1HNIB

Structure of hiv-1 reverse transcriptase in a complex with the nonnucleoside inhibitor alpha-apa r 95845 at 2.8 angstroms resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 reverse transcriptase in a complex with the non-nucleoside inhibitor alpha-APA R 95845 at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 100
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hniB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB03
4O4RA 1KHVA 3KLIA 3G6VA 3V4IA 1ZETA 3DYAB 2W7PA 1S1UB 3MEDA 4KKOA 2XWYA 1C0UA 4KBIA 3NBPB 3EPIA 2VG7B 4PWDA 1MU2B 2JLEA 3N6MA 5DG8A 2XC9A 3I0SA 4O4GB 5HLFB 3JSMA 3FDSA 4NRTA 5KFHA 3GQCA 3EPGA 2FLLA 2J6SA 4QPXA 5HROB 3PW4A 2I5JA 1S1TB 4NLOA 2EC0A 2QV6A 4MFBA 1ZTWA 4WYLA 3I0RB 2YKNA 3V6DA 3QLHA 1FKOB 4NLWA 2UVVA 2I1RA 4G1QA 5CYMB 2OPSA 4I2PB 3DRPB 4XPCA 3KK1B 4EBEA 4ECUA 4ED0A 4ZP9A 3V6JA 1RYRA 4I2QA 3DLGB 3DOLB 5J1EB 4Q44A 4QWAA 4LQ9A 4LSNA 2UUWA 5DQIA 2B6AB 3LP2A 4MK9A 3OSNA 4J9KA 5KFVA 1C1BB 1S9GB 3LAKA 5FDLA 3GILA 3H4DA 3M9NB 4Q8FA 3FQKA 2C2RA 1RTJA 5KG1A 4ZMMA 4K4ZA 1R0AA 4RW6B 1S1VA 3V6KA 2E9ZA 4NZ0A 3PW2A 5I3UA 5KFUA 4FBTA 3KHRA 3DOKA 1REVA 3RB3A 4JV2A 3KLEB 4NLPA 4EYHB 1KLMB 1EP4B 4WFZA 1JLQB 3E51A 4EO8A 4YQWA 1RTDB 2RF2B 1T94A 4K4VA 3PW7A 1TV6B 2JEIA 4ZPDA 1QE1A 4PQUB 4WFYA 1RT2B 3DLEA 4KHMA 5C5JA 4WXWA 2ZD1A 4ED2A 4ECTA 4B3OB 4MIBA 2AQ4A 4O3OA 4I7FA 1LW2A 2YNHB 4DG1B 1JLCA 1C2PA 2IMWP 4ID5A 3PW0A 3GIKA 3JYTA 3I5CA 1JLBA 1TQLA 1UWBA 4URQU 5KFMA 3IS9B 2XGPA 3M9OB 4G3IA 2HNZA 1RT6A 1RYSA 3DMJB 3MR5A 1LWEB 1UWBB 5D3GB 3SFGA 1JLBB 5KFKA 1T05B 2GC8A 4TXSA 4RNNA 1RTHA 2V4QA 3IN5A 4H4MA 4QWCA 3KLVA 5KG5A 5KG2A 1RAJA 2AX0A 5DLFA 3RAXA 1RT5A 2IA6A 2HWHA 4RUCA 4RNFA 3TVKA 1HQUB 4RW7B 4RNHA 1SH2A 3CDUA 2FLNA 3RAQA 2UVUA 4WE1A 3D5MA 3NKYA 4IRDA 3BSNA 5KFRA 4OL8A 3IG1A 2JC1A 3HHKA 4NLRA 4ECWA 1S6QA 2D3ZA 2YNFA 4ECYA 5DQHA 5KG4A 4IG0A 5DG9A 3OSPA 2J6TA 3HVTB 3CDEA 4K4XA 2IBKA 4ZP7A 1W25A 4O3RA 4X2BA 1SH0A 1TKXA 2FJWA 3GIMA 1IKVB 1FKPA 4WZQA 2C28A 3CJ4A 1YVFA 4K4UA 1TKXB 5C25A 1RT4B 1EETA 4I7FB 4NRUA 1RA7A 4ZVFA 4B3OA 3QO9B 1RTIA 5J2NB 2FVPA 2XI3A 5KG7A 5F9NA 2YNFB 2YNGA 3G86A 1HNVB 2WRMA 2ASJA 4QW9A 2ILZA 1Z4UA 4PUOB 3BSCA 3V6DB 2HNDA 2YKNB 1SH3A 1HNIA 3TQ1A 4J9SA 1TKZB 4NLGA 1SV5A 3Q8QB 2GIRA 1ZTTA 4NYZA 1K1SA 2R2UA 2C2EA 4RUAA 3RB6A 2JEJA 1N6QB 1JLFB 3QIPB 3NGDA 1CSJA 3KMSA 4NLTA 4ED3A 1S97A 2HAIA 4TYAA 2E9RX 4KKOB 5DLGA 1JLGB 5D3GA 3KK3B 4DL7A 3FQLA 3ICLA 5KFPA 3DRRB 4F4ZA 2WONA 4ZPBA 4YR3A 2AGPA 2XCPA 2V4RA 3BQ2A 5J2QB 3MEEB 3DLGA 3DOLA 3CDWA 4KHRA 2R8IA 3I5BA 4K4YA 4QWEA 2WONB 4NCGB 4ECRA 4ED1A 4IH5A 5JXSA 3FRZA 1DLOB 3QLHB 3ITHB 1DTQA 4Q0BB 3QZ8A 2ZD1B 5J2MB 2GIQA 4U7CA 4IOBA 1D0EA 4J9MA 2I5JB 5HROA 2OPQB 2JEGA 2VG6A 4KO0B 5KT3A 3OL8A 1JLAA 1S1XA 3KLGB 3IGVA 4FS1A 3V6HA 3KLEA 1C1CB 1TKZA 5F8GA 3ISND 2OPPA 5KFYA 1BQMA 1XR7A 2CKWA 5F8IA 2R8HA 4RW8B 4KFBB 4J9QA 4ICLB 4ECZA 1S0NA 4PUOA 1S1WA 3MR2A 3RB0A 1R0AB 1HNVA 1VRUB 3H4BA 4F4YA 3DLKA 4QWBA 5KG3A 2C2DA 3PZPA 2WCXA 3KLFB 2IAJA 2IC3B 3LP0B 3BQ1A 1EETB 3QGGA 2HMIB 1TVRA 1JKHB 3IRXB 1S0MA 1LW0B 3LP0A 2IC3A 5CYQB 3LALA 3DRPA 1IM4A 2OPSB 2OPRA 5DGAA 4J9PA 4JUZA 1C0TB 3H5SA 2W9BA 4DL3A 4EYIB 1S1WB 1NHVA 4EEYA 5KT7A 4RW8A 3HVWA 4MFBB 4WYWA 4HYKA 2R8KA 4IG3A 1HYSB 5EWEA 4ECVA 4J9RA 3PR5B 1JLAB 1IKWB 1S1XB 3FFIA 3KLGA 1S4FA 1N48A 2D3UA 2QE5A 3FSIA 1MU2A 4WE1B 5KFFA 3GV7B 3DRSA 5K14A 5L9XA 1S10A 5I42B 4J9NA 4DEZA 3MEDB 2AGQA 1RT5B 3ITHA 3DYAA 3V4IB 2XCAA 2E9TA 3Q8SB 3T5LA 1SUQB 3BGRA 2IM3A 5DQGA 4NCGA 1RT1B 4XPEA 4IH6A 5KG6A 1T05A 3QGHA 5C42A 3RBDA 3MF5A 1JLGA 5KFTA 3CJ5A 3JYTB 2IJFA 1RT1A 4YMEA 4Q45A 4RU9A 4R5PA 2FJXA 1MMLA 2R2SA 1QAIA 4H54A 4GC7A 4IR1A 3MFIA 2D7SA 4K50A 2WK4A 3G6XA 3UPFA 1I6JA 3MR6A 4NLVA 3TAMB 3M8PA 5KFCA 4Y2CA 2W7OA 3BQ0A 2BQRA 2W8KA 1RTDA 4Q8EA 2IM0A 4NLYA 3BJYA 1IKWA 3FFIB 2DPIA 1JLQA 3GIJA 1KLMA 3TAMA 2R8JA 3OHBA 3T5JA 1TL3B 4ZHRB 4NLSA 3Q8PB 3HVAA 2YNGB 3QIDA 1JXLA 1NHUA 5J2NA 3MTKA 4ECXA 5I3UB 1N5YA 4QW8A 4IDKB 4RW4B 4Q43A 5F8LA 3KK2B 1S1VB 4NLDA 3UR0A 3LAMA 3KMQA 1S6PA 2V0NA 5C25B 4IFVB 5KT5A 5CYQA 3E01B 2RDIA 2ZKUA 1DTTB 3H98A 4IFVA 4O3PA 3CWJA 1LWCA 5C42B 4I2QB 1JLEB 2IAJB 1LWFA 4MKAA 5HBMB 5T14A 5C24B 2BRLA 4TY8A 5KFGA 1T3NA 3KNAA 4RNOA 1TL3A 3PR4A 4O3SA 1JX4A 1FKOA 4R0EA 1J5OA 3RBEA 3I0RA 2VA3A 2IJNA 4K4WA 4ECSA 3M8PB 1GX6A 3DRSB 4IKAA 5EUHA 3RB4A 3QZ7A 4YR2A 5HLFA 4ZPAA 1S9EB 4O3QA 5KFDA 1HQEB 3PJXA 4IG3B 1XR5A 3KHLA 2ALZA 2AU0A 4M95A 5J2MA 4TQSA 1N56A 4Q0BA 4MIAA 4IRKA 2VG5B 3H5YA 2BANB 4WZMA 1N4LA 2W9BB 2R2TA 2B43A 1S49A 1IKYB 3DM2B 3IS9A 3KHGA 3ISNC 2ILYA 2HWIA 3CVKA 1RT7B 1LW0A 3T5HA 5KFQA 2WTFA 2HMIA 4J9LA 4ID5B 2IM2A 2R2RA 3I5AA 1LW2B 3T19A 3C6TB 3KK3A 4J9OA 1IKXB 4TLRA 4R8UB 3PJWA 3DLKB 5F8HA 3PVXA 2ZE2A 3GYNA 1TKTA 4TYBA 4KFBA 3BSAA 3MEGB 2OPPB 1HPZA 1EP4A 5JUMA 1SV5B 1REVB 3DI6A 4U6PA 3GV8B 1RDRA 4IQXA 4WXOA 2BE2B 2AX1A 4KO0A 3DDKA 3QGIA 2VG6B 5DGBA 3NMAA 3H5XA 4RW6A 1C0TA 2D41A 5KFBA 3OLAA 3CJ2A 2W9AA 1DLOA 4WFXA 4IFYB 4KSEB 1RT4A 1TVRB 1C1BA 1S9GA 2WOMB 4RW9A 2WHOA 5HP1B 5KG0A 3GV5B 4F50A 