1NSKL

The crystal structure of a human nucleoside diphosphate kinase, nm23-h2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
151
Chain Sequence
b'MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The crystal structure of a human nucleoside diphosphate kinase, NM23-H2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase (po4 as acceptor)
total genus 43
structure length 151
sequence length 151
chains with identical sequence N, O, R, T, U
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1995-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nskL00
1PAEX 1NPKA 1W7WA 3B54A 3ETMA 3BBCA 2B8PA 3Q8YA 3JS9A 3NGSA 1NDPA 3FBCA 4W98A 3ENAA 4C6AA 1S59A 5CAAA 1BE4A 3Q86A 2HVDA 1PKUA 2DXFA 1NHKL 3FCWA 3VVUA 1HIYA 1NLKL 2NCKL 3ZTRA 4FKYA 3ZTPA 1BUXA 2DY9A 3ZTQA 3EVOA 5IOLA 1XQIA 1HLWA 1WKJA 2CWKA 3PJ9A 5BXIA 4FKXA 2BX6A 3VGSA 3ZTSA 3FC9A 4UOGA 3EICA 3PRVA 4WBFA 1NSPA 2DXDA 2HVEA 3EVMA 1K44A 3VGUA 3ELHA 2HURA 3EMTA 3NGTA 3MPDA 1LWXA 2BEFA 4S0MA 4ENOA 1VYAA 1B99A 3BH6B 2VU5A 1ZS6A 1NB2A 1F6TA 3DDIA 3EM1A 4HR2A 4KPCA 3NGUA 1MN7A 1B4SA 5C7PA 1HHQA 3EE3A 1KDNA 1UCNA 4O0NA 3WX8A 4F4AA 4DZ6A 3GPAA 3Q8VA 1WKKA 3BH7B 1S57A 3EJMA 4UOFA 4ANCA 1EHWA 1NCLA 5CABA 3R9LA 3L7UA 3BBBA 4F36A 1LEOA 3Q8UA 1NSKL 4ANDA 3Q89A 3FCVA 3FBEA 4ANEA 1XIQA 4DUTA 2AZ1A 2ZUAA 1MN9A 3B6BA 3BBFA 1BHNA 1NDKA 1NDCA 1WKLA 3GP9A 3FBFA 1NSQA 1F3FA 3FKBA 3G2XA 2B8QA 3VGVA 3VGTA 4EK2A 3ZTOA 2DYAA 2DXEA 1NDLA 3VVTA 4DI6A 1U8WA 3DKDA 4CP5A 3FBBA 3NGRA 3EVWA 1JXVA 2AZ3A 1NUEA 4UOHA 3Q83A 1S5ZA
chains in the Genus database with same CATH superfamily
2XGQA 2DVIA 1TL3A 1RWMB 2QL7B 3EGWB 3O8WA 2ZH5A 4H4OB 4R0EA 4OV6A 2VHGA 1RT1A 4ED6A 1DLOA 2WOMB 5KFZA 3F41A 2W24A 4C98A 1XR6A 3P96A 5LJ5Y 4JI0F 4CI0B 3PW2A 2XMJA 4KSEB 2XMMA 4ZCMA 1Q4RA 2ASLA 5L38A 3CUNA 2XZTB 1D8ZA 2UXBF 2QA4G 3UWTA 1S76D 2RKIB 3OR1A 1T05A 2PEBA 4RWXA 2RU3A 1IBKJ 4CLLA 2UVUA 4LFCJ 2LA4A 2MQQA 3AY0A 4M5KA 1RDRA 5A6WA 1Q7LB 2WVCA 3ZZYA 4MIWA 2HHHF 3IBFB 3BSNA 3CJRA 1B0PA 4ZJLA 4OHVA 1QJHA 2FUG9 4G6VB 2WSFC 3KHLA 4BWMA 3ULHA 3O3LA 4OI4A 4LQ9A 1H0HB 2DR7A 2GV1A 4QWBA 3J7ZT 4RUHA 4B3SF 2E66A 2I5JA 2JEIA 2Z4PA 4X4NA 1UZDA 4NCBA 2NS1B 3IFEA 3AJ2A 5AXLA 1FTCA 5KFMA 5KG6A 1YK9A 1RHKB 3W9JA 4KJIA 2PGCA 4RUBA 4XTTA 2Z57B 3GZ7A 1J5OA 2GHWA 2OPRB 4L6V3 4X84A 1DTTB 3DN9A 3AH6A 3SEOA 5AJ3F 1CSJA 1BQXA 2UZAA 1RT6A 3KJFB 3TUIC 2CZ9A 2F65A 4QR2A 2AEJA 4W90B 4HHHA 2IVFB 3HK2A 2DEJA 3P45B 3CPWR 2FQQB 2KG1A 4USKA 3OXGA 2JFDA 5IS2A 4USMA 2Q43A 4JI0J 3G8SA 1TKTB 3N0VA 4JOUA 3VTIA 1PBAA 1SJRA 2FD2A 4DXLA 2CQHA 2GIRA 2ZZTA 3OD2A 2A3JA 3I5AA 4AT1B 3NLCA 1YKWA 2MGZA 1VS3A 2MLYA 2HVIA 4NEZA 3W62A 3KLGA 3H42A 3J7Z5 4DSLA 5L8RC 5BYQA 2HHHJ 1TK5A 4DV1J 4NA2A 1IWAA 1UFKA 2QJ3A 2XNRA 4HT7A 2DNOA 2OHDA 1R3NA 1RAIB 1YJWS 4KHRA 2VV5A 4QWAA 3US5A 1AFIA 2ERRA 2YKNB 3QSIA 1JLEB 5SZTA 1R8AA 3V81A 1S99A 3PO5A 1NDCA 1WKLA 1IR1A 3HD1A 3N4WA 4Q2MA 2PSZA 4NLOA 2JZ5A 3MEDA 2H1YA 2HFUA 1BWVA 4CTAB 5HVHA 1W7WA 1X4FA 1RTDB 3J7YI 2PI5A 1NKEA 1B7FA 2ZBIA 2MKJA 4YR0A 4EO6A 3PYDA 1TKDA 1MMLA 5J2NA 5K14B 2NXJA 1WG1A 1HW8A 3H2UB 2YX1A 2V8VA 3VGUA 1KKHA 5DG8A 3NGTA 5GADI 2H3EB 4LFBF 2RB7A 4QW8A 4DSKA 3WIVA 3K17A 4ZP8A 1KDNA 1PIEA 2IVYA 4WE1A 3LP0A 1IR2A 2ASDA 3MEKA 2G4BA 3B8HA 3N6MA 1S6PA 3CDWA 3D54A 2BA9A 1D1UA 4B9UA 3PYEA 2YX7A 1RACB 3I9ZA 1EKRA 2C2MB 4FYDA 4ECYA 5BJRA 1KR4A 4CZCA 2OMOA 3MGJA 2MLZA 3DYAA 5GAGI 3CCSS 4F7VA 3H8YA 4DV7J 1U26A 3T9ZA 3M8PA 3HP6A 1JLCA 2OEJA 4BLGA 2WZ1A 2EW9A 2L41A 2W2MP 4KIAA 3SCJE 4J9NA 3R7BB 3QGIA 3SQGB 3MM5A 3JYTA 3TAQA 4H4MB 3VZHA 2BJEA 2LEAA 4FKXA 3IXQA 5MAOA 5LXRA 1JLFB 2EK6A 4ILLA 3POTB 4QWDA 1U4BA 2FGCA 5B09A 3FEXB 2MSTA 2GMJA 4KO0A 2UUBJ 2Y1IA 1ZTTA 1N4LA 3K8WA 5F41A 1IKWA 5L1JA 4OYMA 3TZWA 9ATCB 4EMDA 1FRMA 1Q86T 1REVA 3OUYB 1YLXA 4C97A 5KFDA 5A2QU 3IRWP 5B0AA 1NM2A 5J1EA 3PEJA 4P2XA 3UW1A 2FJXA 4MJKA 3W2VB 4DHVA 2KB2A 1NSQA 1RK8A 3FKBA 4Q7AA 2IY5B 1RWXB 4OJ3A 2H5JB 3QQCD 1KHWA 2ZD1A 5JVGQ 2DGSA 1U1PA 1UW9A 4DX7A 5A0YB 2N7YA 1IKXB 2JX2A 1N5YA 1GMWD 1WC6A 2NYIA 2YNGA 1Y5IB 1KQKA 4ZVFA 1WC0A 1HIYA 3TZZA 5LMNJ 1TFWA 1TUGB 3IAS9 3JTNA 2D3O1 2IM0A 2RF2B 1SKSA 1S1WA 1HI0P 4EO8A 1IM4A 3B4MA 2YVSA 5KFOA 1SQEA 1GXTA 3VAIA 3VAJA 2HAIA 3R6LB 1U1MA 5KFVA 1GH8A 2E5LF 3LALA 3UE2A 2VC0A 3D2WA 3Q8UA 3MUTP 1JJ4A 2MY7A 1F3VA 3N01A 2AYEA 4KV8B 4ZPAA 3KDNA 3TANA 2KFYA 1NDLA 2ZBPA 3EXYA 1GTHA 3UCUP 1J27A 4NLDA 2CPXA 4W92B 2Q6BA 1VRUB 3PXGa 3BBCA 4URQU 3G71S 1RU1A 4L74A 1DQ8A 2ZOFA 3TQ1A 3S01A 2OAUA 2V2VA 3LGHA 5G0RA 5L1LA 2NQPA 4YY3F 2ZH1A 3QIPB 5IT9Y 4KHPJ 2ADCA 3W3SA 5HI7A 2UVRA 2UXCJ 1KSPA 3BGRB 1C0UB 3EX7B 3WC0A 1RABB 5EX3A 2HQ3A 4I6YA 3OSNA 1N34F 1KHVA 3M2RB 5HLFA 5KFEA 3R6GB 1NXIA 5AXNA 4K4WA 3OTCA 2YKPA 1VC6A 1KONA 4M5IA 3ILOA 1HQEA 1RT5A 3C8YA 3M9OB 4DV3F 4ITSA 2KKHA 1RBLA 4X4QA 2K7KA 2B6AB 5CYQB 1JKHA 5T41A 3Q8PB 1SBRA 4MFBB 4F2SA 4DEZA 2A2DA 3ZTOA 1LWEB 2DXEA 1ZA1B 2VIHA 4N8NA 4F4KA 1NK0A 1X7VA 1UEVA 3M1VA 5I3UA 1X4GA 1URNA 4C3MA 1AZSA 2VQFJ 3GR0A 2E9ZA 2FVSA 3H25A 4DL5A 4ZVEA 2LVWA 3VV2B 2DGTA 4UQTA 1VQNS 1JLQB 4I56A 4RW4B 1X5TA 4ZPWR 5THWA 3P5TL 4FKYA 5CD4A 2F7VA 4DQSA 2Z2MA 4C48A 3G8QA 5ETNA 3TJAA 1C2PA 3JSMA 3LWMA 3OTEA 1BY9A 2Z58B 3DC2A 2QC3A 1FNXH 4HYKA 3GFYA 4FYWB 3I56S 4PEOA 4ED1A 2QL9B 2QT7A 4M5GA 1TK8A 3PCOB 4ZP7A 1Q95G 3DDNA 5C2GA 2VU5A 2OELA 3KLHA 2QA2A 2AX1A 1EETA 5IXUA 4PXBA 3A8JA 2M70A 1O0PA 4FXWA 2W7AA 2HFOA 3J81j 2AJ4A 3KG1A 5I3QA 1GMVA 1Q0NA 1UJ4A 1T02A 2QSWA 1T03B 3CMES 5FLXU 4YY3J 2BV3A 1D9DA 2R7SA 2J9CA 3KLIA 4ZLPA 2AX0A 2B9EA 1QDUB 4OJ1A 4NI2A 3ILIA 2MQLA 4C0BA 2V2KA 3TOQA 2XS5A 4HTJA 3C6TB 1VK8A 5KG1A 1SIZA 4GVLA 3CC4S 4MKVA 4I64A 5HN0A 1V5IB 3NY0A 2WRMA 3HVTA 2DH9A 2X1GA 4JV5J 1AXQA 3SCLE 2XEXA 2BEFA 5DETA 5HJXA 2CXEA 3BDPA 5LM7E 1FVSA 2BMBA 1HWUA 1S1TB 3D6TB 3KG0A 4JP8A 1YRUA 3I82A 3QFHA 1U0SA 1ZBTA 4OI0A 3FZ2A 1RYSA 4H54A 2HHWA 5L39A 3TA0A 1H38A 2UV8G 4NCAA 3HFVA 3ETOA 4ETZA 1LNQA 4DL6A 2VJUA 1U1OA 1S9GA 2DEIA 2NPFA 2DISA 5DZ7A 1PJ6A 4CRJA 2CNLB 2VC1A 3DRSB 7FD1A 3AB2B 1S0MA 1OPIA 4IRKA 4P72A 4AL5A 1MROA 4OHXA 1SIWB 3QSYB 2BJ8A 4ECWA 3PYGA 3UDEA 2CPEA 1Q1KA 3FCWA 3NWRA 2FLNA 1SH0A 2XMTA 3LGMA 1VISA 2XY6A 2EEYA 2BX6A 4WBFA 4XDCA 2WAQD 2HZCA 4CLTA 4D3HA 2BUNA 3NAHA 4DFMA 2VDHA 4NLUA 2YWWA 1ACMB 2VDIA 3BSAA 2V8PA 2OKQA 1PSDA 3D0HE 2OPQA 1VR6A 4PKDB 3TQEA 3H0PA 3PO4A 3C16B 2RUSA 2MQPA 1Q5YA 4V19X 4C8OA 3FSIA 2MKCA 5CXTA 1JWWA 4KQZA 1ZZNA 5CCMA 3BGLA 4MIAA 1EIYB 3KK3B 4X4SA 3KUHA 3KJVA 4DR6J 2J6SA 4KKOA 2VONA 3ZZZA 4NA3A 4PWDB 1WOOA 1RADB 5EWFA 2R4FA 3S8SA 5KOXA 2W1BA 1ROFA 1U1RA 5IOLA 2FZCB 3SFGA 3TI0A 4WP8A 2BBEA 5KFQA 4CYUB 1OQ3A 2YNFB 4OV1A 3R7SB 2YWFA 4DR2J 4KHMA 3QRRA 1HYSB 4KH0B 3HHNB 1JK9B 3CJSA 1H98A 2WVEA 1VIXA 3GCXP 4LIWA 1HNZJ 3T5HA 1YHQS 4WU3A 1HBUA 3IRXA 1R89A 1CS4B 2IA0A 4EEYA 3W64A 4YP3A 1M5HA 3KNAA 3K58A 4F3MA 2UV8A 2HEKA 4N76A 3OFFA 3B6BA 1KD1T 1N36F 3DFEA 1FK9B 3B78A 5GAHU 2BZ2A 2JWNA 2YNHB 2XBPA 5DLGA 3PIPQ 5DM6Q 2O67A 4U8VA 3MM8B 3NNCA 3CDAA 1X4CA 3DXBA 4UTGA 2AGQA 1JXVA 4DV2F 3Q83A 2ZVIA 4NYPA 1HNVB 3G9CA 3H5SA 2N4CA 1E6VB 1SB6A 3SSQA 1UMJA 4U95A 4J9UE 3RB6A 3PRBA 2NSBA 3C15B 4DN0A 4O23A 3PTWA 5C42A 4M95A 2FHJA 1QSLA 3UD4P 1SPBP 3AXMA 1CULB 3NWGA 1IKYA 1BQNA 4U6PA 3DOLB 2ROPA 4OHWA 3KLFA 2YKAA 2OPPA 4MT1A 4NEYA 1X5OA 3UFCX 4ZK7M 2QMUB 3Q8VA 3ENVA 2KM8B 2P2CB 1WORA 1JXEA 3A8EA 5L9XA 1K9MT 1ZM9A 1NHUA 2XZDB 1U49A 1S0NA 3KLVA 2DNHA 4DV5F 1SKWA 1QAJA 1WD6A 1UWAA 3DRPB 1WC3A 3TW0A 1IKVB 2C3YA 4K50A 4OI1A 4WTOB 4DR5F 3AOAA 4HKQA 4PAAA 2ZKTA 2U1AA 1RTJB 5BR8F 2OSQA 1YWXA 2DRDA 1T3NA 1NRKA 4YOEA 4LF9F 4WZMA 1S0VA 1I94F 2HHSA 4YR3A 2A6OA 2J6TA 4A8FA 1OSDA 1T9WA 5KT3A 2BYCA 2DGWA 3NMAA 3DLLQ 3CCWA 2XG8A 2CQ2A 1M1GA 5F9LA 4S0MA 3J81U 2CVEA 2CNKB 2VBXA 2BRLA 5M2UA 1YI2S 4X65F 2J0XA 3R5AA 4OHZA 1U6FA 1FI4A 4X64F 3SIPB 1RHJB 4H4OA 4OYZA 3S1TA 4BHQA 2WOMA 1WWHA 4LF6F 5F8JA 4P9SA 2A10A 2HWTA 1AA1B 1Q8LA 1HNXJ 2O66A 1Q8BA 4B02A 2CG4A 2XULA 3W61A 5HJYA 5DJBA 4ED4A 3IR5B 4C11A 2HHQA 2EBGA 1F9HA 3D3CJ 5DDQC 4LVNP 4F04B 5HROB 1IJFB 3VVUA 3PW0A 2V4JA 5L1IA 3OTDA 3MTKA 4U9RA 3MPYA 4L75A 4UY85 3MPUB 1RB0A 2DHXA 3D6FB 2ADBA 1K1QA 4ZIWA 1V3SA 2XS2A 3K57A 3KLEB 4J9PA 1B0TA 2IMWP 4FYYB 4PRFA 1FF2A 4K4VA 2GVDA 4DR5J 1YZ6A 2ZM6F 4DV0F 2VFUA 3BN7A 1JNZB 3ISND 3R9LA 2I1RA 3GIRA 4DR4J 2IM1A 4L76A 1RTIB 1OY8A 4U96A 3DRYA 3Q8QB 4USTA 4JI8J 4JI5F 3SI8A 3DLJA 3KJNB 2GQCA 2W9CB 3DKDA 1HMVB 2EWHA 3X1LB 2AEFA 2ZBCA 1ZM4A 1HWKA 5C25B 4Q43A 5K20B 1YJUA 2XYGB 3P4UB 1F1BB 3A4TA 3L95X 3ONQA 3FSYA 1Q5VA 2OPRA 2VPWB 4C3LA 1DTTA 5KG2A 4FF2A 1DBDA 4M5HA 4Y0FA 2CPFA 3BGOP 2LA6A 3GSIA 5F8GA 4IG0A 2GS8A 2ZC4A 4NCGB 4EUVA 4HHJA 4Y34A 2NREA 4Q8EA 3JQMA 4LRDA 4EZ9A 3EMTA 2C2EA 1XK8A 1J2VA 2JEFA 1H7XA 3QRPA 2BANB 2IDLA 4DCPB 3R5BA 2HK2A 1WHYA 2YWGA 2CQBA 3A8KA 3MM6A 3M6VA 1QE1B 4OMFG 3T6BA 3VAFA 4DV6F 3ZZPA 3T1HF 3FBEA 4DUZF 2AZ1A 1M5KC 2XSJB 4EK2A 3W66A 3QGHA 2UXDJ 4CP5A 2XLIA 1XMOF 2W8KA 3MXHP 1S97A 2LQ5A 2VKRA 4RW8A 3BO3A 4CWBA 4Z7YA 3W8PA 5GMDA 2ZHBA 3K5LA 4Y2AA 2YWEA 3KMSA 4C6AA 4CH1A 1JLEA 4OZ0A 4N5SA 1RISA 1XR7A 2K06A 2BQRA 1VQ5S 3H4BA 1U02A 2H5IB 3NCRA 2WBMA 4GMKA 3AAWB 4LF8F 1K44A 1DQ9A 3M8QA 4LQ3A 4QR1A 4JI2J 1T9YA 1QAYA 4ERDA 1IQZA 4CO3A 3TZXA 3PFOA 2HKEA 3GJTB 4ZHRB 3HO1A 1RT4B 3W2WB 1M1KT 2V8GA 1RTDA 4GKJJ 2JSXA 6AT1B 3FCVA 2ZE2B 4DUTA 5A6PA 3FQLA 5K14A 2ASYA 4JI1J 1MMNA 4CO4A 2Y9HA 2XLKA 1N33F 2E5IA 4MAKA 1ZYQA 4G65A 1YBTA 1S79A 2QFIA 3SQOP 3CJ2A 4V19J 4ZVOB 1WUUA 4ED2A 1FD8A 3D1HA 1RP5A 1SKUB 2LDIA 1VQ8S 3EVMA 4OJGA 4ZCKA 3R5DA 2HQCA 1SJ3P 1UJ6A 3KDOA 2DR8A 2XY5A 1UPMB 3RRKA 1KOOA 2P8IA 3M8WA 1XMOJ 3CC2S 2IM3A 1YZ7A 1EHWA 4J9LA 4LBHA 4R25A 2M4MA 4A4JA 2DGVA 3P8BB 1VQMS 3NOCA 4XIUA 2YWKA 4RBVA 3SQGA 4ES3A 4YB5A 4H4MA 3NCPA 2M9KA 4ID8A 1PC4A 3JAMU 5D0RA 3GJQB 3HHLD 3M30A 1JLFA 1VHIA 3TAMA 2MEWA 4K4ZA 4NRUA 4DR3F 3EDQB 2J8SA 3GIIA 1HQUB 3MZIA 1RLCL 3P6YC 4O3PA 2OIHA 1CQNA 1WC1A 4DSFA 4X4TA 3RW7A 4G1IA 2PD1A 1HHSA 1WI6A 1JLBB 3W2VA 3TYTA 4LF5J 1FRJA 3WZ0A 1GMWA 2ALYB 4B3TJ 1RT2B 3J7AN 1KQGB 3DCAA 2AGPA 2X1BA 4RW6A 4Y6IA 4KR0B 4LRCA 1G2EA 2JLGA 3OXLA 3OW2R 1RZMA 4ANCA 2BJ7A 5MLCV 1N33J 4Q0BB 2WSEC 4NZ6A 3ET6B 4ED0A 2QG9B 4ED7A 1RA7A 4KB7A 2JLFA 3H4DA 3VAMA 2BJ9A 3V6KA 8RUCA 1VQOS 1IN0A 1VBZA 3T19A 5ETVA 4I68A 2RF2A 3IM9A 4CO0A 2XHWA 1KRPA 3UD5A 3ISNC 4DCOB 1Z2ZA 2A18A 1WSRA 1YBUA 1DJ0A 2HRTA 3PX4A 2BOPA 3WC2A 3O5TB 1TTHB 5I3PA 3CCVS 3Q23A 1YX2A 5LMUF 3NOGA 1JQGA 2F8EX 5H1SV 5AE3A 2W7PA 1KVJA 2MHEA 3THPA 3CCJS 1XJWB 5DDPC 3O44A 2C28A 3HT3A 1M5PC 3MI7X 3MM7B 2GJ2A 1P9YA 2RQKA 