2XQCA

Deinococcus radiodurans isdra2 transposase complexed with left end recognition and cleavage site and zn
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKYIESQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein/dna
molecule keywords TRANSPOSASE
total genus 32
structure length 129
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2xqcA00
2XM3A 2A6MA 2XQCA 2F4FA 2VICA 4ER8A 2VHGA 2VJUA 2XO6A 2VIHA 2VJVA 2F5GA 2XMAA 2EC2A 2FYXA 2A6OA
chains in the Genus database with same CATH superfamily
1Q8LA 4OI3A 4RNNA 2RHQB 1S6PB 1ZM2A 2J9CA 3BJYA 3D5MA 3MDFA 2F4VJ 3GIIA 4ZVOB 1FF2A 4KHRA 1M1KT 4LF8F 3I9ZA 5CZVA 3OW2R 4WKRA 1LOUA 2LECA 3TVYA 3OSNA 1RKIA 2FZCB 2KKHA 5F3TA 2CJYB 4ZPBA 4RO0A 1TKXA 2FJBB 1HD1A 1EB0A 1WWHA 2BKNA 2J8SA 4L3KA 2QRRA 4DV0J 3LWLA 4RNOA 3OL9A 2GHWA 2HBRB 1C0UB 1RWVB 3K17A 5CYJA 1I94F 4OQJA 2YH1A 1WACA 4GVLA 4IG3B 5F3ZA 1I6JA 1M5KC 4URGA 1KP6A 3AT1B 1VQPS 1ZETA 1N88A 2FY8A 1H7XA 2R7QA 4CLFA 4TKTA 4FBUA 2V9KA 1LFWA 2HVZA 3CJ2A 2RS8A 2FZKB 3B4DA 2BE2B 1NBEB 3C6UA 3Q22A 3CTRA 5LM7E 2HNDA 4UOCA 2HHSA 4XDCA 4B3SJ 4D3HA 1U49A 2J6UA 4ZIVA 1FDAA 1FO1A 2D1CA 2RF2A 2EG1A 3WIUA 2FQQB 1RE1B 2GMJA 2V50A 1HHSA 3JXOA 3HLUA 4PQAA 5E2QA 2BQRA 1WC6A 2YWEA 3N01A 5C42B 4OX7A 4MIWA 3FSIA 1VQ5S 1S59A 3KUGA 4J9KA 2QL7B 4IQMA 3KKFA 1KEKA 2XLKA 4QYZK 3LGNA 5KFQA 3UDVA 1OQ3A 2HMIB 5H9EK 2AX1A 1FRHA 1D8YA 4CNZA 1B0PA 5IV3A 3F44A 1ZH5A 4CM2A 4JI1F 3KXDA 1KQKA 5L9XA 1SQEA 5KT6A 5AJ3J 4DSIA 2PO4A 5K8MA 2HVDA 1HFEL 2WVEA 4WXWA 4X4QA 2G13A 4A8QA 1UVLA 5IT9Y 4NI2A 3RU0A 5J2QB 1NU4A 3Q8UA 4TY8A 4UTGA 3S01A 1Q78A 2OELA 3CJ4A 2HZVA 3DLKB 3HJVA 3SDEB 1ZTWA 1L5UA 4JYAF 1HNWF 3O44A 2IAJA 1QSLA 3M32B 2NUHA 2CQHA 1P8GA 2CPJA 1FKOA 3W63A 3QIPB 3QT7A 2GNKA 2JZ5A 2QYCA 1T05B 4UUWA 3EJMA 3FFIA 4I56A 2ZH9A 5B0EA 1PC4A 3CVKA 3D0HE 2RU3A 4DR1F 4F2SA 4GKJF 4JI0F 3TANA 2E5LJ 3U1NA 3MM5A 5A6PA 5F8HA 3E8OA 3EUNA 4QWCA 1UA0A 1VBYA 5IC4B 3OR2A 2R9LA 1G7CB 1RBLA 3FEZA 5CA5A 2R7WA 4NZ6A 5IQQA 3KLGA 4DV2J 2UVRA 3R2DJ 4K4VA 4C98A 5C25A 2RQKA 4MKYA 3HCXA 2H65B 1NKBA 1WHVA 1FK9B 5FLXY 3CC4S 1H0HB 4I1TA 4NLSA 4EK2A 2GC8A 1FJGJ 4EEYA 1HPZA 2ZE2A 4LFBF 2RSQA 4WFXA 4DL6A 4G3IA 3TA2A 3VVUA 3Q24A 3TI0A 3UVJA 1QVFR 3G82A 3V4IA 1QY7A 3D7SB 3AY0A 3US5A 4NYZA 3GG0A 4KT0C 4NLRA 2VG6A 4CTAA 1NSQA 2C28A 4KGMA 5AXKA 1FXLA 5B0CA 2BJ1A 5DDPC 3R6GB 4I6AA 4OX9J 3D6FB 2FZGB 5LJ3Y 2DNYA 1REVB 5CQGA 3MPUB 4OI2A 2QMUB 4ED3A 1L3TA 3EGNA 1FERA 2NLWA 3IAS9 1RSCA 3HVTB 4ED8A 4WBFA 2QLJB 4DPXA 3CF5Q 5HQ8A 1HNXJ 2XTJP 2YWHA 2ACYA 3EGVA 3MWBA 2J76E 3ULHA 4JI8J 2HHHJ 4J9LA 5HSPA 5D78A 1ZPVA 1NJWA 2KRBA 2KXFA 3MM6B 4QIGA 2D7SA 2ZZTA 5DQIA 2XCAA 4O3QA 2VQFJ 3PHTA 2E5HA 3H2VE 3MCNA 4ZA1A 2BVZA 3C66A 5GAEU 1SI9A 1N5VA 2XWYA 3OR1A 1UWBB 4AYBD 5C2CA 4GKJJ 1G3OA 2K7JA 1OWXA 1EETA 1HIYA 1RWUA 4R8UB 3HHLB 4X4PA 3QSYB 5ETMA 1QAIA 4DUYJ 2HZCA 1IXKA 1E6VB 1SC1B 2AKWB 4JUZA 1U6FA 3W64A 4ZN1A 4YR2A 2RUGA 2HNDB 2Z30B 4XAKA 1XMQF 3KG1A 4ZJLA 1TKTA 4LF2A 2GVDB 1GXUA 2IPOB 3DFEA 2HURA 3QAUA 3W66A 1LXJA 2E7VA 3I5AA 4KV8A 3NNHA 1RWKB 1CJVA 4TXSA 4C8MA 1VQ6S 2R8KA 3CJQA 4OHWA 5EUHA 2IRXA 2RT3A 3FK4A 3I56S 4MKVA 1A9NB 2BX6A 4CRJA 1UCNA 2PDAA 1VFJA 3UNYA 1WKJA 2BDPA 3HHKA 1UZDA 2V69A 2A6OA 1TV6B 2JVOA 1SL1A 3PYEA 2CPEA 5K8PA 2HMIA 3RAQA 2N4DA 1X4HA 2V94A 2FY1A 1NKCA 1NUEA 5JJBA 2AGOA 1YIJS 2E29A 2YNIA 3DRRA 2J9DE 1KOHA 2ZNYA 4RJVA 5DS7A 3H5UA 3IGVA 3ISZA 3OTCA 3ZTPA 4PCQA 5GAEI 3JSMA 1U25A 2DRAA 1CEZA 3MEEA 2MYFA 5E3PA 1NKEA 5CZXA 5CCMA 1YRXA 3M8QB 4WKYA 3MR5A 2V2KA 5L8RC 2HAFA 3DGVA 3JQJA 1NPKA 2QJ3A 4RU9A 3QT8A 1F6TA 2FVRA 2J6SA 2H54B 5LL6d 1ITPA 2M3DA 5IC6B 2R2RA 4CO2A 1RAAB 1HD0A 2GHPA 2CPZA 3DHWC 1ZTTA 5KT5A 3DDKA 3CCES 5HQMA 4HHJA 4DR4F 2HHWA 2JC0A 1U45A 2C2KB 3C3LA 1ZAWA 3ELHA 5DZ7A 1UFWA 5LSLA 1TUWA 2P6TA 2IBOA 3FBCA 3IO1A 4RW8A 5J1EA 2VDHA 5KG2A 2I1RA 3GSIA 4WFZA 3ZZUA 2XGQA 2UXDF 2AQ4A 4ID5B 1FEHA 1IBMF 4IG3A 4QIWD 4Q44A 1RT2A 4UQGA 1F9HA 4ECVA 2BEFA 1MMLA 4QIFA 2XZDB 2PEHA 3CT9A 2GS8A 1FRMA 3JTPA 4RW6B 3WX8A 3ZZZA 4LBHA 3EE3A 4FVMA 4NRTA 4XTTA 2GIRA 2F8EX 2E5JA 1HL6A 2WSFC 3DXBA 4OFZA 5D0GA 5KAKA 2DK2A 3TQ1A 2F4VF 3M2UA 4O0NA 2MMYA 3JSYA 4J9MA 2XHCA 4BCAA 4FPRA 1SCJB 3P96A 4MIAA 2R7XA 2BV3A 3RBDA 2PEBA 4DL7A 2UUBJ 3FJ2A 1VI7A 4FS2A 4X62J 3RTVA 3V6KA 3OLAA 2HW3A 4CO3A 1DURA 4QYRA 3IG1B 3CD7A 4ZIWA 2Y1RI 3I31A 2W24A 4OYIA 2ILZA 4DX8H 1VBXA 2KYXA 1XNRJ 2F8HA 2KFZA 1RUSA 1Y3JA 2B4VA 1VJWA 5FD1A 2BKOA 4IH6A 5B09A 2XM3A 2M88A 4C0HA 2WW8A 2JJ4D 2E1CA 4MMOA 1VC6A 3HHLC 5L9NA 2E44A 2IY5B 1KVIA 1RTIA 3H2UB 2E66A 3T1HF 2ABYA 2DITA 1CULB 1M5OC 3QYYA 1TFYA 1LEOA 1SV5B 1TL3B 1FRIA 5CYQB 4ZPDA 1JLQB 5HQLA 2ZH2A 1YZ6A 4NI2B 1S9EB 2DPIA 2NXJA 1D9DA 2MLXA 2KH9A 2ATCB 4NRUA 3MOJB 4TN2A 3H25A 4DCPB 1LW0B 1JMTA 2H5EA 2HIQA 3R3TA 2MKIA 2XY5A 5B0BA 3MEDA 2E1RA 2YWWA 4M8LA 1RT6B 2DYAA 3SQOP 2JEGA 3OFEA 2EFOA 2V2VA 1H7WA 4ZK7M 5J2MB 4M5HA 4EZ9A 1TK5A 4F02A 2ROEA 2WOMA 4O3OA 3QPIA 2HQGA 2LKZA 5D15A 2AD9A 3IMQJ 2E9RX 4DN9A 3BPSP 1M1HA 3NLCA 5KFWA 4KGXB 2GFFA 1UL3A 1TELA 4OZ1A 4PG6A 2BXJA 3ZTRA 5KFEA 3QBCA 2DNGA 4Z37A 1TL7B 2PD1A 4MTPA 5HBMA 5KG5A 4AXJA 4CH0S 4OZ2A 3J7YI 2L41A 4C0OC 1M1GA 3HHLD 3IR6B 3QNWB 3BSAA 5F8LA 4A8KA 4WIIA 5CCLA 3D9BA 2DHHA 5HVGA 2PT0A 2XLJA 2RUSA 5LXRA 1FX4A 2UXDJ 1YQHA 1BHNA 3N0VA 2VODA 1TL1A 1CVJA 5H9FK 1VC0A 4KHPF 4IH7A 1D1UA 4ZVFA 1JLFB 4IOCQ 3UI3A 2XYGB 3MM7B 4LFAF 1XN9A 1TMMA 4O3RA 1KTVA 3L4BC 1FXDA 1YSJA 4GRSA 3C19A 5D6GA 4DR1J 4RUBA 2QA4G 4EBEA 1AFIA 1SB6A 4FF3A 1OYEA 3KG0A 4ED0A 4JI5J 1S76D 1T9YA 3NMRA 1B4SA 1HMVB 4OYWA 1OQ6A 5H9EJ 1K9MT 4OZ5A 1FJCA 1DY3A 5E3CA 2ZC3A 1KQGB 2OEJA 2XI2A 5H9FJ 1GEHA 1Q86T 3GCXP 4DL0C 1S0VA 2QSWA 2RU9A 5HJYA 3T6BA 3R8YA 3GJSB 3VCDA 4ECXA 3E2EA 4AL5A 1RQ0A 4FF1A 3GE9A 4JI4J 3SV3A 4CWBA 2I2YA 2KTQA 3RAXA 1WUUA 2VA3A 1R6VA 2GW8A 3QQCD 2YKMA 5KFFA 1WTBA 1QD1A 4QWEA 4LSNA 2MGZA 2XY7A 4CT9A 1RT2B 3UD3P 5B0FA 2ZC4A 1RJJA 1KNZA 4N56A 1RISA 4K7QA 3BQ0A 1FTCA 3SMZA 2FC9A 2ZVSA 1X4EA 1FE4A 3OD2A 5K14A 3GV5B 2HYIB 2E1AA 2XZWA 3RJMB 3D6TB 4XDDA 1BQNA 2CPHA 3NEKA 2JDJA 3R7NB 4F3QA 4PUOA 4NCGA 4RW7B 5KFXA 5D0RA 3W1YC 2HVIA 2HWHA 1FJGF 3D1OA 3W8PA 2LQ8A 3TJ9A 1DLOA 3VZIA 4FKYA 4JBCA 2RQ4A 4PXDA 3WC0A 1Q82T 3KLEA 4LF9F 2CJAA 2GX8A 1WF0A 4CLWA 1SVDA 2PMZD 1HQEA 1I5OB 2EK1A 2B8QA 3TP2A 1Q0NA 4NWBA 3CMES 1YVFA 3K5PA 4NYPA 3V81A 3J7A1 3J7ZT 1YLXA 1YRUA 2ZOMA 4RUCA 2KU7A 3EM1A 3QZ8A 3NWGA 1H38A 4KRWA 1B99A 2LXIA 4OZLA 4P74A 3KFWX 5KFZA 2HLTA 1V6HA 3POTA 1Y11A 2BA9A 2R3VA 2HAIA 4OHVA 4PZVA 5JXSA 3ZZRA 1RKJA 2VBYA 1C1CB 5H1SV 1S1UB 1V3SA 4NXNF 1IBCB 1MG7A 1EZZB 1V3RA 2JLEA 1IWAA 4UQTA 3MAAB 1FKPB 4I7FB 3R5BA 3IC1A 1T9TA 3IR5B 4LF4F 2ATLA 2R7OA 4QOTA 3AOAA 2WAQD 3PEJA 5AXMA 5E33A 1U1NA 1NAQA 3BO2A 3SI8A 4LFAJ 1NHVA 1IKYB 3M8YA 5J1EB 1V3ZA 4KC5A 1RT5B 2OMOA 2ZFHA 2HS0A 4W4MA 3S1TA 3MCSA 5F8NA 1F2GA 4FF2A 1JNRB 2Z57B 4OZNA 3R7SB 4WFYA 1KLNA 3K59A 3HVAA 4JYAJ 2C2RA 3R6LB 7FDRA 5T7LA 2X1GA 2ASLA 2Q6BA 2ZVIA 1SH3A 4OJHA 3KK2A 4N76A 4TQSA 2KT3A 1BE4A 1HLWA 2GO9A 4QWDA 2HHQA 5L39A 3BGRB 4PWDB 2B9EA 1V5VA 3RBEA 2CQBA 3OPKA 4QQBA 4EMDA 1EETB 3FQKA 2GVZB 4HKQA 1L3VA 3GTYX 5ADZA 1H74A 1S1TA 2E1PA 1N52B 2FVCA 2OPPA 1FA0A 3JSRA 4XO0A 4B3OB 1NZ8A 3PR5B 3VAIA 4K4TA 3ZNJ1 1Y5IB 2N7YA 2NZCA 4N7TA 2FGCA 4QWAA 1VQYA 2PI4A 1X60A 1UW9A 4FYVB 3ZTQA 4YR0A 1RTHB 1YJWS 4TU8A 1KC8T 3D68A 5KFSA 2V34A 1S6PA 2QO3A 1C4AA 3G8QA 2UUWA 3L7PA 1QE1B 3VALA 2WK4A 1RTIB 1CC7A 2YPYA 4U8VA 4OI0A 3T1HJ 2KM8C 4DSKA 1RHMB 3AD7C 4PG5A 4B9NA 3UCGA 3RGIA 1FHTA 2WB1D 4DF8A 2V8DA 2EFVA 3N5BA 3GV8B 1HNXF 2A10A 1C1BA 2JH3A 3AB2B 3B8HA 2W7PA 4M94A 1Y7PA 1R27B 4WCEQ 1ZM9A 2DGSA 3G2XA 3KLIB 3UNGC 3OJUA 2NR0A 2AX0A 3T1YF 1FEEA 3TX8A 5IWAF 4YN3B 4IDKA 1Q95G 2PGCA 2ZBRA 1VBKA 3CCZA 3MEEB 4EO6A 2ALZA 4MT1A 4NYOA 3HSDA 4ZLJA 2BACA 2R42A 2LU1A 4F25A 5J2MA 5K14B 3MEGB 5I3UB 3OV7A 4OJGA 1XBWA 4LSLA 2IM1A 4BS2A 1RWXB 1HARA 2W2PP 1LNQA 3PO5A 3ILJA 4ZN3A 3BDEA 5DLFA 1EKRA 4Q45A 3DNCA 4MK8A 1ZM3A 2B4UA 2NSCA 2F63A 4RW7A 2HHHF 2WVDA 3MM8A 5E3RA 3N4WA 3BYRA 1IM4A 3EDRB 4KH1B 4P9SA 2RKIB 3JYTB 3MCOA 4ANCA 4IRDA 1VRTA 4MYTA 3IWLA 5G4DA 5HO4A 2FVSA 3OTEA 4QPXA 4WPAA 3K5MA 1AROP 2OPSB 2LMIA 4LVNP 3MMAA 3L7UA 4ZKAA 3FZ2A 4MH8A 2JNJA 5B08A 1N32J 4DV0F 5ETVA 3M9MB 4RW4B 3DLEA 3FEYB 1NH8A 5KFDA 4ECYA 1P1TA 3G86A 3ITHA 3FDSA 3B4MA 4NZ7A 4ZPAA 5ETPA 4O0IA 3QLHB 3OUYA 3TEGA 2ASDA 3CD6S 5J1PA 1FNOA 1R89A 2ZJPQ 1R0AB 1Q4RA 2K1RA 4OYMA 1FJEB 3PKYA 1LWFB 1PYSB 4JV2A 4KPCA 1K1QA 4B3MF 3BKTA 1Z2LA 1X5PA 3H59A 2OD4A 2HS3A 4MK7A 1N5YB 2V4JA 1S6QB 4FPIA 1KFSA 4E0DA 4NXMJ 3W5YA 3IAM9 4HI2A 1LKZA 1W26A 4HHUA 2QTWA 5A2QU 5A8KA 4WP3A 1IBKJ 4GKKF 2YKOA 3M05A 1X9SA 1ACMB 3IRXA 2IA6A 4EZ6A 4K4XA 2YX7A 3M6WA 3QSIA 4Y34A 3DMJA 4KKOB 5ETOA 2OFGX 1SV5A 1JX4A 2AZ1A 3ISND 1DQAA 1S77D 3NCPA 4ZJQA 1BC6A 2PMWA 4OHXA 1T3OA 2D9PA 4GVBA 4USWA 2W25A 1X4DA 4CO5A 1F3FA 2WZ1A 3BGOP 5E7OB 1E6YB 5EHHA 2MSTA 5LMUJ 3V6HA 1T03B 3UN3A 2B5JA 2C2OB 1IR2A 2CDRB 4YS2A 5IT4A 2QIFA 3ILOA 2IC3B 1O0PA 3GP9A 4Y28C 3MEDB 3D54A 3P45B 1HNVA 2GVZA 5GMEA 3J81U 2OTLS 3W62A 1S1TB 2BE9B 3G6ES 3AD9C 4JI3J 3DLLQ 3K5LA 2CDQA 1V9OA 4N5SA 2ZUAA 2FLLA 1AYEA 2XG8A 3LP1B 5SUHA 3UDCA 5KOWA 2BW2A 4LF1A 1RU2A 2F65A 1YK9A 3M8SA 2R7VA 4F4KA 3CSKA 3R27A 1CJTA 4ZOSA 4IFYB 3Q86A 1TL7A 4E8UA 2Z4PA 2DGTA 5AE2A 1YJNS 2K8GA 4G65A 4DUZJ 1U1OA 2VJUA 1B0TA 1SPBP 1RT4A 1SKSA 4DZDA 2UXBF 3TVZA 4QW8A 2MLYA 2YKNB 3IS9B 4DN0A 2CZVC 2HNZA 1Q7LB 1OIAA 2YKQA 5J2PB 4HACB 2KZMA 2OEKA 4XPCA 3D6MB 3D0IE 3VWSA 3J7AN 1OY8A 3PEHA 4DV6F 4O3SA 2ZH3A 3NP5A 2MZQA 3MAAA 4Z2XA 2VB6A 1S0OA 2Q43A 1RU1A 1CC8A 3HO1A 1N4LA 1H2UX 3W3SA 3C6TB 2M8HA 4USJC 2RRBA 3R5JB 4OYZA 3ZNUA 4WP9A 4ZP8A 3HP6A 1OO0B 3ZC4A 4DQQA 2W4PA 1MU2A 2VF3A 1XJWB 3DLGA 3MMJA 4PABA 4CT8A 1UEKA 3U1MA 3Q8VA 1WDTA 4J9OA 1Q5VA 1IKWB 4J90A 3D1QA 2FJDB 4RKUC 2EBGA 2HQCA 4M63A 4RBTA 4BWJA 2GVDA 4OHZA 1UFLA 1MLAA 2B9YA 2YX1A 4O4GB 1RTDA 1FE0A 5E0OA 5LMUF 2UXCJ 1NXIA 5KT4A 5A8RA 1R8CA 1U09A 2RILA 4WP8A 5KFCA 2YWGA 2UV8G 5IOLA 