3PHTA

Crystal structure of h74a mutant of helicobacter pylori nikr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
115
Chain Sequence
IINGYSSRSELVRDMIREKLVEDNWAEDNPNDESKIAVLVVIYDAHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative nickel-responsive regulator
publication title Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 29
structure length 115
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3phtA01
2CAJA 1Q5YA 2BJ1A 3BKTA 2NZCA 2Y3YA 3LGHA 1Q5VA 2WVBA 3PHTA 2BJ3A 2PC6A 2WVCA 2CADA 2F1FA 2WVFA 3BKFA 2HZAA 2CA9A 2BJ9A 2WVEA 3OD2A 3BKUA 2BJ8A 3QSIA 2FGCA 2HZVA 2BJ7A 2WVDA
chains in the Genus database with same CATH superfamily
4GVBB 4PXCA 4ALZA 1ACMB 1TL7B 2QFIA 1Z2ZA 1D9FA 2RKIA 3ILOA 4DV3J 4UW2A 4Z37A 4ZLLA 4ED4A 1SB6A 3BPSP 1AZSB 1FTRA 4KHPJ 2GNKA 1YWXA 2G2ZA 2XSFA 1X4GA 2QC3A 3B4MA 4DI6A 2QLFB 4FYXB 4Y2MA 2RMLA 3M8RA 3VZIA 1IKYA 3GFXA 2Q6BA 4RNFA 1M5HA 4W4MA 2NXUA 1G1XA 4OI2A 3HMJG 3G82B 1JJ4A 1RK8A 3MZIA 1JXLA 3MM7B 2LDIA 5KG5A 4FS1A 1JLAA 3MUTP 2VKZG 4ZVPB 4RNHA 4ED3A 2GAHC 1RTZA 4GC7A 3EE3A 4QW8A 2O66A 2OFHX 2YKOA 5HMWA 1VRTA 2GVZA 2ZDOA 3PHTA 1GXLA 3TX8A 2AWZA 1V9OA 1BQNA 3TOQA 3VCDA 3ZZ0A 4CP5A 4PG5A 2DH8A 4WP9A 4R5PA 2PFDA 4JYAF 5E5NA 3DOMA 2BEFA 4LSZB 2DEIA 3DU6A 3D5MA 5KFLA 1FKOA 1RU2A 3TVZA 3D1QA 3EDQB 2DGTA 3LW5C 3O1LA 5AE2A 2XMJA 3BSNA 3KK2B 1C1CA 3PW4A 3M7VA 3U1NA 4ZMMA 4KYZA 1C1BB 1VJQA 3DM2B 3W63A 1Q53A 1BQXA 2HBQB 2ZUGA 3KLFB 3IGVA 1FK9B 2H1YA 1KQSR 3AOAA 1HNWF 2HQIA 2HGNA 2GMLA 2HFUA 1CC7A 3FMBA 1QY7A 1W25A 2XYPB 4RPFA 4LF6J 1KR4A 2RQMA 3E3XA 2Q43A 3KJVA 1EHWA 2MSTA 5DZ7A 1U4BA 1SKRA 2JFDA 3AOBA 1SL2A 3QZ8A 1U48A 2E7WA 3KLHB 1WACA 2O5DA 4KV8B 5D8HB 2R8KA 1V6HA 1N48A 4G3IA 2FHMA 2CUYA 4ED2A 4U96A 4PG6A 3ELHA 2ZC4A 1S6UA 1WNEA 2FGCA 5CXTA 4AE5A 1AUDA 3H20A 4ZPAA 1RGVA 5DQIA 4IUFA 1CJUA 5GAGU 2R2SA 2YX4A 4M5IA 5CYQA 3UR0A 2CA9A 4DSEA 1V3SA 2MZ1A 3BV8A 3N5BA 5KAKA 2WSFC 3PYEA 2RB7A 4EGLA 4U7UK 5KFFA 2MMYA 3ZZOA 2NZ4A 3DI6B 2HLTA 2Z2ZA 2XYGB 2MQOA 2ADBA 1DAXA 2D7SA 1MNEA 2HGLA 4RX6A 1KFSA 1TU0B 4JI0J 2CQHA 4YDXA 3M8QB 5KFOA 3MFHA 3W60A 1TK5A 2HBRB 1VFJA 3T9ZA 2OPRB 1HL6A 2EK1A 4PEOA 3BQ2A 3C8YA 1RP5A 2QT7A 1JLGA 3QBCA 3VV2B 2FY1A 2YQ3A 2G9OA 3OV7A 3KLIB 1CJTB 2AZ3A 2CQ0A 4OHXA 4NPOA 3A8JA 1SCJB 5L8RC 3MAQA 3HSZA 1CC8A 2QJ3A 8ATCB 3UCZP 4LREA 4QCLA 1PGZA 3S8SA 2R7VA 2AT1B 3QNWB 4FN5A 3DRPA 5CD4A 4W92B 5H9FJ 1C0TB 3MEEB 5D3GB 3CNQP 5DO2A 1FDNA 1N5QA 3BYPA 2JEFA 2UUCJ 1RYSA 2B5JB 4MAKA 3JTOA 3MR6A 3ZZRA 3LUYA 3DOKB 1T9YA 3NWRA 1LW0B 4NLQA 5C2GA 2COLA 1MN9A 3MPWA 1SI9A 1GTHA 2IM1A 2OEJA 3LQVA 2R42A 5KOXA 2DR8A 1YRXA 2YKMB 2BQ3A 3PO5A 2N82B 1JKHA 5D0RA 2HSEB 1DBDA 3T5LA 2IRUA 1E6VA 1NK4A 3GIKA 5D0HA 1IKWB 5ETSA 2XLJA 2RS2A 2AEFA 1FERA 4F67A 1UVKA 2Q66A 3NP5A 3R5BA 5ETOA 2RQCA 3L9ZA 2PD1A 1WG4A 3LA0A 1KWMA 4ETXA 1F2GA 1RISA 1SC1B 4DU7A 4RW8A 2Y1RI 3BS9A 2R3VA 5ADZA 4PAAA 1RDRA 4FYWB 2DBBA 2F9JA 3M9NB 3POTB 1SUQA 3D1OA 4X62J 1HR0J 4CT9A 2VFSA 4B08A 4QPXA 3R7NB 2C3MA 4L3KA 1J5OA 2IBOA 4IYQA 2BE9B 1FRJA 4WJBA 4M63A 1KFDA 1XR7A 1JX4A 1X0FA 2J76E 2YWEA 3TR5A 2F8EX 2R8JA 4BCAA 4NXNF 3KDNA 2Z4PA 1WHXA 5I3PA 2QL5B 4YQWA 3GV7B 3D9BA 2DNMA 3TAPA 4CWBA 1WC0A 2DNLA 2YWGA 1YGYA 2DR6A 1MMDA 1X9SA 2GFFA 4DL2A 1C4AA 3QAUA 1U1QA 3OUYA 2WVCA 3AFGA 2GV1A 4DV3F 3OT9A 2MLXA 1RAGB 4RW9B 1K9MT 4KHPF 3W7BA 3VHQA 3T9NA 3K5LA 1TKZB 4I7FB 2Q1LA 1CULB 2UXBJ 4Q0BA 3N01A 2E1RA 2IRYA 2PN6A 4N7TA 4NA1A 3NNAA 2I5JA 5KFKA 4NCBA 4ZIVA 2GQQA 2C2OB 4O4RA 3R2CJ 3OHAA 3GIMA 1NHUA 1NPKA 3GIRA 2GHVC 5J1EB 3G8TA 4QIWD 1RAAB 2F4VJ 2XZTB 2HHQA 3RGIA 2ZVIA 3VZHA 1S1UA 5THWA 4U7CA 2PI5A 5K8OA 1QE1B 2R7WA 2QA2A 1FXRA 2MHNA 2MQMA 2XS2A 2KKHA 4WIQA 4ECRA 1S1WA 1IR2A 3TZYA 1VK8A 2M7SA 4RU2A 5J2NB 1RTJA 2YNIB 5C24B 2MXYA 2DH9A 2J0XA 4YR2A 1EZZB 1KVIA 4RO0A 5EWGA 2KXHA 2XHCA 4Q8EA 5L9XA 4EO8A 3L7OA 3M8YA 2RJZA 1S97A 1CLFA 3AODA 4C11B 1YX2A 2C1EB 3LH2S 3TO8A 2HHUA 1YJRA 3NG8A 3H2VE 1T03B 4M95A 5HI7A 1D9AA 4HKQA 2P2CB 3D6MB 4B17A 2ZH8A 1NK0A 3DLKA 5T7LB 3AAWB 4O44A 3AJDA 4A48A 4F3OA 1VLYA 3VAFA 1RBAA 4QIVA 1RTDB 4ZVOB 3MAAB 5BXIA 5L1LA 4RLEA 1S9FA 4HHJA 3RAQA 4B9UA 2PA8D 3QFHA 4DSLA 1FEEA 3CULA 1HW9A 4TN2A 1U6BA 4RBUA 4UOGA 2WVEA 3M4XA 1FKPB 5F8GA 1YJTA 4WXWA 1RBOB 2K06A 4FPRA 3CCMS 3FSIA 4A4JA 3AD8C 4ID5A 2IVFB 1BQMB 3M1VB 3BH7B 2BJ7A 3G6XA 3QLHA 4ILRA 1Z2LA 2BR0A 1NMEB 4B3OA 2QLBB 3UN2A 3BO4A 1FNOA 1N88A 5GAHI 3AJ1A 2VASA 4DX6A 4JI0F 2ZZNA 3EVWA 3NEKA 2GMHA 3VGUA 3TA1A 4LF7J 2CJBA 3HVWA 2Z2YB 4XPEA 1S72S 2VC0A 1S10A 5DG9A 4QU6A 4OYBA 1KP6A 2ZHOA 3W8GA 4DV5J 2ACYA 1K44A 1U1OA 4Q8FA 1KLMB 2UZAA 2ZM6J 1YZ6A 4ELVA 2V2VA 2LQBA 3Q83A 2YNHB 1CJKB 4ZVTB 1ZOTA 5J2QA 2XO7A 4OJ3A 4USMA 2IC3B 2LXIA 2V68A 4LSLA 3C6UB 3Q8SB 4BC9A 4M5JA 3WIUA 5IV3A 3T19A 4EZ6A 5IT9Y 3D54A 3KG1A 1RWVB 3GILA 3SDEA 2WONA 3ZNUA 1Q1KA 1VRQC 2JRSA 1J5EJ 2MJUA 4B3SJ 2KI2A 4LSNB 3P5TL 4YB5A 3BH6B 5EWFA 4N5SA 4Y3CA 2L41A 3I6PA 1N32J 3V6DA 3C14A 2VFRA 2JLFA 3LWMA 4QWCA 1FVQA 4WK1A 4DX5A 2XLKA 3GSDA 2UUCF 2E9TA 3FNNA 3SZ2A 4H4MB 4RW7B 1TUWA 1O5JA 3MR5A 1P9YA 3FFIB 1QAXA 4YR0A 3BB5A 3K5OA 4ERDA 2B4VA 4ZP8A 4MIWA 4DCJB 1RT4A 2HAIA 5F41A 1LWCB 5T14A 4IG0B 1N34J 1B0VA 3ILJA 5FJ4A 4EZ9A 2H48B 1Z1ZA 4ZP9A 3KFWX 5I42A 1S6PB 3Q22A 3JS9A 1ZTTA 5FIIA 1SH0A 2PEHA 3LGHA 2W9CA 4WTOB 4U95A 3X1LB 3HKWA 3BQ0A 4KKOB 2AYEA 4WKRA 1DTQA 1FNXH 2JLEA 5HVFA 3DN9A 1LWEB 2F8HA 2JEIA 4HR2A 5GAEI 4LF5J 3TAQA 4JI4J 4HACA 1RXOB 2IA0A 4WE1B 4C98A 2LQ9A 4WFBQ 4O4GA 1S79A 2XS5A 2ZEJA 4DDFA 4CH7A 4TLQA 1FT8A 3R7SB 2UXDJ 4X62F 3FMWA 2VD3A 3EVMA 1LFPA 2DRDA 4BWMA 3A12A 4A8FA 2AIRB 2OKQA 5I3UA 1KSPA 5HQLA 2QRRA 3O8WA 4YB6A 2AJ1A 2OPQB 3QGPA 1U02A 3CCES 2XCAA 3GV5B 2DR7A 2HFVA 4Z2XA 1KKHA 4HHUA 5A8KA 4OHZA 3ZTOA 3VALA 3NGTA 3CCZA 2HNDA 4OYPA 3AOCA 1JLBA 2W9BB 3MTKA 5B0DA 4MYUA 3BN7A 3P96A 4P6QA 2A0FB 2XG8A 1OY6A 1ZAXA 4PPDA 2QE5A 5J1PA 4A8WA 3CJ2A 4N56A 1T9TA 4FF3A 2R8GA 1FDDA 2CJ9A 1PYSB 2UU9J 3ZTPA 1WJ9A 4NLOA 1UA0A 3V81A 2HHWA 2IYGA 4O0NA 1M1GA 4U8YA 4F4AA 3DXBA 2OELA 4GO5X 2UXBF 1IN0A 3IO1A 4I67A 2X1FA 3CD0A 1N5VA 4PR6A 4RW6B 4P72A 3NGUA 5HP1B 4DG1B 1RTIB 2VU5A 3R1HA 4X66J 4AL5A 2MLZA 4FBTA 4ATNA 2F4VF 4BBYA 1Y0HA 2D41A 1EQMA 2DJWA 5HQMA 3TEGA 2X7IA 1S6OA 1V5VA 2DNHA 3BKFA 3D7SB 4JUZA 1EETA 4CLFA 4X64J 4K2JA 5LOQA 1HHQA 3EJMA 1VC5A 3QZ7A 3PRDA 4M5DA 4A8QA 2YWFA 4NXMJ 1B64A 2E44A 3WHIA 4LJMA 2I2YA 1VOMA 3KYLA 1NK8A 3J80U 1ZH5A 1UEUA 2EC0A 2VG7A 3OD2A 3LP0A 3PW2A 2XQCA 2BJDA 1WC4A 3M2UB 5EGYA 3AXMA 4UT4A 2H5JB 4NI2A 2V2QA 4MKVA 4PXDA 2HURA 3RB4A 3HJVA 3LGMA 1SQGA 2GO9A 4ENOA 4LFAJ 2DHGA 1RT5A 4OV6A 2WW8A 1BXNA 4CLWA 2JSXA 4QWAA 4OYWA 3BSCA 2AEMA 4MFBA 2DGQA 3IS9A 3PCOB 5M2PA 4TY8A 5KG1A 3HHKA 2FLPA 2GW8A 3HVTA 2E66A 5K20B 4OI4A 5MLCV 2DNQA 4ED6A 2MZSA 2G13A 2B6AB 4XTTA 2ZWPA 2FD2A 3CDEA 1LQ9A 3GV8B 2FVCA 3D0HE 4CNYA 1VRTB 3ET6A 2DR9A 3WBZA 2I38A 4I56A 1WOOA 2O3DA 3CCLS 3W3SA 5EN1A 2YWWA 1I6JA 1XEZA 1HBNA 3MMCA 1TL5A 1YZ7A 3FK4A 4ZCLA 2QEXS 2A18A 4J9SA 2ZVSA 1FKOB 3RBEA 1QAYA 3QIPB 1TL3A 3ZTRA 1GH8A 5E3PA 4OZ5A 4P74A 3BJYA 2C42A 1FD2A 4P73A 3H40A 2L48A 1CS4B 2EC2A 4NASA 4DXLA 2FLLA 4KQZA 3ENQA 2CJXB 1NSKL 3WZ0A 2N4CA 1S0MA 5ETTA 2IM0A 3DOLB 3W62A 3M6VA 4LF7F 4IRCA 2EFQA 3QGHA 4KAIA 3K8VA 4ZHRB 1YBUA 2M70A 2VV5A 1NK5A 2MHEA 3K17A 1WOPA 3KLVA 3OPKA 3W5XA 4DV5F 1FWLA 3AA8A 2ZBQA 1FFWB 2YKNB 2I9SA 2ZM6F 3WC0A 3MMBB 4AD6A 1PJ6A 1SPBP 1BHNA 1RKJA 3P8BB 3I0RA 2OHDA 1X4DA 4F4WA 1UETA 4UY8T 1RHUB 3CCWA 3C46A 5K14B 3KK3B 3KK1A 1NPPA 4CYUA 2XWXA 2KU7A 4B9MA 1WDDA 1J5EF 3HD1A 1CJUB 4B3SF 5CYQB 3H2UB 3GIJA 3OFEA 3CDUA 2ASJA 1OY9A 4DQIA 3OTBA 3W1YC 4ZPCA 2C28A 2E9ZA 2VQFJ 2NYIA 3HM9A 2RF2B 3X3UA 2JHEA 4FF4A 4OI6A 2IMOA 5D0GA 3NNCA 3UN5A 4TNOA 1DY3A 4FKXA 2F40A 3M2VB 2OD4A 4C4WA 4KH1B 4DV0J 2QMWA 3D0GE 2YVSA 2MGZB 2QL7B 3MECA 3TW0A 1S49A 1K73T 2VPZB 3ULHA 1S1VA 3GU0A 3IWLA 3N79A 4A8KA 3IAM9 3K0JA 2PMWA 1FA0A 3QT8A 1VCTA 3JTPA 4IH6A 2Y0SD 2XC9A 4DL0C 1JLEA 3CVKA 1IM4A 7FDRA 4P75A 4EBCA 2ZKUA 3TZWA 4YHHJ 4H54A 3DNCA 1O8BA 1VYAA 2DY1A 3QO9A 2M88A 4J9UE 3ZXWA 2FJVA 3RBXA 2A3JA 2HS0A 5F8MA 3ETMA 4OMFG 1HNXJ 1TV6B 3AXKA 2ZH1A 4DV7J 3NKYA 5HLFA 1YJNS 4LF5F 5GAHU 2Z57B 3H4DA 4JI4F 2BXJA 4JB8B 1BWVA 5CQGA 5KFAA 4UOHA 4I69A 3L7PA 4YMEA 3MPYA 3CIMA 1OIAA 5LXYA 4X4VA 3EPIA 2Y3YA 4MK9A 1H98A 4GVBA 1Q0NA 4LVOP 1TL7A 2UXDF 5IQ6A 3HSDA 3PVXA 1JMTA 3TQEA 4ZCIA 1F9HA 1U45A 3IRXB 2C2ZB 2X3DA 1MWYA 2R8IA 3AQOA 5KFDA 1UCNA 5KG4A 2YX7A 2CPXA 1GX6A 4ITSA 3Q24A 3K5PA 3R5GA 3EWGA 1A6LA 1N0UA 2Z56B 2QMXA 4UUXA 4DPXA 4AXIA 2V9KA 4ECUA 1REGX 4DX8H 2MZRA 3TVYA 2DXDA 1VQLS 1MWZA 5IWAJ 2HQ3A 2QGFB 1F5AA 5CYJA 3U7JA 2B8PA 4L76A 4YEAA 1IBMJ 4ECWA 2UU9F 4WU3A 3N6NA 5G4DA 4KTQA 4J9RA 4O3RA 4NYZA 1H7XA 5ETMA 3IWNC 5DM6Q 3HKZD 2JEGA 3FCHA 4J9NA 1SUQB 1YRTA 3KK2A 3T3FA 3KLGB 3L7UA 2FIUA 2XMWA 1FXDA 1C1BA 4HVZA 3DM2A 3QIDA 2RUGA 4X66F 2EKNA 3KLFA 2CYYA 1UL3A 3T5HA 1FK9A 6FDRA 1EX8A 4Y28C 3I4PA 2XGQA 4RZRA 2LDYA 2Z2LA 3H4BA 2RDJA 4K5SA 1F2HA 4HEA9 4KY3A 2MTLA 1VLOA 2CDRB 4X64F 4LBIA 3FJ2A 2KN4A 1JNZB 1FJCA 5GAEU 3KLHA 4NXMF 3ZZTA 1G4CA 4DZ6A 2NQPA 1SQFA 4WU2A 1YQHA 1FJ7A 3KNAA 3MCSA 5AT1B 1OY8A 3CDWA 3PR5B 4DR6J 1QUVA 2CPIA 4UTGA 2C2NA 1U25A 1YLXA 2QLXA 2WB1D 2WVFA 3O2IA 1G3OA 3QGIA 2OJ3A 4EBEA 4LFAF 1YBAA 4A8XA 5DDRC 4ILLA 5E7OB 3Q86A 4I2QB 1TUVA 1ZM4A 1NJYA 2NXCA 3DI6A 2ADCA 3HLUA 3OVAA 1F3VA 1NEEA 3IM9A 1LKZA 2R8HA 1WSRA 1GXUA 3LO3A 3GZ7A 1YDLA 5FD1A 4NEZA 1UJ4A 1KNZA 5I4MA 1GMWD 4X4PA 2KT2A 5IT9U 3OTEA 4Q43A 3Q8PB 3R3TA 4G1IA 5KFXA 4PWWA 3NBPA 3K5NA 2W24A 2XM3A 2DNPA 4C8MA 2HAFA 5CA5A 1FFGB 1NNDA 3DMJB 4NLTA 1VS3A 4RUBA 1NK9A 3PX0A 5JXSA 3MTJA 1YBTA 3EGVA 1XQIA 3KLIA 1HBMB 1IWGA 1N56A 3VGSA 4S0MA 1X7VA 1RA6A 1RT1B 1CJTA 3RG6A 2MDAA 2BJ9A 5B0CA 4DPWA 3HPOA 1R31A 2J5AA 2NUHA 3IGNA 2QIFA 1JNRB 3R9LA 2EFGA 3W5ZA 2ZH3A 3NLCA 2CIMA 3R1LA 1P9QC 3D0IE 4DF4A 3GYXB 2KH9A 2HBYB 1Y4ZB 4IFVB 3EGZA 4PYAA 4FP9A 1NK7A 1JLCB 4C8LA 1U26A 4OX8A 4MK7A 3D6HB 4BS2A 4PXEA 2XHWA 4YN3B 1FESA 2G0JA 4J9PA 1LXNA 3OTOJ 5J2PB 4OZ3A 4BLGA 1H3DA 1HARA 1T05B 2BV3A 4O44B 2B5JA 3WQPA 