1HNIB

Structure of hiv-1 reverse transcriptase in a complex with the nonnucleoside inhibitor alpha-apa r 95845 at 2.8 angstroms resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of HIV-1 reverse transcriptase in a complex with the non-nucleoside inhibitor alpha-APA R 95845 at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 100
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hniB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB03
1HNIB 4KFBA 4RW7B 1N6QA 1TP7A 5HLFA 2GIRA 4FBTA 1OS5A 3CDWA 3H98A 4ED7A 1IKXB 1C1BA 1S9EA 3DI6A 3KLGA 3IRXA 1NHUA 4H54A 4IG0B 3CIZA 4ECRA 1RTHA 4ED0A 5KFMA 2HNZA 2RKIB 5KFSA 1BQMB 5K14A 5EUHA 3SFUA 1IKYB 3MFHA 3H40A 5L1LA 3GQCA 4DL2A 1JLGA 5KFWA 4H4MB 1D1UA 4J9NA 5C25A 2VG5A 1N5YB 3I5CA 4EBEA 4J9OA 1S49A 2CKWA 3V6JA 1JLCA 2ZD1A 2YNFA 2UVWA 1HPZB 3IGNA 4Y2AA 3KLEA 1SUQB 4O4GB 2W9CA 4K4XA 4O44B 3DMJA 4ZP6A 5KFOA 2VG7B 4PUOB 4MK7A 1S1WB 2E9TA 3G86A 1TKXA 3GIKA 1T05A 3TQ1A 2BRLA 5J2QB 1QE1B 3LAKA 5F9LA 4EBCA 3DRPB 5FDLB 1IM4A 5T14A 1WNEA 3M8PB 2C2EA 3BSCA 1C0UA 1EP4B 2OPRB 4NLVA 2HWHA 1DTTA 1S4FA 2IM2A 5JUMA 2XCAA 3IN5A 2J6TA 2C2DA 4NRTA 2CJQA 3M8QA 2IA6A 5KT3A 3G6YA 2AQ4A 4TY8B 3UQSA 3QYYA 4K4TA 1TQLA 3TVKA 4WZQA 3Q8QB 1T3NA 2OPSB 4J9KA 4DEZA 2GIQA 4WFXA 4NLUA 2RDJA 3PVXA 4NZ0A 1S6QB 4H4OA 4FS2A 2BQ3A 3DOKA 2FLPA 3NMAA 4ED8A 4IG3A 3OHAA 1C1CB 4IDKA 5KFCA 4JV1A 3NBPB 3D5MA 3M9OB 2YKMB 2RF2A 3GIIA 3N6LA 3UR0A 1S1XA 4QWEA 3OL7A 5CYMB 3JYTB 4Y2CA 1FK9A 3EZUA 3N6MA 1C1BB 1S9EB 3DI6B 3KLGB 1EETA 3IRXB 4URQU 3UDLA 2HNZB 3KMQA 4ED1A 3KK2A 5KFLA 5K14B 5KT5A 4ED3A 3I0RA 5DG8A 2R8GA 5F8NA 1RT1A 2I1RA 4R5PA 4X2BA 5C25B 1JKHA 5I42A 1T94A 1S0NA 1S0OA 3GV5B 1JLCB 4R0EA 1IKVB 2ZD1B 2XC9A 4QWAA 1SH3A 3SI8A 1RT7A 2IM3A 1REVB 3DMJB 2YNIA 2UVRA 3DRSA 4F4XA 1RAJA 2RDIA 5KFVA 1TKXB 1T05B 3I5BA 4NCGA 2ZE2A 1XR6A 4K4ZA 3E51A 5HP1A 2FVQA 2IJNA 2XGPA 4ED2A 4NRUA 1LWCB 1S97A 3KNAA 4KV8A 1S48A 4ZMMA 1DTTB 1JLAA 1JLEA 4ID5A 5L1JA 1DTQA 4IRDA 1LW0B 3DOLA 3KLVA 4KAIA 3PJXA 3BSOA 2AGPA 3HHKA 1HYSA 3FRZA 3NAIA 1RDRA 3FFIA 2QV6A 4KB7A 1JLBA 5L1IA 5KG1A 3IGVA 3V6HA 2W9BA 3NL0A 1YVFA 4H4OB 3QIPA 2ASJA 2AWZA 2WCXA 3DOKB 5L9XA 4IG3B 4IDKB 2J6UA 3CJ4A 4RW8A 1C2PA 3OL6A 2BE2A 4R8UA 2OH2A 3LANA 1RTJB 1S1XB 4WXWA 4QWBA 2HNDA 5KFYA 1S6PA 4RW9A 3PW2A 1RT5A 5J1EA 2JEIA 3OHBA 4ZVEA 1LWFA 3Q8SB 2B6AA 4TLRA 4MKAA 3QGGA 3KK2B 4DG1A 3LP0A 2IM1A 1S1TA 3GV8B 2XI2A 2VA3A 1RT1B 4I2PA 2AX1A 3M9MB 3NKYA 5KFHA 1JKHB 2I5JA 3IS9A 3MR6A 1NHVA 3DYAA 1BQNB 2YNGA 3KLIA 4IFVA 2XI3A 1RT7B 3DLKA 4WE1B 3BGRA 4ECZA 2JEJA 2DPIA 3DRSB 4I2QA 4ICLB 3RBEA 3KJVA 2WRMA 4J9MA 3FQKA 2ALZA 4F50A 5I3UA 5KFKA 3V6DA 5J2PA 1C0TB 5HP1B 5D3GA 3T5HA 3MEEA 3CJ3A 2AGOA 1TL1A 5F8JA 4KV8B 3C6UB 4HKQA 4Q0BA 3DDKA 3KOAA 3KLHA 4NLGA 1JLAB 4RW4A 3MEGB 2UUWA 3T1AA 3GV7B 4ID5B 4DL4A 1HNVA 4ECXA 3I5AA 5DG7A 5KG3A 1T03B 3DOLB 4EO8A 4MIBA 5KT6A 1VRUA 3KK1B 1RTDA 3H4BA 4IRCA 1HYSB 4NLTA 1RYSA 5EWFA 4F4ZA 1LW2B 1JLBB 1UWBA 3PW5A 5KFDA 5KFFA 4WXOA 2W9BB 3TAMA 2D41A 3QIPB 4RNFA 4DL5A 1JXLA 5EWEA 4IQXA 2FVPA 3BQ1A 4K4UA 3KK3B 4RW8B 2ILZA 2BE2B 4R8UB 4WYLA 3KHRA 4ZPAA 2FJWA 3H2LA 1S9FA 1N48A 2HNDB 2E9ZA 3T5LA 4RW9B 3MR3A 1RT5B 5J1EB 2QE5A 4QPXA 3MTKA 3QLHA 1K1QA 4MK9A 1LWFB 5KT2A 4JV0A 1XR5A 4EO6A 4GC7A 1S9GA 4TN2A 2JC0A 4KO0A 3RBDA 2WONB 4K50A 3LP0B 2FVSA 1S1TB 5C42A 1ZTWA 4KE5A 4ZP7A 3ISNC 4I2PB 3T19A 3BR9A 2C2RA 1J5OA 2AU0A 4ZPDA 1N56A 3IS9B 1HQUB 2R8HA 3DRRA 4YR2A 4RW6A 4KFBB 1N6QB 1GX5A 2ILYA 5KT4A 5HLFB 5DQHA 2BQRA 4IFVB 2BQUA 2W7PA 3DLKB 1D0EA 3BGRB 4NLSA 4Q44A 3C6TA 4K4WA 1RTHB 2J6SA 4I2QB 3LALA 2IAJA 2W8KA 2F8EX 5DQIA 3KJVB 3LP1A 2JLEA 2OPQA 4O3RA 4O3PA 1FKOA 1RTIA 5J2PB 3V6DB 2FJXA 1JLGB 2FVCA 4ZVGA 3JSMA 3RAQA 4ZP9A 4G3IA 2OPPA 2VG5B 5DGBA 4Q0BB 2YNFB 5KG0A 3N6NA 4XPCA 3KLEB 2IJFA 2W9CB 4IR9A 1RYRA 4I7FA 1KHVA 4LQ9A 4Y34A 5KFAA 1JLQA 2WK4A 4RUAA 4KBIA 1VRUB 1N4LA 4PWDA 1W25A 1RTDB 3T5KA 2AX0A 3DLGA 3ITHA 3E01A 1UWBB 4O3QA 1HMVA 4YQWA 3MF5A 2EC0A 1C0UB 4RNMA 4ECWA 4MFBA 3PW4A 3QO9A 4ZHRA 4LQ3A 4ECSA 1RT2A 4LSNA 1HNIA 4RW7A 1TVRA 4RNNA 5DLGA 4IOBA 3M8QB 4PQUA 1IKWA 3MECA 3H5UA 5EWGA 5CYQA 4NLQA 3QLHB 2D3UA 4ED6A 1TL3A 4IH5A 2ATLA 3RB0A 3V6KA 5KFNA 4RUCA 2V9WA 3I0SA 1TKZA 4EEYA 3OLBA 1JX4A 5KFUA 4MIAA 4ECVA 1SV5A 4RZRA 1BQMA 5C42B 4OL8A 2R8IA 1IKYA 4Q45A 4GC6A 4TQRA 2IC3A 1J5OB 5HBMA 4LSLA 5KFXA 4QWCA 4FS1A 4J9QA 4O3SA 3DRRB 5KT7A 2R2RA 4RW6B 2RF2B 3HKWA 3OL8A 3H5XA 3QIDA 3Q8PB 1FK9B 1LWEA 4M94A 4NLPA 4RNOA 4EYIB 5J2MA 4XO0A 3C6TB 4O44A 1EETB 4ECUA 5HROA 3HVAA 3GYNA 1RT6A 3KMSA 2IAJB 4NLXA 2W8LA 5DGAA 2D7SA 3LP1B 3PHEA 2R8JA 2OPQB 1RT3A 3I0RB 5F8MA 1FKOB 2XWYA 3CDUA 3OSPA 4O3NA 4R5PB 1TKTA 3KLFA 4IKAA 3IG1A 5KFTA 4YR0A 2OPPB 5I42B 4M95A 1KLMA 2FJVA 1RA6A 1CSJA 2R2SA 2ASLA 2IBKA 4Q8FA 4ZVHA 2YKNA 1DLOA 3EPIA 5L1KA 2YNHA 1FKPA 4I7FB 4Q8EA 3HVTA 3GIJA 2YNIB 1JLQB 3H59A 4PWDB 2XGQA 4IR1A 4NCGB 2ZE2B 4IH7A 2IM0A 2ASDA 1ZTTA 3MFIA 2JEFA 3V81A 2UUTA 3PJWA 1JIHA 1U09A 1S6QA 4YMEA 2V4RA 3NAHA 4ECYA 2R8KA 5KFGA 1S1UA 2BRKA 4EBDA 4MFBB 5KFIA 4ZPBA 1NNDA 1QUVA 4ZHRB 4QWDA 