5IWAF

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5iwaF00
4DV0F 3OTOF 4LF8F 4DR7F 4B3SF 1N33F 2HHHF 2YY3A 3ZZPA 1FJGF 1J5EF 2KJVA 4YHHF 1XNQF 4DV1F 1F60B 4OX9F 4DV2F 4GKJF 1QJHA 4NXMF 4DV5F 1RISA 4LFAF 4DV3F 1HNWF 4JI6F 2UXCF 4B3MF 1N34F 1IBMF 2UXDF 4JI3F 4LF6F 4LFBF 4JI1F 2B7BB 2KJWA 1IJEB 4X65F 5AJ3F 4X62F 1XNRF 3R3TA 4DR4F 2UUCF 4K0KF 2UUBF 1XMQF 4JI0F 4DV7F 4DUZF 4B3TF 4DR2F 1HNXF 2RJZA 4DUYF 2VQFF 2ZM6F 4DR1F 1IBLF 2B7CB 1FKAF 2BXJA 1XMOF 4JI8F 2UU9F 4LF9F 1B64A 1IJFB 4B3RF 4GKKF 1GH8A 4LF4F 4LF7F 2J5AA 1CQMA 3T1HF 1G1XA 3T1YF 4X64F 1N32F 2E5LF 4KHPF 4JI2F 4YY3F 4X66F 1HNZF 1LOUA 5IWAF 1CQNA 1G7CB 4LF5F 2VQEF 4DR5F 2F4VF 1IBKF 2UXBF 1I94F 4DV4F 4DV6F 2UUAF 4DR3F 4JV5F 4DR6F 4JYAF 4JI5F 4LFCF 1VMBA 4AQYF 1N36F 5LMUF 5BR8F 4JI4F 4NXNF 4JI7F 5LMNF 2BVZA 1HR0F
chains in the Genus database with same CATH superfamily
2CDQA 4K5RA 4H4MB 4U8YA 4DFPA 2MB0B 3Q2SC 4OZ2A 5DZ6A 2Q6BA 3TAQA 1DZ5A 1EX8A 4I68A 4FF3A 1OWXA 4C8KA 3TEGA 3KHLA 3GSDA 4JBCA 3PKMA 4IH5A 2FVPA 1BQNA 2G13A 2X1BA 5CYQA 5IC6B 1Q81T 5LSLA 2DIVA 1VQ4S 1TUGB 2D41A 2DNKA 2RB7A 1FJCA 1FD8A 2ZH9A 2V34A 2YKQA 2BDPA 3CTRA 3EYZA 4WP8A 2DRBA 4IOCQ 2V5HG 4RJVA 3ZTOA 5J1PA 1N5TA 3HFVA 3V6HA 3UCGA 1HD0A 4NOHA 3DDIA 2KZMA 4I64A 4KKOA 1L5UA 5FDLA 2J9CA 2B0GA 1VQ9S 3HXMA 3MM5A 2AJ0A 3MM8B 4DFKA 1UAWA 2WB4A 4E8UA 4RNOA 2WONA 2YBVA 1WOPA 2GW8A 4RX6A 3A8JA 1U1KA 3MMAB 3RBEA 3PHTA 4KH1B 1IKVB 4LFBJ 4MT1A 5HMYA 3D6HB 4ECYA 3VGUA 1RHRB 4WK1A 4DV7J 2UUCF 4EZ9A 3DU6A 4B3TJ 4LIWA 3DLKA 5DO2A 1KOHA 3JTNA 3I0SB 2XGQA 3P45B 4WF9Q 1HHQA 4OZNA 1QD1A 3C19A 3NGTA 2DIUA 2M0GB 2V50A 4UUWA 4Y3CA 4AD6A 4F4YA 4CT8A 3CCLS 1Y4ZB 3LGMA 3VGSA 5K8NA 2MZQA 1BQMA 5A2QY 2CNKB 3OUYA 1NDKA 1TUWA 4UQTA 1JJHA 2VONA 1U8SA 2BE7D 4QW9A 2VB6A 4BWMA 5KFOA 2CZ4A 2GO9A 4KQZA 2AJ4A 1X7VA 3CIZA 1YRTA 1S9EA 1PG5B 1WC0A 3FNNA 4DV3J 4O44B 3OL7A 3HJFA 1SC4B 4KJIA 3T5KA 3TQ1A 5D78A 4I0WA 4MKVA 3DOMA 1WC4A 7FDRA 5DG8A 1FRIA 2ILYA 3K2YA 3ZTRA 1OIAA 1S48A 3DLGB 2Q79A 4C7QA 3TZYA 3AOCA 4OJ3A 4ZJOA 1IWAA 2C2RA 1TL4A 2UU9J 4LF9J 3BGFA 3RAQA 2QFIA 2BANB 2LQJA 3LP1A 4YEAA 3N4WA 1SI9A 1D8YA 1PO6A 2AEJA 4EZ6A 4K4ZA 1YK9A 2IYGA 5FDLB 2UV8G 2EFQA 1H2UX 4RNHA 1EKSA 2BMBA 3FRZA 2W2NP 5U47A 1H7XA 5IS2A 1VK3A 3MR7A 4AQYJ 2CQ4A 4F7VA 4DPOA 4KPYA 2M8HA 3P5TL 4C4WA 2YWWA 2MQPA 4ZCMA 2D1CA 2ASDA 2F3JA 1XERA 1R43A 1B99A 4X65J 3W61A 1CEZA 2KO1A 3WDOA 4A8OA 2PC6A 4UY8T 3AOBA 1X4AA 3HVTA 2AV5A 1NAQA 4HTJA 4OYAA 1MN9A 1HQUB 2ZC4A 2MHEA 1HWJA 1MMNA 3LW5C 2KFZA 3TYTA 4WYWA 2OPQB 5C25A 1RAIB 1RYSA 4JI8F 5K20B 4YS2A 3OUYB 1UZHA 5KFTA 1U1OA 2GQQA 1JNZB 1VQ8S 1TV6B 1FKPA 3BQ1A 1X4DA 3D7SB 3RTVA 3LUYA 1R8BA 2BQRA 4DR5F 3Q8SB 3MM9B 2B4PA 2H5EA 4Y34A 1VQMS 2C3PA 1PYOB 5CQGA 5DQHA 3W7BA 3AH6A 1NZ8A 1WACA 4MAKA 1UEUA 1MWZA 4YR3A 1N33J 2VBZA 2Z56B 4DV0F 3KK3A 2HHXA 3HZEA 2ZDOA 1TKXA 1C0TA 3DOMB 4AXIA 4QQBA 5HQLA 1X5TA 3M9MB 3B82A 3CCRS 5DQGA 2CQ3A 4KGKA 3M6WA 4NRUA 2CJ9A 3H2VE 2QLFB 1U26A 1N52B 3SBMA 4GC7A 3J81j 1IJEB 1RAOA 4J9LA 4MJKA 1TQLA 1XMQJ 3HK2A 1R0AB 4OYBA 3BS9A 1NSQA 3I55S 5ETVA 3JSYA 3TUZC 4IFVA 4Q8FA 1UMJA 2ZBIA 1JXVA 4N7TA 3GR0A 1U0SA 4LF4J 5EWFA 4ICLA 1VJWA 1S7HA 2FJEB 3GMGA 4JI2F 2WVEA 3IAS9 4UT4A 3G2XA 3C8YA 1Y3JA 2A18A 3SZ2A 2FQQB 2PI4A 4FBUA 2R7XA 1NH8A 1FRJA 2R7UA 1U6ZA 5EN1A 1U1RA 2NLWA 3HJVA 1APSA 3TARA 2DY9A 1GMUA 4CDIA 1U09A 3ILOA 3QT6A 4M94A 1U0HB 1ZPVA 4IG0A 1VBKA 1T9TA 2NSCA 4B9SA 5CYMB 2M8DB 1NBEB 5C25B 2YNHB 3LGHA 1UKUA 5E7OB 2OPPA 2JNJA 2CKWA 2HHSA 3PNIA 2E1MC 4FVMA 2HFZA 5CA5A 3MPVA 2P6TA 4OZ5A 4KO0A 1N32J 4C0OC 4MKYA 1MG7A 4ZHRB 3CDBA 2E9RX 2DITA 3T41A 4B3RJ 1I94F 2RILA 4XAKA 4EEYA 3M8PA 2VPWB 1C0TB 1S1XA 4J9QA 1KTVA 5B0AA 1QE1B 3HP6A 3N6LA 3L7OA 1ROFA 3TJ9A 3VAFA 4QR0A 3M8QB 3H2UB 2DNGA 4I2PA 1SL2A 2JHEA 3H5UA 4NMLA 3CJ0A 5AXLA 4JV1A 2XBPA 2HZVA 3L4BC 4DEZA 3JSMA 3CSKA 2ZVSA 4MFBA 4M5KA 5ETMA 4F4KA 1IKXA 1F2HA 4OYIA 2IVFB 1ELOA 3C15B 2ZVIA 2H5JB 1NEEA 1XMBA 1PC4A 1SUQB 1JLGA 4GKKJ 2HPUA 1M5HA 3A8KA 2DNZA 2K3KA 4A8XA 2Z0GA 5HL7Q 1T02A 1RBLA 2DNLA 3CJRA 5IV3A 1UP1A 4NCBA 2A0FB 3MEGB 4HL9A 3ZZUA 1ZAWA 2VD3A 3VAKA 2FGOA 2AJ1A 3UWTA 3DLJA 1V3ZA 1AZSA 2J9DE 4IG0B 3G6ES 1TMMA 2HHHF 3NOCA 3N5FA 2X51A 4Q45A 3TUPA 3OVSA 3UDVA 1K0VA 2I38A 1ZPWX 4LR8A 3MMJA 4OZLA 4F0KA 2AEMA 4RNNA 4CT9A 2OPPB 2LXUA 3I5AA 2F63A 3W1YC 4PWWA 4UTGA 2XHWA 4EO8A 4KHMA 3WIUA 1R8CA 1S6QA 3CO0P 4H4KC 1C1CA 3NAIA 3ISNC 3DFEA 4KO0B 2DHHA 3BV8A 4IRDA 4A8FA 3QRQA 4ZN3A 1FESA 3BGOP 1AUDA 3MI7X 4UOGA 3JYTA 4MMOA 5H9FK 2DH8A 1OYDA 2DNPA 2GVZA 3I56S 4DL2A 4YP3A 3BGUA 4FYXB 4B08A 5KT3A 1C0UA 2WW8A 2G1HA 4I2PB 2CPZA 1HHSA 5T7LA 4PG5A 1C1BA 3C16B 2FTRA 2R8KA 3QQCD 2B3TB 4MIBA 1K8AT 3R7SB 3CCSS 3JSMB 3NCPA 4TY9A 1OYEA 1HBMA 2J6UA 3MAAB 2HMIB 3SMZA 4TN2A 2FY1A 1FWPA 1EARA 5J2MB 2QX0A 1ZBTA 5ITHA 1AB8A 2K1RA 4Q0BA 4DZDA 2W9AA 3BM7A 3AQOA 4USIA 2DNRA 1HNXF 3BREA 3SFUA 2W9CA 1T03A 1UEVA 1FRHA 4HEA9 2ZNZA 2CQGA 2GA7A 2SXLA 1RK8A 4DR4J 3H0PA 9RUBA 4ZPTR 5C24B 1TL3B 3MPUB 5C5JA 1HPZA 3CC4S 4CYUB 3SI8A 3CUNA 1IBCB 4DV4J 1FDBA 1Y9OA 