1WF1A

Solution structure of rrm domain in rna-binding protein np_057951
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
b'GSSGSSGMSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTLDINMAGEPKPDRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein Raly
publication title Solution structure of RRM domain in RNA-binding protein NP_057951
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wf1A01
2DK2A 2SXLA 5CYJA 3BO3A 5GAHU 3VAGA 1FT8A 3CMAS 1WG5A 1WHVA 4TU9A 1QVGR 1X5SA 1JJHA 2RS2A 4F25A 2CPFA 5BJRA 1D9AA 2X1BA 3CD6S 1FJCA 1SJQA 2PEHA 2YH1A 1VQ6S 2MB0B 1H6KX 2DIVA 2DGSA 1M5OC 3DLLQ 1NO8A 2FY1A 1KD1T 2HZCA 3SDEB 1H2UX 1YHQS 2CQDA 2CJKA 2DISA 1VQNS 1FXLA 2CPZA 5IFMA 3MD3A 3CXCR 2DGUA 1YWXA 3VAMA 2KRBA 2AD9A 1ZZFA 2DO4A 2WBRA 1KQSR 1RKJA 1N52B 4WF9Q 2U2FA 2NZ4A 1S72S 1FNXH 2N3LA 1N54B 1P1TA 2M4MA 3BO2A 1HD1A 3UCGA 3IWNC 1S79A 5LXYA 3VAKA 1H2VZ 3VAFA 2DNKA 3VAIA 2AYGA 1Q7YT 2DGTA 2DNLA 2G1DA 2KRRA 1HL6A 4WFNQ 3MURP 2CPYA 2QFJA 2G0CA 1N88A 2DH8A 4PR6A 4IUFA 1VQOS 4OZ1A 4LMZA 2PE8A 1OWXA 2LCWA 2ADCA 2J76E 4C7QA 1HD0A 2LXIA 5LSOA 1M90T 1WI8A 3SDEA 1D8ZA 5DDPC 2Q79A 5LJ3Y 2DGWA 3FEXB 2RT3A 2DNOA 2MKHA 1UFWA 2E5HA 2CPDA 2CQPA 1X4BA 4J5OA 1DZ5A 2MZ1A 3MDFA 3TO8A 3ULHA 1U2FA 2LXUA 3MXHP 4FXWA 2M0GB 3ZZZA 2XS7A 2X1FA 3BO4A 2DNGA 2MKKA 3BEGB 4ZKAA 4FXVA 4PKDB 2ZJRQ 3CCES 2HGNA 3P5TL 4CIOA 3UCUP 4LJMA 4Z2XA 1AUDA 3UD4P 2JVOA 2HGLA 1XN9A 2KI2A 1W2BR 2MJNA 5LSLA 2MPUA 2XNQA 4YB1P 2D9PA 1QVFR 2A3JA 1X0FA 2CQHA 1UP1A 1DBDA 2CQBA 3SMZA 1WHYA 2MJUA 1NU4A 2LA4A 1SXLA 2MZTA 2DNQA 4LIRA 2RS8A 1QM9A 1JJ2R 5IQQA 3G8SA 2MKCA 1KOOA 1X5OA 1WI6A 2KH9A 5DDOC 3PIOQ 2JVRA 1OIAA 3CCRS 2DNHA 3CC7S 1FO1A 1VC5A 2L9WA 1FJ7A 2OTLS 2MQQA 2DGOA 2CQIA 1A9NB 2VOOA 2OSRA 4UQTA 2KM8B 2YWKA 3G9CA 5DDQC 2LA6A 3G8TA 3VALA 3UCZP 2MHNA 3OW2R 1VC6A 1WEZA 2M88A 2XS2A 2AYMA 3LQVA 4IO9Q 2DNRA 4ERDA 4PRFA 2CQ2A 1VBYA 2MSSA 4Y0FA 1VC0A 2XS5A 1WHXA 3MOJB 2DGQA 2RRAA 1P27B 4CH0S 2V94A 4WFAQ 1K9MT 2RQ4A 3S8SA 5GMKa 3CMES 3CCVS 3P3DA 2M9KA 3CCMS 2O3DA 2F3JA 2E5IA 2JRSA 1L3KA 2QA4S 3BS9A 2UP1A 3U1MA 3US5A 3G6ES 2LKZA 3NS5A 1K73T 3HHNB 3NNCA 2MKIA 1U1QA 1U1KA 2MMYA 3UE2A 2YTCA 4BS2A 3J7YU 1PO6A 4TU7A 1SJ4P 3UD3P 2I38A 3U1LA 3Q2SC 2CQCA 4QPTA 3CCLS 3I56S 2CQGA 2KHCA 1YJNS 1DHMA 2CPHA 3EX7B 4OZ0A 1WF0A 3G96A 1K8AT 1JJ4A 2XNRA 1SJRA 1YJWS 3J7ZT 1U6FA 2DNZA 2VONA 2RUGA 3VAJA 2BZ2A 2L08A 2OIHA 4A8XA 4WFBQ 5IM0B 3I55S 3TP2A 1R8PA 2KFYA 3TYTA 4YUDA 2KU7A 5FJ4A 2E5GA 3CCJS 1DRZA 4U67Q 1OO0B 2DNMA 2EK1A 5H1SV 3RW7A 2F9JA 3H2VE 2D9OA 5MLCV 1KC8T 2DNPA 4CH1A 1CVJA 2F9DA 2MKSA 1VBZA 2B0GA 3NNHA 1VQPS 2YH0A 4EGLA 4QU6A 2KYXA 4M5DB 5JVGQ 1VQ7S 1G2EA 1VQMS 1VQ5S 3L3CA 2MZQA 3IRWP 3G71S 3CULA 2FC9A 4F26A 1OPIA 2MQMA 2MY7A 2KN4A 4YOEA 1R8HA 2HVZA 1U1NA 1Q82T 2CPIA 2VODA 3NS6A 3H2UB 5GVQA 3S7RA 1X4DA 4ED5A 2GHPA 1WEXA 2JX2A 1KOHA 3CPWR 1U1RA 2I2YA 3CCSS 4QU7A 2CPJA 2ADBA 2N7CA 2MZJA 2RRBA 2G4BA 2DNNA 2HYIB 3EGNA 3HI9A 5CA5A 2D3OR 2XSFA 1WELA 3S6EA 2MQLA 1UAWA 5ITHA 2M52A 2CQ4A 3PIPQ 4C4WA 2CQ3A 4TU8A 3NMRA 1H2TZ 2XB2D 2CPEA 2MZRA 5HL7Q 2DHXA 1RK8A 2LECA 3R27A 5LJ5Y 2DITA 2E5JA 1X4GA 2K3KA 2L41A 2AYEA 5D77A 2FHOB 2KVIA 1U6BA 2DB1A 2MKJA 1PGZA 1M5KC 1U1OA 1WF2A 1URNA 2DHSA 3G4SS 4W90B 2GO9A 1M1KT 3RW6A 2ERRA 5DDRC 1BY9A 2J8AA 1F9FA 3N9UC 3V4MA 3P49B 4TLQA 1IQTA 4V19X 3CUNA 3CC4S 1HA1A 1Q86T 3LPYA 4CQ1A 3D2WA 3CCQS 2KG0A 2MQPA 2MQOA 2EK6A 2AYBA 3VAHA 1VQ8S 2N3OA 5CXTA 4P6QA 2MGZB 1WF1A 3R1HA 1FJEB 4UY8T 4IOCQ 2DGVA 3B4MA 1YJ9S 2N82B 1VQKS 2BOPA 3VF0B 3CC2S 1Q81T 3UWTA 2LMIA 2U1AA 4Y00A 5GAGU 3THTA 1YTYA 1M5VC 2X1AA 2RNEA 3FEYB 4WIIA 2DHAA 5D78A 3CTRA 3P6YC 1SJFA 2KXFA 2DHGA 2LEAA 1X4CA 1YIJS 2JWNA 4WKRA 3MD1A 2DNYA 4W92B 2KM8C 3NNAA 3MUMP 3Q2TC 2KT5A 5EN1A 4QQBA 5GAEU 1UW4A 1VBXA 2VOPA 1YI2S 1X5PA 1N8RT 2QEXS 2HGMA 4F02A 1ZZNA 1X5TA 5LXRA 2EVZA 2OJ3A 2ZJPQ 1ZH5A 2KG1A 1X4FA 2MQNA 1U1MA 1U1PA 1X4EA 3THPA 1WG1A 2CPXA 4WCEQ 2OTJS 2KXHA 1X4AA 2RVJA 2MGZA 3K0JA 1WHWA 3SXLA 3ZZYA 2LQ5A 2OSQA 2DO0A 5DM6Q 2MYFA 2LEBA 1M5PC 3MI7X 2MXYA 2RU3A 1NJIT 2M7SA 2KXNB 3B4DA 5JVHQ 5IM0A 4C0OC 3R1LA 3JB9k 1WTBA 2ZJQQ 2M8DB 2J0SD 2M8HA 4IOAQ 3EGZA 1B7FA 2X1GA 2LYVA 1SJ3P 1A7GE 3CCUS 2MSTA 1JMTA 1U1LA 3MUVP 2E44A 2FPHX 4RU2A 2CQ0A 1FHTA 1X4HA 2CQ1A 2M2BA 2M70A 5DETA 1WWHA 1VQ9S 2YKAA 1WG4A 1WEYA 2MY8A 1VQLS 2K8GA 2MZSA 2DH7A 2RQCA 5GADU 5DM7Q 2DGXA 2NLWA 2FC8A 2DIUA 3MUTP 3S01A 1YITS 2DH9A 2J0QD 3CF5Q 3DXBA 1VQ4S 5HO4A 1O0PA
chains in the Genus database with same CATH superfamily