3VCDA 3JQKA 5E3PA 3GV5B 1SKRA 3LPEA 1OWXA 3VF0B 1XNRF 3OFGA 1LWCB 5IZHA 1EP4A 2V0NA 4J9KA 5ETTA 1XR5A 2RILA 3QATA 5L1KA 2MZJA 4MKBA 4ECUA 3ZXWA 3RRGA 3QIPA 3OQ2A 2CYYA 4URSA 4N56A 2R2UA 2MZRA 1S4FA 2EG2A 3IG1B 2DITA 1Y9OA 1FKOB 1IBMF 2RDDA 2ZBRA 2KDOA 4DUYJ 4U7CA 1TZ0A 4NXNJ 4WIQA 1X5SA 4RKUC 4PUOA 3M2RA 1XNQF 3D9BA 3KMQA 2RRAA 4YN3B 3PM9A 5E3RA 3BSCA 4O3NA 2CADA 4DJBA 3NMRA 4ZVGA 2VG7A 1UVKA 5LJ3Y 3CXCR 2NLWA 1N88A 4K0KJ 4Y2MA 1LWEA 3C3LA 1ZS6A 2FY8A 1JLGA 1XEZA 1N56A 1K8AT 1WEZA 2PE8A 1GXUA 2BR0A 4WFNQ 1UCNA 2QIFA 4CH0S 1OYEA 4FN5A 1XC9A 4ZITA 1TV6B 1T9TA 1GXLA 3DGPA 1UTAA 4RW4A 4KGVB 4DMZA 1S9FA 2FTRA 1SC1B 3DHWC 2M88A 4OZ2A 1FFWB 4NASA 4G1QA 1X4HA 1RXOB 1P1LA 3E3XA 2B56A 1NEEA 4IR1A 3DGVA 2GJFA 1QSSA 2J76E 4CLSA 4DPWA 5C24A 3QZ8A 4F3QA 5J2PB 3QYYA 5B0DA 4CLPA 3JS9A 4C9DA 5BYRA 1FX2A 2CDRB 2H54B 4EWTA 4ZN1A 1CPZA 1LV5A 2FVRA 4P10A 1JMTA 1XNRJ 4GO5X 4P6QA 1NJZA 3HDSA 3JSBA 2XCPA 2W2NP 2FJDB 1APSA 3IC1A 3T41A 3LO3A 1BWEA 3TWZA 2DCUB 5F0UA 1HBNB 1N8RT 3MMAB 4ED5A 1A7GE 3TUJC 1RTZA 1NK4A 2VFTA 5M2RA 3V4IB 2IAJB 2XQCA 5D3GB 5ITHA 1S57A 3JTPA 1VLOA 2KH9A 1CC7A 1VMBA 1VIOA 3H7HB 2LEPA 1FERA 3CDUA 2DTJA 1AUSL 2F8HA 4CLZA 4JV0A 1G3OA 3DOMB 1RUSA 4YHHJ 2O1PA 3QO9B 5J2MB 3NP5A 3ETMA 4X4PA 1Y5LB 4CLKA 1U6BA 2GQ2A 3J80U 1S1TA 2VJVA 4OX8A 4DPYA 3HHLC 1RKJA 1NB7A 3VZIA 4ECTA 3KNGA 4HI1A 1VK3A 2UUCF 4MKYA 1VGYA 2M3DA 1YRTA 5C5JA 5G4DA 1R27B 5HQLA 3SFUA 4KBIA 1LXJA 4QW9A 7AT1B 3ILJA 4ETXA 1TL7B 4IDKB 3DRSA 3G6ES 3EE3A 4QBUA 4HH0A 4OYAA 4ZJQA 2JH3A 4ECRA 4U7UK 4PYDA 1B0VA 4FS2A 2DIVA 2KXNB 1D0EA 3BBFA 1W2BR 4O44A 1PYOB 2B8QA 3QFWA 4F3OA 3TARA 2E5HA 5IFMA 2LECA 3PR5B 5KT6A 2OD4A 3MFIA 5IQ6A 3OR2B 4WZQA 3MUMP 2V94A 3FCHA 2CVIA 4RU9A 5DQGA 2DO4A 4E2FB 4EFAC 5EHHA 4CLWA 4FF3A 1FDAA 3KK2A 2Y8WA 3ZTRA 4C8NA 1TR0A 3G82B 2CWKA 4AUKA 2R8GA 4IUFA 3PY8A 3SYZA 4ZPTR 5HBMA 3CT9A 2WB4A 5A8KA 3OJUA 3CIMA 1RAOA 4ICLB 2IJNA 4DQPA 5K8OA 3OPKA 3FDSA 2V4RA 1UKUA 2ROGA 3VAKA 3M6WA 4ZJOA 3RR7A 4AL6A 2R2TA 4C0OC 2RS2A 4HI2A 4PWDA 3AT1B 3FMWA 1F2HA 1HD1A 4DL2A 1ICEB 2QZ8A 2ZVSA 4JYAJ 3EGVA 3N6LA 2R7OA 4WIIA 2R7RA 4B9VA 2N3OA 4QWEA 4CYUA 4I67A 2YTCA 4RO0A 3BB5A 5EGYA 5HQMA 3LQVA 3TEGA 3EPGA 2VKZG 2CPHA 1RCXB 2RQMA 4IH5A 1NPKA 1SH2A 5DZ6A 4I2QA 4HDGA 1FJ7A 2VF3A 3CO9A 2W4PA 3QJJA 4CDIA 1NBEB 1VJQA 2HQDA 3LP1A 1NMEB 5KFHA 2DXFA 1N0VC 2MTLA 1D8YA 2CJYB 1TELA 2R9LA 1CS4A 1B64A 4X66F 3HHDA 1F0XA 1NAQA 2BOAA 3VGSA 2HBRB 5CYMB 1VDHA 1RCOB 4CLFA 2MQ8A 2RJZA 3K5PA 1WHVA 3C66A 2YNHA 4AL7A 4TU8A 2UUWA 3OTOJ 2ZFHA 4IO9Q 3MM8A 1F6TA 1TL4A 3TUPA 3HVWA 1RU2A 1IBCB 3H90A 2BKOA 4ZCIA 2HFZA 1E6VA 5IC4B 1LWFA 1EKSA 1RWWB 2PFDA 1QAIA 3RYLA 1RI7A 2I8EA 2EFQA 5D6GA 3C15A 1VRTB 3D28A 3DLKA 2FLLA 4JUZA 3DLHA 3N5BA 4ECXA 5IC6B 1G7CB 4QJVA 1TL1B 1U8WA 1WACA 3R8YA 1FKPB 3N5FA 2AF6A 5EDWA 4ELTA 4USWA 2AP6A 5U47A 2Q79A 4ZVUB 4W98A 5CH7B 3KK1A 1WF1A 2GVZA 1NHKL 2BJ1A 1U2FA 1RTHA 5I4MA 2YH0A 2DNPA 3AJ1A 3I0SB 1C1CB 2MKIA 3OVAA 3OHBA 2F4VF 2OFHX 3MR6A 1A0OB 3MF5A 2EG1A 3N9UC 1T9VA 2MDAA 3OL9A 2DNKA 2BDPA 1DARA 4O4GB 2BKNA 2WK4A 3HXMA 3DLEA 1D3WA 4CIOA 3R2DJ 2L48A 2CQGA 2APOA 4X4RA 1KLNA 1UFWA 2I6WA 1U45A 2P9GA 4QPXA 1U2CA 3IP0A 3GJRB 5HP1B 2HMIB 1NH8A 1C1BB 4WK3A 1TL3B 2G2OA 3FNNA 1Z4UA 1BHNA 4LSNB 1F3FA 2XNQA 2D69A 3D6MB 5F8MA 2KI2A 2MPUA 3UNGC 2QLXA 1TUWA 4F4YA 1ZPWX 2GO9A 1CJUA 1FJGF 5E3QA 2W2OP 1UVMA 3W9IA 1NJYA 2QTWA 4DX6A 3EDRB 1RAAB 3B54A 3JB9k 4R0JA 1FNMA 3R3TA 3ZNUA 2ATLA 2CIMA 3H20A 8AT1B 3E01B 3MMCB 3NGKA 1Q8KA 1G1XA 3AB4B 4YQWA 1SCJB 5DLFA 3QT5A 1T05B 5ETLA 2JLEA 2EC2A 4J37A 2R7TA 1GEHA 1CJTB 1FJCA 2CPDA 3CCQS 2R3VA 2LQJA 2GC8A 4DR1J 5C7PA 3KHHA 4RNHA 4IQMA 4IFVB 5GAEI 1YIJS 4UOFA 1B70B 1N5VA 5KFAA 3X3UA 4QPTA 4LBPA 4HH1A 5HROA 4PWUA 3L7PA 1SJ1A 4HLBA 4JI3J 1VFJA 4FYXB 4HACB 2HG4A 4B9NA 2I5JB 5KFTA 4FBTA 1YTYA 3KLEA 2XZWA 3NCQA 4PZVA 3DMJB 1U25A 3GFZA 2IYIA 2AQ4A 4XPCA 2L08A 2Y0BB 3THTA 2KZMA 4IKAA 1FWLA 3MM9B 2MXYA 3S6EA 1NPRA 3PJ9A 3V5RA 3Q8SB 3TJ9A 2EFPA 2P6SA 1FCAA 4QIWD 2ZHOA 3EZOA 3SXLA 3D5MA 3EWGA 2QYGA 4BC7A 1TP7A 1OS5A 2AGOA 3H2VE 5DS7A 1IBLF 2CPJA 5K9FA 2YNIA 2BQUA 2HVHA 4DF4A 3CD6S 3QAEA 3QMQA 5D78A 1TFYA 2QLWA 4PYAA 2R8HA 3F56A 1Q7YT 4GKKJ 1DRZA 1HARA 2RDIA 1Q16B 4H4KC 2O01C 2LEBA 4M1KA 1K0VA 2MGZB 2IDEA 2CNNB 3QWPA 3E2EA 3OJSA 5FD1A 3KLGB 4Y65A 2VD3A 5LSLA 2M2BA 1BE4A 1DTQB 2BW2A 3TA2A 2JNJA 4FXDA 5FJ4A 2IRXA 1QE1A 4J9VA 1WHXA 4M5MA 1MU2B 4IG3B 2HHXA 4DQQA 2C22A 2R7UA 3OFEA 1KBRA 4CNYA 5AXKA 5D4PA 3BH6B 4ZPDA 3SZ2A 3GV7B 4KAIA 2HS0A 4IOAQ 1TU0B 2J9DA 2FVCA 3MEDB 3A13A 2EFGA 2EI5A 3BN4A 1FXLA 1R8BA 3J7YU 2GNKA 2G13A 1D9FA 4DV4J 2D74B 1RSCA 2QMXA 4URGA 4QYZJ 3S7RA 1JB0C 4NZ7A 4ZDNA 1S7IA 5J2NB 4F50A 2QE5A 2OPSA 3H59A 1J5EJ 1JJ2R 1VQSA 2M52A 4EYIB 3BPSP 1LFWA 4I69A 5F9NA 4ECZA 3GYXB 5GADU 4ILRA 1RWNB 2G9OA 3I96A 4C0HA 2MJUA 1L5UA 4I7FA 4ZCLA 4ZIVA 2AYBA 2ZE2A 2D9PA 3M2UA 4P74A 5KFIA 3W65A 1XMQF 1XTZA 4WE1B 3LP0B 2CJXB 1Y4ZB 5HMXA 3RB0A 3TO8A 1S6PB 4RNMA 1UJ5A 4X4VA 1HWJA 3D68A 2RUGA 4RR5A 5HK4A 4K4TA 2DNZA 1QTNB 2W7OA 4NXMF 2H65B 4R8UB 3OL7A 2E7VA 1K47A 4JI7F 1X60A 5IWAF 5GAGU 1VCTA 1HR0F 1WTBA 2LXIA 2G2YA 1H6KX 4FF1A 3M8PB 2E1RA 4XO0A 4HL9A 4NLTA 5EUHA 2MQMA 3DM2A 2UXBJ 3K7RA 1P1TA 1DZ5A 2W2PP 3NAIA 2RH3A 3BM7A 3I0RA 1BMQB 3M6XA 4KFBA 4KO0B 2MQOA 2KVQE 4WF9Q 5EWGA 1N5QA 1NLKL 2NCKL 4ZVHA 1NJWA 2M7SA 3QWUA 4L3KA 1RWVB 2ZZNA 4LREA 3MR7A 3FC9A 1REVB 2Z30B 2CG8A 3HHLA 1FRIA 5DG7A 3ELHA 3BR8A 1TKXA 2QSFA 5J1EB 1B99A 2H5EA 3BGUA 1TAUA 1W2IA 1UETA 4B3SJ 2C2KB 4RX6A 2NPIA 2ZD1B 1U0HA 1AYEA 2C42A 4LF4F 1U24A 4OZ5A 4DSJA 5LXYA 1ZM3A 4TXSA 2L9NA 2HFSA 1TMMA 2AEMA 3UR3C 1GT8A 4C8LA 2AKWB 4LR7A 4A8KA 4HEA9 5IT9U 3FQKA 1JLBA 2BJDA 3JQJA 4YB6A 4OFZA 1XMQJ 5DGAA 4YDXA 1Y5NB 5AJ3J 4NLSA 1Y11A 2LYVA 1UW4A 2CQDA 2E1MC 1DHMA 1OPZA 2B8PA 4ZLLA 3L3CA 2OFGX 2OEMA 1MNEA 1PGZA 2MZ1A 4LFAF 3CGIA 4Q0BA 3EVOA 3ET6A 2B5JB 2C2OB 2DD8S 2R8KA 1NSPA 3HSGA 2H9ZA 1R0CB 1GTEA 1SH3A 2JRSA 3E51A 4KYZA 2E7WA 3TVKA 1AFJA 3VR1A 4FF4A 2FLOA 3ZZTA 2ZOGA 2B43A 3O2IA 4I2PB 5ETPA 3BEGB 3SV3A 1LEOA 5A76A 1N32F 3K0JA 3EGZA 2VPYB 5KFKA 1X9SA 4FZVA 4TYBA 3CCRS 2J7WA 1QUPA 3C14B 3DI6A 1UWBB 2VASA 1ELOA 4OX7A 3DOKB 3G2XA 1HA1A 4K2JA 2OSRA 2DYAA 1UVLA 2UVWA 3IWXA 5G0RB 4O3QA 4TQRA 5B7WA 4QR0A 3MM7A 1L3KA 5FDLA 2NSCA 2XMKA 5B08A 1AROP 2JJ4D 4FPIA 5J2QA 4MMOA 1Q8IA 4RBTA 1T94A 3IS9B 1IVZA 1LWCA 1JLAB 1CVJA 4QYZK 5KFXA 1S12A 4Q45A 4B17A 3P3DA 3AXKA 1FXRA 2KU7A 2LMIA 1JJCB 5HAOA 4DLEA 3BPDA 4ENOA 2ZJQQ 2R2RA 2FY1A 3IG1A 2H4WB 2LFVA 3CCUS 4K5SA 1BXNA 4ZPVR 2WONB 3BQ1A 2BACA 2MYFA 1FEEA 2Z56B 3CDBA 4L72B 1LKZA 1S0OA 4FVCA 1FRXA 1VBKA 3H5XA 3V2UC 1AZSB 3G8TA 4LFBJ 4LFAJ 2C3MA 2QMWA 3HSJA 4ES1A 2MMYA 5F8LA 3NXZA 2XMAA 2DGUA 3WX4A 4WWSA 3JSMB 2ZJPQ 4LBIA 1LW0A 2VQEF 4NWBA 2GQQA 2RMLA 3KLHB 1TV6A 2KT2A 3HD2A 3KG4A 5BXIA 1OY6A 1R8CA 2CQ1A 5KFUA 3T1AA 5K8NA 3IGVA 2KTQA 4CLUA 3MAAA 1MWQA 2PA3A 3ENWA 4NLPA 1WOPA 4K8RA 4C8MA 4AQYF 4M5DA 1T8EA 3B82A 1MLAA 4JI4F 3GIJA 1WC5A 1X8DA 4I0WA 2C3UA 5J2PA 4WTYA 3TRGA 1AW0A 4KC5A 1B3TA 4ELUA 1KS2A 1RAEB 3PG9A 5DM7Q 1Q78A 3PRDA 1FFSB 4I6WA 4NI2B 1R8HA 4PR6A 1KTQA 3OVBA 1OMSA 1JX4A 3CCES 3CWJA 1RAFB 3VWSA 2Q66A 1PJ7A 2XYHB 3ADAC 3ICLA 1FVQA 4A8MP 3HKWA 1KTVA 3T1YF 3V4IA 2IAJA 3MMBB 2F9DA 5D3GA 2SXLA 4IH6A 3CJ3A 2ZH9A 2DY9A 5B0EA 3K5NA 4DWIA 1FDDA 2Q1LA 3ZTSA 4XPEA 5KT7A 1VRQC 3G6XA 4DLGA 3BKTA 3D66A 3BSOA 4OIXA 2MQNA 1CJVA 2CQIA 3MOZA 4EBCA 2POKA 2XTJP 3OT9A 2GHVC 4DPOA 2GMHA 3DOMA 1F60B 1K73T 2A1BA 2MHNA 1IUJA 3UPFA 5J2MA 2FIUA 3FFIB 3UVJB 4DZDA 2EFNA 4MIBA 4QIVA 1QM9A 2V2ZA 2HZVA 2VPZB 2PFFB 1H2UX 2B4PA 2LKZA 1V3RA 1SXLA 4NZ0A 5E2QA 4TLQA 4WKYA 4Q8FA 2CPYA 2NUUG 4PXEA 1S6QA 2WCXA 4QIGA 4OYXA 2E5LJ 1NH7A 3CJKB 1TL7A 2AW0A 4ZMMA 2JVOA 4X62F 5A8RA 1VLYA 3MAHA 2I0XA 2RHQB 3HVAA 4BS2A 3MR3A 2KO1A 2K3KA 2DT9A 4A8XA 3VQSA 4TY8A 2CWXA 4LF1A 2X7IA 2PN6A 5J1NA 4LR8A 3UN3A 4MYTA 4DN9A 5ETMA 2H4YB 1S77D 2AMCB 1R0AA 3AHPA 3OR2A 1KLMB 5K8PA 3WX8A 2C2ZB 1HI8A 3CW2C 1TUVA 3FSXA 3KWMA 1NJIT 3MTJA 4I4BA 1YJRA 5CQGA 1O6XA 3NS5A 2B4VA 4DR7F 2HBQB 2RNEA 1VQ7S 4RU2A 3RAXA 3TX8A 3G82A 5KG0A 5KT2A 3FBFA 1N34J 3RBDA 2FJVA 1BQMB 4B3RF 2DPJA 2V8DA 2CFXA 2B7CB 4H4KA 2ZNYA 4HTIA 1QLNA 1BGXT 4DV3J 4F02A 3FBCA 2VOOA 1WDTA 1N48A 2DKOB 2HBZB 2GGPA 4OI3A 3DRRB 4J90A 3MR5A 4ZP9A 1P9QC 1P6TA 2GHPA 2Y1JA 4YDDB 1RBOB 2H48B 1X31C 3OV7A 1HNIA 3IRXB 2OGUA 3BV8A 1KEKA 4G1PA 3MPDA 4KGZB 2GJIA 1MN7A 2FVQA 1A6LA 4NLGA 5KFBA 1VI7A 2U2FA 2VL1A 1NK6A 1JJHA 1Q81T 5CABA 4GO7X 1NU4A 1SV5A 2HAFA 1XERA 2KXHA 2W4DA 1S1VA 3EUNA 3PX0A 1AT1B 1LW2B 3VHQA 5CYMA 1TK0A 2DNGA 2RQCA 1CC8A 1DFDA 4EGLA 5C42B 4OZNA 1KP6A 2E1PA 4DS5A 1QUVA 1TVRA 2V9KA 2KG0A 3IWLA 3WQPA 5F8IA 4AXJA 1T7PA 3M4XA 4CCHA 2VG6B 1O5JA 1U8SA 3KLFB 1VJWA 1DURA 2OPPB 1PJ5A 4LFCF 3WBZA 2VBWA 3LANA 4YUDA 4DR7J 3QLHB 2FHKA 3M8SA 1FXDA 1R43A 3PIOQ 1FKPA 4ATNA 5DDRC 2IRYA 2DR6A 2K1RB 3A1YG 3MECA 4TQSA 3D7SB 1RAGB 3MHYA 5HVFA 3I9V9 4ECSA 2WVBA 2BJ3A 4OLPA 1LK5A 3I0SA 2DIUA 2P6TA 5B0BA 1T11A 2KJWA 1RWPB 2RD5C 2KXFA 2FYXA 4TU9A 4O4GA 1SL2A 4WFBQ 1S4EA 2WVFA 4KH1B 2IM2A 2HS3A 2I2YA 4ZPBA 2R8JA 2WW4A 3MCSA 3T3FA 5KFNA 2EXUA 2AU0A 5HP1A 2HMIA 1TL5A 2NZ4A 3D6HB 3T5KA 4UUWA 1FTRA 5JJBA 4O4RA 1WF0A 4LSNA 4E8UA 1FRLA 2KRRA 3BDEA 3UN5A 4P73A 3EM1A 1Q53A 2RU9A 2Z0GA 3R7NB 2DO0A 5D4NA 3MD3A 1RT7B 2QX0A 3MEGA 4B3OA 1C0TB 2A6MA 1SC6A 3GU0A 1G6BA 1F9FA 3E01A 2IJFA 2LU2A 3MMCA 2HIQA 4C11B 3M8RA 5H9FJ 2KT5A 2W9BA 4ZP6A 3M7VA 1X0PA 4B08A 4QWCA 2V4JB 1RGVA 4UF4A 3CDEA 1CJTA 5T7LA 2HGMA 3NKYA 5ETKA 3MEEB 2KJVA 3SCKE 4DV1F 4Q5VA 4ZLJA 3TEHB 1XBWA 5CAAA 4IFVA 2NXUA 1Y3JA 2PO4A 2LDYA 1VQKS 1I5OB 4PG4A 4LRFA 5K8MA 2GVDB 4E98A 2M8HA 5HANA 3R5JB 4CM2A 4RW7B 1OJ4A 4OYBA 1WEXA 2VG5B 4HACA 5CCLA 4O3OA 1H2TZ 3EZUA 3PJWA 3T6JA 3C6UB 3DMJA 3GPAA 3ZZ0A 2VPXB 3CEDA 2HHUA 2GAGC 4GRSA 2VZ9A 2HQIA 4LVOP 1L3UA 1VBXA 4PG5A 2MKHA 4ANEA 1R7IA 1ZPVA 3MM9A 4YFUA 4NLYA 3L7OA 5T14A 2MB0B 5IT4A 4UY8T 2BABA 4A8SA 2P9EA 5KAKA 3M6UA 3HZEA 2D9OA 3OSPA 2YQ1A 3FGVA 4Y2CA 4IG0B 2YH1A 1NDPA 2N82B 4B9LA 2F4FA 4AXIA 4RW9A 1JNRB 1K1SA 3OXFA 1HBMB 1N36J 1QTMA 3ITHA 5ETOA 5AE1A 1EARA 5I42B 3GB0A 3QZ7A 3GCWP 2XMWA 2N3LA 1N54B 1RE1B 3MM6B 4DV2J 4LSZB 4LMZA 2KRBA 3GYGA 3ZZOA 2WHOA 1UVNA 2B51A 1XN9A 3QNWB 4TU7A 1FT8A 3G87A 2FLPA 3FZBA 3BH7B 4DV7F 3M32B 3SV4A 1Y10A 4KRWA 4J9QA 4RBUA 4G3IA 3L7UA 2QGFB 1DTQA 4RW8B 1FWPA 2A2CA 2YBVA 2EPIA 2BKPA 4QZVB 2C2NA 2E1CA 1MU2A 4U8YA 2CJ9A 3VGTA 2V6AA 4IG3A 2VUGA 4DU8A 2QO3A 2RKIA 1WEYA 1R31A 1YGYA 4CO5A 2J6UA 2ASJA 4DBQA 1D9AA 5IV4A 4UUXA 1PAEX 4O3RA 2ZH7A 2W2QP 2UUBF 