3PHTA

Crystal structure of h74a mutant of helicobacter pylori nikr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
115
Chain Sequence
IINGYSSRSELVRDMIREKLVEDNWAEDNPNDESKIAVLVVIYDAHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords Putative nickel-responsive regulator
total genus 29
structure length 115
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3phtA01
3PHTA 2BJ9A 2WVEA 2HZAA 2F1FA 2HZVA 2WVCA 2CA9A 3OD2A 2WVBA 2WVDA 2PC6A 3QSIA 2BJ7A 2WVFA 3BKUA 1Q5VA 2BJ1A 2FGCA 2CAJA 1Q5YA 3BKTA 2NZCA 3BKFA 3LGHA 2CADA 2Y3YA 2BJ3A 2BJ8A
chains in the Genus database with same CATH superfamily
3V4IB 4QQBA 3D7SB 1RT1B 4NLQA 2OH2A 4ANDA 3O6QA 2IA6A 1S57A 1CJTA 4EZ6A 3V6HA 1ZOTA 1OYDA 2BBEA 3IS9B 2V8DA 1WC1A 1OMSA 2XCPA 1RWPB 5F9LA 2BKNA 1NBEB 1VQMS 1HNVB 1SUQA 1U8WA 2B4UA 1RAFB 2YWEA 1NSKL 3PYGA 2XZTB 3H7HB 4ZN1A 2QL7B 3IN5A 3W3SA 3DRPB 1SH0A 5HMYA 1KVJA 2ZHOA 1N54B 1QUPA 1NJZA 1RT3B 1T7PA 2H48B 3POTA 4X64F 2RKIA 2K1RA 2UUBF 2GJIA 2W2QP 2XMWA 2DHGA 3MDFA 3M30B 4YMEA 3IRWP 4DQIA 3SCLE 1C4AA 3PRBA 5DM6Q 1XWLA 2ILZA 4OFZA 2FJBB 1NZ8A 2HAIA 3MM9B 2V4QA 1UJ6A 1HBNA 2E1PA 3CJ8A 3DDKA 3KJNB 4BS2A 4CO2A 3R1HA 3PW2A 3H8YA 1UMJA 2GIRA 3CF5Q 4J90A 3FBEA 4O4GB 3CCVS 1FNMA 1IN0A 1RGVA 2IRYA 5D0HA 4C8MA 4HTIA 3PACA 4OL8A 2X3DA 3G71S 1CJUA 3ELHA 3UO0A 3PX4A 2ZVSA 4H4OB 4WF9Q 2BJ7A 1AA1B 2YKOA 3M2RA 2CJBA 4U9RA 4Y3CA 1SCJB 1TR0A 1XN9A 3AOCA 3TEHB 2BJEA 3MMJA 1GTEA 4OJ1A 4G3IA 1J5OB 3FEYB 4BCAA 1FD2A 3CDBA 3NCPA 5AE2A 3H20A 4OX7A 4Y0FA 1RAHB 1A0OB 2YKNB 3G9CA 1RHJB 2P8IA 3IRXA 4F4AA 3NGKA 1MU2B 3ENAA 3J7Z5 1T03A 5H1SV 4CH1A 2Q1LA 2HAFA 1NK8A 3OQ2A 4F2RA 1ICEB 5L46A 1WF2A 3MXHP 5J2NB 3P5BP 5ETSA 5HAOA 2APOA 4DV0J 2MKSA 3RB0A 1VDHA 1XR7A 1KQKA 5C42A 3JB9k 3DNCA 3BB5A 4IG0B 4ZVGA 4LVNP 5D3GB 2V9WA 2VPWB 4LQ9A 3W8GA 2DNKA 2XNQA 5KG5A 4YY3F 3NY0A 3ZZPA 4OI2A 3J81j 2NZ4A 4ANEA 2L3MA 3IBWA 1FO1A 1XR6A 4X66J 2F8HA 3OBIA 2DGTA 1PYSB 1TZ0A 2YX1A 5KFVA 5D0EA 1HNVA 2HFUA 3PM9A 2FQQB 1HNXF 4DR3J 2MKCA 4J9QA 2AF6A 2KVQE 2OAUA 1CJKB 1UA0A 4L6V3 5D0GA 2JH3A 1WSRA 3NEKA 2FUG9 1S4FA 3LUYA 4PXDA 3L09A 1ZYQA 2MQPA 1F3FA 1ZPWX 3DYAB 2X1AA 3U1MA 1WI8A 5CA5A 4DL6A 5CABA 1QAJA 1SV5B 2BM1A 3VAMA 3NL0A 4ZK7M 2V5HG 1MROA 5DS7A 1LKZA 3NNCA 4ZCKA 5B0FA 2VUGA 1RWKB 1TKZA 1YRUA 4J9UE 2F9DA 3P6YC 2BQUA 3DI6A 1RTJA 5KT7A 4DMZA 2VQFF 4J9NA 3EE3A 5F3TA 3JSMA 5FJ4A 3OTCA 4GKKJ 2IBOA 1WSVA 2RRBA 3S1TA 2CNKB 1T9XA 3MAAA 4OZ1A 2DEJA 3VZHA 3TZYA 5KFWA 3T1HF 2KB2A 1N8RT 1NZAA 1S76D 1C4CA 2MJUA 1Q1KA 3H5UA 3KHGA 2VFUA 3HFVA 3JTPA 5KFXA 1PKUA 3LAMA 5DGBA 4IO1A 1X5SA 2J7UA 2MQMA 1OPZA 3SCJE 2VZ9A 1RTHA 2UZAA 1UCNA 2Q6CA 5CD4A 4OYMA 4ZVTB 1D9DA 2E7VA 4X62F 1BWVA 1X7VA 1U47A 1BUXA 2JLGA 2WW8A 5KFPA 1RAJA 4ID8A 4QWEA 2VJVA 3BJYA 4DSIA 1RT4B 2D3UA 3HHKA 5DLFA 1H6KX 2WRMA 4X4PA 2CQBA 4DR4J 3B4MA 3Q8VA 1CJVA 1TV6A 2PEHA 3C19A 3AXMA 4TYAA 4YR3A 3M8SA 1HHTP 4K4XA 3HDSA 2MXYA 1ZM2A 2MZTA 4DN0A 2GV1A 3BGFA 2UVRA 3G8QA 1HMVA 2CJYB 5G0RA 3ZZRA 2EBEA 3S8SA 4JI1F 1O8BA 2NSBA 4IFYA 3N28A 2HRYA 5KFKA 2FLLA 4C2MA 4CLLA 3K0JA 1HWIA 4G1QB 2GHWA 5HROB 5I3UA 3THVA 2K3KA 3T5KA 4OI3A 2Z4PA 4KQZA 2CPJA 1UEUA 3CD5A 4NZ7A 5E7OB 3W62A 2J5AA 4AQYF 2XHWA 1TL5A 2L9DA 3SDEA 1TL7A 1IKWA 1YZ6A 5AXNA 4P2XA 3RGIA 1TK8A 4RPFA 5K8OA 3M8QA 1R0AA 4U7UK 2CQ3A 1ZBTA 2GMHA 2QL5B 3OTOJ 2WONA 4FPRA 2LQ9A 3JSRA 3PZPA 1IWAA 3F41A 2VBYA 4N47A 5A2QU 2LXUA 1F2GA 1M5SA 1TTHB 4F04B 4DQQA 3CDAA 4KHMA 1Y7PA 4A8SA 3H2UB 3CJ2A 2VC0A 5F9NA 4PEOA 2W2NP 3DXBA 3TWZA 4JV2A 5IM0B 2GMLA 3D6TB 3MM8A 3W2WA 2HQ3A 2BANB 3TR5A 1PJ7A 1SH2A 4ES3A 1SVDA 1X4HA 1KTVA 4WCEQ 1CJUB 2AEJA 3V6JA 1L3UA 1RQ0A 4FPIA 5CYQA 1T3NA 4TY8B 2R8GA 1CQMA 2V63A 2VBWA 5KG3A 1KEKA 5J1EA 3HHLC 1HKAA 1TL1B 2QA1A 2LXFA 3MEDB 3HT0A 3QSIA 3MR5A 1TP7A 3TZXA 3IG1A 2KN4A 3BSAA 2HNDA 4KJIA 1VRUA 3P3DA 1F3VA 2VBXA 1KWMA 1Q5YA 2W24A 3D0HE 3D9BA 1MU2A 2HBZB 3N4WA 4NEYA 1LW0B 2HQIA 3BKFA 1IR2A 3GIIA 2ZOMA 5GAGU 2QFIA 5KAKA 1FNOA 2JFKA 3D0IE 3EZUA 3MR7A 1R3NA 4E8UA 3Q8QB 4EK2A 4DV5F 3MCMA 2DY1A 1QJHA 3IM9A 4A47A 4NLRA 3HFZB 2OD6A 2YQ3A 2N3LA 4K4UA 5D4OA 2FLOA 1VRTB 4UQGA 4C3KA 3EMTA 4P2SA 5D78A 2B9XA 1QAYA 4S0MA 2YWWA 2WVBA 2AMCB 3H2LA 4UOGA 2C28A 1XNQJ 5LJ3Y 4B3RF 1UZDA 2ZBPA 5FLXY 2EBGA 2ZJPQ 3V6DA 1KBRA 4M5HA 4ZOSA 5D0RA 3U02A 2JDJA 4RW8A 3EM1A 4K4TA 4B9UA 1FESA 3OPKA 3N5BA 3Q8UA 4DQPA 1NHUA 1F6TA 2CZ4A 2HWHA 4NASA 4B3TJ 2IBKA 4R5PA 2HMIA 2HVZA 2M3DA 2E44A 4JB8B 2VG5A 4PABA 4DR3F 4KPYA 4GC7A 1H0HB 4OHVA 3IA0A 3QGIA 3C6UA 4OX9J 1N0UA 5KFNA 3K58A 3PW5A 2W2PP 2YNGB 2FYXA 4NLOA 1CC7A 2GGPB 3R6LB 4DN9A 5MAOA 4MAKA 4PG6A 4U6PA 1HBMA 4CZCA 4FVCA 1WC3A 4ZP8A 5B0EA 4QOTA 2R9LA 5EUHA 1L3KA 1QTMA 1FVQA 4FF4A 5LMNJ 2ZWPA 1KC8T 1VBKA 2LQ5A 3MPDA 1Y0HA 1WI6A 2OIHA 5KFLA 4WXWA 1FX2A 2U1AA 2MMYA 3WZ0A 1FKAF 1RJJA 3C14A 4YY3J 4EBDA 1MG7A 1YJ9S 2HHWA 4B9LA 3CT9A 2ZKTA 1HYSB 1RU2A 4F67A 5GMEA 4PAAA 1ROFA 5DG9A 2ZBIA 5KFMA 1X9SA 2YKAA 1IBKF 3UCZP 2XS2A 1YQHA 1U0HA 3I4PA 2BRKA 2AJ1A 2C42A 2XHCA 1RHUB 4LF1A 3CJKB 4IRKA 5KFRA 1D9AA 3MM6A 1IR1A 4C6AA 3CC4S 1YIJS 2R8KA 3JYTB 5IT9Y 2RS8A 2XLJA 4ZPVR 3T6BA 2D9OA 3NBPA 3RRKA 2K8GA 4XPEA 1PYOB 4MFBB 1XNRF 2RUGA 3DKDA 3DOLB 2DNRA 3AHPA 4OLPA 4U8YA 4USVA 5M2PA 5IT0A 4DLGA 4F36A 5GVQA 5IV3A 3P45B 4C3LA 2W9BA 2PEBA 3KLFB 4LRBA 3NGRA 3VAIA 3HHEA 3R7NB 1T05B 4Q0BB 3R3TA 3NKYA 4CLSA 1JKHB 4CM2A 2CKWA 5KT5A 3CB4A 2VD3A 4IG3B 2VB6A 4XDCA 4CNZA 5A6PA 5IFMA 4DFPA 3FCWA 2R7RA 1KHVA 3DOKA 1GMWA 3QFWA 5KFOA 4O3QA 4QCLA 4GKKF 1X4CA 3OFGA 4G1QA 4BLGA 1C0TB 5B0AA 1SKWA 5CYMA 2N82B 5KG6A 2I38A 3M8RA 2VG5B 3NGTA 1VRUB 2DJWA 3FDSA 3MR2A 3LPYA 5HATA 1Q7YT 3C16A 2XS5A 3VR1A 2OPPA 4USMA 4OI0A 2LU2A 2A6OA 2V68A 3AQPA 3DHXA 1R27B 4C48A 2DY9A 2R8IA 3GWCA 4TVAB 2B56A 3V4IA 4ED5A 2MQNA 3KHHA 5BYRA 1QVFR 2ZC4A 2HK2A 2M2BA 3W2WB 3OV7A 2BR0A 2UP1A 3PHEA 1EIYB 1RLCL 4JV5F 1E6VA 1R89A 1FKOA 4IH5A 4YN3B 3SEOA 3BPDA 3TI0A 3DRRA 3U7JA 2OFHX 1WHYA 1OPIA 2B7BB 2O5DA 4H4KC 1U26A 4ZIWA 3V4MA 2ZM6J 2B6AB 1QSYA 3HD1A 1QUVA 1T9TA 2MHNA 2M8DB 4K4SA 2HVIA 1Q78A 4X65J 3BBBA 4W4MA 4TY9A 1FKPA 1FRJA 3R5AA 4ECVA 3M8YA 3OR1A 4JV1A 4ZVFA 4RW9A 6AT1B 3KG4A 5LM7E 1YJWS 1T03B 2H5IB 4K2JA 2A6MA 3N79A 4LIRA 2B9EA 4A8FA 4YB7A 2YNHB 4OYXA 1XC9A 4F3OA 1Q53A 2MZJA 1FI4A 1U09A 4MIAA 1X60A 1EKSA 2NS1B 2Y3YA 3SXLA 3C6TA 2K1RB 4DQRA 1U4BA 3CMQA 5SUHA 2RQ4A 4UOHA 3OFFA 4CRJA 1OY9A 3DOMB 3R5DA 4ETXA 3CCUS 3OVBA 1AUDA 1R43A 4RW6B 4UTGA 2XZWA 4YS2A 3RUBL 1KRPA 3QPIA 1U24A 3OXLA 1GX5A 2EFPA 3QFHA 1J5EJ 5KOWA 1WF0A 3ADAC 3DFEA 4P7VA 3HMJG 4Z37A 2HNYA 1YDLA 4DV6J 4XAKA 1NKCA 2PC6A 3N5FA 3A8IA 4FP9A 4IRDA 4C0HA 2FJEB 4PKDB 3EDRB 4ZPCA 3V6DB 2F8MA 4USKA 1TFYA 2BDPA 4QWDA 4MT1A 2Q79A 4M5DB 2J0SD 3UCUP 2LCWA 1U6FA 5DQHA 2GAGC 4IDKA 3CXCR 3TJ8A 5J2NA 4DUYF 4PUOA 2V50A 2YKQA 4G1PA 2N7CA 4WBFA 2YX4A 3CJQA 1IXKA 1O51A 4NMXA 2FLPA 3QZ8A 2KT5A 2YWGA 2NSCA 3DMJA 4I2QA 1BQMB 1QSSA 5LSOA 1K1SA 2JVRA 3MM7B 3MTJA 5BJRA 1CBKA 1HLWA 2AJ4A 2KG1A 5ETNA 2AEFA 4IFVA 4XDDA 1KLMA 1HQEA 4C8KA 1KLNA 4RUBA 4X4VA 5C24B 1VMBA 4KGMA 2JNJA 2AJFE 5DRKA 3THPA 4B02A 1WOPA 4GO5X 2XYGB 3SIPB 1SJQA 3PW7A 1SQEA 4J5OA 1NJYA 2HKEA 1MW7A 1YWXA 1GT8A 2OO4A 1TMJA 3DGPB 3MWBA 4KGXB 4FKXA 4QIWD 4EGLA 5DDPC 4DFMA 5HN0A 4KRWA 3OHBA 2CWKA 4FNHA 4HTJA 3CCJS 5I42A 1JJ4A 1TKTB 3P4UB 2MZRA 3ISNC 1S1WB 3BSNA 1F9EB 2PN6A 2FJAB 1DQAA 2DGSA 3UDCA 5U47A 1VBZA 4U8VA 3S6EA 3ZFVA 3I0RA 4CO4A 3GIMA 4JYAF 1VIOA 4WIIA 2HHVA 1U1RA 2RIJA 3CPWR 2DB1A 2ZBQA 4DU7A 2V2ZA 6FDRA 1YHQS 4LF5F 4NLGA 5CQGA 2WVCA 2H54B 4A8XA 3ZNJ1 1HNIA 4WJBA 4CO3A 3K59A 2O01C 4CLUA 1RBAA 1FRMA 1SC3B 3IRXB 4OMFG 2JJ4D 3GJRB 1H7XA 2E1AA 4NOHA 2DHSA 4DEZA 3KHRA 1XTZA 1KQGB 2WVFA 3CCQS 2AKWB 2VFRA 5C42B 3UD3P 5GAGI 1YBUA 3IM8A 1L5UA 1IKXA 3RBXA 2OPRA 2PA3A 4LBHA 1URRA 4CNYA 5DLGA 4YQWA 4QR2A 3I87A 3RBZA 3TX0A 1IVZA 3MEKA 3TA1A 5GAEI 5KFQA 1S48A 2RD5C 1X4FA 2YBVA 3ISZA 2VA2A 2BMBA 1N34F 1IUJA 3CC2S 2CPYA 3QMQA 2E5HA 4ZVQB 3E2EA 2Y1JA 1YLXA 2RE1A 3FBBA 3UD4P 4DCPB 1NH7A 4A8YA 2XLIA 2QLFB 4PG7A 3KYLA 2R7WA 2KG0A 1FFWB 1NXIA 3EX7B 3MOZA 2O3DA 5CCLA 4JI0J 1M1GA 3DLKB 4HVZA 2RU9A 3HKZD 1C0TA 3NS6A 3NRBA 3DLJA 1RAAB 3J7YI 4B9MA 4BWMA 3NNHA 1U6BA 2J9CA 5KG0A 4NLUA 1JQGA 2NYHA 1DTQB 2DGXA 1OIAA 4TN2A 2VPYB 4URQU 5GMDA 4ZMMA 3D68A 2WTFA 4NWBA 4G1IA 4MK7A 4EO6A 1WC0A 4I6WA 2XGQA 3OSPA 2ZZNA 5EWGA 2FZCB 1DTTA 3PFEA 2NPFA 1KLMB 1HQEB 3ET6B 2R7XA 4RW6A 1ZTTA 3HVTA 3W60A 2XO6A 1EB0A 3L7PA 2MPUA 3DXSX 3G6YA 1H38A 2Z0GA 4ZA1A 2HHHJ 4LQ3A 4GKJJ 3TANA 4HT7A 3TZZA 1RWNB 3LA0A 4ED2A 5A0YA 1KD1T 2WSCC 5LOQA 4FBUA 3DU5A 5AJ3J 2C3OA 2H5EA 1F1BB 1FA0A 1U0SA 2RAQA 2V4JA 3AXKA 3RR7A 4I6AA 2BACA 2OPQB 5F8HA 3GZ7A 2HHQA 3GV8B 3GYXB 5EWFA 2ZH3A 2FLNA 3OXGA 2NCKL 2WK4A 3MPWA 6FD1A 5CAAA 1J2VA 2QJ3A 1X4EA 2P6SA 5KFTA 4NLVA 1E6YA 3M2RB 5CZXA 4NZ0A 1OQ3A 1Q8BA 4F4ZA 1B0TA 4EU0A 4CH7A 1O6XA 3WIVA 3I56S 3MTKA 1CJVB 1TV6B 3KLIB 1UFKA 4ETZA 2PDAA 3GFXA 4Y2AA 1JLAA 3I5AA 4X2BA 1BQMA 2MQOA 1UA1A 3HULA 4QIGA 1SPBP 4O3RA 1VJWA 4DI6A 4WZQA 1UEKA 3N9UC 2MHEA 3P5TL 5E3RA 4ZLJA 1H73A 2F1FA 2RHSB 5DDQC 2KFNA 3I0SB 1RT5A 4TNOA 3DM2A 5HLFA 2EG2A 2Z57B 5E33A 4Z7CA 1FKOB 2D9PA 1ITPA 3LP1B 2OELA 3SSSA 3QGHA 4ILRA 4ZVPB 2DNGA 3HD2A 5K14A 2C3YA 3D4JA 3BGLA 4I68A 4V19X 4FF3A 1WD6A 3IWXA 1H72C 3UD5A 1RTHB 1KS2A 5JUMA 3G96A 5HP1B 3EVMA 5H9FK 3BKUA 1MWYA 4QW9A 3BSCA 4Z2XA 1Q81T 3BKTA 3NMRA 2NXUA 4KBIA 2YNIB 1NKBA 3UN5A 2C3UA 4B9VA 2HVDA 3H5XA 4QIVA 4DCJB 4PQUA 3MPVA 3DLKA 1FRIA 1KFDA 4M5GA 5DM7Q 2R8JA 1LXJA 2OSQA 4WFZA 5K8MA 2BABA 1GNKA 4M63A 1VGYA 1JWWA 1YX2A 3S7RA 1RCOB 3HHLD 3PXGa 3KK1A 1KTQA 2ADCA 1NMEB 3DGVA 1SBRA 4DSKA 4CTAB 2XMJA 5A8KB 3V81A 2QT7A 4V1Ak 3LQVA 1Q16B 4OZNA 4F4KA 4KR0B 1Y9OA 1J5EF 1HR0F 4H4KA 3MD3A 2VICA 4KTQA 4LF9J 3PJWA 1PIEA 5CH7B 2LLZA 2KHDA 3PDNA 2OPSB 1ZZNA 3D66A 1TFWA 4EZ9A 5D6GA 2JFDA 2V69A 1DRZA 5BR8J 2RQCA 2EFQA 3BREA 2FHMA 4DV2J 3Q24A 3MUTP 4PQUB 4RW4A 3UDVA 4YB1P 1KVIA 3HCXA 2GVZB 2VQEJ 3FEZA 4DR2J 2M70A 3E01A 4ELTA 2J7WA 3IC1A 3PIOQ 4DSFA 1VC6A 1NKEA 3SFUA 3G6VA 3MCOA 2HS4A 4LFAJ 2V2QA 1DARA 1DTQA 1DAXA 3CDWA 1FRHA 