2RAQA

Crystal structure of the mth889 protein from methanothermobacter thermautotrophicus. northeast structural genomics consortium target tt205
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
AKGLIRIVLDILKPHEPIIPEYAKYLSELRGVEGVNITLMEIDKETENIKVTIQGNDLDFDEITRAIESYGGSIHSVDEVVAGRTMVEEVTTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein MTH889
publication title Crystal structure of the MTH889 protein from Methanothermobacter thermautotrophicus.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
total genus 19
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2007-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02680 DUF211 Uncharacterized ArCR, COG1888
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits MTH889-like domain 2raqA01
3BPDA 2X3DA 2RAQA
chains in the Genus database with same CATH superfamily
4CRJA 4YUDA 1RBAA 3JTNA 3T5KA 1IWGA 2ZH6A 3THVA 2DKOB 1VC6A 2HHHF 2UUCJ 3M2UB 1AW0A 3UVJB 4FF2A 3HVWA 1YJNS 1HR0J 9RUBA 2VL1A 4ID5A 3IM8A 3D0IE 3ETMA 1FRJA 2EKYA 2E66A 2O67A 2ZUGA 4X66F 2C3MA 2XGPA 2KJWA 4AT1B 4LRDA 1KRPA 1U2RA 4G1IA 5L46A 5DDPC 1KDNA 4LBIA 2QA4S 1LWXA 3QWPA 2E44A 3TQEA 2MY7A 4N56A 5J1PA 3T6JA 1SBRA 4BDPA 2LQ5A 3M8PB 3RB3A 1AROP 3A8IA 1RWPB 3C16A 4ED0A 5A8RB 3G6ES 4DR5F 5LMNJ 2JWNA 4XDDA 1GEHA 2NCKL 4RWWA 4IG0B 3TZYA 3D6MB 2KVIA 5E5NA 5KFFA 2DEJA 1R0CB 4QIWD 1FE4A 2NSCA 4QYZK 1MWYA 1KP6A 1XIQA 3I55S 2Q1LA 3MPUB 1WHVA 4YN3B 1R0AA 4LQ9A 3RU0A 1DHMA 5H1SV 1URRA 5EDWA 1WD6A 3PNIA 1FTCA 1P1LA 1YVFA 4P2FA 2HZCA 1HBUA 2KL8A 1S4EA 2IM1A 2OFHX 2K8GA 1F9FA 1HWLA 2XCPA 3RB0A 1LWEB 2CQ2A 3NXZA 3KOAA 3B82A 1X4DA 3W5YA 3MD1A 2ZH7A 1N5YA 1IBMF 4TU8A 5IS2A 4B3SF 3M8YA 1VRTA 2OPPA 2YKNA 5KFSA 3LOUA 3BF4A 4CZCA 4ELUA 4ZPAA 2IVMA 2KT3A 2WZ1A 2KFYA 4DSLA 3Q23A 1NJYA 2HS4A 5F8HA 2QZ8A 4PYAA 4FS1A 2V4QA 3HULA 3C14A 3FMBA 3TVZA 4CLLA 3NWRA 3EGNA 2HVZA 2MZJA 2O5DA 1UJ6A 2E5JA 2WW8A 1QVGR 2QO3A 2F5GA 4K7QA 3ICLA 3CCLS 3PW5A 4OYWA 3SIPB 2ZJPQ 1QAJA 1KONA 1IN0A 2V8DA 4Y2IA 3M9MB 4C97A 4A46A 3EGVA 1UEKA 3EE3A 2ADCA 2HK3A 2GIQA 1WC3A 3K5PA 3KYLA 2YKNB 5J1EB 5DETA 3MDFA 4KGKA 3TZXA 2AEJA 2DGXA 2DNZA 2JFDA 3I0SA 2LMIA 3N4WA 2CKWA 2ADBA 4O3PA 1YJ7A 4F8RA 5D0HA 4A48A 3HK2A 3N5FA 3A8JA 1VC5A 1IBKF 4B3MJ 4LF6J 1ZETA 2JC1A 4OYZA 5HI7A 3I5BA 1AA1B 4K8RA 2LXIA 3R6GB 4ZK7M 2M0GB 4OX7A 4M5MA 5E2QA 2Z4PA 4FPIA 1VRUA 1G1XA 4I2QB 3CB4A 1NSAA 1TKZA 4KKOA 1VFJA 2RB7A 2EC2A 1X31C 3OPKA 5ETVA 1GXLA 4R5PB 3AOBA 1CPZA 4DMZA 3H4BA 1KOHA 5FDLB 4DSEA 3AODA 1IBLJ 4I0WA 1FXLA 1N33J 3ZTPA 3B6BA 5CCMA 4MK9A 3UN5A 2DEIA 2CQ4A 1S5ZA 2OMOA 3DKDA 2XNQA 5F41A 5DG9A 2RNEA 3V6KA 2CJQA 4Z37A 3DOLA 4NE9C 4RUHA 2UXDF 1VRUB 3D6TB 1XTZA 4V1Ak 2VBZA 2AW0A 1TKZB 1S9EA 2V2QA 3A8EA 4NLDA 3KLIA 4EYIB 3NS7B 4DZDA 2JL9A 2L9NA 1UL3A 4QIFA 4G3IA 1S79A 4QU7A 6FDRA 4RUCA 3NLCA 1RUSA 1U6ZA 2G4BA 4B3RJ 1UWBA 2BJEA 4NCAA 1JLEA 2V8PA 2HWIA 3NP5A 1BMQB 1K0VA 3PO4A 4F0HA 2HBQB 4NYOA 4NA2A 1YG0A 3PTWA 1U0HA 4OHVA 4ZVTB 3W1YC 3AJ1A 5FIIA 3GE9A 4KGXB 3I9V9 8RUCA 1SUQA 3R7SB 1D0EA 1JLQB 1QY7A 3KLEA 2ZWOA 3WC2A 1S9EB 1R6VA 3KLIB 2GGPA 2VPWB 3BEGB 2CQDA 4EBCA 1DQ9A 3QJJA 5E7OB 4I4BA 3ENWA 3LUYA 1U1KA 3CMAS 1PBAA 5IWAF 4Y6IA 4F3MA 1LWCB 1CQMA 2MKCA 4X4PA 2QLFB 1JLEB 1U24A 3T9ZA 3FCWA 2WK4A 5A6PA 3VQSA 1HIYA 2ZH9A 1TUVA 1NDLA 5HMXA 2ACMA 3L09A 3LA0A 2MSSA 1U0HB 4Q0BB 1JXEA 3M9OB 3A8KA 1VHIA 1RCXB 2ATCB 3L7UA 1LV5A 3HF5A 1K47A 4UUWA 4PG6A 4K4YA 3FSYA 3EICA 2E9TA 1RYRA 2HPUA 3UPFA 2GGPB 3MECA 1DRZA 2QMUB 3DDKA 3KHRA 5SUHA 4RW7A 4B3OB 1S1TB 4L3NA 2UP1A 1ZZFA 1O8BA 4DQQA 2XC9A 4O3RA 3EM1A 1RISA 2J6UA 2JEFA 4NLTA 1DQ8A 1PAEX 4ILMA 1IKWB 3P5TL 2VBWA 1Y0HA 4GMKA 4D3HA 2GW8A 1V3RA 2VICA 2HVDA 3A3PB 4NCGA 2ILYA 3EZ5A 2VC1A 1RT5B 2AJ1A 2O3DA 1ZOTA 4WFYA 3LWLA 1VMBA 1N5TA 3MECB 4C8YA 1LKZA 2MLXA 1REGX 4J9VA 2FHMA 4TY9A 2XY6A 3KUHA 3HVAA 4LFCF 1EKRA 3MHYA 1XEZA 4ED4A 2G1DA 4C0BA 1HARA 4J7CA 1VBYA 4IQXA 2BACA 3FBFA 2N3OA 4O44A 1XBWA 1T9XA 1FE0A 1WDDA 4NL5A 1APSA 4X62F 2EEYA 1GXUA 4FXVA 4LSZB 2W7PA 3UN3A 2C2MB 2JH3A 2BW2A 2KRBA 3GIIA 4HACA 3Q89A 1M5KC 1HBMA 3HKZD 5KG5A 4M5IA 1UKUA 1RT2B 4RX6A 5KG0A 2IM0A 4ECQA 3QRPA 3G6VA 5THWA 1RSCA 1FJ7A 1KOOA 2ZBQA 3ILIA 3S01A 3M2RA 2OO4A 4IUFA 4QIVA 5EX3A 3CCWA 3M7VA 4Q43A 3HHLA 3OT9A 5IFMA 1Q86T 4MKVA 1TL1A 2J8SA 2QV6A 3OJUA 2FLPA 3AXMA 3O6QA 4AXJA 3CJ2A 4IR1A 4ETXA 4OL8A 4X65F 4K0KF 3BYPA 2HG4A 1B0VA 1SC1B 4CH1A 3NAHA 3TUIC 1HQUA 1HBMB 3LAKA 3QGPA 3D3CJ 4L72B 3JAMY 2V94A 2IC3B 3G6XA 1PGZA 1OY9A 5DO2A 1HD1A 1RWWB 4P52A 1MU2B 1YI2S 4WP8A 5C2CA 1UAWA 2ZEJA 3ZO7A 4DV4J 2PEBA 1RWKB 4PXCA 1EX8A 3NOGA 3HVRA 1RLDA 4O4RA 3QT8A 2Y3YA 1TL1B 3G8SA 1KVKA 1WKLA 2QL5B 3M1VA 4ZVOB 4JBCA 1N32J 2Z8QA 4FKXA 1T05A 3MOZA 2ASLA 2VPYB 5HAOA 2HRTA 3WC0A 2ZFHA 1WI6A 3I4PA 1NNDA 3BH7B 4K4XA 2AGPA 2BE2B 1RT6A 4C8KA 1RLCL 3CCZA 1UP1A 4OYXA 1QVFR 4RR5A 3CD6S 2BJ9A 3WIVA 1TKDA 4J9SA 3H5SA 3ILJA 1K8AT 4P6QA 2DR5A 2BX6A 3LALA 1HWUA 4CT8A 3GZ7A 3MCOA 4DV0J 2A10A 2D3UA 2F1FA 1S10A 3IS9A 5ETQA 3DHXA 1P9YA 2HFUA 4A8QA 3M1VB 5K9FA 4DV3F 2J7KA 1T05B 3UW1A 2NREA 3UNYA 4F02A 1WG4A 4QPXA 1SH0A 5F9NA 1RT6B 2ZJRQ 1R8PA 5K5MA 1F1BB 2ZC4A 2XS7A 1BWVA 4NLQA 4TU7A 3MPWA 1WEZA 1JLAB 1S7HA 3SCJE 3Q8RB 2UXCJ 1SJFA 1FRKA 4FDFA 2K2PA 3NNHA 5GVQA 3MR6A 3V81A 2V34A 2FLOA 4DPTA 2OEJA 2Y0SD 4U8VA 4LR9A 3BREA 4ELTA 2AGOA 1CJUA 2AMCB 1TL7A 3GFYA 4JI7J 1NDKA 1V5VA 5JVHQ 1B4SA 1KSPA 3DN9A 4RPFA 1Q1KA 2CJBA 1DTTA 3P6YC 2ZH5A 2LEPA 3KDOA 4FN5A 2FGCA 3DLGA 3HP6A 2B9EA 4X4QA 3QFHA 3MR2A 2VG5A 4B9NA 4NXMJ 2VFUA 3VV2B 5KG2A 1HNWJ 2HSEB 1PJ5A 2YQ3A 3UE2A 4CLFA 3M6UA 2FVCA 2DXEA 1MLAA 1WSRA 5EX0A 4C7QA 2J76E 2IDLA 3V81B 3JQKA 2IRUA 4ES1A 1X9MA 3JQJA 3DRRA 2PA8D 1XR6A 3EX7B 1Y11A 2NR0A 4DN9A 4GKJF 1CJUB 1FEHA 1NLKL 3OR1A 3ZTOA 2DGUA 1JJCB 1S6OA 4LF9J 4JYAF 2QMWA 1DTTB 5KFHA 2K06A 4DQPA 2BQ3A 1YGYA 2FJAB 4ECUA 4C3KA 1RT1A 1RJJA 2AHOB 4IKAA 5ETNA 2ZHOA 2YKOA 4K4VA 4WFBQ 2CJYB 5E33A 3W8PA 2E9ZA 1Q5YA 2CPEA 3JTOA 1NKEA 2W9CA 4U7CA 4ZCLA 3D9BA 3HVTA 4Q2LA 2P9EA 3AT1B 1SKRA 5LOQA 2IM2A 3TZZA 3CD5A 4YB6A 2BRLA 4M5NA 2ZM6F 4DQSA 2J7WA 2EFGA 3WZ0A 3QAEA 4TYAA 1HHTP 1ZTWA 3OR1B 1SXLA 4EEYA 4Z7CA 2H65B 2W8KA 2C2NA 3M6XA 2MLZA 1H72C 1QLNA 4UQGA 1FT8A 1X5SA 3TO8A 5KAKA 4LUBA 2PIIA 4YB1P 2EFOA 1UVLA 5CD4H 4NA3A 2C2DA 3CIZA 4PQUB 1RT1B 4KTQA 2XB2D 4RNFA 1DTQA 1CC8A 4QIGA 2YWEA 2BRKA 4CLTA 1MG7A 3FRZA 4FVMA 2W9CB 1RKIA 5D15A 3HVTB 2CQHA 1WF2A 5C2GA 4ZVUB 4Q7AA 1YZ7A 2FHOB 2MQOA 3CC4S 4USJC 1U1PA 3FBEA 1VJQA 2W9BB 2MEWA 3F56A 3DU5A 3SCIE 1SC4B 2Q66A 3SSSA 3R5AA 2HS3A 1S1VA 2VBXA 3GV7B 5IQQA 3OUYA 3CF5Q 3BR9A 3TVKA 4DQRA 4RW6B 4DOZA 3CJRA 1R6YA 1R3NA 3NGUA 4NXNJ 1ZAWA 4O3SA 2F9DA 1NJIT 2NYIA 3RBDA 1I94J 2VJUA 3OD2A 4ICLB 4OFZA 3IAM9 2GVDB 2WCXA 2XM3A 1U1LA 1S6UA 2EVZA 2VQEF 2QC3A 2CA9A 4IYQA 1WEYA 4BC9A 1N0VC 1JX4A 1KHVA 2AKWB 1XNQJ 2DNHA 2QYGA 3AA8A 4F36A 3MPYA 4JV1A 3MAQA 2XULA 3S8SA 5AXMA 3T6BA 2MZ1A 4WE1B 3OUYB 5J2QA 2PMZD 2LA6A 4FNIA 3A12A 1PILA 1TV6B 2K1RA 5A8KA 2R2UA 5KFYA 1FRIA 3D0GE 1S6PB 4DR7J 1YKWA 1X4BA 5K14B 4PYDA 1AB8A 3ZXWA 4C11A 3HHLC 4N76A 3QRQA 1I3OB 4Y28C 2IDEA 3MZIA 4WZMA 2J9DA 4DV1F 4Y00A 2JEJA 1M1KT 3IFEA 1AT1B 5I3QA 1NDPA 2RU3A 1R7IA 1U0SA 4QIEA 3JSRA 2G0IA 2HWHA 3E01B 5HVHA 3RW6A 2HHUA 2YWFA 3VALA 4BS2A 4PUOA 3H8YA 1TK5A 4OHXA 5BYQA 4DX5A 2K1RB 3VAKA 3A4TA 5A76A 3J7YU 4XO0A 1WELA 4C11B 1HWKA 1CBKA 1YQHA 4I64A 4EI2A 4TY8A 3L9ZA 4NA1A 1OPIA 2ZZTA 1OS5A 3K5NA 4U8YA 1T03B 4K4ZA 2B5JA 2HZVA 1IBLF 4ZN1A 5KOXA 2PDAA 1N33F 2R3VA 1TKTA 4WXOA 2BA9A 3VAGA 5JJBA 4KE5A 2QA1A 4P75A 1SQGA 3KK1A 1NKBA 3GWCA 4YDXA 2VOOA 3QATA 1RWXB 1Z1ZA 5BXIA 2GMLA 2NXCA 1B7YB 1LW2B 3GYXB 2Q79A 3RBXA 5E41A 1O5JA 4ED3A 1GTHA 1N34F 2JC0A 1RACB 3RG6A 3BH6B 4TY8B 3N28A 1UTAA 3JYTA 1M1GA 3K5OA 1X0FA 1YJVA 4CM0A 6FD1A 4CM2A 2C2KB 3AOAA 3KXDA 3BO4A 4DV2J 1J5OA 1C1CA 1XR5A 3H42A 4GC6A 2HHWA 4O4GA 3J80Y 1FDNA 1IQTA 2IFXA 4KFBA 3C6UB 1H2UX 3M6WA 3NGDA 2IRXA 1RHRB 1VQLS 2MB0B 3W9HA 2UXBF 2A0FB 4JB8B 4DV5J 1QUVA 3OHBA 5HLFA 1WOPA 2HFVA 5DS7A 1X4AA 3JYTB 2CQ0A 5D0GA 2BVZA 4KHMA 4RNNA 2ASYA 1FESA 3PRBA 3UWTA 2JSXA 2VFTA 3K57A 2GV1A 2AEMA 2HFSA 4GO5X 4N5SA 4KV8A 3BDPA 1UJ4A 2EPIA 3OBIA 1CJVA 3DDIA 1EZZB 3TEGA 4LF4F 2FY8A 2GMJA 2E5GA 2U2FA 5E3RA 1Q16B 3LO3A 4EZ6A 2WOMA 2A2DA 2VC0A 2HQFA 1JKHA 2YPYA 2YWGA 3Q8QB 2ZDOA 1JJ2R 3BKUA 2DNKA 4N77A 5IV4A 3KLGA 4X64J 3W8GA 4P74A 1JLGB 1KQSR 1F0XA 3ADAC 2B8PA 1CJVB 4RZRA 3BYRA 1NHVA 5D4NA 4DQIA 3SYZA 2Z2LA 4PR6A 3HPOA 4DF8A 1X60A 3EPIA 1CJKB 3OL9A 2UVRA 2FJEB 3OQ2A 1X4FA 1J2VA 2ZBPA 2YQ1A 5KFNA 2WOMB 4IH5A 1B70B 3KMQA 3R5BA 4RBUA 4U6PA 1W2BR 2DK2A 4DR1F 1KTQA 4C48A 2R8KA 2HGNA 3HT3A 3D6HB 2DO4A 5ETKA 4S0MA 2KG1A 3D67A 1FRHA 2J9CA 3IR5B 2QIFA 3FFIA 2PT0A 2FGOA 4JI1J 1N88A 4OZJA 4J9KA 5C24B 2GQQA 5KT6A 2HMIA 2WONB 2ZKUA 1GMUA 4I69A 2XY7A 3KJNB 1K9MT 4PXBA 2KZMA 4JV2A 4L3KA 3OSNA 5CYQB 4ZP8A 2DJWA 4DSKA 5HL7Q 4ZJOA 4LFAF 1YJUA 2IA6A 3IWNC 4OYOA 5I42A 2A18A 4WP9A 3TNVA 4I2PA 4CLKA 3R7NB 2DHAA 2E29A 2COLA 1SIZA 3W64A 2W4PA 4MK7A 1TUGB 5BR8F 5LMUJ 3RTVA 2UUTA 2OGUA 3DLLQ 4AL5A 2H4YB 4IRCA 2C2RA 3MWBA 2FJWA 1RWMB 1JLCA 4C0HA 4RBVA 5DDOC 1KQFB 3MAAB 2XMUA 3T41A 4QW8A 9ATCB 3TVYA 1XNRJ 2HMIB 4OI2A 2F3JA 1EQMA 2E9RX 3DGPA 1UPPA 4NZ7A 1IR1A 1RZMA 4XK8C 2DRAA 1S0MA 2JLGA 4LF5J 4DL0C 5I42B 1N48A 1NK5A 1TL4A 2Y1JA 3V4IB 3QIPB 4R8UA 4PWWA 4EMDA 5E3PA 5L1LA 4ZVFA 3QLHA 2FVQA 2MQPA 1JLCB 1X9WA 1TELA 5T7LB 3G87A 1RT7A 2BJ8A 1H38A 3ZNUA 2F8EX 3ITHA 5L39A 2ZHBA 2BKNA 4TYBA 4USIA 3M32A 1RTDA 4RLEA 1RT4A 1BUXA 2CQ3A 3OTOF 5KFIA 1RAOA 1Q79A 4ZPTR 2DXDA 5GAEU 4JI4F 4RW9A 4FBUA 2R4FA 4R8UB 1FRMA 3VF0B 4F4XA 2MQNA 3FBCA 4WK1A 3DC2A 3K2YA 4D3GA 1L5UA 3OFHA 1U2CA 3MPVA 1T9YA 1RT7B 4ES3A 3R6LB 2UVUA 1G4CA 1NM2A 1DZ5A 3NOCA 3DLHA 3ITHB 2VHGA 3MEDA 1V3ZA 2HLUA 1RT4B 3IM9A 3RRGA 2HNDA 2F4FA 1RYSA 2RRBA 2JZ5A 3CO9A 2XMWA 4YFUA 2BXJA 3DLKA 3BQ1A 4ZVRB 2XY5A 1KEKA 3HHDA 4I7FA 4B9TA 4A8WA 5KG7A 2OPRA 4KRWA 2QMXA 1EP4A 3GIKA 2WSFC 3UDCA 5IC6B 2OIHA 4ZPBA 2OHDA 1QSYA 4DL3A 3FSIA 