1HNIB

Structure of hiv-1 reverse transcriptase in a complex with the nonnucleoside inhibitor alpha-apa r 95845 at 2.8 angstroms resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of HIV-1 reverse transcriptase in a complex with the non-nucleoside inhibitor alpha-APA R 95845 at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 100
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hniB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniB03
4ECYA 4ZPBA 4IFYB 4RNMA 4JV2A 2HMIA 3HVTB 3NGDA 2IJFA 4H4OB 5J2NB 2YKMB 1RA6A 3H40A 4EEYA 2V9WA 3KLHB 3RB6A 3DRPA 3MR5A 4URGA 4IH6A 3IRXB 2IAJA 2XWYA 3DI6A 3BREA 5DG9A 3I0RB 3MF5A 1JLAA 1LW0B 5J2PA 4I2PB 3KLFB 2D41A 2W8LA 4ED2A 3QZ8A 4RW8B 1RT1B 5KFXA 2UUTA 1JX4A 2RF2B 4O3SA 3T1AA 1C1CB 5C5JA 5C25B 2UVUA 3JYTA 1YVFA 3T5LA 2BANB 3CDWA 1SUQA 3LAMA 1S10A 3MTKA 3H5XA 3PW4A 1TQLA 3QLHB 3V6KA 4QWDA 1S9FA 3C6TB 2JEIA 4LSNA 2IMWP 4WFXA 4NLGA 5CYQB 3KMSA 2FJWA 2WK4A 3H5UA 1RT2A 3V4IB 4XPCA 2OPRA 3OL8A 4ECUA 2YNFA 4X2BA 2OPSA 2FVPA 1RYSA 5C24A 2FJVA 2JC0A 2WRMA 2XI3A 4O44A 5DLFA 4R5PA 2ZD1B 5EUHA 4KAIA 3MEDA 4ICLB 2OPQB 2W9CB 4O4RA 3IGVA 3Q8PB 5K14A 5I3UA 5J2MB 2WHOA 2IM2A 1TKXA 4M94A 4F4ZA 1HPZB 2VG7A 1HQEB 3DYAB 2VA3A 1IKWA 4R0EA 2OH2A 2HWIA 2R2RA 1FK9B 4MK8A 1IKVB 3GQCA 4TQRA 5F8MA 2F8EX 2B5JB 5JXSA 3BGRA 5D3GA 3M9MB 4WZMA 2HNDB 3D5MA 4IRCA 1DTQA 1CSJA 1HMVA 4QWBA 3BJYA 3DRSA 2AGQA 1S9GA 1EETA 2YNGB 4IFVB 2IBKA 5DQGA 3KNAA 4K4VA 2AGPA 3I5BA 1RDRA 4XPEA 3IGNA 3QIPA 4PQUB 1LWFA 1T3NA 1RT3A 4B3OA 2W7OA 4Y34A 1S6QB 3UPFA 4EYHB 1RTIB 4O3OA 1MU2B 2IC3B 3ISNC 3C6UB 4HKQA 5JUMA 2WB4A 2YKNB 1XR6A 2BE2A 2VG6A 2W9BB 1HNVA 4KBIA 3NKYA 2ATLA 4K50A 2ZE2A 4RNHA 1KHVA 3JSMB 5KFLA 4U6PA 5KFJA 4G1QA 3KOAA 2OPPB 4NLXA 5L1JA 4ZP9A 5KG4A 2HNZB 4URQU 3V6DB 4IG0A 1OS5A 1T03B 3KLVA 3RB4A 4ZMMA 2IM1A 5KFFA 4I7FB 5KFUA 1HYSB 4QW8A 1GX6A 4J9MA 5L1LA 4WE1B 4IRKA 1S1XA 1FKOA 4EO8A 4MK9A 1DTTA 3I5CA 5HP1A 3DRRB 3GIJA 1C0UB 4F50A 3CWJA 1NNDA 3QYYA 2XGQA 4DL3A 3OSPA 4KO0B 3UQSA 4ZVGA 3BSNA 2C2EA 4KE5A 3KHHA 3I5AA 1KLMA 3DLKB 2V4QA 3M8QA 4O3PA 5KG5A 2C2DA 3IG1B 4IG3B 4IDKA 4MFBA 1S1VB 3FRZA 2C2RA 5L1IA 5DG7A 4KV8A 5C42B 4J9LA 1HNIB 1RT5A 3TAMA 1I6JA 2AQ4A 4ZP6A 3V81B 3BQ1A 5F8NA 4KKOB 3H98A 3LANA 3QO9A 5CYMA 3KLEB 4QPXA 1LWEB 1RTDB 1HQUB 1ZTTA 1JLEB 3DLGA 3DOLB 3HVWA 4RW6B 3T5HA 4QWCA 2J6TA 2FJXA 3KHGA 4RUCA 4DL4A 4K4TA 4RW9B 3H5SA 4NYZA 1S0MA 1IM4A 1N56A 2I5JB 5DG8A 3PW7A 4RW4A 3G6YA 1JLQB 1N6QB 3M9OB 1KHWA 1Z4UA 1EP4B 1BQNB 5L1KA 4Y3CA 3E01A 3I0SB 2YNIB 4ZHRB 1QE1A 4NRUA 1REVB 3KLGB 1RTJA 3H4BA 5F9NA 4ECRA 1RT6A 1TKZB 2YNHA 2ASJA 2FLNA 3DM2A 2J6UA 4KFBB 4M95A 3HVAA 1RYRA 2ILZA 3BSOA 5KFQA 4WXOA 1T05A 1SV5B 4R8UB 4F4XA 3KK2B 1TL3B 2DPJA 1IKXB 3MEEB 3RBEA 3QGHA 3LP1A 2B6AA 2BRLA 2WCXA 3CJ5A 1JLBA 1VRTB 3DOKB 1N48A 1LWCA 3RAQA 4KHRA 4K4UA 4PWDA 4FBUA 4RW7B 5DGAA 1JLCA 3CDUA 1BQMB 4YQWA 4WFZA 2RDJA 5HBMA 4JV1A 4PUOB 1S1TA 3HKWA 4FS1A 2XCPA 2VG5B 4ECZA 4NLTA 5I42B 1C0TA 1VRUB 4MKBA 3OLAA 2WONA 1U09A 2AGOA 5KFGA 3H4DA 1JXLA 1S1WA 3LP0B 3FSIA 3KLIA 4NCGB 2WOMB 3E51A 4ZPDA 4I2QB 3FDSA 5HLFA 4PQUA 4IH7A 4IR1A 1UWBA 3FFIB 1N5YA 1S1UA 2HNYA 3LALA 1JLFB 4DG1B 4YP3A 4G3IA 1QAJA 4O4GB 1TVRA 2IM0A 5F8HA 4WYLA 4NLDA 4TY9A 3BQ0A 4K4XA 5KG3A 1RAJA 2O5DA 4ID5A 1S6PB 1LW2B 2E9TA 3MEGA 1TL1B 5J2QA 4ZPAA 1TKTB 5J1EA 3EPGA 1TP7A 1RT7A 1S9EA 3IS9A 2GC8A 4LQ3A 2FVSA 1IKYB 1S4FA 3MR3A 3H5YA 4WYWA 3NBPB 3FQKA 3PHEA 3DLEA 2UVWA 4KHMA 4YR2A 3FQLA 3CVKA 3OLBA 5KT2A 4ED6A 4O3QA 3H59A 1XR7A 1SH3A 1W25A 4KB7A 2ALZA 4Y2CA 2HMIB 2CKWA 3KK1A 5KFZA 4TXSA 3N6LA 3DRPB 3DMJA 1T94A 1ZETA 2BR0A 1R0AA 2IAJB 5HROA 2V4RA 1MMLA 3DI6B 1RTHA 3OSNA 1JLAB 5J2PB 5KT6A 4DL6A 3CJ4A 3KJVA 4RNNA 1DLOA 5KFRA 5KG2A 1S0NA 5KT4A 3OL7A 3M8PA 4LSLA 3JYTB 4TY8A 3QGIA 4NLQA 1JKHA 1SUQB 1RT4A 4TYBA 4ECQA 3MECA 4ED7A 1JLGA 2R8JA 5EWEA 3N6MA 4LSNB 4DL2A 2RKIA 3MR2A 5KT7A 4Q0BA 1RT2B 2HAIA 1C1BA 1NHUA 3N6NA 2OPRB 3GV8B 2YNFB 3KMQA 2OPSB 2B43A 4K4WA 5C24B 4H4MA 1FKPA 4O44B 2R2UA 2JC1A 4MIAA 4R5PB 4NZ0A 3MEDB 1TV6A 3KK3A 3RAXA 3D28A 5K14B 5I3UB 1GX5A 1TKXB 3LP2A 1D1UA 3QGGA 3BQ2A 2VG7B 4Q44A 1J5OA 4NLPA 1QAIA 1IKWB 3ITHA 4J9RA 5KFNA 2AWZA 5L9XA 3UDLA 3EPIA 3BGRB 4IFYA 5KFKA 5D3GB 3HVTA 4WFYA 2ASLA 3PJWA 1DTQB 4H4OA 5J2NA 2YKMA 1HMVB 3PJXA 3DRSB 3KLHA 1S9GB 1EETB 5FDLB 5DQIA 5KFDA 3IRXA 5DGBA 2WTFA 5KFEA 3I0RA 2XGPA 4NLWA 1LW0A 4ECXA 3QIPB 4I2PA 3KLFA 4TYAA 4RW8A 1RT1A 3BSCA 1LWFB 4MKAA 4IR9A 4GC7A 2FVRA 2RF2A 4ZVHA 1RT3B 4B3OB 4ECWA 2E9ZA 1C1CA 5C25A 3G6XA 4LQ9A 4GC6A 2BANA 2AX0A 4ED1A 5KFSA 1HARA 5KFOA 1SH0A 4NLSA 2BE2B 3QLHA 3T19A 2VG6B 3C6TA 2IM3A 4EO6A 1HNVB 3PR4A 5F8GA 2XC9A 3MFHA 4F4YA 2I1RA 2ZE2B 5CYQA 4DL5A 1S48A 4ECTA 3PW2A 1RA7A 4RUAA 4G1QB 3V4IA 3ISND 3Q8QB 4NLOA 2AX1A 5KT5A 4IG0B 5EWFA 4YMEA 2ZD1A 3M9NB 4ICLA 2OPQA 1C2PA 2W9CA 3NL0A 5EWGA 5J2MA 1S1XB 1FKOB 4NLYA 5KFCA 1HPZA 1DTTB 1HQEA 3DYAA 5HP1B 5KG7A 3KHRA 4RNOA 3SI8A 1FK9A 3CJ3A 1IKVA 4ED0A 2R2SA 5KFHA 1SH2A 2C22A 2B5JA 1JIHA 4EBEA 1KLMB 2HNDA 3GILA 3M8QB 3UR0A 2FVCA 4IDKB 4MFBB 3PR5B 5KFVA 2YNGA 4IFVA 