5IWAF

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5iwaF00
1IBLF 4DR2F 4DR7F 2F4VF 1IBMF 4DR4F 4GKKF 1J5EF 4B3RF 2YY3A 4DR3F 4DUYF 1I94F 4JI1F 1N32F 1XNQF 2UUCF 4B3SF 1B64A 4JI2F 5LMUF 1N36F 4LF4F 4KHPF 2B7CB 4JV5F 4AQYF 2UUBF 1N34F 4LF5F 1F60B 2UUAF 4DV6F 4X65F 4DR5F 1G7CB 2BVZA 4JI0F 1QJHA 1IBKF 4DR6F 2UXCF 4LFBF 4DR1F 4NXMF 2E5LF 2BXJA 1HNZF 2UXBF 2HHHF 1VMBA 4DV2F 4YHHF 5LMNF 4DUZF 3T1HF 4DV3F 2UXDF 1CQNA 3OTOF 3R3TA 2UU9F 1LOUA 3T1YF 4JI3F 4LF7F 4JI5F 4JI6F 4OX9F 4JI4F 4LF9F 1XNRF 2J5AA 2VQFF 4GKJF 1G1XA 4LFCF 2B7BB 1XMOF 4B3TF 4JI8F 4DV7F 4K0KF 2KJVA 1CQMA 4B3MF 4JYAF 2KJWA 1HR0F 1RISA 4DV1F 4DV0F 1FJGF 1HNWF 1XMQF 2RJZA 4LF6F 4X62F 4NXNF 1IJEB 4LF8F 5AJ3F 3ZZPA 5BR8F 1N33F 4JI7F 1IJFB 4DV4F 4X66F 4DV5F 4LFAF 1HNXF 2ZM6F 4YY3F 5IWAF 2VQEF 1GH8A 1FKAF 4X64F
chains in the Genus database with same CATH superfamily
1NK4A 1HW8A 1TKZA 2AEFA 1M0SA 4J7CA 4F0HA 2UUBJ 2PI5A 3PKYA 4DSFA 5A0YA 1YBUA 2BJ3A 4M8LA 3RGIA 1DFDA 2MGZB 2QA4S 3MM7B 4NLQA 2VB6A 2YY3A 1F6TA 1RZMA 2Q6CA 4CLUA 3MCNA 3RYLA 2XI3A 4OYZA 4P9SA 4JP8A 2IYGA 4IQMA 1S49A 3TR5A 3VGUA 3CD5A 3KK2A 3VCDA 5LJ3Y 2VKZG 3HFKA 3JYTB 3TJ8A 2P6SA 3CCES 3F41A 4HTIA 3ZTSA 5HQMA 3G4SS 4EUVA 1Y10A 1BY9A 3UFCX 1JLEA 3NY0A 1SBRA 4ECTA 3BO2A 4WTYA 3W9IA 3MR3A 2ACYA 4XO0A 2BJ9A 2DR7A 3FBFA 4O0IA 4EO6A 2B5JA 4O3RA 5B0GA 2O5DA 1FO1A 4DV7J 1VIOA 1IKYB 3CCLS 4HLBA 3MPYA 1SL1A 2XB2D 2QA1A 1URRA 1YJVA 2E29A 5FIIA 4USMA 4DR1F 3DLGA 1K1SA 3OR1B 2OPQB 4M5DB 3KLGB 4PWDB 2FLNA 3MM5A 2J8SA 2RRBA 5I3PA 4X66J 4ZMMA 2G2YA 4ZLPA 2DGOA 4ZIVA 2E5LF 4WWSA 2UV8A 5CYMA 3NCQA 3IS9A 3G9CA 3M2VA 2W7AA 2QL9B 4DV2F 3JB9k 2OELA 3NGUA 2HVIA 1V5IB 2HLUA 2JH3A 1R0AB 2M4MA 5AE2A 4X4OA 3OR2A 2MZSA 3MAHA 3LALA 2IHR1 4DUZF 1NO8A 1REVB 4ELUA 4PQUA 3HSDA 3AXMA 4LMZA 1IQTA 2EC2A 4IH6A 1Q82T 4DR2J 3TUZC 1X4CA 5KT3A 3D6HB 2MKIA 2XEXA 4HTJA 4F36A 2LU1A 1WC0A 3MD1A 4NZ7A 4U9RA 2JEGA 2QX0A 3BH6B 2IRXA 4U67Q 5DDPC 3HKWA 1NU4A 4KC5A 5H9FJ 2YH0A 3VZHA 5IV4A 4XPCA 4JI5F 1HFEL 3POTA 1TKZB 3QWUA 1BC6A 1W2IA 5KT7A 2VV5A 3KUHA 2MQLA 4Z7YA 1WHXA 1WWHA 1F9EB 3KLFA 3M2UB 1IR2A 4Y65A 1YIJS 3QSYB 1G1XA 3SZ2A 1GT8A 3QT6A 2H3EB 2KH9A 1P1LA 1SVDA 1FXDA 1H3DA 2VC0A 3S8SA 4F4YA 5K8PA 3TJ9A 2C2DA 3LANA 1XN9A 3G2XA 2GMLA 2X7IA 3DLGB 3MHYA 4LIWA 5DJBA 2F63A 4G6VB 2Y0BB 1WC6A 4RZRA 3ZNJ1 3C8YA 4X4RA 1TTHB 5ADZA 2CWKA 1Q8IA 3NRBA 2OEKA 3CJ3A 1J5OB 4ZITA 1LK5A 3QO9A 4C8OA 2Q6BA 3I96A 4C4WA 2MLZA 3FEXB 2RJZA 4F3MA 4MYUA 1RTDB 1O0PA 2F5GA 3N4WA 2G2OA 4KBIA 2ZZNA 4KO0B 2U1AA 1HKAA 1AXQA 2UXCJ 2F8HA 1XIQA 4TQSA 5GMDA 1ZYQA 3MM5B 2XSJA 3N0VA 3NMRA 2D9OA 4I2QA 3J81Y 1NHKL 2XNRA 2QGFB 4ZVRB 3M9OB 4DV5F 2HS4A 1T9WA 3MEGB 3SSRA 3W5ZA 4YY3F 2ZM6F 1VQ7S 2L9WA 1IQZA 2DK2A 2KYZA 3T6BA 2AHOB 4X4TA 1RBOB 3UVJA 3R7SB 1IM4A 2RDDA 1TKDA 2R2TA 2KB2A 4CYUB 3RU0A 1Q1KA 2IVYA 3O2IA 2GGPA 2OPSB 3HFZB 3BYPA 2FHKA 4MK7A 5HBMB 2AYEA 1H7WA 4KKOB 3IN5A 4DR2F 1VQ4S 5IOLA 5HJXA 1VQ8S 3BSCA 5HI7A 2YNFA 3RG6A 3ZTRA 4ATNA 3SV4A 2MB0B 4DF4A 2FJEB 2KXFA 4NEYA 2CYYA 2KFYA 4I56A 5KG5A 2Z2YB 5IQQA 2GIRA 1NSAA 2B0GA 3ZZ0A 5L38A 4CP5A 4A8MP 2J9DE 1S9GB 1DQAA 1HWUA 2HRYA 4PR6A 3ZZRA 3PW7A 4JV5F 1S48A 4GC7A 1UEUA 5KG4A 3WX4A 2JFDA 4LSZB 1F60B 4L72B 2YWFA 1QTMA 3RAXA 4B3TJ 4MTPA 3CJTA 1QY7A 4WP3A 4CNYA 2YKAA 3ENQA 4DJBA 1MROA 1RHMB 2VPYB 1FF2A 1XTZA 1N32J 2YNHA 2BR0A 5G4DA 1BLUA 4DV4J 2DGSA 5LSOA 3OTCA 4X4UA 1S10A 1KD1T 3M2RB 3QIPA 4M63A 3S01A 2H4WB 2EXUA 4K5SA 2JC0A 1D0EA 4ED5A 4DQQA 2BANA 5JVGQ 3CGIA 5IT4A 1FTCA 1U1KA 2DITA 1JK9B 1O8BA 1D1UA 2DGXA 3DOMB 4DZ6A 1REGX 1YJUA 3T6JA 4HT5A 4R5PB 1YZ7A 1HWIA 3AB2B 1ZETA 2ERRA 3H5XA 1KFSA 3P5BP 3I55S 3GMGA 1NNDA 1WHWA 4RW6A 3FNNA 3GG1A 2QT7A 3PYEA 4XTTA 2VG6A 1HBNB 4ZPAA 3VALA 1FT8A 4IOBA 2D7SA 1FNXH 3K2YA 1ZH5A 1U1PA 1RTZA 4CO2A 3AD7C 5G0RB 5THWA 3FSYA 3GIMA 2NUHA 1F2HA 4BBYA 3R5BA 1FJGJ 1RT1B 4DL0C 3HSJA 2M9KA 3M8PB 3TA0A 5KFPA 3EM1A 4HACB 1WUUA 4M5MA 4FNHA 4X62J 2J6SA 1Q53A 4J9KA 2VBZA 4WU3A 3TI0A 1TP7A 2FVCA 2VKRA 3MPDA 3H2VE 3SCJE 1FVSA 1MROB 3AHPA 5DZ7A 3R5GA 1VHIA 3MOZA 4C8NA 1HBOB 4DDFA 1IKWB 4P7VA 4OI3A 5I42B 3SQGA 3LAKA 4KGMA 4C11B 1MWZA 3FCWA 2VOPA 3UCGA 4WFAQ 4OQJA 2VG7B 4PG8A 3A3PB 3TARA 3MECB 1S1VA 3KDNA 3R5CA 4K4WA 9ATCB 1S1XA 2N4CA 2M8HA 1TL3A 1IJEB 3DKDA 1UETA 4MKAA 1LWFB 2YVSA 1OY9A 1X4GA 3KLIB 2B4OA 4U6PA 5FLXY 2BACA 3DFEA 5H9EJ 1YTYA 1VQ9S 1AB8A 3K8WA 1KSPA 1NK8A 2Y1RI 3GCXP 4A8WA 1UWAA 1KOOA 1NK6A 2IIHA 2OMLA 1KVKA 3C14B 4CH1A 5L9XA 1R8PA 5K14B 1CJKA 2DEJA 4OZNA 5DG9A 5LL6d 3CD6S 1FXLA 2HURA 1MWQA 2POKA 3B82A 3R5JB 2B3TB 1RT7B 2DH9A 3AY0A 4K7QA 4RJVA 3WZ0A 3OTBA 4KPCA 5A8RA 4CLPA 3RBXA 5F8GA 1K73T 3M7VA 4DLGA 1TV6B 3BEGB 4JOUA 1B0PA 3JSMB 5D4PA 3BKUA 1WEXA 4NL5A 2QIFA 5EX3A 2AJFE 2W24A 3DLLQ 3H5YA 2NYIA 2ALZA 3V4IB 4ZVHA 3QZ8A 1RAIB 2CADA 2J7KA 1IBMF 1RTJB 3R5AA 4NA1A 1ZOTA 4U7CA 3PW0A 2EEYA 2H4YB 1T94A 1EKRA 2W01A 2WRMA 3AJ2A 4LRDA 1EKSA 2GMHA 2HLTA 1ZAWA 2FY1A 4DPWA 1EJ7L 2CQIA 4TNOA 2NLWA 3HDSA 4GRSA 1HHSA 4MK9A 1FD8A 1JLEB 1BQXA 2XZWA 3W2WA 1N88A 5JUMA 1K0TA 3CIZA 2EG2A 