2I9SA

The solution structure of the core of mesoderm development (mesd).
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
GPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mesoderm development candidate 2
publication title The solution structure of the core of mesoderm development (MESD), a chaperone for members of the LDLR-family
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i9sA00
2ZHOA 2P9CA 5IT4A 2FGCA 3IXQA 2QMWA 3LOUA 5IT0A 1XTZA 1YGYA 2LQJA 5IS2A 2P9EA 4PWUA 2RE1A 5JJBA 4LUBA 3OBIA 2KO1A 1SC6A 3OFFA 3AB4B 2JOQA 2DTJA 1O8BA 2I9SA 2MDAA 3LUYA 2F8MA 3CEDA 4M8LA 3TUZC 5FIIA 4IO1A 4NMLA 3KWMA 3W7BA 1LKZA 2PC6A 2J0WA 3OFGA 4GMKA 1YBAA 4GO7X 1Y7PA 3DHWC 3OFHA 3ENQA 2DT9A 5T41A 1UJ5A 3MAHA 2JHEA 1LK7A 2P9GA 2RQMA 2F1FA 2QMXA 3ENVA 1PSDA 3L7OA 2PA3A 1U8SA 3ENWA 3DC2A 4X84A 1RWUA 3OFEA 3IBWA 3NRBA 2QRRA 3DHXA 3N0VA 1KS2A 1ZPVA 2NYIA 2CDQA 3MTJA 2LVWA 2QSWA 3TUJC 3P96A 3DDNA 4GO5X 3AAWB 2J0XA 3O1LA 3TUIC 3S1TA 1UJ6A 2H9ZA 3HHEA 3MWBA 3UW1A 1LK5A 3K5PA 3U7JA 3AB2B 1UJ4A 2RQKA 1M0SA
chains in the Genus database with same CATH superfamily
4Q5VA 5HP1B 5IT4A 2OUGA 2HGMA 4QR0A 3KKFA 1CJUA 6AT1B 3NY0A 4PABA 3H2UB 1VBXA 2DXDA 2HNZB 4X4OA 4OJHA 3CD6S 4XIUA 2H4WB 2BUNA 2DTJA 1HWUA 2DNPA 4QWDA 1P8GA 3MEGA 4OJ3A 2DH9A 4CO4A 4LF1A 2J9DA 2AJ2A 5AJ3F 2XGPA 3VV2B 3DRPA 5HQLA 2DYAA 2CJBA 3OJUA 4X64J 2CPYA 2R8KA 4NCAA 4NXMF 1D1UA 3HSDA 5KFUA 4OLOA 2V5HG 3OTBA 2W8KA 3D5MA 2GGPB 2HRUA 1XMOJ 2XY7A 4K7QA 2WVDA 2K8GA 3NWRA 2UXBJ 1RHMB 4DOZA 2UUCF 1RTZA 3BJYA 2XMMA 2KDOA 3C66A 1S0OA 2YNFB 1X4CA 2OD6A 2PT0A 2UVWA 2YQ3A 1N33J 3HKWA 4DV2F 4B9NA 2BJ1A 2RQKA 4DV6J 1FRHA 2JL9A 1CJTB 3CDWA 5IT0A 3H2VE 2GMLA 4HVZA 2OAUA 3IR6B 2IJFA 1IKVA 4HR2A 2RAQA 2PMZD 5KFYA 4CLLA 5DJBA 3NG8A 4DR4F 3MEEB 1REVA 3P8BB 4UY85 4WXWA 5HSPA 1O0PA 5GAGI 3DLBA 1VQMS 3C6TB 4KIAA 2AJ4A 1RAGB 2XI2A 2IDLA 4PYAA 4LFBF 2VV5A 3MPYA 3RAMA 2AU0A 2VZ9A 1J5EF 3IC1A 3G8TA 1TL5A 4NA3A 1T3NA 1BC6A 4YDXA 1S0VA 1FE4A 2E9RX 2WOMA 4I7FA 3RB3A 1CQMA 2IMWP 4HHJA 4QU6A 1VR6A 2QT7A 2XO7A 4LF4F 3M6VA 1I94F 2UVRA 5IT9U 1RWMB 3MCOA 3UCUP 3FZ2A 4CTAB 4ANDA 2GJIA 3HD2A 1S6PA 3ILLA 3DU6A 3GP9A 1RYRA 1N34J 3QRQA 3DM2B 1YITS 2CNLB 4ED2A 1WC3A 5J2QB 2MPUA 4X2BA 5I3UB 4UOHA 2KYXA 3DDKA 2CJ9A 1X8DA 5CH7B 2IC3B 2R7VA 3CF5Q 2I9SA 4A8WA 4PUOA 2Y8YA 4QR2A 1ZS6A 1C1BA 4DDFA 4K4XA 4QYRA 2O66A 2G1HA 1FJGJ 2B4PA 1N88A 1DY3A 1JX4A 1L3TA 4DUTA 1G6BA 3MMCA 3LPEA 2AHOB 5D3GB 2EFOA 3H2LA 4DPOA 2YKNB 2YY3A 5KFXA 4B3TF 4KHRA 4ZP6A 1Y11A 2W7AA 4RUCA 1RBLA 3KLIA 4Q2MA 1SQEA 3OR1B 3TOQA 5GAHI 3ZXWA 3AODA 4OX7A 3KLFA 4Q0BA 1S1WA 2WB4A 5L1IA 2ZH6A 3EVWA 1SH2A 4ETXA 3M32B 1M5OC 1HI8A 3R9LA 4GKKJ 2V8HA 1L3UA 3BGRB 5DQHA 5JMNA 2D9PA 1VRUA 4FYWB 3UDVA 4G1QB 3S8SA 4MJKA 3KMSA 1VQYA 4RNFA 1RKJA 4BBYA 2L9NA 4WFBQ 1NH7A 4EBEA 4NXMJ 3TX8A 4ITSA 1NPRA 4ZITA 3HHLD 4DV0F 3N9UC 4ZPWR 2YPZA 3TWZA 1SL1A 1MU2B 2DCUB 6FD1A 2UUCJ 2IJNA 3GIMA 3BSNA 3ENVA 5J1EB 3ENWA 1ZTWA 3UFCX 5E3PA 5JVGQ 3KLGB 2CXEA 1EKSA 4DI6A 3HHLA 2R2RA 4KH0B 1D9DA 1C0UA 3JQJA 4NLYA 3MUTP 1PBUA 5HMYA 4LSNB 1NJXA 4KYZA 2MZJA 4O3QA 1T9VA 1GMUA 4OQJA 2U1AA 5LXYA 1TL1B 1RT7B 3I9V9 3T1YF 2CDRB 1LWCB 3SXLA 4PG4A 1BQNB 4I68A 2QLFB 2X1BA 2W4PA 4CI0B 3BM7A 3AJ1A 1SIZA 1R8PA 4P7VA 5EDWA 4LFBJ 4DUYF 1QDUB 3A8KA 1URRA 2ZD1B 3NCPA 3KLHB 5J1PA 2E5IA 2YBVA 4DQRA 2BV3A 4DL4A 2DGWA 5LSOA 2LEAA 1S1XB 3UDLA 1FKOA 4KE5A 4B9LA 1L3KA 2IRYA 4LF4J 1I94J 1YQHA 1VC0A 1WSVA 3UNGC 4X4PA 4DQPA 2J9DE 3BDPA 1CSJA 4W98A 1RHUB 2K7KA 3OT9A 2GAHC 3DHXA 1R0AA 4DL5A 3KUHA 1HLWA 4JOUA 4NMXA 3FRZA 3FSYA 4MKYA 3W9IA 4DCPB 4S0MA 3UW1A 3QBCA 3ISND 1TL3B 5KFKA 2HURA 2HMIA 5IC6B 4WJBA 3BQ1A 2GVDB 3U1LA 3CCSS 3V6DA 4LR7A 1CEZA 3UWTA 2O01C 2HG4A 3KXDA 1NU4A 4DJBA 1YRTA 1MNEA 4YB7A 2HRTA 4ZIVA 1QUPA 4B3SJ 3OPKA 2D3O1 3THPA 3E51A 1MG7A 3CULA 1TKTB 2R7TA 1NK6A 3NS7B 2YNFA 2R4FA 4NRTA 3M1VB 4CH1A 2H51B 4PG7A 2E66A 1Z1ZA 3VAFA 1P1LA 2HGNA 1RJJA 2VBXA 1X9MA 4RBVA 1T95A 1T7PA 2H3EB 3MCSA 1QTMA 2A0FB 3KFWX 4OV6A 2DR7A 2MJUA 2XNQA 2D41A 2YKPA 3WC2A 2KYZA 1DZ5A 2I8EA 2NYIA 4DPYA 3QFHA 1S77D 1KRPA 2FJBB 5LJ5Y 1VGYA 3S1TA 3H5YA 3CMAS 1JLEA 5CAAA 1Y5IB 2HQGA 2ASLA 4RX6A 2CQCA 2V9KA 3C6TA 4AE5A 3WBZA 4DV0J 1U0HB 1U1RA 2E1MC 2A6OA 3KG1A 4JV2A 4UOGA 4H4KA 3N5BA 2UU9J 3AD8C 3HO1A 1F0XA 2FD2A 2NR0A 1XNQF 4JI6F 4K50A 2VH7A 1H2TZ 3DOKB 3V4IA 1RTHB 4ID5A 4JYAF 5EGYA 3H98A 2HS0A 1FRLA 1ACMB 3EE3A 2EKYA 1FX4A 4MTPA 1HWLA 1G1XA 5J2PB 4DPXA 3C14A 2HFOA 4QU7A 2J9EA 2K1RA 3RBXA 2PN6A 1IQTA 1FFSB 8AT1B 5J2QA 1JLQA 3MMBB 4PPDA 2HVIA 2W2MP 3PJWA 2AD9A 1WG5A 4PQUA 3FVYA 2DHAA 3ZZPA 1K0TA 1RTJA 4LFAF 2P8IA 1HR0F 1GTEA 2FC9A 1VBKA 1S1VB 3BSAA 1OJ4A 5KFMA 3BGUA 3MWBA 4R5PB 2AJFE 4DUYJ 9RUBA 4JI1J 1EKRA 2FGCA 1YZ7A 2HQFA 1RSCA 3T5KA 2BX6A 3IWLA 3DRSA 1RWPB 2NZCA 3EVOA 3MOZA 4LUBA 2W4DA 2B4VA 1BWEA 4DSJA 3UN5A 3K7RA 1TK0A 5IV3A 1UCNA 2VBWA 1KOHA 2CQ1A 4PXEA 1HNWF 1KLMB 3FFIB 3M4XA 4YR2A 3FEZA 2AIRB 5T7LA 3TEGA 3M32A 2EFQA 1ZETA 2CAJA 5GMKa 4USHA 4WYWA 2G2YA 4WYLA 4QIFA 3FMWA 3FEXB 4K4UA 4F3MA 3KG0A 2HVEA 3HPOA 2BE2A 2KRBA 1YX2A 1SL2A 4ZVGA 