4ILLA 3SXLA 1I3OB 2CPXA 3M4XA 4UOFA 4B9SA 3S8SA 3QJLA 1ZA2B 4F3OA 2ZZNA 3Q8PB 5GMDA 3MMBB 3O6QA 3HT3A 5D77A 1XIQA 1NB2A 1PCAA 5F9LA 4P2FA 3NNCA 4IG0B 4TYBA 3KHHA 1FWKA 1G4CA 1JLBB 4YQWA 4C8LA 2DR5A 1X8DA 3HK2A 3OVBA 2BE2A 4NA2A 3IRWP 4CDIA 1FJ7A 2HVHA 1NDPA 2EBEA 2HFVA 4L74A 4OLPA 5KFTA 2UU9J 4JV1A 2IVYA 2XSJA 2ZUGA 3I0SB 4DX6A 1SXLA 3LP2A 5KFIA 4CLZA 5EWEA 3JSMB 2ZEJA 4NCBA 2G2ZA 2FJAB 2M0GB 1MROA 5C7PA 1XR5A 2C2NA 2AHOB 4C97A 5DDOC 2KT2A 1W2BR 1LK5A 2Y3YA 1JIHA 1HBOB 2AP6A 2B6AA 3LP0A 2MQMA 2JC1A 2MQQA 5AE3A 4ETXA 4F36A 4PYAA 1VOMA 2C2EA 2HRUA 3RAMA 2MB0B 4QR0A 2FD2A 3UO0A 2ASJA 1SKUB 4C11A 1CG2A 4ED4A 4QCLA 1NPPA 2HLUA 2W2QP 4RUAA 2J0WA 3G8TA 2UP1A 2QC3A 2RVJA 3I5CA 4ZJOA 1DBDA 1WOPA 2JRSA 1P27B 1TK0A 3ET6B 2W4DA 3BKFA 2IIHA 3PM9A 3QO9B 1YZ7A 4KKOA 3UE2A 1C1CA 1VCTA 1HBMB 3VGSA 4DPWA 4R0EA 1S1UA 2CWKA 3PG9A 4IO1A 2V4RA 3K2YA 3DM2A 2DBBA 2DO0A 3HVWA 5G0RA 3G71S 5ETRA 4U67Q 4RNFA 1P6TA 2V63A 2XSFA 1S9GB 1RWNB 2BJ3A 4WWSA 4EI2A 5LT5A 1E6YA 4C4WA 4B3SF 4FBTA 2IAJB 2PC6A 4UZCA 5D4OA 5A8WA 5CXTA 5BYSA 2FJWA 4CP5A 5EN1A 1VLOA 2B51A 3GYGA 2AMCB 5C5JA 2OMLA 4KHPJ 5EX3A 1GMUA 1K0VA 3SFGA 4AL7A 1G2EA 2V4QA 1IWGA 1G1XA 4CM0A 1JLEA 1YDLA 3LA0A 4NEZA 3MFIA 3SZ2A 1HI8A 4NLOA 4X4TA 4AQYF 4ECUA 1IBMJ 5KG7A 1S6UA 4J5OA 1NDCA 1ZYQA 3BREA 2VQEF 4RW4A 3GJTB 1YKWA 2C1EB 2Z56B 2FYXA 2CJBA 1RT4B 3T5HA 2LQ5A 4OYOA 1TMJA 2DNMA 1TU0B 2JVRA 1SH2A 1VS3A 2DCLA 3PX4A 3HD1A 2OLWA 3V6JA 3FCHA 5HLFA 4Q8FA 2PFFB 4ZCLA 3HT0A 1UWAA 3L3CA 2LEBA 4IQXA 4H54A 1RAOA 2CRLA 2DJWA 3BS9A 3Q89A 2VG6B 2BBEA 1WOOA 2BQ3A 4Y2AA 2P2CB 2B4PA 1O6XA 2HQDA 4Q5VA 4TU7A 1T7PA 2HHPA 3CDWA 3MF5A 3PV8A 1REVA 3KHGA 3BH6B 1HQ2A 2WB4A 5KFNA 2MSSA 4DS5A 5GADU 3UCUP 3AOBA 2J0QD 3KLHA 3VAFA 2MQPA 1U1RA 2F9JA 2OO4A 2IFXA 3MHYA 3E3XA 4AD6A 4KBIA 1TFWA 1BGXT 1R8BA 3L95X 3SSQA 1EP4A 3CCSS 3B6BA 3BBFA 1JXLA 3HHNB 1VDHA 3KJVB 1F1BB 3J80Y 4OZJA 2IMWP 3OL8A 1PO6A 5DM6Q 1SQGA 2CJQA 4K4WA 5AE1A 1ZA1B 4F4XA 2D74B 3PX6A 3N28A 2CPYA 2ZZMA 1H98A 3SQGA 4X4RA 4I2QA 4L76A 3FRYA 3MXHP 2XQCA 1HNVB 2HNYB 3HHLA 4HTIA 3MPVA 9ATCB 4DXLA 2UVUA 3QGIA 3G9CA 4LSLB 5DLGA 1DARA 1FVQA 4ZVTB 3A4TA 4DV7J 4OJ1A 4CLLA 1SJ1A 3HHDA 3HULA 4I6YA 1TKTB 2OSQA 4FYXB 1U48A 1KD1T 1Z4UA 4V19X 3GYNA 5DQGA 3ILLA 2LEPA 3K0JA 2XMKA 3GFXA 1MROB 1HMVA 4AE5A 2HWTA 2MPUA 3AJ2A 4A46A 5A2QY 4J9NA 3EGZA 3U27A 4B3RJ 4NXNJ 1TK8A 1IBLF 2RQCA 4IYQA 2OEMA 4QJVA 4EFAC 2QGFB 4Z7YA 1SIZA 1UTAA 3M8RA 2AW0A 3O2IA 2EC2A 2WVBA 3MCMA 2QFJA 5AT1B 1T3NA 1NK7A 4YEAA 4USIA 5HANA 2CNLB 5CYMA 3MUTP 4EYIB 4YOEA 4YHHF 1U2FA 4LQ3A 3BV8A 5GADI 3TVKA 2M2BA 1HW8A 3TNVA 3R7BB 4DU8A 1U1LA 3HFKA 3MR6A 1U0SA 4B3TJ 2VU5A 3NCRA 2QLFB 2VG7A 3QWPA 1WORA 4H4OA 3AAWB 3VTIA 5GAHU 3Q2SC 1OS5A 4KSEB 3OL6A 1N5SA 2K1RB 1F2HA 2ZBQA 3M8QA 4H4KC 3GPAA 3JTOA 3Q8RB 3BGLA 3V4IB 2V8HA 5ETNA 2UU9F 4MYUA 4K4YA 3PX0A 1VQ9S 2NREA 3SCIE 3DRSB 4XK8C 3C2PA 3DOLA 4F8RA 2MY7A 4RZRA 3TEHB 1RHKB 1M0SA 4NLDA 1BWVA 5DDRC 3PIPQ 4LMZA 2L3MA 2NXUA 3K7RA 2NPFA 3THTA 5A8KB 1DJ0A 4RW8B 4EGLA 2RF2B 1K73T 1MN9A 1WSVA 3ZFVA 4HI1A 2W01A 4ED5A 3BGFA 2BMBA 4DI6A 1TVRA 2VOPA 4WJBA 2W2OP 2MQ8A 4L72B 5I42A 3KNGA 2CUYA 2DNRA 5HMYA 2OD6A 4P2MA 2W4CA 1KHVA 3AJ1A 4ES2A 1I1GA 3V6DA 2WVCA 2IC3A 4ZS6A 2FIUA 2HFNA 1U4BA 1QM9A 3H5XA 2BRKA 1WD6A 4X64F 2OKQA 2XBPA 4NLYA 1YI2S 3EDQB 3D0GE 4Q43A 1GMWD 1FRKA 1PJ6A 1R3NA 3OHBA 3GIRA 3PJ9A 1KLMB 1S4FA 3MUVP 1ZAXA 1XERA 3BYPA 4RU2A 2UZAA 4JI7F 1CJTB 3GR1A 1RWMB 3CJ3A 4USKA 3SSRA 3VGUA 5JUMA 4RL1A 4K50A 2FB0A 1FDDA 3PFOA 3WZ0A 4DV5J 1TKDA 1TP7A 1H73A 2RH3A 1HWJA 2XEXA 4WU2A 3VVTA 1N6QA 1Y3KA 3Q83A 4ECWA 3TAPA 1ZS6A 1EP4B 2WSEC 1EJ7L 5IV4A 1S9FA 2F4FA 1AT1B 1GT8A 2YNHA 2AJFE 2JHEA 2QV6A 1NH7A 3PFEA 4LR9A 3VHQA 1UJ6A 4QBUA 1C0UA 3UR0A 5L1KA 1SL2A 4LIWA 1XMOJ 4ELVA 1OYDA 4ALZA 3OVSA 1W25A 3LANA 2V0NA 3VV2B 1B0VA 2BJ7A 4I2QB 5F8MA 1LV5A 4Q0BB 2JEJA 2AYGA 1FT8A 4C48A 2L9WA 3BSCA 3FMWA 4KGZB 3UW1A 1J5OB 3LF0A 4CTAB 4FXDA 3DDNA 5KFJA 1C0TA 1WG4A 2GQCA 3DYAA 4U96A 1XWLA 3AXMA 3IWXA 3K89A 2X1AA 3R1LA 1WDDA 2YXLA 5HBMB 4B9UA 3FUYA 2WRMA 4ZP9A 2RD5C 4AXIA 1WI6A 4GMKA 3VQTA 2N3OA 4ZVPB 2VHGA 4DUTA 2LCWA 3EZUA 5AXNA 1OSDA 1WF1A 5HJXA 3KK1A 3EVWA 1OMSA 4K5SA 4YHHJ 3SBMA 3CCTA 4OHYA 5KFGA 2DGVA 1HHTP 3GFHA 3JTNA 5IT9U 5HMZA 1AW0A 2DO4A 1PIEA 1OY6A 1LWCB 4NEYA 1WOSA 1XNRF 4LIRA 4B17A 4DR7J 1AB8A 1B7YB 1U8SA 1GFWB 2BJ9A 1JLAA 5LOQA 4JI7J 1N33F 4NMLA 4IDKB 4FS1A 3CDBA 4DJBA 3ENQA 2GCFA 2XMJA 1CQNA 5J2QA 5CH7B 3RG6A 4X65J 1U8WA 3PZPA 2JOQA 4DV7F 1T95A 2CIMA 4ZITA 4BWMA 4YDXA 5JMNA 4DR2F 1JJ2R 3M2RA 3GIKA 5KFMA 2AF6A 2ZDOA 4L3NA 1IN0A 2ZD1B 1CQMA 1TKXB 3H5SA 3IA0A 3IXQA 3PXGa 2X7IA 3ZZ0A 1HYSB 2FJVA 4W90B 5FJ4A 3CE8A 2X51A 4LFBJ 1YRTA 4NLXA 3FFIB 4OX6A 1S7HA 3L7OA 3CMAS 4M95A 1RZMA 1RT3B 3M6XA 2W9BB 2OJ3A 2L9NA 3RBXA 4LSZB 4LRAA 2RRNA 2CQDA 3QGHA 1GNKA 2ILYA 4BLGA 5I3QA 3R97A 4M5DB 1N8RT 4K4SA 1HBMA 1ZBTA 4DV2F 4DQPA 2LQJA 1XMQJ 2KI2A 4UOHA 2F7VA 1GXTA 1HHQA 2YNIB 1DQ8A 2I8EA 3DRRB 2FLNA 3D6HB 4W98A 2KG1A 1XNQF 1HPZB 2ZE2B 2QL5B 3GB0A 4P71A 1N0VC 5F0WA 1RI7A 1YJVA 2GMHA 2Q6CA 5KTQA 1RACB 5ETKA 5JVGQ 1P1LA 4MAKA 1R0AA 4OL8A 2FHJA 1JK9B 1TR0A 4M5KA 1PBUA 1DLOB 2BUNA 2WBMA 2IJNA 1JLGB 4Q7AA 2H3EB 2G1HA 3G6YA 1M90T 1Y5NB 1RTDB 2J6TA 3KTQA 3DOMA 4DHVA 4PQUB 2BJEA 3NRBA 1HQEB 3CD0A 4ZVHA 1X4GA 2ZBCA 4O3NA 4NA1A 1A7GE 2G2OA 4HDHA 2PI5A 4B9TA 1MMDA 1SIWB 3UWTA 3BR9A 3LW5C 4U6PA 3BO4A 1L3SA 1HI1A 1MN7A 1K47A 3MMCB 1FNMA 2J8AA 3I87A 2IA0A 2G0JA 3NGSA 2J0XA 2G0CA 1YWXA 3NG8A 3PW5A 4N41A 5ETLA 2DT9A 5B0AA 3BSOA 4KGKA 4OX9F 2J7WA 4DR6F 4F04B 2VG7B 2CKWA 1XR6A 1HNIB 2LXFA 4DV3J 1UJ5A 5A76A 2DEIA 5KT3A 3PJWA 4JV5J 2VFRA 1P9QC 2MZTA 1KR4A 1DZ5A 2BOAA 4GVBB 3NMAA 3UDLA 1N34J 1T03A 1X4BA 3W9JA 2ROPA 3TJAA 3TUPA 1XTZA 2MXYA 4A8FA 2QZ8A 1S79A 5KFKA 4J9RA 2N7CA 2W1BA 1YTYA 2V8GA 2UUCF 1IKYA 1EX8A 1D9AA 1DTTB 3NWRA 3P5TL 3RRKA 3GFZA 4DBQA 4DV1J 4JI2J 2IM0A 1OPIA 1EKSA 5IS2A 1C0TB 2B8PA 4ED2A 4B3TF 4PG7A 3U1LA 5MLCV 4NLPA 4CO0A 3TAMA 1UZHA 2IM3A 3IP0A 2D3ZA 5C25B 1HWUA 4PXEA 4JI8F 3QRPA 2VBWA 3IR7B 5KFYA 3D3CJ 3L9ZA 3BGRA 1M5VC 3OQ2A 5THWA 3PR4A 1WEZA 3UVJB 1P9YA 4HT5A 1NHUA 3JQKA 4IOBA 3GLJA 1SKRA 2CWXA 2MKJA 3DRPA 4EUVA 5KG3A 2IJRA 3T9NA 2LU2A 1S7IA 2GV1A 2QLXA 4MKBA 3FMBA 4J9QA 1Q5YA 1F5BA 2P9GA 5T14A 5GAGI 1R43A 1WKKA 2CAJA 4ZHRA 4DL5A 4C8OA 2WSCC 4P75A 4X4OA 4NASA 2OGUA 3OTBA 2VA2A 4JI6F 1RGVA 1Y9OA 2MZSA 1LWXA 4PEOA 4Q2MA 2AJ4A 4HH0A 5DDQC 5LSRA 2RRAA 1T94A 5L1JA 2DKOB 4Y2CA 4E2FB 4CZCA 2Z2LA 2RDIA 1IKXA 1S1XB 4J7CA 4ZMMA 1GMWA 4DFMA 1NB7A 4K0KF 4A8XA 2DXEA 1N56A 1LK7A 3FBEA 2BJ8A 2WHOA 4F67A 3V2UC 1PJ7A 2JLFA 2HK2A 2AJ2A 2J9EA 3NOCA 3PW7A 2VC1A 4O44A 2E5LF 3OR1B 1X0FA 1FWPA 2XMUA 3UCZP 2ZWPA 2XS2A 1JLBA 3I9V9 1RT7B 3ENVA 4HLBA 4RNHA 4X66F 3D2WA 1HNZF 1KVJA 4NLUA 1IKVB 2E7XA 2GQ2A 3EZOA 5IFMA 3RB4A 3DRSA 4N8OA 3SV4A 3M2UB 1SKWA 1N36F 4DL3A 4YFUA 1X9MA 4KQZA 2VONA 3TUJC 1YJ9S 4DSLA 1CJVB 2I38A 2ZKUA 3EXCX 1JLCB 1S1VB 3LO3A 3WQPA 1J5EJ 3N5FA 2RKIA 3NS5A 3JYTA 2CQPA 5CD4H 3C15B 4KE5A 2DCUB 4Y65A 4DV6J 1UVKA 1QUPA 3FEXB 3M2VB 1KN6A 2AYEA 4WFBQ 3KK1B 3MMAB 1IBKF 4J9PA 1TV6A 3BKUA 1JJCB 4PG4A 4YB1P 1UW4A 2GA7A 2ZOGA 1TVRB 2JFKA 4WK1A 2XB2D 2Y1LB 5L1LA 3IWNC 5I42B 2AIRB 4I68A 3DDIA 5HROA 1U0HA 3CEDA 1VBZA 4G1QB 4RW9B 3VR1A 3D67A 3V6DB 4I69A 2E9ZA 1S5ZA 1HBUA 4B02A 2F3JA 3U7JA 3FKBA 2IYGA 4JI5F 2EI5A 3P49B 1LW2A 4PRFA 2GJIA 3MAQA 2GGPA 2Q3PA 2FTRA 3FCWA 4C3LA 4FKXA 4DPYA 1C2PA 4LRBA 2J7KA 2ZH1A 2V4JB 1RAHB 2YWFA 2J5AA 2I5JA 2XYPB 5EWFA 4C8NA 4IFVA 4UUXA 2FHKA 5GMKa 5HVFA 3QJPA 1R0CB 3DU5A 2BANA 4OI1A 4RWXA 2NCKL 2A1BA 2LP4A 1FD2A 1YBTA 5IM0A 1FX2A 3A13A 3J7YU 2NUUG 3GJQB 3UFCX 3CGIA 1NHKL 3TAMB 2J9DA 2C2MB 2G0IA 3Q0AA 3FVYA 1O51A 2Y8WA 2VPWB 2B7BB 5EX0A 2D69A 4HR2A 4ZCIA 2L9DA 1ZPWX 3SYZA 1KVKA 3PO4A 2B5JB 2NXEA 3QFWA 1UAWA 2N4CA 3M8PB 5D4LA 4QIEA 2AEFA 2MQLA 2ZHAA 3D3BJ 3RB6A 3H8YA 3CJ0A 4Y2MA 4ETZA 5L38A 4EBDA 1HNWJ 3LOUA 4A8OA 1SJQA 3T1YJ 4IR9A 4WTYA 1WI8A 5DETA 1L3KA 5K5MA 3CCJS 3JAMU 4K2JA 5C24A 2DISA 2AJ1A 3CCMS 1HR0F 3N6NA 2U2FA 3X3UA 3BPDA 2DHAA 3LP1A 2GQQA 4X84A 3LWMA 3BO3A 4IFYA 2VG5B 1SC6A 1S0NA 2W2NP 5BYQA 1RBOB 4AL6A 2EFPA 3C14A 5FDLA 4ANEA 4L75A 5DRKA 1RT5A 1B3TA 2W2MP 4LVOP 4YB5A 4DLGA 3SFUA 1WNEA 2I0XA 1N54B 3MPYA 8RUCA 2M4MA 4G6VB 3W65A 2ZJQQ 3CO0P 2RS2A 2R8JA 4CQ1A 1WC5A 2AYBA 1F9FA 1QUVA 1TUVA 1VJQA 1DHMA 1FFWB 1X4FA 1VIXA 4PKDB 3KJVA 4PWWA 5FIIA 3QMQA 3G4SS 2W9AA 1TAQA 2DGQA 2NXNA 1RLDA 1U02A 4O44B 1JLAB 5HVHA 1HNZJ 1KRPA 3KG4A 3CCVS 2BKPA 1X5SA 2UUBF 1RTJB 1MU2B 3DLGB 2DY9A 1NJZA 3ENWA 3R5AA 3AB4B 3LUYA 4KPYA 1EAYC 2VFSA 1IKWA 5BJRA 2OPPB 1RADB 5HI7A 3OTOJ 2OTJS 1IVZA 4O23A 3E01A 5KFOA 4PUOB 2ZH4A 1PJ5A 2M52A 1GTEA 1PSDA 3PDNA 1S1WA 2QT7A 1IR0A 5D4NA 3BQ2A 4DQSA 1JWWA 3PW2A 4DDFA 3BBCA 2IMOA 3PRBA 4ZCKA 6FD1A 5EWGA 4K0KJ 4WTOB 1VQ7S 1RT3A 2PSZA 1X4AA 2W9BA 4F0MA 2A18A 3W2VA 4USUA 2AV5A 5KT7A 3K5OA 3V81B 2H5IB 2ADCA 2EW9A 3CUNA 2NYIA 1VK8A 2AEJA 3OXGA 1HKAA 4H4KA 2Z58B 3FSYA 1SUQB 2DIUA 2B0GA 5D8HB 1IQZA 2GMLA 4QU7A 4KFBB 2EK6A 1N5QA 2VASA 1NDKA 3A8JA 3P4UB 3UDEA 2GJFA 4ZVGA 4C7QA 2D9OA 5ETSA 1KSPA 1NM2A 1MWZA 2QA1A 4ZHRB 4U8YA 2HHVA 1F3VA 5KT2A 3W7BA 2MQNA 3PIOQ 4LQ9A 4Y00A 3SSSA 3HFVA 1HQUB 2KO1A 4LFCF 3Q8SB 2YNFB 5A0YA 3DOLB 3MOZA 1L3UA 3N6MA 3AHPA 4M5NA 4MFBA 3RRHA 1Q7YT 2UUAJ 4X4VA 4B9VA 3I4HX 3QIPA 3PYFA 3MMCA 3MR3A 2YKAA 6AT1B 1PG5B 3RW6A 1ULRA 1TQLA 2YY3A 4TQRA 4LREA 1VRTB 2KJVA 1YITS 4BC7A 2QMXA 4CYUA 5DQHA 2A2DA 2XY6A 1FDNA 1EQMA 2OPSA 3C8YA 4DR5F 4WU3A 5F8JA 3WIVA 1SH0A 4DLEA 2V8PA 3HXMA 2RDJA 3ZXWA 3Q8YA 3ZZOA 2MHEA 2XCPA 1RT7A 2R7TA 3H42A 4ELUA 3QATA 1CPZA 3CDEA 1S9GA 3ITHB 3W9IA 3IBFB 1VQMS 4JI6J 1R8HA 3KDOA 3TWZA 5DGAA 2CG4A 3FGVA 1URNA 2HWIA 5D3GA 3GJRB 1UPPA 2EVZA 2QE5A 2KJWA 3A3OB 2P6SA 1KFDA 2HGNA 2W9CA 2CJKA 3T5LA 3GZ7A 4P7VA 1X0PA 1NK4A 2UV8A 3PNIA 1U2CA 3MPDA 1S0MA 2CQ3A 3C15A 4C2MA 2CNNB 2VQFF 1U1KA 3JS9A 3TRGA 2XS7A 1X5OA 3QWUA 4USTA 2YX4A 1AA1B 3N79A 2FHOB 5C42A 3RR7A 1EARA 4OYXA 4JP8A 7FD1A 4KIAA 3SCKE 