2E7WA 2X1AA 3CCQS 2K1RB 4G65A 3JYTA 3HULA 4PXCA 4OJGA 2F9JA 1B4SA 1EARA 3CJ5A 3I9ZA 4HEA9 4NI2A 1TKXB 1HBOA 2R7OA 3CCSS 1UEVA 2WSEC 3LO3A 4DR6F 2Q43A 2QRRA 3BN7A 3CJRA 2HW3A 1JNRB 2CZ4A 5EWFA 3Q23A 2CPZA 1RHRB 5EWGA 1NK9A 1NBEB 1WSVA 2AGQA 4PQUB 6AT1B 4R0EA 4QW9A 1S1WA 2DNPA 1FK9B 1O51A 2MQNA 5D4LA 1REVA 3LF0A 4NCAA 3M30B 4NRTA 3M05A 4J9SA 1G6BA 3SIPB 5CYMB 4QR0A 4ED7A 4DL6A 3ILIA 1U1OA 4ITSA 3M2VB 2R7XA 1IKVA 2DT9A 5K5MA 3TZWA 2ZH5A 5ETOA 1WG4A 1B3TA 2FJWA 2B6AB 2DIUA 4ES2A 2LECA 1RTJA 1CULB 2Y1LB 1IBKJ 4FBTA 2ZH9A 2GQ2A 1KWMA 3W63A 2AJ4A 2MYFA 1D09B 4FXVA 4RUCA 3L9ZA 3W60A 5K8OA 2DGVA 5J1PA 4G1QB 2X1FA 5EN1A 1PG5B 2AT1B 4WIQA 2GHPA 4CO4A 2W1BA 4WFNQ 1KDNA 1M5PC 2EI5A 2Z2ZA 2XY7A 2M2BA 4JI2J 3HCXA 2CQGA 3MTJA 2Q66A 1YBTA 1KP6A 5KFQA 2ZDOA 5KFEA 3K58A 2CPDA 5IT9Y 3FFIB 1IWGA 3MMAB 1SKWA 3UDLA 5CABA 3JAMY 2ZWPA 1XWLA 1RWNB 2UUTA 4HI1A 2X3GA 3A8IA 2OKQA 1RTHA 2CQ4A 3EVMA 2B7BB 2KT5A 4ZPCA 1LW0A 5HLFA 5A6PA 3D2WA 4OLOA 3OJSA 2VASA 1NAQA 1UL3A 3K8VA 3MEEB 4LT6A 1JLBB 1WACA 4QPXA 1U26A 3CJ2A 3ISNC 4QWEA 4K4VA 2RKIA 4Y2AA 1X4AA 1RYRA 3TUPA 4B3MF 2RMLA 2RD5C 2YNIB 4F2SA 1TL7A 2FYXA 1VRTA 2Q1LA 2FD2A 1OY6A 1D8ZA 1RT4A 2AYMA 3I6PA 5E3QA 3R5DA 2V68A 2AF6A 5KG1A 2W7OA 4Y28C 4DG1B 4DPOA 4ZKAA 2BV3A 5D6GA 2HHHJ 3KHGA 3RTVA 4LF8F 1E6YA 4HDGA 1Y5NB 2HZVA 1YZ6A 3NWGA 3R97A 4BHQA 5IC6B 3GTYX 4ECXA 5HMWA 1RDRA 2CJQA 3THPA 2WVDA 4P2XA 4X66F 1SJ1A 2FZKB 3DGPA 4UUWA 5D4NA 2FZCB 4LFAF 2M52A 3AOBA 4FYDA 1Q5YA 1UZHA 4OZLA 3MOJB 4ILLA 5AXLA 5D4OA 4B08A 2O67A 2RRNA 3Q86A 4KKOA 4RBUA 5C5JA 1KKHA 2PFDA 2OEJA 2Z2LA 5KFWA 4DV0J 1RLDA 5C2CA 4X4SA 3KLVA 3GV7B 4YR0A 1U6ZA 1BQMB 2ROEA 3DM2A 5ETSA 4DV0F 2HFZA 2ZFHA 3AD8C 4EU0A 1JLQB 4KGVB 5ETVA 4ETXA 4RNMA 1WNEA 3E51A 4N5SA 2FLPA 3DLBA 1R6VA 2C1EB 3KWMA 5T41A 3TW0A 5L1LA 4F2RA 3UCZP 5IXUA 2LEAA 1PYTA 1RCXB 3CW2C 4CM2A 3KNGA 3N28A 4RUAA 2M5YA 3MEEA 1C1BA 5LOQA 4DUYF 4K4XA 1C0UB 1NUEA 2BE2A 3TAMB 2ROGA 4EYHB 3PV8A 5BJRA 1N32F 5KFZA 3HVTA 1X5SA 2ZH8A 4JI2F 4M5KA 4FP9A 2ASDA 2IC3B 3ZC4A 3IAM9 3D54A 3BSOA 3HVWA 4WE1A 4Y34A 4LF4F 1X9MA 2V6AA 1RCOB 1WDTA 3W66A 4DI6A 1R7IA 2VH7A 5HROA 4NLTA 4WFXA 2YTCA 1RA7A 3MTKA 5KG3A 4UW2A 4FXWA 5IT0A 2N82B 3RRGA 1L5UA 1DTQA 2IDEA 2LKZA 4OHWA 3VQSA 3IC1A 2ZNYA 2E44A 4H4MA 4B3MJ 3SI8A 1UWBA 4PPDA 2B9XA 2HHPA 1N56A 3C15B 5IFMA 4DL7A 1Z1ZA 3KHLA 1VQPS 3ISZA 2MSTA 3N6LA 2XCPA 2AYGA 4LF7J 3N01A 5JMNA 4JI6J 1UVKA 1OYEA 1WJ9A 1IBCB 1S6UA 4IDKB 3CJ8A 3QGGA 3F44A 2R8IA 4L73A 1N34J 1T7PA 2XYHB 3X3UA 4B3OB 1U02A 1VHFA 2E1RA 3T1HF 5G0RA 1AROP 1VBKA 2OO4A 3FKBA 3FQKA 3HSGA 3NGRA 1NSQA 2V94A 1JJCB 2HAFA 4MIAA 2D74B 4X65J 1KC8T 4IRDA 1Y4ZB 5M2UA 4OFZA 1KVJA 1VJQA 3EWGA 3BGUA 4HHHA 5LXRA 2NXCA 3TNVA 5D0HA 4YFUA 2VIHA 2YWKA 3KK1B 1RK8A 4DHVA 1FJEB 1ZM9A 3BH7B 5I4MA 4DSLA 1KQFB 4ES3A 2CNNB 2YBVA 2WVBA 2C2KB 2GJFA 4BWMA 1VRUA 3M4XA 3ILOA 4OI0A 4QU7A 1FDAA 3OD2A 3QZ7A 3BQ0A 1WOOA 3K17A 3UDEA 3SDEA 4P75A 4EBDA 2J5AA 2OGUA 5C25B 3HT3A 1YJ9S 1QLNA 1JKHB 3ZO7A 4P52A 2DKOB 4RLEA 5HJYA 1CC7A 3SQGB 1BUXA 4FVMA 4Q2MA 5C42A 4LFCF 1CEZA 2QL7B 3NCRA 4OYPA 1U8SA 3G82B 3OFGA 4C8MA 4O4GB 2F7VA 4LBHA 4DU7A 1UWBB 4ED2A 4C9DA 2C2RA 1UJ4A 1WSRA 4Q44A 1C4AA 2GIFA 1HWJA 2FC8A 2LP4A 2MKYA 5GAHI 4DS4A 4JYAF 4QR1A 3W2VB 1KEKA 2VBYA 1VC6A 5KOXA 1FE4A 4MAKA 1FWKA 1GK8A 4EFAC 5CD4A 3QRRA 2IM0A 3EGZA 2DGTA 3GFYA 1U48A 4C11A 4N76A 1AW0A 2FGOA 2MTLA 2MZTA 2OPPB 1KQSR 2PD1A 3W5XA 1NDLA 1NJXA 4NA3A 1RT7A 3HF5A 5HSPA 2W7PA 2JEJA 5E2QA 5F8IA 3C3LA 1VQLS 3OTOJ 2D3UA 3KUEA 1S9EA 2RF2B 3GQCA 1SV5A 2EK1A 4HHUA 5HANA 1KQKA 3KLIA 1HNXF 5F3ZA 1S79A 1S12A 2XGQA 4K4ZA 2AGOA 3QWPA 3JSMA 3CDAA 1RAOA 2VDHA 2UXBJ 1VQSA 3VAIA 4K50A 3SDEB 3NMAA 1HQEB 1S7IA 1U2FA 1UP1A 2L9NA 2PT0A 2ZVSA 5KFKA 2RQCA 1TFYA 2HHTA 1U25A 3ZXWA 4YDDB 2DH8A 1FWLA 4I7FB 1T02A 2FGCA 4ZVTB 6FD1A 4XPEA 4X4QA 4YP3A 1M1KT 3UDCA 2SXLA 3MR5A 4USKA 2WOMB 1XMOJ 3HPOA 2Y1IA 4DR1J 4IRKA 3CSKA 4ZP7A 5KFIA 2AU0A 4I64A 1VGYA 1RYSA 2C3YA 4ZVQB 3UD5A 2E1CA 1E6VB 2BKNA 1DBDA 8AT1B 5GADI 2V2KA 2ZE2B 4WK1A 5FD1A 3QYYA 2XMTA 4TQRA 1LFPA 3DHXA 1FRIA 2HGMA 4NA2A 5KFVA 4ED1A 1ZTWA 3BGFA 2VJVA 1WI6A 3RRHA 1H2UX 1LNQA 4BLGA 5CAAA 4F3OA 2G0CA 2WVCA 1VLOA 2QLXA 2CJBA 2JLGA 4ID5A 4IG3A 2N3OA 2OMOA 2QLWA 2B8PA 2BRKA 1RXOB 3OUYA 3MAAB 1IBKF 2YH1A 3KLHB 4Y2CA 5B09A 5DQHA 3EGWB 2BM1A 4RO0A 4LJMA 3L7PA 5CCMA 2GX8A 1G2EA 3MM9B 1TR0A 4M5NA 1TL4A 1ZPVA 4OYBA 4ED3A 2WVEA 5HVGA 2VICA 3EZUA 1QSSA 3AD9C 2CNOB 2VBWA 2E1PA 2RNEA 4RW7A 3O44A 1HD0A 4TXSA 5KFMA 4K4YA 1PYSB 1Y5LB 2WSFC 1QSYA 1D9AA 4A8KA 4DFJA 3C19A 1MU2A 4U8YA 2JWNA 4PG6A 1VOMA 4D3GA 2XO6A 1H38A 3HHDA 2M0GB 4Y6IA 5B0CA 4FVCA 3W8PA 3ZTPA 1RABB 1TUGB 1UPPA 3HJVA 1WTFA 3R3TA 2FVQA 2MGZA 1CBKA 1YHQS 3F0NA 2BE7D 3C66A 2DH7A 1NPPA 2R4FA 2MKSA 2HS0A 3D4JA 4NYOA 2NUUG 3R1LA 4U7UD 1GNKA 3I9V9 2I6WA 1JLFA 2KYXA 4J37A 2ZJPQ 1HYSB 3LP2A 2UUCJ 1H2TZ 2CNLB 4ZCLA 1UFLA 4M5JA 3M1VB 4DV2J 2RS2A 4HHJA 4FBUA 2N4DA 4ZVSB 3QFHA 3V6DA 2DNNA 2IBOA 3TZXA 1WC4A 4IFYA 4J9UE 1WC5A 2BEFA 4N8OA 4WXWA 1RT5B 3BR8A 3FEYB 1C2PA 2V2QA 3MM8A 