1PC4A 2A6MA 4DV6J 5AXLA 4PPZA 3DOKA 1SJFA 2HZCA 2VH7A 1J2VA 4LRDA 4F26A 3G6VA 2DNKA 4P10A 2XZDB 1UFKA 3M05A 2QO3A 2LU2A 4FXVA 2GHPA 2ZHBA 1RHKB 3M8PA 4NYPA 5E3RA 1KONA 3HHDA 3UD3P 5KT6A 3H2LA 4ID5B 1IKWA 3ZZPA 2EWHA 1IWAA 1S7HA 4QYZK 2VQFF 3HZGA 2XY7A 2DRBA 4E0DA 1S48A 4DR4J 5H9EK 2BUNA 2MQ8A 5HMYA 2AX0A 3GONA 4DV0F 4F2RA 3FSXA 2DXEA 1PC5A 4Y2IA 2PI4A 3A4TA 2C2EA 5A0YB 2FYXA 1Q86T 2C3UA 3VAKA 1S4EA 2R7TA 3TNVA 4R25A 2BQUA 4J9LA 3G87A 4RUHA 2QZ8A 2N3OA 3W9IA 4YHHF 3OR2B 3C15B 4JI2J 4HTIA 5KFTA 2NCKL 3UCGA 2QV6A 4ZKAA 1AB8A 4F25A 1XC9A 3CCRS 3JSRA 5KT5A 3MM6B 1XR5A 3HT3A 1SL1A 1HNXF 2VICA 2L9WA 3KXDA 4DV7F 3W66A 3HO1A 2NPIA 5KFEA 3UVJA 3D68A 2DNYA 4N77A 3DGPA 3KUGA 2DCLA 3DLGA 5HVGA 3V6DB 4JI7J 1S6QA 2B7CB 2AYBA 2AF6A 1NJWA 4NLGA 3UDLA 4KHMA 4F02A 1VBXA 1UVJA 3SCIE 4RW9A 3TA2A 1M0SA 3FZBA 4H4OB 1TKZA 1FD8A 5B0GA 5DJBA 1DTTB 4RU9A 3MPUB 1FRMA 5CYMB 3PDNA 1VISA 2W4DA 1NHKL 3DXSX 4X4NA 2FVSA 3FKBA 1UA1A 4X4OA 2ZH4A 2W2PP 1X4BA 5JJBA 3HHLC 4YB1P 4DV4J 4UOCA 2ZBRA 5I42B 5J1EA 2YPZA 2HS4A 3BREA 2G0CA 1F6TA 3KTQA 1QE1A 1DTQB 4NCAA 1W26A 4K4XA 3TQ1A 2DGOA 1BD6A 1AFIA 2HZVA 5KFYA 1IBMF 5J2NA 2HGMA 3WX4A 3NCPA 2YNIA 3PHEA 3RBZA 5C24A 2CQBA 3OVBA 1I94J 1VQYA 1MWQA 1QVFR 4CH1A 3BSAA 2FJEB 3TX0A 2EBGA 5K8NA 3I82A 3PO4A 4O3SA 4C11A 3OL7A 2ROEA 2P6SA 1T03A 4JI8J 3IXQA 2AX1A 1JLQA 2CRLA 1UFLA 1VRUB 3HX9A 1IKVB 3KHHA 1VC0A 2R7XA 1WG1A 3CWJA 5T7LA 1UAWA 4ECYA 3JXOA 2B9YA 1R6VA 1OO0B 2QFJA 2IJNA 5A6WA 4Q2MA 1OS5A 4RUCA 1RTDA 3MAAA 3RBDA 1SBRA 3IC1A 3LP2B 4KGZB 1QSSA 4ES2A 1GMWA 5KFWA 5KFUA 2MZTA 1FKPA 4DR6F 2Y1LB 2BE2B 4HDGA 3KLEB 5C42B 3ZZYA 5ETRA 3ICLA 2J7WA 1RHJB 1T9WA 1X0PA 2GIRA 3I9ZA 4YR3A 4JYAJ 1ICEB 2D9PA 2GVDB 3MMAA 1BQMA 1N5YB 4UZBA 2VHGA 3M1VA 3KMSA 2IJFA 1WTFA 4EI2A 1NAQA 4A8YA 1WORA 2BW7A 2VOPA 4ZP7A 4JV1A 2M2BA 5KG2A 4CM0A 1FRLA 2WVDA 1NDCA 4ECQA 1C0UB 4QZVB 1S99A 3DRSB 4O23A 1U7LA 2F1FA 1S59A 1TK8A 1RT6B 3MF5A 1M5VC 1URNA 4F4KA 1EARA 4Z7CA 1MW7A 3ISNC 3D2WA 4CO2A 3BEGB 1SVDA 2C2RA 2IHR1 1LOUA 3V4IB 1U1PA 5CH7B 1WC3A 5F8NA 1KLMA 1LV5A 1H2VZ 2YNHA 1R8CA 1CJKA 2ILZA 4KC5A 2FZGB 2MLYA 9ATCB 2PEBA 2VG7B 3C6UA 1UW9A 2KO1A 2ZNYA 1R3NA 2OLWA 1K8AT 3M8WA 3PTWA 2CVIA 2EEYA 3QPIA 2BM1A 4OZ2A 5CZVA 4FKYA 3P49B 2UUBJ 4OX6A 3E51A 3J81j 3DGVA 3LANA 2J0SD 2G2YA 2DY9A 3QT7A 3PKMA 4CCHA 1EAYC 4ZPDA 5KG3A 2B56A 5ITHA 4RW7A 4DV6F 3ENWA 2JZ5A 3FFIA 1YKWA 1JB0C 1Y3JA 2ZC3A 1AROP 1OYDA 1Z4UA 4DUYJ 4NRUA 5D0EA 2YXLA 1LWCA 1FNMA 3TUJC 4TVAB 4M94A 4QYZJ 1VBZA 4YS2A 1BLUA 5C25B 2HQCA 1FI4A 1H0HB 2AJQA 3TA0A 1S6PA 3IG1B 1QJHA 2H4WB 2VQEF 2AYGA 5F3TA 4KBIA 4KGVB 5H9EJ 2UVVA 5B7WA 2IIHA 1HBNB 4UQGA 1DURA 3FQLA 1HW8A 3PZPA 4KKOA 1R89A 1HLWA 1TL3B 2IDEA 3R6LB 1BC6A 1SV5B 3CW2C 4ZITA 1F9FA 1OMSA 4WP8A 4DR4F 4AL6A 3S7RA 1U6FA 4URSA 3A8IA 4C8OA 4WE1A 4C9DA 3DKDA 4RW4B 1I1GA 1EKSA 1HBOB 1NHVA 5D77A 4HL9A 4F0MA 4IO1A 3J7ZT 1RBLA 3PJWA 3ZFVA 5H9FK 3N4WA 2J9CA 3CD7A 3BGUA 5B09A 3Q8RB 3VGTA 2XB2D 1RWUA 1W2BR 4C8KA 2OPQA 3IR7B 3RUBL 2DHAA 2OEKA 3I0RB 4Y6IA 2DYAA 2IDLA 3TP2A 3BBBA 4LF2A 3LP1B 2HEKA 4ZN3A 3FBEA 1F60B 4DUTA 5H1SV 4M5KA 1X60A 5IZHA 1W2IA 4Y2CA 2AW0A 2W9BA 2VPXB 4WCEQ 4JBCA 1GK8A 4E98A 2AU0A 2J7KA 1IUJA 2V2KA 4OIXA 4NLRA 3CCVS 3SSQA 3BKUA 5DM7Q 4TXSA 4USWA 2L9DA 2FHJD 1VQ5S 3GYNA 1X8DA 2WAQD 1LW2A 2CJYB 3ITHA 4QQBA 4DEZA 2W7AA 3NOCA 2VG6B 3R5AA 2RDIA 4DZDA 4M1KA 4WZMA 1A9NB 3AB4B 4LF4J 2J8AA 1Q7YT 4U9RA 3VGVA 2KB2A 4RW6A 2AV5A 5HP1A 4DG1A 4U67Q 3BGOP 1NO8A 4DV4F 1A7GE 1S5ZA 2XY6A 3KHLA 2VBYA 1WDTA 1T0TV 2AQ4A 1I3OB 2BKPA 2KM8C 2D69A 3H5SA 2GX8A 4HI1A 2J9DE 3QO9B 3D6TB 2ABYA 1Q8KA 2ZD1B 4EK2A 2ILYA 1UPMB 5IT0A 1HYSB 2HHTA 4NLUA 2VIHA 4KGMA 5BYQA 2UXCJ 3R5CA 3OFHA 2XBPA 2D3OR 3SSRA 4C6AA 2ZZMA 2LXUA 2V5HG 4DCOB 1U6ZA 1VR6A 4L3NA 3N0VA 4KE5A 2FJXA 1I94F 5JVGQ 2LEBA 3BGRB 2C2DA 2CWKA 4X84A 2O01C 2YY3A 1R7IA 2PGCA 3M2UA 2VJUA 3KWMA 2DEJA 1RI7A 1APSA 3NCRA 1TUGB 1FFSB 4WPAA 4I64A 4ZIWA 4JI8F 2D9OA 1N0VC 1S7IA 3OTCA 2F8MA 1OJ4A 1M5KC 4L72B 1S12A 3B8HA 2Y9HA 4NCGB 1U1LA 1U2RA 2HHXA 2A1BA 3HJFA 1VQKS 3BM7A 3I5AA 1S1XA 3TARA 2OGUA 4GMKA 3QFWA 5DDQC 2Z30B 2GS8A 2OMOA 3CCTA 3FEZA 4LFBF 2WRMA 4CO0A 4UQTA 3IR5B 4QJVA 4KT0C 4K4TA 1B7YB 4B9SA 2PFFB 5KG0A 1C4CA 4RUAA 2OMLA 2B6AA 2ZH5A 4ECVA 2O1PA 2ROGA 2V4QA 2MQLA 2V63A 3MGJA 3MD1A 3VR1A 4D3HA 1LK7A 2W9AA 3GIIA 1HPZB 2DIUA 1RJJA 4DSIA 3UR3C 2KYXA 2HHSA 1N4LA 3M32B 4K4SA 1Q82T 1P8GA 1SKSA 1OQ6A 2OPSA 3MD3A 3OHBA 2AYMA 4OHYA 3QIPA 3LPEA 3QATA 1ZBTA 5DS7A 2WZ1A 4DQQA 3ZZUA 4X4QA 2E5HA 1UP1A 1CS4A 5FDLB 2ROPA 1FHTA 2OTJS 1KC8T 4OV1A 2ZOMA 1RT7B 2HG4A 3CTRA 1SC4B 3GYGA 4PG7A 2WK4A 4G65A 2DCUB 2PMHA 3S1TA 2CDQA 5IQQA 3DOLA 2ZKTA 2B9XA 2V8GA 3D3CJ 4LMZA 4ZHRA 4OYAA 2W7PA 3CO0P 2L9NA 5AJ3J 4OX7A 1VQNS 1UZHA 3TZXA 1F5CA 3NCQA 1U24A 1VQPS 1H2UX 2YKNA 2EFOA 3UDVA 3MMBA 4CNZA 2WBMA 2CADA 4CLPA 1HBUA 3TYTA 3NS5A 5L1IA 4ZLNA 4DN9A 2IVYA 3IR6B 2EBEA 4AT1B 4B9TA 2CPYA 3SFUA 3G2XA 4ED8A 2AZ1A 5K14A 3KK3A 1IKXA 1Q4RA 2W4PA 1JXVA 3SCLE 6FD1A 3MEGA 3MM8B 4B3TJ 1TQLA 2R2TA 3R2DJ 2UVRA 5B0BA 2FB0A 4ZVSB 5MAOA 3O3LA 1GQEA 1WKKA 4USIA 2UUBF 2HVHA 4ZVQB 1Y11A 2LXFA 1PO6A 3PXGa 3GFYA 3K58A 2RF2A 4EWTA 3CO9A 4DOZA 1L5UA 3J80Y 1H72C 4AUKA 3M2VA 2F65A 2V8VA 5F0UA 4B3RJ 2XLIA 4CLLA 2MGZA 3FSYA 4DUYF 3NGKA 3C2PA 2GIFA 2JVRA 4OZ1A 4CIOA 2UUAJ 3NBPB 3NGSA 1U49A 2GO8A 3ZNJ1 4ZPBA 5AE1A 2DNOA 4MIBA 4I4BA 2MQPA 1U47A 2W7OA 1QTMA 1WWHA 2QYGA 1S1TA 2VKRA 1M1HA 2BRKA 1DLOB 4DPOA 4DQPA 3AT1B 3CXCR 2I0XA 1RHMB 2F4FA 3CC2S 4LR9A 3I87A 1VMBA 4CT8A 3GJQB 1TV6A 4LR8A 1EP4B 5K8PA 2VG5B 3QWPA 4DS5A 2U1AA 3BDPA 2CAJA 2R2UA 1U0HA 5JVHQ 1YI2S 3EZ5A 3P3DA 1YTYA 2WVBA 4IQMA 5KFHA 1VQMS 4OHVA 1F3FA 1WOSA 2VFUA 4HTJA 2YKPA 3IRXA 1IXKA 1IVZA 4ZVUB 2FHJA 4WFNQ 2LQ5A 1CJVB 4ZA1A 5DG7A 1MMNA 1IQZA 3FVYA 1VIOA 4U6PA 3GR0A 3V6HA 1BMQB 4H4KC 5IM0A 2RUSA 3LAMA 4XK8C 3M8PB 1HHSA 1RYRA 5AXKA 2BOAA 3R6GB 2NXEA 2Y8YA 1KEKA 2J9EA 3EICA 3G6YA 3MDFA 4P2XA 4LRCA 2YKQA 1NK6A 1ZTWA 4C3KA 3QMQA 2W4CA 4X4UA 3OL6A 3RRKA 3GFZA 4XDDA 3PKYA 2HNYB 1N5SA 2GIQA 4M8LA 5E3AA 3B6BA 2I8EA 3G4SS 3CB4A 5LSLA 2M9KA 4ED7A 4DMZA 4LF4F 3CMAS 2DO4A 1SJ3P 2GZOA 2MKIA 2QYCA 4NMXA 4CLZA 1G6BA 3CE8A 3KLGA 2MZQA 1R0CB 1HIYA 3RB3A 4DL3A 1WI6A 4R0EA 2ATCB 3E01B 3NGRA 1XK8A 3J7Z5 2CQ3A 4KIAA 2XMKA 4EUVA 2DNRA 5LXRA 1OSCA 4RNMA 4C8ZA 1MLAA 5HAOA 2KTQA 3ETOA 3I9V9 2UXCF 5E3QA 1CBKA 5LJ3Y 2RIJA 2HYIB 2V50A 5E41A 1KVKA 2CQ2A 3UVJB 2C3YA 3CPWR 2FVPA 2UUWA 4CO4A 3LGNA 4Y65A 4NWBA 4J37A 3DGPB 3JSBA 3DLGB 4WFZA 4R8UB 2OSQA 3KJNB 2FLNA 1S6QB 3HDSA 2IVMA 1XJWB 2LU1A 4K4WA 4HLBA 3IRWP 5EWEA 5CABA 3TAMA 5L38A 3BO2A 5A76A 2HMIB 1R0AB 3VAJA 5AXNA 2LQJA 4ZVEA 3JQJA 2IM2A 5IOLA 3NGDA 1TTHB 4I2QA 5CHCB 4J5OA 2IYIA 4DPYA 2MPUA 3U27A 1GXTA 1TFWA 3D28A 2HVDA 4GO7X 1XWLA 4DF8A 4ETZA 4HDHA 1NCLA 4NYOA 3PW7A 4J90A 2MKCA 4MYTA 5ETQA 2X1AA 2E5LJ 1HI8A 2EFVA 3DMJA 4OI1A 5KG7A 1IJFB 3EGWB 4TY9A 2POKA 3CJ5A 1HBMA 2DHHA 1DQ9A 2GQ2A 1Y5NB 2ZH9A 1RT1A 4DL5A 3B82A 3KDOA 4KB7A 1TKDA 3A8KA 3CCSS 5FLXU 2UVUA 5HN0A 2CG8A 3UFCX 2BJ3A 4NL5A 3VVTA 2DNZA 1TVRA 2DKOB 2VONA 2ZZTA 4RNNA 4V19J 2MSSA 3VWSA 4FYDA 4LRFA 3GP9A 3BZQA 4DV1J 4IFVA 1KLNA 1S0OA 2R7QA 2CPDA 1JLQB 1JLCA 2E5GA 1WG5A 3JB9k 4KPCA 2HFNA 3UNYA 3ILLA 3GCXP 4O0IA 3K2YA 5J2PA 2QA1A 1KHVA 5DQGA 1T05A 3HXMA 2CNNB 1FRKA 4L75A 1HWKA 3T6JA 2CWXA 5AJ3F 4O3PA 4QIFA 3SI8A 2JNJA 4ES3A 3W2WA 3CT9A 2MKKA 4PWDB 3IBCB 1DHMA 4C0BA 2VL1A 5KFSA 1UWAA 2YNGA 1KDNA 2KL8A 3LF0A 2FJWA 1CPZA 5DLFA 3Q8YA 2BX6A 4PQUB 5L46A 2E1MC 3SMZA 1VJWA 5KFNA 2HK3A 2D3UA 4B3TF 2O67A 1NRKA 4PABA 3IAS9 4N41A 4WXOA 3M8SA 1NJZA 3OR1A 3VAIA 5KFZA 2R7UA 2LEAA 3OTDA 2K8GA 4WYLA 2PSZA 2RSQA 1NDPA 3MM5B 2E5JA 3MMAB 3OJSA 2HIYA 3FCVA 5D78A 4KSEB 4GRSA 4KR0B 3H98A 4IH5A 3BR9A 3DLJA 2LCWA 5D4LA 3KJQB 1K1SA 4ILMA 3B4DA 4B3RF 1SIZA 1Q8LA 2ZBPA 1VIXA 4ICLB 1WI8A 5A0YA 3GG1A 4MMOA 2UUAF 5D6GA 2RU3A 4QW9A 2JLGA 3V5RA 2KXNB 2PA3A 2RDDA 4K7QA 4K8RA 2OP5A 3HHLB 1NKCA 3NRBA 2P8IA 2CQ4A 4C0HA 5KT7A 3H7HB 3OR2A 1NXIA 3C15A 4NRTA 4CDIA 3H5XA 2QMUB 2PT0A 4NE9C 2LA6A 1S77D 4MTPA 3MM6A 1XIQA 4ELUA 3Q2TC 2M4MA 2B3TB 4EYHB 4J9KA 3SBMA 3WC2A 2E5IA 1KTVA 1UJ6A 1UVLA 3CJKA 2MB0B 2E29A 3EUNA 3FDSA 1K47A 3A3NB 1NLKL 3LTOA 3KHRA 2PO4A 3IA0A 3UI3A 1WEXA 2FHOB 2CFXA 2B43A 1DZ5A 1R6YA 2AHOB 4DSKA 4IQXA 3MM9A 4Y2AA 3I56S 1NDKA 3NXZA 2RAQA 1G7CB 3MR2A 1KQGB 4H4OA 1UEKA 3N6MA 1DTTA 2VBWA 1QAIA 2CJQA 5F9LA 3KG4A 2KHDA 4DR2J 5CYMA 2YPYA 1U2CA 1NSQA 4QIEA 4OFZA 4UUWA 1H7WA 2YKAA 4HI2A 4BWJA 1RHRB 3PG9A 2NYHA 3MPVA 1KQKA 4YFUA 3NAIA 4FDFA 1NH7A 4WZQA 1UVMA 5CCMA 2V0NA 2E7XA 5GADI 1V3ZA 2VPWB 2WTFA 2M8DB 3C6TB 1REVB 1X4AA 3M9OB 2Y8WA 2RE1A 2XTJP 2FJBB 4LFCJ 5SZTA 3MOZA 4LUBA 2MJNA 5LJ5Y 9RUBA 1XERA 4YY3J 2JWNA 5HJYA 3FGVA 4MT1A 1RB0A 1K0VA 1T95A 1ZPWX 3HD2A 2V9WA 3RTVA 2MKHA 2ASYA 3RRHA 3MUVP 1NPRA 2NPFA 5HVHA 1UTAA 2NSBA 1X4FA 4CLKA 2Z58B 1TELA 3UD4P 1VRUA 1AT1B 1IKVA 3EX7B 2G1HA 1RKIA 3TJ9A 3T1YF 2XEXA 3AJ2A 4PRFA 2KFNA 4LT6A 3PX6A 2CNOB 1T7PA 3TVKA 5LMNJ 1R27B 2H3EB 4ZK7M 2CG4A 1U8WA 5B0EA 1HWJA 5KFBA 4DUZJ 4IR9A 3E8OA 3HSGA 4I6AA 3LP2A 1OPIA 2WSEC 3I0SB 4QWDA 2NZCA 5BYRA 2BE2A 2YTCA 3KLEA 2HNZB 4QPTA 3G9CA 5C42A 2BVZA 2EFPA 3GJSB 3FUYA 1JJ2R 1LW2B 2GVDA 3ITHB 1N5YA 1YK9A 5A8RA 5EHHA 2VODA 4DFMA 1S57A 4OX9F 5KFVA 3NWGA 5I3QA 3VAHA 2FDNA 1EIYB 1VQ9S 1T94A 4OYXA 4NLPA 3BPDA 4IRKA 1C0UA 3BGFA 2IBKA 4LBHA 4Q44A 2L3MA 3DRSA 3EXCX 1IBKJ 1CEZA 1WC6A 1RT6A 1KRPA 3FC9A 2E5LF 3A3PB 3AD7C 1YIJS 4EFAC 2RHSB 1X4CA 2RS8A 4KO0B 2NREA 4A8MP 1V5IB 2NLWA 2CQPA 1X5SA 3V4IA 1RADB 2XMTA 5KFGA 4WFXA 2OD6A 3UW1A 1N36J 2ZH6A 3F41A 3U1MA 4Y0FA 1B0TA 3MWBA 5ETPA 1RUSA 5KFJA 4QIGA 2YWKA 5DDOC 2J6SA 2H4YB 3V6KA 2DH7A 1XBWA 5LM7E 4DV1F 4OHWA 5DDPC 1Y00A 4Y34A 3HCXA 3RJMB 1A0OB 2V4JB 2Z0GA 1Y7PA 1GMVA 2GGPA 2FC9A 3B54A 3DLEB 4FZVA 2OFGX 2FZKB 3ZO7A 5G0RB 2PMZD 1S1XB 3CJ8A 3R27A 2VZ9A 2NS1B 4G1QA 4HT5A 2XSJA 2HVZA 1FE4A 2CQDA 3HI9A 1ELOA 2N7YA 5L9NA 3G96A 2QLWA 2HK2A 5J2MB 2HWIA 1GAOA 1GMUA 2RRAA 2FVQA 2B4UA 1IM6A 1QVGR 4TYBA 3FBBA 1UZDA 5C25A 1SC6A 1H74A 3M6UA 3IG1A 5HATA 4JV2A 3VQTA 