1WF1A

Solution structure of rrm domain in rna-binding protein np_057951
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
GSSGSSGMSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTLDINMAGEPKPDRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA-binding protein Raly
publication title Solution structure of RRM domain in RNA-binding protein NP_057951
rcsb
source organism Homo sapiens
total genus 12
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wf1A01
3G71S 1HD0A 4WIIA 4TU7A 4J5OA 3G4SS 2KN4A 4CH0S 1IQTA 2JWNA 2AYGA 1UFWA 3LQVA 4C0OC 5LJ5Y 2XSFA 2DNQA 5JVHQ 2CQIA 3US5A 1VC0A 2RT3A 2FC8A 3NS6A 2DH8A 3THTA 2K3KA 3H2UB 3ZZZA 2XS7A 3NNCA 1U1MA 2RU3A 3FEYB 1VBXA 2L08A 2EVZA 1G2EA 2LECA 1SJ3P 2JRSA 2KRBA 2MQOA 2M7SA 1XN9A 1FNXH 2VODA 2E5JA 2QFJA 4C4WA 3CD6S 1X4FA 3VAJA 4WF9Q 1U1OA 3CCQS 2CQHA 2RRBA 4TU8A 5IFMA 5CXTA 1WEYA 3EGZA 3MUMP 1M5OC 1URNA 4WFNQ 2OSRA 2RQCA 2KG0A 1N52B 1VBYA 2F9JA 2RS2A 2L9WA 4OZ1A 1WG5A 1VQOS 2KRRA 2CQ4A 2MSTA 2MKKA 5GMKa 2KFYA 3CC4S 2DHGA 2D3OR 1FJEB 2O3DA 4YB1P 1HL6A 4LJMA 2ADCA 1Q86T 1KQSR 2JVOA 2DNLA 1YWXA 2DO0A 2DK2A 1M1KT 3BEGB 2XS5A 2AYMA 2XB2D 2KXNB 2CPJA 3R1LA 1L3KA 2FHOB 3UCZP 1QVGR 2MB0B 2M88A 2MY8A 1JJ2R 2DHAA 2MQQA 1U1LA 1VQPS 2MMYA 1WI6A 2OTJS 2CQ3A 1WWHA 2KI2A 1K9MT 1JJ4A 1WHXA 1H6KX 4V19X 2LCWA 1WF1A 1X4AA 2MJNA 3CULA 3FEXB 5DM7Q 2CQCA 3NS5A 2MZRA 2BOPA 2HYIB 1U1QA 2CQ2A 4ED5A 2M70A 2HZCA 2DNNA 1F9FA 2ADBA 2KG1A 1ZH5A 1HD1A 4QU6A 1FJ7A 2DNPA 2OTLS 4IOCQ 3VALA 3IRWP 4ZKAA 4PKDB 1KOHA 3EX7B 3HI9A 4BS2A 1P27B 1WF0A 4FXWA 3S01A 1CVJA 1U1RA 1WI8A 3CCLS 2ZJPQ 3PIPQ 3RW6A 3TP2A 4WFAQ 2DHSA 2G0CA 4TU9A 5EN1A 2K8GA 1A7GE 2MHNA 3CF5Q 1QM9A 5GADU 1X0FA 2RQ4A 2CPZA 2N82B 3NNHA 4ERDA 5CA5A 1H2TZ 3CCJS 2N7CA 3OW2R 1SXLA 2DGWA 3THPA 1M90T 2ZJRQ 3MD1A 3Q2TC 1SJ4P 3NMRA 2X1AA 1N54B 2OJ3A 2KHCA 1KOOA 2CQPA 2M52A 4WCEQ 5IQQA 4F26A 1YHQS 2DGSA 1PO6A 2DGQA 2YKAA 2NZ4A 1U1NA 1U1KA 2AYEA 2LYVA 1O0PA 1X4GA 2MZTA 4CIOA 4UQTA 2G4BA 4QQBA 3CCMS 5CYJA 2LXUA 2CQ1A 1WEXA 2HGLA 4RU2A 3P3DA 1VQMS 2YWKA 3U1LA 2GO9A 5JVGQ 1YJNS 2N3LA 5D77A 2PEHA 1KC8T 2FY1A 2CPHA 2LQ5A 3CCSS 2DGTA 2D9OA 2MJUA 2J0SD 1ZZNA 2MZJA 4LIRA 3DLLQ 1FJCA 1M5KC 3UD4P 1SJQA 2RVJA 1JJHA 2CPEA 3CXCR 3MXHP 4PRFA 2MKCA 1VQNS 1FT8A 3HHNB 2VOOA 2MQPA 3RW7A 5GAHU 3H2VE 4YUDA 5GVQA 5LXRA 2M4MA 2LA4A 4WKRA 4EGLA 2F3JA 3CMES 2KT5A 5DDOC 2DITA 1D8ZA 2FPHX 3G8TA 2DIVA 1YI2S 2N3OA 3UCGA 3CCRS 1X4EA 2M0GB 1U2FA 1SJFA 1Q7YT 1N8RT 5GAGU 2J8AA 3I56S 2LMIA 2JX2A 1OIAA 2Q79A 2L41A 2E44A 2DGVA 5IM0A 2CPXA 2KXFA 1X4HA 4P6QA 2QEXS 3BO2A 1FO1A 1WF2A 5DM6Q 1HA1A 2DNZA 3P5TL 1YITS 1VQ5S 2KXHA 2JVRA 1VQ9S 2EK1A 3CPWR 3MUTP 3NNAA 1VBZA 2E5HA 3IWNC 1NU4A 2LKZA 3SDEA 4FXVA 4WFBQ 2UP1A 2CQ0A 5DDPC 3TO8A 1Q81T 2MXYA 1SJRA 3J7YU 4M5DB 1PGZA 4F02A 2I2YA 2MKHA 1K8AT 1B7FA 2CQBA 5LSLA 2U2FA 1DZ5A 1U1PA 3VAIA 2X1BA 1NO8A 2MZQA 3UE2A 2HVZA 3P49B 2VOPA 1N88A 3CTRA 2MGZA 2MPUA 2DIUA 2F9DA 2DISA 2KH9A 3CMAS 2MQNA 2ZJQQ 1VQLS 2WBRA 1R8PA 2HGNA 5DDQC 4UY8T 2FC9A 2ERRA 1X4CA 1U6BA 1X5PA 5MLCV 1M5VC 3P6YC 3ULHA 3CC2S 3CUNA 2DB1A 2PE8A 1VC6A 4YOEA 1WG4A 2DNMA 2KU7A 2LEAA 2J76E 2DH9A 3VAGA 2I38A 3G96A 3BO3A 1Q82T 4C7QA 3CCVS 2MYFA 2AD9A 4PR6A 2QA4S 1K73T 1FHTA 5HO4A 2DNHA 3L3CA 3VAFA 1KD1T 2D9PA 1UP1A 4QPTA 5HL7Q 2EK6A 1X4BA 1WELA 1X5OA 1D9AA 2MY7A 3EGNA 1M5PC 2M8HA 4TLQA 3MDFA 5FJ4A 3UCUP 4F25A 2DNRA 2CQGA 2DNOA 2DHXA 4Z2XA 3V4MA 1UW4A 1RKJA 3SMZA 2NLWA 1QVFR 5ITHA 2XS2A 2RNEA 4IO9Q 3SXLA 2MZSA 3U1MA 2CPIA 2DGOA 2M9KA 5IM0B 3BS9A 1VQKS 3N9UC 5LSOA 3ZZYA 1RK8A 2CQDA 3S7RA 4IOAQ 1VQ4S 3SDEB 1WTBA 2XNRA 3Q2SC 4OZ0A 1FXLA 1P1TA 2LEBA 3PIOQ 1YJWS 1WHVA 2DNKA 2OSQA 2KVIA 5DDRC 5GAEU 3MI7X 3R1HA 2DGUA 1X5SA 3J7ZT 1AUDA 1WEZA 1WG1A 2HGMA 2MKIA 3BO4A 2MZ1A 3R27A 4W92B 2YH1A 1X5TA 3VAKA 2MGZB 2G1DA 3B4DA 3VAMA 1U6FA 4W90B 4QU7A 1ZZFA 3I55S 1OO0B 2M2BA 2X1FA 3UD3P 1NJIT 5D78A 3MOJB 3MUVP 1S79A 2KYXA 1VC5A 2GHPA 5BJRA 3G8SA 1S72S 1X4DA 2MKSA 2XNQA 1WHWA 2E5IA 2V94A 1H2VZ 1UAWA 3S6EA 1YTYA 2VONA 1A9NB 4CQ1A 2CPFA 2RS8A 2J0QD 2RRAA 2B0GA 3MURP 1VQ7S 4A8XA 1WHYA 1VQ8S 2LXIA 3G6ES 2MQLA 5DETA 3CCUS 1YJ9S 2YH0A 2RUGA 2AYBA 4IUFA 1W2BR 3MD3A 4CH1A 2LA6A 1DHMA 2MKJA 3DXBA 2X1GA 2DH7A 1BY9A 2CJKA 2E5GA 5H1SV 3VAHA 3TYTA 4Y0FA 2SXLA 2U1AA 2BZ2A 3D2WA 3JB9k 3G9CA 2DGXA 2MSSA 1DRZA 1DBDA 1VQ6S 2A3JA 2CPDA 4Y00A 1OPIA 2YTCA 2OIHA 4LMZA 3LPYA 1YIJS 3CCES 2DNYA 2DO4A 1R8HA 3B4MA 2MQMA 1OWXA 3UWTA 2KM8B 1H2UX 2DNGA 1JMTA 3VF0B 3S8SA 3CC7S 2CPYA 5LXYA 4U67Q 2M8DB 5LJ3Y 3K0JA 2KM8C
chains in the Genus database with same CATH superfamily