2C28A 2IA6A 3PW5A 2BQ3A 4KV8B 1RT5B 3TAMB 2R8HA 4TLRA 4EYIB 1ZTWA 3NAIA 4NRTA 3QO9B 3QIDA 5CYMB 3BSAA 4ZP7A 2R8GA 3DLGB 1S6QA 4QW9A 4HYKA 1RTIA 3Q8RB 1MU2A 2IC3A 3C6UA 3RB3A 2YKNA 4RW4B 4NLVA 2VA2A 2W9BA 4TN2A 4Q8FA 3E01B 3JSMA 4YR0A 5F8IA 1S0OA 2OPPA 2J6SA 4FBTA 2HNZA 1QE1B 3V6DA 4J9PA 1RTJB 2V0NA 3CIZA 2YNHB 1RT6B 1T03A 2HWHA 3DM2B 3GV5B 2XI2A 4I7FA 3PZPA 3OHAA 1HYSA 4WZQA 3SFGA 5KFWA 4WE1A 3CO9A 2RDIA 1T05B 1NHVA 2UUWA 3NMAA 4Q45A 5T14A 3GV7B 3DRRA 4IH5A 1C0UA 4ECVA 3LP1B 2JEGA 2B6AB 3BR9A 2E9RX 2FVQA 3CDEA 1JLBB 4KO0A 3RB0A 3CJ2A 1LWCB 4WXWA 4XO0A 3OHBA 3KHLA 4PWDB 4F4WA 3GYNA 2JLEA 3DLKA 5DQHA 1JLCB 3IG1A 4IG3A 3GIIA 1S1VA 3G6VA 5HBMB 3PVXA 5KFMA 5KT3A 1S1TB 5C42A 1HNIA 3G86A 4QWEA 2UVRA 3V81A 2QE5A 1C0TB 4KKOA 2WONB 4J9NA 5FDLA 2AU0A 4ZVEA 3KLEA 1LWEA 1RTDA 3MR6A 1HQUA 1S1WB 1JLEA 3DOLA 3KLIB 1S49A 4RW6A 3T5KA 3GIMA 5HLFB 1UWBB 1N5YB 4RW9A 1S1UB 2IJNA 1N4LA 3H2LA 2I5JA 2HNYB 5KFIA 4IQXA 2FLLA 1JLQA 4K4SA 1N6QA 1EP4A 1BQNA 3NAHA 4DEZA 4TQSA 2R8KA 1WNEA 5KFAA 1TVRB 3I0SA 2QV6A 5KFPA 2ASDA 1D0EA 2YNIA 4ZHRA 4ZP8A 4ED3A 1REVA 5F8JA 4ID5B 3KLGA 3T5JA 5KFTA 3MEGB 1TKZA 5J2QB 4KFBA 5J1EB 4ZPCA 3IN5A 2DPIA 3CJ0A 1RT7B 4IOBA 1S9EB 3IS9B 4NLRA 2W9AA 2FLPA 4ECSA 5KFYA 4R8UA 1SV5A 3OL6A 4ED8A 3DLEB 3KK2A 1TL3A 4JUZA 2JEFA 1IKXA 3MEEA 4OL8A 5F8LA 3V6HA 1VRTA 3DOKA 1K1SA 3MFIA 3TQ1A 2D3ZA 2GIQA 4J9QA 4O3RA 3KK1B 4KSEB 4U7CA 4RW7A 5KG1A 3V6JA 5KFBA 5KG6A 3DMJB 3LAKA 1BQMA 1R0AB 5HROB 4IKAA 4J9OA 4O3NA 4EBDA 4DL7A 2JEJA 1RTHB 3Q8SB 4PUOA 3DDKA 5KG0A 4RZRA 4QWAA 1S97A 4FS2A 2VG5A 2D7SA 3KJVB 3PW0A 4Y2AA 2W8KA 1DLOB 5I42A 4J9SA 1VRUA 4RU9A 4H54A 3M8PB 4LSLB 4TY8B 3ICLA 1JKHB 3LP0A 1RT4B 1QUVA 4URSA 4NCGA 4RNFA 2WOMA 5DLGA 4J9KA 4I2QA 2GIRA 3MECB 4K4YA 3FFIA 4IRDA 5EDWA 1JLGB 4EBCA 4NLUA 1JLFA 4MH8A 2RKIB 2BQUA 4DG1A 3QZ7A 3SFUA 4MK7A 4Q0BB 4O4GA 1C1BB 3EZUA 2W7PA 2R8IA 5F9LA 3VQSA 4H4MB 1FKPB 1S6PA 1LW2A 3GIKA 2UVVA 2D3UA 4Q8EA 1TL1A 2ZKUA 4MIBA 2EC0A 2R2TA 3HHKA 1K1QA 1TKTA 1TV6B 3KK3B 4Q43A 2XCAA 2ILYA 3RBDA 3OL9A 4YR3A 3LP2B 4ZVFA 3TVKA 4K4ZA 1XR5A 1IKYA 1J5OB 2BRKA 3NBPA 3ITHB 2BQRA 4JV0A 2CJQA
chains in the Genus database with same CATH superfamily
4LIRA 4GKJF 4IFYB 3NGDA 5J2NB 3H40A 2YKMB 3ENWA 2D3OR 1B0TA 1SC4B 1HBUA 2JVRA 1VHFA 4X4UA 4L3KA 2RT3A 4RW8B 5H9FJ 3H5XA 3QLHB 1GXUA 1OQ6A 1IQTA 4OZ0A 3QT5A 1PO6A 2YNFA 1PYSB 3C66A 3L3CA 3QAUA 1QLNA 2YQ1A 4OYIA 3DYAB 1TFWA 2R2RA 3K8VA 4ZCKA 4B9LA 2F8EX 4FYVB 4DQSA 2EG1A 1VQ5S 1L3TA 3HHLD 1P8GA 2CPIA 4C8NA 5ETKA 3ILOA 2MKJA 2AZ1A 1U26A 2E5JA 3MM9B 4EK2A 4DQIA 2WVEA 5A8WA 2HVHA 1HNVA 2CQ1A 3JSMB 1GXTA 2HHHJ 4PXCA 2AHOB 1VBXA 1UEKA 3ZZZA 3D7SB 1X8DA 1RACB 1JB0C 4OJ3A 3BSNA 2ZJPQ 4KPYA 3I5AA 4OI3A 1OO0B 4JI7F 4FKYA 3MR7A 4X84A 4OJGA 4B9TA 3TEGA 3KLEB 4RW6B 2FZKB 3LO3A 3QMQA 4RUCA 1PBUA 3MD1A 3CT9A 4DLEA 1HR0J 5L1KA 2XMTA 2BZ2A 2YNIB 1S7HA 4NRUA 1RTJA 3HXMA 2V2QA 1HHSA 1T05A 4R8UB 4MAKA 2XLKA 2B6AA 1NK8A 3CJ5A 2L9NA 1ACMB 2BJ7A 1BQMB 4JI8F 4DR5F 1UCNA 4K8RA 3MDFA 1ZZFA 2DYAA 2JSXA 3NLCA 4LSZB 2N4DA 2O66A 1RBOB 1GNKA 4P75A 2PI4A 2KRRA 2YWEA 3MPVA 1RT7A 2HQIA 1B0VA 5E2QA 3IS9A 3CO0P 4ES2A 1HI8A 2HPUA 5E3CA 3I55S 1YJVA 3HHEA 2EVZA 4UOGA 3EVOA 1DLOA 5KFRA 5HANA 2DITA 2FHOB 3MCSA 2MKCA 4A8KA 3V4MA 3GU0A 2NXNA 5KT7A 5B09A 1JNZB 3GV8B 1HD1A 2MGZA 2I2YA 2MQOA 4RKUC 5D78A 3F41A 4P2FA 2K7KA 1TELA 3MWBA 3OBIA 3QGPA 3VALA 2IVYA 4CO2A 1V3RA 2LDIA 1EETB 2WTFA 5IT9Y 1N32F 4I2PA 2GVZA 4UQTA 5A0YA 2DIVA 1E6VB 4F8RA 4QU7A 3C6TA 1S48A 1RA7A 2ZFHA 1SJQA 2HFZA 4I1TA 1NH8A 1YK9A 1FKOB 2OMOA 1HPZA 5GAGI 3EX7B 4RNOA 1IKVA 2MJNA 1H6KX 3A3NB 4LRAA 3QFHA 1G2EA 2VKZG 3VAGA 3FCHA 3MAAA 1ZTWA 1FEEA 3CD5A 3PHTA 3QO9B 6AT1B 2V4JB 3RB3A 2VDHA 3OJUA 3KJQB 1FCAA 3HULA 1T03A 2J0XA 2VBZA 3GV5B 1HW8A 2Z56B 5EX3A 3QJJA 2RDDA 2W25A 1S5ZA 3RB0A 2BM1A 1RCOB 5DQHA 2RVJA 2VC0A 2R7XA 3W5ZA 4ECTA 1N33J 3K2YA 2F5GA 4L74A 1IBKJ 1VBKA 1EP4A 4OHWA 4P71A 2CIMA 2O67A 2Y1IA 3NNHA 2XY7A 1X4GA 1TK8A 4RJVA 1YIJS 1KVIA 1S9EB 2DR8A 1J27A 3CJSA 2GGPA 3TUPA 1VRTA 4PWUA 5B0BA 1YX2A 3KK1B 4GO7X 4ZLLA 2L9WA 2HW3A 4EBDA 5F3TA 1O6XA 2PFDA 4QWAA 5D0GA 3HZGA 3JSBA 3DLLQ 2CUYA 4CNYA 1Y10A 2E1AA 3CW2C 4H4KA 4WIIA 1JLGB 1YKWA 4DG1A 2RMLA 3BPSP 3PCOB 1S0VA 4Q0BB 2HKEA 2DB1A 1L3UA 4Q8EA 2EC0A 2KHCA 1NAQA 1K1QA 3O6QA 2XCAA 1CJTB 5EN1A 2DNGA 1TK0A 3CMES 4ZVSB 1O51A 2EG2A 4I68A 1RA6A 1VHIA 3PYGA 3MR5A 2IAJA 3CSKA 2XWYA 4IQMA 1LW0B 1TKDA 3T5LA 2BANB 4ZPTR 1IQZA 4JYAJ 4YY3J 1T9VA 3QWPA 1RT2A 3RG6A 3M8SA 5C24A 4O44A 1HLWA 2IM2A 1U24A 2OH2A 3GQCA 1K0VA 4OZ5A 2HNDB 4YDXA 3GCXP 3PYEA 5DZ6A 3VVTA 3Q89A 2QA2A 1WWHA 2RS2A 8AT1B 2OMLA 2OGUA 2ZE2A 4FF4A 2KZZA 2A2DA 4NLXA 3VR1A 4ZP9A 2C2ZB 4CLZA 3VCDA 2DR7A 1UFKA 4NEZA 2BDPA 4RLEA 4A48A 1A9NB 3OSPA 4KE5A 3PRBA 3KG0A 2KTQA 1MROB 4KV8A 2PO4A 4CLPA 1HNXJ 1AYEA 2RE1A 2J6TA 4A8YA 4PQAA 2BJDA 1N56A 3NY0A 1AFJA 1FRMA 1KHWA 1Z4UA 1RWNB 4WK3A 2ZBQA 1HD0A 3H4BA 2FLNA 3BGUA 2QT7A 5CD4H 3F0NA 1SV5B 5HMZA 1I3OB 1YZ7A 4PWDA 3W1YC 2ZH5A 2KJVA 3UDEA 1P1TA 4NLTA 1VRUB 2MMYA 5CCMA 1T3OA 4ZJOA 3LP0B 3ILLA 2AIRB 1N5YA 4DCPB 2QFJA 1UP1A 