4AXJA

Structure of the clostridium difficile eutm protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
ANALGMIETKGLVGAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELISVHVIPRPHFEVDAILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ETHANOLAMINE CARBOXYSOME STRUCTURAL PROTEIN
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
source organism Clostridium difficile
total genus 21
structure length 87
sequence length 87
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4axjA00
3DNCA 3SSSA 4RBUA 3N79A 3MPWA 3MPYA 3PACA 2EWHA 4OX8A 3NWGA 4P7TA 4QIFA 2A1BA 4LIWA 4QIVA 4PPDA 3IA0A 4OLPA 3DN9A 3SSRA 2A10A 2A18A 4QIEA 5DJBA 4DDFA 4OX6A 2G13A 3VCDA 4RBVA 3I6PA 4P2SA 3H8YA 3I96A 4OX7A 5L38A 4AXJA 3NGKA 4OLOA 3SSQA 4QIGA 4AXIA 3CIMA 4P7VA 3CGIA 4RBTA 3BN4A
chains in the Genus database with same CATH superfamily
2DXFA 1G6BA 1NRKA 4KGZB 3GG0A 3M6WA 3OVAA 3QFHA 2OO4A 1NHKL 4KKOB 4OZ2A 2A10A 1OMSA 1TL7A 1S1UA 1YRXA 3CCMS 2HRUA 4QPTA 5GAHU 1N8RT 3N5BA 3R5JB 3HHLC 3AB4B 4IH6A 5IT9U 3G86A 3POTA 5THWA 1VQOS 3KUHA 1M5SA 3RJMB 4ENOA 3U7JA 4ECZA 2HVIA 3W9HA 4ECQA 2C3YA 1GMWD 1IBLF 2IM3A 1T9WA 3V6HA 5E41A 4OZ1A 2XS2A 1JKHA 1GH8A 2UXCF 1CS4B 2IDEA 3WDOA 4B3TF 1XMQF 2KRBA 4C2MA 1EKRA 1UFLA 4Q0BA 2BQUA 4L6V3 4YB7A 3CJ2A 2DIUA 3AB2B 5KTQA 2HNDB 2N7YA 1HWLA 1R8HA 1Q95G 2DXDA 3CIMA 2XZTB 5IV4A 2A6OA 3LALA 2N3LA 1WACA 4I56A 4C6AA 2QLWA 4ZP9A 3H5XA 3MHYA 4WK1A 1KVKA 1VQNS 1FTRA 4JV0A 1L3SA 1B3TA 4P9SA 1UZHA 4OLPA 4J9VA 2D1CA 2V4JA 3HMJG 4UTGA 2DEJA 1WC5A 4DV4J 2RUGA 3NGSA 5AT1B 4CH1A 1Q8IA 1TKXB 3LP1B 4UUXA 4E8UA 1GMVA 1QD1A 1VDHA 1N56A 5K8OA 3GIIA 4LMZA 3HVRA 4ANEA 2RF2B 2C3OA 3CO0P 2JLEA 1BC6A 3DLHA 5ADZA 3OL8A 3PEJA 2ASLA 4K2XA 5T41A 2UUCJ 2K06A 4HL9A 4H4KA 1DTQB 3UNYA 3GZ7A 3MM8A 5BR8F 4WIIA 4ED2A 4QOTA 4WTYA 3BDEA 1NK5A 1EP4A 7AT1B 2QV6A 3I31A 1PSDA 3PRBA 4O3NA 4LBPA 2OTJS 4MFBA 4K4SA 5KFMA 1C0TB 1U09A 1R31A 1Y3JA 3R2DJ 4RW4A 2DNNA 2JHEA 4P2FA 3TAQA 2OFGX 2MSSA 1KHVA 4U7CA 4DPOA 2W01A 3TUPA 1P1TA 4NEYA 2QG9B 3I0SB 4J9OA 4IR1A 2YKMA 4DSFA 4A8FA 4HACB 2B9XA 1TAUA 1L3TA 2V2KA 2CPHA 1NKBA 5SZTA 4TNOA 4F4XA 4ZVUB 3OHAA 3U1LA 4UUWA 3Q8PB 3D6TB 4FYXB 3QMQA 2M8DB 2FHOB 5F0UA 3M1VB 2G13A 3GONA 2AZ3A 3VV2B 1EARA 1Y5IB 4QZVB 4DU7A 2Z8QA 2R7UA 2DO4A 2ADCA 2B0GA 1D0EA 2QEXS 4CLSA 4DR7J 3PZPA 4JYAF 3G6VA 3GTYX 4O3OA 4KQZA 4X4PA 4UOGA 4G6VB 3MR5A 3A8IA 1JJHA 3TZYA 4ALZA 1FD2A 3H4DA 4IKAA 4TXSA 4JV5J 1GNKA 2PD1A 3EUNA 1X4FA 2KZMA 2KDOA 4TY8B 3GJRB 4CLWA 2MMYA 1U2RA 2VICA 4DQQA 2HNZB 3AOBA 3BO3A 1HQ2A 1D3WA 4CIOA 4KHMA 1MMNA 3NLCA 3LOUA 2IC3A 4CLTA 1UVMA 2AJQA 2O1PA 1FESA 1G7CB 1P9QC 1IBMJ 3POTB 2RKIB 3P5TL 4ECWA 2AHOB 4ZDNA 2ZC3A 2VQFF 2VF3A 3AOCA 3ETOA 2N4DA 2R2UA 3M8PB 3UD4P 2DRDA 4M63A 3HP6A 4TU7A 2V68A 3KNGA 4DV3F 2YPYA 2AIRB 4NZ6A 3M8ZA 3PW2A 1S1XA 1HD0A 3A12A 1J2VA 3BPDA 1N54B 4MIAA 1W25A 3BGOP 5K14A 1PBAA 1YJ9S 4EZ9A 3O6QA 1TV6A 1VHIA 1YJRA 1U26A 3ICLA 3KNAA 4X4UA 3ADAC 3UDEA 3NS6A 2IBKA 3MECA 3H4BA 3ZFVA 4Q2LA 3OXLA 3P3DA 2CIMA 2ROEA 3CDUA 2QA4S 2VKRA 2E29A 4LR7A 3OL7A 4DL4A 2DPIA 1FXDA 2ZM6F 3K89A 3ZTSA 2L9WA 2FYXA 2AKWB 1WOSA 2PE8A 2IAJB 3GV5B 4G1QA 2KG0A 1F5AA 2HFVA 2XS7A 2WAQD 3P5BP 4BHQA 4M94A 2HQFA 2EXUA 4Q44A 3HHLB 1JLBA 1P27B 1B7FA 1YZ6A 2E5HA 3OVSA 3OR1A 1FD8A 3CE8A 2EVZA 3AFGA 3AT1B 2LDYA 5J1EA 1N5TA 3FBFA 1AFJA 2L9DA 3PKMA 1AW0A 3AA9A 2V69A 2C3MA 2WOMA 1ZM2A 3NGDA 2EG1A 4N5SA 2ZH7A 2ATLA 2YKAA 3MR3A 1TMJA 5KT7A 3RU0A 4O0NA 4ECUA 3CC7S 1VS3A 4P75A 3MM8B 4TN2A 2DR7A 1YQHA 2F4FA 3TZZA 1H38A 2R4FA 4GKKJ 1B64A 2Z4PA 1D9AA 4DQPA 1RCXB 2DEIA 2NLWA 2FB0A 3G87A 1C4AA 2R9LA 4F4YA 1T9VA 3R1HA 4TYAA 4NRTA 1RKIA 2KYZA 4NYPA 3CCUS 2YKMB 4MT1A 1PGZA 4JP8A 2HURA 4MKYA 5IWAJ 3MEEB 5BYSA 3Q83A 5AE3A 1X0PA 3QIPB 2W4DA 3OUYB 2OKQA 4YB5A 3MAAB 1IKYA 1U0HA 2F4VF 4Q8FA 1X4DA 5KFPA 5FDLB 2G1DA 4OJHA 4ED0A 4IFYB 3KK2A 1T11A 3U1MA 1QAJA 4CI0B 1SJ4P 5KFVA 1BE4A 3O2IA 1NDCA 3GIMA 4HDHA 4QWEA 5HO4A 2HGMA 3CWJA 2A1BA 3RBXA 3Q8QB 1U8WA 4RW9B 2QLBB 1DQ8A 3FSIA 2FUG9 4FBUA 3BZQA 4YN3B 3V4MA 3DYAA 2FJAB 1IR0A 3CMAS 3KHGA 3EDRB 1HQEA 1AT1B 3ZZRA 2ZZNA 1HW9A 4KAIA 5B0DA 2LEBA 5HN0A 3OJSA 5HMXA 4DR4F 3R5BA 4DL0C 3T1YJ 3PJWA 4CO5A 3V6KA 2GO8A 4MK8A 4LFCF 3TWZA 1VQ4S 1ACMB 4P6QA 3GIRA 3A4TA 4TQRA 2WONA 2DHHA 3ISZA 4FVCA 4DR5J 2VPYB 1TU0B 3VQSA 3M32B 2CJYB 4ZPBA 4N7TA 4IQXA 4KSEB 1F9FA 3GU0A 3PJ9A 5ETSA 4ZIVA 1NZ8A 1K9MT 1BGXT 3P45B 4B08A 3UN3A 1VK8A 5F9LA 4WFXA 4I2QA 2AF6A 4P74A 1VC5A 3Q22A 3NOGA 2HBQB 1DBDA 2ZJQQ 2R42A 4RO0A 1RWWB 3MUMP 1G3OA 5GAEU 4ZPTR 2RB7A 2ZBCA 5KG1A 3EX7B 2NSBA 4LF5F 1HBMA 1NSAA 4KYZA 2P9EA 4ID8A 3QZ7A 2CPJA 3HO1A 1RHQB 3KJQB 2OFHX 3SFGA 1DARA 2XYHB 3DOKA 2VB6A 3I32A 2LQ9A 5M2PA 2LEPA 2G9OA 1MLAA 2VHGA 2R3VA 4DSIA 3BSOA 4OZJA 2BM1A 1RADB 4DUTA 3P8BB 4EBCA 2I8EA 1U1PA 3IP0A 4XAKA 1AZSA 8RUCA 2BX6A 2W24A 4TQSA 4RBVA 5E3RA 1DRZA 1Q8LA 3LGMA 4IDKA 1Y00A 1EB0A 2X51A 4WXWA 2XM3A 2HVDA 1IBCB 2R7TA 3OR1B 1FFSB 3GSIA 3CJKB 4U8YA 3NRBA 3LANA 2AGPA 1DFDA 3DXSX 1RAOA 1FDAA 2JEGA 3A3PB 2KL8A 4B9SA 2GIQA 2WOMB 4K0KF 4PWDA 2XBPA 2E9RX 3FZ2A 3WC2A 3LPEA 5IQQA 3CULA 