4RWXA

Crystal structure of l. monocytogenes psta
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
76
Chain Sequence
MKLIFAIVQDQDSNRLSDALTKGNFGATKLANTTFIIGTEDERVEDALAIIKENCKARQVGGATVFVMPVESFHHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the recognition of cyclic-di-AMP by PstA, a PII -like signal transduction protein.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Protein binding
molecule keywords Lmo2692 protein
total genus 20
structure length 76
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06153 CdAMP_rec Cyclic-di-AMP receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rwxA01
2GNKA 4WK3A 3DFEA 1VFJA 4CO1A 4AFFA 5D4OA 1O5JA 2XULA 1NAQA 4CNYA 4CO3A 3X3UA 3MHYA 2RD5C 1NH8A 4YB7A 4CNZA 4D3HA 3AA8A 2NUHA 3HLUA 4RX6A 4OZLA 2Z0GA 3AHPA 2J9DE 2XG8A 2CZ4A 4USJC 2PIIA 1XK8A 1HWUA 1UFLA 2EG1A 4OZJA 2NS1B 2XZWA 1O51A 1V9OA 3M05A 4OZNA 2VD3A 4C3MA 3O5TB 1H3DA 4Y6IA 2EG2A 2DCLA 4IYQA 3NCQA 3TA1A 2V5HG 4CO4A 4C3KA 5D4NA 4RLEA 5D4PA 5D4LA 4RWXA 1UMJA 1QY7A 3TA2A 2J9DA 2O66A 4ZK7M 4CO5A 1KR4A 4NYOA 1UL3A 3AA9A 2JJ4D 4USIA 5L9NA 2ZFHA 1UKUA 2J9CA 3OPKA 1Q1KA 4E98A 1VHFA 2NUUG 4WK1A 4RWWA 5DS7A 4USHA 4C3LA 2J9EA 2ZOMA 3N5BA 1V3RA 1NZAA 4R25A 3LF0A 3O8WA 3GSDA 3NCPA 3BZQA 1P1LA 2O67A 4D3GA 2XBPA 1V6HA 1GNKA 3CE8A 2E66A 4Y65A 1V3SA 4YB5A 1PILA 2GX8A 4CO2A 1NH7A 1OSCA 5DRKA 1J2VA 3AH6A 3NCRA 4YB6A 3L7PA 4CO0A 3T9ZA 2GW8A 4NYPA 3TA0A
chains in the Genus database with same CATH superfamily
2J5AA 3LP1A 3ZTQA 1RE1B 4OYPA 1KQKA 2IRYA 2VHGA 2Z57B 3C6UA 4HTIA 1YHQS 2JZ5A 3IGNA 1SQEA 4BWMA 3UNYA 1JLQA 2RMLA 4B08A 1T95A 3DGPA 5IM0B 2WHOA 1N56A 3FSXA 3V6DA 1JLEA 2BXJA 2VG6B 1LW0A 5IM0A 3M6UA 3NGDA 2P6SA 5KFUA 5KFQA 3R7NB 4DPYA 3R5AA 3GIMA 1PGZA 3NBPB 1VQ9S 4IDKB 2YQ0A 3D6HB 3GP9A 1Q8IA 2B6AB 1X5PA 2CPEA 5ETTA 1FWLA 4RX6A 2ZHBA 1LWEB 3LPEA 4DMZA 3TW0A 5J2QB 5LMNF 5FD1A 1QM9A 1NDPA 1U1KA 2B3TB 2VKRA 4TKTA 3W9JA 3ZC4A 1CJTB 2Y3YA 2Z2LA 4KE5A 2K06A 1WC0A 4F25A 3RRGA 4IUFA 4OZJA 2OO4A 5EX0A 3BB5A 2A18A 1HBOB 3DHWC 3M8ZA 3QPIA 1SCJB 4TNOA 4WKYA 1SVDA 3Q24A 2FHMA 3EWGA 4HACA 4Y6IA 3MUMP 1F0XA 1NB2A 2IM3A 3HULA 2PEBA 2V0NA 1FWPA 3NOCA 4HR2A 4I6YA 2VV5A 5EWGA 3F44A 3VZIA 1APSA 4X4UA 3D54A 2V8GA 3VV2B 4CLLA 5C2CA 2V9WA 1CC7A 3FFIB 3LWMA 2DGWA 4H4KA 4ZPTR 2RAQA 3NGUA 2AHOB 2XMVA 1I3OB 3HI9A 1LKZA 2BZ2A 3T1HJ 1T9YA 3UN2A 4KO0B 1KTQA 2J9DA 2Y8WA 2J0QD 3DM2A 3NMAA 3D4JA 1KR4A 3HHLB 2GA7A 3JXOA 3TVZA 4HVZA 1RWNB 2CPFA 2UU9F 4EMDA 1UWBA 4USIA 2DNHA 5ETSA 2BVZA 1ZAXA 2JRSA 3TRGA 2MKYA 4WTOB 5GADI 1LW0B 3A3NB 1U6BA 1T3NA 1NO8A 5HJXA 2AU0A 4DV2F 2XNQA 3V6DB 1RTHB 5ETLA 4ZVTB 5DQGA 2HNDA 1S0NA 5LJ5Y 5HI7A 2ZOGA 4PYAA 5IV3A 3H5SA 3ILIA 2EEYA 2HG4A 3BSCA 4KFBB 4OFZA 4U8VA 3VGUA 3D0GE 5IC6B 3WDOA 4WK1A 4DUZJ 1JXVA 3HSGA 3Q89A 1LFWA 2MB0B 1CVJA 1T9TA 2J9EA 3CD7A 2MKSA 3QT8A 5HMYA 1HBMA 1Q8KA 3GYXB 2G1DA 1FWKA 2CXEA 4M94A 2UUWA 2RNEA 3FUYA 5H1SV 1P8GA 2FQQB 3NCPA 1M1GA 4MKAA 3I56S 3TARA 3L3CA 2G13A 3PV8A 1URRA 4LIWA 3UR3C 1RUSA 2XMKA 2DR6A 1RADB 3J7ZT 1NDCA 3MMAB 1AT1B 4BLGA 2QEXS 1HI0P 4X62F 2B7BB 1KFDA 2BQ3A 1S72S 2B4PA 2FC9A 3MECA 2AT1B 1TUWA 2CQDA 2DRDA 3GCXP 1X9MA 2IBKA 3I0SB 3DKDA 1S1VB 2ZKTA 1UVNA 1RLCL 4KHMA 3A4TA 1OSDA 2DO4A 2V9KA 4L75A 4A8FA 2XWYA 1VC5A 2GMHA 3GONA 1JK9B 5ITHA 1SJ1A 3L7PA 3PRBA 1GXUA 3AODA 1U2RA 3LGMA 2CZVC 2OPSB 3H2UB 2RRNA 3TA0A 1ULRA 4FKXA 1FRLA 1M1KT 1ITPA 1S49A 4P52A 1S9EB 3I55S 5E33A 1YVFA 2ZKUA 1GTHA 3W65A 2CRLA 4A8SA 2ZZTA 3FCVA 4C9DA 1BWEA 2R2RA 2LECA 1NK8A 1U24A 1HHSA 3P5TL 3R97A 5KT3A 2HHHJ 4DCOB 4JI1J 2W7OA 1QD1A 3QAEA 4TY8A 1TKXA 1SKSA 3TZZA 2RILA 4WFZA 1DURA 2ATCB 3AT1B 4WXOA 1TK5A 4ENOA 2DNGA 8AT1B 3JSMB 1EP4A 4CTAA 1RCOB 1T9WA 2KVIA 3ETMA 2KG1A 4ZHRA 1VQ5S 5AXMA 3NNHA 4IOBA 5HATA 5GAHI 2ZBQA 2AJ1A 1VIXA 4CH0S 4MH8A 1N6QB 1BQMA 2JC0A 5ETKA 1XK8A 2E9TA 1XNQF 4O44A 4PCQA 4AXJA 5E41A 4I6WA 4I67A 2WONA 4OI0A 2LXFA 3D1HA 3GZ7A 2N4CA 4FPRA 4I56A 1I94F 1WOPA 1ZTTA 4X4QA 1EETA 2EFGA 4C3MA 4DUYF 1R8CA 3MAAB 1JJ2R 1TFYA 4GKJJ 2POKA 3CT9A 1N5SA 4MIWA 1KOHA 3AFGA 1AUDA 4IYQA 3MMCB 4AQYF 4UZCA 3KJVB 2NXUA 3UVJB 1BQMB 1DLOB 4C3KA 3BO3A 2Q43A 3BREA 3DRRB 4K4ZA 3NWGA 1PO6A 4W4MA 3FZ2A 1M5VC 5M2RA 2JEJA 4F4WA 4U7UD 2ZITA 4ZHRB 5D4LA 3KHRA 2LQBA 2WVDA 2V8DA 2Z8QA 3MM8B 2P9GA 4G1PA 3SCIE 4U95A 2XS7A 3TNVA 1JX4A 5HJYA 4IO9Q 2M8DB 1FKOA 2CQBA 5ETNA 5A2QU 3Q23A 2FY8A 4Q0BB 1W2IA 3FBBA 1RT2B 1TL7B 4UOCA 4CO5A 5KT4A 4X4PA 4GKKF 5CYMB 4J5OA 2HIYA 3PY8A 3TQ1A 4PWDA 1A7GE 2DHXA 3DLKB 2CDRB 2OFGX 1B0TA 1RTIB 1Y11A 2G0IA 2XTJP 3EGVA 1MWZA 1TAQA 3M8PB 4C6AA 1GH8A 5HVGA 5IQ6A 5D15A 2RJZA 1NBEB 2FPHX 4EZ6A 2R2TA 1GK8A 1KHWA 4CT9A 4KYZA 4LBHA 4QIGA 3J7AN 3KDNA 1RAJA 4HH0A 4NEYA 2ZH6A 4F2RA 2LVWA 4A48A 5CA5A 3CMES 4A46A 1E6VA 2WVEA 2HBRB 3W66A 3EVMA 1H72C 5JVGQ 3U1LA 2RHQB 4JV2A 2ZWPA 2QMUB 4DXLA 1TVRA 2YWKA 4WP8A 5DQIA 2VG5A 3P3DA 2J8AA 4OHWA 5HMWA 4NASA 3C14A 1FFGB 4UTGA 2KXFA 3W7BA 2ZM6J 2BJEA 1S1VA 4ETXA 1S0OA 4ANEA 3UVJA 1N33F 4WIQA 3SQGB 3PO5A 1LWXA 3DN9A 3MMCA 4JI4J 3E51A 2LDIA 3TVYA 3G6ES 5C2GA 2GX8A 1N0VC 4EYIB 4QWAA 5CYQA 4DSIA 3WIUA 3I0SA 4ALZA 