2B7BB 4M8LA 3KLEB 2OPSB 2PGCA 1Y3JA 1UPMB 3CGIA 1UETA 1IKWA 2ZC3A 3Q22A 1XN9A 1G1XA 3TQEA 1RWVB 6FD1A 5IWAF 3F0NA 5C42B 2IHR1 3X3UA 4EO6A 4C0HA 4DV3J 1E6VB 1Z4UA 2L9WA 3ZFVA 4HI2A 3BB5A 5GMKa 1BQMB 1FJEB 1RQ0A 3DMJA 1S9EA 1Q86T 2VD3A 1YWXA 1NKBA 2ZKTA 3GFHA 4LVNP 3AQOA 1RA7A 2HNZA 3T5HA 2MB0B 4DDFA 4UY85 2ALZA 4MIWA 3BR8A 2YNIA 4J9NA 4YR0A 1FWKA 2V4RA 3PJWA 2MZRA 3W5YA 1YG0A 2H54B 3KTQA 2CIMA 2BJEA 2R7QA 4OZNA 3L7UA 4I67A 2QO3A 2HHPA 2NS1B 1RE1B 1A6LA 3K57A 3CF5Q 4OL8A 2KT3A 4XTTA 3A3NB 3T5LA 4O0NA 4M5DA 5J2PA 3MEGB 1UJ4A 1LFPA 5AXNA 3M6VA 3O3LA 1RBOB 4DL2A 4MH8A 4KHPJ 2WB1D 4JI8J 2G9OA 4UQTA 2B4OA 3GONA 5CYJA 2ROEA 4ZVSB 4H54A 5G0RB 2HVHA 4K0KF 1WC5A 4JI4J 4PUOA 2GIRA 5I4MA 2IAJA 2J9DE 1I51B 1R8AA 4TLRA 4A46A 1ZZNA 2HQCA 3FRYA 1ZA2B 1RTIB 2XMTA 3CD0A 4MJKA 5L9XA 5B0CA 4YUDA 4OI6A 1HWUA 1D8ZA 1YI2S 2ZOFA 2V67A 3AXMA 4A8QA 5E3CA 4DEZA 3IRXB 2CXEA 1XMOJ 2OPRA 3TAQA 1MMDA 4EWTA 3QSIA 3MEEA 2XYPB 3R5GA 1VBZA 1PYSB 5F0UA 2GCFA 2I2YA 2MKHA 4MKAA 2DRBA 1G3OA 1DQ9A 3DC2A 1SJ1A 1U1PA 1S6UA 4ED3A 2E7WA 4LSLB 4ZA1A 2Y8WA 4F3QA 2HVZA 2YNGA 3H0PA 2VOPA 3G6XA 1Y9OA 1U2RA 4LFBF 1U4BA 2GS8A 3DLGA 4ZVRB 3M2RB 5KT4A 4H4KC 1IM4A 1SH2A 5SUHA 3M32A 4Z7YA 3VAGA 2WOMA 5RUBA 4AXIA 3FBFA 2R8GA 4DG1B 3KJVB 3SBMA 4DR1F 2XZTB 4FF2A 2YX7A 2YKNB 2ZUGA 1PAUB 2ZH9A 1RWXB 3NGTA 2CDQA 2IRYA 2DHXA 4PEOA 4X4OA 2VHGA 1CJVB 5KT2A 4DR6J 4YB6A 4N8NA 1RT5A 1M1GA 2I5JB 2Y1JA 2XMMA 3DRSA 3NOCA 2DY9A 2R2TA 4Y3CA 3RRHA 5GAEU 4U8VA 3ILJA 4CT9A 4RUAA 4IRKA 4W90B 4DN0A 4WK3A 1MSWD 2KYZA 4I1TA 3MUVP 3G8SA 2H1YA 3TUZC 1I1GA 4ZLPA 5K8NA 5C7PA 1YTYA 1XK8A 4CQ1A 2E1RA 1HPZB 1DHMA 2MKJA 4OHVA 4CH7A 4JI2F 2GGPA 4QYRA 4RUHA 1FWPA 1VDHA 3A4TA 3VAHA 5CYQA 1IKXB 2MSSA 5A2QU 4OX6A 4DL6A 4Y00A 1LK5A 4XK8C 3BKTA 2F4VJ 3LPYA 2DO4A 5FDLB 1UA1A 4KO0A 3A8EA 2RKIA 1NJXA 4JI7F 2QIFA 2KO1A 5IS2A 1FTRA 2JEGA 3M6XA 1VFJA 3DOKA 1JLBA 3PJXA 3TZZA 4NLYA 2CQIA 3US5A 4WKYA 4AT1B 3PKYA 2E66A 2F8EX 1YGYA 1TL5A 2EVZA 2JLEA 4AQYJ 1TTHB 3HT3A 3DN9A 1WKJA 1VMBA 2ASYA 4C4WA 1IBLF 4O4GB 2AGQA 3PW7A 4NLRA 2HQ3A 1CJTA 4C3MA 5KFWA 3SSSA 5D0RA 1N5YA 1RTJA 2DRDA 4DV2F 2FJBB 3CC4S 3GG0A 2UU9J 1NUEA 4R0EA 1XERA 3LWMA 3IXQA 3N0VA 2JVOA 2J9DA 4CYUA 2EG2A 4F0KA 1L3KA 2NXCA 1QVGR 1NSQA 1HW8A 4B08A 3M8SA 3QT5A 3KLFB 3IM9A 1O5JA 3GU0A 4J9PA 3CD5A 2W7AA 3J80U 2AGOA 4PAAA 1DQ8A 3R6LB 1HYSB 3GQCA 2FJXA 3IS9A 3EJMA 4ED5A 4QWCA 2FZKB 3AD7C 2HLUA 1S97A 3QZ8A 1RISA 4QU6A 4QR0A 2B51A 4GC7A 1IBCB 2P8IA 3S01A 4NA3A 1FKOA 1YDLA 1TL7A 3FCVA 2P9EA 4A48A 3RW6A 5AE1A 2D1CA 3IBFB 2VG7A 2WSEC 5B0GA 3DM2A 1H2TZ 1EIYB 1SXLA 4NWBA 5KG0A 4P75A 1QE1B 4DQQA 3QO9A 2DGSA 1KR4A 2BA9A 2YKAA 4RNMA 4N5SA 1S4FA 2NUUG 1IKVA 3CIMA 2FLLA 3PG9A 4OZLA 1VS3A 4ZCLA 1ZM9A 1P1LA 3JSMB 3O6QA 3BQ2A 1KC8T 4DR6F 4OV1A 3TVYA 4NZ7A 2DGTA 2D41A 3TUJC 2HHUA 2J0SD 3DLLQ 3KG0A 4IR1A 3DKDA 3CXCR 5I42A 1DTTB 2FZGB 5LOQA 2F8HA 4Q2MA 2Y3YA 3GG1A 1DLOB 3M9NB 1Q7YT 4LF6J 3W9IA 5CABA 2XLKA 1NH8A 3I56S 4WTOB 3G6YA 2XMKA 1CJUA 1FCAA 3GJRB 1FEEA 5IT4A 5E33A 2LKZA 3IWLA 2KKHA 4K5RA 4F02A 4NLTA 2Z4PA 1B0PA 4HYKA 4YY3J 4Q8FA 2CA9A 4S0MA 1QUVA 5A6WA 2IBOA 1VQLS 3DRRA 1HI8A 2ZEJA 1F1BB 2HURA 1NRKA 1RTDA 3MM5A 2RHQB 2YQ3A 2PC6A 3AQPA 1B64A 2LEAA 3I5AA 5B0EA 3QFHA 5A0YA 4KHMA 2V8PA 1R8BA 1U2CA 1FD8A 2IC3B 3HKWA 2HHHJ 1NSAA 2WSFC 4LBIA 2KDOA 3CT9A 3N5BA 1REVA 2UV8A 2BE9B 1UW4A 4U9RA 2KZMA 5ITHA 3KYLA 3DU5A 3SXLA 2BQUA 3GFXA 4MK9A 3C16B 3W2VA 3D1HA 2GHWA 4HLBA 1IBKJ 2R8IA 1XIQA 3Q8SB 3KNAA 3KLGB 1WHVA 1U48A 3QIPA 2UU9F 1WEZA 1JQGA 1KDNA 4DQRA 1CQMA 2G1DA 5C5JA 3KK2B 1JLGB 1DTQB 5CHCB 2PT0A 1XEZA 3QPIA 3VGSA 3QRQA 4AE5A 2HHSA 4URSA 3MM6A 3KMSA 4ECXA 4LREA 4J91A 1H3DA 2XG8A 1X4DA 3C14B 3BN4A 2E5IA 4X4QA 2W7PA 5DLGA 1WHYA 2E29A 3DGPB 3CCZA 4U6PA 4BC9A 5CYMA 1R0CB 3TX8A 3CDEA 3LP0B 8ATCB 5KFXA 2CJKA 3BGRA 2BZ2A 2VG6A 1G6BA 2AX0A 3CCES 1HR0F 4GC6A 4DV0J 2LDIA 3CC7S 2AEJA 2G1HA 1IR1A 1C1CB 3G71S 3AA9A 1MROA 3CCTA 3D67A 4H4MB 4WFZA 4ATNA 4LF4F 3R7SB 3EPIA 1OSDA 4OJGA 1S1WA 3KG1A 2Q1LA 3THTA 1WUUA 1CEZA 9ATCB 1GX5A 2OEMA 2G0JA 3ZZTA 3Q24A 5IC6B 3DLEA 3WBZA 1WDTA 1X4FA 4PXBA 3AAWB 3AT1B 1R0AB 4RW6B 3JSYA 1EQMA 1UL3A 2C2KB 3Q89A 3MUMP 2B9EA 4D3HA 2BV3A 3BKFA 4L74A 4DX6A 1BD6A 1VBYA 2F9JA 4OZ1A 2KRRA 1OPZA 2MSTA 2DR6A 1WC1A 3W5ZA 5B0AA 1GAOA 4FF1A 3DOMA 3RBDA 4ANCA 4LRDA 3EPGA 4IQXA 3OTDA 4USTA 2XB2D 2Z58B 1S0MA 3GYGA 2YX1A 3OT9A 4CNZA 3R7BB 1G7CB 4WJBA 2MQQA 1WI6A 1H6KX 3KK3A 1NH7A 3UDVA 3C66A 3M2VB 1RAJA 2VBWA 1HD1A 2EKNA 2V8HA 3HDSA 1H98A 1PC4A 4I7FB 4YDDB 4DR3F 1SC3B 3D6TB 5F8MA 5LM7E 3KKFA 3CCLS 2VU5A 3PIPQ 3MMBA 1SKRA 1QAXA 4TU9A 3H4DA 2CJQA 5U47A 2MHNA 1TKTB 3GIIA 3D6FB 4OHYA 4IH6A 1LFWA 2XBPA 2VC1A 3ILOA 1WC6A 3PM9A 3ISND 4BWJA 4C8YA 1BQNA 1C1BA 2IJRA 3Q8PB 3MMJA 5FIIA 5AT1B 2VJUA 2BUNA 3NGKA 2QA2A 3GILA 2CNOB 1O0PA 4JI6F 3PHEA 4QQBA 3CCMS 4JB8B 1U6ZA 2E7XA 2FHJA 3BGLA 2BMBA 3U1LA 2GHVC 2XYGB 1T95A 3OHBA 2DYAA 4LIRA 4JI5J 2Y0BB 5C24B 4B3RJ 3FJ2A 3TZYA 1T7PA 1RBAA 1U7LA 2LVWA 2N3OA 1FRXA 4RPFA 4RW9A 3JQJA 5EWGA 2EEYA 2VQFJ 4PG4A 4WP3A 3PV8A 1RAEB 1BE4A 3QSYB 2OD4A 3PYFA 3R5CA 3V4IB 3D0IE 1DURA 4WK1A 4A4JA 2HFVA 3SCLE 1HQUA 2HNDB 4FF4A 1C4CA 3FQLA 4ZS6A 4PPDA 3J7YU 4FBUA 2VDHA 4K4YA 1KEKA 1ZM4A 4C8KA 3QIDA 3UE2A 2KJVA 2W4CA 4C8OA 3CEDA 1X60A 1LWFB 5M2RA 1BHNA 2J8SA 4XDDA 1TKXA 1TKDA 1VRUA 2AV5A 1WG4A 2DRAA 4JV5F 2CG8A 3BO3A 2PI5A 2BJ7A 1EP4B 1Q79A 2C3YA 1M5HA 2W9BB 2UUCF 3OTEA 5D3GB 2QTWA 5EWFA 3MDFA 3TARA 3J7Z5 3UCUP 4ECVA 5DRKA 1TR0A 4YQWA 2XI2A 3BSAA 2VV5A 4F4AA 3BS9A 4B3OB 2A2CA 4DR5F 3IGVA 1HHSA 1R31A 4X4RA 2J6SA 3TA2A 2H51B 2HK3A 2B43A 4LF7F 5E2QA 4WYWA 4W92B 4QIVA 