2I9SA

The solution structure of the core of mesoderm development (mesd).
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
GPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Mesoderm development candidate 2
publication title The solution structure of the core of mesoderm development (MESD), a chaperone for members of the LDLR-family
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i9sA00
2QMWA 2QSWA 1LK5A 2NYIA 1YGYA 2J0XA 3HHEA 2RQMA 1XTZA 1O8BA 1ZPVA 3U7JA 5JJBA 2LQJA 3IXQA 3TUZC 1LKZA 3AB2B 1YBAA 2I9SA 2P9CA 3IBWA 3MAHA 2J0WA 5IT4A 4GO7X 3CEDA 2JOQA 4GO5X 3DHWC 2F8MA 2H9ZA 2RQKA 3K5PA 3TUJC 2JHEA 5FIIA 2QRRA 2KO1A 3OFEA 1U8SA 2RE1A 4X84A 3MWBA 4LUBA 3DC2A 2MDAA 1SC6A 3DDNA 2DTJA 3OFHA 4GMKA 3S1TA 3LOUA 1UJ6A 3OFGA 4PWUA 2PC6A 3TUIC 3NRBA 3OFFA 3ENVA 4M8LA 2DT9A 2PA3A 3OBIA 5IS2A 1UJ4A 3UW1A 3P96A 3DHXA 1M0SA 2F1FA 2P9EA 2P9GA 5T41A 3AB4B 3KWMA 3ENQA 3L7OA 3ENWA 1UJ5A 2FGCA 3O1LA 2CDQA 1LK7A 2LVWA 1PSDA 3N0VA 1Y7PA 1KS2A 3LUYA 4NMLA 5IT0A 1RWUA 4IO1A 3W7BA 2QMXA 3AAWB 3MTJA 2ZHOA
chains in the Genus database with same CATH superfamily
5LXYA 3DRRA 3P5TL 2CNOB 3NNAA 5JVHQ 4WCEQ 1VRUA 3CC4S 4C8LA 5HLFA 3GR1A 4ED3A 1M90T 1H2VZ 2DB1A 3PACA 2IC3A 3V6KA 2HMIB 1CPZA 1Y5LB 1VGYA 2HBZB 2XB2D 2KZMA 3IBFB 3M9OB 4QOTA 4C3MA 4X64F 2EFOA 3S1TA 4ZN3A 1PYSB 4DR6F 2ZBRA 2HFZA 4DPTA 1FRHA 2YKOA 2HHPA 4CLSA 5KT7A 1TV6B 2KRRA 2OLWA 3CF5Q 2EPIA 2WSCC 4LF1A 4F04B 3TW0A 4WTOB 3M9MB 4QIGA 2MQPA 2BM0A 5KFJA 3W5ZA 2HNZB 4O44B 2CXEA 2BMBA 3GYNA 1ZM2A 2VG5B 3M8QA 1VC0A 3QO9A 4YUDA 1RABB 4H4OA 3W2VB 4DR4F 5HN0A 1FWPA 1K9MT 4MFBA 4QYRA 2XWYA 2DGWA 3TZWA 5J2PB 3A8KA 4OIXA 4AE5A 5J1NA 4XAKA 2K1RA 1RAGB 2B9EA 2OGUA 7AT1B 4YN3B 2PIIA 3FEYB 4DV5F 3ISZA 5EX3A 2GMJA 5HP1B 1HYSB 2CWXA 3ZC4A 1Q4RA 3EVWA 4DR2J 1OJ4A 3VGUA 2FD2A 3DGPA 5CZVA 2OELA 3IBCB 4DX7A 1X4EA 3MCSA 3TNVA 1FEEA 1UAWA 1ZA1B 3T9ZA 1GX6A 2AD9A 3T3FA 4E0DA 4Q8EA 2NXCA 3NAIA 1HHQA 3DMJA 2HRYA 1ZZFA 1RISA 1DJ0A 1NDLA 2MZRA 1RT7A 3HSZA 4F4KA 1ZM3A 3HMJG 2GVZA 4AL5A 3PZPA 2HSEB 1R89A 1FJ7A 2CJ9A 1TUVA 2DRAA 2AYEA 3FRYA 5SZTA 1VQ9S 1VR6A 3VF0B 2Y1IA 1IKVA 4LF6J 2DR6A 4DQRA 2LQJA 3G6VA 3OVBA 3Q8RB 1NDKA 4RUHA 3BN7A 4P2MA 2D1CA 2XS2A 5FJ4A 1NZ8A 2AHOB 2JEGA 2JEJA 5FD1A 4IUFA 3TUJC 1UWBB 5FIIA 1T9VA 3V6DA 4FNIA 4AQYF 1UVJA 1JB0C 1FRKA 9RUBA 3OR2B 4F2SA 3FMWA 1F5BA 1X7VA 3SCJE 4DSFA 2V9KA 1FI4A 3FBBA 3PR4A 1ZETA 3MAQA 5GAHI 4I2PA 1FFGB 2VBXA 2BM1A 5LMNF 1S6PB 2KN4A 4DFPA 3G4SS 4X66F 4Y65A 1UZDA 2Z2YB 2DK2A 4B9UA 2KVIA 2FLNA 1PAEX 2ZOMA 1L5UA 4K4TA 4EBCA 2CNKB 2W25A 3GIRA 2QLJB 1VQ5S 3CIZA 1P27B 2J0XA 3BH7B 2XQCA 3MM6A 1RWPB 2Y0BB 2ZWPA 4Y00A 4CH0S 4DV3F 3FBFA 2XI2A 3AODA 3CJ8A 3H5YA 4HHUA 1ZM9A 1W7WA 3GV7B 1N0UA 3UWTA 3QIPB 3H5XA 5U47A 4USVA 4F0KA 3K89A 1DRZA 1WTFA 3D6MB 2R8HA 4M1KA 5J2NB 1WC5A 4KGKA 4PXCA 5F8JA 5LSLA 4JI2F 3HJVA 3KLGA 4B9NA 4GVBB 3ENWA 4DMZA 1R43A 4ECSA 1BXNA 5IV4A 3C66A 3OLBA 4X4RA 3MM8A 1D9AA 2XLIA 3NY0A 5ETQA 1WNEA 4JI1J 4NI2A 2EFVA 3H90A 5CYQB 5H9EK 2E9ZA 2ZEJA 4DV0F 1CQMA 2O67A 2WCXA 2M2BA 2EFGA 2B4OA 2QLXA 2ASLA 3BO2A 2FZGB 3TOQA 4DXLA 4PQUA 4GO7X 4HR2A 3WQPA 2R8KA 1T7PA 5F8HA 2HQDA 1S1WB 3B54A 6FDRA 4URGA 3KKFA 3VALA 4OX9F 2FIUA 2OEJA 3W2WA 2KH9A 3W8GA 1FKPB 4TY9A 2Z4PA 1RTZA 4PWDA 3MD3A 1QSSA 2QX0A 1CJTB 2YKMB 2MKIA 1C4CA 4NLQA 3N79A 1O0PA 4WFBQ 1IJFB 3GFHA 5F8NA 4YOEA 5K14B 1YBUA 3OTBA 2KYXA 2V67A 2OPRB 3H4DA 1JLGB 2EG1A 3VCDA 1J5OB 1RTDA 2FVCA 3W7BA 4ZITA 4X4VA 1TKDA 4U6PA 1H0HB 3EVMA 5HMWA 4DSLA 3FK4A 4JI4F 4URQU 4DU8A 1X31C 3R5GA 1IXKA 2ZVSA 2RVJA 1U26A 2HHUA 3Q8YA 2BRKA 1S97A 3ZFVA 3L09A 5A2QY 1E6YA 2C2NA 2Y1JA 3QRPA 3CDWA 2DBBA 3AXMA 3UN5A 4DS5A 2V2QA 2VQEJ 2MKCA 2UUBJ 2HLTA 3MR7A 4LQ9A 3CSKA 1K0VA 5AXLA 4P6QA 1ZAXA 3H98A 4L76A 3L9ZA 4YDDB 2FJWA 2ZHAA 2V4JB 2PDAA 3Q83A 3BGUA 1RT1A 1M5OC 1LWEA 5CYMB 4CT9A 2RRAA 1AUDA 2A2DA 1T9YA 3BGLA 3CJ2A 5AXNA 2XG8A 2DY9A 1CULA 4D3HA 1RA6A 4LRAA 3H5UA 2VJVA 2UVVA 2I8EA 2HS0A 3M6VA 2BBEA 3CTRA 5IFMA 2ZKTA 1KFSA 1VCTA 4R5PA 2BA9A 4OYBA 1TKZA 1CSJA 3I9V9 1Q86T 4AYBD 1UA1A 2ZE2A 3A3OB 4R8UA 4OZ1A 3GZ7A 3BO3A 1SH2A 2CADA 1PJ5A 1RKIA 3QT7A 4ZP8A 1SL0A 4ZP9A 2CJQA 5LJ5Y 4UT4A 1YJWS 1C4AA 3MCMA 4ANDA 3H4BA 3DOKB 4ZMMA 3UD5A 1WSRA 2XSJA 4OZLA 3M8SA 5FLXU 3MWBA 5HVGA 5F9NA 3BV8A 3QGIA 2MKYA 2JSXA 5L9NA 3ET6A 3MM9B 3MEGA 1HNVB 2AJ2A 5K5MA 2LXFA 1CC7A 5KOWA 1H98A 1SL1A 4F4ZA 3RYLA 4ECRA 3R5JB 2CQCA 3J80Y 3H8YA 3FCWA 1T9UA 2NQPA 4RW9B 3KUHA 4RW7B 1I51B 3W65A 3AD9C 3UFCX 4DPWA 3ISNC 2E1AA 1WOOA 1N48A 1UZHA 5T7LB 4O4RA 2ROEA 1ZOTA 3T5HA 2DXDA 1HW8A 1F0XA 4HACB 1N34J 1IWGA 1IWAA 1MU2A 2W4DA 3C15B 1JLQB 5DZ7A 1Y11A 2PMWA 1WHVA 1Z2ZA 1WF0A 4DR3F 4OHYA 4X65F 4OLOA 2V4QA 1VYAA 3M8WA 4K4XA 1B70B 1MLAA 4PR6A 3OL6A 3DC2A 1TTHB 3OFHA 2RUSA 2GC8A 1RU2A 5L38A 3KLFB 2ADBA 4QU6A 3G6XA 2DNKA 1RT2B 4KC5A 5A8KA 3NBPA 3M05A 3BGRA 3BQ0A 3LPEA 4I7FA 3PX4A 3HO1A 4L3KA 2RU9A 1EB0A 4LIRA 3RBXA 5LXRA 5IT9Y 5ETNA 3MTKA 1KOOA 4QZVB 1RAOA 1PYTA 3RU0A 3QZ7A 4JP8A 3DLEB 2BEFA 3SYZA 2MQLA 3HKWA 2YNFB 3IO1A 5I3UB 3AJ2A 3KJNB 3TVZA 1WOPA 4WTYA 2B6AB 2A18A 4EO8A 2OTJS 