3PNIA 1FRHA 4DCPB 5KFRA 2BJ8A 2I1RA 1NZ8A 2OPSB 5BR8F 1QDUB 3KHGA 2ALZA 3CUNA 1T9XA 1SKWA 1SV5A 2AMCB 2HFZA 3NNHA 1RT2B 2H5IB 4LR7A 2YQ0A 2HVEA 2K1RA 4L6V3 3W2VB 1K1QA 3MAHA 1KD1T 4UF4A 4PCQA 2VDHA 5KT4A 2CJAA 2XO6A 2CQIA 4U7UD 4IG3A 3PIPQ 2B4OA 4RW4A 1MU2B 2DR5A 1HQEA 3FBCA 1HBOA 2V94A 2DGXA 5DGAA 3BN4A 1H73A 1RABB 1U1MA 1J27A 1PCAA 2P9EA 2NUUG 5D4NA 3BGLA 2KM8B 3T1HF 2VC1A 1UPPA 3A8EA 3P45B 1YSJA 3LOUA 1HBUB 1S9GB 4WFYA 2VBZA 2KVIA 3W65A 2D3O1 2R2RA 4X2BA 4XAKA 5A8WB 1IKXB 3HVRA 1AYEA 4NOHA 3LP1A 5IS2A 4IFYB 3NY0A 3MEGB 4TQRA 1FX2A 1CSJA 2DPJA 3EXYA 3DYAB 4ECXA 4I0WA 4Q2LA 1T3OA 4USKA 3G8SA 1D0EA 2W1BA 3EPGA 1X5OA 2V69A 2CQCA 1CVJA 2MKSA 2VG6A 4USTA 3CCQS 4DR2F 3MEDB 5F8LA 1HWUA 2KDOA 3CEDA 1QM9A 2DPIA 4UOFA 3FBFA 1RACB 2XMMA 2EG1A 1S1TB 3AB2B 4PUOB 3EGNA 3GE9A 3OLBA 3PRBA 2ZD1A 1KOHA 1X5PA 4OJ1A 3CD6S 2IM3A 3FQKA 1YJWS 1ZM9A 1HYSA 1B4SA 1XNRJ 2JC0A 5E33A 4LFCF 3HFVA 4IKAA 1OSDA 1NH8A 1RAHB 4OZ0A 4DR5J 4IOCQ 2DVIA 1FF2A 1WF1A 4RL1A 3OL9A 3BGRA 4YY3F 8RUCA 4DFJA 1U0HB 4F04B 3UE2A 3QRRA 1UVIA 4USJC 2AGOA 2KJWA 4U8VA 4ZPVR 3GWCA 1VHFA 2E7VA 1ZA1B 3AHPA 3N28A 3SSSA 4IRDA 1FVSA 2MZJA 3J81U 3C19A 4F36A 3G86A 3OSNA 3SQGB 1YJ9S 2IAJB 4B9LA 1G2EA 4C8YA 2DHSA 4NCGA 1P6TA 4QU7A 3MEKA 1PBUA 2OUGA 3GPAA 5HO4A 1TL1B 4OJGA 4WK3A 2V4RA 4OZLA 2RHQB 3RYLA 2H51B 2JVOA 2RU9A 4AQYJ 5LMNF 2MKJA 5IXUA 5IM0B 1Y10A 2V34A 2V8PA 4ANDA 5HMZA 4WYWA 1R8AA 4FS2A 3CCJS 4DUZF 5IV4A 3MCOA 1MMLA 2BANB 2XS7A 3PW0A 2XGPA 1S76D 2F3JA 2PDAA 1X9MA 5A2QU 1NB7A 2DNNA 4DR3J 1HPZA 3LAKA 4EU0A 4QR1A 4WTYA 4O3NA 3M32A 5HQ8A 3VVUA 3CC4S 2G4BA 4CLSA 4DFPA 2ZH7A 2JEJA 1UW4A 4PYDA 4I1TA 2HHVA 4RWWA 5IT4A 1ROFA 1IR0A 5FDLA 2ZITA 3MR3A 3M6WA 2A2CA 1FRXA 4LRBA 1RWWB 1RT7A 2DGWA 1M5PC 4LBPA 3O44A 3AA9A 1TZ0A 1L3VA 1TKXA 1IBKF 4ED0A 4CRJA 1N6QA 1N5TA 1X4HA 2BMBA 1R8BA 1BGXT 4ZP6A 2G2OA 3OJUA 2MQNA 4LQ3A 2ZOGA 3D6FB 4MKYA 3K5MA 1T9UA 5GADU 1GTEA 2HQDA 4DQSA 4CM2A 1GEHA 2K3KA 2I6WA 1XMBA 4OLOA 5LL6d 4HHHA 3SEOA 1F9EB 4G6VB 1B7FA 1U1RA 1N36F 2HQFA 2DTJA 1PILA 3HVAA 3OBIA 1M1KT 1WD6A 3GFHA 4ES1A 2N4DA 2XCPA 4ZDNA 4CLYA 5D15A 4WWSA 4RR5A 3MM8A 1UWBB 2LVWA 1RU1A 1CG2A 4Q45A 3DFEA 2BQRA 1RWMB 5HBMB 3TAMB 3UDEA 3KUEA 3TEHB 3PRVA 2VPYB 2G0IA 4RBVA 1SQEA 1PAUB 1PYOB 1D09B 2QL9B 2RT3A 4FXWA 5BJRA 1R8PA 2VBXA 1HNIA 4WIIA 2J6TA 4LF6F 1VBYA 1E6YB 2E1PA 2UUTA 2R9LA 3K57A 2EXUA 1FCAA 3BBCA 3L3CA 4ZN1A 4IOBA 2EFNA 1X31C 1XNQJ 3BBFA 3D67A 1RT3B 2E9RX 1BY9A 4ECTA 4W90B 2DGSA 1PKUA 4FVMA 4WP3A 3GTYX 3DDIA 5HROB 2EVZA 1PJ7A 3AD9C 3S01A 1NU4A 2YNFB 4RJVA 3UPFA 3KUHA 3ONQA 4IH7A 2RRBA 2BW2A 4XDCA 1DLOA 1PJ5A 5KTQA 3EYZA 1Q95G 1RWPB 1FJEB 2KXFA 2V8HA 5KFQA 3E2EA 1RTHB 1TVRB 3VAGA 2YH1A 2K7JA 2PC6A 2CXEA 1S0VA 1HMVA 2CNLB 2A10A 1EP4A 5K8MA 2HFOA 3F44A 2VG5A 5LSRA 4Q5VA 4FNIA 4PQAA 4IDKB 2WBRA 4OJHA 3OFFA 4OZNA 4TKTA 1JJHA 2J0QD 4J7CA 3PFEA 5HL7Q 3PY8A 4URGA 1HI0P 3HHLD 1F0XA 1NB2A 2U2FA 1FEHA 1U1KA 3DHXA 2AJFE 3P4UB 2DXFA 3W2WB 3NS7B 1YVFA 3UNGC 2JFKA 1CJVA 1BUXA 2YNGB 1MN7A 2M3DA 2F5GA 2MQQA 2E1CA 3KMQA 2E1AA 5SUHA 2MKYA 2C2MB 2FHKA 2A2DA 2APOA 4JOUA 4F4XA 2N7CA 3FEYB 2RNEA 3OR1B 2VQEJ 4MH8A 3QRPA 2NSCA 4K4UA 1HQUB 3H59A 2WHOA 4F7VA 1HWIA 3CSKA 2CPEA 2ZOFA 2VUGA 4P9SA 1OWXA 3P6YC 3FCWA 2ZE2A 1QAJA 2XNRA 2N3LA 2V67A 4ER8A 4JI5J 1N52B 3OVSA 2HHPA 2HNYA 2F9DA 5D4PA 1HWLA 4LF9J 3ENAA 2BOPA 4F4ZA 3DLLQ 5L1KA 2LECA 3C16B 2KFZA 4EEYA 2OSRA 3PJ9A 4JI3J 3MI7X 2ZJQQ 2GQCA 3RB6A 2FY8A 2ALYB 2FUG9 4X4SA 2DD8S 3FRYA 4CO3A 4NA2A 3QYYA 5F0WA 4AFFA 4J9OA 5F3ZA 3E01A 4KJIA 2H54B 3PX4A 2FPHX 1P27B 2K2PA 2QG9B 1TKTA 2KG0A 1VQSA 1AUSL 4N47A 4CH0S 2DT9A 2QTWA 1HNVA 1B70B 4R0JA 1UVNA 5CD4H 1EQ0A 1D8YA 1LWXA 2OPPB 4X4TA 2K7KA 2OI2A 2CPHA 5L39A 1XNRF 4ZPTR 3D1HA 3CJKB 1Y5LB 3BQ1A 2EI5A 4DR5F 1C2PA 1IR1A 1WSVA 4BHQA 6AT1B 5HSPA 3IM8A 4R8UA 2JOQA 4I6YA 2CNKB 2EPIA 3CJQA 1HR0F 2JH3A 4ZVFA 3MM9B 3JYTA 3R97A 2OH2A 2HMIA 1R0AA 2CKWA 3GCWP 2XZWA 4FXDA 3ISND 4DSFA 5F8JA 2QLJB 1RLCL 3J7YI 2CQGA 3LALA 5ETNA 2WOMB 2SXLA 2Q3PA 4AQYF 2VA3A 2XWYA 4G1PA 1DRZA 3SFGA 1ZETA 2UV8G 1WKLA 4MIAA 4NZ0A 4M5LA 4F2SA 1H6KX 2ASLA 3CJTA 2BABA 2FLOA 1JIHA 4DR3F 3QRQA 3BF4A 3RZAA 2W01A 2DIVA 1NBEB 3MMJA 1Q5VA 4ZOSA 1RE1B 1O6XA 2JC1A 3PR4A 4ZJOA 3DRXA 3V2UC 2A6OA 2GJ2A 2D3ZA 2R7OA 1FE0A 4FYYB 1FDAA 4PZVA 1FWKA 1RWOB 4OLPA 3UWTA 1CQMA 4M5NA 3H5UA 4C48A 5RUBA 4C8NA 1QTNB 4K4YA 2W2QP 3N9UC 1HNZJ 2LFVA 3DRRB 2R7RA 1FX4A 2W25A 1GNKA 4LQ9A 3N5FA 2KYZA 1LWFB 1JLFB 4ZJQA 2W8KA 2UVWA 3M9MB 2XMUA 3IFEA 4PWDA 3QJJA 4LFBJ 2RRNA 1S9EA 1NSAA 4B9VA 4CTAB 1VI7A 2BA9A 4PQUA 1RSCA 4A8SA 4DWIA 2IPOB 1BE4A 2F7VA 1JXEA 4CO5A 3PEJA 4IO9Q 1FWPA 2RKIB 3GMGA 4RKUC 4LIWA 4LF8J 3SV3A 5F8IA 3TI0A 4DFKA 2M0GB 3CDAA 3MM5A 3ZTSA 1WC1A 3QAEA 5A8RB 3U02A 4DU8A 4DS4A 1JWWA 2LKZA 3JAMY 1D3WA 4DL7A 4YUDA 4FBUA 1TAQA 1IKYB 3LPYA 4HYKA 4GKJJ 4C3LA 1NDLA 4ED1A 1KHWA 2B8QA 3DLHA 1XNQF 1JK9B 3OLAA 1JLAB 5EX3A 4ICLA 1Q79A 4USUA 3HK2A 2OEMA 3M30A 2CPFA 5E2QA 2GVZB 1U0SA 1M5OC 3HHLA 1DJ0A 1BQNB 1AW0A 5GMEA 4ZJLA 4EMDA 4PXBA 4R5PB 5DLGA 3M2RA 2Z8QA 3IBFB 3DOMB 4NZ6A 1QSYA 1IQTA 1B3TA 2ZHAA 3PW5A 1GX5A 2HWHA 1HHTP 4ANEA 2XI2A 3OXLA 1WHYA 4IR1A 5IFMA 1C1CB 2KRBA 2QSWA 5ETKA 2BACA 3F73A 1QSLA 2KT5A 4F3MA 4P2SA 3RAMA 3GSIA 3GLJA 4K50A 2GGPB 3D3BJ 1RHQB 3JSMA 1VQ7S 4ANCA 5K9FA 3G6ES 4ID8A 5HMXA 2WB4A 4IOAQ 1O51A 4V19X 5FLXY 1YHQS 3KJVB 2LA4A 1YJ7A 2LQ8A 3RRGA 3ISZA 2M8HA 2LEPA 4G1QB 5JUMA 2XSJB 4C0OC 1FO1A 1IJEB 2H5EA 3RW6A 3THVA 5DRKA 3RR7A 1W7WA 3JQKA 2ATLA 2WCXA 5IC4B 5U47A 5ETLA 2MYFA 1QLNA 4DSJA 3Q8UA 3EMTA 4F0HA 1Y9OA 4KFBA 1UEVA 2BJ1A 3Q89A 2OIHA 3GG0A 2C2KB 1MROA 3VAMA 2AGPA 4TLRA 2YX1A 1N32F 2ZNZA 1S4FA 4ZVRB 5IC6B 3VTIA 3I5BA 2IRXA 4DPUA 3C6TA 1REVA 1XTZA 3R8YA 1NJXA 1WUUA 5B0FA 4JI5F 1TK0A 2K1RB 3M6XA 4NLXA 2DK2A 1P1TA 1D8ZA 4LF9F 2VJVA 3DDKA 2CZ9A 3SYZA 1VQ4S 4IG3B 2BE7D 5GMDA 2KRRA 4CO1A 1HQEB 1N34F 3OXFA 4JI3F 2AD9A 3G71S 3QJPA 1JLGB 3Q2SC 1L3UA 2FC8A 2AKWB 1TFYA 4ZS6A 2AEJA 1NJIT 3UO0A 4N76A 4QOTA 1U2FA 1UKUA 2DGUA 2ZJPQ 4PG4A 4OYOA 4J9MA 3O6QA 3PFOA 5T41A 2P9GA 3RW7A 3DRPB 1SJ4P 1EB0A 4URQU 5F8HA 2X1GA 4TQSA 3I5CA 4GC6A 2L08A 2EW9A 1FJGJ 2P6TA 3BKTA 4I2PA 5KG6A 4ZCMA 3I0SA 2BJEA 3SV4A 2JJ4D 1B99A 1M90T 2HNZA 1OQ3A 4TYAA 5JMNA 1RWXB 1JQGA 1NSPA 1AZSA 2EG2A 3CD5A 5ETVA 1T3NA 3RB0A 1LNQA 1MSWD 2BYCA 3RR8A 3OSPA 1YG0A 4MKAA 4NLSA 1NM2A 3KOAA 3I55S 5HJXA 1NKBA 1AFJA 2UP1A 2V6AA 4JI1J 2LP4A 1JKHB 1LK5A 1Q7LB 5HANA 4X4RA 3G82A 1YJVA 5KFIA 4LRAA 3MM7A 4Y2KA 1E6VB 2KFYA 1LFWA 4XPCA 4C2MA 1TMJA 1D1UA 1SJQA 4XO0A 2F63A 4KO0A 3D4JA 2IA6A 2VOOA 2LMIA 3QGGA 3OQ2A 1XR6A 4RBTA 1HI1A 4AYBD 4MK8A 4RW8B 4ZCKA 4DPTA 4P7VA 1VGYA 4KGXB 3TUIC 3O5TB 2IFXA 4Z7YA 5EX0A 2RVJA 2KJVA 5L1JA 2IJRA 3IMQJ 2V4JA 2BKOA 1L3KA 3I96A 2BDPA 1J5OB 3UD5A 4A46A 5C7PA 1U1NA 2YQ1A 3DLEA 1HNZF 2VB6A 1B0PA 5G0RA 3Q8VA 2ZUAA 2WW4A 5C5JA 5DETA 1N33J 3KKFA 5EUHA 4KV8A 1YITS 2UV8A 5J2MA 4WBFA 3VF0B 3GJRB 2FJDB 2V2ZA 4KH0B 1X9WA 1Y3KA 3C66A 3OUYB 3BDEA 2YH0A 5B08A 1PSDA 4LF8F 2Q79A 1I5OB 1UMJA 5DZ6A 3UQSA 1WF2A 4P2FA 4DV2J 4NLWA 2HFSA 2J7UA 3UDCA 4Q0BB 4BDPA 3HFZB 1SIWB 2ASDA 3J7YU 2Y0BB 3PIOQ 1RT2A 3L95X 3W64A 2I5JB 1Q8BA 5D4OA 5LSOA 1I51B 1FKAF 4GKJF 2C3PA 1X4EA 3W2VA 2K3IA 2B7BB 1O0PA 1RA7A 2XI3A 3M8QA 1TKXB 1RAFB 4QWBA 1RLDA 5HK4A 4QYRA 1MU2A 2OPRA 1N6QB 1S1UB 2MEWA 4O3OA 2J6UA 4FVCA 4NZ7A 4P71A 4USVA 5B0AA 3H8YA 2KZMA 3JSYA 3I31A 1S1WB 3TJ8A 2ACMA 1QD1A 1RTJB 3NOGA 4DLGA 2CVEA 4KHRA 1ZS6A 1SH2A 1S9GA 4DBQA 4DQRA 3PM9A 4JP8A 2NXNA 3V4MA 1WF0A 3EZOA 5A8WA 1VBKA 4EO6A 1N54B 4IFYA 2W2OP 3OW2R 3NMRA 1SXLA 4K5RA 2CZVC 1C0TA 1R43A 3DYAA 3W8PA 3MEEA 4EBDA 5D3GA 3BSOA 2Z2MA 4M5MA 3K8WA 3DLKB 3UN3A 3CJRA 3DCAA 4FF1A 4ZPWR 4P52A 2HHHJ 5F9NA 1HNIB 4QR2A 2VFVA 4DR7J 5M2UA 3PV8A 4E8UA 1IBLJ 4D3GA 1KQFB 4ELTA 3OFGA 2XNQA 2X51A 4O3QA 2CZ4A 2MY8A 4K0KJ 2JDJA 1LW0A 4OL8A 3US5A 1R8HA 2KT3A 3BO3A 2ZDPA 3MEDA 2IY5B 1JJCB 2YKMA 3R5JB 2HVIA 4PG8A 5A6PA 4B3MJ 1U8SA 3KNGA 4A8OA 1VQ6S 1Q8IA 4C7QA 1XMQJ 3T41A 4N8NA 3G8QA 2D1CA 5J1NA 3SXLA 1HD1A 1N8RT 4PUOA 1ZM2A 3JTNA 1K0TA 2C22A 3QLHB 4B3OB 2GJIA 4F0KA 1EJ7L 1TL4A 1UJ5A 1VK3A 1RAIB 1LXJA 4AXJA 2HS3A 1HMVB 3MURP 7FD1A 1DQAA 3EM1A 4OQJA 1RQ0A 4ED5A 4KGKA 3CJ3A 2YBVA 5KT2A 3DC2A 1Q81T 2HLUA 5DGBA 4YP3A 1NZAA 3OXGA 3IP0A 4P2MA 3POTA 4K2XA 3CMQA 5CAAA 1GT8A 3W9JA 5DG8A 3MCMA 4DR1J 3RU0A 3F0NA 1LEOA 2RQKA 3SQGA 2IAJA 1XMOJ 3NAHA 4C3MA 3RAXA 1DARA 3W9HA 5J2QB 1TL1A 1RCOB 3EDRB 3GB0A 4L73A 1L3TA 1F5BA 3MUMP 4LSLB 1BWEA 4E2FB 2BZ2A 1ITPA 3K7RA 3SQOP 2ZFHA 5E0OA 2MY7A 3HULA 1PYTA 4NLVA 2RILA 1Y5IB 3SDEB 4UY85 4Q7AA 2ERRA 2WONB 3AY0A 4OYZA 5LT5A 3AH6A 2BANA 4HH1A 2DGVA 3ADAC 2DITA 1FJGF 2B51A 1VQ8S 3EVOA 4CLTA 3C14B 4QWEA 3TUPA 4USHA 1HKAA 4NEYA 3KJFB 2ZE2B 3CJSA 4NMLA 3NMAA 2HRYA 4DLEA 4X65J 2FTRA 1EKRA 3Q8QB 3IN5A 3TZZA 8AT1B 4I7FA 1CULA 4HT7A 1YRUA 3SIPB 1RT4B 1FDBA 1KOOA 1H38A 2ZH2A 1NUEA 3ZC4A 3R5DA 4JI1F 3DHWC 4GKKJ 1T9VA 3T6BA 2FGOA 1ZPVA 1OYEA 4JV5J 4M5GA 3WDOA 2KHCA 4GVLA 4F4YA 1ZM3A 2W2MP 4FNHA 5KOWA 2W9CB 1NKEA 1WKJA 2D74B 3DDNA 3T1YJ 4FF2A 1TKTB 4B02A 4CLUA 3I32A 5CCLA 1HNVB 5IWAF 4JI6J 3HHNB 2HBZB 2X1BA 2AJ2A 4UZCA 3CDBA 1Q5YA 3C3LA 4DHVA 5KFCA 2B9WA 3THPA 4HACB 3JAMU 4LF1A 1DFDA 5K5MA 2R4FA 1DQ8A 1TP7A 3WIVA 5LMUJ 3MXHP 4O4GB 3Q0AA 1XN9A 3B78A 7AT1B 2DHXA 2J9DA 4ZVHA 1V3RA 1UWBA 2HIQA 1HA1A 3ZZZA 5GAGI 3IWXA 3JYTB 1SJRA 5HBMA 5C2CA 2NR0A 2FQQB 3PEHA 4RNOA 5I3UB 2W8LA 4WKYA 4OYMA 4OX9J 1VQOS 3TWZA 4OI0A 5GVQA 2IMWP 1E6YA 3FRZA 1T02A 3ILIA 5A8KB 3KG0A 4ZLPA 1T11A 2GC8A 1YJUA 1RT3A 5AE3A 3K59A 2OO4A 4TU9A 2HNDB 2GJFA 2XYHB 3PYFA 2XMAA 1U09A 1N33F 2W2NP 4F3QA 1JLBB 2C3OA 3J81Y 3H90A 3CMES 3W61A 1PG5B 2KZZA 4WF9Q 4K59A 2XY5A 4H4KA 1RAOA 3OL8A 5HROA 3HF5A 2HWTA 4ZLJA 1ZAWA 3H25A 2J0WA 2YNFA 3TJAA 4NX9A 1TAUA 1IBCB 2HW3A 3V81B 4B9NA 4CQ1A 2X3GA 3GR1A 1VC6A 2PE8A 3PYDA 4K4VA 4DV2F 1RTHA 2GHWA 3R7BB 3QT6A 1WEYA 2XULA 4HH0A 3M8ZA 1OPZA 1H2TZ 1SC3B 1RWKB 5A2QY 4IDKA 5KT3A 4KRWA 3TRGA 3TANA 3HSJA 3T1AA 1HNWJ 3J7AN 3QQCD 2AJ0A 1PAEX 3JQMA 1M5SA 1RZMA 1ZA2B 4OZJA 3GJTB 4YDDB 3L09A 4ECSA 4L74A 4PKDB 