2XQCA 1JLBA 3J7A1 4C3LA 3E3XA 4LFCF 3IG1B 1H7WA 3R2CJ 1QAXA 5K14A 1BE4A 3DNCA 2VV5A 3I87A 4HH0A 4LRCA 4L72B 3UDEA 3H42A 4DV1J 2V4RA 3PRDA 1T3NA 2HYIB 2GQ2A 5KFJA 4P2FA 3I5BA 4ZVEA 1M5OC 3E01A 1FEEA 5BYSA 4B9UA 1ICEB 8ATCB 3N0VA 3DM2A 5ETOA 4CO1A 4J9VA 3EZ5A 2J8SA 3KTQA 4WKYA 1KVIA 3FKBA 2OPSB 1VLOA 4DX7A 3VHQA 3HHEA 4AYBD 5T14A 3EXYA 4KV8A 2VQFF 2YPYA 2JLGA 2M5YA 1T05A 4HTIA 2Q6CA 5I3UA 1C0UB 3AJ2A 4EU0A 4EUVA 3PEJA 3T5JA 2RAQA 4M5NA 4BC9A 3E51A 3WIVA 3QJLA 3QRPA 4NLYA 1KS2A 2E66A 3B6BA 3G96A 2A2DA 1RWMB 3PFOA 3V81A 5CZVA 5A8KA 1D8ZA 1HBMB 2I5JA 3OTOJ 2E1AA 2AZ3A 1IQZA 4QIWD 1H38A 3LOUA 4Y0FA 2CQIA 1AYEA 1ZM2A 5ETTA 4DX8H 5GAHU 3OV7A 3IMQJ 3L7PA 2K1RB 1RKJA 3BZQA 3CWJA 1S97A 2UXCF 1S9FA 3GIJA 1N34F 4DS4A 5F9NA 1NPRA 4LF6F 3FQLA 3NGRA 3NMRA 3GV7B 2W9CB 5D3GA 2CPHA 4ZLLA 2YNGA 4K0KF 2UUBF 2MQOA 1RGVA 3F44A 4HR2A 2PDAA 3PW5A 1L3SA 1HARA 4M5HA 4J9OA 4DWIA 5J1NA 2KN4A 5IQ6A 1DLOB 3E2EA 1SKRA 1HPZB 1S0OA 1IKWB 4DQIA 1U6BA 3F73A 1SB6A 1JLBB 2LEPA 2DGVA 3P6YC 1NDCA 3ENWA 1GQEA 5A6WA 5J2QA 4NYPA 1U2RA 2C2OB 1VQLS 1BXNA 4R8UA 2G9OA 5JXSA 1X4CA 4PXBA 2VIHA 1U02A 1ZS6A 4I69A 3AA9A 4DI6A 3DM2B 4RW8A 4Y2AA 4QWBA 2XEXA 1H2TZ 3DLHA 5G0RB 1QLNA 1M1KT 5CHCB 1YRUA 4ITSA 4NCAA 5B0GA 1FK9A 2LEBA 3I9V9 4DFMA 4KV8B 2QZ8A 4WK3A 2HBYB 5GADI 1XNRJ 5L1JA 4MK7A 5AJ3F 5G4DA 2XCAA 3GJSB 4DL5A 1W2BR 1O8BA 1Q8KA 1N5VA 3NWRA 2JVRA 2OH2A 1V5IB 2WCXA 3W9HA 4QW8A 2BRKA 3NGSA 3J80Y 2MHNA 1HYSB 4KHPJ 2HLTA 3EVMA 4V19J 4TQRA 3V81B 2R2RA 1WTBA 2HFOA 3PV8A 3PIOQ 1E6YA 2F4VF 5JJBA 1FFSB 2V2VA 3RAXA 4LSNB 2XWXA 4F25A 4YR0A 2WSEC 4UQGA 3KHRA 5MLCV 3OFHA 1KHWA 4JI4F 1NLKL 2M7SA 2MZSA 3CC2S 4F67A 1HR0F 4YHHJ 4NLSA 5JVHQ 2EFGA 1TU0B 2GMJA 4OX9J 1WHVA 4DV5J 3AXKA 1S4EA 2X3GA 5ETNA 4TU8A 1X9WA 4Y00A 3W62A 1I3OB 4DJBA 1HQEA 1WKLA 3SXLA 3R5CA 3GV8B 3OR1A 5HJYA 2WOMA 2BQUA 4CLZA 3IXQA 1NKEA 4NWBA 3ONQA 2CJBA 2V8GA 2OJ3A 2XLIA 4DX5A 2FJWA 4LRDA 1FERA 4K4SA 2FJDB 1QM9A 2YQ3A 3JTOA 1EQMA 2K8GA 5F8IA 3K57A 3KLIA 3RZAA 3M8SA 1OMSA 4LREA 2CJYB 3HHLC 4YY3F 2XC9A 5ETLA 4GO7X 5DETA 1GX5A 3JTPA 1RT3A 4ZVOB 4L6V3 4ZMMA 1S57A 3RUBL 3N6NA 1JLCB 1S9GA 4RW8B 1AW0A 2PEHA 1J27A 1EETB 4CRJA 1L3UA 2R8IA 1VDHA 1UW9A 2K06A 3DLEB 1HWKA 2YTCA 3HSDA 2DO0A 4NLXA 4GKJJ 3QGPA 3FSIA 2W24A 4OFZA 2EVZA 5HROB 2GFFA 4LFAJ 2MQMA 1ZTWA 2CADA 2XLJA 2QTWA 1X5PA 1VRTB 4KT0C 5D77A 2B7BB 4DHVA 2YWKA 2CDRB 2JX2A 3HT0A 4QWDA 3R3TA 3TA2A 3Q22A 1FVSA 4X4RA 1FXRA 1JXLA 1VQ5S 1TKTA 1Q4RA 3RRGA 4A48A 3FEXB 4CNYA 5KFXA 1DQ8A 3M2VA 5KFPA 1RT6A 3L9ZA 2KM8C 3W8PA 3W5YA 3OJUA 3TA0A 2HK3A 1E6YB 2X1FA 2V8VA 4X64J 4DSLA 4FNIA 2MKSA 3PG9A 1FF2A 2CJXB 4OLPA 4Q5VA 5FIIA 3RRHA 3MEKA 4X4VA 4RW7B 1CS4A 3JXOA 1DQ9A 2RS8A 1YJUA 4ZPCA 2BM1A 2X7IA 4ZP8A 5KFDA 4O0IA 3O3LA 3Q89A 4WCEQ 4P74A 2AQ4A 3LPEA 5ADZA 5A8RA 2F1FA 4OZ1A 3EMTA 4C97A 4QIVA 4CM2A 5E2QA 4P9SA 4Q43A 1KHVA 1HQEB 4FDFA 3B4DA 3OR1B 1ZYQA 1HNWJ 2OLWA 2WOMB 2Y3YA 5J2NB 1KLMA 4ILMA 4LT6A 1LKZA 2I0XA 3UN5A 2Z8QA 4EO6A 1B70B 3LA0A 4WTYA 2XO7A 4KTQA 3EWGA 4K2XA 3K0JA 3KLIB 3AJ1A 1HI8A 1XMOF 3H4DA 4ZVRB 2B5JB 4RO0A 1HBOA 3SYZA 2W8KA 1RU2A 4N8OA 3GJQB 3M9NB 4BWJA 4QU7A 2PD1A 4P71A 4URQU 5HLFB 1KKHA 2GGPA 1Q78A 1KEKA 1LW2B 3EDQB 5F3ZA 2DEIA 3DLBA 3GR1A 4PKDB 1RUSA 2B6AB 4F4WA 2IBOA 4TY8A 4KE5A 1LNQA 2QLJB 3NMAA 4C11A 2BX6A 4PYAA 4WZQA 5KOWA 1N88A 2CQPA 4LBHA 3PW7A 1WTFA 1B0TA 3OHAA 3RB6A 1R8AA 2V2QA 4KGXB 2UXDJ 1U7LA 8AT1B 4F4AA 3I0RA 2Y1JA 1X4EA 2HQFA 3V6KA 3BQ2A 4X62J 3HHKA 2NCKL 2H65B 4ES2A 3HD2A 1KN6A 2LLZA 1XN9A 3MM6A 5AE3A 2JDJA 1HKAA 2PMHA 3D9BA 2Y0SD 2QV6A 2WSCC 3T1YJ 2EFVA 3OSNA 4Y2MA 3SDEA 2A6OA 1HNZJ 4LJMA 2J0XA 4HACA 3QT7A 2WBMA 2QSFA 4DS5A 4R5PA 3OW2R 5KFNA 2HEKA 2ZUAA 3DYAA 3THTA 1PBUA 4RWXA 1XIQA 2NPIA 4IO1A 4ETZA 2YKMB 3HHNB 4ELUA 5CH7B 1K0TA 5D0RA 3RBZA 3EGWB 5HMWA 1LXNA 1RAJA 1Q5YA 3CCQS 4RW6A 3GB0A 4P2SA 5LOQA 3MEDA 3TZWA 4CLSA 3TNVA 4L73A 2VC1A 2ZJPQ 2LFVA 4KPCA 5K8OA 2J7KA 4WXWA 3D2WA 4J91A 2DY1A 2VKRA 4FXVA 4J9MA 2N7CA 1SL0A 1HBOB 2HVEA 4QPTA 2W8LA 4UZCA 2OO4A 2FLLA 1YQHA 1B0PA 5KFZA 2FHJA 3BYPA 1RAGB 3EGNA 2EG1A 1VQOS 2KYZA 5JVGQ 4M5GA 1NO8A 4KGMA 2G0JA 4TY8B 2B4OA 2EKYA 2F7VA 4C11B 2VU5A 4KB7A 3I4HX 5JUMA 1S6PB 4RNFA 4JI5J 1BGXT 4FF2A 4MTPA 1X4FA 2CPIA 2LU1A 4LF8F 2GIRA 3EX7B 4ANCA 4OI2A 3OL9A 4OZJA 5I42A 2DPJA 3CW2C 3I0RB 1S1VA 4G65A 1T9YA 3BJYA 5KFYA 4JUZA 1UVIA 4J9SA 3DKDA 3DI6A 1TL1A 2NR0A 3MM6B 3J81Y 3TJAA 1WOOA 1NK4A 1VQ6S 1FRMA 4HDHA 1NK7A 3BBFA 2Y1LB 2KT5A 1Q8BA 4HACB 1RU1A 2HS0A 4R5PB 2HZCA 3OXFA 2V2ZA 2E5GA 4O4GB 4IOAQ 2HS3A 3MTJA 3DRRB 2I1RA 4FKXA 4P7TA 4C0HA 2J0WA 2MPUA 3CNQP 1RE1B 2DHGA 3NRBA 1UETA 2OFGX 2RRNA 3LO3A 4KGVB 3NG8A 2FUG9 3MEDB 1XWLA 2AJ2A 4X84A 1R8PA 1ZAXA 1SL1A 1IQTA 1J5EJ 2IYIA 4WZMA 1XC9A 2IAJB 2OI2A 3PRVA 1NJXA 2OEJA 4P6QA 4K4TA 2XMJA 3EVWA 3RR7A 3NS5A 2HNZB 2MY7A 4HI1A 4LFBF 1NCLA 1RAFB 4C2MA 3R6LB 2V0NA 2BE9B 2MMYA 4X4NA 3EXCX 3MFHA 4JI0J 4DV7F 4B3TF 1YJ7A 3O6QA 3UR0A 1CULA 4DLEA 5ETPA 2W2MP 4F04B 2MZJA 2ZHAA 1KQSR 1FTRA 4X4OA 3IR5B 4ZKAA 3VZHA 1FE0A 3H20A 3HHLB 1RTIA 3KG4A 3M30A 2C2ZB 