4WU3A 3C16B 4NL5A 4JI5J 1RWKB 4NZ6A 4FVCA 4ID5A 4LFAF 5IS2A 3CD0A 3L95X 3CJQA 3LWMA 5DDRC 4USMA 4P2SA 4DHVA 3J7YU 1LKZA 2VPYB 1RCXB 1WC6A 4Y65A 3K5PA 5HMWA 4WCEQ 2O1PA 1FJGF 3MR2A 4OX8A 5CAAA 1H38A 3J80U 4XDDA 2YWGA 3RAXA 3H2UB 3BQ2A 1LNQA 1R8PA 2YWHA 3UDCA 3UCGA 2YX7A 2ASLA 1NB7A 2RUSA 1NK7A 3SBMA 5KFEA 3I0RA 2XGPA 3CXCR 4FYXB 1LWFB 2DH7A 2UUAF 5D4LA 3LTOA 2I1RA 3K5OA 4WTOB 4ZK7M 4DV5F 1H2UX 1KOOA 1XERA 1EAYC 1Q0NA 2CNKB 1S59A 2Y3YA 1HNZF 1NK4A 5I3PA 1G7CB 3T9NA 1RTIA 4KYZA 5AE1A 1AZSB 4CDIA 3ZZRA 2HNZA 3HD1A 3M8WA 3V6DA 2F4VJ 4F7VA 4DSEA 2QA4G 3T1HF 3M1VB 2Q43A 2RDIA 2PDAA 4OJ1A 4WXWA 4CI0B 1ZPVA 1JLCB 1S1VA 2E5IA 4X65J 3MURP 1RQ0A 3FZ2A 3D3CJ 3Q8VA 5HLFB 3C2PA 4K4SA 1LXJA 2HBRB 5KFAA 4ED3A 5F8JA 1QD1A 1TKZA 4ELVA 1K73T 2B7BB 4PG5A 3TZWA 2HHQA 4MKYA 3OL6A 1H2TZ 4LFBJ 1X4FA 2H5IB 3VZHA 3Q8SB 4RZRA 4ELTA 2VG5A 2JZ5A 3PW0A 1VS3A 1NKCA 2BMBA 1V3ZA 3RZAA 3DDNA 4K4YA 1SKWA 2LYVA 2UXDJ 4A8WA 4U9RA 3M2VA 4P72A 1VQOS 4LF5J 1NZ8A 3BKTA 2R2TA 3R7SB 1MMNA 1ULRA 3TVKA 3ZTRA 4HTJA 1XR5A 3BGLA 2Q1LA 4X4PA 4E8UA 2MSSA 3UW1A 1QY7A 4H4OB 4A8SA 5AJ3F 1H7XA 3IRXB 4B02A 1RT1B 3MMCB 1RLDA 3NGSA 4F4AA 4DCJB 2DNHA 3PACA 3OJSA 1IWAA 2VONA 4F04B 4PEOA 4UZBA 4MYUA 3N9UC 2PC6A 2LDYA 4DUYJ 1WHVA 2HWIA 4MK8A 2DTJA 1B70B 2UU9F 1DJ0A 4LF7F 3UFCX 1BHNA 2AGPA 3OTOF 2PGCA 2G1DA 3M32A 4ANDA 4O3OA 2IC3B 2VG6A 3C8YA 2QG9B 4DF8A 2IRYA 2NUUG 3MD3A 4ZMMA 2IM1A 2CZ4A 4OZ1A 4LF8J 1AT1B 3OUYA 3GIJA 4GRSA 2K3IA 3L7OA 2CJ9A 1H73A 1KLMA 3MM8A 2J7KA 1EQMA 2E5LJ 1SC1B 4C97A 2CA9A 1U2CA 3C3LA 4KJIA 3PO4A 5B08A 3N5BA 3U1MA 5L9NA 2GQCA 1ZAXA 1SJ3P 1S0MA 5DG8A 8RUCA 1JLQB 3U7JA 2AJ0A 1YZ6A 2YTCA 2ASJA 2WSEC 1TUVA 5ETLA 3WDOA 1RISA 1KWMA 1EKSA 4JOUA 4X4OA 5HL7Q 4KHRA 2I38A 1A6LA 2F8HA 4DX7A 2BW2A 3U27A 2A1BA 1SBRA 1W2BR 4CT9A 3CJ8A 3CCTA 4IH7A 2W1BA 3GFXA 2ZH1A 1SKRA 5G4DA 1D8ZA 2IM0A 3DLJA 4TNOA 2CQIA 2E9TA 1FD2A 5HVFA 3TA0A 4CIOA 4BC7A 1RWXB 1X0FA 2NZ4A 3DLEA 5H9EJ 1N36J 2XNQA 4X4SA 3SCLE 5KFZA 2V2KA 2BJ3A 4NYOA 2DRBA 3M8PA 1JKHA 3R5CA 1MW7A 2DNKA 2JFDA 2ZBCA 3R5AA 2GCFA 1FESA 5H9EK 3KMQA 2M7SA 4XTTA 5L39A 2EK6A 1LEOA 4J9RA 2LVWA 4IFYA 5J2NA 2YKMA 3VF0B 1FDBA 5DQIA 2VQFF 3PG9A 3QRRA 4RW8A 2C3YA 2P5VA 4P2MA 2HFSA 1CULB 3QLHA 3BYPA 2IM3A 3PR4A 1RHKB 2J9EA 3PW2A 3LF0A 4RUAA 2VHGA 2AX1A 1YRXA 5AXMA 3EE3A 1DTTB 3DYAA 5G0RB 5LMUF 4QIVA 4KQZA 2AJ4A 2G1HA 2K2PA 1NH7A 1GMWA 1RT5B 3KWMA 4EYIB 2XO6A 2ZWOA 3MM9A 5GAHU 4CYUB 1KVJA 1SJ1A 2X1GA 1CC8A 3R7BB 1F9FA 2HIYA 1XQIA 4DFKA 2MZQA 3JSMA 7FDRA 5F8IA 3ZTQA 4ZLPA 1HNWF 3H90A 2V0NA 1HI0P 4QR0A 1XNQF 3OHAA 1J2VA 4AD6A 1U6ZA 1OIAA 4UUXA 2CPEA 2QSWA 2WAQD 2HSEB 4NA2A 3NOGA 5HBMB 2GQQA 2XLJA 3GB0A 3KLEA 3DXBA 4RW6A 2JH3A 2C3MA 3DC2A 2FIUA 2ZKTA 4RBUA 4IOCQ 1MN7A 4I4BA 2YNIA 4ZP8A 4DPTA 5J1EB 1X5TA 2FLPA 4ECSA 4R8UA 2JEFA 2D3ZA 2LMIA 2L9DA 1IWGA 3VQTA 3DMJB 1BQMA 1SKUB 3R6GB 5FJ4A 1IBMF 4EZ6A 4JI0J 2H5JB 3MEKA 3KJVB 4Y2AA 2W8KA 4RU9A 3THVA 2DHXA 2DK2A 2EFQA 4M5GA 4ETXA 1M1HA 3WQPA 4EBCA 2RKIB 1NK6A 3MZIA 4I67A 3AQOA 3EZUA 3CCSS 2KHDA 2H9ZA 2U1AA 3RUBL 2HURA 4YR3A 4X4QA 1RWOB 3LH2S 2R9LA 2Y1LB 5FIIA 2VASA 3ZZPA 3W2VB 4HH1A 2V9WA 3G2XA 1UFWA 1UVMA 4DV3F 3AOAA 4USWA 4Y2MA 1NKEA 4UF4A 5CYQB 4L73A 2XEXA 4RUBA 2NPFA 2Z58B 1WDTA 2HHTA 1WKLA 1RYSA 5DLFA 2PD1A 1BY9A 4ZVTB 3AXKA 2FB0A 2AJQA 2DGSA 1EETA 3G4SS 2G2OA 3TOQA 1WC3A 3A12A 3TA1A 4CH0S 3C6UB 4ZJLA 1T95A 2CJBA 3JAMU 2W9BB 4KBIA 2J76E 3EUNA 5L38A 8ATCB 1S6OA 3KOAA 2OPPB 3KLVA 3WC2A 5KFFA 2DR6A 3W66A 4DR4J 1FKOA 1Z2ZA 2AYEA 1NNDA 2OFGX 3FMBA 1NSQA 2IHR1 2CPHA 1H7WA 4P10A 5DG7A 3CB4A 4OZ3A 4N41A 1O0PA 3QO9A 1CVJA 4QWCA 2YKOA 2V4JA 4K4TA 2AJ1A 4I0WA 1N6QB 4NYPA 4GVBB 3TX8A 1ZS6A 4GKJJ 1HHTP 3CPWR 2N4CA 2CWXA 2BBEA 5IM0B 3RGIA 4L6V3 1LWXA 3QT8A 3MMBB 4K4UA 2CQHA 2M8DB 1KQKA 5JVHQ 3VWSA 3HKWA 1U6BA 3ZZ0A 2ZZTA 1U09A 3M6XA 3BKFA 4ZVQB 4IR1A 3A8JA 5BR8F 1M90T 3LALA 2H51B 4ED5A 4A47A 3OD2A 2VBWA 3R97A 2ZDOA 4K0KF 3TA2A 3IBFB 1TKTB 4DX5A 2LFVA 1S9EA 2J8AA 3H5YA 4B9UA 2UVWA 3HHNB 2MQNA 3KKFA 2HMIB 4U7UK 3KK1A 2H48B 3MGJA 4F4KA 1F9HA 2ATCB 2CZVC 5LM7E 1JJ2R 2IRUA 1JLGA 1OY6A 5EWEA 4Q0BA 1H98A 5U47A 3MEDB 1CJTA 4JI7J 3VZIA 4NLPA 2XYPB 4KGKA 1MG7A 2QIFA 2ZOFA 5KFNA 3UDLA 1U1RA 5B0AA 3NCRA 2E5HA 1EX8A 3W5YA 1LW0A 4ZN3A 3GONA 3DHWC 4ECWA 3P3DA 3W63A 2BANA 3BO2A 2E5GA 2VF3A 2H4WB 5ITHA 4DOZA 3M4XA 3WZ0A 4GVLA 2HGNA 3OFEA 1FXLA 1QSSA 1RAFB 4JI8J 3TARA 1S79A 2Z8QA 3FEXB 2OAUA 3SI8A 2MSTA 2HK2A 1JIHA 2HNDA 3M8QB 2C28A 1X4BA 2KU7A 3NAIA 2DGUA 3IO1A 1KDNA 2ZITA 2HRYA 2DGQA 4LREA 5A8KA 1UKUA 2A2CA 2IA0A 3DM2B 3B4MA 3J81U 1X5OA 4ECVA 2AJFE 1FRHA 3OVBA 1NLKL 1MROA 5SUHA 1RABB 3ULHA 1J5EF 4J9NA 5FDLA 3AHPA 1M1KT 1FD8A 3EYZA 2V9KA 2VUGA 3FVYA 3L4BC 2F9JA 2XYGB 2BJ8A 2FHMA 1N32J 5KFYA 1SV5A 3ENAA 3PY8A 3MCNA 2GIQA 4CTAB 4DDFA 4DN0A 4C8KA 2EWHA 2Y8YA 5CCLA 1VRUA 1WELA 4H54A 2CAJA 3LP0A 3HMJG 3SQOP 3C16A 3Q23A 1ZZNA 1NB2A 4M5NA 4Y2KA 1PG5B 2IVFB 1YJ7A 3AD8C 4K4ZA 1FRLA 1R0CB 4ERDA 2BQRA 1UVIA 2IJFA 3KLHB 1ZM4A 1N34F 1VBYA 4G65A 5H1SV 3HI9A 3T1AA 3P5TL 4WF9Q 2OP5A 2WK4A 3EGVA 1PYTA 2UZAA 3FSXA 4DPOA 2FJVA 2DCUB 