5IWAF

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5iwaF00
4AQYF 4LFCF 4LF5F 4JI0F 4DR5F 2UXDF 1N32F 4DV3F 1IJEB 1HNZF 4DUZF 4LF8F 2UUCF 4JYAF 4JI6F 1XMOF 2UUAF 1VMBA 1XNQF 2VQFF 4B3RF 1IBKF 4JI4F 2RJZA 4B3MF 1GH8A 1G7CB 1G1XA 4B3SF 5LMNF 1CQMA 2YY3A 4NXMF 3T1HF 2UXBF 4DR7F 4DR6F 4KHPF 2BXJA 3R3TA 4B3TF 1CQNA 2UUBF 4DV1F 4K0KF 4LF6F 4DR1F 4DR3F 2B7CB 1IBLF 4LFBF 4GKKF 4JV5F 1IBMF 4GKJF 1F60B 4JI1F 3OTOF 2HHHF 2E5LF 4LF9F 1HNXF 4YY3F 1FJGF 2ZM6F 4X64F 1J5EF 5LMUF 4X65F 1N34F 2F4VF 4YHHF 4JI3F 1FKAF 1HNWF 2B7BB 2VQEF 1XNRF 5AJ3F 2KJWA 5IWAF 4X66F 2J5AA 4DV5F 4JI2F 4LF4F 4OX9F 1HR0F 4LFAF 1QJHA 4NXNF 4DV0F 1N36F 2KJVA 4DR4F 4JI8F 4DV6F 2UU9F 1N33F 4X62F 3ZZPA 4DV4F 5BR8F 1RISA 1B64A 4JI7F 4DV2F 4JI5F 1XMQF 2BVZA 4DV7F 4DR2F 3T1YF 4DUYF 4LF7F 1LOUA 1IJFB 1I94F 2UXCF
chains in the Genus database with same CATH superfamily
2XGQA 3H0PA 4OJGA 4TKTA 2OAUA 1IR2A 4DCOB 2EK6A 5CAAA 1BQMB 1J27A 2H3EB 3IGNA 4IFVA 4KGKA 1FRMA 3S1TA 3MMCB 3QT6A 1IM6A 2XCAA 2HBYB 3OSPA 4X2BA 1KOOA 2OEMA 3A12A 3AD8C 1NNDA 3O44A 5CYQB 3J81Y 4LFCJ 1N32F 2HVIA 1DQ9A 1BQNA 3FCVA 2HYIB 5B0AA 1EQ0A 2DNNA 3H4DA 3Q0AA 2PDAA 1NPRA 1HQ2A 4TYBA 1YJTA 3NOGA 4WKYA 1U1RA 5BXIA 1JLFB 3QJLA 1RHMB 4HTIA 4KHPJ 1CSJA 2C3PA 2N3LA 3W2WB 5FIIA 3R7SB 2V2KA 2JSXA 2VQEJ 2VQFF 1NSPA 3CB4A 3M2UA 5LL6d 3RAQA 2EXUA 1CJKB 3X1LB 4CLLA 2D7SA 4C8NA 4ETXA 2W9BA 2NYIA 1MU2B 1U6BA 2XNQA 1GX6A 1BLUA 3OVAA 5HMZA 3DMJB 5E33A 4ES1A 4X4UA 2CPFA 4DPTA 1HW8A 5HATA 5F41A 2Z2YB 2CQ4A 3EYZA 4PRFA 2NSCA 1RHUB 2YNHB 2DXDA 2G2YA 2IBOA 3I96A 4I6YA 4M63A 4CLZA 3AH6A 1RWVB 2EI5A 2W2NP 3NKYA 4NLTA 5KFQA 2QMUB 3W2WA 1VQMS 3F73A 4O0NA 3DRRA 1ZA2B 1UZHA 1X4FA 3DLEB 3KMSA 1SJ1A 2DRAA 4K0KF 3QJPA 4N8OA 3LWLA 4R25A 3ZNUA 1L3UA 4HH1A 4OZJA 2B3TB 4DF8A 1YBTA 2HFZA 3FBBA 5D6GA 4GKKF 3GYNA 1R6YA 2OO4A 2ZE2A 2JEIA 2FTRA 3GJRB 1FKOB 2B6AB 4ZPTR 3N28A 1HBNB 4WP9A 3MUVP 4AL7A 3OL8A 5BYQA 5A6PA 1SKRA 4KGZB 4ECXA 1GXTA 3ICLA 4X4VA 5C25B 1N36J 2X1GA 4OMFG 5KFMA 4JBCA 2MSSA 4OJ3A 4ECTA 1WACA 3Q8VA 5ETNA 4ALZA 4F7VA 1KD1T 5L38A 1HNWF 5J1EA 1AFIA 3JQKA 1K0TA 2XNRA 1WOSA 4YR0A 3IM9A 2LECA 1XNRF 2HK2A 2ZZNA 1VRTA 2JDJA 2DEIA 2QL5B 5DG8A 4P2XA 2C3UA 4PXEA 1H38A 2EVZA 3SYZA 3QWPA 4IYQA 4RW7B 1FHTA 3NNCA 1C1CB 1WF0A 3MCNA 2FQQB 1TKDA 1R8BA 5ETTA 1XJWB 2F1FA 2O1PA 3TJAA 4F02A 4NZ0A 1TK8A 3M8RA 4DV0F 3FDSA 2MQOA 4BCAA 5KT7A 4B3OA 1NKBA 1FKOA 2B6AA 4O44A 3KK3B 2P8IA 4DS4A 1VBXA 3CJSA 2IYGA 4CWBA 5DGAA 2KKHA 2NXCA 1NO8A 2PMHA 3MTKA 3BR8A 4JI8J 4K0KJ 2IA0A 2B51A 2JFDA 4KPYA 5B08A 4NCAA 4AXJA 5A8KB 1RI7A 5FLXY 1NKCA 2HHUA 4U95A 4CLUA 4ANDA 3OLAA 1RISA 2NUHA 4ECZA 6FD1A 5H9FK 2YWHA 3PY8A 1VRUB 2GC8A 2FJEB 3KLFB 3UPFA 2AJ2A 1IQTA 4ZLPA 1T9UA 3KJVA 4KRWA 4YQWA 4MTPA 4RWWA 2C1EB 2BQRA 1WEYA 5D8HB 4C4WA 1R8HA 2QYGA 2DGOA 5CH7B 4WU2A 2K8GA 1JKHB 2VFUA 4C8KA 1WC5A 3RJMB 3UVJA 2BKNA 2VL1A 1U0SA 2RDDA 3KLIB 3SIPB 3THTA 4DZ6A 3H5SA 4HACB 3UDLA 3BSOA 4JI0J 4AQYJ 3M2VB 2ZH4A 5EX3A 3MFHA 1SPBP 2X51A 1YLXA 4XDCA 2YKMA 1VISA 2ZVIA 1SJRA 1VQLS 3RRGA 5C5JA 1YTYA 3RB6A 5CCMA 4LF9J 3EE3A 3JSRA 2HNYB 3NCPA 3SBMA 1RE1B 2UUCJ 2E9RX 4HKQA 2UXCJ 1U0HB 4MH8A 3M05A 4WFNQ 2BJ7A 2B8PA 2V4QA 2NXUA 4IQMA 3QGIA 1TZ0A 4Q2LA 5CHCB 1JKHA 3AQOA 4JI6F 5HMXA 1TFYA 4JV0A 1UJ4A 1WF1A 2UUAF 3OR2A 4TLQA 2P6SA 3RR8A 4DQIA 5I3PA 1UFKA 2RRBA 3DDKA 1KNZA 4A8MP 2KVQE 4OZ2A 3EVWA 4O4GA 4ZPDA 5FD1A 3NMAA 2MQLA 3MWBA 2CVEA 2COLA 1JXEA 2IVFB 4DL6A 5EN1A 4R0JA 3M30A 3MEKA 1VBZA 4DU7A 5IT9Y 2HS3A 3CCVS 3HVAA 2ZBIA 4CIOA 4HI2A 1JNRB 2XY6A 2XY5A 1CS4B 2DO4A 2MY8A 2NR0A 4KE5A 2W7OA 2DYAA 5G0RB 4N77A 1RBOB 3BGOP 2XQCA 4TY8B 3KK1B 2UUBF 1FVQA 1Z1ZA 1UFWA 3DRPA 3LO3A 4USKA 1URRA 2B5JB 1HBUA 2RRNA 2EFVA 4DV1F 1FEHA 3MHYA 2UU9J 4P7TA 3TQEA 3LP2B 1S6UA 4LQ3A 2OPSA 2C3OA 3HJVA 4F36A 1F3VA 4N8NA 4DLGA 1F9FA 3H5UA 3DLLQ 4KH1B 1S0NA 3OTEA 3M1VB 1EETB 4DR5J 3C14A 4XO0A 1RT6B 2CJBA 2ZHOA 4JI1F 2DXEA 2E5LF 1DBDA 1QY7A 3BGRA 3ELHA 1FDAA 3HSDA 4KAIA 4LF2A 5IQQA 5CD4H 3G6ES 1Y9OA 2JC0A 3FEXB 4B9SA 2E5HA 1IM4A 2VQFJ 4JI3F 1H98A 3TJ9A 4M5DA 3I0RA 1DQ8A 2GW8A 3C66A 1A0OB 3MUMP 1UA1A 3PRVA 4M5IA 5THWA 2ZFHA 1KLMA 4BC9A 5AE2A 5U47A 2ZEJA 2ALZA 2CPEA 1FK9A 2VPWB 1D9DA 3C14B 4LR8A 2VG6B 4EWTA 2JNJA 1JJCB 3I6PA 1UETA 2IM2A 2BACA 3CCTA 2J5AA 3PEJA 4KV8A 2RB7A 1VS3A 3ULHA 3PW4A 3ZFVA 2H54B 4LIWA 5AT1B 1QJHA 4I2PB 1IXKA 2XEXA 3CVKA 2CNLB 4OI1A 1I6JA 1IKVB 1M5PC 3M1VA 1Z2ZA 1S10A 2P5VA 4DR4F 4JI8F 1CJUA 3EMTA 4NLOA 5ETPA 3D1OA 3SSSA 4ZVPB 3M2RA 3KLVA 1LWXA 4QYZJ 1FXDA 2LVWA 3CJ3A 1RA6A 5AJ3J 2W9CB 4C8YA 1FFGB 3H4BA 4RNOA 4LBPA 3W5YA 2J0SD 1UEVA 2OPPA 5DGBA 3M8QA 1S1VB 1SXLA 3U1NA 4X4SA 4X65J 1OY6A 1V3SA 4KPCA 5CZVA 5HMYA 3CUNA 1XMQF 2V94A 1Y11A 2YNFB 4ERDA 1HPZA 2RIJA 1SH3A 3R97A 1RUSA 2HQGA 1X31C 4YR2A 4TU9A 2ZJRQ 5HROB 2G0CA 4K2JA 4Q44A 1PJ6A 1Y5NB 3KG4A 2CQPA 3QYYA 3J81j 2GHPA 1QTMA 3K17A 2GZOA 4ES2A 2DJWA 1N0UA 2D69A 4OV6A 4DR5F 1U1MA 3CE8A 4NLWA 5B7WA 1PAEX 3GSDA 5D0RA 4N47A 3C6UA 3NS5A 4WFBQ 3PR4A 3PKMA 3L9ZA 1DJ0A 5IS2A 1TUVA 3S8SA 1SJQA 3MMBB 4CLWA 1B0TA 2L9DA 