1NSKL

The crystal structure of a human nucleoside diphosphate kinase, nm23-h2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The crystal structure of a human nucleoside diphosphate kinase, NM23-H2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase (po4 as acceptor)
total genus 43
structure length 151
sequence length 151
chains with identical sequence N, O, R, T, U
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1995-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nskL00
2DXEA 1NSQA 3NGTA 1NDLA 1BE4A 3EM1A 4DI6A 3VGVA 3B54A 1S5ZA 1NCLA 1B99A 1F3FA 1NUEA 2BX6A 3BBCA 3FKBA 3NGUA 1XQIA 3ZTQA 2B8PA 1NDPA 1NHKL 4W98A 4UOFA 1UCNA 4UOHA 3L7UA 3ZTPA 3BBBA 4O0NA 1BUXA 2ZUAA 1NSKL 1WKKA 3ZTSA 1S59A 4C6AA 4F4AA 5BXIA 3Q83A 2CWKA 1NSPA 3MPDA 3Q8VA 2B8QA 4FKXA 2NCKL 3BBFA 4KPCA 1U8WA 3EE3A 1S57A 3FBBA 1WKJA 1MN9A 3B6BA 5CABA 3FBCA 3FC9A 3Q8UA 4CP5A 3GPAA 3Q89A 3VGSA 4EK2A 3BH7B 3DDIA 5C7PA 3FBEA 1LWXA 3PJ9A 1F6TA 3R9LA 3BH6B 3JS9A 2HVDA 1LEOA 4UOGA 4S0MA 1NPKA 3GP9A 2HURA 2DXFA 1HLWA 3Q86A 1NB2A 3FBFA 3VGUA 4ENOA 4ANEA 1VYAA 3EVMA 3G2XA 1WKLA 4WBFA 1MN7A 3ZTRA 3NGSA 1HIYA 1NLKL 1PKUA 4F36A 3FCWA 4DZ6A 2DXDA 3EVWA 3EICA 3VGTA 1HHQA 4HR2A 4FKYA 2DYAA 1NDCA 5IOLA 3Q8YA 3ZTOA 1KDNA 1ZS6A 5CAAA 3ENAA 1K44A 2AZ1A 2BEFA 1XIQA 1B4SA 1NDKA 3PRVA 4DUTA 2AZ3A 3WX8A 3FCVA 1JXVA 1PAEX 1BHNA 2DY9A 3NGRA 2HVEA 3ETMA 3VVUA 1W7WA 3EJMA 3EVOA 4ANDA 3ELHA 1EHWA 3EMTA 3VVTA 4ANCA 3DKDA 2VU5A
chains in the Genus database with same CATH superfamily
1PJ6A 2M4MA 1YIJS 4USTA 3Q22A 1S6QA 1RJJA 4LF9F 2MMYA 3FKBA 5E7OB 4YR3A 2IJNA 4OHXA 1MG7A 4I2PA 1VLOA 5KFWA 2VG7A 1Q95G 4HT5A 5LT5A 3TA1A 1D9DA 4CO5A 1HQUA 1YRTA 1A0OB 3OFFA 2PA3A 2IVYA 4P75A 5HLFA 2W9CA 3HVWA 3TANA 2GJIA 4PZVA 3G71S 2Z8QA 2NUUG 1JJ4A 4Y2MA 3JQKA 1T03A 4ZPBA 2NZ4A 4DS5A 1QTNB 3NWGA 5KFRA 5D4PA 1GT8A 2HIQA 1WOPA 3AJ1A 2R7QA 1F2GA 2MQOA 2B4OA 4K4YA 4U8VA 5E3CA 4NLXA 4TLRA 1S7HA 1KTQA 4USHA 2F5GA 3ZTOA 2BQRA 1HBNA 3HVTA 3BN4A 2DR7A 2E5JA 2XY6A 3HHDA 3BQ2A 4M5LA 3TQ1A 2O67A 3WBZA 3W61A 3I31A 2RSQA 2GQ2A 4DUYF 2M5YA 4HACA 2PDAA 4A8FA 2FTRA 3GIRA 5L9NA 3BO2A 1HWKA 4OYOA 4I67A 3DOMB 2OUGA 4DOZA 3C16A 4UOHA 1YWXA 3D9BA 3T1AA 1Y3KA 1WKJA 2NXCA 4DV7J 1QVFR 1FWKA 2E5IA 3PEJA 4IO1A 1EP4B 2LMIA 1U6FA 3BN7A 2N7YA 5A8RA 1XR5A 1VBZA 2YNHA 1GQEA 1KFSA 5IT9Y 3QJJA 1DQ9A 3AXKA 2EKNA 3PYDA 3I87A 1K73T 3PCOB 1R0CB 2W4PA 2CNOB 1B70B 4FVMA 3N6NA 1RHQB 1SH0A 2LFVA 1UEKA 2VFSA 4URGA 3W9JA 3C14A 2J6UA 4FBTA 1Y7PA 3IWXA 4J9QA 1S0NA 3H5SA 1HD0A 3IR6B 5HBMA 2F9JA 4H54A 3AFGA 2D7SA 3MFHA 4DSEA 2FZKB 2QC3A 2ABYA 2MKYA 4OYZA 3DMJA 1GMVA 3MD3A 7FDRA 2Y0BB 1FFWB 3UI3A 3CD6S 1HW8A 4IDKB 1IKWB 2JVRA 1DURA 2E1RA 4DL0C 2CZVC 2LYVA 2OI2A 3H7HB 3FCHA 4DS4A 4IOAQ 2VA3A 2ZWOA 1BC6A 3KLGB 2BOPA 1KKHA 3SV3A 2OPQA 3GMGA 4WXOA 2K7KA 3JQMA 2IJFA 1G4CA 1TTHB 2BZ2A 3VALA 4J9LA 1YBAA 1K1SA 4CDIA 3DLBA 1RAGB 1UA0A 2UVVA 4J91A 2DK2A 3BGOP 3WZ0A 1WOOA 3KNGA 4J9SA 3QPIA 2Z30B 4NI2B 1TU0B 5J1EA 3IG1A 2CFXA 5I3UB 2OTJS 2I38A 1XERA 4RO0A 3T5JA 3MXHP 4DCPB 2JLEA 2V2VA 3ZXWA 2DCLA 2UVRA 4C0BA 4DV2F 2KT3A 4ZVRB 1IBLF 2BQ3A 1NCLA 4CNZA 4ZN3A 1PYOB 4Q45A 4WFAQ 1NDPA 2MQMA 1HYSA 4JI7F 2H51B 5D4OA 4ZS6A 3HHLD 3MM8B 4HDGA 3O5TB 2OPPA 3EZ5A 2CNNB 2YKNA 1ZA2B 1CS4B 1IWAA 2YX4A 1S57A 1L3VA 2ZBIA 4KJIA 4KE5A 4QR2A 3QJPA 4HDHA 2LCWA 1VI7A 5K8PA 1S1VB 3FSYA 2GO9A 1FCAA 2WOMB 1IBMJ 3EGWB 4DV0J 2DNMA 3W7BA 4Y3CA 4ECZA 3W2WB 2GHVC 4ZP7A 4D3GA 4CM0A 2HNDA 2ALZA 1MLAA 3J7A1 4NLQA 4G3IA 4J9RA 3FCWA 4Q0BA 4CWBA 1FWPA 5D15A 3H2UB 2AJ0A 4ZP9A 1L5UA 4ED3A 5JUMA 2PGCA 2BJEA 2BDPA 1FKOA 4PQAA 3ETMA 1TKZA 1X8DA 4QU6A 3EVOA 4K8RA 2XBPA 4J9KA 2K7JA 2BBEA 2LKZA 1BE4A 4DV1J 4CLSA 2J9DE 4GKKF 2HWTA 3D1QA 4IFYB 5IM0A 4HYKA 2IHR1 2ACMA 4CLKA 3RW7A 1S97A 4FVCA 5KFPA 4LF8F 2E44A 4UF4A 3AA9A 4ZMMA 4ZPCA 4X4UA 3DU5A 1SPBP 2Y3YA 4OV1A 3FC9A 2EKYA 2IAJA 1Z2LA 2B4PA 1HR0F 5BYSA 2OPRB 4HHJA 3SSSA 2V8GA 4DDFA 4PQUA 2CQCA 1UEUA 1SV5B 5B0CA 4Q2MA 1H2TZ 4ED6A 3EDQB 4P2XA 2XULA 5CCMA 2DNKA 2KTQA 1TKXA 3EICA 5DZ6A 4OX9J 2YNIB 5CA5A 3C2PA 2V68A 1K44A 5IC6B 2BABA 1CULB 2MDAA 1JLEB 2FLPA 2ROGA 1OSCA 4OMFG 3RRHA 1S6UA 1I94J 2HS3A 1TVRA 3TOQA 3IAS9 2VFVA 4DZDA 5A6WA 1PYSB 4NXMF 2NXNA 1C0UA 4F50A 4DF4A 2VPXB 4LR8A 2GHWA 4J9VA 2YKPA 3MEGB 3A3PB 3DFEA 3BM7A 3HHLA 4FYYB 2DEJA 5B09A 2ZD1A 3BDPA 4ELUA 3TJ8A 3PG9A 5HATA 5E5NA 1Q82T 2ROEA 4ES2A 3VGSA 3KK3B 4EK2A 1S99A 1EIYB 2W9BA 3TP2A 3AODA 3HFZB 2AJQA 3N79A 1OPZA 3QAUA 2KM8B 3EGZA 4ANEA 2WB4A 2CNKB 4OJ3A 4ED2A 4DR6J 3SI8A 3CNQP 2YNFB 2M88A 2W24A 2ZH1A 3CUNA 4OYIA 2AZ1A 4PEOA 2DNZA 4XDDA 3PIPQ 3KK1B 1JNRB 1K0VA 1FA0A 1S77D 3NKYA 2KO1A 1URRA 3HD1A 3NGTA 1WEXA 2X3GA 4ZLLA 3MMAA 1IM6A 1CVJA 5KT2A 1JLGA 3LW5C 3OTBA 2XCAA 3X1LB 5KFLA 3U02A 1DQAA 2Y8WA 1NK6A 2ZUAA 3F73A 2K1RA 3VF0B 1NSPA 4RW7B 1KP6A 4C8KA 3QWUA 2CQBA 3MUMP 2IJRA 3RR8A 2B9XA 4H4MB 1VOMA 3W8GA 2YXLA 4GKJF 1N5TA 3OHBA 3D3CJ 5KOXA 2FLLA 4NOHA 1UFWA 3US5A 5BR8J 1H0HB 4YB7A 3CCJS 4HH0A 2QL9B 3T5LA 3G82A 2CPEA 3H0PA 4DG1A 3KHLA 5J2PB 1XNQJ 5F0UA 2GGPA 3QO9B 5HK4A 2HHWA 3PDNA 1FXRA 4J7CA 2M52A 2HRTA 2XNQA 3IFEA 3LP0A 4DLGA 2HFOA 2VU5A 5KFVA 2BVZA 2H65B 3PHTA 5D0RA 2G2OA 5HQ8A 2WVCA 3BYRA 3RRGA 4EGLA 2HVZA 1JLFA 3KDOA 5EDWA 3MHYA 2V8DA 1F1BB 3ITHA 4IG3B 3MR6A 3U1MA 4DQRA 3HSJA 3DI6B 5RUBA 3CMAS 2GVZB 3GSDA 1KLMB 2O5DA 3HZGA 2GMJA 4ZPDA 2R3VA 1JLQA 2J9DA 4OV6A 3M2RA 1RXOB 4URQU 3FEYB 4DFKA 2HQ3A 3FFIA 2AWZA 1DARA 1JQGA 2IY5B 4F2RA 1R6VA 1D1UA 5KG5A 5DG7A 1N5QA 2VQFF 3CB4A 4U7UD 5HANA 6AT1B 4OYBA 1R0AA 1VQ8S 4A8YA 2HNZB 1EJ7L 4EBEA 4HKQA 3W62A 1XMQF 3HSGA 4JI0J 3KLHB 5KT6A 1JLBB 1E6YB 4DEZA 1RWNB 1G7CB 5C2GA 1EETB 3DM2B 1UJ5A 1NUEA 2MGZB 3E01B 4Z37A 1AFJA 4FBUA 4IH6A 1T0TV 3HT3A 1CG2A 3HHKA 3DDKA 2HHTA 2NSBA 3M8ZA 2M70A 5ETVA 4BDPA 1SUQB 4CCHA 4LFAF 2RDIA 2LVWA 4F4AA 2J76E 4ZVQB 1OWXA 2PFFB 4L73A 3D6MB 2GA7A 1ZM3A 1TUVA 3M6VA 2JNJA 2XMWA 1NZ8A 2ATCB 4CYUA 2R42A 4ZVGA 4CTAB 2YH1A 1RT2A 3VAKA 1KTVA 3VGUA 1SI9A 1HBMB 2HBQB 3K5LA 3IGNA 1SIWB 3IMQJ 1M1GA 3QIDA 5KFNA 3CW2C 3M8SA 1UP1A 4PWDB 4U6PA 2BXJA 4J9UE 2GW8A 2MHNA 2F40A 2KKHA 4DV4F 2H5IB 1X5TA 3J7Z5 2MZJA 1FKAF 2M3DA 4KRWA 4R25A 1RCOB 2ZITA 5KFXA 1SC6A 2BRKA 2W7OA 3VV2B 3PW0A 1AFIA 2R7RA 1FEEA 3PACA 4F0KA 4DPYA 3EYZA 1XEZA 2WZ1A 2C2ZB 1C4AA 3N01A 1ELOA 4ZPVR 2C22A 3MEDA 3DYAB 2VG6A 5EN1A 4G1QA 3B8HA 1S9GA 4KTQA 1NZAA 1LOUA 1MN9A 2MB0B 4F0MA 4AUKA 1H98A 4DN0A 4C8YA 1HPZB 1TKDA 2KYXA 3K89A 1LEOA 5FLXU 1VJWA 1MROA 2V67A 4B3TF 5AT1B 4E98A 1C1CB 1RLCL 3TUJC 3GFXA 1SL0A 4USIA 4ER8A 3PTWA 5T7LA 5KG3A 1NLKL 3FJ2A 2ZBQA 3BR8A 3ZZRA 1HHSA 3MM5A 4ZN1A 4B3OA 4QBUA 3MM9A 3ENAA 3K58A 2DH7A 1IR0A 4A8QA 3MCNA 3J81j 3TVYA 4X4SA 4F26A 5M2RA 5K14A 4LF2A 3HK2A 2CPIA 1F60B 2Z56B 3G6ES 3ILOA 1WNEA 4IR9A 1SL1A 3DLEA 5C42A 1R8AA 1U1OA 4JV5F 3L4BC 1XWLA 4J9MA 4OZNA 2E1MC 4LF7J 4HLBA 3BSOA 4OI4A 1YBUA 3DDIA 2CQIA 4OFZA 5F8JA 4NLYA 3D6FB 1CSJA 2I0XA 3EVMA 2J5AA 2DEIA 2YPZA 1AZSB 3K7RA 2DB1A 2GS8A 2F65A 1X60A 2JH3A 5ITHA 5L8RC 2NLWA 4QW9A 2WVEA 3BKUA 3NNAA 3LP1A 2DPIA 1VIOA 3BSNA 1CPZA 3GIIA 2N4CA 1RT3A 3I4HX 5F8GA 2M9KA 4K0KF 1ZPWX 2R7VA 2LQ5A 3PX4A 2COLA 3NS5A 2ZC3A 4TU7A 2Q6CA 2XLIA 4TNOA 3TRGA 4P72A 2KHCA 3KJVA 2UV8A 4RW6B 2KJWA 2UUAJ 2DNOA 3CJQA 2E9ZA 4JI2F 1S1TA 1BXNA 2CWXA 1QAYA 1HBOA 3OL8A 2ZHOA 1S1WA 4M63A 3M4XA 3MI7X 2BJDA 1FJGJ 4IKAA 5KFAA 1NK4A 4YB6A 3MTKA 3FUYA 4DR7J 3R3TA 1Q8LA 3EVWA 1M5VC 4O4RA 1SCJB 2DNNA 2HHXA 4RUBA 2EEYA 1LWFB 3OL9A 1VLYA 3IC1A 4C7QA 3K5NA 3EPGA 5IT4A 5KFHA 2BM0A 1VK8A 4KFBB 2M7SA 3FVYA 5A8KA 4EU0A 4LRFA 3FZBA 3IBCB 3C66A 5DQGA 1Y4ZB 1V3ZA 4C2MA 1W2BR 1XR7A 3R1HA 1GX6A 5JVHQ 1RWOB 1B3TA 3DRYA 1Q1KA 3ZZZA 4R5PA 4DV6J 5LSOA 1A7GE 3RAXA 4PWUA 5HJYA 1S1XA 3H98A 1U25A 4WJBA 1MWYA 1J5OB 1N5YA 3N6LA 4YUDA 2RQ4A 2EC0A 3MPVA 2R8HA 2BMBA 3UD5A 4X66F 2OPSB 3BGRA 4OYAA 4TU9A 1U26A 3P96A 5LOQA 4RBUA 4WZMA 2KJVA 1FNOA 5GAGU 1RDRA 5A8WA 2DGVA 5L39A 3BPDA 4LRCA 2W7AA 2RKIA 2XMMA 3VAMA 1IUJA 1VC6A 5IT9U 2W2QP 3C15B 1CJTB 2UUCJ 1G3OA 3W66A 2WVFA 3DXBA 1OO0B 1Q7LB 1TL1B 4J9PA 3H59A 2M8DB 3GIJA 2DNLA 1RHJB 2MKIA 2E66A 3UVJB 1GTEA 3ZZOA 2Z58B 1KHVA 2ASYA 1NDLA 2QLXA 4PUOB 1MMNA 1IXKA 1U2CA 2CZ9A 4DUZF 2KU7A 4ED0A 1AB8A 5EWFA 5DM6Q 3IP0A 5HMZA 1LKZA 1X0PA 1RAEB 2A3JA 3GONA 3ZZPA 1YG0A 3QATA 2DIUA 1FDAA 3NBPA 3CCUS 1QJHA 5HO4A 4I4BA 2K8GA 5IV4A 1C4CA 2LQJA 3I32A 4B3MF 1YX2A 1KNZA 5HMYA 5A6PA 3LPEA 4Y34A 3AOBA 2CPDA 2P5VA 4PG5A 3OXLA 5IV3A 1I5OB 4AQYF 1ZBTA 4HHUA 3MMCB 2B3TB 2UUBJ 5IC4B 4N8OA 4Q8EA 2VPZB 2AX1A 3TJ9A 2VD3A 3OVAA 1T3NA 1RWUA 1T7PA 4F4XA 4U96A 4A46A 5HQMA 1J5EF 1HNVB 4LF1A 3GSIA 1S5ZA 2ASDA 4ZITA 2MQPA 4BS2A 1NK7A 4P2MA 4IH5A 3DHWC 4OZ1A 4JI8F 2QN6B 3L7PA 2JRSA 5H9FK 4I2QA 4HTJA 1GXUA 2B5JA 4XO0A 4BBYA 2CDRB 3MOZA 1Q86T 2WBMA 2ZH9A 2DR6A 3Q86A 1UVJA 2IYGA 3ADAC 4CLPA 1H72C 2AX0A 3T6JA 3M6WA 3PV8A 4DPUA 4B9MA 3TVKA 1VIXA 1RT7B 2HQCA 3DRSB 2FD2A 3Q2SC 3PYGA 1FJCA 3OFHA 3D28A 2VOOA 4USJC 5CAAA 4MH8A 2FVQA 2W2MP 5AXMA 4ETXA 3Q8RB 3DLKB 1UZHA 2YX7A 4I1TA 1KOOA 4CI0B 3F56A 1URNA 4ECWA 2UXDJ 4WF9Q 1HQEA 1RTHB 2ZDOA 5M2PA 1FI4A 4ITSA 1XMBA 2HK3A 3I9ZA 3OR1B 3BO3A 2KXHA 2QIFA 2LEAA 3LALA 1EAYC 4DR1F 3ZZUA 3SIPB 3DLGA 5E3QA 4XTTA 2R2SA 1FFSB 2NR0A 4DFJA 2W4CA 3PR5B 3QBCA 4LF9J 2BE9B 2HFZA 5J2QB 3PYEA 2P8IA 1WHVA 2FJXA 3CE8A 1QSSA 1Y11A 2DH8A 4LIWA 4JB8B 3KUHA 1QE1B 4CRJA 1E6VA 4RWWA 2J7WA 4C98A 2Y1JA 2DGTA 3UFCX 3C3LA 1H2VZ 3D66A 4V19J 3QGIA 1VQMS 3K8VA 3VZHA 3GYGA 1VFJA 5D3GB 3QIPB 5LJ5Y 1XK8A 1UVIA 2BKPA 1N34J 2EFNA 5DG8A 1TMJA 1CLFA 3MDFA 2XHWA 1P1LA 4A8XA 4I69A 4O3RA 5GAEI 2OMOA 2RS2A 2DGUA 3KLIB 1QY7A 2CZ4A 1Q16B 5DRKA 4WYLA 1CJVA 1WG4A 4G1IA 5IS2A 2CQGA 2VBWA 4DR3F 3AQOA 2ZH5A 1SJ3P 3OTOF 2YY3A 4DUYJ 2IYIA 2RHQB 1X4AA 2RS8A 3M8YA 2BW2A 4ILRA 3TEHB 4RZRA 5GAEU 3W9HA 3M8PB 2QL5B 3CMQA 2CVIA 3M2VB 1RB0A 3OJSA 4ZLJA 3CO0P 4UZBA 5CZXA 3MAAA 2XMJA 1SJRA 4ZJQA 2FB0A 5CCLA 3K5MA 4RUAA 2AJ4A 4M94A 3M8QA 1U02A 4ED8A 2C3MA 2JZ5A 4RBVA 3W2VB 4QWCA 2Q1LA 4F36A 2YKMA 3BS9A 3ISND 2DNHA 2HK2A 3HKWA 4Y2KA 1U24A 4NLPA 2XMVA 4GVBA 4ZVOB 4FS1A 4JV2A 3VVTA 4ZLNA 3C8YA 4ZPAA 2VODA 2X1FA 3W64A 1WEYA 1YGYA 2WHOA 4YFUA 4X65J 2ZJRQ 3ET6A 2IC3B 2VF3A 2W9CB 5AJ3J 3D68A 2QMXA 2IM0A 2FJEB 2DNRA 1VQ7S 3QQCD 3JQJA 3EZOA 1RE1B 4UY8T 3FMWA 1A9NB 4D3HA 1NSAA 4FNHA 4PABA 5F3TA 5KFFA 1P9QC 1X9MA 3KMSA 3NGDA 3PJWA 3RBEA 2CQ4A 3UD4P 2RVJA 1S10A 4DV5F 3NOGA 2KN4A 3GLJA 2WSEC 5KFEA 1JLAA 1SJ4P 5J1PA 2H3EB 3CC2S 1ZS6A 1K9MT 3U7JA 3DOLB 1MNEA 1Y5LB 5LMNJ 1GX5A 5SZTA 3N0VA 4JI6J 3ZZYA 2E1PA 4HACB 2VDHA 4Z2XA 1FRIA 1VS3A 2DCUB 