3PKYA

Polymerase domain from mycobacterium tuberculosis ligase d in complex with dna, utp and manganese.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
287
structure length
287
Chain Sequence
EQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Putative DNA ligase-like protein
publication title Structure of a Preternary Complex Involving a Prokaryotic NHEJ DNA Polymerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 85
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pkyA02
2IRYA 2IRUA 2R9LA 4MKYA 3PKYA 2IRXA
chains in the Genus database with same CATH superfamily
3JSRA 3FMBA 5IM0B 4NZ0A 3RTVA 1NDLA 1EQMA 5KOXA 1K47A 3IP0A 3OL7A 2I1RA 3NAIA 3ZZZA 4K4SA 5HJYA 4OI0A 4Q7AA 1PAUB 2IM1A 2XMAA 2UV8G 3I55S 1CJTA 3PXGa 2WW8A 4NXMF 3L7UA 4C8YA 2DRDA 2W9CA 1NJIT 3RR7A 2CUYA 3HK2A 2RU9A 5C2GA 1FRHA 4OZLA 2PMZD 2GVZB 1S0OA 3TX8A 2W7OA 2AF6A 2QSFA 2DNHA 2EK6A 2QA4G 3M9MB 3HX9A 1VOMA 2KXHA 2YKMA 5JJBA 4DN9A 3FBFA 4NI2A 2XM3A 1FFSB 1VC6A 1RAFB 4I67A 2EKNA 1R8PA 4RW8B 1HBMB 5DETA 1RXOB 5HVFA 3W61A 3BR9A 3M8YA 1UVKA 3KOAA 3I0RB 4ZP6A 1VS3A 4P75A 2YH1A 4EMDA 3Q8QB 4LBIA 4C8MA 5C42B 2CPHA 2P6SA 3TA0A 1LK7A 4QOTA 5KFEA 4TQSA 4K5SA 3ZTSA 3V6DA 4DL2A 3V5RA 2J6SA 4Y2CA 2XMVA 2V63A 1SKWA 2Q1LA 1UKUA 4ILRA 1FJGJ 1VK3A 1LK5A 4I64A 2HZVA 2G2ZA 4KHRA 4LRCA 4KT0C 2CQCA 3X1LB 3KG4A 1S9GB 3FKBA 4HH1A 2OFHX 1NEEA 1BLUA 3QZ8A 5JXSA 4J90A 1HI8A 3FVYA 3CDBA 3KK2B 2RDIA 4DV6F 1PGZA 4NE9C 2MSSA 1FVSA 3C14B 2HZCA 3UDVA 1I94J 3BQ2A 4ES3A 3MM7B 1Q8IA 1IBLF 2YWWA 1RHMB 1DHMA 4X64J 2B9WA 2VBYA 1I1GA 1I51B 1LW0B 4J5OA 4IH5A 5EGYA 4WIIA 2BW7A 2DGSA 3LOUA 3IG1B 1SJ3P 4JI7F 3PJXA 2MQ8A 3KHRA 3KLGA 2H9ZA 4IOBA 5K14B 8RUCA 5ETLA 5KFSA 4K0KJ 5CYJA 1S10A 1JMTA 2HGLA 1T8EA 2ZH5A 4G1IA 2D3ZA 2KFYA 1RWXB 2NUUG 2ZUAA 3FC9A 4ECWA 4LRBA 2KT2A 4JI5F 2HBRB 3BB5A 4AL6A 5HSPA 2B4UA 1S1WA 3CXCR 2HHXA 2R2TA 2Z30B 4BWJA 3TO8A 1B0PA 2OFGX 1EP4B 3RJMB 2KG0A 4EBCA 4I2PA 5H9FK 4R5PA 4DWIA 3CDEA 4B9LA 5KG1A 2I2YA 2VQEF 2RQMA 4USHA 4RLEA 3OUYA 1XTZA 4DLGA 3ADAC 4DUTA 4ZVTB 1D9AA 1UEVA 4M5MA 4O3NA 3MI7X 2V2VA 5CAAA 1YI2S 3UDLA 5DGAA 1IBKJ 1WC0A 2LQ5A 5THWA 1H72C 4C0BA 4X4SA 4CO1A 4CQ1A 4RWWA 1JLBA 1TL7B 3BSCA 3CPWR 5A76A 3DLGA 5DLGA 2E5HA 5DG8A 1U09A 3ICLA 1PCAA 4B3OA 2ZBRA 4ZVGA 1FESA 2D3UA 3LGHA 2M0GB 5J2NA 1Y5NB 4EFAC 1ULRA 4HACB 4N8OA 3OHAA 4QR2A 5EWGA 3GONA 3GYXB 4CLTA 5KFPA 4DR4F 3CB4A 3SZ2A 3D9BA 3PX4A 4F4AA 1C4CA 1SJQA 3KUGA 4CLPA 2R8GA 2KYZA 4AQYJ 2DT9A 3H2UB 4CNZA 5D4PA 5K8OA 3OSNA 1WC4A 5A2QY 1O0PA 1FJEB 4IFVA 3EVWA 2FLPA 1XIQA 4UUWA 3VGVA 2PC6A 4ECTA 2WSCC 2B4PA 2ZD1B 1DTQB 4G6VB 2KT5A 4PWDA 5DG7A 3RU0A 3GZ7A 3KG1A 4DV2F 2MMYA 2GVDB 4ETXA 1NM2A 4DR1F 1VHFA 1H3DA 5LMUF 3PKYA 2IIHA 3D3BJ 4F3OA 1L3VA 1HL6A 3PKMA 3LGMA 1DFDA 1NU4A 3AD9C 4OL8A 2K2PA 3G8QA 2LYVA 5H1SV 3R5DA 4J9RA 2LDYA 3KTQA 3EGWB 2J0SD 4LF6F 2HFSA 5EDWA 3W5ZA 1FE4A 3N6NA 1HKAA 4DLEA 2UXCJ 2F1FA 2HS4A 5RUBA 1QY7A 3CJKA 1LXJA 3G82B 4ETZA 4U7UD 4X2BA 4ECQA 3BKTA 4WTYA 1ZA1B 1XBWA 2ZHOA 3MCOA 1XMOJ 1VRQC 2V67A 2OMLA 2E1RA 4QWDA 3CJTA 3P4UB 4I1TA 3UR3C 2JSXA 3CCZA 1JLGB 2E1CA 1SJ4P 5IZHA 4HTIA 4RO0A 3M8WA 1P6TA 3RBXA 4CT8A 3D68A 3GV8B 2DBBA 2PE8A 3D3CJ 2HNZB 4Q0BB 1EX8A 3RAQA 3LP1A 2QG9B 1B64A 1I5OB 1GX6A 2C3MA 4GVBA 2V8PA 4ED5A 3LGNA 3KK1A 3FCVA 1KSPA 3EGVA 5K8PA 4LF4F 3CF5Q 2OELA 3DLKA 4NASA 1HNVA 2LECA 4ZVEA 2R7RA 2VG6A 3DNCA 4DL6A 4LREA 2AEFA 5D15A 4H4OB 4OX6A 3VZHA 2CPDA 3K0JA 4OHXA 4OYWA 3GIKA 3MUMP 2E9ZA 2AP6A 5M2RA 2UU9F 3N4WA 4B9UA 3SDEA 2MY8A 2HK3A 2N3LA 3VAMA 2ACYA 4O3QA 5BYSA 3CMAS 2IFXA 2M7SA 1OWXA 3M2RA 4QWBA 1OYEA 3Q8RB 4WFNQ 4IFYB 3OL8A 5GMKa 3DLEA 2QSWA 4IYQA 3HSZA 4UW2A 2LVWA 2QLJB 1WDDA 2IA0A 1E6YB 2HHQA 2IYGA 1R0AB 2XS7A 4YHHF 2YKPA 2W2OP 5CCMA 4M5HA 2DITA 5KFCA 5ETQA 4CLFA 3PDNA 1RTIA 3LF0A 3LP2A 5F8JA 2GGPB 3KLFA 3R6LB 4WCEQ 1NZAA 4DSIA 4M5LA 3QGGA 4XPEA 2F7VA 5AJ3J 1HBNB 3W64A 2B56A 1N5YB 1WF0A 4JI6F 1APSA 4O0IA 3KNGA 3E01B 1TKZB 5CZVA 5HJXA 5FDLB 1HNXF 5T7LB 1C0TB 2B6AB 4KHPF 3CCTA 2H4YB 4XK8C 3WC0A 2YQ1A 2AD9A 2QFIA 4YS2A 2VG7B 2JHEA 5B09A 1FRLA 2DGTA 1P1TA 1U02A 3C6TB 1C2PA 3TUJC 3W9JA 1KVKA 1WELA 2RVJA 3V2UC 4KH1B 2YKAA 3G9CA 1TVRB 3MR7A 1UEUA 2B9XA 1ICEB 3JQMA 4DFPA 4M5JA 4WJBA 3HHKA 3ONQA 3C19A 5B0GA 5IV3A 4KHMA 4EBDA 1VQLS 2QTWA 3P8BB 5HVHA 4WFXA 4OI3A 3DRSB 2GJFA 2Z57B 3QGPA 5IC6B 2WAQD 1UWAA 5GAHI 3DRRA 2LMIA 1S57A 4ECXA 4BC7A 1R27B 2DIVA 4DQPA 2BMBA 3PYFA 2W8LA 3KJVB 2DD8S 4DCJB 5F3TA 2QEXS 3NGTA 4FYWB 1WJ9A 2ROPA 1YGYA 3BYPA 2PFFB 1ZAVA 1B0TA 3TYTA 1X4HA 4BBYA 3D2WA 4B9TA 1MMNA 4ZOSA 6FD1A 4Z37A 2NSBA 3W2WA 1SL1A 2W25A 3Q2TC 1R7IA 4KGXB 4W4MA 2C28A 5HQLA 1RUSA 1NHKL 2QE5A 1YITS 3CJ3A 3B78A 4ZVHA 9ATCB 3RW6A 2F4VJ 1URRA 4P7VA 3T1YF 1YJRA 5KAKA 1XQIA 1NHVA 1R6VA 2QV6A 3FQLA 3H4DA 3HHLD 3N0VA 2UVWA 1Y5IB 3OLAA 4U95A 4NLGA 3D1QA 2HQGA 5E0OA 4EEYA 1IXKA 4RUBA 3BQ1A 4X66F 2VIHA 1RWVB 2ZH7A 3MM9B 4JI0F 3WIVA 4CTAA 4LFAF 3MR5A 2FHOB 2G1DA 4CLKA 4ZJOA 3HSJA 2P9EA 4ZJQA 2KO1A 5EWFA 5DDPC 4DMZA 3RAMA 1PJ7A 1GQEA 1IKYB 2CQHA 2PGCA 3TUPA 4OYXA 4DZDA 2W01A 3QSYB 1N32J 3OXGA 4CT9A 1L5UA 3NL0A 