2XQCA

Deinococcus radiodurans isdra2 transposase complexed with left end recognition and cleavage site and zn
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
129
Chain Sequence
EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKYIESQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords TRANSPOSASE
publication title DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 32
structure length 129
sequence length 129
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2xqcA00
2F4FA 2XM3A 2A6OA 2F5GA 2EC2A 2FYXA 2VICA 2VJUA 2VHGA 2VJVA 2XO6A 4ER8A 2A6MA 2XMAA 2VIHA 2XQCA
chains in the Genus database with same CATH superfamily
1JLGA 4UT4A 3CO9A 4R25A 2UXCJ 4LJMA 4P7TA 1R7IA 2ILYA 4OX7A 1DTTA 2C28A 3AY0A 2DRAA 2HS4A 1OQ6A 4J91A 2LP4A 3JS9A 5GAGI 1AYEA 3PHTA 5KFAA 4B9MA 5C25A 5KAKA 4Q0BB 2XULA 4FS2A 2YWGA 3W61A 2CPFA 5ETOA 2L9WA 4C8MA 3DI6A 2R7SA 4ZPDA 4ZPWR 3UVJA 3KLFB 1GXLA 4DN9A 1FK9A 3BQ0A 3TAPA 1R0AB 1VC0A 1SJ4P 3KNAA 4L74A 3TUZC 1XNQJ 5I4MA 3M2UA 3PY8A 4C97A 2ROGA 2HBYB 4CLWA 2PGCA 2C3YA 4ZCMA 4AL5A 4DV1J 5L1KA 2E66A 1UETA 4USHA 2H9ZA 4TU8A 2MQMA 1TL5A 2B4UA 5CCMA 4LUBA 4H4KC 2AKWB 5C24B 2EBEA 5J2QB 3RG6A 4E98A 1M1GA 4JI2J 3RAXA 3TZZA 3HHLB 2IVYA 3T9NA 2DO0A 4BWJA 2UZAA 1RT6B 2Z2YB 1FXRA 2YPYA 1QUVA 5I3UA 3N01A 5A76A 1GAOA 1CJUB 2CNKB 1KLMA 4N5SA 2BJ1A 2Q3PA 1RAFB 2XCAA 4IRDA 2A2DA 4TQSA 1CJKA 4IO1A 1H98A 3ZTQA 3UNGC 4DV5F 3FMBA 1C1CA 3FEYB 4Y2MA 4MFBB 5F41A 5A0YB 2K3IA 3WX8A 3KLIB 4WCEQ 2WZ1A 4PQUB 4JI5J 4DSJA 3TA0A 3DRPB 1HA1A 2BE2A 3DKDA 1NK5A 4YR3A 2GHWA 3RUBL 1AUDA 4JI1F 4OYBA 4CO4A 4TVAB 1U6BA 3TUJC 3RB6A 1Y0HA 2BRLA 2VQFF 2GQ2A 2XZTB 1F5CA 1JLQA 3GJQB 2OTJS 1NJWA 3CCES 3DC2A 2RRBA 4ZVOB 2PMZD 3HHKA 2HLUA 2MJUA 2GV1A 3MGJA 1D9DA 4CLZA 5E0OA 4QIGA 3DXSX 4YHHJ 5L1LA 2MKIA 1WG1A 2HHPA 3ENAA 3G87A 3GSDA 3N5BA 3OTDA 2JZ5A 3W5XA 2SXLA 3LQVA 1IUJA 3TAMA 2BQUA 2OO4A 3R7NB 1MROB 4NLYA 3KLVA 5T41A 1PGZA 3PIOQ 3TZWA 2WW8A 1CULB 1X4FA 4C9DA 5G0RB 2CQCA 1CJTB 4TQRA 2KH9A 2UUBF 1D9FA 3HVTB 2AJ4A 1C1BA 3FK4A 2HIYA 2KG0A 3FGVA 1O6XA 5ETKA 1CQNA 1U0SA 3W1YC 4RNFA 5F9LA 4PWDB 1OSDA 4I7FA 2F5GA 4KV8A 3R5DA 4IH5A 1XNRF 1TKTA 2GAGC 5D4OA 2XNQA 4OI0A 3MM7B 2MZ1A 1HMVA 1Q8KA 1RHQB 2MQLA 2HBQB 3MAAB 3C16A 2DXDA 3E3XA 2ZJQQ 2D9OA 2YNGA 3ILOA 3MUVP 3K5MA 2H65B 4KIAA 2KKHA 4RNHA 5ETTA 2CJKA 3P96A 2QJ3A 3Q8YA 4ZPTR 4DV6J 2EW9A 4MK9A 4DCJB 2C2ZB 1FE4A 2CKWA 4WXOA 3GTYX 2JVRA 1L3SA 3MD3A 2B9XA 1EARA 5F8LA 4DQSA 4I2PA 4F0MA 1FEHA 1X0PA 1DLOA 4NLUA 3LP0A 3UPFA 3PV8A 4JUZA 3OHAA 2DXEA 4ECSA 5L8RC 2XLJA 4CO5A 2F4VF 4OJ3A 1MG7A 4OZ0A 4RNMA 4M1KA 3CIZA 2EXUA 5CYJA 2HVDA 3L7OA 4KBIA 3G6ES 4DZDA 4ZCKA 4DX8H 4WXWA 3AA9A 2ZOGA 2IM0A 1RHJB 1IKYB 3RBDA 2VOPA 1KSPA 1H2TZ 4F4ZA 5MAOA 3QNWB 3IAM9 3D66A 3F44A 3AOCA 5IM0A 2C2MB 3SEOA 2BQRA 3SBMA 2FLPA 4OX9J 2C3OA 1NZ8A 2IRYA 3BGRB 4PQAA 1R8BA 2FC9A 1JXEA 5IFMA 3ZC4A 1HFEL 4EU0A 3QWPA 3A13A 2A1BA 2KXHA 4NRTA 3AD7C 1MLAA 5KFDA 3GYNA 3GE9A 4KQZA 1ZAWA 4GKKF 4LF8J 3DOKA 3R2DJ 1BQXA 4ANCA 2JL9A 1WKKA 3BB5A 3VAJA 3MTJA 2L08A 2CJXB 2DNLA 4WK1A 2EK1A 3C66A 2ALZA 1QM9A 3DOLA 2V5HG 1VOMA 1NB7A 2RB7A 3M2VB 2OPPB 2ZH8A 5KFMA 1C4AA 3DLHA 4DQIA 2VC0A 4ELTA 4DF8A 4UY8T 2YNHB 1KQKA 2HHVA 4J9SA 2IM2A 1WWHA 3QSIA 4OYWA 4HH1A 4YEAA 4USWA 5HANA 4OI3A 3J81U 3PYDA 1K73T 2BXJA 4RPFA 2YVSA 4RBTA 2Y8WA 3M8RA 2YY3A 2A6OA 2MPUA 4C6AA 1RTIA 2KVIA 1GEHA 3MM9B 1LW2B 1RA6A 1UVIA 1OYEA 4K4VA 2GW8A 2MZRA 5BR8J 2XGPA 2B7BB 4U8YA 2ZM6F 4OLOA 1GTHA 4EGLA 2IDLA 4MK7A 1VLYA 1KD1T 3UD5A 5KT7A 2UVVA 5KOWA 3G6XA 3DLKA 2Y1RI 1RQ0A 2HAIA 3VCDA 2QMWA 4DQRA 1X60A 3MEEA 3PCOB 3ILLA 3HSGA 1N56A 4K8RA 1TL3A 3K8WA 4K0KJ 2JEGA 1TL1B 2WB1D 2AF6A 1T05B 2DTJA 3IWLA 1F9HA 3W62A 4DEZA 2VQEJ 5DGAA 1VQ4S 5F8GA 2MJNA 3QLHA 4JYAF 3KJNB 3CF5Q 3KJVA 3P49B 3BM7A 4KKOB 2XC9A 3SMZA 3KUEA 3CJ3A 2E1AA 1SC6A 1SL1A 4N76A 2AJ0A 3V4MA 2ZOFA 3KOAA 2GIFA 2P8IA 3W9JA 4JI0F 1BLUA 1VISA 4CO0A 2V2VA 1UFLA 2MEWA 3DLBA 1JJ4A 1SJFA 1NJYA 1VRTB 3FUYA 3TVYA 5GVQA 2KHDA 3OPKA 4NLWA 4FYXB 5DG9A 4PYDA 3EZUA 2CPXA 2EKYA 1ZA2B 2HQ3A 3R3TA 1Y3JA 4CDIA 5FIIA 4DG1A 2C3MA 3DXBA 2E5HA 3IP0A 3VQSA 2DHHA 1TK8A 1RBOB 2WK4A 3NAHA 4DR1F 2AYMA 4NYOA 5ETNA 2FVQA 2VASA 3VGUA 3FZBA 2B7CB 3THVA 3MFHA 2R7VA 3M9NB 3LP1A 3ICLA 4ZP8A 3C19A 4A8KA 2F4FA 4OJHA 1MMLA 3HZEA 3KJFB 3D68A 9RUBA 4DZ6A 1HHSA 4WBFA 1SV5B 1CLFA 1SKSA 1PC5A 3IA0A 2Y1IA 1WC1A 3P3DA 2BANA 2VPZB 1KQSR 1FVSA 3LP2B 5M2RA 2Q1LA 2J6SA 2FYXA 3N6NA 3UN3A 1UFWA 4QPTA 2VG6B 1WD6A 