4W90B 2E5HA 3SSRA 3MR6A 3OL6A 1GNKA 4CTAB 2ZH4A 4RUAA 5LMUJ 3AB4B 2CPDA 4PUOB 1JIHA 1X9MA 4M5IA 3KXDA 2FB0A 3K89A 4UW2A 4WP9A 2JZ5A 4C6AA 3KKFA 3KHHA 4DV3F 1UCNA 3QLHB 3WHIA 5M2UA 2VHGA 3BBBA 1U45A 3PJWA 2IRUA 2L48A 2W7AA 2C2NA 1TR0A 1AROP 4NCGB 1RWNB 3FZBA 2V6AA 1DTTA 4IRCA 1YJTA 1REVB 2BXJA 2UU9F 4LF9F 1P1LA 4I4BA 1AFIA 4CO5A 3LWMA 3QGHA 4IQXA 2R8HA 2O5DA 2VODA 1X60A 3OTBA 4QYZK 3MZIA 3FMWA 3C14B 3G8SA 4LF5J 1SH0A 4KSEB 1KDNA 2ZWPA 1IR1A 4C3MA 3MCSA 1YJRA 3TO8A 2JVOA 2KVQE 4NLWA 3CIMA 1J5OB 4CLUA 2FHMA 5IM0B 3CJ8A 4AQYF 1TK5A 1BHNA 3D6TB 1YJNS 1KVKA 2VA2A 3BKTA 4CP5A 4LF1A 3OFEA 3PRBA 4R25A 3EE3A 2YKNB 1URNA 4BBYA 2ZJQQ 1NB7A 3VQSA 2RE1A 4X65F 1F5BA 1VBZA 3D6FB 4K4UA 3J7YU 1CJVA 2F40A 3MEEA 2XSJA 4WYLA 4YB7A 1ZM4A 2OPRA 1LFWA 4P2XA 2ZM6J 3NGKA 2YNFA 1F0XA 1CVJA 4P73A 1GAOA 2YX7A 3PIPQ 3Q83A 2OAUA 2IVMA 3H25A 4PWDA 4LF7J 1TKDA 4IO9Q 2WRMA 2XO6A 3CDAA 4NL5A 3LGNA 3M30B 3MMBA 1VBXA 1OSCA 3R5AA 5EX0A 1PGZA 2L41A 1IBKJ 2EEYA 2WBRA 4DL6A 3PJXA 3HVWA 1OY9A 2VFTA 4RR5A 5HQMA 1UPMB 4CWBA 1UVJA 2DISA 3D4JA 1C4AA 2UUAJ 4RUCA 2Z30B 4DR3J 4OI6A 2YVSA 2XB2D 3Q8YA 1N33F 4HYKA 4EWTA 2QMWA 4PR6A 4PQAA 3ETMA 1NK9A 3AXMA 5E3QA 5KFCA 2C3UA 3M1VA 1OQ6A 1LW0A 5KOXA 1HHTP 3OVBA 4IDKA 2MQLA 1WHWA 1RT4A 3K7RA 1XMQF 1X0PA 5KFLA 2PE8A 3VGTA 1PJ5A 2ABYA 4OIXA 4DPYA 4FXDA 3CE8A 1Q79A 2V4QA 1PC5A 5AT1B 3U27A 4I6WA 4LF4F 2DCUB 4NZ6A 3UDLA 1T94A 4LVOP 5CZXA 1VYAA 3HF5A 4M5DA 4ZLNA 2GCFA 4K5SA 4DL4A 3QT8A 2ZHOA 2QL5B 3DMJA 4NLGA 2B9XA 3OL8A 1N8RT 4DV6J 3C6TA 2VG5A 4ED3A 3OPKA 2X3DA 4RUHA 4F4ZA 3MF5A 1VISA 3J7Z5 2VFUA 5HVGA 1JLQA 3H7HB 4WP3A 4HI2A 5KFWA 4EYHB 3PR4A 1F5CA 4ZCKA 5A0YA 3ET6A 3GG0A 3WC0A 1NKBA 4JI6J 2DHXA 3AAWB 1H0HB 2XNQA 1CJVB 4KC5A 3MEEB 4JI3J 5EHHA 3MECB 3AQPA 2PMZD 2LYVA 4K7QA 2YNFB 4PYDA 1TVRA 4QIEA 3MHYA 2CFXA 2EFPA 3TZZA 4PWDB 2MJNA 2ZE2A 4FN5A 4DR1J 2JEIA 3MMBB 1TL7A 4ZCLA 2B7CB 5DRKA 5A8WA 3M6VA 2OD6A 2EWHA 5HP1A 5B0FA 2GHWA 1JNRB 2V8DA 1VLYA 1MW7A 1SQGA 2ZD1A 4ZVGA 2LVWA 4G3IA 3QJJA 1N32F 5KT4A 5GMEA 2DHSA 4LF2A 1S0VA 4PG8A 4NLDA 5HBMB 2LDIA 4C8YA 2DYAA 3CMES 4ECWA 3CCWA 4PXCA 3FK4A 4QWCA 4ENOA 4YOEA 3KJVB 5LMNJ 3NXZA 2ROGA 4ZP7A 1YZ6A 2YWEA 2HZAA 1S1TB 3ZZPA 2X1AA 3KLGB 4MK8A 2BUNA 1JLEA 1SJQA 1RISA 2EBGA 2W1BA 2AP6A 4N41A 2Z2LA 4G6VB 3QSYB 2HS4A 1S72S 1RT5B 4D3GA 1KD1T 3KYLA 2KFNA 4FPRA 1PAEX 1OY6A 2XMTA 5HATA 3HT3A 1YBTA 3A3PB 1N48A 2XNRA 5HVHA 2GHPA 3L09A 2U2FA 4GKKF 4OL8A 1RP5A 4Q7AA 4LQ9A 5F8GA 3SV3A 1ZZFA 4IKAA 3C6TB 1FT8A 3VGVA 2JL9A 2XI2A 5HSPA 1U49A 1TFWA 3T19A 1NM2A 4Q2LA 3HFZB 1VMBA 2DNYA 2W01A 5KFRA 3JB9k 3ET6B 3TAPA 4EYIB 2ZOMA 2YH1A 3UD4P 2RQKA 3V6DA 3P96A 2HQ3A 3RB3A 5E0OA 3EGZA 3VVTA 1Q1KA 1TVRB 2HG4A 2H51B 2KKHA 4I2QB 3V4IA 2Z2MA 4LUBA 4B3OB 2V2KA 2RRAA 3R5JB 1CBKA 1SXLA 3O5TB 2DGTA 2GVDB 4ED2A 4R0EA 4N77A 2E44A 4CH1A 2KG1A 1SJRA 4WE1A 2ASJA 1KRPA 1KLNA 2L08A 5D8HB 5HAOA 3IBWA 4KIAA 1CSJA 1BUXA 2FLOA 4ED1A 1I6JA 1LEOA 1RI7A 2J7UA 2H1YA 3R5DA 3OVAA 4ZCIA 4LMZA 1FX4A 1FTCA 2KU7A 2DGQA 1JLEB 2RS2A 1DHMA 5BYQA 5GAHI 4O4RA 1TK0A 1JMTA 3QO9B 1RJJA 3UCUP 2RDJA 2P9GA 4PG4A 1RAEB 2F9JA 3TVYA 2BE2A 1SIZA 4Y2KA 2DXDA 3R5BA 1IBMJ 1J2VA 1NUEA 1WF1A 1TKZA 4RW9A 4Q8EA 4A8SA 2IMOA 3O1LA 3N9UC 4QR1A 3IWNC 1T9XA 3EZUA 1KFDA 3I5CA 4OMFG 1QUPA 4BHQA 1OJ4A 2YWFA 4FF4A 3CMAS 4MIWA 1S10A 2QEXS 3QPIA 1Q16B 1KNZA 3RB0A 4CO0A 1I1GA 3AHPA 4ECXA 2QN6B 4USUA 1FE4A 1M90T 3R7BB 3M32A 2QMXA 5DZ7A 3GFYA 2APOA 3QAEA 4YDXA 4O3SA 1RA7A 3G8QA 4J37A 1WNEA 2LECA 4M5JA 4DV4F 3AFGA 1O5JA 2CZ9A 1U1PA 4O3QA 3EM1A 3POTB 4QJVA 2HFNA 5L46A 4O3NA 3LAKA 5BR8F 4J9RA 4DSIA 4M95A 2CIMA 4ZA1A 4NX9A 4DV1F 2PA3A 1T11A 1NJZA 5CCMA 4USVA 2XYPB 3KDNA 2FHJD 4IR9A 3WX4A 4DLGA 2RH3A 1GT8A 5AXMA 2WSFC 1L3TA 1HMVA 3HLUA 2LQ5A 2POKA 1DBDA 1HLWA 1IM4A 1FKAF 1XJWB 2P9CA 2EKNA 2VICA 4R0JA 3KK1A 3HHLD 3KMQA 2GMHA 5HMZA 2UUTA 4KFBA 1V3SA 1RACB 5L38A 2HHPA 3CJKA 3R1LA 4CLWA 1NXIA 3KWMA 3TW0A 2BV3A 4QZVB 3DRPA 2PI5A 3LWLA 4J7CA 1U2CA 3OTOF 4QBUA 1VHFA 3QNWB 2A3JA 4I7FA 4WBFA 2R7TA 1X5SA 1QSSA 3EGVA 4NXMF 4GRSA 4XIUA 2IA6A 2DVIA 5KT6A 2JFKA 1CJKA 3BYRA 4OHVA 4IQMA 3ADAC 4DR2J 4X4QA 3G6XA 3PY8A 2PIIA 5F0UA 1YDLA 1MROA 1ITPA 3GP9A 3X3UA 4KBIA 4DG1B 3BR8A 2BABA 3M32B 1T3OA 2PA8D 4OZ0A 2DEJA 4C8LA 4ED8A 1N5YA 1DAXA 2ZZMA 4K8RA 4ZVPB 4K50A 2I8EA 3FCVA 5IT4A 2K7JA 2AZ1A 4F0HA 2QA2A 2J6SA 4JV5J 1VQ7S 1BQXA 2XMWA 2KI2A 3GILA 3KLHA 3OQ2A 4DSEA 3KNGA 2DGSA 4AFFA 3MM7A 5KAKA 3H8YA 4CLPA 3DGPB 4GO5X 2V8HA 2KJVA 4YR2A 5KG5A 2HGLA 5KFMA 4V19X 4Z37A 3TP2A 3SQOP 2D9OA 1HMVB 1RT1B 1CLFA 4B3MJ 2J6TA 4HH1A 3J7AN 3Q8VA 3K5NA 2WTFA 2R2UA 2ADCA 3ITHA 4HLBA 4XDDA 1UVKA 3LALA 1X4BA 1YI2S 3CJTA 1XNRF 4B9LA 4LRAA 3JS9A 2FVCA 1LWEA 2XTJP 4OYMA 3GYXB 3IM8A 4K4YA 1SKWA 3AOAA 1VQNS 3VVUA 3W66A 4KFBB 5EWGA 2MSSA 1NHUA 5E33A 1U2FA 1HI0P 2NXEA 2HKEA 3IWXA 1F5AA 3S8SA 4F36A 1V9OA 4KHPF 3C46A 3PZPA 2MKKA 2E5JA 3RYLA 1IR2A 4FYDA 4WKRA 2Z2ZA 4J9KA 3JQJA 2QLWA 3D67A 3KLEA 1NMEB 1BQNB 5CYQB 3PHEA 2D3UA 1S5ZA 4DXLA 1QTNB 1OO0B 3O44A 1K1SA 4KRWA 1GTHA 2VUGA 3IBFB 5IT0A 3QSIA 1VC5A 