2F9JA 2G9OA 4F0KA 1U26A 4WP9A 4IDKA 1URNA 4OLOA 4P73A 2HK2A 4QCLA 5EHHA 1RYRA 2A10A 3K5NA 1C4AA 2GO9A 2CQ3A 1ZBTA 3A12A 1NCLA 4OX9J 3IWNC 3W9HA 3GFZA 3HHLA 3LQVA 1EJ7L 4ED6A 2DNQA 3H2LA 3CJ2A 4ECSA 3HHLC 3MFHA 4UQTA 4U6PA 2PA3A 3QO9B 2P8IA 1R0CB 3EPGA 4QWEA 2NS1B 2KXFA 2HS3A 2M70A 4O4GA 4X4QA 2DNRA 1CS4B 1IM4A 2IVYA 1NK6A 3GSIA 1XNRF 5A8RB 1ZPWX 4ENOA 2D74B 1KDNA 2BDPA 2FQQB 4NLUA 3DMJB 1N36J 4OHWA 4DUYJ 1HIYA 2G13A 3HMJG 1T02A 2OTJS 2OPRB 3IAS9 3NNHA 1XNQF 3ILLA 4IG3A 4PCQA 3OTDA 4ZN1A 2UP1A 3M8PA 1ZTTA 4DR5F 3GE9A 4USMA 4DQRA 3I4HX 3ISND 2W4CA 3MMBB 3MMCB 3DOMA 4F4XA 1B3TA 1AFIA 1S1VA 3C2PA 5IWAF 3MECB 1T03B 1X4GA 1RU2A 2GJIA 1WKLA 5T41A 1ITPA 3FBEA 1BQNA 1BHNA 3EXYA 2L9WA 1PSDA 2RU3A 3TJAA 4U67Q 4LJMA 1LWCB 3WC2A 4DV3F 3UD5A 1J2VA 3ISZA 2FJWA 1A7GE 2DGVA 4I6WA 3ILIA 3E2EA 2YBVA 3L4BC 4J7CA 1U8SA 4IH7A 2HYIB 1N0VC 2BJ7A 3TA2A 4ZVOB 3RBDA 2EG2A 3HD1A 1IWAA 2G0JA 5FIIA 2AV5A 3VR1A 4F7VA 3FRZA 4FZVA 2RDJA 1FA0A 3CJ4A 4RNOA 3FRYA 2ABYA 5KG2A 2JEFA 1SH2A 2ZNYA 2G0IA 3J80Y 1F3VA 3F44A 3ULHA 1MWYA 1X9WA 3BO4A 2RS8A 3BV8A 3V6KA 2LXIA 4DPXA 3IWXA 4A48A 1IUJA 2XI3A 3HVTB 1KKHA 1N0UA 2K8GA 2KDOA 2L08A 1GMWA 1VFJA 1JLCB 4IRDA 1Q5VA 4MKVA 3V4IB 1VQ9S 1GT8A 1CJKB 4USJC 2DEJA 4RL1A 5EWEA 3KUHA 4G3IA 3NGKA 4H54A 4FN5A 1GXTA 5D0EA 8AT1B 3EE3A 3QQCD 4CYUB 2K3KA 3HT3A 1D9DA 5KFIA 3QLHB 2JEIA 2D3OR 1HR0J 3C16B 4ZCIA 2M8HA 3BO2A 3PO5A 4HYKA 3UO0A 4DUZJ 4JV0A 4TQRA 4K50A 1S6QB 4LFBJ 4B9MA 2YWHA 1SJFA 2H51B 5D3GA 3AT1B 3KDOA 4C8LA 2MQLA 1X8DA 4NYZA 2VPZB 5H9FJ 4AXJA 3BYRA 1MNEA 2AJ2A 2IM0A 2MHEA 2IM2A 2F40A 2ZKTA 3KLIA 4XDCA 1WTBA 1NDPA 1FDAA 1VJQA 4YEAA 1UFLA 2WOMA 2IMWP 1DARA 3HHEA 2QYCA 2LA6A 2WVFA 3JB9k 1DY3A 2XZWA 3DCAA 4ILLA 4GKJF 3OR2A 3QNWB 5IM0A 5F9LA 4R0EA 3GJTB 1VIOA 2VBWA 3KKFA 1N34F 2E29A 1U49A 2FZKB 3VVTA 3JTNA 2DCLA 4KE5A 4P72A 1WEXA 4XO0A 4QYZK 2JZ5A 4N8NA 2H54B 4OZ0A 4LF9F 2FLOA 2RH3A 3UR0A 1G6BA 4NLRA 2GVZA 4EGLA 2IJRA 3QSIA 1KVJA 1YIJS 2FZCB 2JDJA 3OLBA 2W2NP 3TUZC 5FLXY 1T7PA 3HLUA 1U1MA 3C66A 4J37A 4IRCA 3PW4A 4AL5A 2XHCA 2K1RB 1VQYA 1KHVA 2JEJA 4RW8A 1HBMA 4DL7A 1CJUB 4YOEA 5B0CA 3OJSA 4F3MA 2B9YA 2PT0A 2H3EB 2DHHA 3I0RA 5E7OB 2NXJA 4KAIA 4OZ5A 4YB6A 1QM9A 5C42A 2DGOA 3QIDA 2VB6A 1JJ4A 2M5YA 2XGQA 2CVIA 4LRAA 2W2PP 4ECVA 2BOPA 4DPUA 5HI7A 4UZBA 3EM1A 4O44B 1JXLA 3CCVS 1YRXA 2RKIB 4HHUA 3M8SA 5HAOA 1YWXA 3UN5A 4KR0B 3QAUA 4DV5J 2QL9B 1FK9B 1PG5B 5G0RB 2CJQA 2ZVIA 5KFKA 4LF8F 3KK2A 3PYDA 3I5CA 1N56A 3C14A 1WEZA 3BJYA 2Z2MA 1M5OC 3WBZA 2R7WA 2QJ3A 3MM7A 4WU3A 1JB0C 4N56A 5DZ6A 4ZA1A 1OYDA 5KFAA 1M5HA 5IS2A 1PBAA 4LRFA 1LW0A 2HHWA 3D0IE 4FPRA 4QIEA 2FVQA 4LBHA 3PR5B 3ZZPA 3IG1A 4QQBA 2R7QA 4DR3F 4DOZA 1K0TA 3IRWP 1HWLA 2WVBA 5K14A 4DN0A 2XMTA 2YQ0A 3GR1A 2FHJA 3BGOP 4USKA 3IC1A 3K58A 2AHOB 1KONA 1V3SA 2UVRA 1EETB 4URGA 4UTGA 3HVRA 3D67A 1QSSA 3K59A 1R89A 2WBRA 4OI2A 2V34A 4F67A 2DR9A 4FBTA 1LOUA 5BR8F 2CXEA 1NPPA 1EP4A 2YWGA 4DSKA 3DKDA 3BO3A 2R42A 1S79A 2CG4A 4KGVB 3T5LA 3W8GA 3BGRB 4M5KA 2CVEA 4KSEB 2AT1B 1M0SA 5D0RA 2NPFA 1X0PA 4E98A 2V4RA 3DRXA 4ATNA 4WZMA 5GAGU 1FEHA 2VDHA 4WXWA 4CRJA 1PJ5A 5GVQA 2QO3A 1TL1B 5L1JA 1FFWB 2BKOA 3KNAA 2HQIA 5FD1A 4PG7A 1B7FA 2HNDB 4RPFA 3TQ1A 3CDUA 2Y9HA 2YNHB 1RTJB 3GJQB 2XEXA 2LEPA 2HWIA 4PR6A 1JJHA 2ZOGA 3PRVA 1XR5A 4BDPA 1RGVA 1HMVB 1V5IB 4YR2A 1JLAB 5KFMA 2JC1A 1WG4A 4C98A 1XEZA 1CSJA 3U1MA 1VMBA 1GFWB 4TKTA 3IFEA 2HQDA 4TY8B 1AA1B 5KFXA 2HWHA 1T94A 1HHSA 2EVZA 3NS6A 2O3DA 3SSSA 5EX0A 1WC6A 5T14A 3EWGA 2XC9A 1TKDA 1F2GA 2ALZA 4WKRA 2IJNA 1FKOB 1H2TZ 2YNIB 4KGKA 2BE2B 2ADBA 4RBTA 1FHTA 2ACMA 3M8QB 2MQMA 2MKIA 4HI2A 3BF4A 3QZ7A 4DDFA 3AJ1A 5DQGA 2RT3A 1RTZA 4OJ3A 3Q83A 2OPSB 1ZZFA 2ZD1A 2QIFA 3OUYB 1DTQA 2H5JB 3RAXA 1U2RA 1RWOB 2HRUA 4CO2A 1LWEB 2X51A 2RUSA 3OL6A 2MSTA 2GVDA 2EW9A 3GIJA 1FX2A 4YR0A 2R2RA 2BRKA 4L3KA 3N6LA 4ZCKA 4EBEA 2Y8YA 4PWWA 3HZEA 2PD1A 3IM8A 4HDHA 4ID5B 2AYGA 2DXEA 1WF2A 2XS5A 1H7XA 4LQ9A 5LM7E 2POKA 4LFCJ 3GCWP 2RSQA 4ZIWA 5KFQA 4MH8A 3G82A 1RT1B 4P52A 4I7FB 2QMWA 1VK8A 3MURP 1Y11A 1RSCA 1S5ZA 3ZTRA 3AXKA 4LF5F 3GMGA 2DH8A 3NEKA 3M6VA 4J9QA 4UQGA 2C3UA 3KK3B 4DR6J 1JLGA 1TL3B 1W25A 4V19X 4ELVA 3M2VB 1RWWB 4GKKJ 4RU2A 4H4KA 4OZNA 2HFVA 2MLYA 2DY1A 3PR4A 1YJVA 2EWHA 2AYBA 2HNZA 4H4KC 3EJMA 4Q0BA 1DTTA 5CYMB 4CM0A 3KMQA 2VV5A 2KVIA 5D4LA 1YJ7A 4JI2F 2Y1JA 2VJUA 4F4WA 5IV4A 1VRTB 3WQPA 4Q45A 4EO8A 7AT1B 4TLQA 1TELA 2DHXA 2OUGA 1FRKA 1JXEA 1QAYA 4JB8B 1FE0A 2RS2A 5F8HA 4H4OA 1Y3JA 3NGRA 4XIUA 2YWFA 3EDRB 3S8SA 2NXUA 1UJ6A 4KO0B 1TL5A 1PC4A 1XERA 2KB2A 4OZ3A 1VLOA 3TEGA 2MKYA 3N79A 1JIHA 1NH8A 2NQPA 1RB0A 2OPPB 2MZJA 1I6JA 4IFYA 3IBWA 2JJ4D 4DG1B 2YWKA 5I3QA 3R5GA 1NPRA 4WTOB 3MR6A 2V9KA 4OI1A 5LJ3Y 2FVRA 1BWEA 2IMOA 1RTDB 2EFNA 1E6YA 1R0AA 3UVJB 2PIIA 2QLFB 4Q2LA 5IT4A 2KM8B 1R8AA 2YY3A 1HNZJ 3SIPB 4MIAA 4Y2KA 2ADCA 3DRPB 3C15B 4N77A 2JX2A 4GO7X 2CWXA 4RJVA 5KG4A 2DK2A 1YRTA 3UFCX 2GGPA 2AWZA 2J0QD 4NA1A 1L3SA 4DV4J 1YHQS 4HT5A 3MEEB 2DO0A 3EZ5A 4DV1J 1G2EA 2XWXA 2XS2A 2EXUA 1HBNA 1Z1ZA 1F9FA 3CVKA 4MYTA 1N5YA 1IKXB 3SCJE 3CC4S 3E01A 1SUQB 1TKZA 1VISA 3IM9A 2YKQA 5K5MA 5FDLA 