1WF1A

Solution structure of rrm domain in rna-binding protein np_057951
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
GSSGSSGMSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTLDINMAGEPKPDRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein Raly
publication title Solution structure of RRM domain in RNA-binding protein NP_057951
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wf1A01
1WG4A 4C4WA 3CC7S 1WG1A 2JVRA 1VQ6S 1YJNS 5IQQA 3CTRA 2LQ5A 1VQMS 2M8HA 1WHVA 1Q81T 2U2FA 3LPYA 1NO8A 1N88A 1YWXA 1WI8A 3NNAA 2MZTA 2NZ4A 1U1MA 2I2YA 2KG1A 2DH9A 1X4GA 2MKJA 2MB0B 3R1LA 3SDEB 3SXLA 2JVOA 3ULHA 1M5KC 5DDOC 2XSFA 2D9OA 2HGNA 3CF5Q 5JVGQ 1FJ7A 3MUMP 3I56S 2JRSA 1D8ZA 3MUVP 3CCES 1YTYA 3P3DA 1WEXA 2CPZA 1QM9A 2V94A 1F9FA 2I38A 4UQTA 4WKRA 2KG0A 2J0SD 2AYEA 2LCWA 1U2FA 2NLWA 2X1AA 5DM6Q 2HVZA 3DLLQ 2DIUA 2EK1A 2M4MA 3OW2R 4WFAQ 3S01A 2MKSA 2HGMA 4W92B 4IUFA 4M5DB 1YJWS 1VQ9S 1OWXA 3VAKA 2DO0A 3CCLS 1WEZA 3Q2SC 1N8RT 3MUTP 2CJKA 2LYVA 2DGOA 4LIRA 3J7YU 1G2EA 2MPUA 1X4AA 1FXLA 1SJFA 3G8TA 3CXCR 3VAJA 1NU4A 2M2BA 5MLCV 3HHNB 1JJHA 1X4EA 1ZH5A 3MD1A 3H2VE 1HD1A 2CQ2A 5DDQC 4YUDA 5IM0A 2MQQA 1VBXA 2DNQA 2F9JA 2KU7A 4J5OA 2WBRA 1ZZFA 5GAGU 1Q82T 1M5VC 2DGQA 1KOHA 2DISA 2MKCA 2DHGA 2YKAA 2A3JA 5D77A 2E5GA 1X5OA 4A8XA 1UAWA 2CPDA 2UP1A 1A7GE 1QVGR 2YH1A 2ERRA 2CQ1A 4PR6A 1U1LA 4CH1A 3MOJB 5CA5A 2YTCA 2DB1A 2DNHA 1SJ3P 2MGZB 2F3JA 2KM8C 2AYBA 3H2UB 2PE8A 2QA4S 2SXLA 3CCSS 5DM7Q 3I55S 1XN9A 2J8AA 1VQ4S 2MKHA 1M5OC 2RNEA 2CQPA 3U1LA 4TU7A 5LJ5Y 1W2BR 3CCJS 2CQ3A 1U1NA 2X1BA 2FPHX 3UE2A 2MKKA 2X1GA 2LEBA 1VQKS 1B7FA 3CCUS 1VQ5S 2RS2A 2RRBA 2RQ4A 4EGLA 2FY1A 3VAHA 2DNLA 2DGVA 5HL7Q 1WTBA 1VBYA 3V4MA 2DIVA 2DGUA 2QFJA 2JWNA 3B4MA 3US5A 3EGZA 3PIPQ 2E5JA 2ZJRQ 4U67Q 4UY8T 4OZ0A 1M1KT 2CQIA 2D9PA 2MQPA 2CPXA 2XB2D 2MJUA 4WIIA 1P27B 2CQGA 2MHNA 2LECA 4IOAQ 3BO2A 3BO4A 1Q7YT 2RUGA 2OTLS 1OIAA 2KH9A 1VQLS 2DITA 2KI2A 3TO8A 2U1AA 3MI7X 2XS7A 2EK6A 1U1OA 5HO4A 4YB1P 2AYGA 4LJMA 1H6KX 1SJQA 2CPHA 2O3DA 2DHAA 1OO0B 2N7CA 1VQPS 4WF9Q 3G9CA 1DBDA 5IFMA 1X5PA 5CXTA 1R8PA 1WHXA 1U1RA 2F9DA 1PGZA 2X1FA 2XS5A 2KN4A 3CULA 5EN1A 3LQVA 5GAEU 3ZZZA 2DNNA 2M88A 5GVQA 2KVIA 4CH0S 3G96A 1H2VZ 4ZKAA 3VAGA 2CQ4A 1AUDA 3MD3A 2DNMA 2L9WA 4QU6A 2KFYA 4OZ1A 3N9UC 2RT3A 5IM0B 2OIHA 4V19X 2BOPA 3MXHP 5LSOA 2MSTA 5LXYA 2LA4A 2RQCA 1WI6A 3NMRA 2CPEA 2MY8A 5BJRA 2CQHA 1RK8A 1HD0A 2KRBA 2MXYA 1FJCA 1X4DA 1KC8T 2B0GA 3P6YC 1NJIT 2K8GA 2KT5A 4PKDB 1HL6A 2KXHA 3CPWR 2DNGA 2RRAA 1VC5A 1SXLA 1FHTA 2MQLA 1QVFR 1N52B 2MQMA 5DDPC 1WWHA 1X4HA 2EVZA 1KQSR 1DZ5A 1WF2A 2RS8A 2K3KA 3BS9A 2YWKA 1RKJA 4FXVA 2J0QD 5FJ4A 4RU2A 1U6BA 3HI9A 5D78A 3CC2S 2CPIA 1X0FA 2HYIB 4FXWA 1M5PC 2G4BA 3JB9k 4TU9A 3TYTA 1OPIA 4ERDA 2DK2A 1WG5A 4IOCQ 1YHQS 1DHMA 2J76E 2YH0A 2N3OA 1H2UX 3D2WA 2MY7A 2FC8A 2DNZA 3CUNA 1WEYA 1K8AT 3BEGB 2OSRA 5LSLA 5H1SV 1Q86T 3NNCA 2E5IA 3P5TL 2MYFA 2ADBA 2MZ1A 3IWNC 2DHSA 2LXIA 3CC4S 4C0OC 4WFBQ 3NNHA 1S72S 5LJ3Y 1JMTA 1WF1A 3UCZP 1WHWA 3K0JA 1N54B 2HGLA 4LMZA 3THTA 2ZJQQ 1KOOA 2VOPA 3VF0B 5LXRA 1VC0A 1X4FA 3CCRS 1PO6A 3S6EA 1K73T 3MDFA 3UCUP 2N3LA 1YIJS 4TU8A 2HZCA 3BO3A 1X4BA 2KM8B 2CQBA 2KHCA 1VC6A 4PRFA 5ITHA 2N82B 2OSQA 1CVJA 2AYMA 4F25A 3VAFA 2M8DB 2LKZA 2RVJA 1KD1T 3G71S 2LA6A 1FT8A 1U6FA 3UCGA 2RU3A 4QQBA 3G6ES 2MZQA 2CPFA 2M70A 2XNRA 1R8HA 3RW6A 3IRWP 1VBZA 2OJ3A 2OTJS 2L08A 1D9AA 3S7RA 1VQNS 2FC9A 2MMYA 2M9KA 3FEYB 1L3KA 4QU7A 3SDEA 3S8SA 4C7QA 1YITS 5DETA 5DDRC 2DNKA 2KXNB 3SMZA 1ZZNA 2XNQA 3G8SA 2AD9A 3THPA 2DGSA 1WHYA 4YOEA 2DHXA 2LMIA 2BZ2A 2LXUA 4Z2XA 4CQ1A 3ZZYA 2FHOB 2QEXS 1BY9A 4Y00A 1M90T 1URNA 1X5TA 4WCEQ 3CCMS 2L41A 1H2TZ 1IQTA 3VAMA 1JJ2R 2MZSA 3VALA 4F02A 2Q79A 3NS5A 3UWTA 5GMKa 1S79A 1VQ8S 5GAHU 2ADCA 3U1MA 1UW4A 4W90B 2MQNA 3VAIA 1JJ4A 2CPYA 1HA1A 3EGNA 1SJRA 1VQOS 3MURP 2E5HA 2XS2A 4ED5A 1DRZA 2DNYA 1WELA 2D3OR 1FNXH 5JVHQ 2KYXA 3P49B 2DGTA 2M0GB 3Q2TC 2DNRA 3CMAS 3DXBA 3NS6A 2DNOA 2MJNA 3PIOQ 4BS2A 4F26A 2JX2A 2M7SA 2PEHA 4TLQA 1P1TA 1X5SA 3TP2A 2KXFA 5CYJA 3G4SS 1VQ7S 3R1HA 2G0CA 1FJEB 2DNPA 3R27A 3RW7A 1YJ9S 3J7ZT 3CCVS 1SJ4P 1O0PA 5GADU 4IO9Q 2MKIA 2GHPA 2M52A 1U1QA 2CPJA 2MGZA 2G1DA 3B4DA 1FO1A 2DO4A 2CQCA 2MQOA 2VONA 2MZJA 1WF0A 2DGWA 1K9MT 2GO9A 2MZRA 2CQDA 2E44A 3UD4P 3CMES 3CCQS 2DH8A 2DH7A 1YI2S 2VODA 1U1KA 4Y0FA 4WFNQ 1UFWA 4CIOA 1X4CA 2DGXA 4QPTA 2MSSA 3L3CA 3FEXB 4P6QA 2CQ0A 2KRRA 1UP1A 2ZJPQ 3UD3P 3EX7B 1A9NB 1U1PA 2LEAA 3CD6S 2VOOA
chains in the Genus database with same CATH superfamily
