3PKYA

Polymerase domain from mycobacterium tuberculosis ligase d in complex with dna, utp and manganese.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
287
structure length
287
Chain Sequence
EQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA ligase-like protein
publication title Structure of a Preternary Complex Involving a Prokaryotic NHEJ DNA Polymerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/dna
total genus 85
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pkyA02
2IRXA 2IRYA 2R9LA 3PKYA 4MKYA 2IRUA
chains in the Genus database with same CATH superfamily
4YMEA 4V1Ak 1UEUA 3KJVA 2HLUA 5F0UA 1NAQA 4NL5A 1ZA1B 1VQ5S 4GVLA 3Q2TC 5J1EA 3M30B 2CQ4A 1NK6A 3KK3A 2DR5A 2KKHA 3EPGA 4U7CA 2OMLA 1CJTA 1LWEA 2AF6A 2AD9A 2DGOA 3JTPA 1RAOA 4ZPCA 3W61A 4B3RJ 1SJ1A 3TVKA 1U45A 4DFPA 2KJVA 4DX7A 2LXUA 4G1QB 1HHQA 1SCJB 4Q0BA 2P9CA 2FB0A 2J6SA 4CH0S 2C2DA 3RAXA 3N6NA 3PW2A 1G3OA 5CAAA 4F50A 3BREA 2UV8A 3C8YA 3EZOA 4JI4F 2LYVA 1LW2B 5KFVA 5DG7A 1ZAWA 3AH6A 5DDRC 3BKTA 3JQMA 4ENOA 2EI5A 1XNQJ 5C7PA 3UD3P 4E2FB 4F3MA 3LWMA 2DNOA 3H5SA 3K7RA 3I5AA 4C4WA 2CQDA 5H9EK 4ZOSA 1HL6A 3OTBA 1F60B 2EBEA 4ZKAA 1DURA 5D0GA 2HBRB 3IC1A 2BJ8A 5KT6A 4C8OA 3OXLA 4WP3A 1VC5A 1CC7A 3J80U 3C15B 3LALA 2V63A 4O3OA 1J2VA 1BQMB 5K14B 4PUOA 4L75A 3GZ7A 2SXLA 5BR8F 2G1HA 2MLXA 4OLPA 1W2IA 5KG1A 4NLSA 3R1HA 1H7WA 3WX8A 1CS4A 4F2SA 2AGQA 4C9DA 2BANB 3V4IB 5KG0A 2R7SA 5KFEA 3KLGA 3ZTPA 1FT8A 1RU2A 4DR1F 1DAXA 2AJ0A 2NUHA 3LP0B 2H4WB 1TK0A 4DL2A 1A7GE 4FYVB 3P8BB 4FBTA 4FYXB 5AE1A 5KFFA 2VPWB 1U6FA 2MKYA 3EVMA 2EKNA 3M30A 1BLUA 5D0EA 3HPOA 2A2CA 3CJRA 3PCOB 4BHQA 4CLTA 1MG7A 2VBWA 4WZQA 3WC2A 2BE7D 2UUTA 3I4HX 4KGMA 4JI5F 4TQRA 1GK8A 5KT3A 1S0MA 2YX4A 3AJ1A 2V2ZA 2W2PP 2MEWA 1W2BR 2MJNA 4OQJA 3TWZA 2CG4A 3QO9B 1BQXA 3MM8B 5E3RA 1HD1A 3MI7X 2HHVA 2V8HA 4P52A 3G82B 2HEKA 2DB1A 3M8SA 5LT5A 2CPFA 2IIHA 3CJKA 1M5HA 1AA1B 3BO3A 4Q2MA 1RHQB 1LW2A 3LUYA 4ZIWA 3T41A 1I5OB 4ECVA 1WF2A 4P6QA 3SCJE 2AEMA 3WZ0A 3H5YA 1HMVB 5CABA 3B54A 2CQBA 1RQ0A 2CJ9A 1XR7A 5LMUJ 3BYPA 5DLGA 4URSA 4KTQA 3HCXA 4AYBD 4FXVA 1KC8T 3W62A 3NWRA 3IMQJ 4ZPAA 3UN5A 4HVZA 4L3KA 1V3ZA 4DV7J 4P72A 3AJDA 3C15A 4X4QA 2UXDF 3QSYB 1BHNA 3KK2B 2BMBA 1ZM2A 1YJRA 1BQMA 5K14A 2H9ZA 4WFZA 2Y1IA 4DL6A 1R3NA 3W2VB 1TR0A 2GCFA 3NMRA 2QMUB 4O3NA 3S7RA 4KSEB 4UTGA 3QWUA 3H5UA 4LF5J 3PYGA 4CO2A 3A8IA 3C2PA 2BV3A 4J9LA 3MGJA 2BANA 3V4IA 2FJXA 5KFOA 2BE9B 1SL2A 3ZTOA 1APSA 4GVBA 1XC9A 3CNQP 3I31A 1UJ6A 4NXMF 3PTWA 5L39A 1RTHB 4IRCA 3D1OA 3LP0A 4DL3A 2IAJA 3HF5A 4P75A 1FF2A 3DLGB 5KOWA 1Z1ZA 1BWVA 4OI3A 4RW8B 1SH3A 3CDBA 1ZTWA 3THPA 3LA0A 5L1JA 2VL1A 4ZJQA 4QIGA 3GIMA 4B3SF 1N5TA 1HQEB 4LQ9A 3Q24A 3HI9A 2CPYA 1Y7PA 5LMNJ 3GWCA 3QO9A 3NCQA 2DISA 4M63A 3MM8A 4DV2F 4DX6A 4OYXA 2F1FA 3G82A 2BQUA 2EFVA 4WFAQ 3M9OB 3Q8YA 1WUUA 2KZMA 1NH8A 4C8ZA 3US5A 1REVB 2FUG9 3T1YJ 4X4UA 5E2QA 3GE9A 1XR6A 4OV6A 1IKVB 3LGHA 1CJKB 1N56A 3PFOA 1WKLA 1ZETA 1HMVA 4NCAA 4NWBA 3W5XA 3LPEA 3CCRS 1JWWA 3N5FA 2A0FB 4OYWA 3K5PA 2QYGA 4NYZA 2Z58B 5DRKA 4HHUA 3GU0A 1NCLA 2JL9A 1IWGA 3IN5A 3IBFB 3SQGB 1GMUA 1C0TB 2P9GA 4KT0C 3KK2A 1KWMA 4WYWA 5K8NA 1RWUA 1JXEA 3W2VA 4EBDA 2MB0B 5HJXA 1PILA 4Y2AA 2YPYA 1YJTA 3MWBA 3N28A 2CJKA 1NK9A 1TKTB 4XPEA 1M1HA 2QL7B 2VFRA 2OFGX 4OX9F 3L7PA 5HLFB 3TQEA 3W5YA 4ZITA 4FVCA 2NXCA 1ZPWX 4NLYA 1SJ3P 2OO4A 3BBBA 1PIEA 4B9SA 1RTHA 3I9V9 3BZQA 2QZ8A 4CLKA 2D41A 3GJQB 3DRRB 1IBCB 1F6TA 1X5SA 4P7VA 1UVMA 1KVIA 4C8LA 4GO7X 3DLGA 1O0PA 4Q44A 2LEAA 3H8YA 3M8ZA 5HQ8A 4RW8A 4DFJA 3MUVP 4CLZA 4P9SA 1SI9A 2F65A 1R7IA 5GMDA 3H40A 2C3MA 3MFHA 2GV1A 2MGZB 5F9NA 4WBFA 3T19A 2WVBA 3HHNB 1X0FA 4A8XA 4QQBA 2WVEA 4LF8J 1HQEA 3QIDA 4XAKA 2ZHBA 1FRHA 1RCXB 2DY1A 3KHGA 2AX0A 4LF9F 1WACA 1U1PA 2ZBRA 4ED0A 2C2NA 2DGTA 1SQEA 3D9BA 2AZ1A 3P3DA 3BF4A 2RUSA 4ZVGA 2E7VA 4KAIA 2OFHX 4OZLA 1REVA 2H4YB 5A8RB 1IKVA 1CJKA 1IJFB 3UDVA 2H5EA 3FBCA 5KFPA 3T1AA 3W7BA 2XLJA 2LECA 3L4BC 3ILJA 3EGZA 3HJVA 3ENWA 4OZ0A 3CCZA 1HBUA 2I6WA 4DV5J 3ENQA 2XC9A 5FJ4A 2PE8A 3PYDA 4E0DA 1AFJA 2EVZA 4OI2A 1U02A 2YWFA 1UMJA 5HVHA 5A8KB 5A8WB 1C0TA 5IT9U 4G1PA 3M8QB 4WZMA 2JOQA 3T5KA 4IH6A 2NSBA 2R8IA 4YDXA 1M1KT 2XSJB 1NHVA 4CO0A 1Z2ZA 2IDLA 5D4LA 3CJTA 1IM4A 1R8CA 2VA3A 1I1GA 1TK8A 3PHTA 3KJNB 5DDOC 4JI6F 3QSIA 3FGVA 3CDUA 1GXUA 3UNYA 1OYEA 5KFSA 3EE3A 3NLCA 3PX6A 4PWDB 1WEYA 1TKTA 2GW8A 1HBNB 4HTIA 2QT7A 1SKWA 1EJ7L 1JLCB 2W9AA 1UCNA 2PEHA 3QAUA 3QWPA 1NK5A 5HN0A 4ZPVR 1Z4UA 1VQ9S 1Q86T 3R9LA 1RYSA 4PXEA 3VAKA 5KFYA 1U8SA 3EJMA 2E5LF 1JMTA 3QQCD 1SUQB 1URNA 2BKOA 3DRRA 1RWKB 4DF4A 1RCOB 2ZVIA 1AFIA 2EWHA 3DDNA 2YX7A 2Y1LB 2V68A 1GMVA 3R5BA 2FQQB 4EZ9A 1HWLA 5ADZA 1WJ9A 2ZDOA 1C1BB 2IBKA 4A8WA 2RKIB 4QWAA 3D0HE 4I68A 2MGZA 1ZOTA 5ETRA 4OMFG 2E66A 3ISND 4JI1J 3WIVA 4DBQA 2KZZA 3CJ3A 5KFJA 3H4DA 2HGNA 2XYGB 4ELTA 4HLBA 4A46A 1EAYC 2HSEB 3J80Y 4U7UD 1QUVA 2WZ1A 1D8YA 4P2MA 4IQMA 1UKUA 3M6XA 4AD6A 3K5OA 3BQ0A 4K5RA 1FJCA 1KDNA 2BZ2A 1REGX 4OI4A 2BR0A 1N34F 4ZVPB 3IM9A 3CF5Q 1NSKL 4NLXA 1W26A 2XY7A 5A8RA 1Q79A 3GFXA 5H9EJ 2Z8QA 2EFQA 1I94J 3PRBA 4CO3A 4DHVA 1TAUA 