3A3OB 2H5EA 2XMKA 5KT2A 1TK0A 3TW0A 4DXLA 4PWUA 2HGLA 2W8LA 1IVZA 2HNDB 3THPA 1N52B 2BOAA 2C3YA 1WJ9A 2YWWA 3B54A 2VA2A 1QSLA 1BWEA 3KLFA 3VTIA 1HI8A 3OR2A 3I9ZA 5F8LA 1IJFB 1GK8A 3OJSA 4F26A 2AGQA 3KHHA 1KQKA 3CJ0A 5IOLA 2WVDA 5KFLA 1U4BA 4NZ0A 2IHR1 1RU1A 2HHPA 4M5KA 5LL6d 3O44A 2LCWA 3MR3A 2BV3A 2C2OB 4ZCIA 1Z2LA 4UOGA 3PW0A 1KVIA 2OUGA 1UMJA 3KMSA 5E3AA 4A8FA 2XCAA 2GC8A 4RUAA 2GIFA 2CUYA 1T9VA 1VC0A 1RP5A 2ZOGA 2OPQA 3KLFB 3CGIA 4F3QA 3OR2B 4X4RA 2L9DA 3IP0A 5F8MA 5J2MA 3TA1A 4DR2J 1IBCB 1Y00A 2K7KA 2G13A 3MEKA 2QSFA 3FCVA 1RHJB 3NG8A 3CCJS 4RW8B 4ZP7A 3R5GA 2M88A 4F4WA 2JOQA 1TKXB 4FF3A 5H9EJ 4F25A 4DUZJ 1WSVA 1HYSA 1NB7A 1O6XA 2YKPA 1NO8A 4LF7F 5IM0A 3TYTA 3V5RA 2Y9HA 3BGRA 3AD8C 3GR0A 3HXMA 4DV7J 2HURA 1SKUB 2MJUA 1WOSA 2KTQA 3P45B 2DNGA 3DOMB 3BPSP 2G2OA 2E5IA 2NSBA 5EN1A 1ROFA 1TAUA 3VWSA 2CVIA 4F0KA 1VQ5S 5J2MB 3LGMA 2IIHA 2M2BA 5CYMA 2HYIB 3WQPA 2Q3PA 5L9NA 1RA7A 4Q2MA 1OWXA 1M5OC 4ZHRB 3LW5C 2A6OA 1XMOF 3UDLA 3QMQA 2LXFA 2XS2A 2DXFA 3CSKA 1NDCA 4IR9A 2DHGA 1NEEA 2N4CA 3J81U 2C2ZB 2EC0A 5DM6Q 5DLFA 3PHTA 3T1YJ 1LNQA 2XZWA 3PW4A 4OX9J 2YKAA 2XMAA 4A8KA 2MZTA 2DHSA 2OJ3A 1PCAA 1UA1A 1TUWA 1S12A 5MAOA 1I6JA 4TN2A 1XMQF 1S9GA 1N36J 3SSQA 8ATCB 2NZ4A 4YDDB 4GVBA 4AQYF 2QFJA 2RUSA 2KFZA 3CEDA 2GHWA 3NEKA 4P71A 3OTBA 1YZ6A 1GT8A 1NK8A 2EK1A 1WORA 4DEZA 3QRRA 2PN6A 2DBBA 2CQ1A 5HJYA 1M5PC 4HH0A 2FZKB 2C28A 1OPZA 2POKA 4MFBB 1Y10A 3UCUP 4L73A 4GKKJ 4TQSA 3RB4A 4QR1A 2IVFB 5LSLA 3AD9C 3VGUA 2MDAA 1HHQA 1R8AA 2FVSA 1FFWB 3GSIA 3TJ9A 1PAUB 4NI2B 2R7RA 5AJ3J 4B9VA 4UY85 3PYEA 1XN9A 3LPYA 4G1QA 3V6JA 4NLSA 4OI1A 4MYTA 2VD3A 2RVJA 5B0BA 3W60A 2HNYA 4X4VA 2KHDA 2R8IA 3OFFA 3SQOP 2KXHA 2OELA 2VG6B 1OYEA 4XTTA 1RQ0A 5ETOA 4CTAA 5KOWA 4C8LA 1R0BG 2A2CA 1UFWA 3JTPA 4N7TA 5C42A 2AT1B 3CC7S 1Y5LB 1QTNB 4UUXA 1U47A 5KT7A 2RQCA 3BKFA 2WVCA 3W9IA 4N41A 1S77D 3MOJB 1NAQA 2AX1A 4AYBD 3AXKA 3NMAA 1HQEA 2Y8YA 2B3TB 3HJVA 3BJYA 4JI8J 3EGWB 2AYBA 5H9EK 4LT6A 2HQCA 2DNNA 4DSJA 2HNYB 5B0GA 4DJBA 4JI6J 1ULRA 3KK2A 1S1UA 7FD1A 5EGYA 3R2DJ 1YDLA 5J2PB 2Z56B 2M7SA 1QJHA 4JI0F 4U96A 5DGBA 3D4JA 1JLBA 2P5VA 1TQLA 3AB2B 4ALZA 2YVSA 4A8XA 1NK4A 1IUJA 1QAXA 3RRHA 4CLYA 4IG3A 1T0TV 1NZ8A 2D1CA 3QQCD 3PKMA 3L4BC 2H4WB 1RAGB 3HFKA 2UU9F 1HQEB 3SQGA 5GADU 3K59A 1RAJA 2J7UA 2HAIA 1FD8A 2ZC3A 1T9WA 1X4CA 1FK9A 3PIPQ 3GJQB 2VU5A 3FEYB 4K2JA 4MT1A 1Q7LB 3PJ9A 1Y3KA 4GVLA 1N8RT 1HMVB 3GFZA 4Y34A 3LP2A 5M2PA 1N6QA 1JLBB 2Q43A 1TMMA 2VOPA 3W66A 2R2RA 5AXLA 5IT9Y 4IG3B 3GYNA 2CZVC 5F8NA 5GMKa 5GAGI 2V0NA 1JXLA 1Q82T 4U7UD 1C2PA 2VKRA 1HW9A 1GTEA 3IGNA 4PABA 2EWHA 4ID8A 1T9TA 2BJ7A 3MUVP 2CVEA 3SQGB 4DDFA 3PDNA 1GMWD 3KHGA 2R2TA 2DIVA 2MTLA 1S7IA 2DISA 2DH9A 2XMVA 4YR0A 1FK9B 4CH0S 2OEMA 4PXEA 1RB0A 1NK9A 3N01A 2BR0A 1YLXA 2W4DA 1I5OB 3LP2B 1IKVA 3QYYA 2C3PA 4L6V3 2KFNA 4URQU 3MTJA 2DVIA 2OMLA 2E5LF 2OAUA 2FHJA 3TX8A 3V4MA 3GMGA 2PMWA 3KK3B 4H4OA 4DCJB 3MCNA 3JSMA 5AE2A 1YJRA 2AX0A 4DCOB 4DU7A 3JAMU 2YY3A 3M8WA 3W2WA 2CNNB 1PYTA 3AQPA 3RW7A 4ANEA 4ECTA 3ULHA 4NWBA 1ZM9A 2E1AA 4EYHB 5H9FK 3GLJA 1YSJA 2M5YA 3TZWA 4IO9Q 4KO0A 3BN4A 1U1RA 2QA4G 1RHKB 3F41A 3IA0A 1X9SA 2ZKTA 4YY3F 2GJFA 2WSCC 2KRRA 2ZD1A 4IDKA 2RQMA 3AHPA 3JSMB 1WC6A 1GAOA 2WHOA 5M2UA 5CD4A 2FLNA 4CH7A 3W2WB 5KFOA 4OLOA 4ZA1A 2Z2MA 3TAPA 1PYSB 5B0CA 2DNLA 2ZH4A 1KR4A 4OHYA 4UY8T 5KFAA 4KO0B 4HI1A 2DGVA 1SQFA 4HHHA 1UETA 4DS4A 4IFVA 2B7BB 4OYAA 2B51A 3BGFA 1KLMA 4ZVSB 5IC4B 5C25A 4OZNA 5HP1A 3O1LA 4FVCA 3MEEB 1B64A 2VG7A 4PKDB 1RTHA 2XS5A 3WIUA 3TOQA 3EDRB 5L8RC 2DR8A 3HZGA 1UZDA 4DPWA 2KHCA 2OTLS 4DV6J 2RD5C 4AFFA 2W1BA 3BDEA 2IMWP 2I8EA 2QT7A 4H4MA 4ZLPA 4ELVA 1V5IB 2Z30B 2R8GA 2CQIA 4EO8A 4PWDA 1VOMA 5DQGA 3QWUA 1RTIA 4KB7A 5DQIA 4XIUA 4KHPF 3T1HJ 1B0TA 5HO4A 2P8IA 4MIBA 3KNAA 2LFVA 2HWTA 2MSTA 1RAFB 3CCQS 3NAIA 5C25B 1IWAA 2GFFA 2VG7B 3O2IA 1NRKA 5ITHA 4M8LA 1CULB 1ZM4A 4MIAA 4PEOA 1TTHB 2W2QP 4OJ3A 4DFKA 3K89A 1F2GA 5EWGA 1NJXA 4DR3F 1MSWD 1KN6A 3BO3A 2RAQA 2L48A 5A2QY 1M0SA 1KVJA 2RF2B 1TL3B 1RHQB 1NSQA 3MFHA 1AUDA 1HNIA 4FYVB 4W90B 3C2PA 1ZYQA 3QT7A 2KT2A 4LBPA 2D9OA 3I56S 2VJVA 4Q8EA 2JJ4D 3L3CA 3UDVA 1FI4A 4DL6A 4DR6J 1VJWA 1ELOA 2IA0A 3G2XA 3T5HA 2PFFB 4DX6A 3PV8A 2HIYA 2BQRA 2LQJA 2XQCA 2Y1IA 1KS2A 3BGOP 3CCRS 1HBOA 3ENQA 4KH1B 4KPYA 3QZ7A 1U26A 2Y1LB 5K8MA 3FVYA 4LF8J 1FTRA 1CEZA 2KKHA 3NNAA 3RGIA 3MMAA 3UQSA 4X4NA 1ICEB 1UA0A 2PI4A 4DR4F 3CJ5A 3HD1A 1HNZJ 4RO0A 4RNMA 1TAQA 3CTRA 4USUA 3AJDA 5B0DA 1E6YA 1LOUA 1S4FA 1V9OA 3C15A 2ZH2A 4DX8H 4ID5B 4J91A 1U8WA 5A8WA 5LJ3Y 2W9AA 1Q78A 1P6TA 4Y2MA 4CNZA 3TX0A 3DM2A 4OJHA 2DR9A 2HNZA 2HHHJ 1Q5VA 2M3DA 5D3GA 2Y1RI 1S72S 4LFBF 1FEEA 2PSZA 2W25A 1LK5A 3W62A 5ETRA 1PO6A 3W5ZA 1ITPA 1KHWA 1T94A 4Y0FA 4QBUA 4HTJA 4G1PA 1OYDA 4X66J 1FKPA 5L1JA 2YNGA 2JVRA 4I1TA 1UVNA 3CCUS 2XG8A 3C16B 2XSFA 2ATLA 2G0CA 1TU0B 4UOCA 4F7VA 2VIHA 4NPOA 1SKSA 3ZZPA 1FRLA 4H54A 1UCNA 2GQ2A 3PJWA 1VLOA 2VUGA 2B4OA 3H2VE 2FHKA 1NH8A 2C2EA 4WF9Q 3BS9A 4DR5J 2XMJA 4PZVA 1R0AB 1MROA 1VQPS 4QR2A 4WYWA 4LRFA 1X4EA 1SCJB 3ETOA 1HBUB 3MAHA 2QSWA 2JLEA 3ZZUA 2B56A 2X51A 4MKAA 3FZ2A 2YNFA 3MURP 1SJ4P 3V6DA 2FC9A 2CADA 3ET6A 1N5YB 8AT1B 4C8MA 3EZUA 4WU3A 3I0RA 2ASJA 3VGTA 2HQ3A 1JQGA 1VRTB 2OPPB 4CIOA 1Q8BA 4WPAA 4PXDA 1FXDA 4DPOA 2WTFA 4NLXA 2CZ4A 4RBTA 1NJZA 4JV5F 3ZZYA 3EYZA 2CWKA 1MROB 1MWQA 1RGVA 4PAAA 4EFAC 3C14B 3NCPA 2RSQA 1UVKA 1S99A 1VQMS 4IH7A 3NGRA 4B3SJ 3HD2A 4J37A 1GXTA 4IO1A 4NEZA 2DPJA 4CYUA 1DQAA 5KFWA 4CO3A 2HKEA 3G9CA 4BC7A 5F8IA 2YNFB 2XYHB 2R42A 2NQPA 4ECRA 3MCMA 3PFEA 4RUBA 2F40A 3KFWX 3PJXA 3W63A 3J7Z5 3JS9A 1T02A 3HSJA 4K4UA 1VK3A 4P2MA 1FD2A 3NGSA 4QW9A 5BYRA 1VQSA 3BGLA 3M8SA 4J9MA 2ZVSA 3HSZA 1FCAA 2LU1A 1ZAXA 2YX4A 1GQEA 2KDOA 2AQ4A 2XBPA 3BN7A 5L9XA 3I0SB 2MQLA 1CC7A 1P1TA 2B8QA 4BWJA 2YPZA 5IT4A 3O8WA 5KFKA 3U02A 2V8GA 4JI5F 1HWJA 4HHUA 3OTDA 1ACMB 1GNKA 1JNZB 1BQNA 2HZAA 3NGTA 2I5JA 4NLUA 5HMYA 2CXEA 4CT9A 4DWIA 4YHHF 3GIRA 2NXEA 2YTCA 4B3TF 1IBKJ 2DGOA 5C5JA 3KG0A 4KKOB 4DL5A 5K8NA 4OX6A 2KM8C 1R8CA 3LP1A 3FUYA 3J80U 5J2NA 2A6MA 1HNXF 4KYZA 2MKHA 4RU9A 1D8YA 5GAHI 1ZM2A 4WFNQ 4DL7A 2C22A 3PYDA 4KGZB 3TUZC 3PW7A 2HRUA 2H51B 4LIRA 4C2MA 3DXSX 1HWIA 3Q86A 3FSXA 2O66A 4HYKA 3N6NA 3W61A 4U7UK 4DF4A 5KT5A 2GNKA 2LQ9A 3DOLB 2XWYA 3IG1A 4ITSA 3GFXA 3HKWA 3AOCA 1H2TZ 3IBFB 3C19A 2V8HA 4NLRA 1FWKA 2M70A 3OL7A 1BQMA 4LQ3A 1X4HA 2CQCA 2IRYA 1EB0A 3W9JA 5J2NB 2QJ3A 1R31A 5I3UA 2HGMA 2R8JA 5AXNA 3FQLA 5CXTA 4NX9A 1UWBB 2LVWA 1YWXA 2KXFA 5D6GA 1UPMB 4C0OC 1SJQA 1HA1A 3QNWB 3M2VA 4CLPA 4WKYA 2J0QD 3UDEA 4JI8F 1BGXT 1NHUA 4CWBA 4F2RA 5D4LA 2JEGA 1ZA1B 3DFEA 3TARA 1SUQB 1JJ4A 3GR1A 2AJFE 1QE1A 4WIQA 3KLEB 3W2VA 3G82A 3M6VA 3NNCA 4P9SA 4NCBA 2VV5A 4WYLA 4K4WA 4YR2A 1K0TA 2E1PA 4YMEA 2R7VA 3I87A 4OMFG 1YK9A 1SL1A 2V9WA 2O01C 4ECZA 3UD5A 5A0YA 3BSAA 1FJGF 2MLYA 3M2VB 2KU7A 1UVMA 4ZCMA 1WNEA 3N6MA 3C3LA 4ENOA 1Q8IA 2H9ZA 2MKIA 3G8TA 1FDBA 3FCHA 4W92B 2HHQA 3KLVA 3R3TA 5KFJA 1QE1B 5IQ6A 3R1LA 5CABA 2J9EA 2DH7A 3G82B 4QCLA 3BR8A 1R8BA 4RW7B 1CG2A 2GHPA 4MIWA 1HI0P 3EPGA 5KFMA 2L3MA 1VYAA 3V2UC 2QGFB 4RNOA 3MM5A 5KFDA 2CQBA 4EK2A 5HQLA 1BE4A 5JXSA 3MMBA 2K7JA 3NRBA 5LJ5Y 2GVZA 1FFSB 1I1GA 4NCGB 4KQZA 4ZVEA 4ZPDA 3U1NA 3OSPA 5KFRA 3WHIA 4HI2A 3DU6A 4W98A 1KBRA 2CJ9A 4KPCA 4KH0B 2DCUB 2UV8A 3J7ZT 2Q6BA 1RAHB 3FEZA 3TJAA 2FTRA 2GO9A 4UOHA 4JI2F 4ZJLA 3SEOA 2AF6A 3CDWA 4O44B 4PG8A 4NMLA 4FXDA 4QWDA 3R97A 2I9SA 1VK8A 3IRXA 3OXLA 3B4MA 4XDCA 3JSBA 4OJ1A 3MM5B 2Z58B 3DRXA 1M5SA 4HACB 4KBIA 3ZZZA 4LFCJ 4I67A 4O3OA 1Q4RA 3GQCA 2GVZB 1WHWA 3POTA 4CCHA 2ZNYA 2DNPA 1D09B 2JLFA 3KKFA 2CAJA 1FRXA 2G9OA 4X62J 3CJKA 3MM7A 1S57A 4KGVB 5ETPA 3M2RB 2LLZA 1J5EF 3NBPA 1HLWA 3HHLB 1DAXA 1BLUA 2YH0A 4LR7A 4B9UA 2MQMA 3D0HE 2MGZA 1QDUB 1XK8A 2NXNA 1RI7A 5KFVA 3CC2S 1FWLA 3QAUA 2FIUA 1MNEA 2K3IA 1F5CA 4OJGA 5ETMA 2F8HA 5D8HB 2BEFA 1WC0A 2CQPA 3JSYA 1HQUB 4AL6A 4DFPA 1FDAA 4JI3F 3LAMA 4F4KA 3DLEA 5KT3A 3QGGA 1RAIB 4R0JA 4DFJA 2IYGA 4OIXA 2RUGA 4UW2A 3MM7B 2YNIA 3CJKB 2F9JA 3SDEA 4X65J 2BMBA 1A9NB 4K0KJ 1NPKA 1RWOB 2RRNA 2MKJA 2Z2YB 3DMJA 3X3UA 2RE1A 1CJTA 2BJDA 3M4XA 3GTYX 5GAHU 1Q7YT 1AYEA 1HW8A 3AQOA 1N5QA 1SPBP 1SJ3P 3CCSS 3PIOQ 2D69A 3HSGA 2FVRA 3N5BA 1REVA 3WX4A 3DRSA 1ZPWX 4GRSA 2AJQA 1E6VA 1LWFA 1BXNA 2VDIA 4LRCA 2CIMA 2CNKB 2VH7A 3NS5A 5HQMA 1W2IA 1LFWA 4BCAA 2LKZA 5LXYA 1RKJA 4MKBA 4OYPA 5HJXA 4B08A 2IBOA 1EKSA 3SSRA 1IQZA 2AYGA 2BANA 1RBOB 3PZPA 2NPFA 3QZ8A 3IS9B 4WFZA 3DMJB 3CJ4A 1CJTB 1EETA 4MYUA 5DG7A 3VGVA 4NASA 4R25A 4ZJQA 3EZOA 4K2XA 1KTVA 1T9UA 1XMBA 3DRSB 4ZVQB 1LWFB 3MEGA 4ZP6A 3AJ2A 2F4VF 2XLIA 2GAHC 5CAAA 1UW9A 3LGNA 3D1HA 2Z0GA 1F5AA 2QA2A 2W2MP 4DV3J 1S97A 1N54B 1SI9A 2U1AA 4ZITA 3GFHA 2V6AA 2K3KA 2C1EB 2XMTA 2GJIA 2ZOMA 2UUAF 2F7VA 1GH8A 5HATA 3MUMP 3DRPA 3O5TB 2QL9B 2XWXA 2KVQE 3E3XA 2VZ9A 4DI6A 3TAQA 1EETB 2UUCF 3D28A 1IKYA 3NMRA 3W65A 3D7SB 1TL7B 1BD6A 1JJHA 1G2EA 1HQ2A 2W01A 1NCLA 1HR0F 5LSRA 3SV3A 5G4DA 1TVRA 2L9WA 3FZBA 3ZC4A 3MEGB 1CLFA 4ZMMA 4ZP9A 3IO1A 3DLGB 1FNOA 3EVMA 2MKKA 2W24A 2FJVA 2V2KA 2VG5B 4ZDNA 3UVJA 3M30A 2BJ1A 1SH2A 2HFZA 2IMOA 4HDHA 1GMVA 2QG9B 2R7QA 1CVJA 4ILRA 3PG9A 3CJ8A 3HCXA 1KWMA 3AFGA 3K58A 2CJAA 2QLJB 3DRRB 4USHA 3CMES 4AUKA 3MR5A 3W7BA 3E51A 1IKYB 2H5IB 4B9MA 3LGHA 5LMNF 4QJVA 1MN9A 3GJRB 4OYIA 1WKKA 2EFVA 2EKNA 4M5GA 4JP8A 2RS8A 4AL7A 2P6TA 1G6BA 1RE1B 2CNOB 3M8PA 4RU2A 2CRLA 3HHEA 3OL8A 2CFXA 3SBMA 4GKJJ 3FQKA 5A8RA 1FNMA 3M30B 2B4UA 4DPUA 1H7XA 3HLUA 4IG0A 2B4VA 4N8OA 5HMWA 3QT6A 3EGZA 3ZFVA 4JYAJ 4HEA9 3VAHA 1Z4UA 4DL2A 3DRYA 2D3OR 1A0OB 3D3BJ 3MPDA 3KJQB 2HVHA 4M63A 5CZXA 4HDGA 3GONA 4CQ1A 1RT3A 1XR7A 4OHWA 2JRSA 2J8AA 2PO4A 4URSA 3CVKA 2R7SA 3TWZA 2B9YA 4URGA 2CPYA 1S6QA 3LWMA 4A47A 2ZM6J 4TU9A 5F8JA 3UNGC 5CCLA 3ZTSA 3VAIA 1DTQB 1GX5A 2V2ZA 2BE7D 1QM9A 2EI5A 3KUGA 4JOUA 1LWEA 3I31A 5T14A 3OFEA 1OQ6A 2V4JA 3PR5B 1VQKS 4LRBA 2CNLB 3RR7A 1PSDA 1RT3B 4W4MA 3VAMA 1S1VB 1N5SA 2B43A 4ETZA 2JEIA 4C3MA 1S6QB 2OTJS 2LEAA 3CE8A 3PW2A 1PC4A 3CULA 1B3TA 4OV6A 3T9NA 3EJMA 3CCVS 3FNNA 4HVZA 