3MAHA 4I64A 3BJYA 3V81A 3HT0A 3JTPA 2CA9A 3MGJA 4UOHA 2HHTA 4LUBA 3PIOQ 3D0HE 2IVYA 4PWWA 5KFRA 3IMQJ 4OJ1A 3R6GB 2DRAA 1R43A 3PYGA 1Q81T 1BQMB 4ED6A 3DRRB 3GMGA 3S8SA 4GVLA 2HHQA 2GGPA 2KZZA 2HKEA 5CCMA 4Y2MA 2QIFA 2WSCC 3R6LB 3DHXA 2HVEA 4I6WA 1V5IB 3QWUA 3W9IA 2ZZTA 1SCJB 2O3DA 1FKPA 4RLEA 4KHPJ 1GK8A 5B0GA 1V3ZA 1KN6A 1SXLA 2V0NA 3D66A 5D78A 2AYGA 5F8NA 2H54B 2I1RA 3L09A 4ZP7A 2AJ2A 2ADBA 4LSNB 5KOXA 1MROB 1QUVA 4K4WA 1HWUA 2CJQA 1BMQB 4ED4A 2Z58B 2RSQA 2SXLA 4CDIA 1IKYB 1OYDA 3CCQS 4KHRA 2CXEA 4LJMA 5KFOA 2M4MA 1HI0P 3I4PA 2ASDA 1JNZB 2YNGB 4QIVA 2ALYB 4JI6F 2RRNA 2VIHA 2AP6A 3W9JA 1SC1B 2FVPA 3QT5A 3GJSB 3I5AA 1S4EA 3V4IB 1VQYA 1RU2A 2DY1A 3BBBA 3DYAB 2MPUA 1UEKA 3ULHA 4OZ5A 3G71S 1HQEB 2Y1JA 3T9NA 3FCHA 3OTEA 4H4OA 1TZ0A 4LRFA 4WKYA 3MEDB 2YWHA 3DRSA 3BYRA 3NCPA 2VOOA 3K2YA 4DZDA 3CDWA 1RDRA 1JK9B 1J5EJ 2YWGA 4NXNJ 4NLOA 3FCWA 1ZH5A 2E5IA 1Q86T 1MMLA 2WONB 3CMES 3KHLA 2C2NA 5AXNA 2R8IA 2CUYA 3MR6A 4P73A 2NQPA 2ERRA 4H4MA 2B43A 1HHTP 3OR2A 3CJ4A 2HZCA 2MDAA 2IMOA 3D3CJ 3Q2TC 2VFVA 4ZHRA 3CTRA 3PX4A 1HNXF 4DS4A 3UDLA 4LF8F 4LFBF 5I42B 1KONA 1R0CB 3K5LA 3TUJC 1QSYA 4LF7J 3UDVA 2ZC4A 2QFJA 1IR1A 3PR5B 5ETTA 4ED5A 3L4BC 5KFEA 1HBMB 1OPIA 3MDFA 1GFWB 4NYOA 2ZD1A 3DOLB 4X4VA 3OFEA 4HTJA 3LW5C 3BN4A 2J76E 1UA1A 1MWYA 1GMWA 2LDIA 4KO0A 3QPIA 2HWIA 1SJQA 1JB0C 2BKOA 3KK3B 3M9NB 4YP3A 3MFHA 3EXYA 1MU2A 2GW8A 2OIHA 4M5DA 3GFYA 1CEZA 3G82B 2B56A 5BJRA 2FVRA 4DS5A 4KBIA 2FJXA 4AL6A 1ZM3A 1UJ6A 1WC6A 1Q7YT 1WSRA 2FHKA 4OZNA 4DV2F 2NXJA 2GAHC 2XMUA 4CO3A 2UXBF 4DUYF 1N32J 2KG1A 4JI2J 2Z30B 4ETZA 3N0VA 4DLGA 1M5PC 4NA3A 4ZLPA 3R2CJ 4LFAJ 1MWQA 2B7CB 2XSJA 1T9TA 2JLFA 1SJFA 4G65A 3KLGA 2ZZMA 1FO1A 1Y11A 5IT0A 4IR9A 2WB4A 3V81B 4WWSA 3K5OA 4PYDA 5F9NA 2XHCA 3JQKA 1IKWA 1PC5A 4OHZA 2VG6A 1RT7A 1BLUA 3HK2A 3FQKA 2YKPA 4KRWA 3EGVA 1R89A 3TA2A 3AD8C 4ZVQB 5F8LA 2W8KA 2VQEJ 4DV1J 3D2WA 5CCLA 2EBEA 3T1HF 2UU9J 4FBTA 5ETLA 2RVJA 3UI3A 2HHSA 4DN9A 4EI2A 5IT9Y 2E9TA 4N77A 1PYOB 1Y7PA 2GQ2A 1QE1B 4HI1A 5D3GA 2MTLA 5AJ3F 4YR2A 4DSEA 1RLDA 1P9YA 2HRYA 3DMJA 3JB9k 1UJ4A 2OPPB 2IIHA 4P7VA 1WOPA 4HT7A 4MIWA 3D6HB 4FPRA 3EICA 4GC7A 4LBIA 4W90B 1UZDA 4LIRA 1XR5A 4RUCA 2JL9A 3B4DA 3BGFA 3TYTA 1Q7LB 4URQU 4Y2KA 5CHCB 5K9FA 4QWBA 1R3NA 1UWBA 3HKZD 3WZ0A 4LSLA 3JSBA 4J9MA 1X8DA 1XBWA 2Y0SD 1CBKA 3HVWA 1Q53A 1SI9A 4RUBA 1NCLA 3H42A 4FNIA 4Y0FA 2G0JA 3MR2A 1JLGA 2WVEA 5HMYA 1AUSL 2XG8A 1UEVA 2YXLA 3PFEA 3DRSB 2RS8A 1TTHB 4EYIB 2HFOA 3M2UA 5LMUJ 2FVSA 1LK5A 4N56A 3KUEA 3HHNB 2KHDA 3D9BA 5KT4A 2OH2A 2XMAA 1VRTA 4X65F 1N36F 3J80U 3QGPA 4LRCA 5C24A 2BYCA 4O4RA 1Y5LB 3OR2B 4ZVOB 1WEXA 2WBRA 4USVA 1R6YA 5B0CA 4KT0C 5J2MA 3PV8A 1RT6B 1UP1A 3HSJA 2VH7A 2I6WA 2Z2ZA 2J7UA 1TR0A 1XK8A 3CJSA 4YQWA 1RHJB 2WSEC 5L46A 3OT9A 3MUTP 4I67A 4QWAA 5DG9A 2BZ2A 2H1YA 3HDSA 4WJBA 2HG4A 4DV4F 4LR9A 4F4ZA 5E3AA 5JMNA 2CPXA 2R8GA 1MW7A 2CPEA 4JI5F 1K47A 2AJ4A 4A8XA 3HSDA 2IA0A 4K4UA 1JLEA 1GT8A 2GFFA 1WD6A 1XR6A 1EETA 3OLBA 2PGCA 4A8YA 4NYZA 4N8NA 2UUCF 1MU2B 2QA1A 4M5DB 4OYAA 2VBWA 1HBNB 2AEJA 4CP5A 5ETKA 4N47A 2UXDF 4WFBQ 4L72B 3IS9B 1S7HA 3Q8UA 2HFNA 1RAJA 5AE1A 5DGBA 2GCFA 5HLFB 3DM2A 4C97A 1RB0A 4I6YA 1N52B 2CQ3A 2FZGB 1XMOJ 1TKTA 2M7SA 3M6XA 5HSPA 4PUOA 1RTHB 4QPXA 2ZJPQ 5KFWA 1SKRA 4PWUA 1N6QA 1XNRJ 2R2RA 2YNIA 5LM7E 2GX8A 1J5OA 5HP1A 1HL6A 2QLFB 3OV7A 2CQ0A 2LEAA 5KG5A 2J7KA 2QL5B 3HCXA 2YH0A 3Q23A 1LK7A 1M1HA 3GB0A 1O0PA 1KDNA 2O67A 4K5SA 2XCPA 2V8DA 4BS2A 2J0SD 1IJFB 4JOUA 4BCAA 5F8MA 2ILZA 1WKLA 2WZ1A 1RE1B 3BGLA 4FYVB 5KFTA 4DFKA 2H5JB 3CSKA 1CJVB 1IWGA 4QIGA 1RCOB 2V6AA 2ZOGA 1ELOA 4DR2J 2WW8A 3PFOA 4WYLA 3MM7B 4O44B 4X66J 2ZE2B 3M6VA 4DR6J 4DR7F 4B3MJ 4EO8A 3NGTA 2XI2A 1RYSA 2IPOB 1DHMA 2EBGA 1YRTA 2N7CA 3JSMB 1Q5YA 3D1QA 5FD1A 2YH1A 2OAUA 3BBFA 5L39A 2BKNA 2FY8A 1U45A 1CLFA 1FNOA 1FK9A 5EHHA 2ASYA 4DX5A 2ZJRQ 1L3VA 4B9VA 2CWKA 4JV5F 5K8PA 1KQKA 1NDPA 4OI2A 1FKAF 4QIWD 3JTNA 4LSZB 3H25A 3I6PA 3HX9A 1QTMA 5EWFA 1WNEA 2VG5A 3OLAA 4LF9J 5C25A 2APOA 4D3HA 1REVA 3T41A 2CG4A 4LVOP 2NUUG 2XYPB 2BBEA 1Y0HA 1UWBB 4OHYA 4HEA9 1RWMB 2LKZA 1JLCA 3GYGA 4I2PB 2OLWA 3QO9B 2HW3A 1IBMF 3GFZA 4DR1J 3OD2A 3HHLD 3TEGA 4GC6A 5T7LA 5CYQB 3W5YA 3UQSA 3GR0A 1TKDA 1LXNA 2E1RA 3GCXP 3KMQA 3LO3A 4J91A 2D9PA 5B0AA 3MM6A 4CM2A 2MZSA 4KGXB 2EFQA 2FJWA 5CZXA 2VL1A 1EZZB 4FF3A 4ZCKA 1N5SA 1VRTB 3JYTB 1NBEB 2J8AA 4NLQA 1JX4A 3WX8A 2CYYA 4L3KA 1PG5B 1B99A 1X5TA 1GEHA 3IRWP 1KSPA 3CJTA 1C0UB 4KC5A 4J9LA 2BQ3A 2N82B 4Y00A 5DGAA 2E1MC 1M5OC 1VK3A 4X62J 5L1IA 1XJWB 2VA2A 3W5ZA 3HHKA 2KRRA 2CDRB 2MLYA 1RXOB 4ED1A 1QY7A 3CD6S 1NB2A 2CPZA 5C7PA 1NSPA 3CD7A 1KQSR 3J7A1 2CFXA 4ID5B 4MK9A 4ZVEA 1LWEB 1SUQB 2N4CA 3GIJA 5KT5A 4KPYA 2R7QA 3N6LA 4Y2CA 1H7WA 4OI6A 5J2QA 1JLEB 2HGNA 2Y1RI 4A8SA 1S6UA 2DH9A 1EETB 1WHVA 2BEFA 1B0VA 1JNRB 5J1PA 2DGUA 1C1BA 1CJUA 2DNGA 2GA7A 5L8RC 2CPFA 2P8IA 3IR7B 5HVFA 3CUNA 1Q4RA 1WC4A 4YDXA 4GKJJ 5LMNF 1U4BA 4QCLA 2L48A 3HPOA 4BDPA 2W7AA 1VIOA 4EMDA 4K4TA 1S9EA 5ETPA 1N5VA 4LRDA 2LYVA 4WE1A 2GMHA 2CJKA 4RNNA 1TUVA 4B3SF 2YNIB 3O3LA 4WFYA 3ZC4A 1WELA 1MSWD 3DU6A 2Y0BB 3EGZA 3HZGA 3R7SB 3P4UB 