3PKYA

Polymerase domain from mycobacterium tuberculosis ligase d in complex with dna, utp and manganese.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
287
structure length
287
Chain Sequence
b'EQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA ligase-like protein
publication title Structure of a Preternary Complex Involving a Prokaryotic NHEJ DNA Polymerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/dna
total genus 85
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pkyA02
2R9LA 2IRYA 2IRUA 4MKYA 3PKYA 2IRXA
chains in the Genus database with same CATH superfamily
1U1QA 4MK7A 4RW9A 2XS5A 4A8SA 1UEUA 1Z4UA 2B9EA 2BKPA 3IWNC 3OFGA 3BREA 5BJRA 2F8HA 5CYMB 1JB0C 5HN0A 1YSJA 3H2UB 4P2XA 1KOHA 5DS7A 1NH8A 4DV6J 1ZM2A 1MNEA 1O5JA 3B54A 1J5EF 4LJMA 4DSIA 1FEHA 1RAJA 4GVLA 3Q8VA 2P9GA 5ETVA 1OYEA 3T41A 3ZTRA 1R6VA 2W2QP 1F6TA 3X3UA 1PC4A 2W8LA 2HVDA 3KK2B 4LF7J 2MKHA 1I94F 2ZE2B 4YDXA 1M1KT 1HWUA 3JYTB 3KLEB 4P2SA 1GX6A 1AUSL 1F0XA 1SC6A 1AT1B 3HULA 3QAEA 5HBMA 3QYYA 4YUDA 2FVCA 4K4XA 4CYUA 1Q82T 3CT9A 3M8PB 4I2QB 3K57A 2K3KA 2C3PA 4Q2LA 2OD4A 2Z30B 5DZ7A 4YS2A 4LRDA 4ECZA 3PDNA 4LQ3A 2RKIA 3MM6A 2NZ4A 3S7RA 2VPXB 1WSRA 2ALZA 3PX4A 3HSJA 4NRUA 4M5IA 1RXOB 1ZTWA 1NSKL 1WHVA 3AJ1A 3FBEA 3U7JA 3A3OB 4ED7A 2RMLA 2QSWA 1Q7YT 2HNDB 2DR8A 3KNGA 4ED1A 3D66A 1YHQS 1IWAA 2Z2ZA 4HACB 3GYNA 3RZAA 2EG1A 2DHXA 3I9V9 2HHHF 4KKOB 1XNQF 2W01A 4B9TA 2H54B 5AXLA 4I68A 2R42A 4K2XA 4QWEA 1J5EJ 1N6QB 2UUWA 3G6VA 3BO3A 1QSLA 4LF1A 4ZOSA 1RDRA 4DCPB 3SEOA 1UVIA 5D15A 4TNOA 2R8IA 2IY5B 3QRPA 4RWWA 3AD9C 2ZD1B 5HSPA 3CJ3A 2VA2A 4I6AA 2X1AA 3BKTA 4LF6F 1I94J 3MPWA 5F9LA 2BZ2A 3C3LA 5DDRC 1VQNS 2PI4A 1Q5YA 4J9PA 3IG1B 3LP0B 1RBAA 3C19A 2UVVA 1FD8A 2DGOA 3HHDA 3CCSS 4ED0A 2E29A 3T5LA 2GNKA 2BJEA 4UOGA 1F9FA 1RHQB 4NXMF 4U8VA 1FRMA 3NNHA 4WYLA 2FZGB 4KE5A 4C8MA 1N0UA 1IKXA 3V4MA 5DDOC 5E3PA 1HQUA 2DHSA 1XMOJ 4OZ0A 2FIUA 1HBOA 1TKTB 2FHOB 3NS6A 1C4CA 5D4LA 4F4AA 2BOAA 1IM6A 3Q22A 4RNHA 3B82A 2J76E 2AP6A 2HHHJ 1XNQJ 2IJFA 4FS1A 4X4NA 3MM9A 1TTHB 4KTQA 1YZ6A 2D41A 3D0IE 5IQQA 3U1MA 2N82B 2G0IA 1FRKA 3IGVA 1S6QA 3H0PA 1NKCA 2EKNA 3PYDA 1ZH5A 2HGNA 3H20A 2QA1A 4QIWD 3K7RA 4G1IA 4LF6J 3FMBA 4C98A 3HKWA 2JVOA 3HT0A 2J7UA 3TYTA 2RUSA 4R8UA 3T3FA 2CQPA 1VJWA 1KQSR 1NK4A 2HBRB 2GO8A 5IM0A 2VKRA 4B9UA 1E6VB 4ZVQB 2XQCA 1VBXA 4OJHA 3RG6A 3H42A 3IM8A 3R5DA 5A0YB 1S99A 4C9DA 4NXMJ 3HVTA 3LW5C 3O3LA 1QSSA 3TI0A 1ROFA 4DPTA 3HSDA 3DC2A 3EUNA 1RYSA 3WZ0A 2R9LA 2HEKA 5CHCB 3M6UA 1B4SA 2LVWA 3DRXA 2NUUG 4DR5F 8RUCA 1ZA1B 3CJTA 3MDFA 1YJUA 4B9MA 3H5YA 1HBNA 2QT7A 2ZBRA 4CLTA 2DNZA 5LSOA 1KTQA 4LVNP 4JI3J 1H98A 2OSRA 2K8GA 2WCXA 3D54A 1ICEB 3BJYA 2EVZA 4FF2A 1IXKA 2MY7A 4G6VB 3EICA 2IA0A 3VGUA 5GAHU 4ICLA 3EMTA 3CC7S 3MR3A 3GG0A 2H51B 2OHDA 4EZ9A 4DX7A 1ZAWA 3IBCB 4USTA 1XNRF 1MWYA 5HBMB 2CPFA 2ZVIA 2V2QA 4XK8C 4CYUB 2EWHA 2YNHB 4X65F 1KNZA 1CBKA 3PEHA 2GMLA 4KH0B 2AJFE 1BD6A 1GTEA 4F4WA 3MF5A 3ENQA 1VC0A 2XSFA 5H9FK 2RKIB 3MM6B 2Y8WA 3F56A 3FCHA 1WC3A 2QIFA 4DV1F 4MKBA 3RJMB 5K5MA 4FPRA 3AB2B 3GR1A 4WFAQ 4V1Ak 1QAJA 2PFDA 3AY0A 3VQTA 2ZH7A 4R25A 2GJFA 3FDSA 1SJ1A 3EVOA 2VZ9A 2YQ3A 3SDEA 4B9SA 5D0EA 5KFSA 1TK0A 1SBRA 4DS4A 1WHWA 2IVFB 3OR1A 3PR4A 4OYWA 3MUVP 3CD6S 4KHPF 3D68A 1WORA 1YRUA 1Z2ZA 2HAIA 5B0CA 2YNIA 2ZH4A 4WZQA 2RDDA 3HZGA 2FHKA 3C14A 4AL6A 4QCLA 3ZFVA 1UEVA 1X4BA 2CJQA 2HRTA 1K0TA 4DL0C 2MGZA 2BJ3A 4BC7A 2M70A 3ZZTA 4EFAC 5LXRA 2IHR1 2Y3YA 2ALYB 2DNQA 1OPZA 3EPGA 3K58A 3N5FA 4X65J 3JS9A 3EGZA 1WC5A 4WJBA 1RKIA 3RTVA 5HL7Q 2GMHA 1S57A 3QGPA 3I9ZA 3MR7A 1S4FA 5CYJA 5FDLA 1IKXB 4RPFA 4F4ZA 4OQJA 3WIUA 3RB4A 4CTAA 3OV7A 3FQKA 3T9NA 1AXQA 1NB2A 5ETKA 1HQUB 2ZUGA 4JI7F 1FF2A 4K2JA 2W7OA 2DPJA 2AYBA 4JI5J 2KO1A 2B51A 1NDCA 1HBOB 3W9IA 3IA0A 4YB7A 1FRLA 2ZKUA 2DNMA 3RB6A 3G6XA 2W2NP 4QYRA 1OS5A 3OLBA 3SSQA 2DHGA 4XPEA 1MMLA 3MM9B 2DRBA 1X5OA 3CJKB 1WG5A 4C0BA 4CLZA 4KHPJ 3I56S 1BLUA 4CT9A 5K8MA 1S6QB 1SH2A 4TVAB 2G4BA 3K89A 4DV0F 2C2DA 1HQEB 2DH7A 3EXYA 4ZPTR 3GONA 3BV8A 2LLZA 2XLIA 2PO4A 4OIXA 3TEGA 2QC3A 2FZCB 5A8WA 2C2ZB 2QMUB 1F3VA 4R8UB 1ZOTA 3I4HX 5T7LA 2G1DA 1UAWA 1PBUA 2HFUA 5IM0B 2QE5A 4RWXA 5J1NA 3GFHA 4FXWA 3U1NA 2IC3A 1FWPA 4C3LA 3FSYA 3VF0B 3D5MA 2G2OA 3V4IA 4ELVA 3HVTB 3QWPA 2ZHBA 2MJNA 1Y4ZB 1HNIA 2W24A 3MECA 2HS4A 2ZC3A 5GVQA 3C16B 3KKFA 1KN6A 4JI7J 1VQLS 1ZTTA 3GFZA 3SFGA 2GMJA 4RUCA 2HNZA 3TVYA 4CLFA 4N7TA 1ELOA 1FNMA 1D3WA 1HBNB 4ZJOA 2RU9A 3M6VA 1SIZA 4DN9A 8AT1B 3MFIA 2HYIB 3R5AA 4DMZA 5KFTA 3H25A 2OD6A 2ZHAA 3JQJA 4DV7F 2DT9A 3AQOA 2RJZA 1AFIA 1U45A 1UFLA 3TO8A 5KFHA 2NREA 4TQSA 3R97A 4ICLB 2L9WA 2GJIA 1TELA 4DV0J 3MGJA 2W9AA 2FJXA 2DB1A 5IV4A 1K9MT 2PD1A 4C8NA 1B99A 3AXKA 1YITS 5E0OA 4CLSA 2O01C 1FKPA 3EJMA 1BWEA 4EEYA 4NLWA 4DN0A 1KDNA 3HT3A 5J2NA 3CCZA 4EGLA 1FK9A 2QLBB 3E8OA 3HJVA 4J9UE 4DPOA 1JWWA 2LQ9A 3FFIA 3BDPA 4BWJA 1VBKA 1XR5A 2RU3A 3SCKE 5F8GA 1QD1A 2F3JA 1S1UA 3P8BB 2NPFA 2ASYA 1WF2A 4OHYA 3SDEB 3T1HF 2RQCA 3O2IA 3SSRA 3OR1B 2L9NA 3KUHA 3GV5B 1Q86T 1HW9A 2YNIB 3UDVA 3CD5A 5B0FA 4ZPVR 3HKZD 2E7XA 4NLYA 3IR5B 4B9VA 4DV7J 2JC0A 