3PKYA

Polymerase domain from mycobacterium tuberculosis ligase d in complex with dna, utp and manganese.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
287
structure length
287
Chain Sequence
EQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA ligase-like protein
publication title Structure of a Preternary Complex Involving a Prokaryotic NHEJ DNA Polymerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/dna
total genus 85
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pkyA02
2IRUA 2IRXA 2R9LA 4MKYA 3PKYA 2IRYA
chains in the Genus database with same CATH superfamily
3R8YA 3BEGB 4ZJLA 3LTOA 2NS1B 3OTCA 2X1BA 4ED7A 4I1TA 3HT0A 2D9PA 1HBMA 2VQFJ 4B3SJ 3W63A 5IZHA 3J81Y 2BE9B 1N32F 4CM0A 3PXGa 2ATLA 1R0BG 3OTOF 3J7A1 2BQ3A 3HX9A 1M5KC 1WOPA 4IKAA 3D0IE 3R1HA 1HBNA 3E01A 4AXIA 2KRBA 1BMQB 3QWUA 2IRUA 1HNWF 2BW2A 4CH1A 2HVHA 1TKDA 5KFOA 3L7UA 4HH0A 2BA9A 1KD1T 2AX1A 4PXBA 3AD8C 1SUQB 4P75A 3DGPB 1K0TA 2HWHA 4YUDA 9RUBA 1PSDA 2MQMA 2FVCA 4QR0A 2DIVA 4FN5A 4OHXA 3M8YA 4PKDB 2EBEA 4KPCA 2VJUA 3GU0A 4OHWA 4TXSA 1DLOA 4FNHA 4UOFA 1WI6A 1QSYA 4JYAJ 4MFBB 4LUBA 2LQ9A 4WTYA 3HF5A 3NS5A 4O4RA 1IBLJ 2Y0BB 3D3BJ 1DURA 4H4OA 4U6PA 4OYAA 2RU9A 4JI1F 4QWDA 2K1RA 1FRLA 4KHRA 3PEJA 2R7WA 3NKYA 5DJBA 4J37A 4LSLB 4ILLA 1HNVB 2O66A 2Q79A 4ECZA 3I55S 3GPAA 2W7AA 1H38A 3HHDA 2RMLA 3QQCD 3FVYA 4NCGB 1RAAB 4RU9A 2CRLA 3IWXA 2MQPA 1HKAA 1L5UA 3EZ5A 4NE9C 1VRQC 1ZM3A 2HFZA 1UA1A 4M1KA 1Z2LA 5GADU 1SH2A 2KM8C 3CCTA 3UN5A 1S49A 2IY5B 1VRTB 3QNWB 1KVIA 5IQ6A 1XC9A 2VOOA 3WBZA 1T0TV 4BWMA 2WW8A 1I1GA 3ULHA 5HATA 1U1MA 4CNZA 2D74B 3LA0A 4M95A 4DOZA 2AGOA 1UP1A 2EKNA 1MMNA 3OXLA 1M5PC 3CC7S 2H3EB 4LIWA 2XMWA 4RW4B 4Y2CA 3DRPB 3I0SA 3UI3A 2QN6B 4I2PB 4PRFA 4GMKA 3PDNA 3S1TA 5KG7A 2VFRA 3NY0A 1RLDA 4B3SF 1PG5B 3K5OA 2ADCA 5J2PB 3DOLB 4UUWA 1M5OC 3RB6A 4BHQA 3QYYA 1PKUA 3SMZA 3S01A 3PR5B 4EZ9A 3OV7A 2RQKA 3ZTSA 4DV4J 3VZHA 4XPCA 2RUSA 1Q82T 3BQ0A 4WFXA 1WG4A 3MEGA 4F4XA 1YVFA 2R2SA 1X31C 3Q23A 2AYMA 3W5XA 1NH8A 2JC0A 1CC7A 2DNMA 5DDRC 1KTQA 1S4FA 1DFDA 1HQUA 5ETNA 3C66A 2WAQD 1YJRA 2OPSB 2EFOA 3KKFA 5F3TA 3ZXWA 3J81j 2EWHA 1QAXA 3R6LB 3CSKA 1HBNB 1ITPA 3BSCA 3KUEA 2CPIA 1HQ2A 3FMWA 3EYZA 3HSJA 2QL9B 1TFWA 3JXOA 2ZNYA 5MLCV 5A8WB 4EEYA 2FGOA 1OY8A 4JYAF 4HDGA 3UDVA 1VBYA 1Y4ZB 3OFEA 1BQNB 4YB6A 4DS5A 3DRSA 1IBLF 3ZFVA 3U1MA 4OJGA 2DJWA 1FEEA 4JI2F 4X62J 3CJ3A 3CJ5A 2MSTA 4YB7A 3D68A 4CLFA 3WIVA 4C3KA 2W25A 3T6JA 3W1YC 2NXUA 3LF0A 2HEKA 2ZHAA 1DLOB 7FDRA 1RWWB 3UDEA 2LKZA 3ZTOA 1HNIA 5IM0A 2VODA 1RXOB 2EFQA 4PG4A 1LXJA 2B51A 1NZAA 1RWNB 2DBBA 5G4DA 1N5YB 1OJ4A 1Q1KA 4IOCQ 1T11A 1RSCA 4H4OB 3M32B 4USUA 4GO7X 1N5TA 1F60B 1ACMB 1T9WA 4B9LA 1T7PA 3WC2A 4KHMA 2QA4S 1ZM2A 2COLA 2C2OB 2YWWA 1Q8KA 1SBRA 3H2LA 2G13A 4UQGA 2P5VA 2N7YA 2HIQA 4KH1B 4IFVA 1FJ7A 4NZ6A 1R8BA 2XI2A 3CMES 1X4AA 1S0OA 1CQMA 5D4OA 2GCFA 5JVHQ 2K2PA 2HBYB 4R8UA 4EYHB 3BYPA 3PEHA 3KFWX 5M2UA 1WC6A 1Q5VA 3J7AN 2OD4A 2XGPA 2CQ3A 1FX2A 4MH8A 4Y2IA 4ECXA 1NUEA 3F73A 3J7YI 3VWSA 4U8YA 2MJNA 3T5JA 3ZZZA 1NHVA 3QBCA 4L74A 3G87A 1GTEA 4Z7YA 5LL6d 1DHMA 5SUHA 2DNLA 1O51A 2B3TB 2OUGA 1U48A 3EM1A 3CCLS 1RCOB 2GVDA 3D6MB 1KLMA 4ZVTB 1V3RA 4PQAA 2EG1A 4P7TA 3BO3A 4OMFG 4Q2MA 3CUNA 3VTIA 1X7VA 2KZMA 5LJ5Y 4Q43A 3RRGA 3I0SB 1YZ6A 3OUYB 1S77D 3QT5A 4WKYA 2K06A 3HHLA 1GK8A 2G2ZA 5AXMA 2XHWA 1ZTTA 3EGVA 4KQZA 2BANB 2V2QA 2XLIA 5H1SV 1WEXA 3CCES 3UWTA 2SXLA 3PRVA 2XNQA 1L3KA 3DGVA 2L9NA 2HW3A 1GXTA 4C8YA 3AB4B 1HLWA 3H7HB 4U7UD 5A76A 2HS4A 3K5MA 3CGIA 1H98A 2V2KA 5KFXA 3W5YA 1KSPA 3TA0A 2HHXA 2N82B 2DEIA 3PR4A 2N3OA 2RNEA 3FRYA 3FCHA 3RAQA 2YQ1A 4OZLA 1HL6A 2DISA 1HQUB 4X62F 1WF2A 5CAAA 1MMDA 4IO1A 2IYGA 3WX8A 2AZ3A 3D54A 5SZTA 3MTJA 2E1RA 2UVUA 1RWMB 5J2MA 3Q22A 2EXUA 3KNAA 4MT1A 2OLWA 4ZN3A 1YRXA 1C1CA 1ZETA 1NK0A 4ID8A 3FGVA 3FDSA 1U09A 2PT0A 4FNIA 4C8ZA 1Z2ZA 4TLRA 3ZNUA 2HQFA 5MAOA 2EW9A 2ROEA 5F8MA 3K5NA 3KK3A 1GX6A 4ZK7M 4LMZA 2GFFA 4S0MA 3V4IB 4O3NA 4GC7A 2OKQA 3RBZA 3CDBA 1VQOS 8RUCA 4NYZA 5L9XA 1JX4A 2MKJA 1YJWS 4DV5F 3V6DB 1NK9A 2VKRA 3KLGA 3MXHP 5HSPA 1JJHA 3UDLA 2RB7A 3CEDA 1JLGB 3N5FA 2KXNB 1RYSA 3LGHA 1L3SA 3MEEB 3FC9A 3T6BA 3CJ4A 4RBTA 4NLXA 5F0UA 4DG1A 1I3OB 1U1LA 2UVRA 2OSRA 3OLBA 4WYWA 3J7Z5 1RHRB 1NKCA 2XY7A 2VFUA 4QIEA 3C19A 1S10A 4CLUA 4L3KA 3FNNA 4AXJA 4Y28C 2BABA 3MOZA 4M5DB 2KYZA 3EGNA 2F4FA 1MG7A 1N8RT 3PIOQ 4ID5A 3RB0A 2U2FA 1IWAA 3K5LA 3SDEA 5CZVA 2DIUA 3Q8RB 4KGVB 2FHJD 1S9EA 4XPEA 4MTPA 2HHQA 1FDDA 4R25A 3BSOA 3QWPA 2FLPA 4MKBA 1UPPA 4NLYA 4RW6B 4G65A 2W1BA 5J1EB 1QSSA 2FHOB 5C25B 1HI0P 1XNQJ 3M6VA 3H20A 1WHXA 2W2OP 2IM3A 5F8HA 4HT5A 1UW4A 3VAHA 1X5TA 3R7NB 2HGLA 3HVAA 3M8WA 4NLDA 5DQIA 4CO2A 2VPYB 2OMLA 3MAAA 2AJFE 1BQMB 3MMCA 2BBEA 2LU2A 2PMHA 4HI1A 4USKA 3OSPA 4DFPA 3G6VA 4PG5A 5G0RA 2XMKA 1KLMB 3IG1A 2RF2A 3Q0AA 2UXCJ 1UKUA 2Y1LB 1HMVB 2OD6A 4RW7B 2GIRA 1MLAA 4OZ0A 1N5SA 1RTJB 3EMTA 5D6GA 1XIQA 1UEVA 3G8SA 4D3GA 1B64A 2C3YA 2ZZTA 1F5AA 3IRXA 2A6OA 4J9RA 3K57A 3A4TA 3DN9A 3HHLB 2E9RX 4M5KA 2EPIA 1BE4A 3D7SB 4LRDA 2MY7A 1FD8A 1Q53A 2HAIA 3UE2A 5IQQA 3DDKA 2FLOA 1G4CA 4JI8F 