4AXJA

Structure of the clostridium difficile eutm protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
ANALGMIETKGLVGAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELISVHVIPRPHFEVDAILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETHANOLAMINE CARBOXYSOME STRUCTURAL PROTEIN
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
total genus 21
structure length 87
sequence length 87
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4axjA00
4P7TA 3PACA 3NGKA 3IA0A 3BN4A 2A10A 4QIFA 3SSQA 4RBUA 4AXJA 3DNCA 4QIEA 3VCDA 4P7VA 3N79A 3CIMA 4OLOA 3SSSA 5L38A 3CGIA 4OLPA 4OX6A 4DDFA 2EWHA 5DJBA 4RBVA 3H8YA 4AXIA 3NWGA 3SSRA 2G13A 3I6PA 4P2SA 4LIWA 2A1BA 4RBTA 2A18A 4PPDA 4OX7A 4QIVA 3I96A 3DN9A 3MPYA 3MPWA 4QIGA 4OX8A
chains in the Genus database with same CATH superfamily
1F5AA 3LPYA 1W25A 2HS4A 3I0SB 1ZETA 2MZTA 4FBTA 4DR6F 1KC8T 1HL6A 4LR8A 2ZH7A 2JFDA 2W2PP 4IFYA 5T14A 3A8EA 5C24A 1UAWA 1HPZA 3AA9A 3C6UB 3FBBA 4YB6A 1FT8A 1WELA 1J5OA 4I6YA 2DTJA 2PT0A 2B8QA 3QNWB 1RJJA 1MMLA 2VC0A 4JI8F 2DIUA 3CCZA 5CYMB 4DV5J 4Y0FA 1I51B 2DH7A 4HT7A 3G6VA 2QJ3A 5LXYA 4W4MA 4HVZA 3B8HA 4DL2A 4LR7A 2XSJB 4EMDA 2Z30B 2E5IA 5F9NA 2MTLA 3FRYA 4USWA 3SCKE 1UTAA 3H2VE 4QIGA 1GTEA 3SSSA 3CJRA 3G4SS 3PTWA 4PXBA 4A8KA 2A6MA 3LOUA 1WORA 1KOOA 1WHXA 3FVYA 3M8YA 3G86A 1QAJA 1K73T 1IQTA 2EWHA 4OL8A 3T5LA 4U7UK 2F5GA 2WOMA 1A0OB 1B4SA 4B9UA 1T03B 3J7YI 3Q8PB 4K4TA 3G82A 4DJBA 2J0QD 1RHMB 2WONA 2JRSA 2CJYB 1LFWA 2CA9A 3C16A 4J9QA 2ATCB 4N41A 1OSDA 2E1PA 3PZPA 3PFOA 2MKCA 3DLHA 2V5HG 2PN6A 2C1EB 2QIFA 2BJEA 5CD4H 2MEWA 2ZZMA 4CO1A 4OHZA 4EGLA 3NGDA 2HQGA 2HWHA 4L74A 1Y4ZB 2YNHA 4RW7B 5F8LA 2PIIA 2VASA 3NXZA 2GGPA 1HI1A 4P7VA 4UF4A 1MG7A 1GAOA 4C8LA 2WAQD 2VPYB 1R31A 3IMQJ 1NZAA 2ALZA 3BSCA 1ZM9A 1FE0A 4Y65A 2RKIB 3E51A 1KONA 4KIAA 5BR8J 1QUVA 2H51B 3K17A 2DO4A 1TL7A 1Q53A 2DEJA 1H2TZ 3MMAB 1D1UA 7FDRA 1ITPA 4WYWA 1WNEA 2DY1A 1C1CA 2CQ1A 3I82A 2CQPA 1JWWA 3CD5A 4KV8A 1HARA 3IC1A 3KJFB 1HNIA 2MHEA 5J2NB 2ZKTA 2G2YA 1PG5B 5HP1A 2QLWA 1WTBA 5L9NA 3W9HA 4ECUA 4N77A 4X64F 4YS2A 1FDAA 2WVDA 2D1CA 4DR5J 3MEDB 1GXLA 3ZZYA 1UA1A 5ETQA 3TZYA 4OV6A 2H9ZA 4UY85 2AEMA 3ADAC 2W9CA 3WQPA 3N5FA 2MY7A 2B3TB 4WJBA 4WFBQ 4MMOA 2BM1A 4ANEA 2FC9A 4M5MA 5B08A 1S9EA 2QC3A 1U6BA 1NK9A 4MIWA 2FHJA 5K8OA 3T41A 2HQ3A 1REVA 1WEZA 2LA6A 4QIFA 4ECYA 2X3GA 2P9CA 3MAAA 4OYAA 4HH0A 2YKPA 1RT4A 5CXTA 2HMIA 4ZVUB 2HFNA 1WKLA 1JLFB 2OUGA 1OQ6A 4FNIA 3M1VA 1KQFB 4PR6A 4LF6F 2LMIA 5KFQA 3PW5A 1R8AA 3BKUA 4IOCQ 4GVBB 2VL1A 1P1LA 5EWGA 1PJ7A 3HFVA 3MCSA 3BDPA 2J0SD 3BM7A 2HNYB 4URGA 1RTHB 3ENVA 4DUZF 2CPFA 2GW8A 3KG1A 3CIMA 3AODA 1T02A 1NO8A 3UI3A 4O3QA 2RQCA 3T1HF 3M2RA 3DLGA 1VMBA 5A8WA 1GXUA 4FYXB 2ZHBA 2QFIA 3WHIA 4KO0B 2AYMA 4WYLA 1RACB 1P8GA 2A2CA 5K5MA 1X0PA 1X4DA 4YR2A 2DPJA 3KYLA 3NOCA 1TVRA 1FXDA 4GKKF 1G6BA 2N4DA 3I4HX 1DQAA 2BQRA 4J5OA 1VQ8S 4PPDA 5F8IA 3ETOA 1RT7A 3ZTOA 4ZPTR 2ZJQQ 2NQPA 4KH0B 3OFEA 2P6TA 2MQNA 4PG5A 2LEAA 4J9OA 4PWDA 2M8HA 3H5SA 1ZYQA 1M5OC 3KG4A 3V6DB 4ICLB 4KHPF 2BKNA 2E1AA 4ES1A 3CJ5A 3WC0A 1AA1B 3NGSA 3JTPA 4NLXA 3QT6A 2BUNA 1WG5A 2HQDA 2P8IA 5IZHA 4YDDB 5LXRA 3P4UB 1F0XA 3QGHA 1FRKA 2JNJA 4WP9A 1KRPA 1XN9A 2K3KA 4AL5A 1MNEA 1VQOS 1U25A 2BJ3A 3E01B 3TO8A 4G3IA 1TL5A 2R8JA 3DHWC 1NJXA 5BYSA 1GTHA 3Q8RB 3MMCB 2HVDA 3JYTA 1Q16B 1SJ1A 4B3MJ 4YDXA 1SC3B 1X5OA 1IR2A 4ED1A 3D5MA 1HNXJ 4IO9Q 5HQ8A 1PGZA 2IPOB 2K7JA 4HR2A 4J9VA 1D8YA 3W60A 2RAQA 1EP4A 1RAFB 4UUWA 1AROP 1N33F 2AHOB 1UFLA 2G0JA 1H2UX 4DV7F 4KGXB 5GVQA 5E3QA 1M90T 3GFXA 4E98A 4I1TA 2YKAA 2FZKB 3EICA 1LQ9A 3FZBA 3EVMA 2Y1JA 2GFFA 2BR0A 4HACB 2FJBB 5KG6A 1OPZA 1S12A 3I0SA 1SQEA 1TTHB 1RHRB 2HBYB 3QJLA 1R6VA 3R27A 3TX0A 3AJDA 2G4BA 4Y3CA 4OHXA 2V8VA 4LREA 3CIZA 2AJ1A 4C8OA 1RT2B 1FVSA 1DARA 3TR5A 4C2MA 1RA6A 3C6UA 2R42A 2DVIA 2DGSA 1OY9A 2E9TA 4MAKA 3QBCA 2FHJD 5B0FA 2KVQE 1JNRB 1SKSA 4ID8A 2VOOA 5CYMA 1WF1A 1KR4A 3T1AA 4KPCA 4ERDA 2M0GB 1S1UB 1DAXA 2Y9HA 3FNNA 4OZ5A 1S0MA 2XSJA 4LFAF 1Y11A 3ETMA 5AXKA 4FPRA 3IS9B 3X3UA 2W4DA 3AH6A 2XY7A 3H5UA 4P7TA 2DGXA 2CPHA 5ETMA 2H5IB 3EX7B 1Y5IB 1LNQA 3M2UB 2XYPB 3C6TB 1TR0A 2QT7A 2HW3A 5E3PA 3CJ2A 2VONA 2XMTA 3M7VA 1FJGJ 3AD9C 3HHEA 3ZO7A 1U7LA 3ULHA 2YNIB 1RT5A 4B08A 4I4BA 5L38A 4UT4A 4P10A 4ETXA 4IUFA 4ENOA 2YWFA 1RDRA 2VKRA 1T03A 3EZUA 2DRBA 4OZJA 3S8SA 1FHTA 1KFDA 3P49B 3VTIA 3EVWA 5LMUF 1TU0B 3EMTA 2D69A 1WD6A 4WP8A 3RZAA 3KHGA 1KD1T 1FK9B 4ZLJA 2D7SA 4DSEA 2XI3A 2Y1IA 1XNRF 4DBQA 1JMTA 3SSQA 3CC7S 3RW6A 1IBMF 5C7PA 2FPHX 3GIRA 4ILMA 1NPRA 3LO3A 3N28A 1P27B 3MI7X 1GFWB 1IWAA 4RW7A 2IY5B 2DNMA 3GYGA 2IDEA 2OSRA 3CCUS 1NCLA 2V2VA 2VDHA 2OD6A 4NXMJ 4UQGA 2FD2A 1B7YB 3J7A1 2PFFB 2XY5A 4U7UD 5DS7A 4B3RJ 4S0MA 3NKYA 2DB1A 2RKIA 2AGQA 4JI0J 1NSPA 1B70B 1NH7A 1X7VA 4J9UE 2OFGX 3UCUP 3MMAA 4EYHB 2GHVC 3AFGA 3OSNA 2QE5A 1KVJA 3ZC4A 1MMNA 1F9HA 5DM7Q 3GYNA 3GYXB 1X4GA 2PEHA 3VZIA 4B17A 1S0OA 2UUBJ 2ALYB 2VQEJ 1B7FA 2DY9A 5J2NA 3VGUA 4RNNA 1Q8IA 2JLFA 4M5DB 2UUWA 4K0KJ 4LRAA 2WB1D 4FPIA 3SZ2A 4JI6J 3DRRB 1Q86T 1ZAXA 1TZ0A 2CPIA 4DOZA 3R6LB 5CCMA 1WEYA 5D0EA 3BQ2A 