4AXJA

Structure of the clostridium difficile eutm protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
b'ANALGMIETKGLVGAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELISVHVIPRPHFEVDAILP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETHANOLAMINE CARBOXYSOME STRUCTURAL PROTEIN
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
total genus 21
structure length 87
sequence length 87
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4axjA00
3CGIA 3N79A 3IA0A 3H8YA 3SSRA 3VCDA 4QIVA 4QIEA 3SSSA 3DN9A 5DJBA 3DNCA 3MPWA 4RBTA 4P2SA 3SSQA 3I6PA 4AXIA 4DDFA 4LIWA 2EWHA 3CIMA 3BN4A 3NWGA 4OLPA 3PACA 4OLOA 4P7TA 2A18A 4QIGA 4QIFA 4OX8A 3NGKA 4OX7A 4P7VA 4RBVA 4AXJA 5L38A 3I96A 2A1BA 2G13A 3MPYA 4PPDA 4RBUA 4OX6A 2A10A
chains in the Genus database with same CATH superfamily
2ZH7A 3BQ1A 4JI6J 1LWCB 2YWHA 1K47A 1FXDA 4DQIA 2LA4A 3L9ZA 4DU7A 5CA5A 2N3OA 3LO3A 4DUTA 2BKPA 1FJGJ 5B0DA 1H73A 5KFGA 1F2HA 2HMIB 1TR0A 2G1HA 2RAQA 3DMJB 1TP7A 1SH3A 1UKUA 3M1VB 2C2DA 4PG6A 4ES1A 1MN9A 2HK2A 2WCXA 4ZJOA 2MLXA 2GGPA 3VAKA 1I94J 1MNEA 3DYAA 1RTZA 1RWOB 4PEOA 1S6OA 1S6UA 4FXVA 1X8DA 7FDRA 2WRMA 1RAGB 2ZC3A 1SV5A 1S1TA 2JX2A 2ALYB 3B54A 3T3FA 1RHQB 3BDEA 2FVRA 2ZD1B 1D0EA 2CVIA 1RT6A 3QZ8A 3THTA 4M5JA 2CNKB 4P7VA 1BQMB 5CYQB 2DR8A 2UXBJ 1OSCA 1UWBA 3D68A 5D78A 4MK8A 2OUGA 1QUPA 1TKXA 3DLEB 1TKTB 3ZTPA 1R8AA 4WCEQ 3BQ2A 3CT9A 2OAUA 3UPFA 2DEJA 4CLZA 3TYTA 2VG6A 2NXNA 2XM3A 4PPDA 1NNDA 2W7OA 1RZMA 3V6DA 1VQSA 4DSKA 4Y2AA 3ETMA 3KK2B 2W9CA 2BKNA 1F9EB 1NSAA 2M8HA 1PJ6A 2IC3B 4NOHA 1WOSA 1JLCA 3MI7X 3HSZA 4X4PA 3TO8A 4RO0A 1FNMA 4NRUA 2BACA 1SCJB 4YDDB 2BJ3A 3US5A 3NAIA 4J9UE 2BJ9A 2ZVSA 5GADI 1RBAA 4DF8A 5A0YA 4JI3F 4AD6A 1SV5B 1S1TB 4JI7J 1H98A 3OFEA 2RHSB 4F4XA 1NU4A 4ZP8A 3R2CJ 5K8PA 2MKSA 3CCES 1SL0A 3ZZOA 3UR0A 2BOAA 4NX9A 3BBFA 4ECWA 2V34A 3H4DA 4ELUA 3CDEA 1GMVA 2DEIA 3UDLA 1RUSA 2HWIA 2QZ8A 1CQMA 2E1CA 1TUVA 2GFFA 2VG6B 4ZA1A 2GVZB 2B7CB 1UTAA 1YI2S 4L75A 1FFGB 1HNXF 3O3LA 1VBKA 3PEHA 1Q5YA 2B9XA 3HI9A 3V6DB 5EGYA 4JI6F 1Y5IB 3U27A 3LQVA 1IQTA 5H9EK 2W9CB 3KLFB 3I87A 2JL9A 1FJGF 3HK2A 4B3TJ 1YJTA 4F02A 1UVKA 3ENWA 2H5IB 5SZTA 2LMIA 2HS3A 3C6TB 5J2QB 1SJQA 3M30B 3FBBA 4QU7A 4WFBQ 2XYHB 2B9YA 1I94F 4OFZA 3G6YA 4K0KF 1HMVA 3ILIA 1OY8A 1XNQJ 1EQMA 3KG1A 3W2WA 3I5BA 4EWTA 2J0WA 4ILRA 3JAMU 3PEJA 4RNHA 2Y9HA 1FWLA 3BV8A 2EFNA 1VQ7S 1Q81T 3D0IE 5KFSA 2C22A 1S0MA 4DSLA 2WOMA 5KT7A 1MMNA 3GONA 4IFVA 3EWGA 3A1YG 1U49A 2QA4G 2V4JA 2D1CA 3EZOA 2UXBF 3FZBA 4H54A 5L1IA 4QR1A 3CF5Q 3FQKA 2C3OA 2AJ2A 1ZBTA 1WF2A 1PBAA 1N36F 3MCOA 2W2OP 2JC0A 2XC9A 2Y0BB 3PVXA 1UEKA 3VAHA 3TAPA 5L38A 2KDOA 1VQLS 2AT1B 2PMZD 4TU7A 1WWHA 3V6JA 4K50A 3AD7C 4A8WA 5KFBA 4I1TA 4KRWA 4W4MA 3OLAA 2BQRA 2JVOA 1HHQA 4ETZA 3QWPA 3RR8A 4KHRA 4OL8A 1ZAXA 5BXIA 3W64A 1HMVB 4HI1A 2LEPA 4CT9A 1Y00A 3MM5A 4RW9B 3DNCA 2NYHA 4JI8F 4JI7F 1T03B 2HZVA 2J6TA 4FNIA 5D4OA 3HM9A 5FIIA 3AODA 3HHLC 2ZM6J 3HHDA 2GMJA 3I56S 4MIBA 2DRAA 2WOMB 5D77A 4NI2A 1CJKB 2VPYB 2CQ1A 3M6UA 4H4KA 2V4JB 3NL0A 1UFWA 1Y3JA 1HYSB 4YR0A 1FKOB 2PI5A 2J76E 4HYKA 4MKVA 1XR5A 5J2PA 4MKBA 1RBOB 3OR2B 4O44B 1Y10A 1J2VA 2VG5B 2YNIB 4HHJA 1NKEA 3IWLA 1B7FA 3IXQA 2G4BA 2CPYA 3L09A 1G4CA 1IBKJ 4OHYA 2O01C 2K06A 3M8YA 2GHWA 3EX7B 3SZ2A 2HQFA 1A6LA 1OYEA 1M90T 1M5PC 3RB3A 4C2MA 4R5PB 4TNOA 3OHAA 2R8KA 1JJ4A 1P9QC 4MIAA 4B3TF 2CQPA 1OS5A 5HJYA 1XWLA 4U96A 3CD0A 4ZN1A 3MM7B 1DFDA 2XMJA 4RBTA 4P2SA 3I0RB 1FKAF 5L1LA 2VH7A 3IP0A 1RB0A 4PG7A 3M8ZA 5J1EA 2AGPA 1ZOTA 2ZHBA 4F36A 5JXSA 3T5HA 4ZHRB 1XNQF 1NAQA 4NI2B 3CO0P 3CJ4A 5K8MA 2VFRA 1ZH5A 2J0QD 3KYLA 2FHKA 4ZPTR 4X4UA 3C66A 2AZ3A 1PGZA 2A6OA 1AROP 1VGYA 2N82B 4A47A 3EUNA 1O6XA 3LGNA 2DTJA 1TL1B 4ECRA 2QGFB 2R7VA 5GMEA 2VF3A 1FESA 1W26A 4U95A 2K3IA 1AZSA 2F5GA 1Q5VA 3TARA 4I68A 4DBQA 4IG0B 4C3LA 5ETRA 3CCUS 2E7VA 3LAMA 5L8RC 2CVEA 3CWJA 2QL5B 2XZDB 4WU3A 2ATLA 1G3OA 1VRQC 2Z2ZA 4ELVA 4UUWA 1JXEA 4F4AA 4C0OC 4LRFA 3DLHA 2AWZA 3HMJG 2NCKL 2AYGA 3DRSB 2HHVA 4LSNA 4PPZA 2CYYA 2HBRB 1JLEA 3T5JA 3SFGA 2DGQA 4USHA 3KG0A 4IDKB 1NO8A 4WZQA 1T05A 2QFJA 2ZM6F 3VAMA 3AHPA 2G2YA 1W7WA 2AGOA 1IWGA 5K20B 3PYEA 5CD4A 1X0FA 2MDAA 1T02A 2FYXA 3RU0A 1HIYA 2HRUA 1R8HA 2CZ9A 4NLSA 3K5LA 1H74A 1LOUA 3D67A 3M9MB 2FJXA 4U7UD 1NZ8A 4Y2IA 3G9CA 2IVYA 1RYRA 3UDEA 5KFDA 2C2KB 2DNMA 5C2CA 1GT8A 4OHWA 5IC6B 2A3JA 2P9EA 4PG8A 3UNGC 1PCAA 4G65A 1IBKF 1N5TA 1BQXA 4JB8B 1SIWB 4LF9J 1H2TZ 1T9UA 2W2NP 2W4PA 2CQHA 4DXLA 1SJ4P 4U7CA 3CC2S 3HZGA 3M8RA 1S4FA 3AJ2A 3KWMA 1CSJA 2N7YA 2IAJA 1KN6A 1FNXH 1D3WA 1WTFA 1FXLA 4IH7A 3GV5B 4I2QA 4ZS6A 4OX9J 1SJ1A 4UZBA 2ZUAA 1Z1ZA 4F7VA 1R8CA 1E6VB 2GJ2A 2BVZA 2G0JA 4X84A 4P2MA 1RKJA 1LKZA 1EX8A 3Q22A 1PG5B 1JIHA 2C42A 4K7QA 3H5UA 4IRKA 3PY8A 3S1TA 1TK5A 4IH5A 1UVNA 3D6FB 2BQUA 2R7QA 3BM7A 2R7WA 2QLJB 2MZRA 3T9NA 5IOLA 1N33J 4Y3CA 3N4WA 2KI2A 2V8VA 4WPAA 3BN4A 4CM0A 2FZCB 5LT5A 2RS2A 4WK1A 2OHDA 3GFZA 1EETB 5KFPA 2LQ8A 3OL9A 1QY7A 3GIKA 4ED0A 4WXOA 1Q8BA 2D9OA 4LR8A 2VONA 4C98A 3KNAA 2ZWOA 3NCPA 4DR4J 3CDUA 1O0PA 1TUGB 5LL6d 1FRJA 2QLBB 1SC3B 5EUHA 1SJ3P 3PR4A 1FK9B 3MD3A 