5T7LA 1C0TA 2B6AA 2MZSA 4BS2A 1SC1B 1OS5A 2ZJPQ 3FDSA 1J5EF 2CQGA 1UJ5A 4L6V3 1RBLA 1HD0A 3FEZA 4LR9A 4F26A 5H9EJ 2GX8A 4KFBB 2FD2A 4K7QA 2CPZA 2V4QA 2HBQB 1X4EA 5KFNA 3JYTB 2BM1A 4ED8A 1UL3A 4DX6A 3CD0A 4DPOA 4ZLJA 3SI8A 2CAJA 2VPXB 1TVRA 1FFGB 3NAHA 2HHSA 1WHWA 5C25B 1IWGA 3JAMY 2K3IA 5KG7A 5J1NA 4MIWA 1X5TA 4X62J 1R6YA 2KU7A 1ZAWA 2RILA 3DRSA 2PI4A 4LSNA 1XMQJ 3HFZB 4E2FB 2VU5A 5KFUA 2V5HG 3CMES 4YDDB 3BH7B 2FHKA 3KJVA 4ICLB 1WUUA 4Q43A 4ZHRA 2OTLS 3DYAA 2AZ1A 1L3KA 2ROGA 2GAHC 1DQ8A 1LWXA 1FF2A 3N01A 3CCUS 4Z2XA 1G1XA 4YB1P 3NCPA 1M5SA 2DR5A 2O01C 5CD4H 1X5SA 2ZH4A 4JYAJ 2HAIA 1SV5B 1UVIA 4YQWA 2HIYA 4DV0F 2PO4A 2KJVA 1P9YA 3V6JA 3J7AN 4X84A 1ZPVA 5JUMA 4K2XA 2RF2B 3O5TB 2V2QA 2AJ4A 3FSIA 5LXYA 2HGNA 2FC8A 2AEMA 1N33F 1FCAA 1NK5A 1UP1A 2Y0SD 1B0VA 1GX5A 4AD6A 1BXNA 2H1YA 3ZZTA 2X1FA 4R8UB 1R31A 2KFZA 1UA0A 3MM9A 1SL0A 4HLBA 2FB0A 3SCLE 1RP5A 2I38A 4XDDA 4LVNP 1VCTA 1BY9A 2WVCA 1IKYA 4X65F 2VBZA 3IR6B 3HHNB 4J9VA 5KFHA 3CD6S 3L09A 1MN9A 2DNNA 4FS2A 2I0XA 3D6HB 4E8UA 2MXYA 1T9YA 3VQTA 4WKYA 2RUGA 1U0HB 1SB6A 2XLJA 5DJBA 2QA4S 3PX0A 1YVFA 3CIMA 3O3LA 4Y00A 3H90A 2ZM6F 2WK4A 3ZC4A 2PSZA 3QO9A 2FVPA 3PJWA 4OFZA 4ELUA 3LTOA 4C9DA 4JI8J 1KOHA 4ZN3A 2D7SA 2RE1A 2ZHBA 3HM9A 1CS4A 2OP5A 1FJ7A 4DU8A 2GNKA 3ZZYA 5A8RA 1RAHB 4CH7A 1WD6A 5IQ6A 2J9EA 2CDRB 4ECRA 2M52A 1X4AA 3DMJA 3FQKA 1IQTA 4TLRA 2X3DA 1UW9A 4ZVRB 3BGLA 5AXNA 2UV8A 4FXVA 2WZ1A 1NSKL 4K59A 4A8YA 3GPAA 4OX7A 2OPRA 3VAGA 3DGVA 4CTAB 1LNQA 3H5UA 3EX7B 4L76A 2APOA 2J0XA 2JOQA 3FZBA 3UCZP 2GQCA 3QJPA 2UUCJ 4PYDA 3PFEA 5KFJA 4QYZJ 5ETVA 3MMBA 4OYZA 3GJSB 2MZTA 1NSPA 2UUAJ 3MMCA 2WCXA 4RW4B 3KFWX 1RI7A 5B0AA 3GJRB 3MECA 1T03A 3RGIA 3POTB 2Y8WA 3KWMA 3KJNB 4KIAA 3W5YA 2DH7A 3O1LA 4UZCA 3QAEA 2YX1A 5LMNJ 1IBMJ 4P2FA 1NRKA 4ALZA 4OZ2A 1O8BA 5M2UA 2CQ0A 1Q4RA 4DV7J 2BJ3A 4CLUA 2CQ1A 1LWCA 3ZO7A 3KUEA 2AGPA 1AXQA 2C3YA 2W24A 2QN6B 4NMLA 2RHSB 2WW4A 3JSMB 5EX3A 2VC1A 2OPQB 2E7WA 4UF4A 3MTKA 3IWLA 4A8QA 4NLWA 1RT7B 3C8YA 4WE1B 2YXLA 4FYDA 1HA1A 2UZAA 2JWNA 4CCHA 5HK4A 4ECYA 3MXHP 4KPYA 1D3WA 4B3TJ 3TAPA 1NUEA 2R7VA 2COLA 2QLXA 3NG8A 4YUDA 1Q7LB 2CQ2A 3OXLA 3KJFB 3OPKA 1QE1B 4CO3A 2Y3YA 1RABB 4FYYB 2J8SA 2R8IA 2CZ9A 3DDKA 4HHJA 1D1UA 2N4DA 3D0GE 2DHSA 2L9DA 1OIAA 3I96A 3DLBA 2J7WA 5DM7Q 3BREA 1WHVA 2XI2A 1Y00A 2YQ3A 4K4TA 4FVCA 3HVTA 4DR2F 4X4RA 1JLCA 2XMWA 3V4IA 2E9RX 2C2NA 3GV5B 4AXIA 1CJKA 3H42A 1SIWB 3MGJA 1TUVA 1V3ZA 3CWJA 1JLFA 4GC6A 4B3SF 1YDLA 3R7SB 1Q81T 2EI5A 5F8IA 3SCIE 2EBGA 4CYUA 1Q95G 3UWTA 1U1NA 3AB2B 4JI4F 3QLHA 2VASA 3Q86A 1RISA 4LF7J 3C16A 1AB8A 3LWMA 3MR3A 2Q43A 3CULA 4Y6IA 4WF9Q 2YVSA 4F4ZA 2DHAA 4XPCA 2AW0A 3BQ0A 1H2UX 1S6QA 1YZ6A 4KV8B 3D7SB 4NRTA 1HYSB 3SQGB 3M7VA 3OTOJ 4EWTA 1OJ4A 1FKPB 4I6YA 2CNLB 2XMKA 2CNOB 2A6MA 1XJWB 4OV1A 1HWUA 1U8WA 2LQ9A 4JOUA 3NMAA 3DLLQ 2C2KB 1TAQA 4TYAA 3MPWA 1TUWA 1DZ5A 2NPIA 2HFOA 2BRLA 3T6JA 1WKJA 4C8NA 2XY7A 1FWKA 4WU2A 4P6QA 2M4MA 2R9LA 2OEKA 1HQEB 3J7ZT 4ED3A 4USIA 2VOPA 3PX6A 3GFYA 3IS9B 2ILZA 3SCKE 3ETMA 4J9PA 1RCXB 1UVLA 2M88A 4UUXA 1BUXA 4X4TA 3RYLA 2M9KA 3IBCB 4DPWA 1V6HA 5CA5A 1U1RA 3N28A 3AODA 4FPIA 1GXLA 3MZIA 3TEHB 1CJUA 1WG1A 2X1BA 4DU7A 4AUKA 5KFRA 3D6FB 4FYVB 2JLGA 1UFKA 3MPYA 3GQCA 1W2BR 4JI1F 4CO4A 1UPPA 4L74A 1XK8A 1U7LA 1DBDA 4PG4A 3CUNA 4B3MJ 5A8KB 3KLHB 4I2QB 5J2MB 3QT8A 4RUCA 4PWUA 3Q22A 2XMUA 1VQ7S 2H65B 1U6FA 1ZETA 4Y28C 1FDNA 8ATCB 1YZ7A 2R7XA 3UCUP 2HBYB 4ZIVA 2WSFC 4O44A 5IFMA 1RWKB 3PRBA 2RKIA 4OYOA 3ILJA 2VBXA 1T3NA 1Y3KA 1S6PB 1FK9A 4NLVA 3HSDA 5G0RA 1AUSL 1J5OB 4LQ3A 5C5JA 4JUZA 1VRUB 5KTQA 2OEMA 4J9OA 4CNYA 5ETRA 1HW8A 3MEDA 3H5YA 4J9SA 3NP5A 3A8KA 3MAQA 1IN0A 2D3O1 4GC7A 3QRRA 4IR1A 1F3FA 2YKOA 1LFWA 1Z4UA 1MWQA 3CJ5A 2F4FA 5ITHA 1EETA 2I9SA 3W66A 2W2MP 3H5SA 4JI3F 1NBEB 4FF1A 1SC3B 2VL1A 2ZDPA 3Q8YA 4MT1A 3N5BA 2V8GA 1D8YA 2NZCA 3PTWA 4Y2AA 4JV1A 2ZDOA 2VQFF 3MEKA 5IT9U 3AOCA 3BGRA 3T1HF 1O5JA 3R5BA 3CT9A 4C3MA 2UXDF 3F73A 4QW9A 4NXNJ 2CQIA 4FDFA 3MMAB 4RWXA 3ZXWA 2CPFA 1VI7A 4ZPVR 2X3GA 1HQ2A 3PW0A 3TX0A 2UUBJ 2MTLA 3U02A 1TL1A 2OO4A 1CC7A 4DJBA 1HI1A 1NXIA 3RZAA 3M9OB 5C24B 3OVBA 1HW9A 2HNDA 1CG2A 1H2VZ 2YNHA 2Y0BB 1RTJA 3LUYA 1MMLA 2ZZMA 5LSLA 4K4WA 2Q3PA 3ZZUA 2HHHF 1LQ9A 1OPIA 2LEAA 1HMVA 4PPDA 4MYUA 3LPEA 3LW5C 1RADB 5B0BA 2KHCA 5IT9Y 1F1BB 4KH0B 1JLAA 1VJWA 1AZSB 5CYQB 3VQSA 1SJ1A 2F3JA 4IH6A 4QIWD 2R8HA 2ZH1A 1C1BB 4DSJA 3FK4A 1EHWA 1RAEB 2IM3A 4TY8A 4O4RA 2Z2YB 1RA7A 2DHGA 2MZQA 2C3OA 3DN9A 2FC9A 3CGIA 1FVQA 2V8HA 4B3RJ 3QGIA 2OMOA 4PQAA 2CIMA 2FGCA 2AJ1A 2HURA 1FXRA 4DS5A 4WP3A 4ED1A 5KT2A 1FKOA 1VQMS 2YNIA 5B0EA 2BE2A 2V94A 3GG0A 4DR7F 3M8QA 5IXUA 2YPYA 3HFKA 2RQCA 4IKAA 1NK4A 2DGQA 5D0HA 4EYIB 3UQSA 1IVZA 2OPSA 3M32B 4DSEA 5FJ4A 1NKEA 5CHCB 3CC7S 1KQSR 4QBUA 2UUWA 5G4DA 4NCBA 1LWEA 2UVVA 1B4SA 4ECUA 1JJCB 2Y1LB 2PEBA 3TQEA 2BE7D 2GIRA 3O6QA 4ID5A 4F8RA 1KBRA 4NRUA 2LDIA 2IRXA 4IG0B 4RNNA 3JQJA 5GADU 2Y1RI 1BQMB 1M90T 1S76D 4CH0S 5KT5A 1HBUB 2AX0A 2I5JB 1U0SA 3EICA 1RT1A 4I7FA 3DOLB 2RRAA 5SUHA 1MG7A 2YNGB 4G65A 5KFFA 1Z2ZA 3DLHA 1K9MT 1WEYA 4C4WA 4NXMJ 2V4JB 3RW7A 3KK3A 5AE3A 1TL3A 4DHVA 1AUDA 