3MEDA 1GH8A 1YWXA 1TL3B 3HKZD 2C3MA 3ZXWA 3QJPA 1U09A 4DX7A 3SSRA 3NLCA 2Z2LA 3CW2C 2C3PA 3BQ1A 1S48A 2XQCA 2B51A 3VAGA 4M5GA 1HWJA 4DCOB 1CEZA 2E1RA 1KHVA 4TY8B 3TP2A 1CQNA 2J5AA 2WTFA 1RA7A 4K4WA 2W1BA 5J1EB 2JVRA 3PJXA 1U8WA 1U1NA 1JLFA 3OL9A 1O6XA 3CC2S 3CCVS 4DU8A 4CT9A 4G1PA 1P1TA 1Y00A 1LKZA 2JL9A 2JZ5A 1FJCA 3PG9A 1TKDA 2IFXA 3FCWA 2GIFA 4JOUA 3RB4A 4DF4A 3ZTPA 5L1LA 1RHUB 3M6VA 5KFHA 4NA3A 2HFSA 2HNYA 4KBIA 4QIVA 3BGFA 1RTHA 2DCUB 2WBMA 1IN0A 5L8RC 2H3EB 5KG4A 3T19A 3ZNJ1 1FDDA 3DU5A 3NRBA 4K7QA 4DG1B 2KJWA 2YKNB 3T5HA 1N34F 1VJQA 4QWEA 2MB0B 2KT3A 2GAHC 1T7PA 2CIMA 1QY7A 3N79A 4OIXA 2XZTB 4IR1A 4DV5F 4KO0A 1TK8A 2AEJA 2AQ4A 1VQ4S 3KNGA 1VQ5S 1DFDA 2JLEA 3CO9A 2BACA 1CJUB 4JBCA 2V8PA 2IJNA 1IR1A 1GNKA 2OKQA 5JJBA 5MAOA 3BDEA 4RBTA 5ETOA 1HBNB 1GMUA 4K4XA 1SJ4P 3DI6B 4JI1J 2CZ4A 3Q8VA 3CDBA 3GIKA 4WZQA 1S7HA 4ZPWR 4DN9A 2RHSB 5CYQA 3V6DA 2HRTA 4ICLA 2VU5A 3MPUB 1WTFA 4C8ZA 4Q43A 3M4XA 1R43A 3TVZA 2UZAA 4N7TA 1KKHA 4O3SA 2DR7A 2R8KA 1LEOA 4BCAA 4OYOA 2K06A 4TLRA 2RUSA 2BEFA 1JLCB 4X66F 4K2JA 3ENAA 4NLVA 4U8YA 1U1MA 3E01A 3UQSA 1NHKL 1U6FA 3BR8A 3UR3C 3K0JA 2Z8QA 1AUSL 2CNOB 4OZ0A 4HTIA 3UDEA 2G0IA 2CPZA 2QMUB 4RNFA 2LQ5A 1E6VA 4CYUB 1OYEA 4OZNA 3C46A 2FVPA 3TJ9A 7AT1B 3QZ8A 3VAHA 5L1KA 2XMVA 2VQFJ 4PWUA 1PJ5A 4A8MP 4BLGA 3SCIE 3RRHA 3L95X 4L73A 3TUZC 2IMWP 5K8PA 4WBFA 5GAGI 2FVQA 5DGBA 1ZM2A 5I4MA 2OD4A 3UW1A 3BKTA 1TV6B 4KYZA 4A47A 2O01C 3MM9B 5B7WA 3H2LA 1N4LA 1B0TA 5HMWA 4KKOB 4HACA 2DIVA 4ZPVR 4CLKA 1DHMA 3RBEA 2CDRB 3CDWA 1SL1A 4KE5A 4QOTA 4M1KA 3M6UA 2DXFA 4EYIB 4DV6J 3PW7A 2CZ9A 1RAAB 1RT2A 3PX4A 2E7VA 3LGMA 1H7WA 1KVKA 3D67A 4C0HA 4Q8FA 4BC7A 2IHR1 1OWXA 1YZ6A 5E3RA 1YKWA 1YQHA 3PX6A 4FS1A 2B43A 3LP2B 4W90B 2WW8A 4ZLPA 5IT9Y 3TZXA 4LF5J 1T3OA 2BX6A 5HVFA 1S1UA 4CO2A 3EGVA 2NS1B 5SZTA 1YLXA 3IWXA 3IS9A 3KDOA 4RW9B 1U1PA 2XLJA 3HXMA 4N8OA 1FNMA 3MFHA 3GSDA 5DG7A 5IWAJ 4DL3A 3GONA 2WSFC 4MYTA 3DNCA 4JB8B 3M2UA 2DNZA 2Q1LA 3TA2A 1VQ6S 1YI2S 2R8GA 2AYEA 3C6TA 1UP1A 1HYSB 3POTB 1BLUA 2CNKB 2DNLA 2VFSA 3I6PA 4IOAQ 3CMES 2UUTA 2MZ1A 4F26A 2IDLA 4ZJOA 2AGPA 3GJQB 1G7CB 1NB2A 1UA0A 2YNIA 4EBEA 2VFVA 1ZM4A 2BZ2A 4PYAA 1NK0A 1KN6A 4ZA1A 2QL5B 3H98A 3TVKA 2MZSA 2QA4G 4QWCA 3M6XA 4RU9A 3AOCA 2ZITA 1YGYA 2I1RA 2ZVIA 2ZBRA 1RAJA 2ZD1B 3N6LA 1PJ6A 4ZP9A 3LP1B 4RUBA 4DV1J 3JXOA 1NNDA 1FK9A 3KFWX 3OUYB 4ECZA 2G1DA 4GO5X 1FFSB 2VV5A 3FRZA 2ZH6A 5RUBA 1RE1B 3BH6B 2O67A 4C3MA 3W65A 1YJTA 3B4DA 2W9BB 1QSSA 2V68A 5A76A 1WDTA 1RAHB 1YJ7A 1PBUA 2RVJA 4E8UA 3Q8YA 3HULA 1MN7A 1XR5A 2XGPA 4C98A 4GRSA 2GHWA 4F67A 1DTTB 4F50A 4RBVA 3MURP 1S6QB 2WW4A 5EHHA 3BV8A 3HVTB 2ZOGA 3WX8A 2V0NA 4B3SJ 1UWAA 2E7WA 3RBDA 1ELOA 1SH2A 3PW2A 2HQFA 4JI4J 2EK1A 4USKA 3BH7B 5JUMA 3RU0A 3OT9A 1NRKA 1HWUA 2VUGA 1M5PC 5A6PA 3H4DA 5B0DA 5HI7A 3QFWA 2LVWA 2IAJB 4P52A 2MGZA 3RB6A 2NCKL 1FJEB 3P5BP 1QD1A 4RNOA 1UJ4A 4M5DA 2FDNA 4NCGA 4K4VA 2V8DA 2QRRA 4USIA 3DRRA 3MUVP 3UD4P 5A2QY 5KFWA 4OJGA 4KAIA 2LU1A 2KFZA 4R8UB 2GMHA 3W62A 2HHTA 2ZBCA 1TL3A 3K59A 4H4OB 4EZ9A 2AJ0A 1SXLA 1F5BA 3DMJB 4OHYA 1FEHA 2UUAJ 1RT6B 4R0JA 1V5VA 1YJNS 5F8JA 4NLUA 1HNXF 2BV3A 3CULA 6FDRA 3NS6A 2JJ4D 1ZZFA 4TY8A 1Q0NA 2IM2A 2ZM6J 5JVHQ 1HWIA 3KMSA 4PYDA 1VDHA 3CJKB 2BE2B 2E5LF 1S1VA 4OX7A 1NPPA 1SQGA 1IR0A 2FZCB 1TMJA 5J1EA 5HVGA 2WVBA 1QDUB 2WSCC 3UN3A 3IGVA 1WG4A 2YWKA 3D54A 4ECXA 2IYIA 1KTQA 2RNEA 1FJ7A 4TY9A 3CPWR 2IVMA 3DOKB 1FWPA 1MLAA 2WVFA 2CJXB 3LW5C 1J27A 2DXEA 1ZA2B 4F3OA 3S7RA 2VFUA 5KFKA 1H98A 5AE3A 2X7IA 3NGUA 3UNYA 5AXNA 4QWDA 1SJQA 1S1WA 1U47A 2W24A 1XWLA 5I3UB 1EQ0A 4ZPDA 2XLKA 3FJ2A 3HI9A 4DG1A 1SCJB 2YKNA 5C2GA 5DLFA 1B0VA 1FE4A 3GCXP 1R3NA 2AJFE 4NLRA 4JI2F 2HHHF 4ZP7A 5IT9U 1HQUB 2PA8D 3QGPA 1RCXB 2JH3A 3KUGA 1SJRA 4KT0C 1CJUA 1IUJA 2B5JB 2XMWA 1CJTB 5LJ3Y 2RSQA 3CDEA 3R1LA 2X1AA 3SBMA 1I1GA 2JEJA 1A9NB 2NLWA 4M5LA 1HBNA 3V5RA 3DI6A 1ZA1B 4P2XA 3HO1A 4DL0C 2RH3A 3IXQA 2YQ3A 2XLIA 2DD8S 4CT8A 1WSRA 1RCOB 4IG3B 1SUQB 2IC3B 4ELTA 1Y10A 1QM9A 2IJRA 1ICEB 4ZVTB 3J81j 2OIHA 4DX5A 2BE7D 2JHEA 4M8LA 4PWWA 1NDPA 4G1IA 1FCAA 3PKYA 1R0CB 3OXFA 4ZVEA 2YQ1A 1JLCA 2V4QA 3KLEB 3DYAB 4DFPA 9RUBA 4ZOSA 1V3RA 4LRDA 2XWYA 2G9OA 4XDCA 2VF3A 1X8DA 1MWQA 4J90A 2ZJRQ 4ECRA 2EFPA 4EI2A 2G1HA 3HHLB 4DR7J 2R9LA 3VVUA 4CYUA 3TUJC 1FRIA 1GK8A 4C3KA 4ZLLA 4RZRA 2DHAA 2ADCA 2J0XA 2Y3YA 1VC0A 1HR0J 1G3OA 4P2SA 4ES3A 3MM7B 4XDDA 4CO3A 1Q95G 1FNOA 1BWEA 1TL1B 3BBBA 2WCXA 2MPUA 1TV6A 1IBLJ 4BS2A 3MM9A 3RRGA 1HHTP 4X84A 1L3TA 4KKOA 2DNHA 1A6LA 2Q66A 2XI2A 4R25A 4ZP8A 3OTCA 1JJCB 2PGCA 3CCRS 3TRGA 1V5IB 2UUBF 4I0WA 4WK3A 4NMLA 1KNZA 1A7GE 1WKKA 4I2QB 4P73A 2OSQA 3B6BA 4K0KF 1Q8BA 4F36A 1HQ2A 3OR1B 1RWMB 2QLFB 2BKPA 1VCTA 1NJIT 3NAHA 1G2EA 4DMZA 3IRXB 4OLOA 5A2QU 2XGQA 3LP2A 3AOBA 5IV3A 2QL7B 4PQUB 4M94A 1N52B 2XS2A 3OTOF 3QATA 1O0PA 3THTA 4NEZA 1R8PA 2RDIA 3GQCA 4RW9A 1RAEB 4F7VA 3UN5A 1UFKA 3GV7B 5IXUA 1YIJS 2RF2B 2UV8G 2J9CA 1YJUA 4DSLA 4TYBA 2LXIA 2WZ1A 1U45A 1XERA 1HYSA 3POTA 2RMLA 5DM6Q 4LFBJ 3QWPA 5D3GB 1WKJA 2HK3A 4OX8A 2DNQA 1H0HB 3T5JA 1NJWA 2YNGA 2CQ2A 4ED2A 2L48A 3O3LA 2V2QA 2KXNB 3CCJS 3G8QA 