2E7WA 2EFPA 2LU1A 2VIHA 4CWBA 2CG8A 3HF5A 2VA3A 4P52A 1SKSA 4RO0A 2FZGB 5HQ8A 2B5JB 2YWKA 3BJYA 5THWA 2IBKA 4N76A 2DGXA 3N0VA 5T41A 1WOPA 1LWFA 1EIYB 3CD6S 3WC0A 2V2VA 5KFLA 5LT5A 3PX4A 3OQ2A 1GEHA 1NUEA 1JQGA 4QW8A 3T1YF 2CPXA 4WE1B 2W4PA 1WORA 2VD3A 4DN9A 4USJC 1KN6A 3IG1B 3I87A 1SJFA 4DR2F 4ZP6A 1V6HA 3H42A 3CDBA 2ZEJA 4Q2LA 5D4OA 5EHHA 1AZSA 5M2RA 4CLUA 2BE7D 1BQNB 4WPAA 4Y3CA 2DR5A 3O5TB 3B54A 4ZHRB 2BM0A 5DDQC 4ECRA 3M1VA 3IWXA 4F4XA 4UZCA 4KRWA 1NM2A 3CMQA 3DOMB 4EUVA 2GQ2A 1JLCA 2LU2A 3HVRA 2ZH4A 4F3MA 1BD6A 1LV5A 4MKBA 1FERA 1UW4A 2B9XA 3H4DA 2WOMB 4B9SA 4I2QB 5HLFA 5J1NA 4RWXA 2QL7B 2HBQB 2MPUA 4V19J 2DNNA 3PYFA 4L3NA 2O5DA 1CJUB 5CQGA 4DR7F 2ZM6F 3NS5A 3OLBA 1DHMA 4O0IA 2ALZA 2JRSA 3JQKA 5J2PB 3P5BP 5KG2A 1Y4ZB 3G8QA 3QPIA 1RBLA 2RD5C 3MAHA 1S72S 4X4TA 1NDPA 2GJFA 2B43A 4MJKA 2R2UA 4KIAA 5K14B 1LK5A 4XDCA 4XK8C 3SCIE 3EVMA 3TJ8A 1VQMS 3GE9A 4H4OA 2F65A 2KDOA 4UQGA 3IRXA 4OZJA 3CC4S 4TYAA 1RT1A 3VAIA 4MKAA 3NGUA 3MMCA 1RT3B 2AX0A 4DUTA 3GJSB 1WEZA 4P2XA 4C8ZA 3WX4A 4OZ2A 1X4AA 2XTJP 3KHRA 3HM9A 4ED0A 3TYTA 2AW0A 3C46A 3GILA 2FVCA 3K59A 2LLZA 4PR6A 1CPZA 5LMNF 4S0MA 4ZLJA 4QIEA 2IC3A 1RAIB 3D4JA 4YR0A 2MQLA 1QDUB 4QIGA 2HRUA 5HO4A 1JMTA 4LFCF 1FTRA 4PCQA 3CDEA 1NDCA 1C4CA 1Q53A 4Y6IA 3GIIA 4U67Q 2GX8A 1ZM9A 1YJWS 1M5VC 1S49A 3KG1A 1NKBA 1JLQA 4J9UE 1WOOA 4DEZA 3IC1A 2F7VA 4ELUA 2CPDA 3EGWB 3TO8A 4DX6A 2G0JA 5HAOA 5F8LA 1F3FA 5KFBA 4EZ9A 1R31A 2BABA 4CCHA 1FEHA 1RLCL 1FXRA 2YVSA 2NPIA 3DLBA 1WEYA 4ZJQA 4IRDA 4NLUA 4F2RA 3SFUA 2UUBF 4DV5J 2PSZA 1L5UA 2R8IA 3THTA 3GIKA 2EBEA 3KK3B 1HA1A 4ZVFA 3TI0A 3SQGB 1HNZJ 2WW4A 4JV0A 4G1IA 4NA3A 3VVUA 1X4EA 3MI7X 1X4HA 2R7RA 5DG9A 5D15A 4J90A 4ED2A 1KR4A 2RF2B 5BXIA 2UVUA 3T1HJ 2FYXA 3VAMA 3K89A 4YB6A 2LQJA 2W4CA 3KMSA 1PGZA 1UVNA 2FDNA 4LRBA 3EJMA 3HHLB 2OTLS 1IJFB 5EUHA 4KAIA 3BF4A 4YHHF 3IGVA 3D6HB 2EK1A 4USHA 3HO1A 2N7CA 1CLFA 3MCOA 1TFYA 4A46A 1ZAVA 2DVIA 4DSLA 2XS7A 4DV1F 1P27B 2ZBRA 1S6QB 4HKQA 1CULA 2GA7A 4U6PA 5KG4A 4NCAA 3Q24A 1OS5A 2F8MA 2P6TA 1TMMA 5KFUA 1ZAWA 2FJEB 1U8SA 4O23A 2VPWB 5F0UA 1DTTA 3HSZA 5G0RA 4DL3A 4CNZA 1FA0A 3TZYA 2NQPA 1RT5A 2A0FB 3V81B 4FYDA 4PXEA 3W8PA 3H98A 2HGMA 3T5HA 4CYUA 3SXLA 4RUHA 4RW9B 5F41A 2K06A 3PW7A 3RRHA 3AY0A 1HBOB 3OW2R 1HFEL 1Q79A 1UTAA 3CCJS 1RI7A 4HLBA 4KH0B 1D8YA 5AJ3J 1Y5IB 2EC2A 2GHVC 1PAEX 2SXLA 1XMOF 2VV5A 2LEBA 2NCKL 5HBMA 2BJ9A 2OO4A 3OLAA 3I9V9 4NCGB 3IBCB 1U48A 1D9FA 1UVKA 2HLUA 4WYLA 3G82B 2IYGA 2ZDPA 4YOEA 5J1EA 2UU9J 4I6YA 4LF7J 2YWWA 3MM6B 3FQKA 1EZZB 3OTOJ 1PJ6A 2ZH7A 4I69A 1RWUA 4TU8A 2B56A 3HFZB 1T94A 3DMJA 1Y3JA 2V4RA 1PKUA 3MPWA 2EBGA 2EPIA 2BJEA 3KJVA 3W9IA 2XULA 1JJ4A 5KT4A 2PEHA 1QUPA 4DL2A 2RKIA 2B51A 2OPRB 1BGXT 4WFNQ 2OPSB 2RQCA 1IR0A 1XMQF 2JC1A 1VQKS 5MLCV 3QGGA 4PYAA 3JS9A 5D3GB 3W2VA 1T9YA 2V50A 1F3VA 1BLUA 2I8EA 4LR7A 4IR9A 1RHQB 5I3QA 3QT7A 4DX8H 4ZVUB 3MFHA 5CYQA 1KD1T 1S12A 2EFVA 4B3MF 2CPZA 4ZS6A 1WHWA 2QLBB 3IAM9 4CM0A 2KG1A 1EARA 2FHJA 1GH8A 2ZH2A 2BQ3A 5DZ7A 2GAGC 1U1KA 4NI2B 4ZP7A 4AT1B 2R8GA 5IQ6A 3HD2A 3C6UA 3AB2B 4RW4B 2W9BA 4TN2A 3PFOA 4N8OA 1K47A 2HZAA 2OPPA 2AYGA 1Q5VA 3KUHA 2DO4A 3FBFA 1U8WA 3LP1B 4IOAQ 2E66A 3OPKA 4M1KA 2DJWA 3AJ1A 3ETOA 1R8HA 4W4MA 3SSSA 3G86A 1NHKL 3I32A 2NXJA 4USUA 1N6QA 4GVBA 1PBAA 1WNEA 3T41A 5FLXU 5CZXA 2MZ1A 2GJIA 1UFLA 4ZPCA 5IM0A 2HYIB 2VQFJ 1WC0A 2HQDA 3UN2A 3I96A 2YKAA 1ZPWX 3MMBA 3CUNA 1UZHA 1WJ9A 2KKHA 3V6JA 3TJ9A 2KXHA 4LJMA 4CM2A 2HHWA 3DDKA 1VI7A 4FS2A 5ETOA 2CPJA 1UA1A 2OKQA 4LSLB 3TVZA 1QUVA 1RT4B 3QBCA 4OI6A 2L41A 2HFNA 5HMYA 2BOPA 4FF3A 3T6BA 2UVVA 2D3UA 2MKYA 4Q43A 1TKTA 3OL9A 3ITHB 3GFYA 4O0NA 2OSRA 1N5TA 2QN6B 2HMIA 4FXVA 3O2IA 4IYQA 2UUTA 1YITS 1YBAA 4BC9A 2I6WA 5HATA 3PW4A 1YJ9S 3HHDA 4WFXA 2HQ3A 1FX2A 2WRMA 1N5VA 3MEDA 3A8EA 2PN6A 1N0UA 1RAAB 1HQEB 1Q8KA 3MPDA 1I51B 2VPZB 3AT1B 2AGQA 2J7WA 3J7A1 1X4CA 1FE0A 3VAFA 2VICA 2DY1A 5E5NA 2XYHB 2M70A 2KRBA 4KHPF 1KTVA 2QA4S 3UPFA 3IR7B 3TAQA 2V68A 4DBQA 2B4UA 4X66F 1U0HB 2LA4A 2QMWA 3Q0AA 1HYSB 3P45B 4F0KA 1IBMJ 3JB9k 1AXQA 2VB6A 2MQ8A 3QYYA 3OTBA 1W7WA 1FO1A 3UQSA 3GJRB 1O8BA 2RNEA 3CC2S 3M8QA 2HGLA 4IG3B 3D0HE 5L1IA 5IOLA 3I6PA 3B4DA 1R43A 3JAMY 1JLEB 4J91A 4MYTA 4V19X 3H5SA 4QR1A 3OR2A 4OJHA 1FDDA 3DHXA 1QSLA 3K5NA 3DM2A 3MUMP 3E8OA 3CD7A 5B0GA 1NJXA 1F5CA 4DV3J 2B9EA 4JI2J 4KC5A 3RAQA 2LP4A 4ZOSA 3V5RA 2KT2A 5L8RC 2YH1A 3HFKA 1UEUA 1YJTA 3E51A 4ZPDA 1VLOA 3TQEA 4D3GA 4U8VA 4YP3A 4O4GB 3OV7A 3BQ0A 1VQYA 5KG3A 3CDAA 1VQLS 2BEFA 1YLXA 5CHCB 2UV8A 1S4FA 1FDAA 1UAWA 1RK8A 4LRFA 3AA8A 2JLGA 2B4PA 3TJAA 4CTAA 1U1PA 2BR0A 1MMLA 1S0NA 2HHPA 2DCLA 2P9GA 1FRXA 4ZIVA 4ECQA 1JXVA 2JLFA 3S1TA 3D6TB 2EFNA 1AB8A 4UOCA 4WJBA 1TKXB 1XBWA 3UVJB 4HHUA 3A13A 1IKWB 1HL6A 3MMAB 3EDRB 2HAFA 3KLHA 4ZPVR 5K8OA 2OEJA 4NLWA 2APOA 2FZCB 4GC7A 4L72B 4B3OB 2BOAA 4FYWB 3HPOA 4OX7A 1VQ4S 4X62F 4DV2F 1H72C 4WIQA 4I64A 1OWXA 2LQBA 4G1QB 3ISND 2HZCA 1U25A 2RRNA 3K7RA 5GADU 2P2CB 5AXKA 2QYGA 4ANEA 1VJWA 3MOZA 2D9PA 2HS4A 2XNRA 3CJ3A 4F0MA 2C22A 1YSJA 2B5JA 5BR8J 5GAEU 4MFBB 5DDOC 4ES1A 3KTQA 3PW5A 5L46A 1RKIA 4YB7A 4QBUA 