4RWXA

Crystal structure of l. monocytogenes psta
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
76
Chain Sequence
MKLIFAIVQDQDSNRLSDALTKGNFGATKLANTTFIIGTEDERVEDALAIIKENCKARQVGGATVFVMPVESFHHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2692 protein
publication title Molecular basis for the recognition of cyclic-di-AMP by PstA, a PII -like signal transduction protein.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
total genus 20
structure length 76
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rwxA01
2J9CA 1UMJA 3X3UA 4C3MA 2DCLA 4CNZA 5D4NA 4RLEA 5L9NA 2CZ4A 4D3GA 2XZWA 5DRKA 1UKUA 2J9EA 4Y65A 1V3RA 4USIA 4YB7A 4R25A 1NZAA 2Z0GA 2GNKA 4C3KA 4CO4A 3MHYA 4C3LA 4CNYA 5DS7A 3GSDA 4CO2A 1KR4A 3TA1A 1V3SA 2RD5C 1P1LA 4WK3A 4CO1A 3CE8A 2E66A 1VFJA 2O67A 3LF0A 2XG8A 4E98A 5D4PA 3M05A 1J2VA 3NCPA 2NUHA 1XK8A 4YB6A 4CO5A 1V9OA 2J9DA 2ZFHA 1NH7A 4Y6IA 4CO3A 1NH8A 3BZQA 2ZOMA 4IYQA 1H3DA 4D3HA 2EG2A 3AH6A 1PILA 2XBPA 3T9ZA 3L7PA 3NCRA 4NYPA 4OZNA 2NS1B 1QY7A 1VHFA 2J9DE 1O5JA 2JJ4D 4ZK7M 1OSCA 1HWUA 4OZJA 1Q1KA 5D4LA 3NCQA 3O5TB 1UL3A 4NYOA 3AA9A 2VD3A 2PIIA 4OZLA 4AFFA 3AHPA 3O8WA 2EG1A 2V5HG 2GX8A 4USHA 1O51A 1V6HA 5D4OA 1GNKA 4RWWA 2NUUG 2XULA 4RWXA 3OPKA 2O66A 3DFEA 3TA0A 1NAQA 4RX6A 4USJC 3TA2A 3AA8A 3N5BA 4CO0A 2GW8A 1UFLA 4WK1A 4YB5A 3HLUA
chains in the Genus database with same CATH superfamily
3VF0B 3BBFA 2LYVA 3GYXB 4C3MA 1DRZA 3PKMA 2NSCA 3PIPQ 5D0HA 3FC9A 4N8NA 4ZIWA 3QLHB 2X3DA 1OYEA 3W5ZA 5A8WA 3NGKA 4WIQA 1RP5A 4X64J 3B4DA 3K5LA 1S1UB 3T5LA 1HWIA 1VOMA 3PW4A 5J2NB 4FS2A 4ED2A 2C3PA 4EBCA 4DOZA 3A13A 1E6VA 2BE2B 5DDOC 2V67A 2V4RA 4NWBA 3JB9k 3UNGC 1LV5A 4ZPTR 1URRA 1RTDA 2PO4A 1VQ8S 3CCUS 3IM9A 3OTOJ 4RNHA 4N77A 4HI2A 4E0DA 1FWKA 2VONA 4ZKAA 2DYAA 3DRPA 3SSSA 2HHQA 2NXUA 4G1QA 3Q22A 1EJ7L 2E44A 3QIPA 4ECVA 2YNGB 1RI7A 3E2EA 5HROB 2UXBJ 1WELA 4ID5B 1RHQB 3NBPB 2RRBA 4L74A 1WACA 2YX1A 2WVDA 3CCTA 4MKVA 2BANB 1GMWD 1R6VA 3KDNA 1UZDA 2W25A 2JEIA 4B9MA 4HACB 3K57A 5HQLA 2VQEJ 4K0KJ 3VR1A 2XWXA 4PWDA 4B9VA 1TL1B 5KFXA 2V8VA 2AJFE 1KQKA 1Q53A 4NYZA 4CO3A 1T3OA 2N3OA 2J6TA 2WVCA 3TX8A 1HR0J 4Q0BA 3AD7C 3CCJS 4K2JA 3QGHA 4KTQA 2RHSB 9ATCB 3M6UA 4X62F 4F26A 2X3GA 1KQGB 1CJUB 4ZCLA 1QSYA 2FLPA 4LFCJ 1RWOB 3BGFA 1CSJA 3VGUA 4DV5J 2MZRA 2J0QD 4B3TF 2KI2A 1Y5LB 3K0JA 4M8LA 2KT3A 4K4XA 1X7VA 2MJUA 1X4BA 4IO9Q 2OPRB 2DGXA 1WNEA 1BD6A 1TL5A 1Y00A 1WWHA 2A0FB 2HS3A 3CJSA 1MMLA 2XZWA 3OXGA 4O3OA 3IXQA 5D6GA 4DR4J 3J81Y 3W2WB 1C0UA 2EBEA 2A2DA 1ZETA 2WAQD 1IKYB 1YJNS 2WVBA 4LFBJ 3BH6B 2DK2A 1M5SA 4E2FB 3JSRA 4YQWA 1D9AA 3R5GA 3L3CA 3MEDA 2HZCA 1F2GA 5B0EA 4YN3B 3SFUA 2DNNA 2WW4A 5BR8F 2GA7A 4DSJA 4GKKF 3ENAA 5CYQA 4CIOA 5CYJA 1BLUA 5GAGU 3TUZC 2GMJA 3P4UB 4YR0A 1ZA2B 5ETQA 2XQCA 5DLGA 1UL3A 1N5QA 3ZZZA 2BM1A 2HBYB 2MPUA 4WP8A 3DLBA 3PYEA 4J7CA 1QAXA 2D7SA 2IM3A 3EYZA 1Z4UA 3D9BA 4OYMA 5KFAA 2WHOA 4DV1F 1NK8A 3OHAA 1TL4A 4IFYB 3RB4A 4IH5A 1GXTA 3SQGB 1UFWA 3BB5A 5GAEI 4EZ9A 4DG1A 1VQ6S 3QGGA 4RW8A 4JYAJ 2DR6A 3C16B 4J9RA 2GGPB 2FGOA 1VRUA 2GS8A 1XWLA 3ILOA 2ASYA 3MURP 4KB7A 1IBLF 2LXIA 4DCOB 1AFIA 1JKHA 3CJ8A 2QMXA 4CLUA 3RYLA 4OI1A 2QX0A 3CGIA 3MPUB 2WBRA 2PA8D 1N34F 1YK9A 4J9QA 4LF9F 5H9FK 4XDCA 3A1YG 1XN9A 2Z4PA 1FJ7A 2QRRA 1ITPA 2J7KA 2MZJA 5J1PA 3PO5A 3B78A 1PYOB 1U0HB 1IKVB 4USJC 2JLGA 2MQMA 4C8OA 4CYUA 3K5MA 5D0GA 3HVTA 3KG1A 1CJVB 1CJTA 2HFOA 2FJVA 3LOUA 2JEJA 4FF1A 2VODA 5H9EJ 1S1XA 3M8PA 3R2CJ 1VBXA 1QAYA 1KEKA 3AQPA 2FZGB 3A8IA 4U7CA 2BV3A 5JJBA 3RRKA 5H9FJ 3OW2R 3MR6A 3NGTA 4F4ZA 4TNOA 2R8IA 3KLHB 4DN0A 4WP9A 4CM2A 4L73A 4C8NA 1KS2A 2CNOB 2ROEA 2ZNYA 3DLHA 5C2CA 5KFZA 3KG4A 2J9DA 4Q7AA 2EXUA 3H4DA 4ED6A 2OPQA 2B5JA 3EDQB 2OAUA 3ENQA 1BQNB 5GMKa 2PEHA 1WEXA 4CI0B 1SC4B 3M7VA 5F8NA 2HPUA 4LFAF 3OTCA 1KOHA 2ACMA 1F5BA 4ZLNA 4ZVHA 2N4DA 4U96A 3DOLB 3KMSA 1N5TA 3PFOA 2ZH7A 2IJNA 4DQSA 3GV7B 3R5BA 3MEGB 2OLWA 2QFJA 1BHNA 3GIKA 1K0TA 5RUBA 2IA6A 3Q86A 3PJXA 1P9YA 4QYRA 2HVIA 2L41A 4I6YA 4NL5A 3NNHA 4B02A 3KK3B 2W1BA 5A8RB 3PYFA 2LXFA 4USMA 1G1XA 2FGCA 2L48A 1O0PA 4OYPA 4DPUA 4JI0J 3IG1B 2DITA 4MK7A 5D4PA 4FF4A 3PRVA 2I38A 5AE2A 1PJ6A 2XMTA 4I7FB 1C0TA 3T1YJ 8AT1B 3H5SA 3UFCX 1S6OA 3BZQA 2ZOMA 3DMJA 2AU0A 4IG0A 2R42A 1TVRB 4OQJA 4IG3B 3NAHA 4WTOB 4AXJA 4Q5VA 1X4HA 4JI4J 3R9LA 3UCZP 4ECRA 3UDVA 2YNFA 4HHHA 2C2EA 4QR0A 3V2UC 2QMWA 2B6AA 3JAMY 1YHQS 4DEZA 3U7JA 3G82B 2G0CA 2GW8A 4ELUA 2MB0B 1HQUA 2CAJA 1UMJA 3HO1A 1H38A 5C24B 2ADBA 4NMLA 1EAYC 3R5DA 3BSOA 4DUZJ 1MWZA 4H4OA 2LEAA 1MW7A 3U02A 4HYKA 4OX8A 1WEYA 2QIFA 2YVSA 1YJVA 4V19J 2APOA 2Q6BA 2B9YA 1NK5A 5I4MA 4B9LA 4FYDA 1SC6A 2AMCB 3I0RA 5KFKA 3RAQA 3HFKA 5C7PA 2IRUA 4FZVA 3CMES 2E5LF 3FEZA 2R8KA 3G8TA 4URSA 1IVZA 3MPDA 2XCAA 2NXEA 5I3QA 2HKEA 4KIAA 2FJXA 3CJRA 4Y3CA 3NS6A 3D2WA 3IC1A 4V1Ak 3W5YA 2JNJA 3OJSA 5KFWA 1H74A 3RB3A 3J7YU 2L3MA 2Q6CA 1WF1A 3I5BA 2MMYA 2NREA 2HBZB 1Q16B 4C6AA 1S48A 2O1PA 2V8GA 2QTWA 1RT3A 2A10A 2VG5A 4P2SA 5AXNA 1E6YB 2G1HA 3M8ZA 4RW9A 4Q8EA 1C4CA 1UA1A 1HPZB 2DISA 5ETRA 4CO2A 2ZM6F 1S9GA 4M5DB 2MKCA 4ZHRB 1YSJA 4DX8H 2UUAJ 1J5EJ 2M2BA 1VQPS 4Y2CA 