3K59A 1CJKB 4YHHF 1NKCA 4OX9F 5L9NA 1KVJA 3MFIA 3PFEA 5J2PA 4DV5F 3JQMA 1OPIA 2E1RA 2NXJA 1JB0C 1WC1A 2E9TA 3N28A 1DURA 5AXNA 4USHA 3R97A 4KKOB 3NEKA 2CPJA 3W2VA 4FYWB 5KFHA 1KQGB 2RJZA 3MM5B 1N5YB 2ZC3A 3NBPA 1B64A 4GMKA 1I5OB 2WONB 1W25A 1GH8A 2J5AA 2KXNB 1WOSA 2ATLA 1TAUA 1HL6A 5IT9Y 1GX6A 1VRUA 4I67A 2CG4A 1TUVA 1FJEB 3KLHB 3SQGA 1RKIA 5A76A 5D4PA 3MM7B 1SQFA 2DH9A 1TK8A 2DHAA 3DLKB 2BKOA 2Y1IA 4HHHA 3H59A 3GQCA 4UOFA 1MN7A 3ITHB 3CCES 3NNCA 1Y11A 4GKJF 3VAIA 4IFYA 2AJFE 3TJ8A 4LFAF 4ZVHA 3FFIA 5I3QA 2M3DA 3ZXWA 1RZMA 1JLAA 1IVZA 4OHZA 5AE2A 3I96A 3FGVA 1BQMB 2V63A 1LWFA 2R4FA 2HURA 2R7WA 1EHWA 1SIWB 3PTWA 1WI8A 3VV2B 1Z2LA 2GJFA 4F8RA 2XY6A 3I32A 1KSPA 1OSDA 4Y65A 2K7KA 2DK2A 2VASA 3VWSA 1S9EB 3BB5A 1VGYA 2MKCA 4X64F 2DGXA 2E5LJ 3KLEB 4DSKA 4L3KA 3VAMA 1R7IA 2WHOA 1FFGB 3ZTSA 1FEHA 1FXLA 2G1DA 3OXGA 1RBAA 2H3EB 2HRTA 1NK6A 1A0OB 1RAAB 2IM2A 4J9PA 4NXNJ 4PPZA 1KOOA 2RSQA 5C2GA 2CQ1A 2GAHC 2N3LA 4DUTA 1SCJB 3LP1B 1PBAA 2IVYA 3NCRA 2CPEA 2KXHA 2Y0BB 4O3PA 1HNWF 3MTKA 2JEJA 3W2VB 5KFSA 1FKOA 2JSXA 2BW2A 3BKUA 4L74A 3NBPB 3RJMB 3CCVS 1DJ0A 2Y1RI 3W64A 3CGIA 1NJIT 1F9FA 3DXBA 3AD7C 1T9UA 3D1OA 4USTA 1RHQB 3AODA 4YQWA 1MU2A 1VRUB 3ENAA 4DMZA 2BR0A 1AUSL 3RW6A 4C0BA 2PN6A 2KB2A 2DRDA 1CJTA 1WC6A 3KHGA 3LH2S 4F02A 1K1QA 5ETQA 2CNLB 2AW0A 2BJ3A 2V4JA 1SVDA 2ZH2A 2B8PA 2BYCA 2NUUG 2E7VA 3HVTB 2ZBCA 2GO8A 2BJ9A 4IFYB 4M5LA 1VFJA 4P7VA 3Q86A 1FRKA 2LP4A 4W4MA 2Q1LA 5KFVA 4OHWA 3SCKE 2WZ1A 1XNQJ 1JLAB 4DV2J 5DDPC 3VAGA 1N6QA 3OLAA 5KT5A 4I6AA 1LWFB 4JV2A 1KR4A 1Q5VA 3UQSA 4MYTA 2MGZA 1FKPB 2JRSA 2ILZA 2UXDF 3KJFB 1VJQA 4QYRA 4K4WA 3TX8A 3MCMA 2HVZA 2QYGA 4X62F 2CPYA 3K58A 1S6UA 3RG6A 2C3OA 5B0DA 2DR8A 2UVUA 5RUBA 2EK6A 2EFNA 1SC6A 1B7YB 1M1GA 1YIJS 4ZDNA 1FDNA 5CXTA 2EC2A 3QIPA 4WU2A 4A8YA 2B4VA 1JLFA 4NPOA 1JKHA 3JSRA 3CJ5A 3KK3B 1TKXB 2DD8S 3T1YF 2FLNA 1HBUA 1GMWA 2MYFA 1HNZF 3C6UA 1FVQA 2E9ZA 3KOAA 3CJSA 2L9NA 2VF3A 2KYXA 4Z7YA 2KHDA 3RGIA 4OI1A 1ZETA 4B9NA 4OI0A 2R2TA 3H98A 1HD1A 1Q7LB 3V5RA 3OR2A 2IHR1 4C8NA 2HLUA 1HNIA 4PCQA 2B51A 3CD5A 2H54B 4IFVB 2ZJRQ 3GIMA 2J0QD 1WSRA 5C42A 2ZHBA 4ICLB 4OQJA 1TFYA 2GQCA 1VRQC 1UA0A 4E98A 2C2DA 1R3NA 1WELA 4Y6IA 5E41A 1XBWA 1ZM9A 3HDSA 3DRSA 1Z1ZA 4ECQA 5LSOA 4MH8A 1OS5A 1HNVA 2V67A 2HHTA 1RAHB 3QJPA 3QZ7A 4U7UD 3TVKA 3EJMA 2HAFA 4KY3A 1CJTB 1Q0NA 2R2SA 4QIGA 2ZKUA 3M6UA 2V4JB 5EX3A 4DPXA 2A10A 2Y9HA 4YB1P 2FJXA 3NL0A 2YNIA 2OELA 4A8QA 1YLXA 1FHTA 1W7WA 1UFKA 4JI5F 5LL6d 4CLFA 3KDOA 3H40A 1U1QA 2MGZB 2R3VA 4NLUA 3NNHA 1F60B 1NB2A 4M1KA 3UVJA 2K3IA 2P5VA 3H5XA 4EI2A 1XR6A 2ZH3A 2CNNB 2OUGA 2RKIA 2VPXB 1RQ0A 2QMUB 2RQCA 3R2DJ 1JLFB 4ECUA 5I4MA 4PEOA 2UP1A 3M8PB 2BZ2A 1HBUB 1S1XB 1U48A 3FJ2A 3TEHB 4UY85 3C6UB 4URSA 4BC7A 1O51A 3T1HJ 2VG7A 3D1HA 2Q66A 1V6HA 4F3MA 4F4XA 4ED4A 1IKYA 5KTQA 5D4OA 4H4OA 5IQQA 3MMCA 5B0BA 1FA0A 4WFYA 3OR2B 4I56A 1UWAA 4P2MA 4MFBB 2D3OR 4J90A 4ZJQA 4X2BA 4IOBA 4OYZA 4ZPVR 2AU0A 1S1WA 5CABA 1N36J 1IKXB 1WDTA 2XS2A 2HQIA 3MD1A 1K9MT 5M2RA 2ZUGA 3ICLA 4UOHA 2GV1A 3SSSA 3JAMU 1JLGB 4IG3A 1J5EF 2N3OA 3TRGA 3QIDA 2Q3PA 4OHXA 1TZ0A 1V5VA 1HNVB 2BACA 3J7YI 2OGUA 2KJWA 4LR9A 1HWLA 1ZM3A 1RT7A 3LTOA 3K8WA 3C2PA 4JI0F 3TVZA 3DOKA 4C8ZA 2HHQA 2R7SA 3L3CA 1NRKA 1AZSB 1DFDA 3MAQA 2IBKA 2ZFHA 1IJFB 4IUFA 2G2YA 1RWPB 2DB1A 2QLBB 4OYWA 3P49B 2KZZA 2XGPA 1Y00A 2VQEJ 5EDWA 1O6XA 3UI3A 3G6VA 2H5IB 4LRBA 4OI4A 4NASA 2C2MB 1YSJA 1R0BG 2UV8A 1YBUA 3G71S 1SC1B 2LKZA 4DN9A 1S6QB 2F9DA 3PACA 1C1CB 5LMUF 2H48B 5E3CA 4LQ3A 2FDNA 1ZA1B 2OIHA 3IRXA 2VC0A 2AX1A 5DLGA 2QYCA 3GE9A 3JYTB 4NLTA 2VBWA 2GVZB 4ANEA 1PIEA 2D3O1 2QSWA 4RPFA 5F8JA 3BSAA 3IWLA 2J9DA 3MAHA 2D69A 1LQ9A 3TR5A 2VG7B 1WUUA 3CD7A 3BPDA 5T7LB 1C1BB 4NYOA 1YHQS 3IS9A 4DCPB 4ILRA 3MR5A 2AD9A 2OEKA 1MMDA 2B9EA 3MMAA 2HNDA 4N56A 3VAHA 1IKVA 1H3DA 3AA8A 1N0VC 4LF5F 2YWHA 2HHVA 4CQ1A 3MUTP 2HNYA 4A8KA 1ACMB 2IJFA 2DXEA 1XR7A 3I0SA 3P4UB 4Q0BB 1YJ9S 1FX2A 4A47A 2W2PP 4P10A 2ZH6A 2AHOB 1T03B 3HD1A 5BXIA 3EDRB 3BO2A 3MOZA 3HSGA 1D3WA 5B7WA 3EVOA 1RT7B 2MKYA 2AT1B 3HSZA 2FGCA 1MSWD 1WDDA 2NZCA 2P8IA 3OXLA 4DL7A 1H72C 4J5OA 5C7PA 1X8DA 3A12A 3H4BA 2H4YB 2HGNA 2FJVA 4C8MA 1YITS 1NSPA 2ZM6F 2DTJA 3ETOA 3UR3C 3DCAA 2W2QP 5K14B 3D6MB 2OHDA 4V1Ak 4LF7F 1ZZNA 4O44A 2NPFA 5SZTA 3PW0A 2YX1A 1LV5A 3W9IA 5KFGA 3GFZA 3NLCA 1WEZA 1S59A 1Y5IB 2XMKA 3E01B 2UXBJ 1IBKF 4ALZA 2LCWA 3PYEA 4EBEA 1FNOA 3DLGA 3SCJE 2UUAF 3IRXB 3QGGA 4DR3F 1UWBA 2CQHA 2FLPA 2BANA 6FD1A 2J9EA 3K8VA 3G86A 3MCNA 3C3LA 4ZVUB 2HIQA 1TMJA 1U4BA 5SUHA 4U8VA 1T05B 3ULHA 3BO4A 3A8IA 5I3UB 1NSAA 3FEYB 4ZITA 2UVRA 1V3RA 4PABA 1RLCL 3GWCA 2HQDA 3IS9B 3GFHA 3BPSP 4URGA 4DQRA 3LQVA 2ERRA 1FD2A 4HT5A 2I2YA 2HNDB 4DUYF 5A8KB 3UW1A 2MQNA 4USKA 2I5JB 3BH6B 5B0CA 4DU7A 3S01A 3CCUS 3OSPA 1SPBP 1FNMA 5ETRA 1NSKL 2HNYB 3UNYA 2FC8A 1NDLA 2PSZA 2MKHA 2QO3A 5H9EJ 4XO0A 4DL3A 3OLBA 3HULA 4A46A 2JH3A 2RVJA 2Z58B 3S6EA 5D3GB 1HQUA 4DV6F 4EBCA 5IT9U 5LXYA 2OMLA 2YX4A 2YNGB 2OPQA 1VR6A 4NA1A 3DXSX 3U1MA 9ATCB 4ECRA 4UUXA 1KTQA 3GCXP 3BDPA 2O67A 1FJGJ 4WJBA 1TV6A 