2MMYA 4ZVFA 3M8QB 4DZDA 5JMNA 5T14A 2C2RA 2E5IA 4YB7A 4DL0C 4DG1B 2F40A 1HWJA 3D66A 3DM2A 2C3MA 4CYUB 1C1BB 4K5SA 2QLBB 4B3RF 2Y0SD 2MZTA 3TANA 5F0UA 3EUNA 4Y00A 2AJ4A 4P52A 2CQIA 4TY8A 4B3SF 3DRPB 3P5BP 3FZBA 1TKZA 4M8LA 4OYPA 3MPWA 3I56S 1K9MT 2GVDA 1C4CA 2AJFE 2LU2A 2WTFA 2WZ1A 4YN3B 2R42A 4RBTA 2HFVA 3RTVA 5B0EA 2QN6B 2R7OA 3DRSB 4DR6F 1RT3A 1S59A 3BV8A 3G6YA 2OH2A 4F3MA 2GAGC 4FS1A 3J7AN 1CLFA 2WB1D 1DQAA 1JLEB 1CQNA 4RNNA 1NJXA 4LVOP 1OYEA 2RE1A 1PC4A 2DRBA 5T41A 3UDCA 5HK4A 2VOPA 1KVKA 1X60A 2FLOA 1IBLF 4ELUA 3CJ4A 3CJKA 4M5DB 3VHQA 1RU1A 2KB2A 3BS9A 2UP1A 2QTWA 1X0PA 4IDKA 1HI0P 3QO9A 4CT9A 2GGPB 3JSYA 4X4NA 1J5EF 3H20A 2R4FA 4MIWA 4O3RA 1D09B 1EARA 2DGVA 3N4WA 4DQSA 1N34F 3W5ZA 4ZS6A 3HCXA 4DUYJ 3OR1A 4WU3A 1YGYA 1SKSA 3Q8QB 4F2SA 1A9NB 1RDRA 3ETMA 1TAQA 3DC2A 4XIUA 4FF3A 2ROPA 4RNFA 2HHTA 1OYDA 1WHWA 2LLZA 4NL5A 1S77D 1Q53A 5J1NA 4PKDB 1DRZA 2M8DB 2DRDA 1JLEA 4IDKB 3GIKA 1OS5A 1S49A 2OPRB 4CDIA 5B09A 2FLPA 4B9LA 3CCZA 1L3VA 2E5LJ 2I5JB 2QG9B 4USHA 3DRXA 2PMZD 4LF4F 3I4HX 2N3OA 4ETZA 1Q16B 2XMWA 5KOXA 4A8FA 3KXDA 3MOJB 2K1RB 1SH2A 2G13A 3LF0A 3U02A 2RF2B 2GX8A 1S1VA 1HBNA 5B0DA 2XZWA 2GA7A 1FKPA 1UAWA 3MD3A 1HQEA 1UW9A 3B54A 1YKWA 4DV1J 4BC7A 1T3NA 3HVWA 4BS2A 3R7BB 4PG8A 5SUHA 5DZ6A 3P45B 1U1PA 1N6QB 1M0SA 2IIHA 1C0TB 1FX2A 2D9OA 4DV5J 4DEZA 4LR9A 2CPHA 4MMOA 5GMDA 3AY0A 2VC0A 5DDQC 1RAOA 3OFEA 2R8KA 2X3DA 4ZVUB 1F3FA 1QLNA 2FGCA 3TX8A 1WKLA 1CJVA 2RDIA 3FK4A 2KH9A 3GYXB 1RTIB 3GG0A 4OX8A 5KFPA 3H42A 1VC5A 4M5MA 1TL5A 3ETOA 4YDXA 2RS2A 1Q8KA 2C2MB 4S0MA 1T0TV 1ZAVA 3J80U 4RNMA 2H5IB 2JHEA 2N7YA 5K14A 1WI8A 3MM9A 3KLEB 1VJWA 2VJVA 4EGLA 4A47A 4KT0C 2KM8B 5DQHA 2IDEA 1DZ5A 4W98A 5D4LA 2QLJB 4ID8A 3HVTB 4UUWA 2ZDPA 4JI0F 3FEZA 3TOQA 4F26A 4USVA 1N52B 3A8IA 1AFJA 4K5RA 3CJ2A 2O5DA 5L1JA 2ZKTA 3G8TA 5H9FJ 1HHQA 3TQ1A 5KT5A 1H72C 1RT2A 2OTJS 2OMOA 3MOZA 1CBKA 4WKRA 2B56A 2GJIA 3AAWB 3DYAA 1BD6A 3R2DJ 2ZOFA 1X5SA 3DOKA 5H9EK 2A6OA 4CO2A 1YJVA 1UA0A 4RW4A 1NDLA 1S9GB 2XSJB 2ZNZA 3DRSA 3MF5A 3HO1A 1G7CB 4ZIVA 2DGQA 3E3XA 3G71S 3W62A 2E1CA 4HVZA 2KG0A 1TQLA 2RD5C 5F8HA 3BDPA 1OQ3A 3EM1A 3BQ1A 1YQHA 3CDAA 4HL9A 1XK8A 4NA1A 3HZEA 4FN5A 4XK8C 5M2RA 4B9UA 4LT6A 1DHMA 3OFGA 4P74A 2FJXA 2UXBF 2BR0A 1RT4A 3NG8A 3TX0A 3DNCA 3CO0P 2PEBA 4O3NA 1E6YA 2VOOA 4LSNB 1RTJB 2BRLA 3TI0A 4NLVA 4B3TF 3FQLA 1UPPA 2IYIA 2QFJA 3UR0A 1ZOTA 2ZWPA 1X4HA 1NK8A 1ZETA 4C11A 1U0HA 1DY3A 1RAHB 3RR7A 2GS8A 5HQ8A 2PEHA 2XYHB 3SV4A 1PAUB 2HFSA 4TXSA 2DNMA 2R7VA 3BPDA 5HVFA 1BY9A 5HVHA 1EAYC 4RU9A 1NB2A 2QZ8A 5KFNA 1IWAA 1SL0A 4NLPA 2PMWA 4DV4J 4C2MA 2KHDA 3KHLA 4CQ1A 2VICA 4AD6A 1HNXF 4WZQA 1HI1A 3GIRA 2XULA 2VKRA 3AT1B 1NSAA 2UVUA 4YHHF 2IVMA 5KFFA 2XWXA 2CQ2A 3H2LA 3D2WA 5KFAA 4C3MA 4U7UD 3HHKA 2IMOA 3ILIA 2GMHA 4OFZA 1SC4B 2GIFA 5A8RA 1JLGB 2RU9A 3RU0A 4KFBA 4U7CA 2QA4S 1HBOA 3EXCX 2HGNA 1NJIT 2LXIA 2VPXB 2XMJA 4YB6A 4FF4A 1W2BR 3UCUP 2L3MA 3GCWP 2FVQA 1CJTB 1ELOA 3CD7A 3MPUB 2AWZA 2YXLA 1YRXA 3PFOA 4WK3A 1R8CA 3TZWA 1S6PB 4DCJB 5LJ5Y 2Y1IA 3D3CJ 1U8SA 2QT7A 3HHLD 4H54A 4XAKA 5HJYA 5D3GB 2DGXA 1PG5B 3MEDA 4DPUA 2BUNA 2FJBB 2RUSA 1H3DA 3ILJA 5IC6B 4ED3A 2U2FA 2V67A 3RG6A 4MYTA 1T9WA 3UVJB 2F4VJ 4Y6IA 1B0PA 4LBIA 4PABA 4NXNJ 3QFHA 3HJFA 2DH9A 4FVMA 2W2MP 1UJ5A 4ZCKA 2J0XA 3W63A 1VC6A 4XDDA 1T11A 1ZS6A 2KN4A 1TKXA 3W9JA 4DR4J 4RPFA 4IOCQ 2BBEA 1RT5B 3AD9C 2KXFA 2CZ9A 1H7XA 2MEWA 5KG0A 3D1QA 4PCQA 4F3QA 4YR3A 2IJNA 4WPAA 1FERA 1B64A 3MM5A 3W1YC 1DLOA 2FVSA 1MMLA 4F8RA 2DIVA 4A8YA 3NGUA 1D8YA 3T1YJ 4L74A 4Z7CA 2BVZA 1SQFA 1RTHA 1Y5LB 2G0JA 2LKZA 5A2QY 5HBMA 3VVTA 3LPEA 4IUFA 2W2QP 1OO0B 1JJHA 5LSRA 3THVA 2XZDB 2QX0A 4F4WA 4DL2A 4I2PA 3ILOA 2XCPA 5ETQA 2L9WA 2HVZA 3UD4P 2AHOB 4LFCF 4Y0FA 3JAMY 7FD1A 7FDRA 2FY1A 1YX2A 3GONA 1WG5A 1BE4A 1JLCA 1VLOA 2KRBA 3MPDA 3MZIA 4LR7A 3LAKA 4M1KA 4NWBA 2VV5A 3K5MA 1MW7A 4L76A 1D9FA 2DNQA 2QFIA 3H25A 2RNEA 1FXRA 1OIAA 4DUZF 1B4SA 1NAQA 1VQNS 1U47A 4UW2A 5C2GA 5A76A 3TZYA 4L73A 4RR5A 3OUYB 3TW0A 1NUEA 5GMKa 2RHSB 4IOBA 1QAJA 1FEEA 4EO6A 4OZLA 1HARA 1TU0B 2F8EX 2PSZA 1A6LA 2E1AA 1URNA 3ENVA 2YNFA 1FJCA 5KAKA 3KLFA 4MK8A 3RBZA 3EZ5A 4J9LA 3W8GA 5L9XA 2MZ1A 2B5JA 4B17A 3IM8A 4HTJA 2PI5A 5FDLB 4J9NA 4B3SJ 3DN9A 5EUHA 5HQMA 1B99A 1GMWD 3MECA 4WXOA 2MLZA 4QWEA 4RUAA 3C6TA 5JVGQ 4DR2J 4ED2A 1NHKL 2BXJA 3I31A 4KGMA 5AXLA 5EDWA 8ATCB 3MAHA 4KR0B 1Q7YT 2DR7A 1Y0HA 1VJQA 4WFZA 1NK5A 2KRRA 2B8QA 2NXNA 2GVZB 2KVIA 1WOPA 2DTJA 4Y34A 4QR2A 4L75A 2APOA 5F0WA 3M9NB 5GADI 4H4MB 1RHKB 1JLAA 2HSEB 5D0EA 2HNDA 4KHMA 4IR1A 1ZYQA 3M32B 1FJ7A 2WSFC 3HM9A 2ASLA 4CYUA 4J7CA 3R5AA 2HPUA 2D3OR 2YWWA 5DLGA 1E6VB 2UUWA 3MEGA 3LWMA 4LF9F 4JI1J 3GTYX 1FRHA 1RACB 2CWKA 2ZITA 3KJFB 4ILRA 2K7KA 1YSJA 5IM0A 1U45A 3B8HA 5F3ZA 2Z0GA 2VA2A 4F2RA 1Q4RA 1PCAA 1LWCA 4ZVSB 2OFGX 3FFIB 1LWFB 4ZHRA 3M4XA 3GJSB 3I32A 4CH0S 5AXNA 3TWZA 5KG1A 4BBYA 1Q95G 4OYOA 2F65A 3PCOB 5L1KA 2QSFA 3OSNA 1H0HB 4GKJJ 3CCMS 2HRUA 4P71A 1R0AA 2HZCA 2LDIA 4QIFA 2R8JA 4DL4A 1RAJA 4ZVQB 3PXGa 3CCQS 1SJFA 1E6VA 3MEGB 1I51B 2KJWA 4O3OA 2RQ4A 1F6TA 4MK7A 