4EYHB 3CJ0A 4LREA 3QRRA 1NXIA 5E5NA 2FD2A 1JJ2R 4PG4A 2DPIA 1RWOB 5ETPA 2EFPA 4KGKA 1X4CA 3GJTB 2RF2B 2DR9A 2HWTA 3IG1B 4DR5J 5EWEA 1RT4B 3T1YJ 3H5YA 2HW3A 1RTDA 5HATA 1K1QA 4HI2A 1VQLS 1N0UA 1TP7A 4M63A 3OD2A 4DHVA 5F3TA 4C98A 5HLFB 5EWFA 3EICA 3S7RA 4XIUA 2GGPA 3SCLE 3MUMP 5KFUA 2YPZA 4K4TA 1AROP 5F8NA 3BEGB 2JFKA 5GADI 3UO0A 5FLXU 3N4WA 1GK8A 3QT7A 2NSBA 1TV6A 3TO8A 1RDRA 3T41A 3RW6A 3IBFB 2DT9A 3VQTA 2ZD1A 1HQEB 3FBCA 2NCKL 4CZCA 2BVZA 2ZWOA 3IRXB 3JAMY 2R8GA 5L1JA 2W9AA 1FTRA 3O6QA 2V34A 3HM9A 4KAIA 4J9QA 3ZNUA 4C8LA 3UW1A 4RW8A 3SQGB 1RK8A 4HYKA 4NMXA 5I3QA 3MEGA 4RWXA 2V4QA 1XIQA 2XWXA 2BACA 1QSYA 5DDQC 4ZVTB 1KC8T 3TA2A 4F3MA 5K20B 1U1PA 1YJWS 5LXRA 2OPQB 4RWWA 5ADZA 2LDYA 1PAUB 3B78A 1P9YA 1D09B 2EVZA 4FKXA 4XTTA 1URNA 5CYQB 2MSSA 5DLGA 2RSQA 2HWHA 1NAQA 4J7CA 4MYTA 3L09A 2W2PP 2M88A 2HYIB 2PC6A 1BGXT 2RU3A 1B0PA 1P1TA 2OEKA 3PW0A 4DX6A 1EB0A 3CE8A 3X1LB 1B4SA 3GFXA 4WFYA 1HBNB 2H4YB 2HMIA 3OR2B 3RB0A 1Q8IA 4K2XA 2XHWA 4WP8A 4JB8B 4TNOA 4IRKA 2G2YA 4PYAA 4CLYA 2AIRB 4A8SA 1S9EB 4HDHA 3TZYA 3GILA 3K7RA 3MCSA 3H4DA 3NNCA 4WTYA 1T3NA 4DR3F 3I9ZA 3SSSA 1QAYA 3EVMA 2FJDB 4N56A 2KXNB 5ETQA 5K8OA 3M30A 5KOXA 2QN6B 2ASYA 2NYIA 3EZ5A 2RHSB 5KT3A 1WOOA 2WSFC 3D9BA 4QR1A 5D0HA 3M8PA 4JV0A 2KM8C 3W65A 5T14A 5D0EA 2HEKA 4O3QA 1Y3KA 3MECA 5EHHA 2IYGA 3SCIE 1LNQA 3EUNA 2HRYA 3UI3A 1IWGA 3FMWA 3CJKA 3OLAA 2B9YA 1EQ0A 3M8QA 1BQNA 1HR0F 2CQ3A 4NXMF 1CSJA 1S0VA 3E2EA 3A3NB 1OYDA 4ZVGA 4LF5J 1HWKA 2G0CA 1RI7A 1RT7A 1JLCB 4OHWA 2HAFA 3GCWP 2KT3A 1PBAA 3VAFA 5KFBA 2QRRA 2XMWA 3I82A 3JQJA 4FYYB 3HJFA 4IG0B 4ZA1A 1RP5A 2MKKA 1UA0A 4F0KA 4OHYA 3QYYA 4N47A 3KUGA 4ES3A 3TJAA 1WUUA 1KTVA 2AX1A 1N34J 4H4MB 4YB6A 4CYUB 3JSYA 1AFJA 3IR6B 4O23A 1VHIA 2GAHC 1RLDA 3G2XA 2P9EA 1FNMA 5DDRC 3CCJS 3NRBA 2JEJA 2GO9A 3M9OB 5H9FJ 2G1HA 1B70B 2IJRA 2UXBF 3OXGA 4DPTA 1WHWA 2OPRA 3QGHA 4HHJA 1DTQB 1SQEA 1JNZB 4HTIA 3M8ZA 2M8DB 1WKLA 4ZPCA 3AJ2A 1HPZB 4B9VA 3MM8A 5K14B 2BX6A 4ED8A 2GC8A 3OR1B 4QW9A 4JP8A 4LR7A 1QSSA 2C22A 3AQOA 3OL7A 4J9VA 3QRPA 2IJFA 5I3PA 4O3OA 5B0CA 1LWFA 4M5DA 3PYEA 1AZSB 2HBZB 1PYSB 5BXIA 2ZUGA 3OBIA 4GC6A 1F3FA 3C14A 2J8AA 2OFHX 3Q8QB 4XK8C 1EAYC 3LANA 1DURA 2X3GA 2J6TA 4IDKB 1HQUA 2B4OA 3QAEA 4C48A 2OP5A 1FHTA 4ZCLA 1SC3B 3BR8A 3I56S 1I94J 2KN4A 4JV1A 2YH1A 4IG3A 4EBDA 3UN2A 2AEMA 1D3WA 1S6PB 3BO4A 2YNIA 2W9BB 1ZH5A 1R0BG 4RLEA 1VQYA 4A8FA 3OSNA 2V0NA 3HX9A 4Q8EA 4OV1A 3TAQA 5IC6B 4HTJA 3O3LA 4I69A 1HI0P 3KMSA 5HN0A 5I42A 2CADA 1WEYA 4ECRA 5D15A 2R8IA 2W4CA 1FRIA 3BKUA 1WHYA 2MSTA 1E6VA 1M0SA 3L4BC 1BQMA 4NLRA 3MTKA 4I0WA 4YP3A 1FX4A 2YH0A 1UVKA 3V6JA 1RCXB 2QL9B 4X2BA 3KJQB 4TLRA 1YSJA 3MDFA 3IO1A 2BJ3A 3QATA 1NNDA 4PG8A 2MY8A 3OTOF 2NUHA 3W9IA 1IR0A 5CABA 3FKBA 2HQGA 1H73A 1XK8A 4O0IA 3HVRA 4AFFA 1F5AA 2XI3A 1UL3A 4DL5A 2FZCB 2MZTA 2JX2A 1T3OA 3VGVA 1X5PA 2CPDA 2GJFA 4DSIA 4RBUA 4ECTA 5A6PA 1HNXF 2Z8QA 4F7VA 2KYZA 4DCPB 1RCOB 4QJVA 1RT1A 2EBGA 2K1RA 5C2GA 4PG7A 1L5UA 3C8YA 2ACYA 4W98A 1S49A 5LMUF 5D3GA 3D1OA 4ANEA 2GIRA 1ZZFA 2KVQE 4TKTA 3MEKA 5AE2A 3CO0P 1IJFB 2ZE2A 1S1UA 3ONQA 1LW0A 4ED6A 1VQNS 3HFVA 1S1VA 5HROB 3SSQA 4NLVA 2DGSA 1WTFA 2DNRA 1NK0A 2AYBA 1NJZA 4H4OA 3KLHB 2CJYB 1N5TA 4FDFA 1ZM2A 3PVXA 1X4HA 3E8OA 5DM7Q 2YX1A 2QC3A 1WG4A 3D0GE 4O44A 4BLGA 3BDPA 2BA9A 3AXMA 4AXJA 2RUSA 3D67A 4P2FA 3GU0A 1XMQF 4ECXA 3I6PA 1IKVB 5KFSA 3PKYA 1UWBB 2XI2A 4HL9A 1B99A 4RUHA 3VTIA 1IR2A 4FF3A 3CJ2A 2FJXA 1YZ7A 4WJBA 2FJWA 4I64A 4ZS6A 3B82A 5B0EA 1CJVB 2PD1A 3A3PB 3RB3A 2OD6A 3AJ1A 1NK6A 3P6YC 2FHJD 2QLBB 2WONA 4OYZA 2HNZB 2M0GB 1AT1B 4W92B 1RT3A 3NKYA 4KY3A 2RKIB 3H0PA 1U2CA 2Q43A 4DPXA 1PYOB 2J0WA 2R4FA 4CCHA 2Y1JA 2K2PA 4DR6F 2Z57B 1KP6A 4X4QA 2VFUA 2UXCF 2Y0BB 3CDUA 3SSRA 1RT2B 4AQYJ 4TYAA 2M2BA 4DPOA 2F1FA 3AXKA 3IS9A 1R6VA 1TL7A 1V3ZA 1OS5A 4L73A 4M5HA 3OUYB 3HSJA 3G8QA 3DYAA 1WDTA 4YB5A 1UPMB 1X5OA 4Z7YA 2O66A 5DZ7A 4X4UA 4Q8FA 4CT8A 4ZJOA 4DX7A 5KFIA 3R1LA 4X64J 3H2UB 3R5GA 1Q95G 2J9CA 3UCUP 2C3UA 5J2MA 1RWUA 4K5RA 1L3VA 3DGVA 5THWA 2PN6A 4J9MA 3K5OA 4NZ6A 1FWPA 2KYXA 3V81B 2FHOB 1RAAB 3GB0A 4KFBB 5CD4H 1BC6A 1KWMA 1WACA 3BYRA 1TKZA 1KOHA 4RW4B 4J9RA 2DCUB 2W9CA 3ZTSA 3PXGa 4F36A 3MR6A 4F4WA 3IBWA 4I6WA 1K1SA 1NSAA 3MMJA 1GXUA 1XMOF 2DJWA 1SPBP 4M5NA 4CWBA 1JLFB 1PG5B 3MR2A 1Q0NA 2E5GA 3LTOA 4RW9B 3KFWX 1N48A 1L3KA 1IQTA 5GADU 3T5KA 1QDUB 1Y5IB 2L9DA 1JXLA 5HK4A 4ID5B 2XLKA 3IM9A 4E0DA 3RR7A 4GKKJ 1FDNA 2RIJA 4OI6A 4B3RF 2CAJA 5KG5A 4RKUC 4Q0BA 2CPYA 3EXCX 1F2HA 4WP3A 