2XQCA

Deinococcus radiodurans isdra2 transposase complexed with left end recognition and cleavage site and zn
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKYIESQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE
publication title DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein/dna
total genus 32
structure length 129
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2xqcA00
2EC2A 2VHGA 2VIHA 2FYXA 2XO6A 2F5GA 2F4FA 2VICA 4ER8A 2VJVA 2XQCA 2XMAA 2A6MA 2VJUA 2A6OA 2XM3A
chains in the Genus database with same CATH superfamily
5B7WA 1HPZA 3DHXA 1Q78A 2E7XA 2V8PA 4YR0A 2IVFB 2I1RA 2VBWA 1T05B 2HFVA 1KQFB 2M52A 3MEKA 3KTQA 2A6OA 1E6YA 3WIVA 3S6EA 2N7YA 3HSJA 2BMBA 4F3QA 1LKZA 2FLLA 1YJNS 2BRLA 2HFSA 1TKDA 3DRYA 3ZC4A 1N36F 4ZK7M 5E3PA 2B4VA 4LF8J 3K8WA 1KR4A 1FESA 5D78A 4C8OA 1WC5A 4H4MA 1ICEB 4PG6A 2G0IA 1F5AA 3NOGA 1LOUA 6FD1A 2AYGA 1KTQA 2WONB 5DS7A 2AJ4A 2KYZA 2PIIA 1QUVA 1H7WA 4RL1A 3BGOP 1JLBA 4JOUA 3A8EA 1VK3A 3UI3A 3ENAA 3PW0A 3KLFA 4AD6A 4CWBA 3K89A 4C11A 1RTHB 2V8DA 2D3O1 2VQFF 3CDWA 3CJ2A 4O0NA 4ZVUB 4ZN1A 2HHVA 2BV3A 1L5UA 1VBKA 3DLJA 3J80U 2R7RA 2G1DA 2W9AA 2B6AA 3VZIA 3I4PA 3TUIC 1HW8A 1RT3A 5F8GA 5I42A 4MTPA 4H4KA 2PGCA 2ZZMA 3ZXWA 2XSFA 3JYTA 3QSIA 3QBCA 3W2VB 2QLJB 5A8WB 1GXTA 3UD3P 4ZVHA 1FEEA 2XO7A 2RMLA 2WB1D 3L7OA 3KK3A 2IM2A 4LSLA 2EKYA 1WKKA 1OY8A 1UVLA 5F8HA 4ZP9A 2E9TA 2LXUA 2Q79A 3A1YG 3R5AA 3PX6A 4K2XA 1CQNA 1S1UA 1TR0A 1VQ5S 3NBPA 4KGMA 4QR2A 1RI7A 2R2RA 2EG2A 4FBTA 1RWUA 1Q8LA 3M30A 1P9QC 1Z2LA 1Z4UA 2CQDA 3Q8UA 2IY5B 1HQ2A 1U1PA 1MN9A 2EK6A 5DDQC 3TO8A 2ILZA 3W2WA 3IBWA 3D7SB 3E2EA 4ZHRA 2NLWA 1QE1B 3TAPA 3KHLA 1VJQA 1MLAA 1YZ6A 3MR2A 2A3JA 2K8GA 4ELVA 2JRSA 4R8UB 1Y3JA 4ZP6A 4A46A 2HNZA 1NK5A 1F5BA 1TL7A 1RYSA 4DXLA 3BGRA 1U6ZA 2CWKA 2XZTB 3FRZA 3KK1A 3HT0A 2Z2LA 5GMKa 3UCUP 4DN9A 2IC3A 4ZVQB 3MM7A 4EU0A 3EUNA 1Q0NA 3M32B 1GNKA 4KYZA 2PI4A 5J2MB 2UVWA 2QSFA 3KJVA 3MM5B 2DBBA 2MHNA 4B3SF 3FBCA 2FVPA 3FSXA 1RLCL 3MD1A 3H20A 3NAIA 4DL2A 1BQMA 2KJVA 1BQXA 3FQKA 2F63A 2C2KB 1IKVA 3JQKA 4ZPWR 3VAFA 2PMZD 1JJ2R 1UVIA 2E5LF 2CRLA 1TAQA 2ZVIA 3VV2B 1C1CB 4HACB 1CJUA 1XMOF 1RTDB 3ZTOA 3TUZC 1WC1A 4WU2A 2NREA 2HVHA 4O4GA 2GAGC 2BQRA 1N6QB 1HYSB 3AFGA 2R8GA 4LFAJ 4ZLJA 3GFXA 2A6MA 1U1QA 1OSDA 4K4SA 1VOMA 2HFZA 4LF2A 2Q43A 4F3MA 3F44A 4U7UD 3ISZA 3QJLA 1WF2A 4JI2F 2G2OA 2WAQD 1F0XA 1NK8A 2IRYA 4I69A 2OH2A 4DPTA 1NJYA 3GR0A 4DPWA 3RB4A 2I9SA 4GKKJ 2H4WB 1MSWD 2VD3A 4J9VA 1VQ7S 4LSZB 5KFIA 3CC4S 3RRKA 4OJGA 3B4DA 2HS3A 2ZE2B 3J7YU 4LVNP 1S9FA 5HP1B 1HNIA 2MQNA 3IR7B 1FXLA 3J7AN 2VB6A 2D9PA 2QYCA 4QYZK 2RQCA 2P9CA 1RWNB 1EETA 5AXLA 2E1RA 1PG5B 3PVXA 3FVYA 4LFBJ 4M5HA 2CJKA 4HVZA 3DDKA 4DV2F 1PC4A 1UEKA 5K8NA 3FUYA 5K8MA 2CPYA 4UZBA 3OJUA 2HHUA 3MUTP 4OX8A 5A6PA 4X4QA 2DO0A 3VGVA 2KN4A 3OR2A 1B99A 2C1EB 2CQ1A 3D28A 3MGJA 1LW0B 3SQGB 3FRYA 4CLYA 3BEGB 3LP2A 2B0GA 5J2PB 2YNIA 2V67A 2WVFA 2EFPA 1X4GA 1WHYA 2BANA 2W4PA 3GIRA 1KFSA 1QSYA 1VQMS 3Q8RB 2DCLA 2PFDA 3W3SA 2WBRA 4P52A 1BWVA 5KAKA 3NLCA 1XN9A 5A8KA 3G6ES 5DRKA 3MMAA 1RZMA 2H65B 5IM0B 2RJZA 4B9NA 3DU5A 2JL9A 2BDPA 1RLDA 3M2UB 4I68A 2MZ1A 3QRQA 2JSXA 4ZPVR 1YJTA 4E0DA 3QO9B 2VZ9A 2BOPA 3ZTQA 3V6KA 4C0BA 3VZHA 3BSAA 1FFGB 2VOOA 1ZA2B 1HD0A 3PEJA 4KKOB 4PWWA 3OW2R 4KFBB 1SKSA 1S9EA 1ZS6A 1NH7A 3W5YA 1UKUA 4B3MJ 1N5QA 2KRRA 5DZ6A 4DQPA 2IJFA 3BQ1A 4J7CA 2B4UA 2KB2A 1RWPB 1GX6A 4G1QA 3CJSA 1GMUA 2QA1A 2FZKB 4U7CA 3OV7A 2K1RB 3DYAB 3CC2S 1VRTB 2HQIA 3F73A 3EZUA 2ILYA 4C0HA 3RRHA 1WELA 4JUZA 4JI8F 4W92B 2Y9HA 3DRPA 4IR1A 1TTHB 1XK8A 3HF5A 4WPAA 5HVFA 2OP5A 4PCQA 1FX4A 1CSJA 3FZ2A 1FRHA 4F7VA 2L3MA 2YBVA 5IQ6A 1S5ZA 2HBRB 1CJKB 3Q2TC 5D77A 1SJQA 2W9CB 3EX7B 3KLVA 3DRSA 2C3OA 2QL9B 4U9RA 1N34F 1CS4A 4X4OA 3C14A 4QYZJ 2Q1LA 2B5JB 4EK2A 2V94A 2VQEF 2BUNA 4N77A 1RWVB 4CLZA 3Q8PB 5DG7A 4KHPJ 2J7KA 2E44A 2W2OP 2UXBF 5IT9U 2Y0BB 4L76A 3WBZA 4A8SA 3FCVA 2UUBJ 1QM9A 2WSFC 1HI1A 4DV3J 4JI5F 2PA8D 1KC8T 3IM9A 4B3RJ 3I5AA 3LOUA 4YDDB 5GADI 5B09A 4M5JA 1KWMA 3UDEA 1HQEB 3MZIA 3VAIA 2MB0B 8ATCB 4DR4F 1OY6A 4K0KJ 3D66A 1XQIA 2UUCJ 3OSPA 2ASJA 4OZ1A 2K3KA 3QGIA 1PCAA 5A76A 4IH6A 5D3GB 4EUVA 3TANA 2VG7A 3MMCA 1T05A 1NAQA 2W2NP 2E66A 4MMOA 4OI3A 4ED3A 4WF9Q 1AYEA 2FVQA 4DR3F 3VALA 1RU1A 1NH8A 3C6TA 3MAAA 3TAQA 3BH6B 2GAHC 3D54A 5K5MA 3HO1A 1N33J 1U24A 3T6BA 3OXLA 2EFVA 3EGVA 2LECA 5IC6B 4DSKA 4Y00A 2PEHA 1IWAA 2QLFB 4WE1B 5HN0A 4LF6J 1FWLA 3SFUA 2WONA 3KJFB 3L4BC 2XY5A 1QY7A 2DNOA 4PYDA 3DXBA 2Z30B 5C25B 2HFOA 5D6GA 2UU9J 2VV5A 2XO6A 3TVZA 2ZBRA 3I6PA 2DNZA 3RUBL 3OUYB 1H98A 3KYLA 4G3IA 2WOMA 1V5VA 5AJ3F 1CJVA 2ZBIA 1JLAB 2DISA 2DH7A 3BPDA 4ZCLA 3HFKA 4CLWA 1DJ0A 3CJ8A 3D6TB 3BYRA 2KXFA 4FXDA 4LT6A 1UA1A 4FYYB 3NMAA 4PUOB 2BACA 2VPWB 3SSQA 3PIPQ 3DOMB 4DX6A 5GAEU 4P73A 3P8BB 1YLXA 3K5MA 2I8EA 2VBYA 4EGLA 4Y2IA 3W2VA 2EXUA 2PE8A 4J5OA 5KFEA 2V0NA 5A8RA 4DR5F 3K7RA 2ZFHA 4DCOB 4RWXA 1R8HA 4OLPA 4J9KA 2VA3A 2L9WA 1NCLA 2XQCA 1JLFB 3KG1A 5HBMB 5CYJA 4ECZA 1B7FA 2FZGB 4GO7X 3CD6S 1HARA 2UV8A 2DRAA 9RUBA 1JLEB 3NCRA 2WZ1A 3T19A 3GU0A 3UDCA 1G1XA 1FDNA 1D9AA 2DR5A 1RB0A 2I2YA 1V5IB 3D2WA 2G2ZA 1QE1A 1YSJA 3N5FA 3ENVA 3KNAA 4ECVA 1NHVA 4P9SA 2K7KA 3HULA 2RQMA 2BABA 3IMQJ 1IWGA 2E5GA 3BDPA 3AJDA 5K8OA 2MKHA 3LP0A 4NA1A 3K5PA 5J1PA 1FKPB 4KE5A 4Y6IA 3RW7A 2BM0A 5F8LA 2JEJA 1R8CA 2XY6A 1S4EA 4MKAA 2CQ3A 4I56A 4K8RA 1LWFB 5KT6A 3M32A 3T9NA 3G71S 2HGLA 2PEBA 4K5RA 1WKJA 2WSCC 4E98A 4LMZA 4EWTA 1UVJA 2ADBA 2V6AA 1L3TA 4KB7A 1CULB 4DV1J 3K17A 3EPGA 1KKHA 2EFOA 2RT3A 2V4JA 2ASDA 3MR7A 3BSOA 1N56A 3N0VA 3CC7S 5D4NA 1IBKF 4ECSA 4OI1A 3R2DJ 4YB1P 4K4ZA 1EQMA 3UW1A 1T9TA 2VOPA 4CLPA 3MM6A 1C1CA 2W2MP 3DU6A 3PHTA 4FVMA 2MZJA 1K0VA 5CCMA 2DO4A 3TUPA 4ZVTB 5HI7A 4OI4A 4ZDNA 2ZOGA 2RE1A 3E8OA 2YKPA 1LWEB 1TKXB 3D1OA 2J9CA 5KOXA 5EWFA 2RSQA 2ROEA 3RBDA 3CD5A 1Y00A 4TN2A 2YX1A 1CC8A 3PCOB 1KQGB 3N6MA 2XY7A 3S01A 3TJ9A 3UFCX 4F67A 1Q7LB 4PWDB 1GQEA 2OPRB 4FPRA 2UVVA 3PKMA 1YITS 4USTA 2RF2B 2BQ3A 1JWWA 2IYIA 3OJSA 2XNRA 4N76A 4OV1A 3OLAA 4N56A 1T11A 2AYMA 1ROFA 4F36A 5FD1A 5B0FA 2CA9A 4R0JA 5KFCA 2ZE2A 2Z57B 3L7UA 4F0HA 4FYXB 3BYPA 4RX6A 2AQ4A 3I96A 3CJ5A 1Y9OA 1YJVA 3RG6A 1VC6A 5LMUF 1FFSB 2L08A 2JOQA 2X1GA 1B64A 2XG8A 3GFHA 4RBUA 2RKIA 1FDAA 5LOQA 3L95X 1TFWA 4O3PA 4P71A 4DR1F 4DQIA 1Q95G 4MKBA 2XMKA 3QZ7A 4DQRA 1JXLA 2KT3A 3P4UB 2X7IA 4USMA 1LW0A 2MLYA 2M2BA 4V19J 2KXHA 1BUXA 1KOHA 2XZWA 3WQPA 1RAGB 4JI3J 3SCKE 2ZD1A 3U1LA 2U1AA 2PSZA 2YNGA 4ECQA 3P3DA 3R5CA 2PA3A 2DGOA 2XTJP 3BS9A 2YKMB 3HFZB 5KOWA 2UUWA 5T7LB 2XS2A 2F8HA 4DEZA 4IKAA 3T6JA 2NZ4A 2ZH6A 5ETSA 5JVHQ 2MQOA 4ENOA 2WRMA 3B54A 4V1Ak 2Y1IA 1WI8A 4DL6A 2AP6A 4B3TF 3PW5A 1RBOB 1J5OA 4ECYA 2BYCA 5EX3A 1NDKA 4H4OB 4DV4F 4F25A 3DC2A 5KFKA 4HHHA 2RDDA 5B0AA 2CPFA 5K9FA 4LR7A 3QO9A 5BYSA 3IBCB 2N3LA 3TZZA 1RADB 2Q3PA 4DR6F 2UVUA 4P7VA 2F8EX 4Y2MA 3T41A 2CADA 1HNWF 1FXRA 2OI2A 2CPXA 2V8HA 4KKOA 2YNFB 4Z7CA 4KFBA 2GJ2A 2J7WA 4ETZA 5C2CA 2RB7A 4TLRA 2RH3A 4J9OA 4HL9A 4EI2A 2CPZA 1Y5IB 3PJWA 1IQTA 3TOQA 2LEPA 1NMEB 3N6LA 2C2ZB 5L38A 1OYEA 3DYAA 1VHIA 2LEBA 2W7OA 2FJDB 1VRTA 2OPSB 1C0TB 4FZVA 4YHHJ 2OPQB 1PAEX 1S12A 4WFYA 1Y4ZB 3FEXB 1HFEL 1U02A 4I7FB 2W4DA 2K7JA 2JLGA 5F0WA 2H54B 4GKJF 1TK5A 3ZZYA 2B8PA 3B82A 5EHHA 1U47A 3SCIE 4R5PB 4U96A 1AB8A 3OXGA 5DETA 2BJ8A 1YWXA 2A2CA 1SH3A 2F4VF 1MMDA 1PO6A 4TYAA 3D1HA 5DZ7A 2HZAA 3M8RA 4KGKA 3PV8A 1DTQB 4QWCA 5ETLA 1FO1A 2VIHA 2B5JA 1FDDA 5L9NA 1GMWA 4WXOA 2AIRB 1HNZJ 2GA7A 3RB6A 2G1HA 4C97A 5HSPA 1SKWA 4CT8A 5DDPC 2NCKL 1U6FA 2HHXA 4LF4F 1S0MA 1Q86T 2NS1B 1NPPA 3NAHA 4WK1A 3TJAA 3X1LB 1V3ZA 4WIIA 1FI4A 4I1TA 4BS2A 1LFWA 1HNVB 2OO4A 3BV8A 3SQOP 1HQEA 4ED2A 1OS5A 1OJ4A 2UXDJ 1FD2A 4QJVA 4Q45A 3T1AA 2ZM6J 2J9EA 4Y2AA 1UJ6A 2HQGA 2Y0SD 5D3GA 3UDLA 1EX8A 2NXEA 4M5DB 3Q8QB 1AA1B 2MXYA 2AJQA 1N32J 2FJWA 1NDCA 4DWIA 4URQU 1Y3KA 3ZZ0A 1WORA 1SXLA 2R7QA 4DU7A 2CQ2A 3JQJA 1S1TB 4AL6A 4RUBA 1UWAA 1GK8A 3U1MA 4Y0FA 2RVJA 3E01B 3V6JA 5CQGA 2YQ0A 1JKHB 5L46A 2DKOB 1MROA 1IKWB 2QMWA 4LJMA 4XTTA 5C24B 2ZZNA 1O51A 3SDEB 4FKXA 3BDEA 1YKWA 4WE1A 1F1BB 4HDGA 2F8MA 1SL0A 2JVRA 5C25A 2G0CA 3I0SA 4LF1A 1URRA 4I64A 2Y8YA 2WW8A 2IJNA 1U0HB 3QIPB 4NLOA 4ZIVA 1R0BG 4X4PA 1ZOTA 3GTYX 2IBKA 5I3QA 1UEVA 1GFWB 4F4ZA 3SI8A 2B7CB 5JUMA 1IKXB 2LEAA 1FK9B 4PUOA 5H1SV 3AODA 5HMYA 4FYVB 3TWZA 4BHQA 4JV5J 4ZVEA 5G4DA 2CDRB 1DZ5A 2C2DA 4K59A 3W9HA 4JI7F 3CCJS 4ED7A 4DX7A 1GMVA 4PABA 3P45B 4FS2A 4MFBB 2R9LA 4UY85 4LR8A 3R9LA 2LP4A 3VTIA 2ZUGA 2GJFA 1M5OC 1VISA 2HVIA 2RNEA 4L3NA 1G7CB 4ED0A 2HHHF 2DY9A 1T95A 1EIYB 3TVYA 3ITHA 1RCXB 2CG8A 2C3YA 1VLOA 1UETA 5CCLA 4PYAA 1JLFA 3H40A 3QT5A 3JSRA 5F41A 4K5SA 2AWZA 1KNZA 5C42B 2A1BA 3Q24A 3EGWB 3RRGA 5CA5A 4TY8B 3C8YA 3HZGA 3RJMB 3PDNA 2J9DE 5DM6Q 2ZNYA 4CO3A 3ETOA 1ZYQA 4RW7A 1NB7A 3UVJB 3G87A 4OYMA 4XDDA 1EZZB 3QT7A 3SYZA 5D0HA 2DH8A 3PX0A 1K0TA 3HMJG 3HHLC 4ZPDA 3HHLB 4ZVRB 1WEXA 1U48A 2GCFA 1RT1B 4DFPA 1NSKL 2QEXS 2BKNA 1X8DA 4X4RA 1WDDA 4WTOB 1C1BA 3QT6A 3RBEA 1LWFA 3FSIA 2HRUA 4OYOA 2HIYA 3VF0B 2NSBA 3SV3A 1X5TA 2CFXA 4CP5A 1RJJA 4Q5VA 2NUUG 1VMBA 4RW8B 2OJ3A 1IKYB 4USIA 3AA9A 2RRBA 4DUYJ 1RT2A 5HQ8A 4OYZA 4QW8A 1LXNA 3M9NB 5KFNA 4DF4A 3IAM9 3EMTA 3W64A 3GIJA 1WOPA 2JFDA 5IOLA 2OD6A 4RW9A 1JLQB 4HHUA 3VGUA 3SXLA 4QPTA 2MZQA 1VQYA 1PILA 2HVZA 1TKXA 2P6SA 1NKCA 4J9PA 4OZ2A 1XIQA 2WHOA 4WKYA 2AZ1A 1E6VB 1VK8A 3HD2A 9ATCB 2D74B 2J6SA 2XLKA 4X62F 3MR5A 3K59A 2P6TA 1YBUA 4ZCKA 4OHXA 4PWDA 3HJVA 2IBOA 3M2VA 2DK2A 2OPRA 3EE3A 4DV6F 1RT7B 3G96A 2AYEA 2LVWA 2RF2A 2JLFA 1S1XA 4HTJA 4CT9A 3PRBA 1IM4A 2EKNA 2YKNB 3MF5A 2AGOA 5D0GA 2DXDA 4ANCA 2QTWA 1XR7A 2XSJB 4A8WA 3ZZUA 4IO9Q 3HSDA 3OL6A 3TVKA 1YQHA 2ZVSA 3BR8A 4M5LA 4NYOA 4QOTA 4ILMA 4C9DA 2AMCB 2CZ9A 3DLGA 1TK8A 4ZITA 2O01C 4K7QA 1TMMA 2SXLA 3NGUA 2NZCA 2RQKA 4F26A 5K14B 1KVIA 3F0NA 2XI3A 3ISNC 2Y1RI 2D7SA 4NLGA 3M6UA 1NM2A 5KT2A 2E5JA 4RUCA 2HWTA 3CGIA 4C2MA 3PNIA 3V81A 3N5BA 1L3SA 1NJZA 2GGPA 4ZKAA 2VFVA 4IFYA 3O2IA 3HDSA 1BQNB 2R42A 3HCXA 1X4DA 1IXKA 4A8FA 4DL4A 1FTRA 3T5JA 