4NASA 1ZETA 2A10A 2DXEA 1VC5A 4FP9A 3DRRA 4B3RF 2XB2D 1CC7A 2H54B 3B78A 1Q8IA 3KG1A 3KMQA 4QQBA 4X4NA 3NAIA 1LW2A 2W4DA 1WKKA 4M95A 1IBLJ 3AOAA 1TP7A 3AOCA 3HHNB 3OXFA 1NHUA 4YOEA 2ZJQQ 3K5OA 3E2EA 1RAOA 1G2EA 4JI7J 2YNHB 3OTCA 5HJXA 4O44A 4MMOA 1HA1A 3AA8A 5KFCA 3H42A 1ICEB 3G8TA 4USMA 4I7FA 3SFUA 4LQ9A 2F63A 3I5CA 3M30B 3VGTA 1TL7A 2IM3A 3PHEA 4KGXB 4DSLA 3CTRA 4I0WA 1BQNA 3EWGA 5HBMB 4KHRA 3SFGA 4YY3J 1LWCA 2W2OP 1NH8A 3QT5A 3V2UC 3DMJB 1VBYA 1SKWA 1SKRA 1LNQA 4I56A 2KT2A 3LP2B 2BX6A 2JWNA 3SQOP 3MEKA 3UQSA 5DETA 4CT9A 2ILZA 5D77A 4GC6A 4MK7A 5KFOA 2OPQB 3ZNUA 3C6UA 4KPYA 2AYGA 3MWBA 4CH0S 3U27A 4C6AA 2E5HA 2MQ8A 4PAAA 2F8HA 1GFWB 2BE2A 3L7OA 4GKKJ 2XGPA 2D3ZA 4ZVHA 2MZRA 4GO5X 3OUYA 5B0AA 4ZIWA 1REVB 3W5XA 3W5ZA 2EFPA 4LF8J 1RP5A 2V4JA 5J1EB 3RG6A 4X64F 3PRBA 1ZTWA 4LF5J 4JYAJ 4K2JA 4JV0A 4KH1B 5GMEA 2YQ1A 1NJXA 2VJVA 4EUVA 5AXLA 4USWA 2OFHX 3Q8QB 1HBUA 1U7LA 3JSRA 4KY3A 5F0WA 3RR7A 2XNRA 4MKBA 2CPZA 2MY8A 4FS2A 3GWCA 4OYMA 5DLGA 1QUVA 1HYSB 1RHUB 4CO1A 3MOJB 4CLFA 2OPPB 1AT1B 4QW8A 1XQIA 1N36J 2VOPA 4RW9A 2VICA 1X9SA 2KI2A 2OSQA 4O4GB 2CPHA 3H40A 2CPFA 1RTDB 4DR4F 1G1XA 4NXMJ 1K47A 4GMKA 1DTTB 3BBFA 3MMJA 1TUWA 3DGPA 1OQ6A 3ULHA 3CCVS 4RW8B 1S4FA 4CH1A 1QVGR 3BSCA 2VIHA 4JUZA 4YR0A 1P27B 1F5AA 4ZP8A 3PO4A 4OJGA 4J37A 3D5MA 4QIEA 4EBDA 3UNYA 2CAJA 2B0GA 2XEXA 1NB7A 2FJDB 3P4UB 1FFGB 2C2EA 5IOLA 1BD6A 1VRUA 1BQMB 2ZNYA 2VL1A 4KGZB 5GMDA 2C3OA 1S6PB 3WX8A 1YVFA 1PAEX 3OD2A 2RRNA 1YJ7A 3N5BA 3QWPA 2P2CB 1UEVA 3UDEA 1RK8A 2BE7D 1WTBA 2BYCA 2FY8A 4DV3F 5DGBA 4OYPA 1RWXB 2RF2B 4QCLA 1S48A 2G2ZA 1KN6A 3W9IA 2ERRA 1ZOTA 2MYFA 2YWFA 2LA4A 4UOFA 1TV6B 4QPTA 4LMZA 4ZA1A 3AB4B 2NXUA 1PSDA 1Y0HA 1KSPA 2DISA 2VB6A 3A12A 3V6JA 3W63A 1C0TB 2RAQA 4IYQA 4WXWA 1JMTA 3GP9A 1EKRA 2DRAA 1TKXB 3UWTA 2RRAA 1VRQC 2C2KB 2YWKA 1WKLA 2HLTA 3DOMA 2U2FA 1D8ZA 5AXKA 2ALYB 1C1BA 3I55S 4DU8A 4ID8A 5DZ7A 5DDQC 1TVRB 4L3KA 5ETPA 4C3LA 4ZLPA 4K4UA 4GO7X 5B0BA 5HMXA 3PNIA 1EP4A 2HVHA 2UXCJ 4ED7A 5B0FA 1Q5VA 1GXTA 2RMLA 4BC7A 3IS9B 2ZZMA 2NYHA 1M1KT 3K0JA 1YQHA 1EQ0A 2CA9A 4WK3A 3TEGA 1KWMA 2VUGA 3THVA 3PX0A 1RZMA 3G6XA 4EYHB 1EZZB 1LWXA 1P1TA 1D9FA 3MPWA 4OJ1A 2ZM6F 3UN5A 2EC2A 3O44A 3FK4A 3M9MB 2RHSB 2GCFA 4WTYA 1LWEA 3NGSA 2GMHA 2JC0A 3D0HE 4IDKA 4B3SJ 1X4EA 5KG7A 1REGX 1NK8A 1F2HA 4IG0B 1IKXA 3IM9A 1H73A 1FD8A 3MMAB 1RKJA 1JLGB 1BWVA 1FKPB 1V3SA 1FRKA 2V6AA 8RUCA 4WE1B 4NCAA 1HW9A 2NXJA 4ZHRB 2AV5A 2KH9A 5JJBA 5E3RA 2RT3A 3DN9A 2GAHC 1RLDA 4MYUA 4W98A 4L75A 4I6YA 3CJTA 2GQCA 3IM8A 5CYQA 1RADB 4A8WA 1F5BA 5KFBA 4DV7F 5HI7A 5C7PA 3R8YA 3NCQA 1NO8A 5G4DA 4LFAJ 3G82B 3DDNA 4BWJA 3CJRA 4DG1B 2F8EX 3OQ2A 2FHKA 2CPJA 5HMWA 4BC9A 1Q4RA 2PT0A 3MM8A 2GGPB 2XMUA 3C6TA 4QIWD 2Z4PA 2CJAA 4NLSA 1WELA 5MLCV 4QYRA 1RKIA 1KVKA 1S1VA 3NY0A 1MU2A 2WOMA 3BQ0A 5IQ6A 3IN5A 2HIYA 3EM1A 1YJVA 1Z1ZA 4DV4J 2AJFE 3TW0A 2P6TA 3G87A 3DRPB 2CG4A 1R8PA 4KBIA 2BJ7A 3BZQA 2B9EA 1OIAA 2R8KA 3GZ7A 2VBZA 1V9OA 4FKXA 5LXYA 5I42A 4DHVA 1LV5A 3TI0A 1H74A 1JK9B 1RT1B 4Y00A 4NCGB 5GVQA 4RJVA 2DNQA 1OQ3A 3FFIB 3RBZA 4LFBF 4O3OA 1MW7A 4IFYA 4IRDA 3M05A 1VHFA 2E1AA 5HROB 1R0AB 4M5JA 1XN9A 4ZVEA 1FE4A 2CJYB 2B6AA 1GTHA 4OLPA 1TMMA 1EARA 4B3TJ 4ZCLA 5GADU 4DMZA 4TN2A 4URSA 4J9OA 2FVCA 2AHOB 1SV5A 3R5DA 2Z2ZA 3DRXA 1B0PA 2MLXA 3VGVA 4FDFA 4EFAC 2QEXS 4X84A 3RUBL 1MMDA 3BV8A 3HHEA 1B0TA 5KFDA 3CD5A 1CULA 2XYHB 1JLEA 4LF6J 4IFVA 3Q83A 4CYUB 1U1LA 4DFPA 1RT2B 4MTPA 1RAAB 4Q5VA 1KLNA 2YKQA 1Q78A 7AT1B 2EBEA 3UCUP 4ZVSB 3BQ1A 1YSJA 4GRSA 3HD2A 1SQEA 2YPYA 3TAQA 5JMNA 3PJ9A 2AGQA 1N33F 4JP8A 4L3NA 1IBMF 1VQKS 3MEGA 2H5JB 2VG5A 1NK9A 2A2CA 1YZ7A 4A8KA 3CC7S 3NL0A 5IFMA 1T8EA 4AXJA 1WC1A 1UKUA 3QYYA 2ZC4A 1FT8A 1N56A 3F0NA 3HVRA 2BRLA 4ZPTR 3R5JB 1Y10A 4RU9A 4PKDB 3MFIA 2EWHA 5CHCB 4F25A 3VAFA 4DX7A 4O3QA 3AJ2A 4YEAA 4YP3A 1DLOB 3V4IB 3QMQA 1RI7A 4G1QB 4DV1F 2YNFA 2A18A 2I2YA 1A6LA 3NRBA 1B7YB 4JI4J 2WB1D 2ZKUA 3POTA 4K0KJ 4MKVA 4EZ6A 1R8CA 4RNOA 1T9YA 1UZDA 3KK1A 3PIOQ 2AU0A 4WFXA 3O1LA 2E5LJ 2HBRB 2KRBA 1BY9A 5KG0A 2G2YA 3P6YC 2KT5A 3UCZP 2ASJA 3J81Y 1KQFB 2XSFA 3K5PA 2QL7B 1NB2A 3CCLS 4LRBA 4MKAA 3GQCA 2RIJA 1JLCB 4B3OB 2RUGA 3W5YA 2IVFB 4UUXA 2XI3A 1MWQA 5AE1A 2H4YB 4MYTA 4RNHA 1PKUA 2HNYB 2M0GB 1CQMA 4DLEA 2Q6BA 1QD1A 2JDJA 3CEDA 2XZDB 4RW7A 4OX9F 5JXSA 3T19A 4LQ3A 4P7VA 4YS2A 1MSWD 2W01A 2LP4A 4H4MA 2HHHJ 3PJXA 1U09A 3KLFB 4EZ9A 1T05A 3MAQA 1I94F 3M1VA 1RA6A 3V6KA 2B7CB 5C42B 1WWHA 4CLLA 4TYBA 2EFVA 4B08A 1OSDA 2HMIA 2PMZD 2R8GA 3PX6A 2DHSA 4LBIA 3CCSS 5J2PA 1ZYQA 5E3AA 4QWAA 5A0YA 2GJFA 4I6AA 2B43A 1R8BA 5HN0A 4AL7A 1U1NA 3ZO7A 3PZPA 3UPFA 3LGNA 5IT0A 1UVKA 1H6KX 4PG7A 1KQGB 5H1SV 3I82A 3MR7A 3EXYA 1TFYA 3TR5A 2L08A 1Q5YA 4BWMA 4DR6F 4KIAA 2HRYA 4DSKA 1BMQB 4X66J 4QR0A 5B7WA 4IG3A 3AHPA 4X4VA 1RT3B 4NA1A 5FJ4A 3DI6A 1AROP 3BREA 2GQQA 2GVZA 1KRPA 1FEHA 4QYZK 1RACB 3DLHA 2IIHA 2KXNB 8AT1B 3M2UA 4ECUA 4LJMA 2PEHA 1ZAVA 3KJVB 2LDYA 4ETZA 1S0VA 5BYQA 1ULRA 4ZOSA 1NHVA 4B17A 2XMAA 3QRQA 5FD1A 1S1TB 2VV5A 2PE8A 3IRXB 3QLHA 1VISA 2OMLA 1KBRA 1UMJA 4KV8A 3NXZA 2UVUA 4QWDA 2GX8A 4FZVA 5HVFA 3CULA 3GJSB 3RB4A 3KLHA 3CJ3A 2UXBJ 1E6YA 4LSLB 3TZYA 4YN3B 3T1YF 2QYCA 3DM2A 2HVDA 4XPEA 3HHLC 4NLDA 2MGZA 3E01A 3OLBA 4WFYA 4EMDA 1OMSA 2CJXB 4HI1A 2AIRB 3D4JA 3V81B 5D6GA 5BR8F 4B3MJ 1U1PA 1SUQA 2L9NA 3WC2A 3B4DA 5KFGA 2X3DA 3UNGC 4ZDNA 1YJ9S 3ILLA 3KJQB 1VQ6S 1U45A 3JAMY 3DLJA 1BQXA 1XNQF 2HVEA 3MUVP 3L95X 1EHWA 1FERA 2FJAB 1HWIA 1G6BA 2V4QA 3VR1A 1HBMA 2WBRA 3QSIA 1CJUB 2HHUA 2AEFA 2DJWA 2NREA 3THTA 1KONA 1HL6A 3NGUA 3VCDA 2W2NP 1NHKL 3OPKA 4PXBA 3BGRB 3OSNA 3QZ8A 3KUGA 2MEWA 2HGNA 3HF5A 5K8OA 4WKYA 5DGAA 3T5KA 1LFPA 4ED4A 3R97A 4ATNA 4WBFA 2JEIA 3DYAA 1SH3A 2DH9A 4L72B 5LM7E 2ZZTA 3R27A 1RAHB 3MPUB 1Y5NB 1RWVB 4FKYA 2F1FA 3IR5B 5E0OA 2WTFA 5IZHA 1RHRB 1BWEA 4RBTA 1O8BA 2PEBA 2FPHX 3PRVA 3WIVA 4C3KA 1JKHA 1M5HA 1KC8T 4JI0F 2AW0A 4P10A 2N82B 3RW6A 1C1CA 3JB9k 3ONQA 4FNIA 2IBKA 2ZH7A 2A6MA 3GG0A 3IBWA 1JXLA 2CVEA 2Y1IA 3U1NA 2U1AA 4RWXA 1U1RA 4A8OA 4OHYA 1T9UA 1IM4A 4N77A 3CCES 3K8WA 3A3OB 1P9YA 1LW0B 3ZZ0A 2YKOA 4Y2IA 2VC1A 4IQMA 3H4BA 3MR5A 5CQGA 2CJQA 3TZXA 4DSIA 4EWTA 3WX4A 3ZTRA 2DNYA 1J2VA 2CKWA 5MAOA 2GIFA 2Z2MA 1X7VA 1NPPA 1H38A 1I51B 4TXSA 1RTJB 4YHHF 1TKTB 1NDKA 3T9ZA 4KGKA 4P2SA 3A8EA 2QA1A 1BGXT 3DKDA 4MKYA 4FXVA 1SVDA 1RA7A 1AZSA 4ERDA 4I2QB 1RT4B 2VH7A 1OY6A 4IUFA 4NMLA 3G6VA 3L7UA 3MR2A 2H48B 3EPIA 3I0SA 3QJLA 3IBFB 3DC2A 1FXLA 3OLAA 1H7WA 2V2ZA 2G1HA 1XTZA 5DQIA 1OPIA 2ZOGA 1RAIB 4CLYA 2J8SA 1MMLA 3CPWR 2DGOA 3HMJG 4DR3J 2W25A 3T1HJ 3PXGa 1X4DA 2FHMA 3OTOJ 3H5YA 1RGVA 2HHPA 2O3DA 4ENOA 1N6QB 1SB6A 2ZHAA 3OR2B 4U9RA 2HWIA 5KG1A 3S8SA 4QR1A 1YJUA 1TR0A 3CDEA 4LIRA 5L1LA 4KKOA 5B0DA 2QA2A 2UUWA 3HPOA 1VRTA 1O51A 3HVAA 1GEHA 2HFVA 2XTJP 5CYJA 3AJDA 4DPWA 2J6SA 4LFCF 2YBVA 3QGHA 3TJAA 2FJBB 1HHTP 4Q7AA 3DXSX 3OT9A 1DQ8A 2OSRA 4UQGA 3KG0A 1T9XA 3UW1A 1RBOB 3CDWA 4NE9C 2HQGA 3R7NB 2ZH3A 3BJYA 3HP6A 2AD9A 4OI1A 3BKTA 3TVZA 3OFEA 4LF7F 1XMOJ 4KFBA 1EKSA 1E6VB 4DCOB 4O0IA 3G9CA 1N48A 3LPYA 4O3NA 1CQNA 2OH2A 3R2DJ 1MN7A 3HULA 4M5MA 3ZC4A 1KD1T 2GVDB 1H3DA 3TZWA 2K3IA 2BJ8A 3GV7B 3N5FA 2XMTA 2DY1A 4DQSA 2MJNA 2PO4A 4WCEQ 1S9EB 2HBYB 2QE5A 1J5OA 3I6PA 3IGVA 1KVJA 3MCSA 4WZQA 1FD2A 2KHDA 2HFUA 5F8HA 2BKNA 3CCMS 2C2RA 3IO1A 4OHZA 2J0QD 1F3FA 2AF6A 3ZFVA 3V4MA 3LOUA 2AYBA 3C15A 1CJTA 2JFKA 2E1CA 2KVQE 3ZTPA 2UUAF 3CJ4A 1J27A 2W8KA 4J90A 3D0IE 4B3RJ 4ZCIA 1T3OA 4NL5A 2HPUA 3VWSA 1IBKF 3Q2TC 3Q89A 4ZJOA 4RL1A 3LA0A 2POKA 5F8MA 4N7TA 1LQ9A 2YKMB 4F4WA 2V9WA 4HVZA 1VR6A 3H20A 3SYZA 2B4VA 2XWXA 1ZTTA 2HVIA 4DR7F 3TA2A 2HRUA 3TAMA 4E8UA 5ETKA 1FK9B 1Q53A 4GVBB 1VQ9S 2NPFA 1RWWB 3N4WA 2DR8A 3SDEB 4C11A 3PEHA 1S72S 1TZ0A 4E0DA 3AY0A 3NGRA 2YWHA 2V63A 2W8LA 1OYDA 2V4RA 2IRXA 1WC0A 1S9FA 4MJKA 2V5HG 4ALZA 2ZUGA 2DIVA 3THPA 4W4MA 4DSJA 1NKBA 3QFWA 1O6XA 2C2NA 3GCWP 2AEJA 4CIOA 4A4JA 4C4WA 3ZTSA 4DSFA 1WHXA 2VQEF 3Q23A 3KLEB 3V6DA 2JFDA 3K57A 2B9WA 3EXCX 4O23A 4L74A 2I6WA 2Z2LA 1HNVA 3AQPA 2FGCA 3JYTB 2SXLA 4DQQA 1H7XA 4Z7YA 1PC5A 4DQIA 3J7YU 1JLAB 2JHEA 4G6VB 4RUHA 2CJ9A 3ICLA 4M5GA 4NCBA 4OI6A 1HNIA 3OTEA 4ES1A 3CD0A 3TAPA 2ZFHA 3KHRA 5J2NA 4OX6A 5G0RA 1IR2A 3OTDA 3CVKA 4DUTA 4F7VA 4MT1A 2MQNA 2C2MB 3AH6A 3ELHA 4ANCA 4PPDA 1K8AT 2EK1A 2EG1A 1LW2B 2NQPA 1X0FA 3HCXA 5HP1A 3DRSA 2IRYA 4IH7A 3P5TL 3R7SB 3CWJA 2XS2A 4O44B 5F8IA 1R6YA 4ID5B 4F04B 3JSYA 3CCTA 1FO1A 3E51A 1IBCB 3H2VE 3TA0A 2FIUA 1YLXA 2DRDA 3GIMA 4DR5J 2ZZNA 1LK7A 1PJ7A 3SCKE 1GK8A 1TL7B 5F3ZA 2V2QA 1GAOA 1WSVA 3KUEA 1L3TA 2FJWA 4BLGA 2DNPA 2DRBA 1NEEA 2G1DA 2XSJA 2CQPA 2HAFA 2VONA 2KZZA 4HHHA 1ZH5A 5J2QA 1DY3A 1HARA 1P6TA 2AZ3A 2HW3A 5IWAF 1LFWA 1XNRF 2HGLA 2AGPA 2KFNA 2AMCB 4P74A 3N6MA 4IRKA 1M5PC 1QE1A 3HLUA 2IDEA 1B99A 2MKCA 4FXDA 4OIXA 1Q0NA 1FTCA 5L46A 2B8PA 5KT4A 5D3GA 3I4PA 4IO9Q 3QIPA 1U0HB 3GIKA 3RB3A 4W92B 4KO0A 2DNGA 2KVIA 1T95A 1D09B 4ZIVA 2DHHA 5AXNA 4LUBA 4UTGA 3LQVA 2V4JB 3N9UC 5KFUA 4WU2A 1ZZFA 3ETOA 5KG2A 4S0MA 5ETLA 3KLIA 4WP3A 2A0FB 2I9SA 2DKOB 3PY8A 2MHEA 1HBUB 2Q3PA 1GNKA 2CPXA 1S4EA 3ENVA 4PXEA 2R7WA 4H4KA 1TK0A 4V1Ak 4DFMA 5HAOA 2DXDA 1WSRA 2B51A 2F4FA 4LT6A 2E9RX 4NMXA 1DHMA 3F41A 1FNXH 4DL5A 5LXRA 4Y65A 5E2QA 2VA2A 3M8PA 3GG1A 5KFJA 3TYTA 3TZZA 2KB2A 3M2VA 2UXDF 2RE1A 2G9OA 3P5BP 5KOWA 2C3PA 4X4PA 1NAQA 3M6UA 1T11A 3CJ2A 3LWMA 1SBRA 4AYBD 3T3FA 2L41A 4RU2A 1QAJA 1HI8A 2KL8A 3FZ2A 2IA0A 1NK0A 4U7CA 3TNVA 5C2CA 1U49A 4RR5A 1H2UX 4UY85 3OJUA 1S6OA 2DVIA 4KT0C 4ZPWR 4MK8A 3GCXP 1S7IA 2R2TA 5K9FA 5J2MB 2FVSA 1B7FA 1AXQA 1TQLA 3ENWA 2C42A 4X2BA 1VK3A 2WAQD 2ZH6A 4X4OA 3OBIA 3KWMA 1VRUB 3BDEA 2IC3A 3J81U 4QYZJ 4N5SA 3TUZC 1UWAA 3RGIA 4TY8B 2ZM6J 4G1PA 5KAKA 1IKYB 4DWIA 4MIBA 5BJRA 2PI5A 4RW4B 1N34F 2IMOA 2BANB 1V3RA 3CDUA 3M8WA 2DO4A 2OAUA 3UD3P 1Y00A 4L6V3 2R4FA 2R7TA 4WFBQ 1NJIT 1I6JA 2YQ3A 1R3NA 3DOLA 3BBBA 1IKVA 2J6TA 1NH7A 1RCXB 3HM9A 2UU9F 3R5AA 3BGLA 3UR3C 3EE3A 1UVLA 2LU1A 4MIWA 2HG4A 2C2DA 4RNMA 3LUYA 2OO4A 5HSPA 2BKOA 5DDPC 1C1BB 3HFVA 1TL4A 5C24B 3CCZA 1KQSR 1TK8A 2R7OA 4CT8A 3UN3A 2ZE2A 5C5JA 3MZIA 3LANA 2D9PA 1B0VA 2J7KA 1FRMA 2B4UA 1N8RT 2WONB 4NRUA 3S1TA 4M1KA 4RNFA 4IQXA 4RX6A 2YTCA 2LU2A 4WP9A 3CDAA 2V8HA 4C8NA 3QT8A 2IDLA 2NPIA 4OX7A 2PC6A 5GAGI 4B9TA 1U6BA 3QT6A 3KOAA 2DGWA 5F9LA 5ETRA 3M32A 2FYXA 1ZZNA 5KFIA 4JBCA 2ATLA 3G4SS 4XK8C 1VJQA 2D3O1 3M30A 4P73A 2MZTA 4X65F 5I3QA 3SQGA 2OEKA 3OV7A 3CJ8A 5AJ3F 1EB0A 4NYZA 5CYMA 4Q44A 1SJFA 4JI5F 2Q66A 3HI9A 5K8NA 4JV1A 2XG8A 2BW7A 2OIHA 3NEKA 2Y8YA 1TAQA 4PYAA 5CABA 2CXEA 5B0EA 3I9V9 1ZAWA 1YJTA 3AD9C 1LWEB 1T9WA 3ENQA 3LP2A 