2AZ1A 3QLHA 4LSNB 4QQBA 2DCUB 4EWTA 4C2MA 3KLGA 1XMOF 3CMES 4ZHRA 3JTNA 2FIUA 4NLYA 3H90A 4IOCQ 2ZWOA 1RAJA 3IXQA 3MD3A 2X1BA 4O3OA 5KFYA 3V6HA 2AEJA 1N5VA 1RISA 2V9WA 1WF1A 2OPRA 3D68A 3PHEA 2DHGA 5CZXA 3PXGa 3H8YA 3LGMA 3LP0A 3OR2B 4ID5B 2BUNA 3G86A 4PUOA 1RT2A 1U1LA 2YNIA 5D8HB 4KY3A 9RUBA 3VGVA 1SUQA 5KTQA 3OL8A 3R1HA 1RT4B 3T9ZA 4LSLA 1APSA 4ZN3A 2CPYA 4IUFA 1N33F 4RBTA 3AH6A 5KFSA 3KLEA 3MM9A 3CCJS 3BKTA 4I6YA 3PW5A 4YMEA 1FRLA 1RHKB 2GAGC 2CUYA 1S1TB 2W8LA 1WOSA 1DY3A 3CULA 5IV3A 4LR9A 5IS2A 1PAUB 4RU2A 1LQ9A 4KHRA 3M2UA 4A8SA 2LU2A 1OYDA 3TYTA 3DDKA 4F3QA 4Y00A 1U47A 2MMYA 1I3OB 1DAXA 2WONB 3OSNA 4UY8T 2HNDA 4WKRA 1UCNA 1GMUA 2YX7A 4QIFA 3DLEB 3EJMA 4IH5A 1JJ2R 3H5UA 2ZH1A 1BWVA 2LQBA 1ACMB 1WG5A 4ZA1A 1N5YB 2KZMA 1GAOA 5GAEI 2AKWB 3CB4A 1QE1A 1MSWD 1VI7A 2DNMA 2DNGA 4OHXA 1VBXA 4EZ9A 3TAQA 2PGCA 3IA0A 7FD1A 4DBQA 1TL5A 2YNGA 3FRZA 1UMJA 2NXJA 4OYWA 3TA2A 4LF9J 3IG1A 5MAOA 1NJYA 1N36F 4KHPF 2HHXA 4LRBA 2C3UA 5DG7A 3VAKA 2AQ4A 3NGDA 1TL1B 4AQYF 1IKXB 2ZBIA 1S1WB 1N34F 3AJ1A 4LQ9A 4C8KA 2OP5A 2UUAF 3HFVA 2G13A 1LW2A 4KQZA 3UCUP 4NYPA 4X65F 4RPFA 3Q83A 3DRPA 4Z2XA 1N6QB 2BKPA 2XSJB 1M5OC 2HFOA 2QYGA 4NLRA 5HVFA 2VHGA 3ILJA 3VVTA 1FNOA 1GQEA 4KR0B 3QJPA 1SIWB 1LV5A 3HM9A 3BYRA 2ROPA 2IMWP 1FKPB 2LFVA 2WONA 2KVQE 5LMNF 1VJWA 4CM0A 1MG7A 3FVYA 4FYYB 4PXEA 1AFIA 1TU0B 1QUPA 3D1OA 2V4JA 3OVBA 3DRRB 3H42A 2EFQA 3MUTP 1NRKA 3TA1A 2FTRA 2DY1A 1NHVA 2KKHA 2D9PA 2OD6A 1JWWA 2WK4A 1HR0F 2H1YA 1SL2A 4I68A 1SKRA 4OHYA 1T0TV 4LFBJ 5KFJA 4M5DA 1EX8A 3GB0A 4TLRA 5M2PA 3H4BA 2WB4A 2IMOA 1T11A 3DGVA 3G71S 4FXDA 1HQUB 1RHUB 1B70B 4FDFA 5D0EA 1HQ2A 1BE4A 3V6JA 2MHNA 1H0HB 2HQFA 2MJUA 1UPMB 3DRXA 4PXDA 5KOWA 2NCKL 3ZZYA 4DPTA 2XCAA 4KGKA 4FN5A 4N47A 3V6KA 2WW4A 3IP0A 2FVPA 4LF5J 1A0OB 2HBYB 2R42A 3BS9A 1M1GA 2ASYA 2DTJA 2JFKA 2P9EA 3CNQP 4DEZA 4ES1A 1U09A 1F9FA 5F8MA 4IFVB 1V3ZA 2KJVA 2IJRA 1NJZA 4ZOSA 2UVVA 5HK4A 2GO8A 1YWXA 3O8WA 1ZBTA 3J80Y 3PG9A 4KSEB 2CQ2A 2W2MP 1NPRA 4CLZA 3DU6A 4FF1A 1IKXA 3UN3A 2IRUA 5HP1A 2DISA 2XI2A 1HNWF 1CS4B 2M3DA 3MUVP 4X62F 2W2PP 2ZOMA 1WI8A 4C8LA 4I2PA 3D1QA 2FJAB 3LGNA 2ACMA 2DHHA 2HGNA 1CJTA 3Q8YA 2FUG9 1HBNA 1SQFA 3EGNA 3DOLB 4E0DA 4NWBA 5LJ5Y 1Q7YT 4FS1A 4NASA 3GR1A 2RRAA 1YI2S 2PMHA 5HO4A 1VFJA 3HP6A 5L8RC 2GS8A 2V5HG 2AEMA 2IJFA 1ZTTA 4IH7A 2MEWA 3A4TA 3UD4P 4QW8A 2HRUA 3PCOB 3UQSA 1H7XA 4N56A 4B9VA 4ZVUB 1KLMA 1T95A 2BDPA 1AYEA 3QO9B 2H5JB 4B3SF 2LQ9A 2W2QP 4HACA 5H1SV 2XLIA 4NRUA 3JTOA 2NXNA 4O0NA 2G4BA 3F56A 3MWBA 2HWTA 3CDEA 4KV8B 1NJWA 4DR7F 4L3KA 2JLFA 3O5TB 3TVYA 1A9NB 2W2OP 1HMVB 1KR4A 2VA2A 1FRMA 3GV8B 4DFKA 4USTA 1IKWA 2X3DA 1FKOA 1PIEA 4ANEA 2CPJA 1M1HA 5EGYA 4NPOA 4Q0BB 2R3VA 2QTWA 2GNKA 3OHBA 1S1XB 2DYAA 2P2CB 2EFGA 2F1FA 5GAHU 2GJIA 1JLCA 3BF4A 1O5JA 3MECA 2C42A 3LGHA 5CH7B 5K9FA 4C8ZA 2VF3A 1YKWA 4USJC 2W9AA 4DSEA 2ZEJA 3WX8A 4AL5A 4N77A 4LFCJ 1HLWA 1U24A 2VPZB 4DV6F 2DPJA 2VOOA 2D3ZA 4MKYA 3K57A 3HHLC 4DQPA 1PBUA 3C14A 5CYJA 3CUNA 1F2GA 1NXIA 1YG0A 4OJ3A 4F67A 1Q8LA 2UXCF 3M9NB 2HEKA 4NLWA 2E1AA 2E5GA 2R8JA 1M5KC 2BYCA 2HBZB 2I5JB 3PJ9A 5J2NB 5GAGU 3OUYB 3IWNC 2EFVA 5KFFA 3IRXA 3FJ2A 3OLAA 1RT6B 2OUGA 4ED6A 1VC5A 5F9LA 2V67A 4CWBA 1EQ0A 1DLOA 2ADBA 1F1BB 2KU7A 1WC3A 4ECYA 2BX6A 2WBRA 4CRJA 1URNA 2X51A 4RU9A 1WDDA 2KO1A 1VRUB 2M88A 4XDDA 1K0VA 2E5IA 2P5VA 4DL2A 1N54B 4QIEA 2UXDJ 1QAYA 4WFBQ 1QAXA 1WC1A 1CQNA 3SXLA 4DCJB 4ZJQA 1SB6A 4HVZA 2CIMA 1U6FA 2DNRA 2CQBA 2EK6A 2FPHX 2HFSA 4KIAA 4DR6J 4JBCA 4Q7AA 3CEDA 3K89A 2VG5A 4F8RA 3BGLA 5L1KA 2DHAA 3KHHA 3T1YF 3ENAA 2MZRA 5M2RA 3GFXA 4CLSA 1NCLA 2GZOA 3MM8B 1S0OA 3MR7A 3D3BJ 1S1UA 3KK3A 5CCLA 3NOGA 3G96A 4JI4F 3NAHA 1XQIA 1IR0A 1RUSA 2KL8A 2IVFB 3L7OA 4NCGB 4DN0A 2CQDA 2FVRA 3ENWA 5HMZA 2XTJP 3R6GB 1HI8A 2XBPA 4BDPA 1V3SA 4O3PA 2GC8A 1PC5A 2CQ1A 4OI4A 1MMDA 1TKTA 2KHCA 4ANDA 3C6UB 4B3TF 4QYZJ 2BMBA 4RW6B 2RE1A 1MLAA 3Q89A 4JI8F 5CHCB 2KG1A 1CQMA 5BYQA 4LSNA 2WW8A 4PQAA 4C8YA 1M5SA 1LWCA 3M8ZA 4M94A 5F0WA 3ETOA 1RGVA 2E5HA 2JVOA 3ITHB 2DXFA 1SC4B 2DO0A 3ADAC 3OFEA 4RW9A 2QO3A 2XWXA 3AODA 4Y2MA 1RJJA 3S1TA 4F0KA 5L46A 3HMJG 4M95A 4H4KA 5KFGA 2RIJA 2W4PA 3BR9A 1AUSL 4W98A 3SFGA 1UTAA 5IM0A 3HHLD 3R8YA 3HSZA 4ECWA 2FB0A 3PIOQ 2CWXA 2WAQD 3CWJA 4HR2A 4ZPBA 2MKKA 4BC7A 3FUYA 3BGRA 1XR7A 4IYQA 3PR4A 5D0RA 4JI7F 2W4DA 4ZDNA 4DCPB 3MMBB 1QVGR 4DUYJ 1SCJB 2CQHA 1NMEB 2J9DA 4H4KC 4TY8B 4W92B 2G2ZA 4CQ1A 2Y9HA 3MFIA 1UAWA 1JXEA 3VWSA 3D6TB 1T3OA 1HWLA 1MNEA 3LWMA 1F5CA 4JB8B 5E3PA 2MQPA 1SIZA 5A2QY 3NNCA 3U1LA 3MMAA 3R9LA 1F0XA 3KJFB 3KK2B 2J0XA 1ZA1B 3AOCA 5ETMA 3WDOA 4NXNJ 1UW9A 3H20A 2XS2A 3Q0AA 1X0FA 4O3SA 1ZAXA 2F4VF 4ICLB 4E98A 5A8WA 3PYGA 4XIUA 4WJBA 2I2YA 2HHQA 2ZKUA 2QFJA 1AA1B 4LRCA 4URQU 3T1YJ 2HFVA 4K5RA 4UUXA 4ALZA 2RT3A 4ZK7M 3G82A 4QWAA 3MAAA 4WXOA 2UUCF 3QMQA 3QRPA 1NKEA 2F65A 2XYGB 1TL1A 4JI4J 3UE2A 5LMUF 1HNZJ 4NCGA 2K2PA 3CJKA 3VAHA 1K8AT 2XY5A 4X64J 2PEHA 1VIXA 1TV6A 4ILRA 3W62A 3FCHA 3EGVA 2HMIB 4PKDB 4FYXB 1BGXT 2KHDA 5F8JA 4P10A 4A48A 5K8NA 2YKQA 3C16A 3BDEA 1N0VC 3FBBA 4PEOA 3AAWB 1GXTA 