4Y34A 3R6GB 5KG1A 1WKLA 2CPIA 3TI0A 3JSMB 2HHQA 4KPCA 1MU2A 5IWAJ 2EPIA 4RNOA 4I6WA 3GIMA 1I94F 4CO0A 1U45A 3US5A 2O5DA 4UZCA 2GNKA 3HXMA 3J81U 2FHJD 3DOKB 1UA0A 3Q8SB 3I5CA 1HL6A 2B43A 3CW2C 1Q8IA 2YKAA 2PFFB 2DRDA 1VQNS 4JI4J 1RHJB 2QMUB 4LF5J 4HT5A 4C8MA 2Y1LB 3MDFA 2YNFA 3FK4A 5AXKA 4EZ6A 4DUZJ 1LK5A 5D0EA 2E5LJ 3SZ2A 4CH7A 1IVZA 1IBMJ 4I2QB 3PJXA 3LALA 2MHEA 1JNZB 4CQ1A 4ZP7A 5AE2A 1ZPWX 2O3DA 3TZWA 4BDPA 4OIXA 2HMIB 4MT1A 1HW9A 1RWWB 4ECWA 2OPSA 1C0TA 3TQ1A 2B4OA 2OPQA 3I56S 1OPZA 1B0PA 4IG0B 1FA0A 4M95A 4W98A 5KFUA 1JB0C 1JQGA 3BO3A 2O66A 3PO4A 1FJGF 2W8KA 5BR8J 4RW4A 4IQMA 2GZOA 2GFFA 3TZYA 4WFZA 1UVMA 4ZJLA 4AT1B 5A2QY 1VQOS 2AEJA 3W62A 4K50A 4R5PA 3M8QB 1VDHA 3SV4A 1XWLA 3NGDA 1Q82T 1DTQA 2J0XA 3GIKA 2CKWA 1B7YB 1RTJB 1VHFA 2EK1A 2OLWA 4NLWA 4ZCMA 5GADU 4U67Q 4WFNQ 5E3AA 3FQLA 1RT6A 1W7WA 3LA0A 3V2UC 5LJ3Y 3MWBA 4DI6A 5ITHA 5BYRA 1F60B 1P8GA 1OYDA 3CCWA 3FCWA 4CM2A 3GILA 4ILRA 2QL5B 3DXSX 1VRUB 2JC1A 1FNXH 3DRRA 4DV2J 1TKZA 2LQ5A 5D15A 4L73A 2HWIA 4ETXA 2GO8A 3BM7A 3AQPA 4A8XA 3KUGA 1HNXJ 4FN5A 1FWKA 1I51B 4LRBA 3QRRA 4L6V3 6AT1B 2XMJA 4QU6A 1R31A 2HRYA 3OT9A 4M5DA 1UPMB 1IM6A 1K47A 3CCRS 2MQLA 3S7RA 2FUG9 2CJQA 4LF8F 3WC2A 4NZ7A 1EAYC 4FS1A 3CMES 5EN1A 2QLBB 3MEDA 3UN3A 2ZHOA 4NLPA 1JKHA 1TV6B 3W1YC 1IKWA 3JXOA 5HVHA 2KVQE 3BREA 4KHMA 3IN5A 5C24A 4RNFA 2JNJA 3SDEA 4C6AA 1QUPA 4CIOA 2EI5A 3ZZRA 4OZNA 3ELHA 2R7TA 1RAHB 5IFMA 4RLEA 3RZAA 4F4AA 3V4IB 2QGFB 3CVKA 4B9LA 4WKRA 3KUEA 4CNYA 2OMOA 3N4WA 3G2XA 3B6BA 3UCGA 2IM3A 1G4CA 2MZRA 3QIPA 3DLKA 1HBMB 3MURP 4KV8A 4XIUA 1WSVA 4LRFA 2JFKA 4JI6F 4ALZA 4GO5X 5DJBA 1GXUA 4KIAA 4YUDA 1RT4B 3DI6A 3LAKA 2DIUA 2Z2YB 3M6WA 3TJ8A 3AOBA 1UVKA 4IG3A 1FK9A 4JI0J 3AH6A 4ZOSA 2UXCJ 2IDEA 2MJUA 2YWFA 3AJ2A 3MECB 4DX8H 5B08A 2JEIA 5KFJA 3HVWA 3EXCX 4DF8A 3B78A 1YRUA 2FJAB 4MFBA 1MWZA 1K73T 3W8GA 4DOZA 4P10A 1YGYA 1RAJA 4M63A 4DV0J 3CJQA 2YNHB 1RBLA 2ATCB 2MDAA 1DBDA 3T3FA 2CQBA 2QX0A 2B3TB 3VHQA 3LWLA 2XCPA 2IM0A 3BGUA 3PG9A 5C42A 4PWUA 5DLGA 1H0HB 3LPYA 1ZM2A 1WHXA 4TY8A 3NS6A 4KH1B 4O44B 4MIAA 2DNGA 2GHPA 3HSZA 2P8IA 3GIIA 2NXNA 3UVJA 3Q8VA 2M8HA 3JAMY 2EBEA 1SC6A 5C2GA 3NNAA 3IA0A 3QJJA 3POTB 3K5OA 2CXEA 1S0NA 1WC6A 4ELUA 2N7CA 1HWJA 2KRBA 1RT1A 1OO0B 1WG5A 5J1EB 1SC3B 2M3DA 4A48A 2DHGA 2WTFA 3R8YA 2QA2A 2HK2A 1JLGB 3AJ1A 3DOLB 3O3LA 2KHDA 1YZ7A 1S6UA 5F8MA 2Z58B 1SJ1A 1H73A 3C46A 3T1YJ 3FDSA 5M2RA 1A6LA 4RW8A 2EFGA 1I5OB 2Z4PA 1PBUA 2DGTA 3UE2A 1XEZA 1YDLA 4YDXA 1SH2A 4J9UE 1N54B 3DLEB 4LFAF 2MLXA 3JSBA 5SUHA 4RU9A 1JLQA 1M1GA 3THTA 2VPZB 1FRJA 4OV6A 2CVIA 4KY3A 2M88A 4FNHA 2Z56B 4P2FA 1AUDA 3KHGA 2ZH3A 2FJEB 3BGLA 3PKYA 2CQCA 4QWAA 4YR3A 1SJ4P 3H7HB 4JV0A 5AE3A 3D68A 1KONA 2GC8A 4QIEA 2G0JA 4GKKF 2CNOB 1KS2A 4DL5A 1KBRA 3KJNB 1S49A 3CWJA 1RT7A 3PIOQ 3I4HX 3FJ2A 4Q0BB 2VASA 2XMVA 2XMMA 4XAKA 3NG8A 3PYFA 3QPIA 3H0PA 4ZVOB 3H98A 1RWMB 3LH2S 4UT4A 4U8VA 5J2NA 2YKNA 2BQUA 3LQVA 3SSRA 2HQ3A 4MKVA 1QJHA 2BJ7A 1T94A 2HBQB 3UR0A 4LFBF 1S1WA 3JSYA 5CH7B 1DY3A 3N01A 4Y28C 2J0WA 2JH3A 5GAHI 4NMXA 4J9MA 4KQZA 3GLJA 3MPVA 2J9DA 1YBTA 4M5GA 1R0AB 3IRXA 1UL3A 2LQ8A 5E5NA 1KLMA 2JJ4D 1KVJA 2NPFA 1DRZA 2AGQA 3Q23A 3HZEA 1RHMB 3J80Y 1RK8A 2EWHA 1RAIB 3GONA 1UFWA 2V8GA 3AB4B 4IQXA 1RSCA 5LSLA 3MMJA 4TU7A 4ED8A 2W25A 3IO1A 3CD0A 3DGPB 3R1HA 3TNVA 3UWTA 2QV6A 3D6HB 4OHWA 1RGVA 2UP1A 3FMBA 3H2VE 1BQNA 4Y65A 3PYEA 5J2QA 2M4MA 3GYNA 1PYOB 1HHQA 4LF9J 3VAKA 2DXFA 4X64J 3H59A 2DB1A 3JSMA 3MPWA 2DITA 1UEUA 4NRTA 3VGSA 1SBRA 4DR2J 1AZSA 1XBWA 4DFKA 2OPPB 2DNKA 3AD8C 4C8ZA 4OYAA 1W25A 3DOKA 3TAMB 2DIVA 2AEFA 2JX2A 3HJFA 3RTVA 4B3MF 3DLHA 3EPIA 2QSWA 1RACB 4NRUA 4DU8A 3PO5A 4FXVA 1BLUA 4OL8A 2IDLA 4PAAA 3RR7A 2HRTA 4BC7A 4QR1A 4I2QA 4NCBA 4J91A 2RDJA 4B9VA 5CZXA 3VQTA 4ES3A 2HEKA 4TKTA 2NXCA 2LLZA 4F2RA 1P1TA 4X65J 4DN0A 5B0EA 1ZAVA 4QIVA 2OTJS 4IG0A 4KPYA 5DO2A 3QFWA 4YP3A 2HNDA 1YIJS 1NNDA 4P6QA 3MUMP 2NXUA 1QLNA 3Q83A 3LP1B 2PI5A 4I0WA 4ZPAA 3PYGA 4NXMJ 4TQRA 4LFCJ 2CNLB 2MSTA 1S77D 3G82B 2LXIA 4F3OA 4G1IA 4AXIA 1FRLA 1KQSR 1HQUA 4BLGA 5DQHA 2IFXA 5LXRA 3G6VA 4KHPF 2ZH8A 3MEEB 4QBUA 4I2PA 4XPCA 1RTJA 2A10A 4ES1A 3KHHA 2W9BA 3OSNA 1KD1T 4DFMA 1TL1A 3MFIA 1N5TA 4DQQA 5M2PA 4DV3F 2M7SA 3M2RA 4PG7A 4B3RF 3J7YI 4ED1A 3NS5A 1NXIA 3OTOJ 4ID5B 4C8NA 4WYWA 2CG4A 4K0KF 1VRUA 2UUCF 2QN6B 2DR7A 4S0MA 2IVYA 4FDFA 5KG7A 4OX7A 3GV5B 2WVDA 2OHDA 3J7A1 4OZ3A 3ZFVA 2MKCA 1XNRF 2ZWOA 2DNNA 4F4KA 4NLRA 2RQ4A 3MPYA 3SCJE 4C8YA 1KFDA 1YG0A 2R2SA 2YQ3A 2O1PA 1NKBA 3J7ZT 5KFRA 3BSNA 4EBCA 2F40A 2XCAA 1C2PA 1U2RA 4MH8A 5JVGQ 4USKA 1N33F 4NLYA 1CC7A 3MTJA 4EBDA 1D3WA 3MAQA 3NP5A 5E41A 2XWYA 2EVZA 3CNQP 4CLFA 1D8YA 4LF6F 2FJVA 1YJWS 4HDHA 1TV6A 2DNYA 4MIWA 2CWXA 2HVEA 4BC9A 5I3PA 2FY8A 3ULHA 4DV4J 3GQCA 4LSNB 3UDVA 3JQMA 3MTKA 3CPWR 3C16B 4L72B 2L9NA 1DQAA 2MY7A 3OVSA 3RB0A 3MAHA 2VA2A 4X2BA 3W8PA 2KL8A 3D6MB 3H2LA 3V4IA 1AT1B 2JDJA 2N4DA 1RISA 4GVBB 4F0MA 4RR5A 4MYTA 3D1QA 1X9MA 3NCQA 2FIUA 5HLFA 1AFIA 2HAIA 1HBMA 4OHYA 2H48B 2C2MB 2B8QA 2Q66A 4NOHA 1H38A 2HS0A 2FJBB 1JLCB 3IG1B 3W61A 2DHSA 3OQ2A 2UZAA 3B4MA 2ZDOA 2VG5B 2RHSB 3VAGA 3IFEA 4NMLA 1TAUA 3MECA 4TVAB 4DPYA 1UMJA 2LCWA 5IC4B 1IQZA 2VH7A 4LBPA 2ZC4A 3N6NA 3C3LA 5GAGI 4ED4A 5F8IA 2R4FA 3JTOA 3MCOA 2W8LA 1F2HA 3NWRA 2CJBA 2GS8A 2YNHA 3MM8A 4YR2A 1S59A 4O4RA 3M8PA 1HBNB 1RAAB 1JXVA 4Q7AA 3D9BA 3WX8A 3CMAS 1I1GA 3I5BA 3V6DA 4YY3J 1WACA 2ZWPA 1T9UA 1PYTA 3I87A 1S99A 1G6BA 3KDNA 4LBIA 2OKQA 7FDRA 1FERA 4IYQA 4O44A 4PQUB 4PG8A 5CYMB 1XERA 4O3SA 4USHA 3ILJA 2R2TA 4KBIA 2DNLA 3A8KA 3PRDA 2QMXA 1LEOA 3PEHA 3CDUA 3POTA 2ZH5A 3NNHA 4LF7J 5IXUA 2BJ9A 5ETNA 1WWHA 2KT5A 2V4RA 3GFYA 3EDRB 3IBFB 5J1EA 2XGPA 1ZZFA 4Q43A 3DMJA 1S6PA 1WF1A 1LW2B 3RGIA 4DV1F 2FLNA 1JLGA 1JJ4A 1NLKL 5DGBA 2VJVA 5CYQA 2W2QP 2AJ2A 2QO3A 2XNQA 2VFUA 3CCTA 2QLXA 3MCMA 3NWGA 5ETQA 3ET6B 2RUGA 2GIQA 4AUKA 2JZ5A 3AHPA 5IT9Y 4LIWA 5EX0A 1QSSA 1FJEB 4N47A 1ZH5A 1B0VA 4Q2LA 2CVEA 3EM1A 3DLEA 1T02A 3CO0P 2IMWP 2V68A 4ERDA 1J27A 5BXIA 3CSKA 3KLFB 4Z7YA 5G0RA 4X4UA 1MMNA 1VQKS 2KFZA 1IJFB 4J9NA 2MKJA 3W65A 4C0OC 1QDUB 1CLFA 4X84A 4ECXA 3FZBA 2KYXA 3C6UA 3CJKA 1BXNA 1TQLA 3OFGA 2V2QA 1YJ7A 3KK2B 4NYPA 1N52B 5HMZA 1NJIT 4IOAQ 3G8QA 5HMWA 2C28A 4OQJA 3TEGA 2CAJA 2C42A 2B6AB 5CHCB 4FVCA 2C2OB 5F8JA 3VWSA 3IR6B 2KG1A 3TQEA 4H4KC 2ADCA 5I42B 1U1MA 4PZVA 3IS9A 4UW2A 2VC1A 1Q16B 3A3PB 1PYSB 4H54A 2YWWA 3A13A 3EVOA 3FEZA 1Q7YT 1FCAA 1X4CA 2ZBPA 3OPKA 4FP9A 1WC3A 2AKWB 2IM1A 1S1UB 3Q2SC 3ILIA 2R7VA 3CUNA 4K4XA 4BWJA 2MGZB 1U1KA 1ZTWA 3V5RA 4AQYJ 4F4YA 4WYLA 1B70B 4NEYA 2VICA 4QIGA 1NK4A 4DL3A 2XBPA 4JI3F 1RAFB 2QLWA 4ZHRB 5KFFA 2BJ1A 1T9WA 2KM8C 1HR0J 3HHDA 3E51A 1YI2S 3TX0A 3R1LA 1J5EJ 4QIFA 3ZNJ1 3QIDA 2DYAA 3GYGA 1KN6A 4ANEA 4EO6A 4YQWA 3IGNA 5JJBA 2Y1JA 4OHVA 5EWGA 1MMLA 4M94A 2X3GA 3P96A 3PRVA 3DGPA 3KK1B 2BE7D 3OFHA 2FZCB 2HHSA 2C3PA 4NLQA 4D3GA 4LBHA 1FJCA 2X1FA 3PACA 2C22A 1TKTA 3KJVB 3NKYA 1Q53A 1TELA 1S57A 4J9LA 3M1VA 4J9RA 2IYGA 5E2QA 2H4YB 3BQ0A 4DV7F 3WC0A 5IT4A 1DLOA 2BW2A 1N0VC 2H5IB 2J6UA 4O3RA 2M8DB 4OZLA 1HHSA 2VFSA 3EZ5A 2Y8WA 2X51A 3TEHB 4YMEA 2E29A 1CJUB 1FNMA 2L48A 3R3TA 3ONQA 4DMZA 5DGAA 5CABA 1SQEA 2IAJB 3KWMA 3RW6A 3AXKA 5ETVA 4OX9J 4YHHF 3O5TB 1NDPA 5BJRA 4U7UK 2EC2A 4OX6A 4ES2A 2ACMA 4O3NA 1X5OA 2MEWA 4G65A 4DX5A 1VQPS 4DFJA 3IWNC 1HBOB 2RAQA 1HWUA 3GE9A 1Y5LB 2AF6A 3DLLQ 1LFPA 1NRKA 4WP9A 2RS8A 4NCAA 3AY0A 1RTIB 4XO0A 1HNZF 2I6WA 3EZOA 1VIOA 3G82A 1HNIB 5DLFA 3GZ7A 4RU2A 1I3OB 1EETB 1U8SA 1TZ0A 5HJXA 1L3VA 3MEEA 1SB6A 4QQBA 3KJQB 5KG3A 2FJXA 2XGQA 3DHWC 3M6VA 4E8UA 4XPEA 3NY0A 4L74A 1HBUB 4TYBA 4A8KA 3T5HA 2C3MA 3MCSA 2R7XA 2POKA 2V4QA 1X9SA 2CQIA 4ID5A 1KOOA 1EARA 1RTHA 5SZTA 4UQTA 2UXDF 2R7WA 3PYDA 2ZM6F 1FFWB 2FPHX 1BGXT 3LP2B 2CZVC 1CG2A 2DPIA 4L75A 3IRWP 5LL6d 4U6PA 4OYIA 2BVZA 3O1LA 4NWBA 3KLEB 1MW7A 2OEKA 1N32F 4OI6A 5K20B 2E9RX 3ZTPA 3CEDA 4PKDB 3RBZA 3CDEA 3CIZA 3HKWA 5KG4A 4KAIA 3R5JB 3LUYA 1FF2A 1Z2ZA 2HG4A 2CNKB 1PSDA 1I6JA 1Z1ZA 1T3NA 1J2VA 1ITPA 5FLXU 4DCJB 2AU0A 1A0OB 2LDIA 1TP7A 2CJAA 2NYHA 4M5MA 5A8WA 4PPZA 1PC5A 2F9JA 3OBIA 1NPRA 1S9GB 1A9NB 1N5YB 1U7LA 3S8SA 2MZTA 3M8YA 3ZTRA 4NI2B 2GW8A 2X1AA 1GX5A 1VC5A 2HNYB 3K5NA 2Q6BA 2MSSA 4I6YA 4B02A 1PJ5A 4LRCA 2RU9A 3OTEA 1S9EB 2QA4S 2CPJA 4KO0B 3GV7B 3H25A 1D09B 4GVBA 3QLHB 2IRUA 4R8UA 1UTAA 3VR1A 4JV5F 2OD4A 1VCTA 2V2KA 1T9XA 2QYGA 2GO9A 2J8SA 4DG1B 3BJYA 3P5TL 2OMLA 1SL2A 3H4DA 4UOGA 4KR0B 2JWNA 2J8AA 2JEFA 3K2YA 2WB4A 4OI0A 1FE4A 1Q5YA 3U27A 4ZJQA 4HYKA 5J2MA 1X0PA 5AE1A 3WZ0A 1WEZA 4CO1A 1K8AT 3MM5A 2HFNA 3L7PA 2FQQB 1DTTB 1H2VZ 2NR0A 4N41A 4C8KA 1CS4B 3KXDA 3DRXA 4J90A 1YJUA 2Q6CA 3IP0A 3LW5C 3KUHA 3T1HJ 3NXZA 2CUYA 4RNMA 1Q1KA 4M1KA 2ABYA 3PFEA 3ENQA 1HBNA 4NLSA 4UUXA 4KSEB 2MZSA 2C2RA 4HACA 1WC0A 5L1KA 1RTDA 3LTOA 2XS7A 4GMKA 3UCZP 2BE2B 1N6QA 1HYSA 1UJ4A 1VBXA 3VVUA 4RBVA 2HHPA 2V69A 4PQUA 5F8NA 1NSPA 5CYMA 3ILLA 4A47A 1P27B 2IVMA 4HKQA 3BGFA 3CO9A 4RZRA 3OHBA 4TY9A 3CF5Q 1JMTA 1WI6A 2B9EA 2ZZTA 1REGX 4G1PA 1U1NA 2VG7B 1NB2A 3MMCB 3CJ3A 4WK3A 1M1HA 4C98A 2XEXA 5HL7Q 4NXNJ 1RU2A 3CDBA 5DG8A 3U7JA 4N8OA 4DJBA 3R2CJ 1BMQB 1LW2A 5H9EK 1NZAA 4BCAA 3C6TB 2XYHB 1M90T 4DUYF 3MAAB 2EC0A 1YHQS 4X66J 3I9V9 3DFEA 5B0BA 5KT4A 5HP1A 1NSAA 1KHWA 2DTJA 1WNEA 2XWXA 3BKTA 3ET6A 2GIFA 1REVB 5KFVA 4KRWA 2E7WA 1FT8A 3N9UC 1S7IA 2E1PA 1EP4B 1BY9A 2CJ9A 3M7VA 4EYHB 5L1JA 3L09A 3X3UA 2XHWA 3UD5A 2ZITA 2WOMB 3SQGA 1P6TA 1CJVB 1IBCB 2R7SA 4JYAJ 2HZVA 3EGNA 4NEZA 4DSIA 2CDQA 2OSQA 2HHWA 1S6OA 1N0UA 3THVA 1WG4A 4N8NA 1XTZA 5J2PA 4I67A 3CULA 3KK2A 1SL1A 4NCGB 1UFKA 2APOA 1JNRB 2BE9B 4CO2A 3G8SA 3P6YC 4USWA 1B0TA 4JI6J 4AL7A 3WX4A 2RIJA 3DKDA 3TR5A 3ZO7A 2IMOA 4OYXA 4URSA 5GAHU 2FGOA 3D3BJ 3GCXP 5IM0A 5L39A 1R0CB 4DS4A 1IR0A 2X3DA 3M2UA 1KDNA 2PDAA 2MKSA 1OY9A 5D8HB 5HAOA 5LMNJ 5A8RB 4EMDA 1YJRA 1PGZA 3RAMA 2UUTA 5ETTA 5KFZA 4DPUA 4F2SA 4WFXA 1UW4A 5L1LA 3GSDA 4RNNA 1WC4A 2MGZA 1WOSA 1UAWA 4AYBD 1TUGB 2RRAA 2Y3YA 2KDOA 1R7IA 1SQFA 1AFJA 4A8OA 3G86A 2CNNB 4MJKA 3DDNA 1ZA1B 1MN7A 2JLEA 4C3KA 