1HNIB

Structure of hiv-1 reverse transcriptase in a complex with the nonnucleoside inhibitor alpha-apa r 95845 at 2.8 angstroms resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 reverse transcriptase in a complex with the non-nucleoside inhibitor alpha-APA R 95845 at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 100
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hniB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB03
5DG8A 2R8JA 1FKPA 2OPQA 3DI6A 3FFIA 4Y34A 3H98A 1N6QA 3T5JA 4O4GB 1RT4B 1VRUB 1I6JA 1IKWB 1T94A 3H2LA 3QIPA 2B5JB 5C24B 2W9CA 3OHAA 2BQRA 3CO9A 3IG1A 3HVTA 3TAMB 3GV5B 2AX1A 4K4XA 3DRRB 5KFPA 1S1XB 1N56A 3MECB 5I42A 2CKWA 1S1XA 3PW5A 4TQRA 3KK1A 3RBDA 2QV6A 5DQIA 1HNVA 4R8UA 4DG1A 2FJXA 2R2UA 4JUZA 3LP0B 1DTTB 2BRLA 1S1WB 2IAJB 5HBMB 1KHVA 5CYQB 1S1WA 2IAJA 2HNZA 4MH8A 3UQSA 3IRXA 4TYBA 2C28A 3MR3A 4LQ3A 1K1SA 3DMJA 1D1UA 2FVRA 2OPPB 2IM2A 4H4OA 4ZVGA 1RTIB 1SUQA 4H4MB 4PQUA 1R0AB 1S49A 1R0AA 4MIAA 1TL1A 1TL3B 4URSA 3RB4A 1J5OA 3IG1B 3DOLA 1CSJA 1RA6A 3QIPB 5C24A 1S4FA 4IH5A 4WZMA 1VRUA 1S1VA 2D3ZA 2WRMA 4K4UA 3KNAA 4RU9A 1FKPB 2OPQB 3FFIB 5HLFB 2FVQA 4NLUA 4ZPDA 4QWDA 1TVRB 1KLMB 5KT5A 1EETB 5EDWA 4MKAA 2AU0A 2WTFA 5EWGA 5KFBA 2BQUA 1RT3A 4I2PA 4KKOA 4XPEA 1RTHB 4G1QB 4IFVA 5HP1A 4QWAA 5K14A 3BSOA 4F4XA 4EBEA 3KK1B 1RT5A 1RT2B 3MECA 5I42B 3PHEA 4NCGB 4H4OB 4MFBA 2YNFA 4HKQA 4ZPBA 4ZMMA 4Q43A 1HPZA 3D5MA 2I5JB 5J1EB 3DM2B 4HYKA 4RW7B 1LW0B 3NMAA 1RT7B 3LANA 1HYSB 4KSEB 2VG6B 4FBUA 4ID5B 2IM1A 1RTHA 3DLGB 5KG4A 2C2RA 4RW7A 2IC3B 4ED3A 2JLEA 3N6LA 1S1VB 2AGOA 1FKOB 1IKVA 5F9LA 3QYYA 5KFGA 3OL9A 5KFZA 1N4LA 4NLYA 1TL3A 3E01A 3QGIA 3V6KA 2YKMB 2AGPA 3H4DA 4K4WA 1IM4A 4O3RA 2ILYA 4H54A 1IKWA 1XR7A 1RT3B 3DLEB 5KFYA 5KFOA 2C2EA 4RW4B 1EP4A 4DL5A 4TY8B 4Y2AA 5KFJA 1C1BB 4MK9A 4Y2CA 5CYQA 2BANA 3FQKA 4IG3B 4IFYB 1LW0A 3ISNC 4RNHA 4EO6A 3DOKA 1HPZB 1LWFA 4TN2A 4JV0A 4WE1B 4NLDA 1C1CB 3CDUA 3SFGA 1T03A 3DDKA 2AQ4A 4LQ9A 4YR0A 4KV8B 2HNYA 4IG0B 4ED8A 4ECZA 2YNGB 1RT4A 1LWCA 2R2RA 3DYAB 2R2SA 1BQMB 3H59A 1N6QB 4J9SA 3V6HA 4DL3A 4NLRA 4K50A 4O44A 3MR2A 1N5YB 4DL2A 3M8QB 3V4IA 3C6UB 5KFQA 3LP2B 3MEEB 4LSNB 4ECXA 3QLHB 3BGRB 3PJXA 5JXSA 4DG1B 4KAIA 1NNDA 4MKBA 3PR5B 1HNVB 1ZTWA 4ECQA 4GC6A 3RB3A 4WYWA 3BGRA 3HVWA 3HVAA 3CDEA 3KLVA 4R5PB 3DRPA 5KT4A 3Q8PB 4I2QA 4MK8A 3VQSA 4RNFA 4YQWA 3KJVA 3GIKA 2RKIB 3DMJB 4J9RA 2D7SA 1JX4A 2JEGA 4EEYA 3QIDA 2YKNB 2V4QA 5HBMA 4IG0A 2RDJA 4U7CA 4RW6B 1T3NA 1LW2B 4TY9A 3KLFB 1T03B 3BQ2A 3RAQA 5D3GB 2FJVA 1C1CA 2UVVA 2HNDA 2OPSA 4EYIB 2ALZA 2XWYA 2OPSB 4B3OB 3OL6A 4ED6A 5DLFA 1S1UB 5KFDA 3SI8A 1LW2A 4EBDA 3LP2A 3MEEA 2HMIB 2D41A 4U6PA 1S9FA 3HVTB 3TAMA 3UDLA 3BREA 4J9LA 2EC0A 4IH6A 1N5YA 3JSMA 2FLLA 4XPCA 4RW4A 4IDKA 3KLGB 1S48A 3DI6B 2VA2A 4RW9A 5J2QB 4URQU 3UPFA 3KK3B 4ZP9A 1JLQB 3H5YA 4FS1A 5C25A 2BRKA 2I1RA 1T05B 4RNMA 5KFUA 3LP1B 5KFKA 3NGDA 2DPIA 3KLFA 1DTQB 2ATLA 4IR1A 3KLIB 4NLQA 5KFFA 3V6DB 4ECUA 3T5LA 2JEJA 1RT7A 3DLKB 3LAMA 5EWFA 4J9PA 3MEGB 3TVKA 5J1EA 3CJ5A 5KT6A 4J9OA 2ZE2B 4TXSA 1HMVA 2WCXA 2D3UA 1S6PA 4RNNA 3RBEA 3V6DA 2DPJA 5DQGA 4JV2A 3RB0A 2AWZA 2HWIA 3MR6A 3OL7A 2AX0A 3QO9B 3M9OB 2YKMA 3PW4A 3KLHB 4KFBA 2YNHB 4ZVFA 2YNHA 1JLBA 4O3NA 1UWBA 4RUAA 4K4VA 5DG9A 3QLHA 4QWCA 3KK3A 3EPGA 4IH7A 3QZ7A 2ASLA 1GX5A 4IFYA 1TVRA 3JYTB 3EZUA 2BANB 3OSNA 4YR3A 5HLFA 4KHRA 1S9GA 4NLGA 1JLAA 5F8MA 5KG7A 5DLGA 5KG2A 3OLAA 5J2MA 3CJ4A 3N6MA 2WK4A 3IS9A 3KJVB 2C22A 2XGPA 2E9ZA 4G3IA 1S9EA 3CJ3A 5C42A 1RDRA 2QE5A 5KFXA 3OHBA 3IN5A 2VG5A 2FLPA 1IKYA 4Y3CA 1LWFB 2JEIA 1HNIB 5KFLA 1HQEA 3KK2B 2ZKUA 4IRDA 4EBCA 2E9RX 5L9XA 4IRCA 4ID5A 2AGQA 2VG6A 3KLEB 2BE2B 3I5CA 3DRSA 1HYSA 1S6PB 2R8HA 1XR5A 2ZE2A 4IDKB 4KO0A 3KLGA 1BQMA 2F8EX 1JLFA 3ITHB 5KT7A 4RW8B 3JSMB 3Q8RB 4ZPAA 4WZQA 1REVB 1DLOB 4R5PA 3TQ1A 2HMIA 3ICLA 3DRRA 2W7PA 1WNEA 5K14B 1S10A 3GV7B 2W9CB 5C25B 5I3UB 3H5UA 3Q8SB 3IRXB 3HKWA 1KLMA 5DG7A 4YMEA 4F4ZA 4TY8A 3GIJA 2J6UA 5I3UA 3KHHA 3T1AA 4RUCA 3BQ1A 1BQNB 4PUOA 4TYAA 3UR0A 4NLVA 4KHMA 4ZP8A 5F8HA 1MMLA 3H4BA 2XI3A 1RT1B 2VG7A 3GIMA 3LALA 2ASDA 5CYMA 1S1UA 3D28A 4Q0BA 4NLXA 3SFUA 5KFHA 1TV6B 4K4TA 2W9BA 2VA3A 3NAHA 4O4GA 3T5HA 3PZPA 4J9MA 2O5DA 1EETA 1TKXB 3KMQA 1TKXA 3I5BA 3PR4A 5KG3A 3Q8QB 3GQCA 1S6QB 5J2NA 2XCPA 3I0SB 3MTKA 4IOBA 4R8UB 1NHVA 1GX6A 5F8IA 4O3SA 1TQLA 4K4SA 4ECWA 1S9EB 4WE1A 5JUMA 4I2PB 3IS9B 4KKOB 3BJYA 2ASJA 5KFIA 1HQUB 2R8KA 1S1TB 3T5KA 4IG3A 2HNZB 5FDLB 5FDLA 4IQXA 2IA6A 2FVCA 3DM2A 2YNIA 2HWHA 2E9TA 1TKZA 2I5JA 1IKXB 5L1IA 1C0UB 2YNGA 3MFHA 4O3OA 1S97A 1TL1B 3PW0A 1S0MA 5CYMB 3QO9A 5HROA 3E01B 3MFIA 2IJNA 4QW8A 4ZHRB 3KHLA 3CWJA 3OSPA 1REVA 4J9QA 5KFVA 2ZD1A 5DQHA 2IBKA 5J2NB 2JC0A 4I7FB 4ED0A 2XCAA 1JLAB 2HAIA 3QGGA 4NRTA 2WB4A 5KFNA 1C0TB 4QW9A 3JYTA 5DGAA 1C1BA 1DTTA 4KBIA 4QWBA 4RNOA 3FQLA 2IMWP 4MIBA 4F4YA 5KG0A 3PW7A 1RTDA 2VG5B 4NCGA 4PWDA 2V9WA 5KG5A 1JLEB 4R0EA 5C42B 2CJQA 1QUVA 1TKTA 1SUQB 1SV5B 4H4MA 1VRTA 4PQUB 1RT1A 2VG7B 3CVKA 4KB7A 3MR5A 3GIIA 3H5XA 1C0UA 1RT6B 2FVPA 1BQNA 1HMVB 1IKXA 4PUOB 4MK7A 5KFRA 4ECRA 3KOAA 