2ZE2B 1X5TA 3TAPA 5ETQA 4JV0A 3OPKA 5HJXA 3MOJB 3BGFA 5E3RA 1TFYA 3T9ZA 3M8QB 1VOMA 3W64A 2XNQA 3PYDA 3LP2A 2J0QD 3MURP 4FF3A 1RP5A 5I3QA 2HQIA 4YR2A 2X1GA 3QT6A 5E7OB 4HDGA 3UR0A 4C8LA 1VQ6S 1V3ZA 1RB0A 2BANB 2PMWA 4EFAC 3BQ1A 2HEKA 3J7YI 5KT3A 1PJ7A 1OWXA 1XMQF 3ZTSA 4AUKA 3H90A 5D6GA 4WE1A 2KN4A 2JWNA 4KRWA 4DUZF 2DR5A 1H73A 3D7SB 3V2UC 5H9EJ 4NCGA 1U47A 3NS6A 2DH8A 2X3DA 4KC5A 4MYTA 2IJNA 3ZZZA 5KT5A 2OMLA 2YY3A 2XS7A 2C2ZB 2JLFA 1U1MA 4LF5F 5F8NA 4OJ1A 1NPKA 5B08A 3D4JA 2BE2A 2XZWA 3VAJA 1Y5NB 3IC1A 5HANA 4USWA 1SH3A 4J9MA 1SIZA 1W2IA 4U7CA 4LFAF 4L72B 1Q4RA 1SC1B 1TL1B 2EFOA 3ZZUA 1S6QA 3WZ0A 1RAIB 4JI0F 3QLHB 1HL6A 2BJ1A 4F0HA 4NI2A 2W2QP 3L4BC 2CNLB 1NJZA 3NRBA 1JLQA 1TQLA 2DJWA 3HULA 1JJ2R 4UQGA 3HSGA 1U1LA 4DUTA 2HHWA 2DCLA 3D28A 2KL8A 5J2QB 4EBCA 1U1QA 4IG3A 3M9MB 1FI4A 1Q95G 5CD4H 1P6TA 3BR9A 2PA8D 1WF0A 3HCXA 5ETOA 4C97A 2GVZA 3NBPA 4WFAQ 1IKWB 4DSLA 4UOCA 3RB3A 3PACA 4Q43A 2JC0A 3HVAA 3NMRA 1SC6A 4TN2A 5ETKA 4N41A 4K4SA 4MYUA 1SB6A 1GX6A 4QIGA 4USJC 2XTJP 3QRPA 1N5SA 1V5VA 4KBIA 2QL9B 3DMJB 1S9EB 1F5CA 4ER8A 2GNKA 3K17A 1Q16B 2MZJA 5DQGA 2HNZB 2RVJA 4F4WA 1XNRF 4GKJJ 4KPYA 2QRRA 5F8IA 3ZNJ1 2IYGA 3G82A 3PRDA 2WSCC 1FNOA 2B56A 2CJBA 2VFSA 2VBZA 4DWIA 4NXNJ 4URQU 1L5UA 2I0XA 4NE9C 4ZK7M 3BGUA 4IH5A 2XLJA 1QLNA 2VPYB 1CQNA 1HHTP 1Q8BA 1RUSA 1FO1A 1WF2A 5DM6Q 4KB7A 2RIJA 4G6VB 4A47A 1N33J 5BXIA 5HROA 1RYRA 2CQ0A 5C42A 1AW0A 4C11A 3KHLA 3PCOB 4M5DB 2V68A 5J2PB 3TI0A 5HVFA 2CWXA 4ZP6A 4MFBA 2LDYA 1E6VA 3H5XA 3GV5B 1N88A 4I6YA 2MPUA 3H25A 2KH9A 3KG4A 1H0HB 2B9XA 3SV4A 5K8OA 1Y5LB 4B9NA 2B7CB 1KLMA 2HVDA 2DB1A 4EYIB 1KS2A 2GQ2A 2Y1RI 2IAJB 5KFPA 3T1YF 3M2UA 1RABB 2D3O1 4LF8F 1S9FA 3UI3A 2KT2A 3L3CA 1S7HA 1KD1T 1RDRA 3NGDA 2YPYA 4O4RA 1ZPWX 1X5OA 1VK8A 3WDOA 3MF5A 4ETXA 2M8HA 4OYBA 2XM3A 3K59A 2HRYA 1SQFA 3Q8QB 3ENQA 4FYVB 1N34F 5H9FK 5L39A 3CJQA 2OPRB 5DGBA 1QSYA 1TAQA 3MEEB 3VR1A 3M7VA 6AT1B 1P1TA 4MMOA 4IG0A 3NWRA 4ZHRA 4DSKA 2OLWA 4J9QA 3CJKA 1NKCA 1WG1A 3BO4A 2MKIA 2YNGB 5G0RA 1XR5A 3F56A 3DXSX 2XULA 3AA8A 3WX8A 2BQRA 3Q0AA 1ZPVA 2W4DA 3O44A 5HVGA 3M32B 2CPFA 2WOMB 4O44A 3D9BA 4J9KA 1NJYA 4E2FB 4DLGA 4LF9F 3P8BB 1F2HA 3DRXA 4NXMJ 1RHMB 1WNEA 3TYTA 4PXEA 3AHPA 2VIHA 2YX4A 3W7BA 3W62A 2K7KA 2CPDA 2OIHA 3HO1A 5KG3A 3IRXA 4UW2A 5KFIA 3T3FA 2MQMA 3HD1A 2WZ1A 1H2UX 1OS5A 4JOUA 2R7TA 1RT5B 3LTOA 4OJ3A 2XHCA 4X65F 4GO7X 2RAQA 3DRSB 1N36J 1NK7A 3LQVA 4A8OA 5FLXU 3E2EA 3NS7B 1N5TA 3VVUA 3LGHA 2NXEA 2PFFB 2FLNA 2VODA 4AL7A 2I1RA 2LQ8A 5BR8F 4NA1A 2MEWA 4TU8A 2AJ2A 2VKZG 1WC0A 5CZVA 2ZVSA 5DG7A 1MNEA 2OMOA 3DOLA 2W24A 4JUZA 2W2NP 2NCKL 2D3OR 2F63A 2YKNA 3BBFA 2GGPB 4KTQA 2DHHA 5CYQB 4CO1A 1N32J 2DNLA 3MPWA 3VV2B 2D3ZA 4I0WA 4X4TA 2YBVA 1Y00A 5AJ3F 2VBYA 1S1VA 4NOHA 1UWBA 4KO0B 4F04B 5T41A 5DLFA 1UW9A 2LCWA 3VZHA 4ENOA 4LR8A 3NS5A 4IH7A 1N6QA 2BXJA 1HWJA 1NKEA 3DOKB 2CNKB 1JLBB 3SCKE 1KOHA 4ANEA 4OX8A 4FYDA 1YRTA 2N82B 1X8DA 2MTLA 1M90T 4G1PA 1Q8LA 2GAGC 1R0BG 1AROP 4WCEQ 1CJTB 3EDRB 2QLFB 5D4PA 1LW2B 2LYVA 3H2LA 1VHFA 1N5YB 1RTJB 1NDKA 1QDUB 4RBUA 4ZPCA 3P3DA 4C8ZA 2OPQA 1SKWA 3MR3A 4LSNA 4CYUB 1VK3A 5ETTA 1F3VA 2XSJA 3P4UB 1Q8KA 4PYAA 2MKCA 3HHNB 4RU9A 1EHWA 1RAFB 4NA2A 3IS9B 2QZ8A 2HRUA 2UVUA 1GXLA 1X4EA 3FSIA 2DR8A 1BXNA 3AD8C 1IBMF 2LMIA 2JX2A 1SBRA 4OQJA 2YKQA 1VRQC 1X4HA 4NL5A 5KFQA 4DL7A 2UXBF 4WPAA 5LMNF 2CJ9A 4WBFA 2VG7B 2UP1A 3LGNA 2QT7A 3DM2B 4CM2A 5AXLA 2RMLA 1NO8A 4LQ9A 3QO9B 4QWDA 4NXMF 1BC6A 3CTRA 3D5MA 3D0GE 1UVMA 2LXFA 1IKVB 2RD5C 3DYAA 1U6BA 1DY3A 4DQSA 3CUNA 4A8KA 4WP8A 3PR5B 3A8JA 1Y11A 4YOEA 4IFYA 1FJGJ 4ZN3A 2VFTA 4B3TF 2IDLA 5IC4B 3CCVS 1S49A 2HHTA 1J5OA 1QSLA 2HQGA 1N36F 5I42B 2DR7A 5HL7Q 4MKVA 3JTPA 4CO3A 1LV5A 5HI7A 4IQMA 2IFXA 4IO9Q 2D74B 2RSQA 1CJUB 3MR2A 1VQKS 1URRA 2CZVC 3CMQA 1RCOB 4CO4A 5KFYA 1WOSA 3QGIA 4OZ0A 3FMBA 1QE1A 1RI7A 5ETMA 4M95A 4PWUA 1RT2A 4KR0B 3EWGA 2YPZA 3DRRB 2UUAJ 1ZZFA 4OI0A 4UZCA 4HL9A 4DLEA 1NBEB 2GMHA 2MLZA 1F2GA 1RTDB 1S4EA 2MKSA 3MM5B 2ZH6A 3HVTA 1A9NB 1UJ5A 4HEA9 7AT1B 2RRAA 3PKMA 4F3MA 3NAHA 3CCUS 1AB8A 4H4OA 1S12A 3N6NA 5A0YB 2DH7A 1BQXA 4DXLA 4TXSA 4DQPA 3JSRA 2LP4A 1REVB 3D1OA 4Y2IA 2EFVA 1T3NA 2XWXA 4JI1J 5DS7A 2Y1IA 2R7VA 1H38A 1YQHA 4P52A 3VF0B 3W2VB 3OL6A 5LXYA 1C2PA 1APSA 5GMEA 5E3PA 3CJRA 2OH2A 3OR1A 5F8JA 3PZPA 3VQTA 5JJBA 3PW5A 3QIPB 1UMJA 1VC0A 1OJ4A 4TQRA 3KDNA 4M5MA 3NNCA 4DV7J 4OYZA 4DI6A 3TZWA 3QT8A 3VVTA 4PWWA 3V6JA 2W1BA 3MM6B 1ELOA 5HQMA 4DV4F 4IRDA 1KKHA 3C15A 1JB0C 4M5KA 3HM9A 4FNHA 4LFCF 3I9ZA 5C2GA 2CQ4A 3T6JA 3CE8A 2G2YA 4LJMA 5CD4A 2VG6B 3Q86A 2DO0A 5AE3A 2DKOB 1U26A 2CZ4A 5KFKA 3BYRA 3IR5B 3MM9A 1LWEA 2MMYA 1PC5A 3D1QA 1H74A 3LALA 2X51A 3HZGA 1MROB 5KG4A 4DX5A 4DCOB 3VALA 4NLUA 1DQAA 4BS2A 1S1WB 2HIYA 4E0DA 4OZ5A 4EI2A 2ZJPQ 1R6YA 2G0CA 5KFGA 3F41A 2ZHOA 3AFGA 1I3OB 4WWSA 3DLEB 1YJUA 2DGWA 3MD1A 3MM7A 2ATCB 3SV3A 3DGPA 4B3SJ 2QL7B 4F3OA 1FTCA 4KIAA 2QYGA 3CB4A 4DSEA 2LXUA 5G4DA 4XAKA 1FRIA 2HGLA 1IKYA 3DOMB 3EGVA 2LQ5A 3OSNA 1YBTA 2LU1A 3UD4P 4B17A 1OSCA 3MPDA 1VJQA 1C1CA 3T5KA 3KK3B 1PBUA 2NXUA 2EWHA 1KVKA 3UVJA 2BKNA 4F4YA 1FE0A 1N8RT 3PNIA 2ALYB 2UUAF 