2FJDB 4PG5A 3MMBA 1RAGB 5E33A 4DR3J 3KOAA 4LFBF 1LW2B 3BPSP 1S6OA 1WORA 3U02A 4TLQA 4NLSA 4B9MA 1OPIA 3DRPB 2NPIA 1HBUB 1YRTA 2HG4A 2M7SA 2COLA 4FYVB 2V4JB 4X4NA 4C98A 1XEZA 5ETRA 1YSJA 4WZMA 1NLKL 3CJ4A 3IWLA 5T7LB 1GMVA 3SSSA 2R2UA 2NZCA 1S6QA 3GYGA 4EGLA 5BXIA 3DM2B 2DNHA 4LBPA 5AXNA 1HNIB 3POTB 4B9UA 3FGVA 2CAJA 4ZCIA 4R25A 1X7VA 1F3FA 4C6AA 3A3OB 2KFZA 3VR1A 1DQ8A 2DXEA 2GVDA 3BSNA 3HZGA 4MFBB 4JV0A 2MY8A 1FFSB 1C1BB 2QA2A 4B9NA 1EQMA 1Y11A 3QGIA 3DYAB 3GIRA 5AE3A 1FRXA 3I5BA 4QBUA 4B3RJ 3A3NB 3P4UB 4MKBA 3K5LA 1VYAA 3EDRB 5JVHQ 2UP1A 4JYAJ 5DO2A 1GEHA 2JLEA 1WEZA 4EK2A 2DPIA 2DEIA 1FD2A 1TUVA 1VISA 3IBCB 3R7NB 4QWCA 3RBEA 4MK8A 4ZIWA 1BWEA 2NXUA 2VPWB 1NDCA 3D6MB 2K3IA 2ZE2A 1WKKA 3US5A 2QMXA 5KT4A 4GKJF 1T9VA 2A1BA 1P1TA 3LP0B 5I42A 2CPXA 3MPVA 1U6BA 1R3NA 2DRDA 3JQMA 3LH2S 3EZ5A 2XULA 3BN4A 3ET6B 1P6TA 2XMJA 2C3OA 4IO9Q 1IXKA 1SXLA 3D7SB 4WBFA 1SC1B 5F8HA 1HNXJ 4JI3J 2GGPB 1FWPA 3DNCA 3R6LB 1F9HA 3UNYA 4DPXA 2XSFA 1WTBA 1Q8BA 1X9SA 1KBRA 1HI1A 1LWEB 2KDOA 5DS7A 4B3OA 2JHEA 4QIVA 1TK5A 1B7FA 3T5HA 1HHQA 2ABYA 3PRVA 4CLTA 4J9MA 5B0EA 4ECUA 2K8GA 2V8VA 1AFJA 1RWOB 2YKMA 4BCAA 2NQPA 4P7TA 2QFIA 4Q8FA 3THVA 1S9GA 3J7ZT 1R89A 1AT1B 1FE0A 3IWXA 4ZLLA 3KK1A 2AIRB 3N5BA 5L1IA 3VAGA 2V9KA 2YNFB 3MF5A 4NLXA 4ZVPB 4RNOA 1JLAB 2ZHAA 2JC1A 4NXMJ 4E8UA 3OV7A 1TK8A 5RUBA 2VDIA 2WHOA 1UFWA 4ID8A 1QDUB 2YPYA 4ZP9A 3BBFA 3ZZOA 4I67A 3OXGA 4U7UK 3TANA 2I8EA 2FJXA 2EFPA 3M6VA 4KV8A 4DX8H 7AT1B 3E01B 5KG6A 4AYBD 2ADCA 1S59A 1U0HA 2ZC4A 4NX9A 4ZPDA 3CCUS 3KNAA 4KHMA 1Q4RA 2BJDA 3NBPA 1IBLF 3GPAA 3I5AA 2B51A 1RAFB 3AT1B 3NXZA 3J7YU 4GMKA 1RE1B 2ILZA 1V9OA 3FQLA 2J76E 3K7RA 4ZPWR 5K8MA 2OHDA 4M5GA 3DLHA 2MSSA 3M8SA 2HQGA 1YRXA 1B64A 1RHQB 1CG2A 3CD7A 3NLCA 4RWXA 4J9QA 4J9VA 2ZH4A 2A2DA 2I9SA 4YB5A 2V4QA 3H4DA 5D0GA 4TN2A 2KT3A 2DRBA 3L09A 1SJ3P 4R8UA 4DMZA 2EWHA 4Q5VA 3MM6B 4LREA 4ZS6A 2EKNA 1H98A 2BVZA 4A47A 3RB3A 2ZC3A 2EVZA 2IDLA 1NPKA 3DDIA 4NLDA 1F3VA 4RWWA 2PSZA 1SV5B 5K20B 3KJQB 3A12A 3GILA 1B99A 2RB7A 1P9YA 1VDHA 3KLEB 2KG0A 3T3FA 1R27B 2FHJD 3VAMA 2G1HA 4OI1A 4EI2A 1IKVB 4P72A 2WBMA 1RWMB 4Z7CA 4IR1A 2B6AA 3J80U 2ZM6J 2PI4A 2L3MA 3W7BA 3NKYA 3H98A 1TZ0A 3M8PA 4RNHA 2AD9A 3DC2A 3T1AA 4P2MA 1DLOB 4CNZA 4UQGA 2R7RA 1NM2A 4NLGA 4B9TA 3NWRA 2BJ1A 2KVIA 3H40A 2OSQA 4ED0A 3PX6A 2CJKA 2MHEA 2OSRA 2IM1A 3AXKA 5KFNA 4AUKA 3D9BA 3CDWA 5EHHA 2ZH6A 3CJSA 2UU9F 1FJCA 5E3AA 4C0OC 5FJ4A 4LRAA 1ZAVA 4PG4A 1SJQA 1X8DA 2V8GA 1OPZA 5KT2A 2ZH7A 4ZN1A 4OL8A 3C6TA 4L75A 4C7QA 3HHNB 4QYRA 1S4FA 2DHSA 3ZZZA 1S1VB 4IDKA 4YHHJ 1U1RA 3IG1B 4LF4J 4NE9C 4UF4A 4N7TA 1S1UB 1LWCB 2DBBA 3KK3B 4J9RA 5J2MA 2J9CA 3WHIA 2B8QA 2FJVA 3W65A 2GCFA 3OR1A 5J2QB 3IFEA 5LSRA 1WF2A 2CZ9A 1KTQA 3VZIA 1BD6A 2ZBPA 3NGKA 1ZM4A 2ZNZA 4O4RA 3MI7X 1QAIA 2CVEA 3NOCA 1WD6A 3KTQA 1GX6A 2A0FB 2NSCA 1RLCL 2OFGX 3BBCA 1RP5A 1OSCA 2O3DA 3CJ0A 3OXLA 4OHZA 1X4FA 3K5OA 1RAHB 3RUBL 3TEHB 4B17A 4R8UB 3RB0A 3BSAA 7FDRA 5IM0B 3M9MB 1L3UA 4C0BA 1CC8A 4CT8A 2NZ4A 1LXJA 3OT9A 1KLMB 3GV5B 3K0JA 4RW9B 3GIKA 4NXNF 2GFFA 4F25A 3DMJB 2N3LA 4ZCMA 3Q22A 3M8QB 4W90B 2V2VA 1UJ6A 1HPZA 1TVRA 3OPKA 4LUBA 2MQ8A 3CCTA 1VRQC 2CNKB 4PYAA 4PRFA 1NDPA 3DLKA 5EUHA 1U2RA 2RUGA 2B9EA 2EW9A 2GA7A 8RUCA 5IZHA 3V4IA 1KRPA 3VAJA 1Q95G 3BGRB 4HL9A 1JKHA 4PWUA 5HN0A 1HMVA 1SPBP 1XBWA 2CQ3A 2UV8G 2NS1B 1NH7A 3FEZA 2GMJA 4NI2B 3KG4A 1PBAA 4OYXA 1NZAA 1QUVA 3GFHA 3OL7A 4XK8C 3DU5A 2XZTB 2JZ5A 3PFOA 2VQFJ 4F4WA 4ZPVR 4RW4A 4A46A 4IO1A 5DM6Q 3PW2A 2E9RX 3MURP 3B78A 3G6YA 4DU8A 3BO3A 1T03B 1J5EF 1GX5A 2RF2A 2Y8WA 1RT3B 5HATA 2ZH2A 4USUA 3PM9A 4WK3A 3QT7A 4FS2A 4ECSA 3H59A 1F5AA 4I4BA 3RAMA 2Z58B 3V2UC 3A1YG 2IVMA 4F7VA 5C7PA 4DFMA 2JVRA 4WU2A 1JXVA 3VF0B 4KE5A 1Q81T 2Z2MA 3V81A 1I5OB 2J8AA 4ILMA 3W61A 4ZP8A 1DTTA 2VONA 1M90T 5DQIA 3QJLA 3UR3C 3PHTA 1Z4UA 3KJVB 2LDYA 2LQJA 1FRHA 4TVAB 2I0XA 3IGNA 4JI0F 4JI8J 2Q79A 4GKKJ 2FHMA 3M8YA 1D3WA 3UNGC 4F50A 1JXLA 3RR8A 1M5HA 1RWVB 4OYIA 2F8MA 4F02A 2M8DB 5ETPA 2XS5A 3C16B 1S9FA 3Q2TC 5FDLB 2YXLA 4ETZA 1Y0HA 1VS3A 3JXOA 3DI6B 5ITHA 1BHNA 5HL7Q 1PKUA 3BM7A 2R7TA 5DM7Q 3ISND 3UI3A 1PAEX 3DHWC 3UO0A 1X4BA 1ZA2B 2J9EA 5F8LA 3O3LA 2W9CA 1N5QA 1NHUA 1W25A 4DV3F 3EXCX 1P27B 1TL7B 2C2MB 3MAQA 3Q24A 1WHVA 1FTRA 1CJVA 1U2CA 3JSRA 2PE8A 4V1Ak 1DHMA 3UN5A 5DETA 1T03A 2Y1JA 3FDSA 2F9DA 3CE8A 4AFFA 1Z2LA 3M32B 1JLBA 4R0JA 1RTHB 1RB0A 4I1TA 1KTVA 2R7QA 4L3NA 4TKTA 4ED4A 4O3NA 4U95A 5E41A 4QOTA 3MR6A 2W8KA 3NP5A 1EHWA 1TMMA 3CMQA 3IM8A 2OAUA 3PDNA 1PCAA 4M5IA 4NLOA 4NEZA 3U1MA 3SYZA 1XC9A 4JI6F 4OX7A 3FRYA 1UEKA 1GXLA 2Q3PA 3QT8A 3AJDA 4YEAA 2C3PA 4DG1A 2CG8A 5LMNJ 4CLLA 2LVWA 3T9NA 4CH7A 3K59A 2HHWA 1HD1A 2XHWA 2YWEA 1KHWA 2F4VJ 1N0UA 2D1CA 3N6MA 4X84A 3UN2A 3BJYA 2HHVA 1OY8A 3W64A 2B43A 1R31A 4Z37A 2QV6A 5D77A 1VQ6S 3MPWA 4IKAA 2ZBQA 3HHLA 3TZYA 1QVFR 4K0KF 2R8GA 4NOHA 6FDRA 2VPXB 3D1HA 3A8KA 2XYPB 2F40A 3FMBA 3GP9A 3GJSB 1S6PA 3V81B 3NCPA 3QPIA 3W9JA 3RBZA 1FKPA 1FXRA 2HSEB 1FEEA 5H9EK 2P6TA 4K59A 2Y8YA 4UOFA 3UDVA 2FDNA 2I38A 2L9DA 2ZBRA 1XMQF 4LF6F 5A8KB 