3RAQA 1Q0NA 2A2CA 2QA2A 4K5SA 1HNIB 2WOMB 2BV3A 1S1TA 2YWHA 3R5JB 3G2XA 2EC2A 2DGQA 1U0HB 1TL1A 4OZ0A 2W25A 5L9XA 3RAXA 2DGTA 2G0JA 2L9NA 1QSLA 4PXBA 2WBMA 3CTRA 4I69A 2IRXA 3KK1A 1U1LA 1RT3A 1REGX 2L3MA 2QSWA 5KOXA 3W2WB 4UQGA 1GXTA 4FPIA 2QE5A 3M2RA 2YKPA 4GVBB 5E7OB 4WK3A 5KOWA 3FRZA 3CO9A 3EYZA 2CJKA 4AD6A 4NLUA 5B7WA 4BWJA 4M8LA 5HQ8A 2B4UA 2VG6A 1BWVA 5A8WA 1UVIA 3MAQA 1VOMA 3U27A 4DPOA 1SUQA 2J0WA 4I2PA 1RBLA 2ZH2A 1IXKA 1S79A 4DN0A 3CXCR 4HYKA 4MKYA 1JLQB 4HLBA 4N56A 3D66A 3SSQA 5L8RC 2IVFB 3GIRA 5GAGU 4F4YA 1KSPA 4OZ1A 4YB7A 4JB8B 3HJFA 4O0NA 2GMJA 2RDIA 1AA1B 3BSAA 2FHJA 3LW5C 1DJ0A 3ETOA 4C48A 2VICA 2M5YA 5D6GA 5KG7A 4J90A 1VLOA 4I7FA 2U1AA 2Z0GA 4XK8C 1YI2S 4F0MA 1DHMA 4RL1A 4C8YA 3BQ1A 2NREA 3QIDA 1S5ZA 3KLHA 4U96A 4C97A 3MTJA 4OJ1A 1TMJA 2CJYB 2HWTA 4OYBA 3T6JA 4OV6A 3R5CA 2R2UA 3QSIA 2YNFA 3FEYB 1EB0A 4LF2A 2FJXA 1P1TA 3ZZPA 3D2WA 3QGHA 2JDJA 1H3DA 3KG0A 5A0YA 1NPKA 3FBFA 1VBYA 2OD4A 1S1WB 3D6MB 3P45B 3PX4A 3FJ2A 1NXIA 3NOGA 3PW0A 1NKCA 4I68A 3GU0A 4CP5A 4GO5X 1SH3A 4DCPB 2ZH1A 2PI4A 3R5BA 3CCQS 5J2MA 2B43A 3N79A 3QZ7A 1OQ6A 2X1FA 3D0HE 2YWWA 3RG6A 2WSEC 1N5QA 3DLLQ 5BR8F 3RB6A 3GE9A 1WF2A 4OJ3A 1FERA 4BC7A 4JI8F 3BO4A 3KJQB 4JI5J 3FDSA 1WEXA 1LOUA 1NPRA 4DL4A 1Q5YA 2AJFE 4NYOA 4TVAB 1KVIA 4ZPBA 2HNZB 4OX7A 5KFNA 3PIOQ 2P5VA 3W63A 3AY0A 3BBBA 1KRPA 1XMQF 2QIFA 2M4MA 4F3OA 4LT6A 2LU2A 1IM4A 1MG7A 5HLFB 4URGA 2NR0A 4Y3CA 1RTIA 3LGNA 4QQBA 4DJBA 3ISZA 1HNWJ 3A3OB 1XJWB 1UJ4A 4YR3A 3BO2A 2COLA 5LM7E 4ZJLA 2BJ3A 1NM2A 3DRYA 2K8GA 4USHA 3WQPA 4OYXA 3B4DA 2IM0A 1Q5VA 2GMLA 2M2BA 4WYLA 4PPDA 2YKMA 5F41A 3PYFA 3ENAA 3CCJS 3TUPA 2C2OB 3HX9A 3ZTPA 2A0FB 2L08A 1RAOA 1R31A 2HNYB 4OX8A 4C98A 4TXSA 5J1NA 5A8KA 3KOAA 2OI2A 3K5LA 4KY3A 1U49A 3BQ2A 1FNXH 3K5PA 2ZDPA 2LEAA 4M5DB 3EX7B 4KR0B 4R8UA 4OL8A 1ACMB 3IC1A 1WG5A 1WF1A 1WELA 1YRTA 2R7UA 3MEDB 1UFWA 3N9UC 4EUVA 1OYEA 1EETB 2CQCA 3CGIA 4A47A 2FJAB 3MM9B 4X64J 4WXWA 2NPFA 4DUZF 4KKOB 1RTDA 1Q7LB 5KT7A 1N34F 3BPDA 4RU9A 6FD1A 1RYSA 2R8JA 4C0OC 3VGTA 1RBOB 1PJ7A 3CIMA 3MMAA 3CO0P 2PI5A 1CJVB 3B82A 4DQQA 5E3CA 2VPWB 3UFCX 2C42A 2UUTA 2ZBCA 2V68A 3EUNA 3MPWA 5L38A 4C11B 2NPIA 4FS1A 3P6YC 4FN5A 5K8OA 5KFPA 1X4CA 2VQEJ 1DZ5A 3OR2B 4X62J 3Q0AA 2DIUA 2LMIA 3IXQA 5FLXY 4XPEA 4K4YA 2ZD1B 2XLKA 1X7VA 2AIRB 3NBPA 4DU7A 4JI8J 1QAJA 3G8SA 2NSCA 3DDIA 1S9GA 3FSYA 1T05B 2AX0A 2UVVA 4RNMA 2CNLB 2E5JA 3GG1A 4YY3F 3NS5A 4ZA1A 3AOBA 4K2JA 4HT7A 3CMAS 5HVFA 2QSFA 3HCXA 4TU8A 1AROP 4DBQA 3SFGA 3SIPB 3PRDA 4RUBA 2D3O1 3MFIA 3RR8A 3VZHA 3NMRA 3H4DA 2HPUA 1N0UA 1S1UA 2W4CA 3I0RA 1JLAB 2EFPA 2AEFA 1GAOA 1Y3KA 2MZSA 3RUBL 5EWFA 3ZZUA 1U2CA 2CZ9A 3OR1A 1VC6A 4ER8A 1CEZA 2KJWA 3CB4A 2JEFA 2GFFA 2R7TA 4FDFA 3IWLA 2BR0A 2K1RB 4DQPA 4WE1A 2G2YA 3CVKA 1HKAA 4CM2A 4IRKA 4DPXA 2C2KB 2JOQA 2QLWA 2HHPA 3W8PA 3ZO7A 3C46A 5CXTA 1WDDA 1B64A 4OIXA 4F0KA 1S99A 5U47A 2PO4A 3QIPB 3MAAA 1KN6A 5HANA 2WB1D 3AB4B 3I9V9 1R0AA 3NEKA 1CJUA 2CNKB 2HHVA 1WOSA 4B9LA 1UETA 3ILOA 1IWAA 2DBBA 4ED4A 2DY1A 3U1NA 4CM0A 4HHHA 1IKYA 1HYSB 2ROPA 2IFXA 4LR8A 4W98A 1S6UA 4LRBA 1C0UB 4NLYA 4YDDB 1QSSA 4B9TA 4NCAA 2OD6A 2YH0A 1UCNA 2NXJA 3UQSA 1MLAA 3DOMA 4PAAA 2M9KA 2RIJA 4NYZA 4EI2A 2EKYA 2YPYA 4A8KA 4PR6A 2N82B 1J5OA 2JEGA 3R2CJ 3KWMA 2C2RA 2HNDB 4USMA 2CKWA 4WFNQ 1SIWB 1UEUA 3JSBA 2R8GA 2F5GA 5IWAJ 4AXIA 2QT7A 3OPKA 4DV7F 3R1LA 2V4RA 2XHWA 2E1CA 1WKKA 3QT5A 3D0IE 3MM7B 1HNWF 4YOEA 1QAXA 1RDRA 2HKEA 5LSLA 4J9RA 4DR2J 3OHAA 2YNIA 4B3RF 2HEKA 1HW8A 1Q81T 1C4AA 2UXCJ 3NNAA 2K7KA 1GQEA 4IG3B 4NOHA 4J9PA 1FCAA 3GFYA 1HYSA 1U0HA 3V4IB 2XSFA 1X4FA 2FHKA 4I2QB 2CQ0A 1NK4A 1KQFB 1N5TA 2IC3B 5J2PA 4A8YA 4DX7A 5FIIA 2R8IA 1RBAA 1UTAA 2YY3A 5DLFA 2DGXA 2XLJA 2EVZA 5HQMA 3KYLA 4DR1F 3ELHA 5KFZA 4AT1B 3G9CA 3TR5A 4IOAQ 4RUCA 4TY9A 3O44A 1V3SA 3UR0A 5KFHA 3IWNC 1RU1A 1TL4A 1PILA 3MCNA 4KAIA 1TAUA 3L7OA 2W9CB 1HWLA 3W5ZA 2ZVSA 1PCAA 5KFIA 4X4SA 3QGIA 1WC3A 4C8MA 5HMZA 1N6QA 2E5LF 1LWFA 3AH6A 3D67A 1K9MT 4LF8F 3HHDA 2ZBIA 3CCRS 2B6AA 1O8BA 1WC1A 3VGVA 3CJTA 2AJ0A 2C22A 4C8ZA 2MKJA 2GW8A 4AUKA 3K58A 2JNJA 1SQFA 3DLJA 2JLFA 1RT7A 3OT9A 4ZVFA 4IR9A 1CS4B 1RWKB 2LA4A 3IM9A 4M5MA 4ZDNA 3KLVA 3JSMA 3HVRA 3THVA 4LF9F 2KU7A 2XGPA 4Q8EA 5H9FK 3KG1A 5D4OA 2ZH3A 1W25A 2CAJA 2J7UA 2QO3A 5GAHU 4KV8B 5IOLA 4DPUA 2XWXA 2MQOA 2CPXA 3GJSB 4R0JA 4JV0A 4B3SF 3KDOA 3TZWA 2HGLA 5GMEA 2O01C 2B56A 4O3RA 4CNZA 5LJ3Y 3OVAA 3CDWA 4DV5F 1F6TA 3J7YI 1HNVB 4JOUA 1KVKA 2GO8A 3ZNUA 4M5KA 4USTA 4QYZK 1PKUA 3EXCX 1O0PA 1BY9A 2W1BA 2R7OA 2HNYA 4USKA 1S12A 1EQMA 1YRXA 2CPIA 3IR5B 4IFYA 1VJQA 4EEYA 5B0FA 3FEZA 3IWXA 3TX8A 2BQUA 2W24A 1WTBA 1CSJA 3U1MA 3Q86A 1N88A 4CQ1A 2KYXA 3MM6A 5KFEA 2MLZA 3JTPA 2W8LA 4BBYA 2R7WA 3MEDA 5D0HA 1C4CA 2LQJA 4F4ZA 2WW8A 3JQMA 4O4GA 2H65B 5AXLA 1ZOTA 3MECB 1XEZA 5KAKA 3DLEB 3WC2A 2VUGA 4JP8A 1R0BG 1S9GB 5KFCA 4NWBA 3PVXA 1XR7A 1Y10A 2O1PA 2OJ3A 2LEPA 3R6GB 1ZA2B 1SH0A 1GX6A 1F5BA 2DT9A 3M7VA 1FJGJ 2KI2A 3V2UC 3FSIA 3BH7B 4ATNA 3N28A 2V8PA 5AE2A 3R2DJ 4P2FA 1NSQA 4H4MB 2O66A 5CD4A 4JV1A 4CLWA 5B0GA 2OTLS 3LAMA 1L5UA 4EZ9A 2ZZNA 1UA1A 3NY0A 4FYVB 5AJ3J 1A6LA 3TAQA 2JJ4D 3EGWB 5HQLA 