3FSIA 2MLXA 4DPWA 2GQQA 2XMMA 3KKFA 5B0GA 3T6JA 1TVRA 1FVSA 3MPVA 1I5OB 3A4TA 3IO1A 2ZD1B 2D3O1 2DR9A 1DLOB 2V9KA 5LJ3Y 2CJ9A 1ICEB 4B9VA 4Y2MA 2DCLA 2VPYB 4DN0A 2XS2A 2E7XA 1UWAA 3PRBA 4P2MA 1X4BA 1NDPA 3IBFB 3M6XA 2RMLA 2HBZB 3CO9A 4ECWA 2QSWA 3V6DB 3D6MB 1DTQA 1AB8A 1HBUB 1P1LA 2LDYA 2J9EA 4DV4F 1YK9A 3L4BC 3MR5A 1YHQS 1KLNA 2ZZMA 2P9EA 4QQBA 5ETKA 1WEZA 4KSEB 2ZH8A 4DDFA 1IKWB 1O51A 1JIHA 3SSRA 1TL7A 2PA8D 4UUXA 3WX8A 5EHHA 3TEGA 1HHTP 5EX0A 3TP2A 1Q7LB 3JYTA 1C1BA 3FGVA 3D6TB 2EFGA 2EG2A 2NPIA 1GMWA 2VZ9A 2KFYA 2ZHBA 3C3LA 2NQPA 1CG2A 3GSIA 3PYGA 3W65A 2ZJQQ 2V2ZA 1T05A 4TLRA 3W61A 4EYHB 1WDDA 5FJ4A 2Z57B 2K7JA 3MMBA 2BABA 2K1RA 2IHR1 2KI2A 3D67A 4O23A 1TVRB 2HNZA 1LXNA 1RJJA 4FZVA 5A6WA 3FJ2A 1GNKA 1LQ9A 5HO4A 1EZZB 3GG1A 3O2IA 3UQSA 4AE5A 2D1CA 2YNIB 4E8UA 1S4EA 4LUBA 4DV7J 1F5CA 1VRTB 5K5MA 4BHQA 2VASA 2YWFA 4J9UE 2MPUA 3HSGA 5C42A 2R2RA 2AJQA 1T9YA 3IC1A 5GAHI 3LP1A 3GFZA 1KQKA 4NRUA 2YKNB 4P73A 2R8GA 4W92B 3DFEA 5LOQA 3N5FA 1VIXA 1U02A 4IRKA 2FJAB 3CDBA 2FVPA 2FIUA 4U7UK 4MIBA 5KFUA 3VQTA 4TU7A 1PILA 1RAFB 1FDDA 1OY9A 3PG9A 4LFBJ 2OJ3A 4I2QB 1FD2A 5ETOA 1UJ6A 4N76A 3K8VA 3POTB 2N7CA 3T1HF 4K7QA 1YWXA 2DGUA 4XTTA 4ZN1A 1RWPB 2B9XA 3A1YG 3OW2R 1HNZJ 5C7PA 1VBKA 4ZVGA 3N6NA 5A0YA 3HPOA 4X84A 1MN7A 3CCJS 3I4PA 2RRAA 1S0VA 4UY85 3GR0A 3A8KA 4J9VA 4C8OA 2Y8YA 4MKAA 3OFHA 4LF6J 1RHJB 2LU1A 4USTA 5IOLA 2CNOB 2X1FA 3E01A 3BBBA 2M5YA 3GIJA 4USMA 3DDNA 1M5KC 3NBPA 1UPMB 4P2FA 3R8YA 2BQ3A 4RUBA 2BJ1A 3Q8YA 2I5JA 1O0PA 2YVSA 3FSYA 1HWLA 1BXNA 4DHVA 1HMVB 4ZHRB 2MGZA 4NLDA 4J9KA 2YKOA 4ZPVR 1D9AA 2MTLA 2V34A 2RF2A 2X3GA 3OTOF 4DL3A 2W8LA 4OZNA 2QLWA 1KONA 5D77A 3QRPA 1CJKA 1UW4A 3MCMA 4FYWB 3G4SS 1NDCA 2EBEA 1HW9A 2DITA 4JYAJ 1UZDA 3IAS9 5FLXU 1IVZA 1TL3B 4PWUA 5DO2A 1FKAF 1VR6A 2HRTA 4FBUA 5F8GA 4NMXA 2CPIA 4A4JA 1IBLJ 1WOOA 3ADAC 1ZZFA 4L3NA 4DQRA 3EXYA 2DR5A 2B43A 1YI2S 2B4VA 2HMIA 4CM2A 1RWOB 2MQPA 1WTBA 3UO0A 1S1UA 3IWLA 1RTDB 1U2RA 2LQBA 1VRQC 3V5RA 2MQNA 2QGFB 5D4NA 4OYWA 1BC6A 3V6DA 1ROFA 5GAGU 4G1PA 3K57A 4KKOA 4F04B 3CEDA 3JSMB 2VKZG 4DX7A 2AP6A 4OYBA 1B70B 2W2PP 1OSDA 3D0HE 1WSVA 3EX7B 4J9OA 2HK3A 1IKWA 1V6HA 5KFEA 1K47A 3G6XA 2YQ3A 1SKUB 4DX8H 3CJKB 1F9HA 1CJVB 3T5JA 4AFFA 4ZPWR 4HT7A 2CQ1A 2JLEA 4CO4A 3OPKA 1JQGA 1Q0NA 2XHWA 2JL9A 3DLGB 3CIMA 4UZBA 3HD2A 4P6QA 2E66A 1DTTB 4WBFA 4UF4A 1TUGB 4LRAA 3VVUA 4AT1B 5LT5A 1QUVA 2CQCA 5IWAJ 4K59A 3ZTRA 2QL7B 1G4CA 4KKOB 1N34J 3TUIC 4IO9Q 5K8NA 5B0BA 4NRTA 2YPYA 3GIIA 3BKFA 4B08A 4OI0A 1YZ7A 4TQSA 3N79A 1S7HA 3GV7B 3AA8A 4I6WA 4OHZA 4A8OA 3V6KA 4GO7X 3KJVB 4NLXA 4ZCMA 5J1PA 3JSMA 3C6UB 3QAUA 4K4YA 4RW4B 3VF0B 4PWWA 1XR7A 1N56A 4MK9A 3NNAA 1T7PA 4JI4F 3E2EA 1A7GE 2R7SA 2ERRA 3UR3C 2V50A 3RBDA 2C2EA 1S1WB 1EX8A 5CYMA 5BJRA 4WE1A 4R8UA 1FE4A 2PI4A 4QU6A 2HRYA 4DR6J 2BE9B 3KHRA 1HNZF 1V3ZA 1S6OA 2BKPA 1HFEL 4HR2A 2ZUAA 3PO5A 3C15B 4ELVA 4F50A 3H7HB 1VQ8S 3CGIA 2DNKA 1LEOA 4CNZA 1N5QA 2CRLA 5ADZA 1TK0A 1RTHB 1NZAA 1X4CA 4GO5X 3PW7A 2CJKA 1KQGB 1Z4UA 4PG6A 3G96A 3KMQA 5E2QA 1NRKA 1UVNA 4Q7AA 5KFYA 1GXLA 2YY3A 1XERA 3DRRB 4JUZA 4QW8A 3ZZ0A 4CLSA 4ES3A 3BREA 3M9MB 1RTIA 3I87A 1N6QA 4NXMF 3EVMA 4GRSA 5F8LA 4CTAB 1P9QC 4KBIA 2YX1A 2DPJA 1LK7A 3EDRB 3FNNA 3DOLA 2HS4A 4J9PA 2AYGA 3P49B 4NLRA 5C24B 1AZSA 2F9DA 2IM0A 1R8AA 2LA6A 3MM6B 2B4OA 4H4KC 1M1KT 5CZXA 3GWCA 1SV5A 3EPGA 3H5XA 5E41A 3V6HA 2MQQA 1VOMA 3R5GA 3CMES 1U25A 2XI2A 2KYZA 3DHXA 2IPOB 3RB4A 1JLBB 3MEDB 2HHXA 2QA1A 3P6YC 2Z58B 2E44A 2I1RA 1K0VA 2O67A 3HFKA 1LFWA 1S6QB 1RP5A 1YRTA 2HAFA 1FWLA 2FPHX 2Q1LA 2R2SA 4OX9J 3KNAA 3X3UA 4DSJA 3KLGA 2PT0A 3KG1A 3IWXA 4X65F 1JNZB 1SCJB 1RAIB 2ZUGA 4TQRA 2AX1A 5D3GA 2XZTB 3QSYB 1BQNB 1TMMA 2W01A 4R5PB 2AQ4A 2B7BB 3DYAB 4LSLA 3GV5B 2MKYA 3OBIA 2AW0A 3OTCA 4O3QA 4C0OC 5DQGA 1F9EB 4UOHA 4OZ3A 2BW7A 2HFOA 1FO1A 1REVA 2IAJB 2ZBQA 2ZWOA 4IO1A 3AXMA 1P1TA 2GVZA 2EWHA 2IJRA 2XLJA 3ENWA 3H5YA 1VQ5S 4CO5A 2AGQA 5G0RA 3UNGC 1VDHA 3KK1A 3EGZA 3DHWC 4ED4A 2Y0BB 5HBMB 2HNDB 3QRQA 2CPDA 4JI7J 3M32A 3KLGB 2NUUG 3D0GE 5K9FA 2CXEA 3LP2A 1ZPWX 1KWMA 2F4FA 2VG5A 1B3TA 4BDPA 4NXNF 3DLEA 2DHXA 2V68A 2WBMA 1NM2A 4FKXA 1LV5A 2POKA 4QWBA 3W5XA 4IOAQ 3QT7A 1C0TA 3MI7X 2DGTA 2IC3B 2Z8QA 3I9ZA 2KDOA 4ZPBA 3W7BA 5IQ6A 4RW6B 5DG7A 1GXUA 4ZP7A 3AOBA 2D9PA 5E3RA 4C11B 2G4BA 1WF2A 2IRYA 2M52A 4LRCA 2DCUB 5DQIA 2JEGA 2MKJA 3LANA 4DCPB 1VYAA 4NCGB 2XLKA 4I4BA 2R7RA 4XPEA 3US5A 2K3KA 2H9ZA 3OXLA 3L7UA 4P9SA 2GHWA 4ID5B 4BWMA 2UVVA 4QYZK 4M5LA 3KNGA 1IJFB 3HHDA 1HNVA 4C8LA 4DL5A 3CD6S 5J1EB 6AT1B 3UN2A 2W4PA 3FSXA 2HHVA 2OGUA 1B7FA 2VG6A 2KFNA 5HL7Q 1U7LA 2E29A 3CWJA 2JRSA 5ETRA 4AQYF 1W25A 5DLFA 2DHSA 4WYLA 1BHNA 1EQMA 5LXRA 1RT2B 5F3TA 2AEMA 2AIRB 4KFBB 1U1KA 4F4KA 2CJAA 2UV8G 4RW7A 3H8YA 3RBXA 3WIUA 3CCES 1KN6A 2GIRA 2DVIA 1RA7A 2PD1A 1Y3KA 3GFXA 5I4MA 1LW2A 3CDUA 2SXLA 3P4UB 3CC2S 1XMQJ 3MMCA 1JLFA 3GV8B 4W90B 2LA4A 2OP5A 2WVFA 3PHTA 3WQPA 3AQPA 2RU3A 3D5MA 3FBCA 3K2YA 1YBAA 2FDNA 4K2XA 1VQPS 3Q24A 4DQQA 2PGCA 3HHLA 4FPIA 3W64A 3IRXA 4RW8B 4RKUC 4USWA 3Q83A 3QSIA 2YH1A 4IH5A 1N4LA 