3A8EA 2OMLA 2M9KA 2KB2A 4C0OC 4ZITA 4YMEA 2OPSB 1VQKS 1WEZA 3HT3A 2HHHF 3LTOA 3QT7A 4EBEA 2Z2ZA 3RAMA 3FRYA 3OR2A 3BGOP 3FGVA 5ETOA 4WFBQ 1KTVA 4P2MA 4KFBA 2YKMB 2Y8YA 4N76A 2QN6B 3Q8QB 2NCKL 2ZBRA 2RVJA 1U2FA 2VPXB 3M8QA 2PT0A 2W2NP 1IBMJ 2AT1B 2C2NA 4RLEA 5HAOA 3PY8A 1QAJA 4ECWA 2CNLB 2HFSA 2MGZA 1RAEB 4ZVQB 4J9KA 3BBBA 1CPZA 3KUEA 1Y5NB 5K5MA 5EDWA 1SIZA 1W26A 3UE2A 4UZBA 1LWFA 3MMAA 4LSNA 6FDRA 3TQ1A 4J9UE 4OYOA 4WPAA 2OTJS 1AB8A 4WFZA 2QL9B 2YH0A 1X60A 1V5IB 2Z57B 5E41A 2EFQA 3E51A 4DR3J 5DDPC 1NKEA 1O5JA 1N36F 3RG6A 4LSZB 1UEKA 1SKWA 1RHUB 2CG8A 2F8MA 2GQQA 2ZBCA 3MR7A 1Y3JA 2QC3A 1N56A 2PN6A 3GYGA 1FD8A 1UZHA 2C2OB 4RU9A 4P52A 2QE5A 3EPGA 5KFOA 3LAKA 4O44A 1KQSR 1JB0C 1GMVA 2B51A 3OLAA 4LF5F 4OZ3A 4P2FA 2DGUA 3QFWA 2K06A 1UP1A 1O8BA 4FXWA 3IBCB 3EDRB 3IS9A 3M32B 4WK3A 3QGIA 5KFYA 3R5JB 3UN2A 3M1VB 2WSFC 2W9BB 1HLWA 1WHVA 1VLOA 4DUYF 5LMNJ 4U95A 5MAOA 1CULA 4I56A 2ZD1B 3VVUA 2HAIA 2CA9A 1WSRA 1U24A 1DJ0A 3MMJA 1P6TA 4Y2AA 3O44A 3GE9A 4IRCA 1NK4A 4DPOA 4CLLA 4RWWA 1NLKL 2YPZA 1JLBA 1REVB 3PACA 2HQGA 3W5XA 4LF6J 3M2VA 3ET6B 1N6QB 1BQMB 4KRWA 2HNYB 4NA1A 4NI2B 2DGQA 2AJ2A 4ZVRB 4DU8A 2FLLA 4JI3J 3TEGA 4CNZA 4PQAA 4F3MA 4JV1A 1SL2A 1Y7PA 2XMWA 4JB8B 4ILMA 2ZOFA 1LQ9A 1HBOA 4I69A 5LMUJ 3EE3A 2HHVA 3KK2B 4CT9A 5KG4A 3TUPA 2KU7A 3DOMB 3HVWA 4ANEA 1CJKB 4TU8A 4CLYA 4X4UA 4O4GA 2CNKB 2WTFA 4ELVA 2GVDB 4KGZB 1OIAA 2MKIA 1H2UX 1TKTA 2BX6A 3BGRA 2JOQA 2AWZA 1MG7A 2B9EA 3OVAA 3Q24A 1VS3A 5B0FA 1PO6A 4UUWA 1HWUA 1S9EB 3KJVB 4B08A 3RW6A 3TNVA 1FRJA 2VD3A 3DKDA 1HFEL 2KJVA 5HO4A 3IWNC 3L7OA 2GMHA 3D4JA 2DNLA 2HIYA 2E1CA 1B70B 4FN5A 4DPWA 1RAHB 2HHUA 2WSCC 2ZE2B 3GSIA 1TKDA 4LR8A 4HHJA 2W4PA 4EO8A 2BJ7A 5K8MA 4HTJA 4C8YA 4IFVB 3GV8B 2G1DA 3TAMB 4JUZA 2LU1A 4USVA 2WW8A 2RSQA 1W2IA 1SH3A 4EO6A 4DMZA 2Q3PA 3UR3C 1M5OC 3MDFA 1Q0NA 1TAUA 2FTRA 1RTJA 3KK3A 5LOQA 5KFBA 2BM0A 4O23A 3N01A 2B4PA 3D6MB 1JLAA 5GADU 4ZCKA 3IG1A 1TV6A 3GG0A 3DHWC 4ECSA 1TKZB 3T1HF 1ZTWA 4PQUA 1HWKA 1AW0A 2N7CA 3ITHA 4HTIA 5KG2A 4DFMA 4JI6J 3G71S 4LREA 2KT2A 4ZLJA 2V50A 1GFWB 2B7CB 2G9OA 2WCXA 4A8SA 2CJBA 1VRTA 2PMHA 1YZ6A 3R1HA 5G0RB 2VF3A 1U2CA 2UV8A 4MAKA 1U48A 2IDLA 2RDDA 5L8RC 4GVBA 2GMLA 1T9WA 4JI1J 3BM7A 1YRXA 4RW4B 4B3SF 3EXYA 1TL3B 2L9NA 2BE9B 4BDPA 2UUBF 4RL1A 1H2TZ 1UJ6A 3DRRB 4X4TA 3SQOP 4M5MA 4ZP8A 1SJ3P 1HYSB 2IJRA 1GH8A 5BXIA 3FCVA 5D8HB 2GO8A 5LT5A 2HQDA 4DV6J 1RK8A 5CH7B 4WF9Q 1NH7A 5K8OA 2HMIB 4EUVA 2MZQA 1FXLA 3R5AA 1S6UA 4IYQA 2MTLA 3LP1B 5KT4A 4Q2MA 4KKOA 4ZP7A 5DGBA 3JSMB 1QDUB 2DJWA 1SJ4P 4U6PA 4NXNJ 5HL7Q 4YY3J 2D9OA 2KYZA 2RQKA 1LW0B 1IQZA 2YQ0A 4DR2F 1D1UA 3B6BA 3CC4S 1NK9A 1VMBA 1HBUA 2NPIA 3LWMA 3JSYA 1NDPA 1DTQB 3UI3A 4A8YA 4RW7B 4NOHA 1FNMA 3T5KA 4CT8A 2CVIA 4X4QA 1T9VA 3CDEA 4WWSA 5DG7A 1JX4A 1DLOB 3A3PB 4Y34A 2HRUA 1OJ4A 4AD6A 4AYBD 1G6BA 2BABA 2YWEA 2HZVA 4DQPA 3SSQA 2FY1A 2FHJA 4IDKA 4IUFA 1TL7B 2XCPA 4O3RA 3MCMA 2HGLA 2BXJA 4WCEQ 3Q83A 5DQIA 2V8DA 3PJWA 2VIHA 4EWTA 2NXJA 2YX7A 4L6V3 3RAXA 1FVSA 1LEOA 2VFRA 1C4AA 1IBCB 3VGVA 1EP4B 2F4VF 3H5YA 3HX9A 3MPWA 4NCAA 1ZPWX 3N28A 1XR6A 1XNQF 1RHKB 3BO3A 3A3NB 1FWPA 1DARA 3H8YA 5DQHA 1U1MA 1YITS 2QG9B 2AYEA 4PXBA 2AEFA 2DNPA 2XLIA 1N4LA 4GO7X 4P71A 2Q43A 3PR4A 4NLSA 1RYRA 3MM8A 3PG9A 2XYHB 4A8OA 2MQNA 3W2VA 5AE3A 5GAGI 3BO2A 1HHSA 1S1VA 2HW3A 5DLFA 2H5EA 4LF8J 1YVFA 5HBMB 4CO4A 3MM7B 3M8SA 1R8CA 2RKIA 5A0YB 2KFNA 3R2DJ 1FD2A 4OI2A 3CJ2A 3MCOA 3QO9B 5L1IA 4A48A 3GIMA 4EEYA 3K8WA 1C1CA 1UA0A 5E3PA 3CJTA 3T9NA 3WX4A 1ZM4A 4KR0B 4PG5A 3CD7A 3OSPA 5AXLA 4ZMMA 2OO4A 1WHYA 1NPKA 2KL8A 1GQEA 5T7LA 4P74A 5LM7E 3K5NA 1PCAA 4JI8J 1Q81T 1OS5A 2OEMA 4I4BA 3OUYA 6AT1B 2Y3YA 2JC0A 3FRZA 1XMBA 2I0XA 4OYAA 5D3GA 1AFJA 2IRXA 3KLGB 2R2RA 4QU7A 3NEKA 1SQGA 1T95A 2YKNB 1FKOA 3QRPA 3H2UB 4ES2A 2DIUA 4FYXB 5KFVA 2C1EB 3EVMA 4ED3A 2KH9A 3S01A 2H5IB 2BQRA 2DH7A 5J2MB 1W2BR 2MKJA 3ZFVA 2DO0A 1SXLA 4KH0B 5LSLA 2ATCB 2B4OA 2I1RA 1UVKA 3HXMA 3CCSS 1HD1A 1NK7A 2YKPA 2JJ4D 2UV8G 3EGNA 4DL7A 3Q8PB 2BOAA 2GJFA 3UQSA 2AF6A 5A8KA 2IAJB 3PZPA 5I42B 2EWHA 2AEJA 1HKAA 3RTVA 1JMTA 3EGZA 1Q8KA 2VC0A 1VIOA 2IVYA 3ZTQA 4XDDA 3ZZOA 4DWIA 2HS0A 4J9LA 1FDAA 1HL6A 5D0EA 3E01B 2YY3A 2QA4S 3N0VA 1BQMA 1LWXA 1S6PA 1SI9A 2JEGA 3DI6A 3ZZRA 3KHLA 1RCOB 3OL6A 1KONA 2NUHA 2BQUA 3BREA 5L1KA 1S1WB 4DSIA 5KG5A 3AFGA 3PX6A 1MU2A 2XO6A 2BRKA 4LIWA 1RHRB 3PYDA 2NZ4A 5HLFB 3MR5A 3MXHP 1NCLA 4F50A 1VISA 4CH7A 3CJQA 2BJ3A 4NZ0A 2CQHA 4I2PA 4MIBA 1HI8A 3VAMA 4O3SA 4DR6J 2BW2A 5KT3A 2R7VA 2F65A 3OSNA 1LXNA 3OLBA 4ENOA 2Z30B 1FHTA 2XYPB 1WOOA 4NXMF 1M5PC 3P6YC 2GJ2A 5KFQA 4GO5X 1U49A 4D3GA 4PPZA 4F36A 1RAJA 1X8DA 3VALA 2J0XA 1S6QA 2QA4G 6FD1A 2XGQA 1KFDA 3QZ8A 3IWLA 2ZWPA 3K5OA 5J2QB 4OX6A 1JXLA 3HPOA 3CDBA 3RBEA 1B7YB 2CPDA 5F9LA 2X1FA 2N82B 3U1LA 2MKKA 2RU9A 3UPFA 2O3DA 5A76A 4K4UA 4S0MA 4G6VB 3J7ZT 1K1QA 3FZBA 3LP2A 1RT4B 3KLIB 2W2MP 1XMQJ 3BN7A 1H73A 2YNIA 1WOPA 3VAJA 1Q1KA 2VB6A 2DHAA 4DV3J 5D4LA 3HSGA 2V4QA 2DPJA 3ONQA 3KNGA 3I56S 3QNWB 5KFIA 2ZHBA 2ZC3A 3GIIA 3MOJB 2AV5A 4ZVUB 3NOGA 4DCPB 4FF3A 3AOBA 4RKUC 3MZIA 3C15A 4B9TA 3OTEA 2XTJP 3DLGA 4M5GA 1S5ZA 2PD1A 