3NS5A 4DL0C 3ZXWA 2ADBA 2GAHC 4RNNA 3FZ2A 2D3OR 2HVHA 1WF1A 4X64F 5E3CA 5GVQA 2B6AB 1DFDA 4QWEA 4O23A 4F02A 3K8WA 5A8KA 3OJUA 3AAWB 5A8WA 3RRHA 3M8QA 1YJ7A 2CPZA 4RNFA 3ET6B 3PXGa 2N7YA 2CYYA 4OYPA 3FSYA 3MAQA 3TNVA 4P73A 2XSJA 1D9DA 1YJUA 4UOHA 2IJFA 1HNZF 3MAHA 3W8GA 2DIVA 5C25B 4PWDA 5CD4A 3FQLA 4DCJB 2C22A 1JLCA 2EK1A 3H90A 1B0PA 1Y00A 1UW9A 2ZM6J 7AT1B 2KXNB 2VZ9A 1YKWA 4F4KA 1SUQA 3NKYA 4OYMA 4MAKA 4OZ2A 1NJXA 5BXIA 4B08A 2ZDPA 1N36F 4OLOA 3BDEA 4IO9Q 1X5PA 4TYAA 4ZJOA 2R42A 1C1BA 3OVBA 5HL7Q 1R8HA 2ZHOA 2XM3A 3D2WA 2RKIA 3MTKA 1FNXH 3FQKA 3LH2S 1FRXA 3CMAS 4FYYB 4QWBA 3GR0A 1X4HA 3GJRB 3TX0A 2J7UA 2PMWA 1EKSA 2FHJA 1N52B 1HNXF 2OIHA 3O6QA 3QBCA 4BC7A 1FEHA 4H4OB 1KOOA 3MEKA 2KG1A 4PPZA 2ROPA 1S1VB 4OHZA 4ZVUB 1SQGA 2ZKTA 1RT2B 5D0HA 1DQ8A 3X1LB 5E41A 4AFFA 2E1PA 5IWAJ 2PI4A 4DQIA 3QJLA 4CLFA 4F4AA 2V8DA 5HMWA 2CNKB 3PRDA 2B6AA 2HHXA 1T9TA 3RB0A 2G4BA 1KVKA 4CO1A 3MXHP 3T3FA 3PW0A 1SVDA 1S7IA 4DUZJ 3ET6A 5CD4H 3AB2B 3O2IA 2AYGA 2VONA 2VFTA 1CJVA 2RQ4A 3DRPB 1UWBB 3VHQA 1PYOB 5C25A 4ECRA 4WKYA 1U1MA 3EDRB 1N5SA 3DDKA 4IR1A 2KVIA 4UF4A 5EGYA 3LAKA 3LGMA 4KFBB 4DX5A 4A8YA 1VQPS 4KPCA 3PW5A 4J9SA 3QT7A 1NHUA 4JI8J 3M4XA 4Q43A 3EX7B 3T5HA 2V0NA 1CULB 3R3TA 3KJFB 1WWHA 3I55S 2JC1A 5B0BA 1VQNS 3CEDA 2HZVA 2BOPA 2F4FA 2A6MA 3R7BB 1RBAA 3NWGA 2J0WA 4B9TA 2RUGA 5L1KA 3HDSA 4DPYA 2DCUB 3JAMU 1D9AA 4R25A 3KKFA 4QPXA 2ZM6F 1KTVA 1X4EA 4BDPA 3MUTP 3DMJB 2DCLA 5GAGI 1S1UB 1Q82T 3ZZRA 4PQUB 1S5ZA 1HA1A 3MAAB 5DLFA 3VCDA 2YXLA 3NCRA 4H4OA 3W9IA 4QCLA 1U24A 2EXUA 2H5JB 4F3OA 1IR1A 1S1VA 1Q5YA 2ZZNA 2E5IA 3S1TA 1PYTA 4HT7A 2R7OA 1AUSL 4HI1A 1RT2A 2HWHA 1OIAA 3TAMB 4X66J 4AL5A 2XMKA 1K8AT 3CE8A 4Q5VA 2R2UA 2N3LA 3U7JA 4ZIVA 2XO6A 1RYRA 1GX5A 1RP5A 4C0BA 4YOEA 4JBCA 1S1WB 4MK8A 1IJEB 4D3GA 3MTJA 2UUWA 3W3SA 2PA3A 4U6PA 2QA4S 1FE0A 4K4UA 4OIXA 4WF9Q 2I1RA 3A13A 2UU9J 2CDRB 2K1RB 2UV8G 1VRUB 5IWAF 2JFDA 3GQCA 3BQ1A 3DRPA 1UEKA 3QPIA 3IFEA 5DZ6A 4ED4A 1NSQA 2E1AA 3B4MA 2OPRB 2ALYB 2MZRA 1WHYA 4WXOA 4P7TA 1AB8A 1XMBA 2EW9A 4KHMA 2FTRA 1P9YA 3D1QA 5EUHA 4ZVOB 2DNGA 3OFEA 3A1YG 2N4DA 1RAFB 3BN7A 2JHEA 2J9CA 2C3OA 2VBYA 4DXLA 3AT1B 2DNLA 4YR2A 2VDIA 3MPYA 3QZ7A 2HS3A 1CULA 4F04B 2RAQA 2BEFA 4K4VA 3U1MA 2HURA 4J9QA 4NLWA 1F5CA 2NCKL 1VQ6S 4QIEA 4DV4J 1F9FA 2MJUA 4DLEA 2GVDB 2GQQA 2I0XA 2P2CB 3QGGA 1T02A 3PJXA 3P45B 3DXBA 4ZLLA 4I6YA 1H6KX 2V6AA 3DU5A 3BN4A 1TZ0A 2Z4PA 5F8LA 3G8TA 5IT9Y 3DMJA 2K2PA 5DDQC 2YKNB 1FHTA 3CCSS 5GAHI 1C0UB 4PQUA 3MAAA 2AEFA 1SH0A 2B4PA 1IWAA 1VLOA 1FJGJ 2XCPA 4CNYA 4ZP6A 4KE5A 5LL6d 1O51A 1S7HA 2M88A 3TAMA 3EM1A 2FLOA 3D1HA 2NXUA 4J5OA 1TL3B 1RHJB 1F9EB 1DY3A 3ZO7A 2BABA 2EK6A 1S1WA 3FNNA 4K0KF 2IC3B 1TP7A 4G3IA 1XTZA 2HS4A 2CQ0A 2N4CA 4FF1A 4C8KA 4LUBA 4ZCIA 3JS9A 3IBCB 4XDCA 3BB5A 4DN9A 2HFZA 1S9GB 4AT1B 3VQSA 2K1RA 2DVIA 3DOMB 4X66F 3GIJA 4CH1A 3D6FB 3NEKA 1VRUA 3OL8A 4YQWA 1YK9A 1RI7A 1M1GA 2OPRA 1NPKA 3WIUA 2KRBA 2KXHA 2PFDA 1NKCA 4ED5A 3QT5A 5T41A 4DR7J 1A9NB 1PAUB 4ZVHA 2UVVA 4M94A 6FDRA 4WKRA 1JXLA 1AUDA 2OPQB 2NZCA 1VJWA 1LFPA 4ED8A 2IVFB 3RAQA 5CQGA 4TLRA 4DV6F 2BXJA 2MKSA 1LWFB 4IOAQ 1JB0C 2YQ3A 4ETZA 1CJUA 4O3QA 2ZITA 1S79A 3GV8B 3D0IE 3VR1A 2RQCA 1NH7A 3HZGA 1GXTA 1AT1B 2GVDA 2EBGA 3WC0A 4CRJA 3MPVA 4I6AA 2BJ1A 2EFGA 2QSWA 5ETPA 3FSIA 1WKKA 3OJSA 5KFWA 1MMDA 3ZTSA 1U8WA 2IY5B 2YKNA 4URQU 2WONB 5MAOA 2A2DA 1C0UA 1O6XA 1MMLA 2ACYA 1AYEA 3NGKA 4LF1A 2HPUA 3RBDA 3CIZA 3D6HB 2D9PA 2R2SA 3OTCA 4ZPBA 2MY8A 1QAIA 2XGQA 1CEZA 1NB7A 1HPZB 3P6YC 4QR2A 3GB0A 1TL3A 4PYDA 1YDLA 3QZ8A 3SCKE 2Y3YA 1EQMA 2IC3A 3JSRA 4DR2J 1Q8BA 4QYRA 4HYKA 2QC3A 2OMOA 1QSYA 2DHAA 2BM1A 3D67A 4ECSA 2DKOB 1WELA 1RADB 1S9GA 3DOMA 4GO5X 2VD3A 3CW2C 2VFVA 3CJ5A 3VWSA 4KGVB 4DSFA 3D28A 4USWA 1NJZA 3KHHA 1Q8LA 2WSFC 1RE1B 3ISNC 3IGNA 3MMAB 4OZ3A 1Y5IB 2ZD1B 4RWWA 3HKWA 3X3UA 2JEGA 2M8HA 4USUA 4MMOA 4J9OA 2OPQA 1R0CB 4O44B 3I6PA 1HR0F 4OYIA 2CJYB 5K5MA 1JJHA 1DJ0A 2AHOB 3VAMA 1M90T 3I87A 1B4SA 1S9EB 2GS8A 2WCXA 4ED2A 5D4NA 2Y8WA 4LFBF 4EO8A 3E2EA 1VQKS 1SJFA 4ZLPA 2HQCA 3I32A 2UXBF 4I1TA 2R7RA 3LF0A 2Z56B 3G6VA 2E1RA 3W65A 2CVEA 1VIOA 4QW8A 1S6OA 3R5JB 4ANEA 4CLWA 1UVLA 2OP5A 3M8RA 2HRTA 3UR0A 5I4MA 2VQEJ 2JWNA 1RHKB 3OFHA 3TEGA 3PW7A 2WONA 4TY8B 2I9SA 1PBAA 4KYZA 2RHQB 3QMQA 1RLDA 5LOQA 3PV8A 2QRRA 1ITPA 2D3UA 1SC4B 5EX3A 2G2ZA 1RWMB 4KQZA 1RISA 1HPZA 4JP8A 2ILZA 4NEZA 5I3PA 2R7XA 2HFSA 2RRAA 3M32B 4ZP9A 4IO1A 3WDOA 3M2UB 2CWXA 3ETOA 2JVRA 4CO5A 3KWMA 5JVGQ 4JI7J 4ELUA 1C1CA 5H1SV 2C2ZB 4KHRA 3V4MA 1HQUB 3FC9A 5EWFA 4ETXA 4BBYA 1IKYB 1RTIB 1TQLA 5HI7A 3TZWA 2OPPB 4AXJA 1NO8A 2K06A 3CCUS 3WQPA 1DTQB 4AUKA 3KLEB 4UUXA 3JAMY 2M5YA 2MPUA 4ZS6A 4RNHA 1XJWB 1OQ6A 3MMAA 1X9WA 3J7A1 4ZHRB 2ZD1A 2E44A 2X1AA 2B56A 3T1HJ 3KHLA 1I51B 4AXIA 2ZE2B 3TJ8A 2OEKA 2CPHA 4FKXA 2WVFA 1TAQA 4O44A 1JK9B 3F44A 2KFYA 2IM0A 2W4DA 2I2YA 3I0RB 2HK3A 3OSNA 3NMAA 1S9EA 4B17A 4X4VA 1RU1A 4B9NA 2HZAA 4O4GB 3DRSB 1RTJB 5HJYA 2IMWP 2P5VA 3W1YC 2XY6A 3RB4A 2B7BB 3IP0A 3SEOA 4NMLA 1KQKA 4RLEA 2DNPA 3IGVA 5E3QA 2WAQD 5KFNA 3NXZA 2XSFA 2LEPA 4NLDA 4TY8A 1TTHB 1U2FA 2BJ7A 2VPYB 2BQRA 2M52A 3MR7A 