2RDJA 1S9FA 1RT7A 4IFYA 2C22A 4YP3A 3MEEA 3KLFA 4Y34A 4NLUA 3KK1A 3SI8A 4I2PA 3MR3A 1WNEA 2YKMB 2J6UA 5KFXA 2RKIB 4H4OB 4LSLB 4F4XA 2BANA 3LP1B 2VG5A 4IH7A 4ICLA 2BE2A 4XO0A 1HARA 3N6NA 1S6QB 2BQ3A 1K1QA 2B5JB 2HNYA 1S9EA 1HPZB 2BQUA 1JLFA 3MEGA 3QIPA 2IM1A 4URGA 2B5JA 4KAIA 3KLHB 4HKQA 4ZVGA 4M94A 1VRTA 1HNIB 3HKWA 4YR0A 1DTQB 2HNDB 4RNMA 2ATLA 3KLIB 3MFHA 4H4MB 5KFNA 2RKIA 4H4OA 4LSLA 2YKMA 5C24A 2XI2A 4KE5A 3V81A 1KHWA 5KFWA 4MK7A 3QO9A 3OL6A 1LWFB 1S0OA 4FBUA 2W9CA 5J2QA 3OL9A 1LWEA 2W8LA 3DMJA 1RT3A 5L1LA 1RT6B 5KT4A 2WOMA 2BR0A 2AWZA 3IGNA 3H5UA 1QUVA 5KT6A 3E01A 1JIHA 5F8MA 3CO9A 1HMVA 1IKVA 1FKPB 3BR9A 3VQSA 3EZUA 1JLCB 5L1KA 5KT2A 1HQEA 1TL1A 4TN2A 4ED7A 5KFZA 5L1IA 4IDKA 4RW4A 3H40A 3MECA 4IG0B 1N6QA 3PHEA 3PW5A 3NL0A 2YNIA 1RT2A 3DLEB 3DI6B 1QE1B 4ZHRA 4DL5A 4O44B 2FLPA 5J2PA 3IG1B 4MK8A 3SFUA 4ED6A 2BRKA 5J2PB 4FS2A 4O44A 1XR6A 1GX5A 1U09A 3LANA 4TY8B 1HQUA 4RW7A 1TP7A 2AGOA 1RTIB 3OLBA 5HBMA 1T03A 2JEFA 2FVRA 1TL1B 1FK9A 5DG7A 2R8GA 2VA2A 1LWCB 3KOAA 1DTTA 1QAJA 1RTHB 2FJVA 3T5KA 2V9WA 4IR9A 4JV1A 2DPJA 1BQNB 5KFJA 3KJVA 3DM2A 5FDLB 1IKYA 3M9MB 1S6PB 2FVQA 4ECQA 2OH2A 3KK2A 3HVTA 4LQ3A 5F9LA 3V81B 4EBDA 2UVRA 3Q8RB 4G1QB 5CYMA 5KFLA 4O3NA 2ASDA 3NAIA 3CJ3A 3NAHA 3T1AA 1VRTB 3OL7A 3G6YA 3KLHA 1TV6A 2JC0A 3H2LA 3BSOA 4DL2A 4MH8A 4ZP6A 2RF2A 5KFAA 4MKBA 3JSMB 5EWFA 3I0SB 4O4GA 1J5OB 2HNYB 4ZVHA 2VG7A 4PWDB 1HYSA 5F8NA 3KHHA 4R5PB 3CJ0A 3UQSA 4EO6A 2ASLA 5KFEA 1S1UA 2XGQA 1JLEA 3LP1A 5KFIA 4KB7A 2OPRB 2HNZB 4GC6A 3KJVB 1RTJB 4ZP8A 1BQNA 4EBCA 4NLXA 1JKHA 3IRXA 5HP1A 4RW9B 1SUQA 3BGRB 1RA6A 4JV0A 3GIIA 4DL6A 2YNHA 4DG1A 1FK9B 5J1EA 3QYYA 3H59A 1T03B 1N5YB 3M8QA 1S48A 5KFSA 4ZPCA 5I42A 1VRUA 1D1UA 4PQUA 4ED8A 5K14B 4QWDA 5EDWA 4IRCA 3C6UB 5F8JA 5L1JA 4F4WA 2WB4A 1BQMB 3OHAA 4RZRA 1S1TA 1C1CA 5EWGA 2YNIB 3DOKB 4NLQA 1NNDA 3MECB 1TKTB 2O5DA 3C6UA 4ZVEA 4K4TA 2ZE2B 2OPQA 3NBPA 4DL4A 4URSA 1C0UB 2FVCA 4Y2AA 3M8QB 4TY9A 1HMVB 1IKXA 4R8UA 2F8EX 3CIZA 3D28A 3C6TA 1OS5A 4K4SA 2UUTA 4KV8A 5KFOA 2B6AA 1RT3B 3LP2B 4LSNB 4Y3CA 3UDLA 3BREA 2CJQA 4TQRA 2W9CB 2FVSA 2UVWA 3N6LA 3DRRA 4KV8B
chains in the Genus database with same CATH superfamily
3WC2A 1KHVA 3KLIA 4ZIWA 5FLXY 3G6VA 1ZETA 1FJ7A 1VK3A 3SV4A 3I6PA 3MEDA 4A8XA 2RRAA 1C0UA 2C3PA 1QAYA 3AXKA 3PG9A 1IBMJ 3ETOA 1MU2B 3OFGA 1RKJA 1IR2A 1R8HA 2GAGC 4LF5F 1BGXT 2FLLA 2VBZA 2DGWA 1X5TA 2Y0SD 3IRWP 1SL0A 2D1CA 4QR1A 5CCLA 4A8KA 2H48B 3M30A 2E5LJ 2WBMA 2XLIA 1R31A 2Z4PA 5KAKA 1ZTWA 3HHLB 2BVZA 3I0RB 3BKFA 3DFEA 4LVNP 3Q2SC 1N34J 4DV7J 3MM8B 1FJGF 1GAOA 1RCXB 5K5MA 4ZCIA 1RLCL 2I1RA 5CYMB 1Q1KA 4MTPA 1Q78A 3DXSX 3DRPB 3C19A 3TX8A 1KONA 4EBEA 1RYRA 3ISZA 2DGSA 1HI1A 1V3ZA 2AIRB 2XHCA 5DQIA 2V4RA 3R2DJ 2B6AB 4B17A 2ZHAA 2P2CB 3OSNA 4J9KA 1JNZB 2MDAA 2RJZA 2N7CA 3X3UA 4UY8T 1RADB 2CVIA 3A1YG 3AOAA 5KG1A 2HFUA 4DLGA 3O3LA 3VCDA 4ZN1A 4ZMMA 3PO4A 4RBUA 1S57A 4K4ZA 1M5PC 2POKA 3DHXA 2HHVA 2E9ZA 4NZ0A 5I3UA 1FWPA 2PE8A 4WBFA 4ZS6A 5HK4A 4FPRA 4U95A 4LBPA 1VYAA 1LKZA 3G82A 3RB3A 4QIVA 1CJKB 1KLMB 1EP4B 2M88A 1JLQB 1CJVB 4OYOA 4S0MA 4WFZA 4EMDA 4EZ9A 2MZJA 2MLXA 1NDKA 1YBTA 2HG4A 2AYBA 2JEIA 1QE1A 4QOTA 2QMUB 2CQGA 2M8HA 4ECTA 4WZMA 2V63A 3MM5B 4I7FA 2A2DA 1FD8A 2F40A 2MZTA 1AZSB 4NPOA 1S12A 4USKA 4DLEA 2AJFE 2OEKA 1SKSA 3MMAB 3GIKA 3JYTA 5HI7A 1NB2A 1XWLA 3I5CA 3IR6B 3PEHA 1XIQA 1FE0A 1KVIA 1UFLA 3VGSA 2X3DA 3IS9B 3M9OB 4BWMA 1U1PA 1RT6A 1YQHA 3CE8A 2DGTA 1YHQS 1UWBB 3ZXWA 1T05B 4K59A 4TXSA 4CLUA 1RTHA 1TL7A 2LQ5A 5JVHQ 1OJ4A 3SCJE 4QWCA 5LL6d 2NXUA 5AJ3J 5KG5A 5KG2A 2AX0A 5DLFA 1FHTA 3JAMY 4RUCA 1WHYA 2CQ2A 3PYDA 4RNFA 2BKPA 3CDUA 2FLNA 2ZM6J 3RAQA 2UVUA 4DF4A 1S59A 4CQ1A 7FD1A 1HNXF 1FT8A 4HR2A 3LTOA 3IG1A 3K89A 4BC7A 4M5HA 4NLRA 1U0HB 2A0FB 3TUIC 2F65A 3R5AA 2VDIA 2NYIA 5DQHA 1FWKA 3CCLS 4FKYA 5DG9A 3OSPA 4NMXA 1NJWA 4PQAA 4HVZA 2IBKA 4O3RA 3IWLA 2MQNA 4NWBA 1N88A 2IRXA 1TKXA 1FKPA 4WZQA 3CJ4A 4OLPA 2KXFA 2ZC3A 1FFWB 2ROGA 5ADZA 1T95A 1PKUA 1A9NB 3MZIA 1P27B 4A46A 4ZVFA 4NRUA 3TJAA 2H5IB 3LOUA 1QUPA 3BBBA 1WG4A 2NXCA 4JV5F 1OSCA 1KQFB 4X4PA 2ASJA 1RK8A 1DURA 2ILZA 8RUCA 4DV6F 1LK5A 1J5EJ 1JJCB 2UXCF 1SH3A 8AT1B 2DHHA 1HNIA 4HDGA 3HSGA 5LSRA 3CCZA 4NLGA 3IBFB 1V5VA 2CVEA 3OXFA 1KBRA 4OHVA 3NGKA 4W98A 3IWXA 1JLFB 2JNJA 3NGDA 2ZOMA 4WU2A 2GVDB 3M1VA 4ED3A 2HAIA 4TYAA 3HP6A 1MNEA 3KFWX 3W5YA 1HNXJ 1Q8LA 3MMJA 5M2RA 4YB6A 1JLGB 4Q7AA 5D3GA 3Q8VA 4DL7A 3FQLA 5G4DA 3MGJA 1G6BA 4ZPBA 2GHWA 1NDPA 4C8MA 4B9VA 1FD2A 4XAKA 1FRHA 3R8YA 3MD3A 4ECRA 4ED1A 2HS4A 2M8DB 4IH5A 3CJKB 4LSZB 1N32J 1BQXA 1FRXA 1YDLA 1DTQA 2YWEA 3GSDA 3QZ8A 3RRGA 2QX0A 4CRJA 1FA0A 2OTJS 4IOBA 1D0EA 2C2KB 5GAGU 1IUJA 3M1VB 4J9MA 4L75A 3FUYA 3SDEA 4JI5J 3O2IA 4B9SA 3C14B 4P9SA 1S1XA 1H2VZ 5K8MA 5E41A 3UCZP 2AW0A 2FD2A 4PXCA 5F8GA 3ISND 1S6OA 4KPCA 1BQMA 2OHDA 2KT5A 3TA0A 3P5TL 4RW8B 5A8WA 3F73A 2DNKA 4J9QA 4DSFA 4ECZA 4ELUA 3MR2A 3PIPQ 3FGVA 2D69A 2VFTA 2DTJA 4QWBA 2DNGA 4OZ5A 2ZUAA 1T9WA 3DDIA 1S7IA 2KG0A 1FTCA 2NUHA 1RWXB 2KB2A 2V50A 3IBWA 4QR0A 3QSYB 3QGGA 3RTVA 4JI8F 1Q81T 1RAEB 2VF3A 1N52B 3CNQP 2QLJB 5CYQB 3GYGA 