2RAQA

Crystal structure of the mth889 protein from methanothermobacter thermautotrophicus. northeast structural genomics consortium target tt205
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
AKGLIRIVLDILKPHEPIIPEYAKYLSELRGVEGVNITLMEIDKETENIKVTIQGNDLDFDEITRAIESYGGSIHSVDEVVAGRTMVEEVTTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the MTH889 protein from Methanothermobacter thermautotrophicus.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
molecule keywords Conserved protein MTH889
total genus 19
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2007-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02680 DUF211 Uncharacterized ArCR, COG1888
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits MTH889-like domain 2raqA01
2X3DA 3BPDA 2RAQA
chains in the Genus database with same CATH superfamily
1UWBA 1FXDA 3POTB 3S8SA 3VR1A 4NI2A 3S6EA 4M5DA 4QCLA 3M6VA 1R8CA 2M3DA 1SXLA 4KRWA 3ZZPA 1Q5YA 1ZM4A 1ITPA 2W9CB 2BVZA 2DNGA 3GR0A 5M2RA 3WDOA 4CYUA 6AT1B 3B54A 5KG5A 1KLMB 2BA9A 3EPIA 2HNYB 2KL8A 4B02A 5C2GA 1FDBA 5FD1A 3AFGA 1P6TA 4U8YA 3RRKA 3IRXA 5CYMB 4ETZA 2R7WA 1FXLA 5F8NA 1JK9B 2EFGA 3DNCA 3VF0B 2VODA 3MMCA 4F0KA 3DRSA 2UVWA 3CO9A 1AB8A 4FKXA 2IMWP 2LEBA 4C8ZA 1T9UA 2PDAA 5KG3A 1IQZA 5DM7Q 2Y9HA 2JRSA 3RW7A 1JLEB 2FLNA 1FJGJ 1KR4A 4XDCA 4UY85 4ERDA 2HBQB 1NDCA 3BQ1A 4PYAA 2Q1LA 1EZZB 3N5FA 4B3RF 4ICLA 2UU9J 2MEWA 4OYPA 2KT5A 1Z2LA 3DYAB 3P8BB 1RWXB 3EGVA 3M8QA 1S77D 2QMXA 1Z1ZA 1YDLA 3IM8A 4WCEQ 4UQGA 2HG4A 4FYXB 2E7WA 2ZUGA 3KJFB 1S6QA 3M8PA 3QAUA 5E33A 5C25B 5IXUA 5F8LA 1WORA 4Y0FA 4TU7A 1GX6A 1UPMB 3A12A 1HR0J 2YKPA 1X7VA 2IYIA 4Y2IA 5D0RA 2GQ2A 1TUGB 2G0IA 2RE1A 1ZH5A 3BSCA 4ZVEA 2J0XA 2LKZA 1EIYB 4EZ6A 4DEZA 2DITA 2HLUA 3W9JA 4CNZA 2BACA 5DDOC 3OUYB 3D0IE 1R0CB 1VRUA 2X7IA 5FDLA 3LGMA 2E5JA 3DOLA 1WELA 1KEKA 4NA3A 5ETPA 2KYZA 2ZWOA 3OL6A 1KQKA 4F36A 3B4MA 1Y5IB 3LO3A 1I94J 4M5IA 2WOMB 1MW7A 1S12A 4R8UB 2W7OA 1SKWA 4B9MA 3KLEA 4NASA 4OZ3A 4QIEA 1SJ3P 3AA8A 4BWJA 4YUDA 5HQ8A 1HD0A 1WI8A 2BE7D 2YKAA 2LECA 4PR6A 1LWEB 1X9WA 4ECWA 1HNWJ 2VC0A 4C3KA 3VTIA 3HT0A 4PUOB 1VQ6S 2BJ3A 1RHJB 4OV1A 1QSSA 1RWKB 4NZ0A 3TUPA 1RXOB 3CMES 2MQLA 3FC9A 2L08A 1H98A 4KKOB 1E6YA 1JIHA 3EDQB 2MY7A 1EX8A 2Y1JA 2Q6BA 1BE4A 3IR6B 2RQCA 2HAFA 2HBRB 2I5JA 2WBMA 1RT7B 3K2YA 4IFYB 2J6UA 1GMWA 3OTOJ 5A0YB 1QUVA 1J2VA 3WBZA 3T9NA 3KK2A 1M5HA 4FF4A 2HVEA 4WBFA 1Q86T 3QJJA 2E29A 1SCJB 2BKNA 1CJTB 3RG6A 3THTA 2MQOA 2BMBA 2NSCA 1BLUA 2ZWPA 2XMAA 1FTRA 1QLNA 3T5JA 3MCMA 4GRSA 2XBPA 3QRPA 4UY8T 2D9PA 5F8GA 4B3OB 3KLFB 3IBWA 4CM0A 1L5UA 2OLWA 1K0TA 4DF4A 4L3KA 1TKZB 2EFOA 5HVFA 1FERA 1Q7LB 4C6AA 1U6ZA 2J7KA 2LXFA 1ZTWA 2NREA 3DM2B 3VGSA 2B5JB 3NCPA 2V9KA 2ZHBA 2DNOA 2XS2A 1S1XA 2AJFE 3R9LA 3M2UA 1RZMA 1RAGB 1X0PA 1K1SA 2CKWA 1SC3B 2QMWA 1Z2ZA 4DV1J 1OS5A 4K7QA 1SI9A 3CE8A 4PYDA 4JI1F 4IRDA 4L73A 4DX7A 4HTJA 5DQGA 3ELHA 3IG1A 3MEKA 2HNDB 2HQ3A 2GGPA 4DSIA 2ZEJA 2ZBQA 1E6YB 2MXYA 5CD4A 2Y8WA 3OVBA 4F02A 3KTQA 5IT9Y 1C0TA 2K2PA 2A1BA 4DV1F 1PILA 1CQNA 1FFSB 3TA0A 2W4DA 1N0UA 4PEOA 2RAQA 1DLOB 2CPEA 3ZNJ1 4M5JA 4PAAA 4FVCA 2B6AA 1KRPA 1TL5A 2HWTA 4FS1A 2DNZA 2IRUA 1TV6A 2IM0A 1RWNB 2IRXA 2PGCA 4KBIA 2IM1A 2R7QA 3O1LA 4LFAJ 4DR1J 1J5EF 2HHWA 1KTQA 1B4SA 1VR6A 2BEFA 2CPJA 2OSQA 2WVEA 1FWLA 1D8ZA 1FK9B 2NXNA 3DLKB 1CJKA 3DRPA 3N6LA 3OUYA 4DFKA 2LQ5A 3PEHA 4ER8A 1TK5A 1SC1B 1HA1A 4UZCA 3KUEA 3AODA 2Z57B 1UTAA 2VICA 3ZO7A 4CT9A 2YPYA 2QA4G 1PIEA 2DXDA 2XULA 3I0SB 2RUGA 3G2XA 2Z4PA 3CJ8A 4M95A 1JLGA 1NDKA 2HNZB 2VDIA 2VU5A 4RR5A 2HAIA 3SYZA 4LRAA 5HP1B 4PXCA 1UWAA 2CJAA 3OV7A 2DRDA 1PYOB 4H4MA 1XR6A 2IRYA 2O1PA 5DLFA 1DHMA 3MAHA 1C0UA 1GT8A 4MIAA 1X60A 1AT1B 3PYDA 1F1BB 1M90T 2GA7A 4ED5A 2XM3A 1PG5B 1WF2A 3MMBA 2DGSA 4TVAB 4WP3A 4DQPA 2A0FB 4ZVSB 3UVJB 1RLCL 2VG5B 2ZD1B 1IBKF 1N8RT 3HZGA 3V6DA 4OZ1A 4MKYA 1X4EA 1KVKA 2W1BA 3C19A 4XIUA 2VOPA 3PDNA 5EX0A 3CJKA 3BGOP 4G1PA 1H2TZ 2V8GA 2FJEB 3ILOA 4C7QA 3RAMA 4WIQA 3KK1A 4FPIA 2GMHA 3GPAA 4HR2A 3ENAA 2BX6A 1JB0C 3CDWA 6FD1A 4LQ3A 1HYSB 1NDPA 3FEZA 3JSMA 3M2VA 3BSNA 1P9YA 1NK6A 5I4MA 2IDEA 2MZTA 2HS0A 3OR1A 3R5CA 4P2SA 1RHRB 4CLFA 2UUAF 3HK2A 4HDGA 4O4GB 4C11B 2YY3A 5CAAA 2MKSA 3VZHA 2YNGB 4FBUA 1WC4A 2CQ1A 3G96A 1RA7A 5I3UA 1S6PA 5BR8F 3AD7C 2H4YB 4URSA 4ZPDA 4X4TA 2KFNA 2JWNA 4H4KC 1S6PB 5E3AA 3RBEA 2HW3A 2BANA 3W2WA 3A3OB 2ZH1A 3RR7A 3ZZZA 4DR2F 3ZZRA 2XWXA 4Q2LA 3QZ8A 1RISA 1S49A 1U1MA 4QZVB 2ZHOA 4N56A 2BKPA 3KLFA 2VKZG 2FVPA 2BE9B 2DHGA 3MD3A 4P52A 3DU6A 4DR1F 3IWLA 3H5XA 1R6VA 3JSMB 5A2QY 3Q23A 3RAQA 4HHUA 1HBMB 2OEJA 4J9SA 1NHVA 1S1UB 1UKUA 2OI2A 3OD2A 3M4XA 2O01C 2DO4A 4NEZA 1IVZA 2VL1A 2P9CA 3FEXB 1K0VA 1FX4A 2HHQA 2J5AA 3BN4A 5A0YA 1QAIA 2Z2MA 5L38A 2RS8A 1KN6A 3KDOA 5E2QA 1O0PA 3HVTB 4ZPVR 3MEDA 2CQ0A 1TK8A 2GJ2A 3V81B 3IP0A 1S7IA 2XHCA 5KFEA 4F2RA 2W2OP 3TYTA 4IQXA 4RU9A 2BJDA 4O3RA 2VG7B 5A2QU 3DI6B 4CO5A 3LA0A 2RHSB 2FVRA 2XLIA 2UXCJ 3F73A 1KFDA 1FKOB 1RP5A 2MQNA 3I4HX 4ED1A 4QWAA 2VJVA 2AGOA 1U1OA 2DTJA 4C4WA 1LOUA 4P2XA 2QC3A 4PABA 2CG8A 3TVZA 1Q1KA 3AD9C 5D8HB 2PD1A 2RNEA 3R6LB 4H4OB 3PIPQ 4CI0B 3G6VA 1SKSA 2DNYA 1RTDB 4ELVA 5K8PA 3TW0A 5IM0A 3GG1A 1BQMA 2RB7A 1TFYA 3D9BA 5IT9U 1GMWD 1FVQA 1MMLA 2LQ9A 1R8AA 3AB4B 1XMOJ 4KO0B 2VA2A 4GO5X 4CLLA 2J7WA 2ASLA 2KJWA 1V3SA 1WF1A 3K7RA 3C6TA 2XG8A 4ZOSA 3TAQA 3SQOP 1U48A 3OSNA 2AMCB 4DV0J 3HFKA 2VFSA 4XDDA 3VVTA 1S1UA 4ZCKA 3M6UA 1OPIA 2LLZA 5D6GA 1KC8T 1S9EA 2UUTA 1NPRA 3DRRA 1FJGF 1PC4A 3CIMA 5LSRA 1FWKA 4LSZB 3RB4A 3HPOA 4C11A 2VBWA 1TQLA 2PFDA 1VQKS 1S79A 1D09B 1ZZNA 4CLTA 1NSKL 1R0AA 1NJIT 1JLEA 2J0WA 3UDLA 4ECSA 5L1KA 3A3NB 1TP7A 3Q8QB 1FCAA 2XSJA 1UW4A 3EGWB 1R6YA 1RKJA 3MWBA 1N88A 1RT4B 4J37A 2PFFB 4PZVA 3R5GA 2HVZA 3G87A 3Q89A 2D69A 2HQIA 5ETTA 4JI0J 4PWDA 4NWBA 4C9DA 2JOQA 2PA8D 4MKVA 4K4UA 1U49A 3MCSA 2ZZNA 1D9FA 1ZA1B 1XNQJ 4DV7J 3MOJB 3W66A 2FLLA 3OT9A 1QUPA 4FNIA 3UVJA 1M1KT 2OAUA 5D4PA 4IOAQ 1E6VA 3H5SA 2VQEF 4J9MA 3Q83A 2CZVC 2VFUA 4Y2CA 4AYBD 1S9GB 2XLKA 3NGDA 2GX8A 4WFZA 2MJNA 4CYUB 4DJBA 1IKVA 2BOAA 1S0MA 4RKUC 3ZZ0A 2V2ZA 1FRXA 3K8VA 3JAMY 4YR2A 4BHQA 5LJ5Y 3MEEB 1RT2A 2AV5A 2VUGA 4AXIA 3PVXA 2MMYA 1MU2A 2GMJA 2QFIA 2WCXA 2NPIA 2F3JA 3PO5A 8AT1B 3UN5A 2XC9A 2I38A 1U25A 3HX9A 4ILLA 2AX1A 2RRBA 2X3GA 3EZUA 1S72S 3MFIA 1GAOA 4O23A 2RIJA 1FEHA 3KJVA 3QQCD 4G1QA 2AU0A 5SZTA 3MEGB 4JI2J 2CQPA 4KTQA 4KO0A 3DMJA 5J2NA 2IC3B 2BBEA 5DRKA 5IOLA 3KOAA 2H5IB 2QA1A 4ZIWA 1ULRA 1IR2A 4C3MA 2UU9F 4LSLA 4J9VA 3OFFA 4RUBA 4OZ0A 3PX4A 2DPJA 4K2XA 1SBRA 2O66A 1S59A 2CA9A 4FPRA 5E3PA 2GV1A 2JC1A 1F5CA 1P27B 3Q2SC 4PXEA 5B0CA 1NK0A 1H73A 4I67A 4N77A 3ZTRA 3IXQA 1JLQB 3CCJS 2A6OA 1WOOA 1LW2A 2WB4A 4ZCIA 2HFUA 3EM1A 4ITSA 4OLPA 5B0GA 1PJ6A 4F2SA 2PMWA 2GHVC 4OFZA 1W7WA 2C42A 5IT0A 1FRIA 3TR5A 4ZPAA 2DO0A 2B4PA 5LMNJ 4DV0F 2J6SA 3OJSA 2DHAA 3DOLB 4M1KA 1RTHA 3BYRA 2MKKA 1C0TB 1LV5A 2QA2A 1T9VA 5GVQA 2NZCA 4FNHA 4UQTA 1BUXA 1XR7A 2Q43A 4MYUA 3MM7A 3I5BA 3ILIA 2PC6A 2W9AA 3IN5A 4OHYA 4RBVA 2CPXA 1HW8A 2ZE2B 4DDFA 4R5PA 3G6XA 3HHNB 1NPPA 4RBUA 4YR3A 3JB9k 3TP2A 1GNKA 2KXFA 2QMUB 4Y34A 4X2BA 2XYPB 3CWJA 1SC4B 3HSZA 2VQEJ 4JV5J 1VBXA 1NNDA 2CFXA 1F0XA 2BXJA 2YNIA 3NP5A 4LR8A 3H4DA 1HNWF 2AYBA 2XO7A 1U1KA 1RGVA 5AXMA 4ZKAA 5B0AA 5KT2A 3ISNC 3AHPA 2DGVA 2I1RA 5GMKa 4X4VA 3CCSS 4OZ5A 3PJXA 2FQQB 4RJVA 1FA0A 1UVKA 2ZC4A 1XBWA 4WE1B 4O4GA 4I56A 2GVDA 1LK5A 4I6WA 5DO2A 3BO2A 3GCWP 2D3O1 3D6MB 1ZYQA 1NJXA 2P5VA 4YS2A 2IJFA 4IH7A 5GAEI 2JVOA 4LF5J 4ZVPB 3T3FA 2XZDB 2VZ9A 4ZHRB 4YB1P 2WONB 1CJUA 2OO4A 1T02A 1XWLA 3BH7B 3IMQJ 4HLBA 2D7SA 4NLOA 4ZP9A 5EWFA 5I42A 1NK7A 3JS9A 5J1NA 5KFSA 4B3RJ 2RMLA 4OJGA 1X9MA 1HBNA 4PQUB 2WB1D 1KLMA 4J9KA 3ZZOA 2V34A 1QY7A 3KDNA 3EUNA 2XMVA 3Q8YA 1UZDA 4NMLA 3W2VA 2OUGA 3GIMA 1T8EA 1U4BA 3TNVA 3EXYA 2HZCA 2IBOA 5DQHA 1Q4RA 2PA3A 3NGRA 4S0MA 1HNXF 4NCGA 4DLEA 2NQPA 4DU7A 2F9DA 4WTOB 2DNMA 1HHQA 1LWEA 2W8KA 3MCOA 3RB3A 5IV3A 3GJRB 2RS2A 1RTIA 4C48A 5B7WA 3CULA 1IJEB 2V6AA 4KYZA 5ETKA 3W5XA 4WFBQ 2OD6A 4TYBA 3R7NB 2DD8S 3O5TB 2KT3A 5DGAA 1YRTA 3ONQA 1HWJA 1SKUB 4JV5F 1S9EB 1TKTB 5LXYA 4K4TA 2V2KA 4DLGA 1ZM2A 3PR5B 4I6AA 2LFVA 3FBFA 2DRBA 5AXLA 5E3CA 1KHVA 2NUHA 3HHLC 1VQ7S 3TA2A 1U8SA 4JI6F 1NLKL 3KK3B 4DV6F 1HBOB 4LF7F 4U95A 4CH7A 4DV5J 2H9ZA 1PJ7A 4EI2A 3QYYA 4B9VA 1F60B 2V67A 3H2LA 3I5CA 1X4AA 4QIGA 1V9OA 4ZP6A 3W9HA 1IQTA 1BWVA 3M9OB 2DVIA 2QG9B 2IIHA 3VQTA 3ZNUA 5H9FJ 1REVB 4WXWA 3UR3C 2XCAA 2AWZA 2HWHA 1TKXB 1S1TA 3EX7B 1YGYA 2DH7A 1D9AA 2NXEA 1WACA 3RJMB 4A8WA 3DGPA 4LF2A 3SV4A 3OTDA 3PXGa 3VQSA 3T1HF 2OTJS 4RL1A 4WWSA 3MCNA 4ES3A 5C7PA 4DS5A 3E8OA 4HI2A 3SCLE 2AHOB 3SSRA 2N3OA 1WF0A 1VS3A 2F8EX 4WIIA 1BGXT 2VD3A 4V1Ak 3HVRA 4OJ1A 2KXNB 4PQUA 2KZMA 4RZRA 1WEYA 2V4JA 3MFHA 1CJUB 3MM5B 4X65F 2B4OA 3OPKA 3AH6A 3CPWR 1SQEA 4WFAQ 4CWBA 5J2QB 4KIAA 3HM9A 2GVDB 4X64J 1NJZA 2BOPA 1RTJA 2D9OA 4NRUA 1S99A 1S6UA 1QTMA 4P72A 3W2WB 1U09A 5C42B 2CJBA 2EW9A 2NR0A 2UXBJ 3CJSA 2Q79A 4EGLA 1EKRA 5KFZA 3LWLA 4LIRA 4X65J 2AEJA 3GILA 2W7AA 3PFEA 3RBDA 3Q2TC 4KH1B 2G2YA 1RU1A 4KT0C 4RW4A 2V4JB 2KVQE 4QWBA 5EGYA 4X84A 2M7SA 1P1TA 4IKAA 3V5RA 3IWNC 1FK9A 3PJWA 2LP4A 3CC7S 2NCKL 2FVCA 4BC9A 3SZ2A 2E5LJ 2DYAA 2UXDF 3SV3A 2IVMA 3BGRB 3KG4A 5L9NA 5EHHA 8RUCA 1IR1A 1N36J 5CD4H 1T05A 2OPPA 1ZA2B 2GNKA 2J8SA 5BR8J 3LH2S 3MAQA 2VC1A 2QSFA 4TYAA 3WHIA 3X3UA 3W7BA 4IOCQ 2WSCC 3D3CJ 3LQVA 3J81U 4Q5VA 2OIHA 3C8YA 4N41A 3NMAA 1ROFA 2ACYA 2AT1B 3HHLA 4ALZA 2XEXA 1RWUA 2C3YA 1WI6A 3D6TB 3OBIA 1N5VA 4LVNP 4YR0A 3J7ZT 2J0SD 1IBCB 3HKWA 3VGUA 4C0BA 4Z2XA 4AL5A 1DTQB 3DDNA 3R8YA 4WF9Q 2KXHA 3NLCA 4U7UD 1U0SA 4LIWA 1NHKL 1UVJA 3OSPA 4N76A 2CWKA 4C8LA 1TL3B 3FMBA 1SV5B 2QL9B 2OPRA 1VMBA 3DLEB 9RUBA 3HKZD 4HT5A 4OI2A 4ILRA 4O3PA 1HBOA 4A48A 1U45A 2EC0A 5LM7E 3G8SA 3UPFA 2F4VJ 3BBCA 1JXEA 3O6QA 2VJUA 4FF3A 2R7TA 3EGNA 1FO1A 2ZH5A 4ZHRA 3DDIA 4DBQA 1FE4A 4DZDA 2E1PA 1RCOB 1Y7PA 2XTJP 4RUCA 1LFPA 2CVIA 1VC0A 2FJWA 4I2QB 4W90B 4JV0A 4NXNF 1SIZA 4HH1A 1YHQS 2XMUA 2IPOB 7FD1A 3LUYA 3QIPB 1GXUA 