1U0SA 3QAUA 5CYJA 2F4FA 1C4CA 2CADA 4HHHA 4O4GA 3PW4A 1JLFB 3HJFA 1HKAA 2H54B 2RS2A 4JI5F 1SJQA 3E8OA 5J1EA 4CLLA 2YH1A 4F0MA 4ELTA 3HD2A 1S9GA 2IFXA 1SKSA 3MTKA 5KFPA 1VBKA 1IBLJ 1NCLA 5KFKA 4KH0B 3D68A 1YWXA 2QV6A 1IKVB 3RBXA 4JI1J 3QNWB 2V8HA 2IBOA 1RKIA 4PG6A 2XMAA 4C0HA 2FJVA 3H5XA 1RT4A 2DGTA 3DOMB 1F0XA 1R8BA 1NJZA 1LK5A 3C14A 3TAQA 4F7VA 1RP5A 3SDEA 1O51A 2YQ3A 3A3PB 3I0RA 4PUOA 3A4TA 1PYOB 1YBAA 3NAHA 2ZZNA 2HRUA 5HK4A 3RZAA 3NGKA 5KFIA 5LMNJ 4KTQA 5KFOA 3G8QA 3KHRA 2MKYA 1UW9A 2J5AA 3NS7B 3JSRA 2YNIA 5HVHA 1QM9A 1WDTA 1WI6A 5DDOC 3IBWA 3HHDA 3CC7S 4QWEA 2VKRA 4ZVTB 2E9RX 5HI7A 1R6VA 3C8YA 1FRXA 2CQIA 1ACMB 1N6QB 5DQGA 1BC6A 2CJAA 3V4IB 3VVUA 3TJ9A 3KK1B 1N0UA 2FYXA 2V94A 1MG7A 4JI8J 3S8SA 4Q44A 4MFBA 1MU2B 3IBFB 3B82A 4NI2A 3EVOA 1WDDA 3US5A 4I2PA 2MKIA 1U1QA 3AJDA 1RUSA 1UMJA 1RWUA 3BDPA 1SJ4P 3R7SB 3G87A 3A3NB 3Q8YA 4ES1A 3I56S 3GYGA 3TAPA 2G9OA 3N5FA 3ZXWA 3IRXA 3TP2A 1GFWB 3N0VA 5DG8A 4O44B 3EZOA 1S1XB 1RT1A 2D3ZA 1C1BA 4X4VA 2HMIB 1F1BB 3TJAA 2HVDA 2VL1A 4MK9A 3CB4A 4KJIA 1PSDA 2JLFA 4O3RA 2MKSA 4B02A 1DARA 2R42A 4L76A 2H5IB 2BKPA 3DOLA 5KFSA 1VQMS 4KGKA 2O01C 4DPOA 4HVZA 4FN5A 4GO7X 2E7XA 2JC1A 1ZBTA 3EDRB 4OYPA 1SIZA 4YEAA 1X4DA 3JSMB 2HLUA 1RT7A 3DN9A 2FGCA 2UXDJ 2HYIB 3EGNA 3HI9A 2AJ0A 5CYQA 1U4BA 1W26A 1S0VA 1FKOB 1U2CA 1CS4B 2RH3A 5F0WA 2CQ3A 1H2TZ 2B9XA 2XB2D 2W4PA 1OYDA 1E6VA 3ZC4A 3OVBA 2WOMB 1HI1A 2KFNA 3CJKA 3RW6A 3TQEA 1YGYA 1F9FA 2V5HG 3M30A 2ASLA 3V81B 1NHUA 2C22A 1J2VA 2BACA 2DCUB 3A13A 2YKQA 2L9NA 1FJEB 4BDPA 1EZZB 2QMUB 2HVHA 4CT9A 2WK4A 3QMQA 2IM3A 2WVBA 3QGIA 4QCLA 1NDCA 3MAAB 3FQKA 2HEKA 3OVAA 2Y1RI 3OTEA 1U2RA 3DU5A 3CDWA 1RWKB 1CC8A 4B9UA 2XMTA 8RUCA 2I8EA 5EN1A 3CDBA 1BQXA 5IXUA 4DU7A 4WE1A 4DEZA 1U1MA 3J7A1 2F1FA 3KLFB 4URQU 2E7WA 5A0YB 1GX6A 5C25A 2XHCA 1KP6A 3T5JA 2BRKA 1FK9A 1CSJA 3ZZOA 4BHQA 1XR7A 2AJQA 5IM0A 3V2UC 3EGZA 3T3FA 3LH2S 5K9FA 1U25A 1REVA 3F44A 3CE8A 4JUZA 2R3VA 1HHTP 3NXZA 4QIVA 3OTDA 2HQGA 4ES3A 2ROPA 5HO4A 3D66A 4M5DA 3WZ0A 3Q8VA 3VAGA 4F4KA 4X2BA 1OSDA 1C0UB 1YG0A 4TY8B 1VHFA 2BQ3A 1EETA 4MK8A 2DIVA 2Y0SD 4TQRA 4P72A 5HMWA 5IQ6A 1U24A 4CLSA 4M94A 1F3FA 1T9WA 2AD9A 2G2ZA 2DO4A 4IRCA 4OJGA 3H59A 1N52B 3KHLA 2Y1JA 1S1WB 4KHRA 5B0GA 1KWMA 4PG5A 2B4UA 3PRBA 1Q7YT 3PY8A 3IAS9 3PJ9A 2BJDA 3KJVA 1TV6A 1CJUA 3QO9B 4IUFA 2EW9A 3U27A 1U09A 4DR5F 5EWGA 4XO0A 2IM2A 3W5XA 2I9SA 3D0IE 3DFEA 1CULA 5C2GA 3N6NA 1LOUA 5A8RB 4QOTA 4HACA 3AXKA 3BO4A 2MKKA 1RU1A 4CTAA 1VS3A 4J9OA 2JLEA 2BE2B 2C3MA 4AUKA 2A3JA 2IC3B 1M1HA 2HHVA 3I96A 1I1GA 3H4BA 2P9EA 4UT4A 4B3TF 1KVIA 2MKCA 2GHWA 2Z2MA 2XLIA 4LF9F 3AJ1A 1X60A 4FVCA 3FVYA 4FYWB 4USKA 2KM8B 1J5EF 1SB6A 2MHNA 4NLOA 2A6MA 1QAYA 1I94F 2O1PA 1P27B 4EYHB 3OT9A 1BGXT 1XEZA 5KFCA 3PZPA 3CCVS 1XWLA 3X1LB 3FFIA 2JRSA 2XGQA 3IGVA 3BN7A 2UP1A 4EYIB 1HMVA 4PYDA 1A0OB 4WYWA 2HVIA 4CYUB 3GCXP 3TQ1A 1RWNB 2BR0A 2IM1A 4P2MA 3JXOA 7FDRA 5E2QA 1Q5VA 2XSJB 1B0PA 2W9BB 1DY3A 3NCQA 3Q86A 4PWWA 2GHVC 3T1YF 2CNNB 2EK1A 2B4PA 3DM2B 4EWTA 3UPFA 4NCAA 2EKNA 2C28A 1VBZA 4CWBA 3NNHA 3QLHB 2EFGA 3BH7B 3FZ2A 4ZPWR 3TX0A 4RW7A 2WVEA 1MSWD 3FUYA 4PWDA 3LOUA 2RE1A 2Q3PA 4PAAA 2CPJA 4ECZA 2ZHBA 2W7AA 1Q8BA 5B0EA 2YX4A 4EZ6A 4DSJA 1ZTTA 3QZ8A 2OMLA 2XGPA 1VJQA 2WB4A 1JX4A 4M1KA 2NQPA 3BR8A 4HDHA 1RT5B 1PKUA 2GS8A 3TA0A 2FHOB 3M6VA 4UTGA 4H4MA 2ZC3A 4C48A 1V6HA 5A2QU 3LW5C 5BXIA 2J8AA 1HPZA 4MKAA 2QA2A 3VAHA 1X31C 2W9CB 1BHNA 4P6QA 2IA6A 5HLFB 5J2QA 3VF0B 2LU2A 5GAGU 3THTA 2HIYA 3PW0A 2ZH4A 2KXFA 3TUIC 2DHGA 1S97A 3MD1A 1TMJA 5M2UA 2UUCF 4BLGA 3L9ZA 3SIPB 3D5MA 5KFHA 1FFGB 3RUBL 3PW5A 1EAYC 4X4RA 3C15B 1WG1A 3H40A 4DR1J 3SXLA 4EZ9A 4HL9A 2OSQA 3NGSA 3LGMA 2DJWA 3FGVA 1JLAB 2HLTA 2W9AA 3JS9A 2B8QA 1RT6B 1QAIA 3W60A 9ATCB 2XQCA 2QIFA 3DRPA 5CH7B 3F0NA 2F8MA 1Z1ZA 3GFHA 4NCGB 3E01A 4F3QA 1JMTA 3OBIA 2IDEA 4NLWA 3MUVP 2FPHX 1FHTA 1CQMA 3KYLA 1OYEA 1XMOJ 1YRXA 3ZTOA 1I6JA 3JTNA 4NLGA 2DGXA 2B9YA 1DTTA 3ADAC 3W2WB 3AB4B 3FMWA 4RNFA 2SXLA 2NXNA 4A8YA 2YKNA 1N32F 3LP2B 1IKWA 3I82A 5BJRA 2W8KA 3FBBA 3B6BA 2PEHA 4UOCA 2FZCB 1Y10A 4FBTA 4PXEA 1KD1T 3OHAA 2WVFA 5EUHA 3K57A 3LP1A 1SKUB 3OTOF 1SH3A 5KT4A 2KRBA 2DT9A 3LTOA 2E9ZA 3QGGA 4DPUA 2ZD1A 1S5ZA 3PACA 2CWKA 4N41A 4OJ3A 4KQZA 4ICLB 4ZJOA 5J2MB 1P1TA 2R9LA 4CLWA 4ECVA 1IR0A 3MECA 3VAIA 1VK3A 1FKPA 4C9DA 1C2PA 4UUXA 4KHPJ 3DRRA 1D0EA 4OYIA 2J9CA 4MKVA 1ZM4A 1VQOS 2OEMA 2ADCA 1S6QA 1MWYA 1R31A 3EPGA 1WC4A 2C2ZB 2BW7A 3MGJA 2DNOA 4WWSA 1UFWA 4RW4B 2Y9HA 4FZVA 3VQSA 5L9XA 3TO8A 4DL2A 1FRIA 3H25A 4M5MA 2X1FA 5DG9A 3D0GE 3LPEA 4M8LA 3HKZD 4TYAA 1Z4UA 3JQJA 3UD4P 3GIIA 2B3TB 1F6TA 4JV1A 4IO1A 1Y11A 3FCWA 4XPCA 4J90A 2V4QA 2G2OA 2XY6A 1OY6A 1ZPWX 3QT6A 4ZLJA 2H3EB 4FF4A 4ZVUB 4OZLA 2B5JB 2RD5C 4MH8A 4FKXA 1TKTB 5LMUJ 3HHKA 1X7VA 4IDKB 2OSRA 3VALA 3UCZP 3PKYA 2AYMA 1JJCB 2DNRA 2CQ2A 2RF2A 5DS7A 3HZEA 2F3JA 4B9NA 2E5IA 3SCJE 2ATCB 2OPPA 1NSAA 1N33F 1LWXA 4K4SA 3UN2A 3HCXA 2YTCA 3J7YU 4TU7A 2VFSA 2C2KB 1BQNA 4I1TA 2BJEA 3U7JA 1RBLA 3GYNA 4U9RA 1S1TB 4ZLNA 2OIHA 1I3OB 3R2CJ 3KUHA 4UUWA 5I42B 5EHHA 1Y5NB 3R5BA 2BM0A 4JV2A 2CZVC 2EC2A 4KH1B 3GFXA 5CYMB 5ETMA 5HROB 4WK3A 2F8EX 3GE9A 1JKHA 5I3PA 2JZ5A 3MCMA 5ETKA 1VQ5S 2MZQA 4C98A 3HZGA 4DSFA 3CMQA 2HSEB 2OPQB 4NMXA 3JYTB 1IBMJ 5K14B 8AT1B 2DVIA 4LR7A 3HHLB 4IFVB 3QJPA 5D8HB 4KBIA 5F3TA 2QZ8A 1TL7B 3LWLA 4YFUA 2BANA 1UAWA 3SI8A 4NLTA 1NKEA 4DXLA 4HEA9 3MF5A 4OHWA 2LECA 5LJ5Y 2QGFB 4J9KA 4USMA 2KVIA 5D77A 4ALZA 4B9LA 4W90B 5F8GA 4Q8EA 5HVGA 4KPCA 4XIUA 3QAEA 4U6PA 4EO8A 2HHHJ 1HW9A 2FHKA 2IVFB 1Q7LB 4ZJQA 3HXMA 2V8GA 4F50A 1N6QA 4FP9A 1HI0P 4OI1A 3KK1A 2W7OA 4Q0BB 3M2VB 3BPDA 1C1CB 4LFBF 4DV4F 4CH7A 2DYAA 3Q2TC 7FD1A 1Q95G 1MU2A 