4MKYA 1SL1A 3FBCA 2JHEA 2WHOA 4ZS6A 1VC5A 2YKQA 2IM0A 4WIQA 2XSJA 2OTLS 1HNZJ 3RGIA 4RNFA 2XTJP 2NYHA 3BPDA 1BC6A 2QGFB 2CNNB 5CABA 4QYZJ 5HLFA 1NO8A 4H4KA 1XR7A 1FTCA 4PG6A 4DPUA 1VC6A 2YVSA 1TKZB 3VQTA 4NEYA 1I94J 2PFFB 1CJVB 1RBLA 4LFAF 2HNDA 5I3UB 5E0OA 3TP2A 2DY1A 3PCOB 1RHJB 2VQEJ 4XIUA 1KQGB 2GO8A 2M70A 5KFFA 2E1PA 3QJLA 4QU6A 3FSIA 5HVHA 2QC3A 4ZP9A 3QAUA 3BBCA 1SKWA 4CO4A 1V5IB 1U24A 3C15B 5ETPA 3C3LA 2DH9A 3Q2TC 2V94A 3A3OB 1QE1B 3QGPA 1X4DA 2QLJB 3VZIA 3GJTB 1NPRA 4JBCA 2BKNA 3KLIB 3HSDA 2ROPA 1NK7A 3LP1A 3B54A 1SJ4P 3BGUA 1U1OA 1DRZA 4KAIA 1RKIA 4FS1A 1RA7A 4C11A 3M9OB 3TUPA 2V68A 1YKWA 2I1RA 4W90B 3FSYA 3OR1A 4A8XA 3MUMP 4GKJJ 1R8PA 3UVJA 3LWLA 4ED8A 1Y10A 5IV3A 2G0IA 3P96A 3M2RA 1DJ0A 3BGRB 1SH3A 2CPYA 2W8LA 2QJ3A 4FKYA 1P27B 5ETVA 2X1GA 1XNQF 2VA2A 5GAHU 2C2ZB 1SL2A 4X4OA 1A7GE 4PPZA 4USJC 4A8MP 1HI1A 2BJDA 4UQTA 1VLYA 4JP8A 1RTIB 2XCPA 3D67A 3MURP 1XNRF 5C2CA 1C0UB 2XZWA 1N34F 3JQMA 2YNHB 2UVVA 2JC1A 3LP0A 1NK4A 1S9EB 1FRIA 4NLUA 3CCUS 2NSCA 4RBVA 2I2YA 1G6BA 2YXLA 4LF5J 4CT8A 2Z57B 2O5DA 2JL9A 3ENWA 2UXCF 5AXKA 1DQAA 3GIIA 3PV8A 1N33J 1FRXA 4KBIA 1LWCA 4KC5A 2HBQB 1YBAA 2CJBA 4R0JA 2PDAA 3B82A 2XMJA 3RRKA 2WVFA 3CJSA 1FE0A 1KONA 1U7LA 3H0PA 1YJUA 2VOPA 4F4AA 1JXVA 4Y2MA 4F2SA 4NMLA 4Q44A 3Q2SC 2M0GB 1JJCB 1S72S 5CYMA 3L4BC 2VBXA 2XZTB 1IQZA 1S6PA 1YRUA 1HWUA 3NWGA 4CLYA 4HVZA 1S9GA 2RF2B 2ABYA 3RU0A 4K5RA 3ISND 1JKHA 4JI4J 3FUYA 4DQIA 2MHEA 1UZHA 4K4ZA 3DRRA 4LF2A 3PRDA 4NLGA 1HNZF 1J5EF 2G9OA 3D0GE 2UUBJ 2R8IA 3BR8A 4WBFA 2CG8A 2IBOA 3IRXB 1M5SA 1B3TA 2CQIA 3W2VA 1A6LA 2HGNA 3T3FA 4IG3B 4KGZB 1YJ9S 3ZNJ1 2ROGA 2OI2A 3KYLA 2IM1A 2CYYA 2AKWB 1NSKL 7AT1B 2QRRA 5IS2A 4WK1A 2RRAA 4C7QA 1U1QA 3FEYB 4KYZA 4PZVA 3K8WA 4FXVA 2VQEF 4MAKA 5A2QU 1Q95G 1NEEA 3JQJA 3THVA 3DMJB 3MF5A 2FIUA 2PEHA 1NHUA 2RJZA 3DXSX 3PACA 2J9EA 1GMUA 2BJ1A 3CCWA 2J76E 2J7UA 4K50A 2NZ4A 4QCLA 3PX6A 3D9BA 4ECUA 3M2VA 4NOHA 2VU5A 4ZVHA 4X65J 5DG7A 4YB5A 2N3LA 3DLJA 5HROA 4MIAA 3M8ZA 1ZZNA 3ITHA 2FJVA 3EDQB 4DR6J 1S5ZA 1EARA 5M2RA 3CMAS 1TVRB 3D6TB 4M8LA 1S48A 2WBRA 1RJJA 1YBTA 3W9HA 4DX8H 4LR7A 3V4MA 2IM2A 3H8YA 3O3LA 4GKJF 1CS4A 2XYHB 4NLTA 3THPA 2F40A 1RZMA 4F4YA 3EPGA 4DPYA 3MR3A 2QFIA 2ZBPA 1CQNA 2BR0A 4JV2A 2VG5A 4LQ3A 3LP1B 2WVCA 4O3OA 2CDQA 4MMOA 3CD5A 3AQOA 4ZP8A 4C11B 3HO1A 3QRRA 4B9NA 1K0VA 5A8RA 4LBPA 3FZBA 3OVAA 4YHHJ 1XMQF 2XEXA 3GWCA 4I4BA 3MWBA 2L9WA 3I5CA 4YEAA 5KG0A 2DNPA 4DX5A 4NA1A 1VQNS 1NB2A 4WTOB 2QYCA 3OJSA 4LF5F 5JVGQ 3VF0B 3DHXA 3Q8PB 1SQGA 3NS7B 5IC6B 4DL5A 3TI0A 3CJQA 3JTOA 1FA0A 3MZIA 2DXFA 1T9TA 2V6AA 3QFHA 5IT9U 5AE2A 1FXDA 2UUWA 5C42A 4ZCMA 1PC4A 2KU7A 1W7WA 4HDHA 2LEAA 4AD6A 3DU6A 4H4MA 5IXUA 1GX5A 3BDEA 2D1CA 1EQMA 3LP0B 1TL1A 4HHHA 4DN9A 2BMBA 1RT6A 3E3XA 2HK2A 3T1YJ 3MM6B 4CNYA 1J2VA 1N4LA 3HSZA 2BQUA 5KFMA 3HMJG 1Y5LB 3PFEA 3IBFB 2RKIA 1FVQA 1W26A 4JI4F 3Q8QB 1LWCB 1S57A 3H2VE 1OPZA 4CO1A 2OP5A 4G3IA 4OYMA 5GMDA 5HVFA 2UUBF 2FGCA 3QGHA 1QJHA 4IG0B 3AFGA 2CAJA 3R5JB 4DR7J 3N28A 2E1AA 2WVBA 3AJ2A 1RAIB 5KFPA 1N56A 2Q1LA 1VHFA 3DLGB 1WG5A 1C4AA 3W66A 1S59A 2A10A 1X4GA 1IKXB 1TUGB 1KR4A 2IHR1 3E2EA 5ETTA 3AY0A 3ELHA 1JLBA 4A4JA 3SI8A 2IMOA 1UPMB 4F04B 2MEWA 4B3TF 2LEBA 1S1XB 4ED6A 4QW9A 3LPYA 4RKUC 2GQ2A 1RU2A 3FFIA 1MNEA 1MU2B 4PR6A 5E3RA 1LQ9A 4WFZA 3T41A 1T9XA 4NI2B 4FS2A 4X4PA 4X65F 3FCWA 2CPHA 3MM8B 2V4JB 3FQKA 2CJAA 5A2QY 1UJ5A 4DR6F 4N8OA 1F2GA 1EAYC 1S6QB 2UUAJ 3GV5B 2NXEA 4RX6A 4TNOA 5HBMA 2Z56B 2ZHBA 2OH2A 3HVTA 4NXNJ 2HFSA 2XMTA 2UV8A 3T5KA 2MYFA 4R0EA 3I0RA 2OGUA 4OX6A 2QFJA 3M2VB 3UCGA 2YNFB 4TVAB 2BZ2A 5B0FA 4CTAA 4CCHA 3ITHB 3KLFA 1M1HA 2H65B 4A8WA 1VRUB 1MMLA 1F1BB 4RWWA 4WZMA 4ZP7A 5F9LA 3H5XA 1OPIA 4YHHF 2FD2A 4I6YA 4RNHA 4CLZA 3GV7B 2HFUA 2CNKB 4ZLNA 2BQRA 1F9FA 5L39A 5L1LA 5J2QA 4P2SA 2IDEA 3TRGA 3OFFA 1LNQA 4W98A 3M8PB 2VG5B 4Y34A 4CLTA 2F4VJ 1OQ3A 2C2MB 1ROFA 1PBAA 1E6YA 4N7TA 3WZ0A 5F0WA 3TJ9A 2QE5A 1VQMS 2DT9A 1RAFB 3K7RA 1PAEX 4YDXA 1FE4A 4YOEA 3CCVS 3HHKA 2ZH4A 2CPJA 3UN3A 2B4PA 5I4MA 4CO3A 4WE1A 3T1YF 1IWGA 1S1TB 2PA8D 2LCWA 4U8VA 3FRZA 5IT9Y 2QX0A 1C2PA 2HVZA 2BJ9A 2W9BB 5JMNA 1PIEA 1HI8A 1OS5A 4ZPWR 2PEBA 2QLWA 3UPFA 3KK2A 1NZ8A 5C42B 1UVNA 2D7SA 3M1VA 4P52A 3R27A 4PYDA 1HNXF 3BBFA 2R7RA 1L3TA 2E7WA 2AP6A 1N6QA 5GVQA 2WCXA 1TL1B 2QG9B 3BR9A 1FRHA 4DR7F 4LR8A 2B6AA 2CQPA 1BHNA 4IOAQ 4K4SA 4OI2A 4JI7J 5EWGA 3P3DA 1C1BB 4C8KA 5B0GA 2IAJB 2AEJA 4DV7J 1JIHA 2ZH5A 2HFNA 1B0VA 3SQGB 3JYTA 3U7JA 2IVMA 4I56A 4TU7A 2UU9J 1RA6A 4IR1A 2AV5A 2W2QP 4USHA 4ECYA 1T95A 1KFSA 2K3IA 1FK9A 4DLGA 3T9ZA 4F0KA 3IS9A 1LFPA 1PAUB 2IRXA 3VAMA 3NAIA 2BX6A 2UUAF 4OLOA 2GJ2A 3LAKA 1ZZFA 3N6LA 4N41A 4O3SA 2V4RA 3IBWA 3DI6A 4IDKA 4UUXA 3THTA 4NXNF 2A1BA 4M5IA 3R3TA 3TVZA 3IAS9 3PRBA 4FPRA 5KG3A 1OO0B 4FF4A 1RADB 2DH7A 1IKVA 2Z8QA 2AQ4A 1UVJA 1L3UA 4D3HA 1ZS6A 2R8KA 2EKYA 3AA9A 2XY6A 1AFIA 2CVEA 3HCXA 3JSMA 4QJVA 3QLHB 5HBMB 4B3RJ 4R5PB 1GMWA 2VBYA 4F0MA 3B4MA 3PFOA 3RB3A 1RAHB 2HIYA 2HZVA 4C8LA 2HG4A 4KH0B 1XERA 4EZ6A 1U1KA 2AYEA 2R7OA 5IT4A 3NBPB 4ICLA 7FD1A 3OD2A 4N56A 1EETB 3A1YG 1C0TB 3OXGA 1WHWA 1G2EA 3D66A 2F4VF 2K3KA 