4RPFA 1IBLJ 1S7HA 4CCHA 2K1RA 1SUQB 4OI2A 3LPEA 4IOCQ 3M8SA 3CCMS 3JS9A 2KI2A 2XYPB 1N4LA 3LP0B 4UUWA 5DQGA 5JXSA 1G2EA 2E1AA 1FEHA 2XYGB 1N48A 3CTRA 1HLWA 2V63A 3IGVA 1FE0A 1KVKA 3UO0A 2QZ8A 5IWAF 3BKUA 2MQ8A 1RWXB 5H9EJ 3W60A 2HGMA 5HQMA 2DR8A 3MD3A 2FHMA 4N7TA 1CJKA 3O6QA 2W9CA 1RAOA 1SPBP 2HGNA 2UUAJ 2J5AA 3FC9A 1UVNA 1H7XA 2V4JB 1M5HA 4HI1A 4JI4F 4CLLA 3Q86A 5DDOC 1Y11A 4LF5F 3EYZA 1R3NA 2ZOMA 1V6HA 2J0SD 4DUZF 4P7TA 4D3HA 1X31C 1HIYA 3MM6B 1IBMF 1VQLS 2ZKUA 2R8KA 3HX9A 4NLDA 4USJC 4ECRA 2YH0A 2W7AA 3QWUA 4CRJA 2E5HA 2F5GA 4I6AA 2LU1A 1YRTA 4PXCA 1RA6A 2IAJA 5DQIA 5A6WA 3THPA 2A18A 1YK9A 4M8LA 4WTYA 3KLHB 4DR7J 1FKOB 3HP6A 4LRAA 4U95A 4UTGA 1VQ9S 3OL8A 4IRDA 5BR8F 1Q8KA 1EKSA 1Q8BA 3GMGA 3OHAA 4G6VB 3O8WA 4ID8A 1TUVA 2BX6A 5IV4A 1KP6A 2LDYA 3UD4P 2F4FA 1GMWD 5ETMA 1HBOA 3G9CA 4OFZA 1K1SA 5MAOA 2ZJQQ 3JTNA 3IWLA 3W66A 4CZCA 1RTIA 1RHKB 3TARA 2QA4G 1KSPA 4K4UA 4ZLPA 3PR4A 4JI1J 2OFGX 3MXHP 2NPIA 3R5DA 5LXYA 1A7GE 1ELOA 4MIBA 1C4AA 2D1CA 2RKIB 1HBUA 3D6FB 4ANDA 5EGYA 1BD6A 3A3NB 5KG0A 1X4AA 3OUYA 3AOCA 2ZOFA 1JLAA 1TMJA 1HNXF 4CM0A 1U6BA 2WVEA 2AT1B 2ZD1B 3FCHA 3VAMA 4DLGA 2YNGB 3G6YA 2LYVA 1XMQJ 2KVIA 1OPIA 3ICLA 3KLEA 4DLEA 1NUEA 2YWKA 2E9ZA 1X9WA 3BO2A 1JJHA 2ALYB 2D41A 1TVRB 4AXJA 3DOMA 4ZN3A 1J5OB 4YB7A 3SMZA 4C48A 3KOAA 2W4CA 2BEFA 3C15B 1SJ3P 1S9GA 1N5YA 2CPDA 2FB0A 4NI2A 2MLZA 1SIZA 3HK2A 1NKEA 3NL0A 2XHCA 3MM9B 2R7OA 3E3XA 3LGNA 2HNYA 1NZ8A 5HBMA 1S48A 2BKPA 2H9ZA 4DV5J 3PW7A 1D1UA 1RT5B 4WJBA 1XNQJ 5A0YB 4NLVA 2KXNB 4B08A 2BRKA 1O0PA 1JLEA 1QVFR 4RW6B 2VBZA 4ZJOA 1D8ZA 4EO8A 2COLA 4J9QA 1QAYA 1LQ9A 3G8TA 4KO0A 3JTPA 5B0DA 4TU9A 4FF3A 1S97A 1TUWA 3QLHA 2PC6A 2FVCA 2EG1A 5IS2A 4RO0A 3BN7A 1F3FA 3B8HA 1X4HA 4PXBA 4JBCA 4JI0F 4OYPA 2KO1A 2BJ3A 2G13A 2UXCF 4ZPBA 4DSFA 2FC9A 5GAGU 2GHWA 5E7OB 3K58A 4DG1A 3P49B 1EB0A 1FKPA 2HPUA 2MKYA 2ASYA 4A8QA 3PXGa 3VCDA 3BF4A 1U2FA 4Q8EA 3KFWX 4JP8A 4M5KA 4ZVGA 1R6YA 4X4SA 4FPIA 1M5VC 1N8RT 4DV0F 3J81Y 4TU8A 2DHHA 2XZDB 4HLBA 1WSRA 1DTTA 2F7VA 2CPEA 1CULA 1VGYA 1H3DA 3IC1A 2ALZA 1HA1A 4OYWA 1VC0A 1N36J 1JXEA 3DCAA 3PFOA 2IRXA 5KT5A 5HQLA 2CPHA 5KG2A 1ZZNA 2XULA 2V50A 1H74A 1X7VA 5HMXA 1HWIA 4IH5A 2BM1A 4ZLNA 5KT3A 1SC1B 2FLOA 4FF1A 2VG6B 3KG0A 1O8BA 4ER8A 1VIXA 2JEGA 2BE2A 5EDWA 1LWEA 1DHMA 2HAFA 4PQAA 2QT7A 4ZA1A 4CNZA 2C2NA 2WSEC 1LWXA 2XMWA 3Q22A 3D67A 3MOZA 3KLGB 3BZQA 2ZDPA 4Y2KA 3K57A 2VQFJ 1UJ5A 1U26A 1M1KT 4PPDA 4B9TA 4KGZB 5E3RA 1L3KA 1DFDA 3HSGA 2QFIA 3TX8A 4QZVB 1XNRJ 4WZQA 3T1YF 1SCJB 2PMHA 2F9DA 4GRSA 5DM7Q 5KFBA 3CE8A 2BZ2A 2E1CA 1VQ8S 2YPZA 1C4CA 1SC4B 1KHVA 3QSYB 2ZBQA 2EFNA 4LVOP 2BOAA 1MROB 2YWEA 1U1RA 4DUTA 1FD8A 2BKOA 2CQPA 5IT0A 2VBXA 4Y3CA 2XLIA 3NOCA 3FEYB 1VS3A 3CMQA 1REVA 4CLUA 5KFDA 2HK3A 5L9XA 1PJ7A 1FJ7A 3D5MA 1CPZA 1X4FA 2B9WA 3A8JA 1EP4A 2FC8A 3R97A 4K4VA 1XMBA 1SV5B 2FYXA 3I0SB 2D69A 1XR6A 3H5UA 3QZ8A 3V4MA 4W4MA 2XI2A 2HBYB 5KFHA 1LXJA 2DNMA 1AROP 3EJMA 5KFXA 4DL7A 3CCSS 2ZHBA 2EFQA 2YKMA 4NCGA 3NGSA 4IOBA 1ZAWA 3K8VA 3GG1A 5T7LA 2WCXA 3OL7A 3QNWB 3SCLE 2GMHA 3QFHA 1WEYA 2FLPA 1U2CA 2HVDA 1YTYA 2E5IA 1VLYA 2QL7B 4FYWB 5FDLB 4NX9A 4ECUA 2CJYB 1S76D 3QMQA 5DG9A 4PXDA 4H4OA 4ITSA 1YVFA 1M5PC 5T14A 4M5NA 3QRPA 2M9KA 3BPSP 1KQKA 3CJTA 2OGUA 3KMQA 3BSCA 4UY8T 2J76E 4OYBA 3HM9A 4AE5A 3ITHB 3I55S 3HHKA 4L3KA 2PN6A 1FKAF 2HWHA 4B3SJ 1LV5A 4DBQA 4C3MA 2NYIA 1WHWA 3QGPA 4OZJA 3BH7B 3LGHA 2AJ1A 4F4XA 3PX4A 2V9KA 2XLJA 4O23A 4EZ9A 1YX2A 7FD1A 5GVQA 1APSA 3IM8A 3QQCD 2XMTA 4HHJA 4NLUA 5F9LA 1XMOJ 1X60A 2MQPA 4RW7B 2HLUA 5D4PA 2ZJRQ 1ZM3A 5F3ZA 1WHVA 3KMSA 1CBKA 5HANA 3MOJB 1SUQA 4FNIA 3OVAA 2A0FB 3G6XA 7AT1B 3H2UB 3N79A 4YFUA 4LF9F 4X64F 1ZAXA 3EVMA 1HWKA 4I7FA 2WW4A 3BR9A 2RD5C 1C1BB 3CCES 3HVTB 4X4TA 4JI2J 1NK6A 1GH8A 3RR8A 4FF4A 4DR2F 5IZHA 1WTBA 4IFVB 2G9OA 2HS4A 2VKRA 3BQ2A 2JHEA 2YWGA 4E2FB 1YRXA 4PXEA 1RT2B 2R3VA 4EYIB 4ED5A 2EEYA 3NGRA 2Z2ZA 1U1OA 3QAUA 3NGTA 1F9HA 4RW9B 2CQHA 5ADZA 3U02A 2W7PA 1H2UX 1W2IA 2KTQA 4USUA 2QFJA 3GV8B 2UV8G 2KH9A 4Z2XA 5HO4A 4EEYA 4LUBA 1HNVA 4X65F 3OFFA 3FGVA 1SVDA 3KLHA 1FKOA 3HLUA 1TL3B 2MQMA 3OR1B 3GJRB 2OTLS 2YH1A 5RUBA 3M2VB 2DHXA 3VGTA 4MKYA 1HHTP 3NEKA 4B17A 4NXMF 2KHCA 1S1XB 3TZXA 2R8IA 4DL0C 4OMFG 4LFCF 2IPOB 3KHRA 1UWBB 1IUJA 5ETOA 3Q89A 2QRRA 4TLQA 1S1TA 4NASA 1VQ4S 2GJIA 3E01A 3QGGA 2ZUAA 4HT7A 2F3JA 1WF0A 2NSCA 4TNOA 3R27A 3RBXA 3FFIB 3ADAC 1Y7PA 3DM2B 1UW9A 4RJVA 3TA1A 2GV1A 3DLGB 2DGXA 1O6XA 4F8RA 1R8PA 1EHWA 4MK7A 4P2SA 3CCLS 3OTOF 1K1QA 4ZVFA 4P75A 2VF3A 1X5SA 2D3ZA 4B9UA 4CI0B 3FBBA 1XR5A 3AXMA 1OMSA 3SFGA 2GQCA 4IUFA 1U0HA 3VVTA 1HWLA 2LFVA 2KU7A 3SEOA 1FXDA 5GMEA 3V81B 1IKXA 2I38A 3LWMA 1LWCB 2EBGA 4NLXA 1U09A 2GGPB 2RILA 4IFYB 4YN3B 2VPXB 1S4FA 3LGMA 1VBZA 2B51A 4USVA 1TVRA 1BWEA 2VPYB 3DGVA 1Y0HA 1OWXA 4KH0B 2LA6A 4JI8J 2MTLA 3AT1B 5D4OA 2F65A 4GVLA 1X4BA 4LRDA 4JV1A 1MU2B 1RHRB 3SIPB 3LO3A 3HHNB 4WXWA 3C15A 1NDLA 5C7PA 3SBMA 2YXLA 1U0SA 1M5SA 2QC3A 4DDFA 2BW7A 1WUUA 1N34J 3MM9A 2G2YA 4OLOA 5LM7E 1CJTB 2HLTA 3R7BB 1UCNA 1RT5A 3R5GA 1F5CA 5A0YA 5JMNA 1DURA 4UQGA 2FGCA 2VQEJ 3MFHA 2UVRA 3C66A 4DV7J 4RW6A 5CD4A 2ASLA 4LREA 3ENWA 2BBEA 2XMAA 5C5JA 3WHIA 4HR2A 2C3UA 2UXBJ 1V3RA 1P1LA 2C2EA 3RU0A 2DT9A 1RAEB 2DR9A 1LNQA 4JB8B 3UN2A 4JI5J 4RUHA 2I0XA 4ZS6A 5I3UB 4B3OB 2K2PA 4HI2A 4IO1A 4DR4J 3DN9A 3MEGB 4OZ0A 3HHLA 2HQFA 4WIQA 3RB3A 2KFYA 5ETRA 3GSIA 2E1MC 1PAUB 4RW4B 3D0IE 5CAAA 4K4YA 1D9DA 4CH1A 5KG6A 3T9ZA 1HMVB 1NEEA 3PW4A 4C3LA 2W1BA 4PEOA 4DR3J 3CCZA 1IKYA 1UP1A 1W26A 2MJNA 4YY3F 1F3VA 5F0UA 3ZTSA 3A4TA 2HIQA 4HTIA 3EVWA 1Y5NB 3W63A 5HJYA 4WZMA 1RT6B 1GAOA 2FHKA 2RRNA 1SH0A 3C2PA 3H42A 2H51B 1S6QB 4CTAB 2HHTA 3TYTA 1AXQA 2D9OA 4O0IA 1T03B 3ILOA 4I4BA 2VG6A 3DRRB 1FRKA 3TUJC 3HFVA 3HHLD 3MUVP 4HEA9 3PM9A 2FD2A 1TKZB 1QSLA 3ZZTA 3GB0A 4LF7F 1E6VA 3S1TA 2I5JB 3MMBB 5AJ3J 3NGKA 3KLGA 1S0OA 3OVBA 2RS2A 5IV3A 1XJWB 1FVQA 4QWEA 1QD1A 5KFWA 3GFZA 3N28A 3KDOA 4DCPB 2LQBA 3AB2B 3I32A 4UOCA 2OFHX 3ZZZA 4PRFA 4NA3A 2FY1A 2AEMA 2V34A 3MEDB 2VC0A 2XSJA 8AT1B 2V9WA 1IN0A 3IAS9 1IJEB 3VAJA 1U4BA 2EW9A 2DR6A 3R7SB 1TFYA 2VDIA 1D9FA 5HROB 1OSCA 3T5KA 1WD6A 1VQ6S 2OAUA 4B9SA 5DDRC 4DR5J 3VAHA 4LQ3A 4KC5A 2VFTA 2WVCA 1OIAA 3BN4A 5FJ4A 3DLBA 3W9JA 3QGHA 2ZC3A 5K14A 4ICLB 1SV5A 4WBFA 1NO8A 1T7PA 1NHKL 2ROPA 4WWSA 2GX8A 2MPUA 3DLKB 4KV8B 1ZM9A 2DGSA 2OSRA 3NMRA 1NPKA 5K8PA 2W24A 3CCQS 1R6VA 5KFTA 8RUCA 3DI6B 2KFNA 4KJIA 2ACYA 2XM3A 3M8WA 4IG3B 1TL5A 3I31A 4U8YA 2K3IA 1F9EB 1D0EA 4LR9A 4KGXB 3GYXB 1TU0B 2KT2A 1N88A 1C0UB 3NNCA 4ZIWA 1DQ8A 3RYLA 2BXJA 5FDLA 2ZH7A 3CJ0A 5B0GA 2DGWA 3IXQA 5CXTA 2W01A 2CJXB 3EICA 4IDKB 4Q8FA 2DHAA 4AQYF 1LK7A 1PKUA 1MNEA 1F2GA 3ISND 3GR1A 3WIUA 4CLTA 2VUGA 4FBUA 3TP2A 1DQ9A 1FRXA 1IBKJ 1ZPVA 3DDIA 1HR0F 4CLSA 1J5EF 2DRBA 2YKQA 5HVGA 3H8YA 1NSQA 3KKFA 3MR6A 4IH7A 2HMIA 4XDCA 2VFRA 2N82B 3EGZA 5MLCV 2LA4A 2NQPA 3TA0A 4DSJA 3QJPA 3PW2A 3I0RB 1F6TA 2AJFE 4YB5A 1WJ9A 4N5SA 3HVTA 2LQJA 1EQ0A 3BB5A 3IWXA 3BO4A 2L41A 2AD9A 5KFGA 2J7UA 3M8QA 4TXSA 4IFVA 2HZCA 1BHNA 3KLIB 5KFSA 2LQ9A 1T9YA 3FNNA 1S1VB 2ZH1A 1U8WA 2H3EB 3H5YA 3AOAA 3H5SA 1SI9A 5H9FK 3GJTB 2AZ3A 1NU4A 5GMDA 1U1LA 2UUBF 4KTQA 2QIFA 4K4TA 4C7QA 4MK8A 2ZH4A 4FKYA 2HQDA 4W90B 5LMUJ 3DNCA 2MYFA 4OX9F 1RHQB 3CD7A 3HPOA 2RDIA 3I9ZA 3ZNUA 5CZVA 4DPXA 4ZLLA 4ILLA 4DR1J 5KFMA 4QW9A 4KHRA 3W5XA 1B4SA 4K4WA 2OEMA 5U47A 3ZZPA 2DEJA 1TL3A 2YWHA 1RWKB 2PT0A 4CYUB 5F9NA 1RDRA 3OR1A 1XC9A 2ERRA 1ZETA 2ZJPQ 2B7BB 4F0KA 1M0SA 4JV2A 1IR1A 3BBBA 3LAMA 2O67A 2CZ4A 3A8IA 2HSEB 3OXFA 3K5LA 1U25A 2ZH2A 1S10A 1UWBA 1N5SA 2AYBA 2N4CA 1RQ0A 5J2NB 4ZPTR 1EJ7L 1K44A 2AW0A 1WOOA 3UQSA 4ATNA 2DXEA 1JIHA 3CJ4A 4RNHA 3MR3A 4Q44A 4B3TJ 1S1WB 3FFIA 3DM2A 3GPAA 2GVZB 1R43A 2VJUA 3HKZD 1DAXA 2UU9F 1GXLA 1B3TA 3AD7C 2YX7A 1QTMA 3TW0A 2NXJA 1FNOA 1JK9B 1H2TZ 1UZHA 5CD4H 5KFLA 1FHTA 2GVDB 5E3CA 1NK9A 2DGVA 2AJ0A 3IRXB 5D0RA 2DY1A 4DR6J 1KLMB 4ZVPB 2WBMA 1HNWJ 1X0FA 3L9ZA 2FHJA 2OUGA 3M9OB 3GG0A 4R25A 1SJFA 2QJ3A 4A8YA 2FVSA 1BC6A 1U49A 2H1YA 1NBEB 4QWBA 5KTQA 3Q0AA 1H72C 1NHUA 5HATA 3M4XA 1RT4A 3OFEA 2AV5A 2VODA 5E3QA 4PG5A 1LWCA 1RE1B 3GP9A 2PD1A 2D3OR 2YVSA 3HI9A 2P9EA 4NYZA 3U1NA 3EWGA 3TA2A 2FVRA 4LIRA 2RHQB 1N5VA 5J2QB 4RKUC 1UZDA 3UN5A 1TL4A 2BA9A 1R89A 3ZZOA 2B56A 1HI0P 2DGQA 2Z8QA 3OTDA 1H6KX 4GKJJ 4QU7A 3F56A 1YBAA 1AZSB 1TK0A 5H9FJ 2U2FA 2ATLA 4ED6A 4IRCA 2F4VJ 4YOEA 2W2PP 1CJTA 4HH1A 1VYAA 1T8EA 2PO4A 3QATA 4ZCIA 5LSOA 2KZZA 5ETPA 5KG5A 2M5YA 4Y2CA 1KRPA 2HQCA 3PTWA 3EXYA 4B9MA 4LF4J 1URNA 4A4JA 4NLTA 1MWQA 4IR9A 3NS7B 2QE5A 2KG0A 2IIHA 1RYRA 1HPZB 4CO5A 4QYRA 3CIMA 2ROGA 3Q8YA 5I3UA 4PR6A 4NE9C 4B3OA 5B0CA 5KFPA 4ZVSB 4WFBQ 3MEGA 4OJ3A 1E6YB 4EBEA 4O3QA 4KGVB 2HNDB 3M8ZA 2DNPA 2R2UA 1ZBTA 1HD1A 2ZHAA 3DOLA 2HFUA 3T1HF 4RWWA 4Z37A 1HMVA 4OHZA 1GT8A 1CEZA 3W5ZA 2PMWA 4QR0A 5L8RC 3MI7X 1HQUB 2MY8A 4NL5A 4H4MB 1R8BA 2M70A 1MG7A 4I2PB 1F9FA 3OTBA 4LQ9A 2W9BB 1L3UA 2CYYA 4J37A 1WDTA 3CJRA 5AXMA 1TL1B 4YEAA 3FSYA 4ZP8A 1S6QA 1JLBB 4CTAA 4UF4A 2HKEA 3M2RB 3AA8A 1RHUB 4F04B 1GTEA 2QG9B 4C11B 1T03A 4QWDA 3T5LA 4URGA 3CDAA 2YY3A 2RU3A 4WU3A 2CIMA 1R8AA 2DCUB 2P9GA 1V9OA 1X5PA 2P2CB 5J1NA 2I5JA 3MMBA 4DZDA 5KT7A 1PBAA 1S79A 3D3CJ 4NXNF 4F02A 1BE4A 1KEKA 1QAIA 3HVAA 2CQGA 4PG4A 5THWA 4RBTA 4ZPCA 1RA7A 4MYUA 4Q0BA 3JB9k 4P2XA 1FRIA 1R27B 1RT3B 4X66F 5AT1B 2X1BA 3H5XA 3PJ9A 2P5VA 4Q2MA 3UPFA 4A8MP 3JYTB 2OELA 1FDBA 4JI7J 3UNGC 4BWMA 2BR0A 3NCPA 4DHVA 1GTHA 2Z2MA 3KK3B 2LMIA 4LSLB 1VQSA 1UPPA 3UR3C 4OJ1A 2RUSA 2AHOB 3V6HA 5GAEI 5HROA 1S0VA 3A12A 3NBPB 4EFAC 3D0HE 2V5HG 2HHHJ 4KT0C 3M30B 2CQ4A 1R0AA 2LKZA 3GCWP 4JYAF 1FX2A 4WP3A 3W2WB 3RAXA 3MPUB 3M05A 1ACMB 2V2ZA 1Y10A 1Q4RA 1EKRA 4ICLA 3J81j 4ECTA 3I82A 5E0OA 2DNHA 1PIEA 3OLBA 2KM8B 3HVRA 2VDHA 4DPOA 5HLFB 2E7VA 2KZMA 5HK4A 2DPJA 1ULRA 4R0EA 3NRBA 2HNZB 3MPDA 1TL7B 2FHOB 4C4WA 1ZM4A 1SKUB 1OQ3A 1UFLA 3OTCA 2IHR1 3BGRB 1CQMA 2VKZG 2J6TA 5EWEA 1RABB 2IC3B 5FLXY 3MM7B 3ETMA 5AXNA 4O3OA 4QPXA 1OQ6A 3IR5B 1WG1A 5LMNF 2MQQA 2LU2A 1C0UA 5E33A 2H5EA 1W2BR 2GMJA 3PZPA 4V19X 