4WU3A 3W8GA 4NCAA 2UUBF 3CCZA 4I6WA 1LWCA 3ZZTA 1RT4A 3EVWA 1RWPB 2CYYA 1TKDA 3SDEB 3R7NB 4DR5J 2BUNA 5J2NB 4YHHF 1RCOB 3PV8A 3G82B 1FFSB 4WWSA 5F8LA 2X1AA 3ICLA 3BKFA 4KV8A 4A8YA 4L76A 2NYHA 1FVQA 1T9WA 2WBMA 4IUFA 4J9LA 1YJWS 1SJ1A 2W9AA 2LQJA 4WFXA 1N8RT 5J2PA 3ZNUA 3VVUA 5HJYA 5IXUA 4AL6A 1YJUA 1X4AA 3EE3A 4NLQA 3JXOA 1S57A 3GYXB 3HHNB 2PI5A 4DUZF 3GWCA 1M5VC 4DUYJ 2VFTA 4WZQA 1VQYA 2IM0A 4U95A 2GW8A 4IG3A 1EQ0A 4LSZB 1UAWA 2YPZA 4LRFA 2ZH3A 2CPDA 1JLAB 4P75A 2HS0A 4TKTA 1U1LA 5EWFA 4NZ7A 4PXDA 1OY8A 4GRSA 2OH2A 3L4BC 1EETA 2E9RX 2GIQA 4HTJA 3TEGA 2OELA 4K4SA 3VZHA 5E3QA 5LJ5Y 4DQPA 3UE2A 3ZZUA 4IRCA 2E9ZA 1FFWB 3WC2A 2WOMA 3C14A 5E7OB 4JYAJ 3VAHA 5B0AA 3MPUB 2VU5A 2R2TA 1HBNB 1P1LA 4P7TA 3TI0A 1T3NA 3DLEA 3VR1A 1AFJA 1B0VA 4U67Q 4NCGB 2CQIA 5IV3A 3R2CJ 1HBOB 1QTMA 3DNCA 3BO2A 2A18A 1HI1A 4ZVOB 4H4KA 5GAHI 4DV3F 2U1AA 1U1OA 1UVIA 4DX7A 3BQ2A 1OO0B 5HMYA 5LMNJ 2W8KA 3QJLA 1NSAA 3M6WA 2EEYA 1FEHA 3QWUA 3SI8A 2CQ4A 4PPZA 4G65A 2RT3A 4LF4J 1LWFB 2D69A 3BN7A 3LUYA 2GGPB 3EZ5A 4FN5A 1U47A 4OZLA 1RA6A 5D3GB 2MQLA 1RTZA 1WF2A 2GMLA 3BS9A 1RKJA 2J0QD 5DLFA 4J9SA 1DTQA 2IRYA 3QRQA 3BGUA 2Y0BB 2PD1A 2N3OA 2HHWA 1NJZA 2MY7A 4X4RA 2DNZA 3GMGA 1T94A 2YKMA 1KQFB 1WC4A 2E5IA 4FP9A 3P4UB 3PW0A 5B0BA 2MYFA 4DU8A 4WFBQ 1WF1A 2LQ8A 2VJVA 3MMCA 2XSJA 1S49A 3VF0B 3N28A 1UVLA 3GFHA 4F8RA 2FVCA 3V2UC 3BO3A 1V5VA 3V6JA 1WSVA 3OV7A 5J1NA 1F5AA 2AYMA 4GKKF 1AZSB 2YNGB 3J7YI 1HLWA 2MZQA 1LKZA 3BV8A 1D9AA 4ECSA 4MFBB 2AF6A 5DZ6A 1S1TA 2N7YA 2W9BA 3W60A 3C66A 3T6BA 1VCTA 5C24A 3CSKA 4RJVA 2FHOB 3IBWA 3RRGA 3AODA 4X65F 1NEEA 3HVTA 1IQTA 5B7WA 3OR2A 4F3OA 3F56A 1C4AA 4I4BA 3ZTSA 5HP1A 5GAHU 1UW4A 2CPYA 4NLTA 4FPRA 1VJQA 2VKZG 3SV4A 2DGTA 1QE1A 3JYTB 2G2YA 4ICLB 4LREA 1IR1A 3VV2B 3PVXA 3CNQP 2UV8G 4ECTA 3R5BA 4PCQA 4URSA 1FWKA 3WQPA 3DDKA 4YDXA 1MN9A 2GHPA 4RNNA 2VPYB 1K9MT 1AB8A 3TJAA 2ZH4A 3PFOA 4C8NA 5HAOA 1X4CA 2DGXA 2WAQD 4B17A 4R8UB 1ZPWX 1M0SA 1PJ7A 1RAJA 3J7AN 3KUEA 2R7SA 4ED8A 4LVNP 5IT9U 1A9NB 2E1RA 5EX3A 3H4BA 3J81U 1J27A 2XQCA 3CC7S 5JXSA 1VQMS 1KKHA 5L1KA 4RPFA 4DI6A 5B0FA 5D4NA 2UVWA 4CT9A 2H54B 1VI7A 2I2YA 3CJ4A 2ZHBA 3C6TA 2NQPA 3GONA 2UVRA 1IM4A 2FVQA 2F40A 3MUMP 4J7CA 3P3DA 1F9FA 3I5CA 2QRRA 1HNIB 4K2XA 3TZYA 2UU9J 1Q5YA 2B51A 1LEOA 3AD7C 3ET6B 1OWXA 1OSDA 2FUG9 3W5XA 3MUTP 3MAQA 3J7YU 5IT9Y 2V34A 5A6PA 1B64A 1X4EA 4AE5A 5DGBA 2XI3A 1S6QB 3M9NB 4LF1A 3VWSA 3TNVA 5F8JA 2DHGA 2E5GA 3LGNA 1HHSA 3A8JA 1U0SA 4PYDA 1TMJA 3GIJA 4CTAB 2F3JA 2Z4PA 3H2UB 2ZDPA 3AXMA 4DPXA 2VHGA 3OLBA 3QPIA 2BMBA 2F4VF 1VQ4S 4I2QB 1FTCA 2ROPA 3M2UB 3AA9A 2HK2A 2JEFA 1J2VA 1U2CA 4DV2J 2H3EB 3LAMA 5FDLA 1PC4A 3HCXA 3D6MB 1F2GA 1JLCA 1RT3A 1IKVA 1NLKL 1R43A 3R5GA 1PSDA 4J90A 4PG6A 3KLEA 4DSFA 2MJUA 3T1AA 3ISND 1RT1A 1S0OA 1QSSA 2Q43A 2HBZB 1LW0A 3V6DB 1B0TA 5E41A 2UZAA 4MIWA 2EK6A 2WB4A 3JAMY 3MCSA 4Q8EA 5GAEU 3F44A 3ZZZA 3VAGA 4KE5A 2JC0A 4A8WA 2CWKA 4LF6J 3HHLA 4V19X 2MSTA 1FDBA 4X4SA 2OHDA 2W7OA 5HROA 2MXYA 1C1BA 2JOQA 3WDOA 1Y9OA 3DKDA 1IJEB 4C97A 3M8PB 2RRAA 1R0AB 2O66A 5BXIA 2ZBRA 4NCBA 4LF2A 1FK9A 1NMEB 2Q3PA 2AEJA 8AT1B 2DRBA 1MSWD 5H9FJ 2ABYA 4LFAJ 4RBVA 1DHMA 2C2MB 2B8QA 4X4OA 4USKA 4HACB 1WEYA 4WP3A 3BEGB 3N5BA 4B3RJ 5T7LB 3OTBA 1YJVA 3PM9A 4USTA 1R27B 1VC0A 3D0IE 2GS8A 3D6HB 2PC6A 3SSRA 2Y1IA 2FJDB 3AH6A 3PACA 4C0HA 3FBBA 3CJRA 2BACA 2R7TA 4USIA 4EZ9A 1CVJA 4M5MA 2LKZA 3HMJG 1RTJB 4Q45A 2LA6A 2WHOA 2HFSA 2ZH2A 4IDKA 1Q95G 1VBZA 3HLUA 4LF5F 2UXDF 4WU2A 3C8YA 1UMJA 4EO8A 2ZWOA 1C1CB 2JFKA 4YB7A 4I6YA 3G8SA 2BXJA 4D3GA 3PTWA 3THPA 2WONA 4OI4A 5KFHA 2KJWA 5T41A 2K7KA 1S1VA 4FF2A 4U7UK 4Z2XA 3PYGA 1JLQA 4ECWA 2GQQA 1URNA 2RHQB 1KEKA 2DXEA 1IR2A 1S79A 4JI5J 2CRLA 2C2EA 2HHHJ 2FJVA 4J9VA 1H7XA 1VQOS 4CO1A 3TZXA 2FVPA 4O3RA 4C9DA 3NKYA 3A8KA 5HVGA 4F0KA 2I1RA 4CO2A 4C98A 3PIOQ 1NK4A 1FJGJ 4KQZA 3PW2A 2GZOA 3K59A 2IRUA 2IA0A 1Y5LB 2M52A 1QSYA 4DX5A 1HNZJ 2RDJA 4GO7X 2DYAA 2MZRA 4IG0A 2CQDA 4F4WA 1UZDA 2DD8S 1XNRJ 4QZVB 4K50A 2L48A 2EKNA 3KDNA 4H4OB 2LEAA 1NNDA 5A8WB 2HQCA 4DSKA 2OPQA 2QJ3A 4U96A 2KG1A 3PKMA 4OHZA 1OMSA 2VC1A 4CLPA 2DJWA 1M5KC 4PG7A 3ZTOA 3I56S 1FE0A 2IHR1 2Q6BA 1QM9A 4ZPCA 2V94A 2YKNB 2AYEA 2DPJA 2AHOB 1SH0A 3I0RB 2C3UA 3LP1B 3BSOA 2M3DA 1VS3A 4TNOA 1ZM2A 3C6UB 2XWYA 2QMUB 3DXSX 1TKZA 3DLKB 2LYVA 3T9ZA 3A3OB 3C16A 1ZTWA 4I68A 1XMOF 2WSEC 1F9HA 3GIMA 4ETZA 4WK3A 1Q82T 3MMAB 1HBUA 2XZDB 4JV0A 2AX0A 4FNHA 3BREA 2FGCA 2CIMA 1N34J 2RQMA 3CJKA 5C42B 3TUJC 2DR7A 4ZJQA 2QMXA 1KFSA 3PO4A 1UEVA 4ANCA 3KLVA 2C2ZB 1HPZB 4H4KC 2UXBJ 4K5RA 4I0WA 1RWXB 3LOUA 3B82A 5KFTA 3QIPB 1S9GA 2B4VA 1WC5A 2L9NA 4QWDA 2MKKA 3KLFB 5GMDA 4XDCA 4TN2A 2FY1A 1EP4B 1FF2A 1IBKF 3Q8QB 1N56A 2QLFB 3QLHB 1CS4B 3SV3A 2E5JA 1APSA 1WNEA 2W4DA 1S6PB 4DR7J 2BM1A 1Q8BA 1J5EF 2ZE2A 2BA9A 3H8YA 4DCJB 3D9BA 1GTEA 4IFVB 4Z7CA 3W2VA 5AE3A 2QLWA 4ZJOA 4O44A 5L1LA 3AD8C 4WF9Q 5IFMA 5CXTA 2VBWA 3LO3A 1VQSA 4DFKA 1VMBA 4IKAA 2GVDB 2XS5A 3KTQA 4KTQA 5ETQA 5KG4A 4OV6A 4B08A 3G96A 2VBZA 2XMUA 4RNMA 2L9WA 4OMFG 2OIHA 2DR5A 3GIRA 3A1YG 1S12A 1AYEA 3FJ2A 2RD5C 3RBXA 4JI2F 1VGYA 2KRBA 3QO9B 1KRPA 1OY6A 1B4SA 3I4PA 2DNGA 5B08A 1NAQA 2LU1A 3FSIA 1M5PC 3RU0A 3RTVA 1TL7B 2RB7A 4LSLB 4GMKA 1R6YA 2IBOA 1QLNA 4F36A 2HRTA 4RLEA 3NNCA 5LM7E 5F9NA 1GH8A 4MYUA 3L7PA 1OYEA 3M7VA 4P73A 3HHDA 4AXJA 4XPCA 4G1QB 1VRUB 4PRFA 4CYUB 2PMHA 4RUAA 1CJKB 4PZVA 3HO1A 3MPYA 3UCGA 3NAHA 1NK9A 2XO6A 2ZC3A 4ZLLA 2M70A 1REGX 2D1CA 4GVLA 3EVOA 5L39A 2AJ1A 2YX1A 4HKQA 1T03A 2BVZA 3AQPA 3HT0A 3QMQA 2DNKA 4EO6A 2AX1A 4KC5A 4JOUA 3KUHA 4X66F 1ROFA 3RG6A 3O2IA 1OPZA 1RXOB 4OHVA 2HWHA 3CJ3A 1F3FA 4ZHRA 4EMDA 1MMLA 3NAIA 2FHJA 1VQ8S 2MQNA 1JJ4A 1K0TA 3MM8A 1MN7A 4PQAA 