1UW4A 2BRLA 1SJ3P 4JI6F 3MM9A 4JI1J 4JI3F 5DJBA 1WEXA 2D9PA 4Q2MA 2B4UA 4WXOA 1SH3A 4CIOA 2XSFA 2CPXA 2CZVC 1U1MA 2RIJA 2ASLA 4OX8A 5J2QB 1CC8A 4R8UB 4DR1F 5LT5A 3D54A 1KBRA 2E7XA 3LAMA 1RWVB 1S12A 1UZDA 2L9DA 3M4XA 4KAIA 1Q86T 4CZCA 1TP7A 1P6TA 2CJQA 2DPIA 2AIRB 5IWAJ 3ZTPA 3TAMA 1IUJA 3NNAA 3NCQA 3LPYA 1UWBB 2XMUA 2JFDA 1FK9B 2H4WB 1Y10A 1R0AA 2R7QA 4K4XA 2KVIA 2AYBA 2EI5A 1F3VA 5LMNF 1FXDA 3AD9C 2FHOB 2QFJA 1WHXA 4PG7A 1ZH5A 2LQBA 4LBPA 5THWA 2FVSA 1Y5NB 1X9SA 2N4DA 1S0NA 1M5PC 2UUWA 1X5OA 3UO0A 3VAJA 5B08A 4DCOB 5C2CA 4NA2A 5D4NA 1UJ5A 3D66A 1WG1A 2IM1A 3BDEA 1XK8A 1RLDA 5GAGU 3AJDA 4XTTA 4RU2A 2BW7A 2QA4S 2PFFB 4JV0A 1U0HA 2M9KA 1U8WA 3S7RA 1CC7A 2HQCA 2XS7A 3CJ3A 2BJ8A 5CYMA 4Q44A 1U25A 2CQDA 2P9EA 2YNHA 1A6LA 5DLFA 1X4GA 1HWUA 4FNHA 4OHYA 3GIRA 3E8OA 3M8ZA 3GSIA 1R0CB 3NGUA 2FZGB 3ZNUA 1BWEA 2OMOA 4EK2A 4GVBA 2GJ2A 1HQ2A 2ZZTA 3W5XA 1VS3A 2XMAA 1BD6A 2KRRA 2EW9A 4ZHRA 2IM0A 4O3OA 5HMXA 1RSCA 2AYGA 1H98A 1HW9A 1P8GA 2IM3A 1XTZA 4PAAA 2C3MA 3KLVA 2LQ8A 1RT3B 2BA9A 1QE1A 3CJQA 3TX0A 1RABB 3DC2A 1S9GB 4CLKA 1IBLJ 3G4SS 1UEKA 3M8QA 4OJGA 2NYIA 2JLEA 3TAMB 2ZEJA 2WVBA 2ALYB 3FBCA 3I9ZA 4XK8C 1NZAA 3LP2A 3IAM9 2HWHA 2CQBA 3GLJA 1L3KA 2XZTB 2H9ZA 1VOMA 2A6MA 4NMXA 5KFUA 4HHUA 2VOPA 4L3NA 3C15A 1OQ3A 2CWXA 1WG5A 3PDNA 3R9LA 1SKSA 1KWMA 1NDPA 2KRBA 4JI7J 2JWNA 5M2PA 1SUQA 4FS1A 1TKTB 2XZDB 2V9WA 2O01C 4DN0A 4DR7F 3M2VB 1RT6B 2B9WA 2NXUA 5EGYA 2BOAA 3MEGA 5DQIA 4C3KA 1IBMF 4E0DA 2E1CA 2MQ8A 3NKYA 2RNEA 4ERDA 3F56A 2U1AA 4FS2A 1CS4B 1GMWD 1NU4A 4Z2XA 2NXCA 3RR8A 5EWEA 4MIAA 2B8QA 3VCDA 2MSTA 2V94A 2RT3A 3GZ7A 5A8RB 2J0SD 3IGNA 4PPDA 1H6KX 1R6YA 1VQSA 3H90A 3U7JA 1UJ4A 4X66J 2VBXA 2C42A 1FI4A 2DGOA 5D6GA 2DJWA 3TOQA 1KLMB 2YXLA 2X1GA 4KGZB 4S0MA 4GVBB 1QVFR 4YB5A 4DR6J 3QATA 4ED0A 3GJTB 4OZ3A 3GIIA 1FCAA 1KFSA 3IR6B 2BEFA 3MOJB 3HI9A 2VG6A 3D0GE 2QL7B 2GC8A 2FZCB 2V68A 2XMMA 2KFYA 1K47A 3EPIA 5FJ4A 1MWYA 3GONA 5L1KA 2GGPB 2KDOA 3F0NA 8RUCA 1YX2A 3NWGA 4FP9A 3K5PA 3C16A 3AY0A 4U7UK 3HHDA 1AA1B 1QAYA 2JC1A 4CNZA 4DZ6A 5D0GA 2AGOA 3T9ZA 3LP2B 3BKFA 1SC3B 3Q8QB 3CC7S 2PEBA 4DSFA 4NEYA 2CQ0A 3BSNA 1X31C 2NZ4A 2XY5A 3OFGA 3MAAA 2HMIA 3SFGA 4DQQA 3W60A 5J2MA 4RNMA 4AL7A 2OD4A 4USJC 2W25A 3B54A 4IRKA 4HHJA 4ZVFA 4ECTA 3QFWA 4JYAJ 4WIIA 2DNQA 2CNOB 5EUHA 3QWUA 4AE5A 4B3SJ 2LDYA 5F8LA 1VCTA 1FO1A 5C24A 4ER8A 4RW4A 1TL3A 1HA1A 4CYUA 3SDEB 2FJAB 4GC6A 2LEAA 4F26A 2F4FA 3SIPB 1WD6A 2PFDA 1TL5A 3M2RA 4DUZJ 3IG1A 2UVWA 3PJ9A 5DS7A 3DYAB 4DR2F 4ZPWR 1WF2A 4FYVB 2FC9A 3HO1A 1D9AA 4LIRA 3ZFVA 4RBTA 4RL1A 4F2SA 1WI6A 1CQMA 4RW6B 1JJ2R 5KG2A 4TKTA 4EBDA 3KUEA 3M6XA 5CD4H 4EGLA 4B9MA 1S79A 4RZRA 2OPSA 4QCLA 1T7PA 5F41A 2BQ3A 2VG6B 3B8HA 2DGWA 2WK4A 3MWBA 4JV5F 4DF8A 2NS1B 3O8WA 2W4DA 4ZPBA 3WZ0A 4OI3A 1LK7A 4ZJLA 2GMLA 3A1YG 2LA4A 1G2EA 2XMVA 3MR3A 4PXDA 3NP5A 2VDHA 1HWIA 5DM6Q 3M8WA 2ZDPA 2CQ2A 4B3MF 5ETSA 1B3TA 3FC9A 4HT7A 4K2JA 5KG1A 4K59A 4QWAA 2ZOFA 1S4FA 4TXSA 3CDWA 2ZNYA 3P3DA 3W63A 4CH7A 4ES3A 1WHYA 4WPAA 2CRLA 2IFXA 3R6GB 1NK5A 3FCWA 1Q8LA 2BJ1A 2DBBA 3DU5A 3TA1A 3WQPA 4M63A 1QY7A 4ZVQB 5I42B 2JEGA 2FHKA 1S1VB 3IO1A 3PYDA 2R7RA 3DI6B 1TL1B 2HBQB 3I31A 1DLOA 4DSJA 4RW4B 4I1TA 1UFLA 3PVXA 5GAEU 2RU9A 3MDFA 5L8RC 1PKUA 5D15A 1IKWA 1QVGR 1VC6A 4PZVA 1JQGA 3TI0A 2OEMA 3M2RB 2ZOGA 5FLXU 2C2KB 3FZ2A 5BR8J 5MAOA 3DDKA 1WF0A 4KYZA 2CUYA 3TUIC 2KM8B 4Y2CA 3GPAA 4OYOA 3ZC4A 3A13A 2DRAA 2RQMA 5F0WA 2M52A 4X4UA 4B9TA 2GJIA 2GS8A 3TWZA 3R5GA 4A8MP 4PG6A 2LXIA 5G0RA 4ID8A 1F9EB 3K5MA 4ECZA 5E3RA 1UA1A 1HBNA 3FEZA 1NK8A 1Y7PA 2AMCB 1P9QC 4MK9A 4IH7A 3W9JA 4FZVA 3Q8PB 2ZWOA 1R6VA 5CYJA 1MLAA 4WIQA 2R42A 5LJ5Y 2FZKB 2DH7A 2WAQD 4ECSA 1CULB 1IXKA 3NAHA 4TQSA 1RADB 1HYSA 3QRRA 5K8PA 2HRYA 3UCZP 2ZBPA 5E5NA 2MZTA 2Q43A 5DG9A 4NZ0A 4RUBA 4UOCA 4ZLJA 1NPKA 2DR5A 3FVYA 2CJAA 4LSNA 3GTYX 1RTIB 3OHBA 4LRFA 4JB8B 1AT1B 1X4HA 2GX8A 5I3PA 3M2UA 4NXMJ 3A3OB 4ZOSA 2Y8WA 2W7OA 1U47A 1KQKA 2RHSB 1H73A 2HHWA 2KXFA 2JLFA 1SKUB 2ASYA 3RBXA 2XZWA 2E5LF 2P6SA 1TELA 1KC8T 3OD2A 4TU7A 4F0MA 1RWOB 4CLTA 2KG0A 2XG8A 2VJVA 1S7IA 1UL3A 2JEFA 1YWXA 5LM7E 4ETXA 4ZLPA 3CDEA 4DF4A 1N5SA 1FRLA 3QZ8A 2O66A 4NXNF 4ZIVA 3ZTQA 2J8AA 1G6BA 2V69A 1DTTB 1TTHB 2RUSA 4KR0B 2HIYA 2YY3A 1T8EA 1O0PA 2F8HA 2R8GA 1S1UA 2G0IA 3DN9A 3HVAA 2PMWA 4WFNQ 5A2QU 4M5MA 3HZGA 3CVKA 2FVRA 1VQKS 2AKWB 3OTEA 3A8EA 1RBOB 1JLCA 2UUCJ 1EETA 2FYXA 4WFBQ 1FWLA 3BGRA 4X4PA 3DLEA 4BCAA 2MLXA 2OFHX 3D0IE 4NEZA 5GMKa 1HBNB 4UZBA 3V2UC 3VR1A 5HROA 3A4TA 2QA1A 1R31A 4RBVA 1VRTA 3NOGA 4F3OA 4ELTA 2XS5A 4NLOA 1TAQA 3NY0A 1YVFA 4DPTA 4ED7A 1VC0A 1UVLA 3RU0A 1DRZA 1R27B 3UN3A 4H4KA 2HAIA 3TUJC 3ZZRA 1KP6A 3UDCA 2DNOA 2XSJB 4DOZA 1SBRA 2OPRB 5H9FJ 1AXQA 3DOLA 3DHXA 2BKPA 5KG6A 2OP5A 4HVZA 3CPWR 2ZH7A 2VBYA 1XNQF 1W26A 4DV2F 1PYSB 4C98A 4ATNA 1KONA 4RW7A 2ROEA 3CULA 3M2UB 4F3QA 3F41A 4P72A 1P1TA 2CWKA 3VALA 3KJNB 2WVFA 2QT7A 4FF1A 3P5BP 1RWKB 2RRBA 1MNEA 3S1TA 3ZZ0A 1VQPS 3ELHA 1YRXA 4QU6A 4ANDA 1BWVA 1HIYA 2D3ZA 1H74A 4B3RF 2FPHX 3D68A 5IV4A 3PR5B 5J2NA 2HVIA 1RCXB 1EZZB 1Q95G 2RDIA 3T5LA 