5I3QA 3RBZA 4Y3CA 1UVLA 1N0VC 1P1LA 1ICEB 1S6QB 3M8PB 1H38A 5HANA 3MUTP 2VKRA 3HI9A 1NSAA 2VPZB 4DPYA 3PKMA 2DH9A 4NCGB 4KSEB 5DJBA 3V4IB 4F3OA 4RBTA 1F3FA 2V4RA 1RHKB 4F67A 3F41A 4FDFA 3LGHA 2DISA 2CPYA 1RTIB 1EETB 2H5JB 1U26A 3DN9A 3CCLS 3W1YC 3IWXA 3DLLQ 3I31A 4OLOA 3D3BJ 1QDUB 1RT1B 4TU9A 5HK4A 1N34F 1L3UA 1UVNA 2AJ2A 3QATA 3G9CA 2AGPA 4LF8F 1HNIB 5SUHA 2R7XA 3UNGC 4YEAA 3DOMA 3MM5A 2V8DA 3MM7B 3PV8A 1WSVA 2ZOFA 1LQ9A 2CQDA 3DOMB 1L3KA 3T6JA 4CLUA 3BGUA 2ZH7A 1Y9OA 1C2PA 2E1RA 5D4OA 3HJVA 4ELTA 1EQ0A 2KYXA 3PRDA 4DOZA 1Q82T 1FESA 3AXMA 1T11A 4K5SA 4DUZF 3LW5C 1VLYA 1VQ9S 2UUBJ 2MQ8A 2QFJA 4RLEA 2WONA 4LF8J 1PAEX 3OTBA 3CSKA 1S9FA 4V19X 2QYGA 2POKA 4DN0A 5K20B 2Z0GA 5AT1B 1ACMB 2BRKA 3ZZTA 1TKZA 2GAHC 2RRAA 2BUNA 2ZJPQ 2ZJQQ 2GFFA 1JJ2R 2VB6A 1WKKA 2RDDA 4ANEA 3Q24A 5KFYA 1RT3A 1TVRA 4WZMA 3JSRA 1DRZA 2BZ2A 2BRLA 3HF5A 3V4IA 4OI1A 4R5PB 1LXNA 4M5NA 4Y2AA 1RKIA 2JDJA 1F6TA 4Q43A 4NPOA 4ID8A 2IC3A 2QLXA 4EYIB 1SVDA 1DQAA 1OY9A 1SB6A 2PO4A 2YNIB 3K89A 1H6KX 2AZ3A 4JUZA 1FRJA 1VRTB 3FRYA 3LP0B 4CIOA 1OQ6A 2FY1A 2DHXA 5G0RA 2B9YA 5HO4A 3BSOA 4NLUA 3U27A 1B0VA 1BD6A 4NLSA 4M5MA 1DY3A 2EI5A 3P4UB 3LALA 2AW0A 2RH3A 4I2QA 4OZNA 4KQZA 3EGZA 1P9QC 4F0MA 3NXZA 4CO4A 3QGPA 2G4BA 2EKNA 2CUYA 1YTYA 4LREA 4F4YA 1J5OB 3JTNA 2MZQA 2M70A 3Q8VA 3NGSA 2JX2A 1VQLS 4QU7A 5KG1A 3UW1A 3OTCA 3GG0A 2KDOA 2AX0A 1AA1B 1S9GA 3KMSA 2C2RA 1KQSR 1PGZA 4DR4F 4KHMA 3CJ5A 4Q0BA 4DFPA 1FVSA 3VAJA 3Q22A 1WC6A 3D67A 3W2VB 3R7BB 2R3VA 3FQLA 2M4MA 2CZ9A 4JI3F 2ADCA 1IWGA 2MQMA 3DGVA 4NA1A 1VHIA 2KU7A 4ZPBA 4QW8A 4ZS6A 3OHBA 3CB4A 1HWLA 1YZ6A 3RBXA 1LWFA 1G6BA 1B7YB 1XK8A 4RW8A 3WZ0A 4CNYA 5D77A 1RAAB 5HVHA 1GQEA 1UEUA 4FZVA 4IO9Q 4KH0B 2H4WB 2OHDA 1NZ8A 1NCLA 1SQGA 2WZ1A 3OXLA 2HGMA 4QIFA 3PIOQ 1WOPA 3JTOA 4DR5F 1S4FA 2QE5A 4RWXA 4FYVB 2CQ2A 1N5TA 1VI7A 2R2TA 3TARA 1RT2B 1NK8A 3Q8UA 1FNOA 1OY6A 1JLFB 3QIDA 5CCMA 3OL7A 3LWMA 1M5VC 2HHHJ 1FKPA 1IUJA 1YBAA 4K2JA 1BXNA 4PCQA 4IRCA 4IUFA 1VQNS 2R7SA 2DIVA 2FB0A 3B4DA 5IT4A 3FBCA 5LMUF 4PWUA 3J80Y 4MYTA 1DTTB 1N52B 2W4CA 3RYLA 2LVWA 4J9RA 3J7YI 2WAQD 1XR5A 4UOCA 4ED6A 2FPHX 4MK9A 3QO9A 3QGHA 2C2EA 4ECZA 3FZ2A 3GFYA 3C16B 3RTVA 2HVHA 2ZOMA 4B08A 4ZVHA 5KFXA 1PSDA 5KT3A 2UUCJ 2R42A 4DV2F 3IR7B 1WNEA 1H2UX 3SFGA 4LVOP 4KHRA 4BLGA 4DQQA 1RK8A 2CNNB 4YB6A 3MMAB 2HURA 1NSPA 1RT6A 3D4JA 4OV6A 4E98A 5FLXU 3OLBA 3VAGA 1M5KC 1VDHA 3HHLD 4C98A 1IBLJ 1RJJA 3KFWX 4KB7A 2E1CA 3QGIA 3CCES 1TKDA 3DGPB 4HACB 4JYAF 3L9ZA 4NLQA 3TVKA 3FCHA 4MKAA 3QJPA 1S1WB 2C1EB 5LOQA 1R89A 3VAKA 4ES1A 3FJ2A 3VWSA 3O3LA 5H1SV 1XC9A 4M5DB 3LANA 2ZH9A 1RABB 1JWWA 3AAWB 3GE9A 3ITHA 3U1MA 3P49B 2QX0A 3OXFA 2XNQA 5EX3A 3EDRB 2M8DB 2LYVA 4GKJF 1AUSL 3MR7A 5CXTA 1RBOB 2DNHA 1SH2A 2XB2D 4XK8C 3DRXA 1XNRF 2NPFA 4DR3J 3M8ZA 2HHPA 4F4KA 4IFVB 2FZKB 2HIQA 3FK4A 4OX6A 4YDDB 2AYEA 4ID5A 2BQ3A 5KFPA 3LAKA 3M30A 3OXGA 3OFHA 1VFJA 2DY1A 4NLDA 1NAQA 2MHEA 2HSEB 1ZAVA 5EWEA 4EBDA 4HYKA 1B70B 3CGIA 1KSPA 3NAHA 2I6WA 3HZEA 5HSPA 5IM0B 1XERA 4ZVQB 4E0DA 2MJUA 3DMJB 4G3IA 4UW2A 4DL2A 5GAEU 2EKYA 4E2FB 4ZMMA 5KFKA 1HQEB 2CJ9A 2YKOA 5DLGA 5DDPC 2CNOB 3PEJA 1SJ1A 1JLAA 2MKYA 3AD8C 2RU3A 5BYSA 1EHWA 1VC6A 1H0HB 1TELA 1WC0A 4MK8A 1TKTA 4B3MF 3CW2C 4B9UA 5LMNF 3DYAA 3GYXB 1RACB 2R8JA 2N7CA 4K0KF 5DDRC 4Q2MA 3PRBA 5KFTA 2RRNA 4IG3A 2OJ3A 5J2QA 5HVGA 2M8HA 2QEXS 3CDEA 5LSLA 1EP4A 5B09A 4BDPA 2HQDA 1KVJA 1M5SA 3EXCX 2EBEA 3GLJA 4Z7YA 3M2RB 1ZTTA 1TFWA 2E1MC 2VV5A 2PN6A 4WKYA 3CCUS 1N5SA 5K9FA 2KRRA 4O44A 3BO3A 1PJ5A 2DBBA 2LQ8A 2ZDOA 3IG1B 4ED7A 1DZ5A 2YKNB 3TZWA 2GIRA 2A2DA 2HNYA 4CLWA 2EK1A 1HBNB 2R4FA 2DEJA 2YKNA 1LEOA 1NSQA 4DV4J 1EQMA 1OPZA 4ECVA 1D3WA 2CJXB 2HK3A 2JEGA 4FXWA 4Y28C 5C2CA 2H5EA 2ROPA 4X4NA 3TZZA 1WG5A 3O2IA 3N6MA 4MAKA 2VHGA 2Y1IA 3TZYA 1IKYB 2HS3A 4J9QA 2ZVSA 4TKTA 2R7UA 3C15B 2A6MA 3DDKA 3PO4A 2AF6A 4ATNA 5DG7A 3H20A 1M1HA 1KONA 2J0QD 1ZPVA 3PY8A 4EO8A 2CQHA 2Z2ZA 4O4RA 3KUHA 4UT4A 5HN0A 3GV7B 4G65A 4X4PA 1RQ0A 1Y5NB 2IJRA 2OFHX 3FUYA 4N8NA 3PW5A 4BS2A 3MAAA 2HBZB 1WKLA 1IR0A 5GMEA 3I4PA 1JLCB 2VF3A 4LBPA 5KT5A 1LWFB 4RW8B 4FF2A 4KC5A 2ZC3A 5IZHA 2L3MA 4IFYA 5F8MA 1HNZJ 2X1BA 4TY8A 2ZBPA 3DLHA 4USIA 4KPYA 2HEKA 2DJWA 4HDHA 2R8GA 3Q86A 4EYHB 1N6QA 1JJCB 1GMVA 1OQ3A 4ZLJA 3KK1B 3FGVA 2XNRA 1SQFA 3CCZA 3ITHB 4J9UE 2L48A 2OPQB 2OGUA 3FKBA 4IG0B 4M63A 1OSCA 1M1GA 2FDNA 1F5AA 2XWYA 3GMGA 4ZN1A 3E2EA 1RTHB 3NY0A 3MOZA 1KLNA 3KLHB 2HHVA 3GTYX 5AXKA 2IHR1 1DJ0A 1Y0HA 1B99A 2B7CB 2GMLA 2VG5A 2ZD1A 4Y00A 5KTQA 3LF0A 4M5HA 4AL6A 1WDDA 3I5AA 2CJQA 5L1LA 3SSQA 2JLGA 2QLBB 2M9KA 3V6HA 1TL7B 3OVAA 2HBYB 4MIBA 2OELA 4B17A 3T1YJ 3NBPA 4L72B 4CO0A 3BEGB 2KM8B 1UVIA 1VOMA 5CZXA 3AOBA 3QGGA 3PR4A 4DV5F 4QJVA 3WC0A 3B82A 4WK1A 2B43A 3ZTOA 1EKSA 1QTNB 3BN7A 1EB0A 5L46A 5A8WA 5F8HA 2ZITA 4CRJA 4J9PA 2KHCA 1YKWA 3HULA 5ETVA 1K8AT 2KTQA 3D0HE 4LFCJ 4QBUA 1SL0A 2MGZA 2KT2A 5LXRA 1URRA 1T03A 4LFAF 2LMIA 4TLQA 2H48B 4LF4F 2ZOGA 1X0FA 1T0TV 1FI4A 4YOEA 2MSTA 3HHDA 1OSDA 1RTJB 1VBKA 2DNRA 1NK9A 4AQYJ 4OZLA 4ECXA 5D0HA 3OJUA 1JLBA 5KFCA 4L6V3 5B08A 2CQ4A 1H3DA 2NXUA 3CTRA 4GKJJ 3BSAA 5A8KA 5E3QA 1MMNA 4QYRA 3J81Y 4ICLB 2LA6A 1L3VA 1D0EA 3QT7A 1AUDA 2HPUA 4LF4J 4F04B 1MWQA 1UJ6A 2HRYA 4PG8A 4ECTA 5IC6B 3AQOA 3OR1B 4QPXA 4QWDA 1IWAA 1KP6A 4I0WA 1NXIA 4CLKA 1HBUB 3A8EA 2ZZTA 4DCPB 4LUBA 1RA6A 3HSDA 4A8SA 1PYSB 2K1RB 3BPDA 4DQIA 4DR6F 3OVSA 4LFCF 2K1RA 1G3OA 1FF2A 4OHVA 3CJKB 3HJFA 1RT5B 2MZJA 4KJIA 4KHPJ 2VBZA 1IBKJ 1RWMB 1V6HA 2F9JA 4KGMA 3HXMA 2X1FA 1DQ8A 2NLWA 2R9LA 3NG8A 3OL8A 2W9CA 5K5MA 1EETA 3SEOA 1WTFA 3BF4A 4EO6A 1N34J 1M5OC 2F65A 3SMZA 1RYSA 4ELUA 1N48A 1VRQC 2KJVA 4M94A 1CPZA 4OJHA 5C24A 2BM0A 2J9DA 1S6OA 5KT4A 3T5HA 1DTTA 1HWUA 4R8UA 1IM4A 2RF2B 3D1OA 4K4SA 4B9NA 1XEZA 4X4RA 1DFDA 3T19A 2RUSA 3K5MA 1R0AB 2PIIA 2WVDA 4Z37A 1U1LA 3GWCA 1PAUB 3D1QA 4ZLPA 4OZ2A 1JNZB 1OO0B 2R7OA 1NHUA 3H5UA 3I55S 1RHQB 2D3ZA 2DNNA 4C2MA 2YNFA 3MGJA 3SFUA 4ZITA 2GIQA 2R2UA 5A76A 2GS8A 2YNFB 2VIHA 5DS7A 3W5YA 2EG2A 4HHJA 3BPSP 1HFEL 4UOGA 1FDDA 5LT5A 1OJ4A 5KFDA 5GMDA 2C3MA 2BR0A 3UD5A 2E5HA 3PNIA 2MPUA 2YNHB 4DL5A 4F4ZA 5D4LA 1SV5A 1GXLA 3CJQA 3L7OA 1ZAWA 4P2FA 4OX9F 5KFNA 2B4VA 3CXCR 4F4XA 4NYPA 5KFVA 4ZLLA 2B9XA 2B6AB 1RCXB 1TVRB 1S1VA 3VHQA 4AE5A 4JI7J 2RQMA 4B3TF 2KFZA 4JBCA 2XMMA 2HIYA 2JVRA 3NS6A 1IKVB 3ZTQA 4FBTA 4Q8FA 5H9EJ 3U02A 3KLHA 3PHEA 2WK4A 2CQIA 1ZOTA 3BQ2A 2W9BB 4EEYA 3LP1A 3PM9A 3W65A 1WTBA 3OHAA 5E3RA 1U0HA 4A8QA 1AXQA 1WSRA 3L7UA 4QR2A 3JQJA 2W25A 3GFHA 3MEDB 2EXUA 4PG4A 4TY8B 2HMIA 2QRRA 2ZDPA 1GK8A 2CIMA 2F8HA 2O67A 2K7KA 2YQ1A 4JI3J 3SQGB 4ES2A 3CEDA 2APOA 3C14A 4A8OA 1R0BG 3IGVA 3ILJA 2WVFA 3UQSA 2VONA 3GU0A 2AGQA 1PBUA 3MZIA 5KFOA 2IVFB 1AYEA 4K5RA 4OHXA 3BZQA 2ZUAA 5D0EA 4DSEA 2LA4A 2V94A 3U1LA 4RNNA 1I5OB 2ADBA 1RAJA 1NDLA 2CJYB 1FDNA 4HL9A 3M9MB 2NXJA 5KFRA 1JMTA 1NB2A 4UOFA 4WE1A 2UVRA 1X4DA 1SIWB 3DOKA 4UOHA 1U47A 4QQBA 4J91A 4XO0A 1VQ8S 2RF2A 3TO8A 4GC7A 5FLXY 4KGXB 3UN3A 2HQCA 5DG8A 1HIYA 1X9SA 2C2NA 2FVQA 1VCTA 2ZZMA 3TWZA 2EVZA 3HDSA 2CPZA 2YKQA 4K4WA 2FC9A 2JH3A 2RD5C 2ROEA 5D4NA 2QA4S 3MDFA 1YJ9S 5KFJA 5KG6A 1WEXA 5KFMA 4DSJA 1HNVB 1PO6A 4JI6J 5A8WB 3ILLA 2H1YA 5F0WA 3S7RA 3TX8A 1LFWA 5CYQB 3CVKA 2EFPA 4HTIA 3I6PA 4W92B 5DM6Q 4ED2A 2ZKUA 2HQGA 2DCLA 5AE2A 1RU2A 2QSWA 1U0HB 2MKIA 3KHGA 3CD0A 3NCQA 2AJQA 4KY3A 5E7OB 4JI0F 1NB7A 5HJYA 1HBUA 4LF6J 2DNQA 4ZA1A 1FX2A 2XO6A 1U7LA 1LW2B 1HI8A 2DT9A 1AFIA 3THVA 2FTRA 3NOCA 3KLIA 4F50A 3ET6B 3NL0A 1J5OA 3R97A 3UDCA 1DARA 4NLVA 4J9LA 5HP1A 4OX7A 1IM6A 4OMFG 3FSYA 1JXVA 1CQMA 2GJIA 3BBBA 3GB0A 3CDUA 3PX0A 1PBAA 2XS7A 3BGLA 3BQ0A 1CVJA 2GO8A 4DZ6A 3FEYB 4C8MA 2OMOA 4YY3J 5L8RC 3V4MA 3UR0A 3K0JA 3OFGA 4X4OA 2CQCA 4WFNQ 1Z4UA 2VPYB 2MY8A 3QWUA 2LDYA 3I0SA 5DZ7A 2LXIA 3JAMU 1OY8A 1T05B 2UV8A 1LXJA 2IM3A 4EUVA 4N7TA 1TV6B 2W2MP 2FHKA 2C2DA 4LF5F 3DXSX 4QYZK 1KQGB 3ICLA 1V3RA 3GIIA 3IS9A 2F8MA 5K14A 2G9OA 2QL5B 1RI7A 2DGUA 4RW4B 3GP9A 1F9EB 2CDRB 3UDEA 4DPXA 2BW2A 1HW9A 2HFSA 2KN4A 5DDQC 2RHQB 3W60A 4ZCMA 4DWIA 2DB1A 1X4GA 2QLFB 2XMTA 3M8YA 3MHYA 4ZVGA 3SSSA 5I3UB 1T9TA 4A8YA 3MXHP 3G82A 4K59A 2HVIA 1LW0B 3QAEA 2ILYA 1DLOA 3NGTA 2FHJA 1GTEA 4MIWA 4RW6B 2VPWB 4N8OA 3T6BA 3V2UC 3J7YU 3Q8PB 3QRQA 3ET6A 3MPYA 4C8YA 3J81j 3NS5A 2RQKA 1ZAXA 3VVUA 1VQYA 1YLXA 1S4EA 2COLA 2RT3A 2IJNA 2AQ4A 2XLJA 2MB0B 4TQSA 3H5YA 4ZP8A 1HYSA 4PXBA 1RT4A 3TI0A 1N33F 4KE5A 1U2FA 4HKQA 2DHHA 3R5JB 4JB8B 4PKDB 3L3CA 1YRUA 2EWHA 5T7LB 4DPWA 1HBMA 2DGTA 3TAPA 2DKOB 3QT5A 2XMKA 4X64F 2IM2A 1HNZF 3ZTPA 1R27B 1G4CA 2ZNYA 4C8KA 1WC5A 1TUWA 3Q8RB 3A1YG 4DR4J 5KFAA 1LWCB 2FLOA 4OL8A 1S1XB 1YI2S 3BM7A 2BANB 2L9WA 3POTA 1RAOA 2HYIB 3KG1A 1SH3A 4IR1A 4I2PB 3GSDA 4NXMF 2NS1B 1KBRA 2B9WA 1FKPB 2AJ0A 1PKUA 1JLAB 4RNHA 4W4MA 3VV2B 2F4VF 3G6ES 1XMQF 4LFBF 3C6TB 4LT6A 3D0GE 2ZHAA 1LNQA 1TMJA 2QGFB 3MM9B 4WU2A 3D1HA 3TZXA 1RDRA 2RKIA 4I68A 5B0BA 4DUYF 3MPWA 2ALZA 2WW4A 2U1AA 1FFWB 4OYMA 2GCFA 3P45B 3JXOA 4DG1A 3N4WA 2WSEC 4MH8A 1N36F 4IH5A 3L95X 4CLSA 1SL2A 4UTGA 2BE2A 3S01A 2M2BA 1ZPWX 3G4SS 2HK2A 1J27A 3JTPA 3SQGA 4JI7F 3MUMP 1YJUA 2QL7B 4DCJB 1X4FA 4URGA 4L74A 3BYPA 4Y2KA 2B4UA 1Q53A 3GJQB 5F3TA 3CJRA 4BC7A 4KHPF 1G7CB 1KVIA 1MLAA 4PRFA 1VHFA 3MECB 1AZSB 2OPSA 1CSJA 2F4FA 3JQKA 2HRUA 2YXLA 3IO1A 1VBZA 3TQEA 2C22A 1MNEA 3HHKA 2P9GA 4ZJOA 1B0PA 3C2PA 1ZBTA 3QBCA 2Z56B 4E8UA 4F0HA 1N5YB 2JEFA 2YWKA 1BQNB 1UL3A 5K8OA 1RWOB 2FVSA 4CO3A 2BQUA 5LJ3Y 3IFEA 1DQ9A 2KI2A 2UZAA 4YDXA 5I42B 4WXOA 4YHHJ 2UVUA 4P73A 2R8IA 4M5LA 1WHWA 3BR8A 2HNDA 4FKYA 2FIUA 2CZ4A 2RVJA 3HCXA 4DUZJ 3R3TA 2IA0A 1NJYA 4USMA 3LGNA 2ASYA 3R2DJ 3MM9A 4DN9A 3DLKA 3DRPB 4DR5J 1Q78A 3HT3A 2FJVA 2VFVA 4K50A 5L9XA 3CC2S 3C3LA 4AXJA 3O44A 2DR8A 2IDLA 1HWKA 3THPA 1C1CB 1PC5A 5KG2A 3D28A 4IOBA 2JFDA 2PEBA 1QVGR 1JX4A 2E7XA 2XY7A 1HR0F 2IVYA 3OR2A 2R8HA 4HVZA 2ALYB 3NCRA 1VLOA 3BKUA 4IYQA 2DGQA 1LWCA 2R8KA 4CLZA 3K57A 2MLZA 1VK3A 2DEIA 2E66A 2V50A 2H51B 4P9SA 1VYAA 3QJLA 4B3OA 3NMRA 1FHTA 3H2UB 4DX8H 4MT1A 1NPKA 3M8QB 3PFOA 5KFIA 4HEA9 2E1AA 1KOOA 5T7LA 