4RWXA

Crystal structure of l. monocytogenes psta
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
76
Chain Sequence
MKLIFAIVQDQDSNRLSDALTKGNFGATKLANTTFIIGTEDERVEDALAIIKENCKARQVGGATVFVMPVESFHHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Lmo2692 protein
publication title Molecular basis for the recognition of cyclic-di-AMP by PstA, a PII -like signal transduction protein.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 20
structure length 76
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rwxA01
3MHYA 1VFJA 4RLEA 1UMJA 3X3UA 3T9ZA 5DRKA 1UFLA 1Q1KA 4CO5A 2GX8A 5D4NA 4D3HA 2V5HG 3TA0A 2EG1A 4E98A 2NUUG 1NH8A 3DFEA 4CO4A 3M05A 1O51A 4D3GA 2NUHA 4YB6A 2O67A 4YB5A 4CO1A 3N5BA 5DS7A 2JJ4D 1V3SA 2J9DE 4OZJA 1V6HA 2ZFHA 4OZLA 1NAQA 1V9OA 2Z0GA 4CO3A 4NYPA 1GNKA 2J9DA 1UL3A 4IYQA 2RD5C 2ZOMA 4CO2A 1J2VA 1NZAA 3AHPA 1V3RA 3O8WA 2XBPA 4CNYA 2PIIA 3AH6A 2J9EA 1P1LA 3TA1A 4C3LA 4YB7A 4WK3A 4C3MA 3AA8A 5D4PA 3NCQA 2NS1B 3AA9A 5L9NA 4OZNA 4RX6A 5D4LA 3CE8A 2VD3A 2XZWA 2E66A 1O5JA 1UKUA 3TA2A 2CZ4A 3OPKA 1KR4A 3O5TB 4Y65A 1QY7A 4CO0A 2EG2A 4R25A 4C3KA 4WK1A 4CNZA 3NCPA 3HLUA 2O66A 4USIA 4RWWA 2GNKA 4AFFA 2GW8A 1OSCA 1PILA 2J9CA 4USHA 3BZQA 3GSDA 3NCRA 4USJC 1NH7A 4Y6IA 1HWUA 1XK8A 5D4OA 2XG8A 4NYOA 4RWXA 3LF0A 1H3DA 2DCLA 1VHFA 3L7PA 2XULA 4ZK7M
chains in the Genus database with same CATH superfamily
1S4EA 5HJXA 1Y5IB 3BBBA 3J7Z5 2VC1A 2KRBA 1ZS6A 2KB2A 4KB7A 4CP5A 4DN0A 3OFHA 2A2DA 3K8WA 3FBFA 1O6XA 2Q3PA 2EKNA 1NHKL 1FRIA 3DLHA 3PJWA 2L48A 2DNYA 5IM0A 3IMQJ 1WF0A 1RI7A 2RD5C 5D6GA 1RHRB 5F41A 1KDNA 2YNIB 4URQU 5KFPA 3MURP 4FS1A 5LMUF 2B7CB 2R7TA 1W26A 4MT1A 3O5TB 3WBZA 3NBPB 4O4GB 2XWYA 3M8SA 5ETMA 3GB0A 5F8IA 3OLBA 2COLA 2ZH4A 3VCDA 3HK2A 3GU0A 3G87A 3GG1A 1F0XA 1U1OA 4DWIA 1RWOB 4FNHA 2NZCA 3SSQA 1G1XA 2LDIA 4NLSA 2YNHB 1NK8A 2XLIA 1NK6A 2CQDA 1HYSA 5C7PA 5CZVA 4X65F 1U4BA 3QATA 3MWBA 2NUUG 1RCXB 4MMOA 3I5BA 2VBWA 4X4OA 2GGPB 3P45B 4K0KJ 1N48A 4DG1A 4YHHJ 2ZOMA 2X1BA 4TLRA 1WHVA 3DGVA 1KSPA 5E0OA 3KXDA 3Q8PB 2NS1B 2N4CA 1LWFB 2W4PA 4DL6A 2L3MA 4I2PB 4UY85 2R7OA 2AX1A 1S1XB 3MECA 2DGXA 1M0SA 5CA5A 1WOPA 2BVZA 3TVYA 2Z4PA 4OHZA 1NDKA 3C66A 4UUWA 4USJC 2Y1LB 3CULA 4M8LA 3JTNA 3K57A 1BHNA 5B0CA 3DOKB 2ZH9A 3CJKB 1RHKB 3C8YA 4RBVA 3HVTB 4PWUA 4Q44A 3GP9A 2YWWA 1RT2B 4YDXA 3JXOA 3SMZA 2HFVA 4L74A 3SDEA 3NAIA 1QAJA 3C2PA 1L3KA 2XO7A 2BJEA 3NG8A 3UN5A 1FDBA 2BR0A 4DUTA 2W9BB 4IYQA 4HYKA 5HMYA 3GJSB 1QJHA 2DBBA 5F8HA 3R5DA 1QVGR 5KFVA 3MUMP 2EBGA 2ZKUA 3MI7X 1YG0A 2BKNA 5KFUA 5KTQA 1U1KA 1WHYA 5B09A 4H4KA 5A2QY 4OX9J 1HPZA 4NLDA 1HWIA 1DAXA 5D0EA 1WEZA 2Z2ZA 2YPYA 2KDOA 1XR6A 2BQRA 2F3JA 1KTVA 3HHLB 5D0GA 1FD2A 3UDCA 2ZM6F 2H54B 4G1IA 3SZ2A 2IA6A 1H98A 4DX5A 1RT4B 1U0SA 2GW8A 7AT1B 1UZHA 4DSLA 3VAMA 3OHBA 1UJ5A 4ZITA 2CQPA 2XYPB 1Q78A 4UUXA 4UOHA 3ZZZA 4OI0A 4XK8C 9ATCB 2ZOFA 3PW4A 3ISZA 2Y9HA 4PG7A 4B3OA 2MYFA 4MKAA 2P9CA 2HNDB 4D3GA 3EDRB 2ZVIA 2J9DE 3IG1B 1V6HA 3KUHA 1NNDA 3ET6A 3CF5Q 3W9JA 1C0TB 4DL5A 5GMDA 3B4MA 4Z7CA 5BR8F 6FD1A 2FB0A 4A4JA 3T41A 1MNEA 1L3VA 2FY8A 1HR0J 4BC9A 4GVLA 3NOCA 3V4MA 4FYWB 2BJ3A 3QZ7A 3RW6A 1QD1A 2XSFA 1H2TZ 1I5OB 5C42B 1Z2LA 2B6AA 5I4MA 2C3UA 1NK5A 3EMTA 1BMQB 1B70B 4NA1A 1JLGA 3IS9A 4ZP7A 1UEVA 3HDSA 2QLXA 3IBWA 4EZ9A 2VL1A 4OZ3A 4NYZA 5GAHU 4RNMA 3OL6A 2PMHA 1NJXA 1KOOA 2UXCJ 2HZCA 5T7LA 1VBZA 4DR1F 4A8XA 1C1CA 3KDNA 3OUYB 4IH7A 3H40A 2EC2A 1NLKL 3D6FB 5EHHA 2CQIA 4N7TA 2IIHA 4HHUA 5C24A 4OHYA 5J2QB 2IYGA 1HWLA 3E51A 2ZWPA 2C3MA 3T3FA 1RHMB 2DXFA 4DZDA 3OTOF 2JHEA 2UUWA 2LYVA 3OVAA 3HHLC 1WHWA 2KVQE 3PZPA 1IKVA 4WTOB 1AW0A 2AU0A 2DCUB 1VHIA 5L1LA 3NCRA 2KFNA 4K59A 2IM2A 2KFYA 2Z58B 3LO3A 3EGZA 5HBMB 4JI3F 3LF0A 4P9SA 5SUHA 2DHSA 3GFZA 4C0HA 2R8KA 1R31A 2MLXA 4L73A 1Q8LA 2VA2A 5DG9A 1MG7A 2G13A 1WWHA 4NCBA 2P5VA 2ADCA 3ZZOA 3E01A 2ZJPQ 3KJVA 1TL7B 4QWEA 2E1RA 1F9HA 3Q86A 4ZP9A 2CNOB 1T11A 4DQRA 4ZLPA 3GQCA 3MEEA 3DHWC 1FFSB 1TL1B 1TKTB 2V8VA 4B3TJ 4LSLA 5KFJA 2GCFA 3OD2A 4V19J 2IJRA 3AA8A 5DG7A 2QLWA 3GJRB 1K8AT 2ASYA 4JI2F 1SH3A 2I9SA 3M9MB 4DR7J 3HVWA 5FIIA 1HQEA 1NCLA 1OQ6A 3KLIA 1H74A 1JJ2R 1S1WA 2Y3YA 2AQ4A 2GVZA 3BZQA 3TJ9A 4CLWA 2QYGA 4IG0A 4NXMJ 1RT7A 4LF4F 1S1UB 3MHYA 2IC3B 4TYBA 3M2RA 1JLBB 1E6VA 2BJ8A 4MAKA 1X0FA 5EX3A 3CDAA 4MKVA 3ONQA 1E6YB 5I3UA 3K89A 2GIFA 3IWLA 2RKIA 1RB0A 4MK8A 2F4FA 3FEXB 2GJFA 1IBLF 1VOMA 1RAIB 3DLKB 2C2MB 1X5TA 3BEGB 2MZ1A 1V3ZA 2IBOA 3AJ2A 2LEPA 2V8HA 3CCRS 2RAQA 2U1AA 3PNIA 3LOUA 1UETA 2V8GA 4NXNJ 3IC1A 3QLHA 5KT7A 3CGIA 2YKNA 3CMAS 2D3ZA 4LBIA 4I6AA 1T3NA 4JV5F 3MTJA 3NS6A 5E3CA 1HNZF 1FRJA 2M7SA 1FDDA 3KG1A 4K50A 1Y3JA 2KZMA 3VAJA 4X4UA 2K2PA 4DQSA 2AEFA 4QWAA 4HEA9 2FZGB 4JI7J 4F0HA 1UVNA 4ILLA 3KHGA 1XERA 3FCVA 4QIGA 3R7BB 4DDFA 5FLXY 3MCOA 2Z2MA 3A8JA 1AUDA 4IG3A 2Y8WA 4DV3F 1SKWA 3A3OB 1XR5A 2BQ3A 5CABA 3OBIA 3ZNJ1 4FBUA 3WC2A 2DHAA 4R5PA 3L7UA 1SJ3P 4LQ3A 2QSWA 2B5JA 4O0IA 4I69A 4FPRA 2FGCA 1QSSA 1JMTA 3D1OA 3DU5A 2AJFE 3RZAA 4GRSA 4F4KA 1HYSB 3BJYA 2OAUA 1B7FA 4USKA 4AL7A 4JI4J 1OIAA 2A2CA 3OSNA 3T1HF 3WQPA 2FZKB 1AZSA 4ELUA 4Q8EA 3OVBA 2DGOA 2YTCA 