4OZ3A 3UCGA 3GIJA 4Q5VA 2DITA 4OI4A 3TP2A 2DY9A 1H0HB 5LT5A 1M5VC 4NLOA 4N47A 2WBMA 3PKYA 4O0NA 1S9FA 2V4JB 2E1RA 3H20A 5J1EA 1EAYC 3FC9A 4B3MF 2E7XA 5FLXY 4L76A 4LF6F 2VDHA 4WFAQ 5J2QB 4FF4A 2QFIA 3L7OA 4ERDA 2DHXA 1KC8T 2QE5A 4B17A 1RCOB 3K17A 5A8KB 2VQEJ 1N4LA 2XO7A 2VKZG 1KNZA 5HROA 1FKOA 1RAAB 3Q2SC 1P9QC 1NKCA 2ZBIA 4B9LA 3R2CJ 2R7XA 4R0EA 2LEBA 3KJFB 4NOHA 2ZH3A 2FJXA 2GA7A 4I2QA 5CA5A 2XZTB 5IT0A 5KFUA 5B0EA 1FA0A 2KXNB 3H2LA 1GFWB 3DHWC 3HM9A 3HFZB 3HJFA 4R5PA 4DV1J 4PUOB 4IOAQ 4P73A 1F60B 1PKUA 2PD1A 5FDLA 2V69A 3CD0A 2MJNA 3BPDA 3HFVA 5D78A 4ZPWR 2VPXB 5EWFA 4EZ9A 5HROB 1FKOB 5J1NA 3H0PA 3GV5B 1MN7A 3I96A 4PG5A 1H7WA 3GCXP 2ZZMA 1RU2A 4F3OA 3D1QA 2B5JB 4NRTA 3P96A 4ED1A 2ACYA 2N3LA 3FMWA 1FJCA 4FXWA 4B3RF 4LREA 4Q8FA 1TKTB 4ED6A 3RRKA 5IT9U 3KK1B 1OJ4A 1IKXA 3ZNJ1 3OXFA 1NSKL 1GX6A 1HL6A 1D9FA 2RKIA 1RDRA 4J5OA 5F3ZA 1AFIA 2IPOB 4FNHA 1HFEL 3K7RA 5K20B 2FZCB 1F3FA 4WBFA 3IN5A 5KFPA 5ETSA 4NLWA 2XEXA 3CW2C 1X5PA 2KO1A 5KG1A 4Q44A 3J81Y 3NWGA 3PHEA 1B7FA 1ZPVA 1U09A 1RWNB 5KFGA 2DO0A 1WTFA 3V6HA 1IM6A 1TR0A 4G65A 3CWJA 3WX8A 4DLEA 2AU0A 3S7RA 4FYDA 4DLGA 1SJ1A 3FK4A 1J5OB 1H98A 1RABB 1C1CB 3N79A 2AP6A 4O4GB 1O51A 1JLQA 3EUNA 1UWAA 2DNYA 3B8HA 3T5JA 1N34J 4KFBB 1IKXB 2DGSA 1UEUA 3Q8SB 3GJTB 1DURA 4QWBA 2BKPA 2RKIB 2ZJQQ 3TRGA 4ECXA 1TP7A 1LWCA 2FD2A 1CS4A 2HQIA 4EO6A 4NMXA 2DRBA 2LDYA 3VCDA 5HLFB 3ENAA 4NLGA 3R9LA 3F73A 3BZQA 1FXRA 4UF4A 1R27B 3MCSA 2UXBJ 4Q0BA 3IWXA 3OVSA 1UEVA 4QPTA 5DLGA 2HHVA 3CDUA 4FYWB 4KV8B 2G0JA 1X5TA 2YWHA 4ES2A 3KNGA 2F65A 4ANDA 3U1MA 3OFGA 4B02A 3GIMA 2FPHX 2V4RA 3QIDA 3Q22A 1VQ9S 3VVUA 3GU0A 2ZOFA 1JLFA 4B3OA 1CS4B 1S1TA 2IJRA 4PG4A 3ELHA 4X4UA 5DM7Q 3MM8A 1JKHB 1LXJA 3TA0A 2QLWA 2RRAA 5KFCA 1U02A 2RDIA 4EU0A 2ASDA 1RTJA 5LXRA 1IKWA 3RAQA 1LK7A 3VHQA 1SC6A 1NPRA 2ROEA 3J81j 2QYCA 4MH8A 4LF4J 2KYXA 1QAIA 1MMLA 3KLGB 3MF5A 1RT5A 3CUNA 2MKSA 1Y9OA 4F67A 1PG5B 1VR6A 4U95A 4DBQA 1WOOA 1ZM3A 3C46A 1FHTA 1Q81T 1P27B 3CXCR 1JLFB 4QWCA 5HSPA 3R5DA 3RBEA 4EGLA 1D9AA 4Y3CA 4YEAA 2YKQA 3MM8B 2PEHA 4TKTA 3FGVA 4YQWA 3DLBA 2AJ2A 2HBYB 1RTJB 4TQRA 1VQOS 2IVYA 2EG1A 3H59A 4FP9A 1HHSA 3KWMA 1P8GA 3RR8A 1RT2A 4O3QA 3B4DA 3ISND 3FFIB 3IBCB 3AD7C 3OVAA 1XC9A 4B9SA 2HBZB 1WTBA 2UV8G 4DR1J 4MKYA 1V6HA 3Q8VA 2X3DA 5JVGQ 3D2WA 2HW3A 2ABYA 5A2QU 3FKBA 1R43A 1DJ0A 2V9KA 3VZIA 1Z2ZA 3H40A 3N0VA 1WHXA 4DV4F 2DGQA 4LRAA 2EFNA 4I2PB 2ZE2A 2VQFJ 5CH7B 4Y65A 3PX6A 2E7WA 1VQ6S 5ETTA 4WJBA 5I4MA 1S0NA 3DOKA 2IC3A 1N32F 4OZLA 3EMTA 1EIYB 2DCLA 4LFAJ 4HT7A 5DQHA 1MU2A 2VODA 4ZLLA 3DI6A 3QO9A 3JXOA 1SJRA 3OLAA 3JB9k 2QEXS 1RHUB 5BR8J 2LYVA 1UJ5A 4X4SA 1SB6A 3GB0A 2I6WA 4HT5A 1A7GE 1S0VA 3DGPB 5A6WA 3T3FA 3PVXA 4LSLA 3UCZP 1L3KA 4PG7A 1NB2A 1YRUA 4AD6A 1FF2A 3H5XA 4DV0F 2BDPA 2BE2A 2ZE2B 3ENVA 2VPZB 2FVPA 2W2NP 3K5LA 2HK2A 3VZHA 5CQGA 3DOKB 5E0OA 1U7LA 1D9DA 3QLHB 3BV8A 2MHNA 1U6FA 3UR3C 1VS3A 3DI6B 1QTMA 3QO9B 4KT0C 3L95X 2G1HA 3THTA 5HMZA 4KC5A 2NXUA 5HBMA 2W4CA 2J0XA 2H48B 4I68A 4OHZA 4OI0A 4ED5A 1RTDB 3M32B 4WZQA 2EBEA 1HPZA 3GILA 4LSLB 1Q8LA 2UXCF 2PC6A 1IJEB 2E7VA 3H5UA 4ZPVR 5JUMA 4J9LA 2ERRA 3DCAA 4DCPB 1F9EB 2DT9A 2HVEA 1S1WA 4WFXA 2I0XA 2SXLA 4RW9B 1NK7A 1O0PA 1YITS 3IAS9 2X1GA 1SIWB 3OTOJ 4JI7F 1JLAA 3UO0A 5HVGA 3ZZRA 1RA6A 2UUBJ 3CPWR 4HH1A 2DNRA 5SZTA 2CPJA 1ZS6A 5HBMB 4C8NA 2MZSA 4JI4J 1OSCA 3TR5A 2RS2A 2N7CA 4USWA 1WDTA 3MEDB 2PGCA 3GG0A 4NXMF 2VF3A 1HPZB 1HNWF 1JB0C 1Q0NA 4YB5A 1OSDA 2DNMA 4ILLA 4OLPA 2XI2A 1S1WB 1WWHA 3DLKB 2ZH1A 4I7FB 1G3OA 2NLWA 1VIOA 3J7YI 2DTJA 3R5JB 4FS2A 1NZAA 4ECYA 2OPRB 4F0MA 1EP4B 1VQ4S 3Q8YA 2MZRA 3X1LB 5KG6A 4OQJA 4LF9F 1NMEB 2NS1B 2YNHA 4ZLJA 3RZAA 4KGMA 4UOFA 1WUUA 2CJKA 3HT0A 4H4KA 2D3O1 1C1BA 3HX9A 4I6WA 3BSOA 2RQ4A 4U9RA 2B9WA 3BM7A 1U2FA 4ZOSA 2WVEA 5F9LA 4CNYA 3PYFA 4IRDA 3D5MA 4MK8A 1WF1A 3I32A 2P6SA 4UQTA 1FX2A 5IXUA 3D6FB 1VBZA 3AAWB 3I82A 3TA2A 4RW4A 2KJVA 1BQXA 3VGSA 4PRFA 2YNHB 1VHFA 2DHHA 3CCMS 2ZBRA 4HTIA 2GCFA 2V63A 4ECWA 3NY0A 5M2RA 2RHSB 3RUBL 4FYYB 5U47A 3PEHA 5AXKA 3P3DA 4HHJA 2FQQB 4OI6A 1C1BB 4LF2A 3KJVA 2GAGC 2OPQB 1HNVA 4OZ0A 1EQ0A 2FDNA 2N82B 4M95A 2MZQA 1YJTA 2EK6A 3HMJG 2HBRB 4ZIVA 2BKOA 2MYFA 5D0EA 4ZPCA 4PQUA 3TJ8A 3G71S 2BYCA 1U49A 4RW4B 1HYSB 2E5HA 2C3UA 2AIRB 1FVSA 5IM0B 3BGRB 3K5MA 3J7AN 2H54B 2IJFA 5ETLA 4Y2CA 3CT9A 2J6TA 2VB6A 3C8YA 1SQEA 4NXNF 2W9BA 3DXBA 3KJVB 3R1HA 1RBLA 1FWPA 1FO1A 1HNVB 4PCQA 3N9UC 3NCQA 3RAXA 1I94F 4ER8A 4LF7J 5CYMB 2OD6A 3IR6B 2OP5A 2ZDPA 2QRRA 3SV4A 5L1IA 3NGKA 4RW6A 1HBNA 2FZGB 4O23A 1KLNA 1VQ8S 1SL0A 4DL4A 2X7IA 1XNQF 3PFOA 3MM9A 5MLCV 4ICLA 2D41A 2GVDA 2I1RA 5KFEA 4USVA 4XAKA 2RU9A 1YRXA 4DR7F 1XMOJ 2B7CB 1XWLA 2W7AA 1S9GB 3CJ3A 2XYPB 4GVBB 2P9CA 2DD8S 2R7OA 2ZITA 3VR1A 4YB7A 4WE1A 2H3EB 1QD1A 3KLHA 2HQGA 1TV6A 1NHKL 4HKQA 4P7VA 3UFCX 1HBNB 2ILZA 1S6PA 4J9NA 5K14A 1YHQS 4QQBA 3MM9B 1XMQJ 4J9OA 1OIAA 5H9FJ 3PR4A 4J90A 2HIQA 5CHCB 2GMHA 2WB1D 2YX7A 4LR8A 4AQYJ 3JQMA 5EHHA 3CCES 3LTOA 3BB5A 4USTA 7AT1B 4DX7A 1RXOB 5F0UA 3EVWA 2W2OP 3E01A 5DDRC 2ZUAA 4G1QB 2GJ2A 2BE9B 3ISZA 3F0NA 4LF1A 3QSIA 5KFBA 1X4GA 3KLHB 3I5CA 2YWKA 4DPYA 1AUSL 2GO8A 2MMYA 3CDEA 3DGVA 3IBWA 4C4WA 3MFIA 1VLYA 1VQNS 2N4DA 4CTAB 4ZKAA 3MXHP 5C42B 1Q95G 4PPZA 2R7UA 1N0UA 3HSDA 1DARA 1T03A 1U8SA 2FJBB 3ONQA 4M5HA 1U48A 4NLPA 1WHYA 2L08A 2CPXA 3KHLA 4GC7A 3CIMA 4K50A 3U27A 2CWXA 2FHJD 1S0OA 1QSSA 2M8HA 3ZTQA 2XLKA 3HI9A 5KTQA 1YRTA 4QWAA 1BHNA 3HZEA 5DJBA 3KG1A 2AJ0A 2FB0A 5DG8A 1LW2A 4TXSA 3KK2B 1W25A 4DV2F 1S1UB 4IRKA 1ZAVA 2KYZA 3R7BB 2JVOA 4U67Q 2R7TA 3GPAA 2JHEA 1WG1A 1T95A 4LVNP 4LSNA 2R7WA 2KT5A 4FBTA 3MUTP 4V19X 3OTCA 4DU8A 2GZOA 1R89A 4WTYA 1BC6A 2GIRA 5GMEA 2RT3A 2DIUA 4DV5F 2VBYA 2IAJA 2XI3A 5F8GA 2NXJA 1FNXH 3H2UB 3CJQA 4JI0J 2MY8A 2WW4A 1L3SA 3C6UA 2NZCA 2GS8A 2CJXB 2HVIA 2HHTA 2LDIA 4XPCA 5I3PA 4C6AA 2DY1A 2B9XA 2ZVIA 3O3LA 1RTZA 1G7CB 2MQQA 5HANA 4ZVGA 5B0AA 4EWTA 5CZVA 2QLBB 3BBCA 1RADB 2DNQA 1DBDA 3H5YA 1YJ9S 2R9LA 4K4TA 1EARA 1K1QA 4LIWA 3QGIA 4LSNB 4LMZA 1K44A 5GAEI 2UU9J 1N6QB 4PPDA 3C66A 4KHRA 1H3DA 5IZHA 5K8OA 3TANA 4TLRA 3MGJA 1SKWA 2PMHA 5B09A 3BSNA 3Q8PB 1QUPA 3LQVA 2KI2A 2IAJB 2WBRA 3MM6A 2X1FA 1FKAF 3OXGA 4ED7A 1JWWA 1F6TA 3QFWA 4A8SA 2D3ZA 2M4MA 2DRDA 2R2SA 3A13A 1IR2A 1LEOA 2RIJA 5GMDA 3ZZ0A 5DDQC 4X64F 4WK3A 2DR7A 3D66A 4QU6A 3KTQA 4IQMA 4BLGA 2YH1A 3QJLA 4CLUA 1IKVB 1U1MA 2BOPA 4ZLNA 2NPIA 4CO5A 2YKMA 2WSEC 2Y0BB 2AYMA 4DUTA 3EWGA 3FRYA 2UVWA 4H4KC 4H4OB 2V50A 1T3OA 2EFPA 1JLGA 2IM3A 5JMNA 2V68A 1YIJS 3MM6B 2NUUG 5RUBA 2CPHA 2HAFA 4IFYA 3H90A 1VISA 1UW4A 2YBVA 2BW7A 2RDDA 7FDRA 3OLBA 1U6BA 4HR2A 2E5LJ 4YS2A 1SC3B 2EFQA 1TMJA 1CJKA 3P5BP 1N5VA 4F4AA 2VA3A 3U7JA 2JDJA 2XO6A 3SCLE 2ZNZA 2ALZA 2X1AA 1B99A 3LPEA 1C0UA 4JI1F 4DN0A 1SVDA 4WTOB 2OH2A 1MWZA 2YKMB 4A8OA 4DUYJ 1OY6A 2CPIA 4DS5A 2FUG9 3IXQA 2ZD1B 4IDKB 2EXUA 1ZA2B 3H4DA 2ZH8A 4IFYB 4A8YA 2PE8A 1XQIA 2RJZA 3NCRA 3L7PA 5L38A 2ROGA 5C24A 4YY3J 5LMUF 3UR0A 3RBZA 2WONA 1SV5A 4P7TA 2F63A 4ZVPB 2XLJA 1LW0A 4C8ZA 3Q0AA 4MTPA 4UZBA 4IFVB 5CYQA 3HO1A 5LSOA 4ED2A 3RB6A 4EBDA 2CG4A 4DFMA 1NK6A 1C0UB 2MKYA 1KLMB 3AB4B 3PRVA 2J0WA 5HP1B 2KM8B 4M5LA 3LANA 1RTHB 3VAFA 4QYRA 2AD9A 1XNRF 3BO2A 1VBKA 3Q83A 2V8VA 2MHEA 3OTEA 4E8UA 3M9NB 4KAIA 1IXKA 2AZ1A 5ADZA 5D77A 4F2SA 3Q8UA 2V2VA 2H1YA 2M52A 4H4MB 4LF5F 4C3LA 1UVIA 1R8HA 4Z2XA 3MAAA 2VQFF 2GX8A 4PWDB 3LP0A 1RTIB 3TEHB 1TK8A 1SV5B 2OSRA 1LW0B 1JIHA 1VIXA 3DDNA 2C42A 1X8DA 1FX4A 1RAEB 4ECVA 4FZVA 1OMSA 1S48A 5KFZA 2Q6CA 2BZ2A 1WG5A 4BHQA 2EBGA 5DRKA 2LQBA 2WVBA 3H25A 2VASA 1YJWS 4OYMA 5T41A 2XZDB 4MAKA 4ZCKA 3FBBA 4KHPJ 4RKUC 1DFDA 2OEKA 5KT4A 3V4IA 3QIPA 4Y2AA 4P72A 1NPPA 4L74A 3IWLA 1S1XA 3T5LA 1ZZNA 2G2ZA 1NK0A 5T7LA 3Q2TC 5DZ7A 2F8MA 1WC1A 3LH2S 3EXCX 3R27A 4RNHA 4RWXA 3LP0B 1L3TA 1HNIB 2B4PA 2CPZA 2D74B 3PCOB 3IC1A 2KH9A 1M5HA 2LA4A 3G6YA 4O3NA 3RAMA 2A3JA 4DR3J 4UT4A 4LJMA 3SXLA 2J6SA 5AT1B 1HD0A 1T7PA 3H98A 1S49A 2N7YA 5LM7E 2DB1A 4OYBA 5GAGU 2ZWPA 1D8ZA 4QR0A 2BQUA 4CO4A 2XHWA 1S1XB 5CYJA 1V3SA 4ZS6A 5L1KA 1NH7A 1YBAA 1HBOB 4K5RA 1C4CA 2CYYA 3BBFA 4A4JA 2X3GA 3WBZA 1NXIA 3MMAB 1TFWA 2ALYB 2RMLA 4ANCA 1S76D 3PYGA 1LQ9A 5B0FA 1X5OA 5E3CA 2JFKA 3KUEA 4NYZA 4EUVA 3C6TA 2UUBF 1ZTTA 1WC5A 2B6AA 4BBYA 2P2CB 2RHQB 1DLOA 4RL1A 1JK9B 3ZTRA 4K4SA 2UZAA 4I6AA 4WXWA 4K59A 3BQ2A 2LXUA 1E6YB 2YX1A 2IY5B 3C15B 3E2EA 1VQ7S 4DZ6A 5A8WB 4NZ6A 4DSFA 1U1OA 4DR4J 4PQAA 2GHVC 2HHSA 3DM2B 1A6LA 2NUHA 3PO5A 3QBCA 2HNZB 5D3GB 1NUEA 5EUHA 3CJSA 4AXIA 3MMJA 2DGWA 4OV1A 1WEXA 2IJNA 4DHVA 4WP3A 3C6TB 1FKPB 4RJVA 5F0WA 2YNGB 2B6AB 1UFLA 1DLOB 4X4OA 4LFBJ 4JV0A 1I51B 1RWVB 3EXYA 4NEYA 3GCWP 5AE1A 4X2BA 1PC5A 1YBTA 2WRMA 1Y3JA 3LF0A 1C4AA 3G96A 2MQ8A 4DR2F 2QLXA 1WACA 1T11A 1QAYA 1TL5A 5KFXA 4ZIWA 4FF1A 5KG4A 1LXNA 6AT1B 5GADI 4M1KA 4XPEA 3CMQA 4DUZF 4YOEA 3TI0A 2AV5A 5FLXU 1IBMJ 2AWZA 3RYLA 2ZBCA 3E8OA 1WKJA 1UFKA 3PX4A 4DV7F 1U1NA 3W5XA 2RH3A 1KFDA 1TZ0A 2HLTA 1Q53A 4NRUA 4OZ5A 3QGHA 2AZ3A 3UD4P 4RW8A 2ZZNA 3V6DB 1TKXA 3ET6B 5HVFA 1Y4ZB 1DY3A 1Y5NB 2VFRA 3I0RB 4N8NA 4TLQA 1WC4A 4J9QA 4YP3A 2M9KA 1FJEB 1FERA 3ILOA 2E1CA 3EVOA 1U45A 1J27A 3DOMA 3MTKA 3Q24A 2VFSA 5G0RA 2AYEA 2J0SD 2C3OA 1AFJA 1UZHA 4DG1A 3FEXB 2KN4A 3AH6A 4CYUB 3IRWP 3T1YF 1F3VA 4ZHRA 3BSCA 3QPIA 4OX9F 4JV5J 1RK8A 3FDSA 1JNRB 1N36F 2WVFA 1D3WA 4F50A 4KY3A 5KFTA 2M8DB 4MJKA 4I56A 2VFVA 1K73T 1M90T 3GP9A 1VCTA 3A3NB 4NLVA 2R8HA 5B08A 2Y8WA 2FLLA 4NYPA 5G0RB 1T8EA 1U25A 1NU4A 4USKA 4TNOA 1VDHA 1C0TA 4QOTA 3VVTA 3US5A 4J9PA 4TVAB 3RJMB 4DG1B 1YX2A 3PXGa 4GKKF 5D4PA 2J5AA 1PJ6A 4A8MP 4C9DA 1KQGB 4KIAA 2MXYA 3F44A 1BQNB 4K5SA 3D68A 5AJ3F 3H7HB 4P2SA 2I5JB 3GV8B 2OPSA 2MPUA 1PYOB 4MFBA 3J7A1 2LP4A 3ZZTA 1KFSA 2KB2A 4WWSA 4JI5J 3P49B 2CPFA 4V19J 3IR7B 1CSJA 2PFDA 1U1QA 4NI2A 3S6EA 3B78A 4QWEA 3LP1B 3K0JA 4IOCQ 1HKAA 3QSYB 1C0TB 3WDOA 2XGQA 4FKYA 3W3SA 2UXDJ 4YHHJ 3OVBA 1VRQC 4B3TJ 2UVVA 2P9GA 4OI3A 3I4HX 4UTGA 2VG6A 1KD1T 2IYIA 2PA3A 1AZSA 2OPSB 1X0PA 1T3NA 4C98A 1HNXJ 1HI1A 4M5DA 3IG1B 4ECSA 3G8QA 2EW9A 3I6PA 2UUWA 4JI6F 3CDBA 