JFDA 4J7CA 4ZIWA 3VCDA 2XB2D 4ZMMA 4JV5J 1PC4A 2GJFA 1YZ7A 3HHDA 2B7CB 2H5JB 4DSJA 2CJKA 3H5XA 3UPFA 4DFKA 2VBWA 3UI3A 4ZPTR 2LFVA 3UN5A 5DQHA 5CYMA 1S7HA 4NYPA 4CT8A 4CIOA 4ZOSA 5JVGQ 3IGNA 4B3OA 2FJEB 1FRLA 4N76A 2MQOA 1PC5A 3NWGA 4WFAQ 3J81Y 1OQ3A 1LOUA 2AD9A 4CLKA 4C98A 3MGJA 4F26A 2UVVA 1TK0A 4I0WA 4A8WA 2AEFA 5B0CA 3PFEA 1KLMA 2QA1A 3CPWR 1XN9A 1T0TV 4MJKA 1NPKA 1B0PA 1XEZA 4YR0A 2ZC3A 4GC6A 1OQ6A 3G9CA 3QWUA 2OEMA 4F3OA 1WSVA 3I55S 4IG0A 3DHWC 3H8YA 4LF1A 5HL7Q 1S1VA 5F8NA 2F8HA 1FE0A 3FFIA 2ILZA 2YQ3A 3CO9A 2DNNA 2VASA 3L3CA 5D6GA 2PA3A 3BBCA 4OLPA 1OY9A 1U6ZA 3A12A 2HK2A 1VQYA 4YUDA 2QG9B 3V6DB 2BOAA 1S9GB 2YNIA 1JLBB 5KFOA 3RB3A 2ZM6J 2UUCF 1MG7A 3Q8UA 3OJUA 3MM9B 2K7JA 4JI3J 3RB6A 3AHPA 4PCQA 1R8HA 4IR1A 2R7QA 3PYGA 4NLXA 4C11B 3OSNA 3D1QA 4TQSA 3E01A 4F0HA 5FDLB 1XMOF 1T03A 4Y34A 5H9EJ 2AEJA 2QTWA 3BYPA 1C4AA 1BQMA 2RT3A 4P52A 2Y1RI 3QGGA 2YBVA 4QZVB 1B3TA 1F1BB 4KAIA 3OL6A 3MEDB 3BGOP 1MMNA 2OPRA 4X66F 4FNIA 1Y7PA 5I3QA 4G6VB 3R7SB 3KLGB 1LNQA 1HQEA 3RU0A 2W4DA 4AFFA 4IRDA 4QYZK 2KTQA 3H20A 4ELTA 4CH1A 3LP0B 4LBPA 4Z7YA 4CQ1A 1JJ4A 3W62A 5THWA 4B3SF 3MM7A 5MLCV 4KGKA 2E5GA 5DS7A 2E5IA 1RT6B 2KJVA 3M8PB 4OZ2A 4DL0C 2DTJA 3K8VA 1NPPA 3TZYA 4HDHA 2KKHA 3FGVA 3GJRB 2FHJA 4FYVB 1JJCB 2AU0A 3PW2A 1NK9A 4DBQA 4DR7F 3IBCB 2D7SA 1MSWD 4WZQA 1CJUA 2Q79A 2HS3A 3EZOA 3IRXB 3EXCX 3HX9A 3OLAA 2IDLA 2JEJA 3C2PA 4IR9A 4OV6A 5DDQC 1TP7A 1RT2B 1BE4A 1UA0A 3AH6A 1FJGJ 2MKJA 2E5JA 1ELOA 1S12A 3BKUA 1OO0B 1WI8A 4U67Q 2OD4A 2UVWA 2H5IB 2IJNA 2XCAA 1MW7A 4I6YA 2FZKB 5A8KA 1SI9A 3TW0A 1LWCA 2VV5A 3CJ3A 2Y0SD 4G1QA 5D3GA 3KLIB 2BRKA 1N88A 4WYWA 1TL3B 2NUHA 4ZP9A 3H2UB 1SJ1A 1AW0A 3EJMA 2HFNA 5E7OB 1OSDA 2ZUAA 2XLJA 3M2RB 2WONB 2VJUA 3C15B 2CDQA 2B7BB 2JHEA 3KJQB 2YKNB 1LW0B 2VFTA 4X2BA 3R1HA 4WP9A 4X4UA 1IJEB 4M5KA 1G7CB 3AXMA 1NSPA 3DM2B 2DHXA 4X4VA 4GRSA 2WAQD 3CTRA 1SV5A 3M8SA 4LSNA 4ILRA 3EXYA 4TNOA 1D9FA 4LQ9A 4QIEA 4OHVA 5KFUA 4OX7A 8AT1B 4M5LA 1NDKA 5C42A 3A13A 1P9YA 3KJVB 2CQ3A 3OBIA 1NZ8A 2HHXA 4Q5VA 2ZEJA 4OHWA 5F8HA 3NKYA 4DQPA 2OPPA 2D69A 4OJ3A 5I4MA 3DCAA 1WI6A 2W4PA 1ULRA 4YDXA 2CPYA 2KXFA 3R5GA 3TQEA 4C0HA 5ETOA 4DPTA 3ZTQA 4P75A 2NLWA 4TVAB 1E6YB 3BSCA 4PG7A 2FVCA 4J9NA 2ZE2A 2VFUA 1REGX 5B7WA 5AJ3J 5DG8A 3N9UC 4RW8A 3ZTSA 1ICEB 1AZSB 2WOMB 1FDDA 4E2FB 3CJ5A 4OZJA 2MDAA 3L09A 5T7LA 4F4AA 2E7XA 1RA6A 2ZD1B 4YDDB 1YJ7A 2MQNA 2AX0A 2Y0BB 4CLUA 5K8PA 4WPAA 1VQMS 3NOCA 1HW9A 3TARA 3JS9A 4DV4J 3UCZP 4BCAA 5JXSA 1WACA 3MOZA 1NB7A 2YPZA 1RKIA 3PIOQ 3UFCX 2OGUA 1Q79A 2I5JA 2HHWA 2C2OB 1U02A 4ZJOA 3MCSA 4BS2A 2KFYA 3OR1B 2AV5A 5LJ3Y 2WSFC 3CDAA 2XO6A 4ES1A 4A46A 2GO8A 4NRTA 2VQEJ 5F9NA 2J9DE 9ATCB 3M30B 4P2FA 2UUAF 2IYIA 5KG4A 2UXCJ 2JC1A 3R7BB 2RUSA 1V3ZA 5K5MA 2G9OA 4QR2A 2HNYA 3V81B 5HVGA 3GIIA 1HQ2A 2BZ2A 2CQHA 1XMQF 1RAIB 3POTB 3B6BA 1FXRA 2M0GB 1KFDA 3AJ1A 3K59A 2BKOA 1QY7A 1VBKA 2GVDB 3BBFA 1HYSA 4TXSA 4YS2A 2HMIA 3TRGA 1DLOA 2YNHB 4NLOA 3ZZYA 5EWGA 1TV6A 3CJ4A 4DHVA 2AEMA 1XQIA 1VHFA 2RDDA 2V0NA 3FRZA 1UKUA 3FK4A 3UVJA 5HQMA 1TL4A 1I51B 1ZAWA 2XYPB 3VTIA 4B3TJ 4ED1A 1O8BA 1FFSB 3QLHA 1U0SA 2ZH3A 2ROPA 1U8SA 5KFBA 4ZN3A 2V68A 4DUZF 3HO1A 3T6JA 2CZVC 4DL6A 3JQJA 2D9OA 4J9RA 5A8WA 1UA1A 3GV7B 4U95A 4XPEA 4CCHA 2ZHBA 3BGRB 5J1EB 1WHXA 5EN1A 3C16B 2QIFA 2B51A 2R7RA 2V5HG 2JEGA 2VG7A 2VBXA 5KFYA 1HBMA 3QZ8A 5BJRA 1PJ5A 3TOQA 1KEKA 2R42A 3AFGA 1G6BA 3T1YJ 2D1CA 3Q86A 3KFWX 4I64A 2VPZB 4RW4A 4ECSA 1UWBA 1WF1A 1YGYA 1GH8A 1WC3A 3G82B 2E9TA 1IUJA 2BJEA 2M7SA 2MLZA 4CO4A 4PPZA 3D6HB 3ZZZA 3PJWA 2F4VJ 2DK2A 3BJYA 2KFNA 4C3LA 2RS8A 1SQFA 3NGRA 1URNA 2PMHA 2EW9A 4JI6F 3W5YA 3N5FA 2FJWA 1CC8A 2W8KA 2VFRA 5IOLA 4AXJA 1ZM4A 3ZZRA 3PM9A 3M7VA 4M95A 2Z58B 3EVOA 4QWBA 2KM8B 2C2ZB 3Q89A 5I3PA 1TAQA 1Y00A 2DNKA 1SC4B 1KQSR 4HHHA 4ES2A 3DGVA 1S4EA 1QVFR 4GC7A 4RUBA 4ZVQB 5M2RA 1CS4A 3RRGA 4NYZA 4MK9A 3NGDA 2ASLA 1TKZA 3DLBA 2F1FA 2V8GA 4NLYA 5BR8J 2E66A 3AB2B 3CC2S 4LSZB 5KG6A 1PSDA 3CXCR 3P5BP 1ZAXA 1RKJA 5D0GA 5KFFA 1KVIA 1ZPVA 3ETOA 3AQOA 4X64F 3H5YA 4GKJF 2ATLA 1HHQA 2ZH7A 3C19A 1RHUB 3OVAA 3CGIA 1BY9A 4ANCA 5AE3A 3A1YG 1PAUB 1EB0A 1RWNB 3PX4A 3BQ1A 4OYOA 4WWSA 3GILA 3H7HB 1NKEA 4NLQA 2DGQA 4B9MA 2GCFA 1UVKA 1VHIA 4DCPB 1RWWB 1UFLA 3TUJC 1V6HA 3GFHA 4K4WA 3T3FA 2C28A 1RXOB 4LBIA 3KK2A 3C8YA 1GEHA 2HQFA 2QGFB 1U2CA 2X1FA 3HZGA 3CD7A 4OI3A 3GPAA 2OPSB 4CLPA 1NK4A 2QLXA 3D54A 4JYAF 4EZ6A 1K0VA 3TVZA 3GYGA 1WKKA 2Z4PA 3IM9A 4TKTA 4NA1A 4WP8A 3JSMB 3I82A 2G1HA 3FZBA 1WTBA 4HT5A 1HL6A 2CA9A 3S7RA 3DGPA 1G3OA 4ER8A 4Y2AA 1XNQJ 3G87A 3BQ2A 2BQUA 5L46A 4JV0A 2FGOA 1TZ0A 2MZSA 3MAHA 4RW9B 1L3SA 2M70A 2KYZA 4RW7A 4ID5B 4TU7A 2MGZA 3F73A 3GJTB 5B08A 4UY85 2CQGA 2XZWA 3B54A 3AOBA 1QVGR 5SZTA 4ZJQA 3VZHA 2OP5A 2DO4A 4PKDB 2AHOB 3UD3P 1JLGB 4N56A 4OJHA 5ADZA 3ITHA 2N3LA 4JI1F 4C3MA 4IQXA 2NUUG 1SKUB 2ZBIA 2XYHB 5HROB 4MKBA 4W4MA 2CXEA 1HNWF 4WFNQ 4ZCMA 5GVQA 3C6TB 1FNOA 1NSAA 2EVZA 4RWXA 4QQBA 3BH7B 1VRUB 1U7LA 1RCXB 2DGVA 1RWXB 2W4CA 2EC2A 2FHJD 4ELUA 1P27B 2H48B 3G71S 2HS4A 2OI2A 3FQKA 4ID8A 4P74A 2DR6A 5D77A 4X4TA 1U1NA 4X4NA 2DISA 2W2PP 2GX8A 2CNNB 1S57A 2FY8A 2V2QA 3LGHA 1V5VA 2BV3A 2O67A 4Q7AA 4G1IA 3SFUA 1KKHA 4CLLA 5A0YA 5L1IA 4CM2A 3MPUB 2ERRA 2MY7A 2G0IA 3M32A 4DMZA 4JV1A 2IAJA 1F3VA 1WC6A 2IIHA 3SMZA 5DQIA 3UO0A 3BM7A 3QZ7A 1U0HB 2VZ9A 1BMQB 3N6MA 4TYAA 5IT0A 2KVQE 1HKAA 2HNDB 3M8YA 4AE5A 2CQ4A 3MI7X 2OJ3A 1FK9B 3HVTA 1E6VB 2DNZA 4JI2F 3M1VB 2DNPA 3PZPA 1TVRB 1SCJB 3HHLD 2D74B 1S9FA 4LF7F 1RJJA 3FKBA 4QIFA 4ITSA 2DGSA 4X4OA 2RQMA 4CH0S 1SIWB 1N36F 1YHQS 5CCMA 4ZP6A 3GIMA 4B9VA 4NLGA 1BGXT 3ET6A 1PJ7A 1UEVA 4RLEA 1U1MA 2NYIA 2UUCJ 3ENVA 3CCUS 2KL8A 1VBXA 2BMBA 3EGZA 1T9TA 2EG2A 2IC3B 2PE8A 3X1LB 4RO0A 3M2VA 1SXLA 4Q0BB 2YY3A 2QA4G 1XMOJ 1U6FA 2DIUA 4K4TA 1SIZA 4CYUB 3W5XA 3T1HJ 2DNOA 2H65B 3AXKA 2FDNA 4DV7F 4ZITA 5CYQA 1IKVB 1FRMA 3I5AA 3WX4A 3W65A 2NPIA 4O4RA 4X66J 2OEKA 2ZH4A 2XHWA 4N5SA 4S0MA 3SDEB 3MOJB 3FCVA 1B7FA 2YNFA 4C48A 3A4TA 2AW0A 2OTJS 2K8GA 3F41A 5G4DA 5U47A 3K5NA 4X84A 1R7IA 2RD5C 4KHMA 1RT1B 3QT8A 5DM7Q 1UETA 2BM0A 1IM4A 3W61A 1CJKA 2N4DA 2XGPA 2QA2A 2JJ4D 4PWDB 3OTOJ 4FDFA 1D9DA 4P10A 2RHQB 2BABA 1YDLA 4LFCF 1EJ7L 2GGPA 3KNGA 5HLFA 2NYHA 2HAIA 1EETA 4KR0B 4DR7J 3BKFA 1VQOS 1M1KT 2R8KA 3Q8QB 3N79A 3US5A 4DL5A 5DDPC 2VG5A 4DL2A 2XSJB 1Q16B 2VUGA 2H1YA 2DGOA 5LOQA 3S01A 3VVUA 5K8NA 2VKZG 1AXQA 3DLLQ 2LEAA 3U1NA 4OX6A 1X4BA 4QW9A 2Q66A 2GAHC 1MNEA 1YK9A 2QC3A 4PG6A 3VGUA 4JI8F 2V9WA 1Q8BA 2AKWB 4DU7A 3JSYA 3I32A 3LP2A 4PUOB 1XR5A 4DV3F 2FPHX 2I6WA 2MQMA 1WHVA 4BWJA 1NJYA 1FERA 1HBUA 4WE1B 1RT5A 1FD2A 2R2SA 4KKOB 3NMAA 5K20B 2KHCA 2A18A 5I3UB 4W90B 1CG2A 3QIDA 1WC0A 1S9EA 4JV2A 2QFJA 2GJ2A 3C46A 4OX9F 2GMHA 2HHPA 3Q2SC 4J37A 2YX4A 4H54A 1IVZA 1QSYA 1KTQA 2IMOA 5L38A 1C1BB 5J2NA 1JXLA 4WTOB 1U6BA 4UZBA 1RK8A 3QT5A 3AOAA 4KRWA 4E0DA 1RYRA 2DHAA 4DWIA 2W9CB 1F9EB 3KUGA 3O5TB 2NCKL 3FBEA 4J9SA 5K14B 2MLXA 1O6XA 1Y9OA 2CRLA 3EYZA 1HQUA 2KG1A 4DI6A 2J9EA 4QIWD 4DV6F 1YITS 1IXKA 5IZHA 5F8JA 2UUWA 2VH7A 4DPUA 4DSFA 3IFEA 3N01A 5KOXA 1FEEA 1IKWB 4MYUA 5KT5A 1RTJB 3TUPA 4R5PB 2F8MA 5FLXU 1HWIA 3AJDA 5A2QU 2CJ9A 1NEEA 4OI1A 1N5TA 3T5JA 2DD8S 1H3DA 2J6SA 3W66A 4YR2A 1WC5A 2XEXA 2KZMA 4ZVUB 2NQPA 1QM9A 2DGWA 4XDDA 2ZH6A 1AFJA 1Q78A 4K50A 1SL1A 4NEZA 5C24B 2AJ0A 1VQSA 1UVNA 3I0RA 3VAGA 4X65J 1P6TA 1RABB 5GAEU 1JMTA 1ZPWX 2B5JA 4HDGA 2VICA 3H5UA 5HQ8A 1IQZA 4NMLA 4KTQA 1RISA 3IAM9 2MQPA 5EGYA 3QATA 2R2TA 3CJ2A 1WEXA 2IBOA 2CPXA 2KO1A 3OXFA 4RBVA 1LWXA 3F44A 3CCZA 4YP3A 3TNVA 3DOKB 4J9PA 3TUZC 1S5ZA 4YHHF 4DQRA 2UVUA 1I94J 1M1HA 2AQ4A 4KV8A 3MR2A 2B56A 1D8ZA 1UZDA 1GMVA 3VVTA 2JOQA 1FTRA 1S6PA 4NCAA 4ECRA 2CQDA 3G8SA 3MEGA 3U1LA 2HFSA 1QE1B 2V34A 2XMMA 1HBOA 3VGTA 3DLHA 1HWUA 2XLKA 2CPEA 5HI7A 1HHTP 1S48A 2HRYA 3LW5C 1CJVA 4GVBB 5LMUJ 3TX8A 3MECB 2YH0A 3PRDA 4MTPA 1SVDA 2MZRA 1HI1A 2JH3A 1FVQA 4NI2B 3P6YC 4A8YA 3DOLB 3NMRA 2D3OR 1DTQB 1VRTB 3LA0A 2CQIA 3KG1A 3DRSB 2U1AA 5ITHA 3KJNB 2PSZA 3DLGB 2A1BA 3M8QB 4K7QA 5AT1B 3MMAB 1CJTB 3QSYB 3WQPA 2H3EB 4IUFA 2XGQA 1SPBP 3ZZUA 2C3OA 2EFNA 4RW6B 2AJ1A 4BDPA 4OZLA 1X4AA 1SUQB 4IDKB 1FKOB 4LRCA 3BB5A 2QL7B 3FC9A 2IMWP 2J6TA 2B4PA 1PYTA 1B99A 3KLVA 4LSLB 2JDJA 2CNOB 4RU2A 3JTNA 1T9UA 2MZTA 2MKYA 4PEOA 2XHCA 2LQJA 4ZPAA 3HHEA 4URQU 4DV2J 2J6UA 1G2EA 4ED6A 3D0IE 3IS9B 1QAJA 3SV3A 2HWIA 2BKPA 3TZZA 3PNIA 2R7XA 4AQYJ 3MFHA 1EP4A 1ZOTA 2CPFA 2Y1LB 2RU3A 2HGNA 1X7VA 1J27A 4OI2A 5HP1B 1EIYB 3UCUP 4A4JA 3G2XA 3K57A 4C3KA 3HJVA 4PPDA 1CQMA 2K7KA 3RBDA 5KFPA 2ZJQQ 1LQ9A 3UDEA 3SXLA 2V8HA 3KTQA 3Q83A 1RT4A 5HMYA 3IMQJ 4OYMA 1UPPA 2LP4A 1ROFA 1F6TA 2PIIA 2HW3A 4C8ZA 3IG1B 1T3NA 3W9JA 1HPZB 1U49A 1R0AB 2HNZA 5IM0A 2GZOA 3HM9A 1NAQA 1EQMA 3DHXA 1UWAA 3I6PA 2RKIA 4A8SA 2RF2A 3E3XA 4JP8A 1RU1A 3K5PA 4FYYB 2DGXA 1DURA 3B4DA 1Q81T 2POKA 1EKRA 1S6QA 1A7GE 4YY3F 3HT3A 3PR5B 2YQ0A 2RDJA 3MM5A 4ICLB 1IBLF 4HKQA 2E7VA 4HH1A 1TUGB 2HQIA 2IRUA 2H4YB 4USKA 1WTFA 4DV1F 4OV1A 2ZH9A 3KHLA 1X5PA 3M2UB 2BRLA 2UVRA 1U48A 4WFXA 1RAEB 1I5OB 2VONA 3AOCA 3ILJA 2UXDF 4JI7F 3ISND 3UN2A 3DNCA 2DPJA 1KLNA 1M90T 3SCLE 3T5LA 4URSA 3HK2A 1FI4A 4OJ1A 3BV8A 1TTHB 2BE2A 1ZS6A 5ETVA 3OUYA 2PN6A 1AUDA 4MFBB 4QJVA 2V67A 1IBCB 3JAMU 5CAAA 3DI6A 4DUTA 2GNKA 4H4OA 1IWAA 3TP2A 3PEHA 2DXDA 1S6OA 4ZKAA 4Y2CA 5KFZA 2MJNA 4QU6A 2E5LF 4K59A 2CPHA 2JNJA 3QPIA 1GXLA 4LF4F 3CULA 2IA0A 1R6YA 3HHKA 3ENAA 4ERDA 3GLJA 1I3OB 1UVLA 5F41A 2DNRA 3PYFA 1S4FA 4YOEA 2UUBF 4O44A 3H42A 4IH7A 3NGTA 4DR2F 2XC9A 3Q8RB 1BQMB 1T3OA 3H25A 3KKFA 2HHVA 1PCAA 5F8GA 3A8IA 4K0KF 4B9SA 2FVSA 4OYWA 3W3SA 1PO6A 3IWNC 3FMWA 2JEIA 2XS7A 4CLYA 1NK5A 5GAGU 4DR4J 1RTIA 3W2VB 5G0RA 1WSRA 4UT4A 2CJQA 2K1RA 3OQ2A 1RHJB 4MIAA 2KI2A 4KBIA 4EBEA 1KQKA 1CQNA 2L3MA 3RTVA 3R6LB 4B3RJ 4AL5A 1U25A 3F56A 4LQ3A 4JUZA 5M2UA 2B9EA 3RRKA 3I0SB 1H2VZ 2AGOA 1FHTA 5AXNA 4LF5F 4DL4A 1DRZA 1NK7A 2FJDB 2JL9A 1IN0A 4DX8H 4ECWA 1CJUB 4P7TA 1SJQA 2F9DA 4K4UA 3AODA 3KLEB 1T7PA 