2I9SA

The solution structure of the core of mesoderm development (mesd).
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
b'GPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mesoderm development candidate 2
publication title The solution structure of the core of mesoderm development (MESD), a chaperone for members of the LDLR-family
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i9sA00
4NMLA 4IO1A 2JOQA 3DHXA 1YGYA 3CEDA 2J0XA 4GO7X 1LK5A 2RQMA 3LUYA 3HHEA 2J0WA 1UJ6A 3O1LA 5T41A 2MDAA 3UW1A 3IBWA 3L7OA 2LVWA 3W7BA 2LQJA 5JJBA 1KS2A 1UJ5A 2P9EA 5IT0A 3ENVA 3OFGA 5FIIA 3N0VA 1LK7A 3OFFA 2F8MA 3AB4B 3AAWB 3OFHA 3DDNA 3NRBA 2KO1A 3S1TA 2I9SA 1RWUA 3MTJA 3TUIC 2H9ZA 2DT9A 4GMKA 1XTZA 2F1FA 1UJ4A 3KWMA 2FGCA 3P96A 4PWUA 2CDQA 1ZPVA 4X84A 5IS2A 2QSWA 3AB2B 3TUJC 2PA3A 4LUBA 2RE1A 3OBIA 2QRRA 2PC6A 2DTJA 3U7JA 3MAHA 3OFEA 3ENWA 1YBAA 3DC2A 3MWBA 1SC6A 1Y7PA 1M0SA 2QMWA 2P9CA 2ZHOA 3ENQA 1PSDA 4M8LA 2NYIA 1LKZA 1U8SA 4GO5X 5IT4A 2QMXA 3K5PA 2P9GA 1O8BA 3IXQA 3TUZC 2JHEA 3DHWC 2RQKA 3LOUA
chains in the Genus database with same CATH superfamily
2OJ3A 3F56A 4OX7A 2KG1A 3M6UA 2XYHB 2H1YA 2MQQA 3W2VB 3W2VA 2G0IA 1J5OB 3LGHA 1J5OA 2HRYA 2IM2A 5JJBA 3GG1A 2QT7A 2DJWA 1N34F 1FKOB 1FKOA 1Z4UA 2WVDA 3N0VA 2WONB 2WONA 4Q5VA 2CJXB 2HLUA 4Q2MA 4PWDB 1WUUA 3UN2A 4OYMA 1S10A 4QYRA 4DPXA 1WKLA 1DTQA 1RADB 3CVKA 1FD8A 3F0NA 3M8ZA 4J7CA 3LAKA 3CCMS 1FE4A 2KZMA 4FKXA 2DYAA 2CRLA 1MWQA 4MIWA 3B8HA 1ULRA 2LXFA 3TZYA 1S1TB 1S1TA 1U8WA 3OBIA 3GFHA 4L6V3 5CYQB 3UDVA 4G3IA 4MAKA 1CC8A 4OZ3A 3OQ2A 5HQ8A 2XSJB 2XSJA 5A8WB 5A8WA 1TL4A 3IGVA 3CDUA 2ZH1A 2ZBCA 1G3OA 1U4BA 1U09A 1W25A 3ZZOA 2N82B 2HBRB 1WHWA 3S01A 4DR5F 2VODA 1D09B 1MSWD 5DM6Q 2QJ3A 3BYRA 3TEHB 3TR5A 1V6HA 4ED0A 5K9FA 4DV1F 2WTFA 4QYZJ 2OFHX 3VGUA 1OSDA 4JI3J 2KRRA 4BLGA 4DV7J 1VC6A 5A2QU 4NEZA 1HNZJ 1HBMB 2NXCA 3KWMA 4GC7A 4UY8T 1FESA 5D0HA 4TU7A 3D54A 1JKHB 1JKHA 4EO6A 4WZQA 2RVJA 3HD2A 1BY9A 3J7ZT 4Y2MA 5A2QY 4ECZA 3T1HF 1EP4B 1EP4A 4A8FA 1DLOB 3OFEA 1HFEL 3CCRS 5CZVA 5HAOA 4Z2XA 1WOSA 4KPCA 2ZNZA 1C4AA 1S7IA 4ED2A 2NUUG 4B3MJ 4F67A 3T9NA 2DHHA 2RU9A 1VRQC 5IM0B 2ZWPA 1FKPB 1FKPA 5IM0A 5EDWA 1XMQJ 2JOQA 5ETSA 2IBKA 4ATNA 2I2YA 2IA0A 2ZH5A 4WK3A 4U7UK 3IN5A 2ZJPQ 4P72A 1TQLA 1RBOB 3GJSB 2QLFB 3PM9A 2ZM6F 2KN4A 2F8MA 3NNCA 5HL7Q 2DHXA 1V3ZA 1LNQA 5HROA 2O66A 1GMWD 2IAJB 2IAJA 1Y10A 3H4BA 4J9KA 5H1SV 1U48A 1WF2A 1EKRA 3H40A 3DI6B 3C16B 3C16A 5KFLA 1WDTA 1C0UB 1C0UA 3Q23A 4LUBA 1U1PA 2JEGA 1YKWA 4HHHA 2GQ2A 3PHEA 2W8LA 2ZJRQ 5HVHA 2ZD1B 4M94A 3IAS9 2HHVA 1FVSA 5KOWA 5ETPA 1NUEA 5KAKA 4B02A 3F41A 2UV8G 2W2NP 2C3PA 1NZ8A 5F0WA 1TUGB 3W62A 3CUNA 2AJ1A 1KQKA 2M4MA 1T94A 2MKYA 2B8QA 2Z8QA 3THVA 2HBYB 1IM6A 3BKFA 4HACB 4HACA 2ZOGA 2ALYB 2AJQA 4ER8A 2AYMA 3NRBA 2VA3A 4ZN3A 3OTOJ 4FN5A 5B0DA 2K7JA 4G1QB 4G1QA 3VZHA 2EG2A 3V4MA 3D1OA 3SIPB 4OZ2A 1Q8KA 3TAQA 5GAHI 1WDDA 3OVBA 2XCPA 2HRTA 4CLPA 1U2CA 2EC0A 2CQPA 1RAEB 2GJIA 3UO0A 1FERA 3NY0A 2WZ1A 4HH1A 2LFVA 1OYEA 1JXEA 3NAHA 2JSXA 4GO5X 4AQYJ 1FEHA 2DHAA 2CZVC 1JLCB 2X7IA 1KQFB 1CG2A 3DHXA 3BB5A 3W66A 1FNOA 4WP9A 2F4VJ 3CCWA 4F3OA 2H54B 2E1CA 1S0MA 2MQNA 4OMFG 2XMUA 2PDAA 1MMLA 5KFWA 3KLHA 1RAAB 2AGPA 1HNWJ 4DJBA 5I3UB 5I3UA 5DQHA 3S8SA 3NP5A 5KFVA 2HIQA 3IRXB 3IRXA 4WE1B 4WE1A 1DJ0A 3BV8A 2ILYA 1J5EJ 3NNHA 2WBMA 3MGJA 1RHKB 4DV2F 4I6YA 5D77A 2NS1B 2ASJA 2RDJA 2MLZA 1NRKA 2MY8A 1YJRA 1ZM9A 1NK0A 2Y3YA 1Y3JA 8ATCB 2N4CA 4NL5A 4ZVOB 2KJVA 3PX4A 1VFJA 4WFZA 2H5JB 3AJDA 4KFBB 4KFBA 5D4OA 4X66F 3NBPB 4LF8F 3MFHA 3IBFB 3UE2A 4K50A 1JLAB 1JLAA 2ZVIA 3MM9B 3MM9A 3HO1A 3HHLC 3H59A 3QRRA 1NZAA 3DYAB 3DYAA 3KJVB 3KJVA 1U26A 4KQZA 5A8KB 4N41A 2BOPA 4J9NA 1VQ4S 4QW9A 3MCNA 4RBUA 1VC5A 4DN0A 4ILLA 1UETA 3C19A 1KR4A 5HMWA 3OHBA 5C24B 1BQXA 5C24A 1CULB 1CULA 3GR1A 3I4PA 4KGVB 4C2MA 4QW8A 3F44A 2J76E 1Y00A 4QBUA 4P10A 2XGPA 2J0QD 4DUTA 4FNIA 1I94F 2XMVA 4IFVA 4X84A 4OFZA 3CD6S 1PYOB 4LF6J 1S97A 3BBCA 4IH7A 1DRZA 2XYGB 2PA3A 1OY9A 2AMCB 3HHNB 2YKQA 4IO9Q 2VL1A 2MXYA 2NR0A 3CJ3A 4M95A 1FJEB 2HGNA 1O51A 5DQGA 3DRPA 4JI5J 4J5OA 3UI3A 2ASDA 3IXQA 4YDXA 4C8OA 1CJUB 1F2GA 3FZBA 3D0GE 2XHCA 4WKYA 1FX4A 2J0WA 4CZCA 2E29A 2FYXA 4OI6A 1P8GA 3M05A 5C25A 5C25B 3I9ZA 4PRFA 2CQ0A 1FRIA 2CAJA 3DLJA 3TA0A 4JBCA 1P9QC 3GCWP 5KFFA 4CO2A 4FDFA 1YG0A 3DLKB 3DLKA 1H38A 1UEUA 1RHRB 3FQKA 3I4HX 3ZNJ1 3OTEA 2W7OA 1HYSB 1HYSA 3CJKA 3RBEA 3JS9A 1S99A 4JI8F 1KVIA 1RU2A 2ZJQQ 1MWZA 4RW8B 1TTHB 4RW8A 5I42A 4TY9A 5I42B 2FPHX 1HNIB 1CQNA 1HNIA 4R5PB 4R5PA 2C2DA 2CJ9A 4P71A 3ZZRA 4HT7A 2OEKA 3R5AA 3M2UB 3M2UA 3O1LA 2WCXA 4WPAA 3VAIA 1L3UA 3SSSA 2FLOA 2O1PA 1MMNA 3CXCR 4DR2J 1NSPA 4J9RA 2H5IB 4ZVHA 2AEFA 1LFPA 2LQ8A 3UNYA 1RT4B 1RT4A 2R2RA 1ZZFA 1S48A 4PG5A 2LP4A 3FCHA 1HHTP 3A8JA 4NMXA 5ETKA 1FI4A 5HVGA 3M8YA 2YKNA 5KT4A 5C7PA 1S1WB 5CD4A 3EE3A 2G0JA 3V6JA 1YBAA 4USKA 4O0NA 3EJMA 1LEOA 4RO0A 4B9VA 3KTQA 3FC9A 3K2YA 4EO8A 5KFPA 1N33F 5DG7A 2VA2A 1OPIA 3VAFA 1FD2A 2G4BA 1S1XB 1RE1B 1S1XA 1Q95G 1NK7A 1N32F 1R7IA 1K1SA 2RQMA 2VONA 4YQWA 2LA4A 4WP3A 1TKXB 1TKXA 3DM2B 3DM2A 4I2QA 3GIIA 2OLWA 