1TAQA 2QV6A 1GMWA 5CCMA 2PDAA 2AZ1A 4ECRA 2BDPA 4DL7A 2X7IA 5C5JA 3LWLA 3C15B 4X62F 1TTHB 1KR4A 2VG6A 3K7RA 2KXFA 1RJJA 3RUBL 2HAIA 2N4CA 4NMXA 1V3RA 5B0CA 4Z37A 2VG5B 3AJ1A 3D0HE 2BJ1A 4JI7F 2DO4A 1LK5A 1JB0C 2VODA 3DMJA 4X84A 3OJUA 2J0WA 3NGRA 2ZDOA 2XBPA 3PYFA 2CQ0A 2BV3A 4ALZA 2ZJPQ 1AT1B 1EX8A 5C2GA 2U2FA 3LPYA 4H4MA 3GFXA 1HNVB 4FKYA 1TKXA 3FUYA 4ZVFA 2IYGA 2MKJA 4N7TA 2MB0B 4RW4A 4USHA 3W63A 1TK5A 1LQ9A 1K1SA 3TX0A 5DDOC 4DMZA 4WYLA 3OTCA 3OXFA 3JSMA 2WSCC 3DRSB 4ZJLA 2MQ8A 3K5NA 5ETKA 1S7IA 1RU2A 2NPFA 3OW2R 1S1UB 4C48A 4ZVGA 2CJBA 1GFWB 5F8HA 3DLGB 2KDOA 4X4QA 2VPWB 1FKPB 3GTYX 3N01A 4ZVSB 4ZLJA 3CVKA 2YVSA 4QW9A 4L75A 4QBUA 1VJWA 1IWGA 1N6QA 1RUSA 1B3TA 2YH1A 2QA1A 2ZEJA 5KFQA 2HVHA 3FKBA 2VFUA 1VIXA 4IR9A 3EMTA 1Q78A 1TUWA 3AJ2A 6FDRA 3TAQA 3FCWA 2FTRA 2IAJB 5DM7Q 2DR9A 4DN9A 3O1LA 4TQSA 1TL3B 3U1LA 2CQ3A 1NHVA 2FPHX 4B02A 1LW2A 3EM1A 3O3LA 2I5JA 4Q8FA 1Q7LB 2BKPA 1YSJA 2QZ8A 4CI0B 5KFJA 4Y2MA 2CADA 2R7RA 4F4XA 2JWNA 3VZIA 5ETOA 1UW9A 3RGIA 5E2QA 4HYKA 3MECA 2RMLA 1P9YA 3OVAA 5EX0A 4JYAF 5H9EJ 3TOQA 3BO4A 4WZMA 3FZ2A 3SYZA 4MKBA 1T0TV 1ACMB 3RBDA 4XK8C 4DLEA 3GG1A 1H6KX 2VBYA 2N7CA 2V6AA 4GVBB 1S1XB 5I42B 2G13A 1QAJA 3LQVA 1ZYQA 4CH0S 3MEGA 2GJFA 2A2CA 3N9UC 1VK3A 3EWGA 5LMNF 2B43A 7FD1A 1RT6B 2B6AA 2R2UA 3HJFA 4QCLA 1CJVA 4OV1A 3OLAA 3L9ZA 4K2JA 3MTJA 4OQJA 1RWVB 4QYZK 1RHRB 3A3NB 2CJQA 4CLKA 3MF5A 3E2EA 1U8WA 1HYSA 2ZD1A 3FFIA 5CYQB 4BWMA 3E01B 1U02A 2G4BA 3TYTA 4NYZA 4QJVA 2QO3A 3D2WA 2FC8A 1TUGB 3DOKB 1VFJA 2Y1JA 2LXIA 1HWJA 3PR5B 2RAQA 3UVJA 1T9YA 2CVEA 1LWCB 1UEKA 1UTAA 2CJAA 5FIIA 3GPAA 2QL9B 1JWWA 2ROEA 4DG1A 1RBLA 1R8CA 4LBIA 2KHCA 2V2VA 2RRNA 3UFCX 2HRYA 2N4DA 1QUVA 2RU3A 3TZWA 5AE2A 1YQHA 5C25A 4XO0A 4KV8B 4C6AA 1R0BG 4OX9J 3KOAA 4ANEA 4DEZA 4OLPA 3NWRA 1BC6A 3QGHA 3BSCA 4DWIA 2GVZA 2VQFF 3RZAA 2LXUA 3W8PA 1EKSA 4CQ1A 1CLFA 3IRXA 4IG3B 2VIHA 4Q0BA 1NK0A 1NJXA 1NRKA 4DOZA 3GJQB 2OPPA 2XY6A 3KLIA 5EHHA 1FRJA 1IKWA 2DNOA 4QIWD 5KG6A 4DL5A 1IVZA 2HBQB 4ECUA 2I0XA 5BYRA 1UEUA 2V50A 1VBKA 4EYIB 3OTEA 2H9ZA 2WOMB 3T1YJ 3C14B 3AA8A 3IFEA 1SJ4P 3HD2A 2CPJA 2MGZA 2FJEB 1XEZA 4P71A 2IBKA 4JI4J 4IH6A 3L3CA 2RU9A 3DOMA 4WPAA 1Q16B 2C3MA 4ID5B 3EX7B 3L7OA 5B0DA 1WG1A 4YR2A 1VQ6S 5M2RA 1WHVA 4ZPTR 4RU9A 4LIWA 4U7UD 3QJJA 5G0RB 3IG1A 3C2PA 1KQKA 3VGUA 1T9TA 3I82A 3DLJA 3CDEA 3OSNA 2LCWA 4JV5J 3DGVA 3TQEA 3HPOA 5GMEA 3K89A 1SQFA 4N76A 5L9NA 3DDIA 1LOUA 3KHRA 4A4JA 3CCLS 3OHAA 1NZAA 3ILLA 5KFYA 1RTIB 3OFEA 3QGGA 2MPUA 4ED1A 3POTA 3KG1A 1NJYA 3CW2C 2UU9F 4DJBA 5GAGU 2V4QA 3R5JB 2EFGA 4OL8A 4QR1A 3U1NA 4CO4A 4ZP9A 1NPRA 2YKMB 2DNHA 3TX8A 5IC6B 3CCSS 3MMCB 2XSJB 3K17A 2E9TA 3O44A 1NXIA 1C0TB 2FB0A 1RT2B 2B5JA 1HHTP 3R5DA 1WORA 2JEGA 3IO1A 2DXFA 3SCKE 4CT8A 1WTBA 1SKRA 1A6LA 1JX4A 5AJ3J 2DGUA 2HNDA 3MFHA 1ZAVA 2YXLA 4F3QA 1DAXA 2ZOFA 2BJ9A 4OZ0A 1RI7A 1M1KT 1UVNA 2D9PA 5LSRA 2Z57B 2W9BB 4JB8B 1V3ZA 5K8PA 4LF8F 5D0GA 3OQ2A 2LECA 1U48A 4DV2F 3HSGA 2EW9A 4FBTA 3CJ0A 2VFVA 1OIAA 3BN4A 3TA0A 5I3UB 3A3PB 2FHMA 2X3DA 2CG8A 2HQ3A 4AL5A 2HQIA 2QYGA 3HVTB 4PUOA 1WC6A 4ED3A 3LW5C 1R31A 3OR2B 5KG3A 2AJ0A 3QNWB 2X1FA 3C19A 3DOLA 3KJQB 1MLAA 2KN4A 8RUCA 4ZPVR 2V68A 3HFVA 4OZ1A 1P9QC 5LSOA 2V5HG 4KHRA 2RQCA 5KT6A 2CPEA 1HQUA 2NR0A 2UUAF 4PPDA 3M6VA 3NP5A 1OQ6A 1S1WB 1X31C 3HT3A 2QE5A 4K4ZA 1T7PA 1RBOB 1Q79A 3R5CA 1IKYA 2DKOB 2EVZA 3D67A 4DFPA 1R3NA 4DZDA 4MKVA 1PJ6A 4J91A 1RQ0A 3CC2S 4TU9A 5D4PA 3MPVA 4IOCQ 4JI0F 2YKPA 4WXWA 4RW6A 2A0FB 1NSPA 3AOBA 1FNOA 2HQGA 3Q8UA 3NXZA 5HATA 3OBIA 1IWAA 3R97A 3PYEA 3EXYA 4DV5J 1S99A 1X4FA 3SZ2A 1YKWA 4M5HA 3UR0A 4AXIA 4B3RF 3G86A 4ELTA 2YWGA 4CLSA 4A8OA 4EU0A 2CNKB 1KWMA 2O01C 3IBFB 1K1QA 4NEZA 2XNRA 4C0BA 3HZGA 2M9KA 2BR0A 2LQBA 2H65B 3S8SA 2PI4A 1YITS 2OD6A 4X4UA 4DFMA 2AD9A 5L38A 3MM5A 5CD4H 2L41A 2R7XA 1JNZB 1QAIA 3M8QA 3TJ9A 1NDCA 3G6VA 2HWIA 4NXMJ 3I31A 2LP4A 5CH7B 3K5MA 1Q1KA 2QTWA 4K59A 4A47A 3DHWC 4K4YA 5HBMB 2BEFA 2HAFA 3P49B 2OMLA 2V8GA 1TU0B 3RAXA 3TVZA 3W5ZA 3WX8A 1WJ9A 5I4MA 4K4XA 2CNNB 4JI5F 4TXSA 2HHHF 4EFAC 2NXJA 1RYRA 1S6UA 1DTTA 5K14A 3R1HA 4CH7A 1UWBA 1RHQB 4NMLA 2HNZA 4O4GB 3U02A 3B4DA 2IVFB 4K8RA 5FDLB 3N5FA 2MQOA 1WF0A 1B99A 3MM9A 4JI8J 2VG7A 5DGAA 1IKVB 2ACYA 3AOAA 3KLEB 3FQKA 2KYZA 4O4RA 2HQDA 4USUA 1BQXA 3SCIE 2V2QA 3TVYA 1LW0B 2YWEA 1HNZF 4LFBF 5KG7A 2OMOA 4G1PA 3F0NA 2LQ5A 5E0OA 4M5KA 1NO8A 2NXEA 2Q1LA 1LK7A 5LMUF 3JTNA 3KMSA 1U45A 4DR2J 3GSIA 2JRSA 2F8MA 5HLFA 2VUGA 3HHLB 1YBAA 2F1FA 1SIWB 3H98A 3QZ8A 4OZJA 3GV5B 2HVZA 3FBFA 5HROB 4F3MA 1C1BB 5A8KB 2CZ9A 3MHYA 4DPYA 2DGOA 4OLOA 3Q8PB 1Q5VA 1NCLA 1KTQA 1FK9B 5MLCV 3MAHA 4FS1A 5IM0A 2MQQA 4OIXA 1Q8IA 2F9JA 2BRLA 5H9FK 2BE7D 3MAAA 1KOHA 5ETTA 3M8SA 3M6UA 2A3JA 1MWYA 1ICEB 1X9MA 3W66A 4KH1B 2B9EA 2FY8A 2CQ1A 4Y2CA 1PAUB 4DR6J 2HLUA 1RTHA 2AQ4A 4USMA 3R6LB 2QSFA 1UCNA 1N34F 3VQSA 4J9QA 4ZVQB 4TU7A 5AT1B 4JI3F 1RDRA 1Y0HA 3IMQJ 2RS2A 4OYWA 1E6VA 3IAS9 5DQIA 5DG7A 5HL7Q 1FKAF 4RZRA 1VBYA 1VRTA 1XK8A 2F7VA 5BR8J 3W2WA 4WYWA 2ZJRQ 4UOFA 2KL8A 1SKUB 5J1EB 4I56A 2FZCB 3ZZOA 3WIVA 1Y00A 2DITA 2WONB 3D28A 2AWZA 4OZ2A 5K20B 1S1VB 3MI7X 