4ZIVA 2PE8A 4WFNQ 3FEYB 3EZUA 4HEA9 4QIGA 4HDHA 4PG5A 2Y1JA 1GTEA 1FO1A 3V81B 3L4BC 3KOAA 2NZCA 1S1WB 2F8HA 4IFYA 1QAIA 2B4OA 3C6UB 1IM6A 4A48A 1J5EJ 2H48B 1TKDA 2G0IA 4NLXA 5AE3A 2FVQA 1WKLA 3NBPA 2XI2A 3H40A 1RT5A 4OYAA 1APSA 1JLFA 3SXLA 3KK3B 3H25A 4LIRA 4DL7A 2BKOA 2PFFB 3SSQA 2B43A 2CDQA 2XYPB 2VFSA 2RILA 3GR1A 4LF9F 1TAUA 2QL9B 2AZ1A 4N41A 2B6AB 2OD6A 2WBMA 2R8GA 1AXQA 2CPEA 2UZAA 2ZWPA 2HLUA 1X0PA 4EYHB 1UL3A 1TKZB 3NWRA 4MJKA 3DOKB 2Z56B 2AX1A 2HIYA 3MUVP 1WHVA 4ZP7A 2WSEC 5L1KA 1S12A 3HVRA 4XDDA 1VQ5S 5KG6A 3D4JA 1T11A 3TW0A 5DDPC 4OX9F 2BJ1A 5J2NA 4ECVA 2GQQA 4ZCKA 2A1BA 1GQEA 1LK7A 1WG1A 3ZZUA 3NS6A 3AB2B 1S49A 2XG8A 1Z2ZA 4BC9A 3M2RA 3CJKA 1V3SA 1JLBB 2IRXA 1RWPB 1TK8A 5I3UA 1PAEX 2CQ4A 4LF8J 3NBPB 3CEDA 3NS5A 1RT5B 2MJUA 2B51A 1ITPA 1FX4A 2KKHA 2I8EA 2QA1A 5A6PA 3D3CJ 1N33F 2W2QP 4GO7X 5IT9U 3HFZB 2CJ9A 1D1UA 2XS5A 4M5IA 3OTEA 1NPRA 3L7UA 1XNRJ 1CLFA 4GVBB 2YY3A 1FDNA 4ELTA 3N28A 3KJNB 1BLUA 4QYZJ 1CQNA 3CDAA 4MIWA 4J9PA 1CS4A 1IXKA 3OTOF 3BO4A 2HNZB 4DR4F 1IKVB 4NZ6A 4ZVUB 2G2OA 3GB0A 5KG7A 1X4FA 4EU0A 2CNOB 2Z8QA 5GAEI 1HQEA 5CCMA 1L5UA 3PTWA 2IMOA 1HHTP 3RW7A 3CXCR 4F25A 1TZ0A 3CJKB 3FBFA 4WJBA 3CJSA 4DV0J 2BRKA 4NCAA 4PCQA 4B08A 2MLYA 1Q95G 1B4SA 3EVOA 2B4UA 1J5EF 4K5RA 2CPZA 3J81Y 5GAEU 1UEVA 2HKEA 2AW0A 5LSRA 4J9NA 2FQQB 3MM6A 2DRDA 2X1AA 3TANA 1N56A 5HROB 5KG5A 3Q24A 4OI2A 4UF4A 1RT2A 4GRSA 3R6LB 3UD3P 1CS4B 3PIPQ 4QZVB 2ASDA 3M9NB 3Q83A 4A46A 2GMLA 2YWGA 5T7LB 2XTJP 2QLXA 1EIYB 5A2QY 4EBCA 1M1KT 1VK3A 4M5MA 1B0PA 4QYRA 1K0VA 5HMYA 3OUYA 4WTYA 1SC1B 4O3NA 1O8BA 3POTB 4C8OA 3MXHP 2GAGC 3UN3A 4KQZA 1S97A 2OD4A 1JLQB 1S0NA 3KUEA 2APOA 3BS9A 4AXIA 2KXNB 4F50A 4CZCA 3PYGA 3AJDA 1U0SA 4P2FA 2POKA 2DR7A 2JSXA 1AFIA 4LF8F 1W25A 1U1OA 4OYXA 2OGUA 2KJWA 4DR3J 1XEZA 1F5BA 5FLXY 4L72B 3U02A 5EX3A 3QJLA 1NJZA 3TP2A 1P27B 5AE1A 2GVDA 3J7A1 2CPFA 1ACMB 1SKRA 1LNQA 2J8SA 1R7IA 1RT2B 2B5JB 4F4YA 3UN2A 1MN7A 2UV8G 4QOTA 2EK1A 5KFAA 1XNRF 2R8HA 3BKFA 4FYDA 2R2TA 4TU9A 2H4YB 3SMZA 5M2PA 3VCDA 1NH8A 3FRYA 3O8WA 2VODA 2J7WA 2PEBA 3HPOA 3PYFA 1KEKA 2DNHA 4O3PA 1NDCA 1LW0A 4F3QA 2MPUA 1NLKL 5C2GA 3MPYA 2E7WA 5E3CA 3OUYB 3TR5A 1JJHA 4CT8A 3OXLA 4MAKA 2CQDA 1VQOS 2ZH3A 3IRXA 3NEKA 1NDPA 3QAUA 2DHHA 4R8UA 2EC0A 3FJ2A 1KLMB 3PR5B 4PWDB 2X3DA 1RWWB 4FKXA 1WG4A 4DV0F 3KHGA 3E01A 3K7RA 4I56A 1Q8LA 5KFWA 4OYPA 1RHKB 1T7PA 3TJ8A 2G1DA 2XHWA 3KHRA 3OJSA 4G1PA 4YOEA 4CO5A 3RBDA 2GVDB 1OPZA 3AQOA 4BHQA 4EEYA 3MAAB 5C42B 2GO9A 2UV8A 4IR9A 4LIWA 2NYIA 4L76A 4DSEA 3MPUB 2R3VA 4O4GB 3SCKE 3NCQA 1T9YA 4B3RJ 3PV8A 4OIXA 7FD1A 2V94A 1XR7A 2XSJA 4UOFA 5KOWA 3FKBA 1JNZB 3ICLA 4DG1B 3PIOQ 2DIUA 1OIAA 1LW0B 3OL8A 2HVEA 3N5FA 3R1HA 4I4BA 5DJBA 4DZ6A 3IR5B 3CDBA 4LQ9A 4LF5J 3BR8A 5IZHA 4ZOSA 3NGKA 3UO0A 1PJ5A 2HVIA 3SV4A 2UUBJ 2R7SA 4R8UB 4Q8EA 1RHJB 4RBUA 2CQ3A 1V5VA 5ETTA 5A8RA 1ICEB 1HKAA 4Z37A 2DR5A 3I6PA 2QG9B 1ZM9A 2KG1A 5D4LA 4LRCA 2AYMA 4CH0S 4Y2MA 2LEAA 3R5AA 2LKZA 4M94A 1RKIA 1OWXA 3CJQA 3EGWB 1DTTB 2L41A 3KFWX 4D3HA 3GFXA 3W2VA 1RADB 3D54A 4DR3F 3KUHA 2CJBA 1X31C 1YGYA 2CPJA 1JLGA 4WE1A 4DPWA 3K5MA 4DV4J 2DH8A 4DHVA 3MEEA 3UVJA 3DM2A 1NJYA 5KT4A 1MMLA 2BABA 3HSJA 1UA1A 4HHUA 2OIHA 3GG1A 1C2PA 3PW2A 1EZZB 4DFPA 1VC0A 5GAGI 2DHAA 5HLFA 5D0GA 2DYAA 4K4YA 5A8RB 5DM6Q 3LPYA 3RJMB 4WKRA 3K58A 1N54B 2IRUA 2AHOB 3B82A 1X4GA 3TA2A 3NRBA 1R89A 1XC9A 1T95A 2SXLA 2LDIA 5E2QA 1EP4A 1C1BB 5D4PA 3UE2A 1VQMS 1KR4A 1GNKA 1VOMA 4YB5A 5A8WB 3DGPA 3T5KA 5GAGU 4ZJQA 3SSRA 2XMWA 2VDHA 2HGMA 4KGZB 3J7AN 1U1QA 1JLGB 2QX0A 4ZVTB 3E8OA 3ELHA 5HMWA 1J27A 1U1NA 1P1TA 5E33A 4NPOA 2E9TA 4OYBA 4YFUA 4AQYJ 1C4AA 5H1SV 4IUFA 1B7YB 2A10A 3H20A 1C0TA 4DV1F 3RW6A 1HQUA 1FVSA 4OI1A 2BZ2A 1UJ6A 4B3RF 2GAHC 2LYVA 4OLPA 2YX7A 2YNHA 3ENVA 4H4OA 3C16A 4OZNA 5HLFB 3DCAA 2HHTA 1UFKA 2M8DB 2QMWA 2AU0A 2VBZA 3JSRA 4P9SA 2CKWA 4USVA 4LF5F 1VBZA 1K73T 3WIUA 1Y11A 3KDNA 1UJ5A 5B0BA 2UUBF 4E98A 1VS3A 2XSFA 1M1HA 2PO4A 1HR0J 3H5XA 3R1LA 5B0AA 3MUMP 4LF2A 3JTNA 2DNRA 4AUKA 2COLA 4P52A 1HNZJ 2B8QA 2G2ZA 1JNRB 4ZLJA 5IT0A 4FBUA 1R0AB 3X3UA 3MEGA 1C0TB 4DL2A 2XMUA 1HQUB 2NXEA 1V5IB 1ELOA 3IN5A 4DV4F 2LXIA 4J9SA 3UQSA 9ATCB 3N01A 3EPGA 1E6YA 4BDPA 2YNHB 1ZAWA 2C28A 4LVNP 6FDRA 4H4OB 1G6BA 2F63A 5KFEA 3DRPA 4TU8A 3AY0A 2GMHA 2V2KA 3PJ9A 3HF5A 3W7BA 1X4CA 1C1CA 4DUYJ 2HBQB 5DDRC 3SEOA 3JTPA 4J91A 4X65J 1CVJA 2DNPA 4C0HA 2F3JA 2NS1B 2V8PA 3K8VA 3N6LA 2W2MP 2YWFA 1F1BB 9RUBA 1S1XB 3D66A 3MTJA 2LECA 2BQ3A 4Q43A 4ZCIA 1JXLA 1DJ0A 1SC4B 2HHPA 4LFBJ 3JSMB 2M4MA 2R7UA 5I42A 1TFWA 1DRZA 5KG2A 3D0GE 5KG1A 4NMXA 1S9EB 1WORA 1QE1A 3V6HA 1RISA 1VRUB 2DCLA 2Y0SD 4Y6IA 2ZNZA 2V9WA 4KB7A 3EICA 2FJAB 2ABYA 4DFJA 3C15B 3QJPA 2KVQE 2D69A 2NREA 3G4SS 5KT6A 4J9VA 4AQYF 4OV1A 2FVCA 2OELA 3AAWB 1IBLJ 4KGKA 3DRPB 4RW7A 4LRBA 5DGBA 1LWFA 1PSDA 3AD8C 1RT4A 1P8GA 3M9OB 3FFIB 1UPMB 4NXNJ 3THVA 4PUOA 1UVMA 1U0HA 4KYZA 3A8EA 3ZNJ1 3PCOB 1A0OB 3NWGA 1TL7A 3CCTA 2IYIA 1M1GA 1BWVA 2XY6A 2DXEA 5BYSA 2DGOA 4DOZA 1N6QB 2W24A 2XCPA 3M6XA 1VQPS 4WP9A 5DQIA 2FHJA 2H4WB 1TUWA 2QJ3A 3QQCD 5I42B 3MR3A 3N6NA 1HR0F 4Y34A 3JTOA 4LRAA 2PA8D 