3C14B 2YX1A 3MAQA 4LFBF 2W4PA 3G9CA 3FCVA 2DEJA 2XSJA 3H2LA 2FY8A 3BM7A 1RADB 3IXQA 5KFFA 1KHVA 1JKHA 4USWA 4CO0A 3A8EA 3WX8A 2MGZB 2V50A 4P2FA 4CIOA 3ILOA 2ZJPQ 3IO1A 1HYSB 2QFJA 2AEJA 2XI2A 3PCOB 4ES1A 3H5XA 2J7KA 1IBCB 3I32A 3TVZA 4X62F 5KFXA 1TR0A 4NA1A 2VBYA 2Q43A 4AT1B 2YWEA 3UD4P 5HROA 1JMTA 2UUTA 5FDLB 2QN6B 1BWVA 4LRFA 4CTAB 4CO1A 1TV6A 2V68A 1CJTA 5GAEU 1U1LA 4KRWA 1LKZA 4IKAA 2H65B 1G4CA 6FDRA 1NPPA 3BSOA 1HD0A 2ZUAA 2OPRA 2DISA 5B0BA 3BPDA 4O4RA 3UNGC 1NZAA 3NL0A 2WHOA 3T1HJ 4JOUA 4PYDA 3R6LB 1N0VC 1IM4A 5C24A 2ADCA 1U1NA 2SXLA 2IYGA 4X4SA 2IM2A 4PZVA 1FWLA 4OMFG 4UZCA 5DQGA 3GYGA 2B3TB 2J5AA 3G71S 3OL6A 1QAIA 4DQIA 2XC9A 7FDRA 4DI6A 1TL1A 3IWXA 4LFBJ 1SC1B 5A8WB 1WC4A 1FFWB 3US5A 1WTFA 2IAJA 4PWDA 5IC4B 1FKOA 3AH6A 1MSWD 1QUVA 5T7LB 1B7YB 5JVHQ 1NHVA 5GMEA 4Y2MA 3VZIA 1YRXA 2D3UA 4K4ZA 2IC3B 1TL7B 3J80Y 1VQ4S 1S9GB 1F3FA 2CG4A 1JLBA 3UN2A 2DXEA 3D7SB 3V4IB 4LR7A 1JLEA 3KMSA 2ZC4A 2KT3A 3UNYA 2FZKB 1A6LA 5KFUA 4X62J 4FKYA 2MKSA 3SXLA 2F4VF 3RRGA 2CVIA 1HNIB 2ABYA 2DGXA 1HARA 4PCQA 3MECB 2GHPA 4U67Q 4DR1F 3VZHA 4TY8A 1T9UA 1UA0A 3TAPA 1P1LA 5F8MA 3DRSA 4U96A 4QZVB 4DL5A 2AGQA 3AA9A 4B17A 3DLKA 3N79A 2VIHA 1HWJA 3FBFA 2BXJA 3TA1A 4DUTA 1LOUA 4JI0F 3LAKA 1F2HA 3PW2A 1NSPA 2QO3A 2PN6A 1S4EA 2J6SA 4IRDA 1U1PA 1NK7A 4ED5A 1RTDA 1Q81T 4DFPA 3G4SS 1KEKA 2X1BA 4IFVA 2IMWP 3GLJA 2YKPA 4K4VA 3ZZUA 3LPYA 3QNWB 3PHEA 4ITSA 1UPMB 1U1KA 4F4YA 4QJVA 3OR2B 2W2MP 4JV0A 2XCPA 1UVLA 1JK9B 1DQ9A 1FKPB 3OW2R 5J2NB 1MMDA 4F4XA 4RNMA 3AHPA 1FK9B 4F36A 2R4FA 2OTJS 4BDPA 1WF0A 1C4AA 1Q8LA 2WZ1A 1RBOB 2XO7A 3FFIB 4TQRA 3B6BA 2MHNA 2F4VJ 2XMUA 3MCOA 1S1UB 4NE9C 3OL7A 1WF1A 2VHGA 3ZZZA 3P45B 2EW9A 2DPIA 1U6FA 4CO4A 4K4TA 2W4DA 3DDKA 2OKQA 1DLOA 2KXHA 4DV3F 2G9OA 3M6WA 2MTLA 2R8JA 1OJ4A 2R2RA 2HIQA 2JJ4D 3GSIA 3OTDA 4LIWA 1N48A 3DHXA 3R2DJ 4CNZA 3L09A 2R8GA 1WELA 1VS3A 1WC0A 1V5VA 2XSJB 1N36J 4DR4F 3KXDA 3G8QA 3KG0A 3M4XA 5DLGA 3NMAA 4NLRA 4IOBA 2KT5A 2RAQA 1JKHB 3BGRA 3TQEA 4I69A 1AROP 3P96A 3KTQA 4RX6A 1REVA 1LW0A 3MUMP 3QAUA 2R8HA 2XHCA 5A8RA 1T03B 3CCQS 3HPOA 4PQUA 4FZVA 3SSSA 2WW8A 2CAJA 4F3MA 1UVJA 1RAIB 1RWOB 3LGMA 4M63A 2B43A 3IWLA 2V4JA 5HROB 2ZH6A 4NA2A 2MKCA 3ISNC 4HI2A 2POKA 1TV6B 2EC0A 1CJTB 2UVRA 5HATA 4Y2CA 3SCJE 2K06A 2R7QA 4LF2A 2LA6A 4O3OA 3HVRA 2R2TA 4P74A 3FK4A 1TKDA 4KAIA 3MZIA 1MN7A 2LXIA 2OPRB 4M5NA 3LP1A 2VDIA 3GIMA 3ELHA 2Y1LB 4LF9J 1JQGA 4NLXA 4N8OA 4UZBA 4FYYB 4I7FA 4X4PA 4RJVA 3G6ES 4B3SF 2IMOA 2QL7B 4I6WA 2J0SD 4DV3J 3TWZA 4UTGA 4CO2A 1TL4A 3J7ZT 2R8KA 1VQPS 1RUSA 2ZBIA 3TZWA 1NJZA 3R7NB 4ZLNA 5CD4A 1TL1B 3FNNA 4FYXB 5FD1A 2RDIA 2ZWOA 2MSSA 3A8IA 1VC5A 2PGCA 2IAJB 4PWDB 1FKOB 2VU5A 1Y3JA 3CSKA 3U27A 5D4NA 5AXMA 2HS3A 1VK8A 3CB4A 4PEOA 1IBLF 1LW2A 2I1RA 1JLBB 3NWGA 2C3YA 2VF3A 4OHVA 4ZMMA 3KMQA 1N5VA 1XWLA 3EDRB 4URQU 3WX4A 1N5TA 2CWXA 4KPCA 2DR5A 2VG6A 3UN3A 1TQLA 1YWXA 2FC9A 3J81Y 2MEWA 3AFGA 1RHKB 1RZMA 4TY8B 4ZN1A 3DRSB 1RGVA 3T5HA 3DLKB 3NGTA 1A9NB 1NAQA 2LU1A 4IO1A 4WU2A 5LM7E 4URGA 1B7FA 4ZP7A 1GAOA 3CJSA 3OBIA 4QIEA 3TJAA 1QAYA 4USJC 1SH0A 4MKAA 4GKJF 1SL1A 4F2RA 5GADI 4B3SJ 2DYAA 4CT8A 2DIVA 5KG1A 1Q8BA 2N4DA 1FD2A 1RTDB 2FVSA 5CAAA 1JLCA 1JLFA 3W2WB 2MQNA 2AHOB 2MKIA 1YJRA 4RR5A 4AD6A 4MTPA 3PM9A 1UJ5A 3D3BJ 3OLAA 3NXZA 1CULA 2NSCA 2X1GA 4F0KA 3KJFB 2BMBA 2ZKTA 1DFDA 4OV6A 4AE5A 1N34F 1LFWA 3CIZA 2R3VA 2GHWA 5G4DA 2BW7A 1YVFA 2C2NA 3LUYA 2E5HA 2RQ4A 3QIPA 1F1BB 4K0KF 2FHJA 2GGPA 4X66J 3BSNA 2HQGA 4F50A 1IBLJ 3MI7X 1Q95G 4PG8A 2VG7A 3UCGA 3N5BA 2VC1A 2XMAA 5DLFA 2DKOB 4P7VA 4UY8T 2ZM6F 4KYZA 4U7UK 1GX5A 5DETA 4H4OA 5KFPA 3PO5A 1SL0A 3EM1A 4RUBA 4ID5A 1TUVA 3KHHA 5ETSA 1YI2S 3HHNB 1EP4A 3MMBB 3OFFA 2ZDPA 2MZ1A 4KV8A 1M90T 2AU0A 5LSRA 4ED8A 1T0TV 3K5OA 4GKJJ 3QT7A 1RAOA 3MOJB 1D9FA 4J9NA 1SUQA 3BDEA 2EFOA 2KXNB 4MKYA 1EHWA 4DL3A 2ZZMA 3NS5A 2ZBPA 3O5TB 2CZ9A 3BGRB 4X64F 2IIHA 3CCVS 1SH3A 3P5BP 1REVB 1LW0B 2CQ2A 3A4TA 5A8RB 2VFUA 4PQUB 3IBWA 3OXFA 4QWDA 2MZJA 1N34J 1R0AA 4DCOB 2P8IA 3GIJA 4ZP6A 1PJ5A 1UZHA 3MMCA 2XS2A 3R5GA 2M4MA 3R1HA 2H48B 2V4JB 3CVKA 3I87A 2FTRA 5HJYA 4K0KJ 2KYXA 1VCTA 3K5MA 3GSDA 2AMCB 1H0HB 2V0NA 1R7IA 5EWEA 4EWTA 1XR6A 3GYXB 5KT5A 4PG5A 1A0OB 5J2MA 2Z2YB 4EI2A 1R8AA 2XO6A 4HTIA 4XPCA 3LP1B 2B4UA 2HS0A 5CABA 2Q6BA 3CUNA 2YKNA 3WDOA 3F44A 2IPOB 4I7FB 3MFHA 4LREA 1Q79A 1GMWA 4X4RA 5C42B 4TYBA 3CJRA 1U0HA 2GQCA 1RBLA 5ETPA 5EDWA 1H6KX 2K3IA 1VRTA 1MWZA 1S49A 2VFSA 3M2UB 4QU7A 3TEHB 1S0MA 2VH7A 2H1YA 5EX3A 1R3NA 4OYOA 2D9PA 3VR1A 2VB6A 2UXDJ 2LA4A 3G8TA 3NGDA 4U7UD 2KN4A 3KDOA 2A3JA 4X64J 3DN9A 2Y1JA 3HFZB 3D67A 4RNOA 3H7HB 3VVUA 4IYQA 1OY9A 1D9AA 3MD1A 4TY9A 2F4FA 3T1YF 1HPZA 1LW2B 2DH9A 2X51A 2RF2A 3AJDA 2BE9B 1M5VC 2V67A 4IDKA 3TAMA 3HD2A 2OTLS 2VPYB 1AFJA 4FP9A 7AT1B 2O67A 4DV2F 2VG6B 3JQKA 5DGBA 1R31A 3BGOP 4UUWA 3VHQA 3H59A 1SKRA 2W9BA 4EO6A 2W9CA 2DJWA 1UCNA 4HHHA 4PQAA 4PXDA 1HIYA 4YEAA 3VAKA 3C2PA 1EX8A 4FNHA 1F9EB 2HFSA 3R7SB 2QG9B 3QJPA 3QRQA 2P9CA 2AJ0A 1OSDA 5D4PA 2QSFA 4ZCIA 1CJUA 4QIFA 3MR6A 2OEKA 3KWMA 3HVWA 1YBUA 1RCXB 3OL9A 1JLCB 1EJ7L 4WK1A 4J9LA 1JLFB 2KRRA 5E3QA 2YKMA 1R8PA 2IRYA 