1BQMB 2CQ0A 2NUHA 2B9YA 1WTFA 5T41A 5ETKA 1IR2A 2D3UA 4QIWD 4NPOA 5A2QU 4IDKA 1JX4A 4AFFA 2YQ1A 2ZBCA 3LF0A 3MM8B 2OPPA 3W9IA 1IKVB 3R5BA 1NJWA 3M8PB 3TAMA 1AUSL 2KJWA 2R8HA 3CCUS 3V6DB 3P5BP 5M2UA 2JC0A 4NZ0A 2GQ2A 4O4GB 3CT9A 1FVSA 3HT3A 3HD1A 3MHYA 1IBLF 1RBAA 2AGPA 3R7NB 1CVJA 2Z0GA 4QCLA 2HBZB 2YTCA 1RXOB 3HHEA 3H90A 4K2JA 1FTCA 4BBYA 4WFAQ 2N3OA 1QTNB 5KFYA 1RCOB 2R7UA 2M0GB 4HH0A 4M5IA 4X62J 2ZKTA 1FWPA 4CLKA 2WVBA 3I0RA 3OD2A 1V3SA 4GC6A 2UUAF 3LP1A 2HURA 4DV6J 3DMJB 1S6PB 4FYDA 2MKIA 1RKJA 5KFOA 4X4VA 2VHGA 4YB6A 5CYQB 1FRMA 3FMWA 4XK8C 4FF2A 3RAQA 3KLIA 3GJSB 4WP8A 5LJ5Y 2B9XA 2XS5A 1S1VA 2DJWA 3M6XA 5L1IA 1RWOB 2YKOA 1VI7A 2ZNZA 4ELTA 1SJRA 4F4WA 1P9YA 3QYYA 2HW3A 3OR2B 4AL5A 3A3OB 4NZ6A 5G0RB 4DR7F 1M5KC 1K9MT 3L3CA 4X4NA 1NJXA 1VBYA 2DVIA 4P72A 2K06A 2B4PA 1GEHA 3W7BA 3G4SS 1KLNA 2YNIB 2H5JB 5EUHA 2MMYA 3C6UB 3CJKB 2BANB 4UOHA 3J7Z5 1SIWB 3AD9C 5IQQA 4CYUA 2OIHA 2XC9A 1T3OA 1T9VA 2AX0A 2AX1A 4OZ5A 5A8KB 3CCVS 3TRGA 2XMUA 1VRQC 3UNYA 3MMAB 2GMLA 2FTRA 3MCNA 3PHEA 1SKRA 4NA2A 1Q81T 5LSRA 4CDIA 4WCEQ 2VONA 3IS9B 1Q5VA 1G3OA 3OL9A 4RUAA 3FBFA 3O44A 4JI1F 3KG4A 4MAKA 3GJQB 3QWPA 4IRKA 1QAJA 3F41A 2DNRA 3LANA 2YX4A 2F1FA 4FXWA 3WDOA 5FIIA 5LT5A 2XB2D 2GVZA 2IA0A 5F3TA 1QAXA 3CB4A 1O5JA 4LSNA 2KKHA 1I94J 4DQSA 3BBFA 3C16A 5KFQA 1KTVA 1X4EA 2GVDA 4C8LA 1PJ6A 2G4BA 4ZMMA 5I4MA 3BBCA 1HI8A 4YS2A 1T0TV 3EDQB 1RTZA 2BJEA 4F50A 2DEIA 1AW0A 2V2VA 2GQQA 3KNGA 2V8VA 2R8JA 1XMQF 6FDRA 4G1QB 1ZTTA 1RUSA 1RKIA 2IA6A 4TQSA 4DS5A 2DH9A 3D0GE 1VFJA 3PR5B 2L9DA 1JLCA 1JJCB 4J9SA 4DSEA 2A2DA 3IG1A 1NK7A 3QT8A 1SQGA 2VU5A 3GWCA 2DGUA 3DRPB 5BYQA 2GIRA 3JAMU 2VG5A 3AQOA 2MKKA 4P74A 4CH0S 2WK4A 2ZH9A 5KFAA 3VQSA 3C19A 3FKBA 4DSLA 1TKTB 3AAWB 3DRSB 1FJGJ 2FDNA 3H4BA 2HYIB 4MK9A 3K0JA 3R6LB 3SSSA 3C14B 4DZ6A 4DV5F 1VR6A 4OJHA 1XNQF 2VL1A 3M1VB 1HKAA 4P2MA 5D4LA 1S72S 3D4JA 4CO4A 1DLOB 4UOFA 1DARA 1VJWA 1QVGR 2OEJA 3FBEA 2GHVC 2YPYA 1Q79A 3QAEA 2J0QD 1NK0A 2DNQA 1RP5A 3PY8A 2JVOA 4GC7A 1YJ9S 2IJRA 3BKFA 2BJDA 2LXFA 1MWYA 3CXCR 2ZEJA 3M9MB 2DD8S
chains in the Genus database with same CATH topology
2EC2A 2VHGA 2VIHA 2FYXA 2XO6A 2F5GA 2F4FA 2VICA 4ER8A 2VJVA 2XQCA 2XMAA 2A6MA 2VJUA 2A6OA 2XM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC2 A;  2VHG A;  2VIH A;  2FYX A;  2XO6 A;  2F5G A;  2F4F A;  2VIC A;  4ER8 A;  2VJV A;  2XQC A;  2XMA A;  2A6M A;  2VJU A;  2A6O A;  2XM3 A; 
#chains in the Genus database with same CATH topology
 5B7W A;  1HPZ A;  3DHX A;  1Q78 A;  2E7X A;  2V8P A;  4YR0 A;  2IVF B;  2I1R A;  2VBW A;  1T05 B;  2HFV A;  1KQF B;  2M52 A;  3MEK A;  3KTQ A;  2A6O A;  1E6Y A;  3WIV A;  3S6E A;  2N7Y A;  3HSJ A;  2BMB A;  4F3Q A;  1LKZ A;  2FLL A;  1YJN S;  2BRL A;  2HFS A;  1TKD A;  3DRY A;  3ZC4 A;  1N36 F;  4ZK7 M;  5E3P A;  2B4V A;  4LF8 J;  3K8W A;  1KR4 A;  1FES A;  5D78 A;  4C8O A;  1WC5 A;  4H4M A;  1ICE B;  4PG6 A;  2G0I A;  1F5A A;  3NOG A;  1LOU A;  6FD1 A;  2AYG A;  1KTQ A;  2WON B;  5DS7 A;  2AJ4 A;  2KYZ A;  2PII A;  1QUV A;  1H7W A;  4RL1 A;  3BGO P;  1JLB A;  4JOU A;  3A8E A;  1VK3 A;  3UI3 A;  3ENA A;  3PW0 A;  3KLF A;  4AD6 A;  4CWB A;  3K89 A;  4C11 A;  1RTH B;  2V8D A;  2D3O 1;  2VQF F;  3CDW A;  3CJ2 A;  4O0N A;  4ZVU B;  4ZN1 A;  2HHV A;  2BV3 A;  1L5U A;  1VBK A;  3DLJ A;  3J80 U;  2R7R A;  2G1D A;  2W9A A;  2B6A A;  3VZI A;  3I4P A;  3TUI C;  1HW8 A;  1RT3 A;  5F8G A;  5I42 A;  4MTP A;  4H4K A;  2PGC A;  2ZZM A;  3ZXW A;  2XSF A;  3JYT A;  3QSI A;  3QBC A;  3W2V B;  2QLJ B;  5A8W B;  1GXT A;  3UD3 P;  4ZVH A;  1FEE A;  2XO7 A;  2RML A;  2WB1 D;  3L7O A;  3KK3 A;  2IM2 A;  4LSL A;  2EKY A;  1WKK A;  1OY8 A;  1UVL A;  5F8H A;  4ZP9 A;  2E9T A;  2LXU A;  2Q79 A;  3A1Y G;  3R5A A;  3PX6 A;  4K2X A;  1CQN A;  1S1U A;  1TR0 A;  1VQ5 S;  3NBP A;  4KGM A;  4QR2 A;  1RI7 A;  2R2R A;  2EG2 A;  4FBT A;  1RWU A;  1Q8L A;  3M30 A;  1P9Q C;  1Z2L A;  1Z4U A;  2CQD A;  3Q8U A;  2IY5 B;  1HQ2 A;  1U1P A;  1MN9 A;  2EK6 A;  5DDQ C;  3TO8 A;  2ILZ A;  3W2W A;  3IBW A;  3D7S B;  3E2E A;  4ZHR A;  2NLW A;  1QE1 B;  3TAP A;  3KHL A;  1VJQ A;  1MLA A;  1YZ6 A;  3MR2 A;  2A3J A;  2K8G A;  4ELV A;  2JRS A;  4R8U B;  1Y3J A;  4ZP6 A;  4A46 A;  2HNZ A;  1NK5 A;  1F5B A;  1TL7 A;  1RYS A;  4DXL A;  3BGR A;  1U6Z A;  2CWK A;  2XZT B;  3FRZ A;  3KK1 A;  3HT0 A;  2Z2L A;  5GMK a;  3UCU P;  4DN9 A;  2IC3 A;  4ZVQ B;  3MM7 A;  4EU0 A;  3EUN A;  1Q0N A;  3M32 B;  1GNK A;  4KYZ A;  2PI4 A;  5J2M B;  2UVW A;  2QSF A;  3KJV A;  3MM5 B;  2DBB A;  2MHN A;  4B3S F;  3FBC A;  2FVP A;  3FSX A;  1RLC L;  3MD1 A;  3H20 A;  3NAI A;  4DL2 A;  1BQM A;  2KJV A;  1BQX A;  3FQK A;  2F63 A;  2C2K B;  1IKV A;  3JQK A;  4ZPW R;  3VAF A;  2PMZ D;  1JJ2 R;  1UVI A;  2E5L F;  2CRL A;  1TAQ A;  2ZVI A;  3VV2 B;  1C1C B;  4HAC B;  1CJU A;  1XMO F;  1RTD B;  3ZTO A;  3TUZ C;  1WC1 A;  4WU2 A;  2NRE A;  2HVH A;  4O4G A;  2GAG C;  2BQR A;  1N6Q B;  1HYS B;  3AFG A;  2R8G A;  4LFA J;  4ZLJ A;  3GFX A;  2A6M A;  1U1Q A;  1OSD A;  4K4S A;  1VOM A;  2HFZ A;  4LF2 A;  2Q43 A;  4F3M A;  3F44 A;  4U7U D;  3ISZ A;  3QJL A;  1WF2 A;  4JI2 F;  2G2O A;  2WAQ D;  1F0X A;  1NK8 A;  2IRY A;  4I69 A;  2OH2 A;  4DPT A;  1NJY A;  3GR0 A;  4DPW A;  3RB4 A;  2I9S A;  4GKK J;  2H4W B;  1MSW D;  2VD3 A;  4J9V A;  1VQ7 S;  4LSZ B;  5KFI A;  3CC4 S;  3RRK A;  4OJG A;  3B4D A;  2HS3 A;  2ZE2 B;  3J7Y U;  4LVN P;  1S9F A;  5HP1 B;  1HNI A;  2MQN A;  3IR7 B;  1FXL A;  3J7A N;  2VB6 A;  2D9P A;  2QYC A;  4QYZ K;  2RQC A;  2P9C A;  1RWN B;  1EET A;  5AXL A;  2E1R A;  1PG5 B;  3PVX A;  3FVY A;  4LFB J;  4M5H A;  2CJK A;  4HVZ A;  3DDK A;  4DV2 F;  1PC4 A;  1UEK A;  5K8N A;  3FUY A;  5K8M A;  2CPY A;  4UZB A;  3OJU A;  2HHU A;  3MUT P;  4OX8 A;  5A6P A;  4X4Q A;  2DO0 A;  3VGV A;  2KN4 A;  3OR2 A;  1B99 A;  2C1E B;  2CQ1 A;  3D28 A;  3MGJ A;  1LW0 B;  3SQG B;  3FRY A;  4CLY A;  3BEG B;  3LP2 A;  2B0G A;  5J2P B;  2YNI A;  2V67 A;  2WVF A;  2EFP A;  1X4G A;  1WHY A;  2BAN A;  2W4P A;  3GIR A;  1KFS A;  1QSY A;  1VQM S;  3Q8R B;  2DCL A;  2PFD A;  3W3S A;  2WBR A;  4P52 A;  1BWV A;  5KAK A;  3NLC A;  1XN9 A;  5A8K A;  3G6E S;  5DRK A;  3MMA A;  1RZM A;  2H65 B;  5IM0 B;  2RJZ A;  4B9N A;  3DU5 A;  2JL9 A;  2BDP A;  1RLD A;  3M2U B;  4I68 A;  2MZ1 A;  3QRQ A;  2JSX A;  4ZPV R;  1YJT A;  4E0D A;  3QO9 B;  2VZ9 A;  2BOP A;  3ZTQ A;  3V6K A;  4C0B A;  3VZH A;  3BSA A;  1FFG B;  2VOO A;  1ZA2 B;  1HD0 A;  3PEJ A;  4KKO B;  4PWW A;  3OW2 R;  4KFB B;  1SKS A;  1S9E A;  1ZS6 A;  1NH7 A;  3W5Y A;  1UKU A;  4B3M J;  1N5Q A;  2KRR A;  5DZ6 A;  4DQP A;  2IJF A;  3BQ1 A;  4J7C A;  2B4U A;  2KB2 A;  1RWP B;  1GX6 A;  4G1Q A;  3CJS A;  1GMU A;  2QA1 A;  2FZK B;  4U7C A;  3OV7 A;  2K1R B;  3DYA B;  3CC2 S;  1VRT B;  2HQI A;  3F73 A;  3EZU A;  2ILY A;  4C0H A;  3RRH A;  1WEL A;  4JUZ A;  4JI8 F;  4W92 B;  2Y9H A;  3DRP A;  4IR1 A;  1TTH B;  1XK8 A;  3HF5 A;  4WPA A;  5HVF A;  2OP5 A;  4PCQ A;  1FX4 A;  1CSJ A;  3FZ2 A;  1FRH A;  4F7V A;  2L3M A;  2YBV A;  5IQ6 A;  1S5Z A;  2HBR B;  1CJK B;  3Q2T C;  5D77 A;  1SJQ A;  2W9C B;  3EX7 B;  3KLV A;  3DRS A;  2C3O A;  2QL9 B;  4U9R A;  1N34 F;  1CS4 A;  4X4O A;  3C14 A;  4QYZ J;  2Q1L A;  2B5J B;  4EK2 A;  2V94 A;  2VQE F;  2BUN A;  4N77 A;  1RWV B;  4CLZ A;  3Q8P B;  5DG7 A;  4KHP J;  2J7K A;  2E44 A;  2W2O P;  2UXB F;  5IT9 U;  2Y0B B;  4L76 A;  3WBZ A;  4A8S A;  3FCV A;  2UUB J;  1QM9 A;  2WSF C;  1HI1 A;  4DV3 J;  4JI5 F;  2PA8 D;  1KC8 T;  3IM9 A;  4B3R J;  3I5A A;  3LOU A;  4YDD B;  5GAD I;  5B09 A;  4M5J A;  1KWM A;  3UDE A;  1HQE B;  3MZI A;  3VAI A;  2MB0 B;  8ATC B;  4DR4 F;  1OY6 A;  4K0K J;  3D66 A;  1XQI A;  2UUC J;  3OSP A;  2ASJ A;  4OZ1 A;  2K3K A;  3QGI A;  1PCA A;  5A76 A;  4IH6 A;  5D3G B;  4EUV A;  3TAN A;  2VG7 A;  3MMC A;  1T05 A;  1NAQ A;  2W2N P;  2E66 A;  4MMO A;  4OI3 A;  4ED3 A;  4WF9 Q;  1AYE A;  2FVQ A;  4DR3 F;  3VAL A;  1RU1 A;  1NH8 A;  3C6T A;  3MAA A;  3TAQ A;  3BH6 B;  2GAH C;  3D54 A;  5K5M A;  3HO1 A;  1N33 J;  1U24 A;  3T6B A;  3OXL A;  2EFV A;  3EGV A;  2LEC A;  5IC6 B;  4DSK A;  4Y00 A;  2PEH A;  1IWA A;  2QLF B;  4WE1 B;  5HN0 A;  4LF6 J;  1FWL A;  3SFU A;  2WON A;  3KJF B;  3L4B C;  2XY5 A;  1QY7 A;  2DNO A;  4PYD A;  3DXB A;  2Z30 B;  5C25 B;  2HFO A;  5D6G A;  2UU9 J;  2VV5 A;  2XO6 A;  3TVZ A;  2ZBR A;  3I6P A;  2DNZ A;  3RUB L;  3OUY B;  1H98 A;  3KYL A;  4G3I A;  2WOM A;  1V5V A;  5AJ3 F;  1CJV A;  2ZBI A;  1JLA B;  2DIS A;  2DH7 A;  3BPD A;  4ZCL A;  3HFK A;  4CLW A;  1DJ0 A;  3CJ8 A;  3D6T B;  3BYR A;  2KXF A;  4FXD A;  4LT6 A;  1UA1 A;  4FYY B;  3NMA A;  4PUO B;  2BAC A;  2VPW B;  3SSQ A;  3PIP Q;  3DOM B;  4DX6 A;  5GAE U;  4P73 A;  3P8B B;  1YLX A;  3K5M A;  2I8E A;  2VBY A;  4EGL A;  4Y2I A;  3W2V A;  2EXU A;  2PE8 A;  4J5O A;  5KFE A;  2V0N A;  5A8R A;  4DR5 F;  3K7R A;  2ZFH A;  4DCO B;  4RWX A;  1R8H A;  4OLP A;  4J9K A;  2VA3 A;  2L9W A;  1NCL A;  2XQC A;  1JLF B;  3KG1 A;  5HBM B;  5CYJ A;  4ECZ A;  1B7F A;  2FZG B;  4GO7 X;  3CD6 S;  1HAR A;  2UV8 A;  2DRA A;  9RUB A;  1JLE B;  3NCR A;  2WZ1 A;  3T19 A;  3GU0 A;  3UDC A;  1G1X A;  1FDN A;  1D9A A;  2DR5 A;  1RB0 A;  2I2Y A;  1V5I B;  3D2W A;  2G2Z A;  1QE1 A;  1YSJ A;  3N5F A;  3ENV A;  3KNA A;  4ECV A;  1NHV A;  4P9S A;  2K7K A;  3HUL A;  2RQM A;  2BAB A;  3IMQ J;  1IWG A;  2E5G A;  3BDP A;  3AJD A;  5K8O A;  2MKH A;  3LP0 A;  4NA1 A;  3K5P A;  5J1P A;  1FKP B;  4KE5 A;  4Y6I A;  3RW7 A;  2BM0 A;  5F8L A;  2JEJ A;  1R8C A;  2XY6 A;  1S4E A;  4MKA A;  2CQ3 A;  4I56 A;  4K8R A;  1LWF B;  5KT6 A;  3M32 A;  3T9N A;  3G71 S;  2HGL A;  2PEB A;  4K5R A;  1WKJ A;  2WSC C;  4E98 A;  4LMZ A;  4EWT A;  1UVJ A;  2ADB A;  2V6A A;  1L3T A;  4KB7 A;  1CUL B;  4DV1 J;  3K17 A;  3EPG A;  1KKH A;  2EFO A;  2RT3 A;  2V4J A;  2ASD A;  3MR7 A;  3BSO A;  1N56 A;  3N0V A;  3CC7 S;  5D4N A;  1IBK F;  4ECS A;  