3CCQS 2J9CA 1VQOS 3DOKB 1IKXB 5KFSA 4OZ2A 4UUWA 1PCAA 2QLJB 3LGMA 4RUCA 1FNMA 1GXLA 2JSXA 2Y9HA 2VJUA 3C19A 2DHGA 1RT5A 2P9CA 4LFBJ 2CPYA 3A4TA 5D0EA 5LMNF 4LBHA 1Z2ZA 5KT3A 4JI6F 1REVA 3D6HB 3JAMU 3TQEA 2GIRA 4FF4A 3EMTA 5EWGA 3MEEB 3QZ7A 2JEJA 1YRXA 1T02A 3FNNA 3P45B 3SCJE 2XGQA 6FDRA 2JL9A 4K2XA 4TQRA 5CYQB 4N47A 3UE2A 1PGZA 4OX8A 3BO4A 3BPSP 3UDCA 4LSNA 4WFZA 2LA6A 2QMWA 2BJ9A 1WUUA 2RQCA 1IR1A 4XIUA 1W2IA 3FBCA 4FYVB 3R2CJ 2N3OA 3G8SA 2F3JA 4C3MA 4PR6A 3H2LA 3KFWX 1HLWA 3C6TB 3BR9A 2I1RA 1XR6A 4LVNP 4MFBB 4O4GA 1VQYA 2E7WA 1RTDA 2M2BA 5ETQA 1S0OA 4YB5A 1N33J 1MU2B 4NXNF 1DTTA 1HNZF 1HWLA 4F2SA 2JJ4D 3GYXB 3PW2A 2BEFA 2W2PP 2OFGX 4DPTA 2ZBPA 1VQ4S 2XO6A 4KHMA 4ECRA 1OYEA 2KG0A 4TYAA 4RW8A 2F4VJ 4YY3F 5F8LA 1C2PA 3TWZA 3RTVA 1RTIB 1SQGA 5DJBA 1KFDA 5L1JA 2W9AA 5A2QY 2DR9A 5LSRA 4GC7A 1PBUA 1HNWF 5I42B 1ZM9A 4CZCA 3G6YA 3PW4A 1RYRA 1BQMA 4K4VA 1WG5A 1S6PA 3TUIC 1HMVB 4ZKAA 4CLTA 4FYDA 2GIQA 2HHSA 4DN9A 4MAKA 2DHAA 2YVSA 1FRXA 1WF2A 4RKUC 3SCIE 2BA9A 1M1HA 3FMBA 5D8HB 2RF2A 4PYDA 2XYPB 3CDBA 1Z4UA 2B6AB 4YDDB 1JXEA 1KVIA 2QFJA 3WQPA 5FDLB 5HVGA 4LF5F 3R7BB 4JYAF 2EXUA 5EWEA 4H4OB 1U4BA 1TV6A 2HQIA 2Y0SD 1S1UB 2D41A 4HR2A 1T9TA 1X5OA 3MECB 4IOBA 1M5KC 2EFGA 1FVQA 2PD1A 4OJHA 3P3DA 2DR5A 1NMEB 3VQTA 1WF0A 1C0TA 1N32J 4LF4F 2QX0A 2MZ1A 3MMBB 3ISNC 2BACA 5KTQA 2A6OA 3RBXA 4CLZA 3ZNJ1 1CJKB 4NEZA 2YH0A 2MY7A 3L3CA 1B64A 2L9DA 4IFVB 1K0TA 3H4DA 1N36F 2MTLA 1NK5A 5CH7B 3BSAA 3IWLA 1UWBA 3C46A 3MM6B 3BF4A 4F3MA 2ADBA 1TAUA 2WVDA 2VG5B 4ZVPB 2XLJA 2AYEA 1NRKA 1WDDA 3IS9A 1F0XA 4ICLB 1DFDA 3MM7B 1HIYA 4NLWA 2RQKA 3D67A 4AD6A 2VKZG 2D74B 1IVZA 1VQSA 1HFEL 1CEZA 1QM9A 5DO2A 4DPXA 3G96A 2VPYB 1NM2A 1W7WA 1UL3A 3CF5Q 1VMBA 3POTB 2ZWPA 3GILA 4WIQA 3CMES 1TL3B 2CQHA 2VASA 3ZTQA 2IVMA 2I5JB 5C25A 5D4NA 3LH2S 1X4CA 2ZVIA 1QLNA 2GC8A 4M8LA 2QLWA 1N5VA 4IG0A 4C8ZA 2Z57B 1NU4A 2VC0A 1X4HA 2AEMA 3I0RB 2ZJPQ 4FPIA 2CDQA 1ZM2A 2L3MA 1KOHA 4WFNQ 3JSBA 3MD1A 1WD6A 2HS0A 4DCJB 1FKPA 3DLLQ 4NWBA 3JSMB 4WE1A 4ZHRA 5K20B 4FXWA 2AJ2A 2ZHBA 4X62F 3KK2A 2LLZA 1S12A 1S6QB 2CJKA 2N3LA 4TVAB 2CADA 3T1YJ 1N88A 4I2PB 2VG7B 3J80Y 3O2IA 4C8LA 1T05B 1YRUA 3V6HA 2GFFA 3M1VB 1HQUB 4AL6A 1X5PA 1WC5A 2HQDA 1HD1A 2FLNA 5HLFB 2YX1A 4KH0B 4USUA 1SIZA 2OEJA 4F4KA 3NNCA 2HMIB 3R1LA 1HNXF 4B9SA 3M9NB 5EUHA 2UXCF 1T03B 3JXOA 1PJ5A 5KT7A 2GV1A 3DU6A 1VHIA 5A0YB 2EVZA 2XWYA 3EDRB 1TELA 1NJZA 5L9XA 3EGVA 2XLKA 4M5DA 3PVXA 1RTZA 3GV5B 5DDRC 3MUTP 2EPIA 1RWMB 4EBCA 1UVNA 1FESA 4KPCA 3PO5A 1U6ZA 1HBNB 3HVTB 4YR2A 2R7SA 3KYLA 2GO8A 3PM9A 4DBQA 2AQ4A 3SSQA 3FDSA 1VBKA 2HURA 2NSCA 1O5JA 2GJ2A 2VFTA 4UW2A 4I64A 2LDIA 3DRPA 2W1BA 1RAJA 1EX8A 3J7AN 1R0BG 2RDJA 2IMWP 4B3SF 1X4BA 4RLEA 3CJKA 2DGSA 3D7SB 3C16B 3M2UB 2D3UA 4PCQA 2OD4A 4XDCA 1RT1A 2UP1A 2YWEA 4NCGA 4WWSA 3CJ0A 2X1GA 5K8MA 2HWHA 2XS7A 1GMWD 2Y1RI 2OP5A 4DV2J 4A47A 3QLHB 3H5XA 1FRJA 4KV8B 5HROA 2GMLA 4U8YA 2IPOB 4P2FA 2YKAA 5T41A 4ZVTB 2G0CA 5A8RB 3HFKA 4WPAA 2UUTA 5AE3A 4NYPA 3RRKA 1WACA 5F41A 1WOSA 2NS1B 5KFZA 3PW5A 4B9LA 4RPFA 1FXDA 3W3SA 3HJFA 2KDOA 4Q43A 1RBLA 4Y2AA 4JI3F 2WRMA 1F6TA 4QOTA 2R8IA 3C14B 4CO2A 2HEKA 2A1BA 1UETA 3FRZA 1VYAA 2DD8S 2X1BA 4KHPF 5KFTA 4R8UA 1DTQA 3KHGA 2CUYA 3A1YG 1UA1A 1YBTA 3LWLA 3PW7A 2E7VA 3UDVA 1M5SA 3RBDA 3AB2B 3VVUA 1WHYA 4F8RA 3QAEA 1RT6A 1Q81T 4YHHJ 3JTPA 4I6WA 4K50A 2BR0A 1RU2A 4Y6IA 2C3UA 4WK1A 2ILYA 3A3NB 3HO1A 1XC9A 4OZ5A 3ILIA 5KFQA 3LO3A 2WW4A 4DX8H 3NS6A 3IG1B 2B8QA 2QT7A 1FRLA 5E3PA 1U47A 5KFMA 3VZIA 2LQ8A 1HR0J 1DLOA 3M7VA 3V4IA 3BH6B 4ZP6A 2K2PA 4WTOB 2ZDPA 5GAHI 3LTOA 2LEPA 3FEZA 1DJ0A 4RNNA 1PBAA 4F4ZA 1FJEB 2ZH8A 1HHQA 2R7UA 2YNGA 3TARA 1JKHB 4O3PA 2D3OR 1ZPVA 3OVBA 1RUSA 5EHHA 2YKNB 4UT4A 1S49A 5H9EK 1GMWA 1UPMB 5GAHU 5LMUF 1VC0A 1JLCA 4ILMA 4LFCJ 4JI1F 2HNYA 1Y3JA 1IQZA 2HNDB 1CC8A 5SUHA 4XPCA 2PFDA 2RB7A 2OJ3A 4O0NA 4OZLA 2VHGA 4Q0BB 5FIIA 4DX5A 4N8NA 2OEMA 4LF6F 3UO0A 3KLFA 3B6BA 3HSDA 3CD7A 2RRBA 1FKOB 2AKWB 1TKZB 4K5RA 3RU0A 2KFYA 4NPOA 5DQHA 1P8GA 4DR2F 4ECSA 3QGGA 1VQLS 1OY8A 2Y1LB 2G13A 2NXEA 2XYGB 4U7UK 1NPRA 2JX2A 5JVGQ 1FE0A 1U8SA 5IM0B 4DL7A 2FDNA 3SBMA 1SKUB 1R43A 1U1MA 4UOCA 5KG6A 3M8RA 4R0JA 3FSXA 2QGFB 5L1IA 2XZTB 1UFLA 1RABB 3MTJA 2B7BB 2IAJB 1IJFB 2L9WA 4PQUB 2LXIA 1SQFA 3I0SB 2PN6A 4CQ1A 3AT1B 2QZ8A 4JI4F 4ECQA 5HVHA 2BJ1A 2VBXA 3R5BA 2B56A 2OGUA 2J0SD 2ZKTA 1WF1A 2IM1A 2Q43A 5ETOA 1AYEA 1NJYA 3WDOA 4U67Q 1QSLA 2E5LF 4C8OA 5LL6d 2OHDA 1AA1B 2GNKA 3OW2R 3GR1A 3RYLA 4QIFA 4GKJJ 4USVA 4KKOB 4R0EA 2VPWB 2DPJA 4J5OA 2HZAA 4CM2A 1C0UB 3IRXA 2DITA 2FVPA 1VRTB 4A48A 2DTJA 1IBKJ 3GFYA 4QPXA 5BYRA 2XY5A 2DGXA 2CRLA 3GB0A 1XBWA 2V34A 3HHLB 1IJEB 4N56A 2XHCA 5CD4A 4KSEB 2ZD1B 4OYXA 1PYTA 3H5UA 5U47A 1F5CA 3NGKA 1RSCA 4LSLA 3FCVA 3X3UA 4OQJA 2HHHF 1JJ2R 1AUDA 4LBPA 2PA8D 1NSQA 2W9BB 1YKWA 3V81A 3HX9A 3I56S 3SV4A 4B9UA 3T6BA 2HSEB 1RU1A 1FX2A 4ELTA 1KR4A 4DXLA 2RD5C 3OXGA 3HT0A 1JWWA 1X4GA 1PG5B 4KGMA 2KFZA 2KM8C 1S59A 2C2OB 5KFYA 2KZMA 4QJVA 2QFIA 4PWWA 1TUGB 3Q8UA 1IKWA 4QZVB 3B82A 1OS5A 2ZH4A 5F8NA 1NPKA 1CJUA 3KLGA 3VHQA 3FBFA 2VQEJ 1WDTA 2EI5A 2ZVSA 1KS2A 2JEFA 4NZ7A 2EW9A 2PSZA 1APSA 2FHOB 2VQFJ 3TO8A 2B9YA 5DLFA 4KAIA 1LK5A 1DBDA 4FPRA 2MJUA 5ETTA 3DGVA 2K1RB 3W65A 4B9NA 4NI2A 1WC6A 1XMQJ 2HAIA 2O01C 2HFNA 2BUNA 5I3UA 3D3BJ 2XS5A 1AUSL 3IR7B 4BHQA 3R6GB 5E41A 4YB1P 2ZNZA 2H1YA 1RAFB 5DDOC 2FGOA 3CO9A 5HL7Q 1T94A 1BLUA 3TX8A 3GR0A 1F9FA 5KFKA 1UCNA 4HI2A 3OL7A 2WW8A 3NLCA 4Q2LA 3KHHA 3MPDA 3Q8VA 2CQ3A 4F0HA 2EFOA 3WC0A 1HWJA 3VAHA 2AGOA 2QTWA 3IWNC 4I68A 4OLOA 4P9SA 2F9DA 2UXBF 3BH7B 3P8BB 1WJ9A 1CS4A 3LP0B 3TAMB 2NYIA 4O3SA 1X31C 3PFEA 2MZSA 2QG9B 3MPYA 2EBGA 1FTRA 1OY9A 5B0GA 3QT7A 4C11B 5CZVA 3TUPA 1JLFB 1VGYA 1JIHA 2YWGA 3W2WA 3JTOA 3UCGA 3IXQA 2KRRA 3ITHB 1B4SA 1LW0A 4ECXA 4WIIA 3FSIA 5H9FJ 4EI2A 3SCLE 2IRUA 3O3LA 4OI0A 3VQSA 3L09A 4KB7A 2QA4G 5D4LA 1SXLA 4UQTA 2XY7A 1JLQB 3M2RB 5IWAJ 1S76D 3ISZA 3V6DB 1XNRJ 4WP8A 5D0HA 2ASLA 4B9VA 5GADI 1RTJA 3KTQA 1TKTA 4DF8A 2PMWA 3OL6A 1FF2A 1YDLA 3IAM9 4CO4A 1VQPS 3GPAA 4HH1A 1WI6A 1RYSA 1HNIB 4CLUA 2O66A 3S01A 2J0XA 5J2NB 3NG8A 5G0RB 1RT4A 2OPRA 2ADCA 1EQMA 2BM1A 1YJNS 4K4ZA 2QV6A 1YJRA 4DZ6A 1KQKA 4P6QA 1KDNA 4ES3A 2MZQA 3HXMA 4N41A 1RISA 4QU7A 3W8PA 2KXFA 1WI8A 3GE9A 2YNIA 4K4TA 4NA3A 3LF0A 2PMHA 5HP1B 2JEGA 2FQQB 3M9OB 3KJFB 4GVLA 1F9HA 1LXNA 1N6QA 2FC8A 4EYIB 3OR2A 3D2WA 3B54A 4EO6A 4X4RA 2CQ1A 3PRDA 2V69A 2WK4A 4QWEA 1SJ1A 2V2KA 1ITPA 2CQDA 5D0GA 4JV5J 5A2QU 2MQLA 2RU9A 4ECVA 4DV0F 1NBEB 2FC9A 4LR9A 3UN2A 4TKTA 4PRFA 2G4BA 2X7IA 4MIAA 5ETMA 4FN5A 3AD8C 1YK9A 9RUBA 1YZ6A 5KT5A 1RBAA 2P6SA 4NEYA 1FX4A 3IA0A 2XSJB 3MGJA 2G0JA 3KK3A 2X1AA 2I8EA 1UJ4A 4F02A 1VCTA 3G86A 3EUNA 4OZ3A 3CIMA 2D69A 1SKSA 3MEDB 1TK5A 3CCWA 2VG6B 4ILLA 4MK9A 3CIZA 4USKA 1XIQA 1S9GB 1Y5IB 3NAHA 1JXVA 4OHVA 4Y28C 2H5EA 3PKMA 3FQKA 1UW9A 3J7ZT 3HKZD 4KO0B 1MROB 2E29A 2GVDA 2FVRA 4QWBA 3PFOA 2WVBA 1UPPA 1HKAA 2CNLB 2ZBRA 1WEZA 5T7LB 1YHQS 1Q8KA 2R7XA 1S9EA 4OZ0A 4JI2J 2OD6A 5K5MA 3MM5B 1U8WA 3MM9B 1NNDA 2HS4A 5LJ3Y 1RQ0A 1U2RA 1SC3B 3RAMA 2R9LA 1RWPB 3R9LA 4FYWB 3T1HF 6FD1A 2UU9J 1M90T 4U95A 2DXFA 2Q79A 1UTAA 5K14B 3G2XA 3NMAA 2DGQA 1ROFA 2MLZA 1V5IB 3I5AA 1PO6A 1NXIA 2GHPA 4NLUA 2WSFC 2FLOA 3DLEB 1Q79A 1IN0A 1PAUB 4Y2CA 3SEOA 2ZH2A 4DJBA 4AE5A 2QLFB 3FQLA 1Q7YT 4CLWA 2V8PA 3KG4A 1WC4A 4LR7A 3QO9A 1X9WA 3VAIA 2KG1A 4PG6A 4NA2A 3V5RA 4C8MA 4KYZA 3FGVA 1FK9A 1HI1A 2J7UA 4P71A 1I3OB 4ZCKA 4C48A 2LXUA 3LAMA 2M8HA 4A8SA 2FZCB 3SDEA 1NSKL 4LVOP 3F44A 3WIUA 1WHWA 2CQ2A 2V9KA 5DM7Q 3FBBA 3Q8SB 1XMOF 3I96A 3LP1B 4ZCMA 2CQ0A 4ED5A 4JI5J 2VFUA 2W7PA 3NWRA 2EK6A 4K7QA 3EZUA 4FYXB 4DL2A 3JTNA 1V6HA 1QAIA 1N4LA 1D0EA 1KLMA 2VZ9A 2FY1A 3ILJA 3KDNA 1HWUA 3HJVA 3UDLA 3Q24A 1JB0C 4B02A 4NLOA 3HDSA 4ECTA 3KLEA 3CJ5A 5ETSA 3AD7C 4WU3A 4IR1A 4NLGA 3VAJA 4DL4A 3J80U 1JX4A 4OYWA 3JYTA 3Q8PB 1HBOB 1AW0A 1S1WB 2E9TA 1Q8BA 3FRYA 2HNZA 5EX0A 2OELA 1U0SA 2A2DA 3MAHA 3UR0A 1YJWS 1IKVB 2ZBCA 8ATCB 4DUZJ 4ZVFA 4NX9A 2Z0GA 1JLBA 3G8QA 1LXJA 1S0MA 4K59A 1EETA 2CIMA 3D6TB 1BUXA 1U48A 3QFHA 1L3SA 2LECA 2ZE2B 3ZZTA 2MQQA 2O1PA 1L3UA 5CD4H 4AQYJ 3NMRA 5A8KB 3MR3A 3OHAA 4OL8A 1IWGA 9ATCB 4CTAA 4CNYA 4ID5A 1X4FA 4C97A 1U1QA 1PC4A 3RJMB 1WORA 2QA4S 4TLQA 2CG8A 4R5PB 1HQ2A 1U2FA 3OSPA 2KYZA 2P9GA 1TFWA 3M32B 1S1XB 3NCPA 5AE2A 2OTLS 4PWDA 3NOCA 4PPZA 2AYMA 3EJMA 1YI2S 1N5YB 1J5EJ 4NXNJ 3QRPA 1HNZJ 3SQGB 2LXFA 1D8YA 5CYMB 4KQZA 2PIIA 2LQBA 1ZAXA 1D3WA 5A8WB 2QYGA 1NJWA 1WTFA 3OVSA 4FF2A 4JI8J 3D54A 2RKIB 4HTIA 3KKFA 4LRAA 1HNWJ 5J1NA 2J0WA 1FDBA 4PXCA 4UOGA 4ELVA 2FUG9 5DG9A 1FVSA 5L1KA 1CBKA 3GV8B 1RT5B 2BQUA 3KLVA 1HPZA 2EFQA 5HQLA 1U0HA 1D9AA 5EX3A 2V0NA 5H9EJ 2GAGC 3D0GE 4C9DA 1L3KA 4TQSA 2OKQA 1KHWA 2APOA 4V19X 2D9OA 3MCOA 4W90B 3NBPB 3BB5A 5KG4A 4PG8A 3GJTB 3R6LB 3I5BA 2AP6A 4N76A 2PI4A 1VDHA 4DL3A 1SJQA 3A8IA 4LSNB 3HSZA 4DR1J 4LF4J 1I1GA 2ZOFA 2UVWA 4AT1B 5GMKa 2R2UA 2MKSA 4M5KA 1SL2A 3BKFA 4OI2A 1S79A 3LAKA 4LRDA 3KJNB 4UZCA 2NCKL 2DO0A 2C28A 2MPUA 2WSCC 4KC5A 1Y9OA 3KXDA 1VQNS 4EEYA 4ED1A 1ZM4A 3JS9A 4ZJLA 4DR5F 1X5SA 3RAQA 3CJSA 3SSRA 4AXIA 3O8WA 4CO3A 1M5OC 3RB0A 2RDDA 4KGVB 5J2MA 3DNCA 1HI0P 2IA6A 3CGIA 4HL9A 2H4WB 2DT9A 3MCMA 3A13A 4K5SA 3H25A 2EG2A 2B5JB 3S6EA 1MWZA 2J9EA 2D1CA 4NZ0A 4K4SA 2QMUB 2RQMA 1XJWB 2Z2YB 1NKCA 4DQPA 2HHVA 4TY8A 3AXMA 2BOAA 2CYYA 1IKYA 2ZEJA 2F7VA 4ECYA 3SMZA 4RW4A 2F8MA 1SC4B 2OLWA 2LEBA 3Q0AA 4C0OC 4RW6A 2QSWA 4CP5A 2BANA 1SC1B 3QNWB 2JLGA 1HQEB 2DHXA 3U1LA 2N7CA 5B08A 1UJ6A 2FHJD 4FF3A 3CC4S 2N4DA 3DLGB 3GJRB 4X62J 5M2UA 2HZVA 1F9EB 4M5HA 1NKEA 2MSTA 4DU7A 2MKJA 3BGUA 2H9ZA 1FRHA 3GTYX 5C24A 3PYFA 4YMEA 1JJCB 1LWFA 2C1EB 1UWBB 2R8JA 1WC3A 3IRWP 2RNEA 3P49B 2JOQA 4A8MP 3D1HA 2WONA 3CCRS 4PG4A 2UV8G 1HNXJ 3CSKA 2XZWA 2JLFA 2QLBB 2AJ1A 1W26A 3T9NA 4F67A 1ZA1B 1FDNA 4DPOA 1SH2A 4NRTA 1DRZA 1YITS 1PILA 4Y0FA 3E3XA 4FF1A 3K2YA 3BEGB 1O0PA 3M6XA 7FD1A 4IRCA 1R8HA 3KNAA 3GYNA 4DV5J 3S7RA 1IQTA 3H8YA 2OPSA 4M5NA 3K59A 1CJVB 2G0IA 4CH7A 4AL5A 1N0VC 4NYOA 5IQQA 2YWWA 2L48A 3CXCR 4OI3A 1ACMB 2LQ9A 4LSZB 4H4KC 1TL1A 5C25B 4TU8A 1VBXA 3DOKA 2K3KA 5DS7A 3MAAB 1R27B 3UVJA 2MLYA 2HHQA 2CJBA 3M8QB 2DBBA 4PUOA 3OFGA 3GFZA 1FJGF 3RZAA 5A76A 2XI2A 2CWKA 2IM2A 2FZGB 2HZCA 3NP5A 3KK2B 5L38A 2E5GA 1R7IA 3MEEA 4F3OA 5D78A 1U1KA 2VDIA 3T41A 3CT9A 2QRRA 2HBZB 1QSYA 1RHMB 2FHJA 3GJQB 3QSYB 2ACYA 2JVOA 1PIEA 3DCAA 4JI3J 1UAWA 1KEKA 4F4YA 3ET6B 2DYAA 2VFRA 2K06A 3PR4A 2RUSA 4EO8A 3MMCA 3RB6A 1UVMA 2HQFA 1UFKA 4G65A 3GU0A 3J7YI 1BHNA 4K4WA 3QRRA 4KHPJ 1JJHA 5CXTA 2QJ3A 4YDXA 5ETNA 2JC1A 2E7XA 1RWKB 3DHXA 2IBOA 4DI6A 4MFBA 4DV6F 4M5DB 3LGHA 2YQ0A 4YQWA 3A8KA 4XAKA 5THWA 3SZ2A 2V8VA 2HKEA 1T9VA 2MXYA 2XCPA 3HZEA 4X4TA 1VQ5S 2XC9A 2AT1B 4BCAA 1RTIA 2P9EA 2UUCF 3CJKB 4X64J 1F3VA 3DRRB 5I4MA 3GFHA 3H90A 2GZOA 3A8JA 3AAWB 1QDUB 1HMVA 3NCRA 4C0HA 3E8OA 1NDCA 3Q8YA 4P7TA 2HYIB 4J9NA 4Z7CA 4X4QA 3R5CA 1FWLA 4Q8FA 4P52A 4KR0B 1RT7A 2DY9A 4DX6A 2XMKA 4QIVA 5IXUA 1JNZB 4LREA 5F9NA 4HEA9 3B4MA 2V50A 1N0UA 1YTYA 3DLKA 1WG1A 2HFSA 5FDLA 3NNHA 3BBCA 1N54B 3K17A 4H4OA 2UZAA 2WCXA 4I7FB 5LSLA 1S1UA 1RTHA 4TY9A 2QSFA 3MECA 4DR4J 5LMUJ 3OR1A 4NLTA 2C3YA 1QAXA 2HGMA 1K1QA 2VKRA 3W60A 2RILA 2ROPA 2FJVA 4JI1J 3BGFA 3MMBA 5FLXY 2UUBF 1BQNB 2HLUA 2R2RA 3FBEA 3N28A 4DL6A 1LWCB 4NZ6A 1CJKA 3EX7B 3VTIA 4CO0A 4R8UB 1DTQB 3MURP 4E2FB 4F3QA 1TL5A 3MM6A 2NUHA 4DR2J 2IFXA 2V94A 3C6UB 1RT6B 1QTMA 4M5IA 4NLVA 3VAGA 2BE2B 4DV3J 2F4VF 1GH8A 4ANDA 3R5GA 3L9ZA 1QUPA 3OUYB 1FHTA 3O6QA 4OZJA 1OJ4A 4ICLA 3EGNA 1FJ7A 3MM7A 2VBYA 1W25A 2X51A 4L76A 2MKKA 4ZK7M 2MSSA 5BXIA 3NS7B 1V5VA 2XO7A 4WYWA 1FDDA 3BYPA 2J8AA 4ZVUB 1N52B 5ADZA 2MKHA 1R89A 2NZCA 3D1OA 2BV3A 2RU3A 5T14A 1TL3A 5I3PA 3T5HA 4HT7A 2XM3A 3MF5A 2YNGB 1DAXA 5EGYA 1N5SA 4AFFA 2I5JA 4WKRA 3W1YC 3TX0A 2RH3A 1R31A 3WHIA 3FEXB 3SXLA 2BJ3A 2ZOMA 4RW9B 3I0RA 3QGPA 4OHWA 3PKYA 4QIGA 4JOUA 4NLRA 1RHKB 5E33A 1M0SA 2QO3A 4K4XA 1UW4A 1DZ5A 4PXDA 3W2VA 2RJZA 1GMUA 2XQCA 3JSMA 4IOCQ 1N32F 3DGPB