3JTPA 1IBKJ 3MUVP 2MSTA 1Q5VA 3MPVA 3J7YI 4DDFA 3CMAS 4DV2F 2C3MA 4DLGA 2WVEA 4LRDA 4PWWA 4OLOA 5HATA 2C28A 3WZ0A 3HZGA 3AH6A 4JP8A 1VBZA 3D5MA 5ITHA 3G4SS 1FFWB 4WYWA 3DLEB 1OQ6A 5GMEA 1KN6A 4HT7A 1HBNB 5C42B 1RLDA 4DV4F 1QTNB 2Y9HA 4RW6B 3S7RA 1KVKA 5GMDA 3KOAA 3HHLA 4YFUA 3DHXA 3DU5A 4RX6A 2AJQA 4IH7A 2HHPA 2R4FA 1FDBA 3MTKA 1CQMA 2QSWA 3PNIA 2HHWA 2E9ZA 2J9EA 4C11B 3IA0A 2KKHA 1LW0A 1GTHA 4CH1A 3AAWB 4DV7J 2DHSA 4P6QA 1IWAA 2V2QA 4NE9C 1ZBTA 2Q79A 4C2MA 3GWCA 3LF0A 1RT6A 2QLBB 4G65A 2HFUA 3G6VA 1A0OB 3OHBA 4P10A 3DDIA 1S4EA 1Z1ZA 3OTDA 2E1AA 2B3TB 2ALZA 2KN4A 2DXFA 3H4BA 3C6TA 3HHLC 3CC2S 3EUNA 3H25A 2WONA 1XBWA 1X4DA 4MIWA 3SFGA 3UVJA 2QLJB 5L38A 1HNXJ 2AQ4A 4LF4F 1UEVA 4USTA 2RUGA 1SC1B 3DYAA 2ZJPQ 1UTAA 3MM5B 5D4OA 3AJ1A 1G4CA 3VAKA 4CRJA 4MTPA 2ZUGA 2EKNA 4CP5A 4A8MP 5K9FA 4OL8A 1KWMA 3TAPA 3M9OB 1XMOF 2RQMA 4CTAA 3F73A 4OX9F 5LJ5Y 4ZDNA 4DZDA 2HNZB 1H6KX 2FVSA 3PXGa 1HMVB 5GVQA 2VFSA 1KR4A 1Q86T 5IXUA 1RT1B 3NGUA 3KK1A 2R8HA 1RSCA 2K3KA 1WF0A 3ISNC 5F8GA 2CVEA 3C14A 2P6TA 1VQ4S 5F3ZA 5D15A 1X4CA 2VBZA 4K8RA 2XHWA 1GMUA 4A8XA 4PUOA 3BYPA 5CYMA 5HK4A 3AQOA 2HIQA 3TUIC 1YJ9S 4QWBA 2FDNA 3PVXA 4DI6A 2Z2LA 1U1RA 2NZCA 4N7TA 5A8WB 1VQ7S 1R0AA 2JC1A 4ICLB 2AIRB 1XNRF 2RF2A 1F6TA 4OZLA 3LQVA 2RH3A 2RHQB 4QU6A 1S1TA 2L9DA 3MM9A 4HH1A 1FDNA 4QPTA 5HN0A 1X4FA 4WU2A 1E6VB 1HNZF 4KHPJ 1IR1A 2UZAA 2IVFB 3BPSP 3LAMA 1RTDB 2VDIA 2VA2A 1SUQA 2NYIA 2BQ3A 3KJNB 4F0MA 5IT0A 4DFKA 5CZVA 1X5PA 4KAIA 4OZ2A 4F4XA 2KHDA 5DG9A 2F3JA 3PHEA 2K3IA 1MROA 3TEHB 4OLPA 3LGNA 3QYYA 2XYGB 4UF4A 1F60B 2JFDA 3DRPB 1X5OA 3MFIA 4G1QB 5IZHA 2KT5A 3FFIA 3QIPB 1RTHA 4RZRA 2HGMA 3CE8A 1QVFR 1R8PA 2F4FA 1XERA 3SBMA 4DHVA 3A4TA 1WKKA 2J8AA 1TZ0A 1UEUA 2D3O1 1AXQA 1WJ9A 5KG1A 3I9ZA 3EGVA 1U09A 3GR0A 5G4DA 3NG8A 2VBXA 2YPYA 2CZVC 2OEKA 3OV7A 5H1SV 1NEEA 2RILA 1HNWJ 4PWDB 1Z2LA 1ICEB 5HMXA 5IFMA 2OPPA 4RUBA 4KYZA 3LH2S 1NAQA 3TANA 1NHVA 4UQGA 2RRAA 3FNNA 4CLWA 4F25A 4ED8A 4Y2IA 2A1BA 3HJVA 3CVKA 3I9V9 5E2QA 5ETSA 3MTJA 4LRBA 1JLQA 4F3OA 4Q0BB 5ETKA 2ZH5A 2DXEA 4RUHA 2CZ4A 3PIOQ 4KGKA 4CZCA 3BV8A 4FP9A 3K58A 1VQSA 2A6OA 2HYIB 2UUCF 2NSBA 1KTQA 3EZ5A 4ZPWR 5D77A 3UWTA 5ETNA 2AJ4A 2AGQA 3ETMA 1WG5A 1T11A 3C66A 2YWGA 5IWAJ 1RLCL 4U9RA 2H48B 3GIJA 4NYPA 2A6MA 4B17A 5E3CA 1C0UB 4WXOA 4LUBA 1S9FA 4DPYA 4YHHJ 2MJNA 1N5YA 1Q78A 2AEMA 4TLQA 1AZSA 1LFPA 3HKWA 3AJDA 2YQ1A 3CO9A 4AQYJ 4EU0A 3WIUA 3MEDB 3R7BB 3GYNA 3UCUP 2RE1A 1U1KA 1S4FA 3QAEA 3BYRA 5GADI 3SZ2A 3QRRA 3FSYA 1T0TV 2V6AA 1PYSB 5EUHA 2E7VA 3KG0A 3KLFA 4N41A 2E9TA 2LCWA 2MZ1A 4BWMA 2YKOA 2OIHA 3PCOB 4ECTA 2ZH4A 2VL1A 1G7CB 1VFJA 2C2RA 3TO8A 3J81U 4QBUA 2VKZG 2ASJA 5CQGA 3HZEA 3HHDA 2R7SA 3M6XA 5HI7A 3EVOA 2GIFA 2UU9J 2HG4A 4J9NA 4DG1B 1VJWA 5AXKA 1UVNA 2WB4A 3R7SB 2XLJA 3HSDA 4RW8B 1OSCA 1RCXB 4DR7J 1YBTA 1Q8BA 2I6WA 1H2VZ 3NXZA 2RMLA 4AE5A 1VRUB 2J0SD 5KG6A 1RTIB 4LMZA 4ELTA 4ZP6A 2OD6A 1DHMA 4PXDA 4DV0J 2QLWA 1UJ4A 5KFTA 1JKHB 4HL9A 2LA4A 2D41A 1Y5IB 3VAFA 4PG6A 1X9WA 3JQJA 4PXEA 1GEHA 3CXCR 2VQFJ 1LK7A 2ABYA 1UVMA 1DTTA 5DRKA 3SEOA 2HRYA 3O3LA 4Q44A 2PDAA 4B9SA 2CADA 2H3EB 1ACMB 1Y9OA 4CYUB 1JXVA 3HVTB 1CJTB 5A6WA 3H5XA 2HVDA 1SJ1A 4Z7CA 5FDLA 4OX7A 1S1XB 4CLFA 3M8PB 5ETLA 2FHJD 5JUMA 5AJ3J 1FE4A 4P7VA 2ATLA 3N6LA 1S7HA 1LXJA 1I94F 1SH0A 1L3SA 4F2RA 5C2GA 1FRMA 3D68A 4X65F 2MLYA 1EB0A 5LXRA 1VQ9S 1V6HA 1FESA 1FT8A 4K4TA 2MKSA 2OPQB 2B5JB 1UPMB 2GVZA 2BMBA 4XTTA 4R5PA 4DUTA 1N88A 4JBCA 1WI8A 4DS5A 2EC0A 1WC6A 1FVQA 4NLGA 2J6SA 3C6UA 1UW9A 5DM6Q 3HJFA 2OD4A 2CQ2A 3S1TA 1IR0A 2DY9A 1EIYB 4F8RA 3D1HA 1X9MA 2FZKB 1CS4A 4YB1P 3H40A 4WIIA 4C8LA 8ATCB 4UOHA 2XG8A 3DLLQ 4WZMA 2HVHA 3M2RA 2BACA 3W9HA 3NS7B 1HIYA 2XBPA 3QMQA 5CHCB 4P73A 3Q2TC 2DHHA 5J2PA 2ZZNA 3KUHA 4GMKA 3EPIA 1MMDA 3QRQA 4I1TA 3AHPA 3QT6A 5IT4A 4MK8A 4KO0A 2XS2A 3WC2A 1C0TB 3T6JA 4BHQA 3DMJB 4IG0B 5D78A 4WK1A 1JWWA 3DRSA 4OYBA 4Z2XA 3CCLS 4LF7J 3B54A 1QTMA 2YNHA 2Y1RI 3G6XA 1N33J 2E1MC 1IM4A 4XO0A 3L09A 3IBWA 4ER8A 3ZZPA 2KFZA 4B9NA 2F1FA 4USIA 4X2BA 4LSLA 2HQCA 2F9DA 2B6AB 2Z0GA 3MHYA 1WC3A 1NDKA 4B3RJ 5IC4B 3D3BJ 4FBTA 1S0OA 5CCMA 3OFEA 4DR1F 2R7UA 4KBIA 3GJRB 1R8HA 2HAFA 2C2KB 1HQUB 2DKOB 3AXKA 2QJ3A 3IR6B 1F3FA 3H42A 5EWEA 1Y4ZB 4KGVB 2JVOA 5K20B 1RT1A 2QYCA 4QWDA 3O2IA 4H4OB 2KFYA 2KHCA 4KV8A 4X84A 4HVZA 3O5TB 1WC5A 2FIUA 2R8GA 3I0RB 3TA0A 3FCHA 5F9NA 2VFTA 1HQ2A 2LVWA 1FXDA 3C3LA 2KJWA 2XWYA 5F8JA 3OTBA 5IV3A 1A7GE 1IJFB 4M63A 1T9YA 3JAMU 2JH3A 4ICLA 1QD1A 1CQNA 2WOMA 2PGCA 1S99A 1P8GA 2R8JA 4R0EA 5K14A 1RBLA 2IYGA 2YWKA 3J7AN 3ENVA 4O0NA 3GFXA 1X4AA 2AX0A 1NZAA 1VJQA 2XNQA 1JJCB 4RU2A 2OJ3A 3FZ2A 1Q8LA 3QSIA 4G3IA 1NNDA 2YXLA 4X64F 3HCXA 4QW8A 5KFUA 4KSEB 2GV1A 4QWEA 2DY1A 1RT3B 2VG5B 1EKRA 4M5JA 1PKUA 4IO1A 1MN9A 4RW9B 2KYXA 3Q2SC 4OI0A 4X4SA 1FJEB 1D8YA 3F44A 1S9GB 3OTOF 1SC3B 2CNNB 3O8WA 2BBEA 3CCQS 1DFDA 1SJRA 4DR5J 1HNIA 1PYTA 1B0TA 1ZH5A 3H20A 1F2HA 3MAHA 2UXBF 2ASDA 2JVRA 5ETMA 2W9CA 1ZPVA 3MR2A 3CMQA 3DRYA 3K2YA 3OR2B 2F8EX 5AE1A 4K59A 2RS2A 4KFBB 3TA1A 4ZCIA 1P1LA 4UW2A 2VQEF 4K0KF 5HMZA 4FBUA 1CC7A 4DQRA 3Q89A 4DX5A 3POTA 3BH7B 3M8QB 3TJAA 