5IWAF

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5iwaF00
4DR3F 4B3RF 1QJHA 3T1HF 1IBKF 4DR6F 2UUCF 2B7BB 2ZM6F 1IJFB 4NXNF 1HNXF 2UXBF 1HNWF 1GH8A 4GKKF 1FKAF 1XNQF 3R3TA 4JYAF 4JI6F 2HHHF 4DR7F 1I94F 4LFAF 4JI2F 4JI1F 4LF9F 5IWAF 4B3SF 4JI5F 4DUZF 4X66F 1XMQF 4LF8F 4B3MF 2RJZA 2UUAF 1G1XA 1N32F 1HR0F 4JV5F 4NXMF 4LFCF 1IJEB 4DV1F 2UXCF 4LF5F 2BVZA 4DV5F 2KJWA 4LF7F 4DV0F 4LF6F 3OTOF 1N34F 2VQFF 1VMBA 4DR4F 1IBLF 4GKJF 2F4VF 2B7CB 1IBMF 1CQMA 4YY3F 4DR2F 1LOUA 4DUYF 5AJ3F 1J5EF 1CQNA 1F60B 4JI8F 4K0KF 3ZZPA 2VQEF 1HNZF 4DV7F 4OX9F 5BR8F 4AQYF 4YHHF 4LFBF 5LMUF 1G7CB 2UUBF 4DV6F 4DV3F 4DV2F 4JI0F 4X62F 4DR1F 2UXDF 2KJVA 1XMOF 2J5AA 2YY3A 1FJGF 4JI7F 3T1YF 4LF4F 4DV4F 4X65F 1XNRF 1N36F 4JI4F 1N33F 5LMNF 1RISA 2E5LF 2UU9F 4X64F 4JI3F 1B64A 4KHPF 2BXJA 4B3TF 4DR5F
chains in the Genus database with same CATH superfamily
2UUTA 2YQ1A 1JLAB 4J9OA 4FF3A 4ZLNA 3RAQA 2KH9A 1K47A 4RR5A 2AYGA 4NCAA 2YQ0A 2ZM6F 4F4KA 3W9JA 1G1XA 4DR4J 5IV4A 4DFJA 4LVNP 1UEKA 2HZCA 2I0XA 4OHXA 1N6QA 2DNYA 2EPIA 2WSEC 1G6BA 3V6DB 1T05B 2VJVA 4JYAF 5ETOA 4ZP6A 4IKAA 3AODA 1FKPA 2BRLA 1VLYA 2UV8G 3QGPA 5J2PB 4FBUA 2VQFJ 1RA6A 4TQSA 3AXKA 2V4RA 2H65B 3UR3C 4F02A 2YKPA 4K4UA 1F3FA 2WONA 2HWIA 1M0SA 3QT8A 2XNRA 2I5JB 2QO3A 3QT5A 5K5MA 3I55S 2WOMA 5DZ7A 2IJRA 3J7AN 2DXDA 4DR2J 3KG0A 4B9LA 1J27A 1TMJA 3D6HB 5KFKA 2IC3A 4E98A 9RUBA 4H4MB 2VKRA 4V1Ak 4J9MA 1YWXA 2VFTA 2CPDA 1FKOB 4NE9C 3UR0A 4HYKA 1NJWA 1HNWJ 2RILA 5DZ6A 3FZBA 4ECZA 1XIQA 2BQ3A 2A3JA 2F4FA 4ZS6A 1HR0F 1NO8A 5HP1A 1YSJA 3MMBB 4ECQA 3KFWX 4ALZA 4M8LA 3BO2A 3MEKA 2O1PA 1FERA 3BM7A 5CH7B 5FDLA 1X4FA 4JV2A 3MEEB 2CZVC 4OHWA 3N01A 4I1TA 2ROEA 3TA0A 3KK3A 4RO0A 4TYBA 2DNMA 1U6BA 1I51B 2H9ZA 3HFZB 4JYAJ 1HNIA 3SCIE 2E1RA 1KVKA 2VA3A 4A8WA 1S57A 3VCDA 4F50A 1TK0A 1O6XA 1T9VA 1XN9A 4ZHRA 2CQ0A 3H2VE 4X4RA 3JYTA 2DR5A 4WFNQ 3POTB 1K1QA 2BANB 2F4VF 5C42A 4A4JA 3IBFB 4IH6A 1SJ1A 4DR2F 4PZVA 1F9FA 2VOPA 1J5EF 4UY8T 2FPHX 2K1RB 4CI0B 2J76E 4NYOA 3QZ8A 3OTDA 1F60B 2DGXA 4ECWA 1RTDA 3LPYA 1RWVB 1NKEA 3HHLB 3PX0A 4C8YA 1S9GB 1IQZA 4L3KA 4CLUA 3TR5A 1KOHA 1BE4A 4G1PA 3CDWA 4YHHF 3SDEA 4EBCA 4IG3A 4XDCA 5L9NA 2ZWOA 3AH6A 2BOAA 2N4CA 2DJWA 3OVSA 3AT1B 2BBEA 3TVYA 4NYZA 5DGAA 1RTJA 2QJ3A 2MTLA 4QWDA 4O3NA 3CCUS 1UFLA 1EETA 1S1WB 1U8WA 2OEKA 4B02A 1R43A 1D9AA 5D3GA 2XMWA 4RUBA 1HMVB 1F5AA 5H9FJ 5L38A 1QTMA 1QLNA 3IMQJ 2HIYA 2E9ZA 4A8MP 4PWDA 3DNCA 2AIRB 2V8GA 1WC5A 3NGKA 3TZXA 3K7RA 1NB7A 2QA2A 1ZM2A 3NCPA 2NSBA 1EETB 1S1WA 3JSMA 5HBMB 5KFVA 1RT4A 4OZLA 1FWLA 4C6AA 4ECSA 5D3GB 2QYCA 5DETA 1M5KC 3MGJA 5FJ4A 3R5DA 2RS8A 2CJXB 1CJVA 1BXNA 2YWGA 3DFEA 3G4SS 4ECVA 2ZDOA 4DQPA 3MOJB 1JWWA 2YNGB 2NLWA 3H5SA 3FCHA 4IH7A 3GJSB 2R4FA 5ETLA 3R7SB 5M2UA 5F8IA 4UQGA 1BHNA 2A10A 1HQ2A 2PD1A 4A8OA 3OLAA 3K59A 3M2UB 2VA2A 1GMWA 1TUGB 1YVFA 3IR6B 3PEJA 3VTIA 1RT1A 2A18A 3OL6A 4A48A 2HWHA 1KLMB 4F3QA 1RTHA 1IJFB 2EW9A 2XMTA 4A8FA 4KGVB 4G1QA 3PR5B 3DYAA 1S72S 4AL5A 4KAIA 3F73A 2B9XA 2BX6A 3MOZA 2J9DA 2CVEA 3CD7A 2C2DA 2B56A 4NOHA 3J7ZT 1L5UA 1YGYA 3MM9B 3SCLE 2OHDA 3QO9A 1IVZA 3ZXWA 3IC1A 4IH5A 6FDRA 2IM0A 4F8RA 4KO0A 3G87A 3CC4S 3KJFB 3PY8A 2GAHC 4Q5VA 4CYUA 5E3CA 3RUBL 3VQTA 4ZMMA 2HHHJ 4JI5F 1RAIB 2IPOB 4USKA 3QZ7A 1N56A 1HPZB 4RW4A 1X8DA 2HFNA 3HDSA 1TL1A 2I2YA 2XZWA 1UVKA 1TKZB 3HSZA 4FVMA 2NYIA 4MH8A 2ZUGA 1OSDA 4RLEA 2XY6A 4Y34A 2XYGB 4RUAA 2C2KB 3K17A 3MEGA 4NASA 4ZPTR 3R97A 4NMXA 2ATCB 2XM3A 3OJUA 1H74A 5B0EA 4RJVA 1N32F 2WVEA 4NLOA 2I6WA 3TEGA 2NS1B 2VC0A 4Q45A 3Q0AA 3EDQB 4NLVA 1H2UX 3V4IB 2HVIA 1FE0A 2UXCF 3EDRB 3ITHA 3P4UB 4CTAB 3MURP 1FE4A 1AT1B 3AOAA 1FEEA 3UW1A 3T5HA 2HRUA 3DHXA 2VONA 1FJCA 3BSOA 4OZ0A 2ZBCA 2QFIA 5ETRA 5K9FA 2IA6A 4LF7F 4DV0F 1FDNA 2Q1LA 4LF6F 2HHUA 1NDCA 2YVSA 1VRUA 3LUYA 3IS9A 3MCNA 3R5GA 2H4YB 4ZLLA 4OX7A 2MKCA 5GAHI 4ECXA 3LP1B 1FI4A 1CSJA 5DQIA 2QA4S 2IBOA 3VVTA 3D28A 3OBIA 5K14B 1NSPA 2RDDA 2XTJP 1YDLA 4O0IA 5BR8J 4IRDA 2HGLA 4MKAA 2B7CB 5KT7A 2B4OA 1PAUB 5JMNA 4KV8A 4M5GA 5HO4A 4N5SA 1QAYA 2J6TA 3QYYA 4ZP8A 4A46A 4PXBA 1KLMA 4BBYA 2Y0SD 1S9FA 2AHOB 2YXLA 3M6XA 3U7JA 1XEZA 3QT6A 2AX1A 2P9CA 4R0JA 4C11A 4JI2J 5LXYA 5AJ3F 5IFMA 2KG1A 1MU2B 3M1VA 1U45A 1MMLA 1NSKL 1UFKA 1Y0HA 2H48B 1HQUA 4YY3J 3MM9A 3BGRB 4USIA 1SUQB 2YNIA 5CD4A 1QDUB 3HVTB 1Q86T 2DVIA 3CIMA 3PKMA 4X4NA 2VUGA 3HVAA 1U7LA 2HQFA 2W4CA 4OQJA 5F3TA 5HK4A 2DR6A 1Y10A 4NLQA 3V5RA 3H4DA 1JK9B 4W4MA 4ZIVA 4CT9A 3UQSA 2R3VA 3IRWP 1C4CA 2ZH8A 5KG2A 1N88A 4U7UK 1S1VB 1WC4A 3CCZA 5KFWA 5HAOA 3EPIA 1UVMA 2HHVA 2X1AA 3CJ3A 1C1BB 5KG1A 3E2EA 4MKBA 5F3ZA 2K3KA 2A6MA 3MPVA 2E7VA 1C0TA 2VG6B 1RZMA 3NBPA 2DHXA 3QIPB 4ZPDA 1KHVA 2XC9A 3HPOA 2BQRA 2UP1A 3KUHA 1NZ8A 4USWA 4ZVUB 4U95A 1FKOA 2YKOA 3NKYA 3QGHA 4V19X 3BN4A 3TVZA 4QPXA 5KFZA 3WQPA 3BGFA 5L1IA 1VQNS 5D0EA 3OFGA 4ZCLA 3R9LA 4IR9A 5B09A 1N33F 3CJKB 3HJFA 4NXMF 2OELA 3PJWA 1NPPA 1UL3A 2F65A 4QOTA 4JI0J 1UA1A 5D4NA 3FKBA 1JLQB 1Q5YA 4ICLA 5H1SV 1JJ2R 2RQCA 3CJ8A 3OXGA 1VRQC 2NYHA 5HN0A 1LXJA 2A6OA 2ZDPA 4DSFA 3OFEA 2FY1A 2MQOA 1GX6A 4F4WA 2KN4A 