3M1VB 1LW0B 4PQUA 4IDKB 1T0TV 4ZVSB 3ZZYA 3FBFA 2K2PA 5J1EA 1SJFA 1YG0A 1RT4B 1U24A 2XI3A 2QG9B 1YTYA 2B5JA 1S1UB 4TVAB 2G0CA 5BJRA 2BVZA 2QE5A 2VFRA 1LXJA 3MXHP 3CD0A 1R89A 2HVHA 3D3BJ 2XULA 3BR9A 2ZH1A 2I6WA 5HLFA 2YKOA 2CPFA 3EICA 2ATCB 2VKZG 2KTQA 5AXKA 4TYAA 4RKUC 3BGRB 2MTLA 4M5DB 3KLFA 3V6JA 3ILIA 2OKQA 1LW2A 3G87A 2MKJA 1FRXA 3DMJB 1Y5LB 4Y28C 3HKWA 4TLQA 3X1LB 2B6AA 4L75A 3R7NB 1CG2A 3T9NA 4NLPA 2MLZA 2VG5B 3NS7B 2FVQA 4O23A 4JI8J 1S49A 1W2IA 2ZITA 3IM9A 1PAUB 3BQ0A 1JLQB 3H5SA 5DGAA 4K4VA 2MKIA 1G1XA 3NGDA 5A0YB 4ZPDA 2DNHA 4DR5J 1D9FA 2F8MA 2Z57B 5GMDA 3GYNA 3DOLB 3SEOA 4W92B 4H54A 5IXUA 4OV6A 4X4TA 5AE1A 4J9UE 3PKYA 2ZE2B 1G4CA 2RMLA 4DV0J 3BN7A 1TL7B 1F2GA 2HRUA 5A8WB 3W3SA 4Y2IA 5HP1B 4CCHA 2YWGA 2BKNA 2ZD1B 2JOQA 3QBCA 2G2OA 5B0EA 1GFWB 4CO3A 3G82A 2YKMA 4YN3B 3PXGa 3R1HA 3RBDA 4EFAC 1UPPA 3D5MA 4A4JA 5DM7Q 3CD6S 3CEDA 3B4MA 1Q8IA 1VBYA 2B43A 4PQUB 3T1HF 1FDDA 3AD8C 4JOUA 4JI2J 2VOOA 5DDQC 5K9FA 2JC0A 5J1EB 3HVRA 3KUHA 1WORA 3Q0AA 2HWIA 1JWWA 3CO9A 2L9WA 4CLYA 4WTOB 3OT9A 2ALZA 5DG7A 2YH0A 3MPYA 2CXEA 1N36F 1RHKB 2ADBA 1WC5A 2E7WA 1WG4A 2R7VA 4TU9A 2RD5C 1CJUA 1S76D 3KLFB 3IFEA 4UF4A 2LU2A 2HFUA 4CO4A 2MJUA 3W8GA 4U67Q 1VI7A 2EFOA 1YJWS 1QJHA 3SCLE 1OPZA 5E3PA 4OV1A 3JQKA 4G1IA 2HQGA 1N56A 3W5ZA 2B56A 3GFXA 3KNAA 3G9CA 4Z7CA 4ZN1A 1S6PA 2YKAA 5GVQA 4DR4F 3DRXA 1U6FA 2YQ0A 4DU8A 2DXFA 4AL6A 4IYQA 3L7UA 2E5IA 1QSYA 1IR0A 3GV5B 1PYTA 3KUGA 3V6DB 2VPYB 2HBRB 3T6BA 1SJ1A 3JAMY 1M5VC 2CAJA 3M7VA 1JJ4A 5IOLA 5CD4A 5L39A 2VQEF 1FNXH 5L9XA 3V4IB 1I94J 1D1UA 1R8HA 7FD1A 2PGCA 5HO4A 3BBCA 4USWA 4OX6A 4AT1B 1SJ4P 3MR2A 5HK4A 4G1QA 4NE9C 4O4GA 3HKZD 4QWEA 4WE1B 4YFUA 3DRRA 2E29A 3G82B 3RB4A 2Y8YA 2ROPA 3M8RA 1EIYB 2EBEA 4OYPA 4ZP6A 2ZZNA 3Q8UA 3NS6A 3U1NA 4KH0B 5KFFA 1QSLA 3OTDA 1EJ7L 3BSOA 3A3NB 3RW7A 3LF0A 4ED6A 5CAAA 1Z4UA 2VPZB 3U1LA 2RDDA 3IBCB 1PCAA 3EUNA 2IAJA 3MPDA 2BE2B 2HNZA 7AT1B 3KK2A 4CI0B 2R8JA 1PJ6A 3IRWP 3CXCR 1M1HA 1F6TA 2OSRA 3D0HE 1TKZB 4RW9B 4XDCA 4U9RA 3HX9A 1X0FA 2NREA 3FBEA 1CJUB 2I9SA 3IA0A 3D1QA 1ZAVA 2BJEA 2XHCA 2VH7A 3W2WA 3OFFA 2HHHJ 4ZPAA 5LSRA 1IWGA 5KFKA 1RT2A 3BO3A 1Q7YT 1N4LA 3HHLA 1VQYA 3UN2A 3K5OA 1Q82T 2FY8A 3OTCA 4RBUA 3MPWA 1F1BB 2XM3A 3LP0A 3PYGA 4ED5A 4CTAA 3R27A 1QAJA 3T3FA 3IR7B 4PUOA 4ELVA 3KFWX 2DNNA 2KHCA 2OTJS 2FD2A 2Z4PA 2OSQA 2XCPA 1FJ7A 3ENQA 2FJBB 4AUKA 3PX0A 1FDAA 2CVIA 2V9KA 1KQFB 3CMQA 3QLHA 5D0EA 1LOUA 3GJRB 2EXUA 5F3TA 2UXBF 2M88A 2WVDA 3Q8RB 2A2CA 5KFAA 3J7ZT 2AGPA 1ULRA 3US5A 4NCGA 2RF2A 4G1QB 3WX8A 1REVA 3T6JA 1BMQB 1A7GE 1AFJA 2MLYA 4YB6A 1YKWA 2VA3A 4DPWA 1RHJB 3QYYA 5K5MA 1RWUA 5D4LA 3C14A 3THVA 2BOPA 1N0UA 3KK1B 1S77D 3PM9A 2CQCA 5GAGI 4QR2A 1H2VZ 3M9OB 1J5OA 5ETKA 5IM0A 3Q23A 3T1AA 1NJWA 3M05A 2DR9A 1P27B 1RB0A 2F65A 4N5SA 4XPEA 3CJKB 2WW4A 1HNXJ 1MMLA 4A8WA 2CYYA 4OJHA 5KFEA 3JSBA 5DGBA 3UD5A 5DDRC 1U1NA 3KK2B 4NLVA 3DRPB 3GU0A 2DGUA 2KT3A 2GIFA 1HI1A 2YKNA 2EPIA 4HDGA 2KT2A 4TNOA 4I7FB 5JMNA 2FIUA 2VFVA 4ZP9A 1L3VA 4DQPA 5HJXA 4B17A 2DO4A 3K5LA 4NZ7A 4P52A 5KT7A 3FCHA 2EK1A 3W2WB 3EPGA 3UFCX 3CF5Q 1Q53A 1GXTA 2GZOA 2BJDA 3VZIA 1NNDA 4LFCJ 5KFIA 4J9NA 2P2CB 1RT2B 1GK8A 1GEHA 1UTAA 5HI7A 1MROB 3WC2A 1RTDA 1HFEL 3BSCA 2XYGB 4WFXA 1PJ7A 4B9VA 3WBZA 1FJGF 1QTMA 3LP0B 4WU3A 1Z2ZA 2AGQA 4OJ1A 3TQEA 4G1PA 4WFAQ 1FFWB 1WSVA 2IMWP 4JI1F 1UFWA 1EP4A 1SH2A 3IN5A 3ILJA 2AEFA 2PT0A 2QRRA 5CCLA 2QL9B 4I6YA 3CT9A 2VQFJ 3HSJA 2IY5B 2MEWA 2R9LA 3N79A 4D3HA 3Q24A 3CCJS 2Z2YB 2VJUA 3TANA 1F9HA 2RF2B 5IWAF 1Y0HA 3VTIA 2IC3A 3I6PA 3DRYA 4DPUA 1M0SA 4ZVTB 2M4MA 1I51B 1JJCB 2AX0A 3QMQA 2BJ7A 1LWEB 4CLLA 3L95X 3DHWC 1DQAA 3K17A 1BC6A 1B4SA 1M5KC 3FDSA 1ZOTA 3HCXA 4AXJA 5KG3A 2UXCJ 2QA4G 1XR5A 1N34J 2YQ1A 1F3FA 3N5BA 4LF6J 1E6VA 4BS2A 1NHVA 4FBTA 2CA9A 3OJSA 1Y3KA 2W7PA 2MQQA 4N76A 3BEGB 4K0KJ 1WC3A 2UUBJ 2J7WA 5KG7A 3MUVP 3MUMP 2IDEA 3FUYA 1RWXB 2DT9A 4IH6A 5DDOC 4L76A 2DR6A 2C3YA 1IM6A 2XLKA 3QWPA 1LK5A 3MECA 3MD3A 3GG1A 1ZTTA 3PYFA 3KG1A 2BBEA 2HWTA 5J2PB 2HVDA 2WVCA 2C2EA 5KFQA 2COLA 3M8YA 2C1EB 2ZH8A 2ACMA 2F8EX 2XWYA 3PW4A 1RTDB 4NI2A 3CCZA 3PX4A 4U6PA 2IJNA 1PSDA 4FPIA 5HANA 4NLRA 4DX6A 3FBBA 3MURP 5HN0A 3J80U 1RTHA 1EP4B 2LQ9A 3SV4A 3B78A 3U02A 1JXEA 2VFSA 3Q2TC 1GXLA 3C66A 5HBMA 1D9DA 2IPOB 2O1PA 5AJ3J 4DQSA 3SQGB 3T5HA 3KJVA 4ZIWA 2R7OA 4OYXA 2QC3A 3CCTA 3ILLA 2BM0A 1IBLF 2XY7A 1S1TA 3QAUA 2E1PA 3KG0A 1T95A 4DCJB 3KLGA 3FQKA 1QAIA 2HK2A 3AB2B 3ZNJ1 2IC3B 1S0MA 3ISND 1DY3A 2XYHB 4DUYJ 1HW8A 3THPA 3N6MA 1RXOB 2F4VJ 4LR7A 2IIHA 1VHIA 4AL5A 3FFIB 4RWWA 4PRFA 4U7CA 3MCOA 1RT5A 1CPZA 2C28A 5B09A 1PILA 4MKAA 2NXNA 4NA3A 1EQ0A 4JI4J 2GHVC 4N47A 3D28A 2RQ4A 1HR0J 4JI7F 1LFPA 4DFJA 1RYRA 2HW3A 1E6VB 3FRYA 3UE2A 1C4CA 1YGYA 2ZBQA 3HM9A 3I82A 3UPFA 4N8NA 2IRYA 3PCOB 5IZHA 1GMVA 1RA6A 2L3MA 2QIFA 1UJ6A 2HHUA 5IC4B 2NSBA 2OTLS 2B9YA 2NQPA 1JK9B 2AJQA 2DCLA 3ZZZA 3P8BB 3ENVA 5KFBA 2WB1D 1LWCA 1DARA 3ISZA 1WEYA 3HFKA 4QIFA 2RUGA 1K44A 3BN4A 1OY8A 2EG2A 4LVNP 3IC1A 2ZH5A 2CG8A 4I2QA 1A9NB 1WKKA 2VDIA 4YY3J 3IP0A 1IN0A 4NI2B 4X66F 4B3OA 6FDRA 1URRA 