3AFGA 2HQFA 3IBCB 3K8WA 3MAHA 4R25A 2E5GA 4DX7A 1H3DA 3QRQA 4FYDA 1TUGB 3LQVA 3CCQS 2AZ3A 3J7Z5 1U0HB 5HMWA 2HVEA 3HDSA 2Z8QA 2M8DB 3DMJB 3LPEA 3FQLA 3H2LA 3OVAA 3PRVA 4F50A 1N36J 1HBUB 1QDUB 1N6QB 3I4PA 2W7OA 3T5KA 4J37A 3CO9A 2VH7A 4HL9A 3TZZA 3DRPB 4UW2A 1NJYA 2I9SA 3SDEA 3G96A 1VQOS 3QT5A 4J9VA 4LF9J 2DH7A 2V2ZA 2DHXA 2CQ4A 4OMFG 2OPRB 4OI6A 4TYAA 3CJRA 1C4CA 4IKAA 1KKHA 2GJ2A 1RBAA 2D3UA 1NRKA 3IFEA 9RUBA 2B3TB 2DNQA 4RX6A 2RHSB 4LF6F 4DV4F 3NAIA 2H4WB 3THPA 8AT1B 4MKAA 2Y0BB 4F2RA 2POKA 4OI4A 2KT5A 4QPTA 5IM0B 2C2DA 4PPZA 3CIMA 4LRCA 1NK9A 2DTJA 1JJHA 2H1YA 2HFZA 4A8MP 2ZJRQ 5LJ5Y 4YR3A 4JV5F 2QLWA 3DHXA 3M8ZA 1VR6A 4DR6J 3GFYA 2J7UA 2Y8YA 1MWQA 2DB1A 4DWIA 2CA9A 1D0EA 5KFBA 4DF4A 1S49A 1UPMB 4LF5F 5M2RA 4HACA 1KQSR 3NBPB 2W8LA 1Y00A 2F5GA 2H4YB 2W8KA 3MTJA 1BWEA 4NL5A 2ZHBA 4K4ZA 1N33J 4ZP7A 2DRDA 5J1NA 1UVJA 2R7SA 4KFBA 1N0UA 1HR0J 2CQCA 1RHJB 3QLHA 3OUYB 1Y5LB 3F56A 4X4UA 1BD6A 1S57A 4JV0A 4DU7A 4WXOA 1LFPA 1SJ3P 1QLNA 4IR1A 5DZ6A 4O3PA 4Y6IA 4K5RA 3AODA 4RWWA 5GVQA 1KS2A 2ZH6A 1U1MA 3NGUA 5FDLB 2KL8A 2OP5A 2JEFA 2HG4A 3TZXA 1X7VA 4F0HA 4JOUA 4DV3F 2CPIA 4NZ0A 5DM7Q 5EGYA 3GILA 1WC3A 4FYYB 4F4ZA 4DQIA 1GX6A 1LXNA 1VQKS 3DC2A 2NSBA 2H51B 1Q8BA 2H5JB 4IUFA 2EFNA 3P3DA 1D8ZA 4ATNA 4UZBA 2BJDA 3FCVA 4RBUA 3W2WB 4RR5A 3QZ7A 3HSJA 2WCXA 3CW2C 3EXYA 4FXVA 3T19A 2IYIA 5HN0A 4DCJB 4WFAQ 2AJQA 1H2VZ 4X4SA 4QIVA 2U1AA 5CAAA 2MZRA 3EGWB 4HDGA 3Q2TC 2AT1B 2PIIA 3OJSA 4DUYF 4NLVA 1Y10A 4OYAA 3IM8A 4M5GA 4ECZA 3P8BB 2ZNZA 2AWZA 2Z2MA 2AGPA 1AXQA 4F7VA 4K4UA 3GU0A 3GWCA 4ZVQB 4HHHA 1VRUB 2HBYB 1A6LA 3AA9A 1D09B 4ICLA 3CJKB 4CIOA 2XNRA 3KMQA 1NPRA 1NSAA 4DPOA 3RW7A 1KTQA 2BE7D 3R5DA 2BANB 2LA6A 2QYGA 4BC9A 4IRCA 4DL4A 4PQUA 2R4FA 1I94J 2B6AB 2QLBB 2VPZB 3LP0B 1RWWB 1T9WA 2AEMA 1FFSB 2OHDA 3MGJA 3QGGA 3OR2B 5E3QA 2C2ZB 3M8WA 3I55S 3J81Y 4ELTA 4C0BA 2M70A 3B78A 1F0XA 4DR3J 3R1HA 5LSOA 2DR7A 1RP5A 3PKMA 3DLEB 5U47A 6FDRA 2V68A 4Q8EA 4ZPTR 1GAOA 4X2BA 1QJHA 4B08A 2R2SA 3W60A 2D3O1 2YKNA 2GZOA 1J5EF 3DI6B 1UEVA 2FUG9 1NK5A 4UY8T 2GIFA 4RUHA 1D9FA 1UVMA 4HT7A 2UUAF 4QZVB 2FDNA 4ZVUB 1S9EA 4LBIA 4DL2A 1LWFA 1CSJA 1X4CA 2VFTA 4K2XA 5LMNJ 3DOKA 2VZ9A 2C3UA 3W5XA 2HQIA 3R5GA 2O66A 5DGBA 5E3AA 1SJFA 1WJ9A 3T5JA 3LGHA 2XWXA 4QU6A 4WZQA 4G1IA 2I6WA 2FGOA 2R2TA 4YY3J 1U6ZA 2KYZA 4ZLLA 2F40A 2P9EA 1CJKB 5IXUA 1TAUA 1JXVA 4ZVSB 5F8IA 1ICEB 2VJVA 4Y2KA 3KLVA 1X5TA 1ZM4A 4LF7F 5FLXU 3BF4A 5KFHA 1LWEA 5A8RB 4KAIA 2RE1A 3HMJG 1U1PA 1YHQS 2V67A 4DFPA 5GAGU 4FF4A 2HGMA 1RAFB 2PA3A 4GO5X 1RCXB 2ADBA 1KHWA 1NDLA 2ZOFA 3WX4A 3A8KA 3DLBA 1N5TA 2XC9A 2CPFA 5D3GB 4KJIA 4G1PA 1TL1B 3FBFA 2ZDPA 3LH2S 3EVMA 3H5YA 3CD5A 4L6V3 5F0UA 4M1KA 1FDBA 2BZ2A 2M5YA 2ZHOA 3BEGB 3TQEA 3MM7A 3TUZC 1VQ8S 4ERDA 3SCLE 3OTOF 2YQ0A 1DFDA 2UVVA 2UUCJ 1EHWA 4DQRA 4D3GA 5LXYA 5KFLA 1O8BA 3LP2B 3UD5A 1Y4ZB 4N8NA 1VHFA 2ASYA 2ZBIA 4I6WA 1FWLA 2DHGA 4ZDNA 4ZPVR 4NA3A 4U7CA 3PW4A 2DR9A 3A12A 4FP9A 5F9NA 4C6AA 2YTCA 3ICLA 5CD4A 3CCUS 3CC7S 2XULA 4WYWA 2UXBJ 3KLHB 3VF0B 2VL1A 1NK8A 3PY8A 4F0KA 4DUZF 4B9MA 1AFJA 2DNPA 5HL7Q 4TU9A 1IKXB 1F9EB 1RHQB 1KBRA 1TL3A 1YGYA 1GK8A 4I2PB 1M5SA 5CYQA 1S97A 3BH7B 1FFGB 2RNEA 1SUQA 2K3IA 4H4MB 5K8OA 3OFGA 1LWCA 4Z7CA 1N48A 3M9OB 1T02A 2DIVA 4FYWB 1VYAA 2IM2A 3K5NA 1RT6A 1J27A 2HNYA 2VPXB 3LGMA 1NZAA 2CQ1A 4PR6A 1FESA 4P10A 1QTMA 4U95A 2GHVC 3AXKA 2WOMB 2B9XA 4ITSA 3K8VA 4ES1A 2D3OR 1BQNB 4KY3A 3M2RB 3ZTOA 4NMXA 3KDNA 3JAMY 4K8RA 1Q16B 2WBRA 4ICLB 3DRXA 2WTFA 1Q81T 3JB9k 3I6PA 2KN4A 4CO4A 2WONA 2DXFA 2XLIA 3I32A 3HM9A 4KGVB 1VC5A 4NLTA 1T9VA 1DAXA 2HIYA 1TL4A 3CB4A 3HI9A 2HHUA 4BHQA 1Q1KA 5KFUA 1X9WA 1RLCL 2E9TA 5E41A 4DR5J 1GX5A 2A3JA 4M5DA 1YJ7A 1WG1A 2C3OA 1NCLA 4ILRA 4P2XA 1FVSA 3DN9A 5CYMB 4KH0B 1TKZA 4DCOB 2XO7A 4DV1F 1WELA 2KFYA 2FVPA 1B64A 2YH0A 1Q8KA 1BQXA 3PJXA 3VAMA 1APSA 3POTB 2X3GA 4CLKA 4G1QA 4RW9A 2DGOA 2CVIA 4H4OB 3O3LA 2XMMA 4Y3CA 4ZVRB 1SJ4P 2QEXS 3PYGA 4C3KA 5D0EA 4FZVA 3HPOA 1JLGA 1LW2B 2MKHA 4YMEA 2GAHC 2GGPB 3MFHA 1NNDA 3DOMB 3OTDA 2CJ9A 1FKPA 3DLKA 4XIUA 5K20B 3LALA 5ITHA 3IG1A 1ZZNA 3J81j 3MI7X 2E5IA 3M32A 3PYDA 3BSNA 4PYDA 3A3NB 1RYRA 1PBAA 2HFOA 4FXWA 4P2SA 3C16A 2OFHX 1UVIA 1HA1A 1JKHB 2DR6A 4GO7X 2DHSA 2F8MA 1UP1A 2YBVA 4C8YA 2FJEB 3LPYA 3VGTA 4LF6J 1CULA 1WC4A 2JEIA 3U02A 1UMJA 2XMWA 2PMHA 3DM2B 3S6EA 1IBLJ 4WZMA 1CS4A 4C8KA 4B3RF 1FD8A 2BM0A 1SJRA 1SC3B 3W61A 2N82B 2HBZB 4DR2J 2JSXA 3F41A 3CIZA 1WSRA 4NCGB 4ZPCA 4K59A 5HMXA 3PHEA 1IR1A 1MMNA 3DGPA 3V5RA 4IO9Q 4ED7A 4WYLA 3KLEB 3CXCR 1RT1B 5C24B 1F60B 1R8AA 3I0RB 1YJUA 2ACMA 2V5HG 4URSA 2XMVA 2IVMA 1NJIT 1FKAF 3H0PA 1AZSB 2OSRA 1EIYB 1QAYA 5EDWA 4A8YA 4PWUA 1PAEX 1R31A 4USVA 1VISA 3RRGA 3FZBA 3OBIA 2HFSA 2WW4A 4NCAA 3PVXA 2G4BA 4LUBA 3GSDA 2MHNA 2YNGA 1K8AT 1U24A 2LFVA 2Z2YB 4OZ3A 3IGNA 1MNEA 2L48A 4QR2A 1ZAVA 1MW7A 4YUDA 4ZCMA 2VQEJ 3PW0A 3TYTA 3TJ8A 2R2UA 2LQ9A 5I3PA 3P5BP 5HLFB 4C3MA 1Y0HA 2KRRA 1PILA 3HF5A 4PAAA 1JLFA 2MKCA 2KG0A 2Y1IA 4U7UD 3NGTA 1C1BB 2B4OA 1RA6A 1JNZB 2APOA 2H48B 2YNHB 5KG0A 2CZ9A 1WF2A 2ZKTA 3KLFA 3H98A 4M5MA 5KFRA 1U26A 1HBNB 2K7KA 4IH5A 1FRLA 4WFNQ 1QVGR 5ETQA 4OLOA 1NLKL 1UWBA 2B43A 2CJXB 1XR7A 2P8IA 2QG9B 1WEYA 2XHWA 3KUHA 2CXEA 4R8UA 3EPIA 1U1QA 1KDNA 3DCAA 3N6LA 4DPUA 4ZLNA 5IT0A 3MEGA 5I3UA 1J5OA 2L08A 3RUBL 4P73A 3G6VA 2MTLA 2UUTA 4I0WA 1BUXA 1SL0A 1XK8A 3HZEA 4ECSA 3E01B 3LAMA 1XNQJ 1QSSA 2DNZA 1S1XA 3AD8C 3AOCA 3MM8B 5HK4A 2Q1LA 2VV5A 4M5IA 3TZYA 5IQ6A 3Q23A 2XYHB 4ECRA 3I82A 4M5LA 4ER8A 2ERRA 2Z0GA 3CJTA 4AT1B 4N47A 2FVQA 1UFKA 4P72A 2CPDA 3KK2B 2X3DA 3ENAA 4HTJA 3CCLS 1J2VA 1HWIA 4LSNB 4NXMF 2UVWA 3P6YC 1ELOA 4CLUA 1T8EA 3VAJA 2VFVA 3EVOA 4WE1B 4V1Ak 3IBWA 1PYOB 2FHMA 4YB6A 4YY3F 1RXOB 2RIJA 2MKSA 3HZGA 4FVCA 3UN5A 1IUJA 4DSFA 4NX9A 4OZ0A 3CJKA 4NLWA 3VQSA 2J0SD 3CNQP 1CBKA 4KTQA 1YBUA 3QAEA 3OFHA 2EEYA 1HI0P 3EWGA 4X65F 4C9DA 5D0HA 2KHDA 4FNIA 3W8GA 4CH7A 3BB5A 2AGQA 3KHRA 2BYCA 2HKEA 2Q66A 2ROGA 2CG8A 2YNFA 1F5CA 1RAEB 2JWNA 2CVEA 3M2VA 4CNYA 3WC2A 1KLMA 1RABB 3D28A 3SIPB 3ILIA 2Q79A 5KFAA 2YPZA 2C22A 3OT9A 2EXUA 2O5DA 2VBXA 4HH1A 4RBVA 3W9HA 3CCWA 1NMEB 4ED1A 3E51A 2YWKA 4CYUB 1PKUA 5HROB 2GO8A 2CNOB 3D4JA 1TZ0A 5KFVA 2HHTA 2NPIA 2VBZA 1RAJA 3HKZD 1NK6A 2QA2A 2X1BA 3R5CA 4QWBA 3DI6A 3SEOA 2EKNA 2WVFA 3G87A 4TNOA 3J80U 3C46A 4V19J 3VAKA 4RW6A 3OL7A 1GQEA 3HSZA 3BBBA 4GC6A 4WK3A 5GAHI 2R8GA 2IJFA 4F4AA 2OPQA 1VK3A 2XMTA 3CWJA 3DOKB 5T41A 4EWTA 3GV7B 3BQ1A 1U6BA 3THVA 3R2CJ 2EKYA 4LBPA 3NXZA 3UN2A 2VOOA 5IZHA 2BW7A 3DKDA 4KYZA 1W7WA 2DNHA 1RAIB 2DGUA 3BN7A 3HFZB 2W9CB 4R5PA 1RHRB 2A6MA 3H90A 4YP3A 2O1PA 2DEJA 3I0RA 2MJNA 2HZAA 4P7TA 2R8IA 3NY0A 2FLPA 4CLTA 4DPTA 1AZSA 3MECB 5J2NA 2EWHA 2VKRA 1SQFA 4A4JA 1LWEB 2N3LA 5KG1A 2MKYA 1WEXA 1BQMB 1HW9A 1XMBA 2CQ2A 3IM9A 4MIBA 4NOHA 3MPWA 4TVAB 5T7LB 4CI0B 2KHCA 2AJ0A 3CULA 1O5JA 2E7WA 2KXNB 3RB3A 3HJFA 4B3MJ 1RA7A 3QGPA 2A0FB 1DTQB 2VKZG 3F73A 1HNIA 3CJ5A 1K1SA 4LFCJ 1XEZA 2DNOA 1D3WA 3AJDA 3G82B 3JSBA 3KUEA 4LRFA 2QA4S 1OSCA 2BQUA 2V9WA 2SXLA 5DG8A 4UY85 2HSEB 4B3OA 3KWMA 1HBNA 1S6QA 3NS7B 2IRYA 1URRA 2OPRA 1BMQB 2DGXA 2HEKA 3ZZPA 4LF4J 4X64J 4WF9Q 1RTHA 3MTKA 2VG5A 1T9XA 2VC0A 2JLGA 3RR8A 2VICA 1RYSA 1EQ0A 3M1VB 2C42A 1PYTA 2K06A 1S10A 3A8EA 4FDFA 4ENOA 2OI2A 4P52A 1OY9A 4PG8A 4DEZA 3ETMA 3T1AA 4ZLPA 3TW0A 3ADAC 3F0NA 4MK9A 3O8WA 1ZOTA 5HP1B 2ZD1A 3KNAA 4I2PA 4WIQA 2CFXA 3AQOA 3TARA 1JJ4A 2NS1B 3MM9B 3G6XA 1Q8IA 4LF5J 2E1MC 1A0OB 4H4MA 1MSWD 5ETTA 1NJXA 3SCJE 3UQSA 2ALYB 3KMSA 3KOAA 2R7UA 4DR4J 3KLIA 1UEUA 4B9LA 2B56A 3ETOA 3DLHA 3T6JA 1YX2A 4DOZA 2DRBA 3NBPA 2VFUA 4ID8A 4JI2F 4P6QA 4Q0BA 3GONA 4IG0A 1CLFA 3AA8A 4EU0A 2QX0A 3B54A 4OYPA 4QW9A 4DG1B 4PXBA 4Y0FA 1IJEB 3NGDA 2FLOA 4S0MA 1Q53A 4DFKA 2FC8A 1UJ4A 2NXCA 5CHCB 3H4DA 1TTHB 2WONB 1S72S 1S1WB 3PACA 4F26A 2DVIA 2MY8A 1R7IA 2DH8A 4LRDA 2OH2A 3M7VA 3KJQB 3KJFB 4FNHA 3HX9A 2Z2ZA 2KVQE 3K58A 3GQCA 3OSPA 2BM1A 1CJUA 2O3DA 2HNZB 5J2PA 2C3PA 2ZITA 4C8ZA 2CZ4A 3AQPA 4CLYA 3NNAA 1N32F 4AQYJ 2G9OA 4F4WA 2KZZA 4ES3A 3NGKA 1NO8A 2HFUA 1FI4A 1HWKA 3CJSA 1GMVA 3NOGA 3MZIA 4OV6A 3TZWA 1B70B 5HAOA 2YKMB 2RB7A 3H7HB 2P5VA 1VQNS 2XZTB 1WHYA 3NGRA 4I67A 2NZ4A 2LYVA 2BRLA 1KONA 3KK3A 2XNQA 2PE8A 3EYZA 3GCWP 1VRQC 5G0RB 4F3MA 4UT4A 2MEWA 3UPFA 1RTZA 2X1FA 1HQUA 4OYBA 1IKVA 1W2IA 1FNXH 3TOQA 1S48A 2RDDA 4MFBB 1VRUA 3OHAA 2OIHA 4UF4A 3DLJA 1YJRA 1Z2ZA 2W7AA 3ZO7A 4E98A 2DNNA 4UOGA 1YBAA 2DY1A 4ED6A 3LAKA 2RQMA 2NYHA 2PN6A 2ZBPA 3N9UC 3ZZYA 1Q79A 2AYMA 2VD3A 4ID5A 2YKPA 4LT6A 5AXLA 3MMBA 4R0JA 5K9FA 2F9DA 2GAGC 4Q2LA 5BXIA 5K8NA 2C3MA 3GIJA 3WHIA 3VAHA 4O4RA 5D4PA 4M5JA 2ZH8A 5E5NA 1WG5A 4WE1A 4LF7J 1REGX 4DV4J 1CS4B 1BQMA 1HYSA 1T0TV 1TL5A 4DMZA 4MJKA 4DZ6A 2CQGA 3OXLA 4A8WA 4LF8J 2Y9HA 1X31C 4ECQA 1RWPB 2XSJB 2EG2A 3FBBA 3I0SA 3KHLA 3FSXA 3M30B 3CC2S 1DTQA 4AFFA 5L1IA 4ECTA 4KO0A 1WKLA 1K0TA 1LQ9A 3DGPB 3GIMA 2UXCF 3RB0A 4DX5A 3KJNB 1JB0C 4TY8B 1FTRA 1RT1A 1UVNA 1S4EA 2CYYA 3DU6A 1DRZA 4I7FA 5LMNF 1FRXA 3HHEA 1FCAA 2D41A 3EPGA 2DPJA 4L73A 2QL9B 3PRDA 3WBZA 2ZH7A 2HRYA 1VQLS 4YDDB 4DR7F 4FN5A 4ZVEA 4N77A 4OJ3A 4C11B 2HGLA 4EBCA 2BR0A 5DG7A 4U7UK 5SZTA 3K57A 4W92B 1H72C 3MR2A 5F41A 5M2PA 2MZ1A 1DQ9A 2DXDA 1CJKA 3MM5B 2HPUA 1NSPA 2O01C 3O1LA 4RPFA 3GMGA 1GH8A 2FPHX 4U9RA 2FHJD 4DR3F 5HP1A 2MZJA 4CCHA 2KDOA 1SBRA 1JLQA 2LLZA 2C3YA 3CDUA 3FNNA 1VLYA 3DXSX 3BDPA 2P9CA 1JQGA 5HATA 1RB0A 2KVIA 3D1HA 3MEKA 5DO2A 4AUKA 4CO1A 3A3PB 1N34F 3BGUA 1UKUA 2HHXA 1LW0A 2VDIA 3C6TA 5RUBA 4PWDA 5A8WB 3M8PA 4URQU 4EO8A 2MKKA 3H40A 2BABA 1XQIA 2HRTA 1Z1ZA 1QAJA 3HSGA 4Y2IA 3DRYA 4R5PB 4CH1A 2FJXA 2IDEA 3C6UB 3M6VA 5L46A 3MD3A 3V4MA 1DTTA 5B7WA 1JXEA 4QR1A 3QJJA 1JLEB 2QMWA 2DNKA 2AU0A 3NKYA 5AJ3F 1V5IB 1GXLA 3BM7A 3MECA 2IRUA 1R6YA 5J2NB 4O4GA 1KOOA 3Q8QB 4TLRA 1BY9A 2KM8B 1RHUB 1WTFA 1KWMA 1JLCA 1S1VA 3BR8A 4BDPA 4ZP6A 2CQIA 1IQTA 2V8VA 3UD4P 3C14B 3TA0A 5JVHQ 2XI3A 1QE1A 3NCQA 2DR8A 1T11A 4J9SA 1CJUB 4XPEA 2H9ZA 2OAUA 2XO6A 2DH9A 2IHR1 3CPWR 1PGZA 3LTOA 4ILMA 2DD8S 2XGPA 3AH6A 1I51B 1G6BA 3OFFA 4J91A 2HQ3A 