1H73A 4ELUA 2VBWA 4RW7A 4LFCJ 5KT6A 3AOAA 1CULB 1NJWA 1S79A 2JOQA 4IFYA 4R5PB 4E2FB 1T7PA 1LNQA 3HZEA 1TFYA 3IBFB 3QIPB 2AJ1A 4WXOA 2GGPB 2GIFA 2P9EA 5CCLA 4JBCA 4LFAF 3BYPA 3LO3A 2VG7B 3K8VA 4OHWA 1RISA 3VQSA 2V8VA 2KM8C 2MZTA 2DO4A 4JB8B 4XO0A 1HI1A 4M5LA 4H4OB 5AE3A 2APOA 3PJWA 2FJVA 1M5SA 3RRHA 3M1VA 4ID5B 4C48A 2JWNA 1IJFB 1B70B 2I0XA 3F73A 2VASA 4LSZB 2RVJA 4QW9A 1EP4B 3OUYA 1AW0A 1FO1A 2XNQA 4KV8B 1EQ0A 4BC9A 2Y1IA 4L6V3 5A2QY 4Q45A 4OZNA 2XNRA 4DLEA 2XG8A 1SUQB 4UQGA 2RT3A 1WDDA 2BKOA 5E3AA 1FX4A 2GCFA 3NMRA 2B4VA 3ZZYA 1Y9OA 1U09A 2OO4A 4KPYA 1YLXA 3KLGA 2A6OA 1M5OC 4P6QA 1VBYA 4PABA 3VWSA 2IDEA 4TKTA 3TUZC 5AJ3F 2MZQA 2DGUA 2I9SA 3GTYX 3TUJC 1U4BA 1R0AB 1NPRA 1K1SA 3MMCB 4O3QA 4XAKA 4O23A 5MLCV 3DFEA 3NRBA 3J80U 1GTHA 1HNWF 1FDNA 1HNXJ 1HQ2A 2R7VA 4LFAJ 3MXHP 2AQ4A 5J2MB 5L1KA 4IH5A 4C8LA 3ILJA 2FHMA 4LRCA 5SZTA 3OJSA 1YBTA 2ZH8A 2YKNB 2QZ8A 3NAIA 1PO6A 5EHHA 5J1PA 4ECTA 4EBCA 4P73A 4ZPCA 2JEJA 2F40A 4OL8A 1U0HB 3TUIC 1VRUA 2DGWA 1VRTB 1SQGA 1FXLA 3W5ZA 2E9TA 2XZWA 2EXUA 2PA3A 1RHMB 4MYUA 2WONA 5KFMA 2NXCA 4USHA 3QSIA 1X5PA 3E01A 1FTCA 3CMQA 2UUCJ 3LPEA 3N9UC 4LRAA 2HMIA 2VJVA 2WW4A 3CDWA 3NNAA 3BPSP 2BDPA 2CPJA 4Z7YA 2HBYB 1VHIA 1S10A 4NX9A 3MWBA 4Q7AA 2ASLA 1U26A 1HPZB 3WBZA 5AJ3J 4C3MA 5A76A 2CIMA 1UWBA 2ZH1A 1NZ8A 2RF2B 2OMOA 2JDJA 4IDKB 3TAMB 2FY1A 4U6PA 3VV2B 3KLIA 1P9QC 3GG1A 4DZ6A 3FRZA 1S0OA 3KNAA 2HRUA 4WU3A 1FDDA 4LBHA 1BQMA 1HNWJ 1UVMA 3W64A 2IRUA 5HLFA 5CCMA 2W9BB 3MAAA 2W9CB 4FXDA 3DI6A 3TUPA 2FGOA 3OXGA 1IWGA 2V8PA 5D8HB 5G0RB 4EUVA 1WOOA 1YJ9S 2MXYA 3JTNA 4RL1A 4ZVTB 1W7WA 2KRBA 2NYIA 3SZ2A 4ECSA 4DPWA 1LK5A 4OI1A 4W98A 4E8UA 3MCMA 2XYPB 1CJUB 1JJCB 3IN5A 3G8SA 2J8SA 1S1VA 1KQKA 3H4DA 5KFWA 3PV8A 2CQ0A 1IKWA 1T95A 3DRPA 4CLYA 3GB0A 2YKMB 4NYOA 2HHWA 3MPUB 3VALA 2V9WA 4RW7B 1SJ3P 2FUG9 2NXEA 5ETLA 2HFOA 3HHEA 4NLOA 4IFYB 1U1MA 1UEKA 3R5JB 4ANEA 1RWMB 2P6SA 2M5YA 1OY6A 2KVIA 1F2GA 3BQ2A 3SV4A 2WVFA 3KJQB 2HLUA 2B6AA 2PFFB 4IQXA 3P49B 5LXYA 2LCWA 1VI7A 4J91A 3HFVA 3OSPA 1Q78A 3QGGA 4ILLA 3M1VB 1XBWA 2CXEA 3DU6A 3T1AA 2DRAA 2GAHC 3FBBA 5CZXA 2DH8A 4DUZF 4K4UA 2EFNA 3OUYB 2EFGA 2ZBCA 3S01A 4NLSA 5M2UA 2NXJA 2JFDA 2XULA 4UQTA 1Y5IB 2OPSA 5C5JA 4L3NA 2IJRA 3CDBA 2XM3A 1TP7A 3D28A 3EGNA 3TX8A 2V8HA 4MK9A 2YNGA 3CPWR 3JXOA 4C11A 2BQ3A 3KLGB 3D3CJ 1PSDA 4JI1F 4CQ1A 1UW4A 2JFKA 2RILA 5KG7A 1WEXA 1S1XA 1ITPA 1SPBP 2V8GA 1ZM3A 3NEKA 2D3O1 4XIUA 3SMZA 2NSBA 3CCRS 5KG4A 1V3ZA 2UUAF 4DG1A 4ECWA 1VR6A 2AF6A 2LXUA 3ICLA 2YWKA 4HVZA 1L3TA 1FNOA 3BEGB 3Q2SC 3DRRA 1FRHA 3I31A 1D1UA 2XMMA 3UDLA 4DR2F 4QR2A 3KDNA 2W7AA 1YBAA 3IGNA 1KVKA 2WB4A 2CPHA 2XBPA 5DQHA 3L95X 3I0SA 2KTQA 1BMQB 4CLWA 4DFMA 2N3LA 1S9FA 4GO5X 4LUBA 2XS7A 4ED6A 1DJ0A 1RTIA 2CG8A 3LH2S 3NGSA 2ILYA 2J9DE 2WONB 1R8BA 3A3NB 5B0EA 1ZAXA 2R7OA 1NK0A 5CZVA 2VV5A 3E01B 1HNVA 1P9YA 2ZFHA 3LF0A 1XR7A 2HMIB 1OPIA 3ILIA 1RWXB 3ETOA 2J6TA 2JSXA 2B5JA 5HMXA 4JI1J 1ZA2B 5ETQA 2F1FA 5F8LA 3A3PB 1UWBB 4KB7A 2OH2A 5L38A 1RT6A 1WSVA 3HJFA 1GXUA 1IQZA 1RU2A 1Y11A 3PIPQ 4ECUA 5F8HA 3CJQA 3G87A 1S0NA 2PSZA 4M5DA 4DSEA 2UUAJ 1BQMB 2BE7D 5HLFB 1DRZA 3MAAB 4MMOA 1IJEB 1KONA 1RWPB 4JI4F 3FQLA 2DCLA 3DI6B 3M2VB 2DGVA 5GADU 2CUYA 1T8EA 2VFRA 4FPIA 5KG6A 1SC4B 1C0UA 4JI8F 2YWFA 4ZDNA 4DR2J 3QGHA 1TL3B 3FSIA 2C2MB 3AA8A 3W8GA 3VAIA 1IR0A 1RWUA 4V19X 4USVA 3FC9A 3HI9A 4OFZA 3R27A 1H2TZ 3OT9A 1S1VB 3L9ZA 1FXRA 1S6OA 4C6AA 3CCES 1IKWB 2FVQA 2HPUA 2E5IA 2ASJA 3ENVA 1GT8A 4FKXA 4X84A 1U49A 3OTEA 5IC6B 2ZOGA 1QJHA 3BKFA 3NOGA 1EKSA 4NMLA 4MIBA 5K9FA 3J7A1 3PXGa 1MMNA 1PIEA 2YKAA 2XMTA 3FGVA 3K5PA 2YXLA 1U6BA 3KUGA 3KUEA 1VGYA 5J2QA 4DX5A 2GVDA 2B6AB 3QIDA 1LWEB 4U7CA 3KHLA 4N56A 3NGUA 2NS1B 2WVDA 1FE0A 3BGFA 1FKAF 1L3SA 4HDHA 3MMAA 3SCLE 3GZ7A 2GVZA 2XMWA 4DHVA 1LFPA 6FD1A 4OHXA 2BJ1A 4JI4J 2JRSA 4RU9A 2HWHA 1SL2A 2XGPA 3HK2A 1Q0NA 5ADZA 4A8OA 2ZH9A 4JI8J 3I82A 1N5SA 1IKVA 3GFXA 3S8SA 4Z2XA 3D2WA 1NHKL 1CJVB 1BGXT 2JLFA 1N88A 4QBUA 4TN2A 2OPSB 4ECYA 3M9NB 4ZJLA 3J7YI 1PAEX 4OYBA 1N32F 2YNHA 1O0PA 1FFSB 2HURA 4Y3CA 3NCRA 4HHUA 1LQ9A 2YNGB 4OLOA 4C11B 3PW5A 5C2GA 1M0SA 5E3RA 1QM9A 4I0WA 2KU7A 1JJHA 1KBRA 1S1XB 2EKYA 4M94A 1OMSA 4X4QA 2FLPA 1X9WA 3NP5A 1FTRA 3GQCA 4ZITA 4YMEA 4WIQA 2LQBA 3W5YA 3B4DA 2L9DA 3PW7A 2XMJA 4DG1B 2J8AA 2AKWB 1ZM4A 2KJVA 1YQHA 1CQNA 2HWIA 3HX9A 3VTIA 3LWMA 4J9SA 3DRRB 3K0JA 3NG8A 3GJRB 4YQWA 1KP6A 1FRXA 4OI3A 4G65A 4WTYA 4C7QA 5JJBA 5GMDA 3UN5A 3CMES 3I0SB 3W3SA 1YG0A 3TQ1A 2XWXA 3PTWA 3MCNA 4OI6A 3OTCA 2YQ1A 5KFRA 2CQ1A 4D3GA 2L41A 1RTIB 1HLWA 1Q4RA 3MPDA 3RYLA 3D6TB 1R43A 4IOAQ 4ZVPB 3Q8QB 4KGKA 2D7SA 1HNVB 2BRLA 1RKJA 1L5UA 1NPKA 1EIYB 3TA2A 3VCDA 3TJ8A 3VAHA 3ONQA 2B5JB 3D1QA 1X4HA 4TU7A 3LQVA 4KHMA 1XQIA 4UY85 3LOUA 4RW8A 4DCJB 3UI3A 5HP1A 3NY0A 1VJQA 1PG5B 1RT6B 4QWBA 3HHLC 3I0RA 4FN5A 2EC2A 4B3OB 2DITA 2OEJA 4M5DB 1W2IA 5KFVA 4BCAA 3DDIA 1HA1A 5KFIA 1KS2A 3ENAA 4XDDA 3W60A 2IM3A 3JSYA 4S0MA 2HWTA 1T9TA 3D1HA 3CJKA 4K7QA 1C0UB 1P6TA 1F5CA 4H4MA 2LU2A 1HBMA 2O5DA 2J9DA 3QFHA 4O44A 3U1LA 5U47A 2VQEF 1HQEA 2GC8A 3JAMU 5A6PA 2C22A 3RR7A 4O3SA 4F8RA 1NK9A 2QYGA 5C2CA 