3PHTA

Crystal structure of h74a mutant of helicobacter pylori nikr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
115
Chain Sequence
IINGYSSRSELVRDMIREKLVEDNWAEDNPNDESKIAVLVVIYDAHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nickel-responsive regulator
publication title Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 29
structure length 115
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3phtA01
3LGHA 2F1FA 3BKTA 2HZVA 2FGCA 2WVFA 2WVBA 2WVEA 2WVCA 2BJ7A 1Q5YA 2CAJA 3QSIA 2CADA 3OD2A 2BJ9A 2BJ3A 2BJ1A 2BJ8A 2HZAA 3PHTA 3BKUA 2WVDA 2PC6A 1Q5VA 2CA9A 2NZCA 2Y3YA 3BKFA
chains in the Genus database with same CATH superfamily
1S9GA 4OYAA 1MU2B 3LANA 1R8BA 3TUIC 3DGPA 3V81A 1TKZB 3MXHP 1KLMB 3ZO7A 4ECUA 1JNZB 1QM9A 3EYZA 3CCWA 2QA2A 3MPDA 4NASA 3BYPA 3S7RA 1WI8A 3PNIA 5GAGI 3BN7A 2JLFA 5D4LA 2EEYA 1SJRA 3AH6A 5K8NA 4RBTA 1CQNA 2QO3A 3UWTA 2GC8A 3BV8A 3JYTB 4LFCJ 1OY6A 2LYVA 4JP8A 1YZ7A 3EPGA 1RHQB 4DQIA 3H7HB 5ETRA 4QBUA 3KK3B 3B4DA 3AODA 4DPXA 2VJVA 3R7SB 4OX7A 4H4MB 4DSFA 4ZJQA 4LR9A 1FDNA 2JH3A 1C0UB 2K1RB 3T19A 1NXIA 2V4JB 5I3QA 2X51A 2GAGC 4Q45A 1FTRA 4WXOA 4KPYA 3EGNA 3AFGA 4JV5F 5DDOC 5C24B 2H65B 5IC4B 1LWCA 1TL1A 1I6JA 2KYXA 5IQ6A 1C1BA 3I0SA 4CYUA 3GV8B 2NYIA 3DOKB 2UUCF 1HBOB 3BGOP 4E2FB 4WYLA 1N32F 4NCGA 1YHQS 2DXEA 2IDEA 4DSLA 4K4SA 4CZCA 2M8DB 1JLEB 2BM1A 1T05B 4I4BA 4WYWA 1N54B 4PYDA 4ZN3A 2KN4A 1BXNA 4JI6J 1TK0A 1WC3A 2ZDPA 4EMDA 1R0AB 3RZAA 4KIAA 2D69A 5AXKA 5HQ8A 4K4XA 3QGHA 2OMLA 2XYHB 1U4BA 2JFDA 2B9WA 4QW9A 2R7XA 4F2RA 4DR3J 2E7XA 3MUTP 4DG1B 1EARA 3RB6A 3GJSB 2LQJA 5KFYA 4J9SA 5FDLB 2Y0BB 1KVKA 3OTDA 2WZ1A 4J9QA 3OL6A 1SJ4P 5DG8A 1WF0A 3DU6A 4WK3A 2A2DA 4B9UA 1XJWB 3HFKA 4MTPA 2WK4A 3F73A 3LW5C 4OI4A 5DG9A 3IG1A 3T1HF 1T0TV 4EFAC 2EFVA 2RAQA 2J6SA 3BKUA 1NNDA 2YWFA 2MJUA 1FRKA 2HBQB 2Y3YA 3QJLA 4X4NA 2FC9A 1QSSA 4RW4A 1SCJB 3G71S 2Z2ZA 2IM1A 3IBWA 2EK6A 1MMLA 1L3UA 1AUSL 5DQIA 5KFSA 4P9SA 3J81U 1EB0A 1S1XA 3PRBA 2AYBA 5EDWA 2P5VA 1KQFB 1XMOJ 3N6NA 2QG9B 5I4MA 2BABA 1FK9B 3VZHA 2F8MA 3OW2R 5EX0A 3C19A 4YOEA 2WHOA 4HI1A 4BLGA 1WOPA 1OMSA 2QLXA 1FEEA 2ERRA 1NB7A 1Q5VA 3HM9A 1J2VA 3FRYA 1V5VA 2H3EB 2DKOB 1FVSA 4J90A 4ED3A 4EO8A 2NUHA 2I1RA 4AT1B 2WRMA 4QWCA 1FNXH 4FS2A 2WW4A 2OO4A 2IYIA 8ATCB 4UZBA 2P6TA 2ZBQA 5DGAA 4FF2A 4R0EA 1WDTA 5HROA 2QYGA 3ZXWA 1YSJA 2ROPA 1KQGB 3W8PA 3WDOA 3BKFA 2VG6B 2YXLA 2GCFA 4ERDA 3I5BA 1PBUA 2RDDA 1DJ0A 2E1AA 2EC2A 2BE9B 2V8VA 3AD7C 2X7IA 2UXBJ 1PIEA 4LRFA 1H2TZ 5AT1B 2JLGA 2XZWA 4ZP9A 4ILLA 4ZIVA 2D3OR 4F25A 1TL3B 3M1VA 1RT2A 4WKYA 4M5NA 1RADB 2YVSA 3JSRA 2EWHA 1IKVA 4OI3A 3PKMA 4DR7J 1RTIB 1WKKA 3MM8B 4ICLB 3HT0A 4C3LA 2B8PA 1JJ4A 4KV8B 2VUGA 3ISND 3EJMA 1X60A 4MK8A 2BUNA 3MPUB 1SJFA 4ECXA 4CLKA 3MR2A 2JHEA 3VALA 1N4LA 2GGPA 2CPFA 4KAIA 3AXKA 1SC3B 3SSRA 4PXCA 3MCMA 2IA0A 4O4RA 1UJ6A 2AEMA 2AX0A 2E9TA 3NXZA 1F9FA 4KFBB 3W5YA 2OHDA 2VOPA 1T3NA 2LEAA 2ASDA 1KWMA 3I96A 4HEA9 1G4CA 3CDBA 1NB2A 1TP7A 3W66A 3ZZOA 1N5TA 1DQ8A 2OPSA 4FDFA 4KC5A 5ETQA 3NGRA 4F67A 2CPHA 1OSDA 4LFAJ 2ILZA 1TAUA 1FX2A 4U95A 4OZ2A 4RW9A 4DX8H 5KFRA 3BQ0A 1PKUA 5LMUF 2BJ7A 2JLEA 1VDHA 3FBFA 3PHTA 1NM2A 3NCPA 1GH8A 2WCXA 6FDRA 4ES2A 3MUMP 2NYHA 2DPJA 3KNAA 4KT0C 2PEHA 3G86A 2UXCJ 3IA0A 2Q79A 4U7UK 1IR2A 4B08A 5B0AA 1CULA 2DH9A 4RO0A 3VWSA 3CCQS 2N7YA 5A2QU 4EO6A 4ZPWR 1TKTB 5C25A 3HULA 5A8RA 1HQUB 1CJTA 3PJ9A 1NK6A 5DO2A 4KJIA 4M1KA 2ACYA 2WVDA 2GIQA 2CDQA 1VQ4S 1RYSA 4ZPBA 2DHAA 2ZM6J 5CD4A 2Y8WA 3OUYA 1IVZA 3KWMA 3G6VA 4GKJJ 5KFWA 1S1VB 3TW0A 1RAFB 4JI2F 2E1RA 4GKKJ 4XO0A 3V6HA 2IDLA 2HQIA 2O5DA 1VQSA 1WG5A 3UN3A 3R9LA 2CQ1A 3M9MB 1XNRF 3LP0B 2V2VA 2IJNA 4I69A 2WONB 1DTQB 2PMHA 2CPEA 3OQ2A 4MIAA 1N34J 4QZVB 5ITHA 1XNQJ 3KMQA 1RTJA 1VQ5S 4RWXA 4DX5A 1K1SA 3MF5A 4NZ6A 2C3UA 1O6XA 3OD2A 3HZEA 4A8QA 1L3KA 4DL7A 5HMZA 4RBVA 2R7UA 4ZHRA 1VISA 3MR5A 4TQRA 1VCTA 3SQOP 1WF1A 2GA7A 4JYAJ 3N6MA 2G2ZA 4TNOA 1UWBA 4WPAA 2XY5A 1ZYQA 3AQOA 4F3QA 4ZK7M 4DF8A 1RAJA 1H2UX 2FZGB 5E3PA 2KFZA 1M1KT 1EX8A 4ECQA 5LT5A 1C1CA 4C97A 2HFNA 5D8HB 4MYTA 4L75A 4XDDA 4LIRA 1JLFB 2J8AA 5DZ7A 1FE0A 2RS8A 1WNEA 2GJ2A 4JBCA 1N0VC 1KD1T 1PJ6A 4PQUA 2H48B 1FCAA 3HI9A 4K7QA 1RB0A 5CD4H 3QQCD 4ED6A 2B51A 2AKWB 3FBBA 1Y7PA 1JMTA 5L9XA 1ZPWX 1JLQB 1X5OA 3LWLA 3RRGA 1HHSA 3H20A 1LV5A 3UVJA 1S9FA 2XS2A 3JQKA 3TA2A 3M6XA 5LL6d 4DR4F 1IKYB 4IOAQ 1NJXA 2IIHA 4YY3F 1FNOA 4QWDA 3M4XA 4B9SA 3M32A 4OLOA 1CQMA 1RTHB 4YHHJ 3NS5A 2OPQA 2FLNA 2H5JB 2WVFA 1FD2A 2J9DA 1WG4A 3KLGB 4S0MA 1NK9A 5HVGA 2VC0A 3CIZA 2C2EA 4HT7A 5LSOA 2MY8A 1DBDA 2GO8A 1TMMA 1Y00A 2HBRB 3RW6A 4B17A 4OV6A 4LRAA 2EG1A 1I51B 2P9CA 2VPZB 1RBLA 4OYBA 4NXMJ 3P49B 2CDRB 5CYJA 1TL7B 4H4OA 1JKHB 1FDBA 1FWLA 4JI4F 3KFWX 2ZBRA 3RGIA 2KO1A 5KT2A 3K5OA 3QIDA 4IOCQ 3W63A 3CJTA 5B0EA 1SPBP 3EVOA 2F4FA 3AD9C 3I56S 4YQWA 4WU2A 3NNAA 3UD5A 3O1LA 1FRHA 5D3GB 1U2CA 3RJMB 1XC9A 5ETOA 5J2NB 4NMLA 3KLFB 4ZVQB 2MY7A 4DUTA 3D1QA 1HBUB 1VOMA 1AT1B 4QW8A 1IKWA 4DV2J 1NH7A 1F3VA 2E29A 3BGRA 2JNJA 5KFPA 1AXQA 1KP6A 4E0DA 4OYIA 2V8GA 4GO5X 4OQJA 5F0WA 4C2MA 2YNGB 4E8UA 3F41A 1N5QA 3DOLA 4WP3A 3FSXA 2HHHF 2W9BA 2XB2D 5IC6B 3B54A 3RYLA 4LSZB 3L7OA 4OIXA 3A3PB 2G13A 1RHMB 2YKAA 2Z57B 2ZH2A 2NXEA 2HRYA 4KGZB 2HQDA 4NLTA 1S9EA 2RH3A 3H5XA 1JXEA 4H4KC 3DKDA 4PXBA 5IM0A 2HRUA 5KFQA 2F4VF 4Z2XA 2V5HG 3W2WB 1NJZA 3OFFA 4O4GA 3C6TA 4KH0B 1EP4B 3VF0B 5HO4A 2K7KA 3K57A 1HBNB 2OH2A 3CCLS 3CW2C 1LXNA 3MMCA 4JI3J 2HWHA 4A47A 3GB0A 2RUSA 3W61A 3KDOA 2FJXA 4NYOA 2CPXA 2V4QA 3VAMA 1BQXA 1Q86T 1P1LA 1F2GA 5ETSA 1GX6A 4N7TA 3B82A 1HI1A 5GMEA 1RT7B 3CSKA 2YNIA 2CQBA 2LXFA 2XC9A 4B9TA 1IM6A 1R6VA 4TQSA 2VASA 5KFCA 5HQLA 3DYAB 4IG3B 2ZFHA 1FRMA 4JV1A 4J7CA 2V8HA 2FJBB 1EAYC 1VBXA 3IXQA 2KM8B 4X4UA 4EZ9A 2DEIA 4EBDA 4F3MA 2FHJD 1FJGJ 3DRRA 4Y00A 4Y34A 2PI5A 3TR5A 3O8WA 2DNGA 2C2RA 1TELA 4RW6A 3QZ8A 2EW9A 4OJGA 3N0VA 2XZTB 2CJBA 2L9DA 2MQLA 4RX6A 2YH1A 1P8GA 5AE1A 1TTHB 3K5PA 2HVEA 3T3FA 3EVMA 1IUJA 1RJJA 4K5RA 1AZSB 1UPMB 1R6YA 1ZH5A 2ZNYA 2CQ4A 5D4PA 2HKEA 3UE2A 3H90A 4RPFA 2HQ3A 1RAOA 2HS4A 1FWPA 1O0PA 3JXOA 3SV4A 2DY1A 2CVEA 4TU7A 1RTZA 2F8EX 4LSNA 1IBLF 8AT1B 2KT2A 4TU9A 2EK1A 2VFUA 4JI1J 4RW7A 3RU0A 1NKBA 2GVDA 1YJNS 3L3CA 2CZ4A 4QR1A 3TEHB 1GXLA 4ENOA 3D0HE 4OZ3A 3FBCA 4N8NA 3QT5A 4P6QA 1CJUA 1Q8IA 2M88A 2OEKA 2HMIA 2RQKA 1B0TA 3RBZA 4DV5J 3KJVB 4G1PA 4RUAA 3RB3A 2CJQA 1Q8BA 1RI7A 4P2FA 1QAYA 1HD0A 1VRTA 3R7BB 4F4AA 1YKWA 4G65A 3A12A 5B0DA 3GV7B 2LDIA 2A10A 1YBTA 1CSJA 4XDCA 1TKXA 2C2NA 5DQGA 4JV0A 1IBKJ 2FHJA 4U6PA 3NMAA 2RILA 3K5LA 1VIOA 2F40A 3CJKB 1I3OB 1GTHA 3OTOF 4A8YA 2AWZA 3DLEA 5IV4A 4J9LA 4CLWA 3TA1A 3AJ2A 4J9NA 2ZJRQ 3ZTRA 2QL7B 5DDPC 4DV4J 3KK2A 2OLWA 4OZJA 4HDGA 5I3UA 3HSJA 3FMWA 1KR4A 4X64F 3DLGA 3E2EA 3DMJB 5DS7A 4W92B 5AXLA 1R89A 1U1LA 1V3SA 1Y10A 3BF4A 3R3TA 3MEGB 1F1BB 2HHXA 1J5OB 5J2MA 4N8OA 3NG8A 1GNKA 3CCSS 4LQ3A 1WHYA 2RQCA 2AU0A 2FLLA 1CPZA 1DURA 4WE1B 4KYZA 3T5KA 2XMVA 3IMQJ 3MR7A 3J7AN 1RKIA 2NCKL 5C5JA 2BE7D 3EMTA 1IM4A 3DLBA 4EI2A 2AYEA 5CYMA 2BEFA 1VRQC 2PGCA 3OXGA 4KO0A 5CYQA 4B9VA 1VLYA 4HACA 3IWNC 3QGIA 1KVIA 4F4WA 1H7XA 3IO1A 5L39A 5F8MA 1NZAA 3GJRB 3A8EA 4ZLNA 3RAMA 3ENQA 5HSPA 4B3RF 1URRA 2MQNA 4JI0J 4LQ9A 1X4CA 3CVKA 4RUBA 5IWAJ 3BKTA 2MEWA 3PCOB 1G2EA 2BW2A 4FYWB 2PT0A 3PW7A 2V34A 2QE5A 4J9OA 1EZZB 1RACB 2DPIA 2KTQA 4F36A 3BZQA 1UEUA 2W01A 3MMAA 3FQLA 4QR2A 2C2OB 4QIFA 4JI7J 1RTDA 3M8RA 1U6BA 3SFGA 2I6WA 1LW2A 2FVSA 1YJVA 1HPZB 1NH8A 2AJ4A 3VZIA 5F8LA 3ILOA 2I9SA 2XNRA 4WTYA 3DN9A 1TL4A 2DR8A 4ZP8A 4HR2A 1HBMA 4TLQA 3OSNA 5C42B 2G9OA 2OSQA 2B7BB 2IBOA 5BR8F 2EBGA 4P72A 2BXJA 2UP1A 2K3IA 1QY7A 5HLFA 3G82B 2GJIA 1XN9A 4C6AA 1P27B 1RGVA 2MZ1A 4N47A 5J2QA 3MM5B 4LF7J 2FGCA 1FJCA 2W24A 5H9FJ 1R43A 2FVQA 2QFIA 1HWIA 3KJQB 2FDNA 2LA6A 1YJ7A 2D9PA 2HK2A 1MSWD 2UU9J 3EX7B 1S10A 1KLNA 3V4IA 1U1PA 3C66A 1D0EA 3SI8A 4CLSA 2QX0A 4LF5J 2E44A 4M5GA 2JFKA 2QA4G 1WOSA 2DGOA 4DUYF 1VQ7S 3FKBA 2E66A 4DV6J 4NXNJ 2VFTA 3KLHA 4ZVGA 2G0JA 2DRBA 4ED0A 2PMWA 4LF8F 3PKYA 2CQPA 3MMBB 1XTZA 3T9NA 4X65F 2UUTA 2R7RA 4OFZA 3FCHA 2IC3B 2QYCA 2BA9A 1DQ9A 1N6QB 2XMUA 1RT4B 2YX4A 1TV6B 4L3NA 2B9EA 3QRQA 5K5MA 2WSEC 3SQGA 2AEFA 2RRAA 5U47A 1UP1A 1SJ1A 4Q44A 1SH3A 4WIIA 4IH5A 5F8HA 3HVWA 2ZKTA 3DC2A 3CUNA 3QBCA 1BWEA 4IDKB 3HHNB 5LSRA 2QSWA 2PA3A 4UQGA 4YB1P 2QRRA 4R5PB 4CLZA 3O2IA 4X62J 2GW8A 1NSQA 2IMWP 3DOMB 4FYDA 3LPYA 2PN6A 1MROB 3T6BA 3R27A 4I2PA 1H98A 3SXLA 2DR7A 1QDUB 2BQUA 4X66J 2ROGA 4YN3B 4YP3A 1FJEB 3TA0A 1VRUA 4ANDA 1ZPVA 9ATCB 3QJJA 3ZC4A 1N5SA 4NLQA 2OELA 4A8XA 5E41A 1T9YA 4P10A 3GILA 2Z8QA 2E5LF 3C16B 1IJEB 2HZAA 2V67A 4CLUA 1WC5A 2GAHC 2CA9A 4WFXA 3NCRA 1UKUA 1HQEA 4IYQA 2F5GA 4ECRA 2MKKA 1KKHA 1S12A 2QMUB 2YBVA 1RYRA 3BPSP 2VQFF 1Z4UA 4NI2B 1BHNA 4B02A 1N5YA 2HLTA 4RW8B 2AP6A 1M5KC 1D09B 3IR7B 1ZM2A 5EGYA 3CULA 4P2XA 3PRDA 2OUGA 4ZITA 1E6YB 1GTEA 5L8RC 3R1HA 3M2VA 2M5YA 1KDNA 4WP9A 1FDDA 4G1QA 5FLXY 1P1TA 4LR8A 4C11A 4PWUA 4NLVA 1FI4A 2CQ2A 4OX9F 4DN9A 5KG5A 3DI6B 1B4SA 5L1LA 1XMQJ 2Z56B 4DZ6A 2NREA 5HAOA 4MKVA 2X3GA 1EQ0A 1D1UA 1BQMB 4CLYA 3A8IA 3BH6B 2XO7A 4B3OA 3HVAA 3MWBA 2CKWA 2DR9A 3CD0A 1KS2A 3QIPB 1HI0P 1N33J 2PIIA 3Q2TC 2WOMB 3CMES 2FC8A 3R5GA 3D6MB 4M5DB 3EVWA 4HKQA 3QSIA 1T9VA 3W9JA 2R7OA 1U8SA 1J5EJ 3TO8A 2CXEA 1IBCB 3D2WA 1FKOA 2JRSA 2O66A 4A8FA 1SC6A 2DNPA 4FBUA 1T9UA 4A8SA 4FPRA 2CRLA 3OL8A 2W2QP 2WB1D 4NCBA 3LTOA 4Q2MA 2JJ4D 2IRYA 3KTQA 1UJ4A 1A9NB 1RAIB 4PG6A 3MURP 5D77A 4GVBB 3HVTB 1TL5A 4KR0B 4DJBA 4OHWA 4O44A 3CC4S 4PXEA 1DTTB 2MKSA 1UVIA 3HX9A 2ZKUA 1FK9A 3SDEA 3ITHA 4H54A 3AA8A 1KOHA 1REVA 4K4TA 2ZH7A 4IH6A 2CJ9A 3J80Y 1RT5A 3T9ZA 1U0HA 3KMSA 1VJWA 2LLZA 3QLHA 2H5EA 5IZHA 1N36J 1JLCB 1RAHB 2MDAA 4CO2A 4JI6F 3HD2A 1WKLA 3R2CJ 3IWLA 3PDNA 3NP5A 1RDRA 2CUYA 2QEXS 1LFPA 4LRDA 3WQPA 3GFYA 1U26A 1TMJA 5A0YB 4DPUA 4RKUC 2KG1A 4DR3F 2X1FA 4USIA 3JQMA 2ZH4A 1X4GA 3S8SA 2DITA 4JUZA 3FUYA 2JC1A 4ID5B 2DVIA 1R31A 2VG5B 1H0HB 3R5BA 4DQSA 4DCOB 1FWKA 4RUHA 2YKNA 1Q8KA 3HMJG 2ZH8A 5HI7A 1QE1A 4ZIWA 2IBKA 1YTYA 3H5YA 3CCJS 2GHWA 2FUG9 4CH1A 2YNFB 4K4WA 3MDFA 1UW4A 5CHCB 