1IBKF 1GX5A 3J80U 8RUCA 3AD8C 4PUOA 2DTJA 3W8GA 5E3RA 5MAOA 4K0KF 1S10A 3V6HA 1EJ7L 3KK3B 3D3CJ 1EARA 1UKUA 1WJ9A 2HZVA 2CQIA 5D0EA 1GFWB 3L9ZA 1CQNA 5DDOC 4LRDA 4O0IA 1NHVA 2C3YA 1MMNA 3PM9A 1VQSA 2M88A 4R8UB 2E7XA 1NSPA 3OL6A 1Q4RA 4DV3F 5D8HB 3DI6A 4R25A 1S77D 2CPHA 5IQQA 3TAMB 2Z4PA 4DV3J 2FJBB 3T5HA 1LXJA 3PKMA 1K44A 1Z2LA 2A3JA 3EMTA 1SIZA 2FZCB 1TTHB 2AZ1A 3KUEA 4M5GA 5A2QY 5DGAA 4TQSA 1VQOS 2ZJQQ 5F8NA 1FDBA 2DXEA 2KRBA 3TAMA 4DPTA 1OY6A 2DH7A 4RW6B 1X4EA 1ROFA 4D3GA 5T14A 1CC8A 3DNCA 5A8RA 7AT1B 2OLWA 4OYWA 2XQCA 2AYMA 1QVFR 1FXLA 1GMVA 4KGZB 3E01B 3M2VA 2ZE2B 3CC2S 1N5VA 1FFSB 4Z7CA 4C8OA 2AX1A 1GTEA 2MMYA 2VFRA 5F8HA 5D3GB 3CD6S 2Q1LA 1C1BA 1TUVA 2QA4S 4YY3J 4KB7A 3UCUP 1YSJA 1X9SA 2BBEA 1OPZA 4GVLA 5A8WB 4UQTA 1J2VA 2LXIA 3TP2A 2V2QA 1PJ5A 1Q8LA 4N8NA 3DC2A 5KT2A 3PW4A 1JXLA 4CO0A 2LQ9A 3NL0A 4HL9A 2KG0A 2F1FA 3BGLA 3DMJA 1MMDA 1VHIA 4I64A 2HZCA 4G1QB 1CQMA 3TZXA 5KFTA 4JI6J 1F9EB 2PC6A 5JUMA 1O5JA 3BGRB 1RTHA 2W4DA 1FX4A 2ZE2A 2Y0SD 3ENVA 4C8NA 1HHTP 4RUHA 3K5NA 1KEKA 5D3GA 1G4CA 4WFAQ 3OTOJ 2HHWA 2L48A 2QV6A 1REVB 5KG4A 4JI0F 4DFMA 4LBIA 1ELOA 4YEAA 3M8WA 4EO6A 5F8LA 3LP1B 3KMQA 4LRFA 1SV5B 2DNRA 3W62A 5K8PA 4ES1A 2EK6A 3D7SB 2M0GB 1YJ7A 4QWBA 1IVZA 3I4HX 2EBEA 3P49B 2W8KA 1CPZA 1R6YA 3BJYA 2J9DE 1K0TA 4ZJQA 3QLHB 2MQQA 3GV8B 2H5IB 3I9ZA 1JLAA 1JIHA 2B8PA 1C1CA 2RVJA 2Z2YB 4IG3A 5J2NB 1B99A 3U7JA 3UE2A 2YKAA 4DUYJ 1EZZB 2SXLA 2AEMA 4HACB 4IG0B 2X1GA 4OZ5A 5AJ3F 1QAIA 2VD3A 3TJAA 2D74B 3BF4A 4K50A 1VC0A 1NDKA 1RAIB 3W9IA 2B9XA 1HBOA 3I5AA 2IJRA 2HRYA 4OYIA 4JI3F 4NXMJ 3CJ5A 4ZVGA 1UA0A 3DYAB 4LUBA 1PSDA 4J9KA 3F0NA 2DB1A 1TKTA 2DISA 5GAEI 3CCMS 4FNIA 3KHHA 3CCSS 1DTQA 1NJIT 3G82B 1RJJA 2HQGA 4ZJOA 2RUGA 4DN9A 2DCUB 4E8UA 3LP2A 1U1OA 3BN4A 1J27A 3ILLA 2AQ4A 2FVRA 2BE2B 4YFUA 3AJ2A 5EDWA 3AJDA 4DR7F 2WSFC 4P7TA 2Q6CA 2H1YA 2QLJB 2MZQA 2QGFB 2Y0BB 2D3OR 2H54B 4U8YA 3OUYB 2AP6A 3D9BA 5CCMA 2UVRA 1IKVA 2DHGA 2QG9B 7FDRA 2RS8A 5K8MA 2PE8A 2EKNA 1I51B 5H9FJ 1FF2A 1RT4B 4DV4F 3IP0A 4F02A 2HURA 3GG0A 4RBVA 4K0KJ 1TMMA 2CG8A 2YWFA 4A8XA 3BH6B 3DRXA 3FKBA 1V5VA 2KDOA 2XMJA 3PW2A 1VHFA 5HBMB 2O5DA 1RT2A 1TL7A 3C19A 1S1XB 3EJMA 4CYUA 5L46A 3C14B 5FLXU 4A8WA 3T1YF 3POTB 1CLFA 5E0OA 3QLHA 2KH9A 3M9OB 1HNZJ 2MYFA 4TYBA 3O8WA 3C6TB 3KXDA 3M8QB 2KXNB 4ECTA 4ECYA 1HNVA 2J7KA 3BZQA 3OSNA 1PAUB 1YBTA 3CDAA 3R1HA 1B0PA 4NMXA 4OLPA 4IQXA 1N32J 2VFVA 1FI4A 3NGSA 5K14A 2D41A 1S4FA 3G6VA 2RRBA 1AW0A 2FLOA 2A6MA 2XBPA 4IOCQ 3KTQA 3H7HB 4EWTA 3H5YA 1IR0A 3POTA 2NLWA 4B9UA 2FUG9 2ZUGA 1HMVB 5KFVA 5C25A 4HTJA 4LIRA 3A8EA 4PG7A 4X4RA 3TYTA 2KM8C 5DETA 3WX8A 2MKCA 1HR0F 4QU7A 2D9OA 1DAXA 2G2OA 2IJFA 4ZVRB 1AB8A 1C0TB 1RHUB 2N7CA 1B7FA 4NRTA 3OLAA 5LSOA 2IVYA 4DS4A 2NCKL 4HHJA 4LF5J 1B3TA 2GO9A 1PYTA 3RB4A 2DNQA 3MGJA 5JXSA 1ZZFA 4CT8A 4K4WA 1FK9B 2CJQA 3IAM9 3OXLA 4MK7A 1YJ9S 4Q8FA 3OTDA 5DDRC 1T02A 1TQLA 2QA1A 4P71A 2CVEA 3H8YA 4YR0A 4DQSA 1MROB 2QX0A 3HVTB 1JLFA 3DFEA 2BE9B 2LCWA 1Y3JA 4OHVA 5EWEA 3KK2B 4ZN3A 2QMXA 4E2FB 5B09A 4P75A 5THWA 1I94J 2GIRA 4G1IA 4NL5A 3SBMA 3OW2R 3MD1A 3J81Y 2KZZA 1N5YA 4O3NA 1LXNA 4LSLB 3Q8UA 5EHHA 4AL5A 2K1RA 2CPZA 1WKLA 4M5LA 1TELA 1WSRA 2HVDA 3QGPA 8ATCB 5DG8A 3BS9A 3MI7X 4P10A 4LSNB 3ZZOA 1E6YB 1GXLA 3T5JA 2EFVA 4ZP9A 1IKXB 4DUTA 1BGXT 1DY3A 1F2HA 2MLYA 4ECZA 2V34A 3G6YA 3DOLB 2G2ZA 3J80Y 2IYIA 3MPVA 3R7SB 5DG9A 4B3TF 4HI2A 1KQSR 1H2VZ 3IG1B 4IFVA 3G87A 2OELA 2MGZA 1S6QA 2HBZB 3IO1A 3QT7A 4DSJA 3IA0A 5DDPC 5L1LA 2JFDA 4DR6J 4J91A 2CADA 3KFWX 4V1Ak 3CC4S 1U6ZA 3RZAA 5JMNA 2HLUA 4DPWA 4LF6F 1R43A 5JJBA 3MUVP 5KFMA 1BHNA 1ZM2A 1B0VA 3NCQA 3DOMB 3CW2C 3VWSA 4DOZA 4DV5J 1RTJA 2WK4A 2VBWA 4ICLB 2R8HA 1HPZA 3FBCA 2FDNA 3QGGA 5J1EA 2IJNA 3VF0B 3M30A 2CPJA 2OEMA 1N8RT 1CS4A 4YN3B 3BPSP 3N01A 5IFMA 3GB0A 3M2UA 3HHLA 2CQHA 1QJHA 1R8HA 4RWXA 3SXLA 2UUCF 3UI3A 3ZZRA 4HI1A 3SI8A 4ILLA 1W2BR 1RWXB 2OGUA 4Z2XA 4X65F 2IRUA 2OKQA 2JSXA 1RISA 3F41A 1U1MA 1YBAA 1XMQJ 3IRXA 4FYDA 1YJTA 2I2YA 1HQUB 1VDHA 4FP9A 1IBLJ 2UP1A 3TZYA 4ZCIA 1SJFA 1L3UA 1DTTA 2YWGA 4ILMA 4K4UA 2ZOFA 3VVTA 1VIOA 4KBIA 2ZM6F 1HLWA 4LFAJ 2RHSB 4PQAA 3RBDA 4PYDA 1Q1KA 3HF5A 3QWUA 1DRZA 5A76A 4RW8B 2NUUG 4M63A 3SDEA 1X60A 2ASYA 1FTCA 3CJ2A 2BYCA 4NA3A 5HAOA 2PFDA 4OI1A 4CIOA 2DNLA 1RI7A 2HK2A 2AGQA 3LF0A 5F9NA 3MMJA 1WEYA 1UVKA 2RUSA 4H4KC 2IM1A 4CDIA 5HL7Q 4YB1P 1NK6A 3KNGA 1ZM3A 1TVRB 2PDAA 3GV7B 4ID8A 3DI6B 3QNWB 1FJCA 5M2PA 3JS9A 1VS3A 1SJ3P 2APOA 3K5OA 4M1KA 4YUDA 2FVSA 1MU2A 1S1UB 1QUPA 1UVMA 3QJPA 1RHKB 1NSKL 1VLYA 3H5UA 2ZC3A 4MMOA 5KT5A 4PKDB 1KLNA 5KFKA 1YBUA 2KT3A 2XHCA 3OFHA 2BRKA 2ZUAA 1U4BA 1Z4UA 2HRUA 3L7UA 4NZ6A 1WC5A 3UD5A 4F67A 1SL0A 5G0RB 2AYEA 1JKHA 2BX6A 3T3FA 2LA6A 4LREA 4DF4A 2CDQA 4DR2F 2GC8A 2RQKA 1MROA 5CQGA 3HO1A 2UV8G 4QJVA 4B3RJ 2E5LJ 5IT9U 1Z2ZA 3BGOP 4H54A 2OP5A 3R7BB 4JUZA 3DRSB 2WTFA 3C15B 1T05A 2HYIB 4NXNF 1S0VA 1NHKL 1V5IB 3D1QA 3H20A 3MUTP 4YB6A 3OTEA 3GFZA 3W2WA 3JB9k 3HSZA 2F3JA 2V4JB 3HPOA 3T5KA 1OIAA 3MAHA 3C16A 3GILA 1UFKA 4DR4J 2E29A 2W7PA 4Y2CA 4CLSA 4ED1A 1OPIA 2EFOA 1FX2A 4KTQA 4LFCF 1VK3A 3C66A 4KC5A 3D6TB 4ZOSA 3RR7A 2XULA 3Q8PB 3FBEA 