1Y7PA 5AXMA 1F5AA 1X4HA 4JI4J 3MR2A 2RUGA 3ILLA 3OSPA 3PG9A 1Q78A 4U8YA 2XMMA 2CJXB 3DLKA 1S1UA 3TUPA 1T9VA 1I51B 1IKXA 3GILA 1HNZF 3RG6A 1U1MA 4M5NA 4XPEA 2J0XA 2W9BA 3E51A 3PNIA 2BE9B 3BSAA 4IO1A 2MGZB 4DV3J 1LQ9A 1SQGA 1KHWA 3CE8A 3MMBB 1KQGB 5E7OB 1LWFB 1XMOJ 3T1YJ 2M2BA 2OMOA 4FDFA 1FKPA 2Q43A 2XB2D 4ALZA 1VMBA 2OFHX 3WX8A 1QLNA 4JI5J 2YKQA 3PJXA 5KFOA 4XPCA 4DUYF 4Q45A 2FC8A 2HWHA 4K8RA 2J9CA 2QMUB 2DXDA 4X65F 2FIUA 5D0RA 1R6VA 2IVFB 3F44A 2B8PA 2BYCA 2FDNA 3FMWA 2ZH4A 1P9YA 4FP9A 2WVFA 1GMUA 2RU3A 2KXHA 4LFBF 2MZ1A 4OI3A 2Z0GA 3VALA 5KFTA 3WZ0A 3HJFA 5E3RA 4DR1J 2HQ3A 1T9XA 3JYTA 2DPIA 2ZKUA 4B3MJ 2B3TB 1U6BA 3HVWA 2MKIA 4KV8A 2IM0A 2RQMA 1FHTA 3HKWA 1ZPWX 2AJ4A 2CG8A 4FVMA 3OTBA 1IKYB 1I3OB 2A6MA 4O4RA 2RB7A 2P9GA 4YP3A 1CC8A 2U1AA 1VCTA 4Y65A 3M8QB 4OX7A 1LXNA 3QJJA 1IBLF 3HZEA 4DZDA 4A8KA 4FF4A 1S1VA 1HNVB 1TL3B 5KFUA 1HBNA 2R7XA 4NXNF 3Q8UA 3KLHB 2UUTA 4Y0FA 3SFUA 1L3KA 4LR9A 4B9SA 1NHUA 3ZTQA 4MK9A 3I4HX 4CNZA 2ZH8A 3HHNB 3RBZA 4DV7J 4DQPA 2YQ1A 1ZYQA 3EGVA 1KQKA 5KFKA 2GQCA 2FVPA 2I1RA 1N34J 1GXUA 2UUCJ 3U1MA 4W98A 4C97A 2VFTA 3BPDA 3JYTB 1CULA 4KPYA 5F9LA 4ICLB 5HMZA 2LLZA 3LALA 4JI4F 2JLEA 1KQSR 4HH1A 1GX5A 1FI4A 1VQ6S 5HQMA 1KVKA 3WIVA 1TK0A 4KIAA 4ED1A 1WEYA 3P45B 4O3QA 1VC6A 5DG9A 1PBUA 2DT9A 2R7TA 3DDNA 3SBMA 4DV3F 2RQKA 2H1YA 1XMOF 3T1YF 2PMWA 3ITHB 3QRRA 4DDFA 5HATA 1HNWJ 3FQLA 3W61A 4I2PB 3ZNUA 3I31A 2V50A 4CO2A 4CTAA 2NXUA 2KN4A 2UU9F 4JI5F 3VHQA 4C11A 3RB0A 2CQIA 4RW4B 1RLDA 5EN1A 3BGFA 3DOMB 3ZFVA 2RE1A 3WBZA 2YVSA 3MAHA 1RE1B 3D28A 3QWUA 3S6EA 3CTRA 1NXIA 2H54B 3RYLA 1CULB 3AFGA 1MU2B 1SKUB 2QO3A 1WJ9A 3HDSA 4GMKA 4DR1F 3FSIA 2ZHAA 2UVVA 3A8IA 4RW6A 2Y1IA 1S72S 2Q66A 3P6YC 4C8NA 2C3UA 3B78A 4V1Ak 4B3MF 1JK9B 4HACA 3NLCA 2HFNA 1PYTA 3FCVA 1F5CA 5KFHA 4NLOA 2V2QA 2I0XA 3HFKA 1HBUB 2EVZA 4JBCA 3PW4A 2W8LA 1ZA1B 4ID8A 2NLWA 3FCWA 1YJNS 3TUZC 2E9ZA 2Z2MA 1FNOA 4TVAB 1C0UA 3MHYA 1DTQB 2ZC4A 2E1MC 3KXDA 2K1RA 2IPOB 2V4RA 3FEZA 1NPPA 1RAFB 4V19J 2BE2A 1S10A 2DRBA 3BR9A 2WBRA 5BYRA 2XY7A 4G1QA 1S6PB 3VAFA 1F3FA 4L3KA 5HVFA 2VBYA 2HRTA 4X4QA 1CEZA 5KFVA 4NZ7A 4DV7F 3PRDA 4ZLNA 2KXFA 2KRRA 2QSFA 4Q5VA 3Q8SB 2ZOFA 1N34F 2XYGB 2UUCF 4K4WA 1FRIA 4RW6B 4LMZA 1PKUA 2VQEJ 3KMSA 4X64J 5DO2A 2Q79A 4WFXA 2FVSA 4NLUA 4ERDA 3MAQA 2N3LA 3CC7S 3QZ7A 1UA0A 1U8SA 1FF2A 2YPYA 4B9UA 4UOCA 2XGPA 3ZZPA 4PYAA 1X4BA 4K4ZA 4AL5A 2Z57B 5AE2A 1REGX 5GMDA 1UPPA 1C0UB 3A12A 3HFVA 3QFWA 1ZETA 1HWLA 1QDUB 2AYBA 1VQKS 2PI4A 4NASA 3BYPA 1RT7B 2V68A 2WAQD 1HLWA 1HNWF 4DQSA 1SQEA 3HSDA 3HT0A 2BE2B 1QJHA 4QPTA 4QPXA 2XULA 4TYBA 3GIMA 3CJ3A 1S9GB 3G6VA 4LREA 2IM1A 3C2PA 4JP8A 1QAXA 2L9DA 2OO4A 4YMEA 2C2RA 3DOLA 3IGNA 4NLVA 1ZS6A 3MMCA 3QRPA 1JMTA 3LP1A 1ZZFA 1IJEB 1ZTTA 2YX4A 3EXCX 1BWEA 2KFNA 5DLFA 1UW9A 4ZLPA 3FEXB 4F0MA 3LOUA 3TZYA 2ROPA 4DCPB 4ZVQB 2VD3A 3SDEB 3HKZD 2JLFA 2KHCA 3P5BP 3HVAA 1GTHA 1VHIA 1KDNA 5ETKA 5FDLB 1YITS 1RTDB 1Q0NA 4OJ1A 4Z7YA 1Y5NB 2FY8A 4OJHA 5DM7Q 2E66A 2BUNA 4DN9A 2QIFA 1BUXA 2HQIA 5L9XA 3J81j 4DWIA 4X4OA 3SQOP 1REVA 2YKOA 2OPPA 3OR1A 2PGCA 4N7TA 3PDNA 4RBVA 3AA9A 3JB9k 2B0GA 4FPIA 2LU2A 2DH9A 1L3VA 3J81U 1FD2A 2XHCA 4DL4A 5D3GA 4C0BA 3RRKA 2EKYA 3BBBA 2CQ0A 4DPTA 1XMQJ 4CLTA 4DF4A 1LK5A 4ES2A 4NLGA 3JQMA 5E0OA 4JI0J 2YKMA 4YB6A 3GMGA 4ATNA 2F4FA 1YJVA 4AXJA 4EGLA 3QNWB 2YNGB 3R9LA 1SI9A 1U1LA 3GTYX 1SL2A 3AJ1A 2VQEF 1KOOA 1CJVA 4OQJA 3HLUA 2CWKA 2ZZTA 2J5AA 5A2QU 4X64F 4CIOA 3T19A 3JQKA 1RXOB 2ZBCA 5ETLA 4YHHJ 3GJTB 3RTVA 2MKHA 1YJRA 1AB8A 1KQFB 2OPRA 2HFVA 4MFBB 5DQHA 4DX6A 1FEEA 2ACYA 1KP6A 1REVB 2OPPB 1D8ZA 2PEHA 4P74A 2KM8C 2MKCA 4B9TA 2UUAF 1TVRA 4JUZA 1VDHA 3JQJA 1WDTA 4V19X 3IAM9 5FLXU 1XBWA 1RABB 4K2JA 3MR6A 2GNKA 2OPSA 4EK2A 1XR6A 1NJXA 3MF5A 3MGJA 3CIZA 3ENQA 3MPVA 1WC5A 3OL7A 3TRGA 3MMJA 5C24A 1CJTB 4RZRA 2X51A 4M5DB 3ISND 2EFOA 5H9EJ 2V6AA 2Y3YA 2LXFA 4Q0BB 4E2FB 2W9AA 2RIJA 4M8LA 1HL6A 3PACA 2QRRA 2PMHA 2ZOMA 3CD7A 4K4VA 3KJFB 5H9FK 1NM2A 3O5TB 3OT9A 1M0SA 3DKDA 5HQLA 2N4CA 2RQ4A 1VQNS 2HEKA 1HPZA 5A8KA 3MOJB 4TQRA 2KJVA 4LSLB 3TOQA 4LFAJ 1FEHA 1F60B 2NR0A 4U8VA 1OY6A 3C19A 3TJ9A 3G6XA 2VA2A 4CP5A 1YRXA 4CQ1A 3U7JA 1TVRB 3H7HB 4BC7A 4ZPBA 3R27A 3EXYA 1FCAA 2RJZA 4FN5A 1UZHA 2HURA 3G86A 5LXRA 2OEMA 1UVLA 1VJQA 2BM0A 4ZP9A 3PW0A 1HBMA 3BREA 3BGOP 4IQXA 2BEFA 5ETNA 4USMA 4HR2A 1RTJA 4CYUA 2LEBA 4OI4A 1LW2A 4B17A 3G87A 2YNFA 3QATA 1FTCA 4PAAA 4HT5A 1OY9A 1MWZA 2GHPA 2ZHOA 2W4CA 3IS9A 4TLRA 2IM2A 4DN0A 1XMQF 2GGPB 4R0EA 3DYAB 4CO4A 3M8WA 5T14A 3Q23A 4JI0F 4CO0A 2JOQA 3H0PA 3PFEA 2BR0A 2WVEA 2J7UA 5F0WA 2L08A 3TJAA 2JWNA 4BCAA 4X2BA 3HJVA 4ZPDA 1RT6B 3OXGA 3A13A 3K5OA 3EGZA 2UXCJ 2GJFA 2E9RX 4A4JA 2IA6A 4NEZA 4WF9Q 5F9NA 3Q89A 4RNFA 1UWBB 3BZQA 2ZEJA 1JX4A 4FPRA 4USWA 3HXMA 4I6WA 4YHHF 3D1HA 5L1JA 1TKXB 1ULRA 1R0BG 2ZDOA 1MMDA 1RI7A 3PO4A 4RWXA 4LUBA 2HHSA 4FYVB 4OX8A 4CYUB 4ECXA 4DS5A 3QSIA 3MEDA 3A3OB 2D3OR 2WSCC 1JLCB 2FGOA 3TUJC 5GVQA 3ZTSA 1HW9A 3G8TA 4QWAA 2IRYA 3I4PA 5KAKA 4ED2A 1WC6A 3H2VE 1S0VA 1YBUA 1FJEB 4ZVPB 3LP2A 5A0YB 2NQPA 2BMBA 3AT1B 3TX0A 1EQ0A 4QWEA 3IGVA 1EARA 4ID5A 3R8YA 4ZMMA 2NXCA 