4FYDA 3V4IA 3OW2R 4JI3F 4L3NA 1IR0A 4DS4A 1AB8A 2EI5A 1S1TA 3QBCA 4O3PA 4ZPWR 1LKZA 2V8VA 2WBRA 4OHWA 3V2UC 1TZ0A 4IRCA 3AA8A 2C3UA 3OVSA 2RB7A 1SVDA 3BREA 3Q24A 4C6AA 5F3TA 3DLKB 3NRBA 5L1LA 4QWDA 3TAMB 2ZOFA 4NA1A 5CAAA 4YS2A 1LWCA 4LFAF 3TRGA 2WHOA 3JSBA 3C16B 3TYTA 4OYPA 3KG0A 3S8SA 2LKZA 5HATA 2FVQA 4XTTA 4Q2MA 2WVBA 4ER8A 2FHOB 2GMHA 1RT4B 2CQBA 2RSQA 1R0AB 4O0IA 2LECA 4YY3F 2YXLA 2QGFB 1QLNA 4NRUA 4LSLA 2AGOA 1TVRA 4K59A 4QR0A 2VKZG 2P6TA 2IVFB 3MURP 3SDEB 2J5AA 5KG0A 2EK1A 1HARA 5C2CA 3U27A 2CVIA 2VPXB 2EFPA 3UPFA 4O23A 5DM6Q 2G2ZA 4HDHA 1BQNB 8RUCA 1DQAA 3CC7S 4J9SA 3OT9A 4NXMJ 1CC8A 2BE9B 3BBBA 5C42B 3R1LA 2GS8A 3IR5B 4RX6A 3M7VA 2P6SA 2KHDA 3GQCA 3PHEA 2YPYA 2VF3A 3B82A 3GTYX 1SKRA 2C42A 3HHDA 4DCOB 1S7HA 5L46A 4ITSA 3VAGA 4CNYA 1OY8A 5KFKA 1JKHA 1VBYA 4ED5A 3J81U 3KDOA 1X4HA 2RAQA 5KT4A 1R8PA 2BE2A 4BLGA 1NLKL 4JI8J 3BR9A 3EDQB 1PILA 4B3MJ 2UV8A 2V8HA 3I0RA 3AFGA 3ILIA 1O8BA 4PZVA 2VJUA 2DNRA 3HVTB 1IBKF 2FGOA 5KFZA 5ETPA 4LJMA 4JV2A 2VV5A 4HTJA 2BJ8A 4HVZA 2BW2A 2YWEA 2M7SA 1GNKA 2MXYA 3I9ZA 1YJTA 4TLQA 4EYIB 3MHYA 2N4CA 3DLBA 3PKYA 3TANA 4K4VA 4KPYA 1TAUA 3BDEA 1ZTTA 4DLEA 3J81j 3TZZA 3GJQB 2DPJA 1RTHB 2FTRA 4E8UA 4ELUA 3UVJB 4WU3A 2ATCB 2AIRB 2VQFF 1C1BA 2GCFA 1S1XB 4RBVA 5HBMB 2MLXA 2VICA 2FHMA 3DLLQ 1HD1A 2P9EA 4LBHA 2BV3A 4ECUA 1N5YA 1Q8LA 3FEZA 2BW7A 2W01A 4UOHA 1APSA 3DCAA 1FK9B 1JLBB 3KLVA 1G3OA 3GILA 2Z56B 2BR0A 3PW0A 2XY7A 2HNDB 1NZAA 4DZDA 3BKUA 3TA0A 4LQ3A 2KHCA 1RWKB 1PGZA 3CCLS 3V4MA 2OPSB 4IG3A 4B02A 4FN5A 4RW8B 1VRTB 1FWKA 4NX9A 4TQSA 2PMZD 1YJVA 2R7SA 1MWZA 5A6WA 5BYSA 3F41A 2M88A 4HH0A 5HJXA 3I6PA 1UVKA 2VG7B 4K8RA 4A8YA 4RWXA 1VRUB 4DL0C 2DT9A 2B56A 1WI8A 2OPQA 4M5NA 1UJ4A 2FB0A 1YJ7A 3EJMA 1ZZNA 2HFSA 4C8OA 1Q79A 4TQRA 2HAFA 1BMQB 1IKYA 4RL1A 3OPKA 4O3SA 1NBEB 1KDNA 3C6UA 1Y5NB 4ECYA 4C3KA 2W7OA 3HHLB 2BZ2A 3TI0A 3AQPA 1PG5B 2H5IB 3BBCA 2J8SA 3O5TB 2NUHA 3KOAA 5A8WB 2XGQA 2FHJA 4DEZA 5J2QB 4Z7YA 4KHPJ 3J7ZT 4ECTA 5JJBA 2WOMB 3HHLD 4C9DA 2BJ7A 4ZIWA 3M8QB 1HKAA 1KQSR 2V50A 4A48A 1JLAA 2OPPA 1XMQJ 2JHEA 2OAUA 3EVOA 3JSRA 3ENAA 1HMVA 1KN6A 1RLDA 3KLHB 3GJSB 4KHMA 2X3DA 1OY9A 4NLYA 2XHCA 3KHHA 5IS2A 4CO4A 2KXFA 4ZPTR 1N6QB 2DNHA 3ISND 2BJDA 5LOQA 2F1FA 5D8HB 3R9LA 3ZZUA 3VZHA 3A12A 4H4MA 4MK7A 2A6OA 2IJNA 2HHHJ 4OX6A 4RU9A 4NZ6A 3L7UA 3MM7A 4PG8A 1LW2A 1HNIA 1ZYQA 3THTA 1UEKA 4LF5J 3KMQA 2GMLA 3CPWR 2WRMA 1YHQS 1OSCA 5CQGA 5KFNA 2PMHA 2JX2A 1X9WA 4B3SJ 4LF6F 2X3GA 3OHBA 4CLPA 3G96A 3CJ0A 4HH1A 4QWEA 3LP2A 5IM0A 4WYWA 2BRLA 4DSEA 4DJBA 3D28A 1RT7B 4WFZA 4P71A 4I69A 3OTEA 2DGQA 4USTA 4IH6A 3ZZPA 4J9PA 2HBYB 3CCQS 4CTAA 3HP6A 2DH9A 4KFBA 1U1LA 1TK5A 2MKJA 4C8NA 5EGYA 3MOJB 3HSGA 4C0HA 4WFNQ 3CUNA 1SQEA 2DR5A 4I2QB 4RJVA 2OH2A 2FQQB 3RBZA 4JI5J 1VQ8S 4Q5VA 1RBLA 3V6DB 3DRPA 4EI2A 4DQIA 2OHDA 3LUYA 2JNJA 2RF2A 3MZIA 2IMWP 2DYAA 2NXJA 2VD3A 3NLCA 2CPFA 5KFLA 1VC6A 4OZNA 1S79A 3NAHA 1JK9B 1S77D 2OSQA 4IG0B 4WWSA 2BQUA 5J1EA 4ZVQB 2QIFA 2V8PA 3GPAA 3GSIA 1A6LA 2P9CA 1R6VA 1R8AA 2GGPA 4NRTA 2FC8A 4ZCKA 4F25A 4ZCLA 1F9HA 1EP4B 3MUVP 1FJEB 4DUYJ 2A6MA 4DN0A 5DG9A 1K0TA 2D9PA 3CCVS 1ROFA 4DN9A 2VFSA 4HLBA 1VHFA 5IOLA 3SCIE 2R8GA 1FESA 2WW4A 3VTIA 5E2QA 1X5TA 3OHAA 2PO4A 2RKIA 3EZUA 3W66A 1HBUB 3IM8A 5BYQA 1M1HA 2AJ1A 4KY3A 2X1BA 3HZEA 2M4MA 4TU9A 4DR7F 1VQYA 1K44A 1WF2A 1NK5A 2CNLB 2QC3A 1X8DA 2ZDOA 2R42A 4CM0A 1HWLA 5BR8J 4KRWA 2CPIA 2D3UA 2DGUA 2BVZA 2Z0GA 4JI1F 1N5TA 5KFTA 5GAEI 2CPJA 2RRNA 3BPSP 3CCSS 3JS9A 3R7SB 2DVIA 2RHQB 4M63A 3CT9A 3LGMA 2DNLA 1LW0B 2HG4A 4NI2B 2WVFA 4ZVHA 1TL1B 3KHRA 1FWLA 2DGVA 5KT5A 2LU2A 1B0PA 4PG6A 3Q8UA 1SIZA 4LRCA 1B64A 1IR1A 2J7WA 2EW9A 1RWWB 1NSKL 3G2XA 4F4WA 1M0SA 1Q7YT 2HMIA 1R0CB 2F40A 1S0MA 1IBMJ 2B4UA 3NEKA 3GWCA 5HAOA 3UNYA 4TYBA 2XSFA 3ADAC 5E3PA 3UO0A 4NMLA 1TV6A 2GIQA 3QT5A 5DO2A 1NK0A 1X9SA 4R0JA 3FSYA 4WKYA 4O44A 2FLLA 1Y5IB 1R8HA 1SJ1A 2UXCJ 1TL3A 2CIMA 5E41A 2V6AA 3KUGA 4ZIVA 2YX4A 2HYIB 2H65B 3FCHA 1MMDA 2IM3A 5J2PA 5K8NA 3B78A 2IRUA 4EYHB 4NLUA 2DNMA 2PSZA 5BJRA 2HWIA 1IBLF 2AX1A 2UUBF 1FXLA 4MMOA 1NK7A 1U6BA 3QT8A 3N4WA 2OKQA 1FX2A 2E1PA 2HQ3A 1PC4A 2CPHA 2AZ3A 1FT8A 1MSWD 5IQQA 5HP1A 4QIEA 2BJ9A 1HYSA 4FYVB 3VGSA 3JQMA 4LSNA 4DV7J 1T9XA 4F4YA 3GB0A 4P75A 2MHNA 2C3YA 2V4RA 3GJTB 4FYWB 3RB0A 2MPUA 3CDAA 1ULRA 3LANA 3LO3A 4FXWA 4IRKA 4LFCJ 4USMA 2ERRA 1RT1B 2IRXA 2YNIA 2APOA 2IBKA 4O3NA 1REGX 2ASDA 3VGTA 1N0VC 2E5HA 4ZPBA 5GMEA 1VLYA 4N76A 3GIMA 4MYUA 2HHWA 3CD7A 3CJKB 3KFWX 3C3LA 1RXOB 3E8OA 3TZXA 3ETOA 4WKRA 1PKUA 1KTVA 3VAIA 2WVCA 4FYYB 4X4TA 1N36J 4Y34A 3TUPA 2VASA 2M3DA 3SFGA 4M8LA 4J9MA 1Q1KA 4OV6A 3JAMY 3TQ1A 3HSDA 2WBMA 1OYEA 1WORA 2E44A 4DHVA 2HVZA 3MM5A 1FVQA 1UWBA 5C24B 4PYDA 4ZKAA 2B4PA 2FGCA 2EVZA 2JH3A 1HI0P 4URSA 2XSJB 1S0OA 1SKUB 3PYEA 4JI7J 4C8KA 1N54B 2FUG9 1WC3A 1CBKA 3Q0AA 2KZZA 3OR2A 3MR6A 2QMWA 1YZ6A 1K47A 3ET6B 3M6WA 2OJ3A 1KBRA 5K9FA 1S6PA 4OI4A 4KH1B 5B0BA 3K5OA 1N34F 5H9FK 2V94A 1C2PA 3AB2B 2RS8A 3IBWA 1U0HB 2JWNA 1RBAA 1Q82T 3D54A 4WK3A 2LFVA 2ZH7A 4UOFA 2HPUA 1HI8A 1W25A 2DCLA 1OO0B 1N5QA 1N33J 1DFDA 2VU5A 4YB7A 1NHUA 2J6UA 1T94A 