4ZVSB 4OZNA 4K4UA 3M2UB 4NA1A 3GIIA 4ZVHA 2VQEJ 4WIQA 1OS5A 4USHA 1NK5A 2XSJB 2AGQA 3GPAA 2LQ5A 1TZ0A 2UUAJ 1WKJA 4RWWA 1FFSB 4DR5F 4CI0B 3MTJA 2LVWA 2FPHX 4JI5F 4C3KA 4FF3A 1NPRA 2W4DA 4PZVA 1RA6A 3UDEA 3UCUP 2KH9A 2MSTA 1M90T 3Q0AA 2JWNA 2QGFB 3MEDB 4WK1A 5DETA 1S1UB 3I0RB 2BJ8A 2Y1RI 3UQSA 4ZOSA 3FEYB 2MB0B 4EYIB 4Z37A 5GMKa 3TOQA 1CLFA 1LWEA 1RLDA 2PA8D 3FFIB 4C3MA 3AOCA 4CNZA 2MZSA 2KRRA 3TAQA 1SI9A 1S1TB 1VQYA 4WFAQ 4RNMA 3RR8A 1HLWA 4RL1A 8RUCA 1DLOA 3M8QA 1WELA 3CJ2A 2J0QD 2MLYA 2N4CA 4CLFA 2BBEA 2XI2A 2AHOB 2N4DA 2GJFA 4DV1J 4FNIA 2ZHBA 1CJVB 1X31C 3PR4A 2BKPA 2NR0A 4EEYA 2BOPA 1KHVA 3ISZA 2CJAA 4DL4A 2PD1A 3OL9A 2BANA 2AJ2A 5KFMA 2NSCA 3QO9A 5AXNA 3ETOA 1S5ZA 2KL8A 1YWXA 5HVFA 3MAAA 2IMOA 3B4MA 2DXDA 3KJFB 4L76A 4CH7A 2VD3A 4C8NA 1SQFA 4F0MA 4DMZA 2HHQA 3R8YA 1S6PB 3CPWR 4HI2A 1T3OA 3HDSA 3CD6S 1RZMA 3Q8YA 3M7VA 2AD9A 1YJWS 4F4XA 4DR7F 5G0RA 3SFUA 4M5JA 5L9NA 3PW5A 1UWAA 3OFGA 4DX6A 3LP1A 4HLBA 4ECZA 1RWNB 5MLCV 2AW0A 4DR1J 2RRBA 1FRIA 4X4OA 5KAKA 4UY85 2HBYB 5B0BA 1RCOB 4A46A 2WVEA 1YI2S 3FC9A 4WP8A 2ZC4A 5GADI 4IH7A 1UFLA 2ASLA 3UDCA 3TANA 1NUEA 2GX8A 1Q78A 4FYVB 1XWLA 2HPUA 3OV7A 4WXWA 1WHXA 3GIKA 4URQU 2B9XA 5A8WA 4U7UD 5I42B 3RR7A 1CVJA 3K8VA 3BBBA 4P7TA 3FEXB 4B9MA 4BBYA 4ECSA 1RWUA 2BZ2A 4HHUA 5B08A 3Q23A 1JLBB 2A2CA 4UT4A 3PACA 2UV8G 4FVMA 4JV5J 3R1LA 5HMWA 1Y5LB 4KKOB 4C8MA 4NLSA 3C6UA 2DT9A 3L09A 2MQQA 4PXDA 2UUCJ 3I87A 3NS6A 2FB0A 4NCAA 2DRDA 4BC9A 3KG0A 1U7LA 1S0VA 5HMYA 5KFKA 3PO5A 1BWVA 2DBBA 1SUQB 4QYRA 4ZMMA 1FX4A 3EE3A 2H9ZA 1YJUA 2VG7A 3HD1A 2HS3A 3GG1A 3GG0A 2XNQA 3K5NA 3N4WA 1JXVA 1HNWF 2G2OA 2I38A 3F44A 3GCXP 4PUOA 4CM2A 1NDLA 4PG4A 2YWEA 1KBRA 2BW7A 1S9GB 3MMJA 2C2ZB 1W2BR 4OYXA 4FYYB 2B4VA 3DGPB 3V81B 2UVWA 4Y65A 3C14A 4K50A 1PAUB 3EICA 3P96A 4NA2A 4DV3J 3RB0A 5CZVA 4GKJF 3MD3A 3BSAA 1H38A 1CS4B 1KN6A 2I5JA 3C8YA 4O3OA 2HHTA 4CM0A 4GKKF 3T1HJ 4RLEA 3NAIA 5F9NA 3SZ2A 2ACMA 2H51B 4OV1A 2NPIA 1TL7A 2RE1A 2J0WA 3TQEA 1N34F 1U45A 1RU2A 3E01A 1GXUA 4KSEB 3H2LA 3V6DA 3QGPA 4ED1A 3PYEA 3HHLA 5KG3A 1MNEA 3R7NB 1HD1A 4LBHA 2YX1A 4CLPA 2YKOA 5AE3A 3TX8A 4JYAF 5DM7Q 2NSBA 2HLUA 4KGXB 1SQEA 1LWCB 3A4TA 2MTLA 1TL1B 4FXVA 3E51A 3PX4A 2AZ3A 3L9ZA 1C1BB 1NK7A 2A0FB 3I0SB 4FF1A 3OPKA 2E5IA 4DV0J 3ZTPA 4ES3A 1C0TA 1VFJA 3W65A 4NCGB 3KG1A 2M7SA 1T02A 2KJVA 3I5AA 2UVUA 2Z0GA 2CPDA 3R6LB 2XCAA 4EZ6A 3MM6A 4ELUA 2QZ8A 5IOLA 1C4AA 1CC7A 2ZITA 4IRKA 2AQ4A 2YNGA 1RWMB 2YKMA 4GO7X 2XO6A 2YWKA 2DK2A 2FLPA 1FXRA 2LFVA 4AXJA 4YB5A 3CTRA 5H9EJ 4AD6A 3FEZA 3OLBA 1F6TA 2J0XA 3J80U 2DNZA 3MFIA 1YLXA 2UVRA 2MSSA 3X1LB 3VTIA 4IR1A 1ELOA 4F7VA 1A7GE 4P74A 3N5BA 2ZNZA 2DH7A 4YHHF 2VB6A 2W7PA 4ECVA 1R0BG 1HYSA 1WD6A 3QSYB 1M0SA 5LXYA 2QL5B 2F9JA 3TWZA 4ZLLA 1L3VA 2X1AA 2YY3A 2BJ3A 5J1EA 3I9V9 4U96A 4URGA 4B3TJ 1UCNA 5JJBA 3IG1B 3VAFA 1AW0A 1GMWD 3H98A 2XMKA 3CDAA 4A8OA 2VONA 2P6SA 4NXMF 4IG0A 3UPFA 3TYTA 1EJ7L 3M9OB 2NUUG 3HT3A 4CTAA 1FHTA 4IOBA 3D66A 3QT7A 4RW4B 1S97A 2GZOA 4CNYA 2DNRA 3CDWA 1IJFB 1PC5A 1RE1B 3V2UC 3PRVA 5J2PA 1RT3A 2DCLA 2EVZA 1S1XB 3CCUS 5KFAA 1RWOB 1U1OA 3D28A 1HNZJ 3OL7A 1ACMB 3P8BB 1VQLS 1U47A 1U8WA 3SEOA 2AZ1A 3SCJE 1VJQA 1LXJA 3DXSX 5BYRA 2XGQA 3MHYA 4O0IA 1Q8LA 4KHRA 4ZPVR 1Z2ZA 5K20B 1RQ0A 1T8EA 3ADAC 2ADCA 1YJ9S 5KT7A 2JVOA 5LMUJ 3IN5A 2EBEA 4UOFA 3DLKA 3HSZA 3A3NB 4M8LA 4J37A 2UXDF 2LCWA 4M5KA 4FYXB 5HROB 2MZJA 3KHGA 1Y11A 3GP9A 3I32A 3M8PA 4AL7A 5KG1A 2ZBCA 1S79A 3PG9A 4CO4A 2B4UA 1WEYA 4QIGA 4DWIA 4R8UA 3J7Z5 1N52B 2V8PA 5LOQA 3KG4A 2FHOB 1F5BA 3AJDA 4A8KA 2LECA 3M1VB 1RT2B 4ILMA 1TFYA 3NBPA 2ZZMA 1VC6A 1G7CB 2IM2A 2IAJA 1IKVB 2MLZA 1ZA2B 2G1DA 4LJMA 4FN5A 3QWPA 2NZ4A 1S59A 4WZMA 2VBXA 4OMFG 3RBDA 3RTVA 2V50A 3PEJA 2RU3A 1F3FA 4NZ0A 4J9MA 3ZZRA 4JI2J 2RHQB 2YH0A 1S1WA 2L3MA 2BQ3A 2F1FA 3CCZA 1Q0NA 5L1KA 3SV3A 1X5TA 1XNRJ 4M5MA 5KFZA 3I82A 2GGPB 5ETKA 3ETMA 2RF2A 1Q82T 4NLUA 5AJ3F 1OPZA 3U1NA 2NZCA 2X1BA 7AT1B 4O3NA 2O01C 2KHCA 3CCRS 4ED2A 1D9FA 4EGLA 3EXCX 3MEEA 5KFNA 3MR3A 2GQQA 1RT1A 2HHPA 4JOUA 1WHWA 5BJRA 2DCUB 5B0CA 5E5NA 1HARA 1FT8A 2E7VA 2GHVC 1IBMJ 5LMNJ 4I7FB 4XPEA 4IUFA 1FJGF 2M4MA 2OPSB 4WJBA 3OJSA 2XGPA 3WX4A 3UW1A 1L3SA 1S7IA 2XI3A 3Q89A 5GVQA 3JSYA 2DGSA 2KVIA 4I6WA 3V4MA 2HVHA 3OFEA 1FRLA 3QGGA 3E3XA 2AT1B 2NLWA 4RW9B 1U49A 4LVOP 3DRYA 1LNQA 1T94A 4L6V3 4A8WA 2JEGA 1UVKA 3TZXA 2HFZA 3KLIB 3NCQA 1UL3A 1RABB 5D15A 1IR1A 4OJHA 1B7YB 4TU8A 2X3DA 2VU5A 2D3UA 1CULB 3CB4A 2R8IA 4MMOA 5DLGA 4QIWD 2MQ8A 2MHNA 1XERA 3GLJA 2V94A 4Q0BA 5E3AA 5C25B 4HYKA 3BSNA 5A8RB 1CJTB 1ZZNA 2D74B 3MOZA 4JI1F 4I2QA 1MG7A 4ZVFA 4IR9A 1H3DA 4OI6A 2VFRA 5FIIA 1UAWA 3SBMA 3D0IE 3MCSA 4J9PA 5GMDA 4LFBJ 2RSQA 4W98A 3I9ZA 2HQGA 4ED8A 4O0NA 2XS7A 9RUBA 2ZE2A 2ASJA 2HAIA 3VR1A 3I6PA 4K2XA 4LRBA 2XQCA 3I31A 3TP2A 4DR2F 4USVA 1F0XA 4PG8A 4ILRA 4QOTA 2KVQE 2V69A 1RTJB 2MQOA 4TY9A 4ATNA 1K0VA 2R8KA 3MZIA 1IBKF 1JQGA 4IFVA 4ZN1A 5IV3A 1HPZA 1KTQA 3K2YA 3CDUA 2CJKA 1UWBB 2A1BA 5E33A 1P9YA 4F02A 3MEKA 1WJ9A 1QUVA 5C42A 2VKZG 4FZVA 3EGZA 4C8LA 2DNHA 1S77D 3GSIA 3L7UA 1C1CB 2WW8A 1S4EA 2CJXB 3V6JA 2GO9A 5T7LA 3HLUA 4ZPCA 4Z7YA 4ELVA 5ETMA 4PQUB 4DU7A 1WSVA 4OJ1A 4LT6A 2D41A 3NGSA 3UI3A 4QYZK 2BX6A 4JI8J 3BGFA 3FNNA 2J6UA 3IP0A 1Q7YT 5A8KA 1VQKS 3UVJB 3PJXA 2XMTA 1TUVA 1NSAA 1XK8A 1SVDA 1ICEB 4YB7A 4WFBQ 1Y0HA 3EGVA 3M32B 1T95A 4DL0C 4IQMA 1GEHA 3CNQP 2F4VJ 3CC7S 2OPQB 2B6AA 3OVBA 2H4YB 2RVJA 4P2SA 2CADA 1U1QA 2DGWA 3O44A 2F3JA 4GC7A 3W2VA 3PM9A 4YDDB 1QTMA 3M2RA 4JI0F 2HNDA 3AOAA 4WFYA 4CRJA 2CJYB 4DFMA 5IWAF 3OR1A 4CO3A 3G2XA 4GMKA 3BSOA 1WACA 1U6FA 1JWWA 4BDPA 3VAHA 1U24A 4H4OB 4KGVB 1BQNA 4N5SA 1HMVA 2UUWA 3MPYA 2NXJA 3K0JA 3HP6A 1CJKA 1PYTA 3BM7A 3VGTA 1QSYA 4JI7F 2GVZA 3C15A 3FSYA 1HNXJ 4QPXA 1NPPA 2C3YA 2EXUA 3PIOQ 4F4ZA 5MAOA 5F8NA 1Q5YA 5D78A 2MYFA 3MM9A 5H9EK 2B5JA 2HNYB 1PCAA 4TY8A 3EZ5A 3I55S 2K8GA 6AT1B 3IS9A 3C2PA 3MCOA 1HNIA 3GE9A 1IKWB 4MKYA 3J7YU 2A18A 4KPCA 1LWFB 5HBMA 4LF7F 4B9LA 1K9MT 3BGRB 2DRAA 3QWUA 3KOAA 4WWSA 1CG2A 3HSDA 2ZWOA 2Q66A 2LMIA 3GIRA 1OWXA 1RWKB 2GV1A 2HZVA 2BR0A 1SV5A 3MOJB 1S76D 1GT8A 2W9BB 3BGUA 3S6EA 3G6ES 2N3OA 4EK2A 2AEJA 3M30A 3DDIA 3Q8RB 3TUPA 2GNKA 3VQTA 2DGUA 2EFGA 4ZVUB 4K5SA 4DV6F 3QATA 3KJNB 4NXNF 4EBEA 2EFPA 1S9EB 4X4QA 2HGNA 2NXNA 1B70B 4BHQA 5IM0B 1IBLJ 3TZZA 1ZS6A 2W8KA 2OP5A 5C2GA 4QU6A 3NOGA 1PYOB 4O4GB 3C6TB 2XLJA 4ALZA 1NPKA 1HKAA 2IVMA 2MZTA 4L73A 4N41A 3DLHA 2M8HA 2FD2A 4OI2A 3RAQA 1YRXA 3MMCB 1ZZFA 2YQ1A 3FGVA 3VVTA 2DHXA 2SXLA 5C7PA 3H59A 1PGZA 2W9CA 5K8OA 4DV7F 7FD1A 2HQFA 4CO1A 2HGLA 2VF3A 2GMJA 3MGJA 2HVIA 5L46A 3EGWB 2LQBA 1XR6A 5M2PA 2HYIB 3SCKE 3L4BC 4X62F 2YNIB 5K9FA 4TVAB 2WTFA 2C22A 4N77A 3NL0A 1F2HA 2FLOA 4Z7CA 3MPWA 3K5MA 5HANA 2F7VA 4DPTA 3IAM9 4F26A 1J27A 3OTOJ 3DRRB 4B3SJ 4ZVTB 4X66F 4LSLA 3POTA 2DNYA 4HHJA 4RNOA 4RW6B 4Q43A 2IJFA 1RU1A 4LF6J 3ENWA 3RBXA 4BC7A 1KONA 3DGVA 1U1KA 1U1NA 1XBWA 1YJRA 2A3JA 3PTWA 3GFZA 2K06A 1WDDA 5KFJA 2DYAA 3DNCA 3Q83A 3UD4P 4AXIA 2HFUA 2M9KA 4OX8A 4P2MA 3DU5A 5ETLA 5EX3A 3DHWC 1NMEB 4U8YA 2BQRA 3H40A 2D1CA 4HT5A 1BMQB 4U67Q 4YS2A 1N88A 4RW7B 2GVDB 3NWRA 3AD8C 2XMWA 1JLCA 1U2FA 3UCGA 3OBIA 4UQTA 1ULRA 5KFFA 3CT9A 4K8RA 2DGXA 4EUVA 1D8ZA 3TVZA 3F56A 4OYMA 2OPPA 4DFJA 1HW8A 1RBAA 2HHWA 4WFNQ 3ZNJ1 3W9HA 4MKBA 2VH7A 3R5DA 2KXFA 4LF1A 3D6TB 2LU1A 2DO0A 2DEJA 2P9EA 1TKXB 4LREA 3X3UA 2U1AA 4W4MA 1AUDA 3QNWB 3HPOA 3IRWP 2HBZB 4LR7A 3PW4A 3NLCA 2YNFA 3KKFA 2HG4A 3A3OB 3HHLC 3M2UA 2FYXA 4D3GA 2UVVA 5A6PA 3H25A 4LF9J 1NO8A 3PZPA 4PPDA 1VS3A 3DLEB 3ZFVA 1J5EF 2V9KA 2NQPA 1CC8A 2HW3A 4G1IA 3ZZUA 3UO0A 4MFBB 2CQHA 1ZOTA 2E5JA 4RU9A 4O3SA 3GYXB 3KK2B 5IXUA 2DNQA 3THPA 3VAJA 3IM9A 5I3UB 2IRXA 3BN4A 3DLGB 1K73T 4PEOA 2GQ2A 1LW0A 1MMNA 4NWBA 2VDHA 4RBUA 1FA0A 4CCHA 3IM8A 2ZOMA 1U6ZA 5J2MB 1UVNA 1WEXA 5A6WA 2RDJA 3SSQA 5IT0A 1HW9A 2E1PA 2COLA 1OJ4A 2R2RA 5HP1A 4M5LA 1WI6A 4ZCKA 5CYMB 4I67A 3LA0A 2V2KA 5LSLA 1ZM4A 2YTCA 5L1JA 2Z30B 4OX6A 4KO0B 5CYQB 4MKAA 4LUBA 4X65J 3T1YF 2VL1A 3OT9A 4HACB 3VGUA 1HHTP 3GFXA 2ROEA 5T14A 3SCIE 3UFCX 2RMLA 4LRCA 1GX5A 2MXYA 3KNGA 1QLNA 2YKPA 4C8YA 1ZAVA 2KDOA 3HCXA 3CJ3A 2B0GA 3BPDA 4RNNA 3MMAB 2FGOA 3V6KA 1RT6A 4V19J 4TYBA 3T5JA 4I0WA 1RTDB 2B4PA 3G87A 2WVCA 3O3LA 1LW2B 1PC4A 2VA3A 3MM7A 1N5VA 3AXMA 4CT8A 2VQEF 1HBMB 3RRKA 1K0TA 4DU8A 5DZ6A 4J9UE 3IR6B 2P8IA 2UUAF 5KFHA 4JB8B 5CZXA 2AGPA 1VBYA 5GAHI 3IC1A 4XIUA 2W1BA 4DHVA 5J2QB 5K8PA 2I0XA 2IFXA 3QRPA 4HL9A 2CG4A 4M5HA 1G1XA 4J91A 2JZ5A 3ICLA 3R6GB 4RNHA 2KI2A 4PKDB 5KOXA 3HSGA 1D9AA 3V4IB 2ZDOA 2ZVSA 3GFHA 5CXTA 2E5LJ 3W64A 1IWAA 2V63A 3LGMA 1WTBA 1KHWA 2FQQB 1AYEA 2M2BA 2ZUAA 1S48A 1SXLA 4ECYA 4ZPDA 2ABYA 2DIVA 5JVGQ 2HNZB 3KLHB 2VQFJ 4DV1F 3H42A 2V6AA 2GMLA 4DN0A 4KHPJ 5IT9Y 1MLAA 2OGUA 1E6VA 1NBEB 2PC6A 4MJKA 1M5HA 2HURA 3M8WA 3TVYA 2GIFA 4ID8A 4OZ1A 1M5OC 4M94A 3SQGB 2GS8A 2W2MP 2ZBIA 4PYAA 5E7OB 2F65A 1S57A 5GAHU 2KXNB 4CT9A 2NXCA 2FJVA 3GQCA 2B4OA 4G6VB 2IVFB 3THTA 5CQGA 4CLTA 4IRCA 4BCAA 2PI4A 2ATCB 3DRSA 1NKEA 2OPRA 3Q22A 2R42A 4XAKA 5CH7B 2R2TA 1TFWA 2KZZA 1Y3JA 2R8HA 2XLKA 1NHKL 2J7UA 1PG5B 3DLJA 2BKOA 3JTOA 1CS4A 3JSMA 2FJDB 1B99A 1NK8A 2W2NP 2FVCA 4DR1F 2N7CA 4ZP7A 3ZTOA 2V68A 3IAS9 2VIHA 3W5ZA 1JLAA 4NRTA 3MAHA 1X4HA 1XMBA 4I2PB 3IR5B 4PCQA 3JAMY 2L41A 1YX2A 3KK1A 1B3TA 1VRUB 3KLEB 1WC6A 5HATA 4LVNP 1SIZA 3NRBA 3D7SB 3KDNA 4AQYJ 1W2IA 5KFOA 3DM2A 4DR6F 1ZAXA 2DHGA 1Y5IB 5DLFA 2KHDA 1FFWB 5HVHA 4I56A 1SKWA 5D4NA 5KG2A 3LAMA 2XWYA 2BDPA 1HQEB 3FMBA 2OFGX 2H54B 4Q2LA 1FKPA 2XBPA 2YNHA 1EETB 4OHZA 1FKAF 1XIQA 3EWGA 2V9WA 1N5YB 4DQQA 3RB4A 3GWCA 1CEZA 4N76A 2B9YA 4RR5A 5G4DA 5HQMA 5CCMA 3C3LA 4PR6A 3OLAA 2H4WB 2DY9A 5GAGU 1R0CB 4BWMA 1OQ3A 1KNZA 3MPVA 2KXHA 4USUA 2AJ0A 2RIJA 3K7RA 1S6QA 3M2VB 4HVZA 4NL5A 1PJ7A 4G1QB 3QMQA 3CD7A 2RKIA 1HR0F 4C11B 3OXFA 4FPIA 5EWFA 4ZCLA 2EKNA 1MW7A 2N3LA 2R7SA 2JEFA 1T03A 4D3HA 4PG5A 3SIPB 2XLIA 1GMVA 1Q4RA 1FO1A 1P6TA 3CJRA 4B3OB 3PYGA 3MECA 3TUZC 2O3DA 4OYZA 1SL0A 5CAAA 2M52A 5IT4A 3NMRA 2QA1A 2RUGA 4DV3F 1EKRA 5F9LA 1H7WA 1WSRA 2G4BA 5J1PA 2LKZA 3THVA 2DNKA 4WZQA 3GU0A 2IHR1 3PEHA 1RA7A 3VVUA 