4KO0B 2XGQA 2BR0A 3KMSA 5L1LA 5C5JA 3E51A 2BE2A 4URGA 4NYZA 4ZVEA 1RA7A 5EWEA 2FVSA 4J9NA 4ED7A 4I7FA 3BR9A 1SH0A 1UWBB 5KFSA 1TV6A 2R8GA 2RF2B 4OL8A 3GYNA 3DOLB 5J2PB 4KE5A 1MU2B 3PW2A 1JLQA 2UVUA 4NLWA 5F8LA 5F9NA 1RT5B 5KT2A 3G6XA 4LSLB 4RW9B 4IFVB 1JLCB 1RTJA 4G1QA 5HP1B 2JC1A 3H40A 4K4ZA 1JLGB 2UVWA 5KFWA 1YVFA 3V6JA 4Q8FA 1FK9B 1W25A 4F50A 1Z4UA 3LP0A 4NZ0A 1S1TA 4WYLA 3M8PA 1RYSA 3CIZA 3CJ2A 3KK2A 4IKAA 2W9BB 1HNIA 3NBPB 5KG1A 5KFCA 4DL6A 1IKYB 2J6SA 4Q0BB 2UVRA 4RZRA 3BSNA 4ECVA 4WXWA 5KFMA 2IJFA 2IM0A 3C6UA 4NLSA 4ECYA 4QPXA 2XC9A 3EPIA 2B5JA 1LWEA 2OPPA 5L1KA 4O44B 4RW8A 1S6QA 3PVXA 4EYHB 1JLFB 2ILZA 4NLOA 1ZETA 4IR9A 3NAIA 2JEFA 2GIQA 3C6TB 4TLRA 4IRKA 4LSLA 4ZP7A 5KFAA 1MU2A 4TQSA 3IGNA 3LP1A 5J2PA 4O4RA 2RF2A 4FBTA 4EO8A 4J9KA 1T05A 1KHWA 1JKHB 2OPRB 4DL7A 1RYRA 2GIRA 4Q44A 3M8PB 1JXLA 2UUTA 2WONA 4F4WA 2UUWA 2WOMA 5J2MB 3FDSA 1JLGA 2W8LA 1ZTTA 1LWCB 1QE1B 2RKIA 3QZ8A 3DLKA 2R8IA 1LWEB 3DRSB 3G86A 3OLBA 3KLEA 3MF5A 3KLIA 3M9MB 3MEDB 1TKTB 4ED2A 4NRUA 2BQ3A 2FLNA 5T14A 3BQ0A 4WXOA 2B6AB 3NBPA 4YR2A 1IKVB 4ECTA 1FKOA 3KLHA 3G6VA 3G6YA 1S0OA 4QWEA 4ICLB 1QAJA 1NHUA 3V4IB 1DLOA 3FSIA 1C0TA 5KG6A 3M8QA 2IM3A 3C6TA 4ECSA 3ITHA 4X2BA 1EP4B 5DGBA 1K1QA 3NL0A 3I5AA 2B43A 4M94A 1S9GB 4ZP6A 4I2QB 4MFBB 3RB6A 3I0RB 2WONB 1SV5A 4WFZA 3GV8B 3V81A 1DTQA 1JLEA 4DL4A 4ZVHA 1HQEB 1JKHA 2OPRA 1U09A 4WFXA 2V0NA 2W8KA 2W9AA 1RTDB 3DOKB 1TKZB 4ED1A 1TP7A 4FS2A 5F8JA 4RW6A 3BSAA 4WFYA 4NLPA 2FJWA 4O3PA 3CDWA 2YKNA 1C2PA 2WHOA 2RDIA 1QE1A 2XI2A 5KT3A 1OS5A 5EUHA 3DYAA 1QAIA 2ZD1B 3LAKA 3IGVA 4YP3A 4KV8A 1HARA 2HNYB 4ZHRA 4ICLA 1J5OB 5HROB 3BSCA 3HHKA 3KHGA 3FRZA 4XO0A 1JLBB 2R2TA 4O3QA 4DEZA 2B6AA 4Q45A 3I0SA 4ZPCA 3QGHA 3N6NA 4KFBB 1N48A 3T19A 5KFTA 2C2DA 3V81B 3ISND 5F8NA 3I0RA 5KFEA 5J2QA 1SH2A 1XR6A 1FK9A 5F8GA 3RAXA 3KHRA 4GC7A 3PJWA 1RAJA 4Q8EA 1HQUA 3H5SA 3MEGA 3DLEA 3M9NB 1SH3A 2WOMB 1RT6A 2V4RA 1JLCA 1RTJB 4M95A 2YNFB 2GC8A 4NLTA 2W7OA 3DRPB 4K4YA 1VRTB 3CJ0A 4JV1A 1RT2A 3GILA 2J6TA 1RTIA 4PWDB 1D0EA 4B3OA 1S0NA 2HNDB 2OH2A 5L1JA 3OL8A 5D3GA 2YNIB 2IC3A 4LSNA 1JIHA 3DLGA 3MEDA 3NKYA
chains in the Genus database with same CATH superfamily
1OPIA 1U0HB 3NLCA 2ZM6J 4CLKA 2R8JA 1U0HA 4DR2J 1AT1B 4OX6A 1HLWA 4Y6IA 4B3SJ 4I67A 2HIQA 2W4DA 3D1OA 1QTMA 3D66A 1PJ6A 1Y4ZB 1IKWB 1T94A 1ZAVA 5F3ZA 2ZH8A 2HHWA 2VDIA 2W9CA 5HI7A 3CO9A 3HVTA 3TAMB 3GV5B 2AX1A 3I87A 5KFPA 2KRBA 4DFJA 1FJEB 5I42A 2CKWA 3K89A 3PW5A 4KTQA 2ZNYA 1YZ6A 3RBDA 4U67Q 4N56A 4M63A 3HHLD 4R8UA 5LMUJ 3AQPA 3M2VA 2R2UA 2FC8A 4HT7A 4CLZA 1D8ZA 2I9SA 4YFUA 2N3OA 3G8SA 1E6VA 2B9EA 1U47A 3LP0B 2C2NA 4QU7A 1X5SA 1EKRA 2YKAA 1KHVA 1PAUB 3KFWX 1SC6A 3Q2SC 4KYZA 2HFUA 4TYBA 4PXDA 2C1EB 3JQJA 5A8WA 2O1PA 1WKLA 3EGVA 3MCMA 4OHZA 4X62F 3OUYA 2YY3A 3IBWA 3CCJS 2YKPA 4LMZA 1R0AB 3IAM9 5SZTA 2V2QA 4MIAA 2CWKA 3UVJB 1RI7A 2VH7A 2ZDPA 1RA6A 1S4FA 1TMJA 1F5BA 2DNLA 3SDEA 1RWWB 1UEKA 2KRRA 2WRMA 2FVQA 4ZPDA 2RB7A 2UU9F 2XZTB 3LOUA 2AIRB 3HDSA 1EETB 4TNOA 4C98A 2IVMA 2KFNA 4W90B 3SQOP 3G82B 3PFEA 4A8OA 3GB0A 3VAFA 2CZ4A 4ELVA 4KKOA 3TA1A 4G1QB 3K7RA 2XHCA 4WKYA 2K8GA 2QGFB 3VVUA 3WX4A 4M5GA 4CT8A 3IR5B 4IOCQ 3GG1A 4YOEA 1PYOB 2KZZA 1YIJS 3PHEA 3CD6S 4NCGB 3CGIA 2WSFC 4H4OB 1T02A 3KNGA 3M1VA 4HKQA 4RO0A 5DZ6A 3FVYA 4C3KA 2LEBA 5HL7Q 2QLBB 3CDAA 3D5MA 4HYKA 1XIQA 2GGPA 3L9ZA 3ZFVA 4KGKA 3VAMA 3HSJA 3NMAA 3TJ8A 2HHUA 1N54B 3FBCA 1SJ1A 2CQGA 2W01A 3JSYA 4DV1F 4RW7A 1P1LA 3ZXWA 3N6LA 4CLLA 3EXYA 1CS4A 5K8OA 1T9WA 1IKVA 5F9LA 4P52A 1AW0A 1ZZFA 2L3MA 3OFHA 1N4LA 3OL9A 2HLUA 4RBTA 3WC0A 1KOOA 1TZ0A 1IQTA 4UUWA 1GTHA 3RW6A 4O3RA 3FEZA 1MMNA 3L4BC 4OI4A 1FEHA 1RT3B 4X66F 3LW5C 4WK1A 5IT9U 2CVEA 2DXFA 1FI4A 3P5TL 2LQ5A 1C1BB 1OYDA 1PAEX 5CYQA 2BANA 3F41A 3M2RA 3FQKA 1WHWA 2JFDA 2WVEA 1R3NA 1YBAA 3MDFA 2BW2A 2OMOA 5LT5A 4ZVOB 3ISNC 4DL0C 2H9ZA 2OD6A 3SCIE 3U1NA 4EO6A 3CTRA 1WWHA 2MZSA 1LWFA 5AE3A 3A12A 1KTVA 3SFGA 3Q23A 1L3UA 1NSPA 2XG8A 1IBMF 4IYQA 4HT5A 3UE2A 1FTRA 4DOZA 4ED8A 3R2DJ 4ECZA 1SQFA 1ZBTA 2K2PA 3MTJA 3TO8A 1LWCA 1UW4A 1WG5A 3DRXA 3MCOA 3FSYA 3QNWB 3QT7A 4OZLA 3OVBA 1KVJA 3MD3A 1WTFA 4NLRA 3HP6A 1N5YB 4DL2A 3TANA 3OTCA 3MXHP 4X4VA 4IUFA 2OGUA 4USVA 3PKMA 3NS6A 3PJXA 4ERDA 3ZC4A 4DCJB 5LJ5Y 3HD2A 4KAIA 1FX4A 2MXYA 1HNVB 1ZTWA 4ECQA 3TAQA 3QT5A 2HVHA 2RE1A 2K1RB 4DV6F 4DV3J 1IBCB 1NJWA 1FD8A 2LYVA 3HVAA 1LXNA 4YB7A 3DRPA 5KT4A 5M2UA 4DQIA 3O5TB 1RLDA 1U02A 3PM9A 4RNFA 5HQMA 1PILA 4LFBF 2DXDA 1R6YA 4J9RA 7FDRA 4F2RA 4ZLLA 2BEFA 1HNXF 2FD2A 3BH6B 4YY3J 1Y5LB 1DQAA 3ILJA 4ES3A 4B3MF 3R7BB 4L74A 2CG4A 2LA4A 5B0DA 2GVZB 2BM0A 4U7CA 4KC5A 1T03B 4LR7A 5HVHA 3W2WA 2PE8A 3F0NA 2ZH7A 2GQ2A 2OPSA 4EYIB 2XWYA 2OPSB 1HBNA 4ZIWA 4YDXA 1EARA 4J9UE 2HMIB 1WI8A 1YLXA 4V19X 1DBDA 4DUYF 1WACA 3JSMA 2FLLA 4XPCA 5D4PA 1N5QA 3G71S 2BACA 2HVIA 3R6GB 4DV5J 4C7QA 3MURP 1FRJA 1S4EA 2Z58B 3TUPA 2CRLA 1KQKA 4RW9A 5J2QB 5ETMA 3CCQS 1WOSA 4MKYA 4DR6F 4U7UK 4J91A 3MM9B 5GAHU 4FS1A 3H5YA 1GEHA 1PIEA 1T05B 4ZPTR 3FNNA 4F67A 3CMAS 4J5OA 1RJJA 5KFKA 2X51A 3SMZA 3AH6A 2ATLA 4DX5A 5F0UA 3BDEA 2GVZA 3TEHB 2IJRA 4WBFA 