2E5JA 1XJWB 2G2YA 1FJGJ 3MMBA 2MGZB 1Q4RA 2POKA 1RZMA 4WTYA 1FKPA 1VR6A 2KRBA 4DQIA 4RUCA 1HR0F 4QQBA 1FRKA 4Q43A 4J9OA 4M94A 5KT6A 1MWYA 4JV5J 3HM9A 3QJLA 2M3DA 3BSAA 2X1GA 3LALA 2V63A 2E9RX 1LWFB 3MMAB 5DGAA 4LSNB 4U8VA 3GG1A 4LFCF 1FJGF 3PRBA 4AXIA 3GCWP 4DV5F 1IKXA 1S97A 3N5BA 4QZVB 3SYZA 1KVIA 3ADAC 2RAQA 1LK5A 1RISA 2HBQB 3F0NA 4DX6A 1ZM2A 1L3UA 2OGUA 2AYGA 4WE1A 2LKZA 1TUVA 4C7QA 4M5LA 4DR4F 4PABA 2W24A 4IKAA 5HVHA 2NLWA 4NCGA 3HDSA 1YTYA 2YWWA 4LFBF 3U1NA 3CNQP 4O44B 3OBIA 4OIXA 1SCJB 2ZITA 4OHYA 4OZNA 1HI1A 3GJTB 4DL0C 3D6HB 1VYAA 3IS9B 3QJPA 2ZWOA 1SV5A 2WB1D 3V81B 4W4MA 4WFAQ 3GQCA 3FBFA 3TAQA 2FLOA 1URNA 1PBUA 1B4SA 2CPXA 1CULB 4LF2A 5LJ3Y 3LO3A 1VQLS 3HHLD 1RTZA 4KPCA 1VQNS 4WFNQ 1RTIA 4Y65A 5F8IA 2IPOB 2P9CA 4X4VA 3T3FA 4Q2LA 3S6EA 2XMJA 2XS7A 5DS7A 1JLBB 4JI7J 2P5VA 1P9QC 2EK1A 3D3CJ 3M2VB 2WSEC 4JYAF 4R8UA 4LR9A 2W8LA 2UXCJ 2H4WB 4WXWA 2QYGA 1U47A 2DNZA 3UCGA 1TK5A 1O6XA 2Y1IA 2J76E 5KFCA 1SKRA 2WVFA 4NLXA 5GAHI 4JI7F 2B9WA 5IOLA 4DCJB 1HBOB 4WFYA 2CWXA 5DDQC 1ROFA 3CIZA 1SJFA 4W90B 2G13A 2UXCF 2V2KA 4ZJQA 2HLUA 3ISND 2UVVA 2HWIA 3TW0A 1N48A 2EFPA 3TRGA 5E33A 4O4GB 3E3XA 3PEJA 2XGPA 4ATNA 1UETA 1TMMA 3W8PA 1X5SA 2IBOA 1TKTB 1IR2A 3BGRB 4URQU 3HHNB 3HD1A 3IM8A 1SQEA 1HA1A 3KLEA 2AJ0A 3H2LA 1Q79A 5L1JA 2D3ZA 1OY6A 2G0IA 3KWMA 2VBYA 2GQCA 3M4XA 4K5RA 7AT1B 1NZ8A 2RIJA 4YR2A 5DZ6A 4C8KA 3GMGA 3ZC4A 4YOEA 1F0XA 2VASA 3JTOA 1N32J 2ZBIA 4RNNA 1J2VA 3PRDA 3VQTA 1H3DA 2DD8S 3G8SA 3OXFA 4CM0A 2M0GB 1R7IA 4EYHB 2LA6A 5ETVA 8RUCA 4TQRA 2FJBB 4NRUA 1R43A 4DPTA 3P5TL 5JVGQ 1T05A 3W8GA 1RTJB 2W7PA 3DXSX 3MEEA 2QMUB 2XZTB 3N9UC 2D3OR 4NX9A 3MGJA 3BO4A 4NZ6A 1RWUA 1VQOS 1JLAB 1CEZA 1TV6B 4PQUB 4LF1A 3ITHB 2ADCA 2E1PA 3HK2A 3VGSA 1B7FA 1V3ZA 4JI2J 4F4AA 3MFHA 3PHTA 3TJ9A 3AY0A 1WHWA 3VV2B 1NKCA 1VRTB 4U7UD 4YP3A 3EZUA 4JI0F 5HJYA 4NMXA 1FFGB 1RWNB 3NAIA 3DGVA 2GFFA 1UWAA 2XY5A 1M90T 4GVBB 3A3OB 3OFGA 3T1YF 2XSFA 4IQXA 2R2UA 2P9EA 2AZ1A 3I96A 1JK9B 1WG4A 5E3QA 5B09A 1M1GA 4JI4F 1N0UA 2GQ2A 1NXIA 4MT1A 3R6LB 3G8QA 3RGIA 2MQ8A 3QWPA 2CRLA 1AA1B 3CB4A 3AXMA 2KG0A 2IA0A 1M5KC 2ERRA 2FVPA 4DX7A 3HF5A 4DU7A 4HDGA 3VAGA 1U8SA 2DGTA 2PC6A 1XTZA 4KKOB 3WC0A 3H2VE 4OZ1A 4J91A 2GAGC 2BVZA 5HQMA 4C8ZA 1ELOA 4DUZF 4C4WA 3BS9A 2IVMA 1Q7YT 5F8MA 4B3MJ 4DL3A 4OV1A 4JI5J 3MMCA 1HBUB 1M1HA 4P2XA 1ZAVA 4MFBA 3TQEA 2V68A 3BEGB 1LOUA 4K7QA 2EBGA 1YJ7A 1ZZNA 4RPFA 4J9SA 3RB6A 3W3SA 4ZOSA 1OY8A 2F5GA 3DNCA 2NS1B 1JLFA 5FIIA 1K0VA 1TELA 3JYTA 2W7AA 4KPYA 3TJ8A 4IDKB 3AA9A 1RYSA 3GONA 2EFNA 3GTYX 1ZYQA 4U7UK 1SKUB 2B4UA 1WHXA 4A8WA 2DEIA 3MUMP 2UP1A 3SCKE 3HHEA 2D3UA 1U45A 4LJMA 2RDJA 3D66A 3ELHA 2IHR1 1YDLA 1LWEA 1NJXA 1U6FA 4TY8A 4WU3A 4O0IA 2X51A 4LT6A 4UUXA 4YB7A 3LPEA 2CIMA 4BLGA 2NYHA 1ZM9A 2QL5B 2QEXS 2XNRA 2CFXA 3OR1A 3M30A 3P3DA 1YG0A 4L75A 4ZVTB 2O67A 3I31A 3GU0A 4RNOA 3MM8B 3NCPA 1EQMA 2RU3A 2UUAF 1K44A 3W2VB 4GC7A 4GKJJ 1J5EF 2DGSA 2HVEA 5KFSA 1QE1A 4FDFA 2KZMA 2DH9A 1S1VB 5CCLA 3JXOA 2IM2A 3ZZYA 3W64A 1RAAB 3P45B 2RKIB 3UD4P 2QT7A 2XS5A 4PCQA 1S0MA 4J37A 4A47A 4L3NA 1TK8A 1OPIA 2EEYA 2QA2A 4X66J 1GNKA 3MECA 2A3JA 1C1CB 2VZ9A 1NHUA 1LW2A 3NNCA 2E7XA 4X4OA 2A2CA 5B0BA 2ZKTA 2BKNA 1UFLA 1T9TA 1NSQA 5L46A 3SCJE 1T8EA 1WKLA 2B7BB 3QQCD 3QBCA 2HFVA 4CLPA 1UKUA 1IBMF 3KHRA 1HI0P 5T7LB 5J1EA 1ZAXA 2HZAA 2KM8C 4HHUA 2HWTA 3NNAA 1KHWA 4ZLPA 2H1YA 3OUYB 5SZTA 4QWCA 1JJ2R 1UFKA 2YH1A 2CQDA 2XEXA 5IM0A 5D3GB 3PW2A 2PI5A 1XR7A 3PM9A 1FTRA 3GP9A 1FKOB 3QJJA 1H72C 2FHMA 4TLRA 3IAM9 1BWVA 5DM7Q 4DR3F 2GCFA 3I4PA 2JEFA 5DZ7A 4IOBA 4ZVPB 1VQMS 2CJXB 2Y0SD 2XMMA 2NUUG 2QA1A 3LP0A 3IGVA 1HQEB 2BW7A 4E8UA 4MKBA 5IC6B 4CLSA 1RA6A 1ZS6A 4DF4A 4OFZA 5B08A 1K47A 3W65A 4DQQA 4L3KA 2DCLA 2JHEA 3V81A 2YWFA 3OT9A 1UWBA 4LBIA 1R8AA 3KHHA 1VCTA 5HP1A 5A8KB 2E29A 4OHVA 3KMQA 2BUNA 3D6FB 3OVSA 2HK3A 2W8KA 1GK8A 3DCAA 4CO1A 4RUAA 1XIQA 2IM0A 2CJQA 3OL8A 2HFZA 3CEDA 1WSVA 4U8YA 1FRIA 4QIGA 3GFYA 3IAS9 4D3HA 2VKRA 5LMNF 1Q95G 1KVJA 3V4IA 1FX2A 5KFPA 4NLPA 1FI4A 4GVLA 4OZJA 2MLXA 1S6PB 2QSFA 1KLMA 4K2XA 3DI6B 1YWXA 2GJIA 2CQGA 2EG1A 1FRHA 1KOOA 1J5OA 2R7TA 1PC5A 1WD6A 3V6HA 3L4BC 2RS8A 4LF6F 1MU2B 4DFPA 4DFJA 3G6ES 4JI3F 3R3TA 2DNGA 4I2QB 2M4MA 4LBPA 3KDOA 3MD1A 4FNIA 4I2PB 3HKZD 1GXUA 3ZZTA 2HEKA 3V6DA 2MQQA 2JRSA 5LMUF 1LNQA 2H51B 4RJVA 1RT7A 3DOKA 4F2SA 4W98A 1N8RT 4P9SA 3UDCA 4ECZA 2ALYB 1X5TA 4B3OA 1IKWA 2BKOA 3M2UA 3R27A 1F1BB 1S6QB 4BS2A 4AL7A 3CF5Q 2J8SA 1QSSA 4B9UA 2FB0A 4K4YA 4M5KA 1EHWA 1U02A 2LXUA 2PFDA 5B7WA 3PO4A 4FYYB 1WORA 3TZXA 4CDIA 1WTFA 4CO0A 3LP2B 1TUGB 3Q8YA 2YNIB 3RJMB 4FXDA 1ZAWA 4ZPAA 3AB4B 2VBWA 2IY5B 1RXOB 3FUYA 2ZH1A 3G86A 3MAQA 4URGA 2Q1LA 3RR7A 3X1LB 2HNDA 3C2PA 1B64A 3N6NA 2CKWA 4ANDA 1R6YA 2Z8QA 2IMOA 3IRXB 3MF5A 2ZDOA 4ETXA 3J80Y 1M5HA 4O4RA 2IMWP 1HNVA 2AJ1A 4FKXA 3QZ7A 3AOCA 3C8YA 3C15B 1F5CA 1VHIA 3BJYA 3T9ZA 4ZP9A 4ZVEA 2M88A 1VK8A 3DLGB 2G2ZA 2YKAA 2CQBA 2V0NA 4EFAC 4X62J 1X0FA 3RU0A 4B3TJ 1OSDA 1Y11A 4JI6F 3QT5A 3CUNA 3CJ0A 1W7WA 2U2FA 4UT4A 2LQBA 4QPXA 2HHXA 2MQPA 2AKWB 3KNAA 2JLEA 2DGVA 3ZTRA 1QSLA 2VJUA 3UN3A 5FD1A 4ED0A 2MZSA 3R6GB 3EX7B 2Y0BB 