4NLPA 2BRLA 2MKYA 3M6UA 2YX7A 4BWJA 3WZ0A 2IVYA 1FKOB 2DR6A 3ZZ0A 1T11A 2DTJA 3FCWA 4PWDB 3GV5B 2CQ0A 4DR5J 1M5SA 2ZH6A 3CC2S 5D0HA 4O3QA 4JI5J 4Y0FA 3VCDA 2Z2YB 4YR0A 1WG1A 3LAKA 5K14B 2C3MA 4O44B 4DS4A 3H2UB 2MGZA 1M5PC 4MT1A 4OYPA 4LF4J 2RNEA 4OI0A 3SDEB 1DRZA 2BJEA 3ITHB 3IRXA 4ZDNA 4TKTA 3Q8VA 3JB9k 1REVB 3MTKA 1Q1KA 4DV0F 3ET6A 3VAGA 3TARA 2Q6CA 1YVFA 1FTCA 1D3WA 1RT5B 1FRJA 1U0HB 2XHCA 2CQ3A 2K2PA 3CCTA 3M6VA 3N28A 2BE2A 3QZ7A 1R8AA 3QLHB 3MR6A 3ZZTA 3L95X 1EKSA 3HO1A 1IWGA 2R7VA 1V3ZA 4X4TA 2RHSB 3W5XA 4J9KA 4PAAA 2RD5C 3HFZB 2MQMA 3PR5B 2OKQA 4NOHA 1VQMS 3QJPA 5D0RA 2WBRA 1GMUA 1R3NA 2XMJA 4MK7A 4DZDA 2W25A 4OZ0A 4J9VA 5JVHQ 2UZAA 3NGTA 3LGNA 2QMXA 5M2RA 1Z2LA 1HNVA 1DHMA 3DRXA 2MKHA 3ZTSA 1HIYA 2APOA 4TXSA 2VHGA 3G8TA 1QAXA 3A8KA 1YIJS 2YKNB 5I3PA 2XY7A 5KFXA 1SQGA 1QE1B 2XHWA 4DUZJ 4IFYA 3H8YA 5DRKA 3CJQA 4B3TF 2XG8A 4OZ5A 3B6BA 3O5TB 2DJWA 3Q2SC 1WC0A 2C42A 4ZJOA 3FQKA 1TVRA 2R2UA 5D6GA 1RISA 2YWHA 1PILA 2EFNA 2OAUA 2Q6BA 4KH1B 5LJ5Y 1F60B 3HJFA 3TAMA 2C3OA 4EU0A 2BOAA 2GIRA 2B56A 2Q3PA 5KT5A 2E1MC 3OR2A 2OTJS 3LGHA 1M1GA 3M8ZA 3H5UA 3G9CA 2XM3A 2DNOA 1BD6A 1HWKA 4LBIA 5KG7A 1IQZA 1Q95G 1HNZF 3LQVA 4UOHA 1IKXA 1IR0A 4YDXA 3BJYA 2ADBA 3EPIA 3T5HA 4OJ3A 4OYOA 1SH2A 4QJVA 1S0MA 1LWEB 4K0KJ 2QV6A 4O3RA 4C0BA 4I7FA 3EDQB 1MU2A 2Y8YA 2EFQA 1K1QA 2AYGA 1TKZA 3AA9A 4USWA 1KLMA 2D7SA 5GAEI 2HIQA 4DS5A 1DLOB 3M8QB 2Z58B 2HIYA 5EHHA 4NLOA 2U2FA 4AL5A 4F3OA 1VQNS 4X84A 2FZCB 1VMBA 3JYTA 3KLIA 1T9WA 3TRGA 1RHRB 2HVZA 2RU9A 3OFHA 2E5GA 2MJNA 4KQZA 3KK3A 3A8JA 4U9RA 2DH8A 2BANB 3QO9B 1TUWA 1Q79A 1BLUA 4H4MA 3MAAB 1C0UA 1LKZA 3PV8A 2K1RA 2ZOFA 3BO3A 4FBTA 4F0KA 5IT9U 2V4JA 3HHKA 2LEPA 3FJ2A 4LBPA 1HNWJ 3FRZA 3CJ5A 2R7TA 1UMJA 3ZZPA 2ZWPA 5BYSA 2DGVA 5C24A 2AF6A 1QAIA 4FXWA 2H1YA 1F5AA 2ZOGA 4P52A 1OQ6A 5G0RB 1G6BA 2KYZA 3DOKA 4C8OA 1HBOA 1RHUB 4I68A 4MIBA 1URNA 5CABA 2HAFA 4NLGA 4A8MP 3LP1B 5KG0A 1EIYB 2MHEA 1JLEA 5GAEU 1T05A 2JVRA 3DLLQ 3AB4B 4PQAA 1I94J 3GMGA 1CBKA 4K59A 3DRPB 2IJRA 3ZZZA 2XS5A 1R0AA 5KFEA 3ISNC 2HFSA 3DFEA 3UN2A 2RQ4A 1BE4A 4OLPA 5A8WB 4UUWA 2UUBF 5KG4A 2ZH5A 4NLRA 1U1MA 2QSFA 4DG1A 4PG7A 1JJCB 3RUBL 5FDLA 1YQHA 1IBMF 5LMNF 2ZUGA 3JAMU 2B43A 4ZCMA 1UA0A 5CA5A 1X9WA 3CWJA 3WC0A 1X4FA 1X4AA 3NAHA 3UR3C 3C6UB 2K7JA 4ANEA 1XR5A 4K4VA 3D1HA 1R7IA 4F50A 4LFCF 1LFWA 4USMA 4XK8C 2ALYB 3WX8A 3K17A 1B0PA 1NDKA 3F0NA 4MH8A 2W2OP 1WTFA 2HWIA 2RB7A 4P75A 4KTQA 1V6HA 1NJIT 1AA1B 2VG7B 1VGYA 2Z2LA 4FKXA 4OZLA 1UETA 3JQJA 4GC6A 3PW0A 4PUOB 4YMEA 1VR6A 2PO4A 2KRBA 2JX2A 3VGSA 1X4EA 3LWMA 2VFSA 4WFZA 3C14B 1OO0B 4XPCA 2C2MB 1S6UA 1JLGB 3TAPA 1PYSB 4LFBF 3GZ7A 1NSKL 1TK5A 1RUSA 4B3MJ 2N82B 4AYBD 1OYEA 2IRUA 3BH7B 2I5JB 2KJWA 4ZPTR 2DR5A 2VPYB 4ZVEA 3ILJA 5KFIA 2CG8A 2AYMA 3ENVA 2CAJA 2PFDA 3AQPA 2CQDA 3LP2B 2GMHA 1MWYA 5HN0A 4Q8FA 2QLFB 3KLVA 2RQMA 3E01B 1NU4A 2WB4A 2VG6A 3E8OA 3RW7A 3VAIA 3OTCA 3V6DB 2FVPA 3GIMA 3HHLB 4F4KA 1NK0A 3FDSA 2BM0A 1X0PA 4DX7A 2RS2A 4ZS6A 3IBCB 1S0NA 1TL3A 3D3CJ 1OSCA 1YBAA 2QTWA 3T41A 1KEKA 2HNYA 1SKUB 1ZM3A 4KHMA 2POKA 4KB7A 2QIFA 4HHHA 1AB8A 3HKWA 1C0TB 1RTIA 2A6OA 4RNFA 3MM8A 3OTEA 3GJTB 4NRUA 1LWFA 4C8KA 4ICLA 1QD1A 5B0GA 3TNVA 2G0IA 2W8LA 2C28A 1RHJB 1WORA 3KUGA 1UJ5A 1WC1A 4KV8A 3TI0A 3MM6B 3CJ0A 4DSEA 3BBCA 2YWGA 2L9WA 1X5SA 2YKMB 5M2UA 2OTLS 3BO4A 2PMZD 2CZ9A 2UXDJ 2DIUA 2BJ9A 4JI8F 1UVLA 2F8HA 5FD1A 3GONA 5DQHA 1D8YA 5CCLA 4X4SA 3B8HA 4KFBA 4ETXA 3CE8A 4IQXA 1U09A 2KT5A 1REGX 1XMOF 3N5FA 4F8RA 2MMYA 1ROFA 4DF4A 1HYSB 1JJHA 1PJ5A 4RJVA 1FNMA 2J0SD 2FY8A 2JSXA 4P73A 2KZMA 4F2SA 5J1EB 1S7HA 5F0UA 1LEOA 1KTVA 2QT7A 3W1YC 1TKDA 4ECWA 3FZ2A 5KFLA 4K4YA 1SJ3P 1RKJA 1EQMA 5F3ZA 2P9GA 3K59A 2XULA 4CWBA 4IG0B 2ZJPQ 4DL5A 1B64A 2IPOB 4CTAB 2DO4A 2FHKA 2F9DA 1NLKL 5JUMA 3QAEA 2V2ZA 3GYNA 5AJ3J 2LP4A 3ZTQA 3CO0P 1F9HA 2IY5B 2UXBF 1VQ8S 5J2PB 1RT3B 4HH1A 3OSPA 1HNXF 1UVJA 1TKTA 5FJ4A 1RXOB 3LF0A 4LF2A 3D5MA 1RAEB 1HQUA 3SCLE 1QVFR 5D0EA 5RUBA 4NLYA 2Y1IA 3RG6A 4DFKA 1KSPA 1JK9B 1MN7A 1Y4ZB 5KOWA 3AOBA 2OMOA 3NGUA 5H9FK 4KE5A 5E3CA 2NPFA 1Q16B 4HTIA 4C9DA 4DCJB 1X0FA 4AUKA 1S1VA 2CIMA 1ITPA 4M63A 3D6FB 1HWJA 2CPJA 3UDLA 4DOZA 1RK8A 3NKYA 3DLKB 1Q81T 2D3ZA 3SSSA 3Q86A 5EWGA 3LP0A 3S1TA 1NCLA 3EDRB 4UOCA 2WONA 1DTQA 1FD8A 1VC0A 3N01A 3M8PB 3OJUA 4DQRA 2FIUA 1AFJA 3CF5Q 4R8UB 2J8SA 2V4RA 2ATLA 2A6MA 2CPIA 1PO6A 5ADZA 1DQAA 2X1GA 3BSCA 2L08A 2PFFB 1RBOB 1K8AT 3NBPB 3DDNA 3PFOA 2VKRA 2CNNB 2IAJB 4I6YA 4KRWA 3MUVP 4LFAF 1C2PA 3GCWP 1R8CA 3CCVS 3IWXA 3NGKA 1XEZA 1R8HA 1N32J 2R4FA 3G8QA 1JLFA 1GXTA 2YQ3A 1UEKA 2R8GA 3G6YA 1S1WB 5F8GA 2OFHX 1HL6A 5DDQC 2XSFA 2HRTA 2DNLA 2UXCF 2RF2B 1N0UA 4DR2J 1JLQA 2ZD1B 5D0GA 2XMAA 4ED7A 2VPXB 5HMXA 3MEEB 1IKYA 4FXDA 1RT1B 4UOGA 4USTA 3CD5A 4NYPA 5ETPA 1RTHA 3N9UC 2ZVIA 4ANCA 4PRFA 2ZBPA 4B3SF 2ZM6F 3KLGA 3LH2S 5FLXU 4ZKAA 4MFBA 4LF6F 4NA3A 3QYYA 3UCZP 1FXDA 4F04B 1X8DA 1X9MA 3ENAA 2B7CB 2DHSA 2MLXA 2V2QA 1QAJA 2DD8S 3M05A 5KFTA 4NZ7A 1JKHA 1NHVA 3HXMA 1QVGR 1XNQF 1Q7LB 2QJ3A 1S6OA 3L7PA 3M8YA 4E98A 4Y2CA 2W7AA 3NGDA 1MMDA 1YGYA 1YG0A 4Q0BB 1GAOA 1NHUA 1HWUA 1LK7A 4I2QB 1U2RA 5D3GA 4FP9A 4YR3A 3IBFB 5J2NA 2VV5A 4NLDA 3KLFA 4M5IA 3P5TL 1HBUA 4CYUB 5KFDA 1NJWA 3I4PA 1IQTA 2WVBA 4ZPAA 2HFVA 1UW9A 4YB6A 1EHWA 3U1MA 4ZA1A 1O51A 2RRNA 4OI1A 2AV5A 2O67A 4Y3CA 2ZE2B 3CXCR 5J1NA 3BEGB 2QA4S 3DHXA 4CQ1A 1X9SA 1I1GA 1N48A 3FK4A 4IFVB 2MZQA 1DARA 4FS1A 5EWEA 4LF9F 2HVDA 3ZNUA 3ILIA 3R5CA 2VC1A 2E9RX 1UFWA 3FVYA 3W2WA 5KFGA 3KHHA 3BREA 1Y3KA 2XYGB 3ELHA 5HL7Q 1EP4A 5A76A 3D54A 3NEKA 1HBNA 3VHQA 2VBZA 3AT1B 1O5JA 1LOUA 2VZ9A 1HA1A 2Y1LB 1RHKB 5T7LB 4UUXA 2DNMA 3PX6A 3LO3A 3G4SS 1YDLA 4WBFA 2HZCA 5KFBA 2RJZA 3AAWB 2HGMA 3OVSA 1UFKA 2UV8A 3QFHA 3K8WA 5HJYA 3PVXA 4ZVOB 3U7JA 2HHSA 2OI2A 1ZBTA 2HWTA 1G3OA 5A8KB 2FJAB 1RT7A 3ILLA 3EUNA 3G8SA 2VJUA 1GQEA 2XWXA 3GJQB 1TR0A 5D4OA 4QPTA 2QLWA 2J76E 1C4CA 2HNZA 5B7WA 3DYAA 1VC5A 4IG3A 5KTQA 2W4PA 2EC0A 2VPWB 4I1TA 2G2YA 3BGLA 5F3TA 4DSIA 2HS0A 2BMBA 4USJC 3CJ4A 3TZWA 5LJ3Y 4C7QA 3A1YG 2CPYA 1GFWB 2B6AB 2B8QA 3D1OA 2J9EA 4DV2F 3Q8PB 3W2VB 1A0OB 3KUEA 3HK2A 3NNHA 1Y5NB 3CCES 1FRXA 3M2RB 4X4RA 2HNDB 4JV2A 2G0CA 3B78A 3OR1B 4U8VA 3G96A 1ZTWA 1NRKA 4ES1A 5JXSA 3R5JB 4DV7J 1BQNB 3W8GA 3M8SA 1HMVB 2NXUA 2WSFC 1AZSA 1SL1A 4ITSA 1CJKB 4Q7AA 1ZTTA 2E9ZA 2QLJB 2OIHA 1VK3A 2GVZB 3C15B 1VI7A 4Y2KA 2PE8A 2L9NA 3ZZYA 4PPZA 4DLEA 1X4DA 2C3PA 3MM9B 3HFVA 2B5JB 1GMWA 2E7WA 1LK5A 3UNYA 4TY8B 1V5IB 3IS9B 1HNIB 2GQCA 4X2BA 2D3O1 4ECTA 2QFJA 4DDFA 5HBMB 4AE5A 2R7QA 3D4JA 3KLEA 1BY9A 4JI3F 2BJDA 1W7WA 4QIVA 3KJVA 3HVRA 4WKRA 3BB5A 2HQCA 2R7WA 1SC1B 5SZTA 2XEXA 1TAQA 1UVMA 4KGKA 1SL2A 2C2DA 4DL6A 1W26A 4DL3A 2LU2A 4K4ZA 1K44A 4TYAA 1SV5B 4Q5VA 4WU3A 4QQBA 2CZVC 4RU2A 4PWWA 3M30B 3DDKA 4USKA 4F4YA 3RRHA 3D0GE 4W90B 2YWWA 1EETA 1VBKA 2BJ1A 3BQ2A 4KHPF 1JIHA 2JOQA 4A4JA 3RBEA 3CIMA 3CJKA 4DXLA 2OJ3A 2ASYA 1FEHA 2VOOA 3TEGA 2DISA 2YPZA 1OY8A 1LWXA 2PEBA 3AB2B 2CPZA 4OHXA 4YR2A 3AHPA 3RAXA 4KY3A 1H6KX 1VLOA 4NMXA 4B9NA 4CLLA 2VBYA 1B7FA 2ZJQQ 3JS9A 4OHVA 3DMJA 5EN1A 2YPYA 3HHEA 2O1PA 3Q8SB 2W9CB 1PBAA 3SYZA 1S0OA 3MEGA 5E3QA 2BV3A 1J5OA 2ZC3A 3NOCA 2KG0A 2CWXA 4DPWA 4GVLA 1O8BA 1T7PA 2PSZA 2WBMA 5IS2A 1HWLA 4WE1A 3PW2A 1QJHA 3QAUA 5KFVA 3UDVA 1SIWB 2BYCA 2HSEB 3P5BP 5F41A 2EI5A 4L74A 4NX9A 3A13A 4DR4J 4YY3J 4CO0A 2DNNA 1WWHA 2AIRB 4IKAA 5JMNA 3NY0A 5KT4A 2DGTA 3K58A 2XYPB 1RAAB 3UR0A 2FJWA 1R27B 2W7OA 1SKRA 1RWPB 1UZDA 2EPIA 3SMZA 2Z2MA 4LSLB 1MWZA 3POTB 4DSJA 2JEIA 2XTJP 3OUYB 2OEMA 2CQIA 1H72C 2C1EB 3HHDA 4PWDA 3H5SA 4UF4A 2M0GB 4DV5F 4MAKA 3CCMS 3BDPA 4NEZA 3WBZA 3QFWA 2XMMA 3D3BJ 5IFMA 1DY3A 4AQYF 5K14A 4NYZA 4FKYA 3S01A 4JI4J 1FVQA 4PABA 4V19X 1OY9A 3MFHA 3Q8UA 1H2VZ 2QN6B 4ZLJA 4Y2AA 4ZHRB 2C2KB 1H73A 2IYGA 2JEJA 3CDEA 3KHRA 2LQ8A 4IO9Q 5KG6A 1YJTA 3WIVA 3KYLA 3PX0A 4U7CA 1S99A 3LALA 4NPOA 4DBQA 3K89A 1YK9A 2M3DA 3T1YJ 4DV4F 3P45B 1NEEA 3G82A 4F0HA 1F5CA 4ELTA 3MM5A 2OPPB 4NEYA 3V5RA 2OD4A 3R97A 1FF2A 2LDYA 1JJ2R 1X4BA 2VICA 3C46A 4UY8T 1RAGB 4CH0S 1KQSR 1UTAA 3TZYA 4YUDA 1SJQA 2HK3A 5IQQA 5HK4A 3D68A 3T1AA 4DLGA 2AJQA 3KXDA 4URSA 4OHYA 2HHHJ 3GTYX 2KFYA 1JNRB 2AX1A 3CMQA 3U1LA 4ED5A 2FJEB 3PYFA 4Y2IA 2MKIA 3CMAS 1NZ8A 4O23A 1Z1ZA 2XZDB 3J7YI 2DXFA 5E0OA 2ZHAA 3MMBA 2FY1A 4UW2A 1SKSA 2QC3A 5BXIA 3BYRA 1X7VA 2IC3A 3LOUA 2VDIA 1TU0B 2CQCA 1N6QA 3PFEA 4NE9C 1RT4A 2CNKB 2G1HA 3R2DJ 1TV6A 3W60A 3IGNA 1Q53A 3CO9A 2R8JA 1JB0C 4CP5A 2CVIA 4DFPA 1LW0B 2BACA 1UPPA 1SB6A 3PHEA 1T9TA 1HFEL 5EUHA 2M70A 4G3IA 1LQ9A 4M95A 4LF4F 1QSLA 2ALZA 4IDKA 4AFFA 1RSCA 3BR8A 3WC2A 4R5PA 4EBCA 4X4PA 4ZLPA 5HP1B 4C8ZA 1UZHA 2ZHOA 2CNLB 3I4HX 2W2PP 2DHHA 1QTNB 2LXUA 1WOOA 3DOMA 3PXGa 5KT3A 4DEZA 1MROA 2QL9B 2WAQD 3P6YC 2ZH1A 3TJ8A 4I6AA 4UZCA 4C98A 1NSPA 5H1SV 4R25A 4DSKA 1ZM9A 4OYWA 1AROP 4BS2A 4ZJLA 4XTTA 1KVJA 1U1RA 1TUGB 1W25A 4J9RA 1APSA 2RT3A 2UU9F 2J9CA 4DQPA 3TJAA 3JSBA 2H5IB 3DOLB 4GRSA 5SUHA 7FDRA 2QLBB 2LA4A 4QWAA 2VA2A 3C16A 4NLWA 3O6QA 4LF5F 4P71A 3PY8A 2IM0A 2V0NA 1RT6B 4DUZF 3G6XA 2R2SA 1KOOA 3TX0A 4KGMA 2MKCA 3TQ1A 4TLRA 2XY6A 1HI8A 4NI2A 3MM7B 1HQ2A 2AGOA 2CQGA 4NLXA 3OXLA 4RW8A 4WCEQ 3M9NB 3HZGA 3QPIA 2KB2A 3DRPA 3D6HB 1E6YA 3U02A 3MAQA 1K47A 1H74A 2D9OA 1RCXB 1OIAA 2CFXA 3MD1A 2ZZTA 3ONQA 3AY0A 4Q8EA 2GHPA 3NWGA 1A6LA 3GR0A 2VODA 2DGQA 2IM3A 3MI7X 3DI6A 5DDRC 1WUUA 4QWBA 3FZBA 1F9EB 4K0KF 1BQMA 3WIUA 2JL9A 3HHLD 4DR6J 1GK8A 1U0SA 3FCVA 2ZH9A 2KKHA 5K8MA 3EM1A 1B0VA 2Y0SD 1IN0A 3HF5A 1S4FA 4LIWA 2VBWA 3QIPA 2V8DA 2WOMA 3UN5A 2MPUA 1FDAA 1VQPS 2BRKA 4M5DA 1FXLA 2HEKA 3TJ9A 1E6VB 3J7A1 1TK8A 3JTPA 5DGBA 1SBRA 4IRDA 4LMZA 1RWWB 4O3PA 4CIOA 4EWTA 2MKJA 2MQPA 3VV2B 3OHBA 1YZ6A 3GR1A 3P3DA 2HHUA 3GIJA 1YRTA 1D9DA 5GADU 4X64J 1X5PA 1DAXA 3BR9A 1HR0J 5KFUA 2AJFE 5LM7E 4AL6A 5HJXA 6FD1A 2JC0A 4GVBA 4DI6A 3HVTA 1S72S 2DB1A 4EYHB 1DTTA 2Y1JA 2HHVA 5DG7A 3TVKA 2ZEJA 3UD3P 1PSDA 3DRSB 4ZCIA 2OPRB 3QT8A 2ILYA 2LXIA 2Q43A 3Q8QB 4C0HA 2BVZA 2AJ1A 1JLGA 3W9IA 4QYZJ 3EXYA 4ETZA 4LSNB 3EZOA 4WF9Q 4RUCA 3JSMB 3H0PA 4TN2A 2W4CA 5B09A 1I94F 1JLAB 4Y28C 2ZZNA 4WTOB 3LP2A 1M5VC 1JX4A 