4CNYA 2G4BA 2HMIA 2V2VA 1FD8A 2QLBB 3CSKA 2QYGA 4DEZA 4K8RA 1YX2A 4ES2A 4JI3J 3PXGa 2C2EA 2E9ZA 9ATCB 1NH8A 3FCWA 3M32A 4MTPA 5A8KB 1L3VA 3ZTSA 2NUHA 1BUXA 4DR3F 1T03B 2KHCA 3GPAA 1RHJB 3I31A 3NGTA 4OHXA 4NCBA 3M6XA 3DRPA 3CJ3A 3K2YA 1RZMA 1N36F 3W1YC 1T03A 3AHPA 1AFIA 4LF9J 2R7SA 1JLGB 5C42B 3KUGA 2VDHA 2XGQA 3DHXA 1UFLA 4XTTA 3GR0A 3IS9B 3M1VA 1RT1B 2XMTA 3HM9A 2WVBA 5CD4H 1D0EA 2YNGA 4RW8A 1S48A 3E3XA 4RR5A 2EWHA 4LBPA 3RRKA 4U67Q 2AGOA 4QYZJ 1V9OA 4CLKA 3G8TA 4F3QA 1NSAA 2MHEA 4OX9J 3G71S 1RWMB 1YJRA 2ILYA 4KH0B 2LLZA 3JQKA 3ITHA 4ED3A 3QRPA 3A1YG 2V5HG 1OO0B 2ZBPA 1YQHA 3QO9A 1R8AA 4KV8A 5KG0A 2FTRA 4DSFA 5LMUF 2XNRA 3C16B 2AYGA 4PWDB 3GFHA 2VC0A 2V4JA 1TV6B 4ZLPA 1Q79A 2AKWB 1R7IA 1VQ6S 1IM6A 4OYAA 4ECQA 2P8IA 4I1TA 1XNQJ 3MR2A 1TUGB 1RA7A 3L09A 2W2OP 3MEGA 1LFPA 4KQZA 2RRAA 1QTMA 1QDUB 3PX0A 4AYBD 1KS2A 3H4BA 1R0AB 1RTJB 4ICLA 1GMUA 4OHYA 4MAKA 4DL7A 3P4UB 1ZZNA 1T7PA 2ZDOA 1WEZA 3AD7C 1VQYA 2ABYA 2HFVA 3CCVS 1NJXA 3KLGA 2OIHA 2RB7A 3SQGA 2DY9A 4ED2A 2XMUA 1R3NA 1VK8A 1N52B 1UAWA 1MN7A 6AT1B 4F2SA 4QWDA 4HHUA 1BQNB 5KFFA 1U2FA 4QW8A 1HR0J 2QLFB 3MM6B 1RAHB 2HHUA 5LSRA 5HROA 2ZOMA 2Z2ZA 4FVMA 4Q2MA 2E1PA 2CA9A 5LL6d 5AE3A 1RGVA 1RWOB 1XQIA 1Y0HA 1HQUA 2YWEA 1YZ7A 2ZEJA 3CD5A 4O4RA 4FF3A 1IBCB 1M1HA 3B4MA 3GSDA 1RCXB 3PYDA 2QLXA 3L4BC 4N77A 2H4WB 5KT6A 3DXBA 4F0HA 2GJIA 2A6OA 3SEOA 1H2TZ 5ETRA 3V4IA 1NUEA 4DR4F 3M8SA 3THTA 4DV2J 4DV4J 1U7LA 2QJ3A 3W5YA 3OVSA 2RE1A 3Q2TC 3BKUA 4LF1A 4EYHB 3PNIA 4OJHA 4XIUA 1D8ZA 5KFSA 5ADZA 1UP1A 2F40A 3M4XA 1NH7A 2AEJA 2F63A 2ILZA 1HNXF 1FHTA 4UOFA 2KZMA 4PUOB 4QWEA 3FCHA 4GVBA 2VFTA 2QC3A 2WRMA 4UOGA 2M70A 1HD1A 1QE1B 1CJKB 1C0UA 5BXIA 3IN5A 2P6TA 4FF2A 2EI5A 4RW4B 1RT7B 3B54A 1IUJA 1S7IA 1UEKA 1I6JA 4FXWA 1G6BA 1S1TB 4OX6A 5GVQA 3M30B 5KFAA 2EPIA 3E8OA 3Q8VA 3WHIA 4AE5A 5AXNA 4RW9B 3OLBA 1K47A 4HT5A 4ES3A 2N4DA 2LFVA 2M3DA 3BDEA 4ERDA 4LSNA 1N33J 1GEHA 2W2QP 1FRHA 2ROEA 2WOMA 1FO1A 4OYZA 4CH1A 1CJUB 2R2SA 4J9SA 4HDGA 2BABA 2D1CA 4O3OA 2MSSA 1RT5A 4ETZA 5A0YB 3IAS9 4U7CA 1TU0B 3R3TA 4CO3A 4JYAF 3G86A 2X1BA 1T0TV 2CWKA 4IFVB 5BJRA 2MGZB 2WONB 1EIYB 4FKYA 4MJKA 3O2IA 1HQEB 1WC4A 1K1SA 1PBAA 2KN4A 3BBCA 3AA8A 2YQ1A 4RO0A 4DLEA 3D5MA 1ZH5A 3DOLA 1IWGA 3FVYA 4P2SA 2XSJA 5K14B 2KVQE 4USWA 3CCES 3N6NA 4PG6A 3I87A 2VG5B 4TYAA 5DZ6A 4BC9A 5C7PA 1CJTA 5HMXA 4I2QA 3CJRA 1ZETA 1NJZA 1VQ8S 2UUBF 1DFDA 5L1KA 3VAGA 4PABA 5G4DA 3SV3A 3D1OA 4RNFA 1M90T 2C2ZB 3S8SA 1YLXA 2VDIA 3AXKA 3KLIA 4X66J 4K7QA 1UPMB 3PCOB 4OI2A 2PFFB 3VVUA 2DPIA 3HZGA 4GC6A 2VC1A 3OFGA 4USUA 4LF5F 2B4OA 3OV7A 2EW9A 2EC0A 2VKZG 4WFXA 4RNHA 1IBLF 1VRUB 1IR2A 3HD2A 2ZH7A 1S6PA 2DCLA 1S9FA 1UVLA 1OWXA 2AJ2A 4LVOP 2K2PA 2GQ2A 2BANA 3N5FA 4H4OB 1RAAB 4K59A 5T7LB 3CNQP 3O1LA 3TA1A 3TJ8A 3RYLA 3ZZ0A 4DV7J 2HQIA 2DYAA 2MKIA 4RLEA 1KHVA 7FD1A 4LRAA 2RF2A 4LVNP 3RW7A 3HVAA 2EFQA 3M2RB 2R4FA 3PZPA 1FE4A 1S6OA 3PFOA 1XNRJ 1RT3B 3UDCA 3D68A 1UMJA 1QY7A 5E3AA 1YTYA 4M95A 3TA2A 1FJ7A 3AB2B 4G6VB 3T5LA 1IKYB 1FNOA 2DEIA 1DARA 2IMOA 2QYCA 4PG5A 5E2QA 4A8OA 3HXMA 3VAMA 2OMLA 4DFJA 3HHKA 1UL3A 3PHTA 3AA9A 1M5OC 4ELVA 5L9NA 2X1AA 5B0BA 3H90A 2OPRA 4OI4A 4GKJF 2OPQB 1SH2A 4FF1A 1RHQB 4KT0C 4L3KA 1EQ0A 3KLEB 1RT5B 1RKJA 4JI2J 1JLBA 2HFNA 3QAUA 3CJKB 1Y9OA 4WYWA 5I3UB 2RQCA 3CEDA 4PQUA 1RQ0A 2RKIB 2E44A 4F4AA 1NRKA 3I4PA 4LFBF 1XMBA 1VYAA 3U02A 4OZ2A 3JYTA 2QMWA 2FY1A 4GMKA 1XR6A 5KFYA 1AYEA 4RW9A 2E7WA 2OPRB 3UO0A 2FZKB 3H2LA 2BKOA 4IH7A 4QOTA 1KKHA 2HFUA 3PO4A 1AUSL 1T3OA 1T9XA 2BJ1A 3NS6A 3Q2SC 4QYRA 2PMZD 2YKMB 4NLDA 2CUYA 2BJ9A 4OJGA 1EP4B 4CTAB 2JC1A 2B9YA 1E6VB 1H6KX 1SV5A 3NRBA 1HL6A 1N54B 4O23A 4Z7YA 2A2DA 2ROGA 3LP2B 4C2MA 1V6HA 4O3PA 2ATLA 5B0DA 4KJIA 3PEJA 4RW7B 4FXDA 5EN1A 2FB0A 4MT1A 1WI6A 4DL6A 5H9EK 2VL1A 3UNGC 2E66A 3I32A 3HK2A 3HKZD 3JQJA 1HW9A 2PA3A 1Q86T 3W9HA 4ITSA 2DGVA 3RB3A 2H51B 3D6FB 3PIPQ 1K73T 2R7QA 3QT6A 1QLNA 3BQ0A 4UUWA 3PW5A 5T41A 3F56A 2OPSA 4ED7A 1FDAA 2K3KA 4NCGB 3DMJB 4ZMMA 2KL8A 2F8MA 3OR2A 1WHVA 2WSCC 3MR3A 4G65A 1XTZA 3ZZTA 2GZOA 3ZTOA 4PXEA 4DR5F 2AJ4A 1W7WA 5C24B 3V4MA 4IRDA 2C3OA 1WD6A 1XN9A 2U2FA 3I82A 3PTWA 2R9LA 4HDHA 1UEVA 1KDNA 4N8OA 4NLTA 2QN6B 2YXLA 3ET6B 2MKKA 4FS2A 1OQ3A 4FXVA 1LWCA 3M6WA 4K5RA 2RT3A 3SDEB 1LK7A 3VGSA 2NSBA 2XC9A 2V69A 3VQSA 3TUIC 4ANCA 3K0JA 5ETPA 4KHPJ 2RQMA 4NA1A 1WDTA 1PC4A 5BYQA 4EBCA 2IY5B 4A8MP 5H9EJ 1C1CB 1L3SA 2FHOB 4B9SA 4MKVA 2MY8A 2VJVA 4UUXA 3VAIA 4E0DA 3D28A 2OSRA 2VH7A 2YNFB 2HVZA 3GR1A 4RW6A 4TN2A 2XEXA 2NYIA 3NAHA 2D7SA 2FIUA 2QTWA 3ILJA 3IRXB 3OR1B 4X84A 1X5SA 3SCJE 5LMUJ 4ZP6A 1TV6A 1CG2A 3AQPA 2XB2D 4YMEA 5EUHA 4KIAA 3PJWA 4PPZA 1VRQC 3DGVA 2XO6A 1FD2A 1NNDA 1P6TA 2RF2B 3CCUS 4USVA 4AL6A 3P5BP 4NPOA 4KHRA 4DF8A 1SC4B 5IT4A 4LF6J 1F9HA 1FE0A 4OZNA 2I38A 2VBZA 3OSPA 2VA3A 3O5TB 2BANB 2L9DA 2PGCA 4WWSA 5T7LA 5ETOA 4DV1J 3M8PA 4RNOA 2EG2A 3MWBA 3LP0A 3ISNC 1JJCB 3LO3A 4ZP7A 2PEHA 1SC1B 3BV8A 3V81A 2DXDA 2Q3PA 1TKZB 2B5JA 3GTYX 2BRLA 3EGZA 4V19X 3BBFA 4QIEA 3VAHA 1X0FA 1FKOB 2CIMA 4C11A 2MJNA 5LT5A 2BW7A 4ZPCA 2N3OA 3PW7A 1F9FA 4DFKA 1YG0A 1F5CA 1HNIA 3RAMA 4EFAC 2GQCA 4RNNA 3OL8A 3HFVA 