4O4RA 3KJVA 1R8AA 2Z8QA 1F9FA 1X4DA 4FXVA 3I0RB 3M05A 1F5AA 2XY6A 3R1LA 2UU9J 1I94F 2EEYA 1ELOA 1Y4ZB 2IVMA 4IQMA 4OZJA 3R2DJ 3HJVA 3BGRA 1VLOA 3UR3C 1VHFA 4A4JA 3BDPA 3CCTA 1FDNA 1GXLA 3C14B 3IFEA 3ETOA 3EWGA 4RR5A 4X4TA 4WFAQ 1HBUA 1M5VC 2UUWA 1VISA 2EC2A 3X3UA 1VK8A 4QYZJ 1GTHA 3MFHA 2G13A 5B09A 2DTJA 4NL5A 1KP6A 2F4VF 5B0BA 2AHOB 9RUBA 4DX6A 1NPRA 3MM6B 3TUJC 4JI6J 2QG9B 3DGPA 4JV0A 3PJXA 3CJKA 1CULA 3SQGB 2RU3A 1D1UA 4DPTA 2JEFA 1E6YB 4OYBA 4WTOB 3TA0A 2HZAA 4DLEA 1PJ6A 1NUEA 5D8HB 3KLGA 2CPZA 4PYAA 2Y8YA 3RU0A 3QIPB 1BD6A 3AB4B 2IDEA 1VOMA 1VQPS 3WX4A 1EP4B 1VCTA 3K8WA 1N5YB 4YR0A 3M30A 1EQMA 5E3CA 5D4LA 3P49B 1FD8A 4J9RA 3KLFA 2M4MA 1HNWJ 2HNZA 4QPXA 5H9FJ 1Z2LA 1QM9A 2HLTA 2WB1D 1N48A 4EEYA 2IC3A 2Z2YB 1NJIT 2V4RA 1S77D 4ES1A 1XMOF 1DTTB 3M8ZA 2FZGB 3QNWB 2GIQA 5BYSA 2DIUA 1FX4A 2I5JA 1S1TB 3HHLA 3LANA 4N41A 3R2CJ 1NH8A 2XSJB 1CPZA 2HIQA 1VFJA 4F0KA 4IH7A 5LL6d 1S5ZA 2W7AA 2ZUAA 1HL6A 3CDEA 4EYIB 4AXJA 4UUWA 1S1XA 4DR6F 2YVSA 4TU7A 2B9YA 2MKHA 3DDIA 3HM9A 3NS7B 4K8RA 3IS9A 2QA2A 2GJFA 1MLAA 2RB7A 4RJVA 5KFBA 2CQHA 2XULA 2YNHA 4P72A 2WOMB 2ZNZA 2VA3A 2MSSA 4C98A 1CQNA 1CS4B 3HJFA 5T41A 3T1AA 3C6TB 3CVKA 1HD0A 2HNDB 2NYIA 3H42A 4HH0A 4KFBB 4DZ6A 1NB7A 2J0QD 5J2QB 2XNRA 4DU8A 1RT7B 3ITHB 3CE8A 4DPUA 3KG1A 3M1VA 4DXLA 4BWJA 2A10A 4DR6J 1PCAA 2FTRA 4A8QA 4YB5A 5HMWA 2XQCA 4UY85 1N32J 4CO5A 3NWGA 2R7TA 2BKOA 4AT1B 3SCKE 2RDJA 4OHYA 3PY8A 1AZSA 1CSJA 3AJ2A 3HPOA 4TKTA 1XERA 2AJ0A 1C1CA 2G9OA 2L41A 4HI2A 1S1VB 4LT6A 3IR5B 3LGMA 3KLEB 1VQ5S 3QGGA 1J27A 2HFZA 3MD1A 3JAMY 4PYDA 2VIHA 4B9TA 5IT4A 1BY9A 3ULHA 5GAEU 1S72S 1N88A 3BR8A 4RO0A 1XMQF 1YGYA 1Y5NB 1REVB 3JTOA 4ZCIA 2UVVA 3MCNA 4Y00A 3BR9A 1S6QA 4CLTA 4NLTA 3THTA 3VZIA 2OPPB 3R5JB 1R6YA 3EPIA 2P9GA 1OY6A 3GSDA 5KFCA 3SZ2A 2C2RA 2ROEA 3U1LA 2AYGA 3H5SA 1FTRA 1T9WA 1RHRB 1FK9B 2ILYA 3RYLA 4EYHB 2G0CA 1J5OA 1VQ8S 5IM0A 4DR5F 4WYWA 3KTQA 2H51B 2HFSA 1ZM3A 5LXRA 3KK2A 1IBCB 4MTPA 4PPDA 3V2UC 4BC7A 3BQ0A 1DLOB 4O44A 3KHLA 1RT2A 2WSFC 1QY7A 3EXYA 2R2RA 3TX8A 3QWUA 2F4VJ 5A8WA 2KRRA 3FZ2A 4WKRA 4NA1A 2N3OA 4L3KA 4OI1A 2CJ9A 3R7SB 1JLBA 2EK6A 2MDAA 3FK4A 4QW8A 4ZLLA 3QJPA 2M9KA 3FEXB 4UW2A 5DZ6A 3QQCD 2B6AA 4MKBA 2CQ1A 4C0BA 4J9LA 3DOKB 1DHMA 4DSLA 1HPZB 1T0TV 1Q5VA 4Y2KA 4OZ0A 4PWDB 1MWZA 5L8RC 2E9ZA 2XO7A 4Y6IA 3ZTOA 2KRBA 1HI0P 3W63A 1N5VA 2LDYA 1F9HA 1WEXA 3EZOA 5HJXA 3OVSA 4I6YA 1RKJA 2DGOA 2QMUB 4USUA 3PKMA 2AW0A 1BGXT 2ALZA 2HW3A 2BE2B 3C15B 1X0FA 2OEKA 5T14A 4A8KA 3PKYA 4Y2MA 1S9EB 1UP1A 2ACYA 4P71A 1H98A 1ACMB 2DNOA 4NPOA 3BO3A 3ZC4A 1CLFA 3UN2A 1N5TA 3PR4A 4IFVB 2YQ1A 2XS7A 4ECQA 3CUNA 3EICA 4F2SA 3I31A 5L1IA 4I2QB 2WVDA 2EFVA 7FD1A 1C2PA 4QWCA 1OWXA 1V5VA 3MI7X 3TUPA 1S1TA 1YG0A 3DOMA 3OFHA 4OI6A 4DPOA 5BXIA 1Q86T 2DNPA 3IR7B 3ZO7A 3QAEA 4JI2J 5D4PA 1DBDA 5ETOA 1S1WA 5I4MA 3MMAA 2NUHA 4YR2A 2DISA 2J76E 3IR6B 2RH3A 1K0TA 3OFEA 4F0HA 1SIZA 1RHMB 1PGZA 4L3NA 3FKBA 3MMBA 4J9VA 2B4PA 4WWSA 3KDNA 1WHXA 2JZ5A 4TU9A 3OTOF 3K89A 2G2ZA 4WKYA 2AX1A 3TYTA 2ZZMA 4CT9A 3QRQA 1RK8A 3CD0A 4I0WA 5KFEA 1K73T 1RKIA 5IV4A 1BC6A 5FLXU 2RRAA 1WHVA 4OLOA 1U1KA 3X1LB 1QAXA 2IY5B 1F5BA 5L38A 2GX8A 2BQRA 4DR4F 2MY7A 4HHJA 3DLLQ 1U2RA 5KFHA 4CM0A 4Q2LA 1JB0C 3K5LA 4KHPJ 2WBMA 1OO0B 3DI6B 1HNZF 3EGNA 3GG0A 2R7OA 3ETMA 1FEEA 2QMWA 2ZHBA 2UUAF 4RW7B 3NCQA 4PWUA 4RNFA 2CJKA 3G8TA 4RX6A 1G7CB 3P96A 1DQ8A 3DLEA 4OX8A 4LF6F 4JYAJ 3SBMA 3J81U 2ATLA 2B0GA 1B0PA 1ZAVA 3KNAA 2DK2A 5GAHI 4OJGA 1JLFA 3CMES 5KT6A 2LFVA 2B8PA 2BEFA 1NCLA 2DO4A 1YJUA 4B3MJ 3QO9B 3RAQA 3HX9A 4NLDA 4OJHA 3ZTQA 2IJFA 3WQPA 3FC9A 5KG2A 4ECWA 5H9EJ 2DR5A 4LSZB 1S49A 2RKIB 2WSEC 4M8LA 4NLYA 4IO9Q 3AOAA 4CLFA 2LQBA 3KLGB 3CJTA 2CPDA 4NLSA 2H3EB 3M8QB 3QGPA 4WP8A 3VQSA 1U7LA 2I8EA 3R5BA 2FJVA 4JI8J 2CIMA 1TKXB 2ERRA 2AV5A 2VG6B 3KFWX 5B7WA 4FS2A 3M1VB 5GADI 3NP5A 2H4YB 4IYQA 2VPZB 2J6SA 2CPHA 3O1LA 4DX8H 1ZH5A 2YWFA 3TAPA 3VV2B 1Y5IB 2GHVC 1YKWA 3HSZA 4LF4F 2W01A 3HF5A 1FCAA 3QLHB 2IVYA 4WU2A 5CYQB 3AA9A 8ATCB 5ETRA 3T41A 2ZKUA 4X4QA 2KU7A 4NA2A 2V34A 1U1LA 4U96A 3KXDA 3G4SS 3DRPA 3GFZA 4USHA 2GVDA 4ICLA 2GZOA 1UVIA 1RT3A 1S9EA 2XWYA 2FHKA 2Y1RI 3GJSB 3GONA 4LSLA 2MEWA 4M5LA 5ETMA 5FIIA 4DQSA 4L76A 4O3PA 3GCWP 2G0JA 2LDIA 3BGUA 1RT6B 2HGNA 3H40A 3VAHA 2VF3A 4IH6A 4DFKA 1L3TA 2ZDOA 3W5ZA 4ERDA 4GVLA 3CCSS 3EXCX 4QR0A 2YY3A 3PW0A 1FWLA 2LA4A 3M2VA 1DFDA 4R0JA 4DUTA 3DRYA 1RWMB 2QC3A 2VDIA 4ALZA 1B7YB 1D3WA 1C0UA 3ENWA 4OYAA 1SIWB 1RT1A 3ZNUA 3J7A1 2PFDA 1RI7A 3EZ5A 3SSRA 1WC5A 4QU6A 3EGVA 1B0VA 2HWIA 3MM5B 4PXEA 2AGOA 5A8WB 4LRDA 4YHHF 2J0XA 3M6VA 1N4LA 1TELA 2GVDB 4PG4A 4DR7F 2C3MA 2QV6A 3W1YC 2KTQA 3D2WA 2CRLA 3K5PA 3KJFB 2QEXS 3GJTB 3BH6B 1WG5A 4MIBA 1HHQA 5IC4B 4CLPA 4ENOA 4B3SJ 4K4WA 1Z4UA 2FIUA 3I5CA 2FHJD 2Y0SD 1U02A 4H4MB 2YNIA 3M2VB 2FJWA 5D77A 1P9YA 1T02A 1GMWD 2E29A 3MEGA 3Q8SB 4DR5J 5C7PA 2F9JA 1HWJA 3A3OB 3QZ7A 3D6HB 4OZ5A 1Q8KA 3EYZA 2HHHF 2GMJA 2HS3A 5HQ8A 3A1YG 1RP5A 2OHDA 4KGKA 4DBQA 3FMWA 2PD1A 1VRTA 4C4WA 2BW7A 2Y1LB 3IGNA 1FJEB 1FERA 1M5KC 1FRXA 1HHSA 1KOHA 4OHXA 1X4AA 2Z56B 3H4BA 4ECYA 2GAHC 2MQ8A 3E01B 1M0SA 4HT5A 2XY7A 4B3TF 3TEGA 4DV1F 1SI9A 3UWTA 2A2CA 4DR1J 1RTDA 2CNOB 4K59A 4OX6A 3JQJA 2FB0A 3D0GE 3GSIA 4H54A 4PCQA 4EUVA 3I96A 1P6TA 4N7TA 1GMVA 1ZETA 3B4DA 3BGOP 4M1KA 3SSQA 4KV8B 2XYHB 1WEZA 1TKZB 3MMBB 4ZCMA 4DV0F 1Q82T 2HGMA 2JLFA 2ZH5A 1TKXA 2QFJA 3D3CJ 4GC6A 1HWKA 1RACB 4FXWA 2GO9A 1ZM4A 1S6UA 5C2GA 4N56A 2KKHA 4OZ3A 1IKYB 3W5XA 2YKPA 3J7AN 1SJ4P 2CJAA 4M5IA 1VQSA 1RYSA 4JP8A 2JEJA 1FHTA 4A8MP 4WK3A 5ADZA 1P27B 1UVMA 3GPAA 2I5JB 2KYZA 3DU6A 3AODA 4D3HA 5M2UA 3RBDA 2DRAA 3EVOA 4O3SA 1IQTA 2V67A 2X51A 1RTDB 2RT3A 4X65F 3H90A 2W2MP 1FRKA 3ZTPA 1IBKJ 2E66A 5E5NA 2MLXA 2ZH1A 3LOUA 4NXNF 3QLHA 1JLQA 2EKYA 2KVIA 2G1DA 4WIQA 3H0PA 2VQEF 3MAHA 4CT8A 2IYGA 2NXCA 4J37A 5L1JA 5HP1A 3UPFA 2CZVC 4DR7J 4OI4A 1GEHA 1IKWB 1T11A 3MUMP 4IOAQ 3GR0A 1WWHA 1N5YA 5IT9U 1GAOA 1Q79A 1YVFA 4MIWA 4E98A 2QA4S 2XLKA 2KZZA 1LW2A 4M5MA 2KL8A 4GMKA 4KKOB 5RUBA 2JHEA 2CQ2A 3SI8A 2A3JA 2YWKA 3D1QA 1JNZB 4M5NA 3J81Y 4LMZA 4F3QA 1EETA 2OMOA 3CCWA 3OLAA 2DIVA 4Y2CA 2VKZG 3RAXA 4ZVRB 3MR6A 2CQGA 3LGNA 3T1HJ 3OTEA 2DHHA 5HQLA 5KFAA 4IFYB 3KLIA 2QO3A 4Y28C 3UCGA 1ZTWA 2W25A 4NCBA 5J2MB 1WC6A 2LXIA 2R2SA 5G0RB 2NXNA 5KFIA 3ICLA 1RWOB 3AD8C 4CO1A 1TK0A 2BVZA 1UFLA 2V8HA 2OPSA 2C2DA 1NDLA 2CPEA 1RA7A 3OR2B 2COLA 5EWEA 1IR0A 1NDKA 3DCAA 1R31A 1SXLA 2W4DA 1IJFB 2E5JA 2FVRA 1UWBA 3JXOA 2CA9A 2SXLA 3FSIA 3AB2B 2DPJA 1K44A 1WOSA 2DKOB 2HBRB 3IMQJ 4O0IA 4I7FB 1G6BA 1S79A 3PFOA 3OL6A 4TQRA 4QPTA 3QT6A 2JOQA 3D54A 3FQKA 4TLRA 2OP5A 5K8PA 2KM8B 2HBYB 1TKDA 5KT2A 3NS5A 2F63A 3VAFA 1UVNA 2Y1IA 2J9DA 4Q0BA 3Q89A 2AEMA 1V3SA 1HA1A 1Y11A 2EI5A 2X7IA 1NPPA 3ET6A 1RT6A 3PYDA 3PCOB 4KYZA 3PV8A 2BYCA 2OEJA 4J91A 2EPIA 3E3XA 3H4DA 5F8NA 1GXTA 4XK8C 2DXEA 4YEAA 2HG4A 1N33J 3GIJA 2XWXA 2WAQD 3QT5A 3GIKA 2NLWA 3OR2A 2Q66A 2WZ1A 3MCSA 4K0KF 4NYOA 4RU2A 2DR9A 2VFVA 3K2YA 1Z1ZA 5KT3A 3N01A 2GIFA 3GCXP 3MEDA 3M2UB 3TVYA 1T9VA 3Q86A 5KG7A 2BRLA 3PX6A 1H7WA 5F8MA 4PWDA 2VU5A 1N56A 4LRFA 1TU0B 2B3TB 4R5PB 2W8KA 3MAQA 3RRHA 2WB4A 5DETA 4JI4J 1JJ2R 4DV5J 3PRVA 1EAYC 4RBUA 5AXLA 3VWSA 4CH0S 3PIPQ 2J6TA 2HRTA 4KHRA 4LR7A 3F73A 2NZCA 2HK3A 2O67A 3BDEA 3TQEA 2G0IA 4IDKB 4OHWA 2HHXA 1UJ4A 3EPGA 1YZ7A 3LGHA 3R9LA 1LW2B 3T1YF 4B3OB 5I3PA 2HFOA 1DLOA 1RSCA 4NXNJ 2DNYA 2M7SA 4Q45A 2XMAA 2VQFJ 4ECXA 1PC4A 1S1UA 1S9GB 1WKLA 3M8PB 2CQPA 2HQCA 2WONB 2WVEA 4O3NA 5KFUA 1RAGB 1S6OA 1LNQA 2FJDB 2HQGA 3EGWB 4DPYA 1FDBA 3T5JA 5CD4H 2C2NA 3ZXWA 5K14B 5F8GA 4DV4F 5L1LA 3MPYA 3R97A 1NM2A 2ZNYA 1N34J 2IM0A 2DHXA 1UW9A 4AD6A 3RG6A 4WPAA 5LT5A 1Q8LA 1CJTB 2FC8A 2QRRA 1S99A 1WOOA 1RB0A 4RL1A 2IIHA 2X1GA 4DV3J 4IRCA 2QE5A 3D1HA 3Q2TC 3NMAA 2HVHA 1C1CB 2OI2A 2BXJA 1TUWA 4P2FA 3ZZ0A 1R6VA 1A9NB 2YKNA 5EN1A 1TKTA 2QSWA 4QZVB 2MKKA 1XNQF 4B3RJ 3A3NB 4X4OA 4KE5A 2IRUA 3JYTA 1LQ9A 1WACA 2ZH4A 1KSPA 2KZMA 2V0NA 1N5QA 3LWLA 3KK1B 3TUIC 2EFNA 1X5PA 3MEEA 2ZOGA 4WFBQ 4I67A 5B0CA 2BX6A 5T7LA 1BWEA 1FXDA 3LO3A 4FYYB 1JXLA 5J2QA 2YNFB 3N6LA 2HQDA 2O1PA 2N4CA 2R8HA 2QMXA 5AE3A 5K8NA 3R5CA 2UXBF 3DMJB 2ZJQQ 3LP0A 1AUSL 2QLXA 3BH7B 3WHIA 3MM9A 1YRXA 4C7QA 1L3VA 3DLGA 3KLHB 4C9DA 3W2VA 4DSEA 1Y3KA 4FKYA 3NGDA 4UQTA 1X9WA 3UNGC 1VQKS 4JI4F 3M2UA 1ZZFA 2OD4A 4LSNA 1HW8A 5F41A 5K20B 1FDDA 3ZZTA 5CCMA 1IKVA 1WDTA 1T8EA 5ETLA 3HVWA 3L7UA 4TXSA 3AD7C 2QZ8A 3CCMS 2KXHA 1U1NA 4FXDA 3M9NB 2LKZA 4Q5VA 3VVUA 2F8EX 2AZ3A 1RAOA 4NXMF 5K5MA 4ATNA 1T9YA 2C2EA 5G4DA 2CPXA 1O0PA 5DDRC 4G6VB 3U27A 1LK7A 2RF2A 2X3GA 4ZPDA 4ECZA 2I9SA 5DQGA 2Q43A 2XTJP 2HHPA 2UV8A 1SQGA 2VFSA 4MMOA 4GVBB 2K2PA 3JSMB 3GILA 4DUYJ 1B64A 2DD8S 1NEEA 2JVOA 2UUTA 5FDLA 3KK2B 2FZKB 1RABB 3G6ES 4M94A 4DV2F 2AT1B 4U67Q 1RTIA 3R6GB 2EC0A 1VQ7S 2HSEB 3PRDA 2UUBJ 4USWA 1GX6A 2GFFA 3MURP 4URSA 1AB8A 2DR6A 1HYSA 2Q6BA 2XEXA 4WE1B 1XEZA 2GS8A 2OPQA 5L9XA 2MB0B 2Z30B 4O23A 4CO0A 3D6FB 4A48A 2NREA 2IFXA 5J2MA 2I0XA 1FKPB 4FDFA 4C0OC 4CLWA 3AOBA 2ASLA 4ED4A 3DN9A 1WKJA 3M7VA 5E41A 1X5OA 4LFCF 2E1MC 4LJMA 2GVZA 2PT0A 2FY1A 2AP6A 4AL7A 1PBUA 1M5HA 3QO9A 4W92B 2VOOA 1X8DA 4DFJA 2HNZB 1S1UB 1S9GA 2EW9A 3TP2A 2R2TA 1IBMF 1SC6A 1R8CA 3WC2A 1UPPA 4ILLA 4W98A 4WFXA 2I1RA 4F02A 4Q43A 1LWCA 3HFKA 4F8RA 3POTB 1AXQA 2H1YA 2U2FA 2MKJA 1S0OA 4IOCQ 2HYIB 2OTLS 2Q3PA 1CEZA 2LA6A 4BC9A 2M0GB 2VBZA 2XCAA 3OXFA 3FSXA 3R27A 2BJ9A 1IM6A 3UVJB 1T94A 3PNIA 1LV5A 1F0XA 4ZPAA 2JRSA 2OJ3A 4B3MF 3RB3A 2F4FA 2CXEA 3BN4A 3QAUA 3TARA 3UR0A 4RUAA 3M32B 4HYKA 2HHTA 3BF4A 3A4TA 2P9CA 3C3LA 5DO2A 2I2YA 5D4NA 5EGYA 1SQFA 4UOFA 5I3QA 2DXFA 4KH1B 2JEIA 3EDQB 4O4GA 3UDLA 1LXNA 4A8OA 2RSQA 1NK9A 1ZM9A 1X4GA 1R0AB 2EVZA 3KLVA 2QX0A 2EXUA 5CYJA 3OVAA 2IDLA 5IXUA 3B78A 4Q44A 1S10A 3CD6S 1YJ7A 2FC9A 2G4BA 3MFIA 3GFHA 3UW1A 3KWMA 5IQQA 4QU7A 4DX5A 1JX4A 2XC9A 4JV5J 1OY8A 3A12A 3CCRS 4DV7F 5H9EK 2W2OP 3OHAA 3ZTRA 3FUYA 3H5YA 2ZBCA 3BYPA 4RZRA 3TQ1A 1VC0A 2HZVA 3O5TB 1BQNA 1KVKA 4QWAA 3TNVA 4TY8A 4DL4A 3K17A 1S97A 4QYZK 4RW7A 1MMDA 2FPHX 4OYOA 4PG8A 2ZZTA 4ED0A 2B43A 1IBLF 3OUYB 2BUNA 3TJAA 4DZDA 