4A8WA 3S01A 4F50A 1TL3A 3HZEA 5H1SV 3IWLA 1JWWA 1C1CA 4ELUA 3R5GA 4DG1B 1NPRA 2C1EB 2WVCA 4WPAA 3NL0A 1LW0A 3GJTB 2XZDB 4Z7CA 2FY1A 1BQNA 1FKOA 3NCQA 2KU7A 4TLRA 2BE2B 3C6TB 4ZVTB 1HR0J 3MD3A 3QATA 2WCXA 1GX5A 4C11A 5CYMA 1FFGB 2W8LA 1BWEA 3DRXA 3NOCA 1GTEA 3WIVA 1KQGB 3B8HA 2NXNA 3H2LA 2KT5A 3H7HB 3P49B 1FRIA 2GVZA 4FS1A 2DTJA 1RISA 2ZH5A 3KG4A 4C3LA 4KJIA 1JLFA 5L9XA 1R8AA 3EDQB 3M2RA 3QAUA 5D4NA 2RQMA 2E5LJ 3OTOJ 4Q43A 3C14B 2K2PA 3ENQA 1NM2A 3SQGA 4ELVA 3E8OA 3TAPA 2KKHA 1FK9B 1KTVA 1HHQA 3CJQA 3C3LA 3T1YF 3JXOA 4IH7A 3AD7C 3VGTA 2I0XA 2PI4A 2DR9A 3MUVP 2G2YA 3TAMB 3TANA 2DNKA 1UA0A 1IJEB 3NG8A 1IKVA 2QA2A 3D7SB 3LP2A 2VUGA 4J9SA 1RA7A 3D0IE 4DR5F 3E2EA 5K8NA 2Q6CA 2VFSA 4NWBA 1AYEA 4RW6B 3DDIA 3SSRA 4IFVA 4N76A 5HQ8A 1SPBP 5LT5A 1JLCB 2OI2A 4RU2A 5JVHQ 1ZM9A 3M9MB 2YNHA 2XLKA 2AYBA 4MK7A 2CVEA 3RBZA 4DQRA 4J90A 3GV7B 2CAJA 1WWHA 2Y3YA 1ZYQA 3AOAA 4DSJA 1VFJA 1MN9A 4YR3A 3QJPA 4YY3F 3DRYA 4C8KA 4F7VA 2DCLA 3OQ2A 4ZCMA 2W9AA 4PKDB 4K4XA 1KLMA 3R8YA 3W3SA 3UD3P 2JRSA 2C2EA 2KJVA 2COLA 1HBOA 4USWA 3B6BA 3CNQP 4DQSA 2H3EB 3RBDA 2KYXA 2ZNYA 2XWYA 3VCDA 3RTVA 5F8JA 3DLLQ 1WUUA 1QJHA 2B6AB 3EWGA 4ZVSB 2OMOA 2BACA 2CWXA 2DNLA 5LOQA 2VKZG 1OS5A 4O4GB 2XQCA 3M8YA 2ZWOA 3X3UA 3A8KA 3N6NA 1LWCA 2CZ4A 1G4CA 5H9EJ 1PO6A 3DDKA 3B54A 5KFLA 3R5CA 4F0KA 3GG1A 3KLVA 1X31C 1S76D 2L41A 3I87A 2DR6A 1RWOB 4FKXA 5HROA 2XMMA 5J2QB 2FVCA 3C66A 1FWKA 2OJ3A 5A8RB 2CNOB 1ZETA 2RQCA 2Y1IA 3MM9B 4CNZA 3IBCB 1T8EA 1S1WB 3SDEB 3HVTB 3BGRB 1HD1A 4IRDA 4FS2A 3OBIA 5C42A 2BANB 1KKHA 2FJEB 1T05B 4DV7J 3FEXB 2W25A 2OTLS 4MYUA 5E33A 3VAGA 3EVOA 4KB7A 4M5LA 4WE1B 4KHPF 3IC1A 3PW7A 2CQCA 1KVIA 4P10A 2EW9A 4DR3J 4KGKA 7FDRA 1U0SA 3ITHA 2XGPA 2WW4A 1NKEA 1WDTA 2RU3A 2PFDA 4KR0B 2MKIA 2CPYA 5KG7A 1LW0B 2MQQA 2CVIA 2C2DA 3KHHA 3RB0A 4EGLA 4CH0S 2HHVA 1S1VA 2B8PA 3PYFA 1NNDA 5GMDA 2BJ3A 2V2ZA 3J81U 2OSQA 2M3DA 4AE5A 3D68A 3BKFA 2FD2A 1B0TA 1FRJA 1L3UA 1T03B 3UPFA 4J9NA 4ZMMA 4X64F 3EPIA 1HYSB 2IRYA 1S5ZA 4C0HA 4P2MA 5KFIA 1F9EB 2F7VA 2F3JA 4OYBA 1U47A 2B4PA 2MQOA 2A2DA 1RU1A 3T1AA 2EFNA 1VQ8S 4DF8A 5KG0A 2FGCA 3NS5A 2OPQB 3QBCA 1FEEA 1RACB 2NSCA 1K0TA 2KI2A 1X5OA 5G0RB 2YVSA 2RDDA 1I1GA 2F1FA 3WQPA 5FIIA 4NXNF 3RYLA 1DAXA 2CQPA 4YEAA 1YJ7A 2Z0GA 2BM0A 1CS4A 3DLEA 1KC8T 1ZPWX 1QVFR 3BBCA 1EAYC 4LQ9A 4IFVB 1ROFA 4MKBA 4ECXA 1FT8A 1OQ3A 4GO7X 5KFUA 3DGPB 2VPWB 1RTJB 2NCKL 4IG3B 3MCMA 4ZA1A 1RBOB 2KXHA 3M8SA 3KFWX 1K73T 3LGHA 2L3MA 1ZA2B 1RWVB 4C3MA 2J0XA 2GZOA 1S12A 3W2VA 2Z57B 5KFFA 3R5DA 2DYAA 2QTWA 1FDBA 2ACYA 3PW0A 1S6QB 2F40A 1VJQA 3OXFA 2C3PA 4P52A 4UOFA 1IBLJ 2DISA 1Q79A 3RB3A 4FPIA 3IAM9 3IRXB 2HQDA 2MKYA 4Q7AA 1ZA1B 3VVTA 2F65A 2UXCJ 3MEGB 3KJVB 4N8OA 4TYBA 2QL7B 4B3TJ 1NEEA 1X4CA 3Q86A 2B7BB 2NXUA 3SMZA 2YX1A 4PG6A 4PG4A 5HK4A 1HWJA 3D6MB 2QYCA 3DLJA 3Q8RB 2J9DA 3GLJA 2F9JA 3QRPA 3KOAA 1VC0A 1HI1A 1VQ7S 3ZZYA 2XGQA 1SKUB 4OZ3A 1DTQA 1AA1B 2R8KA 1LWCB 1U7LA 3EZOA 3E01B 1N32F 1FJ7A 4PYAA 4JI2F 2HIQA 1NB7A 2BJDA 2MZQA 2V8HA 4ED8A 3Q2SC 1T94A 1YGYA 1YITS 5KFKA 3K8VA 2XWXA 4ES3A 2YKOA 5RUBA 2BE7D 3H2VE 2JJ4D 3FKBA 5HROB 2HQGA 3OXGA 5D6GA 4LFAF 2JVRA 2EK6A 2HLTA 3CVKA 4ZS6A 4J9UE 2F5GA 4HI2A 4FYYB 2UVWA 2DGQA 1F0XA 3U27A 3I0SA 2HWHA 4ZPDA 1M1GA 4OJGA 2OHDA 4HACA 5D4OA 4CCHA 5K8MA 2O66A 4IRKA 2G0IA 4A8KA 2MGZB 5CYJA 4L75A 4Y2IA 4F04B 1Z4UA 4OHVA 4NXMJ 4J9RA 2QN6B 2EG2A 1MG7A 3CCVS 2NZ4A 2VQEF 3VGUA 4DV1F 2MZ1A 1LOUA 3M1VA 4NPOA 3QQCD 1B7YB 2DK2A 1H74A 4OYOA 3US5A 3ITHB 5KFYA 3G96A 4QU7A 5HBMB 4DU8A 4OX9J 3FSYA 5G4DA 2KHCA 2VU5A 3S7RA 5HANA 4YMEA 1RI7A 3R7BB 4AQYF 1FRHA 1VYAA 3EPGA 3KLHB 4Y65A 4DSLA 2DHAA 4F3QA 1EKSA 1RTIB 3VGSA 1O6XA 2BJEA 3QGIA 2BRLA 1RHRB 3J80Y 3VAHA 5F8IA 3QYYA 2JC1A 1FDNA 1S6OA 3IM9A 2WRMA 3HI9A 4X4TA 4RNFA 1VHFA 1UAWA 3HSGA 5DDRC 2W7OA 3ELHA 1FI4A 3H59A 3M2VB 4TY8A 5KT6A 3H5UA 3BV8A 4L74A 3BSAA 1SH2A 2HNZA 1VJWA 3IO1A 3ZNUA 2H4WB 4F26A 1NPKA 2ZOFA 4NLVA 1Z1ZA 2MSTA 2EFOA 1DY3A 4HT5A 4F0MA 3GILA 4K4VA 2KB2A 2HAIA 4PR6A 2RKIA 3HVAA 5CZVA 1HNZF 3C16B 4G1IA 2GMLA 3DOMB 4MYTA 2HIYA 4ECSA 3M8PA 4UZCA 4MTPA 4CYUA 3KLIA 2RQ4A 4EFAC 2MLZA 1R0AB 1NDLA 4LF2A 2DGSA 3DLEB 1I94J 4IOCQ 2MKHA 1I51B 1IQTA 2GJIA 2DNMA 2DITA 1S1TB 1T0TV 5F41A 2KTQA 2DY9A 3EGNA 1S72S 2Q1LA 1XEZA 1LKZA 1KOHA 3W2VB 2H51B 2IAJA 2YKNB 2GVDB 5D0EA 1X60A 1OY9A 1F3FA 1M5HA 1DZ5A 1OSDA 4WXOA 4JV2A 2J5AA 4UY85 2ZBIA 5SUHA 1T9UA 3MMAB 3HHLA 2F8MA 3SCKE 3MM5B 2RILA 1KR4A 4PZVA 4JI3J 3G6YA 2V2QA 1AUDA 3V6JA 1CQNA 4E98A 2POKA 4X84A 4DL2A 3UO0A 4A8MP 3EXCX 3FZBA 3AHPA 4WBFA 4DX7A 3A3NB 3PRVA 2LQ8A 2RAQA 4JV1A 5L1JA 1XMOF 5A76A 2ZM6J 3BREA 5DM6Q 5B0FA 1XN9A 1U2CA 4I6AA 3ISND 3WX4A 3U02A 1V3SA 1NAQA 4ER8A 4C8LA 3SV4A 1UEUA 2YWWA 3L3CA 1WHYA 2RE1A 2N3OA 2PA3A 4X4SA 4Y34A 3OL6A 4QW8A 4OFZA 4I7FA 3T5JA 2L08A 2HS4A 2JX2A 2FIUA 4IRCA 2RQKA 2VPZB 2XY7A 4QR2A 3HF5A 4NLUA 1GXUA 3EVWA 3LWMA 3I5BA 3K0JA 3MEEA 1NK7A 3W5XA 3M8QB 2RU9A 2BVZA 3RR8A 3QIPA 4CLZA 3OUYA 3KLFB 4FDFA 2FLPA 3RRHA 3MAAA 1SH3A 4DR2F 3T5KA 2I9SA 5FDLA 3C46A 3G8TA 4X66F 4IFYA 4EBEA 3BQ2A 2E1CA 2DBBA 2VBZA 4B3MF 2WB1D 2DB1A 3AJ2A 2EWHA 1VLOA 