1XNQF 4Y2CA 2RJZA 3A8JA 1SC6A 2AZ1A 3QLHB 3HLUA 2HS0A 1NPKA 3R2CJ 4P2SA 2ZH9A 1VRUA 1APSA 1SV5B 3QWUA 4MIAA 3Q8UA 4L3KA 4LSNA 3VZIA 2MJUA 4ICLA 1Q8LA 1XR6A 4IH6A 1HNXJ 4B9TA 2QL9B 1NJZA 1P6TA 2C22A 2V4JB 4KHPF 4KY3A 3J7A1 5KFKA 4OX7A 2K2PA 3QGPA 2MKKA 4NYPA 2VBWA 5J2NB 4BLGA 5HP1A 1SL1A 4TY9A 3KK2B 1R0AB 3IR7B 3L09A 1MSWD 1ZZNA 2E9TA 1CPZA 2FHOB 4NLQA 1KBRA 2BM0A 1PJ5A 1UWBB 5ETSA 2HWIA 3IR6B 5KG3A 5KFWA 3MDFA 1N32J 1XNRJ 2PC6A 4RNHA 1OPZA 3OL9A 2ZOMA 1N33J 2CIMA 4E0DA 1PBUA 1AROP 1NDKA 1WD6A 2MKSA 4I0WA 3IG1B 2MKIA 4DSFA 4ATNA 1NJWA 2ZD1A 5HAOA 4NXMJ 1FJGF 5LMUJ 1KC8T 1HR0J 1KLMB 3BSAA 2ZOGA 2C2KB 1V9OA 3N5BA 2ZH2A 4FBTA 3ZTPA 5LXYA 4KYZA 2HKEA 3LGMA 4NZ7A 2R2UA 5KFLA 4GKKJ 3CJ8A 1Q8BA 1SKWA 2MZJA 1EP4A 2Q43A 2WBRA 4L6V3 4DQPA 2DHHA 3CCLS 3PYEA 4USUA 2XS5A 3IG1A 4DSLA 4QWDA 3UD5A 4EFAC 2C28A 4X64J 3KWMA 2EW9A 1DTQB 2KXNB 3U1LA 4ZP6A 4OV1A 2QJ3A 1UWBA 3JQMA 3HHLC 3J80Y 3OXFA 3C16B 3C19A 3RB0A 1MMDA 3GZ7A 3LP0B 3MAQA 2PFDA 2W25A 3MECB 3NAIA 5RUBA 5CQGA 1BGXT 4IRDA 2XG8A 5LM7E 4A46A 3UI3A 3JTPA 2MLYA 1L3SA 3ITHB 4F25A 4JP8A 9ATCB 4X4PA 1BWVA 4ED7A 4KJIA 5D0HA 1O6XA 3KYLA 2UUAJ 4ZVOB 4F4XA 2B9YA 2FHKA 4YUDA 2YQ1A 1QE1B 3CF5Q 1NHUA 2MHEA 4HLBA 2DXFA 3ZC4A 3ZZPA 4C48A 3A13A 4RUHA 5BR8J 4DFMA 1RWXB 4YMEA 3RAXA 4W4MA 2BJDA 2MSTA 1Y7PA 3VV2B 2BOPA 2YH0A 3BH7B 3Q8SB 3GIMA 2WVEA 4I7FA 4F67A 4A8WA 3UN5A 2KG1A 1ZAXA 1WUUA 3C16A 3GYGA 3DU6A 1EP4B 2ILZA 2CYYA 3ET6B 1V5IB 2AEFA 3LP0A 4RWXA 1RAAB 1HBMA 3QGGA 3G8SA 4DUYF 3PZPA 3RZAA 4WK1A 1IR1A 2J9DE 2H65B 4NEYA 3I5AA 1LWEA 2AD9A 2OPRA 3BN7A 1F5AA 3EZUA 3QATA 3BGLA 2V8VA 4FVCA 1NHVA 2ACYA 4H4KA 2QE5A 2AT1B 4P10A 4LF8F 4LMZA 1RHRB 5L39A 3V6JA 2H4YB 3FKBA 4AUKA 1F2HA 1FNOA 2I0XA 1F1BB 5E0OA 4LF4J 1UVJA 2VBYA 3K0JA 3PACA 1WI6A 2J6UA 4KB7A 3M9OB 1WKKA 1UL3A 4Y65A 4LIRA 1K1QA 4DFKA 1HYSA 1EB0A 4OZ0A 3SSQA 3MEEA 1JLQB 3TJ8A 1NJYA 2UXBJ 4IH7A 2O66A 4PUOA 2HG4A 1XTZA 2HFNA 1GK8A 1LWEB 1HD0A 5J2PA 2HLUA 3MR6A 5KG7A 3CJRA 2AZ3A 3M8ZA 3B82A 3DRYA 3BO4A 3VGTA 2L48A 4CO0A 1FD8A 2V4JA 1S12A 4HYKA 2V0NA 4DLEA 3PIOQ 3PX4A 1N5VA 3IWNC 2GQ2A 1CC8A 2QLFB 3ZTQA 2VPZB 2M9KA 2N4CA 4AXIA 4U67Q 5J2NA 5HP1B 2IY5B 2AEJA 4YFUA 5KT6A 2YQ0A 4RBVA 1WC3A 2CQGA 3QZ7A 3ZXWA 2HBQB 1H2TZ 2I38A 2J7KA 4LRDA 1RT5A 2W9CA 2FLNA 2F5GA 5DRKA 2GHVC 2HQIA 1FF2A 5EWFA 3PX6A 3W2VB 3MM5B 5GAEI 1TK5A 4FPRA 3OFFA 3QQCD 2NYHA 1DURA 4WP3A 1VQKS 3LQVA 3PFEA 4LF6F 2YWKA 1VQ9S 2C2ZB 3NCRA 1OJ4A 1KTVA 2YNIA 2AJ1A 3HK2A 3NOCA 2DY1A 1XC9A 2R7WA 4TN2A 1MMNA 3MR2A 2P2CB 3DOKB 4YY3J 3LP1B 3CDEA 2EFPA 3CJ5A 4ECYA 2HHHF 2Y8WA 2PA3A 3D0IE 3R27A 1WC0A 4C8ZA 3DLKB 1U4BA 2F4VF 4NEZA 2PN6A 1GTEA 3NWRA 4DG1A 3TO8A 1RSCA 4PG4A 2VG7B 4ECQA 2IDLA 1VQSA 4Q0BB 3B78A 3ISNC 5KFDA 4F0KA 4B3RJ 1NLKL 4ELTA 2CG8A 3R6LB 3FMWA 4UOGA 1X4GA 3PKYA 2Y1LB 1ZA1B 3IMQJ 4QPTA 1SBRA 2RSQA 3PX0A 4JV5J 2FC8A 1U26A 5AJ3F 3W2VA 4WFAQ 1YVFA 1WDTA 4RLEA 4U96A 3VAFA 4NI2A 1PGZA 2Z2ZA 1QAXA 2MKHA 4HI1A 4AL6A 2CZ4A 3V81A 1QE1A 1JLBA 1UTAA 4C0BA 4LFAJ 4DUZJ 1FNXH 1AUDA 3AHPA 1HR0F 3LGHA 3POTA 1SC3B 1KQFB 4DL7A 4B9NA 4OHYA 4PQAA 1H2UX 4EYIB 4OYMA 4QW9A 5A8WB 2HHSA 5FDLA 4QR1A 1YJRA 1R8PA 4F4ZA 4C0HA 2BE7D 4WJBA 4Y2AA 2MGZB 2Q66A 2W4CA 4ZLJA 2XGPA 2UUTA 1U8WA 2DH7A 1N33F 1HBMB 1UVMA 2B9EA 2W7AA 3AJDA 2LXFA 4TNOA 4X62F 4B3MJ 1VQ6S 1U2CA 1WC4A 2DB1A 1OY8A 3MTJA 2Q6BA 3QGHA 2I9SA 4PQUB 1FT8A 3CPWR 1BWEA 2J7WA 2WAQD 4KC5A 3UCZP 3SQGB 4DV2F 4JV2A 1GEHA 4ECSA 1S1TB 1VIOA 2WSEC 3T1YF 3HFZB 3HZGA 2DEJA 3MM8B 1WWHA 3NNHA 3BPSP 3IBCB 2W9AA 4C6AA 4OYZA 3S7RA 1FX4A 1IKYA 1HA1A 3K5OA 2V8HA 5T7LA 4OYXA 1J2VA 3MEEB 2VG5B 3D68A 3JTOA 2JJ4D 3PW5A 5IT9U 4C3LA 5KG5A 2Z2LA 4L72B 4D3HA 3H90A 3G6VA 2K06A 4Y2IA 5L1IA 2NXEA 2VBXA 3L3CA 2WHOA 1U1LA 4MFBB 5KFOA 3FFIA 3K5NA 3T3FA 3PVXA 3GB0A 1S1UB 2HQ3A 1IJEB 1RTDA 1Y5IB 1G6BA 2HGLA 3OTDA 4TYAA 1SI9A 2E5GA 4Z37A 4FXWA 2VJUA 1CEZA 1SUQA 3NY0A 2CDQA 4X4RA 3NCQA 4K4WA 2ZC3A 1VGYA 1IKYB 4ZJLA 4QPXA 3G9CA 4PQUA 2ZH5A 4UQTA 3R5JB 4J37A 1IKXA 5DDOC 3DXBA 2YBVA 4C97A 3QNWB 1C4AA 2DNGA 1HNVB 1S1TA 3PO4A 5A2QU 1NK6A 2FYXA 1Y3JA 2CQ0A 2KT2A 3HI9A 2XHCA 4V19X 1S6QA 5MAOA 2Q6CA 1FKPB 1X8DA 3OD2A 3OHAA 1PSDA 3SV3A 2XTJP 3PJ9A 3ZO7A 1RT3B 2HQFA 5DDRC 2MY7A 3NRBA 2VFRA 1T8EA 2A18A 2J7UA 2ZHAA 1N8RT 1RT1A 2BANA 3QJJA 3B4DA 2VIHA 3V4IA 1J5OA 4E98A 1X9SA 3EWGA 3KUEA 3A3NB 4JOUA 4F4YA 3A3PB 1L3TA 3T6BA 2OUGA 5IXUA 5GMEA 4Y3CA 3KUHA 3RGIA 3AD7C 3TNVA 4ZPAA 4CLKA 5HQLA 2FVRA 3DGPA 5HI7A 4DR3F 4WE1B 4R8UB 1WELA 3BJYA 1IBMF 2VA3A 1RXOB 2VG7A 1YRUA 3A3OB 2LQJA 3AB4B 3OXGA 4PEOA 3CC7S 2J0QD 1HQUA 2KZZA 4EO8A 3G8QA 3Q23A 2W4DA 1RWUA 3BGUA 1SH0A 3V2UC 4K4SA 2GAHC 3FVYA 1S1WA 5CYMB 3UDVA 3OLBA 1RYSA 3OVSA 1NSKL 2M0GB 2CA9A 2VFTA 2KM8C 1S6PA 3H59A 1S97A 2V8DA 2HIYA 1OPIA 2YKAA 1U1QA 1ITPA 2KHCA 2MHNA 3DGPB 3TAPA 4EEYA 1SL2A 2H51B 4NMLA 1L5UA 2LXUA 1SQGA 1Y4ZB 3IAM9 1FXLA 1RADB 2HW3A 1HQUB 1FE0A 2QEXS 1L3KA 2KU7A 2OFHX 3AB2B 1U1OA 2CQHA 1R3NA 1XMBA 2D3ZA 4X66F 4MKVA 3MURP 1N48A 4F3OA 2BA9A 2KO1A 2QMWA 4CT8A 1X9WA 1WHVA 2A6MA 4H4MA 4KO0B 4QZVB 3VGUA 