3NBPA 1JLEB 4MK8A 1RT2B 2YKMA 4LSNB 4NYZA 1TVRB 1DTQB 3H4DA 4PQUB 1IKWB 3MECB 5CYMA 3JYTA 2V0NA 4Y3CA 5F8HA 1MU2A 5CYQB 2C22A 1TL3B 3UPFA 3PW0A 4WFZA 1TV6A 4J9RA 3FFIB 1S1VA 1TKZB 3I0SB 3MR2A 5C5JA 3KHHA 4HYKA 5F8LA 1SV5B 5KFBA 1VRTA 1S10A 3CJ0A 4NLDA 4G1QA 3GIMA 2IC3B 3Q8RB 5HBMB 4LSLB 2W9AA 3PW7A 2FLLA 5J2NA 4Q43A 2B5JA 3CJ5A 3T5JA 4NLOA 1S0MA 3QZ7A 4FBUA 3MEDA 4URGA 1IKVA 5C24A 2BANA 2IMWP 2FVRA 4KHRA 4DL7A 2VG6A 3OLAA 1LWEB 1S6PB 3PZPA 3RAXA 5J2MB 1REVA 5KG5A 5HROB 1JLFA 3BQ0A 2O5DA 1RT6B 2B6AB 2HNYA 1RT4A 4DG1B 3HVWA 1RT3B 1TKTB 4XPEA 3KLFB 3IG1B 4ECTA 2JEGA 2JC1A 2I5JB 4TYBA 2VA2A 1KLMB 4NLWA 2WHOA 4O4RA 4JUZA 1LWCA 3DYAB 2YNGB 2YKNB 3KLIB 3KHGA 5F8GA 2HMIA 1DLOB 1QAJA 3CO9A 3NGDA 2W7OA 5DLFA 4J9LA 2YNHB 3DLEA 1FKPB 3CJ2A 3D28A 4TY9A 3HVTB 3H5YA 4DL3A 4KKOA 3CWJA 3DM2A 3LP2A 4B3OA 3EPGA 1LW0A 4TYAA 5KFJA 3QGIA 4WFYA 2C28A 3KHLA 4ZP8A 5I3UB 5JXSA 3BQ2A 2R2UA 4MH8A 1R0AA 1HQEA 2R2TA 5D3GB 3V81B 3MEEB 3PR5B 3QGHA 1TL1B 1S1UB 4KHMA 1ZETA 4IRKA 3V4IA 3KLHB 5DG9A 4RW4B 1HNVB 1RTJA 4JV2A 5DQGA 3PR4A 5KFEA 1MU2B 3MR5A 3OSNA 4KSEB 1XR7A 1TV6B 5EDWA 4ZVFA 3BJYA 1S1VB 2V4QA 4IFYA 1VRTB 3TAMB 5KG4A 1SH2A 4G1QB 3H5SA 4RU9A 2FLNA 2B43A 3FDSA 2HWIA 5J2NB 4QW9A 3CVKA 2B5JB 3QZ8A 2WOMA 3MEDB 1BQNA 5C24B 5KG6A 2BANB 3G6VA 3RB6A 3OL9A 4K4SA 2VG6B 4WE1A 1IKXA 4TXSA 3CDEA 3M9NB 1JLFB 2GC8A 4K4YA 4IG0A 1KHWA 3FSIA 1SH0A 1S9GB 3FQLA 4YP3A 4K4VA 4KO0B 1RT4B 2HNYB 2RKIA 4ICLA 4NLRA 4TQSA 4IH6A 1C0TA 4NLYA 2UVVA 4H4MA 2DPJA 1I6JA 1N5YA 1K1SA 4U6PA 4EYHB 2WB4A 2UVUA 2AGQA 3C6UA 2HMIB 3LAMA 1HPZA 2XCPA 4RNHA 4DL6A 3MEGA 4WZMA 3DLEB 1SUQA 4O4GA 4F4WA 4MKBA 4KKOB 3DM2B 2D3ZA 3LP2B 4B3OB 2HAIA 2VG7A 1T03A 4PUOA 1S1WA 4O3OA 4ECQA 4U7CA 1MMLA 3KK1A 1GX6A 5F8IA 1Z4UA 1RTIB 5J2QA 1LW2A 1HQEB 1QE1A 1R0AB 2BR0A 4ZPCA 3JSMB 2ZKUA 3DRPA 5FDLA 1RA7A 3M8PA 3ICLA 3KK3A 1EP4A 2OPRA 3V4IB 5KG7A 3BREA 4WYWA 4QW8A 5F9NA 3ISND 4YR3A 4J9PA 3RB4A 2E9RX 3VQSA 5KFRA 1QAIA 5KFPA 4TY8A 5KFQA 3DLGB 3GILA 3SFGA 3ITHB 3E01B 4IFYB 2OPSA 4J9SA 4F4YA 1HMVB 1HARA 2WONA 3G6XA 2WTFA 3BSNA 5KFZA 3BSAA 4URSA 3RB3A 1C1CA 3QO9B 1HQUA 5KG2A 2WOMB
chains in the Genus database with same CATH superfamily
1HWJA 4KFBA 3FSXA 1TP7A 4C8NA 5ETOA 4BWJA 4PEOA 3ZZZA 3LWLA 2B4UA 3OFGA 2ROGA 1U4BA 2HNZA 5KFSA 1U8WA 5K14A 1R89A 4OHYA 2VG5A 1FD8A 3BEGB 1D9DA 1ZS6A 2ZH2A 1L3UA 4DX5A 3SCLE 5J2QB 2N4CA 4MKYA 4U67Q 1OY6A 1VQLS 2R42A 2H5EA 4GVBB 1WOSA 1FJGJ 5SZTA 2OKQA 2C2NA 4OZ3A 4ED8A 1N34F 4ZKAA 3GIIA 3N6MA 3T9ZA 4URQU 3HHDA 3P3DA 4CTAA 2KYXA 1YBTA 2BW2A 4KC5A 4F4XA 1OMSA 4BHQA 4DV3F 1CJUB 3JXOA 4HHHA 1X4CA 1WOPA 3BSOA 3D7SB 3H25A 1XBWA 2ZH3A 3CCJS 4P73A 3JAMU 1CJKB 4XAKA 4WFNQ 1FRIA 1EARA 4OJ3A 2Z2YB 3DGPA 2CPDA 3VGTA 3KK2B 1X7VA 4ECZA 2JEJA 1QY7A 2KVIA 2CDQA 3V6DA 4GRSA 4DR5J 2AGOA 5F8JA 4KV8B 1VMBA 1CJTA 3T1AA 4NX9A 1EAYC 1XJWB 1SL0A 1RBOB 3I56S 1KVIA 1FFGB 5ITHA 4JV5J 3U1NA 1JXLA 1P27B 3KK3B 2P9EA 1S9FA 4K0KF 2QE5A 4JV0A 3P6YC 1OWXA 1ZTWA 1J5OA 1N6QB 5KT4A 5DQHA 2GFFA 1S79A 2ZC4A 1N5SA 2DXFA 2F9DA 2OPQA 1XEZA 4Q0BB 1FE0A 5LXYA 4XPCA 3KLEB 3M8SA 2W9CB 2AJ2A 1FTRA 2QL7B 3HFVA 4WK1A 3DLGA 1U25A 3CMES 4XDCA 1T9YA 4CO3A 3IWXA 3O44A 3W2WA 3ZZTA 1MMNA 3TZZA 1RAAB 2GAHC 3ILLA 3V6KA 5KFNA 1WF1A 2RF2B 2ZBRA 5D4LA 2X3DA 4M94A 1R8AA 4RUHA 3NLCA 2K1RA 1HQ2A 2D7SA 2ZJPQ 3TJ9A 1DY3A 2NS1B 3G96A 2HVIA 3C14A 3CDBA 4WBFA 2KXHA 3EPIA 3HVTA 3MM7A 3G71S 4ZK7M 4UOHA 1WF0A 3IXQA 2M4MA 3NBPA 1RT2B 3JYTA 1RCOB 5CYQB 4KY3A 3I0SB 5CHCB 4U95A 1VC5A 2R7QA 2MSSA 1U6ZA 2QA4S 2HHVA 4DR6J 3RAXA 3J7AN 2O67A 5ETSA 1N54B 4ER8A 3MMCB 4ZJLA 3CJTA 3CE8A 1F9FA 5J1NA 1KRPA 3DM2A 3LP2A 4B3OA 3UVJA 2KM8C 1D3WA 1R0AA 2LKZA 4Z7YA 1VS3A 3MEEB 3QGHA 5IOLA 2HEKA 4EZ6A 1HI8A 2KVQE 4JV2A 4ETZA 3I55S 2IFXA 1F1BB 3PX4A 4XK8C 1SIZA 1B7FA 3WC2A 3VAIA 4G1QB 2EC2A 5J2NB 1Z2ZA 5GADU 2BV3A 5KG6A 4LF5F 5CD4A 3PIOQ 1LQ9A 3HULA 4LR7A 5HMZA 2VH7A 1KN6A 3HLUA 2QLFB 1NKCA 4QJVA 4NCBA 1SKRA 1FHTA 4NPOA 1FRXA 5KFPA 2OAUA 1VQKS 4DXLA 2D9OA 4QR2A 2KTQA 3IBCB 4MYTA 4ANCA 2YKOA 4F0HA 4H54A 3G8TA 2HVZA 2G2ZA 3CCES 5EX3A 3MFHA 2XZDB 2M5YA 3W9HA 3SCIE 3M2RA 2ADCA 2AHOB 3RBZA 2RE1A 2Y8WA 4DSFA 1TKXA 4EBCA 1U0HA 1NB7A 2J5AA 5FDLB 2DCLA 3N01A 5A76A 4DCOB 1EP4B 5IV4A 3LA0A 1DTTA 4PCQA 4KHPF 1U6BA 2B8QA 2GIQA 1U0SA 2V50A 3HT3A 1FK9A 5E3AA 2VPZB 4DR1J 2XLIA 2RB7A 2QN6B 4R0EA 3GYXB 3NXZA 5IQ6A 1WTFA 4RL1A 4NCGA 1XR6A 1FX2A 2Z2MA 2ZKTA 3RYLA 1QDUB 3EGZA 1TELA 1D9AA 4QCLA 1PBUA 3DOLA 4CLPA 2QO3A 3HHKA 3FRZA 4L6V3 1FFSB 3TO8A 3IGVA 3PKYA 3KJFB 4H4OB 4IDKB 4QQBA 3MTJA 1TL4A 2FZGB 2DCUB 2UXDF 5JJBA 3NKYA 3Q2SC 2XI3A 5CZVA 3QT8A 4Y0FA 2J7WA 2XYPB 2FGOA 2WRMA 2GA7A 4LF8F 2UUAJ 3NOGA 4ZIVA 3OW2R 3TEHB 2E66A 2KXFA 3ZZ0A 3KXDA 4LRFA 3HO1A 1U8SA 3KK1B 1RTDA 5EWFA 5HATA 4RNFA 3GJTB 4S0MA 2FJWA 4ZITA 3P45B 2K2PA 5J1EB 4MK9A 4B9UA 1TUGB 3AY0A 2BUNA 4ZLLA 2CPFA 4YEAA 3E8OA 5C42A 2RRBA 2BKOA 3EDQB 3I6PA 1LOUA 1IR1A 3S8SA 1SVDA 2EFGA 3LP1A 1HNWJ 1YBUA 3TX0A 3FEXB 1UMJA 3D3BJ 3U27A 5D77A 5B0FA 2P5VA 1RE1B 3AJ1A 2B7CB 3ITHA 3CCMS 5K9FA 3K17A 3MD1A 1TMMA 3M8ZA 3JQMA 4OHVA 2HQIA 3CEDA 