2RDDA 1N52B 1FERA 1ZA2B 2A18A 1T9WA 1NK9A 2W7PA 2FLLA 3B6BA 1KC8T 3NGRA 1EJ7L 5HK4A 2RS8A 2D7SA 2QC3A 4ED3A 2C2OB 2CG4A 4NLQA 3K57A 1GXLA 1VYAA 1VLOA 3PO5A 5CYJA 5IC4B 4DPXA 4LFAF 4K4UA 4RUBA 4I6YA 5A6WA 3CCZA 4OHVA 4G6VB 5DZ7A 2QL7B 3ULHA 3ZO7A 8RUCA 2R2UA 4CLPA 3IRWP 1YG0A 1VC5A 4GVLA 1VRTA 3PJWA 4ZPCA 3F73A 1HI8A 2CNLB 1RT1A 5DDOC 2YKPA 4HKQA 4FF1A 3J80Y 3ZZYA 4UQTA 4OYMA 3QGGA 3FC9A 2HNYA 1SUQA 4OZ2A 4M5LA 3LP2B 1N5SA 3H2LA 1RYSA 1B0VA 3IAS9 2F9JA 1U47A 3G6ES 4NA1A 1BMQB 1YDLA 1F9FA 3NOCA 2VIHA 4X4NA 2DIVA 3W2WB 3EJMA 4UW2A 2XI3A 1JB0C 4PQUA 3DLGA 4ZVSB 1NPKA 3ZTOA 2IJNA 2M0GB 1X5TA 3BB5A 4MKAA 4URGA 4IFVB 2UXCF 1BXNA 3N5BA 2ZH9A 2XQCA 3GPAA 4CLFA 1YK9A 5L39A 4TY8A 4TYAA 3DI6A 2V8DA 2U2FA 4QBUA 5F3TA 3GSDA 4GO5X 3CCWA 4H4MA 4RR5A 5HVGA 2IM3A 3AOBA 4HI2A 3MURP 3H4BA 1UCNA 1RAHB 3HP6A 5EWFA 3V5RA 4IKAA 2LQJA 3VAIA 1WKJA 2HHWA 1Q16B 3RAMA 3GWCA 2KB2A 4KH1B 4MTPA 4U6PA 3DLLQ 4NZ0A 1F3VA 3KLIA 2WK4A 2DB1A 2XLIA 2KTQA 5L46A 3RUBL 4LF7J 1SH0A 4ZPAA 1WF0A 1KSPA 3G82A 1XIQA 3MM5B 4XIUA 3C3LA 2VQFJ 4LFCJ 4NLYA 1AFJA 4DMZA 3ZZ0A 4ILMA 3NMAA 1TELA 1L3UA 1U2CA 3MCMA 1VLYA 3HVTA 1ZZNA 4DX7A 3SSSA 4A8OA 3OV7A 2AGQA 1IR2A 1GX6A 4EI2A 5ADZA 3QIPA 1EAYC 2EKNA 3DRRA 3THPA 1YRTA 3S01A 2V2ZA 4NWBA 2M3DA 2WB1D 3Q0AA 1WEXA 2B9EA 3DI6B 5DQGA 2NZ4A 2VBXA 3EYZA 5J2PB 2FY1A 1TL4A 2K2PA 3G8QA 2O1PA 3GP9A 3I32A 2BXJA 4ZVHA 1B70B 3L7PA 1RAAB 3HHLA 3D1OA 4IYQA 1R0CB 1K8AT 2AEMA 2DBBA 1R27B 2AF6A 4Y28C 4J9RA 2MMYA 1RLCL 2CA9A 4L6V3 4IO9Q 2BJ7A 4M5GA 1X5SA 2OEJA 3DDIA 1S4EA 2MJNA 4NCBA 4A8MP 3KMQA 4RU2A 3OHBA 2XCAA 4CI0B 2C3MA 3IR6B 2CIMA 3JSBA 3G82B 1MW7A 3LA0A 3LW5C 4WFAQ 5HO4A 4LBPA 5J1EB 4DI6A 2AJFE 2HVZA 4NLPA 1WNEA 2YBVA 2JH3A 1RAJA 5A76A 3H42A 2XS2A 3D7SB 1VQ4S 4IG3A 2X1BA 3FSYA 5CZVA 4KKOA 3EDQB 2ZOGA 2DNYA 3WC2A 5B0FA 1EB0A 1WUUA 2MQPA 3ZXWA 4LSZB 4KBIA 3C46A 3I82A 3L3CA 4UQGA 3BPSP 1N32J 2KFYA 1JLAA 3HHLB 3G71S 2OPQA 4C8YA 1SJFA 2QFIA 3AOAA 5ETOA 4RKUC 1YJUA 3AA8A 4UT4A 4ZVOB 1AZSB 4N8NA 1KTVA 1NMEB 1BGXT 4K4SA 1R43A 5HBMA 3IG1A 2IHR1 4FKYA 4DSJA 4WFYA 3NKYA 3ZZRA 2JFKA 3IM9A 1S79A 2IYGA 3F56A 4LF4J 3UD5A 5D0HA 3BF4A 1DLOA 2XLKA 1QAYA 4KFBA 4YUDA 2MQ8A 4LSNB 4DR2J 4OI6A 4BS2A 1RWNB 3K17A 3EE3A 1JLEB 4N5SA 4LF7F 3SQGA 3TZWA 5E3QA 3KLGA 1R6YA 1UEUA 3D0HE 3CCLS 2VQFF 4LFCF 3N79A 1T05B 4OZLA 5AJ3J 2EC2A 2Z30B 2ALZA 3BKUA 2DO0A 2DNLA 4PZVA 2M88A 1HI1A 2HVDA 5IFMA 1UJ4A 5DGAA 2ZFHA 3D1QA 3JSYA 1X5OA 2GIRA 3OTCA 3DLBA 1U2RA 1HWUA 1T94A 2Q6BA 4HTJA 3OLBA 2BANA 4ZK7M 3IMQJ 2OPQB 3TAMA 4P2XA 2MHNA 3HHLD 1XN9A 3CVKA 2PA3A 3OW2R 2XEXA 3M8PA 1FFWB 4JV0A 5HVHA 5IWAJ 1K0TA 4LJMA 4TLQA 3DN9A 2FZGB 3TQ1A 1A9NB 3A3NB 3W3SA 5HBMB 2LVWA 5D6GA 2MZQA 4DV6J 4NLWA 1JJ2R 4QR0A 4NCGA 3K5NA 3C14A 3D6HB 2MQLA 1NRKA 3M2UA 1FTRA 3D5MA 3V4IA 1Q7LB 3E2EA 2M9KA 2FLPA 3P49B 2DNNA 2IAJB 4KFBB 5HJXA 2MY8A 4Q2MA 3VGSA 3B4DA 1HNIA 3SQGB 2CQ2A 4I2QB 2KRBA 1H38A 3FRZA 4P75A 1YZ6A 1YHQS 2P6SA 4ZN3A 2V63A 4W90B 1S76D 4URQU 3VWSA 5EDWA 3DDKA 3H90A 3P3DA 1ZPVA 4ANCA 4HTIA 1U1RA 2XMKA 2BW7A 5ETPA 5KFRA 1RWVB 2ZE2A 3I0SA 5T41A 3N6MA 1N32F 4Y2KA 3Q8VA 5F8MA 4OHXA 4ANEA 4J9QA 4PRFA 2V67A 5DG7A 3W5XA 1BHNA 1X4EA 1NDLA 3ZTRA 5K8OA 2VHGA 2OFGX 2MEWA 1S99A 2AV5A 2DGWA 1DBDA 4JYAJ 1VBYA 3CUNA 1LWCA 3CMES 4LF4F 1LWEA 2HWTA 2C2ZB 2VICA 5M2UA 1X4AA 3KHHA 4DR2F 2ZUGA 4F4ZA 2HHQA 3M7VA 5E5NA 4ZP6A 4DFMA 2HMIA 3FUYA 3K2YA 5C25A 4U7UK 4J9OA 2C3YA 2LXUA 5LMUJ 3MFIA 1WI8A 3BN7A 3M1VA 4DR5J 2HSEB 4ENOA 5AJ3F 2E5HA 2RD5C 1QSSA 2YTCA 3BGLA 2O5DA 1PIEA 4NRTA 1H6KX 3LAKA 4IFYB 1Y5LB 3M05A 4E0DA 1YX2A 4ANDA 4DQQA 2Q6CA 4UY8T 3OVBA 1UVJA 1OPIA 3HO1A 5JVGQ 1JLFB 1AA1B 3NNCA 2EFQA 1B0TA 2EXUA 5IWAF 3KLVA 2WVBA 1BQMA 5CYQA 1S7HA 2VUGA 1ZM3A 2RU9A 3TNVA 4DV6F 4DL5A 1N0VC 2FD2A 1FXRA 1LXJA 4CO1A 3DHXA 2F8EX 3BH6B 3DLEA 1TKTA 2QA2A 1U09A 2RRNA 4MK7A 3GCXP 1KVJA 1LWEB 4A8FA 2JEGA 1FT8A 4QU6A 3NCRA 4ZCMA 4DL0C 3IA0A 1PC4A 2DGTA 3HHKA 5KFMA 5C25B 2XWYA 3B4MA 4DPUA 3QFHA 3KK2A 4OYIA 4FYXB 4AT1B 2IC3A 5J2NB 1IWAA 1MG7A 2ZZMA 3UDVA 2EK6A 1RK8A 4RUCA 5GAHU 4USUA 2CDRB 3LANA 2GZOA 5IXUA 4K0KJ 4KY3A 4F3OA 3F41A 4PABA 4F3MA 3KK1A 3M2RB 1RA7A 4QWDA 1RAOA 3W66A 5I3UB 4KT0C 5KFQA 2AQ4A 1YVFA 3D6TB 3NGSA 2YWEA 4OZ3A 3LWMA 3RBXA 4DR6J 1K1QA 2EW9A 3B8HA 4PG4A 2ZJQQ 2JEIA 4F0HA 1XK8A 3R5CA 5KFZA 1U25A 4OJGA 4EBDA 3VV2B 4JV5J 4N56A 5F8HA 4HHHA 2KT5A 1VI7A 3MD1A 5KFJA 1SKWA 3NP5A 2J9DE 3QAEA 4G3IA 2FLNA 4C8MA 3Q2SC 2GVZA 1FDAA 1HWKA 4FYYB 4XK8C 1N36J 4JYAF 2BM1A 1PYSB 4NYOA 4HVZA 2MZTA 1C4CA 3ETOA 3LF0A 2VOPA 1N0UA 1HA1A 3HCXA 2CPDA 2ASJA 3KLFA 2XGQA 4DL6A 3KLEA 1FRLA 2Q3PA 4C48A 4RNNA 5IS2A 1HQEB 1JXVA 2ZBPA 2OTLS 3MZIA 4C9DA 3C6TA 5LMUF 5J2QA 3KK1B 1NKCA 4DR5F 3M30A 1WD6A 2KFZA 3W62A 4JI8J 4EFAC 2DY1A 4HL9A 2Y1LB 2HLTA 3IM8A 2IA0A 3KJVA 1RU1A 4CH7A 2EEYA 4I69A 2EBGA 5HAOA 4CNYA 2MY7A 3LUYA 3ILJA 3TQEA 1FRKA 3CCRS 1AYEA 2ZJRQ 4OYZA 2EFPA 3NS7B 1NHVA 4UTGA 6AT1B 4IOAQ 3ZZTA 1P1LA 2J9DA 4P7TA 4LQ3A 1ZTWA 2P2CB 3MM6B 5GADU 2L9NA 1Q53A 4N76A 1UMJA 3R5BA 4NE9C 3TA1A 5BR8J 1R8BA 3T1HJ 3PZPA 1T0TV 4KHPJ 2B4PA 4J5OA 1UZDA 2ZH6A 3G8SA 2PC6A 3GYNA 