3MR6A 3M6WA 2YWFA 4B9NA 1YBUA 3UVJB 4OYIA 4F3OA 2LQ8A 3LWMA 1OY8A 4CP5A 1HNWF 1MWYA 2B3TB 2MEWA 2XHCA 3DRYA 3WC0A 1WG1A 2B43A 1RT3B 4RW9A 3ZTQA 3CCTA 2W1BA 2OP5A 1IR0A 4IUFA 4KKOB 2M7SA 3GYXB 4C9DA 3DMJA 5HQ8A 1WI8A 1UWAA 3BGRA 4JI1F 5KT4A 3PYFA 4ZCKA 5IWAF 5H9EK 2DPJA 2HFSA 2B6AA 3QATA 3W5YA 3JTNA 2MYFA 1B3TA 2ZC4A 2GGPB 3ELHA 3I0SB 2CNOB 3GWCA 3B82A 2DEJA 1J5OB 1NDPA 3HHLA 3SBMA 4NI2B 1RKJA 2FVPA 2BM0A 3LPEA 1KQKA 4PCQA 3GB0A 3N4WA 3GV5B 3T5LA 3QJPA 3RG6A 3ILJA 2VKZG 3HO1A 2O3DA 2CJ9A 4Z7CA 2V34A 1FRLA 3HVWA 1PGZA 2E5GA 4ZJLA 2B5JB 2YKNB 3WHIA 1J5OA 4IRKA 4ERDA 3CW2C 2OPRB 4RZRA 3D3BJ 3MD1A 1AZSA 2HQGA 4P52A 1PYOB 1SJRA 1YJVA 2QX0A 4H54A 2ZHAA 2HFUA 4F4XA 2NZ4A 4P73A 1NB2A 4CLYA 3LW5C 1LWCB 2Q6BA 3TRGA 1OS5A 1NHUA 1R8PA 3PFEA 4MKYA 1ZM9A 1RT5B 2AGOA 3A8EA 1VJQA 4UOCA 3FDSA 4FF4A 3JTOA 4YR2A 1NAQA 1BQXA 1BY9A 5KG0A 2NSCA 3DRPB 1RT4B 4NEZA 4CH0S 3HT3A 2ZJPQ 2OJ3A 4LJMA 4KPYA 3CVKA 2HWTA 4OJ3A 2H3EB 1XMBA 3TX0A 3NCQA 3L95X 4K4ZA 3CJ2A 1RLCL 3K8VA 3V4MA 2VDIA 4F67A 4QWAA 3JYTB 1CQMA 1XC9A 2BANA 1S48A 1R0AB 3DRPA 4FVCA 3SSQA 1N5YB 1AW0A 1YK9A 4DUYF 4HHJA 3FCWA 1UETA 3CPWR 4MYUA 1IBKJ 1R8BA 1X7VA 1RBAA 1YQHA 2SXLA 2V2ZA 3D6MB 3QAEA 3R27A 4CLPA 3A13A 2ZH9A 1VQ4S 1HLWA 1RTHB 2XO6A 4ELUA 1R0AA 2KU7A 3ZTRA 4D3HA 4YFUA 2MB0B 1FEHA 3GV8B 1LW2B 4PR6A 3P49B 1LKZA 1S9GA 1VK8A 2FVRA 2IY5B 2HK2A 3O3LA 5LMUF 1UPMB 1RYRA 4DV6F 3B54A 1RHQB 2QYGA 1VHFA 2PSZA 3FBCA 3N28A 4X84A 2PA8D 4C8NA 2CNLB 4R5PB 1U26A 2KVIA 4IR1A 3CD0A 5GADI 2VZ9A 2MQQA 3TJ8A 3VAFA 3V81A 4CLWA 3GCWP 4ID5B 2DKOB 2EKNA 2EKYA 2R8JA 4LF4F 2NPFA 3GG1A 1S12A 1SJ4P 3DOMB 4M5NA 3BGUA 3NS6A 3A8IA 4QR2A 4TLRA 2NQPA 2BW7A 3VV2B 2GVDB 4RW8A 2DNHA 2LA4A 4DI6A 1VS3A 3CNQP 2KI2A 3IWNC 1RABB 2RU9A 1DTTB 2IRYA 4EU0A 5MAOA 3AHPA 2RKIA 2IVYA 3ZZRA 2WSFC 2U2FA 1VRUB 1S6OA 4F3MA 3RB3A 2GHPA 4TYAA 1P1LA 5E2QA 1SQFA 2B7BB 3CJSA 5LMUJ 2OTLS 1UVJA 3DDKA 3H98A 4LUBA 4XTTA 3VGSA 4RU2A 3PACA 3Q86A 4IFVB 1NZAA 3AY0A 2NZCA 4L75A 4WKYA 5LSLA 5AE3A 3Q8PB 1RADB 1Y3KA 1U49A 4DCPB 3DLEB 3BQ2A 1I94F 2P9EA 3CTRA 2XLKA 3R2CJ 4WFBQ 1T9XA 1RHUB 4DR5J 2B6AB 2X1BA 2YWWA 3POTA 3V6HA 1WTFA 2R7QA 4TKTA 1VI7A 2FB0A 2R7WA 2KZZA 4CWBA 4NLYA 1PJ7A 2EFPA 3AFGA 4W90B 2KT2A 4XDDA 4C8KA 2L08A 2RJZA 3PV8A 4O4GB 2C3MA 1Q7LB 4QW8A 1O5JA 1DFDA 2XSFA 4NZ6A 4P72A 1RAJA 1S1TB 2HNDA 2ABYA 2LCWA 1FO1A 3IXQA 2WB1D 3M32B 4RNHA 3RRKA 2EC2A 7FD1A 2OSRA 3X1LB 3OSNA 2D3UA 4TU7A 4IRCA 2JNJA 2GVZB 2GMHA 1BWEA 4HL9A 2HS4A 4B08A 1FK9A 4B3OB 1S0VA 2BVZA 3CJ4A 3FRZA 3C66A 3MMAA 4K7QA 5CABA 1U1NA 1NJZA 4XAKA 1SQGA 4AE5A 1C0UA 2XEXA 2VPYB 2OEMA 5HMYA 4KBIA 1UP1A 3G8TA 3ADAC 1R6YA 2CIMA 3KTQA 1PG5B 1VCTA 2JL9A 2Z4PA 4WFAQ 3AD9C 5I3UA 1IKXB 2IM1A 4ES3A 2G2ZA 2GJ2A 2IFXA 3KLHB 2ZBIA 3GILA 3V2UC 4DCOB 3FGVA 3THPA 3D6FB 1F9HA 4X65J 2V0NA 3CDBA 1WC0A 1FRXA 1S79A 1IM4A 3OL7A 1M5SA 2B4UA 2IJNA 2Y3YA 4C48A 5C24A 1NH7A 3ISND 1SH3A 8AT1B 2APOA 2DGOA 2LEAA 3HFVA 2F1FA 5E7OB 5KG7A 5GAGI 4YQWA 2H51B 2OPSA 4Z2XA 4RUCA 3HZEA 3OVBA 3CO0P 1YJTA 1EAYC 3HCXA 2M5YA 3KKFA 4OYPA 3GFXA 4C0HA 4FNHA 3GFHA 4N8NA 2RRNA 5E3QA 3F41A 1TL4A 5AXNA 3B6BA 3GIMA 1HL6A 2DK2A 1SUQA 3A3PB 3CF5Q 4F4ZA 4F2SA 2M2BA 3QRQA 2R2TA 2P9GA 1SC4B 3BDEA 4RKUC 3PJ9A 4OLPA 2VJUA 1UTAA 3CSKA 5KFOA 4OI0A 2XULA 5J2MA 2HS3A 3TP2A 3BJYA 5IV3A 4M5HA 4JI0F 3ILIA 1WEYA 1RDRA 2VBXA 1VR6A 2RH3A 1WNEA 2YY3A 4DQRA 4LSNA 3DM2A 3VZHA 2DXFA 3CD5A 1EP4B 4YB5A 4ED6A 2L3MA 4ED2A 5I3QA 1YKWA 2CJQA 1RLDA 2BW2A 2VG6A 3CE8A 2MSSA 2IDLA 2Z2ZA 5D6GA 5L39A 4HI1A 1UJ4A 2F8EX 1HW9A 3PNIA 5B0AA 2W4DA 3KK2B 5A0YB 2WVFA 4WTOB 4DWIA 3NOCA 2B5JA 2YKNA 4PWUA 3KUEA 5BYRA 3UPFA 1B0VA 5LJ3Y 3K57A 4KHMA 4C8LA 5JJBA 2CWKA 5FD1A 5F8NA 4EI2A 1RACB 2P6TA 4LBHA 3CC7S 1VJWA 1LWFB 1M5VC 4TNOA 2PMZD 4OFZA 2AV5A 3ONQA 1YZ7A 3OLBA 4DR6F 4M63A 3SV3A 3FVYA 3R5BA 1V3ZA 1YJRA 2F9JA 3MPWA 4MTPA 2BA9A 4F26A 5DQHA 2KXNB 1IKVA 1GMVA 4J9NA 2ZBQA 3OXFA 1ZYQA 4IQXA 3IS9B 3H90A 1XNQF 1WF1A 5C24B 4G1IA 4DR7F 1KHWA 1FRHA 2BEFA 2C2ZB 2B8QA 3IBWA 4ES1A 4ZITA 1PAEX 4GMKA 4P7TA 3M2RB 5D15A 4X66J 2QL9B 4DPTA 1AUDA 4LFAF 5CAAA 4ZJQA 1JLCB 1GTHA 1ZM3A 3VAIA 4A8YA 3CCMS 1Q4RA 2WBMA 4JI6J 2LQ9A 2M0GB 2N7YA 3EVMA 4DUZF 1NKBA 1SL2A 3HKWA 2HGMA 3C6TA 3NLCA 2CXEA 2OUGA 3SSRA 4DQIA 1JLFA 5GAEI 5KG6A 4HDGA 2HNDB 2GHWA 3MI7X 4K2JA 4TY8B 2Q6CA 5A76A 5CA5A 1JLCA 1N54B 2FTRA 2X3GA 2N3LA 1CULB 1S9EA 1ZPVA 1U0HB 1TL3A 4UQTA 3X3UA 4DL3A 2HHWA 1XJWB 3T19A 3OPKA 5HVHA 4RW4B 2KZMA 3ZO7A 4KGMA 3N6LA 4BC7A 1N5VA 5C25B 3G6ES 3SQGA 4TY8A 4HTIA 1UW9A 2QLBB 1NUEA 2YQ3A 2KRBA 4DR1J 2PIIA 1N34J 2UUCJ 2VFUA 3TUIC 4EBEA 3OFHA 1TK5A 2Y9HA 4QW9A 2QSFA 4OYMA 1H6KX 2KHCA 1F5BA 3C8YA 4DHVA 1XNQJ 4KH1B 2QRRA 4ZPVR 2CPZA 2HVEA 2DH8A 2D3O1 3CMES 3KOAA 2MDAA 2YPYA 3OUYA 3EZOA 3T9ZA 3NBPB 2ERRA 2QMUB 2WK4A 4YMEA 3IA0A 3M2VA 1JNRB 1T9WA 3MMJA 2J8AA 3JSBA 1CJUA 4PXDA 2HEKA 3Q83A 2C3PA 2GIFA 5D0RA 4DV4J 4N77A 3SV4A 4PUOA 1DTTA 1ZAXA 1NHKL 3JAMU 1D3WA 2MQNA 3FEZA 4DL7A 3NAHA 3R6LB 4PG5A 3T41A 4FBTA 1RE1B 1FXDA 3MMCB 2NXCA 4G1QB 2YNHB 1TZ0A 4URGA 5HROA 1U1RA 1KKHA 