2XQCA

Deinococcus radiodurans isdra2 transposase complexed with left end recognition and cleavage site and zn
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKYIESQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE
publication title DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein/dna
total genus 32
structure length 129
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2xqcA00
2VJUA 2F4FA 2VIHA 2EC2A 2VHGA 2A6OA 2FYXA 2F5GA 2VICA 2VJVA 2XQCA 2XMAA 2XM3A 4ER8A 2A6MA 2XO6A
chains in the Genus database with same CATH superfamily
3HFKA 4OHYA 5HBMA 1S0VA 1S1VB 2BQRA 2QLFB 5KG6A 2XWXA 2G1HA 1WACA 2WCXA 3ENWA 2JLGA 4WK1A 4P2SA 3M4XA 3KLGA 1BMQB 4QOTA 5KFGA 2WBRA 3BGOP 4EI2A 4RLEA 3HMJG 1N6QA 2FHMA 1VQSA 4LR8A 2DNOA 3DDKA 3BN7A 2JX2A 1W2IA 1TVRA 2H65B 4KBIA 1S0MA 2WONA 1KWMA 3FEXB 2GHPA 4HEA9 3L3CA 4O4GB 4DLGA 1S6QA 4N77A 4LF6F 1N56A 2RNEA 3B78A 1S1XB 2H4WB 2VPWB 2XMVA 4YHHF 2W25A 2CJYB 3NY0A 3UR3C 2I5JB 4HDHA 3K0JA 1F5BA 4ITSA 4MT1A 2XS2A 2HFSA 3DLJA 2XG8A 1C1BB 1NZ8A 1DARA 2IYGA 3OTOF 2VDHA 4QW9A 4YP3A 1DJ0A 3MHYA 3A3PB 4IOAQ 3JAMU 4YB5A 3N9UC 3MD1A 4RNFA 1U1RA 3IBCB 3GFXA 1NKEA 1S6PB 1EKSA 1NRKA 2Y9HA 3CULA 3UDEA 1NPKA 4DR5J 3MMBB 2IJRA 1IKVB 4KTQA 2DEIA 3VGVA 4AD6A 4TVAB 4CH0S 2DHSA 2HHPA 2YQ3A 2RS8A 4DPWA 2MMYA 4G1QA 3QT8A 4D3HA 4NYOA 3TVYA 1S1UB 3R1HA 4ZCMA 4A8MP 3TVZA 5HBMB 1S6OA 4JB8B 2UU9F 4X4VA 4I2QA 4C8YA 3MM9A 4RWXA 4A48A 1N52B 4QWEA 1GMUA 3KLGB 1U1OA 1SKSA 4F25A 1FI4A 3UR0A 3SQGA 2GCFA 3KLEA 4E2FB 2XMKA 2MJUA 1TVRB 4X2BA 1MNEA 3IRXB 4CO1A 4JI1F 4OZ2A 1IN0A 5CH7B 1N33J 4IR9A 3US5A 4NLRA 5KOWA 4CLFA 1RADB 1S6QB 2M2BA 4TY9A 2E1MC 4KRWA 2UXBF 4DSEA 1Q81T 3LP1B 4ZKAA 3CT9A 5H9EK 1F1BB 2RB7A 3NGSA 2QV6A 4RPFA 3IR7B 3NMAA 3TJAA 2AJ1A 1SJFA 2CQBA 3LAMA 4ZVPB 5C25A 4EBCA 4LIRA 4M5DA 4UZBA 1XNRF 5D0HA 2F5GA 3JXOA 4Y2IA 2RMLA 3A4TA 3P96A 2DGWA 1UCNA 2VFVA 5K8PA 1MMDA 3W63A 3QQCD 4RX6A 5KG3A 1NU4A 4DR6J 3H2UB 2ZKUA 1HMVA 1CPZA 1WSRA 4OI4A 3UCGA 1Y11A 1Y9OA 1AUDA 3AODA 1RWVB 2CRLA 2Y0BB 1I94J 3BB5A 1VQ6S 1TFYA 2EFVA 1FO1A 2XNRA 1RT2B 1S76D 2V34A 4ELUA 3Q8RB 4J9LA 4HH0A 2O3DA 4G1QB 2CNNB 3ZO7A 2C42A 3HZEA 3C6TA 4NEYA 2C2NA 3KG4A 3KXDA 1HWKA 2F8MA 2RF2A 4PQUB 2KXNB 2AV5A 3QZ7A 1H38A 3R9LA 2BW2A 3S6EA 3QIDA 3OT9A 3H5YA 3VGTA 3EM1A 4QQBA 4L73A 4JI6F 1XEZA 4I2QB 3Q8PB 3VAKA 1SUQA 1HW9A 1NDPA 3KK1A 2OP5A 3NG8A 2YKNA 2WRMA 3CD0A 2FJBB 3OFEA 2CYYA 1KSPA 3SQGB 5DG7A 4WIIA 1GQEA 4NXNJ 3QT5A 8AT1B 1JLAA 1J2VA 4P2MA 4WTYA 2KJVA 2OSQA 1L5UA 2G0JA 3CJTA 2UV8A 1NK9A 2CQ4A 2V8DA 1UJ5A 2BJDA 4FF3A 1DTTA 3H90A 4LF8J 3W2VB 1U02A 5KFFA 1ZA2B 4K4YA 1FRLA 4PUOA 1B4SA 2A2DA 1Q78A 1RTHA 1C2PA 2EC0A 1VRQC 3R1LA 1WWHA 2HQCA 4WU3A 3I55S 2XYGB 4DFKA 4F04B 1IVZA 4EFAC 4HACA 4M5DB 2W4CA 3M30A 2PA8D 1ZETA 4DPTA 1NJWA 4DV6J 4OYXA 2J76E 2RQKA 1UVMA 3Q24A 1P6TA 4PG5A 1D8YA 3MCOA 2QC3A 3UN5A 1VMBA 3OL7A 2ZWPA 2Y8WA 1SPBP 2OFGX 3UN2A 3HKWA 4HHUA 2DNPA 1S12A 1RKJA 1T9XA 4DX7A 4C3MA 1O8BA 2Y3YA 1B0VA 2ZZMA 3QAEA 3QJJA 1T94A 1EQ0A 2ASJA 5DM7Q 4WFZA 3LGNA 2ZNYA 3MD3A 1PYOB 1SQGA 4U6PA 5A8RA 3ICLA 4K8RA 5B0CA 3C6TB 4NL5A 1RWKB 1PJ5A 1M5PC 2QMWA 4PRFA 4ICLA 3RB6A 2ZH1A 1FRIA 3GJQB 3ISND 1H73A 4A8KA 2VG6A 4K5RA 4DUZF 3M8ZA 3SCJE 4AL6A 1VFJA 1RTIA 2XLJA 2AEFA 2YKNB 4MJKA 1IXKA 1V3SA 3B4MA 4K4VA 2DGUA 2OMOA 3H5SA 5IT4A 3NMRA 4F3QA 2LFVA 1JLAB 1RE1B 1FWKA 3IC1A 2CIMA 4PWWA 3MPVA 4P6QA 2QTWA 1FF2A 4DS5A 4M5GA 1DTTB 3LP2B 1UA1A 5J1PA 4X4NA 3G6XA 5IC6B 1ACMB 4NLDA 1V3RA 3CCES 1EETA 3LTOA 3MEKA 1RTHB 3PR4A 5B0GA 4RBTA 1HBOA 3BBFA 4K7QA 4CLWA 4CO4A 3DYAA 1N5YB 1N33F 2HQ3A 3DI6B 3WIVA 1RA7A 4CLPA 4O0IA 3ENAA 3GR0A 4DDFA 2FHOB 2Z2LA 2ZZNA 4YB1P 2UXCJ 1QAYA 1M5VC 2HWIA 2F7VA 3UD4P 2RJZA 2FZGB 2QL5B 1IWGA 2B8QA 1HARA 5KFTA 4ID8A 2BUNA 5F8LA 4FBUA 1FFWB 3NEKA 4ALZA 3MTKA 3V6KA 5D4OA 1CC7A 1X9MA 2ROEA 2XYPB 2H5JB 3BH6B 5HN0A 4ILMA 2FHJA 3ILJA 3N6LA 4Y00A 2CJQA 3GONA 3TUJC 3MXHP 3GV8B 1NEEA 2QX0A 4CM2A 5A8RB 4NLUA 3K57A 5CCMA 3LQVA 4DSLA 1SBRA 2CJAA 1CVJA 2VODA 4A46A 4ZA1A 4U96A 4WFBQ 2R7RA 1TL4A 2BZ2A 1SH0A 2N3OA 4KO0A 1FTCA 3P45B 3WX8A 4DX8H 2VG6B 5BYQA 4OHZA 3ITHB 1R6VA 1MN9A 1Q8KA 2FHJD 1RTIB 4BDPA 2DEJA 1F9HA 5GMKa 4P52A 2OTLS 1YIJS 4GKKF 1ZTWA 4F36A 1DRZA 3T5JA 3MR2A 2HYIB 4DU8A 4DR1F 3IN5A 4OYIA 2EBEA 1N34F 1ZAXA 2WHOA 4A8YA 3KHGA 2XI2A 3M1VB 4NXNF 1EETB 1HBNA 4OZJA 4ZVEA 1HBOB 2EKNA 2OAUA 1KQFB 4XDCA 1RT1A 2QN6B 4DQPA 3VAJA 3DYAB 6FDRA 2FTRA 3ELHA 4IOBA 2CQ3A 3LGHA 3MM8A 1VJWA 4LF8F 2AYGA 3MPWA 1WKLA 1HBMA 2ZH3A 3MDFA 1FWLA 1VQKS 3PNIA 2RRAA 2CPJA 5K8NA 5A8KA 3HF5A 5KFRA 3W9JA 2YX1A 3R6LB 3GYNA 2MY8A 1WF2A 1WSVA 4OYAA 5M2UA 2QYGA 4FYVB 4URGA 2A10A 2DGXA 1WOOA 1TFWA 4MTPA 3VAMA 3AA8A 1WHVA 3UDCA 3GJTB 1FCAA 2R8JA 4DCPB 1IBKF 2Q6CA 2O1PA 2L41A 2ATLA 5IV4A 5D4NA 4CT8A 2Z56B 2CQ0A 1JXVA 3LH2S 4K2XA 1J5EJ 1D9FA 2HNZA 2W1BA 3DOKA 4KO0B 1QJHA 4IR1A 2V67A 4RUAA 2OTJS 3MR6A 3QJLA 2NXJA 1UAWA 3TI0A 3BDEA 4PG4A 2DYAA 3EXCX 4J5OA 3AHPA 1IKYA 4TKTA 3M2UB 3O3LA 4ZCLA 1RDRA 4WE1B 3ZZ0A 4C3LA 5I3UB 4H4KA 5K8OA 1W25A 2YPZA 1WC4A 2QL7B 1T9YA 2LQJA 3G87A 2C2EA 2MKJA 1GT8A 2D9OA 4UOGA 1Q79A 1RWOB 5HVHA 4QPXA 3M8WA 4KSEB 1F6TA 3E3XA 4XK8C 4NYPA 2EG1A 2E5LJ 2ZOGA 5M2RA 4DG1A 5BYSA 2YKPA 2MQOA 1HBNB 2GQ2A 5CCLA 4RW9A 5KFAA 4ZPDA 2VONA 1BQMA 4NA2A 1RT1B 3OTEA 4P74A 2ZM6J 2ZH9A 1SH3A 3MM8B 9ATCB 1C0TA 1XR5A 1YZ6A 5IS2A 2D69A 3MMJA 4OHVA 1DAXA 1NSAA 4LSLB 1TELA 2VA2A 4FPIA 1HBMB 3GZ7A 4X84A 3CNQP 3W2WB 3P49B 1JIHA 1S9EA 3G6ES 2BOPA 2W2PP 3BBCA 3OTCA 3P6YC 2XZTB 1WG4A 4MKYA 4C48A 3LAKA 4NLVA 4ZPVR 3GTYX 1RYRA 2UXCF 1TV6A 2LLZA 3CD5A 2DISA 4QWDA 1SKUB 5E0OA 6FD1A 4ZPBA 4B3TJ 2VU5A 3ZXWA 1SL2A 2VPYB 3FCVA 4DR3J 2OH2A 1ZM9A 1ITPA 4KJIA 2C3PA 1SJ4P 1TP7A 2PFFB 3J7YI 1WOSA 1MWQA 2OD6A 2HNZB 2HBQB 5B09A 3PFEA 4F0HA 2DNYA 4KY3A 2N4CA 1HI1A 3SBMA 2GJIA 2DH9A 2KFZA 1DTQB 3QRRA 4Y2CA 4B9UA 1FK9A 1IKYB 1ZZNA 4A8FA 3DXSX 1RAEB 1FT8A 3CJ8A 1H7XA 2NXEA 2V69A 1H6KX 4NXMJ 3PJXA 3DGPB 3OVAA 3RGIA 2H51B 4EBDA 5B0BA 4B3RJ 2PEBA 4OX6A 3HX9A 3M8QA 1UFKA 4RJVA 2R8IA 3KUHA 4WP9A 4GKJJ 4O3OA 2VOOA 5B7WA 1TK8A 3MCMA 4ECYA 4DG1B 2ACMA 1Y5NB 3F44A 3MOZA 1NAQA 4F4ZA 3DFEA 4RW9B 3KG1A 4WK3A 4ECUA 1KLMB 3KLHA 1BQMB 1S57A 2OPSA 3LWMA 5EX3A 4OX9J 2VD3A 4IG0B 1JKHA 4HYKA 3O5TB 1W2BR 1KBRA 3PW2A 4ZVQB 3QPIA 1GK8A 3ZC4A 1BE4A 2R8KA 4WZQA 4OL8A 1S9EB 2RDIA 3TAMA 3CB4A 3KYLA 4YEAA 4X4PA 2W7AA 3UVJA 2AZ3A 4FYYB 3CCLS 5LSRA 4MYUA 1TV6B 4QWAA 1Y5IB 2N7YA 1RBAA 5CYMA 3DHXA 2XI3A 4RBUA 1HR0F 4BCAA 4GO7X 4CO3A 3KJFB 2VC1A 5GAHU 3TRGA 2BJ8A 4RNHA 4EO6A 3BYRA 1SL0A 4B9TA 2MSTA 1KKHA 3NAHA 3R7BB 2EFPA 2AX0A 3CJ5A 1DURA 2A0FB 3VQTA 1N5TA 5J1EB 2MLXA 2M52A 2FHKA 1FK9B 5L9XA 5E5NA 1R8CA 3N5BA 4F50A 2PIIA 1T03B 1U49A 4K2JA 3JSYA 3MFHA 3FZBA 1IR1A 4B3SJ 1FEEA 2XSFA 5FD1A 2BX6A 4EGLA 4ECZA 3RRGA 4MH8A 3ILOA 3QRPA 3SSSA 3HO1A 5DG8A 2GAGC 4USUA 2ASLA 1VJQA 2HURA 1B0PA 3O8WA 4G1PA 1TR0A 2VH7A 1VR6A 1RHQB 3KLHB 2OPSB 3A8KA 3AT1B 2E1AA 3HVRA 4V19J 3LGMA 2B4VA 2C3YA 5T7LA 4CQ1A 5C42A 1JKHB 1WC3A 3T5HA 2E5LF 4LBHA 3PJ9A 3ZZZA 3GYGA 3H59A 2V8PA 1WTFA 3GV7B 1PG5B 4OQJA 2ZM6F 1J5OA 4BWMA 1B7YB 3TAMB 4GMKA 1X9SA 4O0NA 4B9NA 3C2PA 3UVJB 3ZNJ1 1HQUA 3J7ZT 1SV5A 1UPPA 2EK1A 3CJSA 1KLNA 2H54B 2HIYA 2GS8A 2KFYA 3DM2B 2HGLA 1LNQA 2P9EA 3OR1A 3N6NA 3RJMB 1YITS 3W62A 2XHWA 4USIA 4O23A 4LF7J 3LF0A 4TQRA 3D68A 4NLOA 2IDEA 1IM4A 1R0AB 1SC6A 4USTA 2WB1D 4DR3F 4HH1A 1U47A 5KT2A 3JQJA 3M9OB 2YX7A 4J9NA 1Q5VA 5FDLA 1ZYQA 3BSCA 4EYHB 2WVDA 4NRTA 3D67A 1PKUA 3VAIA 2EEYA 2XCAA 3HK2A 1PJ7A 5HP1B 3BH7B 3BSNA 1BWEA 3CXCR 1MMLA 4TU8A 2CPHA 2HFUA 3HHKA 4CH7A 2AJ2A 2GZOA 5KT4A 1UEKA 3EZUA 3QIPA 4NXMF 2MHNA 3FC9A 1FFSB 1R0BG 2ZC4A 2ATCB 2DB1A 2CNLB 2L48A 2GHVC 3VQSA 3RB3A 2DNNA 1KVIA 2J7KA 5T7LB 5C42B 2VBYA 4GKJF 3DMJA 3I0SB 2DNZA 3AFGA 4RNOA 2IC3A 1OMSA 3ZZUA 2O66A 3EGWB 2HPUA 3CWJA 1LW0A 3JTOA 2B9XA 3PCOB 2C1EB 4CIOA 1OS5A 2VQFJ 3PDNA 1KRPA 2HQFA 1VQ9S 2CUYA 2Y0SD 1TMJA 1YRXA 1CEZA 2NPIA 2LQ5A 1J5OB 1NHVA 4TYAA 5THWA 2JC0A 3T1YF 3SZ2A 4NLPA 5HVGA 4RUHA 4DV1J 3QT6A 1LWCA 3PX4A 2F4VJ 1TU0B 2OI2A 1SV5B 3MAAA 4X4RA 3QBCA 3GCXP 2YNGB 3IXQA 4U7UK 5DRKA 2WBMA 2QE5A 4USJC 3OR1B 2BDPA 4K0KJ 4C8KA 4RW8A 3P8BB 5E2QA 8ATCB 3QGGA 3KFWX 4JI2F 1VQOS 2V8VA 1R31A 2UXDF 3D0GE 1TAUA 5DM6Q 3OJUA 3TZZA 2HHHJ 1NK0A 1QLNA 1WHYA 1R8BA 3P4UB 3THTA 3TQ1A 2UUCJ 4NYZA 3IR5B 4DR7J 3TANA 4FP9A 5FDLB 2ILZA 5L39A 2OLWA 3PRVA 3NNAA 4DPOA 1HW8A 1N0VC 3AY0A 1FDAA 4DSKA 2FPHX 3D1QA 4BS2A 3Q8YA 3T6BA 2ZH4A 4FVMA 1I3OB 5D0EA 3QIPB 1JWWA 1N48A 5J2NB 3NS6A 2GO9A 1NDLA 3QWUA 3T5LA 2BJ9A 3H25A 1VQMS 4NEZA 2FLOA 1H3DA 1A6LA 3RBEA 4J9SA 3DMJB 4A8QA 3OVBA 3EWGA 2YH1A 2IC3B 3IBFB 4ZVSB 3JTPA 1VBZA 2E7WA 4W4MA 1LW0B 1RCXB 5L1LA 5JVGQ 3NCPA 1UEVA 1AZSB 4OYPA 3H2VE 2MKYA 2ZHOA 3BDPA 1FDDA 1LWCB 1APSA 3AXKA 2DTJA 2H9ZA 1UVNA 4WWSA 3R5AA 1WEXA 3AJ1A 3CMAS 1U1KA 1I6JA 1Z4UA 1VK8A 4ZP7A 3MEDA 3FGVA 4ZCIA 3DHWC 4RUCA 2HMIB 3CCZA 1GX5A 1YJUA 2WW8A 3TJ8A 5LSOA 5KFEA 5A6WA 5M2PA 1JLCA 4ED6A 4X65J 3CW2C 3LP0A 1RHUB 2DGQA 5F8NA 1SIWB 2Z2MA 4RW8B 4I64A 3MUVP 3KNGA 2M70A 4ED8A 3W7BA 3PX6A 3GIRA 2C3MA 3VTIA 3FBFA 2NREA 2XWYA 1M5KC 2Y1JA 2P6SA 2YQ0A 2ZH6A 4ED2A 3RAQA 1WTBA 3D28A 1KC8T 3GIKA 2NLWA 1S59A 4YR3A 3NRBA 1LWFA 2P2CB 3CDBA 2CNKB 4LF7F 1MLAA 2OPQA 5KFKA 2DITA 3PIPQ 2ZDOA 2YWFA 4DS4A 2DIVA 3MCNA 4EUVA 3L7UA 2KKHA 1NH7A 3GU0A 3MR5A 1HNZJ 2V68A 4ZVFA 4B3OB 3BSAA 3NP5A 1FJCA 1ELOA 3KLVA 4I7FA 1EHWA 4ZS6A 2PI4A 1TUGB 2DY9A 3HHLA 4P71A 3JTNA 4GVBB 1RHJB 3NL0A 5F9NA 2VHGA 2C2OB 4IKAA 3PEJA 1RWNB 4QPTA 2EC2A 3BJYA 2DD8S 2BBEA 3GYXB 1G1XA 3H0PA 3VVUA 5GADI 2PGCA 5CD4A 1M1KT 4MMOA 2HAFA 3T5KA 3PKYA 2DNKA 4EEYA 4WKRA 1VLOA 4ZP6A 3HHLD 2C2DA 3GE9A 2APOA 1HA1A 2QMXA 4RWWA 3HXMA 2J0XA 2BANA 4AQYJ 2MSSA 1DLOA 4NLYA 1C1CA 1F60B 3OD2A 2Q1LA 3SIPB 4FF1A 2BKOA 5ITHA 2HHSA 1M1HA 5HANA 3IAS9 4DV1F 2QJ3A 2HLTA 1JLCB 3MAQA 2W8LA 4E0DA 2F4VF 3FUYA 3LP0B 3VCDA 2H4YB 3OJSA 1WDDA 3X3UA 2FJEB 4FYWB 3TZWA 1MU2A 2B4PA 4V19X 4C8NA 4X4SA 2KT2A 2H3EB 2X1FA 2BKPA 2XEXA 4YS2A 2FVQA 3HDSA 