3MECA 3AD7C 3K89A 1RDRA 4C9DA 4C3MA 8ATCB 1IM4A 1NDCA 2D3ZA 5J2NA 2RSQA 4BLGA 2JX2A 2NPIA 4ZVQB 3MD3A 4WPAA 2QLXA 4U96A 4GVBA 2E44A 1NK5A 2K8GA 3UCUP 1RQ0A 3DCAA 3PHTA 2R7SA 4DR1J 1HW9A 1X8DA 3C2PA 1URNA 4M5LA 1XN9A 2RS8A 1PJ7A 2LXFA 4ELVA 2HRUA 1UVKA 5C24A 1RUSA 3NCQA 4OI0A 4K4YA 1E6YB 3KG4A 5F8JA 4FYWB 1WI8A 2VB6A 3IWLA 3VVTA 4Y65A 3BQ1A 1U2RA 1TKTB 3GCXP 2E9TA 3OJUA 1I5OB 1CJTB 1RT5B 5KFTA 2CPZA 4ZVPB 2B9EA 2KRRA 3SZ2A 3HHLD 1RACB 1HYSA 3KLHB 2C2NA 1IBMJ 1F9HA 2DK2A 3P5BP 1U4BA 3F41A 2VONA 4MIBA 1UETA 3BH7B 3SCKE 4NA3A 4DL3A 4OZ2A 2B4VA 1N6QB 3OFGA 1SH0A 1X5OA 4CRJA 5HQLA 2MQ8A 3R5AA 2PFDA 4QU7A 5IT0A 4Y2KA 3H25A 2IMWP 2HHTA 1RYRA 2J0QD 1SI9A 3NGKA 5U47A 5KT4A 3MMBA 2GV1A 2WOMA 5KG6A 3KOAA 3W64A 3C6TB 4OI3A 4X4RA 4V19X 3ICLA 1WSRA 2CQCA 5EWEA 4F4ZA 2ZITA 2VH7A 2EC0A 2I5JB 5C5JA 2M3DA 3SQOP 3H4BA 3IAM9 4JI0J 1FNOA 2DR8A 4AYBD 2ASDA 2V9KA 1RT3A 4C98A 3G6ES 3R1LA 4URQU 4YS2A 4F36A 1N48A 3SSQA 2KKHA 3R97A 3TJAA 5DDPC 1AW0A 3R7SB 3O5TB 2HS0A 1VK3A 1RWXB 2DHHA 3IS9B 2E9ZA 4BDPA 4IFYA 2GVZA 3DYAA 1XBWA 4B3RF 4DU8A 2V69A 4A8OA 2OEKA 5CA5A 3DI6B 4IDKB 3EE3A 3HHNB 4KGKA 3OBIA 2OPRA 4JUZA 4G1QA 2V8GA 2ZVSA 2YY3A 5D0GA 1R0CB 3JSRA 4KSEB 4OHZA 1NAQA 4ZLJA 4J91A 3N6MA 1IKVB 4K4UA 3TNVA 1P6TA 1SQEA 5ETQA 2BM0A 5HMWA 3GCWP 5KG4A 2XGQA 1NK6A 3VGSA 3HPOA 4Q45A 2RHQB 1ZYQA 1MWZA 5F9NA 1AROP 2W9CA 1SL0A 2PMWA 5KFGA 5DETA 1REGX 1TV6B 4DSIA 3V6KA 4URSA 3CDUA 3MM5B 4M94A 5A0YA 5ETMA 2Q66A 3GFXA 1X9MA 4DZ6A 2GX8A 1S0VA 1E6VB 4IH5A 1SJQA 4J90A 4B9SA 3POTB 3CE8A 4OHYA 1KVJA 1KLNA 4USMA 1WEYA 3GTYX 3TEGA 2UZAA 2OEJA 2GO9A 1H74A 2ZFHA 1UWBB 1FCAA 3A13A 4M5MA 5KFKA 4RNNA 2DHXA 2MLZA 4GVBB 3W2WB 2ALZA 3PG9A 2YKNA 1GEHA 3ILJA 1N88A 4U7UK 2G0CA 2CG4A 4KV8B 4DPXA 3Q8SB 4CO5A 4LJMA 2H4WB 1XMOJ 4FZVA 5ADZA 2V5HG 3HFKA 2ZJPQ 1S1WA 4B9TA 3MMAA 4NZ7A 2B5JA 1REVA 3AXKA 3L9ZA 2GNKA 3TZYA 4NEZA 1NCLA 4QPXA 5KFIA 4IO9Q 4NRUA 1G7CB 3C14A 1EIYB 4OX7A 2EC2A 2GQCA 3LOUA 4DV2J 2XI3A 1DQ9A 3MR7A 2DKOB 4ES1A 4RO0A 3K8VA 1TL7A 5M2PA 3PM9A 1HWLA 3KJFB 2Z2MA 2XM3A 2HBZB 4KR0B 4ZP6A 2GC8A 1CJKA 5KFLA 3MPYA 2HHWA 3GMGA 3M4XA 1OWXA 5AJ3J 2HVEA 3MFHA 4JI0F 2FYXA 2AX0A 3PW5A 1LWXA 2AJ4A 2ZOMA 4B3OB 5EUHA 2DR9A 3OL9A 2ZH6A 4QIVA 4WJBA 1FT8A 2VPZB 4TYAA 3NAHA 2ZUAA 4DEZA 3W8PA 3BO2A 5DGBA 1VQSA 5C2GA 1Q79A 4ZOSA 1OQ6A 4LBHA 4UOCA 2POKA 2WB4A 1YLXA 1PGZA 3GFZA 4FF1A 1SC1B 2AYGA 4X4NA 3BSAA 4Z37A 5KTQA 5FIIA 1IVZA 1KS2A 5LM7E 2L41A 1F9EB 3CJKA 4ZCIA 1RT3B 4N77A 1S99A 3R2CJ 2GA7A 4LSNA 4PAAA 1FKAF 4K4VA 5BYRA 3B78A 2LA6A 5B08A 1B7YB 2KT2A 1TKXA 2GZOA 3M8RA 3ET6A 3NG8A 5ETRA 5HANA 3DYAB 5HAOA 3UN2A 2H5IB 3TX8A 1WOOA 2IA6A 1RTDB 3ENQA 4DL2A 4IQMA 4PWUA 4EO6A 3IR7B 4G1QB 1NM2A 4DF4A 2E5GA 1PJ6A 3JAMU 1RBOB 3DRXA 4DL4A 1FDAA 1RK8A 4QIWD 3FSXA 3S7RA 4JI5J 2LYVA 1R89A 3N4WA 3DLHA 1UJ6A 1TUWA 2W7PA 1RWKB 5K14A 1TK5A 2HMIB 1SC3B 2ZHOA 1EB0A 2DH8A 4OYOA 2B8PA 3MOJB 1U49A 3D6HB 2DITA 2YX1A 2Z30B 4NPOA 2RUGA 1QAIA 2VG7A 3K17A 2ZBCA 5FDLB 1K47A 2W9CB 4O4GB 2G0JA 1T9YA 1RHMB 2A0FB 3PZPA 5A0YB 3W61A 4ETXA 1VJQA 5KFSA 3BQ2A 5H9FK 3HT3A 3W60A 5KG5A 4P2XA 1YJVA 3LPEA 2QLBB 4PWDA 2L48A 1DBDA 3SCLE 3ISZA 2PN6A 1QUVA 4DFJA 4Q2LA 2CXEA 2YNIA 4EK2A 4QQBA 3GSDA 4NLOA 4DV2F 2CJQA 4LFCJ 1U1PA 4ZPBA 2ATCB 1FI4A 2YKNB 4I64A 2JLGA 1PILA 2ZE2A 2V8HA 3HKWA 3UR3C 3VCDA 2K7JA 2YWFA 1HBOA 2KJWA 3ENAA 2HQGA 3QO9A 3TUJC 4OFZA 3MMAB 5AJ3F 4LF9F 2DNRA 5D3GB 5RUBA 3M2UB 2J7WA 5CXTA 4DX7A 3TZWA 1WKLA 1T9UA 3C14B 1HPZA 3M9MB 3BO4A 3TOQA 2RDJA 1LK5A 4F26A 2YNGA 4ZN1A 3CJ8A 1EP4A 1MROB 1VBZA 4OJHA 3M8SA 1B99A 3RAMA 3BKUA 2DR7A 1Y3KA 1CJKB 3I5AA 2G2OA 3V81B 4JB8B 3K5PA 2JEIA 3US5A 3VGVA 3M9NB 1PYOB 2NZCA 3PY8A 1JLQB 2BM1A 5LOQA 4XDDA 2DNQA 1V3ZA 1NSAA 2JJ4D 2MPUA 4TY8A 4TU8A 4OYIA 3ILLA 1S0MA 3TAMB 4ED4A 2AT1B 2N4DA 1JLEB 1IXKA 1IQTA 1WACA 3KMQA 1N52B 2XLKA 3QSIA 4CYUA 1VQ5S 2L3MA 1RU1A 3KHLA 4ZPAA 1HARA 3PKMA 1NKBA 1HWJA 1W25A 3MUVP 3DM2A 5CYQA 4PUOA 4CH7A 2MZSA 2YWHA 4ZLLA 1YX2A 2V8DA 3P4UB 4FBUA 4FYXB 2CPDA 3CJKB 5T14A 1NB7A 1FFWB 2ZWOA 4IRCA 2P9EA 1IR2A 4LSNB 4JI5F 3LP2A 2R8HA 3ZZ0A 3FEZA 5A6PA 5GAGI 1XMBA 2B56A 1U1NA 2YKOA 3NGRA 3DOKA 3QPIA 4ZIVA 3X1LB 3ET6B 2UXDF 3KK1B 2VICA 2KN4A 2CQHA 3EZUA 3KLEB 3NGSA 2BKPA 1FJEB 2F63A 2X3GA 2ZKUA 2P6SA 1IR0A 1DARA 1YITS 2B8QA 2GIQA 3S8SA 3DU5A 1RHKB 2EK6A 1IR1A 3OQ2A 1P8GA 1ZTWA 1Q0NA 1CJUB 1H6KX 3C6UA 2VG6A 1UFLA 4GO5X 3CF5Q 1SCJB 1SXLA 2W2PP 2MQQA 1ZA2B 3HD2A 2CJKA 4F4WA 2DYAA 4ZCLA 5JXSA 1AZSB 2QO3A 1LXNA 1FKPA 4ZHRA 1FKOB 3BZQA 2HHPA 4PXCA 1WTBA 1KOHA 4FBTA 2DPJA 1FESA 5HP1A 4ED5A 2HNYA 4URGA 2BEFA 2Z2ZA 4JI6J 2DR5A 1UFKA 2L08A 2YNIB 1FF2A 4USIA 5D0HA 2EG2A 2HLUA 2A2CA 4HKQA 5B0AA 1AXQA 1HWIA 5KAKA 2V8VA 3LANA 4OYZA 1XK8A 2I8EA 3HI9A 1QSLA 1R0AA 4KTQA 4QR2A 3TR5A 2H51B 4J9LA 3BGLA 2FHKA 4CWBA 5F8GA 2AJ0A 2DRAA 2C3PA 2CQ0A 2J8SA 1UVLA 2IVFB 4MKVA 1Q81T 2RHSB 4A46A 3G8QA 4ILRA 3EVWA 1HPZB 1TMMA 2MKSA 4JV1A 2ILYA 2M8DB 2OPQB 2YNGB 3PHEA 3I87A 4LF6J 1U0SA 2AGPA 4H54A 2YWGA 2B7BB 3M8QA 1JJ2R 1WDTA 4KKOA 4ES3A 1Q7LB 3N0VA 3VAFA 1B4SA 3NOCA 3AJ1A 3BF4A 3DRYA 2VQFF 1CEZA 2HHUA 1RT7B 4ANCA 