4OI1 A;  3R2D J;  4YB1 P;  4K4Z A;  1EQM A;  3UW1 A;  1T9T A;  2VOP A;  4CLP A;  3MM6 A;  1C1C A;  2W2M P;  3DU6 A;  3PHT A;  4FVM A;  2MZJ A;  1K0V A;  5CCM A;  2DO4 A;  3TUP A;  4ZVT B;  5HI7 A;  4OI4 A;  4ZDN A;  2ZOG A;  2RE1 A;  3E8O A;  2YKP A;  1LWE B;  1TKX B;  3D1O A;  2J9C A;  5KOX A;  5EWF A;  2RSQ A;  2ROE A;  3RBD A;  3CD5 A;  1Y00 A;  4TN2 A;  2YX1 A;  1CC8 A;  3PCO B;  1KQG B;  3N6M A;  2XY7 A;  3S01 A;  3TJ9 A;  3UFC X;  4F67 A;  1Q7L B;  4PWD B;  1GQE A;  2OPR B;  4FPR A;  2UVV A;  3PKM A;  1YIT S;  4UST A;  2RF2 B;  2BQ3 A;  1JWW A;  2IYI A;  3OJS A;  2XNR A;  4N76 A;  4OV1 A;  3OLA A;  4N56 A;  1T11 A;  2AYM A;  1ROF A;  4F36 A;  5FD1 A;  5B0F A;  2CA9 A;  4R0J A;  5KFC A;  2ZE2 A;  2Z57 B;  3L7U A;  4F0H A;  4FYX B;  3BYP A;  4RX6 A;  2AQ4 A;  3I96 A;  3CJ5 A;  1Y9O A;  1YJV A;  3RG6 A;  1VC6 A;  5LMU F;  1FFS B;  2L08 A;  2JOQ A;  2X1G A;  1B64 A;  2XG8 A;  3GFH A;  4RBU A;  2RKI A;  1FDA A;  5LOQ A;  3L95 X;  1TFW A;  4O3P A;  4P71 A;  4DR1 F;  4DQI A;  1Q95 G;  4MKB A;  2XMK A;  3QZ7 A;  4DQR A;  1JXL A;  2KT3 A;  3P4U B;  2X7I A;  4USM A;  1LW0 A;  2MLY A;  2M2B A;  4V19 J;  2KXH A;  1BUX A;  1KOH A;  2XZW A;  3WQP A;  1RAG B;  4JI3 J;  3SCK E;  2ZD1 A;  3U1L A;  2U1A A;  2PSZ A;  2YNG A;  4ECQ A;  3P3D A;  3R5C A;  2PA3 A;  2DGO A;  2XTJ P;  3BS9 A;  2YKM B;  3HFZ B;  5KOW A;  2UUW A;  5T7L B;  2XS2 A;  2F8H A;  4DEZ A;  4IKA A;  3T6J A;  2NZ4 A;  2ZH6 A;  5ETS A;  5JVH Q;  2MQO A;  4ENO A;  2WRM A;  3B54 A;  4V1A k;  2Y1I A;  1WI8 A;  4DL6 A;  2AP6 A;  4B3T F;  3PW5 A;  1RBO B;  1J5O A;  4ECY A;  2BYC A;  5EX3 A;  1NDK A;  4H4O B;  4DV4 F;  4F25 A;  3DC2 A;  5KFK A;  4HHH A;  2RDD A;  5B0A A;  2CPF A;  5K9F A;  4LR7 A;  3QO9 A;  5BYS A;  3IBC B;  2N3L A;  3TZZ A;  1RAD B;  2Q3P A;  4DR6 F;  2UVU A;  4P7V A;  2F8E X;  4Y2M A;  3T41 A;  2CAD A;  1HNW F;  1FXR A;  2OI2 A;  2CPX A;  2V8H A;  4KKO A;  2YNF B;  4Z7C A;  4KFB A;  2GJ2 A;  2J7W A;  4ETZ A;  5C2C A;  2RB7 A;  4TLR A;  2RH3 A;  4J9O A;  4HL9 A;  4EI2 A;  2CPZ A;  1Y5I B;  3PJW A;  1IQT A;  3TOQ A;  2LEP A;  1NME B;  3N6L A;  2C2Z B;  5L38 A;  1OYE A;  3DYA A;  1VHI A;  2LEB A;  2W7O A;  2FJD B;  1VRT A;  2OPS B;  1C0T B;  4FZV A;  4YHH J;  2OPQ B;  1PAE X;  1S12 A;  4WFY A;  1Y4Z B;  3FEX B;  1HFE L;  1U02 A;  4I7F B;  2W4D A;  2K7J A;  2JLG A;  5F0W A;  2H54 B;  4GKJ F;  1TK5 A;  3ZZY A;  2B8P A;  3B82 A;  5EHH A;  1U47 A;  3SCI E;  4R5P B;  4U96 A;  1AB8 A;  3OXG A;  5DET A;  2BJ8 A;  1YWX A;  2A2C A;  1SH3 A;  2F4V F;  1MMD A;  1PO6 A;  4TYA A;  3D1H A;  5DZ7 A;  2HZA A;  3M8R A;  4KGK A;  3PV8 A;  1DTQ B;  4QWC A;  5ETL A;  1FO1 A;  2VIH A;  2B5J A;  1FDD A;  5L9N A;  1GMW A;  4WXO A;  2AIR B;  1HNZ J;  2GA7 A;  3RB6 A;  2G1H A;  4C97 A;  5HSP A;  1SKW A;  4CT8 A;  5DDP C;  2NCK L;  1U6F A;  2HHX A;  4LF4 F;  1S0M A;  1Q86 T;  2NS1 B;  1NPP A;  3NAH A;  4WK1 A;  3TJA A;  3X1L B;  1V3Z A;  4WII A;  1FI4 A;  4I1T A;  4BS2 A;  1LFW A;  1HNV B;  2OO4 A;  3BV8 A;  3SQO P;  1HQE A;  4ED2 A;  1OS5 A;  1OJ4 A;  2UXD J;  1FD2 A;  4QJV A;  4Q45 A;  3T1A A;  2ZM6 J;  2J9E A;  4Y2A A;  1UJ6 A;  2HQG A;  2Y0S D;  5D3G A;  3UDL A;  1EX8 A;  2NXE A;  4M5D B;  3Q8Q B;  1AA1 B;  2MXY A;  2AJQ A;  1N32 J;  2FJW A;  1NDC A;  4DWI A;  4URQ U;  1Y3K A;  3ZZ0 A;  1WOR A;  1SXL A;  2R7Q A;  4DU7 A;  2CQ2 A;  3JQJ A;  1S1T B;  4AL6 A;  4RUB A;  1UWA A;  1GK8 A;  3U1M A;  4Y0F A;  2RVJ A;  3E01 B;  3V6J A;  5CQG A;  2YQ0 A;  1JKH B;  5L46 A;  2DKO B;  1MRO A;  1IKW B;  2QMW A;  4LJM A;  4XTT A;  5C24 B;  2ZZN A;  1O51 A;  3SDE B;  4FKX A;  3BDE A;  1YKW A;  4WE1 A;  1F1B B;  4HDG A;  2F8M A;  1SL0 A;  2JVR A;  5C25 A;  2G0C A;  3I0S A;  4LF1 A;  1URR A;  4I64 A;  2Y8Y A;  2WW8 A;  2IJN A;  1U0H B;  3QIP B;  4NLO A;  4ZIV A;  1R0B G;  4X4P A;  1ZOT A;  3GTY X;  2IBK A;  5I3Q A;  1UEV A;  1GFW B;  4F4Z A;  3SI8 A;  2B7C B;  5JUM A;  1IKX B;  2LEA A;  1FK9 B;  4PUO A;  5H1S V;  3AOD A;  5HMY A;  4FYV B;  3TWZ A;  4BHQ A;  4JV5 J;  4ZVE A;  5G4D A;  2CDR B;  1DZ5 A;  2C2D A;  4K59 A;  3W9H A;  4JI7 F;  3CCJ S;  4ED7 A;  4DX7 A;  1GMV A;  4PAB A;  3P45 B;  4FS2 A;  4MFB B;  2R9L A;  4UY8 5;  4LR8 A;  3R9L A;  2LP4 A;  3VTI A;  2ZUG A;  2GJF A;  1M5O C;  1VIS A;  2HVI A;  2RNE A;  4L3N A;  1G7C B;  4ED0 A;  2HHH F;  2DY9 A;  1T95 A;  1EIY B;  3TVY A;  3ITH A;  1RCX B;  2CG8 A;  2C3Y A;  1VLO A;  1UET A;  5CCL A;  4PYA A;  1JLF A;  3H40 A;  3QT5 A;  3JSR A;  5F41 A;  4K5S A;  2AWZ A;  1KNZ A;  5C42 B;  2A1B A;  3Q24 A;  3EGW B;  3RRG A;  5CA5 A;  4TY8 B;  3C8Y A;  3HZG A;  3RJM B;  3PDN A;  2J9D E;  5DM6 Q;  2ZNY A;  4CO3 A;  3ETO A;  1ZYQ A;  4RW7 A;  1NB7 A;  3UVJ B;  3G87 A;  4OYM A;  4XDD A;  1EZZ B;  3QT7 A;  3SYZ A;  5D0H A;  2DH8 A;  3PX0 A;  1K0T A;  3HMJ G;  3HHL C;  4ZPD A;  3HHL B;  4ZVR B;  1WEX A;  1U48 A;  2GCF A;  1RT1 B;  4DFP A;  1NSK L;  2QEX S;  2BKN A;  1X8D A;  4X4R A;  1WDD A;  4WTO B;  1C1B A;  3QT6 A;  3RBE A;  1LWF A;  3FSI A;  2HRU A;  4OYO A;  2HIY A;  3VF0 B;  2NSB A;  3SV3 A;  1X5T A;  2CFX A;  4CP5 A;  1RJJ A;  4Q5V A;  2NUU G;  1VMB A;  4RW8 B;  2OJ3 A;  1IKY B;  4USI A;  3AA9 A;  2RRB A;  4DUY J;  1RT2 A;  5HQ8 A;  4OYZ A;  4QW8 A;  1LXN A;  3M9N B;  5KFN A;  4DF4 A;  3IAM 9;  3EMT A;  3W64 A;  3GIJ A;  1WOP A;  2JFD A;  5IOL A;  2OD6 A;  4RW9 A;  1JLQ B;  4HHU A;  3VGU A;  3SXL A;  4QPT A;  2MZQ A;  1VQY A;  1PIL A;  2HVZ A;  1TKX A;  2P6S A;  1NKC A;  4J9P A;  4OZ2 A;  1XIQ A;  2WHO A;  4WKY A;  2AZ1 A;  1E6V B;  1VK8 A;  3HD2 A;  9ATC B;  2D74 B;  2J6S A;  2XLK A;  4X62 F;  3MR5 A;  3K59 A;  2P6T A;  1YBU A;  4ZCK A;  4OHX A;  4PWD A;  3HJV A;  2IBO A;  3M2V A;  2DK2 A;  2OPR A;  3EE3 A;  4DV6 F;  1RT7 B;  3G96 A;  2AYE A;  2LVW A;  2RF2 A;  2JLF A;  1S1X A;  4HTJ A;  4CT9 A;  3PRB A;  1IM4 A;  2EKN A;  2YKN B;  3MF5 A;  2AGO A;  5D0G A;  2DXD A;  4ANC A;  2QTW A;  1XR7 A;  2XSJ B;  4A8W A;  3ZZU A;  4IO9 Q;  3HSD A;  3OL6 A;  3TVK A;  1YQH A;  2ZVS A;  3BR8 A;  4M5L A;  4NYO A;  4QOT A;  4ILM A;  4C9D A;  2AMC B;  2CZ9 A;  3DLG A;  1TK8 A;  4ZIT A;  2O01 C;  4K7Q A;  1TMM A;  2SXL A;  3NGU A;  2NZC A;  2RQK A;  4F26 A;  5K14 B;  1KVI A;  3F0N A;  2XI3 A;  3ISN C;  2Y1R I;  2D7S A;  4NLG A;  3M6U A;  1NM2 A;  5KT2 A;  2E5J A;  4RUC A;  2HWT A;  3CGI A;  4C2M A;  3PNI A;  3V81 A;  3N5B A;  1L3S A;  1NJZ A;  2GGP A;  4ZKA A;  2VFV A;  4IFY A;  3O2I A;  3HDS A;  1BQN B;  2R42 A;  3HCX A;  1X4D A;  1IXK A;  4A8F A;  4DL4 A;  1FTR A;  3T5J A;  4Y34 A;  3R6G B;  5KG1 A;  1WKL A;  2CPI A;  3TI0 A;  3JSM B;  2HHQ A;  4KPC A;  1MU2 A;  5IWA J;  2EPI A;  4RNO A;  4I6W A;  3GIM A;  1I94 F;  4CO0 A;  1U45 A;  3US5 A;  2O5D A;  4UZC A;  2GNK A;  3HXM A;  3J81 U;  2FHJ D;  3DOK B;  1UA0 A;  3Q8S B;  3I5C A;  1HL6 A;  2B43 A;  3CW2 C;  1Q8I A;  2YKA A;  2PFF B;  2DRD A;  1VQN S;  4JI4 J;  1RHJ B;  2QMU B;  4LF5 J;  4HT5 A;  4C8M A;  2Y1L B;  3MDF A;  2YNF A;  3FK4 A;  5AXK A;  4EZ6 A;  4DUZ J;  1LK5 A;  5D0E A;  2E5L J;  3SZ2 A;  4CH7 A;  1IVZ A;  1IBM J;  4I2Q B;  3PJX A;  3LAL A;  2MHE A;  1JNZ B;  4CQ1 A;  4ZP7 A;  5AE2 A;  1ZPW X;  2O3D A;  3TZW A;  4BDP A;  4OIX A;  2HMI B;  4MT1 A;  1HW9 A;  1RWW B;  4ECW A;  2OPS A;  1C0T A;  3TQ1 A;  2B4O A;  2OPQ A;  3I56 S;  1OPZ A;  1B0P A;  4IG0 B;  1FA0 A;  4M95 A;  4W98 A;  5KFU A;  1JB0 C;  1JQG A;  3BO3 A;  2O66 A;  3PO4 A;  1FJG F;  2W8K A;  5BR8 J;  4RW4 A;  4IQM A;  2GZO A;  2GFF A;  3TZY A;  4WFZ A;  1UVM A;  4ZJL A;  4AT1 B;  5A2Q Y;  1VQO S;  2AEJ A;  3W62 A;  4K50 A;  4R5P A;  3M8Q B;  1VDH A;  3SV4 A;  1XWL A;  3NGD A;  1Q82 T;  1DTQ A;  2J0X A;  3GIK A;  2CKW A;  1B7Y B;  1RTJ B;  1VHF A;  2EK1 A;  2OLW A;  4NLW A;  4ZCM A;  5GAD U;  4U67 Q;  4WFN Q;  5E3A A;  3FQL A;  1RT6 A;  1W7W A;  3LA0 A;  3V2U C;  5LJ3 Y;  3MWB A;  4DI6 A;  5ITH A;  5BYR A;  1F60 B;  1P8G A;  1OYD A;  3CCW A;  3FCW A;  4CM2 A;  3GIL A;  4ILR A;  2QL5 B;  3DXS X;  1VRU B;  2JC1 A;  1FNX H;  3DRR A;  4DV2 J;  1TKZ A;  2LQ5 A;  5D15 A;  4L73 A;  2HWI A;  4ETX A;  2GO8 A;  3BM7 A;  3AQP A;  4A8X A;  3KUG A;  1HNX J;  4FN5 A;  1FWK A;  1I51 B;  4LRB A;  3QRR A;  4L6V 3;  6AT1 B;  2XMJ A;  4QU6 A;  1R31 A;  2HRY A;  3OT9 A;  4M5D A;  1UPM B;  1IM6 A;  1K47 A;  3CCR S;  2MQL A;  3S7R A;  2FUG 9;  2CJQ A;  4LF8 F;  3WC2 A;  4NZ7 A;  1EAY C;  4FS1 A;  3CME S;  5EN1 A;  2QLB B;  3MED A;  3UN3 A;  2ZHO A;  4NLP A;  1JKH A;  1TV6 B;  3W1Y C;  1IKW A;  3JXO A;  5HVH A;  2KVQ E;  3BRE A;  4KHM A;  3IN5 A;  5C24 A;  4RNF A;  2JNJ A;  3SDE A;  4C6A A;  1QUP A;  4CIO A;  2EI5 A;  3ZZR A;  4OZN A;  3ELH A;  2R7T A;  1RAH B;  5IFM A;  4RLE A;  3RZA A;  4F4A A;  3V4I B;  2QGF B;  3CVK A;  4B9L A;  4WKR A;  3KUE A;  4CNY A;  2OMO A;  3N4W A;  3G2X A;  3B6B A;  3UCG A;  2IM3 A;  1G4C A;  2MZR A;  3QIP A;  3DLK A;  1HBM B;  3MUR P;  4KV8 A;  4XIU A;  1WSV A;  4LRF A;  2JFK A;  4JI6 F;  4ALZ A;  4GO5 X;  5DJB A;  1GXU A;  4KIA A;  4YUD A;  1RT4 B;  3DI6 A;  3LAK A;  2DIU A;  2Z2Y B;  3M6W A;  3TJ8 A;  3AOB A;  1UVK A;  4IG3 A;  1FK9 A;  4JI0 J;  3AH6 A;  4ZOS A;  2UXC J;  2IDE A;  2MJU A;  2YWF A;  3AJ2 A;  3MEC B;  4DX8 H;  5B08 A;  2JEI A;  5KFJ A;  3HVW A;  3EXC X;  4DF8 A;  3B78 A;  1YRU A;  2FJA B;  4MFB A;  1MWZ A;  1K73 T;  3W8G A;  4DOZ A;  4P10 A;  1YGY A;  1RAJ A;  4M63 A;  4DV0 J;  3CJQ A;  2YNH B;  1RBL A;  2ATC B;  2MDA A;  1DBD A;  3T3F A;  2CQB A;  2QX0 A;  2B3T B;  3VHQ A;  3LWL A;  2XCP A;  2IM0 A;  3BGU A;  3PG9 A;  5C42 A;  4PWU A;  5DLG A;  1H0H B;  3LPY A;  1ZM2 A;  1WHX A;  4TY8 A;  3NS6 A;  4KH1 B;  4O44 B;  4MIA A;  2DNG A;  2GHP A;  3HSZ A;  2P8I A;  3GII A;  2NXN A;  3UVJ A;  3Q8V A;  2M8H A;  3JAM Y;  2EBE A;  1SC6 A;  5C2G A;  3NNA A;  3IA0 A;  3QJJ A;  3POT B;  3K5O A;  2CXE A;  1S0N A;  1WC6 A;  4ELU A;  2N7C A;  1HWJ A;  2KRB A;  1RT1 A;  