3ONQA 1VQ4S 4X62F 2V2QA 4LR7A 3TX0A 2JL9A 2OUGA 3BZQA 1R8PA 4PXCA 4A47A 4RLEA 4PPDA 3MD1A 3QFHA 1VIOA 2VPYB 3NS6A 1QSYA 4CLPA 3TUIC 5MAOA 4GKKJ 4QYZJ 1M5HA 1RTJA 1ZZFA 2LXUA 3OLBA 5DG9A 4USMA 3S7RA 1E6VA 1YG0A 3TA1A 1U7LA 2DGWA 3KLFB 1XC9A 5BR8J 1HBOA 2QSFA 1WC1A 1OPZA 2CNKB 4OV1A 2COLA 4EYHB 3KYLA 7AT1B 4KV8B 2I5JB 1RDRA 2YQ3A 8ATCB 1IM6A 4ANDA 3FC9A 2HBQB 3MM9A 4HVZA 4CLSA 2Y1JA 2R7RA 4OX8A 2M7SA 3BN4A 1UETA 2MDAA 1S99A 4JB8B 1RK8A 2M9KA 3W2WA 3W2VB 3EZ5A 4DFJA 4JI0J 3ET6A 2MGZB 4JI4F 3A1YG 1YJTA 3SQGB 3QO9A 3W5ZA 1H2TZ 5M2UA 2CQ0A 4JI1J 3WDOA 5B0DA 2NQPA 2KFNA 2KXHA 3EMTA 2A2CA 1TKZB 4KR0B 3VZHA 4JI3F 2HK3A 2R8HA 3QRRA 1FK9A 3CDAA 4NLGA 2RJZA 2VIHA 4GC7A 1B7FA 2QN6B 3FRZA 1WHWA 2B7CB 2OPQB 3X1LB 3MUMP 1U47A 1UA1A 1S12A 4BBYA 1HWLA 2LEAA 3PTWA 3M30A 3M6UA 3NAHA 4LR8A 4X66J 1AUDA 4KO0B 4TLQA 3L09A 3M9NB 3B82A 3TAQA 1PC5A 3IN5A 3MURP 2F1FA 3I96A 2G2YA 3ZZTA 3CMQA 1XMOF 3NL0A 2EC0A 3EX7B 5A0YB 5B0GA 1NEEA 5I4MA 3A8IA 1N5YA 2K2PA 4NPOA 4NLQA 5DJBA 3CCRS 5IWAJ 3C16B 3TR5A 1JKHA 5C2GA 1RCOB 3IRXB 1WHXA 3HVTA 3HVRA 4DV5F 1NK0A 2ZM6J 2IBKA 5KG6A 3I5BA 2ZM6F 4A8SA 1R0BG 3UR3C 3KK3B 3MR7A 1U2RA 1MWYA 1QTNB 3QT6A 3VAGA 2PA8D 3MM6A 5A6WA 1VHIA 5BYRA 3EICA 1F5AA 2XMAA 3D66A 3HKWA 1T9UA 2JFDA 1GTHA 2XS5A 3HD2A 1FRJA 1VQSA 2V6AA 4LJMA 3G8SA 2K3KA 2KB2A 2BOPA 1FKOB 4F4YA 4DSEA 4IFVB 2G1DA 4I4BA 1T05A 2DNLA 3T41A 3QIDA 2RAQA 3M1VA 2YVSA 2LA4A 2MLZA 1KQFB 2ZH5A 3T3FA 4RNMA 1BLUA 1NSKL 4IRKA 4HYKA 4X4NA 1FXRA 1RWOB 2LDYA 3DYAB 4J9UE 3RBZA 2EFGA 3KLGB 2LDIA 4IOAQ 1QAXA 1IJFB 1S6OA 1BXNA 2HS4A 2LQBA 3CJ8A 4HEA9 4YB7A 5KFPA 2CADA 2MJUA 4TY9A 4ZPWR 1SC4B 5KG4A 3PCOB 2IVFB 3OXFA 2YNGB 4NE9C 2Y0SD 3R9LA 3ISNC 3JQMA 1ROFA 2EFQA 2IDLA 3T9ZA 3VGVA 5CABA 4DSJA 3GR0A 2PFDA 3IS9A 4OIXA 4USHA 4A48A 1VGYA 3RZAA 1RAGB 2EPIA 2O67A 2ZWOA 2JX2A 2RMLA 3GYXB 1VMBA 1OJ4A 1K44A 4DG1A 3RYLA 4I64A 2B9WA 3TO8A 3ZTSA 1AUSL 2LVWA 1WC0A 2QFIA 2YQ1A 3H20A 2GIQA 2VUGA 5F8GA 2MQOA 3GG1A 5KOXA 3H4BA 1PAUB 1H6KX 4DS4A 3O5TB 4KB7A 5BR8F 4KHMA 1M5PC
chains in the Genus database with same CATH topology
2XM3A 2A6MA 2XQCA 2F4FA 2VICA 4ER8A 2VHGA 2VJUA 2XO6A 2VIHA 2VJVA 2F5GA 2XMAA 2EC2A 2FYXA 2A6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM3 A;  2A6M A;  2XQC A;  2F4F A;  2VIC A;  4ER8 A;  2VHG A;  2VJU A;  2XO6 A;  2VIH A;  2VJV A;  2F5G A;  2XMA A;  2EC2 A;  2FYX A;  2A6O A; 
#chains in the Genus database with same CATH topology
 1Q8L A;  4OI3 A;  4RNN A;  2RHQ B;  1S6P B;  1ZM2 A;  2J9C A;  3BJY A;  3D5M A;  3MDF A;  2F4V J;  3GII A;  4ZVO B;  1FF2 A;  4KHR A;  1M1K T;  4LF8 F;  3I9Z A;  5CZV A;  3OW2 R;  4WKR A;  1LOU A;  2LEC A;  3TVY A;  3OSN A;  1RKI A;  2FZC B;  2KKH A;  5F3T A;  2CJY B;  4ZPB A;  4RO0 A;  1TKX A;  2FJB B;  1HD1 A;  1EB0 A;  1WWH A;  2BKN A;  2J8S A;  4L3K A;  2QRR A;  4DV0 J;  3LWL A;  4RNO A;  3OL9 A;  2GHW A;  2HBR B;  1C0U B;  1RWV B;  3K17 A;  5CYJ A;  1I94 F;  4OQJ A;  2YH1 A;  1WAC A;  4GVL A;  4IG3 B;  5F3Z A;  1I6J A;  1M5K C;  4URG A;  1KP6 A;  3AT1 B;  1VQP S;  1ZET A;  1N88 A;  2FY8 A;  1H7X A;  2R7Q A;  4CLF A;  4TKT A;  4FBU A;  2V9K A;  1LFW A;  2HVZ A;  3CJ2 A;  2RS8 A;  2FZK B;  3B4D A;  2BE2 B;  1NBE B;  3C6U A;  3Q22 A;  3CTR A;  5LM7 E;  2HND A;  4UOC A;  2HHS A;  4XDC A;  4B3S J;  4D3H A;  1U49 A;  2J6U A;  4ZIV A;  1FDA A;  1FO1 A;  2D1C A;  2RF2 A;  2EG1 A;  3WIU A;  2FQQ B;  1RE1 B;  2GMJ A;  2V50 A;  1HHS A;  3JXO A;  3HLU A;  4PQA A;  5E2Q A;  2BQR A;  1WC6 A;  2YWE A;  3N01 A;  5C42 B;  4OX7 A;  4MIW A;  3FSI A;  1VQ5 S;  1S59 A;  3KUG A;  4J9K A;  2QL7 B;  4IQM A;  3KKF A;  1KEK A;  2XLK A;  4QYZ K;  3LGN A;  5KFQ A;  3UDV A;  1OQ3 A;  2HMI B;  5H9E K;  2AX1 A;  1FRH A;  1D8Y A;  4CNZ A;  1B0P A;  5IV3 A;  3F44 A;  1ZH5 A;  4CM2 A;  4JI1 F;  3KXD A;  1KQK A;  5L9X A;  1SQE A;  5KT6 A;  5AJ3 J;  4DSI A;  2PO4 A;  5K8M A;  2HVD A;  1HFE L;  2WVE A;  4WXW A;  4X4Q A;  2G13 A;  4A8Q A;  1UVL A;  5IT9 Y;  4NI2 A;  3RU0 A;  5J2Q B;  1NU4 A;  3Q8U A;  4TY8 A;  4UTG A;  3S01 A;  1Q78 A;  2OEL A;  3CJ4 A;  2HZV A;  3DLK B;  3HJV A;  3SDE B;  1ZTW A;  1L5U A;  4JYA F;  1HNW F;  3O44 A;  2IAJ A;  1QSL A;  3M32 B;  2NUH A;  2CQH A;  1P8G A;  2CPJ A;  1FKO A;  3W63 A;  3QIP B;  3QT7 A;  2GNK A;  2JZ5 A;  2QYC A;  1T05 B;  4UUW A;  3EJM A;  3FFI A;  4I56 A;  2ZH9 A;  5B0E A;  1PC4 A;  3CVK A;  3D0H E;  2RU3 A;  4DR1 F;  4F2S A;  4GKJ F;  4JI0 F;  3TAN A;  2E5L J;  3U1N A;  3MM5 A;  5A6P A;  5F8H A;  3E8O A;  3EUN A;  4QWC A;  1UA0 A;  1VBY A;  5IC4 B;  3OR2 A;  2R9L A;  1G7C B;  1RBL A;  3FEZ A;  5CA5 A;  2R7W A;  4NZ6 A;  5IQQ A;  3KLG A;  4DV2 J;  2UVR A;  3R2D J;  4K4V A;  4C98 A;  5C25 A;  2RQK A;  4MKY A;  3HCX A;  2H65 B;  1NKB A;  1WHV A;  1FK9 B;  5FLX Y;  3CC4 S;  1H0H B;  4I1T A;  4NLS A;  4EK2 A;  2GC8 A;  1FJG J;  4EEY A;  1HPZ A;  2ZE2 A;  4LFB F;  2RSQ A;  4WFX A;  4DL6 A;  4G3I A;  3TA2 A;  3VVU A;  3Q24 A;  3TI0 A;  3UVJ A;  1QVF R;  3G82 A;  3V4I A;  1QY7 A;  3D7S B;  3AY0 A;  3US5 A;  4NYZ A;  3GG0 A;  4KT0 C;  4NLR A;  2VG6 A;  4CTA A;  1NSQ A;  2C28 A;  4KGM A;  5AXK A;  1FXL A;  5B0C A;  2BJ1 A;  5DDP C;  3R6G B;  4I6A A;  4OX9 J;  3D6F B;  2FZG B;  5LJ3 Y;  2DNY A;  1REV B;  5CQG A;  3MPU B;  4OI2 A;  2QMU B;  4ED3 A;  1L3T A;  3EGN A;  1FER A;  2NLW A;  3IAS 9;  1RSC A;  3HVT B;  4ED8 A;  4WBF A;  2QLJ B;  4DPX A;  3CF5 Q;  5HQ8 A;  1HNX J;  2XTJ P;  2YWH A;  2ACY A;  3EGV A;  3MWB A;  2J76 E;  3ULH A;  4JI8 J;  2HHH J;  4J9L A;  5HSP A;  5D78 A;  1ZPV A;  1NJW A;  2KRB A;  2KXF A;  3MM6 B;  4QIG A;  2D7S A;  2ZZT A;  5DQI A;  2XCA A;  4O3Q A;  2VQF J;  3PHT A;  2E5H A;  3H2V E;  3MCN A;  4ZA1 A;  2BVZ A;  3C66 A;  5GAE U;  1SI9 A;  1N5V A;  2XWY A;  3OR1 A;  1UWB B;  4AYB D;  5C2C A;  4GKJ J;  1G3O A;  2K7J A;  1OWX A;  1EET A;  1HIY A;  1RWU A;  4R8U B;  3HHL B;  4X4P A;  3QSY B;  5ETM A;  1QAI A;  4DUY J;  2HZC A;  1IXK A;  1E6V B;  1SC1 B;  2AKW B;  4JUZ A;  1U6F A;  3W64 A;  4ZN1 A;  4YR2 A;  2RUG A;  2HND B;  2Z30 B;  4XAK A;  1XMQ F;  3KG1 A;  4ZJL A;  1TKT A;  4LF2 A;  2GVD B;  1GXU A;  2IPO B;  3DFE A;  2HUR A;  3QAU A;  3W66 A;  1LXJ A;  2E7V A;  3I5A A;  4KV8 A;  3NNH A;  1RWK B;  1CJV A;  4TXS A;  4C8M A;  1VQ6 S;  2R8K A;  3CJQ A;  4OHW A;  5EUH A;  2IRX A;  2RT3 A;  3FK4 A;  3I56 S;  4MKV A;  1A9N B;  2BX6 A;  4CRJ A;  1UCN A;  2PDA A;  1VFJ A;  3UNY A;  1WKJ A;  2BDP A;  3HHK A;  1UZD A;  2V69 A;  2A6O A;  1TV6 B;  2JVO A;  1SL1 A;  3PYE A;  2CPE A;  5K8P A;  2HMI A;  3RAQ A;  2N4D A;  1X4H A;  2V94 A;  2FY1 A;  1NKC A;  1NUE A;  5JJB A;  2AGO A;  1YIJ S;  2E29 A;  2YNI A;  3DRR A;  2J9D E;  1KOH A;  2ZNY A;  4RJV A;  5DS7 A;  3H5U A;  3IGV A;  3ISZ A;  3OTC A;  3ZTP A;  4PCQ A;  5GAE I;  3JSM A;  1U25 A;  2DRA A;  1CEZ A;  3MEE A;  2MYF A;  5E3P A;  1NKE A;  5CZX A;  5CCM A;  1YRX A;  3M8Q B;  4WKY A;  3MR5 A;  2V2K A;  5L8R C;  2HAF A;  3DGV A;  3JQJ A;  1NPK A;  2QJ3 A;  4RU9 A;  3QT8 A;  1F6T A;  2FVR A;  2J6S A;  2H54 B;  5LL6 d;  1ITP A;  2M3D A;  5IC6 B;  2R2R A;  4CO2 A;  1RAA B;  1HD0 A;  2GHP A;  2CPZ A;  3DHW C;  1ZTT A;  5KT5 A;  3DDK A;  3CCE S;  5HQM A;  4HHJ A;  4DR4 F;  2HHW A;  2JC0 A;  1U45 A;  2C2K B;  3C3L A;  1ZAW A;  3ELH A;  5DZ7 A;  1UFW A;  5LSL A;  1TUW A;  2P6T A;  2IBO A;  3FBC A;  3IO1 A;  4RW8 A;  5J1E A;  2VDH A;  5KG2 A;  2I1R A;  3GSI A;  4WFZ A;  3ZZU A;  2XGQ A;  2UXD F;  2AQ4 A;  4ID5 B;  1FEH A;  1IBM F;  4IG3 A;  4QIW D;  4Q44 A;  1RT2 A;  4UQG A;  1F9H A;  4ECV A;  2BEF A;  1MML A;  4QIF A;  2XZD B;  2PEH A;  3CT9 A;  2GS8 A;  1FRM A;  3JTP A;  4RW6 B;  3WX8 A;  3ZZZ A;  4LBH A;  3EE3 A;  4FVM A;  4NRT A;  4XTT A;  2GIR A;  2F8E X;  2E5J A;  1HL6 A;  2WSF C;  3DXB A;  4OFZ A;  5D0G A;  5KAK A;  2DK2 A;  3TQ1 A;  2F4V F;  3M2U A;  4O0N A;  2MMY A;  3JSY A;  4J9M A;  2XHC A;  4BCA A;  4FPR A;  1SCJ B;  3P96 A;  4MIA A;  2R7X A;  2BV3 A;  3RBD A;  2PEB A;  4DL7 A;  2UUB J;  3FJ2 A;  1VI7 A;  4FS2 A;  4X62 J;  3RTV A;  3V6K A;  3OLA A;  2HW3 A;  4CO3 A;  1DUR A;  4QYR A;  3IG1 B;  3CD7 A;  4ZIW A;  2Y1R I;  3I31 A;  2W24 A;  4OYI A;  2ILZ A;  4DX8 H;  1VBX A;  2KYX A;  1XNR J;  2F8H A;  2KFZ A;  1RUS A;  1Y3J A;  2B4V A;  1VJW A;  5FD1 A;  2BKO A;  4IH6 A;  5B09 A;  2XM3 A;  2M88 A;  4C0H A;  2WW8 A;  2JJ4 D;  2E1C A;  4MMO A;  1VC6 A;  3HHL C;  5L9N A;  2E44 A;  2IY5 B;  1KVI A;  1RTI A;  3H2U B;  2E66 A;  3T1H F;  2ABY A;  2DIT A;  1CUL B;  1M5O C;  3QYY A;  1TFY A;  1LEO A;  1SV5 B;  1TL3 B;  1FRI A;  5CYQ B;  4ZPD A;  1JLQ B;  5HQL A;  2ZH2 A;  1YZ6 A;  4NI2 B;  1S9E B;  2DPI A;  2NXJ A;  1D9D A;  2MLX A;  2KH9 A;  2ATC B;  4NRU A;  3MOJ B;  4TN2 A;  3H25 A;  4DCP B;  1LW0 B;  1JMT A;  2H5E A;  2HIQ A;  3R3T A;  2MKI A;  2XY5 A;  5B0B A;  3MED A;  2E1R A;  2YWW A;  4M8L A;  1RT6 B;  2DYA A;  3SQO P;  2JEG A;  3OFE A;  2EFO A;  2V2V A;  1H7W A;  4ZK7 M;  5J2M B;  4M5H A;  4EZ9 A;  1TK5 A;  4F02 A;  2ROE A;  2WOM A;  4O3O A;  3QPI A;  2HQG A;  2LKZ A;  5D15 A;  2AD9 A;  3IMQ J;  2E9R X;  4DN9 A;  3BPS P;  1M1H A;  3NLC A;  5KFW A;  4KGX B;  2GFF A;  1UL3 A;  1TEL A;  4OZ1 A;  4PG6 A;  2BXJ A;  3ZTR A;  5KFE A;  3QBC A;  2DNG A;  4Z37 A;  1TL7 B;  2PD1 A;  4MTP A;  5HBM A;  5KG5 A;  4AXJ A;  4CH0 S;  4OZ2 A;  3J7Y I;  2L41 A;  4C0O C;  1M1G A;  3HHL D;  3IR6 B;  3QNW B;  3BSA A;  5F8L A;  4A8K A;  4WII A;  5CCL A;  3D9B A;  2DHH A;  5HVG A;  2PT0 A;  2XLJ A;  2RUS A;  5LXR A;  1FX4 A;  2UXD J;  1YQH A;  1BHN A;  3N0V A;  2VOD A;  1TL1 A;  1CVJ A;  5H9F K;  1VC0 A;  4KHP F;  4IH7 A;  1D1U A;  4ZVF A;  1JLF B;  4IOC Q;  3UI3 A;  2XYG B;  3MM7 B;  4LFA F;  1XN9 A;  1TMM A;  4O3R A;  1KTV A;  3L4B C;  1FXD A;  1YSJ A;  4GRS A;  3C19 A;  5D6G A;  4DR1 J;  4RUB A;  2QA4 G;  4EBE A;  1AFI A;  1SB6 A;  4FF3 A;  1OYE A;  3KG0 A;  4ED0 A;  4JI5 J;  1S76 D;  1T9Y A;  3NMR A;  1B4S A;  1HMV