3G8TA 3C3LA 2PIIA 3D6FB 3VGVA 1JLQB 1JLQA 1K47A 5CZXA 1YRXA 5ETTA 1ZTTA 2VASA 4OJ3A 1N36J 2R8GA 2W2OP 2BKOA 4OI1A 3K5NA 1RTJB 1RTJA 2DY9A 2LEBA 3FRYA 3QWPA 2JJ4D 4DOZA 3KHHA 2B6AB 3K89A 3N6LA 3QGIA 1RHUB 1F3VA 5L39A 4K4TA 1IJFB 2KFYA 1BMQB 4NI2B 1ACMB 4HLBA 3ISNC 4CYUB 4CYUA 3ETMA 1DTTB 1DTTA 2YVSA 4OI3A 1U0HB 1U0HA 3MURP 3IS9B 3IS9A 1R31A 1I6JA 2HBQB 3K7RA 3BF4A 1YI2S 1B64A 1WORA 2B7CB 3A8EA 5F8JA 4PYAA 3TUZC 4QQBA 1N0VC 2FC8A 3JSMB 3BO2A 3CMQA 1UVLA 2J0XA 4WKRA 2E1MC 4IH5A 4NWBA 2DHGA 4A8QA 3ILJA 3NOGA 2L9NA 2CQ2A 2M9KA 2FJWA 1AXQA 2VQEF 3Q24A 4LQ9A 1SQGA 4UW2A 2EFPA 5KFZA 2HS0A 1F0XA 4DG1A 5H9FJ 4CIOA 3HLUA 3UNGC 5K20B 3GYNA 4NXNJ 5C42A 4CP5A 4F4WA 1Q79A 4IRCA 2IBOA 2YX4A 4RNFA 1D9AA 3EICA 1S6OA 4U96A 1RCXB 3A13A 3PRDA 1KQSR 2R4FA 1BUXA 2ROPA 3R5DA 3FBFA 1IR2A 3I5CA 3TO8A 4LRDA 2XY7A 4WFNQ 2RH3A 3M6VA 3N28A 1VQMS 3H8YA 3RRGA 4NZ0A 2PN6A 3CMAS 3BO4A 4L73A 2KH9A 2DR6A 4Y65A 1SUQB 1SUQA 1S6QB 1LXNA 1D8ZA 1CJTB 1CJTA 4XTTA 3LGNA 1E6VB 1E6VA 3OUYB 3OUYA 2F63A 1RZMA 2A10A 2VPWB 4B9UA 1JXVA 3T5LA 4B9TA 2P2CB 3AQOA 1UJ5A 3ZZ0A 1D3WA 2A6MA 4I64A 4JB8B 3EXCX 2I8EA 2A1BA 4DX7A 3NG8A 1EQ0A 1VCTA 3BGLA 2DGUA 4BS2A 3RBDA 1NNDA 2OKQA 3MR2A 1YJWS 5E3AA 2WVCA 1KSPA 2XQCA 3KHRA 5HK4A 2V2KA 4OLOA 4ECRA 4IR1A 1YK9A 1X8DA 4F4YA 3I6PA 4B9LA 1VDHA 3FZ2A 3MPVA 5F8LA 2OH2A 1XQIA 4NZ6A 1NDLA 4ZHRB 4ZHRA 5HMZA 4XPEA 2VQFJ 3WIUA 4DSJA 3NOCA 2WVBA 2B5JA 2W2MP 5E2QA 4DUYF 1WC1A 2LEPA 1RT3B 4KO0B 2AEMA 5H9EK 3QATA 1WEXA 3CCLS 2HWTA 4ENOA 1DURA 4C4WA 1OS5A 4N7TA 2RF2B 2RF2A 2F65A 2MDAA 3GJQB 4YUDA 3TZZA 4DR7J 3OJUA 3BPDA 2OELA 3IA0A 4OQJA 1YHQS 4KE5A 5CH7B 4DZDA 3OFHA 4J9OA 3CIMA 3ONQA 2DK2A 1Y5NB 2YKOA 2D69A 3G8QA 5IWAF 4QR2A 2CA9A 4C97A 2PMHA 3PJXA 1SB6A 1JLEA 2ASYA 2CKWA 2CJQA 4RUHA 3M9MB 5AXKA 2M8DB 1N5TA 4X65J 2R2UA 2GJFA 3S6EA 1HWKA 1HI0P 4P2FA 2OSQA 3GIKA 2X1GA 2MJNA 5KFRA 1YBUA 3DLHA 2RMLA 1ZPWX 4N56A 2IYGA 3GG0A 4DV5J 3QNWB 2VIHA 4DUZF 5L9XA 2ZKTA 3BJYA 1RT2A 1R6VA 2V6AA 2BR0A 4YB1P 2NXUA 3BSCA 2UP1A 2DPJA 3W7BA 1QTNB 1LW0B 1LW0A 2DH9A 4ANCA 1R6YA 2CPJA 2XI3A 4XDDA 4CNYA 3KK2B 3RGIA 4EBCA 3DDNA 3RU0A 4PKDB 1RT5B 1RT5A 2BQRA 4LFBF 1WWHA 1KTVA 2R8JA 2DT9A 1IBLJ 4GMKA 4LF4J 2RJZA 4NX9A 1TL1A 4FS1A 4DPTA 3OL6A 3D9BA 4OYZA 4XDCA 3MMBA 5AE1A 4N77A 1DFDA 3D66A 4Q8FA 4KB7A 4OZ5A 7FDRA 3C46A 4FYXB 2GX8A 1V3RA 2C3UA 3CIZA 1RAJA 4GVBB 4RZRA 5KFQA 5IT4A 3H20A 4OYAA 1GH8A 5F8GA 2CQ1A 5B0FA 4XIUA 4B9SA 4DCOB 3W5ZA 2IM3A 2HLTA 3HCXA 1RWMB 1B99A 2HK3A 4MKBA 1N34J 1KN6A 5CAAA 3WQPA 3MTKA 5DRKA 3MMAB 3MMAA 2KVIA 4DQIA 4AL5A 4CT8A 4F36A 3DMJA 3NWGA 2QA4S 4WK1A 4JI0F 1HNVB 1YZ7A 2IVFB 2D3UA 2HS4A 1T3OA 3MTJA 1KRPA 3A4TA 3TWZA 4RW4B 4RW4A 2HZVA 3EX7B 2U2FA 5DLGA 3UR0A 1EZZB 5DDRC 2CJAA 2JEJA 3FJ2A 3CDEA 4DDFA 2B4PA 4O3NA 2HW3A 3MCOA 2CPFA 3DN9A 2G2YA 1NPKA 4IR9A 1SC3B 4IOBA 1V9OA 4OYOA 2GAHC 5C2GA 2FJBB 2WK4A 1JXLA 4NLDA 1S9GA 4DSFA 1FTRA 2FHKA 4CO1A 3CMES 1WSRA 2W9CA 3UFCX 3OVAA 4DR5J 4MIBA 4ZVPB 4KRWA 4K4YA 4EI2A 3HSJA 1M5SA 2GVZB 3CULA 1N5QA 3W5XA 3I82A 2MKIA 2V2VA 4IG3B 4IG3A 1S5ZA 2M0GB 4DV1J 2QV6A 3HK2A 3R7SB 2PO4A 5E7OB 1JJ2R 1SJ3P 5HMXA 4CDIA 3HKZD 1KONA 2XS7A 5KFSA 2LU1A 4UUWA 3BN7A 3UDLA 4I0WA 2KM8B 3IFEA 4KV8B 4KV8A 5KG1A 3T1HJ 1UVMA 1GX6A 4IG0B 4IG0A 2FLLA 4WFXA 1IKWB 1IKWA 3W65A 1VJQA 4ALZA 1NDCA 4FF2A 2DTJA 2V4QA 1QUVA 1RSCA 1ZM3A 4ZPBA 1T11A 2V34A 3LF0A 4V1Ak 3D3CJ 5DJBA 3CJSA 5CABA 2QYCA 2OPQA 4DF8A 5KFNA 2FHMA 1Q8LA 2ZBIA 4F4XA 5JUMA 5A6WA 3B82A 4DL0C 4P52A 2ZM6J 1FJGF 3QBCA 4M1KA 3OV7A 2OIHA 4OYBA 3G6ES 3G6VA 5KTQA 3VWSA 1U02A 4MKYA 4OYPA 5AE2A 1NHVA 3ZTRA 4QOTA 2PFFB 2VBYA 2KKHA 4DWIA 3OLAA 8AT1B 2F1FA 4LBPA 1Y5IB 1Q0NA 5KG7A 4C0OC 3CJ5A 5L1LA 2R7OA 3M8QB 1MU2A 4RWXA 4Q2LA 3FSIA 4J9UE 2IDLA 4H54A 5DDPC 3TUJC 4C8LA 3JB9k 2UUTA 2IVYA 1IKXA 3AH6A 4CLKA 4HHUA 4USTA 5KT6A 2W9BA 4O3SA 3R8YA 3RG6A 1T95A 1B4SA 2XLKA 1BQNA 2WB4A 5KFAA 2XWYA 2DXFA 3I0SA 2VFSA 1UVKA 3H5UA 3RW6A 3DLLQ 4CO3A 5IOLA 2J7UA 3NNAA 2HIYA 3CCQS 2M70A 4U6PA 2MHEA 3S7RA 4MMOA 2VU5A 2HHPA 3OFFA 3BDEA 2BW2A 1CBKA 3JQKA 1FWPA 2NZ4A 1A7GE 3KLIB 3KLIA 1RWUA 2ZH9A 4Y3CA 4IFYB 7FD1A 2BE9B 2LA6A 1MWYA 4NLQA 3UD5A 2DRBA 1JLBB 1JLBA 1U47A 5D8HB 1SL0A 4ZVGA 2OFGX 2BJ3A 4PXDA 3SSRA 1VQLS 4F50A 2OMLA 1VR6A 1HD1A 3BBBA 3HFZB 3AOAA 2AZ1A 4NOHA 4DV6F 3C2PA 2OP5A 3QRQA 2OTJS 1S72S 3MUVP 4C8MA 2J5AA 5LMUF 5J1NA 1XNQF 4FNHA 1F9FA 3R27A 2DNOA 2VUGA 1X0PA 2ZZMA 2X1AA 1AROP 3W8GA 3T3FA 3NS6A 4O4GA 4O4GB 4B3TF 1C1BB 1C1BA 3IWLA 4RR5A 2RRBA 2Z58B 3B78A 1XERA 1N6QB 1N6QA 3M2VB 5EHHA 3DOKA 2BACA 4Y28C 3LUYA 1RWWB 2RIJA 4F0KA 5E33A 5E5NA 1VBZA 3EYZA 1R8BA 3ZZYA 3IM9A 1HARA 4UF4A 1VHFA 1NJWA 3PVXA 1VC0A 1UFWA 2VPZB 2UUCF 4JI7J 4DV2J 3PJ9A 1N48A 4QWBA 3D67A 3UCUP 3P96A 4LSLB 4LSLA 3A1YG 2V2QA 4KT0C 2J8AA 4C3KA 2AHOB 3X1LB 4X66J 3CCES 2UU9J 4LF8J 3LWMA 2BW7A 1TKTB 1TKTA 1XN9A 5T7LB 4H4MB 4H4MA 4USWA 2CQ4A 2QA2A 2VJVA 3VR1A 3DRSA 4LR9A 2AU0A 1T8EA 1NKCA 2J9EA 4M5IA 3B6BA 3L7PA 3NCPA 3FCVA 1HWLA 3TYTA 4YMEA 3CCJS 2G2ZA 3X3UA 5G0RB 5G0RA 3JQJA 4USHA 1Z1ZA 1RACB 2XHWA 1URRA 1GEHA 1VRTB 1VRTA 1O5JA 3EDQB 3UW1A 5LT5A 