2CRLA 5BJRA 4DX5A 2P5VA 1S77D 3KLEB 3CJ0A 3TZXA 2HQDA 2ZBQA 4USTA 1U45A 1GH8A 1N5YA 2R2RA 1VJWA 1QD1A 1N48A 1K1SA 4DUZJ 1FFSB 2DR9A 2VG7A 1OO0B 2YKAA 1NJWA 4B02A 1YBAA 4H4KC 2RUSA 2V0NA 2AJQA 3KJVB 2XLJA 3QSYB 4RW8A 1V3ZA 5LXYA 4RW9A 2NXJA 2IDEA 1T03A 2HVHA 1D9DA 3KDOA 1L3SA 1KOHA 2FHMA 3T6JA 4DR6F 3VGVA 3CIMA 1DURA 4G1IA 1PO6A 2YXLA 3R5DA 1CJKA 4CLWA 3PHEA 3FVYA 4USIA 2JC1A 2MHEA 4JV5F 3A8JA 4KGMA 1NHKL 4TN2A 1KFDA 1WC3A 5DDQC 1HYSA 3QO9A 1FKOA 2CZ4A 1EHWA 3FNNA 3OR2A 4O44A 1FE4A 2CQBA 5ITHA 2H5JB 2HS0A 2VG5A 2ZH2A 2YNIA 2EFGA 2ZDPA 1BY9A 4HH0A 1YWXA 2K8GA 4JV1A 4MYTA 4XO0A 2MZJA 3BJYA 1WC4A 1N5YB 4O3SA 3GJQB 4R5PA 2L9WA 4F2RA 1FX2A 5FJ4A 2VG7B 4X4SA 2HAFA 3IRXB 1NZAA 4B3OA 1Y0HA 2FTRA 2G13A 4EYIB 3HSGA 4F0KA 2P6TA 4RW8B 3CCMS 3MM7A 3W5ZA 1XMBA 3I0RA 1U48A 4OI0A 3E01B 4KH0B 2CJQA 4DX8H 4KAIA 2DISA 4ZHRA 2VZ9A 2H65B 1WOPA 1WC1A 2Y1RI 1IBCB 2AP6A 1RWKB 2JRSA 4PQAA 1U02A 3QO9B 1MWQA 3IBCB 4D3GA 1WTBA 2AYEA 2J6SA 2CAJA 3O6QA 2ADBA 5BR8F 2G0CA 3T1HF 2XSJB 1TL1A 4MH8A 5IV4A 4KHPF 2WTFA 3R6GB 4UOGA 2BBEA 2F7VA 4WIIA 3W60A 2PN6A 3CGIA 1K44A 3LPEA 4L74A 3I5CA 2E1RA 1AUDA 3R5GA 3CULA 3Q8QB 4IG0A 4ILLA 2RMLA 1X60A 3GQCA 4B3OB 5B7WA 4QW8A 1RGVA 1N5QA 4KJIA 3AXMA 4NL5A 1RSCA 1JQGA 5HSPA 4DUZF 4JI2J 3GFHA 4GKJJ 2OMLA 4KSEB 3DRSA 1PC5A 4USJC 1D8YA 2H9ZA 3CPWR 4WYWA 4UY85 1QUVA 3ET6A 4F2SA 4F04B 4IDKA 1FRHA 3IO1A 3EMTA 3PRVA 3W2VB 3CDWA 4DL3A 2XO7A 3EZ5A 1RWXB 1YJ9S 3CMQA 4PYDA 4WE1B 2KU7A 3BGUA 2LQBA 3UWTA 3H5SA 4ER8A 3MEEB 3D3BJ 3DRXA 3UVJB 3IC1A 4J37A 3DM2B 3IR7B 1S0OA 2RQCA 3RBEA 2H5EA 1KKHA 2V2VA 4MMOA 4RUHA 1URRA 2ZZNA 1LFWA 1RAEB 5LSLA 5EX0A 3LWLA 4IH6A 3CNQP 4OLOA 4Y00A 1KWMA 2B9WA 2MQMA 1H2VZ 2GIFA 1BQNA 4KGVB 4ITSA 3VF0B 4WKYA 3OVSA 1RWUA 1N8RT 1G2EA 3K89A 1YIJS 2VA3A 5LM7E 3NAHA 1NCLA 3NGUA 1KVIA 1YBTA 1BD6A 3R5JB 2ACMA 5B0CA 2WW4A 1EP4B 3VTIA 2H51B 1K9MT 2GS8A 2QTWA 3ET6B 4TKTA 1KTQA 2DGSA 2HZAA 1XTZA 4X4RA 4EZ9A 1KD1T 3DGPB 4FF2A 5LJ5Y 1OSDA 1U24A 1YRUA 1KRPA 3EVWA 1E6VA 2ASYA 3NY0A 2EWHA 2NSBA 4CLKA 2DGXA 4Q8FA 1TU0B 2RDJA 3OVAA 4U67Q 5JJBA 3UD4P 3LTOA 2HNDA 4DPYA 4WBFA 4Z2XA 2OTJS 2E29A 4LF6J 2HZCA 2LP4A 8AT1B 4BBYA 5LJ3Y 1FDDA 4ZJLA 4F4KA 1I6JA 3LH2S 2HQCA 2R8IA 1BQNB 4FS2A 1NK5A 3C16B 2N4DA 2C2NA 3M6VA 2I6WA 1TL5A 3AD9C 4QIFA 1T3NA 1B3TA 1EETA 3OD2A 3TEGA 3KJQB 5HANA 2LCWA 2X7IA 2YWWA 4USKA 3PX4A 2JEFA 4QCLA 4CM2A 1B64A 4C8LA 2QT7A 3UNYA 1WHYA 2J6UA 3O2IA 5KG3A 1M5SA 2HFSA 3PYDA 2HYIB 3NXZA 2RHQB 2MTLA 2ATCB 4JI2F 1AUSL 3J80U 4GKJF 3G96A 2J7KA 4RX6A 3IWNC 4R0JA 3CO9A 1FK9A 5CQGA 1DQ9A 5E41A 3NMRA 5I4MA 2AIRB 4DSIA 3VR1A 1I5OB 1GEHA 2IFXA 4LBHA 4NYPA 3HULA 2HBYB 3RR7A 2BJDA 3MEGB 3FCHA 2HNDB 1J5OA 2LQ5A 3C8YA 2N7CA 1VQYA 3V81A 2KZZA 3KKFA 2VJUA 1RHRB 1E6YB 1S1WA 4P71A 2RF2A 2KG0A 2CXEA 2XNRA 4QIVA 4LF1A 3CCVS 3C6UA 1D09B 4Q44A 4PXBA 1HBOA 3DFEA 3VGUA 1QTMA 4E8UA 2EI5A 2FLOA 3KK3A 1C1CB 1JJCB 4OX6A 2VASA 3BYRA 3FMBA 3VAGA 2BX6A 5CXTA 2OKQA 2R2SA 2OSQA 3PHTA 3Q8RB 5IQQA 3PM9A 3OQ2A 3LP0A 5KTQA 1SL1A 3OTOJ 2B6AA 4EZ6A 5F8NA 4I6AA 1SB6A 2OEKA 3EGNA 3GCWP 1RHMB 3KTQA 1TKZA 1W2BR 3DOKA 3GLJA 3CD6S 2GHVC 1FE0A 4ETXA 2B4VA 2YWKA 4MT1A 1D9AA 1QE1B 3T5LA 5C5JA 3W8GA 3V6KA 4ZVGA 1J5OB 2HQGA 5F8LA 2M70A 3K0JA 4KO0A 3WC0A 4YEAA 1JLBA 3CJRA 2RF2B 3HHEA 1U8WA 1VIXA 1VK8A 2C1EB 5IV3A 3MCSA 2E1AA 4CLUA 1VR6A 1HBOB 2V4QA 1HARA 4WFZA 4RW7B 2EG2A 4NA3A 1RT4B 1U4BA 4LF6F 5BYQA 1I1GA 2BJ8A 2ILZA 4PUOB 1U0HB 2R42A 4NXMJ 2IIHA 3OSNA 3D9BA 4DLEA 2JFDA 3LP0B 1TL7B 3VZHA 5FD1A 2E5JA 2J0SD 1TTHB 2HGLA 1IQZA 4GVBA 1ROFA 3I9V9 4WIQA 2FC9A 1KONA 4EMDA 3NNAA 3MPDA 2C2MB 2HIQA 2HNZA 5F3ZA 1IKVA 1LWXA 2J9EA 1X9MA 4K59A 1H0HB 2DXFA 3CJ8A 1T8EA 2DKOB 4O3OA 2MZSA 2MKKA 1NKBA 4PXCA 3MM8A 3DLKB 4QQBA 1S1UB 5CYMA 4ECZA 1IKXB 3GSIA 2KZMA 4OZ0A 3QT6A 4KO0B 1YKWA 2W9BB 2V8GA 5J2MA 3R3TA 2QEXS 2FZKB 5IT4A 1PYOB 2E5LJ 4NA2A 3L7OA 2W2PP 4C3KA 1DQ8A 3TUIC 2QN6B 1FKPB 4AFFA 2LDYA 1HFEL 1NSQA 2OI2A 2IBKA 4I67A 3UCZP 1DQAA 4DCJB 4NYZA 2LA6A 3OTDA 2B7BB 1WEZA 4EBEA 1SBRA 5HROA 1RP5A 4GC6A 2XMAA 2HHHJ 2ROEA 4WYLA 4FS1A 2IVMA 1QVGR 2HHXA 1Q4RA 2X1GA 4NEYA 4FNHA 1QTNB 2FHJD 2ZVIA 4AYBD 3TAQA 1SC6A 5T7LA 5CCLA 1IR1A 5F8IA 3MM8B 2KH9A 2AEJA 2DNQA 2Z2LA 1YJ7A 5CYMB 1T3OA 1DZ5A 5KFYA 4KGXB 3MMAA 1LFPA 3POTA 4KV8B 5RUBA 1L3TA 5J2MB 4ED7A 4C3MA 4NLTA 1JLQA 3I9ZA 2CNNB 2KO1A 3QGIA 2CPXA 2NSCA 4B9LA 1N5VA 2AKWB 1HQ2A 4NMLA 4PXEA 1WC0A 3A3PB 2ROGA 3PKMA 2O66A 4N77A 4FXDA 1S1VB 4KR0B 1HBNB 1H2UX 2W7AA 5KFXA 2RT3A 4IRDA 2UP1A 1H7WA 4NXMF 2HG4A 4WP3A 1WKKA 2Z2YB 4P73A 1TMJA 4OV6A 2B5JA 1SPBP 1BE4A 1SH2A 5G0RA 4KPCA 1S6QA 4C8ZA 2ZH1A 1NB2A 4M5HA 3BO2A 1NK6A 3M8SA 4F8RA 4XAKA 4ECSA 3MFHA 4J9LA 2E5IA 3CD5A 2E1PA 1O51A 3HD1A 3MECA 3BEGB 5HI7A 3J7ZT 3MMAB 1XQIA 4OZ1A 5JMNA 3U1LA 3T1AA 5KFCA 2A0FB 3CSKA 4M63A 2IDLA 4J9MA 1YQHA 3UW1A 1Q8IA 2WSFC 2YPZA 3VQSA 1KLMA 1M5OC 4ZITA 2P8IA 1KS2A 2FJVA 3UR3C 2GX8A 4PWDA 1WOOA 2DHXA 3A4TA 3UFCX 1IR0A 2E5LF 1MWYA 4I0WA 1RA6A 3S8SA 4GKKJ 3RAXA 3AQPA 3O44A 3WHIA 4LRDA 1OQ6A 5F41A 4QYZK 3GYXB 2EPIA 5ETMA 3RB4A 1NUEA 2NUUG 4ZCLA 3E3XA 4CLLA 1WELA 3MAAA 5C42A 