1T9UA 3FEZA 1EJ7L 4DV5J 1FKAF 3HHEA 2LQ8A 3M8QB 3CULA 5LSRA 1F2GA 4ZA1A 2XI2A 2OH2A 2BM0A 3JTOA 4N41A 2F9JA 3MFHA 1O8BA 2ZITA 1N52B 5BR8J 2HZAA 2RS8A 3RBZA 4GC6A 2QEXS 4JB8B 3QGPA 2AJ2A 2L9DA 4KGKA 2IPOB 2K7JA 1B4SA 4LF9J 2CJKA 4Y28C 3CD0A 1I94J 4WYLA 2GZOA 3EJMA 3M9NB 1P27B 3PHTA 1EAYC 2RAQA 2ALZA 4F25A 3ZZUA 1R8PA 3GILA 5LMNF 2CDQA 3N79A 4WJBA 4ZVSB 1CLFA 2HS4A 5GMKa 7FDRA 4X65J 3EVWA 2E44A 4YS2A 1GMUA 4OYPA 4X64J 4BDPA 4ID5B 4R8UA 5DO2A 5H9FK 3GIKA 4LF2A 4LF6J 1W26A 3IBWA 3W5YA 1H2VZ 5E5NA 2ZZMA 1TKTA 2GAHC 3NGDA 5HSPA 1OY9A 2CZ4A 2X3GA 1HWLA 3FUYA 2BM1A 1S7HA 4WPAA 2DJWA 3EXCX 2DNMA 4DZ6A 2HNDB 4KGXB 3M30B 1KWMA 3TAMB 4TLRA 4WXWA 4EBDA 1E6YB 1GFWB 2DCLA 3BGFA 3BKFA 2MKYA 4KGMA 3SDEB 3HULA 3RB3A 1Q82T 2MKSA 1IJEB 1S10A 3LTOA 2CQ3A 3VGVA 4Q44A 3PJXA 3P49B 5IQQA 4ED8A 1XMBA 4KHPF 4PWWA 2YKNA 2ZM6J 4DV0J 1ZAVA 1YJTA 4WFZA 2UXCF 2HVZA 2YKMB 1ZTWA 5D77A 3HMJG 5AXMA 3PV8A 3LW5C 1HKAA 2AIRB 4XAKA 5KFPA 1N5TA 4JI5J 1HQ2A 3CJ8A 1NZAA 4RW6B 2CKWA 5DRKA 4CTAA 2FJBB 2I38A 3WHIA 1M90T 4CT8A 2CA9A 2XWXA 1EB0A 4F0MA 4DX8H 1PILA 3DDIA 4HR2A 2FHOB 1MMDA 2Q3PA 3NBPB 3CD5A 5B0GA 2VFRA 2VQFF 3GG1A 3KXDA 2OJ3A 1RT3B 3BYRA 2DH8A 4YB1P 3TAPA 1MSWD 2KM8C 3QAUA 3RUBL 1SI9A 2B5JA 1H73A 4BC9A 1M5OC 2GA7A 3PNIA 2ZNZA 1UA0A 1VHFA 2BVZA 2M5YA 3H98A 3SCIE 3T9NA 4CNZA 4FS1A 4K7QA 4DSIA 5KFYA 4DV6J 4F2RA 2OO4A 3T1HJ 3GJSB 2VA3A 4DUZJ 5E0OA 3OTBA 5EN1A 3LUYA 3HF5A 4I2PA 1ZM2A 3C2PA 5L9NA 4J9OA 4B9MA 5LT5A 2AJQA 3PRVA 3Q2SC 2GO8A 3HPOA 4TNOA 5GVQA 4FYVB 4KE5A 3C14A 1EP4B 1UWBA 3DOKA 1NJXA 3W1YC 3IM8A 4F0KA 2M0GB 2XGPA 4USJC 3D1OA 1GNKA 2B0GA 2EVZA 2C1EB 3POTA 4PUOB 2HW3A 1NSKL 4LF8J 3Q89A 2V68A 3IS9A 3F44A 5LL6d 4K4SA 4K5RA 2FPHX 1JLAA 1YQHA 4TVAB 5KFSA 1RAHB 4DI6A 2QA4S 3OUYA 1LK7A 3K8VA 2VG7B 4JV5F 5DDOC 2KT3A 2ZDOA 1AB8A 2WONA 5CZVA 4MK8A 2AHOB 3CJQA 1JLGB 2HPUA 2YY3A 4OX9F 1XQIA 4NLWA 5A0YA 1OSCA 2F3JA 1IKXA 3AA8A 1FDNA 2Y8YA 2DXDA 2O5DA 3MAQA 3NS6A 3DGPB 1RWKB 2V67A 3R5GA 3CMQA 5E33A 1FWKA 4DQIA 4G1QB 4QOTA 2HRYA 4C7QA 4M8LA 1NPPA 2HHPA 3U1MA 8ATCB 1UAWA 3RU0A 2FHMA 4UZCA 5C24B 3A3NB 3LWLA 2VOPA 2V69A 6FDRA 5SUHA 5JXSA 2K2PA 3PEHA 5HMWA 4XK8C 5JUMA 2OUGA 2G0JA 2XLJA 4IYQA 3I5BA 3OLBA 3NNAA 1WG5A 1NKCA 2F63A 2MZQA 3CJ0A 3M8ZA 4ILMA 4LF7F 2QN6B 4ALZA 2CQ4A 4Y2IA 5A2QY 2LXUA 4KV8A 5HO4A 2V9WA 2HVDA 1NK8A 4HT5A 2K8GA 3QJLA 2XCAA 2EK1A 3UCGA 3PW5A 2GCFA 2CPZA 2PA8D 3D1QA 2BE9B 2NXCA 2PIIA 3TNVA 1VRUA 1Y00A 1JIHA 1VQPS 2DRAA 5ETQA 4DR3J 3U02A 3I32A 4ZVPB 3TZYA 1SJ4P 4RJVA 3D4JA 1YJNS 4L73A 4DR6F 1IQTA 3BZQA 5DG9A 3MMBA 1CBKA 1H3DA 1S1XB 3BGRA 1C0UA 4LUBA 4F67A 5IM0B 4C4WA 2V34A 4OX9J 1SQFA 1U2RA 3U1LA 4UQGA 3V6DB 3IWNC 1SQGA 4FPRA 2DHHA 2L3MA 2ILYA 2LU1A 1G4CA 4DR2F 2OEKA 3Q0AA 2B6AA 5CYQA 2ZHAA 5K5MA 4MFBA 1GK8A 1RAJA 4BCAA 3QT8A 4NX9A 3P5BP 3FFIA 3UVJA 2X1AA 1HNZF 5RUBA 3DLGB 2CJBA 4F4WA 2EKYA 3UNYA 3EICA 4IOBA 5J1PA 1WJ9A 4R5PB 4NYOA 3VAHA 4HVZA 1FNOA 1RHMB 2P5VA 2ZC3A 1JLQA 3IA0A 5E41A 5F8HA 3HM9A 2ZWPA 2OLWA 2YQ0A 4O44B 3CD7A 1UL3A 4Z2XA 5LMUJ 2DY1A 1HHQA 1WTFA 4DDFA 3UN2A 4MK7A 2QL5B 3CJKA 1HWIA 3MCMA 4LF7J 3DHXA 1IR0A 1RHUB 5CHCB 3PKYA 1ZAWA 3LA0A 1HL6A 1X4AA 2LCWA 3AJDA 4NA1A 4ECVA 3KK2B 1WSVA 1Y0HA 3DDKA 2HNYB 3CE8A 4QU7A 2UUTA 3O6QA 2JEJA 4NE9C 5HBMB 1KLMA 4P7VA 2E29A 1CEZA 2QLFB 1T03A 1D09B 5A8KB 1QY7A 2HLTA 5B0CA 4F4XA 4PXCA 3TUZC 3N28A 3Q8RB 1HPZB 3K5OA 4N8OA 1SL0A 2KN4A 1WKJA 4ES2A 2DK2A 2WW8A 1IBMJ 2PMHA 4NLRA 4Z7CA 1QSYA 2EBEA 4DG1B 3FRYA 1KN6A 1XNQJ 1HNWF 1BQMA 5HL7Q 2FC8A 1C4AA 3T5LA 3C6TA 5FIIA 2W8LA 3AA9A 1S1UB 1T95A 5IV3A 1FE0A 1UP1A 1TKZB 3B4DA 2R2SA 4LSLB 2RRNA 3UO0A 2KZZA 3CJ5A 3MUVP 1NSAA 3TR5A 4UT4A 5HATA 4WFXA 3N6NA 1LFPA 4I2QB 5LOQA 3DRRA 1K0TA 1RYRA 1GAOA 3FRZA 1CJKB 3LP1B 1EQ0A 2NXEA 4OQJA 1QVGR 4FP9A 2HLUA 2HQFA 2QLBB 3EYZA 4DFKA 3OHAA 3NNHA 2R8IA 2A0FB 3G6YA 1HBOB 1UFLA 2B4UA 3RZAA 4ZN3A 5LSOA 3HHKA 1MWZA 3NRBA 1L3VA 2R7QA 2IJRA 2DGXA 4X2BA 5A8WB 5D15A 4A8OA 2HNZB 4RNOA 4NOHA 3J7A1 3GTYX 2ZJRQ 2J0WA 5FLXY 2DNLA 1FRKA 1C4CA 3BREA 1LW2A 3D0IE 1FJEB 4IR9A 2E1AA 5CD4H 2DPIA 4RUAA 3EGNA 3QGGA 2Z2LA 2LLZA 5JVHQ 1LWFB 2B9WA 2FJAB 4OLOA 1VYAA 4KY3A 3FVYA 1NB2A 1N6QB 4PQUB 2XO7A 1GQEA 4NLVA 3DLKB 1HNXF 1T0TV 2C3OA 4NL5A 4O3SA 2IA6A 3A3OB 1Z2LA 1YITS 2G0IA 4IFYB 1WNEA 2ZUGA 4ZPCA 4C8ZA 1SL1A 2QV6A 2VG6A 3A12A 4A8WA 2XS7A 4USHA 3KK1B 1ZETA 3ILLA 1SC3B 2ZH6A 2GVZB 5HMYA 1MW7A 1RTHB 3QLHA 3R2CJ 3C16A 2L9WA 5KFRA 1NUEA 2J5AA 1S5ZA 2RE1A 2LXFA 3NGSA 3K2YA 2B4OA 1HNWJ 2K1RA 2HK3A 4AD6A 3IMQJ 3KK3A 3DLEB 4DL4A 1ZAXA 5KFFA 5KG7A 2YWHA 2IC3B 2AT1B 2HVEA 3GQCA 4DR4F 2XSFA 1S9EB 2AJ0A 4K2XA 2J9EA 4JI8F 2N4DA 2DNNA 1YJ7A 2CQCA 1F9EB 1Y3KA 2LP4A 1HFEL 1KVKA 1QVFR 2XM3A 2VFVA 2BE2B 1ZOTA 3LP2B 2D41A 1CJUB 2E9TA 2YNFA 4DPUA 5JMNA 2UUCJ 1HYSA 1VQYA 3M2VB 2DNRA 2DHAA 3UQSA 2R7WA 2UP1A 4GVBB 1LXNA 3D3BJ 1DY3A 3LOUA 4P2MA 4USVA 2WSCC 4J9SA 2P9CA 3I5CA 3I55S 1VQLS 3TJ8A 5DQHA 2ZH2A 3CC7S 5KOWA 3BS9A 4AFFA 3CJTA 2DHGA 2R7XA 1FK9A 3ENAA 4OYOA 2RT3A 1RT7A 5GAHI 1C0TA 1T9XA 4A48A 2ATCB 2XB2D 3I4HX 3WIUA 4TYAA 1U47A 3ZTQA 5D0GA 3R1HA 2KYZA 5GAEU 4CO2A 4JV2A 4EI2A 2ZWOA 2W25A 2R42A 1HNVA 4WU2A 4A8YA 5DGBA 1VQ9S 4A46A 4K59A 2JHEA 3FMBA 3CCZA 4EYHB 2UXDF 2XHCA 1V5VA 2BE7D 3Q22A 3MEEA 4KPYA 3BBBA 1CULA 4PPZA 1R6VA 3PFEA 1HHTP 3DOLA 3DLBA 2DNQA 3H5YA 3GP9A 3U1NA 3CVKA 4K4UA 2YX4A 3M05A 3AODA 1FE4A 3I4PA 3KFWX 3VVTA 3NS7B 4M94A 4RW7A 1YDLA 2K3IA 2VG5A 2M8DB 1NZ8A 4A8QA 2KHCA 3H2LA 3SSSA 4J9MA 3C6UA 4JI2F 2Y3YA 2R7VA 3DRPA 5KG4A 4ER8A 3OFHA 1IKVA 3PVXA 2CQPA 5D0EA 4MTPA 3M9MB 2OTJS 2JDJA 2EKNA 4NMLA 2JEGA 2CZVC 2UU9F 4WP9A 2FZGB 4GKJF 3PR4A 2VODA 1RTJA 2YNIB 3MWBA 3AOBA 1KVIA 4LIRA 1KNZA 4HDHA 1SUQB 4USIA 4J5OA 3RTVA 4RWWA 1JXLA 4JI1F 4KPCA 3NGUA 4WK1A 3GMGA 2GIQA 2HBYB 2KHDA 5F8NA 2VBZA 1T3OA 4LT6A 1OO0B 4X66J 1BD6A 1RT1B 3C46A 1DLOB 1WHWA 4OI6A 1OQ6A 3W60A 1HBMA 4W4MA 1I3OB 2E5GA 2HFVA 3LH2S 3R1LA 4E0DA 2VB6A 2YKQA 4C2MA 5I42A 2D3ZA 3UDLA 4DF8A 1L3TA 1NKBA 4OZ3A 2X3DA 4U7UD 4WKRA 2J8AA 3RJMB 3OR1B 2AV5A 2V5HG 4NMXA 1GX6A 2Z2ZA 2V8HA 4OZ1A 3M32A 2RVJA 4CM0A 3ZTPA 4I1TA 4OL8A 1HLWA 3KYLA 2G2ZA 4LR9A 3ENQA 2QYCA 4J7CA 3VAGA 2MSSA 5CZXA 1F5AA 2VICA 1SJFA 2IYGA 3RGIA 3UI3A 2QRRA 4N7TA 2ABYA 3H40A 4M5JA 4A47A 4DPXA 4M63A 1U09A 1U48A 1PBUA 3TX0A 2F4VJ 4RL1A 4ZVTB 3CSKA 1PC5A 3KTQA 1OYDA 2OPSB 3RAQA 1NK5A 3BO4A 1X4DA 3GE9A 2UUAF 3SSRA 5E3CA 3I31A 2UU9J 4FXVA 3J81Y 3HX9A 1U6ZA 1DQAA 4I7FB 1J5OB 6FD1A 3M2UB 3G4SS 1RTIA 2COLA 5KT4A 4LF5F 1U1NA 5C2CA 3BO2A 1RWUA 2W9AA 2V2QA 1M1HA 3GR1A 1RLDA 4B3TF 1M5VC 3RAMA 1RT6B 3BQ2A 2PMZD 1ZH5A 1FD2A 3LGNA 9RUBA 2J0SD 2X51A 2W9CA 2Z8QA 1HMVA 3JXOA 2JOQA 5C25A 3L9ZA 3CF5Q 4ELVA 3PW4A 5H9EJ 3L4BC 1FJGJ 2XI3A 4LRBA 3U7JA 5DQIA 3BKUA 3IAM9 2VFSA 3R97A 1FA0A 5HVGA 2ZOMA 2NR0A 4X4OA 2EFVA 2HHVA 3HJVA 4F8RA 4QCLA 3AD9C 3DM2B 4NCGA 3FK4A 4ID5A 4WFYA 4KT0C 3QJPA 1VOMA 2NUHA 2HGLA 2BANA 2FC9A 3I0RB 3HFZB 2XY7A 4DQRA 3GG0A 3MR2A 4KFBB 2JC0A 2ROEA 4M5NA 1RKIA 4UW2A 1NK9A 3QT7A 2Y0SD 3U27A 2KFNA 3HHLB 1H72C 1I6JA 4U67Q 2Y1RI 3MDFA 4HHUA 3V6HA 1EQMA 2AWZA 2XSJA 1TKXB 3V81B 2HNDA 2Y1LB 1ZZFA 2GW8A 2DHSA 2F5GA 2PI4A 1E6YA 2GIFA 4OX6A 3SDEA 3I87A 5D0HA 3HKZD 1U0HB 4KTQA 1WI8A 1EZZB 1VBYA 1RQ0A 5CA5A 4CO1A 3LAKA 2AYGA 2GFFA 3KHRA 2UUAJ 3LF0A 2YKMA 4Y3CA 3D0GE 4DUYF 4NXNF 1B7YB 2QA1A 1WF2A 3VALA 3QT6A 3G6VA 1UEUA 1NCLA 3HFKA 2DGQA 1VQ4S 4ANDA 4C8KA 3KHGA 1UEKA 2AJFE 4ZHRA 5D8HB 1FHTA 1RT4A 3W2WA 1M5SA 4MH8A 3K89A 3GLJA 5HMZA 1IBLJ 4F26A 1URRA 4DCJB 1X9WA 4Y2KA 2GX8A 2D1CA 4K0KF 4FDFA 3TA1A 4DS4A 3OLAA 2NZCA 3TVYA 2HWHA 3V4MA 3NBPA 3IGNA 1PYTA 2RQ4A 3CNQP 4WXOA 1RT3A 3LAMA 3OVSA 1RHRB 4C8YA 2CRLA 3DYAB 3FEYB 4NLQA 2F40A 2G1DA 3JSRA 2DGOA 1REGX 1GX5A 4QQBA 1JLCB 3K59A 3CIZA 3DI6B 5CYJA 2BQ3A 1FFGB 3F0NA 4PCQA 1UPPA 3MM5B 3JYTB 3W9HA 3TP2A 5FDLB 1XIQA 3NEKA 1UZHA 3R5CA 3THVA 2X1FA 2Z2YB 5J2QB 3BF4A 2JVRA 1IKWB 3FBBA 1F5CA 3NGRA 5KT5A 1A9NB 2MLXA 4QYRA 1CQMA 4GC7A 2KL8A 2QFJA 2PDAA 5ETSA 2KFZA 1RBAA 4EBEA 3MCNA 1V9OA 4LRAA 4WCEQ 4OHYA 2PMWA 1RA6A 3Q86A 3LPYA 1KFSA 2YPZA 3BR9A 1BUXA 5F0WA 1RJJA 2DNYA 1KQSR 4UOGA 2HWIA 1FRHA 1HQUA 3F73A 2XMVA 2HURA 2OTLS 3O1LA 3GFXA 3VQTA 1H74A 1N0UA 4PPDA 3DRXA 3HZGA 4FNHA 3IR6B 2E7XA 2HYIB 1N5YB 3AQOA 4IQXA 4BWJA 4QIEA 2YNGB 3PYFA 5ADZA 1X9MA 4YHHF 2OD6A 4OZLA 5KFGA 2D3OR 5H9EK 5B0FA 4NPOA 5D4LA 2ZH3A 5L46A 1RT2A 4IOCQ 5AE2A 3A8IA 1LW0B 3RRHA 1S1WB 3CMAS 2ZBQA 4NXMJ 3IO1A 2YPYA 2XYPB 3BJYA 4P75A 4QIFA 4JI7J 2DBBA 3MPVA 2O3DA 5IWAJ 1BC6A 2V63A 1HR0J 5M2PA 3MAAB 1ZA2B 5F3TA 2XO6A 4O0IA 2YXLA 2DRBA 2Q6CA 2RDJA 1PKUA 1KOHA 4M5DB 1CG2A 3PW7A 2C3PA 1UA1A 3T5JA 3DNCA 4DL7A 3QIDA 3JAMY 1YJ9S 1N5SA 2ZH4A 3OBIA 3UCZP 3UDVA 4EZ6A 4IRDA 3ZNJ1 2IHR1 3UD3P 4RNFA 1YVFA 2QLJB 5HQ8A 2RSQA 4MYUA 4N47A 2MY8A 3HSDA 1R6YA 1ULRA 3EZ5A 2ZUAA 3MCOA 2ACMA 4JV1A 3QRQA 3GIMA 5HLFB 2BXJA 2B9XA 1O51A 4UOHA 4LF4J 1W25A 3PZPA 1CJVB 4B3MF 1IXKA 4PG6A 2YKOA 3CO0P 1L3SA 1HQEB 1RT5B 4WYWA 4Y00A 3C19A 2OMLA 3QBCA 2LQBA 2IIHA 3E8OA 1JKHB 1FKOA 2CJQA 3GSDA 4K4YA 1S1XA 2XWYA 3GFHA 4EU0A 3Q24A 4IRCA 2UVVA 2G0CA 1PO6A 4X4UA 4ZVRB 5IM0A 1XWLA 1YJVA 3PX6A 2ACYA 2DH7A 3M1VB 4JYAF 5I3UB 3V6DA 1ITPA 2MZSA 3RBEA 2ZH8A 3AD8C 5GMEA 3CTRA 1YRXA 4F4AA 4RZRA 3MPWA 3V6JA 1S6QB 1YG0A 4PXDA 1FEHA 2WB1D 3ZFVA 2WTFA 1MN9A 1VQ6S 3DLGA 3HVRA 4TN2A 3ZZRA 5A8RB 1KQFB 4DX5A 4J91A 2W01A 4OZJA 4R5PA 3IBCB 1NO8A 1EETB 3UR0A 4TY8B 4ZS6A 2B9YA 2ZEJA 3OTOF 3GV8B 2VBYA 3MOJB 3RBXA 1N32J 3W7BA 5BYSA 4WFAQ 3JSYA 4M5LA 1LOUA 1PYSB 3RW6A 2IBKA 4IH7A 3HT0A 3Q2TC 1R0AB 4PG8A 3K5MA 4F0HA 4PQAA 2AD9A 2IFXA 4CT9A 2V50A 3FJ2A 2KVIA 3AFGA 4XDDA 2IVMA 1QD1A 3KLIB 1KFDA 3HCXA 1WC4A 3RR8A 1SVDA 5KFWA 3IN5A 2HNYA 4O0NA 3HLUA 4P2FA 3W8GA 4DL3A 4DU7A 1MWYA 2NYHA 1AUDA 3KUEA 2CUYA 4Z37A 2RHSB 3A3PB 4B3MJ 2E9RX 1SJQA 3ZC4A 4F4ZA 1HBNA 3GYNA 3MMAA 1HPZA 3HVTB 5KG3A 2H51B 4DSEA 4QU6A 1TAQA 3PACA 1M0SA 2GGPB 2MKKA 1MG7A 3BQ0A 2LQ9A 4DG1A 4V1Ak 2J0QD 3ISZA 4CQ1A 4NLXA 2BW7A 2YQ3A 4LJMA 3Q8YA 4P7TA 4B9TA 1HNIB 2AJ1A 4FNIA 2PC6A 1DAXA 1S59A 3I6PA 3NL0A 1S1UA 4YEAA 1TKZA 4K4XA 4PABA 4LSLA 1FX4A 2FGOA 3QO9A 4AE5A 4B9SA 3HI9A 1S9GB 3UDCA 1NK7A 1CJKA 1SV5B 1S1VB 1LWXA 3SBMA 2VQEJ 2HSEB 4MKAA 3EPIA 1R0BG 1NNDA 4L3NA 3KUGA 2DR9A 1MROB 4ZKAA 5KFCA 4C3KA 4ZOSA 1WKKA 1HBOA 4FBUA 5IT0A 1V6HA 2JC1A 1X4EA 1WG4A 4ECQA 5A8WA 3PDNA 2HNZA 3DU6A 1TVRB 4RNNA 1RHQB 3CCTA 4IDKA 3OL6A 1U1LA 3D67A 3RG6A 4AQYJ 3CCMS 1VC5A 1PAUB 1BLUA 4JI4J 2JL9A 1IWGA 3W5XA 2AZ3A 1S48A 3KJQB 4OYIA 4ZVQB 2OPQB 1HD0A 4RLEA 3TVZA 1N6QA 4PQUA 5EWEA 3NG8A 4I6AA 3DU5A 4AYBD 2FVPA 2CQ0A 3PHEA 4DR1F 2RIJA 3CJ4A 4IFYA 2D3UA 3OL8A 2EC0A 2MZTA 4N77A 2IRUA 1EX8A 5D4OA 4D3GA 2CJAA 3MECB 3G96A 4JI6F 2FJWA 1F5BA 1PG5B 4JI3F 3KJVB 3RB4A 1HW9A 3HJFA 2VA2A 3T1YJ 2OI2A 4KKOB 3MURP 1UVJA 1S6UA 3QPIA 3J80Y 1FDBA 3AOCA 4ZLNA 2VH7A 3AD7C 2AYMA 2ZKUA 3GONA 4TKTA 1VC0A 1S72S 2XMUA 4NRTA 4F36A 4NYZA 1YSJA 5EX0A 1P8GA 3M8YA 3R27A 4ICLA 4DL0C 1WOSA 1X5PA 2HHTA 2CAJA 2RRBA 2IC3A 5ETRA 4JBCA 3G86A 5KFLA 2GMLA 4WP3A 1S9EA 4DOZA 4P71A 2C2DA 4TY9A 2DB1A 5E3AA 1V3ZA 1IM6A 2BRKA 1RWOB 1Y7PA 2IMOA 2HFNA 1HBUB 1S6OA 2D7SA 2CPIA 1Q79A 2BE2A 3LP2A 1U1KA 2F1FA 2E5JA 4ED3A 5KTQA 3MD1A 1KC8T 2PT0A 3M2VA 4USUA 3ZO7A 3MEGB 4B3OB 2C2RA 3IR7B 4J9RA 4GVBA 2DR5A 1SC4B 4CLYA 4GKKF 2FB0A 2N7CA 4OYWA 4UZBA 4X62J 1PCAA 5AT1B 1I1GA 4YMEA 5F3ZA 1U7LA 2W9BB 2NXNA 1FO1A 3CB4A 1OIAA 2XC9A 4IO1A 2EFOA 2JFKA 4P52A 3MMJA 1HI1A 4DFPA 2KYXA 5T7LB 2J7UA 4DFJA 2B7BB 2CNOB 4PG7A 4FVMA 3CCLS 2F8MA 1NDKA 4Q2LA 2B3TB 2FHJD 1IKYB 1BQNB 3BYPA 5KG5A 2MJNA 4JI6J 1FESA 2PEHA 1IBKF 4UOCA 4OJHA 3KOAA 1NHVA 1X4BA 1S49A 1VRTA 2V4QA 4YR2A 1Z1ZA 1TL1A 2IBOA 4MK9A 4DPTA 1TMJA 4B3RJ 4YB7A 2FJEB 2FDNA 1UVIA 2HIYA 3H5UA 3W5ZA 1U1QA 1QAXA 2ILZA 4DV4F 3WDOA 3PKMA 2ZDPA 3W63A 2HQGA 1TQLA 3HSZA 1X0FA 5E7OB 1C1CA 2WVDA 4RPFA 3SMZA 1LQ9A 2J9DE 3KKFA 2OP5A 1J5EF 5KFJA 1H7WA 3AQPA 2WBRA 2I9SA 2W4CA 3L09A 4RUCA 1YBAA 3GWCA 3DXSX 4CH7A 4RW9B 1WELA 4P2SA 3ITHB 1WDDA 2FZKB 2G1HA 2J7KA 1I51B 2HGNA 1SUQA 4OI2A 4BBYA 1C1BA 2HRUA