1O6XA 1VJWA 4CLSA 2HHHF 2RS2A 1BQMB 1BQMA 5KFDA 1GMVA 3FK4A 4LVOP 3IWNC 1RT7A 2WAQD 5IV3A 1Q7LB 3KMQA 2MKCA 1NSKL 4E98A 1I94J 1F2HA 4Z7CA 2WSFC 3QT8A 2BDPA 4OIXA 1B0VA 3KK1B 5BYSA 3O2IA 4ZP9A 1FK9B 1FK9A 3IWXA 5KFYA 4J9LA 4AD6A 5F0UA 3KXDA 4U8YA 3L3CA 4YP3A 3TAPA 2BMBA 5LSOA 3MHYA 3QT6A 4XPCA 5SZTA 1T0TV 4F8RA 2DNGA 5A76A 3THPA 2DIUA 3HF5A 1FXDA 3BQ0A 1UA0A 3ZZUA 5HJYA 3AFGA 2R7QA 1RT6A 1IM4A 4WFAQ 4U67Q 3Q8YA 4ED5A 3CEDA 4DX8H 3I87A 3AT1B 1IVZA 2J8SA 5L8RC 4LRAA 3FEZA 1RTIB 1UJ6A 3PRBA 4A8WA 3A3PB 3N9UC 3M2RB 2RILA 3M2RA 3TZWA 3PJWA 5AXNA 4X4OA 2R7WA 3O5TB 2M8HA 1JNZB 4ZJOA 3BS9A 4AYBD 1X5SA 3AB4B 2HFNA 2H5EA 1HPZB 1HPZA 3OHAA 3H2UB 2H9ZA 3BQ2A 2HZAA 4YR2A 3L9ZA 2B9XA 1FNXH 5AT1B 1FE0A 3GIMA 1IXKA 4E2FB 3FVYA 1YQHA 3MM7A 3MD3A 4DZ6A 4TQSA 3IR5B 2DXEA 4R0JA 4F3MA 4JI8J 1R8AA 2ZITA 2VFUA 3AY0A 2V94A 2FJVA 1CVJA 1NB7A 3HSDA 1SKSA 1S9EB 1S9EA 1NAQA 4FYVB 2VG6A 3EXYA 4Q0BB 4Q0BA 1RUSA 4RBVA 3GONA 4LRFA 1LWXA 5DG9A 4K5SA 3C66A 4DU8A 2UVUA 1X9MA 4O4RA 5T41A 1FT8A 4KC5A 3Q8RB 1VQNS 4UOHA 5IT0A 4ZPTR 3OR2B 3OR2A 2KXFA 4I69A 3I56S 5DS7A 1D8YA 2GAGC 4A8OA 4LRCA 3HULA 2I6WA 1JB0C 4OZ0A 2ZUAA 3GFYA 4PZVA 1WHVA 4KAIA 4X4VA 3UD3P 2DVIA 1NMEB 3GFZA 2XMWA 3M6WA 4Y2AA 4UQGA 1HMVB 1HMVA 3BGFA 2PC6A 5F8HA 2DH8A 1TAQA 5LSLA 4MYUA 1N33J 2FJXA 2DNQA 1WACA 3I9V9 2YNIB 2YNIA 3R6GB 4C11A 2IRXA 1RCOB 1S6PB 1S6PA 2MKKA 8RUCA 1N32J 4F4ZA 3BZQA 2JVRA 4JP8A 2GA7A 1M5VC 2XNRA 1DBDA 3MEDA 5KG0A 3DRYA 2M2BA 1FWKA 3J81Y 1YJ9S 2E1PA 4K4SA 2BJ7A 4FXVA 1S59A 2FY1A 5J2NB 5J2NA 3KOAA 4DFKA 2RRAA 4A47A 3OTCA 3MMCB 1AFIA 2EVZA 1XR5A 3CJ0A 1LQ9A 1FX2A 5DGBA 1RXOB 2R7RA 1YIJS 2AX0A 4PWUA 4NLPA 1C1CB 1C1CA 4LSNB 1KQGB 2C2RA 2DCUB 4F02A 2ABYA 4DEZA 4DCJB 5E3RA 4A8KA 4V19J 2OAUA 3KJQB 1JJCB 3OL7A 1NK5A 4QIFA 4NRUA 3CC4S 3PKYA 3P45B 2HG4A 4CH1A 4TNOA 2MKHA 4ZVEA 4PPDA 1X0FA 5GAHU 4MIAA 2W4CA 3TP2A 4RNMA 3SEOA 2GCFA 5HLFA 2AP6A 1YJVA 3TANA 4F4AA 3KUGA 3Q86A 2VQEJ 2GO9A 3Q0AA 2J9CA 1DQ8A 4UQTA 4FBUA 3G4SS 2YH0A 1TAUA 3W2WB 3HMJG 2NPIA 1VQYA 3DOMB 2XLIA 2YWEA 2FHOB 5DZ7A 5GVQA 1NDPA 3AJ1A 5D6GA 2ZH6A 3A3OB 4BWJA 4FVMA 3PX0A 2W25A 2XWXA 3ET6B 3ET6A 4DXLA 2H48B 2RT3A 1GXLA 1NH8A 2C22A 1KD1T 3D0HE 1HQUB 1HQUA 2A0FB 1S4FA 5D0EA 4A8SA 3HVWA 3HP6A 3D6MB 2RQ4A 3JSYA 4ECSA 1TMJA 2FHJA 2LMIA 3SFGA 4UT4A 3R2DJ 2YY3A 2DNNA 2CQCA 1AB8A 2EBGA 1NDKA 3M1VA 3O44A 2XMJA 2UUBF 3NKYA 1VQ5S 3ELHA 4RPFA 3W9HA 1P9YA 3KLFA 4ELUA 5LXYA 1Q8IA 2XMAA 3B4DA 3PYEA 5KT5A 5KFBA 3ITHB 3ITHA 1HR0F 1YDLA 3PG9A 3QJJA 3U1MA 3VGSA 1FFGB 4PR6A 4ZCLA 3LP2B 3LP2A 2FTRA 9RUBA 3V6KA 5HVFA 1LWEB 2NLWA 3UN5A 5IFMA 5D0RA 2FIUA 1LFWA 2AYBA 2Q3PA 2CWKA 1RAOA 1B70B 2VBWA 4CNZA 1W7WA 1FEEA 2DGSA 2NUHA 2HVEA 4OYXA 3AB2B 2BXJA 2QX0A 1MN7A 2FD2A 1CEZA 1N5YB 1N5YA 4DUYJ 1KLMA 1TUVA 2CYYA 4Q8EA 1N8RT 3MR3A 2J6SA 1XMOF 3RB4A 3ZO7A 1A6LA 4KGZB 2P9GA 4ZCMA 4JI4F 1CPZA 2V2ZA 4ECWA 1NEEA 4GVLA 2K8GA 1P1TA 3MFIA 2RNEA 3PW4A 5RUBA 2ZZNA 1QAIA 2ILZA 3MEGB 3MEGA 2HFVA 2ZE2B 4C98A 1HBOA 5EX3A 1P1LA 1HL6A 4DS4A 1TL7B 4IDKB 4IDKA 1NSAA 3PYFA 4MK7A 4RX6A 4K4WA 1UP1A 3JTNA 1ZA2B 5C5JA 3QFHA 5IWAJ 1SXLA 2YNFB 2YNFA 3SXLA 2DEJA 2WSEC 1X31C 3BGRB 3BGRA 2GMHA 1PC4A 3WC0A 3QSYB 4K59A 4KBIA 4P6QA 4R0EA 4P2MA 2HVHA 3SYZA 1EKSA 1SCJB 3IO1A 4ECTA 4O23A 3VHQA 2UXCF 3EGNA 4WU3A 4ZA1A 5H9EJ 5CHCB 2V0NA 2VKZG 3HZEA 1NM2A 3Q22A 2UV8A 5JMNA 2MLXA 1T03A 2DIVA 2QLWA 2ATCB 3BGUA 2OSRA 5KOXA 5HANA 1K9MT 2AZ3A 4DN9A 2RRNA 1RGVA 2JHEA 2BE7D 2KB2A 1XR6A 1RYRA 4LT6A 1GFWB 3Q8UA 1M5KC 2V8PA 1UW4A 5K8NA 2KHCA 2R2TA 2OHDA 3PR4A 4ED3A 5HBMA 4UZBA 4Q45A 2P9EA 5D4LA 1SL2A 1M1HA 1UW9A 3PIOQ 4USJC 2Z57B 2BOAA 1M90T 2O5DA 3LANA 1KVKA 1RP5A 2XO6A 3KLGB 3KLGA 3EPGA 5GADI 4I67A 4C8KA 1Q78A 5D0GA 3OW2R 4MK8A 3DU5A 4M5HA 2VHGA 3MM6B 3MM6A 1LWFA 4X4SA 3JSRA 5CCLA 2MQPA 3TRGA 5F3TA 3KG4A 4DV5F 2RU3A 2I0XA 1Y4ZB 2GHPA 6AT1B 1XWLA 3MPWA 5FDLB 4FPIA 1I3OB 4X62F 2X1BA 1RAFB 4QR1A 3KNAA 2YQ3A 4KHPF 1SJRA 1QY7A 4JI0J 4URSA 3C6TA 5KG2A 1MMDA 2F7VA 4L74A 3C15B 3C15A 3W64A 1ICEB 4DMZA 4IRKA 4U7UD 3R9LA 4Y00A 4LR7A 1U6FA 2A2CA 5A8RB 5A8RA 3HHLD 2KT3A 3BO3A 4C8YA 3ADAC 4CO5A 3C8YA 3A8KA 3NGDA 3I55S 4WU2A 4ES2A 2P5VA 3TARA 4WFYA 2HRUA 2R7VA 1ZAXA 2CNLB 2E66A 3OXFA 4DU7A 4CI0B 1BWEA 2YWFA 2L41A 2HNYB 2AWZA 3V81B 3V81A 2RS8A 2WRMA 5L1IA 1LKZA 1SH0A 4F04B 5E3PA 4G6VB 1S0OA 1H0HB 5DQIA 1WOPA 3OD2A 1UL3A 4X4NA 3PKMA 2OEMA 4N76A 4PG7A 4PWDA 5KFOA 4DSKA 3G87A 4YR0A 1TL3B 1TL3A 4IOCQ 3CO0P 4HL9A 4PG4A 3TVZA 3Q8QB 5DO2A 3VTIA 3CWJA 1V3SA 2QLJB 1SI9A 2GQCA 1QUPA 4ZVFA 5CYQA 4C8NA 3RRHA 3FFIB 3FFIA 2QFJA 3C6UB 3C6UA 2RB7A 4LF7F 4LMZA 3PR5B 4DR3F 4TLRA 5DGAA 1HKAA 3W8PA 2H51B 3O3LA 1F3FA 2VDIA 3IG1B 4ETXA 3QZ8A 2X3GA 1SQFA 2QL5B 2EFOA 2ZOFA 2R42A 3HT0A 4CLFA 3H90A 2MQOA 3VVUA 1TV6B 2C3YA 3AA9A 1ZYQA 4IO1A 5CYJA 2H3EB 1FJGJ 1KVJA 1URNA 1JNRB 4NYPA 3M6XA 2OD4A 1U49A 1HBMA 5AE3A 3EVMA 2YX7A 4HDGA 5KG6A 4ZVQB 2HQGA 2HGMA 2DNLA 3NGKA 4P9SA 4AFFA 3OTBA 2BJEA 2BX6A 2IC3B 2IC3A 2IIHA 4PAAA 2DGXA 2VC0A 4ERDA 4V19X 1DLOA 2PI5A 3FBEA 4ID5B 3CF5Q 1NPRA 1F1BB 2BM1A 2C2MB 5LMNF 2JC0A 3NS7B 1JMTA 1K44A 3ZTOA 3ZTQA 