chains in the Genus database with same CATH topology
2DXEA 1NSQA 3NGTA 1NDLA 1BE4A 3EM1A 4DI6A 3VGVA 3B54A 1S5ZA 1NCLA 1B99A 1F3FA 1NUEA 2BX6A 3BBCA 3FKBA 3NGUA 1XQIA 3ZTQA 2B8PA 1NDPA 1NHKL 4W98A 4UOFA 1UCNA 4UOHA 3L7UA 3ZTPA 3BBBA 4O0NA 1BUXA 2ZUAA 1NSKL 1WKKA 3ZTSA 1S59A 4C6AA 4F4AA 5BXIA 3Q83A 2CWKA 1NSPA 3MPDA 3Q8VA 2B8QA 4FKXA 2NCKL 3BBFA 4KPCA 1U8WA 3EE3A 1S57A 3FBBA 1WKJA 1MN9A 3B6BA 5CABA 3FBCA 3FC9A 3Q8UA 4CP5A 3GPAA 3Q89A 3VGSA 4EK2A 3BH7B 3DDIA 5C7PA 3FBEA 1LWXA 3PJ9A 1F6TA 3R9LA 3BH6B 3JS9A 2HVDA 1LEOA 4UOGA 4S0MA 1NPKA 3GP9A 2HURA 2DXFA 1HLWA 3Q86A 1NB2A 3FBFA 3VGUA 4ENOA 4ANEA 1VYAA 3EVMA 3G2XA 1WKLA 4WBFA 1MN7A 3ZTRA 3NGSA 1HIYA 1NLKL 1PKUA 4F36A 3FCWA 4DZ6A 2DXDA 3EVWA 3EICA 3VGTA 1HHQA 4HR2A 4FKYA 2DYAA 1NDCA 5IOLA 3Q8YA 3ZTOA 1KDNA 1ZS6A 5CAAA 3ENAA 1K44A 2AZ1A 2BEFA 1XIQA 1B4SA 1NDKA 3PRVA 4DUTA 2AZ3A 3WX8A 3FCVA 1JXVA 1PAEX 1BHNA 2DY9A 3NGRA 2HVEA 3ETMA 3VVUA 1W7WA 3EJMA 3EVOA 4ANDA 3ELHA 1EHWA 3EMTA 3VVTA 4ANCA 3DKDA 2VU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXE A;  1NSQ A;  3NGT A;  1NDL A;  1BE4 A;  3EM1 A;  4DI6 A;  3VGV A;  3B54 A;  1S5Z A;  1NCL A;  1B99 A;  1F3F A;  1NUE A;  2BX6 A;  3BBC A;  3FKB A;  3NGU A;  1XQI A;  3ZTQ A;  2B8P A;  1NDP A;  1NHK L;  4W98 A;  4UOF A;  1UCN A;  4UOH A;  3L7U A;  3ZTP A;  3BBB A;  4O0N A;  1BUX A;  2ZUA A;  1NSK L;  1WKK A;  3ZTS A;  1S59 A;  4C6A A;  4F4A A;  5BXI A;  3Q83 A;  2CWK A;  1NSP A;  3MPD A;  3Q8V A;  2B8Q A;  4FKX A;  2NCK L;  3BBF A;  4KPC A;  1U8W A;  3EE3 A;  1S57 A;  3FBB A;  1WKJ A;  1MN9 A;  3B6B A;  5CAB A;  3FBC A;  3FC9 A;  3Q8U A;  4CP5 A;  3GPA A;  3Q89 A;  3VGS A;  4EK2 A;  3BH7 B;  3DDI A;  5C7P A;  3FBE A;  1LWX A;  3PJ9 A;  1F6T A;  3R9L A;  3BH6 B;  3JS9 A;  2HVD A;  1LEO A;  4UOG A;  4S0M A;  1NPK A;  3GP9 A;  2HUR A;  2DXF A;  1HLW A;  3Q86 A;  1NB2 A;  3FBF A;  3VGU A;  4ENO A;  4ANE A;  1VYA A;  3EVM A;  3G2X A;  1WKL A;  4WBF A;  1MN7 A;  3ZTR A;  3NGS A;  1HIY A;  1NLK L;  1PKU A;  4F36 A;  3FCW A;  4DZ6 A;  2DXD A;  3EVW A;  3EIC A;  3VGT A;  1HHQ A;  4HR2 A;  4FKY A;  2DYA A;  1NDC A;  5IOL A;  3Q8Y A;  3ZTO A;  1KDN A;  1ZS6 A;  5CAA A;  3ENA A;  1K44 A;  2AZ1 A;  2BEF A;  1XIQ A;  1B4S A;  1NDK A;  3PRV A;  4DUT A;  2AZ3 A;  3WX8 A;  3FCV A;  1JXV A;  1PAE X;  1BHN A;  2DY9 A;  3NGR A;  2HVE A;  3ETM A;  3VVU A;  1W7W A;  3EJM A;  3EVO A;  4AND A;  3ELH A;  1EHW A;  3EMT A;  3VVT A;  4ANC A;  3DKD A;  2VU5 A; 
#chains in the Genus database with same CATH topology
 1PJ6 A;  2M4M A;  1YIJ S;  4UST A;  3Q22 A;  1S6Q A;  1RJJ A;  4LF9 F;  2MMY A;  3FKB A;  5E7O B;  4YR3 A;  2IJN A;  4OHX A;  1MG7 A;  4I2P A;  1VLO A;  5KFW A;  2VG7 A;  1Q95 G;  4HT5 A;  5LT5 A;  3TA1 A;  1D9D A;  4CO5 A;  1HQU A;  1YRT A;  1A0O B;  3OFF A;  2PA3 A;  2IVY A;  4P75 A;  5HLF A;  2W9C A;  3HVW A;  3TAN A;  2GJI A;  4PZV A;  3G71 S;  2Z8Q A;  2NUU G;  1JJ4 A;  4Y2M A;  3JQK A;  1T03 A;  4ZPB A;  2NZ4 A;  4DS5 A;  1QTN B;  3NWG A;  5KFR A;  5D4P A;  1GT8 A;  2HIQ A;  1WOP A;  3AJ1 A;  2R7Q A;  1F2G A;  2MQO A;  2B4O A;  4K4Y A;  4U8V A;  5E3C A;  4NLX A;  4TLR A;  1S7H A;  1KTQ A;  4USH A;  2F5G A;  3ZTO A;  2BQR A;  1HBN A;  3HVT A;  3BN4 A;  2DR7 A;  2E5J A;  2XY6 A;  3HHD A;  3BQ2 A;  4M5L A;  3TQ1 A;  2O67 A;  3WBZ A;  3W61 A;  3I31 A;  2RSQ A;  2GQ2 A;  4DUY F;  2M5Y A;  4HAC A;  2PDA A;  4A8F A;  2FTR A;  3GIR A;  5L9N A;  3BO2 A;  1HWK A;  4OYO A;  4I67 A;  3DOM B;  2OUG A;  4DOZ A;  3C16 A;  4UOH A;  1YWX A;  3D9B A;  3T1A A;  1Y3K A;  1WKJ A;  2NXC A;  4DV7 J;  1QVF R;  1FWK A;  2E5I A;  3PEJ A;  4IO1 A;  1EP4 B;  2LMI A;  1U6F A;  3BN7 A;  2N7Y A;  5A8R A;  1XR5 A;  1VBZ A;  2YNH A;  1GQE A;  1KFS A;  5IT9 Y;  3QJJ A;  1DQ9 A;  3AXK A;  2EKN A;  3PYD A;  3I87 A;  1K73 T;  3PCO B;  1R0C B;  2W4P A;  2CNO B;  1B70 B;  4FVM A;  3N6N A;  1RHQ B;  1SH0 A;  2LFV A;  1UEK A;  2VFS A;  4URG A;  3W9J A;  3C14 A;  2J6U A;  4FBT A;  1Y7P A;  3IWX A;  4J9Q A;  1S0N A;  3H5S A;  1HD0 A;  3IR6 B;  5HBM A;  2F9J A;  4H54 A;  3AFG A;  2D7S A;  3MFH A;  4DSE A;  2FZK B;  2QC3 A;  2ABY A;  2MKY A;  4OYZ A;  3DMJ A;  1GMV A;  3MD3 A;  7FDR A;  2Y0B B;  1FFW B;  3UI3 A;  3CD6 S;  1HW8 A;  4IDK B;  1IKW B;  2JVR A;  1DUR A;  2E1R A;  4DL0 C;  2CZV C;  2LYV A;  2OI2 A;  3H7H B;  3FCH A;  4DS4 A;  4IOA Q;  2VA3 A;  2ZWO A;  1BC6 A;  3KLG B;  2BOP A;  1KKH A;  3SV3 A;  2OPQ A;  3GMG A;  4WXO A;  2K7K A;  3JQM A;  2IJF A;  1G4C A;  1TTH B;  2BZ2 A;  3VAL A;  4J9L A;  1YBA A;  1K1S A;  4CDI A;  3DLB A;  1RAG B;  1UA0 A;  2UVV A;  4J91 A;  2DK2 A;  3BGO P;  3WZ0 A;  1WOO A;  3KNG A;  4J9S A;  3QPI A;  2Z30 B;  4NI2 B;  1TU0 B;  5J1E A;  3IG1 A;  2CFX A;  5I3U B;  2OTJ S;  2I38 A;  1XER A;  4RO0 A;  3T5J A;  3MXH P;  4DCP B;  2JLE A;  2V2V A;  3ZXW A;  2DCL A;  2UVR A;  4C0B A;  4DV2 F;  2KT3 A;  4ZVR B;  1IBL F;  2BQ3 A;  1NCL A;  4CNZ A;  4ZN3 A;  1PYO B;  4Q45 A;  4WFA Q;  1NDP A;  2MQM A;  1HYS A;  4JI7 F;  2H51 B;  5D4O A;  4ZS6 A;  3HHL D;  3MM8 B;  4HDG A;  3O5T B;  2OPP A;  3EZ5 A;  2CNN B;  2YKN A;  1ZA2 B;  1CS4 B;  1IWA A;  2YX4 A;  1S57 A;  1L3V A;  2ZBI A;  4KJI A;  4KE5 A;  4QR2 A;  3QJP A;  4HDH A;  2LCW A;  1VI7 A;  5K8P A;  1S1V B;  3FSY A;  2GO9 A;  1FCA A;  2WOM B;  1IBM J;  3EGW B;  4DV0 J;  2DNM A;  3W7B A;  4Y3C A;  4ECZ A;  3W2W B;  2GHV C;  4ZP7 A;  4D3G A;  4CM0 A;  2HND A;  2ALZ A;  1MLA A;  3J7A 1;  4NLQ A;  4G3I A;  4J9R A;  3FCW A;  4Q0B A;  4CWB A;  1FWP A;  5D15 A;  3H2U B;  2AJ0 A;  4ZP9 A;  1L5U A;  4ED3 A;  5JUM A;  2PGC A;  2BJE A;  2BDP A;  1FKO A;  4PQA A;  3ETM A;  1TKZ A;  1X8D A;  4QU6 A;  3EVO A;  4K8R A;  2XBP A;  4J9K A;  2K7J A;  2BBE A;  2LKZ A;  1BE4 A;  4DV1 J;  4CLS A;  2J9D E;  4GKK F;  2HWT A;  3D1Q A;  4IFY B;  5IM0 A;  4HYK A;  2IHR 1;  2ACM A;  4CLK A;  3RW7 A;  1S97 A;  4FVC A;  5KFP A;  4LF8 F;  2E44 A;  4UF4 A;  3AA9 A;  4ZMM A;  4ZPC A;  4X4U A;  3DU5 A;  1SPB P;  2Y3Y A;  4OV1 A;  3FC9 A;  2EKY A;  2IAJ A;  1Z2L A;  2B4P A;  1HR0 F;  5BYS A;  2OPR B;  4HHJ A;  3SSS A;  2V8G A;  4DDF A;  4PQU A;  2CQC A;  1UEU A;  1SV5 B;  5B0C A;  4Q2M A;  1H2T Z;  4ED6 A;  3EDQ B;  4P2X A;  2XUL A;  5CCM A;  2DNK A;  2KTQ A;  1TKX A;  3EIC A;  5DZ6 A;  4OX9 J;  2YNI B;  5CA5 A;  3C2P A;  2V68 A;  1K44 A;  5IC6 B;  2BAB A;  1CUL B;  2MDA A;  1JLE B;  2FLP A;  2ROG A;  1OSC A;  4OMF G;  3RRH A;  1S6U A;  1I94 J;  2HS3 A;  1TVR A;  3TOQ A;  3IAS 9;  2VFV A;  4DZD A;  5A6W A;  1PYS B;  4NXM F;  2NXN A;  1C0U A;  4F50 A;  4DF4 A;  2VPX B;  4LR8 A;  2GHW A;  4J9V A;  2YKP A;  3MEG B;  3A3P B;  3DFE A;  3BM7 A;  3HHL A;  4FYY B;  2DEJ A;  5B09 A;  2ZD1 A;  3BDP A;  4ELU A;  3TJ8 A;  3PG9 A;  5HAT A;  5E5N A;  1Q82 T;  2ROE A;  4ES2 A;  3VGS A;  3KK3 B;  4EK2 A;  1S99 A;  1EIY B;  2W9B A;  3TP2 A;  3AOD A;  3HFZ B;  2AJQ A;  3N79 A;  1OPZ A;  3QAU A;  2KM8 B;  3EGZ A;  4ANE A;  2WB4 A;  2CNK B;  4OJ3 A;  4ED2 A;  4DR6 J;  3SI8 A;  3CNQ P;  2YNF B;  2M88 A;  2W24 A;  2ZH1 A;  3CUN A;  4OYI A;  2AZ1 A;  4PEO A;  2DNZ A;  4XDD A;  3PIP Q;  3KK1 B;  1JNR B;  1K0V A;  1FA0 A;  1S77 D;  3NKY A;  2KO1 A;  1URR A;  3HD1 A;  3NGT A;  1WEX A;  2X3G A;  4ZLL A;  3MMA A;  1IM6 A;  1CVJ A;  5KT2 A;  1JLG A;  3LW5 C;  3OTB A;  2XCA A;  3X1L B;  5KFL A;  3U02 A;  1DQA A;  2Y8W A;  1NK6 A;  2ZUA A;  3F73 A;  2K1R A;  3VF0 B;  1NSP A;  4RW7 B;  1KP6 A;  4C8K A;  3QWU A;  2CQB A;  3MUM P;  2IJR A;  3RR8 A;  2B9X A;  4H4M B;  1VOM A;  3W8G A;  2YXL A;  4GKJ F;  1N5T A;  3OHB A;  3D3C J;  5KOX A;  2FLL A;  4NOH A;  1UFW A;  3US5 A;  5BR8 J;  1H0H B;  4YB7 A;  3CCJ S;  4HH0 A;  2QL9 B;  3T5L A;  3G82 A;  2CPE A;  3H0P A;  4DG1 A;  3KHL A;  5J2P B;  1XNQ J;  5F0U A;  2GGP A;  3QO9 B;  5HK4 A;  2HHW A;  3PDN A;  1FXR A;  4J7C A;  2M52 A;  2HRT A;  2XNQ A;  3IFE A;  3LP0 A;  4DLG A;  2HFO A;  2VU5 A;  5KFV A;  2BVZ A;  2H65 B;  3PHT A;  5D0R A;  2G2O A;  5HQ8 A;  2WVC A;  3BYR A;  3RRG A;  4EGL A;  2HVZ A;  1JLF A;  3KDO A;  5EDW A;  3MHY A;  2V8D A;  1F1B B;  3ITH A;  4IG3 B;  3MR6 A;  3U1M A;  4DQR A;  3HSJ A;  3DI6 B;  5RUB A;  3CMA S;  2GVZ B;  3GSD A;  1KLM B;  2O5D A;  3HZG A;  2GMJ A;  4ZPD A;  2R3V A;  1JLQ A;  2J9D A;  4OV6 A;  3M2R A;  1RXO B;  4URQ U;  3FEY B;  4DFK A;  2HQ3 A;  3FFI A;  2AWZ A;  1DAR A;  1JQG A;  2IY5 B;  4F2R A;  1R6V A;  1D1U A;  5KG5 A;  5DG7 A;  1N5Q A;  2VQF F;  3CB4 A;  4U7U D;  5HAN A;  6AT1 B;  4OYB A;  1R0A A;  1VQ8 S;  4A8Y A;  2HNZ B;  1EJ7 L;  4EBE A;  4HKQ A;  3W62 A;  1XMQ F;  3HSG A;  4JI0 J;  3KLH B;  5KT6 A;  1JLB B;  1E6Y B;  4DEZ A;  1RWN B;  1G7C B;  5C2G A;  1EET B;  3DM2 B;  1UJ5 A;  1NUE A;  2MGZ B;  3E01 B;  4Z37 A;  1AFJ A;  4FBU A;  4IH6 A;  1T0T V;  3HT3 A;  1CG2 A;  3HHK A;  3DDK A;  2HHT A;  2NSB A;  3M8Z A;  2M70 A;  5ETV A;  4BDP A;  1SUQ B;  4CCH A;  4LFA F;  2RDI A;  2LVW A;  4F4A A;  2J76 E;  4ZVQ B;  1OWX A;  2PFF B;  4L73 A;  3D6M B;  2GA7 A;  1ZM3 A;  1TUV A;  3M6V A;  2JNJ A;  2XMW A;  1NZ8 A;  2ATC B;  4CYU A;  2R42 A;  4ZVG A;  