3ZNJ1 2HHTA 3MM6B 2DNNA 1J5OB 3H20A 4L3NA 2HQIA 2NZ4A 3TEHB 2W2NP 3KLFA 4ZK7M 5DO2A 1R0AA 4A8XA 4LFBJ 4DV4J 3VALA 2LVWA 2A3JA 3O2IA 1NPPA 4CIOA 2RJZA 1NDKA 4P9SA 4BHQA 4OFZA 2UU9F 2QZ8A 1Q7LB 5C24A 1YJ7A 4K4XA 1VQPS 4CH0S 2J7UA 4YHHF 3EPIA 2KL8A 3ISNC 3HHLA 2DGXA 1XWLA 1S1WB 2D3UA 2VPWB 3QT8A 4M5LA 2QA2A 1RT6A 4KPCA 1R27B 2XQCA 2DGUA 1ROFA 2LFVA 2R2UA 1CJUA 5LMNF 2FY1A 3G82B 1TVRB 1S1TB 4A4JA 3TWZA 2W7AA 3WC0A 4IQXA 1UPPA 1EP4B 3IR7B 4C8KA 2ZEJA 4MFBA 4B9LA 3AA8A 5A0YA 3KLIA 1G1XA 4PQUA 4O4GA 1H2UX 1R0CB 3HD1A 5H9FK 5LSRA 5EN1A 3SDEB 3HHLC 1VRUA 5L9XA 1EHWA 2GIQA 3BN4A 4V19X 2HZAA 1JWWA 1GMUA 5C2CA 1RAJA 1NKEA 1C0UB 3JB9k 4NYPA 4C3MA 1T9XA 2ASDA 2LXIA 4JYAJ 2QSFA 2IVFB 2DK2A 1EKRA 1W7WA 4K4WA 2ZUAA 1QVFR 2DR6A 2A6MA 1ZS6A 4QYRA 2BQ3A 2UUAJ 2FC8A 2CG8A 4N7TA 2IRUA 2JNJA 5KFHA 4PXBA 3IFEA 3GV8B 4JI0J 2HNDA 3SI8A 2ADCA 2V50A 2PEHA 1UZDA 2E9TA 1G7CB 3EGVA 1NEEA 2MQQA 4DV6F 2B8PA 3UD4P 3KKFA 2DB1A 5D0GA 3PW4A 1LWCB 1MWZA 4MT1A 1KOOA 4DLEA 1RZMA 1JLEB 3R5JB 3D6MB 1MROA 3T1AA 3MMAB 3PDNA 2E7WA 2BJ9A 3WZ0A 4OL8A 3Q83A 2LEBA 5IC4B 3MCNA 1CULA 2R9LA 3NBPB 4FVCA 2HVIA 3OFHA 5G0RA 3KK3B 1LEOA 4WF9Q 1TMMA 4FPRA 1RAHB 5HBMB 4K2JA 2ZHBA 1NZAA 4ES1A 1J27A 4PPZA 2UXDJ 4TY8B 2V8VA 4ED0A 1KHVA 3FVYA 3FRZA 4JI8J 3CNQP 2V4JB 3I5AA 4ER8A 3CXCR 1HBUB 2V9KA 3NCQA 1UZHA 2OMOA 3LWMA 4OX9F 4QOTA 2LQBA 3MAAA 2OFGX 2ZJPQ 1YBAA 1TAUA 5KG1A 1NH8A 1VBZA 3RBXA 3EX7B 2XY6A 4QIFA 2O67A 3P5TL 3AJDA 1RJJA 4K5SA 4NLPA 4DSEA 4KC5A 3US5A 1ICEB 3R7BB 2YBVA 4DL2A 4LF8F 3M1VB 5B0BA 4YOEA 5J2PB 2ZZTA 3RYLA 5FJ4A 4DL0C 1S0NA 2ZC4A 3KHRA 5AE3A 3ILJA 5KFJA 2BBEA 2FVRA 3EWGA 1XR6A 3B8HA 1SUQB 4GO7X 4LSNB 2R7OA 3IAS9 3Q23A 1P8GA 4UW2A 1FWKA 4LF2A 1NK4A 1LQ9A 2AW0A 3JTOA 2HBRB 2ZH3A 1N52B 5J2NB 3NG8A 3KG4A 2G2OA 1L3TA 4CLKA 5HP1B 2CYYA 4LBIA 5HJXA 4NZ0A 2YKPA 3ETMA 3PR4A 2WHOA 5DETA 2VL1A 2GMHA 3K5NA 2KTQA 1JLGB 4DR2F 3H5UA 3U1NA 1VLOA 3CCZA 4IOCQ 2DR5A 2FTRA 2OD4A 1DTTB 3UDEA 2BW2A 1LFPA 5L46A 3R97A 2Z0GA 5KFGA 1FNOA 2QFJA 4F4KA 4G65A 3MMCB 5HL7Q 2B0GA 2OPSB 3TJ9A 3Q8PB 4DN0A 3HXMA 5AJ3F 4CTAA 4DL3A 3BGRA 3SQOP 2CG4A 3PX0A 3UDLA 1YJ9S 1V5IB 2IM1A 1TUVA 1TUGB 4X62F 2RUGA 3RBZA 2B9WA 3OL9A 3DHXA 1UKUA 2H5IB 1SL2A 4M5MA 2Y8YA 2AT1B 2FY8A 4CLUA 3ENVA 5IS2A 4B9SA 5HVHA 4ITSA 3IC1A 1V9OA 2FVCA 5LOQA 4ETXA 4LFCF 1VJWA 3Q24A 2RVJA 1QVGR 4RNNA 5L39A 5A8KB 4DR3J 4DI6A 3C6UB 1RAOA 4TN2A 4G1IA 4UY85 3CD5A 1RHKB 4QIWD 5EX0A 3NAIA 4NCGB 2J6UA 3C15B 5K9FA 2WB4A 1BWEA 2AGPA 3M2VA 1VIOA 2OPPA 5DS7A 3BPSP 3NCPA 3HD2A 2VQEF 1UCNA 1WG5A 2F9JA 1M1KT 4BBYA 1M5OC 2AGQA 3QGGA 4A48A 2I9SA 3BV8A 4J9LA 5HMZA 1KLMB 3KNGA 1H2VZ 1Y9OA 1WF2A 1T02A 1UTAA 5LSOA 1MWYA 1RTJB 2VG5A 1FX2A 1QE1B 1NMEB 1C1CB 4ZN1A 3VVTA 1UP1A 3MM9A 1HR0J 1LW2A 2FUG9 4BS2A 3RBEA 4NXMJ 2WVCA 3PACA 3VZHA 4QWAA 2VA3A 3CCUS 3NMRA 2RQKA 2L41A 2CQPA 4C11B 4USIA 3G71S 1FO1A 3BGFA 2CQGA 2X51A 3LGNA 2VJVA 4WYLA 4F3QA 3JSMA 2BDPA 4LF1A 2R7UA 1KLNA 1O0PA 4WP9A 2C2RA 3TQEA 4OZ5A 3NEKA 5F8IA 1IM6A 3GG1A 1TL1A 2IRXA 4PKDB 1S9GB 4F4AA 4KE5A 3T9ZA 1U0HA 1T05A 1VBKA 4Y00A 1CEZA 3OVSA 2J8SA 1AXQA 4EO8A 3AOAA 3D0IE 1RT5B 4NLDA 3BQ1A 2E29A 2CZ9A 1O8BA 3PJXA 3MUTP 1CVJA 2B4PA 3CD6S 3UCZP 4Y2IA 2CVIA 4F04B 4MKBA 5EUHA 4MKVA 3OJSA 2EKNA 2Z56B 1MU2B 4C7QA 4KKOA 2ZBRA 1WNEA 3UE2A 2CQ0A 1BE4A 2IA0A 2DR7A 1S12A 1H0HB 4IFVB 4EI2A 1GMWD 2GVZA 1SKWA 5LM7E 2MKJA 2R3VA 1R8HA 1XERA 3GYGA 4WWSA 3T1YF 2FB0A 5IWAJ 1CS4B 3AB4B 3QGPA 3HLUA 4A8MP 3HULA 4OZNA 3FSYA 2MKCA 3DHWC 2XYGB 1SCJB 1VRTA 2LQ9A 1C1BB 2BOPA 2ATCB 4EFAC 3PX4A 2XBPA 4MKYA 2DXFA 1D0EA 1YQHA 4I7FB 4ZKAA 1VIXA 3RR8A 1SBRA 4Q45A 1KVIA 3I96A 1TKTB 2RS8A 1X5TA 4H54A 2KI2A 2PSZA 3QSYB 1SH0A 1HIYA 1QAIA 2RQCA 4J37A 3P45B 2E1PA 3J7ZT 2OTLS 1JLBB 1YBUA 3VAKA 3MR3A 1KQFB 1UVMA 3QO9B 2HHSA 1SV5A 4ID8A 4O3SA 3BSOA 2E7VA 4DR4F 3DM2B 2DEIA 4NI2B 3LP2A 3EE3A 2V67A 4F2RA 1YTYA 4LF9F 3H7HB 4K4YA 1VFJA 2NS1B 4ERDA 3I4HX 4USJC 3MPUB 2VG6A 2DH8A 2NZCA 5JVHQ 3FEXB 2V68A 2YQ3A 3R7SB 2XCPA 3D4JA 1HW8A 1RA7A 3PM9A 4X66F 1RT4A 1UWAA 4QIVA 4B9TA 1REVB 3TNVA 1U09A 4TU7A 1FFWB 4GO5X 5CH7B 1PKUA 4IR1A 5HLFA 2BKPA 1RWWB 3K89A 1N4LA 2QLFB 1FJGF 2VHGA 1S57A 3SIPB 2KZZA 1U4BA 4RW6B 1N0VC 4U95A 1T9WA 4QYZK 4LFAF 2O01C 3PRDA 2DKOB 5E3CA 1WKJA 1HQEA 4YR2A 3VVUA 5IM0B 3IRXA 3LW5C 4HHUA 3HK2A 1NHVA 4MMOA 1AFIA 1NU4A 1IBMJ 4CLSA 1R89A 2DR8A 1S79A 4UOHA 2OELA 1U47A 4MH8A 3Q8SB 1NLKL 2HQCA 2BR0A 2B3TB 3I0RB 3PW5A 3D1HA 1JK9B 5DDOC 4I1TA 3NOCA 2IA6A 2OPQA 5CHCB 3D3BJ 1MSWD 4YN3B 