3R5AA 2CQDA 2VOPA 4RW9A 5L9NA 3K5PA 2AZ1A 1TK8A 4Q8EA 3THPA 3TJ8A 2IMWP 1CSJA 3W66A 4Q5VA 2IYIA 1ZAWA 3ZZTA 1NK6A 3DNCA 1NH8A 4DL5A 1AB8A 3NBPB 2EFPA 4F2SA 3UN2A 2XC9A 1LQ9A 3G4SS 4URSA 2KVIA 4YS2A 1T3OA 4PAAA 4LF9F 2HHWA 1FX2A 4NA1A 1RSCA 2P2CB 4ZLJA 2IYGA 5U47A 1K0VA 4WZMA 4RUHA 2NREA 5ETRA 4JI1J 2MY7A 1IM4A 4DV0F 5A2QU 3OL9A 2K7JA 1JJCB 1FJEB 3AODA 4DR1F 4V19J 3ZXWA 3RUBL 3M32A 4GMKA 2HFZA 1F2GA 1RA6A 2MQ8A 3EM1A 3PTWA 4NI2B 2W2PP 2X1GA 5L1KA 5DRKA 1VBKA 1A6LA 4R25A 3NNAA 3F44A 1GX6A 5IZHA 1HQUB 5D4LA 1Y4ZB 3AH6A 5D15A 2RNEA 4R0JA 3F0NA 4M8LA 4RW8A 2XCAA 3UWTA 4CYUB 4G3IA 3KLIB 2FVQA 4R5PB 2HMIA 2YWKA 1YKWA 5DETA 1U6FA 2XSFA 2KXFA 4OI1A 4PABA 1GXTA 2MHEA 2XMJA 4C48A 1S0MA 2A6MA 3BPSP 4USHA 3R7NB 5KFNA 1IM6A 4OX6A 3UW1A 4LFCJ 2ZH6A 5IV3A 4B9UA 2DPJA 5GADU 2C28A 1VBXA 4X62F 2DXEA 2CQBA 3JQJA 4QWDA 3RGIA 4U9RA 3W64A 1Y9OA 3MMBB 1HWKA 5B7WA 4DV5J 2PEBA 1AROP 4LF1A 1U8SA 1P1LA 3PW4A 3TX0A 5A8WB 1APSA 3LTOA 5MAOA 2X1AA 2RUSA 3HKWA 1TL1B 3H5YA 2D3OR 1TFYA 4F4AA 2HHHJ 5F8GA 4EZ6A 5A0YB 3CJKA 1PC4A 1G1XA 1SC4B 4FXDA 2WHOA 4NLPA 4YHHF 4RPFA 4QU6A 4ZPCA 1OQ6A 4PQUA 1RTDB 5DLGA 2D3O1 2CRLA 3DRPB 1VQKS 2NXEA 4UT4A 2O01C 2DIVA 4C8ZA 4OI3A 2K1RB 4MIBA 2E5JA 3J7ZT 2QGFB 3C8YA 4NLDA 3UN5A 1KEKA 1H6KX 3T19A 4DXLA 2LP4A 3UCGA 2LECA 1HLWA 5C2GA 1BQMA 3DGVA 3DRRA 2V9KA 1REGX 2LU1A 2MKJA 2XTJP 1ZZFA 3D1OA 3W65A 3FEYB 1F9HA 1YVFA 4JI8J 2Z2YB 2DKOB 1HNIB 4WP9A 2DR5A 2RIJA 4USKA 3IM8A 3ZZUA 1FERA 2UUTA 4I7FB 1TQLA 5HAOA 1NHUA 2U1AA 3BR8A 3MMJA 3BKTA 2J8SA 3VVUA 1RT1A 2IVFB 9ATCB 1I5OB 2WVBA 2YX7A 3TZWA 3AAWB 4LSNA 2KXNB 1CC7A 1MROA 1YK9A 5KFZA 2QZ8A 2OELA 5DJBA 5B0BA 4KFBA 1UW9A 2QO3A 2XO6A 3HFZB 4PXEA 1A7GE 4X4QA 4OMFG 4RWWA 5KAKA 2RT3A 3RW7A 4PQAA 3MZIA 5F3ZA 3N9UC 4ILRA 2FGOA 2FZKB 3SZ2A 1TUGB 2VJUA 3OTOF 5L1LA 2XS5A 3PACA 2YNGA 2ILYA 1LEOA 1SL2A 1VOMA 3FK4A 3PCOB 3EE3A 1S77D 5LSRA 1SBRA 3QNWB 4M5KA 3V4IA 1IQZA 4W98A 3N28A 3DLKB 1LXJA 5D0GA 4JI7J 4DX6A 3R9LA 3R97A 1RWPB 1SL1A 2M8HA 2Q43A 2WVDA 4FKYA 3PY8A 3PEHA 1RAEB 4C8YA 1OSCA 1HI8A 2VONA 1RHUB 3MEDA 2C2KB 1GQEA 4DUZF 1KVJA 2K7KA 3LUYA 3CCLS 3SI8A 4NRUA 3BQ1A 4JBCA 1SVDA 3TA0A 5E3QA 4DL6A 4U96A 1YBUA 3NWRA 2QL9B 3GJQB 3HD1A 3CCES 5GAGI 2QSWA 2LXIA 4CTAB 4AT1B 2XULA 2IA6A 3KG1A 1TKZB 4ZKAA 2D3UA 1VRUB 2JZ5A 5FLXU 2P6SA 2H5IB 2UVUA 2HS0A 2ZOMA 4I4BA 3TP2A 2MZJA 4IO1A 2Z2LA 4WP3A 2VZ9A 1P6TA 1ICEB 3GFHA 2FJVA 5I42A 2RDJA 3NMRA 4B17A 4RW8B 1X0FA 1Y10A 4E2FB 3MF5A 4RNOA 2HMIB 2QJ3A 1RP5A 1RKJA 2HVZA 2JEIA 3K7RA 3PKYA 1S6PB 3VTIA 1FVQA 3LA0A 1W2IA 5LXYA 1T02A 3W7BA 4O23A 4CM0A 4J9QA 1RBLA 3DOLA 2J0WA 2Y8WA 4EBDA 2BRKA 2VFTA 4HLBA 1XC9A 2CNLB 2JNJA 1YI2S 5BXIA 3KK3A 1DLOA 2QLJB 1YJWS 1NSQA 3PYDA 2GHWA 4CH7A 3VAMA 3FMWA 3G82A 1YTYA 2AJ0A 2U2FA 1HNXJ 1PJ5A 1WTBA 2QYGA 3GR1A 7FD1A 4LF8J 2PA8D 4ZVPB 4LFBJ 3WC0A 2W7PA 2DNPA 2R2TA 3THVA 1RJJA 4UQGA 3IWNC 1H3DA 5KG2A 1S97A 3G8QA 4ZVFA 2XI3A 4J9PA 2UUBF 4R0EA 4OYZA 4LF6J 5ETVA 2DHSA 2VFRA 1N5QA 4OHWA 4DF4A 4PQUB 2E66A 1HNVB 4TU9A 1CJKB 2ZHBA 1YHQS 4B9NA 3KYLA 3J81Y 4QBUA 2VDIA 1S0VA 2LMIA 2HQIA 3NCRA 3MXHP 4NLSA 2X1FA 2C3UA 3CDBA 2FJBB 2KJWA 4NLTA 1X7VA 3CW2C 4LRBA 4QQBA 2HHPA 4DR3F 3N01A 2JLGA 1U25A 2H4YB 3PO4A 3AY0A 4OYXA 4JI4F 1VRQC 4ECYA 2QMUB 3A1YG 3MEKA 1FJGF 2W9CB 1BD6A 1O51A 4ZP8A 2K3IA 2V8VA 1RT1B 3FEZA 1QE1A 4WFNQ 5JVGQ 3HM9A 1KD1T 2NXCA 3ZZPA 1MN7A 1Q78A 2MZRA 3MCOA 2ZH3A 4KFBB 2VASA 2HFUA 1FE4A 3KXDA 1PAUB 3R1LA 4IH5A 2OPPA 4CO0A 4K4ZA 2QE5A 3NAHA 3UVJA 4O3SA 2X3GA 4JI0J 3QGGA 1E6YA 2AEMA 2ASJA 1HKAA 2W4CA 4ZPAA 1M90T 2FZCB 2E1AA 1J27A 4YB1P 3FBCA 2ZWPA 2IHR1 4DI6A 3T3FA 2P5VA 4A47A 1ULRA 5LXRA 5I3UB 1RTZA 3C6UB 3T1HJ 3FRZA 2CQGA 4G1PA 1XWLA 2CZVC 3I0RB 4AD6A 1VQLS 5IT4A 3VAJA 4UW2A 5GVQA 1SC3B 3L95X 5AJ3J 2F9DA 2BDPA 2XZWA 2BOPA 2D41A 2B8QA 4F67A 3J7Z5 2UUAF 3IAS9 1WF0A 3QZ8A 1D8YA 1RK8A 2Y8YA 4A48A 1HIYA 3I56S 2UP1A 5E3PA 5CAAA 3EJMA 3K5MA 2NPIA 2ZUGA 4KY3A 3W61A 3K8WA 4QW9A 3AA8A 4FXWA 4DFMA 3OSNA 4NCBA 4A8QA 2KO1A 2R7RA 4PXBA 1RWNB 2GV1A 3DI6A 3VAFA 5A8KA 3ILLA 1VLYA 4B9MA 3LWLA 1ZPVA 1RT6A 4LF4F 4M5JA 1FNMA 1A0OB 2CZ9A 3Q0AA 4M5MA 1SL0A 3OW2R 4NOHA 3BB5A 5HMZA 3OTCA 2HZVA 4FF1A 1D1UA 1W7WA 1IKXB 2VA3A 4RU9A 5KFCA 5IFMA 4WP8A 1S0OA 2B51A 2O5DA 1RHKB 3MPDA 3CCWA 1YRUA 3BKUA 2G4BA 4H4KC 4DOZA 2G0CA 3RRGA 2G2ZA 2XLJA 2X3DA 4X65J 2ZHAA 3SIPB 1N36J 1NU4A 2OPRA 3TEHB 2VC0A 2AJFE 1URNA 4DCOB 1Q82T 1FTCA 5MLCV 1DLOB 3DC2A 3I96A 4ZPVR 2C22A 2LQ5A 3HSZA 2E9ZA 3CC4S 4DBQA 1HBNA 4WU2A 1U2FA 3TW0A 5D4PA 2DNZA 3ILJA 4NMLA 3IS9A 2FC8A 3EZUA 3H8YA 4IG0B 4C4WA 3H40A 3B4MA 3KDNA 5HLFA 2GQCA 1S99A 5EX3A 4HTIA 1RT5B 3DLGB 3TUIC 1RTHA 3QWPA 4WCEQ 1C2PA 3PG9A 2QRRA 1ZZNA 2ZEJA 3AXMA 2MQMA 2R7SA 2B4UA 2JH3A 4JI5J 1F1BB 3VWSA 2XMKA 1U49A 2M5YA 2HWTA 3QAEA 4B3RF 2V4QA 1F60B 5IM0B 1XNQF 5KFAA 2IJFA 1JLQB 4NXMF 4PXCA 5KFJA 2HZAA 5KFGA 3MD1A 2BJ7A 1OWXA 5LSOA 2J9CA 2DGTA 1YZ7A 3DKDA 3SXLA 2BABA 3HFVA 2UXDJ 5LJ5Y 1CJVA 1DTTA 5B0EA 1RAIB 4DSKA 1GAOA 4HKQA 1HNWF 4K7QA 2KT3A 3MM7A 4O44A 5KT3A 2ZE2A 4OX9F 2Q6BA 2DNYA 1JJ2R 5HI7A 1KQFB 1T3NA 4W92B 3JSMA 2CJBA 1WF2A 5DG7A 1Q1KA 