chains in the Genus database with same CATH topology
1PAEX 1NPKA 1W7WA 3B54A 3ETMA 3BBCA 2B8PA 3Q8YA 3JS9A 3NGSA 1NDPA 3FBCA 4W98A 3ENAA 4C6AA 1S59A 5CAAA 1BE4A 3Q86A 2HVDA 1PKUA 2DXFA 1NHKL 3FCWA 3VVUA 1HIYA 1NLKL 2NCKL 3ZTRA 4FKYA 3ZTPA 1BUXA 2DY9A 3ZTQA 3EVOA 5IOLA 1XQIA 1HLWA 1WKJA 2CWKA 3PJ9A 5BXIA 4FKXA 2BX6A 3VGSA 3ZTSA 3FC9A 4UOGA 3EICA 3PRVA 4WBFA 1NSPA 2DXDA 2HVEA 3EVMA 1K44A 3VGUA 3ELHA 2HURA 3EMTA 3NGTA 3MPDA 1LWXA 2BEFA 4S0MA 4ENOA 1VYAA 1B99A 3BH6B 2VU5A 1ZS6A 1NB2A 1F6TA 3DDIA 3EM1A 4HR2A 4KPCA 3NGUA 1MN7A 1B4SA 5C7PA 1HHQA 3EE3A 1KDNA 1UCNA 4O0NA 3WX8A 4F4AA 4DZ6A 3GPAA 3Q8VA 1WKKA 3BH7B 1S57A 3EJMA 4UOFA 4ANCA 1EHWA 1NCLA 5CABA 3R9LA 3L7UA 3BBBA 4F36A 1LEOA 3Q8UA 1NSKL 4ANDA 3Q89A 3FCVA 3FBEA 4ANEA 1XIQA 4DUTA 2AZ1A 2ZUAA 1MN9A 3B6BA 3BBFA 1BHNA 1NDKA 1NDCA 1WKLA 3GP9A 3FBFA 1NSQA 1F3FA 3FKBA 3G2XA 2B8QA 3VGVA 3VGTA 4EK2A 3ZTOA 2DYAA 2DXEA 1NDLA 3VVTA 4DI6A 1U8WA 3DKDA 4CP5A 3FBBA 3NGRA 3EVWA 1JXVA 2AZ3A 1NUEA 4UOHA 3Q83A 1S5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAE X;  1NPK A;  1W7W A;  3B54 A;  3ETM A;  3BBC A;  2B8P A;  3Q8Y A;  3JS9 A;  3NGS A;  1NDP A;  3FBC A;  4W98 A;  3ENA A;  4C6A A;  1S59 A;  5CAA A;  1BE4 A;  3Q86 A;  2HVD A;  1PKU A;  2DXF A;  1NHK L;  3FCW A;  3VVU A;  1HIY A;  1NLK L;  2NCK L;  3ZTR A;  4FKY A;  3ZTP A;  1BUX A;  2DY9 A;  3ZTQ A;  3EVO A;  5IOL A;  1XQI A;  1HLW A;  1WKJ A;  2CWK A;  3PJ9 A;  5BXI A;  4FKX A;  2BX6 A;  3VGS A;  3ZTS A;  3FC9 A;  4UOG A;  3EIC A;  3PRV A;  4WBF A;  1NSP A;  2DXD A;  2HVE A;  3EVM A;  1K44 A;  3VGU A;  3ELH A;  2HUR A;  3EMT A;  3NGT A;  3MPD A;  1LWX A;  2BEF A;  4S0M A;  4ENO A;  1VYA A;  1B99 A;  3BH6 B;  2VU5 A;  1ZS6 A;  1NB2 A;  1F6T A;  3DDI A;  3EM1 A;  4HR2 A;  4KPC A;  3NGU A;  1MN7 A;  1B4S A;  5C7P A;  1HHQ A;  3EE3 A;  1KDN A;  1UCN A;  4O0N A;  3WX8 A;  4F4A A;  4DZ6 A;  3GPA A;  3Q8V A;  1WKK A;  3BH7 B;  1S57 A;  3EJM A;  4UOF A;  4ANC A;  1EHW A;  1NCL A;  5CAB A;  3R9L A;  3L7U A;  3BBB A;  4F36 A;  1LEO A;  3Q8U A;  1NSK L;  4AND A;  3Q89 A;  3FCV A;  3FBE A;  4ANE A;  1XIQ A;  4DUT A;  2AZ1 A;  2ZUA A;  1MN9 A;  3B6B A;  3BBF A;  1BHN A;  1NDK A;  1NDC A;  1WKL A;  3GP9 A;  3FBF A;  1NSQ A;  1F3F A;  3FKB A;  3G2X A;  2B8Q A;  3VGV A;  3VGT A;  4EK2 A;  3ZTO A;  2DYA A;  2DXE A;  1NDL A;  3VVT A;  4DI6 A;  1U8W A;  3DKD A;  4CP5 A;  3FBB A;  3NGR A;  3EVW A;  1JXV A;  2AZ3 A;  1NUE A;  4UOH A;  3Q83 A;  1S5Z A; 
#chains in the Genus database with same CATH topology
 2XGQ A;  2DVI A;  1TL3 A;  1RWM B;  2QL7 B;  3EGW B;  3O8W A;  2ZH5 A;  4H4O B;  4R0E A;  4OV6 A;  2VHG A;  1RT1 A;  4ED6 A;  1DLO A;  2WOM B;  5KFZ A;  3F41 A;  2W24 A;  4C98 A;  1XR6 A;  3P96 A;  5LJ5 Y;  4JI0 F;  4CI0 B;  3PW2 A;  2XMJ A;  4KSE B;  2XMM A;  4ZCM A;  1Q4R A;  2ASL A;  5L38 A;  3CUN A;  2XZT B;  1D8Z A;  2UXB F;  2QA4 G;  3UWT A;  1S76 D;  2RKI B;  3OR1 A;  1T05 A;  2PEB A;  4RWX A;  2RU3 A;  1IBK J;  4CLL A;  2UVU A;  4LFC J;  2LA4 A;  2MQQ A;  3AY0 A;  4M5K A;  1RDR A;  5A6W A;  1Q7L B;  2WVC A;  3ZZY A;  4MIW A;  2HHH F;  3IBF B;  3BSN A;  3CJR A;  1B0P A;  4ZJL A;  4OHV A;  1QJH A;  2FUG 9;  4G6V B;  2WSF C;  3KHL A;  4BWM A;  3ULH A;  3O3L A;  4OI4 A;  4LQ9 A;  1H0H B;  2DR7 A;  2GV1 A;  4QWB A;  3J7Z T;  4RUH A;  4B3S F;  2E66 A;  2I5J A;  2JEI A;  2Z4P A;  4X4N A;  1UZD A;  4NCB A;  2NS1 B;  3IFE A;  3AJ2 A;  5AXL A;  1FTC A;  5KFM A;  5KG6 A;  1YK9 A;  1RHK B;  3W9J A;  4KJI A;  2PGC A;  4RUB A;  4XTT A;  2Z57 B;  3GZ7 A;  1J5O A;  2GHW A;  2OPR B;  4L6V 3;  4X84 A;  1DTT B;  3DN9 A;  3AH6 A;  3SEO A;  5AJ3 F;  1CSJ A;  1BQX A;  2UZA A;  1RT6 A;  3KJF B;  3TUI C;  2CZ9 A;  2F65 A;  4QR2 A;  2AEJ A;  4W90 B;  4HHH A;  2IVF B;  3HK2 A;  2DEJ A;  3P45 B;  3CPW R;  2FQQ B;  2KG1 A;  4USK A;  3OXG A;  2JFD A;  5IS2 A;  4USM A;  2Q43 A;  4JI0 J;  3G8S A;  1TKT B;  3N0V A;  4JOU A;  3VTI A;  1PBA A;  1SJR A;  2FD2 A;  4DXL A;  2CQH A;  2GIR A;  2ZZT A;  3OD2 A;  2A3J A;  3I5A A;  4AT1 B;  3NLC A;  1YKW A;  2MGZ A;  1VS3 A;  2MLY A;  2HVI A;  4NEZ A;  3W62 A;  3KLG A;  3H42 A;  3J7Z 5;  4DSL A;  5L8R C;  5BYQ A;  2HHH J;  1TK5 A;  4DV1 J;  4NA2 A;  1IWA A;  1UFK A;  2QJ3 A;  2XNR A;  4HT7 A;  2DNO A;  2OHD A;  1R3N A;  1RAI B;  1YJW S;  4KHR A;  2VV5 A;  4QWA A;  3US5 A;  1AFI A;  2ERR A;  2YKN B;  3QSI A;  1JLE B;  5SZT A;  1R8A A;  3V81 A;  1S99 A;  3PO5 A;  1NDC A;  1WKL A;  1IR1 A;  3HD1 A;  3N4W A;  4Q2M A;  2PSZ A;  4NLO A;  2JZ5 A;  3MED A;  2H1Y A;  2HFU A;  1BWV A;  4CTA B;  5HVH A;  1W7W A;  1X4F A;  1RTD B;  3J7Y I;  2PI5 A;  1NKE A;  1B7F A;  2ZBI A;  2MKJ A;  4YR0 A;  4EO6 A;  3PYD A;  1TKD A;  1MML A;  5J2N A;  5K14 B;  2NXJ A;  1WG1 A;  1HW8 A;  3H2U B;  2YX1 A;  2V8V A;  3VGU A;  1KKH A;  5DG8 A;  3NGT A;  5GAD I;  2H3E B;  4LFB F;  2RB7 A;  4QW8 A;  4DSK A;  3WIV A;  3K17 A;  4ZP8 A;  1KDN A;  1PIE A;  2IVY A;  4WE1 A;  3LP0 A;  1IR2 A;  2ASD A;  3MEK A;  2G4B A;  3B8H A;  3N6M A;  1S6P A;  3CDW A;  3D54 A;  2BA9 A;  1D1U A;  4B9U A;  3PYE A;  2YX7 A;  1RAC B;  3I9Z A;  1EKR A;  2C2M B;  4FYD A;  4ECY A;  5BJR A;  1KR4 A;  4CZC A;  2OMO A;  3MGJ A;  2MLZ A;  3DYA A;  5GAG I;  3CCS S;  4F7V A;  3H8Y A;  4DV7 J;  1U26 A;  3T9Z A;  3M8P A;  3HP6 A;  1JLC A;  2OEJ A;  4BLG A;  2WZ1 A;  2EW9 A;  2L41 A;  2W2M P;  4KIA A;  3SCJ E;  4J9N A;  3R7B B;  3QGI A;  3SQG B;  3MM5 A;  3JYT A;  3TAQ A;  4H4M B;  3VZH A;  2BJE A;  2LEA A;  4FKX A;  3IXQ A;  5MAO A;  5LXR A;  1JLF B;  2EK6 A;  4ILL A;  3POT B;  4QWD A;  1U4B A;  2FGC A;  5B09 A;  3FEX B;  2MST A;  2GMJ A;  4KO0 A;  2UUB J;  2Y1I A;  1ZTT A;  1N4L A;  3K8W A;  5F41 A;  1IKW A;  5L1J A;  4OYM A;  3TZW A;  9ATC B;  4EMD A;  1FRM A;  1Q86 T;  1REV A;  3OUY B;  1YLX A;  4C97 A;  5KFD A;  5A2Q U;  3IRW P;  5B0A A;  1NM2 A;  5J1E A;  3PEJ A;  4P2X A;  3UW1 A;  2FJX A;  4MJK A;  3W2V B;  4DHV A;  2KB2 A;  1NSQ A;  1RK8 A;  3FKB A;  4Q7A A;  2IY5 B;  1RWX B;  4OJ3 A;  2H5J B;  3QQC D;  1KHW A;  2ZD1 A;  5JVG Q;  2DGS A;  1U1P A;  1UW9 A;  4DX7 A;  5A0Y B;  2N7Y A;  1IKX B;  2JX2 A;  1N5Y A;  1GMW D;  1WC6 A;  2NYI A;  2YNG A;  1Y5I B;  1KQK A;  4ZVF A;  1WC0 A;  1HIY A;  3TZZ A;  5LMN J;  1TFW A;  1TUG B;  3IAS 9;  3JTN A;  2D3O 1;  2IM0 A;  2RF2 B;  1SKS A;  1S1W A;  1HI0 P;  4EO8 A;  1IM4 A;  3B4M A;  2YVS A;  5KFO A;  1SQE A;  1GXT A;  3VAI A;  3VAJ A;  2HAI A;  3R6L B;  1U1M A;  5KFV A;  1GH8 A;  2E5L F;  3LAL A;  3UE2 A;  2VC0 A;  3D2W A;  3Q8U A;  3MUT P;  1JJ4 A;  2MY7 A;  1F3V A;  3N01 A;  2AYE A;  4KV8 B;  4ZPA A;  3KDN A;  3TAN A;  2KFY A;  1NDL A;  2ZBP A;  3EXY A;  1GTH A;  3UCU P;  1J27 A;  4NLD A;  2CPX A;  4W92 B;  2Q6B A;  1VRU B;  3PXG a;  3BBC A;  4URQ U;  3G71 S;  1RU1 A;  4L74 A;  1DQ8 A;  2ZOF A;  3TQ1 A;  3S01 A;  2OAU A;  2V2V A;  3LGH A;  5G0R A;  5L1L A;  2NQP A;  4YY3 F;  2ZH1 A;  3QIP B;  5IT9 Y;  4KHP J;  2ADC A;  3W3S A;  5HI7 A;  2UVR A;  2UXC J;  1KSP A;  3BGR B;  1C0U B;  3EX7 B;  3WC0 A;  1RAB B;  5EX3 A;  2HQ3 A;  4I6Y A;  3OSN A;  1N34 F;  1KHV A;  3M2R B;  5HLF A;  5KFE A;  3R6G B;  1NXI A;  5AXN A;  4K4W A;  3OTC A;  2YKP A;  1VC6 A;  1KON A;  4M5I A;  3ILO A;  1HQE A;  1RT5 A;  3C8Y A;  3M9O B;  4DV3 F;  4ITS A;  2KKH A;  1RBL A;  4X4Q A;  2K7K A;  2B6A B;  5CYQ B;  1JKH A;  5T41 A;  3Q8P B;  1SBR A;  4MFB B;  4F2S A;  4DEZ A;  2A2D A;  3ZTO A;  1LWE B;  2DXE A;  1ZA1 B;  2VIH A;  4N8N A;  4F4K A;  1NK0 A;  1X7V A;  1UEV A;  3M1V A;  5I3U A;  1X4G A;  1URN A;  4C3M A;  1AZS A;  2VQF J;  3GR0 A;  2E9Z A;  2FVS A;  3H25 A;  4DL5 A;  4ZVE A;  2LVW A;  3VV2 B;  2DGT A;  4UQT A;  1VQN S;  1JLQ B;  4I56 A;  4RW4 B;  1X5T A;  4ZPW R;  5THW A;  3P5T L;  4FKY A;  5CD4 A;  2F7V A;  4DQS A;  2Z2M A;  4C48 A;  3G8Q A;  5ETN A;  3TJA A;  1C2P A;  3JSM A;  3LWM A;  3OTE A;  1BY9 A;  2Z58 B;  3DC2 A;  2QC3 A;  1FNX H;  4HYK A;  3GFY A;  4FYW B;  3I56 S;  4PEO A;  4ED1 A;  2QL9 B;  2QT7 A;  4M5G A;  1TK8 A;  3PCO B;  4ZP7 A;  1Q95 G;  3DDN A;  5C2G A;  2VU5 A;  2OEL A;  3KLH A;  2QA2 A;  2AX1 A;  1EET A;  5IXU A;  4PXB A;  3A8J A;  2M70 A;  1O0P A;  4FXW A;  2W7A A;  2HFO A;  3J81 j;  2AJ4 A;  3KG1 A;  5I3Q A;  1GMV A;  1Q0N A;  1UJ4 A;  1T02 A;  2QSW A;  1T03 B;  3CME S;  5FLX U;  4YY3 J;  2BV3 A;  1D9D A;  2R7S A;  2J9C A;  3KLI A;  4ZLP A;  2AX0 A;  2B9E A;  1QDU B;  4OJ1 A;  4NI2 A;  3ILI A;  2MQL A;  4C0B A;  2V2K A;  3TOQ A;  2XS5 A;  4HTJ A;  3C6T B;  1VK8 A;  5KG1 A;  1SIZ A;  4GVL A;  3CC4 S;  4MKV A;  4I64 A;  5HN0 A;  1V5I B;  3NY0 A;  2WRM A;  3HVT A;  2DH9 A;  2X1G A;  4JV5 J;  1AXQ A;  3SCL E;  2XEX A;  2BEF A;  5DET A;  5HJX A;  2CXE A;  3BDP A;  5LM7 E;  1FVS A;  2BMB A;  1HWU A;  1S1T B;  3D6T B;  3KG0 A;  4JP8 A;  1YRU A;  3I82 A;  3QFH A;  1U0S A;  1ZBT A;  4OI0 A;  3FZ2 A;  1RYS A;  4H54 A;  2HHW A;  5L39 A;  3TA0 A;  1H38 A;  2UV8 G;  4NCA A;  3HFV A;  3ETO A;  4ETZ A;  1LNQ A;  4DL6 A;  2VJU A;  1U1O A;  1S9G A;  2DEI A;  2NPF A;  2DIS A;  5DZ7 