2IFXA 4OI4A 4ZPVR 4EGLA 3J7A1 4DX5A 4I6WA 3R3TA 2BV3A 3MM5B 3MM5A 2B56A 3UQSA 4ICLB 4ICLA 1A9NB 3CCSS 4NXMF 2HAFA 2NXJA 4M5GA 3RAXA 2HHQA 1KBRA 1WTBA 3W61A 3NXZA 3DU6A 4AT1B 2JVOA 3HT3A 3G9CA 1FWLA 1RT1B 1RT1A 1D1UA 3FQLA 3ZZPA 2LQJA 3P5TL 2VBXA 1OSCA 3DI6A 1S1UB 2FZKB 2Y9HA 4CH7A 5B0BA 2AF6A 2RSQA 3Q2TC 1Q82T 2CDRB 5ETMA 2MMYA 3MEEB 3N6NA 1H72C 1R8HA 2VFRA 4LFAF 2ZD1A 2JWNA 2VBZA 2ATLA 4FP9A 4UZCA 4DV6J 4HR2A 2MEWA 3CE8A 1LOUA 3EZ5A 5LMUJ 1XNQJ 5IXUA 4QU6A 1VMBA 2V69A 5D15A 2ZUGA 1K0TA 3W63A 2M3DA 2CQGA 4B3TJ 3VGTA 4Q7AA 2W9AA 1FA0A 1WEYA 3M4XA 5ITHA 1KOHA 2PMWA 2EI5A 1U6ZA 3ILIA 3TI0A 1PC5A 4ZN1A 4ITSA 2QL9B 2EFVA 2CADA 4MKAA 3ISND 1F5AA 4KH0B 5T14A 2UUWA 4X64F 1HQ2A 3KNGA 1E6YB 4ZP7A 2UUCJ 4OJHA 4ZVTB 2XB2D 1JWWA 1CLFA 2ZBQA 3MR7A 4FF4A 4DV4J 3CCZA 5EWFA 3TUIC 2R7XA 2UVWA 1X5TA 4DL3A 4K4XA 2NXEA 3PIPQ 4LJMA 4FXDA 5HJXA 1VQSA 2E44A 2MZRA 2QIFA 2ZBPA 4OHVA 4NA3A 3KJNB 4CQ1A 1CSJA 1VBKA 4KJIA 3W9IA 1JLCA 1RAHB 1ZTWA 4NLTA 4KHRA 1FDDA 4CO4A 2RAQA 4FF3A 3T6JA 1TU0B 4ANEA 3B54A 1GMWA 5KG4A 4GKJF 2DR7A 3BR8A 3ENAA 2UZAA 1QDUB 4ECXA 1ITPA 1U1LA 1HBNB 3SCKE 1RHMB 2HHHJ 4RW6B 4RW6A 5ETRA 2J7KA 4YDDB 1SKRA 1OO0B 3GIJA 3IMQJ 4ECQA 4JI7F 5CCMA 3QFWA 1HW8A 2C2ZB 1ZS6A 1JIHA 2Y8WA 5LJ5Y 3GIRA 5L1JA 3NBPA 2UU9F 2HHTA 3QRPA 2OGUA 5ADZA 3CD5A 4E0DA 2OMOA 4CLLA 4DR6F 4TYAA 4PEOA 2WVFA 3G71S 2D9OA 6FDRA 3ZTPA 3HFVA 4F7VA 5CQGA 2P9CA 5A8KA 3TQ1A 1KKHA 1SJFA 1F5BA 3MOZA 1DY3A 4FPRA 4K7QA 4JI2F 3PNIA 1SIWB 1Q53A 3LOUA 2DHSA 4GC6A 3D0IE 2E9ZA 4JV1A 1L3TA 3KMSA 4FS2A 3ULHA 3N01A 1AFJA 5KFXA 3BGOP 2UXDJ 2K2PA 2Q79A 2GGPB 2GGPA 5J2QB 5J2QA 1UZHA 2Z30B 4EUVA 5HQMA 1YITS 3CDAA 3UDEA 3QPIA 4WYLA 2B4UA 3QGGA 4EZ6A 4RUCA 4K2XA 4KYZA 1KHWA 3LALA 2MPUA 1Y5LB 1PAEX 3R5BA 3W5YA 2HVIA 2JLFA 4ZDNA 5IC4B 4Y2IA 1NKBA 4N8NA 4WYWA 1CJUA 5BR8F 4ZS6A 4RBTA 3PDNA 5KFEA 3ILOA 2LU2A 3K57A 1P27B 4WIIA 2W24A 3K5PA 4QZVB 3J81j 4OJ1A 4ECUA 2Z4PA 2GO8A 2LDIA 1JK9B 2CJBA 3LP1B 3LP1A 4BDPA 3UR3C 1OQ3A 4DV0F 4TU8A 4C0HA 2BVZA 4AUKA 4LQ3A 4JV0A 2XGQA 2V9KA 1F5CA 2ASLA 1N54B 1RHQB 5KT2A 1GMUA 2MZ1A 2LXIA 1NO8A 1AUSL 3ILLA 3OVSA 5F9NA 2HS3A 2DGTA 4HI2A 4CO0A 4H4KA 3SQOP 2ERRA 1X4BA 3GJTB 2POKA 3SBMA 2VDHA 4DPWA 2FVRA 3PW7A 2YKMB 2GHVC 2YKMA 1X9SA 1SC4B 1BWVA 4J9PA 5I3PA 3E2EA 4KIAA 2JZ5A 4ZIVA 1UTAA 2YQ1A 1FKAF 2CXEA 2KFNA 4ECVA 1RABB 4I2PB 4I2PA 4DFMA 4PXCA 3C14B 4P74A 4FVCA 2JX2A 4ZVRB 1U1QA 3L7UA 4N8OA 3WX8A 1QAJA 3FMWA 4ZK7M 2CNNB 3T1YF 3R1LA 4TN2A 4YHHF 3G2XA 2DY1A 3HJVA 3JYTB 3JYTA 1K1QA 2CFXA 5B7WA 2D74B 1S79A 1UWBB 1UWBA 2VOOA 5HATA 3CTRA 5D4PA 1X7VA 3BH7B 5J2PB 5J2PA 3RAMA 3GWCA 1VQ9S 1PKUA 3QGHA 2HHXA 2KXNB 1S1WA 4RL1A 1IR0A 2VD3A 2NPFA 3JAMU 4RWWA 2BJ1A 2UVRA 4CLUA 1LWCB 4EYHB 1WEZA 4GKKJ 2HGLA 3LTOA 2R8KA 4OI0A 2ROGA 1Q5VA 2MTLA 4WCEQ 3RTVA 4RNHA 4EFAC 4HEA9 1W2BR 4DPYA 3ZFVA 3TA1A 2VZ9A 1IUJA 5J1EB 5J1EA 2PA8D 2CNKB 3OTDA 1PYTA 1YBTA 1Y11A 2APOA 2QSFA 3KKFA 2KXHA 2V50A 4PQUB 2RUGA 2M7SA 3BN4A 3QLHB 4IQXA 4DFPA 1ROFA 3FKBA 3HD1A 2I1RA 3EVWA 4ETZA 4TVAB 5LSRA 2B6AA 2R7UA 2E5HA 4CH0S 2KO1A 2E9RX 1S57A 1NJZA 3FNNA 1NKEA 4NI2A 4OYWA 5KT3A 3MUTP 3TNVA 3TJ8A 1UFKA 1WSVA 4IQMA 1GX5A 5BYQA 5E3QA 1RQ0A 2VFTA 4EEYA 2B7BB 1VQ8S 4CLTA 2UUAF 3OLBA 3V6HA 3QT7A 3JSMA 4IUFA 4KY3A 4USVA 3K8VA 2UUBJ 3M8PB 1AUDA 1SJQA 3K58A 4M5NA 2XS2A 1FO1A 5HN0A 2Y8YA 2QGFB 4WBFA 1Z2LA 3TX8A 1MROB 1MROA 2GFFA 1HR0J 4O0IA 4B3RF 2N7YA 4HI1A 4OV1A 1WC3A 1N0UA 2XMKA 3HXMA 4D3GA 2C3OA 4CM2A 2YBVA 2N4DA 5SUHA 1RBLA 3CPWR 2IHR1 2D41A 4FYYB 4C8ZA 2XO7A 1VRUB 1VRUA 2QN6B 4AL7A 2CG4A 1YRTA 4LFCF 2MQ8A 2NCKL 3K5MA 4ZPDA 3VVTA 4ZJLA 1REVB 2F9DA 2AGOA 3IR7B 3D2WA 2DRAA 1S6QA 2EBEA 1VHIA 2DO4A 4P7TA 1XMOJ 4ZVSB 5D4NA 1LW2B 1LW2A 4DCPB 4RU2A 2HURA 2R3VA 3J7YI 4JI4J 4BCAA 2C2OB 2BRLA 1XBWA 2ZEJA 1U8SA 1EARA 4TKTA 3V5RA 3PYGA 2OO4A 4CCHA 4F0MA 4PG6A 3HI9A 1WELA 2RQCA 3H5YA 3W60A 3E3XA 4J91A 2N3LA 3NWRA 4WXOA 1A0OB 4EBDA 1RKIA 3GYXB 3SZ2A 2DGQA 3HPOA 2MQMA 2CZ9A 2UXCJ 2ZBRA 4WZMA 3DOLB 3DOLA 2FVSA 4ZPCA 1PCAA 4YR3A 3QO9B 3QO9A 4K4UA 2IMOA 1D9FA 3R2CJ 1RT3A 4DR4F 1U0SA 4KO0A 2PGCA 3OPKA 1SIZA 3U7JA 4JI6F 1N88A 1DTQB 4NCGB 4NCGA 4ED6A 1NPPA 5HI7A 2VPXB 1T7PA 1RDRA 5F9LA 1EAYC 2CPZA 3EZOA 1GAOA 4OL8A 5K5MA 3G6YA 2D7SA 2DNMA 3J7AN 1GK8A 2EFQA 3NGSA 4L76A 1U2FA 1Q16B 1RISA 3M9NB 2WHOA 2CNOB 5EUHA 3G96A 1S77D 3WBZA 3RAQA 4L75A 1YJNS 5EN1A 1XNRF 1NK8A 3G82B 3G82A 3IR6B 4Y6IA 2FJEB 5BYRA 3BSNA 4DS5A 4YB7A 2YPYA 4KHMA 2CQDA 2Q43A 4L72B 1NK6A 2AQ4A 3GQCA 3FGVA 3SDEB 3SDEA 2G2OA 5MAOA 2W4PA 1M5HA 2LXUA 2K3IA 2CPEA 2VF3A 2R7SA 1Q1KA 2HYIB 2B9WA 1TVRB 1TVRA 3AODA 3SCJE 3AA8A 3H42A 3HKWA 4B08A 1KDNA 4LF5F 1EQMA 5EX0A 4WJBA 2E5GA 2N3OA 4A8XA 3I0RB 3I0RA 4AXIA 3MD1A 4ELVA 1RLCL 3IGNA 2GIRA 1M5PC 3P8BB 1YJ7A 2FDNA 2CUYA 3L95X 3JXOA 2BANB 2BANA 3AD9C 2GV1A 4X62J 5CXTA 4JOUA 1WI6A 2SXLA 2B4OA 3CCUS 4C3MA 4KHPJ 2YWHA 3KK2A 4AL6A 1LK5A 2ACYA 4J90A 5DZ6A 4NLOA 1I51B 1S7HA 3PYDA 1WD6A 4YB5A 3DXBA 3T19A 1M1GA 4DL5A 2GHWA 2V67A 1T9TA 4I68A 1F6TA 1WG1A 2FB0A 3HVRA 3AOBA 4DFJA 3PCOB 2QA4G 4U9RA 4QR0A 2VFVA 2F40A 3VAKA 1XTZA 4LF9F 4GVBA 4QWAA 