5LMUJ 4C4WA 3L7PA 3PEJA 3QIPA 4K4YA 3DHXA 3G86A 3EPGA 1GH8A 5I3PA 5GAGU 3GIIA 3O6QA 5J2NA 1B99A 3SQGA 2VBWA 1UP1A 4ETXA 1U09A 3US5A 2B5JB 1XNRJ 1R31A 5D0HA 4B9SA 1U48A 1H7XA 4IKAA 4RU2A 3HK2A 4GVBA 4JV5J 3HM9A 4K7QA 2B7CB 1JNRB 5IC4B 3OD2A 3EM1A 1U1PA 3GYGA 3IRXB 3OL7A 4NCAA 1U49A 2HZAA 2DXFA 2N7CA 2J0WA 2JFDA 3FSXA 3OV7A 2UUWA 1M1KT 2DH7A 4A8WA 4LRDA 3NP5A 4MH8A 3A4TA 1U8SA 2W2OP 4FNHA 3IWNC 3NS7B 2A2CA 4IFVB 4S0MA 3I96A 5HMYA 4MIWA 1VLOA 2WSFC 2VC1A 5KFOA 3EPIA 2N3OA 3D3BJ 3L95X 5KFIA 2JC1A 1WHWA 1S1WA 2BKOA 3NKYA 3BZQA 1XERA 3J7YI 1FKPA 2L9DA 1U8WA 5H9EJ 2R9LA 3H25A 1QAIA 1O6XA 2H54B 1N8RT 2DHXA 2DNZA 2YKMA 1CJTA 3H2UB 2NYIA 3DGVA 3TA2A 3UD3P 3ZTRA 3A8IA 2KDOA 4FF4A 1S76D 3HFVA 3D1HA 3BM7A 2ZH3A 5K14A 2YKQA 3QZ8A 3IAM9 2E9RX 3FSIA 1QAJA 2XZDB 2OPRA 1JLGA 2YKAA 3HLUA 2LEBA 3BF4A 2YY3A 4NXMF 1FRXA 2Y0SD 3MECB 1FF2A 2M8DB 4DQPA 1BQMA 2XTJP 2XCAA 1NSPA 2V69A 1WWHA 4YB1P 3NMRA 1ZS6A 2X7IA 4UQGA 1SQGA 3LPYA 2DIUA 4LT6A 4HI2A 1JJHA 2PEHA 3I5AA 3FEXB 2EEYA 4B3TF 1NRKA 2NZCA 1KQFB 1AYEA 5GADI 1UL3A 4RBUA 3VGVA 1YBTA 4LR8A 2V4JA 2WW8A 1QUPA 4OYIA 1FJCA 2JRSA 5CYMA 4JI8F 4P72A 4C0OC 4F4AA 4J9NA 3EGZA 2ALZA 4B3MF 1BQXA 2D9OA 2CRLA 3HHEA 4BBYA 1VQNS 2DHGA 1VOMA 1SXLA 1N52B 2E66A 4PG5A 2J8AA 2RIJA 1JWWA 2XMVA 1N4LA 5KG6A 3OSPA 3VV2B 5BYRA 2DR9A 1DY3A 1VJQA 2YWWA 1AXQA 1XEZA 1XNQJ 5GAHU 2W4CA 1NH8A 1Q5VA 3Q2TC 2QL7B 3QWUA 4DSJA 3M8YA 1HNWJ 5F41A 4DX8H 5EDWA 5IZHA 2GQQA 1Z2LA 2X1FA 2H5EA 2PA3A 1J2VA 1D9FA 1M5VC 4I4BA 4YFUA 5DG7A 3DOKA 5HQMA 2HWHA 3KG4A 2E5LJ 1RADB 4KH0B 3SFUA 3P4UB 1S1VB 4MIBA 3RAQA 3QFHA 4DV2J 1HNVA 4J9UE 4MKAA 3RW6A 2GAGC 1N5YB 4RW4B 3GMGA 4D3GA 3IXQA 5E3QA 3EXCX 5E5NA 4GKJJ 4RW9A 4RW7A 1RU1A 4ZVEA 3QIDA 4A46A 3KK2B 5K8MA 5T7LA 3FDSA 2DNYA 4HACA 5L1IA 2XI3A 3CMQA 1X4CA 3P8BB 4I1TA 4LIWA 4XO0A 3C15A 1JLQA 3OJSA 3D3CJ 4IG3B 4B3OB 2NUUG 3QAEA 1HW9A 4MKBA 4F50A 2HVHA 1UJ5A 3W9JA 2HQGA 4FF2A 1S6UA 2RS2A 3K57A 1RT2A 2FJBB 2OPQB 2DNNA 3ZTOA 3OL8A 3J80U 3LP0B 1K73T 3UCGA 1X4FA 1FRLA 2AYMA 3PV8A 1YKWA 1U1OA 4RNHA 1DLOA 1JLEB 4QR2A 3TAQA 4J37A 3DLEA 1QD1A 1VBZA 3MUMP 1XMQF 4GRSA 4QBUA 2IA0A 2YNFA 4RR5A 4EO6A 1DZ5A 4J91A 1DAXA 2VPWB 2XM3A 2B6AA 3CJ4A 3OXLA 1DURA 2P5VA 1AUSL 4C8ZA 5D3GB 1U6FA 1EKSA 2Z2LA 2KI2A 2BABA 4NEYA 2UUAJ 4PG4A 4O3RA 3BSCA 3K2YA 5EUHA 4DOZA 1IN0A 3HHKA 4PABA 1FERA 2BKNA 2HW3A 2CUYA 4KT0C 3DLKA 4USHA 3TAMA 2IJFA 3OTCA 1F9FA 2QLWA 5L9XA 4WPAA 4Y2IA 5ETSA 2PN6A 2I5JB 5CD4H 4LF5F 1D8YA 1KONA 4CP5A 1VBKA 3C16A 2ZC4A 1CS4B 2B7BB 2IVMA 1RT4A 5CH7B 4LR7A 2BDPA 2MZSA 4L72B 3MM7B 1R0AA 4IRDA 1J5EJ 1Y0HA 2KJWA 1CLFA 2MZTA 4C8MA 3HT0A 3CCZA 1GQEA 5LM7E 2CQDA 3W5XA 1TL4A 4LUBA 3MPDA 1VHIA 2NXEA 4CH1A 2C2ZB 2Q6BA 4PPDA 3GCXP 2ZZNA 2Y8YA 2HVEA 2R7VA 4Y0FA 4IFYB 3VVUA 1BQNA 1M5KC 1XK8A 2J76E 3QSIA 1FKOB 2C2RA 3X3UA 5C42A 3VAJA 3CNQP 4JI5F 2OSRA 4CDIA 3SI8A 2HRUA 1HBNA 4OHVA 3NCRA 3CCJS 3LALA 2QJ3A 1S7IA 2V34A 4TNOA 2DR8A 4WP3A 2V0NA 1WG4A 1BWEA 2HNYA 5AXMA 3BSAA 5L8RC 2PFFB 2KT5A 2XYHB 3IP0A 5DDPC 4DLGA 3CJ5A 3IR7B 2AGQA 2HRTA 4U9RA 5D4PA 2OUGA 3Q86A 4ICLB 1JJ4A 2LEAA 3R6LB 2F8HA 4ID5A 2FJVA 4O3OA 2B3TB 4LREA 4ECWA 1SB6A 4DUYF 3ICLA 3KJVB 1R8BA 3VZIA 4C8YA 2VIHA 5DZ6A 5HROB 3GYXB 4NLVA 2DNPA 1IQTA 2GGPB 3N5BA 3CW2C 2W7AA 3Q22A 4UY85 1CJUB 2FC9A 2ZD1B 1RTHA 2MJUA 3UVJA 5KG2A 1P9QC 2AGPA 4ZP7A 5BR8F 1TMMA 5B09A 1S1XA 4WFAQ 4IO1A 5HBMA 3NNCA 4QU7A 2CWKA 2QSWA 2F9DA 4KIAA 1UEUA 2W8KA 4TY8B 3H59A 5KG7A 2LQ5A 3F0NA 3EDRB 1ZPVA 1OSDA 3M30B 4OFZA 1LWXA 1JLBA 5A6PA 1KD1T 2HNDA 2KB2A 1NJWA 1GFWB 2Y3YA 1RHKB 2J6SA 2WONB 5E3AA 3RG6A 1KLNA 3IG1A 1UJ6A 1HR0J 2JLFA 2G9OA 2OPSA 1G7CB 3POTB 2IJRA 5IC6B 2HFNA 4RW8A 3HF5A 4LR9A 1VRTA 4UUXA 5ITHA 2HFOA 2YH0A 3AXKA 2GQ2A 4ZVGA 3TARA 4BHQA 4HEA9 1WDTA 4GKKJ 1IBMF 5GAGI 4NXNJ 2VG7A 4ANCA 1Y7PA 3FCVA 2C28A 3E2EA 2UU9J 4NYOA 1I3OB 4C11B 1NPRA 4ZP6A 1FTRA 4P2FA 3F56A 2NZ4A 4WE1A 3JTNA 1EARA 4G65A 1SKSA 2HQFA 5ETTA 3U1MA 4A47A 2UXCF 3HHLA 4IO9Q 5KFMA 3K8VA 4G1QB 1V5VA 4DSKA 3E51A 2ZH4A 2K7JA 3K5PA 5E33A 4N8NA 1WTBA 5A8WA 5KT3A 5B0FA 4AL6A 1JJCB 5J2QA 2RDDA 4N7TA 2CZ9A 2YX7A 2F7VA 3RAMA 1P6TA 2WOMA 4LF7F 1TL3B 2IMOA 4J9QA 2Y1RI 1UMJA 1WD6A 3PYFA 4DV1J 2BJ3A 1DQ8A 3DU6A 5G4DA 1VK8A 2CPZA 3V81A 1L3UA 1EQ0A 1OS5A 4IOCQ 2DEJA 2ZNZA 2CG4A 3KLHA 3BS9A 1H74A 4YB6A 3N9UC 3JTPA 4ZPDA 1X4DA 1JXEA 4HHHA 4DR1J 4N5SA 1N6QA 1XBWA 5DGAA 1VQOS 2E7VA 4Q7AA 1BD6A 4ZCIA 3EICA 4MKYA 2LDYA 3D67A 1S5ZA 4RNMA 2D3ZA 5HQLA 4LSNB 1HNZJ 3GU0A 5F8MA 1H7WA 2LQ9A 1TUWA 1RGVA 3D2WA 5E3CA 2DO0A 1TK8A 5J1PA 2LLZA 1UW4A 3R5DA 3RTVA 4ZVRB 3NG8A 2CQ1A 2YNIB 3D9BA 3ZTSA 2MGZB 3CC2S 2DCUB 2XMTA 1G6BA 2VB6A 2GJ2A 1DARA 3IAS9 2VODA 3HSJA 3A13A 4PQAA 4PRFA 5JVGQ 2H4YB 2XS5A 3LGNA 1OIAA 4NA3A 3BN4A 2AJ4A 4AQYJ 2ZBIA 5F8LA 1RHRB 1KP6A 1UW9A 1O51A 2ALYB 2E1CA 4NCBA 4PXEA 2ZOGA 3M8PB 4JI7F 1DTTB 1FJGJ 4U95A 3I82A 4JUZA 2XYPB 1N5VA 3TEGA 1NKBA 1NKEA 4PXBA 4KR0B 3UDVA 4AT1B 4UOGA 4FDFA 4CM2A 5MAOA 4I2QA 2CAJA 3MM5B 3W3SA 4MYTA 2C3PA 2XZWA 4NLWA 3DM2A 2EFNA 4EFAC 1KVKA 1Y4ZB 3UE2A 2Q3PA 1B0VA 4AFFA 2I38A 4CWBA 4LRBA 2XY5A 2DHAA 4NEZA 4C3LA 3TEHB 