4TLQA 4UZBA 3NWGA 4DQRA 2VOOA 4ECUA 2E9RX 4AL5A 5EWFA 1CJUA 1N5SA 2Y3YA 1M1HA 2CJ9A 2YWGA 3BBFA 4J9OA 3O8WA 5KT6A 1VLOA 3LTOA 4ILMA 2CIMA 4PR6A 3C66A 1U26A 4OHYA 5DQGA 3Q2TC 4WIQA 1HHQA 1GMWD 2B4PA 1SVDA 2AX0A 3QO9B 5CXTA 1OPZA 3KLHB 3ILOA 1HHSA 3JTPA 1JJ2R 1MMDA 2LCWA 2YNHA 2VPZB 4ZDNA 5JVHQ 4OZ5A 4C3LA 3BO4A 4K4VA 1V3RA 1HR0F 4LF5J 1KNZA 3HVRA 4IH7A 2G2OA 5HLFA 3N01A 4FNIA 1S9GA 2JOQA 1FA0A 2MHEA 4NLGA 5KG7A 5KG2A 1UMJA 3OLAA 4DQSA 2EBEA 2G9OA 3KJVB 1DQ8A 3QATA 4MT1A 1TU0B 2H4WB 1S9EA 3B78A 2BJ1A 5HJXA 3PO4A 3KG0A 4OYWA 2BMBA 5B0EA 3M30B 4JI8J 2XULA 1REGX 5IV3A 3G96A 4LF4J 2VG5A 2FLPA 1IKYA 2QMWA 1LWFB 1NK5A 1JB0C 3KK2B 2ZKUA 1OQ6A 3BKTA 4D3HA 2CQ3A 3M4XA 4ZN1A 5LSLA 2ZH1A 4GKKJ 4F02A 1BHNA 3C8YA 1W7WA 3L3CA 1H2UX 2Q6CA 4ZKAA 4U8VA 1HNZJ 3HO1A 2DGUA 1S6PB 2R8HA 2WVFA 4K8RA 2ZE2A 2FHJA 3J81U 5BYRA 4A8SA 2B8PA 3PG9A 4RW8B 4QJVA 3Q8RB 1VHFA 1LFWA 1HWUA 5DETA 4O0IA 3NOGA 2X1FA 2DKOB 3BGFA 3D4JA 3ICLA 4P9SA 2W7PA 1HA1A 1X5OA 2JLGA 4ETXA 1QSLA 5F3TA 3AXMA 3MUVP 3BO2A 2EKYA 2LDIA 3BS9A 4HEA9 3DCAA 3Q8SB 4X4OA 3DRYA 1RWNB 3OTDA 1F3VA 2H5JB 3ENWA 4F4ZA 2UXCF 4TY8A 3O2IA 1JJCB 5I3UA 2CQHA 3LGNA 4CP5A 2MZ1A 2PD1A 3BQ1A 2M70A 1BQNB 1BD6A 4NLVA 4ZP8A 1SIZA 3H4BA 4GKJF 2VB6A 2Z2YB 4WPAA 4DDFA 3ZZTA 5CYMA 2H5EA 2CJYB 4CTAB 2E1CA 4Q0BA 3OTBA 1LKZA 2W9BA 2VPWB 4O4GA 2DEJA 1X4HA 2KVIA 2JLFA 3CDBA 4I68A 4OMFG 4BWJA 2MY7A 2R7WA 4J9MA 2V8DA 1EETA 5K9FA 1WF2A 1J2VA 1TKXA 2WSCC 5KG3A 3Q8QB 3R1HA 1S6QB 4KQZA 2XSJA 3PYFA 1SL0A 3I0SB 1LNQA 4DX7A 1RWPB 2CNOB 4K59A 3W9JA 4OHVA 1NHVA 4BBYA 1G1XA 1NZ8A 3GSIA 4ZVUB 3DHWC 5IQQA 5K5MA 5F8IA 4B9TA 2DRDA 4JI7J 1TQLA 2QYCA 3MMBA 3MMJA 3IM8A 4ECWA 1U49A 1D09B 1YDLA 5AXKA 2CJKA 2R7UA 3UDEA 2DGQA 4KKOB 1AA1B 4DR1J 4YEAA 5BYSA 1A6LA 3H2VE 3J80Y 2AJ1A 2EW9A 2DGOA 4IG3A 2BZ2A 2HWTA 2KYXA 2KKHA 2OUGA 3D0IE 2JSXA 3PTWA 5DJBA 2UXDJ 2Q1LA 2KTQA 1UJ6A 5CD4A 4MMOA 4DR3F 2KXFA 3UDVA 2AJFE 1TKZA 3NY0A 4P72A 3T1HJ 1K0VA 2DO0A 1CJTB 1RHMB 3IXQA 2XMWA 3TOQA 2Q3PA 2Q43A 4JI0J 2A18A 4N77A 3QO9A 2RHSB 5HROA 3E01B 3DXSX 2P2CB 3MFIA 4ZHRB 2V5HG 3GJRB 1VQ5S 2EVZA 5KFVA 3HJFA 5FD1A 5J2NB 1FRLA 1VMBA 2XYPB 4ED0A 2BJ3A 1JLAB 2HAIA 4ZCIA 1VS3A 4Q5VA 4M5LA 3W1YC 1PJ5A 4Z37A 2RQCA 2MDAA 2VUGA 1UVKA 2DGSA 2ZH5A 2MKCA 3NXZA 4KBIA 4EFAC 1B0TA 3P96A 1CJKB 4OYAA 3FZ2A 4A8FA 4F4YA 2CWXA 5G0RA 2LQ9A 2XS5A 1H2TZ 3PIOQ 3HHLC 2ZHAA 3PW7A 4UTGA 2HAFA 3FMWA 5A0YB 1RU2A 3BEGB 1NEEA 3D1HA 1U45A 2HS0A 2CQDA 3R2CJ 3R97A 4ZJLA 1NH8A 3BSOA 1TKTA 1H7WA 2ZBQA 3CVKA 4DR1F 4DX8H 1XNRF 4A46A 1RB0A 5ETSA 1CJTA 1H3DA 2RUGA 3OQ2A 4BC9A 3PX6A 3DDIA 4JI5F 2KT2A 1WC5A 2LQ8A 3KMSA 1KWMA 2HBQB 2NXUA 5M2RA 1QJHA 4PXEA 5C5JA 5D6GA 4DF8A 2ZH4A 4LR9A 4URGA 4ZVEA 1H2VZ 3PJ9A 1LQ9A 5AXMA 1U1KA 1OJ4A 4ED7A 5DDQC 2R8GA 4OL8A 3GYNA 3L09A 4RL1A 3KUHA 3IWLA 3CXCR 2ACMA 1RT5B 1YX2A 2MQPA 2ATCB 2M0GB 4LSLB 2BYCA 2LXUA 3BF4A 3I56S 4IFVB 1JLCB 1RTJA 5HP1B 3K2YA 3MM5B 3H40A 3MI7X 5ETVA 5CQGA 3Q22A 4DFPA 5D4NA 3W2VB 4NWBA 3R5GA 5E41A 2V34A 3HFZB 1M1KT 4C48A 1F9HA 3BPSP 3V6JA 3KJNB 1BMQB 2HG4A 2XB2D 3CIZA 4EBEA 2JRSA 5FLXU 2W9BB 2PC6A 1H6KX 3KYLA 2UVRA 4ED5A 1KFSA 1D9FA 4LRBA 4CYUB 3GCWP 4RZRA 3BSNA 5KFMA 1FO1A 2IRYA 1NLKL 4C4WA 1TAQA 2IM0A 4AD6A 3OFGA 4DI6A 2XZDB 2OPPA 4RW8A 1S6QA 4XIUA 3EXCX 4EYHB 1XMOJ 1YRTA 3ILIA 2HQGA 3QGPA 2RRAA 1TFYA 4LSLA 1Q4RA 2G1HA 2IHR1 2JFKA 5KFAA 1FFGB 3KG1A 3FMBA 4YHHF 4TQSA 3IGNA 2B3TB 4OFZA 3RZAA 4FBTA 4J9KA 4DL7A 1KHWA 1JKHB 2OPRB 4B17A 2AF6A 1FTCA 2MJUA 4OHWA 3SXLA 1HNWF 4F4AA 2WVBA 4F4WA 5HMYA 1IVZA 2UUWA 1RWUA 3E8OA 3AA8A 5A2QU 1HWKA 3IO1A 2RT3A 2Z2MA 4L6V3 3DFEA 4W98A 1RAEB 1ZTTA 3DLKA 2HHXA 2RUSA 3G2XA 2YPZA 2NYIA 3MF5A 3SCLE 4AT1B 1QLNA 1BQXA 1TKTB 2C3YA 2QMUB 4UOFA 4C8MA 4B9UA 5T14A 2C2ZB 3NEKA 3BQ0A 5CHCB 1U6ZA 2GVDB 1C4CA 4YR2A 3VAJA 2AKWB 4ECTA 2NSCA 2QJ3A 2V2KA 4UUXA 3ZZRA 1S0OA 1VYAA 4C11B 3IAS9 3S01A 1NHUA 3V4IB 5KG6A 1R7IA 1C0TA 1SC1B 3HHNB 3GE9A 3FJ2A 1RHUB 4JB8B 1EP4B 1D3WA 4G65A 3NL0A 2MZJA 4DXLA 4M94A 1YJTA 1Q1KA 2E44A 1QAYA 2KJWA 5JVGQ 1IQZA 1AXQA 3RB6A 5A6WA 4KPYA 3GV8B 1C4AA 1X4DA 3GJTB 5T7LB 3CCWA 2VJUA 3CC7S 3AOBA 1UTAA 3JQKA 2LXFA 3MZIA 5GMEA 2Z2LA 2AW0A 5M2PA 3TVYA 2M2BA 2GMHA 4RW6A 3B54A 4LR8A 4RX6A 4WFYA 1FF2A 4LF7F 4O3PA 1NUEA 3VR1A 2YKNA 1L3VA 1GT8A 1RCOB 2DGVA 4L72B 1U1PA 3I4PA 3MCNA 4DN0A 1RTZA 1QAIA 3BM7A 3TA0A 2KT3A 4C6AA 2BW7A 3WX8A 2DNHA 3ETMA 2PMHA 2HNYB 3RR8A 4ZHRA 2MKJA 3VGTA 5HROB 1RQ0A 4AE5A 3FRZA 3KHGA 2SXLA 3PRVA 4KH1B 1F60B 2Y8YA 2P8IA 2HRUA 4Q45A 3I0SA 3SQGB 9RUBA 2VQFF 4WFBQ 2OD4A 2VFTA 4YB1P 3FBEA 3P4UB 3MM9A 2P6TA 2EFNA 3H90A 4HVZA 3Q0AA 3I0RA 1UZHA 2ZWPA 1VIOA 2W2NP 1XR6A 4DN9A 3RRHA 1FK9A 3W5YA 5L9NA 3RAXA 2DCLA 2PO4A 1I3OB 3KHRA 1ZAXA 4LUBA 2NUHA 2VKRA 1FD2A 1VR6A 3F73A 5ETPA 3HMJG 4M95A 2GC8A 3R6LB 4NLTA 3JAMY 3DRPB 2FPHX 5CZVA 4K4YA 1Q81T 2ZDOA 3MMBB 3UFCX 4DR2F 4JV1A 3ONQA 4HACA 3TW0A 4CRJA 2KVQE 4OZ0A 1S0VA 2AEMA 1KS2A 1HHTP 1D9DA 1HBNB 4ZA1A 1EKSA 1NRKA 1Q16B 2X1BA 3FBFA 2V6AA 3OFFA 4OJ3A 2J9DA 2U1AA 5D3GA 4QIGA 3OL8A 5L1JA 4W92B 4DPOA 2YNIB 2CNNB 1FWKA 2K3IA 1UKUA 1JIHA 3LQVA 3DLGA 