3OQ2A 2QSFA 3D6FB 1EJ7L 1FWPA 2HGMA 3BF4A 2QT7A 4K4XA 3QRPA 5EX3A 4ITSA 1LW2B 3VZHA 1RT3B 3KLGA 3G2XA 2VPZB 2PMZD 3N01A 1NJIT 4B17A 2ZJQQ 4ED1A 4N7TA 4R5PB 2XTJP 2RAQA 3T6JA 2GA7A 4DV5J 2HMIA 4B3TJ 4XTTA 4GKJJ 2CQ0A 2WB1D 3BR9A 1GMWD 2MZSA 1EX8A 3U1NA 4B08A 3PYDA 4NYOA 3HX9A 2OPRB 5LOQA 3SFGA 2V6AA 3OD2A 1P9QC 1G6BA 2GV1A 1OS5A 4IR1A 4LF4J 1I94J 1WOPA 3NP5A 3OJSA 4Q45A 2RHSB 3SBMA 3DLLQ 1ZTWA 4KIAA 2HNYB 1L3VA 1YHQS 3V6HA 1XQIA 1KR4A 4DL5A 1QAXA 1KFSA 3VAMA 4U7UD 4YR0A 1HWLA 1RKJA 3M7VA 4JI6J 3MM9B 1SPBP 1VR6A 3BO2A 3UCGA 1S79A 1F9HA 4X64J 2LU1A 1TR0A 3VAKA 4F0HA 5F3ZA 4YR3A 5F8NA 2G1DA 5HJXA 2WOMA 3HFVA 5KFNA 4YQWA 5HQ8A 1TK8A 1N88A 4PR6A 2VU5A 1RA7A 2YPZA 2GNKA 1GMWA 3NG8A 2PE8A 3V81A 2UUTA 4ED3A 1WUUA 3ILOA 1WI8A 5ETOA 2DGWA 5KFLA 3CJSA 2KZZA 3W9IA 4H4OB 4NEZA 4G1PA 1NK5A 1HNIB 1U2FA 4N8OA 2VJUA 3M9MB 4ZIVA 3ZTPA 1TU0B 1FRKA 5EWFA 3OLAA 4ELUA 4C3LA 2HGLA 4Y2CA 4B3MJ 1JQGA 5LSLA 3K7RA 1X0FA 4LQ9A 1UZHA 2CQBA 1S9EB 4JI2J 2GAHC 2W25A 4NXNF 3UR3C 3KLFA 5F8LA 5A0YA 5F8IA 2YWEA 4FPIA 2OP5A 4RKUC 4ZPCA 1VC5A 1XJWB 1S57A 1FJ7A 2FJAB 5KOWA 4UQTA 4QYRA 5DDQC 2ZOGA 4IO9Q 3GFZA 1NZAA 2Y8WA 2KHDA 4C8NA 3G6XA 1IBKF 4NXMJ 1LFWA 2OAUA 2MLYA 2ZDOA 2M9KA 4M5IA 5L1IA 2ZWPA 1AB8A 5ETVA 2MMYA 2DCLA 1FI4A 1UWAA 4I68A 3EJMA 4E0DA 3DLKB 4PXCA 1WF0A 1C0UA 1T3OA 1JJ4A 4NLUA 3MMBA 4TY8A 2HPUA 4KSEB 3AFGA 1VRTA 3BREA 4WP3A 1G4CA 1RE1B 1SC4B 4P52A 2NS1B 1DJ0A 4RLEA 1NM2A 3RW7A 4USVA 1R8CA 2AGOA 4YN3B 2C3UA 2BM1A 3AQOA 1S1WA 1HBNA 4MK7A 1WKKA 4D3GA 2YH0A 1B0TA 1YBUA 2V9KA 2IY5B 2Z4PA 5KOXA 3QO9A 2NUHA 2VODA 4DR7J 3FSYA 2N4DA 4ZVRB 1RT2B 1UVLA 2AJFE 5E7OB 5A8RA 3DOKA 2RRNA 2VH7A 5CAAA 3G82A 3OL7A 4FS1A 4WU2A 4PEOA 2DHXA 5FDLA 2E5JA 4K5RA 3V6DA 4CRJA 4M5JA 3W61A 2IC3A 3G4SS 2IHR1 1NH7A 4O3SA 1K1QA 1Q86T 3ITHB 1NK0A 4OQJA 4YB5A 4RUCA 1VFJA 4I56A 2ZM6J 2ZE2A 1WF1A 2XZTB 2GQ2A 1HNZJ 2LXFA 3NGDA 1X9MA 2B56A 1FCAA 2VG7B 4WBFA 4C3MA 3BZQA 5T41A 3R6GB 3IR5B 1YX2A 2LEAA 3HDSA 3NCRA 4LQ3A 4A8OA 4AXIA 3RB0A 2C2RA 4ED7A 3KTQA 3KK2B 2VV5A 3ZTSA 2KDOA 4KRWA 2ILZA 1L5UA 4CYUA 2GVZB 2VB6A 3TVZA 3FQLA 1MMLA 2XSJA 4IH7A 4USIA 2OI2A 4K7QA 4FF1A 3HT3A 2VG5B 2W9BA 4RNNA 2ZH6A 2FTRA 5J2PB 1L3SA 5FLXU 1WC1A 2Q43A 3EMTA 1VGYA 4U7UK 1ZAVA 4AT1B 3O1LA 1BQMB 2EKYA 2AT1B 4X62J 3DM2A 3M8QB 3E2EA 3CIZA 3W2VB 3CF5Q 1VHIA 2GGPB 3ZO7A 3M4XA 5IT0A 1FT8A 4ZN1A 1K0TA 1Q0NA 4GVBB 2IA0A 2HQ3A 3DHXA 3FEZA 1P9YA 1NK6A 3FDSA 3EZ5A 2MQ8A 1M5OC 2UVWA 1GNKA 3ZZPA 1HQ2A 2CQDA 2VUGA 1KQFB 2DISA 2QLXA 3MFHA 4ECQA 3IM8A 1U6ZA 4C8KA 1IUJA 1FKAF 2FVCA 2RHQB 1HD1A 1F5BA 4NLQA 5K8NA 2V67A 1RT5A 2X3DA 2DNLA 2BVZA 3IP0A 3CCZA 3NGTA 4ZP8A 5KT6A 2N7YA 1K44A 1VRUA 4LMZA 3JSBA 2LXIA 3LF0A 2HRYA 2W9CA 3ENAA 1TELA 2CPDA 2CQPA 4F36A 4J5OA 1QAJA 1DZ5A 1LWCB 5C42A 2XG8A 2RSQA 2XS7A 4Y6IA 2B6AA 2AWZA 4RW9B 5HQLA 3P5TL 4CIOA 4CO5A 4DQPA 4WU3A 2B7CB 2QO3A 3MM7A 2PEBA 4JI3F 4YHHF 4R8UA 5AE3A 3NGUA 2DR8A 4ECYA 3C15A 3G86A 4GKKF 2CA9A 2HBYB 3D28A 1M5SA 3GIKA 1RT6A 2DGOA 2RMLA 5DQHA 1EARA 2A10A 4M5HA 4I69A 4NCGA 1BWEA 3OTCA 2ACYA 2MSSA 3I0SB 5IOLA 5F8JA 3WIUA 4X66F 2PI5A 3PM9A 1NB2A 3U02A 4F3OA 1XR5A 4ZP9A 1F9EB 2X3GA 3VR1A 2V34A 1V9OA 4NLXA 4JI4J 4NMLA 4QWDA 4I6WA 3LP2A 3I9V9 1X8DA 5FLXY 4RNMA 2IIHA 2NCKL 8ATCB 4DV4J 3LP0A 4DCJB 2QMWA 2CJQA 2KT3A 1S59A 1WC5A 2KU7A 5ETQA 1B3TA 3C16B 1H74A 2VJVA 3IG1B 4KE5A 1LEOA 3H2VE 1RHRB 4CLFA 1AT1B 1CVJA 4IG0A 4ICLA 1JLBB 3ZTRA 1RTDA 1JLQB 5J2MA 2XI2A 3I31A 4HHJA 1RWOB 3CNQP 1KQKA 4ZHRB 1WKLA 2CNLB 1OPIA 2MY7A 2KN4A 1XMQJ 1U1NA 4YY3F 2HNZB 4PQUB 3R8YA 3S7RA 2GHPA 2JX2A 2I2YA 1UEKA 1NJXA 2YY3A 2N7CA 1MMDA 1R3NA 4BCAA 4USJC 4RW4A 4OZ5A 1HNWJ 1J5OB 2D3OR 1WELA 3LWMA 1F5AA 1PYSB 4K2XA 1DAXA 1U0HB 2MZRA 3EXYA 1RAJA 1LXJA 4W4MA 4DFKA 1XK8A 2D74B 5JXSA 2OFHX 4ED0A 1GTHA 2AYEA 4LF6J 1U1OA 2HURA 1YVFA 2XMUA 4XAKA 2DHSA 3ILIA 3K5OA 3PXGa 4Z7CA 5KFUA 2G1HA 3CSKA 2ALZA 3CCQS 1RYSA 4LREA 5IZHA 2NZCA 4W98A 1UVIA 1UJ5A 2MGZB 3R1HA 2B5JA 3TA2A 2G0IA 1TL1B 1TKTA 2ZUGA 1AA1B 3Q8SB 3UWTA 5JMNA 3MAQA 4HTIA 2JWNA 1ZS6A 3QRQA 4OYOA 1AUSL 1U47A 2KM8C 3NNAA 4Q2LA 1U7LA 2KT5A 1MN9A 1CC7A 1EP4B 2UUBJ 4RBVA 2YKMA 4QIGA 2MQNA 4DI6A 1X4EA 3QJLA 3DNCA 3KMQA 1WOSA 3M2UA 5B09A 4DN0A 1VI7A 3E3XA 3D3BJ 5E3PA 3FMBA 5K8OA 5GAHI 2RU3A 1S9FA 1S1TA 1WACA 1XNQJ 3R1LA 2FJBB 5F9LA 3ENWA 2M8HA 1SJ3P 2V63A 3TOQA 4LRAA 2MEWA 4RU2A 1SBRA 1Q53A 3PYGA 2YKAA 2J6UA 5CYMA 4LSZB 5HROA 1NSPA 9RUBA 3PFEA 2NPIA 5RUBA 1Q8IA 2HAFA 4L74A 1PJ6A 5KFYA 4X4NA 5GAGI 4K59A 5KFEA 1RYRA 4WKYA 4JV5J 5KG3A 2EBGA 5KTQA 2OPQA 3JYTA 3DDKA 3H5UA 5K14A 1O8BA 3EGVA 3OSNA 4CNZA 4P2FA 2HZCA 4Q43A 3PO4A 1HWKA 1H73A 1TL7A 2EC0A 2GAGC 3MEDA 2D69A 4DF8A 1F3VA 3AA8A 3IN5A 3MM5B 3FC9A 3AODA 4LT6A 2U2FA 2M4MA 4ZPBA 3EZUA 4DPYA 2AYGA 3MHYA 4ID8A 2CNOB 2CPYA 5DJBA 5KT2A 2IVYA 4YB6A 2JLGA 4LF7J 1HR0F 1IR1A 1N34F 3KDOA 3DDNA 3ISNC 1HNXF 3TEHB 2BE7D 3PFOA 1Y5IB 4LBIA 2J7UA 3RBDA 3ZZZA 3TR5A 4OYXA 3I6PA 3DLEB 4Q0BA 3TZXA 3CCES 3VTIA 1AUDA 3MMAA 3QSYB 1C1CA 4ZOSA 1TUVA 3I4PA 2IPOB 4DR2F 4M5NA 1UP1A 2ZEJA 1YJVA 3SMZA 4KO0A 2DRAA 3KJFB 2JEIA 2LA4A 1N56A 5IQQA 4A48A 2BDPA 