4UT4A 5KFYA 3M9MB 2NPFA 1LWFB 5AXKA 4ELTA 2QZ8A 3UPFA 1TL7A 2FDNA 5HSPA 3CCUS 5KFDA 2KYXA 2WSEC 1LV5A 4B9SA 3BKFA 2EXUA 2HHHF 2HHUA 4I7FB 3R5JB 1WC5A 4XPCA 1QSSA 4W92B 3M05A 2V6AA 1RXOB 2UUCF 5F3ZA 2YXLA 1L3VA 1HI8A 2LDIA 4OI6A 2HWTA 4WZMA 3U1LA 3PO5A 3CJ2A 5JUMA 2I0XA 3NS5A 4HVZA 1XMOJ 4MKVA 3TEGA 5HQ8A 2YNFA 3QGHA 1HNWF 2QGFB 4LIWA 4ZMMA 3CMES 3MUTP 4PAAA 2RUSA 4DV2F 4NPOA 4PYAA 1GTHA 1A0OB 4ETXA 3D3BJ 3S01A 4ZVHA 2BE2A 4Y2KA 4DPUA 3TARA 1P27B 4U8VA 3ZZOA 3X1LB 2J0SD 2BANB 2HHVA 1DLOB 5KT7A 2I9SA 4AYBD 1C1CB 2HS0A 2K3IA 2HAIA 4JI7F 1URRA 3UW1A 4ES1A 1EP4A 2GIRA 4ZVTB 1MWYA 2ZH2A 4LRDA 3ET6B 4C0BA 1IUJA 3LUYA 3SCIE 1U24A 2AJ4A 5JVHQ 1U8SA 4ZCKA 3NCQA 5EGYA 4LVNP 1DQ8A 1FTRA 1IQTA 2MZSA 1H72C 1HNXF 2M9KA 1UWBA 4DXLA 3Q0AA 4DV4J 1ZOTA 1OY9A 3EVOA 5A76A 2UVRA 3PG9A 4C11B 1LWXA 2DNQA 1XMQJ 4YB6A 1NUEA 2RT3A 2WZ1A 4YY3J 3K5MA 2LVWA 2KB2A 3F56A 5LM7E 2X1AA 5ADZA 1HYSA 5L46A 4PG7A 2F8EX 3C19A 1Y7PA 2O01C 4KT0C 1KEKA 4KC5A 4PWDB 3QRQA 3M32A 1X4BA 1BQNA 5KFBA 3A8IA 1HI0P 2VBZA 2EK6A 4B9VA 2R9LA 3DNCA 5I3QA 3R6GB 4ZIWA 5BR8F 5AJ3J 4R8UB 2V9KA 1Q86T 5MAOA 1NMEB 2ZVSA 1E6YA 4C8ZA 3KJQB 2ZDPA 5CZXA 4OI0A 4DV0J 1RTJA 1UP1A 3GMGA 4CO2A 1S79A 1GXUA 3ETOA 5ETNA 2OIHA 4USMA 5HQMA 1REVA 4LF1A 2W2QP 3QSIA 4J7CA 3BKTA 4DUYJ 4M5IA 3HFZB 4DSFA 4ECWA 2ABYA 3FK4A 1NJXA 3K7RA 5RUBA 3CC7S 4YB7A 1BXNA 3V6DB 3H5UA 2HZVA 2AYMA 3NGUA 2M5YA 3SCLE 2RS2A 3EDRB 4LFAF 5KT5A 3G8SA 2VJUA 3RRHA 3C3LA 2LP4A 1EP4B 5KFNA 2HHTA 3QFWA 3G2XA 1WG1A 2WVFA 1OO0B 3VF0B 3CIZA 5LXRA 1NK5A 4FS1A 3PEHA 5KTQA 3KMQA 3CSKA 3TX0A 2P9CA 2G9OA 1YJVA 4L72B 5KFPA 2NQPA 1UWBB 1VQ5S 4DV3F 2W8KA 1GMVA 3E2EA 1TTHB 2KT5A 1U45A 3UDLA 5HATA 3FMWA 4ANCA 1NK6A 3HM9A 2F40A 1Q82T 3TNVA 2BMBA 3H98A 1ZZFA 2XO6A 4P75A 1ZM3A 4FYXB 3G8TA 3U7JA 1HYSB 2YKQA 1V9OA 3I4PA 5D15A 1JLBA 1W7WA 1JJCB 1BQNB 1RISA 3PR5B 3TAQA 2Z2ZA 5DQGA 1RAHB 3Q89A 5F41A 4PEOA 3FNNA 2VG5B 7FDRA 3VAGA 3NCRA 1OJ4A 3P5BP 2B0GA 1QUVA 1YJ7A 3ISZA 4OIXA 3TW0A 5LMNF 1D1UA 3W8PA 1CLFA 4UZCA 1RACB 2AWZA 1RTJB 3PYEA 2R7QA 4LFBJ 3QO9A 3GP9A 3W65A 3OQ2A 1REVB 5L9NA 3K5OA 4ES2A 2RD5C 5JJBA 2KN4A 4LSNA 2HHQA 1NSPA 1CULA 3MEEA 3HSZA 4H4MB 3IG1A 2E7VA 4N47A 3QWPA 2FUG9 1VQYA 2KM8C 2FGCA 1K44A 1QUPA 2ZHBA 4LBIA 4EWTA 4N76A 2KT3A 2KJWA 4MKAA 3HHEA 4QIWD 3C16A 3H40A 2IHR1 1D8ZA 2CPFA 1YI2S 1QAJA 4YQWA 2M7SA 1RCOB 4PQAA 1YQHA 3KHRA 1ZA1B 2CQCA 4I4BA 3CPWR 5HLFA 2PN6A 1KOHA 3UNGC 3O1LA 2VJVA 4LFCJ 2V2KA 4YMEA 1DY3A 5D78A 4NCAA 2BV3A 3JSBA 4DL2A 4RKUC 2A2CA 3CCTA 3CCWA 2YY3A 3D6FB 2J7UA 3BREA 3UWTA 2DO4A 2U1AA 3UDVA 5DLFA 5DETA 1MW7A 1N5VA 1RKIA 3SDEA 4OI1A 2B43A 1VQ4S 8RUCA 3JYTA 2FLNA 4UTGA 2UVVA 2PI5A 1RHRB 4KR0B 3GG1A 3GR1A 1RT3A 1PILA 4JUZA 4D3GA 2HHXA 1NJYA 1V5IB 2PA3A 3DRXA 3TZYA 1S9FA 3K5NA 1YTYA 1JXEA 4FXVA 2X1BA 1SQFA 1XR6A 1XMQF 3D6HB 4WFXA 1BUXA 3HLUA 3QNWB 2FY1A 4IUFA 2E5HA 4W90B 1FRMA 3M6VA 1JK9B 1DQAA 4CTAB 4IG3A 1HWIA 2Z4PA 2OJ3A 2CVIA 2XTJP 1KHWA 1UWAA 1X0FA 4LMZA 3W5XA 4A4JA 2E5IA 2EWHA 5ETVA 4WCEQ 3QO9B 4NA1A 2OPRA 5KT3A 3M6XA 1NO8A 3S7RA 5J2PA 4LSNB 2YKMB 1CULB 3MEEB 4B08A 1FJEB 5IZHA 1X4GA 1X4DA 1PAUB 2AMCB 4M5NA 4TY8A 2VV5A 4DV0F 4OYZA 4LF4J 2ZBQA 5D6GA 2ZC3A 2XY5A 3MFIA 2UP1A 1H98A 1N88A 4OZ1A 2VQEJ 4JI8J 3C16B 3I87A 2N7CA 1RT4A 4DUYF 1FESA 4L6V3 2HQIA 4LJMA 1OWXA 1U6ZA 3J7YU 3UCUP 4ZP9A 1E6VA 5C24A 5ETSA 4OZNA 4CWBA 1R6YA 3TX8A 4DCOB 4K4XA 4S0MA 3HHNB 2P6TA 2OUGA 3RRKA 3BBBA 1D09B 2CA9A 2DHAA 3HD1A 1TMMA 5DLGA 1RWPB 2OMLA 3RAXA 3GFZA 5LOQA 1IBLJ 2ROGA 4J9RA 1GAOA 1NK4A 1O5JA 5HAOA 3F73A 3CMQA 4ZVGA 4BHQA 1KQSR 4AXIA 2GV1A 3JSRA 1ZM4A 4WP8A 3SDEB 2EBGA 3CD7A 4O4RA 3JYTB 4HDGA 5HROA 1SKWA 1YWXA 1D3WA 1YJRA 5KG4A 2ZBIA 5IQ6A 1RT3B 4QYZK 2K3KA 1C0UA 1EB0A 3HKZD 3M9NB 1VRTA 3HZGA 3WC0A 2BM1A 4KHRA 1WKKA 3IWXA 2ROPA 2YNHB 2P9GA 3CCSS 2B7CB 4DR4J 3BO4A 2CPEA 1S72S 4ZN3A 1OIAA 5CZVA 4HI2A 4XDDA 4I2PA 4UUXA 5L1JA 2OPPA 1RAFB 3AH6A 3HT3A 3B6BA 2RRBA 3PYFA 1RTDB 4OYWA 5AXNA 3OUYA 3NKYA 4H4OA 1FFGB 2CG8A 4ED5A 3B4DA 4CI0B 1ROFA 3FDSA 4ZPCA 2IMWP 4KH0B 4ZPWR 3I32A 1SJRA 2OPRB 1WD6A 2RU9A 1QTNB 2LXIA 4NMLA 5J2PB 3CJRA 2OKQA 1YRTA 4IH5A 3NLCA 4NLQA 3KJNB 1Q8IA 4C97A 2ZH8A 1BC6A 1B70B 1LK7A 1EJ7L 1WHWA 5ETKA 2FJDB 4LFBF 4FPRA 2AF6A 4KQZA 1LWEA 2DCLA 1SC3B 3PYGA 4TN2A 1R8HA 1V5VA 2IM2A 1X4CA 1M5OC 3TWZA 1VGYA 2GMHA 2VUGA 2MQMA 3UO0A 3D3CJ 4ILLA 2AEJA 4RW6A 3KLIA 1FX4A 3LANA 1E6VB 3UFCX 5GMDA 4DV5J 2JEJA 5LJ3Y 3AOAA 1CQMA 4WF9Q 5FLXU 2HGNA 1TK5A 3MM7A 2UUBF 4BC7A 4I6YA 2X3GA 1U1PA 1KFDA 1K1QA 3KHHA 2PC6A 5SUHA 2FYXA 2DBBA 1XWLA 2M0GB 1UVJA 1VQ7S 1FKPA 3W8GA 3CO9A 3MCSA 4HT5A 1QDUB 3VWSA 1N6QB 5E3AA 3FFIA 3C14A 4PYDA 2GVZA 4LBPA 1FHTA 3R97A 3O2IA 4XPEA 1C0UB 3CJKA 2EFGA 3ILIA 2WONB 4ANEA 1VRTB 1CJTA 5KFUA 4QJVA 3SMZA 2N3LA 4LRFA 4F4WA 2R2TA 1G4CA 1D9AA 4MIBA 4ZDNA 4JYAF 5KFIA 2FZCB 3CCQS 1VBKA 2IVMA 1KVKA 1YLXA 3DC2A 3G4SS 2RAQA 4M5HA 2ZBRA 2OPPB 4Q43A 3BEGB 4LF9F 4H4OB 4OMFG 2ERRA 1FDBA 3FMBA 5A0YA 2Y1RI 3QZ8A 1JLQA 4AL7A 2BJ1A 4IO1A 3DOLA 3G96A 3BR9A 3FEZA 2VFTA 1YHQS 4K5SA 1VHIA 2LA6A 2IRYA 1YJNS 2VDIA 2D3ZA 2IMOA 4DF4A 2JLEA 1HPZA 4OX8A 3VZIA 3HI9A 1Y10A 1R89A 4DF8A 2JL9A 1JLGA 1P1TA 3KLIB 1VCTA 2MQLA 2XNQA 2R8GA 1PC5A 4OZLA 4RR5A 2MZQA 2J9DE 1T3OA 2AEMA 2QSFA 3Q23A 4I1TA 4KGMA 2HQDA 4JI5F 3V6JA 3FQLA 3EVWA 3MM7B 2BOAA 5EWGA 2NSCA 3EDQB 3H4DA 2LYVA 4IOCQ 4NCGA 4JI8F 1L3KA 1TZ0A 1KTVA 5KG2A 2QFIA 3ZTSA 4FN5A 2WW4A 1IR2A 1T9WA 4KE5A 1UETA 2Q79A 2HVDA 4G65A 1OSDA 3NGKA 3MM9B 4MK8A 3CJQA 1FKPB 2GQQA 1GFWB 1Z1ZA 2DNRA 4C4WA 5JMNA 1RZMA 3KLEB 3WDOA 3C14B 2B56A 1IKWA 4DPXA 2GVZB 3PW7A 2CPXA 2KU7A 4KHPJ 5KFJA 3K8VA 3I0RA 4HTIA 3CJKB 3G6YA 1HD1A 1CJTB 3MR7A 3A1YG 5LJ5Y 5HMZA 4C98A 5I42A 2K8GA 2CZ4A 2EI5A 3FBEA 5K20B 4BWJA 3A8JA 2E44A 4YUDA 5A2QY 2PDAA 1FXRA 1LQ9A 1N36J 2IBKA 1C4AA 3BSOA 2N4DA 3DDIA 2M8DB 3MF5A 1JMTA 4DFPA 1HHTP 2IRUA 5C25B 3POTA 1HWJA 2AU0A 4JP8A 5KFOA 3DXBA 3OFGA 1JLQB 4PCQA 3S1TA 2XB2D 1UVKA 1GXTA 4O3NA 5IXUA 4DR2J 1HMVB 2IYIA 3N0VA 4ELVA 2OEMA 4ECSA 3AOCA 3OSNA 4C8LA 3I4HX 1PBUA 3PJWA 1HPZB 4JV5J 5CQGA 2R7TA 3GFHA 4LF5J 1JLGB 2V4JA 4J9OA 2VZ9A 1F2GA 2LU1A 3GCWP 1LEOA 1HQEA 4LVOP 1T9VA 4P2FA 3KDNA 1XR7A 2RF2B 4DR5F 2BQ3A 4J9MA 2XMWA 2PD1A 2OEJA 4UY8T 2QA2A 4NCGB 4DZ6A 5GAGI 5DDPC 2UUAJ 1TKXA 2HS3A 5E41A 1T8EA 3QFHA 3EXYA 1YDLA 2CDRB 1UL3A 3ADAC 2FJWA 1SUQB 3BM7A 1M1GA 3KK1B 3NXZA 4DV5F 4C6AA 3MTJA 2J7WA 5KFLA 1X5OA 3GILA 5HL7Q 4YR2A 3ONQA 5ETRA 3QATA 2FJXA 2K7KA 1IKWB 1I51B 1HFEL 2NXNA 2LU2A 3P5TL 3SCKE 5LMUJ 3I0RB 2Y1IA 1G3OA 4L75A 5H9FK 1R7IA 5EHHA 2QIFA 4ZITA 4IQXA 2MY7A 2EFOA 2RU3A 4PUOB 3H7HB 1RAJA 4ZJOA 1VQNS 2HBZB 1VHFA 4LREA 2B51A 2C2ZB 3TJ9A 4FVCA 5C2CA 4J9VA 1IM6A 1RTZA 3L7PA 4NE9C 4HACB 3I5AA 3POTB 2KZZA 2B6AA 3M30B 4U9RA 2I6WA 2FZKB 4EZ9A 2BE9B 2HNDA 4ECXA 3M2RA 1YGYA 2B4UA 1ZH5A 4A8WA 5G0RA 3N01A 3JQKA 2V2ZA 1TL3A 2XMJA 2NUUG 4LQ9A 3PHTA 4R0EA 2LCWA 3J81U 3UNYA 1IWAA 2B9WA 1REGX 1RT7A 1SJ1A 3FSXA 3OLAA 4JOUA 2R4FA 2XQCA 2FJAB 1XK8A 3N5FA 1RWWB 3I96A 1KDNA 4HR2A 4RL1A 1NJZA 4FS2A 3ILLA 5KFMA 1CG2A 3GWCA 5L8RC 4ZVOB 3KK2A 2V4JB 3T1AA 4DR6F 2V2VA 3I9ZA 2NCKL 3BO2A 2CQIA 2QSWA 1F3VA 1SXLA 3LPYA 3Q8UA 2V4QA 2MQQA 3HSDA 1I94F 4ICLB 3OR2A 4Q8EA 1TKXB 4OV6A 4AUKA 2FVSA 2CQDA 2WVBA 4NZ6A 4LF6J 3L09A 4Q0BA 3GLJA 2GHWA 1CS4A 2DXDA 4NA3A 1Q8BA 2AJQA 4KGXB 3EJMA 1WI6A 2K1RA 3D6MB 3LO3A 3DOMA 2R7OA 4JBCA 2DR6A 2FB0A 1XJWB 1BY9A 2Y1LB 5HJXA 5J1NA 1DQ9A 3OTOJ 2OFHX 4J9UE 1NCLA 4RZRA 2HFNA 2FLPA 4BC9A 3G71S 5GADU 1NXIA 2K7JA 5KFHA 3ZZRA 2X51A 2QA4S 1EIYB 1DFDA 1KTQA 1RT5A 1JJHA 1RAAB 3NGRA 3I5CA 4OYOA 2JWNA 3H42A 4DBQA 3BR8A 2AD9A 3DU6A 1N32J 4TYBA 4J9QA 4QU6A 5IFMA 2MKHA 2HNDB 2AGOA 1N36F 2SXLA 5G0RB 5CD4H 4CZCA 2YPYA 1TL3B 1RWUA 3EZOA 2DR8A 3I5BA 3MPYA 2ZJPQ 3OHAA 4Y0FA 4PZVA 3FQKA 2EFQA 4MIAA 5HO4A 1NDCA 4HL9A 4DV6F 3OVSA 3LOUA 4FF2A 4QIEA 4ID5A 2MKCA 2UU9J 4IFYA 4KHMA 2UUWA 5IV3A 1HL6A 3KK2B 1KS2A 1MSWD 5EWFA 2CG4A 4WXOA 3W1YC 4GO5X 2KRBA 3OHBA 5LSLA 2Q6BA 2MKIA 1S1VA 5L1IA 1K9MT 3OR2B 4NOHA 4JV5F 1VQLS 4CRJA 3HJFA 1RYSA 4JI1J 2R7XA 3AD7C 3DKDA 4LF5F 3UI3A 3UCZP 1M0SA 4J9KA 2F9JA 5AE3A 5HI7A 3OXFA 2UXBJ 1QE1A 2G1DA 4Q0BB 6AT1B 4DX5A 1UPMB 2XBPA 2K1RB 2UUAF 3BKUA 1NLKL 3DOMB 3H8YA 2HKEA 1KNZA 2B9EA 3KWMA 1U8WA 2GAHC 3THPA 3W64A 4CLKA 4USHA 2A6OA 4ECQA 3MM6A 2B9YA 1VRUA 2PMWA 3TUIC 2LECA 1S1XA 2YWWA 4F4XA 3W9IA 1U6BA 1RSCA 2KFNA 3HP6A 5FLXY 2VBWA 4ZLPA 1UA0A 3R3TA 1YJ9S 1RT5B 3QYYA 2RSQA 2GO8A 1NKBA 3OW2R 4CDIA 2DJWA 4USVA 3AD9C 3LWLA 5D4LA 1Y5LB 2NXCA 2AQ4A 1XTZA 4YR0A 2AP6A 1D0EA 3RR8A 3B54A 5A8KB 1ZBTA 5L38A 2VL1A 4K4WA 4U8YA 1K1SA 2R7VA 2RQ4A 1RU2A 1LKZA 1WC6A 2DT9A 3NOCA 5ETTA 4CCHA 4OFZA 3F41A 2CPIA 4ID5B 4B9MA 2PEHA 4IFYB 4JI6J 1OYEA 3MGJA 1HWUA 4PXBA 1KN6A 3I6PA 1UFLA 1L3UA 2D3OR 2EVZA 2ZD1A 5AXMA 2U2FA 2BACA 3HULA 1S1UA 3DN9A 2HVZA 2X3DA 3DOKB 3KDOA 2DRBA 4DZDA 2HSEB 5CABA 1H74A 3ULHA 5KAKA 2JHEA 1QE1B 2G2OA 5BXIA 2HFOA 3D7SB 2FC8A 3IRXA 2KG0A 1FE4A 4X62J 3I9V9 3SXLA 1N5QA 4UF4A 4R0JA 4QCLA 2HQGA 5AT1B 3Q2SC 4ZN1A 2A6MA 2LXUA 5KFWA 3LP1A 1YBUA 4ETZA 2F8HA 4H54A 4CO5A 1BWVA 3MM6B 4IQMA 1VRUB 3TOQA 3EVMA 1X0PA 1U0SA 2ILYA 2R7WA 3K17A 3PXGa 1NJIT 2BW7A 2DR5A 2FVPA 1ZS6A 3GV5B 2IAJA 5DZ7A 4B3MJ 1C0TB 3U27A 4QZVB 1WNEA 1WDTA 3O44A 1HIYA 1GX6A 5DS7A 1U2FA 2DXEA 3RW7A 1NSQA 3CF5Q 2XLKA 1RLDA 1X8DA 1F5AA 1X5SA 1PYSB 3Q8SB 4DQQA 3EUNA 1U7LA 3OSPA 1PCAA 1N32F 1Q1KA 1RT2A 4DUZJ 4EK2A 3VAFA 2YX4A 4CO0A 3HD2A 4C2MA 4DWIA 1OQ6A 4UOCA 1T0TV 1VC6A 3MR3A 3BGRA 4JV2A 1FE0A 1BHNA 3CEDA 4PQUA 1HNVA 2YTCA 3SYZA 2D7SA 2JRSA 1NHUA 1YKWA 2ZD1B 1PGZA 3RZAA 1NZAA 3K89A 4K4UA 3R27A 3KUGA 2W01A 5EN1A 2Q66A 1TUVA 4EMDA 3V5RA 3WBZA 2IPOB 5J2QA 5D4PA 3PYDA 3TO8A 2AW0A 4OI3A 1JLFA 2OD4A 4Z7YA 1F2HA 3E51A 2RQCA 5E7OB 1J5EF 1SH2A 4DN9A 4K4TA 3THVA 4DFMA 3Q22A 1X4FA 2RDJA 1QD1A 4P2XA 4G1IA 2XZWA 2DNHA 3R5BA 3MMCA 3W2VA 3RUBL 2VOPA 2DCUB 3M8QB 2BJEA 2BRKA 4IH6A 1TKTA 3SI8A 3EX7B 5EUHA 2AKWB 1R8AA 2HFVA 5IM0A 2ZUGA 3KOAA 3TYTA 1UW9A 2OSRA 2N82B 2BQUA 3IO1A 4KV8A 1WC0A 5DO2A 2IAJB 