4O3RA 2CQHA 4DL6A 2EBEA 2BBEA 2ZD1A 4WFNQ 3V81B 3LP1A 1EAYC 3T3FA 5AJ3F 4YQWA 2JC0A 2ZH3A 3OUYA 2MJNA 3ZZUA 2K2PA 1PO6A 3SV4A 1PCAA 3TX8A 2V4RA 2RJZA 5KFFA 2HQCA 1U8SA 5HROB 4X62F 4WU3A 4LF8J 1WEXA 1RYRA 2CAJA 2W9BA 3BPSP 2F3JA 5T41A 2D9OA 3G6ES 5KFPA 1KSPA 5E3CA 1QVFR 2R2SA 4F4YA 4IQXA 4NMXA 3CJ0A 1DTTA 3DRXA 4F3MA 3CD6S 1S6QA 1ULRA 1BQNA 2P2CB 4HHUA 3FEXB 4KRWA 3GLJA 5B0CA 3HVTA 3I55S 1IKYB 3GWCA 1T9WA 1RZMA 4NZ7A 3FBEA 3CVKA 5D15A 4YR3A 2FUG9 2IA0A 4OZ2A 3VZHA 2DGTA 3UD5A 2FVRA 1KQGB 2Y0BB 4M5HA 5THWA 1GX6A 1SBRA 2XBPA 4IH7A 4CH1A 1HQEB 1ZZNA 2DNGA 1JLBB 4ECTA 5IQ6A 1NB7A 2C2OB 2IAJA 3SEOA 2POKA 2ROEA 1U48A 1VQYA 4BWJA 1KBRA 1TQLA 4I56A 3K58A 4GC7A 3QO9B 3EPIA 2F4FA 3A3OB 2L9NA 4R8UA 4V19J 3VAKA 4RWWA 1YRXA 1RADB 2GMLA 2HZVA 1W7WA 2Q6CA 4H4OA 3I5AA 3DMJA 1RT6A 2F4VJ 2J8SA 4OX9J 2NPIA 3U1LA 1P9YA 2GAGC 1HBOA 5ETSA 2B9EA 1HWKA 4JYAF 2GA7A 1RHKB 2MQMA 4DEZA 3CJKA 4U8VA 1CQMA 2BE2A 1PBAA 4ZVSB 2GX8A 2VQFF 5ETVA 2P9GA 5KFUA 1FO1A 2H5JB 1NH8A 2DRDA 3DDNA 4OJ3A 1PYSB 2XNQA 4QR1A 1DBDA 2CJAA 1N8RT 3DOKA 1F9EB 5KTQA 3TAMB 5DDRC 4QW8A 4ED4A 3U27A 4C0BA 4AQYF 2F8EX 2QV6A 1CULB 4CLYA 4FXWA 3R5BA 4CTAB 1B99A 5EX0A 5I42B 3M30B 2VBZA 1WOPA 4RWXA 4FKYA 2UVWA 3LWMA 3C8YA 3Q2TC 2RRAA 1N5QA 4X4QA 1RWVB 4ZHRB 4QU7A 5I3UA 2V9KA 4TU9A 2MY8A 3SDEA 4F4ZA 3M8QB 2B9XA 1R8BA 4HT5A 4DV4J 2B0GA 3V6KA 4C3LA 3K2YA 1ZPVA 3MPDA 4OI4A 4Q45A 5DLGA 2O5DA 3MM6B 5KG1A 1BE4A 5L1IA 4DR1F 2MLXA 3K8VA 2ASYA 5KFZA 1U49A 1HQUA 4TLQA 4RKUC 1L3VA 1CBKA 2XHWA 3RB0A 1S7IA 1FFGB 5D0HA 2B5JA 1CJTA 1VRUB 2BDPA 5IWAF 4ECVA 2ZNYA 1UMJA 2YXLA 1FA0A 3BPDA 4JI3J 2HZAA 2DNOA 4YB7A 2A10A 4QR2A 2G2OA 1KFSA 5LM7E 4USMA 4M63A 4OLPA 4CO0A 2LA4A 4IG3A 2XMUA 4QZVB 2AX1A 1SUQA 3CJ8A 2IC3A 1B3TA 4DZDA 1HNWF 1AW0A 3AOAA 2OPSB 2RRNA 3D7SB 2R7SA 2J9DE 3CMQA 3H40A 4KSEB 1NEEA 5IFMA 2UXCJ 1N5VA 4L3NA 2YQ0A 3CEDA 5GAHU 3KLEA 3DYAA 2DISA 4UTGA 2AZ3A 3P45B 5E2QA 2EI5A 4QPXA 3CJQA 3N0VA 3OXLA 2V50A 4Y2MA 2HBQB 2FB0A 3U1NA 5F3ZA 3HHLA 2Y8YA 1REGX 2MZRA 4CLWA 2KM8B 1JNZB 1VK8A 2XCPA 3DGVA 4IH5A 4XPEA 3V4IB 1OSCA 2HG4A 2HGLA 3MOJB 1X9WA 3DCAA 4NRTA 4FF2A 2CQDA 5DO2A 2JDJA 4CP5A 3HKWA 3MM7A 4FYDA 3B54A 5M2RA 2GJIA 3O5TB 1HNVB 2PO4A 1RTJB 3RB3A 1TL1A 3BGRB 3PKMA 4DXLA 1IJFB 4JV5F 2VA3A 4JI4F 3SXLA 5AT1B 3M9MB 1S6UA 1S9EB 2HURA 1MROB 1BC6A 1FX4A 2GVZA 1JKHB 1R7IA 4L72B 3OFHA 3GILA 4ZITA 4GKJJ 4OYZA 3MAAB 2MZJA 5L39A 4X2BA 3MR3A 2QZ8A 4I2QA 2B56A 3S6EA 2KHCA 1JXVA 1IBKF 1NPKA 1VOMA 3OR1A 1WUUA 4OHWA 1VISA 4A48A 2OEKA 4ZVQB 4K4YA 3LTOA 2MZQA 3IRXA 1RU1A 4FP9A 1SKUB 3HF5A 4ZIVA 2X51A 4PQUA 4DV0J 4FF3A 2DPIA 2EG1A 1DQ8A 2UUAF 2XULA 3BN4A 1FI4A 4RJVA 1WACA 2VB6A 2DITA 5LSLA 4FZVA 2PA3A 3L7OA 1SIWB 2XYHB 4WKRA 4K2XA 4ER8A 5D0GA 3PX0A 4AD6A 2ZM6F 3EGWB 3D9BA 2HVIA 3EJMA 1G4CA 1RWXB 5DDQC 2XG8A 4ES2A 5D3GA 1CJKB 1N54B 4PQAA 4A8SA 3FMBA 1FRJA 4M5JA 4KB7A 4P74A 3BJYA 3AJ1A 3RR8A 3TJ8A 1AT1B 4IYQA 3SCLE 2AMCB 3VQSA 2NUUG 3Q24A 1LOUA 3FC9A 4RW6B 2Z2MA 4C8YA 1WJ9A 1JXLA 3V81A 4EO8A 3HHKA 2VPWB 3BF4A 4ZDNA 5KFGA 1F3FA 1LK5A 2OELA 4PWDB 1U1OA 1TFYA 2WVEA 2L9DA 2B4OA 3PIPQ 2JFKA 5HROA 3CB4A 4EK2A 4F4AA 3N6MA 3QRQA 2W7OA 4DWIA 1NK4A 2DH9A 3CF5Q 3KUEA 1F1BB 2M5YA 5BYQA 1L3SA 1SJFA 2EBGA 2CQGA 2DNPA 3ISZA 5C25B 4OI0A 4JV0A 2I8EA 1FKPB 5K8NA 4P9SA 1XMOJ 4MKVA 3H8YA 1SI9A 3TQEA 3VV2B 1WOOA 1IKYA 4OI3A 2W9AA 5E3AA 3PW0A 4QU6A 2UU9J 2DR9A 4DI6A 4PG6A 3CJSA 5J2MB 1JK9B 1D09B 3FZ2A 3HD2A 3D0IE 3HSJA 3MTJA 1U4BA 3DFEA 1S97A 4TQRA 4K4UA 5A8KB 4ZPAA 1K44A 5KT3A 2XEXA 1OIAA 5KFXA 1HQEA 4IQMA 4NX9A 1KQKA 1JLBA 3OBIA 1EQMA 5DDPC 1DZ5A 3MDFA 4X4UA 3LAKA 2QMXA 2H1YA 1P9QC 2QGFB 2DNRA 5KFAA 1RLDA 2W2OP 3ET6B 2BW2A 3QO9A 4H4MB 1RBOB 1LV5A 4R0EA 3UD3P 2KYZA 1JJ4A 1CC7A 4J91A 3NMRA 4DZ6A 4HLBA 4FYYB 4NRUA 3W61A 4PCQA 3WZ0A 3AQOA 4QWAA 3TUIC 2KKHA 1RUSA 1YRUA 2PC6A 4YY3J 1MN9A 2NXNA 1FWKA 2AYBA 1D8ZA 5FLXY 3A12A 3I56S 3R2DJ 3BYRA 5D77A 3MGJA 4ITSA 4B02A 2EK6A 1OJ4A 4DR3J 3MEKA 5DDOC 1URRA 3CO0P 2CUYA 5E5NA 2RE1A 2MQQA 3L4BC 3K57A 1HR0F 4LUBA 1U2FA 1NLKL 3H4BA 2M9KA 3PEJA 2GNKA 1H7XA 1R8CA 2DGUA 4AE5A 1IM6A 3JB9k 2O66A 3TAMA 1XBWA 4NASA 2Q43A 4C9DA 4MIAA 1O51A 1M0SA 2ROGA 1CULA 5DZ6A 1EIYB 3FDSA 4CTAA 2Z56B 5I42A 3M30A 3W8PA 4ZCKA 2KO1A 4ZHRA 4NYPA 3FMWA 4DR6J 3M32B 3HFZB 3M8QA 4F2SA 5IS2A 2FLOA 3U1MA 1RT5B 4U95A 3IGNA 5F41A 5BXIA 5KG7A 1CG2A 2ASJA 4NCBA 1I3OB 5E0OA 1YJRA 1NZ8A 3UWTA 3MM6A 1HI0P 4RUHA 3PY8A 3FQKA 3AD7C 5GAEU 3HVRA 3M8PB 1VI7A 1MWZA 5HK4A 1NXIA 3TQ1A 3M2VB 5IV4A 1FXLA 1EKSA 2LYVA 2OHDA 3L3CA 3OVAA 4Q2LA 4PG7A 1WC1A 2XB2D 1FF2A 1AYEA 1VRUA 4Y6IA 2JVOA 1BD6A 5KFCA 3MCNA 4ED5A 3R5CA 5KFJA 2QYGA 4FBUA 5FJ4A 3GG0A 4I68A 2AYGA 2KTQA 2I5JA 2XWXA 2UXDJ 3R5GA 2MKYA 1C2PA 1VBKA 3EZ5A 3ILJA 1YK9A 2DNYA 2CKWA 1JB0C 2G0CA 2OPSA 2BQ3A 3OFFA 4KGKA 1SC1B 4B9TA 4X4VA 2GS8A 4DL4A 2WK4A 1HWLA 1EARA 3Q8UA 3JTOA 4USVA 4YFUA 3ELHA 1J2VA 2J9EA 3G6YA 4DR2F 1XC9A 4QYZK 4N5SA 4DDFA 1OPIA 3A8KA 4ZMMA 4X4RA 1YBTA 4QQBA 3K89A 5ETLA 1OY6A 1H2VZ 4LF8F 4ZVFA 2ABYA 2EFQA 2GO8A 3HLUA 1JJHA 2V6AA 4NLDA 2LQJA 1X4HA 3QYYA 3UVJB 4OYWA 4UUXA 2G13A 3V4IA 1S49A 4JI7J 