2I2YA 4CT9A 2FLOA 2W9BA 3WHIA 4RW7B 1S9GB 4DEZA 2Q3PA 2V67A 3UVJB 1PAEX 1E6YB 1JXEA 5F3TA 1IBKJ 5I3PA 5HQLA 1HWIA 1S10A 5EUHA 3TQ1A 3FJ2A 2EFGA 2M70A 4AL5A 3AD9C 2ZH8A 2QX0A 4KTQA 1ZAVA 3QGHA 2ZDOA 4C3KA 3BM7A 1OY8A 2PMWA 4IQMA 4OQJA 5FJ4A 4URGA 4CRJA 2JFKA 4I2PA 3QO9A 3RAQA 4NLRA 3BQ0A 1HHSA 5B08A 2DRBA 3FFIB 5CYQA 3FUYA 4NLXA 2OPSA 2QSFA 4WFZA 1TUWA 4F2RA 2FJDB 1I94F 3N79A 4V19X 4FYWB 4USUA 1Y3KA 1W26A 3CCZA 4OL8A 1WTFA 3P6YC 2MQNA 1UMJA 3JYTA 2HRTA 3TX8A 4CWBA 4NMXA 1T7PA 4F02A 2LFVA 4M5HA 1WG4A 1U1OA 1C0UA 1TL7B 1S1UB 2H65B 3M6UA 1HPZA 3D1HA 2OD4A 3DI6B 5A8KB 1WC0A 3KLEA 1NXIA 3ENVA 2XLIA 3CCTA 2FDNA 1DQAA 3PNIA 1FRXA 1YX2A 3ZZ0A 2MZTA 3SCLE 1JXLA 1WORA 5KOWA 1XMBA 5J2PA 5IXUA 1JKHB 3D54A 4JI3F 4LIWA 3FMBA 1Y5NB 4F0HA 3D6FB 2GIFA 4ZJOA 4ID5A 1LWEA 1SUQA 1UPMB 2LQBA 1UETA 3S6EA 1KS2A 3GSDA 3ZNJ1 2AV5A 2OUGA 3CO9A 2OPRB 4Q0BB 1FNXH 4ES1A 3KMSA 5KFDA 2W2NP 4K50A 5KT2A 2J9DE 3D67A 2DH7A 1D9FA 3T5LA 2LXFA 2MLXA 1N88A 4ES2A 4YUDA 4NLWA 3BO2A 2IRUA 1EIYB 1WDDA 2AYEA 2X1BA 2PT0A 1P8GA 5KFBA 1JQGA 3QFWA 4ZIWA 2PMZD 4DL3A 4B9TA 2P6TA 3C2PA 4NASA 2P9GA 5EDWA 2HHXA 4CO4A 3U1NA 3EGWB 2V4JB 1T9XA 6AT1B 1V9OA 5DDOC 1QAIA 1S79A 2HLUA 2AGOA 3KHRA 5AXKA 1V5VA 2ZUAA 1XIQA 2A3JA 4YDDB 1XR7A 2CQ4A 5DZ7A 3HFKA 5GAGU 4TU8A 1PIEA 3MURP 4K2JA 4DG1A 2W1BA 3PRDA 2YX4A 2OD6A 2RJZA 2MXYA 3M05A 4DPWA 1RLCL 1EQ0A 1SQEA 1RBAA 1NUEA 2BE2A 2J9EA 3C6TA 1N33J 4B3OA 5E7OB 5DG8A 5A2QY 3OPKA 1EP4B 3V6DA 1DTTB 1WG1A 1U1LA 5LMNJ 4ANDA 2LA4A 4DPYA 2DNQA 4MFBB 4R8UA 5KG4A 4RW4B 2HAFA 3KUGA 1KWMA 4OYIA 3CJ3A 2YKQA 2DGVA 3FRYA 2JEJA 3TR5A 3ZO7A 2YTCA 1YDLA 4B3SJ 4X4OA 1N48A 1RYRA 2R7XA 1H0HB 1N34J 3NGUA 3LAMA 3NWGA 3C14A 5JXSA 2LLZA 2GC8A 4QR0A 1SJRA 2W9BB 1X5SA 2Q79A 4C0OC 4DPTA 1FRMA 2AX1A 3QT8A 4USMA 2GIRA 1WEZA 2HBYB 4M5GA 3TAMA 2HNYA 2B3TB 4JI1F 1SQFA 2CJ9A 3NGKA 1U1KA 1YLXA 3CD5A 4FF4A 4MKAA 4PG8A 3KTQA 5HL7Q 2HGLA 3BF4A 4RW6A 2CDQA 4J37A 1F5CA 2M52A 3QSIA 4WTOB 1OY6A 3G2XA 2ZFHA 3CIZA 4DLEA 4UF4A 1H7XA 4HR2A 1RAHB 4GRSA 3MOZA 1WI8A 1YJNS 2FHJD 1Q16B 5H9EK 2OPSB 3I5CA 1R8BA 1R8PA 3GQCA 3VR1A 5DQHA 2GQQA 3IR5B 2YPZA 4RWXA 4PG7A 2UZAA 3AJDA 1NH7A 3J81j 4LBHA 3VF0B 5CXTA 1U02A 3W8PA 4DCJB 4ZP6A 1CULA 4HHJA 5F8HA 2CJAA 2RH3A 3LH2S 1BUXA 4RKUC 3JAMU 6FDRA 5DDPC 1QTNB 4DV5F 1HPZB 2B6AA 4NCAA 2IC3B 4P72A 4ILLA 1PKUA 3HLUA 3KLEB 1KHWA 4LREA 3EZ5A 4KV8A 1CC8A 2V8GA 1KTQA 4USIA 4WU3A 1FDDA 3DFEA 2CG8A 1WHXA 1KFDA 4AXJA 3OFHA 5DLFA 1RABB 4O4GA 2QC3A 5J2PB 4B9LA 1PJ6A 2DNOA 3I55S 5BYRA 1RWUA 2KH9A 3PDNA 3J7YI 2HHHF 4YY3J 4P7TA 1IR2A 2XNRA 4XDCA 2YQ0A 4CQ1A 2KFNA 1YG0A 2VD3A 1S1XB 1X5PA 1EJ7L 5JJBA 3MI7X 5K14B 1TV6B 3FGVA 3Q89A 3TO8A 2ATCB 4U6PA 2JEFA 5A8RA 2NPFA 5CD4A 3MECB 2ZH2A 3PM9A 3MPVA 3SQOP 1X4EA 3MM9A 3C15A 2RHQB 1S1WA 1LNQA 3GE9A 3SDEA 4C7QA 3HVTA 9RUBA 1M5KC 3BGRA 2DNRA 2YY3A 1TK5A 1GMUA 4HVZA 1JIHA 3JQMA 1NK0A 4U95A 4G1QB 3HJFA 4GKKF 1UFWA 2BANA 1BHNA 1T05A 3ILIA 2PSZA 4JI8F 4DCPB 4XTTA 1JLBB 3N6MA 4DJBA 1GXLA 1H2UX 2ZH4A 3T6JA 1R27B 5J1EB 3CJ5A 4Q45A 4K59A 2HVHA 3OHBA 2IM1A 5IWAF 3PHEA 4FN5A 2DR8A 2VPXB 3TNVA 3CDEA 2ROPA 3K57A 5AE2A 1WHWA 4F3OA 2VDHA 3F41A 4L73A 4LR8A 1SJ3P 4QIFA 4PPZA 2IJNA 1OIAA 2WBMA 3CPWR 1NJXA 3OFGA 4B3OB 4OLOA 2BA9A 3V6DB 4QYRA 4UQTA 3H20A 1T03A 3NGRA 2RHSB 4XK8C 2NYIA 4R8UB 3TVYA 5FLXY 1HYSA 4FP9A 3ZTRA 5DZ6A 1WJ9A 3MPUB 1RUSA 2P9CA 4N41A 1SIWB 3NNCA 3EYZA 4QYZK 5DQGA 5D77A 4JI7F 3MCSA 4UZBA 3B82A 2PO4A 2JVOA 2AGQA 3TOQA 1B70B 2B9WA 1MNEA 2OPQA 4EK2A 2D3ZA 2H48B 3BDPA 3QLHA 2C42A 2MKCA 3GYNA 2CNNB 3K59A 1VIXA 4ZLNA 1U0HB 2CADA 4A8OA 2YQ3A 5G0RA 4J7CA 3IA0A 1M1KT 2HNYB 3DN9A 4F4WA 3C19A 1HA1A 3KK2B 2ZKUA 2D74B 4U8VA 4ZN3A 5KFSA 3PO5A 1FHTA 1UKUA 4X64J 2AW0A 2ZITA 2Z2MA 2DT9A 4OI4A 1MMDA 1ZAXA 4EEYA 3DGPA 3JSRA 1RTJA 4ICLA 4IG3A 1AXQA 3ENAA 4RNHA 1NJIT 3N4WA 4CLFA 2W2OP 1UVJA 3CCSS 4ZN1A 1MWZA 5KG6A 2NYHA 4OX7A 1PCAA 4OV6A 2XNQA 1VC6A 4ED3A 3SSSA 2E7WA 1H2VZ 5LJ3Y 1VQMS 2UUWA 2KN4A 4XPCA 3R27A 1S6QA 1M5VC 4USTA 3OFFA 1CULB 2D9OA 1FXRA 3LGNA 3IRXA 2EC0A 3JSYA 2HBRB 3MEGA 3TVZA 3KJVA 3FSXA 4ED7A 3KJFB 3I82A 3GFXA 4OZLA 2V9WA 1F5BA 4F4KA 4AL7A 2J6SA 2WK4A 1KRPA 1IUJA 4KV8B 1W2BR 5CH7B 4I2QB 1YWXA 4NCGA 4C8NA 3RG6A 3SSQA 2PMHA 2J6TA 2VFUA 2VJVA 3H0PA 3E01A 4DMZA 3NNHA 3G6ES 1F6TA 3VZHA 2BJ8A 3O1LA 5ETNA 1TL5A 2VC1A 5EWGA 4XPEA 1EQMA 4LF6F 3DOKB 3BYPA 3J7AN 3UNGC 1SJ1A 3DU5A 3HT3A 2DGXA 4DX8H 4LVNP 4I68A 4HHUA 3HXMA 3C15B 1KLNA 2PI5A 5CA5A 2PIIA 2IFXA 2BXJA 2VBYA 1HBUA 1AZSB 1QSLA 1S49A 4QIEA 2MGZA 5DM7Q 5LSLA 4TKTA 4DV6J 4NLYA 1X4GA 2HK3A 3PXGa 3B78A 1YBTA 4IDKB 3LF0A 3ISNC 3BSCA 4BC7A 1D09B 4NZ0A 2CPIA 5GADI 3ZZOA 2XMVA 2ABYA 1RGVA 3KWMA 3AJ1A 2GJFA 2B4OA 3OJUA 1CPZA 1NHVA 1H72C 4XIUA 5HBMA 4V1Ak 3PX0A 3PHTA 1UL3A 1RWKB 4PWDB 1K8AT 4TVAB 2WTFA 4D3GA 3PYEA 3NMAA 4KPCA 4Z2XA 4JI0F 4GVBA 3W60A 3KLHA 2ROGA 4WK3A 1LV5A 4MKVA 4OV1A 2GHPA 4HDGA 1RTIA 3GPAA 2A2CA 1ZTWA 5D8HB 4BWJA 4U7UK 1FCAA 3SCJE 2M88A 1FEHA 2MB0B 5C2CA 3HHEA 5HATA 1OJ4A 3Q8SB 1OPZA 4FNHA 2GGPB 4Y2AA 5J2NA 3RRKA 3M9OB 4WKRA 1CJTA 1LW2A 5EX0A 3K17A 3M2VA 1DURA 4P2SA 2K8GA 3G6XA 3QJLA 