2XGQA 1XMQJ 3X1LB 2PEHA 2CNKB 2UV8G 4NX9A 1WHVA 8ATCB 2QV6A 3PYEA 1CJVA 4A8KA 4OI4A 1BC6A 1ZZFA 1XMOF 2X3DA 4QIWD 3AA9A 4PQAA 4QIVA 1RHUB 3FFIA 3WIVA 3WQPA 4DCOB 2G2OA 3S1TA 6FDRA 4O0IA 3T5LA 2YX1A 3V6DB 2ZE2A 1YX2A 2YX7A 1B3TA 4O44B 3NGUA 2JNJA 4I7FB 5CYJA 3RB0A 2CRLA 3I0RA 5HROB 2K3KA 3K59A 2E5IA 3PW4A 2HHHF 1HI1A 2C3OA 3T41A 4MK7A 3P5TL 5U47A 2VBXA 2W9BA 3FSXA 5A8KB 3L7PA 2CXEA 2ASDA 3IBFB 1NK4A 1BQXA 2AEFA 4IH6A 1FRMA 1M0SA 4MJKA 1Q81T 4DSFA 4MMOA 4RO0A 1TKXA 3M7VA 1CBKA 4OYZA 2OH2A 3M9NB 3MMBB 5THWA 2D74B 3GJSB 2WTFA 3OLAA 3UCUP 1YSJA 3SI8A 2JEIA 3CJTA 2V8HA 4R0JA 3SCKE 1Q8IA 1CJTA 1JLBB 2JLEA 5F3ZA 1R43A 4RW7A 5FIIA 1S10A 3CJ4A 4UF4A 4P7TA 3JSBA 5J2NB 4NLGA 5HI7A 2LU2A 3TUIC 3H90A 4CLPA 1IBLF 3QIPA 3IS9B 5KFGA 3TJ9A 1QAXA 3A13A 3HFZB 2AJ1A 3MMJA 3R5BA 1CS4A 2O3DA 2HZVA 4Q44A 1QSLA 3B6BA 3K58A 4CM2A 2XI2A 4PWWA 1IBMJ 1N54B 1RT3B 2CWXA 1FJ7A 4G1QB 1X4HA 2ZH4A 4DL7A 2EFVA 2H65B 3I87A 4NLPA 5AE3A 2E9ZA 2HHXA 5BXIA 4WYWA 4ZDNA 4DL4A 2E9TA 4EK2A 4NRTA 2AYMA 1FRHA 3FNNA 1O6XA 2V8VA 3AJ1A 3D7SB 3VZIA 1NMEB 1X4BA 2OMLA 3HFVA 4CCHA 2K3IA 1RB0A 5F0UA 2ZM6J 4ECUA 1QAJA 2B3TB 2W2PP 4M5KA 1S57A 4AUKA 3MEEA 3CUNA 4JI4J 3HSGA 4JI5J 1NH7A 3G8TA 1T9YA 4CO2A 1YITS 2KM8C 2YWWA 1VIOA 4RNFA 4CTAA 5CA5A 2KH9A 2HFVA 3BREA 4I6YA 1EARA 3KMQA 2UXBF 1OIAA 3VALA 3RR8A 4WP8A 4RUAA 2BW7A 4O3OA 4GC6A 4J5OA 5IQ6A 1S7HA 3UD3P 1NKCA 2G13A 1XNQF 1ELOA 2Q3PA 3QMQA 2CDQA 5AE1A 2R7RA 1DAXA 5ETOA 4FS2A 4PXDA 3IC1A 4AQYF 3BDEA 4U67Q 2BYCA 4FXDA 1NKEA 2MDAA 1RAFB 4USUA 1VRTA 3LP0A 4NLTA 3I9ZA 3MPUB 4PPDA 3CCMS 4PWDB 2N7YA 5LSOA 2JJ4D 3KLGA 3MAAB 2M0GB 3P5BP 1RWPB 2D3UA 3ZTSA 4P71A 2C2ZB 2CYYA 1TAQA 3DFEA 1WUUA 4LF1A 4F25A 5ETNA 1HQUB 1UMJA 4B9TA 4LRFA 1KTVA 3I96A 1LK7A 3MM6A 4DPUA 2QZ8A 3A8KA 3GFZA 2N4DA 3C15A 3JYTB 4DX6A 2FJAB 1PYTA 4WP9A 1X8DA 3OR2B 4DPTA 2Y0SD 2ZNZA 4DFMA 1SJFA 2HMIB 3M6XA 1VBYA 4HH0A 1V3ZA 2MYFA 2AIRB 3MTKA 3MR6A 1RUSA 2FGCA 2RILA 2VG6A 3HLUA 1JNRB 3UCZP 2PI5A 3PACA 2BQRA 3M32A 5CYMA 3QFWA 1RWWB 5ETRA 4TU8A 2GQQA 7AT1B 2I9SA 2ZH8A 5E41A 4LQ9A 4IG3B 1UCNA 2KG1A 4ZLNA 5RUBA 1ZS6A 3ENQA 4RW6A 2HS4A 3SBMA 3NBPB 1YIJS 3WC2A 3PCOB 3PX6A 4NCAA 4TXSA 1MN7A 2VQFJ 4DV3J 1HQ2A 2W01A 3H4BA 4B9SA 3SDEA 4H4MB 2HHTA 2GAGC 3TOQA 2UVVA 7FDRA 3NNCA 3I56S 5HMXA 3CCWA 3F56A 1WC1A 3IM9A 2KHDA 3GR1A 4X62J 3DC2A 5FDLB 3N6NA 5GAHU 4KFBA 4DR7F 3RUBL 4CLYA 3NNHA 1WEZA 3PRVA 2FY8A 1AZSA 2OPSB 3DLGA 4JI5F 4Q0BB 4OYBA 3CJ2A 4WTYA 3DHWC 4LRDA 1RAEB 2YKMB 3M1VB 5F8IA 3K5LA 3MF5A 3PYGA 4KAIA 4KR0B 4USWA 2D3OR 1X5PA 2GVZA 1HPZA 2KVIA 2ASJA 2VH7A 3R1LA 3BB5A 2DGWA 1MWZA 3HVTA 1U1RA 2BJ1A 3DXBA 2V4QA 1FD2A 2ZVIA 4ZN3A 2XSFA 4CO1A 5A8RB 3KJVB 1IKXA 5DG9A 3GIJA 4Y6IA 3BO4A 2BV3A 1RAIB 2RJZA 2FJBB 3DCAA 4FVMA 3K5NA 4DF8A 1S0OA 3ZZYA 3R5DA 2GJFA 4JI4F 3L4BC 2J8AA 3B8HA 2GC8A 4M5GA 5C5JA 1A9NB 3EVWA 3E3XA 2J76E 3O8WA 4MTPA 9ATCB 4JV1A 4QR1A 1VJQA 4ID5B 2XMJA 2XY5A 4IFVA 4ZVOB 4F8RA 1TZ0A 2UUBF 5C25A 3LAMA 4J9OA 3G71S 1TMMA 1VQSA 3DLEA 4LR7A 4X4SA 2JLFA 3CDBA 4D3HA 5HBMB 2P6SA 2RQ4A 1KQFB 2ZBRA 4Q45A 4QWCA 1T7PA 4TNOA 4CP5A 1E6VB 1FNMA 3OTOF 3CMAS 4TLRA 3RRGA 4URQU 3CCQS 2WVCA 2Y1RI 5EN1A 4F7VA 5KOXA 1RHMB 4YP3A 3W9IA 2MLXA 1UFKA 1I1GA 2I2YA 5CYQA 5M2UA 2K7JA 1G1XA 4I69A 4BWMA 3HMJG 1V5VA 3K5PA 1F3VA 3M32B 3RU0A 2Z58B 1TR0A 2CPHA 2IAJA 3D54A 5A6WA 1UWBB 4LRBA 3MM8A 4X66J 3A8JA 5IC4B 1EP4B 1K47A 2OEMA 1YJWS 2OEKA 1A6LA 1U2RA 5EUHA 2ATLA 2W2QP 1H7XA 2JL9A 1LWXA 5IQQA 1BWEA 2C2OB 4A8XA 2NSBA 1SL1A 5ETMA 1HNXJ 4NXNJ 3D68A 1OWXA 4DV7F 3CCVS 4DPOA 4CH1A 4AL7A 2VDHA 2G0CA 4AT1B 4RW9B 4UZBA 2PI4A 3RGIA 1CS4B 1R3NA 5GADI 1SUQB 4LR9A 4LRCA 2CNLB 4U9RA 4LBIA 5J2PA 2N4CA 2QLJB 3CDAA 4PG7A 2J9EA 2JSXA 1M5PC 2UP1A 4LFBJ 1Q8KA 2KKHA 2C2KB 3RB6A 1SC6A 1KS2A 4Q7AA 2GVZB 1NH8A 2WBRA 1HL6A 1OYDA 4LSNA 1BQMB 3NEKA 4NL5A 2VOOA 3KHLA 4F4AA 2NXCA 4NCBA 2N3LA 2Q6CA 2MKJA 3J80U 1Y10A 1RLDA 2P2CB 5ETLA 1IBMF 4DSKA 1UW9A 1VQMS 1T94A 1WOSA 1Y00A 2P6TA 4OYAA 1YBUA 4N47A 3VCDA 4FYYB 3UNYA 2P8IA 4C3LA 2ZJRQ 4DV4F 1TL3A 2HLTA 5KFHA 4ED0A 3AQPA 1MSWD 4ZIVA 1UFWA 2HFOA 3OFEA 3AT1B 5ETQA 1TL7A 5MLCV 3NNAA 3BKTA 3KYLA 3W61A 4DX5A 4NZ7A 3D5MA 3PYFA 1SJ4P 2YTCA 3T9ZA 5F41A 1N6QB 4HI1A 5D15A 2O5DA 4EFAC 4Y2MA 3HHLB 1U8WA 1FWPA 1YJVA 4PG5A 3US5A 3C66A 1I3OB 4IDKB 5B0EA 1VRUB 3F44A 3TUJC 5DQIA 3HVWA 5LMUJ 3KKFA 1RT6B 4QR0A 2FYXA 1TU0B 2AD9A 1FD8A 4FYWB 4F4WA 1X5SA 4C97A 2CQBA 3UN2A 2V68A 2B5JA 1K44A 2L9NA 3HP6A 4UUWA 5E5NA 2EC2A 2OD4A 3DOKB 3R27A 3JYTA 2VBYA 4DXLA 3BR9A 2G1HA 3RRHA 1QSYA 5LL6d 2GW8A 3MM6B 4XPCA 3M2UB 3MPDA 5KFWA 2V2QA 3N5BA 3IRWP 1N32F 1JKHA 4USVA 4P2MA 4B3SF 3HO1A 4KGKA 4GKKJ 2CPFA 2MZSA 1HARA 4DV3F 1JKHB 4J9NA 2EK6A 4OYIA 1TK0A 5H9EK 3KJQB 1T9WA 1YG0A 3J7A1 2FHMA 1JLFA 2Y0BB 3QZ7A 2DH8A 5J1EA 3LP2B 1BMQB 4HT7A 4WJBA 1N56A 2Y8YA 3W62A 2YBVA 4WK3A 1QVFR 2JC0A 3A3PB 4B9LA 5AXNA 3CCTA 4P10A 2V9WA 4X4UA 2YWEA 1QAYA 1Q79A 5D0GA 2OKQA 3MMCB 2IAJB 2U2FA 3QSIA 2QT7A 3P96A 3W63A 5IWAF 2E5GA 3Q8SB 1SJRA 2DIUA 2EFQA 4BBYA 1BQNA 2XCPA 1MROB 4IDKA 2ZBCA 5IFMA 3KHRA 3FZBA 3ENVA 2PSZA 1B7FA 1G2EA 2BDPA 2YH0A 2DXEA 4NOHA 1FT8A 3OQ2A 3EVMA 1HNIA 2HHUA 1C0UB 1UEKA 4GO7X 2XZWA 4OHZA 1LKZA 3CIZA 3MTJA 2J9DE 2YPZA 2H54B 1H2VZ 1FFGB 3FVYA 2HFNA 2YNHA 2QIFA 2DK2A 4K8RA 4KGVB 1YVFA 1NEEA 1QD1A 2MTLA 1KHWA 3D6FB 4KGZB 2YH1A 1NU4A 3IBCB 5KAKA 3H25A 1R8BA 1TL1B 1Y3JA 1U2CA 4R25A 3CC4S 3PW7A 1KDNA 3FBEA 3IR5B 4WYLA 5J1PA 3NOGA 3G86A 4DSLA 2ACMA 3CO0P 1XJWB 3N0VA 4F3QA 4XPEA 4DL6A 3FRZA 1XNRJ 3G6YA 4ED8A 1O51A 1CJKB 2C28A 1JJ4A 2NZ4A 2GHWA 1T9XA 2EBGA 1RT7A 5J2PB 3KG0A 4QWEA 5D3GB 4USJC 4K4YA 1TAUA 1O5JA 3AJ2A 2JFKA 1FEEA 3TJ8A 2D1CA 1CULA 1DURA 1YJRA 3M8WA 1RSCA 3SCIE 4EZ9A 2KO1A 1Y11A 2IFXA 1K73T 4R0EA 2LU1A 5J2MA 2A10A 4YB5A 3VAIA 3EICA 4MFBA 2BABA 2LEPA 2A18A 2Y3YA 1S0NA 4FF1A 3P6YC 2FHJD 1WG1A 1FKOA 5ETSA 5GAHI 4F3MA 2FZCB 4QW9A 4NA2A 1WJ9A 1JQGA 5C24B 4O3QA 1DTQA 3MMAA 3IAS9 3DKDA 3T1HJ 1WHYA 1YK9A 2WOMA 4NYZA 2HGNA 3IRXB 1JLQA 1MMDA 4OI0A 1S1WA 2E7VA 3I32A 1ZM9A 4IR9A 1RBLA 3DRYA 2DPIA 2MKCA 4Y65A 2GIFA 3QLHB 4QYZJ 1UFLA 3HVAA 4GVLA 5M2PA 4ANDA 5DGBA 4NI2B 4LSLB 4DQRA 5FJ4A 4RW9A 3TVYA 4P74A 3PW0A 1F2HA 3BV8A 2DNPA 4U7CA 2CAJA 1R31A 1F2GA 4X66F 4ZPWR 1CC8A 4B3MJ 2RKIB 4KPCA 1F5BA 4OI6A 3JQMA 1FNXH 5JVGQ 1YWXA 4F26A 4ETXA 1YRXA 2PE8A 4J90A 3QT8A 4A47A 1KOHA 5G4DA 2IMOA 5CH7B 2L41A 1NO8A 4RUHA 4LF6F 2DXFA 3PHTA 1I94F 5C42A 4LMZA 2AEMA 3C14B 1W2IA 4NLXA 1IKXB 3IAM9 4NZ6A 3SCJE 4ANCA 1WDTA 2RDIA 3R1HA 3V6KA 3H40A 2IBKA 1QE1B 1OYEA 3ETOA 1S0VA 2ZFHA 3AY0A 5KT7A 2XGPA 3M2VB 3EPGA 3H98A 1X31C 1A7GE 4UUXA 4ZVTB 3NS7B 4NLRA 4WFYA 2MLYA 2XYGB 1R7IA 2DGOA 3FQKA 5K8MA 3T1YF 1K1QA 1RWVB 3HSJA 3BH6B 4H4OA 2QN6B 3U7JA 3C46A 1VIXA 3MR3A 2FJXA 1L3TA 2W24A 3AB2B 5HBMA 5B0FA 3QT6A 3KLIB 4DR2J 1XQIA 2FD2A 2YWHA 3H7HB 5J2MB 1T3NA 3VAHA 4WZQA 3CD6S 1BHNA 1REVA 5MAOA 2B8QA 5HQMA 1TUVA 4DV2J 4IG0A 4QOTA 3SXLA 1GMUA 3AOCA 3TA1A 4N5SA 2GO9A 5EDWA 2DR7A 1PCAA 2RSQA 2HZAA 5AJ3F 3KJNB 4L76A 1X4CA 4WPAA 5I3PA 2RU9A 5HJXA 4OQJA 4G6VB 4EWTA 3CJ3A 2NYHA 5GAGI 2I8EA 1S5ZA 2E44A 2EPIA 2V63A 3QFHA 4PG6A 1KNZA 4FYDA 2X51A 3LPEA 3TANA 3KNGA 1KFSA 2GHPA 2BE2B 2CPIA 3WX4A 5BJRA 2MHNA 5HL7Q 1EAYC 3F0NA 2CQGA 1UJ4A 1WG4A 2WVBA 1B64A 2GZOA 1VC5A 3MD1A 1APSA 4C8OA 4D3GA 3ISND 1HMVB 1Q8LA 3ADAC 3FMWA 4H54A 2UXCF 4KFBB 3M8RA 3M8SA 1F9FA 2A2CA 4RX6A 4IRKA 4H4KA 1U6BA 3N28A 1DBDA 1VQPS 3AOAA 2XY6A 4K4VA 4JOUA 4ED4A 1IJFB 2OP5A 4A46A 2YKMA 1UVMA 3RW6A 1K9MT 2CG4A 4OYOA 3UFCX 4ZVUB 2B9EA 5F8JA 3EZ5A 4PPZA 1C4AA 2BJ8A 4ZVFA 3KHHA 2VQFF 2UUWA 4NLYA 3C6UB 3H59A 2NUUG 4DR3F 1IKYA 1T3OA 1IKWB 4USTA 1CEZA 1MROA 1REGX 1A0OB 1WKJA 1MWYA 3PW2A 3EZOA 4DI6A 1U02A 3DI6A 5DZ6A 1N5YA 3OL9A 3R2CJ 3RAXA 2V5HG 3ZZUA 2JHEA 3LP1B 2GGPB 4QU6A 5IWAJ 4EBEA 2OFGX 4K0KJ 1HD1A 1CC7A 1RAHB 2VFTA 2Z8QA 1BY9A 5JVHQ 4DUYJ 4QPTA 1X5OA 5HMYA 1J5EJ 3DU5A 3ZXWA 3VAFA 3BS9A 3HHEA 2AP6A 2XMWA 3QO9B 3W3SA 2CQ3A 2M88A 4XAKA 2FHOB 4OI3A 4NEYA 1LW0A 4U6PA 1U1PA 3BJYA 5B0DA 4JYAJ 2OSRA 3HD2A 4NXMJ 1SPBP 1B0TA 2EEYA 2YWFA 2B0GA 4ZJLA 1GTHA 1IKWA 2CPDA 3FCVA 4DL3A 2E9RX 4EMDA 1RT1A 4MFBB 3TJAA 1S1TB 3H0PA 4OZJA 5J1EB 1FE0A 1C1BA 2B8PA 3A4TA 5KFBA 3I82A 5IS2A 3EYZA 4GKKF 1GEHA 3RZAA 1MG7A 1HQUA 2C3PA 3GV5B 4JI8F 1UPPA 3DRRB 1CULB 3L09A 1UZHA 1YBTA 4WFXA 4RWWA 5E0OA 1HLWA 5KG4A 1KKHA 1C1CA 2R7VA 4P75A 2YNGA 5L1JA 4NYOA 3ZC4A 4DUTA 2FC8A 4JP8A 3KK3A 5HLFA 2PT0A 4DR6J 3EMTA 5A8RA 5L1IA 3QLHA 1YJNS 2JZ5A 2MZRA 4P7VA 2FLPA 1AW0A 4TQRA 3NWRA 5CZVA 1Y4ZB 5T14A 3UE2A 1VQ5S 4HHHA 2N82B 5L39A 3D6HB 4LJMA 2DR5A 4JI8J 1XN9A 1P8GA 1Y3KA 2L9DA 2HGLA 3N79A 3U1NA 4ENOA 5GADU 4RNMA 4KKOA 4YB7A 3QPIA 1NM2A 2AJ4A 2B56A 3DLGB 1VISA 3GSIA 2YQ0A 5ITHA 4X62F 4AD6A 5ADZA 3AJDA 2AKWB 3P3DA 1R8PA 1WC3A 3OTEA 3QRRA 2DY9A 3D66A 4K4ZA 4M8LA 1SH0A 4G1IA 4U96A 4CZCA 1S48A 1ZM3A 3SDEB 1HHSA 4ECQA 4EBCA 1S1VB 2OPQA 2V0NA 2ATCB 4KV8A 3W8GA 3GCXP 3KNAA 4GVBB 3PKYA 2CJKA 1MN9A 4CH0S 3ENWA 2Q66A 2BJEA 4OX8A 2ERRA 4DFJA 3KUGA 5G0RB 3BKFA 1HWIA 2JEJA 5D78A 1JXLA 2J6TA 1JJHA 1NJWA 1CJVB 3CD7A 5KFLA 1JLCA 1FRKA 4ZJQA 2V8PA 1SUQA 5CABA 3R6GB 3TQ1A 2KZZA 5JJBA 4O3NA 1TTHB 1UJ5A 3BGRA 4YY3F 3DLJA 4IO1A 1HHTP 2DCUB 3UDVA 3GJTB 4DV6J 4OYWA 4RU2A 1FJCA 3C16A 3CNQP 5IV4A 3MEGA 5KT6A 3FBBA 3QWPA 4RNOA 2LQBA 1OMSA 3HD1A 2ZH3A 4I1TA 1XIQA 3V6JA 4I64A 2E5LF 4FN5A 1T95A 3GQCA 3K17A 2IA6A 1WWHA 1T03B 1U1NA 2QLWA 3CCRS 2HHSA 2ZH6A 3G8QA 3FDSA 3QSYB 3UD4P 4RPFA 1ZETA 2SXLA 2WW8A 2XHWA 2YWGA 2WSFC 3OW2R 2W4PA 3DHXA 3QNWB 4OIXA 2MKHA 2MSSA 3KXDA 2YX4A 1Q16B 3KK2B 5BYQA 2X1AA 1H74A 4V19J 4YN3B 3M05A 1RE1B 3CD5A 3FFIB 4USHA 5KFQA 5H9FK 1VGYA 2LQJA 2K8GA 1YJ7A 1RT5A 3WIUA 3W64A 5KG0A 2HWIA 3CT9A 1UETA 3I0RB 1QJHA 5HROA 4U7UK 2B51A 4OHWA 2IYGA 3KLVA 2XSJB 5HQLA 2HRTA 4JI2F 1Q5VA 1AFJA 5AJ3J 4W98A 5CCLA 3BDPA 3I9V9 1F9HA 1HI0P 2YVSA 2ZBIA 2F7VA 2VFRA 1FXRA 2C2MB 2WHOA 1KWMA 2DHSA 4MKBA 2G0JA 3WX8A 4YQWA 1FTCA 1R8HA 2CVEA 1L3SA 3E01A 3MPVA 2C3UA 1H72C 2VASA 3AXKA 3GFXA 2XI3A 4I4BA 3VGTA 3GIKA 2R2SA 