4NRTA 1TAQA 4K0KJ 3DLGB 1AA1B 2X1BA 3GYXB 2HEKA 5F0WA 4Z2XA 2CFXA 3E01B 1GT8A 4N77A 4KGXB 2G2YA 4CLLA 1W26A 2W2PP 2HVIA 4WE1A 3D3BJ 2XMKA 4B3TF 2FVQA 1Y5LB 3ETMA 1IBLF 3IG1A 3OTCA 2UVRA 4ZCIA 1S1UB 3W64A 1N4LA 1WG1A 2H3EB 3PM9A 1BQNA 2MQMA 1NSKL 1N33F 2CQDA 4ZHRA 2ZH8A 4KH1B 1N8RT 4IOBA 4WU2A 1RP5A 3HSGA 1NDKA 1GFWB 4B3SF 3K57A 3DOMA 1N54B 5KG0A 4OFZA 1YGYA 3W9HA 1Q16B 3ICLA 2XHCA 2WOMA 4I2QA 3D68A 3M6VA 5E3RA 4LVNP 3HLUA 1CJUA 1I94F 5EGYA 1Q8BA 1N52B 5A6PA 2QJ3A 2N82B 4ILRA 4IH6A 1IXKA 3PKYA 2J5AA 2V94A 5J2PA 4FPRA 2K3KA 5KFXA 1OQ3A 1YVFA 3D1OA 4FNIA 3IP0A 1ZYQA 2JEIA 2IMWP 4LT6A 2EKNA 1FJ7A 2Z2LA 4O4RA 2VQEF 5K14A 5J2MB 2F63A 2XMMA 2DNYA 3GLJA 4YN3B 1J5EJ 2KJWA 2QLWA 3PEJA 1FJEB 4K2JA 3D5MA 1BE4A 4IFVB 5DQGA 1PIEA 3KNAA 1NJIT 3BH6B 4OZLA 3RW6A 2ZC3A 1RT3A 5JVGQ 3NEKA 2CQ2A 4DPXA 1OSDA 1MU2B 4FF2A 3KJFB 2EFOA 5JUMA 1UW9A 2MZJA 4CH7A 3I56S 2WBRA 3K0JA 4OYMA 1VQ7S 2XZDB 3PO5A 1RHMB 1WEXA 2K7JA 2XGQA 2DT9A 2ERRA 1F60B 3K17A 4ZDNA 3KHHA 1DY3A 4O3PA 1WI8A 2NSCA 2MYFA 2RHQB 1ZH5A 3LA0A 2QLJB 1QM9A 1HQUB 2QO3A 4DR6F 2UXCF 3M9OB 3C14B 4M5JA 1VQPS 2CDRB 3Q86A 1RYRA 3P8BB 3HK2A 2QC3A 3MOJB 2YH0A 1GQEA 1N34J 3KK2B 3DGVA 3W8GA 2BRLA 4JI3F 1N48A 3QJLA 2H54B 4CLWA 4LF6F 2ZOMA 4JV1A 2HG4A 5E41A 1U49A 4PRFA 3OVAA 1NMEB 1Z2LA 2ROPA 1L3SA 3FDSA 4A8QA 4PQUA 5A8RB 3FFIB 1HBNB 3FBEA 1JLFB 3F56A 2IPOB 4DU8A 4OHXA 3PHEA 2CRLA 1SH3A 1W25A 4OLOA 2GV1A 1R8AA 1Y00A 1GK8A 5K8NA 2FC9A 2DHHA 3IM9A 3T1YJ 2MY7A 4DLGA 2HAIA 1NJZA 1RWPB 2ZHAA 3GWCA 2J9DA 3KK3A 2ZJRQ 5I3UB 1GX5A 1U45A 2VG7B 4UOFA 3SQGA 1FX4A 2XS5A 2AWZA 3EPIA 2DNMA 4WFYA 1ROFA 1HMVB 2KI2A 2BKNA 4KR0B 2IMOA 4Z37A 3VAKA 2GHPA 3S6EA 5M2PA 3W2WB 1A7GE 2RF2A 4C98A 2DRDA 4F36A 3LGMA 1SH0A 2D69A 3X1LB 4EO6A 1KBRA 2XC9A 1VQ6S 3NS7B 3HHLA 3NL0A 3CCLS 5HP1B 3R8YA 5A76A 4C3KA 3TZZA 3N79A 2WVFA 1BWEA 1P9QC 4TLRA 4CO1A 4DR7J 1S6QA 3JTPA 2ZM6J 4DR1F 4F0HA 3AJDA 1FRKA 4CLYA 1ZA2B 1UWAA 3FCVA 4J9PA 2V8VA 5KFWA 2GW8A 2O01C 1NHVA 2KFYA 1DARA 3BR9A 4DCOB 3WIVA 5IC6B 1MMDA 1IUJA 1LWCB 4BWJA 1M1GA 4I56A 1NPKA 1S1TB 3IR5B 1YQHA 3V81A 2CNNB 2QX0A 3FC9A 4I6WA 1L3KA 4OYBA 4RW9A 2X1FA 2DD8S 1HBOA 3NAHA 2CADA 2YWFA 2ADCA 3ZO7A 4YB1P 2E7VA 3OFFA 4OYPA 1XN9A 4I6AA 1URRA 2W7AA 4RBTA 2OEKA 2DNLA 3MFIA 2WVDA 3FBCA 1QAYA 2AJ2A 2G2ZA 3H0PA 4TY8B 1I1GA 2GNKA 4NCGA 1IM6A 4F02A 2VU5A 4MH8A 2XMWA 3QZ7A 3UN3A 2DY9A 3MM7B 3G82A 3R6LB 1FKPB 3BGOP 1NK5A 5LXRA 1UPPA 3MM6A 1XTZA 2DHGA 1Q78A 4USKA 4ECYA 4JV2A 2C42A 1RXOB 4B08A 2MZRA 2NSBA 3CJTA 3UCZP 1FDNA 2GVDB 1U2FA 5C5JA 2LEAA 4AL6A 2V8HA 2QYCA 3MHYA 4CT8A 5A6WA 4LFCJ 1PAUB 4QWDA 1SL0A 1F5AA 2FJWA 3H5UA 4XPCA 4OHYA 2OPRA 2OPSA 2CQ0A 2XI3A 2I9SA 2CPYA 2OPQB 3OVSA 3DRYA 2MKIA 4DXLA 4DPYA 5D3GA 3M9MB 4IRCA 3NXZA 3PRDA 2BYCA 4NMLA 4K4VA 3AFGA 4YEAA 3QQCD 5HJXA 2MY8A 1T9UA 4Y34A 1ZBTA 4DV6F 3M6UA 5CXTA 2FY1A 4K50A 1NU4A 5HN0A 1KVKA 3B78A 3VAJA 4M5MA 5ETNA 1SIWB 4ZVRB 4CO5A 1RWMB 3Q2TC 1WG4A 2W2OP 1X5SA 3KNGA 3TANA 5FD1A 5GAGU 2XLIA 4PXDA 3FRZA 2OD6A 5C42B 2UUBJ 3AD7C 2AQ4A 4HT7A 4NI2A 4WKYA 2KL8A 1LWEB 1D9AA 2EW9A 4HL9A 4RW4A 3G6YA 4IO9Q 2RHSB 2RAQA 3M7VA 3BN7A 3US5A 1TTHB 2JJ4D 3PIOQ 1UETA 1ZM2A 1P9YA 2OEMA 3BGFA 4Y28C 1E6YB 1TL3B 3BM7A 3RBEA 2ZOGA 3LP1A 3DOKB 1Y7PA 4HHHA 4JI6F 4RW7B 3LUYA 4YQWA 3I9ZA 1ZA1B 4ECZA 3IR6B 1Y5NB 1JXLA 3FGVA 2C1EB 2N7YA 2CQCA 1VRQC 1AW0A 3RBXA 1CBKA 5ADZA 1U1MA 2HBZB 2C2MB 4M5KA 3OFGA 4NZ7A 2RS8A 1S6PB 3AD9C 1TL1B 3X3UA 1Q8LA 3MR3A 4QU6A 3NBPB 4WBFA 1M5KC 4JV5F 2CYYA 3H59A 1XR7A 4Y2CA 2CZ9A 1OJ4A 2VFSA 4DL6A 4UY85 4RNNA 2CQ4A 4LSLA 1SUQB 1RT4A 4KGVB 2CXEA 4ENOA 4HVZA 3BBFA 1XNRF 2NXUA 4K4WA 3BN4A 1F1BB 4NZ0A 1JJCB 1D3WA 4J5OA 5E3QA 3NWGA 1FFGB 1QAIA 3G8TA 1HWJA 3ITHA 1WD6A 2HHUA 3BGRB 2ZBIA 2AYBA 1DTQB 5KFDA 1T0TV 1U1LA 1WKKA 4WP3A 2FVRA 4ZVHA 4ALZA 3TRGA 1UJ4A 2RUGA 3S8SA 3H20A 1Q81T 4HACB 5E3PA 1NJWA 2NLWA 1XMOJ 4DPUA 2F40A 3BO3A 1S6UA 1S1XB 3HZEA 1HQEA 4PABA 3R7NB 3HHLC 3RTVA 4PG4A 3LPYA 3OR1B 4CQ1A 4TU9A 4P73A 2DO0A 1IVZA 1RBAA 1SC6A 3Q8RB 2DH9A 1OMSA 2QFIA 5M2UA 4Q8FA 4PAAA 1QE1B 2PI5A 1RE1B 1U0HA 1HBMB 2X3DA 1HYSA 3SFGA 3KDOA 2MTLA 3OT9A 2HVZA 4FP9A 3SCJE 1KKHA 2G0CA 1M5OC 4IG3A 4X64F 5KT3A 4DPWA 4BLGA 2QE5A 2LQ8A 1QAXA 1XMQJ 1JLEA 1CJKB 2QLXA 3QSYB 4M5IA 1Y3KA 3JSRA 2HNYB 3GFHA 4DFPA 3D2WA 4ER8A 1MN9A 3E3XA 3MEGB 3N28A 2KO1A 3CJ0A 1KLNA 3VGVA 4DV4F 2ZJQQ 4ITSA 4NXNJ 5KAKA 3M2UB 2RRBA 2DKOB 4JI1F 4QPTA 4RNFA 1R0BG 3OTDA 5FLXY 3VV2B 2MKHA 2V6AA 4O4GA 3W3SA 1M5PC 4F25A 2BW7A 2RU3A 1KQFB 3TX0A 2EKYA 2WBMA 4RNMA 3HVTB 2KM8C 2XG8A 1U4BA 3QZ8A 3M05A 2Q66A 1C1CB 2QA1A 4Z7CA 3FNNA 1S10A 3MTKA 4P7VA 4K5RA 3RW7A 5IV4A 4WWSA 3HJVA 2Q3PA 1DQ8A 2ZUAA 3GMGA 4ICLB 4ID8A 3JSYA 2HZVA 1TKXA 2O3DA 3UVJA 1Q7LB 1IKWA 3DLHA 3MMAA 2C3UA 2D74B 3ZXWA 1HIYA 2FJAB 5J1PA 4GKKF 2J8SA 1D09B 4JBCA 3AXMA 1LXNA 2V8DA 1FVSA 1Q4RA 4B3OA 4ZN1A 3EMTA 4LR9A 4Z7YA 4LBPA 3ISZA 2WB4A 2R7SA 2H65B 3FSYA 2Q6CA 3NKYA 4HDHA 1VC0A 1KHVA 4G1QA 3BS9A 1U1OA 1JNRB 3D0IE 4I7FB 5AT1B 1VC6A 4PZVA 2FGCA 3CWJA 3UNGC 5ETPA 3ZTOA 4FXWA 4KO0B 4C48A 2C2EA 3DLKB 2V4QA 1NCLA 5KG5A 4MFBA 2C2RA 1MSWD 