4J9LA 4JUZA 4IQXA 1FCAA 1JLFB 1QD1A 3PEHA 4P74A 3AB4B 3EVOA 2XG8A 2NYHA 4URGA 3MCOA 4AL7A 1KN6A 5JXSA 1RBAA 1MMLA 5FDLA 1N4LA 3GE9A 2AYBA 1KQGB 2DNYA 3Q2SC 1XMBA 4MYTA 4USWA 3Q8QB 2XMMA 2HKEA 4DV4F 2RS8A 4G3IA 2B9YA 3I5CA 4OMFG 1RA6A 1ZZFA 3CT9A 3E8OA 4LIRA 3PY8A 1UVIA 1V5VA 4QIGA 3KHRA 4UTGA 1FFWB 3NBPB 3ZTQA 3EMTA 2HBRB 2VJUA 1HNWJ 4YR3A 3QIDA 4M5HA 3T19A 2QG9B 4DQSA 1FK9A 2QJ3A 3CD0A 1MN9A 2VFUA 5DGAA 1X4HA 2PA8D 2GIQA 3QNWB 3LTOA 4B3RF 3D5MA 2IJNA 4DWIA 4FF3A 2XMUA 2X1GA 3S6EA 1DARA 1BXNA 1TKTB 3HD2A 1CULA 2BOPA 5CA5A 3KYLA 2YKPA 4NCBA 3J7A1 5KG0A 3VV2B 1L3VA 5U47A 2CKWA 2G0IA 3G8QA 5J2PA 2BQRA 5J1NA 4CYUA 4OX9J 2XS7A 3JSYA 2APOA 4A8XA 1SH2A 5BYSA 2ASJA 1ZPWX 2BBEA 5H9FK 2W2NP 4B3SJ 1MW7A 1FX2A 1FEHA 2HNDB 2RH3A 2RHSB 3GR0A 3MPUB 3HVAA 4LR7A 4ZVFA 3J7Z5 5T14A 4OZ1A 3T5KA 4MIBA 3VQTA 4DSIA 4DX5A 2R7SA 2N7YA 3VGSA 3P49B 3EZOA 3I4HX 1N5SA 2VFTA 3PTWA 4DPUA 5K14A 2LEBA 2AGPA 1D8YA 1S0VA 3W3SA 4K0KJ 3BQ1A 1QE1B 2QEXS 1YRUA 3A8EA 1GMWA 2XNQA 1CJUB 1LW0B 2V8PA 3FZ2A 1DRZA 3EPGA 2HZAA 4WCEQ 2XO7A 3FSIA 2OPSA 5HBMA 1VQMS 3GU0A 2VA3A 3FBEA 2PC6A 3I87A 2CJYB 1T9UA 3D3CJ 2KXNB 1LKZA 1FNMA 1Y00A 3CDUA 2HVEA 2Z30B 4N8NA 2AZ3A 2IM2A 3FZBA 3GJQB 3NS7B 3SCLE 4YHHF 2J6UA 4HKQA 5AJ3J 1UVJA 2ZHBA 4C0HA 2K06A 3PACA 4CCHA 2LXIA 4EEYA 3C46A 2P8IA 4DV6J 4NYZA 4FF2A 3FC9A 3KUGA 2YNGB 5E5NA 1H6KX 2YNHB 1YJRA 2XMVA 3KDOA 2A3JA 1M5VC 3OL9A 2ASLA 3JSBA 3L7UA 2HHUA 2AJ0A 5EWEA 2EFNA 1LOUA 1C0TA 2BABA 2HIYA 5DGBA 1S4EA 1GMWD 2GHVC 1FDDA 1RT5A 1QTNB 2ZOGA 3CDBA 2K1RA 2VBXA 4TU7A 4R5PA 4L76A 4LF9F 2Z56B 3MUMP 2DO4A 3PYDA 2VFVA 1RTDA 1Y7PA 4KHPJ 1OSDA 5F41A 3OJUA 2ZUGA 1WHYA 3C6TB 2EFOA 2MZ1A 3J81j 2R7UA 1Y3JA 3M2RA 4LQ3A 4ECRA 4JI7J 1SI9A 1WKLA 3DRSB 2PN6A 1UVNA 4X2BA 3D0IE 4KYZA 1LWXA 2VG6B 2HGLA 4CO1A 2NREA 4AL6A 4RL1A 5J2QA 1YDLA 1LK7A 3S7RA 2F4FA 3LPYA 2V0NA 4FYWB 4NMXA 1ELOA 3TWZA 5A0YB 2J6TA 2QSWA 1JJ4A 1UVMA 2XMKA 5GMKa 1EZZB 4ENOA 4DXLA 4USVA 3JTPA 3P3DA 3PFEA 2W9BB 1K44A 2XM3A 1SL0A 2RQKA 3MMJA 5KFDA 4QZVB 2AP6A 3TZZA 3TEGA 4OYOA 5ETKA 3AQOA 1T9XA 4PPZA 1S72S 2A10A 1U0SA 4IFVA 3THTA 1PYOB 5LT5A 1EETA 2HNYA 5SZTA 2O1PA 1H72C 4MIWA 3CCRS 4GVBA 4MFBA 2MZQA 4K4UA 4OZ5A 2KI2A 2E9TA 3DLEA 1VK3A 2DB1A 3OBIA 1UJ5A 2V2ZA 2B5JB 3FFIA 3UR0A 2VQEF 1R0BG 1RWUA 2P9CA 3OFHA 1UVLA 2V34A 3BBBA 2VD3A 3O1LA 2YKOA 4X64F 2D3O1 1P8GA 3H0PA 1YITS 2MQMA 5DRKA 5FLXU 3KJNB 1H73A 2HPUA 2DVIA 5ETLA 2CXEA 4HH0A 3TUJC 1RWXB 1TK0A 2MKHA 3W5YA 4CLFA 2GO9A 3PRBA 4CTAA 3CCWA 3KLHA 4DR3F 3OW2R 1NKBA 1HIYA 2HIQA 2YQ0A 2HZCA 2HQCA 3H2LA 1NJIT 1I94F 4J9PA 4Y0FA 5KFBA 5LXYA 2OEMA 1DTTB 2MKCA 3N9UC 3RZAA 4I2PB 1FJ7A 1X31C 3QAEA 4FZVA 2RQ4A 3QQCD 4AD6A 4EMDA 1L3KA 4RW8A 1E6YB 2B7CB 2YPZA 2WTFA 2MZJA 3WC2A 2HHSA 2YWHA 2KZZA 2KT2A 3WBZA 3PIPQ 2EC0A 1SC6A 2FJBB 2ZD1B 1ULRA 2MY7A 4RW7B 1SJ4P 3SV3A 3R27A 5CYQB 3NS5A 3BGOP 3LP2B 1SC3B 2FZGB 2ZVIA 3TP2A 3MR2A 4DV3J 1G7CB 4CLYA 1T3NA 1HHTP 2A2CA 2I1RA 1QSLA 1NKCA 4ERDA 3T5LA 2JEIA 4F04B 3KJVA 2HNYB 4O44B 4ZCKA 4JI1J 1JB0C 4OYAA 4WYWA 3EPIA 1IR1A 1RACB 3GSIA 3CPWR 3CC2S 4O4GA 1XNQJ 3NAIA 5MLCV 4BC9A 2YWGA 4ZJOA 4PWWA 1F5BA 2W9BA 1IN0A 2V8DA 3W2WB 3BQ2A 1SH3A 1SQGA 4WP9A 1VMBA 3CCZA 3P8BB 3JQJA 1RTIA 1TMJA 2W4CA 4AQYJ 2FLLA 4LF8J 4GKJJ 1G3OA 1T05A 1T9TA 5CQGA 2YQ3A 2AX1A 3J7AN 2VL1A 4N41A 2IFXA 4C3MA 3SBMA 3BB5A 1JX4A 4P2SA 1IM6A 1ICEB 1J27A 2HVDA 2Z57B 1C1CA 1I1GA 3PNIA 4FF4A 2ILYA 4DR4J 4OI2A 2VODA 3IM9A 1L3TA 1CJVB 1Q8KA 4PZVA 1G4CA 4JI3F 2OTJS 2B9WA 4IG0A 5J1EB 3WQPA 4KO0A 3ZFVA 2HVZA 3BV8A 5KG7A 3PO5A 5HROB 1GTHA 1TKXA 3CIMA 1Y3KA 4F26A 2EPIA 1KVIA 3DRYA 3G6XA 1J5OA 1EAYC 5E3CA 1XNRF 5D3GA 4QR2A 1VCTA 2VQFF 1R6YA 3MGJA 2CQ0A 4DQIA 2BW7A 3CO0P 2WVFA 2MXYA 2E7XA 3TAPA 1NSKL 2LXFA 5KT5A 2C2OB 5KFCA 1RWKB 4OIXA 5LSLA 5KFUA 2DR6A 3GJTB 3MCSA 2VG5B 4O44A 4F4ZA 2LCWA 4RUBA 1YJTA 1CJTB 1XJWB 4WFYA 1HNIA 5A8KA 3NG8A 1D9DA 3MEDB 4OX6A 1SJFA 3JAMU 4BWJA 1S6QB 3TOQA 3PZPA 4WIIA 2UVUA 3C2PA 2KRBA 5B0DA 3ZTOA 4L74A 3BKFA 1S6PB 2LA4A 2WB1D 3ZZTA 2OD4A 5A76A 3I56S 3EUNA 4O3QA 3CMAS 2C28A 2ZDPA 4KGXB 2A18A 4J9OA 3I0RA 3TVKA 2DD8S 3C6UA 4AXJA 4A8QA 2RDJA 5E7OB 4ECZA 3RAQA 1S76D 4Y3CA 1FRKA 2D3OR 1FDBA 1U7LA 3L95X 4MKVA 4CDIA 4CT9A 4CLKA 4YQWA 1PC4A 1V6HA 2C2EA 1N5YA 1TFWA 3MDFA 1LWFA 3T5JA 3CC4S 1TQLA 2HS3A 4FNIA 3SCKE 4OZJA 4DCOB 3VAFA 2DXDA 4TYAA 1VBZA 1T05B 1S99A 1GH8A 3B4MA 4EBCA 1FKAF 5D3GB 3PO4A 3IS9B 2XGPA 4RX6A 2DGUA 1TUWA 3K5NA 3VHQA 5BR8J 1ZM3A 2IRYA 1NDKA 3AFGA 2VZ9A 3N5FA 3ONQA 1CSJA 4OZ0A 5F9NA 5I3UA 2OH2A 4UOHA 2QC3A 5DQGA 3QBCA 1PJ6A 2EKYA 4MJKA 2VC1A 1OO0B 3LA0A 2HVHA 5B0BA 1HL6A 1OMSA 1Y9OA 2YQ1A 3CTRA 4PCQA 5DDQC 4TU8A 1H74A 4HYKA 2V4RA 4C3KA 1OWXA 5B08A 2E5LJ 1T8EA 3NNHA 4U8VA 3KXDA 3DXSX 3HHEA 4E2FB 2HRTA 3ETMA 3MMCA 2LYVA 1B0TA 1DZ5A 1JLGA 4KAIA 1CPZA 4OLPA 5L39A 2G0JA 4RUHA 4K4SA 5IQ6A 2KFNA 2J7UA 3M1VA 4NZ6A 1RT6A 3D0HE 3GLJA 1FX4A 1JLAA 1Q5VA 1W26A 2BE2B 3IMQJ 2R8HA 2MLYA 1LFWA 1QJHA 2V50A 2ZBCA 1U1QA 3TUIC 1C0UA 3TAMA 5SUHA 2CVIA 3QLHB 5GMEA 2UU9J 3ZNUA 3I32A 2FHOB 1JLQA 1RQ0A 4ZHRB 1JIHA 