4BC9A 1G1XA 1QAIA 1C0UB 4XAKA 2BMBA 4DFMA 1Z1ZA 3VF0B 2M8DB 4NYOA 2DT9A 1U02A 2YX4A 5A8RB 4Q8EA 4DQQA 1HNVA 4C4WA 2MQOA 3RAQA 4J37A 1RTJA 2Y1RI 2V67A 3BGRA 4DU7A 3K5NA 2FHKA 2HK2A 3PEHA 4IRKA 1ACMB 2YH0A 1MROA 3K5PA 2J9DA 1HNZF 4F04B 1JKHA 2YX7A 2MHNA 1HMVB 3C3LA 2GMJA 4NLYA 4RNMA 2LQ9A 1SQFA 4HKQA 5IT0A 3OTDA 3QIPB 1H74A 3TAQA 5HLFB 1X4CA 2RD5C 4Y2IA 2HSEB 4EFAC 4AUKA 2CXEA 2ZNZA 2EVZA 4ECQA 4DCJB 3HZGA 2N3LA 4B3TF 1ZM3A 5KFOA 2EPIA 3GJSB 2KYXA 2HKEA 5C5JA 1IQZA 4X64J 1PAUB 4CCHA 1HIYA 4JI5F 2M88A 3LWLA 2CDQA 1VR6A 2LCWA 1S72S 3BZQA 3TVYA 2F4VF 2E66A 1IKXB 2J76E 3EXCX 4CRJA 2FJAB 2YWEA 1K0VA 4C8MA 4F0KA 3FEYB 2HHWA 2KVIA 2BQUA 3J80Y 1FX2A 1T05B 2MQ8A 2HNZB 3AHPA 2XMJA 1CJKA 2Z2ZA 4LIWA 3C66A 4WXWA 2OH2A 3MPYA 4DV2F 2RU3A 2LP4A 2OO4A 4LR9A 4WPAA 2JLGA 4LF6J 1AZSB 4A8FA 2BW7A 2VJUA 4FXVA 2C3YA 4RW6A 1NSKL 1F60B 1YRTA 4P2FA 2W7PA 2XS5A 2RQKA 4NXNF 1T3NA 2WBRA 4WE1B 5JMNA 3O44A 2LDYA 2VC1A 1R27B 3GV5B 5CYQB 3TYTA 4DQPA 3JSMB 3CCMS 2I38A 3MM8A 2IYGA 4A8WA 3H0PA 2PI5A 2XMAA 3F44A 2HFUA 3T1HJ 5B0BA 3MM5A 3NBPB 5C25A 3N01A 1FKPA 2ZJPQ 4RBUA 5HATA 1Z4UA 2VDIA 4PRFA 2W25A 1T8EA 1UETA 3W8GA 4HYKA 2MKJA 1TKXB 5GADU 2LXFA 3IM9A 2UVVA 1TUWA 2MDAA 2RT3A 2RDDA 1D9FA 1DLOB 4JI3F 5J2MA 4PXEA 3D6HB 1X5SA 4O44A 2ZC4A 5A8KA 1E6VB 1Y9OA 2DGQA 4NEYA 2GVDB 4LF7J 1NAQA 4IFVB 3RG6A 2H5EA 4KGZB 3MCMA 5KFVA 2M70A 1XK8A 1IBCB 4NLSA 3G87A 1XMQJ 1ZTWA 2H4YB 1S5ZA 1O8BA 4KHPJ 1O5JA 4ZJLA 2AX0A 2BXJA 4A8XA 2LKZA 2UXCF 1NJYA 3DRSB 3ET6A 4H4MA 4AYBD 1S6PB 2IBKA 3PRVA 1VQNS 4WFXA 1VQMS 2ZH4A 4NWBA 1AB8A 4KFBB 3F41A 3CGIA 4JUZA 2M3DA 4NOHA 1ZBTA 3SFUA 2N82B 4DQSA 4QWBA 3IA0A 3OFGA 2V63A 3HHNB 1TL4A 4UZCA 3Q22A 5KFBA 1M1HA 1RK8A 3UDLA 2MKIA 4LRCA 1KS2A 5F9LA 3CCQS 1UEKA 4K50A 1Y5NB 3MXHP 4DV7J 3OQ2A 1R0AB 2GV1A 1QVGR 5D6GA 2DH8A 3LP0B 4LFCJ 1UW4A 1ZAVA 5KFDA 3KK1B 2YKQA 3IR7B 2FLPA 3CMAS 2XYGB 4GKJF 4MK7A 4DFJA 3MD3A 2UP1A 1BXNA 3R3TA 3OV7A 1GX5A 3GJRB 3Q86A 2IM1A 2J7WA 3M32A 4Y2AA 2I2YA 4OZLA 1TK0A 4MH8A 2C42A 2BOAA 1S9FA 1WI8A 1VHIA 1FNXH 3R7BB 2J6SA 1ZPWX 1UPPA 3G9CA 1ZOTA 3M8PA 5H9EK 4FKXA 3EYZA 3HX9A 3M2VA 3DLEB 3HSZA 3GV8B 4PABA 3HP6A 1S10A 3EUNA 1QTMA 3HPOA 1M5HA 3PXGa 3DLKB 1N32F 2LLZA 1TFWA 2BJ7A 1EKRA 4I6WA 2WSEC 4YHHF 3EVOA 1GT8A 2K8GA 1K8AT 5I3QA 3QT7A 2QSWA 5H9FK 2O1PA 5CHCB 2B9YA 2W2NP 3J80U 1UEUA 4CM2A 5L46A 3OJSA 5CZXA 1PILA 4X65F 1VQSA 4J9MA 4I7FA 3LUYA 4Z37A 2GIQA 4Q7AA 2AKWB 4H54A 2BJ8A 5K9FA 3IR6B 8AT1B 3NNAA 2DHSA 2YPZA 3GR0A 5ITHA 4P6QA 2VHGA 1F3VA 3HVWA 5K20B 4WXOA 3V6JA 2KI2A 1I94F 1YZ7A 5CA5A 1IWGA 2KJVA 5LMUJ 1MW7A 1AFJA 2R4FA 3KXDA 4PUOB 4HEA9 3KTQA 5HN0A 3T5KA 3E3XA 2OGUA 4G65A 5L9XA 1TKZA 2QYCA 2QN6B 2MGZB 1IBMJ 4MK9A 1VLOA 5KFSA 4N56A 3GJTB 2N4CA 3FFIA 4JV2A 2HIQA 2OMLA 4NCGB 5CYJA 1HD0A 5LSOA 2XTJP 3UVJA 3FCHA 1Y5LB 4LQ3A 1KEKA 1JJ2R 2AZ1A 4YUDA 1XMOF 5FIIA 3RBXA 1C0UA 2FC8A 1DTQB 2QA2A 1NBEB 3BR9A 3UN2A 5A8RA 4RUCA 1OMSA 3R97A 4O3PA 2UU9F 3HHLC 3NWRA 2VG6B 1H3DA 4Q5VA 4ZVHA 3QWUA 2ZH9A 1NK6A 3CNQP 2FJDB 1J5EF 1IKWB 2CQ0A 3H7HB 1YSJA 2C2KB 3R7NB 2LECA 4PPZA 5KFNA 4BDPA 1HMVA 1EJ7L 2D3ZA 1S1VB 4LF1A 4C8KA 1TUGB 2J8AA 3QIPA 3KK3B 2I9SA 2OTJS 5HLFA 2IRXA 4K59A 3W9JA 1VGYA 1K47A 4LQ9A 1T0TV 2ZHOA 2F63A 3P3DA 2A1BA 4KQZA 1AXQA 5G0RA 3HSGA 2B4VA 4N47A 1VBYA 2QL9B 1XIQA 4USUA 2AJ2A 1F9FA 1S59A 3NCRA 4G6VB 1DY3A 1RBAA 3TAPA 2NYHA 2WHOA 1GEHA 2GIRA 1I6JA 3R8YA 1RWUA 4CDIA 3HSDA 4ETZA 4YY3F 1S1WB 2RUGA 3CCLS 5D4OA 1JLAA 1IKXA 3IAS9 4AXIA 1X4FA 1RQ0A 4PAAA 1N0VC 1RBLA 3CD0A 1T05A 2ZFHA 2RILA 2OPPB 2HNZA 2M52A 3PYFA 3SIPB 3R1HA 2NR0A 1X31C 1HBUB 1VC5A 4LIRA 1YBAA 3BSNA 3UO0A 3D0HE 2HEKA 2KDOA 1WHWA 2HGNA 2VODA 1AZSA 3AA8A 3QGIA 4CO5A 4LSZB 1N5SA 3JQKA 2DR5A 4UOCA 4NLPA 1X4BA 4TYAA 3NS5A 3H25A 1VFJA 2VKZG 3HD1A 4RL1A 3A3PB 2VIHA 3F73A 4DQIA 4F4KA 4U9RA 4WE1A 1VRTB 3GR1A 1VIOA 4HDGA 2HPUA 4WIQA 2NXEA 3JSMA 4DX8H 1VQLS 1F5CA 1EETB 1UVNA 4B9NA 1S1TB 3A13A 1N34J 3NBPA 3I5CA 3DLJA 5B0EA 4ZCMA 2KH9A 3UR0A 2FZGB 2CWXA 1RHJB 3QRPA 1BMQB 1S4FA 1RKIA 2BYCA 3KLFB 3CCES 1TKXA 1UL3A 3H2UB 5ETPA 3A8IA 2Y0SD 1DLOA 4TKTA 5EGYA 2OAUA 3HM9A 4NZ6A 4ZVGA 4RW8A 1CSJA 4PZVA 3NNHA 3EGZA 2C3OA 2UXDF 2GVDA 3P96A 2L3MA 3HCXA 4IFVA 2GCFA 3N4WA 3W5XA 1VQ9S 2XSFA 3MR2A 5BR8F 5ETTA 3TA1A 8RUCA 3ISND 1TKTB 3I5BA 1JXEA 2CZVC 2GC8A 4EWTA 1RTZA 4J9LA 3DRSA 2PMWA 4O23A 5F3TA 4BBYA 4TN2A 4Z7YA 3JQJA 1S6PA 3RTVA 2YH1A 4LBHA 3DLLQ 3C2PA 1Y3JA 1P6TA 5GMKa 3EDQB 3RAMA 4YB5A 2OJ3A 3JS9A 4X66J 2PEBA 2FQQB 4CO4A 4KFBA 2A0FB 1RWKB 2J7KA 1N0UA 4UW2A 5KT6A 1NU4A 3PHTA 4OI6A 3PIOQ 1LW0B 1T94A 2R7RA 1X4AA 3VAIA 1WC6A 1Z2ZA 3EZOA 3LH2S 4JI7F 1KQSR 1CC8A 4C48A 5HQMA 3PVXA 2HHVA 2NYIA 4KY3A 4X4PA 4DR5F 5KFRA 1MU2B 3JAMY 3RYLA 2RHQB 3GCWP 2DGVA 2HWIA 3HVAA 1YG0A 3CCSS 1R0BG 1R0AA 1BQMB 4F0MA 3KDNA 5KFEA 3T1YJ 3LP0A 3TEHB 3RR7A 3IWNC 2HYIB 3KK1A 5F8GA 2BJ9A 3IBWA 5G4DA 2KL8A 5KG0A 3Q8SB 3O1LA 3LA0A 3GZ7A 3BEGB 2OEMA 2KT5A 2W8LA 1BQXA 2ZWOA 2PMHA 1NKBA 2HS0A 4ANDA 4M5NA 4DHVA 3Q83A 2MSSA 3UNGC 2YNGB 1RTDB 4WF9Q 2C2ZB 4BWMA 4FNHA 1N5YB 1WC0A 3CJ4A 4DX6A 3KHLA 2H54B 2ZOFA 4RR5A 3TI0A 3RAXA 1K1SA 