4AXJA

Structure of the clostridium difficile eutm protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
ANALGMIETKGLVGAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELISVHVIPRPHFEVDAILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
molecule keywords ETHANOLAMINE CARBOXYSOME STRUCTURAL PROTEIN
total genus 21
structure length 87
sequence length 87
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4axjA00
4OLOA 3I6PA 3DNCA 4QIFA 2A18A 4QIEA 2A10A 3BN4A 4PPDA 4OX6A 3CIMA 3DN9A 4OX8A 4RBVA 5DJBA 4RBUA 4P7VA 2G13A 4P2SA 3H8YA 3I96A 4RBTA 5L38A 3MPWA 3CGIA 3PACA 4OX7A 3IA0A 3SSSA 4AXJA 4DDFA 3VCDA 4P7TA 3N79A 3NGKA 3SSQA 3MPYA 4QIGA 3SSRA 4LIWA 4AXIA 4QIVA 4OLPA 2EWHA 3NWGA 2A1BA
chains in the Genus database with same CATH superfamily
4DUTA 1BGXT 2K1RB 1WHYA 4J7CA 4O44B 4Y3CA 4NLRA 4CM2A 4BDPA 1NK6A 2JL9A 2PEHA 5DRKA 3P49B 1B70B 3CJKB 2OPRA 4OZ3A 5B0GA 2W9BA 1BY9A 2IAJA 4HVZA 3UDCA 3AD8C 1U6BA 4K50A 4JV0A 5K20B 1DARA 4F3QA 2C3OA 2YBVA 3G2XA 3H8YA 4LRBA 2BE9B 2DITA 1BQMB 4CLKA 2MB0B 1RWWB 2J0SD 2YY3A 1R89A 1HWIA 2RAQA 1KVJA 2BM0A 4WP3A 5K5MA 4C3MA 2GA7A 2C2NA 2WVDA 3HT3A 4P2XA 4Z37A 1RCOB 2BUNA 3UD4P 2R8GA 1CJKB 2BX6A 3HVTA 1J5EF 4O0IA 3QRQA 1RU2A 2KN4A 1UA0A 4DPYA 2MHNA 2JWNA 4KQZA 4ELUA 4U67Q 3PYDA 4ZPVR 2HBYB 1IBCB 3LAMA 1UWBA 2CPDA 1T9XA 4DSKA 1HWUA 1SUQA 4UOCA 4U6PA 4DR1F 5CXTA 3DRYA 5EHHA 2ZHAA 1KKHA 3HKWA 3VR1A 3VZHA 4OV1A 1WG1A 1GAOA 2UUWA 1TQLA 5L8RC 1WHWA 3DRSB 4HH1A 3M8WA 4B3OA 2EFGA 2E7XA 4E8UA 2YH1A 1PJ6A 1U1LA 2AEJA 4O3OA 4NLOA 2HQGA 3CVKA 4I2PA 4CTAB 2KG0A 1EB0A 4QW9A 4DR3J 3SDEA 1L3KA 3VALA 1YWXA 5B0FA 2UXBF 3W2WB 4CLTA 3POTB 4NA2A 1XMOJ 4DR4J 1DRZA 1PBAA 2K1RA 2B4VA 2IC3A 4NEYA 2ZHOA 4PWDA 2AJ0A 4K4SA 4ED7A 2FY8A 3Q86A 4KHPF 2NXUA 5DDOC 2AGQA 2CNLB 3LP2B 3H90A 3EM1A 2R7WA 3N01A 1EAYC 4BC7A 2J7WA 1T7PA 2Y8WA 3D28A 1MROB 2A6MA 3J7ZT 1VFJA 3IRWP 3E01A 4PR6A 3SCJE 4Q8FA 2D69A 3CCQS 1EKRA 2GO9A 4AUKA 2J6TA 2W9AA 1R8HA 3R1HA 1U1NA 3P6YC 3M05A 3RZAA 1SJ4P 3D9BA 2SXLA 1NDPA 1OWXA 4Y00A 4J9MA 4ID5B 2IYGA 3C6TA 3MEEA 4ED0A 5F8GA 1NMEB 1RT6B 2EC2A 2HRYA 3B4DA 3HI9A 1CJKA 2VU5A 2WVEA 4AXIA 5HMWA 3VAHA 4CIOA 3N4WA 4F8RA 3ZXWA 3C3LA 1S5ZA 4R25A 3VGVA 2XMWA 3ZZZA 5GADU 2M88A 3QATA 4DZDA 1X4HA 4H4MA 4ECTA 1NCLA 2E1CA 3M2VB 4OHZA 3FDSA 3QRRA 2H3EB 2OO4A 4KJIA 4KGMA 3HDSA 5AJ3J 1J2VA 3T5HA 1VRUB 1JJ2R 3D1OA 1FKPB 2VB6A 1L3VA 1S9FA 4FYWB 4OI0A 4X62F 5HQMA 3GPAA 4ALZA 2YWGA 3U1MA 1KSPA 1Q95G 1H73A 1GFWB 4IRDA 1IKYB 2DNHA 2IRXA 2MSSA 1YRUA 2AV5A 2DNKA 3CGIA 1QE1A 2QLBB 1YIJS 1L3UA 2QSFA 4USTA 4USVA 1WNEA 2VODA 1DJ0A 3HX9A 4EBEA 2AGOA 4O4GA 4FKYA 2UV8G 2P5VA 1I6JA 3RW7A 4TQSA 1X60A 1Y3JA 3V4IA 2C3PA 2OEMA 3NP5A 3GYNA 4LIRA 1GTEA 4ZJQA 3MM9A 4DQSA 4ZCIA 2YVSA 3V6KA 3HKZD 3M8PA 1EJ7L 3O5TB 5HANA 2HAIA 2DRAA 5KFUA 1VQLS 4M5MA 1F5BA 4OX9J 4OX6A 1OS5A 2ADBA 3P8BB 4B9MA 3BR9A 3PIPQ 1D9FA 4JI2F 2EKNA 2DTJA 1MWQA 4DG1A 4JV2A 5HMZA 2DJWA 2DEJA 1H6KX 3BGUA 3K8VA 3K17A 2DY1A 3KUGA 3CD0A 4AFFA 3KK3B 2AYGA 4LREA 4ITSA 2Z0GA 3PFOA 4I6AA 3SBMA 1U1RA 5RUBA 3QO9A 2FVCA 3G6YA 1WJ9A 2ZNZA 4CYUB 4JI7F 4IQXA 3D7SB 4UY85 2XMJA 5DG8A 4CT8A 2CJQA 1NK0A 2IY5B 1X9MA 1CJUB 5LMNJ 2XZTB 4EUVA 1F1BB 3UPFA 3IWLA 2V69A 4F7VA 2HHXA 2VBZA 2WSFC 3QLHA 2AYEA 1VI7A 1NSKL 2FLOA 3BYRA 4H4MB 5DQGA 2MZJA 3GV8B 1TVRA 3TAQA 3BBCA 4NCGB 2OD6A 2IM0A 2I5JB 1A7GE 1HWJA 1N34F 4WXWA 5E3AA 3MM5A 3FQLA 4I56A 1SIZA 2GHPA 3AXMA 5CQGA 3JAMU 2EFPA 1KS2A 1LW0B 2ILYA 1UZHA 3PACA 5A8WA 1WSRA 4XDDA 4LMZA 3NBPA 4CI0B 1DQ9A 1XEZA 2VHGA 3PYEA 2QLXA 4WP9A 4ELTA 4EZ9A 2VG6B 2G1DA 3IR5B 3CJ5A 4TY9A 2FPHX 4FYYB 2AEMA 3IBWA 3LF0A 2LEAA 2V4QA 3M2UB 4GVLA 4I2PB 4ED6A 1RUSA 4DR7F 3AAWB 4KV8B 1VHFA 4WK3A 1XMQJ 3M8QB 1X8DA 4ZOSA 5F8JA 3D68A 2RVJA 2PE8A 1NXIA 2MQ8A 2W2PP 1HYSA 4DV7J 2OD4A 4HHHA 3CCSS 1JXVA 4ANEA 1S1UA 2DGXA 3EGZA 2QMXA 3BGFA 2JX2A 3RB3A 1H74A 3A8IA 3R5AA 3LP2A 3SI8A 1H98A 1YG0A 2KKHA 3CE8A 4LFCF 3HHLD 1SH3A 3Q2SC 4NRUA 3KK3A 4LFBF 4IFVB 5KFYA 3PW7A 1MG7A 2NZ4A 3H59A 4ZP7A 1IR1A 2DGQA 2FC9A 2CRLA 2HBZB 3FK4A 4L3KA 4P74A 4DPUA 3GIMA 4B3SJ 2AGPA 3U27A 1URNA 1EIYB 2ZH8A 1VJQA 2ZVSA 3PR5B 4IO1A 5KG3A 3TJ9A 4F26A 1I51B 1O51A 4ICLA 5BYSA 5J2PA 3MEEB 4J9PA 1RHJB 1N5QA 1E6VA 1HNWJ 1KD1T 2DR6A 4URQU 3DLEB 2O3DA 4ZCMA 4A8XA 2MZTA 3M9NB 4B9SA 4ANDA 4D3GA 3TAMA 1TL5A 2L3MA 3AJ1A 1TP7A 3IM8A 5DJBA 5LSOA 4NCGA 3W9HA 3HF5A 3MMCB 3RTVA 2HNZB 2XMVA 2MQNA 4X4RA 5T14A 4G6VB 2MGZB 3OVAA 1WG5A 2GNKA 2ZZMA 3M8YA 4TLQA 2UXCF 4ZLNA 3JSRA 4PEOA 3W64A 4DZ6A 3JQJA 1YITS 1K0VA 3A13A 3IA0A 2Q6CA 1KHVA 1X9SA 2WAQD 4DR5J 2QRRA 3VAGA 1Z4UA 2OSQA 2H5IB 5DLFA 4WZMA 1ULRA 4WFBQ 3VF0B 1NJWA 3M4XA 1CG2A 1FRIA 4BCAA 2QC3A 2QO3A 1ZBTA 1VK3A 2GAHC 2V94A 1AFJA 3QT8A 2IAJB 2BANB 4OZ2A 2X1AA 3HHNB 1AW0A 4LT6A 2ABYA 2YKNA 3D0HE 2V50A 1BQMA 4P73A 1N5TA 1C1CB 4L3NA 1SJ1A 3ZZPA 3MM6A 1YHQS 2H1YA 4NXNJ 4A8QA 1OQ3A 4ZCKA 4LSLB 1OYEA 3MCSA 2VFUA 4RU2A 4B3RF 4C6AA 3BS9A 5L1LA 2F9DA 1LOUA 2DR7A 2KZZA 2GIFA 3G86A 1DFDA 2ZKTA 4DUZJ 2U1AA 3DOMB 4I68A 3L7PA 1YJTA 4NLYA 3W2VB 1TMJA 2Y3YA 4LVNP 4P2MA 1WF1A 4AD6A 1CJVB 4PKDB 