3FMBA 1XJWB 3GV5B 2YNHB 2YNHA 3AJ2A 3FEYB 5HROB 1J2VA 1FRLA 2HEKA 3M30B 3M30A 2GVDB 2GVDA 2DB1A 3V4IB 3V4IA 1WKKA 2WOMB 2WOMA 3QIDA 4B3SF 4I6AA 4DQRA 1TK8A 1RWOB 1PSDA 3SCLE 5M2UA 2JLEA 2LQ5A 3R5GA 4CWBA 1VK8A 1S76D 2XZTB 3PO4A 3LP0B 3LP0A 5F3ZA 5E3CA 2XG8A 5A0YB 5A0YA 4LBIA 2DKOB 5EWGA 1HNVA 2AJ2A 5ETOA 1R0AB 1R0AA 3EWGA 1L3VA 4MH8A 1RWXB 1RK8A 3ISZA 3PW2A 3PXGa 2ADCA 2KG0A 1X4DA 2LLZA 1TFYA 3PTWA 7AT1B 5DM7Q 4LF7J 2GQQA 2EK6A 1C4CA 4DR3J 2HQFA 3N5FA 4ZLNA 3Q89A 1ZAVA 3RUBL 1IKYB 1IKYA 1GXTA 2JFKA 4KGMA 1WTFA 3K59A 1VQ7S 3H98A 1T9WA 1B7YB 2G1HA 3L09A 1NHUA 1VGYA 2DR8A 5GAGU 2AJ4A 2GMJA 1UEKA 5EGYA 1HWUA 2GVZA 1KTQA 3RR7A 4PXBA 2Y0SD 5F41A 1PG5B 2IVMA 3DDIA 2ZHAA 1FFSB 3WC2A 3AQPA 3DLBA 1N5VA 2DNKA 4P75A 1QSSA 2EPIA 2HFUA 2KT2A 3D3BJ 1RAGB 1K0VA 1H7WA 5B0CA 5E41A 4E8UA 3M7VA 2F8EX 1IBCB 1U25A 2KVQE 1W2IA 3EPIA 4P2XA 3QAEA 4HVZA 4NZ7A 3T9ZA 2MZTA 3U1LA 4DL7A 3D28A 1PYSB 5LMNJ 2FGOA 3KDNA 3MUMP 1HI1A 3KLHB 1H98A 4YS2A 4QCLA 1HNXF 3LO3A 4ELTA 1HWIA 3M32B 2Z2ZA 3M32A 1VYAA 4DQSA 4BHQA 4QPXA 5GAEI 1B0TA 4JV2A 4NXMJ 2DNZA 1RB0A 1VIXA 3MF5A 4X4RA 1HBUB 1HBUA 2NYIA 2EKNA 4OV6A 2ZH3A 4OX8A 2HWIA 5CYMB 5CYMA 2ZDPA 3DHWC 1N52B 4PG8A 3K17A 4PCQA 3SFUA 1VS3A 4JV5J 4HT5A 3CGIA 4QU7A 2MB0B 4U7CA 4S0MA 1HI8A 4ES1A 3M8QA 4ID8A 2QMUB 2YKPA 5E0OA 3WIVA 1HD0A 5HQLA 3OL8A 4LFAJ 2MQLA 4DR1F 5F8NA 4R8UB 4R8UA 3RBXA 2JNJA 1EB0A 3H2LA 1BC6A 4OJGA 2EWHA 4CRJA 2DD8S 5IC6B 2HHSA 1FDAA 2V8VA 3UD4P 2PI4A 2XMTA 2W7AA 2FVPA 2E5LF 4IFVB 1KNZA 3NEKA 3CD0A 4B3OB 4B3OA 1T9VA 4RLEA 2PEHA 3V2UC 3LGMA 4F2SA 2HAIA 1TK5A 1I5OB 5KFIA 3CD7A 4X64J 1NJYA 4LBHA 3HHKA 5KFJA 2CQIA 3BBFA 3BEGB 1NBEB 4IFYA 3DRPB 4ZLLA 1KS2A 4RU9A 3MR6A 2DR5A 4M5DB 4M5DA 3PO5A 5KT7A 1JLGB 1JLGA 2OPSB 2OPSA 4ZITA 2YTCA 3HZGA 1IJEB 4ED4A 2CQ3A 5CA5A 4L3NA 2FZGB 1S0NA 3U1NA 5KFHA 2Z2LA 2IRYA 2LQBA 4A4JA 2VC1A 1HWJA 1VOMA 1EIYB 4QPTA 4ZMMA 2J0SD 5D3GB 5D3GA 2CQBA 1S12A 3TEGA 3CCTA 4FYDA 3M2VA 2KRBA 5GADU 2DBBA 3D1QA 1X4FA 3QJPA 4GKJJ 5U47A 1FJCA 1VI7A 3P3DA 1WHYA 1S9FA 3W3SA 1YTYA 2CQHA 3CJRA 2E1AA 1QAYA 1KHVA 4LF1A 3CJKB 3NL0A 1XK8A 1XEZA 3IC1A 3PZPA 1BHNA 1WC4A 4K0KF 4DV4F 3DGPB 3DGPA 4OX9F 1QE1B 1QE1A 4YOEA 5B0AA 3TOQA 3DDKA 4K2JA 1X5PA 3AHPA 4BBYA 4BWMA 2ZKUA 5FD1A 1PJ7A 4FXWA 1U24A 3VQTA 4F26A 5T7LA 4KPYA 2G13A 2E5IA 4HTJA 5DG8A 3W9JA 4DR6J 1DARA 2B51A 4NCAA 4F2RA 2CJKA 1NJIT 3P49B 1IR1A 4B9NA 1FXLA 3MAQA 1SH3A 4YY3J 3MXHP 3THTA 4CT9A 2W1BA 2PT0A 1SC6A 3DFEA 2ZC4A 4ILMA 4JI2J 3QWUA 1DAXA 3TVKA 5J1PA 1FTCA 1U2RA 2ALZA 1WG4A 3CJ8A 3M8RA 2QMXA 4NEYA 5AJ3F 2EG1A 1S1VB 1S1VA 3U02A 2YKNB 2FLNA 3OJSA 1FDBA 5THWA 1IQZA 2OPPB 2OPPA 4NASA 1R8CA 3HHEA 3T6BA 5MLCV 1DQAA 3ZC4A 1WF0A 1N4LA 1RWVB 2ACMA 2LVWA 1HLWA 3LA0A 4LIRA 4HHJA 1CC7A 2ZNYA 2XZDB 3KK1A 3FSXA 2XMMA 5I4MA 1IWGA 3WHIA 4EWTA 3PEHA 4JI1J 2LEAA 1AW0A 1ZM4A 3JSBA 4I2QB 2KFZA 4HYKA 2CIMA 2HWHA 4YEAA 4TYBA 5BR8J 2CG8A 2E7WA 1ZA1B 3B4MA 3NAIA 2X1FA 1Q5YA 1RYSA 1R3NA 2Z2YB 4W4MA 4DSLA 1WG5A 1RTIA 1FXRA 3A12A 2F3JA 2AYEA 2K3KA 4DV0J 3OXLA 4GRSA 4FBTA 4ZCKA 1L3SA 2UXDF 1NH7A 2YNGB 2YNGA 4K5RA 4DL2A 3HSGA 3MEKA 5KFGA 2V63A 2VH7A 1UCNA 1TMMA 3KLVA 4M5MA 4U95A 4PPZA 3EVOA 1XIQA 2COLA 1C0TB 1C0TA 1SBRA 1G2EA 4NYZA 3RBZA 1ZH5A 1RHJB 2YWWA 5FLXU 5F8MA 1Z2ZA 3UVJA 3UVJB 4EU0A 4DG1B 2EKYA 5LOQA 1R0CB 3WX4A 5C42B 4OX6A 2QTWA 4I7FB 4I7FA 4DV3F 2L48A 1U1MA 2FJAB 2HQIA 5FLXY 3Q8SB 2YH1A 1R0BG 1FDNA 1M0SA 1O0PA 1UZDA 4P73A 1BGXT 3ZTSA 2BBEA 4YFUA 2XC9A 3RRKA 3T1YJ 1TUWA 4N47A 4YHHJ 4PABA 3ETOA 3MPYA 3Q8VA 4F4KA 1YGYA 4NLVA 2AJ0A 2Y1RI 1WNEA 2ZHBA 1U7LA 3J80U 1NHKL 5ETLA 3H2VE 2HZCA 1RWPB 4IKAA 2HQCA 3T5KA 1X4AA 1KFDA 1AYEA 1QLNA 3DRRB 3DRRA 3J80Y 3GTYX 2JEIA 3D1HA 4UOFA 4H4KC 4TU9A 5KFKA 1GTEA 3CCVS 3HX9A 4OI2A 3EUNA 4CLZA 2J9DA 1PAUB 3EGWB 4Y34A 3FSYA 3TUPA 4LVNP 2AEJA 2RD5C 5K14B 5K14A 5CD4H 1QD1A 3CJ2A 2YQ0A 1NCLA 1SPBP 4NCBA 3PW5A 5JXSA 3KYLA 3O8WA 1T3NA 3BPSP 1Y7PA 2BQUA 3U27A 1HHQA 1RJJA 1X4EA 2RHSB 3EDRB 2B9YA 2O67A 3M8WA 3LWLA 2UXBF 2IA6A 2P6SA 3KG0A 2JC1A 3OXGA 3G8SA 1FRXA 3I31A 2G9OA 3RR8A 1FFWB 2IDEA 2B5JB 5B0EA 1FF2A 3MMCA 3H5SA 1PBAA 4RUAA 2PMZD 2PE8A 4CTAB 4CTAA 5BXIA 3MR5A 1HW9A 1EJ7L 2HVZA 4A48A 2DXDA 3OFGA 4DQQA 1GNKA 5FIIA 2FVQA 4F3QA 4LSNA 2BM0A 1TP7A 2L9DA 1SV5B 1SV5A 4ED7A 2KJWA 2FJDB 1UVIA 1UJ4A 4OZ1A 4WTOB 2BABA 2C2NA 4GKKF 2AIRB 1VLOA 1YWXA 2UUAJ 2D1CA 4NLSA 2WW8A 3LQVA 4WTYA 3SMZA 4WXWA 5DLFA 3ENWA 2RKIB 2RKIA 1JLEB 1IBKF 2IRUA 1EHWA 2RUSA 2NSBA 1WC5A 3GU0A 3VAHA 2BJ9A 4I4BA 4OHYA 3GMGA 4URGA 2O01C 4B3RJ 2G1DA 2Z2MA 3BH6B 3W2WA 3WDOA 4ZP6A 2JDJA 3DOMA 1IKVB 1IKVA 5GAGI 1SQEA 5B0GA 1U1KA 2HQDA 3VF0B 4NE9C 2YWKA 2CPDA 5LXRA 2A3JA 1RT2B 3R5CA 4DBQA 4LFCJ 4ZVUB 3SSQA 3IAM9 4NA1A 3D68A 4JUZA 3A8IA 3FDSA 4X4TA 4UUXA 2V5HG 4JYAJ 4X4PA 4Q43A 4OZNA 1PILA 2G0CA 4URQU 2C42A 1PJ5A 4ZCIA 2DEIA 3MCSA 2H4YB 3R97A 1R27B 4NLGA 1B0PA 5J2MB 5J2MA 1S4EA 1OWXA 3VV2B 3N79A 3MOJB 4EZ9A 4UY85 2O3DA 2ZH7A 5IZHA 1H2VZ 3SV3A 1F60B 1TL1B 5B09A 4M5LA 3J7Z5 1IBMF 3MMBB 3SI8A 1G7CB 3ENQA 1ELOA 3VQSA 4C0BA 1M5OC 3HM9A 2R2SA 2NYHA 1N56A 1D9DA 2VICA 2NZCA 5FJ4A 2MSSA 