2MQNA 1U0SA 2W2MP 1ZM4A 2JHEA 2XSJB 3JAMY 3L95X 1IKXA 1DLOA 5LXRA 4YHHF 4C0HA 2OHDA 1NJYA 1JQGA 1UWAA 2CQ4A 4B17A 3A3PB 4Y0FA 1IQTA 1YITS 4MIBA 1SKRA 3QBCA 2DEJA 1VRTB 4ZP8A 3GIJA 1F1BB 2I9SA 3ZZYA 2PMWA 1WG1A 5BYSA 3Q8RB 4DV0F 4TU7A 2GJ2A 4F3MA 3CDUA 1T94A 2IVMA 2CWXA 2JLEA 4Y2AA 1YK9A 2UUCJ 4B3MF 1G7CB 2GHVC 2HS0A 3DLGB 5KG6A 4ELTA 1RTZA 4M5NA 3W5XA 2KT2A 2DPJA 5KG2A 4X65J 3K57A 1FXRA 1FTRA 5G0RA 3TJ9A 1HWKA 2MSTA 2DH9A 3DOKA 2RH3A 4DR5J 1U48A 4WCEQ 4NCGA 3UN5A 2J6UA 4DQIA 4WP3A 3JTNA 3MZIA 4RJVA 2VFUA 5GAEU 1L3TA 2P9CA 1P27B 4WZMA 3CE8A 2IHR1 1KBRA 2FD2A 2EXUA 2RU9A 2YX4A 3DGPB 3LP0B 4NLSA 4P7VA 3VHQA 2EBGA 1RAGB 4P73A 1JLEB 4RBTA 1U47A 4ECUA 2VPYB 1T9VA 4NMLA 1U25A 4B3SJ 3LH2S 3MD3A 1BMQB 4Q7AA 4GC7A 2DRAA 3DOKB 4JYAJ 1BC6A 5JVHQ 5L1IA 3IM8A 1SPBP 4WKRA 2ZC4A 3GWCA 1IBMF 2KFNA 5SUHA 1RT1A 5CYMA 2HQFA 2ZH8A 2DVIA 2VOPA 1TFWA 5D0RA 1WI8A 1S97A 4ZLLA 2Z58B 3W64A 1X8DA 2IAJA 1TL1B 2CJXB 2HFZA 3EICA 5BYRA 4J9LA 1U1QA 1NB7A 4LF4F 4DLGA 5DM6Q 3SQOP 3KJVA 1VFJA 4DDFA 4P6QA 4AFFA 1WHXA 1T8EA 2Y9HA 1SXLA 1HQ2A 1KWMA 1XERA 4DFPA 1JNRB 2XCPA 4K4SA 5KFBA 4CYUB 1VRTA 3EPGA 3THPA 3KLEA 2I0XA 5DJBA 3RBEA 3K5MA 4XDCA 2ADCA 2FVQA 4B3OA 4F36A 1F5AA 2MZJA 4O44B 1H7XA 4GRSA 4DWIA 2F7VA 2HQ3A 4DX5A 2VOOA 3DU5A 4KGXB 4K4XA 4DL0C 5L39A 2Y1IA 1SI9A 3QFHA 1JLFB 4NRUA 4UW2A 1NPPA 2BOPA 3MXHP 3LALA 5A6WA 4CH7A 1GT8A 4J9UE 1X0PA 4DV6J 1R8BA 2V8HA 1R89A 2NZCA 3FNNA 3SZ2A 4OZLA 3M2UB 1FJGF 4J7CA 2G9OA 4LRCA 2YKNA 4ZPVR 2DR7A 3BM7A 3MCSA 3H59A 3OJUA 4DR7J 1TKZA 2B5JB 2AW0A 5F9LA 2UXDF 1X31C 5F8JA 2W01A 3VR1A 3AOCA 2FVPA 1NK0A 4IO1A 3PYEA 5EGYA 3MR6A 2ERRA 1S6PB 4QCLA 4XAKA 1XMOF 3O3LA 2VG7A 1SC6A 3ITHB 2L41A 1X9WA 4ZVQB 4MK8A 1AZSA 1YJWS 1H74A 2KJVA 4K2XA 1FA0A 1M5HA 3CCZA 3OXFA 2DIVA 2F9DA 2VG7B 2FJEB 2V67A 1B7YB 1H7WA 1VRUA 1UJ6A 2YVSA 1UWBB 3ISND 3KLIB 1Y5LB 3R5GA 4HH1A 4KH1B 4MYUA 1XWLA 2GHPA 3K7RA 5D4PA 1NMEB 1NZ8A 1O6XA 3DDNA 3HVWA 4DL2A 1HBNA 1KOOA 1RWWB 3LANA 4WTYA 3V5RA 3MPUB 4Q0BA 4ED0A 4PRFA 3EVOA 2FJWA 2YKNB 5J2MB 3FFIA 1HD0A 4I6AA 3MM8A 5I3QA 4DL3A 5CZXA 1IKWB 1UZHA 1WOOA 3BKFA 2XO7A 3LAKA 4QW9A 2BJ7A 4RKUC 3ZFVA 5LXYA 2AGPA 4L76A 5DG7A 1Y5NB 1Q7YT 3QATA 1N5YB 2DNMA 2Z2MA 3KMSA 1Y4ZB 3IRWP 2HVEA 5KFGA 4B3OB 4PG4A 1HIYA 3WC0A 2R42A 4B02A 3GJQB 3IBWA 4WE1B 1MNEA 3G8QA 4WU2A 1KVJA 4NLGA 3FEXB 1MWQA 4UOHA 3RTVA 5CZVA 5HO4A 2E5IA 1V3RA 2GAGC 4PXCA 4ZPAA 2CJBA 2RS2A 4C8LA 5B0EA 1IJEB 5D77A 2VQFF 3UD3P 4ZS6A 1D9DA 4WFBQ 2CVIA 3CCLS 3K17A 2E5GA 4MYTA 3RBXA 3MM5B 2VB6A 2AMCB 4CZCA 3GLJA 2YX1A 1MMLA 2UVUA 2J76E 9RUBA 1S57A 2HBQB 3H0PA 1KFSA 3DRSA 3FMBA 4B9MA 1FNMA 1WORA 3KHGA 1Q82T 1GNKA 3SYZA 2OPPA 3AD9C 1HWJA 4X64F 2WW4A 1C2PA 4TLQA 3P96A 1P9YA 1FKAF 5IXUA 1N34J 1HHQA 4J9MA 3GJRB 3N6LA 4KFBA 1HMVA 4U9RA 1WC6A 3HMJG 3MF5A 2HK3A 5KFWA 3H40A 2DGUA 3DLKA 2ASDA 4JI1F 1N48A 1RU2A 5IZHA 4NLOA 3VAKA 2HQCA 3JSYA 3QZ8A 4ILRA 4LR9A 2OEJA 4DSKA 1DQAA 2DNOA 2J0XA 3CCTA 5CAAA 3F73A 1UJ5A 2N7YA 2IDEA 1PAEX 3DCAA 2VPZB 1S6QB 4LR7A 4Y2KA 3UDVA 1GMWD 5CYJA 4U6PA 3M9NB 4NXNJ 2JEIA 1FRJA 3T9ZA 2QFJA 1TP7A 3JSRA 1URNA 3EM1A 3RB0A 2C1EB 3S6EA 4K4VA 2K3IA 3QFWA 3LA0A 2XY5A 1VQ7S 2KFZA 3BN7A 3R27A 1IR1A 3OFFA 1VBXA 2KO1A 3M32B 4ZN1A 2DGOA 4X4NA 2KYZA 3LUYA 4CO1A 2W9BA 3I6PA 2DKOB 2VFSA 4MFBB 2VASA 3UCGA 4J37A 3DLBA 3RRHA 4ZVOB 4LFCJ 4A8QA 1REVA 2JVRA 3HHLD 3CJKA 2VPXB 1XBWA 3W60A 5IS2A 4LF8J 4LSLA 3OQ2A 4DX6A 1RT4A 1YIJS 4DV1F 3RBZA 4F4XA 2OFHX 3PRVA 1PYSB 4ZVSB 2Q6BA 3TUJC 3R6LB 4ZLJA 2VBYA 4YP3A 4AQYJ 3CWJA 4RPFA 4DZDA 4DR3J 5HP1A 4URQU 2Y1LB 4QIFA 2M8HA 2D3UA 3EGNA 2A10A 1WTFA 4ANDA 4J9VA 4ZVHA 1EHWA 1K1QA 3CJ0A 3C3LA 2ZZMA 1J5EF 2BE2A 2HGNA 3GSIA 2CJ9A 2QRRA 3MCMA 4IDKA 3A12A 3SSRA 5KFRA 4X66F 2XG8A 2C28A 5BR8J 2CZ4A 4USJC 4F50A 3AXMA 2BW2A 3MCOA 2MLXA 5KFJA 1WNEA 1HWIA 3N6MA 4HEA9 5GMKa 1VQ4S 3FZBA 1HI8A 1D09B 2J7WA 3ZXWA 2FLLA 4M5IA 3SSSA 4YHHJ 1RYRA 3KNAA 3TEGA 1VBKA 1JKHB 5KG3A 3DLEA 3OXGA 3FC9A 2J6TA 4OI3A 1HBUA 2Y8YA 3FMWA 1MN9A 1ZBTA 2DNYA 2F9JA 3LTOA 4CO4A 1RT6A 1YRUA 3BSNA 3MR5A 4QIWD 1FKPB 2GCFA 1Q53A 1RLDA 1U8WA 1NCLA 1WACA 3SFUA 2VF3A 1R27B 2YNGB 2AV5A 3Q8YA 3HHNB 1UZDA 2HHTA 3HFZB 3DRPB 4M5DA 2WBRA 3DM2B 3EE3A 1IQZA 1XIQA 4EU0A 2A1BA 2HGMA 3UW1A 2XZTB 2GQQA 1QSYA 2GVDB 3TQEA 3C2PA 2W7AA 3JYTB 1E6YA 4PXDA 4TLRA 3MR7A 4NLXA 3A8IA 4OX9F 2ZWOA 4ZVUB 3D3BJ 1NK9A 5IWAF 2G0CA 3CJ4A 4DHVA 5I42A 1BQNA 4NXMF 3LOUA 4OYOA 1F2GA 3W2VA 2BM1A 4F8RA 5DM7Q 3ONQA 5LOQA 3M9MB 3KLGB 3RW6A 4P72A 2XY7A 2BKNA 2CNNB 3M8RA 3OVBA 1MSWD 3ZTRA 1NZAA 3J7Z5 3MEEA 2MQPA 3R9LA 4DCJB 3QWPA 1QAYA 2FVCA 4ZVEA 3T6BA 1SL1A 1IBMJ 2R7XA 1I5OB 2M52A 3KJNB 1LWEA 2VJUA 2AWZA 1H38A 4N76A 4MKBA 2C2MB 2CNOB 4NE9C 4MK9A 1K0VA 2UUAF 1M0SA 1H73A 4S0MA 1U02A 4LQ9A 1LWFB 5KG1A 1VGYA 3UWTA 3GYGA 3GFXA 4DQRA 4IRCA 2MTLA 1B4SA 4P74A 1TKTB 3T9NA 5HP1B 4LFBJ 1FT8A 2W9CA 4QIVA 3DYAA 3B78A 1R0CB 1X4AA 3E01A 3M2VB 4CO2A 1WWHA 2P9EA 5C25B 2F4VJ 1Q78A 3PJXA 2V2KA 1TZ0A 4KSEB 2XM3A 4QPTA 2XI3A 5A8RB 5DRKA 2PA8D 4UZBA 3HZEA 1AFJA 4J9OA 4ED6A 4YQWA 4JI7J 2UXDJ 2L9WA 2PT0A 2RDDA 5IT0A 2RU3A 2E9RX 3MMBB 3EDRB 1KLMA 2LXUA 3ICLA 3BR8A 2MEWA 