3H5SA 5DG8A 1WG1A 1N52B 2RSQA 3B4DA 3M6XA 4F0MA 4WE1B 2BQUA 4LBIA 3EDQB 2UVWA 1XMQJ 1MMNA 2HQDA 1YVFA 3GZ7A 2BJ7A 2OPRB 1K1QA 1PGZA 2U2FA 4OX8A 3TRGA 3OHAA 3HVTB 2DNKA 3FK4A 4PYDA 2ZH3A 2UXDF 2RAQA 3UW1A 3VVUA 4C48A 5HQ8A 1VQOS 2CJ9A 3MXHP 1JQGA 1S77D 4EO8A 4LF2A 3FMWA 1RU2A 5F8NA 1VBYA 2FHJA 2BZ2A 4NLUA 2R7WA 3A8JA 3LUYA 2G9OA 3G87A 1X4DA 3DXBA 4G1IA 1BMQB 3V5RA 1ZS6A 5CD4H 2BKOA 1HR0J 4QYZK 3QAUA 3ULHA 2QLJB 3B6BA 2C3MA 3MMCB 4IG3B 2HK2A 2BQ3A 4WPAA 3DCAA 1CS4A 3H2UB 3KG1A 4P73A 1NK0A 1YLXA 3UVJB 4DX7A 4DF8A 4PG7A 3CXCR 1PSDA 3P96A 3C15A 1S5ZA 5ETTA 3D66A 2NSBA 2LLZA 1DJ0A 3MEKA 3LOUA 4CI0B 4WKYA 2NR0A 1H2VZ 4HDHA 2XQCA 1VQKS 2CQCA 2Y3YA 1S57A 3PJWA 3RRKA 2QE5A 3DRSA 3AA8A 2B56A 2CDRB 4O23A 4UOCA 1NB2A 3TQ1A 5KFOA 3E2EA 1BQNB 4F4KA 1T9YA 1MU2B 1JLGB 2CPHA 3F73A 4DV1F 2DR5A 3KMSA 3A13A 4JI5J 2QA4G 1S0MA 5IT9U 4EZ6A 1ROFA 4QIWD 3HX9A 2BE9B 2XLJA 2DGWA 3PVXA 2UUWA 5D15A 2GQCA 4Q0BA 4GO7X 2H65B 3GYNA 1SKSA 2IAJB 1UA1A 4GVBB 2RU3A 3ET6A 2P9GA 4MMOA 2RILA 3O6QA 1RKIA 2FVSA 3I31A 2IY5B 1KFDA 2BW2A 4J9NA 4JV2A 2A6OA 1N6QA 2WSCC 3GYXB 4OHVA 3VTIA 2GVZA 5L9NA 4B9LA 3HO1A 5KFLA 3Q8RB 3RW6A 1R0AA 3IAS9 2E66A 3BO4A 2KM8B 2BANB 2BM0A 4UT4A 1NB7A 2QMWA 2HNZA 2CJAA 3QIPB 2OPPA 1U45A 2XZDB 2K7JA 1RI7A 1JLCB 2FC9A 3HT0A 1N5TA 3DOKA 4QWBA 2PMZD 1YJWS 2D69A 4GKKF 3B8HA 4I6WA 3GJRB 1HBMB 1NH8A 2IA0A 2V63A 2ALYB 4GVLA 3KFWX 3OL6A 2N7CA 1J2VA 1EP4B 4JI1F 1HW9A 2OIHA 2C2ZB 2HMIA 1FFGB 4XDCA 2ZJQQ 3HK2A 3HKZD 1HQEA 3OVAA 3KLFB 2LMIA 2ATLA 3E3XA 4YN3B 3DMJA 3D6FB 2MQOA 1FA0A 2W25A 1WEYA 3CCMS 1U0HB 3M30A 4B02A 1HA1A 2ZZTA 3NGTA 2F3JA 5EX0A 1YK9A 4DN9A 2JJ4D 2QN6B 3M6UA 4CLWA 1ITPA 3OTDA 3CCVS 2V69A 2IPOB 2V8HA 3TVZA 2QLFB 4GC6A 2LDIA 3DLKB 4DOZA 2JSXA 2XLKA 3W8GA 4B9SA 4LRFA 2H9ZA 5F0UA 4RR5A 5CZVA 2XMWA 4DV1J 2LQ5A 2E1MC 4Q45A 2BXJA 2K3KA 3AA9A 3IR6B 4YB7A 4Q43A 2VU5A 3IO1A 1RKJA 5LMUJ 1HNZF 2EG1A 3I4PA 4RNNA 2QYCA 2BA9A 5B0AA 3PR5B 2JRSA 1DURA 1YQHA 4YB6A 5F3TA 3Q8VA 4WTOB 1D9FA 2AJQA 2AW0A 5C24A 5I3QA 1GTEA 3CO9A 2VG7A 4AXIA 4Q8EA 5HP1B 4IG0B 5J1EA 1N33J 4S0MA 4ZLNA 1NEEA 1YGYA 3ITHA 5GADU 4I2QB 4NLPA 2OPQA 1U4BA 1IBLJ 1HARA 4JI0J 2CFXA 1HBMA 4PWDA 2GQQA 3J81U 3LP1A 5HMYA 4HH1A 1OQ3A 3LAMA 4OJ1A 4TYBA 2ZUAA 3PRDA 2Z4PA 3IBWA 1RADB 1PJ7A 5L1JA 2IM3A 1FERA 1HNVB 2B4VA 4FPIA 2R2RA 2HNZB 2R9LA 1Z2ZA 5A6WA 1KOHA 2WZ1A 2MDAA 2PIIA 4ZJLA 5KFXA 1TAQA 4URSA 3PX4A 2XC9A 3M8WA 2C22A 3GONA 4XAKA 2O01C 2LA6A 5A8RB 3OQ2A 3ELHA 2DIVA 1R8HA 1ZM2A 3M6WA 4J91A 3N6NA 3KMQA 4QU6A 1RU1A 3HI9A 1HYSA 1X5OA 1I94J 4DR5J 1PO6A 2QMUB 2ZHOA 1KHVA 3CVKA 1VQ5S 1UKUA 4ELTA 3Q8UA 4H4OB 3IR5B 3N79A 1L3SA 1N36J 5C42B 2PA3A 4ED8A 1NK5A 1RSCA 1MN7A 2PEBA 5GAEU 4DSJA 3ZZUA 4Q2LA 2BRLA 2W9CB 3V6DB 1EB0A 3MCMA 2M70A 5DLGA 4A8YA 1X5TA 2B4PA 3D28A 3L4BC 2EBGA 3LQVA 5D78A 3TX8A 5C24B 1YBAA 4IR9A 1AZSB 2ZJRQ 1K47A 2B4UA 2CQPA 3IR7B 1CLFA 1Q78A 3P45B 3U27A 1S97A 2HFNA 2IC3A 2DR8A 1IBMJ 1Q7LB 3B54A 4CH0S 2H48B 1N8RT 2IYIA 5AXKA 2AJ2A 3UPFA 1N48A 1UA0A 2GW8A 3LP1B 3JS9A 2D41A 3M32A 2MPUA 3RB6A 1U8WA 5A8WB 5A2QU 3GIIA 8ATCB 2R2SA 4QCLA 1DTQB 4TU9A 2VFRA 2Z0GA 1SUQB 2DY9A 3HVRA 4YB1P 2RU9A 3DDNA 4PUOB 2BJEA 2KN4A 2XHCA 5KT6A 3LWLA 5CXTA 4LF6J 2ZKTA 3W1YC 5E0OA 3K5MA 3CJKB 3PW4A 2HWHA 4RW8B 4WFZA 2OTLS 1R8BA 5ETQA 4YR2A 4HT7A 4YUDA 2R8KA 4DR4F 3TQEA 4LVOP 2JOQA 3QJJA 4P71A 2DR9A 1B0VA 3GWCA 1LXNA 2CPIA 1SQEA 3HHLB 4OV6A 1IVZA 2JX2A 1YJ7A 1P9QC 1X0PA 4H4MB 5HMXA 5I3UB 2FY8A 2RDIA 1Q16B 2PO4A 3MM7A 4LSLB 2H5EA 5IWAJ 2Z8QA 3IBFB 4I7FA 4Y2KA 2UXBF 3M8QA 1PILA 1OJ4A 2DCLA 2JL9A 4ECQA 5T7LA 4I69A 4EBEA 4UZBA 1VK8A 2EBEA 4OV1A 4ZVEA 5HVHA 2JNJA 4ZVGA 2UUBF 2LQ8A 4LF5F 2O66A 2L41A 1U1MA 4DR5F 5KFTA 3VGTA 4K2XA 1VQYA 4NZ0A 2XY6A 2KTQA 2CDQA 1RHJB 1VC0A 5HLFB 2GVDB 1TELA 1Q79A 2OJ3A 1IKYA 3OXFA 3CC7S 4WZQA 1YX2A 1I51B 2WCXA 4DX6A 3HJFA 1FDNA 1R0CB 2RHQB 2DRAA 3QFWA 4DL3A 2R7VA 3UWTA 3NNAA 1VRTB 4DUTA 4PAAA 3P6YC 2QZ8A 3G6ES 2BJ8A 3H25A 4KTQA 3W2VA 2HYIB 2DNLA 2XWYA 3NS6A 3KKFA 4H54A 2GJ2A 4AT1B 3OTOF 4KH1B 4QWDA 1DQ9A 2E9ZA 3EYZA 4M1KA 4ANCA 4CO5A 3X1LB 4CTAB 1XR6A 4ZVOB 2YKMB 5J2MB 4OZ2A 4P6QA 2HK3A 2DNZA 3DOMA 1W7WA 4RBVA 3H7HB 4CIOA 3WIUA 1U49A 4L6V3 1OQ6A 1FI4A 3G8TA 3MEDA 4DR7J 4C3LA 3GFZA 1UW4A 2HFUA 4KFBA 4X4PA 3HZEA 3CF5Q 4U96A 4IOAQ 2F8EX 2H54B 1CJUA 2ZITA 2VFSA 3FBCA 2RVJA 4NLVA 4ZP6A 3QSIA 3BZQA 3EX7B 5J2NA 1Q86T 1XERA 1I6JA 1S9EB 4G1PA 2JEFA 3Q8SB 1QAJA 4ICLA 4I6AA 2PMWA 2YWWA 3I0RB 4LFAJ 2MQQA 1YJNS 4MH8A 2KJWA 1UZDA 3WIVA 4UOGA 3GIJA 3DRRA 1RWWB 4QPTA 1WKJA 4DL4A 3I82A 4UY85 4DL5A 1R8CA 2QSFA 3BREA 3Q8PB 1VR6A 3E01A 1WELA 3NGSA 4KT0C 3OFFA 3I0SB 3DN9A 3FCVA 1S7HA 4WYLA 1RAEB 1GXUA 5KFAA 2GVZB 4IRCA 1E6VA 5ETNA 1GFWB 2CA9A 4OZ3A 5EDWA 1LEOA 3PJXA 3MEGA 4LVNP 3SFUA 1NZ8A 1C0TB 1R8AA 2LEPA 3LPEA 1IJFB 5KFRA 1SJRA 5DLFA 3KG0A 3RR7A 3ILLA 3P5TL 1IUJA 1TAUA 4OYMA 4AE5A 2IAJA 1XR5A 4FKXA 1C1CB 4LR8A 3MM6A 4DLEA 3EICA 2DHXA 4QJVA 4RW4B 1X4EA 2NXEA 2QLBB 3BPDA 3SSQA 4P2FA 1HWKA 4J5OA 4WP8A 3TJAA 1UFKA 3R7BB 5GAGI 1K9MT 2HBQB 4K4TA 1VQNS 1XK8A 5KAKA 5KG2A 