2E5GA 4U7CA 1M5SA 3N6LA 5B0CA 2MSSA 1CJKB 5LSOA 4IG0A 3CO9A 5DQGA 1WKJA 1U47A 5HO4A 4H4KA 5LMUF 4IQXA 3WDOA 2XNRA 1RHMB 5GMDA 1EP4A 3KXDA 4QIFA 5EN1A 3M1VB 4ED2A 2K7KA 4ERDA 4OYAA 1T8EA 1SC3B 1YRUA 4DFKA 5KFVA 4NMXA 4RUBA 4EU0A 2VG6A 3G8SA 2J9EA 4CYUA 4LVOP 1TK0A 2FJEB 1SV5B 3C14B 3IA0A 1KEKA 4JBCA 1HBUA 1R6YA 2B51A 3DOLB 1Q95G 3R7BB 1XTZA 4WXWA 3C8YA 4LRFA 4DR5J 1OY6A 2XS7A 1F60B 4OJGA 2DY1A 3SQGB 3RB3A 3TVYA 4M5KA 1JXVA 2GW8A 3IRWP 4DV0J 2JOQA 3VAMA 4DPXA 4JOUA 4JI6J 4FPRA 2WTFA 3K58A 4FF3A 4QW8A 2VFRA 4PXDA 4DPUA 3CE8A 4B9LA 2W2QP 4GMKA 4PYAA 2HFUA 2RDIA 3Q2SC 1K1QA 3CJTA 1UVNA 2V2KA 2KG0A 5AT1B 1LW0A 3P96A 2AF6A 5KFEA 2OD6A 4I67A 1TL1A 3T19A 1NK9A 4DL2A 5ETRA 3FNNA 2U2FA 3S7RA 4DU7A 2F63A 2KRBA 1NSQA 4K4SA 4I6WA 4ZHRB 4USUA 5C7PA 2GFFA 2UVUA 1KTQA 1QAXA 2NCKL 2RT3A 2R8JA 4X4QA 4ED8A 1AW0A 1NSAA 5KFAA 2KYZA 3T5LA 2M5YA 5EWFA 5IWAJ 2HBRB 2J7UA 2AU0A 2YTCA 4GO5X 1QAYA 4MT1A 2CQPA 4X4UA 1FD8A 2G13A 4HL9A 3T41A 1M5PC 1S12A 3BPDA 2ACMA 2GO8A 4V19J 4BS2A 3TJ9A 2QMUB 2UZAA 4KE5A 4USIA 3HXMA 1Z4UA 3LTOA 3UDCA 4USWA 3NL0A 1TAQA 2EFQA 1S0NA 4AXJA 3T9NA 4K5RA 1S48A 3D0GE 2GAHC 1UFWA 1BQMB 5KFFA 3CDEA 5HI7A 2ZUGA 3FVYA 4DQSA 2AZ1A 8ATCB 2BXJA 1BC6A 1PIEA 2DGOA 3Q89A 3PR5B 3W8PA 2ZZTA 4NLTA 2WVEA 1NO8A 3ZZYA 3ZTQA 3ZXWA 2NREA 1IM4A 4DWIA 4PKDB 3BSOA 2QN6B 1X9MA 2KJVA 2LA4A 3RJMB 2ZITA 2HVIA 2J9DE 1VS3A 2RUGA 4F02A 4QW9A 1JMTA 1SC1B 3UN2A 1XNQF 2MDAA 2EG2A 3HD1A 5D4OA 2DTJA 1HIYA 4MK9A 2XMAA 3GE9A 3SZ2A 1HNWF 2RH3A 3TX8A 5C25A 5D77A 3U1LA 3CJKA 4CLYA 4UF4A 3HHNB 2KT2A 2FVRA 4RNOA 1UPMB 3PG9A 2CQIA 1RDRA 4P52A 3VVTA 2KTQA 4A8QA 2E5LF 1R27B 1GXLA 1FNMA 2CQGA 4PPZA 1U4BA 3FUYA 1TL7B 2E7WA 2EXUA 2NSBA 2DGTA 5ETLA 2E9TA 2XMUA 4UW2A 1GT8A 3PKMA 3ILJA 3KMSA 5C24A 2E1MC 1D8ZA 2WB1D 5D15A 2RD5C 1IKXB 2ZVIA 3MFIA 2A1BA 3VAKA 2MKKA 2F4VJ 5KT2A 2GHVC 4CT8A 4ZVSB 3HHLC 1I5OB 3LF0A 1QY7A 4GKJF 1SI9A 2W2PP 2MLYA 1I94J 3OFEA 2OFHX 2ZJQQ 5KFSA 3ZZOA 4PWUA 2M0GB 4OYZA 5B08A 1JXLA 3EXYA 4X65J 1FEHA 2XULA 2QTWA 1HPZB 1U0HA 3IS9B 3R8YA 5B0EA 5GAEU 1S9FA 4NWBA 1RP5A 4J9VA 1IKWB 4CCHA 2UUTA 3JAMU 3RBEA 3OSNA 1JLFB 3ZTPA 1T95A 2QFIA 4W90B 4ILLA 3MF5A 4CO3A 1RWUA 2QYGA 2LCWA 3PJWA 5KG3A 4G1IA 2DJWA 1L3VA 1SL2A 4BWMA 5H9FJ 2HZCA 1U1KA 2V9WA 3WIUA 1F3VA 2YNGB 4RUAA 2B5JA 2VFTA 4ED6A 1RB0A 3D66A 4PUOA 4JI0J 1YIJS 2MB0B 1NAQA 1U1QA 2FHJD 3JYTA 5HMXA 4ILMA 5KFBA 4X2BA 3VWSA 3I55S 5F9LA 3IRXA 1NCLA 4UY8T 1WUUA 3RBDA 3D6TB 4NA2A 3IGNA 1BLUA 1A9NB 5KG1A 2XC9A 4M95A 1I1GA 2AJQA 4YB5A 1YRTA 1DLOB 1B4SA 3IMQJ 2UUAF 3BKFA 2W9CB 1REVA 5EX0A 5HL7Q 3EX7B 1HFEL 4RKUC 1KRPA 1IUJA 2D3O1 3FQKA 4IFVA 3KG1A 3SXLA 4NLXA 4LFAJ 2EC2A 3E01A 2VKRA 3TO8A 1GXTA 1B3TA 1YZ7A 1Y00A 3I87A 4CRJA 4F7VA 3DOMB 3MEDB 2YVSA 4O4GB 4C2MA 3DLHA 4YP3A 4IR9A 1FNXH 2W24A 3ZO7A 4LF4J 1SQFA 2J0QD 2HVDA 3H20A 1WI6A 5EHHA 1TQLA 1CEZA 2AMCB 2IY5B 4ZLPA 5J2MB 1QJHA 1S10A 1J5EF 3CCUS 1G1XA 3OR1B 3ZNJ1 3O8WA 3JSMB 3QAUA 4B08A 2NSCA 1S4FA 1OQ3A 3FQLA 4OHZA 3DRSB 3TWZA 3WIVA 4QWBA 1PYOB 3ENVA 3EYZA 3AT1B 2DNGA 4ZS6A 1Q53A 1A7GE 1C0TB 3HVRA 1RAJA 3LH2S 4G1PA 1HNXJ 4H4KC 2LXUA 4MIAA 1RHQB 1FDAA 4ZVUB 3MECA 3HX9A 2YKPA 3T1HJ 4Q45A 2JFKA 1TFYA 4Y3CA 1IBCB 4ZPVR 1HA1A 2MY7A 1QDUB 1W2IA 3MGJA 4DV6J 2VDIA 4FS1A 2DH8A 1HBMB 3OXFA 2GVDB 2GV1A 2IYGA 3AOCA 5F0UA 4DPOA 5C5JA 5DQIA 4DFJA 3L4BC 1LFPA 2L48A 3UDLA 2LDIA 2JVOA 3HD2A 1FRMA 4F3QA 1VQLS 1HBNB 2X51A 4MK8A 1OYDA 4IOBA 1WC4A 2RE1A 5HJYA 2HNYB 2L41A 3RR8A 3M2VA 1H6KX 1VMBA 4IQMA 1KWMA 4ZA1A 3TP2A 3T1YJ 4K4UA 4HDGA 1BUXA 3SCLE 4TXSA 1QSYA 2QL9B 4Q44A 4LF8J 2HBQB 2YKNB 1PBUA 5THWA 4KYZA 1QVFR 2HHQA 4F0MA 3ZNUA 4ID5B 1KR4A 5K8OA 3OUYB 2ZC3A 4UOCA 1TELA 4DBQA 1SJQA 2AT1B 4OI0A 2KFNA 1PSDA 3CCES 3Q8SB 4ALZA 1BGXT 5LJ3Y 4LBPA 3CMAS 1X0FA 5F0WA 3THVA 3TJ8A 2ZHOA 4ED0A 2GO9A 4U96A 4CO5A 4E98A 2AEMA 4A8MP 4ZPCA 1FDDA 3FGVA 2V2VA 2X1AA 1Q8KA 2NXUA 1U2CA 2YWFA 1S6QB 3NGDA 2JDJA 4A4JA 1S1VA 2A3JA 3IM9A 4P9SA 4QIVA 3GV8B 3NGUA 3BGOP 1BHNA 5E3RA 2NLWA 4ILRA 1ZAVA 3MMJA 3THPA 2GJFA 1KVIA 3D1OA 2BX6A 4RW4A 3R1HA 5HANA 2DD8S 2IPOB 2DO4A 3M6XA 1HR0F 1URRA 3OFFA 3D0HE 3PXGa 3SIPB 3T1AA 3MR5A 3R5AA 3HPOA 4NL5A 3M32A 3KK2A 4TN2A 5HSPA 2XY6A 2X1GA 2JEIA 2R7QA 2JL9A 1L3TA 4GKKF 3G6YA 1JLCB 4Z2XA 3NXZA 3IG1B 4O3QA 4EZ9A 2OO4A 4NXNF 3OTDA 3GG1A 4M5IA 5D78A 1FO1A 4B3OA 2UU9F 3MEEA 1KNZA 4RO0A 2R7TA 5KFQA 2V8GA 2GHPA 4KHRA 1I6JA 3GJRB 1V6HA 1VJWA 4XPEA 1KQGB 3PEHA 1ACMB 2VUGA 1XR7A 2N3LA 1TKXB 3WHIA 3AJDA 2E5IA 4ED4A 4M5LA 2RQKA 5ETKA 2FVPA 2QRRA 3LP0A 3MCNA 1SPBP 2H48B 5I42B 4WE1B 3J7YU 1RQ0A 2A0FB 1EHWA 2AEJA 3NGKA 5E0OA 5D0GA 1JLEA 1RT5B 3K5NA 4DCPB 1CVJA 4DV1F 5KFXA 1S9GA 1RTIB 4RPFA 1FRJA 5BXIA 1B0TA 3AQOA 4OLPA 3B6BA 1QTMA 2MZQA 4ZVOB 5D3GA 4OQJA 1GAOA 3GFXA 1NHKL 2W9AA 1VQPS 5IT0A 2JVRA 4RNNA 1MROB 4DR1F 3M8RA 3DXBA 3KHGA 4CLLA 3ILOA 4RWWA 3HVAA 4EBEA 2B4VA 3V81B 2QA4S 1AFIA 1UWAA 4IOAQ 3QFWA 1UPPA 1HQ2A 3SSRA 2ZJPQ 1HNZF 2FLPA 2FDNA 4DR2F 2HS3A 1GMWD 1IVZA 3Q8VA 4EMDA 1WJ9A 3TAPA 1NMEB 1DTQA 1T05A 3C6TB 2ZZMA 2I5JA 4JYAJ 2XO7A 3K8WA 5G0RB 1VISA 2D69A 4F26A 2DHSA 1KVJA 1N5SA 1CS4A 2W7PA 