B;  4OYW A;  1OQ6 A;  5H9E J;  1K9M T;  4OZ5 A;  1FJC A;  1DY3 A;  5E3C A;  2ZC3 A;  1KQG B;  2OEJ A;  2XI2 A;  5H9F J;  1GEH A;  1Q86 T;  3GCX P;  4DL0 C;  1S0V A;  2QSW A;  2RU9 A;  5HJY A;  3T6B A;  3R8Y A;  3GJS B;  3VCD A;  4ECX A;  3E2E A;  4AL5 A;  1RQ0 A;  4FF1 A;  3GE9 A;  4JI4 J;  3SV3 A;  4CWB A;  2I2Y A;  2KTQ A;  3RAX A;  1WUU A;  2VA3 A;  1R6V A;  2GW8 A;  3QQC D;  2YKM A;  5KFF A;  1WTB A;  1QD1 A;  4QWE A;  4LSN A;  2MGZ A;  2XY7 A;  4CT9 A;  1RT2 B;  3UD3 P;  5B0F A;  2ZC4 A;  1RJJ A;  1KNZ A;  4N56 A;  1RIS A;  4K7Q A;  3BQ0 A;  1FTC A;  3SMZ A;  2FC9 A;  2ZVS A;  1X4E A;  1FE4 A;  3OD2 A;  5K14 A;  3GV5 B;  2HYI B;  2E1A A;  2XZW A;  3RJM B;  3D6T B;  4XDD A;  1BQN A;  2CPH A;  3NEK A;  2JDJ A;  3R7N B;  4F3Q A;  4PUO A;  4NCG A;  4RW7 B;  5KFX A;  5D0R A;  3W1Y C;  2HVI A;  2HWH A;  1FJG F;  3D1O A;  3W8P A;  2LQ8 A;  3TJ9 A;  1DLO A;  3VZI A;  4FKY A;  4JBC A;  2RQ4 A;  4PXD A;  3WC0 A;  1Q82 T;  3KLE A;  4LF9 F;  2CJA A;  2GX8 A;  1WF0 A;  4CLW A;  1SVD A;  2PMZ D;  1HQE A;  1I5O B;  2EK1 A;  2B8Q A;  3TP2 A;  1Q0N A;  4NWB A;  3CME S;  1YVF A;  3K5P A;  4NYP A;  3V81 A;  3J7A 1;  3J7Z T;  1YLX A;  1YRU A;  2ZOM A;  4RUC A;  2KU7 A;  3EM1 A;  3QZ8 A;  3NWG A;  1H38 A;  4KRW A;  1B99 A;  2LXI A;  4OZL A;  4P74 A;  3KFW X;  5KFZ A;  2HLT A;  1V6H A;  3POT A;  1Y11 A;  2BA9 A;  2R3V A;  2HAI A;  4OHV A;  4PZV A;  5JXS A;  3ZZR A;  1RKJ A;  2VBY A;  1C1C B;  5H1S V;  1S1U B;  1V3S A;  4NXN F;  1IBC B;  1MG7 A;  1EZZ B;  1V3R A;  2JLE A;  1IWA A;  4UQT A;  3MAA B;  1FKP B;  4I7F B;  3R5B A;  3IC1 A;  1T9T A;  3IR5 B;  4LF4 F;  2ATL A;  2R7O A;  4QOT A;  3AOA A;  2WAQ D;  3PEJ A;  5AXM A;  5E33 A;  1U1N A;  1NAQ A;  3BO2 A;  3SI8 A;  4LFA J;  1NHV A;  1IKY B;  3M8Y A;  5J1E B;  1V3Z A;  4KC5 A;  1RT5 B;  2OMO A;  2ZFH A;  2HS0 A;  4W4M A;  3S1T A;  3MCS A;  5F8N A;  1F2G A;  4FF2 A;  1JNR B;  2Z57 B;  4OZN A;  3R7S B;  4WFY A;  1KLN A;  3K59 A;  3HVA A;  4JYA J;  2C2R A;  3R6L B;  7FDR A;  5T7L A;  2X1G A;  2ASL A;  2Q6B A;  2ZVI A;  1SH3 A;  4OJH A;  3KK2 A;  4N76 A;  4TQS A;  2KT3 A;  1BE4 A;  1HLW A;  2GO9 A;  4QWD A;  2HHQ A;  5L39 A;  3BGR B;  4PWD B;  2B9E A;  1V5V A;  3RBE A;  2CQB A;  3OPK A;  4QQB A;  4EMD A;  1EET B;  3FQK A;  2GVZ B;  4HKQ A;  1L3V A;  3GTY X;  5ADZ A;  1H74 A;  1S1T A;  2E1P A;  1N52 B;  2FVC A;  2OPP A;  1FA0 A;  3JSR A;  4XO0 A;  4B3O B;  1NZ8 A;  3PR5 B;  3VAI A;  4K4T A;  3ZNJ 1;  1Y5I B;  2N7Y A;  2NZC A;  4N7T A;  2FGC A;  4QWA A;  1VQY A;  2PI4 A;  1X60 A;  1UW9 A;  4FYV B;  3ZTQ A;  4YR0 A;  1RTH B;  1YJW S;  4TU8 A;  1KC8 T;  3D68 A;  5KFS A;  2V34 A;  1S6P A;  2QO3 A;  1C4A A;  3G8Q A;  2UUW A;  3L7P A;  1QE1 B;  3VAL A;  2WK4 A;  1RTI B;  1CC7 A;  2YPY A;  4U8V A;  4OI0 A;  3T1H J;  2KM8 C;  4DSK A;  1RHM B;  3AD7 C;  4PG5 A;  4B9N A;  3UCG A;  3RGI A;  1FHT A;  2WB1 D;  4DF8 A;  2V8D A;  2EFV A;  3N5B A;  3GV8 B;  1HNX F;  2A10 A;  1C1B A;  2JH3 A;  3AB2 B;  3B8H A;  2W7P A;  4M94 A;  1Y7P A;  1R27 B;  4WCE Q;  1ZM9 A;  2DGS A;  3G2X A;  3KLI B;  3UNG C;  3OJU A;  2NR0 A;  2AX0 A;  3T1Y F;  1FEE A;  3TX8 A;  5IWA F;  4YN3 B;  4IDK A;  1Q95 G;  2PGC A;  2ZBR A;  1VBK A;  3CCZ A;  3MEE B;  4EO6 A;  2ALZ A;  4MT1 A;  4NYO A;  3HSD A;  4ZLJ A;  2BAC A;  2R42 A;  2LU1 A;  4F25 A;  5J2M A;  5K14 B;  3MEG B;  5I3U B;  3OV7 A;  4OJG A;  1XBW A;  4LSL A;  2IM1 A;  4BS2 A;  1RWX B;  1HAR A;  2W2P P;  1LNQ A;  3PO5 A;  3ILJ A;  4ZN3 A;  3BDE A;  5DLF A;  1EKR A;  4Q45 A;  3DNC A;  4MK8 A;  1ZM3 A;  2B4U A;  2NSC A;  2F63 A;  4RW7 A;  2HHH F;  2WVD A;  3MM8 A;  5E3R A;  3N4W A;  3BYR A;  1IM4 A;  3EDR B;  4KH1 B;  4P9S A;  2RKI B;  3JYT B;  3MCO A;  4ANC A;  4IRD A;  1VRT A;  4MYT A;  3IWL A;  5G4D A;  5HO4 A;  2FVS A;  3OTE A;  4QPX A;  4WPA A;  3K5M A;  1ARO P;  2OPS B;  2LMI A;  4LVN P;  3MMA A;  3L7U A;  4ZKA A;  3FZ2 A;  4MH8 A;  2JNJ A;  5B08 A;  1N32 J;  4DV0 F;  5ETV A;  3M9M B;  4RW4 B;  3DLE A;  3FEY B;  1NH8 A;  5KFD A;  4ECY A;  1P1T A;  3G86 A;  3ITH A;  3FDS A;  3B4M A;  4NZ7 A;  4ZPA A;  5ETP A;  4O0I A;  3QLH B;  3OUY A;  3TEG A;  2ASD A;  3CD6 S;  5J1P A;  1FNO A;  1R89 A;  2ZJP Q;  1R0A B;  1Q4R A;  2K1R A;  4OYM A;  1FJE B;  3PKY A;  1LWF B;  1PYS B;  4JV2 A;  4KPC A;  1K1Q A;  4B3M F;  3BKT A;  1Z2L A;  1X5P A;  3H59 A;  2OD4 A;  2HS3 A;  4MK7 A;  1N5Y B;  2V4J A;  1S6Q B;  4FPI A;  1KFS A;  4E0D A;  4NXM J;  3W5Y A;  3IAM 9;  4HI2 A;  1LKZ A;  1W26 A;  4HHU A;  2QTW A;  5A2Q U;  5A8K A;  4WP3 A;  1IBK J;  4GKK F;  2YKO A;  3M05 A;  1X9S A;  1ACM B;  3IRX A;  2IA6 A;  4EZ6 A;  4K4X A;  2YX7 A;  3M6W A;  3QSI A;  4Y34 A;  3DMJ A;  4KKO B;  5ETO A;  2OFG X;  1SV5 A;  1JX4 A;  2AZ1 A;  3ISN D;  1DQA A;  1S77 D;  3NCP A;  4ZJQ A;  1BC6 A;  2PMW A;  4OHX A;  1T3O A;  2D9P A;  4GVB A;  4USW A;  2W25 A;  1X4D A;  4CO5 A;  1F3F A;  2WZ1 A;  3BGO P;  5E7O B;  1E6Y B;  5EHH A;  2MST A;  5LMU J;  3V6H A;  1T03 B;  3UN3 A;  2B5J A;  2C2O B;  1IR2 A;  2CDR B;  4YS2 A;  5IT4 A;  2QIF A;  3ILO A;  2IC3 B;  1O0P A;  3GP9 A;  4Y28 C;  3MED B;  3D54 A;  3P45 B;  1HNV A;  2GVZ A;  5GME A;  3J81 U;  2OTL S;  3W62 A;  1S1T B;  2BE9 B;  3G6E S;  3AD9 C;  4JI3 J;  3DLL Q;  3K5L A;  2CDQ A;  1V9O A;  4N5S A;  2ZUA A;  2FLL A;  1AYE A;  2XG8 A;  3LP1 B;  5SUH A;  3UDC A;  5KOW A;  2BW2 A;  4LF1 A;  1RU2 A;  2F65 A;  1YK9 A;  3M8S A;  2R7V A;  4F4K A;  3CSK A;  3R27 A;  1CJT A;  4ZOS A;  4IFY B;  3Q86 A;  1TL7 A;  4E8U A;  2Z4P A;  2DGT A;  5AE2 A;  1YJN S;  2K8G A;  4G65 A;  4DUZ J;  1U1O A;  2VJU A;  1B0T A;  1SPB P;  1RT4 A;  1SKS A;  4DZD A;  2UXB F;  3TVZ A;  4QW8 A;  2MLY A;  2YKN B;  3IS9 B;  4DN0 A;  2CZV C;  2HNZ A;  1Q7L B;  1OIA A;  2YKQ A;  5J2P B;  4HAC B;  2KZM A;  2OEK A;  4XPC A;  3D6M B;  3D0I E;  3VWS A;  3J7A N;  1OY8 A;  3PEH A;  4DV6 F;  4O3S A;  2ZH3 A;  3NP5 A;  2MZQ A;  3MAA A;  4Z2X A;  2VB6 A;  1S0O A;  2Q43 A;  1RU1 A;  1CC8 A;  3HO1 A;  1N4L A;  1H2U X;  3W3S A;  3C6T B;  2M8H A;  4USJ C;  2RRB A;  3R5J B;  4OYZ A;  3ZNU A;  4WP9 A;  4ZP8 A;  3HP6 A;  1OO0 B;  3ZC4 A;  4DQQ A;  2W4P A;  1MU2 A;  2VF3 A;  1XJW B;  3DLG A;  3MMJ A;  4PAB A;  4CT8 A;  1UEK A;  3U1M A;  3Q8V A;  1WDT A;  4J9O A;  1Q5V A;  1IKW B;  4J90 A;  3D1Q A;  2FJD B;  4RKU C;  2EBG A;  2HQC A;  4M63 A;  4RBT A;  4BWJ A;  2GVD A;  4OHZ A;  1UFL A;  1MLA A;  2B9Y A;  2YX1 A;  4O4G B;  1RTD A;  1FE0 A;  5E0O A;  5LMU F;  2UXC J;  1NXI A;  5KT4 A;  5A8R A;  1R8C A;  1U09 A;  2RIL A;  4WP8 A;  5KFC A;  2YWG A;  2UV8 G;  5IOL A;  4ILL A;  3SXL A;  1I3O B;  2CPX A;  3M4X A;  4UOF A;  4B9S A;  3S8S A;  3QJL A;  1ZA2 B;  4F3O A;  2ZZN A;  3Q8P B;  5GMD A;  3MMB B;  3O6Q A;  3HT3 A;  5D77 A;  1XIQ A;  1NB2 A;  1PCA A;  5F9L A;  4P2F A;  3NNC A;  4IG0 B;  4TYB A;  3KHH A;  1FWK A;  1G4C A;  1JLB B;  4YQW A;  4C8L A;  2DR5 A;  1X8D A;  3HK2 A;  3OVB A;  2BE2 A;  4NA2 A;  3IRW P;  4CDI A;  1FJ7 A;  2HVH A;  1NDP A;  2EBE A;  2HFV A;  4L74 A;  4OLP A;  5KFT A;  2UU9 J;  4JV1 A;  2IVY A;  2XSJ A;  2ZUG A;  3I0S B;  4DX6 A;  1SXL A;  3LP2 A;  5KFI A;  4CLZ A;  5EWE A;  3JSM B;  2ZEJ A;  4NCB A;  2G2Z A;  2FJA B;  2M0G B;  1MRO A;  5C7P A;  1XR5 A;  2C2N A;  2AHO B;  4C97 A;  5DDO C;  2KT2 A;  1W2B R;  1LK5 A;  2Y3Y A;  1JIH A;  1HBO B;  2AP6 A;  2B6A A;  3LP0 A;  2MQM A;  2JC1 A;  2MQQ A;  5AE3 A;  4ETX A;  4F36 A;  4PYA A;  1VOM A;  2C2E A;  2HRU A;  3RAM A;  2MB0 B;  4QR0 A;  2FD2 A;  3UO0 A;  2ASJ A;  1SKU B;  4C11 A;  1CG2 A;  4ED4 A;  4QCL A;  1NPP A;  2HLU A;  2W2Q P;  4RUA A;  2J0W A;  3G8T A;  2UP1 A;  2QC3 A;  2RVJ A;  3I5C A;  4ZJO A;  1DBD A;  1WOP A;  2JRS A;  1P27 B;  1TK0 A;  3ET6 B;  2W4D A;  3BKF A;  2IIH A;  3PM9 A;  3QO9 B;  1YZ7 A;  4KKO A;  3UE2 A;  1C1C A;  1VCT A;  1HBM B;  3VGS A;  4DPW A;  4R0E A;  1S1U A;  2CWK A;  3PG9 A;  4IO1 A;  2V4R A;  3K2Y A;  3DM2 A;  2DBB A;  2DO0 A;  3HVW A;  5G0R A;  3G71 S;  5ETR A;  4U67 Q;  4RNF A;  1P6T A;  2V63 A;  2XSF A;  1S9G B;  1RWN B;  2BJ3 A;  4WWS A;  4EI2 A;  5LT5 A;  1E6Y A;  4C4W A;  4B3S F;  4FBT A;  2IAJ B;  2PC6 A;  4UZC A;  5D4O A;  5A8W A;  5CXT A;  5BYS A;  2FJW A;  4CP5 A;  5EN1 A;  1VLO A;  2B51 A;  3GYG A;  2AMC B;  5C5J A;  2OML A;  4KHP J;  5EX3 A;  1GMU A;  1K0V A;  3SFG A;  4AL7 A;  1G2E A;  2V4Q A;  1IWG A;  1G1X A;  4CM0 A;  1JLE A;  1YDL A;  3LA0 A;  4NEZ A;  3MFI A;  3SZ2 A;  1HI8 A;  4NLO A;  4X4T A;  4AQY F;  4ECU A;  1IBM J;  5KG7 A;  1S6U A;  4J5O A;  1NDC A;  1ZYQ A;  3BRE A;  2VQE F;  4RW4 A;  3GJT B;  1YKW A;  2C1E B;  2Z56 B;  2FYX A;  2CJB A;  1RT4 B;  3T5H A;  2LQ5 A;  4OYO A;  1TMJ A;  2DNM A;  1TU0 B;  2JVR A;  1SH2 A;  1VS3 A;  2DCL A;  3PX4 A;  3HD1 A;  2OLW A;  3V6J A;  3FCH A;  5HLF A;  4Q8F A;  2PFF B;  4ZCL A;  3HT0 A;  1UWA A;  3L3C A;  2LEB A;  4IQX A;  4H54 A;  1RAO A;  2CRL A;  2DJW A;  3BS9 A;  3Q89 A;  2VG6 B;  2BBE A;  1WOO A;  2BQ3 A;  4Y2A A;  2P2C B;  2B4P A;  1O6X A;  2HQD A;  4Q5V A;  4TU7 A;  1T7P A;  2HHP A;  3CDW A;  3MF5 A;  3PV8 A;  1REV A;  3KHG A;  3BH6 B;  1HQ2 A;  2WB4 A;  5KFN A;  2MSS A;  4DS5 A;  5GAD U;  3UCU P;  3AOB A;  2J0Q D;  3KLH A;  3VAF A;  2MQP A;  1U1R A;  2F9J A;  2OO4 A;  2IFX A;  3MHY A;  3E3X A;  4AD6 A;  4KBI A;  1TFW A;  1BGX T;  1R8B A;  3L95 X;  3SSQ A;  1EP4 A;  3CCS S;  3B6B A;  3BBF A;  1JXL A;  3HHN B;  1VDH A;  3KJV B;  1F1B B;  3J80 Y;  4OZJ A;  2IMW P;  3OL8 A;  1PO6 A;  5DM6 Q;  1SQG A;  2CJQ A;  4K4W A;  5AE1 A;  1ZA1 B;  4F4X A;  2D74 B;  3PX6 A;  3N28 A;  2CPY A;  2ZZM A;  1H98 A;  3SQG A;  4X4R A;  4I2Q A;  4L76 A;  3FRY A;  3MXH P;  2XQC A;  1HNV B;  2HNY B;  3HHL A;  4HTI A;  3MPV A;  9ATC B;  4DXL A;  2UVU A;  3QGI A;  3G9C A;  4LSL B;  5DLG A;  1DAR A;  1FVQ A;  4ZVT B;  3A4T A;  4DV7 J;  4OJ1 A;  4CLL A;  1SJ1 A;  3HHD A;  3HUL A;  4I6Y A;  1TKT B;  2OSQ A;  4FYX B;  