4P72A 4OL8A 2OO4A 2Y3YA 1FRKA 3ETMA 1LWEA 5BYSA 4PEOA 5J1NA 1NSPA 1YHQS 3W9JA 5GAGU 1IJEB 2VBZA 2MXYA 3ISNC 5AE1A 2B4OA 2AIRB 4YY3J 1UW9A 4DV3J 1FERA 3BYRA 2KJVA 1D8ZA 1MWQA 1X4FA 3MM7A 1JXEA 4P74A 2O01C 1HD1A 1BWVA 3LQVA 1EZZB 1UZDA 3AA8A 4OZ1A 5KFQA 4WCEQ 1VHIA 5BR8J 1HBMB 4MYUA 2O3DA 5D15A 4FYYB 3KHGA 3DM2B 3N79A 3FJ2A 5KG1A 4UY8T 4WP8A 1VFJA 5KFBA 3A12A 3E8OA 4JOUA 2AJ2A 2CQDA 5CHCB 1SJRA 3E01B 2LDIA 3UNYA 3QT6A 4A48A 4XO0A 3LP2B 2LP4A 4C97A 3CTRA 3CB4A 1F5BA 2EBGA 1CULA 2XSFA 2OPPA 3V6HA 1RE1B 3G86A 3DDIA 3TJ8A 1D9FA 1VR6A 2KG1A 2LXIA 1NJYA 2C1EB 4KE5A 2RDDA 1RLCL 2R2RA 4RW9A 2NCKL 4OX9J 4KO0A 4AE5A 3KHRA 2FLNA 2Y0SD 5EWFA 3MEDA 3PIPQ 1F0XA 1AUSL 3KJVA 1IKYA 2J5AA 4BC9A 4RL1A 3A8IA 4RUHA 4ATNA 4JI6F 2AYBA 2LMIA 4QPTA 2K7KA 2XY5A 2KHCA 4QWBA 2K1RB 2V67A 2ZDPA 1NDPA 1FDBA 2F5GA 4LIRA 4WYLA 4UF4A 1A0OB 2LU1A 3TARA 1Y7PA 2DB1A 2HSEB 2VPXB 4RNMA 4PXEA 4C0BA 5DLGA 2F9DA 3MMJA 2CUYA 5HP1B 3X3UA 1RT1A 3DLKA 3TAQA 2C2EA 3ZTPA 2MKKA 3H42A 2WK4A 2C28A 3IBCB 3DLLQ 2EFPA 3KWMA 1SV5A 4A47A 2XB2D 2BYCA 2DO0A 3Q8VA 1YIJS 2ADBA 3QATA 1XWLA 1JQGA 4Y3CA 1IBCB 2HBRB 1NJZA 4QIGA 3FCVA 2BKOA 5I3PA 4DL6A 4DCOB 1KHVA 4J9KA 1VDHA 4ZVRB 1R3NA 4ZVFA 4F3OA 3HZGA 3J80U 3MCMA 1KP6A 2DEJA 2WONA 2A2DA 4YY3F 3SCJE 4QIFA 4YDDB 4RUAA 4DV4F 4F3QA 4J7CA 1WWHA 1S79A 5KFVA 4DPOA 4DQRA 3IGVA 1OMSA 5BR8F 3JTPA 3PYEA 5IWAJ 1GNKA 4KGMA 4ECVA 1LKZA 2JVOA 4ECRA 2JZ5A 2QIFA 1LWEB 2GGPA 1Q7YT 2CFXA 1YRTA 4Q5VA 2YKMA 1PYSB 4Y2AA 3AHPA 2QL7B 3HSGA 5BJRA 3QRPA 4ZPVR 3SXLA 1KN6A 4LREA 1FFGB 3H98A 2HHHJ 2FUG9 3MEGB 2GJFA 3TUZC 4ZIWA 1J5OA 2IJFA 2C2DA 3NP5A 4Y6IA 4C2MA 2BJ8A 4YR0A 2KFZA 3AD9C 3U1LA 1H72C 3EUNA 3BGOP 1RHQB 3DLEA 3M30A 1WEZA 1FNMA 2VJVA 1H0HB 1S1VA 2BE7D 2QMUB 3OR2A 1Q78A 1RTHA 1D1UA 2DNHA 2QA2A 3A8EA 4OJ3A 2ZH7A 3NCRA 3G96A 2OFGX 3OTDA 4OX9F 2JLEA 2WSEC 2HZCA 4E8UA 3MCSA 2B0GA 1TMJA 2Y1RI 3VV2B 2VDIA 2XMAA 4F02A 4EO8A 1WDDA 1OYEA 4USVA 3GIRA 3IR6B 5KFUA 3DRSB 5B7WA 2IIHA 5DG9A 2PMZD 2MKCA 3ZC4A 2LQ5A 3CMQA 1SIWB 2V0NA 4J5OA 2V2VA 3I56S 3LH2S 3KMSA 3IFEA 3OTEA 3QGIA 2I6WA 2Z4PA 2ZVIA 1QDUB 4KO0B 1PYTA 3BN7A 2QTWA 3FKBA 4FXDA 2Y8YA 4LR9A 2Z2LA 2IYIA 3MCNA 3TW0A 1VOMA 1HNIB 2WTFA 2V63A 5IM0B 3CO0P 1VQPS 4ILMA 1X0FA 1NH7A 4XTTA 3VQSA 3GONA 5AXLA 1U0HA 3J7YU 2Y9HA 2HS3A 4WP9A 1WJ9A 3KG1A 5LXYA 4MK7A 2QLFB 2X1FA 2KI2A 3UFCX 2MMYA 2CDRB 2NXNA 4TU9A 1J27A 2GHPA 5KFJA 1YZ7A 4YMEA 2DD8S 2KHDA 5D0RA 4KHPJ 1WF1A 2NLWA 2OTJS 2G1DA 2C3OA 4E98A 4DQQA 4IFVB 3MI7X 3GLJA 4O3RA 3EICA 4EWTA 1D0EA 1RT1B 2VPWB 3DLKB 3EVOA 2R8GA 4R8UB 2JH3A 1FXRA 4AT1B 1D9DA 3PKYA 3A3NB 4WK3A 2A18A 3PO5A 1SUQA 4DX6A 4GKKJ 3DGPA 2FJXA 3VAKA 2MKIA 1XEZA 2LEPA 4ZPDA 3GYNA 4IH6A 4YQWA 3SV4A 2NREA 2HURA 4DR4J 2M7SA 1VCTA 1SC6A 5IWAF 4I6WA 4F4KA 2C3UA 3J80Y 3OVSA 4LF4J 1SKUB 4N8NA 5B09A 2J7KA 3NNCA 4ED3A 4PCQA 1PBUA 2GVDB 3H5SA 2WONB 4RJVA 2CVIA 2AGQA 2Z2YB 4CLSA 2F8HA 1JMTA 2F8EX 1FRJA 3U27A 2HHHF 3H2UB 3KUHA 1RI7A 1F2HA 2MZRA 4DWIA 3GIKA 1XQIA 4LSLA 3PW0A 3PJXA 3HXMA 1T02A 1HNVA 5HL7Q 4PPDA 1N5VA 4O0IA 1G3OA 1M0SA 2CWXA 3PW7A 1XR5A 1EKSA 2VA3A 3IN5A 3HFZB 4NCGA 1TELA 2PSZA 2ERRA 4ERDA 4P10A 2J0SD 4JI1J 2G2YA 4K8RA 1V5VA 3RTVA 1ZPVA 4DSKA 3EX7B 2J9CA 5B0CA 1BWEA 2XS7A 2AF6A 2BJ7A 5F3ZA 3I6PA 1R27B 3SFGA 1VRTA 3AQPA 4OX8A 3I96A 2V9WA 2DNNA 3CO9A 1S1VB 2C2KB 4NLPA 2KT5A 3IC1A 2XG8A 5D8HB 5E5NA 2H1YA 1RTHB 5J2MB 1P9YA 1S7HA 2MY8A 3GB0A 2DXDA 1C1CB 2QSWA 2W4DA 3W3SA 2QMXA 5LMNJ 4RW4A 4B9UA 3DRPA 1H3DA 4LF8J 2DY9A 4N47A 2QV6A 3KK3B 3HJFA 4NLQA 4I2PA 2Q3PA 4CO0A 4DUYJ 3H40A 1HHSA 1WF0A 4BWJA 3R5BA 2MLXA 3CJ0A 4TN2A 5J2PA 3LGMA 5GADI 3MM9A 2NYIA 4O44A 2ALYB 4MJKA 5D4PA 1QY7A 1IM6A 3KLGB 2R2UA 4NLWA 2KM8B 4EGLA 4PXDA 4A8KA 2R7XA 4LFBJ 3I5BA 4DG1B 3MCOA 2X1AA 4DI6A 4J9VA 2DGXA 2FVQA 1MSWD 3H90A 4FF2A 5IOLA 2XCAA 4I67A 3I31A 4GKKF 1FD2A 3AODA 3DC2A 4I69A 3E51A 2DNOA 3NNAA 2EI5A 4L72B 2OPSA 2FC9A 4ID5B 4WFYA 1B70B 3M6UA 3V5RA 3SDEB 2FHMA 4DR4F 3V2UC 1GQEA 3TYTA 5FD1A 3UW1A 1AT1B 1AA1B 1TUVA 1X5SA 4OYWA 2AWZA 2HFOA 4F50A 4LF4F 5D4LA 2NXJA 1T05A 4UTGA 4UT4A 5A8WA 5HJYA 1UJ4A 1BXNA 1B7FA 2VC0A 2ZH2A 2RS2A 2YTCA 3HHLC 3SYZA 1K44A 1BQNA 3QIPA 2E5LJ 4OI6A 5H9EJ 1YTYA 3KJNB 3MHYA 1QM9A 2IC3A 1Y5NB 3H5UA 4YN3B 2HRTA 4K2XA 3MAAB 2FVPA 3MMCB 2XLJA 2BJ3A 1KVKA 2HZAA 3QSYB 1H73A 1UA0A 1NPPA 3KUGA 6FD1A 4DSJA 1T94A 1LW0A 5G0RB 1KQSR 3IG1B 3EZOA 3CC4S 2HQ3A 3LALA 4ZA1A 2RQCA 1N5YA 4DUZJ 1Q8IA 4JI2J 4P6QA 3M32A 1DZ5A 3EGZA 4G1PA 3RR8A 4UZCA 1H2VZ 3HFVA 2ZH8A 3D1QA 2CQ4A 1SQFA 2FZGB 3GR0A 4FXWA 1Q4RA 3GJQB 2AU0A 2E1CA 1P9QC 1I94F 4DF8A 2XWYA 5EDWA 1UVMA 1I6JA 1HHTP 2JWNA 5FLXU 4DV6J 4WWSA 2XSJB 2CJXB 3ZTQA 1JK9B 1ZPWX 4UOGA 4J9PA 1X9SA 3I9ZA 2VV5A 3OL7A 4U7CA 2RE1A 5LMNF 2NQPA 1H2UX 4LF8F 1RT4A 5HLFB 3MUTP 4WF9Q 4ANDA 4EYIB 4DUYF 1U2CA 1WC5A 2HNDB 4PQUA 3RW7A 4K59A 5EHHA 4L3NA 3NEKA 4IYQA 5KFWA 3TQ1A 4C0HA 2XMUA 4K7QA 1NNDA 1GMVA 4LFBF 1KBRA 1WUUA 2JRSA 4KGXB 3OUYA 2ZDOA 3NCPA 4QWCA 4P71A 1YI2S 5ETOA 1SVDA 1GTHA 4WXWA 2BANA 3MM9B 4O44B 3FBFA 3KG0A 3H5YA 5K5MA 2B4UA 4FYDA 2CPFA 3OHAA 1OYDA 1TAUA 2FTRA 1KRPA 3OR1B 1ZBTA 3RW6A 3UVJB 