1KKHA 2V69A 3ISZA 3M8WA 4LVNP 3G96A 3PV8A 4JI1F 1H7XA 1KDNA 4OJ3A 4I64A 3DDNA 1PBAA 4TU7A 3DGPA 5LL6d 4ZCMA 3MAAA 3HHLB 4DS4A 1RT2A 2CQ3A 1LKZA 1K73T 2MDAA 4QYZK 1S59A 3W7BA 2ZKUA 3PX0A 4ZLLA 2I5JA 2FY8A 5M2PA 3Q8UA 4DV6F 2KTQA 3PTWA 5BR8J 1FK9A 3BQ1A 4GKKJ 2AP6A 5EGYA 3NMAA 5T14A 2HRTA 3I32A 3EM1A 3GJQB 4ZK7M 3S8SA 1R3NA 4ED4A 3WIVA 5T41A 1EETA 1RT6B 5K8NA 2GIRA 2DR9A 4NXNF 4YY3F 3CDUA 5LSRA 4YUDA 2MHNA 1BGXT 3AD9C 3C6TB 4NLWA 4ECYA 4QYZJ 2R7QA 4DV1J 4H4MA 3KXDA 2FUG9 2WONB 4I6AA 1JIHA 3ILLA 3UVJB 5KFLA 3PDNA 4J90A 4GRSA 2ZZTA 3DYAB 3RUBL 4C3LA 2C2DA 1B99A 4KE5A 1C1BA 3O1LA 4DL6A 3SDEA 3RBZA 1I3OB 2DR8A 5IQ6A 1JLEA 1IBLJ 2KG1A 1HBMA 3VWSA 2FPHX 4A8FA 2AX1A 3W62A 5JVHQ 4CTAB 3I0SA 2C3OA 2VG6A 1RKJA 1KLNA 2ILYA 4DSLA 2DCUB 1X9SA 3DXBA 3NCRA 4NZ7A 4LRAA 1N34J 4DSEA 4LF9J 1JNRB 2VICA 4DBQA 2R2SA 4DL4A 2J6UA 1VBYA 5H9EK 3KK1B 4DZ6A 1MSWD 2W01A 4OI6A 2W9AA 3C14B 1AROP 2EK6A 4OV6A 3T5JA 2L08A 1NO8A 5A2QY 4PUOB 4A4JA 3K17A 4Z7YA 3D7SB 5CYMB 2V4JA 4ED1A 1FXRA 2XSJA 3LANA 3EVWA 1R0AB 1WOSA 4ZPCA 2XY7A 1T03A 3V6KA 2RF2B 2JFKA 1I5OB 3TOQA 4R25A 2G4BA 1S1TB 3MM9B 3KKFA 4LF8F 1PSDA 5JXSA 1S7IA 2CQCA 2XZDB 1DQ8A 2CXEA 4A8KA 1FNOA 3RRHA 2BZ2A 5E0OA 1SUQB 3FDSA 1KHVA 3D67A 2P6SA 5C5JA 1BMQB 2EG2A 2J5AA 1PC4A 4LFAJ 5I3UB 1MROB 2ZUAA 4K5SA 4UOGA 2PE8A 3Q8RB 1RT5A 2MKHA 1YRTA 1G3OA 1NB2A 3FEYB 3FFIB 1RTHB 3FBBA 4FVMA 1TKXA 4G1PA 1S72S 2IRYA 2R9LA 4G1IA 5L9XA 1HARA 3D1QA 3H5UA 3FVYA 1D9DA 4JI8F 4F0KA 4YB5A 2CWKA 3U1MA 2N3LA 4C98A 2YWHA 3BF4A 3L9ZA 3QWUA 4FKYA 1NK6A 1BE4A 3HULA 4NEYA 3BKUA 1TAQA 1EARA 2VPYB 3HI9A 1HQEA 4NA3A 4WFXA 4QW9A 2D69A 2OPPB 4NLUA 4QWAA 3FBEA 1FEHA 3ENWA 2VDHA 5M2RA 1WC1A 4PG4A 1F9FA 1JLQB 1TFYA 3KUGA 2FJDB 4ZVGA 2XY6A 4PYDA 1B0PA 3MUTP 4ED7A 4RBUA 4OYZA 3L7UA 3OL7A 1B0VA 4BWJA 4MJKA 1RABB 5C25A 4ZPBA 4OHXA 3MM6A 4K4SA 1QM9A 2I2YA 4J9VA 4NLOA 3ILJA 2LDIA 4NYOA 3HVAA 5D0RA 1S0NA 2PSZA 1O51A 3SCLE 1JLGA 3FKBA 4BBYA 4AUKA 2K7JA 4BCAA 1FE0A 4O3QA 3DM2A 4OMFG 2CPEA 3TA2A 1L3VA 1GXLA 3N79A 1X4EA 4MKAA 3GILA 2XMAA 2KVQE 2K1RA 1OPZA 5CXTA 5F41A 2IC3A 3BDPA 3PJ9A 3ZZUA 2FYXA 1PG5B 3QPIA 1N5YB 3AD8C 4QOTA 1AZSB 4ZIVA 3G2XA 4A46A 5KG3A 3LA0A 2ASLA 1WC0A 5KTQA 3OFHA 5IT9U 4KT0C 1NJYA 2W2QP 3GFZA 4P7TA 2EFOA 2E5LJ 2V94A 4I2QA 4ID8A 3MI7X 4DSFA 1HW9A 3L7PA 3KLFB 5KT2A 4YR3A 3AODA 4ECQA 3KTQA 3SMZA 4C0BA 1T9UA 3OVBA 1HWLA 2QLFB 1RWMB 5CD4A 3QLHA 1RADB 1U0SA 3FCWA 2UXDJ 1GX5A 1QAIA 3K89A 4EK2A 1S1UA 3NWGA 3AA8A 5J2NA 4O3NA 4DR6F 1UVIA 4TY9A 1GX6A 2BE2A 2DGWA 1U2RA 2M8HA 2YX4A 4CH0S 2DR7A 2V9KA 4RBVA 2UXDF 1U4BA 2V8PA 2ZM6J 2BJ8A 1RAFB 2R2TA 4EZ6A 2RRNA 3IR5B 3MWBA 2CJYB 5KG0A 4QR1A 3D1OA 2Z56B 3K5PA 2CG4A 3GLJA 2OELA 2ZFHA 1U6BA 3PEHA 1DTTB 2YNGA 1ZTTA 2VFUA 2ZDPA 2QGFB 3CSKA 5HROA 2HHHJ 5CD4H 1YJTA 4A8QA 4ID5A 3NBPA 3UD3P 1JNZB 1QVGR 2K2PA 1XMQF 2R7RA 4HDHA 3IRXA 4ES3A 2BANA 4L72B 4J9MA 3K59A 2OP5A 1NK0A 2E5HA 3J81j 2EFVA 4DV3F 1BQXA 3OPKA 5FDLB 4HACA 1RE1B 1V5VA 2P8IA 1RBAA 4C48A 2Y1LB 2OH2A 1TL1A 3I5AA 2BRLA 1MMNA 4OYIA 1F9HA 4ILLA 4C8MA 4YDXA 2GHPA 4H4KA 4CWBA 4WJBA 2B56A 2B8PA 2I8EA 1UCNA 2BR0A 1Z2ZA 1TK0A 1L5UA 3ZTPA 2XMVA 2DNHA 1IBKF 1YZ7A 1KC8T 2AW0A 2GVZB 3M8YA 4UZCA 3A8JA 1CJUA 4R5PB 4JV2A 4TYBA 2FLNA 2ZBPA 2WK4A 4PG7A 3TVYA 3C6UB 3NGSA 2B8QA 1N36J 1RDRA 2OI2A 1M0SA 2OPRA 1CS4B 3UDLA 2AYMA 1KQFB 4EYIB 3BN4A 3PW7A 3J7Z5 3ZNJ1 3W2WA 4IRKA 4H4KC 3M2RB 2M70A 2OSRA 3RBDA 2FQQB 4XIUA 5GAHU 4N5SA 2JSXA 1IKYA 1WKJA 2HWHA 2LU2A 3PFEA 3THTA 1Q82T 5J2PB 4LF5J 1I6JA 3B4MA 5FJ4A 4CLTA 1UAWA 5L9NA 2F63A 4NASA 2B0GA 2V2ZA 1N5SA 4ECUA 1ZZFA 2EKYA 3CDWA 4DV7F 4KO0B 2NR0A 2IIHA 3MOZA 2RD5C 3VTIA 3DRSB 4IRDA 4IOCQ 2F40A 2ROGA 4DUYJ 2YNHB 4YB6A 4RR5A 1WUUA 4K4WA 1D0EA 1R0CB 2MZTA 3KJFB 3UDEA 2XI2A 1DQAA 4WKRA 2V2VA 1R31A 3ZNUA 5K8PA 3BBCA 4C0HA 3OXLA 5HANA 4LSLB 1NJIT 2MQLA 3LUYA 4IFYA 2BOPA 3FMWA 3BKTA 3SQGA 1HNXF 2OFHX 3N6MA 3DFEA 3NY0A 3C16A 1DURA 4DL5A 2GGPA 2H5JB 5KFNA 3IWXA 1SL1A 3CT9A 1DY3A 5B0GA 1T7PA 4QCLA 2Z58B 2XLKA 5HVFA 3BQ2A 3IFEA 4KV8B 4X4PA 4X4RA 3M9NB 1U1QA 3MCSA 3V5RA 3NMRA 4KQZA 2DNRA 1YBAA 3Q0AA 3RBXA 4FS1A 1NDCA 1RA7A 1ZA1B 3H0PA 5B0AA 1H98A 4DSKA 3FQKA 5U47A 3KHGA 4NLVA 2ZOGA 2AD9A 3VAIA 2DR5A 2WOMB 4NA2A 1U0HA 1H0HB 1IKVA 3VHQA 1SIWB 2CPHA 2D1CA 3NWRA 4CLZA 3BGUA 5K14B 4NLQA 1CJVA 2V8HA 5F8HA 2V34A 2NPFA 1VHFA 2IJFA 3M9MB 2FZCB 2G2OA 1U8WA 2ZHAA 2ZH3A 2D74B 2UVWA 2VC1A 1YGYA 3NCQA 1VLYA 4M1KA 1T3NA 3VZHA 2GHWA 2DT9A 3E8OA 5I3UA 2P9GA 3FJ2A 3WDOA 4OI4A 3ZO7A 1QJHA 3KYLA 1DQ9A 1KSPA 3CWJA 5F0UA 2AGPA 4KHPF 3KLHA 4USUA 3P49B 3FK4A 3CPWR 4YEAA 5L1LA 1BWEA 3FSIA 1XR5A 4O3PA 1BQNA 1V3RA 2HHSA 2KRRA 5BYQA 3LWLA 7FDRA 4CNYA 3CDAA 5KT7A 3GR1A 4IQMA 1HNIB 4LIRA 3OD2A 1RAIB 3DOLA 3HD2A 4UY8T 3T19A 2NXNA 3FMBA 4M95A 1ZM3A 3MEGA 3NOCA 2FVRA 5EX0A 4HKQA 2CQPA 3T1HJ 1FRLA 2W9CB 5BJRA 1QY7A 1JXEA 2MY8A 1XQIA 1F5AA 1PJ5A 2MYFA 1FWLA 5A8RA 2LEPA 2YKQA 4USHA 3W66A 4DXLA 1HNWF 3POTB 3HVRA 4QIWD 5IT9Y 2KXHA 5J1NA 2WBMA 4TYAA 1D9FA 4V19X 2ZHOA 3SXLA 3MMBB 2VH7A 2HSEB 4I7FA 1FKPB 4B3SJ 1IQTA 5AXMA 1PIEA 2YTCA 3Q23A 2UUBJ 2W2PP 4OYXA 2IM1A 4OHZA 1TVRA 5I3PA 