4X4QA 2LU1A 3LALA 1QD1A 4X66F 1KFSA 1HWKA 1X4CA 4FZVA 3R5GA 2Y3YA 1S77D 3CD7A 4PYDA 2VKRA 3BB5A 5IOLA 4DPXA 4O23A 5KT7A 4RW8A 1FVQA 3HVWA 2XZWA 3UNGC 2KFNA 3SCKE 3S01A 3MEKA 1E6VA 5EWEA 3EDQB 3PR5B 1S1XB 1S4FA 1N48A 2ZVSA 4G1IA 5B0AA 5KOWA 2DYAA 2B3TB 4FNHA 1U1NA 4NI2B 3RW6A 3VALA 4CCHA 5K14A 2EKNA 2AYMA 3RGIA 2MKYA 4PCQA 2D3OR 1U8SA 2HAFA 4CDIA 4WTYA 1YJWS 2MQQA 2MSSA 2KG1A 5DQGA 3B8HA 4CM0A 1RT1B 4R0JA 1T05A 1ZPWX 1Y0HA 2IBOA 1VQ5S 3VAJA 3TANA 1UW4A 3D3CJ 2Q6BA 1MROB 3MF5A 4K7QA 3SSRA 1T8EA 2DEJA 1JLGA 3R7BB 3CJ5A 3JYTB 2IJFA 3R27A 4YMEA 1Q8BA 4JI8J 1U24A 2VDHA 3LUYA 3ZNUA 3NEKA 2NSBA 3BS9A 4UTGA 1FE4A 1MMLA 4USUA 3NCQA 4DV4J 3Q23A 3PY8A 1VQYA 3OJUA 4MIWA 3MFIA 2OFHX 4C8OA 2WK4A 4QYZJ 2RB7A 3UPFA 5BR8F 1SIZA 2C3MA 3MR6A 4NLVA 1B7YB 3A3NB 3M8PA 3ZZTA 2VQFJ 3K0JA 2IM0A 1ZAVA 4HH1A 1JLQA 1CJVA 1EZZB 1KLMA 2BA9A 5IQQA 3GB0A 3OHBA 2R8JA 3Q8PB 3OXGA 2ZH8A 2EG1A 3FC9A 4ES1A 1JXLA 2V4JA 3JQMA 3NS5A 4I6YA 3ULHA 5I3UB 4QW8A 5M2PA 4ECXA 1IJFB 3KMQA 3UR0A 2F8MA 1FERA 1K0VA 1X4DA 4FP9A 3L7OA 4P75A 3QPIA 3E01B 2RDIA 2N82B 1SJ3P 2ZKUA 2WVDA 2DR8A 4IFVA 3V4MA 2A1BA 3CWJA 1LWCA 1FXLA 2RIJA 2P9CA 2Y0BB 2EFQA 4ENOA 2IAJB 2G0JA 1EAYC 2OO4A 4ZCKA 5T14A 3UN5A 5D6GA 2BOAA 3MAAB 3KJQB 5C24B 4TY8A 3VZHA 3RRHA 3Q24A 2F4VJ 5KFGA 2GMLA 1TL3A 3PR4A 4A8FA 4B3RJ 2D9OA 3BO2A 2WSCC 3OJSA 9ATCB 3I0RA 4ED5A 2VA3A 3HHLA 4K4WA 4P74A 4LIRA 1WHWA 4FYVB 1GX6A 4IKAA 4DR6F 1T9YA 4DR3J 1PILA 1TMMA 3NLCA 3QZ7A 2VD3A 2GO9A 4ILRA 4C8ZA 4YR2A 1WC0A 3D0IE 4WWSA 2GW8A 1IXKA 5DRKA 4DQSA 1WDDA 2GV1A 2XS2A 2BKOA 3IXQA 3FZ2A 2HWTA 4ILMA 4TQSA 3NCRA 2DH9A 3BZQA 4IRKA 3OQ2A 4DPYA 4F2SA 3T3FA 4DSIA 4OX9F 3PIOQ 2G2ZA 2W9BB 3BM7A 3LGNA 2B43A 1HIYA 8ATCB 1IKYB 4HI1A 3DM2B 3IS9A 3KHGA 1Q5VA 4KQZA 4C11A 2FHJD 1M5OC 2KVQE 1RT7B 1LW0A 2KKHA 2DNRA 2ERRA 2ZH7A 2Z8QA 4Y2IA 2KH9A 2R7UA 5ETTA 1LXNA 1IKXB 2MKIA 2J8AA 2FHMA 3PFOA 4F0KA 2XY7A 5HN0A 5DM7Q 4YUDA 3DLKB 2DGQA 3J81j 3NNCA 3CJTA 1NK0A 3TEHB 3THPA 3M4XA 5IFMA 2E7WA 4JI7F 3QJLA 2EEYA 2GJIA 3OW2R 3HSZA 3MEGB 3SCLE 1CC7A 1JK9B 1EP4A 2UXDF 3MPDA 2WAQD 5JUMA 4FF4A 4I56A 2ZUGA 3G82B 2FPHX 3SXLA 1RDRA 2HHPA 3GV8B 3TEGA 2FB0A 2OSQA 4TNOA 4KO0A 3DDKA 3JSYA 2ADBA 3IC1A 2J7KA 3CT9A 5D8HB 2ZWOA 3CCSS 1PAUB 1K0TA 1ZZNA 4EWTA 3CJ2A 1SL1A 2I9SA 4N47A 3NP5A 3PEJA 4EZ6A 3JAMU 2YH1A 1TVRB 5I3PA 2CPIA 4ECVA 1P9YA 4F50A 1H74A 1ZAXA 2FQQB 1N5QA 5CXTA 1N33J 3C15A 4NZ7A 4NLUA 3A4TA 5EHHA 1WNEA 2YKMB 3TNVA 2J6UA 3S6EA 2CQ3A 4B9UA 2BANA 2OI2A 2VG5A 1Z2LA 3I32A 1VBKA 2KHDA 2MHNA 4OYBA 4XO0A 2C2NA 3BO4A 2BQ3A 1PC4A 2M3DA 2EPIA 2X3GA 2V2VA 2XB2D 3MEGA 3GWCA 2DBBA 2DR6A 3AB4B 5DJBA 4AXIA 2XMTA 2YX1A 2ZDOA 4HKQA 4ZVGA 2V2QA 1VRTA 4J9UE 2XNQA 4HL9A 4JI7J 5HQ8A 3BGFA 3BGUA 3HKWA 1TELA 2VQEF 2LVWA 1CQMA 4CO4A 2R9LA 3KLIB 3WX4A 4X4SA 3MFHA 2RKIA 2CA9A 1B70B 4KE5A 4LRCA 2ZBCA 2AZ3A 1S0OA 2B7CB 1LWFB 2Z2MA 3RG6A 3EVMA 3NGRA 5H9FJ 5J2QA 4ES3A 2Q43A 3FEZA 2W9CA 2W8LA 1FJGJ 3TZWA 5HVFA 2P9GA 5KT4A 3DOMB 2WOMA 2M5YA 2ZOFA 4F36A 2P8IA 4DJBA 3H5UA 2KT2A 4DL0C 3ILJA 1M5KC 2YQ3A 3HD1A 3AQPA 2DNLA 1VLYA 2DNPA 2GGPB 5CZXA 1MMDA 2O01C 4HHJA 3W66A 4TN2A 5GAEI 3AODA 5KFZA 5IV3A 4RW4A 1QTNB 2JOQA 2B0GA 3HFZB 4W4MA 1SKUB 1N6QA 3CSKA 1M0SA 3CC7S 1VJQA 3R5CA 3E8OA 4OI6A 3HD2A 3HFKA 5CD4H 1KLNA 2I0XA 4CP5A 2C2MB 4FXDA 4ZLNA 1S72S 1UPMB 2HHQA 4O44A 3MMCA 1YBAA 2CPEA 3LANA 4FXWA 4TY8B 1HQUA 5B0GA 5B0CA 4TU8A 3W2VB 1GMUA 4M1KA 2VODA 2YXLA 2CDQA 3VAMA 5F0WA 3UDEA 2HFOA 3QT6A 1XMQJ 1LWCB 2UV8G 3DN9A 5D0HA 3MCOA 4IR9A 4JV1A 3J81U 4UF4A 2DPJA 2IRYA 4NXNJ 3IBCB 3G96A 2ZH2A 2VJUA 4J90A 2CQ4A 2EVZA 3BGOP 2UUAJ 2BUNA 1VIXA 4I68A 1IR0A 4JB8B 1NKBA 3C46A 1ICEB 1EARA 1PYOB 2PDAA 1WTFA 1UJ5A 3AAWB 3CJ3A 4CO5A 2EK1A 3LA0A 6FD1A 3G6YA 3KLHA 4NCAA 1OIAA 2W2QP 3H2LA 3BSOA 2LEBA 4OV6A 4MH8A 3DXBA 3QMQA 1WD6A 3JSMB 5KFAA 3BDPA 3WIUA 1J5OB 4P10A 1N54B 2HNYB 2VG7A 2AP6A 4N8NA 3CJ0A 4M5MA 1H6KX 4LR9A 2RT3A 3PNIA 5DO2A 4DR2J 2XGQA 2K1RB 2ZWPA 4LRDA 3JB9k 3T1YF 5D4NA 3GSIA 4TU9A 3M7VA 4QU7A 5E3RA 1U8WA 1RHKB 1TUWA 3AY0A 3K5OA 3RJMB 4LF6J 3Q0AA 3KKFA 4A47A 4DR7F 3PRBA 3QGPA 4WPAA 4EI2A 3NL0A 1JKHA 4I67A 1YWXA 3CW2C 1HQ2A 2BJ1A 2VV5A 3GIIA 2D3O1 4DL6A 4Q5VA 1UVLA 1UEUA 2YNHA 1VQPS 2HGLA 2K7KA 3WIVA 1N5YB 1OYDA 3TWZA 2HVHA 2DGOA 1V5IB 1NCLA 2HQGA 4H4KC 4WIIA 1D1UA 4PQUA 4ED8A 5K14B 4YHHJ 4NCBA 1Q5YA 2DNOA 4X4OA 5JVGQ 2YWFA 4RWXA 4CO0A 1K73T 1VCTA 1FNOA 5ETPA 3WDOA 2OD4A 1C1CA 3BKUA 3S8SA 1IJEB 2LQ8A 2VKZG 2MQPA 3D4JA 2XY6A 4OYAA 1PYSB 4K4TA 3C6UA 4X65F 3GJTB 5CHCB 1VBYA 3TP2A 3CCES 4B02A 3NBPA 2VZ9A 4K2XA 2CQBA 1NJXA 2JVOA 1KN6A 4F67A 3LPYA 4NEZA 5C2GA 1TL4A 3EZOA 3SMZA 2F8EX 3D28A 3CJ8A 3RRKA 2GFFA 2W24A 3EGWB 2KN4A 4IOCQ 3MAHA 2KM8B 5KFOA 3LP2B 1X5OA 4LSNB 1LXJA 1KP6A 1G3OA 3ENAA 3PDNA 3Q83A 4USHA 2MJNA 3W60A 5LJ5Y 5GAHU 3E2EA 5ETQA 4CZCA 3K5NA 4GKKJ 1U2FA 1Y9OA 4OZ2A 2X1GA 1SBRA 2ZH1A 2QFJA 4AQYJ 1IQTA 2ZBQA 3T9ZA 1NKCA 4A4JA 2PI4A 1BHNA 2K3KA 1BUXA 3DYAB 3VGUA 3T1HJ 2J9EA 2Y8WA 4DR7J 1S1UB 2M9KA 2B9EA 1NAQA 2XWYA 1X0PA 2W01A 5A8WB 9RUBA 1WEYA 3AQOA 3M6VA 3CCQS 3N6MA 2EFOA 3D67A 4DMZA 3UD4P 1VC5A 