1NSKL

The crystal structure of a human nucleoside diphosphate kinase, nm23-h2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase (po4 as acceptor)
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The crystal structure of a human nucleoside diphosphate kinase, NM23-H2.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 151
sequence length 151
chains with identical sequence N, O, R, T, U
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1995-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nskL00
1NDCA 1PKUA 5IOLA 4C6AA 1NHKL 2B8QA 3FKBA 3EVWA 4DZ6A 3EE3A 4ANDA 1F3FA 3L7UA 3ENAA 3NGSA 4ANCA 1XIQA 3JS9A 3VVTA 1S5ZA 1JXVA 3EMTA 4HR2A 4DI6A 1W7WA 1NUEA 3VGUA 3PRVA 2NCKL 3ZTSA 3ETMA 1U8WA 1UCNA 3FBBA 4UOHA 2BEFA 3VGTA 2AZ3A 2HURA 3FC9A 4F36A 3EICA 2AZ1A 3FCWA 3NGRA 3BBFA 2DY9A 3R9LA 3G2XA 3B6BA 3NGTA 4UOFA 3VGVA 1HHQA 3ELHA 4DUTA 3ZTRA 2DXDA 2HVEA 3FCVA 1NLKL 5C7PA 1B4SA 3PJ9A 1MN9A 2DXEA 5BXIA 4ENOA 1NSPA 1NDLA 3WX8A 3ZTQA 1PAEX 1NDPA 3GP9A 3Q8VA 1BUXA 1HIYA 1NPKA 2BX6A 1NSKL 4ANEA 3GPAA 3ZTOA 3Q89A 1WKLA 3EVMA 1B99A 3Q83A 3FBFA 3EM1A 1XQIA 3EVOA 4F4AA 1K44A 1ZS6A 2ZUAA 3MPDA 1HLWA 2DYAA 3DKDA 1NSQA 5CABA 1EHWA 1S57A 3Q8YA 2VU5A 1F6TA 4KPCA 3FBCA 1MN7A 4WBFA 3VVUA 1WKKA 3BH7B 3EJMA 4O0NA 4FKYA 2HVDA 1BE4A 3ZTPA 3FBEA 4FKXA 5CAAA 1S59A 2CWKA 1NCLA 1VYAA 3DDIA 3B54A 3BBBA 1KDNA 1NDKA 1NB2A 4UOGA 1LEOA 3Q86A 4S0MA 2B8PA 1LWXA 1WKJA 3NGUA 3BBCA 3VGSA 3Q8UA 4EK2A 1BHNA 2DXFA 4CP5A 3BH6B 4W98A
chains in the Genus database with same CATH superfamily
1IR0A 2HS0A 4DEZA 1CPZA 1T05B 4ECYA 2R7VA 3QPIA 2FQQB 3MUTP 4LIRA 3L4BC 4OQJA 5GMDA 2GIQA 4O3QA 3ISZA 1SQEA 3HO1A 2BABA 4DHVA 4MYTA 1RWKB 2HHHJ 3D0IE 2ZJQQ 2P9GA 1Z4UA 3RG6A 2XULA 1B3TA 4WE1B 4RU2A 1RT4A 1FKOB 4Z37A 2J8SA 3RR7A 2EFOA 1FWKA 3GP9A 1YJ7A 1AYEA 2Z4PA 1U24A 2N4DA 2DEIA 4P6QA 2FJVA 3IBWA 2HQDA 1NJWA 1K44A 1C4AA 2DGQA 2LYVA 5D4OA 4A4JA 3ET6A 2MQLA 2W9AA 2YNHB 1SBRA 4ZJLA 2VBWA 2JC1A 4IQXA 4DU7A 4WE1A 4DG1A 4A8XA 1URNA 3HSZA 4OV6A 1Q8BA 1O5JA 3T5HA 4IFYA 4NZ0A 1VISA 1E6YB 1YVFA 1JLEB 2NXCA 1EARA 1R7IA 4KT0C 3CC7S 1SC1B 2RKIB 4O3PA 1KFDA 2QFIA 1JXVA 4HR2A 3KTQA 2Q6BA 4I64A 4DR5J 1AUDA 2QX0A 3AD7C 5KFIA 3QBCA 2E5LJ 1RJJA 2HMIA 2YNIB 4AL6A 2HNZB 3PEHA 3RRKA 4USWA 5D8HB 1RAFB 3VTIA 1P27B 4UZCA 4EFAC 4GO7X 3WX8A 3HP6A 5E33A 1V6HA 2LQBA 2LXFA 3QATA 3MEGA 5LT5A 4BDPA 3J7ZT 1NK7A 3K5MA 2NPFA 4XAKA 2V94A 9RUBA 1X9MA 1R31A 2FJDB 4NLVA 3FEXB 3H8YA 1VDHA 2DR6A 4F0MA 3NL0A 3KJQB 4PQAA 1SCJB 1TFWA 4UY8T 4PXEA 5HLFA 2FVQA 1U25A 4USJC 4NCBA 2AMCB 3CIZA 2F9DA 3QGHA 2XYGB 1PG5B 2IY5B 1XWLA 5DETA 2IVMA 4WIIA 5AE3A 2RQMA 2VA2A 3CTRA 3VR1A 4EYIB 3CCSS 1LW0B 3D1HA 4BCAA 5ETSA 3SSQA 1Y0HA 1OSDA 2OFHX 3M32A 3GB0A 3QO9B 1K47A 3GU0A 3WHIA 4JI4F 1HBNB 3N6LA 2POKA 1ZA1B 3V6JA 2BUNA 4K50A 2EFQA 2GS8A 1T9WA 1IKWA 2HQIA 2EKNA 4LSZB 3MR7A 3AQOA 5B0EA 3FQLA 2F8MA 1NK5A 1YJUA 2WOMA 1GFWB 1YWXA 2MZTA 2DVIA 2HVZA 4X4VA 1FKAF 3KJVA 5IWAJ 4WYWA 2VONA 3B54A 5KOXA 2B5JB 3PZPA 3WIVA 3BBCA 4PG6A 2CZ4A 2VV5A 3H98A 5J2NB 3KLFA 2EXUA 3M8WA 4J9OA 4ECUA 2JFDA 3AA8A 5LSLA 1HFEL 4FNIA 2RSQA 2LDYA 4NMXA 4GC6A 5H9EK 3WX4A 5T41A 3WIUA 3GR0A 1H3DA 4DPYA 2EWHA 3ONQA 4AQYJ 1PJ5A 3PIPQ 5K8PA 1UEVA 3LWLA 3MZIA 1QTNB 4O0IA 3V4MA 4CO2A 1QM9A 1K8AT 2V4QA 2P9CA 2X3DA 1NPRA 2BW7A 4NXNF 3EZOA 3M1VB 2KI2A 1N5QA 2LVWA 2XB2D 3CJRA 2WVDA 3MDFA 2R8IA 2FVPA 4P74A 2FC9A 2V2ZA 2XG8A 3S6EA 4CI0B 6FD1A 2QN6B 2O1PA 1R0BG 1HNVB 2FDNA 2RS2A 3NP5A 5CZXA 2YBVA 2BQ3A 4DL2A 1FEEA 3HVTA 4FVMA 3C6TA 4X4NA 2Y3YA 3AA9A 3B4DA 1EKSA 3F0NA 1R8BA 2H5IB 4ALZA 4IH7A 2M88A 3DLEB 2DISA 2CJKA 3K7RA 4UOCA 2VIHA 4FP9A 4LJMA 4C0BA 3A4TA 1S12A 3D4JA 1U1OA 5AJ3J 2NREA 4RNMA 3OXLA 3HF5A 2FLLA 4R8UB 3VAFA 1RTZA 3I96A 1SXLA 4FNHA 2KRRA 2NXUA 2W4DA 4B3RF 1U26A 4RW6A 2CQDA 3DI6A 3DLEA 2VICA 5E5NA 4NLGA 3FVYA 5LMUF 3G6VA 4QBUA 3LGMA 2HHPA 3LP0A 1TKXB 1N0UA 4KKOB 3CJ0A 2HQGA 4KH1B 1RT5A 2UXDF 3NS7B 4IR9A 3QFHA 1Q8IA 4LBPA 4W4MA 2MKIA 4J91A 3UPFA 4I69A 4X4RA 2ZZMA 5F0UA 3HSGA 3ILIA 4LFBF 2E5GA 1HBMB 2HIYA 3MM8A 4U7UK 5LXYA 3CW2C 1BGXT 2XZTB 1RAHB 2B9XA 1UFWA 3AOBA 2V0NA 1FDDA 1RSCA 1IN0A 2HHWA 3M8SA 1UCNA 1FKPA 1JKHB 1M1HA 2OPRB 4TXSA 1KQSR 1AUSL 3RJMB 2J9EA 4DSKA 4URGA 1BD6A 1H6KX 2OIHA 2WVBA 1KVKA 3IRXB 3LF0A 1SB6A 3PKMA 1X31C 3HMJG 1HHSA 3MTJA 1Q7LB 1EHWA 2CNNB 4YR2A 3NY0A 2AF6A 5FD1A 5K14B 3G82B 3R5BA 3CIMA 1KDNA 4NLPA 3KNGA 4OLPA 4DR7J 4WP3A 1LEOA 3H5SA 3OL9A 2MKYA 4CP5A 2N82B 2CG4A 3C6UB 1RAIB 1S1TB 1RTIA 3GG1A 2EKYA 1UPPA 3GJTB 5A76A 4F26A 2QIFA 3C16B 2L08A 5KOWA 3PR4A 2FZKB 3KMQA 2NZ4A 1S0MA 1UVNA 1Q16B 2YX4A 4DUTA 4IG0B 3AD8C 3K5LA 3HHLD 4QPXA 4HKQA 4PUOB 5J2MB 3JB9k 1H74A 1NPKA 1ZM2A 1HW8A 1XR6A 2BYCA 3FBFA 4I0WA 2FYXA 3TA2A 4R0EA 2XSJB 3W2VB 2XGQA 2XC9A 1S9GA 4Q45A 5FJ4A 3KG4A 2IJFA 4FKXA 4X65J 2CQCA 4EI2A 4OZ0A 4LF9F 1RACB 2OELA 2FZGB 3K5NA 3UW1A 2KT2A 2FY1A 4NLOA 2DNHA 3TNVA 4PXBA 3W2WA 2MJNA 2W01A 2J9DE 3ENAA 4Y2MA 4KTQA 3V6HA 5GAEI 4DS5A 4OJ1A 1XN9A 1FFSB 2MZSA 4ZDNA 3TZXA 1O0PA 3GIJA 1KQKA 4L3NA 4H4MB 2XM3A 3MM7B 3PKYA 1F5CA 4D3GA 4ECZA 2GQQA 3T1HF 2E7WA 2A18A 1RYSA 1XR5A 1T3OA 4DQSA 1VQMS 3AT1B 2LQJA 1ZTTA 3VZHA 2R7OA 4U9RA 3R5CA 4DMZA 5F8HA 4NLTA 2OFGX 4RBTA 2VZ9A 3RTVA 3FJ2A 4C3MA 3M8YA 4DV2F 2Y1RI 2CPEA 2I6WA 3A8KA 3FBEA 1Q86T 3F56A 3BDEA 2HQ3A 4QWCA 3LAMA 3BQ0A 4X4QA 1MU2A 2WVFA 2WHOA 4M94A 4PXDA 1H2TZ 2BE9B 4H4OA 3G4SS 1R3NA 4K4SA 1FD2A 4AL7A 3AXKA 1VJWA 5DS7A 1EETA 1YBAA 4Q0BA 4EU0A 2ZBCA 4UW2A 1RT1A 1HBOA 3ZO7A 4Y2KA 2QYGA 4DR4F 4X2BA 3HD2A 2QL7B 5KFTA 1EIYB 3OTOF 2XSFA 4QR1A 4OHZA 4RNOA 3PXGa 2RD5C 5IFMA 2ALZA 2GVZB 1B4SA 2BM0A 1SV5B 4MIWA 2VQFF 2KZMA 4P7TA 4KBIA 2HHSA 1TMJA 2Z2YB 1FVSA 3BPDA 3I5BA 3IO1A 5C25B 4C7QA 4DV1J 1Q8KA 3RB6A 1X4HA 2F9JA 3MTKA 2ZBPA 5KFUA 4QIEA 4RNFA 2DH9A 4O4RA 4MK9A 3HVRA 5HI7A 1FJGJ 5DDQC 1R8AA 2RDIA 3CMES 1NHKL 1VI7A 1YZ7A 4JI2F 3TW0A 1F2HA 2KH9A 3D3CJ 1JB0C 3TAQA 3K58A 4Q43A 5B0DA 4X4SA 4HI2A 4DR1J 5DGBA 3BM7A 3BREA 1S1XB 1D9FA 5IT9Y 2QE5A 4ZN1A 4PRFA 1B70B 1FXDA 3CCQS 5DQIA 2IIHA 3W60A 1B7FA 1S1UB 5E7OB 1G6BA 1PO6A 3BGUA 3J7AN 4F04B 3PYEA 2IM3A 5A8KA 1H98A 1OY9A 2R8HA 3EXCX 1FRJA 5H1SV 2OEMA 1HD1A 4RWWA 1HQ2A 2DTJA 4F4AA 1YBTA 3X3UA 4JI3F 3VAIA 5MLCV 2DNLA 1VQ6S 2HZAA 2H3EB 1PC4A 4ICLB 3GWCA 1IBLJ 3I0SA 1QUPA 4YFUA 4ED1A 2E9RX 5HATA 3D1OA 1JMTA 2MQ8A 1TKZB 1S1WB 3LP2A 3C14A 3H0PA 2CVEA 4DCOB 5F9LA 1IBMF 1JLBB 3Q0AA 3L7UA 1VK3A 3CDWA 4Z7YA 4EGLA 2XY5A 4DSEA 3GCWP 1VRTB 2LDIA 5KFBA 4FPIA 2ZDOA 3POTB 3ZZZA 1MMLA 1F3VA 4O44A 2VKZG 7AT1B 2HFNA 1VQLS 2ZH9A 1UMJA 2QGFB 1TK5A 2EFPA 3NNCA 2DT9A 3M2RA 2WB4A 3SCJE 1RAGB 1HNXJ 4WIQA 4LSNA 1WSRA 3TVZA 4X84A 3OVBA 2DHXA 1JX4A 3M6VA 4PQUA 1B99A 2VJUA 4DCPB 2AYBA 4P73A 1NK9A 1SKUB 1WC6A 2ZBRA 1NPPA 1LFPA 4J5OA 1HI0P 5THWA 2XQCA 5HSPA 3C66A 1FX2A 3RAXA 1KTVA 2HG4A 1ZYQA 1QAYA 3BBBA 1NM2A 4CM0A 4QYRA 2I2YA 4YR3A 2E1MC 5KG1A 4OI3A 4DLEA 2MZQA 2EK1A 2GJIA 4IRCA 3Q22A 4J9UE 1VFJA 5CCLA 1ZZFA 2GAHC 5RUBA 3T1AA 2BJ3A 2EG2A 3MEEA 4C8NA 3SFGA 1ZH5A 4C3LA 1WHWA 3PEJA 1WTBA 4KHRA 4E8UA 2MSTA 2WAQD 3GG0A 4KC5A 1IR1A 1ZBTA 1RUSA 1WOPA 2VB6A 5KT2A 1ZZNA 3PY8A 2C2KB 4EUVA 1HMVB 1FJEB 4IFVB 4NPOA 3NRBA 1NDPA 3BN7A 2F3JA 1UFLA 4WU3A 3BSAA 2QTWA 3KJFB 4L76A 5CHCB 2ATLA 3E3XA 3HK2A 3V4IA 4A8QA 3G8TA 3FZBA 1KC8T 3AOAA 1CS4B 2AJ0A 2EFGA 2F63A 3BKFA 3JQJA 2RHSB 3HT0A 2GMHA 4C4WA 3NCPA 3C15A 3W5YA 1RT7B 4A8WA 4N5SA 4FXDA 3OR2A 3T6BA 4V19J 2WW4A 1YRTA 1XNQF 4EEYA 5IV4A 2AEJA 2VFSA 1VRUA 1URRA 3DRXA 3EGNA 1WORA 2F4VF 1VGYA 3T3FA 3MUMP 1T95A 5EDWA 1S9EA 3UDCA 4PWUA 5EWEA 1HYSB 1VC0A 1C1BB 1U6FA 3LAKA 1S6QA 1TFYA 3HFKA 3I55S 1UEUA 3NOGA 2C2NA 4FYDA 4FPRA 4DFKA 1NKEA 1TKTB 4DUZF 2A3JA 5BYQA 2QSWA 1WNEA 5C2CA 3Q8YA 3DN9A 1ZAXA 4IRDA 3GYXB 2NLWA 1C4CA 3ETOA 1PJ6A 2B7BB 2E66A 3NKYA 4ELUA 1C1BA 4ILRA 2EI5A 1HNWJ 3BGRB 4F4ZA 3HHNB 1TV6A 2M52A 5KG2A 3AB4B 2LP4A 1B0VA 4DL0C 2YVSA 2ZOFA 3GIIA 1SQFA 3SQGA 4CYUA 4ANDA 1HWJA 2PIIA 3QIPB 4I7FB 4GMKA 5B0CA 3GFYA 1H73A 1NH8A 3FC9A 1R89A 4X64J 3K59A 1JXLA 2PI5A 3UCUP 3VGVA 4QR0A 1I5OB 4WZQA 5IT9U 5C7PA 3BDPA 3W61A 1BQNA 4ZHRA 3ZC4A 3ILJA 2BX6A 2WONB 1UWBB 3T5KA 2DK2A 3RAQA 3KLGB 4P52A 2WSEC 1I94J 3TAMA 2HW3A 2Y1IA 2Q3PA 2APOA 4I68A 3IWLA 1IM6A 1ZETA 4OX9F 4I6AA 3M2UB 4WYLA 3GV8B 3EZ5A 1CULA 2ZITA 3U1LA 3CJ4A 3R7BB 1XTZA 3AOCA 4OHWA 2R9LA 3C3LA 3UE2A 2R7QA 5C24B 3DLGB 3P96A 4IG3A 1Y10A 3FKBA 5HBMB 2CQ3A 5KG6A 3R3TA 1FF2A 3S1TA 1YK9A 4B3OB 2P9EA 2PEHA 4DOZA 2YQ1A 3KJNB 4CZCA 1U8WA 3VWSA 2DR8A 2XO6A 4IR1A 1VQOS 3M2VA 3EX7B 4HT5A 3NS6A 4NI2A 3BBFA 3OR1B 3C2PA 2OJ3A 4YOEA 1BQMB 2RU3A 2AP6A 3X1LB 4K8RA 1J5EF 5C24A 3MURP 5HAOA 2VG5B 2Z2MA 1OS5A 4XPCA 2QL9B 4I4BA 3VCDA 1P1LA 2W7PA 2AIRB 5F9NA 5DDPC 4NCGA 1B64A 5FIIA 4WFAQ 3V6DB 2AEFA 4KIAA 4NRTA 3HHLA 5CH7B 1YQHA 4FVCA 2AJ1A 3LWMA 3M8QB 4X66F 3OVAA 2FLOA 2XWYA 4DBQA 4RBUA 1BLUA 1D8YA 5HMYA 2EC0A 2C1EB 1VR6A 2CQBA 3H2VE 2ZBIA 4KE5A 1RTJA 3HJVA 4KAIA 2HZCA 5A8WB 3EZUA 3M7VA 3TUIC 2UV8A 4V19X 2FGOA 5ETOA 2F7VA 3J7A1 2X51A 4DJBA 5D3GB 4AXJA 3QAUA 1C1CA 4CIOA 4C8OA 4IOAQ 1Z1ZA 1KVIA 1O51A 4JI4J 3OBIA 3B8HA 3TEGA 2ZBQA 2JEGA 3PJ9A 4JYAF 4ED8A 5CYMA 2ZH7A 2XLKA 1S76D 2CPYA 2NYHA 4DR3F 4WK1A 3HHLC 4J90A 2FJEB 2R2RA 3JSMB 2ZHBA 3A3NB 2YQ3A 1TL1B 2RQKA 1ICEB 1HL6A 1UW4A 3DDIA 2RILA 4IDKB 4F3MA 2IHR1 2AHOB 1LWCB 2BDPA 1C0TA 5D77A 2MKCA 2OHDA 1IKVA 4KHPJ 3MM5B 3W63A 3OFHA 3TVYA 3K8WA 2UU9J 3TANA 4ILLA 2DR7A 3MPVA 2C3OA 3AFGA 2VG6A 3ENWA 1OY8A 3LPYA 3SYZA 4FYXB 3MM9A 4E2FB 2R8GA 4HI1A 1HHTP 3E01A 4DPWA 1KLMB 2B4UA 1SIWB 1U2RA 4MH8A 2J76E 2H48B 3H25A 1H38A 2V5HG 2UV8G 1RT3B 2YKMA 2B9YA 3MPUB 2LU2A 2CUYA 3EDRB 4Z2XA 5C2GA 4CH7A 2IDLA 1T94A 1XMOJ 3NCRA 2UUBJ 3MFIA 3JTPA 2U2FA 3R1LA 3A8IA 1N88A 4LF1A 1FE4A 1FXRA 2BKNA 5DGAA 2ADCA 2PDAA 3OUYB 4OZNA 3PW0A 1V5VA 3BO2A 2C2DA 2PFDA 2L9WA 2J6TA 3CJ2A 3G96A 4I2PB 1CJKB 1WG5A 5HROA 4JI5F 3FUYA 5KG4A 3WQPA 4USUA 1HNIB 1M5PC 3DXSX 4AFFA 2UXCF 2I0XA 2BANB 3SCIE 4JV1A 2WK4A 5BYRA 1YSJA 2CAJA 3SIPB 3M9OB 4RW8B 2RQCA 4ZLLA 1R0AB 2GVDB 2A6MA 2QYCA 3ICLA 4ZKAA 1IKXB 3TZWA 1T8EA 3DU6A 1JLAB 3PVXA 3RAMA 2KN4A 3C8YA 5E3PA 3VAMA 2BANA 3OL7A 5E3QA 2OPPB 2ZC4A 3I82A 1OYEA 2QL5B 2K1RB 4M5DA 4Y2IA 3L09A 3ZTQA 3RRHA 4DSJA 2HNDB 3H5UA 2J6UA 2I38A 3CD0A 4KO0B 1SC6A 4URQU 3Q2TC 3MECA 3Q89A 1X5OA 1N5TA 2F40A 1L5UA 1VMBA 1HLWA 2B4VA 2GV1A 3KUHA 5HMXA 1IKYA 4ZIWA 3T5JA 4CLWA 2FHKA 1RTHB 4NA1A 2K1RA 2PMWA 4B02A 4DR2F 3HZEA 5JMNA 4XO0A 3BKTA 3M8PB 2JSXA 3Q8UA 4JI1F 4DN0A 3O44A 3BYPA 2AJQA 4I2QB 1WF2A 1BY9A 3U1MA 2JEIA 2UUAJ 1W7WA 2V2KA 3GV5B 2B4PA 1S0NA 4B3MF 3MMBB 