3RBZA 3MD1A 3PEJA 2ZDPA 4DLGA 4PABA 5ETTA 4CNZA 4NXMF 2V4QA 1SC1B 2DY9A 2YKPA 3V4MA 2AZ3A 3GIJA 2BBEA 4KGXB 3TJAA 2RSQA 5IC4B 2DHGA 3TA2A 5B0EA 5CABA 1QSSA 4MKYA 1RAAB 5IV3A 3UD4P 1IBKF 4CTAB 2ABYA 1JLAA 2G2YA 2R7VA 3H4BA 4O0NA 3PCOB 2HWTA 5CA5A 1J5EF 4FKYA 2AF6A 1NRKA 1KOOA 2Y1JA 3HULA 3ZNJ1 3HHLB 4DPYA 2UU9J 5CQGA 5F3ZA 2EG1A 3V6DA 4WFYA 4Y65A 4JI2J 4CNYA 1YBUA 1S9GA 5A76A 2YNGB 2U2FA 1JLBA 2QV6A 1SKSA 2HHSA 3ZZ0A 3KK1A 3MM9A 3QFHA 4FYDA 2C2KB 5IWAF 2ZH8A 3WC0A 2IVYA 3OPKA 3SZ2A 4DG1A 4I4BA 3HLUA 1WD6A 5DLGA 4F2RA 4C11A 1U8WA 2YH1A 5FDLA 1M5SA 3A3NB 1JLQB 2DBBA 2YWEA 1RBAA 2RHSB 3CB4A 2CNKB 1KDNA 3MEDA 4NX9A 4H4KA 3L9ZA 4ZA1A 1HNXJ 4K5RA 3V5RA 4NPOA 4RBTA 1S59A 2I9SA 4YB6A 5KFGA 2UV8A 5ETNA 2E1MC 4EUVA 3ZZPA 3LP0A 3WX8A 2XM3A 3IR6B 1T05B 4QW8A 4IFYB 2XNRA 2XMUA 3VF0B 4I68A 1RT6A 3M8PA 2B43A 5FIIA 3ADAC 1L3UA 4YN3B 1C0UB 2F9JA 2RH3A 1BQNB 1R31A 1UZHA 3HJFA 2UP1A 3TYTA 2PA8D 4FYXB 2CADA 4RX6A 4ZVGA 3GG1A 4ZHRB 1T9YA 4LFCJ 2BJ8A 4IH6A 2V4JB 1HNVA 3MHYA 2VPWB 3UR3C 2DY1A 2QZ8A 2KHDA 3G6VA 5KT2A 2WVFA 2XO7A 2V50A 4C4WA 2HHHF 3I9ZA 2Z30B 4I56A 3GV5B 1NK0A 3CC4S 1YIJS 4HI2A 3DKDA 4OL8A 1NNDA 3K17A 4NCBA 3G96A 1YBAA 4C8OA 2MQQA 1QLNA 4KT0C 4ZS6A 1JWWA 2CVIA 2MXYA 3I87A 2MZ1A 1K44A 2BJ7A 5E3RA 1Q4RA 3NRBA 2AJQA 3PFOA 1B7YB 1Q8IA 1T11A 1FDAA 1SH2A 3I96A 2BJ9A 3NGKA 1NKBA 4ECZA 4B9TA 5A6WA 4PQAA 4EMDA 4Z2XA 1R8CA 1EHWA 3KLIA 1AYEA 4PQUB 1TL3A 3IGVA 1IBMF 3Q2TC 4DL3A 4K2XA 1UFKA 1RGVA 4C8YA 1K1QA 1XR6A 5MAOA 4DPXA 2VPXB 3T41A 1J5OA 2EI5A 1X0PA 4HR2A 4OX9J 2WONA 3C15A 4LF6F 2PO4A 4O3QA 4TY8B 3CMES 5H9EK 2YKNA 1LW0A 2DNYA 4NLTA 3MXHP 4BWMA 3H98A 2SXLA 5IQ6A 3S6EA 4MK8A 3HXMA 1FFGB 3DM2A 3M6VA 2GS8A 5BXIA 3IP0A 2OMOA 1LV5A 2WSEC 4IO9Q 2AP6A 1LWFB 4DV0F 2WVEA 1DBDA 3E2EA 1MMLA 3I5BA 1DLOB 3T5HA 1SJ3P 2KYXA 3U27A 1CPZA 3PO4A 4DV6J 2CZ4A 1JB0C 3KJVA 3D0HE 5AXKA 1BHNA 3PX6A 6AT1B 4QCLA 3EZ5A 4URGA 2CG4A 4KO0A 3QAUA 1LW2B 1HBNB 3FEZA 4LF9F 4O4GB 3OL9A 2VF3A 3QO9B 4JI4J 1TQLA 2B9XA 2IPOB 4M94A 5I42B 4N47A 4DZDA 1BLUA 2WB1D 3V6HA 4QU7A 3NCRA 4CO1A 5CZVA 3J80U 4DX6A 4WK3A 2QEXS 1GK8A 2NXEA 3LQVA 1E6YA 2HPUA 4LRBA 1NJXA 2GQCA 4B3MF 2IRXA 3TZWA 1JJHA 1AZSA 2WOMA 3KMQA 3T9ZA 1MU2B 5DJBA 1VQKS 3AJ2A 2ZZMA 1VOMA 2J0SD 1N4LA 3CJQA 1L3KA 5KOWA 2Y3YA 2GIQA 2ASDA 4WP3A 4NRUA 1NHVA 3LGNA 4JI0F 1RHKB 3CIMA 3L7OA 4O0IA 4I2QB 4CLWA 1DARA 3LALA 5HBMB 2DR5A 4Y6IA 4ZCKA 1PJ6A 2W7PA 3MPWA 4KE5A 3PVXA 2G2ZA 3Q8SB 3OR1A 1KN6A 2EBGA 1OY8A 2ZNZA 4CT9A 3WC2A 3PR4A 1RT7B 2XSFA 2FLLA 1JXEA 1SH0A 4WFBQ 3RRHA 4DR3F 3M30A 2QLBB 5LMNF 4PXBA 1NLKL 3QRPA 1QAIA 3ZZTA 5J2QB 2W2NP 1OIAA 5D4PA 5HMWA 4NXNF 4ZPWR 1V5IB 4OIXA 3D0GE 2RQ4A 3LP1B 4N7TA 1WOPA 3V81A 5E3AA 3OVBA 1C1CB 3POTA 2L41A 1DHMA 2I2YA 4RUAA 4LRDA 3P4UB 4ECTA 1VQ7S 2N3OA 2GVDA 1X4GA 5AE1A 1VI7A 5B0AA 1VFJA 2NSCA 3KUHA 4ECQA 2YNHA 3OTEA 5FD1A 3MM6B 1RZMA 2W9BB 3NAHA 3GG0A 1HIYA 5KG5A 1H7WA 3VGSA 1AFIA 5IC6B 2YWWA 1V3RA 4LVNP 4CM0A 4FYWB 3BN7A 1FT8A 1DQAA 4ZJLA 1X4FA 5E3QA 4PRFA 1REVB 2DPIA 1SC3B 2DH8A 4PZVA 3V6KA 2UXBJ 4R8UB 5FLXY 5J2MB 5A2QY 4I6AA 5ETRA 1S72S 5KFMA 3U1MA 4K8RA 1U1QA 1PILA 2A6OA 1RAOA 1CC7A 2B4UA 3EWGA 2W2QP 3PG9A 2CUYA 4L3NA 1NDPA 1RWOB 4WFZA 1XMBA 3WDOA 1HI0P 2BW7A 3GWCA 5J1EA 3C16A 1T02A 2HKEA 3NWRA 4DPOA 2AYBA 1RWMB 1FF2A 1IKYB 3JTPA 2HVIA 3MR3A 3MCNA 4FF2A 3SIPB 4LFAF 2EFQA 3BO3A 4O3RA 3CWJA 2KH9A 2EPIA 4AT1B 3QT6A 2O01C 3G82A 4LT6A 3HI9A 1KHWA 1C4CA 2J0QD 3IR7B 2BA9A 2JEFA 4ES3A 2VD3A 1HARA 3LAMA 1RYSA 2ROEA 1KD1T 3FJ2A 1KC8T 1PYSB 4F8RA 1DQ9A 3MR7A 4JV5F 4F3QA 1UCNA 5CD4A 4GO5X 2BR0A 1OSCA 2VKRA 4OYZA 1YRXA 2XY5A 3J81j 2KXHA 5KFIA 4USJC 3AB4B 1HWJA 2FVRA 1KQFB 1JNRB 3R5BA 2Q6BA 2KJWA 1NUEA 3IWLA 2NXNA 3BH6B 4OHYA 1ACMB 2XZDB 3QWPA 2LA4A 2DT9A 3JQMA 1S1UA 2QE5A 4MT1A 1X60A 1ZA1B 3PO5A 4P7VA 4ECUA 3R5DA 3RW7A 2DR8A 3DRPA 3N4WA 1VRQC 3CDWA 3SFGA 2C2NA 5LXRA 2ZKTA 1TL7B 2IAJB 4NZ0A 2LXFA 2WTFA 1JLEB 5DLFA 1QD1A 3HD2A 5GMKa 1UMJA 3W8PA 4HVZA 1L5UA 3H2VE 3AY0A 3ISZA 1TUVA 4G65A 3B82A 2W7AA 3CCRS 2ADCA 2V2VA 3JB9k 1N48A 3UN3A 2FZCB 2OPSA 2ZM6F 2FGCA 3OJSA 1ZM2A 4OI0A 5EWEA 3ETMA 4JI3F 2X1GA 3QMQA 2BE7D 3ET6B 1X4EA 3JSMA 1YZ6A 2GIFA 1RSCA 4LFBJ 2ZBCA 2J76E 3VAJA 4HYKA 1UW9A 4LF4J 4U8YA 3D2WA 4KHPJ 1K8AT 1NCLA 4F2SA 3RB4A 1WG4A 1S99A 3THTA 1FRHA 4RW9A 4I7FB 4K4SA 3HFKA 3M2VB 2B0GA 4KFBB 4ID5A 2O5DA 2A10A 1KVKA 4M5NA 3M6UA 1Y4ZB 3MUTP 4FF1A 4DR2J 4FXDA 4R25A 2ZH5A 3K8WA 5SUHA 5A6PA 4I2PB 1KWMA 1XNRJ 5IFMA 2E1CA 1JLGA 2EK1A 4R0JA 3N6LA 1OS5A 1HHSA 2I8EA 3VZIA 4ZPCA 1U2FA 3OD2A 2LQ5A 5HROA 4K5SA 2FHOB 2JLFA 3C6TA 4QIGA 2ZNYA 1JKHB 3TR5A 1VRUA 2J8SA 5HJYA 2Y1IA 1FCAA 1GNKA 4I69A 2HK3A 4ELVA 1S49A 2ZJRQ 5EX3A 3P3DA 3MMCA 5LSOA 4DX5A 5A8RB 2NSBA 4E98A 2EK6A 3FSXA 3NAIA 3GSDA 3HVRA 3BO2A 1FJEB 2JRSA 2GMLA 3IC1A 3RUBL 3SI8A 2LU2A 1VIOA 1TK5A 1T9WA 1RADB 4ENOA 3QAEA 5IS2A 2EFPA 2QMXA 1GX6A 1FJGF 4OMFG 1H6KX 2VG5B 1Y11A 4F4YA 1Q0NA 4M8LA 2LVWA 5E3CA 3D66A 3JYTB 4NA3A 2YQ1A 2BDPA 3VAFA 2HBZB 4G3IA 5HANA 2RJZA 1HR0F 4NZ7A 1N5YA 3LO3A 2OMLA 4KQZA 2QT7A 4NL5A 1U0HA 4XO0A 2HNDA 4DEZA 1D8YA 3K5MA 1RT5B 5KFNA 2XI3A 3D5MA 1FK9A 2C2EA 3QBCA 2MSTA 4WKRA 2HGLA 1J5EJ 1RBOB 1RI7A 3BS9A 2R2RA 3LWLA 2GHVC 4N41A 1G1XA 1A6LA 2W2OP 3NS6A 3WIVA 5ETKA 3HT0A 4KGZB 3D1OA 4DR1J 4IYQA 3JAMY 3MAAB 3FEYB 2Z0GA 2DHSA 3CNQP 5L39A 1TL5A 3RR7A 4R0EA 2A0FB 1DTTB 3CCTA 2Z8QA 3U02A 2WVBA 2FHKA 3UDLA 9RUBA 4ILMA 4U6PA 4FF3A 2BJ3A 5JUMA 5DRKA 4LIRA 2IC3A 1XC9A 2PGCA 3DRYA 2V8PA 1LFWA 2HVDA 4ECYA 4HTJA 1L3TA 4FVCA 4Q0BA 5DETA 4RNMA 2A3JA 1FWLA 2ATCB 3Q0AA 5DZ6A 4DUYJ 1S1WB 4B9LA 4NLSA 1TAUA 3NOGA 3LTOA 4UY8T 3TAQA 4ECVA 2HLTA 1IKVA 1WNEA 5F8LA 1RTDB 3GTYX 2KU7A 2VOPA 2KT5A 1BWVA 2VDIA 3PJ9A 2HHQA 3SDEA 2VQFF 3RG6A 1QTNB 3AA9A 5DDOC 2E9RX 3K89A 3LAKA 4DV5J 1RT1A 1RT3B 4JI5J 4CZCA 4YMEA 2EFGA 3BR9A 3HMJG 4PWDA 2BXJA 2B5JB 5AJ3F 1K47A 2CQ0A 4ANEA 3ENWA 5HMXA 1X0FA 3BPSP 2D9PA 3IBFB 4PWUA 2OAUA 3GV8B 2DH9A 2DEJA 3GR1A 3KUEA 3G6XA 4LF8F 2XSJA 1FDNA 2QO3A 2PI5A 4DV4F 2JWNA 3KYLA 1X9MA 1X5OA 2Z2YB 1OPIA 2GHWA 4WCEQ 2HHHJ 3RAXA 2MKCA 1X8DA 2HVEA 4FF4A 4LREA 4X4SA 4HACB 5F0UA 3UNYA 2RS2A 1NHKL 3I4HX 3ZO7A 3MUMP 4L6V3 1SKRA 1K1SA 4XTTA 1PG5B 4CWBA 2H4WB 2OTLS 4WE1A 1CJVB 2OSRA 3TA1A 2GW8A 2VQEF 1WDTA 4KKOA 1OYEA 2M3DA 5I3UA 4Y2IA 2CIMA 3MPVA 1FJ7A 2UXCF 1FXLA 4LUBA 2ZVIA 2DGUA 4OYIA 3FZ2A 1GX5A 4LR7A 3QJLA 3W64A 3Q8VA 1PBUA 3BQ0A 1C1BA 4IOCQ 2K06A 3OL8A 2HHTA 1YVFA 5BYRA 1HNZF 3THVA 2MB0B 1VMBA 4LF6J 3GCWP 1B70B 4WU2A 5HVHA 5K14A 4K2JA 4Q43A 1TL1A 3V4IB 4O23A 3PHEA 4H4KC 4IG3A 3ZTOA 1SB6A 1VC6A 4UOGA 3MM8B 7FD1A 4IRKA 1EZZB 4HEA9 4OYBA 1FE4A 2BJDA 1N32F 1RHQB 1IKWA 3WZ0A 4QWEA 1RTJA 4R5PA 3FUYA 4B3TF 3T19A 2M8DB 3VGVA 1C0TB 3IR5B 1QJHA 1DFDA 4OYPA 4QWAA 2ALZA 1UFWA 3OTDA 1W2IA 4NOHA 5EX0A 4CLSA 1RQ0A 5C24A 3W1YC 2PFFB 1LK5A 3NY0A 1LK7A 2QLWA 1S79A 4ANDA 1HMVB 1EP4B 4QPXA 4PWWA 2MPUA 2BW2A 3FBCA 5GAHI 2P6SA 2KXNB 1S0OA 3NP5A 3J7YI 1VJQA 2Q43A 3FRYA 3IM8A 1N0VC 2GHPA 2VG6A 1YX2A 2LQBA 1NU4A 5LJ5Y 4ZLPA 3BDPA 4B3MJ 2QRRA 3RR8A 2ACMA 3T1YF 3LWMA 4C0OC 1TMJA 3DOKA 4P72A 1ZBTA 2OFGX 1YLXA 2ZKUA 3TAMB 3L4BC 1MWZA 2UV8G 3BR8A 3ILLA 5GADU 1ITPA 1FRJA 3ENQA 2MZQA 3M4XA 3OXGA 2D41A 1FWPA 2F4VF 2CJAA 4H4MB 2LLZA 1X31C 4YQWA 3O1LA 4C9DA 3G6ES 4DCOB 4JI0J 1QE1A 1OJ4A 2HRTA 4X62J 4IOBA 2F3JA 3Q8YA 3O44A 3LH2S 1RHRB 3KK3A 3FBBA 5H9FJ 4AYBD 4OQJA 4GVBA 2NZCA 3MECA 3BKTA 1SL2A 5CYJA 1GTEA 3R8YA 5LT5A 1SKWA 3O3LA 5L1KA 2ZWPA 1VRTA 3CW2C 1TKXB 3CJRA 2M88A 2AWZA 3DRSA 2KT2A 3H5SA 4MMOA 4TY9A 1FVSA 3MM5B 4M5IA 5BR8F 3DLGA 3FNNA 1RLCL 1KBRA 2ZC4A 3WBZA 2XMVA 3MMAA 1MN7A 1CJTA 1UVJA 1T94A 4Z37A 4C8MA 1HFEL 4CO0A 2CQPA 3EPIA 3CJ0A 4QPTA 4RW6A 1EKSA 1IWGA 1FESA 3HF5A 2VBYA 2A2CA 3HD1A 2BKNA 2FTRA 4IDKA 7FDRA 2D3UA 1FKOA 3EM1A 2QX0A 1VC0A 3K58A 2DGTA 2RE1A 1WOSA 1T9VA 4FBTA 4LSLA 1OPZA 1AB8A 3BGLA 5KFCA 1MN9A 2G1DA 5T14A 3I9V9 1H7XA 4RKUC 3OUYB 1HLWA 2KN4A 1P1TA 3FQLA 5D0HA 4DX7A 3EDRB 1UVIA 1RWPB 1WKJA 3IS9A 4H4OB 4C97A 1SH3A 4FBUA 4ZPDA 1F2GA 4FS1A 5KT7A 3F0NA 2G13A 2MHNA 5L9XA 2QYCA 1XNQF 3IA0A 5HP1A 2OO4A 4UOCA 4C8NA 4ZP7A 1HD0A 3MEEB 3GJQB 1Y5NB 1JLCA 1XTZA 1OMSA 3J80Y 1IKXB 3AQPA 2NS1B 4DU8A 2VC1A 5C5JA 2XMKA 1FKAF 3DLEB 1JJ2R 1JLFA 4OJGA 1ZZFA 1K9MT 4LIWA 3OFGA 1RUSA 3M05A 1R89A 4FN5A 2ZH1A 1VQPS 3PHTA 3G8QA 5DM6Q 5KFJA 4J5OA 2E44A 5IQQA 3OT9A 3PKYA 5JVHQ 4ZIVA 2BOPA 3EZUA 3IG1A 3MMJA 5L1LA 3AD8C 4P2SA 4M5GA 1HPZA 5KTQA 4PXCA 3ZFVA 2ASJA 1SC6A 1T95A 1R0AA 1D09B 2K1RB 3CCMS 1VQ6S 3RAMA 2M8HA 3D6TB 2CAJA 2Y9HA 5CZXA 4DDFA 3C3LA 2MMYA 3A8EA 4Q45A 3R2DJ 3C14B 3R7NB 4F50A 4RNOA 1MROA 1BWEA 2CQCA 5KAKA 5J2PB 2F7VA 5HMZA 1TKTB 1VQ9S 4U7CA 4ICLA 3MAQA 4MAKA 1KONA 4IFVA 5LSRA 3T5KA 4DZ6A 4KGMA 1Z2LA 2XS5A 3TZXA 3OFHA 4BLGA 3RBXA 2V2ZA 4NCGB 3PYEA 4F67A 1U47A 4ATNA 1NM2A 3SQGB 3M2UA 3R97A 2LU1A 1WC1A 1JNZB 1TELA 2CQBA 1NDLA 1NB2A 1LKZA 3BN4A 3QNWB 4HHJA 1F5BA 1CLFA 1F5AA 1JLAB 4XAKA 1X4HA 3OR2B 4YEAA 4MFBA 1NPRA 1N8RT 3VAKA 1QUVA 1EQ0A 3MMBB 2VIHA 3FEXB 2OHDA 2CWXA 2Z2ZA 4EEYA 1I6JA 2MQ8A 5F3TA 5B0GA 3KK1B 3LF0A 2B9WA 3TAPA 2LXUA 3PY8A 4DG1B 3CJKB 3CMQA 4CH7A 1VC5A 5DQGA 2B9YA 3KNAA 4N77A 2EXUA 5HJXA 3CCES 4B3SJ 3CT9A 4KPCA 3T1HF 1M5HA 2HBYB 2D3O1 5F0WA 2HG4A 3H4DA 4DFMA 1XK8A 3C6UB 4I6WA 1YKWA 5DGBA 1YJVA 3CD6S 2ZITA 1S6UA 2I0XA 2BM1A 3CJTA 3W9HA 1YRUA 4WIIA 3W2VA 4P2MA 3N0VA 4ZPBA 2K2PA 3R3TA 3EMTA 2YKMB 4UQGA 4M1KA 4RUHA 4EI2A 2MQLA 2RILA 2KM8C 2KZZA 4ZVEA 1N33F 5KFQA 3GIRA 3PRBA 3H2LA 4QIVA 3OTOF 3DRRB 1RE1B 1P9QC 3NEKA 3PV8A 3I0SA 1BC6A 1F3FA 2YWHA 4LRFA 2Q1LA 2PDAA 3NCPA 3CDBA 1VQ4S 2P2CB 1RACB 2OLWA 2ROGA 2BANA 3ILOA 2KG0A 1MLAA 1WHWA 4Z7CA 1HNVB 2RIJA 3CD0A 3HKZD 3D6FB 3J7Z5 3KLEA 4JOUA 1Q82T 1N5VA 2DNHA 3CCVS 1ZETA 2V94A 4V19J 1U09A 2VL1A 1H38A 4CO5A 2BE9B 2Y8WA 1H2TZ 2CJXB 4CLZA 4ZVSB 2LMIA 3SEOA 1FJCA 2R4FA 1VLYA 1UTAA 1CEZA 4DSEA 4NLDA 2COLA 1BQXA 1HR0J 4CTAA 4WXOA 2NPFA 4I1TA 4ZVTB 1U45A 1KS2A 2JVRA 2ZOMA 3LPYA 2Z2LA 