2Y1IA 1LWCB 2WVFA 1TL7A 2FDNA 1HIYA 1WD6A 3M30A 1UP1A 1WF2A 1X5PA 2YQ1A 3MEDA 4FDFA 1CQMA 4OI2A 5B0BA 2KZMA 3DLJA 1CSJA 3L7OA 1R6YA 2HFNA 2JLFA 3D6HB 1E6VB 1HL6A 3LANA 4DFKA 1N32J 1UJ6A 3KK2A 2QG9B 3BDPA 4P52A 2NQPA 2X7IA 2RT3A 1HW9A 2BKOA 4M5DB 4RW8B 2UUBF 4ED3A 2G1HA 2EC0A 2VQFF 1SKSA 1FXLA 2F40A 1JLBA 3AFGA 1TVRB 1E6YB 3KMSA 4B3SF 2BVZA 4HDGA 4R0EA 4ZP9A 5B08A 3C6UA 2AJQA 7FD1A 3W2WA 2IJRA 3I9V9 2NS1B 5KFTA 4URSA 2IA0A 1S12A 1FFGB 3RBEA 4F2RA 3BSCA 4OYBA 2BW7A 4IH6A 4P71A 2FHJD 3GV5B 4NASA 3UD5A 5KOWA 3EDQB 1UTAA 5I3PA 4DL4A 2HFVA 2L41A 2XC9A 2RDIA 5DGAA 2RS8A 3OT9A 3G8TA 3KLEB 3ZZTA 3OTBA 5GAGI 4IO9Q 3SCIE 1RT3A 1U2RA 3DHXA 4K8RA 4X84A 3AJ2A 4CNZA 2HNYA 3ENQA 3MPVA 4UOGA 3G8SA 3GU0A 1S0NA 1Y5IB 1Q4RA 2KHDA 3NS7B 3G6XA 2FIUA 4ER8A 3O6QA 1Q5YA 3RRKA 3KLFA 1SBRA 2GQ2A 3TJAA 2I8EA 2YWHA 4NX9A 3N28A 3TANA 1MMNA 5K8MA 4UZBA 1WWHA 2HLUA 3C6TB 2R2RA 2OP5A 3FNNA 3W5YA 3L3CA 1TL4A 1RLDA 2XNRA 3DOMA 1RAEB 2DR5A 2XY7A 4IR1A 1FE0A 2FLNA 2MZ1A 5J1NA 3DU6A 2BBEA 4JI6J 1PC5A 2RB7A 4K59A 2MY8A 4Q44A 4X4VA 4LRDA 3PHEA 4J5OA 3CJKA 4LF8J 4ZLPA 5AXKA 2CDQA 2W2QP 4YR2A 2W9BB 4NLXA 2PA8D 2IHR1 3W61A 1X4EA 1YI2S 4IOBA 1TKDA 1YQHA 2XS5A 2ZD1A 4C8YA 3T41A 2Z56B 2ZEJA 2VJUA 1HQ2A 3IP0A 3CDAA 1Y0HA 1K73T 2KL8A 3RAMA 1NH8A 3NCPA 5ETSA 2CQ4A 2CQBA 4DR6J 1XR5A 3FCVA 1S9EA 1SCJB 3SCLE 1C0UA 1RWVB 2VD3A 3W5ZA 1G4CA 5L1IA 3MMBB 1Q0NA 3WHIA 5U47A 1GK8A 1SPBP 3BPDA 1GX6A 2J76E 5KFQA 1S48A 4XPCA 3CCWA 1R0BG 3M6WA 5CABA 4Q45A 4WTYA 2ALYB 4A8FA 1VGYA 3M32B 1OJ4A 3Q8UA 4TQRA 4AQYJ 2VQEF 3ELHA 4GC6A 2CZ4A 2C2MB 4DN0A 1P9YA 4HL9A 4U7UK 4GKJF 1HNIB 1T11A 3H2UB 4TU9A 3PKYA 1F60B 2YWFA 4RX6A 2EBEA 3DRRA 1RDRA 3IBCB 4NA3A 1CULB 1W2BR 1S1TA 1RCXB 1KVIA 1MWZA 1RTJB 3CJRA 2JVOA 2QA4S 4LSNB 2V9WA 4KGZB 1IR2A 5HBMA 4ERDA 5EWGA 2NXEA 5DM7Q 2OPPA 2LXUA 3UDVA 3FEYB 1MNEA 4JI1F 1SV5B 3BO2A 4C8OA 1S1VB 3NGKA 3KG1A 5D15A 2BRKA 5CAAA 3ITHA 1SC3B 4R8UA 3DHWC 2CJXB 4PABA 4QIVA 5D0GA 5DZ6A 1V3SA 4OHVA 1K8AT 4F4KA 3SYZA 1H7XA 4FYDA 2UUBJ 2A2CA 1HWLA 3H20A 5AJ3F 3QSYB 2F8MA 2KDOA 4PPZA 5AE2A 4U7CA 4Y34A 3CCRS 2IVFB 4MKVA 3W8GA 1S57A 4ETXA 4EWTA 2GCFA 3MEDB 5J2NB 5IT0A 1X9WA 2BJ3A 1G1XA 3ILOA 2DNPA 2HS3A 3W66A 1REVB 4DV5J 1N5YA 5G0RA 2XG8A 3M6VA 5KFAA 3LOUA 4ID5A 1S79A 3H2LA 1UEUA 2CAJA 1Y3KA 3I96A 2XS2A 1RBLA 1Y5LB 3IG1B 4KSEB 1N36J 3VVUA 5FLXU 4G1QA 3U02A 2AJFE 1D9AA 1UETA 3W5XA 4ZJLA 5JVHQ 3ADAC 3MPUB 3PW0A 1JLGB 1ZM2A 5EWEA 1T03B 1GXLA 4A8KA 1YKWA 3I87A 3TZWA 4ES2A 4MFBA 4J91A 2NCKL 4W98A 1RAJA 3EPGA 1MMLA 2CQPA 2ZWOA 4ED4A 3BO4A 3K57A 4DS5A 4KH1B 2ZBRA 3HHDA 4U95A 3QIDA 1YJWS 2R2SA 2CWKA 4IG0B 2HQDA 3BH6B 3VGUA 2AW0A 2QFJA 2KT2A 1VBYA 4W92B 2IM3A 2AJ4A 3OTOF 2GS8A 5E3PA 4PPDA 2XBPA 1QUVA 4LRAA 1JB0C 5DM6Q 2WBMA 3TI0A 1FKAF 4YDDB 3KMQA 4F4YA 2MZQA 4I4BA 1VQOS 1OPIA 1RA6A 2YKOA 4ENOA 1DQ8A 4O3RA 5D4PA 4OFZA 1U09A 3PX0A 2DVIA 1W26A 4DL5A 1AZSB 1Q8KA 2L08A 1XR7A 3AD7C 1Y4ZB 4OZLA 1J27A 5MAOA 4K4YA 1J5OB 2B5JB 1RT2B 2PMWA 3AOAA 2CPXA 4N8NA 4X65F 4X4OA 3PEJA 1S1VA 2BJ8A 3PNIA 2OEKA 2QGFB 3TYTA 1JJ4A 1QSYA 6AT1B 2V8DA 4K5SA 2JZ5A 2OH2A 3B8HA 5HO4A 3HVRA 3W7BA 1GXUA 2KTQA 1UFLA 2V2QA 3LGMA 1U1MA 4DR1J 1CJTA 4CH7A 9RUBA 2MGZA 3MPDA 3LP0A 4WP8A 3PR4A 3H0PA 1QDUB 3BEGB 1MN7A 3MTJA 4WJBA 2Z2MA 3GONA 4DV0F 3EZUA 1TU0B 1REVA 3AQOA 5KT2A 1N5YB 4O3NA 4WWSA 4ECSA 3VAJA 1PIEA 3A8EA 3BYPA 2VBWA 4JI5J 6FD1A 1R3NA 2H51B 2NYIA 2NSCA 3IG1A 5CHCB 1NDLA 3MZIA 2GW8A 1TUWA 5GAHI 1CJUA 5L1KA 4PQUA 4DF8A 1X5TA 3OTOJ 3J81U 4JV5F 3QT7A 4LF6F 3F44A 2OPSA 2QN6B 3G87A 3J7A1 3C14A 1FFSB 1HLWA 4NZ6A 3TUJC 5I42A 4DQRA 1VJWA 3KYLA 4MAKA 5HVHA 1IBMJ 1KHWA 4Z7YA 2YWEA 2P9GA 4RNOA 2V9KA 4IG0A 2CQHA 4IDKA 5IOLA 2IRYA 3BKUA 2ZJQQ 5EX0A 2W24A 4WKYA 1R8PA 1UZDA 4Y6IA 4CM0A 1R0AB 5ETVA 3I5BA 4DR2J 2B7BB 3V81B 2YPZA 3PJWA 4OJHA 1EP4B 1X31C 2QLJB 2D3UA 1U1QA 4DUYJ 1B7YB 2DY9A 2B4OA 1ELOA 3M2UA 1RTJA 4LSNA 1TUGB 4R0JA 1GMWA 3QGHA 2Z2ZA 4RW9A 1XNRF 5EN1A 3MPYA 4OV6A 4H4OB 5B0DA 1RGVA 2BZ2A 2R7OA 2XHWA 1RI7A 3KTQA 3VQSA 1U24A 5M2PA 2M0GB 1LXJA 2JNJA 2BOPA 3K8WA 5IM0B 1SV5A 1U49A 2JJ4D 4CRJA 2DIVA 1SKUB 2YNHB 1S0OA 4TLRA 4ZIWA 3CEDA 3TA1A 4KO0A 5IT4A 1ZYQA 2V68A 4KTQA 2DNZA 3ICLA 4ZLJA 3C19A 5KFGA 2EXUA 2O1PA 3ISZA 4DXLA 2BM1A 3F0NA 4RUCA 3K0JA 3GYXB 3H5YA 4IRCA 3KDOA 3H2VE 5D4NA 4OI6A 5J2NA 4FYVB 3T1HJ 1WI6A 3NGTA 2W2OP 4ZVEA 5HAOA 4WXOA 4NLTA 3GWCA 3BJYA 2Z2LA 4F36A 1RT7B 1B3TA 2YQ3A 3E51A 2CQDA 4GKJJ 2RF2A 3JB9k 1OQ6A 3K59A 4ES1A 3M9MB 2FHKA 1G3OA 2WZ1A 5D4OA 4AQYF 4JI4J 4DU8A 1C4CA 4UT4A 2DXEA 4PWWA 1VRQC 3DMJB 1Q7YT 3H98A 1JLCA 5KG2A 3ZTOA 1VIOA 2BV3A 2V8VA 3C66A 4PG8A 3OV7A 1WHXA 2L9DA 4OZ1A 4OYPA 3CD6S 1YRXA 2DNGA 2RUGA 4NWBA 3HULA 4YDXA 1DZ5A 2FVPA 2XY6A 3M8ZA 4QYRA 2VASA 1KWMA 3BH7B 3HSGA 3NXZA 5KFRA 2ZBPA 4DG1B 2KYZA 4JI8F 1FO1A 2O66A 3FCWA 2C22A 2HWIA 1ZH5A 1PCAA 4O3SA 2MKYA 1RACB 3RUBL 2QTWA 2IRUA 2ZJRQ 1IWAA 4K4WA 3J80Y 1RYRA 1RT5A 2VPYB 2ERRA 1JLQB 2BOAA 1SH0A 2DEIA 2CDRB 3LAKA 1VK8A 2LQ9A 4CO0A 5IQ6A 1SL0A 1HNWF 3UR0A 3K5NA 4LF8F 5KG0A 2ASJA 4KB7A 4DCJB 1R27B 3J81j 2E5JA 3T1YJ 2ZOMA 2G2YA 3QFHA 5JXSA 4J9KA 1XERA 