3KJNB 4U9RA 3UCUP 5CD4H 4NLPA 5KFJA 4K59A 1RT3A 5L1JA 2HVHA 5A2QU 2IA6A 3BH7B 3QGIA 1BQNA 2CQCA 3E3XA 2U2FA 3HHLB 5LSLA 3FUYA 2Z4PA 4OX7A 1M5PC 4E0DA 2HQDA 3OVBA 2QX0A 3K5NA 3ZC4A 1NK5A 4C8ZA 3BBCA 1WWHA 1RYRA 1WC6A 1RQ0A 1KWMA 2AIRB 2DEIA 3C16A 1URNA 3BR9A 4PWWA 5J2QB 2GVDB 3PACA 1QDUB 1M5KC 3IRWP 5I3UA 3OQ2A 3FRYA 1S12A 5F0UA 3K17A 5BYSA 2VBZA 3MMAB 4PXEA 4OYMA 2AX1A 2GVZB 3MUTP 1KOOA 3Q83A 2XZTB 3CNQP 2J6UA 3T5KA 2ROGA 4CH7A 1TUWA 3MEEA 3QO9A 4J7CA 2GAGC 5E3CA 1WNEA 1RT5B 2O3DA 1KLMA 5HQLA 2G13A 3V6HA 4ID8A 5DG8A 1FRJA 5IFMA 2C3OA 5KFBA 3BKUA 3M8SA 3D1OA 5LJ5Y 5ETNA 1WJ9A 2CPIA 2CVEA 3TARA 1IKVB 4BLGA 4R0JA 2VQEJ 3HLUA 4DXLA 3C6TA 1H2VZ 1DTQA 4OZ3A 4PPZA 2XMKA 2CJYB 4DSFA 1ZYQA 2BM0A 2OSQA 3KHRA 4ZLJA 5K20B 2F63A 4FVCA 2JNJA 4B3TF 2DNOA 4P9SA 4DPYA 3AD8C 1HI0P 3OVSA 2D3OR 2E66A 2V5HG 1NM2A 2UU9F 3KFWX 2MQLA 1GNKA 2QMXA 2DY1A 4NRTA 2FLOA 2M88A 5D4OA 3NS7B 1GQEA 1NB7A 1JNZB 4RKUC 1X5SA 5GMKa 4DR5J 2DNYA 5EWFA 2BJDA 3O8WA 5CQGA 2CDQA 4CLPA 4ETXA 3DHWC 4ES2A 1HWIA 1YK9A 3I5BA 4DF8A 1ZZNA 5CA5A 2VOOA 2MPUA 1JJ2R 1XTZA 1YJNS 2HVZA 3BO4A 1QE1A 4NLTA 4PG4A 4CRJA 1S97A 2AYEA 1SB6A 3D6MB 4YDDB 5FJ4A 3Q24A 1R27B 1U7LA 3R8YA 4ZS6A 2EI5A 3BBBA 2PA8D 1HYSA 3BQ1A 1FJ7A 3DRYA 1S77D 4ZKAA 1XNRJ 3BB5A 4DV4F 3NNCA 2A10A 2J9CA 3QMQA 5B0GA 4Z37A 1N5QA 4MH8A 1HHQA 4B3TJ 2RB7A 1FRIA 2HFVA 4RW8B 1KTVA 5HP1B 2XI3A 3VGTA 4DV1J 1S59A 5IT9Y 1FDAA 2HHPA 4F3QA 1T9YA 2VC0A 2KI2A 2Z2MA 2AJQA 3I0RB 4ZVSB 3N01A 3SQGA 3G96A 5D78A 2A18A 3PJXA 2OFGX 7FD1A 5HMZA 3AQPA 1S0VA 1NMEB 3ZTQA 3VGSA 3FVYA 2M3DA 2IDLA 3TR5A 2KZMA 2CPEA 3QATA 3GP9A 4OZJA 1L3VA 4H4MB 2GX8A 3HDSA 1HBMB 1PBAA 3CD7A 4O44B 1T9XA 3TZZA 1RHRB 1M1HA 4PG6A 1RWWB 4KSEB 3Q8PB 3D6HB 1QVFR 4MK8A 3CO0P 1S6UA 2MLZA 4B3RF 1X4CA 4L73A 1RT3B 4C0OC 2YBVA 1ZPWX 4NZ6A 1BQNB 1Z2LA 1C0TA 2A6MA 1TL7A 3VGVA 4DV4J 2EBGA 3W9HA 4A8KA 4YR2A 1S9GA 3TX0A 3PHTA 2XCAA 3DOLB 2GV1A 4J9QA 3DOMB 2HZCA 1RAGB 1SKUB 3WC0A 2Y0SD 3UWTA 3M32A 4WXWA 4FXVA 4TLQA 1B3TA 2MDAA 2C2OB 1JLAA 1N52B 5E41A 2Y1RI 4PAAA 3AOBA 5I3UB 1UW9A 3H5UA 2V2VA 1VISA 3BN7A 1FJCA 3TOQA 2AEMA 2AGPA 3X1LB 4P7TA 4P2MA 3T19A 3WQPA 1GEHA 3MEEB 3QO9B 3RBZA 3RBEA 5IT4A 3ITHA 1WG4A 1KLMB 1KVIA 3NLCA 5FIIA 3W62A 2AZ1A 1MROA 2HFZA 2BQRA 2P6TA 4QWCA 5L39A 4J9KA 4NCAA 2G2ZA 3NKYA 2N7CA 2HBQB 4OLPA 4UOCA 3KK3A 3HO1A 1TFWA 4HDGA 4AQYF 5LMNF 3G82A 4PRFA 4DOZA 1MU2A 1U8SA 1RJJA 1TU0B 3C6TB 4QR1A 4LF5F 2VODA 1DTQB 3PYFA 3C8YA 1FXDA 3OR2A 4B3RJ 2MY8A 2XB2D 1CS4B 4NZ7A 2HHTA 4WFBQ 4Q0BA 4K50A 5KOWA 3ZNJ1 4ECRA 4CWBA 2OMLA 2KZZA 2Q79A 2QLXA 5J2PA 2NQPA 2E5JA 4G1PA 3OD2A 3BQ0A 1LWXA 2ZWPA 4IQMA 1DBDA 2CQ3A 4DPXA 2RS8A 2UZAA 5HK4A 4WE1A 2IBKA 4A8QA 1RAEB 5RUBA 3GU0A 4L3KA 2FGCA 4FF4A 2MMYA 3ET6A 4QQBA 2AT1B 1S48A 3OHAA 2V4QA 5JUMA 1IR2A 2Q3PA 2BACA 1I1GA 5E33A 4OYZA 2GHVC 1OQ6A 2KH9A 2UVWA 2D69A 2YPYA 1B0TA 1QE1B 2QMWA 5HJXA 4CI0B 4UOFA 3DNCA 2KHDA 4DSJA 2V94A 1XN9A 1Z1ZA 2BANA 5BYQA 4AQYJ 5E2QA 4C8OA 3BGLA 4C4WA 2DD8S 4LF5J 4IH7A 4K4SA 2PEBA 1T03A 1YJWS 1YGYA 3L7PA 2IJNA 3FZBA 2ZNZA 2MKJA 4ED4A 3MMJA 1Q7LB 2JHEA 3AB4B 1BXNA 1T05A 4V19J 1OQ3A 2FB0A 1U2CA 4ALZA 4Y00A 3RAXA 2HHUA 3NCPA 2IFXA 1IQTA 2K7KA 2N7YA 1G1XA 1AB8A 3OJUA 5I3PA 4ZVEA 2OLWA 1T3NA 4K8RA 3EZOA 1YJVA 1UKUA 3SQGB 1PCAA 4I6YA 4UF4A 1X5TA 3NWRA 5HQ8A 1RTJA 3ZTOA 3R9LA 2UUBF 1UWAA 1N33F 3DYAA 4KGVB 4NXNF 1KR4A 3ZZOA 1ULRA 1IR1A 1IBKF 4KBIA 2NCKL 2RSQA 1HWKA 5KFZA 3QT8A 4QR0A 4RZRA 5BR8F 1JXEA 3HD1A 3LAMA 1JLQA 3CIMA 4K4YA 3ZNUA 2E5LF 5B0AA 3ZO7A 3L7OA 2KXFA 5IV3A 3CJ0A 4YOEA 1UP1A 2RQMA 2Q1LA 3HFKA 3IS9A 3ISZA 4ELTA 4K5RA 2OJ3A 1WG1A 2FJEB 1C0TB 1QLNA 1P27B 2AX0A 5J1EA 2KL8A 2LXFA 4CLKA 1RT2A 1H38A 4IH6A 3RGIA 2HHSA 4HT7A 5HVHA 4ECXA 1VBZA 5M2RA 3W9JA 1WI6A 1UVNA 1EB0A 2H5IB 2QLFB 4CDIA 3HSGA 3M32B 2IBOA 5ETTA 4DPUA 1NH7A 2RRAA 1DY3A 1KFSA 1JLAB 1O6XA 4M1KA 1KC8T 2M2BA 3ISND 5EGYA 3MM8A 4USIA 4OYIA 1HBUB 3SYZA 4J9VA 1YRTA 2DXDA 4ER8A 1OY8A 4ZCKA 5D6GA 2BM1A 3ITHB 3R5CA 5K8PA 2UUBJ 1N33J 2WVEA 1MROB 4NXNJ 3J7YU 2O66A 2XMVA 1IBKJ 2E7VA 3TJ9A 4RW4A 1VK3A 4USUA 2QLJB 3KK3B 3W2WA 1OIAA 1XMOF 5BR8J 3G82B 1MU2B 4NLUA 3UR3C 4DS5A 3R7BB 2E5LJ 3PIOQ 1RTZA 3EZ5A 4CH1A 5KG2A 1LXJA 1UETA 2C3MA 2CZVC 2JVRA 1T9VA 1ZS6A 2VA3A 3EVWA 4Q0BB 1BQXA 4H4KA 4PWUA 5K14A 5SUHA 3GILA 2J7WA 4NCBA 3PFEA 2EFQA 5J2PB 2DR9A 1XIQA 1D9DA 4OYPA 3AXMA 4RBVA 3TA0A 4CZCA 3OVAA 2NZCA 4WE1B 4DL4A 3OHBA 2CQHA 1XMQF 1VQ5S 1SV5A 2KYZA 1CC7A 2RHSB 3J81j 2V8DA 3ET6B 2RRBA 4JV5F 4DR1J 4H54A 2HQFA 2YWGA 2VG5A 1D8ZA 2K7JA 4LBPA 3MEGA 1Q8IA 3MMBA 3H90A 4JI0J 4Q5VA 4DX8H 2CQBA 1U2FA 3PVXA 1PJ6A 1UMJA 2GQ2A 6AT1B 2JEIA 4KIAA 2ZJQQ 2VOPA 5F3TA 3LGHA 2W1BA 4DR3F 4CM0A 3SI8A 1HNZF 4BS2A 4JUZA 1X4DA 2LEBA 3M8ZA 3MTKA 2BJ9A 2BANB 5LT5A 4X4UA 3NOCA 4NYZA 3MCSA 2FVPA 2FJAB 4M5KA 2UXBF 3PR5B 1H7WA 2J0QD 4W4MA 4JI3F 5B0DA 1CPZA 2WSEC 4DFKA 4OZ2A 1T05B 2I38A 3KLHB 1J5OA 3AD7C 1GFWB 3KG1A 2ZZNA 4Y65A 1S1TB 4DJBA 5FLXY 4DR7F 1X8DA 3RB0A 2CQGA 4P52A 2DVIA 4ZLLA 1NDKA 1VQ7S 4HYKA 3OTBA 1AA1B 1XMQJ 2HZAA 3DCAA 3DMJA 3MM5A 1X4EA 3QWUA 2BUNA 2UP1A 4JI6F 5JXSA 4F67A 4Q2MA 3V6JA 2F9JA 