4CNYA 1JLQB 5AXNA 2O3DA 5HQMA 3GIKA 4NA3A 1M1HA 2HRUA 3CD0A 4MT1A 5IQ6A 3BGLA 2YNFA 2M88A 3MCMA 1AUSL 3ITHA 4B3SJ 2CDRB 1FCAA 4JV2A 2YKQA 2KFYA 5IS2A 4F04B 3QAEA 1SB6A 1MMDA 2LA4A 2RQKA 5BJRA 3J7A1 5CYMA 3NCQA 1HD0A 5A2QU 1XIQA 2B0GA 2V2ZA 3ISZA 1NJIT 2QSWA 3AOCA 2OFGX 3WC0A 1NHUA 3PW4A 3V6HA 2EBEA 1FRIA 4YQWA 3BGOP 2UV8A 4DV7F 3SEOA 3IXQA 3TRGA 1KVJA 4I1TA 1RAEB 2OPSA 3KK3B 4X64F 3MCNA 1WG5A 4GO5X 1H2UX 3ZTRA 2KZZA 2EPIA 3ZZ0A 1N33J 1K8AT 1YK9A 3KDOA 4C3LA 5LSLA 2XYGB 4GKJF 2IVMA 1S0VA 4Q43A 2XGPA 1C0UB 4IH7A 2ADBA 3KMQA 3MEDA 5KTQA 1VR6A 5LJ3Y 3AXKA 2OPQB 3JS9A 2GJIA 2CZ4A 4DL2A 5CZVA 4AQYJ 3P45B 2Z2ZA 3MDFA 4ZPWR 3BSAA 3OFHA 2KTQA 4O23A 1CULA 3TUIC 3TA2A 4ZPAA 3OHBA 3DRPB 1L3UA 3FEYB 3SDEA 2EG1A 1JLFA 3OTOF 1DFDA 2HLTA 5J2NA 2NXCA 4KJIA 2HG4A 1RP5A 2O5DA 2DGSA 4ANDA 3G82A 3ZZYA 1HQ2A 1XR7A 2UUCF 2JEIA 3I0SA 4UQGA 1HBUB 3B6BA 3UNYA 3IS9B 1UPPA 2EWHA 3MCOA 3TW0A 5CCLA 5BYSA 3HFKA 1HFEL 5JVHQ 4YDDB 3PW5A 1XQIA 3ILJA 3NS6A 1DLOB 2Z2MA 1N48A 3PW7A 1X5SA 1LWEB 2DTJA 3LALA 2AV5A 3KLGA 4KY3A 2G1DA 2E1CA 4HI2A 2JNJA 5E3PA 3PNIA 4ZITA 5KT4A 3ADAC 1YBUA 2XEXA 2XZWA 4DSIA 2ZVSA 5CZXA 4DR3F 4QPTA 2GFFA 3FEXB 2XZTB 2XO7A 3LH2S 3LA0A 2XLJA 2ZE2B 3T41A 1NKBA 1U1PA 3QFHA 4ER8A 3IM9A 2OP5A 2K1RB 2M8HA 4O44B 1YWXA 1XC9A 1PJ5A 1JXVA 4LF9F 2XMMA 5J2MA 3DDNA 3PRBA 4NCGA 2ASYA 3BYRA 4OYXA 1HBOA 3MUVP 1F5CA 2ZWPA 2W2NP 3KG0A 3TARA 4DR1F 4KHPJ 5I3QA 1FDAA 2IJFA 4LFCJ 1AROP 3HVRA 1NB2A 3GB0A 4LIRA 4HT5A 1G2EA 3CDAA 3HK2A 1SL1A 5KOXA 4XPEA 5ETRA 1LWFA 2YNIA 3R5AA 4GC6A 1Z1ZA 2LEPA 2MKCA 4J37A 1X5OA 2FDNA 3UDVA 4YY3J 3CCTA 1U0HB 2F8EX 1CQNA 2XY5A 5DS7A 3MOJB 3I9ZA 3NS7B 1P6TA 4OI6A 2KM8C 4NRTA 2SXLA 2VJUA 4FYDA 3F41A 4UY85 2VDHA 3BB5A 2UUBJ 3PX0A 4IYQA 4AD6A 2UVUA 1GT8A 4RWWA 4XTTA 3SFGA 2P8IA 3DGPB 3PO5A 3J81j 1YG0A 4B3OA 5KFSA 3D1QA 3FSYA 4N47A 3CIMA 3VHQA 2YPYA 2HIQA 4LRDA 2BM0A 4K0KF 4ZP8A 2ZC4A 2L3MA 1RWKB 3T19A 1T03B 1T02A 3Q23A 2MLYA 3KJFB 1VQLS 4QWAA 1UFKA 2ZKUA 1AZSA 1ZAWA 1WHXA 2DHHA 2Z2YB 4ZHRB 4DUZJ 1RCXB 4C8OA 5CD4A 5AXMA 3EPIA 2KVQE 1RWMB 2KJVA 3GCXP 1RT5B 3UDEA 1KTVA 3EJMA 3ILIA 3MM8B 2ZZNA 2JC1A 3T6JA 5IWAJ 2R7QA 1WI6A 4J9MA 3NEKA 2BQRA 2YNHB 2AJ2A 2W9CA 1RK8A 1JNRB 1WOPA 3Q8YA 5FD1A 2K8GA 4PKDB 4Q7AA 4OYMA 2VG6B 1JK9B 4CM0A 4ES2A 3QT5A 3V4IA 2MQMA 1WWHA 3UN3A 1TL4A 1CPZA 3CJSA 1GMVA 2WVDA 1MWQA 5KFLA 3QT8A 3M2VB 4ICLA 4KB7A 2RDDA 2DT9A 2CFXA 4PXEA 1KLMA 2GAGC 2J7KA 3ILOA 3K5PA 4ZA1A 2ZBQA 2DHSA 3MMBA 1T9VA 4H4MB 2VPXB 1BD6A 4DV3J 4GC7A 4J9NA 3KJVA 2APOA 3GP9A 1YIJS 3PYDA 2IM3A 4NEYA 4HHHA 1ZM9A 1RYSA 4B9SA 5ITHA 1NH7A 3H2LA 3W9JA 4FXDA 4OJ3A 1R8HA 2ROGA 2NCKL 3S7RA 1EIYB 4C8KA 1S76D 4KHMA 4QR2A 4C7QA 5DETA 4FS2A 1RHKB 5F3TA 1FTRA 4P7VA 4OX9F 1H38A 4OI0A 1M90T 1HNIA 2YKOA 4LRCA 3VAMA 1JJCB 4DR4F 1CJUB 5GMKa 4S0MA 3U1MA 1SJRA 2NYIA 1V5IB 3LGHA 1FNXH 4A8KA 3U27A 2J7UA 3G6XA 1S6QA 3DN9A 2ASJA 4OI1A 4XIUA 3MWBA 3D1OA 2BQUA 1FDDA 3TP2A 3IC1A 5KT7A 4B9TA 3R27A 1YJ9S 1GXTA 2XULA 2L9DA 3KHGA 1TL1B 4CTAA 3ZZRA 4P72A 1WDDA 4DQQA 3T5JA 1RTDB 3MECB 4I2QA 2ZVIA 4MAKA 5H9EK 3M2UA 3PEHA 1IBLF 4TQRA 2QA4G 4UOCA 3K5LA 2VOOA 3W3SA 3O5TB 4CP5A 3C3LA 4C4WA 2NS1B 2HMIA 2GQ2A 4JI4F 5HANA 1WI8A 3OXLA 4P2FA 4KBIA 2E1MC 4ZVPB 3R1LA 3SXLA 3ULHA 2IMOA 4Q2LA 3PX6A 3MEGB 5B0EA 4CCHA 4M95A 5A8RA 1YTYA 4JI1F 4C8ZA 1U2FA 2HPUA 2JDJA 2G1HA 2BKOA 2B6AB 4N56A 3CT9A 4W92B 2EI5A 1VQ9S 3CD7A 3V81B 1KDNA 3Q2SC 4YB5A 4JV5F 1S48A 2BW2A 1FRKA 2ZKTA 3VAJA 2GV1A 5DG8A 1PBAA 4KH0B 1HYSB 1ZETA 2ZD1B 4OYBA 3CO0P 2KT3A 1Q0NA 2V8HA 1LFWA 3ENWA 3M8PA 2YQ3A 4JUZA 4B9LA 3DYAA 3UVJB 5L1JA 4NZ0A 4FVMA 2RKIB 2IA6A 4Z7YA 5AXLA 2X1GA 1VQKS 3UDCA 1Y11A 3T3FA 3V5RA 3CGIA 4ZMMA 1IM6A 3MGJA 2ALYB 2HEKA 2DIVA 4ILRA 1VHFA 4R0JA 2CJ9A 4OFZA 1WC0A 4UY8T 3KNAA 2CPXA 1FD8A 2XHCA 1U6ZA 4K7QA 2J6TA 4EEYA 4KO0A 1KVKA 4M5NA 2XS7A 3LPEA 1RTJA 5HO4A 2XY7A 3GILA 1DBDA 3IRXB 3N4WA 3OPKA 4Q0BB 4RWXA 3P96A 2FLPA 1QTNB 1IXKA 1TELA 3JTOA 1R8AA 2OPPB 3D6FB 3MD3A 4FPIA 2FLNA 2LLZA 3MXHP 2V9KA 3QYYA 1TKTA 4QR0A 1TV6B 5F3ZA 5KAKA 2YWFA 1UFLA 1KN6A 3OUYA 2CQHA 3DRRA 4CLZA 2E7XA 4DQIA 2JSXA 3QATA 4J9PA 1UZHA 2FJXA 2F4VJ 4NLSA 5F41A 2QLBB 3CJTA 1FHTA 1N52B 4M63A 3LP0B 2HFZA 3Q89A 4N5SA 3HI9A 2BJDA 2HK3A 4FXWA 3HHLD 2F8HA 3PRVA 5M2UA 1QD1A 5J2QA 1P8GA 4CLYA 3FMBA 1SUQA 4A8MP 5H1SV 3FRYA 2QN6B 2FIUA 3NOGA 4RBTA 4L72B 3IP0A 2B9XA 4OJGA 4HLBA 2VQEF 4M94A 3UR3C 3BJYA 4CO0A 4WP8A 2LFVA 3CJ2A 3M1VB 1QY7A 3N6NA 4IQXA 5KFUA 3ZNJ1 3TAMB 1DJ0A 2KT2A 5A8WA 3FC9A 3IGNA 2L08A 3CEDA 2VPZB 3S1TA 3RB3A 1HNXF 4F4KA 1JIHA 1RWUA 1ZZNA 3Q24A 3LWMA 1N4LA 4DV4F 1VRQC 2YKNA 5KFDA 1BY9A 3SIPB 1W7WA 3C46A 1EQMA 3LP1A 2MZSA 2RUSA 2Y1RI 4W90B 2WVCA 1N5SA 4FZVA 2AGOA 4OJ1A 4DU7A 3J81Y 3PFEA 1O51A 1HMVA 2QYCA 3N79A 4DUTA 2QLXA 4QW8A 2BANB 4L6V3 4NXMF 2GO8A 1I3OB 3MMAA 3BH6B 3OTDA 3SFUA 2QC3A 1NK8A 5C42A 1U1QA 2MKIA 3FNNA 2CJYB 1HPZA 5HVFA 2DGWA 2IC3B 3MR2A 2HNDB 1FKOB 2E44A 1D09B 2Z30B 1U25A 1UFWA 4CIOA 5HQLA 2MSSA 3QIPA 4P6QA 3OL9A 3T5HA 5HMWA 2KRRA 2BABA 4LF5J 2UXDJ 3UD3P 3KLFA 2XLKA 1EP4A 2QL7B 5IQQA 1AW0A 1RABB 4UOGA 1CS4A 4PUOB 3QSYB 2NZ4A 