4CTA B;  2YH1 A;  1RT2 A;  3VAK A;  1KTV A;  3VGU A;  1SI9 A;  1HBM B;  2HBQ B;  3K5L A;  3IGN A;  1SIW B;  3IMQ J;  1M1G A;  3QID A;  5KFN A;  3CW2 C;  3M8S A;  1UP1 A;  4PWD B;  4U6P A;  2BXJ A;  4J9U E;  2GW8 A;  2MHN A;  2F40 A;  2KKH A;  4DV4 F;  2H5I B;  1X5T A;  3J7Z 5;  2MZJ A;  1FKA F;  2M3D A;  4KRW A;  4R25 A;  1RCO B;  2ZIT A;  5KFX A;  1SC6 A;  2BRK A;  2W7O A;  3VV2 B;  3PW0 A;  1AFI A;  2R7R A;  1FEE A;  3PAC A;  4F0K A;  4DPY A;  3EYZ A;  1XEZ A;  2WZ1 A;  2C2Z B;  1C4A A;  3N01 A;  1ELO A;  4ZPV R;  2C22 A;  3MED A;  3DYA B;  2VG6 A;  5EN1 A;  4G1Q A;  3B8H A;  1S9G A;  4KTQ A;  1NZA A;  1LOU A;  1MN9 A;  2MB0 B;  4F0M A;  4AUK A;  1H98 A;  4DN0 A;  4C8Y A;  1HPZ B;  1TKD A;  2KYX A;  3K89 A;  1LEO A;  5FLX U;  1VJW A;  1MRO A;  2V67 A;  4B3T F;  5AT1 B;  4E98 A;  1C1C B;  1RLC L;  3TUJ C;  3GFX A;  1SL0 A;  4USI A;  4ER8 A;  3PTW A;  5T7L A;  5KG3 A;  1NLK L;  3FJ2 A;  2ZBQ A;  3BR8 A;  3ZZR A;  1HHS A;  3MM5 A;  4ZN1 A;  4B3O A;  4QBU A;  3MM9 A;  3ENA A;  3K58 A;  2DH7 A;  1IR0 A;  4A8Q A;  3MCN A;  3J81 j;  3TVY A;  4X4S A;  4F26 A;  5M2R A;  5K14 A;  4LF2 A;  3HK2 A;  2CPI A;  1F60 B;  2Z56 B;  3G6E S;  3ILO A;  1WNE A;  4IR9 A;  1SL1 A;  3DLE A;  5C42 A;  1R8A A;  1U1O A;  4JV5 F;  3L4B C;  1XWL A;  4J9M A;  4OZN A;  2E1M C;  4LF7 J;  4HLB A;  3BSO A;  4OI4 A;  1YBU A;  3DDI A;  2CQI A;  4OFZ A;  5F8J A;  4NLY A;  3D6F B;  1CSJ A;  2I0X A;  3EVM A;  2J5A A;  2DEI A;  2YPZ A;  1AZS B;  3K7R A;  2DB1 A;  2GS8 A;  2F65 A;  1X60 A;  2JH3 A;  5ITH A;  5L8R C;  2NLW A;  4QW9 A;  2WVE A;  3BKU A;  3NNA A;  3LP1 A;  2DPI A;  1VIO A;  3BSN A;  1CPZ A;  3GII A;  2N4C A;  1RT3 A;  3I4H X;  5F8G A;  2M9K A;  4K0K F;  1ZPW X;  2R7V A;  2LQ5 A;  3PX4 A;  2COL A;  3NS5 A;  2ZC3 A;  4TU7 A;  2Q6C A;  2XLI A;  4TNO A;  3TRG A;  4P72 A;  2KHC A;  3KJV A;  2UV8 A;  4RW6 B;  2KJW A;  2UUA J;  2DNO A;  3CJQ A;  2E9Z A;  4JI2 F;  1S1T A;  1BXN A;  2CWX A;  1QAY A;  1HBO A;  3OL8 A;  2ZHO A;  1S1W A;  4M63 A;  3M4X A;  3MI7 X;  2BJD A;  1FJG J;  4IKA A;  5KFA A;  1NK4 A;  4YB6 A;  3MTK A;  3FUY A;  4DR7 J;  3R3T A;  1Q8L A;  3EVW A;  1M5V C;  4O4R A;  1SCJ B;  2DNN A;  2HHX A;  4RUB A;  2EEY A;  1LWF B;  3OL9 A;  1VLY A;  3IC1 A;  4C7Q A;  3K5N A;  3EPG A;  5IT4 A;  5KFH A;  2BM0 A;  1VK8 A;  4KFB B;  2M7S A;  3FVY A;  5A8K A;  4EU0 A;  4LRF A;  3FZB A;  3IBC B;  3C66 A;  5DQG A;  1Y4Z B;  1V3Z A;  4C2M A;  1W2B R;  1XR7 A;  3R1H A;  1GX6 A;  5JVH Q;  1RWO B;  1B3T A;  3DRY A;  1Q1K A;  3ZZZ A;  4R5P A;  4DV6 J;  5LSO A;  1A7G E;  3RAX A;  4PWU A;  5HJY A;  1S1X A;  3H98 A;  1U25 A;  4WJB A;  1MWY A;  1J5O B;  1N5Y A;  3N6L A;  4YUD A;  2RQ4 A;  2EC0 A;  3MPV A;  2R8H A;  2BMB A;  3UD5 A;  4X66 F;  2OPS B;  3BGR A;  4OYA A;  4TU9 A;  1U26 A;  3P96 A;  5LOQ A;  4RBU A;  4WZM A;  2KJV A;  1FNO A;  5GAG U;  1RDR A;  5A8W A;  2DGV A;  5L39 A;  3BPD A;  4LRC A;  2W7A A;  2RKI A;  2XMM A;  3VAM A;  1IUJ A;  1VC6 A;  5IT9 U;  2W2Q P;  3C15 B;  1CJT B;  2UUC J;  1G3O A;  3W66 A;  2WVF A;  3DXB A;  1OO0 B;  1Q7L B;  1TL1 B;  4J9P A;  3H59 A;  2M8D B;  3GIJ A;  2DNL A;  1RHJ B;  2MKI A;  2E66 A;  3UVJ B;  1GTE A;  3ZZO A;  2Z58 B;  1KHV A;  2ASY A;  1NDL A;  2QLX A;  4PUO B;  1MMN A;  1IXK A;  1U2C A;  2CZ9 A;  4DUZ F;  2KU7 A;  4ED0 A;  1AB8 A;  5EWF A;  5DM6 Q;  3IP0 A;  5HMZ A;  1LKZ A;  1X0P A;  1RAE B;  2A3J A;  3GON A;  3ZZP A;  1YG0 A;  3QAT A;  2DIU A;  1FDA A;  3NBP A;  3CCU S;  1QJH A;  5HO4 A;  4I4B A;  2K8G A;  5IV4 A;  1C4C A;  2LQJ A;  3I32 A;  4B3M F;  1YX2 A;  1KNZ A;  5HMY A;  5A6P A;  3LPE A;  4Y34 A;  3AOB A;  2CPD A;  2P5V A;  4PG5 A;  3OXL A;  5IV3 A;  1I5O B;  4AQY F;  1ZBT A;  4HHU A;  3MMC B;  2B3T B;  2UUB J;  5IC4 B;  4N8O A;  4Q8E A;  2VPZ B;  2AX1 A;  3TJ9 A;  2VD3 A;  3OVA A;  1T3N A;  1RWU A;  1T7P A;  4F4X A;  4U96 A;  4A46 A;  5HQM A;  1J5E F;  1HNV B;  4LF1 A;  3GSI A;  1S5Z A;  2ASD A;  4ZIT A;  2MQP A;  4BS2 A;  1NK7 A;  4P2M A;  4IH5 A;  3DHW C;  4OZ1 A;  4JI8 F;  2QN6 B;  3L7P A;  2JRS A;  5H9F K;  4I2Q A;  4HTJ A;  1GXU A;  2B5J A;  4XO0 A;  4BBY A;  2CDR B;  3MOZ A;  1Q86 T;  2WBM A;  2ZH9 A;  2DR6 A;  3Q86 A;  1UVJ A;  2IYG A;  3ADA C;  4CLP A;  1H72 C;  2AX0 A;  3T6J A;  3M6W A;  3PV8 A;  4DPU A;  4B9M A;  3TVK A;  1VIX A;  1RT7 B;  2HQC A;  3DRS B;  2FD2 A;  3Q2S C;  3PYG A;  1FJC A;  3OFH A;  3D28 A;  2VOO A;  4USJ C;  5CAA A;  4MH8 A;  2FVQ A;  2W2M P;  5AXM A;  4ETX A;  3Q8R B;  3DLK B;  1UZH A;  2YX7 A;  4I1T A;  1KOO A;  4CI0 B;  3F56 A;  1URN A;  4ECW A;  2UXD J;  4WF9 Q;  1HQE A;  1RTH B;  2ZDO A;  5M2P A;  1FI4 A;  4ITS A;  1XMB A;  2HK3 A;  3I9Z A;  3OR1 B;  3BO3 A;  2KXH A;  2QIF A;  2LEA A;  3LAL A;  1EAY C;  4DR1 F;  3ZZU A;  3SIP B;  3DLG A;  5E3Q A;  4XTT A;  2R2S A;  1FFS B;  2NR0 A;  4DFJ A;  2W4C A;  3PR5 B;  3QBC A;  4LF9 J;  2BE9 B;  2HFZ A;  5J2Q B;  3PYE A;  2P8I A;  1WHV A;  2FJX A;  3CE8 A;  1QSS A;  1Y11 A;  2DH8 A;  4LIW A;  4JB8 B;  3KUH A;  1QE1 B;  4CRJ A;  1E6V A;  4RWW A;  2J7W A;  4C98 A;  2Y1J A;  2DGT A;  3UFC X;  3C3L A;  1H2V Z;  3D66 A;  4V19 J;  3QGI A;  1VQM S;  3K8V A;  3VZH A;  3GYG A;  1VFJ A;  5D3G B;  3QIP B;  5LJ5 Y;  1XK8 A;  1UVI A;  2BKP A;  1N34 J;  2EFN A;  5DG8 A;  1TMJ A;  1CLF A;  3MDF A;  2XHW A;  1P1L A;  4A8X A;  4I69 A;  4O3R A;  5GAE I;  2OMO A;  2RS2 A;  2DGU A;  3KLI B;  1QY7 A;  2CZ4 A;  1Q16 B;  5DRK A;  4WYL A;  1CJV A;  1WG4 A;  4G1I A;  5IS2 A;  2CQG A;  2VBW A;  4DR3 F;  3AQO A;  2ZH5 A;  1SJ3 P;  3OTO F;  2YY3 A;  4DUY J;  2IYI A;  2RHQ B;  1X4A A;  2RS8 A;  3M8Y A;  2BW2 A;  4ILR A;  3TEH B;  4RZR A;  5GAE U;  3W9H A;  3M8P B;  2QL5 B;  3CMQ A;  2CVI A;  3M2V B;  1RB0 A;  3OJS A;  4ZLJ A;  3CO0 P;  4UZB A;  5CZX A;  3MAA A;  2XMJ A;  1SJR A;  4ZJQ A;  2FB0 A;  5CCL A;  3K5M A;  4RUA A;  2AJ4 A;  4M94 A;  3M8Q A;  1U02 A;  4ED8 A;  2C3M A;  2JZ5 A;  4RBV A;  3W2V B;  4QWC A;  2Q1L A;  4F36 A;  2YKM A;  3BS9 A;  3ISN D;  2DNH A;  2HK2 A;  3HKW A;  4Y2K A;  1U24 A;  4NLP A;  2XMV A;  4GVB A;  4ZVO B;  4FS1 A;  4JV2 A;  3VVT A;  4ZLN A;  3C8Y A;  4ZPA A;  2VOD A;  2X1F A;  3W64 A;  1WEY A;  1YGY A;  2WHO A;  4YFU A;  4X65 J;  2ZJR Q;  3ET6 A;  2IC3 B;  2VF3 A;  2W9C B;  5AJ3 J;  3D68 A;  2QMX A;  2IM0 A;  2FJE B;  2DNR A;  1VQ7 S;  3QQC D;  3JQJ A;  3EZO A;  1RE1 B;  4UY8 T;  3FMW A;  1A9N B;  4D3H A;  1NSA A;  4FNH A;  4PAB A;  5F3T A;  5KFF A;  1P9Q C;  1X9M A;  3KMS A;  3NGD A;  3PJW A;  3RBE A;  2CQ4 A;  3UD4 P;  2RVJ A;  1S10 A;  4DV5 F;  3NOG A;  2KN4 A;  3GLJ A;  2WSE C;  5KFE A;  1JLA A;  1SJ4 P;  5J1P A;  2H3E B;  3CC2 S;  1ZS6 A;  1K9M T;  3U7J A;  3DOL B;  1MNE A;  1Y5L B;  5LMN J;  1GX5 A;  5SZT A;  3N0V A;  4JI6 J;  3ZZY A;  2E1P A;  4HAC B;  2VDH A;  4Z2X A;  1FRI A;  1VS3 A;  2DCU B;  4NAS A;  1ZET A;  2A10 A;  2DXE A;  1VC5 A;  4FP9 A;  3DRR A;  4B3R F;  2XB2 D;  1CC7 A;  2H54 B;  3B78 A;  1Q8I A;  3KG1 A;  3KMQ A;  4QQB A;  4X4N A;  3NAI A;  1LW2 A;  2W4D A;  1WKK A;  4M95 A;  1IBL J;  3AOA A;  1TP7 A;  3AOC A;  3HHN B;  3OXF A;  1NHU A;  4YOE A;  2ZJQ Q;  3K5O A;  3E2E A;  1RAO A;  1G2E A;  4JI7 J;  2YNH B;  3OTC A;  5HJX A;  4O44 A;  4MMO A;  1HA1 A;  3AA8 A;  5KFC A;  3H42 A;  1ICE B;  3G8T A;  4USM A;  4I7F A;  3SFU A;  4LQ9 A;  2F63 A;  3I5C A;  3M30 B;  3VGT A;  1TL7 A;  2IM3 A;  3PHE A;  4KGX B;  4DSL A;  3CTR A;  4I0W A;  1BQN A;  3EWG A;  5HBM B;  4KHR A;  3SFG A;  4YY3 J;  1LWC A;  2W2O P;  1NH8 A;  3QT5 A;  3V2U C;  3DMJ B;  1VBY A;  1SKW A;  1SKR A;  1LNQ A;  4I56 A;  2KT2 A;  3LP2 B;  2BX6 A;  2JWN A;  3SQO P;  3MEK A;  3UQS A;  5DET A;  4CT9 A;  2ILZ A;  5D77 A;  4GC6 A;  4MK7 A;  5KFO A;  2OPQ B;  3ZNU A;  3C6U A;  4KPY A;  2AYG A;  3MWB A;  4CH0 S;  3U27 A;  4C6A A;  2E5H A;  2MQ8 A;  4PAA A;  2F8H A;  1GFW B;  2BE2 A;  3L7O A;  4GKK J;  2XGP A;  2D3Z A;  4ZVH A;  2MZR A;  4GO5 X;  3OUY A;  5B0A A;  4ZIW A;  1REV B;  3W5X A;  3W5Z A;  2EFP A;  4LF8 J;  1RP5 A;  2V4J A;  5J1E B;  3RG6 A;  4X64 F;  3PRB A;  1ZTW A;  4LF5 J;  4JYA J;  4K2J A;  4JV0 A;  4KH1 B;  5GME A;  2YQ1 A;  1NJX A;  2VJV A;  4EUV A;  5AXL A;  4USW A;  2OFH X;  3Q8Q B;  1HBU A;  1U7L A;  3JSR A;  4KY3 A;  5F0W A;  3RR7 A;  2XNR A;  4MKB A;  2CPZ A;  2MY8 A;  4FS2 A;  3GWC A;  4OYM A;  5DLG A;  1QUV A;  1HYS B;  1RHU B;  4CO1 A;  3MOJ B;  4CLF A;  2OPP B;  1AT1 B;  4QW8 A;  1XQI A;  1N36 J;  2VOP A;  4RW9 A;  2VIC A;  1X9S A;  2KI2 A;  2OSQ A;  4O4G B;  2CPH A;  3H40 A;  2CPF A;  1RTD B;  4DR4 F;  1G1X A;  4NXM J;  1K47 A;  4GMK A;  1DTT B;  3BBF A;  3MMJ A;  1TUW A;  3DGP A;  1OQ6 A;  3ULH A;  3CCV S;  4RW8 B;  1S4F A;  4CH1 A;  1QVG R;  3BSC A;  2VIH A;  4JUZ A;  4YR0 A;  1P27 B;  1F5A A;  4ZP8 A;  3PO4 A;  4OJG A;  4J37 A;  3D5M A;  4QIE A;  4EBD A;  3UNY A;  2CAJ A;  2B0G A;  2XEX A;  1NB7 A;  2FJD B;  3P4U B;  1FFG B;  2C2E A;  5IOL A;  1BD6 A;  1VRU A;  1BQM B;  2ZNY A;  2VL1 A;  4KGZ B;  5GMD A;  2C3O A;  1S6P B;  3WX8 A;  1YVF A;  1PAE X;  3OD2 A;  2RRN A;  1YJ7 A;  3N5B A;  3QWP A;  2P2C B;  1UEV A;  3UDE A;  1RK8 A;  2BE7 D;  1WTB A;  2BYC A;  2FY8 A;  4DV3 F;  5DGB A;  4OYP A;  1RWX B;  2RF2 B;  4QCL A;  1S48 A;  2G2Z A;  1KN6 A;  3W9I A;  2ERR A;  1ZOT A;  2MYF A;  2YWF A;  2LA4 A;  4UOF A;  1TV6 B;  4QPT A;  4LMZ A;  4ZA1 A;  3AB4 B;  2NXU A;  1PSD A;  1Y0H A;  1KSP A;  2DIS A;  2VB6 A;  3A12 A;  3V6J A;  3W63 A;  1C0T B;  2RAQ A;  4IYQ A;  4WXW A;  1JMT A;  3GP9 A;  1EKR A;  2DRA A;  1TKX B;  3UWT A;  2RRA A;  1VRQ C;  2C2K B;  2YWK A;  1WKL A;  2HLT A;  3DOM A;  2U2F A;  1D8Z A;  5AXK A;  2ALY B;  1C1B A;  3I55 S;  4DU8 A;  4ID8 A;  5DZ7 A;  5DDQ C;  1TVR B;  4L3K A;  5ETP A;  4C3L A;  4ZLP A;  4K4U A;  4GO7 X;  5B0B A;  5HMX A;  3PNI A;  1EP4 A;  2HVH A;  2UXC J;  4ED7 A;  5B0F A;  1Q5V A;  1GXT A;  2RML A;  4BC7 A;  3IS9 B;  2ZZM A;  2NYH A;  1M1K T;  3K0J A;  1YQH A;  1EQ0 A;  2CA9 A;  4WK3 A;  3TEG A;  1KWM A;  2VUG A;  3THV A;  3PX0 A;  1RZM A;  3G6X A;  4EYH B;  1EZZ B;  1LWX A;  1P1T A;  1D9F A;  3MPW A;  4OJ1 A;  2ZM6 F;  3UN5 A;  2EC2 A;  3O44 A;  3FK4 A;  3M9M B;  2RHS B;  2GCF A;  4WTY A;  1LWE A;  3NGS A;  2GMH A;  2JC0 A;  3D0H E;  4IDK A;  4B3S J;  1X4E A;  5KG7 A;  1REG X;  1NK8 A;  1F2H A;  4IG0 B;  1IKX A;  3IM9 A;  1H73 A;  1FD8 A;  3MMA B;  1RKJ A;  1JLG B;  1BWV A;  1FKP B;  1V3S A;  1FRK A;  2V6A A;  8RUC A;  4WE1 B;  4NCA A;  1HW9 