4CZCA 1KLNA 2Y0SD 3QT5A 4K2JA 2UUAJ 2DNQA 2OLWA 1X60A 2DGQA 4GO5X 1EP4A 4YDXA 5HAOA 4C97A 3WC0A 4DFPA 2UZAA 4ELVA 3IRWP 3FSXA 4HI2A 4UZCA 1CJKB 5HQLA 5E3RA 3BDPA 1Q0NA 3RJMB 2E5JA 2OI2A 3DOKB 2CPFA 2XMAA 4DV5J 1KNZA 1XNQF 3GSDA 3GCWP 2L08A 3PX0A 4YY3J 2J0SD 4USIA 2AJ1A 2KM8C 3TX0A 2VQEJ 4BS2A 4KH0B 4PXBA 1O6XA 2A6MA 2KRRA 3EE3A 3OLBA 4JV1A 1KONA 2GV1A 2GHWA 2OFHX 3JQKA 4X4VA 1SH0A 4KFBB 4D3HA 1NSPA 3I0SA 5AXMA 4CO3A 4V19X 3ENVA 3PEJA 5C25A 4ZLJA 3MFHA 1OS5A 5B7WA 3RB4A 2ZZMA 1JNZB 3DI6A 1WOPA 1EETB 4TY8A 3SEOA 1FKOB 2FQQB 4NMLA 1J5EJ 4DSKA 1W2BR 3RW7A 4OI6A 4DZDA 1X9WA 4K8RA 3D0GE 3G6VA 3EXYA 4YOEA 3AOAA 5AT1B 4Y2IA 2YKNB 2ATCB 4KJIA 2J7WA 2HAIA 1SKUB 4IFYB 4NXMF 1A7GE 2DNOA 4F4XA 1RAAB 1ZZNA 1VLYA 3OVSA 4KRWA 2HQIA 4PABA 2AV5A 4RKUC 5B0FA 2IA6A 2PDAA 3J7YI 3QGPA 4V19J 3R2CJ 4JV5J 1PJ5A 3CJQA 4A8OA 3DLJA 1AUDA 2AWZA 2MKJA 1FESA 4UQTA 1LWEA 5DZ6A 1HNVA 2LXUA 3V4MA 1A6LA 5KFHA 3U1NA 5J2PB 4LF1A 4RNFA 5GVQA 1FHTA 3DGPB 1R43A 4A8FA 4A4JA 1MWYA 3IRXB 3W9HA 3PKMA 2FLOA 3G8SA 2I5JA 3AQPA 1FRJA 3MZIA 1B7YB 5LM7E 2AMCB 1C4CA 3D67A 3IGVA 3TO8A 3HXMA 2CRLA 4W4MA 3RBDA 1CVJA 1BQMA 1RWPB 3SMZA 1JJHA 2MJNA 2RQMA 3K5PA 1S0NA 4LF7F 2ZD1A 3SCIE 4J90A 4OX9F 5CYQA 1RT2B 2CJXB 1BQNA 1S1TA 4M5LA 3OTEA 1RT1A 3NEKA 3T1HJ 3HD1A 3NL0A 1KS2A 1HQUA 3ICLA 2DJWA 2GAHC 5DDRC 4H4OA 4DS5A 4G1QA 1HBUA 1JMTA 2WOMA 3LW5C 4OJHA 4TY9A 3HHKA 1FVQA 3U7JA 4DV7F 4DQRA 2AX0A 3QRQA 2H5IB 1HPZB 1IWAA 1TVRB 2NPFA 5JJBA 3OSPA 4USHA 3T41A 1EIYB 2CZVC 2VUGA 2CG4A 2PFFB 1Y5IB 4ECVA 4EYIB 3QGHA 4KGZB 1AZSA 3GG0A 1TL3B 3HLUA 3EVWA 1FJGF 4CO0A 2J0WA 5BYRA 2HHHF 1XNRJ 2E7VA 2RUSA 4FKYA 5AE1A 2C2NA 1RTIB 1U1NA 1X5PA 4I0WA 3QATA 1QM9A 5IC4B 5AJ3F 3ZZPA 1V3RA 4DPYA 5BR8F 4DUZJ 1RBLA 2JDJA 3DYAA 3PYFA 4MT1A 4ZPTR 2RKIB 2K7KA 3SQOP 3UD3P 2YKNA 2G1DA 1WF0A 2KXHA 2H51B 1HI0P 2IBKA 4FPRA 4WF9Q 2ZOFA 1RT3A 2J0QD 4KPYA 4KB7A 2YX4A 2MLXA 3R2DJ 4ER8A 5IWAF 2UVRA 2BOAA 2HQ3A 2L48A 4F4AA 4YS2A 3DOLA 5DDOC 2CPEA 2HWIA 2YX1A 1NK7A 3M8RA 5C2GA 2QL5B 3L3CA 1OIAA
chains in the Genus database with same CATH topology
1NK4A 1HW8A 1TKZA 2PI5A 1M0SA 3PKYA 4DSFA 5A0YA 4M8LA 1DFDA 2MGZB 2QA4S 3MM7B 4NLQA 2VB6A 2YY3A 2Q6CA 3RYLA 2XI3A 2IYGA 4IQMA 1S49A 3TR5A 3CD5A 3KK2A 3VCDA 5LJ3Y 2VKZG 3HFKA 3JYTB 3CCES 2P6SA 3F41A 4HTIA 3G4SS 4EUVA 1BY9A 3UFCX 1JLEA 1SBRA 4ECTA 3BO2A 4WTYA 3MR3A 2ACYA 4XO0A 2DR7A 4O3RA 4O0IA 4EO6A 2B5JA 5B0GA 2O5DA 1FO1A 1VIOA 1IKYB 3CCLS 4HLBA 3MPYA 1SL1A 2XB2D 2QA1A 1URRA 1YJVA 2E29A 5FIIA 4DR1F 3DLGA 1K1SA 3OR1B 2OPQB 4M5DB 3KLGB 4PWDB 3MM5A 2RRBA 5I3PA 4ZMMA 4ZLPA 2E5LF 2DGOA 2UV8A 5CYMA 3NCQA 3IS9A 3G9CA 3M2VA 2W7AA 4DV2F 3JB9k 2HVIA 2HLUA 2JH3A 1R0AB 2M4MA 5AE2A 3OR2A 2MZSA 3MAHA 3LALA 2IHR1 4DUZF 1NO8A 1REVB 4ELUA 4PQUA 4LMZA 1IQTA 4IH6A 1Q82T 3TUZC 1X4CA 5KT3A 2MKIA 2XEXA 4HTJA 2LU1A 3MD1A 4NZ7A 4U9RA 2JEGA 4U67Q 2IRXA 5DDPC 3HKWA 1NU4A 4KC5A 5H9FJ 2YH0A 3VZHA 4XPCA 4JI5F 1HFEL 3POTA 1TKZB 3QWUA 1BC6A 1W2IA 5KT7A 2VV5A 2MQLA 1WHXA 1WWHA 3KLFA 3M2UB 4Y65A 1YIJS 1G1XA 3SZ2A 1GT8A 2KH9A 1P1LA 1FXDA 1H3DA 2VC0A 3S8SA 4F4YA 5K8PA 2C2DA 3LANA 1XN9A 2GMLA 3DLGB 3MHYA 4LIWA 5DJBA 4G6VB 4RZRA 3C8YA 4X4RA 5ADZA 1Q8IA 3NRBA 3CJ3A 1J5OB 1LK5A 3QO9A 4C8OA 2Q6BA 3I96A 4C4WA 3FEXB 2RJZA 4MYUA 1O0PA 3N4WA 4KBIA 2ZZNA 4KO0B 2U1AA 1AXQA 2F8HA 1ZYQA 4TQSA 3MM5B 2XSJA 3N0VA 3NMRA 2D9OA 4I2QA 3J81Y 2XNRA 3M9OB 4DV5F 2HS4A 3MEGB 3SSRA 2ZM6F 4YY3F 1VQ7S 2L9WA 1IQZA 2DK2A 2KYZA 3T6BA 4X4TA 1IM4A 1TKDA 2R2TA 2KB2A 3RU0A 1Q1KA 2IVYA 3O2IA 2GGPA 2OPSB 4MK7A 5HBMB 2FHKA 2C2RA 3IN5A 2AYEA 1H7WA 4KKOB 4DR2F 1VQ4S 1VQ8S 3BSCA 5HI7A 2YNFA 4ATNA 3SV4A 2MB0B 4DF4A 2FJEB 2KXFA 2KFYA 2CYYA 4I56A 5KG5A 3ZZ0A 5IQQA 2GIRA 5L38A 2B0GA 4A8MP 2J9DE 1S9GB 1DQAA 1HWUA 2HRYA 4PR6A 3ZZRA 3PW7A 4JV5F 1S48A 4GC7A 1UEUA 5KG4A 3WX4A 2JFDA 1F60B 4L72B 2YWFA 1QTMA 3RAXA 4MTPA 1QY7A 4CNYA 2YKAA 3ENQA 4DJBA 1MROA 2VPYB 1FF2A 1XTZA 2YNHA 2BR0A 5G4DA 1BLUA 2DGSA 5LSOA 3OTCA 4X4UA 1S10A 1KD1T 3M2RB 3QIPA 3S01A 1D0EA 4K5SA 2JC0A 4ED5A 4DQQA 2BANA 5JVGQ 3CGIA 5IT4A 1FTCA 1U1KA 2DITA 1JK9B 1O8BA 1D1UA 2DGXA 1YJUA 3T6JA 4HT5A 4R5PB 1HWIA 3AB2B 2ERRA 3H5XA 1KFSA 3I55S 3GMGA 1NNDA 1WHWA 4RW6A 3FNNA 3GG1A 2QT7A 2VG6A 1HBNB 4ZPAA 3VALA 1FT8A 4IOBA 2D7SA 1FNXH 3K2YA 1ZH5A 1U1PA 4CO2A 5G0RB 5THWA 3FSYA 3GIMA 2NUHA 4BBYA 3R5BA 1RT1B 4DL0C 3TA0A 2M9KA 3M8PB 4FNHA 2J6SA 1Q53A 4J9KA 2VBZA 4WU3A 3TI0A 1TP7A 2FVCA 2VKRA 3H2VE 3SCJE 1MROB 1FVSA 3AHPA 3MOZA 4C8NA 1HBOB 4DDFA 1IKWB 4P7VA 4OI3A 5I42B 3SQGA 3LAKA 4KGMA 4C11B 1MWZA 2VOPA 3UCGA 4WFAQ 4OQJA 2VG7B 4PG8A 3TARA 3MECB 1S1VA 3R5CA 4K4WA 1S1XA 2N4CA 2M8HA 1TL3A 1IJEB 1UETA 4MKAA 1LWFB 2YVSA 1X4GA 3KLIB 2B4OA 4U6PA 5FLXY 2BACA 3DFEA 5H9EJ 1YTYA 1VQ9S 1KSPA 3K8WA 2IA6A 1NK8A 2Y1RI 4A8WA 1KOOA 1NK6A 2OMLA 4CH1A 5L9XA 1R8PA 5K14B 5DG9A 4OZNA 5LL6d 3CD6S 1FXLA 2POKA 3B82A 4F3MA 2B3TB 1RT7B 2DH9A 3AY0A 3WZ0A 5MLCV 2FLNA 3OTBA 5A8RA 1K73T 5F8GA 4DLGA 1TV6B 3BEGB 4JOUA 1B0PA 3JSMB 5D4PA 4NL5A 1WEXA 2QIFA 5EX3A 2AJFE 2W24A 3DLLQ 3H5YA 2NYIA 2ALZA 3V4IB 4ZVHA 