3PW5A 2LMIA 4TXSA 2H5IB 4KB7A 4FXDA 2ADCA 2RHSB 2WSCC 1NKCA 4P7VA 2K2PA 3IM9A 1QAIA 4KPYA 3UD3P 4UW2A 4Y28C 3QT7A 3G86A 3I31A 4A47A 5L1KA 2MQ8A 4M5KA 3BQ0A 4ENOA 1FRXA 2JOQA 2Z57B 5GAEI 2C28A 3BGLA 1UEUA 2Z0GA 3I56S 2JEGA 4EZ6A 4ZPTR 2XHCA 4LQ3A 5CYMB 4ED7A 3BGRB 3OL6A 3WQPA 1RP5A 1RHMB 1HNVB 5KOXA 4QR1A 5A8WA 4WPAA 2IVYA 4GKKJ 2IRXA 1Y3KA 2DPJA 3GQCA 4IRKA 2GVDA 1T02A 4F4YA 4LF2A 2ZOFA 4RO0A 2E1CA 4ECTA 4DR1J 5I3PA 3CC4S 2G2YA 2V0NA 3J80U 2FGOA 4B3TF 1FEHA 1N34J 1VDHA 3IGVA 5J2QB 2RE1A 1SQEA 4UY85 5F0UA 1JB0C 1JLFB 4ZIVA 4FDFA 3J81Y 1RK8A 5DDRC 3CJ0A 1AFIA 4LRBA 3A3OB 2B3TB 2GFFA 3HT0A 1URNA 2H5EA 2W7PA 1XC9A 1NHKL 2CQ2A 3LP2A 4CNYA 3ENQA 1AROP 4AXJA 3MMCB 2XS5A 2QA1A 4A8OA 4DL6A 1TKTB 2HZAA 4OLOA 1S4FA 2F3JA 3JSMA 2VB6A 3IAM9 2IDLA 4X62F 1FXLA 2LEPA 4XIUA 3HJVA 5IM0B 2KG1A 1N5YA 2GNKA 3RTVA 3DI6A 5AE2A 4B3RF 2QA4G 4F7VA 3SFGA 3C6UA 1O0PA 3K5PA 2MZTA 4KV8B 4CLSA 4ERDA 3PRDA 1KD1T 2HG4A 1IKXA 2DNLA 1UVLA 1U2RA 3N6MA 3PX0A 1N5SA 1IBKJ 3HVTA 1FX2A 3BO3A 1CQNA 3CVKA 1Z2LA 3R8YA 4OX9F 2AJ0A 4UQGA 2L08A 1IQZA 2B7BB 3SV3A 1RGVA 4B3MF 3T9NA 4C0HA 2KI2A 2CNOB 2W9BA 2QRRA 4CH1A 2NZ4A 4Z7CA 7FD1A 1HQUB 5B08A 3T19A 2BVZA 3D2WA 3QLHA 1A7GE 2CDQA 3R2DJ 1U25A 3CJ3A 1JNZB 3PHEA 3A3NB 5A8WB 2DH8A 2LQBA 1OYDA 2GVDB 4DQIA 3M8PA 4IDKA 1HHSA 3ITHA 2HVIA 2DH7A 4YOEA 2EKYA 2LQ9A 3TQEA 4PXCA 3W5ZA 2HBRB 1VC0A 3GFYA 3MMAA 3ZTRA 3UQSA 1PAEX 2QL9B 3M6UA 3GB0A 1LOUA 2B5JA 3AB2B 3H20A 2R42A 3ZTOA 5IT9U 2WB4A 1Y4ZB 2POKA 4DV7J 2KO1A 1FXDA 3Q8QB 2E66A 1S1TA 3DLGA 1P9YA 1SIZA 3VVTA 2XSJA 3DRRA 3QSYB 2DGTA 4DSJA 2Q43A 2A3JA 3KNAA 4ZLJA 4Y2AA 3M1VA 4NWBA 1QAXA 4Q45A 3OV7A 2XY7A 3TA1A 2V63A 1TKZA 3JSMB 1Y0HA 4JV1A 4DPYA 1XNQJ 4ZP8A 4DQSA 4B3SF 4CT9A 2ZBCA 2IY5B 1X31C 3C6UB 5F8JA 5HQLA 5E3PA 1IKXB 3Q2TC 4K59A 4J91A 2VICA 1BD6A 3HVTB 3PY8A 2EPIA 2CQGA 2EW9A 2QFJA 3MUMP 3Q83A 2CJXB 3DLEA 5F8IA 2V4RA 1RQ0A 3N4WA 1TL1A 2V8HA 1L3SA 4DL3A 2YKAA 2XMAA 1AXQA 2W9BB 3W9HA 2JDJA 3MAAB 3WIUA 1EKRA 3QLHB 1K0VA 3MM5A 5IT0A 3IR6B 3TA0A 3FRZA 4AFFA 2WVCA 3G8QA 5ETOA 1H2VZ 4M63A 2C3OA 1U4BA 3M8PB 2MEWA 2DGOA 4IDKB 2R2SA 2MQNA 2CWKA 2YWHA 3NS7B 2KVQE 4MKBA 4P72A 1HLWA 1I1GA 5K14A 3M2UA 3MMAB 4TU7A 4WE1A 5I3UA 2ZJRQ 1IJFB 1YSJA 2F4FA 4BLGA 4WTOB 5CHCB 3ZZYA 3M8RA 2B5JB 3RW6A 2VBXA 5ETMA 3V81A 3GIMA 3IWLA 1U1LA 4USWA 1IJEB 2J0WA 4X66J 1FRHA 1S1TB 3DLGB 2E5GA 2G0CA 1KP6A 2XSJB 2QO3A 1QTMA 3DRRB 3EGVA 2XLIA 2ZITA 2WSFC 3NOGA 2DGSA 1HNIA 3CCJS 2HLUA 1TKZB 5H1SV 1RAGB 1R8PA 4I0WA 1RAOA 2VPXB 5K5MA 5DDOC 3E8OA 1AW0A 1X4EA 5F9LA 4LSLA 5D3GA 1S7HA 1F5CA 4DLEA 3W2WA 1VIXA 1I5OB 3AA9A 4Q8FA 1CBKA 4URSA 2DNMA 2DRAA 1HR0J 4CNZA 1U26A 5DQHA 2YNIA 3EGNA 3A13A 2R8HA 2WTFA 4DQRA 3DLEB 1FRKA 2RQMA 3IS9A 3R7SB 4CLUA 1TL1B 2W2OP 4QU7A 5KFZA 1FWPA 2OEKA 3MWBA 2EFNA 2JSXA 4OZ3A 4WJBA 2HK2A 2VQFF 2WVEA 3FSYA 3MEDB 1HQ2A 1VS3A 1MG7A 2RKIA 2D3UA 3ZZTA 3MM5B 4DOZA 2F63A 3VAHA 2CVEA 1Y3JA 2BEFA 4A8SA 1KQKA 2MPUA 1YJTA 1ZTTA 3T41A 4QR2A 3LW5C 5DGBA 1RJJA 2W9CA 3A12A 4WYWA 2CQ1A 1C4CA 1DTQA 2W4PA 3JAMY 5D77A 2MHEA 2R2UA 2GJFA 2RVJA 5K14B 2VFRA 3J7A1 4Z2XA 3BF4A 2ASDA 1M90T 4RW4A 2RHQB 3NWRA 3V81B 3DGPA 3AOBA 4K0KF 1LK5A 1WG5A 4KGKA 1RLCL 2OPQB 3QGIA 2ALYB 3OXLA 4GRSA 3D0IE 3UD5A 5E33A 4K50A 2CJKA 1VBYA 3ENVA 2W2MP 2DGVA 1Q0NA 3T3FA 4DMZA 2J8SA 2V2QA 3BPSP 1S49A 1HNIB 4DV7F 5F0WA 2A1BA 5KFXA 3HHLB 3G6VA 1KLMA 1UKUA 2KVIA 4U7CA 4DR7F 3RB4A 2V9WA 4TU9A 2VKZG 5B0EA 3K59A 2Z30B 4IG0A 1LW2A 2IJNA 3W60A 3ISNC 2ZH7A 3C15A 4F2SA 3SFUA 1EARA 3RBZA 2KRRA 5D3GB 1D9DA 2EG2A 4CLYA 4DEZA 5ETPA 1FD2A 1B99A 1WC1A 5DQIA 3CDUA 1LFWA 3KG0A 1S99A 2JFKA 3AQOA 3R7NB 4ZOSA 2YWEA 2Y8YA 1XNQF 1VYAA 5F3TA 2YNIB 2CPZA 2C2RA 3M8SA 5A6PA 2DR9A 4PXDA 2W9AA 3IS9B 3FSIA 2DPIA 2GJ2A 3RG6A 4USKA 1DHMA 3BN4A 1V3ZA 4RNMA 3BZQA 4X4QA 1OSCA 1AA1B 3H5XA 2OGUA 2ZH5A 4MYTA 4F26A 4E8UA 5KFQA 1S77D 1CC8A 2RKIB 4ZJQA 4IH7A 4WYLA 4N41A 4FF4A 3M6WA 5GAGU 2KTQA 2KM8B 1G6BA 1WEZA 4QWBA 2W9CB 4QYZJ 3HSGA 3CTRA 5J1EA 1YJWS 2KXHA 3TR5A 1YBTA 4J37A 2E9RX 5IOLA 3EGZA 4KPCA 3R2CJ 1MU2B 2XYHB 4JI0J 3PRBA 1RU1A 3C8YA 2YWGA 3V4MA 1T03A 4G3IA 2HRUA 4RW4B 3HSJA 4NASA 4X65F 4N8NA 4WP3A 1Q8LA 2YKOA 3GIJA 3E01A 4KYZA 1TL7B 2AYEA 2VKRA 3V6HA 4O3QA 3QMQA 3CO0P 1H7WA 1QVGR 5LXYA 4JV0A 4PG6A 4X66F 3U02A 4C7QA 2E5JA 1TAQA 1KVJA 5CYJA 1YX2A 2UVUA 2JH3A 3W3SA 2LQ8A 3RBDA 1LW2B 1HNZF 3T1YJ 3C15B 4QW8A 4ECRA 2D3O1 1QM9A 3J80Y 2XY6A 4DFJA 2ACYA 2XZDB 3OFFA 2F1FA 4DL7A 1VQPS 2AYBA 2MZRA 2YNFB 4JI3J 2C2KB 3R5GA 4GC6A 2KL8A 4NMXA 4AE5A 4LR7A 5CAAA 1WUUA 3WHIA 3BGUA 3Q86A 4QIGA 3HVWA 2YH0A 4YDDB 3QJPA 2BE2B 4GC7A 1U0HA 4Z37A 4PPDA 3TA2A 3UN3A 4JI2J 1CJUA 5GVQA 3QAUA 2UXDJ 2HRYA 1X5PA 4TLRA 3HVAA 2DO0A 4URQU 3WC2A 1UFWA 3DM2A 4J9PA 4O3SA 4P7TA 3KMSA 3OLBA 2LKZA 3CDEA 4UOFA 3WZ0A 2FC9A 2NS1B 4N5SA 5CA5A 5E3CA 2I8EA 2CAJA 2ZBPA 3NWGA 4AQYF 2DRDA 2ZWOA 1R0AA 3V4IA 2Z8QA 4L3KA 4C8MA 2JLFA 3KK3A 4I69A 5A2QU 3T1HJ 4NZ0A 3D6TB 4RUBA 4F3MA 1N54B 1JJ2R 4Y2MA 3VALA 1WELA 4GVLA 1MROA 1SKRA 3TP2A 1FRJA 2XC9A 2B4OA 1S4EA 1X4HA 2GQCA 2L9NA 1AB8A 4NX9A 3D5MA 4I67A 2VFUA 5HP1A 2ZZTA 3DLHA 3E01B 4FYDA 1Q95G 1OY6A 5HMWA 4LRCA 4ZVRB 2ZVIA 4ZLLA 1RABB 3L95X 1G2EA 1IBCB 3M32B 3OTDA 3PW0A 3D9BA 2M88A 3SSQA 3MPUB 1IBMJ 4R25A 3ZTQA 3M8YA 3PV8A 4KIAA 2CQPA 3I0SA 4F67A 1FERA 3VGSA 1PJ6A 1NBEB 1NPPA 2VPZB 2YWKA 1P8GA 1E6YB 1RI7A 2RIJA 2HHWA 3IA0A 3CDAA 2OELA 4M8LA 5IT9Y 2MYFA 4ED0A 1UVIA 2MTLA 1S5ZA 1XMOF 2NXUA 4CLTA 4PWUA 5D8HB 1M5HA 2AIRB 3VZHA 1PC4A 1FD8A 3CDWA 1U0HB 3J7AN 3RYLA 1PIEA 3MECA 3NGDA 2DKOB 1YBAA 4N56A 2QLWA 2RILA 4C8OA 2D1CA 3SEOA 1CJUB 3OTBA 2JFDA 2R3VA 2YNGA 2QEXS 4F2RA 3BPDA 3GG0A 4OZ0A 3IWNC 2W2NP 4H4KC 4OJGA 2B8PA 1VBXA 4C9DA 1DZ5A 2GGPA 1O6XA 2W24A 3VR1A 3IGNA 4L76A 1NSKL 2ZHAA 2HIQA 3V4IB 2ZEJA 1XN9A 3KK3B 4NCBA 4I6WA 2MZJA 3U1MA 4B9LA 4X4TA 4OX7A 4F4AA 4Y65A 2E9TA 2WOMA 4Q5VA 1HWLA 4Q44A 1MROB 1HD0A 3T9ZA 1QY7A 2IM3A 5KG1A 1JJ4A 5CYQA 1T9UA 1JX4A 2XMUA 4HI1A 2PO4A 2JNJA 2O67A 4JI0F 5AXLA 3WX4A 1AT1B 1WJ9A 2CZVC 3NNHA 2F9DA 4WBFA 5DJBA 4DV4F 2M8HA 2VG7A 1JLBB 5C2GA 3PACA 4OHWA 1GH8A 1U1QA 3N79A 5J2NA 4TNOA 1R43A 2DXFA 4P10A 3QGPA 4YY3F 4A8XA 1JQGA 5DGAA 4WFAQ 3AB4B 4UUWA 4NLTA 1O51A 2AZ1A 1EZZB 5IQQA 1X9WA 4TLQA 2Q3PA 1FKOA 1RB0A 1FJGJ 4NLWA 3MURP 2R7SA 1UMJA 1SJQA 3EYZA 3KHLA 5MLCV 2PFDA 1RHKB 2GX8A 2VASA 2XULA 4FNHA 5HJYA 2D9PA 2MLZA 2J0QD 3TUPA 5E3RA 2MGZA 1AZSA 4Y34A 5AJ3F 3V2UC 5F8GA 3J81j 2IJFA 1OQ3A 2F65A 4RU9A 1T9TA 5HK4A 4Y6IA 3IG1B 4JI3F 5FJ4A 2JEFA 3MECB 1U1MA 3EE3A 4ZPAA 3GSIA 2HMIA 1Q7YT 4QIVA 1U48A 4KFBA 2V50A 1TL5A 3LA0A 4KGZB 2XM3A 4ED4A 2AT1B 2GGPB 3FZ2A 3AQPA 2AHOB 3NNCA 4HTJA 3DCAA 5HLFB 4DSIA 1GXLA 5H9FJ 1Q5YA 1EX8A 4LRAA 4Y3CA 2WOMB 3IM8A 5IWAJ 1CSJA 2NUHA 2HWHA 2KYZA 3EMTA 5BJRA 3BYPA 4I56A 1RBLA 5CYQB 5HMXA 3RU0A 1NM2A 3GJSB 3T1HF 3D66A 4B3OA 1SI9A 4HT7A 4V1Ak 3GSDA 3OL9A 4KKOA 2DHHA 2FQQB 3L7OA 1RBOB 2ZJQQ 1HNWJ 3PZPA 4DL4A 5K9FA 1VOMA 2AGQA 4GVBA 4X4UA 5D0RA 4CYUA 1PSDA 2RRNA 2VG7B 4DV2J 5T41A 1DBDA 3ETMA 2FJVA 1ZPVA 4OJ1A 2ALZA 4M5LA 3NGTA 1ICEB 2GC8A 3GIIA 3ZZPA 1JXLA 1TKDA 4NRUA 3MPDA 3GJRB 1S97A 2NZCA 3CGIA 1ZM2A 1F0XA 4IG3B 1FKOB 3OBIA 2KHCA 2YBVA 5KG5A 2J6UA 2QG9B 2IVFB 2XO7A 1IBMF 4JI7J 2HW3A 2W7OA 1GMWA 2MGZB 1T11A 2DNGA 2CPDA 4DUTA 3MEGA 4PXEA 3HFVA 1ULRA 2CWXA 3FKBA 5C5JA 1Y00A 1VISA 2UUTA 5CXTA 2D74B 3ZFVA 4MK7A 2FD2A 3P3DA 5FIIA 1SJ3P 5SZTA 4TY8B 3VHQA 4YN3B 3D0HE 1ZPWX 5K8MA 5F8HA 2KDOA 4E98A 1HNXJ 4KFBB 1L3TA 1GMWD 1S9GA 2BKNA 1RT4B 4U67Q 4XAKA 4K4SA 2L3MA 5C24B 4OI2A 5KG7A 2HVHA 1T7PA 1U09A 2GIQA 2I38A 2PT0A 3CCVS 4OLPA 4OJ3A 2NYHA 4IFVA 2J6SA 1KFSA 2BABA 3W5YA 1MN7A 5AE1A 4CM0A 1UZHA 4PABA 4CLZA 2J9DA 4LR9A 1FJ7A 4ZLNA 5B0DA 2CPYA 2FVRA 2MXYA 1RWXB 1NPRA 4K4ZA 3PFOA 1XIQA 2DHGA 1PYTA 5J2MA 5ETLA 4WXWA 2NR0A 2JVOA 4Q2MA 5EX0A 3R5CA 1KR4A 1WEYA 5BR8J 1R27B 1U1NA 1FVQA 2MDAA 3TZXA 2CJBA 1WI8A 2LXFA 3C46A 4LFCF 4M95A 2VC0A 3MZIA 3FBCA 3EPGA 4KKOB 5HROB 4M1KA 2C22A 3IFEA 2HFZA 3TVKA 2CXEA 1QVFR 7AT1B 4CYUB 1BLUA 3IP0A 2QT7A 4HHHA 4PPZA 1EQMA 2HBYB 3DDNA 3IMQJ 2MKKA 1AYEA 4FKYA 3TUZC 4XO0A 4WU2A 1S1WA 2RH3A 4I2PB 4EYIB 4X64J 4ES3A 1K73T 1TQLA 1RT6A 4FBTA 1RWMB 1H2UX 3OUYB 2BE7D 3A8EA 2UVWA 1NK7A 3D1HA 2KHDA 4LFAJ 1OY8A 2HVEA 4Q7AA 4R5PA 1UJ4A 2PSZA 1V6HA 4QYRA 4QIFA 3CCRS 2BM0A 3MEGB 4JI4J 2RUGA 2H1YA 2CZ9A 4UQTA 1Q16B 1ZAVA 3MOJB 1FJGF 4YDXA 4ZHRA 5GAEU 1QSLA 3AD8C 1RA6A 1FKAF 3LPEA 1YK9A 1LWEB 2GMLA 2HRTA 1SCJB 1G7CB 1WHXA 1MWZA 4QBUA 4DV3J 2J8AA 1S9GB 3CUNA 3ET6A 4RW6B 5B0AA 1X5TA 4WFNQ 4RU2A 2MKSA 3B8HA 4LF4F 1R0CB 4ZK7M 2LA4A 4IFVB 5KG0A 1P9QC 2JVRA 4LUBA 1SC1B 1W26A 4U7UD 1Q4RA 2VQEF 5F8MA 4OJHA 4C11A 3DRYA 5IC4B 2CADA 2YQ1A 5J2MB 3SQOP 4ECVA 4HHJA 4IRDA 3N28A 2L9WA 1CJVA 3DRPA 3FBBA 4LSZB 2UV8G 2D41A 3RBXA 2ZOMA 4KAIA 4MK9A 3ZNUA 4F0MA 2MQPA 4PWDA 2GA7A 2IIHA 3L4BC 2CKWA 3KLFA 1IBLF 5LMNJ 3FFIB 3EICA 4CP5A 4ED1A 1S48A 5LL6d 2XMTA 4ATNA 1YRUA 3M2VA 5IWAF 2RDDA 4NI2A 4B02A 1B3TA 1U6FA 1AUSL 1U2CA 3OL8A 4P9SA 1Q7LB 4R8UA 4M94A 3DLLQ 4OHXA 3FJ2A 2J9EA 1VLYA 4ZJLA 4U95A 1S1WB 5HMYA 2CQHA 3GPAA 4J90A 3K58A 1RT6B 1S10A 2FIUA 4IRCA 4RBVA 1GNKA 4PR6A 3RB0A 2BXJA 2V94A 1NH8A 4R5PB 1FA0A 4LT6A 4DR4F 4DHVA 4PG8A 2DVIA 3FCWA 1FNXH 5A0YB 4NLGA 1X7VA 3EPIA 1S7IA 5DDQC 2VF3A 4ILRA 2BR0A 4EBEA 2LEBA 2GIFA 4C3KA 3V6DA 1PBAA 3DOLB 4ZHRB 2FVCA 3LALA 2HK3A 1LFPA 1KHVA 1SB6A 1HKAA 2X7IA 4KH1B 2IM0A 3VV2B 3DLBA 3IRWP 2P8IA 5C7PA 5KT6A 3BV8A 2IA6A 2YVSA 4C0OC 1J27A 2E29A 2OO4A 5GMEA 3PTWA 2XS7A 4DCJB 2I1RA 4YFUA 4N7TA 4OV1A 4P73A 3FRYA 4HLBA 2VFSA 2R2RA 1F9FA 4DX6A 4F0KA 1F9EB 1N0UA 2QLBB 1WKJA 1CJKA 5B0FA 2BRLA 4HKQA 1VC5A 1T05A 1JLEA 4NLSA 2Z58B 2DK2A 2KZMA 2IA0A 4MAKA 3DLKA 1YZ7A 2AX1A 2MLYA 1CJVB 3DRPB 1X4AA 2PE8A 3PM9A 1YG0A 3KLFB 4O3PA 1EAYC 1K8AT 3BQ1A 4KGVB 2M3DA 3NBPA 1FNMA 3M2VB 2IFXA 3D4JA 4NI2B 2OHDA 2I2YA 2HGMA 3C66A 2VG5A 2WAQD 3W61A 2JEIA 2QLJB 5I42B 1FVSA 2G4BA 3OFHA 1YVFA 5EDWA 4CLLA 1KQGB 4EU0A 2J6TA 5KFSA 3ZTPA 2AGPA 3TAPA 1X60A 2VIHA 2HNYA 2HEKA 4QWCA 4DL0C 2NSBA 2H48B 2XGPA 