2IBKA 1AW0A 4CWBA 1FT8A 4MKBA 5L9XA 2ZH1A 3Q23A 4TNOA 2BW2A 2HVEA 4CLKA 3MF5A 1X4GA 4ZVUB 3IXQA 2BQRA 4OX6A 2MY7A 1Q0NA 5I3UB 3DRRA 5KFCA 3PACA 4LF6F 2UVVA 4DV6J 2BJ8A 3HPOA 2G2OA 1PYOB 2RIJA 1AZSB 2QLWA 4I6WA 3EUNA 5DO2A 2DBBA 3QWPA 4C8ZA 2YKNA 4TKTA 3T1YF 5M2RA 2Y8WA 2DNKA 4GVBB 4KYZA 2GGPA 2CJYB 5KFHA 3BSOA 2J7UA 2F4FA 3W9IA 1F9EB 2W2MP 1RHMB 2N4CA 1ROFA 1M5KC 1YRUA 2RRBA 2M9KA 4G6VB 4ECQA 5IM0B 2BEFA 1W25A 2ZH8A 2MQMA 1FA0A 3O8WA 4J9QA 4AXIA 2Y1LB 1D3WA 3BQ2A 2KHDA 4MTPA 2KVQE 3KLHB 1KP6A 4ZVHA 4ZVRB 3THPA 4UT4A 1CVJA 2B9WA 5L8RC 2VODA 4DPXA 1NSPA 2HBRB 3A3OB 4LF7F 4GKKJ 2B56A 1O6XA 2VC0A 4X4PA 4RW7A 4DV3J 5BR8J 2BA9A 4K7QA 2RVJA 2O66A 4CT8A 5IT4A 3Q24A 1LNQA 2AGPA 1FESA 1W26A 1SJ1A 5K20B 1K73T 1KKHA 1WKKA 4OZJA 2B43A 3IC1A 4ETZA 2UUCF 1ZPVA 3MCNA 2QMXA 3QFWA 1VBKA 4B9MA 4G1PA 4LF5J 2XI3A 3DGPA 3FRZA 4J9LA 4OIXA 5G0RB 2AW0A 2DB1A 3EPGA 1WHXA 3PX6A 2HEKA 2HGLA 5KFKA 3MEDB 4DX8H 3MR5A 1X5SA 2ASLA 2MHEA 2C2MB 1GNKA 4C0HA 3D0GE 2X3GA 4QYZJ 4ES2A 4LVNP 4IO1A 1U1LA 4C8LA 1TP7A 2HNYA 1S7HA 4UF4A 2Z57B 4PZVA 4IH6A 1CC7A 3D28A 4OHVA 1FWPA 2KFNA 1F2GA 3BJYA 1JLFA 1RZMA 4QZVB 3DDNA 5LL6d 3OXFA 3JTNA 1BE4A 3GJQB 2WTFA 4WCEQ 2FHMA 1LOUA 5H9FJ 4Z7CA 4JI8J 5KFEA 3OJSA 1NEEA 4Y65A 3FSIA 2J8AA 2RAQA 2HHQA 1EKRA 3V81A 1T7PA 3PO5A 1NXIA 1YJRA 2VOPA 5DG7A 2HRTA 5D6GA 4B3TJ 2MKSA 2YQ0A 4AL5A 4P2FA 2W9CA 3DMJB 5KFQA 2MZJA 4PYDA 4E98A 4F4WA 1TVRB 1K0VA 1RWPB 3TX8A 1S6PB 4QIWD 4ZPCA 1IBKJ 4CLUA 2V8DA 2V2VA 1GEHA 2CJBA 3HD1A 4RU9A 1X8DA 3DLHA 2ZZNA 4HACA 2VC1A 2WVEA 3NWGA 3LTOA 2AX1A 2GJFA 3HHEA 1VBYA 1WG4A 4N76A 2FJAB 3O1LA 3MFHA 3PHTA 1SUQB 1MLAA 3DKDA 3SQOP 5B09A 3FBCA 3DHXA 2RUGA 4O0NA 4HHUA 4N41A 5LMNF 2MLYA 3G9CA 2AEMA 4OI2A 3Q8PB 2ZOGA 3N6NA 4OYWA 5AXNA 2ZD1A 4OJGA 1V3ZA 1DTQB 4TY9A 2QG9B 2MB0B 1DTTA 4WXOA 3GIMA 1RWNB 5HMWA 3CO9A 4QWAA 1L3UA 1YLXA 2ACMA 1VQKS 3M9MB 2F65A 2UZAA 1CJTB 1XMBA 4YY3J 3ILOA 1RBAA 2C3PA 3PJWA 4QJVA 4F67A 1HBUA 4USIA 2OPQB 3UO0A 4CLLA 4DLGA 1R6VA 3AODA 3MXHP 2HVHA 2N7CA 4WP8A 3GMGA 3ZXWA 2M7SA 4DX6A 4RNHA 3DDKA 3QGIA 4X62F 1FRKA 2DPIA 4JV2A 3TQ1A 8RUCA 4JI3J 1KN6A 4O3OA 4Q7AA 5J1EB 3OSPA 3E51A 2LECA 1HWKA 4K2XA 1REVA 3BH7B 1U0HB 4M5NA 3L9ZA 4K4UA 3GIRA 4DX5A 4JV5F 5GAHU 3QNWB 4K4ZA 2RHQB 2DIUA 1DARA 2C42A 4NZ7A 3OXGA 4DL4A 4LFAJ 1XNRJ 4ED6A 2IAJA 4B9VA 2HLUA 1IXKA 4OI4A 5B08A 4N7TA 3K2YA 5J2QA 4XTTA 3US5A 4C6AA 4ELVA 4ED3A 1N32J 2J6SA 4RW9A 5ETQA 1ZM3A 4WTOB 3ZZPA 3VGUA 5C42A 4KFBB 4DR6J 5KT6A 2YXLA 3RBZA 2FGCA 1GTHA 3RU0A 2YKPA 3VZIA 3HLUA 1AT1B 1EP4A 3IN5A 1RWMB 1RWOB 2YNGA 3J81Y 3GFZA 3MMCB 5HANA 2RH3A 3WZ0A 1S1VB 5DJBA 1QVFR 1YI2S 1E6VA 2EVZA 4LRAA 4LFCF 2WVCA 2C2EA 3CCJS 4GKJF 3ISND 3IS9B 3M4XA 2IRYA 4DV5J 2XI2A 1JLGA 4ZJQA 4M63A 4PWDB 4KRWA 1GX5A 1C0UA 3RB4A 3OHAA 1FEHA 4DV0F 2MSSA 4IUFA 3KUEA 3G87A 2IMOA 3HDSA 1SKRA 4EZ6A 2LEBA 3UFCX 3N0VA 3VV2B 2I1RA 1BHNA 3AJ2A 3QGPA 4ID5A 4P2MA 3VVUA 4CTAA 4NYOA 3SMZA 2IJRA 1BMQB 3DYAB 2Q79A 2FIUA 1XIQA 5ETTA 1X0PA 1HWLA 2VKRA 1LFWA 1IWAA 2F1FA 1KD1T 1S7IA 3UR3C 4F36A 1HR0F 2V6AA 4M5HA 1CQNA 5F8MA 1DHMA 3PNIA 2RF2B 3MD1A 4NRUA 3M6XA 3O6QA 1IVZA 3IR6B 4OFZA 2K7KA 4B08A 3Q2SC 1VQ8S 3UN5A 1SJ3P 3DRYA 5I42B 3KDNA 2OTJS 1LW2B 3KK3A 3CJKA 1GXLA 1G4CA 4N77A 3Q83A 2GHPA 2HHHF 4YEAA 5IXUA 4DPTA 3M8ZA 2IMWP 1NJZA 4OZ1A 4WFYA 4R5PA 4XPEA 4DQRA 4U8VA 2B51A 1HPZB 1WEYA 2RF2A 1RKIA 1U6BA 2YKQA 1JLCB 5FDLB 4CO3A 1DLOB 2PMHA 3I87A 3I31A 3MMAB 2MGZB 3OLAA 1ELOA 3NGUA 2GZOA 3DNCA 1BWVA 4IRKA 1Q1KA 5KT5A 4P71A 5BJRA 5KTQA 1OJ4A 1KS2A 1RA6A 5E3AA 3E8OA 3PW7A 2V8HA 2PGCA 1EAYC 2JHEA 2MLZA 2GA7A 1GMWD 1HPZA 3OHBA 3MHYA 2D69A 2MQQA 3D2WA 2PA3A 5MAOA 2ZEJA 5F8LA 3QIDA 3QLHA 2IA6A 2MGZA 1UVJA 2WZ1A 2HQFA 4OYXA 4DUYJ 5J2PB 3VAHA 4RW4B 2EK6A 3JXOA 2HGMA 1VK8A 4YDXA 4N8OA 3NMRA 4DR5F 1YG0A 1M90T 3ZTOA 2E5LF 2CQ1A 4LR9A 3BR8A 1VQPS 3KKFA 1FI4A 4DV4J 2AYEA 1VQNS 4U8YA 2DY1A 3N28A 4ZK7M 1PSDA 1ZM9A 2HS4A 3NBPB 2RT3A 2HLTA 2RDJA 4C11B 4XDDA 1NB2A 1S0OA 4K4TA 1WOOA 2PI4A 4FYVB 3KNAA 3EDQB 2YNFA 3PRDA 3CDUA 1UPMB 2B0GA 4ZS6A 2HBYB 3IRWP 5E2QA 1RLDA 4TY8A 2MYFA 3BSNA 5B7WA 1TL7B 1V3SA 2GIRA 4A8KA 3I5AA 3I9ZA 4OYZA 3D54A 4LT6A 4PABA 3BZQA 1A6LA 4QWEA 1RTDA 1PAUB 1SQGA 1BUXA 4QPTA 4UUXA 1DZ5A 3KXDA 1IWGA 5IV3A 3EM1A 1XMQJ 3FQKA 3A13A 2RUSA 2Y9HA 4C8YA 4DV7F 1SH3A 1RT4B 3KLIA 2C2RA 4OZ5A 1NJYA 3M8RA 1OYDA 3R5AA 4TN2A 2YX1A 1VIXA 4HDGA 1QAJA 5I4MA 3KDOA 4CH1A 4ECVA 1DRZA 2X7IA 2VPXB 5A2QY 5E3RA 3ET6B 3IBCB 2J7WA 3EGZA 1UP1A 5B0GA 2CPIA 1I3OB 5IWAF 2MEWA 1F9HA 4DG1B 3SBMA 2AZ3A 3FCWA 1CG2A 2FVRA 4IFYB 2JOQA 1K1QA 2XEXA 5ETLA 2DXDA 1JJCB 5DDOC 4USTA 2K2PA 1U1PA 5KT4A 4F0HA 3TAPA 1Z2LA 2ZNYA 4WWSA 1NJIT 5B0FA 2DEJA 3J81U 4O23A 4EBCA 2CPZA 2HMIB 3SXLA 2YWFA 2DD8S 4NLXA 2C3YA 2AJ4A 1A7GE 4PXCA 5HVFA 4AQYF 1JIHA 5FLXY 4ZVQB 3DLBA 3THVA 1M5OC 4JV0A 3MEGB 4QR2A 5HVGA 1AROP 3TP2A 3CCES 1VQ9S 2QRRA 2W9BB 1WG1A 4L75A 1F0XA 1N36J 3RW6A 4CLYA 4F50A 2DGUA 1T9YA 2CQIA 3IGVA 4RNNA 2KHCA 5HLFB 2W7OA 3U27A 3G6ES 2IM2A 4NLDA 2CZ9A 4DWIA 3PYFA 3G71S 2EW9A 1YTYA 3HJFA 1RHQB 1FNOA 4JYAJ 5G4DA 3D6FB 1MMDA 2JC0A 2W9BA 2VFUA 2NUUG 1D1UA 1UEKA 2M2BA 4FS1A 2DCLA 1APSA 3NGKA 3ZZRA 4BHQA 1TZ0A 4LUBA 3LH2S 2KO1A 1I6JA 5AJ3F 2VPYB 2UUTA 3M32B 4OYMA 2DNPA 3DC2A 4K4YA 4NYZA 2W2OP 1UJ4A 2R42A 5L1JA 4KJIA 4BWMA 4JI7J 1IKWB 1OWXA 4DU8A 4S0MA 3WC0A 1Y11A 4F4XA 3H4DA 2BXJA 1BQXA 2VD3A 2XLIA 4GC7A 2WOMB 2XCPA 2JNJA 1YJNS 1PGZA 2I8EA 2HWIA 3W8GA 4QYZK 1CJUA 1A0OB 3KJVB 3T9ZA 5L9NA 3I56S 5DG8A 5ITHA 2JWNA 1KSPA 3Q8RB 3SV4A 1KNZA 3KLFB 4MJKA 4FXWA 1M0SA 2O67A 1TMMA 3CT9A 4P7VA 3T9NA 5KAKA 4HT7A 5H9FK 3DXBA 1N6QA 2HVIA 4UQTA 5HP1A 1NKBA 2DHGA 4HEA9 2D41A 3A12A 3QAEA 1DAXA 3MWBA 4TLRA 2BKPA 3N9UC 2H51B 3CCUS 3R6LB 3W66A 3TA1A 3KMSA 1PCAA 4LRCA 3PHEA 1QDUB 2AV5A 3CB4A 4P2XA 1RWWB 4F8RA 3UD4P 3P6YC 3AQPA 2ZDPA 3MI7X 3RBEA 2V67A 4K5RA 4NYPA 1PKUA 3THTA 5DM7Q 1X4FA 4K0KJ 4HH0A 4I67A 2UXBJ 2VG7A 4Y00A 1S5ZA 4DI6A 4YN3B 2WBRA 4J9KA 2IM1A 1UA0A 4BS2A 4HLBA 2RB7A 4RUCA 4DR7F 1I1GA 2HAFA 1RI7A 3HVTB 4L73A 2E1RA 1VC5A 3C6TB 2WBMA 3TA0A 1C2PA 3QWUA 1RWUA 2F5GA 2BQUA 3H42A 3B78A 2W2PP 2KM8C 3BO4A 1HNZJ 1QAXA 5GVQA 3DLKA 3MAAA 3OT9A 4YS2A 2OPSA 5HQLA 4NZ6A 4PR6A 4NA3A 2G0CA 2ATCB 1D0EA 4NXMJ 5DQHA 1YJTA 1WC1A 1T11A 2CFXA 2R8JA 1TK8A 3CWJA 5LSRA 5AE1A 2HFUA 3CDBA 4JI0J 2FVSA 2BACA 2DNQA 1YJWS 2KXFA 4ED5A 3MCOA 3CMAS 2QA2A 2DYAA 2HFVA 4AYBD 4KV8A 4FKYA 3KK2A 5CAAA 2CQHA 3IG1A 2X1BA 4RW6B 3DI6B 4B9TA 2DH7A 1S97A 5KFVA 4J9NA 4UZBA 3TJ9A 3LA0A 4ZPTR 3LP0B 1RK8A 3FGVA 2OH2A 1PBAA 5HMZA 2DIVA 2BOAA 3ZNJ1 4W98A 1FNXH 1RT5B 3JS9A 3VVTA 3EMTA 2CJAA 4X65F 4MFBA 2DHAA 3CXCR 1JJ2R 1T03A 2ZM6F 5A2QU 1N5SA 2CYYA 5KT7A 6FDRA 3GTYX 4Q8EA 3MM8B 2V4JA 4O4GA 2PO4A 2GCFA 3M6UA 1SJRA 3DRSA 1M1KT 4ZLJA 2J0XA 4CO5A 2IRXA 3JSYA 2DGWA 1N48A 2EC2A 3GJSB 1FKPB 3GPAA 2W7AA 1HQUA 2B4OA 3PIOQ 2D74B 4DFJA 2FTRA 3EVOA 1WD6A 1JK9B 5H9EJ 1KWMA 4EYHB 2NXEA 3DOMA 1RQ0A 1B7YB 3C19A 1NK0A 2NXNA 7FD1A 2RS8A 5KFXA 3CE8A 2M8DB 4ER8A 3IM9A 2XMUA 4LSLA 4C98A 2CA9A 5FLXU 2IA0A 3NMAA 1XR7A 3QRPA 2UUWA 1JLQA 4TYAA 4QW9A 2JRSA 4G1IA 4KGMA 4LF8J 3OTDA 1WEZA 3CDAA 5A0YB 3VQTA 2RMLA 2YWWA 2J7KA 4V1Ak 4OMFG 1OPIA 2R7TA 3F41A 4PG4A 3AXMA 2WCXA 1MG7A 3CD5A 1LXJA 1RTIB 2E5HA 3VQSA 2YPZA 1QTMA 1NB7A 2L48A 3FFIA 3ADAC 1EZZB 3SSRA 3J80Y 3IAS9 3A8EA 1NSKL 4WKYA 4HHHA 2YWGA 2ZE2A 1JJ4A 5A0YA 1VLYA 4C48A 3PX0A 2G4BA 2V50A 3ISNC 2ZJPQ 2K3IA 2JL9A 1TL3A 3IAM9 3R97A 5T7LA 1WF0A 3IM8A 3MAHA 3VAGA 4FYYB 5IOLA 1WC5A 3GYNA 2HK2A 1S9GB 4DQQA 4DV1F 4CT9A 2ROEA 2G0JA 3ZTSA 3BN4A 1RKJA 2DHHA 4QU6A 5KT3A 1JNZB 2ZNZA 1F60B 3W2WB 5CXTA 2FPHX 1IM4A 5ADZA 4DQIA 1VHFA 5A8RA 1N34J 4DR1F 2XMAA 2XMVA 1GMWA 1KHWA 1EB0A 4WFBQ 3L7OA 2XO7A 2E9TA 2XMJA 2VBYA 2XYHB 2KG1A 2KFZA 5U47A 3I4PA 4DCJB 4DFMA 4M5LA 4WBFA 4NWBA 3P5TL 1IUJA 2R4FA 1RU1A 2FHJD 3J7Z5 1S0VA 1S59A 1P8GA 1UVIA 2C2ZB 4KQZA 4P9SA 1Q78A 5HQ8A 1FFWB 3PW4A 2ZH4A 1N33J 4UTGA 1RT6A 4MYUA 3NGSA 1RT2B 4UY85 3H40A 3QSYB 2H4WB 3L95X 4DSFA 3PG9A 4Y3CA 1IBLF 2NXJA 3N5FA 2KL8A 1MU2B 1QJHA 2AU0A 1FX4A 3ZTRA 3GSIA 4H4OB 1QSYA 3FMBA 4MKYA 3DOKB 2DXEA 3WBZA 1EETB 4Q0BB 2D3ZA 1RT2A 3LALA 4YQWA 1WHYA 1RT1B 4NLUA 1HBOB 4KR0B 1HIYA 1Y3JA 2B6AB 4LQ3A 3D9BA 4G1QA 4KGZB 4FXVA 1R8HA 3F44A 5CQGA 5LMNJ 2LLZA 3DOKA 3BQ1A 2EPIA 1PILA 1HNXF 3N5BA 5GAGI 4W90B 4X4UA 2B6AA 2YH1A 3PFEA 1HKAA 1NDCA 1RCXB 5T14A 2VPWB 2MXYA 5F0WA 1D8ZA 2DCUB 2DO4A 3KWMA 5B0BA 1AA1B 4B17A 2FHOB 3U7JA 4PG7A 3HI9A 4DFPA 4FBTA 2UVWA 3NS5A 1S4FA 3HFZB 3TUZC 3PX4A 2BE2A 1SC4B 2Z58B 4FF3A 2C3UA 3OTEA 3F73A 1PAEX 4OV1A 3NXZA 4AUKA 3AJ1A 4Q5VA 5ETNA 4DN9A 1FERA 3UNGC 2AYGA 3MOZA 3OLBA 1G3OA 3BR9A 1KFSA 2VHGA 4C9DA 1X4DA 4GO5X 1SIZA 5A8KB 3L3CA 3M30A 3PRBA 1NKCA 2EFVA 3KLEA 3BGLA 3L7PA 2GFFA 3K5PA 1DFDA 4K2JA 4F3OA 5CYJA 2DKOB 4QU7A 4TU8A 2OEKA 3KK1A 3I0SB 1NJXA 3SDEA 4PKDB 3G86A 5GAEU 2VBZA 2AJ2A 3PDNA 3LP2B 3C14B 2NZCA 2JEJA 2CRLA 2FY8A 4QIVA 1MN9A 3W3SA 1NDLA 4ZPAA 4ZCIA 1FDBA 1OMSA 1FJ7A 3CJ3A 5GMKa 2LQ9A 3RW7A 4O44B 4DPOA 2PC6A 2NUHA 1HQEA 3J80U 2AGQA 4FS2A 1U4BA 5IQ6A 1D09B 3QT8A 2M8HA 5F41A 3HT3A 3CNQP 3P3DA 3M2RB 4IO9Q 1NCLA 3S01A 1X5TA 3DOLA 3LANA 4P75A 5KFNA 3CSKA 4LSNB 2M4MA 2P6TA 2HKEA 3TO8A 4RBVA 1Y9OA 4PQUB 3OTBA 3VGSA 2DH8A 3NCQA 1SKWA 4KH0B 5LXRA 2B8QA 2W25A 1F3FA 1QE1A 4LF4F 3G8QA 4RL1A 3VAJA 3LGNA 1HNWF 2J0WA 3FRYA 4OL8A 5GAGU 3UVJA 4B3SJ 3JYTA 4BC7A 1NLKL 2ZHAA 3ITHB 2C22A 5A6PA 4JB8B 1V5IB 2O3DA 1KTQA 1TKDA 2D9OA 5KG5A 1Z2ZA 4ZPWR 3MEEB 1N5YA 4X64F 2IYIA 3NOCA 3HM9A 5ETMA 2FVCA 2G0IA 5ETRA 2DITA 3HHDA 3EGVA 1T05A 1H2VZ 5E0OA 4PG8A 3ITHA 2JDJA 2HHUA 2JVOA 2ZWPA 3D1QA 4F3QA 2N3LA 4RLEA 4HVZA 5KFOA 4EWTA 1I94F 1FNMA 3CJQA 5D4NA 3B4MA 1NK4A 3V4IB 1FKOA 1U1NA 3SSSA 1GAOA 2B7CB 2R2UA 3R1HA 1SJQA 3R9LA 3HFVA 3C15B 3T41A 3U02A 4R0JA 2B3TB 1IJEB 1S77D 4MK8A 3OR2B 2YNHA 2FZCB 1ZTWA 2KB2A 4NCAA 5EUHA 2ASDA 1VRUB 2XGPA 1PIEA 2CQ4A 2V8PA 2CPDA 1V3RA 4ATNA 1E6YA 1JLEA 1U1RA 1S9EB 4YHHJ 3CCTA 1ZS6A 2E29A 4YB1P 3PO4A 2RKIA 4F4KA 2VU5A 1F6TA 3TX0A 4YB5A 5KFZA 3VALA 1S6QB 4KGKA 1RISA 3FEYB 3W9JA 4M5MA 4ZVTB 2YNIA 2MZRA 2VQEJ 2HNZA 3NEKA 2E5IA 4CRJA 2VJVA 2DGSA 2W4CA 3P45B 2OSRA 3QZ7A 1VS3A 1RAAB 1QY7A 4K4XA 1X4AA 2BM1A 1UJ5A 2HS3A 4JI6J 1TV6B 1WI6A 4JOUA 2J9DA 3CCRS 3SQGB 4KHMA 2Y1JA 1FVQA 1RXOB 4CYUB 5KG0A 3DRPB 3QGGA 2AJFE 4H54A 2W1BA 2DJWA 4MT1A 3FZ2A 2XNQA 3Q8VA 3W1YC 5D0RA 4I56A 1MNEA 4TU7A 3PM9A 1PJ7A 1K9MT 1T9VA 4ZOSA 4U6PA 2RDDA 2EBGA 4DV7J 3G6YA 1Y5LB 3R7NB 2XWXA 2M0GB 3IP0A 1BQNB 1WUUA 4C8KA 2OGUA 1YX2A 3BF4A 1NNDA 3DRPA 4ZHRB 2HFZA 4DZDA 4LRFA 1Q7YT 3AB2B 2CG8A 2V8VA 5KFSA 