3VCDA 1KQFB 1WHXA 1HNWF 4NA3A 2BJDA 3D1HA 3M2VA 2DISA 1TKTB 4NLPA 4JV5F 1T95A 3NLCA 1FD2A 5CYMA 1FNXH 1TMJA 3RRHA 2EFGA 2YH0A 4ZITA 4WZQA 4K5RA 3ELHA 2H5IB 4NLOA 3OV7A 2E9TA 2H4WB 4YY3F 1VLYA 2GHWA 2E5LF 4WWSA 1RT3B 4J9UE 5DDRC 1VRTA 3KMSA 1WOPA 4DF8A 4ZP8A 1JKHB 3VZIA 4ID8A 1T9UA 1S9EB 2LQJA 4J9KA 2BBEA 3SFUA 4ZJLA 5HL7Q 2F5GA 2IDLA 2N7CA 2RAQA 3NGSA 1QAIA 4KO0A 1WORA 2PMHA 3SV3A 3QBCA 2C2EA 4OI4A 2OPPA 2JH3A 2E7XA 3MTJA 2KZZA 1Q8KA 5GAHU 2BXJA 1CBKA 3FSYA 3A8JA 1QAJA 2AMCB 2NCKL 5L8RC 4DV6J 1D0EA 1GMUA 4DG1A 3KLVA 4RNMA 5KT4A 4MK7A 3U7JA 2KFNA 1IBLJ 2UXBF 4ZVSB 3BR8A 1O6XA 1RTDA 4U96A 1UCNA 4DQIA 2E44A 3UVJA 3RBEA 4V1Ak 1FX4A 2HZAA 3DRPA 4JI7J 2KM8C 2VHGA 3C15A 2BQRA 1VBYA 4EO6A 3NXZA 1DTTB 1L3TA 4NWBA 4OYAA 4XTTA 2EC2A 3MEEA 4HKQA 1FDDA 3I9ZA 3CJSA 4JI5J 3OXFA 4ITSA 2CADA 1IKXA 4ZVPB 2EC0A 2ZZNA 3OFHA 2DYAA 1MW7A 1SUQA 4ECZA 2ALYB 4NLSA 1MU2B 4QWCA 1S97A 4ZPDA 4TXSA 2ROEA 2B43A 4HHHA 2VA3A 2VQEJ 4ZPCA 1N48A 1GTHA 2W9BB 1U48A 7FD1A 2BUNA 2CNKB 4DX8H 1V3RA 2PEHA 4KFBA 1K0VA 3TARA 3DDIA 1UVJA 1IJFB 4TU9A 3JYTA 3HT0A 4I0WA 3PHTA 2FHMA 4ZP9A 1HHTP 5IOLA 1YKWA 2A2DA 4F0HA 1F9HA 2JC0A 2MKKA 4OMFG 2FY1A 5C25A 2ZWOA 3U1NA 3HD2A 2NXCA 2MQOA 4DEZA 5KOWA 4KRWA 1OY6A 2KL8A 2BJ1A 1HNIB 1JX4A 4S0MA 4OZ1A 2OAUA 1P9QC 5BXIA 5K8NA 2XSJB 3OSPA 4I6AA 2N4CA 4O0NA 2H5EA 4NCGB 2GW8A 1TK5A 3DDNA 1NJZA 4KTQA 4DR4J 1RBAA 2ZFHA 4NPOA 4ICLA 4USWA 4TNOA 3NNAA 4CP5A 1H7WA 1IM6A 3K17A 5DS7A 4F50A 1VQKS 2N7YA 4RNFA 1WTFA 1CULB 5AXMA 4HDGA 1KLNA 4LR8A 4C2MA 2ASYA 3PEHA 2A1BA 4IOCQ 5ETPA 4BC9A 3MM5B 4OZJA 3TZYA 4ZS6A 3DGPB 1PKUA 2V0NA 1KLMB 2G2YA 3IN5A 4ED4A 3FBCA 1EARA 2ZJRQ 3PIPQ 4PXCA 2M8DB 1SV5A 2ATCB 5F8GA 3GCXP 1EQ0A 2HQFA 3E51A 4DV2J 4BCAA 4L75A 2C2OB 3GIRA 4DR1J 5LMUJ 3I0SB 2ZOFA 2CQBA 3VGSA 2RF2A 3HHDA 3V4MA 2CZVC 3DU6A 2LU2A 2XCAA 3MPDA 2IC3B 2FDNA 3OQ2A 3MOJB 4LF6J 4MKBA 2VKZG 2KXNB 2ZVSA 3OTCA 3N9UC 4R8UA 3LALA 3ITHB 3EVMA 3R1LA 4O23A 2XO7A 2W8KA 4LSNB 1RTHB 5C7PA 3JXOA 1JQGA 3UN3A 4DXLA 4OHZA 2H48B 3UDCA 3G6VA 1KN6A 1SBRA 1GMVA 2ZOMA 1U2FA 3DI6B 4ZHRB 2OJ3A 3DYAB 4NZ6A 5L38A 1VQ6S 3MWBA 4QR1A 2P9CA 2ZJQQ 1U0HA 3UCGA 2VZ9A 1IKWB 3SMZA 2GHPA 2ZEJA 3RR8A 1LW2A 3FEXB 1N5SA 1UJ4A 2FJEB 1NH7A 2ZBPA 1DQ9A 5LT5A 2KTQA 3SYZA 4LF4J 4WYWA 2PN6A 3VVUA 1K73T 1LV5A 4YMEA 4MMOA 1RWMB 2DJWA 1IQZA 4ZLNA 1QTNB 2DB1A 4WIQA 4FKYA 3IMQJ 3AQPA 3QT7A 3ENQA 1AROP 2U2FA 4Y2IA 4KQZA 3AOAA 3D66A 2VA2A 4LF2A 4DFKA 1X0FA 2G2OA 2DGWA 3HCXA 5DLFA 1XR6A 3KHHA 2MJUA 4TYBA 2UU9J 2KT3A 3Q2SC 3TW0A 1TAUA 2ZNZA 2XBPA 3Q8VA 2Z8QA 3QPIA 2BA9A 2GV1A 2EFOA 1KQGB 3R5AA 1FJGF 1YBAA 2GMLA 2OD6A 2FVSA 3VAFA 3LAKA 5BJRA 1Q5YA 4UY85 1QTMA 1SH3A 3MFIA 1PC5A 2LQ8A 3ZNJ1 1GAOA 5E41A 1YJNS 4ZVFA 2HPUA 2ASJA 3FCWA 2DXDA 2P2CB 2DR6A 1SIZA 4ZVUB 1HLWA 4RW4A 1H74A 5HO4A 1I94F 3CJ0A 5J2PB 3I82A 1CEZA 4YHHJ 3POTA 2ZH3A 1NK8A 1V5VA 2PA8D 2FPHX 2VF3A 3L9ZA 1SKRA 3CCES 3R97A 3MDFA 4X64F 2V8DA 3P45B 2GQ2A 2ZUGA 3VHQA 2NYHA 3B82A 3SQOP 1S1XB 2RQKA 2DTJA 4U7UK 2XHWA 5MLCV 4GRSA 3D4JA 5LSOA 3JSMA 1YSJA 4K0KF 2OPQA 2YNFB 2FY8A 2KKHA 1RT7A 4WE1A 2WTFA 4FNIA 4JI6J 1DJ0A 5HROA 4DF4A 4KGMA 4NX9A 1AYEA 1NJYA 2GMJA 3DRYA 3G6XA 3W60A 1HNXJ 1NKBA 2BM0A 2R2SA 1QE1A 1K8AT 4RW7B 4KHPJ 1NMEB 4ZP7A 3FCHA 3TP2A 2VFVA 5B08A 2BJ9A 2Z2LA 2HHUA 2GJ2A 1SVDA 4AYBD 2N3OA 3EXCX 3L7PA 2WVDA 1KFDA 3BH6B 3OTBA 3PZPA 3ET6B 1RDRA 3QFHA 5D8HB 2F9DA 2AU0A 5BYQA 1U2CA 3PO4A 2RRNA 2KZMA 1N5QA 5KFWA 3PW5A 1IBKF 1MROB 2VICA 3WX8A 2N82B 3P49B 3ENWA 4DZ6A 4O3SA 1SKUB 2P9GA 2XYGB 3R5CA 2KRBA 2W4DA 2HFUA 3OFGA 1VQOS 3R8YA 1RWNB 2A3JA 2RJZA 3BSOA 1VQNS 1M1GA 3IA0A 4WP8A 1HD1A 1TTHB 2XY5A 4YB5A 1Y5LB 1X4DA 2AGOA 2KHDA 5KG3A 4IUFA 5HP1B 4KV8A 3NCQA 2EFPA 3VGUA 1UA1A 3DHWC 3MEGB 3K8WA 1HYSA 3OL9A 3SQGA 4YB7A 1DURA 1X4CA 1FKPA 3DM2B 3SEOA 4B08A 4AQYF 2EK1A 3TJ8A 2KI2A 2LKZA 1RU1A 3NBPB 1ZH5A 2AQ4A 4PXBA 1GH8A 4DI6A 4QPXA 2HVZA 4F02A 2AZ3A 3T1YJ 3LP0B 2ASDA 5D4OA 3ISNC 3I31A 2DGXA 1OPZA 3A4TA 4AE5A 4TN2A 3MM8B 5L9XA 2FTRA 2KYXA 1NK0A 1YJTA 4DPYA 1T0TV 3KYLA 1HQEA 1YJUA 3FSXA 4X66J 1CQMA 1QSLA 1JLFB 3I6PA 3R27A 4JI0J 1BC6A 4LFAJ 1T11A 3IS9A 2ZBCA 3H20A 4QU6A 4RKUC 3UE2A 3NWRA 4KGZB 2UXCF 3ENAA 2G0CA 3RRGA 1ZOTA 1SH0A 3G71S 3K8VA 1V9OA 5L46A 4OJ1A 2Q66A 2OI2A 1KP6A 4ZPTR 1XMOF 2ZKUA 4YR3A 1LEOA 4U8VA 1MMDA 1Y4ZB 5KFVA 4ANCA 1X9SA 4N47A 4Y65A 2DNLA 2FJDB 5HQMA 3HJFA 2MPUA 3I4PA 3T6BA 5A8KA 3KLHA 1PYSB 3VAHA 4I2QA 5J2MA 3C46A 1WNEA 4Z7YA 4FVMA 2R7OA 4HL9A 3MOZA 4CLLA 4FYXB 1RBOB 3AD8C 3UPFA 2F65A 2LXFA 5CXTA 4ZPAA 3GTYX 1Q79A 2MKCA 1B70B 4RW9B 1X5PA 1FERA 2CJAA 4C8KA 2MJNA 3T1AA 6AT1B 5JMNA 3NOCA 1S6PA 1ELOA 4TU8A 2CG8A 4UOGA 2YWEA 4FF3A 1J5OA 2W9AA 1XNRJ 3K5OA 2K06A 1NO8A 1VRUA 3OJUA 1F60B 2GC8A 3JQKA 5KFDA 1OQ3A 5DO2A 1N6QB 2BOAA 3UN2A 5HLFB 1JXVA 1VQ4S 4NOHA 1IKVB 1KRPA 4RZRA 4WFYA 2F8EX 2AYMA 2WRMA 2HVHA 3GB0A 3IRXB 1UWBB 2VC0A 5KG6A 2MLZA 1YG0A 1XNQJ 1NJWA 4B9SA 2DH9A 1KQKA 3CDWA 4HI1A 3CCLS 4DR5J 3A13A 2XMJA 1OO0B 3N5FA 1SI9A 4DX7A 1N4LA 4CLSA 3J7YI 5GAEI 3GYNA 3TVYA 5IWAJ 2CJKA 4PZVA 2HMIA 4M95A 4PRFA 3UI3A 2W4PA 1I3OB 1Q7YT 2AJQA 1FRIA 5A2QU 2XG8A 