3GJSB 3MMCA 2GQCA 2XHCA 2XNRA 3VAJA 2BUNA 4ZVHA 4WIIA 5KG3A 1BQMB 1F5BA 3IMQJ 4AE5A 1K1SA 5F3TA 3PACA 3CDAA 2WAQD 4YR3A 3BBBA 1RWUA 5I3UB 2FC8A 2HS0A 2FYXA 5KFQA 3MD3A 1URNA 5EWEA 3HHLD 1XJWB 3BGUA 2B0GA 3PEJA 3GG1A 3FJ2A 2D7SA 5J2PA 4UZCA 2XTJP 4G6VB 2APOA 3NS6A 1AZSB 1MMDA 3AA9A 2ROPA 1OO0B 1W26A 5IWAJ 4M5DB 4WKRA 2DGTA 2YQ0A 3MMCB 3OHAA 3W2VB 2V67A 3M8ZA 3BQ0A 5DGAA 4Z7YA 1VGYA 1AXQA 3OW2R 1VQYA 3M8RA 3N6LA 1FDDA 3P8BB 4USMA 2LECA 1N56A 1X7VA 2HFOA 3TAMA 4EBEA 1PIEA 2D9PA 1EHWA 1JXVA 2JNJA 5A0YB 1WI8A 4P10A 1W7WA 1HMVA 4LBHA 3SCKE 2FY1A 1M1HA 3D54A 3QJPA 2OSQA 4BWMA 4ZN3A 3PRDA 4X84A 2PI5A 4DSIA 1FJGJ 3SFUA 3GYGA 5D0RA 2HQDA 4HLBA 1IR0A 2CQGA 2DNOA 4CLSA 1SH3A 5E3QA 1SL2A 1L3UA 4KJIA 3ISNC 1TFYA 4IH6A 3TAMB 3SMZA 4HL9A 1OY8A 3T19A 1B0PA 3OL6A 2BM0A 2YXLA 4Y2KA 1VI7A 3MMBB 3S1TA 3UI3A 4JUZA 2ZHAA 2LU2A 1CQNA 5HN0A 3M05A 4CO1A 3KK3A 1FFGB 2QN6B 5BYSA 2HHXA 3UN2A 1NSPA 2BBEA 4C8OA 4WCEQ 4FPRA 3CD7A 2IBKA 1MMNA 4FYXB 2OD4A 4P2XA 1XERA 3HDSA 3SFGA 3IRXB 1Y5IB 1FVQA 1LFPA 5D4OA 2OI2A 4J9RA 2RQKA 4MMOA 2JX2A 3PM9A 2W7OA 3ZZOA 1NJWA 2WB4A 1NBEB 1JMTA 1PJ7A 4OZ1A 2W2PP 4JI2J 2AJ4A 3PY8A 3POTB 2DYAA 2AEFA 3UD3P 4E98A 2XMMA 3MR7A 3DNCA 1RHMB 4CP5A 3KDNA 5DZ6A 3CJTA 3NBPB 4L75A 4KR0B 1BY9A 2EG2A 5HK4A 4CO2A 2BABA 5FD1A 2MGZB 3SI8A 2I2YA 4DUYF 1H6KX 1F2HA 3NL0A 4QZVB 4DV6F 1EJ7L 4E0DA 4F04B 1H73A 3QT5A 3K8VA 1OQ3A 2HFNA 2BM1A 1YBUA 3ILLA 1J5EJ 2DR6A 4NLYA 2I38A 4M5JA 3BKTA 2V5HG 3MEEA 2XSJA 3M8QA 3DLEB 4LVOP 1ZBTA 4GO7X 2NYHA 1H2VZ 2YNIB 3T1HF 3SDEB 4CDIA 1GMWA 5C7PA 3K8WA 3R8YA 2CPDA 2FJDB 4OX8A 2KZZA 3D1OA 1F9HA 4X4TA 4CLWA 1IM4A 3NKYA 1WF0A 4JI3J 4CLZA 5BJRA 3IGVA 3MI7X 2CZ9A 3I5AA 4E2FB 4I6YA 2CG8A 3T1AA 4WU2A 2XYGB 1REVB 2CDRB 4J9UE 3SZ2A 1E6VB 2KG0A 1L3VA 2O1PA 3DYAA 3PX0A 3TQ1A 2XSJB 3M8QB 4QYZJ 1CULA 3R5CA 4KSEB 3TUPA 2OLWA 1D1UA 2X1BA 2QTWA 3A1YG 4CI0B 2A1BA 4CO0A 5AE3A 5FJ4A 2Z2ZA 2BANB 2LQ8A 3EDQB 4Q45A 2CDQA 2Z57B 4DR6F 1PBUA 2HRYA 2RF2A 1TL3A 2HEKA 4O0IA 3CCTA 3VQTA 3KG4A 2RDJA 4F4YA 2BJ3A 2QX0A 3U1LA 4OZ2A 2E1MC 1KKHA 1MW7A 3DYAB 5B7WA 3P4UB 1S59A 4F4ZA 3M2UA 4LF8F 3TUJC 3AY0A 2H5JB 2G2YA 5K8PA 2L41A 3CO0P 1VBXA 3G4SS 5HQ8A 4ED8A 1Y7PA 3DLJA 2J9DE 2F4VJ 4DPXA 3DRPB 1YTYA 1HNZF 1UVJA 1ZH5A 2OFGX 2RILA 2OKQA 5IV3A 1H74A 3HHNB 2DH8A 2DPIA 4IOBA 1Q8KA 3HHKA 3OV7A 3GSDA 4M94A 1TVRB 3G86A 2VONA 2QL7B 3CNQP 2UUAJ 4ATNA
chains in the Genus database with same CATH topology
3BPDA 2X3DA 2RAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPD A;  2X3D A;  2RAQ A; 
#chains in the Genus database with same CATH topology
 4CRJ A;  4YUD A;  1RBA A;  3JTN A;  3T5K A;  1IWG A;  2ZH6 A;  3THV A;  2DKO B;  1VC6 A;  2HHH F;  2UUC J;  3M2U B;  1AW0 A;  3UVJ B;  4FF2 A;  3HVW A;  1YJN S;  1HR0 J;  9RUB A;  2VL1 A;  4ID5 A;  3IM8 A;  3D0I E;  3ETM A;  1FRJ A;  2EKY A;  2E66 A;  2O67 A;  2ZUG A;  4X66 F;  2C3M A;  2XGP A;  2KJW A;  4AT1 B;  4LRD A;  1KRP A;  1U2R A;  4G1I A;  5L46 A;  5DDP C;  1KDN A;  4LBI A;  2QA4 S;  1LWX A;  3QWP A;  2E44 A;  3TQE A;  2MY7 A;  4N56 A;  5J1P A;  3T6J A;  1SBR A;  4BDP A;  2LQ5 A;  3M8P B;  3RB3 A;  1ARO P;  3A8I A;  1RWP B;  3C16 A;  4ED0 A;  5A8R B;  3G6E S;  4DR5 F;  5LMN J;  2JWN A;  4XDD A;  1GEH A;  2NCK L;  4RWW A;  4IG0 B;  3TZY A;  3D6M B;  2KVI A;  5E5N A;  5KFF A;  2DEJ A;  1R0C B;  4QIW D;  1FE4 A;  2NSC A;  4QYZ K;  1MWY A;  1KP6 A;  1XIQ A;  3I55 S;  2Q1L A;  3MPU B;  1WHV A;  4YN3 B;  1R0A A;  4LQ9 A;  3RU0 A;  1DHM A;  5H1S V;  1URR A;  5EDW A;  1WD6 A;  3PNI A;  1FTC A;  1P1L A;  1YVF A;  4P2F A;  2HZC A;  1HBU A;  2KL8 A;  1S4E A;  2IM1 A;  2OFH X;  2K8G A;  1F9F A;  1HWL A;  2XCP A;  3RB0 A;  1LWE B;  2CQ2 A;  3NXZ A;  3KOA A;  3B82 A;  1X4D A;  3W5Y A;  3MD1 A;  2ZH7 A;  1N5Y A;  1IBM F;  4TU8 A;  5IS2 A;  4B3S F;  3M8Y A;  1VRT A;  2OPP A;  2YKN A;  5KFS A;  3LOU A;  3BF4 A;  4CZC A;  4ELU A;  4ZPA A;  2IVM A;  2KT3 A;  2WZ1 A;  2KFY A;  4DSL A;  3Q23 A;  1NJY A;  2HS4 A;  5F8H A;  2QZ8 A;  4PYA A;  4FS1 A;  2V4Q A;  3HUL A;  3C14 A;  3FMB A;  3TVZ A;  4CLL A;  3NWR A;  3EGN A;  2HVZ A;  2MZJ A;  2O5D A;  1UJ6 A;  2E5J A;  2WW8 A;  1QVG R;  2QO3 A;  2F5G A;  4K7Q A;  3ICL A;  3CCL S;  3PW5 A;  4OYW A;  3SIP B;  2ZJP Q;  1QAJ A;  1KON A;  1IN0 A;  2V8D A;  4Y2I A;  3M9M B;  4C97 A;  4A46 A;  3EGV A;  1UEK A;  3EE3 A;  2ADC A;  2HK3 A;  2GIQ A;  1WC3 A;  3K5P A;  3KYL A;  2YKN B;  5J1E B;  5DET A;  3MDF A;  4KGK A;  3TZX A;  2AEJ A;  2DGX A;  2DNZ A;  2JFD A;  3I0S A;  2LMI A;  3N4W A;  2CKW A;  2ADB A;  4O3P A;  1YJ7 A;  4F8R A;  5D0H A;  4A48 A;  3HK2 A;  3N5F A;  3A8J A;  1VC5 A;  1IBK F;  4B3M J;  4LF6 J;  1ZET A;  2JC1 A;  4OYZ A;  5HI7 A;  3I5B A;  1AA1 B;  4K8R A;  2LXI A;  3R6G B;  4ZK7 M;  2M0G B;  4OX7 A;  4M5M A;  5E2Q A;  2Z4P A;  4FPI A;  1VRU A;  1G1X A;  4I2Q B;  3CB4 A;  1NSA A;  1TKZ A;  4KKO A;  1VFJ A;  2RB7 A;  2EC2 A;  1X31 C;  3OPK A;  5ETV A;  1GXL A;  4R5P B;  3AOB A;  1CPZ A;  4DMZ A;  3H4B A;  1KOH A;  5FDL B;  4DSE A;  3AOD A;  1IBL J;  4I0W A;  1FXL A;  1N33 J;  3ZTP A;  3B6B A;  5CCM A;  4MK9 A;  3UN5 A;  2DEI A;  2CQ4 A;  1S5Z A;  2OMO A;  3DKD A;  2XNQ A;  5F41 A;  5DG9 A;  2RNE A;  3V6K A;  2CJQ A;  4Z37 A;  3DOL A;  4NE9 C;  4RUH A;  2UXD F;  1VRU B;  3D6T B;  1XTZ A;  4V1A k;  2VBZ A;  2AW0 A;  1TKZ B;  1S9E A;  2V2Q A;  3A8E A;  4NLD A;  3KLI A;  4EYI B;  3NS7 B;  4DZD A;  2JL9 A;  2L9N A;  1UL3 A;  4QIF A;  4G3I A;  1S79 A;  4QU7 A;  6FDR A;  4RUC A;  3NLC A;  1RUS A;  1U6Z A;  2G4B A;  4B3R J;  1UWB A;  2BJE A;  4NCA A;  1JLE A;  2V8P A;  2HWI A;  3NP5 A;  1BMQ B;  1K0V A;  3PO4 A;  4F0H A;  2HBQ B;  4NYO A;  4NA2 A;  1YG0 A;  3PTW A;  1U0H A;  4OHV A;  4ZVT B;  3W1Y C;  3AJ1 A;  5FII A;  3GE9 A;  4KGX B;  3I9V 9;  8RUC A;  1SUQ A;  3R7S B;  1D0E A;  1JLQ B;  1QY7 A;  3KLE A;  2ZWO A;  3WC2 A;  1S9E B;  1R6V A;  3KLI B;  2GGP A;  2VPW B;  3BEG B;  2CQD A;  4EBC A;  1DQ9 A;  3QJJ A;  5E7O B;  4I4B A;  3ENW A;  3LUY A;  1U1K A;  3CMA S;  1PBA A;  5IWA F;  4Y6I A;  4F3M A;  1LWC B;  1CQM A;  2MKC A;  4X4P A;  2QLF B;  1JLE B;  1U24 A;  3T9Z A;  3FCW A;  2WK4 A;  5A6P A;  3VQS A;  1HIY A;  2ZH9 A;  1TUV A;  1NDL A;  5HMX A;  2ACM A;  3L09 A;  3LA0 A;  2MSS A;  1U0H B;  4Q0B B;  1JXE A;  3M9O B;  3A8K A;  1VHI A;  1RCX B;  2ATC B;  3L7U A;  1LV5 A;  3HF5 A;  1K47 A;  4UUW A;  4PG6 A;  4K4Y A;  3FSY A;  3EIC A;  2E9T A;  1RYR A;  2HPU A;  3UPF A;  2GGP B;  3MEC A;  1DRZ A;  2QMU B;  3DDK A;  3KHR A;  5SUH A;  4RW7 A;  4B3O B;  1S1T B;  4L3N A;  2UP1 A;  1ZZF A;  1O8B A;  4DQQ A;  2XC9 A;  4O3R A;  3EM1 A;  1RIS A;  2J6U A;  2JEF A;  4NLT A;  1DQ8 A;  1PAE X;  4ILM A;  1IKW B;  3P5T L;  2VBW A;  1Y0H A;  4GMK A;  4D3H A;  2GW8 A;  1V3R A;  2VIC A;  2HVD A;  3A3P B;  4NCG A;  2ILY A;  3EZ5 A;  2VC1 A;  1RT5 B;  2AJ1 A;  2O3D A;  1ZOT A;  4WFY A;  3LWL A;  1VMB A;  1N5T A;  3MEC B;  4C8Y A;  1LKZ A;  2MLX A;  1REG X;  4J9V A;  2FHM A;  4TY9 A;  2XY6 A;  3KUH A;  3HVA A;  4LFC F;  1EKR A;  3MHY A;  1XEZ A;  4ED4 A;  2G1D A;  4C0B A;  1HAR A;  4J7C A;  1VBY A;  4IQX A;  2BAC A;  3FBF A;  2N3O A;  4O44 A;  1XBW A;  1T9X A;  1FE0 A;  1WDD A;  4NL5 A;  1APS A;  4X62 F;  2EEY A;  1GXU A;  4FXV A;  4LSZ B;  2W7P A;  3UN3 A;  2C2M B;  2JH3 A;  2BW2 A;  2KRB A;  3GII A;  4HAC A;  3Q89 A;  1M5K C;  1HBM A;  3HKZ D;  5KG5 A;  4M5I A;  1UKU A;  1RT2 B;  4RX6 A;  5KG0 A;  2IM0 A;  4ECQ A;  3QRP A;  3G6V A;  5THW A;  1RSC A;  1FJ7 A;  1KOO A;  2ZBQ A;  3ILI A;  3S01 A;  3M2R A;  2OO4 A;  4IUF A;  4QIV A;  5EX3 A;  3CCW A;  3M7V A;  4Q43 A;  3HHL A;  3OT9 A;  5IFM A;  1Q86 T;  4MKV A;  1TL1 A;  2J8S A;  2QV6 A;  3OJU A;  2FLP A;  3AXM A;  3O6Q A;  4AXJ A;  3CJ2 A;  4IR1 A;  4ETX A;  4OL8 A;  4X65 F;  4K0K F;  3BYP A;  2HG4 A;  1B0V A;  1SC1 B;  4CH1 A;  3NAH A;  3TUI C;  1HQU A;  1HBM B;  3LAK A;  3QGP A;  3D3C J;  4L72 B;  3JAM Y;  2V94 A;  2IC3 B;  3G6X A;  1PGZ A;  1OY9 A;  5DO2 A;  1HD1 A;  1RWW B;  4P52 A;  1MU2 B;  1YI2 S;  4WP8 A;  5C2C A;  1UAW A;  2ZEJ A;  3ZO7 A;  4DV4 J;  2PEB A;  1RWK B;  4PXC A;  1EX8 A;  3NOG A;  3HVR A;  1RLD A;  4O4R A;  3QT8 A;  2Y3Y A;  1TL1 B;  3G8S A;  1KVK A;  1WKL A;  2QL5 B;  3M1V A;  4ZVO B;  4JBC A;  1N32 J;  2Z8Q A;  4FKX A;  1T05 A;  3MOZ A;  2ASL A;  2VPY B;  5HAO A;  2HRT A;  3WC0 A;  2ZFH A;  1WI6 A;  3I4P A;  1NND A;  3BH7 B;  4K4X A;  2AGP A;  2BE2 B;  1RT6 A;  4C8K A;  1RLC L;  3CCZ A;  1UP1 A;  4OYX A;  1QVF R;  4RR5 A;  3CD6 S;  2BJ9 A;  3WIV A;  1TKD A;  4J9S A;  3H5S A;  3ILJ A;  1K8A T;  4P6Q A;  2DR5 A;  2BX6 A;  3LAL A;  1HWU A;  4CT8 A;  3GZ7 A;  3MCO A;  4DV0 J;  2A10 A;  2D3U A;  2F1F A;  1S10 A;  3IS9 A;  5ETQ A;  3DHX A;  1P9Y A;  2HFU A;  4A8Q A;  3M1V B;  5K9F A;  4DV3 F;  2J7K A;  1T05 B;  3UW1 A;  2NRE A;  3UNY A;  4F02 A;  1WG4 A;  4QPX A;  1SH0 A;  5F9N A;  1RT6 B;  2ZJR Q;  1R8P A;  5K5M A;  1F1B B;  2ZC4 A;  2XS7 A;  1BWV A;  4NLQ A;  4TU7 A;  3MPW A;  1WEZ A;  1JLA B;  1S7H A;  3SCJ E;  3Q8R B;  2UXC J;  1SJF A;  1FRK A;  4FDF A;  2K2P A;  3NNH A;  5GVQ A;  3MR6 A;  3V81 A;  2V34 A;  2FLO A;  4DPT A;  2OEJ A;  2Y0S D;  4U8V A;  4LR9 A;  3BRE A;  4ELT A;  2AGO A;  1CJU A;  2AMC B;  1TL7 A;  3GFY A;  4JI7 J;  1NDK A;  1V5V A;  5JVH Q;  1B4S A;  1KSP A;  3DN9 A;  4RPF A;  1Q1K A;  2CJB A;  1DTT A;  3P6Y C;  2ZH5 A;  2LEP A;  3KDO A;  4FN5 A;  2FGC A;  3DLG A;  3HP6 A;  2B9E A;  4X4Q A;  3QFH A;  3MR2 A;  2VG5 A;  4B9N A;  4NXM J;  2VFU A;  3VV2 B;  5KG2 A;  1HNW J;  2HSE B;  1PJ5 A;  2YQ3 A;  3UE2 A;  4CLF A;  3M6U A;  2FVC A;  2DXE A;  1MLA A;  1WSR A;  5EX0 A;  4C7Q A;  2J76 E;  2IDL A;  3V81 B;  3JQK A;  2IRU A;  4ES1 A;  1X9M A;  3JQJ A;  3DRR A;  2PA8 D;  1XR6 A;  3EX7 B;  1Y11 A;  2NR0 A;  4DN9 A;  4GKJ F;  1CJU B;  1FEH A;  1NLK L;  3OR1 A;  3ZTO A;  2DGU A;  1JJC B;  1S6O A;  4LF9 J;  4JYA F;  2QMW A;  1DTT B;  5KFH A;  2K06 