5KAKA 1WKKA 1YG0A 1S72S 2V69A 1HD1A 1SV5A 2X1FA 3BN4A 1NU4A 3NRBA 3ILIA 5M2UA 5A8KA 1EETB 1H2VZ 1H74A 1UEKA 4ZS6A 4X4QA 1SQFA 4Q8FA 2A2DA 2HFVA 4LF6J 5ADZA 4YDXA 3HHLB 3IO1A 4DV4F 4JI7F 4Y00A 1T9VA 2UUTA 3CJSA 1S1UA 1R27B 2IJRA 2N82B 3H4DA 1KEKA 3PRVA 5E3CA 4OYWA 3B82A 4HYKA 2YWGA 4NLDA 2Y3YA 4LSLB 4QIEA 1AW0A 5C24A 2IMWP 2CQ1A 4JI0F 2NPFA 3BQ0A 2RSQA 1RT6B 1O6XA 3BGFA 3CJKA 3OTDA 2I5JB 3GP9A 2UXCJ 3KLIB 3OUYB 2BJ1A 3MMAB 2AJFE 1WELA 1TMJA 2EXUA 1RWVB 2KFNA 1UFWA 2HGLA 2MGZA 3OTBA 3L9ZA 4NI2B 3WBZA 2ZBCA 5KFEA 4F2SA 1H38A 1VRTB 2ZH6A 2QGFB 5M2PA 4P52A 4ZVTB 1SBRA 3F44A 2YWWA 2YX4A 2VHGA 2XWXA 2Q6CA 3QMQA 4H4MA 1YJWS 2WW4A 1N5YA 3IWLA 4QBUA 1X4AA 4ECQA 1ZH5A 4N56A 2RQCA 2BE9B 4OZNA 5K8OA 4X84A 3KK3A 2KYZA 3W62A 3VQSA 2W2MP 1SQGA 1I1GA 3JSRA 1HARA 2WTFA 5SUHA 5LJ5Y 3VAGA 1N6QA 4OZLA 1FWKA 4ED7A 3KLGA 3CIZA 3SV4A 3EYZA 2RKIB 1NDLA 4J90A 5G4DA 4M5GA 2DD8S 4EBEA 2JFDA 3FNNA 2JOQA 4ILRA 3KLEA 4O4GB 2DK2A 4A8OA 2W9CA 4YB6A 1AZSB 1FXDA 2QA4G 4G1PA 1IM4A 1WNEA 5B0CA 2C2EA 4WU3A 2HWHA 1XN9A 3UE2A 4J9KA 4DSEA 4C8KA 2BQ3A 2XYGB 4QR0A 4JV1A 1WHXA 1VGYA 2RF2A 1S1XA 2NUUG 4NXNJ 4DX7A 2AP6A 1S9EB 2JFKA 1NEEA 4YB7A 1S0NA 1OSCA 4ZCIA 1HNXF 4M5DB 5BJRA 2HFSA 2VQFF 4HHUA 3AD7C 1T05B 3E51A 3H20A 3KTQA 2YWEA 5L1JA 1IBKJ 3CCTA 1QTNB 2AWZA 3CJ4A 2OH2A 3CD5A 1ZPVA 1UPMB 1UW4A 3N0VA 5E5NA 1RLDA 1RHMB 3IS9A 2PE8A 1VBKA 3QQCD 3CCWA 5K8NA 3GJRB 1NO8A 1FJGF 2IA0A 3L09A 2EWHA 3MEEA 4LFBF 2COLA 1NH8A 4MYUA 4NLGA 4PPDA 4HI2A 3T6BA 4FF2A 4MIBA 2LECA 3DDNA 1F3VA 3HHEA 2CJKA 4P2XA 4WWSA 1Q0NA 2V8VA 1M1GA 2WONB 3T19A 1N56A 4ZPDA 1RWNB 2R8HA 5A8RB 1D0EA 2RDDA 3C6TA 3UD5A 3LO3A 3W8PA 2GV1A 5J2PB 4ZP9A 5CQGA 4C9DA 3KKFA 3FVYA 5D0RA 1N4LA 1W25A 1X9MA 2UU9J 2AX0A 1OPZA 3MF5A 3GR0A 1G1XA 4B3MF 1VQ4S 3AOAA 2X1BA 1NAQA 2D3UA 4OX6A 3LH2S 2I2YA 4DR5F 5HVFA 4NA2A 5GAHI 4FS1A 3Q0AA 2R7SA 1IUJA 4ZPWR 3MCOA 4JOUA 2QYCA 5DGAA 4EUVA 4IKAA 2R2SA 1P6TA 5L1KA 4M5KA 2G13A 1F3FA 3PJWA 3EJMA 3F0NA 5KFGA 2ALYB 2GJ2A 4LSNB 1TVRB 3ZNUA 4CLSA 1MU2A 4FZVA 5IM0B 5KFBA 2YQ1A 1ZAXA 2XS2A 2PD1A 2FZKB 2E7VA 2U2FA 1IR2A 5E3QA 3HMJG 5J2MB 2W2PP 1E6VB 2NZ4A 3VCDA 2HMIA 5IC6B 2VPYB 2DH7A 3VHQA 5BYRA 5THWA 1VR6A 1HLWA 2MZ1A 5I3UB 5JXSA 3BQ2A 3MR7A 3D0HE 4OX7A 1OQ3A 2XB2D 1ZM2A 2F8MA 2CJ9A 3HM9A 3M8WA 2CPEA 5EDWA 4CH0S 3P4UB 5D0GA 3GJSB 4IFYA 4KTQA 2G9OA 1P1TA 3KG4A 2XG8A 4QPTA 3P5TL 1S5ZA 3I87A 2WOMA 3G6VA 3TJAA 2CQ2A 3CT9A 3TVZA 2LQ5A 4K4VA 2VFVA 5AXNA 2BJDA 3R27A 4YDDB 4PG5A 4CT9A 1YRXA 1Y9OA 1L3TA 3R3TA 4WZMA 3DN9A 3GONA 4DQRA 4O3OA 3KK1A 1GX6A 1HQEB 1SPBP 1X0PA 2QL9B 3NS5A 3AQOA 4C11A 1HI0P 4B17A 1LXJA 2E9RX 4DR6F 1TL7B 2N7YA 2R7TA 3IMQJ 1S4EA 1S99A 3VV2B 2PO4A 4YFUA 2R8IA 8AT1B 1QSYA 2EG2A 3DI6A 2ACMA 2FJAB 1IM6A 3P5BP 5IC4B 1PO6A 3NCPA 4P74A 3D1OA 4KT0C 1A7GE 1NDKA 2LEAA 3A1YG 4BS2A 4ZP6A 4JI1F 2HBZB 3HSGA 2CZVC 5F9LA 2LA4A 3IAS9 2VQEF 1KKHA 2ZM6F 4PQAA 4NLVA 3IN5A 3PY8A 1VHFA 4RPFA 4TY8B 2FHKA 3TWZA 4X4SA 4M5MA 2CQ4A 2HFUA 2E5LF 4QWEA 3OL7A 5IWAF 4PG6A 4Z2XA 1T3OA 1EETA 2FJBB 2IHR1 3M30B 2LYVA 3R1LA 4ED3A 2MLXA 4C0BA 4XIUA 3DFEA 1UCNA 5HK4A 1YTYA 5BYQA 2BOPA 3HHLA 2UVRA 4OYZA 3HSZA 1RSCA 3WC0A 3CJ8A 1NHKL 1S97A 2LDYA 1WORA 1ELOA 2DGWA 2PA3A 4IRDA 2XLKA 3SSSA 3FCWA 1RDRA 4AXIA 3BV8A 1CULA 3V4MA 3FBCA 1MSWD 3UR3C 3OV7A 4FYWB 4WU2A 4ELUA 1IWGA 3HVRA 1HI1A 4DSIA 3M7VA 3QNWB 3CW2C 4Q5VA 2I5JA 1FNMA 1G3OA 1HIYA 4DZ6A 3KLIA 3TUPA 3MMAA 5C7PA 3DRSB 3PFEA 4ZCKA 1R8HA 2OJ3A 3KOAA 1NH7A 2CADA 4DR1F 2MHEA 2Z57B 1ZM4A 2FQQB 1O5JA 3MTKA 1VIXA 2C2RA 4ZP7A 1HQUB 2EK1A 1GMUA 3DLKB 4NLSA 3OD2A 4YB5A 2OEJA 1RTHB 1AUDA 3HSDA 6FDRA 4OI1A 5J1PA 4O3PA 4EMDA 1OYEA 2XMKA 5EN1A 2GMHA 3PEHA 3QBCA 1APSA 5ETPA 1FFWB 4F25A 4IR9A 4DLGA 4Y34A 5KFAA 3T5KA 4LRCA 1UFLA 3M6WA 4U9RA 4ECSA 1IKWA 5DZ7A 1JNRB 1PBAA 1V5IB 4WK3A 3Q22A 2HVEA 3O1LA 3H5XA 1Y3JA 1RK8A 4OV6A 1CPZA 5L38A 4ELVA 2C3UA 1B64A 4K59A 1AZSA 3PHEA 3BPSP 3VR1A 4DV7J 1K44A 5HMYA 2F8HA 2FJVA 3NOCA 3SSRA 2YNHA 1WD6A 3GIJA 2BOAA 2ABYA 2D9PA 4IR1A 1JJ4A 2IM0A 3NWGA 3R5AA 1LV5A 4DPTA 1W26A 4ZHRB 2YWFA 2OGUA 4OYAA 2RAQA 4USIA 1TTHB 2AZ3A 4MKVA 5DM7Q 3GIMA 2B5JA 3T5JA 1RADB 1CQNA 3TI0A 4K2XA 4PR6A 2KHDA 1S6OA 2ZITA 3RAQA 1QAJA 2HS4A 3H5YA 2B56A 2AYEA 2CPJA 3TR5A 3ZO7A 2HBYB 4ZP8A 2RU3A 2VBZA 3ZTSA 4KHMA 4IRKA 1HBOA 3PR4A 2HFZA 4KSEB 2DGVA 3MM8A 2Y1JA 4QU6A 2E1MC 2A6MA 2DY1A 3T1YF 4CO4A 3PACA 4AL5A 5B09A 1JLFB 1RT4B 4NLYA 2F4FA 1KVJA 2HRUA 2HAIA 4PUOA 2EG1A 2HHHF 5LSLA 4U7CA 3B4MA 1T95A 2OFHX 1KLNA 2VJVA 2IDLA 2KL8A 4G65A 4H4KA 4D3HA 1Q7YT 3MCNA 1IBLF 1S59A 2IYGA 2DISA 2KO1A 4O0NA 4J9SA 2DXDA 2WONA 5DDQC 1TFWA 1N5TA 3LGMA 1KOOA 3LW5C 5A8RA 4OI3A 4X4VA 3GSIA 1Q53A 1IKXB 2MQMA 1LWXA 2RU9A 4C0OC 3KUEA 2CQ0A 4ETXA 4DR2F 4C0HA 1S6UA 3HKZD 1HPZB 3DDIA 2VG7B 1JXVA 4F0MA 3G86A 2FJDB 3J7A1 4CO0A 1RKJA 2XHCA 4CLLA 3MM6A 3PEJA 3IM9A 4PPZA 2XHWA 2UUBJ 2RIJA 4G1IA 2Z58B 1WWHA 3G2XA 4GKKJ 2AJ1A 3LPYA 3Q8QB 3UWTA 2B51A 1J5EF 1S6QB 2ZH5A 2PEBA 3EICA 1C1CB 2W4PA 1HNZF 2FPHX 4RJVA 1NSPA 1C1BB 2GCFA 5KT5A 5A6WA 4Y2MA 4ZJQA 1HWLA 4OZ2A 2WSFC 4EFAC 1RLCL 3PYGA 4CYUA 4UQTA 5E7OB 