1EETB 4OI3A 1KS2A 2GAGC 2LLZA 4DL4A 1R0BG 2VFTA 1ZYQA 4M5DB 1TMMA 3Q23A 1S0NA 3CIZA 2BM0A 1S9EB 3CF5Q 1UFWA 4AL7A 3MFIA 4ECZA 2RH3A 2IC3A 2ZJRQ 1Q78A 4P7TA 3LP0B 3A13A 1T8EA 4XIUA 3VQSA 4NI2B 2HKEA 3AQPA 3W5YA 2DISA 3BR8A 1P1LA 2HQGA 3BYRA 3NL0A 3TUZC 2GCFA 1KTQA 4LSNA 3DRYA 2OTLS 3MR7A 4NLYA 3QSYB 1HQUA 4OYIA 1RT5B 4FPIA 3H42A 1FRIA 3OTOF 5BR8J 4V1Ak 1FTCA 3V6JA 3J7A1 2HHHF 4FYVB 4DR7F 4MFBB 4H4MA 1IBLF 3IS9B 3PYGA 4K0KF 4TY8B 3CC7S 2B9EA 2BKNA 4F50A 3HVTB 1AXQA 5AXMA 2HRUA 3A3OB 3HZEA 2QA4G 4J9QA 2CPZA 4DN0A 2VF3A 3T5KA 4IG0A 3C16A 3K89A 3M30B 2KVQE 4B3MF 3ET6B 2H65B 3QSIA 3UCUP 3QT5A 4PWUA 1HD0A 3D66A 1XMQF 2OAUA 4I68A 3EZUA 3HFKA 3M2RB 4YB7A 2DNGA 3T1HJ 3NS6A 1X5TA 3MMCB 1AA1B 2H9ZA 1RWNB 3CJ0A 3SCKE 2R7SA 2ZBCA 4I6WA 5DQHA 3LWLA 2AP6A 1HQ2A 3MCNA 1KVJA 1URRA 2OPPA 1LWEA 3FEXB 3GQCA 1WHWA 3DU5A 2B0GA 3HT0A 1KN6A 1D9DA 1WELA 1MG7A 4QBUA 2ZWOA 2DB1A 1WHVA 2M52A 2JX2A 2BRLA 4J9VA 5KFMA 3JSMB 3SCJE 2V8DA 2FJAB 3S6EA 2DO0A 2GMJA 1ULRA 3WX8A 1Q16B 3CJ4A 3P5BP 1SH3A 4EYIB 4CI0B 1GFWB 4QR0A 1VDHA 4M5HA 3QWUA 3L4BC 2BBEA 4DR1F 3T5JA 2GA7A 1SKUB 4BC7A 4A47A 3HP6A 1XMOF 3A1YG 1ZZFA 4KPYA 4JV0A 4JI2F 2KG1A 3THTA 2P5VA 4DL6A 2RD5C 4F8RA 1ZZNA 5KFPA 1FXLA 2WOMA 2Q6CA 3ENVA 4K4ZA 2JL9A 3MOJB 4DJBA 3KK1B 4NA3A 4CYUB 2ZBIA 3FZ2A 4KFBB 1WTBA 3MHYA 3F56A 1PIEA 4DX7A 2VDIA 4W98A 2QA4S 3MPDA 1CQNA 1MROB 2LYVA 2WSCC 4RWXA 1TR0A 1SJ1A 4JI7F 2EKYA 2P9CA 1VHIA 1RCXB 4TU7A 2DRAA 4N8OA 4LIRA 3QJLA 1ZAVA 3IBWA 1WC5A 4X65F 2AJ4A 4J91A 2CPJA 2Y1JA 1SL0A 1HFEL 4Y00A 1QUPA 2QSFA 3MECB 3PJXA 5CZXA 3CCUS 5BYSA 2PIIA 2M5YA 1S1VB 2Y1IA 4MKBA 1RAEB 3DLBA 1F1BB 1KBRA 4GKKF 3U1LA 3H5YA 2FVRA 2G1DA 1RTIA 2J8SA 1JLEB 2B4PA 2XMVA 3HHEA 4JV5F 4LVNP 3ZTQA 2AGQA 4YOEA 2HRTA 4TU8A 2CQ1A 2FZCB 5EDWA 3DRRA 2CJKA 1WEZA 4WFAQ 3N6LA 2EK6A 5E3CA 1LWFA 4NXNJ 1JLFA 2QN6B 4JI6F 1L3SA 1RAJA 2RQ4A 3CGIA 5HLFB 2QX0A 4C97A 3PACA 4MJKA 3I4HX 5M2RA 2YWHA 5GMKa 1PBAA 2HZAA 4NLDA 2VA2A 4CZCA 4CTAA 4ZVGA 5LMUF 4I2PB 3H0PA 2HPUA 2NXJA
chains in the Genus database with same CATH topology
2CAJA 1Q5YA 2BJ1A 3BKTA 2NZCA 2Y3YA 3LGHA 1Q5VA 2WVBA 3PHTA 2BJ3A 2PC6A 2WVCA 2CADA 2F1FA 2WVFA 3BKFA 2HZAA 2CA9A 2BJ9A 2WVEA 3OD2A 3BKUA 2BJ8A 3QSIA 2FGCA 2HZVA 2BJ7A 2WVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAJ A;  1Q5Y A;  2BJ1 A;  3BKT A;  2NZC A;  2Y3Y A;  3LGH A;  1Q5V A;  2WVB A;  3PHT A;  2BJ3 A;  2PC6 A;  2WVC A;  2CAD A;  2F1F A;  2WVF A;  3BKF A;  2HZA A;  2CA9 A;  2BJ9 A;  2WVE A;  3OD2 A;  3BKU A;  2BJ8 A;  3QSI A;  2FGC A;  2HZV A;  2BJ7 A;  2WVD A; 
#chains in the Genus database with same CATH topology
 4GVB B;  4PXC A;  4ALZ A;  1ACM B;  1TL7 B;  2QFI A;  1Z2Z A;  1D9F A;  2RKI A;  3ILO A;  4DV3 J;  4UW2 A;  4Z37 A;  4ZLL A;  4ED4 A;  1SB6 A;  3BPS P;  1AZS B;  1FTR A;  4KHP J;  2GNK A;  1YWX A;  2G2Z A;  2XSF A;  1X4G A;  2QC3 A;  3B4M A;  4DI6 A;  2QLF B;  4FYX B;  4Y2M A;  2RML A;  3M8R A;  3VZI A;  1IKY A;  3GFX A;  2Q6B A;  4RNF A;  1M5H A;  4W4M A;  2NXU A;  1G1X A;  4OI2 A;  3HMJ G;  3G82 B;  1JJ4 A;  1RK8 A;  3MZI A;  1JXL A;  3MM7 B;  2LDI A;  5KG5 A;  4FS1 A;  1JLA A;  3MUT P;  2VKZ G;  4ZVP B;  4RNH A;  4ED3 A;  2GAH C;  1RTZ A;  4GC7 A;  3EE3 A;  4QW8 A;  2O66 A;  2OFH X;  2YKO A;  5HMW A;  1VRT A;  2GVZ A;  2ZDO A;  3PHT A;  1GXL A;  3TX8 A;  2AWZ A;  1V9O A;  1BQN A;  3TOQ A;  3VCD A;  3ZZ0 A;  4CP5 A;  4PG5 A;  2DH8 A;  4WP9 A;  4R5P A;  2PFD A;  4JYA F;  5E5N A;  3DOM A;  2BEF A;  4LSZ B;  2DEI A;  3DU6 A;  3D5M A;  5KFL A;  1FKO A;  1RU2 A;  3TVZ A;  3D1Q A;  3EDQ B;  2DGT A;  3LW5 C;  3O1L A;  5AE2 A;  2XMJ A;  3BSN A;  3KK2 B;  1C1C A;  3PW4 A;  3M7V A;  3U1N A;  4ZMM A;  4KYZ A;  1C1B B;  1VJQ A;  3DM2 B;  3W63 A;  1Q53 A;  1BQX A;  2HBQ B;  2ZUG A;  3KLF B;  3IGV A;  1FK9 B;  2H1Y A;  1KQS R;  3AOA A;  1HNW F;  2HQI A;  2HGN A;  2GML A;  2HFU A;  1CC7 A;  3FMB A;  1QY7 A;  1W25 A;  2XYP B;  4RPF A;  4LF6 J;  1KR4 A;  2RQM A;  3E3X A;  2Q43 A;  3KJV A;  1EHW A;  2MST A;  5DZ7 A;  1U4B A;  1SKR A;  2JFD A;  3AOB A;  1SL2 A;  3QZ8 A;  1U48 A;  2E7W A;  3KLH B;  1WAC A;  2O5D A;  4KV8 B;  5D8H B;  2R8K A;  1V6H A;  1N48 A;  4G3I A;  2FHM A;  2CUY A;  4ED2 A;  4U96 A;  4PG6 A;  3ELH A;  2ZC4 A;  1S6U A;  1WNE A;  2FGC A;  5CXT A;  4AE5 A;  1AUD A;  3H20 A;  4ZPA A;  1RGV A;  5DQI A;  4IUF A;  1CJU A;  5GAG U;  2R2S A;  2YX4 A;  4M5I A;  5CYQ A;  3UR0 A;  2CA9 A;  4DSE A;  1V3S A;  2MZ1 A;  3BV8 A;  3N5B A;  5KAK A;  2WSF C;  3PYE A;  2RB7 A;  4EGL A;  4U7U K;  5KFF A;  2MMY A;  3ZZO A;  2NZ4 A;  3DI6 B;  2HLT A;  2Z2Z A;  2XYG B;  2MQO A;  2ADB A;  1DAX A;  2D7S A;  1MNE A;  2HGL A;  4RX6 A;  1KFS A;  1TU0 B;  4JI0 J;  2CQH A;  4YDX A;  3M8Q B;  5KFO A;  3MFH A;  3W60 A;  1TK5 A;  2HBR B;  1VFJ A;  3T9Z A;  2OPR B;  1HL6 A;  2EK1 A;  4PEO A;  3BQ2 A;  3C8Y A;  1RP5 A;  2QT7 A;  1JLG A;  3QBC A;  3VV2 B;  2FY1 A;  2YQ3 A;  2G9O A;  3OV7 A;  3KLI B;  1CJT B;  2AZ3 A;  2CQ0 A;  4OHX A;  4NPO A;  3A8J A;  1SCJ B;  5L8R C;  3MAQ A;  3HSZ A;  1CC8 A;  2QJ3 A;  8ATC B;  3UCZ P;  4LRE A;  4QCL A;  1PGZ A;  3S8S A;  2R7V A;  2AT1 B;  3QNW B;  4FN5 A;  3DRP A;  5CD4 A;  4W92 B;  5H9F J;  1C0T B;  3MEE B;  5D3G B;  3CNQ P;  5DO2 A;  1FDN A;  1N5Q A;  3BYP A;  2JEF A;  2UUC J;  1RYS A;  2B5J B;  4MAK A;  3JTO A;  3MR6 A;  3ZZR A;  3LUY A;  3DOK B;  1T9Y A;  3NWR A;  1LW0 B;  4NLQ A;  5C2G A;  2COL A;  1MN9 A;  3MPW A;  1SI9 A;  1GTH A;  2IM1 A;  2OEJ A;  3LQV A;  2R42 A;  5KOX A;  2DR8 A;  1YRX A;  2YKM B;  2BQ3 A;  3PO5 A;  2N82 B;  1JKH A;  5D0R A;  2HSE B;  1DBD A;  3T5L A;  2IRU A;  1E6V A;  1NK4 A;  3GIK A;  5D0H A;  1IKW B;  5ETS A;  2XLJ A;  2RS2 A;  2AEF A;  1FER A;  4F67 A;  1UVK A;  2Q66 A;  3NP5 A;  3R5B A;  5ETO A;  2RQC A;  3L9Z A;  2PD1 A;  1WG4 A;  3LA0 A;  1KWM A;  4ETX A;  1F2G A;  1RIS A;  1SC1 B;  4DU7 A;  4RW8 A;  2Y1R I;  3BS9 A;  2R3V A;  5ADZ A;  4PAA A;  1RDR A;  4FYW B;  2DBB A;  2F9J A;  3M9N B;  3POT B;  1SUQ A;  3D1O A;  4X62 J;  1HR0 J;  4CT9 A;  2VFS A;  4B08 A;  4QPX A;  3R7N B;  2C3M A;  4L3K A;  1J5O A;  2IBO A;  4IYQ A;  2BE9 B;  1FRJ A;  4WJB A;  4M63 A;  1KFD A;  1XR7 A;  1JX4 A;  1X0F A;  2J76 E;  2YWE A;  3TR5 A;  2F8E X;  2R8J A;  4BCA A;  4NXN F;  3KDN A;  2Z4P A;  1WHX A;  5I3P A;  2QL5 B;  4YQW A;  3GV7 B;  3D9B A;  2DNM A;  3TAP A;  4CWB A;  1WC0 A;  2DNL A;  2YWG A;  1YGY A;  2DR6 A;  1MMD A;  1X9S A;  2GFF A;  4DL2 A;  1C4A A;  3QAU A;  1U1Q A;  3OUY A;  2WVC A;  3AFG A;  2GV1 A;  4DV3 F;  3OT9 A;  2MLX A;  1RAG B;  4RW9 B;  1K9M T;  4KHP F;  3W7B A;  3VHQ A;  3T9N A;  3K5L A;  1TKZ B;  4I7F B;  2Q1L A;  1CUL B;  2UXB J;  4Q0B A;  3N01 A;  2E1R A;  2IRY A;  2PN6 A;  4N7T A;  4NA1 A;  3NNA A;  2I5J A;  5KFK A;  4NCB A;  4ZIV A;  2GQQ A;  2C2O B;  4O4R A;  3R2C J;  3OHA A;  3GIM A;  1NHU A;  1NPK A;  3GIR A;  2GHV C;  5J1E B;  3G8T A;  4QIW D;  1RAA B;  2F4V J;  2XZT B;  2HHQ A;  3RGI A;  2ZVI A;  3VZH A;  1S1U A;  5THW A;  4U7C A;  2PI5 A;  5K8O A;  1QE1 B;  2R7W A;  2QA2 A;  1FXR A;  2MHN A;  2MQM A;  2XS2 A;  2KKH A;  4WIQ A;  4ECR A;  1S1W A;  1IR2 A;  3TZY A;  1VK8 A;  2M7S A;  4RU2 A;  5J2N B;  1RTJ A;  2YNI B;  5C24 B;  2MXY A;  2DH9 A;  2J0X A;  4YR2 A;  1EZZ B;  1KVI A;  4RO0 A;  5EWG A;  2KXH A;  2XHC A;  4Q8E A;  5L9X A;  4EO8 A;  3L7O A;  3M8Y A;  2RJZ A;  1S97 A;  1CLF A;  3AOD A;  4C11 B;  1YX2 A;  2C1E B;  3LH2 S;  3TO8 A;  2HHU A;  1YJR A;  3NG8 A;  3H2V E;  1T03 B;  4M95 A;  5HI7 A;  1D9A A;  4HKQ A;  2P2C B;  3D6M B;  4B17 A;  2ZH8 A;  1NK0 A;  3DLK A;  5T7L B;  3AAW B;  4O44 A;  3AJD A;  4A48 A;  4F3O A;  1VLY A;  3VAF A;  1RBA A;  4QIV A;  1RTD B;  4ZVO B;  3MAA B;  5BXI A;  5L1L A;  4RLE A;  1S9F A;  4HHJ A;  3RAQ A;  4B9U A;  2PA8 D;  3QFH A;  4DSL A;  1FEE A;  3CUL A;  1HW9 A;  4TN2 A;  1U6B A;  4RBU A;  4UOG A;  2WVE A;  3M4X A;  1FKP B;  5F8G A;  1YJT A;  4WXW A;  1RBO B;  2K06 A;  4FPR A;  3CCM S;  3FSI A;  4A4J A;  3AD8 C;  4ID5 A;  2IVF B;  1BQM B;  3M1V B;  3BH7 B;  2BJ7 A;  3G6X A;  3QLH A;  4ILR A;  1Z2L A;  2BR0 A;  1NME B;  4B3O A;  2QLB B;  3UN2 A;  3BO4 A;  1FNO A;  1N88 A;  5GAH I;  3AJ1 A;  2VAS A;  4DX6 A;  4JI0 F;  2ZZN A;  3EVW A;  3NEK A;  2GMH A;  3VGU A;  3TA1 A;  4LF7 J;  2CJB A;  3HVW A;  2Z2Y B;  4XPE A;  1S72 S;  2VC0 A;  1S10 A;  5DG9 A;  4QU6 A;  4OYB A;  1KP6 A;  2ZHO A;  3W8G A;  4DV5 J;  2ACY A;  1K44 A;  1U1O A;  4Q8F A;  1KLM B;  2UZA A;  2ZM6 J;  1YZ6 A;  4ELV A;  2V2V A;  2LQB A;  3Q83 A;  2YNH B;  1CJK B;  4ZVT B;  1ZOT A;  5J2Q A;  2XO7 A;  4OJ3 A;  4USM A;  2IC3 B;  2LXI A;  2V68 A;  4LSL A;  3C6U B;  3Q8S B;  4BC9 A;  4M5J A;  3WIU A;  5IV3 A;  3T19 A;  4EZ6 A;  5IT9 Y;  3D54 A;  3KG1 A;  1RWV B;  3GIL A;  3SDE A;  2WON A;  3ZNU A;  1Q1K A;  1VRQ C;  2JRS A;  1J5E J;  2MJU A;  4B3S J;  2KI2 A;  4LSN B;  3P5T L;  4YB5 A;  3BH6 B;  5EWF A;  4N5S A;  4Y3C A;  2L41 A;  3I6P A;  1N32 J;  3V6D A;  3C14 A;  2VFR A;  2JLF A;  3LWM A;  4QWC A;  1FVQ A;  4WK1 A;  4DX5 A;  2XLK A;  3GSD A;  2UUC F;  2E9T A;  3FNN A;  3SZ2 A;  4H4M B;  4RW7 B;  1TUW A;  1O5J A;  3MR5 A;  1P9Y A;  3FFI B;  1QAX A;  4YR0 A;  3BB5 A;  3K5O A;  4ERD A;  2B4V A;  4ZP8 A;  4MIW A;  4DCJ B;  1RT4 A;  2HAI A;  5F41 A;  1LWC B;  5T14 A;  4IG0 B;  1N34 J;  1B0V A;  3ILJ A;  5FJ4 A;  4EZ9 A;  2H48 B;  1Z1Z A;  4ZP9 A;  3KFW X;  5I42 A;  1S6P B;  3Q22 A;  3JS9 A;  1ZTT A;  5FII A;  1SH0 A;  2PEH A;  3LGH A;  2W9C A;  4WTO B;  4U95 A;  3X1L B;  3HKW A;  3BQ0 A;  4KKO B;  2AYE A;  4WKR A;  1DTQ A;  1FNX H;  2JLE A;  5HVF A;  3DN9 A;  1LWE B;  2F8H A;  2JEI A;  4HR2 A;  5GAE I;  4LF5 J;  3TAQ A;  4JI4 J;  4HAC A;  1RXO B;  2IA0 A;  4WE1 B;  4C98 A;  2LQ9 A;  4WFB Q;  4O4G A;  1S79 A;  2XS5 A;  2ZEJ A;  4DDF A;  4CH7 A;  4TLQ A;  1FT8 A;  3R7S B;  2UXD J;  4X62 F;  3FMW A;  2VD3 A;  3EVM A;  1LFP A;  2DRD A;  4BWM A;  3A12 A;  4A8F A;  2AIR B;  2OKQ A;  5I3U A;  1KSP A;  5HQL A;  2QRR A;  