3DKDA 3R5JB 3G6XA 1RA6A 3MCMA 4DHVA 4A8MP 4RNNA 1LWEA 3DLEB 3DLEA 1Q81T 4DSIA 2J9DE 5KFUA 3TJAA 3LW5C 3Q2SC 4M63A 3CC2S 2GW8A 3RB3A 5L1KA 1RBAA 2BQ3A 3S1TA 3UCGA 3D6TB 1C2PA 3VALA 3T1AA 4DQPA 2J7WA 4G1PA 4DR4J 2RHQB 3PHTA 2DISA 3DMJB 2F9JA 4JI6J 1IWAA 2JL9A 1X60A 2ZZTA 1ZBTA 1QSLA 2P8IA 2JFDA 2ZE2A 1RU1A 5HO4A 4U8VA 1TL7A 2MLYA 5F8IA 4XO0A 1T02A 1VK3A 2JH3A 3HJFA 4C6AA 2V8HA 4ECYA 2YX1A 2ZWOA 2W8KA 1WF1A 1S9GB 1XNRJ 2XTJP 1GTHA 3NMAA 2PD1A 1JJHA 1SVDA 4F25A 2W01A 3TA2A 2A6OA 1TKZB 1TKZA 5HMYA 3UDCA 2W9CB 3V6DB 3V6DA 3P6YC 2XCAA 4IOAQ 1HA1A 2X3DA 2PSZA 4KKOB 4KKOA 2OI2A 2QO3A 2OUGA 2CPXA 1KOOA 3Q83A 1ZAWA 5JVHQ 2R8HA 5L9NA 1YLXA 3LPEA 1WC0A 3QIPB 3QIPA 2UVVA 1RTDB 1RTDA 2CPIA 2Q6CA 4K4VA 1B7FA 1T9XA 1DZ5A 1QTMA 4HTIA 2E1RA 3NS5A 4CLWA 4LF5J 4NLXA 1SC1B 3PFEA 2CJYB 2JRSA 4ZIWA 1T9UA 1ZM2A 2DCLA 4QYZK 4J9VA 2KU7A 5G4DA 2VB6A 4LR8A 2P6TA 4OYIA 4I56A 1CJKB 1CJKA 1H6KX 2QMWA 1REGX 2X51A 4RW9B 4RW9A 2BE2B 2BE2A 2XBPA 4OZLA 3LH2S 1S0VA 2AJFE 5JVGQ 3SQGB 3SQGA 1Y3KA 2HFSA 2HNDB 2HNDA 3CC7S 1BE4A 1TFWA 3IBWA 2QZ8A 1RKJA 2MHNA 1S6UA 2WBRA 2C2KB 4R25A 1SKUB 1T05B 1T05A 1Q4RA 5EWEA 4DSEA 2KZZA 2BUNA 2OPQB 1CS4B 1CS4A 3FBBA 4MYTA 3GV8B 2K1RB 2K1RA 3EZUA 3R7NB 2XYPB 4LF9J 4Q44A 2BZ2A 2NQPA 4X4UA 3R6LB 2MSTA 2DGWA 4NPOA 2B0GA 1X5OA 5M2PA 4DF4A 3HSZA 1P6TA 4JI3F 2HMIB 2HMIA 4K8RA 4MKVA 4DV7F 3IP0A 2XI2A 1HNZF 2EXUA 4LSZB 2JLGA 2VG5B 2VG5A 2C3MA 2KHDA 5B08A 2L08A 4B3SJ 3D7SB 2IPOB 4C48A 5FDLA 2VKRA 3RB0A 2DH7A 1QJHA 3TW0A 1SJ1A 3I5BA 4O3PA 3TX0A 2HHUA 1MU2B 2LCWA 1VQ6S 3H0PA 1WI8A 2R9LA 2QL7B 5IQ6A 2QA1A 1IKXB 3MZIA 4TXSA 3CW2C 4ZLPA 4B3MF 2Y0BB 4QWDA 2W9BB 5IT9U 2IM0A 1WHXA 4PQAA 5K8OA 3FEXB 3O6QA 3VAGA 2QFIA 3AXMA 5ETQA 1XMQF 4FKYA 1QM9A 1BQNB 1KFSA 1Y0HA 1VIOA 1APSA 2E7XA 1R43A 5IT9Y 3VCDA 2V8DA 3DNCA 2Q66A 4RNOA 4I1TA 2CVIA 2PFDA 3I0SB 4DLEA 3TVYA 1PBUA 2QC3A 3K5OA 3SV4A 9ATCB 4X4QA 3AAWB 1TKDA 1H2TZ 2WB1D 2XS5A 3NMRA 2QLBB 2B8PA 2L9WA 2MZSA 2HSEB 2DPIA 2HNYA 3BSAA 5BJRA 3PRVA 1FHTA 5ETVA 4C9DA 3KDOA 4M5JA 3GE9A 2XNQA 1F9EB 3DC2A 2QLXA 4MTPA 2BKPA 3BDPA 2AD9A 4A46A 1VISA 2HPUA 2IY5B 1QSYA 4KGKA 4W92B 2Y1LB 3ZXWA 4RKUC 4PXEA 1BLUA 4DLGA 3HVAA 4YB6A 1S49A 3MPUB 1OPZA 1M1KT 2QE5A 1NLKL 3NCRA 4EYIB 2EEYA 4AE5A 1U6BA 3K5LA 1V5IB 1BD6A 4O3OA 3RYLA 2GIFA 1X9WA 4F0HA 4ED8A 1BXNA 3DOKB 2XY6A 3RB6A 4OZJA 2KYZA 4N5SA 3JTOA 1V5VA 1HNXJ 5DDQC 3F73A 1UKUA 2K7KA 3IG1A 4QIVA 2VV5A 2IYIA 1VQPS 1T9YA 2FY8A 2Y1JA 4K4ZA 4EBEA 1AT1B 3NCQA 3OTOF 1OJ4A 5HP1B 5HP1A 3N5BA 3KUHA 2E5JA 1X4GA 4LIWA 1TR0A 2IJFA 3VAJA 2V4RA 1RTZA 1TV6A 3VZIA 3EM1A 2ROEA 4WP8A 3OR1B 3OR1A 1PGZA 1IN0A 1OQ6A 5I3QA 2CPYA 3K8WA 2AYGA 3HHLB 3HHLA 1OMSA 1O8BA 2DGOA 3QJLA 2AV5A 5AXLA 1NU4A 4EMDA 4AQYF 3DRSB 3OSNA 2DNHA 4FYWB 3J7YU 1OYDA 3AD7C 2F4VF 4Y0FA 3ZZZA 3GJRB 2IJNA 3FUYA 4ID5A 2E7VA 2KM8C 2DNPA 2V68A 4P2SA 2KL8A 2MYFA 4DR1J 3W1YC 3FCWA 1OY6A 1HNWF 4NLUA 4USUA 2FC9A 1NSQA 1NB2A 4NLRA 4QWCA 3IRWP 3K0JA 1U1RA 3GZ7A 4KTQA 1QVFR 1J5EF 1L5UA 4J9SA 1AA1B 1VLYA 3BM7A 2IM1A 1RT7B 2C28A 4QJVA 1JJ4A 3EGZA 4O3QA 2E5LJ 1UVNA 2MZJA 2KYXA 1XR7A 4ILRA 1UVJA 1KWMA 4NYOA 5HSPA 3TZXA 1SL1A 1OY8A 2AT1B 4M8LA 1FRHA 1F9HA 1PO6A 4PWWA 1NK4A 2R8IA 3ICLA 5KFMA 4JV5F 4NA2A 4RUBA 1CJVB 1CJVA 4UTGA 5KFTA 4ZJQA 5LL6d 1S1UA 2RDIA 1YJTA 3L4BC 2A18A 1G6BA 2OEJA 3Q8PB 1GQEA 3MEEA 4D3HA 3CNQP 1RT6B 4USMA 1YX2A 2CVEA 2W4DA 4ZP8A 2ZH4A 3P5BP 1TK0A 4OHWA 3R1HA 5KG5A 1VBXA 3IM8A 1NXIA 2ZC3A 1H2UX 1D0EA 2J6TA 1WJ9A 2D3O1 3M9OB 1GT8A 3KK3B 1FRJA 3KK3A 1Q86T 1HQEB 1HQEA 3GSIA 2RDDA 1OIAA 2RE1A 3QT5A 3GR0A 2GNKA 1KP6A 2QYGA 4LF6F 3UPFA 1SJ4P 1Q7YT 4ZPAA 1UAWA 2DITA 3MM7B 1LV5A 2VG7B 2VG7A 4TY8B 2MZQA 4TY8A 2AKWB 4ZKAA 1SKWA 3MM8B 3MM8A 1E6YA 4ANDA 2F5GA 2NSCA 1PJ6A 1RWNB 5IV4A 4JI5F 2HFZA 2B3TB 4K0KJ 4OX9J 1UMJA 4OHZA 1U45A 2ZOMA 4G1IA 4O3RA 4HDHA 2R7TA 3KUEA 2VG6B 4AXJA 2W2QP 2V8GA 2EK1A 4B9MA 3CJ4A 3MI7X 2Q1LA 4J9QA 3OT9A 1KC8T 2HHWA 3H7HB 3BSOA 3SCIE 4Y2KA 2XLJA 1NK9A 4P7VA 1H7XA 1FJ7A 4XAKA 3FRZA 2Z0GA 4TLQA 2QRRA 3CSKA 3A3NB 3UCZP 3MWBA 3P4UB 5AJ3J 1HBNA 2GS8A 4QWEA 1DQ9A 1WKJA 3NGRA 3UWTA 4DPUA 3QSIA 3BQ1A 2I38A 5AXMA 3LPYA 4O44B 4O44A 2EFNA 2V4JB 2V4JA 4W98A 2DR9A 4C11B 3J81U 2LECA 3PFOA 4BC9A 2LQ9A 1R89A 3I32A 2FHJD 2KDOA 1IQTA 4G65A 2QEXS 1LK7A 3MEDB 2FQQB 3GCXP 3PX6A 4MFBB 4MFBA 1JLFB 1JLFA 3H5XA 2MKJA 2WW4A 4ZPWR 3PY8A 2HQ3A 4DR2F 3KLEB 3KLEA 3MDFA 3GFXA 4OLPA 2CPHA 3DLGB 3DLGA 1MN9A 5K8PA 2ZFHA 4YY3F 3VAMA 3OSPA 4IRDA 2CWXA 3FBCA 4DL4A 1MLAA 1PIEA 3CJQA 2XY5A 4W90B 3PACA 2EFGA 5DETA 1RWKB 3GILA 3JQMA 5M2RA 3MAAB 3MAAA 4CLYA 3BKUA 4BC7A 4EK2A 2OD6A 2DRDA 3MPDA 2BA9A 2M52A 3G86A 1VBYA 1UPMB 4J37A 4IH6A 2JEFA 3GYGA 2VJUA 3QAUA 1Q8BA 3POTB 3POTA 5ETNA 2GC8A 2ZH2A 1JX4A 3QZ7A 2XEXA 4QIGA 3GP9A 3DRXA 4JI1F 1NJXA 4OHXA 2MJUA 5HLFB 3TJ9A 4C7QA 1N5SA 3CB4A 3CO9A 3DXSX 5A6PA 2DO0A 2AGQA 3BYPA 5K8MA 2H4WB 3HVTB 3HVTA 3ZZTA 1N36F 2FGCA 2ZDOA 2M5YA 3HDSA 4M5KA 4MJKA 1XC9A 5IS2A 1UPPA 1WOOA 4DV3J 4LREA 2U1AA 3BR9A 2H65B 2BJDA 2KI2A 1I1GA 3R7BB 5H9FK 5L46A 1L3KA 1HIYA 2HBZB 3T5HA 3PV8A 4KSEB 4KH1B 3CDWA 3EGVA 5GMDA 1MW7A 2CZ4A 