1NLKL 3HDSA 1LV5A 1DQ8A 3OTCA 4L3NA 2G1HA 3VAFA 2MQ8A 2B9WA 2MJUA 1TK8A 4L72B 1JJHA 4V19J 1JLCA 5KFOA 4IKAA 4UF4A 4XDDA 1NAQA 1RABB 4BCAA 2GGPA 1LWCB 3CJQA 3PX6A 4ECSA 4LF7F 1A9NB 1G2EA 1SUQB 4NLRA 2JH3A 3JAMU 3SCLE 1QUVA 4C7QA 2CQGA 3RU0A 2FJVA 3GIKA 1M5SA 3GYNA 3OL9A 3NKYA 2W9AA 2ASJA 1RHMB 2WVFA 4OV1A 2IYGA 1TKDA 4WF9Q 2BMBA 2GAHC 4O3SA 4EO8A 2MDAA 2NXCA 3A13A 4NEZA 3R8YA 1FFWB 1G3OA 2PIIA 2N3LA 4LSZB 5F8GA 2HRTA 2BACA 4ECXA 3V6JA 2JFKA 5I3PA 3V81B 2QL5B 5IT9Y 3MTKA 2EFNA 4WPAA 3UDLA 3I96A 5DZ7A 1DQ9A 1VQMS 4KHPF 2NQPA 2C3UA 2NXEA 3LPYA 4FNHA 5CYQB 1OJ4A 2AD9A 1HI1A 3OL7A 1VQNS 4CRJA 2CPYA 1PIEA 2AF6A 2V8VA 3C8YA 2BQRA 3A8JA 2XS5A 1RXOB 4FZVA 3RJMB 4KGKA 3J81U 3UDEA 3AOAA 2LDYA 2DK2A 2FGCA 4KGMA 2BUNA 2C3MA 2CPDA 2HAFA 4Y2IA 1RWVB 4RUAA 3CPWR 4IH5A 4ZITA 2UU9J 2XMWA 1KTVA 5E5NA 5F0WA 1FRMA 2Q79A 2HWIA 2X7IA 4I4BA 4BHQA 2D69A 1YJNS 1IN0A 4JI2F 2RKIA 5CABA 3J7YU 5AT1B 4LMZA 1VQPS 1OMSA 1YWXA 5AXKA 1TK0A 1X4HA 2V2ZA 1TL3A 2FZGB 3BGRA 3KK3A 2XS2A 4ID5A 1IKWA 1CULA 5CH7B 4KRWA 4C3LA 1GMWA 3NLCA 1IJFB 4L6V3 4X4TA 2XZDB 5K9FA 2IMWP 3UN3A 4C4WA 3TAPA 3WX4A 3A8KA 5K8NA 3HVTA 2FGOA 2JWNA 5GMDA 3BSOA 4J9NA 5J2QA 1OS5A 3DLHA 2ZHOA 5GADU 2XMMA 4M5HA 4H4MA 3WZ0A 1ZS6A 4DG1A 4F4KA 4B9NA 1KC8T 3O6QA 5L1JA 2ADBA 2MXYA 2ZVIA 3CDBA 1CULB 2H5EA 4CWBA 2DR5A 3CCWA 1NDLA 4H4OA 1H98A 2BEFA 1RK8A 2DNZA 1ZPWX 3I5CA 1MW7A 4CLYA 3SMZA 3TUZC 4DR1J 1JB0C 4RW7A 1N4LA 1FJEB 2B7CB 4YDXA 2C2NA 1Y7PA 4N5SA 1S59A 3MPDA 4IG0A 4ZIVA 2UXBJ 4UY85 1S9EA 2KHDA 3OJSA 5I42B 1MU2B 2OAUA 5AE1A 1PG5B 1A0OB 1FDDA 1U09A 2HQDA 3IG1A 1NKBA 2EK1A 4CLFA 2FLPA 4DI6A 3ZNJ1 1D3WA 4NYPA 3ZZZA 4XPCA 5F0UA 3DDKA 4FYXB 3J81j 3MURP 2XLIA 4ECVA 2MZ1A 2FLNA 3AJ1A 1AXQA 2I1RA 3G96A 2HVIA 5FJ4A 3C6TA 3M8QA 4N7TA 1X5TA 4ZCKA 3S01A 2HHQA 3CJ8A 2HMIB 3HHLC 2CQPA 1FRKA 3HFKA 1JLBB 4Z37A 2HHHF 2DJWA 5M2UA 2VZ9A 3VTIA 4DX8H 3QJJA 2HHXA 1UVJA 2KRRA 1RHRB 2XYGB 2X51A 2D3ZA 1VQKS 1IKVB 1HBUB 1QTNB 1VQLS 5KG5A 3X3UA 3MHYA 1S4EA 4Y28C 4X4VA 2IA0A 3FK4A 5B08A 4D3HA 1KP6A 2OSQA 2YNHB 3QMQA 5IC4B 4DG1B 2YTCA 4NX9A 2ZH4A 2HIQA 1SJQA 2KXHA 3GMGA 3GJTB 4CLZA 4MIAA 5IV4A 4DR6F 1SKUB 2GHWA 2ACYA 3MFHA 3QRRA 3KUHA 3TOQA 5LMNJ 4FVCA 4RU2A 2F8HA 5B0CA 1XMOJ 4NZ0A 1TL3B 3MDFA 2F8EX 1YJVA 1C1BB 2RQ4A 1P9QC 3NGKA 4RBUA 3UCZP 3M05A 2VA2A 1WUUA 6FDRA 1Q95G 1LK5A 2HVHA 4WFYA 3HHEA 3LQVA 4QR1A 4TU9A 1V3ZA 2DH8A 1JJ4A 2ALYB 1RWUA 3W2VB 3LWLA 2B0GA 2HAIA 3ULHA 1EAYC 3FQKA 4FYWB 2IM2A 2Z56B 3EZUA 3HD1A 2J8SA 2MPUA 1YKWA 5D0GA 3Q8SB 4ZPWR 1VCTA 1EX8A 2X3DA 3NWRA 4KO0A 4P9SA 1D9FA 2UXCF 3EVWA 2F65A 2H3EB 2AYBA 1LEOA 3KLFB 5KFXA 1XNRF 3BDPA 4ZK7M 3T41A 1SQGA 4KPYA 2GJFA 1YJUA 4EBDA 5HROB 1XC9A 4FF4A 3MPYA 3EZOA 2ZFHA 2FJDB 4BS2A 4M5JA 1L3KA 1VI7A 2CJAA 5SZTA 1FESA 4X4OA 1RKIA 4GO7X 4BDPA 5HBMA 3I5BA 2V6AA 2PD1A 3MM7A 3H25A 2HFSA 1LNQA 2J9CA 1HA1A 3N0VA 2YKQA 2PMHA 1G1XA 1FRXA 2JVOA 4OMFG 2JX2A 4RWWA 5DS7A 1Y5IB 1JWWA 2OPPB 2V63A 3FQLA 1TR0A 2HNZA 1PBUA 2KT5A 3NXZA 2MY7A 2LEBA 2XI2A 1NEEA 3T1YJ 3BKTA 4RW4A 4P2MA 1U1RA 3PR4A 1FK9A 4WBFA 4ECWA 1ZA1B 2O67A 3HKWA 3WBZA 4DS5A 3TEHB 5J1EB 1M5KC 3DLGA 3Q22A 4ELUA 4Q2LA 2JL9A 2NXNA 1N32F 1DBDA 4QU6A 2XYHB 1WKJA 1FEEA 3IR6B 1SBRA 5KFLA 4QZVB 2DHHA 2LU1A 2Z30B 1H0HB 4KKOA 3S7RA 1SKWA 4L73A 4JI4F 3MOJB 4EK2A 1UW9A 1VR6A 2IA6A 3VAJA 3QIPA 4ED5A 5E3PA 5F3ZA 3JTOA 2R7VA 2CYYA 2GGPB 3CD0A 5DO2A 3MEKA 3R5DA 1TL5A 2ZH5A 3C6UB 2VODA 4MFBA 1OSCA 1I1GA 1JLGA 5C42A 2XY6A 3PYGA 1YDLA 1KNZA 2HHSA 4OYMA 3NCRA 4XO0A 2E5HA 3UD4P 5GAGI 2C3PA 4CLUA 3S1TA 2BJ8A 1Q16B 4I7FB 4LF4J 3BYRA 3B6BA 5I4MA 2UUBJ 1F3VA 3Q83A 4QBUA 3X1LB 2UZAA 3P8BB 3OFEA 1NJWA 1KD1T 2YKOA 2DHSA 3G4SS 2DGSA 2M7SA 2R8KA 3OD2A 4ZCMA 1HFEL 2QA4G 2BOAA 4JI6F 1X5OA 1U45A 1SL2A 3ET6A 2E1MC 3ADAC 3CUNA 2QL9B 2WAQD 4DL5A 3EXYA 3IGVA 2R7RA 2ZJPQ 2RD5C 3OTBA 5HK4A 5C24A 4PG8A 2VQEF 2ACMA 3CULA 2AZ3A 4OZ3A 3VCDA 2DXFA 3OUYA 4JI7F 1PYOB 3QSYB 1J5EJ 4DSLA 4W92B 2GVZA 4QPXA 2IBOA 3HLUA 3PJ9A 4LJMA 1FDNA 1RAEB 2YQ3A 1CBKA 1FXDA 2ZHAA 3KK1B 4B3TJ 3H98A 1VBZA 2GVZB 1Q8BA 4OI6A 3QO9B 3C15A 2J6SA 4FBUA 1KQGB 1DTQB 4NA2A 1HWUA 2EG1A 1OY9A 1RWPB 1U6FA 3ENQA 2DNPA 5EX3A 1WSVA 4Y2MA 2LQ8A 2C2DA 2OMOA 1F60B 2DD8S 2OEKA 2NS1B 4O3QA 1K8AT 2XZWA 3US5A 2E7VA 1S1WA 2LYVA 2YNHA 2YX7A 5K20B 2XMAA 2VONA 2KB2A 3IFEA 2HLTA 4IR1A 2CQ2A 3NAIA 4IH6A 3KJFB 2BDPA 1QVGR 3FGVA 4Q5VA 4OLOA 1RTDB 5ETVA 4QWCA 1WHYA 4CCHA 4ZCLA 1BQXA 3BGFA 4IFYB 4UT4A 3KLHB 1S0MA 2F4FA 3AQOA 3BYPA 4QR2A 5C5JA 5J2NA 5J2PB 2AJQA 2HSEB 3PR5B 4ZVPB 4F04B 3W61A 2KKHA 3TWZA 4JV5F 4JI5F 1ZTWA 4URSA 2WCXA 3H2VE 4PEOA 2HW3A 1N36J 2W2PP 4A4JA 1XR5A 1S1XA 2MZRA 3GIIA 2J0SD 1U26A 1X4DA 2YBVA 3DXSX 3J7A1 4F7VA 1LW2A 3VQTA 1BLUA 2R3VA 1M5PC 2KTQA 5I3UA 3W3SA 4LFAF 4PQUB 1FKPA 1Z1ZA 3G6XA 4EBEA 3QQCD 1SJ4P 3E2EA 3NG8A 1EKRA 2Q66A 3NNCA 1AZSB 2XCAA 2MQLA 1BE4A 2OPQA 4IQMA 4K4TA 3TANA 2ALZA 1DTTB 4E98A 5HVHA 2NZ4A 2CQ1A 4NLQA 4NI2A 2FC8A 3PHEA 3HT3A 2QL7B 5HLFA 1BXNA 2GIFA 3NGRA 2FHJD 4G3IA 4NZ7A 4W90B 2D9PA 1BD6A 3N5BA 2GIQA 1RAFB 3PKYA 2BM0A 3DU6A 4QR0A 3MM5A 1OYDA 3HSJA 2MKHA 5ETQA 2V4QA 3T1HF 3PDNA 3TVKA 1VISA 1P1LA 