2FVPA 3IWNC 1EQ0A 3K8VA 3DRRB 1VS3A 2G2OA 2W1BA 4X4RA 4PRFA 1TAQA 1I5OB 2CPFA 1PAUB 1G2EA 3OL9A 1X4BA 1G4CA 3CO9A 3IXQA 3G86A 3T9NA 4JI5J 4W90B 2PO4A 3U1NA 1SKUB 2FD2A 1U49A 1RT4A 1NJXA 2CG8A 7FDRA 3UN3A 2YQ0A 3LWMA 5DDOC 4LFCJ 1FWPA 3K5OA 4ILMA 1KR4A 2BJDA 2M52A 4X66F 5J1PA 5B08A 1XMQJ 1PSDA 2JC0A 1KHWA 3AQOA 3MGJA 4RW9B 3OL8A 1NB2A 2CZ9A 3KMQA 4YFUA 1HNXJ 4ED6A 3LP0B 2RS2A 3MZIA 2VG6A 5CXTA 2RDDA 1JLBB 1LWEA 1Y3JA 1RWXB 1M90T 2VOPA 3PG9A 1IKXB 1D8ZA 3H2VE 4ELUA 4B9NA 4OQJA 3JQMA 4ED1A 4FYDA 3I4HX 2GNKA 3HSDA 5IWAJ 4RNNA 3CC7S 2IM1A 2YH1A 2W9CA 1JLQB 1WORA 1MMNA 2N4DA 1WELA 4X62J 3KNGA 2HNYB 3T5LA 3MMCB 2FJXA 2WW4A 1ZA2B 4DSJA 2F40A 2QA4G 3TW0A 4HKQA 2MQQA 5GAHU 3PYEA 3M6XA 1R8PA 4ZVUB 4DL5A 3TA2A 1HD1A 2KFYA 3J7YU 2VC1A 2WOMA 5HBMB 4QWBA 1LFPA 1REVA 5KT4A 2XMKA 3GU0A 4ZKAA 3PJ9A 2ZD1A 4GO7X 1FT8A 3IBCB 1AT1B 1B99A 1F60B 1N52B 4P75A 4DL7A 4EBEA 2P6TA 2DT9A 2A18A 2AZ1A 1N0VC 5F0UA 5T7LB 1Q0NA 3PEHA 2CWXA 4NI2B 5D15A 1R0CB 4LREA 1WUUA 3VGTA 1V9OA 2B5JA 2IHR1 1MN7A 2X1BA 3FSYA 3HVAA 5C24A 4RNOA 4ECRA 4ED3A 1X9MA 4R25A 2RVJA 4HR2A 1K1QA 5I3UB 5HROA 5C2CA 3TAQA 4DJBA 1HQUB 2VG7A 1XMOJ 3AY0A 1W7WA 4DV1J 2WBRA 4OYZA 4EO8A 5THWA 1S12A 2M5YA 1V3RA 5JJBA 4FS1A 1QAIA 2XI3A 1HPZA 1NU4A 1TL3A 1XMBA 3AH6A 3IG1B 3L9ZA 4ANCA 3QT8A 4L74A 4UOCA 1NPKA 2IAJA 2LQJA 2MZSA 1TL1A 1XK8A 4KKOA 4B17A 1K9MT 2QTWA 4NRTA 1XJWB 4HHUA 3DHWC 3OLBA 1VQYA 2HIYA 1UZHA 3AA8A 4MYUA 4K4VA 1RHKB 4NCGA 3CULA 3PR5B 2GGPA 4PQAA 1D8YA 4JBCA 1RBOB 4C8ZA 2KFZA 4XTTA 5AXMA 2MSTA 4DX7A 3Q8RB 2R4FA 3T5HA 1RHQB 4F4XA 1PC5A 4TQSA 4I64A 3SYZA 3M6WA 3FMBA 4EMDA 2OFGX 8RUCA 2DNNA 2GO8A 2IC3B 3CSKA 5EDWA 3K5NA 3AJ1A 3KJQB 4OHZA 3PVXA 1TK5A 1U2FA 4DDFA 2ROPA 1G3OA 2UXBJ 2IAJB 2DEIA 3SCIE 4MK8A 4PXCA 5HVGA 2XY5A 1WKKA 3PEJA 2EK1A 4NLPA 3GR1A 4HEA9 4AFFA 3WDOA 7AT1B 1KNZA 1APSA 4B9SA 2ZVIA 1S1VA 1WC4A 1TQLA 3ILOA 4KY3A 4NLXA 2DR7A 5A6WA 2YPZA 2Z58B 3LAKA 4JUZA 2B7CB 2CDRB 2OKQA 2AQ4A 3GQCA 2G2YA 1XR5A 1T95A 2R7UA 4LFAF 3HHDA 4DS4A 2HLUA 2FGCA 5ETQA 4OIXA 1U1MA 1FWKA 2UUAJ 2YNGA 1H3DA 1F5CA 3I55S 4N5SA 2RQKA 3R7BB 1NSAA 2HPUA 1L3SA 2OLWA 1R8HA 1LWXA 2CVEA 2P2CB 1RT2B 1HW9A 1KN6A 1RWWB 3ZZUA 5A76A 4FZVA 2NUUG 3HI9A 3ONQA 1X0PA 5F8IA 4X64J 4N8OA 2AJQA 4PR6A 2IMOA 2IPOB 1C1BB 4IR9A 2KDOA 2VODA 1S0NA 3L3CA 1HWUA 2DGVA 2MTLA 4FYXB 4LBIA 4NE9C 2BANA 4NYZA 4AL5A 2ACMA 3GE9A 3BBFA 3MMCA 4LVOP 4CQ1A 2IJNA 2GCFA 1H2TZ 3OR1B 4FF1A 4WZMA 1EHWA 2YTCA 2D1CA 4NMLA 2OGUA 4YDXA 3PW4A 2AGPA 2ATCB 3UNYA 4DG1B 3RB4A 4MYTA 5DGAA 4TLQA 4F25A 3C2PA 1Q8IA 5KFGA 2HEKA 3TVZA 5HO4A 1RISA 4PG5A 4JI6F 3VGVA 4ED7A 1NK7A 1U8SA 4OZLA 2P5VA 2ZH9A 2YNFA 2K7KA 3BO4A 2BE2A 3C15A 3M8PA 1FTCA 3RTVA 3V6KA 3NCRA 2MZQA 3ISND 3MF5A 3H98A 3ILIA 5IS2A 1OS5A 1RTJB 3DRXA 2YXLA 2R7SA 1VRQC 3J80U 1HFEL 1PJ5A 4ZP7A 3UQSA 3VTIA 3VQTA 1HNIB 4ZCLA 4A46A 5HJYA 1N6QB 3Q23A 3GLJA 4ZP6A 3FFIB 3CCES 4MKYA 5ETPA 2MGZB 3GB0A 2XMUA 2J9EA 5A8KA 4A8WA 3V81B 2CUYA 3I6PA 1RAIB 4NLWA 3AJDA 2DYAA 1VBYA 3A13A 1HBNB 5HMXA 1SC1B 1RU1A 1EJ7L 3DLEB 1CJKA 1SJRA 2BA9A 3Q0AA 4OV6A 2HURA 2RMLA 2LQ8A 3HSJA 4AXIA 4L75A 3MEEB 2WHOA 4EBCA 4IKAA 2XSFA 5HSPA 3CJSA 2HFNA 1DQ9A 3KJVB 3FVYA 1S6PA 3KUGA 4N77A 3C8YA 3Q8YA 5LSRA 5KOXA 5AJ3F 2IVFB 1OSDA 3BBCA 2DXDA 3FZBA 2YKMB 1R0BG 3CIMA 3IWLA 4USTA 4P9SA 4XIUA 5LMUF 4B3SF 2W8LA 1NHKL 5DG7A 4DR2F 4UY8T 3CMAS 4ZPTR 1S0VA 2K3IA 3Q22A 2CJXB 4ZJLA 1BMQB 1KDNA 4FNIA 5DJBA 1HR0J 4KGVB 2JEGA 1LWFB 1RAEB 4LF6J 3RAMA 1K8AT 4KC5A 1RDRA 3W2VB 1R7IA 4ED8A 2UUCF 1B7FA 2EFOA 3C46A 2D7SA 5LSLA 1XBWA 3D5MA 2KJVA 4XO0A 3PX0A 1D9FA 4FBTA 3E8OA 1A6LA 3AD9C 2UXCJ 2Z2MA 3C66A 2VH7A 2IM2A 3MAAB 5F0WA 2CYYA 3CJ0A 4I2PB 2QLJB 1S6PB 2NXJA 2XM3A 1NNDA 2B4VA 4G65A 4ZVSB 4F0MA 1NK5A 2GC8A 2R7QA 3OT9A 4ZIVA 4ID5A 1S4EA 1ZAXA 1U0HB 3FQLA 3WBZA 4AQYJ 4LR9A 3LPEA 4MJKA 1B4SA 1W2BR 1QVGR 1FJ7A 1VQNS 5KFSA 3DYAA 1YK9A 3HO1A 3IBFB 4MKVA 3TO8A 2ASDA 5E3PA 3PTWA 2V9KA 4C11A 4IUFA 1BLUA 2KM8C 2ZITA 4LF5J 2ZC3A 2ASJA 3I9V9 4U7UD 4K5RA 1C1BA 4DR1F 3QT7A 1U48A 2JLEA 4R0EA 4CYUA 1Q7LB 1HBOB 1OJ4A 2PIIA 2V8GA 2OTJS 3RW6A 2GJ2A 2A2DA 3P8BB 3HHLB 2HRUA 3FBCA 3DLGB 3OJSA 3KLHA 3QATA 3PHTA 4X4UA 4LUBA 1KFSA 1GQEA 5KFJA 3FCHA 3S01A 2MQLA 4NXMJ 1OSCA 3HT3A 1NK4A 1S7IA 1JLGB 1HARA 2CVIA 3IAS9 2QYCA 3LP1A 4I1TA 5JVGQ 4B08A 4KAIA 2LEBA 1IQZA 2V6AA 1JLFB 2DRDA 3OL7A 4DV7J 2IMWP 3A3PB 3LALA 1WTFA 2CNNB 2XZDB 3MEGB 4MK9A 2KXFA 4LF7F 3DRSB 4NCGB 3W9JA 1SL0A 3W65A 3RRGA 1UWAA 3AAWB 2C22A 4UZBA 2W7PA 1VJQA 4Z7YA 3JAMU 1SB6A 2D69A 1FFGB 2BZ2A 3A8JA 3BGRB 1HI8A 1RE1B 4OJ3A 4N8NA 1UVLA 3CEDA 5ETTA 3NAIA 5JMNA 2JWNA 3MM8B 5IC6B 3MR3A 2V4JB 1JLCA 3KUEA 4HL9A 5LJ5Y 2DVIA 1PAEX 4P7TA 1JLGA 3CNQP 1RYRA 1AFIA 2DHAA 2LEPA 4KB7A 2FVCA 1I6JA 4QIEA 4DG1A 2J8SA 2UVWA 1U2CA 5K9FA 1LW0A 2FGOA 3NLCA 3T6JA 1FEHA 4CCHA 2YX7A 3MECB 1GH8A 4JI2F 2DO0A 2LP4A 2CFXA 2W9BB 4DF4A 3IGVA 4M5DA 5C25A 5HQMA 1VQOS 1FK9A 2BQ3A 2RUSA 5E0OA 1W2IA 1NDCA 1ULRA 2Z2LA 4FN5A 1YITS 5CZVA 2BJ8A 1D09B 2QYGA 5GADU 1VBXA 1W26A 4LIWA 4AYBD 1URNA 1CS4A 5B0DA 1UW4A 3PO4A 1Y5LB 5FDLB 4F26A 2R42A 2ADBA 2J6UA 4KSEB 1QDUB 5A2QY 3OUYA 2VONA 3CW2C 3VAJA 4OYIA 3SV4A 2CDQA 3RB6A 4WU3A 1NLKL 4NEZA 3HVRA 1QD1A 4DCOB 2FHOB 3QBCA 3QRRA 1DY3A 4CIOA 1AZSB 2FVQA 2DGQA 3L95X 2KT3A 2KYXA 3AT1B 1RLDA 3UVJA 1UETA 2B4OA 2E5LF 4P74A 3KG0A 1KKHA 3ENVA 1V3ZA 2CAJA 5KG1A 2H4WB 4KO0A 3W64A 4DPXA 2ZBRA 2PMWA 1RXOB 2J7KA 1IJEB 1EZZB 3TVKA 2RDIA 2FY8A 5J1EB 4KV8A 3SDEB 1SL2A 3EGZA 1VI7A 2BM0A 2CQ0A 2H5JB 4QR1A 4U95A 2IJRA 5C5JA 3KK3A 4DWIA 4C11B 1FXLA 2ROGA 3DOLA 3ZZYA 4ZDNA 2BE9B 3GYGA 1Y00A 2PI5A 2AGQA 2M88A 1PBAA 5HI7A 5F8LA 3QIPA 4U7CA 4P2MA 1FE4A 2B5JB 4DL0C 2LVWA 3BSOA 3KK3B 4DL2A 3BEGB 4M5KA 3HLUA 2K06A 1U1OA 1JLCB 3K7RA 4ITSA 4O44B 4E0DA 3O44A 3BZQA 3E51A 4WK1A 1NSQA 2YPYA 1IKYA 3SFGA 5EHHA 2DNZA 4I2PA 1X31C 2IM3A 1RWUA 2GQCA 5B0GA 5HVHA 2CADA 3N6MA 4YDDB 4DUZF 2DCLA 4GKJF 4NCAA 4OYWA 2LU1A 4DF8A 1N5SA 3FJ2A 1PO6A 2F65A 2E9RX 2XG8A 3UDEA 3D28A 4RW8B 2KXNB 3BM7A 2VASA 1G1XA 1QE1B 3TOQA 5ETKA 2J8AA 2NPIA 1JXEA 2ZOFA 3VHQA 3SV3A 3CO0P 2LEAA 3FBFA 4FVMA 3H59A 4DV4J 1S1XB 4ZJQA 4ER8A 1HQ2A 2XMMA 4RU9A 1XNRJ 3HK2A 4PPZA 3L4BC 2O66A 4FYWB 1W25A 4WFNQ 3NOCA 2YKMA 3CJ4A 3M4XA 2JL9A 4HHHA 1Q95G 2OMLA 4K5SA 2I6WA 4QYRA 4IQXA 2CQ4A 4IG3A 4C97A 1FF2A 3GYNA 1GXUA 4PXBA 1JKHA 3W9HA 1VQ4S 3T1YJ 1IKVB 1LWEB 4R8UA 4OYPA 2MLYA 1T05A 1O5JA 1S59A 3DM2B 3ENQA 3MMAB 5J2PB 1PILA 3I32A 2UVUA 4Q8FA 1FRLA 1UWBB 4C3MA 3GP9A 4WP3A 2AU0A 1QE1A 3Q2SC 3JSYA 4LF2A 1YJRA 4LBPA 2ZWOA 3CTRA 1LOUA 1TL4A 4AE5A 1SKRA 3LP2B 2ZH6A 5EX0A 4YP3A 3HZGA 1JIHA 2XMVA 2RF2B 4K2XA 3T19A 3KLEA 4DPWA 2L9NA 4F7VA 5HL7Q 2QL9B 4JI1J 1YJVA 2NQPA 2JSXA 4O0NA 4OV1A 4ECTA 4ZJOA 2HHSA 1H74A 2L08A 4KGZB 1A7GE 1MNEA 2G1HA 2GQQA 4IOBA 4Q7AA 3H25A 1N32F 9ATCB 1QLNA 4RUHA 1MROB 2QLWA 3FRYA 4I69A 4K0KJ 2F5GA 3CCZA 4L73A 4ZLPA 4DL3A 2B51A 3DRSA 5D3GA 1Y10A 4ZHRB 1C0UB 1U6ZA 2EFGA 2CJQA 3NGUA 4URGA 2PMZD 2C2OB 1NDPA 2XB2D 3G8SA 2HFVA 5M2RA 5IWAF 5BYQA 3UI3A 1FFSB 4JOUA 3TAMA 1SL1A 4BDPA 1SJFA 2FHJA 2UXDJ 3QSYB 1GFWB 1U25A 2PMHA 3Q8PB 3JS9A 5LMNF 3CWJA 1UL3A 4DUZJ 3I0SA 4KH0B 2AD9A 1VR6A 3R5GA 4LSLB 1HNWF 2ZEJA 1FJCA 2KT2A 4ZS6A 3TZWA 2ALYB 3OSNA 4CLKA 2CPIA 3SMZA 2OSRA 1P1TA 1ZA1B 2QLBB 3L7OA 4H4MA 4KIAA 4UUXA 4ZVOB 3NGSA 5L9NA 3T3FA 4ELVA 3BS9A 4H4OA 1TVRB 2X1FA 4JI8F 4USIA 2C2ZB 2HMIB 2FVSA 2FDNA 4F4WA 1UAWA 3F44A 4KPCA 1WNEA 1VHIA 4XPCA 1BE4A 1M5OC 3DLBA 5CHCB 4LF8F 1KOOA 3GV5B 1H2UX 1RTZA 1RZMA 1WF1A 2J0WA 3RBEA 2MLZA 3NOGA 3TAMB 1VLYA 1B3TA 1SJ3P 2PGCA 2V8PA 2YH0A 3BV8A 3ILLA 2E5IA 2ABYA 3J80Y 1ZS6A 4JI3J 2E7WA 2ZHAA 4C8OA 5KTQA 1REGX 2DGWA 4C8YA 1UFWA 1BQXA 4J9KA 4DHVA 3I82A 4CDIA 2JC1A 1V6HA 2CQDA 4HH1A 2DNQA 2CNLB 2J9DE 2ZJRQ 2E5LJ 2L9WA 3MM5A 1N36F 2Z2ZA 1CULB 3SQGA 3D67A 4HDGA 2XI2A 1V5IB 3W5YA 3D1OA 3W66A 4PWWA 4ZVEA 5E3QA 3KOAA 1HIYA 3V5RA 4Q2MA 1VK3A 4EI2A 2BJ3A 1XQIA 1CG2A 4QJVA 2ZH7A 1NAQA 1NHVA 4ICLB 1KQFB 3W8PA 2ASYA 3GJQB 3AFGA 1U1PA 2XGPA 3RR8A 3O3LA 2BW2A 5JXSA 4F50A 2K7JA 4KHPF 2MGZA 3T9ZA 2ZM6F 5F8JA 4LRCA 2W9AA 4UT4A 1N6QA 1LWCB 2V94A 5IOLA 2DH9A 3QYYA 2PE8A 4LR8A 2AWZA 1SV5A 1I1GA 2E1RA 1UJ5A 2VJUA 4OX9F 5I42B 4AUKA 2HZCA 3CIZA 1VIXA 4CTAA 4TYBA 1NJWA 2POKA 4MKAA 2XSJA 5IQ6A 2ZH8A 3QJLA 4YOEA 1DJ0A 1ZAWA 2P9EA 3KMSA 4RNHA 2EKNA 2F7VA 2CQIA 2D41A 2ZE2B 2VKRA 3VF0B 5SZTA 1NK0A 2QIFA 3PYFA 5FD1A 2MJNA 3BQ1A 2RRNA 1YSJA 3MPUB 2ZDPA 1S0MA 3W7BA 1TUGB 4P52A 2DRBA 2DNMA 3HKWA 5DQIA 3RW7A 4DV6F 3PO5A 1HBMB 3A8EA 3JSBA 4F3MA 1MMLA 5HANA 2D3O1 4JI5F 1WDDA 3VCDA 3VAGA 2M8HA 2GW8A 4PUOB 1NO8A 4QIFA 4ECUA 3JQKA 3SQOP 3ITHA 1ZPVA 2DNHA 1DZ5A 4X4SA 2DR8A 1FXRA 2CG4A 1FDAA 4KFBA 3TJ9A 2YWHA 2IRXA 2MZ1A 3HP6A 5F3ZA 1LWFA 2XYPB 4DS5A 4FYVB 3UFCX 4ZN3A 5MLCV 1M1HA 2DCUB 2HBQB 2RNEA 2DBBA 4NZ6A 4Q8EA 4LF4J 2H9ZA 1S9FA 3NNAA 1JXVA 2EG1A 1JJHA 4RKUC 5J2PA 2PSZA 1JJCB 1EX8A 3M32A 3W9IA 4R8UB 4K50A 2JX2A 2OPRB 1P1LA 2VDHA 3DDNA 1T3OA 2QGFB 3RZAA 4K7QA 5KFFA 2MYFA 3B82A 2NXEA 1TAUA 1WG1A 2E7XA 2GA7A 3BYRA 4HACB 4P73A 3LF0A 4NRUA 3J7ZT 4M95A 2DNLA 4DOZA 5LMUJ 4BHQA 1KQSR 1JLEB 4J9MA 5HMZA 1FE0A 3KUHA 1I94J 2LMIA 3OD2A 5DZ7A 1SH3A 4ZLNA 3B54A 5A8RA 3WX8A 3M8WA 5AE1A 4RNMA 3LP2A 1MWQA 1JMTA 2DH8A 1H2VZ 2VFTA 3NG8A 1BXNA 3RJMB 1OQ6A 4YHHJ 1GK8A 1MN9A 4JI3F 2ZUGA 5KFZA 4Y34A 5KFDA 1EKRA 2RQMA 4ZHRA 2MKIA 4C8LA 1WJ9A 3WIUA 2XMTA 4OZ2A 4RLEA 1FVSA 4ES2A 1HQUA 2VG7B 4YUDA 2OUGA 1JK9B 3HVTB 2AX0A 1UEVA 3G87A 4RWXA 4E2FB 5GMKa 1AW0A 4WTYA 1QSLA 2BOPA 1GMUA 3MUVP 4JI7J 1OYEA 3DLHA 5ETVA 2V8VA 3VGSA 4LFBF 1LK5A 2QSFA 3B6BA 2Y9HA 4DV3F 1VQ6S 3R8YA 1TUVA 1IWGA 2ZE2A 1K47A 2KHCA 4LRAA 5KG4A 2UXDF 1WTBA 1SUQB 3G82B 4V19J 2DGUA 4NYPA 2DITA 1AYEA 2E5GA 1S6QB 3GFYA 2HVEA 1FJGF 2E9TA 4ZITA 4NX9A 4D3GA 3K57A 1R8BA 1TMMA 2C2KB 4GRSA 4X84A 3W61A 1YTYA 1IBMJ 4I4BA 2V2KA 1JLAB 2B9WA 1DURA 1TL7B 2VHGA 2B8QA 3G2XA 1TVRA 5IZHA 3QRPA 2GHPA 1U45A 3B8HA 2IYIA 3CJ3A 1D0EA 4UF4A 4RBTA 1HI1A 4EFAC 2UUCJ 1LEOA 1LFWA 4HDHA 1YJNS 1RADB 4K4ZA 1T9UA 2W4CA 3JTNA 1P9QC 2V2VA 3G6XA 2F3JA 4BBYA 2PA8D 3TRGA 5DG8A 3VAKA 