2J9DE 4N47A 4JBCA 2J9CA 4GVBB 4DFPA 4JI8F 2AYMA 4OIXA 2EVZA 3ZZPA 4DS4A 5I42A 3CULA 4DV1J 1PIEA 4USTA 5K8PA 2UUWA 1XTZA 2RT3A 1RUSA 4AD6A 4ILRA 4C11B 2HZAA 5C42B 1P9QC 3HP6A 4UTGA 2Q66A 2V9KA 4LBPA 4HH1A 2BV3A 3CT9A 1WEXA 2GJIA 2DISA 1MN7A 3ZZYA 4ZKAA 4X4TA 4ECUA 5IT9U 1PCAA 1S77D 3BREA 1VOMA 2IAJA 3EE3A 3O1LA 3RB4A 4DSEA 3CO9A 4DCJB 3FEXB 3M4XA 4M94A 2J5AA 1B99A 3MECA 1MMDA 1OYDA 4KHRA 4RL1A 2XLJA 1U09A 2AKWB 1YRXA 3MUMP 3SZ2A 1U1PA 3SCKE 1KONA 2VB6A 3EGVA 3VGTA 4DV4F 4YEAA 2ATLA 4IO9Q 2KT3A 4DX8H 2L9NA 3DOMA 1JLBB 2GV1A 4OJHA 2VFVA 3NGSA 5LMNF 1JKHB 2F9DA 3ILOA 4OI4A 3ZTOA 1K1SA 1B64A 4JI3F 1SV5B 4XPCA 2FHJA 3MEEA 4B3TF 4PWDB 5A8RA 4YB1P 4DR5F 1UPPA 2PT0A 1HI8A 1SBRA 3DLGB 3IM9A 3DLHA 2DR7A 1N33J 2MZ1A 4CO2A 2DH7A 3I0RA 3TARA 1O51A 2IIHA 4FPRA 4CDIA 2C22A 2CJKA 1BC6A 1MROA 2ZWPA 3TA2A 5B0CA 1QSLA 1GX5A 2BOPA 5CYJA 1HNVA 3H0PA 2VQEJ 2GJFA 3PZPA 2HPUA 2ZKTA 4WJBA 4Y6IA 3HMJG 4EO8A 3I0RB 1RAEB 3P5BP 4YUDA 4CCHA 4WWSA 4KIAA 4CM2A 1N5QA 4LR7A 1BWVA 1EJ7L 2FLPA 2FJAB 1IR2A 4Q43A 4KJIA 3HX9A 2X1FA 4UY85 1RT7B 1HBMA 1S6PB 3A3OB 3E51A 4RW6A 2M8DB 4B3SF 4ECYA 3CJ5A 1Q8IA 1XMQF 1KBRA 3P3DA 3W60A 2BE2A 4F0MA 1T03A 3JQMA 1GTEA 1U0HA 2DNPA 2CJBA 5E5NA 1SIWB 3GYGA 5M2RA 4ANCA 2MJNA 2KL8A 3QPIA 5ETMA 5GAEU 2MGZA 3DRSA 2QA4G 5IZHA 3RB6A 1U48A 3DI6B 4NEYA 4Y2KA 2YX4A 4XPEA 1ROFA 3BBFA 1BUXA 5IT4A 3BO4A 1I6JA 1RTDB 4FF1A 3MECB 4UT4A 3ZTSA 2ZC3A 4DG1B 2ZH2A 2PDAA 3C16B 3T5KA 4X62J 1K8AT 5DM7Q 1DLOB 2FLOA 2CPIA 1RQ0A 3W61A 3DN9A 1CLFA 1UZHA 5LSOA 3TJ9A 3PYGA 2CRLA 1DBDA 1YG0A 1D0EA 2RAQA 5KAKA 1SKWA 4LRFA 4EYIB 3EUNA 4RBVA 2ALYB 4KGXB 4FXDA 4M1KA 4YN3B 5CCLA 3DOLA 5E41A 4OMFG 2HAFA 1ZA1B 1ZPWX 3G9CA 4QBUA 1SH2A 3KWMA 4HVZA 2CWXA 1NU4A 1HARA 1OMSA 5KT3A 1S0NA 2ACYA 5JVHQ 3QSYB 4P7VA 5GVQA 5CXTA 1N8RT 4LF7J 1P8GA 3EZ5A 4UZCA 2GMLA 4CO3A 3CDEA 3JB9k 3UVJA 5FDLB 2HW3A 1R8CA 2LP4A 4UOGA 1Y5LB 3HZGA 4NWBA 3TUZC 2PFFB 2OLWA 1KR4A 5FIIA 2JJ4D 2LU1A 2BJ7A 3JXOA 4BC9A 2HVDA 2ZUAA 4X4UA 5BR8F 2ZH3A 3OTCA 1L3KA 3CWJA 2ZM6J 5HVFA 1HBMB 1MN9A 1RWKB 1S6PA 2CJYB 2O01C 3DOKB 1RHJB 1ZOTA 4DV7J 3FBBA 3I9ZA 2JLFA 3RRGA 3EM1A 4V19J 1W2BR 1J2VA 3BH6B 2J0SD 5AJ3J 5I4MA 3RRHA 4ZIWA 3ZZUA 1E6VB 3W2VB 1YHQS 2DR8A 2FYXA 2OD4A 2R42A 4LBIA 3K89A 3S01A 4OI2A 4DV6J 4DF4A 3MM5B 5E3AA 1LW0A 1OJ4A 2Z0GA 2E1MC 4TU8A 3SYZA 5GMDA 1CULA 1S9EB 1C1CB 1FWPA 1B0TA 2BE7D 2DCUB 3OD2A 4OJ1A 1X4CA 1E6VA 4CRJA 3KLGB 3KMSA 2AGQA 1FTCA 1S1VA 5D4LA 3MFHA 3PXGa 3GU0A 3TA1A 1EHWA 1HBUA 1WG5A 4A8XA 4RNOA 2W9BB 2DHSA 3W62A 2J7KA 3M8RA 1YRTA 1SI9A 2HFOA 3GR1A 5KFYA 3QIPA 4DV0J 2MKSA 3SIPB 4F36A 3HKZD 4NLSA 2CG8A 3AB2B 4J9QA 4GKKJ 1HW8A 4DX5A 1FESA 1HBUB 1XR5A 1NLKL 3M8QA 2QLWA 3LP1A 4TQRA 2GHVC 3MM8A 3I5BA 5CZVA 4GO7X 2X1GA 5J1NA 2EFVA 1VQYA 1JQGA 5F0UA 3EXYA 3OL8A 3GTYX 2EC0A 2Y8WA 1EB0A 3UN3A 2ZJRQ 3QJLA 3M6UA 3BKUA 2XMAA 4RW6B 4OYBA 1KDNA 3H59A 3D7SB 4HHUA 1V6HA 3LTOA 5IC4B 3TAMA 4GC6A 3HLUA 2ZKUA 3R5AA 4AL7A 4QU7A 3N6NA 1RU2A 3LQVA 1A9NB 1A6LA 3DOKA 2IRUA 5F8GA 3Q8SB 2IYIA 3RAXA 5KT5A 4P9SA 3VR1A 3W3SA 1RT6B 5BYQA 2IA0A 3G71S 4ID8A 2XS2A 4N7TA 3MPYA 1TL3B 2CG4A 2JZ5A 3AOCA 1KC8T 4ILLA 2FJWA 2YPZA 3N0VA 2GIQA 2EBEA 3T1HJ 1N6QB 2IRXA 1RBOB 4DLGA 4WP9A 2ASJA 1WF2A 1F6TA 2MKKA 2EWHA 3W9HA 1C1CA 2XG8A 5AXKA 1KFSA 5A8KA 3KLGA 1T11A 1YJ7A 4BDPA 3ZZOA 1VQLS 4OZ5A 4UZBA 2R2UA 4Y2MA 1UEVA 2HHQA 3ZNUA 4UW2A 1APSA 1HQEA 2EG2A 1I5OB 2AEMA 4K59A 4LSNB 3D0GE 1AXQA 3H2UB 1SKRA 2JDJA 2XO7A 1NSAA 1RI7A 2HG4A 3CC2S 4EZ9A 1X9WA 4GVLA 4RWXA 4ED7A 2DY9A 3I82A 1LK5A 3J80U 1LOUA 3PIOQ 1T8EA 4OHZA 2HQ3A 3IR7B 2AGPA 2MQPA 3TI0A 3W5XA 5GAGU 1N5TA 4ZVFA 4YDDB 1MROB 3NGRA 4WU3A 2ILZA 3DLLQ 2AJ0A 4NZ7A 2MQMA 3MTKA 2G1HA 3HHEA 3VAKA 4O3RA 3UCGA 4DN9A 1H7WA 3IFEA 3IM8A 1IBMJ 3PEHA 2W24A 1RWMB 3PKYA 4MFBB 4LSLB 2RRBA 1RTIA 2H5JB 1XWLA 1VBZA 3KJNB 2VG5A 4MKVA 3U1NA 1JNZB 2ZBRA 2KB2A 3Q8RB 1MSWD 3MUTP 2CZ9A 5B0DA 3HFKA 1R8HA 1SC3B 1O0PA 1SXLA 4EBDA 1K0VA 1MWZA 2KJVA 3P45B 4I64A 5KG3A 1XMOF 3C46A 2VIHA 3CDUA 4I7FA 1N36J 4JI7F 1IBCB 4QIGA 3UO0A 2DO4A 3R7NB 3R6GB 4WPAA 3PW4A 3TVKA 2BKOA 4LF8J 3NWRA 3CD6S 3ET6A 1VGYA 2MY8A 3WDOA 3W65A 1LFPA 3U1MA 4DOZA 4WXOA 4PAAA 4DG1A 2CQPA 2QC3A 1T9TA 4RW7A 2ZHBA 3MXHP 3HHKA 4U8YA 3D0IE 1B7FA 4OYAA 3MF5A 4P71A 1DJ0A 2IJFA 3AJ1A 4DR3F 3NGDA 4USHA 1SV5A 1QJHA 4DJBA 1YITS 1UJ5A 2FD2A 2YBVA 3RBXA 3V6KA 1S76D 2HSEB 1Z4UA 2LA6A 4I4BA 4C3MA 1RTJB 4QWEA 4QWBA 5LL6d 5F0WA 3PJXA 1N5SA 2UXBF 5KFLA 2DHAA 1VISA 1A7GE 1LFWA 1TUVA 1KEKA 4IOBA 4GC7A 5D8HB 3IRXB 2IYGA 4GRSA 3HJVA 5KTQA 3QIDA 2EI5A 3KYLA 2YX1A 4K4VA 2MZTA 2U1AA 1HFEL 2GAGC 3I5CA 5ADZA 2MY7A 2PO4A 3L3CA 4OHYA 4FYDA 2HLUA 2LLZA 2OPQB 3D9BA 4FN5A 5GAHU 2AD9A 3J7A1 1H0HB 1VHIA 3H40A 1HYSB 4LF8F 4LFAJ 2JLGA 3K58A 4JP8A 4B3MF 2FJVA 3FMWA 3LP0A 4PXEA 4Z7YA 5M2PA 3C6UB 4FXVA 4O0NA 3KG4A 1UVIA 2UU9J 3PW2A 1Y5NB 4URQU 1RT1B 4J91A 4KSEB 2J7WA 1B70B 1XR6A 4LF2A 3TX8A 3DRSB 3RW7A 1PO6A 4EMDA 3NS5A 4M5JA 1U1MA 1EARA 4LIRA 4CNZA 3J7YU 4DBQA 1S4FA 2A1BA 2LDYA 2CNKB 1RHRB 4DUTA 4ZLJA 1AFIA 2JWNA 3PTWA 3KDNA 4I6YA 4NLRA 