4O3SA 2AGPA 3HHLA 3BPDA 3AT1B 3CMAS 1RLDA 2G4BA 4TYBA 3GONA 2J9CA 3A8JA 4RNFA 2KVIA 4DQSA 2ALYB 2B8PA 2HBRB 3UCGA 1N6QB 2YNGA 1J5OB 2DXFA 1M5VC 4FPRA 5F8IA 1ZAVA 8RUCA 1WG1A 4ALZA 1QAXA 1Y5LB 2IJFA 2CPZA 3PTWA 3IRWP 4ED0A 1NSKL 2XCPA 3FVYA 2LECA 1CSJA 4DFJA 1PGZA 1F9HA 1UEKA 3MPDA 4UOHA 2Z56B 1D9AA 2D3ZA 4DS5A 2HIYA 2A6MA 2BYCA 2HZVA 1JLQA 3MPYA 4DQQA 2G2OA 1RTHB 1X9WA 1ZTWA 5IT9U 3NS7B 2R8HA 4WJBA 3KLFA 3TEHB 1CULB 2AYMA 2YKAA 3GJSB 3SCIE 3KHGA 1N56A 3MEKA 2FLNA 5DO2A 4M5HA 3VALA 1FKPB 4HTIA 2RUGA 2IA6A 4ED8A 4KY3A 4ZVHA 4CO2A 2HEKA 5KG1A 1EARA 4DSLA 4U96A 4KO0B 1J2VA 1T05A 1KSPA 3KDOA 4LJMA 1LXJA 4IFYA 3O2IA 4C7QA 1FRXA 5L1JA 2VQFJ 1HW8A 4X65F 4B9NA 2DB1A 3HSJA 3QIPB 2R2UA 1S97A 3QJJA 3W2WB 1C0UA 1RWVB 3TANA 3K5OA 3DYAB 4ZP8A 1BQNA 1F0XA 2APOA 3KWMA 2JZ5A 2FVPA 3J7A1 3CEDA 4FKXA 1AROP 3WIUA 2L9DA 4RWWA 2XYGB 1H73A 3RAQA 4FS2A 2ZZTA 4DL7A 1I94F 4ZHRA 3W9IA 2XBPA 2V4JA 4QBUA 1S1XB 2R7OA 3NS5A 1WOOA 4A48A 3HCXA 5KFLA 3OV7A 3G4SS 1S1TB 3OHAA 1FA0A 3DLKB 4LF8J 4Q44A 2R8IA 2UUAJ 4O3NA 2LEPA 4RU9A 2LDYA 4FXWA 3CCQS 5D0EA 4OZNA 2JLEA 3IXQA 1KOHA 4WKYA 4ETXA 5C25B 5LMUF 3BYRA 2X51A 2E7WA 3QGPA 4NE9C 1Q8KA 4FZVA 1XMQJ 3ELHA 4EWTA 3CO0P 4OHXA 2KRBA 1V3SA 2A2DA 2B6AB 4PQUA 3PJXA 4UZCA 1HNIB 5KFVA 1WUUA 3DOMB 1FXDA 1UEUA 3VAMA 3HPOA 5AXLA 4KH1B 3OW2R 3FSIA 2O66A 4TY8A 2X3GA 3H90A 1Q86T 1H74A 4TLRA 2DNGA 3DMJB 3CCWA 2QJ3A 4C8LA 4WZMA 3GYNA 1HNZJ 4M5JA 1NSQA 2AYGA 4DUZJ 4WBFA 1Z4UA 5J1PA 5C7PA 1LWFA 1TUWA 4M5DB 3CSKA 5KG7A 3CF5Q 1R3NA 2HAFA 2P5VA 4USVA 5BYQA 1H98A 1Q95G 2GA7A 4IRCA 2HZAA 2C1EB 2WW8A 2FYXA 3MFIA 5KT6A 4J91A 2W01A 2GO9A 1HD1A 3FBFA 3S1TA 4LF2A 1SQGA 4DV2F 1N32J 1RBLA 3W7BA 1HI8A 3MZIA 2IYGA 1QSLA 4F02A 1LW2A 1HBNA 1N54B 1M5KC 4O4GA 1ZA2B 3P49B 2EFOA 4AUKA 3GFYA 4C2MA 3QO9A 2NZ4A 4K4ZA 4IQMA 5AXMA 2H9ZA 1MMDA 4AQYF 1LWEB 2XG8A 1NH7A 5I42A 4NLRA 2DRAA 4IOAQ 4ED5A 2AZ1A 3KXDA 2F8EX 3GZ7A 4PG8A 2XQCA 2IHR1 4ZCLA 4IH5A 1Q8LA 3MTKA 3TJ8A 4QYRA 4YB1P 1S10A 3QSIA 3FMBA 3QYYA 1CVJA 3IWXA 4UOFA 4JI6J 4LBHA 1MU2A 4DR6F 4QYZJ 2YTCA 1C2PA 3DDKA 1XIQA 1M1GA 1WEYA 2XY7A 1GT8A 6FD1A 3BBBA 4M5MA 2WW4A 3BGUA 3L7UA 4WTYA 1EAYC 2GVZA 2ADBA 5CYMB 2WVDA 4B3OB 3D68A 2J7KA 2ZWOA 5KFRA 3BSOA 4I2QA 5HBMA 1YG0A 2FD2A 3KDNA 4NLUA 4F0MA 1N34F 4FVMA 2XZTB 1FWKA 1KLMB 4X64J 6FDRA 4GKJJ 5FJ4A 1RT7A 5KG2A 2M5YA 4UTGA 1RDRA 4UQTA 1R8AA 2XMJA 4NLVA 5HVFA 4IG0B 1X9SA 2FB0A 2G0CA 2X7IA 5J2QA 1UW4A 3CD5A 1S1VB 3CC7S 3RGIA 3FFIB 2WBRA 1PKUA 2WB4A 3LP1A 3AD7C 4UUXA 2AJFE 3PRVA 1Y3JA 2BJ1A 5HATA 1S1UB 3DN9A 2FC8A 1JXVA 4MKVA 1I1GA 5AE2A 1C1CA 4ZK7M 2PI4A 2E5HA 1Y3KA 3UQSA 2YNIB 2XMAA 3DRPB 5JMNA 2HYIB 3EGWB 2LYVA 4F4ZA 4JYAJ 4OX8A 2XWYA 4F0KA 2JC0A 2G0JA 3MM6A 2ZOFA 2W9BA 3EGVA 3FCWA 3M6WA 3MR6A 5H1SV 4ZVRB 1KTVA 1UAWA 3EUNA 2RRBA 3NBPA 3E01B 2M4MA 1T03B 1RAFB 2EC0A 1U1KA 5BYSA 3NG8A 3V2UC 3NGSA 2HLUA 4JB8B 1PBAA 2W24A 2OPQA 4L3KA 1REVA 2ASYA 4F4KA 3A3PB 4NA2A 3TO8A 2OPRB 4R8UA 2PFDA 5J2MA 1FTCA 2IVMA 2LEBA 2ZFHA 4KH0B 2R7WA 1HQEB 2DNQA 2DR7A 5KFTA 3KLHA 2HQCA 1WJ9A 2FJBB 2PC6A 1TFWA 1WWHA 1HWLA 4JI1J 4J90A 2DEIA 3MM7B 1ZM3A 1MWQA 1HNWJ 3OXLA 4NASA 1IKYA 1VR6A 2XULA 4MKAA 4OHZA 2V63A 4YR3A 4XDCA 2AT1B 3DXSX 1VK3A 2X1AA 4ZCIA 1RAJA 2UUTA 5IV4A 4TQRA 4DR4F 5HSPA 4U7UK 2YX7A 1QAYA 4NLPA 1H2UX 1FX4A 3D1HA 3HDSA 4J9KA 2BQ3A 1XR7A 3SQOP 2VA2A 1QTMA 1Z1ZA 3VAIA 1XJWB 3R6GB 3PDNA 4LVOP 4CDIA 3KG4A 2VB6A 3H0PA 4B3RF 3TJ9A 2DNMA 3ZZOA 1NJWA 3EVWA 5KT4A 2CWKA 2AJ4A 3MTJA 3KHHA 5KFKA 4LRAA 2CJYB 1W2BR 2J8AA 4F7VA 3MMCB 2HQDA 1UJ6A 3B4MA 2ILYA 3V6JA 2OKQA 1GXUA 5A8KB 1XWLA 3GFXA 2P9EA 1LWCB 2C3UA 3M9MB 2FUG9 7AT1B 4XK8C 4G1QB 2LQ8A 5HAOA 3PIPQ 1GXTA 4P9SA 4ZVOB 2IM0A 5D3GB 4F36A 1X4DA 3W8GA 5D15A 2QFIA 1GAOA 4LF7J 1VLOA 1YTYA 1N36J 4A8KA 3T6BA 2NXJA 1F9FA 2FVQA 1SQEA 1TL7A 2P8IA 4DR5F 2GIRA 4EGLA 1N5YB 2WCXA 1JLEA 3PACA 5E2QA 3X3UA 4J9LA 1U4BA 4Q8EA 3EE3A 2HS0A 1SJFA 2DXEA 2FHMA 2UU9F 1NK6A 1SV5B 4LSNB 3Q24A 3KHRA 1H0HB 2VOOA 4C6AA 1V9OA 4ILLA 2DRDA 1X5SA 1RP5A 1FNMA 2EKYA 2V9KA 2CKWA 2NREA 5C42B 1RWUA 1FX2A 4K4XA 3KLGA 4F3MA 1YRTA 4DV7J 1NKCA 2GC8A 3JQKA 2I1RA 4Y2KA 3GMGA 1IM6A 3Q23A 2LKZA 3M8ZA 5CXTA 2OPPB 3TA0A 2YWKA 4U8VA 1UJ4A 1VQLS 2RAQA 4WXWA 1WHYA 3SSQA 3P5TL 5DZ7A 4ZLLA 4I7FA 1D0EA 2ZOGA 4YB5A 1YJWS 4KFBA 2JFKA 4P6QA 4LR8A 1HNXF 2ZE2B 4BBYA 1P8GA 3CJ8A 2CPDA 1DZ5A 3G6YA 3SSRA 2OIHA 1NK8A 2IM3A 4DSKA 4B9UA 4I2PA 4RW8B 5KG3A 3W60A 3O6QA 3OLBA 3RZAA 5E5NA 4OFZA 3R27A 3ZTRA 2Z57B 1ZYQA 2R7TA 3IRXA 1VDHA 5T7LB 3NNAA 3DDNA 4XIUA 3T1AA 4BC9A 1W25A 3QT7A 3BREA 2QMWA 4ZVFA 3M8WA 4Y3CA 1VQNS 1RT2A 2R8JA 1R0CB 1JKHA 4I67A 5JJBA 1PAEX 4USHA 3W63A 2VBZA 1JX4A 4USTA 1R8PA 4TU9A 2K3KA 2RDIA 1N33J 2CVEA 3BSAA 3UD5A 3QGHA 3B8HA 2QA4S 4OYXA 2O3DA 4PG5A 2I5JB 5L8RC 3QRQA 2PT0A 5A8RA 2HSEB 4JI8J 3M8RA 4L75A 2N7CA 2MJUA 3SCJE 5EUHA 2MLYA 3AD9C 4DV3J 4EO6A 4RBUA 5KFHA 4D3GA 2DNLA 1TKDA 3JXOA 2N4CA 5B0DA 3JYTA 4OLOA 2M52A 4L72B 3DU6A 3GYXB 5C2CA 4PYDA 1S0MA 3M2RA 5EWFA 1RA7A 2RRNA 4WF9Q 3VAHA 4TLQA 2HNYB 5KFDA 2GQ2A 1JIHA 3N5BA 2DCLA 5E33A 3GR0A 3R2CJ 1JQGA 1Y0HA 1DAXA 4AXIA 2H54B 1IR2A 3GB0A 4ZLNA 4EYIB 2F40A 1HYSB 2LQ9A 4EZ9A 2QYGA 2HMIB 2HFUA 1GFWB 5HN0A 3A3OB 1TV6B 2X1BA 2Q3PA 3UDVA 3PX0A 3TVKA 2ZDOA 1R27B 2OUGA 3UVJB 3UNGC 1CBKA 4CLTA 2KB2A 3MAAA 3PW5A 1YWXA 1GTHA 4B17A 4BC7A 2HBQB 2NXUA 3QLHB 1DTTA 2HHUA 4X4PA 4CO3A 2EFVA 3E8OA 3S8SA 1LFPA 5LM7E 1YJTA 1TL1B 3IAS9 1F2HA 2IVFB 5KFAA 5A8WB 2BUNA 3J7AN 1Q7YT 3Q8PB 5KFSA 5F9LA 2IM2A 2R7UA 4IG3B 2FZGB 4DCJB 4DF8A 3G86A 4G1PA 1S1WA 2L9NA 5KFXA 1KHVA 3M6XA 2I38A 2C3MA 1RHMB 2BEFA 2F65A 2IM1A 3K0JA 1RTDA 2VG7B 2H5EA 1HBMB 4KJIA 5B09A 3JSRA 2ZVSA 2JSXA 4JI4F 2RNEA 2ZD1A 1KQGB 2JLGA 1NBEB 5D4OA 3TQ1A 2HRUA 3CDEA 4ZVPB 2V8VA 4XPCA 4YHHJ 4RW4B 1UWBB 1KRPA 2R9LA 2ZBPA 1S77D 5E41A 3ULHA 1IQTA 1L3VA 1NZAA 1RT3A 2F4FA 4FPIA 1YJRA 2E1RA 1H72C 2DJWA 1RAHB 1YQHA 4J9QA 1GMWA 3K5LA 2WSCC 4MIWA 2FIUA 2UZAA 2VG6B 2F5GA 2YX1A 3P45B 1WF2A 2XS2A 3CIZA 2CNLB 2ZH2A 3UR0A 4HHUA 2MY8A 2XY6A 2FLPA 1DJ0A 2GFFA 4DSIA 3VV2B 4DPWA 2ZHOA 1NH8A 1M5OC 3MD3A 3J81U 1OWXA 5GADI 4RL1A 1CS4B 3ZNUA 3M9NB 1TKZB 4NLWA 4B02A 4RZRA 4HACA 4D3HA 1VISA 3MCMA 1FRKA 3SBMA 4GKKF 2VODA 1FDBA 4EBCA 4KC5A 3HHLC 1X4CA 3KK3B 2HQGA 1OY6A 2HFVA 1B0TA 1Q5YA 2VFVA 1PIEA 3GP9A 2QMUB 3FSYA 4OI6A 4RJVA 4KSEB 3OSPA 1B4SA 5KFWA 1WELA 3AA8A 2FJAB 3LPEA 3JSBA 4ZPVR 3TI0A 1U24A 2N7YA 3THPA 2FC9A 4KYZA 3CJSA 1T9XA 3KK2B 1VQ5S 4IKAA 2DCUB 2F63A 2ZBRA 4N8NA 2HQ3A 4ZLJA 2FJXA 2VPYB 3HKWA 5HQLA 4DF4A 1TFYA 1Q53A 3IBWA 5KFEA 3V4IA 1MWYA 4DN0A 1Q5VA 1VJWA 4HLBA 3H59A 2DKOB 3QRRA 3MM8A 3HSZA 3VWSA 4MH8A 3BGRA 2RRAA 4W98A 8ATCB 3DGPB 1WORA 2EBEA 3E51A 2MKHA 5IT9Y 1C0TA 2VU5A 1SJ4P 4RW7B 4ECXA 4AD6A 3TEGA 4Y2MA 2UXBF 2MGZB 4JBCA 5K8OA 1D1UA 4P2XA 2PD1A 2QSFA 4O3OA 3NL0A 2W7OA 2C22A 1HMVA 1RB0A 4PXDA 1URRA 3P96A 3K2YA 4UF4A 1RTZA 3ITHB 2XLIA 3GQCA 2P6TA 5GAHU 2RQCA 2NXCA 4ED7A 1FRIA 3J7YU 3N6NA 4GVLA 3OHBA 1JLCB 5EHHA 2HVHA 1XERA 4PR6A 4ETZA 3CE8A 1XBWA 1JLFB 1FD8A 3TAMA 2RMLA 4DR6J 1YJUA 3ILIA 3KJFB 3TWZA 4WYLA 3PW4A 3DRXA 5B0FA 3RBEA 4YY3J 3I4PA 2V8DA 1ZZNA 4A8OA 3HFZB 2YKQA 4WK1A 3A8KA 4H4MA 2OELA 1IBLJ 2ZBQA 5LSLA 3NXZA 3PW0A 3SYZA 3B78A 2C3YA 3NNHA 2W1BA 3R9LA 3T9NA 4DV1J 1T8EA 3CCSS 4OZ5A 4ED2A 2ZUGA 3CVKA 4OYAA 3HHNB 3R1LA 2XMWA 5A0YB 1S7IA 1N34J 3M32B 4B08A 2J7WA 2UXDJ 4JI7J 1MROB 1M5PC 1DY3A 1TKXA 1R8BA 3D67A 2JX2A 1O0PA 1FFWB 3MR5A 3KOAA 2V2KA 4K4YA 1VK8A 4IFVB 4MK7A 1VIXA 4K4VA 2MHEA 5KG0A 3ZC4A 3BSNA 3HVTB 3TUIC 2WVCA 1Y10A 3G8TA 4USIA 2CZ9A 3VHQA 4EU0A 2CJBA 1SL0A 2H51B 4DFPA 3BZQA 2JVOA 1R43A 4F4XA 4DQIA 2GJIA 5CD4H 1YI2S 2E5LJ 2QSWA 4USWA 4F25A 1GMUA 1U1OA 3NNCA 1IJFB 4UW2A 5ETQA 2UUBJ 2B4VA 5CH7B 1EX8A 2RB7A 1M0SA 1N5SA 2GAGC 5D78A 1GQEA 3HSGA 1KFSA 3K7RA 2KT3A 2NR0A 4K0KJ 1YSJA 4RR5A 1DQ8A 2LA6A 5CYQB 4LFBF 1Z2ZA 2VDHA 3DLJA 2EEYA 3EDQB 3R5AA 2RU9A 2YKOA 3RYLA 2YXLA 1WF0A 4KHPF 3L7PA 3MWBA 2OFHX 2YNFB 4GO7X 2MSSA 4AL7A 4EBDA 4V19X 3MEEA 3DXBA 5DDRC 1FO1A 4UUWA 1LEOA 1O51A 1IKXA 1IR1A 2XI2A 2J0XA 2PMWA 3DLEA 4E8UA 1A9NB 1G4CA 3PXGa 4KIAA 1P1LA 4L76A 1CJKB 3Q22A 2C2RA 2MEWA 2B3TB 1XNRF 1S0VA 2L48A 3DC2A 3FCHA 3MCOA 4PYAA 2GGPB 3CUNA 5HLFB 4L74A 5H9FK 1EETB 4LF5J 4Y0FA 3RB0A 2N82B 2CDRB 3OFFA 4FNHA 3BO4A 3PKMA 3DDIA 2E1AA 2DITA 2E29A 2J7UA 2HZCA 4J9UE 3HSDA 2VJVA 2YWFA 2BACA 1UPMB 1FNXH 4NXMJ 1FEHA 3C14A 4PXEA 1HA1A 3DFEA 3EICA 5CCLA 4CLFA 4ED4A 2RQKA 3GCXP 5J2PA 4DN9A 4PG4A 1QDUB 3C66A 1TKTA 3LP2B 2XMTA 1IBKJ 1YJNS 3P8BB 3VQSA 5EDWA 4CP5A 1HBUB 2LCWA 4X4QA 2BANB 3BEGB 4KGVB 1E6VA 4OZ3A 3M1VA 1TVRA 4NCGA 5D4NA 2BVZA 3ONQA 2DRBA 4FXVA 3SQGA 1S9EB 3OVSA 2HWHA 2W25A 4RNNA 3D28A 2MKKA 4J9MA 4OZ1A 4OZ0A 2DHHA 4P73A 2L9WA 2X3DA 5J2NB 4OI4A 2ZHAA 3CDUA 1PYOB 2V6AA 3QFWA 3MURP 4DR5J 5IWAJ 5GMEA 2XWXA 3BGFA 3OR2A 4FP9A 1N5QA 1HQUB 1UP1A 3MDFA 1VS3A 2OSQA 2PEBA 4USUA 1KP6A 4LMZA 3GFZA 3ZTPA 1JK9B 3MMBA 4DOZA 1ZM9A 3EPGA 4CYUA 2IBKA 4CRJA 3HZEA 4DR1F 2WHOA 4LR9A 1NXIA 5B0BA 2AX1A 5IXUA 5D8HB 5C2GA 1NO8A 4HI1A 1UJ5A 4V1Ak 3N28A 1UVMA 1O5JA 4ZN1A 1YJ9S 5ETSA 1WDDA 3CJKA 2FQQB 2EKNA 4YB7A 2HIQA 2AJ2A 1KVJA 3CCJS 1YBTA 3UE2A 5M2PA 2XTJP 3I0RB 4DUYF 1B0VA 5GAEI 5DG9A 1KNZA 3C6UA 1A0OB 3TVYA 3KLFB 4QR1A 3LOUA 2CPJA 1VBYA 2DR9A 2MYFA 5DG7A 3NGUA 2CQ1A 3EVMA 4KB7A 3QQCD 2VHGA 5HK4A 2YKMA 4MIBA 4TU8A 1IR0A 3D7SB 2GQQA 2C42A 4KV8B 4DV5F 2YVSA 1X5TA 3W5ZA 4JI5F 5J1NA 1S6PB 2IJRA 3R5CA 1SJRA 2V69A 3PYDA 3HP6A 3DRRA 1W7WA 3HVAA 3MEGB 3SV4A 1BXNA 3MF5A 1HBOB 1GMWD 1Q1KA 4HL9A 4PUOA 1TU0B 2DYAA 3I31A 4L73A 3ZXWA 4IO1A 2OH2A 4KPYA 2KRRA 3IO1A 2J9DA 1VQ8S 3GE9A 3AAWB 3ISNC 1S0NA 4Y28C 4A47A 4RNHA 1IBMJ 4J9OA 3QJPA 4U9RA 1F5CA 2CQ2A 4TN2A 2DO0A 2W2MP 3DU5A 2HURA 5T41A 2GMJA 4P71A 4A8FA 4N8OA 1NJIT 4O3PA 1Y5IB 2W9CA 2CG8A 1U1LA 1D3WA 4GMKA 2BX6A 1Q7LB 3OFEA 1AUSL 3TX0A 2VFSA 4BHQA 1AT1B 3R5JB 4QWDA 3RJMB 3KG0A 5E3PA 4USMA 3OL7A 2ACYA 1U2RA 5F8MA 3HFVA 1R6VA 2M9KA 1ZH5A 4DV0J 3VQTA 3NLCA 2W9AA 2WK4A 3LGMA 1N6QA 2PEHA 4AL6A 1VYAA 4Q2MA 2QLJB 4NZ6A 2IY5B 2CYYA 5RUBA 3WHIA 4A8XA 2P9GA 2LDIA 2DIVA 5DGAA 4NYOA 4LF9J 1RWKB 2B4OA 4Y00A 2MZJA 4A8MP 1K73T 1B64A 3IN5A 1TR0A 4NMXA 1RTHA 3EX7B 4RPFA 3OTBA 1CULA 5ETMA 2M2BA 2R7SA 2CPIA 4MYTA 1LXNA 2OEJA 3I56S 4A8QA 4EO8A 2AGQA 1VCTA 4M63A 3UWTA 1FKPA 1QUPA 1AA1B 5K8MA 2C2DA 5L9NA 3GSIA 2QN6B 1N52B 1WG5A 2Q6CA 2W8LA 2XNQA 1BUXA 1UL3A 4DLEA 1WEZA 2AYEA 2PMZD 4KHRA 1U1RA 1RT4B 3QIPA 1N0UA 3GIKA 4Q8FA 1NDCA 4ZDNA 3W2WA 2MKSA 4NEYA 2FY1A 3D6MB 3DYAA 5D4LA 4QR0A 2OD6A 2Y8YA 2O1PA 4DJBA 1OYDA 2C2MB 2HNZB 1F60B 5IM0B 4F4WA 2HFZA 1U1PA 3SCKE 2P9CA 5ETPA 2LXIA 3D4JA 2RKIB 2K3IA 1TK8A 2RF2B 4U7UD 2EWHA 3UW1A 2VA3A 3NCQA 3LANA 1S1XA 5ETLA 4NI2A 4WIQA 2YPYA 3DOLA 1S6QB 5IT4A 1WC4A 1U26A 3M9OB 1DTQA 3J7ZT 2WBMA 1S1TA 2GVZB 4DR3J 3DLKA 3GU0A 2QL5B 3JTOA 1NMEB 5LMNJ 2HGMA 2BQRA 3M8QA 3ICLA 3FDSA 4NXNJ 4X62F 1NHUA 2AMCB 2R3VA 2WZ1A 4ED3A 2IFXA 2AIRB 2IRYA 3D9BA 5C25A 4W92B 2B8QA 5LL6d 1ZTTA 3U7JA 4WU3A 3VR1A 4GKKJ 3BF4A 5CHCB 3RW6A 2YWGA 4DXLA 2C3PA 4NWBA 2V4RA 1SUQA 5KT3A 2KFZA 2J0WA 2B6AA 4QWCA 2QL9B 3MUVP 1K0TA 2RVJA 2VC0A 1HNIA 4YFUA 3DOMA 1NJZA 2KDOA 4RUCA 3EGNA 1WKLA 2BE2B 4EK2A 4DS4A 2DVIA 1APSA 3UDCA 2J5AA 4J9VA 4EFAC 3DI6B 3HVWA 3DMJA 1S76D 5HO4A 3SSSA 4C0BA 4F04B 5GMDA