2XB2D 3CJ8A 1N5YB 2FPHX 2VHGA 3ZZTA 1IBKJ 2DR8A 4DR6F 3WHIA 4RX6A 1XMQJ 2W25A 2IFXA 2NXEA 4RPFA 4LF4F 1JNRB 3HHEA 1D1UA 1IR2A 3M32A 3G6XA 2ZUGA 3BKUA 3M2UA 1HBMB 1WG4A 2VQEF 4KB7A 1MWYA 2PIIA 3ELHA 1WEZA 4XTTA 2NYHA 1KHVA 2D74B 1HQUA 1NDPA 2VG7B 2DXEA 4M5HA 1WI6A 3DGPB 2EG1A 1IKYA 2CJQA 4K2JA 1RTIA 2FGCA 2OPPA 3CO9A 2DR6A 3ZZPA 1S97A 2F7VA 3Q86A 2MY7A 4YY3J 3UN2A 1DTQA 2QJ3A 2LCWA 3KLEA 2V69A 4LR9A 2AQ4A 1HNWF 3CUNA 2FJWA 2L08A 4ZN1A 2DGWA 1NEEA 4ZHRA 5DETA 3ZC4A 2F63A 1KR4A 3EWGA 1MWQA 3PG9A 3UR3C 2M3DA 2C3UA 3EGVA 2K3KA 1R27B 1ZA2B 1FRMA 2ILYA 2VFUA 4ZMMA 5GADU 2D3ZA 2K7KA 1GAOA 3CVKA 3I0RA 1P6TA 1KEKA 1VOMA 1RT7B 4DPWA 2JJ4D 4O4GA 3DRSA 2LA6A 3E8OA 5DQHA 3B8HA 1RTJA 4USJC 2V8PA 1N5VA 4Y28C 3CJ4A 4F0MA 5HK4A 2W2NP 3EDQB 3EICA 4F7VA 1KTQA 2M2BA 1BMQB 1EARA 4E98A 2VKRA 5KOXA 4OZNA 4O3RA 2Y1RI 2DRAA 4YUDA 4JYAJ 1WEXA 4IQXA 1N8RT 3MR3A 1N5YA 4EO6A 3PW4A 4MKVA 2HHQA 4OV1A 3TO8A 1PO6A 2H51B 2QMXA 3LQVA 2QG9B 2WBRA 4KKOB 1RAIB 1XR5A 1SKRA 2OH2A 4KGKA 4R8UB 1HBMA 2HIYA 1Q53A 4Y2IA 3SXLA 1T3NA 2J7WA 3A3PB 1TFYA 3RW6A 4CLYA 9RUBA 2DO4A 1YBUA 1U25A 3Q8VA 8RUCA 2VG7A 4B02A 2MTLA 2M8DB 1VBZA 3DGPA 3D7SB 3FUYA 4LFCJ 3E01B 2N82B 4RO0A 1VQLS 1Q78A 2GMHA 1L3TA 2BBEA 2YWGA 1S59A 2GVZB 4HT5A 3Q8PB 1UW4A 1TUVA 5EX0A 2BVZA 3AHPA 1P8GA 2JZ5A 2GMLA 4NZ6A 2OEJA 2HHUA 3N01A 1FXLA 4Z37A 2RB7A 4B9VA 2B4UA 2A18A 2R7WA 1NK7A 1KFDA 1Y11A 3FDSA 5T14A 1CPZA 3G2XA 2EFNA 5KFGA 1UETA 3I0SB 1Z2LA 1RUSA 5KFAA 2HHWA 1RT7A 4XK8C 4NYOA 4N5SA 4EK2A 2AX1A 1OSCA 2IM2A 4NLTA 2RS8A 2FHKA 1OPIA 2H48B 4JI3J 1UJ4A 4HH0A 2V8GA 3HVWA 2AJFE 2HHPA 5GAEI 2EG2A 4Y65A 4QBUA 4DV3J 3MECA 2RU3A 5B09A 4MTPA 2VH7A 4WK3A 1KVJA 3V81B 3P5TL 5KG7A 4R0JA 3J7AN 3DGVA 4EWTA 2BRKA 3RBZA 1IQTA 4PQAA 2CNLB 1VYAA 4NX9A 4OZJA 3SSRA 3A3NB 3H42A 3DCAA 4Z2XA 2AEJA 4K7QA 4E8UA 3DOLB 1BE4A 2CUYA 1EZZB 3KK1B 4G1IA 5C42B 4KKOA 2B51A 1EETB 1MN9A 1DBDA 4DN0A 3SQOP 4R8UA 4W92B 3BO2A 5GAGU 1XN9A 3NNAA 3HHDA 2VB6A 3TUJC 4DCPB 1V3RA 4WIQA 2BJDA 2V5HG 2F8HA 3W8PA 1WHWA 4EFAC 4H4KC 3E01A 4IDKB 2E9TA 4YB7A 2ZHAA 3AD7C 3BR9A 4URGA 3TA2A 1RWOB 1NPRA 2GVZA 4OJGA 4WTYA 3SFUA 1SKUB 5K20B 1HIYA 1HI1A 3G86A 1S6QA 2YVSA 3VGTA 4ID8A 1RABB 4LSNB 3I4PA 1Q1KA 1RTDB 3T9ZA 5KFLA 4A8MP 4WFXA 1VJQA 4H54A 1RZMA 3VZHA 2IJRA 3OFFA 2EFOA 3QGIA 2DR7A 2RRNA 4NASA 3I0SA 4L6V3 3AOCA 1X9MA 5F0WA 1EX8A 1S10A 4K4WA 1QVGR 4ES3A 2LXFA 1QD1A 1WHVA 1F9HA 2MLYA 3ILIA 2B4OA 4X2BA 2XNQA 2DPIA 1B64A 4LRDA 2XEXA 1VS3A 2PMZD 1XBWA 2VPZB 4A47A 4KO0B 3UDLA 2YY3A 2L9WA 5KT2A 4YB1P 2FC8A 2UUAF 1SJQA 4RUCA 1BXNA 3V81A 1HARA 3CULA 1T9YA 3O3LA 2XQCA 1OWXA 2X1GA 4J9KA 3NY0A 4GKKF 1MSWD 4JI3F 3TZXA 4PG5A 3DOLA 4CNZA 2W2OP 2MZSA 3KK1A 3W5ZA 3MFIA 2CAJA 3CCJS 1EETA 2Z2MA 4LRBA 1S4FA 4ZVSB 1YBAA 3KUHA 4DV3F 1DRZA 5GAHU 1Q81T 4JUZA 2BOAA 2QLWA 5J2MA 1BQNB 4R0EA 3JQKA 3KXDA 2BJ9A 4TU8A 3MCMA 2VQFF 3T6JA 4M5NA 4TXSA 2J8SA 4Z7YA 2D1CA 4FKYA 2QFIA 4U95A 4JV1A 3DOKB 2XMJA 5AXMA 3BQ2A 4HTJA 4IDKA 3VV2B 4DV1J 3MM9B 4EI2A 1Y9OA 2ZH9A 4IFYB 2CG8A 3D3BJ 4RW7B 4UW2A 2FHOB 2B3TB 2AYMA 2MQMA 5J2QB 2W01A 3FZBA 4K4ZA 4UZBA 1NK0A 4B3TF 4MYUA 4Q8EA 1T7PA 4NXNF 1LXJA 4HACB 5LJ3Y 1OQ3A 2V4QA 5HQMA 4EBCA 4LSNA 2XBPA 1RTDA 1JKHB 4IRDA 4YB5A 2CJBA 3R2DJ 5EHHA 2LXIA 1NK4A 2GQCA 1YLXA 1M5PC 3BGOP 4UQGA 1VQMS 1JLFB 1X4FA 2AP6A 2HNYB 3IM8A 1S1XB 3DLEB 4K59A 1N6QB 3TI0A 1OY8A 2PEBA 5ETSA 2KT2A 1H2TZ 2B9YA 2R3VA 2JC0A 4KO0A 4AE5A 1YJVA 2W1BA 1YRTA 4BS2A 4B3MF 1QSSA 4DR5F 1SIWB 4ALZA 3H98A 3MEDB 3L7UA 1ULRA 4UQTA 3A4TA 4GMKA 4UY85 5JUMA 1QAXA 2X1BA 1XQIA 2AJ4A 4V19J 2MKCA 3HO1A 1M5SA 3MPUB 3ZZ0A 2MKIA 1NK8A 1YRXA 2ZC4A 2DRBA 2QV6A 3DKDA 3BKFA 3OTOJ 3KLHB 1KFSA 4ANCA 4NCGB 5DG9A 1FRKA 3KJQB 1U48A 4ZLNA 1FTCA 1UFKA 3CD5A 5F3ZA 1X4CA 2G1DA 1BQNA 3UI3A 4BWMA 2ALZA 5AT1B 3CJQA 4B9MA 1Q8KA 3A8KA 3MM7B 5L1LA 4LIRA 1KONA 3IAS9 5LSRA 3DOKA 1PBUA 2Y9HA 3VAHA 3OLBA 3TYTA 3MM9A 4LFAJ 5SZTA 3O8WA 2FLLA 4IFYA 3G87A 4K5SA 4RW7A 1KLNA 4DWIA 3GONA 3HSZA 2FY8A 1FWPA 4PABA 4DPTA 3V6DB 2LA4A 4OYAA 4Y3CA 1JNZB 2XG8A 4HACA 2DHXA 2HYIB 1WNEA 1G7CB 2G9OA 2DGVA 3QRQA 1JKHA 3QYYA 3PYFA 4WE1B 5I3QA 4DV1F 1VQOS 5IQQA 5DQIA 5L9NA 1R6YA 4EMDA 4DS4A 1S57A 1VFJA 4WK1A 3CCWA 1JLFA 4D3HA 2HNYA 1FDAA 1S1XA 3DLEA 1N6QA 2RNEA 2UUBJ 2COLA 1HFEL 4YR0A 3EMTA 1B0VA 2LEBA 2Q3PA 1FDNA 2Y1JA 4M95A 4ZLJA 1WORA 1EHWA 2ZC3A 4F4XA 4OJ3A 3KMSA 2BW7A 2CPEA 3AJ2A 1F0XA 3TP2A 4USHA 4ICLB 3WX4A 2R7UA 3NGTA 4K4YA 1VK8A 3MEDA 4RW6A 1H72C 2FVCA 4EYHB 4B9UA 5J1PA 4C11B 3KG1A 1UTAA 2LP4A 1J5OB 1TL5A 1DARA 5BYQA 1RJJA 1VQYA 1BD6A 1X5TA 3KLHA 3EGNA 3VGSA 5B0CA 4NCGA 4C0HA 2BM0A 3HFKA 4UUWA 3VVTA 2JFKA 1V6HA 2I38A 5ETQA 3KDNA 4QOTA 2HHTA 4G1QA 1GXLA 4WFNQ 2MQPA 4ZPDA 4M1KA 2HAIA 3MEEB 3BEGB 3MM7A 5L46A 1ZPVA 2XMMA 2V67A 2DYAA 2HBYB 3KLIB 3D6MB 4NLPA 3H25A 4USIA 3Q83A 2K7JA 1GTEA 3J7YI 3BV8A 3UDCA 5FLXU 1WOPA 1C4AA 4ECQA 2HVDA 2W4CA 2ZH3A 1ZM9A 3OTOF 3V5RA 1AZSB 2ROGA 1S1TB 2HFVA 1N32J 4B3RF 4M5JA 3OL6A 1Y4ZB 1DHMA 1QDUB 3V6DA 2DO0A 3MMCB 1J27A 3V6HA 2OPSB 2VF3A 2U1AA 2GHWA 2ZUAA 2GIRA 3LAMA 4MFBB 3MM6B 1FKAF 1MROB 2CQ3A 2D3O1 1WDTA 2RDJA 1T0TV 2APOA 