4DI6A 4AFFA 2ZHBA 3A3OB 4QPXA 3DLGA 4OV1A 2AEMA 2AEJA 4NYZA 4HR2A 2RQKA 3E01A 3I0SB 3KLGB 5F9NA 4KFBB 2ILZA 1F2GA 1BC6A 5IXUA 5ETTA 3WX8A 2HHVA 3TR5A 2LQ5A 1KFSA 2XCPA 2QL5B 4DV7F 1S1UA 3DXSX 3EXCX 1FE4A 4LRDA 4TLQA 5DS7A 4F26A 1U2RA 3B8HA 4E98A 2KVQE 4EWTA 1XWLA 4KHPJ 5H9FK 3K8WA 4KB7A 4NMXA 4EGLA 2VOOA 3DRPB 5DM6Q 3DI6B 3SSRA 1KP6A 4X66J 4E0DA 3JYTB 4NWBA 3QT6A 4ED7A 2WVCA 1YG0A 3AAWB 1T02A 1T9XA 3GP9A 2LCWA 3E2EA 4R5PB 4CO4A 3RAMA 4HI1A 1D1UA 3RBZA 2M0GB 4F67A 1PSDA 2RB7A 5L9XA 1FWLA 3CEDA 2UXBF 3QRQA 3G6XA 5LL6d 4ED1A 5T7LB 4NLSA 2CJYB 5A2QY 3N01A 4DL5A 3P4UB 4FF1A 3Q8QB 4NLOA 4A8FA 4YMEA 1CS4B 1K44A 5J2MA 3CCQS 1L3VA 4Y00A 5KOWA 3PEHA 3IWNC 3BR8A 3UR0A 2HQCA 4IFVA 2AZ3A 4C3LA 1WHXA 2R42A 3BDPA 1SB6A 1RU1A 1OYDA 4HYKA 1MU2A 2HQFA 1NSAA 3CE8A 4OMFG 2MKSA 3GYGA 3VGTA 1M5SA 2GIFA 1SJ4P 1IJEB 5IQQA 4FYYB 4R0JA 4Q45A 2C3PA 3KHLA 3LW5C 1SPBP 3CF5Q 2P6SA 3PVXA 2J9DE 1VCTA 3MXHP 3BBBA 1HQUA 1S1WB 5IT0A 1MWQA 4DV0F 3FMWA 4HTIA 2M4MA 2UP1A 2MXYA 2FLLA 3RU0A 1AUDA 3IWLA 3C14A 2D1CA 3DRXA 5KFPA 4DFJA 1E6VA 1XMBA 2MHNA 3A8KA 2YXLA 2DPIA 3T6JA 4OHVA 3KK2A 3THPA 2IDEA 1FT8A 4W92B 1DZ5A 4X62J 5IWAF 4DV2J 3TUIC 1Q8IA 4MTPA 3J7YI 2PT0A 5HSPA 4C7QA 1U47A 2VBYA 2F9DA 4NASA 1DBDA 5IC4B 5DLGA 4AQYF 5A8RA 2YKQA 3FFIA 2GMHA 1HBNA 1JLFA 1ICEB 4F3QA 3OFHA 3EXYA 1TV6B 1FKAF 2KYZA 1J5OB 2H5EA 2AD9A 3R1HA 1K9MT 4ZPBA 4MT1A 7FD1A 3MUTP 2GJ2A 4URGA 1F5BA 3BREA 4DFMA 2XB2D 4HHJA 1WSVA 4P74A 3BO4A 5RUBA 2VJUA 4B3TJ 1IR2A 4ECUA 2FVPA 1IBLJ 3WIUA 2XMAA 2ZD1B 5I3UA 2DNZA 3J7Z5 2VG7A 1UVJA 3KXDA 3FBBA 1Q95G 4TQRA 3CCUS 3HSDA 4QJVA 3RJMB 4WZMA 2XMVA 1HMVA 2YNGB 1R7IA 5C2CA 2LKZA 3MM5B 3W2WA 4XIUA 4YS2A 2Q79A 3CJKB 1NDLA 1T3NA 1YBUA 4QZVB 1XR6A 4C11B 4DSFA 4A4JA 1FXDA 1RSCA 2HQGA 1WSRA 2ZZNA 4B3SJ 3Q2SC 4G6VB 1SL1A 2K1RB 2Z30B 2NXEA 2VFRA 4MK9A 5HP1A 2YBVA 4BWMA 2NYIA 5D0EA 3JQMA 4KKOB 2FJBB 2ACYA 2P9CA 2BE9B 5CD4A 1I94J 1IM4A 1RAHB 2WW8A 2B9WA 1LFPA 3DU5A 3J7AN 2QLFB 1REVB 3GCWP 3BEGB 4AXIA 2HLTA 3BDEA 4DR5J 1YI2S 1LWCA 5GMEA 2A6OA 1WKJA 5E33A 4NE9C 2RDJA 3GTYX 5C2GA 1MWZA 1KTQA 1S1TA 5E3AA 2M3DA 3PXGa 3JTOA 5KFGA 2FC8A 4LIWA 4DR3F 2VQEJ 1BQXA 1RHUB 5F8HA 4TY9A 2OLWA 5BJRA 3CJRA 4C9DA 1LW2B 3WBZA 3M30B 2R7UA 3Q8YA 4MKVA 1S4EA 2E1PA 1KS2A 3R2CJ 1X9SA 2CKWA 1F9EB 2QGFB 2OELA 2L48A 2VBXA 3RRKA 3TEHB 1WDDA 1HWUA 4TY8A 3QGIA 1WF2A 4TYBA 5A8KB 4LBIA 2R8JA 4LSNB 2ZNZA 3GR1A 4YDDB 1CJVB 3N6NA 1D9DA 3MM7A 4PG7A 4CZCA 1FKPA 2J7UA 5DM7Q 5DRKA 4WP9A 3BH7B 4DR6J 5FDLB 2UXCJ 4CLSA 2WSCC 3ZFVA 2GVDA 1CEZA 4X4VA 5ETMA 3LGNA 5KFOA 3TNVA 5K8MA 4JI3J 1K8AT 1X5PA 2EXUA 1VC5A 2OPQA 4LF6J 4NLYA 3O3LA 5KG7A 2IRXA 2FPHX 4PYDA 5E0OA 3PR5B 5KFVA 1C4AA 2W2MP 3W62A 2R3VA 2GO8A 2E1RA 4DUZF 4QYRA 3CIMA 1RKJA 3D54A 1S0OA 3TWZA 3AB4B 4NPOA 4FKXA 2H1YA 2NUHA 4A8OA 1Q7YT 2W24A 3NMAA 2XS2A 3RYLA 2JLEA 5KFMA 4JI4F 5C42A 4QWEA 1PJ7A 3R3TA 2WONB 2ROGA 2AU0A 2RU9A 1BUXA 1LWEA 2Q6BA 3A4TA 1PILA 1SQEA 5D0HA 2C2NA 2CPFA 1TVRB 4LF9F 1D0EA 3ZC4A 2JOQA 1KEKA 3T5JA 5DETA 4OX9F 3T3FA 1X60A 3CNQP 4RU2A 2IVMA 1E6YA 1H3DA 1VR6A 1P6TA 1TL3A 4JUZA 4W98A 1GTHA 4OL8A 5LJ3Y 1JK9B 3R5GA 3DOKA 3TQ1A 4RW7A 3NCQA 3H7HB 5HROB 5B0CA 3T9ZA 1S97A 5HVGA 4URSA 4DWIA 3O1LA 4NA1A 4LF1A 2M5YA 1R6YA 4N56A 5JJBA 1S6PA 1TL1A 4MIBA 2H4YB 2IIHA 2BRKA 4A8XA 3NBPA 2HS0A 1REGX 1T7PA 2L3MA 4ZKAA 1TAUA 4DR1J 1DAXA 3PX6A 2W8LA 3KLFB 4U96A 1AROP 4LR8A 1FWKA 4NXMF 1SUQA 5B0EA 2AV5A 3R27A 4MMOA 2JVOA 3ZNJ1 1S9FA 3BB5A 5HVHA 3UNYA 1V5IB 1SL2A 4LF4F 1QSYA 4X2BA 4C0OC 1X9WA 4CLKA 2MEWA 4KY3A 3Q8PB 2QRRA 1VBZA 1WC4A 5BYRA 5F8MA 5JXSA 3BGRA 2D3O1 1DTQA 1CSJA 2YY3A 1NZAA 2Z57B 2IFXA 5GAHI 3RRGA 4XPEA 2R7TA 1HI1A 3PFEA 4K2XA 2MLZA 3IRWP 2DH8A 1LOUA 2YKNB 1DURA 1EHWA 2WSFC 4HACA 1KONA 1GMWD 2CJKA 5L1JA 1B0PA 1VOMA 2HWTA 4ED4A 3D6FB 4IRKA 1S1XA 2NREA 4QYZJ 1G1XA 4ZVGA 1NO8A 1Z1ZA 3EVWA 5AE3A 2XY5A 2PMHA 3OR1A 2NS1B 3EZOA 4J9LA 5CZVA 9RUBA 2A6MA 1OPIA 1RAGB 3DOLB 2Z2ZA 3TVYA 3IM8A 5K9FA 2MZSA 2N3OA 4H4KC 4QYZK 3J80Y 4AL5A 1QE1A 2J6UA 5E7OB 1HBMA 1ZOTA 1VIXA 3F73A 2LEPA 3BSOA 1XEZA 1KRPA 4LMZA 1IKXB 3D66A 5CYJA 2ZBPA 5AE2A 2KT3A 2ALYB 5DGAA 3H2VE 3W65A 4WFZA 1TL5A 3SDEB 2OD4A 1CJKA 3GIRA 2G0IA 3FRYA 3QATA 2HNYA 4LFAJ 3M8RA 4G3IA 3MEGA 4EMDA 1KOHA 2EI5A 1TP7A 2WZ1A 3LPEA 3UWTA 2FVSA 9ATCB 1IR1A 1SVDA 4ED6A 3GPAA 4O3QA 3N5FA 2WVBA 4DV6J 4TXSA 1RWVB 1URNA 3M2UA 3B6BA 1JLAB 5KT6A 2GFFA 1FJGJ 1U1QA 3SSQA 2R4FA 1SXLA 2DNQA 2P8IA 2CVEA 1X7VA 3MPUB 2OJ3A 2MHEA 2Z4PA 5HMXA 2CVIA 2DISA 1X31C 1FNXH 1ITPA 2GMJA 4Q44A 1F2HA 1WF0A 2KZMA 3V2UC 2CQ3A 4TVAB 3HVTA 4M5DB 3PJXA 3DRSB 3VTIA 1S9GB 2UUAJ 5DGBA 2XSJB 3BSCA 3P96A 1UZDA 1C1CA 1SJRA 1HARA 1LK7A 2BE2B 3MMJA 3P6YC 3SZ2A 1X9MA 4IG0B 4JI6J 5B0DA 4ICLA 2LXUA 1C2PA 1XJWB 3ZTSA 1PYOB 1ELOA 2MQPA 1NBEB 2KN4A 1YJRA 2QMUB 5KFHA 6FDRA 1RZMA 3JXOA 1KFDA 3TAMB 2M9KA 4LF2A 1CC7A 4JB8B 1Y11A 2GO9A 4NLVA 2RIJA 2ZH9A 1R3NA 4JV5J 5ETVA 2YNHB 4X4NA 2XI2A 4I7FA 2XBPA 3M2RB 3OTEA 5T14A 1KC8T 2BXJA 4KO0A 3M8YA 3CJ2A 2JHEA 3DLKA 1XNRJ 3FJ2A 2LQ9A 1C0TB 2OFHX 1OYEA 4Y0FA 4ZVEA 3VGSA 1VQ8S 3MR6A 3KLIB 4PXBA 1UWBB 1WC1A 