2A0FB 2XM3A 1Y5LB 1KOOA 1B4SA 3W3SA 1NK7A 1LW2A 1IWGA 2HFZA 4LF2A 4LSLB 2VOOA 2GVDB 3C6TB 3OW2R 5LL6d 2LEPA 1EQMA 1WHXA 3RAQA 3H5YA 5B0DA 1S4FA 3PRDA 2K06A 3PR4A 4ZP6A 3QGPA 1N36J 2PC6A 3M05A 4IR9A 3Q83A 3QBCA 5KAKA 3VGVA 3TVKA 2AX0A 5FD1A 1U1KA 3G6YA 3CDEA 3D1OA 4USWA 2OPRA 3GIJA 1XNRJ 2CZ9A 2YNFB 2VQEJ 1LW0B 4PCQA 2PFDA 2XCPA 1WC6A 3QT8A 3MR5A 1YJWS 2RJZA 1H72C 1KRPA 4PQAA 3M32A 1YQHA 5B0BA 2YX1A 5CHCB 4DL4A 1RZMA 3M8RA 2DTJA 5J1NA 2F65A 3MMJA 3MM9A 1G2EA 1H7XA 5DQIA 3L3CA 1LNQA 2LQBA 4YOEA 2V69A 2WZ1A 4RPFA 4KFBB 5GVQA 4MJKA 3RBZA 3MR7A 2QLFB 4QU7A 5AE1A 4WFZA 2ASDA 2ZBRA 3IR7B 1FVQA 3T1AA 3J7YI 4K0KF 4JBCA 1T9UA 3UQSA 1RK8A 1X9SA 3K8VA 4L3KA 4URGA 2FJXA 2VBXA 2DY9A 4WYLA 2YWFA 4ZVPB 2HHUA 3CDAA 3W7BA 3R7NB 1S9EA 2AKWB 2R7RA 2V8PA 4EBCA 2E5LF 3ENVA 4ZCLA 4C8OA 3TARA 2XZWA 5KG0A 4UY8T 1HARA 2DR6A 1WSRA 4DV0F 1LFPA 2JEGA 2XBPA 2R2SA 4TKTA 1M5VC 3PKMA 2AJ2A 5H9EJ 3P6YC 1RHQB 4WKRA 4ANCA 2K2PA 3RAMA 4JYAF 4N8NA 3LAKA 4QQBA 1VBXA 4CO4A 1ZAXA 3T1HF 4Y2AA 4Y28C 2OJ3A 1OQ3A 1ZH5A 1U1PA 1R0CB 2AEFA 4LFCF 1X4AA 4HI2A 4C8MA 3MZIA 2LQ5A 3FNNA 5ETRA 1W25A 1JXLA 3UN3A 3DLKA 2CWXA 4K4TA 5KFBA 4TYBA 2ZUAA 2GIRA 2VA3A 4DL0C 4OFZA 4JI3J 3M8WA 5DZ6A 4I6YA 2LQ9A 1YZ6A 3C6UB 1S77D 5G0RA 1WG4A 2D3O1 4ED2A 2FLPA 2RQCA 5GADU 1Y00A 1TL3A 3CJQA 1VQ4S 4K4UA 2R7WA 2HFOA 3VGTA 2HWIA 1D09B 2GO8A 4TU9A 2YNGB 1IKYB 4F25A 2KJVA 5L9NA 1H6KX 1ZYQA 1RTJB 3GWCA 2BKNA 5HP1B 1ULRA 4DR3J 4P7TA 4DQSA 1S6UA 2QTWA 1RT2A 4DS4A 3MD3A 4O3QA 3C19A 1JLEB 3HHLC 4PPDA 2E1CA 4IH6A 1FWKA 4ID5A 4RW8A 1H2VZ 1QD1A 4YDXA 1F2HA 4A47A 1R0AA 2ZH2A 2VZ9A 2HHQA 1T94A 3GU0A 3ITHA 1DTQB 3CDUA 1TL4A 5CCLA 5DDPC 2R2TA 4FYDA 1HBUB 4UOHA 3ZNJ1 1RADB 2JDJA 2P6SA 2HHXA 2VG7A 4LIWA 1NLKL 3WX4A 1QE1A 1QVFR 1FEEA 3AD9C 1EIYB 3EYZA 2UZAA 3CVKA 2MLZA 3WBZA 3M8YA 3QATA 1JLCB 2Z30B 4DV2J 3JQKA 2RS8A 2GVZA 3NWRA 1FE4A 4QR1A 3BGRB 1X5OA 4NZ0A 3PIOQ 2YBVA 1VCTA 3ZZ0A 1PBAA 2VG5A 2R8KA 4QWBA 4Q7AA 5J2PA 2A18A 1GTEA 2LA6A 1VC6A 2XS2A 2IM0A 3KLVA 1WC0A 4M5LA 5KFDA 2ZKTA 4OHVA 1BQMA 1VC0A 2XS5A 2C2MB 4X4PA 2UUAJ 2KFZA 4CH0S 1JXEA 3K58A 2ZDPA 3PDNA 3HSZA 1L3KA 4DQQA 2V4RA 3H8YA 5D0HA 3W2VA 1S10A 2GGPA 3UDEA 3OR2B 3UD3P 4C97A 1RABB 3RGIA 3TW0A 4ZPAA 2CQCA 3GCWP 2KHCA 4F3MA 1RI7A 5L38A 1LV5A 2VFVA 4OYBA 2DNZA 4B9VA 1NPRA 1NXIA 4ZMMA 2AP6A 4HR2A 1GT8A 4LF8F 3ET6B 2DNPA 3BSAA 4TVAB 5F0UA 2OHDA 1Q78A 1RWMB 2W2PP 1W2IA 3IGNA 3HVRA 4TY9A 4FYYB 3IRWP 3OR1A 4A8KA 3BBBA 2NYIA 1V3RA 4MIBA 1Q82T 2CPIA 4JI7J 1Q16B 1EB0A 3CPWR 1TKXA 1GX5A 3UDLA 3Q89A 3FJ2A 2OKQA 2QRRA 1N4LA 4DUZF 4HTJA 1LWCA 2M52A 2V8DA 4NA3A 1VLOA 1LWEA 4RW9A 2DITA 1PYTA 2DB1A 3D1HA 1Y3JA 1K47A 5LSRA 1WORA 3LPYA 2KG0A 3FBEA 4I7FB 3TANA 2R7TA 4YMEA 3EUNA 2IRXA 1Y3KA 2VFTA 2XMMA 5KG7A 1UFLA 4IOCQ 1HYSB 4U8YA 3KOAA 4OYMA 2U1AA 3TZWA 2FZGB 2X1AA 5KFFA 4W92B 4AE5A 2NUUG 1NEEA 5T14A 1TFYA 3GG1A 3NLCA 1RQ0A 1VDHA 3PJWA 5AXMA 1UW4A 2YWHA 3BB5A 1K0VA 4DHVA 5LXRA 1VMBA 4EO6A 2VBZA 3MOZA 3THPA 1GK8A 4HHUA 4WTOB 4O4GB 4YDDB 3C2PA 2AU0A 4ZCIA 4L72B 2F4VF 2M8DB 3M2RA 2P9GA 3C16A 2Z2YB 3ILLA 2M70A 1O6XA 1WWHA 2KT2A 2K8GA 4DV7J 2C3PA 5KG2A 3HF5A 1JLBA 3BYRA 1JLQA 3K5PA 3B78A 1RT4B 3DYAB 4ZHRA 1S6PA 2DXDA 3W9HA 3Q23A 4AL6A 2HNZA 4PQUA 3M6WA 2AW0A 2UXBJ 2XO6A 2NSBA 4WPAA 2J6TA 3DHWC 3SDEB 1H2UX 3T9NA 2CJKA 1VQNS 1Z2LA 3OL6A 2UVUA 1J5OA 1BE4A 4OZ3A 3TUZC 2R7SA 4DL6A 1UL3A 3UVJB 1U0HA 4OIXA 1S7HA 1R43A 1JK9B 2RUSA 2DNKA 4DL7A 3R5DA 1ITPA 2XYGB 2CJBA 2HQFA 1KLMB 4OZ1A 2D3UA 3DLGA 4WJBA 1M90T 1RAHB 2CG8A 1TL1A 5I4MA 4F4XA 5HBMB 3ULHA 1JB0C 2LXUA 1QUVA 2M0GB 3AD7C 3AY0A 4K2JA 2HGNA 2V2VA 5C2CA 3A8JA 3RB4A 2XYPB 2XNQA 4L6V3 4PABA 2PIIA 4ED4A 2QN6B 3CO9A 1EP4A 4NI2B 4CI0B 1NU4A 3D67A 2HZVA 1KEKA 4K0KJ 4DQIA 3FCVA 1WSVA 4F4WA 4JI0F 2CVIA 1A9NB 2X7IA 2FLLA 3IM9A 5DGBA 1KHWA 3MEGB 3OHBA 2OGUA 4B3RF 3EWGA 2VBWA 1B0VA 3QPIA 3V6KA 3KG0A 3D54A 2QJ3A 1K73T 4QJVA 3FZBA 3R97A 2H4WB 4LFAF 2VICA 4E98A 2QL5B 3Q2SC 5EX0A 4DR6J 4R25A 4XDCA 4NRUA 1GMVA 4RX6A 3J7ZT 2GW8A 4XDDA 3VAJA 2ZZTA 2B4OA 2YQ0A 2FVSA 5HSPA 4JYAJ 1GXLA 1VK8A 2DKOB 2RIJA 2QLBB 4LFCJ 3MM5A 2HW3A 1GMUA 5D3GB 1WD6A 2XMVA 2B0GA 3SV3A 2HZAA 5L39A 3EPIA 2LQ8A 5JJBA 4E8UA 3TJ8A 3CJKB 1NPKA 3M30B 4ED5A 2OELA 5DGAA 4C11A 4DLGA 1HBMA 2DNNA 4DWIA 5KG6A 2UXCJ 1D8YA 1SC3B 3S6EA 1Z2ZA 3GONA 1SV5A 1FWLA 4EI2A 2J9DA 2EEYA 3VHQA 4MT1A 2AZ1A 4AYBD 2UU9J 3QSIA 5AXKA 3CJRA 3S1TA 2I5JB 4NE9C 3SCLE 1IBLF 4V19X 2HQIA 1HA1A 2B4VA 2DEIA 1QSLA 4U95A 2YNHA 5D4LA 2N3OA 2EFVA 4JI1F 1UVKA 4DV3J 4P75A 3QQCD 4RW6B 5CZXA 4RBTA 4O3PA 3MM8A 4Y00A 3UDCA 4LSLA 4FPRA 2GVDA 3I4HX 2WRMA 1MWZA 3O3LA 4DFMA 3WC0A 1FRJA 2WW8A 5ETTA 5D15A 2XULA 2AGQA 1R6YA 4B3OB 3DRYA 1N8RT 2A2CA 2EVZA 3RYLA 2FUG9 2KB2A 1VLYA 2EBEA 1RLDA 1TL5A 1RHUB 2OD4A 4X65J 2ZH5A 4ELVA 1LW0A 2ALYB 4M63A 2M7SA 4LUBA 5LMNF 5E3CA 1EETB 2E29A 1KBRA 1UFKA 3KKFA 4YR2A 2J7WA 2LVWA 1X4HA 2BRLA 1LWFA 3W1YC 1G1XA 1XC9A 1A6LA 4QR0A 4BWMA 4RWXA 2DR5A 3UN5A 4DV1J 4QYZJ 5AJ3J 4Z37A 4S0MA 2PT0A 1HQUA 4P71A 3C3LA 5K8MA 1EKRA 1KHVA 1TV6B 1FD2A 2EFPA 4DV6J 4KFBA 4GC7A 1VQ6S 1IJFB 2VFUA 2OEKA 4JI8F 2FY1A 1SQFA 