5GADU 1Q0NA 2QZ8A 2FZCB 2D3OR 3LAMA 3HVWA 2HHTA 2CQ3A 3D4JA 4USKA 1VDHA 1NJYA 3W1YC 2LYVA 4KJIA 2L9NA 4IFYA 4KTQA 2ATLA 1FJGF 2O5DA 4M5DB 2OI2A 3EGWB 1WF1A 1FKOA 1V3ZA 4CLZA 1LK5A 1UKUA 2CKWA 4OYXA 3FFIA 2HHSA 2G1DA 5KFDA 4LF9J 2ILZA 3QLHB 3G9CA 5IT4A 1FFWB 4OI1A 3QGPA 5CABA 4R25A 4GVLA 5CYJA 4NLGA 4Q8FA 1S0VA 5DQHA 4EZ6A 2CVEA 3R97A 2PC6A 3DM2B 2R2SA 2BQRA 3MMCB 2A10A 1RT3B 3L3CA 1NDCA 3M6UA 3KK1A 1C1CB 1S99A 4ICLA 1TR0A 2YNHA 3DYAA 5D0EA 4E2FB 1AA1B 2XHWA 4DPYA 3QPIA 5K8PA 4PWWA 2ROPA 2V8DA 3J7Z5 5FDLA 3KJVA 3MMAB 4KV8A 5JUMA 5HROA 4M5GA 5DG8A 5DLGA 4FBUA 3DXSX 1Y10A 3CO0P 4DR7J 4CH7A 1SKWA 3I4PA 1N88A 1JNZB 4UTGA 3DI6A 1R8CA 3EE3A 1RKJA 1NK6A 2ZUAA 1RJJA 4RW6B 1SJ3P 1CJUA 2ZD1A 4DR5F 1U25A 2WVDA 4YQWA 1D09B 2RHSB 2QT7A 3MAHA 5KFGA 2VG6B 4DV4J 2NXNA 1JJ2R 1RAAB 4CYUB 4NE9C 2IIHA 4QPXA 2F8EX 3NS6A 4FXVA 1KHVA 4JI6F 3W9HA 1GMUA 4TY8A 3W5YA 4A8OA 2OEKA 2DHHA 4QIWD 1HL6A 1WG5A 2J0SD 3M30A 5DDOC 1FVSA 5ETVA 4A8SA 3CWJA 3H5SA 4OI2A 3OXGA 1V3SA 1FXRA 1HQUB 1C0UB 3L7OA 1D3WA 3G87A 2WONA 3A3NB 4B9MA 4HKQA 4WP9A 2B8QA 4MTPA 1Q7LB 1CG2A 1U02A 4TU8A 3POTA 4FBTA 3D5MA 4K2JA 1HD0A 3FMBA 1S1UB 2DISA 3WBZA 3FZ2A 3RUBL 3GFYA 4P7TA 2UVRA 1TKTA 3DU5A 2POKA 4OZ0A 5KG5A 2ZBQA 1X4GA 2ASYA 5A8RB 1QVGR 2OP5A 4ZVTB 2VA3A 1RHUB 1SUQB 2GQCA 5IWAF 2F3JA 4C11A 1PJ7A 1UA0A 2Q6CA 3NMAA 3LGHA 4DL4A 3C19A 4ENOA 4V1Ak 1U24A 5B0DA 5IQ6A 3BYPA 2W4PA 2ZH6A 3KK3B 3RRKA 3MEKA 1U2FA 5KAKA 4G1QA 3OBIA 1CQNA 1HWUA 2HK3A 3BO4A 1WG1A 2DIVA 1ELOA 5CCMA 3KLEB 4KPCA 1IBLJ 1VIOA 3PYGA 4DL3A 3KWMA 1P1TA 3ITHA 3ONQA 4QWAA 1OMSA 2B9WA 1RT6B 1HWKA 2B9YA 4B9TA 4DI6A 3A1YG 1V9OA 1R0BG 3UD4P 1E6VA 4DUTA 1NEEA 2IHR1 2IVYA 1QTNB 2HURA 2D41A 2XMMA 1NJZA 4B3RJ 3G82B 3VHQA 2PI4A 3CCMS 2GNKA 4ECXA 1WC0A 1X5SA 3SQOP 3EMTA 2VQEF 2C22A 3CCRS 3I0SB 4DCJB 3LWMA 3KLIA 2NPFA 2E29A 4WZQA 3T6JA 4F67A 4NLOA 3D7SB 4CNZA 1S49A 4QWCA 5M2PA 4CLFA 1RBOB 1TL5A 4L6V3 2R2RA 2EK6A 3N28A 1HLWA 3CJSA 2VOOA 3PX0A 1DHMA 3RB4A 5C2GA 2ZH5A 3UR3C 3PIOQ 3K5MA 1TFWA 1SCJB 1XIQA 4ED1A 3R6GB 3PRDA 2YBVA 3BDPA 3QJJA 2MGZA 1LWFA 2DKOB 1TU0B 3IWLA 2HIYA 4TVAB 2CQHA 1RWXB 2C2MB 2DNOA 3H0PA 2YQ0A 4WIQA 2I1RA 4IDKA 5C25B 4WU2A 5CXTA 3HJFA 2R7UA 2EBGA 2RQ4A 1YGYA 1NK4A 2G2YA 3M8PA 2OFGX 4G3IA 4KQZA 2HLUA 3UN3A 2DRDA 4LMZA 1DTTA 1BY9A 2F4VF 3CD6S 4YDXA 3W62A 1WKLA 1VQ7S 3NCPA 1UVMA 2JEFA 5AXKA 2R8IA 1SC4B 2ASJA 3ZZTA 5RUBA 1I94F 1Q16B 3N01A 3DRYA 3DKDA 3NWRA 5F8IA 3FBEA 4KKOA 1W26A 1FCAA 3IFEA 1HBOB 4ANEA 1UVLA 4LFBJ 4CI0B 2B9XA 3U1NA 1AROP 2DPIA 2XLJA 1CJKA 1U1NA 2W9BB 2HHXA 3ZZZA 3W61A 4KGZB 2PT0A 4Y28C 1D9DA 3QJPA 5KT6A 1VRQC 2KKHA 2JJ4D 1DBDA 4C48A 3M1VA 3QYYA 3LP1A 3D6FB 4YR0A 4I56A 3M2RB 1QE1B 1H3DA 1SV5A 4Y2CA 4KO0A 3C14A 4JI0F 3KNAA 2QV6A 3DOLA 1JQGA 2MLZA 3VR1A 1HQEB 4P2XA 2VFUA 3M4XA 3M2UB 4MAKA 4NZ7A 5E7OB 2Z30B 4KGXB 3K7RA 2MJNA 2LA6A 3TA1A 3OL9A 3DN9A 4QYZK 2MYFA 2AJ0A 1GTEA 3EZ5A 1XMOJ 4NLSA 3W63A 4PUOB 1RAEB 2XCPA 3DNCA 1RA7A 3JYTB 4DG1B 2BOPA 4Q0BB 2OMLA 3SCKE 2LP4A 2IM0A 4X4NA 3CDBA 2GZOA 3BGFA 4ZJQA 3AD7C 3SEOA 3MR2A 2OIHA 1KC8T 2CNNB 4W92B 2EKNA 2EWHA 2KM8C 4W98A 5CZXA 2HAIA 3I56S 3IWXA 3MAAB 1NXIA 4ELVA 4L74A 5SUHA 2PI5A 1AZSB 4LF4F 3PJXA 3SSSA 1REVB 3PO4A 3CCWA 4QQBA 4K0KJ 4K4ZA 1NU4A 2HHVA 1CJVB 1GEHA 2PFDA 2ZH9A 3I31A 4BC9A 3KTQA 4XIUA 1P9YA 4OV1A 3ILLA 3E01B 3PFOA 2JLGA 1X5PA 4J9RA 2J9DA 4EK2A 3DFEA 1RWOB 4ZHRA 1YSJA 1T0TV 1ZH5A 3BYRA 3D1QA 4X84A 1XR5A 2E1RA 3F44A 3V6JA 3C2PA 2WZ1A 4EEYA 2DNQA 1XC9A 4U7UD 1NB2A 1LFWA 2RQCA 2ZM6J 4F8RA 3Q8QB 2Q43A 3PW5A 2L9WA 1HNXF 4N41A 4P2SA 1LNQA 1WSVA 2UXBJ 3N5FA 1MNEA 5F8GA 7FDRA 1SJFA 2LQ8A 3IN5A 3UDEA 3T1HF 3RAXA 1EZZB 1RZMA 2HIQA 3RR7A 4DV6F 1H38A 3CD5A 2JZ5A 5B0GA 2CJAA 1T02A 5KOXA 4B3TJ 3DLGA 1YJ9S 2LMIA 4NCGB 6AT1B 4WF9Q 1ZPWX 4L73A 4CO2A 4I68A 1SJ4P 3I5CA 3TUZC 2YWKA 1WOSA 2OTLS 5HVHA 3QQCD 1F9EB 2PGCA 2AYGA 2UUCJ 2C3OA 2VPYB 4Q2LA 1EETB 4OJ3A 4RZRA 2IAJB 3R2DJ 4EUVA 1W2BR 1WEYA 4ZOSA 4O0NA 2C2DA 5GMKa 3KJQB 2VZ9A 1RAFB 1LXNA 1KLMB 1YITS 1K8AT 2QLFB 2QA1A 2AWZA 3T1YF 4U8VA 4FKXA 3DDKA 1RTJB 4LF8F 5I4MA 4F3MA 3O1LA 2M70A 1T03B 1UFKA 3MDFA 4FS2A 3MPVA 1VK3A 2KXHA 4WBFA 1U1MA 1WDDA 3M2VB 3J7A1 2IDEA 1RWMB 2O01C 5AE3A 3UCUP 3PDNA 2FZKB 2AYBA 3MFHA 2OEMA 2QEXS 2AX0A 2D7SA 4NLRA 2R2TA 5KFCA 1VFJA 3OJUA 4WXOA 4DL7A 2J7KA 4CIOA 1AT1B 4IYQA 3U02A 5A2QU 4KAIA 1ZAWA 3UNGC 3PM9A 1TL7A 5ADZA 1YQHA 2O3DA 1WHYA 1S72S 2ZBPA 5AJ3J 3CB4A 1HI1A 1B7YB 3WZ0A 4F3OA 1NPKA 3R5CA 1F5AA 1IKXA 5L1JA 4UQTA 3NCQA 3TUIC 4ED7A 1EJ7L 4Z37A 5DRKA 3DRRB 3B4DA 2DR7A 4X4SA 3NGRA 4OL8A 4CLWA 2FJAB 3N0VA 5HLFB 2V2ZA 2PE8A 3IC1A 1KS2A 1WELA 2GIRA 4A8FA 1HPZA 3IS9A 2IC3B 4PAAA 1SH0A 4FVCA 1BE4A 1YG0A 1IKWA 1YJRA 4NASA 4USJC 4X62J 4ZLLA 3M32B 3GSDA 1JLFA 3BSNA 3HKZD 3LQVA 3HFKA 2XGPA 4J5OA 3O3LA 3UR0A 1FD2A 1V3RA 3PYDA 2MTLA 2R7WA 3O2IA 2MHEA 3MEEB 2KG1A 2C3MA 3I5BA 4ES1A 4UZCA 2H4WB 2Y8WA 2H5JB 3QO9B 2YNGA 2QLBB 4CQ1A 2Y9HA 4H4OB 3R2CJ 5H1SV 3TQEA 2RU3A 1NH7A 4MFBB 1X60A 1NHVA 2N7YA 4CO1A 1N32J 5IV3A 3WX4A 1ZM4A 2SXLA 3CJQA 2KT3A 4CO0A 2K1RB 2BANA 1YRXA 1D1UA 3HI9A 2IM1A 3QWPA 5K20B 2V63A 2ZH2A 