3O8W A;  4YB6 A;  2AJ1 A;  2OPQ B;  3QGP A;  1U02 A;  3CCE S;  2XCA A;  3GV5 B;  2DR7 A;  2HFV A;  4Z2X A;  1KKH A;  4HHU A;  5A8K A;  4OHZ A;  3ZTO A;  3VAL A;  3NGT A;  3CCZ A;  2HND A;  4OYP A;  3AOC A;  1JLB A;  2W9B B;  3MTK A;  5B0D A;  4MYU A;  3BN7 A;  3P96 A;  4P6Q A;  2A0F B;  2XG8 A;  1OY6 A;  1ZAX A;  4PPD A;  2QE5 A;  5J1P A;  4A8W A;  3CJ2 A;  4N56 A;  1T9T A;  4FF3 A;  2R8G A;  1FDD A;  2CJ9 A;  1PYS B;  2UU9 J;  3ZTP A;  1WJ9 A;  4NLO A;  1UA0 A;  3V81 A;  2HHW A;  2IYG A;  4O0N A;  1M1G A;  4U8Y A;  4F4A A;  3DXB A;  2OEL A;  4GO5 X;  2UXB F;  1IN0 A;  3IO1 A;  4I67 A;  2X1F A;  3CD0 A;  1N5V A;  4PR6 A;  4RW6 B;  4P72 A;  3NGU A;  5HP1 B;  4DG1 B;  1RTI B;  2VU5 A;  3R1H A;  4X66 J;  4AL5 A;  2MLZ A;  4FBT A;  4ATN A;  2F4V F;  4BBY A;  1Y0H A;  2D41 A;  1EQM A;  2DJW A;  5HQM A;  3TEG A;  2X7I A;  1S6O A;  1V5V A;  2DNH A;  3BKF A;  3D7S B;  4JUZ A;  1EET A;  4CLF A;  4X64 J;  4K2J A;  5LOQ A;  1HHQ A;  3EJM A;  1VC5 A;  3QZ7 A;  3PRD A;  4M5D A;  4A8Q A;  2YWF A;  4NXM J;  1B64 A;  2E44 A;  3WHI A;  4LJM A;  2I2Y A;  1VOM A;  3KYL A;  1NK8 A;  3J80 U;  1ZH5 A;  1UEU A;  2EC0 A;  2VG7 A;  3OD2 A;  3LP0 A;  3PW2 A;  2XQC A;  2BJD A;  1WC4 A;  3M2U B;  5EGY A;  3AXM A;  4UT4 A;  2H5J B;  4NI2 A;  2V2Q A;  4MKV A;  4PXD A;  2HUR A;  3RB4 A;  3HJV A;  3LGM A;  1SQG A;  2GO9 A;  4ENO A;  4LFA J;  2DHG A;  1RT5 A;  4OV6 A;  2WW8 A;  1BXN A;  4CLW A;  2JSX A;  4QWA A;  4OYW A;  3BSC A;  2AEM A;  4MFB A;  2DGQ A;  3IS9 A;  3PCO B;  5M2P A;  4TY8 A;  5KG1 A;  3HHK A;  2FLP A;  2GW8 A;  3HVT A;  2E66 A;  5K20 B;  4OI4 A;  5MLC V;  2DNQ A;  4ED6 A;  2MZS A;  2G13 A;  2B6A B;  4XTT A;  2ZWP A;  2FD2 A;  3CDE A;  1LQ9 A;  3GV8 B;  2FVC A;  3D0H E;  4CNY A;  1VRT B;  3ET6 A;  2DR9 A;  3WBZ A;  2I38 A;  4I56 A;  1WOO A;  2O3D A;  3CCL S;  3W3S A;  5EN1 A;  2YWW A;  1I6J A;  1XEZ A;  1HBN A;  3MMC A;  1TL5 A;  1YZ7 A;  3FK4 A;  4ZCL A;  2QEX S;  2A18 A;  4J9S A;  2ZVS A;  1FKO B;  3RBE A;  1QAY A;  3QIP B;  1TL3 A;  3ZTR A;  1GH8 A;  5E3P A;  4OZ5 A;  4P74 A;  3BJY A;  2C42 A;  1FD2 A;  4P73 A;  3H40 A;  2L48 A;  1CS4 B;  2EC2 A;  4NAS A;  4DXL A;  2FLL A;  4KQZ A;  3ENQ A;  2CJX B;  1NSK L;  3WZ0 A;  2N4C A;  1S0M A;  5ETT A;  2IM0 A;  3DOL B;  3W62 A;  3M6V A;  4LF7 F;  4IRC A;  2EFQ A;  3QGH A;  4KAI A;  3K8V A;  4ZHR B;  1YBU A;  2M70 A;  2VV5 A;  1NK5 A;  2MHE A;  3K17 A;  1WOP A;  3KLV A;  3OPK A;  3W5X A;  4DV5 F;  1FWL A;  3AA8 A;  2ZBQ A;  1FFW B;  2YKN B;  2I9S A;  2ZM6 F;  3WC0 A;  3MMB B;  4AD6 A;  1PJ6 A;  1SPB P;  1BHN A;  1RKJ A;  3P8B B;  3I0R A;  2OHD A;  1X4D A;  4F4W A;  1UET A;  4UY8 T;  1RHU B;  3CCW A;  3C46 A;  5K14 B;  3KK3 B;  3KK1 A;  1NPP A;  4CYU A;  2XWX A;  2KU7 A;  4B9M A;  1WDD A;  1J5E F;  3HD1 A;  1CJU B;  4B3S F;  5CYQ B;  3H2U B;  3GIJ A;  3OFE A;  3CDU A;  2ASJ A;  1OY9 A;  4DQI A;  3OTB A;  3W1Y C;  4ZPC A;  2C28 A;  2E9Z A;  2VQF J;  2NYI A;  3HM9 A;  2RF2 B;  3X3U A;  2JHE A;  4FF4 A;  4OI6 A;  2IMO A;  5D0G A;  3NNC A;  3UN5 A;  4TNO A;  1DY3 A;  4FKX A;  2F40 A;  3M2V B;  2OD4 A;  4C4W A;  4KH1 B;  4DV0 J;  2QMW A;  3D0G E;  2YVS A;  2MGZ B;  2QL7 B;  3MEC A;  3TW0 A;  1S49 A;  1K73 T;  2VPZ B;  3ULH A;  1S1V A;  3GU0 A;  3IWL A;  3N79 A;  4A8K A;  3IAM 9;  3K0J A;  2PMW A;  1FA0 A;  3QT8 A;  1VCT A;  3JTP A;  4IH6 A;  2Y0S D;  2XC9 A;  4DL0 C;  1JLE A;  3CVK A;  1IM4 A;  7FDR A;  4P75 A;  4EBC A;  2ZKU A;  3TZW A;  4YHH J;  4H54 A;  3DNC A;  1O8B A;  1VYA A;  2DY1 A;  3QO9 A;  2M88 A;  4J9U E;  3ZXW A;  2FJV A;  3RBX A;  2A3J A;  2HS0 A;  5F8M A;  3ETM A;  4OMF G;  1HNX J;  1TV6 B;  3AXK A;  2ZH1 A;  4DV7 J;  3NKY A;  5HLF A;  1YJN S;  4LF5 F;  5GAH U;  2Z57 B;  3H4D A;  4JI4 F;  2BXJ A;  4JB8 B;  1BWV A;  5CQG A;  5KFA A;  4UOH A;  4I69 A;  3L7P A;  4YME A;  3MPY A;  3CIM A;  1OIA A;  5LXY A;  4X4V A;  3EPI A;  2Y3Y A;  4MK9 A;  1H98 A;  4GVB A;  1Q0N A;  4LVO P;  1TL7 A;  2UXD F;  5IQ6 A;  3HSD A;  3PVX A;  1JMT A;  3TQE A;  4ZCI A;  1F9H A;  1U45 A;  3IRX B;  2C2Z B;  2X3D A;  1MWY A;  2R8I A;  3AQO A;  5KFD A;  1UCN A;  5KG4 A;  2YX7 A;  2CPX A;  1GX6 A;  4ITS A;  3Q24 A;  3K5P A;  3R5G A;  3EWG A;  1A6L A;  1N0U A;  2Z56 B;  2QMX A;  4UUX A;  4DPX A;  4AXI A;  2V9K A;  4ECU A;  1REG X;  4DX8 H;  2MZR A;  3TVY A;  2DXD A;  1VQL S;  1MWZ A;  5IWA J;  2HQ3 A;  2QGF B;  1F5A A;  5CYJ A;  3U7J A;  2B8P A;  4L76 A;  4YEA A;  1IBM J;  4ECW A;  2UU9 F;  4WU3 A;  3N6N A;  5G4D A;  4KTQ A;  4J9R A;  4O3R A;  4NYZ A;  1H7X A;  5ETM A;  3IWN C;  5DM6 Q;  3HKZ D;  2JEG A;  3FCH A;  4J9N A;  1SUQ B;  1YRT A;  3KK2 A;  3T3F A;  3KLG B;  3L7U A;  2FIU A;  2XMW A;  1FXD A;  1C1B A;  4HVZ A;  3DM2 A;  3QID A;  2RUG A;  4X66 F;  2EKN A;  3KLF A;  2CYY A;  1UL3 A;  3T5H A;  1FK9 A;  6FDR A;  1EX8 A;  4Y28 C;  3I4P A;  2XGQ A;  4RZR A;  2LDY A;  2Z2L A;  3H4B A;  2RDJ A;  4K5S A;  1F2H A;  4HEA 9;  4KY3 A;  2MTL A;  1VLO A;  2CDR B;  4X64 F;  4LBI A;  3FJ2 A;  2KN4 A;  1JNZ B;  1FJC A;  5GAE U;  3KLH A;  4NXM F;  3ZZT A;  1G4C A;  4DZ6 A;  2NQP A;  1SQF A;  4WU2 A;  1YQH A;  1FJ7 A;  3KNA A;  3MCS A;  5AT1 B;  1OY8 A;  3CDW A;  3PR5 B;  4DR6 J;  1QUV A;  2CPI A;  4UTG A;  2C2N A;  1U25 A;  1YLX A;  2QLX A;  2WB1 D;  2WVF A;  3O2I A;  1G3O A;  3QGI A;  2OJ3 A;  4EBE A;  4LFA F;  1YBA A;  4A8X A;  5DDR C;  4ILL A;  5E7O B;  3Q86 A;  4I2Q B;  1TUV A;  1ZM4 A;  1NJY A;  2NXC A;  3DI6 A;  2ADC A;  3HLU A;  3OVA A;  1F3V A;  1NEE A;  3IM9 A;  1LKZ A;  2R8H A;  1WSR A;  1GXU A;  3LO3 A;  3GZ7 A;  1YDL A;  5FD1 A;  4NEZ A;  1UJ4 A;  1KNZ A;  5I4M A;  1GMW D;  4X4P A;  2KT2 A;  5IT9 U;  3OTE A;  4Q43 A;  3Q8P B;  3R3T A;  4G1I A;  5KFX A;  4PWW A;  3NBP A;  3K5N A;  2W24 A;  2XM3 A;  2DNP A;  4C8M A;  2HAF A;  5CA5 A;  1FFG B;  1NND A;  3DMJ B;  4NLT A;  1VS3 A;  4RUB A;  1NK9 A;  3PX0 A;  5JXS A;  3MTJ A;  1YBT A;  3EGV A;  1XQI A;  3KLI A;  1HBM B;  1IWG A;  1N56 A;  3VGS A;  4S0M A;  1X7V A;  1RA6 A;  1RT1 B;  1CJT A;  3RG6 A;  2MDA A;  2BJ9 A;  5B0C A;  4DPW A;  3HPO A;  1R31 A;  2J5A A;  2NUH A;  3IGN A;  2QIF A;  1JNR B;  3R9L A;  2EFG A;  3W5Z A;  2ZH3 A;  3NLC A;  2CIM A;  3R1L A;  1P9Q C;  3D0I E;  4DF4 A;  3GYX B;  2KH9 A;  2HBY B;  1Y4Z B;  4IFV B;  3EGZ A;  4PYA A;  4FP9 A;  1NK7 A;  1JLC B;  4C8L A;  1U26 A;  4OX8 A;  4MK7 A;  3D6H B;  4BS2 A;  4PXE A;  2XHW A;  4YN3 B;  1FES A;  2G0J A;  4J9P A;  1LXN A;  3OTO J;  5J2P B;  4OZ3 A;  4BLG A;  1H3D A;  1HAR A;  1T05 B;  2BV3 A;  4O44 B;  2B5J A;  3WQP A;  1PC4 A;  2A6M A;  4DV6 J;  5AXL A;  4PPZ A;  3DOK A;  1SJF A;  2HZC A;  2VH7 A;  1J2V A;  4LRD A;  4F26 A;  3G6V A;  2DNK A;  4P10 A;  2XZD B;  1UFK A;  3M05 A;  2QO3 A;  2LU2 A;  4FXV A;  2GHP A;  2ZHB A;  1RHK B;  3M8P A;  4NYP A;  5E3R A;  1KON A;  3HHD A;  3UD3 P;  5KT6 A;  3H2L A;  4ID5 B;  1IKW A;  3ZZP A;  2EWH A;  1IWA A;  1S7H A;  4QYZ K;  2VQF F;  3HZG A;  2XY7 A;  2DRB A;  4E0D A;  1S48 A;  4DR4 J;  5H9E K;  2BUN A;  2MQ8 A;  5HMY A;  2AX0 A;  3GON A;  4DV0 F;  4F2R A;  3FSX A;  2DXE A;  1PC5 A;  4Y2I A;  2PI4 A;  3A4T A;  2C2E A;  5A0Y B;  2FYX A;  1Q86 T;  2C3U A;  3VAK A;  1S4E A;  2R7T A;  3TNV A;  4R25 A;  2BQU A;  4J9L A;  3G87 A;  4RUH A;  2QZ8 A;  2N3O A;  3W9I A;  4YHH F;  3OR2 B;  3C15 B;  4JI2 J;  4HTI A;  5KFT A;  2NCK L;  3UCG A;  2QV6 A;  4ZKA A;  1AB8 A;  4F25 A;  1XC9 A;  3CCR S;  3JSR A;  5KT5 A;  3MM6 B;  1XR5 A;  3HT3 A;  1SL1 A;  1HNX F;  2VIC A;  2L9W A;  3KXD A;  4DV7 F;  3W66 A;  3HO1 A;  2NPI A;  5KFE A;  3UVJ A;  3D68 A;  2DNY A;  4N77 A;  3DGP A;  3KUG A;  2DCL A;  3DLG A;  5HVG A;  3V6D B;  4JI7 J;  1S6Q A;  2B7C B;  2AYB A;  2AF6 A;  1NJW A;  4NLG A;  3UDL A;  4KHM A;  4F02 A;  1VBX A;  1UVJ A;  3SCI E;  4RW9 A;  3TA2 A;  1M0S A;  3FZB A;  4H4O B;  1TKZ A;  1FD8 A;  5B0G A;  5DJB A;  1DTT B;  4RU9 A;  3MPU B;  1FRM A;  5CYM B;  3PDN A;  1VIS A;  2W4D A;  1NHK L;  3DXS X;  4X4N A;  2FVS A;  3FKB A;  1UA1 A;  4X4O A;  2ZH4 A;  2W2P P;  1X4B A;  5JJB A;  3HHL C;  4YB1 P;  4DV4 J;  4UOC A;  2ZBR A;  5I42 B;  5J1E A;  2YPZ A;  2HS4 A;  3BRE A;  2G0C A;  1F6T A;  3KTQ A;  1QE1 A;  1DTQ B;  4NCA A;  1W26 A;  4K4X A;  3TQ1 A;  2DGO A;  1BD6 A;  1AFI A;  2HZV A;  5KFY A;  1IBM F;  5J2N A;  2HGM A;  3WX4 A;  3NCP A;  2YNI A;  3PHE A;  3RBZ A;  5C24 A;  2CQB A;  3OVB A;  1I94 J;  1VQY A;  1MWQ A;  1QVF R;  4CH1 A;  3BSA A;  2FJE B;  3TX0 A;  2EBG A;  5K8N A;  3I82 A;  3PO4 A;  4O3S A;  4C11 A;  3OL7 A;  2ROE A;  2P6S A;  1T03 A;  4JI8 J;  3IXQ A;  2AX1 A;  1JLQ A;  2CRL A;  1UFL A;  1VRU B;  3HX9 A;  1IKV B;  3KHH A;  1VC0 A;  2R7X A;  1WG1 A;  3CWJ A;  5T7L A;  1UAW A;  4ECY A;  3JXO A;  2B9Y A;  1R6V A;  1OO0 B;  2QFJ A;  2IJN A;  5A6W A;  4Q2M A;  1OS5 A;  4RUC A;  1RTD A;  3MAA A;  3RBD A;  1SBR A;  3IC1 A;  3LP2 B;  4KGZ B;  1QSS A;  4ES2 A;  1GMW A;  5KFW A;  5KFU A;  2MZT A;  1FKP A;  4DR6 F;  2Y1L B;  2BE2 B;  4HDG A;  3KLE B;  5C42 B;  3ZZY A;  5ETR A;  3ICL A;  2J7W A;  1RHJ B;  1T9W A;  1X0P A;  2GIR A;  3I9Z A;  4YR3 A;  4JYA J;  1ICE B;  2D9P A;  2GVD B;  3MMA A;  1BQM A;  1N5Y B;  4UZB A;  2VHG A;  3M1V A;  3KMS A;  2IJF A;  1WTF A;  4EI2 A;  1NAQ A;  4A8Y A;  1WOR A;  2BW7 A;  2VOP A;  4ZP7 A;  4JV1 A;  2M2B A;  5KG2 A;  4CM0 A;  1FRL A;  2WVD A;  1NDC A;  4ECQ A;  1C0U B;  4QZV B;  1S99 A;  3DRS B;  4O23 A;  1U7L A;  2F1F A;  1S59 A;  1TK8 A;  1RT6 B;  3MF5 A;  1M5V C;  1URN A;  4F4K A;  1EAR A;  4Z7C A;  1MW7 A;  3ISN C;  3D2W A;  4CO2 A;  3BEG B;  1SVD A;  2C2R A;  2IHR 1;  1LOU A;  3V4I B;  1U1P A;  5CH7 B;  1WC3 A;  5F8N A;  1KLM A;  1LV5 A;  1H2V Z;  2YNH A;  1R8C A;  1CJK A;  2ILZ A;  4KC5 A;  2FZG B;  2MLY A;  9ATC B;  2PEB A;  2VG7 B;  3C6U A;  1UW9 A;  2KO1 A;  2ZNY A;  1R3N A;  2OLW A;  1K8A T;  3M8W A;  3PTW A;  2CVI A;  2EEY A;  3QPI A;  2BM1 A;  4OZ2 A;  5CZV A;  4FKY A;  3P49 B;  2UUB J;  4OX6 A;  3E51 A;  3J81 