1N5YB 2LCWA 2B9WA 1N5SA 1HQEB 2DHGA 5I42B 3T9ZA 1YZ6A 4Y2KA 2QA4G 5CCLA 1UVIA 4I2QA 3DLGA 4JI3J 1X7VA 2KJVA 4JV1A 4FDFA 1YJWS 4QU7A 1REGX 4DPYA 1G2EA 2YWEA 2NREA 2VUGA 3HX9A 1S5ZA 2FUG9 2WVDA 3FBFA 2J76E 4GVBB 5ETMA 5AXMA 5LSOA 4A8QA 2YKPA 1VBYA 3B6BA 3OT9A 5HLFB 1NU4A 4H4OB 3UFCX 4X62J 2X1BA 4DSIA 3DMJA 1VHIA 2YWGA 1JXLA 3P96A 3GLJA 2CQBA 4Q2MA 1S76D 4KO0A 2DNZA 2WOMA 3IBWA 4OX6A 5D15A 5K8MA 4PAAA 1YJNS 3WC2A 2UUBJ 1JLCB 1FI4A 2UVRA 2NZCA 4ANEA 2ILYA 2FJWA 4IQXA 2KFZA 3H2VE 1KVJA 1EIYB 1XNQJ 3ONQA 4QJVA 3BBCA 4IKAA 4EK2A 3MR7A 7AT1B 2OELA 4GMKA 4LF8J 2B4PA 2HNYA 2NSBA 3O5TB 2L41A 5KT3A 2ASJA 3EZOA 5HVGA 5D78A 3KJQB 1MG7A 3Q86A 3P5TL 4DV3F 3D3BJ 5DZ7A 2XM3A 2HHHJ 4PYDA 3CCWA 3TUZC 2CG4A 3BEGB 3M8PB 3JTNA 2RQCA 3BSNA 2FJDB 4IFVB 1NK9A 4FF1A 5E5NA 2RKIB 5I3UA 1EHWA 5JXSA 3PDNA 1QM9A 3NLCA 3DDIA 4I68A 4JYAF 4CO1A 5HLFA 1VQ7S 4DMZA 2F8HA 4O3PA 4JI6J 1VMBA 2GJ2A 3MR3A 5EWGA 1ZM2A 4A8XA 3KLHB 1MWQA 1RB0A 3HKZD 4CTAA 1TR0A 2A2CA 3UE2A 5HN0A 4GC6A 4K4VA 2LQ8A 2RH3A 2UV8A 1N5TA 3W66A 2AX0A 2KT5A 2MYFA 3SEOA 1AZSB 1QVGR 3L7PA 2JLFA 1HL6A 2A3JA 3CT9A 5CD4A 1RGVA 1CVJA 1JLAB 1VK3A 1O5JA 4ED5A 1WKJA 3NS7B 2WCXA 2XY7A 2Y1JA 1LKZA 2ZNYA 4FF2A 3W3SA 3DI6B 4IG0A 3RRKA 1RCOB 3GPAA 2D3UA 2CDRB 1AUSL 2PFFB 3R5DA 4NLGA 2L9NA 5C2CA 2MJNA 2WRMA 5AE1A 2BE2B 4FKYA 3CXCR 2HQCA 1S1XB 3H2UB 5CYJA 3KHHA 2DPIA 2Q3PA 2B7CB 2HEKA 2MZQA 2E1MC 3NS6A 3I82A 4UY8T 3D6HB 1D1UA 2IRXA 3N6MA 2XS7A 1FA0A 2BJEA 3AOCA 5IV4A 1F60B 2H1YA 5G4DA 3N6LA 3KOAA 4DR7J 2QV6A 2ZM6F 3U1MA 3R5BA 4N41A 1R89A 1XQIA 3FQKA 2HHWA 3KLIA 2XBPA 2QLXA 4ECVA 5ITHA 5M2PA 2ZH3A 4I69A 2YKMB 8RUCA 5F9NA 1FK9B 2CQ3A 1UFLA 1CJTA 2CNNB 1S7IA 1Q5VA 3FMBA 2HZVA 1F2GA 4QIVA 3RB3A 1UKUA 3SDEB 4CH1A 5A8RB 2LMIA 3TUPA 2CADA 1HD1A 4YDDB 3TA2A 2R7QA 4J91A 1GTHA 4E2FB 2V6AA 3TVZA 4EMDA 3VAKA 3DLHA 2LYVA 4I67A 1HI8A 1T95A 2WB4A 3DLBA 2G1HA 4WFXA 4CP5A 2N82B 4PPZA 1J5EJ 2DR8A 3DLJA 4WTYA 1MROB 3C2PA 4WIIA 4XPCA 4H4OA 4WZMA 4QOTA 4QWCA 1RTZA 5KG2A 2W2OP 1RLCL 1JB0C 3I5BA 3NGSA 4DU8A 5DDPC 4Q43A 2X1AA 2GMJA 1TP7A 5CXTA 5GVQA 2LEPA 4OYIA 3D9BA 5BR8F 4P72A 4FYYB 4B3OB 2BJ3A 2OKQA 2RQKA 3MM6A 1TMJA 3Q2SC 3P8BB 4ZVEA 5GAHU 1Q8IA 3GJTB 4UZCA 5J2QA 3IS9B 4FNIA 4PUOB 4M5GA 2ZH1A 1T94A 3LA0A 2AV5A 1NH8A 2C3YA 3AJ2A 3DGVA 3WX4A 2R8HA 4NI2B 2EKYA 2DNYA 1FCAA 1NK0A 5KT2A 4NLUA 3BBFA 4YP3A 3ZZZA 2VODA 1PKUA 3BDEA 2G0IA 2F3JA 4Z2XA 4G3IA 5I3UB 2XMAA 3BGRB 1IUJA 1S72S 1U6ZA 3IA0A 3MAAB 4UOFA 1LWFA 2B0GA 2ATCB 2BRKA 2CKWA 2UXDF 4LFBF 2M2BA 3GILA 3GQCA 1IWGA 1Q81T 3HHLB 2A2DA 2XI3A 4KQZA 4DSEA 3CULA 4OI2A 4OHVA 1JJ2R 3LAMA 2V9WA 1U09A 3HVRA 1HHSA 2GJFA 2DBBA 2CNKB 3LUYA 4HACA 4C98A 2IM1A 3BSCA 3I5CA 3P3DA 4URQU 4NOHA 4EBCA 1YITS 4CLTA 5IV3A 1CULB 3GFYA 1RCXB 4U8VA 2HURA 2M7SA 2C2OB 3KK3A 1S9EA 1JJ4A 1TAUA 1NKEA 4OI4A 3NGKA 4LF5J 1T3OA 3MM8A 4EUVA 1IBKF 3RBEA 4EI2A 2YKQA 3PNIA 2ALYB 2IM3A 4KTQA 1P9YA 3IFEA 3TVKA 2ZC4A 1CQMA 1T03A 4DI6A 1MNEA 1WNEA 4K4UA 4N56A 2KTQA 4U6PA 2MQ8A 3MMAB 2FHMA 1KKHA 2HVEA 4DXLA 2CPZA 3JYTB 4TU8A 4RW6A 3NBPB 2RHQB 3SCIE 1PYOB 1P8GA 3NEKA 4OIXA 2AF6A 1X4EA 2AMCB 4RX6A 3FRYA 3TZXA 2ADCA 3BQ0A 1DFDA 4V19J 1FESA 2CPYA 2LFVA 2OPPB 3M30B 2KL8A 2VDIA 4FNHA 5E3CA 2ZBPA 3SCLE 1KVIA 2XMVA 2HZAA 3KDNA 3JXOA 5JVHQ 2KXHA 3FC9A 4YOEA 4USJC 4FYXB 2YX4A 3M2RB 3NGRA 1PIEA 1F0XA 1NCLA 4DFJA 4MKYA 2JC1A 1IKXB 4JV5F 1QTNB 1NEEA 3LALA 3C46A 1KHWA 1R27B 3PR5B 1RWKB 1WORA 3EJMA 4DV3J 2KYXA 2Y1RI 3O1LA 4C7QA 2HMIB 1FTCA 1N88A 3TYTA 4OHXA 5HROA 1PC5A 3O3LA 1VCTA 1XR5A 2F9JA 3J7ZT 1FFSB 2BOAA 5J2MA 1YIJS 1HLWA 2WVBA 4Q5VA 2MKCA 5E7OB 2ROEA 2MZRA 5IFMA 1XIQA 4OQJA 1TUWA 1WC1A 2DGWA 5IM0B 4IFYB 1WHXA 4O0IA 1TKTA 1OSCA 2JWNA 4NASA 3W9HA 1N54B 1NBEB 1H74A 3K8WA 3PTWA 3WC0A 4X4OA 4ED1A 4JI4J 1FDBA 3C8YA 3NP5A 4ZIWA 4D3GA 1SJ4P 4RW9A 1PJ7A 3J7YI 2DNRA 3TA0A 1R31A 1JX4A 2ACMA 2CVIA 4NLYA 2EFQA 1RLDA 4A48A 2E7VA 5A0YB 3OTOJ 2AGOA 1QAIA 3BN4A 3I9V9 5KFVA 2HHQA 3Q22A 3Q8RB 2HWTA 5T7LB 4ZVRB 2H5JB 2NZ4A 1Q5YA 3JAMU 2EK1A 5IZHA 4F0HA 3T9NA 3RRHA 1I1GA 2DIUA 4DOZA 4RU2A 3TR5A 3Q2TC 1XBWA 4LRFA 1RABB 1PYSB 1Q82T 3T1AA 2YNHA 3ET6A 3W8PA 1RWMB 2IA6A 1RWNB 2AYEA 3VGVA 1K44A 5KFIA 2VFSA 4PG5A 5ETLA 4I6AA 2XYPB 2AYBA 5GAEU 3BKUA 4JI7F 2YTCA 2M8HA 3LH2S 3T1HJ 2GMLA 2XO6A 3NGDA 2YNGA 3DXSX 1YJ9S 4JI5F 4MJKA 1X5PA 2ROGA 4O4GB 4DUTA 4DR2F 2OD6A 4CO3A 1LOUA 3ZZUA 1T9TA 1S4FA 4U8YA 2QC3A 1TELA 3CW2C 1JK9B 5KFRA 2OLWA 3G2XA 1VQOS 2MDAA 1YBUA 1NK4A 1N5YA 4NZ6A 2GCFA 3QT8A 4CM0A 3M6UA 1R0BG 3V81B 4WTOB 4ZCLA 1WJ9A 3GR1A 2NCKL 1S9EB 2M70A 4ZDNA 1MLAA 3R6GB 2ZDOA 3HMJG 2HWHA 5J2PB 3QT5A 5MLCV 2IMWP 2KZMA 1WG1A 1FRXA 5I3QA 5C42B 3MCOA 3ZZTA 5GADU 5LSLA 3G87A 3I55S 4J9QA 1VQ4S 2F8MA 2UUCF 3QRRA 4ITSA 3B4MA 5IC4B 2VC1A 2XYGB 3HHNB 2QA2A 1QSLA 3H40A 2C42A 1M5OC 3JB9k 2U1AA 3F44A 5B0CA 4FXDA 2NLWA 1Q78A 2VF3A 1S48A 1RT1B 1RBAA 2OEKA 4YS2A 2MB0B 1M5VC 4CCHA 4QBUA 4ID5A 2PIIA 2QMXA 1DTTA 3G86A 4USIA 5KOWA 2W24A 4O44B 2ADBA 5DJBA 2JFKA 4C3KA 1E6YB 1GQEA 4ZITA 5DM6Q 1RTJA 2BQUA 1VI7A 2QRRA 4M5JA 1GMVA 4NE9C 2W9BB 3FCWA 