5DM6Q 3H2VE 1UEVA 1HHQA 3KK1B 1ZETA 1CJUB 2EKYA 1I5OB 2HMIB 2J6TA 4HH0A 5A0YA 4B3RJ 3MCNA 1N56A 1DZ5A 1XMQF 1PAEX 3GSDA 4I64A 4KBIA 4ID5A 1VBZA 3M6WA 3R5AA 1NDPA 1P9QC 3DM2B 3LUYA 1MN9A 1BUXA 1VRTB 2VG5A 2XCPA 4CO5A 5ETNA 3D9BA 1U25A 1N33F 3J7ZT 1YITS 1U02A 4DL2A 3I5CA 2Q1LA 1FKPB 1WHVA 2YNHB 1FERA 1FJ7A 1IXKA 4QU7A 3J81Y 2FZKB 2OEJA 2XSJA 2P2CB 3NNCA 1JXLA 2J5AA 2W9AA 3JTNA 5BR8J 2NS1B 1NJYA 1KFSA 3Q24A 3US5A 3U27A 4RZRA 4K2JA 1S6QB 4YEAA 1OPIA 2R9LA 1RWXB 3BO2A 3W3SA 2RKIB 5ETTA 4DPOA 2Z4PA 3T6JA 2Y9HA 3MEDA 1V9OA 4OL8A 1S1UA 2I8EA 2YQ0A 3I0RA 1T03B 3H4DA 4DPYA 1SC4B 2EFOA 4UTGA 4ZP6A 4V1Ak 1QUPA 3FFIA 1YBUA 2OSRA 4A48A 3MECB 2MZRA 4X4VA 5T41A 2OD6A 1S1TA 5ETVA 3BBFA 2E1CA 1AFIA 4DUYJ 4C4WA 4B3MF 5DJBA 2QMWA 1CJVA 1BGXT 1N36F 1U48A 2FHMA 4LF8J 4MYUA 4MIWA 3PIPQ 1ZA1B 3DXBA 2WSCC 4ED4A 2EG2A 3PO4A 3N79A 2RDIA 5KT6A 5AXMA 1FESA 2ZH3A 1WF2A 3VAKA 4H4KA 1UA1A 5E3RA 2BKNA 3D67A 4MK9A 2J9DE 3DCAA 4ER8A 1T9XA 1YRUA 2MGZB 1S6PA 2IA6A 1N8RT 1WEZA 4Y2MA 3VGVA 3IRXB 1BC6A 4FF4A 1RLCL 3BS9A 3CJSA 3ET6B 1NAQA 5F8IA 2E5HA 4N56A 1OYDA 3CEDA 4L72B 2BE2B 2KT3A 1R8PA 5LXRA 3W62A 4C0OC 1RWVB 1V3RA 3J81j 2GFFA 3FSIA 5AE2A 2PDAA 1MWQA 1KFDA 1VHIA 3OVAA 5HLFB 2FVRA 3QRRA 3T5LA 1VQ6S 2KM8C 4CDIA 1NDCA 3QT6A 2CWKA 1VQOS 4L3KA 3ULHA 4ZVPB 3GYGA 1VYAA 4FVCA 5I42A 2R3VA 4QWEA 3KHLA 4R0JA 5THWA 3P4UB 1M1HA 2L48A 2HFOA 5E2QA 1ZAWA 3PYDA 3W7BA 2KU7A 3HJVA 5C2CA 3IGVA 4YFUA 1HNVB 1JLBA 3BQ1A 1SH0A 1DFDA 2CNOB 2CYYA 3FBEA 2VFVA 2F63A 2JDJA 4J5OA 4IFYB 4IO1A 4KKOA 3H4BA 1NKCA 1L5UA 2K3KA 5BYQA 3OTBA 1FE4A 2I2YA 1KRPA 3EZUA 3N6LA 2AMCB 3TUJC 2YKQA 1FFGB 1TQLA 5B0FA 1NK4A 5A2QY 2KFNA 3CJ8A 3AJ1A 1WC4A 5F8JA 2J7KA 1XQIA 1TVRB 1L3TA 2FTRA 4C48A 1VQ9S 2B3TB 3KUHA 3PJWA 4P7VA 4DCPB 3BDEA 1VIXA 3TAMB 3OHAA 3NS7B 1KQKA 4FNHA 3IFEA 3LPEA 4QCLA 1SUQA 2ZD1A 4QR0A 3OR2B 4QIEA 2J7WA 1VK8A 1VHFA 1Y9OA 2LQ9A 4ZVRB 3UNGC 1KC8T 1S49A 1RP5A 2UUBJ 3WHIA 3HKZD 1XR7A 4OX9J 5L1IA 4HDHA 3CGIA 3VQSA 1IKXB 2LEBA 5L38A 4Y6IA 4HTJA
chains in the Genus database with same CATH topology
3LGHA 2F1FA 3BKTA 2HZVA 2FGCA 2WVFA 2WVBA 2WVEA 2WVCA 2BJ7A 1Q5YA 2CAJA 3QSIA 2CADA 3OD2A 2BJ9A 2BJ3A 2BJ1A 2BJ8A 2HZAA 3PHTA 3BKUA 2WVDA 2PC6A 1Q5VA 2CA9A 2NZCA 2Y3YA 3BKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGH A;  2F1F A;  3BKT A;  2HZV A;  2FGC A;  2WVF A;  2WVB A;  2WVE A;  2WVC A;  2BJ7 A;  1Q5Y A;  2CAJ A;  3QSI A;  2CAD A;  3OD2 A;  2BJ9 A;  2BJ3 A;  2BJ1 A;  2BJ8 A;  2HZA A;  3PHT A;  3BKU A;  2WVD A;  2PC6 A;  1Q5V A;  2CA9 A;  2NZC A;  2Y3Y A;  3BKF A; 
#chains in the Genus database with same CATH topology
 1S9G A;  4OYA A;  1MU2 B;  3LAN A;  1R8B A;  3TUI C;  3DGP A;  3V81 A;  1TKZ B;  3MXH P;  1KLM B;  3ZO7 A;  4ECU A;  1JNZ B;  1QM9 A;  3EYZ A;  3CCW A;  2QA2 A;  3MPD A;  4NAS A;  3BYP A;  3S7R A;  1WI8 A;  3PNI A;  5GAG I;  3BN7 A;  2JLF A;  5D4L A;  2EEY A;  1SJR A;  3AH6 A;  5K8N A;  4RBT A;  1CQN A;  2QO3 A;  3UWT A;  2GC8 A;  3BV8 A;  3JYT B;  4LFC J;  1OY6 A;  2LYV A;  4JP8 A;  1YZ7 A;  3EPG A;  1RHQ B;  4DQI A;  3H7H B;  5ETR A;  4QBU A;  3KK3 B;  3B4D A;  3AOD A;  4DPX A;  2VJV A;  3R7S B;  4OX7 A;  4H4M B;  4DSF A;  4ZJQ A;  4LR9 A;  1FDN A;  2JH3 A;  1C0U B;  2K1R B;  3T19 A;  1NXI A;  2V4J B;  5I3Q A;  2X51 A;  2GAG C;  4Q45 A;  1FTR A;  4WXO A;  4KPY A;  3EGN A;  3AFG A;  4JV5 F;  5DDO C;  5C24 B;  2H65 B;  5IC4 B;  1LWC A;  1TL1 A;  1I6J A;  2KYX A;  5IQ6 A;  1C1B A;  3I0S A;  4CYU A;  3GV8 B;  2NYI A;  3DOK B;  2UUC F;  1HBO B;  3BGO P;  4E2F B;  4WYL A;  1N32 F;  4NCG A;  1YHQ S;  2DXE A;  2IDE A;  4DSL A;  4K4S A;  4CZC A;  2M8D B;  1JLE B;  2BM1 A;  1T05 B;  4I4B A;  4WYW A;  1N54 B;  4PYD A;  4ZN3 A;  2KN4 A;  1BXN A;  4JI6 J;  1TK0 A;  1WC3 A;  2ZDP A;  4EMD A;  1R0A B;  3RZA A;  4KIA A;  2D69 A;  5AXK A;  5HQ8 A;  4K4X A;  3QGH A;  2OML A;  2XYH B;  1U4B A;  2JFD A;  2B9W A;  4QW9 A;  2R7X A;  4F2R A;  4DR3 J;  2E7X A;  3MUT P;  4DG1 B;  1EAR A;  3RB6 A;  3GJS B;  2LQJ A;  5KFY A;  4J9S A;  5FDL B;  2Y0B B;  1KVK A;  3OTD A;  2WZ1 A;  4J9Q A;  3OL6 A;  1SJ4 P;  5DG8 A;  1WF0 A;  3DU6 A;  4WK3 A;  2A2D A;  4B9U A;  1XJW B;  3HFK A;  4MTP A;  2WK4 A;  3F73 A;  3LW5 C;  4OI4 A;  5DG9 A;  3IG1 A;  3T1H F;  1T0T V;  4EFA C;  2EFV A;  2RAQ A;  2J6S A;  3BKU A;  1NND A;  2YWF A;  2MJU A;  1FRK A;  2HBQ B;  2Y3Y A;  3QJL A;  4X4N A;  2FC9 A;  1QSS A;  4RW4 A;  1SCJ B;  3G71 S;  2Z2Z A;  2IM1 A;  3IBW A;  2EK6 A;  1MML A;  1L3U A;  1AUS L;  5DQI A;  5KFS A;  4P9S A;  3J81 U;  1EB0 A;  1S1X A;  3PRB A;  2AYB A;  5EDW A;  2P5V A;  1KQF B;  1XMO J;  3N6N A;  2QG9 B;  5I4M A;  2BAB A;  1FK9 B;  3VZH A;  2F8M A;  3OW2 R;  5EX0 A;  3C19 A;  4YOE A;  2WHO A;  4HI1 A;  4BLG A;  1WOP A;  1OMS A;  2QLX A;  1FEE A;  2ERR A;  1NB7 A;  1Q5V A;  3HM9 A;  1J2V A;  3FRY A;  1V5V A;  2H3E B;  2DKO B;  1FVS A;  4J90 A;  4ED3 A;  4EO8 A;  2NUH A;  2I1R A;  4AT1 B;  2WRM A;  4QWC A;  1FNX H;  4FS2 A;  2WW4 A;  2OO4 A;  2IYI A;  8ATC B;  4UZB A;  2P6T A;  2ZBQ A;  5DGA A;  4FF2 A;  4R0E A;  1WDT A;  5HRO A;  2QYG A;  3ZXW A;  1YSJ A;  2ROP A;  1KQG B;  3W8P A;  3WDO A;  3BKF A;  2VG6 B;  2YXL A;  2GCF A;  4ERD A;  3I5B A;  1PBU A;  2RDD A;  1DJ0 A;  2E1A A;  2EC2 A;  2BE9 B;  2V8V A;  3AD7 C;  2X7I A;  2UXB J;  1PIE A;  4LRF A;  1H2T Z;  5AT1 B;  2JLG A;  2XZW A;  4ZP9 A;  4ILL A;  4ZIV A;  2D3O R;  4F25 A;  1TL3 B;  3M1V A;  1RT2 A;  4WKY A;  4M5N A;  1RAD B;  2YVS A;  3JSR A;  2EWH A;  1IKV A;  4OI3 A;  3PKM A;  4DR7 J;  1RTI B;  1WKK A;  3MM8 B;  4ICL B;  3HT0 A;  4C3L A;  2B8P A;  1JJ4 A;  4KV8 B;  2VUG A;  3ISN D;  3EJM A;  1X60 A;  4MK8 A;  2BUN A;  3MPU B;  1SJF A;  4ECX A;  4CLK A;  3MR2 A;  2JHE A;  3VAL A;  1N4L A;  2GGP A;  2CPF A;  4KAI A;  3AXK A;  1SC3 B;  3SSR A;  4PXC A;  3MCM A;  2IA0 A;  4O4R A;  1UJ6 A;  2AEM A;  2AX0 A;  2E9T A;  3NXZ A;  1F9F A;  4KFB B;  3W5Y A;  2OHD A;  2VOP A;  1T3N A;  2LEA A;  2ASD A;  1KWM A;  3I96 A;  4HEA 9;  1G4C A;  3CDB A;  1NB2 A;  1TP7 A;  3W66 A;  3ZZO A;  1N5T A;  1DQ8 A;  2OPS A;  4FDF A;  4KC5 A;  5ETQ A;  3NGR A;  4F67 A;  2CPH A;  1OSD A;  4LFA J;  2ILZ A;  1TAU A;  1FX2 A;  4U95 A;  4OZ2 A;  4RW9 A;  4DX8 H;  5KFR A;  3BQ0 A;  1PKU A;  5LMU F;  2BJ7 A;  2JLE A;  1VDH A;  3FBF A;  3PHT A;  1NM2 A;  3NCP A;  1GH8 A;  2WCX A;  6FDR A;  4ES2 A;  3MUM P;  2NYH A;  2DPJ A;  3KNA A;  4KT0 C;  2PEH A;  3G86 A;  2UXC J;  3IA0 A;  2Q79 A;  4U7U K;  1IR2 A;  4B08 A;  5B0A A;  1CUL A;  2DH9 A;  4RO0 A;  3VWS A;  3CCQ S;  2N7Y A;  5A2Q U;  4EO6 A;  4ZPW R;  1TKT B;  5C25 A;  3HUL A;  5A8R A;  1HQU B;  1CJT A;  3PJ9 A;  1NK6 A;  5DO2 A;  4KJI A;  4M1K A;  2ACY A;  2WVD A;  2GIQ A;  2CDQ A;  1VQ4 S;  1RYS A;  4ZPB A;  2DHA A;  2ZM6 J;  5CD4 A;  2Y8W A;  3OUY A;  1IVZ A;  3KWM A;  3G6V A;  4GKJ J;  5KFW A;  1S1V B;  3TW0 A;  1RAF B;  4JI2 F;  2E1R A;  4GKK J;  4XO0 A;  3V6H A;  2IDL A;  2HQI A;  2O5D A;  1VQS A;  1WG5 A;  3UN3 A;  3R9L A;  2CQ1 A;  3M9M B;  1XNR F;  3LP0 B;  2V2V A;  2IJN A;  4I69 A;  2WON B;  1DTQ B;  2PMH A;  2CPE A;  3OQ2 A;  4MIA A;  1N34 J;  4QZV B;  5ITH A;  1XNQ J;  3KMQ A;  1RTJ A;  1VQ5 S;  4RWX A;  4DX5 A;  1K1S A;  3MF5 A;  4NZ6 A;  2C3U A;  1O6X A;  3OD2 A;  3HZE A;  4A8Q A;  1L3K A;  4DL7 A;  5HMZ A;  4RBV A;  2R7U A;  4ZHR A;  1VIS A;  3MR5 A;  4TQR A;  1VCT A;  3SQO P;  1WF1 A;  2GA7 A;  4JYA J;  3N6M A;  2G2Z A;  4TNO A;  1UWB A;  4WPA A;  2XY5 A;  1ZYQ A;  3AQO A;  4F3Q A;  4ZK7 M;  4DF8 A;  1RAJ A;  1H2U X;  2FZG B;  5E3P A;  2KFZ A;  1M1K T;  1EX8 A;  4ECQ A;  5LT5 A;  1C1C A;  4C97 A;  2HFN A;  5D8H B;  4MYT A;  4L75 A;  4XDD A;  4LIR A;  1JLF B;  2J8A A;  5DZ7 A;  1FE0 A;  2RS8 A;  1WNE A;  2GJ2 A;  4JBC A;  1N0V C;  1KD1 T;  1PJ6 A;  4PQU A;  2H48 B;  1FCA A;  3HI9 A;  4K7Q A;  1RB0 A;  5CD4 H;  3QQC D;  4ED6 A;  2B51 A;  2AKW B;  3FBB A;  1Y7P A;  1JMT A;  5L9X A;  1ZPW X;  1JLQ B;  1X5O A;  3LWL A;  3RRG A;  1HHS A;  3H20 A;  1LV5 A;  3UVJ A;  1S9F A;  2XS2 A;  3JQK A;  3TA2 A;  3M6X A;  5LL6 d;  4DR4 F;  1IKY B;  4IOA Q;  1NJX A;  2IIH A;  4YY3 F;  1FNO A;  4QWD A;  3M4X A;  4B9S A;  3M32 A;  4OLO A;  1CQM A;  1RTH B;  4YHH J;  3NS5 A;  2OPQ A;  2FLN A;  2H5J B;  2WVF A;  1FD2 A;  2J9D A;  1WG4 A;  3KLG B;  4S0M A;  1NK9 A;  5HVG A;  2VC0 A;  3CIZ A;  2C2E A;  4HT7 A;  5LSO A;  2MY8 A;  1DBD A;  2GO8 A;  1TMM A;  1Y00 A;  2HBR B;  3RW6 A;  4B17 A;  4OV6 A;  4LRA A;  2EG1 A;  1I51 B;  2P9C A;  2VPZ B;  1RBL A;  4OYB A;  4NXM J;  3P49 B;  2CDR B;  5CYJ A;  1TL7 B;  4H4O A;  1JKH B;  1FDB A;  1FWL A;  4JI4 F;  3KFW X;  2ZBR A;  3RGI A;  2KO1 A;  5KT2 A;  3K5O A;  3QID A;  4IOC Q;  3W63 A;  3CJT A;  5B0E A;  1SPB P;  3EVO A;  2F4F A;  3AD9 C;  3I56 S;  4YQW A;  4WU2 A;  3NNA A;  3UD5 A;  3O1L A;  1FRH A;  5D3G B;  1U2C A;  3RJM B;  1XC9 A;  5ETO A;  5J2N B;  4NML A;  3KLF B;  4ZVQ B;  2MY7 A;  4DUT A;  3D1Q A;  1HBU B;  1VOM A;  1AT1 B;  4QW8 A;  1IKW A;  4DV2 J;  1NH7 A;  1F3V A;  2E29 A;  3BGR A;  2JNJ A;  5KFP A;  1AXQ A;  1KP6 A;  4E0D A;  4OYI A;  2V8G A;  4GO5 X;  4OQJ A;  5F0W A;  4C2M A;  2YNG B;  4E8U A;  3F41 A;  1N5Q A;  3DOL A;  4WP3 A;  3FSX A;  2HHH F;  2W9B A;  2XB2 D;  5IC6 B;  3B54 A;  3RYL A;  4LSZ B;  3L7O A;  4OIX A;  3A3P B;  2G13 A;  1RHM B;  2YKA A;  2Z57 B;  2ZH2 A;  2NXE A;  2HRY A;  4KGZ B;  2HQD A;  4NLT A;  1S9E A;  2RH3 A;  3H5X A;  1JXE A;  4H4K C;  3DKD A;  4PXB A;  5IM0 A;  2HRU A;  5KFQ A;  2F4V F;  4Z2X A;  2V5H G;  3W2W B;  1NJZ A;  3OFF A;  4O4G A;  3C6T A;  4KH0 B;  1EP4 B;  3VF0 B;  5HO4 A;  2K7K A;  3K57 A;  1HBN B;  2OH2 A;  3CCL S;  3CW2 C;  1LXN A;  3MMC A;  4JI3 J;  2HWH A;  4A47 A;  3GB0 A;  2RUS A;  3W61 A;  3KDO A;  2FJX A;  4NYO A;  2CPX A;  2V4Q A;  3VAM A;  1BQX A;  1Q86 T;  1P1L A;  1F2G A;  5ETS A;  1GX6 A;  4N7T A;  3B82 A;  1HI1 A;  5GME A;  1RT7 B;  3CSK A;  2YNI A;  2CQB A;  2LXF A;  2XC9 A;  4B9T A;  1IM6 A;  1R6V A;  4TQS A;  