chains in the Genus database with same CATH topology
2BJ7A 3BKFA 2CADA 2NZCA 2F1FA 2BJ1A 1Q5YA 3BKTA 2HZVA 2WVBA 3QSIA 2PC6A 3PHTA 2FGCA 2WVDA 2CA9A 3BKUA 2BJ8A 2WVEA 2BJ9A 2WVCA 3LGHA 2CAJA 2BJ3A 2WVFA 3OD2A 1Q5VA 2Y3YA 2HZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ7 A;  3BKF A;  2CAD A;  2NZC A;  2F1F A;  2BJ1 A;  1Q5Y A;  3BKT A;  2HZV A;  2WVB A;  3QSI A;  2PC6 A;  3PHT A;  2FGC A;  2WVD A;  2CA9 A;  3BKU A;  2BJ8 A;  2WVE A;  2BJ9 A;  2WVC A;  3LGH A;  2CAJ A;  2BJ3 A;  2WVF A;  3OD2 A;  1Q5V A;  2Y3Y A;  2HZA A; 
#chains in the Genus database with same CATH topology
 2ZJP Q;  4CI0 B;  3D3B J;  3L95 X;  2E9Z A;  4QOT A;  1HWK A;  2FJV A;  2CFX A;  4M5D A;  5LXY A;  3I5C A;  2HVZ A;  1RCO B;  2WRM A;  1BD6 A;  4PAA A;  2ZZN A;  4Q2L A;  3QGI A;  2R8G A;  2HFO A;  3NBP B;  4O44 B;  3PW7 A;  1SBR A;  1VBZ A;  4HT7 A;  1RAG B;  5K9F A;  3D3C J;  2GV1 A;  2L08 A;  3O8W A;  2OPQ B;  4X4R A;  1VGY A;  1W26 A;  2DH7 A;  4EYH B;  4LFA J;  5D0R A;  1LWE A;  5E0O A;  2IDE A;  5GAG I;  2QLF B;  3OTC A;  2MKI A;  1KR4 A;  1RTI B;  1TMM A;  4C8K A;  5G0R B;  1RU2 A;  3H40 A;  3KLH B;  2E1P A;  3BDE A;  3CCL S;  1R0B G;  2MTL A;  3KMS A;  4HH0 A;  2FLO A;  3LUY A;  2Z2M A;  2JFD A;  4J7C A;  4ZIW A;  3VCD A;  2XB2 D;  4ZMM A;  4JV5 J;  1PC4 A;  2GJF A;  1YZ7 A;  3HHD A;  2B7C B;  2H5J B;  4DSJ A;  2CJK A;  3H5X A;  3UPF A;  4DFK A;  2VBW A;  3UI3 A;  4ZPT R;  2LFV A;  3UN5 A;  5DQH A;  5CYM A;  1S7H A;  4NYP A;  4CT8 A;  4CIO A;  4ZOS A;  5JVG Q;  3IGN A;  4B3O A;  2FJE B;  1FRL A;  4N76 A;  2MQO A;  1PC5 A;  3NWG A;  4WFA Q;  3J81 Y;  1OQ3 A;  1LOU A;  2AD9 A;  4CLK A;  4C98 A;  3MGJ A;  4F26 A;  2UVV A;  1TK0 A;  4I0W A;  4A8W A;  2AEF A;  5B0C A;  3PFE A;  1KLM A;  2QA1 A;  3CPW R;  1XN9 A;  1T0T V;  4MJK A;  1NPK A;  1B0P A;  1XEZ A;  4YR0 A;  2ZC3 A;  4GC6 A;  1OQ6 A;  3G9C A;  3QWU A;  2OEM A;  4F3O A;  1WSV A;  3I55 S;  4IG0 A;  3DHW C;  3H8Y A;  4LF1 A;  5HL7 Q;  1S1V A;  5F8N A;  2F8H A;  1FE0 A;  3FFI A;  2ILZ A;  2YQ3 A;  3CO9 A;  2DNN A;  2VAS A;  3L3C A;  5D6G A;  2PA3 A;  3BBC A;  4OLP A;  1OY9 A;  1U6Z A;  3A12 A;  2HK2 A;  1VQY A;  4YUD A;  2QG9 B;  3V6D B;  2BOA A;  1S9G B;  2YNI A;  1JLB B;  5KFO A;  3RB3 A;  2ZM6 J;  2UUC F;  1MG7 A;  3Q8U A;  3OJU A;  3MM9 B;  2K7J A;  4JI3 J;  3RB6 A;  3AHP A;  4PCQ A;  1R8H A;  4IR1 A;  2R7Q A;  3PYG A;  4NLX A;  4C11 B;  3OSN A;  3D1Q A;  4TQS A;  3E01 A;  4F0H A;  5FDL B;  1XMO F;  1T03 A;  4Y34 A;  5H9E J;  2AEJ A;  2QTW A;  3BYP A;  1C4A A;  1BQM A;  2RT3 A;  4P52 A;  2Y1R I;  3QGG A;  2YBV A;  4QZV B;  1B3T A;  1F1B B;  4KAI A;  3OL6 A;  3MED B;  3BGO P;  1MMN A;  2OPR A;  4X66 F;  4FNI A;  1Y7P A;  5I3Q A;  4G6V B;  3R7S B;  3KLG B;  1LNQ A;  1HQE A;  3RU0 A;  2W4D A;  4AFF A;  4IRD A;  4QYZ K;  2KTQ A;  3H20 A;  4ELT A;  4CH1 A;  3LP0 B;  4LBP A;  4Z7Y A;  4CQ1 A;  1JJ4 A;  3W62 A;  5THW A;  4B3S F;  3MM7 A;  5MLC V;  4KGK A;  2E5G A;  5DS7 A;  2E5I A;  1RT6 B;  2KJV A;  3M8P B;  4OZ2 A;  4DL0 C;  2DTJ A;  3K8V A;  1NPP A;  3TZY A;  4HDH A;  2KKH A;  3FGV A;  3GJR B;  2FHJ A;  4FYV B;  1JJC B;  2AU0 A;  3PW2 A;  1NK9 A;  4DBQ A;  4DR7 F;  3IBC B;  2D7S A;  1MSW D;  4WZQ A;  1CJU A;  2Q79 A;  2HS3 A;  3EZO A;  3IRX B;  3EXC X;  3HX9 A;  3OLA A;  2IDL A;  2JEJ A;  3C2P A;  4IR9 A;  4OV6 A;  5DDQ C;  1TP7 A;  1RT2 B;  1BE4 A;  1UA0 A;  3AH6 A;  1FJG J;  2MKJ A;  2E5J A;  1ELO A;  1S12 A;  3BKU A;  1OO0 B;  1WI8 A;  4U67 Q;  2OD4 A;  2UVW A;  2H5I B;  2IJN A;  2XCA A;  1MW7 A;  4I6Y A;  2FZK B;  5A8K A;  1SI9 A;  3TW0 A;  1LWC A;  2VV5 A;  3CJ3 A;  2Y0S D;  4G1Q A;  5D3G A;  3KLI B;  2BRK A;  1N88 A;  4WYW A;  1TL3 B;  2NUH A;  4ZP9 A;  3H2U B;  1SJ1 A;  1AW0 A;  3EJM A;  2HFN A;  5E7O B;  1OSD A;  2ZUA A;  2XLJ A;  3M2R B;  2WON B;  2VJU A;  3C15 B;  2CDQ A;  2B7B B;  2JHE A;  3KJQ B;  2YKN B;  1LW0 B;  2VFT A;  4X2B A;  3R1H A;  4WP9 A;  4X4U A;  1IJE B;  4M5K A;  1G7C B;  3AXM A;  1NSP A;  3DM2 B;  2DHX A;  4X4V A;  4GRS A;  2WAQ D;  3CTR A;  1SV5 A;  3M8S A;  4LSN A;  4ILR A;  3EXY A;  4TNO A;  1D9F A;  4LQ9 A;  4QIE A;  4OHV A;  5KFU A;  4OX7 A;  8AT1 B;  4M5L A;  1NDK A;  5C42 A;  3A13 A;  1P9Y A;  3KJV B;  2CQ3 A;  3OBI A;  1NZ8 A;  2HHX A;  4Q5V A;  2ZEJ A;  4OHW A;  5F8H A;  3NKY A;  4DQP A;  2OPP A;  2D69 A;  4OJ3 A;  5I4M A;  3DCA A;  1WI6 A;  2W4P A;  1ULR A;  4YDX A;  2CPY A;  2KXF A;  3R5G A;  3TQE A;  4C0H A;  5ETO A;  4DPT A;  3ZTQ A;  4P75 A;  2NLW A;  4TVA B;  1E6Y B;  3BSC A;  4PG7 A;  2FVC A;  4J9N A;  2ZE2 A;  2VFU A;  1REG X;  5B7W A;  5AJ3 J;  5DG8 A;  3N9U C;  4RW8 A;  3ZTS A;  1ICE B;  1AZS B;  2WOM B;  1FDD A;  4E2F B;  3CJ5 A;  4OZJ A;  2MDA A;  3L09 A;  5T7L A;  4F4A A;  2E7X A;  1RA6 A;  2ZD1 B;  4YDD B;  1YJ7 A;  2MQN A;  2AX0 A;  2Y0B B;  4CLU A;  5K8P A;  4WPA A;  1VQM S;  3NOC A;  1HW9 A;  3TAR A;  3JS9 A;  4DV4 J;  3UCZ P;  4BCA A;  5JXS A;  1WAC A;  3MOZ A;  1NB7 A;  2YPZ A;  1RKI A;  3PIO Q;  3UFC X;  2OGU A;  1Q79 A;  2I5J A;  2HHW A;  2C2O B;  1U02 A;  4ZJO A;  3MCS A;  4BS2 A;  2KFY A;  3OR1 B;  2AV5 A;  5LJ3 Y;  2WSF C;  3CDA A;  2XO6 A;  4ES1 A;  4A46 A;  2GO8 A;  4NRT A;  2VQE J;  5F9N A;  2J9D E;  9ATC B;  3M30 B;  4P2F A;  2UUA F;  2IYI A;  5KG4 A;  2UXC J;  2JC1 A;  3R7B B;  2RUS A;  1V3Z A;  5K5M A;  2G9O A;  4QR2 A;  2HNY A;  3V81 B;  5HVG A;  3GII A;  1HQ2 A;  2BZ2 A;  2CQH A;  1XMQ F;  1RAI B;  3POT B;  3B6B A;  1FXR A;  2M0G B;  1KFD A;  3AJ1 A;  3K59 A;  2BKO A;  1QY7 A;  1VBK A;  2GVD B;  3BBF A;  1HYS A;  4TXS A;  4YS2 A;  2HMI A;  3TRG A;  1DLO A;  2YNH B;  4NLO A;  3ZZY A;  5EWG A;  1TV6 A;  3CJ4 A;  4DHV A;  2AEM A;  1XQI A;  1VHF A;  2RDD A;  2V0N A;  3FRZ A;  1UKU A;  3FK4 A;  3UVJ A;  5HQM A;  1TL4 A;  1I51 B;  1ZAW A;  2XYP B;  3VTI A;  4B3T J;  4ED1 A;  1O8B A;  1FFS B;  3QLH A;  1U0S A;  2ZH3 A;  2ROP A;  1U8S A;  5KFB A;  4ZN3 A;  2V68 A;  4DUZ F;  3HO1 A;  3T6J A;  2CZV C;  4DL6 A;  3JQJ A;  2D9O A;  4J9R A;  5A8W A;  1UA1 A;  3GV7 B;  4U95 A;  4XPE A;  4CCH A;  2ZHB A;  3BGR B;  5J1E B;  1WHX A;  5EN1 A;  3C16 B;  2QIF A;  2B51 A;  2R7R A;  2V5H G;  2JEG A;  2VG7 A;  2VBX A;  5KFY A;  1HBM A;  3QZ8 A;  5BJR A;  1PJ5 A;  3TOQ A;  1KEK A;  2R42 A;  3AFG A;  1G6B A;  3T1Y J;  2D1C A;  3Q86 A;  3KFW X;  4I64 A;  2VPZ B;  4RW4 A;  4ECS A;  1UWB A;  1WF1 A;  1YGY A;  1GH8 A;  1WC3 A;  3G82 B;  2E9T A;  1IUJ A;  2BJE A;  2M7S A;  2MLZ A;  4CO4 A;  4PPZ A;  3D6H B;  3ZZZ A;  3PJW A;  2F4V J;  2DK2 A;  3BJY A;  2KFN A;  4C3L A;  2RS8 A;  1SQF A;  3NGR A;  1URN A;  2PMH A;  2EW9 A;  4JI6 F;  3W5Y A;  3N5F A;  2FJW A;  1CC8 A;  2W8K A;  2VFR A;  5IOL A;  4AXJ A;  1ZM4 A;  3ZZR A;  3PM9 A;  3M7V A;  4M95 A;  2Z58 B;  3EVO A;  4QWB A;  2KM8 B;  2C2Z B;  3Q89 A;  5I3P A;  1TAQ A;  1Y00 A;  2DNK A;  1SC4 B;  1KQS R;  4HHH A;  4ES2 A;  3DGV A;  1S4E A;  1QVF R;  4GC7 A;  4RUB A;  4ZVQ B;  5M2R A;  1CS4 A;  3RRG A;  4NYZ A;  4MK9 A;  3NGD A;  2ASL A;  1TKZ A;  3DLB A;  2F1F A;  2V8G A;  4NLY A;  5BR8 J;  2E66 A;  3AB2 B;  3CC2 S;  4LSZ B;  5KG6 A;  1PSD A;  3CXC R;  3P5B P;  1ZAX A;  1RKJ A;  5D0G A;  5KFF A;  1KVI A;  1ZPV A;  3ETO A;  3AQO A;  4X64 F;  3H5Y A;  4GKJ F;  2ATL A;  1HHQ A;  2ZH7 A;  3C19 A;  1RHU B;  3OVA A;  3CGI A;  1BY9 A;  4ANC A;  5AE3 A;  3A1Y G;  1PAU B;  1EB0 A;  1RWN B;  3PX4 A;  3BQ1 A;  4OYO A;  4WWS A;  3GIL A;  3H7H B;  1NKE A;  4NLQ A;  2DGQ A;  4B9M A;  2GCF A;  1UVK A;  1VHI A;  4DCP B;  1RWW B;  1UFL A;  3TUJ C;  1V6H A;  3GFH A;  4K4W A;  3T3F A;  2C28 A;  1RXO B;  4LBI A;  3KK2 A;  3C8Y A;  1GEH A;  2HQF A;  2QGF B;  1U2C A;  2X1F A;  3HZG A;  3CD7 A;  4OI3 A;  3GPA A;  2OPS B;  4CLP A;  1NK4 A;  2QLX A;  3D54 A;  4JYA F;  4EZ6 A;  1K0V A;  3TVZ A;  3GYG A;  1WKK A;  2Z4P A;  3IM9 A;  4TKT A;  4NA1 A;  4WP8 A;  3JSM B;  3I82 A;  2G1H A;  3FZB A;  1WTB A;  4HT5 A;  1HL6 A;  2CA9 A;  3S7R A;  3DGP A;  1G3O A;  4ER8 A;  4Y2A A;  1XNQ J;  3G87 A;  3BQ2 A;  2BQU A;  5L46 A;  4JV0 A;  2FGO A;  1TZ0 A;  2MZS A;  3MAH A;  4RW9 B;  1L3S A;  2M70 A;  2KYZ A;  4RW7 A;  4ID5 B;  4TU7 A;  2MGZ A;  3F73 A;  3GJT B;  5B08 A;  4UY8 5;  2CQG A;  2XZW A;  3B54 A;  3AOB A;  1QVG R;  5SZT A;  4ZJQ A;  3VZH A;  2OP5 A;  2DO4 A;  4PKD B;  2AHO B;  3UD3 P;  1JLG B;  4N56 A;  4OJH A;  5ADZ A;  3ITH A;  2N3L A;  4JI1 F;  4C3M A;  4IQX A;  2NUU G;  1SKU B;  2ZBI A;  2XYH B;  5HRO B;  4MKB A;  4W4M A;  2CXE A;  1HNW F;  4WFN Q;  4ZCM A;  