4WE1A 3MR2A 1H3DA 4LFAF 3I56S 1AW0A 4ED6A 1QLNA 1FNMA 4PXCA 3PZPA 4DV0J 5KG6A 2VIHA 1XNQF 3J7Z5 4PZVA 1T9WA 2KH9A 3AQPA 5KT5A 3M7VA 1R0BG 4HR2A 3S01A 3FCHA 2ZOFA 4J9MA 2XS5A 3NBPB 1CVJA 1WSVA 1RT4B 2R4FA 4LVNP 3BGLA 3RRGA 1SBRA 4ICLA 3SMZA 1U2CA 4ZPWR 2NR0A 2O5DA 3L09A 3IR5B 4R5PB 4RKUC 4XO0A 1WDDA 3HLUA 1SKSA 1NBEB 2HWTA 4IOCQ 4USKA 1B0TA 2UUBF 2CNNB 2V94A 3IO1A 4C11A 4A48A 3T5JA 1J5OA 4MIAA 4C8YA 3NGRA 4O0NA 4EEYA 4FZVA 2F8MA 2H54B 4RU2A 4PRFA 1U26A 2WW8A 2GQ2A 3PHEA 2P9EA 4OI1A 1VIXA 3C6TB 2J0XA 5KFXA 3CT9A 3N79A 1K1QA 5KFHA 3MHYA 3MEEA 4JV5J 2LQJA 3KLIA 4EYIB 2DNHA 4B9LA 5J2PB 2F9DA 3AD9C 1NHKL 4F4WA 2DY9A 4DL4A 2CQHA 2M0GB 2OSQA 5F8IA 4N56A 3VAIA 1U49A 1CSJA 4W98A 1RT3B 1X7VA 1AZSA 3ENVA 4Y6IA 1Q8IA 4ECZA 1S1TA 4I2PB 4NA2A 2MQQA 2HZCA 3QFWA 2ZBPA 3QFHA 2NQPA 2I5JB 3MMCA 2OPSA 4OHVA 5F8HA 4MFBA 4ELVA 2BDPA 2J9DA 3MM6A 1MROA 2MQOA 3FCVA 3SV3A 4RBTA 3PX4A 3BBFA 2R8KA 1NJIT 1U1RA 4X4RA 4CZCA 1U1QA 1CC8A 1NXIA 3OXFA 4QIVA 2V9WA 2X7IA 3HFVA 2XLIA 2YWWA 1VBXA 4DSKA 1VC0A 1K73T 1N32F 3K5NA 2P6TA 1HI8A 3IRWP 5LMUF 3M9MB 1NZ8A 3OLAA 2J6UA 1Y5LB 1TL1B 2XNRA 4J91A 2IYGA 3NBPA 3JXOA 1XMOJ 1RT4A 5IV3A 4O4RA 4ZVRB 3DI6B 3FBBA 1B7YB 1RLCL 5AE3A 5I3UB 3IXQA 4M5IA 2PGCA 4YB6A 4GC6A 3TZYA 1WOSA 2QLBB 4DV7F 5KT7A 5D8HB 4R5PA 3ONQA 4ZP7A 4DSEA 4LR7A 4DV0F 2CPDA 4YEAA 4JV2A 5K8MA 3P5BP 1RTZA 1JX4A 1FKOB 2GHVC 4FVMA 2FJAB 4I64A 2BJ3A 5IC6B 3L3CA 3G9CA 4LF5F 2EFPA 4ECUA 4WCEQ 1UA0A 2E5GA 3TANA 3MDFA 1HW9A 1YIJS 4IOBA 1HHSA 3KNAA 1ELOA 3BPSP 3C6TA 5EN1A 2DH7A 4L3NA 1VMBA 1KBRA 2RJZA 2QMWA 2OGUA 3KG0A 5FDLB 3BSOA 5KAKA 2KU7A 1IKXB 2WW4A 2QGFB 5J2PA 1KP6A 2QSFA 2G2YA 2WVDA 3CDAA 4QYZK 1NKBA 3LO3A 3TARA 2ZKUA 3OT9A 4F3QA 2HQGA 2YPZA 3M2RB 1FCAA 5HROB 1JJ4A 2KL8A 1RHRB 1RT3A 5B0GA 1VQ4S 4YR3A 2FC9A 3LP2B 3O5TB 5B0DA 3SDEB 1T11A 2LQ5A 5IZHA 1XNRJ 2I5JA 2DNMA 2JDJA 1MNEA 2LQ8A 4JV0A 4DLGA 1ZM4A 1S4EA 5LMNF 2BE2B 2GGPB 4F2RA 3UCUP 4J9UE 1FVQA 4K50A 1IR0A 5IM0B 2YNHB 4K4SA 3CXCR 5GMEA 5DGBA 5IQ6A 4IYQA 3R8YA 1WC6A 4CH7A 4MJKA 3K17A 3SQGA 4EGLA 3T1YF 2HW3A 2L9DA 4HHJA 2IM3A 4UT4A 3I5CA 3RW7A 2VICA 4J9VA 4GKJJ 4USMA 3OQ2A 3BPDA 4FPRA 1K47A 2LKZA 1TL1A 1HWUA 4G65A 3DI6A 4Q7AA 2C28A 3M8PB 3Q89A 5I3UA 2HVZA 5AJ3J 3K58A 9ATCB 3PX0A 1HBOB 5LXYA 2H65B 1FDDA 5HLFA 1VR6A 2R8GA 2GFFA 3CWJA 4QU6A 2LLZA 3F41A 4DJBA 1FKOA 2FVSA 3MOJB 4YHHJ 3RB3A 2KM8B 4GRSA 1VI7A 3MCSA 2ZH8A 2KT3A 1XMOF 5L38A 2KI2A 2QYCA 3DHXA 3ZTRA 4CIOA 3GV5B 1RWPB 4F26A 4USVA 1HI0P 4MKAA 3QLHB 1CG2A 1CLFA 1FXRA 1PKUA 2NYIA 2FDNA 1RBLA 2RH3A 2WSEC 1GX6A 2AZ3A 3PY8A 1IKXA 4ILLA 4M5MA 4AL7A 4CYUB 2OLWA 2HVIA 2DTJA 3ULHA 1X60A 1N33J 1TL7B 5CXTA 4QZVB 2E7XA 3M2RA 5HROA 2ZH7A 2ZJQQ 3TVYA 3LP2A 1H74A 4LRCA 3E51A 3DLHA 3SDEA 5CCLA 2YKAA 6AT1B 4LF8F 1TUGB 3J81U 5J1NA 3BSAA 1FDBA 2ZZMA 2BE2A 3TA0A 5A0YB 4WJBA 1WC3A 3MOZA 2PI5A 5IM0A 2YNHA 4UOGA 3EVOA 1KQSR 2J6TA 2X1FA 1JJ2R 1FK9B 3HT3A 3CCTA 2B9EA 1E6YB 4TN2A 4QIWD 4NCBA 3W9HA 2GNKA 4OHXA 2QFJA 2L48A 4I69A 4P2FA 4ECWA 2FHMA 2IVMA 4X65J 1UVNA 1YGYA 2C2OB 3GFHA 4JOUA 1FKPB 2MQ8A 3PM9A 4JI4J 1BUXA 4FPIA 1SPBP 3GG1A 4LIWA 2HRUA 5B08A 1UVJA 4DV5F 2EC2A 1V5VA 4RBVA 3M8PA 3PYEA 5ETTA 1HBNA 3MD1A 1LQ9A 3DXSX 4NLOA 1HBOA 4LMZA 3GFYA 4Q0BB 1K0VA 5SUHA 1LW0B 3F56A 4Y0FA 5FLXY 5K8PA 2FHJD 5KFQA 2GIFA 1MLAA 1FXDA 5C2GA 2BACA 2PD1A 5DZ7A 3U27A 2HFUA 2V9KA 3HSDA 4I0WA 4NE9C 1RAGB 3QLHA 3DRXA 1H73A 5BR8J 3NCPA 2ZWPA 3CCVS 2ZH5A 2OUGA 1X4DA 4W4MA 2X3DA 4ED1A 4YHHF 1T9VA 3HSJA 1X5OA 1WHXA 4ZJLA 2VUGA 4CYUA 4PG4A 2Q1LA 3P96A 1P1TA 2RE1A 3MMJA 2GIQA 1Y5NB 3MURP 1TU0B 6FD1A 4HKQA 3PR4A 2C2RA 2E5JA 1Q7YT 1Q95G 2HK2A 1S72S 1ZM3A 1Y3JA 4JI1F 1Y3KA 4F0KA 2CPXA 1WOOA 2FY1A 2B43A 4CM0A 1TFWA 2NXJA 4NLRA 2UVRA 1XEZA 3KLGB 1F2HA 2WB4A 2XYHB 4JI5J 1FWKA 4UOCA 4Q8FA 1LWXA 1SQFA 1N33F 1FK9A 1SXLA 1WG1A 1E6YA 2MMYA 3AOAA 3JYTB 2ZBCA 3MZIA 4NA3A 1I94F 1CQNA 4C8NA 3GCWP 4M5KA 2VV5A 2JLEA 1FKPA 3K5MA 2FVRA 4U96A 5BYSA 4YP3A 1Q7LB 3PO5A 1FFSB 1RA7A 5HP1B 5DS7A 4WTOB 1ZBTA 2KHDA 3OTDA 1NB2A 4K4TA 3B78A 4DL7A 5KG5A 3S8SA 1IBMJ 3RR7A 3CCLS 1BWEA 3K2YA 1T05B 3UW1A 1LW0A 4ZVQB 4U8YA 4JB8B 1B7FA 2LDYA 4X65F 4KV8B 3CJKB 1PJ7A 3Q8SB 4C97A 2NXNA 2CQ2A 3POTB 4RWXA 3PO4A 2UXDJ 3M9NB 2CQIA 1KN6A 5D3GB 3B6BA 3ADAC 4ILMA 4J9PA 4RL1A 5KFUA 1RDRA 1UVKA 3P4UB 1HLWA 2GC8A 2IDEA 2R8HA 4CO4A 2R8JA 3TZZA 2DHSA 3P49B 4KGXB 5M2RA 4OX8A 2HS0A 1X9SA 4PEOA 5B0EA 4X62J 2BUNA 1T03B 2QTWA 5CYQB 2CZVC 2B5JB 3V6KA 3TQ1A 4P2SA 4DF8A 2DXFA 2MZQA 3H2UB 2ZBIA 5DJBA 4NXMJ 1GQEA 1YHQS 4HEA9 1RB0A 2XZDB 4IUFA 2O01C 2Q6BA 2E29A 4PWWA 1R43A 1NSPA 2CQPA 4I56A 2F3JA 4HHHA 2VDHA 1VCTA 1GNKA 1TVRB 5IT0A 3GCXP 4LT6A 2KFNA 3NGUA 1H98A 4CLSA 3BDPA 2O67A 1UA1A 3OVSA 1O5JA 4GVBB 4B3SJ 2OELA 2YNFB 4HDHA 3TUIC 1FO1A 4OZ1A 2IA0A 3JYTA 2IAJB 3CJSA 4DG1B 2OEMA 4WFYA 2HBZB 2U2FA 4DV2J 5JXSA 5HSPA 3N0VA 3DC2A 2GJ2A 2HGMA 1ROFA 1VHFA 4F25A 4N41A 3OV7A 1UWBA 3NRBA 5MLCV 5E0OA 4UY8T 1FVSA 3AODA 2FGOA 4DI6A 3IWXA 2JEJA 1N5QA 5HP1A 3GMGA 5KFCA 3CC2S 4IFVB 1WC1A 1GFWB 1FI4A 2A10A 3JTOA 2VOPA 1T05A 1UZHA 2GO8A 4DUZF 1R31A 4KFBA 3OHBA 1GTHA 4KV8A 1R0AB 1QVFR 