2CJAA 3M8SA 2VF3A 1FESA 3NKYA 1IBKJ 3EGZA 1E6YB 2XO6A 2PFFB 2OPQA 3FFIA 1Y7PA 4UZCA 4FF1A 1ZYQA 4O4GB 1RT4B 1VRUB 1I6JA 1SC4B 5C24B 2B5JB 2XTJP 2BQRA 3W8PA 3IG1A 3PIPQ 3KWMA 1ZOTA 1N56A 1IM6A 3MECB 1IBLJ 3KK1A 1ZS6A 2CPJA 2RH3A 3SV4A 2AHOB 1X5TA 4RLEA 5DQIA 1HNVA 2X7IA 2MKIA 3GLJA 2XSJB 5CH7B 4D3GA 2GCFA 3MPWA 2GMJA 2NS1B 1X4FA 4RJVA 1IJFB 2B7BB 2BRLA 3MPUB 1YHQS 4IR9A 2OTJS 1S1WA 2IAJA 4MH8A 4KGVB 1N88A 2CPXA 2E66A 2AMCB 1M5HA 3MR3A 1AFJA 4ANDA 9ATCB 4X4QA 5E3AA 3DMJA 1IR0A 2FVRA 3CT9A 3HI9A 4ZVGA 3GFHA 5GAHI 3HFKA 3OTEA 4H4MB 2A0FB 4CTAA 4K2JA 4DCOB 1TK8A 4B9NA 4NXNF 1TL1A 4B02A 1T9VA 4URSA 4YDDB 4LT6A 1J5OA 5HQLA 5GMKa 3DOLA 1FVQA 1F2GA 1JWWA 2VODA 4WZMA 4IH5A 2QL7B 2R7XA 4AQYJ 1U1MA 2UP1A 4WWSA 2UUAJ 4K4UA 3NGSA 1FKPB 4P10A 1XK8A 5HLFB 2CA9A 3BGOP 4OV6A 2A6OA 1TVRB 2R7RA 5EDWA 2FZCB 2Y9HA 2AU0A 2NXJA 2WTFA 3MOJB 4FKXA 3M8ZA 3MMAA 2GW8A 4CT9A 4F4XA 4QWAA 1VQOS 1G3OA 4ZCLA 3M1VB 1VDHA 2ZBCA 3M30A 4QR1A 1RT2B 3PYEA 3MECA 2CG8A 5ETNA 5IT0A 4JI2F 3J7YU 1NM2A 2A1BA 4C8YA 2NREA 2LA6A 2YNFA 4USMA 4ZMMA 2R7VA 2DHSA 4LFAJ 3CCUS 2I5JB 5J1EB 3DM2B 3I82A 4RW7B 2APOA 2HBZB 4CH1A 1RAOA 1UVLA 1E6YA 2P5VA 1N0VC 4DV7J 4FXDA 3O1LA 1ZA2B 2IM1A 5KG4A 2BE7D 5B0CA 4LBIA 1FDAA 2IC3B 2XWXA 2UV8G 3VVTA 4ED3A 5H9EK 2MMYA 4HH0A 4UQTA 1DZ5A 2KM8C 1WHXA 2JJ4D 3Q8UA 2EFOA 3QYYA 2MSTA 3UVJA 5IFMA 2YTCA 1RKJA 2K7JA 4AQYF 2AGPA 3K0JA 2DD8S 2AEFA 2FTRA 2MPUA 2DXEA 2CPEA 2VICA 1WHVA 2ZKTA 3TR5A 3PNIA 3OTOJ 2OLWA 4B9VA 1CLFA 1K73T 2FIUA 3B6BA 4NZ6A 4F0MA 2KB2A 4DL5A 3D1QA 3ISZA 2QA2A 2C2KB 4U95A 4WFAQ 2V8PA 2ZZMA 3D0GE 2YWWA 4ILLA 4RNHA 3HHLA 3IFEA 4PKDB 3W63A 4DV2J 5C2GA 3GCXP 5LL6d 3OR1A 4JV0A 4X4RA 4WE1B 4PQAA 3D6HB 3CDUA 3J7AN 3BH7B 2CNLB 1T03A 3DDKA 4WP9A 4I0WA 1HFEL 4DV1J 4IG0B 2OO4A 2YNGB 3HD1A 2BJ9A 3PYGA 3QMQA 3G87A 4HHUA 1RT4A 2R2RA 2BX6A 4J9SA 3V6HA 1T3NA 3IR6B 4OYOA 2L08A 2PI5A 2IVFB 3MR2A 3M8QB 3UI3A 2BE9B 3C6UB 1VK3A 4I6WA 3LP2B 1ELOA 1GXUA 1OY6A 2J7KA 3BBCA 4OI2A 1UFKA 2ROPA 2AZ1A 2HS4A 3C15A 5E3CA 3W7BA 2MZRA 3HF5A 3SQGA 1U1LA 1VBXA 3H7HB 1NKBA 1HWJA 5D0GA 5E0OA 5IWAJ 3VALA 4C8NA 1EX8A 2VJVA 3LWMA 4GC6A 4H4KA 2XS7A 3KUEA 3FSXA 1KEKA 1H74A 3CDEA 2K3KA 3RR7A 2JNJA 3HLUA 2ZJRQ 5AT1B 4Y00A 3P49B 3GIKA 1FDBA 2F4FA 1EJ7L 3GMGA 1AZSA 4P6QA 1IJEB 1F0XA 4EEYA 4ELUA 4QBUA 1CJUB 3R5AA 2YKNB 2BJDA 2LU1A 3I4HX 3GTYX 3P5BP 4IG0A 3R7SB 1T3OA 3JSBA 2VBXA 1NSAA 1MN7A 2AZ3A 3CJKA 1XNQJ 2PDAA 3FUYA 4TY9A 3RAQA 5D3GB 2FJVA 1N52B 3OR1B 3OL6A 4B3OB 4ED6A 3R5CA 1NK4A 2HYIB 2D9PA 1VQSA 5KFDA 1U6BA 3R27A 3LP2A 2D41A 3QT8A 4U6PA 4OX9J 1S9FA 3HVTB 3TAMA 4USJC 4J9LA 2EC0A 2Q66A 3T9NA 4IH6A 2DVIA 1N5YA 2Z2ZA 2G2YA 3IP0A 2XQCA 2KHDA 3C16A 3JTNA 2XNQA 4IDKA 3KLGB 2AYMA 4OI1A 3J81Y 2ACYA 1ZM9A 2VZ9A 4QR0A 5GAEU 1HBUB 4ES2A 3HPOA 2JVRA 3AFGA 1BUXA 1S57A 1JLQB 1NDCA 2EC2A 2I1RA 4BHQA 5K8NA 1K9MT 4GO5X 3D67A 2DR7A 2H4YB 1IBKF 3LP1B 1NAQA 2QO3A 1G2EA 1KVIA 3KUGA 2M3DA 3N5BA 4F04B 1YJ9S 3JXOA 2MQOA 3Q86A 2E5GA 5KFFA 3V6DB 3T5LA 1I1GA 3DLKB 3LAMA 3CO0P 3VGUA 3MEGB 4J9PA 1FJGF 3AD9C 4PYDA 5J1EA 3CJ5A 3VF0B 3D7SB 3RBEA 1HMVA 2E5IA 2D3UA 4MKVA 2O67A 2EFQA 5AXNA 2DPJA 3RB0A 1BWEA 2AWZA 2HWIA 3EVWA 2KU7A 1Y3JA 4HL9A 3TX8A 3OL7A 3M8WA 5IS2A 1GXTA 3HZEA 1OQ3A 1WC4A 4KFBA 4L3NA 4YB6A 3MHYA 3I96A 1JLBA 4O3NA 4EI2A 3QJJA 1UWBA 1LWXA 2FB0A 4RUAA 3C14B 5DG9A 1FXLA 1Y0HA 2DT9A 3PX0A 1NJYA 2R4FA 4A48A 1TVRA 4PWUA 4E98A 3CEDA 2BANB 4U8YA 4M5NA 4PCQA 2BVZA 4PPDA 4YS2A 1VC0A 2NYHA 5F8MA 5CCLA 4OI3A 3N6MA 2WK4A 5J1PA 2XGPA 2VA3A 1MWYA 1HNZF 3EWGA 5HN0A 3JAMU 3IBCB 5BXIA 4LRCA 3RTVA 1VC6A 5C42A 1RDRA 5KFXA 1ZZNA 2R7QA 1B7YB 2D1CA 3IR7B 3IN5A 3Q8VA 4Y3CA 1HQEA 4P7TA 1R27B 3EZ5A 4NYOA 4FDFA 3AJ2A 2IRXA 3KDNA 5GAEI 4Q2MA 2VC0A 4ZPVR 4EBCA 2AGQA 2OTLS 2FJAB 4IRCA 3KLEB 2BE2B 4M5HA 4NA2A 1F9FA 1WUUA 5LMUF 3GYXB 1IR2A 5B08A 4IDKB 3KLGA 1IUJA 1YJVA 4RKUC 3TVZA 1WEYA 2B8QA 3K5PA 5KT7A 1B3TA 2XNRA 4C9DA 3N5FA 4WZQA 1REVB 4AL7A 2CPYA 4R5PA 2AYEA 2N4DA 1WNEA 2PEBA 3GPAA 1R8AA 2DY9A 4DJBA 3GIRA 4X65F 2DNNA 5C25B 2DB1A 3G82A 4DLEA 2MQNA 2C3OA 2E5JA 1WOOA 1CJVB 3DLLQ 3HKWA 1KLMA 1HBUA 1AUDA 4YMEA 1U8WA 1UVIA 1FFSB 1APSA 1M5SA 3WHIA 5IZHA 1ZM2A 2J6UA 1HD1A 1P9YA 1AZSB 3T1AA 2XSFA 1YSJA 2V4JB 4PUOA 3GSDA 2YKOA 1M5KC 3LALA 3ENVA 1S1UA 4LF8F 3Q83A 4H4KC 4R25A 4WTOB 2BJ7A 3W66A 4OX7A 4OZ2A 1G6BA 3AXKA 4KH0B 5HMXA 5KFHA 4NCAA 3NAHA 3PZPA 1GAOA 2KG0A 3J7ZT 3DLBA 4DR6J 1FRKA 3EGNA 4CO5A 4QYZK 1ZH5A 3SCJE 1YWXA 4B9MA 5IT4A 4HI1A 2RQ4A 3M6VA 4DR5F 3GQCA 1Y11A 1FE4A 4NA3A 3SSRA 5CYJA 3MTKA 4R8UB 1AB8A 5HAOA 3W9IA 5H9FJ 2NR0A 4LF7J 2RQMA 1GX6A 3MM8B 1YZ7A 4ENOA 3MM8A 2VIHA 1WF1A 1JQGA 5D0EA 4WE1A 2CPHA 5CCMA 3BJYA 3HULA 2V4JA 3MWBA 3VGVA 2HNZB 1VCTA 1RHRB 2RAQA 4DU7A 1YTYA 2CDQA 1LV5A 1UFLA 1MG7A 1Y10A 2FVCA 1Q0NA 3CCMS 1EIYB 4UY8T 1IKXB 5L1IA 4J90A 4UT4A 5JMNA 2MGZA 2QTWA 2J0WA 3MFHA 3SSSA 4O3OA 2QC3A 2ZBIA 4OZ3A 2FJBB 2GHPA 4NYPA 3PW0A 1S0MA 4JI4F 4JYAJ 1UETA 4QW8A 2E5LJ 3CWJA 3VAKA 2PT0A 1NB2A 3UN3A 5K20B 3TI0A 5DQHA 4CM2A 2IBKA 2JC0A 3BGLA 4I7FB 3N28A 4N5SA 1NHKL 1CJKA 1EAYC 1HWIA 3DNCA 3O6QA 4NRTA 4P2MA 