5GVQ A;  3C6T B;  1FNO A;  1NSA A;  2EVZ A;  4RWX A;  4QQB A;  3BH7 B;  1VRU B;  1U7L A;  1RCX B;  2DGV A;  1RWX B;  2W4C A;  2EC2 A;  2FHJ D;  4ELU A;  1P27 B;  2H48 B;  3G71 S;  2HS4 A;  2OI2 A;  3FQK A;  4ID8 A;  4P74 A;  2DR6 A;  5D77 A;  4X4T A;  1U1N A;  4X4N A;  2DIS A;  2W2P P;  2GX8 A;  2CNN B;  1S57 A;  2FY8 A;  2V2Q A;  3LGH A;  1V5V A;  2BV3 A;  2O67 A;  4Q7A A;  4G1I A;  3SFU A;  1KKH A;  4CLL A;  5A0Y A;  5L1I A;  4CM2 A;  3MPU B;  2ERR A;  2MY7 A;  2G0I A;  3M32 A;  4DMZ A;  4JV1 A;  2IAJ A;  1F3V A;  1WC6 A;  2IIH A;  3SMZ A;  5DQI A;  3UO0 A;  3BM7 A;  3QZ7 A;  1U0H B;  2VZ9 A;  1BMQ B;  3N6M A;  4TYA A;  5IT0 A;  2KVQ E;  1HKA A;  2HND B;  3M8Y A;  4AE5 A;  2CQ4 A;  3MI7 X;  2OJ3 A;  1FK9 B;  3HVT A;  1E6V B;  2DNZ A;  4JI2 F;  3M1V B;  2DNP A;  3PZP A;  1TVR B;  1SCJ B;  3HHL D;  2D74 B;  1S9F A;  4LF7 F;  1RJJ A;  3FKB A;  4QIF A;  4ITS A;  2DGS A;  4X4O A;  2RQM A;  4CH0 S;  1SIW B;  1N36 F;  1YHQ S;  5CCM A;  4ZP6 A;  3GIM A;  4B9V A;  4NLG A;  1BGX T;  3ET6 A;  1PJ7 A;  1UEV A;  4RLE A;  1U1M A;  2NYI A;  2UUC J;  3ENV A;  3CCU S;  2KL8 A;  1VBX A;  2BMB A;  3EGZ A;  1T9T A;  2EG2 A;  2IC3 B;  2PE8 A;  3X1L B;  4RO0 A;  3M2V A;  1SXL A;  4Q0B B;  2YY3 A;  2QA4 G;  1XMO J;  1U6F A;  2DIU A;  4K4T A;  1SIZ A;  4CYU B;  3W5X A;  3T1H J;  2DNO A;  2H65 B;  3AXK A;  2FDN A;  4DV7 F;  4ZIT A;  5CYQ A;  1IKV B;  1FRM A;  3I5A A;  3WX4 A;  3W65 A;  2NPI A;  4O4R A;  4X66 J;  2OEK A;  2ZH4 A;  2XHW A;  4N5S A;  4S0M A;  3SDE B;  3MOJ B;  3FCV A;  1B7F A;  2YNF A;  4C48 A;  3A4T A;  2AW0 A;  2OTJ S;  2K8G A;  3F41 A;  5G4D A;  5U47 A;  3K5N A;  4X84 A;  1R7I A;  2RD5 C;  4KHM A;  1RT1 B;  3QT8 A;  5DM7 Q;  1UET A;  2BM0 A;  1IM4 A;  3W61 A;  1CJK A;  2N4D A;  2XGP A;  2QA2 A;  2JJ4 D;  4PWD B;  3OTO J;  4FDF A;  1D9D A;  4P10 A;  2RHQ B;  2BAB A;  1YDL A;  4LFC F;  1EJ7 L;  2GGP A;  3KNG A;  5HLF A;  2NYH A;  2HAI A;  1EET A;  4KR0 B;  4DR7 J;  3BKF A;  1VQO S;  1M1K T;  2R8K A;  3Q8Q B;  3N79 A;  3US5 A;  4DL5 A;  5DDP C;  2VG5 A;  4DL2 A;  2XSJ B;  1Q16 B;  2VUG A;  2H1Y A;  2DGO A;  5LOQ A;  3S01 A;  3VVU A;  5K8N A;  2VKZ G;  1AXQ A;  3DLL Q;  2LEA A;  3U1N A;  4OX6 A;  1X4B A;  4QW9 A;  2Q66 A;  2GAH C;  1MNE A;  1YK9 A;  2QC3 A;  4PG6 A;  3VGU A;  4JI8 F;  2V9W A;  1Q8B A;  2AKW B;  4DU7 A;  3JSY A;  3I32 A;  3LP2 A;  4PUO B;  1XR5 A;  4DV3 F;  2FPH X;  2I6W A;  2MQM A;  1WHV A;  4BWJ A;  1NJY A;  1FER A;  1HBU A;  4WE1 B;  1RT5 A;  1FD2 A;  2R2S A;  4KKO B;  3NMA A;  5K20 B;  2KHC A;  2A18 A;  5I3U B;  4W90 B;  1CG2 A;  3QID A;  1WC0 A;  1S9E A;  4JV2 A;  2QFJ A;  2GJ2 A;  3C46 A;  4OX9 F;  2GMH A;  2HHP A;  3Q2S C;  4J37 A;  2YX4 A;  4H54 A;  1IVZ A;  1QSY A;  1KTQ A;  2IMO A;  5L38 A;  1C1B B;  5J2N A;  1JXL A;  4WTO B;  1U6B A;  4UZB A;  1RK8 A;  3QT5 A;  3AOA A;  4KRW A;  4E0D A;  1RYR A;  2DHA A;  4DWI A;  2W9C B;  1F9E B;  3KUG A;  3O5T B;  2NCK L;  3FBE A;  4J9S A;  5K14 B;  2MLX A;  1O6X A;  1Y9O A;  2CRL A;  3EYZ A;  1HQU A;  2KG1 A;  4DI6 A;  2J9E A;  4QIW D;  4DV6 F;  1YIT S;  1IXK A;  5IZH A;  5F8J A;  2UUW A;  2VH7 A;  4DPU A;  4DSF A;  3IFE A;  3N01 A;  5KOX A;  1FEE A;  1IKW B;  4MYU A;  5KT5 A;  1RTJ B;  3TUP A;  4R5P B;  2F8M A;  5FLX U;  1HWI A;  3AJD A;  5A2Q U;  2CJ9 A;  1NEE A;  4OI1 A;  1N5T A;  3T5J A;  2DD8 S;  1H3D A;  2J6S A;  3W66 A;  4YR2 A;  1WC5 A;  2XEX A;  2KZM A;  4ZVU B;  2NQP A;  1QM9 A;  2DGW A;  4XDD A;  2ZH6 A;  1AFJ A;  1Q78 A;  4K50 A;  1SL1 A;  4NEZ A;  5C24 B;  2AJ0 A;  1VQS A;  1UVN A;  3I0R A;  3VAG A;  4X65 J;  1P6T A;  1RAB B;  5GAE U;  1JMT A;  1ZPW X;  2B5J A;  4HDG A;  2VIC A;  3H5U A;  5HQ8 A;  1IQZ A;  4NML A;  4KTQ A;  1RIS A;  3IAM 9;  2MQP A;  5EGY A;  3QAT A;  2R2T A;  3CJ2 A;  1WEX A;  2IBO A;  2CPX A;  2KO1 A;  3OXF A;  4RBV A;  1LWX A;  3F44 A;  3CCZ A;  4YP3 A;  3TNV A;  3DOK B;  4J9P A;  3TUZ C;  1S5Z A;  4YHH F;  4DQR A;  2UVU A;  1I94 J;  1M1H A;  2AQ4 A;  4KV8 A;  3MR2 A;  2B56 A;  1D8Z A;  1UZD A;  1GMV A;  3VVT A;  2JOQ A;  1FTR A;  1S6P A;  4NCA A;  4ECR A;  2CQD A;  3G8S A;  3MEG A;  3U1L A;  2HFS A;  1QE1 B;  2V34 A;  2XMM A;  1HBO A;  3VGT A;  3DLH A;  1HWU A;  2XLK A;  2CPE A;  5HI7 A;  1HHT P;  1S48 A;  2HRY A;  3LW5 C;  1CJV A;  4GVB B;  5LMU J;  3TX8 A;  3MEC B;  2YH0 A;  3PRD A;  4MTP A;  1SVD A;  2MZR A;  1HI1 A;  2JH3 A;  1FVQ A;  4NI2 B;  3P6Y C;  4A8Y A;  3DOL B;  3NMR A;  2D3O R;  1DTQ B;  1VRT B;  3LA0 A;  2CQI A;  3KG1 A;  3DRS B;  2U1A A;  5ITH A;  3KJN B;  2PSZ A;  3DLG B;  2A1B A;  3M8Q B;  4K7Q A;  5AT1 B;  3MMA B;  1CJT B;  3QSY B;  3WQP A;  2H3E B;  4IUF A;  2XGQ A;  1SPB P;  3ZZU A;  2C3O A;  2EFN A;  4RW6 B;  2AJ1 A;  4BDP A;  4OZL A;  1X4A A;  1SUQ B;  4IDK B;  1FKO B;  4LRC A;  3BB5 A;  2QL7 B;  3FC9 A;  2IMW P;  2J6T A;  2B4P A;  1PYT A;  1B99 A;  3KLV A;  4LSL B;  2JDJ A;  2CNO B;  4RU2 A;  3JTN A;  1T9U A;  2MZT A;  2MKY A;  4PEO A;  2XHC A;  2LQJ A;  4ZPA A;  3HHE A;  4URQ U;  4DV2 J;  2J6U A;  1G2E A;  4ED6 A;  3D0I E;  3IS9 B;  1QAJ A;  3SV3 A;  2HWI A;  2BKP A;  3TZZ A;  3PNI A;  2R7X A;  4AQY J;  3MFH A;  1EP4 A;  1ZOT A;  2CPF A;  2Y1L B;  2RU3 A;  2HGN A;  1X7V A;  1J27 A;  4OI2 A;  5HP1 B;  1EIY B;  3UCU P;  4A4J A;  3G2X A;  3K57 A;  4C3K A;  3HJV A;  4PPD A;  1CQM A;  2K7K A;  3RBD A;  5KFP A;  2ZJQ Q;  1LQ9 A;  3UDE A;  3SXL A;  2V8H A;  3KTQ A;  3Q83 A;  1RT4 A;  5HMY A;  3IMQ J;  4OYM A;  1UPP A;  2LP4 A;  1ROF A;  1F6T A;  2PII A;  2HW3 A;  4C8Z A;  3IG1 B;  1T3N A;  3W9J A;  1HPZ B;  1U49 A;  1R0A B;  2HNZ A;  5IM0 A;  2GZO A;  3HM9 A;  1NAQ A;  1EQM A;  3DHX A;  1UWA A;  3I6P A;  2RKI A;  4A8S A;  2RF2 A;  3E3X A;  4JP8 A;  1RU1 A;  3K5P A;  4FYY B;  2DGX A;  1DUR A;  3B4D A;  1Q81 T;  2POK A;  1EKR A;  1S6Q A;  1A7G E;  4YY3 F;  3HT3 A;  3PR5 B;  2YQ0 A;  2RDJ A;  3MM5 A;  4ICL B;  1IBL F;  4HKQ A;  2E7V A;  4HH1 A;  1TUG B;  2HQI A;  2IRU A;  2H4Y B;  4USK A;  1WTF A;  4DV1 F;  4OV1 A;  2ZH9 A;  3KHL A;  1X5P A;  3M2U B;  2BRL A;  2UVR A;  1U48 A;  4WFX A;  1RAE B;  1I5O B;  2VON A;  3AOC A;  3ILJ A;  2UXD F;  4JI7 F;  3ISN D;  3UN2 A;  3DNC A;  2DPJ A;  1KLN A;  1M90 T;  3SCL E;  3T5L A;  4URS A;  3HK2 A;  1FI4 A;  4OJ1 A;  3BV8 A;  1TTH B;  2BE2 A;  1ZS6 A;  5ETV A;  3OUY A;  2PN6 A;  1AUD A;  4MFB B;  4QJV A;  2V67 A;  1IBC B;  3JAM U;  5CAA A;  3DI6 A;  4DUT A;  2GNK A;  4H4O A;  1IWA A;  3TP2 A;  3PEH A;  2DXD A;  1S6O A;  4ZKA A;  4Y2C A;  5KFZ A;  2MJN A;  4QU6 A;  2E5L F;  4K59 A;  2CPH A;  2JNJ A;  3QPI A;  1GXL A;  4LF4 F;  3CUL A;  2IA0 A;  1R6Y A;  3HHK A;  3ENA A;  4ERD A;  3GLJ A;  1I3O B;  1UVL A;  5F41 A;  2DNR A;  3PYF A;  1S4F A;  4YOE A;  2UUB F;  4O44 A;  3H42 A;  4IH7 A;  3NGT A;  4DR2 F;  2XC9 A;  3Q8R B;  1BQM B;  1T3O A;  3H25 A;  3KKF A;  2HHV A;  1PCA A;  5F8G A;  3A8I A;  4K0K F;  4B9S A;  2FVS A;  4OYW A;  3W3S A;  1PO6 A;  3IWN C;  3FMW A;  2JEI A;  2XS7 A;  4CLY A;  1NK5 A;  5GAG U;  4DR4 J;  1RTI A;  3W2V B;  5G0R A;  1WSR A;  4UT4 A;  2CJQ A;  2K1R A;  3OQ2 A;  1RHJ B;  4MIA A;  2KI2 A;  4KBI A;  4EBE A;  1KQK A;  1CQN A;  2L3M A;  3RTV A;  3R6L B;  4B3R J;  4AL5 A;  1U25 A;  3F56 A;  4LQ3 A;  4JUZ A;  5M2U A;  2B9E A;  3RRK A;  3I0S B;  1H2V Z;  2AGO A;  1FHT A;  5AXN A;  4LF5 F;  4DL4 A;  1DRZ A;  1NK7 A;  2FJD B;  2JL9 A;  1IN0 A;  4DX8 H;  4ECW A;  1CJU B;  4P7T A;  1SJQ A;  2F9D A;  4K4U A;  3AOD A;  3KLE B;  1T7P A;  3RBZ A;  3MD1 A;  3PEJ A;  2ZDP A;  4DLG A;  4PAB A;  5ETT A;  4CNZ A;  4NXM F;  2V4Q A;  1SC1 B;  2DY9 A;  2YKP A;  3V4M A;  2AZ3 A;  3GIJ A;  2BBE A;  4KGX B;  3TJA A;  2RSQ A;  5IC4 B;  2DHG A;  3TA2 A;  5B0E A;  5CAB A;  1QSS A;  4MKY A;  1RAA B;  5IV3 A;  3UD4 P;  1IBK F;  4CTA B;  2ABY A;  1JLA A;  2G2Y A;  2R7V A;  3H4B A;  4O0N A;  3PCO B;  2HWT A;  5CA5 A;  1J5E F;  4FKY A;  2AF6 A;  1NRK A;  1KOO A;  2Y1J A;  3HUL A;  3ZNJ 1;  3HHL B;  4DPY A;  2UU9 J;  5CQG A;  5F3Z A;  2EG1 A;  3V6D A;  4WFY A;  4Y65 A;  4JI2 J;  4CNY A;  1YBU A;  1S9G A;  5A76 A;  2YNG B;  2U2F A;  1JLB A;  2QV6 A;  1SKS A;  2HHS A;  3ZZ0 A;  3KK1 A;  3MM9 A;  3QFH A;  4FYD A;  2C2K B;  5IWA F;  2ZH8 A;  3WC0 A;  2IVY A;  3OPK A;  3SZ2 A;  4DG1 A;  4I4B A;  3HLU A;  1WD6 A;  5DLG A;  4F2R A;  4C11 A;  1U8W A;  2YH1 A;  5FDL A;  1M5S A;  3A3N B;  1JLQ B;  2DBB A;  2YWE A;  1RBA A;  2RHS B;  3CB4 A;  2CNK B;  1KDN A;  3MED A;  4NX9 A;  4H4K A;  3L9Z A;  4ZA1 A;  1HNX J;  4K5R A;  3V5R A;  4NPO A;  4RBT A;  1S59 A;  2I9S A;  4YB6 A;  5KFG A;  2UV8 A;  5ETN A;  2E1M C;  4EUV A;  3ZZP A;  3LP0 A;  3WX8 A;  2XM3 A;  3IR6 B;  1T05 B;  4QW8 A;  4IFY B;  2XNR A;  2XMU A;  3VF0 B;  4I68 A;  1RT6 A;  3M8P A;  2B43 A;  5FII A;  3ADA C;  1L3U A;  4YN3 B;  1C0U B;  2F9J A;  2RH3 A;  1BQN B;  1R31 A;  1UZH A;  3HJF A;  2UP1 A;  3TYT A;  2PA8 D;  4FYX B;  2CAD A;  4RX6 A;  4ZVG A;  3GG1 A;  4ZHR B;  1T9Y A;  4LFC J;  2BJ8 A;  4IH6 A;  2V4J B;  1HNV A;  3MHY A;  2VPW B;  3UR3 C;  2DY1 A;  2QZ8 A;  2KHD A;  3G6V A;  5KT2 A;  2WVF A;  2XO7 A;  2V50 A;  4C4W A;  2HHH F;  3I9Z A;  2Z30 B;  4I56 A;  3GV5 B;  1NK0 A;  3CC4 S;  1YIJ S;  4HI2 A;  3DKD A;  4OL8 A;  1NND A;  3K17 A;  4NCB A;  3G96 A;  1YBA A;  4C8O A;  2MQQ A;  1QLN A;  4KT0 C;  4ZS6 A;  1JWW A;  2CVI A;  2MXY A;  3I87 A;  2MZ1 A;  1K44 A;  2BJ7 A;  5E3R A;  1Q4R A;  3NRB A;  2AJQ A;  3PFO A;  1B7Y B;  1Q8I A;  1T11 A;  1FDA A;  1SH2 A;  3I96 A;  2BJ9 A;  3NGK A;  1NKB A;  4ECZ A;  4B9T A;  5A6W A;  4PQA A;  4EMD A;  4Z2X A;  1R8C A;  1EHW A;  3KLI A;  1AYE A;  4PQU B;  1TL3 A;  3IGV A;  1IBM F;  3Q2T C;  4DL3 A;  4K2X A;  1UFK A;  1RGV A;  4C8Y A;  1K1Q A;  1XR6 A;  5MAO A;  4DPX A;  2VPX B;  3T41 A;  1J5O A;  2EI5 A;  1X0P A;  4HR2 A;  4OX9 J;  2WON A;  3C15 A;  4LF6 F;  