3K8WA 2AJFE 3H4BA 1P1LA 1VK3A 5BYRA 1LXJA 2ZE2A 2NYIA 4UOHA 4OYMA 5T14A 4L3NA 4H4MA 1NK8A 3KTQA 4IYQA 3VGUA 3D54A 3FEYB 4G6VB 4X64F 1FNOA 2J5AA 1T95A 1N4LA 2C2MB 3CE8A 4O3RA 2IBOA 4FKXA 1SC4B 3FCHA 1TUWA 2WK4A 1A9NB 2C3UA 1KONA 3AJDA 4X4OA 2BJ7A 3J7Z5 1S0NA 4JI4F 3CCMS 3OXGA 1RUSA 4ER8A 2CFXA 2Z2YB 3JB9k 1GEHA 4DN0A 2E7XA 4AT1B 4ED3A 5GAHI 5E3QA 1VQ8S 4RNNA 2DY1A 1HQEB 2LDYA 5D0GA 2O5DA 1AFJA 1H0HB 2GMJA 5ETQA 1WF0A 3CD6S 1NNDA 2G13A 2MB0B 1XBWA 1NB2A 2J9CA 3HHDA 1JNRB 1CJKB 3K5LA 3K2YA 2ZUAA 4O44A 4F3OA 2P5VA 4TQSA 2CJ9A 3HHLC 1T05B 1JLEB 5H9EJ 5LT5A 2ASYA 4OYBA 3PKMA 1FDNA 2MJNA 2V8GA 1T3NA 3MAHA 3DLKB 1LXNA 4F4KA 1H2TZ 1XMBA 1BQXA 4WFYA 4F8RA 3M7VA 1HHQA 3IBWA 4YHHJ 3DRSA 3AJ2A 2DHXA 1B0TA 1TK0A 2BYCA 2PMZD 3NBPB 4NLXA 3G82A 2VA3A 1R3NA 2LEAA 2COLA 3T6JA 3CJ4A 2XGQA 3F0NA 2FY8A 4CTAA 2JZ5A 3SSRA 1WORA 3S8SA 2X1GA 2ZFHA 2ZNZA 2MZ1A 3PVXA 2A18A 3O6QA 4MFBA 4KHPF 4I6AA 4FXWA 4WIQA 2BA9A 3KJVA 3PW4A 2HNYB 2FLLA 2G0IA 4W98A 3RAMA 1B7FA 3FVYA 2E1PA 3HCXA 4RW7A 1Z2ZA 2PMHA 2YKMA 2ZE2B 1WF1A 2UZAA 4N8OA 2B6AB 4Q2LA 5HVFA 4M5MA 1ZAWA 1F3FA 2JJ4D 3M2RB 4XTTA 2W4DA 4L74A 1GTEA 1M5SA 1NDKA 4FNIA 3G9CA 2R7UA 1KOOA 3L9ZA 1RT7B 2UUBJ 5I4MA 4DL5A 4M5JA 4ANDA 2QMUB 3CIMA 3D1OA 3JS9A 4QR0A 4DI6A 2IM1A 1IR0A 1HBUA 2HS4A 3KKFA 3NAIA 1PO6A 3BS9A 2L9DA 2XMMA 3HPOA 1K0TA 4DR2F 2V5HG 4PKDB 1UTAA 1WOPA 3I82A 4EO8A 4FZVA 3AXMA 4O44B 5U47A 2DIUA 1K47A 4JYAJ 3OPKA 4NZ7A 1BGXT 3U1NA 1CS4B 4I68A 4IO9Q 1B64A 2G2ZA 3DRSB 4LF9J 2E9ZA 3AAWB 2BJ3A 2YNHA 4O4GA 4F02A 3R5DA 3G82B 1OPZA 1SL1A 5DG9A 4ZVUB 1UZDA 3CC2S 1XNRJ 3PIOQ 3PO4A 2M4MA 3W66A 2QLXA 2DR7A 4DJBA 3BQ2A 2KXFA 1N8RT 2JC1A 1RTDA 1VI7A 2GW8A 4MFBB 1Q53A 2I5JA 5LMUF 1NB7A 2ZKTA 3KJVB 3Q8VA 3H2LA 4OZ5A 1C1BA 2E1RA 3SV4A 1VIOA 1XERA 4RW7B 5EWEA 1OPIA 5JXSA 1UJ6A 3RR7A 2HZCA 2XCPA 9RUBA 3DGVA 1SVDA 1S6PA 1XQIA 2KH9A 5DZ6A 2QYCA 2K06A 3KUEA 1UW4A 4WKYA 2ADBA 3BGFA 4B17A 4JI5J 3MI7X 1S0OA 3MMBA 1IKVA 4DU7A 1RAIB 4MIWA 5G4DA 5KFCA 3EZ5A 1HBUB 3JQMA 1S6UA 3UE2A 1QSYA 3B82A 3TEHB 4AL5A 3DU5A 5KFVA 4BBYA 1MMNA
chains in the Genus database with same CATH topology
2VJUA 2F4FA 2VIHA 2EC2A 2VHGA 2A6OA 2FYXA 2F5GA 2VICA 2VJVA 2XQCA 2XMAA 2XM3A 4ER8A 2A6MA 2XO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJU A;  2F4F A;  2VIH A;  2EC2 A;  2VHG A;  2A6O A;  2FYX A;  2F5G A;  2VIC A;  2VJV A;  2XQC A;  2XMA A;  2XM3 A;  4ER8 A;  2A6M A;  2XO6 A; 
#chains in the Genus database with same CATH topology
 3HFK A;  4OHY A;  5HBM A;  1S0V A;  1S1V B;  2BQR A;  2QLF B;  5KG6 A;  2XWX A;  2G1H A;  1WAC A;  2WCX A;  3ENW A;  2JLG A;  4WK1 A;  4P2S A;  3M4X A;  3KLG A;  1BMQ B;  4QOT A;  5KFG A;  2WBR A;  3BGO P;  4EI2 A;  4RLE A;  3HMJ G;  1N6Q A;  2FHM A;  1VQS A;  4LR8 A;  2DNO A;  3DDK A;  3BN7 A;  2JX2 A;  1W2I A;  1TVR A;  2H65 B;  4KBI A;  1S0M A;  2WON A;  1KWM A;  3FEX B;  2GHP A;  4HEA 9;  3L3C A;  4O4G B;  4DLG A;  1S6Q A;  4N77 A;  4LF6 F;  1N56 A;  2RNE A;  3B78 A;  1S1X B;  2H4W B;  2VPW B;  2XMV A;  4YHH F;  2W25 A;  2CJY B;  3NY0 A;  3UR3 C;  2I5J B;  4HDH A;  3K0J A;  1F5B A;  4ITS A;  4MT1 A;  2XS2 A;  2HFS A;  3DLJ A;  2XG8 A;  1C1B B;  1NZ8 A;  1DAR A;  2IYG A;  3OTO F;  2VDH A;  4QW9 A;  4YP3 A;  1DJ0 A;  3MHY A;  3A3P B;  4IOA Q;  3JAM U;  4YB5 A;  3N9U C;  3MD1 A;  4RNF A;  1U1R A;  3IBC B;  3GFX A;  1NKE A;  1S6P B;  1EKS A;  1NRK A;  2Y9H A;  3CUL A;  3UDE A;  1NPK A;  4DR5 J;  3MMB B;  2IJR A;  1IKV B;  4KTQ A;  2DEI A;  3VGV A;  4AD6 A;  4TVA B;  4CH0 S;  2DHS A;  2HHP A;  2YQ3 A;  2RS8 A;  4DPW A;  2MMY A;  4G1Q A;  3QT8 A;  4D3H A;  4NYO A;  3TVY A;  1S1U B;  3R1H A;  4ZCM A;  4A8M P;  3TVZ A;  5HBM B;  1S6O A;  4JB8 B;  2UU9 F;  4X4V A;  4I2Q A;  4C8Y A;  3MM9 A;  4RWX A;  4A48 A;  1N52 B;  4QWE A;  1GMU A;  3KLG B;  1U1O A;  1SKS A;  4F25 A;  1FI4 A;  3UR0 A;  3SQG A;  2GCF A;  3KLE A;  4E2F B;  2XMK A;  2MJU A;  1TVR B;  4X2B A;  1MNE A;  3IRX B;  4CO1 A;  4JI1 F;  4OZ2 A;  1IN0 A;  5CH7 B;  1N33 J;  4IR9 A;  3US5 A;  4NLR A;  5KOW A;  4CLF A;  1RAD B;  1S6Q B;  2M2B A;  4TY9 A;  2E1M C;  4KRW A;  2UXB F;  4DSE A;  1Q81 T;  3LP1 B;  4ZKA A;  3CT9 A;  5H9E K;  1F1B B;  2RB7 A;  3NGS A;  2QV6 A;  4RPF A;  3IR7 B;  3NMA A;  3TJA A;  2AJ1 A;  1SJF A;  2CQB A;  3LAM A;  4ZVP B;  5C25 A;  4EBC A;  4LIR A;  4M5D A;  4UZB A;  1XNR F;  5D0H A;  2F5G A;  3JXO A;  4Y2I A;  2RML A;  3A4T A;  3P96 A;  2DGW A;  1UCN A;  2VFV A;  5K8P A;  1MMD A;  3W63 A;  3QQC D;  4RX6 A;  5KG3 A;  1NU4 A;  4DR6 J;  3H2U B;  2ZKU A;  1HMV A;  1CPZ A;  1WSR A;  4OI4 A;  3UCG A;  1Y11 A;  1Y9O A;  1AUD A;  3AOD A;  1RWV B;  2CRL A;  2Y0B B;  1I94 J;  3BB5 A;  1VQ6 S;  1TFY A;  2EFV A;  1FO1 A;  2XNR A;  1RT2 B;  1S76 D;  2V34 A;  4ELU A;  3Q8R B;  4J9L A;  4HH0 A;  2O3D A;  4G1Q B;  2CNN B;  3ZO7 A;  2C42 A;  3HZE A;  3C6T A;  4NEY A;  2C2N A;  3KG4 A;  3KXD A;  1HWK A;  2F8M A;  2RF2 A;  4PQU B;  2KXN B;  2AV5 A;  3QZ7 A;  1H38 A;  3R9L A;  2BW2 A;  3S6E A;  3QID A;  3OT9 A;  3H5Y A;  3VGT A;  3EM1 A;  4QQB A;  4L73 A;  4JI6 F;  1XEZ A;  4I2Q B;  3Q8P B;  3VAK A;  1SUQ A;  1HW9 A;  1NDP A;  3KK1 A;  2OP5 A;  3NG8 A;  2YKN A;  2WRM A;  3CD0 A;  2FJB B;  3OFE A;  2CYY A;  1KSP A;  3SQG B;  5DG7 A;  4WII A;  1GQE A;  4NXN J;  3QT5 A;  8AT1 B;  1JLA A;  1J2V A;  4P2M A;  4WTY A;  2KJV A;  2OSQ A;  1L5U A;  2G0J A;  3CJT A;  2UV8 A;  1NK9 A;  2CQ4 A;  2V8D A;  1UJ5 A;  2BJD A;  4FF3 A;  1DTT A;  3H90 A;  4LF8 J;  3W2V B;  1U02 A;  5KFF A;  1ZA2 B;  4K4Y A;  1FRL A;  4PUO A;  1B4S A;  2A2D A;  1Q78 A;  1RTH A;  1C2P A;  2EC0 A;  1VRQ C;  3R1L A;  1WWH A;  2HQC A;  4WU3 A;  3I55 S;  2XYG B;  4DFK A;  4F04 B;  1IVZ A;  4EFA C;  4HAC A;  4M5D B;  2W4C A;  3M30 A;  2PA8 D;  1ZET A;  4DPT A;  1NJW A;  4DV6 J;  4OYX A;  2J76 E;  2RQK A;  1UVM A;  3Q24 A;  1P6T A;  4PG5 A;  1D8Y A;  3MCO A;  2QC3 A;  3UN5 A;  1VMB A;  3OL7 A;  2ZWP A;  2Y8W A;  1SPB P;  2OFG X;  3UN2 A;  3HKW A;  4HHU A;  2DNP A;  1S12 A;  1RKJ A;  1T9X A;  4DX7 A;  4C3M A;  1O8B A;  2Y3Y A;  1B0V A;  2ZZM A;  3QAE A;  3QJJ A;  1T94 A;  1EQ0 A;  2ASJ A;  5DM7 Q;  4WFZ A;  3LGN A;  2ZNY A;  3MD3 A;  1PYO B;  1SQG A;  4U6P A;  5A8R A;  3ICL A;  4K8R A;  5B0C A;  3C6T B;  4NL5 A;  1RWK B;  1PJ5 A;  1M5P C;  2QMW A;  4PRF A;  4ICL A;  3RB6 A;  2ZH1 A;  1FRI A;  3GJQ B;  3ISN D;  1H73 A;  4A8K A;  2VG6 A;  4K5R A;  4DUZ F;  3M8Z A;  3SCJ E;  4AL6 A;  1VFJ A;  1RTI A;  2XLJ A;  2AEF A;  2YKN B;  4MJK A;  1IXK A;  1V3S A;  3B4M A;  4K4V A;  2DGU A;  2OMO A;  3H5S A;  5IT4 A;  3NMR A;  4F3Q A;  2LFV A;  1JLA B;  1RE1 B;  1FWK A;  3IC1 A;  2CIM A;  4PWW A;  3MPV A;  4P6Q A;  2QTW A;  1FF2 A;  4DS5 A;  4M5G A;  1DTT B;  3LP2 B;  1UA1 A;  5J1P A;  4X4N A;  3G6X A;  5IC6 B;  1ACM B;  4NLD A;  1V3R A;  3CCE S;  1EET A;  3LTO A;  3MEK A;  1RTH B;  3PR4 A;  5B0G A;  4RBT A;  1HBO A;  3BBF A;  4K7Q A;  4CLW A;  4CO4 A;  3DYA A;  1N5Y B;  1N33 F;  2HQ3 A;  3DI6 B;  3WIV A;  1RA7 A;  4CLP A;  4O0I A;  3ENA A;  3GR0 A;  4DDF A;  2FHO B;  2Z2L A;  2ZZN A;  4YB1 P;  2UXC J;  1QAY A;  1M5V C;  2HWI A;  2F7V A;  3UD4 P;  2RJZ A;  2FZG B;  2QL5 B;  1IWG A;  2B8Q A;  1HAR A;  5KFT A;  4ID8 A;  2BUN A;  5F8L A;  4FBU A;  1FFW B;  3NEK A;  4ALZ A;  3MTK A;  3V6K A;  5D4O A;  1CC7 A;  1X9M A;  2ROE A;  2XYP B;  2H5J B;  3BH6 B;  5HN0 A;  4ILM A;  2FHJ A;  3ILJ A;  3N6L A;  4Y00 A;  2CJQ A;  3GON A;  3TUJ C;  3MXH P;  3GV8 B;  1NEE A;  2QX0 A;  4CM2 A;  5A8R B;  4NLU A;  3K57 A;  5CCM A;  3LQV A;  4DSL A;  1SBR A;  2CJA A;  1CVJ A;  2VOD A;  4A46 A;  4ZA1 A;  4U96 A;  4WFB Q;  2R7R A;  1TL4 A;  2BZ2 A;  1SH0 A;  2N3O A;  4KO0 A;  1FTC A;  3P45 B;  3WX8 A;  4DX8 H;  2VG6 B;  5BYQ A;  4OHZ A;  3ITH B;  1R6V A;  1MN9 A;  1Q8K A;  2FHJ D;  1RTI B;  4BDP A;  2DEJ A;  1F9H A;  5GMK a;  4P52 A;  2OTL S;  1YIJ S;  4GKK F;  1ZTW A;  4F36 A;  1DRZ A;  3T5J A;  3MR2 A;  2HYI B;  4DU8 A;  4DR1 F;  3IN5 A;  4OYI A;  2EBE A;  1N34 F;  1ZAX A;  2WHO A;  4A8Y A;  3KHG A;  2XI2 A;  3M1V B;  4NXN F;  1EET B;  1HBN A;  4OZJ A;  4ZVE A;  1HBO B;  2EKN A;  2OAU A;  1KQF B;  4XDC A;  1RT1 A;  2QN6 B;  4DQP A;  3VAJ A;  3DYA B;  6FDR A;  2FTR A;  3ELH A;  4IOB A;  2CQ3 A;  3LGH A;  3MM8 A;  1VJW A;  4LF8 F;  2AYG A;  3MPW A;  1WKL A;  1HBM A;  2ZH3 A;  3MDF A;  1FWL A;  1VQK S;  3PNI A;  2RRA A;  2CPJ A;  5K8N A;  5A8K A;  3HF5 A;  5KFR A;  3W9J A;  2YX1 A;  3R6L B;  3GYN A;  2MY8 A;  1WF2 A;  1WSV A;  4OYA A;  5M2U A;  2QYG A;  4FYV B;  4URG A;  2A10 A;  2DGX A;  1WOO A;  1TFW A;  4MTP A;  3VAM A;  3AA8 A;  1WHV A;  3UDC A;  3GJT B;  1FCA A;  2R8J A;  4DCP B;  1IBK F;  2Q6C A;  2O1P A;  2L41 A;  2ATL A;  5IV4 A;  5D4N A;  4CT8 A;  2Z56 B;  2CQ0 A;  1JXV A;  3LH2 S;  4K2X A;  1J5E J;  1D9F A;  2HNZ A;  2W1B A;  3DOK A;  4KO0 B;  1QJH A;  4IR1 A;  2V67 A;  4RUA A;  2OTJ S;  3MR6 A;  3QJL A;  2NXJ A;  1UAW A;  3TI0 A;  3BDE A;  4PG4 A;  2DYA A;  3EXC X;  4J5O A;  3AHP A;  1IKY A;  4TKT A;  3M2U B;  3O3L A;  4ZCL A;  1RDR A;  4WE1 B;  3ZZ0 A;  4C3L A;  5I3U B;  4H4K A;  5K8O A;  1W25 A;  2YPZ A;  1WC4 A;  2QL7 B;  1T9Y A;  2LQJ A;  3G87 A;  2C2E A;  2MKJ A;  1GT8 A;  2D9O A;  4UOG A;  1Q79 A;  1RWO B;  5HVH A;  4QPX A;  3M8W A;  4KSE B;  1F6T A;  3E3X A;  4XK8 C;  4NYP A;  2EG1 A;  2E5L J;  2ZOG A;  5M2R A;  4DG1 A;  5BYS A;  2YKP A;  2MQO A;  1HBN B;  2GQ2 A;  5CCL A;  4RW9 A;  5KFA A;  4ZPD A;  2VON A;  1BQM A;  4NA2 A;  1RT1 B;  3OTE A;  4P74 A;  2ZM6 J;  2ZH9 A;  1SH3 A;  3MM8 B;  9ATC B;  1C0T A;  1XR5 A;  1YZ6 A;  5IS2 A;  2D69 A;  3MMJ A;  4OHV A;  1DAX A;  1NSA A;  4LSL B;  1TEL A;  2VA2 A;  4FPI A;  1HBM B;  3GZ7 A;  4X84 A;  3CNQ P;  3W2W B;  3P49 B;  1JIH A;  1S9E A;  3G6E S;  2BOP A;  2W2P P;  3BBC A;  3OTC A;  3P6Y C;  2XZT B;  1WG4 A;  4MKY A;  4C48 A;  3LAK A;  4NLV A;  4ZPV R;  3GTY X;  1RYR A;  2UXC F;  1TV6 A;  2LLZ A;  3CD5 A;  