2IJNA 1PAEX 3ZZUA 3O3LA 5I3QA 1Y5NB 3KWMA 3HF5A 4NA3A 2VOOA 1JLBA 3LTOA 4K7QA 1YVFA 4B3SJ 1XNRF 4R8UA 2PFFB 4QWBA 1RT5A 4AQYF 4CQ1A 1NM2A 1D09B 2VD3A 1Y4ZB 2VA3A 3OXFA 3C2PA 1G4CA 2QEXS 1BY9A 3EWGA 3J80Y 3GG1A 2OIHA 1BD6A 3AJDA 5I3UA 5HP1B 1C0TB 2IDEA 5D0HA 2VL1A 3MEGB 3FZ2A 4IO9Q 1TK0A 4M1KA 2GVZB 5KT6A 1VRUA 1K8AT 4QIWD 1UWBA 2GHPA 3PW5A 5KFFA 4KIAA 4DL5A 3ENQA 1HBUA 2V4JB 2Z2LA 2ZUAA 1C4CA 2NR0A 1NRKA 1KBRA 2AEJA 1URNA 2EBEA 3VAHA 4OX9J 3BGRB 5D6GA 9RUBA 1H6KX 1NDPA 5KOXA 4DQPA 2BYCA 3CPWR 4BLGA 5KG0A 4PKDB 2QSFA 1XNQF 1JLQA 1CJVA 1UZDA 2C2ZB 1WC4A 4KGZB 1DQAA 3WIUA 3W65A 1B0TA 1TL3A 2WW8A 4LBHA 3BH6B 4OL8A 3IRWP 4LSZB 4WP9A 2B9XA 4O3SA 1N34J 1VK8A 1NPRA 2Q1LA 4DV1J 1ZM3A 4M63A 4KRWA 4DR4J 4QOTA 1KD1T 3KLFA 3QRQA 3IG1A 3U1LA 4JI8F 1FKPA 5HAOA 3CC7S 2X3GA 1NK0A 1QLNA 5CD4H 1M90T 3CD7A 2L9NA 4DV3J 4ECYA 3OTEA 2QJ3A 3HXMA 2BJ9A 3FBEA 3TUJC 4WFZA 4OHWA 3M30A 5C5JA 2PMZD 2Y0SD 5LSOA 3QFHA 1TKDA 1S0MA 1KQFB 1Y11A 3D6HB 1KDNA 2UV8A 3Q8UA 4DG1B 2MKJA 5D8HB 2P6TA 3GFHA 2C28A 2NLWA 4J5OA 1XC9A 1RBAA 1YDLA 1AA1B 3POTB 2K7JA 4QIGA 1U7LA 2BBEA 2VZ9A 5HI7A 1CS4B 5A6PA 2DYAA 3FDSA 4NE9C 2BZ2A 4K4SA 4K0KJ 1ZM9A 4XTTA 1F5AA 2GC8A 4IG0A 1KHWA 2LA6A 1A0OB 4NLRA 4UZCA 1EJ7L 3HZEA 1K0VA 2DPJA 1LFPA 2R7XA 2XCPA 3GPAA 1MMLA 3T6JA 2MKKA 1FNXH 1PJ6A 3JSMB 1SC4B 3DRPA 4FNHA 4C6AA 3PKMA 3P49B 3ISND 4J9UE 3S7RA 2KG0A 3CD0A 2ZHOA 1N5QA 3QJPA 3BKTA 5KFZA 2MY8A 5CABA 4J37A 3QO9B 1HQUA 5GAHU 2I8EA 1ZZNA 3CXCR 2HRTA 4DF8A 1RTHA 4ED0A 1X4EA 4LR8A 2ZH8A 4OHXA 2XNRA 1EKSA 1S49A 1QSSA 7AT1B 4B9LA 1H0HB 2CJYB 1EQ0A 5DDRC 2RVJA 3TVYA 3DXSX 1QE1B 1G7CB 2ACYA 4LIWA 3JSBA 2XS5A 4FPRA 5LT5A 1NJWA 2AIRB 1FDDA 1QUPA 1Q8KA 1N88A 5ETQA 4GKJF 2KZZA 5CYMB 1RWOB 2HNZB 4ED1A 5K14B 1RT1A 1JMTA 2XMMA 2XMAA 4X2BA 3GV5B 4QWAA 4OZJA 2XS7A 1UAWA 5IXUA 1SKWA 1VI7A 1QD1A 4J9VA 3IBWA 3PJXA 2DGQA 3BZQA 3C66A 4K8RA 3SMZA 1DQ9A 1JB0C 5GMEA 4RW8A 1LEOA 2HK3A 1SCJB 3OTCA 3OHBA 3MM5A 4ZLPA 3VAKA 2ZBQA 3I31A 4OI0A 1LXNA 4LF5J 2RRAA 2NXUA 2LQ9A 3OBIA 5H1SV 5DRKA 5D15A 3FEYB 4HKQA 4F3OA 4HDHA 3IBFB 3M32B 4MAKA 4ECXA 4PZVA 1T03B 4PG8A 4IRCA 4NLTA 3NG8A 5IT9Y 2BXJA 3AXMA 2MKYA 3ZTQA 3D0IE 2MKHA 1N48A 5CH7B 3DGPB 3QSIA 2X51A 4EO6A 4FF3A 3ZTRA 5EGYA 2BA9A 2AU0A 1NK8A 4YR2A 3MUMP 1WC6A 4EU0A 2BQRA 2CZ4A 4U7UD 1KSPA 2MJUA 4DPXA 3WX4A 5E2QA 1U26A 3V6DB 1JLGB 3OXGA 4ZVSB 1CJTB 3K58A 5HQ8A 2J8AA 1MWQA 1S0VA 3PW4A 4LQ3A 4ZN1A 4KHPJ 3M8QB 3MECA 2L9WA 2DRBA 2R7UA 1MN7A 4CZCA 3A8IA 2IC3A 1J5OB 5HBMA 3HKWA 1LWEA 5FIIA 4N41A 1YGYA 3PJ9A 3NS7B 3F41A 2OPQB 1RT3A 2CVEA 4R5PB 3BGUA 4DQIA 1GFWB 2CPHA 3R97A 1VQOS 3HHNB 3BPDA 2YNIB 5L8RC 1WEZA 2BW7A 1RWKB 1S6QA 2V4RA 3W2WB 1TV6A 2FJEB 3OR2A 2UUCF 3H7HB 4KH0B 3PXGa 2NZCA 3HJVA 1G2EA 4CH7A 1X60A 1V9OA 3QZ7A 4URGA 2XEXA 4W92B 2UXDJ 2K1RB 4UUWA 3HVWA 2HGNA 2J9CA 2V63A 4CLYA 3C14B 2GQCA 2YNGB 1LFWA 1HW8A 2ZC3A 3V2UC 4PYAA 3HVTB 3MM7B 3W64A 3MPDA 4OI6A 3HK2A 2FIUA 3W2VB 4LF8J 3GFYA 2G0CA 1J2VA 2ZVIA 4ES3A 1HHTP 2OSRA 2V4QA 4QIFA 3EVWA 3UNGC 5KG4A 4DV7F 8RUCA 3PTWA 2MKIA 3FJ2A 5A0YA 3IR7B 4X4OA 4TXSA 3M9NB 1S9GB 3N5BA 2Z8QA 2EK6A 1C0TA 1P1LA 1UVKA 3MHYA 4DSJA 3MEGA 1SUQA 3DM2B 3LP2B 4B3OB 3UVJB 1YJ9S 1R0AB 1AB8A 2DRAA 2LXFA 2V4JA 2Z4PA 4FF1A 2HYIB 4GO5X 3MZIA 4QW8A 2GHVC 5F9NA 3FCHA 4LR9A 4A48A 3E01B 2YBVA 1TZ0A 4NCAA 3L7OA 2N3LA 4P2MA 4RW7B 1G6BA 4DS5A 2VBXA 3IRXA 1BQMB 2X7IA 4RUBA 3TUZC 5C25A 2BM0A 1JLCA 3IGNA 4LJMA 4WJBA 2QYGA 3DMJA 3CULA 1XERA 2GO8A 1H3DA 1ZA1B 2ZWPA 1IBCB 1VYAA 2C2DA 2CJQA 4ZA1A 2HS3A 5MLCV 2CNLB 1TQLA 3AD8C 4DV4J 4JI7J 1UPPA 2HBQB 3OJUA 5JVGQ 1RI7A 2ZFHA 2V94A 2DGOA 3K59A 3DU5A 4KGVB 3ZFVA 4F4AA 2VV5A 2R8GA 5B0EA 1JKHA 1UEVA 5T7LA 3O2IA 4ENOA 3M2RB 2ZVSA 3CIMA 3SI8A 4JI0J 1N33J 1UTAA 3FC9A 1RAJA 2RDIA 1TKXB 3FKBA 4WTOB 1DAXA 1U0HB 2KI2A 5HL7Q 1S48A 1DTTB 1JLAA 2R3VA 2HVDA 3KLVA 1F2HA 5EHHA 3NAIA 5F0UA 4OYMA 4B02A 4KQZA 5KG1A 2AYGA 3G82B 3QIPA 3OFHA 3QWUA 1TUVA 4RW9A 5E41A 3Q8SB 4OYOA 4DG1A 2XI2A 2AV5A 3FCVA 2UXBJ 1V5VA 4OV1A 1YJRA 3M8RA 5CCLA 2NXNA 3UDCA 4X64F 2EPIA 2OFGX 3I9ZA 2G2YA 4NYOA 4P72A 2HSEB 2J8SA 3AXKA 2ZOFA 1QJHA 4HI1A 3DOLB 3ZC4A 4EO8A 3I32A 3DLBA 1LW2B 4WXOA 1CS4A 1H7XA 2J0QD 4WYLA 1NZ8A 2E9ZA 4ANDA 3MR3A 4DDFA 2W2OP 3ZTOA 4QPXA 1WHWA 3QLHA 2EW9A 4DV0F 3GE9A 1FWPA 5CZXA 2LLZA 3SCJE 1GX5A 2W7PA 1UJ5A 2ZNYA 4K4WA 2F8EX 2ZBIA 1ZAWA 1GTHA 3JSMA 1YWXA 3BH7B 2YNFB 2UV8G 2FLOA 1RAFB 1PKUA 2AMCB 1SC3B 4PWDA 1RTDB 1YITS 2Q6BA 2M52A 1H98A 3KJQB 1C0UB 4MFBA 3QO9A 2RS8A 2PSZA 1I3OB 4PQUA 3OVAA 3BO3A 3RB0A 2IVFB 2V9WA 3PYDA 3OLBA 2H3EB 4MIAA 4ECVA 5C42B 3W5XA 2FD2A 4LIRA 4DQSA 1NLKL 3KMSA 3LP1B 4HHJA 2XWYA 3RU0A 1TKTA 2Y1LB 1NK7A 2O3DA 2YKNA 2V68A 1HNXJ 2D1CA 2VQFJ 1KWMA 2ROPA 4ZPBA 4FYDA 5CYMA 4FVCA 3BGLA 3PCOB 4U96A 5F8HA 3SYZA 4CLUA 1H72C 2MJNA 1SV5B 3NY0A 2XBPA 3J7Z5 1WKJA 2C2KB 3MEDA 3JQJA 2FVRA 3OLAA 5A8KB 2JVOA 2PN6A 2YWHA 3HI9A 3R9LA 2XLJA 3D1QA 4TYBA 3MPWA 2R7RA 1QTMA 2B7BB 1FVSA 2KH9A 4HEA9 3TP2A 1FRJA 2QMXA 1K9MT 2HQFA 2YXLA 5G0RA 3C3LA 1SQEA 1S1UB 4LFBJ 3V4IA 2VDIA 1HNVB 2AT1B 4DV1F 3EZOA 2Q66A 3K5LA 4M5NA 4ZVFA 4DR4F 