3V2UC 1RAFB 1CC8A 5EX0A 4I2PA 4JV5J 2LKZA 1RTJB 3IFEA 1VQ6S 1VIOA 4P72A 1ZZFA 2F7VA 4GRSA 3DYAB 3M8YA 4HEA9 4HH1A 3MAHA 5C42A 2HAFA 3SV3A 2X3GA 4WKRA 3ZTSA 5T41A 1LV5A 3PX0A 4OI4A 1EZZB 3W5XA 1X4GA 1BE4A 3I6PA 5D77A 3IRXA 4RW9B 1JLQB 3RUBL 3OL8A 2D9OA 3M2UA 2MLXA 4DR3J 2IM1A 1HNZJ 4K4WA 5D0GA 4EK2A 3DLGA 4DR4J 1LXNA 1RB0A 4EO8A 2WRMA 2VD3A 4ZCMA 3IS9B 1LWCA 1HI8A 2OPQA 1V3SA 2JLEA 4MJKA 4DBQA 2ROPA 4WFYA 5J1EB 4EMDA 5AE2A 4KR0B 2UXBJ 1RT2B 1WD6A 4TYAA 3PKMA 1FVSA 3TZXA 5H9EJ 2BE2A 1S9EA 2R2SA 1X0PA 3DOKA 3RW7A 3EXCX 3GCXP 4KJIA 3CDUA 3JB9k 3RRKA 2NYHA 1CSJA 4DR7J 1RE1B 4H4KC 4WP8A 1UJ6A 3TRGA 1SXLA 5I4MA 4IO9Q 3MM8B 2E1RA 5A6WA 4JI6J 3RW6A 1P8GA 4LR9A 1U47A 3EPIA 4A8XA 2BV3A 3FKBA 3CCLS 4F0MA 1EQMA 3BH6B 2C42A 3H8YA 4GC6A 1SQEA 3KOAA 2CJKA 2KHCA 3D0GE 4ANCA 4ZK7M 2IRXA 4X4OA 4DSKA 4RW4B 4Y2IA 3JQMA 4OYXA 3KJVA 1NKBA 4RUAA 4DF4A 4OI2A 5KAKA 3N6MA 4JI5F 4NPOA 3WC2A 3B4MA 4DR6F 4NLGA 4R5PA 4NA3A 1FERA 5K14B 1DZ5A 1NLKL 2WTFA 4U95A 3HHKA 3D9BA 5I3QA 4CO5A 2Y8YA 2OELA 4AYBD 4TLRA 1T9WA 3RB3A 2AZ3A 2LDYA 5A8KA 2E9RX 2MLYA 3J7AN 3ILLA 4B9NA 4M5HA 4BWMA 4XDCA 4O4GA 3GPAA 3UVJA 1SV5B 1D0EA 1U6ZA 1JIHA 1FT8A 5KT7A 5LOQA 4DQQA 4QWAA 2YX4A 4MT1A 2VG5B 5IT9U 4ZVUB 1C1CA 2HIYA 1TUGB 3MEGB 4EBEA 5C25A 1VMBA 5AXKA 4NOHA 3AJ2A 2GIRA 3CCMS 2DCUB 2FHJD 1ACMB 2CNNB 2BA9A 1Y7PA 5KFAA 4PYAA 2HLTA 4J9RA 3CCJS 1T11A 2QA2A 4DSLA 4F04B 1DAXA 1UZDA 3PEJA 4ECQA 4KT0C 3CDAA 2HQCA 1UPPA 4GVBA 1XJWB 2DNKA 2Z57B 3PYEA 5IWAF 5L1LA 5LL6d 4WFZA 2NXUA 4DR6J 3BZQA 3EDQB 4CLUA 4Y6IA 1B0VA 3DDNA 1F9HA 2DTJA 2DNPA 1J5OB 2KVQE 4USMA 3LTOA 3H98A 1V5IB 3DKDA 5F41A 4Y2KA 2CYYA 3QFWA 3MM7A 1REGX 2M52A 3QZ7A 2HW3A 1NHUA 1NUEA 3DMJB 3MM5B 2G0CA 4AXJA 2ZM6J 3BR8A 4WP3A 2VKZG 3IR6B 3UE2A 1U1RA 1NSAA 1UTAA 4I2PB 2RRNA 2QRRA 3GE9A 4HH0A 1BC6A 2X7IA 2DGSA 3BYRA 2G1HA 4LBIA 3C46A 2ROEA 4TU8A 4OZ5A 2GW8A 4FS2A 1KLNA 2KT2A 4KC5A 2IVMA 1NJXA 2AWZA 2ZH5A 2L48A 4L72B 2IM0A 5DZ6A 1N4LA 1Y5LB 2QTWA 4IG0A 1BUXA 3IRXB 1SI9A 2AJ2A 2AEFA 2EPIA 4OJGA 1KVJA 2CJXB 5LJ3Y 1CJKA 2AJ4A 2XGQA 1JX4A 3POTA 2UV8G 1JLGA 2N4CA 3K59A 4B9LA 3GJSB 4X2BA 2ZZTA 3DLGB 2OGUA 1JXVA 1VYAA 2CA9A 2RD5C 4O3PA 2B8PA 5EWGA 1LWCB 1M5HA 4P10A 2OPQB 3EWGA 4LRBA 2HFNA 2B0GA 3RR8A 4O3NA 2Q6CA 1NCLA 1X60A 5IWAJ 1G3OA 2NUHA 3NGRA 4M5JA 3I4PA 1FNXH 1GMWD 2CNOB 4KQZA 2BE2B 1S9EB 3PFOA 2G2YA 3DOKB 2VQFF 4IR1A 1MW7A 4LSNA 4A48A 4WFXA 1NJIT 2LEAA 2R2UA 5IXUA 5L46A 2DHHA 2YVSA 4A47A 4MKVA 3MD3A 4ZPDA 2AYMA 2MZRA 3R2CJ 1KD1T 1HHTP 2YQ0A 5G0RA 2YNFA 4KFBA 1LK7A 1RT1A 1U1OA 2QA4G 1BY9A 4OZLA 3D6FB 3CDEA 1U8WA 5F8NA 3Q8YA 1K1QA 2MKYA 4URSA 1PILA 2JC1A 1CG2A 3D4JA 5C7PA 1K44A 3KJVB 4C8KA 4KGMA 2R7UA 2BYCA 4F25A 2XYHB 4IOCQ 5DM6Q 3LP2A 3GIKA 1PYOB 4DU7A 5KOXA 2H4YB 4X4TA 3BS9A 1L3KA 3QT5A 3T5JA 3FEYB 5T14A 2CADA 1FEEA 3LANA 4DU8A 4DL6A 2IYIA 4WBFA 4RNFA 5A8KB 3T1YJ 3FSXA 3C15A 4LVOP 2DR6A 4DEZA 3TANA 4OYAA 1HFEL 1TMJA 4O4GB 3MOZA 3EGWB 3UVJB 1WI8A 2B4OA 2VQFJ 1RHJB 4DV2J 4ZP9A 2MQOA 4Q43A 2I2YA 5DQIA 1U02A 2DO0A 4IRCA 3EGVA 5JMNA 3AODA 3AT1B 4Y28C 1C1CB 5D3GA 1ZBTA 2PMWA 1HKAA 3GFYA 5E7OB 2RH3A 2MZSA 3JAMY 4Y2AA 4AXIA 5C25B 2XY5A 2C2RA 4DV5F 2CDRB 2CKWA 4ZP8A 3WHIA 4R0EA 3W66A 1RWNB 2B9YA 3KG4A 5DM7Q 3B8HA 4WFNQ 5HVFA 2HVEA 2VJUA 5KFEA 2BX6A 1VQKS 4ED3A 5KFQA 4PXBA 5DDPC 3N6LA 1S6PA 2D1CA 4L74A 3CWJA 3N4WA 1FJEB 4DUYF 4GVBB 2NLWA 2CPYA 1X9SA 1TMMA 2M8DB 1YX2A 4NLVA 3F41A 3CCUS 3SQOP 2G0JA 1HMVA 1FESA 3DM2A 1WEYA 1X4AA 1YJ7A 1P1TA 3PW4A 2QJ3A 2WOMA 2KFZA 4ZN3A 2F8EX 3NAHA 4BHQA 2OIHA 2OPPA 4Y0FA 3JSMA 4YN3B 2LQJA 4AL7A 3MM7B 1EARA 1R8HA 4HTJA 2HQIA 4LQ9A 3QJLA 4ANDA 2ATLA 2UVUA 4C97A 2EK6A 3CGIA 5HQMA 1ZETA 1M1GA 2ZJRQ 3UCZP 1U24A 4NCGA 4MFBA 5KT3A 3MEDA 2W8KA 2BRKA 2HGLA 4YB1P 2E7WA 4DV5J 2YKQA 3V5RA 2F65A 2FYXA 4E98A 3M9MB 4IG0B 2CFXA 2ZHOA 4WYWA 1GXLA 3H4BA 3V6KA 2A2DA 3LALA 3UDEA 1X0FA 1CJKB 1PKUA 1HHSA 1WUUA 3POTB 2J0WA 1JLGB 3GIRA 3CC2S 2F8MA 2KDOA 4DUYJ 3PNIA 1XC9A 2QFIA 4TXSA 1W26A 1EETA 2YH1A 2DNGA 5B08A 2DNRA 2NR0A 1PAUB 2HNZB 4I67A 2YWWA 3N6NA 1Q5VA 2B9XA 1RHUB 2FLNA 4HL9A 4GO7X 4UUXA 3O6QA 2GQQA 4AFFA 1VQSA 2B7CB 3Q8UA 5L8RC 3MTJA 2CPDA 3E2EA 2EFVA 3V6DA 2FQQB 1IBMF 1T02A 4LSNB 2YKOA 3FEXB 1GH8A 1TAUA 2V6AA 3I55S 2VDHA 1N36F 4PXCA 2FJDB 3M2VA 3IM9A 3GJTB 4U8YA 3Q8SB 4ZVOB 3KYLA 3GV8B 3I5CA 2ADBA 2FC8A 2YNFB 4QU6A 1TL3A 2ZOFA 4J9MA 4KFBB 3IR7B 1RT1B 4NEYA 2J9EA 5HVGA 4LR8A 2BR0A 4ZJQA 2YY3A 4FBUA 3HM9A 1NNDA 2LECA 5CH7B 3IAM9 3OTOF 2KJWA 1VC6A 1AZSA 4N47A 2QYCA 1HR0F 1NK8A 1IUJA 1SKWA 4NZ0A 5H1SV 5KFLA 2QV6A 3T9ZA 4WZMA 3MEKA 1B64A 3FBCA 1YTYA 1VQOS 3LP2B 1MG7A 2N3OA 2GO9A 4ATNA 4LF9F 4WP9A 1A7GE 4RBUA 3ETMA 1WKKA 1XMBA 2DK2A 4KGZB 3MR5A 4WWSA 3R3TA 3DLHA 4OZ1A 1I3OB 3PRVA 3C15B 2XZDB 4A8MP 3JTOA 4QYZJ 1G6BA 3BN4A 2VFTA 1LWEA 1TKXA 1IBMJ 3M8RA 1NRKA 5FLXU 2GFFA 3K5LA 2KFNA 4EYIB 5I42A 5IT0A 2MQMA 3OFEA 4A8YA 5D3GB 1PC5A 1QTMA 3GR0A 4ZVFA 4W90B 1FFGB 2ZNYA 3NCQA 5K8NA 2R7RA 3TP2A 1FVQA 4LSLA 4L75A 3CULA 4NL5A 2QL5B 3V81A 2WBMA 3HVAA 3RU0A 1CJVA 3CE8A 2EG2A 4OX9F 4I1TA 1F5AA 5CXTA 1FDBA 1TAQA 1S6PB 3CJ8A 2F5GA 3OTOJ 1RLCL 4O0NA 1HR0J 