2DIS A;  4QWD A;  1SKU B;  5E0O A;  6FD1 A;  4ZPB A;  4B3T J;  2VU5 A;  3ZXW A;  1SL2 A;  2VPY B;  3FCV A;  4DR3 J;  2OH2 A;  1ZM9 A;  1ITP A;  4KJI A;  2C3P A;  1SJ4 P;  1TP7 A;  2PFF B;  3J7Y I;  1WOS A;  1MWQ A;  2OD6 A;  2HNZ B;  2HBQ B;  5B09 A;  3PFE A;  4F0H A;  2DNY A;  4KY3 A;  2N4C A;  1HI1 A;  3SBM A;  2GJI A;  2DH9 A;  2KFZ A;  1DTQ B;  3QRR A;  4Y2C A;  4B9U A;  1FK9 A;  1IKY B;  1ZZN A;  4A8F A;  3DXS X;  1RAE B;  1FT8 A;  3CJ8 A;  1H7X A;  2NXE A;  2V69 A;  1H6K X;  4NXM J;  3PJX A;  3DGP B;  3OVA A;  3RGI A;  2H51 B;  4EBD A;  5B0B A;  4B3R J;  2PEB A;  4OX6 A;  3HX9 A;  3M8Q A;  1UFK A;  4RJV A;  2R8I A;  3KUH A;  4WP9 A;  4GKJ J;  4O3O A;  2VOO A;  5B7W A;  1TK8 A;  3MCM A;  4ECY A;  4DG1 B;  2ACM A;  1Y5N B;  3F44 A;  3MOZ A;  1NAQ A;  4F4Z A;  3DFE A;  4RW9 B;  3KG1 A;  4WK3 A;  4ECU A;  1KLM B;  3KLH A;  1BQM B;  1S57 A;  2OPS A;  3LWM A;  5EX3 A;  4OX9 J;  2VD3 A;  4IG0 B;  1JKH A;  4HYK A;  3O5T B;  1W2B R;  1KBR A;  3PW2 A;  4ZVQ B;  3QPI A;  1GK8 A;  3ZC4 A;  1BE4 A;  2R8K A;  4WZQ A;  4OL8 A;  1S9E B;  2RDI A;  3TAM A;  3CB4 A;  3KYL A;  4YEA A;  4X4P A;  2W7A A;  3UVJ A;  2AZ3 A;  4FYY B;  3CCL S;  5LSR A;  4MYU A;  1TV6 B;  4QWA A;  1Y5I B;  2N7Y A;  1RBA A;  5CYM A;  3DHX A;  2XI3 A;  4RBU A;  1HR0 F;  4BCA A;  4GO7 X;  4CO3 A;  3KJF B;  2VC1 A;  5GAH U;  3TRG A;  2BJ8 A;  4RNH A;  4EO6 A;  3BYR A;  1SL0 A;  4B9T A;  2MST A;  1KKH A;  3NAH A;  3R7B B;  2EFP A;  2AX0 A;  3CJ5 A;  1DUR A;  2A0F B;  3VQT A;  1N5T A;  5J1E B;  2MLX A;  2M52 A;  2FHK A;  1FK9 B;  5L9X A;  5E5N A;  1R8C A;  3N5B A;  4F50 A;  2PII A;  1T03 B;  1U49 A;  4K2J A;  3JSY A;  3MFH A;  3FZB A;  1IR1 A;  4B3S J;  1FEE A;  2XSF A;  5FD1 A;  2BX6 A;  4EGL A;  4ECZ A;  3RRG A;  4MH8 A;  3ILO A;  3QRP A;  3SSS A;  3HO1 A;  5DG8 A;  2GAG C;  4USU A;  2ASL A;  1VJQ A;  2HUR A;  1B0P A;  3O8W A;  4G1P A;  1TR0 A;  2VH7 A;  1VR6 A;  1RHQ B;  3KLH B;  2OPS B;  3A8K A;  3AT1 B;  2E1A A;  3HVR A;  4V19 J;  3LGM A;  2B4V A;  2C3Y A;  5T7L A;  4CQ1 A;  5C42 A;  1JKH B;  1WC3 A;  3T5H A;  2E5L F;  4LBH A;  3PJ9 A;  3ZZZ A;  3GYG A;  3H59 A;  2V8P A;  1WTF A;  3GV7 B;  1PG5 B;  4OQJ A;  2ZM6 F;  1J5O A;  4BWM A;  1B7Y B;  3TAM B;  4GMK A;  1X9S A;  4O0N A;  4B9N A;  3C2P A;  3UVJ B;  3ZNJ 1;  1HQU A;  3J7Z T;  1SV5 A;  1UPP A;  2EK1 A;  3CJS A;  1KLN A;  2H54 B;  2HIY A;  2GS8 A;  2KFY A;  3DM2 B;  2HGL A;  1LNQ A;  2P9E A;  3OR1 A;  3N6N A;  3RJM B;  1YIT S;  3W62 A;  2XHW A;  4USI A;  4O23 A;  4LF7 J;  3LF0 A;  4TQR A;  3D68 A;  4NLO A;  2IDE A;  1IM4 A;  1R0A B;  1SC6 A;  4UST A;  2WB1 D;  4DR3 F;  4HH1 A;  1U47 A;  5KT2 A;  3JQJ A;  3M9O B;  2YX7 A;  4J9N A;  1Q5V A;  5FDL A;  1ZYQ A;  3BSC A;  4EYH B;  2WVD A;  4NRT A;  3D67 A;  1PKU A;  3VAI A;  2EEY A;  2XCA A;  3HK2 A;  1PJ7 A;  5HP1 B;  3BH7 B;  3BSN A;  1BWE A;  3CXC R;  1MML A;  4TU8 A;  2CPH A;  2HFU A;  3HHK A;  4CH7 A;  2AJ2 A;  2GZO A;  5KT4 A;  1UEK A;  3EZU A;  3QIP A;  4NXM F;  2MHN A;  3FC9 A;  1FFS B;  1R0B G;  2ZC4 A;  2ATC B;  2DB1 A;  2CNL B;  2L48 A;  2GHV C;  3VQS A;  3RB3 A;  2DNN A;  1KVI A;  2J7K A;  5T7L B;  5C42 B;  2VBY A;  4GKJ F;  3DMJ A;  3I0S B;  2DNZ A;  3AFG A;  4RNO A;  2IC3 A;  1OMS A;  3ZZU A;  2O66 A;  3EGW B;  2HPU A;  3CWJ A;  1LW0 A;  3JTO A;  2B9X A;  3PCO B;  2C1E B;  4CIO A;  1OS5 A;  2VQF J;  3PDN A;  1KRP A;  2HQF A;  1VQ9 S;  2CUY A;  2Y0S D;  1TMJ A;  1YRX A;  1CEZ A;  2NPI A;  2LQ5 A;  1J5O B;  1NHV A;  4TYA A;  5THW A;  2JC0 A;  3T1Y F;  3SZ2 A;  4NLP A;  5HVG A;  4RUH A;  4DV1 J;  3QT6 A;  1LWC A;  3PX4 A;  2F4V J;  1TU0 B;  2OI2 A;  1SV5 B;  3MAA A;  4X4R A;  3QBC A;  3GCX P;  2YNG B;  3IXQ A;  4U7U K;  5DRK A;  2WBM A;  2QE5 A;  4USJ C;  3OR1 B;  2BDP A;  4K0K J;  4C8K A;  4RW8 A;  3P8B B;  5E2Q A;  8ATC B;  3QGG A;  3KFW X;  4JI2 F;  1VQO S;  2V8V A;  1R31 A;  2UXD F;  3D0G E;  1TAU A;  5DM6 Q;  3OJU A;  3TZZ A;  2HHH J;  1NK0 A;  1QLN A;  1WHY A;  1R8B A;  3P4U B;  3THT A;  3TQ1 A;  2UUC J;  4NYZ A;  3IR5 B;  4DR7 J;  3TAN A;  4FP9 A;  5FDL B;  2ILZ A;  5L39 A;  2OLW A;  3PRV A;  3NNA A;  4DPO A;  1HW8 A;  1N0V C;  3AY0 A;  1FDA A;  4DSK A;  2FPH X;  3D1Q A;  4BS2 A;  3Q8Y A;  3T6B A;  2ZH4 A;  4FVM A;  1I3O B;  5D0E A;  3QIP B;  1JWW A;  1N48 A;  5J2N B;  3NS6 A;  2GO9 A;  1NDL A;  3QWU A;  3T5L A;  2BJ9 A;  3H25 A;  1VQM S;  4NEZ A;  2FLO A;  1H3D A;  1A6L A;  3RBE A;  4J9S A;  3DMJ B;  4A8Q A;  3OVB A;  3EWG A;  2YH1 A;  2IC3 B;  3IBF B;  4ZVS B;  3JTP A;  1VBZ A;  2E7W A;  4W4M A;  1LW0 B;  1RCX B;  5L1L A;  5JVG Q;  3NCP A;  1UEV A;  1AZS B;  4OYP A;  3H2V E;  2MKY A;  2ZHO A;  3BDP A;  1FDD A;  1LWC B;  1APS A;  3AXK A;  2DTJ A;  2H9Z A;  1UVN A;  4WWS A;  3R5A A;  1WEX A;  3AJ1 A;  3CMA S;  1U1K A;  1I6J A;  1Z4U A;  1VK8 A;  4ZP7 A;  3MED A;  3FGV A;  4ZCI A;  3DHW C;  4RUC A;  2HMI B;  3CCZ A;  1GX5 A;  1YJU A;  2WW8 A;  3TJ8 A;  5LSO A;  5KFE A;  5A6W A;  5M2P A;  1JLC A;  4ED6 A;  4X65 J;  3CW2 C;  3LP0 A;  1RHU B;  2DGQ A;  5F8N A;  1SIW B;  2Z2M A;  4RW8 B;  4I64 A;  3MUV P;  3KNG A;  2M70 A;  4ED8 A;  3W7B A;  3PX6 A;  3GIR A;  2C3M A;  3VTI A;  3FBF A;  2NRE A;  2XWY A;  1M5K C;  2Y1J A;  2P6S A;  2YQ0 A;  2ZH6 A;  4ED2 A;  3RAQ A;  1WTB A;  3D28 A;  1KC8 T;  3GIK A;  2NLW A;  1S59 A;  4YR3 A;  3NRB A;  1LWF A;  2P2C B;  3CDB A;  2CNK B;  4LF7 F;  1MLA A;  2OPQ A;  5KFK A;  2DIT A;  3PIP Q;  2ZDO A;  2YWF A;  4DS4 A;  2DIV A;  3MCN A;  4EUV A;  3L7U A;  2KKH A;  1NH7 A;  3GU0 A;  3MR5 A;  1HNZ J;  2V68 A;  4ZVF A;  4B3O B;  3BSA A;  3NP5 A;  1FJC A;  1ELO A;  3KLV A;  4I7F A;  1EHW A;  4ZS6 A;  2PI4 A;  1TUG B;  2DY9 A;  3HHL A;  4P71 A;  3JTN A;  4GVB B;  1RHJ B;  3NL0 A;  5F9N A;  2VHG A;  2C2O B;  4IKA A;  3PEJ A;  1RWN B;  4QPT A;  2EC2 A;  3BJY A;  2DD8 S;  2BBE A;  3GYX B;  1G1X A;  3H0P A;  3VVU A;  5GAD I;  2PGC A;  5CD4 A;  1M1K T;  4MMO A;  2HAF A;  3T5K A;  3PKY A;  2DNK A;  4EEY A;  4WKR A;  1VLO A;  4ZP6 A;  3HHL D;  2C2D A;  3GE9 A;  2APO A;  1HA1 A;  2QMX A;  4RWW A;  3HXM A;  2J0X A;  2BAN A;  4AQY J;  2MSS A;  1DLO A;  4NLY A;  1C1C A;  1F60 B;  3OD2 A;  2Q1L A;  3SIP B;  4FF1 A;  2BKO A;  5ITH A;  2HHS A;  1M1H A;  5HAN A;  3IAS 9;  4DV1 F;  2QJ3 A;  2HLT A;  1JLC B;  3MAQ A;  2W8L A;  4E0D A;  2F4V F;  3FUY A;  3LP0 B;  3VCD A;  2H4Y B;  3OJS A;  1WDD A;  3X3U A;  2FJE B;  4FYW B;  3TZW A;  1MU2 A;  2B4P A;  4V19 X;  4C8N A;  4X4S A;  2KT2 A;  2H3E B;  2X1F A;  2BKP A;  2XEX A;  4YS2 A;  2FVQ A;  3HDS A;  4UT4 A;  5KFY A;  3M9M B;  2NPF A;  1LWF B;  5AXK A;  4ELT A;  2QZ8 A;  3UPF A;  1TL7 A;  2FDN A;  5HSP A;  3CCU S;  5KFD A;  2KYX A;  2WSE C;  1LV5 A;  4B9S A;  3BKF A;  2EXU A;  2HHH F;  2HHU A;  4I7F B;  3R5J B;  1WC5 A;  4XPC A;  1QSS A;  4W92 B;  3M05 A;  2V6A A;  1RXO B;  2UUC F;  5F3Z A;  2YXL A;  1L3V A;  1HI8 A;  2LDI A;  4OI6 A;  2HWT A;  4WZM A;  3U1L A;  3PO5 A;  3CJ2 A;  5JUM A;  2I0X A;  3NS5 A;  4HVZ A;  1XMO J;  4MKV A;  3TEG A;  5HQ8 A;  2YNF A;  3QGH A;  1HNW F;  2QGF B;  4LIW A;  4ZMM A;  3CME S;  3MUT P;  4PAA A;  2RUS A;  4DV2 F;  4NPO A;  4PYA A;  1GTH A;  1A0O B;  4ETX A;  3D3B J;  3S01 A;  4ZVH A;  2BE2 A;  4Y2K A;  4DPU A;  3TAR A;  1P27 B;  4U8V A;  3ZZO A;  3X1L B;  2J0S D;  2BAN B;  2HHV A;  1DLO B;  5KT7 A;  2I9S A;  4AYB D;  1C1C B;  2HS0 A;  2K3I A;  2HAI A;  4JI7 F;  1URR A;  3UW1 A;  4ES1 A;  1EP4 A;  2GIR A;  4ZVT B;  1MWY A;  2ZH2 A;  4LRD A;  3ET6 B;  4C0B A;  1IUJ A;  3LUY A;  3SCI E;  1U24 A;  2AJ4 A;  5JVH Q;  1U8S A;  4ZCK A;  3NCQ A;  5EGY A;  4LVN P;  1DQ8 A;  1FTR A;  1IQT A;  2MZS A;  1H72 C;  1HNX F;  2M9K A;  1UWB A;  4DXL A;  3Q0A A;  4DV4 J;  1ZOT A;  1OY9 A;  3EVO A;  5A76 A;  2UVR A;  3PG9 A;  4C11 B;  1LWX A;  2DNQ A;  1XMQ J;  4YB6 A;  1NUE A;  2RT3 A;  2WZ1 A;  4YY3 J;  3K5M A;  2LVW A;  2KB2 A;  3F56 A;  5LM7 E;  2X1A A;  5ADZ A;  1HYS A;  5L46 A;  4PG7 A;  2F8E X;  3C19 A;  1Y7P A;  2O01 C;  4KT0 C;  1KEK A;  4KC5 A;  4PWD B;  3QRQ A;  3M32 A;  1X4B A;  1BQN A;  5KFB A;  3A8I A;  1HI0 P;  2VBZ A;  2EK6 A;  4B9V A;  2R9L A;  3DNC A;  5I3Q A;  3R6G B;  4ZIW A;  5BR8 F;  5AJ3 J;  4R8U B;  2V9K A;  1Q86 T;  5MAO A;  1NME B;  2ZVS A;  1E6Y A;  4C8Z A;  3KJQ B;  2ZDP A;  5CZX A;  4OI0 A;  4DV0 J;  1RTJ A;  1UP1 A;  3GMG A;  4CO2 A;  1S79 A;  1GXU A;  3ETO A;  5ETN A;  2OIH A;  4USM A;  5HQM A;  1REV A;  4LF1 A;  2W2Q P;  3QSI A;  4J7C A;  3BKT A;  4DUY J;  4M5I A;  3HFZ B;  4DSF A;  4ECW A;  2ABY A;  3FK4 A;  1NJX A;  3K7R A;  5RUB A;  3CC7 S;  4YB7 A;  1BXN A;  3V6D B;  3H5U A;  2HZV A;  2AYM A;  3NGU A;  2M5Y A;  3SCL E;  2RS2 A;  3EDR B;  4LFA F;  5KT5 A;  3G8S A;  2VJU A;  3RRH A;  3C3L A;  2LP4 A;  1EP4 B;  5KFN A;  2HHT A;  3QFW A;  3G2X A;  1WG1 A;  2WVF A;  1OO0 B;  3VF0 B;  3CIZ A;  5LXR A;  1NK5 A;  4FS1 A;  3PEH A;  5KTQ A;  3KMQ A;  3CSK A;  3TX0 A;  2P9C A;  2G9O A;  1YJV A;  4L72 B;  5KFP A;  2NQP A;  1UWB B;  1VQ5 S;  4DV3 F;  2W8K A;  1GMV A;  3E2E A;  1TTH B;  2KT5 A;  1U45 A;  3UDL A;  5HAT A;  3FMW A;  4ANC A;  1NK6 A;  3HM9 A;  2F40 A;  1Q82 T;  3TNV A;  2BMB A;  3H98 A;  1ZZF A;  2XO6 A;  4P75 A;  1ZM3 A;  4FYX B;  3G8T A;  3U7J A;  1HYS B;  2YKQ A;  1V9O A;  3I4P A;  5D15 A;  1JLB A;  1W7W A;  1JJC B;  1BQN B;  1RIS A;  3PR5 B;  3TAQ A;  2Z2Z A;  5DQG A;  1RAH B;  3Q89 A;  5F41 A;  4PEO A;  3FNN A;  2VG5 B;  7FDR A;  3VAG A;  3NCR A;  1OJ4 A;  3P5B P;  2B0G A;  1QUV A;  1YJ7 A;  3ISZ A;  4OIX A;  3TW0 A;  5LMN F;  1D1U A;  3W8P A;  1CLF A;  4UZC A;  1RAC B;  2AWZ A;  1RTJ B;  3PYE A;  2R7Q A;  4LFB J;  3QO9 A;  3GP9 A;  3W65 A;  3OQ2 A;  1REV B;  5L9N A;  3K5O A;  4ES2 A;  2RD5 C;  5JJB A;  2KN4 A;  4LSN A;  2HHQ A;  1NSP A;  1CUL A;  3MEE A;  3HSZ A;  4H4M B;  3IG1 A;  2E7V A;  4N47 A;  3QWP A;  2FUG 9;  1VQY A;  2KM8 C;  2FGC A;  1K44 A;  1QUP A;  2ZHB A;  