5HLFB 5KFHA 4C3LA 3GQCA 4NXNF 3H5XA 2MPUA 3SDEB 4WP8A 4QPXA 4NYPA 2CPFA 2CPJA 1KC8T 2NXNA 5E5NA 1S1TB 4UUWA 2RUSA 1YI2S 1Y4ZB 4WYLA 3AD8C 1NXIA 1NH8A 1GQEA 2QMXA 3PYGA 5ETMA 4MMOA 4DX6A 2HYIB 2HQDA 4NLWA 4DQRA 4U7UK 3U1NA 2NZ4A 1P9QC 1MSWD 2OD6A 2Z56B 3KK1B 2MLZA 4ED0A 5H9EJ 2XSJA 2LDIA 4Q44A 5J1EB 1UWAA 5IZHA 4LQ9A 4QWAA 2PA8D 2FUG9 3Q8YA 1SL2A 1C1BB 1S9GB 5FDLA 2JRSA 1FFGB 3GILA 3M9NB 3H4DA 2E66A 2H4YB 2QZ8A 4DSKA 1X4BA 1RTJA 2YPYA 3ENVA 2VU5A 1WI6A 1HL6A 1F5AA 2HK3A 1EJ7L 2Y1RI 3WZ0A 2G2YA 4RW6B 1OY9A 3NCPA 5A8KB 5B08A 4DR3F 2AYGA 1DFDA 1TFYA 4H4KA 2DR7A 4FBTA 2DNHA 3DOKA 3FSYA 4FYWB 3PO5A 2L9NA 4QBUA 4HHHA 4EYHB 1WTBA 1TK0A 4LFBF 2C3OA 3GYXB 3W61A 2LMIA 3EXCX 4EO8A 1RTDB 2RF2B 3UD3P 2MB0B 1N0UA 1U6ZA 1NPKA 3UN3A 3PW7A 2KFYA 1TV6B 4LFCF 4ZPDA 4JI4J 1WSRA 4ES2A 4KHMA 4X4TA 4WXWA 2ZD1A 4DXLA 2CJ9A 2RHSB 4P2SA 4MKVA 2W2NP 4DG1B 4YS2A 1SC1B 3PW0A 2IMWP 2WW8A 2DNNA 2H51B 4I69A 1IWGA 2MQMA 1HR0F 1X60A 2B51A 4WK3A 2HNZA 2GQ2A 2CG4A 1RYSA 1WJ9A 3GONA 3P49B 1X31C 1WEXA 1HBUA 4ZVPB 3SFGA 1VQLS 5LM7E 4DFJA 2V4QA 2HBZB 3W9HA 3MAQA 1TAQA 1TK5A 2HHSA 4RNHA 2ZBPA 1SH2A 3FBBA 1HBOA 4WE1A 2YY3A 3D5MA 2VFRA 3NKYA 4KRWA 3ENQA 3BSNA 4QYZK 2EXUA 5E3CA 3M8ZA 4B3TJ 2YKOA 2CYYA 2FTRA 5DETA 1S6QA 3W7BA 4ECYA 1S99A 2RQMA 3FBEA 2AJ4A 2DIVA 4P72A 1TL7B 2UUCJ 3MPYA 4OQJA 1NRKA 2HFVA 4ZP7A 1W25A 2G9OA 4F04B 1XBWA 1ZA1B 4DPWA 3H7HB 1UMJA 2FJWA 3UNYA 2XEXA 1IKVB 4BWJA 2ALYB 4QIFA 1H38A 1DZ5A 1T02A 2V2KA 5H9EK 2R7SA 1JJ4A 4K4UA 3HSDA 4CO2A 1X7VA 4DV2J 1RT4B 2PD1A 2YKQA 4QU6A 2UXCJ 4I7FB 1AB8A 2CQIA 2IY5B 2XSJB 3O5TB 5J2NB 2FVPA 4HEA9 3G86A 1FJCA 3BSCA 2HLUA 5DDOC 5B0FA 3ZZUA 4W90B 1LNQA 5CAAA 3D6TB 7FDRA 2CNNB 3N5FA 1XC9A 2LU2A 3B6BA 2F4VF 4UOCA 2GIRA 1ZTTA 2DEIA 3GR0A 3I9ZA 3MWBA 2DB1A 1K1SA 2C2EA 2XMMA 2QGFB 3AB2B 1CVJA 3QIPB 3L3CA 1F9HA 5MLCV 3LGMA 3OFHA 1DJ0A 3D6FB 4RU2A 4WFBQ 2VJVA 2BE7D 2VASA 3HHLD 3I4PA 4DV3F 3LWMA 1URNA 1EHWA 3P4UB 3MXHP 5D4LA 1G1XA 2AKWB 3S7RA 1F0XA 5DLGA 3CPWR 2LP4A 4DCJB 4B3TF 3CGIA 2V8DA 4WU3A 4ERDA 5KFPA 1SJ4P 4YR3A 2MY8A 4PAAA 3BQ2A 1SC3B 3CDWA 5CH7B 2R8IA 2LQJA 1WF0A 5FIIA 4AUKA 4OX9J 2WONB 4NCGB 4F25A 4DUZF 2BZ2A 2C3UA 2ROEA 2ZBRA 4YEAA 4N5SA 1X0FA 5J1NA 3BN7A 2EFNA 4Q0BB 2BJ9A 1D9DA 3LPEA 2ZD1B 1BLUA 1VS3A 4ZVOB 2GIQA 5DM6Q 1J27A 1RSCA 1IBLF 2PI5A 4EK2A 2E1MC 2BX6A 2VBYA 3B54A 2VG6A 1W2BR 5KT3A 3OL8A 5F41A 5A8RB 4NX9A 3FVYA 4FS1A 3G6ES 4ZIVA 1VMBA 1C1CB 3R97A 1TKZA 2R7XA 2OPPA 5KFYA 1XR7A 2CKWA 4LF5J 5AE1A 4N41A 3GJSB 4U67Q 3H90A 1S0NA 4PUOA 4OI3A 3J80U 1HNVA 4F4YA 1PBUA 4FYXB 2C2DA 2V6AA 3MMBA 4OYPA 1SB6A 4RBVA 4I6WA 4CLTA 4DOZA 4C48A 2F4FA 4DFPA 1G7CB 2IRUA 4F0HA 4KH1B 2Y1LB 1L3KA 2GZOA 3KDOA 2N3LA 4TKTA 3UDCA 4CT9A 2HMIB 1XK8A 1JKHB 2RU3A 3LP0A 2IC3A 1RLDA 1H73A 2QO3A 1R27B 2CPHA 1UEKA 2KHCA 2Z2YB 1FEHA 1Y3KA 1KOOA 1XQIA 4JUZA 3M8SA 1IBCB 2AZ1A 3MI7X 1NHVA 5HL7Q 5L39A 2ZJRQ 1NDLA 4EYIB 4EEYA 1U1LA 3GE9A 3TUZC 1FESA 2R8KA 4M5IA 1UVNA 3E3XA 4ED4A 3QSIA 1PJ5A 3QAEA 4CIOA 3FCWA 3MR7A 3M05A 1JLAB 3K59A 2D3UA 2HZAA 2QE5A 2B9WA 2EBEA 3FSIA 2BJDA 5ETOA 2B7BB 3GV7B 3DRSA 2LXFA 1IBLJ 5I42B 2DVIA 4J9NA 3D3BJ 3N01A 1GFWB 2AGQA 4L76A 1NK5A 3ITHA 1DQAA 1CJTB 3DYAA 2OP5A 5K8PA 4UQGA 1X9SA 1HNWJ 1HHSA 5DZ6A 2JVRA 2E9TA 4WF9Q 1YITS 1SUQB 3BGRA 2ZBIA 1HW8A 2QA1A 2BE9B 4XPEA 2MKHA 3FZBA 1YG0A 4W92B 2JSXA 2XBPA 4OYXA 1IQZA 3ZC4A 3M6XA 5C42A 2XYHB 3SEOA 3CC2S 3CUNA 3DU5A 3SQGA 1M90T 2BJ3A 1EQMA 3KUHA 5U47A 1VQNS 5IM0A 4I0WA 4KIAA 3D54A 1HWUA 1JJHA 5KFTA 5BYRA 5CD4A 3VAHA 2QJ3A 2W7AA 2FJDB 5D0RA 4C0HA 1Q8IA 2V9KA 4CLLA 1R0BG 1VBXA 2APOA 1VOMA 4NOHA 4JI3F 2N4CA 2F9DA 2W2MP 2UZAA 3FCVA 4FYDA 4WP9A 2DRBA 1WHVA 5IT9Y 1VK8A 5T41A 3OR2B 2AEFA 2CZVC 4Y2CA 2W8KA 3W2WB 3BQ0A 4NLYA 1YIJS 3T6BA 2DPIA 1GMVA 3GIJA 3TVZA 3TAMA 1JWWA 3NY0A 4FF3A 1APSA 3CJRA 2X1FA 4Z37A 1YJUA 3HDSA 3QFHA 4JI2J 2AJ0A 1HD0A 5A0YB 1N5YA 3W3SA 4RW4B 3K58A 1U1OA 3KK2B 2W25A 4NLDA 1QSSA 3R5DA 3FNNA 2DHAA 2XWXA 2HQ3A 5C25B 3TJ9A 4CNZA 2QIFA 3HT3A 1P8GA 3SQOP 1NSKL 2GCFA 5KT5A 5H9FK 3ZZOA 3B82A 4L3KA 4X64J 3M6WA 1DTTB 2NS1B 4K5SA 3AXMA 3VAKA 3DC2A 2E44A 3TZYA 4I2QB 1LWFA 1KFDA 1U2RA 2XMKA 2E1CA 1X4AA 2V34A 2YVSA 4LR7A 2C3YA 2A2CA 4NZ6A 3F41A 2QFIA 1NJIT 1TKDA 2CFXA 2CPZA 3QJJA 4ALZA 4LFCJ 2CQCA 1J5OA 3DRYA 3MD1A 3IM9A 3RBEA 1W26A 2R4FA 3OR2A 4NL5A 3D1HA 5IT0A 3GFHA 5EUHA 3G71S 3RB4A 4CO3A 5GAHI 1WG1A 4LJMA 4N76A 3PRVA 5A8RA 4ITSA 1J5EF 2HHHJ 2HHWA 3G2XA 5L9NA 2I2YA 1WG5A 4CNYA 4JI1F 1HQEB 3KHLA 4IG3B 5J1PA 2ALZA 3MDFA 2AU0A 4QQBA 3NWRA 4DFMA 1N56A 4Q0BA 4MIAA 2VG5B 5ETSA 2BANB 2YTCA 4BCAA 3H5YA 1G2EA 1RTZA 1QJHA 3UR3C 3ET6A 4DQPA 3UO0A 2R7VA 1RWMB 1AXQA 2C2OB 2PIIA 5BYQA 2PO4A 3SZ2A 3JTPA 3BPDA 2ILYA 1T9VA 2HWIA 3CVKA 4RLEA 5KFQA 4CLYA 2GHVC 4LF1A 3RU0A 4C3MA 4ILLA 3I5AA 2DH8A 2QYGA 3LQVA 4J9OA 4PRFA 3DHWC 3CEDA 4R8UB 4Y0FA 1PO6A 2ASYA 4CLWA 3PHTA 4A8QA 1GXUA 5F8HA 3N79A 3GYNA 3P96A 4C8NA 4DPOA 4KFBA 3BSAA 1VHFA 2EK6A 2VICA 2OMLA 4DV5F 4ATNA 1REVB 5ETRA 1T7PA 2CJAA 2HRTA 4MT1A 5CYJA 4WXOA 5K8OA 4IQXA 1L3VA 4JYAJ 1NK4A 1F9FA 1XN9A 3DU6A 5DGBA 4X4UA 1HR0J 5AXNA 4XDCA 