2NXUA 1IM4A 3B8HA 2AEJA 4MIWA 1FNMA 4HT7A 2QA4G 5L46A 1PBUA 4CT8A 1FRLA 3AHPA 4EU0A 3VAFA 2BJ7A 3GJRB 3BDEA 5IC6B 1S12A 1M5HA 3VZIA 5A8KB 3ETMA 5M2PA 1HNVA 4CLKA 1TMMA 4ZS6A 1CEZA 2DH8A 4MYUA 1TUGB 1D8ZA 3NBPB 4UOFA 4LRCA 2AIRB 5A76A 4AQYJ 5HANA 1ZAWA 2C42A 4M5GA 3BEGB 3KUGA 3RG6A 2YKPA 5BR8J 4ILMA 1DURA 4IQMA 2EFQA 1AFJA 4EUVA 4DZ6A 2CQHA 4OL8A 1GH8A 2VQFF 3FFIB 4ZPVR 3FSIA 2UXDF 1ZM3A 4LIRA 3RR7A 1TAQA 3VGUA 2DNHA 1FO1A 5B0CA 5HATA 4UOGA 4FVMA 1NRKA 2L9WA 3D9BA 1GQEA 4C8YA 2HNDB 3W63A 3G8TA 3LQVA 4JI5J 1T3NA 4ERDA 4OV1A 3C6UA 3LGNA 2UVRA 4FXDA 1VISA 4A8MP 2BXJA 3SEOA 2AF6A 3RTVA 4A8QA 2CJYB 4AL7A 1T7PA 3A8IA 4GMKA 4M95A 1HHQA 3KXDA 3D1QA 3HULA 3M9OB 4PWDB 3G96A 1IKYA 3W62A 2MLXA 4DF4A 3I55S 1RTJA 4MKYA 4YUDA 2E5GA 1IJEB 2DNMA 4QR2A 1AXQA 2FHMA 3V6JA 1YJRA 1HFEL 1V5VA 1NB7A 2ZFHA 2J9DE 2BJ3A 2ZWOA 2F4VJ 3NY0A 1RCXB 4OZJA 4H4MB 3OPKA 3MFIA 4OV6A 1FF2A 4I2QB 4UY85 1GXUA 4UQGA 2CKWA 1U1RA 4CLPA 3CCSS 3FRYA 1DTQA 2K7JA 1CJKB 1DLOA 5KG1A 4DN9A 2FY8A 5EWEA 4ECUA 2RDIA 2MQLA 4JP8A 4FS2A 2FZKB 5AE2A 3OTBA 2L41A 4K4WA 1AYEA 3TI0A 1Q4RA 3W66A 3P5BP 3WQPA 1CBKA 4DX8H 1SUQA 4ZIWA 1SH2A 1IQTA 1BY9A 2BYCA 2Z57B 1SC6A 3I9ZA 4O0IA 1JLCA 4CM2A 1HQEB 2HBQB 1T95A 3SQGA 3QJJA 1YJ9S 2N82B 1NAQA 2KJWA 2ILYA 1UWBB 3PG9A 1YTYA 1MNEA 2OMOA 2ZVSA 2LFVA 5IS2A 3CTRA 3OVSA 2JFKA 5CQGA 4DOZA 1UVMA 3OXGA 3TZYA 4LVOP 1KS2A 4OZ2A 2DNYA 2QL9B 1YJUA 2ZBIA 3MCSA 3MWBA 1TKZB 5E0OA 4NYZA 2HQDA 5F8MA 4OX9F 4L75A 2VOPA 3Q8UA 1X5PA 2RKIB 1DTTB 2ASYA 4NOHA 2JC0A 2HKEA 2GQQA 2CPXA 1ZETA 3OR2A 4B9MA 2MYFA 3RB3A 2LEBA 4NZ7A 3D6TB 1RAOA 3X3UA 4ZN3A 2J8SA 5HN0A 2X1GA 2AHOB 4LVNP 2E44A 2WW4A 2GMJA 3LP1B 2VD3A 5KFGA 1VQ9S 3SV4A 2HBRB 4ZA1A 2ZD1B 3L7UA 2JH3A 3GSIA 4J9QA 3L4BC 2CRLA 1CG2A 3W64A 4ZLPA 3MECB 3BO3A 3GV5B 3CT9A 2P9CA 2B51A 1WG5A 3HSGA 1TVRA 1OJ4A 3ZNUA 1RTHA 4Y2IA 4P2SA 3MCNA 3Q8QB 3RU0A 4O3NA 1FXLA 3SFUA 3L7OA 4B3SF 1UJ4A 3UO0A 2WBRA 4IYQA 4CO3A 4BC9A 4WP9A 2CFXA 3OFEA 1C0TA 1N54B 2QX0A 1KNZA 2KL8A 3CJ2A 1WOOA 1JLFA 4DJBA 1OSCA 3GJQB 3HK2A 5BYQA 2DR9A 1KN6A 1OWXA 1KTVA 4I7FA 2OO4A 4J37A 5GADI 1SL0A 3IS9B 2VA2A 3HVTB 1RLCL 4CNYA 3LALA 4ZLLA 1HYSA 3MM6B 1J27A 1IKVA 3EVWA 4FXWA 2CVEA 2AV5A 4F4YA 5IC4B 2WVDA 3Q0AA 2ZJRQ 2WSEC 3B54A 2GFFA 1XN9A 2KI2A 1ROFA 1SCJB 3ZZUA 2MJNA 3DOMA 3BQ0A 2RF2B 3ELHA 2BQUA 1F60B 1RACB 3AAWB 1WHYA 3N79A 1HBOB 2PI4A 2R7UA 1JJ2R 1L3TA 3G8SA 2WSCC 1P1LA 3HVAA 7AT1B 1BQNB 3BBCA 4J91A 1PAUB 4P2XA 3L09A 3FK4A 3OFHA 2F63A 2YWGA 3PX0A 3BKTA 5J2NB 3GPAA 4ZVSB 2ABYA 2JEJA 2ZNZA 2QYGA 2YWWA 4I0WA 5GMEA 3CMES 2HHTA 4OX7A 3BS9A 4HLBA 4G1QB 4LRFA 2ROEA 1K1SA 2NYHA 3QFWA 1NNDA 2G13A 1JKHB 2PFFB 3M1VB 1IVZA 2I38A 3DYAA 3LAMA 4OX6A 4EFAC 2IRYA 1K8AT 2XNRA 1SJRA 2C2EA 4G1IA 4ZDNA 1U48A 2L08A 1WNEA 1FESA 3V4IA 3TYTA 4KR0B 2H5JB 3W65A 1D3WA 1NHVA 4DR5J 4ED6A 1R0BG 3J81j 2BANB 5H1SV 3BQ2A 2D9OA 5MLCV 2VPXB 3ISZA 3UVJA 4ZVHA 4J9NA 4DR1F 3I32A 2V2ZA 3CULA 2P2CB 4Q2MA 1KLMA 4O44A 4PXBA 2O66A 3OV7A 1S1XA 3ZTQA 1XMOF 4P73A 2RILA 1FJGF 4HH0A 4I6AA 1Q79A 5HBMA 4IG3B 1HHSA 3HD1A 4LF9J 2ZC4A 1E6YB 2HWTA 4DDFA 4GC6A 3Q8PB 1Y0HA 4G3IA 5DLGA 1J5EJ 1MLAA 3HM9A 3K89A 4ZVFA 1WF2A 2YQ1A 1URNA 2ZBCA 1FDNA 2J9EA 1HW8A 1SQEA 3KNGA 2CJXB 3KWMA 3CC4S 3JSMA 1PCAA 1S1UB 5C5JA 4DMZA 1JWWA 2ACMA 4EBDA 2E9TA 2E1PA 1FKOA 2JEFA 1CS4A 1SQGA 3KLGB 3W9JA 2R2UA 1Q81T 1AZSB 1RU2A 2IJFA 4FNHA 3PX4A 3MEKA 2QFIA 3K8WA 4AD6A 1SJFA 4DU8A 4KHPF 3MEGA 2GCFA 1IQZA 2CJ9A 4ECWA 1FE0A 1T05B 2IBKA 1T03B 1MW7A 2VPWB 2QYCA 3T1YJ 5HAOA 5B08A 3POTB 2W4DA 4XK8C 3R5AA 2C3OA 1NK9A 3HT0A 1X9WA 3K0JA 2DO0A 5DRKA 1SC1B 4GRSA 5LT5A 3MAAA 2E7VA 3GV7B 1B7FA 1NK4A 2VQFJ 4DSLA 1Y4ZB 3P45B 3RR8A 3SCKE 2CQ1A 2AJ1A 1VQLS 1WEYA 3UDVA 2ROGA 4C0BA 2E66A 5SUHA 5D3GA 1YITS 3CJ8A 5H9EK 1SJ1A 1NPPA 2VG6B 5LMUF 2CDQA 5HMYA 3TUPA 1EHWA 4NL5A 2Y1IA 4RR5A 5IT4A 4J9UE 1JJHA 4QIFA 3HJVA 2X1BA 3CD6S 3I5BA 4NLSA 3C46A 2KYZA 3GQCA 2YX7A 2L9DA 2M3DA 3ENQA 3FBCA 3LO3A 4ZPDA 2XMJA 4NEYA 3PW2A 1X0PA 2RB7A 1TAUA 2I5JA 1W7WA 5D4PA 2UUCJ 1NBEB 5LSOA 5LJ3Y 4MAKA 3FEXB 2RT3A 2E5HA 3K5LA 4DG1B 4RW6A 3MDFA 2ZHOA 1F2GA 3BGOP 5IV4A 1RAEB 3SSQA 4DFPA 3NKYA 5DG7A 5D0EA 4KPYA 4Z2XA 5FIIA 4UW2A 4OHYA 4YB1P 3FSXA 3RJMB 3SZ2A 1IBMF 2Y8YA 1TP7A 1KONA 4B3OA 2QSWA 1WC3A 5HVFA 2DXEA 1S7IA 3PEHA 3QRRA 3I5AA 3A8EA 4C8ZA 5F41A 2CXEA 3J7Z5 3HKWA 1ZPVA 1MMNA 2DBBA 2AGPA 4ATNA 2XLJA 1N32J 3AD8C 2YWKA 3MMBB 4X4SA 4ETZA 1U49A 1VRTB 2DD8S 3DRSB 4ZVEA 2BE2A 1Q1KA 2O3DA 2HHHF 2A2DA 3OTOJ 3NNCA 1HBNB 2HS3A 5K20B 2AMCB 4IQXA 2ZZMA 1ZA2B 5A8WB 4PZVA 4DLEA 2X51A 2C2NA 2RUGA 4KGZB 4A8XA 4WFBQ 4ECRA 4RZRA 3T9ZA 4DUTA 2R8GA 4Y2KA 1QLNA 1ELOA 4OX9J 4U67Q 3VGSA 3CEDA 5KFMA 3GMGA 3QWPA 2PGCA 1KC8T 4Y2MA 3DOKB 4CH1A 4OI0A 1RCOB 1RISA 3IC1A 3G82B 2JSXA 4EGLA 5FDLB 3N4WA 2KYXA 2B9WA 4ZP7A 3AA9A 5E33A 3V6DB 2YVSA 2IDLA 3J80U 4Q5VA 5A8KA 3G71S 2XI3A 3PEJA 4F26A 5ADZA 3KLEB 5F9NA 2HQCA 2ZHAA 4KC5A 1KFDA 3CIMA 4ES2A 2EG2A 2KVQE 3NS6A 4DV5F 3H2UB 4GKJF 1WEXA 3DLBA 3QGHA 3NBPA 3THVA 3PV8A 3ETOA 4O4RA 2ZE2B 3GB0A 2LQJA 2NSCA 3ISND 1IKXB 2E1MC 4X4OA 1B7YB 3GIRA 5ITHA 4TLRA 1FTCA 3TWZA 