3QZ8A 1IBMF 2J7KA 1RTJB 3R5AA 4NA1A 1ZOTA 4U7CA 3PW0A 1T94A 2WRMA 3AJ2A 2GMHA 2HLTA 1ZAWA 2FY1A 2CQIA 4TNOA 2NLWA 3HDSA 4MK9A 1HHSA 1FD8A 1JLEB 2XZWA 1BQXA 3W2WA 1N88A 5JUMA 1K0TA 3CIZA 2EG2A 2E7WA 2X1AA 3CCQS 2K1RB 3JYTA 4PXCA 4OJGA 2F9JA 3CJ5A 3I9ZA 4HEA9 1TKXB 1HBOA 2R7OA 3CCSS 1UEVA 2WSEC 3LO3A 4DR6F 2Q43A 2QRRA 3BN7A 2HW3A 1JNRB 2CZ4A 5EWFA 3Q23A 2CPZA 5EWGA 1NK9A 2AGQA 4PQUB 4QW9A 4R0EA 1S1WA 2DNPA 1FK9B 1O51A 2MQNA 5D4LA 1REVA 3LF0A 4NCAA 3M30B 4NRTA 3M05A 4J9SA 1G6BA 4ED7A 5CYMB 4QR0A 4DL6A 1U1OA 4ITSA 3M2VB 2R7XA 1IKVA 2DT9A 5K5MA 2FJWA 2ZH5A 1WG4A 2B6AB 2DIUA 4ES2A 2LECA 1RTJA 4FBTA 2ZH9A 2GQ2A 2AJ4A 2MYFA 4FXVA 4RUCA 3K58A 5K8OA 2X1FA 5EN1A 2DGVA 4G1QB 4CO4A 2GHPA 4WFNQ 1M5PC 2EI5A 2XY7A 2M2BA 3MTJA 2CQGA 2Q66A 5KFQA 2ZDOA 5KFEA 2CPDA 5IT9Y 3FFIB 3MMAB 1SKWA 3UDLA 3JAMY 1XWLA 2UUTA 4HI1A 2X3GA 2OKQA 1RTHA 2CQ4A 2B7BB 2KT5A 4ZPCA 1LW0A 5HLFA 5A6PA 3D2WA 4OLOA 3OJSA 2VASA 1NAQA 1UL3A 3K8VA 3MEEB 4LT6A 1JLBB 1WACA 4QPXA 1U26A 3CJ2A 3ISNC 4QWEA 4K4VA 2RKIA 4Y2AA 1X4AA 1RYRA 4B3MF 2RMLA 2RD5C 2YNIB 2Q1LA 1VRTA 2FD2A 1D8ZA 1RT4A 2AYMA 3I6PA 5E3QA 3R5DA 5KG1A 2AF6A 2W7OA 4Y28C 4DG1B 4DPOA 4ZKAA 2BV3A 5D6GA 3KHGA 3RTVA 4LF8F 1E6YA 4HDGA 1Y5NB 3NWGA 4BHQA 4ECXA 5HMWA 1RDRA 2CJQA 3THPA 4X66F 1SJ1A 3DGPA 4UUWA 5D4NA 4LFAF 2M52A 4FYDA 4OZLA 3MOJB 4ILLA 5AXLA 5D4OA 4B08A 2O67A 2RRNA 4KKOA 4RBUA 5C5JA 5KFWA 2Z2LA 1RTDB 4X4SA 3KLVA 3GV7B 4YR0A 1U6ZA 1BQMB 2ROEA 3DM2A 2HFZA 2ZFHA 4EU0A 4ETXA 1JLQB 4RNMA 1WNEA 3E51A 4N5SA 2FLPA 3DLBA 3KWMA 5T41A 3TW0A 5L1LA 4F2RA 3UCZP 5IXUA 2LEAA 4RUAA 1ZETA 1NK7A 3KNGA 3N28A 2M5YA 3MEEA 1C1BA 4DUYF 4EYHB 4K4XA 1C0UB 3TAMB 2BE2A 3PV8A 2ROGA 1N32F 5BJRA 5KFZA 3HVTA 1X5SA 2ZH8A 4JI2F 4FP9A 2ASDA 2IC3B 3ZC4A 3IAM9 3D54A 3BSOA 3HVWA 4WE1A 4Y34A 4LF4F 1X9MA 1R7IA 2VH7A 5HROA 4NLTA 4WFXA 2YTCA 1RA7A 3MTKA 5KG3A 4UW2A 4FXWA 5IT0A 2N82B 3RRGA 1L5UA 1DTQA 2LKZA 4OHWA 3VQSA 3IC1A 2ZNYA 2E44A 4H4MA 3SI8A 1UWBA 4PPDA 2B9XA 2HHPA 1N56A 5IFMA 4DL7A 1Z1ZA 3KHLA 1VQPS 3ISZA 2MSTA 3N6LA 2XCPA 2AYGA 3N01A 1UVKA 1S6UA 4IDKB 3QGGA 3F44A 2R8IA 1T7PA 3X3UA 4B3OB 1VHFA 2E1RA 3T1HF 5G0RA 1AROP 2OO4A 3FQKA 2V94A 4MIAA 1KC8T 2D74B 1Y4ZB 5M2UA 4OFZA 1KVJA 5LXRA 3BGUA 3TNVA 4YFUA 2YWKA 3KK1B 1RK8A 4DHVA 1FJEB 1ZM9A 5I4MA 4DSLA 1KQFB 4ES3A 4BWMA 1VRUA 3M4XA 4OI0A 1FDAA 3QZ7A 3BQ0A 3SDEA 4EBDA 1YJ9S 2J5AA 3HT3A 5C25B 1QLNA 1JKHB 4RLEA 1CC7A 3SQGB 4FVMA 4Q2MA 5C42A 4LFCF 1CEZA 3NCRA 4C8MA 1U8SA 3OFGA 4O4GB 2F7VA 1UWBB 4ED2A 4C9DA 1UJ4A 4Q44A 1C4AA 5GAHI 1HWJA 2FC8A 4DS4A 4JYAF 4QR1A 3W2VB 1KEKA 2VBYA 1VC6A 5KOXA 1FE4A 4MAKA 4EFAC 2IM0A 3EGZA 2DGTA 3GFYA 1U48A 4C11A 4N76A 1AW0A 2FGOA 2MZTA 2OPPB 1KQSR 2PD1A 1NJXA 4NA3A 1RT7A 3HF5A 2W7PA 2JEJA 5E2QA 5F8IA 3C3LA 1VQLS 2D3UA 1S9EA 2RF2B 3GQCA 1SV5A 2EK1A 1KQKA 3KLIA 1HNXF 5F3ZA 1S79A 2XGQA 4K4ZA 2AGOA 3QWPA 3JSMA 3CDAA 1VQSA 3VAIA 4K50A 3SDEB 3NMAA 1HQEB 5KFKA 1U2FA 1UP1A 2L9NA 2ZVSA 2PT0A 2RQCA 1TFYA 2HHTA 1U25A 4YDDB 2DH8A 4I7FB 1T02A 2FGCA 6FD1A 4XPEA 4X4QA 4YP3A 1M1KT 3UDCA 2SXLA 3MR5A 2WOMB 3HPOA 2Y1IA 4IRKA 3CSKA 4ZP7A 5KFIA 2AU0A 4I64A 1VGYA 1RYSA 2C3YA 2E1CA 1E6VB 1DBDA 5GADI 2V2KA 2ZE2B 4WK1A 5FD1A 3QYYA 2XMTA 4TQRA 1LFPA 3DHXA 1FRIA 2HGMA 4NA2A 5KFVA 4ED1A 1ZTWA 3BGFA 1WI6A 3RRHA 1H2UX 4F3OA 2G0CA 2JLGA 2QLXA 2CJBA 4ID5A 4IG3A 2N3OA 2OMOA 2QLWA 2BRKA 3OUYA 1IBKF 2YH1A 3KLHB 4Y2CA 5B09A 5DQHA 3EGWB 2BM1A 4LJMA 3L7PA 5CCMA 2GX8A 1G2EA 3MM9B 1TR0A 4ED3A 1TL4A 1ZPVA 4DSJA 4F2SA 3EZUA 1QSSA 2VBWA 2RNEA 4TXSA 4RW7A 3O44A 1HD0A 4K4YA 5KFMA 1Y5LB 2WSFC 1QSYA 1D9AA 4A8KA 4DFJA 1MU2A 2JWNA 4PG6A 1VOMA 4D3GA 1H38A 3HHDA 2M0GB 4Y6IA 5B0CA 4FVCA 2FVQA 1WTFA 3R3TA 2MGZA 1YHQS 3C66A 3TVYA 2DH7A 2R4FA 2MKSA 2HS0A 4NYOA 3R1LA 2NUUG 1GNKA 3I9V9 1HYSB 1JLFA 2KYXA 4J37A 2ZJPQ 3LP2A 1H2TZ 4ZCLA 1UFLA 2RS2A 3M1VB 4FBUA 4HHJA 2N4DA 3V6DA 2DNNA 2IBOA 4IFYA 4N8OA 4WXWA 3SFUA 1RT5B 3BR8A 3FEYB 1C2PA 3MM8A 4QQBA 3QLHA 4EWTA 4LSNB 3KLGA 2DCUB 4C2MA 1XMOF 3CMES 1K0VA 4ZHRA 3JTNA 2FIUA 4NLYA 4IOCQ 1RAJA 3IXQA 3MD3A 2X1BA 4O3OA 5KFYA 3V6HA 1N5VA 1RISA 2V9WA 1WF1A 2OPRA 3PHEA 2DHGA 5CZXA 3PXGa 3H8YA 3LGMA 3LP0A 3OR2B 4ID5B 2BUNA 3G86A 4PUOA 1RT2A 1U1LA 2YNIA 5D8HB 5KTQA 1SUQA 3R1HA 3OL8A 1RT4B 3T9ZA 4LSLA 1APSA 2CPYA 4IUFA 1N33F 4RBTA 3AH6A 5KFSA 3KLEA 3MM9A 3CCJS 4I6YA 3PW5A 4YMEA 1FRLA 1S1TB 2W8LA 3CULA 5IS2A 4RU2A 1LQ9A 4KHRA 3M2UA 4A8SA 2LU2A 3TYTA 3DDKA 4F3QA 4Y00A 1U47A 2MMYA 3OSNA 1DAXA 2WONB 4UY8T 2HNDA 4WKRA 2YX7A 4QIFA 3DLEB 4IH5A 1JJ2R 3H5UA 2ZH1A 2LQBA 1WG5A 4ZA1A 1N5YB 2KZMA 1GAOA 5GAEI 3CB4A 1QE1A 1VI7A 2DNMA 2DNGA 4OHXA 1VBXA 4EZ9A 3TAQA 2PGCA 3IA0A 7FD1A 4DBQA 1TL5A 2YNGA 3FRZA 1UMJA 3TA2A 3IG1A 5MAOA 1NJYA 1N36F 4KHPF 2HHXA 2C3UA 5DG7A 3VAKA 2AQ4A 3NGDA 1TL1B 4AQYF 1IKXB 2ZBIA 1S1WB 1N34F 3AJ1A 4LQ9A 4C8KA 2OP5A 2UUAF 2G13A 1LW2A 4KQZA 3UCUP 4NYPA 4X65F 3DRPA 4Z2XA 1N6QB 2XSJB 1M5OC 2HFOA 4NLRA 3QJPA 1FNOA 1GQEA 4KR0B 1SIWB 1LV5A 3HM9A 2ROPA 2IMWP 1FKPB 2WONA 5LMNF 1VJWA 3FVYA 4PXEA 1AFIA 3D1OA 1QUPA 2V4JA 3OVBA 3DRRB 2EFQA 3MUTP 1NRKA 3TA1A