1FKPB 3M8RA 3FBEA 1V3RA 3O8WA 1UJ5A 1WI6A 2VODA 3THTA 4BC9A 1EHWA 3QT6A 5HMWA 1RT3A 2HYIB 2IVMA 2BQRA 1PBUA 3G9CA 2X7IA 3QLHB 4RNMA 5ETOA 3TRGA 5EWEA 2V5HG 3C16A 4AQYJ 3SV3A 3DOMA 1J5EF 1OO0B 1YSJA 4DDFA 3KDOA 5M2RA 4BLGA 3ZTPA 2WSFC 2W4PA 1QM9A 1R0AA 3RBEA 2JOQA 3D0GE 2BKPA 4Y6IA 2V63A 2DO0A 3A8EA 2KT2A 2W2MP 3TJ9A 1QAXA 2R7OA 2UVVA 1VMBA 5ETMA 4ICLB 1HW8A 1S1TA 4GO5X 2CQ1A 1ZTTA 2AWZA 4OYMA 3MPWA 1NK9A 5DQIA 1F2HA 4DHVA 3MR7A 2C2OB 4S0MA 4LF7F 3L7PA 4QYZJ 1S4FA 2DH8A 5GMEA 4O3QA 1ZM4A 3UCZP 4H4OB 4X4RA 1FWPA 1JMTA 1S59A 1UVKA 3QRQA 2RRBA 2ZH9A 4OZ0A 4RR5A 1NZAA 2YKNA 2GVDA 1SB6A 3GIKA 1HNZJ 3L7UA 2C2MB 4ZVRB 2BR0A 4OHXA 4ZCIA 1O5JA 4ZCLA 3IBWA 3SYZA 3MMAA 1VQPS 2KFYA 2FC9A 2E44A 3MM5A 2B4VA 1T9YA 1RWXB 1U48A 4RX6A 2F8EX 2DGOA 1VQ6S 4H4MB 3X1LB 3O44A 3IBFB 1XMQJ 3TVKA 3SEOA 1TP7A 5D0RA 4CO2A 3TJAA 4EWTA 3KJNB 4ZHRB 2EC2A 1NK8A 1VI7A 4KIAA 5HVHA 1FA0A 3CEDA 3FNNA 1HFEL 2A18A 4NCGB 1GTHA 4FXVA 4C0BA 1WC3A 3K58A 4P2XA 3NP5A 5ETQA 1H73A 2LXUA 1JJ4A 2UVRA 1ITPA 3BSNA 2MKSA 2IM2A 4ZVGA 4FF2A 1LFWA 4ZLLA 3I4HX 4EUVA 3AQPA 1VISA 2NR0A 1WF1A 2OGUA 2ZD1B 4ECTA 4FVMA 2NS1B 3JS9A 2EEYA 5KG3A 3ETMA 3V2UC 3D5MA 4DQIA 4KO0B 2YBVA 2E1PA 2ZVSA 4J9KA 1KOOA 3IN5A 4M5IA 4U7UD 2M9KA 3E3XA 3FQLA 3VAIA 2EFVA 2AU0A 3DCAA 4K8RA 1HBUB 1M0SA 3IGNA 3BH6B 3M8QA 3RZAA 1N5YA 3KLFA 2B5JA 3ILOA 4NA2A 2AT1B 3L7OA 4MH8A 5BR8J 2UU9F 2FPHX 2AMCB 3UE2A 1Q5VA 2KM8C 2XSJB 3TA1A 1R0BG 3KLGB 2XHWA 2AD9A 4GVBB 3MMCA 3NBPA 1IKWB 1IBKF 2DHGA 3T6BA 2ZHOA 4WF9Q 2CJXB 3VAKA 4O0IA 1B0PA 2VG6B 3CJRA 1NK4A 3ET6A 1K1QA 1RT7B 1RAGB 4PCQA 3VQTA 2FTRA 1S57A 2YQ1A 4WYWA 5AXMA 4F25A 5J2NB 1FVSA 1IXKA 4CZCA 1SH0A 1CJTB 1LW2B 1NKCA 4WIQA 3LP0A 3J7YU 3W2WA 3CJ8A 1X9MA 1K44A 2RMLA 3M8WA 1CVJA 3MPYA 5D3GB 3G8SA 5K5MA 1K1SA 3VGVA 1VQ9S 1RT3B 4NI2A 2L9NA 5HQMA 4RUAA 1NJWA 1UTAA 2FHMA 3DMJB 3WIUA 4JYAJ 1LWFA 1HQUA 4EO6A 2YWEA 5LMUF 1I6JA 1YIJS 1FXLA 1E6VA 3PJXA 4FZVA 4RZRA 4R5PA 3HHDA 1VBZA 1RQ0A 1NO8A 1CQMA 1YJTA 4OIXA 3FCVA 4M1KA 1YJUA 3IXQA 1YJVA 4ECRA 4LSLB 2XMWA 5L38A 2JSXA 4Z7YA 4K4YA 4DV0J 2YNFA 2CQ2A 2QLXA 1B4SA 2MJUA 4HH0A 1S48A 2B9EA 2D69A 4ECVA 1VQSA 4NX9A 2MQPA 4J5OA 1NDKA 3MMBA 2BOAA 4TLQA 3KG0A 2ZBRA 1JLAA 1JLGB 5LL6d 3EMTA 3QSYB 3H5SA 2QT7A 5EGYA 2V2VA 1Q8BA 2MQLA 4M5NA 4ZPWR 5A8WA 4EU0A 2IM0A 4F8RA 5I3QA 2XYGB 3IFEA 4O3RA 3KK1A 1UVIA 2ZH1A 3M2UB 2WVFA 5IQ6A 3VZIA 2VQFJ 2EKYA 4ZVHA 1Q0NA 1FRLA 1TL1A 1HMVA 4DV3J 1TMMA 2AEFA 4HHHA 3FC9A 2FHJA 5A0YA 5C24B 3FBBA 2DCUB 1TVRA 1U1MA 4ELTA 4WFAQ 2PC6A 1U1RA 4XDDA 2VG7A 1RTDA 3FDSA 1KNZA 1DJ0A 5J2MB 3DRPA 1Z2ZA 2A0FB 2K1RA 1HARA 4OI0A 4DWIA 3IG1A 3CCJS 4AFFA 1VQ5S 4IO9Q 1NLKL 4B02A 1UCNA 1TAQA 4M95A 4L76A 1L3KA 3UD5A 2HQ3A 1XNRF 2E7VA 3MCNA 2UV8A 1URRA 1WSVA 2E7XA 3GYXB 2LU2A 2K3KA 2JDJA 4YOEA 5GAHI 1HNIA 3UR3C 3CXCR 4FYDA 1RT4A 4CO1A 4I1TA 1NJYA 4ZK7M 2EPIA 2BE9B 1S9FA 1XQIA 3N5FA 3GP9A 2H9ZA 2YWFA 2C2ZB 4YHHJ 3P96A 3IR6B 4Y3CA 1R8CA 2MY8A 4NZ7A 5HJYA 4X4NA 3ZZZA 1N33F 1N5YB 2HS3A 5DS7A 2B5JB 5E2QA 3DM2B 4ZJLA 4Q2MA 1SKWA 4MJKA 3DHWC 3CCRS 1TKTB 1U1QA 4HYKA 4DR6F 4PUOB 1SKSA 2GHVC 3T5HA 1C4CA 4NLGA 1N6QB 3UFCX 3M4XA 2DNHA 1J5OB 5HP1B 3JTOA 4A4JA 1N34F 1PYSB 2GJ2A 4USJC 2HPUA 4PPDA 4OYPA 1YBAA 2XO7A 5DO2A 1QDUB 2GS8A 3OTDA 2RD5C 2V50A 2AYMA 3A8JA 2G2OA 3DLKA 2OP5A 2LCWA 2ZVIA 2OEMA 3MMCB 2FQQB 5HJXA 4O3PA 4DFPA 4MMOA 3RR7A 1QAYA 3W8GA 4I69A 3SCIE 3ET6B 3I9V9 2KFZA 4DN0A 1WKJA 3EVMA 2R7WA 1PILA 1IN0A 1PYTA 3JAMY 4C8OA 2F4VJ 4JUZA 4EYHB 3FVYA 2ZBQA 3M30A 1TELA 1AFIA 5K20B 2KVQE 4CLKA 4CTAA 3LP0B 3LAKA 2RRAA 4ZJQA 3W2WB 1NJZA 3BR9A 4QWCA 1TKZA 3QJJA 2QA4G 3NAIA 3S1TA 5A6PA 2J6UA 3CDAA 2IDLA 1VRUA 8ATCB 4WZQA 3VALA 1FE0A 2CKWA 2HFSA 1N4LA 3GV8B 3MAQA 2BMBA 3PVXA 1PJ7A 1R7IA 1LWFB 2Y9HA 3SFUA 3ZTOA 2C2RA 1NPPA 3PR4A 1T95A 2KM8B 3F56A 4IOBA 3NEKA 1E6VB 5H9FK 2IJRA 2VG5B 5J1NA 1IWAA 5AXLA 1U6BA 5C25B 4KH0B 1REVB 2HSEB 2DHXA 4DR4J 1X4HA 3R3TA 4DUZJ 1S6PA 2UV8G 3AXKA 1VBYA 1SV5A 2BJ9A 4MAKA 4F36A 2PEHA 5D0HA 3T9ZA 1XERA 2YNFB 1FRKA 1O8BA 3CGIA 5M2UA 2V34A 3D3BJ 4NE9C 1Q8KA 4TY9A 4PXDA 4IOAQ 5T7LB 1BWVA 1JLAB 1X9SA 2AJ1A 5E5NA 2LQJA 2IBOA 4JB8B 4C98A 4AYBD 2ZBPA 3MM6B 2NUHA 1ZOTA 3W63A 3H90A 4IUFA 8AT1B 1UW4A 3KK1B 4ITSA 2PN6A 3ENWA 1HMVB 1BXNA 3BH7B 1FJCA 4OJ3A 4A46A 4LF5J 2MKKA 1UVNA 3BGUA 2CQIA 4CLPA 1TVRB 2DVIA 2E5GA 2Q66A 1RZMA 1X4BA 2ZKTA 3CT9A 2VG7B 1HNVA 3MFIA 3CMQA 5F0WA 3I9ZA 1CJKA 4QR1A 5B09A 1QSSA 4GKJF 3TUZC 2R8HA 2F8HA 5CD4H 3KKFA 2MEWA 4AUKA 3NS7B 1UWAA 3IG1B 4RBUA 5GMKa 5KFXA 3V5RA 5IOLA 4PG5A 1U24A 1I3OB 5JUMA 2BW7A 3W1YC 5E0OA 2DD8S 1WKKA 1CG2A 1RHMB 5EN1A 3O5TB 1LFPA 3TARA 3NKYA 1WOOA 3CF5Q 3BO4A 3SBMA 4CNYA 2XEXA 1RT4B 1A9NB 4NL5A 4RL1A 2W9CA 3UCUP 2F63A 1C1BB 1CJUB 1Z2LA 2UUBJ 3Q24A 2QMXA 5IC4B 3LPYA 4K0KJ 2M2BA 1HR0F 5CABA 5IS2A 4HH1A 1UFKA 5DDQC 3QRRA 4K5RA 1NSKL 1S9EB 3MWBA 3MTKA 4PRFA 5KFHA 2BV3A 2LA6A 3OVBA 2E5LF 1FWLA 2R7VA 1RT2A 1TL3B 2I5JA 4JI4J 5I3UA 1C1CB 3C6UA 3L9ZA 2IRXA 4PEOA 1QLNA 1FJGJ 2JWNA 3I0RA 3IGVA 1BQNB 4OX8A 1FKOB 1TK0A 4LRAA 1VCTA 3PIPQ 1ZBTA 3UR0A 3F73A 4DL7A 2M0GB 2CQHA 2CNKB 1L5UA 4UY8T 4C9DA 3NXZA 2ACMA 