2V8GA 2N4DA 1WC3A 4B3RF 3H5SA 1FCAA 2MQPA 2MHNA 3D67A 1FJ7A 3UN3A 3QZ8A 1Z2LA 1X31C 5C24B 4X4PA 1RHJB 1KNZA 3U7JA 2HW3A 2ZEJA 9ATCB 3CJKB 4NASA 2QIFA 3M32A 4MKBA 5A8WA 1T03A 1U24A 1TAUA 1PGZA 4ZVPB 4OLPA 4C8YA 1FT8A 2MGZB 2CIMA 1NK4A 3R5JB 5GAEI 2WB1D 4USMA 4B3MJ 4ID8A 3K8WA 1UKUA 3MPYA 4BWMA 4V1Ak 1JLGA 4H4MB 4AL7A 1N5YB 5CAAA 3OVBA 3THVA 4K4XA 2ZOMA 1HHQA 2V67A 1UVIA 3BBBA 1M1KT 4MTPA 4DOZA 2CA9A 2KXNB 2L9DA 2J9EA 4NRTA 3RTVA 3M8QA 1REGX 2YKQA 1GMWD 4FKYA 2X1AA 2LU2A 2FLPA 1VQYA 4LF1A 3D5MA 4R25A 1S77D 2BX6A 3RRHA 3CB4A 3KLGB 3DRXA 4JI5F 1M5KC 3KMQA 2NSBA 1RWMB 1JQGA 4R5PA 1S0OA 2XC9A 4B08A 4DWIA 1RT7A 3ENVA 1NPKA 2YNIA 2DR9A 3PHTA 5LMUF 2OLWA 3HSJA 1HYSA 1RAIB 1YRTA 2QV6A 2LQBA 3D9BA 1U2FA 4DHVA 1JJHA 1C2PA 2BE2A 3LANA 5HMXA 1S1XB 2J7UA 4LVNP 2RD5C 5DM6Q 3LP0A 4UY8T 1EHWA 2YNGA 2DPIA 1KONA 4I2QA 4J9MA 3HPOA 4N5SA 3T5HA 3W2VA 2MQNA 3DDKA 4JI3F 3MOJB 2F40A 3DU6A 2AJQA 4FDFA 2W25A 1S57A 3CCSS 4F4ZA 4IQXA 3M6UA 3BBFA 3KG0A 2AF6A 1X5TA 2NSCA 4ZPAA 1VISA 1GNKA 2I9SA 1K1QA 2DNRA 1XR5A 1S9GA 2JC0A 3F73A 3MAHA 3IS9B 2ILYA 5HLFB 5ETRA 2C3MA 4PWWA 4FKXA 3Q24A 1WI6A 2NXCA 2IAJA 3K57A 2B9EA 4O3RA 1WHVA 4IQMA 5DGBA 3N6NA 3N4WA 2K3KA 4M5LA 4I7FA 5B08A 4KBIA 2HAFA 4JI1J 3E01A 3CCUS 5AE1A 2VQEJ 1NK9A 2ZM6J 4RW7A 2JWNA 3TX8A 3ETOA 4ED6A 2ATLA 1UEUA 2KRBA 1BQMA 1MWZA 4A8MP 4QWCA 2E5LJ 2EFQA 3C6TB 1WOOA 5LL6d 5IWAJ 3EX7B 4RO0A 4NLXA 3J80U 3G6ES 2LEPA 2HBRB 4I6AA 1MWYA 4O3NA 1ZYQA 1FJEB 5I42B 2Q43A 2ASLA 4DFPA 2VODA 2XGQA 1HKAA 3EZ5A 3PG9A 4USWA 3EVOA 3V81A 4F04B 4Q2LA 2RUGA 1VBZA 3I82A 4Y3CA 1E6YA 3D6MB 2VF3A 2GJIA 1S1VA 3OPKA 3BO2A 4NWBA 1DBDA 2YPZA 4DN9A 1HWKA 2HFNA 3RW7A 3RW6A 2KT3A 1P8GA 1X4GA 7FD1A 4NLWA 2WHOA 2VBYA 4O4RA 3DYAB 4DPUA 3GB0A 4ITSA 3DLEA 4JB8B 4TU8A 5BXIA 4DL3A 2FDNA 4WFYA 4IOCQ 2K8GA 4MH8A 2GMJA 3G82A 2MKSA 3VZIA 4CNYA 1YIJS 4AXJA 1MU2B 3RZAA 4CLKA 5HN0A 2H51B 4M5JA 1BWVA 4FVMA 4YY3J 2H5JB 3R7BB 1PYOB 1OIAA 2ZHAA 1KQKA 1SC6A 3BM7A 1WDDA 4OX8A 2ATCB 3UD3P 4U6PA 2HMIB 2HG4A 2K3IA 4F4WA 1U1OA 2YQ0A 1S1WA 3A4TA 5F8IA 1LW2A 1Y3KA 2ZKUA 4Y28C 5KG7A 2OPRA 1RUSA 1X5OA 4DZDA 1NUEA 3RB4A 3JQKA 2YTCA 2XZWA 4IFYB 1HMVB 1TFYA 1OY8A 4JYAJ 2DNOA 2ROEA 4URSA 3UN2A 2VBWA 3HFZB 2WOMB 2VDHA 2RUSA 1YZ6A 1NHUA 2RNEA 4ECRA 5HJXA 2BACA 2RQKA 4DL2A 1X4DA 1WG1A 2YNFA 2FHOB 2DNYA 5KFOA 4YS2A 1NZAA 2KZMA 1SJ3P 4DFMA 3LAKA 2DHXA 4C11B 1GH8A 1C0UA 1VQ7S 2AQ4A 3UQSA 4IUFA 2ZWOA 4DEZA 3KDNA 1EB0A 3RR8A 1Q79A 2FHJD 5IS2A 2YKMB 3M9OB 4Y2CA 3EZUA 2OEKA 3DI6B 3M2UA 1U45A 2KKHA 5KFLA 1WEXA 4NEYA 3ADAC 2K06A 3PYFA 4LREA 1CQMA 2KT5A 2WVBA 4XDDA 4W4MA 2WAQD 1OPIA 2F3JA 3QRRA 4J91A 4ID5A 3N28A 5DDPC 3DLJA 4L3KA 1RWWB 1PC5A 3ZTPA 2XTJP 2DHHA 3QRPA 3PW2A 1IVZA 1FESA 2VICA 2IRUA 1B70B 2K7KA 3I96A 4I2PA 2OSQA 2B8PA 4IFVA 2DIUA 2BE7D 3T1YJ 3QT6A 4USTA 4C98A 3FQKA 2L08A 4CLWA 2A2CA 4DU8A 2UUWA 3EXYA 1HNVA 1RU2A 2HHHJ 1RP5A 2HURA 5KFDA 1CULB 4F7VA 4HT5A 2M8DB 3KG1A 1R8PA 1UWAA 3G8SA 4OYIA 1IBLJ 3TAPA 1N33F 4TN2A 2FVSA 4HTJA 1HBNB 3TAQA 1R7IA 2DIVA 1HWIA 1SI9A 2J9DE 3C19A 2NQPA 3EXCX 4DR2J 2OPPA 1VQNS 3CDAA 5FLXY 1RYRA 4LQ9A 1DQ8A 4RUAA 2M7SA 2QLBB 4W98A 4KYZA 2HHSA 4X65F 4I1TA 2UXBF 4CLTA 1FTCA 4IOBA 3D66A 4EZ9A 2Z2ZA 1UA1A 4EEYA 1J5EJ 3BKUA 1T11A 3W61A 3JB9k 2XNQA 3QIDA 3Q8PB 4LF7F 1HNZJ 1VLOA 4ECUA 2OELA 5HROA 3GYNA 1IBMF 4Y2IA 1RAGB 1KLMA 3UN5A 1ZAVA 2I0XA 4OJHA 3H59A 2CPYA 1ZTTA 2B3TB 4FYXB 1KQSR 5IT9U 1N36F 1PC4A 4NYZA 1M5HA 1IKWB 2C22A 4AD6A 3PW0A 3CJ0A 3B54A 3SXLA 1DJ0A 3W63A 4DV6F 1WI8A 1T9TA 3R2DJ 1XNRJ 2BANA 2QRRA 3EGNA 2ZHBA 1FDNA 4PXEA 5KG5A 4AQYJ 3KJNB 1WHYA 2KDOA 2QTWA 2QFJA 3CO9A 2W7OA 2YNHB 4KKOA 3CWJA 5EX0A 2M2BA 4HACB 4OIXA 1HBMA 3PR5B 4YHHF 3KLHB 4DU7A 2GMLA 4DR7F 1GTEA 3THTA 1CBKA 3MR5A 3OSNA 2APOA 1SKSA 3HD2A 2ERRA 1AFJA 1RB0A 2EBGA 2R4FA 2B5JB 1P9QC 2R9LA 1R0BG 3PO5A 2BJ7A 3L3CA 3LPEA 4MIWA 4E0DA 4HTIA 4IH6A 1PCAA 2M0GB 3KNGA 3DHXA 1KVKA 4ZIWA 3P96A 1NSAA 4P7TA 3K89A 2PI4A 3TANA 7FDRA 3CCVS 4I64A 3OFFA 1HBOB 2V34A 1XNQJ 1DFDA 3MM8B 2OPSA 3SQOP 3BSNA 4F26A 1SKUB 1DARA 1LKZA 5E33A 5HLFA 4ZVRB 2DHSA 4LVOP 4A8YA 1XMQF 1IKYB 4NMLA 1SL2A 1K47A 3GQCA 2P8IA 2ZD1A 2CJXB 3M1VA 2OMLA 4Y2AA 1FRLA 1RABB 4PUOB 4Y65A 2E9TA 4HH1A 3GIKA 3TQ1A 1WJ9A 2DNLA 3GG0A 1UETA 3MCMA 2BVZA 3FK4A 3VVUA 3RAMA 4JI8J 4J7CA 1TR0A 2C2MB 1ZZFA 2PI5A 2PIIA 4WFXA 4FS2A 2GGPA 3GFXA 4E98A 3G4SS 3W3SA 5DG8A 5F8NA 2I1RA 4DUYJ 5I42A 1OY9A 1REVB 3JTOA 4DUZJ 1F5CA 5LXRA 3MM6B 2VPXB 4EWTA 1NJXA 1WG5A 4NRUA 2YVSA 2DR7A 1SC1B 1U02A 2GX8A 2ADBA 5T41A 2IIHA 3R6LB 2W9BA 2DJWA 3AB4B 3R7NB 4A46A 3ZXWA 3KFWX 3IP0A 2HNDA 1BLUA 1LWFA 1VRQC 1S1TA 1FF2A 1XTZA 1K0TA 1NCLA 2FGCA 3ISZA 3MR6A 3DYAA 1BQNB 4NYPA 4TNOA 4L72B 2BJ3A 5HVGA 4FYVB 3BR8A 4CYUB 2G1DA 1B3TA 3M6XA 1OYDA 4FXWA 5E3RA 3OTOF 1OQ6A 1WG4A 2GHWA 2FZCB 4WTYA 3QT7A 1FDAA 1RU1A 1JLBB 2HQGA 2GJFA 2E1RA 1P9YA 4R8UB 3H2LA 4X66F 4I69A 5GAEU 2KHCA 4ALZA 1RT5B 1VQMS 1Q5YA 3RBDA 3VAFA 3VWSA 3ISNC 4WFBQ 1QVGR 2J9DA 4KGXB 4Q44A 4ZCLA 1XMOF 1PIEA 3GSDA 2BMBA 4KGMA 4CWBA 1UVNA 2JNJA 2QT7A 1FNOA 2WVDA 2IJFA 2WK4A 1VRUB 3AODA 1UVMA 1TK5A 1UWBB 