A;  4DQP A;  2BQ3 A;  1YGY A;  2FJA B;  4ECU A;  4C3K A;  1RT1 A;  1RJJ A;  2AHO B;  4IKA A;  5ETN A;  2ZHO A;  2YKO A;  4K4V A;  4WFB Q;  2CJY B;  5E33 A;  3W8P A;  2E9Z A;  1Q5Y A;  2CPE A;  3JTO A;  1NKE A;  2W9C A;  4U7C A;  4ZCL A;  3D9B A;  3HVT A;  4Q2L A;  2P9E A;  3AT1 B;  1SKR A;  5LOQ A;  2IM2 A;  3TZZ A;  3CD5 A;  4YB6 A;  2BRL A;  4M5N A;  2ZM6 F;  4DQS A;  2J7W A;  2EFG A;  3WZ0 A;  3QAE A;  4TYA A;  1HHT P;  1ZTW A;  3OR1 B;  1SXL A;  4EEY A;  4Z7C A;  2H65 B;  2W8K A;  2C2N A;  3M6X A;  2MLZ A;  1H72 C;  1QLN A;  4UQG A;  1FT8 A;  1X5S A;  3TO8 A;  5KAK A;  4LUB A;  2PII A;  4YB1 P;  2EFO A;  1UVL A;  5CD4 H;  4NA3 A;  2C2D A;  3CIZ A;  4PQU B;  1RT1 B;  4KTQ A;  2XB2 D;  4RNF A;  1DTQ A;  1CC8 A;  4QIG A;  2YWE A;  2BRK A;  4CLT A;  1MG7 A;  3FRZ A;  4FVM A;  2W9C B;  1RKI A;  5D15 A;  3HVT B;  2CQH A;  1WF2 A;  5C2G A;  4ZVU B;  4Q7A A;  1YZ7 A;  2FHO B;  2MQO A;  3CC4 S;  4USJ C;  1U1P A;  3FBE A;  1VJQ A;  2W9B B;  2MEW A;  3F56 A;  3DU5 A;  3SCI E;  1SC4 B;  2Q66 A;  3SSS A;  3R5A A;  2HS3 A;  1S1V A;  2VBX A;  3GV7 B;  5IQQ A;  3OUY A;  3CF5 Q;  3BR9 A;  3TVK A;  4DQR A;  4RW6 B;  4DOZ A;  3CJR A;  1R6Y A;  1R3N A;  3NGU A;  4NXN J;  1ZAW A;  4O3S A;  2F9D A;  1NJI T;  2NYI A;  3RBD A;  1I94 J;  2VJU A;  3OD2 A;  4ICL B;  4OFZ A;  3IAM 9;  2GVD B;  2WCX A;  2XM3 A;  1U1L A;  1S6U A;  2EVZ A;  2VQE F;  2QC3 A;  2CA9 A;  4IYQ A;  1WEY A;  4BC9 A;  1N0V C;  1JX4 A;  1KHV A;  2AKW B;  1XNQ J;  2DNH A;  2QYG A;  3AA8 A;  4F36 A;  3MPY A;  4JV1 A;  3MAQ A;  2XUL A;  3S8S A;  5AXM A;  3T6B A;  2MZ1 A;  4WE1 B;  3OUY B;  5J2Q A;  2PMZ D;  2LA6 A;  4FNI A;  3A12 A;  1PIL A;  1TV6 B;  2K1R A;  5A8K A;  2R2U A;  5KFY A;  1FRI A;  3D0G E;  1S6P B;  4DR7 J;  1YKW A;  1X4B A;  5K14 B;  4PYD A;  1AB8 A;  3ZXW A;  4C11 A;  3HHL C;  4N76 A;  3QRQ A;  1I3O B;  4Y28 C;  2IDE A;  3MZI A;  4WZM A;  2J9D A;  4DV1 F;  4Y00 A;  2JEJ A;  1M1K T;  3IFE A;  1AT1 B;  5I3Q A;  1NDP A;  2RU3 A;  1R7I A;  1U0S A;  4QIE A;  3JSR A;  2G0I A;  2HWH A;  3E01 B;  5HVH A;  3RW6 A;  2HHU A;  2YWF A;  3VAL A;  4BS2 A;  4PUO A;  3H8Y A;  1TK5 A;  4OHX A;  5BYQ A;  4DX5 A;  2K1R B;  3VAK A;  3A4T A;  5A76 A;  3J7Y U;  4XO0 A;  1WEL A;  4C11 B;  1HWK A;  1CBK A;  1YQH A;  4I64 A;  4EI2 A;  4TY8 A;  3L9Z A;  4NA1 A;  1OPI A;  2ZZT A;  1OS5 A;  3K5N A;  4U8Y A;  1T03 B;  4K4Z A;  2B5J A;  2HZV A;  1IBL F;  4ZN1 A;  5KOX A;  2PDA A;  1N33 F;  2R3V A;  1TKT A;  4WXO A;  2BA9 A;  3VAG A;  5JJB A;  4KE5 A;  2QA1 A;  4P75 A;  1SQG A;  3KK1 A;  1NKB A;  3GWC A;  4YDX A;  2VOO A;  3QAT A;  1RWX B;  1Z1Z A;  5BXI A;  2GML A;  2NXC A;  1B7Y B;  1LW2 B;  3GYX B;  2Q79 A;  3RBX A;  5E41 A;  1O5J A;  4ED3 A;  1GTH A;  1N34 F;  2JC0 A;  1RAC B;  3RG6 A;  3BH6 B;  4TY8 B;  3N28 A;  1UTA A;  3JYT A;  1M1G A;  3K5O A;  1X0F A;  1YJV A;  4CM0 A;  6FD1 A;  4CM2 A;  2C2K B;  3AOA A;  3KXD A;  3BO4 A;  4DV2 J;  1J5O A;  1C1C A;  1XR5 A;  3H42 A;  4GC6 A;  2HHW A;  4O4G A;  3J80 Y;  1FDN A;  1IQT A;  2IFX A;  4KFB A;  3C6U B;  1H2U X;  3M6W A;  3NGD A;  2IRX A;  1RHR B;  1VQL S;  2MB0 B;  3W9H A;  2UXB F;  2A0F B;  4JB8 B;  4DV5 J;  1QUV A;  3OHB A;  5HLF A;  1WOP A;  2HFV A;  5DS7 A;  1X4A A;  3JYT B;  2CQ0 A;  5D0G A;  2BVZ A;  4KHM A;  4RNN A;  2ASY A;  1FES A;  3PRB A;  3UWT A;  2JSX A;  2VFT A;  3K57 A;  2GV1 A;  2AEM A;  2HFS A;  4GO5 X;  4N5S A;  4KV8 A;  3BDP A;  1UJ4 A;  2EPI A;  3OBI A;  1CJV A;  3DDI A;  1EZZ B;  3TEG A;  4LF4 F;  2FY8 A;  2GMJ A;  2E5G A;  2U2F A;  5E3R A;  1Q16 B;  3LO3 A;  4EZ6 A;  2WOM A;  2A2D A;  2VC0 A;  2HQF A;  1JKH A;  2YPY A;  2YWG A;  3Q8Q B;  2ZDO A;  1JJ2 R;  3BKU A;  2DNK A;  4N77 A;  5IV4 A;  3KLG A;  4X64 J;  3W8G A;  4P74 A;  1JLG B;  1KQS R;  1F0X A;  3ADA C;  2B8P A;  1CJV B;  4RZR A;  3BYR A;  1NHV A;  5D4N A;  4DQI A;  3SYZ A;  2Z2L A;  4PR6 A;  3HPO A;  4DF8 A;  1X60 A;  3EPI A;  1CJK B;  3OL9 A;  2UVR A;  2FJE B;  3OQ2 A;  1X4F A;  1J2V A;  2ZBP A;  2YQ1 A;  5KFN A;  2WOM B;  4IH5 A;  1B70 B;  3KMQ A;  3R5B A;  4RBU A;  4U6P A;  1W2B R;  2DK2 A;  4DR1 F;  1KTQ A;  4C48 A;  2R8K A;  2HGN A;  3HT3 A;  3D6H B;  2DO4 A;  5ETK A;  4S0M A;  2KG1 A;  3D67 A;  1FRH A;  2J9C A;  3IR5 B;  2QIF A;  3FFI A;  2PT0 A;  2FGO A;  4JI1 J;  1N88 A;  4OZJ A;  4J9K A;  5C24 B;  2GQQ A;  5KT6 A;  2HMI A;  2WON B;  2ZKU A;  1GMU A;  4I69 A;  2XY7 A;  3KJN B;  1K9M T;  4PXB A;  2KZM A;  4JV2 A;  4L3K A;  3OSN A;  5CYQ B;  4ZP8 A;  2DJW A;  4DSK A;  5HL7 Q;  4ZJO A;  4LFA F;  1YJU A;  2IA6 A;  3IWN C;  4OYO A;  5I42 A;  2A18 A;  4WP9 A;  3TNV A;  4I2P A;  4CLK A;  3R7N B;  2DHA A;  2E29 A;  2COL A;  1SIZ A;  3W64 A;  2W4P A;  4MK7 A;  1TUG B;  5BR8 F;  5LMU J;  3RTV A;  2UUT A;  2OGU A;  3DLL Q;  4AL5 A;  2H4Y B;  4IRC A;  2C2R A;  3MWB A;  2FJW A;  1RWM B;  1JLC A;  4C0H A;  4RBV A;  5DDO C;  1KQF B;  3MAA B;  2XMU A;  3T41 A;  4QW8 A;  9ATC B;  3TVY A;  1XNR J;  2HMI B;  4OI2 A;  2F3J A;  1EQM A;  2E9R X;  3DGP A;  1UPP A;  4NZ7 A;  1IR1 A;  1RZM A;  4XK8 C;  2DRA A;  1S0M A;  2JLG A;  4LF5 J;  4DL0 C;  5I42 B;  1N48 A;  1NK5 A;  1TL4 A;  2Y1J A;  3V4I B;  3QIP B;  4R8U A;  4PWW A;  4EMD A;  5E3P A;  5L1L A;  4ZVF A;  3QLH A;  2FVQ A;  2MQP A;  1JLC B;  1X9W A;  1TEL A;  5T7L B;  3G87 A;  1RT7 A;  2BJ8 A;  1H38 A;  3ZNU A;  2F8E X;  3ITH A;  5L39 A;  2ZHB A;  2BKN A;  4TYB A;  4USI A;  3M32 A;  1RTD A;  4RLE A;  1RT4 A;  1BUX A;  2CQ3 A;  3OTO F;  5KFI A;  1RAO A;  1Q79 A;  4ZPT R;  2DXD A;  5GAE U;  4JI4 F;  4RW9 A;  4FBU A;  2R4F A;  4R8U B;  1FRM A;  3VF0 B;  4F4X A;  2MQN A;  3FBC A;  4WK1 A;  3DC2 A;  3K2Y A;  4D3G A;  1L5U A;  3OFH A;  1U2C A;  3MPV A;  1T9Y A;  1RT7 B;  4ES3 A;  3R6L B;  2UVU A;  1G4C A;  1NM2 A;  1DZ5 A;  3NOC A;  3DLH A;  3ITH B;  2VHG A;  3MED A;  1V3Z A;  2HLU A;  1RT4 B;  3IM9 A;  3RRG A;  2HND A;  2F4F A;  1RYS A;  2RRB A;  2JZ5 A;  3CO9 A;  2XMW A;  4YFU A;  2BXJ A;  3DLK A;  3BQ1 A;  4ZVR B;  2XY5 A;  1KEK A;  3HHD A;  4I7F A;  4B9T A;  4A8W A;  5KG7 A;  2OPR A;  4KRW A;  2QMX A;  1EP4 A;  3GIK A;  2WSF C;  3UDC A;  5IC6 B;  2OIH A;  4ZPB A;  2OHD A;  1QSY A;  4DL3 A;  3FSI A;  3A3O B;  2H5E A;  2XMK A;  5KT2 A;  1TK0 A;  3TW0 A;  4DXL A;  4PWU A;  2HGL A;  2W8L A;  1IVZ A;  2HND B;  3THP A;  1N52 B;  2BOA A;  2C3Y A;  1WJ9 A;  2YWW A;  3B54 A;  2VA2 A;  1QSL A;  1BWE A;  3KLF A;  3VTI A;  1HI8 A;  3OR2 A;  3I9Z A;  5F8L A;  1IJF B;  1GK8 A;  3OJS A;  4F26 A;  2AGQ A;  3KHH A;  1KQK A;  3CJ0 A;  5IOL A;  2WVD A;  5KFL A;  1U4B A;  4NZ0 A;  2IHR 1;  1RU1 A;  2HHP A;  4M5K A;  5LL6 d;  3O44 A;  2LCW A;  3MR3 A;  2BV3 A;  2C2O B;  4ZCI A;  1Z2L A;  4UOG A;  3PW0 A;  1KVI A;  2OUG A;  1UMJ A;  3KMS A;  5E3A A;  4A8F A;  2XCA A;  2GC8 A;  4RUA A;  2GIF A;  2CUY A;  1T9V A;  1VC0 A;  1RP5 A;  2ZOG A;  2OPQ A;  3KLF B;  3CGI A;  4F3Q A;  3OR2 B;  4X4R A;  2L9D A;  3IP0 A;  5F8M A;  5J2M A;  3TA1 A;  4DR2 J;  1IBC B;  1Y00 A;  2K7K A;  2G13 A;  3MEK A;  2QSF A;  3FCV A;  1RHJ B;  3NG8 A;  3CCJ S;  4RW8 B;  4ZP7 A;  3R5G A;  2M88 A;  4F4W A;  2JOQ A;  1TKX B;  4FF3 A;  5H9E J;  4F25 A;  4DUZ J;  1WSV A;  1HYS A;  1NB7 A;  1O6X A;  2YKP A;  1NO8 A;  4LF7 F;  5IM0 A;  3TYT A;  3V5R A;  2Y9H A;  3BGR A;  3AD8 C;  3GR0 A;  3HXM A;  4DV7 J;  2HUR A;  1SKU B;  2MJU A;  1WOS A;  2KTQ A;  3P45 B;  2DNG A;  3DOM B;  3BPS P;  2G2O A;  2E5I A;  2NSB A;  5EN1 A;  1ROF A;  1TAU A;  3VWS A;  2CVI A;  4F0K A;  1VQ5 S;  5J2M B;  3LGM A;  2IIH A;  2M2B A;  5CYM A;  2HYI B;  3WQP A;  2Q3P A;  5L9N A;  1RA7 A;  4Q2M A;  1OWX A;  1M5O C;  4ZHR B;  3LW5 C;  2A6O A;  1XMO F;  3UDL A;  3QMQ A;  2LXF A;  2XS2 A;  2DXF A;  3CSK A;  1NDC A;  4IR9 A;  2DHG A;  1NEE A;  2N4C A;  3J81 U;  2C2Z B;  2EC0 A;  5DM6 Q;  5DLF A;  3PHT A;  3T1Y J;  1LNQ A;  2XZW A;  3PW4 A;  4OX9 J;  2YKA A;  2XMA A;  4A8K A;  2MZT A;  2DHS A;  2OJ3 A;  1PCA A;  1UA1 A;  1TUW A;  1S12 A;  5MAO A;  1I6J A;  4TN2 A;  1XMQ F;  1S9G A;  1N36 J;  3SSQ A;  8ATC B;  2NZ4 A;  4YDD B;  4GVB A;  4AQY F;  2QFJ A;  2RUS A;  2KFZ A;  3CED A;  2GHW A;  3NEK A;  4P71 A;  3OTB A;  1YZ6 A;  1GT8 A;  1NK8 A;  2EK1 A;  1WOR A;  4DEZ A;  3QRR A;  2PN6 A;  2DBB A;  2CQ1 A;  5HJY A;  1M5P C;  4HH0 A;  2FZK B;  2C28 A;  1OPZ A;  2POK A;  4MFB B;  1Y10 A;  3UCU P;  4L73 A;  4GKK J;  4TQS A;  3RB4 A;  4QR1 A;  2IVF B;  5LSL A;  3AD9 C;  3VGU A;  2MDA A;  1HHQ A;  1R8A A;  2FVS A;  1FFW B;  3GSI A;  3TJ9 A;  1PAU B;  4NI2 B;  2R7R A;  5AJ3 J;  4B9V A;  4UY8 5;  3PYE A;  1XN9 A;  3LPY A;  4G1Q A;  3V6J A;  4NLS A;  4OI1 A;  4MYT A;  2VD3 A;  2RVJ A;  5B0B A;  3W60 A;  2HNY A;  4X4V A;  2KHD A;  2R8I A;  3OFF A;  3SQO P;  2KXH A;  2OEL A;  2VG6 B;  1OYE A;  4XTT A;  1RQ0 A;  5ETO A;  4CTA A;  5KOW A;  4C8L A;  1R0B G;  2A2C A;  1UFW A;  3JTP A;  4N7T A;  5C42 A;  2AT1 B;  3CC7 S;  1Y5L B;  1QTN B;  4UUX A;  1U47 A;  5KT7 A;  2RQC A;  3BKF A;  2WVC A;  3W9I A;  4N41 A;  1S77 D;  3MOJ B;  1NAQ A;  2AX1 A;  4AYB D;  3AXK A;  3NMA A;  1HQE A;  2Y8Y A;  2B3T B;  3HJV A;  3BJY A;  4JI8 J;  3EGW B;  2AYB A;  5H9E K;  4LT6 A;  2HQC A;  2DNN A;  4DSJ A;  2HNY B;  5B0G A;  4DJB A;  4JI6 J;  1ULR A;  3KK2 A;  1S1U A;  7FD1 A;  5EGY A;  3R2D J;  1YDL A;  5J2P B;  2Z56 B;  2M7S A;  1QJH A;  4JI0 F;  4U96 A;  5DGB A;  3D4J A;  1JLB A;  2P5V A;  1TQL A;  3AB2 B;  4ALZ A;  2YVS A;  4A8X A;  1NK4 A;  1IUJ A;  1QAX A;  3RRH A;  4CLY A;  4IG3 A;  1T0T V;  1NZ8 A;  2D1C A;  3QQC D;  3PKM A;  3L4B C;  2H4W B;  1RAG B;  3HFK A;  2UU9 F;  1HQE B;  3SQG A;  5GAD U;  3K59 A;  1RAJ A;  2J7U A;  2HAI A;  1FD8 A;  2ZC3 A;  1T9W A;  1X4C A;  1FK9 A;  3PIP Q;  3GJQ B;  2VU5 A;  3FEY B;  4K2J A;  4MT1 A;  1Q7L B;  3PJ9 A;  1Y3K A;  4GVL A;  1N8R T;  1HMV B;  3GFZ A;  4Y34 A;  3LP2 A;  5M2P A;  1N6Q A;  1JLB B;  2Q43 A;  1TMM A;  2VOP A;  3W66 A;  