1Y9OA 3QLHA 4U96A 1FX2A 2WONB 2XYHB 2PA3A 5THWA 4LF4F 4F2RA 2MKJA 3PYEA 4C8LA 1VQYA 3AB2B 2W7PA 4B3SJ 3D2WA 1DQ8A 1AW0A 2AYBA 4LR9A 1VQ8S 5CXTA 1HWUA 5ETLA 4QBUA 1N33J 2WAQD 4JI6F 2DGVA 1H98A 4DPXA 4LSNB 3IXQA 4X64F 2HNDA 2AJ4A 2EPIA 4WIIA 2DHAA 1T8EA 2FGOA 1NHKL 4FNIA 4RU9A 3H98A 4Y65A 4WZMA 2DY1A 5HMZA 1V3ZA 4HKQA 2FQQB 4NA2A 2B7BB 4Y34A 2BOAA 1FA0A 3P4UB 1RAGB 1R89A 4WCEQ 2XMWA 4UZCA 3QT5A 2RVJA 3HSJA 5HLFA 2UVVA 4WTYA 1DQAA 3QIDA 3I87A 2QL7B 2KXNB 5KT3A 3AOCA 5B7WA 4B3MF 1TK0A 1A7GE 3CCUS 1NSKL 6FDRA 4LF5F 4ILRA 3QIPB 4DS5A 5ETNA 1SI9A 2M2BA 4JI2F 2VC0A 3GZ7A 2B43A 4OLPA 3ICLA 2EG1A 3NEKA 3BGFA 4C3KA 2DIUA 1VQSA 1SL1A 3L7PA 4K8RA 3DXBA 2IJNA 4URSA 4RWWA 1O0PA 3TNVA 5C7PA 1OY9A 5GAHU 1MN7A 2GJFA 2QC3A 4NX9A 2GMHA 1JLAA 4QW9A 3TVYA 2OD6A 2BJ9A 2CPFA 3G6VA 4I2QA 3M6UA 1VRUB 4J7CA 4JOUA 3T5HA 4NXMF 1CJKA 4A8SA 1HWIA 2POKA 2CPZA 5KFTA 3W5ZA 3CXCR 1RJJA 3CJ5A 3CD0A 1KQSR 2DR7A 5C42B 2ATLA 1RGVA 2B6AB 3W2WA 1S72S 2N3LA 3J80Y 1YLXA 3VVTA 1IN0A 4QPXA 5E41A 4K5SA 3BGUA 4WFNQ 2A1BA 3MM7B 2VIHA 3V5RA 4J9SA 3QWUA 4LFBJ 1NH8A 4WXOA 2J76E 4R8UB 1HQEA 4MMOA 2IRUA 2BA9A 3EDQB 1FDDA 2VPYB 1L3UA 2PDAA 2HK2A 3R6LB 1YKWA 1NDPA 3CO0P 2H48B 2IMOA 1UWBA 2DNGA 3TAMB 3MPUB 1MWQA 2GIFA 3H42A 4LJMA 3DRXA 5I3UB 3KFWX 1W2BR 1Q8LA 4DR7F 1TKZA 1UA0A 3HFKA 4EK2A 5CZVA 2RKIA 2MJUA 4Z7YA 1FJGJ 2Q1LA 4V19J 1UA1A 4BBYA 2YPYA 4P9SA 2Z8QA 2N4CA 4B9TA 1RAFB 1CJVB 1HIYA 1GXTA 1S99A 4PWUA 2KKHA 2LDIA 1TZ0A 2RQKA 2HFNA 1B70B 3LP0B 4DUYF 5EDWA 3NOGA 4PRFA 4F4AA 1YSJA 4USHA 4Y0FA 3IBCB 2WTFA 4WFAQ 2F7VA 1U8SA 1K9MT 1ICEB 3T41A 2RQ4A 4CLZA 2W4CA 1JLGB 2VDIA 5HMXA 2NXCA 4LR8A 5L8RC 3HHNB 2ZM6F 2HHSA 4IG0B 4NLYA 1RTDB 3HO1A 3JQMA 1HNZF 4A4JA 3GSDA 3WHIA 2UV8A 3HMJG 3SYZA 4K4VA 2NPFA 4FKYA 3W5YA 4ILLA 3N6LA 5E3QA 4K4YA 1YJNS 4ECXA 4ZPTR 4BWJA 3BYPA 3UNGC 4IDKA 2BZ2A 4O23A 3DLJA 1TFWA 1OPZA 1FVSA 1OO0B 1LQ9A 3KDNA 1KDNA 1H7WA 1RAIB 2QE5A 4DR4F 1RDRA 1RB0A 3HHLD 4ER8A 3D6MB 2F9DA 2OUGA 5ETSA 2H5EA 4CO1A 2D7SA 2XMKA 3MEEB 1BWVA 4GVLA 2IYIA 5A2QY 1VQ7S 1NDLA 2FDNA 2W2QP 1RTIB 1IBCB 4HH1A 1BMQB 4RUAA 1UEUA 2NREA 1RBAA 2OEJA 1KOHA 4X62F 5I42A 1T11A 3EM1A 3IS9A 3HVTA 3J81U 3W8GA 3MM6A 3IFEA 4NXNJ 1QTNB 2PA8D 3RRHA 4KKOB 5HL7Q 2OPSB 2XY7A 4YS2A 3R9LA 5B0AA 2OFGX 3JAMU 2RDJA 1FD8A 1BUXA 4ZCMA 3IWLA 2V8VA 1IBKJ 4AL5A 1HBOA 3KLIB 2YKMB 3HHLA 2MQOA 4IFVA 4IFYB 2EK6A 1RHJB 4OHZA 3M2UB 4UZBA 4N5SA 3CCTA 2BOPA 1R27B 2DPIA 3M8PB 2A6OA 5CD4H 3BKFA 5J2NA 4PPZA 5E5NA 3K5MA 2CDRB 3MR2A 4A8FA 4RL1A 3JSYA 5D6GA 1IWAA 2FLNA 1O5JA 5GAEU 1D1UA 4F02A 4CZCA 2QEXS 4G1QA 2ZJPQ 3BPSP 4FF2A 1QUPA 1U8WA 3M1VA 3DI6B 3DXSX 1SL2A 3ZZYA 2HS4A 3NL0A 2R7OA 1OQ6A 1M5PC 2BQRA 2BJ8A 4X4QA 1WTBA 2VF3A 2J0SD 4IOAQ 2F8HA 3M2VA 1FNOA 4G65A 4D3HA 5IV3A 1NDKA 1VJWA 3MEDB 5DETA 2MY8A 2V4JB 2DH7A 1VIOA 4X84A 4ANDA 4F2SA 3GILA 4WXWA 1RWXB 1RT3A 1WHVA 2JL9A 1X5SA 3A8KA 3RB6A 3NMAA 4DSEA 4KGMA 3UFCX 1D9AA 3WX8A 2Z56B 1S1VB 3BSNA 5LM7E 4R5PA 4USUA 4J9RA 3HVWA 1CPZA 5BYSA 5T7LB 5ETPA 4NRTA 4IG3A 4JI4F 2DXFA 1E6YA 1UPPA 2HHWA 4DPTA 3R2DJ 2WVCA 2V2QA 3MMAB 3KLHB 3QYYA 4CLYA 1S0MA 2FJDB 3F73A 1S1UA 4KO0B 3BM7A 4N47A 3J81Y 2HNYA 3OL8A 4QYZK 4F4ZA 5M2RA 3PHTA 1X4BA 1KVKA 4ZK7M 1YK9A 2MZ1A 3EXCX 1AZSA 3D0HE 3JAMY 1XMQF 3N6MA 1T05A 3PVXA 1T03A 3KUEA 2JFDA 4IH5A 1D9FA 3BSOA 1SIWB 3POTA 1SXLA 1HNWF 2FVRA 4DCOB 3VCDA 4NZ6A 2B9EA 3CCRS 4H4OA 3Q8RB 4TXSA 1HNIA 2FVQA 6AT1B 2M5YA 3FKBA 5IT9U 4LF6F 3BJYA 3M32B 3CD7A 1HI8A 2DHHA 2RU9A 2Y1LB 2D1CA 2Y0BB 4F04B 2H51B 2HIQA 4C2MA 4ETXA 2VG6A 4BS2A 3F41A 1FFWB 5K8PA 4QPTA 3CCLS 1DHMA 5L1KA 4XPEA 1TQLA 1H0HB 5DZ7A 2OH2A 3BGLA 1RSCA 1DRZA 5KG4A 4F8RA 4NLRA 4J9VA 1N5VA 4GO5X 2UUBF 1NMEB 4NLVA 3CJTA 2H65B 2CIMA 1ZA1B 1VQPS 4Q8FA 2FHJD 5JVGQ 2R7QA 4KT0C 1UEVA 3IWXA 1XNQF 3K17A 4UF4A 2FJEB 3FCHA 4LF5J 2ZITA 3GJSB 3H0PA 1V5IB 4ZVQB 1EQ0A 4OLOA 2ADBA 2KTQA 5IWAF 4YHHJ 4DSIA 1Q8KA 2BEFA 5CA5A 4DG1A 2R8JA 3EE3A 4GKKJ 5KFRA 3OUYB 3CJ4A 4ZCKA 4TU8A 3KK3B 2GX8A 1DQ9A 3R27A 2XO7A 1X4GA 4JV5F 4KYZA 2DRDA 3PO5A 3T5LA 1U6BA 2JJ4D 2J0WA 4N77A 2GO9A 2ERRA 3P49B 3BN4A 4J9PA 4IKAA 4CDIA 3OXFA 4JB8B 4X66J 3KMSA 2MQPA 2GC8A 1SKRA 2NR0A 3PYFA 2ZH3A 2FHJA 3MCOA 4NA1A 2YXLA 3FEYB 3LUYA 5SZTA 5DO2A 1YIJS 2V0NA 3DRSA 4M5KA 4MTPA 1PC4A 4LF7F 2ZKUA 5G0RB 1T9XA 5C24B 1I5OB 2ZBQA 2Z0GA 4K4ZA 3H90A 5AXNA 2BABA 1TL3B 1QDUB 2KG1A 4U7CA 2LP4A 4P10A 1UZDA 3F56A 1MROB 1WHWA 4H4KA 1R8AA 5A8WA 5IT9Y 4F0KA 1PJ7A 3DMJB 5A6PA 1T0TV 2LYVA 3KJNB 4RNHA 1U1LA 4YY3J 5E3AA 1YBTA 3OFFA 4OI6A 3KK2A 2IVMA 1BXNA 2BBEA 1PAEX 3S01A 2DH9A 3MPVA 3WDOA 1RTZA 1PG5B 4ID5B 4RW8B 2GQCA 3UNYA 4FYXB 1PIEA 2H1YA 1SKWA 2JHEA 4DUYJ 3KLEA 1R0AB 1EKSA 1SVDA 3EGWB 1FJCA 2FB0A 4P7VA 1YZ7A 1BLUA 3EVMA 2MB0B 3MAHA 1ZOTA 3TRGA 1N36F 3RRGA 2J7KA 1T9VA 1IKXA 4YP3A 3M8QA 4I4BA 2HS0A 1UETA 1S4EA 4CO0A 1XNRF 2RDDA 2NZ4A 2VQEF 2I6WA 1WJ9A 2WONA 1QE1B 3TA1A 3JTPA 4KV8B 3HFZB 1N5QA 3CW2C 5H9FK 4GVBA 2G0CA 3AOAA 3KJQB 1WTFA 4H54A 4DR4J 1XTZA 2QA1A 2W1BA 3I5CA 4ZVGA 5D4OA 4LSNA 2V2KA 5KT5A 3PR5B 2DRBA 2CAJA 2P6TA 3GTYX 3D3CJ 4ZKAA 4FXVA 1RXOB 2BKOA 3DLHA 3MTJA 3GR0A 3BSCA 