3ZNUA 3J7A1 4A8XA 1NAQA 3M8RA 4IR9A 1TR0A 2VFTA 2ATLA 3CNQP 2DNGA 1GK8A 4CH1A 2XY6A 4DV3J 3N6MA 3HF5A 4PG8A 1ACMB 1RT4B 3F56A 3CCRS 4CLZA 3MMAA 1E6VB 1VQ5S 4U7CA 3Q0AA 3AY0A 5E3AA 2QX0A 4NA2A 2GA7A 3U27A 5A6PA 1SJRA 5AJ3F 1WWHA 4IOAQ 1LKZA 4CO0A 1C0UB 5C24A 5DQIA 5IQQA 1JJ2R 1BWVA 3VV2B 5F9NA 1SQFA 2E66A 5EUHA 2BZ2A 1QVGR 2XZTB 3S7RA 3ZZRA 3G86A 5KFLA 2NYIA 3HULA 2J6TA 2X1AA 3MEDB 5HBMB 3PW7A 1AZSA 4NEYA 5CYQA 5J2QA 4Y3CA 2ZH6A 2F8HA 3PCOB 5AT1B 1C1BA 4CM2A 1KHWA 2DNPA 1YJ9S 1OSCA 2V9WA 4UOFA 2FZGB 2LEBA 1XWLA 1KWMA 3W2VB 2JFKA 5KT6A 3R7BB 3QYYA 1Y10A 3CCJS 2OSQA 1F5CA 1RT5B 2WBMA 2IA6A 4Q5VA 1P1LA 3WX4A 2YX4A 2DNKA 4J9MA 3GR0A 2ZZTA 4MK8A 1HWJA 3HKZD 3OVSA 2G4BA 3MPVA 3EPIA 3JTPA 1IJEB 4H4MB 4CIOA 1JK9B 3JS9A 1RHKB 1T9TA 4E0DA 1H6KX 2NXEA 2CDQA 4UY8T 1LWFB 3M32A 4OHVA 1RT6B 4MFBA 3C6UB 1B7YB 2B5JB 2XYHB 4USVA 2W7AA 5F0UA 3MCSA 2RQ4A 3KG0A 4NLDA 3K89A 2IHR1 3H40A 3THTA 2DR8A 4PYAA 3TAMB 5DZ7A 3AJ2A 2XGPA 4D3GA 2HNYB 4L72B 3TNVA 1WC1A 3LO3A 2YKNB 3MAAB 1VQ8S 3NCRA 3NY0A 3QIPB 4IG0A 1KFSA 4DL4A 1BQMA 3TAQA 1WC3A 4GKJJ 2F4VF 1HBUA 2JL9A 1TV6B 4DBQA 3V81B 2I5JA 2FYXA 3EDQB 4FBUA 3DOLA 1N34J 2HG4A 1NZ8A 2YNGA 3B4MA 2R7UA 1RAJA 2BJ8A 4I56A 3BSAA 1S4FA 2RD5C 5E3RA 2O66A 2GIFA 3J81U 3FJ2A 2DO4A 4BLGA 2V4JA 4C7QA 4LF9J 1PYTA 5ETTA 5CH7B 3BBFA 2J7UA 2EKYA 3QJLA 2DR7A 1TKTA 4I68A 5I42B 1F2HA 1XR7A 3TOQA 5KT7A 1QVFR 1FT8A 1R43A 4DSFA 4CLWA 3BBBA 2JEGA 4MKYA 3KHGA 3NS5A 1W7WA 1TFYA 1VYAA 4RR5A 2OKQA 3RB3A 1NNDA 1RT3A 3OBIA 2VPYB 1WDTA 5GADI 1N32F 2V2ZA 3MM6B 2OHDA 1TK8A 3J81Y 3NKYA 1JKHA 3Q8SB 1QD1A 2E1MC 1S9EA 3T3FA 1WC5A 1RK8A 2YTCA 2B7CB 3WIUA 1UMJA 5A8WB 1NB2A 1VC0A 2AKWB 2V2KA 2MQPA 4A8KA 4OX9F 4X4PA 2QYGA 2FVCA 3QGHA 3W8PA 1UPMB 1SPBP 3VGTA 4OX8A 3UD4P 3MAHA 1VBXA 1VIXA 5J1PA 1T05B 4FP9A 5ETMA 4LF8J 1HPZB 3TR5A 4DFMA 3M05A 4DQSA 2O5DA 2DY9A 3I5BA 1RE1B 3GLJA 3IGNA 4USTA 1N52B 4WFZA 2GQQA 1VDHA 3CIZA 2IVMA 3T5KA 2D9PA 4LBPA 2E5IA 5KFOA 4LUBA 2IYIA 4P2MA 1N36F 3QJJA 4DUYF 2UUTA 1RHQB 2B8PA 3GIMA 2DIUA 2J8AA 4DR3J 4DCOB 3CTRA 3EYZA 1JNZB 3D5MA 3VAKA 2JFDA 3B4DA 4MK9A 1F9EB 3I32A 4LRDA 1TMMA 2PFDA 4OJGA 3KDNA 1AW0A 4Q8EA 1DQAA 4HVZA 4CDIA 2IJFA 2JRSA 1SL2A 4O3PA 1TP7A 4ILMA 1DLOA 1TKXB 5BR8J 4C11B 3QATA 2VH7A 1GEHA 1MU2A 2KG1A 2W1BA 1OMSA 2Y1IA 4DL3A 2X7IA 2AEJA 2W9BA 1ZM3A 4YDXA 1KTQA 4ERDA 3P5BP 1RAAB 4NLXA 1FWLA 3M30A 4C8OA 2LU1A 1N88A 7FDRA 4BHQA 2K7JA 3K2YA 2DEIA 1CJVB 4C6AA 2Z58B 1XC9A 1S77D 2MY7A 5ETOA 3V6HA 2HRTA 3H98A 2HHVA 2XYPB 1N8RT 3LAMA 1T3OA 5KFZA 4PPZA 2CKWA 2VG5B 5HMXA 1RYSA 4M5DB 1U6BA 1U4BA 1HNIA 1F5BA 4KKOB 5DDOC 2W2QP 1EB0A 2XSJA 2OEJA 4NCGA 1ZM9A 5AXLA 1HWIA 1X60A 1G7CB 2WB1D 1HFEL 1S4EA 3HO1A 2WONB 1FNMA 4NLTA 1K44A 1HQUB 2R4FA 3RB6A 2BANB 2QLWA 3RRKA 1NSQA 3R5JB 4X4NA 3Q24A 1REVB 4DL5A 1RWPB 1CULA 5AXKA 4P10A 3EMTA 4NYOA 4DFJA 3HP6A 3MM5A 1DAXA 3LWLA 3ETOA 3DGPA 1KLMA 3PRDA 1WACA 2J9DA 1R3NA 1HR0F 1ROFA 5I3PA 4R0JA 1QUPA 4DUZF 3CMQA 2C3PA 1VBZA 5B0DA 5AE1A 3HJVA 1U47A 2HQ3A 1N54B 1ZM2A 3H2VE 4LFBF 4FXDA 3GILA 4WFAQ 5MAOA 3I0SA 1R8CA 3M2UA 1D09B 3IGVA 2VONA 2BJEA 2HLUA 3P3DA 5GMEA 1PAEX 1D8ZA 2IC3A 4CI0B 1FRJA 4HH0A 3M4XA 3H59A 3H25A 1WOSA 3NGDA 2JVRA 3AJDA 2ZE2B 1H73A 2XWYA 2NZ4A 1VGYA 3M9NB 4OIXA 1SCJB 3DU5A 3BSNA 3L95X 3ITHA 4M5IA 1MN7A 2O1PA 3W7BA 5H9EK 1JLEA 1RTHA 5J1EA 4LF5J 3G6YA 4TU7A 2J6UA 1ZZNA 3PEJA 1Q0NA 3HVWA 4KBIA 2F63A 3DXSX 2BX6A 2CPIA 4KPCA 4ZLPA 4WXOA 4ZKAA 3WZ0A 3H5XA 3D6MB 3M6XA 3DI6A 4BWMA 2MGZB 2RIJA 3AXMA 3G87A 3CW2C 4PUOB 3B8HA 1MSWD 2CA9A 2P6TA 2GZOA 1IKWA 2HEKA 4W92B 3WDOA 3PVXA 2R3VA 2G1HA 2I6WA 3TJ9A 4Z7CA 4JI2J 2E5JA 4I69A 4QPTA 1JLQB 1G3OA 1Q82T 5HANA 5LSRA 3CJRA 4C0HA 4RW6B 2HFNA 1OQ6A 5HMYA 2HSEB 3Q8PB 1GMWD 2EFVA 1S1UB 4OI6A 3J80U 3I5AA 3W9IA 1N5VA 2C2RA 2JLEA 2DNMA 4U8YA 1UW4A 3L7OA 3GG1A 4EU0A 5L1KA 4PXEA 2C2ZB 1D9FA 2LFVA 3B6BA 4F4KA 3CD5A 1ZTWA 2IRYA 2IAJB 4DV5F 5D6GA 4GVLA 1JWWA 3VF0B 3G8TA 1L3UA 2HFZA 1FEEA 2FJVA 1RAGB 1O51A 3O2IA 2FIUA 2M2BA 2MEWA 3G2XA 4PQUA 1H38A 5LL6d 1RA6A 2ZITA 4M5GA 5J2PA 4J9LA 5KG0A 2VKRA 4F2RA 1NDKA 1RHRB 2DVIA 3SSRA 4EZ9A 3CJ8A 3KJQB 3SSQA 3OFEA 2JVOA 3DOKB 2L48A 1GNKA 1U1OA 4Y0FA 5K9FA 2Z4PA 2BQUA 1S1XA 4PG5A 1EKSA 3RUBL 4K4YA 1LW2B 2GS8A 3RB0A 1FXDA 2YNFA 3TA1A 5F41A 3EVOA 2HIQA 3K5PA 2FLLA 5GMDA 5D77A 2J9DE 3PYEA 4F04B 2BR0A 2W7PA 2AIRB 2GIQA 3CJQA 1KS2A 4URSA 2VJVA 1M1KT 4F3QA 2XLKA 2MZ1A 3GFXA 2VFRA 2CJXB 4RW7A 4NYPA 1OY8A 2P5VA 4QW8A 2E7VA 2A0FB 1J5EJ 1WKKA 3CCQS 5ETKA 3D0HE 4PEOA 1S6OA 5L9NA 4F36A 3KLEB 3ET6A 4A8WA 2CRLA 5M2PA 3HFVA 1ZA2B 3P6YC 1OY9A 2YX7A 1YQHA 3B54A 3T5JA 2IPOB 1XN9A 4FF4A 1MROA 4LR7A 2M3DA 1EZZB 4C3LA 3NWGA 2DNZA 1UVNA 5HQ8A 3VALA 2FJXA 3I9V9 1S0VA 1YK9A 5FLXU 4A8MP 1C1CB 4LSZB 4DPTA 2VPWB 1SC4B 3QRQA 1EAYC 2XLIA 1ZS6A 4LSLB 2ZH8A 1S72S 3C3LA 4M8LA 2R7TA 5F8LA 1UFWA 2EBEA 2HQCA 2V69A 3FNNA 1FXLA 2KJWA 5E2QA 3BKUA 4CLYA 3HDSA 5HP1A 1W2IA 3A8IA 1OSDA 3CSKA 3PIOQ 3IAM9 3MEGA 5A0YB 3RBZA 1BGXT 4G1QB 2ZC4A 1FJCA 1TL4A 4EZ6A 5HROB 1RT2B 2Z0GA 2D69A 3DM2A 1S1TB 5I3UB 1FI4A 1X5OA 3FFIB 1M5PC 5B7WA 3NBPA 2L3MA 2ZHAA 4WPAA 1IR2A 2EEYA 