4IG3A 3IP0A 5MLCV 3I5CA 5KOWA 4HH0A 3T6BA 3GIRA 2DXDA 4PYAA 2OTLS 2H4YB 2ZNZA 3IO1A 1S12A 1NPPA 1SBRA 1IKXB 2O01C 4Q8FA 1RGVA 4XPCA 3IRWP 4F4KA 1FRXA 4DJBA 1WF2A 3ULHA 2LECA 5KFDA 1YI2S 2XI3A 3G82A 1L3TA 4KHMA 4QIFA 1VQYA 1NSAA 2CQ1A 5IWAF 4WE1B 5C24A 4XAKA 2DH8A 4XK8C 3HSJA 5E5NA 4NRTA 3TWZA 2DNKA 2PA3A 4YHHF 4FF2A 1PAEX 4AFFA 4NCGB 3RB0A 4ZVSB 2Q66A 4DR2J 1ULRA 5CAAA 4UY85 5F3TA 2PMWA 4AQYF 2UVUA 5HSPA 5KFGA 2QZ8A 2HBRB 4PAAA 4M5HA 1HW8A 1F9EB 1N0VC 2ZC4A 5DETA 3PYGA 3CC7S 2E1RA 3CD0A 3IGNA 3HP6A 5FLXU 1SV5B 4F4WA 3BSNA 5E7OB 4IR1A 4NLDA 3HSZA 1J27A 4C3KA 2MQOA 3FBCA 4ZPDA 2WRMA 3KFWX 3D6TB 2CPZA 4HEA9 5EHHA 3SIPB 1U6ZA 1RAGB 3FEXB 2FJWA 1S76D 2HQ3A 2AGOA 1OWXA 1JJHA 2F4VJ 1YJUA 2XB2D 2ZJQQ 2UU9F 2PMZD 1FFSB 4KHRA 1XNQJ 1E6YA 2M52A 2JWNA 1PJ7A 3ZTSA 4DR7F 3H98A 4R8UB 4ES1A 2YBVA 1HPZA 5KFMA 4ZN3A 1HWJA 1AUSL 1AYEA 4ZA1A 3CW2C 2MKYA 2B4VA 4M5DA 5CA5A 1QUPA 1C2PA 2IFXA 4ZHRA 2ZZMA 2E7WA 4DV0F 1UPPA 3MD3A 3BQ0A 1RKIA 2BEFA 3THPA 1NSKL 3CJ3A 4ED5A 2ZH9A 2VQFF 1R27B 2OPSA 3PKYA 2L9WA 1QUVA 2LQ8A 1EX8A 4E98A 1SQFA 2A18A 3KLEB 3DLKB 2YKMA 4NEZA 1X4GA 3D28A 2DRAA 4F04B 4AL6A 3QATA 1NDLA 5AJ3F 3Q8VA 3UO0A 2RDIA 1RHJB 4NPOA 1W25A 4YDDB 3DU6A 2R3VA 2E5GA 3DLJA 1FX4A 2VU5A 4MIAA 3IBFB 2BDPA 2U1AA 3CCRS 4LRCA 4RWXA 2EW9A 5A6PA 1IN0A 2VFVA 3TX0A 1CVJA 2BYCA 2FHOB 4I67A 1TP7A 2LFVA 3I55S 5LXYA 1GT8A 1U25A 3EXCX 3QFHA 1M5VC 2IYIA 2DO4A 2JX2A 2C2MB 1T05B 2ILZA 2ZVIA 1TMJA 4I6WA 3R97A 1GAOA 3MEEB 3P8BB 1UVLA 3UW1A 2FVQA 1FEEA 3TZYA 1P1TA 2LQJA 3A8KA 2CQ0A 4WZQA 3CJ5A 1HD0A 4KY3A 4J5OA 2H65B 2G0JA 1I1GA 3V4MA 2XMUA 4ECXA 1KD1T 4KH1B 3RRGA 2LDYA 1Y10A 1S77D 1MN7A 4R0JA 3OL9A 4N47A 5DJBA 1VDHA 3N5FA 2PIIA 1NUEA 1I51B 4Y2MA 4AL5A 4NLTA 4CQ1A 3M32A 2OMOA 1GTEA 1KNZA 3ETOA 3GZ7A 1CLFA 2ZH6A 2ZH2A 1MNEA 5F8LA 4USWA 3M1VA 2Z2YB 1X31C 2W9BA 1JLCB 4LF7F 1HHQA 2ZD1A 2CPYA 1FTCA 1N33F 4KGMA 3B82A 4MK9A 4UQTA 4XPEA 5DDRC 1VIXA 3GB0A 3G9CA 1QLNA 1S49A 4EI2A 1NBEB 4PR6A 3GCXP 4F7VA 2P2CB 4ANCA 3AOAA 4B3RF 1WDTA 4ZVOB 1RWWB 1NU4A 2EC2A 1REVA 3UR0A 4CO5A 1S57A 1K1SA 3VGTA 1TU0B 3ET6A 1N6QA 1BY9A 2HNYA 4P75A 4NI2A 4YS2A 4K4VA 2J7WA 1Q8IA 3BDEA 2V9WA 1XEZA 3LW5C 4RNMA 2LLZA 5KT5A 1KFSA 2VOPA 2LQ9A 2EVZA 3MMCB 4MFBB 3K8VA 3AB2B 2MHEA 3KK2A 2R7WA 3DOMA 2JDJA 1CJKA 4FNHA 1GMWA 4Y0FA 2EFGA 5DQGA 4NXMJ 2M7SA 2BA9A 1S0VA 2FD2A 1NJZA 3DDKA 1JLFB 5E3RA 2COLA 2GVDA 3JYTB 2GZOA 3CCWA 3VCDA 4LR7A 3GPAA 1SVDA 3GV5B 2W4DA 5AT1B 1VRQC 1S9EA 3KJVA 3TZWA 3WBZA 1YBUA 4HT5A 2UUTA 5KAKA 3M6VA 3G6YA 4DLEA 2VJVA 3TYTA 2DBBA 1LWEB 4TY8B 2H9ZA 4QR2A 1KRPA 3EJMA 1PILA 3SCIE 4FXVA 4Z37A 3W60A 2QL7B 4Y2KA 3T1AA 4K4ZA 1NKBA 2ZE2A 4PWUA 3OR1B 3M30B 3WX8A 3CD6S 4PEOA 4FPRA 2J0WA 1RWPB 3SV4A 5F0WA 2V5HG 4IFVA 3MCNA 3J7A1 2HS4A 3NP5A 3TAMA 2RB7A 3CCVS 2KM8B 1U1OA 4DR5F 5HMYA 1QE1B 5M2UA 5BYRA 5E3AA 1T02A 2X7IA 5KOXA 3TP2A 4OI3A 3VAHA 1D3WA 1WDDA 2RJZA 1NJWA 2NXCA 4I68A 3T41A 2VG7B 1XC9A 1LWCB 4F0HA 3D54A 1TKZA 3MECB 3I82A 2Y8WA 3GSDA 4NLYA 3M6WA 1LW2B 2FHKA 3CULA 1YLXA 2CZ9A 2DGOA 3BKFA 1JJ4A 4DV2J 3M05A 1BUXA 3HFZB 3Q8SB 4QJVA 3IN5A 2BKPA 1PGZA 2DRBA 1AT1B 1FCAA 1V9OA 2FC9A 2FVCA 1LFWA 9RUBA 2CQIA 1IJEB 1MLAA 5J1EB 4HLBA 5G0RA 2K7KA 4LRFA 2KXNB 3M8RA 2LP4A 1R89A 3W61A 5FLXY 3THVA 1YJRA 4DV4J 2RQ4A 3CD5A 1K9MT 4RW4A 1TL3A 5GAEU 1SH2A 1FA0A 3QAUA 1FDDA 3DRRA 4JV5F 2ZEJA 3CCES 1HYSA 3KLVA 4RNFA 3MPYA 4N8OA 4KGXB 5IM0B 4OYWA 4BC7A 2AHOB 2J9CA 2DHGA 3X3UA 4Y00A 1NHKL 2HMIA 3AT1B 3UNYA 3LP1A 2HQFA 3W9IA 2DTJA 2IDEA 1UJ5A 3ZTOA 5HVGA 4USKA 4ZJOA 3LP0B 2GHVC 4DPXA 3JSMA 3MEKA 1CG2A 1WTBA 3TARA 1F3VA 3O6QA 2GO9A 2M8DB 4TVAB 4NCBA 1UWBB 4IR9A 5EWFA 1FF2A 3P96A 5HP1B 1H7WA 1OMSA 3ZXWA 1RU2A 3DN9A 1D09B 4LF4J 1DTQA 4RW7A 2HQIA 2RT3A 4MH8A 3BR9A 4M5NA 4DL2A 3SSRA 2X1BA 2CDRB 1DLOA 2RQCA 3H90A 3UN5A 3PR5B 1UVJA 3CJKB 1YRUA 3R1LA 3VQSA 1XMOJ 1TL7A 1VC0A 4W92B 4OX9J 1OYDA 4OZ5A 2N4CA 5KFEA 3V4IB 2DIVA 1N52B 2HHTA 1Y3KA 2BE7D 2VUGA 1YKWA 4GC6A 1KLMB 2PI4A 3SI8A 1VC6A 3HMJG 1MWQA 2QV6A 5ETPA 1DBDA 1CBKA 4F02A 1J5OB 1Q7LB 1EP4A 1VC5A 4MKYA 4U67Q 1EKSA 2BJDA 4ALZA 1KP6A 2HGNA 3LGMA 3JQMA 3QT8A 5BYSA 4KC5A 7FD1A 2X1AA 3NRBA 3WQPA 4MMOA 4Y6IA 2MXYA 3NGDA 1UW4A 4PG8A 3H59A 3ICLA 5ETTA 1HHTP 1Q5YA 3DRXA 4OJ1A 3CO0P 1XNRJ 3TUJC 2YQ3A 3JS9A 4ETZA 3V6DB 5SUHA 3DLKA 3GFHA 5HBMA 1SB6A 4ILRA 3OQ2A 1RT7B 3DOKB 1HNZJ 2RUSA 3MM7A 3R5CA 5A0YA 1OY9A 4B3OB 1IKWB 3QO9A 3A12A 3M2UB 2UVRA 1P27B 3JQKA 1TFWA 3W9JA 2DNYA 3KJQB 2H54B 4OJHA 3V6JA 3OFFA 1WC4A 2DNQA 2C3UA 2KDOA 2SXLA 1WI6A 1RUSA 3VVTA 4F3QA 1VBKA 3NS5A 5DO2A 1BC6A 4ZS6A 2MLZA 1R0BG 2LMIA 2M5YA 3TVKA 1N32F 1FERA 2LQ5A 4ITSA 3VZIA 4LBHA 5EN1A 2EPIA 3IR7B 1NMEB 1S10A 4I0WA 2MEWA 2OEJA 3MR3A 2HNDB 5L39A 3EICA 3U27A 2B43A 2EI5A 5KFFA 3KLGA 4OZ0A 1TTHB 4TU9A 3TVZA 3NL0A 2ROPA 3HHKA 2YKNA 2CUYA 1S79A 2XULA 4ZJLA 5B0CA 2F8HA 1HNVB 1RWVB 2AYBA 2Y1JA 2KVIA 5J2MA 1B3TA 1YQHA 2BJ1A 3D0IE 3ILIA 4BC9A 2Z2MA 1RQ0A 1U1LA 5EWGA 1NPRA 2VOOA 2CYYA 4CCHA 2VHGA 3LGHA 3W1YC 3TI0A 1VK3A 1VGYA 1U1PA 1SJQA 4PZVA 1IWGA 3LPYA 2UUCJ 4JI2F 3CJ4A 1Y0HA 1RWKB 2IAJA 4ZVFA 1U7LA 1U26A 4P72A 1SKSA 1JLCA 4K50A 