1LQ9A 4ZKAA 2B4VA 1FVSA 4Q43A 4ZIWA 4U7UK 2GS8A 3GCWP 3N4WA 4Y00A 1NK7A 3PEHA 1IBKJ 1S7HA 2B9EA 3IR7B 3M8YA 4JBCA 5KFDA 4DU8A 2KM8B 2ZH9A 1YGYA 1CJVA 2VU5A 4C8KA 2WZ1A 4OHZA 2H9ZA 3BR9A 3CMQA 3PFEA 1C0TA 4FYYB 4O4GB 2MHNA 1S76D 4N41A 1U1PA 2VIHA 2V94A 2UV8A 1KONA 2HS4A 3KHLA 3TO8A 2HS3A 2IC3A 4TQRA 2B51A 1PC5A 2MZTA 2JLGA 1X4GA 1D1UA 1KLMB 1JMTA 1UPPA 2ASLA 4Y34A 2IAJB 1NHUA 2FYXA 2OUGA 2HFOA 4NLVA 4DV6F 1T11A 2I5JA 5CHCB 3KKFA 1R8PA 1NK5A 4L74A 2GNKA 4YS2A 5KTQA 3HP6A 2QZ8A 3UPFA 4ECRA 1D8YA 5E3QA 2H48B 3CJSA 3EPIA 2WVCA 1CJKA 4FBTA 3HT0A 1NU4A 3IBCB 2RDJA 1TKXB 5K5MA 5FDLA 2BE7D 4CLTA 2DNKA 4WIIA 1U1NA 4LF7J 3H42A 1VMBA 1J5OB 2ZBRA 2I8EA 2HBYB 3NS7B 2IIHA 4R5PB 2X3GA 3QRQA 3K89A 1OY8A 4G1QA 2PSZA 4R0EA 2ZD1A 4PZVA 2H4YB 2LP4A 4WP9A 3T1AA 2QFIA 1MWYA 2DR9A 1SC3B 4EGLA 5HSPA 1PJ6A 3GV5B 4HKQA 2Y1RI 2XYPB 4LQ3A 2KFYA 4JV5J 2BKPA 3PG9A 3FRYA 1RB0A 1QE1A 4ZPDA 1YZ6A 1WF0A 1HPZB 2DR8A 1ICEB 5F3TA 4R5PA 3DRRA 3OHBA 3MOZA 3G82A 2BJDA 3RGIA 2RSQA 4N47A 1HQEA 4GKKJ 4ID5B 4KGVB 2BA9A 1O51A 2NYHA 3IMQJ 5FDLB 3MM9A 2PN6A 3OTOF 2OTJS 3ENWA 2GV1A 3AAWB 2ZJRQ 4JI0J 2I6WA 3H5XA 1NKEA 3KG4A 3K8WA 3IBFB 1HARA 1RSCA 5DDQC 1JLCB 5D4NA 5RUBA 2OH2A 3WIVA 2I5JB 4DV0J 4YR2A 3KLFA 2DHAA 1RP5A 3K8VA 2UVWA 2GVDA 1FRIA 3I0RB 3EZ5A 1HNZF 2LKZA 2VQFJ 1HBNB 2DRBA 3GQCA 4B3MJ 1ZYQA 1ZAWA 3TX0A 5DQHA 3MMBA 5D78A 4Q44A 3HJVA 4WU3A 1ZM9A 2IPOB 1RT6B 1X4BA 2YNIB 4ED8A 2MQMA 5A6PA 3K59A 4DSEA 4TY8B 4UY8T 2CG4A 4X2BA 2P2CB 1ZAVA 5CCLA 3KK2A 4NI2B 3HSDA 2DO0A 4CI0B 2VBXA 5DLGA 2B8QA 3OBIA 4I2PB 2YPZA 2E1RA 4C0BA 1W26A 1Y00A 5F8IA 5F8MA 2W2NP 1SB6A 3MEGB 3V6KA 1B70B 3PACA 2HWHA 1F3FA 4OQJA 3BEGB 4P2XA 1RA6A 1D9AA 2IDLA 3B8HA 3IS9A 3M1VB 4AL7A 4CLPA 3CC7S 3SCKE 4B9VA 3MEEB 4NLWA 3T19A 2UUAJ 2CFXA 1WG4A 2HZAA 3TI0A 2E1AA 5J1PA 1U8SA 2DITA 2ZNYA 1JXEA 4WZQA 1SJRA 5B0AA 3NP5A 4DZ6A 2O3DA 4ZLNA 4RZRA 4Y65A 1HNXJ 5DGBA 2UXBF 2W4PA 4J9QA 3M6VA 1JNZB 4NLPA 4YB5A 4Q45A 4F26A 1LW2B 2F4VF 3CDEA 3QJLA 3CIZA 1R6VA 1VJWA 4I0WA 2W9BB 1UW4A 3Q8QB 4PWWA 2H5JB 3CF5Q 3EDQB 2Y1JA 3QYYA 1T9UA 1WHWA 4WJBA 2CQ3A 5ETMA 1RACB 5HN0A 5MLCV 2ZNZA 1H2UX 2LQ5A 3SV4A 4KPCA 2WB4A 3BGUA 2V50A 1FEHA 4PWUA 1FVQA 2DNNA 1EKSA 2K7JA 2YH1A 3LGHA 3VALA 1ZPVA 1HBMB
chains in the Genus database with same CATH topology
2J5AA 3LP1A 1KQKA 2IRYA 3C6UA 4HTIA 1YHQS 2JZ5A 3IGNA 1SQEA 4BWMA 1JLQA 2RMLA 4B08A 1T95A 3DGPA 5IM0B 2WHOA 1N56A 3FSXA 3V6DA 1JLEA 2BXJA 2VG6B 1LW0A 5IM0A 3M6UA 3NGDA 2P6SA 5KFUA 5KFQA 3R5AA 3GIMA 1PGZA 3NBPB 1VQ9S 4IDKB 1Q8IA 2B6AB 1X5PA 2CPEA 2ZHBA 4RX6A 5J2QB 1LWEB 4DMZA 3TW0A 5LMNF 5FD1A 1QM9A 1U1KA 2B3TB 2VKRA 4TKTA 3ZC4A 4KE5A 2Z2LA 4F25A 3RRGA 4IUFA 4OZJA 2OO4A 5EX0A 3BB5A 2A18A 1HBOB 3DHWC 3QPIA 4TNOA 4WKYA 3Q24A 2FHMA 4Y6IA 3MUMP 1F0XA 2IM3A 2V0NA 4I6YA 2VV5A 5EWGA 3F44A 3VZIA 1APSA 4X4UA 3D54A 2V8GA 2V9WA 1CC7A 3FFIB 3LWMA 2DGWA 4H4KA 4ZPTR 2XMVA 3HI9A 1LKZA 2BZ2A 4KO0B 1KTQA 2J9DA 2J0QD 3DM2A 3NMAA 1KR4A 3HHLB 2GA7A 3TVZA 4HVZA 2UU9F 2CPFA 1UWBA 4USIA 2DNHA 3TRGA 2BVZA 1ZAXA 2JRSA 3CULA 3NNAA 5GADI 1U6BA 1LW0B 1T3NA 1NO8A 2AU0A 4DV2F 2XNQA 3V6DB 1RTHB 5DQGA 2HNDA 1S0NA 5LJ5Y 5HI7A 2ZOGA 3H5SA 4OFZA 2HG4A 3BSCA 4KFBB 3WDOA 3D0GE 4WK1A 1LFWA 2MB0B 1CVJA 2J9EA 3CD7A 2MKSA 5HMYA 1HBMA 3GYXB 2G1DA 4M94A 2UUWA 2RNEA 5H1SV 1P8GA 3NCPA 4MKAA 3I56S 3TARA 3L3CA 2G13A 3PV8A 1URRA 4LIWA 3UR3C 2XMKA 3J7ZT 3MMAB 2QEXS 1HI0P 4X62F 2B7BB 1KFDA 2BQ3A 1S72S 2B4PA 2FC9A 3MECA 2CQDA 1X9MA 2IBKA 3I0SB 1S1VB 2ZKTA 1UVNA 4KHMA 1OSDA 2DO4A 2V9KA 4A8FA 2XWYA 1VC5A 2GMHA 1JK9B 5ITHA 1SJ1A 3L7PA 3PRBA 1GXUA 1U2RA 3LGMA 2CZVC 2OPSB 3H2UB 2RRNA 3TA0A 1ULRA 1FRLA 1M1KT 1S49A 1S9EB 3I55S 5E33A 1YVFA 2ZKUA 1GTHA 4A8SA 2CRLA 4C9DA 1BWEA 2R2RA 2LECA 1NK8A 1U24A 1HHSA 3P5TL 5KT3A 2W7OA 3QAEA 4TY8A 1TKXA 1SKSA 2RILA 4WFZA 1DURA 4WXOA 1TK5A 2DNGA 3JSMB 1EP4A 4CTAA 2KVIA 2KG1A 4ZHRA 1VQ5S 5AXMA 3NNHA 4IOBA 5GAHI 2AJ1A 1VIXA 4CH0S 4MH8A 1N6QB 1BQMA 2JC0A 1XK8A 2E9TA 1XNQF 4O44A 4PCQA 4AXJA 5E41A 4I6WA 4I67A 2WONA 4OI0A 2LXFA 3D1HA 3GZ7A 2N4CA 4FPRA 4I56A 1I94F 1ZTTA 4X4QA 1EETA 2EFGA 4C3MA 4DUYF 1R8CA 1JJ2R 1TFYA 2POKA 3CT9A 1N5SA 4MIWA 1KOHA 1AUDA 4IYQA 3MMCB 4AQYF 3KJVB 2NXUA 1BQMB 1DLOB 4C3KA 3BO3A 2Q43A 3BREA 3DRRB 4K4ZA 3NWGA 1PO6A 2JEJA 3FZ2A 1M5VC 5M2RA 4F4WA 2ZITA 4ZHRB 5D4LA 3KHRA 2LQBA 3MM8B 2V8DA 2Z8QA 3SCIE 2P9GA 4G1PA 2XS7A 3TNVA 1JX4A 2M8DB 4IO9Q 1FKOA 2CQBA 3Q23A 4Q0BB 1W2IA 1RT2B 4CO5A 4UOCA 5KT4A 4X4PA 4GKKF 5CYMB 4J5OA 3PY8A 3TQ1A 4PWDA 1A7GE 2DHXA 3DLKB 2OFGX 1B0TA 1RTIB 1MWZA 1TAQA 3M8PB 1GH8A 5IQ6A 2RJZA 2FPHX 4EZ6A 2R2TA 1KHWA 4CT9A 4QIGA 1RAJA 4HH0A 2ZH6A 4F2RA 2LVWA 4A48A 5CA5A 3CMES 4A46A 1E6VA 5JVGQ 3U1LA 4JV2A 1TVRA 2YWKA 5DQIA 2VG5A 3P3DA 2J8AA 4OHWA 5HMWA 2KXFA 3W7BA 1S0OA 2BJEA 1S1VA 4ETXA 1N33F 3SQGB 3PO5A 3MMCA 3DN9A 3E51A 2LDIA 3TVYA 3G6ES 2GX8A 1N0VC 4EYIB 4QWAA 5CYQA 4DSIA 3I0SA 4ALZA 3RAQA 2A2CA 2QA2A 4K5SA 1HNIB 2WOMB 2BV3A 1S1TA 2YWHA 1VBZA 2DGQA 5L9XA 1TL1A 4OZ0A 2W25A 2DGTA 2L9NA 1QSLA 4PXBA 2WBMA 3CTRA 4I69A 2IRXA 3KK1A 1U1LA 1RT3A 2QSWA 2L3MA 5KOXA 3W2WB 4UQGA 1GXTA 2QE5A 3M2RA 2YKPA 5E7OB 4WK3A 