4C9DA 2CPXA 2WTFA 3NP5A 3FBBA 2C2OB 2DNZA 3MMBB 1VQ5S 1VQ9S 3SDEA 2YWEA 4HR2A 3UPFA 4J9RA 4OI1A 4RNOA 1MN9A 1C1BB 3R97A 2OEJA 2MGZA 2F9DA 2MQNA 2ERRA 1OYEA 1RZMA 2CJYB 3CC2S 3V6HA 2Y1LB 9RUBA 2V0NA 4GRSA 1TKZA 3Q8YA 1F9HA 4M1KA 1RSCA 3H42A 2FHJD 1HQEA 3W1YC 4C7QA 4ZP9A 2QA4S 4ILLA 3ZO7A 1H72C 2VL1A 1R43A 2VASA 4AXJA 3M2VA 1QD1A 5HJYA 5HLFA 2HWHA 4X4SA 1VBKA 1F6TA 3J81j 4RW9B 2BM1A 4ECUA 2P5VA 2Q6BA 3A8KA 1H7WA 3PO4A 2DGOA 1HBNA 1N5QA 3TEHB 1KNZA 3QAUA 3N28A 3FBCA 4DUYJ 1RK8A 3DDKA 4PWDA 4P10A 4ZOSA 1HQUB 3Q2SC 2LEBA 1HBOB 3HXMA 1S0NA 3C2PA 3T1HJ 2HMIA 1R7IA 2VB6A 2V4JB 2QGFB 2G0IA 3ZZOA 4ZVHA 1FKPA 4DS5A 2C2EA 1WJ9A 3MTJA 1EAYC 5HSPA 1OO0B 3OVSA 1XNQJ 2A0FB 1ITPA 1S72S 1TKXB 1VJWA 4ZN1A 1VRUB 3M8WA 3S6EA 3GMGA 2LXIA 2B5JA 4UTGA 5EX0A 1JLCA 2AMCB 2V2ZA 3FC9A 1HHQA 3E51A 3D2WA 1Q78A 1FNMA 2YTCA 2ZITA 4OX9J 2XWYA 1EARA 1JNRB 3LAMA 2R2UA 2JL9A 1RTHA 2JH3A 5D4NA 5KFVA 4ZVGA 4LUBA 2IA0A 4O3OA 4DSJA 1U25A 3UCZP 1UPPA 3HP6A 2HLTA 3THVA 4CH0S 4YHHF 1UFWA 4YEAA 1KSPA 5IV3A 3V81A 4DL4A 2IBKA 3H2UB 3FEYB 5KFBA 3B82A 3N6MA 5BYSA 2GAHC 2M7SA 1CC7A 3MCNA 3CDAA 1PCAA 2AZ1A 3TR5A 5F41A 5IFMA 4F4KA 4FP9A 3DI6A 2OKQA 1L3UA 3MAHA 3LP2B 4ZVTB 3O1LA 5IWAJ 1N4LA 3GV8B 2JDJA 1WG5A 4KGZB 3HSJA 5KFTA 1NPPA 2GA7A 4FPIA 5J2MA 1FDDA 2DEIA 4NLDA 2DK2A 3LA0A 4ED7A 4K4TA 3CJSA 5LMUJ 2MLYA 4FZVA 3M1VB 2EXUA 4U95A 2FDNA 4M63A 4OFZA 5KFHA 1ROFA 4RW7A 1WHXA 2RH3A 2MJNA 5EUHA 3K2YA 2FHMA 1KQFB 1YSJA 2ADBA 3MR5A 4WE1B 3H40A 3FSXA 4MTPA 4IO1A 3PJ9A 3BSNA 1OYDA 1HMVB 1X7VA 3O2IA 3FNNA 4NCGB 2FJWA 3TP2A 1IR0A 4A8WA 3KOAA 3UD5A 1X0FA 4I69A 3NNHA 2BE2B 2UXCF 2AEFA 3H4BA 2GO8A 2F40A 2PMZD 4ZPBA 4YMEA 2ZNZA 1N54B 3NOGA 2OJ3A 2GJ2A 5LT5A 3NMAA 2RF2A 1SL2A 3L7PA 3KLHA 3GYNA 4LF1A 5F9LA 3HMJG 1ULRA 4NLPA 4UOGA 2YQ0A 2N3LA 3PW2A 2FJAB 4ZMMA 4K8RA 4NI2B 4OYAA 1HW9A 4K0KJ 4DUYF 3IN5A 1JLQB 3X1LB 2NSBA 3CJ0A 4OI3A 2GIQA 1PYTA 1T9TA 3RW7A 1HWLA 2IY5B 2F3JA 2HZAA 2FGCA 1RAOA 2DIVA 2CRLA 3OJUA 1FRMA 4HT5A 4IG3B 3SCJE 4EBDA 4HHUA 3LAKA 3J7A1 1B70B 3MCMA 2IVYA 3MGJA 4QIWD 2R8HA 5K8PA 1X9SA 2W7OA 1VGYA 5KFDA 1B0VA 2GVZB 3NBPB 5KFFA 3CPWR 1TL3A 2YVSA 4WXOA 3TO8A 1Q81T 3A3PB 4RNNA 1FKAF 1NM2A 2CQBA 2ZNYA 3JAMY 5DG9A 2X1BA 2VF3A 2QLWA 5EDWA 2DISA 5J2NA 4ZPVR 4PG7A 3AD9C 4NLGA 3VHQA 2WONA 3DRYA 4ZJOA 4O3RA 2MYFA 3EE3A 1EQ0A 1NK5A 1HI1A 3GPAA 2ZM6F 5KFLA 3E8OA 2ZC4A 4A8SA 1X4BA 1FX2A 3R2DJ 3KWMA 1L3TA 1KHWA 3G82B 3AJ1A 4ECQA 2B3TB 1QTMA 4DR1J 1U0HA 2FLOA 1LK7A 1KQKA 3V4MA 1RU2A 4DX8H 3PX6A 4O3QA 1V3RA 1PKUA 3MR6A 4FYWB 1X9WA 4R0JA 4IOAQ 5HROB 1HARA 4C11B 2JNJA 2R8KA 1YLXA 2KVIA 2J9EA 4ED1A 8AT1B 4MFBB 3TOQA 3PX0A 3AH6A 4ZITA 3J7ZT 2AJFE 2CKWA 2O01C 3WC0A 3EXCX 5LMUF 3CJ2A 3D3CJ 3EVMA 1SQEA 1QTNB 2FYXA 1KLMB 4ZVUB 2AGPA 2VONA 2YWHA 2FVCA 1T9UA 1S1XA 2AJ4A 3HPOA 4NZ0A 2EBGA 5KT7A 3M2UB 1LXNA 4IUFA 2VPXB 4WTYA 5K8MA 3K58A 7FDRA 3GR0A 4Y0FA 4CLLA 4Z37A 1RT4A 1T9VA 4JI2J 2PN6A 1RJJA 3FZBA 5K20B 1EX8A 4M5IA 1J2VA 1IUJA 2YNHA 1R8HA 2V2QA 4ZDNA 1XQIA 2R9LA 2H4YB 1RHUB 1JMTA 2RHSB 2VJVA 2CPYA 3EDQB 4KGXB 1FEHA 3GSDA 3FSYA 2LQ9A 2CG4A 4JI7J 2K1RA 5GADI 2RB7A 4IG0B 4ZHRB 3CD7A 3KJNB 3CJKB 2NYHA 1UVNA 4DR2F 5HBMA 1Y0HA 1K0TA 4O3NA 1G2EA 4HI1A 3SSRA 3T41A 4CLUA 2E5JA 4C8NA 5F8GA 4NLOA 3QMQA 2ZBIA 1IBLJ 3HHKA 3PFEA 4J9UE 4ZJQA 3MHYA 2XO7A 4O44B 3NGUA 1VQOS 1SIWB 1ICEB 2MKKA 4X4PA 2LFVA 4NYPA 4FS1A 5DQHA 1GXTA 5L1IA 2ADCA 4DV2J 1U45A 1HWIA 2ZD1A 4D3GA 4LQ3A 1GXUA 2Z2LA 1TMMA 4OZ2A 2FD2A 1SI9A 1WWHA 3OSPA 2PDAA 3TA1A 2CQCA 3HZEA 4GKKF 2M70A 1GFWB 5ETNA 1ZH5A 1UFKA 2HHXA 3S1TA 4WZMA 2VPZB 4Q44A 2PFDA 1TFWA 4ELTA 3CJ5A 3EXYA 2YWGA 2ZDOA 2DR9A 3KHRA 1EKRA 3W9HA 3CJ8A 5H9FJ 3GTYX 3THPA 4O3PA 3V5RA 2VQEF 5DJBA 1KOOA 3KXDA 4P2XA 3DOLB 2AIRB 1U1NA 3RAMA 3VGUA 1X4GA 4CIOA 2CJAA 1DJ0A 5C25A 3J7AN 3IBWA 5CCLA 1NK4A 1WEXA 4ZVEA 2YWKA 2LQJA 2GO9A 2HK2A 4OIXA 1T8EA 1NB7A 3EZOA 2F65A 2H5JB 1YBUA 3MXHP 1S1VB 4ECZA 4PRFA 1UWBB 4L75A 2VOOA 3T9NA 5GAHU 5LXRA 1HQ2A 5GVQA 2M4MA 2LA4A 3BBBA 2BJ3A 4DBQA 3IFEA 2ZZNA 5MAOA 1N6QB 2OGUA 1YZ6A 3GCWP 1OIAA 4DPTA 2Q79A 1W26A 2HIQA 4LBHA 5IOLA 4J90A 2PI4A 4P6QA 3AODA 3D3BJ 3U7JA 3DLJA 3GE9A 4J9SA 3Q8RB 2JEFA 5F3TA 4DX7A 1FA0A 1SJRA 3RAXA 1HKAA 1SKSA 2WCXA 1DZ5A 1KWMA 3T5JA 1FXRA 3VAIA 2HFNA 5E5NA 2X7IA 3CW2C 1R8PA 3W8PA 1B0TA 3G6VA 2BQ3A 5CCMA 3MMCA 4Q7AA 2Y8YA 2PO4A 1XR7A 4DMZA 3ETOA 2K3IA 2OPQB 3B6BA 3G96A 2Q43A 4LSNB 2XSJB 2Z30B 3ADAC 4DSIA 1UP1A 1S6PA 4TYAA 2JFKA 1MLAA 5FJ4A 1JJCB 3ZXWA 2BKPA 1SKUB 2DNOA 5AXMA 1FFWB 4KQZA 2FIUA 4L3KA 1SC4B 4OZ3A 3ITHA 1NAQA 4PCQA 4NASA 3ILLA 4HACA 1XC9A 3BPSP 2Q66A 2V63A 2BBEA 2ZFHA 2JLGA 1ZTTA 3KUHA 1LW2A 3M8PA 2NPIA 5J1PA 4X64F 2APOA 2VPWB 3R27A 3VAKA 2ASJA 3LH2S 4BDPA 4DV1F 4HDHA 5L1LA 3DYAB 2LQBA 2M2BA 5GAHI 2ZZTA 4LR7A 5BJRA 2EFQA 3UDEA 4IFYB 4DFKA 2EBEA 4CLSA 3UNGC 2C42A 1ZOTA 4IDKA 7FD1A 4DZ6A 3KNGA 2RUGA 1J5OB 3PX4A 5ETVA 3UNYA 2O5DA 2AP6A 2NXNA 2CADA 2UV8G 5F3ZA 5F8LA 3HVRA 2GMJA 2ZDPA 1DRZA 1DBDA 1OPIA 1VHIA 3GSIA 1CC8A 2YQ1A 2KM8B 2GFFA 1JXLA 4P7VA 1YJTA 2B4VA 3ET6A 1HR0J 4ZPAA 1C0UA 4KT0C 4DL0C 4P7TA 1HI0P 3LWLA 4QYZJ 4J5OA 1CBKA 3PEJA 