2Y1RI 1C0UB 1RHKB 3IR6B 3QLHB 1U1PA 4M5IA 5J1PA 1JLAB 1RBAA 3MMBA 4J9UE 1QVGR 3RW6A 3BQ0A 1TKTA 2D3O1 4JBCA 1VBXA 1RTDB 1IVZA 2G2OA 2IM1A 2EFNA 3RB0A 1HBOB 3P4UB 3W60A 2IBOA 2GVDA 4AYBD 5IFMA 3MAQA 4ZVFA 4C8NA 4DOZA 1RT7A 3J81Y 2PMZD 3WX8A 1NK8A 2RHSB 3OSNA 1FJEB 1RT4A 3GLJA 1FJGF 1NNDA 2VV5A 2V4JB 4FF3A 3K2YA 3OHAA 3AOCA 4LF4F 2BYCA 4DV6F 2ZBCA 1NHVA 2WK4A 4LVOP 4NLQA 1ZM4A 2VZ9A 4UZCA 2FGCA 2VUGA 4KV8A 4DV4J 1REGX 4N76A 2F8HA 3OL6A 2BABA 3NMAA 3BN4A 3W8PA 1WKKA 3D3CJ 1S7IA 5C42A 5HBMB 2HNDA 2NPFA 2XMAA 2XO6A 2NYHA 3AOBA 1RZMA 4O3QA 2V8PA 5IZHA 1XNRJ 3PDNA 3GFHA 4DPXA 1RKJA 1NJXA 3W63A 1ZETA 1M5SA 2ROGA 3CCVS 2RQMA 1YK9A 3AT1B 2XM3A 3GFZA 2GJFA 1MSWD 1DAXA 3T5KA 2IFXA 3G82A 3T3FA 3PRVA 3EXCX 3LP1B 5KFEA 2PO4A 3ZTSA 1EP4A 4H4KC 4M1KA 2QFIA 1LWXA 1RT3B 2Y0BB 4C7QA 4ZIVA 3UVJA 4FXVA 5BYRA 1RP5A 4NLGA 3BGRA 2KXFA 2QA1A 2DNRA 3MDFA 2XHCA 3O44A 2XSFA 3EMTA 2IDEA 3G9CA 3TWZA 3UCZP 2FJEB 3ISND 2VFVA 3ET6B 4ZMMA 4ECVA 2CNKB 3AODA 1RK8A 3NGSA 1PJ5A 1QLNA 5HVFA 1Z1ZA 5F8MA 5J2QB 2XCAA 1FD8A 4X2BA 4FNHA 4KHPJ 1N48A 4USHA 4WYWA 3HJVA 1TKTB 4IKAA 3AD9C 2EK1A 1IKWB 4KFBB 3BGLA 1PILA 4NCAA 2R7RA 2P6TA 1KTQA 4JI5F 2ASYA 3JTOA 3T6JA 1S6PB 2DYAA 2HW3A 3BSAA 3NY0A 3BQ1A 1TL1B 1K1QA 1T05B 1B7FA 4F02A 1HI8A 1IQTA 5E33A 4DV0J 3PW4A 1RT4B 1KP6A 4KE5A 3HMJG 4ED1A 1VQ8S 1NAQA 4PRFA 2P9CA 4QQBA 3R9LA 2E7VA 2HHHF 1SVDA 3QZ8A 2NREA 3E8OA 1KONA 2I2YA 4RW4B 4BWMA 2XYHB 2M4MA 3DDNA 4HHJA 2BANA 4YB7A 2Q66A 2RRAA 2HS0A 1F3FA 4DFMA 1N56A 1HBNA 3R5BA 1M90T 4ZN3A 1Q53A 3R6GB 1OIAA 2R2TA 1MN9A 4MIBA 3BBFA 2PMHA 1PBUA 4DV2J 2AEFA 3UWTA 4LSLA 3HP6A 5AE3A 4EBDA 2ZKUA 3OFGA 1T9WA 4DPTA 3KLHA 1FRHA 1FXDA 1TV6B 3MEKA 4RPFA 4FF1A 4DDFA 1VQ6S 1FRKA 4B02A 4GVBB 2Z58B 2UVWA 4J90A 1DHMA 5HK4A 2RU9A 3MUMP 1S0VA 3DRRB 1RT5B 1N33F 5D77A 1LKZA 3EJMA 1JLQA 2RD5C 4K4ZA 4EI2A 5CYMA 3DRXA 1U47A 1ZA2B 2AYBA 1UAWA 3VTIA 1VOMA 4L6V3 2R8KA 3KUEA 1CVJA 2AZ1A 3UR3C 4UTGA 3A3PB 2HVHA 5A8RB 1RHMB 2MKIA 4L76A 4RW8A 1AB8A 4EGLA 1XJWB 1RABB 2CVEA 1ACMB 3BM7A 3DM2A 4ZPWR 2H4YB 2L9WA 3PYFA 5CYQB 2H9ZA 5CYJA 4MYUA 1L5UA 1WKJA 2BKNA 1VBZA 2AX1A 3MFIA 2XWYA 3NAHA 3MR2A 5E41A 2CG4A 1HBOA 1UFKA 1R8BA 2J5AA 2RQ4A 1RSCA 3NG8A 3QBCA 5K9FA 3GIJA 1F5CA 2R2UA 3SV3A 4U8YA 3JXOA 3SIPB 4DLGA 1FX2A 2N4DA 2B6AB 2FVQA 2B4UA 3C8YA 3A3NB 2MQPA 4NLSA 3BZQA 3RJMB 3PM9A 2CJ9A 3PV8A 2ZNYA 3MD3A 3NCRA 5GAEU 5F3ZA 3CIMA 4ES3A 5B0AA 4B3TJ 4LSZB 5D0HA 3IAS9 4DQIA 1APSA 1HPZA 5IWAJ 1S10A 1LK7A 2C2ZB 3CJ2A 4CO2A 1RWXB 1NZAA 2DB1A 1HW8A 1O6XA 1S1WB 3OR2B 4LRFA 2N82B 1A0OB 2C1EB 4PZVA 4PUOA 3HVAA 3MM9B 4NI2B 3JTNA 3M8PB 5AXLA 4CQ1A 1OYDA 1TV6A 4Y2AA 1N8RT 1Q78A 2M3DA 3PO4A 2EFOA 1VQYA 2D1CA 4B17A 5IM0A 3K5LA 4YS2A 1HD1A 1N5SA 4QIGA 1UPPA 4PG4A 1RHUB 4YP3A 1FVQA 2LQ8A 5KFCA 2CPHA 3LALA 1JLEA 3I31A 4ECRA 3VCDA 2IMWP 4C8LA 4NYPA 4JYAF 4ZPTR 4KPYA 3PTWA 2GQQA 3DNCA 3IS9B 4JI7J 1XNQJ 4QCLA 2NZCA 3R8YA 1FHTA 5CYMB 4YB1P 1RWOB 4JB8B 2ACMA 4UOHA 1IBLF 1U26A 3E01B 3UW1A 1NSPA 1VQKS 1SKWA 5FDLA 3TR5A 4DU7A 5DS7A 2I6WA 1IM4A 2B0GA 4DX8H 3PIOQ 4HHUA 1F9FA 1ROFA 4E2FB 1RT2A 1RWKB 3UD3P 5IV3A 1FJ7A 3MECB 1WG4A 3MAAA 1EKSA 4ZVUB 1SQFA 4ZVRB 4C8KA 3W9IA 1N6QA 1T3OA 2E5GA 2G4BA 1HD0A 1GNKA 3UQSA 4RW6B 2AJ2A 2JDJA 5KFSA 3GFXA 2W1BA 1YBAA 3CT9A 1Z2ZA 3M8SA 1RT1A 3EZ5A 3B4MA 4NOHA 4DV2F 5J2MA 1RTIB 3FSXA 5F3TA 5CD4H 4A8WA 3CXCR 5KFPA 1DLOA 3OLBA 4U8VA 3V6DA 3RR8A 2HVDA 3LH2S 3M6XA 3OFHA 3RRGA 3GTYX 3DKDA 3PEHA 1T9UA 2BE2A 2IVMA 1NK9A 1VR6A 4X62J 1EX8A 2ROPA 1S1TB 2E7WA 4I7FA 2AWZA 1HBNB 1S99A 2RHQB 3FBBA 4MKYA 2VF3A 2FZGB 4Y0FA 4PUOB 3TVKA 4YHHJ 2GIRA 1QTMA 3V4IB 3T9ZA 2ZDPA 3R97A 1VC0A 4N8OA 3AB2B 3QIPA 1B0VA 4RUHA 2QL7B 5J1EA 3VWSA 3ILIA 4I2QB 3Q2TC 2RH3A 3KOAA 3ITHB 2WB4A 4F04B 2CZVC 1FTCA 3BKFA 3LPEA 1KTVA 1LFPA 4JOUA 3G4SS 1R0AA 4GC7A 3QJPA 1WC6A 4FN5A 2R7SA 4A8SA 3TEHB 4Q7AA 2MMYA 2A10A 1IWGA 2KFNA 1EHWA 4ZHRA 9ATCB 2GMHA 2OAUA 1NPRA 4BS2A 4KR0B 3GMGA 5ETKA 3WBZA 1QAJA 2FLLA 5FDLB 5T41A 3M8RA 1HQEB 3OUYA 2C2DA 3BPSP 4DHVA 3MR6A 2CA9A 2NPIA 4P7VA 4DSFA 4KGXB 1N34J 4K0KJ 3TZZA 1PO6A 1PKUA 3EGVA 3I0SB 3TNVA 1WORA 3QQCD 1IKXB 2QLWA 1SJ3P 3MAAB 1EQ0A 3NS5A 4ZCLA 2HVZA 2QV6A 3LTOA 2JC1A 3G6ES 2YNGA 2MHEA 1BUXA 3BN7A 2R42A 2AMCB 3G8QA 3QMQA 1W25A 5LM7E 3SSQA 3ZZYA 7AT1B 4LQ9A 3BO3A 1UPMB 2VA3A 3ULHA 4M94A 2CJKA 2R7UA 1LEOA 4P6QA 3L9ZA 2KFYA 1HBUA 2RDJA 1N32F 5H9EK 1H38A 3BB5A 5L46A 4U96A 4J9RA 2MDAA 1M1HA 2J7UA 4UW2A 4N56A 2DKOB 3MM5B 3HHLC 5C24A 4DV4F 4L74A 1AFIA 4ZVPB 4PQAA 2KRBA 2QL5B 5LT5A 1RWMB 2NSBA 4KH0B 3HD1A 3I4HX 4DV6J 2HS4A 3MCNA 3OTEA 4HDHA 2H54B 2R4FA 1SB6A 1UVNA 1F3VA 3IN5A 2JEGA 5H1SV 4DUZF 4IOAQ 1R31A 2FZKB 2XMTA 3MTKA 4H54A 1F9EB 3OJUA 4DPWA 5KG7A 2E1AA 3DMJA 3QYYA 3OR2A 4N77A 2AYMA 2IJNA 1QSLA 3CJ0A 5DGBA 1LXNA 3CNQP 3MM6B 3IBFB 5HJXA 3U7JA 1PAEX 3E3XA 4IQMA 3HM9A 4I2QA 1XQIA 1D0EA 4O4RA 5C7PA 1HA1A 3QWUA 3AXKA 3RRHA 5J2QA 2MKKA 1G7CB 3FCHA 3QGIA 4LF9F 3DOKA 1LQ9A 4FPRA 1RLCL 2EBGA 3V5RA 1LWEB 2NUUG 1X0PA 1DY3A 4MIWA 2N3OA 5KFJA 3UNYA 5KTQA 3T1YF 5HJYA 3RAQA 1VQMS 2E5LJ 5KFMA 3ZZUA 3EGWB 4CO1A 2KJWA 2LEPA 1K1SA 2RKIB 