3PW4A 2R7UA 1AFJA 2ASLA 2RIJA 4OZ3A 4Z7CA 2HNZA 3M2RB 2F1FA 1JLCA 1XTZA 1AYEA 3NNHA 4F67A 2HGMA 2AMCB 2DVIA 4FDFA 5CCMA 2CQ2A 2E5LF 1KHWA 4Q8FA 1N33F 4RNOA 2EK1A 1T3NA 5ITHA 4XDCA 5K8OA 3D2WA 3B8HA 1FNXH 1D9AA 4C3LA 1OSDA 2EEYA 1SJ3P 1SKRA 4NASA 3CC2S 1T05B 4NYPA 4IRDA 4HT7A 4B9VA 2WW4A 1WTFA 3HVWA 2UUCJ 1UEUA 3CXCR 1O0PA 4LVNP 3QIPB 3IXQA 3U1NA 1JXLA 1KFDA 4EBCA 1L3VA 3V4IA 4DUZF 4QYZK 4TYBA 3SFUA 2XQCA 3UO0A 1HR0J 1GH8A 3T5HA 4A8YA 3M6XA 2IC3B 3DNCA 3JS9A 3BM7A 1Y11A 4C6AA 3V6DA 5CYMB 1NRKA 3D28A 4DS4A 2H9ZA 1JLGA 2E7XA 1S6PB 1OSCA 5IC4B 3GYGA 3AXMA 1LW0B 3MEEA 3UNGC 3CCZA 1S9GB 2JEGA 3MTKA 3VAGA 4H4KC 1WNEA 2HFVA 3GQCA 2M8HA 2MHNA 1JKHB 2DGOA 1SIZA 1WORA 4ETZA 2GHWA 4DV6F 1RWOB 2BJEA 3I4HX 2GMLA 4ZMMA 3DRRB 2ZC4A 3ZO7A 4QYRA 4M5DA 4ZJQA 5CCLA 2E66A 4DV5J 2CQ1A 3W2VB 2V34A 2RDIA 4XAKA 2RH3A 2GJIA 2PGCA 2YH0A 2W2NP 1R7IA 1TK0A 2E5IA 2M4MA 1CG2A 5CZXA 4OZNA 3SSRA 5FLXY 3ZZTA 2YKPA 4HACA 3NLCA 2YH1A 4DLEA 2OSQA 4RW6A 2W9AA 5HMYA 5J1EA 5C25A 2JEFA 1X60A 3LUYA 3SCIE 1VYAA 4Q7AA 3WX4A 2F65A 1RT4B 4QWEA 2DGUA 4BS2A 3IA0A 2KL8A 2LLZA 1BQMA 2FZCB 2DNYA 4JV5J 2WVEA 5HN0A 5HROB 4PQUB 4ENOA 3PTWA 4ECWA 3SBMA 2MZTA 4CH0S 4WFAQ 1VBKA 1U6ZA 1QAJA 2GMHA 4WIIA 2ACYA 1BGXT 4J9QA 1HMVA 1MN7A 2LFVA 1QVGR 3V6JA 3WC0A 4IR9A 4RW7A 1WSVA 1LFWA 2FC8A 4FYVB 1RTJA 1CS4B 4RWXA 2OFHX 5H9EK 3T1HJ 5E33A 5K8MA 4X2BA 4ECSA 4ANEA 3IGNA 1R8CA 1P1LA 3BB5A 1IKWA 3ZZPA 2Z0GA 2OMOA 2ZNZA 4DCJB 2F3JA 4ECTA 1HQEA 1K73T 5A8RB 3I4PA 1B0TA 3VHQA 3QT7A 3MFIA 2HNZB 3BKFA 2XYPB 1JLCB 1V6HA 3BSNA 2UUCF 4NRTA 3TZXA 1YJTA 2DCUB 3ZZUA 2H5EA 2GIFA 2HLTA 2JEJA 1EX8A 3GR1A 4B02A 1PC5A 1TKZA 4CM2A 1S12A 4UY85 2ZBRA 1HR0F 1CJVA 4KFBA 5ETKA 5I3UA 1GAOA 2PI5A 3OHBA 5HMXA 1HFEL 3DOMA 2PI4A 2FZKB 4JI8J 3R5GA 2LA4A 4H4MB 3EJMA 5K9FA 4DJBA 1N0UA 3ONQA 3T5LA 3IM8A 2MJUA 3BDPA 2W4CA 3RG6A 1RT6B 3BBBA 3W7BA 1KQKA 3QJPA 1K1QA 5DGAA 3G8TA 3C15A 2RKIB 2R7QA 1YWXA 2APOA 4YFUA 1QE1A 1QLNA 3GZ7A 1RAJA 3WIUA 4F25A 1RWPB 1LWFA 3KLIA 1KDNA 4LFAJ 1CPZA 3B6BA 4DMZA 1N5QA 3GJRB 2A3JA 3JB9k 4X4UA 1JLAA 3IO1A 9ATCB 4ED0A 1TTHB 2RRNA 3L95X 2DNZA 3TVKA 1RGVA 3TWZA 1KWMA 2HKEA 5KT5A 5L1JA 4X66J 2CZVC 3G2XA 1S4EA 1BUXA 3HP6A 2J6SA 4HI2A 3BGRA 1NJIT 2B9XA 3KHHA 2MSSA 4MK9A 4L6V3 1JLBB 2DGVA 2ZH1A 3PYFA 3CWJA 4F0HA 3I82A 3KXDA 2LDYA 1RTIA 2MLYA 3FFIB 2HAFA 3T9NA 4CLKA 1BY9A 1D3WA 1C0UA 2ACMA 2YNHA 1WC4A 4JV5F 2AEMA 4DR5J 3G82A 4HLBA 4LT6A 4HACB 5CD4A 2HWTA 2W24A 4BC7A 5LSRA 2GAGC 4C4WA 3W65A 5DQGA 3G4SS 1RAOA 2MDAA 1TZ0A 5F8IA 2GMJA 3RBXA 5KFEA 3HVTB 2H5JB 4EBDA 1HHQA 3T1HF 4MKAA 1XNRJ 4ZITA 3OTBA 1N34J 1M1GA 2H54B 3I0RB 2GAHC 3A3PB 1RHUB 2KFNA 5DG8A 5GAHI 4OQJA 3P8BB 4CTAB 1R43A 3KLFB 2QA4G 5DM7Q 5LJ3Y 2FVSA 3O1LA 2RD5C 6FDRA 3ILOA 4FF3A 4NLSA 1LW2A 5K20B 3W8GA 1Z4UA 1Q86T 1R8HA 2BRLA 1RISA 2NR0A 4OYPA 1CBKA 1ZAWA 3VAJA 2VFSA 3TA2A 1YGYA 1UFWA 4ED2A 4DUTA 4P7VA 3G9CA 5J2QB 4GRSA 3W62A 3SV3A 2D3O1 5B0EA 2R3VA 1IKWB 4PG8A 1IBKJ 2NUHA 3HDSA 4IG3A 4ZVEA 2DGWA 2XC9A 2Y1IA 3CD7A 4DU7A 1W2IA 4EBEA 1HQEB 2VL1A 5E41A 4ZVUB 1YQHA 1X0PA 1AB8A 1W2BR 2YWEA 2IA0A 1BLUA 3Q83A 1V3SA 4WE1B 4QBUA 5KFCA 1J5EJ 4ZVSB 1TL3A 2UV8G 3DMJA 2CA9A 2JOQA 3VGUA 4ZJOA 2KG0A 4X84A 4JI7F 1NDKA 1V9OA 1YSJA 3FEXB 2GS8A 4NA2A 5DDOC 3ZZOA 2P9GA 3TA1A 3KK2B 4DV7F 1U8SA 4KFBB 3M1VB 3HKZD 1HA1A 3G6YA 4P73A 1X4BA 3DOMB 1KKHA 5D77A 1FWPA 4U67Q 2FPHX 3UQSA 2UU9F 4RW8A 1TVRA 1C4CA 3BV8A 1R6YA 4J9UE 2B6AB 4USTA 2ZH9A 3UD4P 2RRBA 3D6FB 1LV5A 1U8WA 5DO2A 4ELUA 3GP9A 4ZPTR 2GQQA 2NSBA 4X66F 1RAGB 1T3OA 4ZLPA 2J6UA 3OL6A 2UVWA 3CULA 2J6TA 1Q8BA 3VGTA 4HYKA 3KNGA 3CD6S 1LWFB 2KVQE 3B4DA 2KT3A 3JYTB 4Q0BA 2CZ9A 2OELA 1JLAB 1JB0C 3IR5B 4W92B 3GFYA 3L3CA 2NPFA 3QGGA 2AEFA 2ZH3A 2EFVA 3K58A 4I2QA 4DR5F 3DDNA 3RJMB 2RVJA 1FK9B 3MR2A 3O8WA 3IM9A 4UZBA 4K4WA 3MGJA 1WHVA 4USWA 1VBXA 2HYIB 1NBEB 3OT9A 1NSQA 2YWKA 4CT9A 4EFAC 1VQ7S 3EGWB 2HRYA 4ER8A 1Y5IB 2CNLB 1O8BA 3RAXA 1AUDA 1QTMA 3C46A 2PIIA 4DFMA 1XMQJ 2I9SA 4DPTA 2CQGA 1LOUA 1ULRA 4C8NA 5DS7A 2J9DA 3G82B 1DAXA 4KPYA 3MM6A 5THWA 1ZA1B 4AL7A 3OSNA 2W01A 3KTQA 1RABB 1Z1ZA 5HI7A 3A8JA 3JSMB 4K4XA 2MZQA 2YPYA 5KG2A 4DL0C 3AH6A 1OY9A 1YJ7A 2JSXA 2BOPA 4ICLB 3TVYA 4DR1F 4F8RA 1VQ9S 5I42A 4IG0A 4CI0B 4G1IA 3FMBA 2P2CB 5GMKa 1IBKF 1RCXB 2KXHA 3MECB 3CCQS 2WSCC 1HWKA 3RBEA 3HLUA 4G6VB 1B0PA 1UTAA 2LQBA 3NL0A 1LW2B 4X4VA 1S1UA 4K2JA 3DLGA 5HO4A 5J2NB 3AT1B 1UMJA 2DNGA 1IKXA 2JNJA 2BE2A 2O67A 3DFEA 4JV0A 4FPIA 1RWUA 3H4DA 1S1XA 3P6YC 3RYLA 4AQYJ 5AT1B 3RR7A 1R6VA 4EUVA 1VQLS 3CVKA 5C24B 3NOGA 1MU2A 1VQYA 5FJ4A 2B9YA 1IBMF 4NI2A 2ZM6J 2EFGA 2XS2A 2XS5A 3MM8A 2V4JA 1F3FA 3CDAA 5LSOA 3BGFA 2DGQA 4KT0C 1S6QA 4Y00A 1EQ0A 4M63A 3DXBA 3M6WA 4WU2A 2VIHA 1OIAA 4IOBA 1ZOTA 2WRMA 3UR0A 5F8LA 1TL3B 2XO7A 1KOOA 4B3TJ 4TKTA 2DRBA 5E3QA 3MAHA 5A8KA 4B17A 2XHCA 2CIMA 1FO1A 1HYSB 2RILA 2ZJRQ 4OI1A 3KJQB 5KFNA 2BVZA 4OHVA 1VQ6S 1UVIA 2YNFA 2FJWA 3DHWC 2OIHA 1VRUA 3D3CJ 2XNRA 1R8AA 3HM9A 2CPXA 4RW8B 2ZUGA 4C8MA 3GILA 1UWAA 2PC6A 5D0EA 2RU3A 1KC8T 3ETOA 3FQLA 3MMBB 2WOMB 2QT7A 5JJBA 3P49B 3SIPB 4DDFA 3M8PA 2ZJQQ 1IN0A 2ZD1A 4BBYA 2KTQA 2BOAA 4RR5A 