3DLEA 5LSRA 4NZ0A 3MAQA 4D3GA 1WC5A 1YJVA 5HBMB 1ZH5A 1ZAWA 3DLKA 2FTRA 3CUNA 4M95A 3JSBA 2HS3A 3QSYB 1E6YB 2I0XA 5A6WA 4IR9A 3BGLA 2CVEA 2F8MA 5DQGA 2HHXA 4KC5A 3EDRB 4U6PA 4URSA 2F1FA 1IVZA 1MWYA 5IM0B 1S57A 1BQNB 1QLNA 4JV1A 1N56A 1Q4RA 1RWWB 3P5TL 2AV5A 1XQIA 2VBXA 3MTKA 4ALZA 1VLYA 4N8NA 2FYXA 4YN3B 2YWWA 4KJIA 1WI6A 2Z4PA 3PR4A 5LL6d 2CQ4A 1S0NA 3ENWA 2R7UA 3EPGA 1QAXA 1LK7A 1HBMA 4HTJA 3J7YU 2DHXA 2R7XA 3CE8A 4PUOA 1SVDA 3CWJA 3MEEB 1XTZA 2DNKA 3BREA 4FF4A 3OR2B 5KFIA 2HFVA 2ZBPA 3GIMA 3O8WA 1Q82T 2CPDA 1OQ3A 4P75A 2KFNA 3TANA 4V19X 2VG7B 1EHWA 2HGMA 1DTQA 1SKRA 4DLEA 5D4PA 4RX6A 2ZUAA 4Y2KA 2KXHA 5F8NA 4A8OA 1YJ9S 4B3MF 5F8HA 1T95A 2VG6A 2KM8C 3EGNA 1HBOB 1LW2B 3DOMB 1IKWA 2RU9A 2B7BB 4DPWA 4LF7F 2HRYA 3DDKA 2X1BA 4NYZA 4NLGA 4EBDA 2HIYA 3TNVA 2Q79A 1YHQS 1EZZB 2P6SA 1SC4B 3L09A 3RUBL 3J81Y 3KK3A 2ZH2A 4FVCA 2EFOA 1XR6A 1XMQF 4CI0B 2RQMA 2MMYA 1KP6A 2A6OA 1U2CA 2QLXA 4C97A 3LPEA 4F2RA 2GQQA 3R2CJ 1LXJA 5CQGA 3SYZA 4PG8A 3OLBA 2BKOA 2DXDA 3ZTRA 1UVKA 4LSNB 1B0PA 4KR0B 4KH1B 4WIIA 4UZBA 4TVAB 2ASDA 2DYAA 3SDEB 5LT5A 3PO4A 3T6BA 2FY8A 4ZJQA 1UJ6A 4YMEA 2OPPA 3NCQA 4GVLA 1CS4B 1PSDA 1HBUA 4OYPA 4IDKB 2E5LJ 3JAMU 1UVLA 2ZKUA 1RKJA 3A4TA 5C42B 3OVSA 3GB0A 4EBCA 1F2GA 4LJMA 2Z2YB 1HI8A 3VQTA 1FRMA 3NP5A 3BS9A 4LFCF 2BRKA 4OQJA 1KLMB 5KFYA 5F0WA 3K5MA 4MTPA 1FJGF 1WHVA 1VRTA 3M9NB 4NE9C 1XEZA 5EDWA 2WB4A 4Y28C 4MIBA 5AE1A 5HO4A 4MJKA 2KT2A 3B4MA 2YWGA 2W4CA 1LWCB 1EETA 1IKVB 1TUVA 3IBCB 2HHUA 2B8PA 2H4WB 1N5TA 3MF5A 1S1TA 1S77D 3WC2A 4FVMA 3K8WA 1U24A 3PCOB 3I9ZA 4XTTA 4ZVPB 4MFBB 3EWGA 2ZZNA 4I2PB 2QMWA 3I96A 1W2IA 2M7SA 1LWXA 3FGVA 4JI2J 2JSXA 3UCGA 2HHHJ 1C4CA 1DRZA 3KNAA 3Q2SC 3KLFA 1NUEA 2EFGA 2HAIA 4DS5A 4PXCA 1XMBA 2YNFB 4CLSA 2FVSA 5HSPA 1Q8LA 2XM3A 4DPTA 2HHSA 2BANB 2AU0A 2ZH5A 4PEOA 3FSXA 1SH0A 4NXMF 1DURA 2VJVA 3W2WB 2R7WA 4CWBA 2RB7A 2BJ1A 2MSTA 4B3RF 3IG1B 4OYBA 4P72A 4JI0F 3N9UC 3GG1A 1RWOB 1U1KA 1TKTA 2CG4A 2OP5A 1FKOB 1N48A 2LEPA 2NREA 2HBZB 2V9WA 2YKOA 4A46A 4QYZJ 3S1TA 4DLGA 2M4MA 1X9MA 2C2EA 2WVCA 2EC0A 2GVZB 3MHYA 3MEGB 3GPAA 3QJJA 5HMXA 3H42A 1IXKA 1RI7A 3BGUA 4DV3J 2R7QA 2J6TA 2V2KA 2DBBA 3FBFA 5DQHA 2VQEF 2UVRA 2VA2A 5IT4A 1JLGB 4LSLB 4LT6A 1LW0A 2RIJA 4JI6F 4H4KA 3IBFB 3MECB 2J0WA 5JVGQ 2K3IA 3FEZA 3RRKA 2DKOB 1PKUA 1MU2A 5HL7Q 3DGPB 5ETNA 1T11A 2V4JB 2KXFA 3QQCD 4I64A 5KFLA 2PI4A 1VJWA 1WF2A 2VD3A 1BGXT 1WOSA 4OHVA 4WTYA 1ZTTA 3G8TA 2JEFA 2W01A 1BQMA 4DUTA 3QPIA 3M9OB 4CNZA 2YBVA 4XO0A 3CSKA 3WX4A 3PYDA 1F2HA 4URQU 3A3NB 2KRBA 4ZCLA 1T9UA 3OD2A 4NI2B 4Q44A 3ZNUA 4GC6A 2XO7A 2DNNA 1PIEA 3GTYX 1YJWS 5LOQA 1HHQA 4FF1A 2B7CB 4K8RA 3J81U 4ZN3A 3MFIA 3I0RB 3THPA 3NOGA 3M8SA 1NKCA 3Q89A 5F8MA 5M2UA 3L7UA 3QGGA 1RTDA 2ZDOA 3HJVA 3Q8QB 1N5YA 5HJXA 4C7QA 1T9VA 1XR7A 3E2EA 2GZOA 2YKMB 3TWZA 4LVNP 1FWLA 1FERA 4F3QA 3PFEA 1N88A 1VRQC 4M5KA 4QBUA 2ZC3A 2EW9A 1OY8A 2DHHA 3T9ZA 1M5SA 4FYWB 2BVZA 2PE8A 1QSYA 3UE2A 5HBMA 3OTOJ 2KZZA 2R8HA 1UVJA 5FDLB 2FY1A 3AB4B 4CZCA 2G2ZA 2XO6A 3VCDA 3W5YA 2JEGA 4B9SA 4DPYA 1E6YA 2DRAA 1MMDA 4G1QB 1Y3KA 2U1AA 1DJ0A 3BN7A 2UUCJ 3L7PA 4W92B 3RGIA 1FTRA 1V3ZA 5IM0A 2NSCA 2F9DA 5ADZA 2W7AA 4ZS6A 4NPOA 5CABA 2E5JA 2BJDA 4HH1A 4Q2MA 5DG8A 3J7ZT 3R5DA 3PR5B 2RQ4A 4GVBA 3HT0A 2Z58B 3OHBA 4UOHA 4JI1F 2HHPA 1SPBP 1GQEA 1JLEB 4ZP6A 5ETKA 3H90A 2C28A 3UDCA 3PNIA 3BBCA 5AXLA 4EEYA 5AJ3J 3HK2A 3MEEA 1RT1B 3I4PA 2ERRA 3UDVA 1KVIA 2D74B 3OR2A 2OMOA 4Q0BB 1NM2A 2QSFA 2MLYA 5GAHI 4J9SA 1WSVA 4ZPBA 4X62J 2ZOMA 5D0RA 2CNNB 4IG0B 2XCAA 4J9NA 2EC2A 3MMJA 3I87A 1M5KC 4L6V3 2VG7A 5GMDA 4NA1A 1JX4A 3R5AA 3PRBA 4YB1P 4QIEA 3I9V9 3CC4S 3R6GB 3ISNC 3KLGB 1LW2A 5J2PB 3DOMA 2D41A 4USTA 3PM9A 4E2FB 2L08A 2AGOA 2GQ2A 3UFCX 3AQPA 4MYUA 4DUYJ 3MOZA 4MK8A 2DGWA 1LWFB 2D9PA 2HFOA 3QIDA 4OI2A 6AT1B 4U7CA 1JLQB 2C2RA 3NEKA 5J2QB 2LQ8A 1YBUA 3D2WA 3BKFA 5KFTA 4LMZA 2FJVA 2IRUA 4DSKA 2A2DA 2B4UA 2X1FA 5I3PA 4KGMA 4KGVB 2E9ZA 3U02A 3GIIA 3VAJA 1PC5A 1UKUA 3G8SA 2IVYA 3MAHA 4OYIA 1KHWA 1HW9A 2CQBA 3THVA 2HNDB 2JWNA 3SI8A 1L3UA 3O6QA 2Y8WA 4TNOA 4DV6F 3QAUA 4LSNA 1U0HB 2VG5B 5M2PA 4NLTA 4P2MA 2LFVA 3BYPA 3MMCA 1H38A 1HW8A 1R89A 3FCVA 3OXGA 3GP9A 3SFGA 3IN5A 4HI1A 3PJWA 3PYEA 2CYYA 3DHXA 2CPXA 2HBRB 4JYAJ 1CS4A 2CQCA 2BM0A 3GE9A 1QTNB 4IDKA 5HAOA 4LF5F 2NXCA 2F8HA 3TW0A 3TZWA 4DPUA 5C42A 2KB2A 1X4EA 2VFTA 1EB0A 1V6HA 3T1YF 3P8BB 1FFWB 3MWBA 3GFYA 3SV3A 1H6KX 1EX8A 3D3BJ 1UVIA 3MUMP 5AE2A 2FLNA 2EEYA 4USJC 5E41A 1KLMA 1CLFA 2AP6A 3B78A 1S9GB 4F0HA 4AQYJ 3D66A 2YVSA 5D8HB 4I6AA 5J1PA 2I5JB 3NS7B 3KG0A 5JXSA 2QLBB 2EXUA 4LF4J 1SIZA 1Q5VA 4DS4A 1L3KA 5H9EJ 4WTOB 5E33A 2BRLA 1RWPB 5D4NA 3KLIB 4ZLNA 1LWCA 1IKVA 5EX3A 4OFZA 3I31A 2Y1LB 2I6WA 2ZUGA 4MFBA 3DU6A 4I2PA 4ZN1A 1NMEB 3TA0A 1CPZA 2MKSA 4DV1F 2LU2A 1WC3A 4DR1J 3KOAA 5H9FJ 4OMFG 3DLBA 2OTLS 4LF9J 1RB0A 3CDAA 3OTBA 3TZZA 4ILRA 3NAIA 3F56A 2FHMA 1FEEA 3DRPB 2YNFA 3LGHA 2MJUA 3ITHB 5H1SV 2YX1A 5ETRA 1H72C 1RXOB 2BANA 2OEJA 2APOA 3KLHB 3W2WA 2C2NA 2NZ4A 3WIUA 3IG1A 3HDSA 2E7XA 3ZZ0A 2ZHAA 1PC4A 1WF0A 5T7LB 1HNWJ 1FKOA 4B3SF 3ZZPA 4XPCA 3AY0A 1XJWB 4ED7A 8ATCB 3KJNB 4ATNA 4ED0A 1AUDA 