1OO0 B;  1WG5 A;  5J1E B;  1SC3 B;  2M3D A;  4A48 A;  2DHG A;  2WTF A;  3R8Y A;  2QA2 A;  2HK2 A;  1JLG B;  3AJ1 A;  3DOL B;  3O3L A;  2KHD A;  1YZ7 A;  1S6U A;  5F8M A;  2Z58 B;  1SJ1 A;  1H73 A;  3C46 A;  3T1Y J;  3FDS A;  5M2R A;  1A6L A;  4RW8 A;  2EFG A;  1I5O B;  2Z4P A;  1PBU A;  2DGT A;  3UE2 A;  1XEZ A;  1YDL A;  4YDX A;  1SH2 A;  4J9U E;  1N54 B;  3DLE B;  4LFA F;  2MLX A;  3JSB A;  5SUH A;  4RU9 A;  1JLQ A;  1M1G A;  3THT A;  2VPZ B;  1FRJ A;  4OV6 A;  2CVI A;  4KY3 A;  2M88 A;  4FNH A;  2Z56 B;  4P2F A;  1AUD A;  3KHG A;  2ZH3 A;  2FJE B;  3BGL A;  3PKY A;  2CQC A;  4QWA A;  4YR3 A;  1SJ4 P;  3H7H B;  4JV0 A;  5AE3 A;  3D68 A;  1KON A;  2GC8 A;  4QIE A;  2G0J A;  4GKK F;  2CNO B;  1KS2 A;  4DL5 A;  1KBR A;  3KJN B;  1S49 A;  3CWJ A;  1RT7 A;  3PIO Q;  3I4H X;  3FJ2 A;  4Q0B B;  2VAS A;  2XMV A;  2XMM A;  4XAK A;  3NG8 A;  3PYF A;  3QPI A;  3H0P A;  4ZVO B;  3H98 A;  1RWM B;  3LH2 S;  4UT4 A;  4U8V A;  5J2N A;  2YKN A;  2BQU A;  3LQV A;  3SSR A;  2HQ3 A;  4MKV A;  1QJH A;  2BJ7 A;  1T94 A;  2HBQ B;  3UR0 A;  4LFB F;  1S1W A;  3JSY A;  5CH7 B;  1DY3 A;  3N01 A;  4Y28 C;  2J0W A;  2JH3 A;  5GAH I;  4NMX A;  4J9M A;  4KQZ A;  3GLJ A;  3MPV A;  2J9D A;  1YBT A;  4M5G A;  1R0A B;  3IRX A;  1UL3 A;  2LQ8 A;  5E5N A;  1KLM A;  2JJ4 D;  1KVJ A;  2NPF A;  1DRZ A;  2AGQ A;  3Q23 A;  3HZE A;  1RHM B;  3J80 Y;  1RK8 A;  2EWH A;  1RAI B;  3GON A;  1UFW A;  2V8G A;  3AB4 B;  4IQX A;  1RSC A;  5LSL A;  3MMJ A;  4TU7 A;  4ED8 A;  2W25 A;  3IO1 A;  3CD0 A;  3DGP B;  3R1H A;  3TNV A;  3UWT A;  2QV6 A;  3D6H B;  4OHW A;  1RGV A;  2UP1 A;  3FMB A;  3H2V E;  1BQN A;  4Y65 A;  3PYE A;  5J2Q A;  2M4M A;  3GYN A;  1PYO B;  1HHQ A;  4LF9 J;  3VAK A;  2DXF A;  4X64 J;  3H59 A;  2DB1 A;  3JSM A;  3MPW A;  2DIT A;  1UEU A;  4NRT A;  3VGS A;  1SBR A;  4DR2 J;  1AZS A;  1XBW A;  4DFK A;  2OPP B;  2DNK A;  3AD8 C;  4C8Z A;  4OYA A;  1W25 A;  3DOK A;  3TAM B;  2DIV A;  2AEF A;  2JX2 A;  3HJF A;  3RTV A;  4B3M F;  3DLH A;  3EPI A;  2QSW A;  1RAC B;  4NRU A;  4DU8 A;  3PO5 A;  4FXV A;  1BLU A;  4OL8 A;  2IDL A;  4PAA A;  3RR7 A;  2HRT A;  4BC7 A;  4QR1 A;  4I2Q A;  4NCB A;  4J91 A;  2RDJ A;  4B9V A;  5CZX A;  3VQT A;  4ES3 A;  2HEK A;  4TKT A;  2NXC A;  2LLZ A;  4F2R A;  1P1T A;  4X65 J;  4DN0 A;  5B0E A;  1ZAV A;  4QIV A;  2OTJ S;  4IG0 A;  4KPY A;  5DO2 A;  3QFW A;  4YP3 A;  2HND A;  1YIJ S;  1NND A;  4P6Q A;  3MUM P;  2NXU A;  1QLN A;  3Q83 A;  3LP1 B;  2PI5 A;  4I0W A;  4ZPA A;  3PYG A;  4NXM J;  4TQR A;  4LFC J;  2CNL B;  2MST A;  1S77 D;  3G82 B;  2LXI A;  4F3O A;  4G1I A;  4AXI A;  1FRL A;  1KQS R;  1HQU A;  4BLG A;  5DQH A;  2IFX A;  5LXR A;  3G6V A;  4KHP F;  2ZH8 A;  3MEE B;  4QBU A;  4I2P A;  4XPC A;  1RTJ A;  2A10 A;  4ES1 A;  3KHH A;  2W9B A;  3OSN A;  1KD1 T;  4DFM A;  1TL1 A;  3MFI A;  1N5T A;  4DQQ A;  5M2P A;  4DV3 F;  2M7S A;  3M2R A;  4PG7 A;  4B3R F;  3J7Y I;  4ED1 A;  3NS5 A;  1NXI A;  3OTO J;  4ID5 B;  4C8N A;  4WYW A;  2CG4 A;  4K0K F;  1VRU A;  2UUC F;  2QN6 B;  2DR7 A;  4S0M A;  2IVY A;  4FDF A;  5KG7 A;  4OX7 A;  3GV5 B;  2WVD A;  2OHD A;  3J7A 1;  4OZ3 A;  3ZFV A;  2MKC A;  1XNR F;  2ZWO A;  2DNN A;  4F4K A;  4NLR A;  2RQ4 A;  3MPY A;  3SCJ E;  4C8Y A;  1KFD A;  1YG0 A;  2R2S A;  2YQ3 A;  2O1P A;  1NKB A;  3J7Z T;  5KFR A;  3BSN A;  4EBC A;  2F40 A;  2XCA A;  1C2P A;  1U2R A;  4MH8 A;  5JVG Q;  4USK A;  1N33 F;  4NLY A;  1CC7 A;  3MTJ A;  4EBD A;  1D3W A;  3MAQ A;  3NP5 A;  5E41 A;  2XWY A;  2EVZ A;  3CNQ P;  4CLF A;  1D8Y A;  4LF6 F;  2FJV A;  1YJW S;  4HDH A;  1TV6 A;  2DNY A;  4MIW A;  2CWX A;  2HVE A;  4BC9 A;  5I3P A;  2FY8 A;  3ULH A;  4DV4 J;  3GQC A;  4LSN B;  3UDV A;  3JQM A;  3MTK A;  3CPW R;  3C16 B;  4L72 B;  2L9N A;  1DQA A;  2MY7 A;  3OVS A;  3RB0 A;  3MAH A;  2VA2 A;  4X2B A;  3W8P A;  2KL8 A;  3D6M B;  3H2L A;  3V4I A;  1AT1 B;  2JDJ A;  2N4D A;  1RIS A;  4GVB B;  4F0M A;  4RR5 A;  4MYT A;  3D1Q A;  1X9M A;  3NCQ A;  2FIU A;  5HLF A;  1AFI A;  2HAI A;  1HBM A;  4OHY A;  2H48 B;  2C2M B;  2B8Q A;  2Q66 A;  4NOH A;  1H38 A;  2HS0 A;  2FJB B;  1JLC B;  3IG1 B;  3W61 A;  2DHS A;  3OQ2 A;  2UZA A;  3B4M A;  2ZDO A;  2VG5 B;  2RHS B;  3VAG A;  3IFE A;  4NML A;  1TAU A;  3MEC A;  4TVA B;  4DPY A;  1UMJ A;  2LCW A;  5IC4 B;  1IQZ A;  2VH7 A;  4LBP A;  2ZC4 A;  3N6N A;  3C3L A;  5GAG I;  4ED4 A;  5F8I A;  2R4F A;  3JTO A;  3MCO A;  2W8L A;  1F2H A;  3NWR A;  2CJB A;  2GS8 A;  2YNH A;  3MM8 A;  4YR2 A;  1S59 A;  4O4R A;  3M8P A;  1HBN B;  1RAA B;  1JXV A;  4Q7A A;  3D9B A;  3WX8 A;  3CMA S;  1I1G A;  3I5B A;  3V6D A;  4YY3 J;  1WAC A;  2ZWP A;  1T9U A;  1PYT A;  3I87 A;  1S99 A;  1G6B A;  3KDN A;  4LBI A;  2OKQ A;  7FDR A;  1FER A;  4IYQ A;  4O44 A;  4PQU B;  4PG8 A;  5CYM B;  1XER A;  4O3S A;  4USH A;  3ILJ A;  2R2T A;  4KBI A;  2DNL A;  3A8K A;  3PRD A;  2QMX A;  1LEO A;  3PEH A;  3CDU A;  3POT A;  2ZH5 A;  3NNH A;  4LF7 J;  5IXU A;  2BJ9 A;  5ETN A;  1WWH A;  2KT5 A;  2V4R A;  3GFY A;  3EDR B;  3IBF B;  5J1E A;  2XGP A;  1ZZF A;  4Q43 A;  3DMJ A;  1S6P A;  1WF1 A;  1LW2 B;  3RGI A;  4DV1 F;  2FLN A;  1JLG A;  1JJ4 A;  1NLK L;  5DGB A;  2VJV A;  5CYQ A;  2W2Q P;  2AJ2 A;  2QO3 A;  2XNQ A;  2VFU A;  3CCT A;  2QLX A;  3MCM A;  3NWG A;  5ETQ A;  3ET6 B;  2RUG A;  2GIQ A;  4AUK A;  2JZ5 A;  3AHP A;  5IT9 Y;  4LIW A;  5EX0 A;  1QSS A;  1FJE B;  4N47 A;  1ZH5 A;  1B0V A;  4Q2L A;  2CVE A;  3EM1 A;  3DLE A;  1T02 A;  3CO0 P;  2IMW P;  2V68 A;  4ERD A;  1J27 A;  5BXI A;  3CSK A;  3KLF B;  4Z7Y A;  5G0R A;  4X4U A;  1MMN A;  1VQK S;  2KFZ A;  1IJF B;  4J9N A;  2MKJ A;  3W65 A;  4C0O C;  1QDU B;  1CLF A;  4X84 A;  4ECX A;  3FZB A;  2KYX A;  3C6U A;  3CJK A;  1BXN A;  1TQL A;  3OFG A;  2V2Q A;  1YJ7 A;  3KK2 B;  4NYP A;  1N52 B;  5HMZ A;  1NJI T;  4IOA Q;  3G8Q A;  5HMW A;  2C28 A;  4OQJ A;  3TEG A;  2CAJ A;  2C42 A;  2B6A B;  5CHC B;  4FVC A;  2C2O B;  5F8J A;  3VWS A;  3IR6 B;  2KG1 A;  3TQE A;  4H4K C;  2ADC A;  5I42 B;  1U1M A;  4PZV A;  3IS9 A;  4UW2 A;  2VC1 A;  1Q16 B;  3A3P B;  1PYS B;  4H54 A;  2YWW A;  3A13 A;  3EVO A;  3FEZ A;  1Q7Y T;  1FCA A;  1X4C A;  2ZBP A;  3OPK A;  4FP9 A;  1WC3 A;  2AKW B;  2IM1 A;  1S1U B;  3Q2S C;  3ILI A;  2R7V A;  3CUN A;  4K4X A;  4BWJ A;  2MGZ B;  1U1K A;  1ZTW A;  3V5R A;  4AQY J;  4F4Y A;  4WYL A;  1B70 B;  4NEY A;  2VIC A;  4QIG A;  1NK4 A;  4DL3 A;  2XBP A;  4JI3 F;  1RAF B;  2QLW A;  4ZHR B;  5KFF A;  2BJ1 A;  1T9W A;  2KM8 C;  1HR0 J;  3HHD A;  3E51 A;  1YI2 S;  3TX0 A;  3R1L A;  1J5E J;  4QIF A;  3ZNJ 1;  3QID A;  2DYA A;  3GYG A;  1KN6 A;  4ANE A;  4EO6 A;  4YQW A;  3IGN A;  5JJB A;  2Y1J A;  4OHV A;  5EWG A;  1MML A;  4M94 A;  2X3G A;  3P96 A;  3PRV A;  3DGP A;  3KK1 B;  2BE7 D;  3OFH A;  2FZC B;  2HHS A;  2C3P A;  4NLQ A;  4D3G A;  4LBH A;  1FJC A;  2X1F A;  3PAC A;  2C22 A;  1TKT A;  3KJV B;  3NKY A;  1Q53 A;  1TEL A;  1S57 A;  4J9L A;  3M1V A;  4J9R A;  2IYG A;  5E2Q A;  2H4Y B;  3BQ0 A;  4DV7 F;  3WC0 A;  5IT4 A;  1DLO A;  2BW2 A;  1N0V C;  2H5I B;  2J6U A;  4O3R A;  2M8D B;  4OZL A;  1HHS A;  2VFS A;  3EZ5 A;  2Y8W A;  2X51 A;  3TEH B;  4YME A;  2E29 A;  1CJU B;  1FNM A;  2L48 A;  3R3T A;  3ONQ A;  4DMZ A;  5DGA A;  5CAB A;  1SQE A;  2IAJ B;  3KWM A;  3RW6 A;  3AXK A;  5ETV A;  4OX9 J;  4YHH F;  3O5T B;  1NDP A;  5BJR A;  4U7U K;  2EC2 A;  4OX6 A;  4ES2 A;  2ACM A;  4O3N A;  1X5O A;  2MEW A;  4G65 A;  4DX5 A;  1VQP S;  4DFJ A;  3IWN C;  1HBO B;  2RAQ A;  1HWU A;  3GE9 A;  1Y5L B;  2AF6 A;  3DLL Q;  1LFP A;  1NRK A;  4WP9 A;  2RS8 A;  4NCA A;  3AY0 A;  1RTI B;  4XO0 A;  1HNZ F;  2I6W A;  3EZO A;  1VIO A;  3G82 A;  1HNI B;  5DLF A;  3GZ7 A;  4RU2 A;  1I3O B;  1EET B;  1U8S A;  1TZ0 A;  5HJX A;  1L3V A;  3MEE A;  1SB6 A;  4QQB A;  3KJQ B;  5KG3 A;  2FJX A;  2XGQ A;  3DHW C;  3M6V A;  4E8U A;  4XPE A;  3NY0 A;  4L74 A;  1HBU B;  4TYB A;  4A8K A;  3T5H A;  2C3M A;  3MCS A;  2R7X A;  2POK A;  2V4Q A;  1X9S A;  2CQI A;  4ID5 A;  1KOO A;  1EAR A;  1RTH A;  5SZT A;  4UQT A;  2UXD F;  2R7W A;  3PYD A;  2ZM6 F;  1FFW B;  2FPH X;  1BGX T;  3LP2 B;  2CZV C;  1CG2 A;  2DPI A;  4L75 A;  3IRW P;  5LL6 d;  4U6P A;  4OYI A;  2BVZ A;  3O1L A;  4NWB A;  3KLE B;  1MW7 A;  2OEK A;  1N32 F;  4OI6 A;  5K20 B;  2E9R X;  3ZTP A;  3CED A;  4PKD B;  3RBZ A;  3CDE A;  3CIZ A;  3HKW A;  5KG4 A;  4KAI A;  3R5J B;  3LUY A;  1FF2 A;  1Z2Z A;  2HG4 A;  2CNK B;  1PSD A;  1I6J A;  1Z1Z A;  1T3N A;  1J2V A;  1ITP A;  5FLX U;  4DCJ B;  2AU0 A;  1A0O B;  2LDI A;  1TP7 A;  2CJA A;  2NYH A;  4M5M A;  5A8W A;  4PPZ A;  1PC5 A;  2F9J A;  3OBI A;  1NPR A;  1S9G B;  1A9N B;  1N5Y B;  1U7L A;  3S8S A;  2MZT A;  3M8Y A;  3ZTR A;  4NI2 B;  2GW8 A;  2X1A A;  1GX5 A;  1VC5 A;  2HNY B;  3K5N A;  2Q6B A;  2MSS A;  4I6Y A;  4B02 A;  1PJ5 A;  4LRC A;  2RU9 A;  3OTE A;  1S9E B;  2QA4 S;  2CPJ A;  4KO0 B;  3GV7 B;  3H25 A;  1D09 B;  4GVB A;  3QLH B;  2IRU A;  4R8U A;  1UTA A;  3VR1 A;  4JV5 F;  2OD4 A;  1VCT A;  2V2K A;  1T9X A;  2QYG A;  2GO9 A;  2J8S A;  4DG1 B;  3BJY A;  3P5T L;  2OML A;  1SL2 A;  3H4D A;  4UOG A;  4KR0 B;  2JWN A;  2J8A A;  2JEF A;  3K2Y A;  2WB4 A;  4OI0 A;  1FE4 A;  1Q5Y A;  3U27 A;  4ZJQ A;  4HYK A;  5J2M A;  1X0P A;  5AE1 A;  3WZ0 A;  1WEZ A;  4CO1 A;  1K8A T;  3MM5 A;  2HFN A;  3L7P A;  2FQQ B;  1DTT B;  1H2V Z;  2NR0 A;  4N41 A;  4C8K A;  1CS4 B;  3KXD A;  3DRX A;  4J90 A;  1YJU A;  2Q6C A;  3IP0 A;  3LW5 C;  3KUH A;  3T1H J;  3NXZ A;  2CUY A;  4RNM A;  1Q1K A;  4M1K A;  2ABY A;  3PFE A;  3ENQ A;  1HBN A;  4NLS A;  4UUX A;  4KSE B;  2MZS A;  2C2R A;  4HAC A;  1WC0 A;  5L1K A;  1RTD A;  3LTO A;  2XS7 A;  4GMK A;  3UCZ P;  2BE2 B;  1N6Q A;  1HYS A;  1UJ4 A;  1VBX A;  3VVU A;  4RBV A;  2HHP A;  2V69 A;  4PQU A;  5F8N A;  1NSP A;  5CYM A;  3ILL A;  4A47 A;  1P27 B;  2IVM A;  4HKQ A;  3BGF A;  3CO9 A;  4RZR A;  3OHB A;  4TY9 A;  