1RABB 2D41A 1KQKA 5KFBA 3OLAA 4DWIA 4CTAB 2HHHF 1DLOA 2IDLA 4KHPJ 4RL1A 4ZN3A 2QL9B 1RT4A 2BDPA 5KG0A 2WOMB 4RW9A 2WSEC 4DPTA 5HP1B 5IWAF 3GV5B 1S9FA 2RDJA 1CS4A 1RT7A 1QY7A 4P71A 3RYLA 2Z30B 4C11B 3MEEA 5LMNJ 4QPTA 2FJEB 3SI8A 2MEWA 3TAQA 1RE1B 2J0WA 3VF0B 2RKIB 3ZZ0A 2YX4A 4L73A 3LP1B 4LREA 1DHMA 4IH7A 4ZPWR 2BE2A 2FY8A 3G8SA 3Q22A 2BBEA 1S6QB 4PPZA 5I4MA 2HFZA 4DF8A 1NSAA 1HPZB 3GCXP 5E33A 2BQUA 4NA3A 2UUCF 2IM1A 3S1TA 2DISA 3BGLA 4MJKA 2UUBF 1HBOB 2LYVA 1SJRA 1VQ9S 4B3MJ 3A13A 2XTJP 3H20A 4DHVA 5GMKa 4LUBA 2HNDB 3A8EA 2KYXA 1SQFA 4GKJF 4G3IA 5C24A 2YKMA 1OWXA 2MZSA 2XI2A 4WFAQ 3OL6A 1ACMB 4B9MA 3QO9A 4FBUA 4DDFA 2O1PA 5K20B 3O1LA 1RT3A 4OZJA 4QIWD 3QWPA 1GTHA 2G0IA 3NGSA 2AWZA 3MPUB 1RBOB 4ZVTB 4DCPB 1H72C 3DRXA 3IGNA 5KT6A 2H54B 3E01A 2ZKTA 5F8MA 2QSFA 3CO9A 1HNZJ 2QTWA 3BR9A 3W9IA 2VUGA 3G4SS 1R8CA 5THWA 3D0GE 4DS4A 4DR4F 2IIHA 4UZCA 5LMNF 3H40A 4AYBD 3MECA 4IG0B 5SUHA 3PW5A 4J91A 5LSLA 2HBYB 4LFAF 4P52A 2PFFB 2FLPA 1X5PA 5LMUJ 1PGZA 1J2VA 2KRBA 2VH7A 1V3SA 3AFGA 1KQGB 1VHIA 2XM3A 3D2WA 4KTQA 2FY1A 1GXTA 2XHWA 2MXYA 1MWQA 5J2PB 3GFXA 2H9ZA 3MHYA 4EFAC 5BR8J 4TU7A 5AT1B 4PZVA 4Y65A 1Z2ZA 1ZS6A 4RW7A 2AJQA 3D1OA 3OLBA 1BMQB 1UJ6A 1RU1A 2DHXA 2XZTB 3LGHA 1TL1B 1FK9A 5E2QA 3NXZA 3HJVA 2ZH9A 1WKLA 5DG7A 2UXDJ 5EN1A 2WBRA 4DX7A 4NA1A 1MMNA 1PCAA 2QC3A 2VIHA 2RDDA 2LA6A 1GNKA 3KNGA 1RQ0A 2XMUA 3OTBA 5KFJA 3DM2A 5FDLB 2ATCB 1IKYA 2HGMA 2K2PA 1S6PB 3P3DA 5FLXU 4DS5A 2FVQA 4KJIA 1F6TA 1NM2A 2CNOB 2GIFA 3UVJB 1Y5LB 3IAM9 4LF4F 2KJVA 4WKRA 4ID8A 3CD6S 1N0VC 3V81B 2EFVA 5RUBA 3BDEA 4EBDA 5KFLA 1O51A 3I82A 4WKYA 2ASDA 3QRRA 3TQEA 1F1BB 1RHUB 4LF9F 2HEKA 3NAIA 3TUJC 1AROP 4ZVSB 2KM8C 3OV7A 1HNZF 2MJUA 3SSQA 3W8GA 5IV4A 1FDNA 1VQ8S 1I5OB 1HWJA 1W7WA 2YPZA 1VJWA 4MYUA 4DL2A 4B3RF 4RWWA 4DR2F 4OZLA 5EWFA 4MKBA 1YJNS 3HXMA 3HPOA 3F56A 4R5PB 3DGPA 1H7WA 2ASLA 1Q82T 2W4CA 4ZVUB 1S1UA 4GO5X 4KR0B 5AE2A 1EB0A 1H2TZ 5KFIA 1DQ8A 4DZ6A 4N56A 2JX2A 2HNZB 2CPYA 3M2VB 4GC6A 1S6UA 3HF5A 3KJVB 2B4OA 2QG9B 1BQNA 2GMJA 4FVCA 2F63A 4YN3B 1NK8A 4NLXA 2V2ZA 5ETNA 1KQSR 2BKNA 1QM9A 1RA6A 4DG1A 2MQLA 2M0GB 2RRNA 3CCMS 4JI5F 1KOHA 3F44A 1T03B 1XNQF 1GEHA 1S48A 2VPZB 1QSLA 1NSPA 2V4JB 4CLSA 2QL7B 4QWDA 1U1KA 3OR1A 4ZJQA 3NS7B 3C6UB 4FVMA 2CQ0A 1U6BA 5L1JA 1R3NA 2WB4A 5IC6B 4F4WA 1BQMB 4G6VB 5EWGA 2CJKA 2YNIB 2UXBJ 1OQ3A 3DOKB 2BEFA 1AW0A 4NLQA 3KG1A 1TKTB 4ZVEA 2V8HA 1YTYA 4I1TA 2ZE2B 1X4FA 5E3AA 1FDBA 4F7VA 3TR5A 4URSA 4ZLJA 3FKBA 2FVCA 4FYYB 1D9FA 4LRFA 1HMVB 3L09A 3CIZA 1PAEX 3C6TA 2ZJPQ 4KY3A 4K4SA 3TZXA 2UUTA 3HLUA 4R25A 2CXEA 3BBCA 1SIWB 3RZAA 5AXLA 2P6TA 2CJQA 3BREA 3MPWA 3PKYA 2G4BA 1JQGA 1UEVA 3BKTA 2YWGA 2IPOB 4BHQA 2XLJA 3TO8A 1EKRA 1RWKB 3K7RA 2VFUA 3M8YA 3N9UC 2KXHA 3P8BB 4FN5A 2QSWA 4O4RA 2KT3A 2K1RA 2O3DA 2V94A 3MM7A 3U27A 4KYZA 1R8BA 4DUYJ 4DUZJ 5IT9U 1T3OA 2LLZA 4OYIA 3GZ7A 2VG7B 3AOBA 4NI2A 2JLEA 5DG8A 2XC9A 1FEEA 3FDSA 5GMDA 1REGX 3JSMA 1FNMA 2J6SA 1RWVB 2G0CA 1XMOJ 3IO1A 3D6MB 5HROB 3NOGA 2FGOA 4NLOA 3VAIA 2MYFA 1FKOB 3H2UB 4LRBA 4X64F 3OR1B 3SBMA 3OFEA 1WUUA 3EVOA 1UTAA 4OLOA 1AUDA 2J7WA 4I2PB 4XPCA 2VC0A 2PFDA 3V6JA 4ZP9A 4PG6A 4CT8A 1HKAA 3DLGB 2W4DA 2E1PA 3CTRA 4LSNA 4PG7A 5BYSA 3LP2A 3D66A 3OUYB 1VQOS 2HRUA 2P5VA 4Q8FA 3RBXA 2R7OA 1IR1A 4PXDA 3FQKA 4IUFA 4K0KJ 4P2MA 4NYOA 3FBFA 4AL5A 4Y2MA 2KTQA 1TUVA 4OX6A 2GX8A 1S1VA 3V6KA 1UZDA 1SCJB 1MWYA 1TR0A 5KFUA 4LVOP 1M5VC 2MZ1A 2QLBB 3KHRA 2E7VA 1CPZA 3GU0A 4OYWA 3DGPB 1OYEA 1YJVA 4JV2A 3E51A 2L41A 3DLBA 2IYGA 2BABA 3ZZPA 3CMQA 1KVJA 3MURP 2WVEA 2DHGA 1Q79A 1T94A 1YZ7A 4IQMA 5L46A 4JI6J 4PQUB 5C5JA 2G2OA 1XEZA 4YFUA 4ZDNA 2YBVA 3W65A 3L9ZA 4M5NA 1U4BA 4MIBA 2QLFB 4O3OA 2D74B 1LW2A 2A3JA 2YNHB 1K47A 2Q1LA 1CBKA 4ID5A 2CJBA 2OELA 2RQCA 2GMHA 3AH6A 4LF8J 1U25A 1TQLA 1YGYA 4X65J 1UWBA 4FKXA 1HNWF 1H0HB 2HFNA 5G0RB 2DCUB 3DDNA 4B08A 4P7VA 1WELA 1VI7A 1NK6A 2IYIA 5D3GB 4I6AA 2FC9A 3AA8A 5KFKA 1GMWD 2H3EB 2XS7A 4RJVA 2A10A 4B9TA 4DR6J 3ILIA 2GVDA 1V3RA 4PXEA 3MM5A 4BDPA 1RT5A 2HWHA 4UY85 1R6YA 1PG5B 4RW7B 1RAGB 4I4BA 4Q2MA 1I1GA 1Y7PA 2VPWB 2QRRA 4WP3A 5IC4B 2YH0A 1LK7A 3ELHA 3TX0A 1RISA 2LQ9A 4IRDA 2Q66A 2FJAB 5IT4A 5CABA 5KFRA 3NS6A 4OL8A 5F0UA 5DDRC 3OTOF 5CQGA 2KRRA 3HHKA 3PXGa 2BOPA 1D8YA 3PJ9A 2QYCA 3W5ZA 4IG0A 2R42A 2J6TA 4K4XA 1FCAA 4JI6F 1PJ6A 4UOHA 1FX2A 3L7PA 3L7UA 1O8BA 4OYMA 5D0GA 4KC5A 3GIMA 3J7AN 3HHLC 3JSBA 2JZ5A 3RR7A 1LEOA 1YVFA 1HBNA 3U02A 3VQTA 1TKXB 3GIRA 3HHDA 2L3MA 4QR2A 4ZITA 3GJRB 2BXJA 1KEKA 1EETA 3K5LA 1RA7A 1WOPA 1MG7A 2N7YA 4B3OA 4C7QA 3QO9B 3EJMA 4KT0C 1RUSA 5F9NA 3HZGA 2YNGA 1UW9A 1B4SA 1U0HA 4HACB 1SKWA 4QW9A 4B9LA 4PKDB 2HNDA 4OHZA 4ETZA 4XIUA 1R89A 4C0OC 3A8JA 2EFGA 1RB0A 4PWWA 3BF4A 2Z2ZA 3Q8QB 2QL5B 1XNRF 3QATA 4NYZA 4DV3J 4B3SF 3J7A1 3P6YC 2R2UA 4RUAA 2KU7A 3RB6A 1N6QB 5E3PA 1MW7A 1CSJA 3KMSA 3CB4A 1NPPA 1BY9A 1S97A 5HJYA 3H25A 4HI2A 1TAUA 1DARA 2E9RX 1RHMB 3K2YA 3ZZRA 4E98A 3GG0A 4KH0B 3HCXA 3AJ1A 3H8YA 2J0XA 3DRRB 2HZCA 2AGPA 3RUBL 2RSQA 5J2QB 3MEEB 3DOLA 1K44A 1SPBP 1W2IA 2KVIA 2VFSA 1V6HA 4QWEA 1Y10A 2RHQB 3FEYB 4HT5A 4CI0B 5DDPC 1R8PA 2M4MA 