3MAQA 3HVRA 4Q0BB 2MKYA 2B7CB 1VISA 4FKXA 4MIWA 2J8AA 2MTLA 1KTVA 4DSEA 4I2QB 1X4HA 3O2IA 4I68A 3GJSB 2OAUA 4FVMA 3ZZRA 1ZAVA 1PCAA 1S1TA 4CLPA 3ILIA 4IFYB 2GVZB 1GXUA 4C48A 1Q8LA 2CADA 2QL5B 1WG1A 4I0WA 5T7LA 1VI7A 2W9BA 1RKJA 3CIMA 4A8QA 2PO4A 2DNKA 3L7OA 4WU3A 4HTIA 2DPIA 3HD1A 2E5HA 2OPRB 1SKSA 3D1HA 2N4CA 5L1IA 3Q89A 4DR2J 3K0JA 3P45B 3T19A 3GG0A 2Y1JA 4CLLA 2H48B 1FJCA 2JDJA 5DRKA 3C8YA 1NPKA 4DR3J 3OW2R 3I9V9 1HW8A 4DPWA 5DLFA 4I7FA 3QZ7A 1WKKA 2M2BA 3A8KA 1C1BA 3EXYA 2KB2A 2IAJA 4CQ1A 4HHUA 3GYXB 1K1SA 1CVJA 4M5HA 5HVGA 5E3PA 1HNXJ 2J9DE 3SQGA 2QYGA 5KT3A 4IH7A 4CIOA 4DHVA 5I42B 4AQYF 4FVCA 2DCLA 2QEXS 1NK8A 3TX0A 1FJGJ 2AHOB 2FLLA 1H7XA 1XMOF 3TQEA 2DXEA 2ZM6F 4J9NA 4RZRA 1NJWA 3RRHA 1S1UB 2KO1A 3BH6B 3Q8YA 4TY9A 4RLEA 3QJJA 4OIXA 2M88A 5AXNA 2WVDA 1M5HA 2KYXA 3IWNC 4GC6A 3LWMA 1BQXA 2B43A 4ALZA 2UUTA 1S76D 1P1TA 3BREA 4OYXA 2BE2B 5HJXA 1N0VC 1FHTA 4NLRA 4QZVB 3BN4A 1SJ1A 2FB0A 5LXRA 3D5MA 3PVXA 2MQLA 4ES2A 1TK8A 2IRYA 3RZAA 3L09A 4NCAA 5F41A 2VKZG 1S1WB 4U9RA 2XYGB 2B5JB 1TU0B 1REVB 4PG7A 2DTJA 4MK8A 1S0NA 4PYAA 2OEMA 1M5VC 2HK3A 3QLHA 2IBKA 4LF7J 4R5PA 4J9MA 3MPVA 1WELA 1EJ7L 1TL7B 1VK8A 4KIAA 5A8KB 3LO3A 2QSFA 2JLFA 5HK4A 3NBPA 3IRWP 2DHSA 4DZDA 4UW2A 2YPZA 2ZZNA 1EETA 1ICEB 1C0TA 2ASJA 1T03A 4LBIA 2FDNA 5DDQC 1TL4A 3BJYA 3SEOA 4TQSA 3OVBA 2VF3A 2VDHA 1FWKA 4WFNQ 2M52A 5IFMA 2RQ4A 2W7OA 1U26A 3R6GB 5HMZA 2Q6CA 5F8NA 3HK2A 2CKWA 5KOXA 2UXBJ 4DBQA 1CSJA 3EPIA 1IJFB 3FBBA 1T8EA 3EWGA 4O23A 2VBWA 2ZD1B 1TL5A 1RB0A 1DY3A 1S6UA 1U25A 3BPSP 1VC0A 1LEOA 1S97A 4RUCA 2VC1A 2W2MP 2KVIA 2AZ1A 1TKTA 5E3CA 4DR2F 4TLQA 3CCMS 2VASA 2FY8A 1FDNA 1K8AT 2LECA 1CJTA 1QD1A 1UCNA 1APSA 1RT5A 3HULA 3FBEA 4PABA 3QIDA 4V19J 4DR3F 1TKXB 2D41A 4X4TA 5T7LB 4U95A 4NL5A 2VD3A 4X64J 3KLHA 3CD0A 3JAMY 4A8SA 4DSLA 3PYDA 1LK7A 2BACA 2OHDA 1NJXA 1QUPA 3CPWR 3TUIC 1IUJA 3IP0A 2I38A 1FJGF 5K14B 5KFDA 2VHGA 1Y0HA 4I7FB 3CW2C 3AOCA 4E0DA 1DTQA 1PO6A 3C6TA 4QOTA 3NMRA 2VG7B 4WP3A 2VZ9A 2D69A 5LMUJ 3RB4A 3BKTA 3W5ZA 2I5JA 4V1Ak 2L9DA 3NGUA 4LFCF 1DTTA 4IUFA 4K5SA 5C7PA 2MQOA 2BRKA 2GW8A 3O6QA 2NXCA 4ZVGA 2V4QA 1EHWA 4NXMJ 2WB1D 1NMEB 3OL8A 2C42A 3TEHB 2YBVA 1VJWA 4PWDB 2J0XA 4M5GA 1NDLA 4MYTA 2ZOGA 2CQBA 2KDOA 4HR2A 3PJ9A 3R5DA 4RUBA 5AE3A 4L75A 1ELOA 1CC8A 3H59A 4EU0A 3OXFA 4OV1A 4QR1A 3F56A 3RBDA 2G1HA 4LF7F 5A6WA 3Q24A 1VQKS 2MZ1A 3PX4A 1RP5A 4O3PA 3R2DJ 4DQPA 2FQQB 4WZQA 2ZE2B 3OPKA 1KQFB 1HBOB 3QO9B 3CDEA 3ADAC 1S9FA 2O1PA 1U2FA 4NX9A 2R8JA 3S6EA 5E3AA 3BS9A 2FY1A 4GVLA 2WBMA 3RUBL 3QT8A 2HQDA 4ZCKA 3OLAA 4DSFA 2M5YA 4Q8EA 1MN9A 4OZJA 1ZM4A 3NXZA 5L8RC 1EP4B 2CJ9A 3DLBA 2E29A 2XULA 1YJNS 1VIXA 2IFXA 2UXBF 1DQ8A 5CH7B 5CD4H 1TV6A 2ZC3A 4LRBA 4OYBA 5KFHA 3MM5A 2XMMA 3M7VA 1KEKA 4I6AA 1T03B 1E6VA 1YG0A 2KH9A 5J1PA 3AB2B 3ZZYA 3GIMA 2R7VA 3POTA 3D4JA 5EN1A 4J9OA 2D3UA 4TY8B 3OFHA 4L76A 5DZ6A 3K2YA 2F7VA 2Q43A 3MR5A 2V2ZA 3CNQP 3CDWA 1Q5YA 4E2FB 2LQJA 4DN0A 4HEA9 1UWBA 3JSBA 4ELTA 2HVIA 3O44A 5ETSA 3W2WA 2DGSA 1FTRA 2CPEA 4CYUB 4YR3A 1VS3A 3U02A 2GHVC 4OJ1A 4KV8A 5L46A 4DV1J 4X64F 5CYQB 4PUOB 1GXLA 1N54B 2P9CA 3GFHA 5B0DA 3FK4A 3Q86A 3W9IA 5ETLA 2CJYB 2XBPA 3PO4A 2DO4A 2E5JA 4NWBA 4OI4A 4AL6A 1VQ4S 5KFZA 2IVYA 2ZKTA 2KFYA 5LSLA 4AFFA 5IV4A 3DOKB 2CNOB 2ZWPA 1M90T 1FWLA 2CWKA 1T9VA 4B3MJ 1XJWB 4LRAA 5LMUF 2V8PA 1U47A 5K8NA 5KOWA 4DL7A 2LQ8A 3C16A 2P8IA 2R7TA 3ENVA 5H9FJ 4CDIA 1WC0A 2QA1A 4B3OA 3EXCX 4NXMF 1NLKL 4QW8A 3QRQA 2IDLA 1S7IA 3C6UB 2FHJA 5LT5A 1VIOA 2VG6B 1X5PA 1WKJA 1DTQB 2W8KA 2P6TA 2FJEB 3J7ZT 2KZZA 3Q8UA 3QAEA 4DV0J 1JLFA 1X9WA 4NYOA 2EVZA 1FKPB 4ZHRB 4O3QA 3WHIA 4ZPCA 1VQ8S 2VUGA 1DTTB 4ED1A 2V50A 1HD0A 4LF1A 4F7VA 3EVMA 2IJRA 5BYQA 2OJ3A 1XR6A 1VLOA 3CJ2A 2B9WA 3ZTRA 1JNRB 1ZM9A 1O6XA 1G1XA 3F0NA 2HNYB 3GIJA 4B9MA 4NCBA 2CZ4A 3DKDA 1TQLA 2MGZA 5K8PA 5CYJA 1RWVB 4RBUA 3VAIA 4LF6F 1RTDA 5KFRA 1QAYA 2YX7A 2R2TA 2E7VA 2FJBB 3QFWA 3PW2A 3VVUA 1R0AB 1FFSB 5EX3A 1QTNB 3KLVA 1GFWB 1Y9OA 3PNIA 3UD5A 4ITSA 2KXFA 2ZEJA 3WDOA 2IPOB 5HQMA 2HMIA 4K0KJ 4WFBQ 3SSSA 2DHGA 2I0XA 3WQPA 1U6FA 1HBUA 4CLWA 4DV3F 4JI3J 4OZ5A 1O5JA 2AD9A 1WC1A 4N76A 2XO6A 2YX4A 4NLVA 5FDLA 1NKEA 1YK9A 4O4GA 1FVSA 1M1KT 3M8QB 4KKOB 2R4FA 1PJ5A 2U1AA 3PX0A 1VGYA 1BD6A 3CIZA 1TFYA 3N6NA 4DV1F 2A6MA 4TQRA 4KJIA 1FX4A 2VFVA 4DFKA 2Y8WA 4WKRA 4P2MA 2XZDB 4HL9A 1GMWD 1JWWA 3MM7B 4YP3A 2R42A 2HWIA 2NUUG 1R31A 3R9LA 3D0HE 3R5CA 2D3OR 1RT2A 1TP7A 1ZAXA 1JJ4A 2HVDA 4LSZB 5D4NA 3KDNA 1F3VA 3MPWA 3MR6A 4WXOA 1MWYA 5EGYA 5T41A 3TZZA 2LVWA 4B3MF 4PWWA 4C0OC 1YBUA 1U6BA 2BUNA 5D3GA 6AT1B 2Z58B 3M2UA 2FJAB 4HH1A 4DQSA 2MB0B 3MD1A 1SC4B 3N5BA 3UCZP 2N7CA 2JFDA 3AOAA 1X4CA 1CULB 3CCJS 2OPPB 2PE8A 2VFTA 1MROA 2AJ1A 4EI2A 3AAWB 4XK8C 1N36J 1RBAA 1FRMA 1NHKL 3CT9A 3UD3P 3AOBA 4DV0F 5EX0A 3VR1A 2RAQA 3V81A 3P5TL 2PD1A 1WHYA 5GAEI 3CCRS 4LF9J 3C16B 4W4MA 4O0NA 5DQHA 1JLQA 3CJRA 4RW9B 2X51A 5BXIA 4F3MA 3GG1A 1UEKA 2HQCA 2WZ1A 3NMAA 3GE9A 3KDOA 2G4BA 4OV6A 3MEDB 4K4TA 3TAMA 4DCPB 5KT2A 8AT1B 2DRDA 3KJVB 1IKYB 1URRA 1JLEA 2XMVA 4FP9A 2JVRA 1JLFB 2ZZMA 4DXLA 4KRWA 1K9MT 4YR2A 1F5CA 5E7OB 2HPUA 1OY6A 3LAMA 1TAQA 