2Z2YB 1U1QA 1NK5A 2UXDJ 1EJ7L 2IY5B 3MUVP 1JLGB 2HNZA 3CJ0A 4ZK7M 2A3JA 2DRAA 1NRKA 1HMVA 1FDAA 1FJEB 3LPYA 1NZAA 1Q0NA 2ABYA 5BYRA 3GYGA 3A8IA 3LTOA 4DU8A 1UA0A 2MGZB 1Q8BA 2GQCA 2P9EA 3M1VA 2PMZD 1GH8A 4DG1B 3J7Z5 5GAGU 1AROP 2KB2A 5D3GA 4ZCLA 3PJ9A 1URNA 3TEHB 5EWGA 4L3NA 4YHHF 1Y5LB 4CT8A 5A6PA 5F9LA 1RTDA 1I51B 5HLFB 4WKRA 2DGXA 3E51A 2F1FA 1D8YA 1UAWA 1FRLA 1UP1A 2XZTB 4RW7B 4C0OC 2KG0A 4A8FA 1CLFA 2XYHB 5CHCB 4LF7J 4I2PA 2HFZA 2QTWA 3R5AA 3PZPA 4GVBA 1Q7YT 1YZ7A 5HMWA 2ZM6F 4KV8B 1FKAF 2HVDA 1TL1A 2F5GA 2H3EB 3MURP 2VG7A 3N01A 1W26A 4B3TJ 2J7UA 3LOUA 4NMXA 1C1BB 4LBHA 4TY9A 3CF5Q 4DQSA 2FGOA 2DNLA 3IA0A 5T41A 3UCGA 1RTZA 1GXTA 2CADA 4HACA 2F40A 4GMKA 4P6QA 3DLBA 2VA3A 1I6JA 1KD1T 3MM8B 2R2RA 3EE3A 1TL4A 3W8PA 2OPPB 4C0HA 4I7FA 3MI7X 2FZGB 2BM1A 3ETMA 4ZVRB 4LSNB 4CDIA 4ECRA 3V81A 1N5QA 3NAIA 1WHXA 2K06A 1QM9A 2DNKA 3VGVA 4DMZA 4ED3A 1UA1A 2KRBA 2X1GA 3BGFA 2YQ3A 5KFFA 1HNVA 3GYNA 3LP2A 4EU0A 4O0NA 3EVOA 4Q8EA 3FCWA 3TUZC 5JUMA 2NYIA 3TRGA 3K5OA 2VG6B 2ZKTA 3GV8B 3BBFA 1UEVA 4K4XA 3N9UC 2EG1A 3DM2A 4U8VA 3ZFVA 2ZH2A 1U24A 2B7BB 4DS4A 2HQFA 3NKYA 4Z7CA 4ECYA 2V69A 3D2WA 2QJ3A 1V5IB 2Z2LA 1N33J 3NGKA 4OYXA 3C6UA 1D9DA 2HKEA 2BJ7A 2LXUA 5K8NA 1HQEA 2VPXB 5KG7A 2XQCA 2UUCF 2Z30B 5KOWA 1N32J 4B3SJ 2EFNA 2MZ1A 3J7AN 4ZPCA 2J9CA 4ZPTR 3VAMA 4J7CA 3T5KA 4NLWA 1VJWA 3TAMA 2M5YA 3MR5A 4OJ3A 2W2NP 4JV2A 3GONA 3EWGA 3KLGB 4YMEA 2FJDB 3M30B 4XTTA 1X5TA 2ILZA 5KFUA 1XTZA 1D1UA 4LF9F 1CG2A 1C4CA 3IGNA 2I5JB 4CTAB 1O8BA 1SJQA 1W25A 2PMHA 2OPRB 5HMZA 1HPZB 3W5ZA 2MQPA 2AYGA 2G2ZA 3DRSB 2QYCA 3UO0A 3NRBA 2UUAJ 3R7SB 3G82B 3M2RA 2W8LA 4DL0C 1U6FA 3Q0AA 2MQQA 2RDJA 1VK8A 2M52A 1HKAA 4PUOA 4FP9A 2F63A 2QO3A 4JI1J 1RBAA 4DR7J 3M6WA 3NWGA 4LF9J 3ISZA 2DR6A 5CQGA 1RADB 2BJ9A 3H42A 3PG9A 3SIPB 2XS5A 5K14B 3B78A 1GX5A 1WD6A 1XMBA 3GIRA 4USKA 4ZP7A 1YJTA 3MECA 2D41A 4WU3A 3ULHA 3UWTA 4CQ1A 4BCAA 3TEGA 5JMNA 3KLEB 4ILMA 5HAOA 1N4LA 2LDIA 3GZ7A 4L75A 4YFUA 2V2VA 1NUEA 1GFWB 3H2VE 3JSYA 3K8WA 2FUG9 3PTWA 3MR2A 1VQ4S 1W2BR 3EJMA 2W7PA 3CMQA 2LCWA 4O3SA 2OTLS 5JXSA 1NKBA 1Q95G 1S76D 1IXKA 1YQHA 2AZ1A 3H8YA 4TN2A 4A4JA 4AFFA 1VQOS 3UI3A 3TAMB 2DR9A 4NE9C 4X4QA 4C8NA 1SKRA 4DHVA 1QE1A 2G1DA 4OX9J 1MU2B 4FXVA 1IN0A 3T1AA 1S97A 3KWMA 5DETA 1H7WA 2ROGA 4IQMA 4A8MP 3TX0A 3FSIA 2WRMA 1RYRA 3E01B 2Y1LB 5HATA 1NBEB 2KFYA 2I0XA 5F9NA 2BKOA 2LEAA
chains in the Genus database with same CATH topology
2X3DA 3BPDA 2RAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3D A;  3BPD A;  2RAQ A; 
#chains in the Genus database with same CATH topology
 1UWB A;  1FXD A;  3POT B;  3S8S A;  3VR1 A;  4NI2 A;  3S6E A;  4M5D A;  4QCL A;  3M6V A;  1R8C A;  2M3D A;  1SXL A;  4KRW A;  3ZZP A;  1Q5Y A;  1ZM4 A;  1ITP A;  2W9C B;  2BVZ A;  2DNG A;  3GR0 A;  5M2R A;  3WDO A;  4CYU A;  6AT1 B;  3B54 A;  5KG5 A;  1KLM B;  2BA9 A;  3EPI A;  2HNY B;  2KL8 A;  4B02 A;  5C2G A;  1FDB A;  5FD1 A;  3AFG A;  1P6T A;  4U8Y A;  3RRK A;  3IRX A;  5CYM B;  4ETZ A;  2R7W A;  1FXL A;  5F8N A;  1JK9 B;  2EFG A;  3DNC A;  3VF0 B;  2VOD A;  3MMC A;  4F0K A;  3DRS A;  2UVW A;  3CO9 A;  1AB8 A;  4FKX A;  2IMW P;  2LEB A;  4C8Z A;  1T9U A;  2PDA A;  5KG3 A;  1IQZ A;  5DM7 Q;  2Y9H A;  2JRS A;  3RW7 A;  1JLE B;  2FLN A;  1FJG J;  1KR4 A;  4XDC A;  4UY8 5;  4ERD A;  2HBQ B;  1NDC A;  3BQ1 A;  4PYA A;  2Q1L A;  1EZZ B;  3N5F A;  4B3R F;  4ICL A;  2UU9 J;  2MEW A;  4OYP A;  2KT5 A;  1Z2L A;  3DYA B;  3P8B B;  1RWX B;  3EGV A;  3M8Q A;  1S77 D;  2QMX A;  1Z1Z A;  1YDL A;  3IM8 A;  4WCE Q;  4UQG A;  2HG4 A;  4FYX B;  2E7W A;  2ZUG A;  3KJF B;  1S6Q A;  3M8P A;  3QAU A;  5E33 A;  5C25 B;  5IXU A;  5F8L A;  1WOR A;  4Y0F A;  4TU7 A;  1GX6 A;  1UPM B;  3A12 A;  1HR0 J;  2YKP A;  1X7V A;  2IYI A;  4Y2I A;  5D0R A;  2GQ2 A;  1TUG B;  2G0I A;  2RE1 A;  1ZH5 A;  3BSC A;  4ZVE A;  2J0X A;  2LKZ A;  1EIY B;  4EZ6 A;  4DEZ A;  2DIT A;  2HLU A;  3W9J A;  4CNZ A;  2BAC A;  5DDO C;  3OUY B;  3D0I E;  1R0C B;  1VRU A;  2X7I A;  5FDL A;  3LGM A;  2E5J A;  3DOL A;  1WEL A;  1KEK A;  4NA3 A;  5ETP A;  2KYZ A;  2ZWO A;  3OL6 A;  1KQK A;  4F36 A;  3B4M A;  1Y5I B;  3LO3 A;  1I94 J;  4M5I A;  2WOM B;  1MW7 A;  1S12 A;  4R8U B;  2W7O A;  1SKW A;  4B9M A;  3KLE A;  4NAS A;  4OZ3 A;  4QIE A;  1SJ3 P;  3AA8 A;  4BWJ A;  4YUD A;  5HQ8 A;  1HD0 A;  1WI8 A;  2BE7 D;  2YKA A;  2LEC A;  4PR6 A;  1LWE B;  1X9W A;  4ECW A;  1HNW J;  2VC0 A;  4C3K A;  3VTI A;  3HT0 A;  4PUO B;  1VQ6 S;  2BJ3 A;  1RHJ B;  4OV1 A;  1QSS A;  1RWK B;  4NZ0 A;  3TUP A;  1RXO B;  3CME S;  2MQL A;  3FC9 A;  2L08 A;  1H98 A;  4KKO B;  1E6Y A;  1JIH A;  3EDQ B;  2MY7 A;  1EX8 A;  2Y1J A;  2Q6B A;  1BE4 A;  3IR6 B;  2RQC A;  2HAF A;  2HBR B;  2I5J A;  2WBM A;  1RT7 B;  3K2Y A;  4IFY B;  2J6U A;  1GMW A;  3OTO J;  5A0Y B;  1QUV A;  1J2V A;  3WBZ A;  3T9N A;  3KK2 A;  1M5H A;  4FF4 A;  2HVE A;  4WBF A;  1Q86 T;  3QJJ A;  2E29 A;  1SCJ B;  2BKN A;  1CJT B;  3RG6 A;  3THT A;  2MQO A;  2BMB A;  2NSC A;  1BLU A;  2ZWP A;  2XMA A;  1FTR A;  1QLN A;  3T5J A;  3MCM A;  4GRS A;  2XBP A;  3QRP A;  4UY8 T;  2D9P A;  5F8G A;  4B3O B;  3KLF B;  3IBW A;  4CM0 A;  1L5U A;  2OLW A;  1K0T A;  4DF4 A;  4L3K A;  1TKZ B;  2EFO A;  5HVF A;  1FER A;  1Q7L B;  4C6A A;  1U6Z A;  2J7K A;  2LXF A;  1ZTW A;  2NRE A;  3DM2 B;  3VGS A;  2B5J B;  3NCP A;  2V9K A;  2ZHB A;  2DNO A;  2XS2 A;  1S1X A;  2AJF E;  3R9L A;  3M2U A;  1RZM A;  1RAG B;  1X0P A;  1K1S A;  2CKW A;  1SC3 B;  2QMW A;  1Z2Z A;  4DV1 J;  1OS5 A;  4K7Q A;  1SI9 A;  3CE8 A;  4PYD A;  4JI1 F;  4IRD A;  4L73 A;  4DX7 A;  4HTJ A;  5DQG A;  3ELH A;  3IG1 A;  3MEK A;  2HND B;  2HQ3 A;  2GGP A;  4DSI A;  2ZEJ A;  2ZBQ A;  1E6Y B;  2MXY A;  5CD4 A;  2Y8W A;  3OVB A;  4F02 A;  3KTQ A;  5IT9 Y;  1C0T A;  2K2P A;  2A1B A;  4DV1 F;  1PIL A;  1CQN A;  1FFS B;  3TA0 A;  2W4D A;  1N0U A;  4PEO A;  2RAQ A;  1DLO B;  2CPE A;  3ZNJ 1;  4M5J A;  4PAA A;  4FVC A;  2B6A A;  1KRP A;  1TL5 A;  2HWT A;  4FS1 A;  2DNZ A;  2IRU A;  1TV6 A;  2IM0 A;  1RWN B;  2IRX A;  2PGC A;  4KBI A;  2IM1 A;  2R7Q A;  3O1L A;  4LFA J;  4DR1 J;  1J5E F;  2HHW A;  1KTQ A;  1B4S A;  1VR6 A;  2BEF A;  2CPJ A;  2OSQ A;  2WVE A;  1FWL A;  1D8Z A;  1FK9 B;  2NXN A;  3DLK B;  1CJK A;  3DRP A;  3N6L A;  3OUY A;  4DFK A;  2LQ5 A;  3PEH A;  4ER8 A;  1TK5 A;  1SC1 B;  1HA1 A;  4UZC A;  3KUE A;  3AOD A;  2Z57 B;  1UTA A;  2VIC A;  3ZO7 A;  4CT9 A;  2YPY A;  2QA4 G;  1PIE A;  2DXD A;  2XUL A;  3I0S B;  2RUG A;  3G2X A;  2Z4P A;  3CJ8 A;  4M95 A;  1JLG A;  1NDK A;  2HNZ B;  2VDI A;  2VU5 A;  4RR5 A;  2HAI A;  3SYZ A;  4LRA A;  5HP1 B;  4PXC A;  1UWA A;  2CJA A;  3OV7 A;  2DRD A;  1PYO B;  4H4M A;  1XR6 A;  2IRY A;  2O1P A;  5DLF A;  1DHM A;  3MAH A;  1C0U A;  1GT8 A;  4MIA A;  1X60 A;  1AT1 B;  3PYD A;  1F1B B;  1M90 T;  2GA7 A;  4ED5 A;  2XM3 A;  1PG5 B;  1WF2 A;  3MMB A;  2DGS A;  4TVA B;  4WP3 A;  4DQP A;  2A0F B;  4ZVS B;  3UVJ B;  1RLC L;  2VG5 B;  2ZD1 B;  1IBK F;  1N8R T;  3HZG A;  3V6D A;  4OZ1 A;  4MKY A;  1X4E A;  1KVK A;  2W1B A;  3C19 A;  4XIU A;  2VOP A;  3PDN A;  5EX0 A;  3CJK A;  3BGO P;  4G1P A;  1H2T Z;  2V8G A;  2FJE B;  3ILO A;  4C7Q A;  3RAM A;  4WIQ A;  3KK1 A;  4FPI A;  2GMH A;  3GPA A;  4HR2 A;  3ENA A;  2BX6 A;  1JB0 C;  3CDW A;  6FD1 A;  4LQ3 A;  1HYS B;  1NDP A;  3FEZ A;  3JSM A;  3M2V A;  3BSN A;  1P9Y A;  1NK6 A;  5I4M A;  2IDE A;  2MZT A;  2HS0 A;  3OR1 A;  3R5C A;  4P2S A;  1RHR B;  4CLF A;  2UUA F;  3HK2 A;  4HDG A;  4O4G B;  4C11 B;  2YY3 A;  5CAA A;  2MKS A;  3VZH A;  2YNG B;  4FBU A;  1WC4 A;  2CQ1 A;  3G96 A;  1RA7 A;  5I3U A;  1S6P A;  5BR8 F;  3AD7 C;  2H4Y B;  4URS A;  4ZPD A;  4X4T A;  2KFN A;  2JWN A;  4H4K C;  1S6P B;  5E3A A;  3RBE A;  2HW3 A;  2BAN A;  3W2W A;  3A3O B;  2ZH1 A;  3RR7 A;  3ZZZ A;  4DR2 F;  3ZZR A;  2XWX A;  4Q2L A;  3QZ8 A;  1RIS A;  1S49 A;  1U1M A;  4QZV B;  2ZHO A;  4N56 A;  2BKP A;  3KLF A;  2VKZ G;  2FVP A;  2BE9 B;  2DHG A;  3MD3 A;  4P52 A;  3DU6 A;  4DR1 F;  3IWL A;  3H5X A;  1R6V A;  3JSM B;  5A2Q Y;  3Q23 A;  3RAQ A;  4HHU A;  1HBM B;  2OEJ A;  4J9S A;  1NHV A;  1S1U B;  1UKU A;  2OI2 A;  3OD2 A;  3M4X A;  2O01 C;  2DO4 A;  4NEZ A;  1IVZ A;  2VL1 A;  2P9C A;  3FEX B;  1K0V A;  1FX4 A;  2HHQ A;  2J5A A;  3BN4 A;  5A0Y A;  1QAI A;  2Z2M A;  5L38 A;  2RS8 A;  1KN6 A;  3KDO A;  5E2Q A;  1O0P A;  3HVT B;  4ZPV R;  3MED A;  2CQ0 A;  1TK8 A;  2GJ2 A;  3V81 B;  3IP0 A;  1S7I A;  2XHC A;  5KFE A;  4F2R A;  2W2O P;  3TYT A;  4IQX A;  4RU9 A;  2BJD A;  4O3R A;  2VG7 B;  5A2Q U;  3DI6 B;  4CO5 A;  3LA0 A;  2RHS B;  2FVR A;  2XLI A;  2UXC J;  3F73 A;  1KFD A;  1FKO B;  1RP5 A;  2MQN A;  3I4H X;  4ED1 A;  4QWA A;  2VJV A;  2AGO A;  1U1O A;  2DTJ A;  4C4W A;  1LOU A;  4P2X A;  2QC3 A;  4PAB A;  2CG8 A;  3TVZ A;  1Q1K A;  3AD9 C;  5D8H B;  2PD1 A;  2RNE A;  3R6L B;  4H4O B;  3PIP Q;  4CI0 B;  3G6V A;  1SKS A;  2DNY A;  1RTD B;  4ELV A;  5K8P A;  3TW0 A;  5IM0 A;  3GG1 A;  1BQM A;  2RB7 A;  1TFY A;  3D9B A;  5IT9 U;  1GMW D;  1FVQ A;  1MML A;  2LQ9 A;  1R8A A;  3AB4 B;  1XMO J;  4KO0 B;  2VA2 A;  4GO5 X;  4CLL A;  2J7W A;  2ASL A;  2KJW A;  1V3S A;  1WF1 A;  3K7R A;  3C6T A;  2XG8 A;  4ZOS A;  3TAQ A;  3SQO P;  1U48 A;  3OSN A;  2AMC B;  4DV0 J;  3HFK A;  2VFS A;  4XDD A;  3VVT A;  1S1U A;  4ZCK A;  3M6U A;  1OPI A;  2LLZ A;  5D6G A;  1KC8 T;  1S9E A;  2UUT A;  1NPR A;  3DRR A;  1FJG F;  1PC4 A;  3CIM A;  5LSR A;  1FWK A;  4LSZ B;  3RB4 A;  3HPO A;  4C11 A;  2VBW A;  1TQL A;  2PFD A;  1VQK S;  1S79 A;  1D09 B;  1ZZN A;  4CLT A;  1NSK L;  1R0A A;  1NJI T;  1JLE A;  2J0W A;  3UDL A;  4ECS A;  5L1K A;  3A3N B;  1TP7 A;  3Q8Q B;  1FCA A;  2XSJ A;  1UW4 A;  3EGW B;  1R6Y A;  1RKJ A;  3MWB A;  1N88 A;  1RT4 B;  4J37 A;  2PFF B;  4PZV A;  3R5G A;  2HVZ A;  3G87 A;  3Q89 A;  2D69 A;  2HQI A;  5ETT A;  4JI0 J;  4PWD A;  4NWB A;  4C9D A;  2JOQ A;  2PA8 D;  4MKV A;  