2R2R A;  5AXL A;  5IT9 Y;  4IG3 B;  3GYN A;  2CZV C;  5F8N A;  5GMK a;  5GAG I;  2V0N A;  1JXL A;  1Q82 T;  4U7U D;  1C2P A;  2VKR A;  1HW9 A;  1GTE A;  3IGN A;  4PAB A;  2EWH A;  4ID8 A;  1T9T A;  2BJ7 A;  3MUV P;  2CVE A;  3SQG B;  4DDF A;  3PDN A;  1GMW D;  3KHG A;  2R2T A;  2DIV A;  2MTL A;  1S7I A;  2DIS A;  2DH9 A;  2XMV A;  4YR0 A;  1FK9 B;  4CH0 S;  2OEM A;  4PXE A;  1RB0 A;  1NK9 A;  3N01 A;  2BR0 A;  1YLX A;  2W4D A;  1I5O B;  3LP2 B;  1IKV A;  3QYY A;  2C3P A;  4L6V 3;  2KFN A;  4URQ U;  3MTJ A;  2DVI A;  2OML A;  2E5L F;  2OAU A;  2FHJ A;  3TX8 A;  3V4M A;  3GMG A;  2PMW A;  3KK3 B;  4H4O A;  4DCJ B;  3MCN A;  3JSM A;  5AE2 A;  1YJR A;  2AX0 A;  4DCO B;  4DU7 A;  3JAM U;  2YY3 A;  3M8W A;  3W2W A;  2CNN B;  1PYT A;  3AQP A;  3RW7 A;  4ANE A;  4ECT A;  3ULH A;  4NWB A;  1ZM9 A;  2E1A A;  4EYH B;  5H9F K;  3GLJ A;  1YSJ A;  2M5Y A;  3TZW A;  4IO9 Q;  4KO0 A;  3BN4 A;  1U1R A;  2QA4 G;  1RHK B;  3F41 A;  3IA0 A;  1X9S A;  2ZKT A;  4YY3 F;  2GJF A;  2WSC C;  2KRR A;  2ZD1 A;  4IDK A;  2RQM A;  3AHP A;  3JSM B;  1WC6 A;  1GAO A;  2WHO A;  5M2U A;  5CD4 A;  2FLN A;  4CH7 A;  3W2W B;  5KFO A;  4OLO A;  4ZA1 A;  2Z2M A;  3TAP A;  1PYS B;  5B0C A;  2DNL A;  2ZH4 A;  1KR4 A;  4OHY A;  4UY8 T;  5KFA A;  4KO0 B;  4HI1 A;  2DGV A;  1SQF A;  4HHH A;  1UET A;  4DS4 A;  4IFV A;  2B7B B;  4OYA A;  2B51 A;  3BGF A;  1KLM A;  4ZVS B;  5IC4 B;  5C25 A;  4OZN A;  5HP1 A;  3O1L A;  4FVC A;  3MEE B;  1B64 A;  2VG7 A;  4PKD B;  1RTH A;  2XS5 A;  3WIU A;  3TOQ A;  3EDR B;  5L8R C;  2DR8 A;  3HZG A;  1UZD A;  4DPW A;  2KHC A;  2OTL S;  4DV6 J;  2RD5 C;  4AFF A;  2W1B A;  3BDE A;  2IMW P;  2I8E A;  2QT7 A;  4H4M A;  4ZLP A;  4ELV A;  1V5I B;  2Z30 B;  2R8G A;  2CQI A;  4EO8 A;  4PWD A;  1VOM A;  5DQG A;  3QWU A;  1RTI A;  4KB7 A;  5DQI A;  4XIU A;  4KHP F;  3T1H J;  1B0T A;  5HO4 A;  2P8I A;  4MIB A;  3KNA A;  2LFV A;  2HWT A;  2MST A;  1RAF B;  3CCQ S;  3NAI A;  5C25 B;  1IWA A;  2GFF A;  2VG7 B;  3O2I A;  1NRK A;  5ITH A;  4M8L A;  1CUL B;  1ZM4 A;  4MIA A;  4PEO A;  1TTH B;  2W2Q P;  4OJ3 A;  4DFK A;  3K89 A;  1F2G A;  5EWG A;  1NJX A;  4DR3 F;  1MSW D;  1KN6 A;  3BO3 A;  2RAQ A;  2L48 A;  5A2Q Y;  1M0S A;  1KVJ A;  2RF2 B;  1TL3 B;  1RHQ B;  1NSQ A;  3MFH A;  1AUD A;  1HNI A;  4FYV B;  4W90 B;  3C2P A;  1ZYQ A;  3QT7 A;  2KT2 A;  4LBP A;  2D9O A;  3I56 S;  2VJV A;  4Q8E A;  2JJ4 D;  3L3C A;  3UDV A;  1FI4 A;  4DL6 A;  4DR6 J;  1VJW A;  1ELO A;  2IA0 A;  3G2X A;  3T5H A;  2PFF B;  4DX6 A;  3PV8 A;  2HIY A;  2BQR A;  2LQJ A;  2XQC A;  2Y1I A;  1KS2 A;  3BGO P;  3CCR S;  1HBO A;  3ENQ A;  4KH1 B;  4KPY A;  3QZ7 A;  1U26 A;  2Y1L B;  5K8M A;  3FVY A;  4LF8 J;  1FTR A;  1CEZ A;  2KKH A;  3NNA A;  3RGI A;  3MMA A;  3UQS A;  4X4N A;  1ICE B;  1UA0 A;  2PI4 A;  4DR4 F;  3CJ5 A;  3HD1 A;  1HNZ J;  4RO0 A;  4RNM A;  1TAQ A;  3CTR A;  4USU A;  3AJD A;  5B0D A;  1E6Y A;  1LOU A;  1S4F A;  1V9O A;  3C15 A;  2ZH2 A;  4DX8 H;  4ID5 B;  4J91 A;  1U8W A;  5A8W A;  5LJ3 Y;  2W9A A;  1Q78 A;  1P6T A;  4Y2M A;  4CNZ A;  3TX0 A;  3DM2 A;  4OJH A;  2DR9 A;  2HNZ A;  2HHH J;  1Q5V A;  2M3D A;  5D3G A;  2Y1R I;  1S72 S;  4LFB F;  1FEE A;  2PSZ A;  2W25 A;  1LK5 A;  3W62 A;  5ETR A;  1PO6 A;  3W5Z A;  1ITP A;  1KHW A;  1T94 A;  4Y0F A;  4QBU A;  4HTJ A;  4G1P A;  1OYD A;  4X66 J;  1FKP A;  5L1J A;  2YNG A;  2JVR A;  4I1T A;  1UVN A;  3CCU S;  2XG8 A;  3C16 B;  2XSF A;  2ATL A;  2G0C A;  1TU0 B;  4UOC A;  4F7V A;  2VIH A;  4NPO A;  1SKS A;  3ZZP A;  1FRL A;  4H54 A;  1UCN A;  2GQ2 A;  3PJW A;  1VLO A;  2VUG A;  2B4O A;  3H2V E;  2FHK A;  1NH8 A;  2C2E A;  4WF9 Q;  3BS9 A;  4DR5 J;  2XMJ A;  4PZV A;  1R0A B;  1MRO A;  1VQP S;  4QR2 A;  4WYW A;  4LRF A;  1X4E A;  1SCJ B;  3ETO A;  1HBU B;  3MAH A;  2QSW A;  2JLE A;  3ZZU A;  2B56 A;  2X51 A;  4MKA A;  3FZ2 A;  2YNF A;  3MUR P;  1SJ4 P;  3V6D A;  2FC9 A;  2CAD A;  3ET6 A;  1N5Y B;  8AT1 B;  4C8M A;  3EZU A;  4WU3 A;  3I0R A;  2ASJ A;  3VGT A;  2HQ3 A;  1JQG A;  1VRT B;  2OPP B;  4CIO A;  1Q8B A;  4WPA A;  4PXD A;  1FXD A;  4DPO A;  2WTF A;  4NLX A;  2CZ4 A;  4RBT A;  1NJZ A;  4JV5 F;  3ZZY A;  3EYZ A;  2CWK A;  1MRO B;  1MWQ A;  1RGV A;  4PAA A;  4EFA C;  3C14 B;  3NCP A;  2RSQ A;  1UVK A;  1S99 A;  1VQM S;  4IH7 A;  3NGR A;  4B3S J;  3HD2 A;  4J37 A;  1GXT A;  4IO1 A;  4NEZ A;  2DPJ A;  4CYU A;  1DQA A;  5KFW A;  4CO3 A;  2HKE A;  3G9C A;  4BC7 A;  5F8I A;  2YNF B;  2XYH B;  2R42 A;  2NQP A;  4ECR A;  3MCM A;  3PFE A;  4RUB A;  2F40 A;  3KFW X;  3PJX A;  3W63 A;  3J7Z 5;  3JS9 A;  1T02 A;  3HSJ A;  4K4U A;  1VK3 A;  4P2M A;  1FD2 A;  3NGS A;  4QW9 A;  5BYR A;  1VQS A;  3BGL A;  3M8S A;  4J9M A;  2ZVS A;  3HSZ A;  1FCA A;  2LU1 A;  1ZAX A;  2YX4 A;  1GQE A;  2KDO A;  2AQ4 A;  2XBP A;  3BN7 A;  5L9X A;  3I0S B;  2MQL A;  1CC7 A;  1P1T A;  2B8Q A;  4BWJ A;  2YPZ A;  5IT4 A;  3O8W A;  5KFK A;  3U02 A;  2V8G A;  4JI5 F;  1HWJ A;  4HHU A;  3OTD A;  1ACM B;  1GNK A;  1JNZ B;  1BQN A;  2HZA A;  3NGT A;  2I5J A;  4NLU A;  5HMY A;  2CXE A;  4CT9 A;  4DWI A;  4YHH F;  3GIR A;  2NXE A;  2YTC A;  4B3T F;  1IBK J;  2DGO A;  5C5J A;  3KG0 A;  4KKO B;  4DL5 A;  5K8N A;  4OX6 A;  2KM8 C;  1R8C A;  3LP1 A;  3FUY A;  3J80 U;  5J2N A;  2A6M A;  1HNX F;  4KYZ A;  2MKH A;  4RU9 A;  1D8Y A;  5GAH I;  1ZM2 A;  4WFN Q;  4DL7 A;  2C22 A;  3PYD A;  4KGZ B;  3TUZ C;  3PW7 A;  2HRU A;  2H51 B;  4LIR A;  4C2M A;  3DXS X;  1HWI A;  3Q86 A;  3FSX A;  2O66 A;  4HYK A;  3N6N A;  3W61 A;  4U7U K;  4DF4 A;  5KT5 A;  2GNK A;  2LQ9 A;  3DOL B;  2XWY A;  3IG1 A;  4ITS A;  3GFX A;  3HKW A;  3AOC A;  1H2T Z;  3IBF B;  3C19 A;  2V8H A;  4NLR A;  1FWK A;  2M70 A;  3OL7 A;  1BQM A;  4LQ3 A;  1X4H A;  2CQC A;  2IRY A;  1EB0 A;  3W9J A;  5J2N B;  2QJ3 A;  1R31 A;  5I3U A;  2HGM A;  2R8J A;  5AXN A;  3FQL A;  5CXT A;  4NX9 A;  1UWB B;  2LVW A;  1YWX A;  2KXF A;  5D6G A;  1UPM B;  4C0O C;  1SJQ A;  1HA1 A;  3QNW B;  3M2V A;  4CLP A;  4WKY A;  2J0Q D;  3UDE A;  4JI8 F;  1BGX T;  1NHU A;  4CWB A;  4F2R A;  5D4L A;  2JEG A;  1ZA1 B;  3DFE A;  3TAR A;  1SUQ B;  1JJ4 A;  3GR1 A;  2AJF E;  1QE1 A;  4WIQ A;  3KLE B;  3W2V A;  3G82 A;  3M6V A;  3NNC A;  4P9S A;  4NCB A;  2VV5 A;  4WYL A;  4K4W A;  4YR2 A;  1K0T A;  2E1P A;  4YME A;  2R7V A;  3I87 A;  4OMF G;  1YK9 A;  1SL1 A;  2V9W A;  2O01 C;  4ECZ A;  3UD5 A;  5A0Y A;  3BSA A;  1FJG F;  2MLY A;  3M2V B;  2KU7 A;  1UVM A;  4ZCM A;  1WNE A;  3N6M A;  3C3L A;  4ENO A;  1Q8I A;  2H9Z A;  2MKI A;  3G8T A;  1FDB A;  3FCH A;  4W92 B;  2HHQ A;  3KLV A;  3R3T A;  5KFJ A;  1QE1 B;  5IQ6 A;  3R1L A;  5CAB A;  2J9E A;  2DH7 A;  3G82 B;  4QCL A;  3BR8 A;  1R8B A;  4RW7 B;  1CG2 A;  2GHP A;  4MIW A;  1HI0 P;  3EPG A;  5KFM A;  2L3M A;  1VYA A;  3V2U C;  2QGF B;  4RNO A;  3MM5 A;  5KFD A;  2CQB A;  4EK2 A;  5HQL A;  1BE4 A;  5JXS A;  3MMB A;  2K7J A;  3NRB A;  5LJ5 Y;  2GVZ A;  1FFS B;  1I1G A;  4NCG B;  4KQZ A;  4ZVE A;  4ZPD A;  3U1N A;  3OSP A;  5KFR A;  3WHI A;  4HI2 A;  3DU6 A;  4W98 A;  1KBR A;  2CJ9 A;  4KPC A;  4KH0 B;  2DCU B;  2UV8 A;  3J7Z T;  2Q6B A;  1RAH B;  3FEZ A;  3TJA A;  2FTR A;  2GO9 A;  4UOH A;  4JI2 F;  4ZJL A;  3SEO A;  2AF6 A;  3CDW A;  4O44 B;  4PG8 A;  4NML A;  4FXD A;  4QWD A;  3R97 A;  2I9S A;  1VK8 A;  3IRX A;  3OXL A;  3B4M A;  4XDC A;  3JSB A;  4OJ1 A;  3MM5 B;  2Z58 B;  3DRX A;  1M5S A;  4HAC B;  4KBI A;  3ZZZ A;  4LFC J;  4I67 A;  4O3O A;  1Q4R A;  3GQC A;  2GVZ B;  1WHW A;  3POT A;  4CCH A;  2ZNY A;  2DNP A;  1D09 B;  2JLF A;  3KKF A;  2CAJ A;  1FRX A;  2G9O A;  4X62 J;  3CJK A;  3MM7 A;  1S57 A;  4KGV B;  5ETP A;  3M2R B;  2LLZ A;  1J5E F;  3NBP A;  1HLW A;  3HHL B;  1DAX A;  1BLU A;  2YH0 A;  4LR7 A;  4B9U A;  2MQM A;  3D0H E;  2MGZ A;  1QDU B;  1XK8 A;  2NXN A;  1RI7 A;  5KFV A;  3CC2 S;  1FWL A;  3QAU A;  2FIU A;  1MNE A;  2K3I A;  1F5C A;  4OJG A;  5ETM A;  2F8H A;  5D8H B;  2BEF A;  1WC0 A;  2CQP A;  3JSY A;  1HQU B;  4AL6 A;  4DFP A;  1FDA A;  4JI3 F;  3LAM A;  4F4K A;  3DLE A;  5KT3 A;  3QGG A;  1RAI B;  4R0J A;  4DFJ A;  2IYG A;  4OIX A;  2RUG A;  4UW2 A;  3MM7 B;  2YNI A;  3CJK B;  2F9J A;  3SDE A;  4X65 J;  2BMB A;  1A9N B;  4K0K J;  1NPK A;  1RWO B;  2RRN A;  2MKJ A;  2Z2Y B;  3DMJ A;  3X3U A;  2RE1 A;  1CJT A;  2BJD A;  3M4X A;  3GTY X;  5GAH U;  1Q7Y T;  1AYE A;  1HW8 A;  3AQO A;  1N5Q A;  1SPB P;  1SJ3 P;  3CCS S;  3PIO Q;  2D69 A;  3HSG A;  2FVR A;  3N5B A;  1REV A;  3WX4 A;  3DRS A;  1ZPW X;  4GRS A;  2AJQ A;  1E6V A;  1LWF A;  1BXN A;  2VDI A;  4LRC A;  2CIM A;  2CNK B;  2VH7 A;  3NS5 A;  5HQM A;  1W2I A;  1LFW A;  4BCA A;  2LKZ A;  5LXY A;  1RKJ A;  4MKB A;  4OYP A;  5HJX A;  4B08 A;  2IBO A;  1EKS A;  3SSR A;  1IQZ A;  2AYG A;  2BAN A;  1RBO B;  3PZP A;  2NPF A;  3QZ8 A;  3IS9 B;  4WFZ A;  3DMJ B;  3CJ4 A;  1CJT B;  1EET A;  4MYU A;  5DG7 A;  3VGV A;  4NAS A;  4R25 A;  4ZJQ A;  3EZO A;  4K2X A;  1KTV A;  1T9U A;  1XMB A;  3DRS B;  4ZVQ B;  1LWF B;  3MEG A;  4ZP6 A;  3AJ2 A;  2F4V F;  2XLI A;  2GAH C;  5CAA A;  1UW9 A;  3LGN A;  3D1H A;  2Z0G A;  1F5A A;  2QA2 A;  2W2M P;  4DV3 J;  1S97 A;  1N54 B;  1SI9 A;  2U1A A;  4ZIT A;  3GFH A;  2V6A A;  2K3K A;  2C1E B;  2XMT A;  2GJI A;  2ZOM A;  2UUA F;  2F7V A;  1GH8 A;  5HAT A;  3MUM P;  3DRP A;  3O5T B;  2QL9 B;  2XWX A;  2KVQ E;  3E3X A;  2VZ9 A;  4DI6 A;  3TAQ A;  1EET B;  2UUC F;  3D28 A;  1IKY A;  3NMR A;  3W65 A;  3D7S B;  1TL7 B;  1BD6 A;  1JJH A;  1G2E A;  1HQ2 A;  2W01 A;  1NCL A;  1HR0 F;  5LSR A;  3SV3 A;  5G4D A;  1TVR A;  2L9W A;  3FZB A;  3ZC4 A;  3MEG B;  1CLF A;  4ZMM A;  4ZP9 A;  3IO1 A;  3DLG B;  1FNO A;  3EVM A;  2MKK A;  2W24 A;  2FJV A;  2V2K A;  2VG5 B;  4ZDN A;  3UVJ A;  3M30 A;  2BJ1 A;  1SH2 A;  2HFZ A;  2IMO A;  4HDH A;  1GMV A;  2QG9 B;  2R7Q A;  1CVJ A;  4ILR A;  3PG9 A;  3CJ8 A;  3HCX A;  1KWM A;  3AFG A;  3K58 A;  2CJA A;  2QLJ B;  3DRR B;  4USH A;  3CME S;  4AUK A;  3MR5 A;  3W7B A;  3E51 A;  1IKY B;  2H5I B;  4B9M A;  3LGH A;  5LMN F;  4QJV A;  1MN9 A;  3GJR B;  4OYI A;  1WKK A;  2EFV A;  2EKN A;  4M5G A;  4JP8 A;  2RS8 A;  4AL7 A;  2P6T A;  1G6B A;  1RE1 B;  2CNO B;  3M8P A;  4RU2 A;  2CRL A;  3HHE A;  3OL8 A;  2CFX A;  3SBM A;  4GKJ J;  3FQK A;  5A8R A;  1FNM A;  3M30 B;  2B4U A;  4DPU A;  1H7X A;  3HLU A;  4IG0 A;  2B4V A;  4N8O A;  5HMW A;  3QT6 A;  3EGZ A;  3ZFV A;  4JYA J;  4HEA 9;  3VAH A;  1Z4U A;  4DL2 A;  3DRY A;  2D3O R;  1A0O B;  3D3B J;  3MPD A;  3KJQ B;  2HVH A;  4M63 A;  5CZX A;  4HDG A;  3GON A;  4CQ1 A;  1RT3 A;  1XR7 A;  4OHW A;  2JRS A;  2J8A A;  2PO4 A;  4URS A;  3CVK A;  2R7S A;  3TWZ A;  2B9Y A;  4URG A;  2CPY A;  1S6Q A;  3LWM A;  4A47 A;  2ZM6 J;  4TU9 A;  5F8J A;  3UNG C;  5CCL A;  3ZTS A;  3VAI A;  1DTQ B;  1GX5 A;  2V2Z A;  2BE7 D;  1QM9 A;  2EI5 A;  3KUG A;  4JOU A;  1LWE A;  3I31 A;  5T14 A;  3OFE A;  1OQ6 A;  2V4J A;  3PR5 B;  1VQK S;  4LRB A;  2CNL B;  3RR7 A;  1PSD A;  1RT3 B;  4W4M A;  3VAM A;  1S1V B;  1N5S A;  2B43 A;  4ETZ A;  2JEI A;  4C3M A;  1S6Q B;  2OTJ S;  2LEA A;  3CE8 A;  3PW2 A;  1PC4 A;  3CUL A;  1B3T A;  4OV6 A;  3T9N A;  3EJM A;  3CCV S;  3FNN A;  4HVZ A;  4OZ3 A;  3UCG A;  3GIJ A;  4Q5V A;  2DIT A;  4OI4 A;  3TP2 A;  2DY9 A;  1H0H B;  5LT5 A;  1M5V C;  4NLO A;  4N47 A;  2WBM A;  3PKY A;  4O0N A;  1S9F A;  2V4J B;  2E1R A;  3H20 A;  5J1E A;  1EAY C;  3FC9 A;  4B3M F;  2E7X A;  5FLX Y;  4L76 A;  4LF6 F;  2VDH A;  4WFA Q;  5J2Q B;  4FF4 A;  2QFI A;  3L7O A;  4ERD A;  2DHX A;  1KC8 T;  2QE5 A;  4B17 A;  1RCO B;  3K17 A;  5A8K B;  2VQE J;  1N4L A;  2XO7 A;  2VKZ G;  1KNZ A;  5HRO A;  1FKO A;  1RAA B;  3Q2S C;  1P9Q C;  1NKC A;  2ZBI A;  4B9L A;  3R2C J;  2R7X A;  4R0E A;  2LEB A;  3KJF B;  4NOH A;  2ZH3 A;  2FJX A;  2GA7 A;  4I2Q A;  5CA5 A;  2XZT B;  5IT0 A;  5KFU A;  5B0E A;  1FA0 A;  2KXN B;  3H2L A;  1GFW B;  3DHW C;  3HM9 A;  3HFZ B;  3HJF A;  4R5P A;  4DV1 J;  4PUO B;  4IOA Q;  4P73 A;  1F60 B;  1PKU A;  2PD1 A;  5FDL A;  2V69 A;  3CD0 A;  2MJN A;  3BPD A;  3HFV A;  5D78 A;  4ZPW R;  2VPX B;  5EWF A;  4EZ9 A;  5HRO B;  1FKO B;  5J1N A;  3H0P A;  3GV5 B;  1MN7 A;  3I96 A;  4PG5 A;  1H7W A;  3GCX P;  2ZZM A;  1RU2 A;  4F3O A;  3D1Q A;  2B5J B;  4NRT A;  3P96 A;  4ED1 A;  2ACY A;  2N3L A;  3FMW A;  1FJC A;  4FXW A;  4B3R F;  4LRE A;  4Q8F A;  1TKT B;  4ED6 A;  3RRK A;  5IT9 U;  3KK1 B;  1OJ4 A;  1IKX A;  3ZNJ 1;  3OXF A;  1NSK L;  1GX6 A;  1HL6 A;  1D9F A;  2RKI A;  1RDR A;  4J5O A;  5F3Z A;  1AFI A;  2IPO B;  4FNH A;  1HFE L;  3K7R A;  5K20 B;  2FZC B;  1F3F A;  4WBF A;  3IN5 A;  5KFP A;  5ETS A;  4NLW A;  2XEX A;  3CW2 C;  1X5P A;  2KO1 A;  5KG1 A;  4Q44 A;  3J81 Y;  3NWG A;  3PHE A;  1B7F A;  1ZPV A;  1U09 A;  1RWN B;  5KFG A;  2DO0 A;  1WTF A;  3V6H A;  1IM6 A;  1TR0 A;  4G65 A;  3CWJ A;  3WX8 A;  4DLE A;  2AU0 A;  3S7R A;  4FYD A;  4DLG A;  1SJ1 A;  3FK4 A;  1J5O B;  1H98 A;  1RAB B;  1C1C B;  3N79 A;  2AP6 A;  4O4G B;  1O51 A;  1JLQ A;  3EUN A;  1UWA A;  2DNY A;  3B8H A;  3T5J A;  1N34 J;  4KFB B;  1IKX B;  2DGS A;  1UEU A;  3Q8S B;  3GJT B;  1DUR A;  4QWB A;  2BKP A;  2RKI B;  2ZJQ Q;  3TRG A;  4ECX A;  1TP7 A;  1LWC A;  2FD2 A;  1CS4 A;  2HQI A;  4EO6 A;  4NMX A;  2DRB A;  2LDY A;  3VCD A;  5HLF B;  3ENA A;  4NLG A;  3R9L A;  3F73 A;  3BZQ A;  1FXR A;  4UF4 A;  1R27 B;  3MCS A;  2UXB J;  4Q0B A;  3IWX A;  3OVS A;  1UEV A;  4QPT A;  5DLG A;  2HHV A;  3CDU A;  4FYW B;  4KV8 B;  2G0J A;  1X5T A;  2YWH A;  4ES2 A;  3KNG A;  2F65 A;  4AND A;  3U1M A;  3OFG A;  4B02 A;  3GIM A;  2FPH X;  2V4R A;  3QID A;  3Q22 A;  1VQ9 S;  3VVU A;  3GU0 A;  2ZOF A;  1JLF A;  4B3O A;  1CS4 B;  1S1T A;  2IJR A;  4PG4 A;  3ELH A;  4X4U A;  5DM7 Q;  3MM8 A;  1JKH B;  1LXJ A;  3TA0 A;  2QLW A;  2RRA A;  5KFC A;  1U02 A;  2RDI A;  4EU0 A;  2ASD A;  1RTJ A;  5LXR A;  1IKW A;  3RAQ A;  1LK7 A;  3VHQ A;  1SC6 A;  1NPR A;  2ROE A;  3J81 j;  2QYC A;  4MH8 A;  4LF4 J;  2KYX A;  1QAI A;  1MML A;  3KLG B;  3MF5 A;  1RT5 A;  3CUN A;  2MKS A;  1Y9O A;  4F67 A;  1PG5 B;  1VR6 A;  4U95 A;  4DBQ A;  1WOO A;  1ZM3 A;  3C46 A;  1FHT A;  1Q81 T;  1P27 B;  3CXC R;  1JLF B;  4QWC A;  5HSP A;  3R5D A;  3RBE A;  4EGL A;  1D9A A;  4Y3C A;  4YEA A;  2YKQ A;  3MM8 B;  2PEH A;  4TKT A;  3FGV A;  4YQW A;  3DLB A;  2AJ2 A;  2HBY B;  1RTJ B;  4TQR A;  1VQO S;  2IVY A;  2EG1 A;  3H59 A;  4FP9 A;  1HHS A;  3KWM A;  1P8G A;  3RR8 A;  1RT2 A;  4O3Q A;  3B4D A;  3ISN D;  3FFI B;  3IBC B;  3AD7 C;  3OVA A;  1XC9 A;  4B9S A;  2HBZ B;  1WTB A;  2UV8 G;  4DR1 J;  4MKY A;  1V6H A;  3Q8V A;  2X3D A;  5JVG Q;  3D2W A;  2HW3 A;  2ABY A;  5A2Q U;  3FKB A;  1R43 A;  1DJ0 A;  2V9K A;  3VZI A;  1Z2Z A;  3H40 A;  3N0V A;  1WHX A;  4DV4 F;  2DGQ A;  4LRA A;  2EFN A;  4I2P B;  2ZE2 A;  2VQF J;  5CH7 B;  4Y65 A;  3PX6 A;  2E7W A;  1VQ6 S;  5ETT A;  4WJB A;  5I4M A;  1S0N A;  3DOK A;  2IC3 A;  1N32 F;  4OZL A;  3EMT A;  1EIY B;  2DCL A;  4LFA J;  4HT7 A;  5DQH A;  1MU2 A;  2VOD A;  4ZLL A;  3DI6 A;  3QO9 A;  3JXO A;  1SJR A;  3OLA A;  3JB9 k;  2QEX S;  1RHU B;  5BR8 J;  2LYV A;  1UJ5 A;  4X4S A;  1SB6 A;  3GB0 A;  2I6W A;  4HT5 A;  1A7G E;  1S0V A;  3DGP B;  5A6W A;  3T3F A;  3PVX A;  4LSL A;  3UCZ P;  1L3K A;  4PG7 A;  1NB2 A;  1YRU A;  4AD6 A;  1FF2 A;  3H5X A;  4DV0 F;  2BDP A;  2BE2 A;  2ZE2 B;  3ENV A;  2VPZ B;  2FVP A;  2W2N P;  3K5L A;  2HK2 A;  3VZH A;  5CQG A;  3DOK B;  5E0O A;  1U7L A;  1D9D A;  3QLH B;  3BV8 A;  2MHN A;  1U6F A;  3UR3 C;  1VS3 A;  3DI6 B;  1QTM A;  3QO9 B;  4KT0 C;  3L95 X;  2G1H A;  3THT A;  5HMZ A;  4KC5 A;  2NXU A;  5HBM A;  2W4C A;  2J0X A;  2H48 B;  4I68 A;  4OHZ A;  4OI0 A;  4ED5 A;  1RTD B;  3M32 B;  4WZQ A;  2EBE A;  1HPZ A;  3GIL A;  4LSL B;  1Q8L A;  2UXC F;  2PC6 A;  1IJE B;  2E7V A;  3H5U A;  4ZPV R;  5JUM A;  4J9L A;  2ERR A;  3DCA A;  4DCP B;  1F9E B;  2DT9 A;  2HVE A;  1S1W A;  4WFX A;  2I0X A;  2SXL A;  4RW9 B;  1NK7 A;  1O0P A;  1YIT S;  3IAS 9;  2X1G A;  1SIW B;  3OTO J;  4JI7 F;  1JLA A;  3UO0 A;  5HVG A;  3ZZR A;  1RA6 A;  2UUB J;  3CPW R;  4HH1 A;  2DNR A;  5SZT A;  2CPJ A;  1ZS6 A;  5HBM B;  4C8N A;  2MZS A;  4JI4 J;  1OSC A;  3TR5 A;  2RS2 A;  2N7C A;  4USW A;  1WDT A;  3MED B;  2PGC A;  3GG0 A;  4NXM F;  2VF3 A;  1HPZ B;  1HNW F;  1JB0 C;  1Q0N A;  4YB5 A;  1OSD A;  2DNM A;  4ILL A;  4OLP A;  2XI2 A;  1S1W B;  1WWH A;  3DLK B;  2ZH1 A;  4I7F B;  1G3O A;  2NLW A;  1VIO A;  3J7Y I;  2DTJ A;  3R5J B;  4FS2 A;  1NZA A;  4ECY A;  2OPR B;  4F0M A;  1EP4 B;  1VQ4 S;  3Q8Y A;  2MZR A;  3X1L B;  5KG6 A;  4OQJ A;  4LF9 F;  1NME B;  2NS1 B;  2YNH A;  4ZLJ A;  3RZA A;  4KGM A;  4UOF A;  1WUU A;  2CJK A;  3HT0 A;  4H4K A;  2D3O 1;  1C1B A;  3HX9 A;  4I6W A;  3BSO A;  2RQ4 A;  4U9R A;  2B9W A;  3BM7 A;  1U2F A;  4ZOS A;  2WVE A;  5F9L A;  4CNY A;  3PYF A;  4IRD A;  3D5M A;  4MK8 A;  1WF1 A;  3I32 A;  2P6S A;  4UQT A;  1FX2 A;  5IXU A;  3D6F B;  1VBZ A;  3AAW B;  3I82 A;  3TA2 A;  4RW4 A;  2KJV A;  1BQX A;  3VGS A;  4PRF A;  2YNH B;  1VHF A;  2DHH A;  3CCM S;  2ZBR A;  4HTI A;  2GCF A;  2V63 A;  4ECW A;  3NY0 A;  5M2R A;  2RHS B;  3RUB L;  4FYY B;  5U47 A;  3PEH A;  5AXK A;  3P3D A;  4HHJ A;  2FQQ B;  4OI6 A;  1C1B B;  4LF2 A;  3KJV A;  2GAG C;  2OPQ B;  1HNV A;  4OZ0 A;  1EQ0 A;  2FDN A;  2N82 B;  4M95 A;  2MZQ A;  1YJT A;  2EK6 A;  3HMJ G;  2HBR B;  4ZIV A;  2BKO A;  2MYF A;  5D0E A;  4ZPC A;  4PQU A;  3TJ8 A;  3G71 S;  2BYC A;  1U49 A;  4RW4 B;  1HYS B;  2E5H A;  2C3U A;  2AIR B;  1FVS A;  5IM0 B;  3BGR B;  3K5M A;  3J7A N;  2H54 B;  2IJF A;  5ETL A;  4Y2C A;  3CT9 A;  2J6T A;  2VB6 A;  3C8Y A;  1SQE A;  4NXN F;  2W9B A;  3DXB A;  3KJV B;  3R1H A;  1RBL A;  1FWP A;  1FO1 A;  1HNV B;  4PCQ A;  3N9U C;  3NCQ A;  3RAX A;  1I94 F;  4ER8 A;  4LF7 J;  5CYM B;  2OD6 A;  3IR6 B;  2OP5 A;  2ZDP A;  2QRR A;  3SV4 A;  5L1I A;  3NGK A;  4RW6 A;  1HBN A;  2FZG B;  4O23 A;  1KLN A;  1VQ8 S;  1SL0 A;  4DL4 A;  2X7I A;  1XNQ F;  3PFO A;  3MM9 A;  5MLC V;  4ICL A;  2D41 A;  2GVD A;  2I1R A;  5KFE A;  4USV A;  4XAK A;  2RU9 A;  1YRX A;  4DR7 F;  1XMO J;  2B7C B;  1XWL A;  2W7A A;  1S9G B;  3CJ3 A;  2XYP B;  4GVB B;  2P9C A;  2DD8 S;  2R7O A;  2ZIT A;  3VR1 A;  4YB7 A;  4WE1 A;  2H3E B;  1QD1 A;  3KLH A;  2HQG A;  1TV6 A;  1NHK L;  4HKQ A;  4P7V A;  3UFC X;  1HBN B;  2ILZ A;  1S6P A;  4J9N A;  5K14 A;  1YHQ S;  4QQB A;  3MM9 B;  1XMQ J;  4J9O A;  1OIA A;  5H9F J;  3PR4 A;  4J90 A;  2HIQ A;  5CHC B;  2GMH A;  2WB1 D;  2YX7 A;  4LR8 A;  4AQY J;  3JQM A;  5EHH A;  3CCE S;  3LTO A;  3BB5 A;  4UST A;  7AT1 B;  4DX7 A;  1RXO B;  5F0U A;  3EVW A;  2W2O P;  3E01 A;  5DDR C;  2ZUA A;  4G1Q B;  2GJ2 A;  2BE9 B;  3ISZ A;  3F0N A;  4LF1 A;  3QSI A;  5KFB A;  1X4G A;  3KLH B;  3I5C A;  2YWK A;  4DPY A;  1AUS L;  2GO8 A;  2MMY A;  3CDE A;  3DGV A;  3IBW A;  4C4W A;  3MFI A;  1VLY A;  1VQN S;  2N4D A;  4CTA B;  4ZKA A;  3MXH P;  5C42 B;  1Q95 G;  4PPZ A;  2R7U A;  1N0U A;  3HSD A;  1DAR A;  1T03 A;  1U8S A;  2FJB B;  3ONQ A;  4M5H A;  1U48 A;  4NLP A;  1WHY A;  2L08 A;  2CPX A;  3KHL A;  4GC7 A;  3CIM A;  4K50 A;  3U27 A;  2CWX A;  2FHJ D;  1S0O A;  1QSS A;  2M8H A;  3ZTQ A;  2XLK A;  3HI9 A;  5KTQ A;  1YRT A;  4QWA A;  1BHN A;  3HZE A;  5DJB A;  3KG1 A;  2AJ0 A;  2FB0 A;  5DG8 A;  1LW2 A;  4TXS A;  3KK2 B;  1W25 A;  4DV2 F;  1S1U B;  4IRK A;  1ZAV A;  2KYZ A;  3R7B B;  2JVO A;  4U67 Q;  2R7T A;  3GPA A;  2JHE A;  1WG1 A;  1T95 A;  4LVN P;  4LSN A;  2R7W A;  2KT5 A;  4FBT A;  3MUT P;  4V19 X;  3OTC A;  4DU8 A;  2GZO A;  1R89 A;  4WTY A;  1BC6 A;  2GIR A;  5GME A;  2RT3 A;  2DIU A;  4DV5 F;  2VBY A;  2IAJ A;  2XI3 A;  5F8G A;  2NXJ A;  1FNX H;  3H2U B;  3CJQ A;  4JI0 J;  2MY8 A;  2WW4 A;  1L3S A;  3C6U A;  2NZC A;  2GS8 A;  2CJX B;  2HVI A;  2HHT A;  2LDI A;  4XPC A;  5I3P A;  4C6A A;  