2ZH2A 1N52B 1UVIA 1MN7A 1B4SA 2BZ2A 3KUGA 3NRBA 4OLOA 2F63A 2QFJA 1FJGJ 1R6VA 3JQKA 1HQUA 2DEJA 3IR5B 1UVKA 2HVEA 4C98A 1XNQF 3CC4S 1X4BA 3TEHB 4DS5A 5KFAA 3DRRB 2NPFA 4WBFA 3MECB 5KFCA 3CD0A 5IT9U 4C6AA 3HVAA 2CRLA 2VKRA 3F0NA 1LK7A 4EWTA 3ZXWA 1NKEA 2Y1IA 2K3IA 4LRAA 3H5XA 1FRXA 1VC5A 2GQ2A 5LMNF 1TR0A 1M5PC 2D1CA 3H7HB 3WZ0A 1H7WA 1WTFA 3JB9k 3LTOA 4ICLA 3SDEB 2IA0A 3GIJA 2IDLA 2XG8A 2KZZA 3I5AA 1B0PA 2WHOA 1TMMA 2WK4A 1QAYA 3BDPA 3MUVP 4EUVA 4NMLA 4ZMMA 1RT1B 1B99A 5D4NA 1XMQF 2HGLA 3HSGA 1YWXA 1KOHA 3S01A 4ZJOA 4U7UK 5KOXA 2R2SA 3HHDA 3GCWP 3M2VA 4X62F 4JOUA 4K5RA 1HPZB 4WCEQ 4YR2A 2XMTA 1ICEB 1WEXA 2O3DA 3G4SS 2FJAB 5IFMA 3OR1A 5IWAF 1IKYA 2FUG9 3EE3A 1GNKA 3H5UA 3KHLA 2CNKB 2V2QA 4TKTA 2V2KA 4HACB 3KNGA 2WVDA 2F40A 3V81A 2VPYB 1KVKA 2UP1A 3BDEA 1YIJS 1ZM2A 3GMGA 3J7YI 1T8EA 1MMLA 4B3OB 3KOAA 2YH0A 1FFWB 3TNVA 3TZYA 4DFPA 2DXEA 2G0CA 3BS9A 3ET6B 4JYAF 2FVQA 4I7FA 2NR0A 2LXFA 2C2RA 1C1BB 1LNQA 2OEMA 4YB6A 3RB3A 2VFSA 7FDRA 2FC8A 5FD1A 4ZKAA 4NYPA 4C2MA 1LFWA 1XN9A 4MTPA 3M6WA 2L41A 1U7LA 1X9MA 4Q2MA 3OL8A 3JSBA 3OFFA 4LF5F 3HM9A 4B17A 3JSMA 1JLGB 3IS9B 3ILJA 3HMJG 3FQLA 1RGVA 1YX2A 4XPEA 2CQ2A 2YNGB 1P9QC 4OYXA 2W7OA 4IFVA 1N33J 2UUCF 2R4FA 4USIA 5ETPA 2VF3A 1VQNS 4PPDA 4OMFG 5T7LB 2QMWA 4IDKA 2GVDA 4ES3A 4WIQA 1NB7A 2AHOB 2MLZA 5D77A 4DV1F 3P5TL 4X4NA 3QT6A 1WC1A 5KOWA 2HPUA 1UFLA 5C24B 4K4YA 2GX8A 4H4KC 5KFNA 1CJUB 2QRRA 1KQKA 2V6AA 2HYIB 2VG5B 3Q8QB 2RU9A 1WF1A 2CDQA 4RW8A 1OJ4A 1DFDA 4I2QA 1KQFB 3CCUS 1IKVB 2CQ1A 1EAYC 2PMZD 1P8GA 3V6KA 3OTBA 1CVJA 4ZVUB 4KO0A 3DRYA 2GA7A 3I31A 3R2DJ 2VV5A 4UQTA 2HEKA 5CD4A 5IQ6A 1RADB 3PHEA 1LW0A 1HARA 4FPIA 2DGUA 2DVIA 3S8SA 2JEIA 1FJEB 3KNAA 4DR5J 1SQFA 2I6WA 3M8ZA 3OFEA 3JYTA 4J9MA 4AFFA 4GC6A 3H42A 4ZP6A 1VRQC 3E01B 3KJVB 6AT1B 1MU2A 2MQ8A 2VFRA 3KLEA 1ZAXA 2G9OA 3BBFA 2WSFC 3UDVA 3PIOQ 3VAKA 4A8WA 3MEEB 1R0AA 2F4VJ 1X5PA 3RR7A 4YFUA 4LSLB 4CQ1A 2P9GA 2ZDPA 4FYDA 2KHDA 3VVUA 1N0VC 4ZPCA 3MPWA 2J6SA 4EFAC 2YBVA 4H4MA 1PYSB 2CADA 1GX6A 2YQ0A 4EBDA 1XJWB 1HQEB 4CO3A 3CCQS 3KLIB 1Q8BA 3V6DA 2QEXS 1RE1B 4F7VA 2GMJA 1S1WB 4USUA 2I5JA 2GVZB 4N56A 4QJVA 4OYZA 5EGYA 1GX5A 4IG0B 2GAGC 1KN6A 4GKJF 1S6OA 1RT7B 3TOQA 3AA9A 1HI1A 1HBOA 2MDAA 2H9ZA 3Q8YA 4OV6A 5AJ3F 1URNA 4CWBA 2ATLA 3FZ2A 3PEJA 3M2RB 2JVRA 2OPPA 1E6VB 4KTQA 2M52A 2VDIA 3MPVA 4WP3A 2M70A 5I3UB 3PRDA 1MMNA 2RKIB 4ZVGA 1EKSA 3EDQB 3F56A 1EARA 3FGVA 3CPWR 3ITHB 3QMQA 1I3OB 1HD1A 1RYRA 2QA2A 1FI4A 1OYDA 4QR0A 1RHUB 2IVYA 4KIAA 5JMNA 1HHSA 1HD0A 4M5DA 2MB0B 4PWDA 1K1SA 4I1TA 5HMXA 5A8KA 1RKJA 2YKAA 2HG4A 2DT9A 4F4AA 2YKNB 3BM7A 3KG4A 5HL7Q 2HMIA 4J37A 4PKDB 5AT1B 4DCOB 4DV6J 3W9HA 3RAQA 1V5IB 2NSCA 1RWWB 2DNPA 2YVSA 3M8QA 4TU9A 3LPYA 4QW8A 2HURA 2OD6A 2DH7A 2R42A 3R6LB 2JZ5A 1CQMA 2PD1A 1BWVA 4X4VA 4FYXB 1PILA 4AQYJ 2ZH1A 2W4CA 2HQDA 2E5JA 3NWGA 4QIVA 1TZ0A 3RJMB 3GWCA 2DCLA 2BJ9A 2DNQA 4ENOA 3QRRA 1FDNA 5K8OA 1RBLA 3MM7A 2F8HA 5IXUA 1I94F 2R3VA 4R5PB 4C8MA 4A8OA 2B5JB 1XQIA 2F5GA 2CNNB 4NLYA 5MAOA 2HHHF 1O51A 4C0BA 2QYCA 5KFHA 3DLLQ 2MZQA 2KO1A 2ZZNA 4HDHA 2XCAA 4I0WA 3NMAA 4I56A 1DARA 3MEKA 2W2PP 3GPAA 3PTWA 3NKYA 4CLPA 2G0IA 3R2CJ 1AZSB 1IBMF 3DLBA 1BC6A 4LRBA 4PG4A 2W9CA 3NL0A 2VH7A 5DDPC 4P2XA 1FKPA 1U8SA 4ZJQA 1QAXA 1RT5A 1Q79A 2RDDA 4RU2A 1T7PA 3PACA 1RUSA 3LQVA 1HQUB 3MF5A 2VICA 3KHRA 2ZUAA 1JJ4A 3RR8A 4DV7F 1X5SA 1J27A 1U8WA 4QOTA 1HMVA 3ENWA 3TYTA 2I1RA 4C8OA 3PV8A 4P73A 4WP8A 4EBEA 3WX4A 3M8YA 3DLJA 2PN6A 5EWEA 4GKKF 1NDLA 3HHNB 2WAQD 4Y2IA 1AFIA 3HJFA 4ZOSA 3V2UC 2J76E 2R8IA 2EFGA 4OZLA 2RF2A 2XMWA 2M0GB 1OMSA 3C14A 2YQ3A 2F8MA 3MPUB 4PQUA 3Q8VA 1RAEB 4DUYF 4ICLB 5E5NA 4IO9Q 3NGUA 4IH5A 2CPIA 1YJRA 1P9YA 2IPOB 2D3OR 4Q5VA 1UKUA 2W2QP 1KP6A 3THPA 1R27B 4GC7A 1R3NA 1NJWA 5G0RA 4GO7X 2HWIA 3K2YA 1X4CA 2VHGA 1WKLA 4X66F 3M8RA 1Q8IA 1YJNS 1JX4A 7FD1A 3HO1A 3P6YC 1VQMS 3TWZA 1DTQA 1OPIA 3M2VB 4F4WA 1ZM3A 4OJHA 1H72C 2OH2A 3OR1B 1IKYB 1KHVA 4MKBA 2J5AA 1PIEA 2PA8D 2CJKA 4RW9A 2LQJA 1K44A 1IJEB 3SI8A 5KFFA 3N28A 4RNHA 1JKHA 4DEZA 2GMHA 1W7WA 3LUYA 1LEOA 2G1HA 3ETOA 3V81B 4XIUA 2MGZA 4V1Ak 5HVFA 1V3SA 4FYVB 1PC5A 3M8WA 3HD1A 2JDJA 3OTCA 3AOAA 3JSRA 4QR1A 2EEYA 3PW0A 3MAQA 4DZ6A 3UI3A 1DHMA 1UP1A 4L72B 1P27B 3F73A 3NCQA 4JI6J 1SJ1A 1LWXA 3CB4A 2V8PA 3SFGA 4I6WA 4EYIB 2LU1A 3RBEA 1YITS 2A1BA 4A8SA 4ZVEA 4I7FB 1RA7A 1RAGB 1CJKA 1M1HA 4ECZA 4DV4J 1N34F 2V50A 4C0OC 2B4OA 3EPIA 4NZ7A 3FBEA 1X9WA 2D9OA 4ES1A 4LVOP 4F2RA 4TQSA 1VHFA 5L1IA 3W1YC 3VVTA 4TY8A 2R2RA 3PYGA 1HI8A 1RTHA 4WKYA 5CAAA 4LBHA 2B3TB 2XYGB 3G9CA 2RDIA 4LFAF 1ZM4A 4OYMA 2C1EB 5G4DA 3JSMB 1HBUA 2EK6A 5L39A 3BSAA 4B3SJ 2N7CA 1RWMB 5ETOA 1NPPA 5LSRA 2XTJP 2MKKA 4IFVB 3SV4A 5DQHA 4G1QA 1RACB 4O0NA 3KG0A 4NL5A 5C25B 3JAMU 4IDKB 3W63A 2GVDB 3H4BA 5E7OB 1S6QB 2KYZA 4DPOA 3HHKA 1EHWA 1N88A 5IC4B 2RUGA 2J8AA 4B9MA 1HLWA 4ECWA 4KRWA 5K8MA 3W8PA 2VQFF 2NXUA 1VC0A 5HQ8A 3JQMA 4YMEA 2JEFA 3CDEA 4RW8B 2DPIA 2DISA 1YJTA 3I6PA 1VIOA 4I2QB 3L7PA 1NMEB 2DEIA 3LP0B 4M94A 3D1QA 3F41A 1S0NA 3EXCX 3F44A 2RUSA 1BE4A 4P52A 4EZ6A 2AYGA 5K8PA 2CJAA 4WFBQ 3H8YA 1KQGB 4KO0B 2IJFA 3GJQB 5K5MA 2OJ3A 3DKDA 