2B56A 4OYIA 1S6UA 1FRMA 1NHKL 2L48A 1XR6A 1AA1B 3Q89A 4RO0A 5EGYA 3I82A 5HP1A 3R5GA 1S1XB 1YJUA 1NJIT 2PT0A 4ICLB 2Y9HA 3KJVA 2FQQB 4MT1A 5DO2A 4XDCA 1FTRA 1BQNB 2PDAA 3GG0A 1DTQA 1U45A 2N7CA 4JI3F 1FESA 4ECZA 1YSJA 1YZ6A 2CNNB 2BEFA 2DGWA 2Z4PA 4MH8A 3RGIA 3MR7A 4UUWA 2G0JA 2GO8A 3KWMA 3GE9A 1WC3A 3B82A 1D09B 3VGSA 4HYKA 4WF9Q 3TUPA 3OBIA 5E5NA 1ZZNA 4IUFA 2XMUA 3EVMA 4FP9A 1Y5NB 3PX6A 3OVSA 4UY8T 3DLHA 4CO4A 4HT7A 3NNHA 1U1OA 3V81A 2R3VA 3FBFA 5LL6d 4FNIA 5DDQC 1YJ9S 1FFWB 1WEXA 4P75A 5B0CA 5ETNA 3R7SB 3KLGA 1X4CA 3IGVA 4F2SA 1LNQA 2ALZA 3FBEA 1RAHB 3HHEA 2MSTA 3EX7B 4FXWA 1HNZF 4NA1A 3S8SA 1TK5A 1ZS6A 3FC9A 4H4OA 3GJRB 3Q24A 3CCMS 4ZPBA 2BKPA 5C42B 1C1CA 2C42A 2JRSA 2V6AA 5H9EJ 3U1NA 2E9ZA 5FJ4A 2PFFB 5J1EB 1UMJA 2P9EA 2B9EA 2LFVA 2ZM6F 1WACA 3F41A 4JI0J 2BACA 3MEGB 5D0RA 1S97A 3GILA 4KO0B 2XI2A 4M5HA 2HG4A 2KXNB 1TAQA 4WFZA 1XN9A 1R43A 2H4WB 4YMEA 2V0NA 4B3TF 3C16A 1N4LA 1X0FA 4CLLA 1U8SA 1MU2B 1KOOA 1U2FA 3B6BA 4PG6A 4DLEA 3SFGA 4Q0BB 3L95X 5ETMA 3VGTA 1F6TA 4ZP8A 1LW2B 3MPWA 4HT5A 2H5EA 5HP1B 1AXQA 3DOLB 4F0KA 1RTZA 3CJ4A 2OHDA 2ZE2A 1VQSA 2NLWA 3ZFVA 5JMNA 3PVXA 3OTCA 3OXGA 4YR3A 3I0SA 2JLGA 3K5OA 4M5KA 3JSMA 3JSYA 3BQ2A 3PX4A 3EICA 4LIWA 2PI5A 5LJ5Y 4LFAJ 2DHAA 4IYQA 2I0XA 1YJVA 3RG6A 3SFUA 4Z7CA 4CLUA 2PEBA 5F0UA 3SQGB 3ENVA 2KFZA 3MCMA 4TYBA 1BXNA 4KFBA 1S1WA 3CJ3A 2D3OR 2YH0A 2AF6A 4QJVA 5I3UB 1N54B 2W2NP 2LDIA 3D0GE 4NYZA 2LEBA 2JSXA 3OR1B 3S1TA 2W01A 1VS3A 4I6YA 2AIRB 3R6LB 3PYGA 2PA3A 4X64J 1N33J 1UWBB 3CC2S 1JJHA 1S4EA 2UUTA 3I32A 1Y10A 1KLNA 1JLEB 2RDDA 1NUEA 4QR2A 1HNXJ 1ZA1B 1TELA 1KR4A 1HNVB 2WB1D 2ASDA 1VQ4S 2BJ7A 4OLPA 3IC1A 3H42A 4B9TA 5D8HB 2XWXA 4V19J 2F5GA 4QYZK 4F4ZA 2YX7A 4DL2A 4FVCA 2IBKA 1Y11A 1SXLA 3A3OB 2C3YA 1B0TA 2Y8YA 4ED2A 4MK8A 1JLAA 2IYIA 5JUMA 4N5SA 4OQJA 1RTHA 2DNLA 5MLCV 2ZJPQ 4P10A 1N6QB 1MU2A 3KG0A 3QT6A 1RAGB 1LWEA 4K2JA 4MK9A 3CC4S 2R7XA 4X65J 3JAMY 1WOOA 4RNHA 2DO4A 1FEHA 5BXIA 1VC6A 2DCLA 2GVDB 2VA2A 1A9NB 1TUVA 4Y2MA 3IWNC 2WW4A 1D8ZA 3H25A 1JIHA 1JKHA 5BR8F 1RTIA 2DCUB 2GVZB 2R9LA 1TK0A 2KT5A 1YJNS 3GYGA 2ZH5A 2B8PA 5G0RB 3RBDA 3O3LA 2ZC4A 5GMEA 3MWBA 4AL7A 3MMAB 1O0PA 3UE2A 4B3OB 5EWFA 3FFIB 4HKQA 1RKIA 2W4DA 4QIEA 2J6SA 1EARA 2CIMA 3DM2B 4L73A 3UO0A 1WC1A 3SQGA 1OMSA 2V63A 3A8JA 4I7FB 1SJRA 3ILJA 2V2ZA 1ICEB 1DTTA 1RYSA 2QYCA 3NMRA 3P3DA 2VPWB 5KT4A 2OFGX 2HFZA 3FMWA 2XQCA 3HT0A 1PSDA 3MCOA 3SZ2A 2RRNA 2ZBQA 3QIPB 4L75A 2HRTA 1QUPA 2QA4G 3QFWA 2RU3A 2EI5A 4A4JA 4QWBA 2Y0SD 2ZOGA 1D8YA 4QZVB 4WFYA 2MQQA 3EXYA 1DBDA 2VKRA 2VICA 1PG5B 1OY8A 2X3DA 3PXGa 3PRBA 4DL7A 1HNVA 2R7VA 5F8NA 3VAMA 3CJ8A 3I6PA 2HMIA 1FX4A 2PC6A 3KJFB 1IKYA 5LSLA 2CPEA 3RR7A 1KDNA 4I69A 1QE1B 2D74B 2PSZA 1XMOF 1P1LA 2EKYA 3LGNA 2N7YA 4EO6A 2VDHA 3NNCA 1C2PA 1LWFA 1RT6A 1F2HA 1KFDA 4DR3F 2UUAF 1VLYA 2PFDA 2J7KA 3FGVA 4NL5A 5KFZA 2YNGB 2HFSA 3QRPA 5SZTA 4ETZA 3US5A 3P96A 4AXJA 1M1GA 5IXUA 1HHSA 4CH1A 3ENWA 1ZAXA 1HBUB 4NMLA 1M5KC 3CDWA 1G2EA 3DDIA 1HI1A 2HYIB 1FJGJ 1FDNA 2A3JA 3SSRA 4J9QA 3PW5A 1VLOA 1VRUA 4WCEQ 5LSRA 4A8YA 5DDRC 1UEKA 4C4WA 2RQKA 2DT9A 5C5JA 4LJMA 1QVFR 2K7KA 1TKXB 4G1IA 3ZZ0A 4S0MA 3FFIA 4LBPA 4DX6A 1UJ4A 5JVGQ 3R1LA 4FF4A 2YWKA 3MECA 2GC8A 2EFVA 3UI3A 2BE7D 2ZBIA 3AA9A 4WZQA 4F3OA 3OFEA 2ROEA 3ONQA 2YKMA 5M2UA 1CBKA 1JLGA 2C3UA 3DLGA 2HIQA 2IJFA 2Q79A 1FT8A 3OQ2A 5CD4A 1UVMA 1CLFA 3DI6A 4MFBB 4FPIA 4FZVA 1FERA 2FUG9 3SXLA 4X64F 3KLHB 4X4NA 5J2MB 2G2ZA 2NR0A 4MK7A 1IBLJ 3P5BP 4OMFG 4F67A 1VC5A 4B3MJ 2EW9A 2N4CA 3D6FB 4DPOA 2E1PA 1S9GB 3H5SA 2XLJA 1FA0A 1U25A 3D0IE 2ZH7A 4X66F 1T3NA 3MF5A 4JYAJ 1X4DA 5HLFA 4C0OC 2OMOA 1O5JA 3KK1A 4DBQA 4JP8A 2XGQA 1IKVB 2JFDA 5HATA 5CZVA 2J0WA 4KT0C 2XLIA 3PJXA 5KT6A 3DN9A 3MI7X 4RBVA 2VG6A 4CYUA 2LCWA 2YWWA 1HWKA 1FDAA 1LWFB 2DXDA 3TUZC 5AXMA 2OSRA 1I1GA 2LKZA 3KJVB 2GHWA 2KRRA 4KRWA 3GCWP 3TRGA 5CYQA 4RUAA 3FRYA 4QU6A 1NSQA 1NB7A 2F65A 1X4FA 3OPKA 4EU0A 1NJYA 1CC7A 3WIUA 4KIAA 2YX4A 1AUSL 2CNOB 1IUJA 3BSOA 2CUYA 1YRTA 2UVUA 1C1BB 4YQWA 1T02A 1VDHA 1BD6A 1MW7A 4P72A 2DHSA 4BBYA 3LP0B 1JKHB 2MTLA 1CS4B 1QD1A 2GGPB 1SL1A 5LJ3Y 4CO3A 1SL2A 3CSKA 1LW0A 2MKHA 1ZPWX 3HLUA 5M2RA 3JQKA 5A8WB 1M5VC 4DSJA 3T9NA 2VONA 1UW9A 3MMAA 4CLYA 1RISA 2UV8A 3PW2A 1HNZJ 5EDWA 4Q43A 4DEZA 1KEKA 2V67A 3HSJA 3OFFA 1X4AA 2OPSB 4PYAA 1S76D 1M5HA 2XYGB 2YKPA 1N0UA 4CO5A 2CQ2A 1K0TA 1YDLA 1N0VC 3S6EA 1RAAB 5DDPC 1R7IA 2QMWA 3A4TA 1JLFA 4BLGA 2UUCF 2LU1A 1M0SA 3GJSB 1Q81T 2JLEA 3CWJA 1S6QA 2RSQA 4NRTA 1NO8A 4A46A 3TZXA 2FHJA 3D5MA 1R6VA 4NLVA 3FJ2A 1Q5VA 5C24B 2FC8A 3IGNA 5A6PA 3K5MA 2AT1B 2VQFJ 5KFXA 3MM7B 1V9OA 1VRTA 3D2WA 1I5OB 1RAOA 4DR2F 2QX0A 1TZ0A 1KQGB 3ZZRA 4Q0BA 1VISA 4ZVQB 4B9UA 1LW2A 3AHPA 2AU0A 3KHRA 2BR0A 1FCAA 2OTLS 2VBYA 2FVRA 3HXMA 2O01C 2WOMB 5BJRA 2V5HG 4F4WA 4RW9B 2VDIA 2F4VJ 2F8EX 1SKRA 2DH7A 3TOQA 2LXIA 4YEAA 4EK2A 1HKAA 6FDRA 5THWA 1ZTWA 4OI3A 2AJ1A 4AT1B 2ZUAA 4DCPB 3KNAA 3ETMA 2ACYA 1UVJA 5GADI 4LF7J 2WSEC 2YQ0A 4DX5A 1X5OA 4NMXA 3GFYA 4OYWA 3Q23A 1NEEA 3MMCA 3DXSX 4Y2KA 1GH8A 2RS2A 1RT1B 2QZ8A 4GRSA 4KHRA 4LF9J 1R0CB 1EQMA 5K8NA 4YY3J 3OL7A 3KJQB 4USWA 2BJ9A 