1G4CA 2YH1A 2HFVA 4KHPF 3H40A 3AAWB 4OZ2A 5I3QA 4ZN1A 1H73A 1NUEA 1T9WA 2W9CA 2P2CB 4FZVA 1S9GB 1PJ6A 2J9CA 3R7NB 1IQZA 3NGSA 2F4FA 4I6YA 3DGPB 1ICEB 4ATNA 4EBDA 3AD8C 5B7WA 1YBAA 5KFUA 1KQKA 1SIWB 3DOMA 4R0EA 3MEDA 2F8MA 4O4GA 3QT6A 3NOCA 4JYAF 3PFEA 1QM9A 4J9KA 1X4AA 3DMJB 4ZK7M 2UXDJ 4TYAA 4AL7A 1KKHA 3QRQA 4P7VA 4AD6A 2HS4A 5A0YA 2GVZB 4CLTA 5ETMA 2HHHF 2H1YA 5J2MA 5KTQA 3OR1A 1DTQB 1T05B 3JSMA 1RAIB 4EGLA 5IT9U 3A3PB 1NJIT 4OYOA 1IKVB 3SSQA 3JSYA 1GK8A 4AXIA 2P8IA 1NM2A 1K1SA 3DRSA 4OJ1A 2Q66A 3PTWA 3AOBA 4B3SF 4IR1A 1RI7A 1C0TA 1VQ4S 2NPIA 1ITPA 4NLPA 1RHJB 1F2HA 4HYKA 3VAFA 4PCQA 4U7UK 5L1KA 2WK4A 3AH6A 3PY8A 3N6NA 3B4MA 2K2PA 3DRXA 3K59A 3P49B 2QFJA 4LF9F 1YX2A 3K17A 3UCZP 2MEWA 3TVKA 2FHKA 1R3NA 1HBMA 2GVDA 4F4XA 1WC6A 4ZVPB 2KM8B 4ECVA 5D0RA 4I2PB 2MQ8A 2DRBA 3BBFA 4NZ0A 1WHXA 1NK8A 1KSPA 4LVNP 2HQIA 4ZJOA 4ZJLA 3FFIB 2AW0A 5EWGA 4HHJA 2RRBA 2JLEA 2R3VA 3H2LA 2R7OA 4H54A 5DS7A 7FD1A 4DUZJ 1HWJA 2KU7A 2JC0A 3CXCR 4DX6A 4FKYA 1Q78A 3MMBA 3ZZRA 4DZ6A 3ELHA 3MM6B 2CDQA 2ZDPA 4P73A 2Z2MA 1YVFA 3OQ2A 3OTOJ 3KHLA 2QMXA 1F3FA 9ATCB 3KK1B 3Q23A 2YKNA 2K06A 1MWQA 2YNHB 1S57A 3DYAB 3OUYA 3UI3A 1RYSA 2V5HG 4Y6IA 2XMWA 1OPZA 3RB6A 3GLJA 2HKEA 1TMJA 2HEKA 3R27A 2D74B 4RNFA 3U7JA 1S9EA 4RLEA 1Y9OA 3V6HA 4WP8A 2U1AA 2YX1A 4ZLJA 5FDLB 2QYCA 3KLGB 2DITA 4KV8B 1UTAA 2XZTB 4ZPAA 4M94A 4DV4F 2M52A 3CEDA 4DDFA 3G8QA 1GTHA 4DQQA 4YHHJ 2FY8A 2CPXA 5HK4A 1UCNA 1SC6A 1KFDA 1S6QA 2CZ4A 3LAKA 4M5HA 4N56A 3DI6B 3MM8B 4HI1A 2ZKUA 2QL5B 3UW1A 3I4HX 1FRIA 4N8OA 5DM7Q 1UFLA 5HQ8A 5IXUA 5A76A 2LVWA 3CULA 3GCWP 2AV5A 3X1LB 3PW7A 3I32A 3G6ES 1OQ6A 2KL8A 4OHXA 5CHCB 2LQBA 4I6AA 4PQUB 2Z57B 1LQ9A 5D6GA 1S4EA 1GX5A 2MKHA 3FKBA 2BE7D 4ES2A 2MQMA 4RBTA 3W2WB 4YR3A 3EGNA 3GFZA 1JLCA 3K0JA 4PWDB 3FBCA 4XK8C 4GC7A 4OMFG 2HNZA 5D4LA 3KUEA 1TKTB 2VG5A 5KG4A 2MKSA 4CLKA 4X64J 3TJAA 4PG7A 3W2VA 3QNWB 4DR6J 2CQ4A 1Q81T 4NYZA 1TKXA 2ABYA 1RTDB 1OPIA 1HHSA 4A8KA 4YMEA 3O44A 1P1LA 2IM2A 1WEXA 1ZTWA 2AQ4A 2P9GA 1YJUA 3ENQA 4Q43A 4LF7J 4OYMA 4WFYA 3Q8PB 5I42A 3QGHA 3JQJA 3AOAA 3KDNA 3DLJA 2C1EB 4DR4J 1LEOA 1FE4A 2XEXA 3NNHA 3VQSA 3AY0A 1NKCA 1RT5A 3AA9A 4OYWA 2HGNA 3T5KA 1XWLA 2RMLA 3PRVA 1E6YB 1RTIA 1FXDA 2BJEA 2ZFHA 4NPOA 1XJWB 4B3RF 2RQMA 2CG8A 3ITHB 5KFYA 4DF8A 3CCTA 1VI7A 4ID8A 1XMBA 2ZNYA 4DV5J 5FLXY 1GMWA 3BJYA 1MROA 2KFZA 3NOGA 1LWEB 1U6ZA 2M8HA 1E6VB 3GIJA 1X5OA 1CULB 2KO1A 3J7AN 1U0SA 3LOUA 1YJNS 3LWLA 5EWEA 3HFZB 1VQSA 4DV7F 5B0AA 2DGSA 4XPCA 4OJHA 3CD0A 3F73A 4R5PB 1TKZB 1FDBA 3PNIA 1FDNA 3C6TA 1EKRA 2ZJRQ 3KLIB 2J6TA 4ECZA 2ZE2B 2GA7A 2CPYA 4DL6A 1U7LA 5G0RA 4DX5A 4R8UB 2G1HA 2RNEA 4LFCF 1LK7A 4F0HA 1RACB 2AEFA 1RWNB 4KBIA 4OZ5A 2C2EA 3W60A 4X4OA 2E7XA 2K3IA 1VBXA 3MTJA 2ILYA 2XLKA 2K3KA 1U1RA 2GX8A 2QSFA 2IRYA 3SBMA 1LWFB 1EX8A 2H51B 5L39A 1N36F 1Y3KA 2BJ1A 1NB7A 3LW5C 3D68A 5KFPA 3MEGB 4M5DA 1NPPA 2YWHA 5F3ZA 2VOPA 1T3OA 4QR1A 2BQ3A 4IDKB 4MKVA 2VL1A 1RWVB 3DDNA 5AE2A 3H7HB 3VAHA 4BC7A 3P6YC 1MMLA 2MQNA 4B9VA 2FPHX 4MJKA 3N6MA 3D6HB 3W9IA 2IBOA 2W2NP 3QLHA 4OI3A 2R7RA 1URNA 4LFBF 3NGTA 5LMNJ 1GXUA 2B0GA 4OX7A 2YPZA 3NWGA 4J9LA 4X66J 3PIPQ 1MU2B 3MMCA 1VQMS 4W4MA 1IR2A 1WACA 1IM6A 2HZVA 1RT3A 1C1CA 5DGBA 4LF2A 2B43A 4AUKA 4KKOB 4WYLA 3WC2A 4JB8B 4I64A 3EZOA 1F6TA 2VH7A 3RGIA 4DV3J 3MPUB 4HT5A 2BKPA 1NNDA 3MMAA 3GIKA 1FX4A 5A8KB 3NBPB 3BGRB 4V19X 1N33F 4ETZA 4I7FB 1L3SA 1MW7A 1LOUA 3FRZA 4KGMA 4Z7CA 3GONA 4RW6A 3T6BA 3LP1B 4JI2J 2BUNA 1RSCA 5CYQA 2DXEA 2VPZB 2DEIA 3S6EA 2FVSA 3P3DA 1XNRF 3M8ZA 1XMOF 4KO0B 1RLCL 1G2EA 1KOHA 2CQ2A 3UQSA 4JV5F 2C2KB 3V4IB 1S59A 1P8GA 2VC0A 1S1TB 3EUNA 2F9JA 4ZCMA 4FVMA 3HCXA 1T9TA 2UVWA 1RCOB 4U8YA 1HQUA 1C0UA 3RRHA 1PO6A 2BACA 8AT1B 4WZMA 3PRBA 3FZBA 2G0JA 2XBPA 3CJRA 3P5BP 4ELTA 4HT7A 5M2RA 1N56A 2XWXA 4N77A 4K0KF 2QG9B 1RUSA 2CDRB 4C97A 4NLDA 1S1UA 1BWVA 1LWCB 4IH5A 4LSZB 5KFRA 2Z58B 4IH7A 2L08A 2ZBCA 2CQ0A 3TX0A 5CA5A 4OX9J 3V5RA 1MG7A 1NDPA 1RAHB 2HGLA 5DLFA 1WEZA 1UETA 5A8RA 1J5OA 4Y2KA 3AJ1A 1MWYA 1XR6A 4TU7A 1SUQA 2MY8A 2Z8QA 2CFXA 2ZM6F 5DDRC 4OI6A 4WJBA 4LSLB 1TVRB 2FJXA 1J27A 3J81Y 1T11A 3KK3A 2I0XA 2NS1B 2UXBF 2OMOA 2R2UA 2H3EB 2QO3A 2CA9A 4K50A 4KB7A 1F2GA 1YLXA 3SV4A 1GMVA 3H42A 4J9OA 2GJIA 3ULHA 4C7QA 3KLEA 2I2YA 4CZCA 4X4PA 3MOZA 3OLAA 2N4DA 1U45A 1H2TZ 4JI4J 2XMKA 4QJVA 2VONA 3MPWA 3SV3A 1RT6A 2EKYA 3MCOA 3CJ3A 4LBIA 2L3MA 2LEPA 1MMNA 2KVQE 2VDHA 3T5JA 3DHWC 2H9ZA 2UUCF 1U2RA 2HGMA 1Z1ZA 2UP1A 3C46A 3G82A 3NS5A 2FY1A 4CLUA 1FFSB 3BR8A 3DLGB 4GC6A 2G0IA 1JKHB 1T3NA 3I0SA 3JXOA 2AP6A 5LL6d 2PEBA 3RW7A 2BE2B 2O1PA 3PO5A 3JQKA 4BCAA 1M5HA 1HHTP 1MN9A 1YTYA 4DFMA 3I0RB 1UVIA 2QE5A 4BWJA 4TLRA 2MZ1A 1V5IB 2RJZA 3PJ9A 2MQOA 3MXHP 3HZGA 3QATA 1EIYB 2RDJA 3W64A 2DGXA 2HWTA 3BB5A 1VQ6S 2GHWA 4EWTA 2F5GA 2MMYA 2I6WA 4WIIA 4UZBA 2FLOA 3HULA 1YK9A 2NYHA 4I0WA 1FKAF 3H2VE 1O5JA 1HWIA 3MM9A 1YWXA 3IR6B 1KHWA 1C1BB 2I9SA 3MD1A 1DQ9A 1FNOA 2PD1A 3PHTA 4K5SA 4PEOA 1PC5A 4QPTA 4K4WA 5AJ3F 4G6VB 2W2MP 2MZJA 3PVXA 3GP9A 2Y1LB 2LXIA 3CGIA 1MN7A 6FD1A 3CMES 4FF1A 5LSRA 3MPYA 3A8JA 1PCAA 4ES3A 3E3XA 5T41A 4DV2F 4B17A 3VQTA 2Z2ZA 