2WOMA 1YK9A 2UXBJ 2QZ8A 2MEWA 2G1DA 3D5MA 1YI2S 2MZRA 1PJ5A 2DITA 2W24A 2F9JA 2P6SA 3IWXA 2XS7A 3AFGA 4F0KA 2B56A 3FDSA 1U2RA 5ETSA 5JJBA 1MU2B 3KLEB 4LFCF 5LMUJ 3R6GB 3A1YG 3R1HA 1IQTA 3BV8A 1MWYA 2GMLA 4NEZA 5DLFA 4PQAA 4XDDA 2BABA 5CYMA 1DQ8A 4OX6A 2MKIA 2VC0A 4OHVA 4KT0C 1M5KC 2FD2A 2ADBA 2AJ2A 4H4MB 1DTTA 2DNZA 5DETA 1S7HA 2CPJA 3CJQA 1P1TA 2WVEA 5KFRA 4EO8A 3PG9A 2HQFA 5CYQA 5DRKA 3V6DB 1D8ZA 4X65J 2I5JB 4RW4B 2NZ4A 4O3SA 1FFGB 3MEDA 3PX4A 2NXCA 3G8TA 4K2JA 1NDPA 3DLEA 2N3OA 1HBOB 4M1KA 4ELTA 1NK9A 1X4FA 2HHQA 3R5CA 2Q6CA 2OPPB 1LKZA 1QSYA 3JTOA 3GTYX 1RK8A 2VQEJ 3MOJB 2ROGA 5J2NA 4F3QA 3Q8UA 2HS4A 1PBAA 2CJXB 4CDIA 5ETTA 1Q8KA 3A13A 1SL1A 2ZH5A 2J7KA 4DS4A 3C3LA 3T5HA 1T9TA 4N77A 4HLBA 4M5DB 3MXHP 3DHXA 2EFNA 4PWDB 1NSQA 5A8KB 3C6UA 1QDUB 3I0SA 4HT5A 1R7IA 4ECVA 1FJ7A 2OI2A 1T9UA 2IRYA 4U8YA 4NX9A 5KFWA 3UNYA 1Y3KA 2HMIB 1SUQA 1J5EJ 1U2CA 3UVJA 4RNOA 4I68A 2ZZTA 5KT3A 3OV7A 2I8EA 4JI1J 2VUGA 2PDAA 1L3SA 4BBYA 1NSKL 2W7PA 3A3PB 3POTA 4WP9A 3M8QB 4FVMA 5CXTA 2FZCB 1TV6A 1LWCA 1D8YA 3C6TA 1JB0C 2XS5A 3KLGB 1R8BA 1NAQA 1F3VA 1M90T 4DHVA 2X51A 2C2KB 1SQGA 4ZDNA 4EU0A 3O8WA 2WZ1A 2F65A 4DL3A 4HDGA 2L9DA 3QBCA 5E41A 2ZUGA 3K5LA 2UXDJ 3ICLA 5D0HA 3KYLA 2V8DA 4K0KF 2I38A 3MR2A 4YHHF 1ZETA 4CYUA 1K9MT 1JNZB 3ZZ0A 2DNLA 3MM7B 3NBPA 3CJ3A 3TZXA 3D0GE 2R7RA 2J6TA 3MAAA 2DY1A 2KTQA 3G8QA 1F9FA 3EVOA 2LLZA 2QE5A 5HMWA 2NQPA 1N6QA 1RTIB 5D8HB 3R5AA 3T1YF 3A8KA 1IM4A 3DDKA 4PUOA 3CJ8A 1B3TA 1PG5B 3SQGB 3B82A 1S9GA 1RXOB 4ID5A 3AOBA 1T9YA 3K0JA 2WW8A 3CJ4A 2Y8YA 1CS4A 5KFTA 4NLWA 3M6VA 2HHWA 2X1AA 2W9CB 4FN5A 1FKPB 4CLYA 5T41A 1UJ6A 2MKCA 2W9AA 1U24A 3D2WA 3PR4A 2RILA 3MM6A 3FEYB 4K4WA 1RT5B 2ZKTA 4W92B 2AJ1A 4IQXA 2UVRA 2GGPA 3N5FA 4NMXA 5BR8J 5DG8A 2JLFA 2H3EB 2FLLA 1SB6A 3IAS9 3NWRA 4V19X 2FY1A 3VR1A 3MD3A 2ASDA 5KG6A 1HMVB 1LWFA 1ZYQA 3N79A 1BY9A 1S10A 2CFXA 2ZNZA 3QGIA 1TK0A 4OX9F 1R43A 2AZ1A 4L3NA 3MMCA 1K73T 5GVQA 1RLDA 1JNRB 4KV8A 4OYWA 2QC3A 4U9RA 2A6OA 2BRLA 5EWFA 2RF2B 1YZ7A 2IVFB 2J0SD 2XNQA 1OYEA 1GXTA 2M3DA 3C14B 2QT7A 3V4IB 1YTYA 3EGWB 3CJKA 3OL7A 4PQUB 5KFQA 2JEGA 5ETVA 4WFZA 2JOQA 3TAQA 1KKHA 5GAEI 1B0TA 1SVDA 3R27A 1RT2A 1IR2A 2CXEA 1VR6A 1BQNA 4DPUA 2WVFA 5J1PA 4URSA 4FDFA 2FGOA 5G0RB 4ZN3A 2J9DA 1FK9A 1PC4A 2VJUA 1UAWA 3QRPA 1KONA 2HFSA 3CJRA 1QUPA 3N0VA 2ALYB 2BJ7A 5ETKA 3PDNA 2ROPA 4CI0B 2L08A 5GADU 1SJ4P 3FJ2A 3PHTA 4RW9B 1VQ9S 4USVA 2LDYA 3NNHA 1JKHB 3IGNA 3GR0A 5B0GA 1HR0F 2H1YA 1P6TA 2B9WA 3HT0A 4PAAA 5L38A 1VRTA 2DTJA 4HI2A 2IM3A 2MQMA 2X1GA 5DDOC 4X4SA 3H2UB 2KT5A 3CCES 1T03B 4N76A 3TAMA 4U8VA 4CO5A 1Q53A 4MK7A 2WBRA 2ZBQA 2DH8A 3TQEA 4QYZJ 3MAHA 5F8MA 4DR3J 1JLAA 1JJCB 2WCXA 2BUNA 4ITSA 4UOFA 2CPZA 2HQIA 2GIRA 3J7A1 4DQPA 1QLNA 1EX8A 3IG1A 1WTBA 3AHPA 4QWCA 4P2FA 2MSSA 2RS8A 3G6ES 4FF3A 4DX7A 2XCPA 1M5OC 3FSIA 3UCZP 1R8CA 2JNJA 2UVVA 3MR6A 4DI6A 3TA2A 2RHSB 5L8RC 3MEGA 2EFOA 1PYTA 2XY7A 1TL5A 4DU8A 2DY9A 1RTHB 3G96A 4CT8A 4C8LA 3FUYA 3K5PA 3K59A 4OLPA 5J1EA 1HBUB 1HWUA 4CIOA 4F50A 2UVWA 1IN0A 1RABB 5DO2A 3M8PA 1VQ8S 3OXGA 1GMWA 3LGMA 4G1QB 1B7YB 3Q22A 2JLEA 1U0HA 2NXNA 1YQHA 1NXIA 4ERDA 1Y5NB 1RAFB 1B64A 2NUHA 5SZTA 5JVHQ 2DHXA 4F0MA 1Y00A 3DRPA 4M5IA 4H4OA 5KFKA 4NLXA 4ZHRA 3RGIA 1RWUA 2N7YA 1U1MA 1TKDA 1EIYB 5MLCV 4LBPA 1JLFB 3HJVA 3EWGA 1UVLA 4B9TA 5J2QA 3DLGA 1RP5A 3LAMA 2ZH6A 3ZZTA 5DGAA 1VLOA 1QY7A 1RAJA 3LWLA 1N32F 4G6VB 3W61A 5L1JA 3D6HB 3L4BC 1WI8A 2CPXA 3ZZPA 4PXEA 1Q7LB 2MMYA 4ZIVA 2ACYA 2WOMB 5T14A 3TVZA 4DR7F 4RUAA 4UT4A 4ES2A 1HNVA 4ELVA 2HRUA 2D9PA 4EBCA 2ZBCA 4QU7A 3TX0A 3MM8A 2U2FA 4YQWA 3GIIA 2FVRA 4IFYA 1RCOB 2HBQB 2V2VA 1H73A 2WW4A 3RYLA 1TMJA 1APSA 1U6BA 1TUWA 1RTDA 4HH1A 4AL6A 2XO6A 2DD8S 3G71S 2PO4A 2ZBRA 2OSQA 4CM0A 5CYMB 5FDLB 2W4DA 1UA0A 3BKUA 1DTTB 3WDOA 1FJCA 1KBRA 3T5JA 1X5OA 2X3GA 1H2VZ 2GJIA 2XS2A 3KJQB 1TKXB 1BGXT 2PT0A 5CYQB 1A6LA 3U7JA 2KT3A 3OLAA 3GV8B 2IFXA 1T3OA 3J7YU 3MEDB 1BUXA 2OO4A 3BGRA 3DLEB 4ETZA 5D4OA 2RH3A 2UU9J 2DNGA 3D1HA 4RJVA 4IKAA 4QR2A 4NLVA 3KMQA 1Q1KA 5J2NB 5E3QA 1KVJA 2R7XA 2ERRA 2QX0A 4E98A 4ANCA 3EPGA 1F3FA 3MFHA 2HHXA 3TW0A 2P2CB 3CCMS 2E9TA 4MFBA 1JLCA 1E6YA 4JI7F 4N8OA 3ENQA 4QWBA 1HBMA 1HNWF 2YKQA 5IV3A 2CPHA 3DLKA 1JXLA 2ZJRQ 4CCHA 2MKJA 3KK3A 2LA4A 3PFOA 1RYSA 2QSFA 4WIIA 3TEGA 3C6UB 3I0SB 1FEHA 2EXUA 2AEJA 4ZJLA 2HQ3A 1VQ5S 3RRKA 4CLLA 1SUQB 2RE1A 2JC1A 3UVJB 4NLPA 3DU6A 2DIVA 4YB1P 3UO0A 3MR3A 1S9EA 3HVRA 1VBYA 1ULRA 5J2MA 4LIWA 2W25A 3POTB 4Z37A 1TV6B 1LWCB 2GQCA 4J90A 2R2TA 2DNOA 3C6TB 3DXBA 3VTIA 3FSYA 4FP9A 1GTEA 2HBRB 4JI4F 2RU3A 2PMWA 3BGUA 4A8YA 5F9LA 3RAXA 3I87A 4X62J 4OL8A 3ILIA 1MLAA 3D54A 4CYUB 3PW5A 1NO8A 3RB6A 3DOMA 3P4UB 1FJGF 4ED3A 3CUNA 2GO9A 1AYEA 1Y11A 1CSJA 3FVYA 5H9EJ 3MAAB 1WG1A 4AE5A 2OELA 3UD5A 3MMBA 3HI9A 3Q8SB 4C3MA 1VBXA 4M5KA 4CLUA 1N6QB 5LL6d 2XYHB 3UWTA 4B3RJ 1NK4A 4PUOB 3R7SB 3BREA 1GT8A 3MCNA 1GMWD 1S9GB 1NRKA 3N01A 4ID5B 5EWGA 2CZVC 1K0TA 4JI0J 1CS4B 3FQKA 3PW2A 3VAHA 2JWNA 4KFBA 3ILOA 4KPCA 1J5OA 2Q1LA 5D15A 5IT0A 2CJQA 3MM6B 3SV3A 2UUAJ 2JC0A 1FESA 1WUUA 5IC6B 4LF9J 1F2GA 1WEYA 8RUCA 1YBAA 3PVXA 5HAOA 3I55S 3PYFA 