3ISZA 5E3AA 3SXLA 4C8MA 5A8KA 3CJQA 3HHEA 3EPIA 2E7WA 2F63A 3BKTA 5D0GA 3SQGA 2IVYA 3AODA 3GJQB 3CMAS 2WSCC 2V2QA 3IGVA 4EBDA 3G82B 4IG3A 5D4OA 4KGXB 4N5SA 3QZ8A 1RHQB 4ZA1A 4PXBA 3TARA 2XSFA 2RKIA 4ZK7M 2UZAA 4DR1F 2AJ0A 3KLEA 4EZ9A 3PRDA 2UXDJ 3MXHP 1V5VA 4DPXA 3EICA 2AKWB 2LP4A 2CJYB 3CC4S 4DS5A 3IRXB 4RW8A 3HULA 5I42A 1T9VA 3EGVA 3BGFA 3FUYA 1P27B 5CA5A 1NPPA 3UW1A 2DT9A 4X64F 3K5PA 1REVB 2IAJA 5KFGA 1JLGA 2XLIA 3T5HA 4Q8FA 4JI5J 1KDNA 3M6WA 4LF7J 1ZH5A 4GC7A 1RK8A 2EC2A 3NXZA 4J9MA 1RT7B 1U1NA 3K89A 3AXKA 3O8WA 3PV8A 3CCUS 1CC7A 2P9CA 1QD1A 1H2VZ 2ASYA 4MAKA 1TV6B 5K8OA 3CCRS 1ZM3A 3AJ1A 5K14B 1NXIA 2O01C 2HVDA 1BQXA 4ZJQA 3G82A 4IG3B 1M5SA 3LPYA 3HVTA 3VCDA 4GVBA 1FJGJ 1MWYA 4HDHA 4F4AA 2Z2MA 1AXQA 1FRKA 2BYCA 2EG1A 4I56A 1Y10A 4ZP9A 1KHVA 4JI2F 5KFXA 2YPZA 2NS1B 3OL6A 1S0MA 4OZ1A 3BZQA 2HAIA 4LRBA 4RZRA 2BANB 5AE3A 4DV6F 4WF9Q 2RQMA 4WFYA 2ABYA 3VAHA 2UVWA 1KS2A 1XEZA 3DOLB 1EKRA 2JVRA 2EFOA 1S9GA 2XSJA 3M6VA 4GVLA 2L08A 1R6VA 2R3VA 1RKIA 1JXVA 2EFNA 3BH6B 3PHEA 2R9LA 1UEKA 4ZOSA 4PWDA 3QMQA 4QWAA 4MKBA 4PR6A 1TV6A 3S01A 1RAGB 3MM7B 8AT1B 1FFWB 1W2IA 1R43A 1W7WA 4NLSA 2XC9A 3BB5A 1GMUA 3DCAA 3BQ2A 4R5PA 3BR9A 3GU0A 3N0VA 4YEAA 4PYAA 1TKZB 3SMZA 3KTQA 2RDJA 1YJ7A 4PZVA 2JOQA 5AXKA 3VWSA 3QFWA 9RUBA 3PW0A 1MROA 3UCGA 3JS9A 3EGNA 1C2PA 4NA2A 3D4JA 4ZMMA 1AYEA 1K1SA 1NZ8A 3BF4A 3QIDA 5DG9A 3NMRA 2EBGA 3HFVA 4A8SA 3ENAA 1D3WA 3MUTP 1XN9A 1I3OB 2XWYA 4ZN3A 2VDHA 4KGVB 2LQ9A 2G2OA 5C25A 3RUBL 3OUYA 2JEJA 3RW6A 2P9GA 4ZPCA 3IR5B 1FRIA 2VH7A 3R1HA 4NYZA 5KFZA 1HBOB 1QDUB 4CLFA 4Y28C 1X0FA 2HLTA 2FHJA 4G65A 3WDOA 1XMOJ 3CCSS 2E5JA 1YDLA 1TL1A 4CI0B 4ILLA 1HKAA 1SC1B 2D41A 4OLOA 1IBCB 5KFJA 2FGOA 1KTQA 3MM7A 4NA3A 1QAYA 5M2UA 1HNWJ 2FZGB 3FEYB 3QAEA 3D6FB 3FZ2A 5F8MA 3M7VA 5LMNJ 1IBKJ 2OMLA 2VU5A 3L95X 2BE2A 3IP0A 4NCGA 5LMNF 1M1HA 3T5LA 1S9FA 1SIWB 2OIHA 5A8WA 3V4IB 3HT3A 1OWXA 2FVCA 4URGA 5EGYA 3HDSA 4M5NA 4M95A 2WW4A 2D74B 3AA9A 1FJEB 4LF5F 4DX6A 3ISND 2C2DA 3NL0A 3CMQA 4DR7F 2OI2A 4M94A 3T41A 3D54A 4RJVA 4OJHA 1EKSA 2EKNA 2W8KA 2FC9A 2RVJA 1TFWA 2BKOA 2J6SA 1U24A 2DD8S 1MU2A 5H9EJ 2VBZA 4DX5A 1VK8A 2N4DA 1AT1B 2DKOB 1N0VC 5SZTA 1UVKA 5GAGI 4OL8A 3PJXA 1QSSA 4I1TA 2BW2A 1MN9A 1TKXB 2BX6A 3SCJE 4B02A 1B0VA 1EJ7L 2W1BA 3KJNB 3M2UB 2X7IA 3L7OA 4TVAB 4F0MA 2DK2A 3EGWB 4G1QA 4QYRA 1GT8A 2V2VA 4WWSA 4LBHA 3CTRA 1IR0A 4J5OA 4YY3F 3M8SA 2GNKA 1G3OA 2QYCA 2XB2D 4K8RA 1LW0B 2FB0A 5LMUF 1HWUA 1H7WA 2GO9A 4I64A 2HQDA 3D7SB 4WP8A 4O3SA 1EETA 2BJ9A 2M88A 4PXCA 1JWWA 1RQ0A 2XMUA 3A8EA 4MFBA 2O3DA 2RILA 1ZM4A 1JMTA 4UT4A 2Z30B 3HT0A 1U2FA 3AFGA 5L8RC 2ZBRA 6FDRA 3IN5A 2IJFA 2VQEF 4DF4A 2LQ5A 2J6TA 1T9XA 1UCNA 3EDQB 2WVCA 3IS9A 3FRZA 4FP9A 3I0RB 5L1LA 4G1QB 5HANA 4OI3A 3ZZOA 3PIPQ 4ER8A 1FRJA 4HDGA 2ZVSA 3M2VA 2HBRB 1LW0A 4NYOA 1H6KX 1AA1B 1G1XA 1BQMA 2NPFA 5J2QB 2IC3A 4ZKAA 3W9IA 2OTLS 3KK2A 5E3PA 2CWXA 1IN0A 4QIEA 3SCKE 3HF5A 3J81U 3Q8PB 4V1Ak 4HEA9 3VAIA 3VAJA 3CSKA 2QO3A 3UDEA 2ZKUA 1FNMA 3ENQA 3ZTOA 2EPIA 3TEHB 3MFIA 1S57A 1PBAA 3BO2A 5L46A 3OR2B 4QCLA 2CPXA 4UTGA 2YX7A 3CDWA 1D0EA 4ENOA 3SI8A 1VFJA 3T19A 4WYWA 1CS4A 1YJUA 4P7VA 2Z56B 3JSBA 4DJBA 2V5HG 2DHAA 2DR6A 1RAEB 1LFPA 3FCHA 3GE9A 3HSJA 2H48B 3OTBA 4KH0B 4NPOA 4NX9A 4LF7F 2HIQA 3SDEA 1HNIB 4ZCIA 4QIGA 4DV6J 3TRGA 4ED8A 2R7TA 3M8PA 4LJMA 2BV3A 3WHIA 1IBMJ 4G6VB 1LW2B 2GO8A 1RT6A 2GFFA 4DBQA 5IT0A 2EEYA 2AGPA 3RAMA 3UD3P 3OR1B 1RWWB 4JI2J 1WHYA 1VLYA 4FYDA 1LWCB 4UQGA 4FXVA 3KFWX 2EC0A 2CAJA 2G9OA 4M5KA 4RUCA 3LW5C 5IT4A 2V8GA 3OJUA 2V69A 4WXWA 2BEFA 1FWPA 3O6QA 3WZ0A 3ZNJ1 1HNIA 4IRCA 1XMOF 4Q45A 3NWGA 4DFPA 3R7NB 2ZE2B 3SFGA 2I2YA 2H4WB 3PM9A 4LREA 1KFDA 4EU0A 1M90T 1BMQB 1KFSA 1Z2LA 5KG6A 2RAQA 5KFTA 3BM7A 2CJQA 4HT5A 5KG4A 4A8KA 2AU0A 1TL4A 1Y00A 3F0NA 3CIZA 5CABA 4FS2A 3DI6A 4IG0B 3SQOP 5HMWA 5B0FA 2GIQA 4LQ9A 4C9DA 2DNLA 3D1HA 3QLHA 3UNYA 4ANCA 1UEUA 1KQSR 3MPYA 2JLGA 5ETVA 3E01B 3R3TA 4OI6A 4X66J 4ICLB 1X5OA 4PXDA 2IFXA 2HFUA 3MCSA 2I8EA 4CLYA 3J7YU 1FWKA 3K5LA 1K8AT 1LNQA 3E51A 4B3TJ 1KEKA 3N9UC 1C0UB 2ZBCA 4LVNP 3V4MA 4DR1J 4ZP8A 1U49A 1F5BA 4HH0A 3NAHA 5K8PA 4ECUA 4K50A 4OJ1A 4CH7A 3ILLA 3C6TB 1SB6A 2A1BA 1C1CA 1SIZA 5HSPA 4Q8EA 1CJUB 1YG0A 4OZ5A 2R2TA 2NXJA 2ZH7A 2ZJPQ 2DO0A 2FY8A 2JZ5A 4HHHA 2ZM6J 3MAAA 5KFSA 3S6EA 2FLLA 2XMTA 1JLQA 1R7IA 1OQ6A 4WIQA 5KT4A 5D4PA 1KRPA 4DV0J 1VC0A 1H73A 2ZZTA 3Q89A 1FTRA 1RYRA 1K73T 1RZMA 4N7TA 3UN3A 3KDOA 1R0CB 3MMJA 1SVDA 1U48A 2OPSB 4AYBD 4DR3J 5BYRA 1WTFA 1WEXA 4O4RA 4ZLNA 4DPOA 3PJWA 3PEHA 4YB1P 1KOHA 3KHGA 3CD5A 3QBCA 1ACMB 1UP1A 1PO6A 1J5OB 1SQEA 3EVOA 1M1GA 4HHJA 2OD4A 2OSQA 2E1RA 3IXQA 1KR4A 2IBKA 2AYMA 3K7RA 4CRJA 2OEJA 4OX9F 1GAOA 4M5HA 3M8WA 2WONB 2BZ2A 3TAMA 2A0FB 5DM7Q 1Q79A 3MMAA 2DNHA 3WIVA 1N36F 1X5TA 2DGSA 1FRLA 3N01A 1NH7A 2CUYA 2QIFA 3LOUA 4MT1A 2HVHA 3NGTA 4LSZB 1QVFR 2V8PA 4P75A 1RT4B 3W60A 1BUXA 4QR0A 5JUMA 4X4QA 3OL7A 3TA1A 4X4TA 3GFHA 4IR9A 3ITHA 4I7FB 4G1IA 2FZCB 3PW2A 2FHJD 2ATLA 2LEAA 1WG4A 2G2ZA 3D28A 4FYVB 1S79A 1RBLA 2DNOA 1X4DA 2VHGA 1X9MA 1ULRA 2VONA 2PO4A 3RYLA 