3GG0A 4YFUA 1UZDA 4RNMA 3HVRA 2JLGA 3A12A 3OBIA 3POTA 4ANDA 2G2OA 4CLUA 4S0MA 4G6VB 3CCQS 4ER8A 2RF2B 4QW9A 3D3CJ 3DU6A 5D3GA 4DS5A 1WSRA 5IC4B 1DLOB 3K59A 1IBMF 3EXCX 2JNJA 1W7WA 3CO0P 1RA6A 3ILLA 4JI8F 4NLGA 4OX9J 4ED7A 1B70B 1MU2B 2G0JA 1T03A 3QIPB 5CYQA 4JI2J 4OJHA 4QYZJ 1H7XA 1D3WA 1S1UA 2RS2A 1NNDA 2B5JA 1RSCA 3IS9B 1FJEB 4OYOA 3D54A 3VF0B 2DT9A 3CGIA 3BJYA 1N48A 2AJQA 3TRGA 5E3AA 5E3PA 3UFCX 3CDWA 3U02A 1P9QC 4TVAB 4C3LA 1SL1A 1TVRA 1HWKA 2XHCA 5CHCB 4X62F 2J76E 2M7SA 3J7YU 3MR5A 1RGVA 1S6UA 1EKRA 3R1LA 2CIMA 2YNFA 3HP6A 1U1NA 3D6TB 4LF9J 1U0HB 1ZAVA 4DG1A 3G6YA 3KTQA 3RG6A 2WSCC 4LR8A 2QO3A 3IA0A 1ZZNA 2J9DE 4K8RA 5D78A 4ZK7M 2DD8S 3EYZA 3JSYA 3LPYA 1NMEB 2VKZG 4C7QA 1GT8A 2UVWA 4IFVA 2MQNA 3GR1A 4DUTA 4LSLB 2DGXA 4QR0A 1Y0HA 1UFWA 3AA9A 2O1PA 1KRPA 4OZ5A 3KLFB 1WKJA 4QU7A 2Q6CA 2CADA 2UU9F 4KRWA 4I67A 4DPOA 1R0AA 1KOHA 1OS5A 2KTQA 1WF0A 2AYEA 1RK8A 3C66A 3C3LA 2K3IA 1WC0A 2DGUA 2N3OA 2RF2A 3J81Y 1YJNS 4U67Q 5B0AA 4F0HA 3JB9k 1EIYB 3FRYA 2MKKA 1DLOA 2PN6A 4X4PA 4FS1A 4JI6J 4LREA 1VRQC 1FD2A 1HBUB 3HVAA 1D9FA 3R5CA 2FVQA 4EBEA 3ZZYA 3G8QA 3K0JA 4ZVTB 4WIIA 1HNVB 1MU2A 3QIPA 3MCOA 5KG3A 2ZNYA 3M05A 3KYLA 4FYWB 4RNOA 3CIMA 4H4KA 3LWLA 3IS9A 5L1IA 3BH7B 4M8LA 4M5GA 1RAHB 1S49A 2E5LJ 2KO1A 1YJWS 4DV4F 5AXNA 3PJ9A 2XMAA 4WP8A 5D4OA 2DNZA 4Z7CA 3D4JA 4DR3J 1VK3A 4CM2A 1RT6B 2CNOB 1RT5B 2VA2A 5JJBA 2XTJP 2CVIA 3W2WB 4JI2F 1YX2A 3RJMB 1SB6A 2HHHJ 3DM2B 3JSBA 4UOFA 3J7ZT 2MQLA 4WPAA 3TUPA 2IMOA 3KMQA 1SJRA 4XIUA 2H1YA 3BGFA 1FJGF 3VVUA 3DLKB 1X31C 1U0HA 2Q79A 1I6JA 2BQ3A 1MWZA 5E7OB 3WBZA 4OL8A 4KHPJ 3AOBA 2AWZA 4P2XA 1N34J 2E7WA 2AGOA 2KHCA 2GHPA 3OXGA 4N8NA 3SCIE 4DSLA 4RJVA 3RYLA 4LSLA 2DPJA 4M5DB 3QRPA 5LM7E 3PACA 2H3EB 5ETLA 4RR5A 3VAGA 3KLFA 1D09B 4TYBA 1YBTA 2J7KA 1PJ5A 3IR6B 2CPJA 4RUBA 4X64J 2W9BB 2D7SA 2W9CB 2EKYA 3RTVA 4BWJA 2WBMA 1HKAA 1ZTTA 1LK5A 1LWFA 1TV6B 1FX4A 2JEIA 3CMES 3VQTA 4DR7F 3BR8A 4DUYJ 3SSSA 1HNZJ 3NAHA 4ECYA 4NYPA 1HYSB 2QA4G 2BKPA 2MHNA 4F4ZA 4A4JA 5KFBA 3HJFA 4JI0J 1HNVA 4DDFA 1P27B 5AXLA 5M2PA 1ZAXA 2RRBA 5H9FK 3TUZC 2KM8C 2MXYA 5KFZA 3H2VE 3M6UA 1S6PB 1OPZA 3B4DA 2QE5A 1N36J 3IR7B 3UO0A 5KFMA 5IFMA 2WK4A 4PXBA 1RT6A 3BSNA 7FDRA 1RT5A 2ZNZA 3W2WA 1UFLA 3DM2A 3PVXA 2DBBA 4GC7A 2RMLA 1A6LA 3ENAA 4Y2CA 4DR4J 3OTEA 4J37A 1KKHA 1DZ5A 4MT1A 2XS2A 4N76A 3DLKA 5A2QU 4DU8A 2C3PA 5HMZA 4KIAA 4N47A 2VJUA 3DRYA 4MH8A 1HNXJ 1LWCB 4DR3F 4N7TA 5KFIA 1U47A 2H5IB 4L73A 2Q43A 2AYBA 1SL0A 3OR1B 3BBCA 4J90A 4FNIA 2HHHF 1PGZA 4DR2F 3G8SA 2NPIA 1FTRA 7FD1A 3KHRA 4M5DA 1QJHA 3I96A 4TY9A 4OX6A 2QA1A 2C1EB 5A6WA 1K44A 5A76A 2ZH4A 2AGPA 4ATNA 2W9BA 4MK7A 4KHPF 2LVWA 1FE4A 3C6UB 2FIUA 4C98A 2W9CA 4IG0B 2KYXA 1SJ4P 3BSCA 2IYIA 2VJVA 4CDIA 1EQ0A 2HHSA 2OTJS 1DQAA 3I5BA 1TV6A 4DEZA 2HBQB 2ZH2A 3NOGA 3HHLB 3GFZA 5B0FA 1LV5A 4XDDA 2W8KA 3VALA 1X8DA 1QTMA 4C3KA 3SSQA 5T7LB 3QGHA 1T3OA 3UD4P 1YSJA 1HYSA 3TJAA 1Q5VA 3NG8A 1KD1T 4ZP8A 3W66A 4YDDB 1RKJA 3OW2R 1VQ8S 2MYFA 2RVJA 4I6WA 2RQKA 3PNIA 2NS1B 5ETVA 1JJCB 1H2UX 3FSXA 2O66A 1FNOA 1CJVB 2J8AA 2MKJA 2V50A 1S6PA 3G71S 1ZH5A 4DUYF 1R89A 3R7SB 3GIRA 5GADI 2KRRA 4DQQA 1U6BA 3I9ZA 3R7NB 4NA1A 4FS2A 2VG6B 4N77A 3HXMA 4JI0F 5L9XA 3OHAA 3G4SS 1U1OA 4PXDA 2IJNA 4NPOA 2PT0A 3OR2B 1P1LA 4TU9A 2C42A 2W7AA 5K8OA 4OX7A 4IH7A 3QJPA 1S77D 1LWCA 1L3KA 3SFGA 2AKWB 3OFGA 4A8QA 2OKQA 3HHLD 3D68A 4NI2B 2XZWA 3OR1A 1VBYA 3RR8A 4JI7F 2ZOMA 5IOLA 1OO0B 3UCGA 2ASJA 4DR4F 2W4PA 1L3UA 5KG2A 2MLZA 3DLLQ 2ZE2A 1U7LA 3K8VA 4KBIA 4NZ7A 1M5KC 2XZTB 3A8JA 4DSIA 1EP4B 4YN3B 2QLXA 3JTNA 2L41A 3C6UA 1XWLA 4IG0A 2FJDB 3HM9A 1JLGB 2QX0A 1LOUA 3N9UC 1RWWB 3A3OB 3HHLA 1H2VZ 3EXYA 2NPFA 3AD8C 4Q2LA 1IQZA 1WC5A 3T1HF 2J0QD 3R6LB 1R8BA 5IS2A 2HMIB 5T7LA 4B3OB 2XCAA 4J7CA 3Q2SC 3IWNC 4LVOP 3FKBA 1V9OA 3DDIA 2ZJRQ 4ZDNA 2W7PA 3VTIA 4F36A 3EZUA 4ES1A 1QE1B 1TKXB 3MEGB 3QRRA 2XLKA 1UEVA 2P8IA 1C2PA 4TQSA 4QJVA 1DTTB 3H2LA 4O3PA 1JLAB 3AXMA 3KOAA 1QY7A 4ED3A 2QA2A 1EB0A 1F3FA 2PFFB 3NAIA 3M6VA 2HFOA 1IXKA 2VG6A 3FBEA 1SH2A 2YH0A 5CZXA 1JQGA 4WU2A 4FXDA 1NZAA 2MZTA 1ACMB 4HL9A 3UQSA 3QAEA 4CLPA 3SI8A 5HQLA 3OR2A 4K2XA 1NDCA 2ZWOA 5THWA 2B8PA 5JMNA 1IBKF 3DNCA 2O3DA 4C0OC 1SC6A 2AV5A 2VG5B 1XMQF 3W60A 1LFWA 3Q23A 1S0NA 5IXUA 2Z57B 1ICEB 2JEFA 1T8EA 2UVUA 4NI2A 4DL5A 3K89A 3QNWB 5KT4A 4DPUA 2AW0A 2KDOA 1NPPA 2FYXA 2FLPA 2HG4A 8AT1B 4AL6A 3ILOA 2CKWA 1RXOB 5ETNA 4FP9A 3NNCA 4K0KJ 3HK2A 4NEYA 3PEHA 2KN4A 3HX9A 2YNIB 1EP4A 1L3VA 4C48A 4YY3F 2Z2LA 2XWXA 1FJ7A 4DPXA 2CZ9A 1JLGA 1I3OB 3FFIB 2QLJB 2MHEA 3V6JA 3NS6A 2ERRA 1K9MT 1RACB 2HMIA 3F0NA 4AQYJ 1NJYA 1X4AA 1HQ2A 4B3OA 4IKAA 4CQ1A 1RAJA 4LF2A 2N7CA 2M4MA 1KNZA 2JLFA 5DM7Q 2YKOA 2IM1A 4FNHA 2IRYA 4Q45A 2XMWA 1T9XA 4TNOA 1QE1A 1OJ4A 1TKXA 4FF3A 5CZVA 3AA8A 3MEGA 2RDIA 4ZCLA 2W2MP 2E5HA 3CMQA 5D77A 1DTTA 1JLAA 1H0HB 2JH3A 4DV6J 3MM5B 1JLEB 4DQSA 5K9FA 4DSJA 1YQHA 5HVGA 2HKEA 3EPIA 1JLBB 2HQFA 3GYXB 2XHWA 5F8MA 3CTRA 1KS2A 3SZ2A 1Q16B 3Q8RB 1J5EJ 4ZA1A 5CCMA 1OMSA 1YI2S 4P74A 5HAOA 4JYAF 4ILRA 5C24B 2BKNA 1K0TA 3UVJB 2YTCA 1TKZB 1BY9A 4WP9A 2MDAA 2VG5A 3RRKA 3TAQA 1CJUB 2PSZA 4F8RA 4FBUA 2HQDA 