3LA0A 1S79A 2UZAA 3FCHA 4QCLA 3QWPA 3PIPQ 5A8RA 3PEHA 3FMBA 3DRRA 2DK2A 3CCZA 2V4JB 2BDPA 3ZTRA 2MY7A 3MMCB 4KV8B 3SSRA 3CE8A 2CPYA 2A10A 3TJ8A 3C16A 2E5LJ 4DR2F 1DQ9A 3AD7C 2Y0SD 2UUCJ 1W2BR 5F3TA 1UEKA 1PGZA 1WNEA 1YBUA 3IRXA 3QGPA 4KGKA 3CD6S 2JSXA 5HN0A 1BQNB 4DFKA 2RHQB 4IRDA 4DL0C 3L9ZA 4NLQA 3IA0A 2E29A 3PKMA 4ED7A 4OZ5A 1FK9B 1HWKA 4RNNA 4RU9A 1AUSL 1TK8A 2AP6A 2QL7B 3M4XA 1RT1A 1D0EA 4LF2A 4J9RA 3SQOP 2MKYA 4PXCA 2DPJA 5LT5A 4WYLA 3W60A 3ETMA 1ZBTA 2HK2A 2CPFA 1NZAA 2IMWP 1LXJA 1DQAA 3AH6A 3T6BA 2IM0A 1X7VA 4DV2J 2BACA 3N9UC 1VRTB 4HACA 1QE1A 2E66A 4ZVHA 4OZ2A 1FVQA 1H6KX 2HHVA 2D74B 4X64F 4DXLA 3TAMB 2GFFA 2KVIA 4DPYA 3CC7S 4PPZA 1VQ4S 3FC9A 1PAEX 2L9NA 4AXJA 5H9FJ 3H0PA 1OPZA 1JLAB 2ALZA 3R8YA 2ZHBA 1N33F 2H48B 3QIPB 4KR0B 2M5YA 2DGTA 3DI6A 4ECRA 1KHWA 1SBRA 4J9LA 2FVCA 2FVSA 3DFEA 1S97A 3VALA 1PCAA 1C1BA 4DPXA 3MEGB 1SH0A 4M5LA 2M8DB 2CUYA 4YUDA 1Q5VA 2E7WA 4USTA 1DZ5A 4ZPBA 3MM9A 5J1EB 2O01C 1SIWB 2QN6B 2BXJA 4DSJA 1X60A 1U48A 3AAWB 3BQ1A 5D4LA 3L7OA 2FQQB 3M8PB 3ZZRA 2OEJA 5U47A 2XLKA 3AOCA 2XGQA 2J0WA 1U1PA 4MYTA 1KQSR 3GV5B 4RBUA 4GVBB 2YNGA 1U0HB 4WE1A 3M9NB 3EJMA 3MOZA 3D0IE 1LOUA 2VKZG 3EVMA 1XBWA 5A6WA 4HL9A 2DRBA 1UW4A 1HNIA 3DRPB 4DR5F 3MDFA 4H4OB 4ZHRB 2BV3A 1MWQA 4ZN1A 2M8HA 1KC8T 4ZPWR 4FNIA 4ATNA 1OSDA 2RQCA 4LF6J 3DLGB 1DLOA 3EICA 4Q2LA 1CJUA 4ER8A 3D7SB 3FNNA 3LP1A 3H59A 2VG5A 4LFBF 2F4VF 4B9VA 2VASA 3QSIA 4Y0FA 3NS5A 5KFBA 3WIVA 1J2VA 4RNFA 2YNFA 3RAMA 1IKWA 1RAHB 4DUZJ 2B4PA 1DJ0A 2HRYA 4TYAA 1HNVB 4K2XA 2HFZA 2W2NP 4LF1A 3AXMA 2EFQA 2H5JB 1JIHA 3MM8B 5DGBA 3BKTA 1TTHB 4IFYB 3RB4A 1HWJA 4ID8A 1HHTP 1MWZA 2HNZA 2QLJB 1WI6A 4Z2XA 1CBKA 1VJQA 1RTDB 4DU7A 2AEMA 3W5YA 4ZK7M 1NUEA 4ZVPB 2YWFA 4K5SA 4NA2A 3M6UA 1T9WA 2ZITA 3ZTPA 1NJIT 3A8IA 3W5ZA 5E3PA 2B9EA 4AT1B 3H90A 3TRGA 4RUCA 3QT7A 4K4XA 1ZPVA 4YB5A 4EO6A 1FXDA 1Z2ZA 4K4VA 1F2HA 2HS0A 4I67A 1WDTA 1V9OA 1RBOB 2B0GA 4WYWA 3ENVA 3B6BA 3M1VA 1F5BA 3LPEA 2BEFA 4ZPDA 4KGZB 2GJ2A 1UWBB 2M9KA 3BGRB 1S5ZA 3VV2B 3HFKA 2DR6A 5KG5A 1YJWS 2VBXA 4MIBA 2LEBA 3CCWA 4WK1A 4LMZA 2EC0A 4DV6F 1VISA 4B02A 3D6TB 2EWHA 2H65B 3GIRA 1XK8A 4MFBB 4NYOA 3UNGC 1JLCB 3NXZA 3L3CA 1SI9A 3CJ2A 4W4MA 1HBMB 3ITHA 4ZA1A 3OJUA 4AQYF 3KK3B 8ATCB 5KFXA 4P75A 4G3IA 1IBCB 3PXGa 2NXEA 4F3OA 5HATA 2FHOB 2HHPA 4CO4A 3CIZA 4GKKJ 4EYHB 1YJUA 2MZJA 2B7BB 2Q79A 1X31C 3N6NA 4ZLJA 4P7TA 1S9EB 3D3BJ 4ED0A 2UUBJ 4B08A 5J2MB 2HGNA 1REVA 3HXMA 2CG8A 2LQBA 5BXIA 1SH2A 4NI2B 2MKSA 3VAGA 2Z2LA 3SEOA 1CQNA 2PE8A 5A8WA 1WKJA 2DNHA 2AJQA 3VGTA 1TP7A 2XZWA 4DSFA 2BM1A 1FTCA 3FFIA 1KR4A 2E1PA 3NCPA 4X66J 5M2RA 4X4PA 4O44A 3AODA 1FKOA 1WKKA 1L3UA 2ZHAA 3Q89A 3J80U 4OFZA 4DQIA 1EZZB 2X3DA 5ETNA 4Y2MA 3DOMB 1X4AA 1WACA 2N3LA 2KL8A 2FTRA 1BXNA 3MMBB 2JEJA 3HSZA 2OFGX 4WFXA 4TU7A 4I64A 2E5GA 2VBYA 1N5QA 3DDIA 4NEYA 4DR6F 2JRSA 4O3QA 1YZ6A 2QL9B 4X4TA 4PEOA 1ZTWA 1EQ0A 5F8JA 3QFWA 2QMXA 2XNRA 5DM6Q 4KFBB 1J5OB 4QIWD 1KVIA 2AIRB 4RUHA 3T5KA 2CZ4A 2KXFA 2VG6A 2EG2A 2QO3A 1Y9OA 2LQ5A 2MHNA 1WD6A 4JP8A 2HVDA 4NA3A 1XMOJ 3MCMA 1EETA 5KAKA 1DBDA 2GZOA 5DLGA 1SIZA 2Z30B 2MTLA 1JWWA 1RU1A 2CJYB 2XC9A 5IT9Y 3L95X 2LCWA 1EP4A 1LK5A 5A8RB 1ROFA 1URRA 1Y4ZB 4YY3J 3SXLA 2DJWA 3GZ7A 4DSKA 4OJ3A 2EKYA 1S57A 1Z1ZA 5IT4A 4KHPJ 3I4PA 1XR7A 2KFZA 1I51B 2APOA 4P6QA 5LOQA 1XWLA 3ISND 2E9ZA 1T95A 4U6PA 4NZ6A 2AV5A 2RNEA 3HKZD 3HHEA 2PA3A 4RPFA 1FE0A 2E1CA 2E7XA 2HAFA 5KG7A 3C16B 4DQQA 1RT6A 4EI2A 2XBPA 3TVKA 1U1RA 3IRXB 2KJWA 2E1MC 4B3MJ 3KLVA 4W90B 2WB1D 3SYZA 4JI5J 2RT3A 2N82B 3K5OA 4CZCA 2LKZA 2RRAA 3J81U 2ATCB 4JI6F 2YWGA 2HK3A 4XPCA 5D78A 4I6YA 4DX6A 5DZ7A 4QW9A 2VBZA 1AXQA 1EB0A 2A6MA 4DX8H 3S7RA 4QYZK 1SJRA 3IR7B 1Q5YA 2GHVC 3PJXA 5K9FA 2DGSA 3OXLA 4DV4F 5ADZA 2D3UA 4QIEA 4BCAA 1S6PA 4PG6A 1WC0A 4DFJA 1MW7A 4CH1A 1TL3B 2YWHA 5DDRC 4FF1A 1QE1B 1A7GE 4CRJA 2VIHA 4O3PA 2RQKA 2DB1A 3IAM9 3NGKA 4DCPB 1VQPS 1FNMA 2LQ8A 1ACMB 1G7CB 2MXYA 4B3SF 3CD7A 3ZZYA 2HW3A 2RIJA 4Z7YA 4UOCA 2BW7A 4OYPA 2BKOA 1TKZA 2Q66A 4EMDA 3TI0A 3IBCB 1H38A 5F8NA 2KRRA 1NKBA 3V6HA 5LXYA 3DI6B 4A46A 3NGTA 2PEBA 5E3AA 4R8UA 2HNYA 3RBXA 2HFNA 4U7CA 3O44A 4ZLLA 2DR9A 3W2VB 2JLGA 1D1UA 1QTMA 4OZ1A 2DH9A 2AYEA 1HNXJ 2C3OA 5GMEA 2EBEA 2BOAA 4OI1A 2AGPA 2FPHX 4CLSA 4TQRA 4OI3A 3MM9B 1R8PA 2HLTA 3D6MB 3KK1A 2O67A 3HD2A 4Q45A 2JX2A 4N41A 1NDCA 2AYMA 4WE1B 1UPPA 4PYDA 1NZ8A 1U25A 3ZC4A 1AFJA 2UXBF 4DL4A 2DO4A 2NXJA 1UTAA 5C25A 1HNIB 3Q23A 3BO3A 2VD3A 1S6QA 4EEYA 2XHWA 3AQPA 3NY0A 4DF4A 4PG5A 3CW2C 4ECSA 3T5LA 1DLOB 1VYAA 1C0UA 4N8NA 3GSDA 2YY3A 3LP1B 2MZSA 2VPWB 5HLFA 3SSSA 3DRSA 2MKHA 2ZE2A 2XMMA 2AJ0A 2K7JA 3LP0A 2KN4A 2YNFB 5GMKa 1IKWB 1GXLA 1SKUB 4MIWA 5GAEU 1VRUB 3MMAA 4EK2A 1CULA 4WJBA 2QLBB 4OX8A 3K5NA 4IR1A 1CG2A 3TARA 2BANA 4XAKA 2FJXA 4LREA 1B0VA 5ITHA 2HNZB 1UVJA 1QAIA 1F9EB 1VCTA 5KFDA 2F9DA 1JLEA 1K1QA 2HZVA 4KKOA 4KSEB 4C9DA 1BD6A 1PJ7A 3TANA 1KLMB 1ZA1B 2VQEF 5CCMA 5D3GA 4ED5A 2PC6A 3G8SA 2HQCA 2V4QA 4PZVA 1FD8A 4WWSA 3V6JA 5B0AA 4C8ZA 4Y6IA 3TUZC 4QWDA 3HCXA 3T1YJ 3D3CJ 2Y0BB 1G2EA 5HSPA 2R7SA 1SKRA 1O0PA 4OHXA 3M1VB 4ZCMA 2WB4A 1H2UX 3BR9A 4FZVA 3ELHA 2ZC4A 3HFVA 