2AYGA 3AJDA 5LJ5Y 1FD2A 2IDEA 2DNQA 1RT2B 4LF4J 4NMLA 2R7RA 2RT3A 3IA0A 2DPIA 2BACA 1XTZA 5DO2A 5KOXA 3PEHA 1HNZF 1S48A 4ED8A 4RW8A 2QFJA 1GMVA 1RHQB 3CCQS 1GQEA 2RRBA 3SQGA 1RWOB 1WEYA 3HVTB 1F5AA 1IVZA 4ED6A 2F4FA 1M5OC 4G65A 2D7SA 5JMNA 4PQUA 2UVRA 4B9LA 4H4OB 1MU2A 1WD6A 3PTWA 3R5AA 1T05A 2VG5A 4YB1P 4JI3J 5F0WA 2W9AA 3MPUB 5A8WB 2ZUAA 4R8UA 4B02A 1VLOA 1WOPA 1TL4A 3R1LA 3JS9A 1B7YB 2FVPA 4KFBA 4DZDA 4LT6A 4DU7A 5D0HA 1B99A 3OJSA 4F4XA 3F44A 3CCWA 5IT9U 2ACMA 3RUBL 3OR1B 4DOZA 2B8QA 3RGIA 4LRFA 1OMSA 3EX7B 1XBWA 4DR3J 3I4HX 1JLAA 2QFIA 1FERA 4F8RA 2MKYA 3OUYA 4EO8A 3T6BA 2KHCA 3C15B 4F2SA 4H4KA 4C48A 4HH0A 4GVBB 2UXDF 1TU0B 1FWLA 4ETZA 2PMHA 4JI6J 2QYCA 3RB6A 5JVGQ 1TK8A 4DV5F 2PEHA 4FYXB 3KJFB 2N7YA 1M5KC 3MM9B 1J27A 1JJHA 4B3MF 1R8CA 1X31C 2EFNA 1RHJB 5L38A 1LWEB 3H2VE 3ZZRA 4EGLA 3CMES 2DITA 1S0VA 3HJFA 1NSKL 3FCHA 4QWAA 2W9CA 3OTOF 5IM0A 2ASDA 4W98A 3QWUA 2VH7A 3QYYA 1LQ9A 1ZBTA 3UQSA 4JBCA 5GMDA 1WACA 4WFBQ 1T0TV 2BEFA 5DDPC 2MXYA 5KTQA 3MM7B 4QOTA 2QSWA 3QT7A 1AUSL 3FEZA 2CVEA 3I6PA 2H5IB 2DIUA 2KTQA 3I4PA 2HPUA 1SUQA 1WSRA 3HSDA 3DRPA 5HK4A 2FJVA 2NSCA 1IKYB 3W5XA 1D8YA 2L9DA 4ZCIA 3NGRA 2KU7A 2VFRA 3C6TA 3NEKA 4C98A 1N0VC 1ZAVA 4NCAA 2E1PA 2AJ1A 4PR6A 4JV5J 1BGXT 1WSVA 1GK8A 4RZRA 3FBEA 2D9PA 1CJKA 2CNNB 1V5IB 5KFNA 1XMBA 1TP7A 3W9JA 3IM8A 4N76A 2J5AA 2HWTA 2UUCJ 3QRRA 2E1CA 1WKLA 2OPPA 3TAMA 3BN7A 4F25A 5IXUA 2DNRA 3E01A 3UVJB 2HVEA 1J5EF 1VIOA 3W8GA 4EBEA 1RBLA 5LSOA 2H3EB 4CCHA 4HHJA 3ZZYA 2CQDA 2ZOMA 3MPYA 3SDEB 1FXLA 2DNKA 5KFOA 3OFGA 4DR5J 2YKPA 1PAEX 3PRVA 2HWIA 4JI3F 2MGZB 1FK9A 3VAMA 3N5FA 4CRJA 4M5NA 4LF7J 3W66A 3TRGA 2UUBJ 4DJBA 1HBMB 2L48A 1HNIA 1TKZB 4I68A 2HVIA 2QLXA 2V8GA 1HQEB 4CH1A 4U8YA 3IWXA 1E6YA 1U49A 2EKYA 3CDBA 1BY9A 3JB9k 3H59A 5HLFB 1SH0A 4TQSA 4Q2LA 3BKUA 2HKEA 3A3OB 1HBNB 4ZVOB 3LUYA 2DD8S 3S8SA 2BR0A 2KVQE 1XMQJ 4TNOA 2HAFA 1HD0A 4PWDB 1K47A 5SZTA 2UUWA 2YWFA 2MHEA 2XSFA 4Y2MA 3OXFA 4ZIWA 2ZH5A 4I56A 2FC8A 4C3KA 1F60B 1Q1KA 2HMIB 3GCXP 4DUZJ 1I6JA 1VBXA 1FKPB 2L08A 1DAXA 4LVOP 4LF5J 4XDCA 1T11A 1FNXH 4WF9Q 3KDOA 4UUWA 3GIRA 2VDIA 2V69A 3UW1A 4CLFA 3OXGA 2E5LF 1HNVB 3QFWA 2AJ0A 2BABA 2B5JB 4O23A 4LFAJ 4M5HA 3SFUA 3AOBA 1JLCB 3C8YA 1FF2A 5KG7A 3BH7B 2K7JA 3ZZ0A 3GJSB 4ES3A 3HFZB 4JI0J 3OTCA 2CPJA 3EGWB 3ENVA 1NK0A 1LXJA 3MEDA 4I6WA 3OXLA 2XHWA 4UZBA 1RTHB 4JP8A 1K9MT 1JJ4A 1S77D 1HBOA 3PDNA 2ZBPA 2KG1A 1MMLA 2LU2A 1FJ7A 4ECWA 3OHAA 4PKDB 2V4JA 2JFDA 1L3VA 3V81B 1KFDA 1JNZB 1WI8A 2BJ9A 5CAAA 2DXEA 2YXLA 4K2JA 3MCOA 3NG8A 2IJFA 4ELVA 1FESA 1S1TA 4EUVA 4ZLLA 5B09A 4ZVFA 5EWEA 3TVKA 5IQQA 3DI6B 4TYBA 1SV5A 3C6UB 1CG2A 4J37A 3IAS9 1SQGA 4RW4A 5I3PA 2A18A 2CQ1A 1PBAA 1SL0A 3QGHA 1C0TA 2GC8A 4URGA 1Y5IB 1YJNS 4TKTA 2QJ3A 4KGMA 5J2MB 4NLXA 4ECTA 2C2NA 2KZZA 3CCSS 1KBRA 2MJUA 1ZAWA 2XMVA 4J7CA 2UZAA 1TUGB 5B0BA 4X4NA 4RW7B 1XNRJ 3RB4A 3MAAB 1REGX 5DDOC 3G8TA 2FPHX 2AEMA 4RUCA 2DTJA 1MW7A 1GEHA 1Q53A 2ASLA 1JLFA 5AXKA 3NCQA 4R25A 4CI0B 5HAOA 3W63A 4DHVA 2Q3PA 4ECSA 2UUBF 5D4OA 5A76A 2R7OA 3LP1A 5A6PA 5T7LA 3LPEA 4KGVB 3NNAA 2E5HA 1NU4A 2MLXA 4FXVA 2EPIA 4YN3B 1IR2A 3EUNA 1QAYA 1K8AT 5LSLA 2EFGA 3IG1A 2U2FA 2HAIA 1N0UA 2RF2B 5E3AA 3P49B 2HZVA 3KLHB 3O5TB 3W2WB 2IMOA 4WXWA 5DDQC 3N01A 2FC9A 4UOFA 4I2PA 5MLCV 2H65B 4OZJA 2HFUA 4DV6F 3EZ5A 3M1VA 3BF4A 2I38A 3RAQA 2C1EB 2BJDA 2OI2A 3VAFA 3Q83A 3T1YJ 2EK6A 2ATLA 4B9UA 4LF8J 2A10A 2P6TA 3JQKA 3IMQJ 1UEVA 2RILA 2B6AA 4K7QA 1HMVA 2UUTA 2NLWA 4WYLA 4NX9A 2KJWA 3RR7A 3FQKA 2MDAA 3U1MA 1QSSA 1TV6B 4ZVPB 3VTIA 4UF4A 3ICLA 3MM8A 4K2XA 1N34J 1TL3B 4MIAA 1WTBA 2BW2A 4ELUA 1HFEL 2XGPA 4F7VA 5A8KA 1RWKB 1V6HA 4TVAB 2GJFA 3ZNUA 2ZKUA 2MZ1A 2J7KA 2V6AA 4Y2KA 4QPXA 4ILMA 1U6FA 2FJEB 5J2NB 2ZH1A 5D78A 2XMWA 4YB7A 1Q5YA 1VC5A 3D54A 4QWEA 3HHLC 2GW8A 5B7WA 3L7OA 1H2VZ 3H5SA 2WONB 2PEBA 3MWBA 5KG1A 3DXBA 1Q5VA 2CYYA 5L8RC 2AZ3A 1U24A 1UFLA 4LF9J 1U0HB 1HNXF 4QZVB 5KFAA 4OJHA 1H7XA 3NAIA 2HRTA 2HW3A 2F8MA 4FYYB 1FDBA 4OI4A 4MAKA 1ZM3A 4DPXA 4WU3A 1SPBP 2B4UA 2YWWA 2XGQA 1UA0A 1WKKA 4WIIA 3G4SS 3H8YA 1IQTA 4C0OC 4RKUC 2JZ5A 4X65J 3KHGA 2JHEA 3K5NA 2HS0A 2FVQA 4V1Ak 1HNWJ 1JX4A 1KRPA 3FCWA 1BWEA 3I0RA 2NUHA 1GMWA 4DV3F 2QV6A 1RADB 1WTFA 2ZH2A 4X4UA 1D9FA 5BR8J 1S1XB 4P74A 4EYHB 3I87A 2KG0A 2RQCA 2Z56B 4AL6A 1RAAB 1W25A 2DPJA 2M3DA 3P5BP 1VLYA 3OR2A 2R8JA 3CWJA 2V34A 1KQSR 1P8GA 1W7WA 3ONQA 4I2QA 1RT4B 3HLUA 2QN6B 1QAIA 4X66J 1KQGB 5D0EA 1CULA 4ILRA 2YNHB 5FD1A 2DHAA 4J9OA 3PVXA 1VQPS 4QWBA 2GQQA 2KI2A 5AJ3J 2J0XA 3I31A 5ETPA 4FVMA 4HTJA 2HZCA 2DNNA 3DHXA 4FPRA 3I0SA 1YX2A 4YS2A 2K1RB 1ZS6A 3K7RA 3QGPA 1P27B 1T02A 3KK1A 3SI8A 3H5YA 4I6AA 5EN1A 5KFZA 5HBMB 4OHZA 2VFVA 2W2OP 5A8RA 2AW0A 2N7CA 1NSPA 4ID8A 3Q23A 4KHPF 4R5PA 2NZCA 2CQPA 2M52A 4L76A 1RWWB 4JI8F 4OX7A 4ZIVA 3EZUA 2DGQA 1HLWA 4ANDA 4Y6IA 2NQPA 4K4XA 4JI4F 3BJYA 3L9ZA 1LWCA 1K1SA 1TUVA 1HBUA 3DU6A 2FY1A 1JK9B 3VQSA 1NK9A 2ZD1B 5HQLA 3KFWX 4MT1A 2AJQA 3GFZA 3JQMA 1RKIA 2XMUA 5D15A 2MQPA 2A6OA 1YBAA 3GJQB 2I9SA 4JV2A 5KOWA 3JYTA 4U7UK 2C2RA 4ZLNA 2XQCA 4HH1A 1XMOF 4I64A 1EKSA 2P9CA 2EFPA 1NDLA 4WU2A 2QEXS 1HIYA 1IBMJ 3SSQA 