1HMVA 3GCXP 1HBUB 4JBCA 4ECWA 3CTRA 5DLGA 3H5UA 1VJQA 1TKZA 1JX4A 3NNAA 2DNHA 1I94F 3C46A 4GKJJ 1HFEL 5IZHA 4XO0A 1VBXA 2MZTA 2E44A 2W8LA 3LQVA 2DEJA 1KQGB 3CDUA 1RHRB 3ZZOA 4G6VB 1A9NB 3TA2A 2KRRA 4RR5A 5BR8F 2RJZA 1JLQB 2DXEA 2EI5A 1CJVB 2MLZA 2OD4A 3FEZA 1U09A 4YMEA 3NAHA 2BRKA 4OMFG 5IFMA 2YKMA 4DF4A 2V2KA 4EGLA 1RAOA 2V0NA 1TL3B 4NOHA 5KTQA 1S10A 4ZN3A 1RCXB 2FLLA 2DHGA 2AEFA 4FBUA 1T7PA 2VG6A 1U1NA 2A10A 4B9VA 4ELTA 1FD2A 2HNYA 4CO2A 1HD0A 3KLFB 3IG1B 2JC1A 3MPVA 5LM7E 1Y5LB 3NGDA 2CNNB 1FKPB 4TVAB 2MKCA 2PT0A 1YBAA 3BDPA 4P6QA 2LXUA 2R2TA 1LK5A 4DV2F 5B0BA 2EVZA 3RUBL 1RKIA 3Q89A 4JI6F 1SJRA 5E3PA 3ET6A 1Y5IB 3HCXA 3BJYA 2O66A 3K0JA 2CQCA 1MMDA 4RU9A 4NL5A 4F4KA 5DS7A 2IRXA 3GWCA 1R3NA 1HW9A 5IV3A 3MPUB 2AJ4A 3O6QA 3FSIA 4YP3A 4L74A 3NGKA 1TK8A 2HHPA 2MQ8A 4QYRA 4RBUA 4QR1A 2D3ZA 4PYDA 3GZ7A 2ZH9A 1XIQA 1U47A 3OFEA 4EI2A 2BJEA 2A18A 1EX8A 4PRFA 4HL9A 5CA5A 1RA7A 3M8PA 1RHQB 4WYWA 4LF9F 1VIOA 2KG1A 2QC3A 2W1BA 5KFQA 3KUHA 1TU0B 2V8HA 3TNVA 2E1PA 3RB3A 2MXYA 1FEEA 1HBNA 2C3OA 4GO7X 1RWPB 1NKEA 1Q8IA 3PO4A 4IG0B 5KFMA 5EUHA 1Y0HA 5KFWA 4J9NA 1GAOA 3WZ0A 3V6JA 2CKWA 4E8UA 2F4VF 4NA1A 5LOQA 3M05A 3ELHA 3DRPB 3TZYA 3FUYA 3BSCA 1FX4A 2IVYA 4YY3F 2H1YA 3US5A 5HQMA 1YRUA 2RDJA 2GQQA 2ZDOA 2LU1A 2QA1A 3DOKA 4IG3A 3OHAA 4K5SA 1QVFR 5L46A 1FDBA 5A2QY 3SQGA 4Y6IA 3GJQB 3UDLA 2UUCJ 3W9JA 4CP5A 3RR7A 4CM0A 2J7KA 3R8YA 2L3MA 4BDPA 3J81U 1ICEB 3I5BA 2ZZNA 2CXEA 4WIQA 3LUYA 3PV8A 4JYAF 1WC5A 4F3MA 3HHLC 5F41A 4ED5A 2RQ4A 4DS4A 5K8PA 3V6HA 1AROP 3OL6A 4DBQA 4WXWA 1R8BA 3GV8B 1RT1B 3QAEA 1Q86T 1R6YA 3UCGA 3AOBA 3D54A 4A8WA 1F6TA 1VQ6S 2MSTA 1WSVA 4DCPB 2B4OA 2HIQA 2MZQA 5ETTA 1WC1A 4C8LA 4ICLB 1VDHA 5DZ6A 3KJVA 3HP6A 4HACA 4IOAQ 2HHTA 3FMWA 1NKBA 4B9TA 3KLHA 3MM9B 1IQTA 2C42A 5CCMA 1FRMA 2DGTA 3H4BA 2D69A 4MMOA 1JWWA 1O8BA 3A13A 3F56A 2FVPA 1OO0B 4RW8B 2MPUA 4DPYA 1YJVA 2VB6A 3MM5B 1B4SA 4K50A 5FD1A 3QGPA 1SJ1A 1UP1A 5HVHA 2VU5A 3DRRA 4RW6A 3R2CJ 4NMXA 4FPIA 1MG7A 1MROA 3M6VA 5DQIA 4KR0B 1FKOA 3UDEA 2MTLA 2W4DA 1Q7LB 3VVTA 2Y0BB 2W2QP 3LGNA 2AZ1A 3NEKA 2FYXA 4CNZA 3AAWB 1KHVA 2N7CA 5HANA 1UFKA 3JS9A 6AT1B 2QLXA 2EC0A 3R5BA 1UW9A 3PRBA 3AQPA 1B0PA 4RNNA 3TRGA 3PX0A 4RUCA 3SCKE 5DJBA 1PYSB 4F3QA 1IKYA 2HQCA 1LK7A 1D8ZA 4UT4A 3CJRA 5U47A 2QX0A 4NLPA 1C4AA 3I0RB 3OVSA 2J76E 2AD9A 1RQ0A 4ZVHA 5AT1B 1F60B 1DLOA 3K5OA 2HIYA 4LF4J 1A6LA 3S6EA 1H73A 3RBXA 2ZE2B 1RWUA 2DY9A 5IT0A 2Q3PA 1VQ8S 3QAUA 2XSJB 1JLEB 3MECB 3T1HF 4J9RA 3R1HA 3KHHA 4QZVB 1B99A 3D68A 1W2BR 2HFOA 2XM3A 2IC3B 5HBMB 2W9AA 4USHA 2CAJA 4NLOA 3PZPA 1LWEB 1HA1A 1REVA 3MMBA 1SJ4P 4OQJA 2B6AB 3NP5A 1RT3B 1YJ7A 2RHSB 3G87A 4A4JA 4FYYB 3KHGA 5DLFA 4CDIA 1JK9B 4N47A 2MQLA 3M2VA 1PYTA 3QGIA 4X64J 5LMNF 1JJCB 2RRNA 4A8XA 5ETLA 4P2FA 5LSRA 2CUYA 4KPYA 3A8EA 1W2IA 2IY5B 4AYBD 1F9HA 1TV6B 3OR2B 4HDGA 2D74B 1O0PA 1SH2A 2FLNA 3TA0A 1BE4A 4X4NA 3MAAA 4X4UA 1BQNA 2MZJA 3MEKA 4O23A 3CDEA 3NCQA 4DV0J 2RILA 4N77A 2WB4A 1B0VA 1X9SA 4NXMF 1IXKA 4A8QA 3EE3A 4LFCF 2DITA 1VHIA 1Z4UA 3T41A 4DX6A 3VAJA 5J2QA 4OLOA 4RBTA 4ZPCA 1X5PA 3UD4P 5GVQA 4FN5A 1R43A 3R5GA 2YH1A 4GVBA 3VTIA 4DL0C 1MW7A 2VKZG 4E2FB 1GXLA 2CPZA 4F4YA 5DETA 4LFAF 2QLWA 3LWMA 4UOGA 3MUVP 3QPIA 4H4KC 2EFPA 1SIWB 5KG2A 4F0KA 1HNIB 5A0YB 4FBTA 2G1HA 4Q7AA 1WSRA 3H98A 3W8GA 2Y9HA 4OZ1A 2E5GA 5L1LA 4AE5A 4L3NA 2FHMA 1SL1A 3WIVA 2BDPA 1SUQB 4LRDA 1QM9A 1CJUA 2YQ3A 2FC9A 4ZLNA 4U7UK 3R5DA 2IM2A 1XMBA 2GNKA 1UZHA 2IA6A 5CXTA 3G6YA 4UOFA 3BYRA 1SXLA 5IQQA 2PGCA 2CQPA 2R7VA 3ILOA 1CJKA 5KFCA 1WKLA 4B3TF 3HDSA 1GK8A 2HPUA 3GCWP 3IRXB 3WHIA 4USJC 3KK2A 3DGVA 3SSQA 3W60A 2ZZTA 5C25B 1JLCB 5AJ3F 4NZ6A 3DMJB 3FBBA 2WZ1A 2XY7A 4K4ZA 1YJTA 3IFEA 4KV8A 4ZMMA 1N5VA 3EGVA 4DV5F 4KAIA 1NJYA 4ZJOA 4ILLA 5L1IA 2PEHA 1CLFA 5I4MA 2AKWB 4DQQA 3DHWC 1VQ5S 3B4DA 1RTJB 3MXHP 3BYPA 4TLRA 3QGGA 2OTJS 4PG4A 4B3RJ 2CQHA 1JKHB 2HZAA 1M5OC 5T7LB 2DO4A 2HKEA 3TZXA 4DR3F 2QG9B 1R8CA 5KFKA 4WKYA 1NK6A 1M5PC 3C6UB 4Q0BA 3J7YI 1JLAB 4DL4A 2EEYA 4MT1A 2VIHA 5DDOC 3SBMA 3NGUA 1U2RA 3QIPB 4DUYF 4DSLA 5CYJA 1RTZA 4UOCA 3T5LA 4GMKA 4RW9B 3A3PB 4DUZF 1BC6A 3BF4A 2DR6A 2M3DA 1T02A 2J6SA 1F5BA 2DTJA 2ZH1A 2JHEA 8ATCB 4RWXA 2F9JA 3VQTA 3A3NB 1DURA 3TYTA 1X0FA 1Q8BA 1UA0A 3AD9C 1Q95G 1HR0F 4WF9Q 1DRZA 1N32F 1X4HA 1YI2S 2DB1A 3C15B 1RT2A 3IC1A 1FVQA 4ES1A 2PDAA 5EWGA 5CYQA 4NLQA 3L95X 3QLHB 1F2GA 1CEZA 3I0SA 5ETVA 5KFUA 4YUDA 4J9QA 2DNQA 4PXCA 3HVAA 4JI5J 2R8JA 3MMCA 2A1BA 2RMLA 4IYQA 2C3YA 1KFSA 2GS8A 5IT4A 1RA6A 4V19X 1EIYB 1S12A 1VOMA 2OI2A 4PWDB 1DHMA 1IN0A 2G0IA 2ZJQQ 3BKFA 2HHXA 1FXLA 4MFBB 2CG8A 1S76D 1NNDA 1QUVA 4DN0A 1L5UA 4PQUB 4GVLA 2YKAA 4FNIA 5LMUJ 4YOEA 2E5JA 3MR2A 4PXBA 2VC1A 4G1QA 3SEOA 2IYIA 2JL9A 2GO9A 5J2NA 4Z7CA 4ATNA 2DNKA 3FRYA 1U6FA 2FUG9 1RAEB 1TUWA 2DNGA 2HZVA 1TKTB 1ULRA 4JUZA 2YKNB 1NXIA 1X8DA 3ONQA 5FLXU 4Z37A 1BGXT 2Y8YA 3K7RA 2PC6A 1ZETA 3CJQA 4JI3J 4X62J 1EQMA 4B9SA 2NREA 3TAMB 4V19J 2MLYA 4QW9A 3CVKA 2IMOA 3MEDB 1QAXA 1ZBTA 3DXBA 2V8PA 4Y2KA 2DGSA 4ICLA 3H0PA 5AXLA 4DI6A 4TQSA 2KFZA 3T9NA 1NBEB 5C2GA 3A12A 3MM9A 3ZNJ1 2LFVA 4JV5F 3JTNA 2QZ8A 