5L1KA 2RILA 1CVJA 3A8KA 1UPMB 3EJMA 2E1CA 4CYUB 3MM7A 2UXCF 4X4NA 3GG1A 2AYBA 2W4PA 3CGIA 1IBLJ 3CDUA 4IR1A 1RT5B 3ZTSA 5HLFB 4RBVA 1Z2ZA 1WHWA 1RUSA 3KKFA 1RBLA 4AL6A 4PZVA 2LECA 2L48A 3QWPA 5HBMA 1P8GA 8AT1B 4LF7J 3EVWA 2KI2A 3HZEA 1PYTA 3FNNA 2AYMA 4NA3A 1QTNB 1F2HA 2LYVA 3F0NA 4CLYA 4I7FA 2D3OR 2C2MB 4QBUA 1UKUA 3CJ5A 3M9OB 1N36J 2BOAA 3N0VA 2ZH2A 4Y65A 3GTYX 3F56A 1YRTA 3NAHA 5J1NA 2Y8WA 3HHNB 2BV3A 3CCLS 1N33F 1BHNA 3DC2A 3QJJA 3K5MA 2UV8G 5E2QA 3BPSP 1UVKA 3ZZOA 1Q4RA 4NI2A 1AFJA 4LF8J 2R2UA 4K4YA 1VC5A 3HXMA 1YBTA 4M5JA 3BN7A 3N6NA 4J7CA 4WFYA 3IAM9 5ITHA 4ECSA 3OTDA 2MKYA 3BQ2A 4ZP9A 2DPIA 4USJC 2R3VA 3MOJB 1NRKA 1UTAA 3VALA 1HBUB 3CD7A 1CC8A 1PG5B 2PI4A 4JI0F 4RUCA 1VQLS 1BQNB 2DH7A 2HQFA 1M5PC 1I51B 2GQ2A 4CI0B 3NWRA 4Y2IA 3I9ZA 3O2IA 4IG0A 1YI2S 2KO1A 5KFYA 4P6QA 4ZPBA 1HNZJ 3LH2S 1MSWD 3M9MB 3EUNA 5JVHQ 1X5TA 5LXYA 3FCVA 4I56A 4ZPWR 2A1BA 1IM4A 4O3OA 2ZFHA 2MY8A 5A8RB 3ILJA 2W9CB 4KO0B 1RCXB 5EX3A 5C25B 3IO1A 3GV7B 3OTBA 3MECA 4CP5A 1FJGJ 1EARA 4RWWA 4ID5B 1RWVB 1SC4B 3C16B 4C8NA 4MFBA 3IP0A 2KJWA 3C6UB 4GVBA 1M1KT 2UU9F 3I5BA 4B3OA 4J9PA 4P10A 3NBPB 1K0VA 1WEYA 3FGVA 3MHYA 1HMVB 3OJUA 2EWHA 2HWTA 2ZD1B 4UZCA 1AROP 2BE7D 3GMGA 3QIDA 4JI7F 1HWLA 3HSGA 4L72B 4LFBJ 3BO2A 1EETB 3D6MB 1YBAA 2BJ1A 2Y0BB 3CJRA 3O8WA 3KDOA 4HLBA 2H65B 3Q83A 5HK4A 1WG4A 4YB6A 5L39A 1VQ9S 1XIQA 3FRZA 5AT1B 4N76A 4MH8A 2AIRB 4F4YA 2AJ2A 3G82A 1HBOA 4HACA 4WP9A 1U1QA 1UVJA 1S7HA 2VL1A 4LSNB 2PFFB 3D3BJ 1JLEA 5E3AA 4J9OA 2NR0A 2D3ZA 4HI1A 4WXOA 1VYAA 5A0YB 1TL3B 1YJTA 4ZVHA 1NK6A 5HVFA 2N7YA 3VGUA 3TUZC 5BR8F 2HS0A 4FF2A 4TU8A 2VPXB 5CYMB 4RW4B 3LTOA 1KONA 2WCXA 3OW2R 1FNXH 1B70B 2HHUA 2W7OA 2CQCA 2KH9A 5AXKA 2C3PA 2D74B 2A0FB 1NSPA 2OEMA 2RJZA 4LF9F 1RT7A 3NXZA 4CLZA 2VV5A 2AYEA 2R7VA 4CWBA 2QN6B 1RA6A 3UE2A 1EP4A 2BKPA 3WC0A 2HGLA 4EWTA 2IA0A 4WE1A 3US5A 1E6VB 1I3OB 4J9SA 3VVTA 4WYLA 3ZZZA 1JNRB 1SJ1A 2C1EB 1SKSA 2RHQB 3FFIA 3LW5C 2XBPA 3GIRA 3M6UA 4KT0C 1RTIB
chains in the Genus database with same CATH topology
3PHTA 2BJ9A 2WVEA 2HZAA 2F1FA 2HZVA 2WVCA 2CA9A 3OD2A 2WVBA 2WVDA 2PC6A 3QSIA 2BJ7A 2WVFA 3BKUA 1Q5VA 2BJ1A 2FGCA 2CAJA 1Q5YA 3BKTA 2NZCA 3BKFA 3LGHA 2CADA 2Y3YA 2BJ3A 2BJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHT A;  2BJ9 A;  2WVE A;  2HZA A;  2F1F A;  2HZV A;  2WVC A;  2CA9 A;  3OD2 A;  2WVB A;  2WVD A;  2PC6 A;  3QSI A;  2BJ7 A;  2WVF A;  3BKU A;  1Q5V A;  2BJ1 A;  2FGC A;  2CAJ A;  1Q5Y A;  3BKT A;  2NZC A;  3BKF A;  3LGH A;  2CAD A;  2Y3Y A;  2BJ3 A;  2BJ8 A; 
#chains in the Genus database with same CATH topology
 3V4I B;  4QQB A;  3D7S B;  1RT1 B;  4NLQ A;  2OH2 A;  4AND A;  3O6Q A;  2IA6 A;  1S57 A;  1CJT A;  4EZ6 A;  3V6H A;  1ZOT A;  1OYD A;  2BBE A;  3IS9 B;  2V8D A;  1WC1 A;  1OMS A;  2XCP A;  1RWP B;  5F9L A;  2BKN A;  1NBE B;  1VQM S;  1HNV B;  1SUQ A;  1U8W A;  2B4U A;  1RAF B;  2YWE A;  1NSK L;  3PYG A;  2XZT B;  3H7H B;  4ZN1 A;  2QL7 B;  3IN5 A;  3W3S A;  3DRP B;  1SH0 A;  5HMY A;  1KVJ A;  2ZHO A;  1N54 B;  1QUP A;  1NJZ A;  1RT3 B;  1T7P A;  2H48 B;  3POT A;  4X64 F;  2RKI A;  2K1R A;  2UUB F;  2GJI A;  2W2Q P;  2XMW A;  2DHG A;  3MDF A;  3M30 B;  4YME A;  3IRW P;  4DQI A;  3SCL E;  1C4A A;  3PRB A;  5DM6 Q;  1XWL A;  2ILZ A;  4OFZ A;  2FJB B;  1NZ8 A;  2HAI A;  3MM9 B;  2V4Q A;  1UJ6 A;  1HBN A;  2E1P A;  3CJ8 A;  3DDK A;  3KJN B;  4BS2 A;  4CO2 A;  3R1H A;  3PW2 A;  3H8Y A;  1UMJ A;  2GIR A;  3CF5 Q;  4J90 A;  3FBE A;  4O4G B;  3CCV S;  1FNM A;  1IN0 A;  1RGV A;  2IRY A;  5D0H A;  4C8M A;  4HTI A;  3PAC A;  4OL8 A;  2X3D A;  3G71 S;  1CJU A;  3ELH A;  3UO0 A;  3PX4 A;  2ZVS A;  4H4O B;  4WF9 Q;  2BJ7 A;  1AA1 B;  2YKO A;  3M2R A;  2CJB A;  4U9R A;  4Y3C A;  1SCJ B;  1TR0 A;  1XN9 A;  3AOC A;  3TEH B;  2BJE A;  3MMJ A;  1GTE A;  4OJ1 A;  4G3I A;  1J5O B;  3FEY B;  4BCA A;  1FD2 A;  3CDB A;  3NCP A;  5AE2 A;  3H20 A;  4OX7 A;  4Y0F A;  1RAH B;  1A0O B;  2YKN B;  3G9C A;  1RHJ B;  2P8I A;  3IRX A;  4F4A A;  3NGK A;  1MU2 B;  3ENA A;  3J7Z 5;  1T03 A;  5H1S V;  4CH1 A;  2Q1L A;  2HAF A;  1NK8 A;  3OQ2 A;  4F2R A;  1ICE B;  5L46 A;  1WF2 A;  3MXH P;  5J2N B;  3P5B P;  5ETS A;  5HAO A;  2APO A;  4DV0 J;  2MKS A;  3RB0 A;  1VDH A;  1XR7 A;  1KQK A;  5C42 A;  3JB9 k;  3DNC A;  3BB5 A;  4IG0 B;  4ZVG A;  4LVN P;  5D3G B;  2V9W A;  2VPW B;  4LQ9 A;  3W8G A;  2DNK A;  2XNQ A;  5KG5 A;  4YY3 F;  3NY0 A;  3ZZP A;  4OI2 A;  3J81 j;  2NZ4 A;  4ANE A;  2L3M A;  3IBW A;  1FO1 A;  1XR6 A;  4X66 J;  2F8H A;  3OBI A;  2DGT A;  1PYS B;  1TZ0 A;  2YX1 A;  5KFV A;  5D0E A;  1HNV A;  2HFU A;  3PM9 A;  2FQQ B;  1HNX F;  4DR3 J;  2MKC A;  4J9Q A;  2AF6 A;  2KVQ E;  2OAU A;  1CJK B;  1UA0 A;  4L6V 3;  5D0G A;  2JH3 A;  1WSR A;  3NEK A;  2FUG 9;  1S4F A;  3LUY A;  4PXD A;  3L09 A;  1ZYQ A;  2MQP A;  1F3F A;  1ZPW X;  3DYA B;  2X1A A;  3U1M A;  1WI8 A;  5CA5 A;  4DL6 A;  5CAB A;  1QAJ A;  1SV5 B;  2BM1 A;  3VAM A;  3NL0 A;  4ZK7 M;  2V5H G;  1MRO A;  5DS7 A;  1LKZ A;  3NNC A;  4ZCK A;  5B0F A;  2VUG A;  1RWK B;  1TKZ A;  1YRU A;  4J9U E;  2F9D A;  3P6Y C;  2BQU A;  3DI6 A;  1RTJ A;  5KT7 A;  4DMZ A;  2VQF F;  4J9N A;  3EE3 A;  5F3T A;  3JSM A;  5FJ4 A;  3OTC A;  4GKK J;  2IBO A;  1WSV A;  2RRB A;  3S1T A;  2CNK B;  1T9X A;  3MAA A;  4OZ1 A;  2DEJ A;  3VZH A;  3TZY A;  5KFW A;  3T1H F;  2KB2 A;  1N8R T;  1NZA A;  1S76 D;  1C4C A;  2MJU A;  1Q1K A;  3H5U A;  3KHG A;  2VFU A;  3HFV A;  3JTP A;  5KFX A;  1PKU A;  3LAM A;  5DGB A;  4IO1 A;  1X5S A;  2J7U A;  2MQM A;  1OPZ A;  3SCJ E;  2VZ9 A;  1RTH A;  2UZA A;  1UCN A;  2Q6C A;  5CD4 A;  4OYM A;  4ZVT B;  1D9D A;  2E7V A;  4X62 F;  1BWV A;  1X7V A;  1U47 A;  1BUX A;  2JLG A;  2WW8 A;  5KFP A;  1RAJ A;  4ID8 A;  4QWE A;  2VJV A;  3BJY A;  4DSI A;  1RT4 B;  2D3U A;  3HHK A;  5DLF A;  1H6K X;  2WRM A;  4X4P A;  2CQB A;  4DR4 J;  3B4M A;  3Q8V A;  1CJV A;  1TV6 A;  2PEH A;  3C19 A;  3AXM A;  4TYA A;  4YR3 A;  3M8S A;  1HHT P;  4K4X A;  3HDS A;  2MXY A;  1ZM2 A;  2MZT A;  4DN0 A;  2GV1 A;  3BGF A;  2UVR A;  3G8Q A;  1HMV A;  2CJY B;  5G0R A;  3ZZR A;  2EBE A;  3S8S A;  4JI1 F;  1O8B A;  2NSB A;  4IFY A;  3N28 A;  2HRY A;  5KFK A;  2FLL A;  4C2M A;  4CLL A;  3K0J A;  1HWI A;  4G1Q B;  2GHW A;  5HRO B;  5I3U A;  3THV A;  2K3K A;  3T5K A;  4OI3 A;  2Z4P A;  4KQZ A;  2CPJ A;  1UEU A;  3CD5 A;  4NZ7 A;  5E7O B;  3W62 A;  2J5A A;  4AQY F;  2XHW A;  1TL5 A;  2L9D A;  3SDE A;  1TL7 A;  1IKW A;  1YZ6 A;  5AXN A;  4P2X A;  3RGI A;  1TK8 A;  4RPF A;  5K8O A;  3M8Q A;  1R0A A;  4U7U K;  2CQ3 A;  1ZBT A;  2GMH A;  2QL5 B;  3OTO J;  2WON A;  4FPR A;  2LQ9 A;  3JSR A;  3PZP A;  1IWA A;  3F41 A;  2VBY A;  4N47 A;  5A2Q U;  2LXU A;  1F2G A;  1M5S A;  1TTH B;  4F04 B;  4DQQ A;  3CDA A;  4KHM A;  1Y7P A;  4A8S A;  3H2U B;  3CJ2 A;  2VC0 A;  5F9N A;  4PEO A;  2W2N P;  3DXB A;  3TWZ A;  4JV2 A;  5IM0 B;  2GML A;  3D6T B;  3MM8 A;  3W2W A;  2HQ3 A;  2BAN B;  3TR5 A;  1PJ7 A;  1SH2 A;  4ES3 A;  1SVD A;  1X4H A;  1KTV A;  4WCE Q;  1CJU B;  2AEJ A;  3V6J A;  1L3U A;  1RQ0 A;  4FPI A;  5CYQ A;  1T3N A;  4TY8 B;  2R8G A;  1CQM A;  2V63 A;  2VBW A;  5KG3 A;  1KEK A;  5J1E A;  3HHL C;  1HKA A;  1TL1 B;  2QA1 A;  2LXF A;  3MED B;  3HT0 A;  3QSI A;  3MR5 A;  1TP7 A;  3TZX A;  3IG1 A;  2KN4 A;  3BSA A;  2HND A;  4KJI A;  1VRU A;  3P3D A;  1F3V A;  2VBX A;  1KWM A;  1Q5Y A;  2W24 A;  3D0H E;  3D9B A;  1MU2 A;  2HBZ B;  3N4W A;  4NEY A;  1LW0 B;  2HQI A;  3BKF A;  1IR2 A;  3GII A;  2ZOM A;  5GAG U;  2QFI A;  5KAK A;  1FNO A;  2JFK A;  3D0I E;  3EZU A;  3MR7 A;  1R3N A;  4E8U A;  3Q8Q B;  4EK2 A;  4DV5 F;  3MCM A;  2DY1 A;  1QJH A;  3IM9 A;  4A47 A;  4NLR A;  3HFZ B;  2OD6 A;  2YQ3 A;  2N3L A;  4K4U A;  5D4O A;  2FLO A;  1VRT B;  4UQG A;  4C3K A;  3EMT A;  4P2S A;  5D78 A;  2B9X A;  1QAY A;  4S0M A;  2YWW A;  2WVB A;  2AMC B;  3H2L A;  4UOG A;  2C28 A;  1XNQ J;  5LJ3 Y;  4B3R F;  1UZD A;  2ZBP A;  5FLX Y;  2EBG A;  2ZJP Q;  3V6D A;  1KBR A;  4M5H A;  4ZOS A;  5D0R A;  3U02 A;  2JDJ A;  4RW8 A;  3EM1 A;  4K4T A;  4B9U A;  1FES A;  3OPK A;  3N5B A;  3Q8U A;  4DQP A;  1NHU A;  1F6T A;  2CZ4 A;  2HWH A;  4NAS A;  4B3T J;  2IBK A;  4R5P A;  2HMI A;  2HVZ A;  2M3D A;  2E44 A;  4JB8 B;  2VG5 A;  4PAB A;  4DR3 F;  4KPY A;  4GC7 A;  1H0H B;  4OHV A;  3IA0 A;  3QGI A;  3C6U A;  4OX9 J;  1N0U A;  5KFN A;  3K58 A;  3PW5 A;  2W2P P;  2YNG B;  2FYX A;  4NLO A;  1CC7 A;  2GGP B;  3R6L B;  4DN9 A;  5MAO A;  4MAK A;  4PG6 A;  4U6P A;  1HBM A;  4CZC A;  4FVC A;  1WC3 A;  4ZP8 A;  5B0E A;  4QOT A;  2R9L A;  5EUH A;  1L3K A;  1QTM A;  1FVQ A;  4FF4 A;  5LMN J;  2ZWP A;  1KC8 T;  1VBK A;  2LQ5 A;  3MPD A;  1Y0H A;  1WI6 A;  2OIH A;  5KFL A;  4WXW A;  1FX2 A;  2U1A A;  2MMY A;  3WZ0 A;  1FKA F;  1RJJ A;  3C14 A;  4YY3 J;  4EBD A;  1MG7 A;  1YJ9 S;  2HHW A;  4B9L A;  3CT9 A;  2ZKT A;  1HYS B;  1RU2 A;  4F67 A;  5GME A;  4PAA A;  1ROF A;  5DG9 A;  2ZBI A;  5KFM A;  1X9S A;  2YKA A;  1IBK F;  3UCZ P;  2XS2 A;  1YQH A;  1U0H A;  3I4P A;  2BRK A;  2AJ1 A;  2C42 A;  2XHC A;  1RHU B;  4LF1 A;  3CJK B;  4IRK A;  5KFR A;  1D9A A;  3MM6 A;  1IR1 A;  4C6A A;  3CC4 S;  1YIJ S;  2R8K A;  3JYT B;  5IT9 Y;  2RS8 A;  2XLJ A;  4ZPV R;  3T6B A;  2D9O A;  3NBP A;  3RRK A;  2K8G A;  4XPE A;  1PYO B;  4MFB B;  1XNR F;  2RUG A;  3DKD A;  3DOL B;  2DNR A;  3AHP A;  4OLP A;  4U8Y A;  4USV A;  5M2P A;  5IT0 A;  4DLG A;  4F36 A;  5GVQ A;  5IV3 A;  3P45 B;  4C3L A;  2W9B A;  2PEB A;  3KLF B;  4LRB A;  3NGR A;  3VAI A;  3HHE A;  3R7N B;  1T05 B;  4Q0B B;  3R3T A;  3NKY A;  4CLS A;  1JKH B;  4CM2 A;  2CKW A;  5KT5 A;  3CB4 A;  2VD3 A;  4IG3 B;  2VB6 A;  4XDC A;  4CNZ A;  5A6P A;  5IFM A;  4DFP A;  3FCW A;  2R7R A;  1KHV A;  3DOK A;  1GMW A;  3QFW A;  5KFO A;  4O3Q A;  4QCL A;  4GKK F;  1X4C A;  3OFG A;  4G1Q A;  4BLG A;  1C0T B;  5B0A A;  1SKW A;  5CYM A;  2N82 B;  5KG6 A;  2I38 A;  3M8R A;  2VG5 B;  3NGT A;  1VRU B;  2DJW A;  3FDS A;  3MR2 