2VAS A;  5KFC A;  5HQL A;  3DYA B;  4IG3 B;  2ZFH A;  1FRM A;  4JV1 A;  4J7C A;  2V8H A;  2FJB B;  1EAY C;  1VBX A;  3IXQ A;  2KM8 B;  4X4U A;  4EZ9 A;  2DEI A;  4EBD A;  4F3M A;  2FHJ D;  1FJG J;  3DRR A;  4Y00 A;  4Y34 A;  2PI5 A;  3TR5 A;  3O8W A;  2DNG A;  2C2R A;  1TEL A;  4RW6 A;  3QZ8 A;  2EW9 A;  4OJG A;  3N0V A;  2XZT B;  2CJB A;  2L9D A;  2MQL A;  4RX6 A;  2YH1 A;  1P8G A;  5AE1 A;  1TTH B;  3K5P A;  2HVE A;  3T3F A;  3EVM A;  1IUJ A;  1RJJ A;  4K5R A;  1AZS B;  1UPM B;  1R6Y A;  1ZH5 A;  2ZNY A;  2CQ4 A;  5D4P A;  2HKE A;  3UE2 A;  3H90 A;  4RPF A;  2HQ3 A;  1RAO A;  2HS4 A;  1FWP A;  1O0P A;  3JXO A;  3SV4 A;  2DY1 A;  2CVE A;  4TU7 A;  1RTZ A;  2F8E X;  4LSN A;  1IBL F;  8AT1 B;  2KT2 A;  4TU9 A;  2EK1 A;  2VFU A;  4JI1 J;  4RW7 A;  3RU0 A;  1NKB A;  2GVD A;  1YJN S;  3L3C A;  2CZ4 A;  4QR1 A;  3TEH B;  1GXL A;  4ENO A;  3D0H E;  4OZ3 A;  3FBC A;  4N8N A;  3QT5 A;  4P6Q A;  1CJU A;  1Q8I A;  2M88 A;  2OEK A;  2HMI A;  2RQK A;  1B0T A;  3RBZ A;  4DV5 J;  3KJV B;  4G1P A;  4RUA A;  3RB3 A;  2CJQ A;  1Q8B A;  1RI7 A;  4P2F A;  1QAY A;  1HD0 A;  1VRT A;  3R7B B;  4F4A A;  1YKW A;  4G65 A;  3A12 A;  5B0D A;  3GV7 B;  2LDI A;  2A10 A;  1YBT A;  1CSJ A;  4XDC A;  1TKX A;  2C2N A;  5DQG A;  4JV0 A;  1IBK J;  2FHJ A;  4U6P A;  3NMA A;  2RIL A;  3K5L A;  1VIO A;  2F40 A;  3CJK B;  1I3O B;  1GTH A;  3OTO F;  4A8Y A;  2AWZ A;  3DLE A;  5IV4 A;  4J9L A;  4CLW A;  3TA1 A;  3AJ2 A;  4J9N A;  2ZJR Q;  3ZTR A;  2QL7 B;  5DDP C;  4DV4 J;  3KK2 A;  2OLW A;  4OZJ A;  4HDG A;  5I3U A;  3HSJ A;  3FMW A;  1KR4 A;  4X64 F;  3DLG A;  3E2E A;  3DMJ B;  5DS7 A;  4W92 B;  5AXL A;  1R89 A;  1U1L A;  1V3S A;  1Y10 A;  3BF4 A;  3R3T A;  3MEG B;  1F1B B;  2HHX A;  1J5O B;  5J2M A;  4N8O A;  3NG8 A;  1GNK A;  3CCS S;  4LQ3 A;  1WHY A;  2RQC A;  2AU0 A;  2FLL A;  1CPZ A;  1DUR A;  4WE1 B;  4KYZ A;  3T5K A;  2XMV A;  3IMQ J;  3MR7 A;  3J7A N;  1RKI A;  2NCK L;  5C5J A;  2BE7 D;  3EMT A;  1IM4 A;  3DLB A;  4EI2 A;  2AYE A;  5CYM A;  2BEF A;  1VRQ C;  2PGC A;  3OXG A;  4KO0 A;  5CYQ A;  4B9V A;  1VLY A;  4HAC A;  3IWN C;  3QGI A;  1KVI A;  4F4W A;  1H7X A;  3IO1 A;  5L39 A;  5F8M A;  1NZA A;  3GJR B;  3A8E A;  4ZLN A;  3RAM A;  3ENQ A;  5HSP A;  4B3R F;  1URR A;  2MQN A;  4JI0 J;  4LQ9 A;  1X4C A;  3CVK A;  4RUB A;  5IWA J;  3BKT A;  2MEW A;  3PCO B;  1G2E A;  2BW2 A;  4FYW B;  2PT0 A;  3PW7 A;  2V34 A;  2QE5 A;  4J9O A;  1EZZ B;  1RAC B;  2DPI A;  2KTQ A;  4F36 A;  3BZQ A;  1UEU A;  2W01 A;  3MMA A;  3FQL A;  4QR2 A;  2C2O B;  4QIF A;  4JI7 J;  1RTD A;  3M8R A;  1U6B A;  3SFG A;  2I6W A;  1LW2 A;  2FVS A;  1YJV A;  1HPZ B;  1NH8 A;  2AJ4 A;  3VZI A;  5F8L A;  3ILO A;  2I9S A;  2XNR A;  4WTY A;  3DN9 A;  1TL4 A;  2DR8 A;  4ZP8 A;  4HR2 A;  1HBM A;  4TLQ A;  3OSN A;  5C42 B;  2G9O A;  2OSQ A;  2B7B B;  2IBO A;  5BR8 F;  2EBG A;  4P72 A;  2BXJ A;  2UP1 A;  2K3I A;  1QY7 A;  5HLF A;  3G82 B;  2GJI A;  1XN9 A;  4C6A A;  1P27 B;  1RGV A;  2MZ1 A;  4N47 A;  5J2Q A;  3MM5 B;  4LF7 J;  2FGC A;  1FJC A;  2W24 A;  5H9F J;  1R43 A;  2FVQ A;  2QFI A;  1HWI A;  3KJQ B;  2FDN A;  2LA6 A;  1YJ7 A;  2D9P A;  2HK2 A;  1MSW D;  2UU9 J;  3EX7 B;  1S10 A;  1KLN A;  3V4I A;  1U1P A;  3C66 A;  1D0E A;  3SI8 A;  4CLS A;  2QX0 A;  4LF5 J;  2E44 A;  4M5G A;  2JFK A;  2QA4 G;  1WOS A;  2DGO A;  4DUY F;  1VQ7 S;  3FKB A;  2E66 A;  4DV6 J;  4NXN J;  2VFT A;  3KLH A;  4ZVG A;  2G0J A;  2DRB A;  4ED0 A;  2PMW A;  4LF8 F;  3PKY A;  2CQP A;  3MMB B;  1XTZ A;  3T9N A;  4X65 F;  2UUT A;  2R7R A;  4OFZ A;  3FCH A;  2IC3 B;  2QYC A;  2BA9 A;  1DQ9 A;  1N6Q B;  2XMU A;  1RT4 B;  2YX4 A;  1TV6 B;  4L3N A;  2B9E A;  3QRQ A;  5K5M A;  2WSE C;  3SQG A;  2AEF A;  2RRA A;  5U47 A;  1UP1 A;  1SJ1 A;  4Q44 A;  1SH3 A;  4WII A;  4IH5 A;  5F8H A;  3HVW A;  2ZKT A;  3DC2 A;  3CUN A;  3QBC A;  1BWE A;  4IDK B;  3HHN B;  5LSR A;  2QSW A;  2PA3 A;  4UQG A;  4YB1 P;  2QRR A;  4R5P B;  4CLZ A;  3O2I A;  4X62 J;  2GW8 A;  1NSQ A;  2IMW P;  3DOM B;  4FYD A;  3LPY A;  2PN6 A;  1MRO B;  3T6B A;  3R27 A;  4I2P A;  1H98 A;  3SXL A;  2DR7 A;  1QDU B;  2BQU A;  4X66 J;  2ROG A;  4YN3 B;  4YP3 A;  1FJE B;  3TA0 A;  1VRU A;  4AND A;  1ZPV A;  9ATC B;  3QJJ A;  3ZC4 A;  1N5S A;  4NLQ A;  2OEL A;  4A8X A;  5E41 A;  1T9Y A;  4P10 A;  3GIL A;  2Z8Q A;  2E5L F;  3C16 B;  1IJE B;  2HZA A;  2V67 A;  4CLU A;  1WC5 A;  2GAH C;  2CA9 A;  4WFX A;  3NCR A;  1UKU A;  1HQE A;  4IYQ A;  2F5G A;  4ECR A;  2MKK A;  1KKH A;  1S12 A;  2QMU B;  2YBV A;  1RYR A;  3BPS P;  2VQF F;  1Z4U A;  4NI2 B;  1BHN A;  4B02 A;  1N5Y A;  2HLT A;  4RW8 B;  2AP6 A;  1M5K C;  1D09 B;  3IR7 B;  1ZM2 A;  5EGY A;  3CUL A;  4P2X A;  3PRD A;  2OUG A;  4ZIT A;  1E6Y B;  1GTE A;  5L8R C;  3R1H A;  3M2V A;  2M5Y A;  1KDN A;  4WP9 A;  1FDD A;  4G1Q A;  5FLX Y;  1P1T A;  4LR8 A;  4C11 A;  4PWU A;  4NLV A;  1FI4 A;  2CQ2 A;  4OX9 F;  4DN9 A;  5KG5 A;  3DI6 B;  1B4S A;  5L1L A;  1XMQ J;  2Z56 B;  4DZ6 A;  2NRE A;  5HAO A;  4MKV A;  2X3G A;  1EQ0 A;  1D1U A;  1BQM B;  4CLY A;  3A8I A;  3BH6 B;  2XO7 A;  4B3O A;  3HVA A;  3MWB A;  2CKW A;  2DR9 A;  3CD0 A;  1KS2 A;  3QIP B;  1HI0 P;  1N33 J;  2PII A;  3Q2T C;  2WOM B;  3CME S;  2FC8 A;  3R5G A;  3D6M B;  4M5D B;  3EVW A;  4HKQ A;  3QSI A;  1T9V A;  3W9J A;  2R7O A;  1U8S A;  1J5E J;  3TO8 A;  2CXE A;  1IBC B;  3D2W A;  1FKO A;  2JRS A;  2O66 A;  4A8F A;  1SC6 A;  2DNP A;  4FBU A;  1T9U A;  4A8S A;  4FPR A;  2CRL A;  3OL8 A;  2W2Q P;  2WB1 D;  4NCB A;  3LTO A;  4Q2M A;  2JJ4 D;  2IRY A;  3KTQ A;  1UJ4 A;  1A9N B;  1RAI B;  4PG6 A;  3MUR P;  5D77 A;  4GVB B;  3HVT B;  1TL5 A;  4KR0 B;  4DJB A;  4OHW A;  4O44 A;  3CC4 S;  4PXE A;  1DTT B;  2MKS A;  1UVI A;  3HX9 A;  2ZKU A;  1FK9 A;  3SDE A;  3ITH A;  4H54 A;  3AA8 A;  1KOH A;  1REV A;  4K4T A;  2ZH7 A;  4IH6 A;  2CJ9 A;  3J80 Y;  1RT5 A;  3T9Z A;  1U0H A;  3KMS A;  1VJW A;  2LLZ A;  3QLH A;  2H5E A;  5IZH A;  1N36 J;  1JLC B;  1RAH B;  2MDA A;  4CO2 A;  4JI6 F;  3HD2 A;  1WKL A;  3R2C J;  3IWL A;  3PDN A;  3NP5 A;  1RDR A;  2CUY A;  2QEX S;  1LFP A;  4LRD A;  3WQP A;  3GFY A;  1U26 A;  1TMJ A;  5A0Y B;  4DPU A;  4RKU C;  2KG1 A;  4DR3 F;  2X1F A;  4USI A;  3JQM A;  2ZH4 A;  1X4G A;  3S8S A;  2DIT A;  4JUZ A;  3FUY A;  2JC1 A;  4ID5 B;  2DVI A;  1R31 A;  2VG5 B;  1H0H B;  3R5B A;  4DQS A;  4DCO B;  1FWK A;  4RUH A;  2YKN A;  1Q8K A;  3HMJ G;  2ZH8 A;  5HI7 A;  1QE1 A;  4ZIW A;  2IBK A;  1YTY A;  3H5Y A;  3CCJ S;  2GHW A;  2FUG 9;  4CH1 A;  2YNF B;  4K4W A;  3MDF A;  1UW4 A;  5CHC B;  4ZVS B;  4OZN A;  4K4U A;  3M2U B;  4NA1 A;  3GII A;  4ZVH A;  2VQE J;  4WIQ A;  1OS5 A;  4USH A;  1NK5 A;  2XSJ B;  2AGQ A;  3GPA A;  2LQ5 A;  1TZ0 A;  2UUA J;  1WKJ A;  4RWW A;  1FFS B;  4DR5 F;  4CI0 B;  3MTJ A;  2LVW A;  2FPH X;  4JI5 F;  4C3K A;  4FF3 A;  1NPR A;  2W4D A;  4PZV A;  1RA6 A;  3UDE A;  3UCU P;  2KH9 A;  2MST A;  1M90 T;  3Q0A A;  2JWN A;  2QGF B;  3MED B;  4WK1 A;  5DET A;  1S1U B;  3I0R B;  2BJ8 A;  2Y1R I;  3UQS A;  4ZOS A;  3FEY B;  2MB0 B;  4EYI B;  4Z37 A;  5GMK a;  3TOQ A;  1CLF A;  1LWE A;  1RLD A;  2PA8 D;  3FFI B;  4C3M A;  3AOC A;  4CNZ A;  2MZS A;  2KRR A;  3TAQ A;  1SI9 A;  1S1T B;  1VQY A;  4WFA Q;  4RNM A;  3RR8 A;  1HLW A;  4RL1 A;  8RUC A;  1DLO A;  3M8Q A;  1WEL A;  3CJ2 A;  2J0Q D;  2MLY A;  2N4C A;  4CLF A;  2BBE A;  2XI2 A;  2AHO B;  2N4D A;  2GJF A;  4DV1 J;  4FNI A;  2ZHB A;  1CJV B;  1X31 C;  3PR4 A;  2BKP A;  2NR0 A;  4EEY A;  2BOP A;  1KHV A;  3ISZ A;  2CJA A;  4DL4 A;  2PD1 A;  3OL9 A;  2BAN A;  2AJ2 A;  5KFM A;  2NSC A;  3QO9 A;  5AXN A;  3ETO A;  1S5Z A;  2KL8 A;  1YWX A;  5HVF A;  3MAA A;  2IMO A;  3B4M A;  2DXD A;  3KJF B;  4L76 A;  4CH7 A;  2VD3 A;  4C8N A;  1SQF A;  4F0M A;  4DMZ A;  2HHQ A;  3R8Y A;  1S6P B;  3CPW R;  4HI2 A;  1T3O A;  3HDS A;  3CD6 S;  1RZM A;  3Q8Y A;  3M7V A;  2AD9 A;  1YJW S;  4F4X A;  4DR7 F;  5G0R A;  3SFU A;  4M5J A;  5L9N A;  3PW5 A;  1UWA A;  3OFG A;  4DX6 A;  3LP1 A;  4HLB A;  4ECZ A;  1RWN B;  5MLC V;  2AW0 A;  4DR1 J;  2RRB A;  1FRI A;  4X4O A;  5KAK A;  4UY8 5;  2HBY B;  5B0B A;  1RCO B;  4A46 A;  2WVE A;  1YI2 S;  3FC9 A;  4WP8 A;  2ZC4 A;  5GAD I;  4IH7 A;  1UFL A;  2ASL A;  3UDC A;  3TAN A;  1NUE A;  2GX8 A;  1Q78 A;  4FYV B;  1XWL A;  2HPU A;  3OV7 A;  4WXW A;  1WHX A;  3GIK A;  4URQ U;  2B9X A;  5A8W A;  4U7U D;  5I42 B;  3RR7 A;  1CVJ A;  3K8V A;  3BBB A;  4P7T A;  3FEX B;  4B9M A;  4BBY A;  4ECS A;  1RWU A;  2BZ2 A;  4HHU A;  5B08 A;  3Q23 A;  1JLB B;  2A2C A;  4UT4 A;  3PAC A;  2UV8 G;  4FVM A;  4JV5 J;  3R1L A;  5HMW A;  1Y5L B;  4KKO B;  4C8M A;  4NLS A;  3C6U A;  2DT9 A;  3L09 A;  2MQQ A;  4PXD A;  2UUC J;  3I87 A;  3NS6 A;  2FB0 A;  4NCA A;  2DRD A;  4BC9 A;  3KG0 A;  1U7L A;  1S0V A;  5HMY A;  5KFK A;  3PO5 A;  1BWV A;  2DBB A;  1SUQ B;  4QYR A;  4ZMM A;  1FX4 A;  3EE3 A;  2H9Z A;  1YJU A;  2VG7 A;  3HD1 A;  2HS3 A;  3GG1 A;  3GG0 A;  2XNQ A;  3K5N A;  3N4W A;  1JXV A;  1HNW F;  2G2O A;  2I38 A;  3F44 A;  3GCX P;  4PUO A;  4CM2 A;  1NDL A;  4PG4 A;  2YWE A;  1KBR A;  2BW7 A;  1S9G B;  3MMJ A;  2C2Z B;  1W2B R;  4OYX A;  4FYY B;  2B4V A;  3DGP B;  3V81 B;  2UVW A;  4Y65 A;  3C14 A;  4K50 A;  1PAU B;  3EIC A;  3P96 A;  4NA2 A;  4DV3 J;  3RB0 A;  5CZV A;  4GKJ F;  3MD3 A;  3BSA A;  1H38 A;  1CS4 B;  1KN6 A;  2I5J A;  3C8Y A;  4O3O A;  2HHT A;  4CM0 A;  4GKK F;  3T1H J;  4RLE A;  3NAI A;  5F9N A;  3SZ2 A;  2ACM A;  2H51 B;  4OV1 A;  2NPI A;  1TL7 A;  2RE1 A;  2J0W A;  3TQE A;  1N34 F;  1U45 A;  1RU2 A;  3E01 A;  1GXU A;  4KSE B;  3H2L A;  3V6D A;  3QGP A;  4ED1 A;  3PYE A;  3HHL A;  5KG3 A;  1MNE A;  3R7N B;  1HD1 A;  4LBH A;  2YX1 A;  4CLP A;  2YKO A;  5AE3 A;  3TX8 A;  4JYA F;  5DM7 Q;  2NSB A;  2HLU A;  4KGX B;  1SQE A;  1LWC B;  3A4T A;  2MTL A;  1TL1 B;  4FXV A;  3E51 A;  3PX4 A;  2AZ3 A;  3L9Z A;  1C1B B;  1NK7 A;  2A0F B;  3I0S B;  4FF1 A;  3OPK A;  2E5I A;  4DV0 J;  