4N7TA 4JP8A 3PJ9A 1VHIA 1WHYA 3LP0A 2BVZA 4DV0J 1U6ZA 2ERRA 3AAWB 2MLXA 3M1VB 4A8FA 1Q78A 3MM8A 4WFBQ 1RAIB 3OR1B 4C8ZA 2MQQA 4RNHA 4KB7A 3IXQA 2FHJD 1X7VA 4RBUA 1N33J 1HBOB 1Q8LA 2FJAB 1Q8BA 3FUYA 2BACA 4LT6A 1F0XA 1FKAF 4RBVA 3F0NA 3A8EA 4DSLA 4WYLA 4LFCF 1S9GA 3S6EA 4CWBA 2VFUA 4X65J 5D78A 1CQNA 2CQDA 3WHIA 2QMXA 3ZTPA 2DNOA 1CJTB 2W9CB 4DR6F 1F5AA 4A4JA 1IR1A 3U1LA 2HVIA 2C2DA 1U1PA 2C42A 1P27B 4WK1A 5HVGA 4GKKF 3QWPA 3G4SS 4MKAA 5I4MA 4RU9A 1P8GA 2YKMB 1GXUA 2R8JA 4CZCA 5HN0A 4NI2B 5HMWA 3R1HA 4JV2A 4PG6A 2AJ0A 2ZM6J 1QLNA 3UD3P 2QMUB 4RW9A 3L3CA 4M5NA 2QRRA 2MKSA 4QYRA 5F3ZA 1VQPS 3CCMS 3LANA 1FD8A 5B0FA 2VDIA 4RX6A 2OSRA 1TUGB 3E3XA 2IRUA 1Z2LA 1PBUA 3HPOA 3CD7A 3DHXA 3US5A 3DFEA 2DRAA 2CJ9A 1RAOA 3EUNA 3VAIA 2CPJA 5JVGQ 5E3PA 1N6QA 3V6DB 5HLFA 2L9NA 1IKVA 2J0WA 4IRKA 4K4VA 2BQ3A 2HKEA 3IRXA 2D9OA 3GP9A 2DGUA 4QJVA 1M1HA 3CCSS 1UWBA 4B17A 1FTCA 1KEKA 4W90B 2CYYA 5DGBA 3JSBA 1KVIA 2J7KA 4EI2A 5LXRA 5KG5A 2JLFA 1AT1B 2HHTA 3EGZA 4Y34A 4OYMA 5HMZA 1SKSA 2XNRA 2DPJA 2MQNA 3MD1A 2VUGA 4PABA 4DS4A 3BZQA 3R3TA 5E5NA 2PDAA 1TL7A 1MWZA 5DM6Q 3TUIC 3ENVA 3PM9A 4QU7A 4K4XA 3SV4A 3AA9A 1VC5A 1A6LA 2QL5B 2VODA 2IBOA 5CD4A 3THVA 1NDCA 3FEYB 4DCPB 3D54A 3PV8A 2J5AA 2GHVC 2SXLA 4HACA 3MD3A 2HWTA 1HNZF 3MCMA 1FTRA 4X4UA 3H8YA 2BYCA 4O3OA 1RT4A 2ZWPA 3UDEA 3KLGB 1E6VA 4MJKA 3ZZ0A 3CCWA 2ILYA 1UTAA 4DV4F 3A3OB 2RB7A 3BBCA 4DV1F 2BEFA 3OVAA 1S1WB 1C0UA 4MIBA 2VOOA 2Q6CA 1YJWS 4K2JA 6FDRA 4I2PB 4AT1B 4R5PB 4A46A 3OT9A 4URQU 4B9VA 2LXUA 4NZ7A 5HBMA 4Y2MA 3BDPA 2HLTA 2AYEA 2XMMA 2BABA 3NNCA 1Q1KA 1PJ6A 4U9RA 4LF1A 1IBCB 2OD4A 3BPSP 4HT7A 5ETSA 4DR2J 2HVDA 1KOOA 4DL0C 3T9NA 1Q53A 3W2VA 2PMWA 5F0WA 1JLBB 2HMIB 4B3SJ 2WHOA 5D4NA 3DLGB 1VQSA 4M1KA 4P9SA 1RT5A 3AHPA 1RWUA 4B3OB 4ED0A 4L73A 3OD2A 4X62F 1BMQB 1LFPA 3K7RA 4JI4J 2LA4A 5J2NB 1S48A 1XMBA 2FGOA 3K5LA 5LOQA 4FXWA 4H4MA 1XMQF 1PILA 1VBKA 1BD6A 3VAJA 1S0NA 2QGFB 1LWFA 3W3SA 3T9ZA 1NKCA 1RT6A 3W1YC 3PNIA 4NMXA 3ZTQA 2HGMA 3C6UA 1TQLA 4OYBA 2B5JA 1RLDA 3RG6A 1TFWA 4NCAA 1UZDA 2QT7A 3QT6A 3K5MA 1BQXA 1S6UA 3AH6A 4DQQA 3MUVP 1RZMA 3AOBA 4X4OA 5DDQC 3EZUA 3TAMA 2Z56B 2J9CA 2XULA 1FRXA 2Q79A 2HNYA 2HS0A 4MAKA 4IFVB 4QIGA 3Q23A 2YKNA 1S59A 3MAAA 3QIPA 1SC6A 1RKJA 1HI0P 4C97A 2NXNA 3I56S 1M5KC 3TVKA 2C1EB 4TY9A 4QIVA 1K1SA 2NSCA 1Q16B 4JYAF 4PWDB 4C3KA 1TV6A 3V81A 5J2QB 1JNRB 3BGFA 3GU0A 3MHYA 1S49A 2IBKA 2AJFE 5E3CA 1S99A 4ELTA 5CQGA 5IC4B 3A1YG 4UT4A 5DG9A 3BS9A 3UNGC 1CC8A 2KVQE 5C2CA 4J9NA 5A6WA 3R2DJ 4GO5X 1R0BG 4OQJA 4OJHA 5I42A 4FS1A 5GAGI 3OFFA 3DXBA 3KHLA 1KNZA 2R7SA 4XAKA 4HTJA 3CJKB 3S01A 3X3UA 5D0GA 3OW2R 4B02A 3PACA 1NHUA 4IQXA 3SFGA 2XO6A 3TZWA 2AX1A 3UNYA 5AE2A 1YX2A 3AB4B 1KD1T 2U1AA 1S12A 1X9MA 4QIFA 4JI1J 4ZPBA 2LP4A 3MM6A 4MFBB 1X31C 3MPUB 1ZYQA 1Q86T 3HZGA 2XZDB 3O44A 2D1CA 3BKFA 4ES1A 4RUHA 2Q6BA 4W98A 5KFGA 5A8WA 1R8BA 3AFGA 3FZ2A 3LP1B 1S0MA 3QFWA 4N41A 3LH2S 1QJHA 1RJJA 4GVBB 2QFJA 2GO8A 2HVEA 3KK1B 2GFFA 3BGUA 1HWKA 4ZK7M 4G1PA 2CPEA 1T05A 1NLKL 3VWSA 3R2CJ 3THPA 3KXDA 3DLKB 1U1LA 1HPZA 1HNVB 4JI8F 3J7Z5 3JAMU 2VG6B 1NPKA 2GAGC 2OLWA 1QSYA 1BE4A 3F41A 2CPYA 1RCOB 3A3PB 2XCPA 3TVZA 3BM7A 3OHBA 4MTPA 2WB4A 3CDAA 3SDEB 1A9NB 3BDEA 5U47A 5CCLA 3W5XA 2VG7A 3W63A 4A8SA 4HR2A 3M2RB 3FMWA 2R8KA 4ZCLA 3TRGA 3C6TA 3G96A 2CWKA 3NRBA 4L3NA 3DLEB 4M94A 3NOGA 4UOCA 2UUCF 1S7IA 4CO5A 1NK7A 1UETA 1WOOA 2UUAF 4JI3J 2C22A 4NLYA 2NLWA 3GV7B 4KYZA 1FDBA 1TKXA 2FUG9 5KFBA 4C11A 2HHPA 3TZZA 2DNYA 4YFUA 2VQFJ 1YLXA 5LMNF 1IBMF 3T1HJ 1RTIB 3EGNA 1PO6A 3LP2B 4A8OA 2UXDJ 2OGUA 1U24A 4DV7F 3ZTOA 1T9WA 4EYHB 2QLBB 4Q8FA 3KLFB 3MR2A 1QAXA 2B0GA 3PY8A 3SXLA 3J81j 3FBBA 1RHUB 2ZC3A 4NL5A 2ZH9A 4QWAA 9RUBA 3Q8UA 1U45A 3G8SA 1HARA 5K8MA 1CJVA 1RQ0A 4B3TF 1X4BA 2HBZB 5ETNA 5KFTA 2HHHJ 3I87A 3RB4A 1X4FA 4P7TA 2F8MA 3CE8A 4DX5A 2VG5A 2B9EA 2B3TB 1G4CA 1S7HA 3NMRA 3CO0P 4M5DA 2CNNB 5BYRA 4KKOA 5LJ5Y 2A6OA 3EZOA 1K1QA 2LCWA 2VD3A 1S9FA 2MB0B 4LIRA 4N5SA 1RACB 2WVEA 1WF1A 2NUHA 4TVAB 3PYGA 3UW1A 1TU0B 5KFYA 2WONA 1ZAXA 1RHJB 2RRBA 2MHNA 1HQUA 3CO9A 2BANA 2XQCA 3IR5B 1CLFA 2EFQA 2FLNA 5KT3A 1KC8T 1DLOB 3R9LA 1REVA 4DR7J 3TZXA 1WG5A 4PKDB 2UVUA 4PXDA 3NGUA 2WSEC 4EUVA 3ILOA 3K57A 3DRRB 1HHQA 4C48A 1YBUA 1VR6A 3S1TA 4LF7F 1CPZA 2DKOB 1KR4A 3CC2S 2RHQB 3M30B 2YPZA 3HSGA 5SZTA 2KH9A 5L1LA 3LA0A 4GMKA 3BEGB 3P5TL 3P96A 3OTOF 4OHYA 2C2MB 1T9VA 3W2WB 1PIEA 4LMZA 4ED7A 1H0HB 4NLQA 1IR0A 3Q89A 1AFJA 3FGVA 4WK3A 1SQEA 2ZE2A 3HXMA 2QA2A 2QA1A 5EN1A 4X4VA 2OIHA 2XSFA 1WI6A 4JBCA 3H4BA 2BKPA 2E5GA 4P2SA 4KJIA 2CFXA 2MZRA 3PFOA 1FNOA 1U25A 3DC2A 2EPIA 1FWPA 3TANA 3DLJA 2BV3A 4OV6A 2QL7B 1HNWJ 4V19J 4KC5A 3GFHA 1KTVA 2MGZA 1H98A 2RNEA 2X1GA 3JTOA 2L41A 4JV5J 3GIIA 1PYOB 4PUOA 4HEA9 2RMLA 4F4YA 2HRYA 2QC3A 2FJBB 4ED2A 4YY3J 2E5LJ 4FKXA 2ZBQA 1NK9A 1JLQA 4P71A 2A2CA 4IDKB 4UOHA 3SBMA 4IO1A 4RW6A 2Z2ZA 2CJBA 3NS7B 3D6TB 3M2UB 1LXNA 5L39A 2RDDA 1S1UA 4B3MF 2MDAA 1YRUA 4OYPA 3ZZOA 2MKHA 4WBFA 3HHLB 2J76E 3AD7C 2XNQA 1EKRA 4Q44A 3R7NB 3E8OA 4YN3B 2CZ4A 3AQOA 3D28A 2MYFA 3HI9A 2LLZA 2B51A 4M63A 2HW3A 1JLEB 3GWCA 4O4GB 5J1EB 2IAJA 2QZ8A 