1LW0A 1KQFB 4C97A 2GHWA 3TAMB 2ALYB 3DU5A 1U8SA 4U96A 4G65A 3QO9A 4LR8A 2E44A 1RHUB 4DSIA 3W5ZA 1HBNA 1R6YA 3UI3A 2CPHA 1AFJA 1NAQA 3FBBA 1CULB 3CULA 3NWRA 5KFMA 1UFKA 3D3BJ 3TEHB 5HVHA 1B0PA 4Y6IA 4KHPF 2PD1A 4ES1A 2UU9F 3E2EA 3PTWA 2G2ZA 2RRNA 4IG3B 5D15A 1RLCL 5BYSA 4F2RA 9ATCB 4L3KA 2R8KA 5IC6B 1AFIA 2B5JA 1S72S 2LA6A 5KFPA 1NU4A 1NK8A 4CCHA 3CO0P 3V2UC 1TUVA 3M2VB 4NI2B 3G6XA 2XMKA 5EX3A 3HHKA 5J2NA 4RZRA 2XZWA 1N54B 5L39A 2H9ZA 1UVMA 1GXTA 2ZZTA 2GQ2A 3HKZD 2DRBA 2VDHA 2YTCA 3NAIA 1XMOF 2UUBF 1YKWA 4JP8A 2YPYA 2BMBA 4U95A 4WFNQ 2GAGC 1IBCB 1TR0A 1A9NB 3R27A 4USKA 4NCGB 2OD6A 4O3SA 1HARA 3W9HA 2NS1B 4P10A 3HHLB 1WHVA 5HK4A 3GFHA 1X4EA 4URSA 2DNMA 3D68A 3SFUA 3K5OA 2CVIA 3DCAA 3WDOA 1WDTA 2ZH3A 4A46A 3G8SA 3M1VA 2V68A 5F8NA 4NLQA 1REGX 1Q5YA 3CEDA 2M70A 1RTJB 2QO3A 4XK8C 5EWGA 1HNVA 1SI9A 1KBRA 2KT3A 3CC4S 4Y2AA 5L46A 2G2YA 4N8NA 4W92B 3HXMA 4XIUA 2WSFC 3NGDA 1C1CB 3GSDA 2FUG9 2WB1D 4JBCA 5IZHA 2AQ4A 1O8BA 1CBKA 5CYMB 3UD3P 1ZOTA 2LXUA 1CLFA 2QV6A 4C3KA 2Z2LA 2ILYA 3D6HB 3UNYA 4UOGA 1HI1A 1R43A 2DXFA 2XZDB 3JSRA 4RUHA 4R8UA 2HPUA 1CJVB 2FHJA 2XMMA 2V9WA 2COLA 1QAIA 2MMYA 3QZ8A 2OUGA 1CEZA 1C0TB 1TKXA 5D0GA 4J9MA 1IKVB 3EYZA 4DL6A 4KKOA 1S99A 2GIFA 2VG6B 4WJBA 2OI2A 3OD2A 4BWJA 2ZJRQ 1XK8A 4ED4A 2UUAF 3GE9A 2IM0A 3MM9B 4IOCQ 4EO6A 1CJVA 2BRKA 1KR4A 4BBYA 2DRAA 3E01B 1TK0A 4U67Q 3QRRA 2D7SA 1YDLA 2VA3A 2H5EA 3CJ5A 1HBMA 4YDDB 4NOHA 5F3ZA 4Q44A 2LU1A 5ETVA 2YKMB 4PEOA 1NH7A 2O01C 4QW8A 1L3VA 3ZTPA 1UAWA 3R5GA 1WOSA 1VYAA 3I4HX 4MKVA 2QEXS 1U09A 3LQVA 4OYPA 2NYIA 1JKHA 4ZCKA 4TLQA 1SL2A 2HYIB 2PMZD 2KYZA 2OPRA 4EMDA 3KHHA 4OZLA 4DV6F 2CZVC 4CDIA 1NSAA 2ZKTA 1U0SA 3GCXP 3K17A 2PA8D 4KGVB 5DLFA 3W5XA 4F4YA 1H7WA 1UVKA 1UVLA 5IT0A 4DXLA 4U7UD 2BVZA 5C5JA 3IRXA 4MAKA 3OTCA 4DSLA 5HROB 4DL5A 4B9SA 3V6KA 5B0AA 1X0FA 4RPFA 2P6SA 3GIKA 2XY6A 2AZ1A 3MR3A 4NXNJ 4LIWA 1Q53A 1FRXA 2IRUA 2G13A 3KG0A 4YB6A 2CDRB 3AH6A 1S10A 1WDDA 4PWWA 5K14A 2QA4S 3G82A 1B0TA 2HHVA 1T9TA 4ZVFA 1JWWA 2H1YA 3C6UA 3C46A 1S1TA 1WWHA 1W2IA 1EJ7L 2MTLA 3NG8A 4M5DB 3ULHA 2Q1LA 3R2CJ 4GKKF 1RBLA 2CQPA 3GJRB 2LA4A 3C16A 1G2EA 3MECB 4FZVA 4DV3F 1J2VA 5IQQA 5BR8F 3RYLA 4IG0A 3PV8A 2ROGA 3BGOP 2KXHA 3EE3A 4ANCA 1IKYB 1U7LA 3JSBA 4PUOA 1RAOA 5J2MA 2ZM6J 4NX9A 3H5YA 4B3RJ 2ILZA 5LMUJ 1NZAA 2BV3A 3H7HB 4LF5F 2HFSA 3B6BA 2L9NA 1HHQA 3W7BA 4ZP9A 2VOOA 2KVIA 2XSJA 3UDLA 3W2VA 2XNRA 2UXDJ 1X5PA 2OKQA 4Q8FA 2FB0A 1WACA 2IFXA 4Y0FA 1KONA 2Z2ZA 2K06A 3FSXA 2HBZB 4U7CA 2DNNA 1WKLA 4LFBJ 4KGXB 5J1PA 1RCOB 3V5RA 3W62A 2DHSA 2XMTA 1MN7A 4C8MA 3BPSP 3MEKA 1ZAWA 3K8VA 3SCKE 3OFFA 3DRRB 1CC8A 3RB0A 3Q86A 3CDEA 2JLGA 1DQ9A 1OPZA 1T0TV 4R25A 4H4MA 4A8OA 4IH5A 5AXLA 3MM7A 3I9V9 4CNZA 3GYGA 2R7UA 1JXEA 4ZITA 4K5SA 4ERDA 2Z8QA 3GONA 2VBXA 1UTAA 2UP1A 2P2CB 3QRQA 2YKNB 5IC4B 1VBXA 3CCZA 1BWEA 3B82A 2GGPB 3DFEA 4FF1A 8ATCB 5AE2A 1RE1B 3QJJA 4JI8F 1OQ6A 4IKAA 1L3SA 3FEZA 2A6OA 3ENQA 2W2QP 3CCVS 1UW9A 3A8JA 3J7YI 2ROPA 2L9DA 1X7VA 4B3TF 3N79A 2ZUGA 4OYIA 3R8YA 4BLGA 2MKHA 5F8GA 3OQ2A 2EEYA 2BE7D 1YZ6A 3BB5A 2P5VA 1IBKF 4KPCA 2OTLS 4QIFA 2GC8A 3TOQA 2R7WA 1X9WA 5L1KA 1V9OA 4K4VA 4RW7B 1RADB 3IBFB 1DY3A 3CCWA 4EBDA 4H4KA 3GLJA 5KFWA 3BO3A 4QIGA 1FHTA 4QOTA 5K9FA 2GVZA 3LOUA 3H2LA 1R8PA 1NBEB 1SV5A 4F25A 1TU0B 4TU9A 2BJ1A 1OQ3A 3PRVA 2M5YA 2DGXA 2DNGA 3AAWB 1P1TA 2DR9A 2QT7A 3DGPB 2QMWA 4G3IA 5C25A 4LBHA 1SVDA 4Y34A 4ELTA 3N6MA 3FMWA 2W24A 3HKWA 3UR0A 5E41A 3OV7A 4ED0A 5M2UA 5GADI 4ZVGA 3UQSA 3A3PB 4LF9J 1Q4RA 3R6GB 2LKZA 4WFZA 4B9LA 1HW9A 4RKUC 4YY3F 3ZFVA 4A8SA 4P2SA 4ZMMA 5CABA 3SZ2A 3JQMA 2CJ9A 3TRGA 3BEGB 4H4KC 2HVDA 2XTJP 4BC9A 1QSSA 1S1XA 3KFWX 1KVJA 2HNYB 1VQ5S 3W8PA 3LP1B 1N52B 2CQGA 1Q5VA 1LWFB 3H59A 2PEBA 3T1HJ 3TYTA 2Q43A 1S1UA 5KFGA 1S49A 3UCGA 1JLFB 1MWZA 3BV8A 4IQMA 3GQCA 2XS5A 4UOHA 2IC3B 1GTEA 4CNYA 1UWAA 2YY3A 2X1FA 1VLOA 4LFAF 1XNRF 3W65A 2HQCA 4CO1A 4QQBA 4ZCLA 4UOFA 3LPEA 4RWXA 3LP1A 4DV2J 2HWHA 1N32F 1LWFA 3V81B 4D3HA 1N4LA 3PR5B 4DR6F 4ZPDA 4ICLA 2W9CB 5EWFA 8AT1B 1RAEB 1VQYA 2IC3A 3IGNA 4ZIVA 1TKZA 2NPIA 1S1WA 1K0TA 3WC2A 3OL8A 4LMZA 2PN6A 4DX7A 1JLBA 4FF2A 3PFOA 3J7YU 1WELA 5I3PA 3QT7A 4M5KA 2HRYA 2BRLA 1VRTA 4ZVPB 4WFXA 3MAQA 4HACB 4DR4J 2D3O1 1Q95G 1LWXA 3POTA 3OTOJ 1ZM4A 4C2MA 3CD7A 1MW7A 4DV5F 1F9FA 1SL1A 1RU2A 4LVOP 2IDEA 5JVHQ 2VQFJ 1QVGR 4NLYA 4O3RA 4CM2A 3KOAA 2MHNA 1WJ9A 4FBUA 2RQ4A 5KFLA 2HURA 1FE0A 3MM6B 4HTJA 2DO0A 2DRDA 1EX8A 1TQLA 2UVRA 2MQPA 2A1BA 2ZD1B 5EHHA 2RNEA 2V63A 4Y2CA 1F5AA 2D9PA 2W2NP 1DTTB 3LGHA 3UD5A 3I5CA 4PCQA 4ECSA 1VQSA 2IYGA 3TQEA 1HBUB 2A10A 4ZA1A 3MM6A 3SI8A 2RRAA 1J5OB 4ZVOB 3H90A 4NMLA 4JI2J 1H7XA 1PYSB 1KOHA 1DJ0A 3QT6A 1FK9B 4TQRA 1K1SA 5GADU 3EPIA 4ZVSB 3EGWB 1DQ8A 3DGVA 4CLFA 1SPBP 2ZFHA 2AYMA 4EK2A 2QA4G 1RABB 1S48A 4L6V3 1YHQS 1J5OA 2NSBA 1REVB 3QJLA 2GMLA 2MY8A 1HMVA 1ACMB 4IFVA 2NSCA 4CQ1A 1FK9A 1AXQA 1F1BB 2KU7A 2XY7A 2NR0A 2IAJB 5CCMA 4DF4A 3D5MA 1GT8A 2J5AA 4L72B 3KHLA 5J2QB 3K57A 2W8LA 1WTFA 4RW9B 4OZ2A 2E7VA 2QFJA 1CSJA 1DURA 5C42B 3TVKA 1TAQA 1CS4A 5CD4H 2ZC3A 1RWVB 3QYYA 1GMUA 3TJ8A 1T02A 4FDFA 1RT7A 1Q79A 1EP4B 1Q81T 4DUYF 4OX8A 2FLPA 2Y0SD 2RE1A 2YNGB 4HH1A 1IBMJ 1FWLA 5SUHA 1H72C 4ECWA 1NHVA 2KZZA 2DNZA 2OP5A 2JVRA 1E6VB 1U2FA 1UETA 1NDKA 4ZP8A 3T5LA 4CLSA 1L3TA 5D4PA 2OMOA 4DV4F 4UQGA 4LF4J 1JLGB 1HYSA 2QZ8A 5CA5A 1GX6A 2X1AA 2V4RA 1C0UB 4PYAA 4PPZA 4A48A 1RDRA 2ASYA 4ITSA 3VAKA 2D1CA 4E0DA 2IPOB 1QLNA 1TELA 4ZP6A 5D0EA 1TKTA 2OEJA 2HHXA 4ID5B 1D9AA 5CD4A 3PW5A 3IWNC 4CTAB 2L3MA 4XDCA 4ECRA 2D3OR 3K89A 3NAHA 4PAAA 4HYKA 2B9EA 2VASA 5CYQB 1NK6A 2E5JA 3BGRA 4A8MP 3M6WA 2E1PA 5DLGA 2AGOA 4WZMA 4NL5A 4DF8A 4EZ9A 2KDOA 2AWZA 1NSQA 1RWXB 1Q82T 2EFNA 2CDQA 3QIPA 3EJMA 2J0SD 4I7FA 1FFGB 3DLLQ 2K8GA 1VCTA 5CYQA 3K0JA 3KK3B 3GR1A 5DZ7A 3CJKB 2Z0GA 5HQMA 1GH8A 1XMQF 3EVWA 4OLOA 1J27A 4R5PB 1W2BR 3OFEA 1IJFB 4PPDA 2KKHA 2WONA 1UWBA 4GVLA 4FF4A 2ZH2A 3KLGA 2LQ5A 2CNOB 1ZA2B 1KLNA 4RX6A 5HL7Q 2LEPA 3KHGA 3TWZA 2IVFB 2MPUA 5BXIA 3M2UA 4MIBA 2IBOA 4J9VA 4L74A 2CWXA 4RUBA 2VL1A 3QLHB 1XQIA 3DLGA 3FCHA 3FDSA 4NLWA 5HBMA 1XNQJ 4B3OA 2L41A 4ID8A 3AD9C 4YUDA 3OFGA 4OJHA 2ASJA 2BJEA 3FSYA 2IVYA 3OR1A 2F4VJ 1SL0A 2BZ2A 3VHQA 4QWBA 3GILA 3TR5A 1VC6A 1BQMA 3AY0A 3T19A 2GO9A 2VUGA 2VG5A 4M1KA 2RU9A 1PC5A 2A2DA 2IJNA 1U2CA 3PJXA 2Y8YA 4F02A 2DNRA 2MQOA 4J9RA 3G2XA 3ENVA 3R5DA 1RBOB 2MKJA 4DUZJ 4DQPA 2YNFB 3V6DA 1HD0A 4NE9C 2XS2A 2VFTA 5AT1B 2C3MA 4J9PA 4DS4A 1N36F 1GMVA 4ECTA 1G1XA 5EX0A 4M8LA 1KOOA 2VFVA 2LCWA 2CNLB 3M8QA 2HK3A 4F2SA 4TY8B 2XBPA 1R8CA 2QJ3A 5KFRA 2DR5A 1VQ7S 4RUAA 1P9QC 1S79A 1SC3B 3TI0A 1KHVA 2XMWA 2E7XA 5JJBA 3EXYA 3P5BP 5A8WA 3KUGA 3ZZYA 1RTDB 3UWTA 3NNHA 4OHYA 1XJWB 1QD1A 2ACYA 2H4YB 5D3GA 4ILMA 4CLZA 4WKRA 4F0KA 5DZ6A 2WW8A 2CADA 3D6MB 2BBEA 2HAIA 2Z56B 1IQTA 2MKKA 3HCXA 2BJDA 2XYPB 1Y5NB 1YIJS 1DBDA 4NA2A 4OI1A 4EBEA 3KLIB 4A8FA 3QSIA 2QLBB 2MJUA 2ZH6A 4YR0A 2I9SA 1WC4A 5F8IA 4JI7F 4M5IA 2CXEA 3NGRA 1R27B 3O5TB 1P9YA 3TZZA 2HFOA 2GO8A 3MCSA 3JSMA 4CO0A 1FCAA 3MOJB 5JVGQ 3FNNA 2CKWA 2QA1A 2ZOMA 5KFYA 1HWUA 1TL1A 4YB7A 4OX9J 2OO4A 1MROB 4RR5A 4OJ3A 4OI6A 4IDKA 1KRPA 3MR6A 3IR7B 1T9XA 4ANEA 1LWCA 1XBWA 2KT5A 1FTCA 3QQCD 3MM5A 1PBUA 4TVAB 2ADBA 1T3NA 1GXUA 3MPDA 2JH3A 2F8HA 2CIMA 4WXWA 2LQ8A 3KLVA 3N01A 4Y28C 4WF9Q 2G1DA 1MROA 2XS7A 1WKJA 1KLMA 3CJ8A 5K8MA 3UDVA 1RT3A 1J5EJ 1RGVA 1ULRA 3NNAA 1WC3A 1RHJB 2XCAA 1NMEB 5SZTA 4K59A 4CLPA 2KJWA 1PYTA 3CC2S 3BS9A 4WTYA 5I3QA 3OL6A 5F3TA 3OUYA 2KYXA 1U48A 4KY3A 1GQEA 2CPJA 1IQZA 4K0KF 4ZN3A 2UXBF 1YBUA 4I2PA 1CJKA 1EQMA 4X66J 1HNIA 3R7SB 4LRBA 2KJVA 3CF5Q 5LSOA 2CPXA 2QLJB 4ECXA 4RW8A 2PE8A 3T6JA 3LUYA 3M9NB 1R0AA 1HNZF 2GVDA 3Q8SB 2R2SA 2I5JB 2E1AA 2H5JB 2HBQB 1IKXA 4C0OC 2GMJA 1OSCA 3PYDA 4NXMF 4TQSA 5KFAA 1JLAA 4WP9A 2HRUA 3H20A 2R2TA 5M2PA 4JI0F 2ZKUA 2OPPA 4USMA 3TZYA 1NUEA 2BR0A 4LQ9A 2H54B 2I5JA 2NCKL 2HNDA 1TUGB 4DR3J 3ZZOA 4KO0A 2KFYA 3J81j 1YJVA 3MMJA 3ELHA 4HL9A 3PYGA 4F7VA 4USHA 2QMUB 2HZVA 1SKSA 2YX7A 4RO0A 1RTHA 1CJUB 5HJYA 3CGIA 2LEAA 4AT1B 5E3CA 3OW2R 2CJQA 3RBDA 1S9FA 3LW5C 3M8PA 1WF1A 3I32A 4P72A 4I2QA 1GK8A 2VDIA 4IYQA 2GNKA 1FTRA 5K8NA 4WU2A 1FO1A 3MD3A 3CCMS 3MMBA 1N6QB 2KM8B 1NHUA 5HP1B 4UUWA 2W8KA 3TUPA 2CNKB 4ED7A 4ZJOA 2XHCA 1Y3KA 2YWEA 3RUBL 4LBIA 5KG3A 2H65B 3A1YG 4KSEB 4RJVA 5I3UA 3SEOA 3EICA 2MLXA 2NQPA 1AB8A 3OSNA 3NGTA 1XEZA 2LFVA 4OX7A 2J0QD 5AXKA 1AZSA 4LREA 2OMLA 2GW8A 2VG7B 4LF8F 3OJUA 4LR7A 4JI5J 3DLJA 2PFFB 4GVBA 2ZHOA 3HVAA 3P4UB 2UXCJ 3LO3A 4NEZA 5D78A 4QCLA 2Q66A 4DL3A 3RBXA 2FJXA 5L1IA 2HIQA 2SXLA 3DLKB 3MAAB 2FC8A 2OPSB 3HULA 1BC6A 1Q8LA 3HZGA 2R7SA 5IM0A 1M5SA 4QWDA 4X4OA 1RHRB 1F5BA 2YWKA 3KYLA 2ZVSA 3KLHA 5JXSA 5K8OA 3O3LA 1N56A 3GZ7A 2YH0A 4NEYA 2VPZB 4DL7A 4KV8B 3KK2B 3IG1B 2FD2A 2G1HA 2JZ5A 4K4WA 3D67A 2V69A 2HSEB 4MMOA 3H5XA 3BYRA 2R7XA 1ITPA 1LQ9A 4OYBA 2V9KA 4GRSA 1RAJA 1VIOA 4N47A 3EWGA 3OVSA 3IR5B 4MFBB 1UZHA 4DR2J 1T03B 4NLSA 4LRDA 2JEFA 1XERA 1JNRB 4JI1J 5LJ3Y 2Y0BB 2KTQA 2JLEA 2V4JB 4O4GB 5DM6Q 5GAHI 5G0RA 4CLTA 1FXLA 3IFEA 3HSDA 1ZPWX 1LKZA 3DRSB 1N34F 1MWQA 2ZH5A 2CWKA 3UCZP 4AE5A 3MR2A 2ZVIA 2OAUA 4B3MJ 5HN0A 1VRQC 1HQUB 3JAMY 2DGTA 2UVUA 4M95A 3Q8QB 1IR2A 3MEDA 1EQ0A 1TL4A 1RB0A 4LF2A 3ZZUA 4DZ6A 2BJ9A 3DOMB 1KQGB 1N5VA 3ETMA 4MIAA 4LSLB 2LXIA 4LF6J 1OO0B 3CCLS 1Y7PA 3CJTA 1N33F 2HWTA 2DNYA 1JLQB 4TYBA 3CD6S 4ETXA 3RZAA 3HX9A 3T1YJ 2JJ4D 2HGNA 4NLRA 3DHWC 3PW2A 4OZ3A 5LJ5Y 3BSCA 1CQMA 2D3UA 5DRKA 1XC9A 2EG1A 2G9OA 4J9SA 1NZ8A 3P49B 1FDAA 4ZLPA 1N8RT 4I6YA 2QLFB 2FJBB 5AXMA 1TTHB 2MDAA 3FFIB 2WRMA 2GX8A 2W4PA 2FLNA 3DMJA 3JQKA 1S4EA 1OY6A 2KXNB 3AJDA 1TVRA 4ZPBA 2ZE2B 1M5VC 3BH6B 1MSWD 4EO8A 1S6PA 5HJXA 2C2OB 1VJQA 1X4CA 4ZCMA 4B9NA 3GFXA 4LF7J 2PT0A 1HI8A 4ZPVR 3BGFA 1JJHA 4MK7A 2AX0A 1TL3B 2KG0A 4OI0A 2DNOA 5T7LB 1UL3A 2ABYA 4DDFA 1SUQA 3FCVA 1RYRA 4A8YA 4YP3A 5EN1A 3SV3A 1LWEB 5EGYA 2DPJA 1QSLA 1Y5IB 3TUJC 1QUVA 2UUCJ 3ZZTA 2R7RA 2QC3A 4A47A 3DM2B 2EBEA 1UA1A 4YMEA 3I6PA 1DTQA 1NO8A 2K7JA 4OHXA 2LMIA 1U1KA 2JFKA 5A8RB 2BKOA 2JX2A 1WC0A 1LWEA 1DQAA 2GJ2A 3ZNUA 5IS2A 3U1NA 1CJTA 1G7CB 1LK7A 3CJSA 3MCMA 2OPQA 3DM2A 4WPAA 1FJGF 1WSVA 3RB3A 3ILLA 5DG9A 1S6UA 4DPUA 3IMQJ 4OYOA 1Y4ZB 2VH7A 4WK3A 2X1GA 3N4WA 3NLCA 3VGTA 1LV5A 1UZDA 2GHVC 2YKAA 1RHKB 2YKOA 3FK4A 5J1EA 1RT6B 2BOPA 4PG5A 2CJXB 3D6TB 1YJ9S 4ENOA 3D7SB 1U0HA 3MUVP 2K3KA 6AT1B 3IA0A 3KG1A 1X4BA 2A0FB 2E1CA 2FJWA 5K5MA 2HHTA 2F8EX 2BJ7A 5HO4A 2AD9A 3VF0B 1YITS 5F8JA 1X60A 4KFBA 1U1MA 3O2IA 3RGIA 1UKUA 2N3OA 2CPFA 5ETKA 2JLFA 3SCLE 3I0RB 4G1QB 2Z30B 3S7RA 1VHIA 3JTOA 1SH2A 3MMCA 1FD8A 2WSCC 1FDNA 3H4BA 4KB7A 5D0HA 1S1VA 4X4TA 3QJPA 4M5JA 4KPYA 1M1GA 4MKAA 1S6OA 2VFRA 3CPWR 2RJZA 1NRKA 4B9UA 3IS9A 1U02A 2XLJA 4J7CA 3R5JB 1TL5A 3I0RA 5JUMA 2O5DA 4PWDA 1OIAA 2OLWA 2P8IA 3KHRA 2VF3A 3TJAA 2DGOA 5GMEA 1U45A 1X9SA 2N7YA 4CH0S 3H2UB 2MZ1A 5KG7A 3D0HE 4B3SF 1FRIA 4CO4A 2ZWOA 3HSJA 3DYAA 2BE2B 1YGYA 5L1LA 4O3NA 2V34A 4HHJA 2XHWA 1HA1A 3TARA 4IOBA 3IWXA 1WI8A 4N56A 1LXNA 3MPWA 1RP5A 4J37A 3S8SA 2PSZA 1VOMA 3JAMU 3CVKA 4X62J 2MQNA 3HVWA 3M30B 5I42A 4FN5A 3KLEB 1LW2A 5KFFA 1VBZA 1LK5A 1U1QA 2CQ0A 1U47A 1SH0A 2J9CA 3UDEA 2OSQA 4NASA 3R2DJ 1FRMA 4JV5J 2YWHA 4HTIA 5LM7E 1TAUA 1JQGA 3KK1B 1U49A 1JLCA 5L38A 5FDLA 3P8BB 1DLOA 1RA7A 3MMAA 3SDEB 1I51B 4ES3A 3MGJA 4ED2A 2DGVA 1FJCA 4USVA 3D66A 4AD6A 4HDHA 1WEXA 4JUZA 2ZUAA 3UN2A 3RR8A 1S57A 2V8GA 4FYWB 3QMQA 2Q6CA 4ZVEA 1SJFA 2GQCA 5KFDA 5LOQA 1SJ4P 2AT1B 1FRHA 3OPKA 5D4LA 4ZLNA 2V2QA 5DDRC 3RRGA 4I1TA 1HWIA 5KFJA 3CMQA 1M5HA 4YHHF 1HQEB 4OYAA 5J2PA 7FDRA 4RW4A 4ZP7A 1R0CB 3CUNA 3DOLB 1MWYA 1UJ6A 4LFCJ 2R3VA 1N0VC 4Q2MA 3PCOB 2U1AA 3QT5A 2QSFA 2DY9A 4M5GA 4GKJJ 2KRBA 4Q2LA 1ZAVA 1D9DA 2VQEF 1KEKA 1MMNA 1H0HB 1VQ4S 2QLXA 2C28A 5DQGA 5ETPA 5CZVA 1QE1B 3NBPA 1FRLA 4DV0J 1YRXA 2M3DA 2OD4A 4C11A 2CQ2A 1TUWA 1L3KA 4JI6F 3ZZ0A 3EVMA 3W64A 5A6WA 3GV7B 3UVJB 3JYTB 1BXNA 2ERRA 3BKUA 3MPYA 3UN3A 3AHPA 1Y00A 2AKWB 1T9UA 1HR0J 1TL7A 1N5YB 2E9ZA 1H2UX 3M05A 2B8PA 2A2CA 1P6TA 5J1NA 1U6ZA