5MLCV 4CTAB 2F8MA 1X7VA 1RBLA 4IRCA 1TQLA 2GQ2A 1S5ZA 5CHCB 4C11B 4O4GA 4WTOB 4DV5J 5G0RB 1S6QB 3OFGA 4PXDA 2I38A 3VVUA 2RDIA 3LGMA 1FWPA 3H59A 2HHHF 1NK0A 1Y3KA 2DHSA 4RJVA 5F8GA 4DG1A 3RAQA 3R97A 3MECB 5F8JA 4RPFA 4L3NA 7AT1B 3MUTP 3MR7A 3O1LA 1TV6A 2OLWA 5LOQA 2UVRA 4J9KA 1Y9OA 1FRMA 1VBXA 3KUGA 3QT7A 3ONQA 4ED6A 4HACB 4X4VA 2MKJA 4DCOB 2RKIA 1VFJA 1H3DA 2QLWA 1FRXA 1RT3A 3RZAA 2BV3A 2ZBIA 1FWKA 3M6WA 2WZ1A 1QM9A 1RWMB 4OYWA 3W63A 4IOCQ 1UW4A 3PKYA 2MQOA 1DTTA 2HBZB 3BDPA 3P5TL 4DFKA 4YN3B 2DCUB 5GMKa 2UVUA 2KT3A 2DY9A 3T9ZA 2K1RB 2R7RA 4DV1J 3W9JA 2VFUA 2IJRA 3PRBA 3RRHA 2M5YA 1ZAVA 1Q86T 1H72C 1NK8A 1U6ZA 4KC5A 4G1QB 3MR5A 2BOPA 1YLXA 3GV8B 4C6AA 2RRAA 1F6TA 2CUYA 4ECUA 3P96A 3ZC4A 2D3O1 2VBWA 1YJWS 3KHLA 3BBCA 1TV6B 2WVCA 3MDFA 2CZVC 4DPOA 5HL7Q 4CRJA 4OJ3A 3H8YA 1YSJA 3DLJA 1CC7A 3F0NA 3FSXA 2RKIB 5HMXA 2NUHA 4B9MA 3VZIA 1RT3B 3BH7B 5M2RA 1R8PA 1RJJA 2XBPA 1XJWB 2W1BA 1H7XA 2D3UA 3D2WA 1WF1A 3OL6A 2B56A 1C1BA 2DGUA 5B09A 1KNZA 1OYDA 4J90A 5C7PA 2JZ5A 4GKKF 2MQNA 3VGTA 1URNA 5A8WA 1TMMA 2DH7A 4URSA 4U9RA 2PDAA 2DD8S 1UP1A 2XS7A 5H9FJ 4LBIA 3PW7A 5AXKA 2HFOA 1NK7A 1O5JA 1HWIA 4FZVA 4YDXA 2BRLA 2QYGA 4F26A 4PKDB 4DV5F 4TY9A 2HAIA 2KL8A 1DY3A 2UXDJ 4UUXA 3FDSA 3TVKA 2F65A 2JVRA 3DOLB 3TA0A 3TVZA 2FJEB 3MMCB 2BE7D 3TEHB 3LP1B 5KFFA 2P9CA 3JAMY 3OFHA 3R7NB 3SYZA 3H2UB 1N88A 1OMSA 2HS4A 2LU1A 2F1FA 3I5AA 4FXWA 2FJDB 2R8JA 5KG4A 1ZM2A 4W92B 2DNKA 2HFUA 1QSYA 3EPIA 3GJRB 3BQ0A 1VQ9S 3R7BB 5IQ6A 1U1KA 4ZVFA 4AL7A 3GZ7A 1IBMJ 3GFYA 3I96A 4P72A 4ECQA 2R4FA 1DARA 5B08A 3UCGA 3M32A 5DS7A 4P6QA 3QRQA 3PFOA 4PWWA 4BLGA 3OR1B 2JLGA 5AXLA 4KTQA 1R0AA 2DITA 3FGVA 3MEKA 3UCUP 1VISA 1N4LA 1RQ0A 2FHOB 5D3GB 2VPWB 1P6TA 3OBIA 2CADA 2ZNYA 5D4NA 2ZBRA 1YTYA 5DG8A 1Q7YT 3GYGA 1WDDA 3MM9A 3BO3A 1VIOA 4L73A 1VQ8S 3DC2A 1LV5A 2NPIA 4WP8A 2YKMB 3RGIA 2Z58B 2ERRA 2L3MA 1Q8KA 4K5SA 2XY5A 4NLRA 4FYWB 3QBCA 3CCJS 2V69A 4I64A 1NDKA 3K5PA 1FDBA 1S1XA 1CJVB 3QGPA 2MQQA 3DGVA 4HLBA 2Q1LA 3DXSX 3R2DJ 1RU2A 3VAJA 3CJTA 3JSMA 3T6BA 2PIIA 3Q8YA 4ZPVR 2K7KA 3M32B 1V9OA 1FJCA 1X4DA 2GIQA 2OPRB 4ED4A 1X9SA 4B9NA 1S9EA 5AT1B 2RVJA 5EWGA 1BC6A 1VRUA 2AMCB 1UWAA 1NK4A 1WSVA 2VB6A 3HT3A 2OSRA 5G4DA 1QVFR 2EG1A 1SQFA 3C15A 3IWXA 1HD1A 3FZ2A 2DPJA 1S9FA 2OPSB 3TX8A 4M1KA 2J8AA 2M7SA 5B0GA 4CLSA 4DEZA 3I55S 3MM9B 2AX0A 2K7JA 3CB4A 3DXBA 2M52A 2PT0A 3FFIA 1FD8A 4OMFG 2UXDF 3OPKA 5C24B 1RTHA 1WHWA 2XMTA 4C4WA 3CCSS 1YZ7A 1UVIA 3J7Z5 2MB0B 1MROA 4BWMA 2CPIA 2BJEA 5KT5A 3U1NA 3Q2TC 3SCJE 2A2DA 4Q2LA 4J7CA 4CWBA 2FUG9 3K8WA 1N6QA 2ZJPQ 4PR6A 4ZVEA 4Q7AA 4QWBA 2JHEA 3MCNA 1PAUB 2IY5B 1HPZB 5A8KB 2WVDA 3PXGa 3Q86A 4N8OA 3GR0A 5KFNA 1OJ4A 4YB1P 1IBMF 3H5YA 2VKZG 5HP1A 1SXLA 3W65A 4DJBA 1IKWA 2GC8A 3TWZA 5AXNA 1RCXB 2RH3A 4RNMA 1MLAA 3AXKA 2V5HG 5DRKA 1UFLA 3SCLE 3QYYA 2MGZA 4JI1J 3W9HA 1HBMB 2EBEA 4F67A 2QV6A 4YS2A 4O3RA 3JS9A 3MMBA 1RTJB 1LW2B 1CPZA 3UDCA 3TZZA 5EHHA 2W25A 2VC1A 2XNQA 2YNFB 1IVZA 5I3QA 2KM8B 3T41A 4ZPWR 4PWUA 1M5VC 5K8NA 1RTHB 3IS9B 3KG4A 1GMWA 4B9VA 3BSOA 3TVYA 1MROB 1R31A 1DHMA 4GC7A 2V8HA 1CBKA 3LGHA 2FJWA 3OJUA 1HHSA 2AD9A 4FBTA 3EM1A 4OYOA 4K4XA 3CMAS 2R9LA 4YR2A 1WI6A 1G1XA 3MOZA 2BA9A 5KFIA 3V4MA 2CJKA 1D9FA 5HP1B 4ZKAA 4WU2A 1WSRA 1IKWB 1PILA 1KFSA 1F0XA 1Q79A 1KLNA 3QT8A 5J1NA 1U7LA 3GV7B 4O23A 3EVMA 2DNZA 2HGNA 4ED5A 4WXWA 3MTKA 4WK3A 5KT2A 3QPIA 1IKYA 3MEDB 3N0VA 3M4XA 2XO6A 2H3EB 4K4TA 3M8QA 4NLDA 2IJFA 4FVCA 5B0EA 1EKRA 1AW0A 2VL1A 4HDGA 2KT2A 2UU9J 1HNVA 4JV2A 1TL3A 3AOCA 3KLHA 1DAXA 2F40A 3NGTA 2DJWA 2KYXA 3G2XA 4CO3A 4ID5B 3NNHA 2AJ1A 4QJVA 5ETQA 2VJVA 4LR7A 2CWXA 1S59A 5HQ8A 1HI0P 3W1YC 1QSLA 3MPWA 3QIDA 2MSTA 1WHXA 2DK2A 4XTTA 2YQ3A 2E44A 2WB4A 2Y8WA 5LMNJ 5SUHA 1Z2LA 4B3SJ 1U26A 1JKHA 4ICLA 3BSNA 2HPUA 4A8QA 1HWJA 2KYZA 4IR1A 3WX4A 4KE5A 2XZWA 3BSCA 3P8BB 4M5KA 1TAQA 5ETVA 3SIPB 2C2EA 3Q8PB 4DU8A 3NG8A 2OJ3A 2RRBA 1VRTB 5CD4H 1RT1B 4OZ5A 4JI1F 5MAOA 1IN0A 4EO8A 3VVTA 3W8PA 3PX6A 1ZM4A 5K9FA 2HHUA 5J1PA 2GA7A 3ITHA 1UETA 2HNYB 1SUQB 3RB6A 2F4VJ 4P10A 1Z4UA 1GMWD 2VOOA 4I2PA 4YB7A 3FK4A 2CFXA 2GV1A 2YH0A 4OZJA 5CZXA 2QLFB 2GCFA 4AL6A 2JEJA 1B99A 3V2UC 4RW4A 4PQUB 1U1PA 3DLGB 3DOMA 2IBOA 2OP5A 3KNGA 1Q82T 1FJ7A 2D74B 2DO4A 2D41A 1NSKL 2CJAA 1GFWB 1JKHB 2VPXB 1MU2A 1NH7A 5EWEA 2I9SA 4TY8B 1RTIA 4S0MA 4A8SA 1Q1KA 5IM0A 2HRYA 4RUAA 1UAWA 1IJFB 2UUWA 4X62J 1GAOA 4H4MB 2RSQA 3TI0A 2W4DA 5KOXA 3GIRA 4XDCA 2WHOA 3SCIE 4ECYA 1G7CB 3ILOA 4X66J 4M95A 1R3NA 4EUVA 1F9HA 1X5PA 2LQ9A 4I7FA 3D6MB 3IBWA 2EFVA 3CW2C 3J7YI 1HBUA 2KVIA 2OH2A 4QIWD 4QR2A 2Y8YA 4RNOA 4CDIA 2R7OA 2AEFA 3W9IA 3L95X 4C8KA 3KLIB 1U6FA 1IM4A 2UVWA 1DTQA 3P4UB 3OXFA 2X3GA 2PD1A 4RWWA 1IUJA 3MWBA 1RDRA 3N9UC 1OQ3A 2ZITA 1S6PA 3HVTB 4QIEA 2WONA 1SJRA 1LEOA 3J7YU 3DRYA 2LFVA 2K3KA 1M5HA 1JWWA 2D3ZA 3QIPB 2MLZA 4WZMA 2CQGA 3DRRB 1EKSA 4DS4A 2D9PA 3CJ2A 1RTIB 2GJIA 5IM0B 1NJIT 5LMNF 4QWCA 1S57A 2CPHA 4ZIWA 1NEEA 4B3SF 3BKTA 4A8XA 5K14A 5IT9Y 3BGRA 4ES3A 1GXTA 2GO8A 3WQPA 1KBRA 2YX1A 4I7FB 3R7SB 2QYCA 2O67A 4DQRA 2QA4S 3GIIA 4K2XA 2VFVA 2W8KA 4Z7CA 1RCOB 2O3DA 1T9TA 2E7XA 1XERA 3HX9A 3IFEA 3GJSB 