4C0BA 3Q24A 2DO0A 1UCNA 2LEPA 3G86A 4TLQA 4IG3B 3T9NA 5C2CA 5GMKa 3PYDA 5HJYA 1N34F 2QEXS 1DURA 1U2RA 2G0IA 3I0SA 3W7BA 2MGZB 3KK2A 3THVA 4MIAA 2XB2D 1R3NA 4NZ0A 5SZTA 3FSXA 2GX8A 3MMBA 2VL1A 1TL7B 3AB4B 2WW4A 3VZIA 2HAIA 3W8PA 2XGQA 1JLEA 4LFCJ 4P2MA 2DD8S 2XWYA 4LF1A 2XY7A 4ILMA 3RBDA 2GC8A 4NA2A 3KNAA 1UW4A 2GQ2A 3OR1B 2NXUA 2FHKA 3G82B 4OYOA 4OYZA 3VF0B 2IVFB 1CG2A 2AMCB 2FVSA 2DGVA 2LXUA 2E7XA 1SC1B 1TL5A 4JI1J 5DS7A 1N0UA 4N8OA 3SMZA 2QE5A 5IWAJ 1CJUB 5DG7A 1YJNS 1X9SA 2CPXA 2CPJA 2VBWA 4PG6A 4DL0C 1Z2ZA 1PSDA 5T41A 4JUZA 4BHQA 4K0KF 4ZHRB 5ETSA 4LT6A 4BS2A 1IBLJ 1D9FA 1Q78A 2QTWA 3DGPA 4BCAA 4OX9F 2UVUA 3PM9A 3MDFA 4Z37A 1FA0A 1NSQA 3UI3A 8RUCA 5HROB 2QL5B 2E5IA 1FDBA 4ZA1A 1AROP 2EEYA 5D77A 1Y3JA 4A8KA 1YIJS 2CADA 2UV8A 3UCZP 2IM2A 3C6TB 2JEIA 2PE8A 5CYMA 2CPFA 1M1HA 5LXRA 5IS2A 2VPZB 1QUPA 2FHOB 2JEJA 4I56A 4LRDA 2LU2A 5KFFA 1QUVA 4M95A 1BQNA 2Q43A 3R8YA 1S7HA 2H54B 3R1HA 2KM8B 2XMKA 2ZD1B 2K7KA 1RWOB 4K4YA 4JOUA 2CQDA 5AXMA 2HLTA 5IQQA 2DH9A 2CUYA 2ZBPA 2VH7A 3NAIA 1NMEB 1MU2A 4DFMA 1T3NA 2R7TA 3I96A 5HMZA 1MLAA 3UDEA 1R89A 4U7UD 1RBLA 5B08A 1RISA 1DRZA 1WF0A 2OFHX 1YI2S 2GZOA 3AD7C 1TKZA 4X64F 4ZPBA 1ZTWA 3BDPA 1NK8A 3O8WA 1YBAA 3VAGA 1EP4A 4ANDA 1IKWA 3RR8A 4WFZA 5HQMA 4DUYJ 1KP6A 4F7VA 2UVVA 1IBKF 4WKRA 3H5YA 1NPKA 3D4JA 3JSMB 1SVDA 4H4MA 2RF2A 1H72C 1RHKB 1RWUA 2BABA 2EK1A 4F4YA 3A1YG 2AWZA 3D1HA 3IRXA 4CM0A 3CMQA 1CJKA 1VRTA 2YNGA 3LH2S 5C7PA 3MR7A 4P75A 2ZOMA 3IAS9 3U27A 3IP0A 4IQMA 5B0FA 3M9MB 3J80Y 4NRTA 2GMJA 5J2NA 4ZN3A 4U96A 2B9EA 2Y1LB 1KVJA 1U8SA 5GMEA 2DXEA 3VVUA 2KHDA 1XK8A 3L7PA 5IC6B 4ZP9A 1S1UA 2CDRB 1P1TA 2LECA 3QSIA 3CJKA 2XYHB 1IKVB 2HHPA 3WX8A 1LK7A 2XLIA 3GQCA 3PX4A 5KOWA 1Q8BA 3CCVS 1TKTA 3W2WA 2XWXA 4OV6A 2VFSA 3KLIA 4G6VB 1W2IA 3QGGA 5L1KA 2QLJB 1Q53A 5THWA 3JSRA 4IFVA 1TUWA 3FQLA 2BE9B 2QGFB 1EKSA 1YBTA 4ZVHA 1D09B 4KB7A 5F41A 5DG9A 2NXNA 3IBCB 4LF6J 2FVCA 1RAOA 1IKYB 2QMXA 4Y2AA 3LGNA 3UDCA 3NNAA 4DMZA 2W2MP 4DUZJ 2FLNA 4J9UE 1UWBB 1V3RA 1WC3A 2RU3A 3OV7A 3QFWA 4DPOA 2I5JA 2AYBA 3VGUA 4OX6A 2BJ8A 4R5PA 1EQ0A 2V63A 4W98A 5KFXA 3G96A 5KFAA 3C16A 3NL0A 2DNOA 2O5DA 3HD2A 1Y4ZB 4NXNJ 1YRUA 4HT5A 5A8WB 1C1BA 4ETXA 5A0YA 4DFKA 3T1YJ 4KTQA 4LFBJ 2GQQA 2AF6A 3GJRB 1TVRA 2M9KA 2VU5A 4WFXA 1IBMF 2E9TA 4RUHA 3SFGA 1DHMA 3TW0A 1OYEA 1DAXA 7AT1B 2KG0A 1B0PA 5DJBA 3HF5A 2H4WB 4BLGA 1FWKA 5CZXA 4OZNA 1P27B 1VIOA 5KOXA 3H7HB 3ZFVA 4B9TA 2HZVA 4LMZA 3KDOA 3CCES 2KKHA 1WKJA 3NGUA 3A8JA 5I3UB 5H9EJ 2FVQA 3NCRA 2VICA 2Y1IA 2E29A 3AOBA 4DR7J 3M8QB 4LFBF 5U47A 4OYXA 4U67Q 2O66A 4IOAQ 4LRCA 3BYPA 2AT1B 1OPZA 3OR2B 1R27B 4B17A 3U1LA 3FRYA 1LQ9A 3OVAA 1ZH5A 5BXIA 3VWSA 2XZTB 4K4SA 5KFGA 2D1CA 3KLIB 4NPOA 1HQUB 2BR0A 3D1QA 2OPPA 1R31A 2V8PA 2Q3PA 1CS4A 3JS9A 5AE2A 2Y8YA 3HHNB 4QPTA 1FD8A 4LRBA 3T1YF 3LAMA 1Q1KA 2BJ9A 3PW0A 2M8HA 4I7FB 3TAMB 1PKUA 2DITA 4QR1A 3CCLS 2DGTA 2ZZTA 3UNYA 2DEIA 3TZYA 1NK0A 2ZH7A 3FK4A 5KG5A 2IAJB 4JI4F 4IG0B 4J9PA 1RWNB 1P6TA 2B0GA 2KVQE 3B4DA 3M9OB 1UA0A 3BF4A 2DT9A 3HSDA 3Q23A 3BSNA 1WSVA 1S6QA 3QJJA 2RDJA 3B78A 1WWHA 4DL2A 1X4EA 4C8OA 1N0VC 3MEDB 4HH0A 3G6YA 3QGIA 4EUVA 2LYVA 2LFVA 4K50A 1NK5A 1C0UB 2W8LA 3M8PB 2DNNA 2M52A 3H2LA 1R6VA 4UOHA 4W92B 1HBNA 6FD1A 4MK7A 3I5AA 4ZVGA 4F2RA 2QLFB 3MZIA 2JX2A 4YR0A 2HBQB 4AUKA 2E7WA 1IKXA 1U25A 1IXKA 4K4WA 1LXNA 2W4PA 1WHWA 3BSCA 2DBBA 5A8RB 4B3TJ 2CQIA 1S1UB 2FJBB 2B4PA 3D3CJ 1X4AA 2GNKA 4P2XA 4WE1B 1FJEB 4LF9F 4K4TA 2LQJA 1ELOA 4KC5A 1REVB 3EGNA 4J9VA 5D4OA 2V8DA 3R1LA 1F0XA 5JXSA 1HNVB 4U9RA 2ZH4A 2UUAF 2JHEA 3KK3B 2CQHA 2FHMA 5L1JA 3L7UA 3E01A 5G0RB 2YNFA 5ETTA 1X5PA 3BPSP 2YTCA 1DY3A 4HTJA 1XERA 3TJAA 3PX6A 4JV5F 5DRKA 4LFCF 2OMOA 4OX8A 2R8KA 3RW6A 1T9UA 2KYZA 4BWMA 3A3NB 3JTPA 2BZ2A 4DLEA 3AJ2A 1RT6A 2DB1A 5KFIA 2JVOA 2IVMA 3M8ZA 2VG5B 4QZVB 1OY9A 3TOQA 3I87A 3KHHA 2MXYA 4PQAA 4HHHA 2IM3A 2HVHA 3HHDA 1RJJA 2E1AA 4FYYB 2F3JA 2WOMB 1IBLF 1W7WA 2KDOA 4LRAA 3BQ0A 1Y7PA 1JJHA 2O67A 3PCOB 3UCUP 1T02A 2VG7A 3IR5B 1DLOA 2C2NA 1JLEB 2QT7A 1UVLA 3FC9A 3HM9A 2K3IA 4YOEA 4P2SA 3EMTA 4CTAA 2EXUA 4MT1A 1GMWD 1NK6A 2HIQA 2R7RA 3LF0A 3DLGA 3Q2TC 2F4VJ 1WHXA 1B4SA 3IWLA 3ENVA 4WYLA 2C2EA 4I0WA 2LQ5A 2V67A 2W25A 1UKUA 1I3OB 2PEBA 4DX7A 4NLTA 2YH1A 1ZTTA 1VC5A 4RBUA 2XMJA 2OFGX 2P2CB 2VQEF 1HNZF 4JV5J 1ZBTA 2OSQA 4MIBA 2OIHA 2DYAA 1VC0A 1K73T 2XZDB 3DGPB 3L09A 1SL1A 1RWXB 4OV1A 2UVWA 1GQEA 2I1RA 5K14A 1N5YA 2JLEA 3CIZA 2WSCC 1XBWA 3OHAA 3HVRA 1C4AA 1K44A 4LR8A 1CJTB 1FDAA 5EWEA 1NDLA 2YWKA 3BB5A 3CB4A 3S1TA 4C97A 4B3SJ 4QU6A 1Q16B 3NGTA 1WJ9A 4ZVSB 2ZOGA 3NP5A 5KFUA 2UXDF 3EICA 3M30B 2DHHA 3PFOA 3MCSA 2DHGA 1FJGF 2MPUA 4OYWA 1VBYA 3DHWC 1VQ7S 2OPQA 1W26A 3M6VA 2V68A 2UVRA 5C2GA 2ILYA 1RWPB 5KFMA 1F2HA 3KHRA 1NJXA 3T3FA 1FRMA 2XBPA 4FKXA 4L6V3 1F3VA 4ZVEA 3GSIA 4FDFA 5K8OA 5HLFB 4ZCMA 1IKYA 1UFWA 1WI6A 2NXEA 2E5LF 4MK8A 5HJXA 2FLLA 3OTBA 4DPYA 2R7OA 3J81Y 3TUJC 5IT9Y 3MM5A 2HNYB 1JJ4A 4AFFA 3BEGB 3GLJA 4YS2A 2CPYA 3DLBA 1ZAWA 4PRFA 2KFZA 5HATA 1BGXT 1UJ6A 2RQ4A 4DQSA 2WVBA 2NR0A 1WDDA 2PI5A 4NI2A 2GVZA 2UUCF 