3CF5 Q;  1JMT A;  1WI6 A;  2B9E A;  2ZZT A;  1REG X;  4G1P A;  1U1N A;  2VG7 B;  1NB2 A;  3MMC B;  3CJ3 A;  4WK3 A;  1M1H A;  4C98 A;  2XEX A;  5HL7 Q;  4NXN J;  1RU2 A;  3CDB A;  5DG8 A;  3U7J A;  4N8O A;  4DJB A;  3R2C J;  1BMQ B;  1LW2 A;  5H9E K;  1NZA A;  4BCA A;  3C6T B;  2XYH B;  1M90 T;  4DUY F;  3MAA B;  2EC0 A;  1YHQ S;  4X66 J;  3I9V 9;  3DFE A;  5B0B A;  5KT4 A;  5HP1 A;  1NSA A;  1KHW A;  2DTJ A;  1WNE A;  2XWX A;  3BKT A;  3ET6 A;  2GIF A;  1REV B;  5KFV A;  4KRW A;  2E7W A;  1FT8 A;  3N9U C;  1S7I A;  2E1P A;  1EP4 B;  1BY9 A;  2CJ9 A;  3M7V A;  4EYH B;  5L1J A;  3L09 A;  3X3U A;  2XHW A;  3UD5 A;  2ZIT A;  2WOM B;  3SQG A;  1P6T A;  1CJV B;  1IBC B;  2R7S A;  4JYA J;  2HZV A;  3EGN A;  4NEZ A;  4DSI A;  2CDQ A;  2OSQ A;  2HHW A;  1S6O A;  1N0U A;  3THV A;  1WG4 A;  4N8N A;  1XTZ A;  5J2P A;  4I67 A;  3CUL A;  3KK2 A;  1SL1 A;  4NCG B;  1UFK A;  2APO A;  1JNR B;  2BE9 B;  4CO2 A;  3G8S A;  3P6Y C;  4USW A;  1B0T A;  4JI6 J;  4AL7 A;  3WX4 A;  2RIJ A;  3DKD A;  3TR5 A;  3ZO7 A;  2IMO A;  4OYX A;  4URS A;  5GAH U;  2FGO A;  3D3B J;  3GCX P;  5IM0 A;  5L39 A;  1R0C B;  4DS4 A;  1IR0 A;  2X3D A;  3M2U A;  1KDN A;  2PDA A;  2MKS A;  1OY9 A;  5D8H B;  5HAO A;  5LMN J;  5A8R B;  4EMD A;  1YJR A;  1PGZ A;  3RAM A;  2UUT A;  5ETT A;  5KFZ A;  4DPU A;  4F2S A;  4WFX A;  1UW4 A;  5L1L A;  3GSD A;  4RNN A;  1WC4 A;  2MGZ A;  1WOS A;  1UAW A;  4AYB D;  1TUG B;  2RRA A;  2Y3Y A;  2KDO A;  1R7I A;  1SQF A;  1AFJ A;  4A8O A;  3G86 A;  2CNN B;  4MJK A;  3DDN A;  1ZA1 B;  1MN7 A;  2JLE A;  4C3K A;  4RPF A;  1IBL J;  1S7H A;  4CCH A;  2K1R A;  1SUQ B;  4OI2 A;  3LPE A;  4IOC Q;  3M8S A;  3CCM S;  3JS9 A;  2KI2 A;  2XYP B;  1N4L A;  3LP0 B;  4UUW A;  5DQG A;  5JXS A;  1G2E A;  2E1A A;  1FEH A;  2XYG B;  1N48 A;  3CTR A;  1HLW A;  2V63 A;  3IGV A;  1FE0 A;  1KVK A;  3UO0 A;  2QZ8 A;  5IWA F;  3BKU A;  2MQ8 A;  1RWX B;  5H9E J;  3W60 A;  2HGM A;  5HQM A;  2DR8 A;  3MD3 A;  2FHM A;  4N7T A;  1CJK A;  3O6Q A;  2W9C A;  1RAO A;  1SPB P;  2HGN A;  2UUA J;  2J5A A;  3FC9 A;  1UVN A;  1H7X A;  2V4J B;  1M5H A;  4HI1 A;  4JI4 F;  4CLL A;  3Q86 A;  5DDO C;  1Y11 A;  4LF5 F;  3EYZ A;  1R3N A;  2ZOM A;  1V6H A;  2J0S D;  4DUZ F;  4P7T A;  4D3H A;  1X31 C;  1HIY A;  3MM6 B;  1IBM F;  1VQL S;  2ZKU A;  2R8K A;  3HX9 A;  4NLD A;  4USJ C;  4ECR A;  2YH0 A;  2W7A A;  3QWU A;  4CRJ A;  2E5H A;  2F5G A;  4I6A A;  2LU1 A;  1YRT A;  4PXC A;  1RA6 A;  2IAJ A;  5DQI A;  5A6W A;  3THP A;  2A18 A;  1YK9 A;  4M8L A;  4WTY A;  3KLH B;  4DR7 J;  1FKO B;  3HP6 A;  4LRA A;  4U95 A;  4UTG A;  1VQ9 S;  3OL8 A;  4IRD A;  5BR8 F;  1Q8K A;  1EKS A;  1Q8B A;  3GMG A;  3OHA A;  4G6V B;  3O8W A;  4ID8 A;  1TUV A;  2BX6 A;  5IV4 A;  1KP6 A;  2LDY A;  3UD4 P;  2F4F A;  1GMW D;  5ETM A;  1HBO A;  3G9C A;  4OFZ A;  1K1S A;  5MAO A;  2ZJQ Q;  3JTN A;  3IWL A;  3W66 A;  4CZC A;  1RTI A;  1RHK B;  3TAR A;  2QA4 G;  1KSP A;  4K4U A;  4ZLP A;  3PR4 A;  4JI1 J;  2OFG X;  3MXH P;  2NPI A;  3R5D A;  5LXY A;  1A7G E;  1ELO A;  4MIB A;  1C4A A;  2D1C A;  2RKI B;  1HBU A;  3D6F B;  4AND A;  5EGY A;  1BD6 A;  3A3N B;  5KG0 A;  1X4A A;  3OUY A;  3AOC A;  2ZOF A;  1JLA A;  1TMJ A;  1HNX F;  4CM0 A;  1U6B A;  2WVE A;  2AT1 B;  2ZD1 B;  3FCH A;  3VAM A;  4DLG A;  2YNG B;  3G6Y A;  2LYV A;  1XMQ J;  2KVI A;  1OPI A;  3ICL A;  3KLE A;  4DLE A;  1NUE A;  2YWK A;  2E9Z A;  1X9W A;  3BO2 A;  1JJH A;  2ALY B;  2D41 A;  1TVR B;  4AXJ A;  3DOM A;  4ZN3 A;  1J5O B;  4YB7 A;  3SMZ A;  4C48 A;  3KOA A;  2W4C A;  2BEF A;  3C15 B;  1SJ3 P;  1S9G A;  1N5Y A;  2CPD A;  2FB0 A;  4NI2 A;  2MLZ A;  1SIZ A;  3HK2 A;  1NKE A;  3NL0 A;  2XHC A;  3MM9 B;  2R7O A;  3E3X A;  3LGN A;  2HNY A;  1NZ8 A;  5HBM A;  1S48 A;  2BKP A;  2H9Z A;  4DV5 J;  3PW7 A;  1D1U A;  1RT5 B;  4WJB A;  1XNQ J;  5A0Y B;  4NLV A;  2KXN B;  4B08 A;  2BRK A;  1O0P A;  1JLE A;  1QVF R;  4RW6 B;  2VBZ A;  4ZJO A;  1D8Z A;  4EO8 A;  2COL A;  4J9Q A;  1QAY A;  1LQ9 A;  3G8T A;  4KO0 A;  3JTP A;  5B0D A;  4TU9 A;  4FF3 A;  1S97 A;  1TUW A;  3QLH A;  2PC6 A;  2FVC A;  2EG1 A;  5IS2 A;  4RO0 A;  3BN7 A;  1F3F A;  3B8H A;  1X4H A;  4PXB A;  4JBC A;  4JI0 F;  4OYP A;  2KO1 A;  2BJ3 A;  2G13 A;  2UXC F;  4ZPB A;  4DSF A;  2FC9 A;  5GAG U;  2GHW A;  5E7O B;  3K58 A;  4DG1 A;  3P49 B;  1EB0 A;  1FKP A;  2HPU A;  2MKY A;  2ASY A;  4A8Q A;  3PXG a;  3VCD A;  3BF4 A;  1U2F A;  4Q8E A;  3KFW X;  4JP8 A;  4M5K A;  4ZVG A;  1R6Y A;  4X4S A;  4FPI A;  1M5V C;  1N8R T;  4DV0 F;  3J81 Y;  4TU8 A;  2DHH A;  2XZD B;  4HLB A;  1WSR A;  1DTT A;  2F7V A;  2CPE A;  1CUL A;  1VGY A;  1H3D A;  3IC1 A;  2ALZ A;  1HA1 A;  4OYW A;  1VC0 A;  1N36 J;  1JXE A;  3DCA A;  3PFO A;  2IRX A;  5KT5 A;  5HQL A;  2CPH A;  5KG2 A;  1ZZN A;  2XUL A;  2V50 A;  1H74 A;  1X7V A;  5HMX A;  1HWI A;  4IH5 A;  2BM1 A;  4ZLN A;  5KT3 A;  1SC1 B;  2FLO A;  4FF1 A;  2VG6 B;  3KG0 A;  1O8B A;  4ER8 A;  1VIX A;  2JEG A;  2BE2 A;  5EDW A;  1LWE A;  1DHM A;  2HAF A;  4PQA A;  2QT7 A;  4ZA1 A;  4CNZ A;  2C2N A;  2WSE C;  1LWX A;  2XMW A;  3Q22 A;  3D67 A;  3MOZ A;  3KLG B;  3BZQ A;  2ZDP A;  4Y2K A;  3K57 A;  2VQF J;  1UJ5 A;  1U26 A;  1M1K T;  4PPD A;  4B9T A;  4KGZ B;  5E3R A;  1L3K A;  1DFD A;  3HSG A;  2QFI A;  3TX8 A;  4QZV B;  1XNR J;  4WZQ A;  3T1Y F;  1SCJ B;  2PMH A;  2F9D A;  4GRS A;  5DM7 Q;  5KFB A;  3CE8 A;  2BZ2 A;  2E1C A;  1VQ8 S;  2YPZ A;  1C4C A;  1SC4 B;  1KHV A;  3QSY B;  2ZBQ A;  2EFN A;  4LVO P;  2BOA A;  1MRO B;  2YWE A;  1U1R A;  4DUT A;  1FD8 A;  2BKO A;  2CQP A;  5IT0 A;  2VBX A;  4Y3C A;  2XLI A;  3NOC A;  3FEY B;  1VS3 A;  3CMQ A;  1REV A;  4CLU A;  5KFD A;  2HK3 A;  5L9X A;  1PJ7 A;  1FJ7 A;  3D5M A;  1CPZ A;  1X4F A;  2B9W A;  3A8J A;  1EP4 A;  2FC8 A;  3R97 A;  4K4V A;  1XMB A;  1SV5 B;  2FYX A;  3I0S B;  2D69 A;  1XR6 A;  3H5U A;  3QZ8 A;  3V4M A;  4W4M A;  2XI2 A;  2HBY B;  5KFH A;  1LXJ A;  2DNM A;  1ARO P;  3EJM A;  5KFX A;  4DL7 A;  3CCS S;  2ZHB A;  2EFQ A;  2YKM A;  4NCG A;  3NGS A;  4IOB A;  1ZAW A;  3K8V A;  3GG1 A;  5T7L A;  2WCX A;  3OL7 A;  3QNW B;  3SCL E;  2GMH A;  3QFH A;  1WEY A;  2FLP A;  1U2C A;  2HVD A;  1YTY A;  2E5I A;  1VLY A;  2QL7 B;  4FYW B;  5FDL B;  4NX9 A;  4ECU A;  2CJY B;  1S76 D;  3QMQ A;  5DG9 A;  4PXD A;  4H4O A;  4ITS A;  1YVF A;  1M5P C;  5T14 A;  4M5N A;  3QRP A;  2M9K A;  3BPS P;  1KQK A;  3CJT A;  2OGU A;  3KMQ A;  3BSC A;  4UY8 T;  2J76 E;  4OYB A;  3HM9 A;  4AE5 A;  3ITH B;  3I55 S;  3HHK A;  4L3K A;  2PN6 A;  1FKA F;  2HWH A;  4B3S J;  1LV5 A;  4DBQ A;  4C3M A;  2NYI A;  1WHW A;  3QGP A;  4OZJ A;  3BH7 B;  3LGH A;  2AJ1 A;  4F4X A;  3PX4 A;  2V9K A;  2XLJ A;  4O23 A;  4EZ9 A;  1YX2 A;  7FD1 A;  5GVQ A;  1APS A;  3IM8 A;  3QQC D;  2XMT A;  4HHJ A;  4NLU A;  5F9L A;  1XMO J;  1X60 A;  2MQP A;  4RW7 B;  2HLU A;  5D4P A;  2ZJR Q;  1ZM3 A;  5F3Z A;  1WHV A;  3KMS A;  1CBK A;  5HAN A;  3MOJ B;  1SUQ A;  4FNI A;  3OVA A;  2A0F B;  3G6X A;  7AT1 B;  3H2U B;  3N79 A;  4YFU A;  4LF9 F;  4X64 F;  1ZAX A;  3EVM A;  1HWK A;  4I7F A;  2WW4 A;  3BR9 A;  2RD5 C;  1C1B B;  3CCE S;  3HVT B;  4X4T A;  4JI2 J;  1NK6 A;  1GH8 A;  3RR8 A;  4FF4 A;  4DR2 F;  5IZH A;  1WTB A;  4IFV B;  2G9O A;  2HS4 A;  2VKR A;  3BQ2 A;  2JHE A;  2YWG A;  4E2F B;  1YRX A;  4PXE A;  1RT2 B;  2R3V A;  4EYI B;  4ED5 A;  2EEY A;  3NGR A;  2Z2Z A;  1U1O A;  3QAU A;  3NGT A;  1F9H A;  4RW9 B;  2CQH A;  5ADZ A;  3U02 A;  2W7P A;  1H2U X;  1W2I A;  2KTQ A;  4USU A;  2QFJ A;  3GV8 B;  2UV8 G;  2KH9 A;  4Z2X A;  5HO4 A;  4EEY A;  4LUB A;  1HNV A;  4X65 F;  3OFF A;  3FGV A;  1SVD A;  3KLH A;  1FKO A;  3HLU A;  1TL3 B;  2MQM A;  3OR1 B;  3GJR B;  2OTL S;  2YH1 A;  5RUB A;  3M2V B;  2DHX A;  3VGT A;  4MKY A;  1HHT P;  3NEK A;  4B17 A;  4NXM F;  2KHC A;  1S1X B;  3TZX A;  2R8I A;  4DL0 C;  4OMF G;  4LFC F;  2IPO B;  3KHR A;  1UWB B;  1IUJ A;  5ETO A;  3Q89 A;  2QRR A;  4TLQ A;  1S1T A;  4NAS A;  1VQ4 S;  2GJI A;  3E01 A;  3QGG A;  2ZUA A;  4HT7 A;  2F3J A;  1WF0 A;  2NSC A;  4TNO A;  3R27 A;  3RBX A;  3FFI B;  3ADA C;  1Y7P A;  3DM2 B;  1UW9 A;  4RJV A;  3TA1 A;  2GV1 A;  3DLG B;  2DGX A;  1O6X A;  4F8R A;  1R8P A;  1EHW A;  4MK7 A;  4P2S A;  3CCL S;  3OTO F;  1K1Q A;  4ZVF A;  4P75 A;  2VF3 A;  1X5S A;  2D3Z A;  4B9U A;  4CI0 B;  3FBB A;  1XR5 A;  3AXM A;  1OMS A;  3SFG A;  2GQC A;  4IUF A;  1U0H A;  3VVT A;  1HWL A;  2LFV A;  2KU7 A;  3SEO A;  1FXD A;  5GME A;  3V81 B;  1IKX A;  2I38 A;  3LWM A;  1LWC B;  2EBG A;  4NLX A;  1U09 A;  2GGP B;  2RIL A;  4IFY B;  4YN3 B;  2VPX B;  1S4F A;  3LGM A;  1VBZ A;  2B51 A;  4USV A;  1TVR A;  1BWE A;  2VPY B;  3DGV A;  1Y0H A;  1OWX A;  4KH0 B;  2LA6 A;  4JI8 J;  2MTL A;  3AT1 B;  5D4O A;  2F65 A;  4GVL A;  1X4B A;  4LRD A;  4JV1 A;  1MU2 B;  1RHR B;  3SIP B;  3LO3 A;  3HHN B;  4WXW A;  3C15 A;  1NDL A;  5C7P A;  3SBM A;  2YXL A;  1U0S A;  1M5S A;  2QC3 A;  4DDF A;  2BW7 A;  1WUU A;  1N34 J;  3MM9 A;  2G2Y A;  4OLO A;  5LM7 E;  1CJT B;  2HLT A;  3R7B B;  1UCN A;  1RT5 A;  3R5G A;  1F5C A;  5A0Y A;  5JMN A;  1DUR A;  4UQG A;  2FGC A;  2VQE J;  3MFH A;  2UVR A;  3C66 A;  4DV7 J;  4RW6 A;  5CD4 A;  2ASL A;  4LRE A;  3ENW A;  2BBE A;  2XMA A;  5C5J A;  3WHI A;  4HR2 A;  2C3U A;  2UXB J;  1V3R A;  1P1L A;  2C2E A;  3RU0 A;  2DT9 A;  1RAE B;  2DR9 A;  1LNQ A;  4JB8 B;  3UN2 A;  4JI5 J;  4RUH A;  2I0X A;  4ZS6 A;  5I3U B;  4B3O B;  2K2P A;  4HI2 A;  4IO1 A;  4DR4 J;  3DN9 A;  3MEG B;  4OZ0 A;  3HHL A;  2HQF A;  4WIQ A;  3RB3 A;  2KFY A;  5ETR A;  3GSI A;  2E1M C;  1PAU B;  4RW4 B;  3D0I E;  5CAA A;  4K4Y A;  1D9D A;  4CH1 A;  5KG6 A;  3T9Z A;  1HMV B;  1NEE A;  3PW4 A;  4C3L A;  2W1B A;  4PEO A;  4DR3 J;  3CCZ A;  1IKY A;  1UP1 A;  1W26 A;  2MJN A;  4YY3 F;  1F3V A;  5F0U A;  3ZTS A;  3A4T A;  2HIQ A;  4HTI A;  3EVW A;  1Y5N B;  3W63 A;  5HJY A;  4WZM A;  1RT6 B;  1GAO