A;  3LPY A;  5HAT A;  1Q7Y T;  3C16 A;  2XS5 A;  3VR1 A;  2OPP A;  4USM A;  4OI0 A;  2LU2 A;  2A6O A;  2V68 A;  3AQP A;  3DHX A;  1R27 B;  4C48 A;  2DY9 A;  2R8I A;  3GWC A;  4TVA B;  2B56 A;  3V4I A;  4ED5 A;  2MQN A;  3KHH A;  5BYR A;  1QVF R;  2ZC4 A;  2HK2 A;  2M2B A;  3W2W B;  3OV7 A;  2BR0 A;  2UP1 A;  3PHE A;  1EIY B;  1RLC L;  4JV5 F;  1E6V A;  1R89 A;  1FKO A;  4IH5 A;  4YN3 B;  3SEO A;  3BPD A;  3TI0 A;  3DRR A;  3U7J A;  2OFH X;  1WHY A;  1OPI A;  2B7B B;  2O5D A;  4H4K C;  1U26 A;  4ZIW A;  3V4M A;  2ZM6 J;  2B6A B;  1QSY A;  3HD1 A;  1QUV A;  1T9T A;  2MHN A;  2M8D B;  4K4S A;  2HVI A;  1Q78 A;  4X65 J;  3BBB A;  4W4M A;  4TY9 A;  1FKP A;  1FRJ A;  3R5A A;  4ECV A;  3M8Y A;  3OR1 A;  4JV1 A;  4ZVF A;  4RW9 A;  6AT1 B;  3KG4 A;  5LM7 E;  1YJW S;  1T03 B;  2H5I B;  4K2J A;  2A6M A;  3N79 A;  4LIR A;  2B9E A;  4A8F A;  4YB7 A;  2YNH B;  4OYX A;  1XC9 A;  4F3O A;  1Q53 A;  2MZJ A;  1FI4 A;  1U09 A;  4MIA A;  1X60 A;  1EKS A;  2NS1 B;  2Y3Y A;  3SXL A;  3C6T A;  2K1R B;  4DQR A;  1U4B A;  3CMQ A;  5SUH A;  2RQ4 A;  4UOH A;  3OFF A;  4CRJ A;  1OY9 A;  3DOM B;  3R5D A;  4ETX A;  3CCU S;  3OVB A;  1AUD A;  1R43 A;  4RW6 B;  4UTG A;  2XZW A;  4YS2 A;  3RUB L;  1KRP A;  3QPI A;  1U24 A;  3OXL A;  1GX5 A;  2EFP A;  3QFH A;  1J5E J;  5KOW A;  1WF0 A;  3ADA C;  3DFE A;  4P7V A;  3HMJ G;  4Z37 A;  2HNY A;  1YDL A;  4DV6 J;  4XAK A;  1NKC A;  2PC6 A;  3N5F A;  3A8I A;  4FP9 A;  4IRD A;  4C0H A;  2FJE B;  4PKD B;  3EDR B;  4ZPC A;  3V6D B;  2F8M A;  4USK A;  1TFY A;  2BDP A;  4QWD A;  4MT1 A;  2Q79 A;  4M5D B;  2J0S D;  3UCU P;  2LCW A;  1U6F A;  5DQH A;  2GAG C;  4IDK A;  3CXC R;  3TJ8 A;  5J2N A;  4DUY F;  4PUO A;  2V50 A;  2YKQ A;  4G1P A;  2N7C A;  4WBF A;  2YX4 A;  3CJQ A;  1IXK A;  1O51 A;  4NMX A;  2FLP A;  3QZ8 A;  2KT5 A;  2YWG A;  2NSC A;  3DMJ A;  4I2Q A;  1BQM B;  1QSS A;  5LSO A;  1K1S A;  2JVR A;  3MM7 B;  3MTJ A;  5BJR A;  1CBK A;  1HLW A;  2AJ4 A;  2KG1 A;  5ETN A;  2AEF A;  4IFV A;  4XDD A;  1KLM A;  1HQE A;  4C8K A;  1KLN A;  4RUB A;  4X4V A;  5C24 B;  1VMB A;  4KGM A;  2JNJ A;  2AJF E;  5DRK A;  3THP A;  4B02 A;  1WOP A;  4GO5 X;  2XYG B;  3SIP B;  1SJQ A;  3PW7 A;  1SQE A;  4J5O A;  1NJY A;  2HKE A;  1MW7 A;  1YWX A;  1GT8 A;  2OO4 A;  1TMJ A;  3DGP B;  3MWB A;  4KGX B;  4FKX A;  4QIW D;  4EGL A;  5DDP C;  4DFM A;  5HN0 A;  4KRW A;  3OHB A;  2CWK A;  4FNH A;  4HTJ A;  3CCJ S;  5I42 A;  1JJ4 A;  1TKT B;  3P4U B;  2MZR A;  3ISN C;  1S1W B;  3BSN A;  1F9E B;  2PN6 A;  2FJA B;  1DQA A;  2DGS A;  3UDC A;  5U47 A;  1VBZ A;  4U8V A;  3S6E A;  3ZFV A;  3I0R A;  4CO4 A;  3GIM A;  4JYA F;  1VIO A;  4WII A;  2HHV A;  1U1R A;  2RIJ A;  3CPW R;  2DB1 A;  2ZBQ A;  4DU7 A;  2V2Z A;  6FDR A;  1YHQ S;  4LF5 F;  4NLG A;  5CQG A;  2WVC A;  2H54 B;  4A8X A;  3ZNJ 1;  1HNI A;  4WJB A;  4CO3 A;  3K59 A;  2O01 C;  4CLU A;  1RBA A;  1FRM A;  1SC3 B;  3IRX B;  4OMF G;  2JJ4 D;  3GJR B;  1H7X A;  2E1A A;  4NOH A;  2DHS A;  4DEZ A;  3KHR A;  1XTZ A;  1KQG B;  2WVF A;  3CCQ S;  2AKW B;  2VFR A;  5C42 B;  3UD3 P;  5GAG I;  1YBU A;  3IM8 A;  1L5U A;  1IKX A;  3RBX A;  2OPR A;  2PA3 A;  4LBH A;  1URR A;  4CNY A;  5DLG A;  4YQW A;  4QR2 A;  3I87 A;  3RBZ A;  3TX0 A;  1IVZ A;  3MEK A;  3TA1 A;  5GAE I;  5KFQ A;  1S48 A;  2RD5 C;  1X4F A;  2YBV A;  3ISZ A;  2VA2 A;  2BMB A;  1N34 F;  1IUJ A;  3CC2 S;  2CPY A;  3QMQ A;  2E5H A;  4ZVQ B;  3E2E A;  2Y1J A;  1YLX A;  2RE1 A;  3FBB A;  3UD4 P;  4DCP B;  1NH7 A;  4A8Y A;  2XLI A;  2QLF B;  4PG7 A;  3KYL A;  2R7W A;  2KG0 A;  1FFW B;  1NXI A;  3EX7 B;  3MOZ A;  2O3D A;  5CCL A;  4JI0 J;  1M1G A;  3DLK B;  4HVZ A;  2RU9 A;  3HKZ D;  1C0T A;  3NS6 A;  3NRB A;  3DLJ A;  1RAA B;  3J7Y I;  4B9M A;  4BWM A;  3NNH A;  1U6B A;  2J9C A;  5KG0 A;  4NLU A;  1JQG A;  2NYH A;  1DTQ B;  2DGX A;  1OIA A;  4TN2 A;  2VPY B;  4URQ U;  5GMD A;  4ZMM A;  3D68 A;  2WTF A;  4NWB A;  4G1I A;  4MK7 A;  4EO6 A;  1WC0 A;  4I6W A;  2XGQ A;  3OSP A;  2ZZN A;  5EWG A;  2FZC B;  1DTT A;  3PFE A;  2NPF A;  1KLM B;  1HQE B;  3ET6 B;  2R7X A;  4RW6 A;  1ZTT A;  3HVT A;  3W60 A;  2XO6 A;  1EB0 A;  3L7P A;  2MPU A;  3DXS X;  3G6Y A;  1H38 A;  2Z0G A;  4ZA1 A;  2HHH J;  4LQ3 A;  4GKJ J;  3TAN A;  4HT7 A;  3TZZ A;  1RWN B;  3LA0 A;  4ED2 A;  5A0Y A;  1KD1 T;  2WSC C;  5LOQ A;  4FBU A;  3DU5 A;  5AJ3 J;  2C3O A;  2H5E A;  1F1B B;  1FA0 A;  1U0S A;  2RAQ A;  2V4J A;  3AXK A;  3RR7 A;  4I6A A;  2BAC A;  2OPQ B;  5F8H A;  3GZ7 A;  2HHQ A;  3GV8 B;  3GYX B;  5EWF A;  2ZH3 A;  2FLN A;  3OXG A;  2NCK L;  2WK4 A;  3MPW A;  6FD1 A;  5CAA A;  1J2V A;  2QJ3 A;  1X4E A;  2P6S A;  5KFT A;  4NLV A;  1E6Y A;  3M2R B;  5CZX A;  4NZ0 A;  1OQ3 A;  1Q8B A;  4F4Z A;  1B0T A;  4EU0 A;  4CH7 A;  1O6X A;  3WIV A;  3I56 S;  3MTK A;  1CJV B;  1TV6 B;  3KLI B;  1UFK A;  4ETZ A;  2PDA A;  3GFX A;  4Y2A A;  1JLA A;  3I5A A;  4X2B A;  1BQM A;  2MQO A;  1UA1 A;  3HUL A;  4QIG A;  1SPB P;  4O3R A;  1VJW A;  4DI6 A;  4WZQ A;  1UEK A;  3N9U C;  2MHE A;  3P5T L;  5E3R A;  4ZLJ A;  1H73 A;  2F1F A;  2RHS B;  5DDQ C;  2KFN A;  3I0S B;  1RT5 A;  4TNO A;  3DM2 A;  5HLF A;  2EG2 A;  2Z57 B;  5E33 A;  4Z7C A;  1FKO B;  2D9P A;  1ITP A;  3LP1 B;  2OEL A;  3SSS A;  3QGH A;  4ILR A;  4ZVP B;  2DNG A;  3HD2 A;  5K14 A;  2C3Y A;  3D4J A;  3BGL A;  4I68 A;  4V19 X;  4FF3 A;  1WD6 A;  3IWX A;  1H72 C;  3UD5 A;  1RTH B;  1KS2 A;  5JUM A;  3G96 A;  5HP1 B;  3EVM A;  5H9F K;  3BKU A;  1MWY A;  4QW9 A;  3BSC A;  4Z2X A;  1Q81 T;  3BKT A;  3NMR A;  2NXU A;  4KBI A;  2YNI B;  1NKB A;  3UN5 A;  2C3U A;  4B9V A;  2HVD A;  3H5X A;  4QIV A;  4DCJ B;  4PQU A;  3MPV A;  3DLK A;  1FRI A;  1KFD A;  4M5G A;  5DM7 Q;  2R8J A;  1LXJ A;  2OSQ A;  4WFZ A;  5K8M A;  2BAB A;  1GNK A;  4M63 A;  1VGY A;  1JWW A;  1YX2 A;  3S7R A;  1RCO B;  3HHL D;  3PXG a;  3KK1 A;  1KTQ A;  2ADC A;  1NME B;  3DGV A;  1SBR A;  4DSK A;  4CTA B;  2XMJ A;  5A8K B;  3V81 A;  2QT7 A;  4V1A k;  3LQV A;  1Q16 B;  4OZN A;  4F4K A;  4KR0 B;  1Y9O A;  1J5E F;  1HR0 F;  4H4K A;  3MD3 A;  2VIC A;  4KTQ A;  4LF9 J;  3PJW A;  1PIE A;  5CH7 B;  2LLZ A;  2KHD A;  3PDN A;  2OPS B;  1ZZN A;  3D66 A;  1TFW A;  4EZ9 A;  5D6G A;  2JFD A;  2V69 A;  1DRZ A;  5BR8 J;  2RQC A;  2EFQ A;  3BRE A;  2FHM A;  4DV2 J;  3Q24 A;  3MUT P;  4PQU B;  4RW4 A;  3UDV A;  4YB1 P;  1KVI A;  3HCX A;  2GVZ B;  2VQE J;  3FEZ A;  4DR2 J;  2M70 A;  3E01 A;  4ELT A;  2J7W A;  3IC1 A;  3PIO Q;  4DSF A;  1VC6 A;  1NKE A;  3SFU A;  3G6V A;  3MCO A;  2HS4 A;  4LFA J;  2V2Q A;  1DAR A;  1DTQ A;  1DAX A;  3CDW A;  1FRH A;  4O4R A;  3KJV A;  1R8A A;  2Z8Q A;  1F9F A;  1X4D A;  4FXV A;  3I0R B;  3M05 A;  1F5A A;  2XY6 A;  3R1L A;  2UU9 J;  1I94 F;  2EEY A;  1ELO A;  1Y4Z B;  2IVM A;  4IQM A;  4OZJ A;  3R2D J;  3HJV A;  3BGR A;  1VLO A;  3UR3 C;  1VHF A;  4A4J A;  3BDP A;  3CCT A;  1FDN A;  1GXL A;  3C14 B;  3IFE A;  3ETO A;  3EWG A;  4RR5 A;  4X4T A;  4WFA Q;  1HBU A;  1M5V C;  2UUW A;  1VIS A;  2EC2 A;  3X3U A;  1VK8 A;  4QYZ J;  1GTH A;  3MFH A;  2G13 A;  5B09 A;  2DTJ A;  4NL5 A;  1KP6 A;  2F4V F;  5B0B A;  2AHO B;  9RUB A;  4DX6 A;  1NPR A;  3MM6 B;  3TUJ C;  4JI6 J;  2QG9 B;  3DGP A;  4JV0 A;  3PJX A;  3CJK A;  1CUL A;  3SQG B;  2RU3 A;  1D1U A;  4DPT A;  2JEF A;  1E6Y B;  4OYB A;  4WTO B;  3TA0 A;  2HZA A;  4DLE A;  1PJ6 A;  1NUE A;  5D8H B;  3KLG A;  2CPZ A;  4PYA A;  2Y8Y A;  3RU0 A;  3QIP B;  1BD6 A;  3AB4 B;  2IDE A;  1VOM A;  1VQP S;  3WX4 A;  1EP4 B;  1VCT A;  3K8W A;  1N5Y B;  4YR0 A;  3M30 A;  1EQM A;  5E3C A;  5D4L A;  3P49 B;  1FD8 A;  4J9R A;  3KLF A;  2M4M A;  1HNW J;  2HNZ A;  4QPX A;  5H9F J;  1Z2L A;  1QM9 A;  2HLT A;  2WB1 D;  1N48 A;  4EEY A;  2IC3 A;  2Z2Y B;  1NJI T;  2V4R A;  1S77 D;  4ES1 A;  1XMO F;  1DTT B;  3M8Z A;  2FZG B;  3QNW B;  2GIQ A;  5BYS A;  2DIU A;  1FX4 A;  2I5J A;  1S1T B;  3HHL A;  3LAN A;  4N41 A;  3R2C J;  1NH8 A;  2XSJ B;  1CPZ A;  2HIQ A;  1VFJ A;  4F0K A;  4IH7 A;  5LL6 d;  1S5Z A;  2W7A A;  2ZUA A;  1HL6 A;  3CDE A;  4EYI B;  4AXJ A;  4UUW A;  1S1X A;  4DR6 F;  2YVS A;  4TU7 A;  2B9Y A;  2MKH A;  3DDI A;  3HM9 A;  3NS7 B;  4K8R A;  3IS9 A;  2QA2 A;  2GJF A;  1MLA A;  2RB7 A;  4RJV A;  5KFB A;  2CQH A;  2XUL A;  2YNH A;  4P72 A;  2WOM B;  2ZNZ A;  2VA3 A;  2MSS A;  4C98 A;  1CQN A;  1CS4 B;  3HJF A;  5T41 A;  3T1A A;  3C6T B;  3CVK A;  1HD0 A;  2HND B;  2NYI A;  3H42 A;  4HH0 A;  4KFB B;  4DZ6 A;  1NB7 A;  2J0Q D;  5J2Q B;  2XNR A;  4DU8 A;  1RT7 B;  3ITH B;  3CE8 A;  4DPU A;  3KG1 A;  3M1V A;  4DXL A;  4BWJ A;  2A10 A;  4DR6 J;  1PCA A;  2FTR A;  4A8Q A;  4YB5 A;  5HMW A;  2XQC A;  4UY8 5;  1N32 J;  4CO5 A;  3NWG A;  2R7T A;  2BKO A;  4AT1 B;  3SCK E;  2RDJ A;  4OHY A;  3PY8 A;  1AZS A;  1CSJ A;  3AJ2 A;  3HPO A;  4TKT A;  1XER A;  2AJ0 A;  1C1C A;  2G9O A;  2L41 A;  4HI2 A;  1S1V B;  4LT6 A;  3IR5 B;  3LGM A;  3KLE B;  1VQ5 S;  3QGG A;  1J27 A;  2HFZ A;  3MD1 A;  3JAM Y;  4PYD A;  2VIH A;  4B9T A;  5IT4 A;  1BY9 A;  3ULH A;  5GAE U;  1S72 S;  1N88 A;  3BR8 A;  4RO0 A;  1XMQ F;  1YGY A;  1Y5N B;  1REV B;  3JTO A;  4ZCI A;  2UVV A;  3MCN A;  4Y00 A;  3BR9 A;  1S6Q A;  4CLT A;  4NLT A;  3THT A;  3VZI A;  2OPP B;  3R5J B;  1R6Y A;  3EPI A;  2P9G A;  1OY6 A;  3GSD A;  5KFC A;  3SZ2 A;  2C2R A;  2ROE A;  3U1L A;  2AYG A;  3H5S A;  1FTR A;  1T9W A;  1RHR B;  1FK9 B;  2ILY A;  3RYL A;  4EYH B;  2G0C A;  1J5O A;  1VQ8 S;  5IM0 A;  4DR5 F;  4WYW A;  3KTQ A;  2H51 B;  2HFS A;  1ZM3 A;  5LXR A;  3KK2 A;  1IBC B;  4MTP A;  4PPD A;  3V2U C;  4BC7 A;  3BQ0 A;  1DLO B;  4O44 A;  3KHL A;  1RT2 A;  2WSF C;  1QY7 A;  3EXY A;  2R2R A;  3TX8 A;  3QWU A;  2F4V J;  5A8W A;  2KRR A;  3FZ2 A;  4WKR A;  4NA1 A;  2N3O A;  4L3K A;  4OI1 A;  2CJ9 A;  3R7S B;  1JLB A;  2EK6 A;  2MDA A;  3FK4 A;  4QW8 A;  4ZLL A;  3QJP A;  2M9K A;  3FEX B;  4UW2 A;  5DZ6 A;  3QQC D;  2B6A A;  4MKB A;  2CQ1 A;  4C0B A;  4J9L A;  3DOK B;  1DHM