4AL7A 2J6SA 2QA1A 4F2RA 1TR0A 4YDDB 1WORA 2MGZA 4ECXA 2LKZA 1WI6A 3R6LB 4PPZA 4DSKA 1RADB 1ZA2B 1U2RA 4DR2F 2E9TA 3IBFB 4V19J 3LW5C 2V8GA 2Y3YA 3CDBA 3OL8A 5F0UA 2DHXA 4DU8A 1UWBB 1MWYA 2VQEF 4NLVA 1S9EA 2W8LA 2B4UA 2ZHAA 2EC2A 1IWAA 2DITA 3PW2A 1EQ0A 2D7SA 1YG0A 1RT1A 3X1LB 3E3XA 1TVRB 2QV6A 4USIA 2AKWB 4C2MA 2A6MA 3M9MB 4M63A 3LF0A 4K4YA 1KHWA 4DV4F 2U2FA 3TANA 2LXFA 3JXOA 1LWCA 5CD4H 4LIWA 4FBUA 1T9YA 2KG1A 2YKQA 3FRYA 4Y3CA 3UDCA 1WC1A 5F8GA 4OZ0A 4N41A 3TUJC 2YWFA 1PBAA 4X4SA 4KHPJ 2XYHB 1XNQJ 3H90A 3PIPQ 3NNAA 3TP2A 2XEXA 3RG6A 2AEJA 5AE3A 4EBCA 3OVSA 4JI7F 3H4DA 2M70A 3HF5A 3CJKA 3LP2A 3K5MA 3H59A 3MXHP 3MAAB 2ADCA 5IOLA 4USKA 2L08A 2EK6A 2XMWA 3BBBA 2KVQE 5A6PA 2KVIA 3RAQA 1VHIA 1U1KA 2F40A 3MCNA 1DTQA 1KQFB 4UT4A 3CB4A 1V3RA 4XTTA 1GMWD 3ISZA 3T1HJ 4C3KA 2W7OA 3P45B 4LFAJ 1HR0J 3D6TB 1HHQA 1UP1A 1U0SA 4USTA 2ROEA 4KO0A 1RWOB 1PYTA 5A8RB 7FD1A 3CJ3A 5KFLA 1P9QC 1M1HA 1PG5B 4CO1A 1CC7A 3IR7B 3PO5A 2UUTA 3HT3A 4YN3B 1AXQA 5CQGA 2JLEA 1LV5A 2ERRA 3U7JA 1HI1A 2HPUA 4P10A 1SL0A 3BV8A 3I9ZA 1HBNA 3UD4P 3V81B 1NSPA 2Q6CA 3PY8A 1NK8A 2QEXS 4AYBD 2M4MA 3M2RB 4IG3B 2ZH4A 3BF4A 1JLFA 1CULB 3K59A 3AD7C 4ANCA 2KI2A 2RSQA 1FDDA 1RT4A 1SKUB 3M8PB 2B8QA 2XSJB 2CG4A 2F9DA 2W24A 3A3PB 2B56A 2YVSA 2HZAA 1RACB 3U27A 2N4DA 5E3RA 4OYIA 2AV5A 4DR2J 2XS5A 2H1YA 3Q8YA 3UI3A 3ZNJ1 4YR0A 4O0IA 3R2DJ 2KJWA 1VK3A 2BMBA 2MKKA 1L5UA 4CT8A 3DOKA 1S12A 2EBEA 1PYSB 4LREA 4C8YA 4MFBB 3JS9A 3AJ2A 1EZZB 2KT3A 1QSYA 3R5BA 2RS8A 3SV3A 1YZ6A 2HWHA 1KVJA 2KJVA 2B5JB 2QMWA 3CE8A 3RW7A 3PZPA 2HK3A 1HL6A 4CYUB 4C9DA 2RNEA 2CVIA 1SJRA 4CIOA 1WC0A 2XS2A 1EHWA 1QLNA 3HVAA 1Q86T 1S0MA 4DSLA 4GMKA 4KGKA 2V63A 4YS2A 3ITHB 1LFPA 1G3OA 3CCJS 1ULRA 2IIHA 5KT6A 4P73A 3TZYA 1K1QA 2MKCA 2ZBCA 2OFGX 1QTNB 5KFHA 1IVZA 1RT5A 3PHEA 3MPWA 4OZ1A 2Z30B 2R7SA 1N4LA 1KD1T 5H9FJ 2QMUB 2BRKA 3G6ES 2HFZA 3D1HA 1S48A 2DNQA 4KY3A 2E9ZA 4USWA 2GMJA 3LO3A 1JNRB 2GVZB 2HFUA 1Q78A 2YKMB 2GJ2A 1B99A 3I4HX 4WE1A 2JEFA 3AQOA 4M5GA 3D7SB 2JNJA 1DTTA 2L3MA 3GIKA 4F0HA 2NREA 3A8EA 3NCRA 2LQJA 5AE1A 4U67Q 1B7FA 2HIQA 5BYQA 1DLOA 1OQ3A 1UTAA 1IBMF 5B0DA 5HJYA 2JZ5A 3R7BB 2KO1A 3H0PA 2JEGA 4WFNQ 1LWEB 2JVRA 4WIIA 5GMEA 1XR5A 5DDPC 2RF2B 4DV3F 1HQEB 4QJVA 4TN2A 5EX0A 2JEIA 1XR6A 1S6OA 5KG3A 2ZVIA 1H6KX 3FCVA 4RBUA 2OEKA 2ZE2B 1F2HA 1Q7YT 5EWEA 3GQCA 3C8YA 1HNXF 3MEDB 3HM9A 3SQGA 3V5RA 4PG5A 3A1YG 4GKJJ 1LFWA 1F5BA 4J37A 1N6QB 1Q16B 2VPZB 3GJTB 3VAKA 2E1CA 4DFJA 4RBTA 3DMJA 4NYZA 2NZ4A 4NLGA 1FWPA 4ELTA 3NGTA 4ZOSA 1VQ6S 2W9CA 3KJQB 2EFGA 3PEHA 5HVGA 5IT9Y 2HFNA 2UV8A 4UW2A 3OW2R 1R89A 2CRLA 4RL1A 2C42A 4DSEA 2OGUA 3TA1A 1U1MA 1FESA 4ECVA 2G13A 1FDBA 2VPYB 4NLWA 3EDQB 3UQSA 4URQU 3M8RA 2PMWA 3LP0A 4A48A 2KHDA 4OIXA 4LSLA 1A9NB 3QJJA 1HWIA 4QW8A 3WHIA 5E5NA 1RHJB 4PXCA 1FT8A 2RRBA 1HNZJ 5LXRA 4JI8J 3PXGa 3L9ZA 3D0HE 3ELHA 1FNMA 1IKXB 4IRCA 4PAAA 3D6HB 5HI7A 3CJ8A 2O1PA 2EPIA 3MAAA 3MFHA 5ITHA 2K06A 4XDDA 3H25A 5ADZA 3IM8A 1S5ZA 4B3MF 3DLEB 3DDIA 2LXUA 1LW2A 3C15B 1NZAA 2Z0GA 2V9WA 2AEMA 4KR0B 4F04B 1JJHA 2CWXA 3RBEA 2WVEA 1C0TA 1UVNA 3FBFA 2DB1A 1SJQA 4HTIA 4PRFA 5A8KA 2FVRA 2GQCA 4CLPA 5B7WA 3N4WA 1RTIB 3G71S 4ZPVR 3Q0AA 5K9FA 2W2QP 2ZBQA 2PEBA 1KC8T 3SSQA 1KLNA 3E01A 3K2YA 5HJXA 4P52A 1WG1A 2CPIA 3M8QB 2OKQA 2KFNA 3HD1A 5B0GA 5B0CA 3PM9A 2PGCA 2ZITA 4RUBA 4ECWA 4ZMMA 1UL3A 4OI3A 2DR9A 5I42B 2BJ3A 2CPFA 5M2RA 1FF2A 1RT6A 3A3NB 1E6YA 4YP3A 1X4AA 1K47A 1RA6A 3NAIA 2GO9A 4USVA 2QGFB 1R31A 1RAJA 3HVWA 4EI2A 4OX9F 3TEHB 4DSFA 4IDKA 1N36F 5IQ6A 1T02A 2A18A 4OFZA 1VLOA 4NPOA 4ECYA 2E5JA 3FNNA 1FJEB 2UXCF 2POKA 4DV3J 2UXDJ 2XQCA 1Z2ZA 4WU3A 1HWKA 3MPUB 3F44A 2R3VA 2UUWA 4XAKA 2GQ2A 2GX8A 1S1TB 3GJQB 1VS3A 5KFPA 4C4WA 2WZ1A 7AT1B 1O6XA 2VIHA 2GIFA 5A8WA 4WCEQ 3MM6A 2J0WA 2B0GA 1WF0A 1VQOS 1Y7PA 5F41A 3QRRA 1SC1B 3FQLA 5L9NA 4MFBA 3CCTA 1S1UB 2MZRA 2VG6B 2MQ8A 5I4MA 3PX4A 5IQQA 3BO2A 3AH6A 4NZ7A 3Q83A 2RUSA 4WK3A 4CLSA 4X84A 2QA4S 1UEKA 3BKTA 4N8NA 3RYLA 4P74A 4ER8A 2QRRA 4MYTA 1FXRA 5CYMB 3HHKA 2GAGC 2Q66A 3V6HA 3B8HA 4RNOA 2BKOA 2QL9B 3MM7B 4ATNA 3W61A 1JIHA 2BJ9A 2AJQA 2F5GA 1KVKA 3I5CA 2VHGA 1M1KT 1RTDB 1TKZA 4OHXA 2NYHA 1EIYB 3M30A 3BO4A 4JI4F 4ZA1A 3FEYB 2AYBA 1BQMA 2I5JA 4ZPAA 2DT9A 2BM1A 3A3OB 2FIUA 3D0IE 1KONA 1TTHB 4CLYA 1TV6A 2FHMA 5DDRC 4NXNF 1DBDA 2JWNA 2CPDA 2DJWA 4B3MJ 3VTIA 3AXMA 3WX8A 4PWDB 1DJ0A 3DI6B 1F60B 3H5UA 1ZH5A 2KFYA 4MKVA 2CDQA 3DN9A 4M5KA 3CCLS 2SXLA 1LWEA 1NO8A 4LQ3A 4V19X 3GV8B 5SZTA 1CJVB 2UUAF 3MPDA 3BEGB 3MTKA 3AHPA 4PXBA 4ID8A 1U02A 3VZIA 2LCWA 1N5QA 5HLFA 3FKBA 1R8AA 1KP6A 5KFFA 3L4BC 2ROPA 2LFVA 3R5CA 2V6AA 4I56A 3GONA 2RDIA 4BCAA 2JX2A 1TUVA 1N6QA 3OFGA 2IM3A 3NNHA 2R2TA 5LMNJ 3G8QA 2FC8A 3ZZOA 3NBPB 1T03B 1HYSB 2C3PA 1FKAF 1FERA 4OZJA 2FB0A 2ZFHA 1UFKA 3ZTRA 5F3ZA 1WDDA 2C3UA 1N36J 2HWTA 3M2VB 2UXCJ 2XB2D 3J81j 4N8OA 1PKUA 4Q2LA 4RW7B 4ED3A 3T5LA 4ZVEA 1F9FA 4C6AA 3KLVA 4DFKA 2XULA 3T6BA 4WFXA 2LXIA 3H8YA 2L41A 3QFWA 5J2NB 4O23A 1M5PC 4LF2A 5FLXU 1XNRJ 4GRSA 2JVOA 5LSLA 1E6VB 2CQ2A 1UFLA 5KFOA 1NHUA 4H4MA 4L73A 3TAPA 1JLBB 1H7WA 4X4TA 1YJUA 3HVRA 1S4FA 4M5HA 2FY1A 4UY8T 