3ZTP A;  4ES3 A;  1C0T A;  1VFJ A;  3W65 A;  4NCG B;  3KG1 A;  2M7S A;  1T02 A;  2KJV A;  3I5A A;  2UVU A;  2Z0G A;  2CPD A;  3R6L B;  2XCA A;  4EZ6 A;  3MM6 A;  4ELU A;  2QZ8 A;  5IOL A;  1C4A A;  1CC7 A;  2ZIT A;  4IRK A;  2AQ4 A;  2YNG A;  1RWM B;  2YKM A;  4GO7 X;  2XO6 A;  2YWK A;  2DK2 A;  2FLP A;  1FXR A;  2LFV A;  4AXJ A;  4YB5 A;  3CTR A;  5H9E J;  4AD6 A;  3FEZ A;  3OLB A;  1F6T A;  2J0X A;  3J80 U;  2DNZ A;  3MFI A;  1YLX A;  2UVR A;  2MSS A;  3X1L B;  3VTI A;  4IR1 A;  1ELO A;  4F7V A;  1A7G E;  4P74 A;  3N5B A;  2ZNZ A;  2DH7 A;  4YHH F;  2VB6 A;  2W7P A;  4ECV A;  1R0B G;  1HYS A;  1WD6 A;  3QSY B;  1M0S A;  5LXY A;  2QL5 B;  2F9J A;  3TWZ A;  4ZLL A;  1L3V A;  2X1A A;  2YY3 A;  2BJ3 A;  5J1E A;  3I9V 9;  4U96 A;  4URG A;  4B3T J;  1UCN A;  5JJB A;  3IG1 B;  3VAF A;  1AW0 A;  1GMW D;  3H98 A;  2XMK A;  3CDA A;  4A8O A;  2VON A;  2P6S A;  4NXM F;  4IG0 A;  3UPF A;  3TYT A;  1EJ7 L;  3M9O B;  2NUU G;  3HT3 A;  4CTA A;  1FHT A;  4IOB A;  3D66 A;  3QT7 A;  4RW4 B;  1S97 A;  2GZO A;  4CNY A;  2DNR A;  3CDW A;  1IJF B;  1PC5 A;  1RE1 B;  3V2U C;  3PRV A;  5J2P A;  1RT3 A;  2DCL A;  2EVZ A;  1S1X B;  3CCU S;  5KFA A;  1RWO B;  1U1O A;  3D28 A;  1HNZ J;  3OL7 A;  1ACM B;  3P8B B;  1VQL S;  1U47 A;  1U8W A;  3SEO A;  2AZ1 A;  3SCJ E;  1VJQ A;  1LXJ A;  3DXS X;  5BYR A;  2XGQ A;  3MHY A;  4O0I A;  1Q8L A;  4KHR A;  4ZPV R;  1Z2Z A;  5K20 B;  1RQ0 A;  1T8E A;  3ADA C;  2ADC A;  1YJ9 S;  5KT7 A;  2JVO A;  5LMU J;  3IN5 A;  2EBE A;  4UOF A;  3DLK A;  3HSZ A;  3A3N B;  4M8L A;  4J37 A;  2UXD F;  2LCW A;  4M5K A;  4FYX B;  5HRO B;  2MZJ A;  3KHG A;  1Y11 A;  3GP9 A;  3I32 A;  3M8P A;  4AL7 A;  5KG1 A;  2ZBC A;  1S79 A;  3PG9 A;  4CO4 A;  2B4U A;  1WEY A;  4QIG A;  4DWI A;  4R8U A;  3J7Z 5;  1N52 B;  2V8P A;  5LOQ A;  3KG4 A;  2FHO B;  1F5B A;  3AJD A;  4A8K A;  2LEC A;  3M1V B;  1RT2 B;  4ILM A;  1TFY A;  3NBP A;  2ZZM A;  1VC6 A;  1G7C B;  2IM2 A;  2IAJ A;  1IKV B;  2MLZ A;  1ZA2 B;  2G1D A;  4LJM A;  4FN5 A;  3QWP A;  2NZ4 A;  1S59 A;  4WZM A;  2VBX A;  4OMF G;  3RBD A;  3RTV A;  2V50 A;  3PEJ A;  2RU3 A;  1F3F A;  4NZ0 A;  4J9M A;  3ZZR A;  4JI2 J;  2RHQ B;  2YH0 A;  1S1W A;  2L3M A;  2BQ3 A;  2F1F A;  3CCZ A;  1Q0N A;  5L1K A;  3SV3 A;  1X5T A;  1XNR J;  4M5M A;  5KFZ A;  3I82 A;  2GGP B;  5ETK A;  3ETM A;  2RF2 A;  1Q82 T;  4NLU A;  5AJ3 F;  1OPZ A;  3U1N A;  2NZC A;  2X1B A;  7AT1 B;  4O3N A;  2O01 C;  2KHC A;  3CCR S;  4ED2 A;  1D9F A;  4EGL A;  3EXC X;  3MEE A;  5KFN A;  3MR3 A;  2GQQ A;  1RT1 A;  2HHP A;  4JOU A;  1WHW A;  5BJR A;  2DCU B;  5B0C A;  5E5N A;  1HAR A;  1FT8 A;  2E7V A;  2GHV C;  1IBM J;  5LMN J;  4I7F B;  4XPE A;  4IUF A;  1FJG F;  2M4M A;  2OPS B;  4WJB A;  3OJS A;  2XGP A;  3WX4 A;  3UW1 A;  1L3S A;  1S7I A;  2XI3 A;  3Q89 A;  5GVQ A;  3JSY A;  2DGS A;  2KVI A;  4I6W A;  3V4M A;  2HVH A;  3OFE A;  1FRL A;  3QGG A;  3E3X A;  2AT1 B;  2NLW A;  4RW9 B;  1U49 A;  4LVO P;  3DRY A;  1LNQ A;  1T94 A;  4L6V 3;  4A8W A;  2JEG A;  1UVK A;  3TZX A;  2HFZ A;  3KLI B;  3NCQ A;  1UL3 A;  1RAB B;  5D15 A;  1IR1 A;  4OJH A;  1B7Y B;  4TU8 A;  2X3D A;  2VU5 A;  2D3U A;  1CUL B;  3CB4 A;  2R8I A;  4MMO A;  5DLG A;  4QIW D;  2MQ8 A;  2MHN A;  1XER A;  3GLJ A;  2V94 A;  4Q0B A;  5E3A A;  5C25 B;  4HYK A;  3BSN A;  5A8R B;  1CJT B;  1ZZN A;  2D74 B;  3MOZ A;  4JI1 F;  4I2Q A;  1MG7 A;  4ZVF A;  4IR9 A;  1H3D A;  4OI6 A;  2VFR A;  5FII A;  1UAW A;  3SBM A;  3D0I E;  3MCS A;  4J9P A;  5GMD A;  4LFB J;  2RSQ A;  4W98 A;  3I9Z A;  2HQG A;  4ED8 A;  4O0N A;  2XS7 A;  9RUB A;  2ZE2 A;  2ASJ A;  2HAI A;  3VR1 A;  3I6P A;  4K2X A;  4LRB A;  2XQC A;  3I31 A;  3TP2 A;  4DR2 F;  4USV A;  1F0X A;  4PG8 A;  4ILR A;  4QOT A;  2KVQ E;  2V69 A;  1RTJ B;  2MQO A;  4TY9 A;  4ATN A;  1K0V A;  2R8K A;  3MZI A;  1IBK F;  1JQG A;  4IFV A;  4ZN1 A;  5IV3 A;  1HPZ A;  1KTQ A;  3K2Y A;  3CDU A;  2CJK A;  1UWB B;  2A1B A;  5E33 A;  1P9Y A;  4F02 A;  3MEK A;  1WJ9 A;  1QUV A;  5C42 A;  2VKZ G;  4FZV A;  3EGZ A;  4C8L A;  2DNH A;  1S77 D;  3GSI A;  3L7U A;  1C1C B;  2WW8 A;  1S4E A;  2CJX B;  3V6J A;  2GO9 A;  5T7L A;  3HLU A;  4ZPC A;  4Z7Y A;  4ELV A;  5ETM A;  4PQU B;  4DU7 A;  1WSV A;  4OJ1 A;  4LT6 A;  2D41 A;  3NGS A;  3UI3 A;  4QYZ K;  2BX6 A;  4JI8 J;  3BGF A;  3FNN A;  2J6U A;  3IP0 A;  1Q7Y T;  5A8K A;  1VQK S;  3UVJ B;  3PJX A;  2XMT A;  1TUV A;  1NSA A;  1XK8 A;  1SVD A;  1ICE B;  4YB7 A;  4WFB Q;  1Y0H A;  3EGV A;  3M32 B;  1T95 A;  4DL0 C;  4IQM A;  1GEH A;  3CNQ P;  2F4V J;  3CC7 S;  2OPQ B;  2B6A A;  3OVB A;  2H4Y B;  2RVJ A;  4P2S A;  2CAD A;  1U1Q A;  2DGW A;  3O44 A;  2F3J A;  4GC7 A;  3W2V A;  3PM9 A;  4YDD B;  1QTM A;  3M2R A;  4JI0 F;  2HND A;  3AOA A;  4WFY A;  4CRJ A;  2CJY B;  4DFM A;  5IWA F;  3OR1 A;  4CO3 A;  3G2X A;  4GMK A;  3BSO A;  1WAC A;  1U6F A;  1JWW A;  4BDP A;  3VAH A;  1U24 A;  4H4O B;  4KGV B;  1BQN A;  4N5S A;  1HMV A;  2UUW A;  3MPY A;  2NXJ A;  3K0J A;  3HP6 A;  1CJK A;  1PYT A;  3BM7 A;  3VGT A;  1QSY A;  4JI7 F;  2GVZ A;  3C15 A;  3FSY A;  1HNX J;  4QPX A;  1NPP A;  2C3Y A;  2EXU A;  3PIO Q;  4F4Z A;  5MAO A;  5F8N A;  1Q5Y A;  5D78 A;  2MYF A;  3MM9 A;  5H9E K;  2B5J A;  2HNY B;  1PCA A;  4TY8 A;  3EZ5 A;  3I55 S;  2K8G A;  6AT1 B;  3IS9 A;  3C2P A;  3MCO A;  1HNI A;  3GE9 A;  1IKW B;  4MKY A;  3J7Y U;  2A18 A;  4KPC A;  1LWF B;  5HBM A;  4LF7 F;  4B9L A;  1K9M T;  3BGR B;  2DRA A;  3QWU A;  3KOA A;  4WWS A;  1CG2 A;  3HSD A;  2ZWO A;  2Q66 A;  2LMI A;  3GIR A;  1OWX A;  1RWK B;  2GV1 A;  2HZV A;  2BR0 A;  1SV5 A;  3MOJ B;  1S76 D;  1GT8 A;  2W9B B;  3BGU A;  3S6E A;  3G6E S;  2N3O A;  4EK2 A;  2AEJ A;  3M30 A;  3DDI A;  3Q8R B;  3TUP A;  2GNK A;  3VQT A;  2DGU A;  2EFG A;  4ZVU B;  4K5S A;  4DV6 F;  3QAT A;  3KJN B;  4NXN F;  4EBE A;  2EFP A;  1S9E B;  4X4Q A;  2HGN A;  2NXN A;  1B70 B;  4BHQ A;  5IM0 B;  1IBL J;  3TZZ A;  1ZS6 A;  2W8K A;  2OP5 A;  5C2G A;  4QU6 A;  3NOG A;  1PYO B;  4O4G B;  3C6T B;  2XLJ A;  4ALZ A;  1NPK A;  1HKA A;  2IVM A;  2MZT A;  4L73 A;  4N41 A;  3DLH A;  2M8H A;  2FD2 A;  4OI2 A;  3RAQ A;  1YRX A;  3MMC B;  1ZZF A;  2YQ1 A;  3FGV A;  3VVT A;  2DHX A;  2SXL A;  5C7P A;  3H59 A;  1PGZ A;  2W9C A;  5K8O A;  4DV7 F;  7FD1 A;  2HQF A;  4CO1 A;  2HGL A;  2VF3 A;  2GMJ A;  3MGJ A;  2HVI A;  5L46 A;  3EGW B;  2LQB A;  1XR6 A;  5M2P A;  2HYI B;  3SCK E;  3L4B C;  4X62 F;  2YNI B;  5K9F A;  4TVA B;  2WTF A;  2C22 A;  4N77 A;  3NL0 A;  1F2H A;  2FLO A;  4Z7C A;  3MPW A;  3K5M A;  5HAN A;  2F7V A;  4DPT A;  3IAM 9;  4F26 A;  1J27 A;  3OTO J;  3DRR B;  4B3S J;  4ZVT B;  4X66 F;  4LSL A;  3POT A;  2DNY A;  4HHJ A;  4RNO A;  4RW6 B;  4Q43 A;  2IJF A;  1RU1 A;  4LF6 J;  3ENW A;  3RBX A;  4BC7 A;  1KON A;  3DGV A;  1U1K A;  1U1N A;  1XBW A;  1YJR A;  2A3J A;  3PTW A;  3GFZ A;  2K06 A;  1WDD A;  5KFJ A;  2DYA A;  3DNC A;  3Q83 A;  3UD4 P;  4AXI A;  2HFU A;  2M9K A;  4OX8 A;  4P2M A;  3DU5 A;  5ETL A;  5EX3 A;  3DHW C;  1NME B;  4U8Y A;  2BQR A;  3H40 A;  2D1C A;  4HT5 A;  1BMQ B;  4U67 Q;  4YS2 A;  1N88 A;  4RW7 B;  2GVD B;  3NWR A;  3AD8 C;  2XMW A;  1JLC A;  1U2F A;  3UCG A;  3OBI A;  4UQT A;  1ULR A;  5KFF A;  3CT9 A;  4K8R A;  2DGX A;  4EUV A;  1D8Z A;  3TVZ A;  3F56 A;  4OYM A;  2OPP A;  4DFJ A;  1HW8 A;  1RBA A;  2HHW A;  4WFN Q;  3ZNJ 1;  3W9H A;  4MKB A;  2VH7 A;  3R5D A;  2KXF A;  4LF1 A;  3D6T B;  2LU1 A;  2DO0 A;  2DEJ A;  2P9E A;  1TKX B;  4LRE A;  3X3U A;  2U1A A;  4W4M A;  1AUD A;  3QNW B;  3HPO A;  3IRW P;  2HBZ B;  4LR7 A;  3PW4 A;  3NLC A;  2YNF A;  3KKF A;  2HG4 A;  3A3O B;  3HHL C;  3M2U A;  2FYX A;  4D3G A;  2UVV A;  5A6P A;  3H25 A;  4LF9 J;  1NO8 A;  3PZP A;  4PPD A;  1VS3 A;  3DLE B;  3ZFV A;  1J5E F;  2V9K A;  2NQP A;  1CC8 A;  2HW3 A;  4G1I A;  3ZZU A;  3UO0 A;  4MFB B;  2CQH A;  1ZOT A;  2E5J A;  4RU9 A;  4O3S A;  3GYX B;  3KK2 B;  5IXU A;  2DNQ A;  3THP A;  3VAJ A;  3IM9 A;  5I3U B;  2IRX A;  3BN4 A;  3DLG B;  1K73 T;  4PEO A;  2GQ2 A;  1LW0 A;  1MMN A;  4NWB A;  2VDH A;  4RBU A;  1FA0 A;  4CCH A;  3IM8 A;  2ZOM A;  1U6Z A;  5J2M B;  1UVN A;  1WEX A;  5A6W A;  2RDJ A;  3SSQ A;  5IT0 A;  1HW9 A;  2E1P A;  2COL A;  1OJ4 A;  2R2R A;  5HP1 A;  4M5L A;  1WI6 A;  4ZCK A;  5CYM B;  4I67 A;  3LA0 A;  2V2K A;  5LSL A;  1ZM4 A;  2YTC A;  5L1J A;  2Z30 B;  4OX6 A;  4KO0 B;  5CYQ B;  4MKA A;  4LUB A;  4X65 J;  3T1Y F;  2VL1 A;  3OT9 A;  4HAC B;  3VGU A;  1HHT P;  3GFX A;  2ROE A;  5T14 A;  3SCI E;  3UFC X;  2RML A;  4LRC A;  1GX5 A;  2MXY A;  3KNG A;  1QLN A;  2YKP A;  4C8Y A;  1ZAV A;  2KDO A;  3HCX A;  3CJ3 A;  2B0G A;  3BPD A;  4RNN A;  3MMA B;  2FGO A;  3V6K A;  1RT6 A;  4V19 J;  4TYB A;  3T5J A;  4I0W A;  1RTD B;  2B4P A;  3G87 A;  2WVC A;  3O3L A;  1LW2 B;  1PC4 A;  2VA3 A;  3MM7 A;  1N5V A;  3AXM A;  4CT8 A;  2VQE F;  1HBM B;  3RRK A;  1K0T A;  4DU8 A;  5DZ6 A;  4J9U E;  3IR6 B;  2P8I A;  2UUA F;  5KFH A;  4JB8 B;  5CZX A;  2AGP A;  1VBY A;  5GAH I;  3IC1 A;  4XIU A;  2W1B A;  4DHV A;  5J2Q B;  5K8P A;  2I0X A;  2IFX A;  3QRP A;  4HL9 A;  2CG4 A;  4M5H A;  1G1X A;  4J91 A;  2JZ5 A;  3ICL A;  3R6G B;  4RNH A;  2KI2 A;  4PKD B;  5KOX A;  3HSG A;  1D9A A;  3V4I B;  2ZDO A;  2ZVS A;  3GFH A;  5CXT A;  2E5L J;  3W64 A;  1IWA A;  2V63 A;  3LGM A;  1WTB A;  1KHW A;  2FQQ B;  1AYE A;  2M2B A;  2ZUA A;  1S48 A;  1SXL A;  4ECY A;  4ZPD A;  2ABY A;  2DIV A;  5JVG Q;  2HNZ B;  3KLH B;  2VQF J;  4DV1 F;  3H42 A;  2V6A A;  2GML A;  4DN0 A;  4KHP J;  5IT9 Y;  1MLA A;  2OGU A;  1E6V A;  1NBE B;  2PC6 A;  4MJK A;  1M5H A;  2HUR A;  3M8W A;  3TVY A;  2GIF A;  4ID8 A;  4OZ1 A;  1M5O C;  4M94 A;  3SQG B;  2GS8 A;  2W2M P;  2ZBI A;  4PYA A;  5E7O B;  2F65 A;  1S57 A;  5GAH U;  2KXN B;  4CT9 A;  2NXC A;  2FJV A;  3GQC A;  2B4O A;  4G6V B;  2IVF B;  3THT A;  5CQG A;  4CLT A;  4IRC A;  4BCA A;  2PI4 A;  2ATC B;  3DRS A;  1NKE A;  2OPR A;  3Q22 A;  2R42 A;  4XAK A;  5CH7 