2PO4 A;  4O3Q A;  4TY8 B;  3CME S;  5H9E K;  2YKN A;  1LW0 A;  2DNY A;  4NLT A;  3MXH P;  4BWM A;  3H98 A;  2SXL A;  5IQ6 A;  3S6E A;  4MK8 A;  3HXM A;  1FFG B;  3DM2 A;  3M6V A;  2GS8 A;  5BXI A;  3IP0 A;  2OMO A;  1LV5 A;  2WSE C;  4IO9 Q;  2AP6 A;  1LWF B;  4DV0 F;  2WVE A;  1DBD A;  3E2E A;  1MML A;  3I5B A;  1DLO B;  3T5H A;  1SJ3 P;  2KYX A;  3U27 A;  1CPZ A;  3PO4 A;  4DV6 J;  2CZ4 A;  1JB0 C;  3KJV A;  3D0H E;  5AXK A;  1BHN A;  3PX6 A;  6AT1 B;  4QCL A;  3EZ5 A;  4URG A;  2CG4 A;  4KO0 A;  3QAU A;  1LW2 B;  1HBN B;  3FEZ A;  4LF9 F;  4O4G B;  3OL9 A;  2VF3 A;  3QO9 B;  4JI4 J;  1TQL A;  2B9X A;  2IPO B;  4M94 A;  5I42 B;  4N47 A;  4DZD A;  1BLU A;  2WB1 D;  3V6H A;  4QU7 A;  3NCR A;  4CO1 A;  5CZV A;  3J80 U;  4DX6 A;  4WK3 A;  2QEX S;  1GK8 A;  2NXE A;  3LQV A;  1E6Y A;  2HPU A;  4LRB A;  1NJX A;  2GQC A;  4B3M F;  2IRX A;  3TZW A;  1JJH A;  1AZS A;  2WOM A;  3KMQ A;  3T9Z A;  1MU2 B;  5DJB A;  1VQK S;  3AJ2 A;  2ZZM A;  1VOM A;  2J0S D;  1N4L A;  3CJQ A;  1L3K A;  5KOW A;  2Y3Y A;  2GIQ A;  2ASD A;  4WP3 A;  4NRU A;  1NHV A;  3LGN A;  4JI0 F;  1RHK B;  3CIM A;  3L7O A;  4O0I A;  4I2Q B;  4CLW A;  1DAR A;  3LAL A;  5HBM B;  2DR5 A;  4Y6I A;  4ZCK A;  1PJ6 A;  2W7P A;  3MPW A;  4KE5 A;  3PVX A;  2G2Z A;  3Q8S B;  3OR1 A;  1KN6 A;  2EBG A;  1OY8 A;  2ZNZ A;  4CT9 A;  3WC2 A;  3PR4 A;  1RT7 B;  2XSF A;  2FLL A;  1JXE A;  1SH0 A;  4WFB Q;  3RRH A;  4DR3 F;  3M30 A;  2QLB B;  5LMN F;  4PXB A;  1NLK L;  3QRP A;  1QAI A;  3ZZT A;  5J2Q B;  2W2N P;  1OIA A;  5D4P A;  5HMW A;  4NXN F;  4ZPW R;  1V5I B;  4OIX A;  3D0G E;  2RQ4 A;  3LP1 B;  4N7T A;  1WOP A;  3V81 A;  5E3A A;  3OVB A;  1C1C B;  3POT A;  2L41 A;  1DHM A;  2I2Y A;  4RUA A;  4LRD A;  3P4U B;  4ECT A;  1VQ7 S;  2N3O A;  2GVD A;  1X4G A;  5AE1 A;  1VI7 A;  5B0A A;  1VFJ A;  2NSC A;  3KUH A;  4ECQ A;  2YNH A;  3OTE A;  5FD1 A;  3MM6 B;  1RZM A;  2W9B B;  3NAH A;  3GG0 A;  1HIY A;  5KG5 A;  1H7W A;  3VGS A;  1AFI A;  5IC6 B;  2YWW A;  1V3R A;  4LVN P;  4CM0 A;  4FYW B;  3BN7 A;  1FT8 A;  1DQA A;  4ZJL A;  1X4F A;  5E3Q A;  4PRF A;  1REV B;  2DPI A;  1SC3 B;  2DH8 A;  4PZV A;  3V6K A;  2UXB J;  4R8U B;  5FLX Y;  5J2M B;  5A2Q Y;  4I6A A;  5ETR A;  1S72 S;  5KFM A;  3U1M A;  4K8R A;  1U1Q A;  1PIL A;  2A6O A;  1RAO A;  1CC7 A;  2B4U A;  3EWG A;  2W2Q P;  3PG9 A;  2CUY A;  4L3N A;  1NDP A;  1RWO B;  4WFZ A;  1XMB A;  3WDO A;  1HI0 P;  2BW7 A;  3GWC A;  5J1E A;  3C16 A;  1T02 A;  2HKE A;  3NWR A;  4DPO A;  2AYB A;  1RWM B;  1FF2 A;  1IKY B;  3JTP A;  2HVI A;  3MR3 A;  3MCN A;  4FF2 A;  3SIP B;  4LFA F;  2EFQ A;  3BO3 A;  4O3R A;  3CWJ A;  2KH9 A;  2EPI A;  4AT1 B;  3QT6 A;  2O01 C;  3G82 A;  4LT6 A;  3HI9 A;  1KHW A;  1C4C A;  2J0Q D;  3IR7 B;  2BA9 A;  2JEF A;  4ES3 A;  2VD3 A;  1HAR A;  3LAM A;  1RYS A;  2ROE A;  1KD1 T;  3FJ2 A;  1KC8 T;  1PYS B;  4F8R A;  1DQ9 A;  3MR7 A;  4JV5 F;  4F3Q A;  1UCN A;  5CD4 A;  4GO5 X;  2BR0 A;  1OSC A;  2VKR A;  4OYZ A;  1YRX A;  2XY5 A;  3J81 j;  2KXH A;  5KFI A;  4USJ C;  3AB4 B;  1HWJ A;  2FVR A;  1KQF B;  1JNR B;  3R5B A;  2Q6B A;  2KJW A;  1NUE A;  3IWL A;  2NXN A;  3BH6 B;  4OHY A;  1ACM B;  2XZD B;  3QWP A;  2LA4 A;  2DT9 A;  3JQM A;  1S1U A;  2QE5 A;  4MT1 A;  1X60 A;  1ZA1 B;  3PO5 A;  4P7V A;  4ECU A;  3R5D A;  3RW7 A;  2DR8 A;  3DRP A;  3N4W A;  1VRQ C;  3CDW A;  3SFG A;  2C2N A;  5LXR A;  2ZKT A;  1TL7 B;  2IAJ B;  4NZ0 A;  2LXF A;  2WTF A;  1JLE B;  5DLF A;  1QD1 A;  3HD2 A;  5GMK a;  1UMJ A;  3W8P A;  4HVZ A;  1L5U A;  3H2V E;  3AY0 A;  3ISZ A;  1TUV A;  4G65 A;  3B82 A;  2W7A A;  3CCR S;  2ADC A;  2V2V A;  3JB9 k;  1N48 A;  3UN3 A;  2FZC B;  2OPS A;  2ZM6 F;  2FGC A;  3OJS A;  1ZM2 A;  4OI0 A;  5EWE A;  3ETM A;  4JI3 F;  2X1G A;  3QMQ A;  2BE7 D;  3ET6 B;  1X4E A;  3JSM A;  1YZ6 A;  2GIF A;  1RSC A;  4LFB J;  2ZBC A;  2J76 E;  3VAJ A;  4HYK A;  1UW9 A;  4LF4 J;  4U8Y A;  3D2W A;  4KHP J;  1K8A T;  1NCL A;  4F2S A;  3RB4 A;  1WG4 A;  1S99 A;  3THT A;  1FRH A;  4RW9 A;  4I7F B;  4K4S A;  3HFK A;  3M2V B;  2B0G A;  4KFB B;  4ID5 A;  2O5D A;  2A10 A;  1KVK A;  4M5N A;  3M6U A;  1Y4Z B;  3MUT P;  4FF1 A;  4DR2 J;  4FXD A;  4R25 A;  2ZH5 A;  3K8W A;  5SUH A;  5A6P A;  4I2P B;  1KWM A;  1XNR J;  5IFM A;  2E1C A;  1JLG A;  2EK1 A;  4R0J A;  3N6L A;  1OS5 A;  1HHS A;  2I8E A;  3VZI A;  4ZPC A;  1U2F A;  3OD2 A;  2LQ5 A;  5HRO A;  4K5S A;  2FHO B;  2JLF A;  3C6T A;  4QIG A;  2ZNY A;  1JKH B;  3TR5 A;  1VRU A;  2J8S A;  5HJY A;  2Y1I A;  1FCA A;  1GNK A;  4I69 A;  2HK3 A;  4ELV A;  1S49 A;  2ZJR Q;  5EX3 A;  3P3D A;  3MMC A;  5LSO A;  4DX5 A;  5A8R B;  2NSB A;  4E98 A;  2EK6 A;  3FSX A;  3NAI A;  3GSD A;  3HVR A;  3BO2 A;  1FJE B;  2JRS A;  2GML A;  3IC1 A;  3RUB L;  3SI8 A;  2LU2 A;  1VIO A;  1TK5 A;  1T9W A;  1RAD B;  4ENO A;  3QAE A;  5IS2 A;  2EFP A;  2QMX A;  1GX6 A;  1FJG F;  4OMF G;  1H6K X;  2VG5 B;  1Y11 A;  4F4Y A;  1Q0N A;  4M8L A;  2LVW A;  5E3C A;  3D66 A;  3JYT B;  4NA3 A;  2YQ1 A;  2BDP A;  3VAF A;  2HBZ B;  4G3I A;  5HAN A;  2RJZ A;  1HR0 F;  4NZ7 A;  1N5Y A;  3LO3 A;  2OML A;  4KQZ A;  2QT7 A;  4NL5 A;  1U0H A;  4XO0 A;  2HND A;  4DEZ A;  1D8Y A;  3K5M A;  1RT5 B;  5KFN A;  2XI3 A;  3D5M A;  1FK9 A;  2C2E A;  3QBC A;  2MST A;  4WKR A;  2HGL A;  1J5E J;  1RBO B;  1RI7 A;  3BS9 A;  2R2R A;  3LWL A;  2GHV C;  4N41 A;  1G1X A;  1A6L A;  2W2O P;  3NS6 A;  3WIV A;  5ETK A;  3HT0 A;  4KGZ B;  3D1O A;  4DR1 J;  4IYQ A;  3JAM Y;  3MAA B;  3FEY B;  2Z0G A;  2DHS A;  3CNQ P;  5L39 A;  1TL5 A;  3RR7 A;  4R0E A;  2A0F B;  1DTT B;  3CCT A;  2Z8Q A;  3U02 A;  2WVB A;  2FHK A;  3UDL A;  9RUB A;  4ILM A;  4U6P A;  4FF3 A;  2BJ3 A;  5JUM A;  5DRK A;  4LIR A;  2IC3 A;  1XC9 A;  2PGC A;  3DRY A;  2V8P A;  1LFW A;  2HVD A;  4ECY A;  4HTJ A;  1L3T A;  4FVC A;  4Q0B A;  5DET A;  4RNM A;  2A3J A;  1FWL A;  2ATC B;  3Q0A A;  5DZ6 A;  4DUY J;  1S1W B;  4B9L A;  4NLS A;  1TAU A;  3NOG A;  3LTO A;  4UY8 T;  3TAQ A;  4ECV A;  2HLT A;  1IKV A;  1WNE A;  5F8L A;  1RTD B;  3GTY X;  2KU7 A;  2VOP A;  2KT5 A;  1BWV A;  2VDI A;  3PJ9 A;  2HHQ A;  3SDE A;  2VQF F;  3RG6 A;  1QTN B;  3AA9 A;  5DDO C;  2E9R X;  3K89 A;  3LAK A;  4DV5 J;  1RT1 A;  1RT3 B;  4JI5 J;  4CZC A;  4YME A;  2EFG A;  3BR9 A;  3HMJ G;  4PWD A;  2BXJ A;  2B5J B;  5AJ3 F;  1K47 A;  2CQ0 A;  4ANE A;  3ENW A;  5HMX A;  1X0F A;  3BPS P;  2D9P A;  3IBF B;  4PWU A;  2OAU A;  3GV8 B;  2DH9 A;  2DEJ A;  3GR1 A;  3KUE A;  3G6X A;  4LF8 F;  2XSJ A;  1FDN A;  2QO3 A;  2PI5 A;  4DV4 F;  2JWN A;  3KYL A;  1X9M A;  1X5O A;  2Z2Y B;  1OPI A;  2GHW A;  4WCE Q;  2HHH J;  3RAX A;  2MKC A;  1X8D A;  2HVE A;  4FF4 A;  4LRE A;  4X4S A;  4HAC B;  5F0U A;  3UNY A;  2RS2 A;  1NHK L;  3I4H X;  3ZO7 A;  3MUM P;  4L6V 3;  1SKR A;  1K1S A;  4XTT A;  1PG5 B;  4CWB A;  2H4W B;  2OTL S;  4WE1 A;  1CJV B;  2OSR A;  3TA1 A;  2GW8 A;  2VQE F;  1WDT A;  4KKO A;  1OYE A;  2M3D A;  5I3U A;  4Y2I A;  2CIM A;  3MPV A;  1FJ7 A;  2UXC F;  1FXL A;  4LUB A;  2ZVI A;  2DGU A;  4OYI A;  3FZ2 A;  1GX5 A;  4LR7 A;  3QJL A;  3W64 A;  3Q8V A;  1PBU A;  3BQ0 A;  1C1B A;  4IOC Q;  2K06 A;  3OL8 A;  2HHT A;  1YVF A;  5BYR A;  1HNZ F;  3THV A;  2MB0 B;  1VMB A;  4LF6 J;  3GCW P;  1B70 B;  4WU2 A;  5HVH A;  5K14 A;  4K2J A;  4Q43 A;  1TL1 A;  3V4I B;  4O23 A;  3PHE A;  4H4K C;  4IG3 A;  3ZTO A;  1SB6 A;  1VC6 A;  4UOG A;  3MM8 B;  7FD1 A;  4IRK A;  1EZZ B;  4HEA 9;  4OYB A;  1FE4 A;  2BJD A;  1N32 F;  1RHQ B;  1IKW A;  3WZ0 A;  4QWE A;  1RTJ A;  4R5P A;  3FUY A;  4B3T F;  3T19 A;  2M8D B;  3VGV A;  1C0T B;  3IR5 B;  1QJH A;  1DFD A;  4OYP A;  4QWA A;  2ALZ A;  1UFW A;  3OTD A;  1W2I A;  4NOH A;  5EX0 A;  4CLS A;  1RQ0 A;  5C24 A;  3W1Y C;  2PFF B;  1LK5 A;  3NY0 A;  1LK7 A;  2QLW A;  1S79 A;  4AND A;  1HMV B;  1EP4 B;  4QPX A;  4PWW A;  2MPU A;  2BW2 A;  3FBC A;  5GAH I;  2P6S A;  2KXN B;  1S0O A;  3NP5 A;  3J7Y I;  1VJQ A;  2Q43 A;  3FRY A;  3IM8 A;  1N0V C;  2GHP A;  2VG6 A;  1YX2 A;  2LQB A;  1NU4 A;  5LJ5 Y;  4ZLP A;  3BDP A;  4B3M J;  2QRR A;  3RR8 A;  2ACM A;  3T1Y F;  3LWM A;  4C0O C;  1TMJ A;  3DOK A;  4P72 A;  1ZBT A;  2OFG X;  1YLX A;  2ZKU A;  3TAM B;  3L4B C;  1MWZ A;  2UV8 G;  3BR8 A;  3ILL A;  5GAD U;  1ITP A;  1FRJ A;  3ENQ A;  2MZQ A;  3M4X A;  3OXG A;  2D41 A;  1FWP A;  2F4V F;  2CJA A;  4H4M B;  2LLZ A;  1X31 C;  4YQW A;  3O1L A;  4C9D A;  3G6E S;  4DCO B;  4JI0 J;  1QE1 A;  1OJ4 A;  2HRT A;  4X62 J;  4IOB A;  2F3J A;  3Q8Y A;  3O44 A;  3LH2 S;  1RHR B;  3KK3 A;  3FBB A;  5H9F J;  4AYB D;  4OQJ A;  4GVB A;  2NZC A;  3MEC A;  3BKT A;  1SL2 A;  5CYJ A;  1GTE A;  3R8Y A;  5LT5 A;  1SKW A;  3O3L A;  5L1K A;  2ZWP A;  1VRT A;  3CW2 C;  1TKX B;  3CJR A;  2M88 A;  2AWZ A;  3DRS A;  2KT2 A;  3H5S A;  4MMO A;  4TY9 A;  1FVS A;  3MM5 B;  4M5I A;  5BR8 F;  3DLG A;  3FNN A;  1RLC L;  1KBR A;  2ZC4 A;  3WBZ A;  2XMV A;  3MMA A;  1MN7 A;  1CJT A;  1UVJ A;  1T94 A;  4Z37 A;  4C8M A;  1HFE L;  4CO0 A;  2CQP A;  3EPI A;  3CJ0 A;  4QPT A;  4RW6 A;  1EKS A;  1IWG A;  1FES A;  3HF5 A;  2VBY A;  2A2C A;  3HD1 A;  2BKN A;  2FTR A;  4IDK A;  7FDR A;  2D3U A;  1FKO A;  3EM1 A;  2QX0 A;  1VC0 A;  3K58 A;  2DGT A;  2RE1 A;  1WOS A;  1T9V A;  4FBT A;  4LSL A;  1OPZ A;  1AB8 A;  3BGL A;  5KFC A;  1MN9 A;  2G1D A;  5T14 A;  3I9V 9;  1H7X A;  4RKU C;  3OUY B;  1HLW A;  2KN4 A;  1P1T A;  3FQL A;  5D0H A;  4DX7 A;  3EDR B;  1UVI A;  1RWP B;  1WKJ A;  3IS9 A;  4H4O B;  4C97 A;  1SH3 A;  4FBU A;  4ZPD A;  1F2G A;  4FS1 A;  5KT7 A;  3F0N A;  2G13 A;  2MHN A;  5L9X A;  2QYC A;  1XNQ F;  3IA0 A;  5HP1 A;  2OO4 A;  4UOC A;  4C8N A;  4ZP7 A;  1HD0 A;  3MEE B;  3GJQ B;  1Y5N B;  1JLC A;  1XTZ A;  1OMS A;  3J80 Y;  1IKX B;  3AQP A;  2NS1 B;  4DU8 A;  2VC1 A;  5C5J A;  2XMK A;  1FKA F;  3DLE B;  1JJ2 R;  