2VHGA 2R4FA 2N82B 5HVFA 4ZLNA 1A0OB 2WAQD 1PBAA 4FYXB 3FC9A 4L75A 5M2UA 1LV5A 4A8XA 4N47A 1M1GA 5JXSA 2M9KA 4C98A 1HBOA 3BKTA 5D4NA 3PW2A 3KYLA 3ZZ0A 3MUTP 3K5LA 1JX4A 3KLFA 2AJFE 4X62F 2Q1LA 4Y2AA 2W9BA 2FJDB 2EBEA 2ZH1A 4WK1A 2QA4G 1WC1A 2XNQA 4DR3J 2CJBA 3ETMA 3RZAA 2COLA 4ZDNA 1H2UX 3LA0A 3OVAA 2ZHBA 1IKYB 2ZH8A 1PAUB 2C2OB 1R7IA 3C6UB 2BYCA 3AHPA 2CJKA 3M2RA 1QE1A 3QMQA 3PW4A 2ROGA 1JIHA 2RILA 1YI2S 2YQ1A 5I3UA 1EQMA 5GVQA 2BOAA 2ZWOA 1N32F 4M5MA 2IFXA 3QGGA 1HQEA 1YDLA 2G4BA 1AFJA 3M2UA 4DL5A 1OWXA 3R5BA 3HDSA 3GG0A 2FYXA 2YWGA 4DSIA 5LT5A 1H72C 4XDCA 1JLAB 1XN9A 2OPPB 2GIFA 3KJFB 1SBRA 1VIXA 2CJYB 1HMVB 4P10A 3BQ2A 4JI3J 4DG1A 2HK2A 4Q0BA 4OX8A 4KGVB 3M9NB 2BANB 3B8HA 2IDLA 4ECQA 2MSTA 4K2XA 4XDDA 4P74A 4JV0A 1EAYC 3EGVA 5CCLA 5ETOA 1VQKS 1FA0A 3MAAA 1TUGB 1AZSA 4H4MB 2CPDA 3WX8A 2UXDF 3OFGA 2W8LA 1CJVA 4QYZJ 2CPEA 2O66A 4BDPA 3GV5B 4YR2A 2WB4A 4RUCA 5KFHA 3QSYB 1LW2B 3JTOA 1HNIB 2VBYA 1D0EA 1Q8IA 1F1BB 2WSEC 2Q79A 2KFYA 2NR0A 3SDEA 4OZ3A 3S01A 4ZVFA 3WC0A 2R7XA 3BH6B 4U67Q 3G71S 1RYRA 4TKTA 1FE0A 1SH3A 2E5JA 5CD4A 3LP2B 5IM0B 2VA2A 4YY3J 4Y2MA 2EC0A 5A0YB 2ADCA 3CDUA 1F5CA 4YEAA 2G2OA 3DDIA 4FP9A 4CTAB 2VFVA 4HTIA 2MQQA 4KFBB 4KSEB 5JMNA 3A8EA 2KXNB 3FJ2A 3P45B 3QJLA 1QUVA 5DJBA 1X4BA 1UEVA 1ZA2B 5HMZA 4NCGA 1X0PA 2XO6A 5T14A 3DRPB 3QRRA 3CVKA 2B8PA 1Y3JA 2RF2B 2CJXB 3MR3A 1SJRA 4WFXA 5AE1A 1FHTA 2XYGB 3CIMA 3PX6A 3TR5A 1EETA 1NJXA 3AB4B 2IAJA 4DUZF 4F36A 3TZYA 3HVTA 1IJEB 4NYPA 5DDQC 1KLMA 2HQCA 2OD4A 4FPIA 2QA2A 3IGVA 5MLCV 1VC5A 5J1EB 4J7CA 4UUWA 3MI7X 2F65A 3OTOF 3EWGA 3JB9k 4J90A 2G0CA 1RTJA 3GR0A 2AKWB 2IYIA 2ACYA 1T03A 1IBKJ 4DF4A 3MMBB 5DETA 3BQ1A 1B7FA 2W1BA 1QSLA 4M5JA 1Q8BA 2RKIB 3RRGA 2XMJA 4NOHA 3D0IE 3BEGB 3KNGA 4YHHF 2PA8D 1WKKA 1FK9A 2LU1A 1ZBTA 2VQFJ 1FTCA 1Q5YA 2VBZA 1XQIA 1LXJA 1S9EB 2IA6A 3PCOB 4QCLA 1TP7A 3R3TA 1RCXB 2YQ3A 1RK8A 1L3KA 2CYYA 3G8TA 4FXDA 2UV8G 3SMZA 4JV1A 2CZVC 2V68A 1RE1B 4F2RA 5KFWA 1S6OA 2K8GA 3HT3A 4C0BA 4OZJA
chains in the Genus database with same CATH topology
5LXYA 3DRRA 2BXJA 5DO2A 1NK0A 2AX0A 2D7SA 3P5TL 1BC6A 4NLRA 1X9SA 2R2TA 2DGOA 3PR5B 4R0JA 5KFCA 3FSYA 4WKYA 1VFJA 4NLTA 3NNAA 4O44A 2FLLA 1Y5IB 3OJUA 4WXOA 5JVHQ 1NO8A 3ZZYA 4DL7A 1R8HA 1SJ1A 2J7KA 4CIOA 1TL3A 4WCEQ 1VRUA 2CIMA 2NREA 1IM4A 4DWIA 4IYQA 5E41A 3U02A 3CC4S 4KAIA 1ZAWA 3UNGC 5HLFA 4C8LA 3PM9A 4PKDB 5ADZA 3GR1A 3BSOA 4ED3A 1YQHA 2O3DA 1WHYA 2YX4A 1M90T 2XB2D 2HYIB 3FCHA 1H2VZ 2DB1A 3PACA 2KJVA 2LA4A 1S72S 1X9MA 1MMDA 2IC3A 2IM3A 2ZITA 2HVIA 2J9DE 1VS3A 2RUGA 5K8NA 5J2PA 3CB4A 3V6KA 1HI1A 2HMIB 1CPZA 1Y5LB 4F02A 4QW9A 3B78A 1JMTA 2IRUA 3WZ0A 4EYHB 1XNQF 4NLUA 1VGYA 4F3OA 2DNMA 2PSZA 3R5CA 5BJRA 2HWIA 1F5AA 2EG2A 1IKXA 2MDAA 5D4OA 2DTJA 4UQTA 4QOTA 3M9OB 4C3MA 2AX1A 5L1JA 4MK9A 4X64F 2EFOA 3GE9A 4MMOA 3S1TA 2UUBF 1FXLA 1NK7A 1U6BA 3NCQA 3N4WA 3TUIC 4DR6F 2OKQA 2HFZA 3SZ2A 1HNWF 2RH3A 3TX8A 1FRHA 2YKOA 4ED7A 2HQ3A 2HHPA 1PC4A 2CPHA 5KT7A 1FT8A 5C25A 1TV6B 5D77A 2KRRA 2OLWA 3CF5Q 2EPIA 3U1LA 2WSCC 4Z37A 5DRKA 3CJKA 3TW0A 1MSWD 3DRRB 5IQQA 3HHNB 3B4DA 3M9MB 4QIGA 2KT2A 2MQPA 2DR7A 5HP1A 2FVRA 4QIEA 4RNOA 4X4SA 1HYSA 2BM0A 2CQIA 1RDRA 5KFJA 4OL8A 2KTQA 2HNZB 4A8QA 2E5LF 4O44B 1R27B 4LSNA 3GYNA 1ZM2A 1GXLA 2VG5B 2FJAB 1FNMA 2CQGA 4F4YA 4PPZA 1U4BA 3N0VA 3M8QA 3GB0A 1VC0A 5HLFB 3QO9A 2PE8A 3IC1A 4YUDA 3W2VB 4H4OA 4DR4F 2E7WA 2MHNA 1KS2A 1WELA 2C3YA 2NSBA 5HN0A 2V4RA 2DGTA 1K9MT 3RB0A 2MPUA 4MFBA 2GIRA 4QYRA 2XWYA 4A8FA 2E9TA 1HPZA 3CDAA 1ULRA 3LANA 2DGWA 2XMUA 3LO3A 3IS9A 2IC3B 4FXWA 1GT8A 4UW2A 4IRKA 3PKMA 3KMSA 5J2PB 1SH0A 4FVCA 4OIXA 5C24A 2E1MC 1YG0A 2ERRA 1IKWA 1RT1B 2IRXA 1D8ZA 2YNIA 1YJRA 2WB1D 2APOA 4USJC 4AE5A 5J1NA 2RD5C 4XAKA 2K1RA 2IBKA 3M32B 3GSDA 4O3NA 1IKXB 1JLFA 3BSNA 2ASDA 3HKZD 3MFIA 3LQVA 3HFKA 2XGPA 2A1BA 2PIIA 3VAKA 1N0VC 2MKKA 2E5HA 4ZPBA 5KT2A 4J5OA 3FEYB 1VLYA 2GHVC 4N76A 3O3LA 4CT8A 4DV5F 3GIMA 3HHLC 3UR0A 1FD2A 1V3RA 3LF0A 1QY7A 4GKJF 1SI9A 4MYUA 3ISZA 5EX3A 2HHWA 3CD7A 3CJKB 2R7WA 2GMJA 3KFWX 3O2IA 2MHEA 5HP1B 3MEEB 2KG1A 3C3LA 1HYSB 3E8OA 3OFEA 2C3MA 2OFHX 3I5BA 3ZC4A 3ETOA 4ES1A 1Q4RA 4WKRA 1KTVA 2ZJQQ 5KFSA 3VAIA 3ZZOA 4X4TA 2FD2A 3DGPA 4PWUA 4Y34A 2M0GB 2VASA 2M3DA 3QO9B 2YNGA 3SFGA 4CQ1A 5B08A 1JXLA 3EXYA 5CZVA 4H4OB 4M8LA 4J9MA 1Q1KA 3JAMY 5H1SV 2RU3A 3TQ1A 1NH7A 1FEHA 4MFBB 2XULA 2WBMA 1NHVA 1HPZB 2E44A 2N7YA 4DHVA 3IS9B 2HVZA 4CO1A 3MM5A 1X4EA 5B0EA 5GAEU 1S9FA 4NWBA 1FVQA 1RP5A 1UWBA 3MCSA 3TNVA 5C24B 1FEEA 3WX4A 4ZKAA 1UAWA 1IKWB 3T9ZA 1GX6A 2B4PA 4CCHA 1ZM4A 2UUTA 2AD9A 3T3FA 2SXLA 4E0DA 2KT3A 4CO0A 3RBEA 4Q8EA 2K1RB 2BANA 2FGCA 3NAIA 2EVZA 2JH3A 1JLFB 1YRXA 3DMJA 3OSNA 1D1UA 2HRYA 4URSA 1HI0P 1ZZFA 2XSJB 3HI9A 1S0OA 1RISA 2IM1A 3QWPA 4C8KA 1T95A 1DJ0A 1N54B 2FUG9 2MZRA 2ZH2A 3Q0AA 2YH1A 4KHPF 2KZZA 4W90B 1RT7A 4ILLA 3MF5A 4F4KA 1ZM3A 3HMJG 4CO3A 4AL5A 3PZPA 1RWUA 3OR2A 2LCWA 1R89A 3H40A 3AAWB 1FJ7A 5I3QA 2CJ9A 3MR6A 1TUVA 3PJWA 5KG3A 2AYEA 4G1IA 2DRAA 2QMWA 3M6WA 2DJWA 2W9CA 3FRYA 4FZVA 1L3VA 1S9GB 5SZTA 1VQ9S 2OJ3A 1SL2A 2J9CA 4BWMA 1IQZA 3VF0B 2Y1IA 5H9FJ 2HZCA 5K9FA 1IKVA 