4K4U A;  1U49 A;  3MCS A;  2ZZN A;  1D9F A;  1ZA1 B;  1XNQ J;  4DV7 J;  3MOJ B;  3W66 A;  2FLL A;  3OT9 A;  1QUP A;  4FNI A;  3UVJ A;  1M1K T;  2OAU A;  5D4P A;  4IOA Q;  1E6V A;  3H5S A;  2VQE F;  4J9M A;  3Q83 A;  2CZV C;  2VFU A;  4Y2C A;  4AYB D;  1S9G B;  2XLK A;  3NGD A;  2GX8 A;  4WFZ A;  2MJN A;  4CYU B;  4DJB A;  1IKV A;  2BOA A;  1S0M A;  4RKU C;  3ZZ0 A;  2V2Z A;  1FRX A;  3K8V A;  3JAM Y;  4YR2 A;  4BHQ A;  5LJ5 Y;  3MEE B;  1RT2 A;  2AV5 A;  2VUG A;  4AXI A;  3PVX A;  2MMY A;  1MU2 A;  2GMJ A;  2QFI A;  2WCX A;  2NPI A;  2F3J A;  3PO5 A;  8AT1 B;  3UN5 A;  2XC9 A;  2I38 A;  1U25 A;  3HX9 A;  4ILL A;  2AX1 A;  2RRB A;  2X3G A;  3EZU A;  1S72 S;  3MFI A;  1GAO A;  4O23 A;  2RIJ A;  1FEH A;  3KJV A;  3QQC D;  4G1Q A;  2AU0 A;  5SZT A;  3MEG B;  4JI2 J;  2CQP A;  4KTQ A;  4KO0 A;  3DMJ A;  5J2N A;  2IC3 B;  2BBE A;  5DRK A;  5IOL A;  3KOA A;  2H5I B;  2QA1 A;  4ZIW A;  1ULR A;  1IR2 A;  4C3M A;  2UU9 F;  4LSL A;  4J9V A;  3OFF A;  4RUB A;  4OZ0 A;  3PX4 A;  2DPJ A;  4K2X A;  1SBR A;  2O66 A;  1S59 A;  2CA9 A;  4FPR A;  5E3P A;  2GV1 A;  2JC1 A;  1F5C A;  1P27 B;  3Q2S C;  4PXE A;  5B0C A;  1NK0 A;  1H73 A;  4I67 A;  4N77 A;  3ZTR A;  3IXQ A;  1JLQ B;  3CCJ S;  2A6O A;  1WOO A;  1LW2 A;  2WB4 A;  4ZCI A;  2HFU A;  3EM1 A;  4ITS A;  4OLP A;  5B0G A;  1PJ6 A;  4F2S A;  2PMW A;  2GHV C;  4OFZ A;  1W7W A;  2C42 A;  5IT0 A;  1FRI A;  3TR5 A;  4ZPA A;  2DO0 A;  2B4P A;  5LMN J;  4DV0 F;  2J6S A;  3OJS A;  2DHA A;  3DOL B;  4M1K A;  1RTH A;  3BYR A;  2MKK A;  1C0T B;  1LV5 A;  2QA2 A;  1T9V A;  5GVQ A;  2NZC A;  4FNH A;  4UQT A;  1BUX A;  1XR7 A;  2Q43 A;  4MYU A;  3MM7 A;  3I5B A;  3ILI A;  2PC6 A;  2W9A A;  3IN5 A;  4OHY A;  4RBV A;  2CPX A;  1HW8 A;  2ZE2 B;  4DDF A;  4R5P A;  3G6X A;  3HHN B;  1NPP A;  4RBU A;  4YR3 A;  3JB9 k;  3TP2 A;  1GNK A;  2KXF A;  2QMU B;  4Y34 A;  4X2B A;  2XYP B;  3CWJ A;  1SC4 B;  3HSZ A;  2VQE J;  4JV5 J;  1VBX A;  1NND A;  2CFX A;  1F0X A;  2BXJ A;  2YNI A;  3NP5 A;  4LR8 A;  3H4D A;  1HNW F;  2AYB A;  2XO7 A;  1U1K A;  1RGV A;  5AXM A;  4ZKA A;  5B0A A;  5KT2 A;  3ISN C;  3AHP A;  2DGV A;  2I1R A;  5GMK a;  4X4V A;  3CCS S;  4OZ5 A;  3PJX A;  2FQQ B;  4RJV A;  1FA0 A;  1UVK A;  2ZC4 A;  1XBW A;  4WE1 B;  4O4G A;  4I56 A;  2GVD A;  1LK5 A;  4I6W A;  5DO2 A;  3BO2 A;  3GCW P;  2D3O 1;  3D6M B;  1ZYQ A;  1NJX A;  2P5V A;  4YS2 A;  2IJF A;  4IH7 A;  5GAE I;  2JVO A;  4LF5 J;  4ZVP B;  3T3F A;  2XZD B;  2VZ9 A;  4ZHR B;  4YB1 P;  2WON B;  1CJU A;  2OO4 A;  1T02 A;  1XWL A;  3BH7 B;  3IMQ J;  4HLB A;  2D7S A;  4NLO A;  4ZP9 A;  5EWF A;  5I42 A;  1NK7 A;  3JS9 A;  5J1N A;  5KFS A;  4B3R J;  2RML A;  4OJG A;  1X9M A;  1HBN A;  4PQU B;  2WB1 D;  1KLM A;  4J9K A;  3ZZO A;  2V34 A;  1QY7 A;  3KDN A;  3EUN A;  2XMV A;  3Q8Y A;  1UZD A;  4NML A;  3W2V A;  2OUG A;  3GIM A;  1T8E A;  1U4B A;  3TNV A;  3EXY A;  2HZC A;  2IBO A;  5DQH A;  1Q4R A;  2PA3 A;  3NGR A;  4S0M A;  1HNX F;  4NCG A;  4DLE A;  2NQP A;  4DU7 A;  2F9D A;  4WTO B;  2DNM A;  1HHQ A;  1LWE A;  2W8K A;  3MCO A;  3RB3 A;  5IV3 A;  3GJR B;  2RS2 A;  1RTI A;  4C48 A;  5B7W A;  3CUL A;  1IJE B;  2V6A A;  4KYZ A;  5ETK A;  3W5X A;  4WFB Q;  2OD6 A;  4TYB A;  3R7N B;  2DD8 S;  3O5T B;  2KT3 A;  5DGA A;  1YRT A;  3ONQ A;  1HWJ A;  1SKU B;  4JV5 F;  1S9E B;  1TKT B;  5LXY A;  4K4T A;  2V2K A;  4DLG A;  1ZM2 A;  3PR5 B;  4I6A A;  2LFV A;  3FBF A;  2DRB A;  5AXL A;  5E3C A;  1KHV A;  2NUH A;  3HHL C;  1VQ7 S;  3TA2 A;  1U8S A;  4JI6 F;  1NLK L;  3KK3 B;  4DV6 F;  1HBO B;  4LF7 F;  4U95 A;  4CH7 A;  4DV5 J;  2H9Z A;  1PJ7 A;  4EI2 A;  3QYY A;  4B9V A;  1F60 B;  2V67 A;  3H2L A;  3I5C A;  1X4A A;  4QIG A;  1V9O A;  4ZP6 A;  3W9H A;  1IQT A;  1BWV A;  3M9O B;  2DVI A;  2QG9 B;  2IIH A;  3VQT A;  3ZNU A;  5H9F J;  1REV B;  4WXW A;  3UR3 C;  2XCA A;  2AWZ A;  2HWH A;  1TKX B;  1S1T A;  3EX7 B;  1YGY A;  2DH7 A;  1D9A A;  2NXE A;  1WAC A;  3RJM B;  4A8W A;  3DGP A;  4LF2 A;  3SV4 A;  3OTD A;  3PXG a;  3VQS A;  3T1H F;  2OTJ S;  4RL1 A;  4WWS A;  3MCN A;  4ES3 A;  5C7P A;  4DS5 A;  3E8O A;  4HI2 A;  3SCL E;  2AHO B;  3SSR A;  2N3O A;  1WF0 A;  1VS3 A;  2F8E X;  4WII A;  1BGX T;  2VD3 A;  4V1A k;  3HVR A;  4OJ1 A;  2KXN B;  4PQU A;  2KZM A;  4RZR A;  1WEY A;  2V4J A;  3MFH A;  1CJU B;  3MM5 B;  4X65 F;  2B4O A;  3OPK A;  3AH6 A;  3CPW R;  1SQE A;  4WFA Q;  4CWB A;  5J2Q B;  4KIA A;  3HM9 A;  2GVD B;  4X64 J;  1NJZ A;  2BOP A;  1RTJ A;  2D9O A;  4NRU A;  1S99 A;  1S6U A;  1QTM A;  4P72 A;  3W2W B;  1U09 A;  5C42 B;  2CJB A;  2EW9 A;  2NR0 A;  2UXB J;  3CJS A;  2Q79 A;  4EGL A;  1EKR A;  5KFZ A;  3LWL A;  4LIR A;  4X65 J;  2AEJ A;  3GIL A;  2W7A A;  3PFE A;  3RBD A;  3Q2T C;  4KH1 B;  2G2Y A;  1RU1 A;  4KT0 C;  4RW4 A;  2V4J B;  2KVQ E;  4QWB A;  5EGY A;  4X84 A;  2M7S A;  1P1T A;  4IKA A;  3V5R A;  3IWN C;  1FK9 A;  3PJW A;  2LP4 A;  3CC7 S;  2NCK L;  2FVC A;  4BC9 A;  3SZ2 A;  2E5L J;  2DYA A;  2UXD F;  3SV3 A;  2IVM A;  3BGR B;  3KG4 A;  5L9N A;  5EHH A;  8RUC A;  1IR1 A;  1N36 J;  5CD4 H;  1T05 A;  2OPP A;  1ZA2 B;  2GNK A;  2J8S A;  5BR8 J;  3LH2 S;  3MAQ A;  2VC1 A;  2QSF A;  4TYA A;  3WHI A;  3X3U A;  3W7B A;  4IOC Q;  2WSC C;  3D3C J;  3LQV A;  3J81 U;  4Q5V A;  2OIH A;  3C8Y A;  4N41 A;  3NMA A;  1ROF A;  2ACY A;  2AT1 B;  3HHL A;  4ALZ A;  2XEX A;  1RWU A;  2C3Y A;  1WI6 A;  3D6T B;  3OBI A;  1N5V A;  4LVN P;  4YR0 A;  3J7Z T;  2J0S D;  1IBC B;  3HKW A;  3VGU A;  4C0B A;  4Z2X A;  4AL5 A;  1DTQ B;  3DDN A;  3R8Y A;  4WF9 Q;  2KXH A;  3NLC A;  4U7U D;  1U0S A;  4LIW A;  1NHK L;  1UVJ A;  3OSP A;  4N76 A;  2CWK A;  4C8L A;  1TL3 B;  3FMB A;  1SV5 B;  2QL9 B;  2OPR A;  1VMB A;  3DLE B;  9RUB A;  3HKZ D;  4HT5 A;  4OI2 A;  4ILR A;  4O3P A;  1HBO A;  4A48 A;  1U45 A;  2EC0 A;  5LM7 E;  3G8S A;  3UPF A;  2F4V J;  3BBC A;  1JXE A;  3O6Q A;  2VJU A;  4FF3 A;  2R7T A;  3EGN A;  1FO1 A;  2ZH5 A;  4ZHR A;  3DDI A;  4DBQ A;  1FE4 A;  4DZD A;  2E1P A;  1RCO B;  1Y7P A;  2XTJ P;  4RUC A;  1LFP A;  2CVI A;  1VC0 A;  2FJW A;  4I2Q B;  4W90 B;  4JV0 A;  4NXN F;  1SIZ A;  4HH1 A;  1YHQ S;  2XMU A;  2IPO B;  7FD1 A;  3LUY A;  3QIP B;  1GXU A;  5I3Q A;  3RBZ A;  4Y3C A;  1UVL A;  1N0V C;  1P1L A;  1ICE B;  1S6Q B;  3M8P B;  1H38 A;  5HAN A;  3MUT P;  2VKR A;  3HI9 A;  1NSA A;  2VPZ B;  4DPY A;  3PKM A;  2DH9 A;  4NCG B;  4KSE B;  5DJB A;  3V4I B;  4F3O A;  4RBT A;  1F3F A;  2V4R A;  1RHK B;  4F67 A;  3F41 A;  4FDF A;  3LGH A;  2DIS A;  2CPY A;  1RTI B;  1EET B;  2H5J B;  1U26 A;  3DN9 A;  3CCL S;  3W1Y C;  3IWX A;  3DLL Q;  3I31 A;  4OLO A;  3D3B J;  1QDU B;  1RT1 B;  4TU9 A;  5HK4 A;  1N34 F;  1L3U A;  1UVN A;  2AJ2 A;  3QAT A;  3G9C A;  2AGP A;  4LF8 F;  1HNI B;  5SUH A;  2R7X A;  3UNG C;  4YEA A;  3DOM A;  3MM5 A;  2V8D A;  3MM7 B;  3PV8 A;  1WSV A;  2ZOF A;  1LQ9 A;  2CQD A;  3DOM B;  1L3K A;  3T6J A;  4CLU A;  3BGU A;  2ZH7 A;  1Y9O A;  1C2P A;  2E1R A;  5D4O A;  3HJV A;  4ELT A;  1EQ0 A;  2KYX A;  3PRD A;  4DOZ A;  1Q82 T;  1FES A;  3AXM A;  1T11 A;  4K5S A;  4DUZ F;  3LW5 C;  1VLY A;  1VQ9 S;  2UUB J;  2MQ8 A;  2QFJ A;  4RLE A;  2WON A;  4LF8 J;  1PAE X;  3OTB A;  3CSK A;  1S9F A;  4V19 X;  2QYG A;  2POK A;  4DN0 A;  5K20 B;  2Z0G A;  5AT1 B;  1ACM B;  2BRK A;  3ZZT A;  1TKZ A;  2GAH C;  2RRA A;  2BUN A;  2ZJP Q;  2ZJQ Q;  2GFF A;  1JJ2 R;  2VB6 A;  1WKK A;  2RDD A;  4ANE A;  3Q24 A;  5KFY A;  1RT3 A;  1TVR A;  4WZM A;  3JSR A;  1DRZ A;  2BZ2 A;  2BRL A;  3HF5 A;  3V4I A;  4OI1 A;  4R5P B;  1LXN A;  4M5N A;  4Y2A A;  1RKI A;  2JDJ A;  1F6T A;  4Q43 A;  4NPO A;  4ID8 A;  2IC3 A;  2QLX A;  4EYI B;  1SVD A;  1DQA A;  1OY9 A;  1SB6 A;  2PO4 A;  2YNI B;  3K89 A;  1H6K X;  2AZ3 A;  4JUZ A;  1FRJ A;  1VRT B;  3FRY A;  3LP0 B;  4CIO A;  1OQ6 A;  2FY1 A;  2DHX A;  5G0R A;  2B9Y A;  5HO4 A;  3BSO A;  4NLU A;  3U27 A;  1B0V A;  1BD6 A;  4NLS A;  4M5M A;  1DY3 A;  2EI5 A;  3P4U B;  3LAL A;  2AW0 A;  2RH3 A;  4I2Q A;  4OZN A;  4KQZ A;  3EGZ A;  1P9Q C;  4F0M A;  3NXZ A;  4CO4 A;  3QGP A;  2G4B A;  2EKN A;  2CUY A;  1YTY A;  4LRE A;  4F4Y A;  1J5O B;  3JTN A;  2MZQ A;  2M70 A;  3Q8V A;  3NGS A;  2JX2 A;  1VQL S;  4QU7 A;  5KG1 A;  3UW1 A;  3OTC A;  3GG0 A;  2KDO A;  2AX0 A;  1AA1 B;  1S9G A;  3KMS A;  2C2R A;  1KQS R;  1PGZ A;  4DR4 F;  4KHM A;  3CJ5 A;  4Q0B A;  4DFP A;  1FVS A;  3VAJ A;  3Q22 A;  1WC6 A;  3D67 A;  3W2V B;  3R7B B;  2R3V A;  3FQL A;  2M4M A;  2CZ9 A;  4JI3 F;  2ADC A;  1IWG A;  2MQM A;  3DGV A;  4NA1 A;  1VHI A;  2KU7 A;  4ZPB A;  4QW8 A;  4ZS6 A;  3OHB A;  3CB4 A;  1HWL A;  1YZ6 A;  3RBX A;  1LWF A;  1G6B A;  1B7Y B;  1XK8 A;  4RW8 A;  3WZ0 A;  4CNY A;  5D77 A;  1RAA B;  5HVH A;  1GQE A;  1UEU A;  4FZV A;  4IO9 Q;  4KH0 B;  2H4W B;  2OHD A;  1NZ8 A;  1NCL A;  1SQG A;  2WZ1 A;  3OXL A;  2HGM A;  4QIF A;  3PIO Q;  1WOP A;  3JTO A;  4DR5 F;  1S4F A;  2QE5 A;  4RWX A;  4FYV B;  2CQ2 A;  1N5T A;  1VI7 A;  2R2T A;  3TAR A;  1RT2 B;  1NK8 A;  3Q8U A;  1FNO A;  1OY6 A;  1JLF B;  3QID A;  5CCM A;  3OL7 A;  3LWM A;  1M5V C;  2HHH J;  1FKP A;  1IUJ A;  1YBA A;  4K2J A;  1BXN A;  4PCQ A;  4IRC A;  4IUF A;  1VQN S;  2R7S A;  2DIV A;  2FB0 A;  3B4D A;  5IT4 A;  3FBC A;  5LMU F;  4PWU A;  3J80 Y;  4MYT A;  1DTT B;  1N52 B;  2W4C A;  3RYL A;  2LVW A;  4J9R A;  3J7Y I;  2WAQ D;  1XR5 A;  4UOC A;  4ED6 A;  2FPH X;  4MK9 A;  3QO9 A;  3QGH A;  2C2E A;  4ECZ A;  3FZ2 A;  3GFY A;  3C16 B;  3RTV A;  2HVH A;  2ZOM A;  4B08 A;  4ZVH A;  5KFX A;  1PSD A;  5KT3 A;  2UUC J;  2R42 A;  4DV2 F;  3IR7 B;  1WNE A;  1H2U X;  3SFG A;  4LVO P;  4KHR A;  4BLG A;  4DQQ A;  1RK8 A;  2CNN B;  4YB6 A;  3MMA B;  2HUR A;  1NSP A;  1RT6 A;  3D4J A;  4OV6 A;  4E98 A;  5FLX U;  3OLB A;  3VAG A;  1M5K C;  1VDH A;  3HHL D;  4C98 A;  1IBL J;  1RJJ A;  3KFW X;  4KB7 A;  2E1C A;  3QGI A;  3CCE S;  1TKD A;  3DGP B;  4HAC B;  4JYA