A;  2NXJ A;  4ZHR B;  2AV5 A;  2KH9 A;  5JJB A;  5E3R A;  2RT3 A;  3DN9 A;  2GAH C;  1RLD A;  4MYU A;  4W98 A;  4L75 A;  4I6Y A;  3CJT A;  2GQC A;  3IM8 A;  5CYQ A;  1RAD B;  4A8W A;  1F5B A;  5KFB A;  4DV7 F;  5HI7 A;  5C7P A;  3R8Y A;  3NCQ A;  1NO8 A;  5G4D A;  4LFA J;  3G82 B;  3DDN A;  4BWJ A;  3CJR A;  4DG1 B;  2F8E X;  3OQ2 A;  2FHK A;  2CPJ A;  5HMW A;  4BC9 A;  1Q4R A;  2PT0 A;  3MM8 A;  2GGP B;  2XMU A;  3C6T A;  4QIW D;  2Z4P A;  2CJA A;  4NLS A;  1WEL A;  5MLC V;  4QYR A;  1RKI A;  1KVK A;  1S1V A;  3NY0 A;  1MU2 A;  2WOM A;  3BQ0 A;  5IQ6 A;  3IN5 A;  2HIY A;  3EM1 A;  1YJV A;  1Z1Z A;  4DV4 J;  2AJF E;  3TW0 A;  2P6T A;  3G87 A;  3DRP B;  2CG4 A;  1R8P A;  4KBI A;  2BJ7 A;  3BZQ A;  2B9E A;  1OIA A;  2R8K A;  3GZ7 A;  2VBZ A;  1V9O A;  4FKX A;  5LXY A;  5I42 A;  4DHV A;  1LV5 A;  3TI0 A;  1H74 A;  1JK9 B;  1RT1 B;  4Y00 A;  4NCG B;  5GVQ A;  4RJV A;  2DNQ A;  1OQ3 A;  3FFI B;  3RBZ A;  4LFB F;  4O3O A;  1MW7 A;  4IFY A;  4IRD A;  3M05 A;  1VHF A;  2E1A A;  5HRO B;  1R0A B;  4M5J A;  1XN9 A;  4ZVE A;  1FE4 A;  2CJY B;  2B6A A;  1GTH A;  4OLP A;  1TMM A;  1EAR A;  4B3T J;  4ZCL A;  5GAD U;  4DMZ A;  4TN2 A;  4URS A;  4J9O A;  2FVC A;  2AHO B;  1SV5 A;  3R5D A;  2Z2Z A;  3DRX A;  1B0P A;  2MLX A;  3VGV A;  4FDF A;  4EFA C;  2QEX S;  4X84 A;  3RUB L;  1MMD A;  3BV8 A;  3HHE A;  1B0T A;  5KFD A;  3CD5 A;  1CUL A;  2XYH B;  1JLE A;  4LF6 J;  4IFV A;  3Q83 A;  4CYU B;  1U1L A;  4DFP A;  1RT2 B;  4MTP A;  1RAA B;  4Q5V A;  1KLN A;  2YKQ A;  1Q78 A;  7AT1 B;  2EBE A;  3UCU P;  4ZVS B;  3BQ1 A;  1YSJ A;  4GRS A;  3HD2 A;  1SQE A;  2YPY A;  3TAQ A;  5JMN A;  3PJ9 A;  2AGQ A;  1N33 F;  4JP8 A;  4L3N A;  1IBM F;  1VQK S;  3MEG A;  2H5J B;  2VG5 A;  1NK9 A;  2A2C A;  1YZ7 A;  4A8K A;  3CC7 S;  3NL0 A;  5IFM A;  1T8E A;  4AXJ A;  1WC1 A;  1UKU A;  3QYY A;  2ZC4 A;  1FT8 A;  1N56 A;  3F0N A;  3HVR A;  2BRL A;  4ZPT R;  3R5J B;  1Y10 A;  4RU9 A;  4PKD B;  3MFI A;  2EWH A;  5CHC B;  4F25 A;  3VAF A;  4DX7 A;  4O3Q A;  3AJ2 A;  4YEA A;  4YP3 A;  1DLO B;  3V4I B;  3QMQ A;  1RI7 A;  4G1Q B;  4DV1 F;  2YNF A;  2A18 A;  2I2Y A;  1A6L A;  3NRB A;  1B7Y B;  4JI4 J;  2WB1 D;  2ZKU A;  3POT A;  4K0K J;  4MKV A;  4EZ6 A;  1R8C A;  4RNO A;  1T9Y A;  1UZD A;  3KK1 A;  3PIO Q;  2AU0 A;  4WFX A;  3O1L A;  2E5L J;  2HBR B;  2KRB A;  1BY9 A;  5KG0 A;  2G2Y A;  3P6Y C;  2KT5 A;  3UCZ P;  2ASJ A;  3J81 Y;  1KQF B;  2XSF A;  3K5P A;  2QL7 B;  1NB2 A;  3CCL S;  4LRB A;  4MKA A;  3GQC A;  2RIJ A;  1JLC B;  4B3O B;  2RUG A;  3W5Y A;  2IVF B;  4UUX A;  2XI3 A;  1MWQ A;  5AE1 A;  2H4Y B;  4MYT A;  4RNH A;  1PKU A;  2HNY B;  2M0G B;  1CQM A;  4DLE A;  2Q6B A;  1QD1 A;  2JDJ A;  3CED A;  2XZD B;  4RW7 A;  4OX9 F;  5JXS A;  3T19 A;  4LQ3 A;  4P7V A;  4YS2 A;  1MSW D;  2W01 A;  2LP4 A;  4H4M A;  2HHH J;  3PJX A;  1U09 A;  3KLF B;  4EZ9 A;  1T05 A;  3MAQ A;  1I94 F;  3M1V A;  1RA6 A;  3V6K A;  2B7C B;  5C42 B;  1WWH A;  4CLL A;  4TYB A;  2EFV A;  4B08 A;  1OSD A;  2HMI A;  2PMZ D;  2R8G A;  3PX6 A;  2DHS A;  4LBI A;  3CCS S;  5J2P A;  1ZYQ A;  5E3A A;  4QWA A;  5A0Y A;  2GJF A;  4I6A A;  2B43 A;  1R8B A;  5HN0 A;  4AL7 A;  1U1N A;  3ZO7 A;  3PZP A;  3UPF A;  3LGN A;  5IT0 A;  1UVK A;  1H6K X;  4PG7 A;  1KQG B;  5H1S V;  3I82 A;  3MR7 A;  3EXY A;  1TFY A;  3TR5 A;  2L08 A;  1Q5Y A;  4BWM A;  4DR6 F;  4KIA A;  2HRY A;  4DSK A;  1BMQ B;  4X66 J;  4QR0 A;  5B7W A;  4IG3 A;  3AHP A;  4X4V A;  1RT3 B;  4NA1 A;  5FJ4 A;  3DI6 A;  1ARO P;  3BRE A;  2GQQ A;  2GVZ A;  1KRP A;  1FEH A;  4QYZ K;  1RAC B;  3DLH A;  2IIH A;  2KXN B;  8AT1 B;  3M2U A;  4ECU A;  4LJM A;  2PEH A;  1ZAV A;  3KJV B;  2LDY A;  4ETZ A;  1S0V A;  5BYQ A;  1ULR A;  4ZOS A;  1NHV A;  4B17 A;  2XMA A;  3QRQ A;  5FD1 A;  1S1T B;  2VV5 A;  2PE8 A;  3IRX B;  3QLH A;  1VIS A;  2OML A;  1KBR A;  1UMJ A;  4KV8 A;  3NXZ A;  2UVU A;  4QWD A;  2GX8 A;  4FZV A;  5HVF A;  3CUL A;  3GJS B;  3RB4 A;  3KLH A;  3CJ3 A;  2UXB J;  1E6Y A;  4LSL B;  3TZY A;  4YN3 B;  3T1Y F;  2QYC A;  3DM2 A;  2HVD A;  4XPE A;  3HHL C;  4NLD A;  2MGZ A;  3E01 A;  3OLB A;  4WFY A;  4EMD A;  1OMS A;  2CJX B;  4HI1 A;  2AIR B;  3D4J A;  3V81 B;  5D6G A;  5BR8 F;  4B3M J;  1U1P A;  1SUQ A;  2L9N A;  3WC2 A;  3B4D A;  5KFG A;  2X3D A;  3UNG C;  4ZDN A;  1YJ9 S;  3ILL A;  3KJQ B;  1VQ6 S;  1U45 A;  3JAM Y;  3DLJ A;  1BQX A;  1XNQ F;  2HVE A;  3MUV P;  3L95 X;  1EHW A;  1FER A;  2FJA B;  1HWI A;  1G6B A;  2V4Q A;  3VR1 A;  1HBM A;  2WBR A;  3QSI A;  1CJU B;  2HHU A;  2AEF A;  2DJW A;  2NRE A;  3THT A;  1KON A;  1HL6 A;  3NGU A;  3VCD A;  2W2N P;  1NHK L;  3OPK A;  4PXB A;  3BGR B;  3OSN A;  3QZ8 A;  3KUG A;  2MEW A;  2HGN A;  3HF5 A;  5K8O A;  4WKY A;  5DGA A;  3T5K A;  1LFP A;  4ED4 A;  3R97 A;  4ATN A;  4WBF A;  2JEI A;  3DYA A;  1SH3 A;  2DH9 A;  4L72 B;  5LM7 E;  2ZZT A;  3R27 A;  1RAH B;  3MPU B;  1Y5N B;  1RWV B;  4FKY A;  2F1F A;  3IR5 B;  5E0O A;  2WTF A;  5IZH A;  1RHR B;  1BWE A;  4RBT A;  1O8B A;  2PEB A;  2FPH X;  3PRV A;  3WIV A;  4C3K A;  1JKH A;  1M5H A;  1KC8 T;  4JI0 F;  2AW0 A;  4P10 A;  2N82 B;  3RW6 A;  1C1C A;  3JB9 k;  3ONQ A;  4FNI A;  2IBK A;  2ZH7 A;  2A6M A;  3GG0 A;  3IBW A;  1JXL A;  2CVE A;  2Y1I A;  3U1N A;  2U1A A;  4RWX A;  1U1R A;  4A8O A;  4OHY A;  1T9U A;  1IM4 A;  4N77 A;  3CCE S;  3K8W A;  3A3O B;  1P9Y A;  1LW0 B;  3ZZ0 A;  2YKO A;  4Y2I A;  2VC1 A;  4IQM A;  3H4B A;  3MR5 A;  5CQG A;  2CJQ A;  3TZX A;  4DSI A;  4EWT A;  3WX4 A;  3ZTR A;  2DNY A;  1J2V A;  2CKW A;  5MAO A;  2GIF A;  2Z2M A;  1X7V A;  1NPP A;  1H38 A;  1I51 B;  4TXS A;  1RTJ B;  4YHH F;  1TKT B;  1NDK A;  3T9Z A;  4KGK A;  4P2S A;  3A8E A;  2QA1 A;  1BGX T;  3DKD A;  4MKY A;  4FXV A;  1SVD A;  1RA7 A;  1AZS A;  4ERD A;  4I2Q B;  1RT4 B;  2VH7 A;  1OY6 A;  4IUF A;  4NML A;  3G6V A;  3L7U A;  3MR2 A;  2H48 B;  3EPI A;  3I0S A;  3QJL A;  3IBF B;  3DC2 A;  1FXL A;  3OLA A;  1H7W A;  2V2Z A;  2G1H A;  1XTZ A;  5DQI A;  1OPI A;  2ZOG A;  1RAI B;  4CLY A;  2J8S A;  1MML A;  3CPW R;  2DGO A;  3HMJ G;  4DR3 J;  2W25 A;  3T1H J;  3PXG a;  1X4D A;  2FHM A;  3OTO J;  3H5Y A;  1RGV A;  2HHP A;  2O3D A;  4ENO A;  1N6Q B;  1SB6 A;  2ZHA A;  3OR2 B;  4U9R A;  2HWI A;  5KG1 A;  3S8S A;  4QR1 A;  1YJU A;  1TR0 A;  3CDE A;  4LIR A;  5L1L A;  4KKO A;  5B0D A;  2QA2 A;  2UUW A;  3HPO A;  1VRT A;  1O51 A;  3HVA A;  1GEH A;  2HFV A;  2XTJ P;  5CYJ A;  3AJD A;  4DPW A;  2J6S A;  4LFC F;  2YBV A;  3QGH A;  3TJA A;  2FJB B;  1HHT P;  4Q7A A;  3DXS X;  3OT9 A;  1DQ8 A;  2OSR A;  4UQG A;  3KG0 A;  1T9X A;  3UW1 A;  1RBO B;  3CDW A;  4NE9 C;  2HQG A;  3R7N B;  2ZH3 A;  3BJY A;  3HP6 A;  2AD9 A;  4OI1 A;  3BKT A;  3TVZ A;  3OFE A;  4LF7 F;  1XMO J;  4KFB A;  1EKS A;  1E6V B;  4DCO B;  4O0I A;  3G9C A;  1N48 A;  3LPY A;  4O3N A;  1CQN A;  2OH2 A;  3R2D J;  1MN7 A;  3HUL A;  4M5M A;  3ZC4 A;  1KD1 T;  2GVD B;  1H3D A;  3TZW A;  2K3I A;  2BJ8 A;  3GV7 B;  3N5F A;  2XMT A;  2DY1 A;  4DQS A;  2MJN A;  2PO4 A;  4WCE Q;  1S9E B;  2HBY B;  2QE5 A;  1J5O A;  3I6P A;  3IGV A;  1KVJ A;  3MCS A;  4WZQ A;  1FD2 A;  2KHD A;  2HFU A;  5F8H A;  2BKN A;  3CCM S;  2C2R A;  3IO1 A;  4OHZ A;  2J0Q D;  1F3F A;  2AF6 A;  3ZFV A;  3V4M A;  3LOU A;  2AYB A;  3C15 A;  1CJT A;  2JFK A;  2E1C A;  2KVQ E;  3ZTP A;  2UUA F;  3CJ4 A;  1J27 A;  2W8K A;  4J90 A;  3D0I E;  4B3R J;  4ZCI A;  1T3O A;  4NL5 A;  2HPU A;  3VWS A;  1IBK F;  3Q2T C;  3Q89 A;  4ZJO A;  4RL1 A;  3LA0 A;  2POK A;  5F8M A;  4N7T A;  1LQ9 A;  2YKM B;  4F4W A;  2V9W A;  4HVZ A;  1VR6 A;  3H20 A;  3SYZ A;  2B4V A;  2XWX A;  1ZTT A;  2HVI A;  4DR7 F;  3TA2 A;  2HRU A;  3TAM A;  4E8U A;  5ETK A;  1FK9 B;  1Q53 A;  4GVB B;  1VQ9 S;  2NPF A;  1RWW B;  3N4W A;  2DR8 A;  3SDE B;  4C11 A;  3PEH A;  1S72 S;  1TZ0 A;  4E0D A;  3AY0 A;  3NGR A;  2YWH A;  2V63 A;  2W8L A;  1OYD A;  2V4R A;  2IRX A;  1WC0 A;  1S9F A;  4MJK A;  2V5H G;  4ALZ A;  2ZUG A;  2DIV A;  3THP A;  4W4M A;  4DSJ A;  1NKB A;  3QFW A;  1O6X A;  2C2N A;  3GCW P;  2AEJ A;  4CIO A;  4A4J A;  4C4W A;  3ZTS A;  4DSF A;  1WHX A;  2VQE F;  3Q23 A;  3KLE B;  3V6D A;  2JFD A;  3K57 A;  2B9W A;  3EXC X;  4O23 A;  4L74 A;  2I6W A;  2Z2L A;  1HNV A;  3AQP A;  2FGC A;  3JYT B;  2SXL A;  4DQQ A;  1H7X A;  4Z7Y A;  1PC5 A;  4DQI A;  3J7Y U;  1JLA B;  2JHE A;  4G6V B;  4RUH A;  2CJ9 A;  3ICL A;  4M5G A;  4NCB A;  4OI6 A;  1HNI A;  3OTE A;  4ES1 A;  3CD0 A;  3TAP A;  2ZFH A;  3KHR A;  5J2N A;  4OX6 A;  5G0R A;  1IR2 A;  3OTD A;  3CVK A;  4DUT A;  4F7V A;  4MT1 A;  2MQN A;  2C2M B;  3AH6 A;  3ELH A;  4ANC A;  4PPD A;  1K8A T;  2EK1 A;  2EG1 A;  1LW2 B;  2NQP A;  1X0F A;  3HCX A;  5HP1 A;  3DRS A;  2IRY A;  4IH7 A;  3P5T L;  3R7S B;  3CWJ A;  2XS2 A;  4O44 B;  5F8I A;  1R6Y A;  4ID5 B;  4F04 B;  3JSY A;  3CCT A;  1FO1 A;  3E51 A;  1IBC B;  3H2V E;  3TA0 A;  2FIU A;  1YLX A;  2DRD A;  3GIM A;  4DR5 J;  2ZZN A;  1LK7 A;  1PJ7 A;  3SCK E;  1GK8 A;  1TL7 B;  5F3Z A;  2V2Q A;  1GAO A;  1WSV A;  3KUE A;  1L3T A;  2FJW A;  4BLG A;  2DNP A;  2DRB A;  1NEE A;  2G1D A;  2XSJ A;  2CQP A;  2HAF A;  2VON A;  2KZZ A;  4HHH A;  1ZH5 A;  5J2Q A;  1DY3 A;  1HAR A;  1P6T A;  2AZ3 A;  2HW3 A;  5IWA F;  1LFW A;  1XNR F;  2HGL A;  2AGP A;  2KFN A;  2AMC B;  4P74 A;  3N6M A;  4IRK A;  1M5P C;  1QE1 A;  3HLU A;  2IDE A;  1B99 A;  2MKC A;  4FXD A;  4OIX A;  1Q0N A;  1FTC A;  5L46 A;  2B8P A;  5KT4 A;  5D3G A;  3I4P A;  4IO9 Q;  3QIP A;  1U0H B;  3GIK A;  3RB3 A;  4W92 B;  4KO0 A;  2DNG A;  2KVI A;  1T95 A;  1D09 B;  4ZIV A;  2DHH A;  5AXN A;  4LUB A;  4UTG A;  3LQV A;  2V4J B;  3N9U C;  5KFU A;  4WU2 A;  1ZZF A;  3ETO A;  5KG2 A;  4S0M A;  5ETL A;  3KLI A;  4WP3 A;  2A0F B;  2I9S A;  2DKO B;  3PY8 A;  2MHE A;  1HBU B;  2Q3P A;  1GNK A;  2CPX A;  1S4E A;  3ENV A;  4PXE A;  2R7W A;  4H4K A;  1TK0 A;  4V1A k;  4DFM A;  5HAO A;  2DXD A;  1WSR A;  2B51 A;  2F4F A;  4LT6 A;  2E9R X;  4NMX A;  1DHM A;  3F41 A;  1FNX H;  4DL5 A;  5LXR A;  4Y65 A;  5E2Q A;  2VA2 A;  3M8P A;  3GG1 A;  5KFJ A;  3TYT A;  3TZZ A;  2KB2 A;  3M2V A;  2UXD F;  2RE1 A;  2G9O A;  3P5B P;  5KOW A;  2C3P A;  4X4P A;  1NAQ A;  3M6U A;  1T11 A;  3CJ2 A;  3LWM A;  1SBR A;  4AYB D;  3T3F A;  2L41 A;  4RU2 A;  1QAJ A;  1HI8 A;  2KL8 A;  3FZ2 A;  2IA0 A;  1NK0 A;  4U7C A;  3TNV A;  5C2C A;  1U49 A;  4RR5 A;  1H2U X;  4UY8 5;  3OJU A;  1S6O A;  2DVI A;  4KT0 C;  4ZPW R;  4MK8 A;  3GCX