5GAEI 3P5TL 5BYRA 3BSOA 4N8OA 4P2MA 2UXBJ 2M5YA 5ADZA 2HS3A 1N48A 1NHKL 5LMNJ 2ZHAA 3R3TA 4KV8B 3ZTOA 3MMAA 1F3FA 1T9XA 2GQCA 4K4UA 2WVDA 2HBYB 2OP5A 3I5BA 1OY6A 1CLFA 5C25B 4EMDA 3EM1A 3FZ2A 4BWMA 3IP0A 5I3UA 3P6YC 2HNYA 4ZCKA 1GNKA 4IFVA 1VC6A 3EMTA 2J76E 2DH9A 1Q82T 3M30A 1R3NA 1S1UA 3ILIA 3WC2A 3DFEA 1L3SA 4B3TJ 3UFCX 5F8HA 1PYOB 1WELA 3GLJA 4KSEB 1UKUA 1N5VA 4AD6A 4PZVA 3EGNA 2BW7A 2V9WA 1HNWF 3OVBA 2Z2ZA 1MWQA 3LW5C 1TK0A 1KP6A 3HHEA 4RJVA 2DXDA 5HQ8A 2DY1A 5FLXY 3N6LA 3CDWA 3OL9A 1XWLA 2BJ8A 4PXDA 1JLEA 2JC1A 2H4WB 2QLBB 3M05A 3RR8A 3AOCA 3MI7X 1FRJA 2DGUA 5L1JA 2JEJA 4Z7CA 3PY8A 4X66F 4F2RA 4CO0A 1RTZA 3MMCB 4DF8A 5THWA 2BVZA 3R7NB 1WHWA 1PSDA 1UZDA 4WZQA 2RS8A 1ACMB 1RWNB 3F73A 4O0IA 2OD6A 1VQ7S 3HF5A 3OV7A 3WQPA 5DETA 2AYBA 1FDAA 1S6PB 2RU9A 3HHLA 2D3UA 3FMWA 2F4VF 5DG8A 2I8EA 2U1AA 3KMQA 3CSKA 4UT4A 1R27B 1LNQA 2I6WA 3BDPA 1S9GA 3I5CA 5F9NA 2GX8A 4OHWA 3ITHB 3TQ1A 1KTQA 3G8QA 5LJ3Y 5EX3A 4HACB 4PG5A 4OYXA 4AL5A 4KKOA 4FBTA 4Q0BA 1IN0A 1CPZA 5JVHQ 4AQYF 3H5UA 3M8PB 3EYZA 4Y2AA 5T14A 2RU3A 1UEKA 3GFYA 1NEEA 1SJ3P 5B0FA 4J9LA 4B9SA 1UVIA 1NCLA 3GR1A 5E3QA 3WIVA 3CD6S 5CXTA 2OELA 2Z57B 3ELHA 1Z2LA 2XC9A 4DV4J 4IDKB 5KG6A 3M8ZA 1GMUA 3NY0A 1O8BA 4LFCJ 1Q8IA 2GV1A 1PILA 3OVAA 2OHDA 2C2MB 3KLIA 2FHOB 3H98A 3RJMB 3K8WA 3OFFA 1IM6A 3TJAA 1KN6A 3MFHA 3UDCA 4Q8EA 3ET6B 4RUBA 1RLDA 1C0UB 2BOPA 4DU8A 4OHXA 3SYZA 2QE5A 4USVA 3DLKA 2CVIA 1QAJA 4CLTA 3M9OB 3A12A 2ZH8A 1B4SA 1KONA 4Y34A 1YJ7A 4NMXA 1U1RA 1NPRA 4USMA 1NNDA 2BDPA 1RT3A 3FKBA 2CPZA 4ERDA 4RW8B 3B78A 1SJ4P 3IGNA 3SQGB 3KHHA 3DDNA 2ZWOA 5KFEA 3FFIA 1F9EB 4PQUB 2CJXB 1MU2B 2YNFA 3MTKA 2YKMA 4ZVQB 1KVIA 2DEJA 1T05B 2VG5B 2G2ZA 4NPOA 3BM7A 4R8UB 3QJPA 2W25A 2NYIA 3HX9A 4V19J 4JYAJ 5HP1B 1TELA 4G1QA 1GH8A 2YKOA 1FT8A 3W60A 4KFBB 2W01A 1RT6B 2C28A 2XZDB 3I32A 4LF6F 3CCRS 2RDDA 4ED4A 5K14A 5C2CA 5HMYA 5GAGU 3L95X 3M6WA 3VGVA 4DCPB 2BX6A 2E1MC 5DZ7A 4HTIA 4K59A 1TVRA 1JLAB 4DFMA 1S6OA 3QJLA 1RACB 2KB2A 3OFHA 4YY3F 3OUYB 3ETMA 2OAUA 2MZQA 2HFZA 1U8SA 3LANA 2J7WA 2IVMA 3DLBA 1NZAA 3CJ3A 2HGNA 3TANA 5A8WA 2C3OA 1X5PA 4KAIA 4RBVA 3CNQP 3UR3C 4C6AA 5L46A 2R4FA 3OLBA 1FHTA 2HHHF 1VYAA 4KH0B 1CS4B 4GMKA 4QPTA 2J9CA 1C4AA 3TA0A 3KUEA 3MECA 1P9YA 1S10A 2CQGA 3DNCA 4TY8A 4Z2XA 2W9CB 3E3XA 3JTNA 1YJVA 1RHKB 1IBKF 2CPIA 5IM0B 3RBEA 3PRBA 3ZTPA 1I94J 3RG6A 3JXOA 4RNFA 3K5PA 3PXGa 2VA2A 3RBZA 2XNRA 1YJWS 2OSQA 5KFUA 5DDRC 2XEXA 4A8YA 1NK8A 3R1HA 1X5SA 3MPVA 1YKWA 4GVBA 5IT0A 1U8WA 1SUQB 4UUXA 2FLPA 1VRTA 1NK6A 3DRPB 1TZ0A 2L9NA 2KYXA 4M5LA 4MIBA 2HHVA 3C6TB 4ZPDA 4A8XA 1VQ8S 1RT7A 1RXOB 4RX6A 2HG4A 4X62J 5GAGI 3W3SA 5JXSA 4XPEA 2IA6A 1CJKB 4RNHA 1S0OA 2E5GA 4DQIA 2DGXA 2O67A 2OPPB 3TAMB 4CO2A 4LMZA 3E01B 2HQFA 3GIJA 5M2UA 1YRUA 3VWSA 3J81Y 4DV0F 2DNYA 5KAKA 4EZ9A 4DFJA 1LEOA 2FZCB 2AQ4A 2W2PP 2B4PA 3WIUA 3K5MA 4GO5X 4U67Q 5M2PA 3K8VA 3K0JA 3HFVA 4ES1A 2WB4A 4ICLA 1TMJA 2ZH4A 3POTA 1ZM2A 1T9YA 3RZAA 4E98A 4YHHJ 3LO3A 1EETA 2K3KA 4IRCA 2VFUA 1FK9B 1IJFB 1NDCA 2WW8A 2ZZMA 2R7UA 2XO6A 1PIEA 4JYAF 3NGSA 2CQHA 3N79A 1HNIB 1NDPA 3LF0A 1DFDA 2XMAA 1URNA 1FRLA 4WFNQ 1N52B 1X0PA 4N77A 2V2VA 1Q0NA 2A6MA 3RBXA 1E6YB 3QZ7A 3TJ8A 2O3DA 2ILYA 4Y28C 3D6HB 1HWKA 2P9GA 5CZXA 1QUPA 4CLWA 4YP3A 5J1EA 2XS5A 1CSJA 4CLZA 2KXNB 2CAJA 2MY8A 3FVYA 2AWZA 2C22A 1X9MA 5HN0A 2K2PA 2AHOB 3DGVA 1GTHA 1IWAA 2HYIB 1NLKL 4CTAA 4OMFG 5ETSA 1LW0A 2DNPA 2OTLS 3IRWP 3V6KA 4USHA 3HI9A 1CVJA 4YR3A 3TX0A 2DHSA 3V6DA 3BZQA 3CO0P 1A7GE 1YJRA 4MK7A 1HBMA 3M8RA 1T9WA 2B9WA 2RQ4A 3CCJS 2EC2A 2ZJRQ 2R2SA 2QMXA 3DDIA 2UXCJ 2OFHX 1MN7A 1YHQS 1MG7A 1PO6A 3OL7A 3RYLA 2RJZA 2XYHB 1U1KA 2AYEA 2Z8QA 3G87A 1UCNA 4U96A 2G4BA 4L6V3 3TUPA 3DCAA 2ROPA 3OTBA 4JI5F 4B3RF 2XMJA 3QATA 1I94F 3BDEA 1FJCA 2NR0A 4IR9A 2E9RX 4QW8A 3MEDB 1N56A 3DLHA 1VQNS 1BLUA 2F5GA 4CLPA 2XY5A 2O66A 4KJIA 4WKRA 1BMQB 3QQCD 2VQFF 4OYIA 3UCGA 3ZC4A 3MZIA 5K9FA 1U2FA 2H5EA 3EICA 2AKWB 2NREA 2L41A 2UVVA 1AT1B 1AZSA 3RTVA 3QNWB 4ECYA 2EK1A 1RU1A 3MUTP 3GB0A 4U7UD 2CUYA 1S1TB 3SEOA 3TW0A 4KH1B 4X62F 1HNVA 2PA3A 3CIZA 2EW9A 1T03A 1K0VA 1SV5B 2JEIA 1RT1A 2WBRA 2FTRA 2KFNA 3TVZA 3R9LA 3MOZA 4RW4B 3CVKA 1WDDA 1C0TB 2IPOB 3NCRA 3A13A 4WIQA 3UN5A 4K4WA 3FUYA 3NCPA 3C3LA 2HQDA 2QC3A 4KPCA 4ID5A 1FFGB 4PPZA 4DPUA 3A8IA 4NLQA 1JKHA 3HK2A 2ZM6J 3BH6B 2MY7A 4TLQA 2J6UA 1IWGA 1JLFB 3SMZA 1S99A 2BM0A 4N7TA 4N56A 3AB2B 4CT8A 3MR7A 4C0BA 4X4VA 3N9UC 3LP1B 2YNIB 2GVDA 5T7LB 4XIUA 2ROGA 5KG5A 3KLEA 3BV8A 2OPSA 1R6VA 3C6UA 3IG1B 2ZBCA 3ZTQA 2RDJA 3AXKA 1TK5A 1OY8A 2X1FA 3UD3P 1NJIT 3ENAA 1S79A 4I2PB 4E8UA 1AYEA 4RO0A 4P73A 3G6ES 2ZWPA 4BLGA 2IIHA 4CWBA 2LA6A 3MAAA 1BQMA 3PFOA 1XR6A 1I5OB 5H1SV 5KFMA 4MKYA 2Y0SD 2IM1A 3HHDA 1FXDA 1O51A 5IV4A 2B6AB 2LEPA 4PYDA 4G3IA 4PUOB 1YIJS 3GV7B 1D9DA 1V9OA 3UWTA 3GWCA 4PXCA 3T1AA 5K5MA 4HVZA 1FFSB 1F5BA 3BYPA 4QIFA 3MM8B 1RAGB 1RA6A 2KM8C 3D0HE 4RBTA 2N4CA 4P2SA 4QR2A 5ETLA 3TUIC 5A8KB 4OLPA 3D68A 4CLKA 3W2WA 1YVFA 3ENWA 2POKA 3M6UA 1UVKA 3FDSA 3T19A 4NEYA 2IVFB 1AA1B 4RL1A 5AE2A 3PR4A 1JXVA 2R7SA 4B9TA 4DR2J 1YK9A 2Z2YB 3BGOP 3MEGA 3EGZA 2RQKA 3EVOA 2A2DA 4DPWA 