2OD4A 3PX6A 2CZ4A 1H2UX 2W9AA 4BS2A 4ECUA 5CA5A 1PAEX 1R0CB 1Y4ZB 3OFHA 3GPAA 3IS9A 4RW8A 4LR9A 3DLEA 4NCGB 3RRGA 2HIYA 2C2OB 3LANA 3ZNUA 3C15A 5J2MB 1NKCA 3GG0A 4J7CA 5KT5A 2NQPA 3HHLC 4L75A 3VGSA 1URNA 2YNHB 1KQGB 4DV1J 1LW0B 1U1LA 4X62F 3EVMA 2X51A 4ED5A 3D4JA 2CQBA 2VDIA 2IJRA 3VF0B 5EN1A 1JXLA 1TFYA 3BKFA 4TLQA 3BS9A 1SUQB 4I6WA 3OXLA 4KAIA 3KJFB 3W64A 4C8LA 3G8SA 2E29A 1YJTA 1YBUA 2ZC4A 1WELA 3J80U 5KFGA 5HANA 3ILIA 1PYOB 3WZ0A 3GJSB 4OI2A 1HWJA 4HDHA 1XIQA 1RWKB 1GXTA 2A2CA 2V4JB 4CWBA 4OV1A 1ZZNA 4F4WA 3U1NA 4YHHJ 5DGAA 4TYAA 1Y9OA 1B3TA 2C2NA 3QGHA 2LDYA 2XMJA 3I0RB 3NL0A 3G2XA 3UVJA 3CCES 5D4NA 2YKOA 1S76D 1NPPA 4K8RA 1APSA 3TNVA 2HQDA 3OTOF 3T1AA 1OY9A 4DL3A 1UZDA 5DLFA 3FGVA 1X4HA 1S1TA 1FDAA 2DGVA 2KXNB 4H54A 2ZJPQ 3DDNA 1N5VA 3X3UA 2FTRA 5D0EA 3SCLE 3MMJA 1ZBTA 1CS4B 4P2SA 3PO4A 5KAKA 1Q8KA 3CCUS 4HACA 2FHKA 2HZCA 1X4FA 4A8KA 4Y2AA 2V8PA 3IP0A 1U7LA 3IAS9 2JOQA 1YJ7A 5LMUF 3ET6B 2F8MA 4CLUA 2B8PA 4LRDA 5D78A 1D9FA 1S9GA 1XR7A 3OXGA 1C1CA 1RAIB 2WONA 1YLXA 3C6UA 1HNVA 2NSBA 4U95A 1OMSA 1Q5YA 4F3QA 2C3YA 4BDPA 2HHWA 3W62A 1U6BA 2J8AA 5C42B 1NCLA 2W9BA 2E1RA 3MM7A 4MIAA 3GIJA 3CJRA 2WK4A 2CZ9A 2YH0A 4ALZA 4WU2A 3PX0A 1SI9A 3AD9C 2RD5C 2AGPA 2XWYA 2CQ3A 1Q8LA 3LWLA 1KEKA 3CDEA 4KPYA 3P3DA 4RNNA 2ZNYA 1KWMA 1ZYQA 4NEZA 4FN5A 2BR0A 4ZCMA 2IAJA 4ELUA 4LMZA 5G0RB 4TQRA 2EC0A 4JP8A 3THVA 4CP5A 2IYGA 3RR8A 3TRGA 2FLPA 4H4KC 2B4OA 1RLCL 2H5EA 1YRUA 2XHWA 1ZM3A 3MCMA 4NLDA 4DN9A 2OPRB 2ATLA 1WI8A 2XY6A 2BANA 1R8HA 2D1CA 4F36A 3KHGA 4FS2A 3RJMB 1F3FA 3UR3C 3ENQA 3PKMA 4ETZA 4DQSA 1FRXA 4NLRA 2RIJA 3DRYA 3CT9A 3MM9B 1YKWA 3W9JA 2W1BA 3ONQA 3SYZA 4NWBA 1RT3B 1WACA 2O5DA 3RW6A 1ZPVA 2HZVA 3T6JA 3O44A 2ZH1A 5SUHA 5BR8F 1X7VA 4ZVUB 5B09A 5KFIA 3IR5B 4ZLPA 1FE0A 3OL9A 1N32F 4KFBB 4RUAA 2WB1D 2BW2A 4OX6A 4J9RA 5KT3A 3RUBL 1VQKS 3GYNA 3FMBA 4YY3F 2CQDA 2DNLA 2P6TA 1WNEA 4J9LA 4ZJLA 4WP8A 3N79A 3OBIA 4R25A 2DXFA 4ZHRA 1CJUB 5CABA 2CJKA 1WF1A 2F4FA 3F73A 4G6VB 5E0OA 1HIYA 1IKWA 2H48B 3NMAA 1Y10A 1F9HA 1SPBP 3MEGB 2IVYA 3M6UA 3OTOJ 2YX4A 4RW7A 2FJWA 2IPOB 4DHVA 3IWXA 2APOA 2QL5B 5C24B 3DRPB 3FSXA 2OP5A 3ETMA 1R3NA 3DOLA 1E6VA 3PDNA 1VJWA 2HNYA 1KFDA 1RWXB 1DQ9A 1SQGA 4D3GA 2YWKA 3BR8A 2HQ3A 3FBBA 2VFSA 2X7IA 4JV0A 3QAEA 4O44A 1EB0A 3L7PA 3W5XA 1H72C 3QO9A 5DDOC 1D8ZA 2AW0A 2BBEA 3PG9A 4FKYA 2K2PA 2P9CA 3J81U 3DRXA 2Z2YB 3MF5A 4DV7F 3LGNA 3KLEA 4NLPA 2ILYA 2MSSA 3SDEA 4FBTA 2F7VA 3CXCR 4K4TA 1U26A 3MFIA 4FNIA 4EZ9A 1H7XA 4QIWD 3U02A 4JI3F 4BC7A 5HBMA 1LW0A 1MN7A 2F65A 1JKHA 1IKVB 3DU5A 1W26A 4B3OB 5IFMA 3D9BA 1REVB 4PR6A 4LFCJ 2RVJA 5F8LA 4ENOA 4N47A 4M5DB 4NEYA 3LPYA 1TL7A 3ZZRA 3W1YC 2HS4A 2AYMA 2F63A 1NH8A 3UE2A 5ETPA 5BJRA 1EX8A 4ZLLA 4Q7AA 2DRBA 3MTJA 2YWHA 3RBDA 3CNQP 1J2VA 2WOMB 5DS7A 4I7FB 5RUBA 4C98A 5CYJA 1OIAA 1S72S 1F9EB 4P2FA 1FRIA 1HMVA 5D15A 2UVVA 3RRHA 2AX0A 4HH1A 4MKBA 1I51B 1SC3B 4CH7A 2E7VA 4R0EA 3I0RA 2XY5A 2EEYA 4OZNA 5K20B 2OEJA 3EYZA 2NXEA 5AE2A 3QZ7A 4I0WA 1RZMA 2BZ2A 4IH7A 1GNKA 2IRUA 2BM0A 4OYAA 4PUOB 1DQAA 5HO4A 2ZOMA 4FXWA 1YSJA 4KV8A 1BXNA 3BREA 5L8RC 3TR5A 2J7UA 3MMCB 4CO2A 5F8NA 3A13A 3CJTA 3CJ0A 2FJVA 4EUVA 2V2KA 2NXNA 2OO4A 2LVWA 2QSWA 3KLIB 3IRXA 1IR1A 1NB2A 1FFWB 2HHVA 4KQZA 1PO6A 2BW7A 1VQNS 4B9SA 1R8CA 3K5PA 3KLFB 4Q0BB 4FKXA 1S1WB 2BE9B 1WWHA 2JLFA 3P49B 3TJ8A 2DPIA 2CQIA 2EKNA 3RR7A 3RGIA 3GFXA 1LXJA 4DG1A 5C42A 2DNNA 4M5LA 4EYHB 4YB5A 1UVJA 3RAXA 1WJ9A 2AJ1A 1VRUB 3MDFA 1SKRA 2BKPA 3KK3A 4EZ6A 4M94A 2MQNA 4ELVA 2DNMA 2ALZA 2ZH2A 4H4OA 4DX5A 1T9WA 1ZPWX 4OX8A 4P75A 3Q8SB 2VKRA 1FVQA 4DEZA 3PIOQ 5KG0A 3HP6A 3MMAA 5FJ4A 4USUA 2XS7A 3QRPA 1FEEA 1CLFA 1TP7A 4L3KA 3KK2A 2O67A 1B0PA 2VA2A 2QJ3A 3H5SA 1K9MT 3PYEA 4FYYB 2GA7A 5E41A 1RHRB 3W2WA 2FPHX 3HHLB 1O5JA 2M2BA 4C11A 5KFCA 1IJFB 4HI2A 4C97A 3VR1A 3QT8A 1C0UB 4F4AA 4IUFA 1T05A 5CD4A 3N6MA 1X4DA 3DLKA 4LRFA 1SBRA 1UJ4A 4KHMA 3GSIA 1WKKA 4NX9A 4U7UK 3DLLQ 4JI3J 1IWGA 4CLZA 4ECTA 3IBCB 5D0GA 3VAGA 3BPDA 1BHNA 2IFXA 3MR5A 4HYKA 2H5IB 4ZP8A 3GILA 1C4AA 4IR1A 3JTPA 1FJ7A 2V8DA 1RKIA 2QZ8A 3JAMU 3EPGA 2DR5A 3MD1A 3DHWC 1ZAVA 2XLJA 2DCLA 4FP9A 3QT7A 2CQ4A 3DYAA 1H3DA 4GVBA 2B6AA 2D3OR 1X0FA 2KB2A 5I3PA 4L76A 2KXFA 3RRKA 3GIIA 1AFIA 4AQYF 1WSRA 3M8ZA 4MIBA 4DF8A 3MECA 1FKOB 2DISA 1UW4A 5A0YB 4NRUA 1RT2A 3JTNA 2KRRA 3BPSP 2ZVSA 3T5JA 2VQFF 5L38A 1A0OB 2R7OA 3MOJB 4RPFA 1Y5NB 2AYGA 1R0AB 1UVIA 4WXOA 4HT5A 5K8PA 3GFYA 4RKUC 1F5AA 3HX9A 2LEPA 2Q3PA 5C24A 4E0DA 1FNOA 1HD0A 1LWFA 2HMIB 3ZO7A 3V6DB 4K4WA 5HN0A 2YTCA 2DGSA 2VC1A 3OVAA 2RQ4A 2HVZA 4DBQA 4YUDA 1LWXA 2G1DA 1NDCA 2JSXA 3AFGA 4NLUA 4KBIA 3PW0A 5E7OB 3C16A 2JFDA 1R43A 1F2GA 2ZNZA 4LBPA 1DHMA 2MKJA 5AXLA 3UO0A 4BWJA 1DQ8A 2VB6A 1T9UA 1FRKA 2XCPA 2YNGA 6FDRA 1L3VA 1OO0B 2G9OA 4JV5F 4LIRA 2VPWB 4PQAA 5B08A 2PA8D 2QLXA 4B08A 1N5TA 4B3OA 2DGOA 3MEKA 5KFSA 2PMHA 2MXYA 5ETOA 3QGGA 1JLEB 4K0KF 4DR3J 1EQMA 3BGLA 3S7RA 2A3JA 2Z58B 3JB9k 1HHSA 4M5DA 2QO3A 4FVCA 3FQKA 1Q53A 3CEDA 4EBDA 2Q6BA 2ZUAA 1IBKJ 3W2VA 3I96A 2PC6A 3IWNC 1J5OA 4IFVA 3PV8A 2AZ1A 3K17A 4I2QA 3FZBA 3V4IB 4ILLA 4ID5B 2ZKTA 3DLGB 3CDAA 3QIDA 2QIFA 