1S6PA 4OI4A 4I6YA 1U1KA 5B0BA 3K5OA 2V9WA 4DQRA 4ATNA 4EBDA 1N34F 2LQJA 3G6VA 2YNGB 4RUAA 3OVBA 5B7WA 2V94A 3Q8RB 4RUHA 1C2PA 1YBAA 2B5JA 3AB2B 2VFTA 2RS8A 4ED6A 3IBWA 3BN7A 1KQKA 5KFUA 1SIWB 4PUOA 2D1CA 3DOMA 2XS2A 5FJ4A 4R0EA 3MEDA 1YIJS 2JEGA 2JEJA 2JWNA 1NAQA 5FD1A 2F8MA 4O4GA 2MB0B 4IUFA 1U1QA 2FHJD 3TUJC 1UWBB 3JYTA 1Q82T 5FIIA 5HMXA 4ILMA 5KFBA 4X2BA 3D54A 4WK3A 4JYAF 3VWSA 2ZH7A 3I55S 3V6DA 5F9LA 4FNIA 3PFEA 1QM9A 4J9KA 4AQYF 3IRXA 1X4AA 3DMJB 4UY8T 4ZK7M 3RBDA 2HPUA 1HI8A 4NA2A 3IGNA 1W25A 1BLUA 2DCLA 1A9NB 5KG1A 1OO0B 2XC9A 1N5QA 4TYAA 1UVJA 4AL7A 1JB0C 4M95A 1FRKA 1I1GA 1DFDA 4YB7A 1NHUA 4P7VA 2J6UA 2AJQA 1T94A 2HS4A 4YB5A 5A0YA 1YRTA 3OR2B 4F2SA 2HHHF 3FMWA 4C4WA 1F5BA 5J2MA 1X7VA 3L7PA 1DLOB 3PEJA 3SCJE 3QIPA 4DSFA 4K4YA 2V9KA 3DHXA 3G86A 2UUAF 3EPGA 3PR4A 1GH8A 5I3PA 2W9CB 5KTQA 1ZETA 3OR1A 1DTQB 1T05B 3MAQA 3JSMA 5GAGU 4EGLA 3GIIA 1REVA 5GAHI 4I2PA 3O6QA 2VBXA 2BM1A 5EX0A 5HL7Q 3EX7B 5LMNF 1NJIT 1HFEL 1IKVB 1S6PB 1IUJA 4RKUC 3SQGA 3JSYA 3SSQA 4AXIA 2KN4A 2VBWA 1UP1A 3FQKA 4ETXA 4IFVA 1K1SA 1U09A 3KG1A 3SXLA 4NLXA 4DFPA 3E01A 2VKRA 3DRSA 3TO8A 3G4SS 4X66F 4Y65A 4OJ1A 3US5A 2Q66A 2B5JB 1GXTA 2DK2A 1R31A 4B9UA 2KVIA 4B9SA 1Y00A 2FLNA 2ZOMA 1L5UA 4B3SF 1U48A 3I87A 1H7XA 4IR1A 4K4TA 4EBCA 4IKAA 1RI7A 1C0TA 4RU2A 2W25A 3MEDB 2NPIA 2YVSA 1VQ4S 3HK2A 4O4GB 4C2MA 3DLHA 4YP3A 3HM9A 4NLPA 4IR9A 2B7CB 1VQ5S 1FNXH 1JNRB 3CIZA 2W24A 4HYKA 3VAFA 4PCQA 1U1PA 1P27B 2J0XA 2J0QD 3IRXB 4U7UK 5L1KA 2WK4A 3MM6A 3OL7A 4NCAA 3AH6A 3H20A 1WI6A 3PY8A 4Y00A 4CH0S 4DV3F 3N6NA 5EHHA 1U49A 3B4MA 2XI2A 1TQLA 1CEZA 3H5YA 2K2PA 1ZM9A 3DRXA 2N7CA 3K59A 3P49B 3GV7B 2QFJA 2J0WA 4LF9F 2JFDA 3FSXA 4ZLPA 3OV7A 3UCZP 1N0UA 3UWTA 2UUWA 5J2MB 3QIPB 1QJHA 3TVKA 2FHKA 1R3NA 1S10A 1M1KT 5U47A 3H5XA 1J5EF 1HBMA 2DH7A 3CCUS 4A8WA 1G1XA 4F4XA 3NP5A 3OR1B 2KM8B 4MH8A 4ECVA 3O8WA 3JSMB 1DRZA 3QAUA 1U8SA 4B08A 2NSCA 4I2PB 1WTFA 1S4FA 2R8HA 2DRBA 4M1KA 4FNHA 5J2NB 3IWNC 1OQ3A 3FQLA 4NZ0A 2A2CA 4IFVB 3I96A 5HMYA 4KGKA 1WHXA 4PXCA 3DRSB 4OHZA 1NK8A 5LSLA 5F8JA 4QWBA 3ENVA 1KSPA 4JI2F 4MIWA 4LVNP 3EYZA 2HQIA 3FFIB 2AW0A 2WSFC 3KLGA 2DNGA 5EWGA 2VC1A 2RRBA 4HHJA 4ZS6A 1Q53A 5KFOA 4B9NA 1A7GE 2JLEA 1C0TB 3H2LA 1RAJA 3HVRA 2R7OA 3EPIA 2N3OA 4H54A 5DS7A 3LH2S 7FD1A 3L95X 4G1PA 5KFIA 1HWJA 2KU7A 4H4KC 2LXUA 2JC1A 2JC0A 3ENWA 1WHWA 4MIAA 3CXCR 1S1WA 1FDAA 4DMZA 1Q78A 3MMBA 3ZZRA 3NKYA 3MM6B 3MECA 1R43A 3BZQA 4ECSA 2CDQA 2ZDPA 1XERA 3J7YI 3HX9A 3C66A 1FKPA 2YKPA 2L9DA 3OLBA 4Q45A 2JFKA 2Z2MA 1YVFA 3OQ2A 4X4RA 3MM8A 1D9AA 2XLIA 1TFYA 4Y3CA 4ZPVR 5H9EJ 1HA1A 2MY7A 2R9LA 3H25A 1QAIA 1W2IA 3MGJA 3KHLA 1WNEA 2QMXA 1N8RT 2DHXA 2DNZA 2EFVA 4FS1A 2DH8A 2YKMA 3H2UB 1HBMB 3OXFA 3KK1B 5CYQB 2YKNA 3Q23A 2E9ZA 2NYIA 3TA2A 3UD3P 2GV1A 4DV0F 2IYGA 2KDOA 5F0UA 4FF4A 2YNHB 1S76D 4DPOA 3DYAB 5C5JA 3OUYA 3UI3A 3D1HA 5DQIA 1RYSA 4DFJA 3BM7A 2V5HG 1LFPA 2L48A 4Y6IA 2XMWA 1CQMA 2ZH3A 1OPZA 3UDLA 2O67A 3RB6A 5K14A 2LDIA 3R27A 2YKQA 2D74B 3QZ8A 4RNFA 3IAM9 3U7JA 1S9EA 4RLEA 2WCXA 2E9RX 3FSIA 1QAJA 1Y9OA 2JVOA 2M2BA 3V6HA 2EFGA 2B4OA 1FRMA 2U1AA 4F3QA 2OPRA 2QLXA 2ASLA 1JLGA 2YKAA 2YX1A 5FDLB 1VQLS 2QYCA 1HBNB 3HLUA 3BO2A 2LEBA 3KLGB 2DITA 4KV8B 2X51A 3TOQA 4ZPAA 3BF4A 4MK8A 4GO7X 4DV4F 4M94A 4PQUA 2M52A 3CEDA 2R8KA 4DDFA 2YY3A 3G8QA 1GTHA 1T7PA 4DQQA 5F8HA 4NXMF 4IOBA 2CPXA 1S1WB 1FRXA 2RE1A 6FDRA 4URGA 3KKFA 2HNYB 2L41A 3VALA 2Y0SD 1SC6A 1KFDA 1S6QA 2CZ4A 2FIUA 3MECB 3LAKA 4OX9F 3RR8A 1FF2A 3W2WA 2KH9A 2M8DB 4N56A 3M2VA 3DI6B 4DQPA 1BQMA 1FKPB 2XCAA 1H6KX 1VMBA 4TY9A 2Z4PA 4IQMA 3MM8B 4ZA1A 4HI1A 4PWDA 3MD3A 1WWHA 3TP2A 4YB1P 2ZKUA 4K4UA 3NMRA 4HDGA 3SCLE 4UQGA 3LPYA 3UW1A 4TXSA 1QSYA 1QSSA 2DIUA 4Q44A 4LT6A 2YKMB 2MKIA 3I4HX 1FRIA 1C4CA 2YKNB 4NLQA 4N8OA 5THWA 5DM7Q 3N79A 1O0PA 1QVFR 1UFLA 2HHQA 4HI2A 4ID5B 1KR4A 5K8OA 1JJHA 4WFBQ 3OUYB 2ZC3A 1IJFB 4UOCA 3GFHA 1IBLF 2PEHA 5HQ8A 3I5AA 4YOEA 5F8NA 5K14B 5IXUA 4DBQA 1SJQA 2LVWA 4OI0A 3FEXB 1PSDA 2KFNA 3CULA 3X1LB 2AV5A 4B3TF 1NRKA 3PW7A 3I32A 3OTBA 2KYXA 1KQFB 3G6ES 1OQ6A 3CCES 5GADI 3Q8SB 2OPRB 4OHXA 3H4DA 4ALZA 1BGXT 1JLGB 5CHCB 1UL3A 2EG1A 4RBUA 3VCDA 2LQBA 5LJ3Y 3CMAS 1J5OB 1RTDA 2V4JA 2WW8A 2FVCA 1QUPA 4I6AA 3W7BA 1FJCA 2JRSA 1X0FA 4PQUB 4X4VA 5F0WA 3THVA 1TKDA 4U6PA 5CYMA 2ZHOA 4ED0A 2GO9A 1H0HB 1LQ9A 4JI8F 4C0OC 4CO5A 4E98A 5D6GA 1GX5A 4A8MP 4ZPCA 4J9NA 3EGZA 1FDDA 3FGVA 2MKHA 2ALZA 4B3MF 5HMWA 2X1AA 4ES2A 1BQXA 2D9OA 4DSLA 2CRLA 3HHEA 2NXUA 2MQMA 2YWFA 4BBYA 1S6QB 4JI4F 1VQNS 2DHGA 1VOMA 4RBTA 3NGDA 1SXLA 3W2WB 4YR3A 2JDJA 4URQU 1N52B 4A4JA 1S1VA 2A3JA 2E66A 3EGNA 3GFZA 1JLCA 4PG5A 4QIVA 3GV8B 2J8AA 3K0JA 1IXKA 2RIJA 2RVJA 2ZVSA 1JWWA 2XMVA 1U26A 4PWDB 2HHUA 2BRKA 1N4LA 5KG6A 1S97A 3ZFVA 3OSPA 3L09A 5A2QY 4XK8C 5E3RA 5BYRA 2DR9A 1E6YA 4GC7A 2NLWA 1AXQA 4OMFG 2HNZA 4ILRA 1XEZA 2Y1JA 5D4LA 1ZAVA 1TKTB 3CDWA 5GAHU 2W4CA 1NH8A 2DBBA 2VG5A 3MMJA 4DS5A 3THPA 5KG4A 2MKSA 1KVIA 2MKCA 3D1OA 3Q2TC 2HLTA 4LQ9A 4RW4A 4PG7A 3R1HA 3W2VA 3QWUA 4DSJA 3CSKA 1K0VA 5AXLA 2DD8S 4P6QA 1ZAXA 2DO4A 3H98A 2CQ4A 3M6XA 1Q81T 1HR0F 5F41A 4DX8H 5EDWA 4NYZA 1URRA