2MXYA 4UZCA 4RU9A 1NB7A 5DZ6A 5E3AA 5D15A 3UI3A 4KHMA 4TXSA 4MYUA 3X1LB 2E5GA 2XZTB 1M5KC 2F4VF 1RT7A 1AT1B 2CQCA 2IMWP 2PFDA 3H98A 1HD0A 2FGCA 4AE5A 4R25A 3ISNC 4UOHA 1GK8A 5KFLA 2JDJA 4C7QA 4DSFA 3RRGA 2WONB 4HT7A 2L48A 5CAAA 3W5YA 1S9GA 4YY3J 2ADCA 2A2CA 1U2FA 4IG3B 4DV2J 2HK3A 5DETA 2MSSA 4KKOB 5D0EA 4DR7J 2VKRA 1S7IA 2VV5A 4F4WA 1TFYA 2FB0A 2DR6A 4Y2CA 4X4TA 2ZKTA 2DGVA 2XMVA 5K14B 1JLAB 2QE5A 3BGRB 2HW3A 4N47A 2RNEA 2X1FA 3HD2A 4ZDNA 2YKNA 3SDEA 4X62F 3NOGA 4A8YA 1SKSA 2BDPA 2QMXA 5CABA 1RACB 1Y4ZB 4X66F 4IQMA 5FDLA 4ED8A 5D8HB 1RTDA 3IG1B 5F0UA 2HFZA 2DNGA 2C3PA 2W01A 1FVQA 3CC4S 2UUAJ 3SI8A 4BWJA 3AH6A 4FF3A 2ASLA 1CG2A 3DHWC 2Z4PA 3JXOA 3PX0A 2I5JA 1DLOB 2JNJA 1MSWD 3PW5A 3DU5A 3QLHA 3WDOA 1A7GE 5JUMA 5U47A 4QW9A 1X9WA 3K59A 1WG5A 3KLGB 1V6HA 3GIJA 1RAIB 3CCQS 4ZVRB 5L9NA 2NPFA 4YQWA 5CH7B 4O0NA 3UN5A 3FBEA 2G9OA 2I2YA 4DLGA 3NGDA 2YH1A 1NSPA 2BANB 1FA0A 3DU6A 1HW8A 3ISZA 3ENAA 2WW8A 2YNGA 3TAMB 2YKNB 3A8KA 4JOUA 1VHFA 5HN0A 2YQ0A 3M8PB 3GE9A 2F9DA 3M2VA 2DHGA 5K5MA 1W2IA 1RHUB 2MKYA 1CJUA 5ETSA 4NCGB 3C14B 2JJ4D 2CJYB 5DLGA 5KT3A 1V3RA 3M2UB 4WWSA 4MFBA 3V4IB 6FD1A 4IOBA 4CH1A 5THWA 2I5JB 3GU0A 8ATCB 1SIZA 3QLHB 4OHZA 1HNIB 2ZH5A 4RLEA 5E3PA 4CLYA 3QT5A 3CJ5A 4LVOP 2ILYA 2VPZB 3SV3A 4CCHA 2QSWA 4LT6A 2VDIA 1QAJA 1F2GA 2VU5A 3ADAC 4YY3F 3DMJA 4MKYA 1PJ7A 4DV2F 2FJBB 4DR7F 3IBFB 4JI3J 1S48A 4ECTA 1CJTA 3FBCA 4O0IA 1KHVA 2DNOA 2GW8A 4M5DA 2BW2A 2XWXA 3EDRB 2MYFA 2V9KA 2ZE2B 3I0SB 4ZLLA 4Q0BA 2DVIA 3S7RA 2KHDA 2AJ0A 2PSZA 3OFFA 3M2VB 3QGHA 4RL1A 3VQTA 2VC0A 1WACA 2ZD1A 5I3PA 3ZZZA 1CJUB 4EO6A 1NBEB 1SVDA 3GG0A 5JVHQ 4LSLA 4TQSA 3AB4B 5LSOA 2FPHX 5GAHI 1HNXJ 3QMQA 4YR3A 5KG0A
chains in the Genus database with same CATH topology
1ZZNA 2ZH7A 5GAGU 2ROEA 3BQ1A 3SSRA 3SSSA 1LWCB 2XMWA 2YWHA 4A8OA 2HGMA 3OV7A 1U1QA 4WYLA 2AGQA 1GX6A 4FS1A 2IVMA 1QVGR 1JLGB 5ADZA 3QIPA 2HHXA 1Q4RA 1FXDA 2X1GA 4DQIA 3E8OA 2LA4A 3DRRA 4FNHA 5HMWA 3THPA 2FHJD 1YRTA 3S01A 1U1NA 5CA5A 1P1TA 2N3OA 3LO3A 4AYBD 4NWBA 5E33A 4NPOA 2M3DA 2E9TA 2WB1D 3Q0AA 4YFUA 1WEXA 1C4AA 5B0DA 3DI6B 5H1SV 5DQGA 3TAQA 4IUFA 2NZ4A 1SC6A 2A10A 2VBXA 3H20A 5T7LA 5KFGA 3EYZA 1C0TA 5J2PB 4DV1F 3RW6A 2HMIB 1TR0A 5CCLA 2FY1A 1HQUA 5F8IA 3MM8B 1TL4A 1FVSA 4OI1A 2K2PA 2KH9A 3G8QA 2BZ2A 2DNQA 1UJ6A 2Z2LA 3DMJB 1T3OA 2O1PA 5CYMB 1DZ5A 4B3RF 1TP7A 5KFYA 3I32A 1SH3A 2BXJA 4ZVHA 1UKUA 3M1VB 2LYVA 3L7PA 4OLPA 2C2DA 2YX7A 3MMAA 3HHLA 1LFPA 2YNHA 3POTA 4KV8B 4PG6A 1L3TA 3D1OA 5J2MB 4ES1A 4IYQA 4ED7A 3ENVA 1K8AT 4C3MA 4NLTA 2WCXA 2DBBA 4H4OA 1R27B 1JLQA 2GGPA 3VAKA 2AF6A 1MNEA 3DYAA 4Y28C 3I9ZA 4OZNA 5HLFB 3DCAA 1S6OA 2KO1A 1S6UA 2HHTA 4J9RA 3QGIA 1X8DA 4FXVA 2MMYA 4L6V3 7FDRA 2CPXA 2NSCA 2QMWA 2WRMA 4IO9Q 2M8DB 4B9LA 1N5VA 2ZC3A 4NMLA 4PXEA 2AU0A 1SV5A 2VBZA 3JSRA 1S1TA 2CKWA 2JX2A 4LF5F 1VBZA 1K73T 3T3FA 2ROGA 1X5SA 3BDEA 1UJ5A 3PKMA 2O66A 2FVRA 4N77A 2ZD1B 1D0EA 5B0BA 2UUBF 4E98A 1VS3A 2MJNA 4NCBA 4FXDA 2CVIA 1RT6A 2XSFA 1S1VB 4A8MP 3KMQA 3QZ8A 3OHBA 2XCAA 4CI0B 4RU2A 2PO4A 4KR0B 1HBNB 2C3MA 3IR6B 2CIMA 1H2UX 3THTA 3JSBA 1MW7A 2W7AA 5KFXA 2RT3A 4P7VA 3H5XA 3R1LA 1BQMB 3LW5C 5CYQB 5B0AA 4IRDA 4WFAQ 5HO4A 2DR8A 2UP1A 1OSCA 1H7WA 1UWBA 4NXMF 3MUMP 5D78A 2HG4A 5J1EB 2AJFE 3JTNA 4MK8A 2DNRA 2HVZA 4NLPA 2B5JA 1QUPA 1WNEA 2JH3A 1SH2A 1TKXA 1RAJA 1TKTB 3DLEB 1R8AA 4WCEQ 4AUKA 2XS2A 5G0RA 3BQ2A 1S6QA 2COLA 3CT9A 2OAUA 2ZH1A 4C8ZA 1VQ4S 4IG3A 3UPFA 2X1BA 3BO2A 3FSYA 3TYTA 5CZVA 1NK6A 2VG6A 3M8SA 1JNRB 4XAKA 4F8RA 4KKOA 5IT0A 4ECSA 4PPDA 4FBUA 1NNDA 2W7OA 2ZOGA 3MFHA 4J9LA 2DNYA 1R0AB 3WC2A 3X3UA 2E5IA 5B0FA 3CD5A 3V6DA 1VQSA 2MQPA 4DSKA 3MEGA 1O51A 1C0TB 4Y2AA 4DL2A 2XMUA 1HQUB 4KBIA 3C46A 1ELOA 3MECA 3IN5A 3I82A 3BEGB 4DV4F 2LXIA 5HI7A 3L3CA 4J9SA 3KK2B 4UQGA 2W9CA 2M8HA 3UQSA 3J7ZT 3EPGA 3N01A 2KFYA 1E6YA 4BDPA 2IC3B 1JLAA 3MMAB 3HHLB 2YNHB 4OZ1A 4NOHA 3T1AA 3U1LA 5KFCA 1JLCA 3MI7X 1ZAWA 3CSKA 4M63A 2C28A 4LVNP 6FDRA 4H4OB 1G6BA 4X4PA 3G71S 4J9MA 1YQHA 5KFEA 3TO8A 1FNMA 4NRUA 2OPQA 3DRPA 4TU8A 4C8YA 2BACA 1SJFA 4YDDB 3UW1A 1Q8IA 3AY0A 2WSFC 2GMHA 2FLLA 2V2KA 3US5A 3NAIA 3VQSA 1KLMA 1M5OC 4RKUC 1YJUA 3AA8A 1KS2A 3HF5A 3W7BA 1X4CA 2ZVSA 1C1CA 5GADI 2FJVA 4N8NA 3UR3C 1KTVA 2GX8A 4PWDA 4DF8A 5A0YA 4JI3F 1BGXT 5DDRC 4K4SA 2DHXA 1R43A 1SV5B 3SEOA 1S1TB 3JTPA 3UFCX 1IR0A 1CVJA 2DNPA 1H98A 3OFEA 5HBMA 2E5LF 4C0HA 3IG1A 2F3JA 1MWYA 2NS1B 1RA6A 2IHR1 4I0WA 3S8SA 3RAXA 3AQPA 3O44A 3K8VA 3N6LA 4F4XA 1NU4A 1OQ6A 4DSJA 5F41A 2YWFA 4WFYA 3NKYA 3GYXB 2EPIA 1S1XB 4ZP8A 3ZZRA 2JFKA 3RB4A 1S79A 3MTJA 2IYGA 2NUUG 5K8PA 2MKSA 2LECA 2BQ3A 3F56A 4ZCLA 3E3XA 4Q43A 3CCES 3BF4A 1DLOA 1SL0A 2XLKA 4ZCIA 1WELA 3ZZOA 1JXLA 1QAYA 5C42A 3UR0A 1DJ0A 2HHPA 4KFBA 4YUDA 5MLCV 3JSMB 4NX9A 4CTAB 2M4MA 4ECWA 2F8MA 4LSNB 3H4DA 1X7VA 2R7UA 4OI6A 4BS2A 4IRCA 1TQLA 4ELUA 2GQ2A 5I42A 3CDEA 1JLEB 4N5SA 3UDLA 4LF7F 3SQGA 1TFWA 2HWIA 5CHCB 1DRZA 5KG2A 4C11B 3D0GE 4O4GA 5E3QA 5KG1A 5G0RB 3KLGA 1R6YA 1S6QB 1UEUA 2QZ8A 1CQMA 3OFGA 4PXDA 1S9EB 2E1CA 1TUVA 2I38A 3D0HE 2GFFA 2VG6B 3CCLS 2VQFF 4ZA1A 4LFCF 3N79A 1T05B 4OZLA 2B7CB 1QE1A 3V6HA 