B;  2R2T A;  1TFW A;  2KZZ A;  1Y3J A;  2R8H A;  2XLK A;  1NHK L;  2J7U A;  1PG5 B;  3DLJ A;  2BKO A;  3JTO A;  1CS4 A;  3JSM A;  2FJD B;  1B99 A;  1NK8 A;  2W2N P;  2FVC A;  4DR1 F;  2N7C A;  4ZP7 A;  3ZTO A;  2V68 A;  3IAS 9;  2VIH A;  3W5Z A;  1JLA A;  4NRT A;  3MAH A;  1X4H A;  1XMB A;  4I2P B;  3IR5 B;  4PCQ A;  3JAM Y;  2L41 A;  1YX2 A;  3KK1 A;  1B3T A;  1VRU B;  3KLE B;  1WC6 A;  5HAT A;  4LVN P;  1SIZ A;  3NRB A;  3D7S B;  3KDN A;  4AQY J;  1W2I A;  5KFO A;  3DM2 A;  4DR6 F;  1ZAX A;  2DHG A;  1Y5I B;  5DLF A;  2KHD A;  1FFW B;  5HVH A;  4I56 A;  1SKW A;  5D4N A;  5KG2 A;  3LAM A;  2XWY A;  2BDP A;  1HQE B;  3FMB A;  2OFG X;  2H54 B;  4Q2L A;  1FKP A;  2XBP A;  2YNH A;  1EET B;  4OHZ A;  1FKA F;  1XIQ A;  3EWG A;  2V9W A;  1N5Y B;  4DQQ A;  3RB4 A;  3GWC A;  1CEZ A;  4N76 A;  2B9Y A;  4RR5 A;  5G4D A;  5HQM A;  5CCM A;  3C3L A;  4PR6 A;  3OLA A;  2H4W B;  2DY9 A;  5GAG U;  1R0C B;  4BWM A;  1OQ3 A;  1KNZ A;  3MPV A;  2KXH A;  4USU A;  2AJ0 A;  2RIJ A;  3K7R A;  1S6Q A;  3M2V B;  4HVZ A;  4NL5 A;  1PJ7 A;  4G1Q B;  3QMQ A;  3CD7 A;  2RKI A;  1HR0 F;  4C11 B;  3OXF A;  4FPI A;  5EWF A;  4ZCL A;  2EKN A;  1MW7 A;  2N3L A;  2R7S A;  2JEF A;  1T03 A;  4D3H A;  4PG5 A;  3SIP B;  2XLI A;  1GMV A;  1Q4R A;  1FO1 A;  1P6T A;  3CJR A;  4B3O B;  3PYG A;  3MEC A;  3TUZ C;  2O3D A;  4OYZ A;  1SL0 A;  5CAA A;  2M52 A;  5IT4 A;  3NMR A;  2QA1 A;  2RUG A;  4DV3 F;  1EKR A;  5F9L A;  1H7W A;  1WSR A;  2G4B A;  5J1P A;  2LKZ A;  3THV A;  2DNK A;  4WZQ A;  3GU0 A;  2IHR 1;  3PEH A;  1RA7 A;  3VVU A;  4NLP A;  2BRL A;  2MKY A;  3M6U A;  2YX7 A;  4BWJ A;  3WZ0 A;  2IVY A;  1FKO B;  2DR6 A;  3ZZ0 A;  1T11 A;  2DTJ A;  3FCW A;  4PWD B;  3GV5 B;  2CQ0 A;  4DR5 J;  1M5S A;  2ZH6 A;  3CC2 S;  5D0H A;  4O3Q A;  4JI5 J;  4Y0F A;  3VCD A;  2Z2Y B;  4YR0 A;  1WG1 A;  3LAK A;  5K14 B;  2C3M A;  4O44 B;  4DS4 A;  3H2U B;  2MGZ A;  1M5P C;  4MT1 A;  4OYP A;  4LF4 J;  2RNE A;  4OI0 A;  3SDE B;  1DRZ A;  2BJE A;  3ITH B;  3IRX A;  4ZDN A;  4TKT A;  3Q8V A;  3JB9 k;  1REV B;  3MTK A;  1Q1K A;  4DV0 F;  3ET6 A;  3VAG A;  3TAR A;  2Q6C A;  1YVF A;  1FTC A;  1D3W A;  1RT5 B;  1FRJ A;  1U0H B;  2XHC A;  2CQ3 A;  2K2P A;  3CCT A;  3M6V A;  3N28 A;  2BE2 A;  3QZ7 A;  1R8A A;  3QLH B;  3MR6 A;  3ZZT A;  3L95 X;  1EKS A;  3HO1 A;  1IWG A;  2R7V A;  1V3Z A;  4X4T A;  2RHS B;  3W5X A;  4J9K A;  4PAA A;  2RD5 C;  3HFZ B;  2MQM A;  3PR5 B;  2OKQ A;  4NOH A;  1VQM S;  3QJP A;  5D0R A;  2WBR A;  1GMU A;  1R3N A;  2XMJ A;  4MK7 A;  4DZD A;  2W25 A;  4OZ0 A;  4J9V A;  5JVH Q;  2UZA A;  3NGT A;  3LGN A;  2QMX A;  5M2R A;  1Z2L A;  1HNV A;  1DHM A;  3DRX A;  2MKH A;  3ZTS A;  1HIY A;  2APO A;  4TXS A;  2VHG A;  3G8T A;  1QAX A;  3A8K A;  1YIJ S;  2YKN B;  5I3P A;  2XY7 A;  5KFX A;  1SQG A;  1QE1 B;  2XHW A;  4DUZ J;  4IFY A;  3H8Y A;  5DRK A;  3CJQ A;  4B3T F;  2XG8 A;  4OZ5 A;  3B6B A;  3O5T B;  2DJW A;  3Q2S C;  1WC0 A;  2C42 A;  4ZJO A;  3FQK A;  1TVR A;  2R2U A;  5D6G A;  1RIS A;  2YWH A;  1PIL A;  2EFN A;  2OAU A;  2Q6B A;  4KH1 B;  5LJ5 Y;  1F60 B;  3HJF A;  3TAM A;  2C3O A;  4EU0 A;  2BOA A;  2GIR A;  2B56 A;  2Q3P A;  5KT5 A;  2E1M C;  3OR2 A;  2OTJ S;  3LGH A;  1M1G A;  3M8Z A;  3H5U A;  3G9C A;  2XM3 A;  2DNO A;  1BD6 A;  1HWK A;  4LBI A;  5KG7 A;  1IQZ A;  1Q95 G;  1HNZ F;  3LQV A;  4UOH A;  1IKX A;  1IR0 A;  4YDX A;  3BJY A;  2ADB A;  3EPI A;  3T5H A;  4OJ3 A;  4OYO A;  1SH2 A;  4QJV A;  1S0M A;  1LWE B;  4K0K J;  2QV6 A;  4O3R A;  4C0B A;  4I7F A;  3EDQ B;  1MU2 A;  2Y8Y A;  2EFQ A;  1K1Q A;  2AYG A;  1TKZ A;  3AA9 A;  4USW A;  1KLM A;  2D7S A;  5GAE I;  2HIQ A;  4DS5 A;  1DLO B;  3M8Q B;  2Z58 B;  2HIY A;  5EHH A;  4NLO A;  2U2F A;  4AL5 A;  4F3O A;  1VQN S;  4X84 A;  2FZC B;  1VMB A;  3JYT A;  3KLI A;  1T9W A;  3TRG A;  1RHR B;  2HVZ A;  2RU9 A;  3OFH A;  2E5G A;  2MJN A;  4KQZ A;  3KK3 A;  3A8J A;  4U9R A;  2DH8 A;  2BAN B;  3QO9 B;  1TUW A;  1Q79 A;  1BLU A;  4H4M A;  3MAA B;  1C0U A;  1LKZ A;  3PV8 A;  2K1R A;  2ZOF A;  3BO3 A;  4FBT A;  4F0K A;  5IT9 U;  2V4J A;  3HHK A;  2LEP A;  3FJ2 A;  4LBP A;  1HNW J;  3FRZ A;  3CJ5 A;  2R7T A;  1UMJ A;  3ZZP A;  2ZWP A;  5BYS A;  2DGV A;  5C24 A;  2AF6 A;  1QAI A;  4FXW A;  2H1Y A;  1F5A A;  2ZOG A;  4P52 A;  1OQ6 A;  5G0R B;  1G6B A;  2KYZ A;  3DOK A;  4C8O A;  1HBO A;  1RHU B;  4I68 A;  4MIB A;  1URN A;  5CAB A;  2HAF A;  4NLG A;  4A8M P;  3LP1 B;  5KG0 A;  1EIY B;  2MHE A;  1JLE A;  5GAE U;  1T05 A;  2JVR A;  3DLL Q;  3AB4 B;  4PQA A;  1I94 J;  3GMG A;  1CBK A;  4K59 A;  3DRP B;  2IJR A;  3ZZZ A;  2XS5 A;  1R0A A;  5KFE A;  3ISN C;  2HFS A;  3DFE A;  3UN2 A;  2RQ4 A;  1BE4 A;  4OLP A;  5A8W B;  4UUW A;  2UUB F;  5KG4 A;  2ZH5 A;  4NLR A;  1U1M A;  2QSF A;  4DG1 A;  4PG7 A;  1JJC B;  3RUB L;  5FDL A;  1YQH A;  1IBM F;  5LMN F;  2ZUG A;  3JAM U;  2B43 A;  4ZCM A;  1UA0 A;  5CA5 A;  1X9W A;  3CWJ A;  3WC0 A;  1X4F A;  1X4A A;  3NAH A;  3UR3 C;  3C6U B;  2K7J A;  4ANE A;  1XR5 A;  4K4V A;  3D1H A;  1R7I A;  4F50 A;  4LFC F;  1LFW A;  4USM A;  4XK8 C;  2ALY B;  3WX8 A;  3K17 A;  1B0P A;  1NDK A;  3F0N A;  4MH8 A;  2W2O P;  1WTF A;  2HWI A;  2RB7 A;  4P75 A;  4KTQ A;  1V6H A;  1NJI T;  1AA1 B;  2VG7 B;  1VGY A;  2Z2L A;  4FKX A;  4OZL A;  1UET A;  3JQJ A;  4GC6 A;  3PW0 A;  4PUO B;  4YME A;  1VR6 A;  2PO4 A;  2KRB A;  2JX2 A;  3VGS A;  1X4E A;  3LWM A;  2VFS A;  4WFZ A;  3C14 B;  1OO0 B;  4XPC A;  2C2M B;  1S6U A;  1JLG B;  3TAP A;  1PYS B;  4LFB F;  3GZ7 A;  1NSK L;  1TK5 A;  1RUS A;  4B3M J;  2N82 B;  4AYB D;  1OYE A;  2IRU A;  3BH7 B;  2I5J B;  2KJW A;  4ZPT R;  2DR5 A;  2VPY B;  4ZVE A;  3ILJ A;  5KFI A;  2CG8 A;  2AYM A;  3ENV A;  2CAJ A;  2PFD A;  3AQP A;  2CQD A;  3LP2 B;  2GMH A;  1MWY A;  5HN0 A;  4Q8F A;  2QLF B;  3KLV A;  2RQM A;  3E01 B;  1NU4 A;  2WB4 A;  2VG6 A;  3E8O A;  3RW7 A;  3VAI A;  3OTC A;  3V6D B;  2FVP A;  3GIM A;  3HHL B;  4F4K A;  1NK0 A;  3FDS A;  2BM0 A;  1X0P A;  4DX7 A;  2RS2 A;  4ZS6 A;  3IBC B;  1S0N A;  1TL3 A;  3D3C J;  1OSC A;  1YBA A;  2QTW A;  3T41 A;  1KEK A;  2HNY A;  1SKU B;  1ZM3 A;  4KHM A;  2POK A;  4KB7 A;  2QIF A;  4HHH A;  1AB8 A;  3HKW A;  1C0T B;  1RTI A;  2A6O A;  4RNF A;  3MM8 A;  3OTE A;  3GJT B;  4NRU A;  1LWF A;  4C8K A;  4ICL A;  1QD1 A;  5B0G A;  3TNV A;  2G0I A;  2W8L A;  2C28 A;  1RHJ B;  1WOR A;  3KUG A;  1UJ5 A;  1WC1 A;  4KV8 A;  3TI0 A;  3MM6 B;  3CJ0 A;  4DSE A;  3BBC A;  2YWG A;  2L9W A;  1X5S A;  2YKM B;  5M2U A;  2OTL S;  3BO4 A;  2PMZ D;  2CZ9 A;  2UXD J;  2DIU A;  2BJ9 A;  4JI8 F;  1UVL A;  2F8H A;  5FD1 A;  3GON A;  5DQH A;  1D8Y A;  5CCL A;  4X4S A;  3B8H A;  4KFB A;  4ETX A;  3CE8 A;  4IQX A;  1U09 A;  2KT5 A;  1REG X;  1XMO F;  3N5F A;  4F8R A;  2MMY A;  1ROF A;  4DF4 A;  1HYS B;  1JJH A;  1PJ5 A;  4RJV A;  1FNM A;  2J0S D;  2FY8 A;  2JSX A;  4P73 A;  2KZM A;  4F2S A;  5J1E B;  1S7H A;  5F0U A;  1LEO A;  1KTV A;  2QT7 A;  3W1Y C;  1TKD A;  4ECW A;  3FZ2 A;  5KFL A;  4K4Y A;  1SJ3 P;  1RKJ A;  1EQM A;  5F3Z A;  2P9G A;  3K59 A;  2XUL A;  4CWB A;  4IG0 B;  2ZJP Q;  4DL5 A;  1B64 A;  2IPO B;  4CTA B;  2DO4 A;  2FHK A;  2F9D A;  1NLK L;  5JUM A;  3QAE A;  2V2Z A;  3GYN A;  5AJ3 J;  2LP4 A;  3ZTQ A;  3CO0 P;  1F9H A;  2IY5 B;  2UXB F;  1VQ8 S;  5J2P B;  1RT3 B;  4HH1 A;  3OSP A;  1HNX F;  1UVJ A;  1TKT A;  5FJ4 A;  1RXO B;  3LF0 A;  4LF2 A;  3D5M A;  1RAE B;  1HQU A;  3SCL E;  1QVF R;  5D0E A;  5RUB A;  4NLY A;  2Y1I A;  3RG6 A;  4DFK A;  1KSP A;  1JK9 B;  1MN7 A;  1Y4Z B;  5KOW A;  3AOB A;  2OMO A;  3NGU A;  5H9F K;  4KE5 A;  5E3C A;  2NPF A;  1Q16 B;  4HTI A;  4C9D A;  4DCJ B;  1X0F A;  4AUK A;  1S1V A;  2CIM A;  1ITP A;  4M63 A;  3D6F B;  1HWJ A;  2CPJ A;  3UDL A;  4DOZ A;  1RK8 A;  3NKY A;  3DLK B;  1Q81 T;  2D3Z A;  3SSS A;  3Q86 A;  5EWG A;  3LP0 A;  3S1T A;  1NCL A;  3EDR B;  4UOC A;  2WON A;  1DTQ A;  1FD8 A;  1VC0 A;  3N01 A;  3M8P B;  3OJU A;  4DQR A;  2FIU A;  1AFJ A;  3CF5 Q;  4R8U B;  2J8S A;  2V4R A;  2ATL A;  2A6M A;  2CPI A;  1PO6 A;  5ADZ A;  1DQA A;  2X1G A;  3BSC A;  2L08 A;  2PFF B;  1RBO B;  1K8A T;  3NBP B;  3DDN A;  3PFO A;  2VKR A;  2CNN B;  2IAJ B;  4I6Y A;  4KRW A;  3MUV P;  4LFA F;  1C2P A;  3GCW P;  1R8C A;  3CCV S;  3IWX A;  3NGK A;  1XEZ A;  1R8H A;  1N32 J;  2R4F A;  3G8Q A;  1JLF A;  1GXT A;  2YQ3 A;  1UEK A;  2R8G A;  3G6Y A;  1S1W B;  5F8G A;  2OFH X;  1HL6 A;  5DDQ C;  2XSF A;  2HRT A;  2DNL A;  2UXC F;  2RF2 B;  1N0U A;  4DR2 J;  1JLQ A;  2ZD1 B;  5D0G A;  2XMA A;  4ED7 A;  2VPX B;  5HMX A;  3MEE B;  1IKY A;  4FXD A;  1RT1 B;  4UOG A;  4UST A;  3CD5 A;  4NYP A;  5ETP A;  1RTH A;  3N9U C;  2ZVI A;  4ANC A;  4PRF A;  2ZBP A;  4B3S F;  2ZM6 F;  3KLG A;  3LH2 S;  5FLX U;  4ZKA A;  4MFB A;  4LF6 F;  4NA3 A;  3QYY A;  3UCZ P;  1FXD A;  4F04 B;  1X8D A;  1X9M A;  3ENA A;  2B7C B;  2DHS A;  2MLX A;  2V2Q A;  1QAJ A;  2DD8 S;  3M05 A;  5KFT A;  4NZ7 A;  1JKH A;  1NHV A;  3HXM A;  1QVG R;  1XNQ F;  1Q7L B;  2QJ3 A;  1S6O A;  3L7P A;  3M8Y A;  4E98 A;  4Y2C A;  2W7A A;  3NGD A;  1MMD A;  1YGY A;  1YG0 A;  4Q0B B;  1GAO A;  1NHU A;  1HWU A;  1LK7 A;  4I2Q B;  1U2R A;  5D3G A;  4FP9 A;  4YR3 A;  3IBF B;  5J2N A;  2VV5 A;  4NLD A;  3KLF A;  4M5I A;  3P5T L;  1HBU A;  4CYU B;  5KFD A;  1NJW A;  3I4P A;  1IQT A;  2WVB A;  4ZPA A;  2HFV A;  1UW9 A;  4YB6 A;  1EHW A;  3U1M A;  4ZA1 A;  1O51 A;  2RRN A;  4OI1 A;  2AV5 A;  2O67 A;  4Y3C A;  2ZE2 B;  3CXC R;  5J1N A;  3BEG B;  2QA4 S;  3DHX A;  4CQ1 A;  1X9S A;  1I1G A;  1N48 A;  3FK4 A;  4IFV B;  2MZQ A;  1DAR A;  4FS1 A;  5EWE A;  4LF9 F;  2HVD A;  3ZNU A;  3ILI A;  3R5C A;  2VC1 A;  2E9R X;  1UFW A;  3FVY A;  3W2W A;  5KFG A;  3KHH A;  3BRE A;  1Y3K A;  2XYG B;  3ELH A;  5HL7 Q;  1EP4 A;  5A76 A;  3D54 A;  3NEK A;  1HBN A;  3VHQ A;  2VBZ A;  3AT1 B;  1O5J A;  1LOU A;  2VZ9 A;  1HA1 A;  2Y1L B;  1RHK B;  5T7L B;  4UUX A;  2DNM A;  3PX6 A;  3LO3 A;  3G4S S;  