2HBZB 1H7XA 2KFYA 3BO2A 2OEMA 1CLFA 4C2MA 4AL5A 2FD2A 1V9OA 3MPYA 1I51B 3HXMA 1HMVB 3PKYA 3DLJA 4NMXA 1S5ZA 3DM2B 1VDHA 1N56A 2XWYA 1MN9A 3BSAA 3PY8A 4YP3A 2M8HA 2V4RA 5GAGI 3JTPA 4JI2F 5ETOA 2WOMB 2AV5A 5C24B 4F3OA 3QRRA 2DNHA 4KY3A 2O1PA 2V2KA 2OPPB 2W2OP 3JSMB 2LYVA 2M7SA 4C0HA 4KGXB 3W8PA 2WK4A 3O44A 5MAOA 1KQFB 1N54B 2E1MC 9ATCB 3HCXA 5LMUF 4USKA 1E6YA 3DGVA 5KFOA 2OP5A 4NCGB 4MFBB 2HSEB 4DQPA 4PG7A 1N5YA 3MEDB 4LT6A 1RABB 5ETRA 3M2RA 1GMVA 3O1LA 4NYPA 4DUZJ 1Y10A 2D3ZA 3FZ2A 4X66F 4ZIWA 4MYTA 2JLGA 4IG3A 1FX2A 2ACYA 5THWA 2CQIA 4UT4A 1JLEB 2CQ4A 4CM2A 3HMJG 2PMHA 3R1LA 3EX7B 4OHZA 1VQ8S 2C2EA 2CJBA 3UO0A 3QQCD 2V69A 4OX9J 4GC7A 4ZCLA 4Q8FA 1ZM9A 1K47A 4LMZA 4GMKA 1FA0A 1EETB 2IVYA 4RW6A 4CH0S 1KSPA 2CRLA 2GIQA 1X9MA 3L7UA 3IAS9 4ECVA 2PI5A 2KG1A 1YZ7A 4FYWB 3RBXA 4WK3A 3V6DB 4JI2J 3W65A 3QLHA 2E44A 5JVGQ 4KO0A 2A0FB 2H5JB 4B3OA 1U25A 2HQ3A 3QJJA 3KLFA 4QW8A 2C1EB 4RNNA 3BSCA 2XYGB 2ZOMA 4TU9A 4IFVB 3CJ2A 5L1IA 2RUGA 3ZTPA 4P75A 5LMUJ 4F26A 1RT7A 3H40A 3HF5A 2HNYA 4YR0A 1LWFA 3TAQA 3UR0A 2AW0A 2B4PA 2I8EA 4NASA 5ETMA 4GKKF 4NI2A 1O8BA 2QLWA 2OI2A 3KLVA 4P71A 2DGQA 3D0HE 1NDPA 1AZSB 3CXCR 2EFPA 2DXFA 5IQ6A 2FJWA 1DTTA 4LF8F 3CW2C 3T6JA 3M8QA 1D09B 5HMWA 5F8IA 2Z8QA 2HHVA 3HHLA 2WSCC 4HR2A 2W25A 1HW8A 2JZ5A 3ULHA 4YFUA 2RNEA 4Y34A 1SCJB 3OFHA 1RU1A 3GJQB 1DLOB 3PZPA 2XTJP 2W2PP 2GZOA 5F0WA 1ZPVA 3P3DA 4PKDB 4YR3A 1R89A 1TKXB 1SJQA 1RSCA 2Y0BB 3PYGA 4LF4F 3ZZPA 1VIXA 1MWQA 2DY9A 1SIWB 4ETZA 2R7WA 2EK1A 2DRDA 2C3UA 4HT5A 4EYHB 2PE8A 5I42B 2EEYA 3J7Z5 3HHLD 1RT5A 2UXDF 1NBEB 1PYTA 2E1PA 4DWIA 1TZ0A 2DIUA 2WAQD 4LSLB 1I6JA 1QVGR 5DG7A 3V81B 5KG3A 3MURP 4I4BA 1H72C 1X4FA 4GKKJ 2RIJA 2MJUA 3OSNA 5D0HA 1JJ4A 1NO8A 1JNRB 1SJRA 1YIJS 1G7CB 2DNNA 2R7XA 1VOMA 4LF8J 5DO2A 2BQUA 4N5SA 1WHYA 1SVDA 2ASDA 2JX2A 2FJBB 4F7VA 3GV7B 1RK8A 1VQ9S 5H9EK 4YB6A 1FJGF 1WC1A 2WB1D 2EBEA 3CO9A 1KFDA 3OXLA 1K73T 1FI4A 2QEXS 2W4CA 4AUKA 3AAWB 5DRKA 1W25A 1WEZA 2RDJA 4N76A 2PMZD 1Q16B 2LQ8A 3PX6A 3RAQA 2HZVA 1APSA 4RLEA 2MQPA 1V6HA 1DARA 1UVKA 2GJ2A 4M5GA 4OI0A 3W63A 1GK8A 3UQSA 1RA6A 4LFCF 5KFDA 4LF4J 5HMYA 2R7TA 2HGMA 3NBPA 4X4VA 1E6YB 1R0BG 2VFVA 4K5SA 3I96A 1RWVB 2ZH2A 2BBEA 4HHJA 3PJ9A 2BABA 3UD3P 3VVTA 4F2SA 4DFJA 1N5YB 4YY3F 3S1TA 2GS8A 3M2RB 3Q2TC 1WDTA 2I6WA 1W2BR 4JYAF 4PPDA 5DG9A 3DGPA 2ATCB 1CVJA 1RTHA 5H9FJ 4CNYA 4IG3B 3IP0A 4IR9A 4WKYA 1SJ4P 2YWHA 2MQQA 4PR6A 4I56A 4J5OA 3TZYA 3LWLA 3K2YA 1UL3A 4PUOA 1KHWA 2Y9HA 1RCOB 1N32J 2P5VA 4Q44A 3KK1A 2LFVA 1PYSB 2ZVSA 3QPIA 2YPZA 1TL5A 5HI7A 4RW6B 3A1YG 4ZPBA 1NXIA 3I5AA 2COLA 4C3KA 4ED2A 2CPZA 1C2PA 4OX6A 2R7SA 2WBRA 1RAHB 3OPKA 3R6GB 1FJGJ 2OAUA 1C1BA 1F5BA 3QLHB 2Z56B 5L9NA 2QGFB 4KO0B 2Z58B 5BXIA 2E1AA 4UOHA 3S6EA 1U0SA 3M7VA 3KLFB 1QY7A 3IC1A 4ZPWR 2M0GB 4OJ1A 1VLOA 2B9WA 3SIPB 1S7HA 2E9ZA 4OV1A 4N8NA 1O51A 1RT7B 2HNYB 2E1CA 1I5OB 4FBTA 3PRBA 5EUHA 1LWFB 3G2XA 1K8AT 1RT4A 3DXSX 2BOPA 3CC4S 4NI2B 4YY3J 5KFCA 5IOLA 4JP8A 1OO0B 4WTOB 3C6UA 2V9KA 4ILMA 4JYAJ 1NEEA 3P6YC 1HNXF 1FE4A 5AXNA 1EKRA 5IZHA 3MHYA 3FJ2A 1DTTB 4N77A 3M8QB 2PC6A 1U48A 3TW0A 2ZBQA 3WIVA 4RU2A 3TNVA 2FPHX 1XERA 3VAJA 3DOLA 4ES3A 3QSYB 3MPVA 3L4BC 1R0CB 1RA7A 3DOMA 1AYEA 2E5GA 2Z0GA 4NLDA 3QBCA 3JSRA 3H5SA 1BHNA 4KH1B 2XY6A 2RS2A 3PW0A 2VPWB 3MR2A 1CEZA 3F0NA 2OFHX 2BJ8A 4HLBA 2GA7A 2ACMA 3DLLQ 1R6YA 3K8WA 2H9ZA 2B7BB 1KKHA 4MIWA 5CYQA 4ZHRA 3BBFA 2CJ9A 2VBXA 1NDLA 2XY7A 3CCTA 4ZIVA 3EVMA 5KFYA 1TK8A 1RACB 1D8YA 1Q8KA 1B0PA 3H2VE 3A12A 2UUCF 5M2PA 2KB2A 3FEZA 2L3MA 1RLDA 5GAHI 1YJTA 2VUGA 4MIAA 4ZVHA 3DXBA 1EAYC 2DNLA 2YTCA 5B09A 2KM8B 3UFCX 2XLJA 3DLEA 3P5TL 4L76A 3DLBA 2K1RA 1CQMA 3THPA 1URRA 2PDAA 1IVZA 1NKEA 1FWKA 3FMWA 3VAGA 2A1BA 1WACA 3SFUA 1MLAA 1NJYA 1X7VA 3TVKA 4EU0A 1WOPA 1CS4A 1VFJA 3A8KA 1SKSA 1FCAA 1WTBA 1TK5A 1WOSA 2Q66A 3W1YC 4EZ6A 4CO3A 3A8JA 1IKYA 2HK3A 2I5JA 3Q0AA 1UJ4A 2QA4S 4JV1A 3M30A 3B78A 4UW2A 4BBYA 1VQYA 3HSZA 4O0IA 1J2VA 4KHRA 3CEDA 5DDQC 2YX7A 1S7IA 1XEZA 4OJ3A 5F9NA 2VICA 4C8YA 2CWKA 2F9DA 4A8FA 2X1FA 4B08A 2MYFA 2MKKA 5AE1A 3LGNA 2LMIA 2H4WB 3C66A 2CNKB 4M5MA 4O3RA 2QL9B 2D74B 1VHFA 3FCWA 3NBPB 3ADAC 1Y5NB 1QSYA 1FHTA 3E51A 3NGKA 1TVRA 9RUBA 1K0VA 2X3DA 4F4KA 4HKQA 2V34A 1DQ8A 2DBBA 5BYRA 1DHMA 1S76D 5KFGA 2XEXA 3DGPB 4NWBA 4DL2A 1RTHB 4A46A 1WKJA 5KG5A 1TKZA 3CTRA 2W7PA 4DQRA 4G1QA 3M05A 1V3RA 2KKHA 4QPXA 1GMUA 3Q8RB 4PUOB 2VPZB 3KK1B 2HHQA 3W61A 2H5EA 2U1AA 1S1WA 2HG4A 5KFKA 4OX8A 2NXNA 1NSQA 4ILRA 4J9OA 1RAAB 4WPAA 2MB0B 1WHXA 1JXLA 5D0RA 2UU9J 4QPTA 2V2ZA 2L08A 1C1BB 1UFKA 8ATCB 4B3MF 4J90A 1KRPA 1HL6A 1RI7A 2JH3A 4EBDA 4ZA1A 2UXCF 2JEGA 4DQSA 4ZVGA 1XK8A 4DDFA 2RQKA 2WVCA 5HANA 1PJ7A 2BEFA 4M95A 3CJ4A 5HAOA 3W2VA 2A2CA 3CCWA 4DL7A 4YB5A 2M9KA 1NU4A 5K8OA 3ZZRA 4FYVB 1RP5A 2P2CB 1RT4B 2DGTA 2ZH3A 3C6UB 3PO4A 4FYDA 3CD0A 5E5NA 1H3DA 2FLLA 3PG9A 2KG0A 5CYMA 1YDLA 2C28A 3SBMA 1NK6A 2ZDOA 5EN1A 4I64A 4ENOA 4F0HA 4FF1A 2MSTA 2BVZA 2AD9A 2DHAA 1R8CA 1HWLA 1RWKB 3KK2A 4RUHA 4MAKA 2PEHA 3JSBA 1QTNB 2ZE2A 3THTA 4WIIA 2AGOA 3JYTA 3KLEA 2CPXA 5CYQB 4B3MJ 4ZHRB 3Q89A 1KQGB 2ILZA 1S72S 2OUGA 1HBUA 3THVA 2UXCJ 