3A8IA 1W2IA 2VODA 4ANCA 3I0SA 3L09A 1RU2A 3KLGA 5J2QB 4KFBA 1S99A 3TZXA 1FVQA 3AJ2A 3CCES 2B9YA 3DGPB 3FEYB 1R0AB 4O3NA 1VMBA 4DL7A 1Y0HA 1RTHB 2PE8A 3GG0A 2CG4A 4J9SA 1DQ9A 1FFWB 3AH6A 4OV6A 3MECB 5EDWA 2BQUA 5D4PA 3PV8A 1C1BB 3QFWA 3MCMA 3I4HX 3IMQJ 1EJ7L 4W90B 4H4MB 3MPYA 3IXQA 2ZKUA 3LP2B 2MLYA 1G4CA 2XMJA 2VH7A 3CCWA 1YRUA 4BS2A 4D3HA 1OSCA 3RB6A 3DRPA 2A18A 3DI6A 1NK0A 4AYBD 2DEJA 3PNIA 5C25B 3JYTA 2N3LA 1TQLA 3PTWA 1NK9A 5JMNA 2JNJA 3U1LA 4NLGA 4C8LA 3ZTPA 4J9VA 2EFGA 3OL8A 3L7PA 3KG4A 4R5PA 2ZHOA 3B82A 2W9CB 1RWWB 3NNCA 4X64J 4M94A 4F4ZA 1TMJA 5DDPC 4R0EA 1N88A 4USVA 2HK3A 1HWLA 2KM8B 1UJ6A 4QWBA 3OXFA 2U2FA 4M8LA 3TUZC 2NYHA 3UO0A 2B8QA 5IZHA 2QTWA 3PDNA 3BPDA 3N4WA 2D9OA 5T7LA 2X51A 4DV4J 1PC4A 4URQU 4BCAA 1RAEB 2E44A 1QJHA 3EGZA 1CS4A 1NJYA 2MKKA 4JI1J 3PKMA 4ZPWR 3DRRB 1C0UB 3DDIA 1RB0A 1U7LA 3LQVA 1EB0A 3DN9A 2C2DA 2YX4A 3EWGA 2ZH6A 3H8YA 1TU0B 3BQ1A 1F6TA 5LSLA 4M5LA 1RTDB 3HVWA 3KHGA 1TUWA 1FTCA 3D1HA 2P9EA 3HJFA 3ZZOA 4DZDA 1TK5A 3JTNA 4USTA 1FFSB 3HVAA 1QVGR 5KFQA 2Y1JA 4NEYA 2DPJA 4ES3A 3MEEB 3QGHA 3R5DA 2RJZA 4Y2IA 4Q7AA 4JI2F 1KQSR 4LVOP 5MAOA 2HRTA 2HIQA 3ZZTA 5I42B 2AT1B 4DQRA 2AGOA 3HX9A 1S1WA 4KTQA 5CA5A 2B0GA 2V69A 1YTYA 4ZLNA 2YX1A 2FJDB 4USIA 4NLDA 1PJ5A 3AOCA 1DFDA 1APSA 3GG1A 3S01A 4PPZA 4GKKJ 2CJAA 3HCXA 2DHSA 2BA9A 4ILLA 3PX0A 1IKYB 1WHYA 2B4OA 4WYWA 4WK1A 4C8MA 3CGIA 3DFEA 5GMKa 4YR2A 3FQLA 1I5OB 4B3RF 2ASYA 4CP5A 1HKAA 3N6LA 1YWXA 4FXDA 4KT0C 3OSNA 2ROEA 2W2QP 2HVDA 2DNRA 4NLQA 1FRIA 3D1QA 3MAQA 2J0QD 4EI2A 3UD4P 3UDVA 2B7CB 3FEZA 2ACMA 1TV6A 3ILIA 3G6ES 4U95A 4V1Ak 3PYDA 1J5OA 1B3TA 4GMKA 1GAOA 2RRAA 2HBYB 3VGUA 2CQBA 4KPCA 5KFKA 2IY5B 3QIPB 3CCRS 4PG6A 1V3SA 4QIWD 1OY9A 1V5VA 4IUFA 3QRPA 2UUCF 1XC9A 5KT5A 5LMUJ 5CABA 2ZD1A 2R7QA 2IDLA 2HFUA 4GO5X 3NG8A 3DKDA 1B99A 2V5HG 2OIHA 4KGMA 1SH2A 2W2NP 3RR7A 1B4SA 4DV7J 4EBEA 5I4MA 4IDKB 2YNGA 2R8HA 4DQQA 3MM5A 3CJKA 5CYMB 4OZNA 1NSPA 1HNWJ 2QMXA 1TL4A 4C11A 2OUGA 1WUUA 4WFBQ 1XNQJ 3FCWA 2J6SA 2B3TB 4FBTA 2VZ9A 3CC7S 4WKRA 3CIZA 1RT6B 2I0XA 2FLOA 1N5SA 2XZWA 1UJ5A 2K1RA 4XAKA 5D77A 2AMCB 2VKRA 3GV7B 1JLBB 2RQMA 1VIOA 5HJYA 4HH0A 3BBCA 3GYNA 3AQPA 3LGHA 3SIPB 5IV3A 1T9TA 2ZZMA 4ZVOB 3L9ZA 3POTB 2V67A 3UE2A 4KKOA 4WTYA 4DJBA 4UUWA 1WOSA 3NP5A 1U6FA 2JL9A 3R5BA 4NCBA 2COLA 2R8KA 3R5JB 2ASDA 3MTJA 3FK4A 1REVA 4OYAA 2UXBJ 2YPYA 4RPFA 4ED8A 5LSRA 1U02A 4AXJA 3V6HA 2A3JA 1VQNS 2HHHF 4U7CA 3SV3A 3KDNA 4J9OA 2JEJA 1MNEA 4M5HA 1DQAA 5ETSA 1BXNA 2D7SA 2M52A 3GJTB 2KB2A 2YQ0A 3IAS9 3FKBA 1SQFA 1LW2A 3HHKA 3M30A 1AFIA 2GAHC 3SCKE 1HR0F 3HDSA 2BVZA 2MDAA 4Q2MA 4EEYA 2R7OA 2M2BA 1Y9OA 2D41A 2X1AA 3TAPA 3ET6B 3AA9A 3OR2B 3CDWA 3IFEA 3DU6A 4LSNA 1CJVA 3V4IB 2JC0A 1VYAA 2Z2YB 3KYLA 3IA0A 3VAHA 4EU0A 1FK9B 2BKPA 2KXNB 1UL3A 2QZ8A 4DV0J 1RDRA 4HT5A 4KGZB 3ZZUA 2W7OA 3ILJA 2M88A 4PWWA 3L7UA 3M8ZA 4ZCMA 3C15B 5D6GA 2XHWA 2YPZA 3J81j 5IWAJ 2F3JA 5ETQA 1WTBA 2E29A 3RB4A 4J9MA 4X4RA 5L1LA 4K5SA 4TU7A 1XK8A 2GS8A 4AQYJ 2XY6A 3QNWB 2MZTA 1HNIB 4WP8A 4Q5VA 5F8NA 4ZVPB 4OIXA 4FNHA 3PRVA 4DF4A 2V2ZA 2PFFB 5B7WA 2I5JB 3NGRA 5K8PA 4JP8A 3QAEA 4ZCLA 1BMQB 3CCZA 1VQSA 1TL7B 4M95A 2XM3A 3HT3A 1H0HB 4OQJA 4RWWA 1QTMA 2NZCA 2Y0SD 1UPMB 3OXLA 4N5SA 3H25A 4FBUA 3ZZYA 5SZTA 2AEFA 1OY8A 4PUOB 2JWNA 5AXLA 1FNMA 2WONA 2ADBA 1GXLA 5HI7A 3ADAC 3PIPQ 1QAJA 1TVRA 4FVMA 2J0SD 2NXCA 4ZPAA 3EPGA 4C2MA 4LQ3A 2V8GA 2OHDA 4L76A 3AODA 5KT2A 4BHQA 4RL1A 1RUSA 3ENVA 3I4PA 1HBUB 5HROA 1EKRA 3FUYA 2XSFA 3CJ4A 5ETRA 6FD1A 4OHZA 5IT9U 2XWXA 4FZVA 4J37A 2G9OA 5HQMA 3K58A 2CNOB 4TKTA 3HT0A 2YNFB 5D4NA 3K5LA 3D28A 1IBKF 3AOBA 3J81Y 4YB5A 3NRBA 3IBWA 2FQQB 1VJQA 5GVQA 2OSQA 3Q22A 2PA3A 4L75A 3PJWA 2IBOA 1S77D 1U0SA 1R89A 3G9CA 4N8NA 1CQMA 3KLFA 5EX0A 2ZC4A 2HS3A 3EGNA 4LQ9A 5A8WB 2B8PA 2G4BA 3T19A 2C3OA 1HNVB 1X0PA 2DNPA 3M9NB 1VK8A 1YDLA 5KFCA 1AUSL 3R9LA 2EEYA 4DR3J 3D67A 4FN5A 1HW9A 1U1NA 4U8YA 3QIDA 3HKZD 4QW9A 2YKNA 3TP2A 4B9MA 3GZ7A 4P6QA 3D9BA 3JQJA 2DNOA 4BBYA 1RTJB 2VJVA 2HVEA 2PIIA 4JYAF 1B64A 3CO9A 1T05B 4YY3F 1MLAA 4YFUA 2VDIA 2JEGA 4DQPA 2B6AB 2E9RX 1A0OB 2CQPA 1DRZA 4F4WA 4C4WA 4F3OA 2FY8A 1VLYA 2OTJS 3ZNUA 2AP6A 4AE5A 3KJNB 2GHWA 3DOLA 3T5KA 2VC1A 2JDJA 4DS4A 5DJBA 1F0XA 3H2LA 4IQXA 1GMVA 1LQ9A 2JFKA 4TQSA 1XIQA 4CLTA 1G3OA 3CULA 2DIUA 4OLPA 4OI4A 5KFTA 1RT7B 3GFZA 3IS9B 3UD3P 3PJ9A 1IKXA 1FRJA 4C0HA 3NS6A 1IBCB 4PPDA 4J9QA 4IO1A 4KSEB 3QWUA 1HWIA 2LA6A 3BKUA 2Y8WA 2KH9A 3A1YG 1DLOB 2V34A 4ZIWA 3SDEA 4DSIA 2GIRA 1HQ2A 3W7BA 4R25A 3KUEA 3G71S 1HNXF 5F9LA 1GMUA 3NWRA 2KG0A 1JWWA 3RBDA 2ILYA 2MGZB 4K59A 4N47A 2RSQA 3KFWX 4DUZJ 3MF5A 2AKWB 1JLAA 4LBHA 4I2PB 1JX4A 4DSKA 2KFZA 2BUNA 2GVZB 2A10A 4MIWA 2DXEA 3LAMA 5A0YB 3C6TB 3GSDA 2XMUA 1JJHA 2CNLB 2VFTA 5LXYA 2C2KB 5BYSA 1H2VZ 4OYZA 1Q86T 4CO3A 4UY8T 2VFVA 4NOHA 3C19A 5CH7B 4JI4J 4NX9A 1HPZB 2NR0A 1IKVB 1NPRA 1YRTA 4JI5F 5BYQA 3RR8A 3NMRA 1FF2A 4M5DA 3W61A 3DRSA 2DEIA 1S9GA 3MAAB 3I82A 3IGNA 4LF9J 4PQUB 2XSJA 2QSFA 4LRCA 2HHXA 4EYHB 4OX9J 3UR3C 3UN5A 1YJUA 2BE2A 2FHJD 2ATLA 2MJUA 2B4VA 1EQ0A 4UT4A 4IG0A 1T03B 3G87A 2J0WA 4DU7A 3I5CA 3M6WA 4F50A 1VISA 3U1NA 4DR2J 3K5MA 1B7FA 3SMZA 3TW0A 3TAMA 3LANA 1WTFA 1P1LA 2FJXA 2R7VA 2MB0B 1EP4B 3KUGA 1PC5A 4B17A 2YNHA 4EFAC 2DGWA 2YKPA 4WXOA 3M2RA 5LOQA 4G1PA 2RILA 2WCXA 2GGPB 1VRTB 4NXMJ 3R2DJ 4E2FB 1WF1A 4FS1A 3GJQB 4LF4J 1C0TA 2QEXS 3FSIA 3KLIA 2ZWPA 3I31A 1UWBA 4AUKA 1UEVA 4DG1B 2XZTB 3FZBA 5J2QA 1NEEA 4C0BA 2GC8A 2WB1D 2ABYA 2IJRA 4DS5A 4CLFA 4KHMA 3CVKA 3DGPA 2F4VF 3G8SA 2XQCA 3D6MB 2LXFA 1ZETA 1R0AA 2IAJB 5D0RA 1RTHA 2VPXB 3MECA 2HFVA 2FTRA 3N6MA 1HWKA 1RT2B 1C1BA 4X65F 1QVFR 2X3GA 1KSPA 5C24B 4H4MA 4O44B 3LP2A 3NCPA 4ATNA 2F1FA 1VQ9S 4OYWA 4OI2A 3SV4A 4F2SA 4ECXA 2KT5A 3W5XA 2E9ZA 2GMLA 2FGOA 5C25A 4LFBF 5KFSA 1SIZA 1QTNB 4F4YA 3HFVA 2ZE2B 4PKDB 1R27B 4CRJA 4AL7A 2W9CA 1NRKA 2DGTA 1FWPA 2UXDF 2POKA 4LF5F 3MUVP 4C8YA 2ZNYA 1RGVA 5LMNJ 4ETZA 2IA6A 4KV8B 1X4DA 3WHIA 4C3MA 2VA2A 1FI4A 1O5JA 2HWHA 4CH1A 4WZQA 5C7PA 2BJ1A 4J7CA 5B0FA 3DRRA 4IH5A 1C0UA 1SCJB 4XO0A 4WFAQ 4PWDB 5IT4A 4P9SA 4DUYF 4BDPA 1FHTA 1NXIA 4RBVA 2CDQA 1KQGB 2DRAA 3DNCA 1RTDA 1WG5A 3DCAA 1N5YB 3UD5A 7AT1B 5F3ZA 3EZ5A 2IJNA 5KFIA 2HFOA 2XO7A 2V63A 4ID5B 3IN5A 2ZUGA 4LUBA 4NLRA 2W9AA 4B9NA 5K20B 3MEEA 3D0GE 1CQNA 1M5HA 2J9CA 1B7YB 1K1SA 3S7RA 2BKOA 5LSOA 5KG1A 5KG6A 2HHSA 1S57A 4UW2A 2GZOA 4NXNF 4LF8F 5I42A 4UOHA 3BV8A 2IYIA 4J9KA 2PMWA 3HSJA 2E5LF 5AXNA 1VK3A 2Y0BB 2W7PA 4DZ6A 1RAOA 4FPIA 1IKYA 1H74A 2VFUA 2Y1RI 1UA0A 5HK4A 3UCUP 3NGTA 1T8EA 3I0RB 4O3SA 1SQGA 1TUGB 3CMAS 3V6KA 5LJ5Y 5GADI 1V9OA 4YHHJ 4C8OA 1RJJA 2E1MC 2YQ3A 3G96A 2ZH3A 2WHOA 4HEA9 2KVIA 4OX6A 5GAEI 2K8GA 2PEBA 4DV1J 2DXDA 2CJXB 1TZ0A 2AF6A 3I5BA 3QIPA 4QOTA 3SEOA 3HP6A 1N36F 1RTIB 4PG8A 3ISNC 1ZM3A 1HHQA 1KNZA 4RNHA 3P49B 5KFJA 3R1LA 3SYZA 3ELHA 2W01A 2HNZB 3V6DB 1T9WA 3BYRA 3CCVS 1R6VA 2E7XA 3EM1A 3CCMS 5HQLA 3NNAA 4YUDA 1GX6A 3NGKA 4EO8A 2UV8G 4RX6A 2CQGA 1OPZA 2Z2MA 4U7UD 1BWVA 2DR9A 2OI2A 2VL1A 4IDKA 1S1VB 1I6JA 5CYMA 3BZQA 1ZTTA 4DL4A 2LECA 1RTZA 1CG2A 1VDHA 2FUG9 4RR5A 2DGOA 1RHRB 1FNOA 1RT6A 1TKZB 3UI3A 3LWLA 1VFJA 3LOUA 3OXGA 1IN0A 1MWYA 1JLBA 3O44A 4DSJA 3CDUA 3VHQA 2R7WA 2ZVIA 3A3PB 2VG5B 3POTA 2Y9HA 4OI1A 4A8MP 2ZVSA 1N5QA 5IFMA 2F4FA 3W60A 3M2VB 3EICA 1YBTA 1SI9A 4K4XA 1K0TA 1RAJA 1R8CA 3TUJC 1UMJA 4DL0C 2BACA 3U02A 2KYXA 5GMDA 3F44A 1YHQS 2L08A 1WC5A 4DMZA 3OL7A 1S7IA 1GTEA 4OYOA 1NPPA 1WACA 1NHUA 1S76D 2V8PA 2DHAA 2FD2A 1PCAA 3ONQA 4MIAA 4QQBA 2KFNA 1M0SA 4OI0A 2M8HA 4HI2A 1T11A 2MQQA 2BX6A 3QSIA 4P7TA 1N0VC 2BV3A 2G13A 2PMZD 3ET6A 3M32B 4GC6A 1Q82T 4HDGA 4C6AA 2DXFA 2VG6B 4B3MJ 3Q8UA 5F8GA 3GR0A 1Q5YA 4JI0F 3V4IA 1TR0A 4QR2A 5D8HB 4CO0A 2W4DA 5EWFA 2DBBA 3W9JA 5EWGA 5K5MA 3O8WA 3OUYB 1FK9A 2R2SA 1KLMB 3MM8B 2QL9B 1R8BA 5KTQA 3J7ZT 1RADB 2CWKA 3BSAA 1YJNS 2Z0GA 3C15A 3CTRA 2DGVA 4B3RJ 2RQ4A 4N7TA 3NOCA 2JX2A 3PZPA 1UVLA 2UUWA 2VOPA 3GSIA 3OHBA 2FHKA 3G6VA 3ENQA 2RH3A 1HNIA 4QCLA 4QIFA 1G6BA 4K7QA 4ZA1A 3GIMA 2AYMA 2PA8D 2I5JA 5A2QU 1SC3B 2X7IA 2QV6A 1LFWA 1VGYA 1TL7A 1RHJB 4B9VA 1FJCA 2KXFA 5DO2A 1Q1KA 3DLEB 3QJPA 1WI6A 4FDFA 4O3RA 4ZITA 3LAKA 4IKAA 2UUCJ 4DR4F 4PUOA 2E1CA 1JXEA 4UTGA 3M8PB 1JKHB 3EDQB 5KOXA 4MK7A 3VQSA 2C2OB 3Q83A 2MLXA 4M63A 4ILMA 2LXIA 4OYXA 2CJQA
chains in the Genus database with same CATH topology
4ECYA 4LIRA 4BS2A 4D3HA 4GKJF 1OSCA 4IFYB 4JV2A 3NGDA 1UVIA 2IJFA 5J2NB 2C42A 2YKMB 3ENWA 3H40A 2D3OR 1B0TA 2JVRA 1HBUA 3KLHB 4B08A 3DRPA 3RB6A 1VHFA 2A18A 4X4UA 3DI6A 2MZRA 2NSBA 1ZM4A 1NK0A 1N34F 3UCZP 2RT3A 1VBYA 1FDNA 4RW8B 5H1SV 4AYBD 3HI9A 1U2FA 3T1AA 5C5JA 3PNIA 5C25B 3P5TL 3JYTA 2OP5A 4WF9Q 2LEAA 2N3LA 4AL6A 2V8HA 2QYCA 3MHYA 5H9FJ 4CT8A 5A6WA 3H5XA 1TQLA 3QLHB 4QWDA 1GXUA 1SL0A 1F5AA 1NK9A 3U1LA 1OQ6A 4NLGA 1IQTA 4OZ0A 2FJWA 2WK4A 3H5UA 4C8LA 4XPCA 2EFGA 1PO6A 4OHYA 2OPRA 3OL8A 2YNFA 3C66A 2OPSA 3L3CA 2UZAA 3FSXA 3L7PA 2FJVA 2CQ0A 3QAUA 4DPOA 2XI3A 3KG4A 4R5PA 1QLNA 2ZHOA 2I9SA 2DCUB 2CPYA 2E7WA 2OPQB 3B82A 2EFPA 2W9CB 2LU1A 3NNCA 3OVSA 3HF5A 4M94A 4F4ZA 3DYAB 2VA3A 5DDPC 3DRYA 4R0EA 2MKIA 1N88A 2R2RA 1TFWA 2BQRA 1SKSA 3K8VA 4ZCKA 4B9LA 2F8EX 5HQ8A 4DQSA 2B5JB 1HWLA 5D3GA 2KM8B 3M9MB 4IRCA 2EG1A 1VQ5S 1UJ6A 2YWKA 4QWBA 3OXFA 3BJYA 5THWA 1L3TA 3PRDA 3HHLD 2U2FA 1P8GA 2BYCA 2IBKA 4NMLA 4M8LA 4N76A 4K4VA 2CPIA 2DGXA 4YEAA 4C8NA 3TUZC 3N0VA 2MKJA 5T41A 1LWFA 1U26A 2E5JA 3MM9B 2MY8A 4DQIA 4Y34A 1ZBTA 5IZHA 5A8WA 3PDNA 4DV6F 3N4WA 2D9OA 3CD6S 3WC0A 5T7LA 2HVHA 3M6UA 5CXTA 1HNVA 2X51A 2CQ1A 2FY1A 1NU4A 5HN0A 3B78A 4K50A 3JSMB 5KFLA 3VAJA 5LT5A 3PX4A 1GXTA 1PC4A 4URQU 4BCAA 1SIWB 3OQ2A 4PXCA 4CO5A 1VBXA 3ZZZA 2E44A 1QJHA 4QW8A 3T1YF 3EGZA 1NJYA 2MKKA 2CPXA 3Q2TC 1WG4A 4WE1B 1X8DA 3PKMA 1X5SA 2W4PA 1JB0C 2VD3A 4ZPWR 4OJ3A 3DRRB 1C0UB 3KNGA 1U7LA 3LQVA 4DN9A 2ZJPQ 3BSNA 3TANA 4KPYA 5FD1A 5GAGU 2XLIA 3I5AA 3DN9A 4USJC 1KN6A 4PXDA 2C2DA 2YX4A 4OI3A 2ZH6A 3IG1B 3I87A 1OO0B 3FRZA 2OD6A 5C42B 1SJFA 4JI7F 3H8YA 4DR2F 2AQ4A 4X84A 4HT7A 4ZP6A 3BQ1A 4OJGA 4B9TA 1V6HA 5LSLA 3CDBA 4WKYA 3KLEB 4Q2LA 1LWEB 1RTDB 3HVWA 4RW6B 1D9AA 3LO3A 3QMQA 3KHGA 4RUCA 5D4OA 1FTCA 2EW9A 4HL9A 3D1HA 3MD1A 5EHHA 2P9EA 5M2RA 4RW4A 3G6YA 3CT9A 4IO9Q 4DLEA 3BN7A 3US5A 1BQNB