4LRBA 3CJ0A 3UD5A 2MPUA 4V1Ak 3H20A 2HRTA 1DBDA 2IAJB 2R4FA 1YRUA 4IRDA 4KHMA 1Q5YA 4MYTA 4WIQA 1WKJA 3BKUA 2MZTA 2DNQA 3J7AN 2HFSA 3OJUA 3RBEA 4LF1A 2KH9A 3R5CA 5GMDA 2XY5A 4WZQA 1CJTB 4U8VA 2OTLS 2MQQA 2COLA 3G9CA 5KFQA 4CCHA 2ZOFA 1N5YB 3QIPA 5HJYA 1C4AA 2C2OB 3MOJB 4K50A 4QW8A 2QA4S 3MMCB 4OJHA 3TZZA 3UE2A 2EXUA 3KG4A 1VOMA 3OR1B 5CCMA 2PN6A 2AX1A 2CPHA 3QT7A 3EX7B 2V9WA 1XR6A 1TTHB 2HHPA 2EFOA 2W24A 1PC5A 2KFYA 1TKXB 5FJ4A 3I0SA 4HYKA 4DL3A 3TEGA 1HR0J 3C66A 4QWCA 2MHEA 1N34J 4Y3CA 1HNXJ 3DGPB 4NLDA 2W01A 1NSQA 1LWEB 2K1RB 4DX5A 2V50A 4WFYA 1N5TA 3IO1A 2MQMA 3T19A 2HVZA 3VWSA 1TK5A 2HWHA 4RBUA 5J1EB 1CLFA 3HHEA 4DR2J 1UTAA 1S9GB 4DX6A 4QIWD 3T5KA 1LXNA 4A46A 2EFNA 2RQMA 1FERA 3IG1A 2CQ4A 3NMRA 2XLKA 3TAMA 4KAIA 2P5VA 2BUNA 5I3UA 3MR6A 3CGIA 2GMLA 4ANEA 1NK8A 3BQ1A 3GJTB 2J0XA 2O67A 4DR3F 2QG9B 2BE9B 2R8HA 1U45A 2XZDB 3C14B 1KKHA 2WBMA 2F40A 3UW1A 3DKDA 1CJVA 2R8IA 1QTMA 1G3OA 2FIUA 1VQKS 3I0RB 1NZ8A 4OYWA 4PUOB 3GIMA 1KTQA 2QLWA 4ED8A 4PG8A 2BV3A 2RNEA 3LGHA 2CG4A 1YJTA 2VC1A 3M2RB 2CUYA 4PG7A 4ECTA 1M0SA 1JLGA 3ZZRA 4DCPB 4CLTA 1M1GA 1B64A 1FFSB 2QMXA 2Q66A 2XWYA 3M9NB 2YNIB 5D4NA 1B99A 2MGZA 4J9LA 2XHWA 2GJIA 4O3OA 5DM6Q 1T9YA 1YRTA 1S6PB 2Q6BA 1CQNA 3FBFA 3MI7X 4YB7A 2ZH8A 5JVHQ 4C0OC 4H4KC 4RUHA 3MPDA 4NWBA 2D41A 1DFDA 3A3OB 1JNRB 1FXDA 3Q22A 1UPMB 4MFBB 4DV2F 4J9MA 2J6SA 5DM7Q 1JXVA 3MUTP 4QZVB 4I2PB 2MDAA 3H2LA 2DK2A 3MEEA 2Z58B 3D6HB 3GFYA 2WCXA 1RTIA 2W2OP 3SQOP 4P74A 3AT1B 3MPYA 1QSSA 3EICA 3PW7A 3IRXB 2UUAF 2DGSA 1RT1B 1NO8A 4ZVOB 4CP5A 3DLGB 1C1BB 2ZNYA 3GLJA 3DDIA 1FEHA 3QFHA 3IA0A 3RAXA 5G4DA 2E5LJ 1P6TA 4O0NA 1REGX 3MR3A 1RHKB 4R0JA 4OI4A 4OI2A 4KKOA 4DV0J 2OPSA 5LXYA 3DOLB 4RJVA 4L3NA 1RA6A 2KRRA 1HL6A 2QFJA 3NGRA 4DBQA 2LCWA 3KLIA 1RWPB 3AQPA 4IFYA 1RT7B 1TUWA 5U47A 3R3TA 3T1HJ 2MKHA 6FD1A 3SSSA 1XERA 5CYQB 4G6VB 3IAM9 1LKZA 3MXHP 3M8PA 3O8WA 3K2YA 2R2RA 4PKDB 3H7HB 1E6VB 2ASJA 3DC2A 4JI7F 3K5NA 4OYAA 1UCNA 3M6XA 1APSA 4WP8A 5IWAJ 4E2FB 1N48A 4USTA 4DSKA 4X4TA 2FVPA 2VBYA 4N76A 3DI6A 2FD2A 2JVRA 3WIVA 5AXLA 3DU6A 2DPJA 4DX7A 2K3IA 2M88A 1I51B 3DLEA 1IM6A 4KGXB 1N5SA 4I67A 2DGQA 1URRA 3TX8A 2ZH9A 4OX8A 2V4JA 3P3DA 3CCMS 2XWXA 3PCOB 5KFXA 1BD6A 3NS5A 3CCWA 3P8BB 4WE1B 4EEYA 3AXMA 1UJ6A 5J1PA 3DGVA 5KFWA 5C25B 4ZITA 1FK9B 3O2IA 2CQGA 4OZ0A 3LANA 4NLPA 2L48A 1VYAA 3C6TA 1S1VA 1KVJA 3GYXB 2DEJA 5IM0B 1S0OA 1YJ7A 2I0XA 4C11B 3H4DA 1HBMB 3KNAA 1OMSA 2HBZB 4OMFG 1REVB 1FRMA 2HAIA 2WHOA 1PILA 1JIHA 5T7LA 2IYGA 3TUJC 2JOQA 4N56A 4ENOA 2W2MP 4CO2A 3DCAA 1SV5B 3N5BA 3AH6A 2WSFC 4QU6A 3CD5A 4M5DB 5HQMA 2YNFA 1S6OA 2XEXA 3KLHA 4DZDA 3IR6B 4ZJLA 2B8PA 5MAOA 3HLUA 3A12A 3O5TB 3R5GA 3KHGA 4MKBA 1PJ5A 4DV7F 2YNHB 2MZJA 2G4BA 2LDYA 3VV2B 3WC2A 2XSFA 1Y7PA 2ZVIA 3PIPQ 4C4WA 3MM8B 2I1RA 3K59A 2CPEA 4IOBA 1FXRA 1R7IA 2ZH1A 5BYRA 2GZOA 1M5KC 2UXBF 3KJVB 5B0FA 1CJUB 5DDRC 3N9UC 4QWAA 1H3DA 2FJWA 2R7XA 4KB7A 1F5CA 3NWGA 2UUWA 1S0NA 1KLNA 2C3YA 1CULB 4I64A 1FDAA 3CC2S 3W8PA 4HACB 2OLWA 3SCIE 1TKDA 2H9ZA 4RO0A 4CTAB 5D0RA 1OY8A 1G7CB 2Z2LA 3UI3A 2PMHA 1LWFB 2VASA 1U26A 3R7BB 4ECSA 1FDBA 1YI2S 3H5SA 2XCAA 4LF8J 3BBFA 1ZM2A 2CZ4A 2KXHA 1KSPA 3AOBA 3NCPA 2C1EB 2W8LA 4KY3A 3NAIA 1HQUB 4R0EA 3GV8B 2MXYA 3B4DA 1AFIA 4DFJA 2HFUA 5E3RA 2MSTA 5A6WA 5I3QA 4F67A 1T9TA 3ONQA 4WFXA 3PNIA 4LBHA 1ZM9A 2NLWA 4DUZJ 1HMVB 2FLOA 1VIXA 2F5GA 4OYZA 4KGVB 1IXKA 3CMAS 4TNOA 1QVGR 3BV8A 2KZMA 1HNVB 2PMWA 2MTLA 2E1RA 3AJ2A 2VKZG 5GAEI 1S49A 2L3MA 2Z2ZA 2QLJB 3OLBA 2CYYA 1D9DA 5IFMA 2DGUA 3QZ7A 1ZZFA 2CNKB 3OL9A 1YDLA 3OUYA 5L1JA 4WF9Q 3KK3A 1FNXH 4DR6F 3IWNC 2V68A 1RWWB 4RW7B 4NPOA 5D0GA 4OHXA 2ZOMA 3HP6A 3MPWA 3MURP 2R7VA 2YNGA 4LRDA 4AXJA 4C7QA 5KFVA 1HD0A 5HP1A 2LLZA 2JNJA 3CWJA 5F8HA 4HT5A 2Q79A 3P96A 2P8IA 3HPOA 1JLEA 3R5JB 1H38A 1RBOB 4CM0A 1QSYA 2KO1A 2AEMA 4X4UA 4B9SA 3PRVA 3UCUP 4OI3A 2JVOA 1NJYA 3GG0A 1FRHA 4HDGA 2NXEA 2D9PA 2BJ1A 3M8ZA 5KG5A 5C24A 4HI1A 1NJWA 2H4YB 3BH6B 1SH0A 3VQTA 1HPZB 2UXCF 5AT1B 1S48A 4FDFA 3SSRA 1KQGB 1JNZB 1HBUA 1MROA 1OIAA 3OSPA 5J2QB 4RNOA 4LBPA 4MIAA 5KFJA 3DMJA 1N0VC 2PD1A 1WEZA 4TN2A 5CD4A 2UU9F 3IMQJ 1VBYA 4OZNA 2RRAA 4FF3A 4TQSA 5GMKa 1NKCA 4PG4A 1NKBA 3U1MA 3G6ES 2LKZA 4A8WA 1S76D 4IRKA 4DV3F 4PYAA 3LA0A 1FX4A 3D7SB 1PO6A 3BGRA 3O44A 4AFFA 3U1LA 3N28A 2XC9A 1GAOA 2NXJA 1FTRA 3E51A 1IR2A 2APOA 1XBWA 3GR1A 2GJ2A 1U6FA 2VONA 2G0JA 3ZFVA 3DRPB 3FRZA 1AROP 1R8PA 2HVEA 3E01B 1V3SA 3CCJS 2AQ4A 3D4JA 1DLOB 5KFAA 2C2DA 3HSDA 3A1YG 4PXDA 2HG4A 4QIEA 2F9JA 1LK7A 3Q24A 1XMBA 2VDHA 4X65F 2G2YA 1HWJA 4FYVB 2GIQA 2YKNB 2YKOA 5L1LA 3KG1A 1IKWB 4KV8A 2VHGA 2FC9A 2Y3YA 3OXLA 1R8HA 4EMDA 1SUQB 3PHEA 4NCBA 3CJ3A 1RHMB 2O5DA 3ZZTA 1XIQA 2EI5A 2PSZA 2UV8G 3L95X 2RRBA 3SQGB 1NUEA 2IMWP 4RUBA 5H9FJ 3M8SA 3ET6A 2BW2A 4WK1A 4DV1F 1T02A 2K7KA 5AJ3F 4CLUA 4JI0J 4EBEA 2W2NP 2K3KA 1FKPB 2ZH7A 3PX6A 4DV6F 1PGZA 3DRRB 4B3RJ 1GEHA 1M1KT 2BMBA 2IAJA 3V4MA 5KFZA 3KHHA 3UR0A 4TLQA 5K5MA 4BC7A 3CUNA 3NOCA 4CQ1A 1S6QB 4DPWA 4NYPA 4L73A 4C6AA 3O6QA 3ILJA 3B4MA 1U02A 1CJTA 4LFAJ 2IJRA 2LMIA 5JUMA 5D78A 4DQRA 1X4CA 5KT7A 1HLWA 1N5YA 5EGYA 1P8GA 2BX6A 1QJHA 1VRQC 1RWVB 3OFGA 5CABA 2E1AA 3PJXA 4JV0A 2Q6CA 3MUMP 2PO4A 1ZZNA 1QY7A 3NRBA 1X5TA 3MMCA 1X4FA 2EWHA 4FBUA 4AQYF 4OJ1A 2OTJS 3T6BA 2HK3A 1UVNA 3RRKA 1UKUA 1TVRB 5BR8F 1RTHB 1RAAB 3JB9k 4NASA 3PTWA 2ZBPA 2VFRA 3JTOA 3GP9A 2HFVA 5DLFA 2FC8A 3DGPA 2OPPB 2AZ3A 2J0QD 1UVJA 1C0TB 2K1RA