1VQKS 1JK9B 4RW4A 3M6XA 3BSOA 4FXVA 1J5EF 1Z4UA 1W2IA 2LFVA 4JI1F 3CCJS 3CCVS 2Q43A 2KM8B 3GFXA 5AE2A 4A47A 2ZVSA 3DOLA 3LH2S 3DGPB 3Q24A 3TQ1A 2ZJQQ 1YJ9S 2VODA 1RWVB 2XY5A 2K7KA 1FRHA 1PKUA 1VI7A 3PRBA 4M5GA 3TUJC 4EGLA 1FX4A 4U95A 1U26A 1WF2A 4LRDA 1FRLA 5F0WA 1NJZA 1ZZFA 2P9EA 4L75A 2UXDF 4F02A 2YWKA 3VZHA 1JJHA 5HMZA 1RISA 1BQMA 1OO0B 4HR2A 2KXNB 4ZLNA 3D4JA 1SXLA 3QWUA 2QA4S 4NCGA 2CYYA 3ISNC 2ROEA 1REVB 4C48A 3WC0A 2ZC3A 1U47A 4E8UA 3Q83A 3ZTOA 5A2QU 5H9EK 5A8WB 1U6FA 5IV4A 3QJJA 3FFIB 4GMKA 2FJBB 4HTIA 1Y7PA 4KPYA 3QAUA 3KLGA 2WVBA 2ZBPA 4O44B 1KS2A 2E5HA 4K7QA 1FKOB 1Q95G 2P6TA 1FHTA 3VZIA 3LGNA 3GE9A 4I4BA 4WKRA 2XZDB 1VK3A 4ED2A 4Y3CA 1XNRJ 2QA1A 5I3PA 4WFAQ 1RTJA 4IRCA 1CJVB 2B4VA 2FIUA 2HBYB 4O4RA 2RS2A 3R97A 2YQ1A 4P72A 4F8RA 1IBKJ 3CTRA 1DURA 3E8OA 2YPZA 2M2BA 4YDDB 1PYOB 1VGYA 3KLHB 1LQ9A 4HHJA 2BJDA 2QV6A 1FWLA 1RTIA 5K14A 4RLEA 4J9NA 1WG4A 4BC7A 1S77D 1D9FA 4D3HA 4RL1A 3SQGA 3OHAA 2IRXA 3QT8A 2AWZA 2KM8C 2NLWA 4MK9A 2XMAA 2VG6B 4XO0A 4KGMA 5KG1A 4DPTA 3C46A 2GO8A 3OR2A 2AYBA 2LXUA 2OKQA 1EETB 5M2UA 1TK5A 3KFWX 1VC6A 4NLGA 4ZIWA 2J9EA 2JFKA 3I9ZA 1YBTA 4C3LA 2IBKA 2PGCA 1YLXA 4JUZA 1EP4B 4F4XA 4RX6A 2B9YA 4BLGA 3O6QA 5I42A 4LSZB 2ABYA 2X1FA 1RZMA 1HW8A 1FXRA 1TL4A 1W25A 2GS8A 3G6YA 1SC1B 4J9PA 2LU2A 4LF7J 3WIUA 2YX4A 3EGVA 3THVA 4ECTA 2PI4A 3DCAA 3PRVA 1RHQB 2W2OP 5A6PA 2J6UA 2BQUA 2ZHOA 1RT6B 4DFMA 3H2VE 3IN5A 2PFFB 3QIDA 2UV8A 3B54A 2OFHX 4IOCQ 3V4IA 4RW7A 4OYIA 4LRCA 3T6JA 4DR4J 3CCTA 2A0FB 4ED8A 4C4WA 2ILZA 4UOGA 4ZCIA 5DQIA 1N54B 4WFYA 3OTDA 1UL3A 3ZO7A 4UZBA 2A3JA 3ZFVA 3UD3P 2KU7A 1SJQA 2HBZB 4DR3F 3R1LA 3B8HA 3CDUA 2QG9B 4ECQA 4ZVTB 5H9FK 5E33A 1N32J 2FHJA 3CDWA 3O3LA 3QZ8A 1S6PB 5AXNA 4KH0B 1KFDA 3AXKA 2KT2A 2HWHA 4LF8J 4OYBA 2VOOA 4PYAA 4QBUA 2OSRA 2Z57B 2VPZB 4NASA 3US5A 1S7IA 1I6JA 4Q7AA 1N5VA 3D67A 2PI5A 5IQQA 3W7BA 4R0JA 3K8VA 2OPQA 1A0OB 4FVCA 2KJVA 1HIYA 5DM7Q 2EVZA 2AZ3A 4CH7A 1FRKA 4DV0J 1T03A 3BQ0A 2UVUA 2QA4G 3THTA 1TKZB 2CPEA 2D69A 1UJ4A 1S48A 3CD5A 2FLPA 3TP2A 1UA1A 2JH3A 2IVMA 3RRGA 2LP4A 5L9XA 2HFUA 4YEAA 1CEZA 3AD8C 1M5SA 3BN7A 2ZNYA 4LVNP 1X4DA 1V3RA 4WPAA 4BS2A 5KFZA 4R8UB 2HNYB 1P1LA 2H5IB 2VU5A 3KMSA 1RHJB 3BGOP 2OMLA 3QAEA 2B43A 1UPMB 4M5MA 1NK7A 2C42A 4LR7A 3IXQA 3ILLA 4S0MA 2VA3A 3VWSA 1F1BB 1KD1T 4K8RA 4O3NA 4JI8J 1D09B 2QJ3A 2WRMA 3DXSX 4DV5J 1YDLA 3KK1B 2VFVA 3JAMY 1S4FA 5GADI 4NRUA 1FX2A 1SC6A 2XMKA 3C19A 5B0BA 5JXSA 2GAHC 4PXBA 3ZNUA 3I5CA 4G1PA 1AB8A 2XI2A 5C5JA 2MQNA 2I0XA 1YKWA 3H4DA 5IM0B 1RAAB 1U1QA 1LWEA 1VS3A 3IP0A 4PXDA 2Q6BA 1G4CA 3CXCR 2OMOA 1NSPA 2BMBA 4DCJB 2LMIA 2KHCA 1S1VA 1U1LA 1HNWJ 3VAIA 1IKXA 2C3YA 1WHXA 4CLFA 2MQQA 5GAGI 1C0UB 1SCJB 2VFUA 4Q0BA 4DOZA 3PX0A 2RQMA 1JLFA 1PO6A 5HLFB 1CC7A 3DRSB 1IQZA 4NLOA 2ZE2B 3UCGA 3RBDA 4U96A 3R9LA 4E0DA 5FLXU 2XMUA 3R3TA 3CSKA 3QQCD 3W65A 2GHPA 3PW7A 3AJDA 4C8YA 4QIFA 1MMDA 1JQGA 1VQLS 3MMAB 1M1GA 3I4HX 5KG2A 1CULB 3W66A 2CA9A 1N36F 2R7QA 2HHSA 1N5SA 2BANB 4Q8FA 5HI7A 1UFKA 3M30A 2LEAA 2R2UA 2V69A 1I1GA 4F67A 2UU9F 2QLFB 2DGQA 3K17A 1JLEB 1R8HA 4LSNA 3QNWB 1IWAA 4KKOB 4DG1B 4TXSA 4NE9C 3TJAA 5IOLA 1TUVA 4YN3B 1QUVA 3CJ0A 2KKHA 3OVSA 2ZOGA 1LV5A 5F3ZA 5D3GB 3G6XA 5K20B 2YX7A 5KG3A 2K06A 3KJFB 2NYHA 1FT8A 1ZAWA 2AKWB 1X9SA 1F5CA 3FZBA 2YKPA 1NBEB 4L3KA 5FDLA 5C2GA 2VZ9A 1WSRA 2QFIA 5JUMA 4R25A 2J7UA 3CIMA 5DDQC 4AYBD 5CH7B 4JV2A 3QO9A 1TKXA 1S99A 3GCXP 1N8RT 2CWXA 2KG0A 1UCNA 3CCLS 2O5DA 1Y10A 4F26A 4J9KA 4BHQA 2EPIA 3PO5A 4BWMA 1IWGA 4HHHA 2BRKA 2R9LA 4R0EA 4UQGA 1XMBA 2KYXA 2B51A 3DOLB 4X4QA 1S0MA 3JS9A 4YR3A 2V68A 4HT7A 1N5YA 1X4GA 2BA9A 2FYXA 2FJWA 1YSJA 1NHUA 3MZIA 4BWJA 2H4WB 2HZAA 2FHJD 3NMRA 4C8KA 4DF8A 1XEZA 3UR3C 5KFSA 3VF0B 1BQMB 3IRWP 1DRZA 3GILA 2E44A 1C4CA 4HVZA 4ZVSB 4NCGB 2DR5A 3R5BA 3U1MA 3SBMA 1VMBA 2F1FA 2AT1B 1R6YA 4DR2J 2V9WA 3VQTA 3PM9A 1N4LA 1KFSA 3D28A 4AL5A 4B3RF 4A8MP 4ECUA 4RO0A 3HFZB 1ITPA 3HZGA 1BWEA 2HKEA 1Y5LB 5HO4A 4LQ9A 4JI0F 4ZS6A 1CJTA 2VG7A 2V5HG 1KLNA 1N5TA 4TLQA 3PX6A 4AXIA 2W01A 3H98A 1QVFR 2FLOA 1HKAA 1VDHA 4FF2A 3N6LA 4CO1A 2ZWOA 5EX0A 4KH1B 5DS7A 2UUAF 4J9UE 1RTJB 1VQOS 4KBIA 4OZJA 3GG0A 4PR6A 1U2FA 4J9OA 4IUFA 4LF9F 3VGVA 3QJPA 4RW6A 1IR1A 2HGMA 4DL2A 4KAIA 2ZM6J 3MR5A 1RKIA 4KC5A 3LANA 1PSDA 1WELA 2DGVA 2E1AA 2W8KA 2CKWA 1GTHA 5K14B 3I9V9 1NPKA 2KXHA 4X64J 2B6AB 4CNZA 1G6BA 3Q2TC 4IOAQ 4KHRA 4WXWA 5I3QA 2CNLB 2YX1A 4OJGA 2CQ0A 4CLKA 2SXLA 4HH0A 4WZQA 5HQMA 1TQLA 1SL0A 5ETRA 2ZH3A 4ZVOB 2ZH7A 2N4DA 3GFYA 2E5LF 3DNCA 2LA6A 3BBCA 1MN9A 2AF6A 3BYRA 4P71A 3X3UA 2XWXA 3OR2B 1S1TA 2BOPA 1JXEA 2QL5B 1SJFA 3TZZA 1C1CB 3I56S 2V94A 5I42B 1WC6A 4JV1A 3QYYA 4H54A 3ULHA 2C22A 3U02A 4KY3A 2PIIA 1UW9A 2V4RA 2C2OB 3TA1A 4C11A 1K0VA 2DHGA 2BM0A 2V4JA 2XB2D 4U7UD 2YXLA 3CJ5A 3W9IA 2XGPA 4Y2AA 1IXKA 2OD4A 4YOEA 1SC4B 3BF4A 5KFEA 1REGX 4QPTA 1VJWA 3FRZA 2LECA 3NP5A 1OSCA 3P3DA 4DV2F 4RW7B 3RU0A 3IGVA 3FCWA 3R5GA 1FWPA 1A9NB 2WSCC 4DR1J 3P8BB 2RRNA 4HI1A 3SCJE 1FCAA 3PR5B 2DYAA 4Y00A 5KT5A 3DN9A 4ZPVR 3IM9A 3PYDA 4J9QA 4QZVB 1HA1A 2F8EX 3UDEA 4ANDA 3QGHA 4QPXA 3ZTQA 2MLYA 4LFBJ 3OTOJ 5F8GA 1SC3B 3NOGA 3EXYA 