1JLF A;  4OJG A;  1ZZF A;  1K9M T;  4LIW A;  3OFG A;  1RUS A;  3M05 A;  1R89 A;  4FN5 A;  2ZH1 A;  1VQP S;  3PHT A;  3G8Q A;  5DM6 Q;  5KFJ A;  4J5O A;  2E44 A;  5IQQ A;  3OT9 A;  3PKY A;  5JVH Q;  4ZIV A;  2BOP A;  3EZU A;  3IG1 A;  3MMJ A;  5L1L A;  3AD8 C;  4P2S A;  4M5G A;  1HPZ A;  5KTQ A;  4PXC A;  3ZFV A;  2ASJ A;  1SC6 A;  1T95 A;  1R0A A;  1D09 B;  2K1R B;  3CCM S;  1VQ6 S;  3RAM A;  2M8H A;  3D6T B;  2CAJ A;  2Y9H A;  5CZX A;  4DDF A;  3C3L A;  2MMY A;  3A8E A;  4Q45 A;  3R2D J;  3C14 B;  3R7N B;  4F50 A;  4RNO A;  1MRO A;  1BWE A;  2CQC A;  5KAK A;  5J2P B;  2F7V A;  5HMZ A;  1TKT B;  1VQ9 S;  4U7C A;  4ICL A;  3MAQ A;  4MAK A;  1KON A;  4IFV A;  5LSR A;  3T5K A;  4DZ6 A;  4KGM A;  1Z2L A;  2XS5 A;  3TZX A;  3OFH A;  4BLG A;  3RBX A;  2V2Z A;  4NCG B;  3PYE A;  4F67 A;  1U47 A;  4ATN A;  1NM2 A;  3SQG B;  3M2U A;  3R97 A;  2LU1 A;  1WC1 A;  1JNZ B;  1TEL A;  2CQB A;  1NDL A;  1NB2 A;  1LKZ A;  3BN4 A;  3QNW B;  4HHJ A;  1F5B A;  1CLF A;  1F5A A;  1JLA B;  4XAK A;  1X4H A;  3OR2 B;  4YEA A;  4MFB A;  1NPR A;  1N8R T;  3VAK A;  1QUV A;  1EQ0 A;  3MMB B;  2VIH A;  3FEX B;  2OHD A;  2CWX A;  2Z2Z A;  4EEY A;  1I6J A;  2MQ8 A;  5F3T A;  5B0G A;  3KK1 B;  3LF0 A;  2B9W A;  3TAP A;  2LXU A;  3PY8 A;  4DG1 B;  3CJK B;  3CMQ A;  4CH7 A;  1VC5 A;  5DQG A;  2B9Y A;  3KNA A;  4N77 A;  2EXU A;  5HJX A;  3CCE S;  4B3S J;  3CT9 A;  4KPC A;  3T1H F;  1M5H A;  2HBY B;  2D3O 1;  5F0W A;  2HG4 A;  3H4D A;  4DFM A;  1XK8 A;  3C6U B;  4I6W A;  1YKW A;  5DGB A;  1YJV A;  3CD6 S;  2ZIT A;  1S6U A;  2I0X A;  2BM1 A;  3CJT A;  3W9H A;  1YRU A;  4WII A;  3W2V A;  4P2M A;  3N0V A;  4ZPB A;  2K2P A;  3R3T A;  3EMT A;  2YKM B;  4UQG A;  4M1K A;  4RUH A;  4EI2 A;  2MQL A;  2RIL A;  2KM8 C;  2KZZ A;  4ZVE A;  1N33 F;  5KFQ A;  3GIR A;  3PRB A;  3H2L A;  4QIV A;  3OTO F;  3DRR B;  1RE1 B;  1P9Q C;  3NEK A;  3PV8 A;  3I0S A;  1BC6 A;  1F3F A;  2YWH A;  4LRF A;  2Q1L A;  2PDA A;  3NCP A;  3CDB A;  1VQ4 S;  2P2C B;  1RAC B;  2OLW A;  2ROG A;  2BAN A;  3ILO A;  2KG0 A;  1MLA A;  1WHW A;  4Z7C A;  1HNV B;  2RIJ A;  3CD0 A;  3HKZ D;  3D6F B;  3J7Z 5;  3KLE A;  4JOU A;  1Q82 T;  1N5V A;  2DNH A;  3CCV S;  1ZET A;  2V94 A;  4V19 J;  1U09 A;  2VL1 A;  1H38 A;  4CO5 A;  2BE9 B;  2Y8W A;  1H2T Z;  2CJX B;  4CLZ A;  4ZVS B;  2LMI A;  3SEO A;  1FJC A;  2R4F A;  1VLY A;  1UTA A;  1CEZ A;  4DSE A;  4NLD A;  2COL A;  1BQX A;  1HR0 J;  4CTA A;  4WXO A;  2NPF A;  4I1T A;  4ZVT B;  1U45 A;  1KS2 A;  2JVR A;  2ZOM A;  3LPY A;  2Z2L A;  4O3S A;  2AGP A;  3HHL A;  3BPD A;  3AT1 B;  3CMA S;  1RLD A;  2G4B A;  4TYB A;  3GON A;  2J9C A;  3A8J A;  4RNF A;  2KVI A;  4DQS A;  2ALY B;  2B8P A;  2HBR B;  3UCG A;  1N6Q B;  2YNG A;  1J5O B;  2DXF A;  1M5V C;  4FPR A;  5F8I A;  1ZAV A;  8RUC A;  1WG1 A;  4ALZ A;  1QAX A;  1Y5L B;  2IJF A;  2CPZ A;  3PTW A;  3IRW P;  4ED0 A;  1NSK L;  2XCP A;  3FVY A;  2LEC A;  1CSJ A;  4DFJ A;  1PGZ A;  1F9H A;  1UEK A;  3MPD A;  4UOH A;  2Z56 B;  1D9A A;  2D3Z A;  4DS5 A;  2HIY A;  2A6M A;  2BYC A;  2HZV A;  1JLQ A;  3MPY A;  4DQQ A;  2G2O A;  1RTH B;  1X9W A;  1ZTW A;  5IT9 U;  3NS7 B;  2R8H A;  4WJB A;  3KLF A;  3TEH B;  1CUL B;  2AYM A;  2YKA A;  3GJS B;  3SCI E;  3KHG A;  1N56 A;  3MEK A;  2FLN A;  5DO2 A;  4M5H A;  3VAL A;  1FKP B;  4HTI A;  2RUG A;  2IA6 A;  4ED8 A;  4KY3 A;  4ZVH A;  4CO2 A;  2HEK A;  5KG1 A;  1EAR A;  4DSL A;  4U96 A;  4KO0 B;  1J2V A;  1T05 A;  1KSP A;  3KDO A;  4LJM A;  1LXJ A;  4IFY A;  3O2I A;  4C7Q A;  1FRX A;  5L1J A;  2VQF J;  1HW8 A;  4X65 F;  4B9N A;  2DB1 A;  3HSJ A;  3QIP B;  2R2U A;  1S97 A;  3QJJ A;  3W2W B;  1C0U A;  1RWV B;  3TAN A;  3K5O A;  3DYA B;  4ZP8 A;  1BQN A;  1F0X A;  2APO A;  3KWM A;  2JZ5 A;  2FVP A;  3J7A 1;  3CED A;  4FKX A;  1ARO P;  3WIU A;  2L9D A;  4RWW A;  2XYG B;  1H73 A;  3RAQ A;  4FS2 A;  2ZZT A;  4DL7 A;  1I94 F;  4ZHR A;  3W9I A;  2XBP A;  2V4J A;  4QBU A;  1S1X B;  2R7O A;  3NS5 A;  1WOO A;  4A48 A;  3HCX A;  5KFL A;  3OV7 A;  3G4S S;  1S1T B;  3OHA A;  1FA0 A;  3DLK B;  4LF8 J;  4Q44 A;  2R8I A;  2UUA J;  4O3N A;  2LEP A;  4RU9 A;  2LDY A;  4FXW A;  3CCQ S;  5D0E A;  4OZN A;  2JLE A;  3IXQ A;  1KOH A;  4WKY A;  4ETX A;  5C25 B;  5LMU F;  3BYR A;  2X51 A;  2E7W A;  3QGP A;  4NE9 C;  1Q8K A;  4FZV A;  1XMQ J;  3ELH A;  4EWT A;  3CO0 P;  4OHX A;  2KRB A;  1V3S A;  2A2D A;  2B6A B;  4PQU A;  3PJX A;  4UZC A;  1HNI B;  5KFV A;  1WUU A;  3DOM B;  1FXD A;  1UEU A;  3VAM A;  3HPO A;  5AXL A;  4KH1 B;  3OW2 R;  3FSI A;  2O66 A;  4TY8 A;  2X3G A;  3H90 A;  1Q86 T;  1H74 A;  4TLR A;  2DNG A;  3DMJ B;  3CCW A;  2QJ3 A;  4C8L A;  4WZM A;  3GYN A;  1HNZ J;  4M5J A;  1NSQ A;  2AYG A;  4DUZ J;  4WBF A;  1Z4U A;  5J1P A;  5C7P A;  1LWF A;  1TUW A;  4M5D B;  3CSK A;  5KG7 A;  3CF5 Q;  1R3N A;  2HAF A;  2P5V A;  4USV A;  5BYQ A;  1H98 A;  1Q95 G;  2GA7 A;  4IRC A;  2HZA A;  2C1E B;  2WW8 A;  2FYX A;  3MFI A;  5KT6 A;  4J91 A;  2W01 A;  2GO9 A;  1HD1 A;  3FBF A;  3S1T A;  4LF2 A;  1SQG A;  4DV2 F;  1N32 J;  1RBL A;  3W7B A;  1HI8 A;  3MZI A;  2IYG A;  1QSL A;  4F02 A;  1LW2 A;  1HBN A;  1N54 B;  1M5K C;  4O4G A;  1ZA2 B;  3P49 B;  2EFO A;  4AUK A;  3GFY A;  4C2M A;  3QO9 A;  2NZ4 A;  4K4Z A;  4IQM A;  5AXM A;  2H9Z A;  1MMD A;  4AQY F;  1LWE B;  2XG8 A;  1NH7 A;  5I42 A;  4NLR A;  2DRA A;  4IOA Q;  4ED5 A;  2AZ1 A;  3KXD A;  2F8E X;  3GZ7 A;  4PG8 A;  2XQC A;  2IHR 1;  4ZCL A;  4IH5 A;  1Q8L A;  3MTK A;  3TJ8 A;  4QYR A;  4YB1 P;  1S10 A;  3QSI A;  3FMB A;  3QYY A;  1CVJ A;  3IWX A;  4UOF A;  4JI6 J;  4LBH A;  1MU2 A;  4DR6 F;  4QYZ J;  2YTC A;  1C2P A;  3DDK A;  1XIQ A;  1M1G A;  1WEY A;  2XY7 A;  1GT8 A;  6FD1 A;  3BBB A;  4M5M A;  2WW4 A;  3BGU A;  3L7U A;  4WTY A;  1EAY C;  2GVZ A;  2ADB A;  5CYM B;  2WVD A;  4B3O B;  3D68 A;  2J7K A;  2ZWO A;  5KFR A;  3BSO A;  4I2Q A;  5HBM A;  1YG0 A;  2FD2 A;  3KDN A;  4NLU A;  4F0M A;  1N34 F;  4FVM A;  2XZT B;  1FWK A;  1KLM B;  4X64 J;  6FDR A;  4GKJ J;  5FJ4 A;  1RT7 A;  5KG2 A;  2M5Y A;  4UTG A;  1RDR A;  4UQT A;  1R8A A;  2XMJ A;  4NLV A;  5HVF A;  4IG0 B;  1X9S A;  2FB0 A;  2G0C A;  2X7I A;  5J2Q A;  1UW4 A;  3CD5 A;  1S1V B;  3CC7 S;  3RGI A;  3FFI B;  2WBR A;  1PKU A;  2WB4 A;  3LP1 A;  3AD7 C;  4UUX A;  2AJF E;  3PRV A;  1Y3J A;  2BJ1 A;  5HAT A;  1S1U B;  3DN9 A;  2FC8 A;  1JXV A;  4MKV A;  1I1G A;  5AE2 A;  1C1C A;  4ZK7 M;  2PI4 A;  2E5H A;  1Y3K A;  3UQS A;  2YNI B;  2XMA A;  3DRP B;  5JMN A;  2HYI B;  3EGW B;  2LYV A;  4F4Z A;  4JYA J;  4OX8 A;  2XWY A;  4F0K A;  2JC0 A;  2G0J A;  3MM6 A;  2ZOF A;  2W9B A;  3EGV A;  3FCW A;  3M6W A;  3MR6 A;  5H1S V;  4ZVR B;  1KTV A;  1UAW A;  3EUN A;  2RRB A;  3NBP A;  3E01 B;  2M4M A;  1T03 B;  1RAF B;  2EC0 A;  1U1K A;  5BYS A;  3NG8 A;  3V2U C;  3NGS A;  2HLU A;  4JB8 B;  1PBA A;  2W24 A;  2OPQ A;  4L3K A;  1REV A;  2ASY A;  4F4K A;  3A3P B;  4NA2 A;  3TO8 A;  2OPR B;  4R8U A;  2PFD A;  5J2M A;  1FTC A;  2IVM A;  2LEB A;  2ZFH A;  4KH0 B;  2R7W A;  1HQE B;  2DNQ A;  2DR7 A;  5KFT A;  3KLH A;  2HQC A;  1WJ9 A;  2FJB B;  2PC6 A;  1TFW A;  1WWH A;  1HWL A;  4JI1 J;  4J90 A;  2DEI A;  3MM7 B;  1ZM3 A;  1MWQ A;  1HNW J;  3OXL A;  4NAS A;  1IKY A;  1VR6 A;  2XUL A;  4MKA A;  4OHZ A;  2V63 A;  4YR3 A;  4XDC A;  2AT1 B;  3DXS X;  1VK3 A;  2X1A A;  4ZCI A;  1RAJ A;  2UUT A;  5IV4 A;  4TQR A;  4DR4 F;  5HSP A;  4U7U K;  2YX7 A;  1QAY A;  4NLP A;  1H2U X;  1FX4 A;  3D1H A;  3HDS A;  4J9K A;  2BQ3 A;  1XR7 A;  3SQO P;  2VA2 A;  1QTM A;  1Z1Z A;  3VAI A;  1XJW B;  3R6G B;  3PDN A;  4LVO P;  4CDI A;  3KG4 A;  2VB6 A;  3H0P A;  4B3R F;  3TJ9 A;  2DNM A;  3ZZO A;  1NJW A;  3EVW A;  5KT4 A;  2CWK A;  2AJ4 A;  3MTJ A;  3KHH A;  5KFK A;  4LRA A;  2CJY B;  1W2B R;  2J8A A;  4F7V A;  3MMC B;  2HQD A;  1UJ6 A;  3B4M A;  2ILY A;  3V6J A;  2OKQ A;  1GXU A;  5A8K B;  1XWL A;  3GFX A;  2P9E A;  1LWC B;  2C3U A;  3M9M B;  2FUG 9;  7AT1 B;  4XK8 C;  4G1Q B;  2LQ8 A;  5HAO A;  3PIP Q;  1GXT A;  4P9S A;  4ZVO B;  2IM0 A;  5D3G B;  4F36 A;  1X4D A;  3W8G A;  5D15 A;  2QFI A;  1GAO A;  4LF7 J;  1VLO A;  1YTY A;  1N36 J;  4A8K A;  3T6B A;  2NXJ A;  1F9F A;  2FVQ A;  1SQE A;  1TL7 A;  2P8I A;  4DR5 F;  2GIR A;  4EGL A;  1N5Y B;  2WCX A;  1JLE A;  3PAC A;  5E2Q A;  3X3U A;  4J9L A;  1U4B A;  4Q8E A;  3EE3 A;  2HS0 A;  1SJF A;  2DXE A;  2FHM A;  2UU9 F;  1NK6 A;  1SV5 B;  4LSN B;  3Q24 A;  3KHR A;  1H0H B;  2VOO A;  4C6A A;  1V9O A;  4ILL A;  2DRD A;  1X5S A;  1RP5 A;  1FNM A;  2EKY A;  2V9K A;  2CKW A;  2NRE A;  5C42 B;  1RWU A;  1FX2 A;  4K4X A;  3KLG A;  4F3M A;  1YRT A;  4DV7 J;  1NKC A;  2GC8 A;  3JQK A;  2I1R A;  4Y2K A;  3GMG A;  1IM6 A;  3Q23 A;  2LKZ A;  3M8Z A;  5CXT A;  2OPP B;  3TA0 A;  2YWK A;  4U8V A;  1UJ4 A;  1VQL S;  2RAQ A;  4WXW A;  1WHY A;  3SSQ A;  3P5T L;  5DZ7 A;  4ZLL A;  4I7F A;  1D0E A;  2ZOG A;  4YB5 A;  1YJW S;  4KFB A;  2JFK A;  4P6Q A;  4LR8 A;  1HNX F;  2ZE2 B;  4BBY A;  1P8G A;  3CJ8 A;  2CPD A;  1DZ5 A;  3G6Y A;  3SSR A;  2OIH A;  1NK8 A;  2IM3 A;  4DSK A;  4B9U A;  4I2P A;  4RW8 B;  5KG3 A;  3W60 A;  3O6Q A;  3OLB A;  3RZA A;  5E5N A;  4OFZ A;  3R27 A;  3ZTR A;  2Z57 B;  1ZYQ A;  2R7T A;  3IRX A;  1VDH A;  5T7L B;  3NNA A;  3DDN A;  4XIU A;  3T1A A;  4BC9 A;  1W25 A;  3QT7 A;  3BRE A;  2QMW A;  4ZVF A;  3M8W A;  4Y3C A;  1VQN S;  1RT2 A;  2R8J A;  1R0C B;  1JKH A;  4I67 A;  5JJB A;  1PAE X;  4USH A;  3W63 A;  2VBZ A;  1JX4 A;  4UST A;  1R8P A;  4TU9 A;  2K3K A;  2RDI A;  1N33 J;  2CVE A;  3BSA A;  3UD5 A;  3QGH A;  3B8H A;  2QA4 S;  4OYX A;  2O3D A;  4PG5 A;  2I5J B;  5L8R C;  3QRQ A;  2PT0 A;  5A8R A;  2HSE B;  4JI8 J;  3M8R A;  4L75 A;  2N7C A;  2MJU A;  3SCJ E;  5EUH A;  2MLY A;  3AD9 C;  4DV3 J;  4EO6 A;  4RBU A;  5KFH A;  4D3G A;  2DNL A;  1TKD