1XMQF 4FF2A 3T6JA 4DV4F 3R9LA 1C0TB 3N0VA 5DGAA 2VBWA 1YITS 1DTTA 4QWBA 2OKQA 2ZBRA 2IMWP 4MIWA 3W62A 1CBKA 2WW4A 2B9WA 5H1SV 5HSPA 4X4PA 2ZH3A 3OXLA 5KG0A 1MNEA 5MLCV 2MKSA 3ZZUA 1RAAB 4PWDA 1X5PA 2QN6B 3AT1B 4ZVSB 2EEYA 4C97A 3VAGA 2CJQA 5C42B 1QUVA 3FEXB 1SUQB 4PQUB 2IRUA 1VRTA 3OPKA 4KB7A 4WFXA 2P9CA 2V2ZA 3DHXA 3GIIA 3H5XA 5KFRA 4PUOB 1HMVB 3D6FB 4OYIA 2HQCA 2VU5A 1N32J 3UNYA 4F2SA 4F3MA 1HNWJ 1F3FA 4NA1A 4YB5A 4DPXA 1MW7A 2BE2A 3HKZD 1WKKA 3RYLA 1V3SA 2CADA 5G4DA 4E2FB 6AT1B 5EWEA 1R0BG 2FVSA 2E29A 2GHWA 3I55S 4WU2A 4J9NA 4X66J 1UWBB 5KFSA 1RWKB 3CC4S 2HFSA 1P8GA 1CQMA 2CAJA 4NI2A 4CH0S 1O0PA 4KE5A 3M7VA 1JLQA 2LEPA 4LIRA 5E2QA 2HFOA 4AUKA 5F9NA 3N9UC 4P7VA 4F26A 1EB0A 3PY8A 4K4ZA 1AFIA 2JC1A 3L7PA 5LMNF 2B4VA 2ZBPA 3I9ZA 3W60A 2YWHA 5KFWA 3AAWB 2Y0SD 1P6TA 4A8WA 1FNXH 4B9LA 1UPPA 2XLKA 1T8EA 1Z4UA 1LK5A 2E1MC 1S1TA 2XHWA 3M8PA 1KVKA 3M8YA 4NZ0A 1RYSA 3QFWA 2CUYA 4K5RA 4IKAA 5KFCA 4DL6A 1IKYB 3HSZA 4Q0BB 1UVMA 1WDDA 4MYUA 4ECVA 4EZ6A 1U0SA 2W25A 4WP3A 4CI0B 2LMIA 4C3MA 4NLSA 4KRWA 4ECYA 2Y0BB 3EPIA 2B5JA 1LWEA 2PA8D 1GTEA 4O44B 3ZZPA 4AL6A 3NAIA 4KGZB 2JEFA 1XN9A 4CM0A 3S1TA 4EU0A 4RUBA 4IRKA 2J0SD 4ZP7A 1SBRA 2QLWA 4OYBA 4P73A 1YJWS 3MM7A 3GFXA 4Y2MA 3LP1A 3EJMA 1PSDA 1H38A 2RF2A 3TYTA 1T05A 2FY8A 3UWTA 1TL7A 5THWA 4I1TA 5J1NA 1X60A 2GIRA 3TWZA 2H65B 4Q44A 5HMWA 1U2CA 2UUTA 2WONA 2Z30B 3CD5A 3M6WA 4R0JA 2A10A 8ATCB 4FKYA 2N7YA 3CSKA 1EQMA 2MLXA 4CO2A 2ZNZA 1U4BA 2DNKA 1RWVB 3FBBA 3Q89A 2HQDA 4S0MA 1FHTA 2R8IA 2RKIA 2LFVA 1NSKL 4JI1F 1NPPA 3DRSB 4I4BA 3OLBA 2DRBA 4Z7YA 3MEDB 1XTZA 4ZVTB 2W7AA 1JNZB 4PXCA 4WXOA 2F65A 2B6AB 3NBPA 1SKWA 2L48A 3HK2A 1CPZA 3R5DA 2KYZA 1FKOA 3KLHA 4DSEA 5EN1A 1HW8A 2RU9A 3NWRA 3G6VA 3X1LB 3CCTA 2HW3A 4WJBA 1QAJA 2R9LA 2J9DE 1DLOA 2E7VA 2ZOFA 3JQMA 4ECSA 2IM3A 3C6TA 3FRYA 3QWPA 3ITHA 2DCUB 3WDOA 1U8SA 3SIPB 1KR4A 1OY9A 2D69A 1Q53A 2P9EA 2B43A 2PEHA 5DGBA 1S9GB 4USKA 3AD8C 3U7JA 5AJ3J 2FHMA 2F8MA 4ZP6A 4MFBB 2YX7A 2MLZA 1KKHA 4NPOA 5K8MA 2WONB 1SV5A 1UCNA 3UNGC 4F7VA 1IXKA 2XMVA 1XERA 2ZH2A 2HHHJ 2W8KA 4OX8A 2W9AA 1RTDB 2GAGC 5U47A 3ZZZA 3G8QA 3DOKB 3RU0A 3D2WA 1TKZB 4ED1A 3C3LA 3CJKB 4B3RF 1TUGB 4NLPA 3CDWA 1N5VA 1RAHB 1JXEA 3QSIA 2XMJA 1T9YA 2N3LA 1MWQA 2ASYA 2O66A 4L76A 1QE1A 1FRIA 2HS3A 2XI2A 5KT3A 2QX0A 2YX1A 3MOZA 2DRAA 2YWFA 3CCZA 4JP8A 2ZH6A 3KTQA 2UUBF 4F3QA 3IGVA 2KZMA 4ZITA 4FYXB 3QWUA 5AE1A 4LRAA 2WSEC 1S6UA 2VFSA 3KJFB 2PMZD 5BJRA 1SJ4P 4XO0A 3PX4A 3PO5A 2B6AA 4ZPCA 2VFRA 1WHYA 1YQHA 3QGHA 1RHKB 1PGZA 3BPDA 1K44A 3QBCA 4Q2LA 2VPXB 2XY5A 5F8NA 5KFEA 5J2QA 1KLNA 2GJ2A 5F8GA 1R43A 2DGTA 4O0NA 2XZWA 3BZQA 1WG1A 2HGLA 3ZZOA 4GC7A 4BDPA 2NSBA 1RAJA 3MM6B 3NG8A 1SH3A 3M9NB 1RT6A 2V4RA 3QAEA 2YNFB 2W7OA 1K0TA 3BO3A 3Q24A 1CC8A 3QT6A 1D0EA 4HH1A 1VI7A 1SJRA 3AHPA 1GMWA 3OJUA 1XMOF 1GK8A 1CS4B 1WI6A 3W2WB 4DR7J 2IC3A 2LDYA 2VV5A 3MEDA 2ZOMA 1RAGB 3GG0A 4H54A 4EO8A 3RG6A 4GVBA 3D0HE 4GVBB 2LEAA 4M5KA 5HATA 1FKPA 3DI6A 2CJXB 2JVOA 2Z8QA 3PDNA 4K5SA 1BWVA 4RBUA 1N6QA 2F7VA 2J5AA 1Z2ZA 2J76E 4L73A 5HK4A 1RISA 1WC0A 2DNZA 4PPZA 5DG8A 1TKDA 3QIPA 1RP5A 3MPDA 4USIA 4I6AA 4XK8C 1RKIA 2FUG9 4PEOA 4ZVRB 3OHAA 2B7CB 2ERRA 4FYVB 2XO7A 3DRRB 3AJ1A 1S1XB 2BXJA 2IA0A 4K4XA 4X4NA 1S1XA 4PG4A 3D6MB 1NJIT 2QV6A 1FDDA 2B4OA 2CQ4A 1HKAA 3BKUA 3DU5A 2FJXA 1IR1A 1UL3A 2QG9B 3FK4A 1NK7A 3K5MA 1QVGR 4E8UA 1B0PA 4U7UD 3UD4P 2QZ8A 1DTTB 2B9YA 3OV7A 4WF9Q 5HBMB 1T11A 5CYQB 2ZJQQ 3UQSA 2NUUG 3DN9A 4G1IA 4OYPA 3RRKA 1O6XA 2CZVC 1K1SA 5BR8J 4CIOA 1J27A 1L5UA 1YJ7A 1D1UA 2OPPB 2IM2A 3ENQA 4B3TJ 2HVZA 2C3MA 2MZQA 1T9TA 4FN5A 1SUQA 4PQUA 1S49A 4OLOA 2VQEJ 1R0AA 1V3ZA 1X4BA 3NOCA 1ZPWX 4LF6F 4CYUA 3D3CJ 2FGCA 3IG1B 1KRPA 1VQYA 1CSJA 2DGXA 3QIPB 3P3DA 1Q79A 3K5NA 3TAPA 2BDPA 2D3ZA 4ZLJA 1VQ9S 3KNAA 2OPQB 3FFIB 4NLUA 3DC2A 3M2RB 1ZA1B 3A8EA 3MR7A 2CJBA 1VQNS 4MKAA 2FYXA 3ZTRA 3GR1A 4LFAF 5EWGA 3LGMA 1YI2S 2BQUA 1RT3A 2KXHA 1RGVA 4I2PA 2IPOB 3CPWR 3H25A 4IFVA 5HP1A 3AB4B 4LBHA 5K14A 2HQIA 2OEJA 3A4TA 3PYDA 3VGSA 5A8RB 3KK1B 4XTTA 3T41A 1G7CB 5I42B 2CFXA 2WZ1A 4A4JA 4FZVA 2F40A 4X64F 4P74A 2CVIA 2V2VA 3US5A 1XMQJ 1R8CA 4ZPBA 3NP5A 4WP8A 4BWMA 4J9VA 1HPZA 4Q43A 4NXMF 1QVFR 3MM6A 3CCLS 2UXBJ 2W4CA 5MAOA 4F8RA 1YBUA 2A6MA 1LW0B 4J37A 4DPUA 4DCPB 4MTPA 3W5XA 2L41A 2MQQA 4NCBA 2J8SA 2OFGX 4KSEB 3EDRB 5DS7A 2VG6B 2G0IA 4FBUA 4ID5B 1K8AT 3DLGB 5HVFA 2XLIA 3GJSB 2JLEA 3ZTQA 2AGOA 1HI1A 1FKOB 5D0RA 1CULB 3NCRA 2DYAA 5KFGA 2EI5A 1KQSR 1TL3A 3QGIA 2YKMB 2Z56B 4CQ1A 4QQBA 3H4DA 5CZXA 4QIVA 2GA7A 2NXNA 2H54B 1HIYA 1IKWA 2G1DA 4LF1A 3DLEB 5KFYA 2C2EA 1H73A 2CXEA 4LF9J 2ALYB 1Q5VA 1EP4A 4A8MP 3L7UA 1Q8KA 4Y2AA 2EK1A 5H9FK 1XNRJ 1Q7LB 4IG3B 4IFYB 1JXVA 2DK2A 2WBMA 3PKYA 3MCSA 1HNXJ 3NNHA 3DXBA 5DM7Q 4B3MJ 3DOKA 1HPZB 1QY7A 3OTOF 2P6SA 3VTIA 3NS5A 4ALZA 5A6PA 2G2ZA 2CQPA 2RHQB 1C1CB 1RWXB 2DIUA 4DF4A 2KFZA 4DV7F 2AQ4A 2MQLA 4FNHA 1MN9A 2V68A 3PFOA 2RIJA 4YR0A 2HNYA 4RWXA 3OR2B 2PIIA 4CH7A 3NCQA 3MUTP 1WORA 2R2SA 2BKOA 3DYAB 2E1PA 1BQMB 3H59A 4WK3A 4ATNA 5A8WB 4DL3A 3PW2A 1QUPA 2CPIA 4UQGA 2B56A 4PWWA 2DO4A 1SQEA 3T1HF 2HQ3A 2OHDA 