3W63A 1KDNA 2QA1A 1T9XA 4PKDB 3NL0A 2B6AB 3MEGA 2L41A 4LRFA 4HI2A 3IP0A 1FRHA 2AD9A 2FGCA 5B0GA 3V6HA 1MSWD 1YDLA 1FESA 1VBZA 3NMAA 1RP5A 3N6NA 3K5LA 1JLGA 1NJZA 1FD2A 4LSLA 3NNCA 4K4ZA 2R3VA 1D9AA 2COLA 3WBZA 3D1OA 1XNQJ 3QMQA 3M05A 3MECA 4X4TA 4OJHA 4CNYA 1OO0B 4B9LA 3GIJA 3NG8A 4C6AA 3ZZZA 1RGVA 3DGPA 5DJBA 3Q0AA 2FJWA 2V4JA 2BA9A 3VALA 3R9LA 1Q79A 3KK2B 5LMNJ 4CLFA 3HZEA 4A4JA 1C1BB 2RDJA 4FYVB 3UPFA 1VK3A 3H20A 1VQPS 1HHSA 1UJ5A 3K7RA 2JX2A 1RT3B 4WFZA 5KOWA 1D9DA 4CLLA 4JV5J 4UOGA 2MKKA 3W2VB 2HWTA 1QJHA 3DXSX 1RAIB 4NI2A 4AT1B 5K8MA 3ONQA 4XIUA 1M1KT 5GAGU 1RTIB 4OZ1A 2KFYA 1SKWA 3LAMA 1WHYA 2KU7A 2HFZA 2C22A 4B3OB 4MT1A 2F40A 3I0RA 2EKYA 2QO3A 4B9MA 3D6FB 4A8YA 4DR4J 1IM4A 1T9TA 1IBKJ 2NZCA 3IFEA 4QYRA 1V3SA 3R7SB 2K7KA 2MYFA 3HMJG 5FD1A 2YKMA 5CH7B 1B64A 4HHJA 5B0AA 3VHQA 2ILYA 2VPXB 2K1RB 1HLWA 3MR7A 3KJQB 1TK5A 4KHRA 3CJTA 1VQ7S 4DN0A 4J9KA 2V69A 1APSA 5BJRA 3T6JA 2UXBJ 2N7YA 3W9IA 5FDLA 1SV5B 3BB5A 4V1Ak 4ZIWA 4ED3A 5GAEI 3FSIA 4USHA 3MM8B 1U2RA 4I67A 4NA2A 1TP7A 2DEIA 4G1QA 3NGTA 4O0IA 5SUHA 1N36J 1Z2LA 4QJVA 4KPYA 2EG2A 3QLHB 3D28A 3MM5B 1M1GA 5BYRA 3W66A 4ANCA 2E1CA 2V8HA 4LRBA 2CNLB 3W7BA 3I32A 2PSZA 3A8JA 1LXNA 5KFMA 2P9EA 4IO1A 2OPRB 2VBWA 1NHUA 5IQQA 2P5VA 1Q81T 3BO3A 3ZTQA 3BO2A 1JLEA 2CG8A 4O44B 5DRKA 4IOBA 4CLPA 3KUHA 4IH6A 1RT1A 3R5JB 1FDNA 2IIHA 4PG4A 1UPMB 4OV1A 3FQLA 2XMKA 1N6QB 2NSBA 3LANA 2R8IA 1U6ZA 3V2UC 4Q0BA 3EM1A 3PRDA 3BSAA 4RW4B 3HHLD 5CCLA 3RW7A 2SXLA 3ZFVA 2EFVA 1RABB 2X3DA 3DM2B 2V2ZA 2EFNA 4IG0A 5E7OB 5CD4A 1QE1B 3X1LB 2L9WA 2UVUA 4DSJA 4O3OA 4L3KA 2X1GA 2ZWPA 5DQIA 1WC4A 2XS7A 1RAOA 2XY6A 2R7VA 3KLGA 5DGAA 4DR7F 5J2PA 2FJEB 3W5ZA 2N7CA 2PD1A 1K9MT 4NLOA 4D3HA 2IJFA 1BWVA 1IJEB 3KHHA 2HVHA 1NKEA 3H5YA 1UVMA 4Z2XA 4Y2CA 1LWFA 5K14B 4FXDA 3M6WA 1JLQA 2B9WA 5J2QA 3JSYA 4DFKA 3L9ZA 4DL5A 2D3OR 2VH7A 1IBLF 2LXUA 2IM0A 3MR6A 1BHNA 2IVFB 2KHDA 1S1XB 4DL7A 1W2BR 3G2XA 4DF8A 4DV3F 1OS5A 2HNDA 3S01A 5A0YB 1U0HA 2VG5A 5DETA 2W8KA 1PYOB 2QX0A 2AW0A 4LBIA 5GMEA 2E5HA 2KZMA 9ATCB 3N5BA 4GMKA 2V8GA 3E8OA 4KHMA 1NSQA 2XZDB 2KG1A 1FKAF 3SCJE 3AXKA 1SC6A 2V94A 3M8RA 4ZKAA 5EWEA 1C0TB 3M8WA 2BE9B 4JI8J 2Z57B 3GFZA 4DPOA 4RPFA 4OJ1A 2AJ4A 5CZVA 3PO5A 3CD7A 4QR0A 3W64A 3HT3A 4QPTA 2FJXA 1Y7PA 1SJ3P 3BSOA 3VGTA 5KOXA 1UFWA 1X9SA 3J7Z5 1GMVA 4YP3A 2CPJA 2OI2A 4EU0A 2DR8A 1S9GA 3TOQA 2A18A 4LFBF 1CVJA 1TAQA 4ECSA 3M8ZA 2C3UA 2D3UA 3KJVB 1GMWA 2QEXS 1SL0A 1X60A 1UZHA 4I7FB 2NPFA 3QFHA 3KLIA 2J7UA 3C14B 2CQIA 4CLZA 1U1QA 2OPQB 3PJ9A 2HZCA 4E0DA 2HRUA 3DDIA 3PW4A 1U0SA 1NHVA 4EUVA 2FHOB 2ILZA 2VICA 3OVBA 4ID5B 2VBYA 2MXYA 3DRPA 1LWEB 2GQCA 1WDDA 1WG1A 3BQ0A 3TARA 4NLQA 3QAEA 1U1RA 4F02A 3ITHA 4IRCA 3VR1A 1TKZB 1BY9A 3FFIB 4KTQA 4AFFA 4LBPA 1M5VC 2CVIA 2AT1B 2UUCF 1SL2A 3ILIA 3KLHA 1X0FA 2CQ3A 3MR5A 2FLLA 5GADI 4GO7X 2NXJA 3W3SA 2C2MB 2ZE2B 1WWHA 4C11B 1C4AA 3KMQA 1S6OA 2KN4A 4RNHA 3HFKA 1ZS6A 3U7JA 4J9RA 5T7LA 4R5PB 2R2UA 1FVQA 3NY0A 4A8QA 3GU0A 4FDFA 2DGOA 3OL6A 3OLAA 2ZBIA 1NK5A 4IKAA 2YPYA 2F65A 2CPYA 4NLWA 4TU8A 4CIOA 1FDBA 4F25A 2RRBA 3VGSA 1VIXA 4OI1A 2VFRA 3JSRA 2B6AA 4OX6A 4ELVA 3G71S 1U1LA 3C19A 3J7AN 1R6YA 2D3O1 3NCPA 4DR2J 4X4SA 1RAGB 5HANA 2XC9A 4QW9A 3QT8A 4AL7A 2DK2A 3LGNA 2QFJA 3G96A 4O4RA 1QSLA 1NDKA 1D0EA 5G0RB 4EO6A 2W2QP 4ECWA 2MKHA 2DR6A 4Y00A 2ACYA 2FIUA 1KTVA 1HA1A 4O4GB 2CJQA 3KK2A 3BGOP 4CQ1A 1C1BA 1RHQB 3PACA 2ZVSA 3F0NA 4OX9F 3EE3A 2E5GA 4N76A 4F8RA 3IM8A 1JLAB 4H4KC 3SQGB 4DPXA 1RT3A 2XHCA 1K0TA 2AEFA 2RS8A 2AIRB 3W2VA 5L1JA 4YR0A 1OYDA 5FLXU 2QLJB 1Q78A 1RTIA 4DUYF 4ED8A 3VAFA 2LDIA 3ILLA 3MMBB 4J7CA 4CH0S 1HNZJ 2A3JA 4WCEQ 3K5OA 3CCWA 4P71A 4B3OA 2ZH1A 1UZDA 2NXUA 1BUXA 1CJVB 3IR5B 1URNA 3C15B 1UWBB 5LJ5Y 2MQPA 2W2MP 4HDHA 3BO4A 3LF0A 2AJQA 2OFHX 3DOLB 4B3TJ 2GJFA 1VC6A 4NL5A 1FXRA 1I5OB 3AB2B 3ZZTA 2N3OA 2K1RA 2AWZA 3CXCR 2GHPA 1VYAA 2XNRA 4OYXA 4JI5J 1PYTA 1ROFA 1SB6A 3GFHA 4DUZJ 2DHGA 4MKAA 4IFYB 1SV5A 2MQLA 4DV4F 5C24B 1Q1KA 3QT5A 4C0OC 1HPZB 2QG9B 3US5A 3FK4A 2ZDPA 4AL6A 3OL7A 5KG5A 1J5OB 4F4XA 1NK8A 3WDOA 1NK7A 3GSIA 3QLHA 3AXMA 4ED6A 4FN5A 1GMWD 1X5PA 2FGOA 3ZZOA 2DJWA 6FD1A 4UY8T 2CJKA 4U67Q 2ZZTA 4U96A 2XMMA 5HMYA 1TAUA 1YITS 4WWSA 4DV2J 3EXYA 2OPRA 4K5RA 5AXMA 5KAKA 4GKKJ 5EWFA 1VBXA 4AXJA 1NDLA 2PDAA 1KLNA 2V34A 1Q8KA 4RLEA 2QTWA 3ENQA 4RW8B 1Q5YA 2VOPA 4OYMA 4LF4F 4NXNJ 4TXSA 5EUHA 4WZMA 3NGRA 3OPKA 2IM3A 5IC4B 1N6QA 4ILLA 2GO9A 2F9JA 3VVTA 2E29A 4RW4A 4LF2A 2O3DA 1S4EA 3CJ3A 3OHAA 1FRLA 2WOMB 2JEIA 3DM2A 1W26A 3OJUA 1FTCA 1L5UA 3G82B 5KT2A 4CLTA 2LEBA 2WONB 2HLTA 3H59A 4LF9F 4PXDA 3C16B 1QE1A 2ZEJA 1Q7LB 2E1MC 2YY3A 3AT1B 2QA4S 2J6UA 3VWSA 3HHDA 3PV8A 1QAYA 1K1QA 4DQRA 4RUAA 4JP8A 4ZVRB 4Z7CA 3SQOP 5KG3A 2VPZB 1S79A 3JQMA 4CM0A 2Q6BA 2IRYA 2CADA 4ELUA 1FRXA 5DG9A 2YNHB 1R8HA 4ZCIA 2H65B 1KWMA 4OZ3A 5HJYA 4MKYA 2GGPB 5MLCV 2HHQA 3TJAA 3FBCA 4CLUA 1VQKS 5HMZA 2Q3PA 4Y34A 3IWLA 3DKDA 2B4PA 5K14A 1RLCL 1N33J 3O2IA 4ZPCA 4C8NA 3FSYA 3FKBA 4J9PA 1TL7B 1V9OA 5C2CA 2CPEA 4RO0A 2ZH8A 3VGVA 1S1XA 3MUTP 3DC2A 3KWMA 3G6XA 7FD1A 3KLVA 4NCAA 3AJ2A 5A0YA 1C1CB 3SMZA 2DO0A 3D68A 3PYGA 