5KOWA 3FRZA 3CO9A 3EYZA 2CJKA 5HQ8A 4NLUA 5B7WA 4BWJA 4M8LA 2B4UA 2VG6A 5A8WA 1UVIA 3MAQA 1VOMA 3U27A 4DPOA 1SUQA 2J0WA 4I2PA 2ZH2A 1IXKA 1S79A 4DN0A 3CXCR 4HYKA 4MKYA 1JLQB 4HLBA 4N56A 3SSQA 5L8RC 2IVFB 5GAGU 4F4YA 1KSPA 4OZ1A 4YB7A 3HJFA 2GMJA 2RDIA 3BSAA 2FHJA 3LW5C 1DJ0A 3ETOA 2M5YA 5D6GA 5KG7A 4I7FA 2U1AA 2Z0GA 4XK8C 1YI2S 1DHMA 4C8YA 3BQ1A 2NREA 3QIDA 3KLHA 4C97A 3MTJA 4OJ1A 2R2UA 3RAXA 2HWTA 3T6JA 3R5CA 2YNFA 3FEYB 2FJXA 1P1TA 3ZZPA 3D2WA 3QGHA 2JDJA 1H3DA 3KG0A 5A0YA 1VBYA 2OD4A 1S1WB 3FJ2A 3PW0A 1NKCA 4I68A 4GO5X 1SH3A 2ZH1A 2PI4A 3R5BA 3CCQS 5J2MA 2B43A 3N79A 3QZ7A 1OQ6A 2X1FA 3D0HE 2WSEC 1N5QA 3DLLQ 5BR8F 3RB6A 3GE9A 1WF2A 4OJ3A 1FERA 4BC7A 4JI8F 3BO4A 3FDSA 1WEXA 1LOUA 4DL4A 2AJFE 4NYOA 1KVIA 4ZPBA 2HNZB 4OX7A 5KFNA 3PIOQ 2P5VA 3AY0A 1KRPA 1XMQF 2QIFA 2M4MA 4F3OA 4LT6A 2LU2A 1IM4A 5HLFB 4URGA 2NR0A 4Y3CA 1RTIA 3LGNA 4QQBA 4DJBA 3ISZA 1UJ4A 4YR3A 3BO2A 2COLA 1D0EA 5B0DA 3DRYA 2K8GA 4USHA 3B4DA 2IM0A 5F41A 2GMLA 2M2BA 4WYLA 4PPDA 2YKMA 3CCJS 3HX9A 2L08A 1R31A 2HNYB 4OX8A 4C98A 4TXSA 5J1NA 5A8KA 3KOAA 3K5LA 1U49A 3BQ2A 1FNXH 3K5PA 2ZDPA 2LEAA 4M5DB 3EX7B 4KR0B 4R8UA 4OL8A 3IC1A 1WG5A 1WF1A 1WELA 1YRTA 2R7UA 3MEDB 1UFWA 3N9UC 4EUVA 1EETB 2CQCA 3CGIA 4A47A 2FJAB 3MM9B 1RTDA 4WXWA 2NPFA 4DUZF 4KKOB 1Q7LB 5KT7A 1N34F 4RU9A 6FD1A 1RYSA 2R8JA 4C0OC 3CIMA 3MMAA 2PI5A 3B82A 4DQQA 5E3CA 2VPWB 3UFCX 2C42A 2UUTA 2ZBCA 3EUNA 5L38A 3MPWA 4FS1A 4C11B 2NPIA 3P6YC 4FN5A 5K8OA 5KFPA 1X4CA 1DZ5A 3OR2B 3Q0AA 2DIUA 2LMIA 3IXQA 5FLXY 4XPEA 4K4YA 2ZD1B 2XLKA 1X7VA 3NBPA 1QAJA 3G8SA 2NSCA 1T05B 1S9GA 3FSYA 2AX0A 2UVVA 4RNMA 2E5JA 3GG1A 4YY3F 3NS5A 4ZA1A 4HT7A 3CMAS 2QSFA 4TU8A 1AROP 4DBQA 3SFGA 3PRDA 3RR8A 3MFIA 3VZHA 3NMRA 3H4DA 2HPUA 1N0UA 1S1UA 2W4CA 3I0RA 1JLAB 2EFPA 5EWFA 1GAOA 1Y3KA 2MZSA 3ZZUA 3OR1A 1VC6A 1CEZA 2KJWA 3CB4A 2JEFA 2GFFA 2R7TA 2BR0A 3IWLA 2K1RB 4WE1A 3CVKA 4IRKA 2JOQA 2QLWA 2HHPA 3C46A 5CXTA 1B64A 4OIXA 1S99A 5U47A 2PO4A 3QIPB 1KN6A 2WB1D 3AB4B 3I9V9 1R0AA 2HHVA 4B9LA 1UETA 2DBBA 3U1NA 1IKYA 1HYSB 2ROPA 2IFXA 1S6UA 1C0UB 4NLYA 4YDDB 1QSSA 4B9TA 4NCAA 2OD6A 2YH0A 3UQSA 3DOMA 4A8KA 2M9KA 2RIJA 4NYZA 2JEGA 2EKYA 1J5OA 4PR6A 2N82B 3KWMA 2C2RA 2HNDB 2CKWA 4WFNQ 1SIWB 1UEUA 3JSBA 2R8GA 4AXIA 2QT7A 3OPKA 4DV7F 3R1LA 2V4RA 2XHWA 2E1CA 1HNWF 4YOEA 3D0IE 3MM7B 1QAXA 1RDRA 5LSLA 4J9RA 3OHAA 2YNIA 4B3RF 1HW8A 1Q81T 1C4AA 2K7KA 1GQEA 4IG3B 4NOHA 4J9PA 1FCAA 3GFYA 1HYSA 3V4IB 2XSFA 1X4FA 2FHKA 4I2QB 2CQ0A 1NK4A 1KQFB 1N5TA 2IC3B 5J2PA 4A8YA 5FIIA 2R8IA 2YY3A 5DLFA 2DGXA 2XLJA 2EVZA 4DR1F 3KYLA 5KFZA 3G9CA 3TR5A 4IOAQ 4RUCA 4TY9A 3O44A 1V3SA 3UR0A 5KFHA 3IWNC 1TL4A 1PILA 4KAIA 1TAUA 3L7OA 2W9CB 1HWLA 2ZVSA 5KFIA 4X4SA 3QGIA 4C8MA 5HMZA 1N6QA 2E5LF 1LWFA 3AH6A 1K9MT 3HHDA 2ZBIA 3CCRS 2B6AA 1O8BA 2C22A 4C8ZA 2AJ0A 2MKJA 2GW8A 4AUKA 3K58A 3DLJA 2JLFA 1RT7A 4IR9A 4ZVFA 2LA4A 3KLVA 3JSMA 4ZDNA 3HVRA 4LF9F 3THVA 2KU7A 2XGPA 4Q8EA 3KG1A 5D4OA 2ZH3A 1W25A 2J7UA 2QO3A 5GAHU 4KV8B 2XWXA 2MQOA 2CPXA 4R0JA 4JV0A 4B3SF 2HGLA 2O01C 2B56A 4O3RA 4CNZA 5LJ3Y 3OVAA 3CDWA 4DV5F 3J7YI 1HNVB 4JOUA 2GO8A 3EXCX 1O0PA 1BY9A 2R7OA 2HNYA 3IR5B 1YRXA 2CPIA 4IFYA 4EEYA 2BQUA 5B0FA 3FEZA 3IWXA 3TX8A 2W24A 1WTBA 1CSJA 3U1MA 4CQ1A 1N88A 5KFEA 2KYXA 3MM6A 2R7WA 3JTPA 4BBYA 3MEDA 1C4CA 2LQJA 4F4ZA 2WW8A 4O4GA 5AXLA 1ZOTA 3MECB 1XEZA 5KAKA 3DLEB 3WC2A 2VUGA 1S9GB 5KFCA 4NWBA 3PVXA 1XR7A 2O1PA 2OJ3A 2LEPA 1SH0A 1GX6A 1F5BA 2DT9A 2KI2A 3V2UC 4ATNA 3N28A 5AE2A 4H4MB 2O66A 4JV1A 5B0GA 2OTLS 3LAMA 1L5UA 4EZ9A 2ZZNA 1UA1A 3TAQA 4DR6F 1IBKF 1A6LA 1DFDA 2JJ4D 3EGWB 1GX5A 4PUOA 2DTJA 5E3RA 5MAOA 4K0KF 1S10A 3V6HA 3KK3B 1UKUA 2CQIA 5DDOC 1CQNA 4O0IA 1NHVA 2C3YA 1MMNA 3PM9A 1VQSA 2M88A 4R8UB 2E7XA 3OL6A 4DV3F 1Q4RA 3DI6A 4R25A 1S77D 2CPHA 5IQQA 3TAMB 2Z4PA 3T5HA 2FJBB 1LXJA 3PKMA 1Z2LA 2KZZA 2A3JA 1SIZA 5A2QY 1VQOS 5DGAA 4TQSA 2ZJQQ 1FDBA 2KRBA 3TAMA 2DH7A 4RW6B 1X4EA 1ROFA 4D3GA 5T14A 1CC8A 3DNCA 5A8RA 2OLWA 2AYMA 1QVFR 1FXLA 3E01B 3M2VA 2ZE2B 3CC2S 1N5VA 4C8OA 2AX1A 1GTEA 2MMYA 2VFRA 5F8HA 5D3GB 3CD6S 2Q1LA 1C1BA 1TUVA 2QA4S 4KB7A 3UCUP 1YSJA 1X9SA 2BBEA 1OPZA 5A8WB 4UQTA 1J2VA 2LXIA 3TP2A 5KT2A 1JXLA 1Q8LA 4N8NA 3DC2A 3PW4A 4CO0A 2LQ9A 3NL0A 4HL9A 2KG0A 2F1FA 3BGLA 3DMJA 1MMDA 4I64A 2HZCA 4G1QB 1CQMA 5KFTA 2PC6A 5JUMA 1O5JA 3BGRB 1RTHA 2W4DA 3ENVA 2ZE2A 2Y0SD 4C8NA 1HHTP 4RUHA 3K5NA 1KEKA 5D3GA 4WFAQ 2HHWA 2L48A 2QV6A 1REVB 5KG4A 4JI0F 4DFMA 1ELOA 4YEAA 5F8LA 4EO6A 3LP1B 3KMQA 1SV5B 2DNRA 5K8PA 4ES1A 2EK6A 2M0GB 4QWBA 3I4HX 2EBEA 3P49B 2W8KA 1CPZA 1R6YA 3BJYA 2J9DE 1K0TA 2MQQA 3QLHB 3GV8B 3I9ZA 4IG3A 1JLAA 1JIHA 5J2NB 1C1CA 2RVJA 3UE2A 2YKAA 2SXLA 4IG0B 5AJ3F 4OZ5A 2X1GA 1QAIA 2VD3A 2D74B 3BF4A 4K50A 1VC0A 2B9XA 1HBOA 3I5AA 2HRYA 4JI3F 3CJ5A 4ZVGA 1UA0A 3DYAB 4LUBA 1PSDA 4J9KA 5GAEI 2DB1A 1TKTA 2DISA 3CCMS 3CCSS 4FNIA 3KHHA 1NJIT 1DTQA 1RJJA 2RUGA 4DN9A 2DCUB 4E8UA 3LP2A 1U1OA 3BN4A 2FVRA 2AQ4A 2BE2B 4YFUA 3AJ2A 5EDWA 4DR7F 2WSFC 4P7TA 2Q6CA 2MZQA 2D3OR 3OUYB 2AP6A 5CCMA 2UVRA 1IKVA 2DHGA 7FDRA 2RS8A 5K8MA 2PE8A 5H9FJ 1FF2A 1RT4B 4DV4F 4F02A 3GG0A 4RBVA 2YWFA 4A8XA 3DRXA 2KDOA 2XMJA 3PW2A 1VHFA