3F44A 2QZ8A 3J81U 4RU2A 2X7IA 3M05A 3G71S 1H7WA 4B08A 2M9KA 4Z2XA 1H2TZ 3CCSS 2C2RA 5CQGA 5JUMA 2FJDB 3CJTA 2DR6A 4QWAA 1FEHA 2MZJA 5B0BA 4M5NA 4K0KF 4LVOP 3JTNA 3LW5C 2MGZB 1EKRA 3TAPA 3KK1A 1SB6A 4M5JA 3GSIA 4JI3F 1WC3A 5D78A 1SV5B 4F2RA 5L1KA 3KLEA 4LQ9A 1N32J 2XWXA 2F9JA 3OTOJ 1Y00A 3MPDA 1D8YA 1S6OA 4ZDNA 2D9OA 1NXIA 5KT7A 2ASYA 3HHEA 2WSFC 1CJUA 1I51B 1X4EA 4EMDA 4N5SA 1HNWJ 3GV8B 3HJVA 2ZOFA 2DGTA 2BW7A 4MFBA 4IQXA 4BCAA 3VALA 4ZKAA 3QMQA 2UXDJ 4LRFA 1Y3JA 3G6XA 1HBUB 2MKHA 4ECQA 3PYGA 3MEKA 1U1RA 3FZ2A 1A9NB 2RQMA 2ZBQA 5KT6A 1AZSA 1WD6A 4P2FA 4AUKA 1RTZA 1FKOA 2R9LA 3LGNA 1TR0A 2J0WA 2UP1A 2HHVA 4IRKA 1YDLA 3IMQJ 1U45A 1ZH5A 1MW7A 1KNZA 3PJWA 4KB7A 5I3QA 4NZ0A 2GGPB 2AJQA 4A8FA 2DHAA 3L7PA 4NMXA 1UL3A 2YKMB 3NGTA 3I32A 3NWRA 1RAEB 3NRBA 3K59A 4Y0FA 3QZ8A 2AW0A 3NS6A 4C8OA 1UAWA 3N01A 2YKAA 4CP5A 2Q6BA 2W4PA 2MQNA 2RT3A 2YQ3A 5GAEU 5L9NA 1SJFA 1RT2B 1J5OB 2BDPA 2C22A 1N36F 2EFNA 5DZ7A 1HIYA 3JQKA 3HZEA 1QVFR 2ILZA 3R7BB 1GT8A 3NGDA 2BXJA 2LXUA 1VMBA 3DLEB 3M30B 2QMWA 3OR2B 2ZBIA 1JNZB 5L38A 1F6TA 4LRCA 3MPUB 4ZVOB 2X3DA 2OPQA 5E2QA 4CZCA 4KY3A 5GMEA 4RPFA 5KFAA 3UDCA 2YQ0A 3AJDA 4AL5A 1SPBP 2JFKA 1CLFA 2HQIA 4P9SA 4UOHA 4X4SA 2PA3A 4YB1P 1WOSA 2H4YB 3EDRB 2BV3A 4L73A 1RT7A 1NU4A 1FXLA 2IJNA 3MDFA 3DOLA 5KFYA 4X4QA 5HQ8A 3T1AA 2E1MC 2F8MA 5DM6Q 4KHPF 1Q16B 4HHJA 4OLPA 3TANA 4J9SA 1U02A 2C3MA 1D09B 4HTJA 2FVRA 3JSYA 3D1OA 3TO8A 2HHSA 1U0HB 3N9UC
chains in the Genus database with same CATH topology
4DL6A 3H5XA 1OPIA 1KHVA 4YHHF 3BEGB 4J9KA 3RAXA 2FD2A 1AUDA 2NS1B 3OTCA 2X1BA 4I6YA 4RNHA 3GV7B 4ED7A 4I1TA 1QTMA 1R3NA 2D9PA 1HBMA 2PIIA 4ZVFA 3C46A 4F3OA 4DFMA 2I9SA 2BQRA 3HZGA 2CQGA 1F9FA 5L39A 5IZHA 3J81Y 5L1LA 1N32F 2WONA 1LOUA 3PXGa 2A2DA 1ULRA 4YY3F 2ATLA 4C8NA 3SCJE 5J2QA 4P2SA 4QIFA 5DS7A 3TRGA 2J9DA 3OTOF 3OFFA 1DAXA 4YDDB 3J7A1 2BQ3A 4KPYA 3M8PB 4RUAA 2VG5B 3HX9A 3MM6A 5THWA 4AL7A 4DV4F 4Y34A 1M5KC 4IKAA 3D0IE 3OSNA 3R1HA 1OQ3A 4F3QA 1HBNA 1ROFA 3E01A 4AXIA 2KRBA 3KTQA 1Z1ZA 5HI7A 1E6YA 1WWHA 3JSMB 4K4XA 2MZQA 1S79A 3WZ0A 5KFVA 4DPOA 4DQRA 3IGVA 3QWUA 5F0WA 5BR8F 3JTPA 2IRUA 2QE5A 1VQMS 2DT9A 5KG2A 1GNKA 3K7RA 4KGMA 4DL0C 3AH6A 4YDXA 4ECVA 1LKZA 1HNWF 2BW2A 1FE4A 2JVOA 4CH1A 4ECRA 3CCVS 5KFOA 3HHKA 1TKDA 2HVHA 2JZ5A 4HH0A 2ZH4A 2BA9A 2JSXA 2QIFA 2CPJA 1KD1T 2BOPA 4ICLB 3TVYA 2AX1A 4PXBA 1LWEB 2GGPA 4DR1F 1Q7YT 2B4PA 5I4MA 4CO3A 1SUQB 2CFXA 4WE1A 1YRTA 1VQ9S 4F8RA 4Q5VA 5I42A 4IG0A 3T1YF 4CI0B 2YKMA 1S1TB 4G1IA 4Y2AA 1K0TA 2PA8D 3AHPA 2LCWA 3FMBA 2HWHA 5GMKa 1IBKF 4YUDA 5BJRA 1PSDA 2KXHA 3MECB 3CCQS 2MQMA 2WSCC 2FVCA 3FRZA 5IT9Y 1HWKA 4QR0A 2DIVA 1C2PA 3RBEA 4ZPVR 3HLUA 2HVZA 4G6VB 3SXLA 1KN6A 3H98A 1B0PA 4FN5A 4OHXA 2LQBA 2W9BB 3NL0A 1LW2B 2FUG9 1HI8A 4PKDB 1OS5A 2EBEA 4ZPWR 4X4VA 2QLWA 1S1UA 3UPFA 3KK2A 4OHWA 5C42B 4TXSA 3DLGA 1UVNA 5HO4A 1DLOA 5J2NB 4FNHA 3MEGB 3TUZC 1UMJA 2D7SA 1WI6A 1J5OA 3M1VA 2IJFA 3R27A 2C2DA 1HNXF 1QSYA 2DNGA 1IKXA 3NP5A 2R7RA 4Y6IA 1L3TA 2E7WA 2AP6A 1N6QA 4C2MA 5GVQA 4YR0A 2BE2A 2KFZA 2O67A 4MFBB 3DFEA 4JV0A 4LUBA 2LQ9A 2WCXA 1TL1B 4WTYA 3HF5A 1RWUA 3BR9A 1FRHA 3U1LA 3NS5A 3H4DA 4DR7F 1S1XA 3P6YC 3EUNA 2B6AA 4O4RA 3DLEA 3M30A 3RYLA 3RR7A 1WEZA 2CQPA 1FNMA 4EUVA 1VQLS 1DURA 1H0HB 1S1VA 3CVKA 4H4OA 5C24B 1MU2A 4U6PA 4IOAQ 3OR2A 1Q78A 2RU9A 4K4SA 4OI2A 5EWGA 1RTHA 4JI1F 1D1UA 2DNHA 1VQYA 2QA2A 3A8EA 3P3DA 4OJ3A 4QWDA 2K1RA 3NCRA 2B9YA 2OFGX 3OTDA 3G96A 2ZH7A 1IBMF 1C1BB 2JLEA 2WSEC 4OX9F 1FRLA 2HZCA 4KHRA 4E8UA 3MCSA 3PEJA 4C8KA 2EFGA 2XS2A 5B0GA 3MM8A 2XS5A 2IAJB 2B0GA 2R7WA 3NKYA 2Y1RI 5DJBA 2V4JA 4J37A 4LSLB 3CDAA 5LSOA 4F02A 4EO8A 4ILLA 1JIHA 2ZH5A 2HFNA 3BGFA 1B0VA 1HNVB 2DGQA 2O66A 4KT0C 3SQGB 3JYTA 2Q79A 1S6QA 4Y00A 3U7JA 3I55S 3IR6B 5KFUA 2IVMA 4ECZA 4M63A 3DRSB 3DXBA 3M6WA 4I56A 5B7WA 4TU7A 2W7AA 4WU2A 1OIAA 4IOBA 5DG9A 2PMZD 1ZOTA 2MKCA 3ZC4A 2WRMA 3UR0A 3HHDA 2LQ5A 1H38A 5F8LA 1TL3B 2XO7A 2RMLA 1RA6A 1SIWB 2V0NA 4J5OA 4IR1A 1KOOA 2AV5A 4TKTA 2DRBA 5E3QA 3FVYA 4USHA 3MAHA 5A8KA 4NCGB 4B17A 4RU9A 4ECYA 2CRLA 3I56S 3LH2S 2CIMA 3KMSA 3IFEA 1T95A 1KFSA 3OTEA 3IWXA 1FO1A 3QGIA 1HYSB 2RILA 2Z4PA 2ZJRQ 4OI1A 2MQPA 5KFNA 2BVZA 4OHVA 2K3IA 1FK9A 3EZ5A 1L5UA 1VQ6S 1UVIA 1ZM3A 2HFZA 4KO0B 1UA1A 3BN7A 2YNFA 4DLGA 4M1KA 4FXDA 3T9ZA 1Z2LA 2FJWA 3IS9A 1LFPA 5GADU 3N9UC 1SH2A 2Z2LA 2IYIA 3TW0A 2IRXA 1VOMA 3NAIA 3VAMA 3DHWC 1HNIB 2WTFA 5IM0B 2UUAF 2KM8C 3CCTA 4OLOA 2GJ2A 2OIHA 3LAKA 1VQPS 4ILMA 1VRUA 1S49A 1X0FA 1NH7A 1ZZFA 3N6LA 2XNRA 1R8AA 3HM9A 1VRTB 3VQSA 4N41A 2CPXA 4RW8B 4O3SA 5AXLA 2V4RA 1KVIA 2ZUGA 4C8MA 3IBWA 3GILA 5IQ6A 1XC9A 2VOOA 3J7YU 3DI6A 4IDKA 4UUXA 3THTA 4NXNF 2HS3A 2A1BA 3WBZA 2PC6A 3KG1A 4BWMA 2WW8A 5LXYA 4MK7A 3R3TA 2RU3A 2X1FA 1I1GA 2KI2A 3TVZA 3UFCX 3ULHA 1KC8T 2MMYA 4TU9A 3ETOA 3IAS9 3FQLA 2GHPA 5KFJA 3MMBB 2WOMB 3PRBA 4YMEA 4FPRA 5KG3A 2DD8S 2KHDA 1U1MA 1OO0B 2QT7A 4CNZA 2D74B 4FF4A 2DH7A 1IKVA 2Z8QA 4M95A 5JJBA 4DOZA 2AGOA 1WF1A 2NLWA 1UP1A 2AQ4A 1UVJA 3P49B 4DDFA 1L3UA 2OTJS 1MMNA 2G1DA 3M8PA 3OXLA 2ZJQQ 4D3HA 1M5PC 1IN0A 2ZD1A 3CC7S 4BBYA 2C3OA 2R8KA 4E98A 4LIWA 2KTQA 2XMWA 4RW4B 