A;  1PJ6 A;  4CRJ A;  2CNL B;  2VC1 A;  3DRS B;  7FD1 A;  3AB2 B;  1S0M A;  1OPI A;  4IRK A;  4P72 A;  4AL5 A;  1MRO A;  4OHX A;  1SIW B;  3QSY B;  2BJ8 A;  4ECW A;  3PYG A;  3UDE A;  2CPE A;  1Q1K A;  3FCW A;  3NWR A;  2FLN A;  1SH0 A;  2XMT A;  3LGM A;  1VIS A;  2XY6 A;  2EEY A;  2BX6 A;  4WBF A;  4XDC A;  2WAQ D;  2HZC A;  4CLT A;  4D3H A;  2BUN A;  3NAH A;  4DFM A;  2VDH A;  4NLU A;  2YWW A;  1ACM B;  2VDI A;  3BSA A;  2V8P A;  2OKQ A;  1PSD A;  3D0H E;  2OPQ A;  1VR6 A;  4PKD B;  3TQE A;  3H0P A;  3PO4 A;  3C16 B;  2RUS A;  2MQP A;  1Q5Y A;  4V19 X;  4C8O A;  3FSI A;  2MKC A;  5CXT A;  1JWW A;  4KQZ A;  1ZZN A;  5CCM A;  3BGL A;  4MIA A;  1EIY B;  3KK3 B;  4X4S A;  3KUH A;  3KJV A;  4DR6 J;  2J6S A;  4KKO A;  2VON A;  3ZZZ A;  4NA3 A;  4PWD B;  1WOO A;  1RAD B;  5EWF A;  2R4F A;  3S8S A;  5KOX A;  2W1B A;  1ROF A;  1U1R A;  5IOL A;  2FZC B;  3SFG A;  3TI0 A;  4WP8 A;  2BBE A;  5KFQ A;  4CYU B;  1OQ3 A;  2YNF B;  4OV1 A;  3R7S B;  2YWF A;  4DR2 J;  4KHM A;  3QRR A;  1HYS B;  4KH0 B;  3HHN B;  1JK9 B;  3CJS A;  1H98 A;  2WVE A;  1VIX A;  3GCX P;  4LIW A;  1HNZ J;  3T5H A;  1YHQ S;  4WU3 A;  1HBU A;  3IRX A;  1R89 A;  1CS4 B;  2IA0 A;  4EEY A;  3W64 A;  4YP3 A;  1M5H A;  3KNA A;  3K58 A;  4F3M A;  2UV8 A;  2HEK A;  4N76 A;  3OFF A;  3B6B A;  1KD1 T;  1N36 F;  3DFE A;  1FK9 B;  3B78 A;  5GAH U;  2BZ2 A;  2JWN A;  2YNH B;  2XBP A;  5DLG A;  3PIP Q;  5DM6 Q;  2O67 A;  4U8V A;  3MM8 B;  3NNC A;  3CDA A;  1X4C A;  3DXB A;  4UTG A;  2AGQ A;  1JXV A;  4DV2 F;  3Q83 A;  2ZVI A;  4NYP A;  1HNV B;  3G9C A;  3H5S A;  2N4C A;  1E6V B;  1SB6 A;  3SSQ A;  1UMJ A;  4U95 A;  4J9U E;  3RB6 A;  3PRB A;  2NSB A;  3C15 B;  4DN0 A;  4O23 A;  3PTW A;  5C42 A;  4M95 A;  2FHJ A;  1QSL A;  3UD4 P;  1SPB P;  3AXM A;  1CUL B;  3NWG A;  1IKY A;  1BQN A;  4U6P A;  3DOL B;  2ROP A;  4OHW A;  3KLF A;  2YKA A;  2OPP A;  4MT1 A;  4NEY A;  1X5O A;  3UFC X;  4ZK7 M;  2QMU B;  3Q8V A;  3ENV A;  2KM8 B;  2P2C B;  1WOR A;  1JXE A;  3A8E A;  5L9X A;  1K9M T;  1ZM9 A;  1NHU A;  2XZD B;  1U49 A;  1S0N A;  3KLV A;  2DNH A;  4DV5 F;  1SKW A;  1QAJ A;  1WD6 A;  1UWA A;  3DRP B;  1WC3 A;  3TW0 A;  1IKV B;  2C3Y A;  4K50 A;  4OI1 A;  4WTO B;  4DR5 F;  3AOA A;  4HKQ A;  4PAA A;  2ZKT A;  2U1A A;  1RTJ B;  5BR8 F;  2OSQ A;  1YWX A;  2DRD A;  1T3N A;  1NRK A;  4YOE A;  4LF9 F;  4WZM A;  1S0V A;  1I94 F;  2HHS A;  4YR3 A;  2A6O A;  2J6T A;  4A8F A;  1OSD A;  1T9W A;  5KT3 A;  2BYC A;  2DGW A;  3NMA A;  3DLL Q;  3CCW A;  2XG8 A;  2CQ2 A;  1M1G A;  5F9L A;  4S0M A;  3J81 U;  2CVE A;  2CNK B;  2VBX A;  2BRL A;  5M2U A;  1YI2 S;  4X65 F;  2J0X A;  3R5A A;  4OHZ A;  1U6F A;  1FI4 A;  4X64 F;  3SIP B;  1RHJ B;  4H4O A;  4OYZ A;  3S1T A;  4BHQ A;  2WOM A;  1WWH A;  4LF6 F;  5F8J A;  4P9S A;  2A10 A;  2HWT A;  1AA1 B;  1Q8L A;  1HNX J;  2O66 A;  1Q8B A;  4B02 A;  2CG4 A;  2XUL A;  3W61 A;  5HJY A;  5DJB A;  4ED4 A;  3IR5 B;  4C11 A;  2HHQ A;  2EBG A;  1F9H A;  3D3C J;  5DDQ C;  4LVN P;  4F04 B;  5HRO B;  1IJF B;  3VVU A;  3PW0 A;  2V4J A;  5L1I A;  3OTD A;  3MTK A;  4U9R A;  3MPY A;  4L75 A;  4UY8 5;  3MPU B;  1RB0 A;  2DHX A;  3D6F B;  2ADB A;  1K1Q A;  4ZIW A;  1V3S A;  2XS2 A;  3K57 A;  3KLE B;  4J9P A;  1B0T A;  2IMW P;  4FYY B;  4PRF A;  1FF2 A;  4K4V A;  2GVD A;  4DR5 J;  1YZ6 A;  2ZM6 F;  4DV0 F;  2VFU A;  3BN7 A;  1JNZ B;  3ISN D;  3R9L A;  2I1R A;  3GIR A;  4DR4 J;  2IM1 A;  4L76 A;  1RTI B;  1OY8 A;  4U96 A;  3DRY A;  3Q8Q B;  4UST A;  4JI8 J;  4JI5 F;  3SI8 A;  3DLJ A;  3KJN B;  2GQC A;  2W9C B;  3DKD A;  1HMV B;  2EWH A;  3X1L B;  2AEF A;  2ZBC A;  1ZM4 A;  1HWK A;  5C25 B;  4Q43 A;  5K20 B;  1YJU A;  2XYG B;  3P4U B;  1F1B B;  3A4T A;  3L95 X;  3ONQ A;  3FSY A;  1Q5V A;  2OPR A;  2VPW B;  4C3L A;  1DTT A;  5KG2 A;  4FF2 A;  1DBD A;  4M5H A;  4Y0F A;  2CPF A;  3BGO P;  2LA6 A;  3GSI A;  5F8G A;  4IG0 A;  2GS8 A;  2ZC4 A;  4NCG B;  4EUV A;  4HHJ A;  4Y34 A;  2NRE A;  4Q8E A;  3JQM A;  4LRD A;  4EZ9 A;  3EMT A;  2C2E A;  1XK8 A;  1J2V A;  2JEF A;  1H7X A;  3QRP A;  2BAN B;  2IDL A;  4DCP B;  3R5B A;  2HK2 A;  1WHY A;  2YWG A;  2CQB A;  3A8K A;  3MM6 A;  3M6V A;  1QE1 B;  4OMF G;  3T6B A;  3VAF A;  4DV6 F;  3ZZP A;  3T1H F;  3FBE A;  4DUZ F;  2AZ1 A;  1M5K C;  2XSJ B;  4EK2 A;  3W66 A;  3QGH A;  2UXD J;  4CP5 A;  2XLI A;  1XMO F;  2W8K A;  3MXH P;  1S97 A;  2LQ5 A;  2VKR A;  4RW8 A;  3BO3 A;  4CWB A;  4Z7Y A;  3W8P A;  5GMD A;  2ZHB A;  3K5L A;  4Y2A A;  2YWE A;  3KMS A;  4C6A A;  4CH1 A;  1JLE A;  4OZ0 A;  4N5S A;  1RIS A;  1XR7 A;  2K06 A;  2BQR A;  1VQ5 S;  3H4B A;  1U02 A;  2H5I B;  3NCR A;  2WBM A;  4GMK A;  3AAW B;  4LF8 F;  1K44 A;  1DQ9 A;  3M8Q A;  4LQ3 A;  4QR1 A;  4JI2 J;  1T9Y A;  1QAY A;  4ERD A;  1IQZ A;  4CO3 A;  3TZX A;  3PFO A;  2HKE A;  3GJT B;  4ZHR B;  3HO1 A;  1RT4 B;  3W2W B;  1M1K T;  2V8G A;  1RTD A;  4GKJ J;  2JSX A;  6AT1 B;  3FCV A;  2ZE2 B;  4DUT A;  5A6P A;  3FQL A;  5K14 A;  2ASY A;  4JI1 J;  1MMN A;  4CO4 A;  2Y9H A;  2XLK A;  1N33 F;  2E5I A;  4MAK A;  1ZYQ A;  4G65 A;  1YBT A;  1S79 A;  2QFI A;  3SQO P;  3CJ2 A;  4V19 J;  4ZVO B;  1WUU A;  4ED2 A;  1FD8 A;  3D1H A;  1RP5 A;  1SKU B;  2LDI A;  1VQ8 S;  3EVM A;  4OJG A;  4ZCK A;  3R5D A;  2HQC A;  1SJ3 P;  1UJ6 A;  3KDO A;  2DR8 A;  2XY5 A;  1UPM B;  3RRK A;  1KOO A;  2P8I A;  3M8W A;  1XMO J;  3CC2 S;  2IM3 A;  1YZ7 A;  1EHW A;  4J9L A;  4LBH A;  4R25 A;  2M4M A;  4A4J A;  2DGV A;  3P8B B;  1VQM S;  3NOC A;  4XIU A;  2YWK A;  4RBV A;  3SQG A;  4ES3 A;  4YB5 A;  4H4M A;  3NCP A;  2M9K A;  4ID8 A;  1PC4 A;  3JAM U;  5D0R A;  3GJQ B;  3HHL D;  3M30 A;  1JLF A;  1VHI A;  3TAM A;  2MEW A;  4K4Z A;  4NRU A;  4DR3 F;  3EDQ B;  2J8S A;  3GII A;  1HQU B;  3MZI A;  1RLC L;  3P6Y C;  4O3P A;  2OIH A;  1CQN A;  1WC1 A;  4DSF A;  4X4T A;  3RW7 A;  4G1I A;  2PD1 A;  1HHS A;  1WI6 A;  1JLB B;  3W2V A;  3TYT A;  4LF5 J;  1FRJ A;  3WZ0 A;  1GMW A;  2ALY B;  4B3T J;  1RT2 B;  3J7A N;  1KQG B;  3DCA A;  2AGP A;  2X1B A;  4RW6 A;  4Y6I A;  4KR0 B;  4LRC A;  1G2E A;  2JLG A;  3OXL A;  3OW2 R;  1RZM A;  4ANC A;  2BJ7 A;  5MLC V;  1N33 J;  4Q0B B;  2WSE C;  4NZ6 A;  3ET6 B;  4ED0 A;  2QG9 B;  4ED7 A;  1RA7 A;  4KB7 A;  2JLF A;  3H4D A;  3VAM A;  2BJ9 A;  3V6K A;  8RUC A;  1VQO S;  1IN0 A;  1VBZ A;  3T19 A;  5ETV A;  4I68 A;  2RF2 A;  3IM9 A;  4CO0 A;  2XHW A;  1KRP A;  3UD5 A;  3ISN C;  4DCO B;  1Z2Z A;  2A18 A;  1WSR A;  1YBU A;  1DJ0 A;  2HRT A;  3PX4 A;  2BOP A;  3WC2 A;  3O5T B;  1TTH B;  5I3P A;  3CCV S;  3Q23 A;  1YX2 A;  5LMU F;  3NOG A;  1JQG A;  2F8E X;  5H1S V;  5AE3 A;  2W7P A;  1KVJ A;  2MHE A;  3THP A;  3CCJ S;  1XJW B;  5DDP C;  3O44 A;  2C28 A;  3HT3 A;  1M5P C;  3MI7 X;  3MM7 B;  2GJ2 A;  1P9Y A;  2RQK A;  3VCD A;  3JQK A;  5E3P A;  3GV5 B;  1SKR A;  3LPE A;  1OWX A;  3VF0 B;  1XNR F;  3OFG A;  1LWC B;  5IZH A;  1EP4 A;  2V0N A;  4J9K A;  5ETT A;  1XR5 A;  2RIL A;  3QAT A;  5L1K A;  2MZJ A;  4MKB A;  4ECU A;  3ZXW A;  3RRG A;  3QIP A;  3OQ2 A;  2CYY A;  4URS A;  4N56 A;  2R2U A;  2MZR A;  1S4F A;  2EG2 A;  3IG1 B;  2DIT A;  1Y9O A;  1FKO B;  1IBM F;  2RDD A;  2ZBR A;  2KDO A;  4DUY J;  4U7C A;  1TZ0 A;  4NXN J;  4WIQ A;  1X5S A;  4RKU C;  4PUO A;  3M2R A;  1XNQ F;  3D9B A;  3KMQ A;  2RRA A;  4YN3 B;  3PM9 A;  5E3R A;  3BSC A;  4O3N A;  2CAD A;  4DJB A;  3NMR A;  4ZVG A;  2VG7 A;  1UVK A;  5LJ3 Y;  3CXC R;  2NLW A;  1N88 A;  4K0K J;  4Y2M A;  1LWE A;  3C3L A;  1ZS6 A;  2FY8 A;  1JLG A;  1XEZ A;  1N56 A;  1K8A T;  1WEZ A;  2PE8 A;  1GXU A;  2BR0 A;  4WFN Q;  1UCN A;  2QIF A;  4CH0 S;  1OYE A;  4FN5 A;  1XC9 A;  4ZIT A;  1TV6 B;  1T9T A;  1GXL A;  3DGP A;  1UTA A;  4RW4 A;  4KGV B;  4DMZ A;  1S9F A;  2FTR A;  1SC1 B;  3DHW C;  2M88 A;  4OZ2 A;  1FFW B;  4NAS A;  4G1Q A;  1X4H A;  1RXO B;  1P1L A;  3E3X A;  2B56 A;  1NEE A;  4IR1 A;  3DGV A;  2GJF A;  1QSS A;  2J76 E;  4CLS A;  4DPW A;  5C24 A;  3QZ8 A;  4F3Q A;  5J2P B;  3QYY A;  5B0D A;  4CLP A;  3JS9 A;  4C9D A;  5BYR A;  1FX2 A;  2CDR B;  2H54 B;  4EWT A;  4ZN1 A;  1CPZ A;  1LV5 A;  2FVR A;  4P10 A;  1JMT A;  1XNR J;  4GO5 X;  4P6Q A;  1NJZ A;  3HDS A;  3JSB A;  2XCP A;  2W2N P;  2FJD B;  1APS A;  3IC1 A;  3T41 A;  3LO3 A;  1BWE A;  3TWZ A;  2DCU B;  5F0U A;  1HBN B;  1N8R T;  3MMA B;  4ED5 A;  1A7G E;  3TUJ C;  1RTZ A;  1NK4 A;  2VFT A;  5M2R A;  3V4I B;  2IAJ B;  2XQC A;  5D3G B;  5ITH A;  1S57 A;  3JTP A;  1VLO A;  2KH9 A;  1CC7 A;  1VMB A;  1VIO A;  3H7H B;  2LEP A;  1FER A;  3CDU A;  2DTJ A;  1AUS L;  2F8H A;  4CLZ A;  4JV0 A;  1G3O A;  3DOM B;  1RUS A;  4YHH J;  2O1P A;  3QO9 B;  5J2M B;  3NP5 A;  3ETM A;  4X4P A;  1Y5L B;  4CLK A;  1U6B A;  2GQ2 A;  3J80 U;  1S1T A;  2VJV A;  4OX8 A;  4DPY A;  3HHL C;  1RKJ A;  1NB7 A;  3VZI A;  4ECT A;  3KNG A;  4HI1 A;  1VK3 A;  2UUC F;  4MKY A;  1VGY A;  2M3D A;  1YRT A;  5C5J A;  5G4D A;  1R27 B;  5HQL A;  3SFU A;  4KBI A;  1LXJ A;  4QW9 A;  7AT1 B;  3ILJ A;  4ETX A;  1TL7 B;  4IDK B;  3DRS A;  3G6E S;  3EE3 A;  4QBU A;  4HH0 A;  4OYA A;  4ZJQ A;  2JH3 A;  4ECR A;  4U7U K;  4PYD A;  1B0V A;  4FS2 A;  2DIV A;  2KXN B;  1D0E A;  3BBF A;  1W2B R;  4O44 A;  1PYO B;  2B8Q A;  3QFW A;  4F3O A;  3TAR A;  2E5H A;  5IFM A;  2LEC A;  3PR5 B;  5KT6 A;  2OD4 A;  3MFI A;  5IQ6 A;  3OR2 B;  4WZQ A;  3MUM P;  2V94 A;  3FCH A;  2CVI A;  4RU9 A;  5DQG A;  2DO4 A;  4E2F B;  4EFA C;  5EHH A;  4CLW A;  4FF3 A;  1FDA A;  3KK2 A;  2Y8W A;  3ZTR A;  4C8N A;  1TR0 A;  3G82 B;  2CWK A;  4AUK A;  2R8G A;  4IUF A;  3PY8 A;  3SYZ A;  4ZPT R;  5HBM A;  3CT9 A;  2WB4 A;  5A8K A;  3OJU A;  3CIM A;  1RAO A;  4ICL B;  2IJN A;  4DQP A;  5K8O A;  3OPK A;  3FDS A;  2V4R A;  1UKU A;  2ROG A;  3VAK A;  3M6W A;  4ZJO A;  3RR7 A;  4AL6 A;  2R2T A;  4C0O C;  2RS2 A;  4HI2 A;  4PWD A;  3AT1 B;  3FMW A;  1F2H A;  1HD1 A;  4DL2 A;  1ICE B;  2QZ8 A;  2ZVS A;  4JYA J;  3EGV A;  3N6L A;  2R7O A;  4WII A;  2R7R A;  4B9V A;  2N3O A;  4QWE A;  4CYU A;  4I67 A;  2YTC A;  4RO0 A;  3BB5 A;  5EGY A;  5HQM A;  3LQV A;  3TEG A;  3EPG A;  2VKZ G;  2CPH A;  1RCX B;  2RQM A;  4IH5 A;  1NPK A;  1SH2 A;  5DZ6 A;  4I2Q A;  4HDG A;  1FJ7 A;  2VF3 A;  3CO9 A;  2W4P A;  3QJJ A;  4CDI A;  1NBE B;  1VJQ A;  2HQD A;  3LP1 A;  1NME B;  5KFH A;  2DXF A;  1N0V C;  2MTL A;  1D8Y A;  2CJY B;  1TEL A;  2R9L A;  1CS4 A;  1B64 A;  4X66 F;  3HHD A;  1F0X A;  1NAQ A;  2BOA A;  3VGS A;  2HBR B;  5CYM B;  1VDH A;  1RCO B;  