chains in the Genus database with same CATH topology
1NDCA 1PKUA 5IOLA 4C6AA 1NHKL 2B8QA 3FKBA 3EVWA 4DZ6A 3EE3A 4ANDA 1F3FA 3L7UA 3ENAA 3NGSA 4ANCA 1XIQA 3JS9A 3VVTA 1S5ZA 1JXVA 3EMTA 4HR2A 4DI6A 1W7WA 1NUEA 3VGUA 3PRVA 2NCKL 3ZTSA 3ETMA 1U8WA 1UCNA 3FBBA 4UOHA 2BEFA 3VGTA 2AZ3A 2HURA 3FC9A 4F36A 3EICA 2AZ1A 3FCWA 3NGRA 3BBFA 2DY9A 3R9LA 3G2XA 3B6BA 3NGTA 4UOFA 3VGVA 1HHQA 3ELHA 4DUTA 3ZTRA 2DXDA 2HVEA 3FCVA 1NLKL 5C7PA 1B4SA 3PJ9A 1MN9A 2DXEA 5BXIA 4ENOA 1NSPA 1NDLA 3WX8A 3ZTQA 1PAEX 1NDPA 3GP9A 3Q8VA 1BUXA 1HIYA 1NPKA 2BX6A 1NSKL 4ANEA 3GPAA 3ZTOA 3Q89A 1WKLA 3EVMA 1B99A 3Q83A 3FBFA 3EM1A 1XQIA 3EVOA 4F4AA 1K44A 1ZS6A 2ZUAA 3MPDA 1HLWA 2DYAA 3DKDA 1NSQA 5CABA 1EHWA 1S57A 3Q8YA 2VU5A 1F6TA 4KPCA 3FBCA 1MN7A 4WBFA 3VVUA 1WKKA 3BH7B 3EJMA 4O0NA 4FKYA 2HVDA 1BE4A 3ZTPA 3FBEA 4FKXA 5CAAA 1S59A 2CWKA 1NCLA 1VYAA 3DDIA 3B54A 3BBBA 1KDNA 1NDKA 1NB2A 4UOGA 1LEOA 3Q86A 4S0MA 2B8PA 1LWXA 1WKJA 3NGUA 3BBCA 3VGSA 3Q8UA 4EK2A 1BHNA 2DXFA 4CP5A 3BH6B 4W98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDC A;  1PKU A;  5IOL A;  4C6A A;  1NHK L;  2B8Q A;  3FKB A;  3EVW A;  4DZ6 A;  3EE3 A;  4AND A;  1F3F A;  3L7U A;  3ENA A;  3NGS A;  4ANC A;  1XIQ A;  3JS9 A;  3VVT A;  1S5Z A;  1JXV A;  3EMT A;  4HR2 A;  4DI6 A;  1W7W A;  1NUE A;  3VGU A;  3PRV A;  2NCK L;  3ZTS A;  3ETM A;  1U8W A;  1UCN A;  3FBB A;  4UOH A;  2BEF A;  3VGT A;  2AZ3 A;  2HUR A;  3FC9 A;  4F36 A;  3EIC A;  2AZ1 A;  3FCW A;  3NGR A;  3BBF A;  2DY9 A;  3R9L A;  3G2X A;  3B6B A;  3NGT A;  4UOF A;  3VGV A;  1HHQ A;  3ELH A;  4DUT A;  3ZTR A;  2DXD A;  2HVE A;  3FCV A;  1NLK L;  5C7P A;  1B4S A;  3PJ9 A;  1MN9 A;  2DXE A;  5BXI A;  4ENO A;  1NSP A;  1NDL A;  3WX8 A;  3ZTQ A;  1PAE X;  1NDP A;  3GP9 A;  3Q8V A;  1BUX A;  1HIY A;  1NPK A;  2BX6 A;  1NSK L;  4ANE A;  3GPA A;  3ZTO A;  3Q89 A;  1WKL A;  3EVM A;  1B99 A;  3Q83 A;  3FBF A;  3EM1 A;  1XQI A;  3EVO A;  4F4A A;  1K44 A;  1ZS6 A;  2ZUA A;  3MPD A;  1HLW A;  2DYA A;  3DKD A;  1NSQ A;  5CAB A;  1EHW A;  1S57 A;  3Q8Y A;  2VU5 A;  1F6T A;  4KPC A;  3FBC A;  1MN7 A;  4WBF A;  3VVU A;  1WKK A;  3BH7 B;  3EJM A;  4O0N A;  4FKY A;  2HVD A;  1BE4 A;  3ZTP A;  3FBE A;  4FKX A;  5CAA A;  1S59 A;  2CWK A;  1NCL A;  1VYA A;  3DDI A;  3B54 A;  3BBB A;  1KDN A;  1NDK A;  1NB2 A;  4UOG A;  1LEO A;  3Q86 A;  4S0M A;  2B8P A;  1LWX A;  1WKJ A;  3NGU A;  3BBC A;  3VGS A;  3Q8U A;  4EK2 A;  1BHN A;  2DXF A;  4CP5 A;  3BH6 B;  4W98 A; 
#chains in the Genus database with same CATH topology
 1IR0 A;  2HS0 A;  4DEZ A;  1CPZ A;  1T05 B;  4ECY A;  2R7V A;  3QPI A;  2FQQ B;  3MUT P;  4LIR A;  3L4B C;  4OQJ A;  5GMD A;  2GIQ A;  4O3Q A;  3ISZ A;  1SQE A;  3HO1 A;  2BAB A;  4DHV A;  4MYT A;  1RWK B;  2HHH J;  3D0I E;  2ZJQ Q;  2P9G A;  1Z4U A;  3RG6 A;  2XUL A;  1B3T A;  4WE1 B;  4RU2 A;  1RT4 A;  1FKO B;  4Z37 A;  2J8S A;  3RR7 A;  2EFO A;  1FWK A;  3GP9 A;  1YJ7 A;  1AYE A;  2Z4P A;  1U24 A;  2N4D A;  2DEI A;  4P6Q A;  2FJV A;  3IBW A;  2HQD A;  1NJW A;  1K44 A;  1C4A A;  2DGQ A;  2LYV A;  5D4O A;  4A4J A;  3ET6 A;  2MQL A;  2W9A A;  2YNH B;  1SBR A;  4ZJL A;  2VBW A;  2JC1 A;  4IQX A;  4DU7 A;  4WE1 A;  4DG1 A;  4A8X A;  1URN A;  3HSZ A;  4OV6 A;  1Q8B A;  1O5J A;  3T5H A;  4IFY A;  4NZ0 A;  1VIS A;  1E6Y B;  1YVF A;  1JLE B;  2NXC A;  1EAR A;  1R7I A;  4KT0 C;  3CC7 S;  1SC1 B;  2RKI B;  4O3P A;  1KFD A;  2QFI A;  1JXV A;  4HR2 A;  3KTQ A;  2Q6B A;  4I64 A;  4DR5 J;  1AUD A;  2QX0 A;  3AD7 C;  5KFI A;  3QBC A;  2E5L J;  1RJJ A;  2HMI A;  2YNI B;  4AL6 A;  2HNZ B;  3PEH A;  3RRK A;  4USW A;  5D8H B;  1RAF B;  3VTI A;  1P27 B;  4UZC A;  4EFA C;  4GO7 X;  3WX8 A;  3HP6 A;  5E33 A;  1V6H A;  2LQB A;  2LXF A;  3QAT A;  3MEG A;  5LT5 A;  4BDP A;  3J7Z T;  1NK7 A;  3K5M A;  2NPF A;  4XAK A;  2V94 A;  9RUB A;  1X9M A;  1R31 A;  2FJD B;  4NLV A;  3FEX B;  3H8Y A;  1VDH A;  2DR6 A;  4F0M A;  3NL0 A;  3KJQ B;  4PQA A;  1SCJ B;  1TFW A;  4UY8 T;  4PXE A;  5HLF A;  2FVQ A;  1U25 A;  4USJ C;  4NCB A;  2AMC B;  3CIZ A;  2F9D A;  3QGH A;  2XYG B;  1PG5 B;  2IY5 B;  1XWL A;  5DET A;  2IVM A;  4WII A;  5AE3 A;  2RQM A;  2VA2 A;  3CTR A;  3VR1 A;  4EYI B;  3CCS S;  1LW0 B;  3D1H A;  4BCA A;  5ETS A;  3SSQ A;  1Y0H A;  1OSD A;  2OFH X;  3M32 A;  3GB0 A;  3QO9 B;  1K47 A;  3GU0 A;  3WHI A;  4JI4 F;  1HBN B;  3N6L A;  2POK A;  1ZA1 B;  3V6J A;  2BUN A;  4K50 A;  2EFQ A;  2GS8 A;  1T9W A;  1IKW A;  2HQI A;  2EKN A;  4LSZ B;  3MR7 A;  3AQO A;  5B0E A;  3FQL A;  2F8M A;  1NK5 A;  1YJU A;  2WOM A;  1GFW B;  1YWX A;  2MZT A;  2DVI A;  2HVZ A;  4X4V A;  1FKA F;  3KJV A;  5IWA J;  4WYW A;  2VON A;  3B54 A;  5KOX A;  2B5J B;  3PZP A;  3WIV A;  3BBC A;  4PG6 A;  2CZ4 A;  2VV5 A;  3H98 A;  5J2N B;  3KLF A;  2EXU A;  3M8W A;  4J9O A;  4ECU A;  2JFD A;  3AA8 A;  5LSL A;  1HFE L;  4FNI A;  2RSQ A;  2LDY A;  4NMX A;  4GC6 A;  5H9E K;  3WX4 A;  5T41 A;  3WIU A;  3GR0 A;  1H3D A;  4DPY A;  2EWH A;  3ONQ A;  4AQY J;  1PJ5 A;  3PIP Q;  5K8P A;  1UEV A;  3LWL A;  3MZI A;  1QTN B;  4O0I A;  3V4M A;  4CO2 A;  1QM9 A;  1K8A T;  2V4Q A;  2P9C A;  2X3D A;  1NPR A;  2BW7 A;  4NXN F;  3EZO A;  3M1V B;  2KI2 A;  1N5Q A;  2LVW A;  2XB2 D;  3CJR A;  2WVD A;  3MDF A;  2R8I A;  2FVP A;  4P74 A;  2FC9 A;  2V2Z A;  2XG8 A;  3S6E A;  4CI0 B;  6FD1 A;  2QN6 B;  2O1P A;  1R0B G;  1HNV B;  2FDN A;  2RS2 A;  3NP5 A;  5CZX A;  2YBV A;  2BQ3 A;  4DL2 A;  1FEE A;  3HVT A;  4FVM A;  3C6T A;  4X4N A;  2Y3Y A;  3AA9 A;  3B4D A;  1EKS A;  3F0N A;  1R8B A;  2H5I B;  4ALZ A;  4IH7 A;  2M88 A;  3DLE B;  2DIS A;  2CJK A;  3K7R A;  4UOC A;  2VIH A;  4FP9 A;  4LJM A;  4C0B A;  3A4T A;  1S12 A;  3D4J A;  1U1O A;  5AJ3 J;  2NRE A;  4RNM A;  3OXL A;  3HF5 A;  2FLL A;  4R8U B;  3VAF A;  1RTZ A;  3I96 A;  1SXL A;  4FNH A;  2KRR A;  2NXU A;  2W4D A;  4B3R F;  1U26 A;  4RW6 A;  2CQD A;  3DI6 A;  3DLE A;  2VIC A;  5E5N A;  4NLG A;  3FVY A;  5LMU F;  3G6V A;  4QBU A;  3LGM A;  2HHP A;  3LP0 A;  1TKX B;  1N0U A;  4KKO B;  3CJ0 A;  2HQG A;  4KH1 B;  1RT5 A;  2UXD F;  3NS7 B;  4IR9 A;  3QFH A;  1Q8I A;  4LBP A;  4W4M A;  2MKI A;  4J91 A;  3UPF A;  4I69 A;  4X4R A;  2ZZM A;  5F0U A;  3HSG A;  3ILI A;  4LFB F;  2E5G A;  1HBM B;  2HIY A;  3MM8 A;  4U7U K;  5LXY A;  3CW2 C;  1BGX T;  2XZT B;  1RAH B;  2B9X A;  1UFW A;  3AOB A;  2V0N A;  1FDD A;  1RSC A;  1IN0 A;  2HHW A;  3M8S A;  1UCN A;  1FKP A;  1JKH B;  1M1H A;  2OPR B;  4TXS A;  1KQS R;  1AUS L;  3RJM B;  2J9E A;  4DSK A;  4URG A;  1BD6 A;  1H6K X;  2OIH A;  2WVB A;  1KVK A;  3IRX B;  3LF0 A;  1SB6 A;  3PKM A;  1X31 C;  3HMJ G;  1HHS A;  3MTJ A;  1Q7L B;  1EHW A;  2CNN B;  4YR2 A;  3NY0 A;  2AF6 A;  5FD1 A;  5K14 B;  3G82 B;  3R5B A;  3CIM A;  1KDN A;  4NLP A;  3KNG A;  4OLP A;  4DR7 J;  4WP3 A;  1LEO A;  3H5S A;  3OL9 A;  2MKY A;  4CP5 A;  2N82 B;  2CG4 A;  3C6U B;  1RAI B;  1S1T B;  1RTI A;  3GG1 A;  2EKY A;  1UPP A;  3GJT B;  5A76 A;  4F26 A;  2QIF A;  3C16 B;  2L08 A;  5KOW A;  3PR4 A;  2FZK B;  3KMQ A;  2NZ4 A;  1S0M A;  1UVN A;  1Q16 B;  2YX4 A;  4DUT A;  4IG0 B;  3AD8 C;  3K5L A;  3HHL D;  4QPX A;  4HKQ A;  4PUO B;  5J2M B;  3JB9 k;  1H74 A;  1NPK A;  1ZM2 A;  1HW8 A;  1XR6 A;  2BYC A;  3FBF A;  4I0W A;  2FYX A;  3TA2 A;  4R0E A;  2XSJ B;  3W2V B;  2XGQ A;  2XC9 A;  1S9G A;  4Q45 A;  5FJ4 A;  3KG4 A;  2IJF A;  4FKX A;  4X65 J;  2CQC A;  4EI2 A;  4OZ0 A;  4LF9 F;  1RAC B;  2OEL A;  2FZG B;  3K5N A;  3UW1 A;  2KT2 A;  2FY1 A;  4NLO A;  2DNH A;  3TNV A;  4PXB A;  3W2W A;  2MJN A;  2W01 A;  2J9D E;  3ENA A;  4Y2M A;  4KTQ A;  3V6H A;  5GAE I;  4DS5 A;  4OJ1 A;  1XN9 A;  1FFS B;  2MZS A;  4ZDN A;  3TZX A;  1O0P A;  3GIJ A;  1KQK A;  4L3N A;  4H4M B;  2XM3 A;  3MM7 B;  3PKY A;  1F5C A;  4D3G A;  4ECZ A;  2GQQ A;  3T1H F;  2E7W A;  2A18 A;  1RYS A;  1XR5 A;  1T3O A;  4DQS A;  1VQM S;  3AT1 B;  2LQJ A;  1ZTT A;  3VZH A;  2R7O A;  4U9R A;  3R5C A;  4DMZ A;  5F8H A;  4NLT A;  2OFG X;  4RBT A;  2VZ9 A;  3RTV A;  3FJ2 A;  4C3M A;  3M8Y A;  4DV2 F;  2Y1R I;  2CPE A;  2I6W A;  3A8K A;  3FBE A;  1Q86 T;  3F56 A;  3BDE A;  2HQ3 A;  4QWC A;  3LAM A;  3BQ0 A;  4X4Q A;  1MU2 A;  2WVF A;  2WHO A;  4M94 A;  4PXD A;  1H2T Z;  2BE9 B;  4H4O A;  3G4S S;  1R3N A;  4K4S A;  1FD2 A;  4AL7 A;  3AXK A;  1VJW A;  5DS7 A;  1EET A;  1YBA A;  4Q0B A;  4EU0 A;  2ZBC A;  4UW2 A;  1RT1 A;  1HBO A;  3ZO7 A;  4Y2K A;  2QYG A;  4DR4 F;  4X2B A;  3HD2 A;  2QL7 B;  5KFT A;  1EIY B;  3OTO F;  2XSF A;  4QR1 A;  4OHZ A;  4RNO A;  3PXG a;  2RD5 C;  5IFM A;  2ALZ A;  2GVZ B;  1B4S A;  2BM0 A;  1SV5 B;  4MIW A;  2VQF F;  2KZM A;  4P7T A;  4KBI A;  2HHS A;  1TMJ A;  2Z2Y B;  1FVS A;  3BPD A;  3I5B A;  3IO1 A;  5C25 B;  4C7Q A;  4DV1 J;  1Q8K A;  3RB6 A;  1X4H A;  2F9J A;  3MTK A;  2ZBP A;  5KFU A;  4QIE A;  4RNF A;  2DH9 A;  4O4R A;  4MK9 A;  3HVR A;  5HI7 A;  1FJG J;  5DDQ C;  1R8A A;  2RDI A;  3CME S;  1NHK L;  1VI7 A;  1YZ7 A;  4JI2 F;  3TW0 A;  1F2H A;  2KH9 A;  3D3C J;  1JB0 C;  3TAQ A;  3K58 A;  4Q43 A;  5B0D A;  4X4S A;  4HI2 A;  4DR1 J;  5DGB