j;  3DGV A;  3LAN A;  2J0S D;  2G2Y A;  2DY9 A;  3QT7 A;  3PKM A;  4CCH A;  1EAY C;  4ZPD A;  5KG3 A;  2B56 A;  5ITH A;  4RW7 A;  4DV6 F;  3ENW A;  2JZ5 A;  3FFI A;  1YKW A;  1JB0 C;  1Y3J A;  2ZC3 A;  1ARO P;  1OYD A;  1Z4U A;  4DUY J;  4NRU A;  5D0E A;  2YXL A;  1LWC A;  1FNM A;  3TUJ C;  4TVA B;  4M94 A;  4QYZ J;  1VBZ A;  4YS2 A;  1BLU A;  5C25 B;  2HQC A;  1FI4 A;  1H0H B;  2AJQ A;  3TA0 A;  1S6P A;  3IG1 B;  1QJH A;  2H4W B;  2VQE F;  2AYG A;  5F3T A;  4KBI A;  4KGV B;  5H9E J;  2UVV A;  5B7W A;  2IIH A;  1HBN B;  4UQG A;  1DUR A;  3FQL A;  1HW8 A;  3PZP A;  4KKO A;  1R89 A;  1HLW A;  1TL3 B;  2IDE A;  3R6L B;  1BC6 A;  1SV5 B;  3CW2 C;  4ZIT A;  1F9F A;  1OMS A;  4WP8 A;  4DR4 F;  4AL6 A;  3S7R A;  1U6F A;  4URS A;  3A8I A;  4C8O A;  4WE1 A;  4C9D A;  3DKD A;  4RW4 B;  1I1G A;  1EKS A;  1HBO B;  1NHV A;  5D77 A;  4HL9 A;  4F0M A;  4IO1 A;  3J7Z T;  1RBL A;  3PJW A;  3ZFV A;  5H9F K;  3N4W A;  2J9C A;  3CD7 A;  3BGU A;  5B09 A;  3Q8R B;  3VGT A;  2XB2 D;  1RWU A;  1W2B R;  4C8K A;  2OPQ A;  3IR7 B;  3RUB L;  2DHA A;  2OEK A;  3I0R B;  4Y6I A;  2DYA A;  2IDL A;  3TP2 A;  3BBB A;  4LF2 A;  3LP1 B;  2HEK A;  4ZN3 A;  3FBE A;  1F60 B;  4DUT A;  5H1S V;  4M5K A;  1X60 A;  5IZH A;  1W2I A;  4Y2C A;  2AW0 A;  2W9B A;  2VPX B;  4WCE Q;  4JBC A;  1GK8 A;  4E98 A;  2AU0 A;  2J7K A;  1IUJ A;  2V2K A;  4OIX A;  4NLR A;  3CCV S;  3SSQ A;  3BKU A;  5DM7 Q;  4TXS A;  4USW A;  2L9D A;  2FHJ D;  1VQ5 S;  3GYN A;  1X8D A;  2WAQ D;  1LW2 A;  2CJY B;  3ITH A;  4QQB A;  4DEZ A;  2W7A A;  3NOC A;  2VG6 B;  3R5A A;  2RDI A;  4DZD A;  4M1K A;  4WZM A;  1A9N B;  3AB4 B;  4LF4 J;  2J8A A;  1Q7Y T;  4U9R A;  3VGV A;  2KB2 A;  4RW6 A;  2AV5 A;  5HP1 A;  4DG1 A;  4U67 Q;  3BGO P;  1NO8 A;  4DV4 F;  1A7G E;  1S5Z A;  2XY6 A;  3KHL A;  2VBY A;  1WDT A;  1T0T V;  2AQ4 A;  1I3O B;  2BKP A;  2KM8 C;  2D69 A;  3H5S A;  2GX8 A;  4HI1 A;  2J9D E;  3QO9 B;  3D6T B;  2ABY A;  1Q8K A;  2ZD1 B;  4EK2 A;  2ILY A;  1UPM B;  5IT0 A;  1HYS B;  2HHT A;  4NLU A;  2VIH A;  4KGM A;  5BYQ A;  2UXC J;  3R5C A;  3OFH A;  2XBP A;  2D3O R;  3SSR A;  4C6A A;  2ZZM A;  2LXU A;  2V5H G;  4DCO B;  1U6Z A;  1VR6 A;  4L3N A;  3N0V A;  4KE5 A;  2FJX A;  1I94 F;  5JVG Q;  2LEB A;  3BGR B;  2C2D A;  2CWK A;  4X84 A;  2O01 C;  2YY3 A;  1R7I A;  2PGC A;  3M2U A;  2VJU A;  3KWM A;  2DEJ A;  1RI7 A;  1APS A;  3NCR A;  1TUG B;  1FFS B;  4WPA A;  4I64 A;  4ZIW A;  4JI8 F;  2D9O A;  1N0V C;  1S7I A;  3OTC A;  2F8M A;  1OJ4 A;  1M5K C;  4L72 B;  1S12 A;  3B8H A;  2Y9H A;  4NCG B;  1U1L A;  1U2R A;  2HHX A;  2A1B A;  3HJF A;  1VQK S;  3BM7 A;  3I5A A;  1S1X A;  3TAR A;  2OGU A;  4GMK A;  3QFW A;  5DDQ C;  2Z30 B;  2GS8 A;  2OMO A;  3CCT A;  3FEZ A;  4LFB F;  2WRM A;  4CO0 A;  4UQT A;  3IR5 B;  4QJV A;  4KT0 C;  4K4T A;  1B7Y B;  4B9S A;  2PFF B;  5KG0 A;  1C4C A;  4RUA A;  2OML A;  2B6A A;  2ZH5 A;  4ECV A;  2O1P A;  2ROG A;  2V4Q A;  2MQL A;  2V63 A;  3MGJ A;  3MD1 A;  3VR1 A;  4D3H A;  1LK7 A;  2W9A A;  3GII A;  1HPZ B;  2DIU A;  1RJJ A;  4DSI A;  3UR3 C;  2KYX A;  2HHS A;  1N4L A;  3M32 B;  4K4S A;  1Q82 T;  1P8G A;  1SKS A;  1OQ6 A;  2OPS A;  3MD3 A;  3OHB A;  2AYM A;  4OHY A;  3QIP A;  3LPE A;  3QAT A;  1ZBT A;  5DS7 A;  2WZ1 A;  4DQQ A;  3ZZU A;  4X4Q A;  2E5H A;  1UP1 A;  1CS4 A;  5FDL B;  2ROP A;  1FHT A;  2OTJ S;  1KC8 T;  4OV1 A;  2ZOM A;  1RT7 B;  2HG4 A;  3CTR A;  1SC4 B;  3GYG A;  4PG7 A;  2WK4 A;  4G65 A;  2DCU B;  2PMH A;  3S1T A;  2CDQ A;  5IQQ A;  3DOL A;  2ZKT A;  2B9X A;  2V8G A;  3D3C J;  4LMZ A;  4ZHR A;  4OYA A;  2W7P A;  3CO0 P;  2L9N A;  5AJ3 J;  4OX7 A;  1VQN S;  1UZH A;  3TZX A;  1F5C A;  3NCQ A;  1U24 A;  1VQP S;  1H2U X;  2YKN A;  2EFO A;  3UDV A;  3MMB A;  4CNZ A;  2WBM A;  2CAD A;  4CLP A;  1HBU A;  3TYT A;  3NS5 A;  5L1I A;  4ZLN A;  4DN9 A;  2IVY A;  3IR6 B;  2EBE A;  4AT1 B;  4B9T A;  2CPY A;  3SFU A;  3G2X A;  4ED8 A;  2AZ1 A;  5K14 A;  3KK3 A;  1IKX A;  1Q4R A;  2W4P A;  1JXV A;  3SCL E;  6FD1 A;  3MEG A;  3MM8 B;  4B3T J;  1TQL A;  2R2T A;  3R2D J;  2UVR A;  5B0B A;  2FB0 A;  4ZVS B;  5MAO A;  3O3L A;  1GQE A;  1WKK A;  4USI A;  2UUB F;  2HVH A;  4ZVQ B;  1Y11 A;  2LXF A;  1PO6 A;  3PXG a;  3GFY A;  3K58 A;  2RF2 A;  4EWT A;  3CO9 A;  4DOZ A;  1L5U A;  3J80 Y;  1H72 C;  4AUK A;  3M2V A;  2F65 A;  2V8V A;  5F0U A;  4B3R J;  2XLI A;  4CLL A;  2MGZ A;  3FSY A;  4DUY F;  3NGK A;  3C2P A;  2GIF A;  2JVR A;  4OZ1 A;  4CIO A;  2UUA J;  3NBP B;  3NGS A;  1U49 A;  2GO8 A;  3ZNJ 1;  4ZPB A;  5AE1 A;  2DNO A;  4MIB A;  4I4B A;  2MQP A;  1U47 A;  2W7O A;  1QTM A;  1WWH A;  2QYG A;  1S1T A;  2VKR A;  1M1H A;  2BRK A;  1DLO B;  4DPO A;  4DQP A;  3AT1 B;  3CXC R;  2I0X A;  1RHM B;  2F4F A;  3CC2 S;  4LR9 A;  3I87 A;  1VMB A;  4CT8 A;  3GJQ B;  1TV6 A;  4LR8 A;  1EP4 B;  5K8P A;  2VG5 B;  3QWP A;  4DS5 A;  2U1A A;  3BDP A;  2CAJ A;  2R2U A;  1U0H A;  5JVH Q;  1YI2 S;  3EZ5 A;  3P3D A;  1YTY A;  2WVB A;  4IQM A;  5KFH A;  1VQM S;  4OHV A;  1F3F A;  1WOS A;  2VFU A;  4HTJ A;  2YKP A;  3IRX A;  1IXK A;  1IVZ A;  4ZVU B;  2FHJ A;  4WFN Q;  2LQ5 A;  1CJV B;  4ZA1 A;  5DG7 A;  1MMN A;  1IQZ A;  3FVY A;  1VIO A;  4U6P A;  3GR0 A;  3V6H A;  1BMQ B;  4H4K C;  5IM0 A;  2RUS A;  3LAM A;  4XK8 C;  3M8P B;  1HHS A;  1RYR A;  5AXK A;  2BOA A;  3R6G B;  2NXE A;  2Y8Y A;  1KEK A;  2J9E A;  3EIC A;  3G6Y A;  3MDF A;  4P2X A;  4LRC A;  2YKQ A;  1NK6 A;  1ZTW A;  4C3K A;  3QMQ A;  2W4C A;  4X4U A;  3OL6 A;  3RRK A;  3GFZ A;  4XDD A;  3PKY A;  2HNY B;  1N5S A;  2GIQ A;  4M8L A;  5E3A A;  3B6B A;  2I8E A;  3G4S S;  3CB4 A;  5LSL A;  2M9K A;  4ED7 A;  4DMZ A;  4LF4 F;  3CMA S;  2DO4 A;  1SJ3 P;  2GZO A;  2MKI A;  2QYC A;  4NMX A;  4CLZ A;  1G6B A;  3CE8 A;  3KLG A;  2MZQ A;  1R0C B;  1HIY A;  3RB3 A;  4DL3 A;  1WI6 A;  4R0E A;  2ATC B;  3E01 B;  3NGR A;  1XK8 A;  3J7Z 5;  2CQ3 A;  4KIA A;  2XMK A;  4EUV A;  2DNR A;  5LXR A;  1OSC A;  4RNM A;  4C8Z A;  1MLA A;  5HAO A;  2KTQ A;  3ETO A;  3I9V 9;  2UXC F;  5E3Q A;  1CBK A;  5LJ3 Y;  2RIJ A;  2HYI B;  2V50 A;  5E41 A;  1KVK A;  2CQ2 A;  3UVJ B;  2C3Y A;  3CPW R;  2FVP A;  2UUW A;  4CO4 A;  3LGN A;  4Y65 A;  4NWB A;  4J37 A;  3DGP B;  3JSB A;  3DLG B;  4WFZ A;  4R8U B;  2OSQ A;  3KJN B;  2FLN A;  1S6Q B;  3HDS A;  2IVM A;  1XJW B;  2LU1 A;  4K4W A;  4HLB A;  3IRW P;  5EWE A;  5CAB A;  3TAM A;  5L38 A;  3BO2 A;  5A76 A;  2HMI B;  1R0A B;  3VAJ A;  5AXN A;  2LQJ A;  4ZVE A;  3JQJ A;  2IM2 A;  5IOL A;  3NGD A;  1TTH B;  4I2Q A;  5CHC B;  4J5O A;  2IYI A;  4DPY A;  2MPU A;  3U27 A;  1GXT A;  1TFW A;  3D28 A;  2HVD A;  4GO7 X;  1XWL A;  4DF8 A;  4ETZ A;  4HDH A;  1NCL A;  4NYO A;  3PW7 A;  4J90 A;  2MKC A;  4MYT A;  5ETQ A;  2X1A A;  2E5L J;  1HI8 A;  2EFV A;  3DMJ A;  4OI1 A;  5KG7 A;  1IJF B;  3EGW B;  4TY9 A;  2POK A;  3CJ5 A;  1HBM A;  2DHH A;  1DQ9 A;  2GQ2 A;  1Y5N B;  2ZH9 A;  1RT1 A;  4DL5 A;  3B82 A;  3KDO A;  4KB7 A;  1TKD A;  3A8K A;  3CCS S;  5FLX U;  2UVU A;  5HN0 A;  2CG8 A;  3UFC X;  2BJ3 A;  4NL5 A;  3VVT A;  2DNZ A;  1TVR A;  2DKO B;  2VON A;  2ZZT A;  4RNN A;  4V19 J;  2MSS A;  3VWS A;  4FYD A;  4LRF A;  3GP9 A;  3BZQ A;  4DV1 J;  4IFV A;  1KLN A;  1S0O A;  2R7Q A;  2CPD A;  1JLQ B;  1JLC A;  2E5G A;  1WG5 A;  3JB9 k;  4KPC A;  2HFN A;  3UNY A;  3ILL A;  3GCX P;  4O0I A;  3K2Y A;  5J2P A;  2QA1 A;  1KHV A;  5DQG A;  1T05 A;  3HXM A;  2CNN B;  1FRK A;  4L75 A;  1HWK A;  3T6J A;  2CWX A;  5AJ3 F;  4O3P A;  4QIF A;  3SI8 A;  2JNJ A;  4ES3 A;  3W2W A;  3CT9 A;  2MKK A;  4PWD B;  3IBC B;  1DHM A;  4C0B A;  2VL1 A;  5KFS A;  1UWA A;  2YNG A;  1KDN A;  2KL8 A;  3LF0 A;  2FJW A;  1CPZ A;  5DLF A;  3Q8Y A;  2BX6 A;  4PQU B;  5L46 A;  2E1M C;  3SMZ A;  1VJW A;  5KFN A;  2HK3 A;  2D3U A;  4B3T F;  2O67 A;  1NRK A;  4PAB A;  3IAS 9;  4N41 A;  4WXO A;  3M8S A;  1NJZ A;  3OR1 A;  3VAI A;  5KFZ A;  2R7U A;  2LEA A;  3OTD A;  2K8G A;  4WYL A;  2PSZ A;  2RSQ A;  1NDP A;  3MM5 B;  2E5J A;  3MMA B;  3OJS A;  2HIY A;  3FCV A;  5D78 A;  4KSE B;  4GRS A;  4KR0 B;  3H98 A;  4IH5 A;  3BR9 A;  3DLJ A;  2LCW A;  5D4L A;  3KJQ B;  1K1S A;  4ILM A;  3B4D A;  4B3R F;  1SIZ A;  1Q8L A;  2ZBP A;  1VIX A;  4ICL B;  1WI8 A;  5A0Y A;  3GG1 A;  4MMO A;  2UUA F;  5D6G A;  2RU3 A;  4QW9 A;  2JLG A;  3V5R A;  2KXN B;  2PA3 A;  2RDD A;  4K7Q A;  4K8R A;  2OP5 A;  3HHL B;  1NKC A;  3NRB A;  2P8I A;  2CQ4 A;  4C0H A;  5KT7 A;  3H7H B;  3OR2 A;  1NXI A;  3C15 A;  4NRT A;  4CDI A;  3H5X A;  2QMU B;  2PT0 A;  4NE9 C;  2LA6 A;  1S77 D;  4MTP A;  3MM6 A;  1XIQ A;  4ELU A;  3Q2T C;  2M4M A;  2B3T B;  4EYH B;  4J9K A;  3SBM A;  3WC2 A;  2E5I A;  1KTV A;  1UJ6 A;  1UVL A;  3CJK A;  2MB0 B;  2E29 A;  3EUN A;  3FDS A;  1K47 A;  3A3N B;  1NLK L;  3LTO A;  3KHR A;  2PO4 A;  3IA0 A;  3UI3 A;  1WEX A;  2FHO B;  2CFX A;  2B43 A;  1DZ5 A;  1R6Y A;  2AHO B;  4DSK A;  4IQX A;  3MM9 A;  4Y2A A;  3I56 S;  1NDK A;  3NXZ A;  2RAQ A;  1G7C B;  3MR2 A;  1KQG B;  4H4O A;  1UEK A;  3N6M A;  1DTT A;  2VBW A;  1QAI A;  2CJQ A;  5F9L A;  3KG4 A;  2KHD A;  4DR2 J;  5CYM A;  2YPY A;  1U2C A;  1NSQ A;  4QIE A;  4OFZ A;  4UUW A;  1H7W A;  2YKA A;  4HI2 A;  4BWJ A;  1RHR B;  3PG9 A;  2NYH A;  3MPV A;  1KQK A;  4YFU A;  3NAI A;  4FDF A;  1NH7 A;  4WZQ A;  1UVM A;  5CCM A;  2V0N A;  2E7X A;  5GAD I;  1V3Z A;  2VPW B;  2WTF A;  2M8D B;  3C6T B;  1REV B;  1X4A A;  3M9O B;  2Y8W A;  2RE1 A;  2XTJ P;  2FJB B;  4LFC J;  5SZT A;  3MOZ A;  4LUB A;  2MJN A;  5LJ5 Y;  9RUB A;  1XER A;  4YY3 J;  2JWN A;  5HJY A;  3FGV A;  4MT1 A;  1RB0 A;  1K0V A;  1T95 A;  1ZPW X;  3HD2 A;  2V9W A;  3RTV A;  2MKH A;  2ASY A;  3RRH A;  3MUV P;  1NPR A;  2NPF A;  5HVH A;  1UTA A;  2NSB A;  1X4F A;  4CLK A;  2Z58 B;  1TEL A;  3UD4 P;  1VRU A;  1AT1 B;  1IKV A;  3EX7 B;  2G1H A;  1RKI A;  3TJ9 A;  3T1Y F;  2XEX A;  3AJ2 A;  4PRF A;  2KFN A;  4LT6 A;  3PX6 A;  2CNO B;  1T7P A;  3TVK A;  5LMN J;  1R27 B;  2H3E B;  