1YJWS 3OHBA 1R8AA 1I94J 2CAJA 5AXLA 4FNIA 1WD6A 3TNVA 5K8NA 4NLPA 2IMOA 2RF2B 3RBEA 1N48A 4J7CA 5A8WA 1HMVA 1X0PA 3FBEA 3MWBA 5AE1A 3ETOA 4AT1B 3NOGA 4OZ2A 1NH8A 3U02A 5DLFA 2UXDJ 1PJ6A 1Y5IB 1ZA2B 1WORA 2PEHA 2CQ2A 2VPXB 3PYEA 4HT7A 4J90A 4OZ3A 1DQ9A 4WF9Q 5HBMA 3KXDA 3H42A 3S8SA 2C3YA 4CH1A 1RXOB 1URNA 1JLQA 3IAM9 2X3DA 3MCOA 2MKIA 2ZE2A 2CQBA 2ZH1A 1LV5A 5KT2A 2LVWA 3P6YC 2C1EB 1L3VA 5DDOC 4QYZK 3NWGA 1AUSL 4B9VA 5FLXY 3CUNA 1NJIT 2K06A 2L9WA 1X5SA 4I68A 4CLSA 4U6PA 2YNFB 2AW0A 4AXJA 1FRIA 2V50A 3CMAS 3C2PA 1OPIA 3M05A 4F25A 2ZZMA 1LWFA 3MHYA 3HSGA 1T95A 4GVBA 1HWKA 4CZCA 2LMIA 3RZAA 2E5LJ 1HBOB 1VQSA 2DNRA 2KRRA 2Z30B 3GFZA 3HHLC 3MAAA 5DLGA 2AX0A 5E3RA 4B3MJ 4K5RA 2YKMA 3UWTA 4DU7A 3Q22A 4KFBB 4WU2A 6AT1B 1X4HA 4DV1F 4DSIA 1TFWA 1RT2A 3LALA 4YB6A 3TZWA 1KFDA 1D8YA 5A6WA 4JI3J 4KHPJ 3OFFA 2L41A 2OPPB 3QWPA 4CT8A 2UUBJ 1FVQA 2QLXA 2HNZA 2LKZA 2YKMB 3RAMA 2OGUA 2OEJA 2RE1A 1LW0B 4ZP7A 1QAJA 3M8WA 1X9MA 3PR4A 4YDXA 1X5OA 3N6MA 1M5OC 1GK8A 1VQKS 1TP7A 4O3QA 2VQFF 1BQNB 4I6WA 5F9NA 1OQ6A 2DTJA 3OSPA 3F44A 4C3LA 3PHTA 3R2DJ 3KK1A 4G65A 2RNEA 2WTFA 1JLFB 2DCLA 5EUHA 1Y11A 3GJQB 3P8BB 4I2PA 2IMWP 1HKAA 5KFCA 2C2MB 2QMWA 1RK8A 2MKYA 2GQCA 4OZJA 3VAJA 3TEHB 2EK6A 2B9WA 4X4PA 4J9RA 3TQEA 5EGYA 5J2QB 3FBFA 2FC9A 3CCJS 2RB7A 3C3LA 1U24A 1X4BA 3ITHB 3UNGC 3VHQA 3W64A 3CCRS 1X4DA 1FJ7A 2J0QD 3BKFA 2N3OA 1YZ6A 3SEOA 5F8HA 2CPHA 4DSKA 2PC6A 4O3PA 3RU0A 3GPAA 3N79A 2ZE2B 4K0KJ 1G7CB 3AA8A 3ZZTA 4Q0BB 2UUBF 3OUYB 4FXWA 2MSTA 1X60A 2MHEA 2Y1RI 3ISZA 1WOOA 4M5DA 3OR2A 5CHCB 3BZQA 4X62F 5KG4A 4F0KA 4RNMA 1Q5VA 2FGCA 2BUNA 1DTQA 4L3NA 3MTJA 3IGVA 1ZM4A 4ELVA 4N41A 2W2OP 4O23A 4PUOB 4I67A 1L3TA 1QSYA 1CS4B 2ZOFA 3J7YI 2NUUG 4USVA 3CJQA 1RGVA 4DL5A 3G8QA 3E01B 4KFBA 2DGWA 4D3GA 1FNOA 2Z56B 1XNRF 1HR0J 1SKUB 2V6AA 1KOOA 4A47A 1UMJA 2B4VA 2CJAA 5J2PA 5KFBA 3UD3P 1IR1A 1VIXA 2DIUA 4M5DB 3TAQA 4N76A 4HKQA 1RT3A 3D5MA 4RW9B 3UDLA 2DRDA 1ULRA 3FFIB 2HKEA 3M8SA 2AQ4A 3LWLA 3EX7B 3FUYA 1XMOJ 2EFGA 4NLWA 1E6YA 2XS5A 5EN1A 3MEGB 2IDEA 4B3RF 1S6QB 2VASA 2NXJA 4LQ9A 4CLLA 3T5JA 1UEUA 4FYXB 4O4GA 2I8EA 1KNZA 1R0BG 1RKIA 5LM7E 3TZZA 4X64J 1FXRA 4WXWA 5IOLA 5L1LA 5ETNA 2DNKA 2JFKA 4Q44A 3J7Z5 1MW7A 2ZJQQ 2UUAJ 1CEZA 1HNXF 3MCMA 3M8PA 3NEKA 1JXLA 4ZJOA 1U02A 2R7VA 5A6PA 2BJ1A 3R3TA 3BBCA 1FKAF 2DGSA 4JI6F 4QYZJ 2V69A 8ATCB 1IN0A 1XR7A 2DGQA 1QSSA 1PBUA 3GR0A 1TV6A 4QIWD 1KLNA 2G1DA 1LWXA 1QVGR 2CDQA 1PC4A 4K2XA 2AZ1A 4PG8A 5E0OA 2Z2MA 1TELA 4FYWB 2XI2A 1U1KA 2J6SA 4PG7A 4U7CA 1JLBA 3VAMA 5IQ6A 1YLXA 2ZITA 3R7BB 3OQ2A 1REVA 3Q8YA 4CO4A 3KHGA 1TTHB 1UAWA 2EFOA 1V5VA 2W01A 4MYTA 1LWCA 3DDNA 1Z2LA 4NCGA 4P74A 5L46A 2N4DA 2ZH5A 3B8HA 3BN7A 2RRAA 1AYEA 2BQUA 2E1CA 2DRBA 2Q79A 3HI9A 5ETVA 4YHHJ 5F9LA 4ED0A 5A2QU 1TR0A 2K7JA 4EEYA 3L4BC 1Q8LA 5F8LA 1DQ8A 2KT5A 1H2VZ 2RHSB 2OI2A 3D1OA 2YKAA 1DARA 3L7OA 4J37A 3KLFB 3MUVP 1YTYA 2DPIA 1K0TA 3GE9A 5K20B 5FLXU 2W9CB 3K5LA 3I56S 2C2RA 1VBKA 3T1AA 3QT7A 3ZC4A 4QQBA 4DV5F 2IBKA 1NKCA 1HYSA 3QBCA 5CQGA 3H5XA 2XMMA 1QTNB 3M30A 2XY5A 3D0HE 1FNXH 1EX8A 2M4MA 3KLFA 2D9OA 3AAWB 3KLVA 3QAUA 3T6BA 4DV2J 4A8SA 2HFVA 2RQKA 4C4WA 3ETMA 3VQSA 1PBAA 1JB0C 2ZFHA 3SFUA 4KQZA 3K5NA 3QO9B 3SQOP 2JRSA 4DR4F 1HNZJ 3O44A 1CBKA 4Y65A 5RUBA 3KJVB 4PYDA 5DDPC 4AQYJ 3TAPA 2BE2B 3K0JA 1IKWB 1NDKA 1FKPB 2JOQA 2G9OA 3GCXP 5KFSA 4C0OC 5KFHA 2HYIB 4MJKA 4ELTA 4FZVA 4DZDA 1FK9B 3RJMB 4E0DA 1IWAA 3GP9A 4A8QA 3WC2A 3KJVA 1U6ZA 4IO1A 4H4OA 5DG8A 3DGVA 3H25A 3OTOJ 3HHLD 3FJ2A 3WZ0A 4JV1A 4DSJA 2HQIA 4O3OA 2CPEA 3QWUA 1TKDA 1HHTP 1M5PC 1IWGA 4NXMJ 1FT8A 1WKKA 4R0EA 4IOCQ 2OH2A 2DNZA 1SJQA 3EZUA 3K5MA 2RUSA 3BR8A 4ZK7M 2W7OA 3PRBA 4Q0BA 2CQCA 3QLHA 4NL5A 1SCJB 3UFCX 1KN6A 1VDHA 2E5HA 2GIRA 2ZEJA 2FY8A 3TWZA 3GIIA 1SL0A 1IQTA 2OD6A 4DV2F 5HMWA 2BJ3A 4WK3A 1DTQB 1UZDA 9ATCB 1GT8A 2I38A 4NCGB 5A2QY 2VHGA 4X4OA 3D6TB 3AQPA 4ZVOB 4DPXA 2ADCA 3BSAA 2WCXA 4E8UA 2HFZA 3ISNC 2CA9A 3CJRA 4KKOA 1Y9OA 4WFYA 1U0SA 2A2CA 1SJFA 1DZ5A 2HMIA 4LQ3A 2J6UA 4EYHB 3BKTA 1MG7A 3CGIA 2DR9A 1S7IA 2ASYA 2VF3A 1IUJA 3CCSS 1CVJA 4QWCA 1U4BA 2B9YA 3Q89A 5CYMB 3SI8A 1VQ6S 1V9OA 5G0RA 1ZAVA 3NS7B 2HHXA 2H5EA 2HMIB 3DLEA 4IYQA 1R0CB 1T03B 2BJDA 4TU9A 3KLEB 1L3SA 1LWEB 2CVIA 3I4HX 1U1QA 1HPZA 2BYCA 3KUGA 5F8JA 2XS7A 5D78A 1H98A 2HNZB 2RMLA 2WRMA 2YNIB 1SC6A 3PDNA 4CLTA 3MR2A 2C3OA 3T1HF 4PQUA 4HI2A 1ZZNA 4QCLA 4Q8FA 4PABA 5EX3A 1TVRB 5DGBA 3D67A 2VD3A 3FQKA 2WB4A 4JB8B 2RS2A 4ANEA 2ACMA 4WK1A 2YKQA 1JKHA 3KK1B 4G3IA 5C25A 3H5UA 4KYZA 4QJVA 5EDWA 3WBZA 1HQEB 2FJEB 4M5MA 2ROGA 3ET6B 3LP2A 3N5BA 1FFGB 3OR1A 5IXUA 1XMQJ 1Q81T 4NLGA 1Z1ZA 4ED3A 1RT5A 4JI2F 1REGX 4EGLA 1RYSA 4JI8J 4KPCA 2DRAA 1RHMB 4RX6A 2D3OR 2QN6B 5ETKA 3O6QA 1G3OA 1WOSA 5D0GA 2GFFA 2XHWA 3V6JA 4EZ6A 2XYPB 3ULHA 1RB0A 3R5CA 2CYYA 1T94A 2BJEA 3QLHB 3ZZ0A 1H73A 4N56A 3ENQA 4TN2A 5J1EB 3FSYA 1SKSA 2HVZA 4QIVA 1HNIB 1WOPA 2X51A 4ICLB 2KTQA 3N9UC 2V8HA 2HHTA 1S6UA 3IG1A 3C15B 3DXBA 4UF4A 5IM0B 2L9DA 1T0TV 3MM8B 4MFBA 2YH0A 3WIUA 2F8HA 1D1UA 1EIYB 4LIWA 1LW2A 2PN6A 3GIKA 1JX4A 2WVCA 2Y0BB 4ETZA 