A;  3BM7 A;  3BRE A;  1S1X B;  1D9F A;  5IT9 Y;  2QE5 A;  4ZN1 A;  4PRF A;  1B70 B;  1FXD A;  3CCQ S;  5DQI A;  2IIH A;  3W60 A;  1B7F A;  1S1U B;  5E7O B;  1G6B A;  1PO6 A;  3BGU A;  3J7A N;  4F04 B;  3PYE A;  2IM3 A;  5A8K A;  1H98 A;  1OY9 A;  2R8H A;  3EXC X;  1FRJ A;  5H1S V;  2OEM A;  1HD1 A;  4RWW A;  1HQ2 A;  2DTJ A;  4F4A A;  1YBT A;  3X3U A;  4JI3 F;  3VAI A;  5MLC V;  2DNL A;  1VQ6 S;  2HZA A;  2H3E B;  1PC4 A;  4ICL B;  3GWC A;  1IBL J;  3I0S A;  1QUP A;  4YFU A;  4ED1 A;  2E9R X;  5HAT A;  3D1O A;  1JMT A;  2MQ8 A;  1TKZ B;  1S1W B;  3LP2 A;  3C14 A;  3H0P A;  2CVE A;  4DCO B;  5F9L A;  1IBM F;  1JLB B;  3Q0A A;  3L7U A;  1VK3 A;  3CDW A;  4Z7Y A;  4EGL A;  2XY5 A;  4DSE A;  3GCW P;  1VRT B;  2LDI A;  5KFB A;  4FPI A;  2ZDO A;  3POT B;  3ZZZ A;  1MML A;  1F3V A;  4O44 A;  2VKZ G;  7AT1 B;  2HFN A;  1VQL S;  2ZH9 A;  1UMJ A;  2QGF B;  1TK5 A;  2EFP A;  3NNC A;  2DT9 A;  3M2R A;  2WB4 A;  3SCJ E;  1RAG B;  1HNX J;  4WIQ A;  4LSN A;  1WSR A;  3TVZ A;  4X84 A;  3OVB A;  2DHX A;  1JX4 A;  3M6V A;  4PQU A;  1B99 A;  2VJU A;  4DCP B;  2AYB A;  4P73 A;  1NK9 A;  1SKU B;  1WC6 A;  2ZBR A;  1NPP A;  1LFP A;  4J5O A;  1HI0 P;  5THW A;  2XQC A;  5HSP A;  3C66 A;  1FX2 A;  3RAX A;  1KTV A;  2HG4 A;  1ZYQ A;  1QAY A;  3BBB A;  1NM2 A;  4CM0 A;  4QYR A;  2I2Y A;  4YR3 A;  2E1M C;  5KG1 A;  4OI3 A;  4DLE A;  2MZQ A;  2EK1 A;  2GJI A;  4IRC A;  3Q22 A;  4J9U E;  1VFJ A;  5CCL A;  1ZZF A;  2GAH C;  5RUB A;  3T1A A;  2BJ3 A;  2EG2 A;  3MEE A;  4C8N A;  3SFG A;  1ZH5 A;  4C3L A;  1WHW A;  3PEJ A;  1WTB A;  4KHR A;  4E8U A;  2MST A;  2WAQ D;  3GG0 A;  4KC5 A;  1IR1 A;  1ZBT A;  1RUS A;  1WOP A;  2VB6 A;  5KT2 A;  1ZZN A;  3PY8 A;  2C2K B;  4EUV A;  1HMV B;  1FJE B;  4IFV B;  4NPO A;  3NRB A;  1NDP A;  3BN7 A;  2F3J A;  1UFL A;  4WU3 A;  3BSA A;  2QTW A;  3KJF B;  4L76 A;  5CHC B;  2ATL A;  3E3X A;  3HK2 A;  3V4I A;  4A8Q A;  3G8T A;  3FZB A;  1KC8 T;  3AOA A;  1CS4 B;  2AJ0 A;  2EFG A;  2F63 A;  3BKF A;  3JQJ A;  2RHS B;  3HT0 A;  2GMH A;  4C4W A;  3NCP A;  3C15 A;  3W5Y A;  1RT7 B;  4A8W A;  4N5S A;  4FXD A;  3OR2 A;  3T6B A;  4V19 J;  2WW4 A;  1YRT A;  1XNQ F;  4EEY A;  5IV4 A;  2AEJ A;  2VFS A;  1VRU A;  1URR A;  3DRX A;  3EGN A;  1WOR A;  2F4V F;  1VGY A;  3T3F A;  3MUM P;  1T95 A;  5EDW A;  1S9E A;  3UDC A;  4PWU A;  5EWE A;  1HYS B;  1VC0 A;  1C1B B;  1U6F A;  3LAK A;  1S6Q A;  1TFY A;  3HFK A;  3I55 S;  1UEU A;  3NOG A;  2C2N A;  4FYD A;  4FPR A;  4DFK A;  1NKE A;  1TKT B;  4DUZ F;  2A3J A;  5BYQ A;  2QSW A;  1WNE A;  5C2C A;  3Q8Y A;  3DN9 A;  1ZAX A;  4IRD A;  3GYX B;  2NLW A;  1C4C A;  3ETO A;  1PJ6 A;  2B7B B;  2E66 A;  3NKY A;  4ELU A;  1C1B A;  4ILR A;  2EI5 A;  1HNW J;  3BGR B;  4F4Z A;  3HHN B;  1TV6 A;  2M52 A;  5KG2 A;  3AB4 B;  2LP4 A;  1B0V A;  4DL0 C;  2YVS A;  2ZOF A;  3GII A;  1SQF A;  3SQG A;  4CYU A;  4AND A;  1HWJ A;  2PII A;  3QIP B;  4I7F B;  4GMK A;  5B0C A;  3GFY A;  1H73 A;  1NH8 A;  3FC9 A;  1R89 A;  4X64 J;  3K59 A;  1JXL A;  2PI5 A;  3UCU P;  3VGV A;  4QR0 A;  1I5O B;  4WZQ A;  5IT9 U;  5C7P A;  3BDP A;  3W61 A;  1BQN A;  4ZHR A;  3ZC4 A;  3ILJ A;  2BX6 A;  2WON B;  1UWB B;  3T5K A;  2DK2 A;  3RAQ A;  3KLG B;  4P52 A;  2WSE C;  1I94 J;  3TAM A;  2HW3 A;  2Y1I A;  2Q3P A;  2APO A;  4I68 A;  3IWL A;  1IM6 A;  1ZET A;  4OX9 F;  4I6A A;  3M2U B;  4WYL A;  3GV8 B;  3EZ5 A;  1CUL A;  2ZIT A;  3U1L A;  3CJ4 A;  3R7B B;  1XTZ A;  3AOC A;  4OHW A;  2R9L A;  3C3L A;  3UE2 A;  2R7Q A;  5C24 B;  3DLG B;  3P96 A;  4IG3 A;  1Y10 A;  3FKB A;  5HBM B;  2CQ3 A;  5KG6 A;  3R3T A;  1FF2 A;  3S1T A;  1YK9 A;  4B3O B;  2P9E A;  2PEH A;  4DOZ A;  2YQ1 A;  3KJN B;  4CZC A;  1U8W A;  3VWS A;  2DR8 A;  2XO6 A;  4IR1 A;  1VQO S;  3M2V A;  3EX7 B;  4HT5 A;  3NS6 A;  4NI2 A;  3BBF A;  3OR1 B;  3C2P A;  2OJ3 A;  4YOE A;  1BQM B;  2RU3 A;  2AP6 A;  3X1L B;  4K8R A;  1J5E F;  5C24 A;  3MUR P;  5HAO A;  2VG5 B;  2Z2M A;  1OS5 A;  4XPC A;  2QL9 B;  4I4B A;  3VCD A;  1P1L A;  2W7P A;  2AIR B;  5F9N A;  5DDP C;  4NCG A;  1B64 A;  5FII A;  4WFA Q;  3V6D B;  2AEF A;  4KIA A;  4NRT A;  3HHL A;  5CH7 B;  1YQH A;  4FVC A;  2AJ1 A;  3LWM A;  3M8Q B;  4X66 F;  3OVA A;  2FLO A;  2XWY A;  4DBQ A;  4RBU A;  1BLU A;  1D8Y A;  5HMY A;  2EC0 A;  2C1E B;  1VR6 A;  2CQB A;  3H2V E;  2ZBI A;  4KE5 A;  1RTJ A;  3HJV A;  4KAI A;  2HZC A;  5A8W B;  3EZU A;  3M7V A;  3TUI C;  2UV8 A;  4V19 X;  2FGO A;  5ETO A;  2F7V A;  3J7A 1;  2X51 A;  4DJB A;  5D3G B;  4AXJ A;  3QAU A;  1C1C A;  4CIO A;  4C8O A;  4IOA Q;  1Z1Z A;  1KVI A;  1O51 A;  4JI4 J;  3OBI A;  3B8H A;  3TEG A;  2ZBQ A;  2JEG A;  3PJ9 A;  4JYA F;  4ED8 A;  5CYM A;  2ZH7 A;  2XLK A;  1S76 D;  2CPY A;  2NYH A;  4DR3 F;  4WK1 A;  3HHL C;  4J90 A;  2FJE B;  2R2R A;  3JSM B;  2ZHB A;  3A3N B;  2YQ3 A;  1TL1 B;  2RQK A;  1ICE B;  1HL6 A;  1UW4 A;  3DDI A;  2RIL A;  4IDK B;  4F3M A;  2IHR 1;  2AHO B;  1LWC B;  2BDP A;  1C0T A;  5D77 A;  2MKC A;  2OHD A;  1IKV A;  4KHP J;  3MM5 B;  3W63 A;  3OFH A;  3TVY A;  3K8W A;  2UU9 J;  3TAN A;  4ILL A;  2DR7 A;  3MPV A;  2C3O A;  3AFG A;  2VG6 A;  3ENW A;  1OY8 A;  3LPY A;  3SYZ A;  4FYX B;  3MM9 A;  4E2F B;  2R8G A;  4HI1 A;  1HHT P;  3E01 A;  4DPW A;  1KLM B;  2B4U A;  1SIW B;  1U2R A;  4MH8 A;  2J76 E;  2H48 B;  3H25 A;  1H38 A;  2V5H G;  2UV8 G;  1RT3 B;  2YKM A;  2B9Y A;  3MPU B;  2LU2 A;  2CUY A;  3EDR B;  4Z2X A;  5C2G A;  4CH7 A;  2IDL A;  1T94 A;  1XMO J;  3NCR A;  2UUB J;  3MFI A;  3JTP A;  2U2F A;  3R1L A;  3A8I A;  1N88 A;  4LF1 A;  1FE4 A;  1FXR A;  2BKN A;  5DGA A;  2ADC A;  2PDA A;  3OUY B;  4OZN A;  3PW0 A;  1V5V A;  3BO2 A;  2C2D A;  2PFD A;  2L9W A;  2J6T A;  3CJ2 A;  3G96 A;  4I2P B;  1CJK B;  1WG5 A;  5HRO A;  4JI5 F;  3FUY A;  5KG4 A;  3WQP A;  4USU A;  1HNI B;  1M5P C;  3DXS X;  4AFF A;  2UXC F;  2I0X A;  2BAN B;  3SCI E;  4JV1 A;  2WK4 A;  5BYR A;  1YSJ A;  2CAJ A;  3SIP B;  3M9O B;  4RW8 B;  2RQC A;  4ZLL A;  1R0A B;  2GVD B;  2A6M A;  2QYC A;  3ICL A;  4ZKA A;  1IKX B;  3TZW A;  1T8E A;  3DU6 A;  1JLA B;  3PVX A;  3RAM A;  2KN4 A;  3C8Y A;  5E3P A;  3VAM A;  2BAN A;  3OL7 A;  5E3Q A;  2OPP B;  2ZC4 A;  3I82 A;  1OYE A;  2QL5 B;  2K1R B;  4M5D A;  4Y2I A;  3L09 A;  3ZTQ A;  3RRH A;  4DSJ A;  2HND B;  3H5U A;  2J6U A;  2I38 A;  3CD0 A;  4KO0 B;  1SC6 A;  4URQ U;  3Q2T C;  3MEC A;  3Q89 A;  1X5O A;  1N5T A;  2F40 A;  1L5U A;  1VMB A;  1HLW A;  2B4V A;  2GV1 A;  3KUH A;  5HMX A;  1IKY A;  4ZIW A;  3T5J A;  4CLW A;  2FHK A;  1RTH B;  4NA1 A;  2K1R A;  2PMW A;  4B02 A;  4DR2 F;  3HZE A;  5JMN A;  4XO0 A;  3BKT A;  3M8P B;  2JSX A;  3Q8U A;  4JI1 F;  4DN0 A;  3O44 A;  3BYP A;  2AJQ A;  4I2Q B;  1WF2 A;  1BY9 A;  3U1M A;  2JEI A;  2UUA J;  1W7W A;  2V2K A;  3GV5 B;  2B4P A;  1S0N A;  4B3M F;  3MMB B;  2IBK A;  1AW0 A;  4CWB A;  1FT8 A;  4MKB A;  5L9X A;  2ZH1 A;  3Q23 A;  4TNO A;  2BW2 A;  2HVE A;  4CLK A;  3MF5 A;  1X4G A;  4ZVU B;  3IXQ A;  2BQR A;  4OX6 A;  2MY7 A;  1Q0N A;  5I3U B;  3DRR A;  5KFC A;  3PAC A;  4LF6 F;  2UVV A;  4DV6 J;  2BJ8 A;  3HPO A;  2G2O A;  1PYO B;  2RIJ A;  1AZS B;  2QLW A;  4I6W A;  3EUN A;  5DO2 A;  2DBB A;  3QWP A;  4C8Z A;  2YKN A;  4TKT A;  3T1Y F;  5M2R A;  2Y8W A;  2DNK A;  4GVB B;  4KYZ A;  2GGP A;  2CJY B;  5KFH A;  3BSO A;  2J7U A;  2F4F A;  3W9I A;  1F9E B;  2W2M P;  1RHM B;  2N4C A;  1ROF A;  1M5K C;  1YRU A;  2RRB A;  2M9K A;  4G6V B;  4ECQ A;  5IM0 B;  2BEF A;  1W25 A;  2ZH8 A;  2MQM A;  1FA0 A;  3O8W A;  4J9Q A;  4AXI A;  2Y1L B;  1D3W A;  3BQ2 A;  2KHD A;  4MTP A;  2KVQ E;  3KLH B;  1KP6 A;  4ZVH A;  4ZVR B;  3THP A;  4UT4 A;  1CVJ A;  2B9W A;  5L8R C;  2VOD A;  4DPX A;  1NSP A;  2HBR B;  3A3O B;  4LF7 F;  4GKK J;  2B56 A;  1O6X A;  2VC0 A;  4X4P A;  4RW7 A;  4DV3 J;  5BR8 J;  2BA9 A;  4K7Q A;  2RVJ A;  2O66 A;  4CT8 A;  5IT4 A;  3Q24 A;  1LNQ A;  2AGP A;  1FES A;  1W26 A;  1SJ1 A;  5K20 B;  1K73 T;  1KKH A;  1WKK A;  4OZJ A;  2B43 A;  3IC1 A;  4ETZ A;  2UUC F;  1ZPV A;  3MCN A;  2QMX A;  3QFW A;  1VBK A;  4B9M A;  4G1P A;  4LF5 J;  2XI3 A;  3DGP A;  3FRZ A;  4J9L A;  4OIX A;  5G0R B;  2AW0 A;  2DB1 A;  3EPG A;  1WHX A;  3PX6 A;  2HEK A;  2HGL A;  5KFK A;  3MED B;  4DX8 H;  3MR5 A;  1X5S A;  2ASL A;  2MHE A;  2C2M B;  1GNK A;  4C0H A;  3D0G E;  2X3G A;  4QYZ J;  4ES2 A;  4LVN P;  4IO1 A;  1U1L A;  4C8L A;  1TP7 A;  2HNY A;  1S7H A;  4UF4 A;  2Z57 B;  4PZV A;  4IH6 A;  1CC7 A;  3D28 A;  4OHV A;  1FWP A;  2KFN A;  1F2G A;  3BJY A;  1JLF A;  1RZM A;  4QZV B;  3DDN A;  5LL6 d;  3OXF A;  3JTN A;  1BE4 A;  3GJQ B;  2WTF A;  4WCE Q;  2FHM A;  1LOU A;  5H9F J;  4Z7C A;  4JI8 J;  5KFE A;  3OJS A;  1NEE A;  4Y65 A;  3FSI A;  2J8A A;  2RAQ A;  2HHQ A;  1EKR A;  3V81 A;  1T7P A;  3PO5 A;  1NXI A;  1YJR A;  2VOP A;  5DG7 A;  2HRT A;  5D6G A;  4B3T J;  2MKS A;  2YQ0 A;  4AL5 A;  4P2F A;  2W9C A;  3DMJ B;  5KFQ A;  2MZJ A;  4PYD A;  4E98 A;  4F4W A;  1TVR B;  1K0V A;  1RWP B;  3TX8 A;  1S6P B;  4QIW D;  4ZPC A;  1IBK J;  4CLU A;  2V8D A;  2V2V A;  1GEH A;  2CJB A;  3HD1 A;  4RU9 A;  1X8D A;  3DLH A;  2ZZN A;  4HAC A;  2VC1 A;  2WVE A;  3NWG A;  3LTO A;  2AX1 A;  2GJF A;  3HHE A;  1VBY A;  1WG4 A;  4N76 A;  2FJA B;  3O1L A;  3MFH A;  3PHT A;  1SUQ B;  1MLA A;  3DKD A;  3SQO P;  5B09 A;  3FBC A;  3DHX A;  2RUG A;  4O0N A;  4HHU A;  4N41 A;  5LMN F;  2MLY A;  3G9C A;  2AEM A;  4OI2 A;  3Q8P B;  2ZOG A;  3N6N A;  4OYW A;  5AXN A;  2ZD1 A;  4OJG A;  1V3Z A;  1DTQ B;  4TY9 A;  2QG9 B;  2MB0 B;  1DTT A;  4WXO A;  3GIM A;  1RWN B;  5HMW A;  3CO9 A;  4QWA A;  1L3U A;  1YLX A;  2ACM A;  1VQK S;  3M9M B;  2F65 A;  2UZA A;  1CJT B;  1XMB A;  4YY3 J;  3ILO A;  1RBA A;  2C3P A;  3PJW A;  4QJV A;  4F67 A;  1HBU A;  4USI A;  2OPQ B;  3UO0 A;  4CLL A;  4DLG A;  1R6V A;  3AOD A;  3MXH P;  2HVH A;  2N7C A;  4WP8 A;  3GMG A;  3ZXW A;  2M7S A;  4DX6 A;  4RNH A;  3DDK A;  3QGI A;  4X62 F;  1FRK A;  2DPI A;  4JV2 A;  3TQ1 A;  8RUC A;  4JI3 J;  1KN6 A;  4O3O A;  4Q7A A;  5J1E B;  3OSP A;  3E51 A;  2LEC A;  1HWK A;  4K2X A;  1REV A;  3BH7 B;  1U0H B;  4M5N A;  3L9Z A;  4K4U A;  3GIR A;  4DX5 A;  4JV5 F;  5GAH U;  3QNW B;  4K4Z A;  2RHQ B;  2DIU A;  1DAR A;  2C42 A;  4NZ7 A;  3OXG A;  4DL4 A;  4LFA J;  1XNR J;  4ED6 A;  2IAJ A;  4B9V A;  2HLU A;  1IXK A;  4OI4 A;  5B08 A;  4N7T A;  3K2Y A;  5J2Q A;  4XTT A;  3US5 A;  4C6A A;  4ELV A;  4ED3 A;  1N32 J;  2J6S A;  4RW9 A;  5ETQ A;  1ZM3 