1FVSA 3UNYA 4LR8A 1NEEA 2O3DA 4ECZA 4ILMA 5KG2A 2IHR1 3GYXB 3C14B 2QLBB 4N76A 3TQ1A 2K1RB 1QM9A 3CCMS 2FHJD 1Z2LA 2QSFA 4ANEA 1YJVA 3BKUA 2R7RA 3I6PA 5JVHQ 1JLQB 2QA4G 4PQUB 2ZWPA 2V4RA 2BOPA 3GU0A 3OLBA 4AXIA 1RTJB 4DUZJ 4K5SA 4DS5A 4X65F 4KGXB 4ZS6A 3BQ0A 4W92B 3MM5B 3SFGA 2Q79A 1GK8A 5FLXY 1TELA 4X4UA 4LF8F 2V67A 3DRSB 2VKZG 3W7BA 4F4KA 4CO0A 2IY5B 1KTVA 2JRSA 4ILRA 4LJMA 4AQYJ 1YTYA 1CC8A 2OLWA 5EUHA 4HHUA 4WFYA 2ZH8A 1B0TA 5IWAF 2VL1A 4DR7F 1QJHA 4DXLA 1OPZA 2NLWA 5T7LB 4ECQA 2KTQA 2OEMA 1PJ6A 4EYIB 4DR5F 5D0RA 3GYGA 3NCQA 4OYOA 3ZZZA 5D4PA 5KOXA 3PW4A 2ZOFA 4B9UA 2DHHA 1FWLA 4R8UB 2BE2B 4A8SA 3DRRA 3Q23A 2DK2A 5AJ3J 3PEJA 2B7CB 2MGZB 3O3LA 1N0VC 1BMQB 4EWTA 4MKAA 3FCHA 3ZTOA 2XMUA 4U96A 3CJ4A 1VQPS 1WG4A 5BYRA 5C5JA 1Y3JA 5CYQA 1B4SA 3QYYA 2CPHA 4X4QA 4OHWA 5KFWA 2OIHA 1GX6A 4UOCA 5KFNA 1OWXA 2GV1A 3CC7S 1T11A 4NLQA 3J80Y 1S9EB 4WKYA 2D69A 2PSZA 1XERA 4DV2J 1Y0HA 3QT6A 4JI2F 2GHVC 3TZXA 4UUWA 4Q43A 3D0GE 1RT1B 4JV5J 2FUG9 3GJRB 1VCTA 2EG1A 2EK1A 2YWWA 3V6KA 3G87A 2PFFB 3WX4A 3CMES 1X4GA 3HI9A 3QSIA 3D1QA 5LT5A 2DIVA 3NWGA 4U8YA 4I6AA 3N0VA 4DR4J 3IA0A 3HVTA 4IR9A 5H9FK 3OXFA 2LQBA 5K8MA 5IV4A 3J7ZT 1RABB 4JI0F 2J9CA 4ZVQB 2YPYA 2HBRB 2CZVC 3ULHA 1BWVA 4J9OA 1J5EJ 3FSIA 4TY8A 2Y1LB 4OZ3A 4DF4A 4O0NA 3NP5A 3PACA 4C48A 5FDLA 1UKUA 3BN4A 2YX1A 3A8JA 3D54A 4LT6A 1L3SA 4RW4A 2ZJRQ 4CO3A 2I6WA 3CJKB 1MWQA 3LP2B 4IO1A 5A0YA 3LA0A 5HMZA 2BA9A 2VD3A 2WSEC 1I3OB 1T8EA 5HATA 1FI4A 3GR1A 2FYXA 2I2YA 3DKDA 1FK9B 1UVLA 2F1FA 1DTQB 1RWUA 4AD6A 2ZDPA 3R1HA 5KG7A 2CG8A 3VGTA 2XC9A 1RHQB 3LGHA 4DPUA 4X65J 2AP6A 4NL5A 4KO0B 1RAAB 3TW0A 3L3CA 3P96A 4O3NA 2LA4A 3BR9A 1RCOB 1N5YA 1JQGA 1GH8A 3B4DA 3AB2B 4LF8J 4K4VA 1FTRA 3NEKA 4B3TJ 2GHWA 3MR3A 1V9OA 1NKEA 1JJ2R 2ACMA 3M7VA 3EGVA 1T94A 5DRKA 1HBNB 4OYZA 1V5IB 3VQTA 4C0BA 2WW8A 3R97A 4L74A 1RQ0A 3JSBA 4RW6A 1GT8A 2VBYA 3E8OA 1JLFB 4LF5F 2MTLA 4EK2A 1J27A 4NLOA 4Q44A 2V50A 2MMYA 5K14A 4B9VA 1IKYA 1RT4B 1RAFB 4CLFA 3ICLA 3PVXA 2ADBA 1EP4A 1ZZFA 2DNGA 3KHLA 4M5MA 3T9NA 4NOHA 4IQXA 4B3RF 4E2FB 4X4RA 5HAOA 4G3IA 2LLZA 1HPZA 1IBCB 3R5JB 2DNZA 4RJVA 2KG0A 3TAMA 2QTWA 2F8EX 1RB0A 1P9YA 4C3LA 2FJXA 3DLGA 1XQIA 2Q43A 2E5LF 2B3TB 1U2CA 2E1AA 4NLXA 2RB7A 2DGTA 3PFEA 3KUGA 4F2SA 4JI2J 5E2QA 2XTJP 1WD6A 1KHVA 2CWKA 3UD3P 1PILA 2ALYB 3LUYA 2CKWA 1TQLA 1XC9A 2ZJQQ 2C2RA 4RW9A 1NSKL 5HVFA 2HBZB 2WRMA 3G82A 3T1YJ 2MKYA 4WPAA 1VHFA 3IG1A 1K73T 2VFTA 4OHZA 2XYGB 4IYQA 4F50A 1TZ0A 2LU1A 2RDDA 2LMIA 4ZVHA 4YB1P 3GB0A 3TARA 1R27B 3MM5A 4YR3A 1VIOA 1RT5B 2MYFA 4LF9F 2Y0BB 1KNZA 1P6TA 1U1QA 1PAUB 5DQIA 1VI7A 2BVZA 1IXKA 4BWMA 1MLAA 2FJAB 2H4YB 3HCXA 1I5OB 2RKIA 3I0SA 2GZOA 4I4BA 2G2OA 3RB0A 4WE1B 1AZSA 1SKWA 2ZDOA 5F8JA 5EWFA 1DURA 3CD7A 3OSPA 1DTTB 3J81Y 2ACYA 1O8BA 3LWMA 1JK9B 1GXUA 1DLOB 2JEJA 3IRWP 3PRBA 4L3NA 1YBAA 4F0KA 4R8UA 2C2DA 1HBOA 4OI1A 4LVOP 3TAQA 5MLCV 1YI2S 1RCXB 3HLUA 3D6MB 1HBUA 2HSEB 4MT1A 5HL7Q 2P5VA 5IM0A 3D66A 2LP4A 4MK7A 1C4CA 3CUNA 5F9LA 4KPCA 1WC6A 2QC3A 1HFEL 3OTDA 3I5AA 2YXLA 4V1Ak 2R7QA 1WUUA 4DMZA 2CPEA 3SQGB 2PIIA 2DGQA 5F8MA 1KQSR 1Q5VA 3IMQJ 3B4MA 3MZIA 5IC4B 3N6NA 4G1PA 3DMJB 4X64F 3I32A 3W3SA 5D0HA 2MQLA 1Q81T 1C2PA 5B0AA 3M8SA 1YGYA 2W9CB 2HVDA 1XMOF 3TYTA 3M2UA 2C3MA 3IFEA 1O51A 2LEBA 2R7UA 2C22A 2NUUG 4IFYA 5HK4A 2Y1IA 1N33F 2J76E 3BYRA 2LA6A 3N01A 5HROA 1UPMB 5DG8A 2KL8A 3H5XA 4MH8A 1PSDA 4QWEA 2UZAA 3LP0B 4MMOA 5CXTA 4LSLB 3CO9A 4JI6J 1RBOB 4FF3A 1FFGB 1N8RT 1U48A 1UFWA 2J6TA 4JYAJ 2BQ3A 3G6XA 1UW9A 3KDOA 3G6YA 2E5LJ 4CNYA 1R6VA 1NZ8A 3TUIC 4FF1A 4RU2A 3J7YI 2CVEA 1RUSA 3CPWR 5GMDA 1OY6A 1FK9A 3BN7A 3RBZA 4Y2MA 5B0BA 3N5FA 3R27A 4W4MA 2VONA 1LW2B 4E98A 4Q8EA 2FHOB 2AZ3A 3DOMA 2BACA 4ZVTB 2HVHA 3R5DA 2DH7A 4ZLNA 2MDAA 3HKZD 4A8QA 5HQ8A 2J8SA 4DZ6A 4OHYA 1C0TB 1HQUA 5A8KB 4J9SA 3DLHA 2OMOA 3PFOA 5KFDA 4O4GA 4MAKA 1ELOA 1U2FA 4HH0A 1FX2A 2QX0A 3E01B 2HHSA 2DEIA 1GMWA 2PD1A 1MMNA 1SH3A 2FVQA 3CCQS 1U6FA 4IRKA 2M7SA 1RYSA 1CJKA 2Z57B 5E3AA 3NGSA 4EO6A 4IQMA 3CDUA 2R7XA 1HNWJ 2ZC3A 4KKOA 1RT6B 5GVQA 1P27B 1E6YB 3OUYA 4ICLB 1FJGF 1FD8A 5KOWA 2HAFA 1OYEA 3KJNB 3Q89A 1UMJA 4K4ZA 1FKPB 3CCRS 4CM2A 1SB6A 2PO4A 2ZUGA 2YWGA 1YJWS 2HHXA 2M3DA 2WHOA 4IDKB 5KT2A 2FZGB 3NXZA 5JJBA 1W2BR 9ATCB 1IQZA 2RHQB 2WVBA 5GAEU 1U49A 2GMHA 4P9SA 4HL9A 4K2XA 4I64A 4UZBA 2DPJA 2ASDA 1ROFA 3GFHA 4IG0A 2W2NP 5A6WA 2GJFA 3JAMY 2DHSA 2RQMA 5A8WB 4GKKF 3MM6B 3OR2A 3MR6A 4DWIA 2VQEJ 4ZK7M 4CLTA 4DQQA 5ETRA 2HAIA 2BJ8A 3K5NA 2YQ0A 4DX8H 1ZTTA 4DV5F 3HHNB 4QW9A 4OYXA 3KK1A 4DLGA 2DNYA 2WBRA 3JYTA 2V2VA 1LQ9A 5HVHA 3R3TA 3I87A 4DV4J 3QIPB 2X1FA 2HHHF 2HK2A 2DKOB 1K8AT 2MLXA 1WOSA 3M6WA 3C19A 1QE1A 4ED1A 2DVIA 1JMTA 1X5PA 5L1KA 4I67A 2HW3A 5C25A 2PI4A 2OPSA 2OSRA 1KSPA 3P6YC 4F67A 4FDFA 2IBKA 3D28A 5IXUA 4M5IA 4QQBA 2D3ZA 2R9LA 5EWGA 2CNOB 1TKZB 3NMRA 1LXNA 3MAHA 2GW8A 3EM1A 4DLEA 1OPIA 2VC0A 3M30B 3EICA 2ZBIA 5KFAA 2QMXA 1MWZA 1QUVA 1BQMB 1JLGA 2I5JB 4JI7J 1DFDA 3PJ9A 3CC4S 1TV6B 3ZTQA 1XK8A 3KHHA 3EMTA 2JC1A 2R42A 3CTRA 3B82A 2P2CB 3K5OA 4WBFA 4LSZB 4NLTA 1CPZA 1UEUA 4KGMA 3D6FB 5HMXA 2QLWA 1UEVA 1M0SA 3BZQA 2MHNA 