P;  1S7I A;  2R2T A;  5K9F A;  5J2M B;  2FVS A;  1B7F A;  1AXQ A;  1TQL A;  3ENW A;  2C42 A;  4X2B A;  1VK3 A;  2WAQ D;  2ZH6 A;  4X4O A;  3OBI A;  3KWM A;  1VRU B;  3BDE A;  2IC3 A;  3J81 U;  4QYZ J;  4N5S A;  3TUZ C;  1UWA A;  3RGI A;  4TY8 B;  2ZM6 J;  4G1P A;  5KAK A;  1IKY B;  4DWI A;  4MIB A;  5BJR A;  2PI5 A;  4RW4 B;  1N34 F;  2IMO A;  2BAN B;  1V3R A;  3CDU A;  3M8W A;  2DO4 A;  2OAU A;  3UD3 P;  1Y00 A;  4L6V 3;  2R4F A;  2R7T A;  4WFB Q;  1NJI T;  1I6J A;  2YQ3 A;  1R3N A;  3DOL A;  3BBB A;  1IKV A;  2J6T A;  1NH7 A;  1RCX B;  3HM9 A;  2UU9 F;  3R5A A;  3BGL A;  3UR3 C;  3EE3 A;  1UVL A;  2LU1 A;  4MIW A;  2HG4 A;  2C2D A;  4RNM A;  3LUY A;  2OO4 A;  5HSP A;  2BKO A;  5DDP C;  1C1B B;  3HFV A;  1TL4 A;  5C24 B;  3CCZ A;  1KQS R;  1TK8 A;  2R7O A;  4CT8 A;  3UN3 A;  2ZE2 A;  5C5J A;  3MZI A;  3LAN A;  2D9P A;  1B0V A;  2J7K A;  1FRM A;  2B4U A;  1N8R T;  2WON B;  4NRU A;  3S1T A;  4M1K A;  4RNF A;  4IQX A;  4RX6 A;  2YTC A;  2LU2 A;  4WP9 A;  3CDA A;  2V8H A;  4C8N A;  3QT8 A;  2IDL A;  2NPI A;  4OX7 A;  2PC6 A;  5GAG I;  4B9T A;  1U6B A;  3QT6 A;  3KOA A;  2DGW A;  5F9L A;  5ETR A;  3M32 A;  2FYX A;  1ZZN A;  5KFI A;  4JBC A;  2ATL A;  3G4S S;  4XK8 C;  1VJQ A;  2D3O 1;  3M30 A;  4P73 A;  2MZT A;  4X65 F;  5I3Q A;  3SQG A;  2OEK A;  3OV7 A;  3CJ8 A;  5AJ3 F;  1EB0 A;  4NYZ A;  5CYM A;  4Q44 A;  1SJF A;  4JI5 F;  2Q66 A;  3HI9 A;  5K8N A;  4JV1 A;  2XG8 A;  2BW7 A;  2OIH A;  3NEK A;  2Y8Y A;  1TAQ A;  4PYA A;  5CAB A;  2CXE A;  5B0E A;  3I9V 9;  1ZAW A;  1YJT A;  3AD9 C;  1LWE B;  1T9W A;  3ENQ A;  3LP2 A;  3CCQ S;  2J9C A;  1VQO S;  3DOK B;  1IKX B;  5KFS A;  4OZ2 A;  4UUW A;  1PCA A;  2QLJ B;  3LGM A;  4RUC A;  1FNM A;  1GXL A;  2JSX A;  2Y9H A;  2VJU A;  3C19 A;  2DHG A;  1RT5 A;  2P9C A;  4LFB J;  2CPY A;  3A4T A;  5D0E A;  5LMN F;  4LBH A;  1Z2Z A;  5KT3 A;  4JI6 F;  1REV A;  3D6H B;  3JAM U;  3TQE A;  2GIR A;  4FF4 A;  3EMT A;  5EWG A;  3MEE B;  3QZ7 A;  2JEJ A;  1YRX A;  1T02 A;  3FNN A;  3P45 B;  3SCJ E;  2XGQ A;  6FDR A;  2JL9 A;  4K2X A;  4TQR A;  5CYQ B;  4N47 A;  3UE2 A;  1PGZ A;  4OX8 A;  3BO4 A;  3BPS P;  3UDC A;  4LSN A;  4WFZ A;  2LA6 A;  2QMW A;  2BJ9 A;  1WUU A;  2RQC A;  1IR1 A;  4XIU A;  1W2I A;  3FBC A;  4FYV B;  3R2C J;  2N3O A;  3G8S A;  2F3J A;  4C3M A;  4PR6 A;  3H2L A;  3KFW X;  1HLW A;  3C6T B;  3BR9 A;  2I1R A;  1XR6 A;  4LVN P;  4MFB B;  4O4G A;  1VQY A;  2E7W A;  1RTD A;  2M2B A;  5ETQ A;  1S0O A;  4YB5 A;  1N33 J;  1MU2 B;  4NXN F;  1DTT A;  1HNZ F;  1HWL A;  4F2S A;  2JJ4 D;  3GYX B;  3PW2 A;  2BEF A;  2W2P P;  2OFG X;  4DPT A;  2ZBP A;  1VQ4 S;  2XO6 A;  4KHM A;  4ECR A;  1OYE A;  2KG0 A;  4TYA A;  4RW8 A;  2F4V J;  4YY3 F;  5F8L A;  1C2P A;  3TWZ A;  3RTV A;  1RTI B;  1SQG A;  5DJB A;  1KFD A;  5L1J A;  2W9A A;  5A2Q Y;  2DR9 A;  5LSR A;  4GC7 A;  1PBU A;  1HNW F;  5I42 B;  1ZM9 A;  4CZC A;  3G6Y A;  3PW4 A;  1RYR A;  1BQM A;  4K4V A;  1WG5 A;  1S6P A;  3TUI C;  1HMV B;  4ZKA A;  4CLT A;  4FYD A;  2GIQ A;  2HHS A;  4DN9 A;  4MAK A;  2DHA A;  2YVS A;  1FRX A;  1WF2 A;  4RKU C;  3SCI E;  2BA9 A;  1M1H A;  3FMB A;  5D8H B;  2RF2 A;  4PYD A;  2XYP B;  3CDB A;  1Z4U A;  2B6A B;  4YDD B;  1JXE A;  1KVI A;  2QFJ A;  3WQP A;  5FDL B;  5HVG A;  4LF5 F;  3R7B B;  4JYA F;  2EXU A;  5EWE A;  4H4O B;  1U4B A;  1TV6 A;  2HQI A;  2Y0S D;  1S1U B;  2D41 A;  4HR2 A;  1T9T A;  1X5O A;  3MEC B;  4IOB A;  1M5K C;  2EFG A;  1FVQ A;  2PD1 A;  4OJH A;  3P3D A;  2DR5 A;  1NME B;  3VQT A;  1WF0 A;  1C0T A;  1N32 J;  4LF4 F;  2QX0 A;  2MZ1 A;  3MMB B;  3ISN C;  2BAC A;  5KTQ A;  2A6O A;  3RBX A;  4CLZ A;  3ZNJ 1;  1CJK B;  4NEZ A;  2YH0 A;  2MY7 A;  3L3C A;  1B64 A;  2L9D A;  4IFV B;  1K0T A;  3H4D A;  1N36 F;  2MTL A;  1NK5 A;  5CH7 B;  3BSA A;  3IWL A;  1UWB A;  3C46 A;  3MM6 B;  3BF4 A;  4F3M A;  2ADB A;  1TAU A;  2WVD A;  2VG5 B;  4ZVP B;  2XLJ A;  2AYE A;  1NRK A;  1WDD A;  3IS9 A;  1F0X A;  4ICL B;  1DFD A;  3MM7 B;  1HIY A;  4NLW A;  2RQK A;  3D67 A;  4AD6 A;  2VKZ G;  2D74 B;  1IVZ A;  1VQS A;  1HFE L;  1CEZ A;  1QM9 A;  5DO2 A;  4DPX A;  3G96 A;  2VPY B;  1NM2 A;  1W7W A;  1UL3 A;  3CF5 Q;  1VMB A;  3POT B;  2ZWP A;  3GIL A;  4WIQ A;  3CME S;  1TL3 B;  2CQH A;  2VAS A;  3ZTQ A;  2IVM A;  2I5J B;  5C25 A;  5D4N A;  3LH2 S;  1X4C A;  2ZVI A;  1QLN A;  2GC8 A;  4M8L A;  2QLW A;  1N5V A;  4IG0 A;  4C8Z A;  2Z57 B;  1NU4 A;  2VC0 A;  1X4H A;  2AEM A;  3I0R B;  2ZJP Q;  4FPI A;  2CDQ A;  1ZM2 A;  2L3M A;  1KOH A;  4WFN Q;  3JSB A;  3MD1 A;  1WD6 A;  2HS0 A;  4DCJ B;  1FKP A;  3DLL Q;  4NWB A;  3JSM B;  4WE1 A;  4ZHR A;  5K20 B;  4FXW A;  2AJ2 A;  2ZHB A;  4X62 F;  3KK2 A;  2LLZ A;  1S12 A;  1S6Q B;  2CJK A;  2N3L A;  4TVA B;  2CAD A;  3T1Y J;  1N88 A;  4I2P B;  2VG7 B;  3J80 Y;  3O2I A;  4C8L A;  1T05 B;  1YRU A;  3V6H A;  2GFF A;  3M1V B;  1HQU B;  4AL6 A;  1X5P A;  1WC5 A;  2HQD A;  1HD1 A;  2FLN A;  5HLF B;  2YX1 A;  4KH0 B;  4USU A;  1SIZ A;  2OEJ A;  4F4K A;  3NNC A;  2HMI B;  3R1L A;  1HNX F;  4B9S A;  3M9N B;  5EUH A;  2UXC F;  1T03 B;  3JXO A;  1PJ5 A;  5KT7 A;  2GV1 A;  3DU6 A;  1VHI A;  5A0Y B;  2EVZ A;  2XWY A;  3EDR B;  1TEL A;  1NJZ A;  5L9X A;  3EGV A;  2XLK A;  4M5D A;  3PVX A;  1RTZ A;  3GV5 B;  5DDR C;  3MUT P;  2EPI A;  1RWM B;  4EBC A;  1UVN A;  1FES A;  4KPC A;  3PO5 A;  1U6Z A;  1HBN B;  3HVT B;  4YR2 A;  2R7S A;  3KYL A;  2GO8 A;  3PM9 A;  4DBQ A;  2AQ4 A;  3SSQ A;  3FDS A;  1VBK A;  2HUR A;  2NSC A;  1O5J A;  2GJ2 A;  2VFT A;  4UW2 A;  4I64 A;  2LDI A;  3DRP A;  2W1B A;  1RAJ A;  1EX8 A;  3J7A N;  1R0B G;  2RDJ A;  2IMW P;  4B3S F;  1X4B A;  4RLE A;  3CJK A;  2DGS A;  3D7S B;  3C16 B;  3M2U B;  2D3U A;  4PCQ A;  2OD4 A;  4XDC A;  1RT1 A;  2UP1 A;  2YWE A;  4NCG A;  4WWS A;  3CJ0 A;  2X1G A;  5K8M A;  2HWH A;  2XS7 A;  1GMW D;  2Y1R I;  2OP5 A;  4DV2 J;  4A47 A;  3QLH B;  3H5X A;  1FRJ A;  4KV8 B;  5HRO A;  2GML A;  4U8Y A;  2IPO B;  4P2F A;  2YKA A;  5T41 A;  4ZVT B;  2G0C A;  5A8R B;  3HFK A;  4WPA A;  2UUT A;  5AE3 A;  4NYP A;  3RRK A;  1WAC A;  5F41 A;  1WOS A;  2NS1 B;  5KFZ A;  3PW5 A;  4B9L A;  4RPF A;  1FXD A;  3W3S A;  3HJF A;  2KDO A;  4Q43 A;  1RBL A;  4Y2A A;  4JI3 F;  2WRM A;  1F6T A;  4QOT A;  2R8I A;  3C14 B;  4CO2 A;  2HEK A;  2A1B A;  1UET A;  3FRZ A;  1VYA A;  2DD8 S;  2X1B A;  4KHP F;  5KFT A;  4R8U A;  1DTQ A;  3KHG A;  2CUY A;  3A1Y G;  1UA1 A;  1YBT A;  3LWL A;  3PW7 A;  2E7V A;  3UDV A;  1M5S A;  3RBD A;  3AB2 B;  3VVU A;  1WHY A;  4F8R A;  3QAE A;  1RT6 A;  1Q81 T;  4YHH J;  3JTP A;  4I6W A;  4K50 A;  2BR0 A;  1RU2 A;  4Y6I A;  2C3U A;  4WK1 A;  2ILY A;  3A3N B;  3HO1 A;  1XC9 A;  4OZ5 A;  3ILI A;  5KFQ A;  3LO3 A;  2WW4 A;  4DX8 H;  3NS6 A;  3IG1 B;  2B8Q A;  2QT7 A;  1FRL A;  5E3P A;  1U47 A;  5KFM A;  3VZI A;  2LQ8 A;  1HR0 J;  1DLO A;  3M7V A;  3V4I A;  3BH6 B;  4ZP6 A;  2K2P A;  4WTO B;  2ZDP A;  5GAH I;  3LTO A;  2LEP A;  3FEZ A;  1DJ0 A;  4RNN A;  1PBA A;  4F4Z A;  1FJE B;  2ZH8 A;  1HHQ A;  2R7U A;  2YNG A;  3TAR A;  1JKH B;  4O3P A;  2D3O R;  1ZPV A;  3OVB A;  1RUS A;  5EHH A;  2YKN B;  4UT4 A;  1S49 A;  5H9E K;  1GMW A;  1UPM B;  5GAH U;  5LMU F;  1VC0 A;  1JLC A;  4ILM A;  4LFC J;  4JI1 F;  2HNY A;  1Y3J A;  1IQZ A;  2HND B;  1CC8 A;  5SUH A;  4XPC A;  2PFD A;  2RB7 A;  2OJ3 A;  4O0N A;  4OZL A;  2VHG A;  4Q0B B;  5FII A;  4DX5 A;  4N8N A;  2OEM A;  4LF6 F;  3UO0 A;  3KLF A;  3B6B A;  3HSD A;  3CD7 A;  2RRB A;  1FKO B;  2AKW B;  1TKZ B;  4K5R A;  3RU0 A;  2KFY A;  4NPO A;  5DQH A;  1P8G A;  4DR2 F;  4ECS A;  3QGG A;  1VQL S;  1OY8 A;  2Y1L B;  2G13 A;  2NXE A;  2XYG B;  4U7U K;  1NPR A;  2JX2 A;  5JVG Q;  1FE0 A;  1U8S A;  5IM0 B;  4DL7 A;  2FDN A;  3SBM A;  1SKU B;  1R43 A;  1U1M A;  4UOC A;  5KG6 A;  3M8R A;  4R0J A;  3FSX A;  2QGF B;  5L1I A;  2XZT B;  1UFL A;  1RAB B;  3MTJ A;  2B7B B;  2IAJ B;  1IJF B;  2L9W A;  4PQU B;  2LXI A;  1SQF A;  3I0S B;  2PN6 A;  4CQ1 A;  3AT1 B;  2QZ8 A;  4JI4 F;  4ECQ A;  5HVH A;  2BJ1 A;  2VBX A;  3R5B A;  2B56 A;  2OGU A;  2J0S D;  2ZKT A;  1WF1 A;  2IM1 A;  2Q43 A;  5ETO A;  1AYE A;  1NJY A;  3WDO A;  4U67 Q;  1QSL A;  2E5L F;  4C8O A;  5LL6 d;  2OHD A;  1AA1 B;  2GNK A;  3OW2 R;  3GR1 A;  3RYL A;  4QIF A;  4GKJ J;  4USV A;  4KKO B;  4R0E A;  2VPW B;  2DPJ A;  4J5O A;  2HZA A;  4CM2 A;  1C0U B;  3IRX A;  2DIT A;  2FVP A;  1VRT B;  4A48 A;  2DTJ A;  1IBK J;  3GFY A;  4QPX A;  5BYR A;  2XY5 A;  2DGX A;  2CRL A;  3GB0 A;  1XBW A;  2V34 A;  3HHL B;  1IJE B;  4N56 A;  2XHC A;  5CD4 A;  4KSE B;  2ZD1 B;  4OYX A;  1PYT A;  3H5U A;  5U47 A;  1F5C A;  3NGK A;  1RSC A;  4LSL A;  3FCV A;  3X3U A;  4OQJ A;  2HHH F;  1JJ2 R;  1AUD A;  4LBP A;  2PA8 D;  1NSQ A;  2W9B B;  1YKW A;  3V81 A;  3HX9 A;  3I56 S;  3SV4 A;  4B9U A;  3T6B A;  2HSE B;  1RU1 A;  1FX2 A;  4ELT A;  1KR4 A;  4DXL A;  2RD5 C;  3OXG A;  3HT0 A;  1JWW A;  1X4G A;  1PG5 B;  4KGM A;  2KFZ A;  2KM8 C;  1S59 A;  2C2O B;  5KFY A;  2KZM A;  4QJV A;  2QFI A;  4PWW A;  1TUG B;  3Q8U A;  1IKW A;  4QZV B;  3B82 A;  1OS5 A;  2ZH4 A;  5F8N A;  1NPK A;  1CJU A;  3KLG A;  3VHQ A;  3FBF A;  2VQE J;  1WDT A;  2EI5 A;  2ZVS A;  1KS2 A;  2JEF A;  4NZ7 A;  2EW9 A;  2PSZ A;  1APS A;  2FHO B;  2VQF J;  3TO8 A;  2B9Y A;  5DLF A;  4KAI A;  1LK5 A;  1DBD A;  4FPR A;  2MJU A;  5ETT A;  3DGV A;  2K1R B;  3W65 A;  4B9N A;  4NI2 A;  1WC6 A;  1XMQ J;  2HAI A;  2O01 C;  2HFN A;  2BUN A;  5I3U A;  3D3B J;  2XS5 A;  1AUS L;  3IR7 B;  4BHQ A;  3R6G B;  5E41 A;  4YB1 P;  2ZNZ A;  2H1Y A;  1RAF B;  5DDO C;  2FGO A;  3CO9 A;  5HL7 Q;  1T94 A;  1BLU A;  3TX8 A;  3GR0 A;  1F9F A;  5KFK A;  1UCN A;  4HI2 A;  3OL7 A;  2WW8 A;  3NLC A;  4Q2L A;  3KHH A;  3MPD A;  3Q8V A;  2CQ3 A;  4F0H A;  2EFO A;  3WC0 A;  1HWJ A;  3VAH A;  2AGO A;  2QTW A;  3IWN C;  4I68 A;  4OLO A;  4P9S A;  2F9D A;  2UXB F;  3BH7 B;  3P8B B;  1WJ9 A;  1CS4 A;  3LP0 B;  3TAM B;  2NYI A;  4O3S A;  1X31 C;  3PFE A;  2MZS A;  2QG9 B;  3MPY A;  2EBG A;  1FTR A;  1OY9 A;  5B0G A;  3QT7 A;  4C11 B;  5CZV A;  3TUP A;  1JLF B;  1VGY A;  1JIH A;  2YWG A;  3W2W A;  3JTO A;  3UCG A;  3IXQ A;  2KRR A;  3ITH B;  1B4S A;  1LW0 A;  4ECX A;  4WII A;  3FSI A;  5H9F J;  4EI2 A;  3SCL E;  2IRU A;  3O3L A;  4OI0 A;  3VQS A;  3L09 A;  4KB7 A;  2QA4 G;  5D4L A;  1SXL A;  4UQT A;  2XY7 A;  1JLQ B;  3M2R B;  5IWA J;  1S76 D;  3ISZ A;  3V6D B;  1XNR J;  4WP8 A;  5D0H A;  2ASL A;  4B9V A;  