1X9SA 5E3AA 5CYQA 4R0JA 4K4UA 3C46A 2AZ1A 2W7OA 4OQJA 3RJMB 4B17A 2GVDB 1OO0B 3NNAA 3DOLB 3ITHB 3M7VA 3QGIA 2P6SA 5A6WA 2QA1A 2LDIA 3QFHA 4DS4A 5E2QA 1GNKA 4LMZA 4J5OA 1RSCA 4EBEA 1HBNA 1HYSB 3UR0A 2LXFA 4OLPA 3OR2A 1XTZA 4V19J 4WU3A 4Y2KA 1VBXA 2CVEA 1N34F 1S9EA 3CD0A 2HS0A 2X1FA 2HZVA 1PJ5A 1S6UA 2JHEA 3GFHA 5DM6Q 1JLAB 3U27A 3DRXA 5GAEI 3R5AA 2Q6CA 1DRZA 1HHTP 3ULHA 2N3LA 1VQOS 3TZXA 2QYCA 4DR6J 1NPRA 2MGZB 1IBKF 5DJBA 2G13A 4YS2A 2LU2A 1T03B 1P1LA 4ZP6A 2HGMA 2C2OB 2BM1A 1APSA 2I6WA 1M5VC 3SV4A 1PYTA 5GAHI 4H4KA 3CMQA 1SIZA 1ZPVA 1V5VA 1VYAA 4DL7A 1CC7A 1NSQA 1FWLA 4LRAA 1Q86T 3TANA 1X8DA 4FXVA 2C3PA 1JLCA 2J9EA 2RH3A 5HVFA 4X4VA 2APOA 4IKAA 3ZZTA 3J7A1 5CYMB 5E3PA 4IG0A 1Q53A 5KG3A 1Y7PA 4CRJA 3W9HA 2R2TA 5HSPA 3V6DB 4A8QA 4ZP7A 1I94F 2ZC3A 2I2YA 3GJSB 1BY9A 1XMOJ 2JLEA 4QZVB 1S4FA 1U02A 4F25A 1WC6A 4AUKA 1QJHA 1YRUA 1SH2A 4NLSA 4O0NA 2IC3B 1DTQA 3ET6B 4FNHA 2K06A 4J9NA 3F0NA 4X4TA 2OH2A 1VQ7S 1Q5YA 1S5ZA 2DNHA 1OY6A 3EYZA 4IRCA 2CZVC 4DPYA 2WCXA 4U96A 5EWGA 5K8NA 5K14A 2CZ4A 4DUYF 4B3RJ 3OR1A 3IN5A 4X4RA 2H48B 1YKWA 2DITA 3MPYA 1JX4A 1A0OB 3THPA 1F60B 1N33F 3UDVA 4B3OB 2HG4A 2OLWA 5IQ6A 3S6EA 1K0VA 1N5QA 4LF6J 3WDOA 2JEIA 3LP1B 3FNNA 4B3TJ 8RUCA 4DS5A 3HHDA 1FRLA 4L3KA 3UQSA 5HMWA 2IBOA 5KFFA 4FBUA 2QO3A 1QTMA 5HQLA 1EETA 4IDKA 4P52A 4WU2A 4KTQA 5H9EJ 5BYSA 2CPEA 2PMHA 4FPIA 1B0VA 2XS2A 2UU9J 4UTGA 2X1AA 4WYWA 2ZHAA 4DSKA 1KFDA 4JI7J 4FYDA 3QIPA 2DNZA 1EZZB 1UA1A 3NS7B 3KDNA 1WOPA 1SB6A 2Q6BA 3U02A 2W9BA 3H40A 4CQ1A 2CNLB 4CO1A 1S48A 5LMNJ 1S76D 4C4WA 2BM0A 1C0TA 1S1XB 4ILMA 2I5JB 2DNKA 1WHVA 4HACA 5D6GA 4NLXA 1YK9A 3R5BA 3B6BA 5KT5A 4NCBA 1IM4A 4D3GA 3Q2SC 3JTPA 1RWXB 3N79A 4RJVA 3MMBB 5FLXY 4WFXA 4NXNJ 1Y5LB 2ZD1B 1HBMA 1PIEA 1QLNA 3FDSA 4G1QA 3S1TA 3T1HF 3BR9A 2VFRA 3PRVA 4RW7B 3MR7A 7FD1A 2ZVIA 3NOGA 3QWUA 1I3OB 3RAQA 4OYMA 2FLLA 3IWNC 2MZSA 5DQHA 4DL4A 4C8NA 4HLBA 4RBVA 1RAIB 2BV3A 4UUWA 4B08A 2QE5A 1S6QB 2CQDA 3FRYA 4JI4F 3B4MA 2W01A 4CNZA 3CMES 2LQ8A 1WJ9A 3S01A 3AODA 4DV2F 3SXLA 2VJUA 3WC2A 1G3OA 4KB7A 5D4LA 1LOUA 3PG9A 4AQYF 1Q78A 4KGMA 3EXYA 2LXUA 1RAEB 2VD3A 1FEEA 3A12A 3KLGA 4ZVPB 1VR6A 2LEPA 3GFZA 4DR7J 2AP6A 3KLHA 2VODA 1MW7A 3VHQA 3R27A 2AJ2A 3M4XA 1XN9A 4LRFA 4X64F 1YBTA 4ZVQB 4F02A 4C3LA 5CZVA 1NO8A 1IKWB 3MCMA 2W1BA 2W25A 5JXSA 1Z2LA 4YUDA 1UWBA 2XNRA 2BRKA 3ZZOA 2E1RA 3BSNA 3CW2C 4ECUA 3CCTA 1AUSL 3W66A 2W24A 4WFBQ 2NQPA 5IT9Y 3QIDA 3PO4A 1CJVA 3POTB 2ROPA 2HHWA 2JLGA 2ZH7A 4KO0B 3LH2S 3TA1A 3ZZ0A 2HNZA 1S77D 4ZLJA 3FBBA 2RKIA 1NPKA 1KDNA 4OJGA 2OEMA 2HRUA 1YI2S 2E1CA 3K57A 2R8KA 2E7XA 2CUYA 1RWPB 3IBCB 3OSPA 1U25A 2VUGA 4ZJQA 3PW2A 5A8WB 1DY3A 3BGUA 4RZRA 2YNFA 1RT2A 1RWVB 3L7PA 1UMJA 3PFOA 1BUXA 5AT1B 4FXDA 5KG2A 2JJ4D 4C3KA 5B09A 2JSXA 3DMJB 3BO3A 2AEJA 3OUYA 4J9UE 5KFRA 2LQ5A 1VJQA 2RDJA 4EWTA 1YJVA 3U7JA 3Q22A 1YRTA 1JKHB 2AEFA 3MWBA 2JRSA 2ZBCA 3D28A 2EC0A 2CDRB 4LFBF 2OPRB 5B08A 2WVFA 4DV4F 5B7WA 2B8QA 3V81A 2HZCA 1G2EA 2C2DA 4DR2J 4KFBA 1RAGB 2NR0A 1FESA 2RU9A 4RW4A 1NJIT 3GIKA 2IY5B 2HGLA 3KUHA 1U1RA 3AH6A 4OMFG 3MM8B 4U7CA 1YJNS 1M5PC 4EK2A 1GH8A 4OZ3A 2NREA 2NYHA 3SCKE 4C0HA 5ETMA 1DJ0A 3PHEA 5AJ3J 1LWFB 2V2ZA 5A2QY 4URQU 3W2VB 1FRHA 4ZHRB 4X62J 2KDOA 2NXUA 2X1BA 3G6YA 4FF4A 4ID5A 1FFSB 5KTQA 1UFKA 2DNYA 2HHHF 5CAAA 2KRBA 1R31A 3RB4A 3CDWA 4DSLA 5D8HB 3AB2B 1W2IA 2XYHB 2X1GA 4RL1A 3F73A 4LFCJ 2L3MA 1HQUB 2AHOB 3LAMA 2X3DA 1UW9A 3NWRA 1H7XA 3SFGA 3CWJA 3WIUA 2XZWA 4YFUA 4DL6A 1O51A 2ZITA 5ETSA 1J5OA 4F2SA 2MKHA 1XEZA 2N4CA 3MPVA 3GV7B 2CJBA 3HZGA 2XLIA 4MK8A 2VICA 4QQBA 1TKXA 4RUAA 3NCRA 2ZH1A 4R0EA 4PZVA 2XGQA 5A8RB 3DRSB 2UUAF 3OTCA 3R6GB 4I67A 2MKSA 5F0UA 4OHVA 2XO7A 1HW9A 1U1NA 4LF4F 5C5JA 1FRJA 2FZKB 4L75A 3HT0A 1X4DA 3Q8UA 1S1WA 3PFEA 3MAQA 4WTOB 2LA4A 2IJNA 4KHPF 2GX8A 2ZNYA 4A8OA 1HKAA 2HFNA 2HHUA 2DHXA 3W2WB 3G82A 1HBOA 5GMKa 1ZTTA 2ALYB 4KHMA 1TVRA 1NHKL 4RR5A 2MHNA 2ASLA 3OHBA 2WSEC 4TY9A 1VCTA 1IJEB 5GAEU 3GR1A 4DFJA 3KYLA 4ZVHA 1EP4A 2L48A 5D0RA 3NMAA 3S8SA 1YX2A 4PABA 2D9PA 4ZVUB 2JH3A 3M9MB 2CA9A 2PO4A 5IOLA 1UEVA 1PAEX 3W7BA 2KU7A 1NDPA 3TW0A 1RT1B 4AD6A 3M6UA 3SDEA 3QBCA 5GAGU 1VC6A 1HNVB 3Q89A 2UXDF 2OKQA 2YKQA 2WOMB 5GAHU 1GMVA 1WC3A 4LIWA 2XM3A 1C0UA 2J0XA 4JI8F 3MOJB 3DRRA 1E6YB 1X4AA 2MKYA 4USTA 2CQ4A 1WDDA 4O3PA 1ZM4A 2E44A 5JJBA 5DQIA 4HKQA 4FS1A 2GNKA 4M94A 4ZMMA 2R7WA 2DY9A 3TJ8A 1NSKL 4DQPA 1JQGA 4H4OB 4GVBB 4DU7A 2W2QP 2AV5A 2IIHA 1F9EB 2K8GA 1W26A 3LGHA 4DOZA 5KFOA 1ZETA 4ZITA 2VBXA 3DCAA 2DH9A 