3IM8A 2Z0GA 2ASJA 4LT6A 3H5YA 3BGFA 5IS2A 3DM2A 2YH1A 4ZVFA 4ECXA 2Z56B 2HWTA 4AD6A 3VGUA 4ED6A 3AB4B 1QM9A 1T9XA 2CDRB 2ZH8A 4OV1A 5L46A 3CNQP 5E2QA 1Q16B 3EM1A 1FKAF 4OZNA 4A8KA 2OTJS 3HPOA 2P8IA 1S9FA 4JI3J 2OPQB 1WDDA 4TU8A 3BKFA 2FDNA 2OTLS 2O66A 3PCOB 1YRTA 3GR1A 3W8GA 4CTAA 2ILYA 1OY8A 3U27A 3UE2A 1HI0P 2BJ1A 3KTQA 3LP2A 4FBTA 2B8PA 1GEHA 4PABA 3K5MA 3HF5A 4OX7A 3M2UA 2AMCB 1G3OA 3T19A 2A18A 3QGGA 3QIPA 2UXCF 2C2DA 1KNZA 5HP1A 3UPFA 2DIUA 4P2SA 4K4SA 2GC8A 2JJ4D 4OZ0A 4LJMA 4DLEA 2ZFHA 1R0BG 4JI2J 3VQSA 1NHVA 3AD9C 2XEXA 2G0JA 1NEEA 4LF6F 3UDLA 3DMJA 3FKBA 2IAJA 3CMES 5J2PA 3DRXA 3QLHB 2BBEA 2R8JA 3ADAC 5KG4A 4K4ZA 2CQBA 2H5EA 2AD9A 2Z2YB 4LF4J 3GYXB 1D3WA 5ETLA 3MR7A 4DSIA 2HHUA 1FERA 3CO9A 3PKYA 3MPYA 3B4DA 4DUZF 3AQOA 1R0CB 4GVBA 4ED1A 1LWEB 1T0TV 2XHCA 1XTZA 3EVWA 4AUKA 1R8AA 1SPBP 2W7AA 4O23A 2BE7D 1S1VB 2HAIA 2PFDA 1IBLJ 1IKXB 3NGDA 4WU2A 2DO0A 1NKCA 4Q0BB 4IG3B 4DJBA 3JQJA 3QSYB 3DC2A 1VBKA 3R5JB 3K58A 1Y0HA 1TVRA 1X4HA 3D0HE 4UF4A 3IO1A 5ETQA 4B3TF 4JV5J 3CJTA 2LVWA 4P74A 3UD4P 1S59A 1CC8A 3H2LA 3LALA 1HNZJ 3IR6B 2OPSA 3B78A 1Q4RA 2YKMA 4ETXA 1RWXB 1KWMA 1FF2A 4NOHA 1X0PA 3BN4A 1FXLA 2JL9A 3MPDA 3M30B 3RUBL 3NGSA 4JB8B 1Q7YT 3TO8A 3J7ZT 4MJKA 3BH7B 2UUTA 3WX8A 4LSNB 3PFEA 3CWJA 4NXMF 2R7WA 3D66A 2VONA 3OTEA 1S49A 2LQ9A 3OSPA 4RR5A 4WXOA 3VHQA 2EI5A 5GAHI 1N0UA 1R89A 4J5OA 1GH8A 4ALZA 4DV3J 3UW1A 4CM2A 1GFWB 5KFGA 3S1TA 1U6ZA 3FK4A 4FXWA 3BSNA 2WSEC 3BB5A 2V34A 4USMA 4YR0A 1S76D 2CJBA 4DR6J 3QO9B 3EX7B 3A4TA 1H7XA 4KQZA 4NWBA 2NREA 2OHDA 4C8NA 4ED4A 3BO2A 1IVZA 1MROA 3BSCA 3A12A 4WK3A 4LR9A 2HIQA 4NXNF 2OUGA 3T1HJ 1PAUB 2IM1A 1UWBA 2UV8G 3UN3A 2K8GA 1S0VA 2POKA 2WBMA 2H4YB 4ZVRB 1D9AA 1F6TA 2UUBF 4OYOA 3PYEA 5HK4A 1X4EA 1U45A 3PO4A 2NSBA 3NNCA 2AW0A 4NRTA 4MH8A 4RKUC 1M5VC 2IMOA 3MD1A 1N5YB 3NLCA 1NM2A 1XNQJ 2F7VA 2FVPA 3DYAA 5CYJA 3NGRA 4HKQA 1WC4A 5KFIA 2V0NA 3BH6B 3W62A 1M1KT 9RUBA 3KLFA 1Q81T 3FMWA 3A8EA 2BKPA 1T9VA 1XIQA 2GQQA 3M32A 4IRKA 1BQXA 4Y28C 1T05A 1PJ6A 2CWKA 3M05A 5EUHA 4NZ0A 2OIHA 3AB2B 2MQPA 1TAUA 5KFLA 2JFDA 3HKWA 2RMLA 3BYPA 3HSJA 2ZD1A 4CO2A 1YHQS 2ASLA 2XSJA 3BR8A 3I0RA 3M7VA 4UY8T 1RWNB 2HHTA 5LMNJ 5HROA 1CLFA 4NI2A 3KK2A 3MUTP 1FNOA 1UWAA 1D9DA 2V2ZA 4N47A 1OY9A 3G86A 3C15A 3N4WA 5LSOA 1CJTB 2VG7B 1Q86T 2V67A 3HLUA 2FC9A 2IDEA 3IBFB 2GNKA 1GMVA 4ZPAA 1XMQJ 2EK1A 1M5HA 4NLUA 5F9NA 4U67Q 2IHR1 1ZM9A 3G82A 1LXNA 3EZUA 2D41A 2KG1A 1RLCL 1XMOF 4J7CA 4M5NA 1NU4A 4CT9A 5IWAJ 4RW6B 5LSLA 3MTKA 1HBNA 3J81j 3R7NB 1Q82T 4HTJA 3TX8A 3UFCX 5LJ5Y 2EW9A 3GFHA 2WONA 4J9SA 4PRFA 3MM5A 4YY3F 2M88A 4KYZA 4FXDA 1EQMA 4KHPF 1VQ6S 2MZTA 5B0EA 2VDHA 5J1NA 4IO1A 3P49B 3K7RA 1QTNB 2K1RA 2ACMA 3H20A 2CVIA 1HL6A 2Y1RI 4J9VA 1NJYA 4C3KA 4YP3A 1S1TB 2E5IA 1GXUA 1SKSA 4B3MF 4JYAJ 2XQCA 2G2ZA 1IR0A 2MPUA 4A8QA 4OI4A 4USHA 4JI5F 1NH7A 2GHWA 2RVJA 5E3RA 2ZDOA 2EFVA 2YKOA 1IJFB 5HANA 4RWXA 1HW9A 1WORA 3HSDA 2HIYA 5DJBA 1PBUA 2J8SA 1U49A 4X4RA 2CQCA 2RJZA 4C11B 3EZOA 2XY6A 2J0XA 2CQ4A 8AT1B 4WTYA 1XC9A 4WFNQ 4F4ZA 2XI3A 4LF5J 3SFUA 1TU0B 2OEKA 2CIMA 3CDBA 3LAKA 1FO1A 2DHHA 1KRPA 2DNKA 1RT3A 5F0UA 2I2YA 1X8DA 3Q8RB 3DDNA 3HT3A 2BE2A 3O2IA 2MHEA 2C2NA 1LW0B 3IFEA 1VLYA 5KFMA 4QU6A 4KJIA 4Y2CA 1BLUA 3NS7B 3JYTB 1FDAA 4DV1J 2XMVA 3ENAA 2D7SA 3W64A 4RZRA 1MSWD 5A0YA 4LIRA 2QMUB 1T94A 1H3DA 1R0AB 2XULA 2Z8QA 1QSLA 3BO4A 1RTZA 3OFGA 1VFJA 3MFIA 1NK0A 3X1LB 3T9ZA 1LW2A 1WC3A 3DM2B 3FBBA 1GQEA 3RB0A 1SQEA 5B7WA 3S6EA 2W1BA 4F25A 2VOPA 2CAJA 2L9WA 4NLRA 1H0HB 2OPRA 1TL3A 2AGQA 2DNNA 3W3SA 4ILMA 1HNXF 4DL7A 3MGJA 2C2ZB 2J7WA 3KHHA 2RB7A 2R7VA 5AXKA 4TVAB 5JVGQ 3TAPA 2KI2A 4CTAB 2DR7A 1RWKB 4TNOA 2AGOA 2XM3A 2AJ4A 1FRMA 1WSVA 3LP2B 1F60B 1WG5A 4LUBA 3HZEA 1JLQA 3M2UB 3NAHA 3L09A 5CQGA 3QFHA 1VIXA 5AXMA 3T1AA 2VB6A 5FJ4A 5KG0A 3GJTB 3AY0A 1SV5A 2IYIA 1N56A 1KEKA 3M9OB 5EDWA 5HP1B 4ILRA 1ZTTA 2HRTA 5AXLA 1RA6A 2CG4A 3HULA 5CCLA 1RWPB 4OI6A 2W2MP 3W2VA 4Q43A 3D68A 4B9NA 1RBAA 1AT1B 1RJJA 3DMJB 4F36A 2IAJB 5J2PB 3J7AN 4ZP8A 3TUPA 4TY9A 1VQSA 1FVSA 3KKFA 2V9KA 2IRUA 2VJVA 4M95A 2G4BA 3W2WA 4GKJJ 2DRDA 4PWWA 2E9RX 2B9XA 4OIXA 2DR8A 2D3O1 3EUNA 3AJ1A 2R8HA 5A76A 1ZZNA 5AJ3J 4L6V3 1S0OA 3RBZA 1O8BA 4N5SA 1Q0NA 4L76A 3CC2S 4UW2A 2GIQA 5L9NA 2XMJA 4P2MA 4C97A 2FLNA 2RDJA 4CLTA 4A48A 4RUBA 3LWMA 4GO5X 1WOOA 1VQ7S 4DBQA 3Q0AA 1FE4A 5LXRA 2WVCA 4DLGA 2O1PA 2YNIA 4Y34A 1RSCA 3OXFA 2HVZA 4ZCLA 1TVRB 4O4GA 2FJDB 3TR5A 2MSTA 3GYNA 4P7VA 2EG1A 1UEUA 3LGHA 5H1SV 5L1KA 1AA1B 2OPSB 3N5BA 4F04B 2YKMB 3CJSA 3AT1B 2DXDA 4CLZA 3N6MA 3CT9A 1VRUA 1IUJA 4A8FA 4M5JA 2YNHA 4LRFA 2CVEA 5BYQA 4DSEA 3EZ5A 5KT2A 5HJYA 4CNYA 4F3MA 2RQ4A 1TFYA 2HVHA 1VQYA 5KFOA 1FNXH 3EYZA 1DY3A 3I32A 1NPRA 4NLTA 3H25A 3TUIC 3OPKA 4O3RA 2Y1JA 3FRYA 3A3NB 3HP6A 1KLMA 2OGUA 4X2BA 2PSZA 1TFWA 2FHKA 3EGNA 3PY8A 4IOBA 3QRQA 2MQLA 4LR8A 1I94J 4DPWA 3CO0P 2X7IA 2CQ3A 2NPIA 2HHHJ 4I2PA 2GV1A 4OYAA 3G2XA 4OJ1A 2MY8A 3E2EA 1S1XA 3E3XA 1MROB 2M4MA 3GYGA 4DMZA 3CMQA 3HX9A 2K3KA 4NCAA 1IBMJ 3SIPB 1YGYA 1TAQA 1OY6A 3DOKA 2YWEA 4E2FB 4MKYA 3I96A 2XZTB 1EJ7L 2ZZMA 1NSAA 3QJLA 3HVTA 4UTGA 3UR0A 2BX6A 5LM7E 