4FVCA 2HVDA 2DNGA 3VV2B 4LSNB 3NGUA 4NEYA 3QLHB 3BGRB 4C11A 2XM3A 4ECXA 1RAIB 5JXSA 3T6BA 3M2VB 3JS9A 1NNDA 3POTA 4MKBA 7AT1B 3IMQJ 4FVMA 4LRFA 5L38A 3RB3A 4C8ZA 3HVWA 3V4MA 4RWWA 4MK8A 4YQWA 1SKSA 4KHPJ 1OY8A 2RKIB 2CQ2A 4RBVA 2VONA 3CD0A 5D8HB 1TK0A 4FPRA 4LF2A 4EZ9A 5F0WA 3QIDA 4BCAA 2V4QA 5HBMA 4OQJA 4F3OA 1PYSB 4RW6B 1WF0A 2LECA 3BQ2A 3KLFB 2QLJB 2QFJA 1Q82T 4CLFA 1HBMB 3QRQA 2HNDA 4OJHA 1N0UA 1TUVA 4F4KA 4DZ6A 4ZCMA 1S1UB 4PYAA 5IV4A 2LKZA 1LW2A 3B4DA 3W8GA 2KI2A 3QRRA 4PG5A 1WSVA 2W24A 1TK5A 1KD1T 1MROB 3U1MA 2AYBA 4MK9A 2I6WA 2VDHA 4C0BA 2DNRA 3ILLA 1SQGA 4O23A 2OSRA 2QL9B 1GXLA 1S48A 1FRXA 3R3TA 6FDRA 4JI1J 2RRNA 4JV5F 1UEVA 1XBWA 3BB5A 2BABA 4DUZJ 1VBYA 2VA2A 5GAGI 2ZHOA 1NMEB 4URQU 3UPFA 3KK3B 2DNOA 3TZZA 4ZP9A 2NXEA 3C14A 3T9ZA 5C25A 2BRKA 5KFUA 3ZTPA 3TZXA 3FC9A 1IBLF 3A3OB 4NMXA 1DTQB 3UD3P 4IR1A 1QDUB 1N36F 4DQPA 4IOAQ 2MHNA 4LSZB 2JEJA 1WKJA 1RT7A 1NO8A 4USUA 1Q95G 4DPYA 3J7A1 3O3LA 1Q5YA 3B82A 3W9HA 3GWCA 4TXSA 4DFKA 1DARA 3V6DA 1SL1A 2CZ9A 2OI2A 3H2UB 3K59A 2EG1A 1DHMA 3MR6A 4JV2A 1KP6A 3K17A 4ES1A 2FC9A 2AJQA 1KTQA 4F36A 3THPA 2YNHB 4ZVFA 3TJAA 1N36J 2NQPA 1NK8A 1PC4A 5E3PA 2IVYA 2Z0GA 3IBFB 3KK3A 1SXLA 1UJ5A 2XMUA 2ZUAA 4I6YA 4IFYA 2B4UA 4U9RA 3QZ7A 3EPGA 3OSNA 2ZITA 2MLYA 2K7KA 4YR3A 2KL8A 3A8JA 1R8HA 5B7WA 5J2MA 2VPYB 2E9ZA 3J80U 3IS9A 1OIAA 2E7WA 2I2YA 1MWZA 1PG5B 1VQPS 3HX9A 4W4MA 3CMQA 1P1TA 3CJ3A 5EX3A 5IXUA 1N33F 2QE5A 5IM0B 1WSRA 3MUMP 2NXCA 1U48A 2JEIA 1T0TV 2IMOA 3AA9A 3ELHA 4JI6F 1J5EF 2IY5B 2RS2A 4ID5A 1LOUA 3AJDA 5GMDA 1TR0A 2VG6A 4P2XA 1UA0A 3I5CA 1WELA 1HYSA 4ITSA 1XR5A 4QIFA 4DMZA 3IWNC 1BE4A 4V19J 2QLXA 2F8EX 2H51B 1BQMA 3UCUP 1JLFA 2WAQD 1WOPA 2PGCA 2G4BA 2JH3A 2BKNA 4ZPAA 1JJHA 5F41A 3TA2A 1NDPA 1DLOB 1R8PA 1NCLA 3TUZC 2JZ5A 2HMIA 1SJFA 1U25A 5DO2A 1P9QC 2RJZA 1U24A 2M8HA 4B3SF 5K14B 1NXIA 2W9CB 5D78A 4PG7A 4GVLA 4V1Ak 3UN2A 5C7PA 1IWAA 3F56A 3HHLB 4ETZA 4N41A 3H5UA 5DDOC 1DJ0A 1RXOB 2G13A 2HFVA 4I69A 4K2XA 5D4OA 3UD5A 4ZVQB 1M5PC 1VISA 3GIJA 4P2SA 3SYZA 1GMUA 3KHHA 4DQQA 1HD0A 2RRBA 3PRDA 3QAUA 1CVJA 2FJEB 3OXGA 3DGVA 4QIWD 4KHMA 2HVEA 2DNQA 3AOAA 3MGJA 1RT1B 2VG7A 3KXDA 2GX8A 3FZBA 2QLFB 3N4WA 4M5MA 2W2QP 5FIIA 2ASDA 2HHTA 4FPIA 2DR9A 3E3XA 3D28A 3WBZA 5BYQA 2DIVA 4IRDA 2IYGA 1WC1A 1HW9A 1UW9A 4NLXA 3SFUA 1TV6B 4DPWA 2KG1A 2VOPA 2I38A 3C15B 3RRGA 5EGYA 3KDOA 1FJ7A 2L9NA 2BJEA 4CO1A 2QA4S 1TKXB 2LQBA 3CUNA 5CD4H 1N8RT 3I5BA 3PEHA 2W2MP 2N7CA 4NX9A 2U2FA 4LF8J 1VJWA 4N7TA 5J2NA 3GR0A 1VQLS 4IOBA 1VK8A 2F1FA 4U96A 1KONA 2GV1A 2GO9A 3P6YC 2OJ3A 3SZ2A 1AUSL 1H7XA 3S6EA 4O3SA 5D15A 5E3QA 3RW7A 2ASJA 4I2PB 3IS9B 1B4SA 4EUVA 1FWLA 4IO9Q 2PI4A 5KFIA 1HQUB 2FZKB 4XDDA 5E7OB 4C2MA 4CZCA 4LBPA 1Y5IB 1S1TB 1RADB 1RZMA 3CJTA 3T5KA 4K0KF 5IC4B 1VJQA 2OIHA 1TAUA 2MY8A 4CDIA 1VFJA 3TNVA 1X9MA 2ZOGA 3TARA 3K5OA 1RU1A 4P75A 3H8YA 4QYRA 1C0UB 2YNGA 4Y28C 3RBZA 4CO3A 3CJSA 1CC7A 2QA4G 2DH7A 4QIEA 1S97A 2DH9A 3PRBA 5CYMB 2UXBF 1Z2LA 3GFYA 2YWKA 4X84A 3KHLA 2QEXS 4NI2B 2HHSA 1REVA 1HI8A 2NPFA 3TJ9A 2ZD1A 2KO1A 1L3TA 2M9KA 2AT1B 2XCAA 2ADCA 3QGGA 1WJ9A 5KFNA 4QW9A 5DRKA 3ULHA 4FYWB 4RNOA 4JI4J 2KXNB 2CNKB 4P71A 1T9XA 4MIBA 3WIVA 4DUTA 3HT3A 2UUCF 2CPZA 4QU6A 3O44A 4QCLA 2BJ8A 2IFXA 3EVMA 4JBCA 3UCGA 5KOWA 4NCGA 2V9WA 2H5IB 4DHVA 1D9AA 1JLEB 2CQBA 4H4MA 2G0JA 3MR5A 4OYXA 2NZCA 3VAHA 4K0KJ 2NPIA 1OO0B 1C0UA 1RT6B 1BQNA 4MK7A 3KOAA 2HFZA 1FXRA 3A13A 4KO0B 2BR0A 2ZH9A 5L1LA 1X7VA 2HRTA 2NLWA 3W3SA 1YK9A 3I9V9 3D3BJ 3R5JB 4OHXA 3NNCA 1RA7A 3SDEB 3UCZP 2C2MB 3BR9A 1HQ2A 1SH0A 2VC1A 4DV0J 1TV6A 2QIFA 4JI8F 1NK6A 3DOLB 1ACMB 1NPKA 1P27B 2CQIA 2HHPA 2JDJA 4KGMA 1MU2B 2EK6A 2HK3A 3DLJA 5F8LA 3EE3A 1S5ZA 2NCKL 4B08A 4UOCA 2MKKA 3G6XA 2M8DB 4G1QA 1M0SA 5LSRA 1QTNB 1VQKS 2BV3A 2HGMA 2IDEA 3D68A 1JLGB 1L3SA 1UAWA 1FKAF 1HI0P 3MMCB 2QFIA 1SPBP 1W25A 2UZAA 2DH8A 4N47A 2A3JA 2J7UA 2LQJA 3CJ2A 5I3PA 3KK2A 4CLUA 1A7GE 5KG1A 3R5BA 2H3EB 3AQOA 3HSGA 2OAUA 2M88A 2BUNA 3QJPA 2IJFA 2ZM6F 3C6UA 4QZVB 1H98A 2J9CA 4L75A 4QPXA 3OUYB 2UU9J 4OI0A 3PVXA 1JLFB 2IBOA 1VLYA 2J0XA 2GIQA 1PCAA 3C6TB 2X1GA 1OMSA 2VBYA 3BV8A 3EICA 3TX0A 3HHDA 1VC5A 4YUDA 1PO6A 2F9JA 1FJCA 3VWSA 4DUYJ 1RCXB 1SKRA 2VASA 5J2PA 1U1RA 4JI3F 1HBOA 1YGYA 1RYRA 4CO4A 1TL5A 1JXLA 2OELA 3NS7B 1LFPA 3PCOB 3TZYA 4WTYA 3CJRA 3J7YI 4ZIVA 2XMKA 5J2MB 3MAHA 2OP5A 2R7SA 4QYZJ 2R7TA 1JLGA 1L3KA 2W8LA 1I94J 2X3GA 1QE1B 4OZNA 4ANCA 2Q6BA 4KR0B 1LWEB 1U2FA 2GQCA 4GRSA 1FDNA 3KJQB 3GYGA 4DSIA 3K58A 4ED2A 2F5GA 2MKYA 3MD1A 2FLNA 2D9OA 3QRPA 2F4VF 4A8KA 2O01C 1FERA 3KG4A 4JI2J 2DGWA 2MQMA 3CIMA 4C0HA 4QWEA 1UA1A 3HSDA 2HHHF 3M8QA 1HR0J 4X4UA 2RSQA 1K1QA 2FHKA 1ZM3A 5B0FA 3OXFA 1BY9A 3UN5A 3I0RB 1NPRA 3W65A 3VAIA 2HSEB 4DL4A 1TL7B 2QSWA 4ZVHA 1IBMJ 1KN6A 1GNKA 1UFWA 2BOPA 7FD1A 4DBQA 3CJQA 2ZVIA 1YG0A 1BC6A 2BKPA 1TP7A 4FS2A 2GO8A 2PA3A 3AOCA 2QYGA 1V9OA 1AYEA 5HO4A 2VQFJ 2UV8A 1R31A 2R7OA 1C2PA 4P2FA 4C8OA 2WHOA 2RDIA 1I51B 2WBRA 4OI6A 2V63A 5EUHA 3S8SA 5A8KB 3U1LA 5B0BA 2ROGA 1R89A 1Q8IA 1V5VA 3M2UA 2UUCJ 4KT0C 3FGVA 1HARA 4L3KA 3QFHA 3BSCA 2YWEA 5HANA 1FE0A 1UZDA 5E5NA 