3NRBA 1DLOB 3QLHB 2NQPA 4FNIA 1ZPVA 2I5JB 1UL3A 4IO1A 3U7JA 3OVAA 2E1AA 3TOQA 1T11A 4USJC 2DGUA 3P5BP 2A6OA 4DBQA 3KLGB 3IGVA 1CJKA 3V6HA 3D9BA 1L5UA 2MZRA 5F8IA 3OTDA 4AXJA 4KFBB 4GMKA 5GAGI 2ZJQQ 3AJ2A 4U8VA 1S1WA 1UVJA 2CIMA 2NSCA 3F0NA 4ZVRB 3CC4S 2PN6A 4HACA 1VGYA 5KG3A 4B3SJ 1AYEA 1Q4RA 2CQ1A 4ZJLA 3OPKA 4FPIA 2IAJA 1DY3A 2DNQA 2DNMA 1EETB 4NA2A 2XMVA 1NPRA 4GVLA 3R7NB 1TVRA 3IRXB 3CCWA 5AJ3F 4C0BA 2FYXA 5LXRA 2FZCB 1RWNB 4P2XA 1V9OA 2ZITA 3PFEA 3DRPA 1AFJA 1T9UA 2OPRA 1Y5IB 1ZM9A 2LDYA 4KGVB 3M2RB 4J9PA 3H5SA 1YRUA 1S1WB 1URRA 4JI0J 6FDRA 1GK8A 3ILOA 4HYKA 1QSYA 4IG3A 1RHJB 5E7OB 3V5RA 1ZH5A 1HYSB 1FKAF 1OO0B 2G1HA 3KLGA 1KKHA 2QA2A 3N0VA 5LT5A 3N5BA 1GTEA 1MU2A 5KFFA 1ULRA 1Y5NB 1IVZA 5L9XA 1JNRB 3CDBA 2W4PA 4HTJA 1GH8A 1IBMF 3CCJS 2E5JA 3MEDB 2U2FA 1RT5B 1H7XA 4OIXA 2XCAA 3Q8SB 5D15A 1NH7A 1UAWA 2B8PA 4CLZA 2LFVA 3BYRA 5KG6A 2HIQA 3KJNB 2HBQB 3EWGA 2AF6A 3QGHA 2Z57B 3OBIA 3PYFA 4AT1B 1CJUB 3RBDA 1BWVA 7AT1B 2NXEA 4ZJOA 3CJQA 2PMHA 4LBIA 4MYTA 3DGVA 3ZTRA 1RT1A 1B3TA 2MMYA 3CO0P 3ZFVA 1Q8KA 3MTJA 4Q45A 3MUVP 2UXBF 1SC6A 1QAIA 4GC7A 4DPUA 2YKPA 2D7SA 4K50A 3G6XA 4ZOSA 3I55S 3X1LB 1I6JA 2HKEA 2DXEA 3TAMB 2J0SD 2CUYA 2F7VA 2BQRA 1NLKL 2CQPA 2J7UA 4G1PA 1F2GA 5B0EA 2CNKB 1TL3B 4TVAB 4NLSA 3ONQA 3T5JA 2AHOB 2YNGB 4LF6F 1NHUA 2A18A 2D9PA 2QN6B 3MTKA 4IDKB 1KD1T 1AUSL 1S1VB 1UP1A 2IA0A 4DU8A 2CADA 4QIGA 5KOXA 1UETA 2V0NA 1F2HA 4IFVB 1Z1ZA 4L74A 1HBNB 3ENWA 4ZCMA 2QLWA 5CYQA 1GMWA 1P6TA 2MQOA 2XQCA 2ZH5A 2Y9HA 3G8TA 4CYUB 3VHQA 4O3PA 2DY9A 1RBAA 5C42B 2BV3A 3W9JA 4QJVA 4WFNQ 2Q3PA 1N36F 3KDNA 4MKAA 3W5XA 5HBMB 1AFIA 1NMEB 2VPYB 2BRLA 4V1Ak 2BJ8A 1FRMA 4Z2XA 4XTTA 4DR5J 4OZ0A 1T3NA 1Q86T 3KNAA 3SCIE 3IM8A 3EDRB 1FKOA 4K8RA 2RVJA 4R0EA 2DJWA 1X9WA 2RQKA 1HA1A 4ECSA 1FDDA 3M8PB 4JOUA 3DRSB 3R5JB 1F3VA 5B09A 1VQ4S 5JMNA 3MUTP 4J5OA 5ETVA 1HI8A 3PJXA 4CH0S 4M95A 1GXLA 1XMQF 4F3MA 4EU0A 3MM7B 1WSVA 3PKMA 1Q16B 2DXFA 1JB0C 2L08A 3QJPA 4X66J 1N5TA 1N4LA 4LR8A 1MROA 2EW9A 2MLYA 4OI2A 1S49A 5G0RA 3ISNC 3K5PA 2JWNA 3UCUP 1B64A 2CZ4A 3DLJA 4DI6A 1MLAA 2HMIA 2WTFA 4ID5B 4J9LA 2EKYA 1F5CA 1R43A 2G1DA 1NJYA 2WB1D 1LW2B 2DNYA 3C6TB 2F5GA 3JTOA 4HTIA 4ZLPA 1RU2A 4TLRA 5HMWA 1D9AA 2HLTA 3NOCA 5HO4A 3EUNA 2R7WA 4OYZA 4RKUC 2IVFB 3CULA 5EGYA 3R7SB 1KVKA 2QT7A 3ZTSA 3PVXA 2ZE2A 2AMCB 1TKTA 3JSRA 1BD6A 5FJ4A 5C2CA 2HVEA 1WF2A 2OPPB 2HPUA 4J37A 5CA5A 1QVGR 5AXMA 1E6VB 3DI6A 4U6PA 4DQIA 2V68A 2WSFC 4LF7F 4DV6J 4LF8F 2IVMA 1QDUB 1RHQB 2VG6B 2DR5A 3M2UB 4EGLA 3NMAA 2YQ0A 2CAJA 2Z58B 1JMTA 2ZZTA 4RR5A 2X1AA 2J8SA 5HVGA 4CLKA 1FWLA 4PEOA 4CH7A 5ETLA 2W9AA 5CZVA 3HHEA 2EBGA 4IFYB 3UE2A 4BC9A 4L72B 2CDRB 2WHOA 2UP1A 2Z0GA 3H0PA 2B8QA 4IOAQ 5ETKA 4IFYA 4YOEA 3D1QA 1FNXH 4YP3A 4DN0A 4Y34A 4I2PA 3MR3A 2HVDA 1WOOA 3CJSA 4H4OB 4F4XA 4C8YA 1R8AA 2FLOA 4OI0A 3ZTOA 1HARA 2VB6A 1K1QA 4M5LA 4YB7A 4B3MF 2NPIA 1S9EA 1Q0NA 3W62A 3QIPA 3C14A 1FRLA 4URGA 1FXRA 1MN7A 3CCTA 2LEPA 2MTLA 2B5JA 1Q95G 3JXOA 2CRLA 4RX6A 4YY3J 1IBKF 4HHUA 2GHPA 1YX2A 4N8OA 1SQGA 3QT5A 1B0VA 1BXNA 1UVKA 1DTQB 4I64A 1RCOB 1QAXA 2K7JA 2ATLA 1YLXA 3FCHA 4LSLA 1RWWB 2FDNA 5KFNA 2UV8A 3V81A 1KHWA 1HD1A 1NU4A 4MK7A 1FF2A 2NZCA 2JFKA 4CLPA 3OL9A 1HI0P 1QTMA 1VQSA 2ZOGA 1RT6B 3IR5B 3CXCR 3OTCA 5L1LA 3R1LA 4DSLA 4DR4J 3JTNA 3TZZA 3BR8A 3JQJA 2Y1JA 1Y11A 1HMVA 1IKVA 3VQSA 4UUXA 2MZQA 3EZUA 3MMAA 4GRSA 1CEZA 5L1KA 1RAHB 3PX6A 1AZSA 1UA1A 3AT1B 1TL1A 1RI7A 5B0DA 4F02A 3IAS9 5L1IA 3PHEA 1RWUA 1CC8A 2IVYA 2WVCA 2YNIA 2X51A 3HVRA 3Q86A 1QE1B 4ZHRA 2HIYA 2RMLA 2EWHA 4TLQA 5J2PA 4DL5A 2ADCA 4MK8A 1TK8A 3EGVA 3T1HF 5HATA 2Q79A 4ED6A 2BRKA 2VHGA 4FS2A 3TI0A 1XR6A 3O8WA 1U09A 2JHEA 1ZM2A 4USVA 5C7PA 1H2UX 1ZM3A 1TP7A 3M32B 2AGOA 4KGKA 1UKUA 5HBMA 2X7IA 4A48A 4X4RA 1T03A 4NXMJ 1R0CB 2FVRA 2BYCA 2E1RA 1KWMA 3FMWA 1E6YA 4OZ3A 3TJ8A 4DV5J 2R8GA 3KJFB 5HMXA 4K2JA 1QAJA 4JI2F 4CYUA 3M8WA 3HZEA 4F3OA 2XS5A 1S7HA 1BQNB 4V19X 2KO1A 3KJVA 2LCWA 4HH0A 1DQ9A 5DZ7A 4P73A 3RBZA 3M9MB 1N5VA 1SJQA 2HQFA 5EX0A 1OSDA 4RUHA 2LXUA 5B0BA 1NJZA 4LQ3A 4KHPF 3Q8RB 5CYMA 4UQTA 3ETMA 3I4HX 4UT4A 3J81Y 5AXKA 4X4NA 1U02A 3WHIA 3QT8A 3U1LA 1TV6A 1ZM4A 2FJBB 4ZA1A 2AJ2A 2QA4G 2C42A 2RF2A 3GFYA 4USTA 3GPAA 2XO7A 2LQBA 1VBZA 1F3FA 1SQEA 4ZVHA 5F8NA 4KGXB 4EO6A 2H65B 2J5AA 4FF1A 1YJ7A 3O44A 4KGZB 1ELOA 1WHXA 3OTEA 4Z7YA 5GMEA 3K17A 1VQKS 1JLEA 3LP1A 4KGMA 4BLGA 2JLGA 4KB7A 2BACA 1CJUA 1FTRA 1X4EA 3C3LA 3TUPA 3I31A 1M5HA 1HLWA 1RTJB 4ZP8A 2OLWA 2F1FA 4NXMF 4GVBB 1CS4B 5BJRA 2IHR1 1A7GE 2DKOB 5HP1A 2GNKA 4RW9B 3G9CA 4WIQA 4JV0A 5B7WA 1HHTP 1WF1A 2RQ4A 1FK9B 5J1EA 1KDNA 4DR1J 4OI1A 2ZZNA 2GQCA 3DNCA 3M8QA 2NYHA 4CTAA 5KFSA 4ZPCA 3HK2A 3NMRA 1VRUA 2V67A 5EDWA 4IRCA 2W1BA 1M1GA 1RAIB 2DXDA 5F8JA 3D7SB 4LT6A 1KTVA 3MM9A 3OHAA 4Y00A 1S1TA 4C8KA 2EG2A 5GAEU 2KXNB 2NREA 1XTZA 2OFGX 2E5IA 1NNDA 3MECB 4LF2A 2O5DA 5GADU 4M5JA 2OPQA 1ITPA 3QRPA 3JS9A 3BH7B 1NHKL 1WOSA 1WI8A 2AYEA 4TY9A 4JYAF 4R8UA 2HS0A 2H5JB 3A12A 1OS5A 4OZ1A 3W64A 5LSOA 2N3OA 1VC0A 2XLKA 2B6AA 1RT3B 3UDLA 2BMBA 3BEGB 2MKKA 4B9NA 2GVZA 2FVSA 3A8KA 1LFPA 3GJQB 5DDQC 1RWPB 1WC5A 