3KUEA 5HVGA 1WJ9A 3T9NA 2B8QA 2NCKL 2VFTA 3DGPA 3DYAB 4B9LA 2QTWA 4K4UA 5CHCB 3KLFB 4DV7J 3WHIA 3GONA 5K8NA 1K47A 2W9BA 4G65A 1DTQB 3M32B 1GMUA 1C2PA 4OQJA 1T05B 3RG6A 1XNRF 3ZZUA 4W98A 2ZEJA 3KDOA 5D0RA 3UQSA 3MCSA 3FEZA 4J91A 3OQ2A 2FJVA 1UMJA 2ZD1B 2XSJB 3I0RB 4Y2KA 1IBKF 4KHMA 3HHLA 3BPDA 2MGZB 4JV0A 1RT4A 4XTTA 3CCSS 5HROB 1YVFA 4DUYJ 3KK2B 4X84A 3J80Y 2IJNA 1YJVA 2JVOA 3PJ9A 1UZDA 1V5VA 3C15B 3BQ2A 1LFPA 3I82A 2AX0A 3CEDA 5M2PA 5THWA 4O3OA 1C4AA 4CH0S 4ANEA 5GAGU 1VK8A 1RQ0A 4YB7A 1JXVA 4FKYA 5D4PA 4IQMA 4NPOA 1T02A 2HNDA 3G82B 4F4YA 3G6VA 3VGSA 3IWNC 2DRAA 3BPSP 4WZMA 4Y65A 1CJKB 5BYRA 1SL2A 3LW5C 4WU3A 2B4UA 3P5BP 1HBNB 3NNAA 1CJVA 1C0TA 4RWWA 2WONB 3OT9A 2OP5A 3MM5B 2MQOA 4TY8B 4LF7F 3KLHA 3FSXA 3UN2A 3D9BA 5RUBA 2E7VA 2PEHA 1ELOA 3ZTSA 5C42A 1WC5A 2KH9A 3TZWA 4OI2A 1WOSA 2K1RB 4RBTA 5HVHA 2CJ9A 1OWXA 2BE9B 2XLJA 5KT4A 2WTFA 1HQ2A 5LJ3Y 1ZAVA 3JTPA 1F5AA 3GIKA 2VPXB 2FHMA 4PG8A 1S12A 4P10A 2DNMA 1ZPWX 5AE1A 1RDRA 3SCIE 3CVKA 4DR4F 1GK8A 2H51B 1TUGB 1N34J 5BYSA 1HHQA 2C2EA 1YJ7A 3H5SA 1O5JA 4UZCA 3OUYA 2IY5B 5AE3A 4IR9A 5C2CA 5DZ6A 4ZVQB 3RW7A 2RRBA 2G2YA 2HVIA 4M5HA 1HFEL 3OJSA 4IH6A 1U02A 4LFAJ 2RSQA 2DKOB 5HQLA 2C28A 3VAFA 2NYIA 2HSEB 1AROP 2QIFA 1RT3B 1FTRA 4FF4A 4LF8F 5KT6A 1KTQA 3O1LA 4QQBA 2BE2B 5KFYA 3TA0A 3GIMA 4YS2A 3J81Y 1NH8A 1IM6A 2G2OA 4FS2A 4B9SA 3KJNB 4ECYA 3U1NA 1FA0A 5HBMA 2HFOA 6FDRA 2FJEB 1RAOA 4JBCA 1U1NA 4DV0F 2OLWA 4WF9Q 5EN1A 1NB2A 1FEEA 1YRUA 3KWMA 5CD4H 3OL9A 2CZ9A 2HLUA 4QYRA 5A0YB 2BW2A 2HS3A 2VQFJ 3JSYA 5F8LA 1TL7A 5B08A 1GAOA 2DNRA 1OQ3A 4CO0A 5B0DA 1LW2B 2MJNA 3W5XA 1ZH5A 3UCUP 1TELA 3FBCA 3QPIA 5BJRA 4K4TA 3SCLE 1U09A 1TL1A 1TKTA 3Q2SC 2BYCA 2J9CA 4M63A 3RRHA 2OPRB 2R8GA 4F2SA 4B9UA 2HQGA 4KGVB 5B0FA 1N36J 2DGWA 1ZA2B 3NEKA 4DN9A 4JI8F 3OW2R 2CQGA 4ZPTR 4DV5F 4FKXA 4TN2A 4MIAA 3SCKE 4FYYB 2W8LA 1UFWA 4ZCKA 1OS5A 1S1UA 4USWA 1JLQB 4LFCJ 2IC3A 3MMJA 1JLBA 3QT5A 2ZBIA 3P96A 3V5RA 1L3TA 5DQGA 1SV5B 1CPZA 1UVMA 3U1LA 3GLJA 4KE5A 4MYUA 2R7UA 3BGLA 1L5UA 4OHWA 2EFPA 4URGA 2LXIA 2MJUA 3GSIA 3HHLD 1EKRA 1FWKA 1ZOTA 4KGXB 4XDCA 3GV7B 4C7QA 2C3PA 3RTVA 1S6UA 4BDPA 2CPDA 2QGFB 4PCQA 3W2WB 1RU2A 5CZXA 2J0QD 2V63A 2CQHA 1S72S 5IZHA 1YRXA
chains in the Genus database with same CATH topology
3DNCA 4MKBA 2J5AA 2LA6A 2AF6A 1Y5IB 3J7Z5 3X3UA 2PA8D 2VC1A 2KRBA 2XWXA 2YWFA 3OR2B 2CJKA 1S1TA 4RW9A 2LQJA 2BOPA 1JXEA 1IJEB 3SI8A 4K5SA 2KB2A 5KFFA 4NA2A 3N28A 3M6UA 4KB7A 4RNHA 1JKHA 1SJFA 4DN0A 2ZITA 3OFHA 1C1CB 2A2DA 3K8WA 4DEZA 2GMHA 1NJIT 3LUYA 3I56S 5E3PA 2Q3PA 3ETOA 1FRIA 3TRGA 3V81B 4RUCA 4K4XA 4XIUA 1ZPVA 3DLHA 2MGZA 4YB5A 3PJWA 4EO6A 1FXDA 2V94A 2L48A 2DNYA 5IM0A 5I42B 1Z2ZA 1V3SA 4K4VA 1PC5A 4JV1A 1WF0A 2HS0A 4I67A 3QYYA 1V9OA 2JDJA 1RI7A 4H54A 2RD5C 2B0GA 4WYWA 3ULHA 5D6GA 3ENVA 3OTCA 2C22A 5F41A 3JSRA 3M1VA 3U02A 1F5BA 4QR1A 4ZPDA 3PW0A 2PIIA 2V4RA 3MAQA 2GJ2A 1UWBB 2M9KA 3BGRB 3TA1A 3UI3A 1DHMA 4C11A 1UP1A 2DHGA 2YNIB 4L72B 4URQU 1P27B 5KFPA 2BM0A 3MURP 3F73A 3NCQA 4FS1A 3HFKA 1SJ1A 2V4JA 3CB4A 2XB2D 5KG5A 5LMUF 2B7CB 3CJ5A 1YJWS 2R7TA 2VBXA 3SFGA 4I6WA 3O5TB 3WBZA 3NBPB 4EYIB 2XGPA 4MIBA 2LEBA 2LU1A 4O4GB 3CCWA 3RBEA 2XWYA 3M8SA 1YITS 3GB0A 2A1BA 5F8IA 4Y2AA 3OLBA 4A8SA 4WK1A 1IXKA 2OD4A 4ZVEA 4LMZA 4I7FB 2EC0A 1RA7A 4DV6F 4YOEA 3BF4A 5KFEA 2COLA 2ZH4A 4B02A 4ECZA 3VCDA 3HK2A 4QPTA 1VJWA 3FRZA 3GG1A 1F0XA 2LECA 3NP5A 1OSCA 3P3DA 4DV2F 4RW7B 3RU0A 1N34F 1U1OA 4DWIA 2EWHA 4FNHA 2B4OA 4C0OC 3EPIA 4NZ7A 1X9WA 3SSQA 2D9OA 1XK8A 4MFBB 4NYOA 3IGVA 3UNGC 1G1XA 1JLCB 4ES1A 2LDIA 4LVOP 1A9NB 3L3CA 2WSCC 4NLSA 1SI9A 4F2RA 4TQSA 1VHFA 2RRNA 4HI1A 5L1IA 2YNHB 3CJ2A 1HBMB 3SCJE 1FCAA 1NK8A 3PR5B 2XLIA 1NK6A 4TY8A 4Y00A 5KT5A 3DN9A 2R2RA 3ITHA 2CQDA 1HI8A 1RTHA 4ZA1A 1HYSA 3OJUA 4AQYF 4ZPVR 4WKYA 5CZVA 4X65F 3KK3B 4J9QA 4QZVB 1HA1A 5KFXA 1U4BA 4G3IA 2B3TB 3PXGa 3MWBA 4F3OA 2F8EX 2NUUG 3G9CA 2FHOB 2RDIA 4LFAF 1ZM4A 5G4DA 3JSMB 1HBUA 2EK6A 2HHPA 4CO4A 5L39A 3CIZA 3BSAA 4EYHB 3QGHA 4MMOA 2N7CA 4QPXA 1YJUA 2MZJA 2B7BB 2Q79A 3N6NA 3I5BA 2VBWA 5F8GA 4PQUB 4X4OA 5LSRA 2GGPB 3EXYA 2Z0GA 4P7TA 2ASJA 1S9EB 4DG1A 4LT6A 1N48A 2MKKA 3H5YA 4IFVB 4ED0A 2ZOMA 3SV4A 3GFYA 3BGFA 2X1BA 5DQHA 4B08A 4G1QA 3DM2A 1WHVA 2HGNA 4TLRA 4ZVFA 5IS2A 5J2MB 4ECXA 1REVA 3HXMA 2HWTA 2LQBA 4ED6A 3KG0A 4NL5A 3AB4B 1KSPA 5C25B 1QM9A 5E0OA 1SH2A 2ZH8A 4IDKB 4OV1A 2MKSA 3H4BA 3VAGA 5E7OB 1S6QB 2Z2LA 5E2QA 3SEOA 1Q16B 3Q8PB 1CQNA 2KYZA 4DPOA 2PE8A 2NS1B 5A8WA 1FKAF 3HHKA 2N4CA 4OZNA 1LWFB 2DNHA 2AJQA 4A8KA 1TP7A 2XZWA 4DSFA 2BM1A 1FTCA 3FFIA 2W4PA 3HPOA 4DL6A 1KR4A 1N88A 2L3MA 2RUGA 4I2PB 4UY85 1S9FA 2R7OA 2J8AA 2OPQB 4B9MA 4TU8A 3NCPA 2FDNA 2OTLS 2AX1A 4ECWA 1S1XB 2O66A 3MECA 4KRWA 5M2RA 4X4PA 4O44A 2DGXA 5K8MA 1M0SA 5CA5A 2BVZA 1FKOA 3TVYA 2Z4PA 1YRTA 3GR1A 2VQFF 1L3UA 4CTAA 2NXUA 4OHZA 1VC0A 5HQ8A 2ZHAA 3C66A 4UUWA 2ILYA 4USJC 4YMEA 2JEFA 4OFZA 3CDEA 4RW8B 3U27A 4DQIA 3UE2A 2DPIA 2DISA 1YJTA 1HI0P 3CULA 3I6PA 1VIOA 3KTQA 4M8LA 3LP2A 4FBTA 4Y2MA 4I2QB 3L7PA 3JTNA 3K57A 3LP0B 4M94A 5B0CA 3K5MA 3DOKB 2ZH9A 3D1QA 3HF5A 1X4AA 4OX7A 3CJKB 3M2UA 3F41A 1WACA 2N3LA 