3VV2B 1OPIA 4KH1B 4GVLA 5DRKA 4W4MA 4YDDB 2WVDA 3RRGA 3HSZA 3LGMA 3UR3C 3T5LA 2CPIA 1LWCA 1FDAA 6FDRA 2MQPA 4EMDA 2OSRA 3TUPA 1FRMA 1N6QA 1PSDA 5H9EK 2EG2A 3MMAA 1AB8A 1X7VA 4X4PA 3W8PA 3I9V9 1WSRA 1MMNA 2WONB 3KWMA 3HHNB 3NBPA 1TQLA 1U1KA 1R3NA 3O5TB 3KK3A 5AXKA 1RT3B 3CJRA 2BUNA 1D8ZA 3NLCA 4J9OA 2GQQA 4X65J 5HBMA 5KT4A 3W3SA 3VGSA 4B3MJ 5BYQA 2AWZA 3RW7A 1M1HA 2CJAA 4CI0B 4DR4J 2ZVSA 1FTCA 2IVMA 4PXDA 3TX8A 3F56A 4LF9J 2KFYA 1KHWA 2OJ3A 3NWGA 3ZTPA 1WSVA 5AXLA 1HBUA 3IS9B 4YB1P 1REGX 2V8DA 4CNYA 3BDEA 2NXCA 1GX5A 2NXJA 2JWNA 3I0SA 1FJ7A 3QT6A 2YKOA 4X66J 4OZ2A 4BC9A 1HNIB 2H4WB 5ETRA 1Z4UA 3IGVA 4F3OA 4M5IA 1EJ7L 1LWEA 2HIQA 2WRMA 5KFKA 1VC5A 3PO5A 3GWCA 3CVKA 3MEDB 2K7JA 1BXNA 3H5SA 3ISZA 5CXTA 4ED1A 3HT3A 3M1VA 1FJGJ 4CP5A 1YWXA 2DEJA 5J2PA 3R1HA 4L76A 1KVJA 1KBRA 3CCRS 4LF7F 4NLQA 1UJ4A 4LFAJ 1BMQB 4ED4A 1SUQA 4CO2A 2W9CB 1B7FA 3KMQA 2H3EB 4CLFA 2VU5A 3H59A 2GHVC 4QR2A 3A8JA 3C6TB 4OV6A 3L3CA 2V63A 4Y34A 2B9EA 2DNGA 3MM5B 5J2NA 2KFZA 2IPOB 4U6PA 4MIAA 4PR6A 3PIPQ 4I2QB 5IT9U 5HP1A 2AMCB 2GA7A 4ZVFA 4CLLA 1UEUA 2VBZA 4WZQA 4QBUA 3OL6A 1RYSA 2V4RA 4R5PB 3PJWA 1J2VA 1GX6A 3KG1A 4GRSA 2YQ1A 3QFWA 1S7IA 1IKXB 1LV5A 1Q16B 5K5MA 4NMLA 2GQCA 3MMCA 2H54B 2OPSA 1HD1A 5HMXA 2F65A 1YG0A 2DHSA 3CJTA 3H2VE 2VDIA 2ZBIA 2GFFA 2ZBQA 1ITPA 2NXNA 4ELVA 4K59A 3GPAA 5BYRA 4U8VA 5RUBA 5L9NA 3AHPA 1EX8A 1AA1B 3L9ZA 3AAWB 3DLEA 4QWBA 1ZM9A 3H25A 2JVOA 5T7LA 3JYTB 2VKZG 1WI6A 3KLEA 1ZM3A 1XR7A 1TTHB 4NZ7A 5KFYA 5A8KA 4NA2A 4KHRA 4UOGA 3C6UA 5HQMA 3FC9A 1HWJA 3ELHA 3R9LA 4NCGA 1Z1ZA 3C15A 2VA2A 1IBKJ 1ZPWX 4DCOB 1SQGA 3PEJA 4CLTA 1R43A 3N6LA 3RRHA 3OW2R 1DQ9A 2PDAA 4NLTA 1RB0A 3BJYA 2GO8A 4PUOB 3T6BA 3KHHA 3NY0A 4ZVEA 5IV3A 3SZ2A 3FFIB 4LVNP 2YX4A 4Y6IA 3CDEA 4O4RA 5E41A 1TR0A 2DNPA 2RRAA 5A2QU 3D2WA 3TP2A 2IFXA 2V8HA 2V6AA 4DJBA 2KT5A 1RTJA 4HT7A 2QMUB 2HGNA 2FVSA 1QE1A 5IWAF 3IRWP 3EDQB 1Q5VA 1WI8A 4OX8A 1CPZA 1MWQA 1XMBA 5AE1A 3NGTA 4O4GB 1S72S 1KQGB 2R42A 2FZGB 4C11A 1VRUB 3M2RB 4OHZA 4TU9A 1NK7A 3QZ8A 2OEJA 1KTQA 3IR5B 2YTCA 1KN6A 1U26A 1DHMA 2ZDOA 3W5ZA 4YY3J 3JXOA 2Q79A 4P10A 4AXIA 2BJDA 1NDLA 1TZ0A 3NL0A 1KKHA 4QWCA 3V6KA 2RDDA 4Y2CA 1S9GA 3X3UA 2D3O1 2FHJA 4ED5A 4MYUA 3D0HE 1VK3A 4D3HA 2HNDB 3N0VA 1N5VA 2UVWA 3EMTA 3LUYA 4J9KA 2MB0B 4WE1B 1RT5A 2EI5A 3ENQA 3M32B 2BE9B 3MR5A 4DUYJ 4X4OA 5U47A 1MU2A 2CRLA 2MLYA 4IR9A 2FQQB 4IFVA 1N33J 3I87A 1WORA 3AD9C 3QJJA 2FPHX 4ILRA 3A8KA 2FJBB 3MCOA 4TYBA 2EFQA 1U6FA 1CS4A 4NLOA 2XWYA 1CG2A 2XSJA 1FXDA 2M3DA 1RWKB 3ZZZA 2JLFA 3PW7A 4U7UK 2YKNA 2EC2A 5CZXA 3H98A 5DG8A 4C8YA 4QW8A 4Y28C 3IMQJ 1SI9A 2HFSA 3G4SS 4JI3J 1SVDA 3QJPA 2LLZA 2Y0SD 2BJ7A 1U48A 4WK3A 2IMWP 3J7Z5 3CDBA 1YGYA 4HDGA 2B43A 2AJQA 2J7WA 3SYZA 3BREA 4IOAQ 3QPIA 4ZVSB 2LKZA 2YWWA 2FDNA 2BE7D 1FKPB 1NH7A 1HNZF 2NUUG 1IBMF 3GIMA 1JLBA 5FDLB 2VKRA 1BWVA 1OMSA 3F41A 2M8HA 3ILIA 3RZAA 1U7LA 4F4XA 1FFGB 3QO9A 2DH7A 1SQFA 3CD7A 4NRUA 3M6WA 4WFNQ 1JIHA 2MQNA 4NEYA 3DM2A 1TL4A 3D5MA 1FRKA 2FJAB 4NI2A 2R7RA 3O44A 4DV7J 5DLFA 2CQIA 3VF0B 4DWIA 5IT0A 3WHIA 2HWIA 4WFAQ 3VWSA 1N5YA 1UJ6A 2Y1LB 1FKOB 3CC4S 5B0FA 1A9NB 1D9AA 2M70A 4IQMA 3T1HJ 1VI7A 1REVA 4WKYA 4Q5VA 4KH0B 1TUWA 2XZDB 1QD1A 2ATLA 4ED3A 2B6AB 2ADBA 3T3FA 2RMLA 2MQOA 4WKRA 4CT9A 2FVPA 4Y65A 4IFYB 4YB7A 3AOBA 2NPIA 3ZZYA 2UUCF 5LSLA 5D78A 5L38A 4BWMA 4KGXB 4WFZA 2BW7A 4XDDA 2VZ9A 3TUIC 1RXOB 2HKEA 4RW6A 4BC7A 2HFVA 4F50A 3CIMA 3BO2A 1WF1A 4JI4J 4G3IA 2OUGA 4LSLB 2BYCA 2DYAA 4LIRA 4DV2J 1N5SA 2D69A 2XG8A 2AU0A 1Y10A 4UF4A 4CTAB 3H90A 2O5DA 1JJCB 3CCMS 4UZCA 2ABYA 3VAIA 2DHAA 2VBWA 1LWXA 1FD8A 3I0RA 1S9FA 2VG7B 2L9NA 3TRGA 2IMOA 5GMDA 2M5YA 5MLCV 2G1DA 1U45A 1DZ5A 2V8PA 4QIEA 4GC7A 3H42A 3BN7A 4FN5A 3KK2B 1PCAA 2N82B 4OI2A 5EX3A 5KT6A 2H51B 3WIVA 2HHXA 3NGDA 4S0MA 1LXJA 3L7UA 4HVZA 2F3JA 4V1Ak 1UJ5A 3GG0A 2GVDA 4ANDA 1N32J 2DBBA 4QPXA 1S4EA 3ITHA 3EGNA 5C42B 2G0JA 3EDRB 1RTHB 2QL5B 4QWEA 4URSA 1HYSA 3P4UB 1HARA 4ZLLA 3D1QA 5HMYA 3W60A 4DU8A 2MQ8A 4B3SJ 2Z58B 1R8CA 2R2RA 3R5CA 1HI8A 5KG7A 1PC4A 2QLWA 2OSQA 4R8UB 2CPJA 1JLAA 2VG5B 4FBTA 1VQSA 1F9FA 3OFGA 2IYIA 1RHMB 3K17A 3P5BP 3E01B 2MGZA 3IGNA 1T95A 4JV5F 2XMJA 1T03A 2DNOA 4USMA 5HI7A 2PE8A 1SJ1A 1X9WA 2G2ZA 3A1YG 3G8SA 2QL7B 2CNNB 2KT2A 4HI1A 5LJ5Y 3JSMB 3FBEA 4F4YA 1NK9A 1KNZA 3V4IB 2YQ0A 4MIBA 2A10A 4RNOA 2V69A 3DLGB 4LT6A 5J1EB 1QTNB 4ES2A 4ECQA 2G0IA 4P74A 2AYEA 4LF6F 3N28A 4NA3A 4B3TF 3ADAC 3RTVA 3GZ7A 2B5JB 4PPDA 1NKBA 1U0HB 2XMVA 4AL6A 2DY1A 5CYMA 4KGZB 4ALZA 1WF0A 2M52A 