A;  4DSL A;  1HPZ B;  1T0T V;  1Q5V A;  4Y2K A;  4OZ0 A;  4PWD B;  1MWZ A;  5L8R C;  2E9Z A;  2XO7 A;  4Y6I A;  3ZTO A;  2KRB A;  1HI0 P;  3W63 A;  1N5V A;  2LDY A;  1F9H A;  1WEX A;  3EZO A;  5HJX A;  3OVS A;  4I6Y A;  1RKJ A;  2DGO A;  2QMU B;  4USU A;  3PKM A;  2AW0 A;  1BGX T;  2ALZ A;  2HW3 A;  2BE2 B;  3C15 B;  1X0F A;  2OEK A;  5T14 A;  4A8K A;  3PKY A;  4Y2M A;  1S9E B;  1UP1 A;  2ACY A;  4P71 A;  1H98 A;  1ACM B;  2DNO A;  4NPO A;  3BO3 A;  3ZC4 A;  1CLF A;  3UN2 A;  1N5T A;  3PR4 A;  4IFV B;  2YQ1 A;  2XS7 A;  4ECQ A;  3CUN A;  3EIC A;  4F2S A;  3I31 A;  5L1I A;  4I2Q B;  2WVD A;  2EFV A;  7FD1 A;  1C2P A;  4QWC A;  1OWX A;  1V5V A;  3MI7 X;  3TUP A;  1S1T A;  1YG0 A;  3DOM A;  3OFH A;  4OI6 A;  4DPO A;  5BXI A;  1Q86 T;  2DNP A;  3IR7 B;  3ZO7 A;  3QAE A;  4JI2 J;  5D4P A;  1DBD A;  5ETO A;  1S1W A;  5I4M A;  3MMA A;  2NUH A;  4YR2 A;  2DIS A;  2J76 E;  3IR6 B;  2RH3 A;  1K0T A;  3OFE A;  4F0H A;  1SIZ A;  1RHM B;  1PGZ A;  4L3N A;  3FKB A;  3MMB A;  4J9V A;  2B4P A;  4WWS A;  3KDN A;  1WHX A;  2JZ5 A;  4TU9 A;  3OTO F;  3K89 A;  2G2Z A;  4WKY A;  2AX1 A;  3TYT A;  2ZZM A;  4CT9 A;  3QRQ A;  1RK8 A;  3CD0 A;  4I0W A;  5KFE A;  1K73 T;  1RKI A;  5IV4 A;  1BC6 A;  5FLX U;  2RRA A;  1WHV A;  4OLO A;  1U1K A;  3X1L B;  1QAX A;  2IY5 B;  1F5B A;  5L38 A;  2GX8 A;  2BQR A;  4DR4 F;  2MY7 A;  4HHJ A;  3DLL Q;  1U2R A;  5KFH A;  4CM0 A;  4Q2L A;  1JB0 C;  3K5L A;  4KHP J;  2WBM A;  1OO0 B;  3DI6 B;  1HNZ F;  3EGN A;  3GG0 A;  2R7O A;  3ETM A;  1FEE A;  2QMW A;  2ZHB A;  2UUA F;  4RW7 B;  3NCQ A;  4PWU A;  4RNF A;  2CJK A;  3G8T A;  4RX6 A;  1G7C B;  3P96 A;  1DQ8 A;  3DLE A;  4OX8 A;  4LF6 F;  4JYA J;  3SBM A;  3J81 U;  2ATL A;  2B0G A;  1B0P A;  1ZAV A;  3KNA A;  2DK2 A;  5GAH I;  4OJG A;  1JLF A;  3CME S;  5KT6 A;  2LFV A;  2B8P A;  2BEF A;  1NCL A;  2DO4 A;  1YJU A;  4B3M J;  3QO9 B;  3RAQ A;  3HX9 A;  4NLD A;  4OJH A;  3ZTQ A;  2IJF A;  3WQP A;  3FC9 A;  5KG2 A;  4ECW A;  5H9E J;  2DR5 A;  4LSZ B;  1S49 A;  2RKI B;  2WSE C;  4M8L A;  4NLY A;  4IO9 Q;  3AOA A;  4CLF A;  2LQB A;  3KLG B;  3CJT A;  2CPD A;  4NLS A;  2H3E B;  3M8Q B;  3QGP A;  4WP8 A;  3VQS A;  1U7L A;  2I8E A;  3R5B A;  2FJV A;  4JI8 J;  2CIM A;  1TKX B;  2ERR A;  2AV5 A;  2VG6 B;  3KFW X;  5B7W A;  4FS2 A;  3M1V B;  5GAD I;  3NP5 A;  2H4Y B;  4IYQ A;  2VPZ B;  2J6S A;  2CPH A;  3O1L A;  4DX8 H;  1ZH5 A;  2YWF A;  3TAP A;  3VV2 B;  1Y5I B;  2GHV C;  1YKW A;  3HSZ A;  4LF4 F;  2W01 A;  3HF5 A;  1FCA A;  3QLH B;  2IVY A;  4WU2 A;  5CYQ B;  3AA9 A;  8ATC B;  5ETR A;  3T41 A;  2ZKU A;  4X4Q A;  2KU7 A;  4NA2 A;  2V34 A;  1U1L A;  4U96 A;  3KXD A;  3G4S S;  3DRP A;  3GFZ A;  4USH A;  2GVD A;  4ICL A;  2GZO A;  1UVI A;  1RT3 A;  1S9E A;  2XWY A;  2FHK A;  2Y1R I;  3GJS B;  3GON A;  4LSL A;  2MEW A;  4M5L A;  5ETM A;  5FII A;  4DQS A;  4L76 A;  4O3P A;  3GCW P;  2G0J A;  2LDI A;  3BGU A;  1RT6 B;  2HGN A;  3H40 A;  3VAH A;  2VF3 A;  4IH6 A;  4DFK A;  1L3T A;  2ZDO A;  3W5Z A;  4ERD A;  4GVL A;  3CCS S;  3EXC X;  4QR0 A;  2YY3 A;  3PW0 A;  1FWL A;  2LA4 A;  3M2V A;  1DFD A;  4R0J A;  4DUT A;  3DRY A;  1RWM B;  2QC3 A;  2VDI A;  4ALZ A;  1B7Y B;  1D3W A;  1C0U A;  3ENW A;  4OYA A;  1SIW B;  1RT1 A;  3ZNU A;  3J7A 1;  2PFD A;  1RI7 A;  3EZ5 A;  3SSR A;  1WC5 A;  4QU6 A;  3EGV A;  1B0V A;  2HWI A;  3MM5 B;  4PXE A;  2AGO A;  5A8W B;  4LRD A;  4YHH F;  2J0X A;  3M6V A;  1N4L A;  1TEL A;  2GVD B;  4PG4 A;  4DR7 F;  2C3M A;  2QV6 A;  3W1Y C;  2KTQ A;  3D2W A;  2CRL A;  3K5P A;  3KJF B;  2QEX S;  3GJT B;  3BH6 B;  1WG5 A;  4MIB A;  1HHQ A;  5IC4 B;  4CLP A;  4ENO A;  4B3S J;  4K4W A;  1Z4U A;  2FIU A;  3I5C A;  2FHJ D;  2Y0S D;  1U02 A;  4H4M B;  2YNI A;  3M2V B;  2FJW A;  5D77 A;  1P9Y A;  1T02 A;  1GMW D;  2E29 A;  3MEG A;  3Q8S B;  4DR5 J;  5C7P A;  2F9J A;  1HWJ A;  3A3O B;  3QZ7 A;  3D6H B;  4OZ5 A;  1Q8K A;  3EYZ A;  2HHH F;  2GMJ A;  2HS3 A;  5HQ8 A;  3A1Y G;  1RP5 A;  2OHD A;  4KGK A;  4DBQ A;  3FMW A;  2PD1 A;  1VRT A;  4C4W A;  2BW7 A;  2Y1L B;  3IGN A;  1FJE B;  1FER A;  1M5K C;  1FRX A;  1HHS A;  1KOH A;  4OHX A;  1X4A A;  2Z56 B;  3H4B A;  4ECY A;  2GAH C;  2MQ8 A;  3E01 B;  1M0S A;  4HT5 A;  2XY7 A;  4B3T F;  3TEG A;  4DV1 F;  1SI9 A;  3UWT A;  2A2C A;  4DR1 J;  1RTD A;  2CNO B;  4K59 A;  4OX6 A;  3JQJ A;  2FB0 A;  3D0G E;  3GSI A;  4H54 A;  4PCQ A;  4EUV A;  3I96 A;  1P6T A;  4N7T A;  1GMV A;  1ZET A;  3B4D A;  3BGO P;  4M1K A;  3SSQ A;  4KV8 B;  2XYH B;  1WEZ A;  1TKZ B;  3MMB B;  4ZCM A;  4DV0 F;  1Q82 T;  2HGM A;  2JLF A;  2ZH5 A;  1TKX A;  2QFJ A;  3D3C J;  4GC6 A;  1HWK A;  1RAC B;  4FXW A;  2GO9 A;  1ZM4 A;  1S6U A;  5C2G A;  4N56 A;  2KKH A;  4OZ3 A;  1IKY B;  3W5X A;  2YKP A;  3J7A N;  1SJ4 P;  2CJA A;  4M5I A;  1VQS A;  1RYS A;  4JP8 A;  2JEJ A;  1FHT A;  4A8M P;  4WK3 A;  5ADZ A;  1P27 B;  1UVM A;  3GPA A;  2I5J B;  2KYZ A;  3DU6 A;  3AOD A;  4D3H A;  5M2U A;  3RBD A;  2DRA A;  3EVO A;  4O3S A;  1IQT A;  2V67 A;  2X51 A;  1RTD B;  2RT3 A;  4X65 F;  3H90 A;  2W2M P;  1FRK A;  3ZTP A;  1IBK J;  2E66 A;  5E5N A;  2MLX A;  2ZH1 A;  3LOU A;  4NXN F;  3QLH A;  1JLQ A;  2EKY A;  2KVI A;  2G1D A;  4WIQ A;  3H0P A;  2VQE F;  3MAH A;  4CT8 A;  2IYG A;  2NXC A;  4J37 A;  5L1J A;  5HP1 A;  3UPF A;  2CZV C;  4DR7 J;  4OI4 A;  1GEH A;  1IKW B;  1T11 A;  3MUM P;  4IOA Q;  3GR0 A;  1WWH A;  1N5Y A;  5IT9 U;  1GAO A;  1Q79 A;  1YVF A;  4MIW A;  4E98 A;  2QA4 S;  2XLK A;  2KZZ A;  1LW2 A;  4M5M A;  2KL8 A;  4GMK A;  4KKO B;  5RUB A;  2JHE A;  2CQ2 A;  3SI8 A;  2A3J A;  2YWK A;  3D1Q A;  1JNZ B;  4M5N A;  3J81 Y;  4LMZ A;  4F3Q A;  1EET A;  2OMO A;  3CCW A;  3OLA A;  2DIV A;  4Y2C A;  2VKZ G;  3RAX A;  4ZVR B;  3MR6 A;  2CQG A;  3LGN A;  3T1H J;  3OTE A;  2DHH A;  5HQL A;  5KFA A;  4IFY B;  3KLI A;  2QO3 A;  4Y28 C;  3UCG A;  1ZTW A;  2W25 A;  4NCB A;  5J2M B;  1WC6 A;  2LXI A;  2R2S A;  5G0R B;  2NXN A;  5KFI A;  3ICL A;  1RWO B;  3AD8 C;  4CO1 A;  1TK0 A;  2BVZ A;  1UFL A;  2V8H A;  2OPS A;  2C2D A;  1NDL A;  2CPE A;  1RA7 A;  3OR2 B;  2COL A;  5EWE A;  1IR0 A;  1NDK A;  3DCA A;  1R31 A;  1SXL A;  2W4D A;  1IJF B;  2E5J A;  2FVR A;  1UWB A;  3JXO A;  2CA9 A;  2SXL A;  3FSI A;  3AB2 B;  2DPJ A;  1K44 A;  1WOS A;  2DKO B;  2HBR B;  3IMQ J;  4O0I A;  4I7F B;  1G6B A;  1S79 A;  3PFO A;  3OL6 A;  4TQR A;  4QPT A;  3QT6 A;  2JOQ A;  3D54 A;  3FQK A;  4TLR A;  2OP5 A;  5K8P A;  2KM8 B;  2HBY B;  1TKD A;  5KT2 A;  3NS5 A;  2F63 A;  3VAF A;  1UVN A;  2Y1I A;  2J9D A;  4Q0B A;  3Q89 A;  2AEM A;  1V3S A;  1HA1 A;  1Y11 A;  2EI5 A;  2X7I A;  1NPP A;  3ET6 A;  1RT6 A;  3PYD A;  3PCO B;  4KYZ A;  3PV8 A;  2BYC A;  2OEJ A;  4J91 A;  2EPI A;  3E3X A;  3H4D A;  5F8N A;  1GXT A;  4XK8 C;  2DXE A;  4YEA A;  2HG4 A;  1N33 J;  3GIJ A;  2XWX A;  2WAQ D;  3QT5 A;  3GIK A;  2NLW A;  3OR2 A;  2Q66 A;  2WZ1 A;  3MCS A;  4K0K F;  4NYO A;  4RU2 A;  2DR9 A;  2VFV A;  3K2Y A;  1Z1Z A;  5KT3 A;  3N01 A;  2GIF A;  3GCX P;  3MED A;  3M2U B;  3TVY A;  1T9V A;  3Q86 A;  5KG7 A;  2BRL A;  3PX6 A;  1H7W A;  5F8M A;  4PWD A;  2VU5 A;  1N56 A;  4LRF A;  1TU0 B;  2B3T B;  4R5P B;  2W8K A;  3MAQ A;  3RRH A;  2WB4 A;  5DET A;  4JI4 J;  1JJ2 R;  4DV5 J;  3PRV A;  1EAY C;  4RBU A;  5AXL A;  3VWS A;  4CH0 S;  3PIP Q;  2J6T A;  2HRT A;  4KHR A;  4LR7 A;  3F73 A;  2NZC A;  2HK3 A;  2O67 A;  3BDE A;  3TQE A;  2G0I A;  4IDK B;  4OHW A;  2HHX A;  1UJ4 A;  3EPG A;  1YZ7 A;  3LGH A;  3R9L A;  1LW2 B;  3T1Y F;  4B3O B;  5I3P A;  2HFO A;  1DLO A;  1RSC A;  4NXN J;  2DNY A;  2M7S A;  4Q45 A;  2XMA A;  2VQF J;  4ECX A;  1PC4 A;  1S1U A;  1S9G B;  1WKL A;  3M8P B;  2CQP A;  2HQC A;  2WON B;  2WVE A;  4O3N A;  5KFU A;  1RAG B;  1S6O A;  1LNQ A;  2FJD B;  2HQG A;  3EGW B;  4DPY A;  1FDB A;  3T5J A;  5CD4 H;  2C2N A;  3ZXW A;  5K14 B;  5F8G A;  4DV4 F;  5L1L A;  3MPY A;  3R97 A;  1NM2 A;  2ZNY A;  1N34 J;  2IM0 A;  2DHX A;  1UW9 A;  4AD6 A;  3RG6 A;  4WPA A;  5LT5 A;  1Q8L A;  1CJT B;  2FC8 A;  2QRR A;  1S99 A;  1WOO A;  1RB0 A;  4RL1 A;  2IIH A;  2X1G A;  4DV3 J;  4IRC A;  2QE5 A;  3D1H A;  3Q2T C;  3NMA A;  2HVH A;  1C1C B;  2OI2 A;  2BXJ A;  1TUW A;  4P2F A;  3ZZ0 A;  1R6V A;  1A9N B;  2YKN A;  5EN1 A;  1TKT A;  2QSW A;  4QZV B;  2MKK A;  1XNQ F;  4B3R J;  3A3N B;  4X4O A;  4KE5 A;  2IRU A;  3JYT A;  1LQ9 A;  1WAC A;  2ZH4 A;  1KSP A;  2KZM A;  2V0N A;  1N5Q A;  3LWL A;  3KK1 B;  3TUI C;  2EFN A;  1X5P A;  3MEE A;  2ZOG A;  4WFB Q;  4I67 A;  5B0C A;  2BX6 A;  5T7L A;  1BWE A;  1FXD A;  3LO3 A;  4FYY B;  1JXL A;  5J2Q A;  2YNF B;  3N6L A;  2HQD A;  2O1P A;  2N4C A;  2R8H A;  2QMX A;  5AE3 A;  5K8N A;  3R5C A;  2UXB F;  3DMJ B;  2ZJQ Q;  3LP0 A;  1AUS L;  2QLX A;  3BH7 B;  3WHI A;  3MM9 A;  1YRX A;  4C7Q A;  1L3V A;  3DLG A;  3KLH B;  4C9D A;  3W2V A;  4DSE A;  1Y3K A;  4FKY A;  3NGD A;  4UQT A;  1X9W A;  3UNG C;  1VQK S;  4JI4 F;  3M2U A;  1ZZF A;  2OD4 A;  4LSN A;  1HW8 A;  5F41 A;  5K20 B;  1FDD A;  3ZZT A;  5CCM A;  1IKV A;  1WDT A;  1T8E A;  5ETL A;  3HVW A;  3L7U A;  4TXS A;  3AD7 C;  2QZ8 A;  3CCM S;  2KXH A;  1U1N A;  4FXD A;  3M9N B;  2LKZ A;  4Q5V A;  3VVU A;  2F8E X;  2AZ3 A;  1RAO A;  4NXM F;  5K5M A;  4ATN A;  1T9Y A;  2C2E A;  5G4D A;  2CPX A;  1O0P A;  5DDR C;  4G6V B;  3U27 A;  1LK7 A;  2RF2 A;  2X3G A;  4ZPD A;  4ECZ A;  2I9S A;  5DQG A;  2Q43 A;  2XTJ P;  2HHP A;  2UV8 A;  1SQG A;  2VFS A;  4MMO A;  4GVB B;  2K2P A;  3JSM B;  3GIL A;  4DUY J;  1B64 A;  2DD8 S;  1NEE A;  2JVO A;  2UUT A;  5FDL A;  3KK2 B;  2FZK B;  1RAB B;  3G6E S;  4M94 A;  4DV2 F;  2AT1 B;  4U67 Q;  1RTI A;  3R6G B;  2EC0 A;  1VQ7 S;  2HSE B;  3PRD A;  2UUB J;  4USW A;  1GX6 A;  2GFF A;  3MUR P;  4URS A;  1AB8 A;  2DR6 A;  1HYS A;  2Q6B A;  2XEX A;  4WE1 B;  1XEZ A;  2GS8 A;  2OPQ A;  5L9X A;  2MB0 B;  2Z30 B;  4O23 A;  4CO0 A;  3D6F B;  4A48 A;  2NRE A;  2IFX A;  5J2M A;  2I0X A;  1FKP B;  4FDF A;  4C0O