4LBI A;  4EWT A;  4N76 A;  2KT3 A;  2KJW A;  4MKA A;  3HHE A;  4QIW D;  3C16 A;  3H40 A;  2IHR 1;  1D8Z A;  2CPF A;  1YI2 S;  1QAJ A;  4YQW A;  2M7S A;  1RCO B;  4PQA A;  1YQH A;  3KHR A;  1ZA1 B;  2CQC A;  4I4B A;  3CPW R;  5HLF A;  2PN6 A;  1KOH A;  3UNG C;  3O1L A;  2VJV A;  4LFC J;  2V2K A;  4YME A;  1DY3 A;  5D78 A;  4NCA A;  2BV3 A;  3JSB A;  4DL2 A;  4RKU C;  2A2C A;  3CCT A;  3CCW A;  2YY3 A;  3D6F B;  2J7U A;  3BRE A;  3UWT A;  2DO4 A;  2U1A A;  3UDV A;  5DLF A;  5DET A;  1MW7 A;  1N5V A;  1RKI A;  3SDE A;  4OI1 A;  2B43 A;  1VQ4 S;  8RUC A;  3JYT A;  2FLN A;  4UTG A;  2UVV A;  2PI5 A;  1RHR B;  4KR0 B;  3GG1 A;  3GR1 A;  1RT3 A;  1PIL A;  4JUZ A;  4D3G A;  2HHX A;  1NJY A;  1V5I B;  2PA3 A;  3DRX A;  3TZY A;  1S9F A;  3K5N A;  1YTY A;  1JXE A;  4FXV A;  2X1B A;  1SQF A;  1XR6 A;  1XMQ F;  3D6H B;  4WFX A;  1BUX A;  3HLU A;  3QNW B;  2FY1 A;  4IUF A;  2E5H A;  4W90 B;  1FRM A;  3M6V A;  1JK9 B;  1DQA A;  4CTA B;  4IG3 A;  1HWI A;  2Z4P A;  2OJ3 A;  2CVI A;  2XTJ P;  1KHW A;  1UWA A;  1X0F A;  4LMZ A;  3W5X A;  4A4J A;  2E5I A;  2EWH A;  5ETV A;  4WCE Q;  3QO9 B;  4NA1 A;  2OPR A;  5KT3 A;  3M6X A;  1NO8 A;  3S7R A;  5J2P A;  4LSN B;  2YKM B;  1CUL B;  3MEE B;  4B08 A;  1FJE B;  5IZH A;  1X4G A;  1X4D A;  1PAU B;  2AMC B;  4M5N A;  4TY8 A;  2VV5 A;  4DV0 F;  4OYZ A;  4LF4 J;  2ZBQ A;  5D6G A;  2ZC3 A;  2XY5 A;  3MFI A;  2UP1 A;  1H98 A;  1N88 A;  4OZ1 A;  2VQE J;  4JI8 J;  3C16 B;  3I87 A;  2N7C A;  1RT4 A;  4DUY F;  1FES A;  4L6V 3;  2HQI A;  4LJM A;  1OWX A;  1U6Z A;  3J7Y U;  3UCU P;  4ZP9 A;  1E6V A;  5C24 A;  5ETS A;  4OZN A;  4CWB A;  1R6Y A;  3TX8 A;  4DCO B;  4K4X A;  4S0M A;  3HHN B;  2P6T A;  2OUG A;  3RRK A;  3BBB A;  1D09 B;  2CA9 A;  2DHA A;  3HD1 A;  1TMM A;  5DLG A;  1RWP B;  2OML A;  3RAX A;  3GFZ A;  5LOQ A;  1IBL J;  2ROG A;  4J9R A;  1GAO A;  1NK4 A;  1O5J A;  5HAO A;  3F73 A;  3CMQ A;  4ZVG A;  4BHQ A;  1KQS R;  4AXI A;  2GV1 A;  3JSR A;  1ZM4 A;  4WP8 A;  3SDE B;  2EBG A;  3CD7 A;  4O4R A;  3JYT B;  4HDG A;  5HRO A;  1SKW A;  1YWX A;  1D3W A;  1YJR A;  5KG4 A;  2ZBI A;  5IQ6 A;  1RT3 B;  4QYZ K;  2K3K A;  1C0U A;  1EB0 A;  3HKZ D;  3M9N B;  1VRT A;  3HZG A;  3WC0 A;  2BM1 A;  4KHR A;  1WKK A;  3IWX A;  2ROP A;  2YNH B;  2P9G A;  3CCS S;  2B7C B;  4DR4 J;  3BO4 A;  2CPE A;  1S72 S;  4ZN3 A;  1OIA A;  5CZV A;  4HI2 A;  4XDD A;  4I2P A;  4UUX A;  5L1J A;  2OPP A;  1RAF B;  3AH6 A;  3HT3 A;  3B6B A;  2RRB A;  3PYF A;  1RTD B;  4OYW A;  5AXN A;  3OUY A;  3NKY A;  4H4O A;  1FFG B;  2CG8 A;  4ED5 A;  3B4D A;  4CI0 B;  1ROF A;  3FDS A;  4ZPC A;  2IMW P;  4KH0 B;  4ZPW R;  3I32 A;  1SJR A;  2OPR B;  1WD6 A;  2RU9 A;  1QTN B;  2LXI A;  4NML A;  5J2P B;  3CJR A;  2OKQ A;  1YRT A;  4IH5 A;  3NLC A;  4NLQ A;  3KJN B;  1Q8I A;  4C97 A;  2ZH8 A;  1BC6 A;  1B70 B;  1LK7 A;  1EJ7 L;  1WHW A;  5ETK A;  2FJD B;  4LFB F;  4FPR A;  2AF6 A;  4KQZ A;  1LWE A;  2DCL A;  1SC3 B;  3PYG A;  4TN2 A;  1R8H A;  1V5V A;  2IM2 A;  1X4C A;  1M5O C;  3TWZ A;  1VGY A;  2GMH A;  2VUG A;  2MQM A;  3UO0 A;  3D3C J;  4ILL A;  2AEJ A;  4RW6 A;  3KLI A;  1FX4 A;  3LAN A;  1E6V B;  3UFC X;  5GMD A;  4DV5 J;  2JEJ A;  5LJ3 Y;  3AOA A;  1CQM A;  4WF9 Q;  5FLX U;  2HGN A;  1TK5 A;  3MM7 A;  2UUB F;  4BC7 A;  4I6Y A;  2X3G A;  1U1P A;  1KFD A;  1K1Q A;  3KHH A;  2PC6 A;  5SUH A;  2FYX A;  2DBB A;  1XWL A;  2M0G B;  1UVJ A;  1VQ7 S;  1FKP A;  3W8G A;  3CO9 A;  3MCS A;  4HT5 A;  1QDU B;  3VWS A;  1N6Q B;  5E3A A;  3FFI A;  3C14 A;  4PYD A;  2GVZ A;  4LBP A;  1FHT A;  3R97 A;  3O2I A;  4XPE A;  1C0U B;  3CJK A;  2EFG A;  3ILI A;  2WON B;  4ANE A;  1VRT B;  1CJT A;  5KFU A;  4QJV A;  3SMZ A;  2N3L A;  4LRF A;  4F4W A;  2R2T A;  1G4C A;  1D9A A;  4MIB A;  4ZDN A;  4JYA F;  5KFI A;  2FZC B;  3CCQ S;  1VBK A;  2IVM A;  1KVK A;  1YLX A;  3DC2 A;  3G4S S;  2RAQ A;  4M5H A;  2ZBR A;  2OPP B;  4Q43 A;  3BEG B;  4LF9 F;  4H4O B;  4OMF G;  2ERR A;  1FDB A;  3FMB A;  5A0Y A;  2Y1R I;  3QZ8 A;  1JLQ A;  4AL7 A;  2BJ1 A;  4IO1 A;  3DOL A;  3G96 A;  3BR9 A;  3FEZ A;  2VFT A;  1YHQ S;  4K5S A;  1VHI A;  2LA6 A;  2IRY A;  1YJN S;  2VDI A;  2D3Z A;  2IMO A;  4DF4 A;  2JLE A;  1HPZ A;  4OX8 A;  3VZI A;  3HI9 A;  1Y10 A;  1R89 A;  4DF8 A;  2JL9 A;  1JLG A;  1P1T A;  3KLI B;  1VCT A;  2MQL A;  2XNQ A;  2R8G A;  1PC5 A;  4OZL A;  4RR5 A;  2MZQ A;  2J9D E;  1T3O A;  2AEM A;  2QSF A;  3Q23 A;  4I1T A;  4KGM A;  2HQD A;  4JI5 F;  3V6J A;  3FQL A;  3EVW A;  3MM7 B;  2BOA A;  5EWG A;  2NSC A;  3EDQ B;  3H4D A;  2LYV A;  4IOC Q;  4NCG A;  4JI8 F;  1L3K A;  1TZ0 A;  1KTV A;  5KG2 A;  2QFI A;  3ZTS A;  4FN5 A;  2WW4 A;  1IR2 A;  1T9W A;  4KE5 A;  1UET A;  2Q79 A;  2HVD A;  4G65 A;  1OSD A;  3NGK A;  3MM9 B;  4MK8 A;  3CJQ A;  1FKP B;  2GQQ A;  1GFW B;  1Z1Z A;  2DNR A;  4C4W A;  5JMN A;  1RZM A;  3KLE B;  3WDO A;  3C14 B;  2B56 A;  1IKW A;  4DPX A;  2GVZ B;  3PW7 A;  2CPX A;  2KU7 A;  4KHP J;  5KFJ A;  3K8V A;  3I0R A;  4HTI A;  3CJK B;  3G6Y A;  1HD1 A;  1CJT B;  3MR7 A;  3A1Y G;  5LJ5 Y;  5HMZ A;  4C98 A;  5I42 A;  2K8G A;  2CZ4 A;  2EI5 A;  3FBE A;  5K20 B;  4BWJ A;  3A8J A;  2E44 A;  4YUD A;  5A2Q Y;  2PDA A;  1FXR A;  1LQ9 A;  1N36 J;  2IBK A;  1C4A A;  3BSO A;  2N4D A;  3DDI A;  2M8D B;  3MF5 A;  1JMT A;  4DFP A;  1HHT P;  2IRU A;  5C25 B;  3POT A;  1HWJ A;  2AU0 A;  4JP8 A;  5KFO A;  3DXB A;  3OFG A;  1JLQ B;  4PCQ A;  3S1T A;  2XB2 D;  1UVK A;  1GXT A;  4O3N A;  5IXU A;  4DR2 J;  1HMV B;  2IYI A;  3N0V A;  4ELV A;  2OEM A;  4ECS A;  3AOC A;  3OSN A;  4C8L A;  3I4H X;  1PBU A;  3PJW A;  1HPZ B;  4JV5 J;  5CQG A;  2R7T A;  3GFH A;  4LF5 J;  1JLG B;  2V4J A;  4J9O A;  2VZ9 A;  1F2G A;  2LU1 A;  3GCW P;  1LEO A;  1HQE A;  4LVO P;  1T9V A;  4P2F A;  3KDN A;  1XR7 A;  2RF2 B;  4DR5 F;  2BQ3 A;  4J9M A;  2XMW A;  2PD1 A;  2OEJ A;  4UY8 T;  2QA2 A;  4NCG B;  4DZ6 A;  5GAG I;  5DDP C;  2UUA J;  1TKX A;  2HS3 A;  5E41 A;  1T8E A;  3QFH A;  3EXY A;  1YDL A;  2CDR B;  1UL3 A;  3ADA C;  2FJW A;  1SUQ B;  3BM7 A;  1M1G A;  3KK1 B;  3NXZ A;  4DV5 F;  4C6A A;  3MTJ A;  2J7W A;  5KFL A;  1X5O A;  3GIL A;  5HL7 Q;  4YR2 A;  3ONQ A;  5ETR A;  3QAT A;  2FJX A;  2K7K A;  1IKW B;  1I51 B;  1HFE L;  2NXN A;  2LU2 A;  3P5T L;  3SCK E;  5LMU J;  3I0R B;  2Y1I A;  1G3O A;  4L75 A;  5H9F K;  1R7I A;  5EHH A;  2QIF A;  4ZIT A;  4IQX A;  2MY7 A;  2EFO A;  2RU3 A;  4PUO B;  3H7H B;  1RAJ A;  4ZJO A;  1VQN S;  2HBZ B;  1VHF A;  4LRE A;  2B51 A;  2C2Z B;  3TJ9 A;  4FVC A;  5C2C A;  4J9V A;  1IM6 A;  1RTZ A;  3L7P A;  4NE9 C;  4HAC B;  3I5A A;  3POT B;  2KZZ A;  2B6A A;  3M30 B;  4U9R A;  2I6W A;  2FZK B;  4EZ9 A;  2BE9 B;  2HND A;  4ECX A;  3M2R A;  1YGY A;  2B4U A;  1ZH5 A;  4A8W A;  5G0R A;  3N01 A;  3JQK A;  2V2Z A;  1TL3 A;  2XMJ A;  2NUU G;  4LQ9 A;  3PHT A;  4R0E A;  2LCW A;  3J81 U;  3UNY A;  1IWA A;  2B9W A;  1REG X;  1RT7 A;  1SJ1 A;  3FSX A;  3OLA A;  4JOU A;  2R4F A;  2XQC A;  2FJA B;  1XK8 A;  3N5F A;  1RWW B;  3I96 A;  1KDN A;  4HR2 A;  4RL1 A;  1NJZ A;  4FS2 A;  3ILL A;  5KFM A;  1CG2 A;  3GWC A;  5L8R C;  4ZVO B;  3KK2 A;  2V4J B;  3T1A A;  4DR6 F;  2V2V A;  3I9Z A;  2NCK L;  3BO2 A;  2CQI A;  2QSW A;  1F3V A;  1SXL A;  3LPY A;  3Q8U A;  2V4Q A;  2MQQ A;  3HSD A;  1I94 F;  4ICL B;  3OR2 A;  4Q8E A;  1TKX B;  4OV6 A;  4AUK A;  2FVS A;  2CQD A;  2WVB A;  4NZ6 A;  4LF6 J;  3L09 A;  4Q0B A;  3GLJ A;  2GHW A;  1CS4 A;  2DXD A;  4NA3 A;  1Q8B A;  2AJQ A;  4KGX B;  3EJM A;  1WI6 A;  2K1R A;  3D6M B;  3LO3 A;  3DOM A;  2R7O A;  4JBC A;  2DR6 A;  2FB0 A;  1XJW B;  1BY9 A;  2Y1L B;  5HJX A;  5J1N A;  1DQ9 A;  3OTO J;  2OFH X;  4J9U E;  1NCL A;  4RZR A;  2HFN A;  2FLP A;  4BC9 A;  3G71 S;  5GAD U;  1NXI A;  2K7J A;  5KFH A;  3ZZR A;  2X51 A;  2QA4 S;  1EIY B;  1DFD A;  1KTQ A;  1RT5 A;  1JJH A;  1RAA B;  3NGR A;  3I5C A;  4OYO A;  2JWN A;  3H42 A;  4DBQ A;  3BR8 A;  2AD9 A;  3DU6 A;  1N32 J;  4TYB A;  4J9Q A;  4QU6 A;  5IFM A;  2MKH A;  2HND B;  2AGO A;  1N36 F;  2SXL A;  5G0R B;  5CD4 H;  4CZC A;  2YPY A;  1TL3 B;  1RWU A;  3EZO A;  2DR8 A;  3I5B A;  3MPY A;  2ZJP Q;  3OHA A;  4Y0F A;  4PZV A;  3FQK A;  2EFQ A;  4MIA A;  5HO4 A;  1NDC A;  4HL9 A;  4DV6 F;  3OVS A;  3LOU A;  4FF2 A;  4QIE A;  4ID5 A;  2MKC A;  2UU9 J;  4IFY A;  4KHM A;  2UUW A;  5IV3 A;  1HL6 A;  3KK2 B;  1KS2 A;  1MSW D;  5EWF A;  2CG4 A;  4WXO A;  3W1Y C;  4GO5 X;  2KRB A;  3OHB A;  5LSL A;  2Q6B A;  2MKI A;  1S1V A;  5L1I A;  1K9M T;  3OR2 B;  4NOH A;  4JV5 F;  1VQL S;  4CRJ A;  3HJF A;  1RYS A;  4JI1 J;  2R7X A;  3AD7 C;  3DKD A;  4LF5 F;  3UI3 A;  3UCZ P;  1M0S A;  4J9K A;  2F9J A;  5AE3 A;  5HI7 A;  3OXF A;  2UXB J;  1QE1 A;  2G1D A;  4Q0B B;  6AT1 B;  4DX5 A;  1UPM B;  2XBP A;  2K1R B;  2UUA F;  3BKU A;  1NLK L;  3DOM B;  3H8Y A;  2HKE A;  1KNZ A;  2B9E A;  3KWM A;  1U8W A;  2GAH C;  3THP A;  3W64 A;  4CLK A;  4USH A;  2A6O A;  4ECQ A;  3MM6 A;  2B9Y A;  1VRU A;  2PMW A;  3TUI C;  2LEC A;  1S1X A;  2YWW A;  4F4X A;  3W9I A;  1U6B A;  1RSC A;  2KFN A;  3HP6 A;  5FLX Y;  2VBW A;  4ZLP A;  1UA0 A;  3R3T A;  1YJ9 S;  1RT5 B;  3QYY A;  2RSQ A;  2GO8 A;  1NKB A;  3OW2 R;  4CDI A;  2DJW A;  4USV A;  3AD9 C;  3LWL A;  5D4L A;  1Y5L B;  2NXC A;  2AQ4 A;  1XTZ A;  4YR0 A;  2AP6 A;  1D0E A;  3RR8 A;  3B54 A;  5A8K B;  1ZBT A;  5L38 A;  2VL1 A;  4K4W A;  4U8Y A;  1K1S A;  2R7V A;  2RQ4 A;  1RU2 A;  1LKZ A;  1WC6 A;  2DT9 A;  3NOC A;  5ETT A;  4CCH A;  4OFZ A;  3F41 A;  2CPI A;  4ID5 B;  4B9M A;  2PEH A;  4IFY B;  4JI6 J;  1OYE A;  3MGJ A;  1HWU A;  4PXB A;  1KN6 A;  3I6P A;  1UFL A;  1L3U A;  2D3O R;  2EVZ A;  2ZD1 A;  5AXM A;  2U2F A;  2BAC A;  3HUL A;  1S1U A;  3DN9 A;  2HVZ A;  2X3D A;  3DOK B;  3KDO A;  2DRB A;  4DZD A;  2HSE B;  5CAB A;  1H74 A;  3ULH A;  5KAK A;  2JHE A;  1QE1 B;  2G2O A;  5BXI A;  2HFO A;  3D7S B;  2FC8 A;  3IRX A;  2KG0 A;  1FE4 A;  