2PFDA 2ACMA 4KV8B 2HAFA 1XNQF 1U26A 3OW2R 1TELA 4WP3A 1HNIB 3ZZRA 1HFEL 5IC6B 1JIHA 4W98A 5HP1B 2CJ9A 2KG0A 4FS2A 2FVCA 2BABA 1LFPA 3TEGA 1S0VA 1C0TA 4DV0F 2HVEA 5LMNF 2EKNA 1GXTA 5CAAA 5B09A 5DZ7A 4M5IA 2M2BA 1UW9A 3DRYA 3D1HA 1UCNA 2W9CB 1T9YA 4I69A 4XK8C 2ATLA 4LFAJ 3A1YG 3IRWP 1FD8A 4YOEA 2F7VA 2YTCA 2GJ2A 3RJMB 2BOPA 2E9RX 5HVHA 2KRRA 3KKFA 1DQ9A 3T9NA 4L75A 2IA6A 4LVOP 5KT7A 4O0NA 1RU2A 1REVB 4X4NA 4WKYA 4UOFA 5IOLA 3KJVA 3TUPA 4DCPB 3QZ7A 1JQGA 1RSCA 3KHRA 1RT4B 4TQSA 2HMIB 2JOQA 4DR4F 4DSIA 4WFAQ 3M1VB 3ICLA 1Q7YT 3C14A 3DN9A 2OPQA 3DXBA 3QRRA 3P6YC 2YWHA 1YX2A 3B82A 5KT4A 3AD8C 4O3NA 1PAEX 5KT5A 3OL8A 3CCTA 5U47A 2CWKA 4ID5A 1AFIA 4TU7A 1TMMA 2UXBF 1HBMB 3PHEA 5J1NA 1LWEA 4ZVOB 4L76A 2Z0GA 1N32J 1XNRJ 1RWNB 2XZWA 4WK1A 4YHHJ 2RF2A 3GMGA 4EZ6A 1N36F 3MCOA 3M2RB 3WIVA 3DLGB 5A8WB 2UV8A 1HKAA 2NUHA 2R2TA 1NSAA 3VAMA 3W1YC 2DCLA 1D3WA 3D1QA 4YEAA 2ZE2A 3BBFA 3ILOA 2C2DA 4C11A 2ZBQA 1YTYA 4X65J 3OTEA 1H73A 3IO1A 2JC1A 2HQIA 5D78A 4HHHA 1TVRB 2HVZA 3PDNA 4R5PA 3D0GE 4X4OA 3CT9A 4K5SA 4UQTA 1SH3A 3D3CJ 5HQLA 1YVFA 2CFXA 5EN1A 1RT7B 4BHQA 5F0UA 1F6TA 4WFYA 1I94J 4DSFA 2OLWA 4QIWD 2R2RA 3LALA 2LQBA 4IRDA 2IMOA 3IAM9 3D6MB 4RU2A 2RS2A 3AAWB 2CJBA 3Q23A 2IBOA 3CDUA 3NWGA 3D4JA 2R7OA 4MKBA 2ASLA 3HJFA 3OSPA 1S99A 2U2FA 1RISA 1S76D 3LQVA 4F4WA 1RYSA 1NDCA 3MD1A 1KOHA 4O4GA 3MPVA 3V4MA 2E44A 5KG2A 3D6TB 3RBZA 3JTNA 2ROPA 4K4SA 2WRMA 2MLZA 2ADBA 4WU2A 2AF6A 1QUPA 2HLUA 4B9VA 3SQGA 4HL9A 3JYTB 1VS3A 1X5TA 1HD1A 3ZTSA 3UCZP 1UEVA 1J5EJ 3CTRA 4DR3F 3QSIA 3NGKA 3MMBA 4CH7A 3FUYA 2PMZD 1EP4B 4QCLA 2W4PA 1Y0HA 2CRLA 2R7TA 1CJVA 3C15A 1UWBA 3MZIA 1VHFA 5D4LA 2VZ9A 3DOLA 3H5XA 2H48B 4ZK7M 3MPWA
chains in the Genus database with same CATH topology
1LWFB 2D9PA 1B0VA 2UVVA 2HFOA 3QIDA 4OI2A 4U7CA 1F5AA 1FE4A 1JLQB 2MDAA 1W25A 2HS4A 2RT3A 3LPYA 2C2RA 1D9FA 5J2QB 3I0SB 1DLOB 1ZETA 4JI3F 1R3NA 3D2WA 2MZTA 4FBTA 5KFTA 5J2MA 2AJFE 4PXEA 4LMZA 4NLRA 4JI2F 4DR6F 1KC8T 2FJVA 1HL6A 2IRUA 2HHHF 2A2DA 2ZH7A 4DSKA 2B4UA 2JFDA 4ZP7A 2X1FA 1X5SA 5I3PA 4KGMA 4O44A 1HQUB 2PA8D 2ZC4A 4IFYA 3QGPA 2JH3A 5A8KA 1E6VB 1Y9OA 3A8EA 5C24A 5T14A 2E9ZA 1UAWA 1HPZA 1SJRA 2DGQA 3AA9A 3U02A 1NAQA 3C6UB 4KT0C 3GIIA 4IFVB 1PC5A 1UKUA 3VAJA 3G8SA 4YB6A 1FT8A 1WELA 2IVYA 3MAHA 1J5OA 1IUJA 2H5EA 2B5JB 2XMWA 1KHWA 4I6YA 1HW9A 2CQBA 2DTJA 2PT0A 5LJ3Y 2RSQA 3CDEA 5KFVA 3THVA 2M70A 3R1LA 2HNDB 2JWNA 2X1AA 1I1GA 1XK8A 4NLSA 3SI8A 2JEJA 1L3UA 3O6QA 1RJJA 1A9NB 1ZTWA 4TNOA 2NLWA 4DV6F 3QAUA 4LSNA 1HBNA 2VG5B 1MMLA 1O8BA 2VC0A 5M2PA 1O5JA 4NLTA 4JI8F 3V5RA 3DI6A 2DIUA 3CCZA 3MMCA 5CYMB 2AX0A 4Y0FA 1H38A 2BXJA 1HW8A 1R89A 2DH7A 4HT7A 4A8XA 3HO1A 3G6VA 2LKZA 4DL0C 5LXYA 2RH3A 4HVZA 2UXCF 3B8HA 4DL2A 3DRSB 1NJYA 3OXGA 3IXQA 4H4MA 3SFGA 2YQ3A 2XSJB 2XLIA 4AYBD 2DD8S 4CT8A 1S6PB 2E5IA 5F9NA 3IN5A 3FRYA 4HI1A 3PJWA 2IBKA 4IG3B 2CYYA 3SCKE 1SUQB 1VQNS 3DHXA 4WFXA 1VQMS 2CPXA 2IC3B 3H2VE 4QIGA 2ZH4A 4ELTA 4NWBA 2CQCA 2BM0A 1GTEA 1QM9A 4O3RA 4KFBB 3GE9A 2OIHA 4IDKA 3F41A 4LF5F 2F8HA 3TW0A 3SSSA 3CGIA 3G4SS 5C42A 2KB2A 2JHEA 4JUZA 2M3DA 4M8LA 1X4EA 4NOHA 2VFTA 1ZBTA 4PXBA 3SFUA 4A8KA 4G1IA 2N82B 1FCAA 1V6HA 3LOUA 4DQSA 1KOOA 1WHXA 3PKYA 3T1YF 3MWBA 3GFYA 3OXFA 4ZVEA 4QWBA 3FVYA 3IA0A 1H6KX 3OFGA 3SV3A 1UVIA 3HHNB 1JLCA 3MUMP 3G86A 5AE2A 3KLEB 2V4QA 3DYAB 1QAJA 4DFPA 2FLNA 1TL4A 1K73T 1IQTA 4ZOSA 1V3RA 2EWHA 4OL8A 3T5LA 4USJC 3Q22A 2XWYA 5KFBA 5E41A 1RK8A 3UDLA 1KLMA 4U7UK 2G9OA 2MKIA 2AP6A 3B78A 1CLFA 4XDCA 1S9GB 2WOMA 1X8DA 4B9UA 2YVSA 1T03B 1KS2A 5F9LA 3J7YI 5D8HB 4I6AA 3CCQS 2ZJRQ 3Q8PB 4ECRA 4K4TA 5J1PA 2EFPA 2I5JB 4DJBA 4K50A 3KG0A 1Y5NB 3MXHP 3HHLB 5JXSA 2J0QD 2WONA 2JRSA 3OQ2A 1LFWA 2R9LA 1SIZA 1R0AB 4J9QA 4N41A 2GV1A 1OSDA 3PZPA 1QVGR 4DS4A 3PFOA 3TUJC 5D6GA 1L3KA 2DH8A 2MKCA 3LP0B 3DLHA 1FRIA 5H9EJ 2V5HG 5E33A 2BRLA 2PN6A 5D4NA 3KLIB 2QIFA 2BJEA 5CD4H 1UW4A 1ZAVA 5KFDA 1LWCA 1IKVA 3KK1B 2YKQA 5EX3A 3IR7B 2FLPA 2ZZMA 4OFZA 4CO1A 3CMAS 4OHZA 4C3KA 3I31A 4RZRA 4GKJF 4EGLA 4MK7A 4DFJA 2ZUGA 4MFBA 2DHAA 3MD3A 2ADCA 2UP1A 3NGDA 3DU6A 2HWHA 2J0XA 4I2PA 1VC0A 1Y4ZB 1G3OA 3R3TA 4P2SA 3TA0A 4ES3A 3OV7A 3MM7B 4XDDA 1CPZA 1GX5A 2MKSA 2YNHA 4DV1F 2IM1A 2LU2A 2J7WA 4RW7B 4CO3A 2PIIA 5F8LA 2VASA 1FNOA 3KOAA 3M32A 4Y2AA 5H9FJ 2I2YA 4OMFG 2GGPA 3DLBA 2OTLS 1BWEA 1TL1B 4OZLA 3CDAA 3OTBA 1TK0A 2WCXA 2MPUA 4MH8A 1TV6A 3NAIA 1HI1A 3F56A 2C42A 4ILRA 2FHMA 4P7VA 4BS2A 3MM9A 3RRGA 1FEEA 1GAOA 4C8LA 3DRPB 1S9FA 2WAQD 1HHTP 4X84A 1L3TA 1WI8A 4KKOA 2DNHA 1FNXH 1A6LA 2Q66A 2XI2A 2YNFA 4R25A 2J6SA 2VPYB 1ZPWX 3OTCA 4ZP8A 1R31A 1NZAA 2MJUA 2ALZA 3ITHB 2PGCA 3BSCA 5H1SV 3CCRS 1ZM9A 2YX1A 1FE0A 3G9CA 4Y65A 2RKIB 3E51A 3TRGA 1KONA 4KIAA 1ZOTA 1QUVA 2UUBF 3M8PA 2BANA 2DO4A 4I0WA 4WK3A 1Q53A 3EYZA 3HX9A 3M2VA 4NMLA 1KNZA 1A7GE 3DLEB 3GV8B 4I2QB 2APOA 3KLHB 1H2TZ 2OSQA 3HP6A 3W2WA 3MMAB 1D1UA 1S10A 3EUNA 1QTMA 3HPOA 4K0KF 2NZ4A 1M5HA 3PXGa 1Q8BA 3DLKB 3OR1B 1N32F 2LLZA 1TFWA 3IG1A 7FDRA 3HDSA 4I6WA 2WSEC 4YHHF 1NJIT 3NAHA 1G2EA 4DMZA 4WYWA 2E7XA 3IRXB 1GT8A 2K8GA 1WNEA 3ZZ0A 4OLOA 1K8AT 5I3QA 2QSWA 1C1CA 2CQ1A 1PC4A 