F;  3L9Z A;  4NLQ A;  3TVK A;  3FCH A;  4MKA A;  3QJP A;  1S1W B;  2C1E B;  5LOQ A;  1R89 A;  3VAK A;  4ES1 A;  3FJ2 A;  3VWS A;  3O3L A;  5H1S V;  1XC9 A;  4M5D B;  3LAN A;  2ZH9 A;  1RAB B;  1JWW A;  3AAW B;  3GE9 A;  3ITH A;  3U1M A;  3P49 B;  2QX0 A;  3OXF A;  2XNQ A;  5EX3 A;  3EDR B;  2M8D B;  2LYV A;  4GKJ F;  1AUS L;  3MR7 A;  5CXT A;  1RBO B;  2DNH A;  1SH2 A;  2XB2 D;  4XK8 C;  3DRX A;  1XNR F;  2NPF A;  4DR3 J;  3M8Z A;  2HHP A;  4F4K A;  4IFV B;  2FZK B;  2HIQ A;  3FK4 A;  4OX6 A;  4YDD B;  2AYE A;  4ID5 A;  2BQ3 A;  5KFP A;  3LAK A;  3M30 A;  3OXG A;  3OFH A;  1VFJ A;  2DY1 A;  4NLD A;  1NAQ A;  2MHE A;  2HSE B;  1ZAV A;  5EWE A;  4EBD A;  4HYK A;  1B70 B;  3CGI A;  1KSP A;  3NAH A;  2I6W A;  3HZE A;  5HSP A;  5IM0 B;  1XER A;  4ZVQ B;  4E0D A;  2MJU A;  3DMJ B;  4G3I A;  4UW2 A;  4DL2 A;  5GAE U;  2EKY A;  4E2F B;  4ZMM A;  5KFK A;  1HQE B;  2CJ9 A;  2YKO A;  5DLG A;  5DDP C;  2CNO B;  3PEJ A;  1SJ1 A;  1JLA A;  2MKY A;  3AD8 C;  2RU3 A;  5BYS A;  1EHW A;  1VC6 A;  1H0H B;  1TEL A;  1WC0 A;  4MK8 A;  1TKT A;  4B3M F;  3CW2 C;  4B9U A;  5LMN F;  3DYA A;  3GYX B;  1RAC B;  2R8J A;  2N7C A;  4K0K F;  5DDR C;  4Q2M A;  3PRB A;  5KFT A;  2RRN A;  4IG3 A;  2OJ3 A;  5J2Q A;  5HVG A;  2M8H A;  2QEX S;  3CDE A;  5LSL A;  1EP4 A;  5B09 A;  4BDP A;  2HQD A;  1KVJ A;  1M5S A;  3EXC X;  2EBE A;  3GLJ A;  4Z7Y A;  3M2R B;  1ZTT A;  1TFW A;  2E1M C;  2VV5 A;  2PN6 A;  4WKY A;  3CCU S;  1N5S A;  5K9F A;  2KRR A;  4O44 A;  3BO3 A;  1PJ5 A;  2DBB A;  2LQ8 A;  2ZDO A;  3IG1 B;  4ED7 A;  1DZ5 A;  2YKN B;  3TZW A;  2GIR A;  2A2D A;  2HNY A;  4CLW A;  2EK1 A;  1HBN B;  2R4F A;  2DEJ A;  2YKN A;  1LEO A;  1NSQ A;  4DV4 J;  1EQM A;  1OPZ A;  4ECV A;  1D3W A;  2CJX B;  2HK3 A;  2JEG A;  4FXW A;  4Y28 C;  5C2C A;  2H5E A;  2ROP A;  4X4N A;  3TZZ A;  1WG5 A;  3O2I A;  3N6M A;  4MAK A;  2VHG A;  2Y1I A;  3TZY A;  1IKY B;  2HS3 A;  4J9Q A;  2ZVS A;  4TKT A;  2R7U A;  3C15 B;  2A6M A;  3DDK A;  3PO4 A;  2AF6 A;  4ATN A;  5DG7 A;  3H20 A;  1M1H A;  1KON A;  2J0Q D;  1ZPV A;  3PY8 A;  4EO8 A;  2CQH A;  2Z2Z A;  4O4R A;  3KUH A;  4UT4 A;  5HN0 A;  3GV7 B;  4G65 A;  4X4P A;  1RQ0 A;  1Y5N B;  2IJR A;  2OFH X;  3FUY A;  4N8N A;  3PW5 A;  4BS2 A;  3MAA A;  2HBZ B;  1WKL A;  1IR0 A;  5GME A;  3I4P A;  1JLC B;  2VF3 A;  4LBP A;  5KT5 A;  1LWF B;  4RW8 B;  4FF2 A;  4KC5 A;  2ZC3 A;  5IZH A;  2L3M A;  4IFY A;  5F8M A;  1HNZ J;  2X1B A;  4TY8 A;  2ZBP A;  3DLH A;  4USI A;  4KPY A;  2HEK A;  2DJW A;  4HDH A;  2R8G A;  3Q86 A;  4EYH B;  1N6Q A;  1JJC B;  1GMV A;  1OQ3 A;  4ZLJ A;  3KK1 B;  3FGV A;  2XNR A;  1SQF A;  3CCZ A;  3ITH B;  4J9U E;  2L48 A;  2OPQ B;  2OGU A;  3FKB A;  4IG0 B;  4M63 A;  1OSC A;  1M1G A;  2FDN A;  1F5A A;  2XWY A;  3GMG A;  4ZN1 A;  3E2E A;  1RTH B;  3NY0 A;  3MOZ A;  1KLN A;  3KLH B;  2HHV A;  3GTY X;  5AXK A;  2IHR 1;  1DJ0 A;  1Y0H A;  1B99 A;  2B7C B;  2GML A;  2VG5 A;  2ZD1 A;  4Y00 A;  5KTQ A;  3LF0 A;  4M5H A;  4AL6 A;  1WDD A;  3I5A A;  2CJQ A;  5L1L A;  3SSQ A;  2JLG A;  2QLB B;  2M9K A;  3V6H A;  1TL7 B;  3OVA A;  2HBY B;  4MIB A;  2OEL A;  4B17 A;  3T1Y J;  3NBP A;  4L72 B;  4CO0 A;  3BEG B;  2KM8 B;  1UVI A;  1VOM A;  5CZX A;  3AOB A;  3QGG A;  3PR4 A;  4DV5 F;  4QJV A;  3WC0 A;  3B82 A;  4WK1 A;  2B43 A;  3ZTO A;  1EKS A;  1QTN B;  3BN7 A;  1EB0 A;  5L46 A;  5A8W A;  5F8H A;  2ZIT A;  4CRJ A;  4J9P A;  2KHC A;  1YKW A;  3HUL A;  5ETV A;  1K8A T;  2KTQ A;  3D0H E;  4LFC J;  4QBU A;  1SL0 A;  2MGZ A;  2KT2 A;  5LXR A;  1URR A;  1T03 A;  4LFA F;  2LMI A;  4TLQ A;  2H48 B;  4LF4 F;  2ZOG A;  1X0F A;  1T0T V;  1FI4 A;  4YOE A;  2MST A;  3HHD A;  1OSD A;  1RTJ B;  1VBK A;  2DNR A;  1NK9 A;  4AQY J;  4OZL A;  4ECX A;  5D0H A;  3OJU A;  1JLB A;  5KFC A;  4L6V 3;  5B08 A;  2CQ4 A;  1H3D A;  2NXU A;  3CTR A;  4GKJ J;  3BSA A;  5A8K A;  5E3Q A;  1MMN A;  4QYR A;  3J81 Y;  4ICL B;  2LA6 A;  1L3V A;  1D0E A;  3QT7 A;  1AUD A;  2HPU A;  4LF4 J;  4F04 B;  1MWQ A;  1UJ6 A;  2HRY A;  4PG8 A;  4ECT A;  5IC6 B;  3AQO A;  3OR1 B;  4QPX A;  4QWD A;  1IWA A;  1KP6 A;  4I0W A;  1NXI A;  4CLK A;  1HBU B;  3A8E A;  2ZZT A;  4DCP B;  4LUB A;  1RA6 A;  3HSD A;  4A8S A;  1PYS B;  2K1R B;  3BPD A;  4DQI A;  4DR6 F;  3OVS A;  4LFC F;  2K1R A;  1G3O A;  1FF2 A;  4OHV A;  3CJK B;  3HJF A;  1RT5 B;  2MZJ A;  4KJI A;  4KHP J;  2VBZ A;  1IBK J;  1RWM B;  1V6H A;  2F9J A;  4KGM A;  3HXM A;  2X1F A;  1DQ8 A;  2NLW A;  2R9L A;  3NG8 A;  3OL8 A;  2W9C A;  5K5M A;  1EET A;  3SEO A;  1WTF A;  3BF4 A;  4EO6 A;  1N34 J;  1M5O C;  2F65 A;  3SMZ A;  1RYS A;  4ELU A;  1N48 A;  1VRQ C;  2KJV A;  4M94 A;  1CPZ A;  4OJH A;  5C24 A;  2BM0 A;  2J9D A;  1S6O A;  5KT4 A;  3T5H A;  1DTT A;  1HWU A;  4R8U A;  1IM4 A;  2RF2 B;  3D1O A;  4K4S A;  4B9N A;  1XEZ A;  4X4R A;  1DFD A;  3T19 A;  2RUS A;  3K5M A;  1R0A B;  2PII A;  2WVD A;  4Z37 A;  1U1L A;  3GWC A;  1PAU B;  3D1Q A;  4ZLP A;  4OZ2 A;  1JNZ B;  1OO0 B;  2R7O A;  1NHU A;  3H5U A;  3I55 S;  1RHQ B;  2D3Z A;  2DNN A;  4C2M A;  2YNF A;  3MGJ A;  3SFU A;  4ZIT A;  2GIQ A;  2R2U A;  5A76 A;  2GS8 A;  2YNF B;  2VIH A;  5DS7 A;  3W5Y A;  2EG2 A;  4HHJ A;  3BPS P;  1HFE L;  4UOG A;  1FDD A;  5LT5 A;  1OJ4 A;  5KFD A;  5GMD A;  2C3M A;  2BR0 A;  3UD5 A;  2E5H A;  3PNI A;  2MPU A;  2YNH B;  4DL5 A;  4F4Z A;  5D4L A;  1SV5 A;  1GXL A;  3CJQ A;  3L7O A;  1ZAW A;  4P2F A;  4OX9 F;  5KFN A;  2B4V A;  3CXC R;  4F4X A;  4NYP A;  5KFV A;  4ZLL A;  2B9X A;  2B6A B;  1RCX B;  1TVR B;  1S1V A;  3VHQ A;  4AE5 A;  4JI7 J;  2RQM A;  4B3T F;  2KFZ A;  4JBC A;  2XMM A;  2HIY A;  2JVR A;  3NS6 A;  1IKV B;  3ZTQ A;  4FBT A;  4Q8F A;  5H9E J;  3U02 A;  3KLH A;  3PHE A;  2WK4 A;  2CQI A;  1ZOT A;  3BQ2 A;  2W9B B;  4EEY A;  3LP1 A;  3PM9 A;  3W65 A;  1WTB A;  3OHA A;  5E3R A;  1U0H A;  4A8Q A;  1AXQ A;  1WSR A;  3L7U A;  4QR2 A;  3JQJ A;  2W25 A;  3GFH A;  3MED B;  2EXU A;  4PG4 A;  4TY8 B;  2HMI A;  2QRR A;  2ZDP A;  1GK8 A;  2CIM A;  2F8H A;  2O67 A;  2K7K A;  2YQ1 A;  4JI3 J;  3SQG B;  4ES2 A;  3CED A;  2APO A;  3C14 A;  4A8O A;  1R0B G;  3IGV A;  3ILJ A;  2WVF A;  3UQS A;  2VON A;  3GU0 A;  2AGQ A;  1PBU A;  3MZI A;  5KFO A;  2IVF B;  1AYE A;  4K5R A;  4OHX A;  3BZQ A;  2ZUA A;  5D0E A;  4DSE A;  2LA4 A;  2V94 A;  3U1L A;  4RNN A;  1I5O B;  2ADB A;  1RAJ A;  1NDL A;  2CJY B;  1FDN A;  4HL9 A;  3M9M B;  2NXJ A;  5KFR A;  1JMT A;  1NB2 A;  4UOF A;  4WE1 A;  2UVR A;  1X4D A;  1SIW B;  3DOK A;  4UOH A;  1U47 A;  4QQB A;  4J91 A;  4XO0 A;  1VQ8 S;  2RF2 A;  3TO8 A;  4GC7 A;  5FLX Y;  4KGX B;  3UN3 A;  2HQC A;  5DG8 A;  1HIY A;  1X9S A;  2C2N A;  2FVQ A;  1VCT A;  2ZZM A;  3TWZ A;  2EVZ A;  3HDS A;  2CPZ A;  2YKQ A;  4K4W A;  2FC9 A;  2JH3 A;  2RD5 C;  2ROE A;  5D4N A;  2QA4 S;  3MDF A;  1YJ9 S;  5KFJ A;  5KG6 A;  1WEX A;  5KFM A;  4DSJ A;  1HNV B;  1PO6 A;  4JI6 J;  5A8W B;  3ILL A;  2H1Y A;  5F0W A;  3S7R A;  3TX8 A;  1LFW A;  5CYQ B;  3CVK A;  2EFP A;  4HTI A;  3I6P A;  4W92 B;  5DM6 Q;  4ED2 A;  2ZKU A;  2HQG A;  2DCL A;  5AE2 A;  1RU2 A;  2QSW A;  1U0H B;  2MKI A;  3KHG A;  3CD0 A;  3NCQ A;  2AJQ A;  4KY3 A;  5E7O B;  4JI0 F;  1NB7 A;  5HJY A;  1HBU A;  4LF6 J;  2DNQ A;  4ZA1 A;  1FX2 A;  2XO6 A;  1U7L A;  1LW2 B;  1HI8 A;  2DT9 A;  1AFI A;  3THV A;  2FTR A;  3NOC A;  3KLI A;  4F50 A;  3ET6 B;  3NL0 A;  1J5O A;  3R97 A;  3UDC A;  1DAR A;  4NLV A;  4J9L A;  5HP1 A;  4OX7 A;  1IM6 A;  4OMF G;  3FSY A;  1JXV A;  1CQM A;  2GJI A;  3BBB A;  3GB0 A;  3CDU A;  3PX0 A;  1PBA A;  2XS7 A;  3BGL A;  3BQ0 A;  1CVJ A;  2GO8 A;  4DZ6 A;  3FEY B;  4C8M A;  2OMO A;  4YY3 J;  5L8R C;  3V4M A;  3UR0 A;  3K0J A;  3OFG A;  4X4O A;  2CQC A;  4WFN Q;  1Z4U A;  2VPY B;  2MY8 A;  3QWU A;  2LDY A;  3I0S A;  5DZ7 A;  2LXI A;  3JAM U;  1OY8 A;  1T05 B;  2UV8 A;  1LXJ A;  2IM3 A;  4EUV A;  4N7T A;  1TV6 B;  2W2M P;  2FHK A;  2C2D A;  4LF5 F;  3DXS X;  4QYZ K;  1KQG B;  3ICL A;  1V3R A;  3GII A;  3IS9 A;  2F8M A;  5K14 A;  2G9O A;  2QL5 B;  1RI7 A;  2DGU A;  4RW4 B;  3GP9 A;  1F9E B;  2CDR B;  3UDE A;  4DPX A;  2BW2 A;  1HW9 A;  2HFS A;  2KN4 A;  5DDQ C;  2RHQ B;  3W60 A;  4ZCM A;  4DWI A;  2DB1 A;  1X4G A;  2QLF B;  2XMT A;  3M8Y A;  3MHY A;  4ZVG A;  3SSS A;  5I3U B;  1T9T A;  4A8Y A;  3MXH P;  3G82 A;  4K59 A;  2HVI A;  1LW0 B;  3QAE A;  2ILY A;  1DLO A;  3NGT A;  2FHJ A;  1GTE A;  4MIW A;  4RW6 B;  2VPW B;  4N8O A;  3T6B A;  3V2U C;  3J7Y U;  3Q8P B;  3QRQ A;  3ET6 A;  3MPY A;  4C8Y A;  3J81 j;  3NS5 A;  2RQK A;  1ZAX A;  3VVU A;  1VQY A;  1YLX A;  1S4E A;  2COL A;  2RT3 A;  2IJN A;  2AQ4 A;  2XLJ A;  2MB0 B;  4TQS A;  3H5Y A;  4ZP8 A;  1HYS A;  4PXB A;  1RT4 A;  3TI0 A;  1N33 F;  4KE5 A;  1U2F A;  4HKQ A;  2DHH A;  3R5J B;  4JB8 B;  4PKD B;  3L3C A;  1YRU A;  2EWH A;  5T7L B;  4DPW A;  1HBM A;  2DGT A;  3TAP A;  2DKO B;  3QT5 A;  2XMK A;  4X64 F;  2IM2 A;  1HNZ F;  3ZTP A;  1R27 B;  1G4C A;  2ZNY A;  4C8K A;  1WC5 A;  1TUW A;  3Q8R B;  3A1Y G;  4DR4 J;  5KFA A;  1LWC B;  2FLO A;  4OL8 A;  1S1X B;  1YI2 S;  3BM7 A;  2BAN B;  2L9W A;  3POT A;  1RAO A;  2HYI B;  3KG1 A;  1SH3 A;  4IR1 A;  4I2P B;  3GSD A;  4NXM F;  2NS1 B;  1KBR A;  2B9W A;  1FKP B;  2AJ0 A;  1PKU A;  1JLA B;  4RNH A;  4W4M A;  3VV2 B;  2F4V F;  3G6E S;  1XMQ F;  4LFB F;  3C6T B;  4LT6 A;  3D0G E;  2ZHA A;  1LNQ A;  1TMJ A;  2QGF B;  3MM9 B;  4WU2 A;  3D1H A;  3TZX A;  1RDR A;  2RKI A;  4I68 A;  5B0B A;  4DUY F;  3MPW A;  2ALZ A;  2WW4 A;  2U1A A;  1FFW B;  4OYM A;  2GCF A;  3P45 B;  3JXO A;  4DG1 A;  3N4W A;  2WSE C;  4MH8 A;  1N36 F;  4IH5 A;  3L95 X;  4CLS A;  1SL2 A;  4UTG A;  2BE2 A;  3S01 A;  2M2B A;  1ZPW X;  3G4S S;  2HK2 A;  1J27 A;  3JTP A;  3SQG A;  4JI7 F;  3MUM P;  1YJU A;  2QL7 B;  4DCJ B;  1X4F A;  4URG A;  4L74 A;  3BYP A;  4Y2K A;  2B4U A;  1Q53 A;  3GJQ B;  5F3T A;  3CJR A;  4BC7 A;  4KHP F;  1G7C B;  