1G2EA 1DQ9A 4C11B 5CYMB 3DLBA 4RJVA 1OYEA 1H2TZ 3RB4A 2EK1A 3RAMA 4DPXA 2QMWA 2GVZB 2ZNZA 3M30B 4CLYA 1KP6A 1H98A 3Q8YA 1D9DA 1V6HA 4AXIA 1JLFB 4RBTA 1KFSA 2XB2D 3CD0A 3M2RB 4NEZA 4KKOA 5BYQA 1S7IA 3ONQA 4JI6J 1SIZA 2R2SA 2FLNA 5CQGA 3SQGB 4F3MA 3Q8VA 3PX6A 2PFFB 2MHNA 4ILMA 4CLUA 4YB6A 1FF2A 4YR0A 2HHUA 1XTZA 2VBXA 3CC2S 4Z37A 4X2BA 2AX0A 1EX8A 3ZTQA 3A3OB 4DZ6A 2HBZB 1IKVB 3LP2B 3HD2A 2NZCA 1X4AA 1IKXA 3TZXA 2UUAJ 4DFJA 4KGMA 2V8PA 3A13A 1SV5B 2DJWA 4P71A 4H54A 4W4MA 4ERDA 3WBZA 5C5JA 2Z56B 2IY5B 2MYFA 4DPUA 3DXBA 2YNHB 3E51A 3LQVA 1UPPA 2HEKA 2D7SA 3BEGB 4OYWA 2HNDA 3QIDA 2QFIA 2B9YA 4KGVB 1WC1A 2J0QD 4E0DA 3D4JA 4LF4J 2OSRA 4ZITA 4IG0A 2BJ1A 2DGWA 1KLMB 3PW5A 4ETXA 2H5EA 3GCWP 2R8JA 1RT5A 3UDCA 2AQ4A 3DLGA 1HBOB 5H9FJ 3IWXA 2J7WA 4U67Q 1RAFB 1S0NA 1TKXA 2GNKA 3LP1A 3TI0A 1D8ZA 1LWXA 4ZOSA 2EKNA 1R6VA 2HK2A 1WEYA 2OEJA 1SC6A 2BW2A 2RF2A 2V4RA 3W62A 4DV6F 2W2QP 4Y28C 5IM0A 1JLQA 4DV7F 2ALZA 2GAGC 3RB6A 1KBRA 5E3CA 1SQGA 1X9WA 1NMEB 5KFQA 3HULA 1UVLA 1FFWB 5T14A 3VHQA 1N0VC 6FD1A 4ANCA 1F3VA 1U6ZA 2VV5A 4DV2J 3CJ0A 2I38A 4XO0A 4I0WA 2RDIA 2OEKA 1C0TA 4BWMA 1JXVA 3M7VA 3D28A 2XY6A 3DDNA 2EI5A 5HVGA 2UXBJ 1N0UA 4DUYJ 4CLLA 2XMTA 3OSPA 2XY5A 5A6WA 3MTJA 3H98A 1VR6A 4QJVA 1IVZA 1TFWA 5GAEI 1QUPA 2HQCA 2G1HA 3TQEA 2MJNA 5C42B 1TL4A 4RW7A 2Y1LB 3H2UB 4B3RJ 1S9GA 3CB4A 3BS9A 3RW6A 1XNQJ 2GO9A 4LQ3A 5I4MA 2GMJA 5IC6B 2ZDPA 1BY9A 2PDAA 3MOJB 4UOCA 4L3NA 3RAXA 4IYQA 2RS2A 1ZS6A 1FX4A 2BUNA 5ITHA 4KH1B 4CT8A 1RT2B 2V94A 1HNWJ 4BBYA 4LT6A 1VGYA 2I5JB 3HJVA 2CPDA 2OMLA 3OTBA 3K5NA 3NY0A 3GWCA 4C8MA 2LVWA 1U1NA 3AQOA 3FFIA 1S1VB 4KE5A 2JC0A 3QT7A 2JFDA 2FLLA 3BN7A 4ATNA 4YFUA 1RAAB 1BQXA 1WG5A 1QVGR
chains in the Genus database with same CATH topology
4BCAA 4PQUA 1RTDB 5DLGA 5F8MA 2ILZA 3JSYA 1G6BA 2CRLA 3MEGA 1NRKA 3TVZA 3KJVA 3DRPB 1VQKS 3FSXA 4ED7A 3BGLA 3I82A 5KFTA 3GG0A 3GFXA 4OZLA 2V9WA 1F5BA 2O01C 2DIVA 4C8ZA 4F4KA 4OI3A 4DFKA 2K1RB 3CSKA 4MIBA 4AL7A 2E5JA 2J6SA 4QIGA 3J7ZT 3M6WA 3OVAA 2WK4A 3C8YA 4NLDA 1KEKA 2OO4A 2ZOGA 1ELOA 1KRPA 1IUJA 4KV8B 1W2BR 5CH7B 1H6KX 3T19A 4KKOB 2WW8A 3PFOA 4I2QB 3UCGA 4WYLA 2LECA 2A10A 1YWXA 3MM7B 4NCGA 4O44B 4C8NA 1S1UA 1YRXA 2ZE2B 3M6VA 2HRUA 3CCMS 4DR7F 1BQMA 4QPTA 3DRRA 2V9KA 4EO8A 5GAHU 1N8RT 2XI2A 3N5BA 3SSQA 1RYSA 2PMHA 3HHLC 2LU1A 2J6TA 2MKJA 1DHMA 1ZZFA 2EBGA 1YRTA 3AB4B 3D1OA 3FEYB 4IH6A 2VFUA 3G86A 3POTA 1YVFA 5THWA 2N7CA 3JSMB 1VQOS 3D1QA 5FD1A 2YH1A 2OAUA 1HNIB 1M5SA 2DR5A 2RIJA 3E01A 4DMZA 3NNHA 3ZZUA 5L39A 3U7JA 4ECZA 3G6ES 2HVIA 1FERA 2UUTA 4I7FB 1TQLA 4ECQA 2C3YA 3VZHA 1U45A 1CLFA 1FNOA 3O1LA 2U1AA 1NHUA 3BR8A 1FK9A 3MMJA 2IM3A 2ASYA 1TL5A 2VC1A 5EHHA 5EWGA 2ZJRQ 4XPEA 1L3VA 4LF6F 4B9VA 1RT1A 2IVFB 3DOKB 3V6HA 5E41A 4JV5F 3UNGC 5K8PA 2YX7A 4OZ1A 1KQKA 2XS2A 1JKHA 1SJ1A 1GH8A 2UXCF 3DU5A 4OI2A 3HT3A 3AAWB 4LSNA 2KXNB 1FKAF 1CC7A 1MROA 2DGXA 4DX8H 4QIWD 5KFZA 3WDOA 2QZ8A 4B3TF 4LVNP 5B0BA 5DJBA 4KFBA 3JTNA 2QO3A 3H25A 3I6PA 3HX9A 4I68A 1XMQF 1QTMA 3HXMA 2KRBA 4C2MA 5EWFA 1WNEA 4PXEA 2VG5A 3OLAA 1A7GE 1KLNA 5C25A 2APOA 4X4QA 4D3HA 2PI5A 1UFLA 5CA5A 4OMFG 1REVA 2PIIA 2IFXA 2CG4A 2BXJA 4RWWA 5KAKA 4LVOP 4Q0BA 2RT3A 2NUUG 2BQUA 2VBYA 2BBEA 3RW7A 1HBUA 1Y0HA 1QSLA 4L6V3 4YB7A 4PQAA 3MZIA 1S49A 1UWBB 3CJ2A 4QIEA 4OHYA 2DIUA 5F3ZA 2MGZA 4HEA9 3N9UC 4ILRA 3AB2B 5KTQA 5DM7Q 2FGOA 2HNDB 2N7YA 5LSLA 1HWLA 4TKTA 1R8HA 4NLYA 1X4GA 2LKZA 3PXGa 3SZ2A 3B78A 1JLCA 4I2PB 2OLWA 3QO9B 4IDKB 2HW3A 1IBMF 3LF0A 3GFZA 3CIMA 3OTOF 5L1LA 2XS5A 3ISNC 3BSCA 4BC7A 3PACA 4NZ0A 2CPIA 2YNGA 2ILYA 3HHLD 5GADI 1SL2A 1VOMA 4GC6A 3ZZOA 3LALA 5T7LA 2N3LA 5CYQB 2XMVA 1S77D 1WACA 3UQSA 2ABYA 5LSRA 3GR0A 4I56A 1LXNA 1TKDA 1RGVA 2E1RA 1SBRA 3KWMA 3AJ1A 2QLWA 3V4IA 4ZP9A 3KMQA 1IQZA 3LO3A 3H5XA 2B4OA 2D9PA 5B0AA 3MHYA 4WK1A 3OJUA 3MM6A 3N28A 3DLKB 1CPZA 1VQNS 1NHVA 1LXJA 1FTRA 4JV0A 1L3SA 2MZSA 4XIUA 5HBMA 3PX0A 2EFQA 4OLPA 1UL3A 1SL1A 2D1CA 2M8HA 2Q43A 2FJWA 5CZXA 2VL1A 2V4JA 3HMJG 1K8AT 4PWDB 3PY8A 2WTFA 3PEHA 4D3GA 4C8YA 1OSCA 4FF3A 1HI8A 2VONA 2RUGA 4ZCKA 3MEDA 3NMAA 1N5SA 1GQEA 4CH1A 1VRTB 4Z2XA 1Q8IA 1TKXB 3LP1B 3JYTB 4DUZF 2J8AA 4JI0F 4UUXA 4E8UA 1KVJA 4NLQA 2K7KA 3KLHA 3LUYA 1JX4A 2ROGA 4WK3A 3CCLS 3SI8A 1N56A 1LV5A 4NRUA 5K8OA 2CYYA 3GIIA 3BQ1A 4KHPF 4LMZA 4JBCA 3HVRA 4OV1A 2GHPA 4HDGA 2RF2B 3TA0A 1X5TA 1RTIA 2C3OA 2JLEA 1BC6A 5E3QA 4DL6A 2A2CA 1ZTWA 3DLHA 5ADZA 3OL8A 5D8HB 3PEJA 3IRWP 4BWJA 4U7UK 4J9LA 1C0UB 4KC5A 2ASLA 1KSPA 1FCAA 3CCES 2N82B 5GAGI 2QSWA 2BQ3A 3SCJE 4K2XA 2M88A 5T41A 1FEHA 2LXIA 4CTAB 2MB0B 3HHEA 2XULA 2IA6A 3KG1A 3Q8SB 4HL9A 4H4KA 1TKZB 1OPZA 1DTQB 4Y00A 5DGAA 3GZ7A 2GGPB 3MM8A 4FNHA 5BR8F 2E1MC 4ZKAA 4Y2AA 1M5OC 2D3UA 4WIIA 5J2NA 1VK3A 1VRUB 2JZ5A 4ED2A 4ED6A 3RRKA 2P6SA 3M9OB 5L1IA 2VA2A 4WKRA 1LW2A 4QOTA 4WTYA 5EX0A 3M2VA 3BDEA 1DURA 4P2SA 2K8GA 3HHKA 3G6XA 2KRRA 3QJLA 1FKPB 1NK5A 1EP4A 3M8RA 2UVUA 1V3RA 2HS0A 3O8WA 2QV6A 1UJ5A 1WI6A 3I31A 4ED1A 2VODA 1PSDA 1QY7A 2ZOMA 3PRBA 3CD6S 3THTA 4O3NA 4BC9A 4I4BA 2OTJS 2CPZA 4MFBA 4K4SA 5KFMA 3TP2A 1C0TB 1U09A 2MZJA 1R31A 1Y3JA 4IO1A 5HMWA 2Z2LA 4RW4A 2DNNA 