2IM1A 2OUGA 1O8BA 3DOLB 2IPOB 3K8WA 3ZTPA 1YVFA 4MKAA 3CCES 4PWUA 4OYPA 2W2QP 2GA7A 2GC8A 2HHUA 1V3SA 2J0SD 2CJXB 3MEEB 2JLEA 1HQUB 2HHVA 1TL5A 2XC9A 3DLLQ 1Z2ZA 2BJ3A 4WFAQ 4B3MJ 1SCJB 2WRMA 2WVFA 3OSPA 1WEZA 2XGQA 1CBKA 2GVDA 1NDPA 4RO0A 6AT1B 4CLUA 1IKYB 2DXDA 4IQMA 4A48A 1MU2A 3M8YA 1ZH5A 3MD1A 3CE8A 4Y28C 5F0UA 5DDQC 1VBXA 1N32F 1ZZFA 2W1BA 4LR7A 1RT7A 4RW6B 1BGXT 3N0VA 1V9OA 7AT1B 2UP1A 4ECYA 2E29A 1Y4ZB 3CMQA 5CQGA 1N5VA 1S9EA 2EFVA 3BZQA 1H7WA 1ZA1B 4KFBB 4CLTA 4HDHA 1I94F 4DR6F 4UZCA 2QA2A 2F65A 2RQ4A 4ECXA 2HFVA 4Y34A 1XMQJ 5M2PA 5A76A 4V1Ak 3NBPA 1OQ3A 1D9FA 1HKAA 4JV1A 1U09A 2OEMA 3M05A 2AT1B 2QL5B 2OTLS 4EBCA 4KSEB 3BKUA 4IRKA 1VQPS 2W4PA 1X5PA 1XMBA 3M8QB 3R6GB 1XMOJ 1U1RA 1NSQA 4MTPA 3UQSA 2HFOA 8ATCB 4M5GA 1F60B 4PXCA 2Z2LA 1YLXA 3DI6A 1BMQB 3AQOA 2BOPA 3ZFVA 1HR0F 3GV8B 3ZC4A 4IFYB 1DQ8A 1N0VC 3PRDA 5KFNA 4U7CA 5K14B 2ZZTA 2R7VA 1UWBB 3VGTA 3K57A 1GEHA 2RS8A 2EFOA 4FXVA 2VG7B 1BQNA 1IBKJ 2OLWA 5BYQA 3EDQB 1JQGA 1Y7PA 5FLXU 1R6VA 5D0EA 2YH0A 2Y9HA 2EFPA 2D3O1 4ZPDA 1RAAB 5KFPA 3R3TA 2J8SA 1A0OB 2XM3A 1J5EJ 4URQU 2VG5A 3NGKA 1KOOA 3VVTA 5LXRA 1H72C 2POKA 2IJRA 4NYPA 2K3IA 3ZO7A 3UD5A 4A46A 4TU8A 2HZCA 1UJ4A 3UN5A 1OY9A 3CB4A 4DCOB 5HLFB 3W5YA 3GCWP 3UDLA 4NA2A 5KFMA 1L3TA 1CJTA 5KT5A 3G6ES 1KP6A 1S97A 2V69A 3SCJE 1HNWJ 3I32A 3I87A 3ZZPA 4NI2B 2ZH8A 5FLXY 3M4XA 1BQMB 4QU7A 2D41A 4PQUA 2Q6CA 4MK9A 4DV0F 3J80U 3ELHA 4FKXA 1SQGA 1HI8A 5GADI 3O6QA 3GU0A 2AU0A 3PDNA 2KKHA 2Q79A 1S1UA 1S59A 1HW9A 2QIFA 3UWTA 3J7Z5 5LT5A 1TP7A 5KG1A 3BR8A 1HA1A 4MK7A 1RTHB 2E5HA 1TQLA 3GZ7A 4E2FB 3I9V9 3CWJA 3H0PA 1QUPA 2GAHC 3ETMA 5C2CA 2IDLA 5HVHA 4DL6A 2MJNA 3MMJA 1RSCA 2HZAA 2PEHA 3SCLE 2C2DA 2CG4A 2B4UA 1E6VB 3D1HA 1VYAA 4O3NA 4ZVTB 1AA1B 3SSQA 2DEJA 3J80Y 3GFZA 4DX6A 1RAGB 1HQEB 1VRTB 1OYDA 4DV1F 3MZIA 2IAJA 4F50A 2DH8A 1BWVA 4R0EA 2J9EA 1S10A 4WFNQ 1GMWD 1TL3A 1FRXA 1HW8A 2MLZA 2EBGA 4YS2A 3AHPA 2CDQA 4AFFA 3QRRA 1O5JA 2YBVA 5A0YA 2BKNA 3HD1A 1NKCA 4HL9A 4RW7A 4X66J 2PGCA 2HHTA 3EGWB 2YNFB 1LV5A 2E5LJ 2OEKA 4DZ6A 2D9OA 3CCWA 4PAAA 3QRPA 2H48B 1TFYA 5DLGA 1SL0A 1HARA 2VFRA 5CYMB 2R9LA 4ZVUB 4JI6F 3LP2A 3HDSA 2ZNYA 2R4FA 3VAKA 1FRHA 3EZUA 3AY0A 1HBMA 5I42A 3W65A 4Q44A 5KFGA 3QGPA 1N5TA 2CJKA 2G9OA 1FXLA 4V19J 2BE2A 3PKYA 2C28A 1RE1B 1XJWB 4G6VB 3HP6A 1JLGB 3FMWA 3VGSA 2ALZA 3B54A 2BQ3A 2DISA 4JI7J 2P2CB 1SC3B 1REVB 5D77A 1G4CA 1Z4UA 3RAQA 4A8FA 2AYBA 3GQCA 2PE8A 3MEDB 5KFBA 5HI7A 3I55S 4UUWA 1WC1A 1N36F 1XN9A 2CQPA 5CYQA 2JLFA 3K5OA 2ILYA 3GG0A 3D68A 4F4AA 4DQSA 3DFEA 4IH5A 3MM7A 1YGYA 2VB6A 3NCPA 3DOKA 2FVRA 2MLXA 3IWLA 2V4JA 4BC7A 2K2PA 3B4MA 9RUBA 2OPRA 2IY5B 2VASA 4PWDB 2VA2A 1JLEA 2MHNA 1JLFB 3BPDA 2XLIA 3QT7A 3DC2A 1X60A 2KI2A 5AE1A 2HURA 4RW8A 4C8LA 2NSCA 3I0SB 2DHAA 1F0XA 4ELVA 3MR5A 1PGZA 4J9OA 1JLBA 1MWZA 1BHNA 1ELOA 4NLXA 4OZ3A 1S0MA 3EYZA 4B9MA 3M2RB 3KK1B 4MIAA 4RW9B 3NMRA 4NA1A 4KGVB 1FJCA 1KC8T 2WSFC 1RWNB 3SQOP 3SQGB 1VC5A 3G87A 4N8NA 1RHUB 5IWAF 3KLGB 2CKWA 2FD2A 3R8YA 1NK5A 4QWEA 2WW8A 4YP3A 2R3VA 2CPIA 4LRBA 4CM2A 1G1XA 2V0NA 1XNQJ 1WKLA 2R8IA 1ZPVA 4TVAB 2KO1A 2R8HA 1E6YA 2OSRA 3ETOA 2B9YA 2W4CA 3AB2B 2Y0SD 4JBCA 1LNQA 2A6OA 4C0OC 5CAAA 2XYHB 3LF0A 1SPBP 4PYAA 2J0XA 4DBQA 4OI3A 5J2MB 3OT9A 3UCUP 2N3LA 3H5SA 1F5BA 3M32B 3VGVA 3TR5A 1VC6A 1WC3A 2N82B 1H74A 4ID5A 4NLGA 4F25A 1YZ7A 2P9CA 1KD1T 3M30A 3OR1A 4YR3A 3Q83A 2LDIA 3TANA 5D15A 3IRWP 2OTJS 3HSZA 4ZPBA 2ZHOA 4ZCMA 4YB6A 5G0RA 2AGQA 1L3KA 2VZ9A 4LSNA 4Y2KA 1Y5NB 3UPFA 4CLFA 5HMXA 4IR1A 4MK8A 4C3MA 2YNIB 2CNOB 1JKHB 4DR5F 3IN5A 1SV5A 1PBUA 2HNYA 2V8DA 1RAHB 1TK0A 2W7PA 2G2ZA 2DY9A 4YFUA 4ZP6A 2XS2A 4EBEA 2PT0A 1RTIA 4CO3A 4NLUA 3Q2TC 3THVA 4YN3B 5K5MA 1BUXA 4HH0A 5F8IA 4EI2A 1VQ7S 4B3OB 3G4SS 3M8RA 4KKOA 4BHQA 2XMTA 3J7ZT 4DUYF 4L73A 3T5KA 4ZDNA 1EJ7L 2BYCA 4P10A 2WK4A 2RF2A 3CMES 1KONA 1MROA 1C0TA 4ED6A 1RT2A 1UP1A 4YEAA 3I5BA 2JVRA 5EUHA 3CTRA 3HVWA 3B78A 4LR9A 2D74B 2VQFJ 3FEZA 3RJMB 3MEKA 1YRXA 2XSFA 2HGNA 1N5YA 2H5IB 4HR2A 5AXKA 2HS4A 2YQ0A 2A1BA 1TVRB 4UQTA 2KG0A 3HSJA 5I3UA 2RILA 4I2PA 2PFFB 2W9CB 4ILLA 3S01A 2FZKB 4RKUC 2DO0A 2GJ2A 2DPIA 3G8TA 3V4IB 2M2BA 1QAYA 1QDUB 1HD1A 2F4FA 5IZHA 3W64A 3NY0A 2H5EA 3H40A 2HFUA 1SKWA 4OHXA 1S1WA 5F8MA 1KLMB 3KLHB 1QVGR 3PY8A 2ERRA 4PR6A 1GX6A 4LF4F 4E98A 2DB1A 4DSJA 4USJC 3MMBB 5ETNA 3FBEA 2ZM6J 2G2OA 1VLOA 1ZM4A 4DV6J 3CDBA 4ED0A 5KFFA 3KJVB 3BGRA 2C3OA 4WJBA 2PSZA 2GNKA 1VQ5S 4FVCA 4LUBA 2BJEA 3RR7A 3RRHA 3FK4A 1MNEA 3KXDA 5GAEI 2DNLA 3M6XA 4UT4A 3JQJA 2MHEA 3W9HA 1RT4B 2DVIA 3CD5A 2LVWA 3EGZA 5B0GA 3LANA 3H7HB 2B7BB 4R5PA 1WDTA 2NXUA 4DLGA 3OL7A 2BBEA 3I6PA 1B70B 1T9XA 1CSJA 1UA0A 2YWHA 4F0MA 3G9CA 1N5QA 5I3PA 2F9DA 1FX2A 4HTIA 1IQZA 1CEZA 2VA3A 5J2PB 2A10A 2KVIA 3AJDA 1H2VZ 4ZN1A 5D4OA 2XMJA 4QU6A 3GE9A 4AUKA 2GHVC 4I69A 5LXYA 2MY8A 3CJ5A 2ZH9A 4KAIA 4BWJA 4PG4A 1HL6A 1AXQA 3RYLA 3RB4A 2JHEA 3TWZA 5D0HA 5KFIA 2PN6A 1EETB 1Y3KA 2K3KA 5HBMA 4ZN3A 2EC0A 2GIFA 3JAMU 4I7FA 4OYOA 4EZ6A 5F9LA 1S9FA 2IDEA 3X3UA 1FXDA 3OFGA 2I6WA 4ZVRB 2VDIA 2W24A 2DCUB 2HMIB 4LF8J 3IWNC 2HHQA 3CC4S 1S72S 4O4GA 1YRUA 3DLEB 1N54B 4TY9A 