4QIGA 4DLGA 1VRQC 5KT2A 5F8JA 3UDCA 3M8PA 3ZXWA 4I2QA 2BW2A 4RBTA 1IN0A 2VL1A 2CJAA 1DQAA 4IUFA 1L3UA 4QIVA 2HKEA 4JV2A 3BGUA 2VONA 2LEPA 2Z2LA 3DLEB 4FVMA 4WCEQ 1G2EA 2K1RB 1Y3KA 3G6YA 1J27A 4B02A 5IS2A 3M6XA 4IRKA 3VAFA 1WKLA 2XHWA 3SCIE 3W7BA 2HNDA 2V63A 3EZUA 2B8QA 4HACA 3UW1A 1HD1A 5F3ZA 5GAGU 4G3IA 4CLLA 2YH0A 4KKOA 2UV8A 3ZZ0A 3Q86A 1F60B 4F02A 3LA0A 1IKYB 1YKWA 1N6QA 2I5JB 5KG0A 3J81U 3R5BA 3UD5A 4LIRA 3M30B 4W92B 4ERDA 3GWCA 2C2KB 2LP4A 3ENWA 2LQ5A 4DZDA 2FDNA 1OYDA 3AOCA 1SJFA 4Q8EA 2ZD1A 3CMAS 5KTQA 1UFWA 1QUPA 2ZEJA 4YHHF 2K2PA 3RAMA 1GXTA 2DR7A 1Y0HA 3QZ8A 1VRUB 2MQ8A 3IG1A 3LP0A 2JEFA 4M8LA 3IMQJ 4N41A 5DGAA 2LDIA 1VQMS 4NLQA 3VAMA 3G86A 1T3OA 3CF5Q 1H2UX 3QT6A 5B7WA 3KHGA 1UA1A 1PGZA 1TVRB 3P4UB 2WVBA 2CZ4A 2ERRA 1H74A 1U2RA 2H3EB 2CQDA 2WSFC 1T94A 4NEZA 3GCWP 3M9OB 5L9XA 4FF3A 5KT4A 4DX6A 4J37A 3HP6A 4WF9Q 1TKZB 4A8WA 5LMNJ 2RE1A 4G1QB 3BF4A 4DV6F 3KLIB 3EE3A 2HRYA 3UPFA 1TKTA 4CP5A 3CJ5A 4FNIA 3U02A 1AUDA 4QOTA 3GIIA 4XTTA 5KFNA 1SC3B 1S1WB 1OWXA 1ZAVA 2BJ7A 3M8WA 5GAEI 3KLHA 4LF7F 5HO4A 4ZLPA 4ZPAA 3N0VA 2ZITA 2B56A 1N8RT 2FVRA 3A13A 4FDFA 1S1TA 2RHQB 2HK2A 2AYGA 5DJBA 4QYZK 4D3HA 3T6BA 3RBDA 5AT1B 1Q1KA 3GMGA 1DURA 2JL9A 1QAXA 5ITHA 4Z7CA 1SQFA 2BKNA 2HVIA 1VLYA 1X31C 3DU5A 2PIIA 2J0XA 2CNLB 1LEOA 4YHHJ 1Y00A 2XLKA 2MHEA 2PT0A 4CCHA 3DRPB 3PRDA 1OSCA 4HI1A 3L3CA 4RO0A 1E6VA 2NPIA 2HHXA 4A4JA 3W2VB 1Q53A 3N28A 4ZVRB 3EYZA 3Q23A 5A0YA
chains in the Genus database with same CATH topology
1U1QA 1U24A 4NCGA 4MK7A 4PG8A 2VG7A 3UCGA 3N5BA 4MFBA 5GMKa 2VC1A 5KT3A 2DNYA 5EWFA 4RW9A 2BJDA 3O8WA 5DLFA 2XS5A 3MEDA 5CQGA 4P7VA 2CDQA 2W8KA 2BRKA 4A8SA 4ETXA 4UY8T 3DHWC 2HGLA 2ZM6F 4YB1P 2E7WA 1UEUA 1Z4UA 4U7UK 1GX5A 5DETA 4H4OA 4ES2A 2YKQA 3IWNC 3V5RA 5KFPA 3OFGA 3PO5A 1SL0A 1HWIA 3BREA 4E98A 3M9MB 3I5BA 5BJRA 4DF8A 1ZZNA 5CA5A 2VOOA 4IG0B 2F8HA 2MPUA 5CYMB 1JB0C 5HN0A 1XTZA 1YSJA 1JJ2R 4ID5A 1TUVA 3KHHA 1YJNS 2CFXA 2HVZA 3H2UB 2ZHOA 4WYWA 1GXLA 3H4BA 3BO4A 3V6KA 1KOHA 5DS7A 1NH8A 1QE1A 2A2DA 1ZM2A 1MNEA 1O5JA 3LALA 1X0FA 4NLTA 1J5EF 1YI2S 4LJMA 1HHSA 4DSIA 1FEHA 3HHNB 4PG4A 3POTB 1RAJA 1EP4A 2J0WA 1JLGB 1S97A 2AYEA 1SB6A 3MMBB 3OFFA 4YDDB 5FJ4A 3CC2S 2ZDPA 2F8MA 2P9GA 4KV8A 2MZ1A 3Q24A 1R27B 2KDOA 1M90T 2AU0A 1U7LA 5LSRA 4ED8A 3PNIA 1XC9A 3K5OA 4TXSA 4ZS6A 3X3UA 1EETA 2YH1A 1PC4A 2EI5A 2DNGA 5B08A 2W8LA 2DNRA 3KK2B 2NR0A 2PA8D 2HNZB 4I67A 1HYSA 3BQ1A 3N6NA 3MOJB 1FJ7A 2MKHA 3DRYA 1D9FA 2B9XA 2FLNA 1S77D 4HL9A 4ZKAA 4GO7X 3BB5A 4DV4F 4UUXA 1I94F 3NNCA 3O6QA 4J9NA 2ZE2B 2GQQA 1SUQA 3BDEA 4AFFA 1VQSA 2B7CB 4YDXA 2EFOA 1M1KT 1HWUA 5L8RC 2KXNB 4MKYA 2A10A 2J9CA 3MTJA 3QMQA 5B0GA 3JYTB 3KLEB 4DL3A 2CPDA 3E2EA 2ZZMA 3NS5A 3O5TB 2EFVA 4Z37A 3BGRB 4P2SA 1GX6A 1N5QA 3V6DA 4X64F 1F0XA 1SC6A 1IBMF 4MH8A 1T02A 3CCVS 4LSNB 1SH3A 2YKOA 3FEXB 1REVB 1LW0B 2CQ2A 2RB7A 1TAUA 1GH8A 1FRIA 3QAEA 5HBMA 3QYYA 4RW8B 3I55S 5A8RB 4YUDA 1KTVA 2FVCA 2VFUA 4K4XA 1N36F 5HP1B 2XI3A 4PQUB 3IBWA 3OXFA 1Q82T 4PXCA 3CT9A 3M8PB 2FJDB 4QWDA 2MZJA 4I2QB 3K57A 3M2VA 2K3KA 2C3PA 4Q2LA 1R0AA 2OD4A 5IT9Y 3GIJA 1FDAA 2HHPA 4ZP6A 4F3QA 2VC0A 3MMCA 2KI2A 2Z2MA 2XS2A 2AJQA 2M4MA 3Q8SB 3R1HA 3I0RB 4ECZA 2V4JB 3CVKA 3PDNA 3N01A 3I87A 2FTRA 3SQGA 4LQ3A 3KYLA 3GV8B 2RKIA 3I5CA 3MM6A 3G96A 5D78A 2KYXA 3K5MA 2A18A 2ADBA 3GSDA 2FC8A 2NZ4A 1H0HB 2OFGX 2V0NA 1R7IA 2VPXB 2YNFB 3AQPA 1TL3A 3PJXA 3S7RA 7FD1A 5HMZA 2ZOFA 5EWEA 4J9MA 2ALZA 1S0VA 3PX4A 4NRUA 4KFBB 3IR7B 1RT1B 2J9EA 1ZTWA 4EWTA 1WHVA 1XR6A 3FVYA 3AJ1A 3GYXB 5KT5A 2M3DA 3U7JA 3TR5A 2BR0A 4PG5A 5J2MA 4ED7A 2YY3A 2JEIA 2RMLA 2KZMA 2CPEA 4FBUA 2QSWA 3HM9A 1NNDA 2LECA 5CH7B 1Q7YT 2HNDB 3IAM9 4OZJA 1R8AA 3OTOF 2DR8A 2KJWA 3KNGA 4HTIA 4H4MB 4ED1A 4XPCA 1L3VA 1VC6A 3LP1B 1YHQS 2GX8A 4N47A 2QYCA 3HDSA 3GYNA 1HBMB 2B4UA 3RZAA 1HR0F 2HS0A 2EG1A 1NK8A 3CD7A 4O44B 2DHXA 3I9V9 2HHHF 1IUJA 2Q6BA 3CUNA 1SKWA 4KKOB 4NZ0A 1XNQF 4PG6A 2YKNA 5KFLA 3WDOA 5H1SV 2QV6A 3F44A 3T9ZA 4B9TA 4I7FB 4WZMA 3MEKA 4KSEB 5AXLA 1B64A 3MFHA 1YTYA 4I68A 4K2XA 4QWEA 3Q8PB 1VQOS 1QVFR 1N6QB 4MK8A 1Q79A 4X4RA 2UUWA 5C42B 1S6UA 3G6VA 3BO3A 3LP2B 4TYBA 2N3OA 4B3RF 1X4CA 2GO9A 2GQCA 1QSLA 1RT3B 4C0OC 4ATNA 4ZOSA 4LF9F 1RDRA 1A7GE 5EDWA 4RBUA 1H6KX 1XMBA 2DK2A 1ZPWX 1VRTA 2K3IA 3MR5A 3SEOA 1UVIA 4NZ6A 1MWZA 1BQNB 4TNOA 2R8IA 1S49A 3R3TA 2VFSA 3M2UB 1Z2LA 3DLHA 1C0TA 4OZ1A 4RWWA 4QU7A 2ZD1B 3CJ3A 2VA2A 4I6AA 2X1AA 4LF6F 2EBGA 1S0MA 2VH7A 3MPWA 5F9LA 2BZ2A 4A8KA 3C3LA 4YR2A 1S9GA 5EX3A 5DDRC 2XCAA 1R3NA 3DOLB 3JTOA 4A8MP 4QYZJ 1G6BA 2D9PA 3BN4A 2VFTA 3VR1A 2VB6A 1VQNS 2GV1A 2PI4A 2LA4A 1LWEA 3G8TA 3NGDA 4J9QA 2KN4A 1TKXA 4J9PA 3IG1B 3LP0B 2HZCA 2A3JA 2UVVA 1FD8A 3DN9A 2Y1JA 2DGOA 3HHDA 3M8RA 3CCSS 4ED0A 3WC0A 1NRKA 4RNOA 2E29A 3T5LA 2GNKA 2Y0SD 4IYQA 2GFFA 3K5LA 1D9AA 3MD1A 2KFNA 4TY9A 3UWTA 3M32A 2BJEA 4WXWA 4EYIB 3T1YF 1HPZA 4FXVA 4TLQA 1LW2B 2DH9A 1F9FA 5I42A 2X51A 5IT0A 2RF2A 2MDAA 4NXMF 2MQMA 1JLAA 3OFEA 4IDKA 1N52B 3TAMA 1M5VC 5E41A 1FRMA 4A8YA 5D3GB 1PC5A 1QTMA 2Y1RI 3NNHA 3GR0A 2OTLS 4ZVFA 4WYLA 4W90B 2VPYB 5I3UB 1AFJA 4FP9A 4KE5A 4C8MA 1N0UA 2ZNYA 3NCQA 