4MIWA 5D4NA 5LL6d 2E9ZA 2J5AA 1KS2A 1OIAA 3JQMA 2U1AA 1ZYQA 3V6DA 1DAXA 3OTBA 1R8PA 1K0TA 2HVZA 1OJ4A 3KK1B 1P9QC 2CNOB 4KJIA 3ZZRA 5J2QA 2ERRA 3DGPB 3UN5A 1OY9A 4JI7F 3FZ2A 1RADB 2AJ1A 1VBYA 4NWBA 4P71A 2GVZB 4ENOA 1FNXH 5EDWA 2B56A 2WSCC 3HP6A 1N8RT 2IC3A 3N5FA 2XY7A 4RUCA 4DQQA 3ET6A 2RRNA 1L3UA 3ZO7A 4KSEB 1KR4A 4QU7A 4OYIA 2HNYB 2HHHJ 2LQJA 1X4EA 2YWHA 4P6QA 1HWUA 3HO1A 2HQFA 3BBBA 3LF0A 3LPYA 2UP1A 3U1MA 3NGSA 4N8NA 4FF2A 2DGQA 1PJ6A 2QLXA 4NXNF 3CJ5A 3BGOP 3DRPA 1WEXA 4UOFA 4B3OA 4NE9C 1BD6A 5KFLA 1F2GA 1IBCB 2GMJA 3K5LA 4QCLA 2GMLA 1FE0A 1QSLA 4PG6A 1WHXA 4LRDA 2DNMA 4ZJLA 1OSCA 1UEKA 4BCAA 3PJ9A 3ETOA 2MYFA 4QYZJ 4ZVRB 3CSKA 4UUXA 2MY7A 2CDQA 1FDBA 7FDRA 3OLBA 1ZAXA 1Q79A 4GKJF 5CA5A 4LF4J 1U2FA 3GONA 4OI4A 1WTBA 2R8HA 3OXFA 1KFSA 2OAUA 4ELUA 1FERA 4F67A 1ZTWA 3OJUA 4DUZJ 3KG0A 2DVIA 3EGWB 4KHPJ 3EGZA 4C2MA 3BBFA 4NLGA 2HVHA 4JI6F 2YKMB 2COLA 2Z2ZA 3HFKA 1JMTA 1S1XA 5K8MA 2I5JA 4U7UD 4DR7F 3LAKA 2I0XA 2XMUA 2UV8G 5J1NA 3Q86A 2QEXS 3HVAA 1RYRA 4Q44A 4ICLB 2DGTA 3TEGA 3MMBA 1CJTA 1M5HA 3HVTA 1Q1KA 1EKSA 4PEOA 3UWTA 4OZJA 1T9TA 2WVBA 3LO3A 4PWDA 4B9UA 4RW7A 1YZ6A 4ZPVR 4DV3J 4DFKA 3K59A 4IH7A 2UUTA 3CCSS 1U1QA 4AYBD 1HNWF 1FKAF 1RGVA 3MM7A 1B0TA 5F9NA 2MLXA 4CM2A 1S99A 2ZH5A 3HF5A 1S6QA 1SJ3P 2QIFA 4OI1A 4CH7A 2GZOA 3MHYA 5HAOA 4DUTA 2KO1A 1NJXA 3FSXA 2MZJA 1URRA 3W5YA 2D7SA 2RHQB 2E5LF 2R7XA 1RU2A 4PRFA 1C4CA 3MOZA 2IAJB 3FCWA 4IO9Q 3BBCA 2RQ4A 2KFNA 2QG9B 3NS6A 1JB0C 4WIQA 1FF2A 3TX0A 4ZN3A 3VAMA 1JNRB 4PG5A 4EZ6A 5KFVA 3FSIA 2YXLA 2VPYB 4P2SA 1P6TA 2BJ8A 3PYGA 3BGLA 1IN0A 1VS3A 3PEHA 2BMBA 3DOMB 4I4BA 2BZ2A 1U8WA 2WBRA 1ULRA 1T7PA 4K4ZA 4P72A 2W7PA 1ZZNA 1IKWA 2CQ1A 4DX5A 1IXKA 2D3ZA 5KFCA 4MKAA 2RILA 4W90B 3C3LA 2QV6A 2PT0A 1IKYA 3ZZUA 3HJVA 4ED2A 1XR5A 1W2BR 3TYTA 3A8EA 4A8WA 2Z2MA 3POTA 2XTJP 4EBCA 6FD1A 1U6ZA 1KRPA 5C25B 4KO0A 2R7TA 2QT7A 4P75A 2F8HA 2H1YA 1C2PA 1IWAA 1LK5A 3Q0AA 1VHFA 4EO6A 2GCFA 5ETVA 3DI6B 2OGUA 4ILLA 1N36J 4YR0A 1G6BA 3HKWA 2G4BA 1GMWA 5A8WA 2DD8S 1NKCA 2K3KA 3UVJB 3OT9A 2VONA 3MAHA 1FA0A 1FK9B 2VFTA 3W64A 2QFIA 3GFYA 2H5JB 1YVFA 1J5EF 4ZDNA 3M2UB 2KHCA 2KB2A 2VF3A 4LF7J 2XS7A 2LCWA 2J9DE 4USVA 3DMJA 4YQWA 2F7VA 3DLJA 4IOBA 2JC0A 2W8LA 4ATNA 1WC0A 4NL5A 5E3QA 3DN9A 3FBFA 3I31A 1JKHA 5J1PA 2YNHA 1LK7A 1XBWA 2QX0A 5I3UB 1GXTA 4FZVA 1QY7A 1MN7A 1T9UA 6AT1B 3GV5B 1CJKB 3D3CJ 8AT1B 1KVKA 4GMKA 2G9OA 3Q8RB 2FGCA 3BKTA 2A0FB 4Y2AA 4G6VB 2UVRA 3HHEA 4UQTA 2AD9A 1X4BA 1YHQS 2QSWA 4ZLNA 3D7SB 2E9RX 5KFWA 2BE2B 4L6V3 3DDNA 3W2VA 4ZHRA 3PKMA 5B0AA 3IM8A 1RABB 3GCXP 2BJEA 2R2SA 3TI0A 3WQPA 1MNEA 2CQHA 2EPIA 4DMZA 4JOUA 1X0FA 4LR8A 3QAUA 3MURP 2GS8A 1JLQB 4I6YA 5KFZA 3HFZB 2U2FA 2UVUA 5H1SV 3A3OB 1UVNA 1EETB 4YMEA 2HQDA 1BHNA 3VAHA 4Z7CA 1I5OB 1V3RA 1A6LA 3BYPA 2ILZA 4PWUA 4ZOSA 4DV0F 4OYPA 5B0GA 3QIPB 2GHPA 3DU6A 1S97A 5HJYA 4EEYA 2QGFB 3CPWR 1B3TA 4CLPA 5AXMA 3LWLA 3RGIA 1IBLF 1DARA 2NSCA 1JXVA 2KXFA 2F40A 3TAMB 3T5HA 1C0TB 2IHR1 4K7QA 4ETZA 4XO0A 2LMIA 3CT9A 5A8RA 3DRSA 4FYVB 2C2NA 4HACB 3M8YA 1U1OA 1T8EA 4DV5J 3VGTA 4KYZA 2P6TA 3CJQA 2ZOMA 3P8BB 3PR5B 5FD1A 4AT1B 1MN9A 1UVLA 2WW4A 2A18A 3EJMA 3DLLQ 4PXCA 1HBMB 2VBYA 1T94A 3GMGA 4G1QB 3N9UC 4CH1A 2AGOA 2J7KA 1Q7YT 5DDPC 3Q8VA 3W2WA 3QJLA 4JI1J 2HSEB 1NSPA 4KV8B 2HK3A 3BSAA 4Q2LA 1UAWA 3ZZPA 3G8TA 3LALA 7AT1B 1ZOTA 2VQFJ 2C2EA 2BEFA 2CXEA 4U9RA 3BH6B 1U1LA 1VQMS 1RBLA 4J9PA 1HMVB 2MLZA 2LECA 1XJWB 1U1MA 2EG1A 2QTWA 3K0JA 3H4BA 2DGOA 3E51A 5HO4A 3C16B 4X65F 4K50A 2AJFE 2YNGB 3NXZA 2IDEA 1A7GE 2HURA 1YJTA 1SJRA 4Q2MA 1DQ8A 2MDAA 5KG0A 1HNVA 4B3MF 3PYFA 1B64A 1FI4A 2RQMA 1T0TV 3MPWA 3OXLA 2WOMA 3DDIA 2HFUA 3GIIA 2B51A 1YITS 4LR9A 1SKRA 1E6YA 2YWKA 3JSBA 2MMYA 3CC2S 2XMAA 3NGRA 4RUBA 3KLGB 4C8ZA 1VQ9S 3FQLA 1G4CA 4I2PB 2RF2A 4X4NA 1RHRB 3IG1A 1DLOB 4GVBA 2NPFA 2XHCA 2XO6A 1N54B 2ZH4A 3LP0B 5KFTA 1F3VA 3QQCD 1H6KX 5KFEA 4AL7A 2E5JA 2KG1A 2UUBJ 4ECWA 3N6MA 1RACB 3H5XA 4IYQA 2HPUA 2VV5A 3HKZD 3QZ7A 3IWXA 3J7YI 3BS9A 1Q8BA 4NX9A 3PX6A 5DGBA 1XNRJ 4L72B 3V5RA 3T6JA 5KT2A 1GFWB 2V8GA 3JAMU 1S59A 1SC4B 3FQKA 4LRCA 1HNZJ 2UUWA 4OHXA 2LU1A 1YIJS 4M95A 2O1PA 3SQGA 5KFNA 4K4SA 5M2PA 2C1EB 4LQ9A 1Z2ZA 3L95X 3KXDA 2QA4G 5E33A 5DG7A 2EFGA 2X7IA 4FF1A 4TLQA 2YNFB 1TK5A 2Z30B 4NEZA 3ENWA 5D4PA 3DOKB 5KG4A 1QAXA 1RKJA 3CTRA 4WIIA 3MZIA 1H3DA 2YWFA 1CC8A 2ZJRQ 4XPCA 2RAQA 4Q43A 4FYWB 1HWIA 2AQ4A 3HCXA 1HNIA 4FNIA 4X84A 2FIUA 2F4VJ 3PTWA 2QMXA 3I5CA 3FCVA 2P9CA 4YDXA 4NYZA 3MEDA 3BH7B 4N41A 4UQGA 2UUCJ 2DPJA 