2HURA 3R5JB 1FX4A 2COLA 2Z57B 3D54A 3ICLA 1DQAA 2K2PA 3MM6A 2N82B 2D7SA 2MKHA 3K5OA 3NY0A 4IG0A 5DDRC 3HVTA 1VQ5S 1G2EA 2XI3A 2Z2YB 1NK7A 2F40A 3GG0A 4HR2A 3MR5A 2D74B 1GXUA 1FD2A 3M9NB 1U2CA 5D0HA 2BKPA 2EFNA 5HI7A 4I2QB 2UXBJ 4WZQA 3EYZA 5I3PA 4ITSA 1RAHB 2V4QA 4DQQA 2HQCA 3IGNA 1FNMA 4OZ1A 2JEGA 4CO5A 4PQUB 2VPWB 1HD0A 2J0WA 2G0CA 3JQJA 3PVXA 2V4JA 1VQ8S 1C0TB 3PW7A 2VG7B 4NRUA 5BYSA 1Q79A 2EG1A 5DO2A 1FX2A 4KGKA 2ADBA 3BGOP 3LAKA 3O2IA 1GAOA 3PRVA 2MJUA 1KQSR 5HL7Q 1Q8KA 4DV7F 3PO4A 4KY3A 1A0OB 1GXTA 3KJQB 3D66A 4NLUA 2AJ2A 1P9YA 2LXIA 3MAQA 1NXIA 2OPRA 5K8MA 3G8SA 1SPBP 3UD4P 4IDKB 4WBFA 4CNYA 4TY9A 2POKA 4H4KA 2G2OA 3IO1A 4XO0A 4WIQA 1JXVA 4DV3F 4CQ1A 3NNCA 1S4EA 3QNWB 2P5VA 1YJ9S 2FUG9 4RU9A 3SSSA 2V2VA 3IN5A 3L9ZA 2I9SA 3BO3A 3HT0A 2Z2LA 1FFSB 2D41A 2OO4A 1N52B 1TKTB 3W2WB 5B0BA 3RYLA 1S97A 3PW5A 2MLZA 3IG1B 5IM0A 4CO1A 2W7PA 1GMUA 1Q0NA 1HNXJ 3DYAB 4MAKA 1V3SA 2JSXA 4C8MA 3W66A 1K9MT 1CPZA 3KLEA 1T7PA 2UU9F 3W2VA 4PEOA 1VQOS 2A0FB 3UN5A 2BXJA 2HBZB 2E5JA 4ATNA 1KTVA 2AP6A 4Y3CA 2G2YA 3RTVA 2OAUA 1S1TA 3UN2A 1KD1T 3W8GA 3M32A 1RT2B 4CH7A 5AT1B 5ETQA 5HSPA 4LF5J 3HD1A 4KGZB 2HK3A 3DRRA 3LGMA 4OL8A 1OO0B 1WDTA 1WACA 1TK8A 2R2RA 4NXNF 1SH0A 1NNDA 2AZ3A 1HIYA 1TL1B 1VYAA 2ZD1A 4C8ZA 2HNYA 3I9V9 4JI4J 3HXMA 4LR9A 1S0OA 4OX9J 3I4PA 2R9LA 3MM7B 1WSRA 4XIUA 5CYQA 1QE1A 1SQEA 5J1PA 1NRKA 3VAHA 2MLYA 4S0MA 4USUA 5CD4H 1VBXA 1VQ9S 3H8YA 3BGLA 2BACA 1AZSB 2FGOA 1T9YA 2CQ4A 2OKQA 2V2KA 4KR0B 3Q8VA 4NA3A 4DL4A 2Z8QA 3SQGB 2G0JA 1LEOA 4GO5X 4NCBA 1KTQA 3G82A 1PC5A 4AYBD 4X66F 2NREA 4YP3A 4PWWA 3G6XA 4QIEA 3I6PA 3LA0A 4J9LA 2A2DA 1NM2A 3DOLB 4ECTA 1LNQA 1FF2A 1PILA 2PA3A 4MK9A 2AJ1A 2RIJA 4L73A 3NG8A 5GADU 3M2VB 1IJEB 2WBRA 4MMOA 1OWXA 3GONA 5KFDA 2R8HA 4U8VA 4LF5F 4WYWA 3DU6A 4TVAB 1RA7A 1GNKA 4YR3A 2G13A 2UZAA 2ASDA 2GCFA 4LSZB 5J2NB 1FRJA 2HQDA 4ZLPA 4F0HA 1HBOA 3EXCX 1VQPS 1HI1A 2MMYA 2DNGA 4Q7AA 2YWEA 4WIIA 2XCPA 2QA1A 5HQLA 1EKRA 1NEEA 3KNGA 1WC6A 4XK8C 3OTOF 1WHYA 3VALA 2WAQD 1QD1A 1XQIA 3M2UA 2AYEA 4HDHA 4R25A 5LOQA 1KSPA 2WHOA 1YJUA 4C3KA 2P6SA 1M1KT 3FCVA 1WC1A 3QQCD 1ZZFA 5KFQA 1WELA 4P2FA 5C5JA 2V5HG 2DNQA 2K1RA 3B4MA 1HWUA 3HSJA 3ILLA 4FP9A 2KYXA 2CQ3A 1Y00A 3DM2B 4PXCA 3DMJB 3LOUA 4LREA 5BJRA 4ED1A 4M5LA 3DRRB 2M3DA 4UOFA 1M1GA 5A8KB 3AA9A 2LQBA 2MHNA 1JLGA 1OY6A 1H7XA 1S1XA 1WEZA 1TQLA 2XMVA 1UWBA 2DNLA 3JQKA 3K8WA 4NA1A 3V81B 2EBGA 4I2PB 2D9PA 3FFIA 2CQGA 3HULA 1X31C 2QIFA 2RUGA 4HLBA 4J5OA 1TFYA 2GW8A 4GKJJ 1OIAA 4ED5A 1RAGB 2AJ4A 1H3DA 4ENOA 1W25A 3EGZA 3P5TL 4ZVTB 4B3OA 1HWJA 4IDKA 3HK2A 5JVGQ 3MMAB 4KH0B 5LT5A 2DGUA 4HACB 3SCJE 5L8RC 4NLDA 5HMXA 4Y0FA 2XCAA 2BM1A 4NYPA 5KFJA 3RBZA 1NHVA 1PYTA 4LF9J 4FS1A 3GYNA 3MPDA 3M7VA 1RSCA 2LDIA 4Y2IA 2QG9B 1U2FA 4ZPWR 1BQMB 3GMGA 2XGPA 3OW2R 1URRA 4RNFA 4JV0A 2WZ1A 4FKYA 4HACA 2KXFA 2B51A 4C2MA 5DDQC 4J9SA 2H1YA 2W2QP 5EHHA 2W2NP 1RP5A 4L72B 3FSIA 3KLHA 4QYRA 1ZS6A 4PPZA 5KFTA 4X65F 2DIVA 2F8MA 5ITHA 2E44A 2V9WA 1BQMA 2GO8A 3BH7B 5EWFA 2MZSA 1FHTA 2DY1A 5EX0A 1KRPA 1CJTA 4DR3J 2NUHA 3RR7A 3C15A 5I42B 3PIPQ 4ECRA 2OTJS 2RVJA 2M88A 3C14A 2R7XA 2VDHA 3LP0B 1EZZB 4LVOP 4DPWA 4ED4A 1JLAA 4Q2MA 1G4CA 4UUWA 3CCQS 2Y1JA 3K5PA 4KRWA 2W9CA 3IWXA 1QM9A 4USJC 1ZETA 1OSCA 1B7YB 1FCAA 1X4GA 3S7RA 2ALZA 1GXLA 1TKXA 2E9RX 3LO3A 4WCEQ 2ZVSA 3H4BA 4KT0C 1TMMA 2NPIA 4NX9A 2GO9A 3US5A 4CLKA 4X4QA 1NK4A 4B9MA 2BRKA 1E6YB 2GA7A 5CYQB 4DEZA 2KFYA 5H9FK 3DLKB 2QFJA 2X7IA 3UE2A 4Y2CA 2HHHF 4JI5J 1QVFR 2VOOA 2B8PA 3A4TA 4EK2A 2VFRA 3JSYA 3PO5A 2JFDA 1V5IB 2ZZNA 2R8GA 1S10A 5DM6Q 3LP2B 5KFEA 4P10A 1JJCB 1YX2A 4DSLA 4OI6A 3DLKA 4ZPCA 2BMBA 4J9KA 1F2GA 3PG9A 1VFJA 3GIJA 2QV6A 1X0FA 3KHLA 3F56A 4O44B 3P96A 2AJQA 1TAUA 2UXCJ 4LF4J 1RU1A 2AJFE 2ZVIA 1HHSA 4RWWA 1EQMA 2HS0A 3DXSX 2RDIA 2EFQA 4DX6A 4ZVRB 4ES2A 3TANA 5J1EA 3J81j 1S49A 5IT0A 2RSQA 5F8MA 2FHJD 4DR6J 5T14A 2ZH6A 2J7UA 3OJSA 3BBBA 2XMUA 1KQFB 2KJWA 2FZGB 3OT9A 4ZOSA 2F63A 3TQ1A 2BKNA 1FJGJ 2KO1A 3LGHA 4CO0A 5MLCV 3EPGA 4PG4A 2VODA 2JH3A 1BD6A 5KFNA 1X5TA 4M5IA 2KXHA 1CC8A 2RQMA 1RT7A 4KE5A 1VMBA 2JEFA 2NCKL 2PFDA 3C14B 2FIUA 4LSLA 1VQMS 1Q95G 1T05A 5E33A 3D68A 5HLFA 2D3ZA 4OI1A 1RWWB 2GS8A 3TYTA 4I2QA 5SUHA 3CXCR 2R2SA 2RHQB 1JLGB 2CZ4A 2ZHOA 3W9IA 4YY3F 4R8UA 1J5EJ 2YX7A 2D69A 3EVOA 4E2FB 1BLUA 5LJ5Y 3DLJA 1AB8A 4B9SA 3I32A 3EWGA 5ETPA 2R8IA 1F5CA 1HI0P 4ZN1A 1CQNA 4UUXA 3ENWA 2F7VA 3NMRA 3CEDA 3BV8A 3MEDA 2IC3B 4HEA9 4YB7A 5D4PA 3V4IA 1N4LA 4AL6A 2FJXA 1TV6B 1T3OA 2ZNZA 1O8BA 3BS9A 4H4OB 4DZ6A 1JMTA 1QAXA 2GGPA 2QL7B 2RD5C 4WP8A 3MM7A 4USMA 3FZ2A 1NCLA 2FDNA 4IFYB 2W9AA 4EO6A 3LANA 4RW7B 3MFIA 5B0GA 3Q8UA 4M5KA 4L74A 1M5HA 1MNEA 2GVDA 2WW8A 4L76A 1F9EB 4RW8B 3PRDA 4O44A 1NK9A 5JUMA 2W9BA 4PPDA 1VK3A 3GFYA 3THTA 1U1OA 1CJKB 3C19A 1QY7A 3JAMY 5E3PA 1NPRA 2RKIB 3AXMA 3T6JA 1U47A 2R7UA 3QFHA 1U6FA 4RBTA 4CIOA 4FYVB 1VC6A 1Q7YT 1L3UA 2AEJA 1KQGB 2C3UA 4X4SA 3CCWA 1WG4A 4O4RA 3BYRA 3QMQA 1FXLA 1CJVB 1I1GA 2HGNA 2J0XA 3MAAB 2CKWA 4DDFA 2ASLA 3NMAA 1SIZA 3G2XA 1FDDA 3AQOA 3UD5A 3M2RA 1RAFB 3GSDA 2FQQB 3MMCA 