4CLF A;  2MQ8 A;  2RJZ A;  3K5P A;  1WHV A;  3C66 A;  2YNH A;  4AL7 A;  4TU8 A;  2UUW A;  3OTO J;  2ZFH A;  4IO9 Q;  3MM8 A;  1F6T A;  1TL4 A;  3TUP A;  3HVW A;  1RU2 A;  1IBC B;  3H90 A;  2BKO A;  4ZCI A;  2HFZ A;  1E6V A;  5IC4 B;  1LWF A;  1EKS A;  1RWW B;  2PFD A;  1QAI A;  3RYL A;  1RI7 A;  2I8E A;  2EFQ A;  5D6G A;  3C15 A;  1VRT B;  3D28 A;  3DLK A;  2FLL A;  4JUZ A;  3DLH A;  3N5B A;  4ECX A;  5IC6 B;  1G7C B;  4QJV A;  1TL1 B;  1U8W A;  1WAC A;  3R8Y A;  1FKP B;  3N5F A;  2AF6 A;  5EDW A;  4ELT A;  4USW A;  2AP6 A;  5U47 A;  2Q79 A;  4ZVU B;  4W98 A;  5CH7 B;  3KK1 A;  1WF1 A;  2GVZ A;  1NHK L;  2BJ1 A;  1U2F A;  1RTH A;  5I4M A;  2YH0 A;  2DNP A;  3AJ1 A;  3I0S B;  1C1C B;  2MKI A;  3OVA A;  3OHB A;  2F4V F;  2OFH X;  3MR6 A;  1A0O B;  3MF5 A;  2EG1 A;  3N9U C;  1T9V A;  2MDA A;  3OL9 A;  2DNK A;  2BDP A;  1DAR A;  4O4G B;  2BKN A;  2WK4 A;  3HXM A;  3DLE A;  1D3W A;  4CIO A;  3R2D J;  2L48 A;  2CQG A;  2APO A;  4X4R A;  1KLN A;  1UFW A;  2I6W A;  1U45 A;  2P9G A;  4QPX A;  1U2C A;  3IP0 A;  3GJR B;  5HP1 B;  2HMI B;  1NH8 A;  1C1B B;  4WK3 A;  1TL3 B;  2G2O A;  3FNN A;  1Z4U A;  1BHN A;  4LSN B;  1F3F A;  2XNQ A;  2D69 A;  3D6M B;  5F8M A;  2KI2 A;  2MPU A;  3UNG C;  2QLX A;  1TUW A;  4F4Y A;  1ZPW X;  2GO9 A;  1CJU A;  1FJG F;  5E3Q A;  2W2O P;  1UVM A;  3W9I A;  1NJY A;  2QTW A;  4DX6 A;  3EDR B;  1RAA B;  3B54 A;  3JB9 k;  4R0J A;  1FNM A;  3R3T A;  3ZNU A;  2ATL A;  2CIM A;  3H20 A;  8AT1 B;  3E01 B;  3MMC B;  3NGK A;  1Q8K A;  1G1X A;  3AB4 B;  4YQW A;  1SCJ B;  5DLF A;  3QT5 A;  1T05 B;  5ETL A;  2JLE A;  2EC2 A;  4J37 A;  2R7T A;  1GEH A;  1CJT B;  1FJC A;  2CPD A;  3CCQ S;  2R3V A;  2LQJ A;  2GC8 A;  4DR1 J;  5C7P A;  3KHH A;  4RNH A;  4IQM A;  4IFV B;  5GAE I;  1YIJ S;  4UOF A;  1B70 B;  1N5V A;  5KFA A;  3X3U A;  4QPT A;  4LBP A;  4HH1 A;  5HRO A;  4PWU A;  3L7P A;  1SJ1 A;  4HLB A;  4JI3 J;  1VFJ A;  4FYX B;  4HAC B;  2HG4 A;  4B9N A;  2I5J B;  5KFT A;  4FBT A;  1YTY A;  3KLE A;  2XZW A;  3NCQ A;  4PZV A;  3DMJ B;  1U25 A;  3GFZ A;  2IYI A;  2AQ4 A;  4XPC A;  2L08 A;  2Y0B B;  3THT A;  2KZM A;  4IKA A;  1FWL A;  3MM9 B;  2MXY A;  3S6E A;  1NPR A;  3PJ9 A;  3V5R A;  3Q8S B;  3TJ9 A;  2EFP A;  2P6S A;  1FCA A;  4QIW D;  2ZHO A;  3EZO A;  3SXL A;  3D5M A;  3EWG A;  2QYG A;  4BC7 A;  1TP7 A;  1OS5 A;  2AGO A;  3H2V E;  5DS7 A;  1IBL F;  2CPJ A;  5K9F A;  2YNI A;  2BQU A;  2HVH A;  4DF4 A;  3CD6 S;  3QAE A;  3QMQ A;  5D78 A;  1TFY A;  2QLW A;  4PYA A;  2R8H A;  3F56 A;  1Q7Y T;  4GKK J;  1DRZ A;  1HAR A;  2RDI A;  1Q16 B;  4H4K C;  2O01 C;  2LEB A;  4M1K A;  1K0V A;  2MGZ B;  2IDE A;  2CNN B;  3QWP A;  3E2E A;  3OJS A;  5FD1 A;  3KLG B;  4Y65 A;  2VD3 A;  5LSL A;  2M2B A;  1BE4 A;  1DTQ B;  2BW2 A;  3TA2 A;  2JNJ A;  4FXD A;  5FJ4 A;  2IRX A;  1QE1 A;  4J9V A;  1WHX A;  4M5M A;  1MU2 B;  4IG3 B;  2HHX A;  4DQQ A;  2C22 A;  2R7U A;  3OFE A;  1KBR A;  4CNY A;  5AXK A;  5D4P A;  3BH6 B;  4ZPD A;  3SZ2 A;  3GV7 B;  4KAI A;  2HS0 A;  4IOA Q;  1TU0 B;  2J9D A;  2FVC A;  3MED B;  3A13 A;  2EFG A;  2EI5 A;  3BN4 A;  1FXL A;  1R8B A;  3J7Y U;  2GNK A;  2G13 A;  1D9F A;  4DV4 J;  2D74 B;  1RSC A;  2QMX A;  4URG A;  4QYZ J;  3S7R A;  1JB0 C;  4NZ7 A;  4ZDN A;  1S7I A;  5J2N B;  4F50 A;  2QE5 A;  2OPS A;  3H59 A;  1J5E J;  1JJ2 R;  1VQS A;  2M52 A;  4EYI B;  3BPS P;  1LFW A;  4I69 A;  5F9N A;  4ECZ A;  3GYX B;  5GAD U;  4ILR A;  1RWN B;  2G9O A;  3I96 A;  4C0H A;  2MJU A;  1L5U A;  4I7F A;  4ZCL A;  4ZIV A;  2AYB A;  2ZE2 A;  2D9P A;  3M2U A;  4P74 A;  5KFI A;  3W65 A;  1XMQ F;  1XTZ A;  4WE1 B;  3LP0 B;  2CJX B;  1Y4Z B;  5HMX A;  3RB0 A;  3TO8 A;  1S6P B;  4RNM A;  1UJ5 A;  4X4V A;  1HWJ A;  3D68 A;  2RUG A;  4RR5 A;  5HK4 A;  4K4T A;  2DNZ A;  1QTN B;  2W7O A;  4NXM F;  2H65 B;  4R8U B;  3OL7 A;  2E7V A;  1K47 A;  4JI7 F;  1X60 A;  5IWA F;  5GAG U;  1VCT A;  1HR0 F;  1WTB A;  2LXI A;  2G2Y A;  1H6K X;  4FF1 A;  3M8P B;  2E1R A;  4XO0 A;  4HL9 A;  4NLT A;  5EUH A;  2MQM A;  3DM2 A;  2UXB J;  3K7R A;  1P1T A;  1DZ5 A;  2W2P P;  3NAI A;  2RH3 A;  3BM7 A;  3I0R A;  1BMQ B;  3M6X A;  4KFB A;  4KO0 B;  2MQO A;  2KVQ E;  4WF9 Q;  5EWG A;  1N5Q A;  1NLK L;  2NCK L;  4ZVH A;  1NJW A;  2M7S A;  3QWU A;  4L3K A;  1RWV B;  2ZZN A;  4LRE A;  3MR7 A;  3FC9 A;  1REV B;  2Z30 B;  2CG8 A;  3HHL A;  1FRI A;  5DG7 A;  3ELH A;  3BR8 A;  1TKX A;  2QSF A;  5J1E B;  1B99 A;  2H5E A;  3BGU A;  1TAU A;  1W2I A;  1UET A;  4B3S J;  2C2K B;  4RX6 A;  2NPI A;  2ZD1 B;  1U0H A;  1AYE A;  2C42 A;  4LF4 F;  1U24 A;  4OZ5 A;  4DSJ A;  5LXY A;  1ZM3 A;  4TXS A;  2L9N A;  2HFS A;  1TMM A;  2AEM A;  3UR3 C;  1GT8 A;  4C8L A;  2AKW B;  4LR7 A;  4A8K A;  4HEA 9;  5IT9 U;  3FQK A;  1JLB A;  2BJD A;  3JQJ A;  4YB6 A;  4OFZ A;  1XMQ J;  5DGA A;  4YDX A;  1Y5N B;  5AJ3 J;  4NLS A;  1Y11 A;  2LYV A;  1UW4 A;  2CQD A;  2E1M C;  1DHM A;  1OPZ A;  2B8P A;  4ZLL A;  3L3C A;  2OFG X;  2OEM A;  1MNE A;  1PGZ A;  2MZ1 A;  4LFA F;  3CGI A;  4Q0B A;  3EVO A;  3ET6 A;  2B5J B;  2C2O B;  2DD8 S;  2R8K A;  1NSP A;  3HSG A;  2H9Z A;  1R0C B;  1GTE A;  1SH3 A;  2JRS A;  3E51 A;  4KYZ A;  2E7W A;  3TVK A;  1AFJ A;  3VR1 A;  4FF4 A;  2FLO A;  3ZZT A;  2ZOG A;  2B43 A;  3O2I A;  4I2P B;  5ETP A;  3BEG B;  3SV3 A;  1LEO A;  5A76 A;  1N32 F;  3K0J A;  3EGZ A;  2VPY B;  5KFK A;  1X9S A;  4FZV A;  4TYB A;  3CCR S;  2J7W A;  1QUP A;  3C14 B;  3DI6 A;  1UWB B;  2VAS A;  1ELO A;  4OX7 A;  3DOK B;  3G2X A;  1HA1 A;  4K2J A;  2OSR A;  2DYA A;  1UVL A;  2UVW A;  3IWX A;  5G0R B;  4O3Q A;  4TQR A;  5B7W A;  4QR0 A;  3MM7 A;  1L3K A;  5FDL A;  2NSC A;  2XMK A;  5B08 A;  1ARO P;  2JJ4 D;  4FPI A;  5J2Q A;  4MMO A;  1Q8I A;  4RBT A;  1T94 A;  3IS9 B;  1IVZ A;  1LWC A;  1JLA B;  1CVJ A;  4QYZ K;  5KFX A;  1S12 A;  4Q45 A;  4B17 A;  3P3D A;  3AXK A;  1FXR A;  2KU7 A;  2LMI A;  1JJC B;  5HAO A;  4DLE A;  3BPD A;  4ENO A;  2ZJQ Q;  2R2R A;  2FY1 A;  3IG1 A;  2H4W B;  2LFV A;  3CCU S;  4K5S A;  1BXN A;  4ZPV R;  2WON B;  3BQ1 A;  2BAC A;  2MYF A;  1FEE A;  2Z56 B;  3CDB A;  4L72 B;  1LKZ A;  1S0O A;  4FVC A;  1FRX A;  1VBK A;  3H5X A;  3V2U C;  1AZS B;  3G8T A;  4LFB J;  4LFA J;  2C3M A;  2QMW A;  3HSJ A;  4ES1 A;  2MMY A;  5F8L A;  3NXZ A;  2XMA A;  2DGU A;  3WX4 A;  4WWS A;  3JSM B;  2ZJP Q;  4LBI A;  1LW0 A;  2VQE F;  4NWB A;  2GQQ A;  2RML A;  3KLH B;  1TV6 A;  2KT2 A;  3HD2 A;  3KG4 A;  5BXI A;  1OY6 A;  1R8C A;  2CQ1 A;  5KFU A;  3T1A A;  5K8N A;  3IGV A;  2KTQ A;  4CLU A;  3MAA A;  1MWQ A;  2PA3 A;  3ENW A;  4NLP A;  1WOP A;  4K8R A;  4C8M A;  4AQY F;  4M5D A;  1T8E A;  3B82 A;  1MLA A;  4JI4 F;  3GIJ A;  1WC5 A;  1X8D A;  4I0W A;  2C3U A;  5J2P A;  4WTY A;  3TRG A;  1AW0 A;  4KC5 A;  1B3T A;  4ELU A;  1KS2 A;  1RAE B;  3PG9 A;  5DM7 Q;  1Q78 A;  3PRD A;  1FFS B;  4I6W A;  4NI2 B;  1R8H A;  4PR6 A;  1KTQ A;  3OVB A;  1OMS A;  1JX4 A;  3CCE S;  3CWJ A;  1RAF B;  3VWS A;  2Q66 A;  1PJ7 A;  2XYH B;  3ADA C;  3ICL A;  1FVQ A;  4A8M P;  3HKW A;  1KTV A;  3T1Y F;  3V4I A;  2IAJ A;  3MMB B;  2F9D A;  5D3G A;  2SXL A;  4IH6 A;  3CJ3 A;  2ZH9 A;  2DY9 A;  5B0E A;  3K5N A;  4DWI A;  1FDD A;  2Q1L A;  3ZTS A;  4XPE A;  5KT7 A;  1VRQ C;  3G6X A;  4DLG A;  3BKT A;  3D66 A;  3BSO A;  4OIX A;  2MQN A;  1CJV A;  2CQI A;  3MOZ A;  4EBC A;  2POK A;  2XTJ P;  3OT9 A;  2GHV C;  4DPO A;  2GMH A;  3DOM A;  1F60 B;  1K73 T;  2A1B A;  2MHN A;  1IUJ A;  3UPF A;  5J2M A;  2FIU A;  3FFI B;  3UVJ B;  4DZD A;  2EFN A;  4MIB A;  4QIV A;  1QM9 A;  2V2Z A;  2HZV A;  2VPZ B;  2PFF B;  1H2U X;  2B4P A;  2LKZ A;  1V3R A;  1SXL A;  4NZ0 A;  5E2Q A;  4TLQ A;  4WKY A;  4Q8F A;  2CPY A;  2NUU G;  4PXE A;  1S6Q A;  2WCX A;  4QIG A;  4OYX A;  2E5L J;  1NH7 A;  3CJK B;  1TL7 A;  2AW0 A;  4ZMM A;  2JVO A;  4X62 F;  5A8R A;  1VLY A;  3MAH A;  2I0X A;  2RHQ B;  3HVA A;  4BS2 A;  3MR3 A;  2KO1 A;  2K3K A;  2DT9 A;  4A8X A;  3VQS A;  4TY8 A;  2CWX A;  4LF1 A;  2X7I A;  2PN6 A;  5J1N A;  4LR8 A;  3UN3 A;  4MYT A;  4DN9 A;  5ETM A;  2H4Y B;  1S77 D;  2AMC B;  1R0A A;  3AHP A;  3OR2 A;  1KLM B;  5K8P A;  3WX8 A;  2C2Z B;  1HI8 A;  3CW2 C;  1TUV A;  3FSX A;  3KWM A;  1NJI T;  3MTJ A;  4I4B A;  1YJR A;  5CQG A;  1O6X A;  3NS5 A;  2B4V A;  4DR7 F;  2HBQ B;  2RNE A;  1VQ7 S;  4RU2 A;  3RAX A;  3TX8 A;  3G82 A;  5KG0 A;  5KT2 A;  3FBF A;  1N34 J;  3RBD A;  2FJV A;  1BQM B;  4B3R F;  2DPJ A;  2V8D A;  2CFX A;  2B7C B;  4H4K A;  2ZNY A;  4HTI A;  1QLN A;  1BGX T;  4DV3 J;  4F02 A;  3FBC A;  2VOO A;  1WDT A;  1N48 A;  2DKO B;  2HBZ B;  2GGP A;  4OI3 A;  3DRR B;  4J90 A;  3MR5 A;  4ZP9 A;  1P9Q C;  1P6T A;  2GHP A;  2Y1J A;  4YDD B;  1RBO B;  2H48 B;  1X31 C;  3OV7 A;  1HNI A;  3IRX B;  2OGU A;  3BV8 A;  1KEK A;  4G1P A;  3MPD A;  4KGZ B;  2GJI A;  1MN7 A;  2FVQ A;  1A6L A;  4NLG A;  5KFB A;  1VI7 A;  2U2F A;  2VL1 A;  1NK6 A;  1JJH A;  1Q81 T;  5CAB A;  4GO7 X;  1NU4 A;  1SV5 A;  2HAF A;  1XER A;  2KXH A;  2W4D A;  1S1V A;  3EUN A;  3PX0 A;  1AT1 B;  1LW2 B;  3VHQ A;  5CYM A;  1TK0 A;  2DNG A;  2RQC A;  1CC8 A;  1DFD A;  4EGL A;  5C42 B;  4OZN A;  1KP6 A;  2E1P A;  4DS5 A;  1QUV A;  1TVR A;  2V9K A;  2KG0 A;  3IWL A;  3WQP A;  5F8I A;  4AXJ A;  1T7P A;  3M4X A;  4CCH A;  2VG6 B;  1O5J A;  1U8S A;  3KLF B;  1VJW A;  1DUR A;  2OPP B;  1PJ5 A;  4LFC F;  3WBZ A;  2VBW A;  3LAN A;  4YUD A;  4DR7 J;  3QLH B;  2FHK A;  3M8S A;  1FXD A;  1R43 A;  3PIO Q;  1FKP A;  4ATN A;  5DDR C;  2IRY A;  2DR6 A;  2K1R B;  3A1Y G;  3MEC A;  4TQS A;  3D7S B;  1RAG B;  3MHY A;  5HVF A;  3I9V 9;  4ECS A;  2WVB A;  2BJ3 A;  4OLP A;  1LK5 A;  3I0S A;  2DIU A;  2P6T A;  5B0B A;  1T11 A;  2KJW A;  1RWP B;  2RD5 C;  2KXF A;  2FYX A;  4TU9 A;  4O4G A;  1SL2 A;  4WFB Q;  1S4E A;  2WVF A;  4KH1 B;  2IM2 A;  2HS3 A;  2I2Y A;  4ZPB A;  2R8J A;  2WW4 A;  3MCS A;  3T3F A;  5KFN A;  2EXU A;  2AU0 A;  5HP1 A;  2HMI A;  1TL5 A;  2NZ4 A;  3D6H B;  3T5K A;  4UUW A;  1FTR A;  5JJB A;  4O4R A;  1WF0 A;  4LSN A;  4E8U A;  1FRL A;  2KRR A;  3BDE A;  3UN5 A;  4P73 A;  3EM1 A;  1Q53 A;  2RU9 A;  2Z0G A;  3R7N B;  2DO0 A;  5D4N A;  3MD3 A;  1RT7 B;  2QX0 A;  3MEG A;  4B3O A;  1C0T B;  2A6M A;  1SC6 A;  3GU0 A;  1G6B A;  1F9F A;  3E01 A;  2IJF A;  2LU2 A;  3MMC A;  2HIQ A;  4C11 B;  3M8R A;  5H9F J;  2KT5 A;  2W9B A;  4ZP6 A;  3M7V A;  1X0P A;  4B08 A;  4QWC A;  2V4J B;  1RGV A;  4UF4 A;  3CDE A;  1CJT A;  5T7L A;  2HGM A;  3NKY A;  5ETK