2JHEA 2VZ9A 1P6TA 3CD7A 3TAQA 1RT3A 2HYIB 3GFHA 2OFGX 1KQSR 2MSSA 2FJVA 1KHVA 2IVMA 5I42A 2RDJA 3NMRA 4B17A 4RW8B 3J7A1 1X0FA 4U7CA 2CFXA 2BQRA 3G9CA 4DPOA 4ID5B 4MK9A 3MF5A 1LWEB 1SUQB 2N4CA 4ZVEA 1P1TA 3QLHB 4RNOA 4RNMA 2HMIB 3GIJA 5KT5A 4KPYA 3TRGA 3I0SB 2R7QA 3N6LA 4Y2CA 4J9OA 1RP5A 1H7WA 5EWEA 2V5HG 1RKJA 2HVZA 4IR1A 2JEIA 2YKMA 4OI6A 4DSFA 3K7RA 4A8FA 5J2QA 3PKYA 3SV3A 3DOMA 1JLEB 1OO0B 1S6PB 2HGNA 3VTIA 2Y1RI 1J5EF 1YSJA 2B9XA 1TAUA 4A8SA 1S6UA 2DH9A 1FVQA 4DDFA 1EETB 1L3TA 5M2RA 1W2IA 2V2KA 2WSFC 1WHVA 5LXYA 1T02A 3W7BA 2CPHA 2W4PA 1NKBA 1QM9A 4O23A 1B0VA 1JNRB 3DOLA 2J0WA 5SZTA 4J9QA 5J1PA 4TNOA 2DGUA 1C1BA 2DNGA 2GA7A 4F4XA 3OHAA 4EBDA 1R0AA 2BRKA 3U1LA 2VFTA 5L8RC 4UUWA 3Q8PB 2CPFA 3RBEA 4HLBA 3IR7B 2JOQA 3D0GE 1XC9A 3CUNA 4Y6IA 1Q4RA 2DO0A 3A8EA 1YI2S 3QMQA 2M8DB 2FHOB 2KT2A 5F0UA 4YDXA 3M1VB 1QAXA 2G13A 3KK3A 1DLOA 2R7OA 2UVVA 1VMBA 1Y5IB 4QZVB 1YJWS 2Z8QA 5LMNF 2R7UA 2DO4A 4ICLB 2GHWA 4CH7A 1U4BA 4QCLA 1HW8A 1S1TA 2L48A 3HPOA 3VAMA 4GO5X 3FMWA 2CQ1A 4BDPA 2W7AA 1ZTTA 1YTYA 2AWZA 2AJ0A 1VIOA 2U2FA 3MPWA 4K4TA 1NK9A 2ADCA 1S9EA 2B0GA 5DQIA 4DHVA 1WTBA 1D0EA 1N5VA 3GR1A 2QEXS 2LYVA 7FD1A 2PA8D 4WE1A 2GMHA 2CJKA 4RNNA 4LF7F 3L7PA 4QYZJ 1S4FA 3PZPA 1TUVA 2DH8A 3WC0A 4B3SF 2YNIB 3O3LA 4O3QA 1ZM4A 3UCZP 4H4OB 4JYAF 4X4RA 3G6VA 4WFYA 3ZC4A 2W7PA 1WELA 1MSWD 1JMTA 3DU6A 1UVKA 3EGZA 2RRBA 2ZH9A 3HZGA 4OZ0A 1NZAA 2DNPA 2YKNA 1SB6A 4A8WA 3S01A 2R2TA 3GIKA 4O3OA 4KQZA 4F50A 1TL3A 3THVA 3HZEA 1RJJA 4X4PA 5H1SV 3IWLA 4UQGA 1JWWA 1C1CA 3IWNC 4ELUA 2BR0A 4OHXA 1H3DA 4ZCIA 1O5JA 4ZCLA 4G6VB 5KG2A 1S97A 4DG1B 3MR5A 3G8QA 3IBWA 2XI3A 4ZVFA 3SYZA 3NL0A 4J9PA 1JJHA 1LW0A 3MMAA 4ALZA 1VQPS 1FD2A 2UUBF 4R0EA 3H4DA 2KFYA 2FC9A 2E44A 4IKAA 3MM5A 2B4VA 2FY1A 2DHSA 2VFRA 1N5QA 1BQNA 4OHWA 4TXSA 4DF4A 1FKOA 4PQUB 1U48A 2E66A 4RX6A 1HNVB 2F8EX 1GNKA 3NCQA 2KU7A 2DGOA 4TLRA 4TU9A 2PD1A 3EUNA 1VQ6S 2BE2B 2ZHBA 4H4MB 3C6TB 1YHQS 1X4FA 3KYLA 3MD3A 3J81Y 4B9NA 2KZMA 2WCXA 3X1LB 1GX5A 4QBUA 2KDOA 3O44A 4C11A 5CYMA 4TY8B 1S0VA 2W8LA 1BWEA 3TVKA 2LMIA 1TP7A 3SEOA 4CO2A 2MMYA 2HQIA 4EWTA 3DRXA 1U2RA 4ZHRB 1GTEA 3NCRA 3MXHP 1KQGB 4NLSA 4DQQA 3B8HA 2X1FA 2C3UA 1NK8A 1VI7A 4KIAA 3H2LA 2HNZB 2KT5A 3BO3A 3P49B 3CDBA 1FRIA 1FA0A 2FJBB 2KJWA 3CEDA 3FNNA 1HFEL 4NLTA 1D3WA 4CIOA 4KHMA 1MMNA 2A18A 1X7VA 2DTJA 4NCGB 4FS1A 4QQBA 1RISA 2ZH5A 2HHPA 3NLCA 3LOUA 3KG4A 1GTHA 4C3LA 4DR3F 2IC3A 3N01A 4KJIA 4FXVA 1UVMA 2JLGA 2AJQA 4C0BA 2O1PA 1JLFA 1FESA 1G7CB 3K58A 5L9XA 3NP5A 1P9QC 1R8AA 3POTB 1U25A 3M2RA 2LXUA 1JJ4A 3QAUA 5D4NA 2RKIB 2RQMA 2UVRA 3BSNA 3P5TL 3PO4A 3AY0A 4Q43A 2MKSA 4ECWA 4ZDNA 2ZC3A 2IM2A 2VQFF 4ZVGA 4JI4F 4FF2A 1LFWA 4ECYA 3ETOA 2K2PA 3ENQA 3I4HX 2N4DA 3A1YG 3SQGA 3MEKA 4EUVA 2R2UA 4ELVA 1FJGF 3AQPA 3M8PB 2W9CB 3E8OA 3TAPA 1BD6A 2KKHA 3UD4P 1FK9B 4M63A 1KTVA 4TU7A 3HP6A 1O51A 2NR0A 3C3LA 1WF1A 3KNGA 4ZP8A 2K3IA 2V8VA 1RT1B 4DV3F 2ZD1B 3T1YF 3FEZA 1QE1A 4NZ6A 4ECTA 4IH7A 4WFNQ 5JVGQ 3PW2A 3HM9A 2I0XA 4FVMA 2NS1B 2PI4A 5KG3A 1KD1T 2DR9A 3ZZPA 3V2UC 3MUVP 3TAMB 3D5MA 3TANA 4DQIA 2DNKA 1S1XA 4KO0B 1Q78A 2MZRA 2ZH3A 1UA0A 2ZVSA 4J9KA 1KOOA 4KFBB 1HD0A 2VASA 3IN5A 1IJEB 1J2VA 3NG8A 1FE4A 1IKVA 2QA2A 3LP2A 1N54B 4MIAA 3R1LA 2VUGA 1W25A 4IH5A 2OPPA 5K14A 4CO0A 2M9KA 4J9SA 3E3XA 1YJ9S 4EZ9A 2QE5A 3NAHA 1RA7A 1TV6A 3O6QA 4O3SA 3D0IE 4DR5F 4K4ZA 1YJRA 3E2EA 1U26A 3FQLA 3ICLA 3VAIA 2X3GA 5K8NA 2Q6CA 3QGGA 3KNAA 2EFVA 1E6YA 2VFSA 2AU0A 4X4UA 4NWBA 3DCAA 3NS6A 1HBUB 2ASJA 2IBKA 2W4CA 3MECA 3H4BA 1M0SA 3ZFVA 4RW6B 3IGNA 4ZPAA 4Q2LA 3SSRA 4IFVA 3M8QA 3RZAA 3OXLA 3P3DA 2CIMA 2ROEA 1M90T 3CDUA 2QA4S 2VKRA 1N5YA 3KLFA 2E29A 4N76A 5HQ8A 2E1AA 5LT5A 3OL7A 2B5JA 4DL4A 2DPIA 1JLCB 4RU2A 1FXDA 4YB1P 2ZM6F 5JVHQ 1ZM9A 3M9MB 4NA2A 2YNHA 2XLKA 2AYBA 3L7OA 4MK7A 2L9WA 2IHR1 4MH8A 2CVEA 2PE8A 4DQRA 3GV7B 2IAJB 3T3FA 3GV5B 2P5VA 4G1QA 2UU9F 1WWHA 2FPHX 4A47A 1ULRA 2KG0A 1F5AA 5LXRA 5I3UB 2WAQD 1ZYQA 2XS7A 3C6UB 4BHQA 4M94A 3FRZA 4DSJA 2CQGA 4G1PA 1XWLA 1VFJA 4YR3A 2CZVC 4Q44A 3I0RB 3HHLB 1VQLS 4YY3F 5IT4A 3QJPA 3DRYA 3VAJA 4UW2A 4C8KA 3UE2A 1JLBA 1P27B 1B7FA 5GVQA 2KM8C 3L95X 2DCLA 2E5HA 2XSJB 3OQ2A 3TA1A 4ZCMA 3OVSA 3OR1A 2W9AA 1FD8A 4PKDB 3CE8A 2EVZA 2F9DA 4K4XA 3KLGB 2XHWA 1KLMA 2BDPA 2LDYA 2XZWA 3W3SA 5J1EA 2BOPA 2D41A 3UD3P 1N5TA 2JRSA 2C2EA 2AD9A 1AFJA 2KJVA 4F67A 3J7Z5 2UUAF 3IAS9 2L9DA 3PKMA 1AW0A 2COLA 3AA9A 1WF0A 3MMCA 1HBOA 3NBPA 3QZ8A 2C3MA 2WOMA 1IKWB 1D8YA 4DQSA 1IBKF 1ZM2A 1RK8A 2DHGA 3T6BA 2ZHOA 3RBDA 4WF9Q 3VAKA 4A48A 2KYXA 2EG1A 3NGDA 4N5SA 2ZNYA 2XWYA 4O0IA 1B0PA 2VG6B 2ZH7A 1NK4A 2ATLA 3VCDA 2YKAA 3I56S 3RTVA 3MR3A 5F8JA 1K1QA 5KT7A 3DLLQ 1RT7B 2UP1A 4PCQA 3RU0A 1QJHA 3VQTA 2FTRA 2B6AB 5E3PA 2OMOA 2BACA 4ECUA 3K5MA 3CC7S 2NPIA 2ZUGA 1VS3A 4WYWA 3MM8B 5AXMA 4F25A 4TN2A 5J2NB 2DR7A 1FVSA 1YQHA 1IXKA 4CZCA 1SH0A 3K8WA 2DNLA 4QW9A 3AA8A 4FXWA 4DFMA 3OSNA 1LW2B 4NCBA 2VKZG 4A8QA 1NKCA 2KO1A 1H38A 2R4FA 2R7RA 3LP0A 4PXBA 1OS5A 2GV1A 3DI6A 3J7YU 3W2WA 3VAFA 1B64A 2Z4PA 5A8KA 4O4GB 1X9MA 1D9AA 1VLYA 2RMLA 4DQPA 4B9MA 3LWLA 1ZPVA 3X3UA 1RT6A 1CVJA 4LF4F 3MPYA 2NLWA 1LWCA</