3EXCX 3F44A 1S0NA 3C8YA 2FTRA 1G3OA 3T19A 4RBVA 4EZ6A 3HVTB 4PWUA 2A18A 5K8PA 2AYGA 2CJAA 3QGGA 3MMBB 3QIPA 2JEJA 4Q44A 4WFBQ 3H8YA 1KQGB 4KO0B 2IJFA 2UXCF 2OFGX 1RT2B 5K5MA 4YDXA 2OJ3A 2C2DA 2WOMA 3SMZA 4WFXA 1KNZA 3SDEA 3NAIA 4TU7A 4I64A 5HP1A 1QAJA 3C2PA 3UPFA 1L3KA 2E5GA 2DIUA 4P2SA 4K4SA 2GC8A 2QZ8A 2JJ4D 2XO7A 2BJEA 2VBYA 4OZ0A 4LJMA 4DLEA 3NG8A 2ZFHA 1N5QA 2G1DA 1FDBA 3D5MA 1YI2S 2BR0A 4DR6F 2MZRA 2W9BB 2JRSA 4IYQA 2DITA 4O3QA 1NHVA 3VQSA 5HMYA 4HYKA 2W24A 2F9JA 2XEXA 2P6SA 3IWXA 1QJHA 1NEEA 4X4TA 2DBBA 4LF6F 2XS7A 3UDLA 5F8HA 3DMJA 1ZTWA 3R5DA 2IAJA 5F8JA 1QVGR 5J2PA 2QMXA 2B56A 3FDSA 1U2RA 3CMES 3DRXA 5KFVA 3QLHB 3MUMP 2BBEA 2R8JA 2XNRA 2EBGA 5DM6Q 2ZKUA 5JJBA 4KFBB 3MI7X 1YG0A 5KFUA 5KTQA 5KG4A 1MU2B 1J5OB 4QIWD 1U1KA 4K4ZA 1KVIA 1WHYA 3KLEB 5B09A 4LFCF 4H4KA 5A2QY 2CQBA 1HPZA 4NLDA 3A1YG 1HWIA 1DAXA 4RUHA 1WEZA 2H5EA 2AD9A 3T5KA 2CZ4A 3R1HA 2KXFA 1IQTA 2VG6A 2EG2A 3GYXB 1MWYA 2GMLA 2QO3A 1D3WA 2KDOA 1Y9OA 2LQ5A 2MHNA 1XR6A 2BQRA 1WD6A 5DLFA 4DSIA 2HHUA 1FERA 2F3JA 4NA3A 3CO9A 1KTVA 3HHLB 4PQAA 1FD2A 3UDCA 2ZM6F 1EETA 5KAKA 1DBDA 3PKYA 5DLGA 4G1IA 1SIZA 3B4DA 2BABA 3MPYA 4XDDA 1H98A 4DUZF 3AQOA 3SZ2A 1RT4B 5CYMA 1DQ8A 2GW8A 4OX6A 2MKIA 2VC0A 4OHVA 1JWWA 4KT0C 2XC9A 4ED1A 1M5KC 1LWEB 2FD2A 5IT9Y 3L95X 2ADBA 4DSLA 4H4MB 2LCWA 1XTZA 1DTTA 2DNZA 5DETA 1S7HA 2CPJA 4AUKA 1EP4A 1R8AA 3VAMA 1P1TA 3OHBA 1UJ5A 1LK5A 2W7AA 5A8RB 1ROFA 1URRA 1Y4ZB 5KFRA 3SXLA 4O23A 2DJWA 4EO8A 1S1VB 3GZ7A 5CYQA 4DSKA 2CQPA 2HAIA 4OJ3A 2EKYA 1Q78A 1Z1ZA 1IKXB 5DRKA 4UUXA 3V6DB 3ZZZA 5IT4A 4OI0A 3I4PA 1XR7A 1D8ZA 2KFZA 4XK8C 2I5JB 4RW4B 3NGDA 2APOA 4P6QA 2NZ4A 4WU2A 2DO0A 4O3SA 1XWLA 2ZOFA 3ISND 3PW4A 1NKCA 3ISZA 2E9ZA 1T95A 4IG3B 4PG7A 4DJBA 3MEDA 4Q0BB 4U6PA 3PX4A 3G8TA 2MYFA 2AV5A 4NZ6A 4MKAA 2RNEA 2P9CA 3HKZD 4B3OA 3DLEA 2HNDB 4D3GA 3HHEA 3DC2A 2N3OA 1HBOB 4M1KA 4ELTA 2PA3A 1NK9A 1FE0A 2J9DE 2E1CA 3K58A 1Y0HA 2E7XA 1V6HA 3IG1B 1X4FA 1NNDA 5KG7A 2HHQA 3R5CA 4DQQA 1RT6A 1TVRA 2Q6CA 3CF5Q 2OPPB 1X4HA 1LKZA 3D0HE 1QSYA 3JTOA 3IO1A 1C0TB 4DL5A 3B4MA 1RK8A 4B3TF 2XBPA 3MOJB 3TVKA 5BR8F 2ROGA 5J2NA 4F3QA 1U1RA 3IRXB 2KJWA 2LVWA 2HS4A 6FD1A 2FB0A 2E1MC 3UD4P 4A4JA 1CC8A 1MNEA 3H2LA 3LALA 1L3VA 3KLVA 4BC9A 4W90B 3IR6B 2WB1D 2OPSA 3SYZA 3B78A 1Q4RA 2RT3A 3V4MA 1SL1A 2YKMA 4ETXA 2ZH5A 2N82B 2J7KA 4DS4A 3K5OA 3QZ7A 3C3LA 3RW6A 3T5HA 1FF2A 4CZCA 4NOHA 2LKZA 4N77A 1X0PA 4HLBA 2RRAA 4M5DB 3BN4A 2XSFA 2JL9A 1FXLA 3M30B 3MXHP 1H2TZ 3DHXA 5C42B 1Z2LA 2B6AA 2EFNA 2C3UA 5I4MA 1Q7YT 4PWDB 3TO8A 1NK5A 4JI6F 2YWGA 3J7ZT 4XPCA 5A8KB 5D78A 4MJKA 4I6YA 3C6UA 3I0SA 2UUTA 4LSNB 3PFEA 3CWJA 4HT5A 2R7WA 1R7IA 4NA1A 4NXMF 2VONA 3OTEA 4ECVA 1FJ7A 5KFWA 2IRYA 4NX9A 1S49A 1JLGA 2LQ9A 2VBZA 3IS9A 4QW9A 3OSPA 1AXQA 4ZP7A 4DX8H 3S7RA 4WXOA 1UEVA 3HDSA 1SJRA 2QLXA 1Y3KA 2EI5A 3IR7B 3IBWA 1N0UA 1SUQA 5GAHI 2HMIB 4EZ9A 2GHVC 3PJXA 2VL1A 5K9FA 2DGSA 1R89A 4NYZA 5GAHU 4RNMA 4J5OA 3OXLA 4I68A 4RNOA 1GH8A 4ALZA 5KT3A 3OL6A 4DV4F 5ADZA 3OV7A 2D3UA 2I8EA 4QIEA 2VUGA 2PDAA 2PMHA 4BCAA 1S6PA 1NJXA 1L3SA 4PG6A 4DFJA 3UW1A 1MW7A 4BBYA 2W7PA 4CH1A 1KOOA 3POTA 2HZCA 1TL3B 2YWHA 3M8QB 5KFGA 4FVMA 3S1TA 5T7LA 5DDRC 1U6ZA 4DR1F 1VBZA 5CXTA 4A8XA 1C1CA 4FXWA 1TV6A 4FF1A 1LWCA 3BSNA 1D8YA 1QE1B 1A7GE 3OUYB 3C6TA 4IH7A 3H40A 1JB0C 2XS5A 2WSEC 3KLGB 3BB5A 4O3PA 1R8BA 1NAQA 5EHHA 2CQIA 1M90T 4DHVA 4YR0A 1S76D 2X51A 2CJBA 2RQKA 3QO9B 3EX7B 2DB1A 3IAM9 1H7XA 3NGKA 4KQZA 1VQPS 1FNMA 4ZDNA 4NWBA 5C24A 4EU0A 4OHYA 3O8WA 5J2QB 2NREA 2IYGA 4C8NA 3BO2A 4DL3A 1HWLA 4HDGA 1MROA 3BSCA 2L9DA 3E51A 1G7CB 5E41A 2MXYA 2C3MA 3T3FA 2ZUGA 4B3SF 3K5LA 3CD7A 3ZZYA 2HW3A 4WK3A 2HIQA 2RIJA 4NXNF 3ICLA 4UOCA 3OTOF 3KYLA 2JHEA 2IM1A 2V8DA 1UWBA 2UUWA 2UV8G 4K0KF 1TKZA 2K8GA 2LYVA 2POKA 1S0VA 2Q66A 3TI0A 2WBMA 3OVAA 2I38A 3MR2A 4YHHF 3HHLC 2YH1A 1ZETA 1H38A 1D9AA 1WHWA 2UUBF 3PZPA 1K9MT 5F8NA 1JNZB 2KRRA 1IKVA 3ZZ0A 1NKBA 3V6HA 1AW0A 2DNLA 3MM7B 5LXYA 2AU0A 2DCUB 3NBPA 3CJ3A 3DI6B 3D0GE 2R7RA 1X4EA 4A46A 2J6TA 2KTQA 5E3AA 4R8UA 1U45A 3PO4A 2NSBA 2HNYA 2AW0A 3NNCA 3G8QA 1F9FA 2HFNA 4NRTA 4U7CA 5L1LA 3O44A 4MH8A 2LLZA 3NCRA 4RKUC 1M5VC 2KFNA 4K59A 2IM2A 2IMOA 3MD1A 2KFYA 1N5YB 2QE5A 3LO3A 3W2VB 2DR9A 5HMWA 2JLGA 3NLCA 1N6QA 1RTIB 1D1UA 3EGZA 2NQPA 5HBMB 4JI3F 5D8HB 2F7VA 3LF0A 3R5AA 3DYAA 5CYJA 3T1YF 1QTMA 2FVPA 4HKQA 4OZ1A 1IM4A 3DDKA 5KFIA 4PUOA 2DH9A 2V0NA 5SUHA 1M1KT 2DHSA 3GFZA 4C0HA 3KLFA 2R8KA 1R31A 2AYEA 1Q81T 2C3OA 3FMWA 1Q8LA 2EBEA 3A8EA 4OI1A 2AGPA 2FPHX 2VA2A 3SQGB 5DG9A 3B82A 1S9GA 2GQQA 4TQRA 4ID5A 3M32A 2G13A 4OI3A 4IRKA 1WWHA 3MM9B 3K0JA 2WW8A 1R8PA 3CJ4A 1BQXA 4Y28C 4NCBA 2P5VA 2ADCA 5KFTA 1T05A 4NLWA 2HLTA 3M6VA 2HHWA 2X1AA 3ZZOA 2W9CB 4FN5A 3M05A 3E01A 2ZJPQ 1FKPB 5EUHA 3KK1A 2O67A 5T41A 3KJVA 4NZ0A 4QWEA 4Q45A 2OIHA 1UJ6A 2MKCA 2JX2A 3AB2B 2W9AA 2MQPA 2E1RA 1U24A 3D2WA 3PR4A 1TAUA 2RILA 3MM6A 5KFLA 4ZP9A 2JFDA 3FEYB 4N41A 3HKWA 4K4WA 1RT5B 4DQRA 4ZLPA 3GQCA 2RMLA 3MEEA 3DHWC 2ZD1A 2ZKTA 2AYMA 4CO2A 1YHQS 4W92B 1TL1B 1TKTB 2V8VA 2AJ1A 2ASLA 4IQXA 2XSJA 3BR8A 3I0RA 2UVRA 2GGPA 4WE1B 4UY8T 3N5FA 1U25A 4LSLA 3ZC4A 5DG8A