4YMEA 3QNWB 4DFPA 2K7JA 4O3PA 1SQFA 4L6V3 4F25A 1ICEB 3T19A 4WTYA 4Y00A 5A2QU 2XBPA 2HWIA 5HLFB 2V8VA 4TKTA 1AB8A 2MEWA 2ROGA 4KB7A 2DEJA 4ZP9A 5FIIA 1VMBA 1H38A 3K5LA 3H42A 2IRXA 2ZZMA 2ZH9A 4I2PA 3AT1B 1CVJA 4XK8C 2HNDA 1X31C 3SQOP 3EDRB 2FLLA 2OTJS 2UUBF 3N6LA 4X4VA 3GG1A 3MM8A 3PW5A 1HBMA 3DNCA 4MIWA 3AA8A 1Q82T 2D3UA 2I1RA 1MROA 3OLAA 2LECA 3J7AN 3SSRA 2YNIA 1RWWB 4B3SF 5HMWA 3LP1A 2M5YA 1S6QA 5JXSA 2OPQA 2BKNA 3D2WA 1RXOB 3BH6B 4FPRA 4A46A 2NCKL 3QSYB 3QLHA 1VQ8S 4N5SA 3QZ8A 4LVNP 3MI7X 2IVFB 1NK4A 4DX7A 4QYZK 1N0UA 2G0JA 2ZM6F 3EJMA 4ZPBA 4RWXA 4GC6A 5E33A 2B9WA 4M8LA 3MR2A 4H4MB 2BEFA 3T9ZA 4QWAA 1X0PA 4N7TA 2K3KA 4HTJA 2JJ4D 3CWJA 4O3SA 2LQ5A 4OMFG 4DV5J 1RAHB 2I0XA 3IS9B 3PJXA 4RW8B 2XO6A 3SMZA 2UU9F 2WW4A 2RILA 4MK9A 4JBCA 1TKXA 1NLKL 4FYDA 1FO1A 1CQNA 2M52A 1MMDA 2HHHJ 2VG7A 2BJDA 2H54B 4DU7A 2NUHA 2YX7A 2QYGA 1OQ6A 2FVPA 4LQ9A 4PEOA 3WIVA 3CJ5A 3R8YA 3JTOA 2N3OA 2PEHA 3KNGA 2QL7B 4C8KA 3DGPA 4KT0C 3CD0A 2KT2A 1VQ7S 4LF6F 5KFBA 1K0VA 1EARA 2R2UA 2F3JA 3W5ZA 3AQPA 2CIMA 4RLEA 1UAWA 2FY8A 1PIEA 4IOAQ 4C7QA 2HQIA 2DRDA 1QSSA 2MKIA 3QQCD 1HNIB 1OS5A 2DBBA 4ICLA 3SI8A 1OSCA 2AJ0A 1PC4A 4JI1F 5J1NA 1VDHA 3DC2A 1FKPA 1W25A 1IBMJ 2X1GA 2VPXB 4DPTA 4U7CA 1JLCA 4RU9A 3IBWA 2EBGA 4UQTA 1NAQA 3UVJB 2GFFA 3VHQA 2BYCA 3DGVA 4ZJQA 1W2IA 5GAEI 4NA1A 5HP1A 4EMDA 4B9MA 1PJ5A 2Y0SD 1T0TV 3GFZA 3FC9A 4DL0C 2ZZNA 4NI2B 2MLYA 2IVMA 2HNZA 2BQRA 3GCXP 2DNKA 3LALA 1HNXJ 4TNOA 2XMVA 4CLKA 1HD1A 3W60A 5HQMA 1RU1A 1M5VC 1TKDA 2XLIA 5KT4A 2MQPA 4FF4A 4EEYA 3OFFA 3W9HA 2AF6A 2UUBJ 1NDPA 4HACB 2D9OA 4I69A 5H9EJ 3LQVA 4IH6A 2DH8A 4LRCA 2PI5A 3CCWA 2I38A 3F0NA 1T9TA 4DL6A 1S7IA 2N7YA 2R2SA 2GGPA 1V3ZA 3U1MA 2MQOA 1S9GB 1U25A 3MAQA 1C1CB 5GADU 2R8JA 4XPCA 1H98A 2WONB 3C6UB 3QIPA 3RB6A 3I55S 1HNVB 2L9DA 4PYDA 3ADAC 5FD1A 3A4TA 2KZZA 3CIMA 4OHVA 2W9BB 4FYVB 3WDOA 1YWXA 1NDKA 2J0XA 1CJTA 3VGUA 4D3HA 2ZM6J 3EZUA 5BXIA 3NS6A 3PKYA 4F02A 3H4BA 2CPXA 1OY8A 4HKQA 5K8NA 1VQ5S 3M6XA 1X9SA 3UN2A 2WCXA 2IAJB 1BE4A 3MEEA 4R0JA 2R7WA 1S6UA 1UPPA 1QAYA 1SC6A 4F8RA 4KH1B 3KTQA 1V6HA 3OVBA 2G2ZA 4IO9Q 1RAEB 4ZPCA 2KH9A 4KHPF 1V3SA 2CJXB 1WEYA 3MUVP 2XNRA 4NYPA 2BANB 1NMEB 3L95X 3OL6A 1RE1B 4Y2KA 4UZCA 4WF9Q 1VFJA 4TLRA 1KBRA 2NXCA 2KHCA 4QZVB 1AFJA 1GEHA 3GE9A 2ZOGA 2MZSA 1KS2A 1NBEB 1NJZA 4CTAA 1KDNA 4ZJOA 3V4MA 4LF6J 1GAOA 3DM2A 4QPXA 3BGOP 2GCFA 4ED7A 4JUZA 3KMQA 3T1HF 5I3UA 1WF2A 3IGVA 3POTB 3K58A 2FJDB 2IC3A 2NXJA 4FXVA 1U24A 1IM4A 1ZM4A 3OSNA 2N82B 5ETVA 1NDLA 4F4YA 2L48A 1D0EA 5D3GA 1X5TA 3LTOA 2CJYB 2YKNA 3EX7B 3I4PA 2IA0A 4ZHRB 3KHRA 4OX9J 4ZN1A 2D74B 2RRNA 3I5BA 3TO8A 4RZRA 1IKWB 2AX1A 3OR1A 1WHXA 4ZN3A 2H5JB 3OHBA 1U8SA 2PFDA 2KN4A 4C0OC 4AXJA 2V69A 1Q7LB 1VOMA 3BDEA 2BRLA 2EVZA 3ZTPA 1VBYA 3VQSA 3HT0A 4QWCA 2W2PP 1X5OA 2C2MB 3DOLB 5M2UA 4TU9A 3BGRA 1SXLA 2CADA 2HNYB 1IJEB 4F26A 1UJ6A 2M0GB 4PZVA 2QE5A 4G1QA 2BDPA 4TVAB 2AGQA 5F8HA 1LK5A 4OYPA 4O44B 2ZHOA 3W65A 3QJPA 1WEZA 4K5RA 3BBCA 4CT9A 1S99A 3OHAA 3QO9B 1LNQA 8RUCA 2FVCA 3IM9A 4A47A 3GWCA 3ZZTA 1KFSA 2HKEA 4ZKAA 1MU2A 1TAUA 2QYCA 5KFVA 1S97A 3W8GA 1N5SA 3KLEB 3IAM9 4M5JA 3SDEB 3DLJA 1D8YA 1B64A 5J1EA 4OZ5A 5T41A 1RHKB 1RA7A 2KM8C 3E2EA 3KLGA 2W25A 5HBMB 3EGNA 2DRAA 1JKHB 4WTOB 4J5OA 3OTCA 3CSKA 2A10A 4LSNA 4KRWA 1PC5A 2DGXA 3NGUA 4YOEA 3CIZA 1ZM9A 3BSCA 5ETMA 4CDIA 1TL1A 1TL7B 4JI4J 1RT7A 1A7GE 3PRDA 3OV7A 1BQNA 2ILZA 3SSSA 1EAYC 4Q45A 2RHSB 4NASA 5U47A 4NXNJ 1HNIA 1IM6A 1NJIT 1X4EA 2DO0A 3VAHA 4AFFA 3AXKA 2PE8A 4OZ2A 2Z2LA 1HMVB 1AROP 3HSJA 2ZD1A 3KLHA 2BJ7A 1U1NA 4WWSA 1HW9A 1I6JA 2UUAJ 5H1SV 1U09A 1S1XA 1M5KC 2HHUA 1YHQS 2ZEJA 1KR4A 4NI2A 1S9FA 3BB5A 3S6EA 3HULA 2EXUA 1DAXA 5KFRA 1WDTA 3GSDA 3OFEA 3T5HA 2FLNA 1XN9A 1TMMA 2CJQA 4KV8B 3TZZA 5L1LA 4LF7F 3V2UC 1TL3A 2COLA 2GC8A 4Y34A 2GVDA 2A2DA 1HW8A 1IR0A 2OELA 3P4UB 4QPTA 3TUPA 1TU0B 3IRXB 2HRYA 3GLJA 1SCJB 2CPJA 5I3QA 3LOUA 1QAIA 1RDRA 1KKHA 1NJWA 3FBCA 3ISNC 5GADI 3EPIA 1FNXH 2FGOA 2DXEA 4GKJF 1H2VZ 2R8HA 3J7A1 1TKTA 2DNOA 3VVUA 3SEOA 3B54A 4DG1B 3M1VA 4ED6A 2HYIB 1KVIA 1VYAA 3KK3B 4FPIA 3HFVA 1FXDA 2J0SD 4H4OB 4AUKA 2OMLA 3B6BA 4DZDA 5F8IA 4U8VA 3Q86A 3L7UA 4KGVB 1QD1A 2DR8A 3ETOA 3ZZYA 2M88A 3MMAB 2KZMA 3B78A 2FZCB 2DGUA 3KK2B 1NK0A 4B02A 2CUYA 1AT1B 1SJ4P 3PR4A 1QVGR 1U0HA 4U6PA 2AQ4A 2XMTA 3W2WB 4ED4A 4MYUA 2XG8A 4C11B 1RTHA 1T05B 1HNZF 1FHTA 4F0MA 4JI8F 5G4DA 3DLKB 5T14A 4X62J 3TUZC 4WK1A 4C8MA 4QIVA 4TYBA 5ETLA 5J2PA 1UA1A 4O4RA 2EI5A 4KJIA 2IMOA 3R7SB 1WC5A 2V4QA 3KUEA 4CO5A 8ATCB 4Y0FA 3KYLA 3MMBA 4IOCQ 4RUHA 4HDGA 3POTA 2V34A 4P2MA 3DYAB 4GVBB 1S1VA 2B6AB 2XYPB 3CC2S 4Z2XA 3HJVA 2JC0A 4R5PA 4HHHA 1NSQA 4P72A 3MECB 3SCKE 2WAQD 3AY0A 1RT2B 1Q4RA 3HSZA 3WIUA 3N28A 3ZZUA 3KOAA 1XBWA 1WEXA 3UN3A 1XTZA 2J5AA 2N3LA 3BGFA 2YKAA 4N56A 2C2EA 1KLMA 2X1AA 3FFIA 2KT5A 1JNZB 4DR6F 5DG9A 3O2IA 2IBOA 4YB6A 1LWFB 1Q79A 1RBAA 3MHYA 2J7KA 5EX3A 2RU3A 1FD2A 5THWA 4ES2A 4KTQA 3MD3A 4LF7J 1NPKA 1D3WA 2XI3A 4HLBA 1IBLF 1GXLA 4DL2A 2QLJB 2UXDF 3ZTSA 1WKLA 3ILJA 4J9KA 1F1BB 2DO4A 3C16B 4RWWA 3D1OA 5LMUJ 3MPVA 1IR2A 4OYWA 3VAIA 3Q2SC 4ZCIA 2FVSA 1UWBA 2CYYA 2H9ZA 