A;  3MEE B;  2KJV A;  3SCK E;  4DV1 F;  4Q5V A;  4ZLJ A;  3TEH B;  1XBW A;  5CAA A;  4IFV A;  2NXU A;  1Y3J A;  2PO4 A;  2LDY A;  1VQK S;  1I5O B;  4PG4 A;  4LRF A;  5K8M A;  2GVD B;  4E98 A;  2M8H A;  5HAN A;  3R5J B;  4CM2 A;  4RW7 B;  1OJ4 A;  4OYB A;  1WEX A;  2VG5 B;  4HAC A;  5CCL A;  4O3O A;  1H2T Z;  3EZU A;  3PJW A;  3T6J A;  3C6U B;  3DMJ A;  3GPA A;  3ZZ0 A;  2VPX B;  3CED A;  2HHU A;  2GAG C;  4GRS A;  2VZ9 A;  2HQI A;  4LVO P;  1L3U A;  1VBX A;  4PG5 A;  2MKH A;  4ANE A;  1R7I A;  1ZPV A;  3MM9 A;  4YFU A;  4NLY A;  3L7O A;  5T14 A;  2MB0 B;  5IT4 A;  4UY8 T;  2BAB A;  4A8S A;  2P9E A;  5KAK A;  3M6U A;  3HZE A;  2D9O A;  3OSP A;  2YQ1 A;  3FGV A;  4Y2C A;  4IG0 B;  2YH1 A;  1NDP A;  2N82 B;  4B9L A;  2F4F A;  4AXI A;  4RW9 A;  1JNR B;  1K1S A;  3OXF A;  1HBM B;  1N36 J;  1QTM A;  3ITH A;  5ETO A;  5AE1 A;  1EAR A;  5I42 B;  3GB0 A;  3QZ7 A;  3GCW P;  2XMW A;  2N3L A;  1N54 B;  1RE1 B;  3MM6 B;  4DV2 J;  4LSZ B;  4LMZ A;  2KRB A;  3GYG A;  3ZZO A;  2WHO A;  1UVN A;  2B51 A;  1XN9 A;  3QNW B;  4TU7 A;  1FT8 A;  3G87 A;  2FLP A;  3FZB A;  3BH7 B;  4DV7 F;  3M32 B;  3SV4 A;  1Y10 A;  4KRW A;  4J9Q A;  4RBU A;  4G3I A;  3L7U A;  2QGF B;  1DTQ A;  4RW8 B;  1FWP A;  2A2C A;  2YBV A;  2EPI A;  2BKP A;  4QZV B;  2C2N A;  2E1C A;  1MU2 A;  4U8Y A;  2CJ9 A;  3VGT A;  2V6A A;  4IG3 A;  2VUG A;  4DU8 A;  2QO3 A;  2RKI A;  1WEY A;  1R31 A;  1YGY A;  4CO5 A;  2J6U A;  2ASJ A;  4DBQ A;  1D9A A;  5IV4 A;  4UUX A;  1PAE X;  4O3R A;  2ZH7 A;  2W2Q P;  2UUB F;  1T9U A;  3FEZ A;  1EJ7 L;  4DV5 J;  1FKA F;  3HHE A;  2LQ8 A;  3M8Q B;  3CUL A;  5LSR A;  1F2G A;  4ZA1 A;  2XI2 A;  2OH2 A;  2BM0 A;  3JTO A;  4N41 A;  2F9J A;  3MFH A;  1O8B A;  2ZIT A;  1N52 B;  5BR8 J;  2HZA A;  2RS8 A;  3RBZ A;  4GC6 A;  2QEX S;  4JB8 B;  3QGP A;  2AJ2 A;  2L9D A;  4KGK A;  2IPO B;  2K7J A;  1B4S A;  4LF9 J;  2CJK A;  4Y28 C;  3CD0 A;  1I94 J;  4WYL A;  2GZO A;  3EJM A;  3M9N B;  1P27 B;  3PHT A;  1EAY C;  2RAQ A;  2ALZ A;  4F25 A;  3ZZU A;  1R8P A;  3GIL A;  5LMN F;  2CDQ A;  3N79 A;  4WJB A;  4ZVS B;  1CLF A;  2HS4 A;  5GMK a;  7FDR A;  4X65 J;  3EVW A;  2E44 A;  4YS2 A;  1GMU A;  4OYP A;  4X64 J;  4BDP A;  4ID5 B;  4R8U A;  5DO2 A;  5H9F K;  3GIK A;  4LF2 A;  4LF6 J;  1W26 A;  3IBW A;  3W5Y A;  1H2V Z;  5E5N A;  2ZZM A;  1TKT A;  2GAH C;  3NGD A;  5HSP A;  1OY9 A;  2CZ4 A;  2X3G A;  1HWL A;  3FUY A;  2BM1 A;  1S7H A;  4WPA A;  2DJW A;  3EXC X;  2DNM A;  4DZ6 A;  2HND B;  4KGX B;  3M30 B;  1KWM A;  3TAM B;  4TLR A;  4WXW A;  4EBD A;  1E6Y B;  1GFW B;  2DCL A;  3BGF A;  3BKF A;  2MKY A;  4KGM A;  3SDE B;  3HUL A;  3RB3 A;  1Q82 T;  2MKS A;  1IJE B;  1S10 A;  3LTO A;  2CQ3 A;  3VGV A;  4Q44 A;  3PJX A;  3P49 B;  5IQQ A;  4ED8 A;  1XMB A;  4KHP F;  4PWW A;  2YKN A;  2ZM6 J;  4DV0 J;  1ZAV A;  1YJT A;  4WFZ A;  2UXC F;  2HVZ A;  2YKM B;  1ZTW A;  5D77 A;  3HMJ G;  5AXM A;  3PV8 A;  3LW5 C;  1HKA A;  2AIR B;  4XAK A;  5KFP A;  1N5T A;  4JI5 J;  1HQ2 A;  3CJ8 A;  1NZA A;  4RW6 B;  2CKW A;  5DRK A;  4CTA A;  2FJB B;  2I38 A;  3WHI A;  1M90 T;  4CT8 A;  2CA9 A;  2XWX A;  1EB0 A;  4F0M A;  4DX8 H;  1PIL A;  3DDI A;  4HR2 A;  2FHO B;  1MMD A;  2Q3P A;  3NBP B;  3CD5 A;  5B0G A;  2VFR A;  2VQF F;  3GG1 A;  3KXD A;  2OJ3 A;  1RT3 B;  3BYR A;  2DH8 A;  4YB1 P;  3TAP A;  1MSW D;  2KM8 C;  3QAU A;  3RUB L;  1SI9 A;  2B5J A;  1H73 A;  4BC9 A;  1M5O C;  2GA7 A;  3PNI A;  2ZNZ A;  1UA0 A;  1VHF A;  2BVZ A;  2M5Y A;  3H98 A;  3SCI E;  3T9N A;  4CNZ A;  4FS1 A;  4K7Q A;  4DSI A;  5KFY A;  4DV6 J;  4F2R A;  2OO4 A;  3T1H J;  3GJS B;  2VA3 A;  4DUZ J;  5E0O A;  3OTB A;  5EN1 A;  3LUY A;  3HF5 A;  4I2P A;  1ZM2 A;  3C2P A;  5L9N A;  4J9O A;  4B9M A;  5LT5 A;  2AJQ A;  3PRV A;  3Q2S C;  2GO8 A;  3HPO A;  4TNO A;  5GVQ A;  4FYV B;  4KE5 A;  3C14 A;  1EP4 B;  1UWB A;  3DOK A;  1NJX A;  3W1Y C;  3IM8 A;  4F0K A;  2M0G B;  2XGP A;  4USJ C;  3D1O A;  1GNK A;  2B0G A;  2EVZ A;  2C1E B;  3POT A;  4PUO B;  2HW3 A;  1NSK L;  4LF8 J;  3Q89 A;  2V68 A;  3IS9 A;  3F44 A;  5LL6 d;  4K4S A;  4K5R A;  2FPH X;  1JLA A;  1YQH A;  4TVA B;  5KFS A;  1RAH B;  4DI6 A;  2QA4 S;  3OUY A;  1LK7 A;  3K8V A;  2VG7 B;  4JV5 F;  5DDO C;  2KT3 A;  2ZDO A;  1AB8 A;  2WON A;  5CZV A;  4MK8 A;  2AHO B;  3CJQ A;  1JLG B;  2HPU A;  2YY3 A;  4OX9 F;  1XQI A;  4NLW A;  5A0Y A;  1OSC A;  2F3J A;  1IKX A;  3AA8 A;  1FDN A;  2Y8Y A;  2DXD A;  2O5D A;  3MAQ A;  3NS6 A;  3DGP B;  1RWK B;  2V67 A;  3R5G A;  3CMQ A;  5E33 A;  1FWK A;  4DQI A;  4G1Q B;  4QOT A;  2HRY A;  4C7Q A;  4M8L A;  1NPP A;  2HHP A;  3U1M A;  8ATC B;  1UAW A;  3RU0 A;  2FHM A;  4UZC A;  5C24 B;  3A3N B;  3LWL A;  2VOP A;  2V69 A;  6FDR A;  5SUH A;  5JXS A;  2K2P A;  3PEH A;  5HMW A;  4XK8 C;  5JUM A;  2OUG A;  2G0J A;  2XLJ A;  4IYQ A;  3I5B A;  3OLB A;  3NNA A;  1WG5 A;  1NKC A;  2F63 A;  2MZQ A;  3CJ0 A;  3M8Z A;  4ILM A;  4LF7 F;  2QN6 B;  4ALZ A;  2CQ4 A;  4Y2I A;  5A2Q Y;  2LXU A;  4KV8 A;  5HO4 A;  2V9W A;  2HVD A;  1NK8 A;  4HT5 A;  2K8G A;  3QJL A;  2XCA A;  2EK1 A;  3UCG A;  3PW5 A;  2GCF A;  2CPZ A;  2PA8 D;  3D1Q A;  2BE9 B;  2NXC A;  2PII A;  3TNV A;  1VRU A;  1Y00 A;  1JIH A;  1VQP S;  2DRA A;  5ETQ A;  4DR3 J;  3U02 A;  3I32 A;  4ZVP B;  3TZY A;  1SJ4 P;  4RJV A;  3D4J A;  1YJN S;  4L73 A;  4DR6 F;  1IQT A;  3BZQ A;  5DG9 A;  3MMB A;  1CBK A;  1H3D A;  1S1X B;  3BGR A;  1C0U A;  4LUB A;  4F67 A;  5IM0 B;  4C4W A;  2V34 A;  4OX9 J;  1SQF A;  1U2R A;  3U1L A;  4UQG A;  3V6D B;  3IWN C;  1SQG A;  4FPR A;  2DHH A;  2L3M A;  2ILY A;  2LU1 A;  1G4C A;  4DR2 F;  2OEK A;  3Q0A A;  2B6A A;  5CYQ A;  2ZHA A;  5K5M A;  4MFB A;  1GK8 A;  1RAJ A;  4BCA A;  3QT8 A;  4NX9 A;  3P5B P;  3FFI A;  3UVJ A;  2X1A A;  1HNZ F;  5RUB A;  3DLG B;  2CJB A;  4F4W A;  2EKY A;  3UNY A;  3EIC A;  4IOB A;  5J1P A;  1WJ9 A;  4R5P B;  4NYO A;  3VAH A;  4HVZ A;  1FNO A;  1RHM B;  2P5V A;  2ZC3 A;  1JLQ A;  3IA0 A;  5E41 A;  5F8H A;  3HM9 A;  2ZWP A;  2OLW A;  2YQ0 A;  4O44 B;  3CD7 A;  1UL3 A;  4Z2X A;  5LMU J;  2DY1 A;  1HHQ A;  1WTF A;  4DDF A;  3UN2 A;  4MK7 A;  2QL5 B;  3CJK A;  1HWI A;  3MCM A;  4LF7 J;  3DHX A;  1IR0 A;  1RHU B;  5CHC B;  3PKY A;  1ZAW A;  3LA0 A;  1HL6 A;  1X4A A;  2LCW A;  3AJD A;  4NA1 A;  4ECV A;  3KK2 B;  1WSV A;  1Y0H A;  3DDK A;  2HNY B;  3CE8 A;  4QU7 A;  2UUT A;  3O6Q A;  2JEJ A;  4NE9 C;  5HBM B;  1KLM A;  4P7V A;  2E29 A;  1CEZ A;  2QLF B;  1T03 A;  1D09 B;  5A8K B;  1QY7 A;  2HLT A;  5B0C A;  4F4X A;  4PXC A;  3TUZ C;  3N28 A;  3Q8R B;  1HPZ B;  3K5O A;  4N8O A;  1SL0 A;  2KN4 A;  1WKJ A;  4ES2 A;  2DK2 A;  2WW8 A;  1IBM J;  2PMH A;  4NLR A;  4Z7C A;  1QSY A;  2EBE A;  4DG1 B;  3FRY A;  1KN6 A;  1XNQ J;  1HNW F;  1BQM A;  5HL7 Q;  2FC8 A;  1C4A A;  3T5L A;  3C6T A;  5FII A;  2W8L A;  3AA9 A;  1S1U B;  1T95 A;  5IV3 A;  1FE0 A;  1UP1 A;  1TKZ B;  3B4D A;  2R2S A;  4LSL B;  2RRN A;  3UO0 A;  2KZZ A;  3CJ5 A;  3MUV P;  1NSA A;  3TR5 A;  4UT4 A;  5HAT A;  4WFX A;  3N6N A;  1LFP A;  4I2Q B;  5LOQ A;  3DRR A;  1K0T A;  1RYR A;  1GAO A;  3FRZ A;  1CJK B;  3LP1 B;  1EQ0 A;  2NXE A;  4OQJ A;  1QVG R;  4FP9 A;  2HLU A;  2HQF A;  2QLB B;  3EYZ A;  4DFK A;  3OHA A;  3NNH A;  2R8I A;  2A0F B;  3G6Y A;  1HBO B;  1UFL A;  2B4U A;  3RZA A;  4ZN3 A;  5LSO A;  3HHK A;  1MWZ A;  3NRB A;  1L3V A;  2R7Q A;  2IJR A;  2DGX A;  4X2B A;  5A8W B;  5D15 A;  4A8O A;  2HNZ B;  4RNO A;  4NOH A;  3J7A 1;  3GTY X;  2ZJR Q;  2J0W A;  5FLX Y;  2DNL A;  1FRK A;  1C4C A;  3BRE A;  1LW2 A;  3D0I E;  1FJE B;  4IR9 A;  2E1A A;  5CD4 H;  2DPI A;  4RUA A;  3EGN A;  3QGG A;  2Z2L A;  2LLZ A;  5JVH Q;  1LWF B;  2B9W A;  2FJA B;  4OLO A;  1VYA A;  4KY3 A;  3FVY A;  1NB2 A;  1N6Q B;  4PQU B;  2XO7 A;  1GQE A;  4NLV A;  3DLK B;  1HNX F;  1T0T V;  2C3O A;  4NL5 A;  4O3S A;  2IA6 A;  3A3O B;  1Z2L A;  1YIT S;  2G0I A;  4IFY B;  1WNE A;  2ZUG A;  4ZPC A;  4C8Z A;  1SL1 A;  2QV6 A;  2VG6 A;  3A12 A;  4A8W A;  2XS7 A;  4USH A;  3KK1 B;  1ZET A;  3ILL A;  1SC3 B;  2ZH6 A;  2GVZ B;  5HMY A;  1MW7 A;  1RTH B;  3QLH A;  3R2C J;  3C16 A;  2L9W A;  5KFR A;  1NUE A;  2J5A A;  1S5Z A;  2RE1 A;  2LXF A;  3NGS A;  3K2Y A;  2B4O A;  1HNW J;  2K1R A;  2HK3 A;  4AD6 A;  3IMQ J;  3KK3 A;  3DLE B;  4DL4 A;  1ZAX A;  5KFF A;  5KG7 A;  2YWH A;  2IC3 B;  2AT1 B;  2HVE A;  3GQC A;  4DR4 F;  2XSF A;  1S9E B;  2AJ0 A;  4K2X A;  2J9E A;  4JI8 F;  2N4D A;  2DNN A;  1YJ7 A;  2CQC A;  1F9E B;  1Y3K A;  2LP4 A;  1HFE L;  1KVK A;  1QVF R;  2XM3 A;  2VFV A;  2BE2 B;  1ZOT A;  3LP2 B;  2D41 A;  1CJU B;  2E9T A;  2YNF A;  4DPU A;  5JMN A;  2UUC J;  1HYS A;  1VQY A;  3M2V B;  2DNR A;  2DHA A;  3UQS A;  2R7W A;  2UP1 A;  4GVB B;  1LXN A;  3D3B J;  1DY3 A;  3LOU A;  4P2M A;  4USV A;  2WSC C;  4J9S A;  2P9C A;  3I5C A;  3I55 S;  1VQL S;  3TJ8 A;  5DQH A;  2ZH2 A;  3CC7 S;  5KOW A;  3BS9 A;  4AFF A;  3CJT A;  2DHG A;  2R7X A;  1FK9 A;  3ENA A;  4OYO A;  2RT3 A;  1RT7 A;  5GAH I;  1C0T A;  1T9X A;  4A48 A;  2ATC B;  2XB2 D;  3I4H X;  3WIU A;  4TYA A;  1U47 A;  3ZTQ A;  5D0G A;  3R1H A;  2KYZ A;  5GAE U;  4CO2 A;  4JV2 A;  4EI2 A;  2ZWO A;  2W25 A;  2R42 A;  1HNV A;  4WU2 A;  4A8Y A;  5DGB A;  1VQ9 S;  4A46 A;  4K59 A;  2JHE A;  3FMB A;  3CCZ A;  4EYH B;  2UXD F;  2XHC A;  1V5V A;  2BE7 D;  3Q22 A;  3MEE A;  4KPY A;  3BBB A;  1CUL A;  4PPZ A;  1R6V A;  3PFE A;  1HHT P;  3DOL A;  3DLB A;  2DNQ A;  3H5Y A;  3GP9 A;  3U1N A;  3CVK A;  4K4U A;  2YX4 A;  3M05 A;  3AOD A;  1FE4 A;  3I4P A;  3KFW X;  3VVT A;  3NS7 B;  4M94 A;  4RW7 A;  1YDL A;  2K3I A;  2VG5 A;  2M8D B;  1NZ8 A;  4A8Q A;  2KHC A;  3H2L A;  3SSS A;  4J9M A;  3C6U A;  4JI2 F;  2Y3Y A;  2R7V A;  3DRP A;  5KG4 A;  4ER8 A;  3OFH A;  1IKV A;  3PVX A;  2CQP A;  5D0E A;  4MTP A;  3M9M B;  2OTJ S;  2JDJ A;  2EKN A;  4NML A;  2JEG A;  2CZV C;  2UU9 F;  4WP9 A;  2FZG B;  4GKJ F;  3PR4 A;  2VOD A;  1RTJ A;  2YNI B;  3MWB A;  3AOB A;  1KVI A;  4LIR A;  1KNZ A;  4HDH A;  1SUQ B;  4USI A;  4J5O A;  3RTV A;  4RWW A;  1JXL A;  4JI1 F;  4KPC A;  3NGU A;  4WK1 A;  3GMG A;  2GIQ A;  2HBY B;  2KHD A;  5F8N A;  2VBZ A;  1T3O A;  4LT6 A;  1OO0 B;  4X66 J;  1BD6 A;  1RT1 B;  3C46 A;  1DLO B;  1WHW A;  4OI6 A;  1OQ6 A;  3W60 A;  1HBM A;  4W4M A;  1I3O B;  2E5G A;  2HFV A;  3LH2 S;  3R1L A;  4E0D A;  2VB6 A;  2YKQ A;  4C2M A;  5I42 A;  2D3Z A;  3UDL A;  4DF8 A;  1L3T A;  1NKB A;  4OZ3 A;  2X3D A;  4U7U D;  4WKR A;  2J8A A;  