2GCFA 1WI8A 1R8HA 2UXBJ 1YBTA 1U1QA 3T41A 3LPYA 2NREA 1UEKA 2ZH2A 3PG9A 4QZVB 1SQGA 2B8QA 5E3QA 1YTYA 4K4UA 2DCUB 3TWZA 3GSDA 1Y0HA 1TZ0A 2V6AA 3DOKA 1SXLA 3MUTP 1UZHA 1J27A 5CZXA 4RUAA 3W62A 4IG3B 2V8VA 4ZPWR 4F25A 3M8PB 4K8RA 4Q2MA 2IY5B 2PI5A 3QT5A 3DOMB 3M8ZA 2BW2A 1S1VB 4NEZA 3W65A 1UVMA 2OH2A 3BN4A 4ZDNA 3M6UA 1BQNB 2XB2D 3HVAA 1B99A 5DRKA 4D3HA 3G6ES 3GYGA 5HATA 1EIYB 3OTEA 1MLAA 4OYIA 4AL7A 5L1IA 1NSAA 2DPIA 3KLEA 4NXNF 1FO1A 2I8EA 3IBFB 2DXFA 2IDEA 4F2SA 4FF2A 2UUBF 2O67A 2K7KA 1UAWA 2E1PA 1F6TA 2NR0A 1RLCL 4LIWA 2V50A 3M6WA 2GMHA 4N76A 2V68A 4LVOP 1RKIA 3IR7B 4PQUB 2HAFA 4ZVQB 2CQ4A 4O3RA 4IQMA 2D41A 4P2XA 1A0OB 4FNHA 3T5HA 1C1CA 2IVFB 5E33A 3AA8A 3O8WA 4QR0A 4ES2A 1ZM4A 5JVHQ 4B9NA 3MF5A 3ZFVA 4K4ZA 4LSLA 1NJXA 4ZLLA 2A18A 3QRPA 2ASLA 5F8NA 5F8MA 2EG1A 2LQBA 2E1AA 2JNJA 3H7HB 2KRRA 3BPDA 2R2UA 1FRMA 4A47A 1WSVA 4ER8A 3T19A 4J91A 4YP3A 2KN4A 3VTIA 2AGQA 1Y7PA 1WSRA 5A0YA 4B3RF 2B4OA 4G1QA 1REGX 3QMQA 2CQPA 4P74A 4EK2A 1RT2A 2MKJA 3R6GB 1Y9OA 4R25A 1S1TA 5I3UA 4C0OC 4PAAA 2VFSA 3FFIA 4I4BA 4F0MA 1TK0A 3IO1A 4ZCMA 3PHEA 2K1RA 1CVJA 3HKWA 1M5VC 5IT0A 4OLPA 2B7BB 3MCNA 1QDUB 4ANEA 2DRBA 3D1OA 4ZMMA 2BE9B 3MMJA 3M1VA 1NB7A 5D3GB 3QWUA 1W26A 3OR1A 1U1KA 2XTJP 1T9XA 1N5TA 2B4VA 2CPXA 3J7YU 5GAEU 4IO9Q 5ADZA 1HBOA 3CEDA 3PW2A 3KLIB 5CABA 2BKNA 3JSYA 1QUVA 4KY3A 2CJYB 5DQHA 4AFFA 2WOMB 5K20B 3H0PA 4ANDA 3BN7A 4USUA 1DRZA 3TI0A 2ZBIA 1GTEA 3A3NB 3OR2B
chains in the Genus database with same CATH topology
4ECZA 5L1KA 3JSRA 3FMBA 4PXEA 5IM0B 4NLSA 4NZ0A 1MU2B 5EX0A 3RTVA 4QWCA 1S97A 5T14A 5KOXA 1D9FA 4ZPDA 4TXSA 2XC9A 2ROEA 2B43A 3OL7A 2I1RA 3NAIA 3ZZZA 1TKDA 4K4SA 1F2GA 2VA3A 4OI0A 2ALZA 4Q7AA 4ZPCA 4WKRA 2IM1A 4F4KA 2UV8G 1N48A 3I55S 2IJNA 3CD5A 1FKOB 1ZTWA 2IRYA 3PXGa 1H2TZ 2WW8A 2YNIB 4KGKA 4NXMF 1GTHA 2BE2B 2ADBA 2IAJB 4C8YA 4DV5F 2W9CA 5D6GA 2W9BB 1NJIT 1U48A 3RR7A 1JWWA 3VF0B 7FD1A 3G8TA 4RBTA 1FHTA 3HK2A 2BUNA 3M8QB 2RU9A 1L3UA 4DX8H 2MQMA 1V3RA 2MKIA 2HFZA 2PEHA 1FRHA 4OZLA 4HI2A 1FEEA 2PMZD 4KFBA 3TX8A 2W7OA 1S0OA 2FJVA 2AF6A 3BF4A 1K0VA 1O51A 3O2IA 3QZ7A 3TARA 2FIUA 2M2BA 2QSFA 2DNHA 4DDFA 1UVJA 4PQUA 1IJFB 4TU9A 3JYTA 3AJ1A 5DQGA 2RT3A 4OJ3A 1H38A 2EK6A 2OPSB 5LL6d 1RA6A 2ZITA 3M9MB 2QA4G 1ZZFA 4I0WA 2ZD1A 5J2PA 2QIFA 1VOMA 3HX9A 1DTQA 3OUYB 5KG0A 2KXHA 2VKRA 2YKMA 4J9LA 3RAXA 2FHMA 1U2RA 4ZP9A 4F2RA 1HHTP 5JJBA 4DN9A 2DVIA 2HRUA 3SSRA 4EZ9A 3SSQA 2A2DA 4CO2A 1LWEB 2JC0A 3OFEA 2X51A 2JVOA 3DOKB 3OL6A 1VC6A 2MSTA 2L48A 4I67A 1GNKA 2MKKA 4OMFG 1U1OA 2FY1A 2EW9A 4Y0FA 3GIJA 5K9FA 5C25A 2Z4PA 1R8PA 4RW8B 1HBMB 4YR0A 5DETA 3U1NA 2R2RA 2BRKA 2BQUA 1S1XA 4PG5A 3N6LA 4ZCKA 2MQOA 4EBEA 4DEZA 5KOWA 3HZEA 2PD1A 4K4YA 4HDHA 1LW2B 4ID5B 2AYGA 4KRWA 3RB0A 3BR9A 3KOAA 1UVKA 3I0RB 1HNIB 4ZP6A 1JX4A 1WF2A 1FXDA 1VS3A 2YNFA 3TA1A 5F41A 2XS5A 1H7XA 2YH1A 2HIQA 3K5PA 4OZ1A 2OAUA 3Q8QB 2FLLA 4LQ9A 1P9QC 5K8NA 2XSJB 5D77A 3OSPA 2J9DE 4C8MA 5C42B 2CPHA 2POKA 2P6SA 4I6AA 2N4CA 3TA0A 2H5EA 4NCGB 2GW8A 1TK5A 2BR0A 1LK7A 2W7PA 2GIQA 2RSQA 3DDNA 4QOTA 4K5SA 5KFEA 4TQSA 4DL2A 1KS2A 3V6DA 1NJZA 4KTQA 5KFQA 2ZFHA 4URSA 4Y2CA 3V5RA 4NPOA 1M1KT 2J6SA 4ICLA 4MH8A 4F3QA 1RT1B 2XLKA 4I7FB 2QMWA 2XMVA 1VK8A 2MZ1A 1SKWA 2Q1LA 3GFXA 3MURP 4TNOA 1UKUA 3NNAA 4ILRA 2VFRA 1VK3A 1H7WA 4LF5F 1LK5A 4I64A 3GMGA 4RW7A 4NYPA 4KHRA 5DS7A 2DH8A 3M6VA 4F50A 2P5VA 4QW8A 4J9QA 4KT0C 1VQKS 4UQGA 2CQCA 2C3UA 3CCQS 2N7YA 3D0HE 4RNFA 1WTFA 3KK3B 3KG4A 5AXMA 3X1LB 1S9GB 1JLGA 1S6OA 1TL3B 4HDGA 1KLNA 5L9NA 4HH1A 4C2MA 2OFHX 1W25A 2ASYA 4V19X 1NEEA 3PEHA 1BLUA 3QZ8A 3KLEB 2A1BA 5JXSA 4IOCQ 1HI8A 4ELVA 4BC9A 3MM5B 3FVYA 3CDBA 3KK2B 2RDIA 3M2VB 4RU2A 4H4KA 4OZJA 4DV6F 4OZNA 4A8WA 1PGZA 4ZS6A 2MSSA 2CRLA 1FVSA 2V0NA 2HZCA 1KLMB 3IN5A 5M2PA 3PR4A 3BQ2A 1YJVA 2EWHA 3P6YC 2AYBA 2HNZA 4H4KC 2YX7A 2ZJRQ 3PIPQ 4PXCA 2M8DB 4ES3A 1YQHA 4Q0BA 3MM7B 1Q8IA 1IBLF 1SV5A 1DTTA 5CYMB 3T5JA 1DHMA 5F8GA 3E51A 4BCAA 1XN9A 4FF4A 1MROA 2B9WA 2VBYA 2M3DA 1I1GA 4C3LA 3NWGA 1LW0B 2VV5A 3I0SB 3KMQA 2DNZA 4J5OA 2ZOFA 5HQ8A 1UVNA 2CQBA 2KVIA 4IH5A 5EGYA 2RF2A 4WIIA 3VALA 2DGSA 5D4LA 3HHDA 2FJXA 3LOUA 3IG1B 4JI2F 1SJ3P 2Y1JA 3I9V9 3V4MA 1S0VA 4F4WA 4JI7F 2CZVC 3DU6A 3PJXA 2LU2A 2XCAA 1VRTB 2IC3B 4A8MP 2FDNA 1C1CB 3KHRA 3KLGA 2H9ZA 4IOBA 5K14B 4Q45A 4EO8A 5KFSA 2VPWB 4TLQA 5CYJA 3OQ2A 2DHXA 1S10A 1JMTA 2HGLA 3MOJB 1FRKA 2XLIA 1T8EA 4MKBA 1JXEA 2VKZG 2KXNB 2ZH5A 4LSLB 1QAYA 4G1IA 2D3ZA 2KFYA 2ZH8A 2NUUG 1S72S 3C3LA 4M8LA 2R7TA 5F8LA 1FE0A 2RS2A 2ZVSA 1UFWA 3N9UC 3OTCA 2EBEA 2KT2A 4H4OA 5F8HA 4ECWA 4R8UA 4JI5F 3LALA 1Y3JA 3BB5A 4AL6A 3ITHB 4XIUA 2YWFA 3FNNA 3R1LA 4O23A 2XO7A 1FXLA 2B4UA 1S1WA 2KJWA 5E2QA 2W8KA 3S8SA 3CXCR 4LSNB 1RTHB 2NXUA 1UJ6A 4KO0B 2HHXA 1TL5A 2R2TA 4BWJA 1PC4A 3HDSA 5HP1A 1W2IA 1XERA 3TO8A 1B0PA 2OFGX 1EP4B 1OSDA 3CSKA 3PIOQ 2KB2A 3IAM9 3MEGA 2KG0A 4I2PA 5A0YB 4EBCA 3N79A 1BGXT 4G1QB 2ZC4A 1FJCA 1TL4A 4OHZA 4R5PA 4DWIA 4EZ6A 5HROB 1JIHA 3CDEA 3UDCA 1RT2B 1NH8A 2NQPA 4B9LA 2OPPB 3G6VA 5KG1A 2Z0GA 2I2YA 2VQEF 1KN6A 1SBRA 2RQMA 3DM2A 1S1TB 4USHA 5I3UB 4RLEA 3OUYA 2MZJA 2ZOMA 1XTZA 1U2FA 3DI6B 4DLGA 