1W2IA 1X4BA 2HKEA 4ZVTB 3GSDA 3QAUA 2DNYA 5LXRA 4C2MA 1IR0A 3MM8B 4IFYB 1BHNA 3HVWA 4X4UA 1U6ZA 1S4FA 1KQKA 4RW7A 4FBUA 1VHIA 1UCNA 3BR8A 2RF2B 3CULA 1FNMA 1F5AA 5E2QA 4X4TA 4XIUA 4DL3A 2XMMA 4EBCA 1OSCA 2CPYA 4FBTA 1U4BA 2KU7A 4DV3J 2JEJA 1TK8A 4DR5F 1URRA 5HVGA 4W90B 1Q79A 3CJQA 4A8MP 4C0HA 2GMLA 5C2CA 2D7SA 2M70A 4N7TA 2BQRA 1JJCB 4P7TA 3DI6B 1ZPVA 2CQ3A 2GX8A 4CP5A 2HFUA 2HNDB 2OLWA 3I0RB 4CLSA 2XYPB 3L09A 3VVTA 2F4VF 3BF4A 3ZNJ1 1RXOB 4M5GA 5B7WA 5KFKA 1M5OC 5A0YB 2YKAA 3AA8A 1ZM3A 4ZPDA 1NHUA 1T9VA 3HFKA 1NK4A 1FKOA 3ZTPA 2M7SA 2HHWA 3MM7A 1KRPA 1WOSA 5L9XA 2K7JA 2Q6BA 4AL6A 1WI8A 3W2VA 3CD5A 3Q8SB 4C0BA 1FNXH 4NXMF 2E5IA 2OUGA 4PXDA 3HPOA 2DRBA 4NZ0A 3Q8QB 3TA2A 2YTCA 3BGRB 4RBUA 4QPXA 2CWXA 4UOFA 3I55S 3SCKE 3AY0A 4ANCA 4USMA 3QPIA 4WU3A 3S7RA 2KVQE 2UZAA 4B08A 2K2PA 3OHBA 2HNYB 1GX5A 1C0TA 5E3RA 2APOA 2VG5A 1UVLA 5KFFA 4LR9A 3C2PA 5DQIA 5A76A 1FD2A 3WZ0A 4M5DA 4CH0S 2GIQA 1NDCA 1PC4A 1YTYA 2HQIA 3UDLA 4F25A 4RL1A 1UL3A 1VQ5S 1F2GA 3TVZA 4DCOB 1N36F 4F4AA 1K47A 2LYVA 2B8QA 3MUVP 1WELA 3EUNA 4C11A 2G0IA 1QTNB 2D9OA 4LF2A 4J9SA 4WU2A 2LQBA 2QEXS 4OJ1A 1WTFA 4X4QA 2XO7A 3CMQA 2C3MA 2W8LA 1JX4A 1NRKA 2ZE2B 4F0HA 4W4MA 3DLKB 3NOGA 2F63A 3CDBA 3FEXB 4TXSA 5A2QY 3H4BA 2KXHA 3CW2C 4YHHF 3JSMB 1MLAA 1QAYA 1QJHA 2DISA 2HEKA 2ZD1B 4M5LA 1FDBA 4TKTA 3ISNC 3D1QA 2DPJA 2BQUA 1GXTA 1BWVA 2XZWA 1SH2A 1FRJA 4LQ3A 1UW4A 4NPOA 4PYDA 4O23A 2BXJA 3TARA 2UP1A 1JLFB 4KC5A 3CUNA 1OPZA 3MAHA 1VQPS 3NAIA 3SV4A 4EO8A 2OPQA 2R8JA 2F7VA 2AZ3A 2U2FA 1TL3B 4Q8EA 4H4KA 4OZ5A 3DOKB 2WVBA 4EFAC 3DU5A 2OEJA 4GO7X 1UFWA 1WEZA 2B9YA 5GAEI 3M32A 2B7CB 4DJBA 2E44A 4X66J 1S6OA 4WFAQ 4ECXA 1K44A 4PCQA 1T0TV 3THPA 3JYTA 2FB0A 2DNNA 4O44A 1F0XA 3ZZOA 2VQEJ 4B3MF 5IT9Y 5CA5A 1P9QC 3MUTP 5F9LA 3IWXA 5D0EA 2M9KA 1C0TB 4JI3J 1JK9B 4I64A 3KHGA 1WEYA 2YNFB 1QAIA 1CULA 2EFQA 2W8KA 1BQXA 2LQJA 4F0MA 4JV1A 3CTRA 5D3GA 1P6TA 1DTQB 2J9DE 2DGTA 4JI4F 2V8GA 3OL9A 2BQ3A 1U02A 4YB5A 4FXDA 2D3ZA 2Q3PA 3VAIA 2MKSA 3OXFA 4D3HA 2O67A 2DGVA 4OX9F 5IS2A 4IRKA 2OPPB 2CQCA 2WVCA 2W2MP 4OHXA 1IKWA 5DETA 1K9MT 1B0PA 3D4JA 3W65A 3GR1A 3DDKA 3Q83A 4ZA1A 1PAUB 3IXQA 3IO1A 1KC8T 1P27B 2ZZTA 3HVTB 4DN9A 1RB0A 1TL1A 2VL1A 5F41A 4EYIB 2YKQA 1T05A 2GVZA 2HWTA 1KQSR 2OMLA 3RYLA 5L38A 3CCTA 2CADA 1FDDA 2XCPA 1UVKA 3FZBA 2X1GA 2ZDOA 1H7WA 4NXNF 4HR2A 2CKWA 3ENAA 4WKRA 2JOQA 5HLFB 5GAGU 2R8IA 4I1TA 3TEGA 2AHOB 2JC0A 4JI6F 3GJTB 1HPZB 2VOPA 3FMBA 2UUAJ 2MY7A 1DTTB 4N47A 2HQ3A 5E3QA 4ZVSB 3CO0P 3DRPA 2GJIA 3IMQJ 3R5CA 4RWXA 4RZRA 4RNNA 1P1TA 4EZ6A 1KN6A 2OPQB 4DWIA 2KB2A 1TL3A 8RUCA 1YLXA 3OD2A 1S77D 1JQGA 2FD2A 4CCHA 4PXBA 1Q1KA 4ATNA 3KHLA 4UUXA 4DUYF 4HH0A 2YPYA 4CLZA 4USJC 4O0NA 2ADCA 1U1KA 3QT5A 2NXNA 3FKBA 2B3TB 1FRXA 1W7WA 3K89A 1H72C 1HARA 4QR1A 5GVQA 4USKA 3HJFA 4FS2A 4ILMA 2XEXA 3M2RB 1GTHA 3N79A 2HMIB 2GGPA 2I38A 2DNOA 2ILZA 2VBXA 2VPZB 3WDOA 3CCLS 4QBUA 3FVYA 4OYOA 1AROP 1HBMB 1H0HB 1H2TZ 1N88A 2VC0A 3NS6A 5A8KA 3TZYA 5D3GB 1IBMF 2VG5B 4G65A 2HZCA 1T94A 4WE1B 5F9NA 4NCBA 2WONB 4LUBA 1M5PC 1B64A 4Q2MA 3NNAA 4LF6J 2FJDB 2MEWA 5ETRA 4USIA 2H48B 1V6HA 1VMBA 5KFDA 4ZDNA 2ZUGA 2ZH9A 3GQCA 2MLZA 4DR4F 4NXMJ 1HR0F 3FRZA 3N5FA 5I3UA 4B9LA 2DGSA 1U0HB 2LP4A 2M52A 2HQFA 3CDUA 3JTPA 3OR1A 1D9DA 2E9RX 3VHQA 2UXBJ 2ZC3A 2MLYA 2ZVIA 2C2KB 2OKQA 4HLBA 4KGKA 1I94J 3PO5A 2HHUA 2GJ2A 1DLOB 5G4DA 3TP2A 3M2VA 4X4PA 2E66A 3V6DB 2B6AA 1CQNA 2FTRA 1HMVB 2MQOA 3J80U 1NJZA 1VQ9S 2UXDJ 3UDEA 3V2UC 3DGPA 2AQ4A 2XULA 1VCTA 2CPIA 1XMBA 1YVFA 2LVWA 3MMJA 4J9VA 2MKCA 1FNOA 3NWGA 2A1BA 4NE9C 3UN3A 1D1UA 4M95A 2F4FA 2DGUA 3J7Z5 2KT3A 1VIXA 4DV3F 4PQUB 1B99A 4QWAA 1AZSA 3NGDA 3Q8RB 2HQCA 2KHCA 4L72B 3TO8A 1WHVA 3AB4B 4I0WA 3O2IA 2HWHA 2WW8A 3RAXA 4KAIA 2DHXA 1RAIB 1PJ7A 5GMKa 2ZH1A 2UU9F 4OHWA 3M6UA 2DR8A 2GMJA 5CCLA 5HMYA 1J5EJ 1RTHB 2FJXA 3PCOB 2EK6A 5DZ7A 3MXHP 1HNXF 5KFOA 4M63A 2VFRA 1WC5A 4Y2IA 1DURA 3HFVA 4IG3B 2QL9B 3OXLA 3OW2R 1CJTB 1SC6A 4ED8A 4GKKJ 2E1MC 3O1LA 4RWWA 2KJVA 8AT1B 2ZOFA 3IS9A 5F8IA 4HACA 3LW5C 3L7UA 2UVVA 1NB2A 3HSZA 4QWEA 3MM8A 3QAEA 3NCQA 4IFVA 4IFYA 4ZVHA 2IIHA 1S49A 4P2FA 3PY8A 2P6SA 2XNQA 4DX7A 5IV4A 2MZSA 4C9DA 1S7HA 3IM9A 2KO1A 1H2UX 3KJNB 1WDDA 1NLKL 5HN0A 3FSIA 4KHMA 3BBBA 4R5PB 3PKMA 2RJZA 2CPZA 3BREA 4K5RA 2HHTA 2FHMA 2FYXA 2HPUA 5C25B 3C14B 2A6OA 3CPWR 2QYGA 3PG9A 2J9EA 5I42B 3OL8A 4LFAF 3LQVA 4RW6A 1KLMA 1R8AA 3V6JA 4DV5F 2YNHA 1GMUA 1YZ7A 3DC2A 4GO5X 4ZPAA 4A47A 1HHTP 4ZKAA 5BYQA 3QWPA 4OX7A 1NU4A 4IDKB 5A0YA 4FF2A 1CS4A 2M2BA 4O3PA 5KT5A 5DLGA 4CDIA 4V1Ak 1AT1B 4OZJA 5IC6B 4AE5A 3AH6A 4RR5A 2UUCJ 4TU7A 3S01A 3CCZA 1CPZA 3HZGA 2HRUA 2QIFA 2DNMA 4OLOA 2BA9A 2XMKA 4PG7A 4DV1J 2X1BA 1U0SA 3B54A 3DLLQ 4HI1A 4JI1J 3VV2B 2CFXA 1WKLA 3GB0A 4P9SA 3NL0A 4PXCA 2F3JA 2DH9A 4JI0F 5F8HA 2FVSA 1FK9A 2DRDA 4RUBA 4DV7F 3W1YC 1JXEA 1U6FA 2HZAA 3R7BB 1IXKA 4PG5A 2VJVA 1TFYA 1BE4A 2ASLA 3LWMA 2W4PA 4ZK7M 4P2SA 2CJAA 2YKNB 4CZCA 5LOQA 5IC4B 1Y7PA 3C15A 1S6QB 5B09A 1XMQF 2HHSA 3BGOP 1JLCB 4ZLLA 3I56S 1TMMA 3M8QA 4WIQA 4UF4A 5FLXY 2OGUA 3KKFA 3TX8A 1VRTB 3THTA 2QJ3A 3ZNUA 5ETTA 2J6UA 1IBKJ 4NLWA 3LGHA 