A;  4WTO B;  3ZZP A;  3VGU A;  5C42 A;  4KFB B;  4DR6 J;  5KT6 A;  2YXL A;  3RBZ A;  2FGC A;  1GTH A;  3RU0 A;  2YKP A;  3VZI A;  3HLU A;  1AT1 B;  1EP4 A;  3IN5 A;  1RWM B;  1RWO B;  2YNG A;  3J81 Y;  3GFZ A;  3MMC B;  5HAN A;  2RH3 A;  3WZ0 A;  1S1V B;  5DJB A;  1QVF R;  1YI2 S;  1E6V A;  2EVZ A;  4LRA A;  4LFC F;  2WVC A;  2C2E A;  3CCJ S;  4GKJ F;  3ISN D;  3IS9 B;  3M4X A;  2IRY A;  4DV5 J;  2XI2 A;  1JLG A;  4ZJQ A;  4M63 A;  4PWD B;  4KRW A;  1GX5 A;  1C0U A;  3RB4 A;  3OHA A;  1FEH A;  4DV0 F;  2MSS A;  4IUF A;  3KUE A;  3G87 A;  2IMO A;  3HDS A;  1SKR A;  4EZ6 A;  2LEB A;  3UFC X;  3N0V A;  3VV2 B;  2I1R A;  1BHN A;  3AJ2 A;  3QGP A;  4ID5 A;  4P2M A;  3VVU A;  4CTA A;  4NYO A;  3SMZ A;  2IJR A;  1BMQ B;  3DYA B;  2Q79 A;  2FIU A;  1XIQ A;  5ETT A;  1X0P A;  1HWL A;  2VKR A;  1LFW A;  1IWA A;  2F1F A;  1KD1 T;  1S7I A;  3UR3 C;  4F36 A;  1HR0 F;  2V6A A;  4M5H A;  1CQN A;  5F8M A;  1DHM A;  3PNI A;  2RF2 B;  3MD1 A;  4NRU A;  3M6X A;  3O6Q A;  1IVZ A;  3IR6 B;  4OFZ A;  2K7K A;  4B08 A;  3Q2S C;  1VQ8 S;  3UN5 A;  1SJ3 P;  3DRY A;  5I42 B;  3KDN A;  2OTJ S;  1LW2 B;  3KK3 A;  3CJK A;  1GXL A;  1G4C A;  4N77 A;  3Q83 A;  2GHP A;  2HHH F;  4YEA A;  5IXU A;  4DPT A;  3M8Z A;  2IMW P;  1NJZ A;  4OZ1 A;  4WFY A;  4R5P A;  4XPE A;  4DQR A;  4U8V A;  2B51 A;  1HPZ B;  1WEY A;  2RF2 A;  1RKI A;  1U6B A;  2YKQ A;  1JLC B;  5FDL B;  4CO3 A;  1DLO B;  2PMH A;  3I87 A;  3I31 A;  3MMA B;  2MGZ B;  3OLA A;  1ELO A;  3NGU A;  2GZO A;  3DNC A;  1BWV A;  4IRK A;  1Q1K A;  5KT5 A;  4P71 A;  5BJR A;  5KTQ A;  1OJ4 A;  1KS2 A;  1RA6 A;  5E3A A;  3E8O A;  3PW7 A;  2V8H A;  2PGC A;  1EAY C;  2JHE A;  2MLZ A;  2GA7 A;  1GMW D;  1HPZ A;  3OHB A;  3MHY A;  2D69 A;  2MQQ A;  3D2W A;  2PA3 A;  5MAO A;  2ZEJ A;  5F8L A;  3QID A;  3QLH A;  2IA6 A;  2MGZ A;  1UVJ A;  2WZ1 A;  2HQF A;  4OYX A;  4DUY J;  5J2P B;  3VAH A;  4RW4 B;  2EK6 A;  3JXO A;  2HGM A;  1VK8 A;  4YDX A;  4N8O A;  3NMR A;  4DR5 F;  1YG0 A;  1M90 T;  3ZTO A;  2E5L F;  2CQ1 A;  4LR9 A;  3BR8 A;  1VQP S;  3KKF A;  1FI4 A;  4DV4 J;  2AYE A;  1VQN S;  4U8Y A;  2DY1 A;  3N28 A;  4ZK7 M;  1PSD A;  1ZM9 A;  2HS4 A;  3NBP B;  2RT3 A;  2HLT A;  2RDJ A;  4C11 B;  4XDD A;  1NB2 A;  1S0O A;  4K4T A;  1WOO A;  2PI4 A;  4FYV B;  3KNA A;  3EDQ B;  2YNF A;  3PRD A;  3CDU A;  1UPM B;  2B0G A;  4ZS6 A;  2HBY B;  3IRW P;  5E2Q A;  1RLD A;  4TY8 A;  2MYF A;  3BSN A;  5B7W A;  1TL7 B;  1V3S A;  2GIR A;  4A8K A;  3I5A A;  3I9Z A;  4OYZ A;  3D54 A;  4LT6 A;  4PAB A;  3BZQ A;  1A6L A;  4QWE A;  1RTD A;  1PAU B;  1SQG A;  1BUX A;  4QPT A;  4UUX A;  1DZ5 A;  3KXD A;  1IWG A;  5IV3 A;  3EM1 A;  1XMQ J;  3FQK A;  3A13 A;  2RUS A;  2Y9H A;  4C8Y A;  4DV7 F;  1SH3 A;  1RT4 B;  3KLI A;  2C2R A;  4OZ5 A;  1NJY A;  3M8R A;  1OYD A;  3R5A A;  4TN2 A;  2YX1 A;  1VIX A;  4HDG A;  1QAJ A;  5I4M A;  3KDO A;  4CH1 A;  4ECV A;  1DRZ A;  2X7I A;  2VPX B;  5A2Q Y;  5E3R A;  3ET6 B;  3IBC B;  2J7W A;  3EGZ A;  1UP1 A;  5B0G A;  2CPI A;  1I3O B;  5IWA F;  2MEW A;  1F9H A;  4DG1 B;  3SBM A;  2AZ3 A;  3FCW A;  1CG2 A;  2FVR A;  4IFY B;  2JOQ A;  1K1Q A;  2XEX A;  5ETL A;  2DXD A;  1JJC B;  5DDO C;  4UST A;  2K2P A;  1U1P A;  5KT4 A;  4F0H A;  3TAP A;  1Z2L A;  2ZNY A;  4WWS A;  1NJI T;  5B0F A;  2DEJ A;  3J81 U;  4O23 A;  4EBC A;  2CPZ A;  2HMI B;  3SXL A;  2YWF A;  2DD8 S;  4NLX A;  2C3Y A;  2AJ4 A;  1A7G E;  4PXC A;  5HVF A;  4AQY F;  1JIH A;  5FLX Y;  4ZVQ B;  3DLB A;  3THV A;  1M5O C;  4JV0 A;  3MEG B;  4QR2 A;  5HVG A;  1ARO P;  3TP2 A;  3CCE S;  1VQ9 S;  2QRR A;  2W9B B;  1WG1 A;  4L75 A;  1F0X A;  1N36 J;  3RW6 A;  4CLY A;  4F50 A;  2DGU A;  1T9Y A;  2CQI A;  3IGV A;  4RNN A;  2KHC A;  5HLF B;  2W7O A;  3U27 A;  3G6E S;  2IM2 A;  4NLD A;  2CZ9 A;  4DWI A;  3PYF A;  3G71 S;  2EW9 A;  1YTY A;  3HJF A;  1RHQ B;  1FNO A;  4JYA J;  5G4D A;  3D6F B;  1MMD A;  2JC0 A;  2W9B A;  2VFU A;  2NUU G;  1D1U A;  1UEK A;  2M2B A;  4FS1 A;  2DCL A;  1APS A;  3NGK A;  3ZZR A;  4BHQ A;  1TZ0 A;  4LUB A;  3LH2 S;  2KO1 A;  1I6J A;  5AJ3 F;  2VPY B;  2UUT A;  3M32 B;  4OYM A;  2DNP A;  3DC2 A;  4K4Y A;  4NYZ A;  2W2O P;  1UJ4 A;  2R42 A;  5L1J A;  4KJI A;  4BWM A;  4JI7 J;  1IKW B;  1OWX A;  4DU8 A;  4S0M A;  3WC0 A;  1Y11 A;  4F4X A;  3H4D A;  2BXJ A;  1BQX A;  2VD3 A;  2XLI A;  4GC7 A;  2WOM B;  2XCP A;  2JNJ A;  1YJN S;  1PGZ A;  2I8E A;  2HWI A;  3W8G A;  4QYZ K;  1CJU A;  1A0O B;  3KJV B;  3T9Z A;  5L9N A;  3I56 S;  5DG8 A;  5ITH A;  2JWN A;  1KSP A;  3Q8R B;  3SV4 A;  1KNZ A;  3KLF B;  4MJK A;  4FXW A;  1M0S A;  2O67 A;  1TMM A;  3CT9 A;  4P7V A;  3T9N A;  5KAK A;  4HT7 A;  5H9F K;  3DXB A;  1N6Q A;  2HVI A;  4UQT A;  5HP1 A;  1NKB A;  2DHG A;  4HEA 9;  2D41 A;  3A12 A;  3QAE A;  1DAX A;  3MWB A;  4TLR A;  2BKP A;  3N9U C;  2H51 B;  3CCU S;  3R6L B;  3W66 A;  3TA1 A;  3KMS A;  1PCA A;  4LRC A;  3PHE A;  1QDU B;  2AV5 A;  3CB4 A;  4P2X A;  1RWW B;  4F8R A;  3UD4 P;  3P6Y C;  3AQP A;  2ZDP A;  3MI7 X;  3RBE A;  2V67 A;  4K5R A;  4NYP A;  1PKU A;  3THT A;  5DM7 Q;  1X4F A;  4K0K J;  4HH0 A;  4I67 A;  2UXB J;  2VG7 A;  4Y00 A;  1S5Z A;  4DI6 A;  4YN3 B;  2WBR A;  4J9K A;  2IM1 A;  1UA0 A;  4BS2 A;  4HLB A;  2RB7 A;  4RUC A;  4DR7 F;  1I1G A;  2HAF A;  1RI7 A;  3HVT B;  4L73 A;  2E1R A;  1VC5 A;  3C6T B;  2WBM A;  3TA0 A;  1C2P A;  3QWU A;  1RWU A;  2F5G A;  2BQU A;  3H42 A;  3B78 A;  2W2P P;  2KM8 C;  3BO4 A;  1HNZ J;  1QAX A;  5GVQ A;  3DLK A;  3MAA A;  3OT9 A;  4YS2 A;  2OPS A;  5HQL A;  4NZ6 A;  4PR6 A;  4NA3 A;  2G0C A;  2ATC B;  1D0E A;  4NXM J;  5DQH A;  1YJT A;  1WC1 A;  1T11 A;  2CFX A;  2R8J A;  1TK8 A;  3CWJ A;  5LSR A;  5AE1 A;  2HFU A;  3CDB A;  4JI0 J;  2FVS A;  2BAC A;  2DNQ A;  1YJW S;  2KXF A;  4ED5 A;  3MCO A;  3CMA S;  2QA2 A;  2DYA A;  2HFV A;  4AYB D;  4KV8 A;  4FKY A;  3KK2 A;  5CAA A;  2CQH A;  3IG1 A;  2X1B A;  4RW6 B;  3DI6 B;  4B9T A;  2DH7 A;  1S97 A;  5KFV A;  4J9N A;  4UZB A;  3TJ9 A;  3LA0 A;  4ZPT R;  3LP0 B;  1RK8 A;  3FGV A;  2OH2 A;  1PBA A;  5HMZ A;  2DIV A;  2BOA A;  3ZNJ 1;  4W98 A;  1FNX H;  1RT5 B;  3JS9 A;  3VVT A;  3EMT A;  2CJA A;  4X65 F;  4MFB A;  2DHA A;  3CXC R;  1JJ2 R;  1T03 A;  2ZM6 F;  5A2Q U;  1N5S A;  2CYY A;  5KT7 A;  6FDR A;  3GTY X;  4Q8E A;  3MM8 B;  2V4J A;  4O4G A;  2PO4 A;  2GCF A;  3M6U A;  1SJR A;  3DRS A;  1M1K T;  4ZLJ A;  2J0X A;  4CO5 A;  2IRX A;  3JSY A;  2DGW A;  1N48 A;  2EC2 A;  3GJS B;  1FKP B;  3GPA A;  2W7A A;  1HQU A;  2B4O A;  3PIO Q;  2D74 B;  4DFJ A;  2FTR A;  3EVO A;  1WD6 A;  1JK9 B;  5H9E J;  1KWM A;  4EYH B;  2NXE A;  3DOM A;  1RQ0 A;  1B7Y B;  3C19 A;  1NK0 A;  2NXN A;  7FD1 A;  2RS8 A;  5KFX A;  3CE8 A;  2M8D B;  4ER8 A;  3IM9 A;  2XMU A;  4LSL A;  4C98 A;  2CA9 A;  5FLX U;  2IA0 A;  3NMA A;  1XR7 A;  3QRP A;  2UUW A;  1JLQ A;  4TYA A;  4QW9 A;  2JRS A;  4G1I A;  4KGM A;  4LF8 J;  3OTD A;  1WEZ A;  3CDA A;  5A0Y B;  3VQT A;  2RML A;  2YWW A;  2J7K A;  4V1A k;  4OMF G;  1OPI A;  2R7T A;  3F41 A;  4PG4 A;  3AXM A;  2WCX A;  1MG7 A;  3CD5 A;  1LXJ A;  1RTI B;  2E5H A;  3VQS A;  2YPZ A;  1QTM A;  1NB7 A;  2L48 A;  3FFI A;  3ADA C;  1EZZ B;  3SSR A;  3J80 Y;  3IAS 9;  3A8E A;  1NSK L;  4WKY A;  4HHH A;  2YWG A;  2ZE2 A;  1JJ4 A;  5A0Y A;  1VLY A;  4C48 A;  3PX0 A;  2G4B A;  2V50 A;  3ISN C;  2ZJP Q;  2K3I A;  2JL9 A;  1TL3 A;  3IAM 9;  3R97 A;  5T7L A;  1WF0 A;  3IM8 A;  3MAH A;  3VAG A;  4FYY B;  5IOL A;  1WC5 A;  3GYN A;  2HK2 A;  1S9G B;  4DQQ A;  4DV1 F;  4CT9 A;  2ROE A;  2G0J A;  3ZTS A;  3BN4 A;  1RKJ A;  2DHH A;  4QU6 A;  5KT3 A;  1JNZ B;  2ZNZ A;  1F60 B;  3W2W B;  5CXT A;  2FPH X;  1IM4 A;  5ADZ A;  4DQI A;  1VHF A;  5A8R A;  1N34 J;  4DR1 F;  2XMA A;  2XMV A;  1GMW A;  1KHW A;  1EB0 A;  4WFB Q;  3L7O A;  2XO7 A;  2E9T A;  2XMJ A;  2VBY A;  2XYH B;  2KG1 A;  2KFZ A;  5U47 A;  3I4P A;  4DCJ B;  4DFM A;  4M5L A;  4WBF A;  4NWB A;  3P5T L;  1IUJ A;  2R4F A;  1RU1 A;  2FHJ D;  3J7Z 5;  1S0V A;  1S59 A;  1P8G A;  1UVI A;  2C2Z B;  4KQZ A;  4P9S A;  1Q78 A;  5HQ8 A;  1FFW B;  3PW4 A;  2ZH4 A;  1N33 J;  4UTG A;  1RT6 A;  4MYU A;  3NGS A;  1RT2 B;  4UY8 5;  3H40 A;  3QSY B;  2H4W B;  3L95 X;  4DSF A;  3PG9 A;  4Y3C A;  1IBL F;  2NXJ A;  3N5F A;  2KL8 A;  1MU2 B;  1QJH A;  2AU0 A;  1FX4 A;  3ZTR A;  3GSI A;  4H4O B;  1QSY A;  3FMB A;  4MKY A;  3DOK B;  2DXE A;  3WBZ A;  1EET B;  4Q0B B;  2D3Z A;  1RT2 A;  3LAL A;  4YQW A;  1WHY A;  1RT1 B;  4NLU A;  1HBO B;  4KR0 B;  1HIY A;  1Y3J A;  2B6A B;  4LQ3 A;  3D9B A;  4G1Q A;  4KGZ B;  4FXV A;  1R8H A;  3F44 A;  5CQG A;  5LMN J;  2LLZ A;  3DOK A;  3BQ1 A;  2EPI A;  1PIL A;  1HNX F;  3N5B A;  5GAG I;  4W90 B;  4X4U A;  2B6A A;  2YH1 A;  3PFE A;  1HKA A;  1NDC A;  1RCX B;  5T14 A;  2VPW B;  2MXY A;  5F0W A;  1D8Z A;  2DCU B;  2DO4 A;  3KWM A;  5B0B A;  1AA1 B;  4B17 A;  2FHO B;  3U7J A;  4PG7 A;  3HI9 A;  4DFP A;  4FBT A;  2UVW A;  3NS5 A;  1S4F A;  3HFZ B;  3TUZ C;  3PX4 A;  2BE2 A;  1SC4 B;  2Z58 B;  4FF3 A;  2C3U A;  3OTE A;  3F73 A;  1PAE X;  4OV1 A;  3NXZ A;  4AUK A;  3AJ1 A;  4Q5V A;  5ETN A;  4DN9 A;  1FER A;  3UNG C;  2AYG A;  3MOZ A;  3OLB A;  1G3O A;  3BR9 A;  1KFS A;  2VHG A;  4C9D A;  1X4D A;  4GO5 X;  1SIZ A;  5A8K B;  3L3C A;  3M30 A;  3PRB A;  1NKC A;  2EFV A;  3KLE A;  3BGL A;  3L7P A;  2GFF A;  3K5P A;  1DFD A;  4K2J A;  4F3O A;  5CYJ A;  2DKO B;  4QU7 A;  4TU8 A;  2OEK A;  3KK1 A;  3I0S B;  1NJX A;  3SDE A;  4PKD B;  3G86 A;  5GAE U;  2VBZ A;  2AJ2 A;  3PDN A;  3LP2 B;  3C14 B;  2NZC A;  2JEJ A;  2CRL A;  2FY8 A;  4QIV A;  1MN9 A;  3W3S A;  1NDL A;  4ZPA A;  4ZCI A;  1FDB A;  1OMS A;  1FJ7 A;  3CJ3 A;  5GMK a;  2LQ9 A;  3RW7 A;  4O44 B;  4DPO A;  2PC6 A;  2NUH A;  1HQE A;  3J80 U;  2AGQ A;  4FS2 A;  1U4B A;  5IQ6 A;  1D09 B;  3QT8 A;  2M8H A;  5F41 A;  3HT3 A;  3CNQ P;  3P3D A;  3M2R B;  4IO9 Q;  1NCL A;  3S01 A;  1X5T A;  3DOL A;  3LAN A;  4P75 A;  5KFN A;  3CSK A;  4LSN B;  2M4M A;  2P6T A;  2HKE A;  3TO8 A;  4RBV A;  1Y9O A;  4PQU B;  3OTB A;  3VGS A;  2DH8 A;  3NCQ A;  1SKW A;  4KH0 B;  5LXR A;  2B8Q A;  2W25 A;  1F3F A;  1QE1 A;  4LF4 F;  3G8Q A;  4RL1 A;  3VAJ A;  3LGN A;  1HNW F;  2J0W A;  3FRY A;  4OL8 A;  5GAG U;  3UVJ A;  4B3S J;  3JYT A;  4BC7 A;  1NLK L;  2ZHA A;  3ITH B;  2C22 A;  5A6P A;  4JB8 B;  1V5I B;  2O3D A;  1KTQ A;  1TKD A;  2D9O A;  5KG5 A;  1Z2Z A;  4ZPW R;  3MEE B;  1N5Y A;  4X64 F;  2IYI A;  3NOC A;  3HM9 A;  