2ZVSA 2LDYA 4NLYA 4WFBQ 1G4CA 4LF2A 4QIWD 2FVCA 1MNEA 1AZSB 1AZSA 1FVQA 3NLCA 2W7PA 5GAEU 2YWGA 3H25A 3CDBA 1YZ6A 3L7OA 3CJTA 1GXUA 1TL5A 3RJMB 3M1VB 1FRMA 1CQMA 1RI7A 3E01B 3E01A 3KLFB 2LYVA 2D9PA 2HNZB 2HNZA 4C3LA 3D6HB 3WZ0A 3MMJA 4B17A 1Y9OA 2I9SA 1LXJA 2C1EB 5D78A 2OTLS 1X4HA 3D4JA 3TQEA 2F8HA 2L3MA 3T41A 4ZLJA 1K8AT 2GMLA 1RTHB 1RTHA 2M88A 4NXNF 1VQOS 1FCAA 3C14A 2BJ8A 4PUOA 4PUOB 4FF1A 2BRKA 4USIA 6FD1A 1ZETA 1UFLA 4NRTA 2GJ2A 1B3TA 1HHSA 2BYCA 5GMEA 2Z56B 2UXBJ 2KT5A 2DGVA 2YXLA 2FUG9 4L3KA 1KLMB 1QVGR 2VPYB 2OPRB 2OPRA 3D5MA 1G1XA 2WSCC 2BKNA 4KGXB 5LM7E 4GO7X 3N6MA 3ZNUA 2XM3A 3GB0A 3RZAA 2D3OR 1XMBA 3JTPA 1YSJA 1TELA 3UN3A 2C2EA 2NREA 1HBOB 3KJFB 1LWCA 2DNRA 2J6UA 3KHLA 2GZOA 2W2PP 3JAMY 1ZPVA 1FNMA 1KLNA 2QSWA 4J9MA 2Y1IA 3PEJA 1IBKJ 3IBCB 1EX8A 3CT9A 3DCAA 4ZOSA 2YKAA 2PEBA 1FRKA 4DI6A 4PQUA 1UA1A 3KFWX 2VQFF 2ZHOA 3QLHA 3HHDA 4X2BA 2A2DA 3GV7B 5IQQA 3OL9A 4TQRA 3GSDA 3H4DA 4PYDA 3QGPA 2ZH8A 1J27A 4NMLA 3E51A 3N4WA 4Y2CA 3I5AA 1T03B 2F4FA 4ES3A 4RJVA 2HVDA 4DUZJ 3AD8C 3BREA 1QAXA 1EETB 1EETA 1RLDA 3M8SA 4DPOA 2XZWA 4DR7F 2LKZA 3LAMA 1R8PA 1YRUA 4UOCA 2MY7A 1KEKA 2EC2A 3I96A 4ED1A 5GMKa 4QIEA 2DNYA 2NXNA 5HBMB 2B9EA 1DHMA 1W26A 2CDQA 4LFBJ 3M8PA 5LJ3Y 2VOPA 4YN3B 4MK9A 1SH2A 4WIQA 2B43A 3GPAA 4X65F 1IBMJ 4IYQA 3MAHA 1JQGA 2HFOA 3KG1A 1U1NA 4XK8C 3E8OA 3QYYA 1TZ0A 4MT1A 1MG7A 5KFCA 4Z37A 1U1OA 1ZZNA 3AOCA 1LWFB 1YJUA 2V9WA 2KTQA 2K06A 4A8YA 3BKTA 2RQKA 2HKEA 3US5A 1H73A 3DGVA 4Z7YA 2HK2A 2YPZA 2D3ZA 5DDOC 1RAIB 2XSFA 3PW0A 1X4CA 3ENVA 1YVFA 2E9TA 4HH0A 2BEFA 1REVA 2WVEA 2IJRA 3RW7A 2MGZB 2MGZA 4LRBA 2MKSA 4JYAF 3AXKA 3T5JA 2IMWP 3NGUA 3QMQA 4DL6A 2FLPA 3C6TB 4WF9Q 3GLJA 1RA7A 1UWAA 1IBLF 2EW9A 4LF4F 4DX6A 2GIQA 4NLWA 3MECB 3MECA 4HKQA 4KR0B 1WC6A 1UEVA 2B4VA 5L38A 3QQCD 1VQKS 1ZOTA 5C2CA 2AX1A 3EMTA 4FZVA 4RW7B 4RW7A 1H74A 2Q6BA 3HFKA 3KHGA 2AW0A 1K73T 2ADBA 2I5JB 2I5JA 2XULA 2N7CA 3TAMB 4H4OB 4H4OA 3TAMA 4CM0A 4UOGA 5KG3A 2QG9B 1H3DA 2FZCB 3NGTA 4WWSA
chains in the Genus database with same CATH topology
2OJ3A 3RR8A 2B5JB 5B0EA 3I0SA 1FF2A 1UVKA 2VFSA 3F56A 2DHSA 3MMCA 3D0IE 3H5SA 4OX7A 3H5UA 4GC6A 2E9ZA 4RUAA 4JV1A 3RW6A 2PMZD 2PE8A 3DLLQ 1L3TA 2KG1A 3M6UA 4CTAB 4CTAA 4CO3A 3KMSA 2J7UA 4FS2A 3ULHA 3MR5A 3N01A 2MQQA 3W2VB 3W2VA 3NNAA 1AFJA 1J5OB 1J5OA 1HW9A 5KFXA 3CCQS 2HRYA 2IM2A 2HVZA 2M70A 5JJBA 4A48A 3GG1A 2K2PA 2Q79A 2QT7A 4U6PA 2MHEA 3S7RA 3OFGA 4DQQA 2GGPB 1GNKA 2GGPA 5J2QB 5FIIA 5J2QA 2FVQA 2DJWA 1N34F 1FKOB 1FKOA 4MMOA 1Z4UA 4F3QA 4EUVA 2HHPA 3N0VA 4LSNA 3OFFA 1YITS 3BDEA 2WONB 2WONA 3CDAA 2BW2A 4Q5VA 3QPIA 2HLUA 4Q2MA 4WYLA 4PWDB 2BM0A 2NZ4A 2B4UA 3QGGA 4EZ6A 4RUCA 1A7GE 1S10A 3KLIB 3KLIA 1RWUA 2ZH9A 1TP7A 2L9DA 4IFYB 1SV5B 1SV5A 4Y3CA 4ED7A 4QYRA 4K2XA 2KJWA 7FD1A 2LA6A 2FJDB 1UVIA 1MWYA 1UJ4A 4NLQA 1KHWA 1DTQA 3CVKA 4OZ1A 1FD8A 2BABA 2DRBA 1JLBB 1JLBA 3LALA 2MPUA 3LAKA 3CCMS 1U47A 5D8HB 1FE4A 1Y5LB 4GKKF 1SL0A 2KZMA 3R5BA 4ZVGA 2OFGX 2HVIA 2CRLA 2JLFA 1YWXA 4ZDNA 4MIWA 3B8HA 2D1CA 1ULRA 4PXDA 3SSRA 1VQLS 2LXFA 4Y2IA 4NLSA 4F50A 1S1TB 1S1TA 2OMLA 2WW8A 1HD1A 3LQVA 1NKBA 4NOHA 4WTYA 3OBIA 3SMZA 4DV6F 2OP5A 4N8NA 4WXWA 4WYWA 3GFHA 3C2PA 5DLFA 5BR8F 3ENWA 4L6V3 4ZS6A 5CYQB 2OTJS 2RKIB 2RKIA 4RBTA 1JLEB 4C8MA 3MUVP 2J5AA 1S72S 1IBKF 5LMUF 2IRUA 5J1NA 3PDNA 5KFEA 2NSBA 2LU2A 4G3IA 4MAKA 1XNQF 4FNHA 1CC8A 3K57A 1F9FA 3OQ2A 3R27A 3VAHA 2DNOA 2VUGA 5HQ8A 1P27B 4WIIA 2W24A 1X0PA 2ZZMA 4I4BA 3K5PA 4QZVB 2X1AA 4OJ1A 4OHYA 4ECUA 2XSJB 2XSJA 3GMGA 4URGA 1AROP 2O01C 2Z4PA 3T3FA 5A8WB 5A8WA 2G1DA 3NS6A 4O4GA 4O4GB 4B3TF 1TL4A 3IGVA 2GO8A 3CDUA 2Z2MA 2ZH1A 2ZBCA 1C1BB 1C1BA 1G3OA 1JK9B 1U09A 1W25A 2LDIA 2RRBA 3IWLA 3B78A 4ZP6A 3W2WA 1XERA 2CJBA 2JDJA 3ZZOA 2N82B 3LP1B 1WHWA 3LP1A 3S01A 3UR3C 1N6QB 1N6QA 4BDPA 3M2VB 5EHHA 4DR5F 3DOKA 2BACA 1IKVB 1IKVA 1OQ3A 3DOMA 5GAGI 1SQEA 5B0GA 1U1KA 4Y28C 3LUYA 4DV0F 3VF0B 4TU8A 4C0HA 1MSWD 2RIJA 2BVZA 5DM6Q 4AUKA 4LQ3A 4JV0A 2XGQA 2V9KA 5E33A 2YWKA 1F5CA 5E5NA 2ASLA 1N54B 2CPDA 3EYZA 1VBZA 1R8BA 3ZZYA 5KT2A 1HARA 3TR5A 5LXRA 2MZ1A 2A3JA 1VHFA 1NJWA 1V6HA 4ED0A 2LXIA 1RT2B 1NO8A 3R5CA 5K9FA 4DBQA 4DV1F 3PVXA 3SSQA 3OVSA 2WTFA 2OFHX 4QYZJ 1VC0A 1UFWA 3IAM9 5F9NA 2VPZB 2HS3A 1OSDA 2DGTA 4NA1A 2UUCF 2KRRA 4JUZA 1VC6A 3FDSA 1N48A 4QWBA 4HI2A 4CO0A 4H4KA 2ERRA 4X4TA 3UCUP 4UUXA 1X4BA 2V5HG 1HBMB 4X4PA 4Q43A 2POKA 3KWMA 4OZNA 3P96A 4LSLB 4LSLA 4GC7A 1FESA 1PILA 4UY8T 2G0CA 3A1YG 4URQU 4TU7A 2C42A 3D54A 2FVRA 1JKHB 1JKHA 4ZCIA 3MCSA 3PW7A 4EO6A 2YKMB 2GHVC 2YKMA 1R27B 4WZQA 1X9SA 2RVJA 4KT0C 1BY9A 2J8AA 4C3KA 4NLGA 1B0PA 5J2MB 5J2MA 3J7ZT 1OWXA 3N79A 4Y2MA 5A2QY 3X1LB 3MOJB 4EZ9A 4ECZA 4UY85 2O3DA 4J9PA 5I3PA 3CCES 1EP4B 1EP4A 3T1HF 2ZH7A 5IZHA 1H2VZ 4A8FA 1DLOB 3LWMA 3OFEA 3E2EA 1TKTB 1TKTA 1HFEL 3SV3A 1XN9A 4KIAA 1F60B 2JZ5A 3CCRS 5CZVA 4H4MB 4H4MA 5T7LB 2CQ4A 1FKAF 4Z2XA 1TL1B 2QA2A 5B09A 2KFNA 4ECVA 2ZNZA 3VR1A 1C4AA 3DRSA 4I2PB 4I2PA 4ED2A 3J7Z5 1IBMF 2AU0A 1T8EA 4DFMA 2NUUG 3MMBB 3SI8A 4PXCA 1NKCA 1G7CB 2J9EA 3ENQA 4F67A 4FVCA 1ELOA 3T9NA 3VQSA 2JX2A 3L7PA 4C0BA 1M5OC 3HM9A 1U1QA 3NCPA 