1I6JA 4IFYA 4ZHRB 3IBWA 1D9AA 1UEVA 1X5OA 2OJ3A 3FFIB 3DYAB 2JJ4D 4DG1B 2YWKA 1M5PC 4NZ6A 5B7WA 5I3QA 5L38A 1VQ6S 3MWBA 3NBPA 2L3MA 4QR1A 4O3NA 2P9CA 2ZHAA 2ZJQQ 3MI7X 3MR6A 2V9KA 4OI1A 5LJ3Y 1YI2S 2FVRA 1WHYA 1BWEA 3LP0A 3UCGA 2IMOA 3UDLA 2BVZA 5DGAA 2VZ9A 1IKWB 1U6ZA 3SMZA 1RTDB 2EFNA 1E6YA 2LQ5A 5THWA 2ERRA 1R0AA 2GHPA 3RR8A 2PIIA 3AAWB 1LW2A 4Q2LA 4C0BA 4X4SA 5IT4A 2KM8B 3M1VB 4A8FA 1Q78A 1R8AA 3MM8A 4CO1A 3FEXB 2YY3A 4CQ1A 1N5SA 4WFBQ 1UJ4A 4RWWA 1JLBA 3OR1B 2FJEB 4MIAA 4C8ZA 1NH7A 3BSCA 4Y2KA 3CPWR 2ADCA 1DQ9A 3DRPB 4RNHA 2MQQA 5LT5A 2KTQA 3DLGA 3SYZA 4KB7A 4N77A 2JX2A 5DLGA 4GO7X 2E5HA 4WYWA 5DG8A 4G3IA 1U09A 2PN6A 3IXQA 5KG4A 2DK2A 1YRTA 3ICLA 2FHJD 1X7VA 4RBUA 2GGPA 3UFCX 1K73T 1LV5A 4YMEA 4B3OA 2AWZA 4MMOA 2J0QD 4NA1A 1HBOB 1L3SA 1YHQS 4HT5A 3MEEB 1Q8LA 4ZVGA 2DJWA 2FJAB 1FESA 1IQZA 2D3UA 1Q8BA 2DB1A 2DO0A 2M0GB 3AQPA 5J2NA 1Y5NB 3EZ5A 4EFAC 1G2EA 2XWXA 1ULRA 3ENQA 1AROP 2XS2A 2U2FA 4Y2IA 4N8OA 4KQZA 2BACA 4LT6A 2VA2A 1HBNA 3OHAA 1Z1ZA 4DFKA 1X0FA 1F0XA 1F9FA 3CVKA 4MYTA 2DGWA 4QR2A 5EWGA 1IKXB 1N5YA 1FKAF 3SCJE 4RBVA 5DLFA 1XR6A 4DSLA 3A8EA 3KHHA 4WYLA 2MJUA 4TYBA 4LFCF 3GYXB 1S9GA 2KT3A 3Q2SC 3TW0A 1TAUA 3CC4S 3E01A 2ZNZA 1SUQB 5KFPA 2XBPA 4DR4F 1TKZA 2Z8QA 3CB4A 3SZ2A 3QPIA 2BA9A 2GV1A 3S6EA 2EFOA 2VFUA 1KQGB 2YKQA 3R5AA 5D78A 3PX4A 1CQNA 5K5MA 5FDLA 2CQDA 1C4CA 1C0TA 5T7LA 1FJGF 1YBAA 2B6AA 2GMLA 2MZSA 2OD6A 1SJQA 2FVSA 4BS2A 2QMXA 2R8GA 2KYZA 3VAFA 3LAKA 5BJRA 4UY85 1QTMA 1SH3A 3MFIA 2DT9A 3H2UB 1OS5A 1PC5A 2DNOA 2ZJPQ 3FDSA 1GAOA 4CNZA 5D4PA 5E41A 2CQGA 1J5EF 1UJ5A 4L6V3 1YJNS 2W9CB 4ZVFA 4DR6F 5K8OA 2HPUA 1F5AA 1HD0A 3FEZA 3OSNA 2ASJA 4A4JA 3U1LA 4F26A 5A2QY 1O0PA 5H9EJ 1FJEB 2HVIA 2C2DA 2GX8A 4IFVA 2C42A 1U1PA 1SIZA 1P27B 4KFBB 4WK1A 2FD2A 4GKKF 3QWPA 2CPZA 2V4QA 2FLPA 1X4EA 4RW4A 5KFNA 3JYTB 4UUWA 5HO4A 2PC6A 3G4SS 4ECTA 1I94F 2BM1A 4MKAA 2WSCC 4ED8A 2B4PA 5I4MA 4RU9A 1UL3A 2ZD1B 3CJ0A 5J2PB 3I82A 1CEZA 1DTQB 1P8GA 3CD0A 2YKMB 4G6VB 1GXUA 2R8JA 2KT5A 3POTA 4CZCA 2ZH3A 4DPOA 5HN0A 2PA8D 1NK8A 2FPHX 4PWDA 5HMWA 5DG7A 3SI8A 3RU0A 3R1HA 2VPXB 1SKRA 3CCES 4JV2A 3GZ7A 1TVRA 3KG1A 4PG6A 4DV2F 2MMYA 3MDFA 4X64F 2V8DA 3NAHA 2AJ0A 1QLNA 4ETXA 2HHSA 1WHWA 2ZBIA 4DR1F 2GQ2A 5C25B 3UD3P 1VHFA 1H3DA 3JAMY 5LMUF 2ZUGA 4RW9A 2K3IA 3PKYA 5KG7A 3B82A 5J1NA 4MIWA 4F3OA 1S1XB 1X5TA 3L3CA 1L3VA 2QRRA 1HL6A 2RQKA 1R6YA 3PKMA 3LGMA 2DTJA 2MKSA 4QYRA 5F3ZA 4U7UK 1VQPS 2KU7A 1DFDA 3CCMS 1ZAWA 2RILA 3LANA 1FD8A 1NU4A 2XHWA 5MLCV 3DRSA 5B0FA 2PI4A 4OL8A 2K2PA 5LSOA 4RX6A 3G8QA 4LSNA 2OSRA 2LYVA 3E3XA 2IRUA 3JSMA 1Z2LA 1YSJA 5H1SV 3HPOA 3CD7A 3HJFA 3R5DA 4K0KF 2OPQA 2YNFB 4J9RA 2LDYA 3DHXA 3KTQA 3EGWB 2KKHA 3US5A 2J0SD 1RT7A 4WE1A 4LF6F 3DFEA 5EDWA 2WTFA 2CJ9A 4FNIA 2DRAA 3EUNA 1FE4A 1DJ0A 3VAIA 5KFUA 5HROA 3N6NA 4DF4A 4DLEA 2CPJA 2V5HG 5JVGQ 5E3PA 1N6QA 3CMES 3V6DB 5HLFA 4KGMA 2F1FA 2HS4A 4NX9A 4YDDB 2L9NA 1IKVA 2J0WA 1NJYA 2GMJA 1QY7A 2FHKA 3CJKA 4ICLB 1LXJA 3KJVA 4ETZA 4IRKA 3DRYA 4K4VA 2BQ3A 4Q43A 3G6XA 3IRXA 2BM0A 2D9OA 1NKBA 2DGUA 4QJVA 4ZHRA 3CCSS 1UWBA 4B17A 1FTCA 1KEKA 2R2SA 4W90B 1QE1A 2CYYA 4X2BA 5DGBA 4ECQA 3DYAA 4WTYA 3JSBA 1K8AT 2OTLS 1XBWA 2ZHOA 1L3KA 4RW7B 1KVIA 2J7KA 4ZP7A 3FCHA 2ROGA 2OMLA 3TP2A 2VFVA 2E1RA 4QWDA 5B08A 5LXRA 1DQ8A 5KG5A 2Z2LA 2HHUA 2GJ2A 2JLFA 1FF2A 3N01A 4I1TA 3UR3C 4AYBD 3CCUS 2JSXA 3EGZA 3CCZA 2N3OA 2HHTA 1JLGB 3EXCX 2E1CA 4Y34A 4Z2XA 3L7PA 1G1XA 1SJ4P 5IZHA 5HMZA 4HTIA 1KFDA 1SKSA 2XNRA 2DPJA 2MQNA 3MD1A 3NCPA 4YB1P 3OTBA 3PZPA 2VUGA 4DS4A 1RDRA 1P6TA 3BZQA 3R3TA 4CT8A 5D8HB 1M5SA 2F9DA 5E5NA 3GV8B 2DBBA 2PE8A 2PDAA 2HNZB 1MWZA 2DR5A 2O01C 5DM6Q 5CD4H 2AU0A 5BYQA 4Q0BB 1X5SA 2ZH4A 3TUIC 2HAIA 3ENVA 3RAQA 1SV5B 3LP1A 3PM9A 3PO4A 4QU7A 4K4XA 2RRNA 1UVIA 3SV4A 2KZMA 1B64A 4YQWA 1N5QA 5KFWA 3PW5A 1GX6A 2C3MA 2KJVA 2PO4A 1MROB 3AA9A 4DV0F 1IBKF 2N82B 3V6JA 1VC5A 1A6LA 4X84A 1ZPVA 2VODA 2IBOA 3THVA 3P49B 3ENWA 3FEYB 3D54A 4O3SA 3PV8A 2J5AA 2GHVC 2SXLA 5JUMA 4ED5A 3LGNA 2P9GA 3R5CA 3KK1A 4K2XA 2KRBA 2W4DA 2RF2B 3MD3A 2HWTA 1HNZF 1KSPA 3O5TB 5K8PA 1FTRA 4X4UA 3H8YA 3OFGA 2AJ4A 2BYCA 1VQOS 4O3OA 3FSIA 1RT4A 4LF4F 3CF5Q 5LXYA 3KLGB 2HGNA 2FC8A 2A3JA 2RJZA 1E6VA 4MJKA 3BSOA 3ZZ0A 3DLKA 1N33F 3CCWA 2ILYA 1VQNS 1FCAA 1NK5A 1UP1A 1HNVA 2Y0SD 1B0VA 1GX5A 4DV4F 2LECA 4ZVEA 2R7RA 2VG6A 3DNCA 3IA0A 4DL6A 2RB7A 1HD1A 4DV1F 4H4OB 3ZZTA 4OX6A 3VZHA 2XY5A 4R8UB 4YB5A 3OVAA 2X1FA 1R31A 2CPDA 2KFZA 1Y5LB 1UA0A 3K0JA 3MM9A 4OHXA 1SL0A 4HLBA 3GIKA 2FB0A 1S1WB 1C0UA 4MIBA 1X4DA 3SCLE 2AGOA 2KHDA 5KG3A 3MUMP 2E9ZA 1RP5A 2AP6A 5M2RA 2I38A 2UU9F 2VOOA 3N4WA 4B9UA 4IUFA 3SDEA 2Q6CA 5HP1B 4XDDA 2MY8A 1YJWS 2N3LA 4KV8A 3NCQA 2EFPA 3VAMA 4LVNP 1UA1A 3DHWC 1BY9A 2ACYA 6FDRA 3MEGB 1IKYA 4I2PB 4O3QA 5BYSA 3K8WA 1HYSA 4X65F 2VBZA 3CMAS 3IR6B 3OL9A 3SQGA 4R5PB 2IFXA 2M7SA 1OWXA 4A46A 3HHNB 3M2RA 4YB7A 1DURA 4QWBA 5KFHA 4URQU 4B9VA 3CD6S 1X4CA 1FKPA 2LXUA 3L09A 3DM2B 3SEOA 4B08A 3Q8RB 4WFNQ 2DNNA 4AQYF 2EK1A 4NZ7A 2KI2A 2LKZA 4IFYB 5HBMA 4Y2MA 4FS2A 2I0XA 3BDPA 2HLTA 2AYEA 3OL8A 4E8UA 2XMMA 5GMKa 2BABA 2MXYA 3NNCA 1Q1KA 3DLEA 3NBPB 2QSWA