4X62 J;  3I9V 9;  3SXL A;  1N5Q A;  4UF4 A;  4R0J A;  4QCL A;  2HQG A;  5AT1 B;  3Q2S C;  4ZN1 A;  2A6M A;  2LXU A;  5KFW A;  3LP1 A;  1YBU A;  4ETZ A;  2F8H A;  4H54 A;  4CO5 A;  1BWV A;  3MM6 B;  4IQM A;  1VRU B;  3TOQ A;  3EVM A;  1X0P A;  1U0S A;  2ILY A;  2R7W A;  3K17 A;  3PXG a;  1NJI T;  2BW7 A;  2DR5 A;  2FVP A;  1ZS6 A;  3GV5 B;  2IAJ A;  5DZ7 A;  4B3M J;  1C0T B;  3U27 A;  4QZV B;  1WNE A;  1WDT A;  3O44 A;  1HIY A;  1GX6 A;  5DS7 A;  1U2F A;  2DXE A;  3RW7 A;  1NSQ A;  3CF5 Q;  2XLK A;  1RLD A;  1X8D A;  1F5A A;  1X5S A;  1PYS B;  3Q8S B;  4DQQ A;  3EUN A;  1U7L A;  3OSP A;  1PCA A;  1N32 F;  1Q1K A;  1RT2 A;  4DUZ J;  4EK2 A;  3VAF A;  2YX4 A;  4CO0 A;  3HD2 A;  4C2M A;  4DWI A;  1OQ6 A;  4UOC A;  1T0T V;  1VC6 A;  3MR3 A;  3BGR A;  4JV2 A;  1FE0 A;  1BHN A;  3CED A;  4PQU A;  1HNV A;  2YTC A;  3SYZ A;  2D7S A;  2JRS A;  1NHU A;  1YKW A;  2ZD1 B;  1PGZ A;  3RZA A;  1NZA A;  3K89 A;  4K4U A;  3R27 A;  3KUG A;  2W01 A;  5EN1 A;  2Q66 A;  1TUV A;  4EMD A;  3V5R A;  3WBZ A;  2IPO B;  5J2Q A;  5D4P A;  3PYD A;  3TO8 A;  2AW0 A;  4OI3 A;  1JLF A;  2OD4 A;  4Z7Y A;  1F2H A;  3E51 A;  2RQC A;  5E7O B;  1J5E F;  1SH2 A;  4DN9 A;  4K4T A;  3THV A;  4DFM A;  3Q22 A;  1X4F A;  2RDJ A;  1QD1 A;  4P2X A;  4G1I A;  2XZW A;  2DNH A;  3R5B A;  3MMC A;  3W2V A;  3RUB L;  2VOP A;  2DCU B;  3M8Q B;  2BJE A;  2BRK A;  4IH6 A;  1TKT A;  3SI8 A;  3EX7 B;  5EUH A;  2AKW B;  1R8A A;  2HFV A;  5IM0 A;  2ZUG A;  3KOA A;  3TYT A;  1UW9 A;  2OSR A;  2N82 B;  2BQU A;  3IO1 A;  4KV8 A;  1WC0 A;  5DO2 A;  2IAJ B;  3PW5 A;  2LMI A;  4TXS A;  2H5I B;  4KB7 A;  4FXD A;  2ADC A;  2RHS B;  2WSC C;  1NKC A;  4P7V A;  2K2P A;  3IM9 A;  1QAI A;  4KPY A;  3UD3 P;  4UW2 A;  4Y28 C;  3QT7 A;  3G86 A;  3I31 A;  4A47 A;  5L1K A;  2MQ8 A;  4M5K A;  3BQ0 A;  4ENO A;  1FRX A;  2JOQ A;  2Z57 B;  5GAE I;  2C28 A;  3BGL A;  1UEU A;  2Z0G A;  3I56 S;  2JEG A;  4EZ6 A;  4ZPT R;  2XHC A;  4LQ3 A;  5CYM B;  4ED7 A;  3BGR B;  3OL6 A;  3WQP A;  1RP5 A;  1RHM B;  1HNV B;  5KOX A;  4QR1 A;  5A8W A;  4WPA A;  2IVY A;  4GKK J;  2IRX A;  1Y3K A;  2DPJ A;  3GQC A;  4IRK A;  2GVD A;  1T02 A;  4F4Y A;  4LF2 A;  2ZOF A;  4RO0 A;  2E1C A;  4ECT A;  4DR1 J;  5I3P A;  3CC4 S;  2G2Y A;  2V0N A;  3J80 U;  2FGO A;  4B3T F;  1FEH A;  1N34 J;  1VDH A;  3IGV A;  5J2Q B;  2RE1 A;  1SQE A;  4UY8 5;  5F0U A;  1JB0 C;  1JLF B;  4ZIV A;  4FDF A;  3J81 Y;  1RK8 A;  5DDR C;  3CJ0 A;  1AFI A;  4LRB A;  3A3O B;  2B3T B;  2GFF A;  3HT0 A;  1URN A;  2H5E A;  2W7P A;  1XC9 A;  1NHK L;  2CQ2 A;  3LP2 A;  4CNY A;  3ENQ A;  1ARO P;  4AXJ A;  3MMC B;  2XS5 A;  2QA1 A;  4A8O A;  4DL6 A;  1TKT B;  2HZA A;  4OLO A;  1S4F A;  2F3J A;  3JSM A;  2VB6 A;  3IAM 9;  2IDL A;  4X62 F;  1FXL A;  2LEP A;  4XIU A;  3HJV A;  5IM0 B;  2KG1 A;  1N5Y A;  2GNK A;  3RTV A;  3DI6 A;  5AE2 A;  4B3R F;  2QA4 G;  4F7V A;  3SFG A;  3C6U A;  1O0P A;  3K5P A;  2MZT A;  4KV8 B;  4CLS A;  4ERD A;  3PRD A;  1KD1 T;  2HG4 A;  1IKX A;  2DNL A;  1UVL A;  1U2R A;  3N6M A;  3PX0 A;  1N5S A;  1IBK J;  3HVT A;  1FX2 A;  3BO3 A;  1CQN A;  3CVK A;  1Z2L A;  3R8Y A;  4OX9 F;  2AJ0 A;  4UQG A;  2L08 A;  1IQZ A;  2B7B B;  3SV3 A;  1RGV A;  4B3M F;  3T9N A;  4C0H A;  2KI2 A;  2CNO B;  2W9B A;  2QRR A;  4CH1 A;  2NZ4 A;  4Z7C A;  7FD1 A;  1HQU B;  5B08 A;  3T19 A;  2BVZ A;  3D2W A;  3QLH A;  1A7G E;  2CDQ A;  3R2D J;  1U25 A;  3CJ3 A;  1JNZ B;  3PHE A;  3A3N B;  5A8W B;  2DH8 A;  2LQB A;  1OYD A;  2GVD B;  4DQI A;  3M8P A;  4IDK A;  1HHS A;  3ITH A;  2HVI A;  2DH7 A;  4YOE A;  2EKY A;  2LQ9 A;  3TQE A;  4PXC A;  3W5Z A;  2HBR B;  1VC0 A;  3GFY A;  3MMA A;  3ZTR A;  3UQS A;  1PAE X;  2QL9 B;  3M6U A;  3GB0 A;  1LOU A;  2B5J A;  3AB2 B;  3H20 A;  2R42 A;  3ZTO A;  5IT9 U;  2WB4 A;  1Y4Z B;  2POK A;  4DV7 J;  2KO1 A;  1FXD A;  3Q8Q B;  2E66 A;  1S1T A;  3DLG A;  1P9Y A;  1SIZ A;  3VVT A;  2XSJ A;  3DRR A;  3QSY B;  2DGT A;  4DSJ A;  2Q43 A;  2A3J A;  3KNA A;  4ZLJ A;  4Y2A A;  3M1V A;  4NWB A;  1QAX A;  4Q45 A;  3OV7 A;  2XY7 A;  3TA1 A;  2V63 A;  1TKZ A;  3JSM B;  1Y0H A;  4JV1 A;  4DPY A;  1XNQ J;  4ZP8 A;  4DQS A;  4B3S F;  4CT9 A;  2ZBC A;  2IY5 B;  1X31 C;  3C6U B;  5F8J A;  5HQL A;  5E3P A;  1IKX B;  3Q2T C;  4K59 A;  4J91 A;  2VIC A;  1BD6 A;  3HVT B;  3PY8 A;  2EPI A;  2CQG A;  2EW9 A;  2QFJ A;  3MUM P;  3Q83 A;  2CJX B;  3DLE A;  5F8I A;  2V4R A;  1RQ0 A;  3N4W A;  1TL1 A;  2V8H A;  1L3S A;  4DL3 A;  2YKA A;  2XMA A;  1AXQ A;  2W9B B;  3W9H A;  2JDJ A;  3MAA B;  3WIU A;  1EKR A;  3QLH B;  1K0V A;  3MM5 A;  5IT0 A;  3IR6 B;  3TA0 A;  3FRZ A;  4AFF A;  2WVC A;  3G8Q A;  5ETO A;  1H2V Z;  4M63 A;  2C3O A;  1U4B A;  3M8P B;  2MEW A;  2DGO A;  4IDK B;  2R2S A;  2MQN A;  2CWK A;  2YWH A;  3NS7 B;  2KVQ E;  4MKB A;  4P72 A;  1HLW A;  1I1G A;  5K14 A;  3M2U A;  3MMA B;  4TU7 A;  4WE1 A;  5I3U A;  2ZJR Q;  1IJF B;  1YSJ A;  2F4F A;  4BLG A;  4WTO B;  5CHC B;  3ZZY A;  3M8R A;  2B5J B;  3RW6 A;  2VBX A;  5ETM A;  3V81 A;  3GIM A;  3IWL A;  1U1L A;  4USW A;  1IJE B;  2J0W A;  4X66 J;  1FRH A;  1S1T B;  3DLG B;  2E5G A;  2G0C A;  1KP6 A;  2XSJ B;  2QO3 A;  1QTM A;  3DRR B;  3EGV A;  2XLI A;  2ZIT A;  2WSF C;  3NOG A;  2DGS A;  1HNI A;  3CCJ S;  2HLU A;  1TKZ B;  5H1S V;  1RAG B;  1R8P A;  4I0W A;  1RAO A;  2VPX B;  5K5M A;  5DDO C;  3E8O A;  1AW0 A;  1X4E A;  5F9L A;  4LSL A;  5D3G A;  1S7H A;  1F5C A;  4DLE A;  3W2W A;  1VIX A;  1I5O B;  3AA9 A;  4Q8F A;  1CBK A;  4URS A;  2DNM A;  2DRA A;  1HR0 J;  4CNZ A;  1U26 A;  5DQH A;  2YNI A;  3EGN A;  3A13 A;  2R8H A;  2WTF A;  4DQR A;  3DLE B;  1FRK A;  2RQM A;  3IS9 A;  3R7S B;  4CLU A;  1TL1 B;  2W2O P;  4QU7 A;  5KFZ A;  1FWP A;  2OEK A;  3MWB A;  2EFN A;  2JSX A;  4OZ3 A;  4WJB A;  2HK2 A;  2VQF F;  2WVE A;  3FSY A;  3MED B;  1HQ2 A;  1VS3 A;  1MG7 A;  2RKI A;  2D3U A;  3ZZT A;  3MM5 B;  4DOZ A;  2F63 A;  3VAH A;  2CVE A;  1Y3J A;  2BEF A;  4A8S A;  1KQK A;  2MPU A;  1YJT A;  1ZTT A;  3T41 A;  4QR2 A;  3LW5 C;  5DGB A;  1RJJ A;  2W9C A;  3A12 A;  4WYW A;  2CQ1 A;  1C4C A;  1DTQ A;  2W4P A;  3JAM Y;  5D77 A;  2MHE A;  2R2U A;  2GJF A;  2RVJ A;  5K14 B;  2VFR A;  3J7A 1;  4Z2X A;  3BF4 A;  2ASD A;  1M90 T;  4RW4 A;  2RHQ B;  3NWR A;  3V81 B;  3DGP A;  3AOB A;  4K0K F;  1LK5 A;  1WG5 A;  4KGK A;  1RLC L;  2OPQ B;  3QGI A;  2ALY B;  3OXL A;  4GRS A;  3D0I E;  3UD5 A;  5E33 A;  4K50 A;  2CJK A;  1VBY A;  3ENV A;  2W2M P;  2DGV A;  1Q0N A;  3T3F A;  4DMZ A;  2J8S A;  2V2Q A;  3BPS P;  1S49 A;  1HNI B;  4DV7 F;  5F0W A;  2A1B A;  5KFX A;  3HHL B;  3G6V A;  1KLM A;  1UKU A;  2KVI A;  4U7C A;  4DR7 F;  3RB4 A;  2V9W A;  4TU9 A;  2VKZ G;  5B0E A;  3K59 A;  2Z30 B;  4IG0 A;  1LW2 A;  2IJN A;  3W60 A;  3ISN C;  2ZH7 A;  3C15 A;  4F2S A;  3SFU A;  1EAR A;  3RBZ A;  2KRR A;  5D3G B;  1D9D A;  2EG2 A;  4CLY A;  4DEZ A;  5ETP A;  1FD2 A;  1B99 A;  1WC1 A;  5DQI A;  3CDU A;  1LFW A;  3KG0 A;  1S99 A;  2JFK A;  3AQO A;  3R7N B;  4ZOS A;  2YWE A;  2Y8Y A;  1XNQ F;  1VYA A;  5F3T A;  2YNI B;  2CPZ A;  2C2R A;  3M8S A;  5A6P A;  2DR9 A;  4PXD A;  2W9A A;  3IS9 B;  3FSI A;  2DPI A;  2GJ2 A;  3RG6 A;  4USK A;  1DHM A;  3BN4 A;  1V3Z A;  4RNM A;  3BZQ A;  4X4Q A;  1OSC A;  1AA1 B;  3H5X A;  2OGU A;  2ZH5 A;  4MYT A;  4F26 A;  4E8U A;  5KFQ A;  1S77 D;  1CC8 A;  2RKI B;  4ZJQ A;  4IH7 A;  4WYL A;  4N41 A;  4FF4 A;  3M6W A;  5GAG U;  2KTQ A;  2KM8 B;  1G6B A;  1WEZ A;  4QWB A;  2W9C B;  4QYZ J;  3HSG A;  3CTR A;  5J1E A;  1YJW S;  2KXH A;  3TR5 A;  1YBT A;  4J37 A;  2E9R X;  5IOL A;  3EGZ A;  4KPC A;  3R2C J;  1MU2 B;  2XYH B;  4JI0 J;  3PRB A;  1RU1 A;  3C8Y A;  2YWG A;  3V4M A;  1T03 A;  4G3I A;  2HRU A;  4RW4 B;  3HSJ A;  4NAS A;  4X65 F;  4N8N A;  4WP3 A;  1Q8L A;  2YKO A;  3GIJ A;  3E01 A;  4KYZ A;  1TL7 B;  2AYE A;  2VKR A;  3V6H A;  4O3Q A;  3QMQ A;  3CO0 P;  1H7W A;  1QVG R;  5LXY A;  4JV0 A;  4PG6 A;  4X66 F;  3U02 A;  4C7Q A;  2E5J A;  1TAQ A;  1KVJ A;  5CYJ A;  1YX2 A;  2UVU A;  2JH3 A;  3W3S A;  2LQ8 A;  3RBD A;  1LW2 B;  1HNZ F;  3T1Y J;  3C15 B;  4QW8 A;  4ECR A;  2D3O 1;  1QM9 A;  3J80 Y;  2XY6 A;  4DFJ A;  2ACY A;  2XZD B;  3OFF A;  2F1F A;  4DL7 A;  1VQP S;  2AYB A;  2MZR A;  2YNF B;  4JI3 J;  2C2K B;  3R5G A;  4GC6 A;  2KL8 A;  4NMX A;  4AE5 A;  4LR7 A;  5CAA A;  1WUU A;  3WHI A;  3BGU A;  3Q86 A;  4QIG A;  3HVW A;  2YH0 A;  4YDD B;  3QJP A;  2BE2 B;  4GC7 A;  1U0H A;  4Z37 A;  4PPD A;  3TA2 A;  3UN3 A;  4JI2 J;  1CJU A;  5GVQ A;  3QAU A;  2UXD J;  2HRY A;  1X5P A;  4TLR A;  3HVA A;  2DO0 A;  4URQ U;  3WC2 A;  1UFW A;  3DM2 A;  4J9P A;  4O3S A;  4P7T A;  3KMS A;  3OLB A;  2LKZ A;  3CDE A;  4UOF A;  3WZ0 A;  2FC9 A;  2NS1 B;  4N5S A;  5CA5 A;  5E3C A;  2I8E A;  2CAJ A;  2ZBP A;  3NWG A;  4AQY F;  2DRD A;  2ZWO A;  1R0A A;  3V4I A;  2Z8Q A;  4L3K A;  4C8M A;  2JLF A;  3KK3 A;  4I69 A;  5A2Q U;  3T1H J;  4NZ0 A;  3D6T B;  4RUB A;  4F3M A;  1N54 B;  1JJ2 R;  4Y2M A;  3VAL A;  1WEL A;  4GVL A;  1MRO A;  1SKR A;  3TP2 A;  1FRJ A;  2XC9 A;  2B4O A;  1S4E A;  1X4H A;  2GQC A;  2L9N A;  1AB8 A;  4NX9 A;  3D5M A;  4I67 A;  2VFU A;  5HP1 A;  2ZZT A;  3DLH A;  3E01 B;  4FYD A;  1Q95 G;  1OY6 A;  5HMW A;  4LRC A;  4ZVR B;  2ZVI A;  4ZLL A;  1RAB B;  3L95 X;  1G2E A;  1IBC B;  3M32 B;  3OTD A;  3PW0 A;  3D9B A;  2M88 A;  3SSQ A;  3MPU B;  1IBM J;  4R25 A;  3ZTQ A;  3M8Y A;  3PV8 A;  4KIA A;  2CQP A;  3I0S A;  4F67 A;  1FER A;  3VGS A;  1PJ6 A;  1NBE B;  1NPP A;  2VPZ B;  2YWK A;  1P8G A;  1E6Y B;  1RI7 A;  2RIJ A;  2HHW A;  3IA0 A;  3CDA A;  2OEL A;  4M8L A;  5IT9 Y;  2MYF A;  4ED0 A;  1UVI A;  2MTL A;  1S5Z A;  1XMO F;  2NXU A;  4CLT A;  4PWU A;  5D8H B;  1M5H A;  2AIR B;  3VZH A;  1PC4 A;  1FD8 A;  3CDW A;  1U0H B;  3J7A N;  3RYL A;  1PIE A;  3MEC A;  3NGD A;  2DKO B;  1YBA A;  4N56 A;  2QLW A;  2RIL A;  4C8O A;  2D1C A;  3SEO A;  1CJU B;  3OTB