C;  4CLW A;  3AOB A;  2ASL A;  4ED4 A;  3DN9 A;  1WKJ A;  3M7V A;  5E41 A;  1X5O A;  4LFC F;  2E1M C;  4LJM A;  2GVZ A;  2PT0 A;  2FY1 A;  2AP6 A;  4AL7 A;  1PBU A;  1M5H A;  3QO9 A;  4W92 B;  2VOO A;  1X8D A;  4DFJ A;  2HNZ B;  1S1U B;  1S9G A;  2EW9 A;  3TP2 A;  2R2T A;  1IBM F;  1SC6 A;  1R8C A;  3WC2 A;  1UPP A;  4ILL A;  4W98 A;  4WFX A;  2I1R A;  4F02 A;  4Q43 A;  1LWC A;  3HFK A;  4F8R A;  3POT B;  1AXQ A;  2H1Y A;  2U2F A;  2MKJ A;  1S0O A;  4IOC Q;  2HYI B;  2OTL S;  2Q3P A;  1CEZ A;  2LA6 A;  4BC9 A;  2M0G B;  2VBZ A;  2XCA A;  3OXF A;  3FSX A;  3R27 A;  2BJ9 A;  1IM6 A;  3UVJ B;  1T94 A;  3PNI A;  1LV5 A;  1F0X A;  4ZPA A;  2JRS A;  2OJ3 A;  4B3M F;  3RB3 A;  2F4F A;  2CXE A;  3BN4 A;  3QAU A;  3TAR A;  3UR0 A;  4RUA A;  3M32 B;  4HYK A;  2HHT A;  3BF4 A;  3A4T A;  2P9C A;  3C3L A;  5DO2 A;  2I2Y A;  5D4N A;  5EGY A;  1SQF A;  4UOF A;  5I3Q A;  2DXF A;  4KH1 B;  2JEI A;  3EDQ B;  4O4G A;  3UDL A;  1LXN A;  4A8O A;  2RSQ A;  1NK9 A;  1ZM9 A;  1X4G A;  1R0A B;  2EVZ A;  3KLV A;  2QX0 A;  2EXU A;  5CYJ A;  3OVA A;  2IDL A;  5IXU A;  3B78 A;  4Q44 A;  1S10 A;  3CD6 S;  1YJ7 A;  2FC9 A;  2G4B A;  3MFI A;  3GFH A;  3UW1 A;  3KWM A;  5IQQ A;  4QU7 A;  4DX5 A;  1JX4 A;  2XC9 A;  4JV5 J;  1OY8 A;  3A12 A;  3CCR S;  4DV7 F;  5H9E K;  2W2O P;  3OHA A;  3ZTR A;  3FUY A;  3H5Y A;  2ZBC A;  3BYP A;  4RZR A;  3TQ1 A;  1VC0 A;  2HZV A;  3O5T B;  1BQN A;  1KVK A;  4QWA A;  3TNV A;  4TY8 A;  4DL4 A;  3K17 A;  1S97 A;  4QYZ K;  4RW7 A;  1MMD A;  2FPH X;  4OYO A;  4PG8 A;  2ZZT A;  4ED0 A;  2B43 A;  1IBL F;  3OUY B;  2BUN A;  3TJA A;  4DZD A;  2FVP A;  3IWN C;  1EQ0 A;  3K8V A;  3DRR B;  1VS3 A;  2G2O A;  2W1B A;  4X4R A;  4PRF A;  1TAQ A;  1I5O B;  2CPF A;  1PAU B;  1G2E A;  3OL9 A;  1X4B A;  1G4C A;  3CO9 A;  3IXQ A;  3G86 A;  3T9N A;  4JI5 J;  4W90 B;  2PO4 A;  3U1N A;  1SKU B;  2FD2 A;  1U49 A;  1RT4 A;  1NJX A;  2CG8 A;  7FDR A;  3UN3 A;  2YQ0 A;  3LWM A;  5DDO C;  4LFC J;  1FWP A;  3K5O A;  4ILM A;  1KR4 A;  2BJD A;  2M52 A;  4X66 F;  5J1P A;  5B08 A;  1XMQ J;  1PSD A;  2JC0 A;  1KHW A;  3AQO A;  3MGJ A;  4RW9 B;  3OL8 A;  1NB2 A;  2CZ9 A;  3KMQ A;  4YFU A;  1HNX J;  4ED6 A;  3LP0 B;  2RS2 A;  3MZI A;  2VG6 A;  5CXT A;  2RDD A;  1JLB B;  1LWE A;  1Y3J A;  1RWX B;  1M90 T;  2VOP A;  3PG9 A;  1IKX B;  1D8Z A;  3H2V E;  4ELU A;  4B9N A;  4OQJ A;  3JQM A;  4ED1 A;  4FYD A;  3I4H X;  2GNK A;  3HSD A;  5IWA J;  4RNN A;  3CC7 S;  2IM1 A;  2YH1 A;  2W9C A;  1JLQ B;  1WOR A;  1MMN A;  2N4D A;  1WEL A;  4X62 J;  3KNG A;  2HNY B;  3T5L A;  3MMC B;  2FJX A;  2WW4 A;  1ZA2 B;  4DSJ A;  2F40 A;  2QA4 G;  3TW0 A;  4HKQ A;  2MQQ A;  5GAH U;  3PYE A;  3M6X A;  1R8P A;  4ZVU B;  4DL5 A;  3TA2 A;  1HD1 A;  2KFY A;  3J7Y U;  2VC1 A;  2WOM A;  5HBM B;  4QWB A;  1LFP A;  1REV A;  5KT4 A;  2XMK A;  3GU0 A;  4ZKA A;  3PJ9 A;  2ZD1 A;  4GO7 X;  1FT8 A;  3IBC B;  1AT1 B;  1B99 A;  1F60 B;  1N52 B;  4P75 A;  4DL7 A;  4EBE A;  2P6T A;  2DT9 A;  2A18 A;  2AZ1 A;  1N0V C;  5F0U A;  5T7L B;  1Q0N A;  3PEH A;  2CWX A;  4NI2 B;  5D15 A;  1R0C B;  4LRE A;  1WUU A;  3VGT A;  1V9O A;  2B5J A;  2IHR 1;  1MN7 A;  2X1B A;  3FSY A;  3HVA A;  5C24 A;  4RNO A;  4ECR A;  4ED3 A;  1X9M A;  4R25 A;  2RVJ A;  4HR2 A;  1K1Q A;  5I3U B;  5HRO A;  5C2C A;  3TAQ A;  4DJB A;  1HQU B;  2VG7 A;  1XMO J;  3AY0 A;  1W7W A;  4DV1 J;  2WBR A;  4OYZ A;  4EO8 A;  5THW A;  1S12 A;  2M5Y A;  1V3R A;  5JJB A;  4FS1 A;  1QAI A;  2XI3 A;  1HPZ A;  1NU4 A;  1TL3 A;  1XMB A;  3AH6 A;  3IG1 B;  3L9Z A;  4ANC A;  3QT8 A;  4L74 A;  4UOC A;  1NPK A;  2IAJ A;  2LQJ A;  2MZS A;  1TL1 A;  1XK8 A;  4KKO A;  4B17 A;  1K9M T;  2QTW A;  4NRT A;  1XJW B;  4HHU A;  3DHW C;  3OLB A;  1VQY A;  2HIY A;  1UZH A;  3AA8 A;  4MYU A;  4K4V A;  1RHK B;  4NCG A;  3CUL A;  3PR5 B;  2GGP A;  4PQA A;  1D8Y A;  4JBC A;  1RBO B;  4C8Z A;  2KFZ A;  4XTT A;  5AXM A;  2MST A;  4DX7 A;  3Q8R B;  2R4F A;  3T5H A;  1RHQ B;  4F4X A;  1PC5 A;  4TQS A;  4I64 A;  3SYZ A;  3M6W A;  3FMB A;  4EMD A;  2OFG X;  8RUC A;  2DNN A;  2GO8 A;  2IC3 B;  3CSK A;  5EDW A;  3K5N A;  3AJ1 A;  3KJQ B;  4OHZ A;  3PVX A;  1TK5 A;  1U2F A;  4DDF A;  2ROP A;  1G3O A;  2UXB J;  2IAJ B;  2DEI A;  3SCI E;  4MK8 A;  4PXC A;  5HVG A;  2XY5 A;  1WKK A;  3PEJ A;  2EK1 A;  4NLP A;  3GR1 A;  4HEA 9;  4AFF A;  3WDO A;  7AT1 B;  1KNZ A;  1APS A;  4B9S A;  2ZVI A;  1S1V A;  1WC4 A;  1TQL A;  3ILO A;  4KY3 A;  4NLX A;  2DR7 A;  5A6W A;  2YPZ A;  2Z58 B;  3LAK A;  4JUZ A;  2B7C B;  2CDR B;  2OKQ A;  2AQ4 A;  3GQC A;  2G2Y A;  1XR5 A;  1T95 A;  2R7U A;  4LFA F;  3HHD A;  4DS4 A;  2HLU A;  2FGC A;  5ETQ A;  4OIX A;  1U1M A;  1FWK A;  2UUA J;  2YNG A;  1H3D A;  1F5C A;  3I55 S;  4N5S A;  2RQK A;  3R7B B;  1NSA A;  2HPU A;  1L3S A;  2OLW A;  1R8H A;  1LWX A;  2CVE A;  2P2C B;  1RT2 B;  1HW9 A;  1KN6 A;  1RWW B;  3ZZU A;  5A76 A;  4FZV A;  2NUU G;  3HI9 A;  3ONQ A;  1X0P A;  5F8I A;  4X64 J;  4N8O A;  2AJQ A;  4PR6 A;  2IMO A;  2IPO B;  1C1B B;  4IR9 A;  2KDO A;  2VOD A;  1S0N A;  3L3C A;  1HWU A;  2DGV A;  2MTL A;  4FYX B;  4LBI A;  4NE9 C;  2BAN A;  4NYZ A;  4AL5 A;  2ACM A;  3GE9 A;  3BBF A;  3MMC A;  4LVO P;  4CQ1 A;  2IJN A;  2GCF A;  1H2T Z;  3OR1 B;  4FF1 A;  4WZM A;  1EHW A;  2YTC A;  2D1C A;  4NML A;  2OGU A;  4YDX A;  3PW4 A;  2AGP A;  2ATC B;  3UNY A;  4DG1 B;  3RB4 A;  4MYT A;  5DGA A;  4TLQ A;  4F25 A;  3C2P A;  1Q8I A;  5KFG A;  2HEK A;  3TVZ A;  5HO4 A;  1RIS A;  4PG5 A;  4JI6 F;  3VGV A;  4ED7 A;  1NK7 A;  1U8S A;  4OZL A;  2P5V A;  2ZH9 A;  2YNF A;  2K7K A;  3BO4 A;  2BE2 A;  3C15 A;  3M8P A;  1FTC A;  3RTV A;  3V6K A;  3NCR A;  2MZQ A;  3ISN D;  3MF5 A;  3H98 A;  3ILI A;  5IS2 A;  1OS5 A;  1RTJ B;  3DRX A;  2YXL A;  2R7S A;  1VRQ C;  3J80 U;  1HFE L;  1PJ5 A;  4ZP7 A;  3UQS A;  3VTI A;  3VQT A;  1HNI B;  4ZCL A;  4A46 A;  5HJY A;  1N6Q B;  3Q23 A;  3GLJ A;  4ZP6 A;  3FFI B;  3CCE S;  4MKY A;  5ETP A;  2MGZ B;  3GB0 A;  2XMU A;  2J9E A;  5A8K A;  4A8W A;  3V81 B;  2CUY A;  3I6P A;  1RAI B;  4NLW A;  3AJD A;  2DYA A;  1VBY A;  3A13 A;  1HBN B;  5HMX A;  1SC1 B;  1RU1 A;  1EJ7 L;  3DLE B;  1CJK A;  1SJR A;  2BA9 A;  3Q0A A;  4OV6 A;  2HUR A;  2RML A;  2LQ8 A;  3HSJ A;  4AXI A;  4L75 A;  3MEE B;  2WHO A;  4EBC A;  4IKA A;  2XSF A;  5HSP A;  3CJS A;  2HFN A;  1DQ9 A;  3KJV B;  3FVY A;  1S6P A;  3KUG A;  4N77 A;  3C8Y A;  3Q8Y A;  5LSR A;  5KOX A;  5AJ3 F;  2IVF B;  1OSD A;  3BBC A;  2DXD A;  3FZB A;  2YKM B;  1R0B G;  3CIM A;  3IWL A;  4UST A;  4P9S A;  4XIU A;  5LMU F;  4B3S F;  2W8L A;  1NHK L;  5DG7 A;  4DR2 F;  4UY8 T;  3CMA S;  4ZPT R;  1S0V A;  2K3I A;  3Q22 A;  2CJX B;  4ZJL A;  1BMQ B;  1KDN A;  4FNI A;  5DJB A;  1HR0 J;  4KGV B;  2JEG A;  1LWF B;  1RAE B;  4LF6 J;  3RAM A;  1K8A T;  4KC5 A;  1RDR A;  3W2V B;  1R7I A;  4ED8 A;  2UUC F;  1B7F A;  2EFO A;  3C46 A;  2D7S A;  5LSL A;  1XBW A;  3D5M A;  2KJV A;  4XO0 A;  3PX0 A;  1D9F A;  4FBT A;  3E8O A;  1A6L A;  3AD9 C;  2UXC J;  2Z2M A;  3C66 A;  2VH7 A;  2IM2 A;  3MAA B;  5F0W A;  2CYY A;  3CJ0 A;  4I2P B;  2QLJ B;  1S6P B;  2NXJ A;  2XM3 A;  1NND A;  2B4V A;  4G65 A;  4ZVS B;  4F0M A;  1NK5 A;  2GC8 A;  2R7Q A;  3OT9 A;  4ZIV A;  4ID5 A;  1S4E A;  1ZAX A;  1U0H B;  3FQL A;  3WBZ A;  4AQY J;  4LR9 A;  3LPE A;  4MJK A;  1B4S A;  1W2B R;  1QVG R;  1FJ7 A;  1VQN S;  5KFS A;  3DYA A;  1YK9 A;  3HO1 A;  3IBF B;  4MKV A;  3TO8 A;  2ASD A;  5E3P A;  3PTW A;  2V9K A;  4C11 A;  4IUF A;  1BLU A;  2KM8 C;  2ZIT A;  4LF5 J;  2ZC3 A;  2ASJ A;  3I9V 9;  4U7U D;  4K5R A;  1C1B A;  4DR1 F;  3QT7 A;  1U48 A;  2JLE A;  4R0E A;  4CYU A;  1Q7L B;  1HBO B;  1OJ4 A;  2PII A;  2V8G A;  2OTJ S;  3RW6 A;  2GJ2 A;  2A2D A;  3P8B B;  3HHL B;  2HRU A;  3FBC A;  3DLG B;  3OJS A;  3KLH A;  3QAT A;  3PHT A;  4X4U A;  4LUB A;  1KFS A;  1GQE A;  5KFJ A;  3FCH A;  3S01 A;  2MQL A;  4NXM J;  1OSC A;  3HT3 A;  1NK4 A;  1S7I A;  1JLG B;  1HAR A;  2CVI A;  3IAS 9;  2QYC A;  3LP1 A;  4I1T A;  5JVG Q;  4B08 A;  4KAI A;  2LEB A;  1IQZ A;  2V6A A;  1JLF B;  2DRD A;  3OL7 A;  4DV7 J;  2IMW P;  3A3P B;  3LAL A;  1WTF A;  2CNN B;  2XZD B;  3MEG B;  4MK9 A;  2KXF A;  4LF7 F;  3DRS B;  4NCG B;  3W9J A;  1SL0 A;  3W65 A;  3RRG A;  1UWA A;  3AAW B;  2C22 A;  4UZB A;  2W7P A;  1VJQ A;  4Z7Y A;  3JAM U;  1SB6 A;  2D69 A;  1FFG B;  2BZ2 A;  3A8J A;  3BGR B;  1HI8 A;  1RE1 B;  4OJ3 A;  4N8N A;  1UVL A;  3CED A;  5ETT A;  3NAI A;  5JMN A;  2JWN A;  3MM8 B;  5IC6 B;  3MR3 A;  2V4J B;  1JLC A;  3KUE A;  4HL9 A;  5LJ5 Y;  2DVI A;  1PAE X;  4P7T A;  1JLG A;  3CNQ P;  1RYR A;  1AFI A;  2DHA A;  2LEP A;  4KB7 A;  2FVC A;  1I6J A;  4QIE A;  4DG1 A;  2J8S A;  2UVW A;  1U2C A;  5K9F A;  1LW0 A;  2FGO A;  3NLC A;  3T6J A;  1FEH A;  4CCH A;  2YX7 A;  3MEC B;  1GH8 A;  4JI2 F;  2DO0 A;  2LP4 A;  2CFX A;  2W9B B;  4DF4 A;  3IGV A;  4M5D A;  5C25 A;  5HQM A;  1VQO S;  1FK9 A;  2BQ3 A;  2RUS A;  5E0O A;  1W2I A;  1NDC A;  1ULR A;  2Z2L A;  4FN5 A;  1YIT S;  5CZV A;  2BJ8 A;  1D09 B;  2QYG A;  5GAD U;  1VBX A;  1W26 A;  4LIW A;  4AYB D;  1URN A;  1CS4 A;  5B0D A;  1UW4 A;  3PO4 A;  1Y5L B;  5FDL B;  4F26 A;  2R42 A;  2ADB A;  2J6U A;  4KSE B;  1QDU B;  5A2Q Y;  3OUY A;  2VON A;  3CW2 C;  3VAJ A;  4OYI A;  3SV4 A;  2CDQ A;  3RB6 A;  4WU3 A;  1NLK L;  4NEZ A;  3HVR A;  1QD1 A;  4DCO B;  2FHO B;  3QBC A;  3QRR A;  1DY3 A;  4CIO A;  1AZS B;  2FVQ A;  2DGQ A;  3L95 X;  2KT3 A;  2KYX A;  3AT1 B;  1RLD A;  3UVJ A;  1UET A;  2B4O A;  2E5L F;  4P74 A;  3KG0 A;  1KKH A;  3ENV A;  1V3Z A;  2CAJ A;  5KG1 A;  2H4W B;  4KO0 A;  3W64 A;  4DPX A;  2ZBR A;  2PMW A;  1RXO B;  2J7K A;  1IJE B;  1EZZ B;  3TVK A;  2RDI A;  2FY8 A;  5J1E B;  4KV8 A;  3SDE B;  1SL2 A;  3EGZ A;  1VI7 A;  2BM0 A;  2CQ0 A;  2H5J B;  4QR1 A;  4U95 A;  2IJR A;  5C5J A;  3KK3 A;  4DWI A;  4C11 B;  1FXL A;  2ROG A;  3DOL A;  3ZZY A;  4ZDN A;  2BE9 B;  3GYG A;  1Y00 A;  2PI5 A;  2AGQ A;  2M88 A;  1PBA A;  5HI7 A;  5F8L A;  3QIP A;  4U7C A;  4P2M A;  1FE4 A;  2B5J B;  4DL0 C;  2LVW A;  3BSO A;  3KK3 B;  4DL2 A;  3BEG B;  4M5K A;  3HLU A;  2K06 A;  1U1O A;  1JLC B;  3K7R A;  4ITS A;  4O44 B;  4E0D A;  3O44 A;  3BZQ A;  3E51 A;  4WK1 A;  1NSQ A;  2YPY A;  1IKY A;  3SFG A;  5EHH A;  2DNZ A;  4I2P A;  1X31 C;  2IM3 A;  1RWU A;  2GQC A;  5B0G A;  5HVH A;  2CAD A;  3N6M A;  4YDD B;  4DUZ F;  2DCL A;  4GKJ F;  4NCA A;  4OYW A;  2LU1 A;  4DF8 A;  1N5S A;  3FJ2 A;  1PO6 A;  2F65 A;  2E9R X;  2XG8 A;  3UDE A;  3D28 A;  4RW8 B;  2KXN B;  3BM7 A;  2VAS A;  1G1X A;  1QE1 B;  3TOQ A;  5ETK A;  2J8A A;  2NPI A;  1JXE A;  2ZOF A;  3VHQ A;  3SV3 A;  3CO0 P;  2LEA A;  3FBF A;  4FVM A;  3H59 A;  4DV4 J;  1S1X B;  4ZJQ A;  4ER8 A;  1HQ2 A;  2XMM A;  4RU9 A;  1XNR J;  3HK2 A;  4PPZ A;  3L4B C;  2O66 A;  4FYW B;  1W25 A;  4WFN Q;  3NOC A;  2YKM A;  3CJ4 A;  3M4X A;  2JL9 A;  4HHH A;  1Q95 G;  2OML A;  4K5S A;  2I6W A;  4QYR A;  4IQX A;  2CQ4 A;  4IG3 A;  4C97 A;  1FF2 A;  3GYN A;  1GXU A;  4PXB A;  1JKH A;  3W9H A;  1VQ4 S;  3T1Y J;  1IKV B;  1LWE B;  4R8U A;  4OYP A;  2MLY A;  1T05 A;  1O5J A;  1S59 A;  3DM2 B;  3ENQ A;  3MMA B;  5J2P B;  1PIL A;  3I32 A;  2UVU A;  4Q8F A;  1FRL A;  1UWB B;  4C3M A;  3GP9 A;  4WP3 A;  2AU0 A;  1QE1 A;  3Q2S C;  3JSY A;  4LF2 A;  1YJR A;  4LBP A;  2ZWO A;  3CTR A;  1LOU A;  1TL4 A;  4AE5 A;  1SKR A;  3LP2 B;  2ZH6 A;  5EX0 A;  4YP3 A;  3HZG A;  1JIH A;  2XMV A;  2RF2 B;  4K2X A;  3T19 A;  3KLE A;  4DPW A;  2L9N A;  4F7V A;  5HL7 Q;  2QL9 B;  4JI1 J;  1YJV A;  2NQP A;  2JSX A;  4O0N A;  4OV1 A;  4ECT A;  4ZJO A;  2HHS A;  1H74 A;  2L08 A;  4KGZ B;  1A7G E;  1MNE A;  2G1H A;  2GQQ A;  4IOB A;  4Q7A A;  3H25 A;  1N32 F;  9ATC B;  1QLN A;  4RUH A;  1MRO B;  2QLW A;  3FRY A;  4I69 A;  4K0K J;  2F5G A;  3CCZ A;  4L73 A;  4ZLP A;  4DL3 A;  2B51 A;  3DRS A;  5D3G A;  1Y10 A;  4ZHR B;  1C0U B;  1U6Z A;  2EFG A;  2CJQ A;  3NGU A;  4URG A;  2PMZ D;  2C2O B;  1NDP A;  2XB2 D;  3G8S A;  2HFV A;  5M2R A;  5IWA F;  5BYQ A;  3UI3 A;  1FFS B;  4JOU A;  3TAM A;  1SL1 A;  4BDP A;  1SJF A;  2FHJ A;  2UXD J;  3QSY B;  1GFW B;  1U25 A;  2PMH A;  3Q8P B;  3JS9 A;  5LMN F;  3CWJ A;  1UL3 A;  4DUZ J;  3I0S A;  4KH0 B;  2AD9 A;  1VR6 A;  3R5G A;  4LSL B;  1HNW F;  2ZEJ A;  1FJC A;  2KT2 A;  4ZS6 A;  3TZW A;  2ALY B;  3OSN A;  4CLK A;  2CPI A;  3SMZ A;  2OSR A;  1P1T A;  1ZA1 B;  2QLB B;  3L7O A;  4H4M A;  4KIA A;  4UUX A;  4ZVO B;  3NGS A;  5L9N A;  3T3F A;  4ELV A;  3BS9 A;  4H4O A;  1TVR B;  2X1F A;  4JI8 F;  4USI A;  2C2Z B;  2HMI B;  2FVS A;  2FDN A;  4F4W A;  1UAW A;  3F44 A;  4KPC A;  1WNE A;  1VHI A;  4XPC A;  1BE4 A;  1M5O C;  3DLB A;  5CHC B;  4LF8 F;  1KOO A;  3GV5 B;  1H2U X;  1RTZ A;  1RZM A;  1WF1 A;  2J0W A;  3RBE A;  2MLZ A;  3NOG A;  3TAM B;  1VLY A;  1B3T A;  1SJ3 P;  2PGC A;  2V8P A;  2YH0 A;  3BV8 A;  3ILL A;  2E5I A;  2ABY A;  3J80 Y;  1ZS6 A;  4JI3 J;  2E7W A;  2ZHA A;  4C8O A;  5KTQ A;  1REG X;  2DGW A;  4C8Y A;  1UFW A;  1BQX A;  4J9K A;  4DHV A;  3I82 A;  4CDI A;  2JC1 A;  1V6H A;  2CQD A;  4HH1 A;  2DNQ A;  2CNL B;  2J9D E;  2ZJR Q;  2E5L J;  2L9W A;  3MM5 A;  1N36 F;  2Z2Z A;  1CUL B;  3SQG A;  3D67 A;  4HDG A;  2XI2 A;  1V5I B;  3W5Y A;  3D1O A;  3W66 A;  4PWW A;  4ZVE A;  5E3Q A;  3KOA A;  1HIY A;  3V5R A;  4Q2M A;  1VK3 A;  4EI2 A;  2BJ3 A;  1XQI A;  1CG2 A;  4QJV A;  2ZH7 A;  1NAQ A;  1NHV A;  4ICL B;  1KQF B;  3W8P A;  2ASY A;  3GJQ B;  3AFG A;  1U1P A;  2XGP A;  3RR8 A;  3O3L A;  2BW2 A;  5JXS A;  4F50 A;  2K7J A;  4KHP F;  2MGZ A;  3T9Z A;  2ZM6 F;  5F8J A;  4LRC A;  2W9A A;  4UT4 A;  1N6Q A;  1LWC B;  2V94 A;  5IOL A;  2DH9 A;  3QYY A;  2PE8 A;  4LR8 A;  2AWZ A;  1SV5 A;  1I1G A;  2E1R A;  1UJ5 A;  2VJU A;  4OX9 F;  5I42 B;  4AUK A;  2HZC A;  3CIZ A;  1VIX A;  4CTA A;  4TYB A;  1NJW A;  2POK A;  4MKA A;  2XSJ A;  5IQ6 A;  2ZH8 A;  3QJL A;  4YOE A;  1DJ0 A;  1ZAW A;  2P9E A;  3KMS A;  4RNH A;  2EKN A;  2F7V A;  2CQI A;  2D41 A;  2ZE2 B;  2VKR A;  3VF0 B;  5SZT A;  1NK0 A;  2QIF A;  3PYF A;  5FD1 A;  2MJN A;  3BQ1 A;  2RRN A;  1YSJ A;  3MPU B;  2ZDP A;  1S0M A;  3W7B A;  1TUG B;  4P52 A;  2DRB A;  2DNM A;  3HKW A;  5DQI A;  3RW7 A;  4DV6 F;  3PO5 A;  1HBM B;  3A8E A;  3JSB A;  4F3M A;  1MML A;  5HAN A;  2D3O 1;  4JI5 F;  1WDD A;  3VCD A;  3VAG A;  2M8H A;  2GW8 A;  4PUO B;  1NO8 A;  4QIF A;  4ECU A;  3JQK A;  3SQO P;  3ITH A;  1ZPV A;  2DNH A;  1DZ5 A;  4X4S A;  2DR8 A;  1FXR A;  2CG4 A;  1FDA A;  4KFB A;  3TJ9 A;  2YWH A;  2IRX A;  2MZ1 A;  3HP6 A;  5F3Z A;  1LWF A;  2XYP B;  4DS5 A;  4FYV B;  3UFC X;  4ZN3 A;  5MLC V;  1M1H A;  2DCU B;  2HBQ B;  2RNE A;  2DBB A;  4NZ6 A;  4Q8E A;  4LF4 J;  2H9Z A;  1S9F A;  3NNA A;  1JXV A;  2EG1 A;  1JJH A;  4RKU C;  5J2P A;  2PSZ A;  1JJC B;  1EX8 A;  3M32 A;  3W9I A;  4R8U B;  4K50 A;  2JX2 A;  2OPR B;  1P1L A;  2VDH A;  3DDN A;  1T3O A;  2QGF B;  3RZA A;  4K7Q A;  5KFF A;  2MYF A;  3B82 A;  2NXE A;  1TAU A;  1WG1 A;  2E7X A;  2GA7 A;  3BYR A;  4HAC B;  4P73 A;  3LF0 A;  4NRU A;  3J7Z T;  4M95 A;  2DNL A;  4DOZ A;  5LMU J;  4BHQ A;  1KQS R;  1JLE B;  4J9M A;  5HMZ A;  1FE0 A;  3KUH A;  1I94 J;  2LMI A;  3OD2 A;  5DZ7 A;  1SH3 A;  4ZLN A;  3B54 A;  5A8R A;  3WX8 A;  3M8W A;  5AE1 A;  4RNM A;  3LP2 A;  1MWQ A;  1JMT A;  2DH8 A;  1H2V Z;  2VFT A;  3NG8 A;  1BXN A;  3RJM B;  1OQ6 A;  4YHH J;  1GK8 A;  1MN9 A;  4JI3 F;  2ZUG A;  5KFZ A;  4Y34 A;  5KFD A;  1EKR A;  2RQM A;  4ZHR A;  2MKI A;  4C8L A;  1WJ9 A;  3WIU A;  2XMT A;  4OZ2 A;  4RLE A;  1FVS A;  4ES2 A;  1HQU A;  2VG7 B;  4YUD A;  2OUG A;  1JK9 B;  3HVT B;  2AX0 A;  1UEV A;  3G87 A;  4RWX A;  4E2F B;  5GMK a;  1AW0 A;  4WTY A;  1QSL A;  2BOP A;  1GMU A;  3MUV P;  4JI7 J;  1OYE A;  3DLH A;  5ETV A;  2V8V A;  3VGS A;  4LFB F;  1LK5 A;  2QSF A;  3B6B A;  2Y9H A;  4DV3 F;  1VQ6 S;  3R8Y A;  1TUV A;  1IWG A;  2ZE2 A;  1K47 A;  2KHC A;  4LRA A;  5KG4 A;  2UXD F;  1WTB A;  1SUQ B;  3G82 B;  4V19 J;  2DGU A;  4NYP A;  2DIT A;  1AYE A;  2E5G A;  1S6Q B;  3GFY A;  2HVE A;  1FJG F;  2E9T A;  4ZIT A;  4NX9 A;  4D3G A;  3K57 A;  1R8B A;  1TMM A;  2C2K B;  4GRS A;  4X84 A;  3W61 A;  1YTY A;  1IBM J;  4I4B A;  2V2K A;  1JLA B;  2B9W A;  1DUR A;  1TL7 B;  2VHG A;  2B8Q A;  3G2X A;  1TVR A;  5IZH A;  3QRP A;  2GHP A;  1U45 A;  3B8H A;  2IYI A;  3CJ3 A;  1D0E A;  4UF4 A;  4RBT A;  1HI1 A;  4EFA C;  2UUC J;  1LEO A;  1LFW A;  4HDH A;  1YJN S;  1RAD B;  4K4Z A;  1T9U A;  2W4C A;  3JTN A;  1P9Q C;  2V2V A;  3G6X A;  2F3J A;  4BBY A;  2PA8 D;  3TRG A;  5DG8 A;  3VAK A;  5L1K A;  2RIL A;  1CVJ A;  3A8K A;  1UPM B;  3EJM A;  2E1C A;  4CYU B;  3MM7 A;  2UXC F;  4X4N A;  3GG1 A;  2AYB A;  2W4P A;  3CGI A;  1IBL J;  3CDU A;  4IR1 A;  1RT5 B;  3ZTS A;  5HLF B;  4RBV A;  1Z2Z A;  1WHW A;  1RUS A;  3KKF A;  1RBL A;  4AL6 A;  4PZV A;  2LEC A;  2L48 A;  3QWP A;  5HBM A;  1P8G A;  8AT1 B;  4LF7 J;  3EVW A;  2KI2 A;  3HZE A;  1PYT A;  3FNN A;  2AYM A;  4NA3 A;  1QTN B;  1F2H A;  2LYV A;  3F0N A;  4CLY A;  4I7F A;  2D3O R;  2C2M B;  4QBU A;  1UKU A;  3CJ5 A;  3M9O B;  1N36 J;  2BOA A;  3N0V A;  2ZH2 A;  4Y65 A;  3GTY X;  3F56 A;  1YRT A;  3NAH A;  5J1N A;  2Y8W A;  3HHN B;  2BV3 A;  3CCL S;  1N33 F;  1BHN A;  3DC2 A;  3QJJ A;  3K5M A;  2UV8 G;  5E2Q A;  3BPS P;  1UVK A;  3ZZO A;  1Q4R A;  4NI2 A;  1AFJ A;  4LF8 J;  2R2U A;  4K4Y A;  1VC5 A;  3HXM A;  1YBT A;  4M5J A;  3BN7 A;  3N6N A;  4J7C A;  4WFY A;  3IAM 9;  5ITH A;  4ECS A;  3OTD A;  2MKY A;  3BQ2 A;  4ZP9 A;  2DPI A;  4USJ C;  2R3V A;  3MOJ B;  1NRK A;  1UTA A;  3VAL A;  1HBU B;  3CD7 A;  1CC8 A;  1PG5 B;  2PI4 A;  4JI0 F;  4RUC A;  1VQL S;  1BQN B;  2DH7 A;  2HQF A;  1M5P C;  1I51 B;  2GQ2 A;  4CI0 B;  3NWR A;  4Y2I A;  3I9Z A;  3O2I A;  4IG0 A;  1YI2 S;  2KO1 A;  5KFY A;  4P6Q A;  4ZPB A;  1HNZ J;  3LH2 S;  1MSW D;  3M9M B;  3EUN A;  5JVH Q;  1X5T A;  5LXY A;  3FCV A;  4I56 A;  4ZPW R;  2A1B A;  1IM4 A;  4O3O A;  2ZFH A;  2MY8 A;  5A8R B;  3ILJ A;  2W9C B;  4KO0 B;  1RCX B;  5EX3 A;  5C25 B;  3IO1 A;  3GV7 B;  3OTB A;  3MEC A;  4CP5 A;  1FJG J;  1EAR A;  4RWW A;  4ID5 B;  1RWV B;  1SC4 B;  3C16 B;  4C8N A;  4MFB A;  3IP0 A;  2KJW A;  3C6U B;  4GVB A;  1M1K T;  2UU9 F;  3I5B A;  4B3O A;  4J9P A;  4P10 A;  3NBP B;  1K0V A;  1WEY A;  3FGV A;  3MHY A;  1HMV B;  3OJU A;  2EWH A;  2HWT A;  2ZD1 B;  4UZC A;  1ARO P;  2BE7 D;  3GMG A;  3QID A;  4JI7 F;  1HWL A;  3HSG A;  4L72 B;  4LFB J;  3BO2 A;  1EET B;  3D6M B;  1YBA A;  2BJ1 A;  2Y0B B;  3CJR A;  3O8W A;  3KDO A;  4HLB A;  2H65 B;  3Q83 A;  5HK4 A;  1WG4 A;  4YB6 A;  5L39 A;  1VQ9 S;  1XIQ A;  3FRZ A;  5AT1 B;  4N76 A;  4MH8 A;  2AIR B;  4F4Y A;  2AJ2 A;  3G82 A;  1HBO A;  4HAC A;  4WP9 A;  1U1Q A;  1UVJ A;  1S7H A;  2VL1 A;  4LSN B;  2PFF B;  3D3B J;  1JLE A;  5E3A A;  4J9O A;  2NR0 A;  2D3Z A;  4HI1 A;  4WXO A;  1VYA A;  5A0Y B;  1TL3 B;  1YJT A;  4ZVH A;  1NK6 A;  5HVF A;  2N7Y A;  3VGU A;  3TUZ C;  5BR8 F;  2HS0 A;  4FF2 A;  4TU8 A;  2VPX B;  5CYM B;  4RW4 B;  3LTO A;  1KON A;  2WCX A;  3OW2 R;  1FNX H;  1B70 B;  2HHU A;  2W7O A;  2CQC A;  2KH9 A;  5AXK A;  2C3P A;  2D74 B;  2A0F B;  1NSP A;  2OEM A;  2RJZ A;  4LF9 F;  1RT7 A;  3NXZ A;  4CLZ A;  2VV5 A;  2AYE A;  2R7V A;  4CWB A;  2QN6 B;  1RA6 A;  3UE2 A;  1EP4 A;  2BKP A;  3WC0 A;  2HGL A;  4EWT A;  2IA0 A;  4WE1 A;  3US5 A;  1E6V B;  1I3O B;  4J9S A;  3VVT A;  4WYL A;  3ZZZ A;  1JNR B;  1SJ1 A;  2C1E B;  1SKS A;  2RHQ B;  3FFI A;  3LW5 C;  2XBP A;  3GIR A;  3M6U A;  4KT0 C;  1RTI B; 
#chains in the Genus database with same CATH homology
 3PHT A;  2BJ9 A;  2WVE A;  2HZA A;  2F1F A;  2HZV A;  2WVC A;  2CA9 A;  3OD2 A;  2WVB A;  2WVD A;  2PC6 A;  3QSI A;  2BJ7 A;  2WVF A;  3BKU A;  1Q5V A;  2BJ1 A;  2FGC A;  2CAJ A;  1Q5Y A;  3BKT A;  2NZC A;  3BKF A;  3LGH A;  2CAD A;  2Y3Y A;  2BJ3 A;  2BJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...