5ETM A;  2FVC A;  2G0I A;  5ETR A;  2DIT A;  3HHD A;  3EGV A;  1T05 A;  1H2V Z;  5E0O A;  4PG8 A;  3ITH A;  2JDJ A;  2HHU A;  2JVO A;  2ZWP A;  3D1Q A;  4F3Q A;  2N3L A;  4RLE A;  4HVZ A;  5KFO A;  4EWT A;  1I94 F;  1FNM A;  3CJQ A;  5D4N A;  3B4M A;  1NK4 A;  3V4I B;  1FKO A;  1U1N A;  3SSS A;  1GAO A;  2B7C B;  2R2U A;  3R1H A;  1SJQ A;  3R9L A;  3HFV A;  3C15 B;  3T41 A;  3U02 A;  4R0J A;  2B3T B;  1IJE B;  1S77 D;  4MK8 A;  3OR2 B;  2YNH A;  2FZC B;  1ZTW A;  2KB2 A;  4NCA A;  5EUH A;  2ASD A;  1VRU B;  2XGP A;  1PIE A;  2CQ4 A;  2V8P A;  2CPD A;  1V3R A;  4ATN A;  1E6Y A;  1JLE A;  1U1R A;  1S9E B;  4YHH J;  3CCT A;  1ZS6 A;  2E29 A;  4YB1 P;  3PO4 A;  2RKI A;  4F4K A;  2VU5 A;  1F6T A;  3TX0 A;  4YB5 A;  5KFZ A;  3VAL A;  1S6Q B;  4KGK A;  1RIS A;  3FEY B;  3W9J A;  4M5M A;  4ZVT B;  2YNI A;  2MZR A;  2VQE J;  2HNZ A;  3NEK A;  2E5I A;  4CRJ A;  2VJV A;  2DGS A;  2W4C A;  3P45 B;  2OSR A;  3QZ7 A;  1VS3 A;  1RAA B;  1QY7 A;  4K4X A;  1X4A A;  2BM1 A;  1UJ5 A;  2HS3 A;  4JI6 J;  1TV6 B;  1WI6 A;  4JOU A;  2J9D A;  3CCR S;  3SQG B;  4KHM A;  2Y1J A;  1FVQ A;  1RXO B;  4CYU B;  5KG0 A;  3DRP B;  3QGG A;  2AJF E;  4H54 A;  2W1B A;  2DJW A;  4MT1 A;  3FZ2 A;  2XNQ A;  3Q8V A;  3W1Y C;  5D0R A;  4I56 A;  1MNE A;  4TU7 A;  3PM9 A;  1PJ7 A;  1K9M T;  1T9V A;  4ZOS A;  4U6P A;  2RDD A;  2EBG A;  4DV7 J;  3G6Y A;  1Y5L B;  3R7N B;  2XWX A;  2M0G B;  3IP0 A;  1BQN B;  1WUU A;  4C8K A;  2OGU A;  1YX2 A;  3BF4 A;  1NND A;  3DRP A;  4ZHR B;  2HFZ A;  4DZD A;  4LRF A;  1Q7Y T;  3AB2 B;  2CG8 A;  2V8V A;  5KFS A;  1LW0 A;  1KQF B;  4C97 A;  2GHW A;  3TAM B;  2ALY B;  3DU5 A;  1U8S A;  4U96 A;  4G65 A;  3QO9 A;  4LR8 A;  2E44 A;  1RHU B;  4DSI A;  3W5Z A;  1HBN A;  1R6Y A;  3UI3 A;  2CPH A;  1AFJ A;  1NAQ A;  3FBB A;  1CUL B;  3CUL A;  3NWR A;  5KFM A;  1UFK A;  3D3B J;  3TEH B;  5HVH A;  1B0P A;  4Y6I A;  4KHP F;  2PD1 A;  4ES1 A;  2UU9 F;  3E2E A;  3PTW A;  2G2Z A;  2RRN A;  4IG3 B;  5D15 A;  1RLC L;  5BYS A;  4F2R A;  9ATC B;  4L3K A;  2R8K A;  5IC6 B;  1AFI A;  2B5J A;  1S72 S;  2LA6 A;  5KFP A;  1NU4 A;  1NK8 A;  4CCH A;  3CO0 P;  3V2U C;  1TUV A;  3M2V B;  4NI2 B;  3G6X A;  2XMK A;  5EX3 A;  3HHK A;  5J2N A;  4RZR A;  2XZW A;  1N54 B;  5L39 A;  2H9Z A;  1UVM A;  1GXT A;  2ZZT A;  2GQ2 A;  3HKZ D;  2DRB A;  2VDH A;  2YTC A;  3NAI A;  1XMO F;  2UUB F;  1YKW A;  4JP8 A;  2YPY A;  2BMB A;  4U95 A;  4WFN Q;  2GAG C;  1IBC B;  1TR0 A;  1A9N B;  3R27 A;  4USK A;  4NCG B;  2OD6 A;  4O3S A;  1HAR A;  3W9H A;  2NS1 B;  4P10 A;  3HHL B;  1WHV A;  5HK4 A;  3GFH A;  1X4E A;  4URS A;  2DNM A;  3D68 A;  3SFU A;  3K5O A;  2CVI A;  3DCA A;  3WDO A;  1WDT A;  2ZH3 A;  4A46 A;  3G8S A;  3M1V A;  2V68 A;  5F8N A;  4NLQ A;  1REG X;  1Q5Y A;  3CED A;  2M70 A;  1RTJ B;  2QO3 A;  4XK8 C;  5EWG A;  1HNV A;  1SI9 A;  1KBR A;  2KT3 A;  3CC4 S;  4Y2A A;  5L46 A;  2G2Y A;  4N8N A;  4W92 B;  3HXM A;  4XIU A;  2WSF C;  3NGD A;  1C1C B;  3GSD A;  2FUG 9;  2WB1 D;  4JBC A;  5IZH A;  2AQ4 A;  1O8B A;  1CBK A;  5CYM B;  3UD3 P;  1ZOT A;  2LXU A;  1CLF A;  2QV6 A;  4C3K A;  2Z2L A;  2ILY A;  3D6H B;  3UNY A;  4UOG A;  1HI1 A;  1R43 A;  2DXF A;  2XZD B;  3JSR A;  4RUH A;  4R8U A;  2HPU A;  1CJV B;  2FHJ A;  2XMM A;  2V9W A;  2COL A;  1QAI A;  2MMY A;  3QZ8 A;  2OUG A;  1CEZ A;  1C0T B;  1TKX A;  5D0G A;  4J9M A;  1IKV B;  3EYZ A;  4DL6 A;  4KKO A;  1S99 A;  2GIF A;  2VG6 B;  4WJB A;  2OI2 A;  3OD2 A;  4BWJ A;  2ZJR Q;  1XK8 A;  4ED4 A;  2UUA F;  3GE9 A;  2IM0 A;  3MM9 B;  4IOC Q;  4EO6 A;  1CJV A;  2BRK A;  1KR4 A;  4BBY A;  2DRA A;  3E01 B;  1TK0 A;  4U67 Q;  3QRR A;  2D7S A;  1YDL A;  2VA3 A;  2H5E A;  3CJ5 A;  1HBM A;  4YDD B;  4NOH A;  5F3Z A;  4Q44 A;  2LU1 A;  5ETV A;  2YKM B;  4PEO A;  1NH7 A;  2O01 C;  4QW8 A;  1L3V A;  3ZTP A;  1UAW A;  3R5G A;  1WOS A;  1VYA A;  3I4H X;  4MKV A;  2QEX S;  1U09 A;  3LQV A;  4OYP A;  2NYI A;  1JKH A;  4ZCK A;  4TLQ A;  1SL2 A;  2HYI B;  2PMZ D;  2KYZ A;  2OPR A;  4EMD A;  3KHH A;  4OZL A;  4DV6 F;  2CZV C;  4CDI A;  1NSA A;  2ZKT A;  1U0S A;  3GCX P;  3K17 A;  2PA8 D;  4KGV B;  5DLF A;  3W5X A;  4F4Y A;  1H7W A;  1UVK A;  1UVL A;  5IT0 A;  4DXL A;  4U7U D;  2BVZ A;  5C5J A;  3IRX A;  4MAK A;  3OTC A;  4DSL A;  5HRO B;  4DL5 A;  4B9S A;  3V6K A;  5B0A A;  1X0F A;  4RPF A;  2P6S A;  3GIK A;  2XY6 A;  2AZ1 A;  3MR3 A;  4NXN J;  4LIW A;  1Q53 A;  1FRX A;  2IRU A;  2G13 A;  3KG0 A;  4YB6 A;  2CDR B;  3AH6 A;  1S10 A;  1WDD A;  4PWW A;  5K14 A;  2QA4 S;  3G82 A;  1B0T A;  2HHV A;  1T9T A;  4ZVF A;  1JWW A;  2H1Y A;  3C6U A;  3C46 A;  1S1T A;  1WWH A;  1W2I A;  1EJ7 L;  2MTL A;  3NG8 A;  4M5D B;  3ULH A;  2Q1L A;  3R2C J;  4GKK F;  1RBL A;  2CQP A;  3GJR B;  2LA4 A;  3C16 A;  1G2E A;  3MEC B;  4FZV A;  4DV3 F;  1J2V A;  5IQQ A;  5BR8 F;  3RYL A;  4IG0 A;  3PV8 A;  2ROG A;  3BGO P;  2KXH A;  3EE3 A;  4ANC A;  1IKY B;  1U7L A;  3JSB A;  4PUO A;  1RAO A;  5J2M A;  2ZM6 J;  4NX9 A;  3H5Y A;  4B3R J;  2ILZ A;  5LMU J;  1NZA A;  2BV3 A;  3H7H B;  4LF5 F;  2HFS A;  3B6B A;  2L9N A;  1HHQ A;  3W7B A;  4ZP9 A;  2VOO A;  2KVI A;  2XSJ A;  3UDL A;  3W2V A;  2XNR A;  2UXD J;  1X5P A;  2OKQ A;  4Q8F A;  2FB0 A;  1WAC A;  2IFX A;  4Y0F A;  1KON A;  2Z2Z A;  2K06 A;  3FSX A;  2HBZ B;  4U7C A;  2DNN A;  1WKL A;  4LFB J;  4KGX B;  5J1P A;  1RCO B;  3V5R A;  3W62 A;  2DHS A;  2XMT A;  1MN7 A;  4C8M A;  3BPS P;  3MEK A;  1ZAW A;  3K8V A;  3SCK E;  3OFF A;  3DRR B;  1CC8 A;  3RB0 A;  3Q86 A;  3CDE A;  2JLG A;  1DQ9 A;  1OPZ A;  1T0T V;  4R25 A;  4H4M A;  4A8O A;  4IH5 A;  5AXL A;  3MM7 A;  3I9V 9;  4CNZ A;  3GYG A;  2R7U A;  1JXE A;  4ZIT A;  4K5S A;  4ERD A;  2Z8Q A;  3GON A;  2VBX A;  1UTA A;  2UP1 A;  2P2C B;  3QRQ A;  2YKN B;  5IC4 B;  1VBX A;  3CCZ A;  1BWE A;  3B82 A;  2GGP B;  3DFE A;  4FF1 A;  8ATC B;  5AE2 A;  1RE1 B;  3QJJ A;  4JI8 F;  1OQ6 A;  4IKA A;  1L3S A;  3FEZ A;  2A6O A;  3ENQ A;  2W2Q P;  3CCV S;  1UW9 A;  3A8J A;  3J7Y I;  2ROP A;  2L9D A;  1X7V A;  4B3T F;  3N79 A;  2ZUG A;  4OYI A;  3R8Y A;  4BLG A;  2MKH A;  5F8G A;  3OQ2 A;  2EEY A;  2BE7 D;  1YZ6 A;  3BB5 A;  2P5V A;  1IBK F;  4KPC A;  2OTL S;  4QIF A;  2GC8 A;  3TOQ A;  2R7W A;  1X9W A;  5L1K A;  1V9O A;  4K4V A;  4RW7 B;  1RAD B;  3IBF B;  1DY3 A;  3CCW A;  4EBD A;  4H4K A;  3GLJ A;  5KFW A;  3BO3 A;  4QIG A;  1FHT A;  4QOT A;  5K9F A;  2GVZ A;  3LOU A;  3H2L A;  1R8P A;  1NBE B;  1SV5 A;  4F25 A;  1TU0 B;  4TU9 A;  2BJ1 A;  1OQ3 A;  3PRV A;  2M5Y A;  2DGX A;  2DNG A;  3AAW B;  1P1T A;  2DR9 A;  2QT7 A;  3DGP B;  2QMW A;  4G3I A;  5C25 A;  4LBH A;  1SVD A;  4Y34 A;  4ELT A;  3N6M A;  3FMW A;  2W24 A;  3HKW A;  3UR0 A;  5E41 A;  3OV7 A;  4ED0 A;  5M2U A;  5GAD I;  4ZVG A;  3UQS A;  3A3P B;  4LF9 J;  1Q4R A;  3R6G B;  2LKZ A;  4WFZ A;  4B9L A;  1HW9 A;  4RKU C;  4YY3 F;  3ZFV A;  4A8S A;  4P2S A;  4ZMM A;  5CAB A;  3SZ2 A;  3JQM A;  2CJ9 A;  3TRG A;  3BEG B;  4H4K C;  2HVD A;  2XTJ P;  4BC9 A;  1QSS A;  1S1X A;  3KFW X;  1KVJ A;  2HNY B;  1VQ5 S;  3W8P A;  3LP1 B;  1N52 B;  2CQG A;  1Q5V A;  1LWF B;  3H59 A;  2PEB A;  3T1H J;  3TYT A;  2Q43 A;  1S1U A;  5KFG A;  1S49 A;  3UCG A;  1JLF B;  1MWZ A;  3BV8 A;  4IQM A;  3GQC A;  2XS5 A;  4UOH A;  2IC3 B;  1GTE A;  4CNY A;  1UWA A;  2YY3 A;  2X1F A;  1VLO A;  4LFA F;  1XNR F;  3W65 A;  2HQC A;  4CO1 A;  4QQB A;  4ZCL A;  4UOF A;  3LPE A;  4RWX A;  3LP1 A;  4DV2 J;  2HWH A;  1N32 F;  1LWF A;  3V81 B;  4D3H A;  1N4L A;  3PR5 B;  4DR6 F;  4ZPD A;  4ICL A;  2W9C B;  5EWF A;  8AT1 B;  1RAE B;  1VQY A;  2IC3 A;  3IGN A;  4ZIV A;  1TKZ A;  2NPI A;  1S1W A;  1K0T A;  3WC2 A;  3OL8 A;  4LMZ A;  2PN6 A;  4DX7 A;  1JLB A;  4FF2 A;  3PFO A;  3J7Y U;  1WEL A;  5I3P A;  3QT7 A;  4M5K A;  2HRY A;  2BRL A;  1VRT A;  4ZVP B;  4WFX A;  3MAQ A;  4HAC B;  4DR4 J;  2D3O 1;  1Q95 G;  1LWX A;  3POT A;  3OTO J;  1ZM4 A;  4C2M A;  3CD7 A;  1MW7 A;  4DV5 F;  1F9F A;  1SL1 A;  1RU2 A;  4LVO P;  2IDE A;  5JVH Q;  2VQF J;  1QVG R;  4NLY A;  4O3R A;  4CM2 A;  3KOA A;  2MHN A;  1WJ9 A;  4FBU A;  2RQ4 A;  5KFL A;  2HUR A;  1FE0 A;  3MM6 B;  4HTJ A;  2DO0 A;  2DRD A;  1EX8 A;  1TQL A;  2UVR A;  2MQP A;  2A1B A;  2ZD1 B;  5EHH A;  2RNE A;  2V63 A;  4Y2C A;  1F5A A;  2D9P A;  2W2N P;  1DTT B;  3LGH A;  3UD5 A;  3I5C A;  4PCQ A;  4ECS A;  1VQS A;  2IYG A;  3TQE A;  1HBU B;  2A10 A;  4ZA1 A;  3MM6 A;  3SI8 A;  2RRA A;  1J5O B;  4ZVO B;  3H90 A;  4NML A;  4JI2 J;  1H7X A;  1PYS B;  1KOH A;  1DJ0 A;  3QT6 A;  1FK9 B;  4TQR A;  1K1S A;  5GAD U;  3EPI A;  4ZVS B;  3EGW B;  1DQ8 A;  3DGV A;  4CLF A;  1SPB P;  2ZFH A;  2AYM A;  4EK2 A;  2QA4 G;  1RAB B;  1S48 A;  4L6V 3;  1YHQ S;  1J5O A;  2NSB A;  1REV B;  3QJL A;  2GML A;  2MY8 A;  1HMV A;  1ACM B;  4IFV A;  2NSC A;  4CQ1 A;  1FK9 A;  1AXQ A;  1F1B B;  2KU7 A;  2XY7 A;  2NR0 A;  2IAJ B;  5CCM A;  4DF4 A;  3D5M A;  1GT8 A;  2J5A A;  4L72 B;  3KHL A;  5J2Q B;  3K57 A;  2W8L A;  1WTF A;  4RW9 B;  4OZ2 A;  2E7V A;  2QFJ A;  1CSJ A;  1DUR A;  5C42 B;  3TVK A;  1TAQ A;  1CS4 A;  5CD4 H;  2ZC3 A;  1RWV B;  3QYY A;  1GMU A;  3TJ8 A;  1T02 A;  4FDF A;  1RT7 A;  1Q79 A;  1EP4 B;  1Q81 T;  4DUY F;  4OX8 A;  2FLP A;  2Y0S D;  2RE1 A;  2YNG B;  4HH1 A;  1IBM J;  1FWL A;  5SUH A;  1H72 C;  4ECW A;  1NHV A;  2KZZ A;  2DNZ A;  2OP5 A;  2JVR A;  1E6V B;  1U2F A;  1UET A;  1NDK A;  4ZP8 A;  3T5L A;  4CLS A;  1L3T A;  5D4P A;  2OMO A;  4DV4 F;  4UQG A;  4LF4 J;  1JLG B;  1HYS A;  2QZ8 A;  5CA5 A;  1GX6 A;  2X1A A;  2V4R A;  1C0U B;  4PYA A;  4PPZ A;  4A48 A;  1RDR A;  2ASY A;  4ITS A;  3VAK A;  2D1C A;  4E0D A;  2IPO B;  1QLN A;  1TEL A;  4ZP6 A;  5D0E A;  1TKT A;  2OEJ A;  2HHX A;  4ID5 B;  1D9A A;  5CD4 A;  3PW5 A;  3IWN C;  4CTA B;  2L3M A;  4XDC A;  4ECR A;  2D3O R;  3K89 A;  3NAH A;  4PAA A;  4HYK A;  2B9E A;  2VAS A;  5CYQ B;  1NK6 A;  2E5J A;  3BGR A;  4A8M P;  3M6W A;  2E1P A;  5DLG A;  2AGO A;  4WZM A;  4NL5 A;  4DF8 A;  4EZ9 A;  2KDO A;  2AWZ A;  1NSQ A;  1RWX B;  1Q82 T;  2EFN A;  2CDQ A;  3QIP A;  3EJM A;  2J0S D;  4I7F A;  1FFG B;  3DLL Q;  2K8G A;  1VCT A;  5CYQ A;  3K0J A;  3KK3 B;  3GR1 A;  5DZ7 A;  3CJK B;  2Z0G A;  5HQM A;  1GH8 A;  1XMQ F;  3EVW A;  4OLO A;  1J27 A;  4R5P B;  1W2B R;  3OFE A;  1IJF B;  4PPD A;  2KKH A;  2WON A;  1UWB A;  4GVL A;  4FF4 A;  2ZH2 A;  3KLG A;  2LQ5 A;  2CNO B;  1ZA2 B;  1KLN A;  4RX6 A;  5HL7 Q;  2LEP A;  3KHG A;  3TWZ A;  2IVF B;  