4ZK7 M;  2CG4 A;  1U8W A;  5B0E A;  1HWJ A;  5KFB A;  4DUZ J;  4IR9 A;  3E8O A;  3HSG A;  4I6A A;  3LP2 A;  1OPI A;  2WSE C;  3I0S B;  4QWD A;  2NZC A;  5BYR A;  2BE2 A;  2YTC A;  3KLE A;  2HNZ B;  4QPT A;  3G9C A;  5C42 A;  2BVZ A;  2EFP A;  3GJS B;  3FUY A;  1JJ2 R;  1LW2 B;  2GVD A;  3ITH B;  1N5Y A;  1YK9 A;  5A8R A;  5EHH A;  2VOD A;  4DFM A;  1S57 A;  4OX9 F;  5KFV A;  3NWG A;  5I3Q A;  3VAH A;  2FDN A;  1EIY B;  1VQ9 S;  1T94 A;  4OYX A;  4NLP A;  3BPD A;  4IRK A;  1C0U A;  3BGF A;  2IBK A;  4LBH A;  4Q44 A;  2L3M A;  3DRS A;  3EXC X;  1IBK J;  1CEZ A;  1WC6 A;  1RT6 A;  1KRP A;  3FC9 A;  2E5L F;  3A3P B;  3AD7 C;  1YIJ S;  4EFA C;  2RHS B;  1X4C A;  2RS8 A;  4KO0 B;  2NRE A;  4A8M P;  1V5I B;  2NLW A;  2CQP A;  1X5S A;  3V4I A;  1RAD B;  2XMT A;  5KFG A;  4WFX A;  2OD6 A;  3UW1 A;  1N36 J;  2ZH6 A;  3F41 A;  3U1M A;  4Y0F A;  1B0T A;  3MWB A;  5ETP A;  1RUS A;  5KFJ A;  4QIG A;  2YWK A;  5DDO C;  2J6S A;  2H4Y B;  3V6K A;  2DH7 A;  1XBW A;  5LM7 E;  4DV1 F;  4OHW A;  5DDP C;  1Y00 A;  4Y34 A;  3HCX A;  3RJM B;  1A0O B;  2V4J B;  2Z0G A;  1Y7P A;  1GMV A;  2GGP A;  2FC9 A;  3B54 A;  3DLE B;  4FZV A;  2OFG X;  2FZK B;  3ZO7 A;  5G0R B;  2PMZ D;  1S1X B;  3CJ8 A;  3R27 A;  2VZ9 A;  2NS1 B;  4G1Q A;  4HT5 A;  2XSJ A;  2HVZ A;  1FE4 A;  2CQD A;  3HI9 A;  1ELO A;  2N7Y A;  5L9N A;  3G96 A;  2QLW A;  2HK2 A;  5J2M B;  2HWI A;  1GAO A;  1GMU A;  2RRA A;  2FVQ A;  2B4U A;  1IM6 A;  1QVG R;  4TYB A;  3FBB A;  1UZD A;  5C25 A;  1SC6 A;  1H74 A;  3M6U A;  3IG1 A;  5HAT A;  4JV2 A;  3VQT A;  3PNI A;  1FRH A;  4DCP B;  5KFR A;  2BJ8 A;  2I1R A;  1NZ8 A;  2OPS B;  5BR8 F;  1QDU B;  3KHG A;  2ALZ A;  3CUN A;  1T9X A;  1SKW A;  1SV5 A;  2AMC B;  2HFZ A;  3NNH A;  1RT2 B;  2H5I B;  4LR7 A;  2YQ0 A;  2HVE A;  2K1R A;  4L6V 3;  3W2V B;  1K1Q A;  3MAH A;  1KD1 T;  4UF4 A;  4PCQ A;  2VDH A;  5KT4 A;  2CJA A;  2XO6 A;  2CQI A;  4U7U D;  4IG3 A;  3PIP Q;  2B4O A;  4RW4 A;  1MU2 B;  2DR5 A;  1HQE A;  3FBC A;  1HBO A;  2V94 A;  2DGX A;  5DGA A;  3BN4 A;  1H73 A;  1RAB B;  1U1M A;  1J27 A;  1PCA A;  2P9E A;  2NUU G;  5D4N A;  3BGL A;  2KM8 B;  3T1H F;  2VC1 A;  1UPP A;  3A8E A;  3P45 B;  1YSJ A;  3LOU A;  1HBU B;  1S9G B;  4WFY A;  2VBZ A;  2KVI A;  3W65 A;  2D3O 1;  2R2R A;  4X2B A;  4XAK A;  5A8W B;  1IKX B;  3HVR A;  1AYE A;  4NOH A;  3LP1 A;  5IS2 A;  4IFY B;  3NY0 A;  3MEG B;  4TQR A;  1FX2 A;  1CSJ A;  2DPJ A;  3EXY A;  3DYA B;  4ECX A;  4I0W A;  4Q2L A;  1T3O A;  4USK A;  3G8S A;  1D0E A;  2W1B A;  3EPG A;  1X5O A;  2V69 A;  2CQC A;  1CVJ A;  2MKS A;  2VG6 A;  4UST A;  3CCQ S;  4DR2 F;  3MED B;  5F8L A;  1HWU A;  2KDO A;  3CED A;  1QM9 A;  2DPI A;  4UOF A;  3FBF A;  1RAC B;  2XMM A;  2EG1 A;  1S1T B;  3AB2 B;  4PUO B;  3EGN A;  3GE9 A;  3OLB A;  3PRB A;  2ZD1 A;  1KOH A;  1X5P A;  4OJ1 A;  3CD6 S;  2IM3 A;  3FQK A;  1YJW S;  1ZM9 A;  1HYS A;  1B4S A;  1XNR J;  2JC0 A;  5E33 A;  4LFC F;  3HFV A;  4IKA A;  1OSD A;  1NH8 A;  1RAH B;  4OZ0 A;  4DR5 J;  4IOC Q;  2DVI A;  1FF2 A;  1WF1 A;  4RL1 A;  3OL9 A;  3BGR A;  4YY3 F;  8RUC A;  4DFJ A;  1U0H B;  4F04 B;  3UE2 A;  3QRR A;  1UVI A;  4USJ C;  2AGO A;  2KJW A;  4U8V A;  4ZPV R;  3GWC A;  1VHF A;  2E7V A;  1ZA1 B;  3AHP A;  3N28 A;  3SSS A;  4IRD A;  1FVS A;  2MZJ A;  3J81 U;  3C19 A;  4F36 A;  3G86 A;  3OSN A;  3SQG B;  1YJ9 S;  2IAJ B;  4B9L A;  1G2E A;  4C8Y A;  2DHS A;  4NCG A;  1P6T A;  4QU7 A;  3MEK A;  1PBU A;  2OUG A;  3GPA A;  5HO4 A;  1TL1 B;  4OJG A;  4WK3 A;  2V4R A;  4OZL A;  2RHQ B;  3RYL A;  2H51 B;  2JVO A;  2RU9 A;  4AQY J;  5LMN F;  2MKJ A;  5IXU A;  5IM0 B;  1Y10 A;  2V34 A;  2V8P A;  4AND A;  5HMZ A;  4WYW A;  1R8A A;  4FS2 A;  3CCJ S;  4DUZ F;  5IV4 A;  3MCO A;  1MML A;  2BAN B;  2XS7 A;  3PW0 A;  2XGP A;  1S76 D;  2F3J A;  2PDA A;  1X9M A;  5A2Q U;  1NB7 A;  2DNN A;  4DR3 J;  1HPZ A;  3LAK A;  4EU0 A;  4QR1 A;  4WTY A;  4O3N A;  3M32 A;  5HQ8 A;  3VVU A;  3CC4 S;  2G4B A;  4CLS A;  4DFP A;  2ZH7 A;  2JEJ A;  1UW4 A;  4PYD A;  4I1T A;  2HHV A;  4RWW A;  5IT4 A;  1ROF A;  1IR0 A;  5FDL A;  2ZIT A;  3MR3 A;  3M6W A;  2A2C A;  1FRX A;  4LRB A;  1RWW B;  1RT7 A;  2DGW A;  1M5P C;  4LBP A;  3O44 A;  3AA9 A;  1TZ0 A;  1L3V A;  1TKX A;  1IBK F;  4ED0 A;  4CRJ A;  1N6Q A;  1N5T A;  1X4H A;  2BMB A;  1R8B A;  1BGX T;  4ZP6 A;  2G2O A;  3OJU A;  2MQN A;  4LQ3 A;  2ZOG A;  3D6F B;  4MKY A;  3K5M A;  1T9U A;  5GAD U;  1GTE A;  2HQD A;  4DQS A;  4CM2 A;  1GEH A;  2K3K A;  2I6W A;  1XMB A;  4OLO A;  5LL6 d;  4HHH A;  3SEO A;  1F9E B;  4G6V B;  1B7F A;  1U1R A;  1N36 F;  2HQF A;  2DTJ A;  1PIL A;  3HVA A;  3OBI A;  1M1K T;  1WD6 A;  3GFH A;  4ES1 A;  2N4D A;  2XCP A;  4ZDN A;  4CLY A;  5D15 A;  4WWS A;  4RR5 A;  3MM8 A;  1UWB B;  2LVW A;  1RU1 A;  1CG2 A;  4Q45 A;  3DFE A;  2BQR A;  1RWM B;  5HBM B;  3TAM B;  3UDE A;  3KUE A;  3TEH B;  3PRV A;  2VPY B;  2G0I A;  4RBV A;  1SQE A;  1PAU B;  1PYO B;  1D09 B;  2QL9 B;  2RT3 A;  4FXW A;  5BJR A;  1R8P A;  2VBX A;  1HNI A;  4WII A;  2J6T A;  4LF6 F;  1VBY A;  1E6Y B;  2E1P A;  2UUT A;  2R9L A;  3K57 A;  2EXU A;  1FCA A;  3BBC A;  3L3C A;  4ZN1 A;  4IOB A;  2EFN A;  1X31 C;  1XNQ J;  3BBF A;  3D67 A;  1RT3 B;  2E9R X;  1BY9 A;  4ECT A;  4W90 B;  2DGS A;  1PKU A;  4FVM A;  4WP3 A;  3GTY X;  3DDI A;  5HRO B;  2EVZ A;  1PJ7 A;  3AD9 C;  3S01 A;  1NU4 A;  2YNF B;  4RJV A;  3UPF A;  3KUH A;  3ONQ A;  4IH7 A;  2RRB A;  2BW2 A;  4XDC A;  1DLO A;  1PJ5 A;  5KTQ A;  3EYZ A;  1Q95 G;  1RWP B;  1FJE B;  2KXF A;  2V8H A;  5KFQ A;  3E2E A;  1RTH B;  1TVR B;  3VAG A;  2YH1 A;  2K7J A;  2PC6 A;  2CXE A;  1S0V A;  1HMV A;  2CNL B;  2A10 A;  1EP4 A;  5K8M A;  2HFO A;  3F44 A;  2VG5 A;  5LSR A;  4Q5V A;  4FNI A;  4PQA A;  4IDK B;  2WBR A;  4OJH A;  3OFF A;  4OZN A;  4TKT A;  1JJH A;  2J0Q D;  4J7C A;  3PFE A;  5HL7 Q;  3PY8 A;  4URG A;  1HI0 P;  3HHL D;  1F0X A;  1NB2 A;  2U2F A;  1FEH A;  1U1K A;  3DHX A;  2AJF E;  3P4U B;  2DXF A;  3W2W B;  3NS7 B;  1YVF A;  3UNG C;  2JFK A;  1CJV A;  1BUX A;  2YNG B;  1MN7 A;  2M3D A;  2F5G A;  2MQQ A;  2E1C A;  3KMQ A;  2E1A A;  5SUH A;  2MKY A;  2C2M B;  2FHK A;  2A2D A;  2APO A;  4JOU A;  4F4X A;  2N7C A;  3FEY B;  2RNE A;  3OR1 B;  2VQE J;  4MH8 A;  3QRP A;  2NSC A;  4K4U A;  1HQU B;  3H59 A;  2WHO A;  4F7V A;  1HWI A;  3CSK A;  2CPE A;  2ZOF A;  2VUG A;  4P9S A;  1OWX A;  3P6Y C;  3FCW A;  2ZE2 A;  1QAJ A;  2XNR A;  2N3L A;  2V67 A;  4ER8 A;  4JI5 J;  1N52 B;  3OVS A;  2HHP A;  2HNY A;  2F9D A;  5D4P A;  1HWL A;  4LF9 J;  3ENA A;  2BOP A;  4F4Z A;  3DLL Q;  5L1K A;  2LEC A;  3C16 B;  2KFZ A;  4EEY A;  2OSR A;  3PJ9 A;  4JI3 J;  3MI7 X;  2ZJQ Q;  2GQC A;  3RB6 A;  2FY8 A;  2ALY B;  2FUG 9;  4X4S A;  2DD8 S;  3FRY A;  4CO3 A;  4NA2 A;  3QYY A;  5F0W A;  4AFF A;  4J9O A;  5F3Z A;  3E01 A;  4KJI A;  2H54 B;  3PX4 A;  2FPH X;  1P27 B;  2K2P A;  2QG9 B;  1TKT A;  2KG0 A;  1VQS A;  1AUS L;  4N47 A;  4CH0 S;  2DT9 A;  2QTW A;  1HNV A;  1B70 B;  4R0J A;  1UVN A;  5CD4 H;  1EQ0 A;  1D8Y A;  1LWX A;  2OPP B;  4X4T A;  2K7K A;  2OI2 A;  2CPH A;  5L39 A;  1XNR F;  4ZPT R;  3D1H A;  3CJK B;  1Y5L B;  3BQ1 A;  2EI5 A;  4DR5 F;  1C2P A;  1IR1 A;  1WSV A;  4BHQ A;  6AT1 B;  5HSP A;  3IM8 A;  4R8U A;  2JOQ A;  4I6Y A;  2CNK B;  2EPI A;  3CJQ A;  1HR0 F;  2JH3 A;  4ZVF A;  3MM9 B;  3JYT A;  3R97 A;  2OH2 A;  2HMI A;  1R0A A;  2CKW A;  3GCW P;  2XZW A;  4FXD A;  3ISN D;  4DSF A;  5F8J A;  2QLJ B;  1RLC L;  3J7Y I;  2CQG A;  3LAL A;  5ETN A;  2WOM B;  2SXL A;  2Q3P A;  4AQY F;  2VA3 A;  2XWY A;  4G1P A;  1DRZ A;  3SFG A;  1ZET A;  2UV8 G;  1WKL A;  4MIA A;  4NZ0 A;  4M5L A;  4F2S A;  1H6K X;  2ASL A;  3CJT A;  2BAB A;  2FLO A;  1JIH A;  4DR3 F;  3QRQ A;  3BF4 A;  3RZA A;  2W01 A;  2DIV A;  1NBE B;  3MMJ A;  1Q5V A;  4ZOS A;  1RE1 B;  1O6X A;  2JC1 A;  3PR4 A;  4ZJO A;  3DRX A;  3V2U C;  2A6O A;  2GJ2 A;  2D3Z A;  2R7O A;  1FE0 A;  4FYY B;  1FDA A;  4PZV A;  1FWK A;  1RWO B;  4OLP A;  3UWT A;  1CQM A;  4M5N A;  3H5U A;  4C48 A;  5RUB A;  4C8N A;  1QTN B;  4K4Y A;  2W2Q P;  3N9U C;  1HNZ J;  2LFV A;  3DRR B;  2R7R A;  1FX4 A;  2W25 A;  1GNK A;  4LQ9 A;  3N5F A;  2KYZ A;  1LWF B;  1JLF B;  4ZJQ A;  2W8K A;  2UVW A;  3M9M B;  2XMU A;  3IFE A;  4PWD A;  3QJJ A;  4LFB J;  2RRN A;  1S9E A;  1NSA A;  4B9V A;  4CTA B;  1VI7 A;  2BA9 A;  4PQU A;  1RSC A;  4A8S A;  4DWI A;  2IPO B;  1BE4 A;  2F7V A;  1JXE A;  4CO5 A;  3PEJ A;  4IO9 Q;  1FWP A;  2RKI B;  3GMG A;  4RKU C;  4LIW A;  4LF8 J;  3SV3 A;  5F8I A;  3TI0 A;  4DFK A;  2M0G B;  3CDA A;  3MM5 A;  3ZTS A;  1WC1 A;  3QAE A;  5A8R B;  3U02 A;  4DU8 A;  4DS4 A;  1JWW A;  2LKZ A;  3JAM Y;  1D3W A;  4DL7 A;  4YUD A;  4FBU A;  1TAQ A;  1IKY B;  3LPY A;  4HYK A;  4GKJ J;  4C3L A;  1NDL A;  4ED1 A;  1KHW A;  2B8Q A;  3DLH A;  1XNQ F;  1JK9 B;  3OLA A;  1JLA B;  5EX3 A;  4ICL A;  1Q79 A;  4USU A;  3HK2 A;  2OEM A;  3M30 A;  2CPF A;  5E2Q A;  2GVZ B;  1U0S A;  1M5O C;  3HHL A;  1DJ0 A;  1BQN B;  1AW0 A;  5GME A;  4ZJL A;  4EMD A;  4PXB A;  4R5P B;  5DLG A;  3M2R A;  2Z8Q A;  3IBF B;  3DOM B;  4NZ6 A;  1QSY A;  1IQT A;  1B3T A;  2ZHA A;  3PW5 A;  1GX5 A;  2HWH A;  1HHT P;  4ANE A;  2XI2 A;  3OXL A;  1WHY A;  4IR1 A;  5IFM A;  1C1C B;  2KRB A;  2QSW A;  5ETK A;  2BAC A;  3F73 A;  1QSL A;  2KT5 A;  4F3M A;  4P2S A;  3RAM A;  3GSI A;  3GLJ A;  4K50 A;  2GGP B;  3D3B J;  1RHQ B;  3JSM A;  1VQ7 S;  4ANC A;  5K9F A;  3G6E S;  4ID8 A;  5HMX A;  2WB4 A;  4IOA Q;  1O51 A;  4V19 X;  5FLX Y;  1YHQ S;  3KJV B;  2LA4 A;  1YJ7 A;  2LQ8 A;  3RRG A;  3ISZ A;  2M8H A;  2LEP A;  4G1Q B;  5JUM A;  2XSJ B;  4C0O C;  1FO1 A;  1IJE B;  2H5E A;  3RW6 A;  3THV A;  5DRK A;  3RR7 A;  1W7W A;  3JQK A;  2ATL A;  2WCX A;  5IC4 B;  5U47 A;  5ETL A;  2MYF A;  1QLN A;  4DSJ A;  3Q8U A;  3EMT A;  4F0H A;  1Y9O A;  4KFB A;  1UEV A;  2BJ1 A;  3Q89 A;  2OIH A;  3GG0 A;  2C2K B;  1MRO A;  3VAM A;  2AGP A;  4TLR A;  2YX1 A;  