2K1RA 4LREA 4LFCF 4ZLPA 4O3QA 4DEZA 2GVDA 2ZJPQ 3JB9k 3RBXA 3N6NA 4KFBB 5IT9Y 3MMAB 1DAXA 3MM7B 5EX0A 4ELTA 4X4SA 3WIUA 1X9WA 5LXRA 4Z7CA 5ETRA 2VBZA 5HJYA 4YY3F 1T7PA 5A76A 2CDRB 2F8HA 2YXLA 3PJWA 4ER8A 2MQ8A 4M1KA 1HQUA 3H5SA 2ZFHA 3MEGA 1DURA 5AXLA 5DDRC 3LA0A 2WOMB 1SB6A 4LRDA 2ZHBA 4KJIA 5L46A 2Y1RI 3CMES 2XMMA 4CLSA 1RT2A 1RK8A 2XMTA 4PWDB 2JX2A 1FWPA 3GU0A 1S0NA 4PABA 2RNEA 2HURA 4NEZA 4LSNA 2HKEA 3ZNUA 4NLDA 1RUSA 3H20A 4MYTA 2FQQB 4AXJA 1CQNA 1F5CA 4Y34A 1PBUA 2KDOA 1TMMA 3H98A 3T5JA 2DTJA 5FLXY 2AJ4A 1VBZA 1ZM4A 3H2LA 1JNRB 2EG2A 5HVGA 3E2EA 4Y0FA 4GKKF 2JL9A 4M5DA 2A2DA 2C2OB 4TQRA 2J7WA 2J9EA 4I56A 1S59A 2HBRB 3LPEA 4Q8EA 4DS4A 2R42A 4DG1A 1F6TA 2WVCA 3HJVA 1F1BB 2ZZTA 1NU4A 4JUZA 1Q7YT 1S1WB 2IAJB 1G4CA 1OYEA 4RUHA 1S77D 4LQ3A 2HNZA 3DLHA 2C28A 3IRXA 3A3PB 4PG6A 2GGPB 4A47A 4AYBD 4FYYB 4CLWA 3HXMA 1NKCA 3PXGa 2CQ1A 2L9WA 3LO3A 3HHEA 1U1NA 3NGKA 4ZN3A 3MEKA 1ULRA 4H4OA 2DJWA 1XNQF 3CW2C 1RTIB 3OW2R 1N5TA 2DY1A 2AYGA 3S7RA 5CAAA 4HACB 5LSOA 4M5JA 3ET6B 4Z2XA 1M5VC 1TL3B 4JI3J 3RB4A 1LEOA 2HRYA 2ZUGA 1XC9A 2EWHA 2PMWA 3AODA 4DR5J 5C24A 3OFEA 1NJZA 2XS2A 1VRUA 1S1VA 2EKNA 1QD1A 1U2RA 2HQFA 2MKHA 4EMDA 4RU9A 1ZAWA 1FJGJ 2ADBA 4QWDA 2ZC4A 4IO1A 1X4GA 1RBLA 1KLMB 2XBPA 3CE8A 4HHHA 5KAKA 5KT5A 3K5LA 1E6VB 3IM9A 5KFBA 3W2VA 5ADZA 3RAMA 3BYPA 3FCHA 4XPEA 2F63A 2MSSA 2FDNA 3R8YA 3NCPA 5AJ3F 3ZO7A 1RT5A 1UJ4A 3I31A 4USHA 2PSZA 5T7LA 5K8PA 1J5EJ 2F3JA 2ZEJA 1FFWB 4MFBA 1S79A 2EXUA 3LWLA 4JI6J 3NMRA 1FRHA 3V2UC 3TP2A 1FNOA 2C3UA 4JYAF 4B3TF 1X31C 3NGRA 1WDTA 2V9KA 1RT7B 3LANA 1HYSB 5KOXA 1RHJB 1PBAA 1T9UA 2PN6A 3GFZA 1RTHA 1Y9OA 1YRXA 4G6VB 2C2RA 3HZGA 1S1VB 2CQ0A 4KY3A 4USTA 4LFCJ 4OLPA 1S72S 5KFZA 3I6PA 4NLYA 4NZ7A 3E01A 3TZWA 3V6KA 2KT5A 3BGUA 2QT7A 2V94A 3HM9A 1RACB 3X3UA 2UXDF 4K4WA 1IM4A 2H1YA 2V8HA 5A8RA 1FNMA 2ILYA 4FXVA 1O5JA 3P8BB 1XR7A 1B99A 1DY3A 5KFOA 1U1OA 4TU9A 4QR2A 4RW4B 2WW8A 3ZZYA 2VFUA 3DGPA 3GONA 4TY8B 1D8YA 5KFJA 4Y2CA 3ETOA 4DR4F 2RQKA 1FT8A 4TKTA 2CYYA 2VQEF 1CJVA 1A0OB 2YQ0A 1LW0A 3A8KA 3T1YJ 4NASA 3VZHA 4A8QA 3SV3A 4TN2A 4DR7F 2MYFA 1VRQC 1HBMA 2FZGB 2E1AA 3HCXA 4UOGA 5IM0A 3R7NB 4LQ9A 1VIXA 1Z1ZA 2HZVA 1KBRA 4KV8B 3D9BA 4TVAB 4X4TA 5AE2A 4DX6A 3EMTA 5D4LA 4ZLNA 2XMAA 2I0XA 4AFFA 2POKA 1N6QB 2RD5C 3FCVA 3PACA 4BLGA 4K50A 2QL5B 4O44A 2XLJA 4LJMA 3T3FA 3V4IA 1VBKA 2DHGA 2BM1A 5KFQA 1JMTA 3CNQP 3MEEB 1M1GA 4CLTA 4X64J 3W64A 3D54A 3QQCD 4DG1B 2JHEA 5LMNJ 2AEJA 3PR5B 1X4CA 3EYZA 4Y2IA 3G9CA 2GJIA 1V5IB 4WYWA 3BGRA 3B8HA 4ZCKA 4ZOSA 3V5RA 3KLVA 2YBVA 4R5PB 2QSFA 1F9EB 2OEKA 3Q8PB 4I2QA 2LU2A 3LUYA 2V50A 3VQSA 3KJVA 5IOLA 3DMJB 2V8GA 1FX2A 2D7SA 2W2OP 3M32A 2AP6A 5CABA 2Z57B 4DV0F 3UW1A 2JEGA 3PHTA 3OR2A 3T1YF 2OMLA 4DWIA 1YBTA 5D0HA 3KKFA 3QJLA 2C3PA 1KDNA 2I8EA 2XYGB 2RDJA 2EPIA 3BN4A 4TU8A 1LW2B 5BR8F 2UVVA 2GNKA 1ZPVA 5GADI 1DRZA 4NXNJ 1C1CA 2ALZA 4FF4A 2DNYA 5FJ4A 5DLFA 2E1RA 3SI8A 3THVA 4EBDA 1R0CB 4CLYA 3MEEA 2VL1A 3TQEA 2L9DA 1YJUA 3UDLA 3BREA 1WEXA 1XJWB 4LVNP 8AT1B 5LOQA 2C42A 2FHJD 5A8KA 4RW4A 3BR8A 3MPYA 4F0HA 3C16B 2YQ3A 3MAAA 3DI6B 2PFDA 3K57A 1MROA 3CB4A 4LF5F 2QA1A 1RWMB 3C2PA 5DDPC 1QM9A 1HBOB 4ILRA 1JJ4A 4RNMA 1NKEA 4HTJA 4ZJQA 3DOMB 2DPIA 3NGDA 1SL2A 3KLFA 2E5LF 1OWXA 1CG2A 1UP1A 1XQIA 1X4AA 2RS8A 3KLIB 2ZWOA 4NLQA 1O51A 3I32A 2HGNA 1U7LA 1RHQB 3TVKA 3IRWP 2ZE2B 3D6TB 2M52A 2WCXA 2B0GA 1S6PA 4RNNA 1NB7A 4XDCA 1SKUB 3ZNJ1 3OVSA 4DV2F 4RU2A 3M9OB 2YKMA 3A8IA 4WIIA 4DR3J 3PW4A 2CPDA 4N8OA 3PEJA 5C2CA 2FLOA 2KFYA 2Z4PA 3SEOA 4X62J 3H0PA 3QLHA 4QWCA 1Q8LA 2ASLA 4PG8A 4PRFA 1GX5A 1JK9B 1NK9A 3JYTB 3EZUA 4DS5A 4DSJA 4KHRA 3MMCA 1RWOB 1JLAA 1N34F 5DLGA 2MB0B 3CJ4A 1BXNA 2Y1IA 1PJ7A 3UDCA 4OZ1A 3TRGA 2C22A 4CNZA 1WD6A 2M4MA 2XY7A 4G3IA 4LVOP 1VQ7S 1KQGB 1TELA 2YQ1A 4FXWA 4PXBA 4EK2A 1KFDA 1XEZA 4HLBA 3OHBA 3C19A 1RBAA 3TUIC 5A0YA 2DITA 1SC3B 3JSRA 1HNIB 2B51A 1Y5NB 5KFLA 2BBEA 4WCEQ 1DQ9A 3J81j 1SI9A 4JOUA 3CF5Q 5D77A 2IIHA 5L9XA 4J7CA 3VCDA 1BGXT 2W1BA 2MEWA 1NDKA 2N82B 4NXMJ 3DRSA 2GZOA 1NSQA 3BDPA 3A1YG 4JI5J 4KO0A 1UEUA 3CJ8A 2E5HA 3ITHB 3NGTA 4OJ1A 3JSMB 2YPYA 4CLPA 1X4EA 3CCRS 3Q8YA 5HMZA 3EDQB 5E3RA 4DV3F 3TQ1A 1UVJA 2Y8WA 3NRBA 1LK7A 2DISA 4BC7A 1Q86T 4PZVA 3U27A 3DRRA 5B09A 3DU6A 4LFBJ 3U02A 4A8YA 3BN7A 4LIWA 4PAAA 3GV7B 3G8TA 2D3OR 2GFFA 1S10A 3GJQB 3M05A 2XEXA 1O8BA 5I3UB 4DV6J 4ZPWR 1UVNA 3IRXB 4LF6J 5DG7A 1HWLA 3QPIA 2DNPA 1B0VA 4USWA 5JJBA 3OBIA 2YH0A 3M32B 4F25A 3VQTA 4DZDA 4RUCA 1VGYA 2RILA 2AD9A 5LXYA 4TYAA 3UR0A 4G1PA 5LM7E 5F8HA 1MMLA 1UWAA 1A9NB 2XI3A 1Y3KA 4DSKA 1H72C 1URRA 4MAKA 2AV5A 4QPTA 1FRMA 2G0CA 3UR3C 3GIMA 5H9EJ 4K7QA 3EZOA 4CWBA 4K4TA 2H48B 3LH2S 3W61A 2M5YA 1RSCA 4NOHA 3FEYB 5IQ6A 3T5HA 2KN4A 1T95A 2O5DA 3FCWA 1RE1B 3L95X 2R3VA 4DUZF 1N33J 3KMQA 1X0FA 1R6VA 2DBBA 3A3NB 1HL6A 3PR4A 5KTQA 5L39A 4LF4F 4DV4J 3AY0A 2Y1LB 3AB2B 4B9SA 2XCPA 1NZAA 1NBEB 1WC6A 4E0DA 4WFNQ 2Y1JA 3M6XA 4ID8A 2HZCA 5ETLA 3TEGA 1FCAA 1RABB 3IWXA 4YHHJ 3CULA 4K4SA 5L8RC 1S9EB 1EZZB 2RDDA 5E33A 2EFVA 3K8VA 2OFHX 5A2QY 5JUMA 1U1QA 1M5OC 1B7FA 1YJNS 2R8KA 3H42A 4I64A 4N8NA 4OZJA 3EX7B 