5KFWA 4LMZA 3NWGA 3KYLA 1FWLA 2J6SA 3R7BB 4D3HA 3NCRA 5A8RB 1G6BA 2OSQA 5DJBA 2RVJA 1IJFB 4ETXA 3EGVA 4F4ZA 2RDIA 2AEMA 3BBCA 5KG5A 4UF4A 2RH3A 1L3SA 4ED4A 1SQEA 3ENAA 2UUAJ 5DDRC 2KXNB 5LL6d 1IKXA 2VD3A 1WHYA 4B9NA 3W7BA 1T05A 3X1LB 1H2TZ 5KT3A 4NWBA 5A8KA 4JI0J 2D7SA 5KG0A 3DLHA 4ED5A 1CQMA 2J9DE 3GR0A 2R7UA 2EFQA 2D3OR 1DARA 2XMKA 4CLLA 3DYAB 3CMAS 1CC8A 2ZUAA 1DTQB 2ZH1A 1GXLA 4ID8A 3BYPA 5CABA 2AP6A 1PCAA 4TYBA 4NRUA 3CCVS 2P6SA 1S0NA 3HX9A 4KGXB 1PIEA 4E8UA 7FDRA 4NXNJ 3DM2A 2GO9A 3CCQS 2DH7A 2JH3A 3E51A 1M5SA 2Z58B 4YR0A 4ZLPA 3MM6A 2Z0GA 2LU2A 3BBFA 3MPWA 1I5OB 2VV5A 4KO0B 4OYIA 4O3OA 1YJNS 3P8BB 1Q81T 5EGYA 1PILA 3HSDA 3PG9A 1S1TB 3HJVA 5KFOA 1DY3A 5J1EA 4J9UE 1FJ7A 5C24B 5JVGQ 3M8WA 3GJTB 1NJWA 2OAUA 4HI1A 4OX7A 1G3OA 2DEIA 4AYBD 2I38A 2NLWA 1TKTB 1KNZA 3OUYB 2DIUA 3GYGA 3DRRB 1EZZB 3T9NA 5HP1B 3A8IA 4CLWA 4ZS6A 4L74A 2NUHA 1KFDA 2GHWA 1UVKA 4N41A 4RUHA 3H20A 1QE1B 1C4CA 2J5AA 5E3RA 5K9FA 5IT0A 2CQ2A 3IAM9 4B3MF 2VL1A 2HBRB 3NGSA 3RBZA 2EXUA 1OJ4A 1EARA 2YKAA 1J5OA 4LF6F 2Q66A 5J2QB 4CH1A 2LXFA 1SUQB 1RAFB 1SJ3P 4OX6A 1VOMA 3KFWX 1K47A 4LFBJ 1LXJA 2AGPA 5F8NA 2RHSB 3KK3A 3BQ0A 5HK4A 5HN0A 2R8JA 5LOQA 2M5YA 4EGLA 5LMUJ 1H98A 2CVIA 4C11A 4LFAF 1C0UA 4NLYA 2QFJA 3IR5B 4W98A 3C6TB 5HSPA 1TAUA 2FGOA 4F7VA 2FJAB 2Y8WA 4IOAQ 4ZLNA 1RAIB 1XMQF 4DX8H 2PMZD 3BH7B 3WX4A 1X8DA 2W25A 2JFDA 4LJMA 2XG8A 2A2DA 2DY1A 1RA7A 5K8MA 1FI4A 4QOTA 4ECZA 3DRPA 3CULA 2UXCJ 3KK2A 3GJRB 2DNNA 4C3KA 3RAMA 1XR6A 3H5YA 4F2RA 4FYWB 4OZ5A 2AJ4A 1HMVB 2GX8A 1FDNA 1RKIA 3G8QA 1X4DA 2XHWA 4M5DA 3IS9A 1PYTA 4L3NA 2PA8D 4FF4A 3TVKA 2HWTA 4JI3J 1KQSR 3AAWB 3L09A 3CJ8A 3DRXA 4LF7J 4WFYA 2P9GA 3W9IA 4Y3CA 3HFZB 3JB9k 3P5BP 3E8OA 1X7VA 2J76E 1DLOA 4P2MA 3BDPA 3G2XA 3CUNA 1SI9A 4M5LA 1LWEA 3HVAA 3P5TL 1NPPA 3NNHA 1SC1B 1JLCB 1RT3B 1WHWA 4ZVEA 3R2DJ 1FJGF 2H51B 4F2SA 1NB7A 4G1IA 3PJ9A 2GIRA 4EYHB 1WKJA 1RT1B 1IN0A 1VLYA 2W8LA 4ECVA 1FXRA 2QGFB 5IC4B 1U6FA 1XNRF 5K8OA 2K1RA 4WIQA 2NPIA 3KJNB 4LRAA 2OJ3A 1NDKA 5HJXA 2EG2A 2OO4A 3DRYA 4K4WA 4ZIWA 2CNLB 5HQ8A 3QT6A 1MU2B 1FNMA 5DQHA 3RR8A 1HNWF 3CCMS 4DV7J 1RT7B 2YY3A 2HS3A 4F02A 4UUXA 3N6LA 4X64J 3R7SB 3VAIA 3KHHA 3MR7A 4B3TJ 3OL8A 3QZ7A 2PA3A 4KGKA 4FBUA 3KNGA 2E7VA 5JJBA 4NPOA 2M0GB 1BXNA 1S9EB 3JSYA 1HWKA 4GKJJ 1O6XA 4ILMA 3PX4A 2COLA 2B56A 3W61A 1U4BA 4BS2A 1ZM3A 1URRA 3TAPA 5THWA 1UETA 4ES3A 5CYJA 2B3TB 1U0HA 1RU1A 3OL6A 2DNPA 3HULA 1S4FA 1YJTA 1U7LA 3H25A 1NM2A 4NE9C 4FDFA 2VFSA 2RIJA 2VICA 1TFWA 3NBPB 1FESA 4Y0FA 2B4OA 3QWPA 2V9WA 3Q8SB 4L3KA 4DPUA 3DGPA 2UXBF 3LAKA 2ASLA 4WE1A 4HT7A 4WIIA 1P27B 2IIHA 1YX2A 4IDKB 3OTOJ 1FA0A 4OYZA 5EDWA 3WHIA 1NUEA 4IOBA 2E66A 2JVOA 2UUCJ 1XBWA 3D5MA 4DL4A 2V8VA 2ATCB 2BJ8A 2C2NA 3DI6B 4WKRA 2W2MP 3GR1A 2HVEA 2NSBA 3K8VA 4PG5A 4USVA 2R8KA 4DR7F 2E5LF 3NRBA 2MKSA 2C42A 4TY8A 3D6TB 4C2MA 3WZ0A 4P9SA 3PHEA 1RT5A 3I5AA 4FNIA 2XCAA 3Q22A 2DNQA 2VKRA 4J5OA 4Y6IA 1BQNB 2WBRA 4NLRA 3JQKA 1CG2A 2YNHA 5IT4A 3FCVA 5ADZA 5CA5A 4DR3J 5D4LA 5C7PA 4M5JA 1SC4B 4NLWA 1S77D 3NMAA 4B9UA 4IG0B 4RX6A 1HIYA 2MKHA 2RNEA 1DQAA 1W2BR 4XAKA 3M2VA 1S7HA 1Q8KA 4U8VA 4X4TA 1Q8LA 3CCUS 4LF9J 1NPKA 2HKEA 2DRAA 5A6WA 1PG5B 4ENOA 2HFNA 3UNGC 1CJTB 4LR8A 4EUVA 3FRZA 2C3YA 5A2QY 2MQPA 5D8HB 1PAEX 4DR1J 1H0HB 3HF5A 4PQUB 4H54A 2OFHX 1ZA2B 5KFKA 2KH9A 2Z56B 1I51B 3QAUA 4YB1P 3A8EA 1VDHA 1XWLA 4JP8A 1TKZB 4W4MA 4NLOA 5EN1A 2W01A 2ZHAA 3C16B 1Q53A 4KYZA 3EDRB 5JUMA 1HWLA 1KQGB 2G0JA 3AT1B 3PHTA 1MW7A 3HHEA 3H42A 3BKTA 3Q0AA 2GCFA 4DFJA 5DQGA 1IBMJ 3GFYA 3P6YC 3CJKB 2XMVA 1ZOTA 1CJUA 2ATLA 1K0VA 2ASDA 1QVFR 4UZBA 1ZTTA 3JTPA 2FLLA 4HHUA 2JZ5A 3GJSB 1Y5IB 3T1HJ 2EKYA 1S9GB 2HYIB 3NL0A 1OPIA 2XYPB 4Y2IA 3AFGA 4OX8A 2ZH5A 1HWUA 2DK2A 4ERDA 1YHQS 4DL3A 4K0KJ 4U9RA 4F67A 1JLAA 5HMZA 3BR9A 2BRKA 2PFDA 1NZ8A 4ZOSA 3ONQA 4OJHA 5A0YB 3MR6A 1TL1A 4DF8A 5KFAA 3K0JA 2W7AA 3HHLC 5KFVA 4OZNA 3THTA 1RACB 3PCOB 4RW7B 2VOPA 3GIIA 1XNQF 3BF4A 1PO6A 1RTDA 3S6EA 2QFIA 1B0PA 1C2PA 3JSRA 1IBCB 1JXEA 1SC6A 2B8PA 2JJ4D 2YX7A 3W2VB 3HKWA 3Q86A 4QQBA 1HBNA 3DCAA 5KOWA 2ACMA 3LP2B 4LBHA 2X3GA 3CDUA 3IGVA 5F8GA 2MMYA 1HBMB 3WIUA 3NGUA 3U7JA 1U49A 3MOZA 2BE2B 2Y1LB 2E1AA 2DHXA 2LMIA 2BZ2A 3VQTA 1B7YB 1Y10A 4NLPA 3VALA 2C2RA 4NL5A 2NREA 4HH1A 3NS5A 2ADCA 1KSPA 4HVZA 3V81A 3EGNA 2DNYA 2F5GA 4E0DA 1WELA 1Q4RA 2KYXA 1YRTA 2DNRA 4O3QA 4DSLA 3I96A 2MDAA 4TYAA 5K8NA 3A4TA 5ETPA 1R0CB 2GGPA 2HVIA 2M7SA 2OI2A 3QBCA 4ELUA 3H5UA 3MM7B 5D3GA 4FYVB 1TZ0A 3QGIA 4KPYA 4P2SA 2WTFA 2JL9A 2VONA 4QWCA 5EWEA 2V4JB 4A8QA 2QG9B 4ED7A 4K4VA 3BDEA 1U1KA 2OPRB 4LVOP 1MG7A 1JLEB 2RKIA 3SSSA 3A12A 4DCPB 4RW8B 4YHHJ 1GAOA 5ETLA 5ETVA 3UN2A 4DL0C 5DZ7A 2MZTA 4ES1A 3NNAA 2A6MA 3OJSA 5IV4A 3Q8RB 1X4GA 2AMCB 4AL7A 1W2IA 4HHJA 4P2XA 2ZFHA 5GAGI 2I8EA 1JLBB 3FSXA 3CF5Q 2HQFA 1D8ZA 4DR4J 1PYOB 4KPCA 4LT6A 4MIBA 3QFWA 3D66A 4PXBA 2FJBB 1UA1A 1UVMA 2YNGA 3FCHA 5DM6Q 3V6KA 2R42A 3ISNC 1UJ6A 4MFBA 3B8HA 2XMWA 1HI0P 4F4YA 1DURA 2B7CB 1SJFA 1NU4A 1UPMB 4B9VA 2R7WA 4YUDA 2H5JB 2DGQA 3I4HX 1TV6A 5L46A 4WBFA 5CHCB 1EB0A 1XERA 4IO1A 1A7GE 2NXNA 1E6YB 3M8ZA 3SBMA 1H73A 1IBLJ 2UUTA 