1XNQF 1FT8A 2F63A 2B4VA 3HVWA 4ECVA 4DF4A 1V6HA 1ZAVA 4UOCA 1SKUB 2VFVA 4DV1F 2C42A 4NPOA 2ZDPA 3ZTOA 1T9VA 1DFDA 1S10A 1RTIB 1RHUB 4AE5A 3C6TA 3MXHP 4JI2F 2W2OP 3MM5A 1ZA1B 1K47A 1VK8A 4LVOP 4DFPA 2CJ9A 1OY8A 3AD8C 3UCGA 2ZH9A 2DCLA 4I2QA 1H7WA 3GR0A 3G6VA 3U1LA 1U2RA 4XPEA 3PRBA 4OX6A 5ETLA 5M2UA 1T11A 3CCWA 3LOUA 4PXEA 1K44A 4I6AA 4FVMA 3DLKB 2CFXA 4R5PA 4DBQA 1PO6A 2RE1A 1IKXA 3MEEB 3I55S 4M5KA 4ED7A 1KEKA 4Z2XA 1TL3B 2NXEA 4JI5F 3G9CA 1K9MT 4ZPBA 3OV7A 1TFYA 3THTA 1IR1A 2W4PA 4UZBA 1GTEA 3T5JA 2PFDA 4RX6A 4A47A 4YY3F 3QLHB 3CCLS 4QR0A 3JYTA 3NGUA 3GIRA 2AZ3A 3KJVB 4A46A 3JQKA 4OJ1A 1NM2A 3GP9A 4H4MA 4CYUA 2PA3A 1N88A 1TKXB 3OVBA 5IXUA 4ZIVA 5JVGQ 4XAKA 3GIJA 2DISA 1RWMB 3EVWA 4DSFA 5KFXA 1SL0A 1X9MA 3I4PA 2DIUA 1HI1A 4JV5J 5CCLA 2JOQA 2W4DA 3HI9A 1YJRA 4P2MA 3OVAA 2ZM6J 5LJ3Y 1FJCA 1HPZA 4Z37A 2CIMA 1VRQC 3SCJE 3TVKA 2EFVA 1HLWA 1P27B 2HLTA 4PUOA 2XS5A 1CQMA 2I1RA 4DG1B 3HPOA 3FFIA 4USUA 1HBOB 5HVGA 3SV3A 2VFSA 3O1LA 4RU9A 1AZSA 5AXNA 3DNCA 5G4DA 1D8YA 2CWKA 4FXWA 1LFWA 2VIHA 4HHHA 2J9DA 4CO3A 2OMLA 1Y4ZB 2P5VA 2A2CA 3M05A 1F0XA 1OQ3A 1U8SA 4P2XA 2W8KA 3M2RA 1TU0B 3CCQS 2LEAA 2BANB 5IZHA 3OTEA 4JI3F 4RO0A 1DQAA 4PCQA 3K8VA 2HVEA 2FLNA 4WZMA 3FCHA 1S0MA 3DRRB 2MTLA 2ZBPA 3WBZA 3UFCX 1RU1A 1Q82T 2H5EA 1V3SA 2PIIA 1KONA 5CD4A 1FRXA 4NASA 2ZH6A 1S6PA 2PMWA 2AYGA 5JUMA 1O5JA 1RTDB 5HQ8A 3CUNA 3G96A 3AT1B 2XEXA 1Q8LA 4G1PA 4OZLA 3CGIA 1DBDA 5L1IA 1PILA 4WE1A 3M6XA 4JV2A 2GGPB 2V2KA 3M32A 3I5BA 3PZPA 3CULA 4DV7F 2LYVA 1NBEB 3K5PA 1SXLA 2OIHA 4ZPAA 2HRTA 3ISND 3O8WA 1TV6B 2J76E 2FGOA 1N6QB 1PBUA 3OFEA 2CQBA 3D6TB 3EM1A 4DR1J 5DQGA 1U24A 3J7AN 1X4GA 2VB6A 3CJ4A 4OIXA 4HT5A 4RW8B 1FVQA 4DFMA 2ROEA 3J80Y 2W2MP 3MEGB 2DIVA 2R8JA 1JJHA 1R6YA 4O3RA 1HQ2A 4CM0A 1IQZA 4DPWA 1XQIA 3KHLA 3A8IA 3QT5A 3HHLD 4F26A 3EZOA 3R6LB 3DFEA 4KGVB 4GKJJ 3I0SB 1FKPA 1RLCL 3IXQA 1Q81T 5FDLA 4PWWA 3CEDA 2E5IA 2WAQD 1WC5A 2ZKUA 2R7QA 3MF5A 1LKZA 3EPGA 2F8EX 1OWXA 1LWEB 4B02A 2HMIB 4OZ1A 4JI6J 2KM8B 5IQQA 3MPDA 2HHQA 5HROA 1RISA 2XMKA 3T19A 2Q66A 2I8EA 3GJRB 1NCLA 3OQ2A 2PI5A 2OI2A 1ZBTA 3NGKA 2DHGA 2MHEA 2JC1A 2VDHA 2V2QA 2EK6A 3CB4A 1VDHA 1N32F 2FJVA 1GQEA 3CDAA 4B9NA 1FKOA 4ZIWA 1F6TA 3GSIA 2PFFB 2N7CA 4ZCIA 1IKVA 2EFOA 1WC4A 4QU6A 2IBKA 1D1UA 3M30B 1EIYB 3MFIA 2AX0A 2CQ2A 2HK2A 2B6AA 5CQGA 1HNWJ 2RNEA 1QUPA 4XDCA 4IFYA 3M8PB 4B3SF 1NK8A 1TMJA 2IM3A 3J81j 1NDCA 3MECB 2MXYA 4E8UA 3C2PA 4QWDA 1FD2A 3B4DA 1ELOA 2QYGA 3CJKB 4N77A 1W25A 4LSLA 3M8QB 3MI7X 1BQNB 1EQMA 2RD5C 4IH6A 5LT5A 3M8WA 1RT7B 5BR8F 2E5LJ 3OL8A 4F8RA 4A8YA 3D6FB 4ECZA 5E7OB 2UV8A 2XY5A 2O3DA 2XMMA 2CPZA 3WX4A 3K58A 2D3OR 2VG7A 2ZNZA 2Z2LA 3V2UC 3NP5A 1OPZA 3DLEB 2E1MC 2VH7A 3PNIA 4F0HA 3KK2A 5T7LB 1MMDA 3KLEB 4EUVA 5EGYA 2N7YA 4LQ3A 4K0KF 3FJ2A 2ACMA 1B7YB 2BKOA 2BOAA 4HR2A 2ZFHA 1F5BA 5C42A 3KTQA 2P2CB 1RTHA 4Y0FA 2DGWA 2RS2A 4OYAA 1IVZA 3UDCA 2ASJA 2K7KA 1FXLA 4NCAA 5F8JA 1I1GA 2HS3A 3LPEA 2ZZMA 3W63A 3BPDA 2Y3YA 4U67Q 4KR0B 4MTPA 3CJ8A 5C7PA 3BQ2A 1VQKS 2ZWPA 4IUFA 1HHQA 1PJ7A 1JLFA 1H72C 4DPUA 3CCVS 4M5DB 4R8UA 2Y9HA 2VPXB 4DDFA 3R8YA 1LXNA 4RW9A 2P9GA 3RU0A 2ZH2A 3AQPA 2FLOA 2GJ2A 3E01A 3J7YU 2NLWA 3C14B 5JMNA 3DRYA 3Q2TC 4LRBA 1YDLA 4ECYA 2EWHA 1YRXA 2PA8D 4URGA 1VGYA 1QAJA 1J5EJ 4LBHA 1Y5NB 2JDJA 3HSDA 1VQ5S 2CWXA 2BABA 2XMTA 1HWLA 1H38A 4MJKA 1YJUA 1X5SA 2EEYA 1NRKA 5ITHA 4C0OC 3V4IA 5DZ6A 5J1EA 3DLGA 2D74B 3ZTRA 2YKAA 3MM6A 3K2YA 1ACMB 3TQ1A 4IG3B 2KJWA 1XC9A 2POKA 5F3ZA 1FDDA 2B5JA 2UXBJ 5F0WA 4FP9A 2YNIB 3OFFA 1VQ8S 1UVJA 2ZZNA 4NA1A 1M5SA 4KPYA 5GMEA 3AFGA 3DU5A 2V9WA 1M5KC 2RDIA 5I42B 3KK1A 1F1BB 1TELA 2RT3A 4HEA9 2HFOA 1E6VB 3DGPA 1BQMB 2C2KB 4RU2A 1S6OA 2M4MA 2FHKA 4ZP9A 2N4DA 2PEBA 4DR5F 4DUZF 2XSFA 4KRWA 5F8MA 2CJQA 2XSJB 1I51B 1SIWB 1Y11A 3UNYA 3GQCA 1HD0A 4PAAA 2HNYA 4I56A 1NUEA 2XB2D 1S1TA 2YKNB 1TAQA 2DO4A 3FEZA 1WOSA 3JTNA 3D6HB 5KFQA 5K8PA 3MD1A 1VMBA 3H8YA 2WBMA 2LA6A 3KHGA 3I32A 9ATCB 2K1RB 1NB2A 3TARA 4DV0J 1SC1B 1TFWA 1YLXA 5D3GB 4DV3F 1H74A 5D77A 2VOOA 4O3NA 1FJEB 2F9DA 5IV4A 5IT4A 1IBLJ 2DRBA 2ZE2B 3CMAS 4C0BA 1S1UB 1LW0B 4M5JA 4MAKA 1S1VB 3D54A 2BKNA 2ZHOA 4M8LA 2KJVA 3NS5A 4OYXA 4Q7AA 3QRQA 5KG6A 3W8GA 3GYXB 2VC1A 2FHMA 1Y00A 1X31C 4O44B 2DGVA 1TK0A 1N5YB 4ZLPA 3V6HA 4I68A 2KRRA 1K8AT 2KZMA 1HL6A 2MZQA 5LXYA 1WEZA 3G86A 2QA4S 2Z4PA 3ZXWA 3OTOJ 5SZTA 1JLEA 2YKMA 1GT8A 1CBKA 4P73A 2I38A 5B0DA 2HFZA 3BSCA 4J90A 5KFPA 3DDKA 4N8OA 3GLJA 4DLGA 4WPAA 3HMJG 4ICLA 1HNXJ 3RAMA 8ATCB 3J80U 1S0OA 3SFUA 