chains in the Genus database with same CATH topology
3QAUA 2GGPB 5CYJA 4QYZJ 1C4CA 3M4XA 4O4GA 5IT0A 1FT8A 4Z37A 2PT0A 1RT3A 1HQUA 3PW4A 1WHVA 2JL9A 3C3LA 1X5SA 1JLFB 1K0TA 3HJFA 5K8MA 3RB6A 2RS2A 4JI5F 2IA0A 1KHVA 3NMAA 1TV6B 4KGMA 2HQ3A 4DSEA 3UFCX 1D9AA 1FD2A 2EFPA 1S1VB 1SJQA 3E8OA 3DHXA 3BSNA 4KFBA 3FEZA 4GC7A 5J1EA 2YH1A 1VQ6S 1IJFB 1NK6A 4R5PA 3FDSA 2VFUA 4ELTA 4JI8F 3EZ5A 1M5OC 2UVWA 4J9RA 1S9GA 1GNKA 2IFXA 3HVWA 3ZZPA 1SKSA 3MTKA 5KFPA 2FY1A 1CPZA 2NXUA 2CQDA 2VUGA 1KQFB 2DISA 2QLXA 1IM4A 5KFKA 3MFHA 3B8HA 4ECQA 5BYSA 5T7LB 1YWXA 1FNMA 4MIWA 1U6ZA 4HT7A 2QV6A 4C8KA 1IUJA 4NRTA 2QA4G 4IG3A 2FVCA 1FKAF 4JI4F 1IKVB 2V8HA 2IBOA 4CT8A 1FRLA 1RKIA 1HD1A 4PG6A 1F5BA 1E6YA 4NLQA 2HHWA 4C0HA 5K8NA 2FJVA 3AHPA 4EU0A 3VAFA 3H5XA 1RT5A 1RT4A 3MMAB 2DGTA 3BDEA 2DNLA 1M5HA 3VZIA 2BVZA 5A8KB 3KLHB 1F0XA 3CCZA 5M2PA 4ZP8A 1HNVA 5KT6A 2N7YA 3QYYA 4ZS6A 1CEZA 1R8BA 2DH8A 1S0MA 4MYUA 2FJDB 3F73A 1VRUA 1NJZA 4LMZA 3JSBA 1S1UA 4KO0B 3BM7A 1LK5A 4N47A 3J81Y 2LXIA 3TAQA 3LF0A 2HNYA 2HRYA 3OL8A 1RP5A 3SDEA 2W9CA 1D8ZA 1O51A 3NBPB 4F4ZA 5M2RA 2YQ3A 2CPDA 2CQPA 1X4BA 4J5OA 4ZK7M 1QAJA 1DZ5A 1LWCB 3I0RA 4PUOA 2MZ1A 3EXCX 5C42A 2XG8A 2RSQA 1ZAWA 2XS7A 4Y6IA 1YBAA 2C42A 2B6AA 3NAHA 2ZZNA 2AWZA 3BEGB 3D0HE 4RW9B 3JAMY 2YKPA 3P5TL 4CIOA 4CO5A 2HRUA 4ILMA 4DQPA 4WU3A 3RZAA 2B7CB 3N6MA 1XMQF 1T05A 3NGKA 5KFIA 2QO3A 1DURA 3MM7A 3PVXA 4IQMA 2EFQA 1T03A 1AFJA 4EUVA 2JFDA 4KTQA 4JI3F 2CQHA 5KFOA 4OL8A 1GH8A 4IH5A 3G8QA 3KHRA 1D9FA 2VQFF 3FFIB 4ZPVR 3BSOA 2J5AA 3FSIA 4YHHF 2UXDF 4R8UA 1SIWB 5AE3A 3JSRA 3POTA 1SXLA 2DR8A 1ZM3A 1HNWF 2YNIA 4LIRA 1QM9A 4ECYA 2FVRA 3VCDA 3RR7A 3G86A 4NZ6A 4GKKF 1TAQA 1WI6A 5DDOC 3IBWA 3CCRS 4H4OA 2DNHA 3HHDA 3CC7S 4QWEA 1FO1A 5B0CA 2VKRA 3Q8RB 2E9RX 4TXSA 4FVMA 1NRKA 1HNIA 2L9WA 3D28A 1GQEA 1M5SA 5HI7A 3GIKA 3C8YA 4C8YA 1RT6A 2DGOA 1FRXA 2HNDB 2CQIA 2RMLA 5DQHA 1N6QB 2FVQA 3G8TA 2A10A 5DQGA 1BC6A 4I69A 2CJAA 3V4IB 2M5YA 3LQVA 3KK1B 3BJYA 3M32B 4NCGA 4LF6F 3OTCA 1BWEA 1T3NA 4ERDA 4OV1A 2ACYA 2VONA 1N0UA 2MSSA 3CD7A 3I0SB 1HI8A 3C6UA 2V94A 5F8JA 3LGNA 3S8SA 2UVRA 4FXDA 4Q44A 4X66F 2RU9A 4MFBA 2PI5A 4A8MP 2BXJA 3SEOA 3PM9A 1MU2B 2D1CA 3U02A 3B82A 2AF6A 3RTVA 4A8QA 3US5A 4F3OA 4I2PA 4AL7A 1XR5A 1T7PA 4ZP9A 2MKIA 2HIQA 2X3GA 1U1QA 4C2MA 3VR1A 1UMJA 1V9OA 4NLXA 4ETXA 1RWUA 2VG6A 4NMLA 4QWDA 4GMKA 4I6WA 3BDPA 4BS2A 4M95A 1SJ4P 3F41A 3LP2A 3D1QA 3I9V9 3M9OB 4ES1A 1X8DA 4QPTA 5K8PA 5FLXY 3CCLS 3I56S 1DHMA 4PWDB 3G96A 1IKYA 4RNMA 3TAPA 2G9OA 5L1KA 4XPEA 1TQLA 3N5FA 4DF4A 3I55S 1H0HB 3IRXA 3LP0A 3TP2A 2OH2A 2QMWA 2CJQA 3N0VA 5DG8A 4O44B 1RTJA 1S1XB 1RT1A 2KT3A 2D3ZA 1C1BA 3BGLA 2KU7A 4YUDA 4MKYA 4X4VA 2E5GA 1IJEB 1DRZA 2HMIB 5KG4A 4F8RA 2VL1A 4NLRA 1N5VA 4GO5X 2DNMA 2UUBF 4QR2A 4MK9A 3CB4A 3IG1B 4KE5A 4KJIA 3H2VE 1AXQA 2FHMA 3V6JA 1YJRA 4NLVA 1PSDA 2JLFA 4O3RA 1CVJA 2MKSA 4IG0A 4ICLA 1JLBB 1HFEL 1RTDA 2CIMA 1JLQB 4B02A 1DARA 2XI2A 5J2MA 1VQPS 1NB7A 2ZFHA 3I31A 2J9DE 4HHJA 4Q8FA 2FHJD 3DOLA 5JVGQ 5KFSA 2R7QA 4KT0C 1UEVA 1KQKA 3IWXA 1VQMS 4KGKA 1XNQF 2O01C 4DPOA 4ZHRB 4OZJA 4H4MB 1OPIA 2FJEB 2MY7A 2KN4A 3FCHA 3OPKA 2ZITA 4HVZA 4FN5A 3MFIA 1U1NA 4GO7X 2E7XA 2JC1A 1FF2A 1ZBTA 4YY3F 4I2QB 2HNZB 1SIZA 4UY85 1GXUA 4YEAA 4PQUB 3S7RA 1X4DA 4UQGA 2GHPA 3JSMB 2HLUA 2CKWA 2JX2A 1U1RA 2I2YA 3CCSS 1NJXA 3FRYA 2YY3A 1RT7A 1DTQA 4OLOA 2K7JA 2N7CA 2ADBA 1MMDA 2KTQA 1R3NA 3DN9A 2FGCA 5IWAF 1DLOA 5KG1A 4BCAA 4DN9A 2HYIB 4USJC 4RW4A 4DSIA 3EGNA 3HI9A 4OZ5A 5EWEA 2AJ0A 5CYQA 5CA5A 4ECUA 1U4BA 4DG1A 2D3OR 1J5OB 1WELA 3LWMA 2R8JA 1S0VA 1FKOB 2RDIA 2MQLA 1F5AA 4FS2A 4K2XA 2RH3A 5F0WA 2CQ3A 5KFRA 1DAXA 3OUYB 3CJ4A 4ZCKA 4TU8A 1H2TZ 2B9XA 2XB2D 3KK3B 2GX8A 2MZRA 3EXYA 2W4PA 1DQ9A 1LXJA 1RAJA 3R27A 5AE2A 4DFKA 2XO7A 1XK8A 1X4GA 1E6VA 4JV5F 3OTBA 2D74B 5JXSA 2OFHX 3ZC4A 3PO5A 4ED0A 2L41A 1GTHA 3T5LA 2AYEA 4K4WA 1U6BA 3TI0A 3OVBA 2WOMB 1HI1A 1Q4RA 1U1OA 2KFNA 2JJ4D 1YVFA 2XMUA 4XAKA 2DHSA 2J0WA 4N77A 3CJKA 1SUQA 4DX8H 2GO9A 3K5OA 3RW6A 2ERRA 1SH2A 1YGYA 1IQTA 1BY9A 2BYCA 1F9FA 3PXGa 3P49B 3BN4A 2V5HG 1SC6A 4J9PA 4IKAA 3I9ZA 3M30A 5KFUA 3OXFA 3CSKA 4O0IA 2ALZA 1JLCA 2ASLA 3CCQS 1RYSA 5IZHA 3KMSA 2MQPA 2GC8A 3V81B 1NHUA 2C22A 1HQEB 1SKRA 1J2VA 1T95A 2BACA 3SQGA 2NR0A 2DCUB 1UVIA 1UJ5A 2YKQA 2L9NA 2MGZB 3R1HA 1FJEB 2B5JA 3TA2A 1TL1B 4BDPA 3QJJA 1YJ9S 2ZH3A 2N82B 1NAQA 1TKTA 2KJWA 2ZUGA 2ILYA 2FHJA 3Q8SB 2HVHA 1UWBB 4CT9A 2WK4A 3QMQA 3UWTA 2IM3A 3QGIA 1YTYA 1MNEA 2OMOA 2ZVSA 4NA1A 4QCLA 5IS2A 3FEYB 3FQKA 3LUYA 3CTRA 5SZTA 3OVSA 2JFKA 5CQGA 5DO2A 3MAQA 3OVAA 4HTIA 4DOZA 1UVMA 2Y1RI 3OTEA 1U2RA 1YIJS 3OXGA 4LVOP 3DU5A 2JWNA 1KS2A 2V0NA 3CDWA 3DRSA 2DNYA 1U47A 2KM8C 1YJUA 1CC8A 4MTPA 2XMTA 4B9UA 1PC4A 3NNAA 2ZBIA 3MCSA 2I8EA 1TKZB 2ZKUA 3MWBA 4LF7F 5G0RB 4Q2LA 5C24B 5E0OA 1U7LA 2KT5A