3LP0A 1JXLA 3GV7B 3JYTA 4IRDA 3DMJB 4RNOA 1UWAA 5J1PA 3CCJS 2AZ3A 4DPTA 3TQ1A 1EKRA 1B7FA 3LGMA 2RRBA 2EFNA 2R2SA 4ZP7A 1F9EB 2PMWA 2ZM6F 1QSLA 4DV6F 3M30B 2DGVA 4F0HA 3EXCX 3QQCD 3OR1B 4UOHA 3V4MA 1TKXB 1D3WA 2E1PA 5SUHA 1OS5A 2V2KA 4JI1J 4RW4B 3MPDA 2XB2D 4R8UA 3BM7A 4LSNB 3AD9C 2QX0A 4OHYA 3JSMB 1UL3A 2DR6A 3IR6B 3M1VA 4URGA 4DHVA 1YJRA 1KLNA 3TAMA 2AYGA 1SJQA 4I6AA 4DPOA 1SV5B 2HNYB 5U47A 1M5HA 4ZKAA 1AUDA 2DNMA 1I1GA 2FVSA 4LBPA 3WBZA 2AEFA 2IYIA 2H4WB 1U24A 2WZ1A 4RNHA 3QIDA 4CDIA 1R89A 1EAYC 1NK6A 1WACA 3ET6A 3KKFA 1N6QB 2C2OB 2KXHA 1X9SA 5L1IA 4KKOB 1X0PA 1DZ5A 1X4HA 1IR0A 2ZH6A 5FJ4A 4RNFA 4RU2A 5DO2A 1VK8A 2RF2B 2QMWA 1RB0A 1MROB 1PKUA 2BANA 1LW2B 4KT0C 3PEJA 4UW2A 2I5JB 3AB4B 4O0NA 5KG2A 3HKZD 1Q86T 4G3IA 1JMTA 3D3CJ 3DU5A 1HHQA 5E33A 4DPWA 2HGLA 4GKKJ 3M9OB 2ZJQQ 2IC3A 1G7CB 1FKOA 4ZCLA 3ZXWA 2CZVC 3T1YF 5T14A 2C22A 1X4BA 1N5YB 4UTGA 2CQBA 3CIZA 1WOSA 2UVVA 1R7IA 4MMOA 1RLDA 1FT8A 4NLDA 4KRWA 4I2PB 3T5LA 1D1UA 3RW6A 1VQNS 4X65J 2VH7A 1BLUA 3HXMA 2GMHA 1TK8A 1V6HA 3SMZA 2PO4A 2J9DA 2FLOA 3V6DA 2CXEA 1RZMA 3D4JA 5SZTA 3MEEA 1SH3A 4Y00A 3NGTA 3VCDA 4WCEQ 1FEEA 1CJVB 4O3PA 4BDPA 4ZIVA 3JQMA 1F3VA 5B09A 3MURP 2ZZMA 3E3XA 3FFIB 4LQ3A 3PJWA 1N0UA 4WK1A 2BX6A 2HVDA 2IM2A 2P6TA 3FQLA 4DF4A 5ETSA 3LTOA 3DLBA 3BGRB 2MEWA 2YX4A 1I6JA 4O3SA 1FJEB 1R0AA 4X4NA 4RL1A 5E3AA 2VQEJ 3D0GE 4NASA 1NH8A 2CQCA 5JMNA 1RLCL 3ENVA 4K4UA 1YI2S 3TZZA 4DG1B 2OKQA 4R5PB 4KFBA 3TUZC 4ATNA 4HACA 4KGZB 4PABA 1GMUA 4WXOA 3CD6S 4NXNF 1WG4A 3ENQA 3D54A 5T7LA 2ZBPA 5C25B 2HHPA 1HNXJ 1N88A 1NHKL 1WD6A 2D3ZA 4CZCA 4DV4J 2PIIA 2DR8A 4KR0B 3MR3A 3BBBA 1ULRA 2E7WA 2ZOMA 2GVZB 1VISA 5AJ3F 5KFZA 3D3BJ 1WEXA 2CPZA 1D8YA 2OD4A 1ZS6A 4P52A 5DG9A 1T3OA 2EK1A 1FFGB 1RGVA 3JSBA 2QT7A 2EC2A 1RHMB 1C1CA 1KS2A 3G6YA 3CDWA 1DQ9A 3KLIB 3CXCR 1JJHA 1IKWB 3OVBA 4I7FB 2WCXA 1U2RA 4IFYA 2ZBIA 2YWWA 2YTCA 4WTOB 5ETMA 2MGZB 2G0IA 3GLJA 3TJ8A 4TLRA 2J8AA 2OEJA 3L95X 1RISA 1SVDA 5KFXA 2C2KB 1U1NA 3DOMB 3QJPA 2LEBA 4MH8A 2LQ9A 1K44A 3Q8VA 3D7SB 2BW7A 2DCLA 2AJFE 1T9UA 4RBUA 2IJNA 2Y3YA 4BC9A 2JLGA 2IVYA 4A8SA 5D6GA 3IG1B 4N77A 2V63A 3US5A 3BPSP 4J9KA 1M1GA 3N6MA 2CQGA 5KT2A 4H4OA 2RUGA 1ZBTA 1IKXB 1GX5A 4DV5F 1WOOA 4O0IA 1T05B 4EBDA 2P9EA 5F0WA 1OSCA 5IOLA 1S6OA 2C3PA 1N32J 3IWXA 4NI2A 1BWEA 4NLVA 3POTB 1BQMA 1FX4A 4KIAA 3I0RA 2UXCF 2AJQA 4QIEA 4MJKA 5KFCA 1YZ6A 4M1KA 3C6UA 2HSEB 3CPWR 2XTJP 3R9LA 3CJQA 3DLKA 4C8YA 1I94J 1NKEA 3HHKA 4U8YA 1FE4A 2VBXA 4M5IA 5EWGA 3DM2B 3OFFA 5D78A 1SKSA 1X0FA 3L7UA 2JEJA 3EZOA 1GTHA 2V4RA 3MM6B 2B5JB 4QYRA 2KFZA 2ZBCA 1H3DA 4I64A 2HW3A 3EICA 2GMJA 5DRKA 2PEBA 4LF7F 1Z2LA 3UO0A 2MZ1A 2W2OP 4Q5VA 3BQ1A 2MKYA 4DS4A 1RWWB 1LWXA 3UI3A 1HQEA 4QIVA 2IFXA 1U26A 3IA0A 1NSKL 3FDSA 3FVYA 3FGVA 1K73T 4FF3A 2V67A 1U8SA 1FRLA 3BGFA 1F2HA 4M8LA 2KM8B 3CO9A 4BCAA 4ZCKA 4DQRA 4JI8F 1WKKA 1SH2A 3QLHA 2CPFA 1T95A 3TUPA 2WVEA 3KHLA 1HR0J 2VC0A 2FC9A 2K7JA 1GXUA 3K2YA 1S6PA 1W26A 4C8MA 2FJWA 2ZOGA 4OHWA 4P74A 4YOEA 4IFVA 2CUYA 1X5TA 1FD2A 4DR2F 3OD2A 4X4PA 1JJ2R 1J5OB 2B9WA 2DBBA 4EWTA 1IUJA 1FRMA 2YQ1A 2O67A 3DHXA 3KWMA 3DXBA 4Y65A 4ZK7M 1X9WA 1SBRA 1JLGA 2Y8YA 3KG4A 2J9CA 3NOCA 3QO9A 1YBTA 4F26A 2JX2A 4TLQA 2HZVA 1REVA 1P1TA 4B3TF 4C11B 4IO9Q 4X2BA 1UKUA 1FO1A 3ZTQA 4DN0A 2MZJA 3EUNA 1YDLA 6FD1A 4RUCA 3H59A 4K5SA 1GK8A 1SL2A 1TL7A 2FQQB 4LSLA 2ILZA 2IRXA 1S4EA 3PJXA 3W1YC 3H4DA 4K4TA 1TR0A 4FYXB 1WSRA 1Y3JA 2H4YB 4DV0J 1WUUA 1U1MA 1FERA 2IMWP 3RBEA 2DH9A 3RRKA 2BOAA 3KK2B 4PWDA 4G1QA 1VRUA 1ZAXA 5BR8F 5KFEA 4CYUA 1CJKA 3RB6A 3MM5B 1PC5A 4OI2A 4HEA9 1YJ7A 1F6TA 2M4MA 1EHWA 4Y2AA 3OVSA 2P5VA 4QIGA 4HDGA 2HGMA 4M5DB 2H1YA 2HBYB 4AT1B 2WB1D 2C1EB 1S5ZA 4CWBA 1ITPA 1LXNA 1KHVA 3H2VE 2UUWA 1LFPA 1XR5A 2KU7A 3M2RA 3KK1A 2AW0A 4RW9A 1HWIA 2D3UA 1QJHA 2R8GA 4ZVHA 4B3SF 1TMMA 4DV1J 4A8XA 4PG8A 1DTTB 2QLJB 4MYTA 2WVBA 1FVSA 3SQGA 2B4PA 2HNZB 2RJZA 2KHDA 2I9SA 2CWXA 2X51A 2QA4S 1F1BB 2RE1A 4DSEA 3MM9B 1L3VA 2J6UA 2HIYA 2FHKA 4DDFA 1M5OC 3C15A 4XDDA 3EPGA 3HM9A 2X1BA 3MTKA 4ITSA 4DS5A 1RHJB 4ZCIA 3TEHB 4J9RA 1VHIA 4QIFA 2O1PA 1PYSB 4KGMA 4FYYB 2ZNZA 1RWOB 2V8PA 2LDYA 3PIPQ 1CC7A 1N33F 3PZPA 4WTYA 5L9XA 1RADB 1NK7A 4JI6J 1Q7YT 4WFZA 3M32A 3EVMA 1KHWA 2F63A 4WKYA 4NZ6A 3TO8A 4CO5A 4AQYF 3IM8A 2CPHA 2Z8QA 1HNVA 1SIZA 1R8PA 1VIOA 3NG8A 3HZEA 1RBAA 4JI2J 3FBCA 1T11A 3GSDA 4I67A 3O8WA 5GVQA 1GNKA 3UW1A 5E3CA 5MAOA 4WP9A 3DRSA 5IM0B 2R7OA 3MAAB 5E5NA 1UVJA 4NYOA 1MMNA 5G4DA 1XTZA 1JKHA 2K06A 2KT5A 1N36J 4LQ9A 1GQEA 3NLCA 3NGDA 1SXLA 5RUBA 1AFIA 3DLGA 4ED2A 5DDPC 1FKPA 3VTIA 1IBMF 2YWKA 1U6BA 1RAOA 2XCPA 1UJ5A 2VF3A 3TA1A 3M9MB 3A13A 4RR5A 3H5XA 1KBRA 2AKWB 2R2RA 4WE1B 4USWA 2HHSA 2FHJD 4CRJA 3BSNA 1R8BA 2XWXA 2XMAA 3T1HF 4PEOA 3W2WB 4NOHA 3UCZP 3IR7B 2HHXA 3RB0A 1WTFA 3CCRS 4EK2A 1T8EA 3OXGA 1KVIA 1D9DA 3FZBA 4X4VA 2CA9A 2KFNA 4QWBA 3W62A 3VAFA 2M8DB 3QSIA 4FF1A 3G71S 3K58A 4BLGA 2NUUG 3KUGA 4QPXA 4R25A 4TY8B 3ITHB 2KB2A 4ECQA 1D0EA 2W2PP 2WW4A 4N8OA 2FYXA 4CNZA 2XNQA 4NX9A 1TVRA 2QEXS 4GVBA 5D0RA 4U6PA 1S1XA 1NDLA 4X62J 1TUVA 3H90A 5L8RC 2J7WA 4KHPF 3PR4A 1DRZA 3F73A 3IBCB 2RSQA 3GYNA 2OPSB 4LFCF 1RT6A 9ATCB 2BE9B 1QAXA 1FWPA 2BJ7A 2CAJA 2G0CA 3KLHA 1L5UA 3PXGa 3RW7A 2NZCA 4QYZJ 1O0PA 2GQCA 2ZH7A 5GADU 4PWWA 2DRDA 4BBYA 4Q2MA 2KZMA 2XI2A 2MTLA 1BE4A 1W25A 2OGUA 2FZGB 4YY3F 3UD4P 3E01A 3DU6A 4MKYA 4OYAA 2AIRB 3MFIA 4DXLA 1NBEB 5KFRA 4YMEA 2ZITA 4RUBA 2ZUGA 1CULB