2UVWA 4U7UD 3ZZZA 3KOAA 3ZTPA 2E29A 2RUGA 4WTOB 5HQMA 1L3SA 3V4IA 1H3DA 1ZBTA 2BW2A 4M8LA 3IR7B 3CIMA 3VTIA 4CLFA 2MGZA 2W7PA 2UU9J 4KKOA 1ZA2B 3JQKA 4P2FA 4DV2F 1VLOA 4KBIA 3NBPB 1XMBA 2PA3A 3EPIA 4PWDA 1OY6A 2N4DA 4OJ1A 4X84A 5SZTA 5LXYA 4OMFG 3I0SA 4O4GB 4NRTA 1CULA 3EPGA 2HQIA 2RU9A 3PX0A 1U1QA 1SKRA 2IJRA 3QNWB 2I5JA 4HLBA 3PW4A 2FHOB 2ZVIA 2EC0A 4OJ3A 2VOPA 2QV6A 4MFBA 5HSPA 2OEJA 2XYGB 3SSSA 5HANA 2YKNA 1SVDA 3EMTA 3V6DA 3QLHA 2DITA 3BV8A 3FSXA 3TAPA 3K57A 4QZVB 2OIHA 2UUBJ 2UVVA 2XNRA 4G1QA 2E5LF 2OPSA 4ECUA 2B56A 3T9NA 2FZGB 3QT7A 3US5A 4I2QA 4QIEA 3DOLB 2F9JA 3QQCD 3DKDA 4Q2LA 1I94F 2DCLA 1IWAA 2M7SA 2RNEA 2UUWA 3A8IA 4MK9A 3R9LA 5KFVA 3WX8A 3LAKA 2J9CA 3IA0A 4DN9A 3M8RA 2C1EB 2I8EA 5JJBA 4ZPVR 5HMYA 2C2RA 5IQ6A 3VVUA 1B0PA 3I9V9 1NKEA 1R0AA 1VQ7S 3UD5A 2HK2A 4DV1J 1N33F 3PW2A 2BJ7A 3AD9C 2ACYA 4FDFA 5A0YA 2QMWA 2COLA 2PEBA 4Z7CA 1REVA 3KLEB 2H1YA 2HBRB 2DH7A 1OPZA 1UJ4A 4NLPA 4O0NA 1NK7A 4Y6IA 1M1KT 1DRZA 2ROPA 4YQWA 1RHRB 1WC4A 4J7CA 3W2WA 1B99A 4DUTA 4LFAJ 4K4VA 1TMJA 4WFYA 1RT2B 3DLEA 2RAQA 1VQMS 4ELVA 4EUVA 5L38A 2FHKA 2RD5C 1U2CA 4ED2A 4B3OB 5D78A 3VR1A 3GG1A 2AQ4A 3VAGA 4PYAA 1S0VA 1JLCA 1YZ6A 1C2PA 4DV0F 3EM1A 1N32F 4UOGA 4QCLA 2HHTA 1JLBA 1NZ8A 2FHJA 2KL8A 1NEEA 4URQU 5KFMA 2XGPA 2HVZA 4C2MA 2RRBA 4A8OA 3ET6B 3DMJB 2WVBA 4OJHA 1LWEB 4YHHF 3MR5A 3SV3A 1JLBB 1SJ1A 2G13A 1ROFA 2GC8A 4RNNA 4DFKA 1RWOB 4RPFA 1FDAA 2JLFA 2WVFA 3R3TA 5LOQA 1PJ7A 2JH3A 3PTWA 3IN5A 4H4MA 2E5HA 3KLVA 1T0TV 1Y3JA 1RAJA 1CJTA 1MWZA 3RAXA 1VC6A 3W2VA 3B78A 2IA6A 4JV5J 4LIWA 3TVKA 4GO7X 1HQUB 2EC2A 2BJEA 5MAOA 2L9WA 2MKSA 2XULA 3ADAC 1ZYQA 5EX3A 4M5GA 2ZEJA 3UN2A 2XMAA 3R5BA 3R1HA 3A3PB 3UDVA 2GAHC 3B4DA 2PMZD 1UPPA 1U45A 2JC1A 1G4CA 2R7TA 2LKZA 4ECWA 2DO4A 3NGTA 5A6WA 2D3ZA 2YNFA 3C2PA 2V69A 4CO1A 2FGCA 5KG4A 3N28A 4ANCA 2AV5A 2DK2A 3HVTB 4GKKF 3CDEA 3HT0A 3C16B 1FFSB 4U9RA 2XO6A 3IWNC 4X2BA 1SH0A 4ETXA 3FRYA 2C28A 2O66A 1T9XA 2OJ3A 5HQLA 2OEMA 2B4VA 2X1BA 3LWLA 3HO1A 4USWA 5K9FA 5C25A 3UFCX 4BBYA 2HHUA 1D3WA 5F3TA 2MQ8A 1U26A 3UWTA 4A8YA 3BPSP 3EGZA 1RTIA 2XI3A 3D6HB 2DRDA 4PG5A 5KG7A 2YNFB 1PC5A 1HNVB 2WRMA 2LXIA 1UZHA 1NSQA 1PBAA 4O0IA 1Z4UA 4PUOB 3TW0A 1U1RA 3V6DB 2UUAF 1A0OB 2YKNB 2BW7A 5IS2A 4F4AA 4DCOB 3L95X 3TQ1A 4J9SA 1SC4B 1TKZB 1SV5A 1O0PA 3LO3A 2CJYB 5D77A 3RAMA 1U47A 3EICA 1NO8A 2JEJA 2MY7A 1YJRA 2ZFHA 1WWHA 1ZZFA 3HX9A 2DRAA 4L3NA 4NLTA 2JDJA 2I6WA 2F8HA 3HM9A 3AHPA 2V5HG 4KKOB 1UA0A 1WC3A 1UFWA 2AT1B 2W2OP 3PCOB 5IM0B 1JJ2R 3KK3B 2QEXS 3SQGB 3BH6B 1VRQC 2RE1A 2CZ9A 3ICLA 3MPVA 3Q8UA 2WONA 4F4ZA 3W8PA 3OUYA 3ZTQA 2XCPA 1WKJA 3M6UA 1S4EA 4DV4F 3DLGA 3GMGA 2K3IA 4KHRA 2CJXB 4M5DA 3I5BA 4F0MA 4K4YA 1KRPA 4MKYA 3KG0A 3THVA 1SXLA 2ZH4A 2YWWA 1BC6A 5E0OA 3J7ZT 3EYZA 5JXSA 1DAXA 2YQ1A 3FRZA 2XZDB 3WQPA 2VQFF 2CQHA 3ITHB 2RH3A 2VFVA 1AT1B 3AOCA 4XK8C 5J2MB 4UOFA 4U7CA 2XMWA 4A8MP 2DO0A 4D3HA 4AL7A 5HROA 2OPQB 3K8WA 6AT1B 2JEGA 4KO0B 1IM6A 3B4MA 4WCEQ 4NEYA 1JLAA 1PSDA 2CG8A 3IFEA 1S79A 4DUYF 3KLEA 1RACB 2HQCA 3AJDA 3R6GB 3MM9B 2R8HA 2VL1A 4ICLB 2V8PA 3QBCA 4A8SA 2FIUA 3RB0A 1EIYB 1XERA 1H98A 1RKIA 1XMOF 1R0AB 1VRUB 3H4BA 5A76A 3DLKA 1B7FA 4JBCA 2CNLB 2DHSA 3PZPA 1KTQA 2WCXA 4AD6A 3KLFB 2IC3B 3KWMA 3LP0B 3R6LB 3I56S 3BQ1A 3MM6B 4WJBA 2AEJA 2CWKA 1S0MA 1LW0B 4JI0F 3T41A 2NUUG 1DBDA 3HJFA 1KNZA 3FMBA 3POTB 1IM4A 2OPSB 2ZNZA 5DGAA 5LMUF 1YJ9S 5CCMA 4C4WA 2DGVA 1C0TB 5F3ZA 1WDTA 1HBMB 2W9BA 4DL3A 4LMZA 4K0KF 5L8RC 3MOZA 1L3TA 4F8RA 1FX4A 3KUEA 5AE3A 1OY8A 4DX8H 4MFBB 3EVWA 4WYWA 3TA1A 3OVSA 4C8LA 2ZC4A 3V2UC 2E7XA 4J9RA 1IKWB 3FFIA 1CULB 2GJFA 2NCKL 2OUGA 4USMA 2DT9A 2VQEJ 4GKJJ 3CD5A 5HAOA 4WE1B 1I51B 5A2QY 1P1LA 2J9DE 1S10A 2CQDA 3ZNJ1 2YX7A 1HHQA 2P6SA 2WZ1A 4DEZA 2AD9A 1RBLA 1VDHA 4C6AA 2MGZB 2R3VA 1LFWA 4UZBA 1CQNA 2F3JA 1S76D 1RJJA 3V4IB 4OZNA 4OI4A 3J7Z5 1XNRJ 4YY3F 3T5LA 2IM3A 3T6JA 3MAAA 4NCGA 1RAAB 2B9YA 4IH6A 4LF4J 4JP8A 1HBUB 4X62J 2AJ1A 3A3OB 4ELTA 3M2VA 3Q2TC 1Y00A 2LEAA 4PWUA 2B4UA 5T7LA 3KTQA 1VIOA 1BE4A 2MSTA 2GJ2A 4MAKA 4LF9J 2MKCA 4RUBA 3FEXB 3FJ2A 1ZAWA 1VISA 3GR1A 4N7TA 4ANEA 1U49A 2DIUA 1N5SA 3VWSA 1O5JA 4R5PA 2FJXA 4RU9A 3BO3A 2R2SA 2ACMA 4H54A 4IR1A 1CLFA 4DU7A 3ILLA 1UFKA 3M32A 4AL6A 2Y1IA 1R7IA 1YRTA 5KFCA 1Q53A 2W7OA 4Q8EA 1RTDA 3TYTA 3BJYA 2RS8A 1IKWA 3FFIB 4PXBA 2J0QD 5I3QA 5HMZA 2SXLA 2HW3A 3HULA 1NDCA 4ZHRB 3HVAA 1UVIA 1LQ9A 3OVBA 2NPFA 3QIDA 3HHNB 5J2NA 1TFWA 3BN4A 4Q43A 5F8LA 3TVYA 5A8KA 2K06A 3UVJA 3LAMA 1FO1A 4ZCLA 4ZK7M 3OTOJ 5KTQA 1S6PA 4JI4F 1O6XA 3POTA 2LECA 2Y8YA 2KFZA 3TRGA 3DCAA 1FRIA 2R7RA 3IP0A 3J7YU 2VPXB 3H98A 4V19J 4DR5F 4NMLA 3MM6A 3QFWA 2HS3A 2XYPB 2ZHBA 1JLEB 3P45B 1NZAA 1WEZA 2XG8A 1Q7YT 4OX8A 2GO8A 4YB5A 4X62F 2AEMA 2QA4S 3TARA 1ZOTA 1D8ZA 4ZPTR 4RNOA 4PR6A 4O3SA 1JX4A 3AD7C 3WBZA 4C98A 3QWUA 2LA4A 5E3QA 2IJNA 4C97A 4DZDA 3CCUS 4F26A 1VR6A 1SJFA 2ZH3A 2IDEA 3MCNA 5GVQA 3LF0A 2HVIA 3OXLA 2WW4A 5HLFA 4ZPAA 1I94J 2HZVA 1S9EB 1KR4A 4OHXA 4O3QA 2YKAA 2ZDPA 5KFDA 5A2QU 3CMAS 1OQ6A 1S5ZA 1XR5A 3HI9A 4PPDA 5J2MA 1U6FA 3G8QA 1P1TA 4E8UA 4F2RA 4OV1A 3SYZA 2HFSA 2R7QA 2R2TA 4CM2A 