4P72A 2WBMA 2DHGA 2WHOA 4ZCMA 3DLGB 3NLCA 1UZHA 1M1KT 3BEGB 1NXIA 2AYMA 4LSZB 1M1HA 1TV6A 2M88A 1RTIA 4QR1A 2OTJS 3PYGA 2RQMA 4V19X 3C19A 1X4AA 4Q45A 5KFCA 1RAHB 4X84A 5KT6A 3VCDA 2QG9B 2HFSA 1NZ8A 1G4CA 1AFIA 2VZ9A 4IOCQ 4GKKJ 4ZKAA 4IYQA 1K44A 1NMEB 2K8GA 4NRUA 5GADU 3I0RB 5CA5A 1RWUA 2IRXA 3K5LA 1ZA1B 1U0SA 4LSLA 4F50A 1VISA 2EI5A 1GMWD 2V8DA 2VQEJ 1ZYQA 4BBYA 5D8HB 2G2OA 3M2RA 3HD2A 3IAM9 4B9VA 1RLCL 3OR2B 3GYXB 4USUA 2CPHA 2RUSA 4GKJF 4I2QB 4LIWA 1CULB 4DG1A 3KJVA 2IMWP 1SJQA 3OD2A 4IOBA 3GIKA 2H9ZA 3BQ0A 4NXNF 4BCAA 4NYZA 1FRHA 1Z1ZA 2C2DA 2MQ8A 3I0SB 4KE5A 3GJTB 4EZ6A 1CJVA 2ZBQA 4YFUA 2H48B 3KK1B 1N33F 1YITS 1D09B 2KXHA 2RKIB 2I5JA 3SQOP 5A8RB 4JV1A 3OL8A 4R5PB 2IM2A 4WFXA 1U09A 3CMAS 2R2RA 2JJ4D 2E9ZA 5HMZA 1RWMB 2VICA 2HSEB 3Q8UA 4UY8T 3ULHA 1LWCB 4P9SA 1HBUB 2QLJB 4WFYA 3B54A 2DNMA 1TUWA 3TJ9A 4O3SA 3K89A 2A1BA 2FB0A 2AD9A 3ISZA 1HPZA 3PHTA 5CH7B 4OLOA 4OYWA 2V4QA 1RCXB 1IKXA 1OQ3A 5D0GA 4QCLA 2GIFA 3OLAA 3QWPA 3JYTB 3AJ2A 4ES2A 5FDLA 2OUGA 1K1QA 2RNEA 2P2CB 4DN9A 1M0SA 4FXDA 4QYZK 5HMXA 1BWVA 1NHUA 2R7XA 3AOAA 4NLWA 4K50A 2B9YA 3W61A 3BPDA 2NXJA 3MMAB 4K4VA 1R89A 4XO0A 2ZVIA 3CJTA 1FKOB 1TL7B 4QU7A 4X64J 2RDIA 4O4GA 3G2XA 2PSZA 5I3UB 1YZ7A 4WP9A 4DV1J 2BKOA 2HNYB 4F0MA 1V3SA 4IFVB 2ZH3A 2V94A 1UAWA 4ZPWR 4DR7J 4AFFA 3M30B 4L73A 2HBZB 3C46A 1YJ9S 1S1UB 2YH0A 3MD3A 1Y4ZB 1OQ6A 4LRBA 3QGGA 2A3JA 3N4WA 4DPYA 4CDIA 4BHQA 3M4XA 4IKAA 2XCPA 3B4MA 3KLFA 2DNGA 2V50A 3W65A 3NKYA 2BRKA 5E41A 1HYSA 3R5BA 3L09A 2AX1A 2FJDB 3ISNC 3EVWA 2C3PA 4HT7A 2E7VA 3PO5A 3CO9A 4KV8A 4PG6A 1JLEB 3M8YA 4ZLJA 1O6XA 2JSXA 4M5GA 1D0EA 5HVHA 2ILZA 4ITSA 1VR6A 1KVJA 4HKQA 3R6GB 3P45B 2WVEA 2R7WA 2KRBA 2FY8A 2WVFA 1T3OA 3AY0A 1U1OA 1HNZJ 3JTOA 2AU0A 4PABA 2VKRA 2FVSA 5DZ6A 3U27A 4CZCA 1MWYA 2RE1A 2RS2A 2CWKA 1RYSA 1PJ6A 1N32F 2KFYA 2ZBRA 2G13A 3HHLB 2QX0A 3JSMA 2AT1B 3IBCB 1MWZA 3HHLD 2LLZA 5DGAA 2KHDA 4ZJLA 4DS4A 3R5DA 4RWWA 3MFIA 2VC0A 1DTTA 3HSZA 1S9GB 4DR4J 1GT8A 1WF1A 3FEXB 5DM7Q 1DLOA 1LWXA 4QW9A 4J9VA 3G86A 4KKOB 2KFZA 1VCTA 4Q0BB 4DF4A 4HHHA 4TY9A 4NYOA 1U02A 4DCJB 2DVIA 3I96A 1QM9A 4RWXA 2P6SA 4QIEA 3OW2R 2HFOA 3Q2TC 5A2QY 2FUG9 3WX4A 2E9TA 4F26A 4KY3A 2ACYA 2NZ4A 4OV6A 1NHVA 3H20A 3MAQA 3D6MB 3D66A 1GTEA 4K5SA 1ZTWA 1AFJA 4B9MA 1RHRB 1VQMS 2CFXA 5KFSA 2UXDJ 5D77A 1KTVA 2D9OA 4DV5J 3KLIB 2GJIA 2V2KA 2CPEA 2PD1A 1OY9A 1Q7LB 2O1PA 2RRNA 4KYZA 2IC3A 5CYMB 4FVCA 4B3MJ 1JXEA 1KFSA 5CQGA 4NZ6A 5E0OA 4EK2A 3OQ2A 4C3LA 3R5JB 3FK4A 3HJVA 4DL5A 3BGRB 2M0GB 3DLKB 1SJFA 3FGVA 2J8AA 1AXQA 3OFEA 2E44A 2DGVA 3SFGA 3CJ4A 3C16A 3OTOJ 3BO2A 1EJ7L 1HA1A 4USIA 2JVRA 3NL0A 3KLGA 1RT3B 1RGVA 4DR7F 3VGTA 2B8PA 2PIIA 4CLYA 1PGZA 3J81U 4G1IA 4QBUA 1B7FA 2XY6A 1NJWA 1D1UA 2ZHBA 4EEYA 4P71A 2COLA 1MMNA 3FFIB 3KK2A 2WW4A 1JLGA 1DTQA 2ZJQQ 3BREA 2BE7D 2UVWA 2YNFB 1FJGF 2YKMB 1X4CA 2V9KA 3J80Y 4LBPA 1IJEB 2PE8A 3C14A 4ZPTR 3GIMA 1S7IA 2DXFA 2ABYA 5HMWA 4G1QB 2DNHA 2XCAA 1UWAA 2BOAA 3LP0A 1VQYA 3BBCA 4NEZA 4USKA 4N47A 1D9AA 3UO0A 1M5PC 1QY7A 3HVWA 4F36A 2EC0A 1M5SA 1BUXA 5LL6d 5K14B 2BYCA 1RKJA 3NXZA 2XS2A 5JUMA 2MZSA 1J5EJ 2M9KA 3HFKA 3MEKA 4OI2A 1TVRB 3QAEA 1PG5B 2X3GA 4QJVA 2QA4G 3S7RA 4H4MA 3SIPB 1D3WA 3PIOQ 2BRLA 3IO1A 4LF2A 4F67A 1DARA 4NRTA 4KGKA 2W4PA 6FDRA 3B4DA 4ED0A 2C3MA 3R2CJ 3OBIA 3HKZD 3JSBA 2GHPA 1WC3A 3IR6B 1R0AA 4RW6A 5HP1A 3TZXA 1Y3KA 4DR4F 1QJHA 1BQNB 2MQLA 5DQIA 3LOUA 1RT6A 1S59A 4LRAA 4NLVA 4YDXA 2FQQB 2W2MP 4NCBA 2SXLA 5D4LA 3VZIA 3SCIE 2FHKA 2J6TA 4JI1F 3MECB 2OFGX 4NLSA 5IT9Y 4TY8B 1EZZB 2FGOA 3AB4B 4I4BA 1WC4A 3B8HA 1S76D 5HATA 4Y65A 2DT9A 2XI3A 4TU7A 1KHVA 1SCJB 5J1NA 2WVCA 4I7FA 1FE4A 4DV7F 4RR5A 1NB2A 3HT0A 3R8YA 2VBXA 1TKTA 2LECA 2FVRA 3LGMA 2JRSA 2MQOA 2C3UA 4X2BA 1VRTB 2QSFA 5IQ6A 3IR7B 2WAQD 4M94A 1EB0A 4CM0A 2WRMA 1ZAXA 2JOQA 4M5JA 5B0DA 1CS4A 2OSRA 1LKZA 1RT7B 4Y2CA 2E5LJ 2IRUA 1JIHA 2HHQA 4K4ZA 2EG1A 2N4DA 2WVBA 3H7HB 1YRXA 3TNVA 2R42A 4P2FA 2VUGA 5C24A 1FVSA 3KJQB 1LOUA 2CQ3A 3CULA 2CQ2A 1UEUA 3GZ7A 2Y9HA 1F9FA 2E1AA 3I9V9 4ICLB 2F1FA 3POTB 4FXWA 2WK4A 1RWPB 4PG8A 3V4IA 2ZOGA 1EETB 4DFPA 1FDNA 3MCSA 4XPCA 2IYIA 5L1KA 2HNDA 4B3SF 5BYQA 3QBCA 2GMLA 3UN2A 2W8KA 2X1AA 1IQZA 3Q8VA 3FRZA 4DPOA 3A1YG 2MZTA 1FRKA 4OYPA 1TAUA 1LWFA 1WOOA 4RU2A 3RU0A 4FDFA 4FS2A 4YB5A 5J1EB 3CDUA 4CP5A 1EP4A 2OO4A 4BC7A 2HS4A 4W4MA 4ED2A 2W9BA 4C2MA 2F7VA 5D3GA 3ZZPA 3I82A 2KT5A 5IZHA 2J7UA 1JWWA 5H9EK 1A0OB 4FKXA 4MKBA 3GP9A 1F0XA 4CTAB 2R3VA 1LW0B 5EHHA 4ZP7A 3SZ2A 4PQAA 4A8MP 2QMUB 2KXFA 1VQSA 3TEGA 5KG2A 1IXKA 2OEKA 2CZ9A 4GVLA 3V6DB 8RUCA 4B3OA 1VI7A 2HBRB 3IWNC 1FX4A 2XY7A 1PJ5A 1FVQA 3WHIA 4ECRA 1XJWB 3U1NA 3KUGA 2J0WA 2Z0GA 1T94A 4A8FA 2HBQB 4DSFA 4C8MA 2IM3A 1UTAA 2ZE2A 1Z2ZA 4MK8A 4ALZA 1ZETA 3KLVA 4CO5A 1M5VC 3M8QA 2DCUB 4FNIA 4Q5VA 3P96A 4AYBD 5ETRA 3UN3A 5LSRA 1S5ZA 4DV6J 1K73T 4OYMA 5HO4A 1Y7PA 3U02A 2Z2MA 3RB0A 4FN5A 2QL5B 3RRKA 3QJJA 5KFJA 1VIXA 4KHRA 1S6QB 2BANA 1SL1A 2Q6CA 4F4ZA 1SVDA 3RRGA 2W8LA 1QVFR 2L3MA 1Y10A 2IM0A 2K06A 4UOHA 1UVJA 1AZSB 3DHWC 3UDLA 1VQ4S 1WORA 2D69A 3T1HF 1AUDA 1T03B 2HGMA 2AF6A 2YH1A 3PYEA 1UJ6A 1XNQF 1RT1B 1UVLA 3I55S 4DL3A 4CNYA 3JAMU 2GZOA 3BSCA 4LR9A 2VA3A 4EU0A 3ZTRA 2B0GA 2XLIA 2V8VA 4L3NA 4RLEA 1KLNA 1TL1A 1P9QC 4FKYA 1W2BR 1B3TA 4ID5B 3PW4A 3QLHA 2CDRB 4OYOA 1JKHB 3NWGA 2QMWA 4OX9F 3K5OA 4LFBJ 3G9CA 2DBBA 5L9NA 3PW0A 1HNXJ 3O8WA 5KFRA 4ZP8A 2NPFA 5EGYA 3TWZA 4LRCA 5J2QA 2V5HG 2M8DB 2ZH7A 2GVDB 2QA1A 1S57A