1KVI A;  1MLA A;  4PRF A;  1VHF A;  3MEC B;  1AZS B;  2OPS A;  1CSJ A;  2F4F A;  3JQK A;  2HRU A;  2YXL A;  3IO1 A;  1VBZ A;  3TQE A;  2C22 A;  1MNE A;  3HHK A;  2P9G A;  4ZJO A;  1B0P A;  3C2P A;  1ZBT A;  3QBC A;  2Z56 B;  4E8U A;  4F0H A;  1N5Y B;  2JEF A;  2YWK A;  1BQN B;  1UL3 A;  5K8O A;  1RWO B;  2FVS A;  4CO3 A;  2BQU A;  5LJ3 Y;  3IFE A;  1DQ9 A;  2KI2 A;  2UZA A;  4YDX A;  5I42 B;  4WXO A;  4YHH J;  2UVU A;  4P73 A;  2R8I A;  4M5L A;  1WHW A;  3BR8 A;  2HND A;  4FKY A;  2FIU A;  2CZ4 A;  2RVJ A;  3HCX A;  4DUZ J;  3R3T A;  2IA0 A;  1NJY A;  4USM A;  3LGN A;  2ASY A;  3R2D J;  3MM9 A;  4DN9 A;  3DLK A;  3DRP B;  4DR5 J;  1Q78 A;  3HT3 A;  2FJV A;  2VFV A;  4K50 A;  5L9X A;  3CC2 S;  3C3L A;  4AXJ A;  3O44 A;  2DR8 A;  2IDL A;  1HWK A;  3THP A;  1C1C B;  1PC5 A;  5KG2 A;  3D28 A;  4IOB A;  2JFD A;  2PEB A;  1QVG R;  1JX4 A;  2E7X A;  2XY7 A;  1HR0 F;  2IVY A;  3OR2 A;  2R8H A;  4HVZ A;  2ALY B;  3NCR A;  1VLO A;  3BKU A;  4IYQ A;  2DGQ A;  1LWC A;  2R8K A;  4CLZ A;  3K57 A;  2MLZ A;  1VK3 A;  2DEI A;  2E66 A;  2V50 A;  2H51 B;  4P9S A;  1VYA A;  3QJL A;  4B3O A;  3NMR A;  1FHT A;  3H2U B;  4DX8 H;  4MT1 A;  1NPK A;  3M8Q B;  3PFO A;  5KFI A;  4HEA 9;  2E1A A;  1KOO A;  5T7L A;  2XGQ A;  1XMQ J;  3X1L B;  2PEH A;  2CNK B;  2UV8 G;  4NX9 A;  1WHV A;  8ATC B;  2QV6 A;  3PYE A;  1CJV A;  4A8K A;  4OI4 A;  1BC6 A;  1ZZF A;  1XMO F;  2X3D A;  4QIW D;  3AA9 A;  4PQA A;  4QIV A;  1RHU B;  3FFI A;  3WIV A;  3WQP A;  4DCO B;  2G2O A;  3S1T A;  6FDR A;  4O0I A;  3T5L A;  2YX1 A;  3V6D B;  2ZE2 A;  1YX2 A;  2YX7 A;  1B3T A;  4O44 B;  3NGU A;  2JNJ A;  4I7F B;  5CYJ A;  3RB0 A;  2CRL A;  3I0R A;  5HRO B;  2K3K A;  3K59 A;  2E5I A;  3PW4 A;  2HHH F;  1HI1 A;  2C3O A;  3T41 A;  4MK7 A;  3P5T L;  5U47 A;  2VBX A;  2W9B A;  3FSX A;  5A8K B;  3L7P A;  2CXE A;  2ASD A;  3IBF B;  1NK4 A;  1BQX A;  2AEF A;  4IH6 A;  1FRM A;  1M0S A;  4MJK A;  1Q81 T;  4DSF A;  4MMO A;  4RO0 A;  1TKX A;  3M7V A;  1CBK A;  4OYZ A;  2OH2 A;  3M9N B;  3MMB B;  5THW A;  2D74 B;  3GJS B;  2WTF A;  3OLA A;  3UCU P;  1YSJ A;  3SI8 A;  2JEI A;  3CJT A;  2V8H A;  4R0J A;  3SCK E;  1Q8I A;  1CJT A;  1JLB B;  2JLE A;  5F3Z A;  1R43 A;  4RW7 A;  5FII A;  1S10 A;  3CJ4 A;  4UF4 A;  4P7T A;  3JSB A;  5J2N B;  4NLG A;  5HI7 A;  2LU2 A;  3TUI C;  3H90 A;  4CLP A;  1IBL F;  3QIP A;  3IS9 B;  5KFG A;  3TJ9 A;  1QAX A;  3A13 A;  3HFZ B;  2AJ1 A;  3MMJ A;  3R5B A;  1CS4 A;  2O3D A;  2HZV A;  4Q44 A;  1QSL A;  3B6B A;  3K58 A;  4CM2 A;  2XI2 A;  4PWW A;  1IBM J;  1N54 B;  1RT3 B;  2CWX A;  1FJ7 A;  4G1Q B;  1X4H A;  2ZH4 A;  4DL7 A;  2EFV A;  2H65 B;  3I87 A;  4NLP A;  5AE3 A;  2E9Z A;  2HHX A;  5BXI A;  4WYW A;  4ZDN A;  4DL4 A;  2E9T A;  4EK2 A;  4NRT A;  2AYM A;  1FRH A;  3FNN A;  1O6X A;  2V8V A;  3AJ1 A;  3D7S B;  3VZI A;  1NME B;  1X4B A;  2OML A;  3HFV A;  4CCH A;  2K3I A;  1RB0 A;  5F0U A;  2ZM6 J;  4ECU A;  1QAJ A;  2B3T B;  2W2P P;  4M5K A;  1S57 A;  4AUK A;  3MEE A;  3CUN A;  4JI4 J;  3HSG A;  4JI5 J;  1NH7 A;  3G8T A;  1T9Y A;  4CO2 A;  1YIT S;  2KM8 C;  2YWW A;  1VIO A;  4RNF A;  4CTA A;  5CA5 A;  2KH9 A;  2HFV A;  3BRE A;  4I6Y A;  1EAR A;  3KMQ A;  2UXB F;  1OIA A;  3VAL A;  3RR8 A;  4WP8 A;  4RUA A;  2BW7 A;  4O3O A;  4GC6 A;  4J5O A;  5IQ6 A;  1S7H A;  3UD3 P;  1NKC A;  2G13 A;  1XNQ F;  1ELO A;  2Q3P A;  3QMQ A;  2CDQ A;  5AE1 A;  2R7R A;  1DAX A;  5ETO A;  4FS2 A;  4PXD A;  3IC1 A;  4AQY F;  3BDE A;  4U67 Q;  2BYC A;  4FXD A;  1NKE A;  2MDA A;  1RAF B;  4USU A;  1VRT A;  3LP0 A;  4NLT A;  3I9Z A;  3MPU B;  4PPD A;  3CCM S;  4PWD B;  2N7Y A;  5LSO A;  2JJ4 D;  3KLG A;  3MAA B;  2M0G B;  3P5B P;  1RWP B;  2D3U A;  3ZTS A;  4P71 A;  2C2Z B;  2CYY A;  1TAQ A;  3DFE A;  1WUU A;  4LF1 A;  4F25 A;  5ETN A;  1HQU B;  1UMJ A;  4B9T A;  4LRF A;  1KTV A;  3I96 A;  1LK7 A;  3MM6 A;  4DPU A;  2QZ8 A;  3A8K A;  3GFZ A;  2N4D A;  3C15 A;  3JYT B;  4DX6 A;  2FJA B;  1PYT A;  4WP9 A;  1X8D A;  3OR2 B;  4DPT A;  2Y0S D;  2ZNZ A;  4DFM A;  1SJF A;  2HMI B;  3M6X A;  1VBY A;  4HH0 A;  1V3Z A;  2MYF A;  2AIR B;  3MTK A;  3MR6 A;  1RUS A;  2FGC A;  2RIL A;  2VG6 A;  3HLU A;  1JNR B;  3UCZ P;  2PI5 A;  3PAC A;  2BQR A;  3M32 A;  5CYM A;  3QFW A;  1RWW B;  5ETR A;  4TU8 A;  2GQQ A;  7AT1 B;  2I9S A;  2ZH8 A;  5E41 A;  4LQ9 A;  4IG3 B;  1UCN A;  2KG1 A;  4ZLN A;  5RUB A;  1ZS6 A;  3ENQ A;  4RW6 A;  2HS4 A;  3SBM A;  3NBP B;  1YIJ S;  3WC2 A;  3PCO B;  3PX6 A;  4NCA A;  4TXS A;  1MN7 A;  2VQF J;  4DV3 J;  1HQ2 A;  2W01 A;  3H4B A;  4B9S A;  3SDE A;  4H4M B;  2HHT A;  2GAG C;  3TOQ A;  2UVV A;  7FDR A;  3NNC A;  3I56 S;  5HMX A;  3CCW A;  3F56 A;  1WC1 A;  3IM9 A;  2KHD A;  3GR1 A;  4X62 J;  3DC2 A;  5FDL B;  3N6N A;  5GAH U;  4KFB A;  4DR7 F;  3RUB L;  4CLY A;  3NNH A;  1WEZ A;  3PRV A;  2FY8 A;  1AZS A;  2OPS B;  3DLG A;  4JI5 F;  4Q0B B;  4OYB A;  3CJ2 A;  4WTY A;  3DHW C;  4LRD A;  1RAE B;  2YKM B;  3M1V B;  5F8I A;  3K5L A;  3MF5 A;  3PYG A;  4KAI A;  4KR0 B;  4USW A;  2D3O R;  1X5P A;  2GVZ A;  1HPZ A;  2KVI A;  2ASJ A;  2VH7 A;  3R1L A;  3BB5 A;  2DGW A;  1MWZ A;  3HVT A;  1U1R A;  2BJ1 A;  3DXB A;  2V4Q A;  1FD2 A;  2ZVI A;  4ZN3 A;  2XSF A;  4CO1 A;  5A8R B;  3KJV B;  1IKX A;  5DG9 A;  3GIJ A;  4Y6I A;  3BO4 A;  2BV3 A;  1RAI B;  2RJZ A;  2FJB B;  3DCA A;  4FVM A;  3K5N A;  4DF8 A;  1S0O A;  3ZZY A;  3R5D A;  2GJF A;  4JI4 F;  3L4B C;  2J8A A;  3B8H A;  2GC8 A;  4M5G A;  5C5J A;  1A9N B;  3EVW A;  3E3X A;  2J76 E;  3O8W A;  4MTP A;  9ATC B;  4JV1 A;  4QR1 A;  1VJQ A;  4ID5 B;  2XMJ A;  2XY5 A;  4IFV A;  4ZVO B;  4F8R A;  1TZ0 A;  2UUB F;  5C25 A;  3LAM A;  4J9O A;  3G71 S;  1TMM A;  1VQS A;  3DLE A;  4LR7 A;  4X4S A;  2JLF A;  3CDB A;  4D3H A;  5HBM B;  2P6S A;  2RQ4 A;  1KQF B;  2ZBR A;  4Q45 A;  4QWC A;  1T7P A;  4TNO A;  4CP5 A;  1E6V B;  1FNM A;  3OTO F;  3CMA S;  4TLR A;  3RRG A;  4URQ U;  3CCQ S;  2WVC A;  2Y1R I;  5EN1 A;  4F7V A;  5KOX A;  1RHM B;  4YP3 A;  3W9I A;  2MLX A;  1UFK A;  1I1G A;  2I2Y A;  5CYQ A;  5M2U A;  2K7J A;  1G1X A;  4I69 A;  4BWM A;  3HMJ G;  1V5V A;  3K5P A;  1F3V A;  3M32 B;  3RU0 A;  2Z58 B;  1TR0 A;  2CPH A;  2IAJ A;  3D54 A;  5A6W A;  1UWB B;  4LRB A;  3MM8 A;  4X66 J;  3A8J A;  5IC4 B;  1EP4 B;  1K47 A;  2OEM A;  1YJW S;  2OEK A;  1A6L A;  1U2R A;  5EUH A;  2ATL A;  2W2Q P;  1H7X A;  2JL9 A;  1LWX A;  5IQQ A;  1BWE A;  2C2O B;  4A8X A;  2NSB A;  1SL1 A;  5ETM A;  1HNX J;  4NXN J;  3D68 A;  1OWX A;  4DV7 F;  3CCV S;  4DPO A;  4CH1 A;  4AL7 A;  2VDH A;  2G0C A;  4AT1 B;  4RW9 B;  4UZB A;  2PI4 A;  3RGI A;  1CS4 B;  1R3N A;  5GAD I;  1SUQ B;  4LR9 A;  4LRC A;  2CNL B;  4U9R A;  4LBI A;  5J2P A;  2N4C A;  2QLJ B;  3CDA A;  4PG7 A;  2J9E A;  2JSX A;  1M5P C;  2UP1 A;  4LFB J;  1Q8K A;  2KKH A;  2C2K B;  3RB6 A;  1SC6 A;  1KS2 A;  4Q7A A;  2GVZ B;  1NH8 A;  2WBR A;  1HL6 A;  1OYD A;  4LSN A;  1BQM B;  3NEK A;  4NL5 A;  2VOO A;  3KHL A;  4F4A A;  2NXC A;  4NCB A;  2N3L A;  2Q6C A;  2MKJ A;  3J80 U;  1Y10 A;  1RLD A;  2P2C B;  5ETL A;  1IBM F;  4DSK A;  1UW9 A;  1VQM S;  1T94 A;  1WOS A;  1Y00 A;  2P6T A;  4OYA A;  1YBU A;  4N47 A;  3VCD A;  4FYY B;  3UNY A;  2P8I A;  4C3L A;  2ZJR Q;  4DV4 F;  1TL3 A;  2HLT A;  5KFH A;  4ED0 A;  3AQP A;  1MSW D;  4ZIV A;  1UFW A;  2HFO A;  3OFE A;  3AT1 B;  5ETQ A;  1TL7 A;  5MLC V;  3NNA A;  3BKT A;  3KYL A;  3W61 A;  4DX5 A;  4NZ7 A;  3D5M A;  3PYF A;  1SJ4 P;  2YTC A;  3T9Z A;  5F41 A;  1N6Q B;  4HI1 A;  5D15 A;  2O5D A;  4EFA C;  4Y2M A;  3HHL B;  1U8W A;  1FWP A;  1YJV A;  4PG5 A;  3US5 A;  3C66 A;  1I3O B;  4IDK B;  5B0E A;  1VRU B;  3F44 A;  3TUJ C;  5DQI A;  3HVW A;  5LMU J;  3KKF A;  1RT6 B;  4QR0 A;  2FYX A;  1TU0 B;  2AD9 A;  1FD8 A;  4FYW B;  4F4W A;  1X5S A;  4C97 A;  2CQB A;  3UN2 A;  2V68 A;  2B5J A;  1K44 A;  2L9N A;  3HP6 A;  4UUW A;  5E5N A;  2EC2 A;  2OD4 A;  3DOK B;  3R27 A;  3JYT A;  2VBY A;  4DXL A;  3BR9 A;  2G1H A;  3RRH A;  1QSY A;  5LL6 d;  2GW8 A;  3MM6 B;  4XPC A;  3M2U B;  3MPD A;  5KFW A;  2V2Q A;  3N5B A;  3IRW P;  1N32 F;  1JKH A;  4USV A;  4P2M A;  4B3S F;  3HO1 A;  4KGK A;  4GKK J;  2CPF A;  2MZS A;  1HAR A;  4DV3 F;  1JKH B;  4J9N A;  2EK6 A;  4OYI A;  1TK0 A;  5H9E K;  3KJQ B;  1T9W A;  1YG0 A;  3J7A 1;  2FHM A;  1JLF A;  2Y0B B;  3QZ7 A;  2DH8 A;  5J1E A;  3LP2 B;  1BMQ B;  4HT7 A;  4WJB A;  1N56 A;  2Y8Y A;  3W62 A;  2YBV A;  4WK3 A;  1QVF R;  2JC0 A;  3A3P B;  4B9L A;  5AXN A;  3CCT A;  4P10 A;  2V9W A;  4X4U A;  2YWE A;  1QAY A;  1Q79 A;  5D0G A;  2OKQ A;  3MMC B;  2IAJ B;  2U2F A;  3QSI A;  2QT7 A;  3P96 A;  3W63 A;  5IWA F;  2E5G A;  3Q8S B;  1SJR A;  2DIU A;  2EFQ A;  4BBY A;  1BQN A;  2XCP A;  1MRO B;  4IDK A;  2ZBC A;  5IFM A;  3KHR A;  3FZB A;  3ENV A;  2PSZ A;  1B7F A;  1G2E A;  2BDP A;  2YH0 A;  2DXE A;  4NOH A;  1FT8 A;  3OQ2 A;  3EVM A;  1HNI A;  2HHU A;  1C0U B;  1UEK A;  4GO7 X;  2XZW A;  4OHZ A;  1LKZ A;  3CIZ A;  3MTJ A;  2J9D E;  2YPZ A;  2H54 B;  1H2V Z;  1FFG B;  3FVY A;  2HFN A;  2YNH A;  2QIF A;  2DK2 A;  4K8R A;  4KGV B;  1YVF A;  1NEE A;  1QD1 A;  2MTL A;  1KHW A;  3D6F B;  4KGZ B;  2YH1 A;  1NU4 A;  3IBC B;  5KAK A;  3H25 A;  1R8B A;  1TL1 B;  1Y3J A;  1U2C A;  4R25 A;  3CC4 S;  3PW7 A;  1KDN A;  3FBE A;  3IR5 B;  4WYL A;  5J1P A;  3NOG A;  3G86 A;  4DSL A;  2ACM A;  3CO0 P;  1XJW B;  3N0V A;  4F3Q A;  4XPE A;  4DL6 A;  3FRZ A;  1XNR J;  3G6Y A;  4ED8 A;  1O51 A;  1CJK B;  2C28 A;  1JJ4 A;  2NZ4 A;  2GHW A;  1T9X A;  2EBG A;  1RT7 A;  5J2P B;  3KG0 A;  4QWE A;  5D3G B;  4USJ C;  4K4Y A;  1TAU A;  1O5J A;  3AJ2 A;  2JFK A;  1FEE A;  3TJ8 A;  2D1C A;  1CUL A;  1DUR A;  1YJR A;  3M8W A;  1RSC A;  3SCI E;  4EZ9 A;  2KO1 A;  1Y11 A;  2IFX A;  1K73 T;  4R0E A;  2LU1 A;  5J2M A;  2A10 A;  4YB5 A;  3VAI A;  3EIC A;  4MFB A;  2BAB A;  2LEP A;  2A18 A;  2Y3Y A;  1S0N A;  4FF1 A;  