2MPU A;  5BXI A;  3M2U A;  4MIB A;  2IBO A;  4J9V A;  4L74 A;  2CWX A;  4RUB A;  2VL1 A;  3QLH B;  1XQI A;  3DLG A;  3FCH A;  3FDS A;  4NLW A;  5HBM A;  1XNQ J;  4B3O A;  2L41 A;  4ID8 A;  3AD9 C;  4YUD A;  3OFG A;  4OJH A;  2ASJ A;  2BJE A;  3FSY A;  2IVY A;  3OR1 A;  2F4V J;  1SL0 A;  2BZ2 A;  3VHQ A;  4QWB A;  3GIL A;  3TR5 A;  1VC6 A;  1BQM A;  3AY0 A;  3T19 A;  2GO9 A;  2VUG A;  2VG5 A;  4M1K A;  2RU9 A;  1PC5 A;  2A2D A;  2IJN A;  1U2C A;  3PJX A;  2Y8Y A;  4F02 A;  2DNR A;  2MQO A;  4J9R A;  3G2X A;  3ENV A;  3R5D A;  1RBO B;  2MKJ A;  4DUZ J;  4DQP A;  2YNF B;  3V6D A;  1HD0 A;  4NE9 C;  2XS2 A;  2VFT A;  5AT1 B;  2C3M A;  4J9P A;  4DS4 A;  1N36 F;  1GMV A;  4ECT A;  1G1X A;  5EX0 A;  4M8L A;  1KOO A;  2VFV A;  2LCW A;  2CNL B;  3M8Q A;  2HK3 A;  4F2S A;  4TY8 B;  2XBP A;  1R8C A;  2QJ3 A;  5KFR A;  2DR5 A;  1VQ7 S;  4RUA A;  1P9Q C;  1S79 A;  1SC3 B;  3TI0 A;  1KHV A;  2XMW A;  2E7X A;  5JJB A;  3EXY A;  3P5B P;  5A8W A;  3KUG A;  3ZZY A;  1RTD B;  3UWT A;  3NNH A;  4OHY A;  1XJW B;  1QD1 A;  2ACY A;  2H4Y B;  5D3G A;  4ILM A;  4CLZ A;  4WKR A;  4F0K A;  5DZ6 A;  2WW8 A;  2CAD A;  3D6M B;  2BBE A;  2HAI A;  2Z56 B;  1IQT A;  2MKK A;  3HCX A;  2BJD A;  2XYP B;  1Y5N B;  1YIJ S;  1DBD A;  4NA2 A;  4OI1 A;  4EBE A;  3KLI B;  4A8F A;  3QSI A;  2QLB B;  2MJU A;  2ZH6 A;  4YR0 A;  2I9S A;  1WC4 A;  5F8I A;  4JI7 F;  4M5I A;  2CXE A;  3NGR A;  1R27 B;  3O5T B;  1P9Y A;  3TZZ A;  2HFO A;  2GO8 A;  3MCS A;  3JSM A;  4CO0 A;  1FCA A;  3MOJ B;  5JVG Q;  3FNN A;  2CKW A;  2QA1 A;  2ZOM A;  5KFY A;  1HWU A;  1TL1 A;  4YB7 A;  4OX9 J;  2OO4 A;  1MRO B;  4RR5 A;  4OJ3 A;  4OI6 A;  4IDK A;  1KRP A;  3MR6 A;  3IR7 B;  1T9X A;  4ANE A;  1LWC A;  1XBW A;  2KT5 A;  1FTC A;  3QQC D;  3MM5 A;  1PBU A;  4TVA B;  2ADB A;  1T3N A;  1GXU A;  3MPD A;  2JH3 A;  2F8H A;  2CIM A;  4WXW A;  2LQ8 A;  3KLV A;  3N01 A;  4Y28 C;  4WF9 Q;  2G1D A;  1MRO A;  2XS7 A;  1WKJ A;  1KLM A;  3CJ8 A;  5K8M A;  3UDV A;  1RT3 A;  1J5E J;  1RGV A;  1ULR A;  3NNA A;  1WC3 A;  1RHJ B;  2XCA A;  1NME B;  5SZT A;  4K59 A;  4CLP A;  2KJW A;  1PYT A;  3CC2 S;  3BS9 A;  4WTY A;  5I3Q A;  3OL6 A;  5F3T A;  3OUY A;  2KYX A;  1U48 A;  4KY3 A;  1GQE A;  2CPJ A;  1IQZ A;  4K0K F;  4ZN3 A;  2UXB F;  1YBU A;  4I2P A;  1CJK A;  1EQM A;  4X66 J;  1HNI A;  3R7S B;  4LRB A;  2KJV A;  3CF5 Q;  5LSO A;  2CPX A;  2QLJ B;  4ECX A;  4RW8 A;  2PE8 A;  3T6J A;  3LUY A;  3M9N B;  1R0A A;  1HNZ F;  2GVD A;  3Q8S B;  2R2S A;  2I5J B;  2E1A A;  2H5J B;  2HBQ B;  1IKX A;  4C0O C;  2GMJ A;  1OSC A;  3PYD A;  4NXM F;  4TQS A;  5KFA A;  1JLA A;  4WP9 A;  2HRU A;  3H20 A;  2R2T A;  5M2P A;  4JI0 F;  2ZKU A;  2OPP A;  4USM A;  3TZY A;  1NUE A;  2BR0 A;  4LQ9 A;  2H54 B;  2I5J A;  2NCK L;  2HND A;  1TUG B;  4DR3 J;  3ZZO A;  4KO0 A;  2KFY A;  3J81 j;  1YJV A;  3MMJ A;  3ELH A;  4HL9 A;  3PYG A;  4F7V A;  4USH A;  2QMU B;  2HZV A;  1SKS A;  2YX7 A;  4RO0 A;  1RTH A;  1CJU B;  5HJY A;  3CGI A;  2LEA A;  4AT1 B;  5E3C A;  3OW2 R;  2CJQ A;  3RBD A;  1S9F A;  3LW5 C;  3M8P A;  1WF1 A;  3I32 A;  4P72 A;  4I2Q A;  1GK8 A;  2VDI A;  4IYQ A;  2GNK A;  1FTR A;  5K8N A;  4WU2 A;  1FO1 A;  3MD3 A;  3CCM S;  3MMB A;  1N6Q B;  2KM8 B;  1NHU A;  5HP1 B;  4UUW A;  2W8K A;  3TUP A;  2CNK B;  4ED7 A;  4ZJO A;  2XHC A;  1Y3K A;  2YWE A;  3RUB L;  4LBI A;  5KG3 A;  2H65 B;  3A1Y G;  4KSE B;  4RJV A;  5I3U A;  3SEO A;  3EIC A;  2MLX A;  2NQP A;  1AB8 A;  3OSN A;  3NGT A;  1XEZ A;  2LFV A;  4OX7 A;  2J0Q D;  5AXK A;  1AZS A;  4LRE A;  2OML A;  2GW8 A;  2VG7 B;  4LF8 F;  3OJU A;  4LR7 A;  4JI5 J;  3DLJ A;  2PFF B;  4GVB A;  2ZHO A;  3HVA A;  3P4U B;  2UXC J;  3LO3 A;  4NEZ A;  5D78 A;  4QCL A;  2Q66 A;  4DL3 A;  3RBX A;  2FJX A;  5L1I A;  2HIQ A;  2SXL A;  3DLK B;  3MAA B;  2FC8 A;  2OPS B;  3HUL A;  1BC6 A;  1Q8L A;  3HZG A;  2R7S A;  5IM0 A;  1M5S A;  4QWD A;  4X4O A;  1RHR B;  1F5B A;  2YWK A;  3KYL A;  2ZVS A;  3KLH A;  5JXS A;  5K8O A;  3O3L A;  1N56 A;  3GZ7 A;  2YH0 A;  4NEY A;  2VPZ B;  4DL7 A;  4KV8 B;  3KK2 B;  3IG1 B;  2FD2 A;  2G1H A;  2JZ5 A;  4K4W A;  3D67 A;  2V69 A;  2HSE B;  4MMO A;  3H5X A;  3BYR A;  2R7X A;  1ITP A;  1LQ9 A;  4OYB A;  2V9K A;  4GRS A;  1RAJ A;  1VIO A;  4N47 A;  3EWG A;  3OVS A;  3IR5 B;  4MFB B;  1UZH A;  4DR2 J;  1T03 B;  4NLS A;  4LRD A;  2JEF A;  1XER A;  1JNR B;  4JI1 J;  5LJ3 Y;  2Y0B B;  2KTQ A;  2JLE A;  2V4J B;  4O4G B;  5DM6 Q;  5GAH I;  5G0R A;  4CLT A;  1FXL A;  3IFE A;  3HSD A;  1ZPW X;  1LKZ A;  3DRS B;  1N34 F;  1MWQ A;  2ZH5 A;  2CWK A;  3UCZ P;  4AE5 A;  3MR2 A;  2ZVI A;  2OAU A;  4B3M J;  5HN0 A;  1VRQ C;  1HQU B;  3JAM Y;  2DGT A;  2UVU A;  4M95 A;  3Q8Q B;  1IR2 A;  3MED A;  1EQ0 A;  1TL4 A;  1RB0 A;  4LF2 A;  3ZZU A;  4DZ6 A;  2BJ9 A;  3DOM B;  1KQG B;  1N5V A;  3ETM A;  4MIA A;  4LSL B;  2LXI A;  4LF6 J;  1OO0 B;  3CCL S;  1Y7P A;  3CJT A;  1N33 F;  2HWT A;  2DNY A;  1JLQ B;  4TYB A;  3CD6 S;  4ETX A;  3RZA A;  3HX9 A;  3T1Y J;  2JJ4 D;  2HGN A;  4NLR A;  3DHW C;  3PW2 A;  4OZ3 A;  5LJ5 Y;  3BSC A;  1CQM A;  2D3U A;  5DRK A;  1XC9 A;  2EG1 A;  2G9O A;  4J9S A;  1NZ8 A;  3P49 B;  1FDA A;  4ZLP A;  1N8R T;  4I6Y A;  2QLF B;  2FJB B;  5AXM A;  1TTH B;  2MDA A;  3FFI B;  2WRM A;  2GX8 A;  2W4P A;  2FLN A;  3DMJ A;  3JQK A;  1S4E A;  1OY6 A;  2KXN B;  3AJD A;  1TVR A;  4ZPB A;  2ZE2 B;  1M5V C;  3BH6 B;  1MSW D;  4EO8 A;  1S6P A;  5HJX A;  2C2O B;  1VJQ A;  1X4C A;  4ZCM A;  4B9N A;  3GFX A;  4LF7 J;  2PT0 A;  1HI8 A;  4ZPV R;  3BGF A;  1JJH A;  4MK7 A;  2AX0 A;  1TL3 B;  2KG0 A;  4OI0 A;  2DNO A;  5T7L B;  1UL3 A;  2ABY A;  4DDF A;  1SUQ A;  3FCV A;  1RYR A;  4A8Y A;  4YP3 A;  5EN1 A;  3SV3 A;  1LWE B;  5EGY A;  2DPJ A;  1QSL A;  1Y5I B;  3TUJ C;  1QUV A;  2UUC J;  3ZZT A;  2R7R A;  2QC3 A;  4A47 A;  3DM2 B;  2EBE A;  1UA1 A;  4YME A;  3I6P A;  1DTQ A;  1NO8 A;  2K7J A;  4OHX A;  2LMI A;  1U1K A;  2JFK A;  5A8R B;  2BKO A;  2JX2 A;  1WC0 A;  1LWE A;  1DQA A;  2GJ2 A;  3ZNU A;  5IS2 A;  3U1N A;  1CJT A;  1G7C B;  1LK7 A;  3CJS A;  3MCM A;  2OPQ A;  3DM2 A;  4WPA A;  1FJG F;  1WSV A;  3RB3 A;  3ILL A;  5DG9 A;  1S6U A;  4DPU A;  3IMQ J;  4OYO A;  1Y4Z B;  2VH7 A;  4WK3 A;  2X1G A;  3N4W A;  3NLC A;  3VGT A;  1LV5 A;  1UZD A;  2GHV C;  2YKA A;  1RHK B;  2YKO A;  3FK4 A;  5J1E A;  1RT6 B;  2BOP A;  4PG5 A;  2CJX B;  3D6T B;  1YJ9 S;  4ENO A;  3D7S B;  1U0H A;  3MUV P;  2K3K A;  6AT1 B;  3IA0 A;  3KG1 A;  1X4B A;  2A0F B;  2E1C A;  2FJW A;  5K5M A;  2HHT A;  2F8E X;  2BJ7 A;  5HO4 A;  2AD9 A;  3VF0 B;  1YIT S;  5F8J A;  1X60 A;  4KFB A;  1U1M A;  3O2I A;  3RGI A;  1UKU A;  2N3O A;  2CPF A;  5ETK A;  2JLF A;  3SCL E;  3I0R B;  4G1Q B;  2Z30 B;  3S7R A;  1VHI A;  3JTO A;  1SH2 A;  3MMC A;  1FD8 A;  2WSC C;  1FDN A;  3H4B A;  4KB7 A;  5D0H A;  1S1V A;  4X4T A;  3QJP A;  4M5J A;  4KPY A;  1M1G A;  4MKA A;  1S6O A;  2VFR A;  3CPW R;  2RJZ A;  1NRK A;  4B9U A;  3IS9 A;  1U02 A;  2XLJ A;  4J7C A;  3R5J B;  1TL5 A;  3I0R A;  5JUM A;  2O5D A;  4PWD A;  1OIA A;  2OLW A;  2P8I A;  3KHR A;  2VF3 A;  3TJA A;  2DGO A;  5GME A;  1U45 A;  1X9S A;  2N7Y A;  4CH0 S;  3H2U B;  2MZ1 A;  5KG7 A;  3D0H E;  4B3S F;  1FRI A;  4CO4 A;  2ZWO A;  3HSJ A;  3DYA A;  2BE2 B;  1YGY A;  5L1L A;  4O3N A;  2V34 A;  4HHJ A;  2XHW A;  1HA1 A;  3TAR A;  4IOB A;  3IWX A;  1WI8 A;  4N56 A;  1LXN A;  3MPW A;  1RP5 A;  4J37 A;  3S8S A;  2PSZ A;  1VOM A;  3JAM U;  3CVK A;  4X62 J;  2MQN A;  3HVW A;  3M30 B;  5I42 A;  4FN5 A;  3KLE B;  1LW2 A;  5KFF A;  1VBZ A;  1LK5 A;  1U1Q A;  2CQ0 A;  1U47 A;  1SH0 A;  2J9C A;  3UDE A;  2OSQ A;  4NAS A;  3R2D J;  1FRM A;  4JV5 J;  2YWH A;  4HTI A;  5LM7 E;  1TAU A;  1JQG A;  3KK1 B;  1U49 A;  1JLC A;  5L38 A;  5FDL A;  3P8B B;  1DLO A;  1RA7 A;  3MMA A;  3SDE B;  1I51 B;  4ES3 A;  3MGJ A;  4ED2 A;  2DGV A;  1FJC A;  4USV A;  3D66 A;  4AD6 A;  4HDH A;  1WEX A;  4JUZ A;  2ZUA A;  3UN2 A;  3RR8 A;  1S57 A;  2V8G A;  4FYW B;  3QMQ A;  2Q6C A;  4ZVE A;  1SJF A;  2GQC A;  5KFD A;  5LOQ A;  1SJ4 P;  2AT1 B;  1FRH A;  3OPK A;  5D4L A;  4ZLN A;  2V2Q A;  5DDR C;  3RRG A;  4I1T A;  1HWI A;  5KFJ A;  3CMQ A;  1M5H A;  4YHH F;  1HQE B;  4OYA A;  5J2P A;  7FDR A;  4RW4 A;  4ZP7 A;  1R0C B;  3CUN A;  3DOL B;  1MWY A;  1UJ6 A;  4LFC J;  2R3V A;  1N0V C;  4Q2M A;  3PCO B;  2U1A A;  3QT5 A;  2QSF A;  2DY9 A;  4M5G A;  4GKJ J;  2KRB A;  4Q2L A;  1ZAV A;  1D9D A;  2VQE F;  1KEK A;  1MMN A;  1H0H B;  1VQ4 S;  2QLX A;  2C28 A;  5DQG A;  5ETP A;  5CZV A;  1QE1 B;  3NBP A;  1FRL A;  4DV0 J;  1YRX A;  2M3D A;  2OD4 A;  4C11 A;  2CQ2 A;  1TUW A;  1L3K A;  4JI6 F;  3ZZ0 A;  3EVM A;  3W64 A;  5A6W A;  3GV7 B;  3UVJ B;  3JYT B;  1BXN A;  2ERR A;  3BKU A;  3MPY A;  3UN3 A;  3AHP A;  1Y00 A;  2AKW B;  1T9U A;  1HR0 J;  1TL7 A;  1N5Y B;  2E9Z A;  1H2U X;  3M05 A;  2B8P A;  2A2C A;  1P6T A;  5J1N A;  1U6Z A; 
#chains in the Genus database with same CATH homology
 1NDC A;  1PKU A;  5IOL A;  4C6A A;  1NHK L;  2B8Q A;  3FKB A;  3EVW A;  4DZ6 A;  3EE3 A;  4AND A;  1F3F A;  3L7U A;  3ENA A;  3NGS A;  4ANC A;  1XIQ A;  3JS9 A;  3VVT A;  1S5Z A;  1JXV A;  3EMT A;  4HR2 A;  4DI6 A;  1W7W A;  1NUE A;  3VGU A;  3PRV A;  2NCK L;  3ZTS A;  3ETM A;  1U8W A;  1UCN A;  3FBB A;  4UOH A;  2BEF A;  3VGT A;  2AZ3 A;  2HUR A;  3FC9 A;  4F36 A;  3EIC A;  2AZ1 A;  3FCW A;  3NGR A;  3BBF A;  2DY9 A;  3R9L A;  3G2X A;  3B6B A;  3NGT A;  4UOF A;  3VGV A;  1HHQ A;  3ELH A;  4DUT A;  3ZTR A;  2DXD A;  2HVE A;  3FCV A;  1NLK L;  5C7P A;  1B4S A;  3PJ9 A;  1MN9 A;  2DXE A;  5BXI A;  4ENO A;  1NSP A;  1NDL A;  3WX8 A;  3ZTQ A;  1PAE X;  1NDP A;  3GP9 A;  3Q8V A;  1BUX A;  1HIY A;  1NPK A;  2BX6 A;  1NSK L;  4ANE A;  3GPA A;  3ZTO A;  3Q89 A;  1WKL A;  3EVM A;  1B99 A;  3Q83 A;  3FBF A;  3EM1 A;  1XQI A;  3EVO A;  4F4A A;  1K44 A;  1ZS6 A;  2ZUA A;  3MPD A;  1HLW A;  2DYA A;  3DKD A;  1NSQ A;  5CAB A;  1EHW A;  1S57 A;  3Q8Y A;  2VU5 A;  1F6T A;  4KPC A;  3FBC A;  1MN7 A;  4WBF A;  3VVU A;  1WKK A;  3BH7 B;  3EJM A;  4O0N A;  4FKY A;  2HVD A;  1BE4 A;  3ZTP A;  3FBE A;  4FKX A;  5CAA A;  1S59 A;  2CWK A;  1NCL A;  1VYA A;  3DDI A;  3B54 A;  3BBB A;  1KDN A;  1NDK A;  1NB2 A;  4UOG A;  1LEO A;  3Q86 A;  4S0M A;  2B8P A;  1LWX A;  1WKJ A;  3NGU A;  3BBC A;  3VGS A;  3Q8U A;  4EK2 A;  1BHN A;  2DXF A;  4CP5 A;  3BH6 B;  4W98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...