chains in the Genus database with same CATH topology
4X65F 4QYZJ 4ES1A 4GO7X 2B7BB 4M8LA 4J5OA 3DRSB 3PEJA 2WB4A 1NK7A 2AYGA 4ICLA 3LQVA 3KLEB 2ZH4A 4A8OA 5LJ5Y 1FD2A 3POTA 2OPSB 1ZM2A 2PGCA 2DNQA 3RZAA 4E98A 1RT2B 3LO3A 4NMLA 2R7RA 2RT3A 1Y3JA 3IA0A 1EETA 2K3KA 2DPIA 3E2EA 2BACA 4IRCA 1XTZA 2VFUA 1N5TA 3CGIA 5DO2A 1FK9B 5KOXA 1IJFB 1IKWA 1UETA 2ZC3A 3PEHA 1HNZF 3Q22A 2WW8A 2ZZMA 1S48A 2R7UA 4ED8A 4JYAF 1XN9A 2PFFB 1G1XA 2FLNA 4RW8A 2VODA 2QFJA 4AL7A 2I1RA 5BR8F 4NA1A 3CCQS 1GQEA 2CQHA 2RRBA 4TU8A 3SQGA 6FD1A 5IWAF 3N79A 1WEYA 1HNIB 2VKZG 5C42B 3LF0A 1DFDA 2IHR1 3HVTB 1F5AA 3X3UA 5CZVA 4ED6A 2ZVSA 4EO6A 5DG7A 1M5OC 1MNEA 2OMOA 3DOLA 1FRLA 4C0HA 2D7SA 2W24A 1E6VB 4WFNQ 1URNA 1N52B 1X0PA 4PQUA 1Z4UA 2L9WA 4JUZA 3ZFVA 2UVRA 4B9LA 4N77A 4HI2A 3BB5A 5GMKa 4H4OB 1MU2A 1WD6A 2D3OR 1BQMB 2YKNA 1E6YB 1RQ0A 3QZ7A 1FJEB 3R5AA 2O3DA 2VG5A 1T05A 4YB1P 2ILYA 2GGPB 4Y28C 3DMJA 4KTQA 1S9EA 1Q86T 5CYQB 4CO1A 2DNLA 2VD3A 5F0WA 1HWKA 2P9GA 3MPWA 1QUPA 5CZXA 5A8WB 4YP3A 1YWXA 2W9AA 4R8UA 4B02A 5J1EA 1NKBA 2XS5A 2D3ZA 1CSJA 2ZKTA 3GFHA 4I0WA 4LVNP 2KXNB 3AQOA 1TL4A 4X4TA 3R1LA 1Y00A 1RA7A 2HNZA 3T5HA 2MB0B 5AJ3F 2VBYA 4DDFA 2FVPA 4UY85 2MY8A 2ALZA 1S1VA 4NOHA 3FVYA 1UWBA 4MIWA 4KO0B 2AWZA 3BR8A 4KFBA 2C22A 2YNIA 1X9MA 4J9NA 5HN0A 2K2PA 5T41A 4YR0A 5DLFA 4LT6A 2LCWA 3OJSA 2V4RA 3VZHA 4F4XA 3F44A 3PJWA 3NS5A 2MZRA 1GTHA 2HYIB 3CCWA 1YG0A 3KTQA 4IH7A 1N6QA 2BXJA 4DOZA 2CIMA 3OR1B 2BJEA 1HWJA 4CTAA 2R7QA 3DOKB 4OZNA 1NKEA 4OMFG 1JLBB 1LW0A 2DNPA 2OTLS 4I67A 2QO3A 3SCKE 3IRWP 3V6KA 1KOHA 4USHA 3EX7B 2HHPA 3HI9A 1CVJA 4YR3A 1XBWA 2NS1B 4OX8A 1A6LA 2DHSA 4FYDA 3V6DA 3K57A 3BZQA 3I4HX 1A7GE 1JLAA 1YRTA 3CF5Q 1FERA 1YJRA 4MK7A 1HBMA 3M8RA 4F8RA 4OL8A 2B9WA 2KT3A 2RQ4A 2N82B 3T5LA 1X8DA 3CCJS 4M5DA 5J2PA 1M90T 3OUYA 2ZJRQ 4G1PA 3MEGB 1Q8LA 1UJ4A 2QMXA 4EO8A 2R2SA 1LFPA 3T6BA 1AROP 2KHCA 5AXNA 3M6VA 4WCEQ 4F2SA 2OFHX 1YHQS 3O3LA 4DL2A 1PO6A 3OL7A 4MH8A 4H4KA 3RYLA 2WB1D 2RJZA 5D4PA 1U1KA 1LW2B 2AYEA 2LYVA 2Z8QA 3H2LA 1VHFA 4HH0A 1N5YB 2G9OA 4UQTA 2B4OA 2G4BA 1RTJB 4L6V3 5CYJA 2ROEA 2UXDF 4RBUA 4H54A 4ZPCA 4ETZA 2PMHA 5G0RB 3P3DA 2HVHA 2QYCA 3RB6A 3DCAA 5JVGQ 1TK8A 4DV5F 4K0KF 2ROPA 3OTBA 4C8ZA 2PEHA 4JI5F 2OPQA 4PUOA 2GIRA 5I4MA 4B3RF 2IAJA 2J9DE 2XMJA 1SKWA 3MR3A 4LSNA 1I94F 1R8AA 1VK3A 4TLRA 3BDEA 4A46A 1ZZNA 1FJCA 2NR0A 4IR9A 2XSJA 2E9RX 2N7YA 1M5KC 3FRYA 3MM9B 4QW8A 1JJHA 4B3MF 1R8CA 3MEDB 1N56A 2EFNA 3DLHA 2MKCA 1VQNS 1BLUA 5L38A 3HHNB 1LWEB 1RTIB 4RU9A 2XMTA 3CD0A 4MJKA 2XY5A 5L9XA 2O66A 5B0CA 3H2VE 4YUDA 4KJIA 4NA2A 4WKRA 3ZZRA 4OI6A 4EGLA 3CMES 1HWUA 2DITA 1D8ZA 3IS9B 2QZ8A 1YI2S 2HRUA 2VQFF 1S0VA 3UCGA 2ZOFA 3HJFA 2UVUA 1GXLA 1X4EA 4A8QA 3ZC4A 3FSIA 3MZIA 5E3CA 2DR8A 3FCHA 5K9FA 1U2FA 4QWAA 2W9CA 3OTOF 2H5EA 1IBMF 4DEZA 2LMIA 2JX2A 3IRXB 1SBRA 4OQJA 2NREA 2L41A 2YKQA 5IM0A 2ASDA 2UVVA 1X4HA 2OPRA 4NL5A 5KFQA 3RTVA 3TAQA 4DL7A 1MMDA 2VH7A 3QWUA 4ECYA 3QYYA 2UXBF 4EWTA 1LQ9A 3MEEA 1ZBTA 3UQSA 2EK1A 4JBCA 5LMNF 3MUTP 1VBZA 3GB0A 1WACA 2CJ9A 2VG7B 5F0UA 4WFBQ 2UP1A 1S1TB 3LGNA 3SEOA 5DDPC 2GCFA 2QT7A 3DM2B 3TW0A 2MXYA 5KTQA 2I2YA 2MKHA 1HNVA 4X62F 2PA3A 4MKAA 2DRBA 1G3OA 1DQ9A 3DC2A 3CIZA 3MM7B 5AXLA 1SJ1A 4QOTA 2EW9A 1U1PA 1S6UA 1T03A 2RMLA 4ED3A 1NO8A 2E7WA 2QSWA 1K0VA 4LQ9A 4LSLB 4ZA1A 4F3QA 2HVZA 2YNGA 3QO9B 4QWDA 1SV5B 4NXMF 3FEZA 2CVEA 3CTRA 3G6XA 1Y9OA 2JEIA 2VOPA 1U2RA 3D5MA 3I6PA 1RT1A 4LFBF 3D0GE 1U4BA 2DIUA 2KTQA 1UVMA 3I4PA 2LXFA 2HPUA 1SUQA 2WBRA 3DLGA 1IKVB 2RD5C 2FTRA 2KFNA 3TVZA 3DYAA 3DRPA 3M2RB 3MOZA 2FJVA 5KT4A 4H4KC 1IM4A 4RW4B 1U6BA 1SH2A 2NSCA 3CVKA 1IKYB 4DQSA 1C0TB 3CUNA 4A8KA 1D8YA 2L9DA 5SUHA 3PR5B 4ZCIA 4YOEA 4IFYA 3NCRA 2KU7A 3M32A 2VFRA 3C6TA 4C98A 1N0VC 1ZAVA 3VAGA 2WOMA 4K4WA 4NCAA 2VFTA 4B3TF 4AXIA 3NCPA 3CCVS 1S49A 3C3LA 2AJ1A 2HHTA 4PR6A 1J5OA 1BGXT 1QSLA 2R8GA 4DG1B 3KJVB 4RZRA 4ID5A 2D9PA 1N36F 4DR1F 5I42B 5KFNA 5HL7Q 1XMBA 2DR7A 4FF2A 4PPZA 1TP7A 3JTPA 4NLQA 4CO3A 1JKHA 4N76A 3HK2A 2J5AA 2YX7A 1LV5A 2HWTA 2YKNB 2MY7A 2E1CA 2ZUGA 4TLQA 2OPPA 3TAMA 2J6UA 2ZH9A 3BN7A 4F25A 2CDQA 5IXUA 2DNRA 3E01A 2IRYA 1J5EF 1JLFB 2DHXA 5HI7A 1VIOA 4IQMA 4X4OA 3SMZA 2IFXA 1S99A 4IO9Q 4EBEA 2BM0A 2D74B 2RSQA 5KT2A 4N56A 3AB2B 4CT8A 3MR2A 4C0BA 4YB6A 1VQKS 1URRA 4X4VA 3N9UC 3LP1B 4N8NA 2YNIB 5LSOA 4CCHA 1RT5A 5T7LB 2I5JB 2Y1JA 2XMMA 2CZVC 4HHJA 3ZZYA 2CQDA 4XIUA 4CO4A 3DRSA 2ZOMA 3MPYA 5KFYA 2ROGA 3QGIA 3SDEB 5KG5A 4OZ0A 1FXLA 3FMBA 3KLEA 1QE1A 1RI7A 2DNKA 2R2TA 5KFOA 3OFGA 4Y3CA 4M95A 4PWUA 2OPSA 3C6UA 3RRHA 5GAEU 2YKPA 3IG1B 1RT2A 2ZBCA 4KR0B 2RDJA 2HWIA 4JI3F 4CT9A 4RUAA 2MGZB 1FK9A 4IRKA 3VAMA 3N5FA 4W90B 1TK5A 4DN0A 3DRRB 4WK3A 1ZZFA 1MSWD 4OI0A 2X1FA 3UD3P 1NJIT 4HL9A 4DLEA 3TRGA 2KYZA 4I1TA 3MUVP 4DJBA 1S79A 1HBMB 2L48A 2GMHA 4I2PB 4E8UA 3G8SA