2G4BA 2W4PA 2YKPA 3CDUA 2RHQB 1RWWB 1GTEA 1VK8A 1FKOB 1VIXA 4BDPA 3N01A 5LXRA 2HSEB 2GVDA 4DR6F 4DBQA 1RTHB 3R8YA 1G3OA 3W65A 2N82B 2JJ4D 1WKJA 1NHKL 4IR1A 2CJKA 4ZK7M 4ILLA 4U95A 1MU2B 4FXWA 4C8OA 4DDFA 3I4PA 3VF0B 4LSLA 2MY8A 1EKRA 3KJQB 2MZRA 1DTQA 3PO4A 1YZ7A 4M8LA 3EZOA 3DLLQ 2IJRA 5L1LA 2ACYA 5GADU 3G8TA 1YJVA 3BH7B 3QO9A 1SV5A 1N5QA 3SSQA 4LBIA 4RU9A 1EAYC 2NYHA 4P75A 3TZXA 2CVEA 2HGMA 3DGVA 2N7YA 1XQIA 2KH9A 3GCWP 4YUDA 4LSZB 2AWZA 4ID5A 1T9WA 1N6QB 2HFSA 5K8MA 1CQNA 5A6PA 3GIKA 5L1IA 5BYRA 5GAEI 3VQTA 5T41A 1T9VA 5H1SV 4JYAF 1RDRA 3GYGA 1QUVA 1QDUB 4FVCA 4YDDB 6AT1B 3PO5A 4OLOA 2D74B 3MGJA 4QYZJ 2W4CA 1BLUA 4B3SF 1GXUA 1D09B 4CM0A 4F50A 4ECVA 1RHMB 3QIPB 1B7FA 4X4SA 2QLXA 1JKHB 2HBZB 2D7SA 5IFMA 3QGIA 2J76E 2DNMA 5FD1A 2HFVA 5F8MA 4B02A 3FMBA 2LMIA 1LWCB 3ZZOA 3PW2A 3AT1B 2M2BA 3POTA 4CH0S 5H9EK 3OBIA 4DUZF 3CB4A 4NLQA 2IA0A 2VL1A 1XMOJ 4QOTA 2GIQA 1FWKA 5E3AA 3CJ4A 1HNIB 3H2LA 3CJ2A 4KHRA 2VZ9A 2W9BA 4RLEA 5C42B 2M70A 4MYUA 1D0EA 2YPZA 1UVMA 3H5YA 1RTJA 4HKQA 4TYBA 2ZKTA 5KG0A 2UVVA 3DRSB 3CCMS 3DDNA 3D3CJ 1NPPA 3BGLA 4LSLB 5D0HA 1NH7A 2MZ1A 1DTQB 3UD3P 4XPCA 2DKOB 1RCOB 1S99A 4CO2A 4ZS6A 4TLRA 3RAMA 2N4CA 2LXFA 4JP8A 4H4MA 4O3RA 4DR7J 1SV5B 3FSYA 2IDLA 2YNIB 2IRXA 3O2IA 4EMDA 2G2ZA 3UNGC 3QFHA 3KMSA 4ID5B 1EB0A 4W98A 4USMA 2PO4A 4FYYB 3QT5A 2NUHA 3UVJB 1G7CB 1WWHA 1LWXA 2V8PA 5HQ8A 2O3DA 3SCIE 2AYMA 4ES1A 5F8NA 2RKIB 3V4MA 1WJ9A 2EC0A 4WWSA 2AYEA 4MKBA 2GNKA 1S6OA 1JX4A 4DG1A 1YBAA 4OX7A 4QPXA 3MM8A 2W2OP 4NYZA 1M5SA 2RU3A 2GAGC 4YMEA 2QGFB 3IGVA 1MWQA 1RHUB 5F9LA 4F2RA 1N54B 1XEZA 1NK0A 5HVFA 5F8HA 1C2PA 1IKYB 2DR7A 3HMJG 2QJ3A 4H4OB 2F5GA 2MDAA 3MMCB 1UVNA 3FSXA 3G6YA 4C48A 1K73T 2A1BA 3DGPA 3LANA 1S1WB 4GVLA 4BLGA 2C22A 5LJ3Y 2W9BB 5KG4A 3BF4A 4U96A 4FKYA 4O0NA 4DL0C 1RTJB 1REGX 2MXYA 1RT1A 3ZZTA 2LA6A 4IG3B 1NJYA 1SQEA 1VIOA 2KL8A 3RRKA 1BY9A 3PX6A 1P9YA 5FLXY 3J81U 1U1LA 1ZA2B 5KT2A 4PWUA 1B0VA 3HPOA 1RTZA 3PEHA 4NRTA 3ZO7A 3DOKB 4E2FB 2AF6A 2ZBRA 4WFZA 4LF8J 4C9DA 4PXEA 2UZAA
chains in the Genus database with same CATH topology
4KR0B 1RAJA 3CCQS 2Q1LA 4RW6A 4OHWA 3SCKE 5KFVA 2CDQA 3GB0A 4P2SA 1T8EA 2YY3A 3MEDA 1JLAB 4K5RA 4H4MB 1O0PA 2F8HA 3TNVA 4DFPA 2MB0B 5DDPC 3VAGA 2R8GA 1S1UA 3DN9A 3HVAA 3OLAA 5KT5A 1N6QA 2VC1A 4I6AA 2ZJPQ 3Q2SC 1LWFB 4JV2A 1KR4A 4WFNQ 2Q6BA 3TAQA 1DZ5A 3UQSA 4MYTA 4I68A 1FKPB 2JRSA 3HZGA 2ILZA 1OWXA 5K8OA 2MGZA 4C8KA 4FF3A 3CVKA 2UXDF 2J7KA 4QYRA 2FVRA 1VQKS 3OTEA 4K4WA 4WXWA 3KHLA 3A8EA 3D2WA 3GSDA 4JBCA 3TX8A 4IH5A 3PKMA 2FVPA 1BQNA 1JLCA 2G13A 2X1BA 2HVZA 5CYQA 2VKRA 4FXVA 4J9MA 4X62F 2CPYA 3K58A 1Q81T 1EETA 1S6UA 2N7CA 1SL0A 2C3OA 5LSLA 1HBOB 2DIVA 5B0DA 4QPTA 2DR8A 1VQ4S 2UVUA 4WFBQ 2D41A 2EK6A 3BGRA 4X4PA 2W8LA 2DNKA 2EFNA 2OO4A 2FLLA 3DLEA 1YQHA 2RB7A 1FJCA 1SC6A 4BCAA 2OFHX 3D0IE 5GMKa 1HBNB 1FD8A 1B0PA 2ZH9A 4ZDNA 3V2UC 1YIJS 1FDNA 5CXTA 5KFZA 2YKQA 2BDPA 3QIPA 4WU2A 3VR1A 2FHJA 2B4VA 4A8YA 3CTRA 1JLFA 4NPOA 1JKHA 3JSRA 3EYZA 3CJ5A 5HROA 3EGNA 2QA1A 3KK3B 1R31A 1TKXB 2EG1A 2DD8S 4RBVA 1VQOS 3T1YF 2DRBA 2FLNA 1HBUA 2KYZA 4IOCQ 2MYFA 1VRTA 2V5HG 5JVGQ 4ELTA 1HNZF 4F3OA 2XS5A 4NLOA 5J1PA 3C6UA 1NO8A 1FVQA 1TAQA 1N5TA 3V6HA 3UCGA 2E9ZA 1HD0A 4KGMA 4NOHA 3KOAA 2KZMA 4I64A 2B4OA 4TY8B 2L9NA 1YVFA 4ED7A 4KKOA 2EKYA 2F7VA 1L5UA 5FDLA 1VC0A 1UVLA 2KYXA 3RU0A 2J9CA 4C11B 1DRZA 2B0GA 1R27B 4KB7A 1VQ9S 2KHDA 3HXMA 3I4HX 4OI1A 5JUMA 4H4KA 3MM5A 1S6PB 4RNFA 2HAIA 2AJ0A 1ZETA 3MM8B 3TUJC 3ZZRA 4B9NA 4OI0A 2R2TA 1BGXT 4FF2A 3UDCA 3H98A 4MTPA 1HD1A 2DNOA 1Q7LB 2XSJB 4DFKA 1X4FA 1SBRA 4DOZA 3V5RA 1UAWA 2CPIA 2WB4A 2LU1A 2OPRB 3OR2A 4E8UA 5H9FJ 1AXQA 4RNOA 2IHR1 3DOLA 3DHXA 4C8NA 2WONA 2HLUA 5KG6A 4LF8F 2GIRA 1HNIA 2OP5A 4PCQA 3EX7B 2B51A 4HVZA 4OI2A 3CPWR 3CD5A 3OL9A 4OZJA 2ZH7A 2GW8A 4RX6A 5I42A 3I0RB 2DPJA 4IFVB 2VBYA 2ZJRQ 3GIMA 2J0QD 1XNQF 1S1VA 4DV2F 1U1KA 3MMAB 5C42A 3BJYA 2ZHBA 4ICLB 4C98A 3RBEA 4ATNA 4OQJA 1KONA 1TFYA 4RW7A 2GQCA 2ROEA 4JUZA 5KFYA 4E98A 1UA0A 3CULA 1IKVB 1UVIA 4J9SA 3M2UB 4F3QA 2C2DA 1R3NA 5HMYA 4ECYA 3F41A 1WELA 1P1TA 4Y6IA 5E41A 1Q86T 1XBWA 3DI6A 1TL1A 2NR0A 3MM6B 3VALA 3J81Y 1ZM9A 4WK1A 3HDSA 2QT7A 1Z1ZA 3DRSA 1NK4A 4FF1A 4ECQA 5LSOA 4MH8A 1OS5A 2UUCF 4EZ9A 1HNVA 1MNEA 2RRBA 3DU6A 1FRMA 3S1TA 1VQ6S 2HHTA 4LIWA 3ZZ0A 3QJPA 3DLKA 4HDHA 5DO2A 1VQPS 1KOHA 1NK7A 3QZ7A 3JTNA 3I0SB 2XGQA 2KT5A 1YRXA 4QU6A 3TVKA 4WF9Q 1Q8BA 4OZNA 2D3ZA 2HS0A 4R5PB 4B3RF 2R2SA 4QIGA 2FPHX 2HZCA 3OXFA 2ZKUA 2DIUA 2M0GB 3M6UA 3PR5B 2V4JB 2E5GA 4UUWA 4O4GB 5J2NA 4Y3CA 2HVIA 4IOAQ 5EX3A 4F4YA 4CT8A 3CCLS 1Y4ZB 3LGMA 2HS3A 3MTJA 3DRRB 2A10A 2I1RA 5K8NA 4P7TA 2MZQA 2RDIA 1BQMA 4C0HA 5A2QY 3T5LA 3RR7A 2J0WA 3M1VB 4YB1P 1LW0B 2FJXA 3OUYA 4PQUA 4IDKB 2MPUA 3NL0A 2YNIA 3ZZYA 2DHGA 3NRBA 4UQTA 1UETA 1JJHA 2K2PA 2VONA 1U8SA 2OFGX 5J1EA 1SJFA 2RRNA 4A8QA 3LO3A 1YG0A 1RT4B 1U24A 3NG8A 4QW9A 1FHTA 2FUG9 3MEDB 2VB6A 4BWMA 4JI5F 2XI3A 5KFOA 1XWLA 2CZ4A 1YTYA 2B5JA 1S1UB 2GO9A 4X84A 1R8PA 5LL6d 2G0CA 5BJRA 2BVZA 4KQZA 2AJ4A 2QE5A 3H40A 1X7VA 2VFRA 1LXJA 3CIZA 3CD0A 