3ZZYA 1NB7A 4B9MA 1MWZA 4HHUA 2A10A 4KV8B 2MQMA 2GVDB 4R0EA 3UWTA 3HSZA 1M5HA 1PYTA 3DOMB 4K4TA 5J2MB 4RW9B 2DNPA 3LTOA 5K20B 4J9RA 4ECRA 4U9RA 4DSKA 2WONA 3TAMB 3R1LA 2BDPA 1WSRA 2HHPA 4IFYA 2BM1A 3AOAA 2VFVA 3DU5A 5KTQA 1CULA 2Y3YA 1SJ3P 3C15A 3THPA 2PE8A 4JB8B 3VGSA 3VQSA 3MM9B 5E3QA 3OQ2A 3OHBA 1T02A 3TAQA 1ZPVA 4RO0A 3OJSA 3CNQP 1UVLA 4ILMA 4KHRA 3DKDA 4OYAA 4YHHJ 3DOMA 3M8YA 3QO9B 5BYSA 2CZVC 2R8IA 2JEFA 1DARA 1NMEB 5CYQA 5EWEA 1KP6A 4LF1A 3VR1A 3HP6A 2W7PA 4J9SA 2DISA 3RW7A 4ZJOA 3VZHA 4RBUA 1W26A 5KFHA 5H1SV 2CFXA 2J8SA 3JQJA 4URSA 4B3MF 2WOMB 4WCEQ 1GH8A 1IQZA 1VHFA 1HWIA 2IRUA 1RU2A 3HKWA 1V3RA 1NSQA 4PPDA 3VTIA 5KFBA 1HIYA 1C0UA 3K58A 3VAGA 4ZVTB 3TZZA 2Q79A 4ED0A 2VB6A 4QIWD 1HYSB 3SFUA 2RS8A 1TTHB 3E8OA 3DM2B 2YNGB 1Q1KA 1I94J 1X4AA 3BYPA 5JJBA 3OVBA 4K4ZA 3TVYA 2J0WA 2P6TA 1ZTTA 2DY9A 2XMKA 5C24A 3ZZRA 5DETA 4CZCA 1ZTWA 2GV1A 1S0OA 4EZ6A 2BMBA 2OPQB 3QIPA 2J9CA 2BJ8A 1ZM9A 3F56A 1ZAWA 1RT7A 2WK4A 1TL1B 3FBEA 3BO3A 4GKJF 4K4XA 2ZH6A 3VALA 2GQCA 2FZKB 2E1PA 3GMGA 1IKVA 5L9NA 1QUPA 2CQDA 2HGMA 4OHWA 3U7JA 2XO7A 2ASDA 1DAXA 2OSRA 1UMJA 2R7XA 3TUJC 3KLHA 3PYFA 1NK7A 2VD3A 1TKTB 4LSLB 2E9ZA 4DV2J 2KT3A 4Q0BA 4BWJA 4ED6A 3J7Z5 2M4MA 1XWLA 3PYDA 3IRWP 1HMVA 1D8ZA 4OLPA 2B4UA 1HWKA 3DLKA 4CLPA 1B7YB 2CPJA 2OPQA 1SUQB 1TL7B 3QIPB 1O8BA 5F8IA 4UOCA 3ZTSA 3T5KA 2V63A 1OMSA 2I6WA 2JX2A 4DN9A 3VAMA 1VQYA 3QPIA 4J90A 4Z7YA 4ZVHA 1T05B 1WC6A 1TL3A 1HPZB 3H98A 4NCBA 5IWAF 3GP9A 2JH3A 2C2NA 4ZLLA 4DV5F 5KFCA 2HNZB 1S1XA 3HD1A 3I0SA 3KG0A 2MXYA 4LFAF 5F8NA 1GFWB 2JVOA 1ZBTA 3F41A 4PWDB 1FDNA 2GGPA 1GX5A 2J9DA 4PG7A 2K3IA 1T03B 3CD0A 3CJTA 3K59A 2LEBA 2Z4PA 3WBZA 2DH8A 1Q86T 1KSPA 2UU9F 1S99A 3BYRA 2WW8A 2CJXB 2H5EA 1LXJA 4KIAA 4RL1A 3CJ0A 2J8AA 3R9LA 2Y9HA 3OV7A 2YKNA 2F7VA 3HXMA 2R7UA 2MZSA 2FJVA 2RT3A 4AL5A 1U6FA 3I0SB 3SZ2A 1QSYA 5F9LA 5F8JA 1LK5A 3GCXP 2OHDA 3U27A 4DV7F 4EBEA 1RKJA 1I94F 2G1DA 3MGJA 4MYUA 1AW0A 4YB5A 5DS7A 3LGNA 2V4RA 3R5CA 2RUGA 3KUGA 2FD2A 3MD1A 2M3DA 5HJXA 4DWIA 2UXCF 4CNYA
chains in the Genus database with same CATH topology
2XGQA 4TKTA 4OJGA 2OAUA 2EK6A 1BQMB 4KGKA 3IGNA 4IFVA 1FRMA 3S1TA 3MMCB 2XCAA 3OSPA 4X2BA 1KOOA 2HVIA 3O44A 1NNDA 5CYQB 3J81Y 1N32F 1DQ9A 1BQNA 2HYIB 5B0AA 2DNNA 3H4DA 3Q0AA 2PDAA 4TYBA 1YJTA 4WKYA 1U1RA 1JLFB 3QJLA 4HTIA 1CSJA 2C3PA 2N3LA 3W2WB 5FIIA 2V2KA 2JSXA 2VQFF 5LL6d 3CB4A 3M2UA 3RAQA 3X1LB 2D7SA 4C8NA 4ETXA 2W9BA 2NYIA 1MU2B 1U6BA 2XNQA 1GX6A 1BLUA 3OVAA 5HMZA 3DMJB 5E33A 4ES1A 4X4UA 2CPFA 1HW8A 5F41A 2CQ4A 3EYZA 4PRFA 2NSCA 2YNHB 3I96A 4I6YA 1TK8A 2IBOA 4M63A 3AH6A 2EI5A 3NKYA 4NLTA 5KFQA 3W2WA 1VQMS 3F73A 3DRRA 1X4FA 3DLEB 3KMSA 1SJ1A 2DRAA 4K0KF 3QJPA 4N8OA 3LWLA 4R25A 1L3UA 4HH1A 4OZJA 2B3TB 4DF8A 2HFZA 5D6GA 4GKKF 3GYNA 1R6YA 2OO4A 2ZE2A 2JEIA 2FTRA 1FKOB 2B6AB 4ZPTR 3N28A 1HBNB 3MUVP 4AL7A 3OL8A 5BYQA 5A6PA 1SKRA 4ECXA 1GXTA 3ICLA 4X4VA 5C25B 2X1GA 4OMFG 5KFMA 4JBCA 2MSSA 4OJ3A 4ECTA 1WACA 4ALZA 1KD1T 1HNWF 1AFIA 5L38A 5J1EA 1K0TA 2XNRA 4YR0A 1XNRF 2LECA 2ZZNA 1VRTA 2JDJA 5DG8A 2C3UA 4PXEA 1H38A 2EVZA 3SYZA 3QWPA 4IYQA 4RW7B 1FHTA 3NNCA 1C1CB 1WF0A 1TKDA 1R8BA 2F1FA 2O1PA 4F02A 4NZ0A 3M8RA 4DV0F 3FDSA 2MQOA 4BCAA 5KT7A 4B3OA 1NKBA 1FKOA 2B6AA 4O44A 4DS4A 1VBXA 2IYGA 5DGAA 2KKHA 1NO8A 2PMHA 3MTKA 3BR8A 2IA0A 2B51A 2JFDA 4KPYA 5B08A 4NCAA 4AXJA 5A8KB 1RI7A 5FLXY 1NKCA 2HHUA 3OLAA 1RISA 2NUHA 4ECZA 6FD1A 2YWHA 3PY8A 1VRUB 2GC8A 2FJEB 3KLFB 3UPFA 1IQTA 4ZLPA 3KJVA 4KRWA 4YQWA 4MTPA 4RWWA 2BQRA 1WEYA 5D8HB 4C4WA 1R8HA 2DGOA 5CH7B 4WU2A 2K8GA 1JKHB 2VFUA 4C8KA 2VL1A 3KLIB 3THTA 3BSOA 3H5SA 3UDLA 3M2VB 2ZH4A 5EX3A 3MFHA 2X51A 4XDCA 1VQLS 3RRGA 2YKMA 1HYSB 1SJRA 5C5JA 1YTYA 3RB6A 5CCMA 3JSRA 2HNYB 3NCPA 4HKQA 4MH8A 3M05A 4WFNQ 2V4QA 2NXUA 4IQMA 3QGIA 1TZ0A 4Q2LA 5CHCB 1JKHA 3AQOA 4JI6F 5HMXA 1TFYA 4JV0A 1UJ4A 1WF1A 2UUAF 3OR2A 4TLQA 2P6SA 3RR8A 4DQIA 5I3PA 1KNZA 2RRBA 3DDKA 4A8MP 4O4GA 4ZPDA 5FD1A 3NMAA 2MQLA 3MWBA 2CVEA 2COLA 1JXEA 2IVFB 4DL6A 5EN1A 4R0JA 3M30A 3MEKA 1VBZA 5IT9Y 2HS3A 3CCVS 3HVAA 2ZBIA 4CIOA 4HI2A 1JNRB 2XY6A 2XY5A 2DO4A 2MY8A 2NR0A 4KE5A 2W7OA 5G0RB 3KK1B 4N77A 2UUBF 4TY8B 1FVQA 1Z1ZA 1UFWA 3DRPA 3LO3A 4DV1F 1URRA 2B5JB 1HBUA 2RRNA 2EFVA 1FEHA 3MHYA 4P7TA 3LP2B 1S6UA 4LQ3A 2OPSA 2C3OA 4DLGA 4N8NA 1F9FA 3H5UA 3DLLQ 1S0NA 3OTEA 3M1VB 1EETB 4XO0A 1RT6B 2CJBA 2ZHOA 4JI1F 2E5LF 1DBDA 1QY7A 3BGRA 1FDAA 4KAIA 5IQQA 5CD4H 3G6ES 2JC0A 1Y9OA 3FEXB 4B9SA 2E5HA 1IM4A 4JI3F 1H98A 4M5DA 3I0RA 1DQ8A 2GW8A 3C66A 1UA1A 3MUMP 5THWA 2ZFHA 1KLMA 4BC9A 5AE2A 5U47A 2ALZA 2CPEA 1FK9A 2VPWB 1D9DA 4EWTA 2VG6B 3I6PA 1UETA 2IM2A 2BACA 3CCTA 2J5AA 3PEJA 4KV8A 2RB7A 1VS3A 3ULHA 3PW4A 3ZFVA 4LIWA 1QJHA 4I2PB 1IXKA 2XEXA 3CVKA 1I6JA 4OI1A 1IKVB 1M5PC 3M1VA 1Z2ZA 1S10A 2P5VA 4DR4F 4JI8F 4NLOA 4QYZJ 3D1OA 3SSSA 3KLVA 3M2RA 1FXDA 2LVWA 3CJ3A 1RA6A 4C8YA 2W9CB 3H4BA 4RNOA 2J0SD 1UEVA 2OPPA 5DGBA 3M8QA 1S1VB 1SXLA 3U1NA 4X4SA 1XMQF 1V3SA 5CZVA 5HMYA 3CUNA 2V94A 2YNFB 4ERDA 1HPZA 2RIJA 1SH3A 4YR2A 4TU9A 2ZJRQ 5HROB 2G0CA 4Q44A 2Q66A 1Y5NB 3KG4A 2CQPA 