chains in the Genus database with same CATH topology
4WU3A 4NCAA 1EP4A 5B0DA 1WG1A 4YR2A 1VQ6S 2UUBF 5IQQA 5M2RA 4IDKB 1AW0A 1WHVA 4ZPTR 4RU9A 4LIWA 1FA0A 3CCZA 3QJJA 4I6WA 4PUOB 5EDWA 1LWCA 2NZ4A 3ZZTA 1RT4A 2IM1A 5G0RB 3IG1A 4IOBA 1O8BA 3DOLB 2CYYA 2E66A 1TKDA 3SDEB 2JVOA 3C2PA 1KQKA 1XBWA 3K8WA 1YVFA 2BUNA 5J2NB 3D5MA 4MKAA 3I82A 4YHHF 3DLJA 3PV8A 4DL4A 2V8VA 3CCES 4PWUA 2GA7A 2GC8A 3DI6B 3CDEA 2HHUA 4WKRA 1V3SA 2J0SD 3OSNA 2LCWA 3GR1A 3MEEB 5F8LA 2NSBA 2X1AA 2JLEA 3K8VA 1HQUB 3ICLA 4PG5A 3HPOA 2HHVA 1TL5A 4KV8A 2XC9A 4A8YA 3DLLQ 2R8KA 4DR7F 1Z2ZA 4WFAQ 2E5LF 1FVQA 3NRBA 2MKSA 2WBMA 2C42A 4IUFA 4J9LA 1YJWS 4N76A 2WRMA 5L9NA 1LOUA 1SJ1A 2W9AA 3KHRA 3OSPA 4A4JA 4TY8A 2LQJA 3CCLS 3OHAA 1WEZA 4WFXA 1NZAA 3WZ0A 4C2MA 2XGQA 5KFYA 1N8RT 5J2PA 3PHEA 1RTIB 4AL6A 1IKYB 3OFEA 1YJUA 1RT5A 2MPUA 1X4AA 3QGGA 4IQMA 4NLQA 4A48A 4ED1A 3POTA 1MU2A 3KG1A 3I5AA 1NJYA 3GYXB 3HHNB 2PI5A 2UU9F 3MD1A 1ZH5A 3CE8A 4FNIA 2XCAA 4DUZF 4DJBA 4Y28C 5F0UA 5DDQC 3Q22A 1VBXA 2DNQA 2VKRA 4J5OA 3GWCA 1BQNB 2WBRA 4Y6IA 4NLRA 1N32F 1ZZFA 5GAGU 1M5VC 2V4QA 2VFTA 4WZQA 1CG2A 1VQYA 2IM0A 2GW8A 4IG3A 2EFGA 4OL8A 4QR1A 2YNHA 3U1NA 4CO4A 1RT7A 4RW6B 1BGXT 1UAWA 4ZP9A 5IT4A 3N0VA 1V9OA 2ZH3A 2CPDA 2UP1A 1JLAB 2HS0A 4TKTA 2YKMB 1U1LA 5ADZA 5CA5A 4ECYA 5EWFA 4NZ7A 5D4LA 2DNHA 2E29A 4NLWA 1Y4ZB 1S77D 4PXDA 3NMAA 4B9UA 5CQGA 2OH2A 3TX8A 1N5VA 4IG0B 4RX6A 3CCSS 1EETA 2E9RX 2GIQA 1S9EA 4HTJA 3MMCB 2XSJB 2EFVA 3BZQA 2E9TA 2MKHA 3O44A 2RNEA 4K4SA 3VZHA 1H7WA 5E3QA 1DQAA 5LJ5Y 4KFBB 4DQPA 1W2BR 1C0TB 4HDHA 4XAKA 2FB0A 3M2VA 1RT2B 1S7HA 3UE2A 1I94F 2B5JA 4DR6F 3ZZUA 4X4TA 1Q8LA 1HHTP 3R5DA 3CCUS 2QA2A 2JEGA 3IO1A 2RQ4A 4IRCA 2E9ZA 2DRAA 5A6WA 3WC2A 2WOMA 2HFNA 4ECXA 3SCKE 5E7OB 3UNGC 3VAHA 5B0AA 4Y34A 4CT8A 5M2PA 1WTBA 1SKRA 1A6LA 2R2TA 1JX4A 1HBNB 1P1LA 2DGUA 2HNDA 4P7TA 3TI0A 4EUVA 3NBPA 1T3NA 3MFHA 1ZAVA 3DLEA 3FRZA 3VR1A 1AFJA 2C3YA 4F3QA 1B0VA 5A2QY 4U67Q 1DAXA 4NCGB 1OQ3A 2ZOFA 4OZ0A 1RI7A 1M1KT 2CQIA 1D9FA 1UVNA 2D9PA 2MQPA 4JV1A 1U09A 3M05A 5D8HB 5LSRA 1H0HB 2W9BB 1V3ZA 1HBOB 3HF5A 5K8PA 1QTMA 4LF8F 4PQUB 4H54A 3OQ2A 2OFHX 3DNCA 2LECA 1U48A 4DV2F 3BO2A 2A18A 1HI1A 2EW9A 5KFKA 2OTLS 3CJ0A 2VFVA 1OIAA 4H4KA 3BN4A 3TA0A 2KH9A 4FBTA 5GAHI 5I3UB 4DV3F 2FHMA 4EBCA 2U1AA 4KSEB 2HQ3A 3QAUA 1U1OA 4AL5A 1UVIA 4YB1P 2HQIA 4IRKA 3BQ2A 1OO0B 1VQPS 3HVTB 2W4PA 5HMYA 4PUOA 1X5PA 1XMBA 4ED3A 3A8EA 3M8QB 1U1RA 3LW5C 1R31A 3OR2B 4MTPA 2AJ0A 5KG3A 1XWLA 2W8KA 2X1FA 3QJLA 3DOLA 3UQSA 2HFOA 1TKZB 2KN4A 3M6WA 4NLOA 5EN1A 1F60B 2ZHAA 4PXCA 2Z2LA 4ZPVR 1FEHA 3QWUA 1Q53A 2CQ4A 3SI8A 4PPZA 5JUMA 1HWLA 1KQGB 3DI6A 4OZ1A 1P9QC 2RT3A 3AQOA 2BOPA 3ZFVA 5LSOA 1MW7A 1HR0F 2V5HG 3HHEA 1LWFB 4KHRA 2RQCA 3BN7A 3LUYA 5KT6A 2CPEA 3GV8B 3Q0AA 3ZC4A 1HQUA 2GCFA 2NR0A 4DFJA 5DQGA 2GGPB 2UUAF 4PPDA 3EZ5A 4FN5A 4IFYB 1DQ8A 3M6VA 1OQ6A 3NP5A 1U47A 1S1WB 3GFYA 1N0VC 3P6YC 3CJKB 4PRFA 3PRDA 4OZLA 3HT3A 2QE5A 4K4ZA 2XMVA 5KFNA 1ZOTA 4U7CA 1T7PA 1RA6A 5K14B 2ATLA 1K0VA 2ASDA 1Q79A 5D3GB 3R5CA 2R7VA 1IKYA 2MQLA 1UWBB 1QVFR 3K57A 1ZTTA 2EVZA 3JTPA 4DFPA 2FLLA 1WF2A 1R3NA 2RS8A 2JZ5A 2GMLA 3BS9A 2EFOA 1RKJA 4FXVA 2J0QD 1RQ0A 2VG7B 1Y5IB 1BQNA 3CC2S 2EKYA 1S9GB 2HYIB 2OLWA 5DLFA 4J9SA 5BYQA 3NL0A 4TU9A 5D4PA 1OPIA 1DTQA 4Y2IA 1Y7PA 2IRYA 4OX8A 2ZH5A 1HWUA 2DK2A 3BGUA 3MPVA 4IOCQ 1YHQS 4ERDA 4JI0F 2PD1A 2YKPA 2YH0A 4WXWA 2N3OA 4RW6A 4DL3A 2HHWA 1NJZA 2MY7A 4X4RA 2EFPA 4U9RA 4F67A 1JLAA 2DNZA 4ZPDA 5HMZA 3GMGA 1FNOA 1T94A 2YKMA 1KQFB 5KFPA 3R3TA 3BR9A 2E5IA 4FP9A 3PW0A 5B0BA 2BRKA 2MYFA 4URQU 4ZOSA 3ONQA 4OJHA 5A0YB 4WFBQ 1TL1A 3MR6A 4DF8A 5KFAA 2VG5A 1WF1A 3OBIA 3K0JA 2W7AA 3HHLC 5KFVA 3MMCA 2XSJA 1S49A 4OZNA 3THTA 3NGKA 1KOOA 3EXYA 4RW7B 3GIIA 3VF0B 1XNQF 3N28A 5LXRA 1UVLA 2VOPA 1S99A 1X4FA 2POKA 3GFHA 3BF4A 1PO6A 1RTDA 3S6EA 4NYPA 3SZ2A 2K3IA 3UR0A 4AXIA 1B0PA 4F8RA 2FVCA 4A46A 2HZCA 4TU8A 3V2UC 1UJ4A 3BO3A 4B3RF 1C2PA 3JSRA 3CB4A 3V6JA 3G86A 3OV7A 1JXEA 1SC6A 5J1NA 5HLFB 1F5AA 4ELTA 2AYMA 2YWGA 2JJ4D 2YX7A 3W2VB 3UDLA 3HKWA 4NA2A 4A8OA 4EU0A 4GKKF 5KFMA 2YNGB 3J7YI 1L3TA 4QQBA 5KT5A 2O01C 2MZQA 3G6ES 1HBNA 1K1QA 3DCAA 2XNRA 5KOWA 4C0BA 1LKZA 3LP2B 1S97A 2X3GA 3CDUA 3SCJE 3IGVA 1D9AA 3I32A 4MFBB 4ECSA 3HZGA 2AF6A 3I87A 3ZZPA 5F8GA 1S1TA 2MMYA 2ZH8A 2M9KA 5FLXY 2BR0A 1HBMB 2N7YA 5IXUA 3M4XA 2W9BA 1BQMB 4QU7A 2LQBA 3C66A 2D41A 3S8SA 2PI4A 4PQUA 1YITS 3U7JA 3T6BA 1U49A 2Q6CA 4MK9A 4DV0F 5C24A 3MOZA 2BE2B 2OD6A 4X4UA 4DFMA 2AD9A 2E1AA 3CSKA 2DHXA 2LMIA 5L38A 2BZ2A 2FHOB 3IBWA 3MM5A 3RRGA 4X65F 1HI8A 1NEEA 5CD4H 2L41A 2R7XA 3HVTA 5GADI 3O6QA 1JNZB 3VQTA 1IQTA 1QAIA 3M8QA 5B7WA 2AU0A 3PDNA 3OR2A 4NLPA 4F3OA 3VALA 2KKHA 3F56A 2Q79A 2C2RA 1C4AA 1S1UA 4NL5A 3G6VA 1HW9A 2NREA 2HWIA 2QIFA 4I4BA 4HH1A 3NS5A 3UWTA 3J7Z5 5LT5A 1TP7A 5GAHU 5HP1A