2FLPA 5EX3A 1Q8IA 3D66A 2NUHA 4ZHRB 5ETQA 3MURP 3KLIB 2MJNA 4HI2A 5DQHA 1XWLA 4FKXA 3EZOA 2LXFA 4EEYA 4YFUA 3GZ7A 1TTHB 2GZOA 1WOPA 2DNQA 5A8KB 3DLKA 5CCMA 1Q86T 1LWCA 4WE1A 1JMTA 3M30B 4NLUA 1RU1A 2ZWPA 4G1PA 4PWUA 3VZIA 2ZH2A 1KFSA 2GV1A 3J7AN 3CCUS 1RA7A 2EVZA 4FYXB 2W9CA 4RBTA 1QM9A 5LMUJ 4DR6F 2V2KA 2K8GA 5KFIA 4XTTA 2V8HA 5LMUF 2BDPA 1SJQA 3DGVA 1V5VA 5ETLA 1IN0A 1ZAVA 3FQKA 4ZP6A 1VQ7S 1H2VZ 2VG7B 4LF1A 4E98A 3GIIA 2C28A 1RAFB 3VAKA 4ZS6A 2HSEB 2E9TA 1S9GA 2JH3A 3X1LB 1UVIA 4DSLA 4K4XA 4Y28C 4ILRA 1SI9A 2XTJP 2KH9A 2MQMA 2E5LF 2DHHA 3A12A 4KKOB 2WTFA 4WYLA 4Q2LA 4WBFA 5KOXA 3GIRA 3KLGB 3R27A 4M5NA 4CLPA 3JQMA 3KK1B 2IA6A 1LFWA 4OZ0A 3N0VA 2V4RA 1UA1A 5I4MA 1YBTA 3JSBA 5KG4A 1G6BA 2HZVA 1NPKA 3JYTB 3KLEA 2DR9A 1NZ8A 3MD1A 2CJBA 4QWDA 2V4JA 3BSNA 4GKKF 5DG7A 2IVYA 2G13A 2XSJA 5DG9A 2WBRA 4DSIA 4MMOA 4OYXA 5T7LB 1WSVA 3I9ZA 3DCAA 3T1HF 3DLBA 1C4AA 2CQ1A 3V6HA 1NK7A 2ZITA 3R3TA 1KNZA 1XK8A 2XY5A 8ATCB 4C97A 5ADZA 2QT7A 3CB4A 1F9HA 1T95A 3C16B 4NEZA 2H65B 4OL8A 1V3RA 3NRBA 4FS1A 2FZCB 2CQ0A 5L1JA 4ECWA 4HACB 4ZVGA 4NLPA 3LWLA 2IC3B 3G71S 4DV1F 2KG1A 2PI4A 3G82B 2WRMA 3ZO7A 3DOLA 1ZAWA 2RKIA 1U7LA 4LR7A 4U9RA 1VYAA 2EG2A 3UFCX 5D6GA 4LF4J 1TFWA 3IFEA 1EETB 4OX8A 3J7YU 2VC1A 4DI6A 1A6LA 2H5JB 1N52B 4B9NA 2F9JA 1TL7B 3QGPA 2GAGC 5K14B 4V19X 4R5PA 3R5DA 3D6TB 2FY1A 2WHOA 1M1KT 2A2DA 3ET6A 4LBHA 3K58A 4EMDA 4RNFA 3KFWX 3PHTA 1KLMB 1RHRB 5IQQA 2B51A 2VFSA 3CC7S 3QJJA 1T9YA 1PYTA 4ECQA 4X4SA 5KAKA 4UQTA 2NXJA 4ID8A 4PXEA 2C2OB 4OHYA 3HD2A 4RU9A 5K8PA 3KUHA 1ZTTA 3CMES 2MJUA 3LP1A 1UWAA 3I5CA 2OJ3A 1OY6A 4C8ZA 3MGJA 1L3TA 3UVJB 2JVRA 1FKPA 1SC4B 1YJ7A 2QSWA 4XAKA 4QPTA 3KXDA 4JV5J 3M2RA 2EPIA 2Z30B 5ETOA 5E7OB 3UNGC 3F56A 1FJCA 2OPRB 4QR0A 5HQ8A 3TX0A 4RW4A 3W3SA 2KI2A 1SQEA 2DPIA 5KFHA 1RE1B 5HMXA 4LRCA 5KT3A 1Q16B 3LO3A 2E5HA 3C15B 5AE1A 2HLTA 2UU9J 4RNMA 2FJBB 3LA0A 1N5VA 1FWKA 4ZN1A 5D78A 4QWCA 1JWWA 3GCXP 2PGCA 2M5YA 4IH7A 1U2CA 4JUZA 1MWYA 3MHYA 4WK1A 3HZEA 2GQCA 4OYAA 1BC6A 3QSIA 2Z8QA 5FD1A 3KLIA 1U0HA 1NDKA 3DYAB 5JJBA 4QIWD 1IJEB 5GAHU 3KHHA 3A1YG 2J8SA 4GVBA 1FXRA 2UXDF 4ILLA 2KM8C 3CD7A 3T5LA 2DK2A 2YNFA 1HMVA 2CPJA 3M1VA 4ELVA 2N3LA 2CQGA 2HGLA 2K06A 3L4BC 3J7YI 3ZTQA 3RB6A 1I94F 1NBEB 2XS7A 2J8AA 4DS4A 2AD9A 2FJWA 4K7QA 7FDRA 1AYEA 5KG6A 3DRSA 2Z57B 3N6LA 3G96A 1HR0J 4OJ3A 2PD1A 3Q0AA 5A8RA 1RQ0A 2W7PA 3G6VA 4FVMA 4QYZJ 2WSCC 2HBQB 4ZPCA 4ECYA 5CH7B 4OYZA 2VFTA 3BV8A 3VQTA 2CQIA 5L9NA 3R5JB 2ZH4A 1X7VA 2DIUA 2YNIB 4QIFA 4WIIA 3H4DA 3K5PA 2CVIA 2XZDB 3UCUP 3NWRA 2W4CA 2KVIA 3EVWA 1ITPA 3SQOP 2CXEA 5C2GA 2O5DA 2I5JA 3O8WA 5KFBA 2OFHX 3AQPA 2Y1LB 1OY9A 4KY3A 4RKUC 2HFOA 5KFWA 4DQPA 2HVEA 5E3CA 4TY8B 2I9SA 3MR3A 2DXFA 1HQUB 1TKZA 3A8KA 1HFEL 3T19A 3WX4A 3GV7B 1NKEA 3QNWB 2OIHA 5IT9U 1Q82T 3CIZA 3D3BJ 1FI4A 2QMUB 2DD8S 5D4LA 2RMLA 2VKZG 3DFEA 1YX2A 2V2VA 2AX0A 4Q5VA 5EUHA 1MROA 3N6MA 3UN5A 3C46A 1SC1B 3TAPA 1XC9A 4TYAA 1CEZA 3F73A 2EWHA 2HK3A 5IWAF 2J9DA 1X4GA 1QY7A 2X3GA 4BWJA 3KLVA 3CCJS 1J5OA 4YR0A 2B5JA 2DH8A 3D67A 1AUDA 3CMAS 2XI3A 1KBRA 3E2EA 3EYZA 4C11B 2HHPA 1IM6A 4RJVA 1S1UB 4NYOA 3CJTA 4R8UB 3TQEA 2C2EA 3Q8PB 1FF2A 2HURA 3M9OB 2HBRB 3SEOA 2D9PA 1WF0A 3BKTA 4MKBA 4A48A 1V5IB 3OLAA 4OI4A 1OSDA 2D41A 2VIHA 3QJLA 1XIQA 3CCES 3T6BA 2BMBA 2DGOA 3Q22A 3TVYA 2HHQA 4ZVOB 3LUYA 3W9JA 5HI7A 4UQGA 2FHOB 3BDEA 4EYHB 2YKMB 5LMNF 1GMWD 1YGYA 2W7AA 3DLGB 3ETOA 3EPIA 3OVBA 5I3QA 3GSIA 3AJDA 2GHVC 4NI2A 3H40A 2K3KA 1DQAA 1S59A 1FRLA 2MQLA 2YNIA 3KG4A 4G1QB 4RLEA 4USUA 4ZITA 1T03A 4IR9A 3PZPA 2ZHBA 1JNZB 2J0QD 3MFHA 1RADB 2HNZA 4J9OA 1RWPB 2GFFA 1CC8A 1YJRA 4QOTA 1NPPA 1RBOB 2LA6A 2L9NA 4DSEA 1Y00A 3DGPB 2IDLA 4JI2J 1FEEA 2B9XA 3UCGA 1OO0B 3PRDA 1QSSA 1FVSA 1IKVA 4TU8A 3GP9A 2ZFHA 4DMZA 2AKWB 1LV5A 3PFEA 2NXCA 1JXLA 4B9VA 2ZZNA 3M7VA 1FE4A 5CZXA 1U48A 2P2CB 4N41A 2OTJS 3B78A 4YOEA 3HCXA 3H7HB 1SJFA 2J0XA 2R7TA 2ZH3A 2Q1LA 3V4MA 2RE1A 2B43A 2Z2YB 2AP6A 2CG8A 2MZRA 3QO9B 5ETPA 3RBZA 1LK5A 3SDEB 2BJDA 3Q8VA 3GR0A 3H5UA 2RUSA 2FJVA 4CWBA 5A6WA 2W9CB 3ZTRA 2JEFA 4F3MA 1HHQA 3CJSA 3FSYA 4LBIA 1C1BA 2OELA 1NK5A 2MLXA 5HROB 4GMKA 2HHHJ 3R2CJ 2JEIA 1T9TA 4Y2CA 2XLKA 1D3WA 3DYAA 4WFXA 2R7QA 2FJAB 5HSPA 4C3LA 2ATLA 3D1HA 4KPCA 4KBIA 3R7NB 3TW0A 2LECA 5B0EA 4ECUA 2X1FA 3R2DJ 1TKXA 1WC0A 4U7UD 2CYYA 3W62A 1CJVA 2LQ5A 4NLDA 2BE2B 2RIJA 4MKAA 3DXBA 1PGZA 2EEYA 5L39A 2KYXA 3T5JA 2G9OA 2X51A 2HHVA 3IRXA 3NBPB 2M8HA 3I4PA 4I6WA 1O8BA 4G3IA 3DRPB 1IKXA 1FWLA 1P8GA 2A18A 1KOHA 3HHLB 2DHGA 3ILLA 4MTPA 5HL7Q 1R8CA 4XO0A 4QU7A 4HTJA 1WC4A 2B4PA 1NH7A 4DL0C 2I1RA 2A0FB 2BRLA 4YN3B 4OI1A 2HIYA 2OI2A 4KYZA 3RB4A 2F1FA 1RHQB 2LA4A 3Q8YA 3UN2A 4F4XA 3THVA 2W25A 3RBXA 1WUUA 4PAAA 2R8HA 4NZ7A 4IH5A 1SIWB 1HYSB 2BJ1A 5KFNA 3HO1A 3C6UB 1ZOTA 3LPYA 4CLWA 2YXLA 4I67A 3IR7B 5F8LA 4TY8A 2RRBA 2KM8B 1HQUA 1Q8LA 3WC2A 1WDTA 1NKBA 1KVKA 4CNYA 4LR8A 1UEVA 4ZJOA 5ITHA 4ED5A 2V34A 2HK2A 1HQEA 2RNEA 4MJKA 2E29A 3OUYB 2WCXA 2WOMA 1HBMA 3OTDA 2VPXB 1FK9B 2XGPA 5E0OA 3FBCA 3H5XA 1EETA 2WONA 4URGA 4K0KF 5FIIA 5BR8J 3FZ2A 3NGRA 4C48A 3KLFB 2QE5A 2VOOA 1KQFB 1RJJA 3HFZB 