1JX4A 4BS2A 3GZ7A 5CA5A 1F5AA 2D3O1 1GH8A 5FDLB 3L7OA 4KHPF 4RR5A 5FDLA 2GS8A 2D74B 5EHHA 2XY6A 4IQXA 1W26A 3M6UA 3WZ0A 2A2CA 2IA6A 3DM2A 2YNIA 1X0PA 2BOAA 2HWHA 2I5JA 4ZJOA 3WQPA 2E9TA 1ITPA 3F44A 4EGLA 5ETOA 2QRRA 2KM8B 3IA0A 1TL1B 2RMLA 4ED4A 5GADU 3WC2A 2IJNA 5IWAF 4KPCA 3OSPA 4UY85 2WVDA 4J9QA 2F4VJ 1VQ8S 1GMVA 4MJKA 3HT0A 3IC1A 3CCVS 2KH9A 2DEIA 2DHXA 3CCSS 1FXDA 2GHVC 1KOHA 2GIFA 3JYTA 2M7SA 2WB4A 1C1BA 4JI0F 2OSQA 3BKFA 3FQLA 3SBMA 4DV5F 2ABYA 4FP9A 2HBYB 3ENAA 4Y65A 1RTDA 3DDNA 2IYIA 2CPFA 2VG5B 5B0GA 2HK2A 2BA9A 1KSPA 1YJRA 5KG5A 2UUAF 4DU8A 4R0EA 3SSQA 4DR4J 4UOHA 1SV5B 3ZTOA 2FHOB 1RT1A 2VG7B 3K8WA 8RUCA 2VD3A 3VZIA 2FVPA 1NDLA 4ECRA 1B64A 1IKXA 4OX9F 4B3RJ 2XGQA 1SJQA 1TTHB 4M5IA 4AXIA 1M90T 3CCES 2F9DA 1N34J 5T41A 1VOMA 2EFPA 3E51A 1EQ0A 4JI7F 4NYZA 3EUNA 3TUJC 4KGXB 2JWNA 4I7FA 4LF9F 1QAXA 1V6HA 2V69A 5ETTA 3OVAA 2GJFA 4Q7AA 2RF2B 2LP4A 6FD1A 4JV5J 2HHVA 5J2PB 2UVUA 4HDGA 4HHJA 4NLWA 1KQFB 4DFMA 5KT2A 2HIYA 2GQQA 1TUWA 2ROEA 4RW9B 2DHAA 2HZAA 1TL4A 3EGWB 3RGIA 1SCJB 1S99A 1FVSA 3HFVA 2UVWA 4WKRA 2K06A 1WG4A 5ETQA 4A8XA 1YVFA 2LVWA 4Q8FA 1RAFB 1FK9B 4F50A 1X9SA 2E7XA 3LP0A 4NL5A 4WYLA 2ZVSA 4C8KA 4FYDA 1YKWA 1RLCL 2N4CA 4GMKA 1HNIA 2X1AA 5RUBA 3NBPB 2J6SA 2KJVA 4KIAA 4DSFA 3ET6A 2AJ2A 4WXWA 2DNMA 3FKBA 4X65J 1VHIA 1W2IA 1VQ4S 2Q79A 3VHQA 2XC9A 3P45B 5L1KA 1GFWB 1Q8BA 3MAAB 2ILZA 2X3DA 3MPVA 4NLOA 1ZETA 2MJNA 2P9GA 3LPYA 4M8LA 3CD7A 2DR6A 2OEMA 3DKDA 1UPMB 4TLRA 4ZS6A 2FJDB 5LJ3Y 3G4SS 2DR8A 2HEKA 2COLA 2W2PP 4XAKA 1WC3A 3RJMB 1MU2A 2FGOA 1B70B 3BYRA 3DOMA 1S12A 4O4RA 4RPFA 1IWGA 5ETKA 2V67A 4OYZA 2QMXA 2W4PA 5DM6Q 2MZTA 3SCKE 3C46A 4M5DB 5DZ7A 1NJXA 3M8PB 1XWLA 5SUHA 1ICEB 3THTA 5HQ8A 4ANEA 5I4MA 2HHQA 1Q78A 2ZZNA 3AD7C 4OIXA 2WOMA 1XMBA 4ZVPB 3PV8A 2J8AA 2KHCA 3FDSA 5GAGU 5B0AA 1X8DA 1LWCB 1R8BA 2EFGA 3EM1A 3QZ8A 4IQMA 2V8VA 3G86A 3KLEA 2YKQA 3LGHA 3KLIA 4YN3B 3ZZ0A 1U6FA 4F0KA 3OJSA 3M9MB 4CCHA 4FF3A 1S76D 4NRUA 3RUBL 2J0QD 2UXCJ 2VFVA 4CNYA 1IKVB 2YVSA 1QSSA 2FY1A 3G6YA 3QSYB 4ICLB 4N76A 3FSIA 2HFNA 2CQCA 1MLAA 3M2UB 4X2BA 4DLGA 3EVOA 3I5AA 2HLTA 1PKUA 1AROP 2EBGA 3B4MA 1WTBA 2YX4A 2NZ4A 4I2QB 1OSDA 2GAHC 2LXIA 1EHWA 1SIWB 4WFZA 1LXJA 3V81A 5GVQA 1DTQA 1JLEA 3ADAC 3MAQA 1URNA 1HQEB 1JKHA 2OPRA 1U09A 4NE9C 2V0NA 4UF4A 1SJ3P 4HR2A 4GO7X 3CC2S 5I3QA 1FEEA 1OSCA 5F8JA 2MTLA 3BSAA 2ZC3A 2LLZA 2AJ0A 1N32F 2FJWA 5ITHA 1S7IA 1GQEA 2RU3A 4EWTA 1PC5A 1OS5A 3DYAA 1H0HB 2XYHB 2DR5A 4HDHA 2ZD1B 3LAKA 1YRUA 4YP3A 1MSWD 4KV8A 1J5OB 4ZK7M 4ICLA 4DPTA 3JTOA 3UO0A 3W5ZA 1VQ6S 3HHKA 3OD2A 1I5OB 1Y00A 1JLBB 2R2TA 3R1LA 3J7Z5 1BLUA 2O3DA 3POTB 1I94F 4GKJJ 1CEZA 1W2BR 3LF0A 5G0RB 3T19A 2B9XA 4Y2KA 4HTIA 1S7HA 5KFTA 3V81B 2C2DA 1N48A 3ISND 1WEZA 2RVJA 4QOTA 4CO0A 2VHGA 4DSLA 1SH2A 3OT9A 1K47A 2DHHA 2UUBJ 1S6OA 5IC6B 4TU7A 4OJGA 3DGPB 3BBBA 3DLEA 1KC8T 1NK0A 2BQ3A 1ROFA 1JLCA 1RTJB 3MM5A 1PYTA 1VQMS 1DFDA 1VRTB 3CJ0A 2WB1D 1RBOB 3ZTSA 4C0OC 2GMLA 4NMLA 3M8RA 3GILA 1NH7A 4UW2A 1RTIA 2J6TA 1TFWA 1IN0A 2HPUA 4B3OA 4OYMA 3GP9A 3NNAA 4HI2A 4WU3A 2HNDB 1CULA 2IDLA 2MGZB 1QSYA 2OH2A 4C8LA 2YH1A 1F2HA 3N79A 2VKZG 1RTHB 3G6ES 4OV1A
chains in the Genus database with same CATH topology
1OPIA 3NLCA 2R8JA 4OX6A 4Y6IA 4I67A 2HIQA 2W4DA 3D1OA 1QTMA 1Y4ZB 1ZAVA 1IKWB 1T94A 2ZH8A 2HHWA 2W9CA 5HI7A 3CO9A 3HVTA 3TAMB 3GV5B 2AX1A 3I87A 5KFPA 2KRBA 4DFJA 1FJEB 5I42A 2CKWA 3PW5A 4KTQA 2ZNYA 3RBDA 4U67Q 4N56A 4M63A 3HHLD 4R8UA 3AQPA 3M2VA 2R2UA 2FC8A 4HT7A 4YFUA 1D8ZA 2I9SA 1U47A 2N3OA 3G8SA 1E6VA 3LP0B 4QU7A 1X5SA 2YKAA 3Q2SC 1KHVA 3KFWX 1SC6A 4TYBA 4PXDA 5A8WA 2O1PA 4X62F 3OUYA 4OHZA 2YY3A 3IBWA 3CCJS 2YKPA 4LMZA 1R0AB 3IAM9 5SZTA 4MIAA 1RI7A 2VH7A 2ZDPA 1RA6A 1S4FA 1F5BA 2DNLA 3SDEA 2WRMA 2KRRA 2FVQA 4ZPDA 2RB7A 2UU9F 3LOUA 3HDSA 1EETB 4TNOA 4C98A 2IVMA 2KFNA 4W90B 4A8OA 3PFEA 3VAFA 3GB0A 2CZ4A 4ELVA 4KKOA 3TA1A 4G1QB 3K7RA 4WKYA 2K8GA 3WX4A 4YOEA 4IOCQ 4CT8A 3IR5B 3GG1A 2KZZA 1YIJS 3PHEA 3CD6S 4NCGB 3CGIA 2WSFC 4H4OB 1T02A 3KNGA 3M1VA 4HKQA 4C3KA 1SL1A 3FVYA 2LEBA 5HL7Q 3CDAA 3D5MA 4HYKA 2GGPA 3VAMA 3ZFVA 4KGKA 3NMAA 2HHUA 1N54B 1SJ1A 2CQGA 3JSYA 4DV1F 4DLGA 4RW7A 1P1LA 3N6LA 3EXYA 5K8OA 1IKVA 5F9LA 1ZZFA 2L3MA 3OFHA 1N4LA 3OL9A 2HLUA 4RBTA 3WC0A 1KOOA 1TZ0A 1IQTA 4UUWA 1GTHA 3RW6A 4O3RA 3FEZA 1MMNA 4OI4A 1FEHA 1RT3B 4X66F 3LW5C 4WK1A 2CVEA 3P5TL 2LQ5A 1C1BB 4MK9A 1FHTA 5CYQA 2BANA 3F41A 3M2RA 3FQKA 1WHWA 2JFDA 3MDFA 1R3NA 1YBAA 5LT5A 2BW2A 2OMOA 3ISNC 4DL0C 2H9ZA 2OD6A 3SCIE 3U1NA 4EO6A 3CTRA 1WWHA 2MZSA 1LWFA 5AE3A 1KTVA 3SFGA 3Q23A 1L3UA 2XG8A 1IBMF 4IYQA 4HT5A 3UE2A 1FTRA 4DOZA 4ED8A 4ECZA 2K2PA 1ZBTA 3MTJA 3TO8A 1LWCA 1UW4A 1WG5A 3DRXA 1KVJA 3FSYA 3OVBA 4OZLA 3MD3A 1WTFA 4NLRA 3HP6A 1N5YB 4DL2A 3TANA 3OTCA 3MXHP 4X4VA 4IUFA 3NS6A 3PJXA 4ERDA 3ZC4A 5LJ5Y 4KAIA 2MXYA 1HNVB 1ZTWA 4ECQA 3TAQA 2HVHA 2RE1A 2K1RB 4DV6F 1NJWA 1FD8A 2LYVA 3HVAA 1LXNA 4YB7A 3DRPA 5KT4A 5M2UA 4DQIA 3O5TB 3PM9A 4RNFA 4LFBF 1PILA 1R6YA 4J9RA 7FDRA 4F2RA 1HNXF 2FD2A 1Y5LB 1DQAA 4ES3A 4B3MF 5B0DA 2CG4A 2LA4A 2BM0A 4U7CA 4KC5A 1T03B 2ZH7A 3W2WA 2PE8A 2GQ2A 2OPSA