2RDIA 1YI2S 1RISA 1VRUB 1HNXF 3LGMA 2ALZA 2DCLA 2Y0SD 3O3LA 3H59A 3PEHA 2B9XA 2DO0A 3HI9A 2DNLA 4Y6IA 3V6DB 2HHHF 1NK0A 1Y3KA 2M88A 5EGYA 2DHSA 2ZNZA 1HI1A 4JI6F 4KB7A 5F8GA 1Y5IB 2V9WA 4DG1A 5IFMA 1UJ4A 5DGAA 2FJAB 3U27A 2ABYA 3LQVA 4DFJA 3RAQA 3QJPA 3MECB 5F8JA 2ZFHA 1IQTA 2NREA 3D1QA 3JSYA 3G4SS 1X5OA 2GIRA 3OTCA 3MUTP 4L3NA 2W9CB 3DLBA 1U2RA 3O1LA 3KLFB 1TV6A 2OLWA 1HWUA 3I87A 5KT6A 2JL9A 1FJGF 4AQYF 2UVRA 1T94A 2FVCA 4OV1A 3HK2A 2Q6BA 4J9KA 4HTJA 1Y9OA 1YJTA 3OLBA 4F02A 2BANA 1UVKA 3AAWB 4ZK7M 3ENWA 1FRMA 4KGKA 2OPQB 3DRPB 4RW7A 3TAMA 1VBXA 5DGBA 5SZTA 1LWFA 1PSDA 2LMIA 2MHNA 1RT4A 1P8GA 2HS3A 3C6TB 3HHLD 1XN9A 3CVKA 3M9OB 2PA3A 3FFIB 3OW2R 2XEXA 5J2QB 3M8PA 3ONQA 4ED6A 4JV0A 1SJQA 3M30B 1K0TA 4X4VA 2MKJA 4LJMA 2RKIA 3THVA 1VFJA 3DN9A 4TLQA 4PUOA 1H3DA 2QLWA 3TQ1A 1UVMA 1FRXA 4QU7A 1A9NB 4WFBQ 3W3SA 1RT3A 2LVWA 5HBMB 5D6GA 3RZAA 3A8EA 2B9YA 2MZQA 1I94F 4NLWA 1JJ2R 2BV3A 2ZBIA 4OFZA 3NWGA 4QR0A 3G6YA 4K0KF 1HMVA 3CCTA 2IYIA 3M6WA 4NCGA 3K5NA 1QM9A 2MQLA 2XY6A 1NRKA 3KG1A 3W2WA 3M2UA 1FTRA 4IOCQ 3I5BA 3D5MA 1UW4A 3V4IA 4EWTA 5BYSA 2J0WA 2DGOA 4DOZA 4ILRA 3PKYA 1Q7LB 2MQOA 1N6QB 3PEJA 3E2EA 2W24A 1DTTA 2M9KA 4RNHA 2FLPA 3BDPA 3P49B 2XCPA 2DNNA 2IAJB 2EFNA 3M6XA 3P5TL 4DFKA 4KFBB 2DCUB 5GMKa 1VQ7S 1VQPS 2UVUA 2MY8A 5DQIA 1Q81T 2FHJA 3D0IE 2KT3A 4Q2MA 5KFSA 3B4DA 2C22A 1S0MA 1HNIA 5I42B 3MR3A 4DSLA 2WOMA 3T9ZA 2K1RB 2R7RA 3SQGB 2VFUA 2CQ2A 3N6NA 5KT7A 1HR0F 4Y34A 3JTOA 1MMNA 2PA8D 3PRBA 4IFVA 4I2QB 3RRHA 3A1YG 2M5YA 1Y7PA 2KRBA 5AXMA 2QA4G 1U49A 2V4JA 2D1CA 1F5AA 1X4HA 1ZAVA 1Q86T 1H38A 2UXBF 3FZBA 4H54A 3FRZA 3MR2A 1NK8A 1U6ZA 2P6SA 1YHQS 4KC5A 4G1QB 5L1IA 4QR1A 2RUGA 3CF5Q 3MR5A 3OSPA 2BOPA 3GV8B 1Q78A 2RRAA 2XMMA 4W90B 3DLKA 1S1UA 2C3OA 3FQKA 4ECUA 1S76D 4URQU 3VWSA 3P96A 3ZC4A 5EDWA 3DDKA 1ZBTA 1IKXA 3GILA 1WF2A 3P3DA 1HNZF 2VBWA 1YJWS 1ZPVA 3KHLA 1U1MA 4XPEA 1TV6B 2J0XA 2W9BA 1N36F 3E51A 3PNIA 4HTIA 3BSAA 2JC0A 2XC9A 4IO1A 1U1RA 2MGZB 2XMKA 1LQ9A 3MDFA 3PVXA 1KHWA 2CZVC 3VAHA 3TAPA 5L38A 2KDOA 3CE8A 4DPOA 1VQLS 3MMBB 2PMZD 5KFRA 1KQGB 4TU7A 5E7OB 5HL7Q 1LWFB 1WWHA 3V6JA 4OJ3A 2ZE2A 2M2BA 3I0SA 5T41A 2OMOA 3H8YA 1YSJA 3DLJA 3N6MA 4K50A 1N32F 4A8WA 1CC7A 4Y2KA 5KFBA 4I1TA 1FKPA 4KRWA 2Q43A 5F8MA 3FSXA 3OLAA 2RKIB 5HMXA 2NUHA 4OHXA 4B9MA 4J9QA 4PRFA 2BQRA 2JVOA 2XB2D 3VZIA 5DG7A 4ALZA 4ETZA 1RT3B 3QWPA 1VMBA 3RR8A 5M2RA 4KHRA 4OL8A 1X4EA 1R8PA 1ZAXA 2OFHX 1HMVB 1RJJA 1QLNA 2XBPA 2YKQA 4HI1A 1H7XA 2D3UA 2LEPA 3PJXA 4CT9A 3D2WA 5KFOA 5K8OA 1WF1A 4XPCA 4DUYF 3OL6A 2OFGX 2B56A 4Q45A 1Y00A 3MM5A 2FC8A 1C1BA 2HWHA 3DNCA 2J9CA 4RW9B 2DGUA 4JI8F 4JI7F 1T03B 5B09A 4X65F 1S99A 2FIUA 2AV5A 2J6TA 1KNZA 2IVFB 4FNIA 2DGWA 3F44A 2JZ5A 4GKKF 5D4OA 1DBDA 3HM9A 2MQNA 5FIIA 1VBYA 1URNA 5A8WA 3HHLC 2DH7A 4URSA 2BYCA 3HHDA 4U9RA 2FDNA 2GMJA 2PDAA 3FMWA 2DD8S 4MIBA 3I56S 2DRAA 2WOMB 3CUNA 5D77A 1LWCA 1UP1A 3CMES 2VPYB 2ZH4A 2XS7A 5H9FJ 2CQ1A 4FP9A 3M6UA 4LF4F 3PW7A 1LWEA 2HWTA 5AXKA 2HFOA 4H4KA 1NK7A 1O5JA 2V4JB 1HWIA 4FZVA 2RU3A 2KXHA 4YDXA 5M2UA 3NL0A 1UFWA 4LFBF 1X4AA 1Y3JA 2BRLA 1HYSB 2MZ1A 3KHHA 4YR0A 4OI3A 2Z0GA 3VALA 4DR2F 5KFTA 1FKOB 2ZUGA 2PI5A 3WZ0A 2J76E 4F4ZA 4HYKA 3HJFA 5E3RA 2HHQA 1XR5A 5J2PA 4MKBA 5E5NA 4ZP6A 4DFMA 2HMIA 2HQ3A 4F26A 3OR2B 4O44B 4PKDB 5C25A 3K2YA 4U7UK 4J9OA 1J2VA 2VG5B 2YNIB 4HHJA 4DV5F 3JYTA 2C3YA 2LXUA 1NKEA 4TY9A 3IWLA 2DPIA 1B7FA 3IXQA 2ZKUA 1WI8A 2HAIA 3MFIA 3BN7A 2B3TB 3M1VA 1U6BA 4UUXA 2G4BA 3FDSA 3HVWA 3TVKA 2MKIA 4KV8A 2IM0A 5AJ3F 2E5HA 2CPYA 2JVRA 3L09A 3DOLB 2RQMA 3TA0A 3TVZA 1FHTA 2FJEB 3MMCB 3HKWA 1ZPWX 4OHYA 2RD5C 1QSSA 2YTCA 2O01C 3LP1B 5KFFA 2AJ4A 2P9CA 3BGLA 2O5DA 2GHWA 3EX7B 3SZ2A 4NRTA 4FVMA 1A6LA 3OTBA 1H6KX 1IKYB 3JAMY 1M90T 3OFHA 3LAKA 1M5PC 3RB3A 4C2MA 4O4RA 4IFYB 4R5PB 2RB7A 4TNOA 1Y5LB 3SYZA 3H2UB 2P9GA 1N88A 4YP3A 3OHAA 2R8KA 2HS4A 1CC8A 1P9QC 2LU1A 2U1AA 3M05A 1JJ4A 4E0DA 4Y65A 3M8QB 4OX7A 4DQQA 2Q6CA 4MIAA 4B3TF 2F1FA 1LXNA 2CQPA 3I5AA 1OS5A 4UY8T 3QJJA 4FXWA 1IBLF 3OVBA 2FJDB 1UVJA 1XWLA 1OPIA 3HO1A 2R8JA 3HZEA 5KG4A 5JVGQ 4A8KA 1ZM2A 4FF4A 4W92B 3CD0A 2DNKA 1S1VA 1JLFB 1HNVB 1TL3B 2EFQA 5KFUA 3NNCA 3MM7B 1DFDA 1HBNA 1B0TA 2R7XA 2XMJA 4NXNF 4RBTA 4P2SA 5IWAF 1QSYA 3KLVA 3EPIA 3I0RB 1FKAF 5L1LA 3KLHB 2VH7A 2UUTA 3BQ0A 4Y0FA 1VQ9S 3SFUA 1BQMA 5CYQA 5IQ6A 1L3KA 1U1KA 4ZVFA 4AL7A 1S7HA 2VUGA 1ZM3A 4B9SA 3GZ7A 2RU9A 4PG7A 5J1EA 1NHUA 3GFYA 3I96A 1ZOTA 3TNVA 1N0VC 2ZHBA 4DV6F 4DL5A 2AGPA 2FD2A 1FXRA 1LXJA 4CO1A 4ECQA 2R4FA 3DHXA 1DARA 5B08A 5JXSA 3UCGA 3M32A 2F8EX 3T5HA 5DS7A 3DLEA 4MK9A 1TKTA 4ZHRB 1XNQF 2QA2A 3I4HX 4CNZA 1U09A 2ZH8A 3HHNB 1NAQA 4P6QA 3CJ4A 2RRNA 5K8MA 4MK7A 2VFRA 4DQPA 1KVJA 1LWEB 4A8FA 1ZYQA 2JEGA 1KQKA 1FT8A 5KFKA 1ZH5A 3PFOA 2GQCA 4QU6A 3NCRA 2J0QD 3OR1B 2JLGA 5AXLA 3KYLA 4KTQA 1R0AA 2I1RA 2FHKA 4ZCMA 2FVPA 2DITA 1GXUA 4DL0C 3IA0A 4ZPTR 1PC4A 3U1MA 4X4UA 3C66A 2DGTA 4C97A 3HHKA 2VFTA 5KFMA 5C25B 1PGZA 3FGVA 3MEKA 3UCUP 2XWYA 1N4LA 3JYTB 4KPYA 1AROP 3B4MA 5F9LA 1RQ0A 4ICLB 2FHOB 5HMZA 1VGYA 3KK2A 5D3GB 2VPWB 1P6TA 2N82B 4A47A 3EUNA 2LLZA 3LALA 3OBIA 4JI4F 2IC3A 5J2NB 3LGNA