1G7CB 5KFQA 2EFPA 1PGZA 1S7HA 4DL7A 2LU2A 3G86A 2YNGB 3H40A 2XZTB 1RWNB 2AEFA 2M9KA 1M90T 2VODA 4M95A 1AUSL 3FBEA 3D67A 4J91A 4J9UE 3P5TL 4PCQA 1R6YA 5LJ3Y 4ZLJA 5CCLA 2IDEA 2ZWOA 3TA0A 1W7WA 1VIXA 2QA2A 1DRZA 1TVRA 4P6QA 1YJRA 4QBUA 5A2QY 1U45A 2YH1A 2AMCB 4M1KA 3G9CA 3A8IA 1JWWA 2CA9A 1HHTP 1SVDA 3PYFA 3W2VB 1P1TA 1J5OB 4IFVB 2IYIA 2FLOA 5B0FA 4I2QB 3QPIA 2QFJA 3HFKA 4LRBA 2LQ9A 4NLSA 2DNRA 4O3OA 1Q8BA 4X4NA 3HFZB 1XWLA 3QMQA 1NSAA 3V6JA 1Q1KA 1G4CA 3M8WA 3AAWB 4ZIWA 3O1LA 1YBTA 3LAKA 3A12A 5L39A 4FXDA 4UUXA 2B51A 3NAHA 4PXDA 4AL5A 4BHQA 4C3MA 3H7HB 2VOOA 3RZAA 1OYDA 3R1LA 5E3QA 1AA1B 4ZPTR 1NJYA 2VICA 3J7Z5 5DLGA 5KG5A 2UV8G 3HZEA 2CQGA 1WHYA 2XZWA 2IM1A 2FJEB 1YIJS 1KQKA 5BR8J 1H74A 3C2PA 1NHKL 2VDHA 2VFVA 2MQMA 2ATCB 1F5CA 1N32J 3ZFVA 1FXLA 1D09B 3OQ2A 2RT3A 5M2PA 2J6UA 3QAUA 5A8RA 1HA1A 1LOUA 4YY3J 2DY1A 3BQ2A 2MY7A 1NRKA 2NPIA 4ZCLA 2EWHA 3HSGA 4EO8A 2LQ8A 3BO3A 1NK9A 2MY8A 5JUMA 1GMVA 2L9WA 2HGLA 3KNAA 3SCIE 4YEAA 1FRMA 1FDNA 5LMNF 3V81A 1IN0A 1AYEA 2R8GA 3DRRB 2BJEA 3M2RA 4DR6J 1LEOA 4IG3A 4QIGA 4WFAQ 1RWVB 4CQ1A 4P7TA 3RTVA 4A8YA 1CULA 2AT1B 1GTHA 2WVCA 1M5HA 3RB4A 5CYQB 3PNIA 2GO8A 1IBLJ 4WP9A 3CO0P 3M8PA 2RS2A 2XSJA 2NPFA 4G65A 2QG9B 4W90B 2XWXA 4ZP7A 1QAXA 2DR6A 1JLAB 1MMLA 2DHGA 2XGQA 4AL6A 1VC6A 2MKSA 3DCAA 1UVMA 4YFUA 4DV7J 1XNRF 2BQUA 1BLUA 2KM8B 1NB7A 1MSWD 3JSYA 2V2QA 1XMBA 2WTFA 1QSLA 4DFMA 3SZ2A 3LAMA 3BYPA 4Y28C 1RI7A 4OZLA 4LRAA 4EGLA 4NYOA 1X4BA 1FCAA 2B5JA 1AUDA 2VFUA 2F8HA 3HVTB 4CYUA 1SH0A 3AOCA 2KU7A 1Q95G 3QATA 1Q8IA 1T3OA 3MR7A 1U4BA 1YK9A 4TY8B 2N4CA 5D4OA 1IUJA 1UWAA 3ITHA 3TJAA 2F4VF 4DV1F 2OPPB 4KSEB 4M5NA 5FDLB 3T3FA 2JH3A 2AYEA 3HJFA 4HEA9 4RW4B 3UDEA 2A1BA 1UJ5A 5L9XA 1RGVA 3M05A 3IN5A 1QAJA 5F3TA 4Y6IA 1VRTB 5AT1B 5KT7A 3L7OA 3VWSA 2RMLA 3K57A 4DQIA 1PCAA 3QWUA 2FZKB 1XMQF 2CPZA 2YQ1A 3VAJA 2ZBRA 4K2JA 2GVZA 4RNMA 3QT5A 1SJFA 2YKMA 1QVFR 2M8DB 2Z8QA 2X3GA 2G0CA 4DX6A 3GV5B 4EFAC 4YHHF 3EGZA 2OI2A 2VFRA 5DETA 3FJ2A 1ITPA 3TA2A 1TL4A 5DDQC 3Q2TC 2RQCA 2V68A 2NXUA 1N5YB 1U1PA 2Z2ZA 2HEKA 3TQEA 4DR1F 4IKAA 4RNHA 2RF2A 1HQEA 3EUNA 4FYXB 5CZVA 3PRVA 3UCZP 4MK8A 2HHPA 4ECRA 3PYGA 2RH3A 1FA0A 4UOFA 4GO7X 2ZE2A 4F3OA 5KG1A 2XM3A 2V94A 2WSCC 3CCZA 3KJVB 1YDLA 2MZTA 3MEDA 5CZXA 3Q24A 2X3DA 3VAMA 4GVLA 4RW6B 2NSCA 3TVYA 3PYDA 1BGXT 3JQMA 1RLDA 4J9PA 1REGX 2G0IA 1BY9A 3CGIA 2H65B 2Z2MA 3I31A 5K14B 1ZA1B 2RUGA 1S49A 2EFNA 1IKYB 1S4EA 3R6GB 3UPFA 3MUMP 1R7IA 2GNKA 4JV1A 4XDCA 1I1GA 1EP4B 3SBMA 1YJNS 4CH0S 1RAOA 5KTQA 3I56S 2RRAA 1HPZB 3TI0A 4UQGA 2AWZA 1WKJA 3TAMB 1M5SA 2EFVA 3VGVA 2BXJA 2Y1RI 1JXEA 3QWPA 4U7UD 2ZH3A 1WHWA 2K3IA 2XSFA 4I1TA 3PCOB 1R8BA 2W2OP 2MB0B 1TFWA 1NNDA 4PKDB 1SV5B 2XCAA 5K5MA 2Z4PA 3FUYA 1SKSA 2BOAA 4DPWA 1VK8A 4BLGA 3CD5A 1TAQA 1IKXA 4ZDNA 4RW9B 4NE9C 3M8YA 2KXHA 4TQSA 2OHDA 2V0NA 3HXMA 3G82B 4F4XA 1S57A 4KGZB 1JJ4A 3TVKA 3GV7B 3O6QA 5EHHA 3IG1B 3AA9A 3R5AA 1F6TA 2ZKUA 3TZWA 2HLUA 1AW0A 1OSDA 3WC0A 2VA3A 2FHJA 1VC5A 4RO0A 2B9XA 5L46A 4USJC 2OH2A 2VU5A 2ZZTA 2V2ZA 5D4LA 1SJ3P 1A6LA 2F4VJ 2HHTA 2E5GA 4LBHA 3IXQA 1RTIA 3THTA 4F4ZA 3OTEA 4XPEA 2RKIB 3CCVS 2HBQB 5ETSA 3I0SB 1XJWB 1BUXA 3D68A 3LGMA 4E8UA 5F9NA 3TJ9A 1AZSB 3P5BP 3M8QA 2VQFJ 1LKZA 1EETB 1VBZA 3O5TB 3GMGA 1PJ7A 1N48A 2JFKA 4AT1B 1M1GA 5KFJA 1XMQJ 3Q8VA 3NS5A 4WP3A 5LSRA 1QY7A 1BQXA 1LK7A 5I42A 3JSMB 1FWKA 1HBOB 2Q1LA 2EG2A 4Z7CA 2BABA 4EU0A 2C1EB 1HBUB 2DY9A 5DQGA 3NRBA 3EXYA 2N7CA 4WIQA 5IM0B 4XO0A 5BYSA 3HHDA 2AGOA 2CQHA 3Q8RB 2B7BB 1H0HB 3CMQA 4DR1J 1S0NA 2GIQA 1UVKA 1U6ZA 4DS4A 2CNKB 5ETTA 1UA0A 3HDSA 2KKHA 1RK8A 1B0VA 1U47A 5ETQA 4NZ0A 2W01A 1JLAA 3PR5B 3Q8PB 1B70B 3NOCA 2WSFC 1YRXA 3GIRA 5K8OA 3DFEA 2P9EA 4RR5A 1N54B 3CJ2A 3WQPA 3KG4A 1X9WA 1WHVA 2Y8WA 3SFUA 2CJAA 3D3CJ 2QN6B 2IM0A 5DZ6A 2IM2A 1S1UA 2E7XA 5CHCB 1GFWB 2VG6A 3M2UB 2B43A 2FQQB 2DD8S 3Q22A 1BD6A 3F56A 4J9VA 3BH7B 1CG2A 1RP5A 3W66A 4CNZA 4IFYB 2MHEA 2QFIA 3NGKA 1JXVA 2RDJA 4K0KJ 2CFXA 4O3RA 5CYMA 1FTCA 5HROB 4IOBA 4HI1A 3I82A 2GHPA 2MKHA 1EJ7L 4QR1A 3R5GA 5C2GA 4ZPDA 2OPPA 3SV4A 4TXSA 2PDAA 1TMJA 1RISA 3FK4A 2E44A 1ZM2A 2Z56B 1ZOTA 4A8MP 4LFCF 3J7YU 1VRTA 1RTDA 2RE1A 3UCGA 1HKAA 3AOAA 1X5SA 3SIPB 2VJVA 4Y2IA 3AB4B 2MZQA 4ED0A 2R8IA 3UR0A 1VQ4S 4NMLA 4K4SA 3DOMB 1S10A 1VJQA 4QYZJ 5DM6Q 5D8HB 1HARA 3JQKA 4C0HA 7FDRA 2XLKA 4J9NA 5C2CA 1Q0NA 3EGWB 4ECSA 3EZOA 4X66F 1HQUB 4I6YA 4PWDA 1G2EA 3W5YA 4ERDA 4UF4A 3DI6A 1KN6A 4KC5A 4QIEA 2PA3A 4OJ1A 1VQLS 3HK2A 1TK8A 2EW9A 4O4GB 3OL7A 1CJVA 1S59A 1NK5A 3MGJA 4ZVRB 3GZ7A 2UP1A 1NK7A 1XEZA 1WC4A 1CJKB 2LDIA 2WVFA 3PTWA 3C46A 3VALA 4OI6A 3HHEA 1DARA 3UD5A 3FDSA 5F0WA 2MZ1A 2YWEA 5IWAJ 1T9XA 4KKOB 3KJVA 2KFZA 3DXSX 4DR7J 1HQ2A 2HFSA 4CCHA 3OUYB 4U9RA 2VG5B 5IS2A 1U1OA 4DR5J 4OI4A 4PG8A 4YQWA 2HS3A 1WTBA 4TU8A 2XZDB 1MN9A 4GC7A 4A8OA 1NHVA 1Y3KA 3H20A 4JI5F 2M8HA 4OI0A 3NBPA 1X60A 4DSIA 1B7YB 1T03A 1HYSA 2ZH7A 2UVUA 2VJUA 1VLYA 1YVFA 4WKRA 5CCMA 2OSQA 2ZBPA 3ZZ0A 1FRJA 2OTLS 5MAOA 4IRDA 1CBKA 3K8VA 3M2VA 5IZHA 2C3OA 4IG0B 4Z7YA 2GQQA 4P71A 3OR2B 3NNCA 5B0EA 3QGPA 4F7VA 4A8XA 5DO2A 4CM0A 4ZVOB 1FJCA 4C8ZA 2BE7D 5C7PA 