5K8NA 2R7RA 2O67A 3TP2A 3H5UA 4DV2F 1FVQA 1IKXA 2VG6B 3V4MA 4LSLA 3CULA 3BN7A 5DGBA 3TOQA 1FJCA 2AGPA 3X1LB 1R31A 4NL5A 5DDOC 4P7TA 5E3PA 1HQUA 4UUWA 3V81A 3H59A 1SKRA 3T19A 2W9BA 2DHSA 4EO6A 3MEEB 3QO9B 2W9CA 2DJWA 2WBMA 3HVAA 3RBEA 5IT4A 3RU0A 3ITHA 1WG4A 1KLMB 1KVIA 3NLCA 4OZ0A 5FIIA 4PQAA 4PXDA 2FIUA 1MROA 4YEAA 3CE8A 1HBOA 1TKTB 2EG2A 3VAKA 2HFZA 2FHOB 3NS6A 4OX9F 4I1TA 1F5AA 1C4CA 5D4LA 2BQRA 2P6TA 4QWCA 5L39A 3C2PA 5CXTA 4J9KA 1FDBA 1TAQA 1S6PB 4NCAA 4FNHA 3Q22A 4RNHA 3NKYA 2N7CA 4OLPA 4UOCA 3B82A 3KK3A 3QJPA 2J76E 3HO1A 2AP6A 4HDGA 4AQYF 1TFWA 5LMNF 4PRFA 1H7XA 4DOZA 2P9CA 1MU2A 2KFYA 2AJ0A 3BO2A 1U8SA 2IJFA 1OSDA 1RJJA 5D4PA 1CLFA 4FS1A 2QSFA 4C2MA 3C6TB 4AL5A 4QR1A 4ZCIA 2FD2A 1V9OA 4X4NA 4LF5F 3MPYA 2VODA 4QIFA 1DTQB 3MM9A 3MR6A 3HXMA 3C8YA 1FXDA 1HMVB 3OR2A 3DLJA 3PKYA 2D41A 4KTQA 3KWMA 3HVWA 3D0IE 5IQQA 3DM2B 3U1MA 1N56A 2N82B 3OL9A 2XWYA 3BSAA 1FRKA 1JLCB 1S6QA 3IGVA 2MY8A 4WK1A 4J9LA 2XB2D 4NZ7A 1NKCA 1JLFB 3PY8A 4YP3A 2HHTA 4WFBQ 2M8HA 2V4RA 5GAGI 2KRRA 3JTPA 5E3QA 4JI2F 4Q0BA 2YKMA 1ZH5A 4K50A 2HGNA 2WOMB 1R8PA 2AV5A 2QA1A 3H20A 5KOWA 4ECRA 5C24B 4F3OA 2OMLA 2IRYA 4ELUA 2KZZA 2VBWA 4RW7A 2DNHA 2Q79A 2QLXA 4QIWD 2O1PA 5J2PA 5KT6A 2V2KA 3K7RA 1NJWA 4G1IA 1S79A 2E5JA 2OPPB 2NQPA 4G1PA 3FMBA 3JSMB 3BQ0A 2LYVA 4C98A 2JOQA 4IFYA 2M7SA 4IQMA 1DBDA 4C0HA 2CQ3A 3HKWA 2JVOA 4R5PB 1T7PA 2RS8A 2J7UA 2WK4A 2UZAA 3TYTA 4R8UA 3T3FA 4WE1A 3HZEA 2IBKA 3O44A 2CQPA 5MAOA 1TFYA 1KQFB 1VJWA 4A8QA 1KQSR 1NK4A 2GO8A 5IM0A 1N54B 2E1MC 3QIPB 2VKRA 2AJ1A 4B9UA 4WXOA 1E6VB 2FGCA 2GGPB 5LMUF 2MMYA 4FF4A 2P9EA 1E6YA 4QQBA 1VBXA 1S48A 4OJHA 5CCLA 5KFOA 3OHAA 2OP5A 4JBCA 3R5DA 5A0YB 1S99A 4LFAF 4NCGB 3LO3A 2VG7B 4C9DA 2V4QA 3K8VA 4OHWA 4MFBB 1RISA 3HVTA 3LW5C 3VQSA 4DQPA 4PG7A 3O3LA 2V8VA 2KM8C 5JUMA 2MZTA 1N5YA 3MEDB 4LT6A 2DO4A 2Q3PA 1QSSA 3TI0A 1ROFA 2BACA 3M2RA 4XO0A 1I1GA 1HI1A 3O1LA 5E33A 4NYPA 3DC2A 4H4OB 3EUNA 1RYSA 2D3ZA 3WZ0A 2GHVC 5AE3A 3FZ2A 4X66F 1OQ6A 2R9LA 2APOA 3PJWA 4MYTA 5CHCB 2KH9A 3M6UA 2JLGA 4IG3A 2UVWA 2FJVA 2ACYA 1M5SA 5THWA 3RRHA 3M1VA 4ID5B 2LVWA 2JWNA 2CQIA 3DRXA 1IJFB 2I0XA 1JLEB 2NUUG 3F73A 2CQ4A 4DR5F 2VASA 1B0TA 2PMHA 3HMJG 1QE1B 2QMWA 3R1LA 3EX7B 4OHZA 1VQ8S 2C2EA 2CJBA 4CI0B 3MDFA 1YJUA 2RVJA 4B9MA 4QW9A 3H5YA 3DNCA 1EP4B 1HBNA 4GC7A 2QT7A 4ZCLA 3OUYA 1AW0A 1FO1A 2KHDA 2XNQA 2DNZA 5LSOA 4Q8FA 1KTQA 4KV8B 4DSJA 1ZM9A 2V94A 1XN9A 4LVNP 1H98A 1Z1ZA 2OSRA 4LMZA 4BC9A 2BANA 5BYQA 4GMKA 1FA0A 5E2QA 2Y1IA 2K8GA 1EETB 4L6V3 2WCXA 5A2QY 2IVYA 4C8OA 3BGLA 4RW6A 3D54A 4CH0S 4C4WA 2DD8S 4Q45A 4OZNA 1KSPA 2XNRA 4DLEA 4IH7A 2CRLA 3BJYA 2EVZA 4FF2A 1IXKA 2GIQA 1X9MA 2MY7A 4K4SA 3IAS9 2XG8A 1T03A 4G6VB 1SUQB 4UQGA 4ECVA 1YJWS 2RT3A 2IA0A 1YGYA 3L7PA 2PI5A 2IJNA 5E3AA 2KG1A 5GAHU 3FZBA 4ICLA 2GCFA 2ZNZA 2MKJA 3NMRA 3MMJA 2B4VA 4WK3A 3ZZYA 1Y9OA 1Q7LB 2JHEA 1U09A 3AB4B 1T05A 3V6DB 3CC7S 2OO4A 3MR3A 4KPYA 3GG0A 3QLHA 4EZ9A 1ZAWA 3KLGA 2E44A 4V19J 1OQ3A 5JVGQ 1M5OC 4KO0A 2FB0A 4P6QA 4B3OA 1VBYA 3VWSA 1XNRF 1MWYA 4TKTA 1U25A 2HQ3A 2CPFA 5HBMB 3QJJA 4ALZA 3TUZC 5AJ3F 4Y00A 2MZQA 3KLFA 4QW8A 4XK8C 3RAXA 2DGUA 2HHUA 2EWHA 2I9SA 3NCPA 4RNNA 3BSCA 2YNHB 4X65F 3TUJC 1KNZA 2IFXA 1U4BA 1IQTA 2ZOMA 2K7KA 3PEHA 2GMLA 2N7YA 2AJFE 4TU9A 1R0AB 1G1XA 3OJUA 4IFVB 3CJ2A 1BD6A 1GTEA 5I3PA 1K1SA 2OLWA 3MMCB 4ZVEA 1T3NA 5L1IA 4F4WA 3MF5A 1YJVA 1UKUA 2RUGA 3ENQA 4XAKA 4O23A 4O3QA 2XSFA 3SQGB 1VC0A 2RKIB 3MM6B 5MLCV 3F56A 3DFEA 3NRBA 3FCHA 4I6YA 4F26A 1RT7A 1X5TA 1GTHA 3HF5A 2HNYA 3H40A 1HNWF 1FDNA 4YR0A 1LWFA 3TAQA 2QIFA 5HQ8A 2R7VA 3UR0A 2AW0A 4DV1F 1RTJA 2B4PA 4MKBA 2I8EA 3MXHP 5K5MA 2UUBF 4GKKF 4FPRA 1N33F 2AQ4A 3DYAA 3AB2B 3GR1A 1O8BA 2QLWA 5J2MB 4NXNF 1KR4A 5L1KA 4IH5A 4WFAQ 3ZZOA 4C8LA 1ULRA 3KLVA 1QAJA 3AY0A 2DGQA 3D0HE 3VQTA 1IBKF 2ZH7A 2FHMA 4KBIA 2RSQA 4R25A 1HWKA 3FDSA 5KFZA 5SZTA 1SJ1A 3CXCR 2EFPA 3OJSA 2VZ9A 5IQ6A 2YQ3A 4QR0A 3SDEA 4RZRA 2FJWA 4B9SA 5BR8F 1JXEA 1DTTA 4LF8F 2ZH8A 2YKNB 3T6JA 5KFSA 2QZ8A 3M8QA 3NAIA 5HMWA 1PO6A 1TK0A 5EHHA 3LAMA 1JLQA 1SBRA 5F8IA 2Z8QA 5J1PA 4DS4A 4ECTA 1WHWA 3CIMA 2IVFB 4K4YA 3OR1A 4EBCA 2E5LF 2HHVA 5B0AA 3HHLA 4ZPCA 2JEJA 3PR4A 2WSCC 3MUVP 3CD6S 4KHPF 2F40A 3L7OA 2KXFA 1YRUA 3CJ0A 1Z2ZA 2HAIA 5B0CA 4YOEA 4OL8A 1UP1A 2RQMA 2YNIA 3TUIC 2Q1LA 1VRUA 2DGWA 3HFKA 2ZH4A 2W25A 3IS9A 4WZQA 3ISZA 1VRTB 4ELTA 1FXLA 1HW8A 2E9TA 2JZ5A 3ULHA 4YFUA 2XZWA 3HZGA 4K5RA 2OJ3A 2PA3A 2RNEA 4Y34A 4MYUA 1WG1A 2FJEB 1C0TB 3OFHA 2FHKA 1DLOB 4AL6A 4QCLA 1QLNA 3PZPA 1P27B 2WONA 2AX0A 5J1EA 5KFMA 3ZFVA 4USHA 1X5PA 2LXFA 3E01A 5F0WA 1FTCA 1RT2A 1UEVA 1ZPVA 1H38A 4IH6A 1X4BA 2CJQA 3P3DA 4PKDB 3N9UC 2HHSA 4YR3A 1K0TA 2HMIA 1R89A 1TKXB 4HT7A 1SJQA 3CDWA 4DL0C 3NNAA 2MGZA 4ECXA 2BDPA 2CPJA 1VBZA 5M2RA 1WI6A 4BC7A 4LF4F 1UVNA 2M70A 3ZZTA 3ZZPA 4EFAC 5LXRA 1VIXA 4ETZA 1S10A 1SIWB 2IHR1 4NX9A 2R7WA 3M32B 3MWBA 2IBOA 4Q7AA 2ASLA 1U26A 1HPZB 2EK1A 3WBZA 4C3MA 2C3UA 2DNQA 4HT5A 2CIMA 1OPZA 1UWBA 2PE8A 1NH7A 5I42B 3J7Z5 3EPGA 3K58A 3N5FA 2ZH1A 4EYHB 2RF2B 2RRAA 3HHLD 3EGZA 2OMOA 1KFSA 2JDJA 1JLAB 4IDKB 1RT5A 3TAMB 4M1KA 4U6PA 2FY1A 4WJBA 1KC8T 2UXDF