3P6Y C;  2FHJ D;  1WG1 A;  1FKO A;  5ETS A;  5GAH I;  4F3M A;  2FZC B;  4QW9 A;  4NA2 A;  1WJ9 A;  1JQG A;  5C24 B;  4O3Q A;  1DTQ A;  3MMA A;  3IAS 9;  3DKD A;  3T1H J;  1WHY A;  1YK9 A;  2WOM A;  4NYZ A;  2HGN A;  3IRX B;  1JLQ A;  1MMD A;  4OI0 A;  1S1W A;  2E7V A;  3I32 A;  1ZM9 A;  4IR9 A;  1RBL A;  3DRY A;  2DPI A;  2MKC A;  4Y65 A;  2GIF A;  3QLH B;  4QYZ J;  1UFL A;  3HVA A;  4GVL A;  5M2P A;  4AND A;  5DGB A;  4NI2 B;  4LSL B;  4DQR A;  5FJ4 A;  4RW9 A;  3TVY A;  4P74 A;  3PW0 A;  1F2H A;  3BV8 A;  2DNP A;  4U7C A;  2CAJ A;  1R31 A;  1F2G A;  4X66 F;  4ZPW R;  1CC8 A;  4B3M J;  2RKI B;  4KPC A;  1F5B A;  4OI6 A;  3JQM A;  1FNX H;  5JVG Q;  1YWX A;  4F26 A;  4ETX A;  1YRX A;  2PE8 A;  4J90 A;  3QT8 A;  4A47 A;  1KOH A;  5G4D A;  2IMO A;  5CH7 B;  2L41 A;  1NO8 A;  4RUH A;  4LF6 F;  2DXF A;  3PHT A;  1I94 F;  5C42 A;  4LMZ A;  2AEM A;  3C14 B;  1W2I A;  4NLX A;  1IKX B;  3IAM 9;  4NZ6 A;  3SCJ E;  4ANC A;  1WDT A;  2RDI A;  3R1H A;  3V6K A;  3H40 A;  2IBK A;  1QE1 B;  1OYE A;  3ETO A;  1S0V A;  2ZFH A;  3AY0 A;  5KT7 A;  2XGP A;  3M2V B;  3EPG A;  3H98 A;  1X31 C;  1A7G E;  4UUX A;  4ZVT B;  3NS7 B;  4NLR A;  4WFY A;  2MLY A;  2XYG B;  1R7I A;  2DGO A;  3FQK A;  5K8M A;  3T1Y F;  1K1Q A;  1RWV B;  3HSJ A;  3BH6 B;  4H4O A;  2QN6 B;  3U7J A;  3C46 A;  1VIX A;  3MR3 A;  2FJX A;  1L3T A;  2W24 A;  3AB2 B;  5HBM A;  5B0F A;  3QT6 A;  3KLI B;  4DR2 J;  1XQI A;  2FD2 A;  2YWH A;  3H7H B;  5J2M B;  1T3N A;  3VAH A;  4WZQ A;  3CD6 S;  1BHN A;  1REV A;  5MAO A;  2B8Q A;  5HQM A;  1TUV A;  4DV2 J;  4IG0 A;  4QOT A;  3SXL A;  1GMU A;  3AOC A;  3TA1 A;  4N5S A;  2GO9 A;  5EDW A;  2DR7 A;  1PCA A;  2RSQ A;  2HZA A;  5AJ3 F;  3KJN B;  4L76 A;  1X4C A;  4WPA A;  5I3P A;  2RU9 A;  5HJX A;  4OQJ A;  4G6V B;  4EWT A;  3CJ3 A;  2NYH A;  5GAG I;  2I8E A;  1S5Z A;  2E44 A;  2EPI A;  2V63 A;  3QFH A;  4PG6 A;  1KNZ A;  4FYD A;  2X51 A;  3LPE A;  3TAN A;  3KNG A;  1KFS A;  2GHP A;  2BE2 B;  2CPI A;  3WX4 A;  5BJR A;  2MHN A;  5HL7 Q;  1EAY C;  3F0N A;  2CQG A;  1UJ4 A;  1WG4 A;  2WVB A;  1B64 A;  2GZO A;  1VC5 A;  3MD1 A;  1APS A;  4C8O A;  4D3G A;  3ISN D;  1HMV B;  1Q8L A;  3ADA C;  3FMW A;  4H54 A;  2UXC F;  4KFB B;  3M8R A;  3M8S A;  1F9F A;  2A2C A;  4RX6 A;  4IRK A;  4H4K A;  1U6B A;  3N28 A;  1DBD A;  1VQP S;  3AOA A;  2XY6 A;  4K4V A;  4JOU A;  4ED4 A;  1IJF B;  2OP5 A;  4A46 A;  2YKM A;  1UVM A;  3RW6 A;  1K9M T;  2CG4 A;  4OYO A;  3UFC X;  4ZVU B;  2B9E A;  5F8J A;  3EZ5 A;  4PPZ A;  1C4A A;  2BJ8 A;  4ZVF A;  3KHH A;  2VQF F;  2UUW A;  4NLY A;  3C6U B;  3H59 A;  2NUU G;  4DR3 F;  1IKY A;  1T3O A;  1IKW B;  4UST A;  1CEZ A;  1MRO A;  1REG X;  1A0O B;  1WKJ A;  1MWY A;  3PW2 A;  3EZO A;  4DI6 A;  1U02 A;  3DI6 A;  5DZ6 A;  1N5Y A;  3OL9 A;  3R2C J;  3RAX A;  2V5H G;  3ZZU A;  2JHE A;  3LP1 B;  2GGP B;  4QU6 A;  5IWA J;  4EBE A;  2OFG X;  4K0K J;  1HD1 A;  1CC7 A;  1RAH B;  2VFT A;  2Z8Q A;  1BY9 A;  5JVH Q;  4DUY J;  4QPT A;  1X5O A;  5HMY A;  1J5E J;  3DU5 A;  3ZXW A;  3VAF A;  3BS9 A;  3HHE A;  2AP6 A;  2XMW A;  3QO9 B;  3W3S A;  2CQ3 A;  2M88 A;  4XAK A;  2FHO B;  4OI3 A;  4NEY A;  1LW0 A;  4U6P A;  1U1P A;  3BJY A;  5B0D A;  4JYA J;  2OSR A;  3HD2 A;  4NXM J;  1SPB P;  1B0T A;  2EEY A;  2YWF A;  2B0G A;  4ZJL A;  1GTH A;  1IKW A;  2CPD A;  3FCV A;  4DL3 A;  2E9R X;  4EMD A;  1RT1 A;  4MFB B;  3TJA A;  1S1T B;  3H0P A;  4OZJ A;  5J1E B;  1FE0 A;  1C1B A;  2B8P A;  3A4T A;  5KFB A;  3I82 A;  5IS2 A;  3EYZ A;  4GKK F;  1GEH A;  3RZA A;  1MG7 A;  1HQU A;  2C3P A;  3GV5 B;  4JI8 F;  1UPP A;  3DRR B;  1CUL B;  3L09 A;  1UZH A;  1YBT A;  4WFX A;  4RWW A;  5E0O A;  1HLW A;  5KG4 A;  1KKH A;  1C1C A;  2R7V A;  4P75 A;  2YNG A;  5L1J A;  4NYO A;  3ZC4 A;  4DUT A;  2FC8 A;  4JP8 A;  3KK3 A;  5HLF A;  2PT0 A;  4DR6 J;  3EMT A;  5A8R A;  5L1I A;  3QLH A;  1YJN S;  2JZ5 A;  2MZR A;  4P7V A;  2FLP A;  1AW0 A;  4TQR A;  3NWR A;  5CZV A;  1Y4Z B;  5T14 A;  3UE2 A;  1VQ5 S;  4HHH A;  2N82 B;  5L39 A;  3D6H B;  4LJM A;  2DR5 A;  4JI8 J;  1XN9 A;  1P8G A;  1Y3K A;  2L9D A;  2HGL A;  3N79 A;  3U1N A;  4ENO A;  5GAD U;  4RNM A;  4KKO A;  4YB7 A;  3QPI A;  1NM2 A;  2AJ4 A;  2B56 A;  3DLG B;  1VIS A;  3GSI A;  2YQ0 A;  5ITH A;  4X62 F;  4AD6 A;  5ADZ A;  3AJD A;  2AKW B;  3P3D A;  1R8P A;  1WC3 A;  3OTE A;  3QRR A;  2DY9 A;  3D66 A;  4K4Z A;  4M8L A;  1SH0 A;  4G1I A;  4U96 A;  4CZC A;  1S48 A;  1ZM3 A;  3SDE B;  1HHS A;  4ECQ A;  4EBC A;  1S1V B;  2OPQ A;  2V0N A;  2ATC B;  4KV8 A;  3W8G A;  3GCX P;  3KNA A;  4GVB B;  3PKY A;  2CJK A;  1MN9 A;  4CH0 S;  3ENW A;  2Q66 A;  2BJE A;  4OX8 A;  2ERR A;  4DFJ A;  3KUG A;  5G0R B;  3BKF A;  1HWI A;  2JEJ A;  5D78 A;  1JXL A;  2J6T A;  1JJH A;  1NJW A;  1CJV B;  3CD7 A;  5KFL A;  1JLC A;  1FRK A;  4ZJQ A;  2V8P A;  1SUQ A;  5CAB A;  3R6G B;  3TQ1 A;  2KZZ A;  5JJB A;  4O3N A;  1TTH B;  1UJ5 A;  3BGR A;  4YY3 F;  3DLJ A;  4IO1 A;  1HHT P;  2DCU B;  3UDV A;  3GJT B;  4DV6 J;  4OYW A;  4RU2 A;  1FJC A;  3C16 A;  3CNQ P;  5IV4 A;  3MEG A;  5KT6 A;  3FBB A;  3QWP A;  4RNO A;  2LQB A;  1OMS A;  3HD1 A;  2ZH3 A;  4I1T A;  1XIQ A;  3V6J A;  4I64 A;  2E5L F;  4FN5 A;  1T95 A;  3GQC A;  3K17 A;  2IA6 A;  1WWH A;  1T03 B;  1U1N A;  2QLW A;  3CCR S;  2HHS A;  2ZH6 A;  3G8Q A;  3FDS A;  3QSY B;  3UD4 P;  4RPF A;  1ZET A;  2SXL A;  2WW8 A;  2XHW A;  2YWG A;  2WSF C;  3OW2 R;  2W4P A;  3DHX A;  3QNW B;  4OIX A;  2MKH A;  2MSS A;  3KXD A;  2YX4 A;  1Q16 B;  3KK2 B;  5BYQ A;  2X1A A;  1H74 A;  4V19 J;  4YN3 B;  3M05 A;  1RE1 B;  3CD5 A;  3FFI B;  4USH A;  5KFQ A;  5H9F K;  1VGY A;  2LQJ A;  2K8G A;  1YJ7 A;  1RT5 A;  3WIU A;  3W64 A;  5KG0 A;  2HWI A;  3CT9 A;  1UET A;  3I0R B;  1QJH A;  5HRO A;  4U7U K;  2B51 A;  4OHW A;  2IYG A;  3KLV A;  2XSJ B;  5HQL A;  2HRT A;  4JI2 F;  1Q5V A;  1AFJ A;  5AJ3 J;  4W98 A;  5CCL A;  3BDP A;  3I9V 9;  1F9H A;  1HI0 P;  2YVS A;  2ZBI A;  2F7V A;  2VFR A;  1FXR A;  2C2M B;  2WHO A;  1KWM A;  2DHS A;  4MKB A;  2G0J A;  3WX8 A;  4YQW A;  1FTC A;  1R8H A;  2CVE A;  1L3S A;  3E01 A;  3MPV A;  2C3U A;  1H72 C;  2VAS A;  3AXK A;  3GFX A;  2XI3 A;  4I4B A;  3VGT A;  3GIK A;  2R2S A;  2Z2Y B;  1U1Q A;  1NK5 A;  2UXD J;  1EJ7 L;  2IY5 B;  3MUV P;  1JLG B;  2HNZ A;  3CJ0 A;  4ZK7 M;  2A3J A;  2DRA A;  1NRK A;  1HMV A;  1FDA A;  1FJE B;  3LPY A;  1NZA A;  1Q0N A;  2ABY A;  5BYR A;  3GYG A;  3A8I A;  3LTO A;  4DU8 A;  1UA0 A;  2MGZ B;  1Q8B A;  2GQC A;  2P9E A;  3M1V A;  2PMZ D;  1GH8 A;  4DG1 B;  3J7Z 5;  5GAG U;  1ARO P;  2KB2 A;  5D3G A;  4ZCL A;  3PJ9 A;  1URN A;  3TEH B;  5EWG A;  4L3N A;  4YHH F;  1Y5L B;  4CT8 A;  5A6P A;  5F9L A;  1RTD A;  1I51 B;  5HLF B;  4WKR A;  2DGX A;  3E51 A;  2F1F A;  1D8Y A;  1UAW A;  1FRL A;  1UP1 A;  2XZT B;  4RW7 B;  4C0O C;  2KG0 A;  4A8F A;  1CLF A;  2XYH B;  5CHC B;  4LF7 J;  4I2P A;  2HFZ A;  2QTW A;  3R5A A;  3PZP A;  4GVB A;  1Q7Y T;  1YZ7 A;  5HMW A;  2ZM6 F;  4KV8 B;  1FKA F;  2HVD A;  1TL1 A;  2F5G A;  2H3E B;  3MUR P;  2VG7 A;  3N01 A;  1W26 A;  4B3T J;  2J7U A;  3LOU A;  4NMX A;  1C1B B;  4LBH A;  4TY9 A;  3CF5 Q;  4DQS A;  2FGO A;  2DNL A;  3IA0 A;  5T41 A;  3UCG A;  1RTZ A;  1GXT A;  2CAD A;  4HAC A;  2F40 A;  4GMK A;  4P6Q A;  3DLB A;  2VA3 A;  1I6J A;  1KD1 T;  3MM8 B;  2R2R A;  3EE3 A;  1TL4 A;  3W8P A;  2OPP B;  4C0H A;  4I7F A;  3MI7 X;  2FZG B;  2BM1 A;  3ETM A;  4ZVR B;  4LSN B;  4CDI A;  4ECR A;  3V81 A;  1N5Q A;  3NAI A;  1WHX A;  2K06 A;  1QM9 A;  2DNK A;  3VGV A;  4DMZ A;  4ED3 A;  1UA1 A;  2KRB A;  2X1G A;  3BGF A;  2YQ3 A;  5KFF A;  1HNV A;  3GYN A;  3LP2 A;  4EU0 A;  4O0N A;  3EVO A;  4Q8E A;  3FCW A;  3TUZ C;  5JUM A;  2NYI A;  3TRG A;  3K5O A;  2VG6 B;  2ZKT A;  3GV8 B;  3BBF A;  1UEV A;  4K4X A;  3N9U C;  2EG1 A;  3DM2 A;  4U8V A;  3ZFV A;  2ZH2 A;  1U24 A;  2B7B B;  4DS4 A;  2HQF A;  3NKY A;  4Z7C A;  4ECY A;  2V69 A;  3D2W A;  2QJ3 A;  1V5I B;  2Z2L A;  1N33 J;  3NGK A;  4OYX A;  3C6U A;  1D9D A;  2HKE A;  2BJ7 A;  2LXU A;  5K8N A;  1HQE A;  2VPX B;  5KG7 A;  2XQC A;  2UUC F;  2Z30 B;  5KOW A;  1N32 J;  4B3S J;  2EFN A;  2MZ1 A;  3J7A N;  4ZPC A;  2J9C A;  4ZPT R;  3VAM A;  4J7C A;  3T5K A;  4NLW A;  1VJW A;  3TAM A;  2M5Y A;  3MR5 A;  4OJ3 A;  2W2N P;  4JV2 A;  3GON A;  3EWG A;  3KLG B;  4YME A;  2FJD B;  3M30 B;  4XTT A;  1X5T A;  2ILZ A;  5KFU A;  1XTZ A;  1D1U A;  4LF9 F;  1CG2 A;  1C4C A;  3IGN A;  2I5J B;  4CTA B;  1O8B A;  1SJQ A;  1W25 A;  2PMH A;  2OPR B;  5HMZ A;  1HPZ B;  3W5Z A;  2MQP A;  2AYG A;  2G2Z A;  3DRS B;  2QYC A;  3UO0 A;  3NRB A;  2UUA J;  3R7S B;  3G82 B;  3M2R A;  2W8L A;  4DL0 C;  1U6F A;  3Q0A A;  2MQQ A;  2RDJ A;  1VK8 A;  2M52 A;  1HKA A;  4PUO A;  4FP9 A;  2F63 A;  2QO3 A;  4JI1 J;  1RBA A;  4DR7 J;  3M6W A;  3NWG A;  4LF9 J;  3ISZ A;  2DR6 A;  5CQG A;  1RAD B;  2BJ9 A;  3H42 A;  3PG9 A;  3SIP B;  2XS5 A;  5K14 B;  3B78 A;  1GX5 A;  1WD6 A;  1XMB A;  3GIR A;  4USK A;  4ZP7 A;  1YJT A;  3MEC A;  2D41 A;  4WU3 A;  3ULH A;  3UWT A;  4CQ1 A;  4BCA A;  3TEG A;  5JMN A;  3KLE B;  4ILM A;  5HAO A;  1N4L A;  2LDI A;  3GZ7 A;  4L75 A;  4YFU A;  2V2V A;  1NUE A;  1GFW B;  3H2V E;  3JSY A;  3K8W A;  2FUG 9;  3PTW A;  3MR2 A;  1VQ4 S;  1W2B R;  3EJM A;  2W7P A;  3CMQ A;  2LCW A;  4O3S A;  2OTL S;  5JXS A;  1NKB A;  1Q95 G;  1S76 D;  1IXK A;  1YQH A;  2AZ1 A;  3H8Y A;  4TN2 A;  4A4J A;  4AFF A;  1VQO S;  3UI3 A;  3TAM B;  2DR9 A;  4NE9 C;  4X4Q A;  4C8N A;  1SKR A;  4DHV A;  1QE1 A;  2G1D A;  4OX9 J;  1MU2 B;  4FXV A;  1IN0 A;  3T1A A;  1S97 A;  3KWM A;  5DET A;  1H7W A;  2ROG A;  4IQM A;  4A8M P;  3TX0 A;  3FSI A;  2WRM A;  1RYR A;  3E01 B;  2Y1L B;  5HAT A;  1NBE B;  2KFY A;  2I0X A;  5F9N A;  2BKO A;  2LEA A; 
#chains in the Genus database with same CATH homology
 2X3D A;  3BPD A;  2RAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...