3QYYA 1QTMA 2GHPA 4LF5F 4ES2A 2DJWA 1N0UA 1U1MA 4DR5F 3CE8A 4NLWA 5B7WA 3GSDA 4N47A 3C6UA 3NS5A 4WFBQ 3PR4A 3PKMA 1DJ0A 5IS2A 1TUVA 3S8SA 1SJQA 3MMBB 1B0TA 2L9DA 2MMYA 4ZVFA 3M8QB 5T14A 2C2RA 1YJNS 2E5IA 4YB7A 4DL0C 4DG1B 2F40A 1HWJA 4B3RF 3DM2A 2C3MA 1C1BB 4K5SA 2Y0SD 2MZTA 3TANA 5F0UA 3EUNA 4Y00A 2AJ4A 2CQIA 4TY8A 4B3SF 3DRPB 3FZBA 1TKZA 4M8LA 3MPWA 3I56S 1K9MT 1C4CA 2AJFE 2LU2A 2WTFA 3RTVA 4RBTA 5B0EA 2R7OA 3DRSB 4DR6F 1RT3A 3G6YA 2OH2A 4F3MA 4FS1A 1CLFA 2WB1D 1DQAA 1JLEB 1CQNA 4RNNA 1NJXA 4LVOP 2RE1A 1PC4A 2DRBA 5T41A 3UDCA 2VOPA 2FLOA 1IBLF 4ELUA 3CJ4A 3CJKA 4M5DB 3BS9A 2KB2A 2UP1A 1X0PA 4IDKA 1HI0P 3QO9A 4CT9A 2GGPB 3JSYA 4X4NA 1J5EF 3H20A 2R4FA 4MIWA 4O3RA 2DGVA 3N4WA 4DQSA 1N34F 4ZS6A 3OR1A 4WU3A 1YGYA 1SKSA 3Q8QB 4F2SA 1A9NB 1RDRA 1TAQA 3DC2A 4XIUA 4FF3A 2ROPA 4RNFA 2HHTA 1WHWA 2LLZA 4NL5A 1Q53A 5J1NA 4PKDB 1DRZA 2M8DB 1JLEA 4IDKB 3GIKA 1OS5A 1S49A 2OPRB 2FLPA 5B09A 4B9LA 3CCZA 1L3VA 2I5JB 2PMZD 4USHA 3DRXA 4LF4F 3I4HX 2N3OA 4ETZA 1Q16B 2XMWA 5KOXA 4A8FA 3MOJB 1SH2A 2G13A 2K1RB 3LF0A 3U02A 2RF2B 2GX8A 1S1VA 1HBNA 5B0DA 2XZWA 2GA7A 1FKPA 1UAWA 3MD3A 1HQEA 4BC7A 1T3NA 3HVWA 4BS2A 4PG8A 5SUHA 1U1PA 1N6QB 1M0SA 1C0TB 2D9OA 4DEZA 4MMOA 2CPHA 3AY0A 2VC0A 5DDQC 3OFEA 2R8KA 1QLNA 2FGCA 3TX8A 2RDIA 2KH9A 3GYXB 1RTIB 3GG0A 4OX8A 5KFPA 1VC5A 1TL5A 3ETOA 4YDXA 2RS2A 1ZAVA 4RNMA 2JHEA 2N7YA 5K14A 1WI8A 3MM9A 3KLEB 1VJWA 4EGLA 4A47A 4KT0C 2KM8B 5DQHA 1DZ5A 2R7UA 5D4LA 2BQ3A 4ID8A 3HVTB 4UUWA 2ZDPA 4JI0F 3FEZA 3TOQA 4F26A 1N52B 1AFJA 4K5RA 3CJ2A 2O5DA 5L1JA 2ZKTA 3G8TA 5H9FJ 3TQ1A 5KT5A 1RT2A 2OTJS 2OMOA 3MOZA 4WKRA 2B56A 2GJIA 3AAWB 3DYAA 1BD6A 2ZOFA 1X5SA 3DOKA 4CO2A 1YJVA 1UA0A 4RW4A 1S9GB 2XSJB 2ZNZA 3DRSA 3MF5A 3HO1A 1G7CB 2DGQA 3E3XA 3G71S 2E1CA 4HVZA 2KG0A 1TQLA 2RD5C 5F8HA 3BDPA 1OQ3A 3BQ1A 1YQHA 3CDAA 4HL9A 1XK8A 4NA1A 3HZEA 4FN5A 4XK8C 5M2RA 4B9UA 4LT6A 1DHMA 3OFGA 2FJXA 2UXBF 2BR0A 1RT4A 3NG8A 3DNCA 4O3NA 1E6YA 2VOOA 4LSNB 1RTJB 2BRLA 3TI0A 4NLVA 4B3TF 3FQLA 2QFJA 2IYIA 3UR0A 1ZOTA 1X4HA 1NK8A 1ZETA 4C11A 3RR7A 5HQ8A 2PEHA 3SV4A 4TXSA 2DNMA 2R7VA 1BY9A 4RU9A 2QZ8A 5KFNA 1SL0A 4NLPA 4C2MA 2KHDA 3KHLA 4CQ1A 1HNXF 4WZQA 1HI1A 2XULA 2VKRA 2UVUA 4YHHF 2IVMA 5KFFA 2XWXA 2CQ2A 3H2LA 3D2WA 5KFAA 4C3MA 3HHKA 2IMOA 4OFZA 2GMHA 5A8RA 3RU0A 1JLGB 2RU9A 4U7CA 4KFBA 2QA4S 1HBOA 3EXCX 2HGNA 1NJIT 2LXIA 2XMJA 2VPXB 4YB6A 4FF4A 1W2BR 3UCUP 2L3MA 2FVQA 1ELOA 3CD7A 2AWZA 3PFOA 1YRXA 4WK3A 1R8CA 1S6PB 5LJ5Y 2Y1IA 4H54A 1U8SA 2QT7A 3HHLD 4XAKA 5D3GB 2DGXA 3MEDA 2BUNA 2FJBB 4ED3A 1H3DA 2U2FA 4MYTA 4Y6IA 1B0PA 3HJFA 2DH9A 4FVMA 4ZCKA 1UJ5A 2J0XA 1VC6A 4XDDA 2KN4A 1TKXA 4IOCQ 2BBEA 1RT5B 2KXFA 1H7XA 5KG0A 3D1QA 4PCQA 4F3QA 4YR3A 2IJNA 1FERA 1B64A 3MM5A 1DLOA 2FVSA 1MMLA 2DIVA 4A8YA 1D8YA 2BVZA 1RTHA 1Y5LB 5A2QY 2LKZA 5HBMA 4IUFA 1JJHA 1OO0B 5LSRA 3THVA 4F4WA 4DL2A 4I2PA 2XCPA 2L9WA 2HVZA 3UD4P 4LFCF 4Y0FA 3JAMY 7FD1A 7FDRA 2FY1A 1WG5A 1JLCA 2KRBA 3MZIA 4NWBA 2J6UA 3LAKA 4M1KA 2VV5A 1MW7A 2DNQA 3H25A 2RNEA 1FXRA 1OIAA 4DUZF 1VQNS 1NAQA 1U47A 4UW2A 3OUYB 3TW0A 5GMKa 4IOBA 1QAJA 1FEEA 4EO6A 4OZLA 1HARA 2F8EX 2PSZA 1A6LA 2E1AA 1URNA 3ENVA 2YNFA 1FJCA 5KAKA 3KLFA 4MK8A 4J9LA 3EZ5A 5L9XA 2MZ1A 2B5JA 4B17A 4HTJA 2PI5A 5FDLB 4J9NA 3DN9A 5EUHA 3MECA 4WXOA 4QWEA 4RUAA 3C6TA 5JVGQ 4ED2A 5AXLA 2BXJA 3I31A 4KGMA 5EDWA 2DR7A 1Q7YT 3MAHA 4KR0B 1Y0HA 4WFZA 1NK5A 2KRRA 2KVIA 2DTJA 4Y34A 4QR2A 3M9NB 2APOA 5F0WA 5GADI 4H4MB 1JLAA 2HNDA 4KHMA 4IR1A 3M32B 1FJ7A 2WSFC 3HM9A 2ASLA 3R5AA 2HPUA 2D3OR 5DLGA 1E6VB 2UUWA 3MEGA 3LWMA 4LF9F 1FRHA 2ZITA 4ILRA 2K7KA 1YSJA 5IM0A 1U45A 3B8HA 5F3ZA 2Z0GA 2VA2A 4F2RA 1Q4RA 1LWCA 2OFGX 3FFIB 1LWFB 4ZHRA 3M4XA 3I32A 4CH0S 5AXNA 5KG1A 4BBYA 5L1KA 2QSFA 3OSNA 1H0HB 3CCMS 2HRUA 1R0AA 2HZCA 2LDIA 4QIFA 2R8JA 4DL4A 1RAJA 3PXGa 1SJFA 3CCQS 1E6VA 3MEGB 2KJWA 4O3OA 2RQ4A 4MK7A 3FSIA 2GQQA 2XMMA 3KKFA 5B0GA 3T6JA 1TVRA 1FVSA 3MPVA 3IO1A 2ZD1B 2DR9A 1DLOB 2V9KA 5LJ3Y 2CJ9A 4B9VA 2XS2A 4Y2MA 2DCLA 2VPYB 4DN0A 2E7XA 3PRBA 1X4BA 3M6XA 2RMLA 3CO9A 4ECWA 2QSWA 3V6DB 1DTQA 1HBUB 1P1LA 2LDYA 4DV4F 2J9EA 3MR5A 1YHQS 1KLNA 2ZZMA 2P9EA 4QQBA 1WEZA 4KSEB 2ZH8A 4DDFA 1IKWB 1O51A 1JIHA 3SSRA 2PA8D 4UUXA 5EHHA 1HHTP 5EX0A 3TP2A 1Q7LB 3JYTA 1C1BA 3FGVA 2ZHBA 2EFGA 2EG2A 2NPIA 2KFYA 2VZ9A 3C3LA 2NQPA 1CG2A 2JEJA 1T05A 4TLRA 4EYHB 5FJ4A 2K7JA 3MMBA 2BABA 2K1RA 2IHR1 2KI2A 4O23A 1TVRB 2HNZA 1LXNA 1RJJA 4FZVA 5A6WA 3FJ2A 1GNKA 1LQ9A 5HO4A 3GG1A 3O2IA 3UQSA 4AE5A 2D1CA 2YNIB 4E8UA 4LUBA 1F5CA 1VRTB 5K5MA 4BHQA 2VASA 2YWFA 2MPUA 5C42A 2R2RA 2AJQA 5GAHI 3IC1A 3LP1A 3GFZA 1KQKA 4NRUA 2YKNB 2R8GA 4W92B 3DFEA 3N5FA 1VIXA 4IRKA 2FJAB 3CDBA 2FVPA 2FIUA 4U7UK 4MIBA 5KFUA 3VQTA 4TU7A 1PILA 1FDDA 4I2QB 1FD2A 1UJ6A 4N76A 3K8VA 3POTB 2N7CA 3T1HF 2OJ3A 1YWXA 2DGUA 2B9XA 3A1YG 3OW2R 4ZVGA 5A0YA 3N6NA 3HPOA 3CCJS 4X84A 4F8RA 2RRAA 3I4PA 1S0VA 4UY85 3GR0A 4C8OA 4MKAA 3OFHA 2X1FA 2LU1A 3E01A 3GIJA 2M5YA 3DDNA 1M5KC 3NBPA 2I5JA 1O0PA 2YVSA 3FSYA 1HWLA 4DHVA 4ZHRB 1HMVB 2MGZA 4NLDA 4J9KA 2YKOA 4ZPVR 1D9AA 2X3GA 3OTOF 2RF2A 4DL3A 2W8LA