3RJM B;  3OR1 B;  2AV5 A;  2V5H G;  4NMX A;  1GX6 A;  2Z2Z A;  2V8H A;  4OZ1 A;  3M32 A;  2RVJ A;  4CM0 A;  3ZTP A;  4I1T A;  4OL8 A;  1HLW A;  3KYL A;  2G2Z A;  4LR9 A;  3ENQ A;  2QYC A;  4J7C A;  3VAG A;  2MSS A;  5CZX A;  1F5A A;  2VIC A;  1SJF A;  2IYG A;  3RGI A;  3UI3 A;  2QRR A;  4N7T A;  2ABY A;  3H40 A;  4M5J A;  4A47 A;  4DPX A;  4M63 A;  1U09 A;  1U48 A;  1PBU A;  3TX0 A;  2F4V J;  4RL1 A;  4ZVT B;  3CSK A;  1PC5 A;  3KTQ A;  1OYD A;  2OPS B;  3RAQ A;  1NK5 A;  3BO4 A;  1X4D A;  3GE9 A;  2UUA F;  3SSR A;  5E3C A;  3I31 A;  2UU9 J;  4FXV A;  3J81 Y;  3HX9 A;  1U6Z A;  1DQA A;  4I7F B;  1J5O B;  6FD1 A;  3M2U B;  3G4S S;  1RTI A;  2COL A;  5KT4 A;  4LF5 F;  1U1N A;  5C2C A;  3BO2 A;  1RWU A;  2W9A A;  2V2Q A;  1M1H A;  3GR1 A;  1RLD A;  4B3T F;  1M5V C;  3RAM A;  1RT6 B;  3BQ2 A;  2PMZ D;  1ZH5 A;  1FD2 A;  3LGN A;  9RUB A;  2J0S D;  2X51 A;  2W9C A;  2Z8Q A;  1HMV A;  3JXO A;  2JOQ A;  5C25 A;  3L9Z A;  3CF5 Q;  4ELV A;  3PW4 A;  5H9E J;  3L4B C;  1FJG J;  2XI3 A;  4LRB A;  3U7J A;  5DQI A;  3BKU A;  3IAM 9;  2VFS A;  3R97 A;  1FA0 A;  5HVG A;  2ZOM A;  2NR0 A;  4X4O A;  2EFV A;  2HHV A;  3HJV A;  4F8R A;  4QCL A;  3AD9 C;  3DM2 B;  4NCG A;  3FK4 A;  4ID5 A;  4WFY A;  4KT0 C;  3QJP A;  1VOM A;  2NUH A;  2HGL A;  2BAN A;  2FC9 A;  3I0R B;  3HFZ B;  2XY7 A;  4DQR A;  3GG0 A;  3MR2 A;  4KFB B;  2JC0 A;  2ROE A;  4M5N A;  1RKI A;  4UW2 A;  1NK9 A;  3QT7 A;  2Y0S D;  3U27 A;  2KFN A;  3HHL B;  1H72 C;  1I6J A;  4U67 Q;  2Y1R I;  3MDF A;  4HHU A;  3V6H A;  1EQM A;  2AWZ A;  2XSJ A;  1TKX B;  3V81 B;  2HND A;  2Y1L B;  1ZZF A;  2GW8 A;  2DHS A;  2F5G A;  2PI4 A;  1E6Y A;  2GIF A;  4OX6 A;  3SDE A;  3I87 A;  5D0H A;  3HKZ D;  1U0H B;  4KTQ A;  1WI8 A;  1EZZ B;  1VBY A;  1RQ0 A;  5CA5 A;  4CO1 A;  3LAK A;  2AYG A;  2GFF A;  3KHR A;  2UUA J;  3LF0 A;  2YKM A;  4Y3C A;  3D0G E;  4DUY F;  4NXN F;  1B7Y B;  2QA1 A;  1WF2 A;  3VAL A;  3QT6 A;  3G6V A;  1UEU A;  1NCL A;  3HFK A;  2DGQ A;  1VQ4 S;  4AND A;  4C8K A;  3KHG A;  1UEK A;  2AJF E;  4ZHR A;  5D8H B;  1FHT A;  1RT4 A;  3W2W A;  1M5S A;  4MH8 A;  3K89 A;  3GLJ A;  5HMZ A;  1IBL J;  4F26 A;  1URR A;  4DCJ B;  1X9W A;  4Y2K A;  2GX8 A;  2D1C A;  4K0K F;  4FDF A;  3TA1 A;  4DS4 A;  3OLA A;  2NZC A;  3TVY A;  2HWH A;  3V4M A;  3NBP A;  3IGN A;  1PYT A;  2RQ4 A;  3CNQ P;  4WXO A;  1RT3 A;  3LAM A;  3OVS A;  1RHR B;  4C8Y A;  2CRL A;  3DYA B;  3FEY B;  4NLQ A;  2F40 A;  2G1D A;  3JSR A;  2DGO A;  1REG X;  1GX5 A;  4QQB A;  1JLC B;  3K59 A;  3CIZ A;  3DI6 B;  5CYJ A;  2BQ3 A;  1FFG B;  3F0N A;  4PCQ A;  1UPP A;  3MM5 B;  3JYT B;  3W9H A;  3TP2 A;  5FDL B;  1XIQ A;  3NEK A;  1UZH A;  3R5C A;  3THV A;  2X1F A;  2Z2Y B;  5J2Q B;  3BF4 A;  2JVR A;  1IKW B;  3FBB A;  1F5C A;  3NGR A;  5KT5 A;  1A9N B;  2MLX A;  4QYR A;  1CQM A;  4GC7 A;  2KL8 A;  2QFJ A;  2PDA A;  5ETS A;  2KFZ A;  1RBA A;  4EBE A;  3MCN A;  1V9O A;  4LRA A;  4WCE Q;  4OHY A;  2PMW A;  1RA6 A;  3Q86 A;  3LPY A;  1KFS A;  2YPZ A;  3BR9 A;  1BUX A;  5F0W A;  1RJJ A;  2DNY A;  1KQS R;  4UOG A;  2HWI A;  1FRH A;  1HQU A;  3F73 A;  2XMV A;  2HUR A;  2OTL S;  3O1L A;  3GFX A;  3VQT A;  1H74 A;  1N0U A;  4PPD A;  3DRX A;  3HZG A;  4FNH A;  3IR6 B;  2E7X A;  2HYI B;  1N5Y B;  3AQO A;  4IQX A;  4BWJ A;  4QIE A;  2YNG B;  3PYF A;  5ADZ A;  1X9M A;  4YHH F;  2OD6 A;  4OZL A;  5KFG A;  2D3O R;  5H9E K;  5B0F A;  4NPO A;  5D4L A;  2ZH3 A;  5L46 A;  1RT2 A;  4IOC Q;  5AE2 A;  3A8I A;  1LW0 B;  3RRH A;  1S1W B;  3CMA S;  2ZBQ A;  4NXM J;  3IO1 A;  2YPY A;  2XYP B;  3BJY A;  4P75 A;  4QIF A;  4JI7 J;  2DBB A;  3MPV A;  2O3D A;  5IWA J;  1BC6 A;  2V63 A;  1HR0 J;  5M2P A;  3MAA B;  1ZA2 B;  5F3T A;  2XO6 A;  4O0I A;  2YXL A;  2DRB A;  2Q6C A;  2RDJ A;  1PKU A;  1KOH A;  4M5D B;  1CG2 A;  3PW7 A;  2C3P A;  1UA1 A;  3T5J A;  3DNC A;  4DL7 A;  3QID A;  3JAM Y;  1YJ9 S;  1N5S A;  2ZH4 A;  3OBI A;  3UCZ P;  3UDV A;  4EZ6 A;  4IRD A;  3ZNJ 1;  2IHR 1;  3UD3 P;  4RNF A;  1YVF A;  2QLJ B;  5HQ8 A;  2RSQ A;  4MYU A;  4N47 A;  2MY8 A;  3HSD A;  1R6Y A;  1ULR A;  3EZ5 A;  2ZUA A;  3MCO A;  2ACM A;  4JV1 A;  3QRQ A;  3GIM A;  5HLF B;  2BXJ A;  2B9X A;  1O51 A;  4UOH A;  4LF4 J;  1W25 A;  3PZP A;  1CJV B;  4B3M F;  1IXK A;  4PG6 A;  2YKO A;  3CO0 P;  1L3S A;  1HQE B;  1RT5 B;  4WYW A;  4Y00 A;  3C19 A;  2OML A;  3QBC A;  2LQB A;  2IIH A;  3E8O A;  1JKH B;  1FKO A;  2CJQ A;  3GSD A;  4K4Y A;  1S1X A;  2XWY A;  3GFH A;  4EU0 A;  3Q24 A;  4IRC A;  2UVV A;  2G0C A;  1PO6 A;  4X4U A;  4ZVR B;  5IM0 A;  1XWL A;  1YJV A;  3PX6 A;  2ACY A;  2DH7 A;  3M1V B;  4JYA F;  5I3U B;  3V6D A;  1ITP A;  2MZS A;  3RBE A;  2ZH8 A;  3AD8 C;  5GME A;  3CTR A;  1YRX A;  4F4A A;  4RZR A;  3MPW A;  3V6J A;  1S6Q B;  1YG0 A;  4PXD A;  1FEH A;  2WB1 D;  3ZFV A;  2WTF A;  1MN9 A;  1VQ6 S;  3DLG A;  3HVR A;  4TN2 A;  3ZZR A;  5A8R B;  1KQF B;  4DX5 A;  4J91 A;  2W01 A;  4OZJ A;  4R5P A;  3IBC B;  1NO8 A;  1EET B;  3UR0 A;  4TY8 B;  4ZS6 A;  2B9Y A;  2ZEJ A;  3OTO F;  3GV8 B;  2VBY A;  3MOJ B;  3RBX A;  1N32 J;  3W7B A;  5BYS A;  4WFA Q;  3JSY A;  4M5L A;  1LOU A;  1PYS B;  3RW6 A;  2IBK A;  4IH7 A;  3HT0 A;  3Q2T C;  1R0A B;  4PG8 A;  3K5M A;  4F0H A;  4PQA A;  2AD9 A;  2IFX A;  4CT9 A;  2V50 A;  3FJ2 A;  2KVI A;  3AFG A;  4XDD A;  2IVM A;  1QD1 A;  3KLI B;  1KFD A;  3HCX A;  1WC4 A;  3RR8 A;  1SVD A;  5KFW A;  3IN5 A;  2HNY A;  4O0N A;  3HLU A;  4P2F A;  3W8G A;  4DL3 A;  4DU7 A;  1MWY A;  2NYH A;  1AUD A;  3KUE A;  2CUY A;  4Z37 A;  2RHS B;  3A3P B;  4B3M J;  2E9R X;  1SJQ A;  3ZC4 A;  4F4Z A;  1HBN A;  3GYN A;  3MMA A;  1HPZ A;  3HVT B;  5KG3 A;  2H51 B;  4DSE A;  4QU6 A;  1TAQ A;  3PAC A;  1M0S A;  2GGP B;  2MKK A;  1MG7 A;  3BQ0 A;  2LQ9 A;  4DG1 A;  4V1A k;  2J0Q D;  3ISZ A;  4CQ1 A;  4NLX A;  2BW7 A;  2YQ3 A;  4LJM A;  3Q8Y A;  4P7T A;  4B9T A;  1HNI B;  2AJ1 A;  4FNI A;  2PC6 A;  1DAX A;  1S59 A;  3I6P A;  3NL0 A;  1S1U A;  4YEA A;  1TKZ A;  4K4X A;  4PAB A;  4LSL A;  1FX4 A;  2FGO A;  3QO9 A;  4AE5 A;  4B9S A;  3HI9 A;  1S9G B;  3UDC A;  1NK7 A;  1CJK A;  1SV5 B;  1S1V B;  1LWX A;  3SBM A;  2VQE J;  2HSE B;  4MKA A;  3EPI A;  1R0B G;  1NND A;  4L3N A;  3KUG A;  2DR9 A;  1MRO B;  4ZKA A;  5KFC A;  4C3K A;  4ZOS A;  1WKK A;  1HBO A;  4FBU A;  5IT0 A;  1V6H A;  2JC1 A;  1X4E A;  1WG4 A;  4ECQ A;  5A8W A;  3PDN A;  2HNZ A;  3DU6 A;  1TVR B;  4RNN A;  1RHQ B;  3CCT A;  4IDK A;  3OL6 A;  1U1L A;  3D67 A;  3RG6 A;  4AQY J;  3CCM S;  1VC5 A;  1PAU B;  1BLU A;  4JI4 J;  2JL9 A;  1IWG A;  3W5X A;  2AZ3 A;  1S48 A;  3KJQ B;  4OYI A;  4ZVQ B;  2OPQ B;  1HD0 A;  4RLE A;  3TVZ A;  1N6Q A;  4PQU A;  5EWE A;  3NG8 A;  4I6A A;  3DU5 A;  4AYB D;  2FVP A;  2CQ0 A;  3PHE A;  4DR1 F;  2RIJ A;  3CJ4 A;  4IFY A;  2D3U A;  3OL8 A;  2EC0 A;  2MZT A;  4N77 A;  2IRU A;  1EX8 A;  5D4O A;  4D3G A;  2CJA A;  3MEC B;  3G96 A;  4JI6 F;  2FJW A;  1F5B A;  1PG5 B;  4JI3 F;  3KJV B;  3RB4 A;  1HW9 A;  3HJF A;  2VA2 A;  3T1Y J;  2OI2 A;  4KKO B;  3MUR P;  1UVJ A;  1S6U A;  3QPI A;  3J80 Y;  1FDB A;  3AOC A;  4ZLN A;  2VH7 A;  3AD7 C;  2AYM A;  2ZKU A;  3GON A;  4TKT A;  1VC0 A;  1S72 S;  2XMU A;  4NRT A;  4F36 A;  4NYZ A;  1YSJ A;  5EX0 A;  1P8G A;  3M8Y A;  3R27 A;  4ICL A;  4DL0 C;  1WOS A;  1X5P A;  2HHT A;  2CAJ A;  2RRB A;  2IC3 A;  5ETR A;  4JBC A;  3G86 A;  5KFL A;  2GML A;  4WP3 A;  1S9E A;  4DOZ A;  4P71 A;  2C2D A;  4TY9 A;  2DB1 A;  5E3A A;  1V3Z A;  1IM6 A;  2BRK A;  1RWO B;  1Y7P A;  2IMO A;  2HFN A;  1HBU B;  1S6O A;  2D7S A;  2CPI A;  1Q79 A;  2BE2 A;  3LP2 A;  1U1K A;  2F1F A;  2E5J A;  4ED3 A;  5KTQ A;  3MD1 A;  1KC8 T;  2PT0 A;  3M2V A;  4USU A;  3ZO7 A;  3MEG B;  4B3O B;  2C2R A;  3IR7 B;  4J9R A;  4GVB A;  2DR5 A;  1SC4 B;  4CLY A;  4GKK F;  2FB0 A;  2N7C A;  4OYW A;  4UZB A;  4X62 J;  1PCA A;  5AT1 B;  1I1G A;  4YME A;  5F3Z A;  1U7L A;  2W9B B;  2NXN A;  1FO1 A;  3CB4 A;  1OIA A;  2XC9 A;  4IO1 A;  2EFO A;  2JFK A;  4P52 A;  3MMJ A;  1HI1 A;  4DFP A;  2KYX A;  5T7L B;  2J7U A;  4DFJ A;  2B7B B;  2CNO B;  4PG7 A;  4FVM A;  3CCL S;  2F8M A;  1NDK A;  4Q2L A;  2B3T B;  2FHJ D;  1IKY B;  1BQN B;  3BYP A;  5KG5 A;  2MJN A;  4JI6 J;  1FES A;  2PEH A;  1IBK F;  4UOC A;  4OJH A;  3KOA A;  1NHV A;  1X4B A;  1S49 A;  1VRT A;  2V4Q A;  4YR2 A;  1Z1Z A;  1TL1 A;  2IBO A;  4MK9 A;  4DPT A;  1TMJ A;  4B3R J;  4YB7 A;  2FJE B;  2FDN A;  1UVI A;  2HIY A;  3H5U A;  3W5Z A;  1U1Q A;  1QAX A;  2ILZ A;  4DV4 F;  3WDO A;  3PKM A;  2ZDP A;  3W63 A;  2HQG A;  1TQL A;  3HSZ A;  1X0F A;  5E7O B;  1C1C A;  2WVD A;  4RPF A;  3SMZ A;  1LQ9 A;  2J9D E;  3KKF A;  2OP5 A;  1J5E F;  5KFJ A;  1H7W A;  3AQP A;  2WBR A;  2I9S A;  2W4C A;  3L09 A;  4RUC A;  1YBA A;  3GWC A;  3DXS X;  4CH7 A;  4RW9 B;  1WEL A;  4P2S A;  3ITH B;  1WDD A;  2FZK B;  2G1H A;  2J7K A;  1I51 B;  2HGN A;  1SUQ A;  4OI2 A;  4BBY A;  1C1B A;  2HRU A; 
#chains in the Genus database with same CATH homology
 1PAE X;  1NPK A;  1W7W A;  3B54 A;  3ETM A;  3BBC A;  2B8P A;  3Q8Y A;  3JS9 A;  3NGS A;  1NDP A;  3FBC A;  4W98 A;  3ENA A;  4C6A A;  1S59 A;  5CAA A;  1BE4 A;  3Q86 A;  2HVD A;  1PKU A;  2DXF A;  1NHK L;  3FCW A;  3VVU A;  1HIY A;  1NLK L;  2NCK L;  3ZTR A;  4FKY A;  3ZTP A;  1BUX A;  2DY9 A;  3ZTQ A;  3EVO A;  5IOL A;  1XQI A;  1HLW A;  1WKJ A;  2CWK A;  3PJ9 A;  5BXI A;  4FKX A;  2BX6 A;  3VGS A;  3ZTS A;  3FC9 A;  4UOG A;  3EIC A;  3PRV A;  4WBF A;  1NSP A;  2DXD A;  2HVE A;  3EVM A;  1K44 A;  3VGU A;  3ELH A;  2HUR A;  3EMT A;  3NGT A;  3MPD A;  1LWX A;  2BEF A;  4S0M A;  4ENO A;  1VYA A;  1B99 A;  3BH6 B;  2VU5 A;  1ZS6 A;  1NB2 A;  1F6T A;  3DDI A;  3EM1 A;  4HR2 A;  4KPC A;  3NGU A;  1MN7 A;  1B4S A;  5C7P A;  1HHQ A;  3EE3 A;  1KDN A;  1UCN A;  4O0N A;  3WX8 A;  4F4A A;  4DZ6 A;  3GPA A;  3Q8V A;  1WKK A;  3BH7 B;  1S57 A;  3EJM A;  4UOF A;  4ANC A;  1EHW A;  1NCL A;  5CAB A;  3R9L A;  3L7U A;  3BBB A;  4F36 A;  1LEO A;  3Q8U A;  1NSK L;  4AND A;  3Q89 A;  3FCV A;  3FBE A;  4ANE A;  1XIQ A;  4DUT A;  2AZ1 A;  2ZUA A;  1MN9 A;  3B6B A;  3BBF A;  1BHN A;  1NDK A;  1NDC A;  1WKL A;  3GP9 A;  3FBF A;  1NSQ A;  1F3F A;  3FKB A;  3G2X A;  2B8Q A;  3VGV A;  3VGT A;  4EK2 A;  3ZTO A;  2DYA A;  2DXE A;  1NDL A;  3VVT A;  4DI6 A;  1U8W A;  3DKD A;  4CP5 A;  3FBB A;  3NGR A;  3EVW A;  1JXV A;  2AZ3 A;  1NUE A;  4UOH A;  3Q83 A;  1S5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...