1RTIB 3K5NA 5G0RB 2F1FA 1FRKA 5FDLA 3TUIC 3EVMA 3ICLA 3NNCA 1EP4A 3V4IB 1FXRA 4YR3A 4J9PA 5KFRA 3N79A 3J81j 3VF0B 2VFTA 4PABA 2GIRA 4HT7A 1OS5A 3JSYA 4C8MA 2Y1IA 4C3LA 5B0GA 4CRJA 6FD1A 3A8KA 2FTRA 2UVWA 2EFVA 3DOMB 3AFGA 4O44B 5A8WB 4TKTA 1D8YA 2DNPA 1KTVA 5T14A 3BDEA 2WVEA 4LMZA 4PG7A 1QAYA 2MQQA 2J0SD 3QYYA 4K4TA 1J27A 3N9UC 4NZ0A 4H4OA 3Q8YA 4IDKA 4CCHA 4B9NA 2DT9A 3N6LA 1YJUA 1RZMA 1Q4RA 1GXTA 4M5HA 4AL6A 2P9GA 3I0RA 3AT1B 1MNEA 1VC6A 1Z1ZA 4PAAA 1NMEB 1YLXA 2A3JA 4OZ5A 1ZOTA 1KFDA 2ZE2A 1XQIA 2VASA 3Q83A 5D4PA 1LWCB 4MJKA 2XSJA 4FXDA 1JLEA 4QIVA 2PFDA 1WTBA 3H2UB 1NPPA 3NGSA 2DH9A 1FA0A 3NL0A 2ASJA 3IWNC 1MLAA 3DLLQ 4CO1A 2F5GA 1NK5A 2VFRA 2XO7A 2VFSA 5J1EA 4ZVEA 1SB6A 2B6AA 4MKAA 2IM1A 2LCWA 2HQ3A 1RT7B 2DBBA 2X1GA 4P9SA 1JJ2R 5I3PA 1ZA2B 4DFKA 1HHSA 4WIIA 2Z0GA 5DG7A 4DPWA 5KG3A 3TOQA 4U8YA 1HYSB 4L75A 4I4BA 2D41A 2GIFA 2JRSA 3BGOP 4K4UA 2CJBA 2BE2B 2DRDA 3KHRA 1X4FA 2W4CA 2BABA 3NS6A 2HHUA 3LP0B 3MUTP 1SJQA 4I56A 2JDJA 3BR9A 3HHLD 3AHPA 3KDOA 2WVCA 3TJ8A 2BQUA 3FBFA 1FI4A 2OP5A 1I5OB 2DO0A 2F7VA 4I2QB 2OO4A 3E2EA 2NPIA 1AYEA 3AB2B 5M2RA 3D4JA 1FE4A 1VQPS 4LBPA 2R7WA 2M70A 2Z30B 2CQDA 4JI2J 2HVHA 2XMJA 3UW1A 4RX6A 1HNIA 2Z56B 4CI0B 4C48A 2CYYA 2AYMA 4IH5A 1TL5A 2ZJRQ 4Q45A 3UCZP 3CO0P 4LSLA 2KJVA 3TARA 3MMJA 1RT6A 2IAJB 1PG5B 4KH1B 1N8RT 4M95A 1CSJA 1YK9A 3OUYA 3W5YA 4I7FB 4I68A 2UZAA 2V6AA 3ZZPA 2XZTB 2ASYA 4CLZA 4DCJB 2R8KA 4LRBA 1U1MA 3IAM9 4QWDA 4NI2A 1U2CA 1DTQB 4OFZA 2BJ8A 2DHAA 2H5IB 5MAOA 2B4VA 3FFIB 3E3XA 2AEMA 1VRTA 2B9WA 3CMAS 2CPIA 4KHRA 3X1LB 4DL7A 1S6PB 4OJ1A 2OEMA 1UVJA 2O5DA 3SDEB 4EK2A 3G8QA 3ENAA 2JEGA 1S7HA 3THPA 4J9LA 3DC2A 3CJ2A 3D28A 4TY9A 3IM8A 1L3KA 3EPGA 4TYAA 5KFJA 3D6FB 1JXEA 1B7YB 4LT6A 2R2UA 3C16B 3AH6A 5D3GB 3V81B 2V2QA 3GU0A 2D3O1 4L73A 4ED4A 3TZWA 1RTJA 4DFJA 2GVDB 1E6YB 2VUGA 1S1VB 4CH1A 1IJFB 2V8DA 3MD3A 3UFCX 2B43A 3C8YA 4LF4F 2NCKL 4KO0B 2RKIA 2BM1A 1SJFA 1EZZB 2UUAF 1Y00A 4N7TA 1K1SA 3C6UA 1IWAA 2Y1RI 3D1HA 4RNHA 2LQ8A 3DLEB 4O4GA 4LRAA 4F36A 4P7VA 5AE3A 2LQJA 3UO0A 2DNNA 3VGSA 3S01A 1NB2A 3BREA 2W7AA 2CQGA 1NJZA 2JJ4D 3OXLA 2FB0A 3MURP 3JAMY 1D9FA 3GILA 2VC0A 1X4BA 2RH3A 3AOCA 2RS2A 4X65J 1FRHA 5D4NA 1OJ4A 4IO1A 5GAGI 1H2TZ 2CWKA 1S9EA 2NYIA 3DNCA 1RBLA 4X4TA 2E7XA 1HNWF 3H40A 3FZBA 3OT9A 2V5HG 4J9OA 2E5IA 4M5DA 2XYHB 5AE2A 4LF7J 2F63A 1S1WB 2O1PA 1IBMJ 1T05A 2E1CA 3C15A 2OPRB 3TW0A 4YN3B 1S4FA 5JUMA 1XWLA 2XCAA 3BB5A 5L39A 1KR4A 4DPOA 1T3NA 4CM2A 3QT5A 2NXEA 1WDTA 2XY5A 2U1AA 4OYBA 4WFAQ 4JI4J 1N36J 3UR0A 3PIPQ 4F2RA 4W90B 2PA8D 2IPOB 2CQIA 2WSEC 3R5CA 2DEIA 2BKPA 3EGWB 4DV6J 1T94A 2MZRA 4LF6F 1SH3A 2N3OA 2I6WA 1YSJA 2FY1A 3UI3A 2VOPA 4ED2A 2P6SA 4UZBA 3KNAA 4BBYA 2L48A 1LW0B 1RHUB 3OR1B 2YX1A 2HLUA 4KB7A 2Q79A 2BEFA 4TU7A 4YHHJ 1UL3A 4DR7J 1V3ZA 3WDOA 1RXOB 2JEIA 3M2UB 2ZOGA 2HHWA 1LNQA 4LBIA 2AX1A 3M9MB 1FWLA 2UXCF 1YHQS 2YKPA 2C2OB 3RBEA 4F50A 5J2PA 4WCEQ 1RJJA 3CJ3A 1RGVA 1V3SA 3V5RA 4ID5B 3FSYA 2P9CA 3I5AA 1M5SA 4USVA 2JLGA 4TLQA 1RACB 2HS0A 3TAMA 4P75A 5EWEA 1WF2A 3CD6S 4A8SA 3BO4A 1VK3A 3W9IA 5A2QU 1DZ5A 1FJCA 4I2PB 1YJNS 2EKNA 3SIPB 4IFVB 3LALA 1ROFA 1Q16B 1V3RA 2JLEA 1XMQJ 2FJXA 1RTIA 1AXQA 1Q5VA 2LMIA 4JP8A 1KTQA 5K8MA 2YPYA 5D0EA 1NSQA 2DR5A 4O3QA 4LF2A 2LP4A 4YQWA 3K5PA 3T3FA 4RWWA 5D78A 3IA0A 4LSNA 3DLHA 3KYLA 1TVRA 2BKNA 3S1TA 4I67A 4ANEA 2KT2A 5IM0A 3WQPA 4RZRA 5KFXA 1WACA 2OMOA 3BBCA 1U1KA 2G4BA 3J81Y 3DOMA 4RNOA 5J2MA 3EMTA 4O44A 2DR8A 1KOHA 1XK8A 3MCSA 4WP3A 1N52B 4ZVQB 3OSPA 3CNQP 5KFTA 2OPPB 1E6VA 4I6YA 4PXDA 2QFIA 5HQLA 1RHKB 4UUXA 3CCRS 4DUTA 2B4PA 4DMZA 1L3SA 1PSDA 4IH7A 2ASDA 3MFIA 3MI7X 3NWRA 3ETMA 1KC8T 3I9V9 4NXNF 4RLEA 3I4PA 2WSCC 2KB2A 2W01A 3Q8RB 3PW7A 3HT0A 1RWXB 3DKDA 2FC8A 2MY7A 5HROB 3MGJA 3AJ2A 1N0UA 4XPEA 2VA2A 1KLMB 1LWCA 3FGVA 3CCLS 3J7YU 2NXJA 3QWPA 1IBKF 3CC4S 3R7SB 1NDCA 3K5MA 4KJIA 2HRYA 4U8VA 1T9WA 3ILJA 4ZCMA 2AJ0A 4OZ0A 4UF4A 5B7WA 1HWUA 2IBOA 1HQEA 1TL1B 1VC0A 4K2JA 4RW4B 4F8RA 1TL7A 1X9WA 3OTOJ 1Q1KA 2C1EB 2G0JA 3GIRA 1GMWA 2D3OR 2BANB 4X66J 2G2OA 3W66A 3OQ2A 1ACMB 2H48B 3FQLA 3MDFA 3RRGA 1YQHA 1PAUB 2OTLS 2UVUA 1T8EA 2AGQA 4CLFA 4DLEA 3LAMA 4M8LA 3OJSA 4Q2MA 2JSXA 3PM9A 4KKOB 1IQZA 1HL6A 1XMOJ 2POKA 2FY8A 2J0XA 3NNHA 1CC8A 1HBMB 3IR6B 3SV3A 1GT8A 3NCRA 2XMUA 1T9XA 3LF0A 3WX8A 4TY8A 1ITPA 3SFGA 4BC7A 2IVMA 3G6XA 2XMWA 4USKA 1RAHB 2JZ5A 3BSAA 2CNOB 2V9KA 5FJ4A 2HLTA 3CDWA 1RISA 2E7WA 3UNYA 3SFUA 2JH3A 3M8YA 4HLBA 3VGVA 1I94J 1PJ5A 1WEYA 4X62F 2UU9F 4PWUA 1AFIA 2H65B 2BRLA 5BYSA 2XQCA 2LEBA 2JLFA 2GW8A 3M4XA 5BR8J 2GAGC 5KT3A 3H8YA 3TVKA 1VCTA 2SXLA 2OPSB 3PVXA 4NLUA 3HJFA 2DVIA 1K73T 3NMAA 5HMWA 1YX2A 2HK2A 2VONA 5ETNA 3O5TB 2OD6A 1IKVB 2ZD1B 3M1VB 3NGRA 2E29A 3DRSA 3IR5B 1M0SA 3VZHA 4A47A 1N0VC 3DRYA 3VALA 1UJ4A 3G9CA 2CWXA 5F3ZA 2ZNZA 5ETKA 1DTQA 3FFIA 2HGMA 4X4RA 4DV2J 2WCXA 2GGPB 3QJLA 2L41A 1U48A 2J6UA 1GMVA 3CCZA 4JI6J 2KU7A 1S6PA 2WBRA 4OI2A 3SDEA 3MOZA 3A3OB 1NHVA 3K8VA 5AXMA 4WE1B 3DLKA 1VBYA 2M88A 5JVHQ 4OYPA 3C16A 5D3GA 5H9EK 5AXKA 2CJAA 2MZSA 4UQGA 1CC7A 2OHDA 4D3GA 3GV7B 2GVDA 2VKRA 4ILMA 2DH8A 2O01C 1R0CB 