4GO5X 5J2NA 3VVTA 1Z4UA 1HI0P 3NGDA 2ABYA 1FEHA 3D3BJ 1SV5A 3ENAA 4J9QA 5DG7A 2VUGA 3Q8QB 4C8OA 5DM7Q 3KK1B 3JSRA 3LH2S 4DN0A 3BBFA 4A8FA 1JLBA 3G4SS 4Q8FA 3US5A 3JYTB 1VRQC 4PWWA 3VCDA 1WTFA 4B17A 2CQ0A 1SIWB 1Y00A 4JI0J 4NCGA 2XMKA 3PW7A 3NGRA 1SC4B 4J9MA 5AXNA 1QE1B 4UTGA 1GX5A 2DIUA 5J2MA 5C25B 3CJSA 2OPSB 3R7NB 2GS8A 2JHEA 4NCBA 2W4CA 2J0QD 4OLPA 4WZMA 4C8NA 2YNHA 1K1SA 4FZVA 2MSTA 4USMA 3AOBA 3M9NB 1WOPA 1JB0C 2XMAA 3K89A 1JLGB 4J90A 3Q8UA 5D6GA 5GAGU 4G1IA 3G6VA 1KTQA 3W63A 1SUQA 3IO1A 4BC9A 1S79A 1EETA 1Y5LB 3CJQA 4QWBA 3GTYX 4K59A 2CQPA 4TU7A 4NA2A 1SJ1A 4ZVFA 2OJ3A 3DXBA 3CW2C 3JSMA 2HHQA 2V4JA 3QGIA 2HQCA 3S01A 5KG6A 2ASJA 5ETNA 1RU2A 5KFTA 4X66J 1UETA 1H73A 3VZHA 4QCLA 3AJDA 2VBZA 3GR0A 4URGA 1MW7A 4ZCKA 5H9EK 2RJZA 1S6PB 3EZ5A 1TUWA 4N77A 3CVKA 5E3CA 5DZ7A 4I2PB 2HBYB 3SCJE 1K44A 4JB8B 1WOOA 2HNDB 3NKYA 4HT7A 4Y2CA 3HZGA 1C1BB 3MM8B 1UZHA 2DNHA 4URSA 2JDJA 1HBMB 4OJGA 1CS4A 2ZHBA 3ZC4A 4Y65A 1TK5A 3IGNA 1MROB 4LF5J 3ILOA 2B9YA 1D9AA 2UXBF 1NKBA 2IA6A 5D77A 3KDNA 5AXMA 4OYMA 4CZCA 2YNIB 1KOOA 5LL6d 5ETKA 2XHCA 4JI5J 2Y1JA 3LP1B 1S6QB 4WFZA 2C28A 4ZVPB 3ET6A 2OPQB 1VQSA 3FCWA 5GAHU 2GIRA 1JJCB 2G4BA 1N52B 3QLHB 5DGBA 3OD2A 5KG4A 2VOPA 4B3RJ 4DV6F 2Y9HA 5LOQA 3KWMA 4Z37A 2VASA 1F3VA 3K8WA 4OL8A 2NS1B 2B9EA 4OYBA 3TVZA 5A76A 4ED8A 2P9GA 4IH5A 2LYVA 2FDNA 1ZAWA 4WZQA 4DR3F 4L72B 2OFHX 4PG6A 1U8WA 2JLGA 3G96A 1R0BG 5G0RA 3M9OB 1IBKF 1TKXB 2C2ZB 3BSOA 2J7WA 2MQQA 2HFVA 3NOGA 4LBIA 3QJLA 2VG7B 3F41A 3OJSA 3EXCX 4TY9A 1N56A 1VISA 3TX0A 4ES3A 4ES1A 2OPRA 2RU9A 3T41A 4PWUA 2F9JA 1NM2A 3DGPB 3RU0A 2WBMA 4LF9J 3K0JA 1YJ9S 4DCJB 3PHTA 2ZH5A 1N34F 5KFZA 3O8WA 4CLWA 3MM9A 5KFEA 1GQEA 3NLCA 2P6SA 4FNHA 3W8PA 2E1PA 3GCWP 1RT3A 2CNNB 4DUZF 2VF3A 4P2XA 1TUGB 3MURP 2ASYA 2E7WA 1V5VA 2VG5A 5LM7E 2C2KB 3R2CJ 1VQ9S 4CRJA 5AXKA 4A4JA 2MLZA 4FS1A 2HLTA 4FVMA 3EWGA 4KFBA 1JLCB 4FF2A 4B9TA 1NUEA 2W7PA 5L1JA 2E5HA 3L09A 3HMJG 4QOTA 1ZAXA 4DCOB 2MJNA 4NZ6A 3C3LA 1NXIA 4ZVSB
chains in the Genus database with same CATH topology
4K4VA 4Q5VA 4MYUA 5HP1B 2XG8A 4C11B 1FTRA 5IT4A 3MM7B 2GHWA 3MR3A 2HGMA 1V9OA 4QR0A 3KKFA 4ATNA 1RTHA 1JIHA 1NKEA 1JJ2R 1T05B 1HNZF 3H2UB 1VBXA 2AJQA 4JI8F 1FHTA 5G4DA 3DLKB 2HNZB 3I5CA 4X4OA 1T94A 4OJHA 5DRKA 1HBNB 3CD6S 4XIUA 5T14A 3VQTA 4C0BA 1M1KT 2WW8A 2BUNA 2DTJA 1HWUA 2DNPA 4QWDA 1P8GA 3MEGA 4OJ3A 1RTDB 3TUZC 1TKZA 4WK1A 4C8MA 2DH9A 4QIVA 4CO4A 4TYBA 5J2PA 4OHXA 1RQ0A 1UA1A 3JSBA 4RW6A 3M30A 1GT8A 2J9DA 4O4RA 3BO4A 2EI5A 4JI4F 2VBYA 4ZA1A 4KJIA 2IMOA 3FEYB 5AJ3F 2XGPA 2AYBA 1BQMA 2I5JA 3DRPA 4ZPAA 2DT9A 2BM1A 3E8OA 2V4QA 1JLFB 2CJBA 4LF5F 3OJUA 2FIUA 3D0IE 4NLOA 4Q44A 1KONA 2CPYA 2R8KA 4CO5A 4NCAA 4NXMF 4Y0FA 3KYLA 1D1UA 1TV6A 2FHMA 5KFUA 5DDRC 4OLOA 3MMBA 4NXNF 2V5HG 3OTBA 2W8KA 1DBDA 2MMYA 2JWNA 3D5MA 5K14A 4IOCQ 4B9VA 4RUHA 2CPDA 1IKYA 1RT4B 2DJWA 4HDGA 2GGPB 3POTA 2HRUA 3VTIA 3ICLA 2XY7A 3PVXA 4PWDB 2ADBA 2K8GA 3DYAB 1DJ0A 1EP4A 1F60B 1S1VA 3DI6B 3H5UA 2B6AB 1ZH5A 1ZZFA 4DOZA 2UUCF 2KFYA 2DNGA 3KHLA 3CC2S 4Z2XA 3T9NA 3BJYA 2JC0A 2CDQA 2XMMA 3DN9A 4NOHA 3CCLS 4IQXA 4B3RF 2SXLA 2KDOA 3C66A 1LWEA 4X4RA 1NO8A 4LQ3A 4G3IA 4R5PA 4V19X 2LLZA 3GV8B 1HPZA 5SZTA 2YNFB 1S0OA 1X4CA 2UUAF 2OD6A 2PT0A 2DNZA 2KG0A 3MECB 3TAMA 3BEGB 2UVWA 3MTKA 2YQ3A 3SCKE 2WAQD 2F8EX 3AHPA 4PXBA 3AY0A 1RT2B 4ID8A 1Q4RA 3HKWA 4DV2F 3N28A 3VZIA 4B9NA 2RQKA 4C3LA 2LCWA 3ZZUA 3KOAA 1FRHA 1N5QA 2JL9A 2FJXA 3DLGA 1XBWA 5HLFA 1WEXA 1R8AA 2Q43A 3CDWA 2E5LF 5IT0A 1XTZA 3H2VE 2J5AA 2GMLA 2N3LA 5KFFA 2B3TB 3BGFA 4HVZA 2E1AA 4NLXA 2YKAA 2RB7A 4N56A 2OAUA 2ROPA 2DGTA 3IR6B 2C2EA 3PFEA 3R5CA 2IJFA 1KLMA 2X1AA 3FFIA 4I56A 4F2SA 5E2QA 1WD6A 2KT5A 1KHVA 2RDIA 4BCAA 2JX2A 3UD3P 1IKVA 1JNZB 1PILA 2PMZD 3LUYA 5KFYA 1TUVA 4DR6F 2CKWA 1TQLA 5DG9A 3O2IA 1N6QA 5DJBA 3NG8A 4DR4F 3MEEB 1XC9A 2IBOA 1REVA 4YB6A 1LWFB 1Q79A 3MHYA 4WXWA 4UY85 2J7KA 3OFGA 1O0PA 2IM3A 5GAGI 2ZJQQ 3NNHA 2R2TA 2C2RA 3G8QA 4RW9A 3DLBA 2FC8A 3ZZOA 1VQMS 3C6TB 5EX3A 2WRMA 4KIAA 2RU3A 2AJ4A 3NBPB 1FD2A 5THWA 4ES2A 2XI2A 4KTQA 3MD3A 1T03B 4LFBF 2VV5A 1VHFA 3MPYA 3IG1A 1HYSB 3RAMA 2AU0A 1D3WA 2VZ9A 2XI3A 1K73T 1J5EF 4HLBA 2VFTA 3IC1A 1IBLF 4OHZA 1GXLA 2C3PA 1FKAF 4IYQA 4F50A 3G8TA 4DL2A 1TL5A 1TZ0A 2UXDF 1FERA 2LU1A 2FB0A 2ZFHA 4OZJA 4NA3A 5F3ZA 1T3NA 1BC6A 4YDXA 4J9KA 2LMIA 4ZVHA 4YB1P 1S0VA 2DO4A 1FE4A 4RWWA 3GB0A 3TARA 1R27B 2E9RX 3D1OA 2WOMA 3MM5A 4YR3A 4I7FA 1VIOA 2C3UA 3RB3A 1RT5B 1CQMA 3MPVA 2MYFA 2HWTA 3M2VB 4LF9F 2IMWP 1KNZA 1P6TA 1U1QA 3VAIA 3Q2SC 4ZCIA 1VI7A 2BVZA 4HHJA 5DQIA 1IXKA 4BWMA 2FVSA 2XB2D 4QU6A 2QT7A 4N8OA 2XO7A 4LF4F 2FJAB 4Q2LA 3M6VA 4RW7B 1I94F 2UVRA 1UWBA 2CYYA 2H9ZA 1G7CB 5KFQA 2EFPA 4ED3A 1PGZA 1S7HA 3T5LA 4DL7A 2LU2A 3G86A 2YNGB 4ZVEA 3UCUP 1F9FA 3FZ2A 3KLVA 4CTAB 3H40A 4DFKA 2XULA 3T6BA 4WFXA 2GJIA 2LXIA 1S6PA 3H8YA 2L41A 2RKIA 3DU6A 1RYRA 5J2NB 3I0SA 3DM2B 1YITS 2M9KA 4O23A 1M90T 2VODA 1M5PC 4ED2A 2JVOA 4M95A 5LSLA 1E6VB 4I4BA 2CQ2A 1UFLA 5J2QB 2MPUA 3RB0A 4WE1B 1SKWA 5KFOA 1NHUA 3P5TL 2ZDOA 4H4MA 3TAPA 4X2BA 5F8JA 5I3UB 5EWFA 1DURA 2KYXA 3CD7A 3DDKA 3OSPA 1DTTB 