2DY1 A;  2B9X A;  2ZVI A;  3O3L A;  1RTZ A;  1G7C B;  2MQQ A;  5HAN A;  4ZVG A;  5B0A A;  4EWT A;  5CZV A;  2QLB B;  3BBC A;  1RAD B;  2DNQ A;  1DBD A;  3H5Y A;  1YJ9 S;  2R9L A;  4K4T A;  1EAR A;  1K1Q A;  4LIW A;  3QGI A;  4LSN B;  4LMZ A;  1K44 A;  5GAE I;  2UU9 J;  1N6Q B;  4PPD A;  3C66 A;  4KHR A;  1H3D A;  5IZH A;  5K8O A;  3TAN A;  4TLR A;  3MGJ A;  1SKW A;  2PMH A;  5B09 A;  3BSN A;  3Q8P B;  1QUP A;  3LQV A;  2KI2 A;  2IAJ B;  2WBR A;  3MM6 A;  2X1F A;  1FKA F;  3OXG A;  4ED7 A;  1JWW A;  1F6T A;  3QFW A;  4A8S A;  2D3Z A;  2M4M A;  2DRD A;  2R2S A;  3A13 A;  1IR2 A;  1LEO A;  2RIJ A;  5GMD A;  3ZZ0 A;  5DDQ C;  4X64 F;  4WK3 A;  2DR7 A;  3D66 A;  4QU6 A;  3KTQ A;  4IQM A;  4BLG A;  2YH1 A;  3QJL A;  4CLU A;  1IKV B;  1U1M A;  2BOP A;  4ZLN A;  2NPI A;  4CO5 A;  2YKM A;  2WSE C;  2Y0B B;  2AYM A;  4DUT A;  3EWG A;  3FRY A;  2UVW A;  4H4K C;  4H4O B;  2V50 A;  1T3O A;  2EFP A;  1JLG A;  2IM3 A;  5JMN A;  2V68 A;  1YIJ S;  3MM6 B;  2NUU G;  5RUB A;  2CPH A;  2HAF A;  4IFY A;  3H90 A;  1VIS A;  1UW4 A;  2YBV A;  2BW7 A;  2RDD A;  7FDR A;  3OLB A;  1U6B A;  4HR2 A;  2E5L J;  4YS2 A;  1SC3 B;  2EFQ A;  1TMJ A;  1CJK A;  3P5B P;  1N5V A;  4F4A A;  2VA3 A;  3U7J A;  2JDJ A;  2XO6 A;  3SCL E;  2ZNZ A;  2ALZ A;  2X1A A;  1B99 A;  3LPE A;  1C0U A;  4JI1 F;  4DN0 A;  1SVD A;  4WTO B;  2OH2 A;  1MWZ A;  2YKM B;  4A8O A;  4DUY J;  1OY6 A;  2CPI A;  4DS5 A;  2FUG 9;  3IXQ A;  2ZD1 B;  4IDK B;  2EXU A;  1ZA2 B;  3H4D A;  2ZH8 A;  4IFY B;  4A8Y A;  2PE8 A;  1XQI A;  2RJZ A;  3NCR A;  3L7P A;  5L38 A;  2ROG A;  5C24 A;  4YY3 J;  5LMU F;  3UR0 A;  3RBZ A;  2WON A;  1SV5 A;  4P7T A;  2F63 A;  4ZVP B;  2XLJ A;  1LW0 A;  4C8Z A;  3Q0A A;  4MTP A;  4UZB A;  4IFV B;  5CYQ A;  3HO1 A;  5LSO A;  4ED2 A;  3RB6 A;  4EBD A;  2CG4 A;  4DFM A;  1NK6 A;  1C0U B;  2MKY A;  1KLM B;  3AB4 B;  3PRV A;  2J0W A;  5HP1 B;  2KM8 B;  4M5L A;  3LAN A;  1RTH B;  3VAF A;  4QYR A;  2AD9 A;  1XNR F;  3BO2 A;  1VBK A;  3Q83 A;  2V8V A;  2MHE A;  3OTE A;  4E8U A;  3M9N B;  4KAI A;  1IXK A;  2AZ1 A;  5ADZ A;  5D77 A;  4F2S A;  3Q8U A;  2V2V A;  2H1Y A;  2M52 A;  4H4M B;  4LF5 F;  4C3L A;  1UVI A;  1R8H A;  4Z2X A;  3MAA A;  2VQF F;  2GX8 A;  4PWD B;  3LP0 A;  1RTI B;  3TEH B;  1TK8 A;  1SV5 B;  2OSR A;  1LW0 B;  1JIH A;  1VIX A;  3DDN A;  2C42 A;  1X8D A;  1FX4 A;  1RAE B;  4ECV A;  4FZV A;  1OMS A;  1S48 A;  5KFZ A;  2Q6C A;  2BZ2 A;  1WG5 A;  4BHQ A;  2EBG A;  5DRK A;  2LQB A;  2WVB A;  3H25 A;  2VAS A;  1YJW S;  4OYM A;  5T41 A;  2XZD B;  4MAK A;  4ZCK A;  3FBB A;  4KHP J;  4RKU C;  1DFD A;  2OEK A;  5KT4 A;  3V4I A;  3QIP A;  4Y2A A;  4P72 A;  1NPP A;  4L74 A;  3IWL A;  1S1X A;  3T5L A;  1ZZN A;  2G2Z A;  1NK0 A;  5T7L A;  3Q2T C;  5DZ7 A;  2F8M A;  1WC1 A;  3LH2 S;  3EXC X;  3R27 A;  4RNH A;  4RWX A;  3LP0 B;  1L3T A;  1HNI B;  2B4P A;  2CPZ A;  2D74 B;  3PCO B;  3IC1 A;  2KH9 A;  1M5H A;  2LA4 A;  3G6Y A;  4O3N A;  3RAM A;  2A3J A;  4DR3 J;  4UT4 A;  4LJM A;  3SXL A;  2J6S A;  5AT1 B;  1HD0 A;  1T7P A;  3H98 A;  1S49 A;  2N7Y A;  5LM7 E;  2DB1 A;  4OYB A;  5GAG U;  2ZWP A;  1D8Z A;  4QR0 A;  2BQU A;  4CO4 A;  2XHW A;  1S1X B;  5CYJ A;  1V3S A;  4ZS6 A;  5L1K A;  1NH7 A;  1YBA A;  1HBO B;  4K5R A;  1C4C A;  2CYY A;  3BBF A;  4A4J A;  2X3G A;  3WBZ A;  1NXI A;  3MMA B;  1TFW A;  2ALY B;  2RML A;  4ANC A;  1S76 D;  3PYG A;  1LQ9 A;  5B0F A;  1X5O A;  5E3C A;  2JFK A;  3KUE A;  4NYZ A;  4EUV A;  3C6T A;  2UUB F;  1ZTT A;  1WC5 A;  2B6A A;  4BBY A;  2P2C B;  2RHQ B;  1DLO A;  4RL1 A;  1JK9 B;  3ZTR A;  4K4S A;  2UZA A;  4I6A A;  4WXW A;  4K59 A;  3BQ2 A;  2LXU A;  1E6Y B;  2YX1 A;  2IY5 B;  3C15 B;  3E2E A;  1VQ7 S;  4DZ6 A;  5A8W B;  4NZ6 A;  4DSF A;  1U1O A;  4DR4 J;  4PQA A;  2GHV C;  2HHS A;  3DM2 B;  1A6L A;  2NUH A;  3PO5 A;  3QBC A;  2HNZ B;  5D3G B;  1NUE A;  5EUH A;  3CJS A;  4AXI A;  3MMJ A;  2DGW A;  4OV1 A;  1WEX A;  2IJN A;  4DHV A;  4WP3 A;  3C6T B;  1FKP B;  4RJV A;  5F0W A;  2YNG B;  2B6A B;  1UFL A;  1DLO B;  4X4O A;  4LFB J;  4JV0 A;  1I51 B;  1RWV B;  3EXY A;  4NEY A;  3GCW P;  5AE1 A;  4X2B A;  1PC5 A;  1YBT A;  2WRM A;  1Y3J A;  3LF0 A;  1C4A A;  3G96 A;  2MQ8 A;  4DR2 F;  2QLX A;  1WAC A;  1T11 A;  1QAY A;  1TL5 A;  5KFX A;  4ZIW A;  4FF1 A;  5KG4 A;  1LXN A;  6AT1 B;  5GAD I;  4M1K A;  4XPE A;  3CMQ A;  4DUZ F;  4YOE A;  3TI0 A;  2AV5 A;  5FLX U;  1IBM J;  2AWZ A;  3RYL A;  2ZBC A;  3E8O A;  1WKJ A;  1UFK A;  3PX4 A;  4DV7 F;  1U1N A;  3W5X A;  2RH3 A;  1KFD A;  1TZ0 A;  2HLT A;  1Q53 A;  4NRU A;  4OZ5 A;  3QGH A;  2AZ3 A;  3UD4 P;  4RW8 A;  2ZZN A;  3V6D B;  1TKX A;  3ET6 B;  5HVF A;  1Y4Z B;  1DY3 A;  1Y5N B;  2VFR A;  3I0R B;  4N8N A;  4TLQ A;  1WC4 A;  4J9Q A;  4YP3 A;  2M9K A;  1FJE B;  1FER A;  3ILO A;  2E1C A;  3EVO A;  1U45 A;  1J27 A;  3DOM A;  3MTK A;  3Q24 A;  2VFS A;  5G0R A;  2AYE A;  2J0S D;  2C3O A;  1AFJ A;  1UZH A;  4DG1 A;  3FEX B;  2KN4 A;  3AH6 A;  4CYU B;  3IRW P;  3T1Y F;  1F3V A;  4ZHR A;  3BSC A;  3QPI A;  4OX9 F;  4JV5 J;  1RK8 A;  3FDS A;  1JNR B;  1N36 F;  2WVF A;  1D3W A;  4F50 A;  4KY3 A;  5KFT A;  2M8D B;  4MJK A;  4I56 A;  2VFV A;  1K73 T;  1M90 T;  3GP9 A;  1VCT A;  3A3N B;  4NLV A;  2R8H A;  5B08 A;  2Y8W A;  2FLL A;  4NYP A;  5G0R B;  1T8E A;  1U25 A;  1NU4 A;  4USK A;  4TNO A;  1VDH A;  1C0T A;  4QOT A;  3VVT A;  3US5 A;  4J9P A;  4TVA B;  3RJM B;  4DG1 B;  1YX2 A;  3PXG a;  4GKK F;  5D4P A;  2J5A A;  1PJ6 A;  4A8M P;  4C9D A;  1KQG B;  4KIA A;  2MXY A;  3F44 A;  1BQN B;  4K5S A;  3D68 A;  5AJ3 F;  3H7H B;  4P2S A;  2I5J B;  3GV8 B;  2OPS A;  2MPU A;  1PYO B;  4MFB A;  3J7A 1;  2LP4 A;  3ZZT A;  1KFS A;  2KB2 A;  4WWS A;  4JI5 J;  3P49 B;  2CPF A;  4V19 J;  3IR7 B;  1CSJ A;  2PFD A;  1U1Q A;  4NI2 A;  3S6E A;  3B78 A;  4QWE A;  3LP1 B;  3K0J A;  4IOC Q;  1HKA A;  3QSY B;  1C0T B;  3WDO A;  2XGQ A;  4FKY A;  3W3S A;  2UXD J;  4YHH J;  3OVB A;  1VRQ C;  4B3T J;  2UVV A;  2P9G A;  4OI3 A;  3I4H X;  4UTG A;  2VG6 A;  1KD1 T;  2IYI A;  2PA3 A;  1AZS A;  2OPS B;  1X0P A;  1T3N A;  4C98 A;  1HNX J;  1HI1 A;  4M5D A;  3IG1 B;  4ECS A;  3G8Q A;  2EW9 A;  3I6P A;  2UUW A;  4JI6 F;  3CDB A;  3GJS B;  3MMC A;  2GQC A;  2XHC A;  2XNR A;  3VAJ A;  2BUN A;  4ZVH A;  4WII A;  5KG3 A;  1BQM B;  1F5B A;  3IMQ J;  4AE5 A;  1K1S A;  5F3T A;  3PAC A;  3CDA A;  2WAQ D;  4YR3 A;  3BBB A;  1RWU A;  5I3U B;  2FC8 A;  2HS0 A;  2FYX A;  5KFQ A;  3MD3 A;  1URN A;  5EWE A;  3HHL D;  1XJW B;  3BGU A;  2B0G A;  3PEJ A;  3GG1 A;  3FJ2 A;  2D7S A;  5J2P A;  4UZC A;  2XTJ P;  4G6V B;  2APO A;  3NS6 A;  1AZS B;  1MMD A;  3AA9 A;  2ROP A;  1OO0 B;  1W26 A;  5IWA J;  4M5D B;  4WKR A;  2DGT A;  2YQ0 A;  3MMC B;  3OHA A;  3W2V B;  2V67 A;  3M8Z A;  3BQ0 A;  5DGA A;  4Z7Y A;  1VGY A;  1AXQ A;  3OW2 R;  1VQY A;  3M8R A;  3N6L A;  1FDD A;  3P8B B;  4USM A;  2LEC A;  1N56 A;  1X7V A;  2HFO A;  3TAM A;  4EBE A;  1PIE A;  2D9P A;  1EHW A;  1JXV A;  2JNJ A;  5A0Y B;  1WI8 A;  4P10 A;  1W7W A;  1HMV A;  4LBH A;  3SCK E;  2FY1 A;  1M1H A;  3D54 A;  3QJP A;  2OSQ A;  4BWM A;  4ZN3 A;  3PRD A;  4X84 A;  2PI5 A;  4DSI A;  1FJG J;  3SFU A;  3GYG A;  5D0R A;  2HQD A;  4HLB A;  1IR0 A;  2CQG A;  2DNO A;  4CLS A;  1SH3 A;  5E3Q A;  1SL2 A;  1L3U A;  4KJI A;  3ISN C;  1TFY A;  4IH6 A;  3TAM B;  3SMZ A;  4HL9 A;  1OY8 A;  3T19 A;  1B0P A;  3OL6 A;  2BM0 A;  2YXL A;  4Y2K A;  1VI7 A;  3MMB B;  3S1T A;  3UI3 A;  4JUZ A;  2ZHA A;  2LU2 A;  1CQN A;  5HN0 A;  3M05 A;  4CO1 A;  3KK3 A;  1FFG B;  2QN6 B;  5BYS A;  2HHX A;  3UN2 A;  1NSP A;  2BBE A;  4C8O A;  4WCE Q;  4FPR A;  3CD7 A;  2IBK A;  1MMN A;  4FYX B;  2OD4 A;  4P2X A;  1XER A;  3HDS A;  3SFG A;  3IRX B;  1Y5I B;  1FVQ A;  1LFP A;  5D4O A;  2OI2 A;  4J9R A;  2RQK A;  4MMO A;  2JX2 A;  3PM9 A;  2W7O A;  3ZZO A;  1NJW A;  2WB4 A;  1NBE B;  1JMT A;  1PJ7 A;  4OZ1 A;  2W2P P;  4JI2 J;  2AJ4 A;  3PY8 A;  3POT B;  2DYA A;  2AEF A;  3UD3 P;  4E98 A;  2XMM A;  3MR7 A;  3DNC A;  1RHM B;  4CP5 A;  3KDN A;  5DZ6 A;  3CJT A;  3NBP B;  4L75 A;  4KR0 B;  1BY9 A;  2EG2 A;  5HK4 A;  4CO2 A;  2BAB A;  5FD1 A;  2MGZ B;  3SI8 A;  2I2Y A;  4DUY F;  1H6K X;  1F2H A;  3NL0 A;  4QZV B;  4DV6 F;  1EJ7 L;  4E0D A;  4F04 B;  1H73 A;  3QT5 A;  3K8V A;  1OQ3 A;  2HFN A;  2BM1 A;  1YBU A;  3ILL A;  1J5E J;  2DR6 A;  4NLY A;  2I38 A;  4M5J A;  3BKT A;  2V5H G;  3MEE A;  2XSJ A;  3M8Q A;  3DLE B;  4LVO P;  1ZBT A;  4GO7 X;  2NYH A;  1H2V Z;  2YNI B;  3T1H F;  3SDE B;  4CDI A;  1GMW A;  5C7P A;  3K8W A;  3R8Y A;  2CPD A;  2FJD B;  4OX8 A;  2KZZ A;  3D1O A;  1F9H A;  4X4T A;  4CLW A;  1IM4 A;  3NKY A;  1WF0 A;  4JI3 J;  4CLZ A;  5BJR A;  3IGV A;  3MI7 X;  2CZ9 A;  3I5A A;  4E2F B;  4I6Y A;  2CG8 A;  3T1A A;  4WU2 A;  2XYG B;  1REV B;  2CDR B;  4J9U E;  3SZ2 A;  1E6V B;  2KG0 A;  1L3V A;  2O1P A;  3DYA A;  3PX0 A;  3TQ1 A;  2XSJ B;  3M8Q B;  4QYZ J;  1CUL A;  3R5C A;  4KSE B;  3TUP A;  2OLW A;  1D1U A;  2X1B A;  2QTW A;  3A1Y G;  4CI0 B;  2A1B A;  4CO0 A;  5AE3 A;  5FJ4 A;  2Z2Z A;  2BAN B;  2LQ8 A;  3EDQ B;  4Q45 A;  2CDQ A;  2Z57 B;  4DR6 F;  1PBU A;  2HRY A;  2RF2 A;  1TL3 A;  2HEK A;  4O0I A;  3CCT A;  3VQT A;  3KG4 A;  2RDJ A;  4F4Y A;  2BJ3 A;  2QX0 A;  3U1L A;  4OZ2 A;  2E1M C;  1KKH A;  1MW7 A;  3DYA B;  5B7W A;  3P4U B;  1S59 A;  4F4Z A;  3M2U A;  4LF8 F;  3TUJ C;  3AY0 A;  2H5J B;  2G2Y A;  5K8P A;  2L41 A;  3CO0 P;  1VBX A;  3G4S S;  5HQ8 A;  4ED8 A;  1Y7P A;  3DLJ A;  2J9D E;  2F4V J;  4DPX A;  3DRP B;  1YTY A;  1HNZ F;  1UVJ A;  1ZH5 A;  2OFG X;  2RIL A;  2OKQ A;  5IV3 A;  1H74 A;  3HHN B;  2DH8 A;  2DPI A;  4IOB A;  1Q8K A;  3HHK A;  3OV7 A;  3GSD A;  4M94 A;  1TVR B;  3G86 A;  2VON A;  2QL7 B;  3CNQ P;  2UUA J;  4ATN A; 
#chains in the Genus database with same CATH homology
 3BPD A;  2X3D A;  2RAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...