A;  2JFD A;  2R3V A;  2YNG A;  2QEX S;  4F2R A;  3BPD A;  3GG0 A;  4OZ0 A;  3IWN C;  2W2N P;  4H4K C;  4OJG A;  2B8P A;  1VBX A;  4C9D A;  1DZ5 A;  2GGP A;  1O6X A;  2W24 A;  3VR1 A;  3IGN A;  4L76 A;  1NSK L;  2ZHA A;  2HIQ A;  3V4I B;  2ZEJ A;  1XN9 A;  3KK3 B;  4NCB A;  4I6W A;  2MZJ A;  3U1M A;  4B9L A;  4X4T A;  4OX7 A;  4F4A A;  4Y65 A;  2E9T A;  2WOM A;  4Q5V A;  1HWL A;  4Q44 A;  1MRO B;  1HD0 A;  3T9Z A;  1QY7 A;  2IM3 A;  5KG1 A;  1JJ4 A;  5CYQ A;  1T9U A;  1JX4 A;  2XMU A;  4HI1 A;  2PO4 A;  2JNJ A;  2O67 A;  4JI0 F;  5AXL A;  3WX4 A;  1AT1 B;  1WJ9 A;  2CZV C;  3NNH A;  2F9D A;  4WBF A;  5DJB A;  4DV4 F;  2M8H A;  2VG7 A;  1JLB B;  5C2G A;  3PAC A;  4OHW A;  1GH8 A;  1U1Q A;  3N79 A;  5J2N A;  4TNO A;  1R43 A;  2DXF A;  4P10 A;  3QGP A;  4YY3 F;  4A8X A;  1JQG A;  5DGA A;  4WFA Q;  3AB4 B;  4UUW A;  4NLT A;  1O51 A;  2AZ1 A;  1EZZ B;  5IQQ A;  1X9W A;  4TLQ A;  2Q3P A;  1FKO A;  1RB0 A;  1FJG J;  4NLW A;  3MUR P;  2R7S A;  1UMJ A;  1SJQ A;  3EYZ A;  3KHL A;  5MLC V;  2PFD A;  1RHK B;  2GX8 A;  2VAS A;  2XUL A;  4FNH A;  5HJY A;  2D9P A;  2MLZ A;  2J0Q D;  3TUP A;  5E3R A;  2MGZ A;  1AZS A;  4Y34 A;  5AJ3 F;  3V2U C;  5F8G A;  3J81 j;  2IJF A;  1OQ3 A;  2F65 A;  4RU9 A;  1T9T A;  5HK4 A;  4Y6I A;  3IG1 B;  4JI3 F;  5FJ4 A;  2JEF A;  3MEC B;  1U1M A;  3EE3 A;  4ZPA A;  3GSI A;  2HMI A;  1Q7Y T;  4QIV A;  1U48 A;  4KFB A;  2V50 A;  1TL5 A;  3LA0 A;  4KGZ B;  2XM3 A;  4ED4 A;  2AT1 B;  2GGP B;  3FZ2 A;  3AQP A;  2AHO B;  3NNC A;  4HTJ A;  3DCA A;  5HLF B;  4DSI A;  1GXL A;  5H9F J;  1Q5Y A;  1EX8 A;  4LRA A;  4Y3C A;  2WOM B;  3IM8 A;  5IWA J;  1CSJ A;  2NUH A;  2HWH A;  2KYZ A;  3EMT A;  5BJR A;  3BYP A;  4I56 A;  1RBL A;  5CYQ B;  5HMX A;  3RU0 A;  1NM2 A;  3GJS B;  3T1H F;  3D66 A;  4B3O A;  1SI9 A;  4HT7 A;  4V1A k;  3GSD A;  3OL9 A;  4KKO A;  2DHH A;  2FQQ B;  3L7O A;  1RBO B;  2ZJQ Q;  1HNW J;  3PZP A;  4DL4 A;  5K9F A;  1VOM A;  2AGQ A;  4GVB A;  4X4U A;  5D0R A;  4CYU A;  1PSD A;  2RRN A;  2VG7 B;  4DV2 J;  5T41 A;  1DBD A;  3ETM A;  2FJV A;  1ZPV A;  4OJ1 A;  2ALZ A;  4M5L A;  3NGT A;  1ICE B;  2GC8 A;  3GII A;  3ZZP A;  1JXL A;  1TKD A;  4NRU A;  3MPD A;  3GJR B;  1S97 A;  2NZC A;  3CGI A;  1ZM2 A;  1F0X A;  4IG3 B;  1FKO B;  3OBI A;  2KHC A;  2YBV A;  5KG5 A;  2J6U A;  2QG9 B;  2IVF B;  2XO7 A;  1IBM F;  4JI7 J;  2HW3 A;  2W7O A;  1GMW A;  2MGZ B;  1T11 A;  2DNG A;  2CPD A;  4DUT A;  3MEG A;  4PXE A;  3HFV A;  1ULR A;  2CWX A;  3FKB A;  5C5J A;  1Y00 A;  1VIS A;  2UUT A;  5CXT A;  2D74 B;  3ZFV A;  4MK7 A;  2FD2 A;  3P3D A;  5FII A;  1SJ3 P;  5SZT A;  4TY8 B;  3VHQ A;  4YN3 B;  3D0H E;  1ZPW X;  5K8M A;  5F8H A;  2KDO A;  4E98 A;  1HNX J;  4KFB B;  1L3T A;  1GMW D;  1S9G A;  2BKN A;  1RT4 B;  4U67 Q;  4XAK A;  4K4S A;  2L3M A;  5C24 B;  4OI2 A;  5KG7 A;  2HVH A;  1T7P A;  1U09 A;  2GIQ A;  2I38 A;  2PT0 A;  3CCV S;  4OLP A;  4OJ3 A;  2NYH A;  4IFV A;  2J6S A;  1KFS A;  2BAB A;  3W5Y A;  1MN7 A;  5AE1 A;  4CM0 A;  1UZH A;  4PAB A;  4CLZ A;  2J9D A;  4LR9 A;  1FJ7 A;  4ZLN A;  5B0D A;  2CPY A;  2FVR A;  2MXY A;  1RWX B;  1NPR A;  4K4Z A;  3PFO A;  1XIQ A;  2DHG A;  1PYT A;  5J2M A;  5ETL A;  4WXW A;  2NR0 A;  2JVO A;  4Q2M A;  5EX0 A;  3R5C A;  1KR4 A;  1WEY A;  5BR8 J;  1R27 B;  1U1N A;  1FVQ A;  2MDA A;  3TZX A;  2CJB A;  1WI8 A;  2LXF A;  3C46 A;  4LFC F;  4M95 A;  2VC0 A;  3MZI A;  3FBC A;  3EPG A;  4KKO B;  5HRO B;  4M1K A;  2C22 A;  3IFE A;  2HFZ A;  3TVK A;  2CXE A;  1QVF R;  7AT1 B;  4CYU B;  1BLU A;  3IP0 A;  2QT7 A;  4HHH A;  4PPZ A;  1EQM A;  2HBY B;  3DDN A;  3IMQ J;  2MKK A;  1AYE A;  4FKY A;  3TUZ C;  4XO0 A;  4WU2 A;  1S1W A;  2RH3 A;  4I2P B;  4EYI B;  4X64 J;  4ES3 A;  1K73 T;  1TQL A;  1RT6 A;  4FBT A;  1RWM B;  1H2U X;  3OUY B;  2BE7 D;  3A8E A;  2UVW A;  1NK7 A;  3D1H A;  2KHD A;  4LFA J;  1OY8 A;  2HVE A;  4Q7A A;  4R5P A;  1UJ4 A;  2PSZ A;  1V6H A;  4QYR A;  4QIF A;  3CCR S;  2BM0 A;  3MEG B;  4JI4 J;  2RUG A;  2H1Y A;  2CZ9 A;  4UQT A;  1Q16 B;  1ZAV A;  3MOJ B;  1FJG F;  4YDX A;  4ZHR A;  5GAE U;  1QSL A;  3AD8 C;  1RA6 A;  1FKA F;  3LPE A;  1YK9 A;  1LWE B;  2GML A;  2HRT A;  1SCJ B;  1G7C B;  1WHX A;  1MWZ A;  4QBU A;  4DV3 J;  2J8A A;  1S9G B;  3CUN A;  3ET6 A;  4RW6 B;  5B0A A;  1X5T A;  4WFN Q;  4RU2 A;  2MKS A;  3B8H A;  4LF4 F;  1R0C B;  4ZK7 M;  2LA4 A;  4IFV B;  5KG0 A;  1P9Q C;  2JVR A;  4LUB A;  1SC1 B;  1W26 A;  4U7U D;  1Q4R A;  2VQE F;  5F8M A;  4OJH A;  4C11 A;  3DRY A;  5IC4 B;  2CAD A;  2YQ1 A;  5J2M B;  3SQO P;  4ECV A;  4HHJ A;  4IRD A;  3N28 A;  2L9W A;  1CJV A;  3DRP A;  3FBB A;  4LSZ B;  2UV8 G;  2D41 A;  3RBX A;  2ZOM A;  4KAI A;  4MK9 A;  3ZNU A;  4F0M A;  2MQP A;  4PWD A;  2GA7 A;  2IIH A;  3L4B C;  2CKW A;  3KLF A;  1IBL F;  5LMN J;  3FFI B;  3EIC A;  4CP5 A;  4ED1 A;  1S48 A;  5LL6 d;  2XMT A;  4ATN A;  1YRU A;  3M2V A;  5IWA F;  2RDD A;  4NI2 A;  4B02 A;  1B3T A;  1U6F A;  1AUS L;  1U2C A;  3OL8 A;  4P9S A;  1Q7L B;  4R8U A;  4M94 A;  3DLL Q;  4OHX A;  3FJ2 A;  2J9E A;  1VLY A;  4ZJL A;  4U95 A;  1S1W B;  5HMY A;  2CQH A;  3GPA A;  4J90 A;  3K58 A;  1RT6 B;  1S10 A;  2FIU A;  4IRC A;  4RBV A;  1GNK A;  4PR6 A;  3RB0 A;  2BXJ A;  2V94 A;  1NH8 A;  4R5P B;  1FA0 A;  4LT6 A;  4DR4 F;  4DHV A;  4PG8 A;  2DVI A;  3FCW A;  1FNX H;  5A0Y B;  4NLG A;  1X7V A;  3EPI A;  1S7I A;  5DDQ C;  2VF3 A;  4ILR A;  2BR0 A;  4EBE A;  2LEB A;  2GIF A;  4C3K A;  3V6D A;  1PBA A;  3DOL B;  4ZHR B;  2FVC A;  3LAL A;  2HK3 A;  1LFP A;  1KHV A;  1SB6 A;  1HKA A;  2X7I A;  4KH1 B;  2IM0 A;  3VV2 B;  3DLB A;  3IRW P;  2P8I A;  5C7P A;  5KT6 A;  3BV8 A;  2IA6 A;  2YVS A;  4C0O C;  1J27 A;  2E29 A;  2OO4 A;  5GME A;  3PTW A;  2XS7 A;  4DCJ B;  2I1R A;  4YFU A;  4N7T A;  4OV1 A;  4P73 A;  3FRY A;  4HLB A;  2VFS A;  2R2R A;  1F9F A;  4DX6 A;  4F0K A;  1F9E B;  1N0U A;  2QLB B;  1WKJ A;  1CJK A;  5B0F A;  2BRL A;  4HKQ A;  1VC5 A;  1T05 A;  1JLE A;  4NLS A;  2Z58 B;  2DK2 A;  2KZM A;  2IA0 A;  4MAK A;  3DLK A;  1YZ7 A;  2AX1 A;  2MLY A;  1CJV B;  3DRP B;  1X4A A;  2PE8 A;  3PM9 A;  1YG0 A;  3KLF B;  4O3P A;  1EAY C;  1K8A T;  3BQ1 A;  4KGV B;  2M3D A;  3NBP A;  1FNM A;  3M2V B;  2IFX A;  3D4J A;  4NI2 B;  2OHD A;  2I2Y A;  2HGM A;  3C66 A;  2VG5 A;  2WAQ D;  3W61 A;  2JEI A;  2QLJ B;  5I42 B;  1FVS A;  2G4B A;  3OFH A;  1YVF A;  5EDW A;  4CLL A;  1KQG B;  4EU0 A;  2J6T A;  5KFS A;  3ZTP A;  2AGP A;  3TAP A;  1X60 A;  2VIH A;  2HNY A;  2HEK A;  4QWC A;  4DL0 C;  2NSB A;  2H48 B;  2XGP A;  3K8W A;  2AJF E;  3H4B A;  1P1L A;  1VK3 A;  5BYR A;  1LXJ A;  2ZE2 A;  2NYI A;  4UOH A;  4OYM A;  5T14 A;  4L3N A;  4H4M A;  1NK8 A;  3KTQ A;  4IYQ A;  3VGU A;  3D54 A;  3FEY B;  4G6V B;  4X64 F;  1FNO A;  2J5A A;  1T95 A;  1N4L A;  2C2M B;  3CE8 A;  4O3R A;  2IBO A;  4FKX A;  1SC4 B;  3FCH A;  1TUW A;  2WK4 A;  1A9N B;  2C3U A;  1KON A;  3AJD A;  4X4O A;  2BJ7 A;  3J7Z 5;  1S0N A;  4JI4 F;  3CCM S;  3OXG A;  1RUS A;  4ER8 A;  2CFX A;  2Z2Y B;  3JB9 k;  1GEH A;  4DN0 A;  2E7X A;  4AT1 B;  4ED3 A;  5GAH I;  5E3Q A;  1VQ8 S;  4RNN A;  2DY1 A;  1HQE B;  2LDY A;  5D0G A;  2O5D A;  1AFJ A;  1H0H B;  2GMJ A;  5ETQ A;  1WF0 A;  3CD6 S;  1NND A;  2G13 A;  2MB0 B;  1XBW A;  1NB2 A;  2J9C A;  3HHD A;  1JNR B;  1CJK B;  3K5L A;  3K2Y A;  2ZUA A;  4O44 A;  4F3O A;  2P5V A;  4TQS A;  2CJ9 A;  3HHL C;  1T05 B;  1JLE B;  5H9E J;  5LT5 A;  2ASY A;  4OYB A;  3PKM A;  1FDN A;  2MJN A;  2V8G A;  1T3N A;  3MAH A;  3DLK B;  1LXN A;  4F4K A;  1H2T Z;  1XMB A;  1BQX A;  4WFY A;  4F8R A;  3M7V A;  1HHQ A;  3IBW A;  4YHH J;  3DRS A;  3AJ2 A;  2DHX A;  1B0T A;  1TK0 A;  2BYC A;  2PMZ D;  3NBP B;  4NLX A;  3G82 A;  2VA3 A;  1R3N A;  2LEA A;  2COL A;  3T6J A;  3CJ4 A;  2XGQ A;  3F0N A;  2FY8 A;  4CTA A;  2JZ5 A;  3SSR A;  1WOR A;  3S8S A;  2X1G A;  2ZFH A;  2ZNZ A;  2MZ1 A;  3PVX A;  2A18 A;  3O6Q A;  4MFB A;  4KHP F;  4I6A A;  4FXW A;  4WIQ A;  2BA9 A;  3KJV A;  3PW4 A;  2HNY B;  2FLL A;  2G0I A;  4W98 A;  3RAM A;  1B7F A;  3FVY A;  2E1P A;  3HCX A;  4RW7 A;  1Z2Z A;  2PMH A;  2YKM A;  2ZE2 B;  1WF1 A;  2UZA A;  4N8O A;  2B6A B;  4Q2L A;  5HVF A;  4M5M A;  1ZAW A;  1F3F A;  2JJ4 D;  3M2R B;  4XTT A;  2W4D A;  4L74 A;  1GTE A;  1M5S A;  1NDK A;  4FNI A;  3G9C A;  2R7U A;  1KOO A;  3L9Z A;  1RT7 B;  2UUB J;  5I4M A;  4DL5 A;  4M5J A;  4AND A;  2QMU B;  3CIM A;  3D1O A;  3JS9 A;  4QR0 A;  4DI6 A;  2IM1 A;  1IR0 A;  1HBU A;  2HS4 A;  3KKF A;  3NAI A;  1PO6 A;  3BS9 A;  2L9D A;  2XMM A;  3HPO A;  1K0T A;  4DR2 F;  2V5H G;  4PKD B;  1UTA A;  1WOP A;  3I82 A;  4EO8 A;  4FZV A;  3AXM A;  4O44 B;  5U47 A;  2DIU A;  1K47 A;  4JYA J;  3OPK A;  4NZ7 A;  1BGX T;  3U1N A;  1CS4 B;  4I68 A;  4IO9 Q;  1B64 A;  2G2Z A;  3DRS B;  4LF9 J;  2E9Z A;  3AAW B;  2BJ3 A;  2YNH A;  4O4G A;  4F02 A;  3R5D A;  3G82 B;  1OPZ A;  1SL1 A;  5DG9 A;  4ZVU B;  1UZD A;  3CC2 S;  1XNR J;  3PIO Q;  3PO4 A;  2M4M A;  3W66 A;  2QLX A;  2DR7 A;  4DJB A;  3BQ2 A;  2KXF A;  1N8R T;  2JC1 A;  1RTD A;  1VI7 A;  2GW8 A;  4MFB B;  1Q53 A;  2I5J A;  5LMU F;  1NB7 A;  2ZKT A;  3KJV B;  3Q8V A;  3H2L A;  4OZ5 A;  1C1B A;  2E1R A;  3SV4 A;  1VIO A;  1XER A;  4RW7 B;  5EWE A;  1OPI A;  5JXS A;  1UJ6 A;  3RR7 A;  2HZC A;  2XCP A;  9RUB A;  3DGV A;  1SVD A;  1S6P A;  1XQI A;  2KH9 A;  5DZ6 A;  2QYC A;  2K06 A;  3KUE A;  1UW4 A;  4WKY A;  2ADB A;  3BGF A;  4B17 A;  4JI5 J;  3MI7 X;  1S0O A;  3MMB A;  1IKV A;  4DU7 A;  1RAI B;  4MIW A;  5G4D A;  5KFC A;  3EZ5 A;  1HBU B;  3JQM A;  1S6U A;  3UE2 A;  1QSY A;  3B82 A;  3TEH B;  4AL5 A;  3DU5 A;  5KFV A;  4BBY A;  1MMN A; 
#chains in the Genus database with same CATH homology
 2VJU A;  2F4F A;  2VIH A;  2EC2 A;  2VHG A;  2A6O A;  2FYX A;  2F5G A;  2VIC A;  2VJV A;  2XQC A;  2XMA A;  2XM3 A;  4ER8 A;  2A6M A;  2XO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...