1UJ6A 3K2YA 3CF5Q 2H4WB 2W9BB 3BN7A 2ILZA 2VPWB 1BWEA 2HNDB 3X3UA 4RBVA 4LF9J 2PMWA 1LWFB 4HVZA 4GC7A 4KO0A 2ZH7A 1S1TB 4KE5A 5GADI 1KP6A 2VFUA 4C97A 2CG4A 4KFBB 1M1HA 3N5FA 5JMNA 2V2VA 2W8KA 2NUHA 4ZVGA 2VG5B 1FEHA 2LDIA 4UTGA 4C7QA 2F4VJ 5GMDA 3CMQA 4UY85 5E0OA 3U1MA 1T0TV 4ZHRA 2A6OA 1H7WA 1QSLA 2B0GA 1EKRA 4F67A 5D4OA 1F0XA 2KJWA 2RQMA 3L7UA 4TQRA 3QFWA 3EDRB 3PYEA 3B6BA 4EYIB 4OI4A 2QA2A 3L4BC 5F8MA 4USUA 3PX6A 3PDNA 4YR0A 2I38A 3D0GE 4DJBA 4CTAB 4ZDNA 1O51A 2IBKA 2QSWA 4Q8EA 1GEHA 1GXUA 2ZBPA 4FP9A 2HHQA 1U1PA 2J0WA 3QATA 2KN4A 3EUNA 3RG6A 2E1AA 4DX8H 3UPFA 1VQSA 3CUNA 1TKZB 1L3VA 5F8LA 4L76A 3U02A 2KFYA 3CJ5A 4NZ7A 1JLFA 2CNKB 1RT4A 1W7WA 4JI2F 4ZLJA 3DCAA 4ECTA 2EKYA 3GFZA 2H9ZA 4WKRA 3H2VE 3MAQA 1LW0A 3OR1A 4A8FA 3KHLA 1M5VC 3EM1A 2YY3A 5DG9A 5H9EJ 4C4WA 5DQGA 1XR7A 1V6HA 2YH0A 1Q8LA 4YB1P 2RT3A 3NGTA 4ZVOB 1BXNA 3RB6A 2VG6B 3W5ZA 1IKXA 2KM8B 3PNIA 4K4YA 1SH0A 1BMQB 2FHJA 2HNYB 3GR1A 2LVWA 2B9YA 3H42A 2UVVA 1YZ7A 4EYHB 4WPAA 2M8HA 4CO5A 3CCQS 2QMWA 1HPZA 4DL6A 2JX2A 2VG7A 1BUXA 4RU2A 4ZPTR 4FF4A 5B0AA 3VAMA 4N8OA 2CPXA 3ET6B 1QAIA 4HR2A 2UP1A 5B0DA 3D3CJ 2CDRB 3DLGB 3LGHA 3VGUA 2C3PA 3JTPA 4N8NA 4TU9A 1C1CA 1AUSL 5K5MA 2CQBA 1C1BA 2VJUA 4K5RA 4RKUC 1D1UA 3B78A 5KOWA 3I5CA 2DKOB 2EFNA 2XSFA 4B9MA 2WVFA 4MK7A 4QU7A 4QYZK 3M8PB 5F3TA 2J6TA 4OYXA 2DGXA 3Q8VA 4WZQA 4BCAA 2HQDA 3RJMB 1S7IA 4P10A 3NBPB 2ZDPA 3JYTB 5L9NA 2QL5B 3T1HJ 1WUUA 4R0JA 1U1LA 2IM3A 1GQEA 3ZZYA 2DGUA 2MEWA 3KUGA 2MDAA 5KFVA 2IRYA 4WP8A 5F0WA 5HP1A 2FVQA 2XGPA 2NYHA 1VFJA 3CSKA 3W7BA 3QSYB 1CG2A 2W24A 2GVZA 2AGPA 2HZCA 5LMNJ 2F65A 4DSKA 3DOKB 5L9XA 4IG3B 1FO1A 2MYFA 4M5IA 2AW0A 1U49A 5H9FK 3R6GB 5KFYA 1KS2A 3SQGB 3FMBA 1X5SA 2QMUB 4F02A 3Q86A 2M9KA 5KFHA 3TQEA 3BGRA 1UVLA 4C8ZA 3GTYX 1CVJA 1TL1A 4JI4F 4RW4A 3CGIA 2XO6A 2H54B 4AUKA 4NXMJ 4CIOA 4LFCJ 1RYSA 1VQ9S 3BQ1A 3UDVA 5HSPA 5GAGU 2W2NP 3P8BB 5KT2A 3D2WA 2RHQB 4ZPVR 1FKAF 1TAQA 1T9UA 1FERA 3ENWA 2LXIA 4LFAJ 4C3MA 2P2CB 3NMRA 1NJIT 3Q2TC 5HO4A 1VLYA 3KJVB 2E5HA 2EFOA 2FVCA 2GQ2A 1MN9A 4G3IA 4HH0A 2HWTA 3ZZRA 3J7ZT 3H90A 1Y10A 3SZ2A 1U1RA 2MQOA 2ZZMA 4AFFA 4RNMA 4QYZJ 2CRLA 2PMHA 3PRDA 5RUBA 3O8WA 2CFXA 2ALZA 4O0IA 4GC6A 4KGKA 1AT1B 3DRRB 5KT7A 2R2RA 4RW6B 3AA9A 3I4HX 3OL8A 2ZUGA 4B3TJ 1FK9B 1MROB 2MB0B 2YWKA 2QLJB 3GMGA 1Q82T 5DO2A 3Q23A 4ZOSA 4OJGA 1FKOB 2UUBF 4N76A 4GKKF 5AJ3J 1I51B 3RGIA 3UCUP 4CT8A 4NCGB 2JEFA 3B8HA 4ZVUB 1JIHA 4EBDA 5KFIA 2YX7A 3CC2S 2DNZA 4MK8A 1Y7PA 1WC0A 3HX9A 3POTA 2WBMA 4DV5J 1Q78A 3GYGA 2GZOA 3HD1A 3LOUA 4LUBA 3AA8A 2OUGA 4Q43A 4KPCA 4P2SA 3ULHA 1Q81T 1IKVA 3TA1A 2H4YB 4I6WA 5H9FJ 2XY6A 4P71A 2A0FB 1BQXA 5HJYA 2JVRA 4FXVA 1YKWA 2CZ9A 2DNMA 1BHNA 5K20B 5F8GA 1DLOB 3D6TB 1H2UX 1JNZB 3MWBA 4DR3J 5GMKa 3BS9A 2AYBA 4AT1B 4B3SF 2XMTA 4A8KA 1IR0A 1R31A 3PFOA 1IJEB 2ZH4A 1OSDA 5C2CA 2CVIA 3L7PA 4OHZA 1U1QA 1PILA 2HWIA 1R6VA 4C3KA 3HFKA 3RRKA 2CQ3A 1PJ7A 3OL9A 3QJJA 4WE1A 4ES2A 3TEGA 3MMBB 4C8OA 2XULA 4C2MA 2XMVA 1NSKL 3HZGA 3GLJA 1I6JA 3A8JA 4NEZA 4ERDA 2R7OA 2MMYA 4I0WA 3M2VB 1VJWA 1ZPWX 2BR0A 1QE1A 2V2ZA 4BC9A 3W1YC 1HR0J 3ITHB 5ETMA 1N32J 1URRA 5LJ3Y 1F9EB 3MAAB 4OX9F 4UW2A
chains in the Genus database with same CATH topology
1HWJA 4KFBA 3FSXA 1TP7A 2GIRA 3LW5C 4HT7A 4OI3A 5A8RA 4C8NA 1OS5A 4X4VA 3JSYA 4BWJA 1Q53A 3ZZZA 3LWLA 1IKXB 2B4UA 2MQMA 3OFGA 4C8MA 2Y1IA 2ROGA 1NHUA 2RNEA 2RU9A 4C0OC 4ECRA 2BACA 5B0GA 4C3LA 1U4BA 2HNZA 5KFSA 2CQ0A 2RQKA 5K14A 4ETXA 4DR2F 6FD1A 4C0HA 1R89A 1S6UA 4DL2A 1X4DA 4OHYA 2VG5A 1WG1A 2FTRA 3HKZD 2YNFA 1FD8A 2UVWA 1HPZB 3BEGB 2EFVA 1D9DA 2FHOB 2ZH2A 4O44B 2DNYA 1L3UA 5A8WB 5KFOA 2VG7B 3G86A 2FJDB 3SCLE 1NZAA 3J7A1 1SJ3P 4TKTA 2KZMA 4CO0A 4DFMA 1D8YA 1RKJA 5J2QB 2DNPA 3LAKA 1KTVA 3MM6A 3PEJA 2DHXA 5T14A 2N4CA 4MKYA 3BDEA 4U67Q 4C11B 1GH8A 4PPZA 1C0UA 2XHWA 2RIJA 4G1IA 1VQLS 1WWHA 1VQ7S 2AJ1A 4LMZA 4PG7A 1QAYA 2AQ4A 2MQQA 3UQSA 2H5EA 3LPYA 3QYYA 4K4TA 4IUFA 2J0SD 3Q8QB 3UWTA 2B51A 1J5EF 3N9UC 4DEZA 5SZTA 2OKQA 4NZ0A 1S6QB 4H4OA 2ZH5A 3RR8A 4ED8A 1N34F 1Q79A 1C1CB 4IDKA 4CCHA 2FHJD 2W4PA 4ZKAA 5IS2A 2YKMB 3M9OB 2DT9A 3GIIA 3N6LA 4B9NA 1HNZF 1YJUA 2FPHX 4Y2CA 3EZUA 3N6MA 1C1BB 3DI6B 1GXTA 1Q4RA 3T9ZA 3M2UA 4URQU 4X4UA 1U45A 3HHDA 2GCFA 2KKHA 5KT5A 5KFLA 4AL6A 1WEXA 2P9GA 3I0RA 1MNEA 5A6WA 3P3DA 1VC6A 4Y2MA 1Z1ZA 1HWLA 4CTAA 2KYXA 1CQMA 2WSFC 2A3JA 4OZ5A 4EFAC 2BW2A 2KT5A 1ZOTA 4XDDA 4KC5A 4F4XA 1KFDA 2ZE2A 4UQTA 4BHQA 4DV3F 2VASA 5E7OB 2IJNA 5D4PA 2WAQD 1LWCB 1X4CA 3ZZUA 3O3LA 4MJKA 5I3QA 1OPIA 2F3JA 2XSJA 4FXDA 1JLEA 4ID5A 1Y5NB 4QIVA 3N28A 3KWMA 3HF5A 5DDPC 3DLJA 3BSOA 1WTBA 3H2UB 3H25A 4NA3A 1XBWA 2ZH3A 3CCJS 2DH9A 1FA0A 2VOOA 1JLBA 3NL0A 1YVFA 2ASJA 3IWNC 1PC5A 3DLLQ 4CO1A 1XNRF 4XAKA 1NK5A 2VFRA 4R8UA 4WFNQ 2XO7A 2PFFB 1FRIA 2VFSA 4QWBA 3PW2A 1RT5A 5J1EA 4OJ3A 3DGPA 4AQYF 4ZVEA 1FESA 4CQ1A 2CPDA 1SB6A 2B6AA 2VD3A 2IRUA 4MKAA 3KK2B 1Y4ZB 2IM1A 2K7KA 2VA3A 3I96A 4I2PA 2OSQA 3OXFA 3C2PA 1X7VA 2LCWA 2HQ3A 4IFVA 2DIUA 2QEXS 1RT7B 1BY9A 3J80Y 2DBBA 3GG1A 4ECZA 2JEJA 1QY7A 2X1GA 2KVIA 2OIHA 1JJ2R 4C98A 2CDQA 1BD6A 3FQKA 5I3UA 3V6DA 5HP1B