1JLBB 1H7WA 4PCQA 3J81Y 1R6YA 5LJ3Y 2CJ9A 5CCLA 4X4TA 1X8DA 5CH7B 2ACYA 1YJUA 2IC3B 3HVRA 2R7VA 1S4FA 3TA0A 1O8BA 3CF5Q 2FY1A 2I9SA 4UY8T 2OD4A 1VIXA 3LWMA 4A8WA 2QA2A 1DRZA 3PX6A 1TVRA 2CZ4A 4P6QA 1JK9B 1GXUA 4PUOA 1DLOB 1H2UX 2W9AA 2JEJA 1YJRA 4QR2A 4QBUA 1C1BA 3IRWP 4BS2A 4DDFA 5A2QY 3PRBA 1U45A 4K4XA 4ECUA 5CA5A 4QYRA 2O66A 4L3NA 1YBAA 2YH1A 4R8UA 2C2DA 1Y4ZB 1HBOA 2B4PA 3OFHA 4M1KA 3G9CA 3IS9A 1N88A 4OI1A 1JX4A 1JWWA 4RW8A 1L3TA 1HHTP 4LVOP 1G6BA 3TAQA 3W2VB 3MMCA 5MLCV 3DLEA 4NCGB 1YI2S 1P1TA 3RRGA 1J5OB 5D3GB 2EFOA 4IFVB 3HLUA 2IYIA 3H2LA 2FLOA 5B0FA 1HBUA 3LANA 4I2QB 3QPIA 2QFJA 4DPOA 2YKNB 3HFKA 2YY3A 5KFXA 5HL7Q 4B3TF 2LQ9A 4NLSA 5J2MB 1NKCA 2P5VA 3GG0A 5KT5A 4KHRA 4ZP6A 2DNRA 5IM0A 2NQPA 4MK7A 2W7AA 4O3OA 4RUCA 3HHLC 1C4CA 3KLIA 3CUNA 5F9LA 4Q2MA 1Q8BA 1SQEA 1HFEL 3OR1B 4X4NA 3TOQA 3OTDA 1URNA 1XWLA 5GAHI 3QMQA 2YNHB 3I5AA 1KQGB 3V6JA 2R7QA 1LW0B 4DMZA 2CPEA 4OX7A 1Q1KA 3SQGB 4X62F 1U1LA 3KLFA 4Q0BA 2X51A 4ED5A 2PIIA 2CQBA 1S1WA 2WB4A 3AAWB 3O1LA 2DGQA 3LAKA 3VF0B 5L39A 5F8MA 1KQSR 4FXDA 5L1IA 5EN1A 4UUXA 2ZH6A 1JXLA 1TFYA 3B4MA 1SH2A 2B51A 4ETXA 3M32B 3NAHA 4TLQA 3MZIA 1M5OC 3BS9A 3N6NA 1HI8A 1SUQB 3OXLA 3DMJB 4G1PA 4I6WA 4KAIA 4PXDA 4X64F 2V8HA 4AL5A 3I32A 1L3UA 3W3SA 3BGRB 4C8LA 4BHQA 4C3MA 2MQLA 3G8SA 2VOOA 5DQHA 3RZAA 2D9PA 1Q81T 1C2PA 2E29A 1VRUA 5B0AA 3R1LA 3M8SA 1YJTA 5E3QA 1YGYA 4G1QB 4ZPTR 3S8SA 2ZC4A 1WELA 4MJKA 3KMSA 2W9CB 1VQYA 1NJYA 5KFGA 4RNFA 1XMOF 3TYTA 3M2UA 3J7Z5 1RKJA 5DLGA 5KG5A 2C3MA 4BBYA 3WZ0A 2UV8G 3HZEA 2L9NA 4WFBQ 1NH7A 4EBEA 3IFEA 1HWJA 4OI2A 4HDHA 2CQGA 3TX8A 1O51A 2LEBA 4ITSA 1GXTA 1WHYA 2R7UA 2A2CA 2XZWA 2V4JB 3HHLD 4DV0F 2C22A 2IM1A 4OV1A 2NUUG 2FJEB 1ZZNA 1YIJS 1KQKA 4F4WA 4IFYA 3N9UC 3C2PA 4ZPWR 1SL1A 3U1NA 5DGAA 2VFVA 1MU2B 2MQMA 4TYAA 1F5CA 3ZFVA 2Y1IA 1Y9OA 1FXLA 2DCUB 1N33F 2J76E 6FD1A 2LA6A 3N01A 2IJNA 5HROA 3QGHA 2LDYA 3OQ2A 5DG8A 3GIMA 2RT3A 5M2PA 2XMJA 3H5XA 2J6UA 3BSNA 3QAUA 5A8RA 4MH8A 1HA1A 1LOUA 3ENVA 5J1EB 1PSDA 3I0RB 3BQ2A 3NL0A 4QWEA 3ENWA 2MY7A 3CCES 1ZTWA 3UFCX 5E3PA 2UZAA 3LP0B 4MMOA 5D4NA 5JVGQ 5CXTA 4LSLB 3KLGB 2YKOA 3CO9A 1NRKA 1S76D 3HHLA 2NPIA 4FF3A 1APSA 4ZCLA 3TNVA 1N8RT 1U48A 3OTOF 3T1AA 2R2RA 2EWHA 1UFWA 1D9DA 2J6TA 1C0UA 4DL3A 4EO8A 2BQ3A 4NLYA 3G6XA 5DLFA 3FGVA 3MUTP 1X4HA 3G6YA 1S1TA 3BO3A 5HMYA 4LSNB 1FDAA 2DGVA 2KXNB 1NK9A 2MY8A 4H54A 4CNYA 1NJXA 2ZJPQ 5JUMA 2L9WA 2HGLA 2MZJA 3DDNA 4O3QA 3KNAA 3SCIE 3TUIC 1N5VA 4YEAA 3X3UA 2FTRA 4FF1A 1FRMA 4OQJA 1FDNA 2U1AA 3SCLE 5LMNF 3V81A 3MMJA 5LXYA 4RU2A 1IN0A 1ZBTA 2R8GA 1TL1B 3DRRB 2BJEA 2CVEA 3J7YI 3M2RA 4P2SA 4IG3A 1RT7B 3I9V9 3CPWR 3PO4A 3T1YF 5KAKA 4QIGA 1LWCB 1FK9A 3SXLA 4WFAQ 3BN7A 4PG4A 1BQNB 4I68A 2X1BA 4Y2MA 4P7TA 4CQ1A 5B0BA 3RTVA 4A8YA 3N5FA 3R27A 3CCUS 2VONA 2W4PA 1LW2B 2FHKA 4CI0B 2HZCA 4E98A 1X4FA 4Q8EA 2FHOB 3DOMA 2BACA 3BM7A 4A8KA 2HVHA 4Y2AA 3R5DA 1U7LA 3AJ1A 2DH7A 3IAS9 1GTHA 1SIZA 2JOQA 1R8PA 1M5HA 5LMUF 4P7VA 5EDWA 2MDAA 3HKZD 2F8MA 3RB4A 5CYQB 4DUYF 3PNIA 5HQ8A 4A8QA 5D78A 2GO8A 1D9FA 3M8PA 2RS2A 4OHYA 1C0TB 1S9GA 2XSJA 1XR7A 3OXGA 1HQUA 1C1CA 2NPFA 5A8KB 1URRA 4J9SA 3DLHA 2OMOA 2WONA 2ZD1B 3PFOA 3NCPA 3KLHB 5J1PA 3C6UA 5KFDA 2E5IA 4W90B 1HNVA 2XWXA 2NSBA 4O4GA 4MAKA 4ZP7A 4F3QA 1QAXA 1ELOA 1JLAB 2C3YA 4BDPA 1MMLA 1U2FA 4HH0A 4DQRA 2BV3A 2DHGA 2DGWA 3E01B 2XGQA 4DL4A 2HHSA 2HHWA 4AL6A 1VC6A 5LSOA 2LEAA 2MKSA 2J8AA 1U6BA 3DCAA 5C42B 2PD1A 1S1XB 3UDLA 1FKOA 1UVMA 4YFUA 4KE5A 1MMNA 1L3KA 1SH3A 2IRYA 2W9BA 2E1RA 2BQUA 4B9LA 1XNRF 1BLUA 1YQHA 3MM7A 4MIAA 3UNGC 3GIJA 1VC0A 4X4PA 2WK4A 2KM8B 1NB7A 1MSWD 2YH0A 4DQPA 4ALZA 4WU2A 3PX0A 1SI9A 2FVQA 2J9DE 3BDPA 1CSJA 3JSYA 3CCQS 2RD5C 2AGPA 1U6FA 4IRKA 2K7KA 1XMBA 2M7SA 2WTFA 1RYSA 5E3AA 1QSLA 4DFMA 3SZ2A 3DHXA 3LAMA 2XWYA 2CQ3A 1R0AA 4DL5A 1Q8LA 3LWLA 1KEKA 4EO6A 4IQMA 3CDUA 3CDEA 4KPYA 4JOUA 4Y28C 2R7XA 1RI7A 3P3DA 2ZC3A 4OZLA 4EGLA 2ZNYA 4RNNA 4KKOA 4NYOA 1RT6B 5GVQA 1P27B 1X4BA 1FCAA 3FSYA 3FRZA 4MKYA 1E6YB 3OUYA 2B5JA 1ZYQA 1AUDA 2VFUA 4FN5A 4ICLB 2F8HA 2BR0A 1FJGF 4ZCMA 2IAJA 3HVTB 1FD8A 4ELUA 4LMZA 3UW1A 5KOWA 5G0RB 4TQRA 1SH0A 2EC0A 3THVA 2KU7A 3ISND 1UMJA 1TL3B 4K4ZA 1FKPB 3CCRS 2IYGA 5KFKA 2HMIA 3TRGA 1Q8IA 3RR8A 1SB6A 2PO4A 2ZUGA 4WJBA 2YWGA 3BQ1A 1T3OA 3U1LA 3CCSS 3V6DA 1YJWS 2FLPA 2HHXA 4H4KC 2B4OA 2M3DA 2H5EA 1CEZA 2WHOA 4IDKB 3UWTA 5KT2A 2O01C 1YRUA 1U4BA 2HG4A 5JJBA 2XHWA 1W2BR 1ZM3A 4TY8B 1IQZA 5GAEU 1NU4A 4NLDA 4DN9A 2N4CA 2OPRB 1U49A 2GMHA 5D4OA 4DJBA 1WI8A 4HL9A 2ATLA 4K2XA 1IUJA 1YRTA 3ITHA 1MNEA 2F4VF 4I64A 4YB7A 2XY6A 4DV1F 2BANA 1QUPA 2OPPB 4KSEB 1R8HA 5FDLB 3OPKA 2D1CA 2DPJA 3THPA 1ROFA 2ASDA 4FS2A 3KHGA 3T3FA 2JH3A 2AYEA 3HJFA 3E51A 3CULA 1TKTB 3UR3C 2R7TA 3ENQA 3GFHA 3PKMA 4HEA9 4RW4B 1NK6A 2YNFA 2R4FA 2A1BA 4ETZA 1UJ5A 4IG0A 4DQSA 1FRXA 4NRTA 5L9XA 3M1VB 1RGVA 4NLRA 4CH1A 3M05A 2RIJA 5A6WA 4PG7A 3JAMY 3IN5A 2DHSA 2E66A 1QAJA 2RQMA 5A8WB 4GKKF 3MM6B 3DRYA 5F3TA 4Y6IA 3CT9A 3OR2A 1VRTB 1Z1ZA 1P1LA 2HGNA 3MR6A 3VAFA 3MM9B 5KT7A 3L7OA 1RJJA 2VBXA 3VWSA 1X9MA 2RMLA 4DWIA 4RBVA 1T95A 1T7PA 3K57A 3ONQA 3MCSA 4ZK7M 4DQIA 1QTMA