4P10A 2GAGC 4NRTA 2Y8YA 3THTA 3KNGA 3CD0A 4PYAA 2KG0A 3THVA 2FJEB 5KTQA 2ABYA 4X4TA 3O1LA 3BGUA 1YWXA 1NRKA 2Z0GA 3PIOQ 2BRLA 4PG7A 1RWNB 4DZDA 2ZEJA 3QGPA 4LFCF 1TMJA 3C46A 1KQFB 3DHWC 3NP5A 2YNIA 5CYJA 4DFMA 1OYDA 2NUUG 1RT1B 1V5IB 4KY3A 2D69A 2YKQA 1HNIB 3GJSB 3FFIA 2KYZA 3V2UC 4I7FB 4BLGA 2V4JB 1MW7A 2CQGA 1S76D 1UPMB 2L9NA 4FDFA 2LDIA 1S48A 3C16B 3FEYB 4KPYA 4I4BA 4L74A 4X84A 5BYRA 5H9FJ 4LBIA 3IWLA 5ITHA 5A2QY 2Z30B 1N0VC 5E5NA 2L3MA 3W64A 1VDHA 3G6ES 1JIHA 3KFWX 2ATCB 2DNRA 2J5AA 2CDQA 1VQSA 1FEEA 1Y10A 1QUPA 2WTFA 2IHR1 2QLFB 1HR0J 1TELA 2B9XA 4USTA 3KG4A 1UJ5A 3TR5A 2YBVA 4F67A 4AQYF 3NOCA 1JLQB 3MM5A 5F8JA 1JLEA 1YZ6A 1RWVB 3MPWA 5C42A 3HZEA 2B0GA 3NNHA 4LFBJ 1JLBA 5CH7B 3AXKA 4OI0A 4RBUA 1UAWA 2XI3A 2RIJA 1PSDA 2UXBJ 4CTAB 1PJ6A 2KJWA 3U1NA 3QATA 1MN7A 3CJ2A 2G0IA 5C24A 2UP1A 2QIFA 3C14B 3UVJA 3ICLA 2E9ZA 4WU3A 3UWTA 2RHSB 3G96A 1TKZA 1HWIA 1FRJA 1OY6A 4CLLA 1IUJA 1YVFA 2J0SD 2GMJA 2DEIA 3QJJA 2CPIA 3FCWA 2ZVSA 3VZIA 3H7HB 5AXKA 1IN0A 2HLTA 1LNQA 2OHDA 3ZZUA 3PJWA 1BGXT 3VGVA 1J5EF 2FZKB 2GA7A 4OJ1A 2HGLA 3L9ZA 1L3SA 1F3VA 2WOMB 3H59A 3H5XA 4ZPTR 4C3MA 3EGWB 1NU4A 5F8NA 2GJFA 3M1VB 5KFTA 2R7TA 5DDPC 4P71A 2YQ1A 1RT1A 2FLNA 5IT4A 1HNIA 3PR5B 2ASLA 2VBXA 3B82A 3TX8A 1SC1B 2C2KB 3N6LA 4I7FA 3M2VB 2V4JA 1PCAA 2VOOA 3OSPA 1ZYQA 4DOZA 4CP5A 2W24A 3PKMA 3C16A 1U2RA 3PKYA 1LKZA 3R5AA 4C6AA 2DNKA 4V19X 3J81j 3A8EA 2HQ3A 1NUEA 2A6OA 1QTNB 3ISZA 5KG4A 1C1CB 1NLKL 3TAPA 2HNDB 3MCNA 3ZNUA 1VHIA 4MK9A 5JVHQ 1IKWB 1UL3A 1KHWA 5ETKA 4PAAA 5LXRA 1F5AA 1D8ZA 3SIPB 3PEJA 1FFWB 2ZZTA 1OY9A 3H20A 2R2RA 4WYLA 2XWYA 4X4OA 2ZJPQ 3LTOA 1JLQA 1S0VA 5M2UA 4QIFA 2X3GA 3KDOA 1QSLA 2C2EA 4HI2A 2LQ9A 2ASYA 2DGQA 5EWEA 1PC4A 2R7QA 1VGYA 1SC3B 2WHOA 3CD6S 4CTAA 3LP1B 2W7OA 1TKDA 5DGAA 3PRVA 2VFSA 1VC6A 2HIQA 2JX2A 3C14A 3SYZA 3CCES 4DQRA 1M5VC 3DLJA 2CFXA 1LXNA 4U8VA 2F4VJ 2DRDA 3GSIA 3RBXA 1TMMA 2B8QA 2HFNA 2KVQE 2WRMA 2FJBB 5HATA 4OHWA 3GYGA 5J2QA 1SV5B 2Y0SD 2EPIA 2Q66A 3UNGC 2CQ1A 1B99A 4DU7A 4DR6J 4OYZA 1DQ9A 2ROEA 2XYPB 2WOMA 4LF4J 3CDEA 2JVOA 4ZCKA 4I2QB 2OD4A 3S6EA 3FJ2A 1YG0A 1U4BA 3N4WA 3SV4A 5CYMB 1HWJA 1UVIA 3M1VA 5G0RB 1XERA 3UPFA 2YQ0A 3NGSA 2DNNA 1IM6A 1UWAA 1W25A 2WB1D 2HNZB 5D0RA 4OFZA 1XK8A 3Q8QB 2E1MC 3CCMS 4Y00A 3KLVA 3RBEA 4CT8A 3RB6A 3T5LA 1WI8A 3PIPQ 3M2VA 5EDWA 1NDKA 1VLYA 1URRA 2ACMA 5D4PA 2RD5C 3GSDA 1N88A 1L5UA 4IRKA 1HNWJ 2XY5A 3CC4S 2DJWA 2FVPA 3LANA 4ID5B 2HNDA 3UE2A 1G6BA 1IKWA 5KFRA 2CJAA 5DO2A 2LU1A 4RZRA 4K4XA 1VRTB 2B4VA 3MPDA 2MSSA 2YKMB 4ZCMA 3GPAA 3R5DA 3CJ0A 1TK5A 3RZAA 3IAM9 5EWGA 3Q22A 1GMWD 2DITA 3ZTQA 3HHLC 3VAJA 3OD2A 4J9NA 2AJ1A 3TEHB 3IRXB 1QAYA 2NZ4A 4FF4A 1R8PA 4F4YA 4OYBA 2IA6A 3LP1A 4WWSA 2ASDA 1F5BA 1PAEX 4KH1B 2CQCA 1T95A 4Y2MA 5I42B 1CQMA 1HW8A 1FRLA 3GTYX 4ITSA 4O3SA 1FERA 2C2MB 2G13A 1YRUA 1D0EA 2I8EA 1GMWA 1XIQA 1VISA 3JQJA 3FEZA 2B9WA 5F3TA 3U1LA 2R7VA 2FD2A 2HWIA 1SV5A 2ZH1A 1RWXB 1G2EA 2YX1A 4UZCA 2MZJA 3MUMP 4PPDA 4A8KA 1AROP 4FYDA 4I2QA 4EU0A 4DQPA 3W63A 5CYMA 3VAFA 4H4MB 3T6BA 2F4VF 5G0RA 2BA9A 2DK2A 1U09A 4BCAA 1AXQA 3SCLE 4NOHA 4O0IA 2HNZA 2B7CB 3L7OA 2RILA 4EZ6A 4QR1A 5F9LA 4RUHA 4QWDA 4NZ0A 4KGZB 1X0PA 3FVYA 5IV4A 2DH9A 2UZAA 2DIUA 2ZOGA 2OJ3A 2CA9A 3TJ9A 4ZN3A 2Z2ZA 2P6SA 2IVYA 2NREA 5ETOA 1S99A 3HHKA 1NJWA 2DGSA 2V2QA 2YWEA 5FIIA 3ITHB 1WD6A 1H38A 4ID5A 2KFZA 2VASA 1PG5B 3HVTB 2Y0BB 2BYCA 3BS9A 3GP9A 1VRTA 2YKMA 5FD1A 5J2NB 3MMBB 2XI2A 3F73A 3M8YA 3HKZD 3HULA 5A6PA 4LRFA 1PC5A 4CT9A 2IRXA 4ERDA 2XGPA 1CBKA 2GZOA 4WXWA 3UCZP 3IRXA 1NM2A 3MD3A 2FZGB 4EUVA 2F9JA 4PWUA 2FZCB 2RU9A 2R9LA 3ZFVA 3BM7A 4BC9A 3HD2A 4LBHA 4DFKA 2AU0A 2UXCJ 5I42A 1NSAA 2CXEA 1O8BA 1V3SA 2OD6A 3FMBA 4X4SA 4FXWA 1RHUB 5HMXA 2AJ2A 2V2VA 3NGDA 4NLUA 3ETMA 4CI0B 3TW0A 2YWKA 4YS2A 2V2KA 1KLMB 4XPCA 4IH5A 1R8AA 2VU5A 5CA5A 4RW4B 1K1SA 3BH6B 1WG5A 1FFGB 2XMUA 1B3TA 3MECB 3H4BA 2DXDA 4H4MA 4QPTA 4IR9A 2MKHA 4TU7A 2X51A 4ECXA 5HVFA 5RUBA 2DEJA 3Q8UA 1N0UA 4DZ6A 1Q0NA 5G4DA 1RAEB 4L76A 2LQBA 3C19A 2VBZA 1R6VA 3FBFA 1S0OA 2IRUA 1UPPA 2DHGA 3HMJG 1HD0A 1YJ9S 1T94A 1YTYA 2PA8D 3K5LA 5D15A 1T9UA 4KR0B 3UN3A 3GV7B 4ZVEA 1MMNA 4Y2KA 2QEXS 4LBPA 3ITHA 3CD7A 4LF7J 4NLVA 3HVTA 2OI2A 1G1XA 1BC6A 4U9RA 1F2GA 2F40A 3FK4A 1S9FA 3O44A 4C2MA 4IG3B 3R27A 2DNQA 5AE2A 5J2NA 1GEHA 3MMBA 3HD1A 3M6WA 3NS7B 2ATLA 2V4RA 5LJ5Y 1G4CA 3R97A 2JRSA 3W9JA 2AT1B 2J9EA 1E6VB 3R6GB 2GO9A 2LFVA 3H0PA 3D5MA 1WTBA 1QM9A 1WTFA 2F8EX 4WFBQ 1LK7A 4LF6J 1VQ7S 3TA1A 1S6QB 4ECTA 1KSPA 4MKYA 1OSDA 3IG1B 3N5BA 4RU9A 1NDLA 2VODA 2UUAJ 3VGUA 2LU2A 2DHHA 3BGRB 3FEXB 1FRIA 1TL4A 4X4NA 5LSLA 3AFGA 2RT3A 2IPOB 1NKEA 4MKBA 1X4BA 2BW2A 1IBLJ 3IBWA 4GKKJ 1N4LA 1KLMA 2HQIA 5F8GA 4I2PA 2QL5B 3UD5A 2XS7A 2RDDA 4Y34A 2AIRB 2KXFA 5DG8A 2A1BA 3DN9A 4RW4A 4JV5F 3AB4B 2UXCF 3UDEA 3E3XA 2LMIA 2JSXA 2XULA 1F1BB 3K57A 3R5GA 1S12A 3GIKA 1JXVA 5KFKA 2VQFJ 3AY0A 2UUCJ 5HO4A 2VC0A 2HVEA 3OL7A 3N6MA 2W8LA 3CB4A 2HAFA 3OVAA 1Q4RA 4QWCA 4A8FA 4DX8H 2DR9A 3MR6A 4OI6A 4L72B 3GJTB 5J2MB 4A8OA 4MIWA 3ZZOA 4B3TJ 5HBMB 4NXNJ 2XMVA 2XO7A 3HT0A 2VC1A 1U0SA 4IG3A 4RUAA 1FD8A 2CZ4A 2MZ1A 2IBOA 4DCOB 