1U48 A;  1KD1 T;  1Z4U A;  4V19 X;  3GYN A;  5DQG A;  3ILL A;  2LEP A;  3K0J A;  2XMK A;  3GFX A;  1MRO B;  1HMV A;  4AE5 A;  2HWT A;  2MPU A;  3AJ2 A;  4A46 A;  5A2Q Y;  4J9N A;  3EGZ A;  3U27 A;  4B3R J;  4NXN J;  1TK8 A;  1IBL F;  2RQC A;  4IYQ A;  2OEM A;  4QJV A;  4EFA C;  2QGF B;  4Z7Y A;  1SIZ A;  1UTA A;  3M8R A;  2AW0 A;  3O2I A;  2EC2 A;  2WVB A;  3MCM A;  2QFJ A;  5AT1 B;  1T3N A;  1NK7 A;  4YEA A;  4USI A;  5HAN A;  2CNL B;  5CYM A;  3MUT P;  4EYI B;  4YOE A;  4YHH F;  1U2F A;  4LQ3 A;  3BV8 A;  5GAD I;  3TVK A;  2M2B A;  1HW8 A;  3TNV A;  3R7B B;  4DU8 A;  1U1L A;  3HFK A;  3MR6 A;  1U0S A;  4B3T J;  2VU5 A;  3NCR A;  2QLF B;  2VG7 A;  3QWP A;  1WOR A;  4H4O A;  3AAW B;  3VTI A;  5GAH U;  3Q2S C;  1OS5 A;  4KSE B;  3OL6 A;  1N5S A;  2K1R B;  1F2H A;  2ZBQ A;  3M8Q A;  4H4K C;  3GPA A;  3JTO A;  3Q8R B;  3BGL A;  3V4I B;  2V8H A;  5ETN A;  2UU9 F;  4MYU A;  4K4Y A;  3PX0 A;  1VQ9 S;  2NRE A;  3SCI E;  3DRS B;  4XK8 C;  3C2P A;  3DOL A;  4F8R A;  2MY7 A;  4RZR A;  3TEH B;  1RHK B;  1M0S A;  4NLD A;  1BWV A;  5DDR C;  3PIP Q;  4LMZ A;  2L3M A;  2NXU A;  3K7R A;  2NPF A;  3THT A;  5A8K B;  1DJ0 A;  4RW8 B;  4EGL A;  2RF2 B;  1K73 T;  1MN9 A;  1WSV A;  3ZFV A;  4HI1 A;  2W01 A;  4ED5 A;  3BGF A;  2BMB A;  4DI6 A;  1TVR A;  2VOP A;  4WJB A;  2W2O P;  2MQ8 A;  4L72 B;  5I42 A;  3KNG A;  2CUY A;  2DNR A;  5HMY A;  2OD6 A;  4P2M A;  2W4C A;  1KHV A;  3AJ1 A;  4ES2 A;  1I1G A;  3V6D A;  2WVC A;  2IC3 A;  4ZS6 A;  2FIU A;  2HFN A;  1U4B A;  1QM9 A;  3H5X A;  2BRK A;  1WD6 A;  4X64 F;  2OKQ A;  2XBP A;  4NLY A;  1YI2 S;  3EDQ B;  3D0G E;  4Q43 A;  1GMW D;  1FRK A;  1PJ6 A;  1R3N A;  3OHB A;  3GIR A;  3PJ9 A;  1KLM B;  1S4F A;  3MUV P;  1ZAX A;  1XER A;  3BYP A;  4RU2 A;  2UZA A;  4JI7 F;  1CJT B;  3GR1 A;  1RWM B;  3CJ3 A;  4USK A;  3SSR A;  3VGU A;  5JUM A;  4RL1 A;  4K50 A;  2FB0 A;  1FDD A;  3PFO A;  3WZ0 A;  4DV5 J;  1TKD A;  1TP7 A;  1H73 A;  2RH3 A;  1HWJ A;  2XEX A;  4WU2 A;  3VVT A;  1N6Q A;  1Y3K A;  3Q83 A;  4ECW A;  3TAP A;  1ZS6 A;  1EP4 B;  2WSE C;  1EJ7 L;  5IV4 A;  1S9F A;  2F4F A;  1AT1 B;  1GT8 A;  2YNH A;  2AJF E;  2JHE A;  2QV6 A;  1NH7 A;  3PFE A;  4LR9 A;  3VHQ A;  1UJ6 A;  4QBU A;  1C0U A;  3UR0 A;  5L1K A;  1SL2 A;  4LIW A;  1XMO J;  4ELV A;  1OYD A;  4ALZ A;  3OVS A;  1W25 A;  3LAN A;  2V0N A;  3VV2 B;  1B0V A;  2BJ7 A;  4I2Q B;  5F8M A;  1LV5 A;  4Q0B B;  2JEJ A;  2AYG A;  1FT8 A;  4C48 A;  2L9W A;  3BSC A;  3FMW A;  4KGZ B;  3UW1 A;  1J5O B;  3LF0 A;  4CTA B;  4FXD A;  3DDN A;  5KFJ A;  1C0T A;  1WG4 A;  2GQC A;  3DYA A;  4U96 A;  1XWL A;  3AXM A;  3IWX A;  3K89 A;  2X1A A;  3R1L A;  1WDD A;  2YXL A;  5HBM B;  4B9U A;  3FUY A;  2WRM A;  4ZP9 A;  2RD5 C;  4AXI A;  1WI6 A;  4GMK A;  3VQT A;  2N3O A;  4ZVP B;  2VHG A;  4DUT A;  2LCW A;  3EZU A;  5AXN A;  1OSD A;  1WF1 A;  5HJX A;  3KK1 A;  3EVW A;  1OMS A;  4K5S A;  4YHH J;  3SBM A;  3CCT A;  4OHY A;  5KFG A;  2DGV A;  1HHT P;  3GFH A;  3JTN A;  5IT9 U;  5HMZ A;  1AW0 A;  2DO4 A;  1PIE A;  1OY6 A;  1LWC B;  4NEY A;  1WOS A;  1XNR F;  4LIR A;  4B17 A;  4DR7 J;  1AB8 A;  1B7Y B;  1U8S A;  1GFW B;  2BJ9 A;  1JLA A;  5LOQ A;  4JI7 J;  1N33 F;  4NML A;  4IDK B;  4FS1 A;  3CDB A;  4DJB A;  3ENQ A;  2GCF A;  2XMJ A;  1CQN A;  5J2Q A;  5CH7 B;  3RG6 A;  4X65 J;  1U8W A;  3PZP A;  2JOQ A;  4DV7 F;  1T95 A;  2CIM A;  4ZIT A;  4BWM A;  4YDX A;  5JMN A;  4DR2 F;  1JJ2 R;  3M2R A;  3GIK A;  5KFM A;  2AF6 A;  2ZDO A;  4L3N A;  1IN0 A;  2ZD1 B;  1CQM A;  1TKX B;  3H5S A;  3IA0 A;  3IXQ A;  3PXG a;  2X7I A;  3ZZ0 A;  1HYS B;  2FJV A;  4W90 B;  5FJ4 A;  3CE8 A;  2X51 A;  4LFB J;  1YRT A;  4NLX A;  3FFI B;  4OX6 A;  1S7H A;  3L7O A;  3CMA S;  4M95 A;  1RZM A;  1RT3 B;  3M6X A;  2W9B B;  2OJ3 A;  2L9N A;  3RBX A;  4LSZ B;  4LRA A;  2RRN A;  2CQD A;  3QGH A;  1GNK A;  2ILY A;  4BLG A;  5I3Q A;  3R97 A;  4M5D B;  1N8R T;  4K4S A;  1HBM A;  1ZBT A;  4DV2 F;  4DQP A;  2LQJ A;  1XMQ J;  2KI2 A;  4UOH A;  2F7V A;  1GXT A;  1HHQ A;  2YNI B;  1DQ8 A;  2I8E A;  3DRR B;  2FLN A;  3D6H B;  4W98 A;  2KG1 A;  1XNQ F;  1HPZ B;  2ZE2 B;  2QL5 B;  3GB0 A;  4P71 A;  1N0V C;  5F0W A;  1RI7 A;  1YJV A;  2GMH A;  2Q6C A;  5KTQ A;  1RAC B;  5ETK A;  5JVG Q;  1P1L A;  4MAK A;  1R0A A;  4OL8 A;  2FHJ A;  1JK9 B;  1TR0 A;  4M5K A;  1PBU A;  1DLO B;  2BUN A;  2WBM A;  2IJN A;  1JLG B;  4Q7A A;  2H3E B;  2G1H A;  3G6Y A;  1M90 T;  1Y5N B;  1RTD B;  2J6T A;  3KTQ A;  3DOM A;  4DHV A;  4PQU B;  2BJE A;  3NRB A;  1HQE B;  3CD0 A;  4ZVH A;  1X4G A;  2ZBC A;  4O3N A;  4NA1 A;  1A7G E;  2G2O A;  4HDH A;  2PI5 A;  4B9T A;  1MMD A;  1SIW B;  3UWT A;  3BR9 A;  3LW5 C;  4U6P A;  3BO4 A;  1L3S A;  1HI1 A;  1MN7 A;  1K47 A;  3MMC B;  1FNM A;  2J8A A;  3I87 A;  2IA0 A;  2G0J A;  3NGS A;  2J0X A;  2G0C A;  1YWX A;  3NG8 A;  3PW5 A;  4N41 A;  5ETL A;  2DT9 A;  5B0A A;  3BSO A;  4KGK A;  4OX9 F;  2J7W A;  4DR6 F;  4F04 B;  2VG7 B;  2CKW A;  1XR6 A;  1HNI B;  2LXF A;  4DV3 J;  1UJ5 A;  5A76 A;  2DEI A;  5KT3 A;  3PJW A;  4JV5 J;  2VFR A;  1P9Q C;  2MZT A;  1KR4 A;  1DZ5 A;  2BOA A;  4GVB B;  3NMA A;  3UDL A;  1N34 J;  1T03 A;  1X4B A;  3W9J A;  2ROP A;  3TJA A;  3TUP A;  1XTZ A;  2MXY A;  4A8F A;  2QZ8 A;  1S79 A;  5KFK A;  4J9R A;  2N7C A;  2W1B A;  1YTY A;  2V8G A;  2UUC F;  1IKY A;  1EX8 A;  1D9A A;  1DTT B;  3NWR A;  3P5T L;  3RRK A;  3GFZ A;  4DBQ A;  4DV1 J;  4JI2 J;  2IM0 A;  1OPI A;  1EKS A;  5IS2 A;  1C0T B;  2B8P A;  4ED2 A;  4B3T F;  4PG7 A;  3U1L A;  5MLC V;  4NLP A;  4CO0 A;  3TAM A;  1UZH A;  2IM3 A;  3IP0 A;  2D3Z A;  5C25 B;  1HWU A;  4PXE A;  4JI8 F;  3QRP A;  2VBW A;  3IR7 B;  5KFY A;  3D3C J;  3L9Z A;  3BGR A;  1M5V C;  3OQ2 A;  5THW A;  3PR4 A;  1WEZ A;  3UVJ B;  1P9Y A;  4HT5 A;  1NHU A;  3JQK A;  4IOB A;  3GLJ A;  1SKR A;  2CWX A;  2MKJ A;  3DRP A;  4EUV A;  5KG3 A;  2IJR A;  3T9N A;  2LU2 A;  1S7I A;  2GV1 A;  2QLX A;  4MKB A;  3FMB A;  4J9Q A;  1Q5Y A;  1F5B A;  2P9G A;  5T14 A;  5GAG I;  1R43 A;  1WKK A;  2CAJ A;  4ZHR A;  4DL5 A;  4C8O A;  2WSC C;  4P75 A;  4X4O A;  4NAS A;  2OGU A;  3OTB A;  2VA2 A;  4JI6 F;  1RGV A;  1Y9O A;  2MZS A;  1LWX A;  4PEO A;  4Q2M A;  2AJ4 A;  4HH0 A;  5DDQ C;  5LSR A;  2RRA A;  1T94 A;  5L1J A;  2DKO B;  4Y2C A;  4E2F B;  4CZC A;  2Z2L A;  2RDI A;  1IKX A;  1S1X B;  4J7C A;  4ZMM A;  1GMW A;  4DFM A;  1NB7 A;  4K0K F;  4A8X A;  2DXE A;  1N56 A;  1LK7 A;  3FBE A;  2BJ8 A;  2WHO A;  4F67 A;  3V2U C;  1PJ7 A;  2JLF A;  2HK2 A;  2AJ2 A;  2J9E A;  3NOC A;  3PW7 A;  2VC1 A;  4O44 A;  2E5L F;  3OR1 B;  1X0F A;  1FWP A;  2XMU A;  3UCZ P;  2ZWP A;  2XS2 A;  1JLB A;  3I9V 9;  1RT7 B;  3ENV A;  4HLB A;  4RNH A;  4X66 F;  3D2W A;  1HNZ F;  1KVJ A;  4NLU A;  1IKV B;  2E7X A;  2GQ2 A;  3EZO A;  5IFM A;  3RB4 A;  3DRS A;  4N8O A;  3SV4 A;  3M2U B;  1SKW A;  1N36 F;  4DL3 A;  4YFU A;  1X9M A;  4KQZ A;  2VON A;  3TUJ C;  1YJ9 S;  4DSL A;  1CJV B;  2I38 A;  2ZKU A;  3EXC X;  1JLC B;  1S1V B;  3LO3 A;  3WQP A;  1J5E J;  3N5F A;  2RKI A;  3NS5 A;  3JYT A;  2CQP A;  5CD4 H;  3C15 B;  4KE5 A;  2DCU B;  4Y65 A;  4DV6 J;  1UVK A;  1QUP A;  3FEX B;  3M2V B;  1KN6 A;  2AYE A;  4WFB Q;  3KK1 B;  3MMA B;  1IBK F;  4J9P A;  1TV6 A;  3BKU A;  1JJC B;  4PG4 A;  4YB1 P;  1UW4 A;  2GA7 A;  2ZOG A;  1TVR B;  2JFK A;  4WK1 A;  2XB2 D;  2Y1L B;  5L1L A;  3IWN C;  5I42 B;  2AIR B;  4I68 A;  3DDI A;  5HRO A;  1U0H A;  3CED A;  1VBZ A;  4G1Q B;  4RW9 B;  3VR1 A;  3D67 A;  3V6D B;  4I69 A;  2E9Z A;  1S5Z A;  1HBU A;  4B02 A;  2F3J A;  3U7J A;  3FKB A;  2IYG A;  4JI5 F;  2EI5 A;  3P49 B;  1LW2 A;  4PRF A;  2GJI A;  3MAQ A;  2GGP A;  2Q3P A;  2FTR A;  3FCW A;  4C3L A;  4FKX A;  4DPY A;  1C2P A;  4LRB A;  2J7K A;  2ZH1 A;  2V4J B;  1RAH B;  2YWF A;  2J5A A;  2I5J A;  2XYP B;  5EWF A;  4C8N A;  4IFV A;  4UUX A;  2FHK A;  5GMK a;  5HVF A;  3QJP A;  1R0C B;  3DU5 A;  2BAN A;  4OI1 A;  4RWX A;  2NCK L;  2A1B A;  2LP4 A;  1FD2 A;  1YBT A;  5IM0 A;  1FX2 A;  3A13 A;  3J7Y U;  2NUU G;  3GJQ B;  3UFC X;  3CGI A;  1NHK L;  3TAM B;  2J9D A;  2C2M B;  2G0I A;  3Q0A A;  3FVY A;  1O51 A;  2Y8W A;  2VPW B;  2B7B B;  5EX0 A;  2D69 A;  4HR2 A;  4ZCI A;  2L9D A;  1ZPW X;  3SYZ A;  1KVK A;  3PO4 A;  2B5J B;  2NXE A;  3QFW A;  1UAW A;  2N4C A;  3M8P B;  5D4L A;  4QIE A;  2AEF A;  2MQL A;  2ZHA A;  3D3B J;  3RB6 A;  3H8Y A;  3CJ0 A;  4Y2M A;  4ETZ A;  5L38 A;  4EBD A;  1HNW J;  3LOU A;  4A8O A;  1SJQ A;  3T1Y J;  4IR9 A;  4WTY A;  1WI8 A;  5DET A;  1L3K A;  5K5M A;  3CCJ S;  3JAM U;  4K2J A;  5C24 A;  2DIS A;  2AJ1 A;  3CCM S;  1HR0 F;  3N6N A;  2U2F A;  3X3U A;  3BPD A;  2DHA A;  3LP1 A;  2GQQ A;  4X84 A;  3LWM A;  3BO3 A;  4IFY A;  2VG5 B;  1SC6 A;  1S0N A;  2W2N P;  5BYQ A;  1RBO B;  4AL6 A;  2EFP A;  3C14 A;  5FDL A;  4ANE A;  4L75 A;  5DRK A;  1RT5 A;  1B3T A;  2W2M P;  4LVO P;  4YB5 A;  4DLG A;  3SFU A;  1WNE A;  2I0X A;  1N54 B;  3MPY A;  8RUC A;  2M4M A;  4G6V B;  3W65 A;  2ZJQ Q;  3CO0 P;  2RS2 A;  2R8J A;  4CQ1 A;  1WC5 A;  2AYB A;  1F9F A;  1QUV A;  1TUV A;  1VJQ A;  1DHM A;  1FFW B;  1X4F A;  1VIX A;  4PKD B;  3KJV A;  4PWW A;  5FII A;  3QMQ A;  3G4S S;  2W9A A;  1TAQ A;  2DGQ A;  2NXN A;  1RLD A;  1U02 A;  4O44 B;  1JLA B;  5HVH A;  1HNZ J;  1KRP A;  3KG4 A;  3CCV S;  2BKP A;  1X5S A;  2UUB F;  1RTJ B;  1MU2 B;  3DLG B;  2DY9 A;  1NJZ A;  3ENW A;  3R5A A;  3AB4 B;  3LUY A;  4KPY A;  1EAY C;  2VFS A;  1IKW A;  5BJR A;  2OPP B;  1RAD B;  5HI7 A;  3OTO J;  2OTJ S;  1IVZ A;  4O23 A;  3E01 A;  5KFO A;  4PUO B;  2ZH4 A;  1PJ5 A;  2M52 A;  1GTE A;  1PSD A;  3PDN A;  1S1W A;  2QT7 A;  1IR0 A;  5D4N A;  3BQ2 A;  4DQS A;  1JWW A;  3PW2 A;  4DDF A;  3BBC A;  2IMO A;  3PRB A;  4ZCK A;  6FD1 A;  5EWG A;  4K0K J;  4WTO B;  1VQ7 S;  1RT3 A;  2PSZ A;  1X4A A;  2W9B A;  4F0M A;  2A18 A;  3W2V A;  4USU A;  2AV5 A;  5KT7 A;  3K5O A;  3V81 B;  