1SPBP 5IS2A 4WP3A 5I42A 1WG1A 1DAXA 3EWGA 2DHXA 4WBFA 1M1KT 2JL9A 4L76A 5HQ8A 2CDQA 1YJWS 2PEBA 3J80U 2DB1A 3DGPB 4X4NA 3HT0A 1IUJA 3MAAB 1NM2A 1RT2B 5B0DA 2HK2A 5CZXA 3PX4A 2F7VA 4PKDB 3BGLA 2GX8A 3E01A 2I5JB 4CLKA 2GC8A 1FO1A 1FK9B 2OKQA 2GIQA 2XO7A 2W2OP 5IV4A 1S1WA 5IQQA 1ZOTA 1A6LA 2ACYA 2MSSA 1SL0A 5CABA 1G2EA 3PW0A 1EETB 4FYWB 5HLFA 4LVOP 2C22A 3RR8A 2I9SA 5CYQB 2KXFA 2FC8A 3T5HA 4Q45A 3BR8A 2BJEA 1IXKA 3GJSB 1RACB 2XMKA 4Y28C 4EBDA 3JSBA 4B3MF 4H4MB 3TR5A 1RJJA 1XK8A 4PRFA 4JI5F 2XM3A 3CTRA 4JOUA 2OFGX 3EMTA 4PPDA 2XC9A 2FJEB 5LSOA 3P5BP 2C2ZB 1C1BB 3SDEB 3D0HE 1NRKA 3L95X 2DNMA 2CJ9A 2JLFA 1JLEB 1HBMB 2J7UA 2O66A 1RBOB 4HI1A 1EQ0A 4IOAQ 3I0SB 2VG6B 5J2QA 3CIMA 4EMDA 2KO1A 4QIVA 1RAOA 2HFNA 1BXNA 1TR0A 1N5VA 4UOCA 1FJCA 4NLRA 2OUGA 1NSPA 2DEJA 3FQLA 2HLTA 2CJAA 5D4NA 1APSA 1YX2A 2O5DA 1RT4A 3KLIA 2VPZB 1IM6A 2PFFB 4UOFA 2W4CA 3I6PA 3DC2A 4OJGA 1A9NB 2CPIA 2E66A 2V4JB 1FNXH 3NKYA 1KBRA 2WZ1A 2XSJB 2CPJA 3QGPA 2QLXA 3B8HA 3C19A 2K8GA 1X0PA 3EZOA 3F56A 3EGWB 2VG7A 1NH8A 1U1NA 1LWCA 5ADZA 1I94J 4TXSA 3ZZ0A 4GKJF 1T03B 3W63A 3JTNA 1TQLA 4H54A 5KG7A 2J9DE 5THWA 3H7HB 4X65J 3PW5A 2CPFA 4RO0A 2GAHC 2VA3A 1DZ5A 2R7XA 4AT1B 2W7OA 1T9XA 1D8ZA 4J9PA 1RHMB 3CCMS 3WHIA 2F9JA 4X66F 2N7YA 4WKYA 3BPDA 4LQ9A 3HLUA 1FKAF 4M5IA 2KZZA 3RW7A 1RT5B 3F41A 3K7RA 1EZZB 5A2QU 2QFIA 4ERDA 3I4HX 1TKXB 4N56A 2OSQA 4F67A 2GNKA 3DLEA 3R7NB 1JQGA 4TKTA 2VV5A 3QIDA 3SV3A 1HBNA 3N4WA 5C42A 2CJKA 1R8BA 2BJ9A 4RW6A 2UUWA 4EGLA 1RWXB 3US5A 1PAUB 4DF8A 4KJIA 4TQSA 3OJUA 2R7OA 2ZBQA 2HURA 1AUDA 4FYVB 4F4YA 1YIJS 3G87A 2DNOA 2OHDA 3QSYB 3I87A 3NGRA 1T94A 3D0GE 2DPIA 2VPWB 4C11A 4JV0A 5KFHA 4HR2A 2RNEA 4QIEA 2C42A 1RU1A 3RZAA 4MYTA 1L3KA 2C3YA 4C97A 5EX3A 2JZ5A 4IH6A 1VI7A 3AJ2A 5C25B 4LQ3A 5HMWA 5KFRA 3MM6B 3R8YA 2HVZA 1OQ3A 4OHWA 2LEBA 4RBTA 4UTGA 2NQPA 2ZH8A 3CJKA 2D9PA 1JLGB 4DR1J 1V3SA 1TUWA 3DM2B 3NLCA 3BSCA 2ZJRQ 1REGX 3C46A 4MYUA 5KFJA 2YNFB 3MM5A 2K1RB 2ZVSA 2IBKA 2DVIA 1N54B 2IC3B 2MY7A 2DRDA 4FPIA 3TZZA 3CCZA 1K8AT 2CQ4A 4ZN1A 2E5IA 2QO3A 3UD5A 4DN9A 5JMNA 1NB7A 4TN2A 1CC8A 4WYLA 1RB0A 2HNZA 4ZPVR 1VQ5S 1OO0B 1HMVA 3HFVA 5HJXA 5DG8A 4PXCA 2B9XA 4C9DA 3IMQJ 2XHCA 3FSXA 2AZ3A 4FVCA 2FJAB
chains in the Genus database with same CATH topology
3VF0B 1JLAB 3P49B 1CEZA 1TV6B 2LYVA 3GYXB 4C3MA 2VC0A 3CPWR 1DRZA 1VIOA 2IVYA 4PQUB 4XDDA 4YEAA 3PKMA 2NSCA 5L1LA 1BWEA 3PIPQ 3ITHB 2ADCA 3FSIA 4N8NA 1XR5A 4O3PA 3HK2A 3ZZOA 4DWIA 1BQNA 2HS0A 1V3RA 1B7FA 2HHSA 2KRRA 1V3ZA 4J9LA 3QLHB 1FDAA 1HL6A 5BYQA 3LWLA 3MFHA 5A8WA 3E01B 7FDRA 3NGKA 2YY3A 4CNYA 3CDAA 5KT7A 3GR1A 2QA4S 3AY0A 3N0VA 1BQMA 1RP5A 4IQMA 1HNIB 4LIRA 3B4DA 3K5LA 1WHWA 1S1UB 1SI9A 1S6PA 2JEGA 3T5LA 1HWIA 1NKCA 1VRTB 3DI6A 1VOMA 3DOLA 3ZZRA 5J2NB 4YP3A 3PW4A 3EZUA 4JI0F 3KHLA 4UY8T 4FS2A 3T19A 4ED2A 3FMBA 4M95A 1ZM3A 2C3PA 3OL6A 1KONA 3MEGA 2NUHA 3NAIA 2BQUA 4EBCA 3BREA 4DOZA 2GFFA 5L1KA 1E6VA 2BE2B 5EX0A 1S1WB 2XY5A 2FVRA 1M90T 5DDOC 4DSIA 2V4RA 4HKQA 3OFGA 4NWBA 5KG5A 3JB9k 3UNGC 3T1YF 1LV5A 4ZPTR 1URRA 1RTDA 2CQPA 2XSFA 4IQXA 3PX6A 2R2UA 2PO4A 1FRLA 2W9CB 1MU2A 1VQ8S 2P9EA 5BJRA 2BRKA 3CCUS 1QY7A 3I96A 1JXEA 2MY8A 4LIWA 1JK9B 2NZ4A 5HLFB 1F5AA 4RNHA 4N77A 3MR5A 1WG4A 5E3QA 4HI2A 5B09A 2MYFA 4E0DA 3MXHP 4JI4F 1N0UA 2GQ2A 5A8RA 4F50A 2LEPA 2VONA 4ZKAA 4CH7A 2YKQA 3DRPA 3SSSA 4USHA 4NZ0A 2HHQA 2CQHA 4I2PA 2NXUA 3G8QA 1HNWF 3POTB 3QWPA 2CRLA 4MIBA 1HI8A 4G1QA 3Q22A 3VAMA 3HVRA 4O3SA 3CB4A 2E44A 4QIWD 5IT9Y 2KG0A 2BW2A 2IA0A 2KXHA 3QIPA 5KT3A 4ECVA 2R7VA 5J1NA 2YNGB 3OSNA 1RI7A 3E2EA 1M5KC 2WBMA 1LXNA 2ERRA 4TYAA 3OLBA 2FVPA 1D9FA 4V19X 2ZHOA 3HF5A 3SXLA 5HROB 3MMBB 1FHTA 2VH7A 1WELA 4HDGA 3VAGA 4ID5B 3NBPB 1U8SA 2DGTA 2PC6A 2RRBA 4I7FA 1FKPB 1XTZA 4NXMF 4KKOB 1IQTA 1WACA 1M5PC 5AXMA 2YTCA 2YX1A 3P6YC 2GJ2A 5KFQA 3Q23A 4GO5X 3WC0A 1U49A 2IM1A 3CCTA 4OHZA 4D3GA 2BANB 1TVRA 3H2VE 4OZ1A 4IG3A 5I3PA 4PPZA 1RAJA 1X8DA 3VALA 2BVZA 5MLCV 2J0XA 2W25A 3I5CA 1S6QA 5KOWA 4HH0A 2QA4G 6FD1A 3T6BA 2XGQA 2JEIA 4C8ZA 4B9MA 1ELOA 1KFDA 4DUZF 3QZ8A 4C4WA 2OTLS 3IWLA 3BS9A 3K57A 2ZNZA 3IO1A 3K5OA 2IVMA 5J2QB 4OX6A 1SBRA 1JXLA 1IKXB 3HPOA 1Q7YT 2O01C 4Q8FA 5F8MA 3VR1A 3CDBA 1RGVA 2XWXA 3RBEA 4PWDA 4DL3A 4OV1A 4B9VA 1TL1B 4XPCA 2CPDA 5F9LA 2X1FA 3IRWP 5KFXA 2N82B 3MMCA 1HBUB 3U1LA 2MKKA 4F4KA 1FRXA 2RU9A 3UPFA 2O3DA 4DJBA 1WF2A 2V8VA 2AJFE 3ULHA 1ZAVA 2LECA 4MFBA 1KQKA 5KFDA 1Q53A 3BEGB 4K4UA 1YI2S 4NYZA 4G6VB 1LOUA 2EBGA 2XI3A 4CO3A 1ZZNA 4J9SA 3RB6A 3J7ZT 1T3OA 1L3TA 1K1QA 4KHMA 3FZBA 3LP2A 1RT4B 4ZOSA 3KLIB 3W3SA 2N3OA 2J6TA 4QIFA 1VQYA 3DNCA 2NS1B 3BN7A 2CQ1A 2YNIA 3TX8A 5IWAF 4Q0BA 1JLFA 4WE1B 5FIIA 5C24A 4XAKA 2DH8A 1K0VA 3JYTA 3VAJA 4XK8C 3CCJS 1Q1KA 2W7AA 5E5NA 2VB6A 4KPYA 2DHAA 5D4LA 4NRTA 4B9NA 3QGHA 4KTQA 4IDKB 2DNKA 2PA3A 3AA9A 3M6UA 4YHHF 1RYSA 2V4QA 4FF2A 2EFNA 4AFFA 4NCGB 3RB0A 4X62F 4F26A 2X3GA 1KQGB 2DPJA 3ONQA 4ZCLA 3KNGA 1QSYA 2FLPA 2Q66A 3BGFA 1CSJA 1ZYQA 4U7UK 4B3TF 2MZRA 2J0QD 3I56S 2KI2A 2B4UA 5KFIA 1ULRA 1WHXA 2ZHBA 1Y5LB 3K0JA 4A8WA 4UY85 3MUMP 2UP1A 4M8LA 2ZC3A 5F3TA 2KT3A 3SCKE 4AQYF 2UVUA 4K4XA 5KFGA 2QZ8A 3HHEA 3GIIA 1X7VA 3MOJB 2D3UA 1HW8A 2MJUA 1U45A 4LJMA 2RDJA 2AV5A 1X4BA 4IO9Q 2IHR1 1LWEA 1NJXA 1U6FA 2OPRB 1N0VC 2DGXA 2ZC4A 4TY8A 5DETA 4WU3A 1WNEA 1BD6A 1TL5A 4FF3A 1Y00A 4O0IA 3CC7S 2X51A 1WWHA 2E1RA 3CD0A 3IGNA 3HP6A 4RKUC 3MZIA 2HS3A 1SV5B 4B9TA 4LT6A 1MMLA 4F4WA 2XZWA 3OXGA 3BSNA 3OTEA 4UUXA 5E7OB 4O3OA 3IXQA 4IR1A 4YB7A 5D6GA 4NLDA 2CIMA 3J81Y 3W2WB 3DLGA 1C0UA 2EBEA 4C3KA 1ZM9A 2MQOA 4ZPDA 2PD1A 2A2DA 3JTPA 2QEXS 2XNRA 2CFXA 2WRMA 2WAQD 3KFWX 3OR1A 3MUVP 3M30A 2MSTA 1ZETA 2CPZA 1IKYB 3P3DA 4HEA9 3MPVA 5EHHA 3J7YI 1YJNS 1YG0A 2DK2A 1M5SA 2O67A 3I31A 1U6ZA 3JSRA 4DDFA 4RNOA 4YQWA 1D9AA 3MM8B 3CMAS 3NCPA 2RU3A 2UUAF 4DV2F 3L3CA 3FEXB 2FJWA 3W2VB 4GC7A 3MEDA 2HZCA 1J5EF 2C3MA 1F2GA 2DGSA 5B0EA 4DLGA 5KFSA 4OLOA 1S76D 2C28A 3SFUA 1QE1A 3HZGA 3WZ0A 2KZMA 2HQ3A 2DH9A 3AH6A 1S1VB 1VBZA 3D5MA 5ITHA 2DNNA 5CCLA 5BR8F 3G4SS 2GA7A 2AGOA 4DSJA 1OWXA 4GKKF 1JJHA 2IM2A 1YJUA 2XB2D 3ZZYA 5CYQA 2ZJQQ 2UU9F 2PMZD 4WYWA 3DLEB 1OQ6A 4CIOA 5CYJA 1BLUA 5GAGU 3TUZC 2GMJA 2RKIB 3UD4P 2QT7A 1KN6A 2XS5A 4PCQA 4YR0A 4J37A 4KHRA 1S0MA 1E6YA 4HT7A 2M52A 1HBNB 2JWNA 5C42B 1UL3A 4A47A 5DLGA 4L3NA 4DV4F 3H98A 1TK8A 4DR7F 1OPIA 1N5QA 4R8UB 3ZZZA 2BM1A 4RW6B 2MPUA 4ES1A 2QA2A 1HPZA 3S7RA 1GNKA 5KFMA 3KOAA 3HHLA 3MECA 1HWJA 3DLBA 2A3JA 1C1CB 2VZ9A 1NHUA 4ZA1A 1LW2A 4YFUA 3DHXA 2B4VA 1QAXA 2D7SA 3DU5A 4M5DA 5CA5A 4RX6A 1QUPA 3NNCA 2E7XA 4X4OA 1C2PA 2AJQA 2A2CA 2IFXA 5B0BA 2IM3A 3EYZA 1Z4UA 2ZKTA 4ZHRA 2ZZMA 1UFLA 2E7WA 1VQOS 4IH7A 4DV0F 3MD3A 3BQ0A 2HHPA 2R4FA 3SCJE 1FDBA 1T8EA 1RKIA 3MTKA 1CQMA 2B7BB 5KFAA 2WHOA 3THPA 4DV1F 1NK8A 3CJ3A 3OHAA 4ED5A 1TL4A 2QSWA 3PNIA 2HHWA 4IFYB 2ZH9A 2E9ZA 3RB4A 4IH5A 2VQFF 1GXTA 1UKUA 2J9EA 1UFWA 3BB5A 3SQGB 1R27B 5GAEI 4C11B 3IA0A 3KHRA 2KKHA 1IBMF 1HI0P 1LW0A 1GTHA 5T7LB 5J1EA 4CH1A 1ZAXA 4EZ9A 3AAWB 4DG1A 2DHSA 4P6QA 1VQ6S 2OPSA 3QGGA 1ZBTA 2KM8C 4RW8A 3PKYA 4J9RA 2HWTA 3NNAA 2GGPB 2L9WA 1KHWA 4ZLPA 1QUVA 2Q79A 4C2MA 3GWCA 2FGOA 1VRUA 3LF0A 4E98A 3OUYB 5SZTA 1RT6A 4QWCA 1XWLA 1JJ2R 2ASYA 3MURP 3G6VA 2YH1A 2A18A 2CQDA 4KB7A 3KLEB 3DLKB 2YKMA 3OHBA 1IBLF 1X4GA 1Z1ZA 3OTDA 3D28A 2E1AA 2B3TB 2LXIA 2ALZA 2KN4A 2XEXA 1AFIA 5IM0A 2DRAA 5D3GB 1JKHA 3PW2A 3H4BA 3C6TA 2QMXA 4AL6A 2PI5A 3RYLA 1XR7A 3PM9A 4OI1A 3HHLC 3CC2S 3CGIA 5AJ3F 3EUNA 3H25A 1FTRA 2WBRA 2WONA 1XBWA 1X4DA 1FKOB 2PA8D 4MIWA 3QJJA 2RDIA 2FHMA 3SFGA 4NPOA 4TLRA 1N34F 3IAM9 5DM7Q 5L38A 1W25A 4J9QA 4YDDB 4LF9F 4DR3F 3DU6A 4XDCA 2AQ4A 2GCFA 3A1YG 4LF4F 1XN9A 3I4PA 1UEVA 2JEFA 2RUGA 2Z4PA 1FJ7A 2E5GA 3DLJA 2QRRA 4IOBA 4MIAA 1VQMS 3DYAA 2BDPA 2ZJPQ 2U1AA 3CCRS 2Y0SD 2XMMA 3MM5B 5D4OA 2NUUG 2QA1A 3AJ1A 3LP0A 4RWXA 3VAKA 2J7KA 3IGVA 1HQEB 2MZJA 2EW9A 5A6PA 4MTPA 1IN0A 4E8UA 5J1PA 3PO5A 3B78A 4MKBA 1IKVB 4USJC 2VFVA 2JLGA 2MQMA 2ZUGA 4C8OA 1RA6A 1CVJA 3K5MA 2BYCA 4DF4A 2FHOB 3HVTA 3KG1A 2HFOA 4A8MP 2FJVA 4OFZA 4I67A 5K9FA 5B08A 4OL8A 3LOUA 3TAPA 3M9OB 1XMOF 2JEJA 1TP7A 4FF1A 2VODA 5H9EJ 2RQMA 4DQQA 1S1XA 4CTAA 2DCLA 2JHEA 4OX9F 3F73A 2YWFA 3M8PA 3I55S 3V81A 1UWBA 5LXYA 5LJ5Y 1GT8A 1R8AA 4ZDNA 3KHHA 1VBXA 1QAYA 1U25A 1KEKA 5HP1A 3EXCX 5A8KB 3AQPA 2HNZB 2E29A 1H6KX 2FVSA 3PXGa 1M5VC 4OHVA 1HMVB 2IYIA 3KMQA 2BUNA 5GVQA 2DO4A 2JX2A 1T05B 2ILZA 2VFSA 4U7CA 3OVSA 4I6WA 1KR4A 1GAOA 3MEEB 2W8KA 1Q86T 5IXUA 1RT1B 2BV3A 3DCAA 3KK1A 5JJBA 3RRKA 5H9FJ 2R8HA 2K3KA 1WF0A 3ISNC 3MR6A 3OW2R 5F8GA 4CO1A 4RUAA 2CVEA 1UVLA 4F4ZA 4TNOA 2R8IA 2P6TA 3UW1A 2FVQA 1VQ4S 3KLHB 1FEEA 4DN0A 1P1TA 5F3ZA 2LQJA 4C8NA 1KS2A 2IM0A 1X4CA 2CJQA 2ROEA 2ZNYA 3DLHA 3OL8A 5KFZA 3KG4A 2CQ0A 2J9DA 2HFZA 2VBZA 4Q7AA 3H4DA 3CEDA 2XHWA 3CJ5A 4ED6A 4WZQA 1HD0A 1FRIA 2OPQA 2B5JA 4A8XA 2OAUA 4QIGA 4PUOA 3GFYA 3IAS9 4J5OA 4D3HA 5CYMA 3AQOA 2HIQA 3TUIC 3ENQA 1BQNB 1YJ9S 5GMKa 4QWBA 1I1GA 3V4MA 2XMUA 2VKRA 2PEHA 5LMNF 4ECXA 2FDNA 1WEXA 3PVXA 4CI0B 1KD1T 1KVJA 2Z2LA 3V4IA 5F8NA 2HPUA 1U1RA 5A8WB 4LFAF 1VQ7S 3OTCA 1KOHA 5KFPA 1R0AA 3RRGA 2LDYA 2JC1A 4NLPA 1S77D 4OZJA 1F5BA 4ICLB 2N4DA 4ZVHA 1XNRF 1S6PB 2QSFA 1KLMA 4R0JA 3OL9A 4N47A 2RF2A 4K2XA 3DI6B 5DJBA 3DOLB 1YWXA 2GJIA 3N5FA 3KMSA 1N5TA 2PIIA 4OZLA 2CQGA 3LQVA 2RH3A 4QU6A 2EG1A 1S1TA 3PFOA 1FRHA 2ZH7A 2IJNA 4DQSA 2L9DA 3MM9A 4HH1A 3R5BA 3GV7B 4Y2MA 3MEGB 1KOOA 2OLWA 4AL5A 1J5OA 1FDNA 2R7TA 4NLTA 4QPTA 5HN0A 1PC5A 4CQ1A 1X4FA 3M32A 4WU2A 2OMOA 1E6VB 1WD6A 3V6HA 1HNZF 1GTEA 1KNZA 3ETOA 2QFJA 3GZ7A 2UZAA 2IVFB 2RS8A 1CLFA 3LAMA 2ZH6A 1RTDB 2ZH2A 1MNEA 4LF6F 2VA2A 5F8LA 3GIKA 1MU2B 3M1VA 1SUQA 2NYIA 2BQ3A 1K0TA 4DFPA 5IT0A 4DFKA 2IA6A 5CZVA 3PJXA 1X5PA 2W9BA 4QYRA 4DFJA 1JLCB 4KAIA 3G6ES 4LF7F 2HVIA 2L41A 4F4XA 2KHDA 4I6YA 4NL5A 3NNHA 4B02A 2ZD1A 2CPYA 3KK3B 4JI3F 1FTCA 5A8RB 1N33F 3R3TA 4KGMA 2F3JA 3PHEA 5DG9A 2DNGA 2K3IA 1MROA 3B82A 4I2QB 4MK9A 4OLPA 2M4MA 3LGNA 3QYYA 4UQTA 1F60B 2JFDA 3DRPB 3MD1A 4XPEA 2LXFA 5DDRC 1VIXA 3GB0A 4FNIA 4I2PB 1S49A 1QLNA 2FGCA 2L48A 3HKZD 3G9CA 1G1XA 1X5OA 1O0PA 3MFIA 4G1QB 1GXUA 4PR6A 3ZZTA 3IG1B 5IZHA 2KT5A 3FFIA 3QIPB 3V6DA 1RTHA 2MQQA 4RZRA 2DITA 2HGMA 2JRSA 4B3RF 3CE8A 4MK7A 5LMUF 1QVFR 5D4PA 4FF4A 1R8PA 1RT7A 3DOKA 4F2SA 1XERA 2I38A 5AE2A