A;  3JXO A;  2N4C A;  5B0D A;  3JYT A;  4OLO A;  2M52 A;  4L72 B;  3DU6 A;  3GYX B;  5C2C A;  4PYD A;  1S0M A;  3M2R A;  5EWF A;  1RA7 A;  2RRN A;  4WF9 Q;  3VAH A;  4TLQ A;  2HNY B;  5KFD A;  2GQ2 A;  1JIH A;  3N5B A;  2DCL A;  5E33 A;  3GR0 A;  3R2C J;  1JQG A;  1Y0H A;  1DAX A;  4AXI A;  2H54 B;  1IR2 A;  3GB0 A;  4ZLN A;  4EYI B;  2F40 A;  1HYS B;  2LQ9 A;  4EZ9 A;  2QYG A;  2HMI B;  2HFU A;  1GFW B;  5HN0 A;  3A3O B;  1TV6 B;  2X1B A;  2Q3P A;  3UDV A;  3PX0 A;  3TVK A;  2ZDO A;  1R27 B;  2OUG A;  3UVJ B;  3UNG C;  1CBK A;  4CLT A;  2KB2 A;  3MAA A;  3PW5 A;  1YWX A;  1GTH A;  4B17 A;  4BC7 A;  2HBQ B;  2NXU A;  3QLH B;  1DTT A;  2HHU A;  4X4P A;  4CO3 A;  2EFV A;  3E8O A;  3S8S A;  1LFP A;  5LM7 E;  1YJT A;  1TL1 B;  3IAS 9;  1F2H A;  2IVF B;  5KFA A;  5A8W B;  2BUN A;  3J7A N;  1Q7Y T;  3Q8P B;  5KFS A;  5F9L A;  2IM2 A;  2R7U A;  4IG3 B;  2FZG B;  4DCJ B;  4DF8 A;  3G86 A;  4G1P A;  1S1W A;  2L9N A;  5KFX A;  1KHV A;  3M6X A;  2I38 A;  2C3M A;  1RHM B;  2BEF A;  2F65 A;  2IM1 A;  3K0J A;  1RTD A;  2VG7 B;  2H5E A;  1HBM B;  4KJI A;  5B09 A;  3JSR A;  2ZVS A;  2JSX A;  4JI4 F;  2RNE A;  2ZD1 A;  1KQG B;  2JLG A;  1NBE B;  5D4O A;  3TQ1 A;  2HRU A;  3CDE A;  4ZVP B;  2V8V A;  4XPC A;  4YHH J;  4RW4 B;  1UWB B;  1KRP A;  2R9L A;  2ZBP A;  1S77 D;  5E41 A;  3ULH A;  1IQT A;  1L3V A;  1NZA A;  1RT3 A;  2F4F A;  4FPI A;  1YJR A;  2E1R A;  1H72 C;  2DJW A;  1RAH B;  1YQH A;  4J9Q A;  1GMW A;  3K5L A;  2WSC C;  4MIW A;  2FIU A;  2UZA A;  2VG6 B;  2F5G A;  2YX1 A;  3P45 B;  1WF2 A;  2XS2 A;  3CIZ A;  2CNL B;  2ZH2 A;  3UR0 A;  4HHU A;  2MY8 A;  2XY6 A;  2FLP A;  1DJ0 A;  2GFF A;  4DSI A;  3VV2 B;  4DPW A;  2ZHO A;  1NH8 A;  1M5O C;  3MD3 A;  3J81 U;  1OWX A;  5GAD I;  4RL1 A;  1CS4 B;  3ZNU A;  3M9N B;  1TKZ B;  4NLW A;  4B02 A;  4RZR A;  4HAC A;  4D3H A;  1VIS A;  3MCM A;  1FRK A;  3SBM A;  4GKK F;  2VOD A;  1FDB A;  4EBC A;  4KC5 A;  3HHL C;  1X4C A;  3KK3 B;  2HQG A;  1OY6 A;  2HFV A;  1B0T A;  1Q5Y A;  2VFV A;  1PIE A;  3GP9 A;  2QMU B;  3FSY A;  4OI6 A;  4RJV A;  4KSE B;  3OSP A;  1B4S A;  5KFW A;  1WEL A;  3AA8 A;  2FJA B;  3LPE A;  3JSB A;  4ZPV R;  3TI0 A;  1U24 A;  2N7Y A;  3THP A;  2FC9 A;  4KYZ A;  3CJS A;  1T9X A;  3KK2 B;  1VQ5 S;  4IKA A;  2DCU B;  2F63 A;  2ZBR A;  4N8N A;  2HQ3 A;  4ZLJ A;  2FJX A;  2VPY B;  3HKW A;  5HQL A;  4DF4 A;  1TFY A;  1Q53 A;  3IBW A;  5KFE A;  3V4I A;  1MWY A;  4DN0 A;  1Q5V A;  1VJW A;  4HLB A;  3H59 A;  2DKO B;  3QRR A;  3MM8 A;  3HSZ A;  3VWS A;  4MH8 A;  3BGR A;  2RRA A;  4W98 A;  8ATC B;  3DGP B;  1WOR A;  2EBE A;  3E51 A;  2MKH A;  5IT9 Y;  1C0T A;  2VU5 A;  1SJ4 P;  4RW7 B;  4ECX A;  4AD6 A;  3TEG A;  4Y2M A;  2UXB F;  2MGZ B;  4JBC A;  5K8O A;  1D1U A;  4P2X A;  2PD1 A;  2QSF A;  4O3O A;  3NL0 A;  2W7O A;  2C22 A;  1HMV A;  1RB0 A;  4PXD A;  1URR A;  3P96 A;  3K2Y A;  4UF4 A;  1RTZ A;  3ITH B;  2XLI A;  3GQC A;  2P6T A;  5GAH U;  2RQC A;  2NXC A;  4ED7 A;  1FRI A;  3J7Y U;  3N6N A;  4GVL A;  3OHB A;  1JLC B;  5EHH A;  2HVH A;  1XER A;  4PR6 A;  4ETZ A;  3CE8 A;  1XBW A;  1JLF B;  1FD8 A;  3TAM A;  2RML A;  4DR6 J;  1YJU A;  3ILI A;  3KJF B;  3TWZ A;  4WYL A;  3PW4 A;  3DRX A;  5B0F A;  3RBE A;  4YY3 J;  3I4P A;  2V8D A;  1ZZN A;  4A8O A;  3HFZ B;  2YKQ A;  4WK1 A;  3A8K A;  4H4M A;  2OEL A;  1IBL J;  2ZBQ A;  5LSL A;  3NXZ A;  3PW0 A;  3SYZ A;  3B78 A;  2C3Y A;  3NNH A;  2W1B A;  3R9L A;  3T9N A;  4DV1 J;  1T8E A;  3CCS S;  4OZ5 A;  4ED2 A;  2ZUG A;  3CVK A;  4OYA A;  3HHN B;  3R1L A;  2XMW A;  5A0Y B;  1S7I A;  1N34 J;  3M32 B;  4B08 A;  2J7W A;  2UXD J;  4JI7 J;  1MRO B;  1M5P C;  1DY3 A;  1TKX A;  1R8B A;  3D67 A;  2JX2 A;  1O0P A;  1FFW B;  3MR5 A;  3KOA A;  2V2K A;  4K4Y A;  1VK8 A;  4IFV B;  4MK7 A;  1VIX A;  4K4V A;  2MHE A;  5KG0 A;  3ZC4 A;  3BSN A;  3HVT B;  3TUI C;  2WVC A;  1Y10 A;  3G8T A;  4USI A;  2CZ9 A;  3VHQ A;  4EU0 A;  2CJB A;  1SL0 A;  2H51 B;  4DFP A;  3BZQ A;  2JVO A;  1R43 A;  4F4X A;  4DQI A;  2GJI A;  5CD4 H;  1YI2 S;  2E5L J;  2QSW A;  4USW A;  4F25 A;  1GMU A;  1U1O A;  3NNC A;  1IJF B;  4UW2 A;  5ETQ A;  2UUB J;  2B4V A;  5CH7 B;  1EX8 A;  2RB7 A;  1M0S A;  1N5S A;  2GAG C;  5D78 A;  1GQE A;  3HSG A;  1KFS A;  3K7R A;  2KT3 A;  2NR0 A;  4K0K J;  1YSJ A;  4RR5 A;  1DQ8 A;  2LA6 A;  5CYQ B;  4LFB F;  1Z2Z A;  2VDH A;  3DLJ A;  2EEY A;  3EDQ B;  3R5A A;  2RU9 A;  2YKO A;  3RYL A;  2YXL A;  1WF0 A;  4KHP F;  3L7P A;  3MWB A;  2OFH X;  2YNF B;  4GO7 X;  2MSS A;  4AL7 A;  4EBD A;  4V19 X;  3MEE A;  3DXB A;  5DDR C;  1FO1 A;  4UUW A;  1LEO A;  1O51 A;  1IKX A;  1IR1 A;  2XI2 A;  2J0X A;  2PMW A;  3DLE A;  4E8U A;  1A9N B;  1G4C A;  3PXG a;  4KIA A;  1P1L A;  4L76 A;  1CJK B;  3Q22 A;  2C2R A;  2MEW A;  2B3T B;  1XNR F;  1S0V A;  2L48 A;  3DC2 A;  3FCH A;  3MCO A;  4PYA A;  2GGP B;  3CUN A;  5HLF B;  4L74 A;  5H9F K;  1EET B;  4LF5 J;  4Y0F A;  3RB0 A;  2N82 B;  2CDR B;  3OFF A;  4FNH A;  3BO4 A;  3PKM A;  3DDI A;  2E1A A;  2DIT A;  2E29 A;  2J7U A;  2HZC A;  4J9U E;  3HSD A;  2VJV A;  2YWF A;  2BAC A;  1UPM B;  1FNX H;  4NXM J;  1FEH A;  3C14 A;  4PXE A;  1HA1 A;  3DFE A;  3EIC A;  5CCL A;  4CLF A;  4ED4 A;  2RQK A;  3GCX P;  5J2P A;  4DN9 A;  4PG4 A;  1QDU B;  3C66 A;  1TKT A;  3LP2 B;  2XMT A;  1IBK J;  1YJN S;  3P8B B;  3VQS A;  5EDW A;  4CP5 A;  1HBU B;  2LCW A;  4X4Q A;  2BAN B;  3BEG B;  4KGV B;  1E6V A;  4OZ3 A;  3M1V A;  1TVR A;  4NCG A;  5D4N A;  2BVZ A;  3ONQ A;  2DRB A;  4FXV A;  3SQG A;  1S9E B;  3OVS A;  2HWH A;  2W25 A;  4RNN A;  3D28 A;  2MKK A;  4J9M A;  4OZ1 A;  4OZ0 A;  2DHH A;  4P73 A;  2L9W A;  2X3D A;  5J2N B;  4OI4 A;  2ZHA A;  3CDU A;  1PYO B;  2V6A A;  3QFW A;  3MUR P;  4DR5 J;  5IWA J;  5GME A;  2XWX A;  3BGF A;  3OR2 A;  4FP9 A;  1N5Q A;  1HQU B;  1UP1 A;  3MDF A;  1VS3 A;  2OSQ A;  2PEB A;  4USU A;  1KP6 A;  4LMZ A;  3GFZ A;  3ZTP A;  1JK9 B;  3MMB A;  4DOZ A;  1ZM9 A;  3EPG A;  4CYU A;  2IBK A;  4CRJ A;  3HZE A;  4DR1 F;  2WHO A;  4LR9 A;  1NXI A;  5B0B A;  2AX1 A;  5IXU A;  5D8H B;  5C2G A;  1NO8 A;  4HI1 A;  1UJ5 A;  4V1A k;  3N28 A;  1UVM A;  1O5J A;  4ZN1 A;  1YJ9 S;  5ETS A;  1WDD A;  3CJK A;  2FQQ B;  2EKN A;  4YB7 A;  2HIQ A;  2AJ2 A;  1KVJ A;  3CCJ S;  1YBT A;  3UE2 A;  5M2P A;  2XTJ P;  3I0R B;  4DUY F;  1B0V A;  5GAE I;  5DG9 A;  1KNZ A;  3C6U A;  1A0O B;  3TVY A;  3KLF B;  4QR1 A;  3LOU A;  2CPJ A;  1VBY A;  2DR9 A;  2MYF A;  5DG7 A;  3NGU A;  2CQ1 A;  3EVM A;  4KB7 A;  3QQC D;  2VHG A;  5HK4 A;  2YKM A;  4MIB A;  4TU8 A;  1IR0 A;  3D7S B;  2GQQ A;  2C42 A;  4KV8 B;  4DV5 F;  2YVS A;  1X5T A;  3W5Z A;  4JI5 F;  5J1N A;  1S6P B;  2IJR A;  3R5C A;  1SJR A;  2V69 A;  3PYD A;  3HP6 A;  3DRR A;  1W7W A;  3HVA A;  3MEG B;  3SV4 A;  1BXN A;  3MF5 A;  1HBO B;  1GMW D;  1Q1K A;  4HL9 A;  4PUO A;  1TU0 B;  2DYA A;  3I31 A;  4L73 A;  3ZXW A;  4IO1 A;  2OH2 A;  4KPY A;  2KRR A;  3IO1 A;  2J9D A;  1VQ8 S;  3GE9 A;  3AAW B;  3ISN C;  1S0N A;  4Y28 C;  4A47 A;  4RNH A;  1IBM J;  4J9O A;  3QJP A;  4U9R A;  1F5C A;  2CQ2 A;  4TN2 A;  2DO0 A;  2W2M P;  3DU5 A;  2HUR A;  5T41 A;  2GMJ A;  4P71 A;  4A8F A;  4N8O A;  1NJI T;  4O3P A;  1Y5I B;  2W9C A;  2CG8 A;  1U1L A;  1D3W A;  4GMK A;  2BX6 A;  1Q7L B;  3OFE A;  1AUS L;  3TX0 A;  2VFS A;  4BHQ A;  1AT1 B;  3R5J B;  4QWD A;  3RJM B;  3KG0 A;  5E3P A;  4USM A;  3OL7 A;  2ACY A;  1U2R A;  5F8M A;  3HFV A;  1R6V A;  2M9K A;  1ZH5 A;  4DV0 J;  3VQT A;  3NLC A;  2W9A A;  2WK4 A;  3LGM A;  1N6Q A;  2PEH A;  4AL6 A;  1VYA A;  4Q2M A;  2QLJ B;  4NZ6 A;  2IY5 B;  2CYY A;  5RUB A;  3WHI A;  4A8X A;  2P9G A;  2LDI A;  2DIV A;  5DGA A;  4NYO A;  4LF9 J;  1RWK B;  2B4O A;  4Y00 A;  2MZJ A;  4A8M P;  1K73 T;  1B64 A;  3IN5 A;  1TR0 A;  4NMX A;  1RTH A;  3EX7 B;  4RPF A;  3OTB A;  1CUL A;  5ETM A;  2M2B A;  2R7S A;  2CPI A;  4MYT A;  1LXN A;  2OEJ A;  3I56 S;  4A8Q A;  4EO8 A;  2AGQ A;  1VCT A;  4M63 A;  3UWT A;  1FKP A;  1QUP A;  1AA1 B;  5K8M A;  2C2D A;  5L9N A;  3GSI A;  2QN6 B;  1N52 B;  1WG5 A;  2Q6C A;  2W8L A;  2XNQ A;  1BUX A;  1UL3 A;  4DLE A;  1WEZ A;  2AYE A;  2PMZ D;  4KHR A;  1U1R A;  1RT4 B;  3QIP A;  1N0U A;  3GIK A;  4Q8F A;  1NDC A;  4ZDN A;  3W2W A;  2MKS A;  4NEY A;  2FY1 A;  3D6M B;  3DYA A;  5D4L A;  4QR0 A;  2OD6 A;  2Y8Y A;  2O1P A;  4DJB A;  1OYD A;  2C2M B;  2HNZ B;  1F60 B;  5IM0 B;  4F4W A;  2HFZ A;  1U1P A;  3SCK E;  2P9C A;  5ETP A;  2LXI A;  3D4J A;  2RKI B;  2K3I A;  1TK8 A;  2RF2 B;  4U7U D;  2EWH A;  3UW1 A;  2VA3 A;  3NCQ A;  3LAN A;  1S1X A;  5ETL A;  4NI2 A;  4WIQ A;  2YPY A;  3DOL A;  1S6Q B;  5IT4 A;  1WC4 A;  1U26 A;  3M9O B;  1DTQ A;  3J7Z T;  2WBM A;  1S1T A;  2GVZ B;  4DR3 J;  3DLK A;  3GU0 A;  2QL5 B;  3JTO A;  1NME B;  5LMN J;  2HGM A;  2BQR A;  3M8Q A;  3ICL A;  3FDS A;  4NXN J;  4X62 F;  1NHU A;  2AMC B;  2R3V A;  2WZ1 A;  4ED3 A;  2IFX A;  2AIR B;  2IRY A;  3D9B A;  5C25 A;  4W92 B;  2B8Q A;  5LL6 d;  1ZTT A;  3U7J A;  4WU3 A;  3VR1 A;  4GKK J;  3BF4 A;  5CHC B;  3RW6 A;  2YWG A;  4DXL A;  2C3P A;  4NWB A;  2V4R A;  1SUQ A;  5KT3 A;  2KFZ A;  2J0W A;  2B6A A;  4QWC A;  2QL9 B;  3MUV P;  1K0T A;  2RVJ A;  2VC0 A;  1HNI A;  4YFU A;  3DOM A;  1NJZ A;  2KDO A;  4RUC A;  3EGN A;  1WKL A;  2BE2 B;  4EK2 A;  4DS4 A;  2DVI A;  1APS A;  3UDC A;  2J5A A;  4J9V A;  4EFA C;  3DI6 B;  3HVW A;  3DMJ A;  1S76 D;  5HO4 A;  3SSS A;  4C0B A;  4F04 B;  5GMD A; 
#chains in the Genus database with same CATH homology
 2BJ7 A;  3BKF A;  2CAD A;  2NZC A;  2F1F A;  2BJ1 A;  1Q5Y A;  3BKT A;  2HZV A;  2WVB A;  3QSI A;  2PC6 A;  3PHT A;  2FGC A;  2WVD A;  2CA9 A;  3BKU A;  2BJ8 A;  2WVE A;  2BJ9 A;  2WVC A;  3LGH A;  2CAJ A;  2BJ3 A;  2WVF A;  3OD2 A;  1Q5V A;  2Y3Y A;  2HZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...