4WK1A 5T7LB 1TTHB 2V8VA 2VOOA 4M5KA 4ZKAA 3BBFA 3T5HA 2BM1A 3Q89A 4UW2A 2W2PP 3EGNA 2IM2A 2R2RA 3KUGA 1E6YB 2IFXA 4OFZA 3T19A 3KK3A 1TUGB 3T1YJ 1EX8A 2DR9A 2EI5A 3NGUA 2JJ4D 2OSRA 3PJWA 1CG2A 1L3UA 3L4BC 2E5GA 1YK9A 4FXVA 2EFPA 1K8AT 3GCWP 3M2UA 1F60B 4TYBA 5D0EA 1OPIA 1LOUA 1HPZA 1RXOB 3RW7A 1F9EB 4DQQA 2A6MA 3J7YI 1SV5B 1X5SA 3HFVA 3LW5C 3FBCA 3PACA 4AQYF 3HMJG 1TL5A 4D3GA 2BE2B 2AX1A 3KYLA 1KS2A 1X8DA 1GT8A 1YSJA 2YWHA 1HWIA 3KXDA 1RAFB 3QGIA 2PC6A 1M1HA 1HBMA 4RW6A 1RGVA 1C0TA 4OJGA 1C4AA 4PG8A 2CWXA 4CH1A 2VC1A 2ZM6F 2Z2LA 3K5MA 4OHYA 4HDHA 3GLJA 3CMES 2GQQA 2GS8A 4WFXA 2M52A 4KSEB 3CJKA 3TA2A 1C1BA 1S9GA 1X9MA 1F5BA 2OTLS 2I38A 3MOJB 2P9EA 1SI9A 1YRXA 3H2VE 4P6QA 5ITHA 2C22A 2B9XA 4JI3J 1PYTA 3KLFA 2QLXA 2M2BA 3KK1A 4L6V3 1RP5A 4C9DA 5KFXA 4LSLB 1WC1A 3C66A 3C16A 3GFZA 4ZVQB 2ZHOA 3MCMA 1NB7A 4IO9Q 4ICLA 3VVTA 2M70A 4E2FB 5GADI 3N6NA 3EX7B 2OGUA 3W63A 1FRKA 2CPDA 1T9TA 4BS2A 2B5JB 2HNYA 3N4WA 3BYPA 5FD1A 1JLFA 4A8WA 1N36J 2PMWA 3K8VA 2UU9F 1XNQJ 2RILA 3NNHA 4YDDB 2ZH6A 1VQ6S 4Y2KA 1YBUA 4KAIA 2PT0A 3KLHB 5M2UA 2HRYA 4RO0A 4M94A 3NG8A 1HNIB 1LWXA 2BM0A 3MUMP 2RS2A 4YR0A 2V8GA 1VFJA 3CF5Q 3QRQA 1Q7LB 1HFEL 5BXIA 4RNMA 2KZZA 3CCRS 1TU0B 4H4MB 4E0DA 4H4OA 3R2CJ 5D4PA 3ZZYA 5KFWA 3WC0A 4J9VA 4M5DB 3MCSA 5A6PA 3THTA 1LWEA 3ZO7A 4AFFA 3DMJA 1U1MA 1D09B 4PABA 2BR0A 2KZMA 2HHXA 1JXEA 2ABYA 2JL9A 1QUVA 2OAUA 4PG4A 4ZLLA 1JIHA 1FI4A 3EZ5A 1FKPB 3G87A 3OT9A 3HKZD 1JLCB 2HSEB 4XDDA 5KT2A 1XJWB 1HQEA 3PRDA 4ED7A 4OX7A 4IDKA 1NBEB 3NNAA 5H1SV 2DNZA 1C4CA 2MKJA 1X4HA 2CPXA 1X4GA 2U1AA 3CDAA 2KYZA 3FK4A 4JI1J 1RT2A 3DLEB 3DI6B 4NE9C 1U48A 3VZIA 4O44B 3GTYX 3MMCB 3DLHA 3IG1B 1YJTA 4DV1F 4X4VA 2H5EA 3SFUA 1NK9A 2JFDA 5D4OA 2YWKA 3VAFA 1QVFR 1GX5A 3VGTA 1KSPA 1UVMA 1U7LA 1RTIB 1WKKA 3H42A 4P7TA 4RBTA 1FRJA 5DS7A 2JEFA 4G65A 3QAUA 1UCNA 1A6LA 2VA2A 2GGPA 4U96A 2PEHA 1WORA 2MHEA 4LF7J 1DTTA 1RTHB 2FJVA 3T5KA 2V9WA 1IN0A 3O6QA 3D0HE 2ZZMA 3VV2B 1TZ0A 2DGXA 3J80Y 3DOMA 3GP9A 1RZMA 3HSJA 1U0SA 2DD8S 4N77A 4DV0J 4ECQA 3IMQJ 3KK2A 2OH2A 3HVTA 3I87A 4Y28C 3UW1A 2HGNA 5F9LA 1YKWA 2UVRA 2Q6CA 2L48A 4G1QB 4AE5A 1R6VA 4O3NA 3PYEA 3D68A 2VBWA 2FZKB 3NAHA 3T1AA 4C3KA 1VRTB 3OL7A 4YDXA 3KG4A 4M63A 4HT7A 2JC0A 3OD2A 3LH2S 4LBHA 4ZP6A 3EXYA 1RAOA 3I0SB 4O4GA 5IXUA 2FC8A 1B0TA 4PWDB 1HYSA 4CWBA 3KHHA 3UQSA 5LJ3Y 4KPYA 3PX4A 5IWAJ 3RR8A 3PM9A 5KFEA 2K8GA 2VBXA 2HURA 3AA9A 2XMJA 2XSFA 1FXDA 3NWGA 3VGVA 2XY5A 3M2RA 3UI3A 1IBKJ 2OPRB 4DR1F 4YB1P 1HW9A 2GVZB 4EBCA 3C15B 1K9MT 1AA1B 3IRXA 1FVSA 3UCGA 1HWLA 4OHWA 1WC6A 1SUQA 3BGRB 3C8YA 4F4KA 4NASA 2VONA 4U8YA 1EQ0A 1FJEB 4LFBJ 3QYYA 4ANDA 2KJWA 3H59A 1NUEA 1LV5A 1N8RT 1WACA 5K8NA 5I42A 2PSZA 3MM8A 3U1MA 2KDOA 1PIEA 2IMOA 2GA7A 2C2ZB 1M5SA 3EE3A 1EKSA 2NXJA 4DX5A 1N34F 4DV7F 1BWEA 3I96A 3DLLQ 4RZRA 3M30B 4FF2A 2OMOA 2L9DA 3W1YC 2B4PA 3PV8A 2DY1A 2J76E 2J9DA 2OKQA 4K5RA 4QYRA 1I3OB 5HJXA 1QLNA 2H4WB 4F3QA 4DSJA 2KI2A 1MN9A 4USIA 4DL4A 3CD0A 1C0UB 4Y2AA 4ER8A 3M8QB 3OFFA 1IKXA 4DSEA 2PGCA 3CCVS 2NLWA 2O67A 3SIPB 4KV8A 4IYQA 1OMSA 5HVHA 4TQRA 4Y3CA 4GVBA 2W9CB 2NR0A 4LRAA 2ZNYA 3N6LA 1JXVA 3DRRA 4KV8B 3MMBB
chains in the Genus database with same CATH topology
3WC2A 1KHVA 3KLIA 5FLXY 3G6VA 1FJ7A 1ZETA 1VK3A 3SV4A 3I6PA 3MEDA 4A8XA 2RRAA 1C0UA 2C3PA 1QAYA 3ETOA 1MU2B 3OFGA 1RKJA 4LF5F 1R8HA 1BGXT 2FLLA 2VBZA 2DGWA 1X5TA 2Y0SD 3IRWP 1SL0A 2D1CA 4QR1A 5CCLA 4A8KA 3M30A 2WBMA 2XLIA 1R31A 2Z4PA 5KAKA 1ZTWA 3HHLB 2BVZA 3I0RB 3DFEA 4LVNP 3Q2SC 3MM8B 1FJGF 1GAOA 5K5MA 4ZCIA 4MTPA 2I1RA 5CYMB 1Q1KA 3TX8A 1Q78A 3DXSX 3DRPB 4EBEA 1KONA 1RYRA 3ISZA 2DGSA 1HI1A 1V3ZA 2V4RA 5DQIA 2B6AB 4B17A 2ZHAA 3OSNA 4J9KA 1JNZB 2MDAA 2RJZA 2N7CA 3X3UA 4UY8T 2CVIA 3A1YG 5KG1A 4DLGA 3O3LA 3VCDA 4ZMMA 3PO4A 4RBUA 4K4ZA 1M5PC 2POKA 3DHXA 2HHVA 2E9ZA 4NZ0A 5I3UA 2PE8A 4ZS6A 4FPRA 1LKZA 3RB3A 4QIVA 1KLMB 1EP4B 2M88A 1JLQB 4WFZA 2MZJA 2HG4A 2AYBA 2JEIA 1QE1A 4QOTA 2CQGA 2M8HA 4ECTA 3MM5B 4I7FA 2A2DA 1FD8A 2F40A 2MZTA 4NPOA 4DLEA 1SKSA 2AJFE 3MMAB 3GIKA 3JYTA 5HI7A 1XWLA 3PEHA 3I5CA 3IR6B 1FE0A 1KVIA 1UFLA 3IS9B 3M9OB 4BWMA 1U1PA 1RT6A 1YQHA 3CE8A 2DGTA 1YHQS 1UWBB 1T05B 4K59A 4TXSA 1RTHA 2LQ5A 5JVHQ 3SCJE 4QWCA 5LL6d 2NXUA 5KG5A 5KG2A 2AX0A 5DLFA 1FHTA 3JAMY 4RUCA 1WHYA 2CQ2A 4RNFA 3CDUA 2FLNA 2UVUA 3RAQA 4DF4A 4CQ1A 7FD1A 1HNXF 1FT8A 3IG1A 4BC7A 4NLRA 3TUIC 3R5AA 2NYIA 5DQHA 3CCLS 5DG9A 3OSPA 1NJWA 4PQAA 4HVZA 2IBKA 4O3RA 3IWLA 2MQNA 4NWBA 1N88A 2IRXA 1TKXA 1FKPA 4WZQA 3CJ4A 4OLPA 2KXFA 2ZC3A 2ROGA 5ADZA 1T95A 1A9NB 3MZIA 1P27B 4A46A 4ZVFA 4NRUA 3LOUA 1QUPA 4JV5F 1WG4A 1OSCA 1KQFB 4X4PA 2ASJA 1RK8A 1DURA 2ILZA 2UXCF 4DV6F 1LK5A 3X1LB 1SH3A 1HNIA 4HDGA 5LSRA 3CCZA 4NLGA 2CVEA 3OXFA 4OHVA 3NGKA 3IWXA 1JLFB 3NGDA 2ZOMA 4WU2A 4ED3A 3M1VA 2HAIA 4TYAA 3HP6A 1MNEA 3KFWX 1Q8LA 3MMJA 5M2RA 4YB6A 1JLGB 4Q7AA 5D3GA 4DL7A 3FQLA 5G4DA 3MGJA 1G6BA 4ZPBA 2GHWA 4C8MA 4B9VA 1FD2A 4XAKA 1FRHA 3MD3A 4ECRA 4ED1A 2HS4A 2M8DB 4IH5A 3CJKB 1BQXA 1FRXA 1DTQA 2YWEA 3GSDA 3QZ8A 1FA0A 2OTJS 4IOBA 1D0EA 4J9MA 5GAGU 1IUJA 3M1VB 3SDEA 3O2IA 4B9SA 5K8MA 1S1XA 1H2VZ