1N32 F;  2ZNZ A;  1S4F A;  4ZVR B;  5IC6 B;  3VTI A;  3I5B A;  2IRX A;  4DPU A;  3C6T A;  1REV A;  1XTZ A;  3R8Y A;  1NJX A;  1WUU A;  5B0F A;  4JI5 F;  1TK0 A;  2K1R B;  3M6X A;  4NLX A;  2DK2 A;  1P1T A;  1D8Z A;  4LF9 F;  2VJV A;  3DDK A;  2CZ9 A;  3SYZ A;  1VQ4 S;  4IG3 B;  2BE7 D;  5GMD A;  2KRR A;  4CO1 A;  1HQE B;  1N34 F;  3OXF A;  4JI3 F;  2AD9 A;  3G71 S;  3QJP A;  1JLG B;  3Q2S C;  1L3U A;  2FC8 A;  2AKW B;  1TFY A;  4ZS6 A;  2AEJ A;  1NJI T;  3UO0 A;  4N76 A;  4QOT A;  1U2F A;  1UKU A;  2DGU A;  2ZJP Q;  4PG4 A;  4OYO A;  4J9M A;  3O6Q A;  3PFO A;  5T41 A;  2P9G A;  3RW7 A;  3DRP B;  1SJ4 P;  1EB0 A;  4URQ U;  5F8H A;  2X1G A;  4TQS A;  3I5C A;  4GC6 A;  2L08 A;  2EW9 A;  1FJG J;  2P6T A;  3BKT A;  4I2P A;  5KG6 A;  4ZCM A;  3I0S A;  2BJE A;  3SV4 A;  2JJ4 D;  1B99 A;  1M90 T;  2HNZ A;  1OQ3 A;  4TYA A;  5JMN A;  1RWX B;  1JQG A;  1NSP A;  1AZS A;  2EG2 A;  3CD5 A;  5ETV A;  1T3N A;  3RB0 A;  1LNQ A;  1MSW D;  2BYC A;  3RR8 A;  3OSP A;  1YG0 A;  4MKA A;  4NLS A;  1NM2 A;  3KOA A;  3I55 S;  5HJX A;  1NKB A;  1AFJ A;  2UP1 A;  2V6A A;  4JI1 J;  2LP4 A;  1JKH B;  1LK5 A;  1Q7L B;  5HAN A;  4X4R A;  3G82 A;  1YJV A;  5KFI A;  4LRA A;  3MM7 A;  4Y2K A;  1E6V B;  2KFY A;  1LFW A;  4XPC A;  4C2M A;  1TMJ A;  1D1U A;  1SJQ A;  4XO0 A;  2F63 A;  4KO0 A;  3D4J A;  2IA6 A;  2VOO A;  2LMI A;  3QGG A;  3OQ2 A;  1XR6 A;  4RBT A;  1HI1 A;  4AYB D;  4MK8 A;  4RW8 B;  4ZCK A;  4DPT A;  4P7V A;  1VGY A;  4KGX B;  3TUI C;  3O5T B;  2IFX A;  4Z7Y A;  5EX0 A;  2RVJ A;  2KJV A;  5L1J A;  2IJR A;  3IMQ J;  2V4J A;  2BKO A;  1L3K A;  3I96 A;  2BDP A;  1J5O B;  3UD5 A;  4A46 A;  5C7P A;  1U1N A;  2YQ1 A;  3DLE A;  1HNZ F;  2VB6 A;  1B0P A;  5G0R A;  3Q8V A;  2ZUA A;  2WW4 A;  5C5J A;  5DET A;  1N33 J;  3KKF A;  5EUH A;  4KV8 A;  1YIT S;  2UV8 A;  5J2M A;  4WBF A;  3VF0 B;  3GJR B;  2FJD B;  2V2Z A;  4KH0 B;  1X9W A;  1Y3K A;  3C66 A;  3OUY B;  3BDE A;  2YH0 A;  5B08 A;  1PSD A;  4LF8 F;  2Q79 A;  1I5O B;  1UMJ A;  5DZ6 A;  3UQS A;  1WF2 A;  4P2F A;  4DV2 J;  4NLW A;  2HFS A;  2J7U A;  3UDC A;  4Q0B B;  4BDP A;  3HFZ B;  1SIW B;  2ASD A;  3J7Y U;  2Y0B B;  3PIO Q;  1RT2 A;  3L95 X;  3W64 A;  2I5J B;  1Q8B A;  5D4O A;  5LSO A;  1I51 B;  1FKA F;  4GKJ F;  2C3P A;  1X4E A;  3W2V A;  2K3I A;  2B7B B;  1O0P A;  1RA7 A;  2XI3 A;  3M8Q A;  1TKX B;  1RAF B;  4QWB A;  1RLD A;  5HK4 A;  4QYR A;  1MU2 A;  2OPR A;  1N6Q B;  1S1U B;  2MEW A;  4O3O A;  2J6U A;  4FVC A;  4NZ7 A;  4P71 A;  4USV A;  5B0A A;  3H8Y A;  2KZM A;  3JSY A;  3I31 A;  1S1W B;  3TJ8 A;  2ACM A;  1QD1 A;  1RTJ B;  3NOG A;  4DLG A;  2CVE A;  4KHR A;  1ZS6 A;  1SH2 A;  1S9G A;  4DBQ A;  4DQR A;  3PM9 A;  4JP8 A;  2NXN A;  3V4M A;  1WF0 A;  3EZO A;  5A8W A;  1VBK A;  4EO6 A;  1N54 B;  4IFY A;  2W2O P;  3OW2 R;  3NMR A;  1SXL A;  4K5R A;  2CZV C;  1C0T A;  1R43 A;  3DYA A;  3W8P A;  3MEE A;  4EBD A;  5D3G A;  3BSO A;  2Z2M A;  4M5M A;  3K8W A;  3DLK B;  3UN3 A;  3CJR A;  3DCA A;  4FF1 A;  4ZPW R;  4P52 A;  2HHH J;  5F9N A;  1HNI B;  4QR2 A;  2VFV A;  4DR7 J;  5M2U A;  3PV8 A;  4E8U A;  1IBL J;  4D3G A;  1KQF B;  4ELT A;  3OFG A;  2XNQ A;  2X51 A;  4O3Q A;  2CZ4 A;  2MY8 A;  4K0K J;  2JDJ A;  1LW0 A;  4OL8 A;  3US5 A;  1R8H A;  2KT3 A;  3BO3 A;  2ZDP A;  3MED A;  2IY5 B;  1JJC B;  2YKM A;  3R5J B;  2HVI A;  4PG8 A;  5A6P A;  4B3M J;  1U8S A;  3KNG A;  4A8O A;  1VQ6 S;  1Q8I A;  4C7Q A;  1XMQ J;  3T41 A;  4N8N A;  3G8Q A;  2D1C A;  5J1N A;  3SXL A;  1HD1 A;  1N8R T;  4PUO A;  1ZM2 A;  3JTN A;  1K0T A;  2C22 A;  3QLH B;  4B3O B;  2GJI A;  4F0K A;  1EJ7 L;  1TL4 A;  1UJ5 A;  1VK3 A;  1RAI B;  1LXJ A;  4AXJ A;  2HS3 A;  1HMV B;  3MUR P;  7FD1 A;  1DQA A;  3EM1 A;  4OQJ A;  1RQ0 A;  4ED5 A;  4KGK A;  3CJ3 A;  2YBV A;  5KT2 A;  3DC2 A;  1Q81 T;  2HLU A;  5DGB A;  4YP3 A;  1NZA A;  3OXG A;  3IP0 A;  4P2M A;  3POT A;  4K2X A;  3CMQ A;  5CAA A;  1GT8 A;  3W9J A;  5DG8 A;  3MCM A;  4DR1 J;  3RU0 A;  3F0N A;  1LEO A;  2RQK A;  3SQG A;  2IAJ A;  1XMO J;  3NAH A;  4C3M A;  3RAX A;  1DAR A;  3W9H A;  5J2Q B;  1TL1 A;  1RCO B;  3EDR B;  3GB0 A;  4L73 A;  1L3T A;  1F5B A;  3MUM P;  4LSL B;  1BWE A;  4E2F B;  2BZ2 A;  1ITP A;  3K7R A;  3SQO P;  2ZFH A;  5E0O A;  2MY7 A;  3HUL A;  1PYT A;  4NLV A;  2RIL A;  1Y5I B;  3SDE B;  4UY8 5;  4Q7A A;  2ERR A;  2WON B;  3AY0 A;  4OYZ A;  5LT5 A;  3AH6 A;  2BAN A;  4HH1 A;  2DGV A;  3ADA C;  2DIT A;  1FJG F;  2B51 A;  1VQ8 S;  3EVO A;  4CLT A;  3C14 B;  4QWE A;  3TUP A;  4USH A;  1HKA A;  4NEY A;  3KJF B;  2ZE2 B;  3CJS A;  4NML A;  3NMA A;  2HRY A;  4DLE A;  4X65 J;  2FTR A;  1EKR A;  3Q8Q B;  3IN5 A;  3TZZ A;  8AT1 B;  4I7F A;  1CUL A;  4HT7 A;  1YRU A;  3SIP B;  1RT4 B;  1FDB A;  1KOO A;  1H38 A;  2ZH2 A;  1NUE A;  3ZC4 A;  3R5D A;  4JI1 F;  3DHW C;  4GKK J;  1T9V A;  3T6B A;  2FGO A;  1ZPV A;  1OYE A;  4JV5 J;  4M5G A;  3WDO A;  2KHC A;  4GVL A;  4F4Y A;  1ZM3 A;  2W2M P;  4FNH A;  5KOW A;  2W9C B;  1NKE A;  1WKJ A;  2D74 B;  3DDN A;  3T1Y J;  4FF2 A;  1TKT B;  4B02 A;  4CLU A;  3I32 A;  5CCL A;  1HNV B;  5IWA F;  4JI6 J;  3HHN B;  2HBZ B;  2X1B A;  2AJ2 A;  4UZC A;  3CDB A;  1Q5Y A;  3C3L A;  4DHV A;  5KFC A;  2B9W A;  3THP A;  4HAC B;  3JAM U;  4LF1 A;  1DFD A;  5K5M A;  2R4F A;  1DQ8 A;  1TP7 A;  3WIV A;  5LMU J;  3MXH P;  4O4G B;  3Q0A A;  1XN9 A;  3B78 A;  7AT1 B;  2DHX A;  2J9D A;  4ZVH A;  1V3R A;  1UWB A;  2HIQ A;  1HA1 A;  3ZZZ A;  5GAG I;  3IWX A;  3JYT B;  1SJR A;  5HBM A;  5C2C A;  2NR0 A;  2FQQ B;  3PEH A;  4RNO A;  5I3U B;  2W8L A;  4WKY A;  4OYM A;  4OX9 J;  1VQO S;  3TWZ A;  4OI0 A;  5GVQ A;  2IMW P;  1E6Y A;  3FRZ A;  1T02 A;  3ILI A;  5A8K B;  3KG0 A;  4ZLP A;  1T11 A;  2GC8 A;  1YJU A;  1RT3 A;  5AE3 A;  3K59 A;  2OO4 A;  4TU9 A;  2HND B;  2GJF A;  2XYH B;  3PYF A;  2XMA A;  1U09 A;  1N33 F;  2W2N P;  4F3Q A;  1JLB B;  2C3O A;  3J81 Y;  3H90 A;  3CME S;  3W61 A;  1PG5 B;  2KZZ A;  4WF9 Q;  4K59 A;  2XY5 A;  4H4K A;  1RAO A;  3OL8 A;  5HRO A;  3HF5 A;  2HWT A;  4ZLJ A;  1ZAW A;  3H25 A;  2J0W A;  2YNF A;  3TJA A;  4NX9 A;  1TAU A;  1IBC B;  2HW3 A;  3V81 B;  4B9N A;  4CQ1 A;  2X3G A;  3GR1 A;  1VC6 A;  2PE8 A;  3PYD A;  4K4V A;  4DV2 F;  1RTH A;  2GHW A;  3R7B B;  3QT6 A;  1WEY A;  2XUL A;  4HH0 A;  3M8Z A;  1OPZ A;  1H2T Z;  1SC3 B;  1RWK B;  5A2Q Y;  4IDK A;  5KT3 A;  4KRW A;  3TRG A;  3TAN A;  3HSJ A;  3T1A A;  1HNW J;  3J7A N;  3QQC D;  2AJ0 A;  1PAE X;  3JQM A;  1M5S A;  1RZM A;  1ZA2 B;  4OZJ A;  3GJT B;  4YDD B;  3L09 A;  4ECS A;  4L74 A;  4PKD B;  1EET B;  4OI3 A;  1KS2 A;  2GAG C;  2LLZ A;  4DL4 A;  1R0B G;  2VFT A;  1ZYQ A;  4M5D B;  1TMM A;  3Q23 A;  1S0N A;  3CIZ A;  2BM0 A;  1S9E B;  3CF5 Q;  1UFW A;  4AL7 A;  3MFI A;  4ECZ A;  2RH3 A;  2IC3 A;  2ZJR Q;  1Q78 A;  4P7T A;  3LP0 B;  3A13 A;  1T8E A;  4XIU A;  3VQS A;  4NI2 B;  2HKE A;  3AQP A;  3W5Y A;  2DIS A;  3BR8 A;  1P1L A;  2HQG A;  3BYR A;  3NL0 A;  3TUZ C;  2GCF A;  1KTQ A;  4LSN A;  3DRY A;  2OTL S;  3MR7 A;  4NLY A;  3QSY B;  1HQU A;  4OYI A;  1RT5 B;  4FPI A;  3H42 A;  1FRI A;  3OTO F;  5BR8 J;  4V1A k;  1FTC A;  3V6J A;  3J7A 1;  2HHH F;  4FYV B;  4DR7 F;  4MFB B;  4H4M A;  1IBL F;  3IS9 B;  3PYG A;  4K0K F;  4TY8 B;  3CC7 S;  2B9E A;  2BKN A;  4F50 A;  3HVT B;  1AXQ A;  5AXM A;  2HRU A;  3A3O B;  3HZE A;  2QA4 G;  4J9Q A;  2CPZ A;  4DN0 A;  2VF3 A;  3T5K A;  4IG0 A;  3C16 A;  3K89 A;  3M30 B;  2KVQ E;  4B3M F;  3ET6 B;  2H65 B;  3QSI A;  3UCU P;  3QT5 A;  4PWU A;  1HD0 A;  3D66 A;  1XMQ F;  2OAU A;  4I68 A;  3EZU A;  3HFK A;  3M2R B;  4YB7 A;  2DNG A;  3T1H J;  3NS6 A;  1X5T A;  3MMC B;  1AA1 B;  2H9Z A;  1RWN B;  3CJ0 A;  3SCK E;  2R7S A;  2ZBC A;  4I6W A;  5DQH A;  3LWL A;  2AP6 A;  1HQ2 A;  3MCN A;  1KVJ A;  1URR A;  2OPP A;  1LWE A;  3FEX B;  3GQC A;  1WHW A;  3DU5 A;  2B0G A;  3HT0 A;  1KN6 A;  1D9D A;  1WEL A;  1MG7 A;  4QBU A;  2ZWO A;  2DB1 A;  1WHV A;  2M52 A;  2JX2 A;  2BRL A;  4J9V A;  5KFM A;  3JSM B;  3SCJ E;  2V8D A;  2FJA B;  3S6E A;  2DO0 A;  2GMJ A;  1ULR A;  3WX8 A;  1Q16 B;  3CJ4 A;  3P5B P;  1SH3 A;  4EYI B;  4CI0 B;  1GFW B;  4QR0 A;  1VDH A;  4M5H A;  3QWU A;  3L4B C;  2BBE A;  4DR1 F;  3T5J A;  2GA7 A;  1SKU B;  4BC7 A;  4A47 A;  3HP6 A;  1XMO F;  3A1Y G;  1ZZF A;  4KPY A;  4JV0 A;  4JI2 F;  2KG1 A;  3THT A;  2P5V A;  4DL6 A;  2RD5 C;  4F8R A;  1ZZN A;  5KFP A;  1FXL A;  2WOM A;  2Q6C A;  3ENV A;  4K4Z A;  2JL9 A;  3MOJ B;  4DJB A;  3KK1 B;  4NA3 A;  4CYU B;  2ZBI A;  3FZ2 A;  4KFB B;  1WTB A;  3MHY A;  3F56 A;  1PIE A;  4DX7 A;  2VDI A;  4W98 A;  2QA4 S;  3MPD A;  1CQN A;  1MRO B;  2LYV A;  2WSC C;  4RWX A;  1TR0 A;  1SJ1 A;  4JI7 F;  2EKY A;  2P9C A;  1VHI A;  1RCX B;  4TU7 A;  2DRA A;  4N8O A;  4LIR A;  3QJL A;  1ZAV A;  3IBW A;  1WC5 A;  4X65 F;  2AJ4 A;  4J91 A;  2CPJ A;  2Y1J A;  1SL0 A;  1HFE L;  4Y00 A;  1QUP A;  2QSF A;  3MEC B;  3PJX A;  5CZX A;  3CCU S;  5BYS A;  2PII A;  2M5Y A;  1S1V B;  2Y1I A;  4MKB A;  1RAE B;  3DLB A;  1F1B B;  1KBR A;  4GKK F;  3U1L A;  3H5Y A;  2FVR A;  2G1D A;  1RTI A;  2J8S A;  1JLE B;  2B4P A;  2XMV A;  3HHE A;  4JV5 F;  4LVN P;  3ZTQ A;  2AGQ A;  4YOE A;  2HRT A;  4TU8 A;  2CQ1 A;  2FZC B;  5EDW A;  3DRR A;  2CJK A;  1WEZ A;  4WFA Q;  3N6L A;  2EK6 A;  5E3C A;  1LWF A;  4NXN J;  1JLF A;  2QN6 B;  4JI6 F;  1L3S A;  1RAJ A;  2RQ4 A;  3CGI A;  5HLF B;  2QX0 A;  4C97 A;  3PAC A;  4MJK A;  3I4H X;  5M2R A;  2YWH A;  5GMK a;  1PBA A;  2HZA A;  4NLD A;  2VA2 A;  4CZC A;  4CTA A;  4ZVG A;  5LMU F;  4I2P B;  3H0P A;  2HPU A;  2NXJ A; 
#chains in the Genus database with same CATH homology
 2CAJ A;  1Q5Y A;  2BJ1 A;  3BKT A;  2NZC A;  2Y3Y A;  3LGH A;  1Q5V A;  2WVB A;  3PHT A;  2BJ3 A;  2PC6 A;  2WVC A;  2CAD A;  2F1F A;  2WVF A;  3BKF A;  2HZA A;  2CA9 A;  2BJ9 A;  2WVE A;  3OD2 A;  3BKU A;  2BJ8 A;  3QSI A;  2FGC A;  2HZV A;  2BJ7 A;  2WVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...