2PI4A 1RTIB 2C2OB 2OMLA 4DN0A 4QIFA 3M1VB 4KHPF 1UVNA 2MZJA 3S6EA 2HRYA 1RCXB 1MWQA 2H5IB 3PHEA 3BR9A 1S99A 3ZNJ1 1HWLA 1TKXB 2XNQA 3DI6A 5G4DA 3W5ZA 2WVDA 1JIHA 1RTZA 2V8VA 4PYAA 4RNNA 3RB0A 3KG1A 2ZNYA 2E1PA 2QSWA 3C6UA 3DC2A 3EGWB 3W63A 3WIVA 3Q8QB 3CJTA 3H20A 1LWEA 2V94A 2VBZA 4K5SA 4R8UB 1GH8A 4GKKF 3ZZZA 4EFAC 1ITPA 5KFRA 4X2BA 1GFWB 3EVWA 4OI3A 3SDEB 4KO0B 4CLZA 4EWTA 4X4VA 1MMNA 3EJMA 2KM8C 1QE1B 3E8OA 3Q2SC 2W2PP 3DKDA 5EWGA 1U1LA 4WZMA 2IHR1 3MPUB 2LEBA 2J8SA 1TAQA 3KMQA 3OL9A 1WKLA 3W1YC 2VBYA 3A12A 3D2WA 4ZVQB 3J81U 3GV7B 4B9UA 1H2TZ 2JVRA 3AD8C 4ZCIA 4IFYA 5LMNJ 2AU0A 3O5TB 2R7SA 3CDAA 4C7QA 1ICEB 4MIWA 1S5ZA 2G4BA 1QAIA 4DL6A 2MZRA 4ID5A 4C98A 2E66A 4DS5A 3E3XA 4NMLA 5T7LA 4WP3A 1D9DA 2XSJB 4I69A 5LSRA 1KVIA 5DQGA 3G6VA 1HBNB 2K8GA 5HP1B 2PMHA 1FRKA 2V2QA 2L48A 2YNHA 4ZPAA 3SXLA 1WHVA 2HBRB 1GEHA 2MQ8A 4OJGA 5HANA 2P8IA 3RGIA 4F04B 2CNNB 4F4AA 3NRBA 5T7LB 3UDVA 3F0NA 1KS2A 4NLXA 2CQ1A 1FTRA 2OPSB 5B7WA 2Z58B 1XNRJ 1N32J 3GJTB 3NNHA 1S0MA 3QRPA 1WTBA 1H38A 4GKJF 4AXIA 4DU8A 1TU0B 4ZDNA 4KV8B 1BMQB 3FNNA 3FMBA 4FS2A 2JC0A 2C28A 2MKJA 4TXSA 2FZKB 3ZTPA 3MM6B 1RAAB 7FDRA 1AA1B 3OXLA 5HVGA 3TO8A 2JC1A 2FZCB 4Q8EA 4URSA 3V6DA 4CYUB 4B3RJ 4K4XA 2BDPA 4OHVA 5J2MB 1S1XB 3K2YA 2W7AA 2KFNA 3M8YA 1WUUA 2WONB 3MR3A 4CLFA 1M90T 4DXLA 1CC7A 2HRTA 1R7IA 1HHQA 4ZVPB 1D8ZA 1S59A 1PYSB 4DPUA 1IM6A 2AEFA 1C2PA 2XQCA 1NBEB 2LXFA 2V4JB 4AQYF 5KT6A 1RCOB 3GZ7A 4WTYA 1TL7A 3GIRA 1ACMB 3MAHA 4OLOA 4RPFA 1NJYA 3TUPA 4O3SA 1HA1A 3QRRA 2HBYB 3OTEA 1AFJA 1Q82T 1OQ3A 2C42A 1KWMA 2MZQA 2VV5A 5CCMA 2YWHA 3CJ0A 4Y28C 3VGVA 3I31A 4P6QA 4DR1F 4PKDB 2N7CA 1JXEA 1HWIA 2M70A 4DV3J 2J9EA 2F5GA 5J2QA 1SB6A 4K8RA 5KFPA 1FVSA 2FC8A 2FJDB 5L9XA 4Y00A 2ROPA 3MD3A 3A8KA 2XSJA 1FFWB 1VLOA 3BPDA 3NXZA 4QR0A 1VRTB 2PMWA 3N5FA 4ER8A 4H4KC 2W8KA 4WE1A 3WX4A 4ED8A 1SJ3P 3DRXA 1N36F 3DU5A 4JI7J 4BWJA 2CFXA 4FPIA 4FF2A 2HHSA 2QZ8A 3BQ1A 1F1BB 4DV5J 1PJ5A 3AJDA 3DCAA 3FEYB 3ENAA 2VC1A 3DDIA 4DF8A 1HD1A 2PGCA 2MLXA 4I6AA 2MQLA 4Q2LA
chains in the Genus database with same CATH topology
2UUTA 1JLAB 4J9OA 4FF3A 3RAQA 2KH9A 2AYGA 4NCAA 2ZM6F 4F4KA 4DFJA 4LVNP 2HZCA 2I0XA 4OHXA 1N6QA 2DNYA 2EPIA 2WSEC 1G6BA 3V6DB 1T05B 4JYAF 4ZP6A 4IKAA 1FKPA 2BRLA 1VLYA 2UV8G 3QGPA 5J2PB 4FBUA 1RA6A 4TQSA 2V4RA 4F02A 3UR3C 2YKPA 4K4UA 2WONA 2HWIA 1M0SA 2XNRA 2I5JB 2QO3A 5K5MA 3I55S 2WOMA 3KG0A 4B9LA 5KFKA 2IC3A 4E98A 4H4MB 2VKRA 4J9MA 4HYKA 1YWXA 2VFTA 2CPDA 1FKOB 3UR0A 1NJWA 2RILA 3FZBA 4ECZA 2BQ3A 2A3JA 4ZS6A 1HR0F 1NO8A 5HP1A 1YSJA 3MMBB 4ECQA 3KFWX 4ALZA 4M8LA 3BO2A 3MEKA 2O1PA 1FERA 3BM7A 5CH7B 5FDLA 1X4FA 4JV2A 3MEEB 2CZVC 4OHWA 3N01A 4I1TA 2ROEA 3TA0A 3KK3A 1U6BA 4TYBA 2DNMA 2H9ZA 1HNIA 3SCIE 2E1RA 4A8WA 1TK0A 3VCDA 4F50A 4ZHRA 1XN9A 4X4RA 2CQ0A 3H2VE 3JYTA 4WFNQ 3POTB 1K1QA 2BANB 2F4VF 5C42A 4A4JA 4IH6A 1SJ1A 4DR2F 1F9FA 2VOPA 1J5EF 4UY8T 2FPHX 2K1RB 4CI0B 2J76E 4NYOA 3QZ8A 3OTDA 1F60B 2DGXA 4ECWA 1RTDA 3LPYA 1NKEA 3HHLB 3PX0A 4C8YA 1S9GB 1IQZA 3TR5A 1KOHA 4G1PA 3CDWA 4YHHF 3SDEA 4EBCA 4IG3A 4XDCA 5L9NA 3AH6A 2N4CA 2DJWA 3OVSA 3TVYA 2BBEA 5DGAA 4NYZA 1RTJA 4QWDA 3CCUS 4O3NA 1UFLA 1EETA 1S1WB 4B02A 1R43A 1D9AA 5D3GA 2XMWA 1HMVB 1F5AA 5H9FJ 5L38A 1QTMA 1QLNA 2E9ZA 4PWDA 4A8MP 3DNCA 2V8GA 3NGKA 3K7RA 1NB7A 2QA2A 1ZM2A 3NCPA 2NSBA 1EETB 1S1WA 3JSMA 5HBMB 5KFVA 1RT4A 4OZLA 4ECSA 5D3GB 1M5KC 2QYCA 5DETA 5FJ4A 3MGJA 3R5DA 2RS8A 3G4SS 3MOJB 3DFEA 2YWGA 4DQPA 4ECVA 2ZDOA 2YNGB 2NLWA 3H5SA 3FCHA 4IH7A 5F8IA 2R4FA 5M2UA 4UQGA 3OLAA 2A10A 2PD1A 4A8OA 3K59A 2VA2A 3M2UB 1YVFA 3IR6B 3PEJA 3VTIA 1RT1A 2A18A 3OL6A 4A48A 2HWHA 1KLMB 4F3QA 1RTHA 1IJFB 2EW9A 2XMTA 4A8FA 4G1QA 3PR5B 3DYAA 4AL5A 4KAIA 3F73A 2B9XA 3MOZA 2C2DA 2J9DA 2CVEA 3CD7A 2B56A 4NOHA 3J7ZT 1L5UA 1YGYA 3MM9B 3SCLE 3QO9A 3IC1A 4IH5A 6FDRA 2IM0A 4F8RA 4KO0A 3PY8A 3CC4S 4Q5VA 5E3CA 3VQTA 4ZMMA 4JI5F 3QZ7A 1N56A 1HPZB 4RW4A 1X8DA 2HFNA 3HDSA 1TL1A 2I2YA 2XZWA 1UVKA 1TKZB 4FVMA 2NYIA 4MH8A 2ZUGA 1OSDA 4RLEA 4Y34A 4RUAA 3MEGA 4ZPTR 3OJUA 5B0EA 1N32F 4NLOA 2NS1B 2VC0A 4Q45A 3Q0AA 3V4IB 4NLVA 1H2UX 2HVIA 1FE0A 2UXCF 4CTAB 3ITHA 3MURP 1FE4A 2VONA 3UW1A 1FEEA 3T5HA 1FJCA 2HRUA 3DHXA 3BSOA 4OZ0A 2ZBCA 5K9FA 2IA6A 4LF7F 4DV0F 1FDNA 2Q1LA 4LF6F 2HHUA 2YVSA 1VRUA 3LUYA 3IS9A 4OX7A 2MKCA 5GAHI 4ECXA 3LP1B 1CSJA 5DQIA 2QA4S 2IBOA 3D28A 3OBIA 5K14B 4IRDA 4O0IA 2HGLA 4MKAA 2B7CB 5KT7A 2B4OA 5HO4A 4N5SA 4KV8A 2J6TA 1QAYA 3QYYA 4ZP8A 4A46A 4PXBA 1KLMA 4BBYA 2Y0SD 1S9FA 3M6XA 3U7JA 1XEZA 4R0JA 2AX1A 2P9CA 4C11A 5LXYA 5AJ3F 5IFMA 2KG1A 1MU2B 3M1VA 1U45A 1MMLA 1Y0HA 1HQUA 3MM9A 3BGRB 4USIA 1SUQB 2YNIA 3PKMA 3HVTB 1Q86T 2DVIA 3CIMA 4X4NA 2VUGA 3HVAA 1U7LA 4OQJA 2W4CA 5F3TA 4NLQA 3V5RA 3H4DA 1JK9B 2ZH8A 4CT9A 3UQSA 3IRWP 1C4CA 5KG2A 1N88A 4U7UK 1S1VB 5KFWA 3CCZA 3EPIA 1UVMA 2HHVA 2X1AA 3CJ3A 1C1BB 5KG1A 3E2EA 4MKBA 5F3ZA 2K3KA 3MPVA 3NBPA 1C0TA 2VG6B 4ZPDA 3QIPB 2DHXA 3HPOA 2BQRA 1KHVA 2UP1A 1FKOA 2YKOA 3NKYA 3QGHA 4V19X 3BN4A 3TVZA 4QPXA 5KFZA 3BGFA 5L1IA 1VQNS 3OFGA 4ZCLA 4IR9A 5B09A 1N33F 3CJKB 3HJFA 4NXMF 