2XGQA 2ZHAA 3I82A 3LP2A 1WF0A 2O1PA 2CQPA 5T7LB 5CHCB 1FKOA 1JWWA 4B3SF 4PQUB 3CD5A 4KV8A 4M94A 2B9YA 3ZZPA 4XPCA 1N52B 3AY0A 1UEUA 1HARA 3IC1A 4ED7A 4ATNA 2XS2A 3OTOF 1HNIA 4ED0A 1O0PA 2MHEA 3THTA 1AUDA 3OJSA 5J2NB 5CZXA 1R8PA 1PILA 2QA1A 2RDIA 4X65F 1VQSA 2ZKTA 4PKDB 4J9MA 4I7FA 5HP1A 2QLWA 3NL0A 1WTBA 3GQCA 5L9NA 4RW9A 3LUYA 2B6AB 3MEGA 4Z37A 4ECUA 2GIQA 4N77A 4X64F 2L41A 4Q7AA 3GV7B 5IXUA 4H54A 4HI2A 1FRHA 1YIJS 2AD9A 2RF2B 2FGCA 2UV8G 5K9FA 5B0GA 3V6HA 1MSWD 2J9CA 1FESA 1FDAA 1YJUA 3IR6B 2D1CA 4DSLA 4TYBA 1VBZA 3NNAA 3NMAA 2LXIA 2DHSA 3GR0A 3MEDB 1GXLA 1RP5A 3ZZYA 1UA1A 1U45A 5ITHA 3N6NA 1XERA 1JLGA 4P6QA 3K5LA 1NJZA 1HYSA 1FD2A 3POTA 4LSLA 2RMLA 3NNCA 4K4ZA 3HVWA 5DM6Q 1D9AA 3QWPA 4WXOA 2COLA 3WBZA 3V6JA 2KI2A 3D1OA 5D3GB 2H9ZA 3QMQA 4UY85 3M05A 2W9CA 1I94F 5CA5A 3MECA 3N5FA 2MY7A 2B3TB 4X4TA 4OJHA 4OX8A 4WJBA 4CNYA 4WFBQ 2DNQA 4MMOA 1OO0B 2KJVA 1H0HB 2BM1A 4B9LA 2FC9A 3GIJA 3T5JA 1MW7A 3NG8A 1NJWA 5B08A 1AFJA 1S9EA 2R4FA 1RGVA 2YNGA 3ZZZA 4PUOB 2CQ2A 4HEA9 4ED2A 2L48A 3O3LA 3KTQA 5HN0A 3T5KA 3E3XA 3DGPA 1U6BA 5DJBA 3Q0AA 2FJWA 2V4JA 1NK9A 4MIWA 2BA9A 2FHJA 3VALA 1Q79A 2KXNB 5L9XA 3KK2B 1TKZA 5K8OA 2HQ3A 3HZEA 2QYCA 2MGZB 1REVA 1WEZA 4MK9A 2LA6A 1C1BB 3G8QA 4QIFA 5KFSA 4A4JA 4N56A 3CCJS 2N4CA 2CQHA 2X3GA 3FFIA 4DL6A 2EBEA 2RDJA 2P9CA 4JV2A 2BBEA 3UPFA 1VK3A 2ZD1A 4WFNQ 3V81B 3H20A 1VQPS 2HIQA 2OMLA 4NCGB 4HH0A 5CYJA 2YKPA 1HD0A 1RT4A 3LP1A 5LSOA 5CXTA 2HMIA 1HHSA 3FCHA 1Y5LB 4LQ3A 1KEKA 3T3FA 1JJ2R 2HFNA 1JLFB 5AJ3F 1UJ5A 3K7RA 4YQWA 1OQ6A 4FNIA 3M1VA 4YUDA 2JC0A 2JX2A 4PR6A 1KQFB 1XMOF 1RT3B 4WFZA 5KOWA 4LF6F 1D9DA 2LMIA 5FIIA 2ZH3A 5KFQA 3OUYA 2MJNA 3ZZUA 3PW5A 1C0UA 2K2PA 2MKKA 3W2VB 1PO6A 1R8AA 2HWTA 1QJHA 2FC8A 3SV4A 3TX8A 3DXSX 4IOCQ 2VL1A 1DTQB 3ONQA 5K8MA 4XIUA 2QA2A 5GAGU 2V4RA 1RTIB 4OZ1A 1M1KT 1P1LA 5EWGA 2RJZA 3BR9A 2KFYA 1SKWA 5KFFA 3LAMA 1U8SA 5HROB 4X62F 1WHYA 2KU7A 2HFZA 2C22A 4WU3A 5A8RA 4RUCA 3MCSA 4B3OB 1WEXA 2F40A 4O3PA 3BDPA 1RYRA 3I0RA 2UU9F 2W9BA 2J0SD 2EKYA 3BM7A 2F3JA 5T41A 3HHLC 2HNYB 2D9OA 2QO3A 2VG6B 1H3DA 4B9MA 3G6ES 4Q5VA 5KFPA 1KSPA 4URGA 1RTHB 4ZVHA 3ENVA 3QWUA 2ZH9A 5E3CA 1NK6A 1QVFR 2FJDB 4DUZF 4A8YA 1IM4A 2R2SA 1J5EF 2CPFA 1IKWB 2CQ0A 4F4YA 4IQXA 2GW8A 1YSJA 3CJ0A 3KG1A 2LECA 3CIMA 1DTTA 3DRXA 3IFEA 4F3MA 3CD6S 4PPZA 1S6QA 4QYRA 1ULRA 1V3SA 1T02A 2K7KA 5KFNA 1BQNA 1NO8A 1HMVA 4BDPA 2MYFA 2D3ZA 3HMJG 5FD1A 2YKMA 3FEXB 5CH7B 1B64A 4KRWA 1S1VB 4HHJA 5B0AA 3HVTA 5B0CA 2ILYA 4C8KA 3I55S 3UI3A 4O3QA 2VPXB 2RQCA 2J8AA 2K1RB 1IKYB 3GWCA 3QIPA 3T1HF 3KK3B 2I9SA 3M2RA 4NZ7A 2OTJS 3DLGA 5HLFA 2IRXA 1VMBA 4K59A 5A8WA 3CVKA 1TK5A 1GXUA 2ZHBA 4KHRA 1VGYA 1VQ7S 4YR3A 2FUG9 4DN0A 4J9KA 4LQ9A 2IA0A 4KO0B 3VZHA 2ZHOA 1APSA 5BJRA 3P3DA 2A1BA 2AYMA 4WYLA 2DGTA 3T6JA 4KQZA 1AXQA 1P8GA 2A2CA 2N7YA 5G0RA 5K5MA 5FDLA 1SV5B 1X0PA 1X4DA 3BB5A 4YR2A 2B4VA 4N47A 2DPJA 3KYLA 5GAEI 4ED3A 1VBYA 2FVRA 1KQGB 5THWA 3FSIA 1GX6A 1SBRA 2XBPA 1TVRA 3MM8B 4USHA 1FXDA 1F9FA 1U2RA 4I67A 4IH7A 4CH1A 4GKKF 1HQEB 1G6BA 2N4DA 4NA2A 1TP7A 2DNGA 3I4HX 4G1QA 4O0IA 1ZZNA 1DQAA 1JLBB 4ECTA 5IQ6A 5SUHA 2BQRA 1NB7A 3NCRA 1Z2LA 4J5OA 4QJVA 4G6VB 4KPYA 2IAJA 3TAPA 2WHOA 2EG2A 3SEOA 1VQ8S 2POKA 3QLHB 3D28A 4PPDA 3MM5B 5F8IA 2ROEA 2GIRA 1U48A 5BYRA 1I6JA 1RWUA 3ETOA 2E1CA 1RT7A 1VQYA 4ZPTR 2V8HA 4ETZA 4YY3F 2ZJQQ 1S1WB 2RUGA 2NQPA 3CCLS 4BWJA 1TQLA 5D4OA 3OFEA 2P6TA 1JLAA 2MQNA 4I56A 1IKXA 3W7BA 3IAS9 3K58A 4PG5A 3I32A 2PSZA 4AXIA 1X4FA 4GC7A 1LXNA 2LEAA 3QO9B 3EPIA 1RQ0A 5KFMA 4J9OA 4PWDA 2P9EA 4IO1A 1N0VC 2M8HA 2L9NA 2OPRB 4R8UA 4V19J 3VAKA 2VBWA 1NHUA 5IQQA 3H5SA 1ZYQA 1M5OC 3CD0A 3KG4A 3V6DB 1T05A 2ZFHA 2RILA 2OPPB 4ICLB 1YRXA 2P5VA 4RWWA 1Q81T 3BO3A 4KHPF 2HNZA 2E1AA 2M52A 2GMLA 3R1HA 2NR0A 1HBUB 2Q6CA 4H4OA 1VC5A 4LIRA 4ES1A 3I5AA 3DMJA 1YBAA 3CJ5A 3BO2A 1JLEA 3BSNA 3WC0A 3JTPA 4NLXA 1RT6A 4O44B 2BUNA 2NPIA 3U1LA 5DRKA 1WG5A 3D0HE 1HBOA 4IOBA 2KDOA 5IZHA 1WHWA 2HGNA 4YDDB 5LXRA 1F0XA 4IH6A 1RT1A 1HWKA 1FDNA 2VODA 3QGHA 4JYAF 2GA7A 4PG4A 1FRKA 4OV1A 3FQLA 3AA8A 2XMKA 2NSBA 3LANA 2MQMA 3QGIA 4DEZA 1N6QB 4CO5A 1KRPA 1N5SA 2R8IA 1U6ZA 1XN9A 3V2UC 3CJKA 2K3KA 3PRDA 4AL5A 4Q0BA 1CQMA 2BE2A 1MNEA 3BSAA 2DR5A 4UOCA 4NLPA 1VQOS 4RW4B 1U25A 2GX8A 3E01B 1X4BA 3TO8A 2VQFF 3HHLD 4TYAA 5CCLA 4G3IA 1TL5A 3NS5A 2R8JA 2P9GA 5KFUA 3DHWC 3RW7A 1FO1A 3H25A 5BYSA 1NJXA 1GTHA 2SXLA 3ZFVA 1VFJA 3MMCB 3Q8RB 1NH8A 2VKZG 2EFVA 3DDNA 3DM2B 4OJ3A 3F73A 4DQIA 4F4KA 2EFNA 1Q16B 1SJ1A 2XNQA 4U9RA 4IG0A 3JYTA 4WE1A 4YDXA 1X5OA 4QR1A 5E7OB 1DBDA 1VRTB 4ED1A 3GR1A 2CJAA 3D5MA 1VIOA 4HDGA 1QE1B 2HPUA 4IO9Q 1N8RT 5HQ8A 3X1LB 3DOKA 1PGZA 5KTQA 2L9WA 2UVUA 3TAMB 2K7JA 5DDRC 4QW8A 1D8YA 3JSMA 4DX8H 1VQLS 4DSJA 1EP4A 3U27A 4O3OA 4C0BA 1F5CA 4AQYF 1EETB 1UVNA 4UUWA 2F8EX 1AROP 2X1GA 4B9NA 1N33F 2QV6A 1S1TB 5DQIA 4FXWA 1UFLA 3R5BA 2XS7A 2XY6A 4CTAB 2R7VA 5EX0A 1H2UX 5I42B 3M30B 3KLGA 2VBZA 3NBPA 5DGAA 3I5CA 3DLJA 4DV7F 4DR7F 4RWXA 2UVWA 5J2PA 2FJEB 3LWMA 2N7CA 3C8YA 2PD1A 3Q2TC 2RRAA 5B0EA 1N5QA 5GVQA 4X4QA 4NLOA 1K9MT 4D3HA 4ZCMA 2KH9A 5E3QA 4ZHRB 3GFXA 1M90T 4QU7A 4E98A 2IJFA