4Y2CA 3DRPB 2EKYA 4DQQA 3AA9A 2XY6A 1AFIA 3MAQA 2CVEA 3I0SA 4IFVB 3MI7X 3HVRA 4Q0BB 2B7CB 3UI3A 3JSMA 4QJVA 4O3RA 3QLHB 5HBMB 4I2PB 4R5PB 4PRFA 2VBYA 4GMKA 3B4MA 3PFOA 3PDNA 3RB3A 3S1TA 4MIWA 5KG7A 2VFRA 4C8LA 4B3SF 4EWTA 2HG4A 1D0EA 1RT1B 2VPWB 2J8AA 3DLKB 4EZ6A 1XERA 1U1KA 2R8GA 1KTVA 3K5OA 4R8UB 2AYEA 2JH3A 2ADCA 1FXRA 2R7OA 5J2PB 3DOLB 5IT4A 3NBPB 4ICLA 3PKYA 4DSEA 1D9DA 4UUWA 4I2QB 4WK3A 1X4HA 7FD1A 3O2IA 2A18A 4I68A 1M5OC 3RB6A 3PO5A 1SUQA 2OAUA 4BHQA 4N56A 3QYYA 4FVMA 3ZZRA 1EETB 3A1YG 3DGPA 3SMZA 1ZAVA 3S01A 1C0TB 1S1TA 3PR5B 3OXGA 2FJXA 4EZ9A 1WHWA 1G2EA 3VAKA 2F4VF 3OV7A 2RQKA 2K3KA 3MECA 2MKIA 1XEZA 4IFYB 2LEPA 4ZPDA 3GYNA 1GXUA 4IH6A 3VZHA 4YQWA 1Q8LA 3SV4A 2NREA 4I0WA 1WG1A 5T7LA 1RDRA 4C9DA 1VI7A 4XPCA 2W9BA 4C3MA 1RKJA 1Q82T 2M7SA 3BQ0A 3CIMA 4A8QA 2PO4A 1IM4A 2DNKA 1SC6A 5IWAF 4I6WA 3L7OA 2D3ZA 4F4KA 4WFXA 2C3UA 4WU3A 4HTIA 3J80Y 5J2NA 1WG4A 2DPIA 2RSQA 3MEGA 3OVSA 4F4XA 1YVFA 2E5HA 2OPRB 2R2SA 3Q23A 2AYMA 4N8NA 2J7KA 5B09A 2JX2A 2NPIA 3NNCA 1SKSA 4ED3A 4PCQA 3MD3A 1NH8A 3D1HA 2N4CA 2QLXA 2JC0A 5L1IA 1CC7A 2DNMA 3H5SA 5DDRC 1KTQA 3K0JA 2E44A 1NK5A 1S4FA 2K8GA 1RQ0A 2WONB 3UCUP 3DCAA 3T19A 1DFDA 1HQUA 2CVIA 2AGQA 3GG0A 2R7SA 2Y1JA 1HW9A 1X8DA 3C66A 2WAQD 3C2PA 1YJRA 1URNA 1FJCA 2OPSB 2EFOA 3KKFA 5F3TA 2EWHA 2JDJA 1XN9A 5DRKA 1QAXA 2F8HA 2RS8A 3C8YA 2LXFA 4ELVA 2HRUA 1JMTA 1UVKA 2F8EX 5C24A 5D8HB 3CSKA 1HBNB 3I9V9 1FRJA 3NCQA 3OW2R 1HW8A 4OI0A 5DLFA 4I7FA 3U27A 4K4YA 3QZ7A 2HHHF 3BSCA 1E6YB 3H2UB 2M2BA 1RI7A 3KG4A 5F8JA 2MZRA 1C1BA 3EXYA 4DWIA 2CPIA 1WI8A 3FMWA 2KB2A 3GIKA 3EYZA 1TFWA 2VB6A 3IWLA 2IAJA 4CQ1A 2ZNYA 5MLCV 5A8WB 4LSLA 4Y65A 3PW0A 3BQ1A 4EEYA 2FGOA 3GYXB 1K1SA 3PJXA 4JYAF 1CVJA 1U2RA 3HXMA 1T02A 4HDGA 1TKTB 1HNVA 1VBYA 5E3PA 1Y4ZB 2J9DE 3OFEA 4PPDA 3SQGA 5HL7Q 1BQNB 1N5VA 5KT3A 4O0IA 4YB6A 4IH7A 3OJUA 4DS5A 4CIOA 2E9TA 1G3OA 3DRSA 1M0SA 4DHVA 1IBLF 3PW7A 5I42B 4AQYF 1RT5B 5KFTA 1XR5A 3ZFVA 4FVCA 2DCLA 2QEXS 3U1MA 2VA3A 4OJGA 2DJWA 1FEEA 2CPZA 4JI2F 3CJ3A 3IN5A 3CJ5A 1NK8A 2MSTA 4YB7A 2KRRA 4NCGA 3SZ2A 2FLLA 1H7XA 2PSZA 1XMOF 2ERRA 3HHLD 4ERDA 2J0SD 4C3KA 2W25A 3T6JA 2ZM6F 1HYSA 4J9NA 2NXUA 4RZRA 3LF0A 1NJWA 3KLHB 3RRHA 1S1UB 2KO1A 3RTVA 2DK2A 4TY9A 1U4BA 4RLEA 2ZHAA 1DLOB 7FDRA 4OIXA 2M88A 1ZPVA 3F41A 5AXNA 3QJJA 4DSKA 1M5HA 2KYXA 3EX7B 2VONA 4MIBA 3IWNC 4GC6A 1UETA 1BQXA 3LWMA 2B43A 2J9CA 2LKZA 3SCKE 4ALZA 2UUTA 5B0CA 1BWEA 4NA3A 2XS7A 1HNIA 4DL3A 2AF6A 2B4VA 5IM0A 1N6QB 1S76D 3OFGA 1P1TA 1SH0A 2VODA 3BREA 5F3ZA 3I6PA 1X5OA 2BE2B 2EFQA 1R27B 1N0VC 3SFGA 1VRTA 3AQPA 4PG4A 1FHTA 1LXJA 2B51A 3R5AA 1NZAA 4NLRA 2DBBA 4QZVB 3BN4A 1SJ1A 5G4DA 1N5YB 4QU7A 4OX8A 3I96A 2V9WA 1Q1KA 5IT0A 4IOCQ 2DNNA 2FB0A 4Y2KA 3CO9A 5LXRA 1S1VB 3D5MA 4H4OB 3H25A 2IMWP 2HHTA 3M32B 3PVXA 4NLPA 2KT5A 1RYRA 4GO7X 3IC1A 2J0QD 1SI9A 2XG8A 3NGKA 5E5NA 1N5TA 2MQLA 5U47A 1RTHB 1F60B 3MMBA 4ES2A 2GV1A 2WOMA 5J2MB 5KT4A 1TK8A 2IRYA 5KG6A 3KOAA 3RZAA 4B9LA 3L09A 3C6TB 1S7HA 2MY8A 3GB0A 4OI3A 4X4RA 1T7PA 4KHMA 5F41A 2VKZG 2QA4S 4NCAA 4V19X 1S1WB 4U9RA 1ZM2A 2COLA 1C1CB 3ICLA 2B5JB 1SBRA 1REVB 2CQCA 2QSWA 3H2LA 4PG7A 2G13A 2DTJA 2W4DA 4MK8A 5EWEA 4UQGA 4F4ZA 1S0NA 3W3SA 2P5VA 2N7YA 2QMXA 2ZITA 4B9UA 4RW4A 2VH7A 2HIQA 2I5JB 1H3DA 3DRPA 2EC0A 1M5VC 5C5JA 2M3DA 3H4BA 3IAM9 4IFVA 4N47A 1FJ7A 2QV6A 3KK3B 3HJFA 1FNOA 3QLHA 4NLQA 4NZ6A 1R8BA 4I2PA 2IBKA 2Q3PA 2DR8A 4CO0A 4R5PA 2XI2A 4J9MA 3CMES 3MPVA 1WELA 3H40A 1X4AA 1HHSA 1WF0A 1S0OA 1CQMA 4AYBD 4BWJA 2ASDA 3R5BA 1VK8A 5D4OA 4KIAA 5A8KB 2V9KA 2GCFA 1RT3A 3LO3A 4C98A 5JVHQ 2K2PA 2QSFA 2JLFA 3CJ0A 3G6ES 3R1LA 4TN2A 4URQU 4R8UA 4EYHB 3LGMA 5GADI 3PEHA 3NBPA 3KFWX 3SSQA 5M2UA 2KKHA 5J2PA 1N48A 3MM9A 3IRWP 5DDPC 2NYIA 4O44A 2DHSA 1AW0A 4UW2A 2OD4A 2XGPA 4MJKA 2CQ3A 1QY7A 4MH8A 5D4PA 2ZZNA 3O5TB 1EETA 2HS0A 3KLGB 1VK3A 2R2UA 1C0TA 4Y2IA 2ASJA 4NLWA 1T03A 4ECXA 3IS9B 2FDNA 2E9ZA 5DDQC 3F73A 4BDPA 1TL4A 3J7YI 3BJYA 3VWSA 2KM8B 3SEOA 2MJNA 4EGLA 4TQSA 4IFYA 3OVBA 4PXDA 4A8KA 3T5JA 3ZZZA 2R7XA 3DYAA 1XBWA 4B3RF 3I5BA 1NHVA 4DG1B 2X1AA 4A8OA 4WFNQ 2M52A 5CA5A 5IFMA 2RQ4A 1GTEA 2W7OA 3DI6B 4IDKB 5LL6d 3HHNB 1DHMA 5SUHA 2DGXA 2FVQA 1U26A 1MSWD 4KGKA 3OBIA 2OPRA 2DNLA 4JUZA 5HMZA 1O51A 2Q6CA 5F8NA 2B3TB 4FF2A 4G1QA 2V8GA 1U48A 2ZVSA 2XCAA 3CCLS 2YY3A 1KLMA 3HK2A 4I67A 2CKWA 5KOXA 4DBQA 3JSRA 4KSEB 4OHZA 3I31A 4GKKF 1FD2A 1NAQA 1V3RA 3DC2A 1CSJA 4I69A 4PQAA 3EPIA 2EG1A 3N6MA 3E51A 4P7TA 1IKVB 2DNOA 1IJFB 3NNAA 2EI5A 4K4UA 4L72B 3TNVA 1T8EA 2OPSA 3BO3A 2FC9A 4ID5B 1P6TA 4O23A 4OMFG 2VBWA 2ZD1B 4WFYA 1SQEA 4Q2MA 1TL5A 3CUNA 3VTIA 2BM0A 1X7VA 2KZMA 3M6UA 5HMWA 5LJ5Y 5KG4A 3V5RA 4Q43A 3RRGA 3SDEB 2FHMA 3I0SB 4DR4F 3V2UC 2XGQA 1NK6A 1GQEA 1S6UA 3HPOA 3TYTA 5FD1A 3OUYB 3UW1A 4Q45A 1TUVA 1X5SA 1ZYQA 1U25A 2AWZA 2HFOA 4F50A 1VC0A 4LF4F 1S77D 5D4LA 1S97A 4RUCA 1MWZA 2VC1A 5F9NA 4WKYA 2KVIA 1T05A 5A8WA 1AROP 1UJ4A 1B7FA 2W9CA 1SL0A 2VC0A 3HHLA 2ZH2A 2RS2A 2YTCA 5AXMA 1TKTA 3HHLC 5E3CA 5KFGA 5DETA 4DR2F 3SYZA 2XHWA 1ZTTA 1BQNA 3QIPA 1TV6B 4KQZA 2BANB 2VASA 4TLQA 3CCMS 1FDNA 2XLIA 3V6KA 4DSIA 4URSA 3CDUA 3MM5B 1K8AT 2LECA