4Z2XA 3N5BA 1V3ZA 3QGGA 3GG1A 3DLEA 3NEKA 3I5AA 2RQCA 5HROA 2QLFB 2POKA 3TAMB 1IJFB 1RWNB 2ATCB 3EVOA 2IPOB 2UVRA 3SSSA 3TA0A 4B3RJ 5H9FJ 4WTOB 3EE3A 4DFJA 4TNOA 4C8MA 2W7OA 4F50A 1FWPA 2J9CA 4C98A 4CLFA 3K7RA 4RW7B 2XB2D 4K4VA 2DBBA 5KG5A 2IM2A 3CF5Q 2PIIA 1SQGA 3GIKA 3P45B 1EZZB 2IMOA 3N9UC 4YY3F 5AXNA 1U8WA 3FUYA 1TAUA 3HHLA 1Q7LB 3FEZA 4HTIA 4AL5A 1S9EB 1BQNA 1IQZA 4LF7F 2YX1A 4YB6A 4DFPA 1GEHA 2VG7A 2MYFA 3KDNA 2BW2A 4CTAA 4BC9A 2MXYA 1NM2A 2LLZA 2UXCJ 1FKOB 1UJ5A 3HSDA 2C2RA 1X5SA 3TJ8A 4J9NA 2B9WA 3IAM9 2CPFA 3NOCA 4MYTA 4A8OA 4BHQA 1VBKA 2E1RA 4IG3A 4KKOA 2FGOA 2JHEA 3VAFA 3CO9A 2MPUA 1XTZA 3GJQB 4JI8J 3TUIC 2P8IA 5KFVA 4TVAB 1MMDA 1QAXA 4KGVB 1S72S 4TN2A 4WPAA 1Y9OA 4IOCQ 1NSAA 1PYOB 4Y65A 3SMZA 2QA2A 5KT7A 4WFNQ 5F0WA 3N6NA 1HNIA 1H3DA 2XSJB 4QW8A 1S1XA 1Z2LA 4XPEA 1PYSB 1BLUA 3M1VB 3X3UA 2Q43A 2CJYB 2HAFA 2JFKA 5T7LA 2Y1JA 5H9FK 3EDRB 3KNGA 3MOJB 3EGNA 1GQEA 4C3KA 4LF5J 5C25A 3NGUA 4J37A 4DL6A 1XBWA 2PN6A 1UKUA 5A2QU 2EG1A 3WC0A 4OYMA 4XK8C 3KK2B 1IBKF 1XNQF 3HHKA 3U1LA 4LFBJ 4LFCJ 3RU0A 1BMQB 2G0CA 2HGMA 3D6MB 3WIVA 2M8DB 2BJEA 5GMDA 5KG1A 2HVIA 2ZH6A 3PJ9A 1JLBB 4OZNA 2ZM6J 5SUHA 1E6YA 3JS9A 4OIXA 2MKJA 4J9LA 2LDYA 1RTDA 4DF4A 4HEA9 3EWGA 1GT8A 1S6PA 1YBUA 1ZM9A 4K2XA 1BWEA 2VH7A 3NKYA 1SUQB 2CZ9A 5K8OA 1I3OB 2K3IA 5HQLA 5K14A 2LMIA 3TQ1A 4DR7J 1Q8BA 5J2PB 3IRXB 1TKZB 5LXYA 1WTBA 1S0MA 1T8EA 2DO0A 2LU2A 4DQQA 1NKCA 2COLA 3T1AA 3OJSA 1GMVA 3OSPA 4M5JA 1RWUA 4LF5F 3NLCA 3I0RA 3P5TL 4K4UA 4M8LA 4O4GB 1VQNS 4PWDB 4YUDA 4E0DA 3MEGA 3CDEA 3D54A 1JNRB 1L3SA 1TR0A 1B4SA 4CT9A 3MR5A 1HI0P 3WQPA 4OJGA 4MIAA 3MOZA 3HK2A 2RILA 1ZZFA 3POTA 5AT1B 3QZ7A 5KFLA 3ZC4A 2HGNA 4K4TA
chains in the Genus database with same CATH topology
1BGXT 2K1RB 1WHYA 4Y3CA 4O44B 4NLRA 4BDPA 1NK6A 2JL9A 2PEHA 5DRKA 3P49B 3CJKB 2OPRA 5B0GA 2W9BA 1BY9A 2IAJA 4HVZA 3UDCA 1U6BA 4K50A 4JV0A 1DARA 4F3QA 2C3OA 3H8YA 2MB0B 2DITA 1BQMB 2J0SD 2YY3A 1R89A 1HWIA 1KVJA 2BM0A 5K5MA 4C3MA 2GA7A 3HT3A 4Z37A 3UD4P 2BUNA 2R8GA 3HVTA 1J5EF 4O0IA 1UA0A 2KN4A 2MHNA 2JWNA 4KQZA 4ELUA 4U67Q 4ZPVR 4DSKA 3LAMA 2XS2A 1UWBA 2CPDA 1HWUA 1SUQA 4UOCA 4U6PA 4DR1F 5CXTA 3DRYA 5EHHA 2ZHAA 3HKWA 3VR1A 3VZHA 4OV1A 1WG1A 1GAOA 2UUWA 1TQLA 5L8RC 1WHWA 3DRSB 4HH1A 4B3OA 2EFGA 2E7XA 4E8UA 2YH1A 1U1LA 4O3OA 4NLOA 3CVKA 4I2PA 4CTAB 2KG0A 4QW9A 3SDEA 1L3KA 3VALA 1YWXA 5B0FA 2UXBF 3W2WB 3POTB 4NA2A 1DRZA 2K1RA 2B4VA 2IC3A 2ZHOA 2AJ0A 4K4SA 4KHPF 2NXUA 5DDOC 2AGQA 3LP2B 2R7WA 3N01A 4BC7A 2J7WA 1T7PA 3D28A 1MROB 3J7ZT 1VFJA 3IRWP 3E01A 4PR6A 3SCJE 4Q8FA 3CCQS 2GO9A 4AUKA 2J6TA 2W9AA 1R8HA 3R1HA 1U1NA 3P6YC 3M05A 3RZAA 1SJ4P 2SXLA 1OWXA 4Y00A 4J9MA 4ID5B 2IYGA 3C6TA 3MEEA 4ED0A 5F8GA 1RT6B 3B4DA 5HMWA 2HRYA 4AXIA 3HI9A 4DL3A 3VAHA 4CIOA 3N4WA 4F8RA 3C3LA 4R25A 2XMWA 3ZZZA 5GADU 2M88A 1X4HA 4H4MA 4ECTA 2E1CA 3M2VB 4OHZA 3FDSA 2OO4A 4KJIA 4KGMA 3HDSA 1J2VA 3T5HA 1VRUB 1JJ2R 3D1OA 1FKPB 2VB6A 1L3VA 1S9FA 4OI0A 4X62F 4ALZA 2YWGA 3U1MA 1KSPA 4IRDA 1IKYB 2DNHA 2IRXA 2MSSA 1YRUA 2AV5A 2DNKA 3CGIA 1QE1A 1YIJS 1L3UA 1WNEA 2QSFA 2VODA 1DJ0A 3HX9A 4EBEA 2AGOA 4O4GA 2UV8G 2P5VA 1I6JA 3RW7A 4TQSA 1Y3JA 3V4IA 2C3PA 3NP5A 4LIRA 3GYNA 4DQSA 1GTEA 1M5PC 3MM9A 4IRKA 4ZCIA 2YVSA 3V6KA 3HKZD 3M8PA 3O5TB 2HAIA 2DRAA 5KFUA 1VQLS 1F5BA 4OX6A 1OS5A 2ADBA 4B9MA 3BR9A 3PIPQ 1D9FA 4JI2F 2DTJA 4DG1A 4JV2A 5HMZA 2DJWA 1H6KX 3BGUA 3K8VA 3CD0A 4AFFA 3KK3B 2AYGA 4ITSA 2Z0GA 3PFOA 4I6AA 1U1RA 3QO9A 2FVCA 3G6YA 4JI7F 2ZNZA 4IQXA 4UY85 2XMJA 5DG8A 4CT8A 2CJQA 1NK0A 1X9MA 4EUVA 3UPFA 3IWLA 2HHXA 2VBZA 2WSFC 3QLHA 2AYEA 1VI7A 4H4MB 2FLOA 5DQGA 3TAQA 2MZJA 3GV8B 1TVRA 4NCGB 2OD6A 2IM0A 2I5JB 1A7GE 1HWJA 1N34F 4WXWA 5E3AA 3MM5A 3FQLA 4I56A 1SIZA 2GHPA 5CQGA 2EFPA 1KS2A 1LW0B 2ILYA 3PACA 5A8WA 4XDDA 4LMZA 3NBPA 4CI0B 1DQ9A 1XEZA 2QLXA 4EZ9A 4ELTA 2VG6B 2G1DA 3IR5B 3CJ5A 4TY9A 2FPHX 3IBWA 3LF0A 2LEAA 2V4QA 3M2UB 4ED6A 4I2PB 4DR7F 3AAWB 4KV8B 1VHFA 4WK3A 3M8QB 1X8DA 4ZOSA 5F8JA 2RVJA 2PE8A 1HYSA 2OD4A 3CCSS 1S1UA 2DGXA 3EGZA 2QMXA 3BGFA 2JX2A 3RB3A 3R5AA 3LP2A 3SI8A 1H98A 1YG0A 2KKHA 3CE8A 4LFCF 3HHLD 1SH3A 3Q2SC 4NRUA 3KK3A 4LFBF 4IFVB 5KFYA 2NZ4A 3H59A 4ZP7A 2DGQA 2FC9A 3GIMA 2CRLA 2AGPA 3U27A 1URNA 2ZH8A 2ZVSA 3PR5B 4IO1A 5KG3A 4F26A 5J2PA 1O51A 4ICLA 5BYSA 3MEEB 4J9PA 1N5QA 1E6VA 1KD1T 4URQU 3DLEB 2O3DA 4ZCMA 4A8XA 2MZTA 3M9NB 4B9SA 4D3GA 3TAMA 1TL5A 2L3MA 3AJ1A 1TP7A 5DJBA 5LSOA 4NCGA 3HF5A 3MMCB 3RTVA 2HNZB 2XMVA 2MQNA 4X4RA 5T14A 4G6VB 2MGZB 3OVAA 1WG5A 2GNKA 2ZZMA 4TLQA 2UXCF 3JSRA 1YITS 1K0VA 3IA0A 2Q6CA 1KHVA 1X9SA 2WAQD 2QRRA 3VAGA 1Z4UA 2OSQA 5DLFA 4WZMA 1ULRA 4WFBQ 3VF0B 1NJWA 3M4XA 1CG2A 1FRIA 4BCAA 2QO3A 1ZBTA 1VK3A 1AFJA 2V94A 2IAJB 2BANB 2X1AA 3HHNB 1AW0A 4LT6A 2ABYA 2YKNA 3D0HE 1BQMA 1N5TA 1C1CB 4L3NA 1SJ1A 3ZZPA 3MM6A 1YHQS 4A8QA 1OQ3A 4ZCKA 4LSLB 3MCSA 2VFUA 4RU2A 4B3RF 3BS9A 5L1LA 2F9DA 1LOUA 2DR7A 2KZZA 1DFDA 3G86A 2ZKTA 2U1AA 4I68A 3L7PA 1YJTA 4NLYA 3W2VB 4LVNP 1WF1A 4PKDB 2Y1IA 1LWCB 2FDNA 3M30A 1WD6A 4OI2A 1UP1A 1WF2A 1X5PA 3MEDA 4Q2LA 1CQMA 5B0BA 2KZMA 3DLJA 1CSJA 3L7OA 1R6YA 2HFNA 2JLFA 4DFKA 1E6VB 1HL6A 