3PJWA 1UL3A 4QOTA 1UA1A 5D4NA 1JLQB 4ICLA 5H1SV 1JJ2R 2RQCA 3OXGA 5HN0A 1LXJA 2ZDPA 4DSFA 3OFEA 2FY1A 2MQOA 1GX6A 4F4WA 2KN4A 3MR6A 3M6WA 2YWFA 4B9NA 4F3OA 3LWMA 1HNWF 1MWYA 2B3TB 3DRYA 3WC0A 1S72S 1WG1A 2B43A 1RT3B 4RW9A 4IUFA 3CCTA 4C9DA 2OP5A 1IR0A 4KKOB 2M7SA 3GYXB 3DMJA 5HQ8A 1WI8A 3BGRA 4JI1F 5KT4A 4ZCKA 5IWAF 2DPJA 2B6AA 3JTNA 2MYFA 2ZC4A 2GGPB 3I0SB 3GWCA 3B82A 1J5OB 3HHLA 1RKJA 2FVPA 2BM0A 1KQKA 4PCQA 3GB0A 3N4WA 3GV5B 3T5LA 3QJPA 2VKZG 3HO1A 2O3DA 2CJ9A 1FRLA 3HVWA 1PGZA 2E5GA 2B5JB 2YKNB 1J5OA 4IRKA 4ERDA 2OPRB 2XY5A 3KTQA 3MD1A 1FHTA 1SJRA 1YJVA 4F4XA 4H54A 2ZHAA 2NZ4A 3LW5C 1LWCB 2Q6BA 3TRGA 1OS5A 1NHUA 1R8PA 3PFEA 4MKYA 1ZM9A 1RT5B 3A8EA 4UOCA 3FDSA 4FF4A 3JTOA 4YR2A 1NAQA 1BQXA 1BY9A 5KG0A 2NSCA 3DRPB 1RT4B 4CH0S 3HT3A 2ZJPQ 2OJ3A 4KPYA 4LJMA 3CVKA 2HWTA 4OJ3A 1XMBA 4K4ZA 3NCQA 3L95X 3CJ2A 4QWAA 3K8VA 3V4MA 3JYTB 1XC9A 1CQMA 2BANA 1S48A 1R0AB 3DRPA 4FVCA 3SSQA 1N5YB 1AW0A 4DUYF 4HHJA 1UETA 3CPWR 4MYUA 1R8BA 1X7VA 1YQHA 2SXLA 3QAEA 3R27A 2ZH9A 1VQ4S 1RTHB 4ELUA 1R0AA 2KU7A 4D3HA 4YFUA 2MB0B 1FEHA 3GV8B 1LW2B 4PR6A 3P49B 1LKZA 1S9GA 1VK8A 2FVRA 3O3LA 5LMUF 1RYRA 4DV6F 1VHFA 2PSZA 3N28A 4X84A 2PA8D 4C8NA 4R5PB 1U26A 2KVIA 4IR1A 3CD0A 5GADI 2VZ9A 2MQQA 3VAFA 3V81A 4ID5B 2EKYA 2R8JA 4LF4F 2NPFA 3GG1A 1SJ4P 3BGUA 3NS6A 4TLRA 4QR2A 2NQPA 4RW8A 2DNHA 2LA4A 1VS3A 2KI2A 3IWNC 2RU9A 1DTTB 2IRYA 4EU0A 5MAOA 3AHPA 2RKIA 2IVYA 3ZZRA 2WSFC 2U2FA 1VRUB 1S6OA 4F3MA 3RB3A 2GHPA 4TYAA 1P1LA 5E2QA 2B7BB 2OTLS 1UVJA 3DDKA 3H98A 4LUBA 4RU2A 3PACA 4IFVB 4WKYA 1NZAA 3AY0A 5LSLA 5AE3A 3Q8PB 1Y3KA 1U49A 3DLEB 3BQ2A 1I94F 2P9EA 3CTRA 2XLKA 4WFBQ 2B6AB 2X1BA 3POTA 3V6HA 1WTFA 2R7QA 4TKTA 1VI7A 2FB0A 2R7WA 2KZZA 4NLYA 2EFPA 4W90B 2KT2A 4XDDA 4C8KA 2L08A 2RJZA 3PV8A 4O4GB 2C3MA 1Q7LB 4QW8A 1O5JA 1DFDA 2XSFA 4NZ6A 1RAJA 1S1TB 2HNDA 2ABYA 2LCWA 1FO1A 3IXQA 2WB1D 3M32B 4RNHA 3RRKA 7FD1A 3X1LB 2OSRA 3OSNA 2D3UA 4TU7A 4IRCA 2GMHA 1BWEA 4HL9A 2HS4A 4B08A 1FK9A 4B3OB 1S0VA 2BVZA 3CJ4A 3FRZA 3C66A 3MMAA 1NJZA 4XAKA 4AE5A 1C0UA 2XEXA 2VPYB 5HMYA 4KBIA 1UP1A 3G8TA 1R6YA 2CIMA 2JL9A 2Z4PA 4WFAQ 5I3UA 1IKXB 2IM1A 4ES3A 2GJ2A 2IFXA 3KLHB 2ZBIA 3GILA 3V2UC 3FGVA 3THPA 2V0NA 3CDBA 1FRXA 1S79A 1IM4A 1M5SA 2B4UA 2IJNA 5C24A 1NH7A 3ISND 1SH3A 2APOA 2DGOA 2LEAA 5E7OB 2F1FA 5KG7A 5GAGI 4YQWA 4Z2XA 2OPSA 4RUCA 3HZEA 3OVBA 1YJTA 2M5YA 3KKFA 3GFXA 4C0HA 4FNHA 3GFHA 4N8NA 2RRNA 5E3QA 3F41A 1TL4A 5AXNA 3GIMA 1HL6A 2DK2A 1SUQA 3CF5Q 4F4ZA 4F2SA 2M2BA 2R2TA 2P9GA 3BDEA 4RKUC 4OLPA 3CSKA 5KFOA 4OI0A 2XULA 5J2MA 2HS3A 3TP2A 3BJYA 4JI0F 1WEYA 1RDRA 2VBXA 2RH3A 1WNEA 2YY3A 4DQRA 4LSNA 3DM2A 3VZHA 3CD5A 4YB5A 1EP4B 4ED6A 2L3MA 4ED2A 5I3QA 2CJQA 2BW2A 2VG6A 5D6GA 3CE8A 2MSSA 5L39A 4HI1A 1UJ4A 2F8EX 1HW9A 3PNIA 5B0AA 2W4DA 3KK2B 5A0YB 4DWIA 3K57A 2B5JA 2YKNA 4PWUA 5BYRA 3UPFA 5LJ3Y 1B0VA 4C8LA 4KHMA 5JJBA 5FD1A 5F8NA 2P6TA 3CC7S 1VJWA 1LWFB 1M5VC 4TNOA 2PMZD 4OFZA 2AV5A 3ONQA 3OLBA 4DR6F 4M63A 3SV3A 3FVYA 3R5BA 1V3ZA 1YJRA 2F9JA 3MPWA 4MTPA 2BA9A 4F26A 5DQHA 2KXNB 1IKVA 4J9NA 3OXFA 1ZYQA 4IQXA 3IS9B 1XNQF 1WF1A 5C24B 4G1IA 4DR7F 1KHWA 1FRHA 3IBWA 4ES1A 1Q82T 1AUDA 4GMKA 4P7TA 3M2RB 4LFAF 1JLCB 1GTHA 1ZM3A 3VAIA 4A8YA 3CCMS 1Q4RA 2WBMA 2LQ9A 2M0GB 2N7YA 4DUZF 1SL2A 1NKBA 3HKWA 2HGMA 3C6TA 3NLCA 3SSRA 4DQIA 1JLFA 5GAEI 5KG6A 4HDGA 2HNDB 2GHWA 3MI7X 4TY8B 4RZRA 2Q6CA 5CA5A 1JLCA 1N54B 2FTRA 2X3GA 2N3LA 1S9EA 1ZPVA 4UQTA 3X3UA 1TL3A 4DL3A 2HHWA 3T19A 3OPKA 4RW4B 2KZMA 4KGMA 3N6LA 4BC7A 1N5VA 5C25B 3G6ES 3SQGA 4TY8A 4HTIA 2YQ3A 2KRBA 2PIIA 2VFUA 3TUIC 4EBEA 3OFHA 1TK5A 4QW9A 2QSFA 1H6KX 2KHCA 1F5BA 3C8YA 4DHVA 4ZPVR 2QRRA 3KOAA 2CPZA 2DH8A 3CMES 2MDAA 3OUYA 3T9ZA 3NBPB 2ERRA 4YMEA 2WK4A 3IA0A 3M2VA 1JNRB 3MMJA 2J8AA 3JSBA 4PXDA 2C3PA 4PUOA 4N77A 3SV4A 1DTTA 1ZAXA 1D3WA 2MQNA 3FEZA 4DL7A 3NAHA 4PG5A 4FBTA 1U1RA 1FXDA 3MMCB 4G1QB 4URGA 2YNHB 1TZ0A 5HROA 2J9DE 4N47A 4JBCA 2J9CA 4DFPA 4JI8F 2AYMA 4OIXA 2EVZA 3ZZPA 4DS4A 5I42A 3CULA 5K8PA 2UUWA 1XTZA 2RT3A 4C11B 5C42B 4ILRA 3HP6A 1P9QC 2Q66A 2V9KA 4HH1A 2BV3A 3CT9A 1WEXA 2GJIA 2DISA 3ZZYA 4ZKAA 4X4TA 4ECUA 1S77D 3BREA 1VOMA 2IAJA 3O1LA 3RB4A 4DSEA 3CO9A 3FEXB 3M4XA 4M94A 2J5AA 3MECA 4KHRA 1MMDA 2XLJA 1U09A 1YRXA 3MUMP 3SZ2A 1U1PA 3SCKE 1KONA 2VB6A 4DV4F 4YEAA 2ATLA 4IO9Q 2KT3A 4DX8H 2L9NA 3DOMA 1JLBB 2GV1A 4OJHA 2VFVA 5LMNF 1JKHB 2F9DA 4OI4A 1K1SA 1B64A 4JI3F 1SV5B 4XPCA 2FHJA 3MEEA 4B3TF 4PWDB 5A8RA 4YB1P 4DR5F 2PT0A 3DLGB 1HI8A 1SBRA 3DLHA 2DR7A 2MZ1A 4CO2A 2DH7A 3I0RA 3TARA 1O51A 4FPRA 2C22A 1BC6A 2CJKA 1MROA 3TA2A 5B0CA 1QSLA 1GX5A 2BOPA 5CYJA 1HNVA 3PZPA 2HPUA 2ZKTA 4WJBA 4Y6IA 3HMJG 4EO8A 3I0RB 4YUDA 4CCHA 4KIAA 2FLPA 1N5QA 2FJAB 4Q43A 4KJIA 3HX9A 2X1FA 4UY85 1RT7B 1HBMA 1S6PB 3E51A 2M8DB 4RW6A 4B3SF 2HW3A 4ECYA 3CJ5A 1Q8IA 1XMQF 3P3DA 2BE2A 1T03A 3GIKA 1GTEA 2DNPA 5M2RA 2CJBA 5E5NA 1SIWB 2MJNA 5GAEU 3QPIA 2MGZA 2QA4G 3DRSA 3RB6A 5IZHA 1U48A 1G1XA 3DI6B 4Y2KA 2YX4A 4XPEA 1ROFA 5IT4A 3BO4A 1I6JA 4FF1A 3MECB 2ZC3A 4DG1B 2ZH2A 2PDAA 3T5KA 1K8AT 5DM7Q 1DLOB 2FLOA 2CPIA 1RQ0A 3DN9A 5LSOA