1R89A 2MGZB 1U1QA 1YRTA 3MXHP 2HVHA 1ZAXA 1S9EA 4NLUA 1SL1A 1IQTA 2IYIA 4WZMA 1XC9A 2XULA 3NNHA 3BR9A 1F60B 2IAJB 2ZH1A 4M1KA 2K3IA 5HLFA 3FNNA 2P5VA 2YKOA 4O44B 3OL7A 2CPFA 1NJXA 3HJFA 4KJIA 3T5KA 2VKZG 4P6QA 3H5XA 3TQ1A 5D78A 4I0WA 5AXKA 2KTQA 4TYAA 4RKUC 3BGRB 3DOMA 4K4TA 2XMJA 4M5DB 1XR6A 3NS5A 2HNZB 2MY7A 4HI1A 7FDRA 3KLFA 2ZH3A 5DG8A 3V6JA 2OKQA 1LW2A 1FRIA 4C2MA 2MKJA 2RKIA 2ILYA 1FRXA 2VPXB 1RQ0A 2V0NA 3DMJB 1Y5LB 4Y28C 2RQCA 2MMYA 3K2YA 3EXCX 3MFHA 3HKWA 4X4NA 4TLQA 1OIAA 3X1LB 1S48A 2B6AA 3DLGB 2Q79A 4C7QA 4DV7F 1JLFB 1CG2A 3T9NA 4B3TF 4ECUA 3O6QA 4OJ3A 4NLPA 5I4MA 2UP1A 3M8PB 3UR0A 2BZ2A 2VG5B 2C2RA 1HBUB 1S1XB 2FVQA 4DLEA 1U48A 4O23A 1TL4A 3FJ2A 1S49A 1W2IA 3BGFA 3RAQA 2BANB 2LQJA 3LP1A 2ZITA 2MZJA 4YEAA 3N4WA 1SI9A 3BQ0A 1D8YA 3C6UB 1PO6A 4UY85 1JLQB 3H5SA 4URSA 5DGAA 4BC7A 1O51A 2ZHAA 1KQSR 2VG7A 1FTRA 4K4VA 2DR9A 4EZ6A 4X4OA 2MKIA 4K4ZA 1G1XA 3IR5B 4ZKAA 2IYGA 5FDLB 3D1HA 3NGDA 2Q66A 2UV8G 1V6HA 5A0YB 4F3MA 4F4XA 4ZPDA 2DNHA 2EFQA 3VZHA 1FE0A 1IKYA 1H2UX 3H20A 5KTQA 3HHLB 5D4OA 4H4OA 4RNHA 1RTIA 1D9FA 5IQQA 2F8MA 3MMCA 3KG4A 5B0BA 1FA0A 3GYNA 4WFYA 3M30A 3FRZA 3OR2B 4I56A 4W90B 3DOLB 4MFBB 2D3OR 2E5HA 5U47A 3SEOA 3SSRA 4W92B 3MR6A 1H7XA 4IOBA 5IS2A 4X2BA 3OL6A 2AU0A 4ZPVR 1GNKA 1VK3A 1S1WA 4H54A 4CTAB 5IXUA 4RUAA 2ZH4A 4X4TA 1IKXB 3AB4B 2CPDA 2CQ4A 5AE1A 2XS2A 3PKYA 1JIHA 4PUOB 2HQIA 2ZE2B 3MD1A 1K9MT 2RMLA 3BN7A 4DPOA 5M2RA 2ZUGA 1X9MA 3ICLA 1F2GA 2HRUA 5A8WB 2GV1A 3W3SA 4KPYA 4Y2IA 3SSSA 1JLGB 2FB0A 2M8HA 4IG3A 4UW2A 5HP1B 1J5EF 4CCHA 2YWGA 3P5TL 4C4WA 2N3OA 2JZ5A 3TRGA 3KKFA 3QIDA 2MQPA 2Q3PA 4ZCMA 3KHHA 2ZD1B 4OHXA 1TZ0A 4DV3F 2BACA 1HNVB 2D1CA 2JOQA 2ASDA 3J7YI 3QLHB 2F3JA 1XERA 5M2UA 1U45A 1R43A 3PJWA 5B0EA 2IRUA 2L48A 2KJWA 2W7AA 1TR0A 4CO3A 2KO1A 1CEZA 1HWLA 1ZM3A 3WDOA 1RT7A 4A8OA 2PC6A 2YKMA 4UY8T 1X4AA 3PXGa 3HVTA 3K8WA 4JI0F 3C2PA 2AV5A 1AROP 1NAQA 4HTJA 4NCGB 3TVZA 3DOKA 4C8ZA 3R1HA 1HQUB 2ZC4A 2MHEA 3FZBA 1HWJA 3RBDA 2HHQA 2R7SA 3L3CA 1MMNA 1DTTA 4EFAC 3LW5C 4IRCA 3TYTA 1YJTA 3D5MA 2KFZA 1REVB 4WYWA 2OPQB 2BXJA 5C25A 1NRKA 4A4JA 1RYSA 5DM7Q 1DFDA 3MAQA 4JI8F 2UU9F 4LF9F 2IBKA 1P1LA 3CD6S 3CEDA 3B4MA 1Q8IA 4I4BA 1AFIA 4CO5A 2ZFHA 1IJFB 1VBYA 4IUFA 3LWMA 2B43A 3QGHA 4IQXA 3OUYB 2R8HA 4PQUB 2O5DA 2VODA 5KFTA 1U1OA 2GQQA 3OTBA 3T1HF 1JNZB 1VQ8S 1FDDA 1TV6B 4JOUA 1FKPA 2DB1A 3MZIA 3FMWA 3BQ1A 2VOOA 1X4DA 5DDQC 3P49B 2KZZA 2XGPA 5K9FA 2JC0A 5J1EB 3G8SA 3HVRA 3RTVA 1Y00A 3LUYA 3Q0AA 1SH0A 1R8BA 2HWIA 2BQRA 4DR5F 4KSEB 3Q8SB 1JWWA 5EDWA 3CO9A 2L9WA 3MM9B 3UI3A 3G6VA 4C3MA 2B4PA 3MCSA 4OI4A 1YSJA 2ALZA 2H5EA 2UV8A 4Y34A 5DG7A 1YJRA 3TO8A 2YH0A 3G71S 3MPYA 2JVOA 4NLWA 3CIMA 1J5OB 2FHMA 1VQMS 2C3PA 5CQGA 5IM0B 2LKZA 4DN9A 5DQHA 1S6QB 3W7BA 2F9DA 3PACA 4AQYF 1N36F 3AH6A 1C1CB 5LMUF 2ADBA 1TK5A 1WACA 4MAKA 5E3CA 4LQ3A 1UEUA 2E7WA 1YJNS 1MWZA 4YR3A 1WG4A 2R7VA 2VA2A 2FDNA 2VBZA 4DV0F 4TU9A 2OIHA 3KK3A 2RD5C 2HHXA 3HZEA 2ZDOA 1TKXA 3IRXA 1S76D 1C0TA 2VC0A 3KLFB 4AXIA 2AX1A 5DLGA 4QQBA 2QYCA 3IFEA 3GE9A 2LU2A 1X5TA 3JYTB 3OFEA 4NLTA 4CO4A 3PRBA 2MJUA 4R25A 3M9MB 4U67Q 1VI7A 2EFOA 2VBWA 3B82A 1QJHA 3SCLE 1YJWS 3CCRS 5DQGA 1OPZA 2YKNB 1URNA 2CQ3A 4BBYA 4KGKA 2ZJQQ 1NB7A 3M6WA 5E3PA 4OV1A 4G1IA 4NRUA 2CJ9A 3VQSA 1N56A 2B56A 3H2VE 1U26A 1N52B 2QSWA 2RE1A 3GFXA 4GC7A 3G9CA 3KNAA 1IJEB 4X65F 1F5BA 1VBZA 5F8JA 4J9LA 4MJKA 1S6PA 1TQLA 4K4UA 2YKAA 3BSAA 3IWLA 5GVQA 2J9DA 4DR4F 3J7YU 3MAHA 2F40A 3MEEA 1R0AB 2XSJA 1LQ9A 3HK2A 4WYLA 3TR5A 3DRXA 1U6FA 4YB7A 3BS9A 1ZM4A 2OPRA 3I55S 2VG7B 4AL6A 1LFWA 3NGKA 4IYQA 5T7LB 2E5IA 3CD7A 3JSYA 1C1BB 2YNFA 1QSYA 1IR0A 4NYOA 1F0XA 3IS9A 1YHQS 3GV5B 1CVJA 3TUZC 1GAOA 2YX7A 4ILRA 4IFVA 3PIPQ 4Q8FA 1UMJA 2ZBIA 3MR5A 2OAUA 2AD9A 3GR0A 2IVMA 3H25A 3V6DB 1MMDA 4PWDA 1TKDA 3MMAA 5EWFA 2VPYB 4ICLA 4IO9Q 1VJWA 1S7HA 2WRMA 2FJEB 3CDAA 3T6BA 2HNDA 4NL5A 3LGNA 3M30B 3MMBA 4N56A 1SJ1A 3VAHA 1VBXA 1OSCA 3GMGA 3JAMY 1IKVA 1H3DA 3AA8A 1M5VC 4JI2F 1JJ4A 1N0VC 3R5AA 5EX0A 1PGZA 5L39A 2L41A 4LF5F 2VQEF 1FNXH 3IAS9 2YWHA 2WBRA 4DL6A 3PJXA 5L9XA 3HVWA 3V4IB 2HHVA 4CQ1A 2VFTA 3C8YA 1Y3JA 2A18A 3MUTP 1D1UA 1UVJA 2HNYA 3SZ2A 1R8HA 4A8KA 2IJFA 2DISA 1C4AA 4RUCA 7FD1A 2PI4A 4FBUA 2R7XA 1NH8A 2PGCA 1FRJA 5HO4A 3I0SA 1XR7A 2R7UA 1U6ZA 4OI6A 5EN1A 4Q0BB 1U1RA 2NLWA 1YJ9S 4A47A 1APSA 2YVSA 3TARA 4OX6A 2XB2D 1SJ4P 3MR2A 2ZH6A 1U09A 1T03B 1N33F 4HYKA 4G1QA 4EWTA 4O4GA 3HKZD 2QMWA 4QWEA 4PR6A 4M94A 3BO2A 4WE1B 3MOZA 4YFUA 3DRRA 1ZPVA 4IG0A 4PQAA 1D3WA 5B7WA 1NK9A 1RT7B 2E29A 5E3QA 2FGCA 5KFCA 1MSWD 2C3UA 3M1VA 3RB4A 1OQ6A 1LW0A 5KOXA 1HHTP 3OVBA 4IDKA 2ROPA 3M8RA 2MQLA 3OXLA 4DL7A 2EBEA 2NSCA 4ZP6A 4B9SA 5CYMB 2ZZNA 4J5OA 4CZCA 2M8DB 1X8DA 3U1NA 3NS6A 1WHWA 5C25B 5KFFA 2YNHB 1RT4A 1QSLA 3OTDA 3H4BA 3K7RA 1XMQF 1X0PA 5KFLA 1UKUA 2PE8A 5E7OB 2HGNA 2OPPA 3BSOA 2FJVA 2ABYA 3RW7A 4OIXA 4C8MA 2CKWA 3LF0A 4ED6A 2HHSA 1YITS 3PNIA 3CE8A 4FXDA 2ZM6F 2E1MC 1Q79A 2V4QA 4FVMA 2DTJA 1Z4UA 3ETOA 2HFZA 1PC5A 3UR3C 2VPZB 3DCAA 3U1LA 3U27A 5CA5A 3EUNA 2IAJA 3MPVA 5K14B 4I6WA 2P6TA 4LF4F 2D