3LANA 1UJ6A 3KK2A 3BDPA 2NQPA 2RT3A 1HW9A 4M5DB 4RW8B 2UUBF 2EC0A 4ED3A 2VQFF 1SKSA 1FXLA 2F40A 1JLBA 1TVRB 1E6YB 3KMSA 4B3SF 2BVZA 4HDGA 4R0EA 4ZP9A 5B08A 3C6UA 2AJQA 7FD1A 3W2WA 3I9V9 2NS1B 5KFTA 4URSA 2IA0A 3RBEA 4F2RA 3BSCA 4IH6A 2FHJD 3GV5B 5KOWA 4DL4A 5I3PA 2L41A 2XC9A 2RDIA 5DGAA 2RS8A 3G8TA 3KLEB 3ZZTA 3OTBA 5GAGI 4IO9Q 3SCIE 1RT3A 1U2RA 3DHXA 3OJUA 4X84A 3AJ2A 4CNZA 2HNYA 3ENQA 3MPVA 3G8SA 4C8OA 1S0NA 1Y5IB 1Q4RA 2KHDA 3G6XA 2FIUA 3O6QA 3RRKA 3KLFA 1SBRA 2GQ2A 2I8EA 2YWHA 4NX9A 3N28A 3TANA 1MMNA 5K8MA 1WWHA 2HLUA 3C6TB 2R2RA 2OP5A 3FNNA 3L3CA 1TL4A 2XNRA 3DOMA 2DR5A 2XY7A 4IR1A 1FE0A 2FLNA 2MZ1A 5J1NA 3DU6A 2BBEA 1PC5A 2RB7A 4K59A 2MY8A 4Q44A 4X4VA 4WKRA 3PHEA 4J5OA 3CJKA 4ZLPA 5AXKA 2CDQA 4YR2A 2W9BB 4NLXA 2PA8D 2IHR1 1X4EA 1YI2S 4IOBA 1TKDA 1YQHA 2XS5A 2ZD1A 4C8YA 1K73T 3CDAA 1Y0HA 3RAMA 1NH8A 3NCPA 2CQ4A 2CQBA 1XR5A 1S9EA 3SCLE 1C0UA 2VD3A 5L1IA 3MMBB 5U47A 1GX6A 2J76E 5KFQA 1S48A 4XPCA 3CCWA 3M6WA 4Q45A 4WTYA 4A8FA 1VGYA 3M32B 4TQRA 2VQEF 4GC6A 2CZ4A 4DN0A 4HL9A 4U7UK 4GKJF 1HNIB 4TU9A 3H2UB 3PKYA 1F60B 2YWFA 4RX6A 2EBEA 3DRRA 1RDRA 4NA3A 1W2BR 1S1TA 1KVIA 1MWZA 1RTJB 2JVOA 2QA4S 4LSNB 2V9WA 5HBMA 4ERDA 5EWGA 5DM7Q 2OPPA 2LXUA 3FEYB 1MNEA 4JI1F 1SV5B 3BO2A 1S1VB 3NGKA 3KG1A 2BRKA 3ITHA 4R8UA 3DHWC 4QIVA 1K8AT 1V3SA 4OHVA 4F4KA 3SYZA 1H7XA 4FYDA 2A2CA 1HWLA 3H20A 5AJ3F 2F8MA 2KDOA 4PPZA 5AE2A 4U7CA 4Y34A 3CCRS 2IVFB 4ETXA 4EWTA 2GCFA 3MEDB 5J2NB 5IT0A 1X9WA 1G1XA 2DNPA 2HS3A 1REVB 1N5YA 5G0RA 2XG8A 3M6VA 5KFAA 3LOUA 4ID5A 1S79A 3H2LA 1UEUA 3I96A 1Y3KA 4F02A 4ED5A 3IG1B 1Y5LB 4KSEB 4G1QA 3U02A 2AJFE 1D9AA 1UETA 5JVHQ 3PW0A 1T03B 1JLGB 1ZM2A 5EWEA 1GXLA 4A8KA 3I87A 4ES2A 4MFBA 1RAJA 3EPGA 1MMLA 2CQPA 3BO4A 4DS5A 3K57A 3HHDA 1YJWS 3QIDA 2R2SA 4IG0B 2AW0A 2QFJA 2KT2A 1VBYA 4W92B 2IM3A 2AJ4A 3OTOF 4GKKF 5E3PA 4PPDA 2XBPA 1QUVA 5DM6Q 1JB0C 3TI0A 2WBMA 1FKAF 3KMQA 4YDDB 4F4YA 2MZQA 4I4BA 1VQOS 1OPIA 1RA6A 2YKOA 1DQ8A 4O3RA 5D4PA 4OFZA 1U09A 3PX0A 2DVIA 4DL5A 2L08A 1XR7A 1Y4ZB 4OZLA 1J5OB 5MAOA 4K4YA 2B5JB 1RT2B 4N8NA 4X4OA 2CPXA 4ED7A 4X65F 3PEJA 1S1VA 3PNIA 3TYTA 1JJ4A 1QSYA 2JEGA 2V8DA 4K5SA 2JZ5A 2OH2A 3B8HA 5HO4A 3HVRA 3W7BA 1GXUA 2KTQA 1UFLA 3LGMA 1U1MA 4CH7A 2MGZA 3PR4A 3LP0A 3PW7A 4NXNF 3BEGB 3MTJA 4WJBA 2Z2MA 4DV0F 3EZUA 1REVA 3AQOA 5KT2A 1N5YB 4O3NA 4ECSA 3VAJA 3A8EA 2VBWA 6FD1A 1R3NA 2NYIA 3IG1A 2NSCA 5CHCB 5GAHI 3NMRA 3MZIA 2GW8A 5L1KA 4PQUA 4DF8A 1X5TA 4JV5F 4LF6F 3F44A 2OPSA 3J7A1 4NZ6A 3TUJC 5I42A 4DQRA 1VJWA 3KYLA 4MAKA 1KHWA 2YWEA 2P9GA 4RNOA 2V9KA 4IG0A 2CQHA 4IDKA 2IRYA 2ZJQQ 5EX0A 2W24A 4WKYA 1R8PA 4Y6IA 1R0AB 3I5BA 3V81B 2B7BB 3PJWA 4OJHA 1EP4B 2D3UA 1U1QA 2B4OA 1ELOA 3M2UA 1RTJA 4LSNA 4R0JA 3QGHA 4RW9A 1XNRF 5EN1A 3MPYA 4H4OB 5B0DA 1RGVA 2BZ2A 2R7OA 2XHWA 1RI7A 3KTQA 3VQSA 1U24A 5M2PA 2M0GB 1LXJA 2BOPA 3K8WA 5IM0B 1SV5A 1U49A 2JJ4D 2DIVA 2YNHB 1S0OA 4TLRA 3CEDA 3TA1A 4KO0A 5IT4A 1ZYQA 4KTQA 2DNZA 3ICLA 5KFGA 3ISZA 2O1PA 2BM1A 4RUCA 3K0JA 3GYXB 3H5YA 4IRCA 3H2VE 5D4NA 4OI6A 5J2NA 1WI6A 4ZVEA 4WXOA 4NLTA 3GWCA 3BJYA 2Z2LA 1RT7B 2YQ3A 3E51A 2CQDA 2RF2A 3JB9k 1OQ6A 3K59A 4ES1A 3M9MB 2FHKA 1G3OA 5D4OA 4AQYF 1C4CA 3DMJB 1Q7YT 3H98A 1JLCA 5KG2A 1VIOA 2BV3A 2V8VA 3C66A 4PG8A 3OV7A 1WHXA 2L9DA 4OZ1A 3CD6S 1YRXA 2DNGA 2RUGA 4NWBA 4YDXA 1DZ5A 2FVPA 2XY6A 4QYRA 2VASA 5KFRA 4DG1B 2KYZA 4JI8F 1FO1A 2O66A 2C22A 2HWIA 1ZH5A 4O3SA 2ZJRQ 2IRUA 4K4WA 3J80Y 1RYRA 1RT5A 2VPYB 2ERRA 1JLQB 1SH0A 3LAKA 4CO0A 1VK8A 2LQ9A 5IQ6A 1SL0A 3UR0A 3K5NA 4LF8F 5KG0A 2ASJA 4KB7A 1R27B 2E5JA 2ZOMA 5JXSA 4J9KA 1XERA 2Y1RI 1C0UB 3QLHB 3IR6B 1U1PA 5J1PA 1JLAB 3RW6A 3MMBA 1QVGR 3BQ0A 1TKTA 4JBCA 1VBXA 1RTDB 2IM1A 2EFNA 3RB0A 1HBOB 3MAQA 2IBOA 4AYBD 5IFMA 4ZVFA 4C8NA 4DOZA 1RT7A 3J81Y 2PMZD 1NK8A 3OSNA 1FJEB 1RT4A 1FJGF 1NNDA 2VV5A 2V4JB 4FF3A 3K2YA 3OHAA 4LF4F 2BYCA 4DV6F 2ZBCA 1NHVA 2WK4A 4LVOP 4NLQA 1ZM4A 2VZ9A 2FGCA 2VUGA 4KV8A 4N76A 2F8HA 3OL6A 2BABA 3NMAA 3BN4A 5C42A 5HBMB 2HNDA 2NPFA 4O3QA 5IZHA 3PDNA 3GFHA 1RKJA 1NJXA 1ZETA 1M5SA 2ROGA 3CCVS 2RQMA 3GFZA 1MSWD 1DAXA 3T5KA 2IFXA 3T3FA 3EXCX 3LP1B 5KFEA 2PO4A 1EP4A 4H4KC 4M1KA 1RT3B 4C7QA 4NLGA 4FXVA 5BYRA 1RP5A 3BGRA 2KXFA 2QA1A 2DNRA 3MDFA 3O44A 2XSFA 3G9CA 3UCZP 2FJEB 3ISND 2VFVA 4ZMMA 4ECVA 1RK8A 1QLNA 1Z1ZA 5F8MA 5J2QB 2XCAA 1FD8A 4X2BA 4FNHA 1N48A 4USHA 4WYWA 1TKTB 4IKAA 2EK1A 1IKWB 4KFBB 3BGLA 1PILA 4NCAA 2R7RA 2P6TA 1KTQA 4JI5F 2ASYA 3JTOA 3T6JA 1S6PB 2HW3A 3BSAA 3BQ1A 1B7FA 1TL1B 1K1QA 1T05B 1IQTA 1HI8A 5E33A 3PW4A 1RT4B 3HMJG 4KE5A 4ED1A 1VQ8S 4PRFA 1NAQA 2P9CA 4QQBA 2HHHF 3QZ8A 2NREA 3E8OA 1KONA 2I2YA 4RW4B 4BWMA 2M4MA 3DDNA 4HHJA 2BANA 4YB7A 2Q66A 2RRAA 2HS0A 4DFMA 1N56A 1HBNA 3R5BA 1M90T 1Q53A 1OIAA 2R2TA 4MIBA 2PMHA 3HP6A 3UWTA 4LSLA 4EBDA 5AE3A 2ZKUA 3OFGA 3KLHA 1FRHA 1FXDA 1TV6B 3MEKA 4FF1A 4DDFA 1VQ6S 1FRKA 4B02A 2UVWA 1DHMA 2RU9A 3MUMP 1S0VA 3DRRB 1RT5B 1N33F 5D77A 1LKZA 4K4ZA 1JLQA 2RD5C 5CYMA 3DRXA 1U47A 2AYBA 1UAWA 3VTIA 1VOMA 4L6V3 2R8KA 1CVJA 3UR3C 2HVHA 5A8RB 2MKIA 4RW8A 4EGLA 2CVEA 3DM2A 3BM7A 4ZPWR 2L9WA 5CYQB 5CYJA 2H9ZA 4MYUA 1L5UA 1VBZA 2AX1A 3MFIA 2XWYA