2H5I B;  2ADC A;  2EW9 A;  3CUN A;  2NYI A;  1VK8 A;  2AEJ A;  3OXG A;  1HKA A;  4H4K A;  2Z58 B;  3FSY A;  1SUQ B;  2DIU A;  2B0G A;  5D8H B;  1IQZ A;  2GML A;  4QU7 A;  4KFB B;  2EK6 A;  1N5Q A;  2VAS A;  1NDK A;  3A8J A;  3P4U B;  3UDE A;  2GJF A;  4ZVG A;  4C7Q A;  2D9O A;  5ETS A;  1KSP A;  1NM2 A;  1MWZ A;  2QA1 A;  4ZHR B;  4U8Y A;  2HHV A;  1F3V A;  5KT2 A;  3W7B A;  2MQN A;  3PIO Q;  4LQ9 A;  4Y00 A;  3SSS A;  3HFV A;  1HQU B;  2KO1 A;  4LFC F;  3Q8S B;  2YNF B;  5A0Y A;  3DOL B;  3MOZ A;  1L3U A;  3N6M A;  3AHP A;  4M5N A;  4MFB A;  3RRH A;  1Q7Y T;  2UUA J;  4X4V A;  4B9V A;  3I4H X;  3QIP A;  3PYF A;  3MMC A;  3MR3 A;  2YKA A;  6AT1 B;  1PG5 B;  3RW6 A;  1ULR A;  1TQL A;  2YY3 A;  4TQR A;  4LRE A;  1VRT B;  2KJV A;  1YIT S;  4BC7 A;  2QMX A;  4CYU A;  5DQH A;  2A2D A;  2XY6 A;  1FDN A;  1EQM A;  2OPS A;  3C8Y A;  4DR5 F;  4WU3 A;  5F8J A;  3WIV A;  1SH0 A;  4DLE A;  2V8P A;  3HXM A;  2RDJ A;  3ZXW A;  3Q8Y A;  3ZZO A;  2MHE A;  2XCP A;  1RT7 A;  2R7T A;  3H42 A;  4ELU A;  3QAT A;  1CPZ A;  3CDE A;  1S9G A;  3ITH B;  3W9I A;  3IBF B;  1VQM S;  4JI6 J;  1R8H A;  3KDO A;  3TWZ A;  5DGA A;  2CG4 A;  3FGV A;  1URN A;  2HWI A;  5D3G A;  3GJR B;  1UPP A;  2EVZ A;  2QE5 A;  2KJW A;  3A3O B;  2P6S A;  1KFD A;  2HGN A;  2W9C A;  2CJK A;  3T5L A;  3GZ7 A;  4P7V A;  1X0P A;  1NK4 A;  2UV8 A;  3PNI A;  1U2C A;  3MPD A;  1S0M A;  2CQ3 A;  3C15 A;  4C2M A;  2CNN B;  2VQF F;  1U1K A;  3JS9 A;  3TRG A;  2XS7 A;  1X5O A;  3QWU A;  4UST A;  2YX4 A;  1AA1 B;  3N79 A;  2FHO B;  5C42 A;  3RR7 A;  1EAR A;  4OYX A;  4JP8 A;  7FD1 A;  4KIA A;  3SCK E;  3AFG A;  2HQF A;  3IBC B;  3K8W A;  3MAH A;  4R25 A;  2E5G A;  4DX7 A;  1H3D A;  3QRQ A;  4FYD A;  1TUG B;  3LQV A;  3CCQ S;  2AZ3 A;  3J7Z 5;  1U0H B;  5HMW A;  2HVE A;  3HDS A;  2Z8Q A;  2M8D B;  3DMJ B;  3LPE A;  3FQL A;  3H2L A;  3OVA A;  3PRV A;  4F50 A;  1N36 J;  1HBU B;  1QDU B;  1N6Q B;  3I4P A;  2W7O A;  3T5K A;  4J37 A;  3CO9 A;  2VH7 A;  4HL9 A;  3TZZ A;  3DRP B;  4UW2 A;  1NJY A;  2I9S A;  3SDE A;  3G96 A;  1VQO S;  3QT5 A;  4J9V A;  4LF9 J;  2DH7 A;  2V2Z A;  2DHX A;  2CQ4 A;  4OMF G;  2OPR B;  4OI6 A;  4TYA A;  3CJR A;  1C4C A;  4IKA A;  1KKH A;  2GJ2 A;  1RBA A;  2D3U A;  1NRK A;  3IFE A;  9RUB A;  2B3T B;  2DNQ A;  4RX6 A;  2RHS B;  4LF6 F;  4DV4 F;  3NAI A;  2H4W B;  3THP A;  8AT1 B;  4MKA A;  2Y0B B;  4F2R A;  2POK A;  4OI4 A;  2KT5 A;  4QPT A;  5IM0 B;  2C2D A;  4PPZ A;  3CIM A;  4LRC A;  1NK9 A;  2DTJ A;  1JJH A;  2H1Y A;  2HFZ A;  4A8M P;  2ZJR Q;  5LJ5 Y;  4YR3 A;  4JV5 F;  2QLW A;  3DHX A;  3M8Z A;  1VR6 A;  4DR6 J;  3GFY A;  2J7U A;  2Y8Y A;  1MWQ A;  2DB1 A;  4DWI A;  2CA9 A;  1D0E A;  5KFB A;  4DF4 A;  1S49 A;  1UPM B;  4LF5 F;  5M2R A;  4HAC A;  1KQS R;  3NBP B;  2W8L A;  1Y00 A;  2F5G A;  2H4Y B;  2W8K A;  3MTJ A;  1BWE A;  4NL5 A;  2ZHB A;  4K4Z A;  1N33 J;  4ZP7 A;  2DRD A;  5J1N A;  1UVJ A;  2R7S A;  4KFB A;  1N0U A;  1HR0 J;  2CQC A;  1RHJ B;  3QLH A;  3OUY B;  1Y5L B;  3F56 A;  4X4U A;  1BD6 A;  1S57 A;  4JV0 A;  4DU7 A;  4WXO A;  1LFP A;  1SJ3 P;  1QLN A;  4IR1 A;  5DZ6 A;  4O3P A;  4Y6I A;  4K5R A;  3AOD A;  4RWW A;  5GVQ A;  1KS2 A;  2ZH6 A;  1U1M A;  3NGU A;  5FDL B;  2KL8 A;  2OP5 A;  2JEF A;  2HG4 A;  3TZX A;  1X7V A;  4F0H A;  4JOU A;  4DV3 F;  2CPI A;  4NZ0 A;  5DM7 Q;  5EGY A;  3GIL A;  1WC3 A;  4FYY B;  4F4Z A;  4DQI A;  1GX6 A;  1LXN A;  1VQK S;  3DC2 A;  2NSB A;  2H51 B;  1Q8B A;  2H5J B;  4IUF A;  2EFN A;  3P3D A;  1D8Z A;  4ATN A;  4UZB A;  2BJD A;  3FCV A;  4RBU A;  3W2W B;  4RR5 A;  3QZ7 A;  3HSJ A;  2WCX A;  3CW2 C;  3EXY A;  4FXV A;  3T19 A;  2IYI A;  5HN0 A;  4DCJ B;  4WFA Q;  2AJQ A;  1H2V Z;  4X4S A;  4QIV A;  2U1A A;  5CAA A;  2MZR A;  3EGW B;  4HDG A;  3Q2T C;  2AT1 B;  2PII A;  3OJS A;  4DUY F;  4NLV A;  1Y10 A;  4OYA A;  3IM8 A;  4M5G A;  4ECZ A;  3P8B B;  2ZNZ A;  2AWZ A;  2Z2M A;  2AGP A;  1AXQ A;  4F7V A;  4K4U A;  3GU0 A;  3GWC A;  4ZVQ B;  4HHH A;  1VRU B;  2HBY B;  1A6L A;  3AA9 A;  1D09 B;  4ICL A;  3CJK B;  4CIO A;  2XNR A;  3KMQ A;  1NPR A;  1NSA A;  4DPO A;  3RW7 A;  1KTQ A;  2BE7 D;  3R5D A;  2BAN B;  2LA6 A;  2QYG A;  4BC9 A;  4IRC A;  4DL4 A;  4PQU A;  2R4F A;  1I94 J;  2B6A B;  2QLB B;  2VPZ B;  3LP0 B;  1RWW B;  1T9W A;  2AEM A;  1FFS B;  2OHD A;  3MGJ A;  3QGG A;  3OR2 B;  5E3Q A;  2C2Z B;  3M8W A;  3I55 S;  3J81 Y;  4ELT A;  4C0B A;  2M70 A;  3B78 A;  1F0X A;  4DR3 J;  3R1H A;  5LSO A;  2DR7 A;  1RP5 A;  3PKM A;  3DLE B;  5U47 A;  6FDR A;  2V68 A;  4Q8E A;  4ZPT R;  1GAO A;  4X2B A;  1QJH A;  4B08 A;  2R2S A;  3W60 A;  2D3O 1;  2YKN A;  2GZO A;  1J5E F;  3DI6 B;  1UEV A;  2FUG 9;  1NK5 A;  4UY8 T;  2GIF A;  4RUH A;  1D9F A;  1UVM A;  4HT7 A;  2UUA F;  4QZV B;  2FDN A;  4ZVU B;  1S9E A;  4LBI A;  4DL2 A;  1LWF A;  1CSJ A;  1X4C A;  2VFT A;  4K2X A;  5LMN J;  3DOK A;  2VZ9 A;  2C3U A;  3W5X A;  2HQI A;  3R5G A;  2O66 A;  5DGB A;  5E3A A;  1SJF A;  1WJ9 A;  3T5J A;  3LGH A;  2XWX A;  4QU6 A;  4WZQ A;  4G1I A;  2I6W A;  2FGO A;  2R2T A;  4YY3 J;  1U6Z A;  2KYZ A;  4ZLL A;  2F40 A;  2P9E A;  1CJK B;  5IXU A;  1TAU A;  1JXV A;  4ZVS B;  5F8I A;  1ICE B;  2VJV A;  4Y2K A;  3KLV A;  1X5T A;  1ZM4 A;  4LF7 F;  5FLX U;  3BF4 A;  5KFH A;  1LWE A;  5A8R B;  4KAI A;  2RE1 A;  3HMJ G;  1U1P A;  1YHQ S;  2V67 A;  4DFP A;  5GAG U;  4FF4 A;  2HGM A;  1RAF B;  2PA3 A;  4GO5 X;  1RCX B;  2ADB A;  1KHW A;  1NDL A;  2ZOF A;  3WX4 A;  3A8K A;  3DLB A;  1N5T A;  2XC9 A;  2CPF A;  5D3G B;  4KJI A;  4G1P A;  1TL1 B;  3FBF A;  2ZDP A;  3LH2 S;  3EVM A;  3H5Y A;  3CD5 A;  4L6V 3;  5F0U A;  4M1K A;  1FDB A;  2BZ2 A;  2M5Y A;  2ZHO A;  3BEG B;  3TQE A;  3MM7 A;  3TUZ C;  1VQ8 S;  4ERD A;  3SCL E;  3OTO F;  2YQ0 A;  1DFD A;  2UVV A;  2UUC J;  1EHW A;  4DQR A;  4D3G A;  5LXY A;  5KFL A;  1O8B A;  3LP2 B;  3UD5 A;  1Y4Z B;  4N8N A;  1VHF A;  2ASY A;  2ZBI A;  4I6W A;  1FWL A;  2DHG A;  4ZDN A;  4ZPV R;  4NA3 A;  4U7C A;  3PW4 A;  2DR9 A;  3A12 A;  4FP9 A;  5F9N A;  4C6A A;  2YTC A;  3ICL A;  5CD4 A;  3CCU S;  3CC7 S;  2XUL A;  4WYW A;  2UXB J;  3KLH B;  3VF0 B;  2VL1 A;  1NK8 A;  3PY8 A;  4F0K A;  4DUZ F;  4B9M A;  1AFJ A;  2DNP A;  5HL7 Q;  4TU9 A;  1IKX B;  1F9E B;  1RHQ B;  1KBR A;  1TL3 A;  1YGY A;  1GK8 A;  4I2P B;  1M5S A;  5CYQ A;  1S97 A;  3BH7 B;  1FFG B;  2RNE A;  1SUQ A;  2K3I A;  4H4M B;  5K8O A;  3OFG A;  1LWC A;  4Z7C A;  1N48 A;  3M9O B;  1T02 A;  2DIV A;  4FYW B;  1VYA A;  2IM2 A;  3K5N A;  1RT6 A;  1J27 A;  2HNY A;  2VPX B;  3LGM A;  1NZA A;  2CQ1 A;  4PR6 A;  1FES A;  4P10 A;  1QTM A;  4U95 A;  2GHV C;  3AXK A;  2WOM B;  2B9X A;  4ITS A;  3K8V A;  4ES1 A;  2D3O R;  1BQN B;  4KY3 A;  3M2R B;  3ZTO A;  4NMX A;  3KDN A;  3JAM Y;  4K8R A;  1Q16 B;  2WBR A;  4ICL B;  3DRX A;  2WTF A;  1Q81 T;  3JB9 k;  3I6P A;  2KN4 A;  4CO4 A;  2WON A;  2DXF A;  2XLI A;  3I32 A;  3HM9 A;  4KGV B;  1VC5 A;  4NLT A;  1T9V A;  1DAX A;  2HIY A;  1TL4 A;  3CB4 A;  3HI9 A;  2HHU A;  4BHQ A;  1Q1K A;  5KFU A;  1X9W A;  1RLC L;  2E9T A;  5E41 A;  4DR5 J;  1GX5 A;  2A3J A;  4M5D A;  1YJ7 A;  1WG1 A;  2C3O A;  1NCL A;  4ILR A;  4P2X A;  1FVS A;  3DN9 A;  5CYM B;  4KH0 B;  1TKZ A;  4DCO B;  2XO7 A;  4DV1 F;  1WEL A;  2KFY A;  2FVP A;  1B64 A;  2YH0 A;  1Q8K A;  1BQX A;  3PJX A;  3VAM A;  1APS A;  3POT B;  2X3G A;  4CLK A;  4G1Q A;  4RW9 A;  2DGO A;  2CVI A;  4H4O B;  3O3L A;  2XMM A;  4Y3C A;  4ZVR B;  1SJ4 P;  2QEX S;  3PYG A;  4C3K A;  5D0E A;  4FZV A;  3HPO A;  1JLG A;  1LW2 B;  2MKH A;  4YME A;  2GAH C;  2GGP B;  3MFH A;  1NND A;  3DOM B;  3OTD A;  2CJ9 A;  1FKP A;  3DLK A;  4XIU A;  5K20 B;  3LAL A;  5ITH A;  3IG1 A;  1ZZN A;  3J81 j;  3MI7 X;  2E5I A;  3M32 A;  3PYD A;  3BSN A;  4PYD A;  3A3N B;  1RYR A;  1PBA A;  2HFO A;  4FXW A;  4P2S A;  3C16 A;  2OFH X;  1UVI A;  1HA1 A;  1JKH B;  2DR6 A;  4GO7 X;  2DHS A;  2F8M A;  1UP1 A;  2YBV A;  4C8Y A;  2FJE B;  3LPY A;  3VGT A;  4LF6 J;  1CUL A;  1WC4 A;  2JEI A;  3U02 A;  1UMJ A;  2XMW A;  2PMH A;  3DM2 B;  3S6E A;  1IBL J;  4WZM A;  1CS4 A;  4C8K A;  4B3R F;  1FD8 A;  2BM0 A;  1SJR A;  1SC3 B;  3W61 A;  2N82 B;  2HBZ B;  4DR2 J;  2JSX A;  3F41 A;  3CIZ A;  1WSR A;  4NCG B;  4ZPC A;  4K59 A;  5HMX A;  3PHE A;  1IR1 A;  1MMN A;  3DGP A;  3V5R A;  4IO9 Q;  4ED7 A;  4WYL A;  3KLE B;  3CXC R;  1RT1 B;  5C24 B;  1F60 B;  1R8A A;  3I0R B;  1YJU A;  2ACM A;  2V5H G;  4URS A;  2XMV A;  2IVM A;  1NJI T;  1FKA F;  3H0P A;  1AZS B;  2OSR A;  1EIY B;  1QAY A;  5EDW A;  4A8Y A;  4PWU A;  1PAE X;  1R31 A;  4USV A;  1VIS A;  3RRG A;  3FZB A;  3OBI A;  2HFS A;  2WW4 A;  4NCA A;  3PVX A;  2G4B A;  4LUB A;  3GSD A;  2MHN A;  2YNG A;  1K8A T;  1U24 A;  2LFV A;  2Z2Y B;  4OZ3 A;  3IGN A;  1MNE A;  2L48 A;  4QR2 A;  1ZAV A;  1MW7 A;  4YUD A;  4ZCM A;  2VQE J;  3PW0 A;  3TYT A;  3TJ8 A;  2R2U A;  2LQ9 A;  5I3P A;  3P5B P;  5HLF B;  4C3M A;  1Y0H A;  2KRR A;  1PIL A;  3HF5 A;  4PAA A;  1JLF A;  2MKC A;  2KG0 A;  2Y1I A;  4U7U D;  3NGT A;  1C1B B;  2B4O A;  1RA6 A;  1JNZ B;  2APO A;  2H48 B;  2YNH B;  5KG0 A;  2CZ9 A;  1WF2 A;  2ZKT A;  3KLF A;  3H98 A;  4M5M A;  5KFR A;  1U26 A;  1HBN B;  2K7K A;  4IH5 A;  1FRL A;  4WFN Q;  1QVG R;  5ETQ A;  4OLO A;  1NLK L;  1UWB A;  2B43 A;  2CJX B;  1XR7 A;  2P8I A;  2QG9 B;  1WEY A;  2XHW A;  3KUH A;  2CXE A;  4R8U A;  3EPI A;  1U1Q A;  1KDN A;  3DCA A;  3N6L A;  4DPU A;  4ZLN A;  5IT0 A;  3MEG A;  5I3U A;  1J5O A;  2L08 A;  3RUB L;  4P73 A;  3G6V A;  2MTL A;  2UUT A;  4I0W A;  1BUX A;  1SL0 A;  1XK8 A;  3HZE A;  4ECS A;  3E01 B;  3LAM A;  1XNQ J;  1QSS A;  2DNZ A;  1S1X A;  3AD8 C;  3AOC A;  3MM8 B;  5HK4 A;  2Q1L A;  2VV5 A;  4M5I A;  3TZY A;  5IQ6 A;  3Q23 A;  2XYH B;  4ECR A;  3I82 A;  4M5L A;  4ER8 A;  2ERR A;  2Z0G A;  3CJT A;  4AT1 B;  4N47 A;  2FVQ A;  1UFK A;  4P72 A;  2CPD A;  3KK2 B;  2X3D A;  3ENA A;  4HTJ A;  3CCL S;  1J2V A;  1HWI A;  4LSN B;  4NXM F;  2UVW A;  3P6Y C;  1ELO A;  4CLU A;  1T8E A;  3VAJ A;  2VFV A;  3EVO A;  4WE1 B;  4V1A k;  3IBW A;  1PYO B;  2FHM A;  4YB6 A;  4YY3 F;  1RXO B;  2RIJ A;  2MKS A;  3HZG A;  4FVC A;  3UN5 A;  1IUJ A;  4DSF A;  4NX9 A;  4OZ0 A;  3CJK A;  4NLW A;  3VQS A;  2J0S D;  3CNQ P;  1CBK A;  4KTQ A;  1YBU A;  3QAE A;  3OFH A;  2EEY A;  1HI0 P;  3EWG A;  4X65 F;  4C9D A;  5D0H A;  2KHD A;  4FNI A;  3W8G A;  4CH7 A;  3BB5 A;  2AGQ A;  3KHR A;  2BYC A;  2HKE A;  2Q66 A;  2ROG A;  2CG8 A;  2YNF A;  1F5C A;  1RAE B;  2JWN A;  2CVE A;  3M2V A;  4CNY A;  3WC2 A;  1KLM A;  1RAB B;  3D28 A;  3SIP B;  3ILI A;  2Q79 A;  5KFA A;  2YPZ A;  2C22 A;  3OT9 A;  2EXU A;  2O5D A;  2VBX A;  4HH1 A;  4RBV A;  3W9H A;  3CCW A;  1NME B;  4ED1 A;  3E51 A;  2YWK A;  4CYU B;  1PKU A;  5HRO B;  2GO8 A;  2CNO B;  3D4J A;  1TZ0 A;  5KFV A;  2HHT A;  2NPI A;  2VBZ A;  1RAJ A;  3HKZ D;  1NK6 A;  2QA2 A;  2X1B A;  3R5C A;  4QWB A;  3DI6 A;  3SEO A;  2EKN A;  2WVF A;  3G87 A;  4TNO A;  3J80 U;  3C46 A;  4V19 J;  3VAK A;  4RW6 A;  3OL7 A;  1GQE A;  3HSZ A;  3BBB A;  4GC6 A;  4WK3 A;  5GAH I;  2R8G A;  2IJF A;  4F4A A;  2OPQ A;  1VK3 A;  2XMT A;  3CWJ A;  3DOK B;  5T41 A;  4EWT A;  3GV7 B;  3BQ1 A;  1U6B A;  3THV A;  3R2C J;  2EKY A;  4LBP A;  3NXZ A;  3UN2 A;  2VOO A;  5IZH A;  2BW7 A;  3DKD A;  4KYZ A;  1W7W A;  2DNH A;  1RAI B;  2DGU A;  3BN7 A;  3HFZ B;  2W9C B;  4R5P A;  1RHR B;  2A6M A;  3H90 A;  4YP3 A;  2O1P A;  2DEJ A;  3I0R A;  2MJN A;  2HZA A;  4P7T A;  2R8I A;  3NY0 A;  2FLP A;  4CLT A;  4DPT A;  1AZS A;  3MEC B;  5J2N A;  2EWH A;  2VKR A;  1SQF A;  4A4J A;  1LWE B;  2N3L A;  5KG1 A;  2MKY A;  1WEX A;  1BQM B;  1HW9 A;  1XMB A;  2CQ2 A;  3IM9 A;  4MIB A;  4NOH A;  3MPW A;  4TVA B;  5T7L B;  4CI0 B;  2KHC A;  2AJ0 A;  3CUL A;  1O5J A;  2E7W A;  2KXN B;  3RB3 A;  3HJF A;  4B3M J;  1RA7 A;  3QGP A;  2A0F B;  1DTQ B;  2VKZ G;  3F73 A;  1HNI A;  3CJ5 A;  1K1S A;  4LFC J;  1XEZ A;  2DNO A;  1D3W A;  3AJD A;  3G82 B;  3JSB A;  3KUE A;  4LRF A;  2QA4 S;  1OSC A;  2BQU A;  2V9W A;  2SXL A;  5DG8 A;  4UY8 5;  2HSE B;  4B3O A;  3KWM A;  1HBN A;  1S6Q A;  3NS7 B;  2IRY A;  1URR A;  2OPR A;  1BMQ B;  2DGX A;  2HEK A;  3ZZP A;  4LF4 J;  4X64 J;  4WF9 Q;  1RTH A;  3MTK A;  2VG5 A;  1T9X A;  2VC0 A;  2JLG A;  3RR8 A;  2VIC A;  1RYS A;  1EQ0 A;  3M1V B;  2C42 A;  1PYT A;  2K06 A;  1S10 A;  3A8E A;  4FDF A;  4ENO A;  2OI2 A;  4P52 A;  1OY9 A;  4PG8 A;  4DEZ A;  3ETM A;  3T1A A;  4ZLP A;  3TW0 A;  3ADA C;  3F0N A;  4MK9 A;  3O8W A;  1ZOT A;  5HP1 B;  2ZD1 A;  3KNA A;  4I2P A;  4WIQ A;  2CFX A;  3AQO A;  3TAR A;  1JJ4 A;  2NS1 B;  3MM9 B;  3G6X A;  1Q8I A;  4LF5 J;  2E1M C;  1A0O B;  4H4M A;  1MSW D;  5ETT A;  1NJX A;  3SCJ E;  3UQS A;  2ALY B;  3KMS A;  3KOA A;  2R7U A;  4DR4 J;  3KLI A;  1UEU A;  4B9L A;  2B56 A;  3ETO A;  3DLH A;  3T6J A;  1YX2 A;  4DOZ A;  2DRB A;  3NBP A;  2VFU A;  4ID8 A;  4JI2 F;  4P6Q A;  4Q0B A;  3GON A;  4IG0 A;  1CLF A;  3AA8 A;  4EU0 A;  2QX0 A;  3B54 A;  4OYP A;  4QW9 A;  4DG1 B;  4PXB A;  4Y0F A;  1IJE B;  3NGD A;  2FLO A;  4S0M A;  1Q53 A;  4DFK A;  2FC8 A;  1UJ4 A;  2NXC A;  5CHC B;  3H4D A;  1TTH B;  2WON B;  1S72 S;  1S1W B;  3PAC A;  4F26 A;  2DVI A;  2MY8 A;  1R7I A;  2DH8 A;  4LRD A;  2OH2 A;  3M7V A;  3KJQ B;  3KJF B;  4FNH A;  3HX9 A;  2Z2Z A;  2KVQ E;  3K58 A;  3GQC A;  3OSP A;  2BM1 A;  1CJU A;  2O3D A;  2HNZ B;  5J2P A;  2C3P A;  2ZIT A;  4C8Z A;  2CZ4 A;  3AQP A;  4CLY A;  3NNA A;  1N32 F;  4AQY J;  2G9O A;  4F4W A;  2KZZ A;  4ES3 A;  3NGK A;  1NO8 A;  2HFU A;  1FI4 A;  1HWK A;  3CJS A;  1GMV A;  3NOG A;  3MZI A;  4OV6 A;  3TZW A;  1B70 B;  5HAO A;  2YKM B;  2RB7 A;  3H7H B;  2P5V A;  1VQN S;  2XZT B;  1WHY A;  3NGR A;  4I67 A;  2NZ4 A;  2LYV A;  2BRL A;  1KON A;  3KK3 A;  2XNQ A;  2PE8 A;  3EYZ A;  3GCW P;  1VRQ C;  5G0R B;  4F3M A;  4UT4 A;  2MEW A;  3UPF A;  1RTZ A;  2X1F A;  1HQU A;  4OYB A;  1IKV A;  1W2I A;  1FNX H;  3TOQ A;  1S48 A;  2RDD A;  4MFB B;  1VRU A;  3OHA A;  2OIH A;  4UF4 A;  3DLJ A;  1YJR A;  1Z2Z A;  2W7A A;  3ZO7 A;  4E98 A;  2DNN A;  4UOG A;  1YBA A;  2DY1 A;  4ED6 A;  3LAK A;  2RQM A;  2NYH A;  2PN6 A;  2ZBP A;  3N9U C;  3ZZY A;  1Q79 A;  2AYM A;  2VD3 A;  4ID5 A;  2YKP A;  4LT6 A;  5AXL A;  3MMB A;  4R0J A;  5K9F A;  2F9D A;  2GAG C;  4Q2L A;  5BXI A;  5K8N A;  2C3M A;  3GIJ A;  3WHI A;  3VAH A;  4O4R A;  5D4P A;  4M5J A;  2ZH8 A;  5E5N A;  1WG5 A;  4WE1 A;  4LF7 J;  1REG X;  4DV4 J;  1CS4 B;  1BQM A;  1HYS A;  1T0T V;  1TL5 A;  4DMZ A;  4MJK A;  4DZ6 A;  2CQG A;  3OXL A;  4A8W A;  4LF8 J;  2Y9H A;  1X31 C;  4ECQ A;  1RWP B;  2XSJ B;  2EG2 A;  3FBB A;  3I0S A;  3KHL A;  3FSX A;  3M30 B;  3CC2 S;  1DTQ A;  4AFF A;  5L1I A;  4ECT A;  4KO0 A;  1WKL A;  1K0T A;  1LQ9 A;  3DGP B;  3GIM A;  2UXC F;  3RB0 A;  4DX5 A;  3KJN B;  1JB0 C;  4TY8 B;  1FTR A;  1RT1 A;  1UVN A;  1S4E A;  2CYY A;  3DU6 A;  1DRZ A;  4I7F A;  5LMN F;  1FRX A;  3HHE A;  1FCA A;  2D41 A;  3EPG A;  2DPJ A;  4L73 A;  2QL9 B;  3PRD A;  3WBZ A;  2ZH7 A;  2HRY A;  1VQL S;  4YDD B;  4DR7 F;  4FN5 A;  4ZVE A;  4N77 A;  4OJ3 A;  4C11 B;  2HGL A;  4EBC A;  2BR0 A;  5DG7 A;  4U7U K;  5SZT A;  3K57 A;  4W92 B;  1H72 C;  3MR2 A;  5F41 A;  5M2P A;  2MZ1 A;  1DQ9 A;  2DXD A;  1CJK A;  3MM5 B;  2HPU A;  1NSP A;  2O01 C;  3O1L A;  4RPF A;  3GMG A;  1GH8 A;  2FPH X;  4U9R A;  2FHJ D;  4DR3 F;  5HP1 A;  2MZJ A;  4CCH A;  2KDO A;  1SBR A;  1JLQ A;  2LLZ A;  2C3Y A;  3CDU A;  3FNN A;  1VLY A;  3DXS X;  3BDP A;  2P9C A;  1JQG A;  5HAT A;  1RB0 A;  2KVI A;  3D1H A;  3MEK A;  5DO2 A;  4AUK A;  4CO1 A;  3A3P B;  1N34 F;  3BGU A;  1UKU A;  2HHX A;  1LW0 A;  2VDI A;  3C6T A;  5RUB A;  4PWD A;  5A8W B;  3M8P A;  4URQ U;  4EO8 A;  2MKK A;  3H40 A;  2BAB A;  1XQI A;  2HRT A;  1Z1Z A;  1QAJ A;  3HSG A;  4Y2I A;  3DRY A;  4R5P B;  4CH1 A;  2FJX A;  2IDE A;  3C6U B;  3M6V A;  5L46 A;  3MD3 A;  3V4M A;  1DTT A;  5B7W A;  1JXE A;  4QR1 A;  3QJJ A;  1JLE B;  2QMW A;  2DNK A;  2AU0 A;  3NKY A;  5AJ3 F;  1V5I B;  1GXL A;  3BM7 A;  3MEC A;  2IRU A;  1R6Y A;  5J2N B;  4O4G A;  1KOO A;  3Q8Q B;  4TLR A;  1BY9 A;  2KM8 B;  1RHU B;  1WTF A;  1KWM A;  1JLC A;  1S1V A;  3BR8 A;  4BDP A;  4ZP6 A;  2CQI A;  1IQT A;  2V8V A;  3UD4 P;  3C14 B;  3TA0 A;  5JVH Q;  2XI3 A;  1QE1 A;  3NCQ A;  2DR8 A;  1T11 A;  4J9S A;  1CJU B;  4XPE A;  2H9Z A;  2OAU A;  2XO6 A;  2DH9 A;  2IHR 1;  3CPW R;  1PGZ A;  3LTO A;  4ILM A;  2DD8 S;  2XGP A;  3AH6 A;  1I51 B;  1G6B A;  3OFF A;  4J91 A;  2HQ3 A;  3ONQ A;  1VQ4 S;  4X62 F;  2V2Q A;  4LR7 A;  3TX0 A;  2JL9 A;  2OUG A;  3BZQ A;  1R8P A;  4PXC A;  4A47 A;  4RLE A;  4PPD A;  3MD1 A;  3QFH A;  1VIO A;  2VPY B;  3NS6 A;  1QSY A;  4CLP A;  3TUI C;  5MAO A;  4GKK J;  4QYZ J;  1M5H A;  1RTJ A;  1ZZF A;  2LXU A;  3OLB A;  5DG9 A;  4USM A;  3S7R A;  1E6V A;  1YG0 A;  3TA1 A;  1U7L A;  2DGW A;  3KLF B;  1XC9 A;  5BR8 J;  1HBO A;  2QSF A;  1WC1 A;  1OPZ A;  2CNK B;  4OV1 A;  2COL A;  4EYH B;  3KYL A;  7AT1 B;  4KV8 B;  2I5J B;  1RDR A;  2YQ3 A;  8ATC B;  1IM6 A;  4AND A;  3FC9 A;  2HBQ B;  3MM9 A;  4HVZ A;  4CLS A;  2Y1J A;  2R7R A;  4OX8 A;  2M7S A;  3BN4 A;  1UET A;  2MDA A;  1S99 A;  4JB8 B;  1RK8 A;  2M9K A;  3W2W A;  3W2V B;  3EZ5 A;  4DFJ A;  4JI0 J;  3ET6 A;  2MGZ B;  4JI4 F;  3A1Y G;  1YJT A;  3SQG B;  3QO9 A;  3W5Z A;  1H2T Z;  5M2U A;  2CQ0 A;  4JI1 J;  3WDO A;  5B0D A;  2NQP A;  2KFN A;  2KXH A;  3EMT A;  2A2C A;  1TKZ B;  4KR0 B;  3VZH A;  4JI3 F;  2HK3 A;  2R8H A;  3QRR A;  1FK9 A;  3CDA A;  4NLG A;  2RJZ A;  2VIH A;  4GC7 A;  1B7F A;  2QN6 B;  3FRZ A;  1WHW A;  2B7C B;  2OPQ B;  3X1L B;  3MUM P;  1U47 A;  1UA1 A;  1S12 A;  4BBY A;  1HWL A;  2LEA A;  3PTW A;  3M30 A;  3M6U A;  3NAH A;  4LR8 A;  4X66 J;  1AUD A;  4KO0 B;  4TLQ A;  3L09 A;  3M9N B;  3B82 A;  3TAQ A;  1PC5 A;  3IN5 A;  3MUR P;  2F1F A;  3I96 A;  2G2Y A;  3ZZT A;  3CMQ A;  1XMO F;  3NL0 A;  2EC0 A;  3EX7 B;  5A0Y B;  5B0G A;  1NEE A;  5I4M A;  3A8I A;  1N5Y A;  2K2P A;  4NPO A;  4NLQ A;  5DJB A;  3CCR S;  5IWA J;  3C16 B;  3TR5 A;  1JKH A;  5C2G A;  1RCO B;  3IRX B;  1WHX A;  3HVT A;  3HVR A;  4DV5 F;  1NK0 A;  2ZM6 J;  2IBK A;  5KG6 A;  3I5B A;  2ZM6 F;  4A8S A;  1R0B G;  3UR3 C;  3KK3 B;  3MR7 A;  1U2R A;  1MWY A;  1QTN B;  3QT6 A;  3VAG A;  2PA8 D;  3MM6 A;  5A6W A;  1VHI A;  5BYR A;  3EIC A;  1F5A A;  2XMA A;  3D66 A;  3HKW A;  1T9U A;  2JFD A;  1GTH A;  2XS5 A;  3HD2 A;  1FRJ A;  1VQS A;  2V6A A;  4LJM A;  3G8S A;  2K3K A;  2KB2 A;  2BOP A;  1FKO B;  4F4Y A;  4DSE A;  4IFV B;  2G1D A;  4I4B A;  1T05 A;  2DNL A;  3T41 A;  3QID A;  2RAQ A;  3M1V A;  2YVS A;  2LA4 A;  2MLZ A;  1KQF B;  2ZH5 A;  3T3F A;  4RNM A;  1BLU A;  1NSK L;  4IRK A;  4HYK A;  4X4N A;  1FXR A;  1RWO B;  2LDY A;  3DYA B;  4J9U E;  3RBZ A;  2EFG A;  3KLG B;  2LDI A;  4IOA Q;  1QAX A;  1IJF B;  1S6O A;  1BXN A;  2HS4 A;  2LQB A;  3CJ8 A;  4HEA 9;  4YB7 A;  5KFP A;  2CAD A;  2MJU A;  4TY9 A;  4ZPW R;  1SC4 B;  5KG4 A;  3PCO B;  2IVF B;  3OXF A;  2YNG B;  4NE9 C;  2Y0S D;  3R9L A;  3ISN C;  3JQM A;  1ROF A;  2EFQ A;  2IDL A;  3T9Z A;  3VGV A;  5CAB A;  4DSJ A;  3GR0 A;  2PFD A;  3IS9 A;  4OIX A;  4USH A;  4A48 A;  1VGY A;  3RZA A;  1RAG B;  2EPI A;  2O67 A;  2ZWO A;  2JX2 A;  2RML A;  3GYX B;  1VMB A;  1OJ4 A;  1K44 A;  4DG1 A;  3RYL A;  4I64 A;  2B9W A;  3TO8 A;  3ZTS A;  1AUS L;  2LVW A;  1WC0 A;  2QFI A;  2YQ1 A;  3H20 A;  2GIQ A;  2VUG A;  5F8G A;  2MQO A;  3GG1 A;  5KOX A;  3H4B A;  1PAU B;  1H6K X;  4DS4 A;  3O5T B;  4KB7 A;  5BR8 F;  4KHM A;  1M5P C; 
#chains in the Genus database with same CATH homology
 2XM3 A;  2A6M A;  2XQC A;  2F4F A;  2VIC A;  4ER8 A;  2VHG A;  2VJU A;  2XO6 A;  2VIH A;  2VJV A;  2F5G A;  2XMA A;  2EC2 A;  2FYX A;  2A6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...