2R2SA 1HWLA 3TYTA 1N56A 2RU9A 4YMEA 1D9DA 5IM0B 5IM0A 1FKPB 1FKPA 3CCJS 4N8OA 3X3UA 5EDWA 5FJ4A 2MSSA 1QAJA 3FMWA 4ZK7M 2JOQA 5G0RB 5G0RA 3T1YF 3R1LA 4USHA 4TN2A 1Z1ZA 4YHHF 4ATNA 2XHWA 2IBKA 1URRA 2I2YA 2IA0A 1VRTB 1VRTA 2ZH5A 3G6XA 1O5JA 1RA6A 4WK3A 4DHVA 4U7UK 3IN5A 3JYTB 3JYTA 2ZJPQ 3UW1A 5LT5A 1K1QA 1LWEA 2CFXA 4RNNA 4A8MP 5B7WA 2D74B 1S79A 3DLEB 1VJWA 3DLEA 1UWBB 1UWBA 2VOOA 1Q81T 4DSIA 3CTRA 2HHHF 5D4PA 2RS2A 1TQLA 2J9DE 5KFUA 1BQMB 1BQMA 3PM9A 5KFDA 2ZM6F 2KN4A 3LW5C 4LVOP 3Q2SC 2F8MA 4M63A 2GW8A 3CC2S 3RB3A 1X7VA 5L1KA 5HL7Q 5J2PB 5J2PA 2DHXA 3RAMA 1V3ZA 1RT7A 2WAQD 3IWNC 3GWCA 1VQ9S 5HROA 2O66A 3QGHA 1Q7LB 2BQ3A 2MKCA 3KMQA 2KXNB 2HHXA 4E98A 3S1TA 3UCGA 1C2PA 2IAJB 2IAJA 3VALA 3T1AA 3H4BA 4DQPA 2J7WA 4J9KA 5H1SV 1U48A 1WF2A 1S1WA 2WSFC 2BDPA 4G1PA 4OIXA 1B0VA 3H40A 3KK1B 3DI6B 2DISA 5BYSA 3O2IA 4ZP9A 1IR0A 3DMJB 2VD3A 5KFLA 1FK9B 1FK9A 2F9JA 3IWXA 2NPFA 5KFYA 4J9LA 4RWWA 2UVRA 1C0UB 1C0UA 5F0UA 2JL9A 3L3CA 3Q23A 1ZBTA 4LUBA 4YP3A 1U1PA 1LWCB 3TAPA 4EYHB 2JEGA 1QSLA 1WEZA 5LSOA 2GQ2A 3PHEA 2W8LA 2ZJRQ 3MHYA 2HGLA 2JFDA 4XPCA 5SZTA 4F8RA 2ZD1B 4M94A 2DNGA 3IAS9 2R8KA 4OI0A 1FVSA 2HHVA 2ZE2A 3THPA 5KOWA 2ROGA 2DIUA 3HF5A 5HO4A 1FXDA 3BQ0A 4WCEQ 3RTVA 4RNHA 1UA0A 3ZZUA 4EFAC 4HEA9 5F8IA 4XO0A 1T02A 1W2BR 3ZFVA 1VK3A 2R7QA 2JH3A 3HJFA 3TA1A 1RT6A 2VZ9A 1IUJA 2V8HA 4ECYA 5J1EB 5J1EA 2YX1A 1IM4A 5KAKA 4WFAQ 2PA8D 4B02A 4U67Q 3F41A 3OTDA 2UV8G 2C3PA 2W8KA 4ED5A 5F0WA 1WF1A 3CEDA 4DX8H 1S9GB 3I87A 2APOA 2QSFA 3KKFA 2KXHA 4PQUB 3NMAA 1GTHA 2PD1A 2RUGA 2M7SA 1JJHA 4F25A 5L8RC 3BN4A 3QLHB 3FEZA 3CUNA 4IQXA 1RTIB 1UJ6A 3TA2A 2AJ1A 1KQKA 1TKZB 1TKZA 2M4MA 3UDCA 5HMYA 2W9CB 4DFPA 1T94A 3PRBA 4A8WA 3V6DB 3V6DA 3P6YC 3N9UC 2XCAA 1ROFA 2Z8QA 3M2RB 2RILA 3M2RA 4IOAQ 1HA1A 3THVA 2I1RA 4ETZA 2PSZA 3PJWA 4KKOB 4KKOA 5AXNA 4X4OA 2QO3A 2ZOGA 2R7WA 5LSRA 3O5TB 2M8HA 1JNZB 2B6AA 2R7UA 2CPXA 1KOOA 3BS9A 4AYBD 2AJQA 1X5SA 3AB4B 2HFNA 1ZAWA 2AYMA 3NRBA 2VA3A 2E5HA 2H5EA 4CH0S 5JVHQ 2R8HA 5L9NA 1HPZB 1HPZA 2KO1A 2E9RX 3QIPB 3QIPA 2UVVA 1NJZA 3FNNA 1RTDB 3OHAA 3H2UB 1NKEA 2H9ZA 1RTDA 2CPIA 2Q6CA 4K4VA 4FN5A 5KT3A 1B7FA 3BQ2A 5B0DA 2K7JA 4G1QB 4G1QA 3VZHA 3I31A 3MUTP 1DZ5A 1QTMA 2EG2A 3TNVA 3V4MA 4YR2A 4HTIA 3D1OA 4IQMA 2E1RA 2B9XA 3NS5A 1FNXH 1GX5A 5BYQA 3TAQA 5E3QA 5GAHI 1FE0A 3GIMA 1IXKA 4NLXA 3FVYA 3PFEA 1YQHA 2JRSA 1RQ0A 2VFTA 3MM7A 4EEYA 2B7BB 3OVBA 1ZM2A 2DCLA 2XCPA 3MD3A 4TQSA 1VQ8S 2EC0A 3IR5B 2KU7A 5G4DA 2CQPA 2VB6A 4R0JA 2UUAF 2GJIA 4F3MA 2P6TA 3OLBA 3V6HA 1FERA 3JSMA 4IUFA 1R8AA 2ZITA 4I56A 4HH1A 2VFUA 3AY0A 1H6KX 2QMWA 2X51A 2V94A 4RW9B 4RW9A 2BE2B 2BE2A 2FJVA 3K8VA 3M8PB 1JXEA 1AUDA 1CVJA 1SJQA 2JSXA 3NAHA 1NB7A 3K58A 2XBPA 4GO5X 2XS2A 1SKSA 4OZLA 1FO1A 1S9EB 1S9EA 1NAQA 5HN0A 1FEHA 2VG6A 3LH2S 2DHAA 1S0VA 3EXYA 4Q0BB 4Q0BA 1Z2LA 3TX8A 2CZVC 1JLCB 1MROB 2AJFE 2GFFA 1MROA 4RBVA 1KQFB 1CG2A 3DHXA 5JVGQ 3SQGB 3BB5A 3SQGA 1Y3KA 5DG9A 2HNDB 2HNDA 4K5SA 4O0IA 1FNOA 4B3RF 3CC7S 2N7YA 3C66A 3CCWA 4HI1A 4OV1A 1TFWA 2UVUA 1X9MA 2XMKA 1N0UA 4O4RA 5T41A 4F3OA 3IBWA 2QZ8A 3HXMA 1FT8A 2E1CA 4KC5A 1RKJA 4D3GA 2C3OA 3Q8RB 1VQNS 2MHNA 1S6UA 2WBRA 1S0MA 2MQNA 4R25A 1T05B 1T05A 5IT0A 1Q4RA 4OMFG 2XMUA 3OR2B 3OR2A 4ZPTR 5EWEA 2N4DA 4DSEA 2PDAA 2KXFA 5SUHA 1MMLA 4I69A 5KFWA 3KLHA 2AGPA 2BUNA 2KZZA 2OPQB 3CPWR 2IHR1 2D41A 3I56S 5DS7A 4MYTA 4DJBA 5I3UB 3GV8B 5I3UA 2K1RB 2K1RA 3EZUA 1D8YA 4C8ZA 5DQHA 3S8SA 2XO7A 1VRUB 1VRUA 3NP5A 5KFVA 4Q44A 2HIQA 3IRXB 3IRXA 4A8OA 2BZ2A 4WE1B 4WE1A 4AL7A 2NQPA 1JB0C 4X4UA 1DJ0A 2MSTA 2DGWA 4NPOA 2B0GA 1X5OA 2CG4A 2ILYA 4OZ0A 1YRTA 5M2PA 4DF4A 4LFCF 3GFYA 3NNHA 2WBMA 3MGJA 1WHVA 4KAIA 1P6TA 4JI3F 2HMIB 2HMIA 3K5MA 4X4VA 4ZPDA 4DV7F 4DV2F 2XI2A 4I6YA 1REVB 5D77A 1HNZF 2NS1B 3UD3P 2JLGA 2VG5B 2VG5A 2DVIA 2F9DA 2ASJA 2AGOA 3IR7B 3D2WA 2RDJA 1NRKA 3GFZA 2MY8A 2XMWA 2C3MA 2KHDA 1YJRA 2DRAA 5B08A 1ZM9A 1NK0A 3M6WA 2L08A 1S6QA 1Y3JA 4Y2AA 2EBEA 4UQGA 2N4CA 4NL5A 1HMVB 1HMVA 2DO4A 2KJVA 3BGFA 4P7TA 1VFJA 3PX4A 4WFZA 2PC6A 5FDLA 2VKRA 5F8HA 2DH8A 3RB0A 1TAQA 2DH7A 1QJHA 5D4NA 3TW0A 1SJ1A 5LSLA 3I5BA 1LW2B 1LW2A 4O3PA 4RU2A 4MYUA 3J7YI 4KFBB 4KFBA 2FJXA 5D4OA 4X66F 2HHUA 2DNQA 3NBPB 1MU2B 1WACA 2LCWA 4LF8F 1VQ6S 4BCAA 3MFHA 3I9V9 2BRLA 1WI8A 2YNIB 2YNIA 2R9LA 4C11A 1XBWA 5IQ6A 3UE2A 2IRXA 1U8SA 1S6PB 1IKXB 1S6PA 2QA1A 4TKTA 2MKKA 4K50A 3MZIA 4F4ZA 1JLAB 1JLAA 3BZQA 4TXSA 3V5RA 2JVRA 2OO4A 4ZLPA 4B3MF 4QWDA 3MM9B 3MM9A 2W9BB 4CCHA 3HO1A 2GA7A 3HHLC 1M5VC 2IM0A 1WHXA 3H59A 2XNRA 4PG6A 1DBDA 3HI9A 1NZAA 3MEDA 3DYAB 3DYAA 4PQAA 5K8OA 3KJVB 3KJVA 3FEXB 1WELA 1U26A 3O6QA 5KG0A 3VAGA 3DRYA 2RQCA 3H5YA 4KQZA 5A8KB 4N41A 2M2BA 2BOPA 3J81Y 1XMQF 4J9NA 1VQ4S 1QM9A 1YJ9S 1BQNB 1KFSA 1Y0HA 4K4SA 3E3XA 4QW9A 1VIOA 1APSA 4RBUA 4FXVA 2E7XA 1VC5A 1R43A 5J2NB 4DN0A 5J2NA 2FY1A 3KOAA 4DFKA 4ILLA 5IT9Y 3VCDA 2V8DA 3DNCA 1UETA 4A47A 1KR4A 2N3LA 4RNOA 4I1TA 5HMWA 2CVIA 2RRAA 2Q66A 3OHBA 3I0SB 4DLEA 3TVYA 3OTCA 3MMCB 4WXOA 3K5OA 4EBDA 1RKIA 1AFIA 2EVZA 5C24B 1BQXA 5C24A 1XR5A 4X4QA 3GYXB 3SV4A 3AAWB 1TKDA 3CJ0A 3SZ2A 2DGQA 3GR1A 3HPOA 1H2TZ 2MQMA 2WB1D