2RSQA 2XMTA 1RHMB 2BX6A 3OUYB 3DYAB 4U7UK 2ADCA 4M5LA 2G0CA 1YZ7A 1RBOB 3RAMA 1YITS 3DFEA 5DQGA 2POKA 4TLQA 5GAEU 1E6VA 2F5GA 2QN6B 2Z2YB 5ETMA 3PFEA 1U1KA 4DMZA 4NLQA 4LF7F 2D9OA 3EZ5A 3JSMB 5C2CA 2YNGB 1M0SA 3Q0AA 2QL9B 1FX2A 4PR6A 3IG1A 4C8MA 4PCQA 2PMHA 5FDLA 2W2QP 4B3MJ 3NL0A 2OTLS 4DR5J 3GYNA 1QAJA 4LRAA 3M8WA 2OSRA 1PYSB 1C4CA 1N54B 3TVZA 3BGRA 3T9NA 5E33A 3DLBA 2ZH6A 3MF5A 2YKPA 1ZS6A 2PDAA 4MIBA 2CJXB 2E9RX 4PG8A 4LF6F 4TKTA 2YWHA 3D0GE 4PKDB 2NSCA 1U6ZA 1VBKA 4OHYA 1SIZA 5L8RC 1FESA 4MYTA 4HDGA 4RW9B 2GGPA 3EVWA 4KJIA 2V34A 4ZVFA 2ZBQA 3I82A 5HMYA 4KH0B 3QT8A 1U1LA 4CCHA 1HHTP 2OAUA 3QT6A 1IBLF 3BO4A 3KJVB 2M9KA 1XNRF 3GLJA 4LJMA 5BJRA 5J1EB 2R2TA 3RU0A 4W90B 3KK3B 3R2CJ 4CWBA 4FF2A 2V8VA 3SBMA 2ZFHA 1CJTB 1GH8A 2FJVA 1LEOA 1LWEB 3LOUA 3CPWR 2K8GA 1WC4A 1FA0A 5KFDA 5B7WA 2CWKA 3L95X 2KT5A 1KQGB 2KB2A 5HBMA 2BJEA 2DNYA 1ZZFA 4PG6A 4HH1A 2RQMA 3HSGA 4FN5A 2NLWA 2PC6A 2UUCF 3EUNA 4KC5A 2DH8A 4GKJF 1A0OB 3GIIA 1X4GA 2EC0A 3OUYA 3DYAA 1FWLA 2CRLA 2MSTA 3TOQA 4NMXA 8ATCB 5AJ3F 4ES2A 3GILA 2PO4A 3OPKA 3AQOA 3JSMA 3KUEA 2YNGA 2E1CA 3CC7S 1UP1A 3PDNA 3ZZZA 5GMKa 4LQ3A 1RKIA 3LW5C 4NRUA 5F41A 1IVZA 3OL9A 4DR1J 3CSKA 2WVCA 5LSOA 3HFZB 5C5JA 5D6GA 1M5OC 3LGNA 1TL7A 4N8OA 3D66A 4PUOB 1TUWA 4A8SA 3FRZA 4J9RA 2VPXB 3RUBL 1RAAB 2GX8A 1CS4B 5HANA 2GJIA 2HRYA 4RW9A 4LSZB 3RGIA 5A0YA 2AMCB 3FMWA 3ZNJ1 3BYRA 3KUGA 2EEYA 4RW6B 5DM6Q 2M70A 2A3JA 5U47A 2C3YA 2YH1A
chains in the Genus database with same CATH topology
4YMEA 4HYKA 2QA2A 1UEUA 2PGCA 4YB6A 2OMOA 4GC6A 2PFFB 3KJVA 2HLUA 1QSYA 3NAIA 3M6VA 2DHAA 5F0UA 4DV7F 1NAQA 5KT7A 2BM1A 2HFOA 4ECSA 4NL5A 5D8HB 4R5PA 3ONQA 4ZP7A 4DSEA 1IXKA 1WELA 1VQ5S 3Q2TC 1S9GA 2VG6A 5J1EA 3M30B 4DV0F 2CQ4A 2CPDA 1SH2A 2YH0A 5CZXA 1NK6A 4WU2A 3KK3A 2DR5A 2KKHA 3DOMA 4GO5X 3EPGA 4YEAA 4U7CA 4JV2A 2OMLA 4FXDA 5K8MA 2VD3A 2VFVA 1FKOB 1JX4A 1LWEA 2AF6A 3CJ5A 1NZAA 2MZTA 3VWSA 2AD9A 2DGOA 2GHVC 4HL9A 3UQSA 3QAEA 4DSFA 4FVMA 3JTPA 2FJAB 3SI8A 4ZPCA 3D28A 1SJ1A 3TVKA 4I64A 1U45A 4DFPA 3OR2A 2KJVA 4K2XA 1NJZA 5THWA 2LXUA 4G1QB 3KHHA 3L3CA 1Q8LA 2WSFC 1IBKF 3DNCA 2O3DA 3G9CA 4LF5F 3ISNC 3IGNA 3MMAB 2EFPA 4Q0BA 4ECUA 2P9CA 2FB0A 4C0OC 1SC6A 2AV5A 2J6SA 1Y5IB 2ZD1B 4RWWA 3HKWA 4WCEQ 3X3UA 1UA0A 2E5GA 2VG5B 1XMQF 2JEGA 2M8HA 3TANA 3MDFA 1HW9A 1LFWA 4MMOA 4CH0S 3Q23A 2C2DA 1YIJS 3RAXA 3N6NA 3PW2A 1G3OA 1S0NA 4F50A 4IOBA 5IXUA 4J9OA 1HHSA 2OPQA 3KNAA 3BREA 1ELOA 4O44B 2UV8A 3I6PA 3C8YA 2JEFA 4JI4F 3C6TA 1T8EA 2UVUA 5EN1A 2LYVA 1LW2B 2DH7A 5KFVA 5DG7A 4DL5A 1HR0F 4L3NA 1VMBA 5K5MA 5KT4A 1ZAWA 2RJZA 2QMWA 3AH6A 1JJHA 5DDRC 2AW0A 1DJ0A 2KDOA 3KG0A 2EI5A 5FDLB 3BSOA 5KAKA 3UD3P 2FLPA 3VAMA 2HG4A 1IKXB 2KU7A 4F3MA 1M90T 4AL6A 3LWMA 5J2PA 3I87A 1S9EB 2DNOA 3H5SA 3K7RA 2CKWA 2WCXA 3I5AA 2QSFA 4C4WA 2CQDA 4ED2A 5D4NA 3CDAA 4FP9A 1HL6A 4ZOSA 4EO8A 3NNCA 4LFBF 3OTBA 1NKBA 3LO3A 3E2EA 3TARA 2ZKUA 1VQKS 3HK2A 1F60B 4F3QA 1SJFA 4ZLPA 3M2RB 2EBEA 3I32A 3PEHA 1FCAA 2KN4A 3HX9A 2YNIB 4ZKAA 5HROB 1JJ4A 2UXBF 1EP4A 5B0GA 1RT3A 4I1TA 1L3VA 1VQ4S 1DURA 4YR3A 2FC9A 3LF0A 3G6VA 2R7RA 2E1RA 4YY3F 3LP2B 2CVEA 2Z2LA 1VIOA 3IC1A 2XWXA 3O5TB 4QW8A 5B0DA 1FJ7A 1S6OA 3SDEB 5KT6A 4C8OA 1UVLA 2LQ5A 5IZHA 1JLGA 3OXLA 2OP5A 3FFIB 3M8RA 2I5JA 2DNMA 1VC5A 2JDJA 3UR0A 1CC7A 3LALA 1MNEA 4O3OA 1J2VA 5I4MA 2MHEA 2JWNA 4JV0A 4DLGA 1ZM4A 5LMNF 2BE2B 1BQMB 2GGPB 3OFHA 5K14B 3NS6A 3V6JA 3UCUP 4F2RA 2ERRA 3PW7A 1K9MT 1FVQA 2WONA 4TY8B 2I9SA 4K50A 2HMIA 1IR0A 5IM0B 4PUOA 2YNHB 4K4SA 3GZ7A 2SXLA 3CXCR 5DGBA 1NJYA 5IQ6A 4IYQA 5BR8F 1X4AA 3QMQA 4CH7A 4MJKA 4B3OA 3PV8A 4IKAA 4OLPA 1W2IA 4CQ1A 5KG1A 2QRRA 4NLSA 2D3UA 3R1HA 1H7WA 1RAJA 5EX3A 3SQGA 2N7CA 4EGLA 3T1YF 2HW3A 2M4MA 4F2SA 2AGQA 4KQZA 2L9DA 1RISA 1HPZA 1KNZA 2JLFA 5DM7Q 2YKOA 2ILZA 4HHJA 2IM1A 4FNHA 4C9DA 2BANB 5I3PA 2IM3A 3V4IB 2IRYA 4Q45A 3I5CA 3RW7A 5KG0A 2XMWA 4TNOA 1QE1A 2R7SA 5KFEA 2R7XA 1TKXA 2RRAA 3KLGA 3M32B 4ZP9A 5CZVA 4FF3A 3AA8A 3MEGA 3OQ2A 4IO1A 3M2UB 3WDOA 1FT8A 2RDIA 4ZCLA 4DR1F 2E5HA 1DAXA 4FPRA 2AJ0A 2NUHA 3ETOA 5D77A 2JVRA 2LKZA 4CO5A 1TL1A 3KWMA 3LP0B 5JVGQ 1DTTA 4ELUA 1HWUA 1TK0A 4DL2A 1JLAA 3DI6A 1H0HB 1C1CA 5H1SV 4Q7AA 2C28A 2JH3A 4KHRA 3M8PB 3V4MA 5I3UA 2HVZA 3MM5B 1HQUB 1A7GE 1JLEB 4DQSA 3K58A 3PX0A 1HBOB 4FBTA 5LXYA 5EWFA 4ETXA 5K9FA 4BBYA 1FDDA 5HLFA 1IKYB 5AE1A 4DSJA 5KFFA 1YQHA 2VPWB 1RTIB 1U6FA 3EPIA 1TQLA 5HI7A 1JLBB 2OPPB 2R8GA 4AXJA 2GFFA 3CWJA 1BLUA 2XHWA 3GYXB 3M30A 1NO8A 4QU6A 5F8MA 2LLZA 2A2CA 3CTRA 3HPOA 1KS2A 3SZ2A 4BHQA 1Q16B 3CCUS 3F41A 3Q8RB 4DJBA 2VBWA 4ZA1A 5CCMA 1DTQB 4WZQA 3WC2A 1FKOA 2UUTA 2FVSA 3MOJB 4AUKA 3I4HX 4KGMA 4JI5F 3RB3A 2KM8B 4TQRA 1YI2S 5KT3A 1VI7A 4JYAF 3MCSA 4ILRA 3KLEB 2ZH8A 1S0MA 4UUXA 5C24B 3JAMY 2YX4A 3AJ1A 1K0TA 2M5YA 2MPUA 2KT3A 4ZS6A 4RNHA 1W2BR 1XMOF 2MJNA 5L38A 2YTCA 4OQJA 1OQ6A 2KI2A 2QYCA 3MMAA 2CG4A 3QO9B 3DHXA 1BQXA 1TKZB 1X9WA 3J7A1 4ZHRB 1BY9A 3MM8B 2ZD1A 2MDAA 2E44A 2VG5A 5E3RA 4CIOA 2X1AA 1HD1A 3MI7X 2B56A 2V8HA 3RRKA 3GV5B 3KHLA 2HHVA 4F26A 4AXIA 3TAQA 2ZE2B 2DB1A 2PSZA 3M8SA 1HI0P 4F8RA 2CPFA 4MKAA 5LT5A 2CPHA 3QLHB 4FBUA 3CJKA 1CG2A 1CLFA 