A;  2FHK A;  2RRN A;  1SH0 A;  3C2P A;  3H42 A;  2H51 B;  1S6Q B;  4CTA B;  2HHT A;  3TYT A;  1AXQ A;  2D9O A;  4O0I A;  1T03 B;  3ILO A;  4I4B A;  2VG6 A;  3DRR B;  1FRK A;  3TUJ C;  3HFV A;  3HHL D;  3MUV P;  4HEA 9;  3PM9 A;  2FD2 A;  1TKZ B;  1QSL A;  3ZZT A;  3GB0 A;  4LF7 F;  1E6V A;  3S1T A;  2I5J B;  3MMB B;  5AJ3 J;  3NGK A;  3KLG A;  1S0O A;  3OVB A;  2RS2 A;  5IV3 A;  1XJW B;  1FVQ A;  4QWE A;  1QD1 A;  5KFW A;  3GFZ A;  3N28 A;  3KDO A;  4DCP B;  2LQB A;  3AB2 B;  3I32 A;  4UOC A;  2OFH X;  3ZZZ A;  4PRF A;  4NA3 A;  2FY1 A;  2AEM A;  2V34 A;  3MED B;  2VC0 A;  2XSJ A;  8AT1 B;  2V9W A;  1IN0 A;  3IAS 9;  1IJE B;  3VAJ A;  1U4B A;  2EW9 A;  2DR6 A;  3R7S B;  1TFY A;  2VDI A;  1D9F A;  5HRO B;  1OSC A;  3T5K A;  1WD6 A;  1VQ6 S;  2OAU A;  4B9S A;  5DDR C;  4DR5 J;  3VAH A;  4LQ3 A;  4KC5 A;  2VFT A;  2WVC A;  1OIA A;  3BN4 A;  5FJ4 A;  3DLB A;  3W9J A;  3QGH A;  2ZC3 A;  5K14 A;  4ICL B;  1SV5 A;  4WBF A;  1NO8 A;  1T7P A;  1NHK L;  2ROP A;  4WWS A;  2GX8 A;  2MPU A;  3DLK B;  4KV8 B;  1ZM9 A;  2DGS A;  2OSR A;  3NMR A;  1NPK A;  5K8P A;  2W24 A;  3CCQ S;  1R6V A;  5KFT A;  8RUC A;  3DI6 B;  2KFN A;  4KJI A;  2ACY A;  2XM3 A;  3M8W A;  4IG3 B;  1TL5 A;  3I31 A;  4U8Y A;  2K3I A;  1F9E B;  1D0E A;  4LR9 A;  4KGX B;  3GYX B;  1TU0 B;  2KT2 A;  1N88 A;  1C0U B;  3NNC A;  4ZIW A;  1DQ8 A;  3RYL A;  2BXJ A;  5FDL A;  2ZH7 A;  3CJ0 A;  5B0G A;  2DGW A;  3IXQ A;  5CXT A;  2W01 A;  2CJX B;  3EIC A;  4IDK B;  4Q8F A;  2DHA A;  4AQY F;  1LK7 A;  1PKU A;  1MNE A;  1F2G A;  3ISN D;  3GR1 A;  3WIU A;  4CLT A;  2VUG A;  4FBU A;  3TP2 A;  1DQ9 A;  1FRX A;  1IBK J;  1ZPV A;  3DDI A;  1HR0 F;  4CLS A;  1J5E F;  2DRB A;  2YKQ A;  5HVG A;  3H8Y A;  1NSQ A;  3KKF A;  3MR6 A;  4IH7 A;  2HMI A;  4XDC A;  2VFR A;  2N82 B;  3EGZ A;  5MLC V;  2LA4 A;  2NQP A;  3TA0 A;  4DSJ A;  3QJP A;  3PW2 A;  3I0R B;  1F6T A;  2AJF E;  4YB5 A;  1WJ9 A;  4N5S A;  3HVT A;  2LQJ A;  1EQ0 A;  3BB5 A;  3IWX A;  3BO4 A;  2L41 A;  2AD9 A;  5KFG A;  2J7U A;  3M8Q A;  4TXS A;  4IFV A;  2HZC A;  1BHN A;  3KLI B;  5KFS A;  2LQ9 A;  1T9Y A;  3FNN A;  1S1V B;  2ZH1 A;  1U8W A;  2H3E B;  3H5Y A;  3AOA A;  3H5S A;  1SI9 A;  5H9F K;  3GJT B;  2AZ3 A;  1NU4 A;  5GMD A;  1U1L A;  2UUB F;  4KTQ A;  2QIF A;  4K4T A;  4C7Q A;  4MK8 A;  2ZH4 A;  4FKY A;  2HQD A;  4W90 B;  5LMU J;  3DNC A;  2MYF A;  4OX9 F;  1RHQ B;  3CD7 A;  3HPO A;  2RDI A;  3I9Z A;  3ZNU A;  5CZV A;  4DPX A;  4ZLL A;  4ILL A;  4DR1 J;  5KFM A;  4QW9 A;  4KHR A;  3W5X A;  1B4S A;  4K4W A;  2OEM A;  5U47 A;  3ZZP A;  2DEJ A;  1TL3 A;  2YWH A;  1RWK B;  2PT0 A;  4CYU B;  5F9N A;  1RDR A;  3OR1 A;  1XC9 A;  2ERR A;  1ZET A;  2ZJP Q;  2B7B B;  4F0K A;  1M0S A;  4JV2 A;  1IR1 A;  3BBB A;  3LAM A;  2O67 A;  2CZ4 A;  3A8I A;  2HSE B;  3OXF A;  3K5L A;  1U25 A;  2ZH2 A;  1S10 A;  1UWB A;  1N5S A;  2AYB A;  2N4C A;  1RQ0 A;  5J2N B;  4ZPT R;  1EJ7 L;  1K44 A;  2AW0 A;  1WOO A;  3UQS A;  4ATN A;  2DXE A;  1JIH A;  3CJ4 A;  4RNH A;  3MR3 A;  4Q44 A;  4B3T J;  1S1W B;  3FFI A;  3DM2 A;  3GPA A;  2GVZ B;  1R43 A;  2VJU A;  3HKZ D;  1DAX A;  2UU9 F;  1GXL A;  1B3T A;  3AD7 C;  2YX7 A;  1QTM A;  3TW0 A;  2NXJ A;  1FNO A;  1JK9 B;  1H2T Z;  1UZH A;  5CD4 H;  5KFL A;  1FHT A;  2GVD B;  5E3C A;  1NK9 A;  2DGV A;  2AJ0 A;  3IRX B;  5D0R A;  2DY1 A;  4DR6 J;  1KLM B;  4ZVP B;  2WBM A;  1HNW J;  1X0F A;  3L9Z A;  2FHJ A;  2OUG A;  3M9O B;  3GG0 A;  4R25 A;  1SJF A;  2QJ3 A;  4A8Y A;  2FVS A;  1BC6 A;  1U49 A;  2H1Y A;  1NBE B;  4QWB A;  5KTQ A;  3Q0A A;  1H72 C;  1NHU A;  5HAT A;  3M4X A;  1RT4 A;  3OFE A;  2AV5 A;  2VOD A;  5E3Q A;  4PG5 A;  1LWC A;  1RE1 B;  3GP9 A;  2PD1 A;  2D3O R;  2YVS A;  3HI9 A;  2P9E A;  4NYZ A;  3U1N A;  3EWG A;  3TA2 A;  2FVR A;  4LIR A;  2RHQ B;  1N5V A;  5J2Q B;  4RKU C;  1UZD A;  3UN5 A;  1TL4 A;  2BA9 A;  1R89 A;  3ZZO A;  2B56 A;  1HI0 P;  2DGQ A;  2Z8Q A;  3OTD A;  1H6K X;  4GKJ J;  4QU7 A;  3F56 A;  1YBA A;  1AZS B;  1TK0 A;  5H9F J;  2U2F A;  2ATL A;  4ED6 A;  4IRC A;  2F4V J;  4YOE A;  2W2P P;  1CJT A;  4HH1 A;  1VYA A;  1T8E A;  2PO4 A;  3QAT A;  4ZCI A;  5LSO A;  2KZZ A;  5ETP A;  5KG5 A;  2M5Y A;  4Y2C A;  1KRP A;  2HQC A;  3PTW A;  3EXY A;  4B9M A;  4LF4 J;  1URN A;  4A4J A;  4NLT A;  1MWQ A;  4IR9 A;  3NS7 B;  2QE5 A;  2KG0 A;  2IIH A;  1RYR A;  1HPZ B;  4CO5 A;  4QYR A;  3CIM A;  2ROG A;  3Q8Y A;  5I3U A;  4PR6 A;  4NE9 C;  4B3O A;  5B0C A;  5KFP A;  4ZVS B;  4WFB Q;  3MEG A;  4OJ3 A;  1E6Y B;  4EBE A;  4O3Q A;  4KGV B;  2HND B;  3M8Z A;  2DNP A;  2R2U A;  1ZBT A;  1HD1 A;  2ZHA A;  3DOL A;  2HFU A;  3T1H F;  4RWW A;  4Z37 A;  1HMV A;  4OHZ A;  1GT8 A;  1CEZ A;  3W5Z A;  2PMW A;  4QR0 A;  5L8R C;  3MI7 X;  1HQU B;  2MY8 A;  4NL5 A;  4H4M B;  1R8B A;  2M70 A;  1MG7 A;  4I2P B;  1F9F A;  3OTB A;  4LQ9 A;  2W9B B;  1L3U A;  2CYY A;  4J37 A;  1WDT A;  3CJR A;  5AXM A;  1TL1 B;  4YEA A;  3FSY A;  4ZP8 A;  1S6Q A;  1JLB B;  4CTA A;  4UF4 A;  2HKE A;  3M2R B;  3AA8 A;  1RHU B;  4F04 B;  1GTE A;  2QG9 B;  4C11 B;  1T03 A;  4QWD A;  3T5L A;  4URG A;  3CDA A;  2YY3 A;  2RU3 A;  4WU3 A;  2CIM A;  1R8A A;  2DCU B;  2P9G A;  1V9O A;  1X5P A;  2P2C B;  5J1N A;  2I5J A;  3MMB A;  4DZD A;  5KT7 A;  1PBA A;  1S79 A;  3D3C J;  4NXN F;  4F02 A;  1BE4 A;  1KEK A;  1QAI A;  3HVA A;  2CQG A;  4PG4 A;  5THW A;  4RBT A;  4ZPC A;  1RA7 A;  4MYU A;  4Q0B A;  3JB9 k;  4P2X A;  1FRI A;  1R27 B;  1RT3 B;  4X66 F;  5AT1 B;  2X1B A;  3H5X A;  3PJ9 A;  2P5V A;  4Q2M A;  3UPF A;  4A8M P;  3JYT B;  2OEL A;  1FDB A;  4JI7 J;  3UNG C;  4BWM A;  2BR0 A;  3NCP A;  4DHV A;  1GTH A;  2Z2M A;  3KK3 B;  2LMI A;  4LSL B;  1VQS A;  1UPP A;  3UR3 C;  4OJ1 A;  2RUS A;  2AHO B;  3V6H A;  5GAE I;  5HRO A;  1S0V A;  3A12 A;  3NBP B;  4EFA C;  3D0H E;  2V5H G;  2HHH J;  4KT0 C;  3M30 B;  2CQ4 A;  1R0A A;  2LKZ A;  3GCW P;  4JYA F;  1FX2 A;  4WP3 A;  3W2W B;  3RAX A;  3MPU B;  3M05 A;  1ACM B;  2V2Z A;  1Y10 A;  1Q4R A;  1EKR A;  4ICL A;  3J81 j;  4ECT A;  3I82 A;  5E0O A;  2DNH A;  1PIE A;  3OLB A;  2KM8 B;  3HVR A;  2VDH A;  4DPO A;  5HLF B;  2E7V A;  2KZM A;  5HK4 A;  2DPJ A;  1ULR A;  4R0E A;  3NRB A;  2HNZ B;  3MPD A;  1TL7 B;  2FHO B;  4C4W A;  1ZM4 A;  1SKU B;  1OQ3 A;  1UFL A;  3OTC A;  2IHR 1;  3BGR B;  1CQM A;  2VKZ G;  2J6T A;  5EWE A;  1RAB B;  2IC3 B;  5FLX Y;  3MM7 B;  3ETM A;  5AXN A;  4O3O A;  4QPX A;  1OQ6 A;  3IR5 B;  1WG1 A;  5LMN F;  2MQQ A;  2LU2 A;  1C0U A;  5E33 A;  2H5E A;  1W2B R;  2GMJ A;  3PZP A;  4V19 X;  1BQM B;  2CQ0 A;  2NUH A;  2B9Y A;  1WTF A;  5T41 A;  5ETK A;  1IR2 A;  2D3U A;  4QIW D;  4NPO A;  5A2Q U;  4IDK A;  1JX4 A;  4AFF A;  2YQ1 A;  2ZBC A;  3LF0 A;  3MM8 B;  2OPP A;  3W9I A;  1IKV B;  3R5B A;  1NJW A;  3M8P B;  3TAM A;  1AUS L;  2KJW A;  2R8H A;  3CCU S;  3V6D B;  3P5B P;  5M2U A;  2JC0 A;  4NZ0 A;  2GQ2 A;  4O4G B;  3CT9 A;  1FVS A;  3HT3 A;  3HD1 A;  3MHY A;  1IBL F;  1RBA A;  2AGP A;  3R7N B;  1CVJ A;  2Z0G A;  4QCL A;  2HBZ B;  2YTC A;  1RXO B;  3HHE A;  3H90 A;  4K2J A;  1FTC A;  4BBY A;  4WFA Q;  2N3O A;  1QTN B;  5KFY A;  1RCO B;  2R7U A;  2M0G B;  4HH0 A;  4M5I A;  4X62 J;  2ZKT A;  1FWP A;  4CLK A;  2WVB A;  3I0R A;  3OD2 A;  1V3S A;  4GC6 A;  2UUA F;  3LP1 A;  2HUR A;  4DV6 J;  3DMJ B;  1S6P B;  4FYD A;  2MKI A;  1RKJ A;  5KFO A;  4X4V A;  2VHG A;  4YB6 A;  5CYQ B;  1FRM A;  3FMW A;  4XK8 C;  4FF2 A;  3RAQ A;  3KLI A;  3GJS B;  4WP8 A;  5LJ5 Y;  2B9X A;  2XS5 A;  1S1V A;  2DJW A;  3M6X A;  5L1I A;  1RWO B;  2YKO A;  1VI7 A;  2ZNZ A;  4ELT A;  1SJR A;  4F4W A;  1P9Y A;  3QYY A;  2HW3 A;  3OR2 B;  4AL5 A;  3A3O B;  4NZ6 A;  5G0R B;  4DR7 F;  1M5K C;  1K9M T;  3L3C A;  4X4N A;  1NJX A;  1VBY A;  2DVI A;  4P72 A;  2K06 A;  2B4P A;  1GEH A;  3W7B A;  3G4S S;  1KLN A;  2YNI B;  2H5J B;  5EUH A;  2MMY A;  3C6U B;  3CJK B;  2BAN B;  4UOH A;  3J7Z 5;  1SIW B;  3AD9 C;  5IQQ A;  4CYU A;  2OIH A;  2XC9 A;  1T3O A;  1T9V A;  2AX0 A;  2AX1 A;  4OZ5 A;  5A8K B;  3CCV S;  3TRG A;  2XMU A;  1VRQ C;  3UNY A;  3MMA B;  2GML A;  2FTR A;  3MCN A;  3PHE A;  1SKR A;  4NA2 A;  1Q81 T;  5LSR A;  4CDI A;  4WCE Q;  2VON A;  3IS9 B;  1Q5V A;  1G3O A;  3OL9 A;  4RUA A;  3FBF A;  3O44 A;  4JI1 F;  3KG4 A;  4MAK A;  3GJQ B;  3QWP A;  4IRK A;  1QAJ A;  3F41 A;  2DNR A;  3LAN A;  2YX4 A;  2F1F A;  4FXW A;  3WDO A;  5FII A;  5LT5 A;  2XB2 D;  2GVZ A;  2IA0 A;  5F3T A;  1QAX A;  3CB4 A;  1O5J A;  4LSN A;  2KKH A;  1I94 J;  4DQS A;  3BBF A;  3C16 A;  5KFQ A;  1KTV A;  1X4E A;  2GVD A;  4C8L A;  1PJ6 A;  2G4B A;  4ZMM A;  5I4M A;  3BBC A;  1HI8 A;  4YS2 A;  1T0T V;  3EDQ B;  1RTZ A;  2BJE A;  4F50 A;  2DEI A;  1AW0 A;  2V2V A;  2GQQ A;  3KNG A;  2V8V A;  2R8J A;  1XMQ F;  6FDR A;  4G1Q B;  1ZTT A;  1RUS A;  1RKI A;  2IA6 A;  4TQS A;  4DS5 A;  2DH9 A;  3D0G E;  1VFJ A;  3PR5 B;  2L9D A;  1JLC A;  1JJC B;  4J9S A;  4DSE A;  2A2D A;  3IG1 A;  1NK7 A;  3QT8 A;  1SQG A;  2VU5 A;  3GWC A;  2DGU A;  3DRP B;  5BYQ A;  2GIR A;  3JAM U;  2VG5 A;  3AQO A;  2MKK A;  4P74 A;  4CH0 S;  2WK4 A;  2ZH9 A;  5KFA A;  3VQS A;  3C19 A;  3FKB A;  4DSL A;  1TKT B;  3AAW B;  3DRS B;  1FJG J;  2FDN A;  3H4B A;  2HYI B;  4MK9 A;  3K0J A;  3R6L B;  3SSS A;  3C14 B;  4DZ6 A;  4DV5 F;  1VR6 A;  4OJH A;  1XNQ F;  2VL1 A;  3M1V B;  1HKA A;  4P2M A;  5D4L A;  1S72 S;  3D4J A;  4CO4 A;  1DLO B;  4UOF A;  1DAR A;  1VJW A;  1QVG R;  2OEJ A;  3FBE A;  2GHV C;  2YPY A;  1Q79 A;  3QAE A;  2J0Q D;  1NK0 A;  2DNQ A;  1RP5 A;  3PY8 A;  2JVO A;  4GC7 A;  1YJ9 S;  2IJR A;  3BKF A;  2BJD A;  2LXF A;  1MWY A;  3CXC R;  2ZEJ A;  3M9M B;  2DD8 S; 
#chains in the Genus database with same CATH homology
 2EC2 A;  2VHG A;  2VIH A;  2FYX A;  2XO6 A;  2F5G A;  2F4F A;  2VIC A;  4ER8 A;  2VJV A;  2XQC A;  2XMA A;  2A6M A;  2VJU A;  2A6O A;  2XM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...