5GAD I;  1RTJ A;  3KTQ A;  1TKT A;  4DF8 A;  2PMW A;  3OL6 A;  1FF2 A;  1YDL A;  3IAM 9;  4CO4 A;  1VQP S;  3GPA A;  4HH1 A;  1WI6 A;  1RYS A;  1HNI B;  4CLU A;  2O66 A;  3S01 A;  2J0X A;  5J2N B;  3NG8 A;  5G0R B;  1RT4 A;  2OPR A;  2ADC A;  1EQM A;  2BM1 A;  1YJN S;  4K4Z A;  2QV6 A;  1YJR A;  4DZ6 A;  1KQK A;  4P6Q A;  1KDN A;  4ES3 A;  2MZQ A;  3HXM A;  4N41 A;  1RIS A;  4QU7 A;  3W8P A;  2KXF A;  1WI8 A;  3GE9 A;  2YNI A;  4K4T A;  4NA3 A;  3LF0 A;  2PMH A;  5HP1 B;  2JEG A;  2FQQ B;  3M9O B;  3KJF B;  4GVL A;  1F9H A;  1LXN A;  1N6Q A;  2FC8 A;  4EYI B;  3OR2 A;  3D2W A;  3B54 A;  4EO6 A;  4X4R A;  2CQ1 A;  3PRD A;  2V69 A;  2WK4 A;  4QWE A;  1SJ1 A;  2V2K A;  1ITP A;  2CQD A;  5D0G A;  4JV5 J;  5A2Q U;  2MQL A;  2RU9 A;  4ECV A;  4DV0 F;  1NBE B;  2FC9 A;  4LR9 A;  3UN2 A;  4TKT A;  4PRF A;  2G4B A;  2X7I A;  4MIA A;  5ETM A;  4FN5 A;  3AD8 C;  1YK9 A;  9RUB A;  1YZ6 A;  5KT5 A;  1RBA A;  2P6S A;  4NEY A;  1FX4 A;  3IA0 A;  2XSJ B;  3MGJ A;  2G0J A;  3KK3 A;  2X1A A;  2I8E A;  1UJ4 A;  4F02 A;  1VCT A;  3G86 A;  3EUN A;  4OZ3 A;  3CIM A;  2D69 A;  1SKS A;  3MED B;  1TK5 A;  3CCW A;  2VG6 B;  4ILL A;  4MK9 A;  3CIZ A;  4USK A;  1XIQ A;  1S9G B;  1Y5I B;  3NAH A;  1JXV A;  4OHV A;  4Y28 C;  2H5E A;  3PKM A;  3FQK A;  1UW9 A;  3J7Z T;  3HKZ D;  4KO0 B;  1MRO B;  2E29 A;  2GVD A;  2FVR A;  4QWB A;  3PFO A;  2WVB A;  1UPP A;  1HKA A;  2CNL B;  2ZBR A;  1WEZ A;  5T7L B;  1YHQ S;  1Q8K A;  2R7X A;  1S9E A;  4OZ0 A;  4JI2 J;  2OD6 A;  5K5M A;  3MM5 B;  1U8W A;  3MM9 B;  1NND A;  2HS4 A;  5LJ3 Y;  1RQ0 A;  1U2R A;  1SC3 B;  3RAM A;  2R9L A;  1RWP B;  3R9L A;  4FYW B;  3T1H F;  6FD1 A;  2UU9 J;  1M90 T;  4U95 A;  2DXF A;  2Q79 A;  1UTA A;  5K14 B;  3G2X A;  3NMA A;  2DGQ A;  1ROF A;  2MLZ A;  1V5I B;  3I5A A;  1PO6 A;  1NXI A;  2GHP A;  4NLU A;  2WSF C;  2FLO A;  3DLE B;  1Q79 A;  1IN0 A;  1PAU B;  4Y2C A;  3SEO A;  2ZH2 A;  4DJB A;  4AE5 A;  2QLF B;  3FQL A;  1Q7Y T;  4CLW A;  2V8P A;  3KG4 A;  1WC4 A;  4LR7 A;  3QO9 A;  1X9W A;  3VAI A;  2KG1 A;  4PG6 A;  4NA2 A;  3V5R A;  4C8M A;  4KYZ A;  3FGV A;  1FK9 A;  1HI1 A;  2J7U A;  4P71 A;  1I3O B;  4ZCK A;  4C48 A;  2LXU A;  3LAM A;  2M8H A;  4A8S A;  2FZC B;  3SDE A;  1NSK L;  4LVO P;  3F44 A;  3WIU A;  1WHW A;  2CQ2 A;  2V9K A;  5DM7 Q;  3FBB A;  3Q8S B;  1XMO F;  3I96 A;  3LP1 B;  4ZCM A;  2CQ0 A;  4ED5 A;  4JI5 J;  2VFU A;  2W7P A;  3NWR A;  2EK6 A;  4K7Q A;  3EZU A;  4FYX B;  4DL2 A;  3JTN A;  1V6H A;  1QAI A;  1N4L A;  1D0E A;  1KLM A;  2VZ9 A;  2FY1 A;  3ILJ A;  3KDN A;  1HWU A;  3HJV A;  3UDL A;  3Q24 A;  1JB0 C;  4B02 A;  4NLO A;  3HDS A;  4ECT A;  3KLE A;  3CJ5 A;  5ETS A;  3AD7 C;  4WU3 A;  4IR1 A;  4NLG A;  3VAJ A;  4DL4 A;  3J80 U;  1JX4 A;  4OYW A;  3JYT A;  3Q8P B;  1HBO B;  1AW0 A;  1S1W B;  2E9T A;  1Q8B A;  3FRY A;  2HNZ A;  5EX0 A;  2OEL A;  1U0S A;  2A2D A;  3MAH A;  3UR0 A;  1YJW S;  1IKV B;  2ZBC A;  8ATC B;  4DUZ J;  4ZVF A;  4NX9 A;  2Z0G A;  1JLB A;  3G8Q A;  1LXJ A;  1S0M A;  4K59 A;  1EET A;  2CIM A;  3D6T B;  1BUX A;  1U48 A;  3QFH A;  1L3S A;  2LEC A;  2ZE2 B;  3ZZT A;  2MQQ A;  2O1P A;  1L3U A;  5CD4 H;  4AQY J;  3NMR A;  5A8K B;  3MR3 A;  3OHA A;  4OL8 A;  1IWG A;  9ATC B;  4CTA A;  4CNY A;  4ID5 A;  1X4F A;  4C97 A;  1U1Q A;  1PC4 A;  3RJM B;  1WOR A;  2QA4 S;  4TLQ A;  2CG8 A;  4R5P B;  1HQ2 A;  1U2F A;  3OSP A;  2KYZ A;  2P9G A;  1TFW A;  3M32 B;  1S1X B;  3NCP A;  5AE2 A;  2OTL S;  4PWD A;  3NOC A;  4PPZ A;  2AYM A;  3EJM A;  1YI2 S;  1N5Y B;  1J5E J;  4NXN J;  3QRP A;  1HNZ J;  3SQG B;  2LXF A;  1D8Y A;  5CYM B;  4KQZ A;  2PII A;  2LQB A;  1ZAX A;  1D3W A;  5A8W B;  2QYG A;  1NJW A;  1WTF A;  3OVS A;  4FF2 A;  4JI8 J;  3D54 A;  2RKI B;  4HTI A;  3KKF A;  4LRA A;  1HNW J;  5J1N A;  2J0W A;  1FDB A;  4PXC A;  4UOG A;  4ELV A;  2FUG 9;  5DG9 A;  1FVS A;  5L1K A;  1CBK A;  3GV8 B;  1RT5 B;  2BQU A;  3KLV A;  1HPZ A;  2EFQ A;  5HQL A;  1U0H A;  1D9A A;  5EX3 A;  2V0N A;  5H9E J;  2GAG C;  3D0G E;  4C9D A;  1L3K A;  4TQS A;  2OKQ A;  1KHW A;  2APO A;  4V19 X;  2D9O A;  3MCO A;  4W90 B;  3NBP B;  3BB5 A;  5KG4 A;  4PG8 A;  3GJT B;  3R6L B;  3I5B A;  2AP6 A;  4N76 A;  2PI4 A;  1VDH A;  4DL3 A;  1SJQ A;  3A8I A;  4LSN B;  3HSZ A;  4DR1 J;  4LF4 J;  1I1G A;  2ZOF A;  2UVW A;  4AT1 B;  5GMK a;  2R2U A;  2MKS A;  4M5K A;  1SL2 A;  3BKF A;  4OI2 A;  1S79 A;  3LAK A;  4LRD A;  3KJN B;  4UZC A;  2NCK L;  2DO0 A;  2C28 A;  2MPU A;  2WSC C;  4KC5 A;  1Y9O A;  3KXD A;  1VQN S;  4EEY A;  4ED1 A;  1ZM4 A;  3JS9 A;  4ZJL A;  4DR5 F;  1X5S A;  3RAQ A;  3CJS A;  3SSR A;  4AXI A;  3O8W A;  4CO3 A;  1M5O C;  3RB0 A;  2RDD A;  4KGV B;  5J2M A;  3DNC A;  1HI0 P;  2IA6 A;  3CGI A;  4HL9 A;  2H4W B;  2DT9 A;  3MCM A;  3A13 A;  4K5S A;  3H25 A;  2EG2 A;  2B5J B;  3S6E A;  1MWZ A;  2J9E A;  2D1C A;  4NZ0 A;  4K4S A;  2QMU B;  2RQM A;  1XJW B;  2Z2Y B;  1NKC A;  4DQP A;  2HHV A;  4TY8 A;  3AXM A;  2BOA A;  2CYY A;  1IKY A;  2ZEJ A;  2F7V A;  4ECY A;  3SMZ A;  4RW4 A;  2F8M A;  1SC4 B;  2OLW A;  2LEB A;  3Q0A A;  4C0O C;  4RW6 A;  2QSW A;  4CP5 A;  2BAN A;  1SC1 B;  3QNW B;  2JLG A;  1HQE B;  2DHX A;  3U1L A;  2N7C A;  5B08 A;  1UJ6 A;  2FHJ D;  4FF3 A;  3CC4 S;  2N4D A;  3DLG B;  3GJR B;  4X62 J;  5M2U A;  2HZV A;  1F9E B;  4M5H A;  1NKE A;  2MST A;  4DU7 A;  2MKJ A;  3BGU A;  2H9Z A;  1FRH A;  3GTY X;  5C24 A;  3PYF A;  4YME A;  1JJC B;  1LWF A;  2C1E B;  1UWB B;  2R8J A;  1WC3 A;  3IRW P;  2RNE A;  3P49 B;  2JOQ A;  4A8M P;  3D1H A;  2WON A;  3CCR S;  4PG4 A;  2UV8 G;  1HNX J;  3CSK A;  2XZW A;  2JLF A;  2QLB B;  2AJ1 A;  1W26 A;  3T9N A;  4F67 A;  1ZA1 B;  1FDN A;  4DPO A;  1SH2 A;  4NRT A;  1DRZ A;  1YIT S;  1PIL A;  4Y0F A;  3E3X A;  4FF1 A;  3K2Y A;  3BEG B;  1O0P A;  3M6X A;  7FD1 A;  4IRC A;  1R8H A;  3KNA A;  3GYN A;  4DV5 J;  3S7R A;  1IQT A;  3H8Y A;  2OPS A;  4M5N A;  3K59 A;  1CJV B;  2G0I A;  4CH7 A;  4AL5 A;  1N0V C;  4NYO A;  5IQQ A;  2YWW A;  2L48 A;  3CXC R;  4OI3 A;  1ACM B;  2LQ9 A;  4LSZ B;  4H4K C;  1TL1 A;  5C25 B;  4TU8 A;  1VBX A;  3DOK A;  2K3K A;  5DS7 A;  3MAA B;  1R27 B;  3UVJ A;  2MLY A;  2HHQ A;  2CJB A;  3M8Q B;  2DBB A;  4PUO A;  3OFG A;  3GFZ A;  1FJG F;  3RZA A;  5A76 A;  2XI2 A;  2CWK A;  2IM2 A;  2FZG B;  2HZC A;  3NP5 A;  3KK2 B;  5L38 A;  2E5G A;  1R7I A;  3MEE A;  4F3O A;  5D78 A;  1U1K A;  2VDI A;  3T41 A;  3CT9 A;  2QRR A;  2HBZ B;  1QSY A;  1RHM B;  2FHJ A;  3GJQ B;  3QSY B;  2ACY A;  2JVO A;  1PIE A;  3DCA A;  4JI3 J;  1UAW A;  1KEK A;  4F4Y A;  3ET6 B;  2DYA A;  2VFR A;  2K06 A;  3PR4 A;  2RUS A;  4EO8 A;  3MMC A;  3RB6 A;  1UVM A;  2HQF A;  1UFK A;  4G65 A;  3GU0 A;  3J7Y I;  1BHN A;  4K4W A;  3QRR A;  4KHP J;  1JJH A;  5CXT A;  2QJ3 A;  4YDX A;  5ETN A;  2JC1 A;  2E7X A;  1RWK B;  3DHX A;  2IBO A;  4DI6 A;  4MFB A;  4DV6 F;  4M5D B;  3LGH A;  2YQ0 A;  4YQW A;  3A8K A;  4XAK A;  5THW A;  3SZ2 A;  2V8V A;  2HKE A;  1T9V A;  2MXY A;  2XCP A;  3HZE A;  4X4T A;  1VQ5 S;  2XC9 A;  2AT1 B;  4BCA A;  1RTI A;  2P9E A;  2UUC F;  3CJK B;  4X64 J;  1F3V A;  3DRR B;  5I4M A;  3GFH A;  3H90 A;  2GZO A;  3A8J A;  3AAW B;  1QDU B;  1HMV A;  3NCR A;  4C0H A;  3E8O A;  1NDC A;  3Q8Y A;  4P7T A;  2HYI B;  4J9N A;  4Z7C A;  4X4Q A;  3R5C A;  1FWL A;  4Q8F A;  4P52 A;  4KR0 B;  1RT7 A;  2DY9 A;  4DX6 A;  2XMK A;  4QIV A;  5IXU A;  1JNZ B;  4LRE A;  5F9N A;  4HEA 9;  3B4M A;  2V50 A;  1N0U A;  1YTY A;  3DLK A;  1WG1 A;  2HFS A;  5FDL A;  3NNH A;  3BBC A;  1N54 B;  3K17 A;  4H4O A;  2UZA A;  2WCX A;  4I7F B;  5LSL A;  1S1U A;  1RTH A;  4TY9 A;  2QSF A;  3MEC A;  4DR4 J;  5LMU J;  3OR1 A;  4NLT A;  2C3Y A;  1QAX A;  2HGM A;  1K1Q A;  2VKR A;  3W60 A;  2RIL A;  2ROP A;  2FJV A;  4JI1 J;  3BGF A;  3MMB A;  5FLX Y;  2UUB F;  1BQN B;  2HLU A;  2R2R A;  3FBE A;  3N28 A;  4DL6 A;  1LWC B;  4NZ6 A;  1CJK A;  3EX7 B;  3VTI A;  4CO0 A;  4R8U B;  1DTQ B;  3MUR P;  4E2F B;  4F3Q A;  1TL5 A;  3MM6 A;  2NUH A;  4DR2 J;  2IFX A;  2V94 A;  3C6U B;  1RT6 B;  1QTM A;  4M5I A;  4NLV A;  3VAG A;  2BE2 B;  4DV3 J;  2F4V F;  1GH8 A;  4AND A;  3R5G A;  3L9Z A;  1QUP A;  3OUY B;  1FHT A;  3O6Q A;  4OZJ A;  1OJ4 A;  4ICL A;  3EGN A;  1FJ7 A;  3MM7 A;  2VBY A;  1W25 A;  2X51 A;  4L76 A;  2MKK A;  4ZK7 M;  2MSS A;  5BXI A;  3NS7 B;  1V5V A;  2XO7 A;  4WYW A;  1FDD A;  3BYP A;  2J8A A;  4ZVU B;  1N52 B;  5ADZ A;  2MKH A;  1R89 A;  2NZC A;  3D1O A;  2BV3 A;  2RU3 A;  5T14 A;  1TL3 A;  5I3P A;  3T5H A;  4HT7 A;  2XM3 A;  3MF5 A;  2YNG B;  1DAX A;  5EGY A;  1N5S A;  4AFF A;  2I5J A;  4WKR A;  3W1Y C;  3TX0 A;  2RH3 A;  1R31 A;  3WHI A;  3FEX B;  3SXL A;  2BJ3 A;  2ZOM A;  4RW9 B;  3I0R A;  3QGP A;  4OHW A;  3PKY A;  4QIG A;  4JOU A;  4NLR A;  1RHK B;  5E33 A;  1M0S A;  2QO3 A;  4K4X A;  1UW4 A;  1DZ5 A;  4PXD A;  3W2V A;  2RJZ A;  1GMU A;  2XQC A;  3JSM A;  4IOC Q;  1N32 F;  3DGP B; 
#chains in the Genus database with same CATH homology
 2DXE A;  1NSQ A;  3NGT A;  1NDL A;  1BE4 A;  3EM1 A;  4DI6 A;  3VGV A;  3B54 A;  1S5Z A;  1NCL A;  1B99 A;  1F3F A;  1NUE A;  2BX6 A;  3BBC A;  3FKB A;  3NGU A;  1XQI A;  3ZTQ A;  2B8P A;  1NDP A;  1NHK L;  4W98 A;  4UOF A;  1UCN A;  4UOH A;  3L7U A;  3ZTP A;  3BBB A;  4O0N A;  1BUX A;  2ZUA A;  1NSK L;  1WKK A;  3ZTS A;  1S59 A;  4C6A A;  4F4A A;  5BXI A;  3Q83 A;  2CWK A;  1NSP A;  3MPD A;  3Q8V A;  2B8Q A;  4FKX A;  2NCK L;  3BBF A;  4KPC A;  1U8W A;  3EE3 A;  1S57 A;  3FBB A;  1WKJ A;  1MN9 A;  3B6B A;  5CAB A;  3FBC A;  3FC9 A;  3Q8U A;  4CP5 A;  3GPA A;  3Q89 A;  3VGS A;  4EK2 A;  3BH7 B;  3DDI A;  5C7P A;  3FBE A;  1LWX A;  3PJ9 A;  1F6T A;  3R9L A;  3BH6 B;  3JS9 A;  2HVD A;  1LEO A;  4UOG A;  4S0M A;  1NPK A;  3GP9 A;  2HUR A;  2DXF A;  1HLW A;  3Q86 A;  1NB2 A;  3FBF A;  3VGU A;  4ENO A;  4ANE A;  1VYA A;  3EVM A;  3G2X A;  1WKL A;  4WBF A;  1MN7 A;  3ZTR A;  3NGS A;  1HIY A;  1NLK L;  1PKU A;  4F36 A;  3FCW A;  4DZ6 A;  2DXD A;  3EVW A;  3EIC A;  3VGT A;  1HHQ A;  4HR2 A;  4FKY A;  2DYA A;  1NDC A;  5IOL A;  3Q8Y A;  3ZTO A;  1KDN A;  1ZS6 A;  5CAA A;  3ENA A;  1K44 A;  2AZ1 A;  2BEF A;  1XIQ A;  1B4S A;  1NDK A;  3PRV A;  4DUT A;  2AZ3 A;  3WX8 A;  3FCV A;  1JXV A;  1PAE X;  1BHN A;  2DY9 A;  3NGR A;  2HVE A;  3ETM A;  3VVU A;  1W7W A;  3EJM A;  3EVO A;  4AND A;  3ELH A;  1EHW A;  3EMT A;  3VVT A;  4ANC A;  3DKD A;  2VU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...