1M5HA 4NRTA 1FXRA 1TAQA 3BO3A 4O44A 4Q2MA 1JK9B 3THTA 3KNGA 3CD0A 1LW2A 3LUYA 2KG0A 3THVA 2FJEB 5KTQA 2ABYA 3F44A 2NYIA 4X4TA 3O1LA 3BGUA 2FDNA 4ECVA 1WF2A 2KFYA 4P6QA 1YWXA 2IM0A 2RH3A 2W4DA 2WSEC 3SCJE 2I2YA 1GX6A 3WZ0A 3H5YA 1HMVB 1NRKA 3I0RB 2CQBA 1RQ0A 2Z0GA 3OSNA 3PY8A 1IKXA 2CJ9A 4ILLA 3PIOQ 4AL7A 3NMAA 1S9EA 1XR7A 4B17A 4X4VA 2BRLA 2OLWA 4PG7A 4B9NA 5DLGA 4O4GB 4URSA 4KTQA 4AYBD 3QGPA 3DRSB 4FXVA 4LFCF 2HVIA 1RTJB 2DTJA 3ULHA 2IMWP 3C46A 2P5VA 1KC8T 1KQFB 5CXTA 4QZVB 3DHWC 2E7XA 3M2RA 3NP5A 5HROA 2YNIA 5CYJA 2ZH7A 2XY6A 2ZJQQ 3RB4A 4DFMA 2NUUG 3TVYA 4ZPAA 1RT1B 2B7BB 3LP2A 3E51A 3SEOA 3DLHA 4HVZA 3SDEA 2YKQA 1HNIB 5CCLA 4NMLA 1V3ZA 1KQKA 2YKAA 3FFIA 4LF8F 4RLEA 2DNPA 5J1NA 2KYZA 3V2UC 4X4QA 3IGVA 5E3QA 2UXDF 4I7FB 3KK2B 3BSAA 2WAQD 5KFNA 2V4JB 2XSFA 1FDBA 2LEPA 2ZZMA 2BE2A 1MW7A 1ZM2A 3TA0A 1YJRA 1BQMA 2CQGA 4NLDA 5K14A 5A0YB 1S76D 4WJBA 4TY8A 3MOZA 2L9NA 2PI5A 2H9ZA 2LDIA 5IM0A 1S48A 1U2FA 2YNHA 2VPYB 4WFZA 3FEYB 2Y1IA 2M52A 1R3NA 4DL6A 2BQRA 3W2VB 4KPYA 1KQSR 2XB2D 1TR0A 2GCFA 4I4BA 3NMRA 4O3NA 2J6TA 2X1FA 1N5YB 2FPHX 3S7RA 4X84A 1FK9B 1JJ2R 4KSEB 3HT3A 3CCTA 3ZZTA 1E6YB 5BYRA 3QWUA 2DR8A 3H5UA 4TN2A 4QIWD 5H9FJ 4CO2A 4NCBA 2GNKA 3IWLA 4OHXA 2QFJA 4DR6F 3C2PA 2L48A 2BV3A 5ITHA 4J9LA 4I69A 3MGJA 4RX6A 5A2QY 2BANA 1N0VC 2W25A 5E5NA 3V4IA 2L3MA 2IFXA 4ECWA 2FJXA 2FHMA 2IVMA 5KFOA 4LF4F 1UVNA 1JNRB 1YGYA 3HHEA 1SL2A 1D1UA 3GFHA 3G6ES 3M32A 1JIHA 3G6XA 3KFWX 2DNRA 2ZUGA 4JOUA 3M2UA 2J5AA 1HBMB 1WG4A 1APSA 1FKPB 2CDQA 3PM9A 1VQSA 2VQEF 1XC9A 1FEEA 3I31A 4KB7A 1QUPA 2WTFA 2IHR1 1UJ6A 3GG1A 4NXMF 1MWYA 4LIWA 2HRUA 2PIIA 5B08A 2B9XA 5L39A 1RTHB 4IRCA 1UVJA 4DV5F 3D1OA 3LP0A 3KG4A 1UJ5A 4DL3A 3TR5A 1WEZA 4F67A 2IAJA 4AQYF 4RBVA 3M8PA 1KHVA 1JLQB 2D74B 3HF5A 3MM5A 1HBNA 1HQUA 3MD1A 1LQ9A 5F8JA 1JLEA 2VG7B 3DXSX 4NLOA 1FF2A 1HBOA 3DLGB 3MPWA 1WI6A 5KOWA 1Z1ZA 5C42A 2EG1A 1IKYA 4LMZA 3HZEA 2B0GA 4OI3A 3NNHA 2CJQA 4RW8B 3GFYA 1RTIA 4Q0BB 1SH3A 2FGCA 1K0VA 1JLBA 2OPPA 3CDBA 3CO9A 1LW0B 5CH7B 5SUHA 1ZTWA 4OI0A 4RBUA 1UAWA 3F56A 2XI3A 2RIJA 1PSDA 4Y0FA 3ZZPA 1S97A 2F7VA 5FLXY 3THPA 4CTAB 5K8PA 2KJWA 2MY7A 1DTQA 3U1NA 2FHJD 5L1JA 2VL1A 2LCWA 5KFQA 3CJ2A 4QIGA 3GIMA 4B3SF 1N5TA 3KLEA 5C24A 1HQEB 4LQ9A 1FXDA 2UP1A 2QIFA 3Q24A 3ICLA 2BACA 2AQ4A 1HNWF 2PD1A 3HI9A 3CUNA 2CPYA 2FJWA 2E9ZA 1Y7PA 2L08A 4WU3A 3GWCA 3QO9A 3U27A 3UWTA 3G96A 3NCQA 2DISA 1TKZA 1HWIA 2V9KA 2DGWA 1NEEA 4M63A 3MM8A 4ZHRA 5DETA 3ZC4A 4DV2F 1FRJA 2F1FA 4I0WA 1IUJA 1YVFA 2BQUA 2EFVA 1KR4A 2J0SD 2GMJA 4WFAQ 3QLHA 3DRXA 3M9OB 3NCPA 3QJJA 3UR3C 2CPIA 2KZMA 2ZVSA 2M3DA 2C3UA 3CCVS 2ZH5A 3VZIA 2K3KA 1NH8A 4C8ZA 1R27B 1IN0A 5AXKA 2HLTA 1FRMA 3ZZUA 2ILYA 1REVB 2VFUA 2FUG9 3PJWA 1BGXT 3US5A 4X4UA 5E2QA 3GE9A 1XR6A 1J5EF 4ZMMA 1IKVB 1X4DA 2GA7A 4OJ1A 1N56A 4ED1A 4YHHF 2HGLA 1L3SA 5GADU 3PFOA 2D3ZA 1ZETA 2WOMB 2K7KA 3H59A 3H5XA 1GAOA 1HMVA 3CVKA 3I0RA 4NCAA 4NWBA 1P6TA 1X5OA 4ZPTR 4C3MA 3CCRS 3EGWB 1NU4A 1WHXA 1JWWA 3N5FA 2VUGA 1KEKA 1VOMA 4PG4A 2Q1LA 1RT7B 3P96A 5F8NA 3K5PA 2JJ4D 4O4GA 1P1TA 3DRSA 4NYZA 2LA6A 3E8OA 5DQHA 3B8HA 1RTJA 2RE1A 4USJC 1N5VA 3MMJA 3M1VB 5KFTA 2GIQA 4Y28C 2R7TA 3CJ4A 1Y5NB 3MURP 5DDPC 6FD1A 5DRKA 4HKQA 3PR4A 2C2RA 2E5JA 1RT1A 1Q7YT 2FLNA 2JL9A 1HNIA 5IT4A 1S72S 1ZM3A 1Y3JA 4JI1F 1KTQA 1Y3KA 3PR5B 3IN5A 2ASLA 2M2BA 2VBXA 3SQGB 3B82A 3TX8A 2CPXA 2FY1A 1C0TB 4E98A 2B43A 2VKRA 2P9GA 4KT0C 3N6LA 4I7FA 1TFWA 3KK2A 3M2VB 2V4JA 5KOXA 4WYWA 5K8NA 4OZNA 4NLRA 2VOOA 2UVRA 4O3RA 2Y1RI 3OSPA 1ZYQA 1XEZA 4DOZA 1RWUA 3KLGB 2WB4A 1JXEA 2DRAA 2W24A 3PKMA 4UOCA 4YUDA 4Q8FA 1U2RA 3PKYA 3W2VA 4EBDA 2MB0B 1LKZA 1WEXA 3R5AA 4IQXA 2DNKA 1N8RT 4V19X 3MR3A 3A8EA 1PILA 4Y2AA 1N5YA 2HQ3A 4EO6A 1FK9A 1N33F 1SXLA 3PW4A 1WG1A 1E6YA 1YJTA 2HHQA 2MMYA 3ISZA 5KG4A 1C1CB 3JYTB 3TAPA 4OV1A 3TO8A 3MWBA 3N28A 2HNDB 2CJKA 1NK9A 1TKTB 4XPEA 2VFRA 2ZBCA 2OFGX 3MZIA 1PO6A 4MK9A 4OX9F 1IKWB 4NA3A 5JVHQ 1UL3A 2QMXA 1KHWA 3LQVA 3L7PA 5HLFB 1I94F 2WBRA 4KKOB 1CQNA 4C8NA 1XR5A 5LXRA 1F5AA 1SKRA 2OH2A 4KGKA 4R8UB 1D8ZA 4FVCA 1HBMA 2VV5A 2JLEA 1Q53A 3PEJA 4Y2IA 1FKPA 3SXLA 3K5MA 1ZPWX 1T3NA 2FVRA 2J7WA 4NLYA 1SJ3P 1TFYA 5BYSA 4YP3A 2OO4A 1Q7LB 3H20A 4B9SA 3RW6A 1RTHA 3I9V9 3BZQA 2R2RA 2QZ8A 3PO5A 2D41A 4WYLA 2DO4A 2XWYA 1RA7A 5HP1B 4X4OA 3DRRB 2ZJPQ 5DS7A 1U25A 1X5SA 4P7VA 1UVMA 1JLQA 1ZBTA 1KVIA 1S0VA 2KHDA 2VG7A 3OTDA 4B02A 5M2UA 4K4TA 3B78A 1VBZA 2M8DB 4C8LA 4GO7X 3DLGA 1O0PA 4Q44A 4DL7A 5KG5A 4QIFA 2X3GA 3DGPA 2LEAA 3S8SA 1QSLA 3H8YA 5HQ8A 4RW8A 4DFJA 2C2EA 3RR7A 3CCLS 4HI2A 3MUVP 2LQ9A 2ASYA 1BWEA 2DGQA 3K2YA 3UW1A 1T05B 1LW0A 3E01B 5EWEA 2N82B 1PC4A 2R7QA 1SI9A 1VQLS 1R7IA 1VGYA 1B7FA 2LDYA 4X65F 1Q78A 2GMHA 2WHOA 2C3MA 4KV8B 3MFHA 3H40A 4CTAA 3CD6S 3LP1B 2GV1A 2MGZB 2W7OA 5F9NA 1L3TA 2BBEA 3CJKB 3Q8SB 3T19A 1TKDA 5DGAA 4C97A 2VFSA 3HHNB 1X0FA 2CQ2A 4QQBA 2YWGA 4A8XA 3POTB 1VC6A 2HIQA 1HQEA 4HT5A 2JX2A 3QIDA 3Q8PB 4XAKA 3SYZA 3CCES 4RWXA 4DQRA 1M5VC 3DLJA 2ZHBA 3PO4A 1UW4A 1FRHA 1TUVA 2CFXA 5EX0A 2BVZA 3AHPA 3KHGA 2AX0A 2CQIA 3M9NB 1WACA 1U1PA 4LF9F 1KN6A 4ED0A 1P8GA 5D3GB 2JZ5A 2DGTA 1LXNA 4ILMA