1YDL A;  4WBF A;  2HZC A;  5KFB A;  2RJZ A;  3AAW B;  2HGM A;  3OVS A;  1UFK A;  2UV8 A;  3QFH A;  3K8W A;  5HJY A;  3PVX A;  4ZVO B;  3U7J A;  2HHS A;  2OI2 A;  1ZBT A;  2HWT A;  1G3O A;  5A8K B;  2FJA B;  1RT7 A;  3ILL A;  3EUN A;  3G8S A;  2VJU A;  1GQE A;  2XWX A;  3GJQ B;  1TR0 A;  5D4O A;  4QPT A;  2QLW A;  2J76 E;  1C4C A;  2HNZ A;  5B7W A;  3DYA A;  1VC5 A;  4IG3 A;  5KTQ A;  2W4P A;  2EC0 A;  2VPW B;  4I1T A;  2G2Y A;  3BGL A;  5F3T A;  4DSI A;  2HS0 A;  2BMB A;  4USJ C;  3CJ4 A;  3TZW A;  5LJ3 Y;  4C7Q A;  3A1Y G;  2CPY A;  1GFW B;  2B6A B;  2B8Q A;  3D1O A;  2J9E A;  4DV2 F;  3Q8P B;  3W2V B;  1A0O B;  3KUE A;  3HK2 A;  3NNH A;  1Y5N B;  3CCE S;  1FRX A;  3M2R B;  4X4R A;  2HND B;  4JV2 A;  2G0C A;  3B78 A;  3OR1 B;  4U8V A;  3G96 A;  1ZTW A;  1NRK A;  4ES1 A;  5JXS A;  3R5J B;  4DV7 J;  1BQN B;  3W8G A;  3M8S A;  1HMV B;  2NXU A;  2WSF C;  1AZS A;  1SL1 A;  4ITS A;  1CJK B;  4Q7A A;  1ZTT A;  2E9Z A;  2QLJ B;  2OIH A;  1VK3 A;  2GVZ B;  3C15 B;  1VI7 A;  4Y2K A;  2PE8 A;  2L9N A;  3ZZY A;  4PPZ A;  4DLE A;  1X4D A;  2C3P A;  3MM9 B;  3HFV A;  2B5J B;  1GMW A;  2E7W A;  1LK5 A;  3UNY A;  4TY8 B;  1V5I B;  3IS9 B;  1HNI B;  2GQC A;  4X2B A;  2D3O 1;  4ECT A;  2QFJ A;  4DDF A;  5HBM B;  4AE5 A;  2R7Q A;  3D4J A;  3KLE A;  1BY9 A;  4JI3 F;  2BJD A;  1W7W A;  4QIV A;  3KJV A;  3HVR A;  4WKR A;  3BB5 A;  2HQC A;  2R7W A;  1SC1 B;  5SZT A;  2XEX A;  1TAQ A;  1UVM A;  4KGK A;  1SL2 A;  2C2D A;  4DL6 A;  1W26 A;  4DL3 A;  2LU2 A;  4K4Z A;  1K44 A;  4TYA A;  1SV5 B;  4Q5V A;  4WU3 A;  4QQB A;  2CZV C;  4RU2 A;  4PWW A;  3M30 B;  3DDK A;  4USK A;  4F4Y A;  3RRH A;  3D0G E;  4W90 B;  2YWW A;  1EET A;  1VBK A;  2BJ1 A;  3BQ2 A;  4KHP F;  1JIH A;  2JOQ A;  4A4J A;  3RBE A;  3CIM A;  3CJK A;  4DXL A;  2OJ3 A;  2ASY A;  1FEH A;  2VOO A;  3TEG A;  2DIS A;  2YPZ A;  1OY8 A;  1LWX A;  2PEB A;  3AB2 B;  2CPZ A;  4OHX A;  4YR2 A;  3AHP A;  3RAX A;  4KY3 A;  1H6K X;  1VLO A;  4NMX A;  4B9N A;  4CLL A;  2VBY A;  1B7F A;  2ZJQ Q;  3JS9 A;  4OHV A;  3DMJ A;  5EN1 A;  2YPY A;  3HHE A;  2O1P A;  3Q8S B;  2W9C B;  1PBA A;  3SYZ A;  1S0O A;  3MEG A;  5E3Q A;  2BV3 A;  1J5O A;  2ZC3 A;  3NOC A;  2KG0 A;  2CWX A;  4DPW A;  4GVL A;  1O8B A;  1T7P A;  2PSZ A;  2WBM A;  5IS2 A;  1HWL A;  4WE1 A;  3PW2 A;  1QJH A;  3QAU A;  5KFV A;  3UDV A;  1SIW B;  2BYC A;  2HSE B;  3P5B P;  5F41 A;  2EI5 A;  4L74 A;  4NX9 A;  3A13 A;  4DR4 J;  4YY3 J;  4CO0 A;  2DNN A;  1WWH A;  2AIR B;  4IKA A;  5JMN A;  3NY0 A;  5KT4 A;  2DGT A;  3K58 A;  2XYP B;  1RAA B;  3UR0 A;  2FJW A;  1R27 B;  2W7O A;  1SKR A;  1RWP B;  1UZD A;  2EPI A;  3SMZ A;  2Z2M A;  4LSL B;  1MWZ A;  3POT B;  4DSJ A;  2JEI A;  2XTJ P;  3OUY B;  2OEM A;  2CQI A;  1H72 C;  2C1E B;  3HHD A;  4PWD A;  3H5S A;  4UF4 A;  2M0G B;  4DV5 F;  4MAK A;  3CCM S;  3BDP A;  4NEZ A;  3WBZ A;  3QFW A;  2XMM A;  3D3B J;  5IFM A;  1DY3 A;  4AQY F;  5K14 A;  4NYZ A;  4FKY A;  3S01 A;  4JI4 J;  1FVQ A;  4PAB A;  4V19 X;  1OY9 A;  3MFH A;  3Q8U A;  1H2V Z;  2QN6 B;  4ZLJ A;  4Y2A A;  4ZHR B;  2C2K B;  1H73 A;  2IYG A;  2JEJ A;  3CDE A;  3KHR A;  2LQ8 A;  4IO9 Q;  5KG6 A;  1YJT A;  3WIV A;  3KYL A;  3PX0 A;  4U7C A;  1S99 A;  3LAL A;  4NPO A;  4DBQ A;  3K89 A;  1YK9 A;  2M3D A;  3T1Y J;  4DV4 F;  3P45 B;  1NEE A;  3G82 A;  4F0H A;  1F5C A;  4ELT A;  3MM5 A;  2OPP B;  4NEY A;  3V5R A;  2OD4 A;  3R97 A;  1FF2 A;  2LDY A;  1JJ2 R;  1X4B A;  2VIC A;  3C46 A;  4UY8 T;  1RAG B;  4CH0 S;  1KQS R;  1UTA A;  3TZY A;  4YUD A;  1SJQ A;  2HK3 A;  5IQQ A;  5HK4 A;  3D68 A;  3T1A A;  4DLG A;  2AJQ A;  3KXD A;  4URS A;  4OHY A;  2HHH J;  3GTY X;  2KFY A;  1JNR B;  2AX1 A;  3CMQ A;  3U1L A;  4ED5 A;  2FJE B;  3PYF A;  4Y2I A;  2MKI A;  3CMA S;  1NZ8 A;  4O23 A;  1Z1Z A;  2XZD B;  3J7Y I;  2DXF A;  5E0O A;  2ZHA A;  3MMB A;  2FY1 A;  4UW2 A;  1SKS A;  2QC3 A;  5BXI A;  3BYR A;  1X7V A;  2IC3 A;  3LOU A;  2VDI A;  1TU0 B;  2CQC A;  1N6Q A;  3PFE A;  4NE9 C;  1RT4 A;  2CNK B;  2G1H A;  3R2D J;  1TV6 A;  3W60 A;  3IGN A;  1Q53 A;  3CO9 A;  2R8J A;  1JB0 C;  4CP5 A;  2CVI A;  4DFP A;  1LW0 B;  2BAC A;  1UPP A;  1SB6 A;  3PHE A;  1T9T A;  1HFE L;  5EUH A;  2M70 A;  4G3I A;  1LQ9 A;  4M95 A;  4LF4 F;  1QSL A;  2ALZ A;  4IDK A;  4AFF A;  1RSC A;  3BR8 A;  3WC2 A;  4R5P A;  4EBC A;  4X4P A;  4ZLP A;  5HP1 B;  4C8Z A;  1UZH A;  2ZHO A;  2CNL B;  3I4H X;  2W2P P;  2DHH A;  1QTN B;  2LXU A;  1WOO A;  3DOM A;  3PXG a;  5KT3 A;  4DEZ A;  1MRO A;  2QL9 B;  2WAQ D;  3P6Y C;  2ZH1 A;  3TJ8 A;  4I6A A;  4UZC A;  4C98 A;  1NSP A;  5H1S V;  4R25 A;  4DSK A;  1ZM9 A;  4OYW A;  1ARO P;  4BS2 A;  4ZJL A;  4XTT A;  1KVJ A;  1U1R A;  1TUG B;  1W25 A;  4J9R A;  1APS A;  2RT3 A;  2UU9 F;  2J9C A;  4DQP A;  3TJA A;  3JSB A;  2H5I B;  3DOL B;  4GRS A;  5SUH A;  7FDR A;  2QLB B;  2LA4 A;  4QWA A;  2VA2 A;  3C16 A;  4NLW A;  3O6Q A;  4LF5 F;  4P71 A;  3PY8 A;  2IM0 A;  2V0N A;  1RT6 B;  4DUZ F;  3G6X A;  2R2S A;  1KOO A;  3TX0 A;  4KGM A;  2MKC A;  3TQ1 A;  4TLR A;  2XY6 A;  1HI8 A;  4NI2 A;  3MM7 B;  1HQ2 A;  2AGO A;  2CQG A;  4NLX A;  3OXL A;  4RW8 A;  4WCE Q;  3M9N B;  3HZG A;  3QPI A;  2KB2 A;  3DRP A;  3D6H B;  1E6Y A;  3U02 A;  3MAQ A;  1K47 A;  1H74 A;  2D9O A;  1RCX B;  1OIA A;  2CFX A;  3MD1 A;  2ZZT A;  3ONQ A;  3AY0 A;  4Q8E A;  2GHP A;  3NWG A;  1A6L A;  3GR0 A;  2VOD A;  2DGQ A;  2IM3 A;  3MI7 X;  3DI6 A;  5DDR C;  1WUU A;  4QWB A;  3FZB A;  1F9E B;  4K0K F;  1BQM A;  3WIU A;  2JL9 A;  3HHL D;  4DR6 J;  1GK8 A;  1U0S A;  3FCV A;  2ZH9 A;  2KKH A;  5K8M A;  3EM1 A;  1B0V A;  2Y0S D;  1IN0 A;  3HF5 A;  1S4F A;  4LIW A;  2VBW A;  3QIP A;  2V8D A;  2WOM A;  3UN5 A;  2MPU A;  1FDA A;  1VQP S;  2BRK A;  4M5D A;  1FXL A;  2HEK A;  3TJ9 A;  1E6V B;  3J7A 1;  1TK8 A;  3JTP A;  5DGB A;  1SBR A;  4IRD A;  4LMZ A;  1RWW B;  4O3P A;  4CIO A;  4EWT A;  2MKJ A;  2MQP A;  3VV2 B;  3OHB A;  1YZ6 A;  3GR1 A;  3P3D A;  2HHU A;  3GIJ A;  1YRT A;  1D9D A;  5GAD U;  4X64 J;  1X5P A;  1DAX A;  3BR9 A;  1HR0 J;  5KFU A;  2AJF E;  5LM7 E;  4AL6 A;  5HJX A;  6FD1 A;  2JC0 A;  4GVB A;  4DI6 A;  3HVT A;  1S72 S;  2DB1 A;  4EYH B;  1DTT A;  2Y1J A;  2HHV A;  5DG7 A;  3TVK A;  2ZEJ A;  3UD3 P;  1PSD A;  3DRS B;  4ZCI A;  2OPR B;  3QT8 A;  2ILY A;  2LXI A;  2Q43 A;  3Q8Q B;  4C0H A;  2BVZ A;  2AJ1 A;  1JLG A;  3W9I A;  4QYZ J;  3EXY A;  4ETZ A;  4LSN B;  3EZO A;  4WF9 Q;  4RUC A;  3JSM B;  3H0P A;  4TN2 A;  2W4C A;  5B09 A;  1I94 F;  1JLA B;  4Y28 C;  2ZZN A;  4WTO B;  3LP2 A;  1M5V C;  1JX4 A;  5DM6 Q;  3H2V E;  1UEV A;  1HHQ A;  3KK1 B;  1ZET A;  1CJU B;  2EKY A;  1I5O B;  2HMI B;  2J6T A;  4HH0 A;  5A0Y A;  4B3R J;  3MCN A;  1N56 A;  1DZ5 A;  1XMQ F;  1PAE X;  3GSD A;  4I64 A;  4KBI A;  4ID5 A;  1VBZ A;  3M6W A;  3R5A A;  1NDP A;  1P9Q C;  3DM2 B;  3LUY A;  1MN9 A;  1BUX A;  1VRT B;  2VG5 A;  2XCP A;  4CO5 A;  5ETN A;  3D9B A;  1U25 A;  1N33 F;  3J7Z T;  1YIT S;  1U02 A;  4DL2 A;  3I5C A;  2Q1L A;  1FKP B;  1WHV A;  2YNH B;  1FER A;  1FJ7 A;  1IXK A;  4QU7 A;  3J81 Y;  2FZK B;  2OEJ A;  2XSJ A;  2P2C B;  3NNC A;  1JXL A;  2J5A A;  2W9A A;  3JTN A;  5BR8 J;  2NS1 B;  1NJY A;  1KFS A;  3Q24 A;  3US5 A;  3U27 A;  4RZR A;  4K2J A;  1S6Q B;  4YEA A;  1OPI A;  2R9L A;  1RWX B;  3BO2 A;  3W3S A;  2RKI B;  5ETT A;  4DPO A;  2Z4P A;  3T6J A;  2Y9H A;  3MED A;  1V9O A;  4OL8 A;  1S1U A;  2I8E A;  2YQ0 A;  3I0R A;  1T03 B;  3H4D A;  4DPY A;  1SC4 B;  2EFO A;  4UTG A;  4ZP6 A;  4V1A k;  1QUP A;  3FFI A;  1YBU A;  2OSR A;  4A48 A;  3MEC B;  2MZR A;  4X4V A;  5T41 A;  2OD6 A;  1S1T A;  5ETV A;  3BBF A;  2E1C A;  1AFI A;  4DUY J;  4C4W A;  4B3M F;  5DJB A;  2QMW A;  1CJV A;  1BGX T;  1N36 F;  1U48 A;  2FHM A;  4LF8 J;  4MYU A;  4MIW A;  3PIP Q;  1ZA1 B;  3DXB A;  2WSC C;  4ED4 A;  2EG2 A;  3PO4 A;  3N79 A;  2RDI A;  5KT6 A;  5AXM A;  1FES A;  2ZH3 A;  1WF2 A;  3VAK A;  4H4K A;  1UA1 A;  5E3R A;  2BKN A;  3D67 A;  4MK9 A;  2J9D E;  3DCA A;  4ER8 A;  1T9X A;  1YRU A;  2MGZ B;  1S6P A;  2IA6 A;  1N8R T;  1WEZ A;  4Y2M A;  3VGV A;  3IRX B;  1BC6 A;  4FF4 A;  1RLC L;  3BS9 A;  3CJS A;  3ET6 B;  1NAQ A;  5F8I A;  2E5H A;  4N56 A;  1OYD A;  3CED A;  4L72 B;  2BE2 B;  2KT3 A;  1R8P A;  5LXR A;  3W62 A;  4C0O C;  1RWV B;  1V3R A;  3J81 j;  2GFF A;  3FSI A;  5AE2 A;  2PDA A;  1MWQ A;  1KFD A;  1VHI A;  3OVA A;  5HLF B;  2FVR A;  3QRR A;  3T5L A;  1VQ6 S;  2KM8 C;  4CDI A;  1NDC A;  3QT6 A;  2CWK A;  1VQO S;  4L3K A;  3ULH A;  4ZVP B;  3GYG A;  1VYA A;  4FVC A;  5I42 A;  2R3V A;  4QWE A;  3KHL A;  4R0J A;  5THW A;  3P4U B;  1M1H A;  2L48 A;  2HFO A;  5E2Q A;  1ZAW A;  3PYD A;  3W7B A;  2KU7 A;  3HJV A;  5C2C A;  3IGV A;  4YFU A;  1HNV B;  1JLB A;  3BQ1 A;  1SH0 A;  1DFD A;  2CNO B;  2CYY A;  3FBE A;  2VFV A;  2F63 A;  2JDJ A;  4J5O A;  4IFY B;  4IO1 A;  4KKO A;  3H4B A;  1NKC A;  1L5U A;  2K3K A;  5BYQ A;  3OTB A;  1FE4 A;  2I2Y A;  1KRP A;  3EZU A;  3N6L A;  2AMC B;  3TUJ C;  2YKQ A;  1FFG B;  1TQL A;  5B0F A;  1NK4 A;  5A2Q Y;  2KFN A;  3CJ8 A;  3AJ1 A;  1WC4 A;  5F8J A;  2J7K A;  1XQI A;  1TVR B;  1L3T A;  2FTR A;  4C48 A;  1VQ9 S;  2B3T B;  3KUH A;  3PJW A;  4P7V A;  4DCP B;  3BDE A;  1VIX A;  3TAM B;  3OHA A;  3NS7 B;  1KQK A;  4FNH A;  3IFE A;  3LPE A;  4QCL A;  1SUQ A;  2ZD1 A;  4QR0 A;  3OR2 B;  4QIE A;  2J7W A;  1VK8 A;  1VHF A;  1Y9O A;  2LQ9 A;  4ZVR B;  3UNG C;  1KC8 T;  1S49 A;  1RP5 A;  2UUB J;  3WHI A;  3HKZ D;  1XR7 A;  4OX9 J;  5L1I A;  4HDH A;  3CGI A;  3VQS A;  1IKX B;  2LEB A;  5L38 A;  4Y6I A;  4HTJ A; 
#chains in the Genus database with same CATH homology
 3LGH A;  2F1F A;  3BKT A;  2HZV A;  2FGC A;  2WVF A;  2WVB A;  2WVE A;  2WVC A;  2BJ7 A;  1Q5Y A;  2CAJ A;  3QSI A;  2CAD A;  3OD2 A;  2BJ9 A;  2BJ3 A;  2BJ1 A;  2BJ8 A;  2HZA A;  3PHT A;  3BKU A;  2WVD A;  2PC6 A;  1Q5V A;  2CA9 A;  2NZC A;  2Y3Y A;  3BKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...