2F8MA 1Q4RA 1WELA 1SH3A 4HH0A 2DRDA 1TKDA 3ZFVA 2J0SD 2ZKTA 3H2LA 3EVOA 4M5GA 1AW0A 5LMUJ 1RWNB 2JFDA 3M6VA 5F8HA 2DNQA 4TY8A 3CC7S 2EFNA 2V94A 1RBAA 2PI4A 3B54A 2V4JA 1SJQA 5SUHA 2D1CA 3JSRA 4EYIB 3BZQA 3R2CJ 4E2FB 1FCAA 3QMQA 1R8AA 1RKIA 3UD3P 1TL7B 1RE1B 4C8OA 3CJSA 3DYAB 3TVZA 1U49A 3VZIA 4EZ9A 3NNHA 1N36F 4FKYA 5E3RA 4KT0C 4LF5F 1RTZA 3BKFA 1RUSA 3KDOA 1S7HA 2QLJB 5J2MB 2J0QD 3M8SA 1XMQJ 1UW4A 2IAJA 4Y3CA 4DXLA 3TOQA 4LBPA 4X4SA 2YX7A 1TKZB 3HDSA 3BF4A 4JBCA 1VQ6S 4LSNA 2N3OA 3VAGA 2CPHA 3RRKA 4USKA 3DOMA 2D41A 4NOHA 2FJEB 4OYOA 2M7SA 2WTFA 3LA0A 4P7VA 2OHDA 1I6JA 3J81Y 4BDPA 4LSZB 2M9KA 2XYPB 3TR5A 1M90T 2JEFA 4TXSA 2YWEA 1T9YA 3A4TA 2GJIA 1NHUA 2WVEA 5BJRA 3VR1A
chains in the Genus database with same CATH topology
2F4FA 2XM3A 2A6OA 2F5GA 2EC2A 2FYXA 2VICA 2VJUA 2VHGA 2VJVA 2XO6A 4ER8A 2A6MA 2XMAA 2VIHA 2XQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4F A;  2XM3 A;  2A6O A;  2F5G A;  2EC2 A;  2FYX A;  2VIC A;  2VJU A;  2VHG A;  2VJV A;  2XO6 A;  4ER8 A;  2A6M A;  2XMA A;  2VIH A;  2XQC A; 
#chains in the Genus database with same CATH topology
 1JLG A;  4UT4 A;  3CO9 A;  4R25 A;  2UXC J;  4LJM A;  4P7T A;  1R7I A;  2ILY A;  4OX7 A;  1DTT A;  2C28 A;  3AY0 A;  2DRA A;  2HS4 A;  1OQ6 A;  4J91 A;  2LP4 A;  3JS9 A;  5GAG I;  1AYE A;  3PHT A;  5KFA A;  4B9M A;  5C25 A;  5KAK A;  4Q0B B;  2XUL A;  4FS2 A;  2YWG A;  3W61 A;  2CPF A;  5ETO A;  2L9W A;  4C8M A;  3DI6 A;  2R7S A;  4ZPD A;  4ZPW R;  3UVJ A;  3KLF B;  1GXL A;  4DN9 A;  1FK9 A;  3BQ0 A;  3TAP A;  1R0A B;  1VC0 A;  1SJ4 P;  3KNA A;  4L74 A;  3TUZ C;  1XNQ J;  5I4M A;  3M2U A;  3PY8 A;  4C97 A;  2ROG A;  2HBY B;  4CLW A;  2PGC A;  2C3Y A;  4ZCM A;  4AL5 A;  4DV1 J;  5L1K A;  2E66 A;  1UET A;  4USH A;  2H9Z A;  4TU8 A;  2MQM A;  1TL5 A;  2B4U A;  5CCM A;  4LUB A;  4H4K C;  2AKW B;  5C24 B;  2EBE A;  5J2Q B;  3RG6 A;  4E98 A;  1M1G A;  4JI2 J;  3RAX A;  3TZZ A;  3HHL B;  2IVY A;  3T9N A;  2DO0 A;  4BWJ A;  2UZA A;  1RT6 B;  2Z2Y B;  1FXR A;  2YPY A;  1QUV A;  5I3U A;  3N01 A;  5A76 A;  1GAO A;  1CJU B;  2CNK B;  1KLM A;  4N5S A;  2BJ1 A;  2Q3P A;  1RAF B;  2XCA A;  4IRD A;  2A2D A;  4TQS A;  1CJK A;  4IO1 A;  1H98 A;  3ZTQ A;  3UNG C;  4DV5 F;  3FMB A;  1C1C A;  3FEY B;  4Y2M A;  4MFB B;  5F41 A;  5A0Y B;  2K3I A;  3WX8 A;  3KLI B;  4WCE Q;  2WZ1 A;  4PQU B;  4JI5 J;  4DSJ A;  3TA0 A;  3DRP B;  1HA1 A;  2BE2 A;  3DKD A;  1NK5 A;  4YR3 A;  2GHW A;  3RUB L;  1AUD A;  4JI1 F;  4OYB A;  4CO4 A;  4TVA B;  1U6B A;  3TUJ C;  3RB6 A;  1Y0H A;  2BRL A;  2VQF F;  2GQ2 A;  2XZT B;  1F5C A;  1JLQ A;  3GJQ B;  2OTJ S;  1NJW A;  3CCE S;  3DC2 A;  2RRB A;  4ZVO B;  2PMZ D;  3HHK A;  2HLU A;  2MJU A;  2GV1 A;  3MGJ A;  1D9D A;  4CLZ A;  5E0O A;  4QIG A;  3DXS X;  4YHH J;  5L1L A;  2MKI A;  1WG1 A;  2HHP A;  3ENA A;  3G87 A;  3GSD A;  3N5B A;  3OTD A;  2JZ5 A;  3W5X A;  2SXL A;  3LQV A;  1IUJ A;  3TAM A;  2BQU A;  2OO4 A;  3R7N B;  1MRO B;  4NLY A;  3KLV A;  5T41 A;  1PGZ A;  3PIO Q;  3TZW A;  2WW8 A;  1CUL B;  1X4F A;  4C9D A;  5G0R B;  2CQC A;  1CJT B;  4TQR A;  2KH9 A;  2UUB F;  1D9F A;  3HVT B;  2AJ4 A;  1C1B A;  3FK4 A;  2HIY A;  2KG0 A;  3FGV A;  1O6X A;  5ETK A;  1CQN A;  1U0S A;  3W1Y C;  4RNF A;  5F9L A;  4PWD B;  1OSD A;  4I7F A;  2F5G A;  4KV8 A;  3R5D A;  4IH5 A;  1XNR F;  1TKT A;  2GAG C;  5D4O A;  2XNQ A;  4OI0 A;  3MM7 B;  2MZ1 A;  1HMV A;  1Q8K A;  1RHQ B;  2MQL A;  2HBQ B;  3MAA B;  3C16 A;  2DXD A;  3E3X A;  2ZJQ Q;  2D9O A;  2YNG A;  3ILO A;  3MUV P;  3K5M A;  2H65 B;  4KIA A;  2KKH A;  4RNH A;  5ETT A;  2CJK A;  3P96 A;  2QJ3 A;  3Q8Y A;  4ZPT R;  4DV6 J;  2EW9 A;  4MK9 A;  4DCJ B;  2C2Z B;  1FE4 A;  2CKW A;  4WXO A;  3GTY X;  2JVR A;  1L3S A;  3MD3 A;  2B9X A;  1EAR A;  5F8L A;  4DQS A;  4I2P A;  4F0M A;  1FEH A;  1X0P A;  1DLO A;  4NLU A;  3LP0 A;  3UPF A;  3PV8 A;  4JUZ A;  3OHA A;  2DXE A;  4ECS A;  5L8R C;  2XLJ A;  4CO5 A;  2F4V F;  4OJ3 A;  1MG7 A;  4OZ0 A;  4RNM A;  4M1K A;  3CIZ A;  2EXU A;  5CYJ A;  2HVD A;  3L7O A;  4KBI A;  3G6E S;  4DZD A;  4ZCK A;  4DX8 H;  4WXW A;  3AA9 A;  2ZOG A;  2IM0 A;  1RHJ B;  1IKY B;  3RBD A;  2VOP A;  1KSP A;  1H2T Z;  4F4Z A;  5MAO A;  3QNW B;  3IAM 9;  3D66 A;  3F44 A;  3AOC A;  5IM0 A;  2C2M B;  3SEO A;  2BQR A;  3SBM A;  2FLP A;  4OX9 J;  2C3O A;  1NZ8 A;  2IRY A;  3BGR B;  4PQA A;  1R8B A;  2FC9 A;  1JXE A;  5IFM A;  3ZC4 A;  1HFE L;  4EU0 A;  3QWP A;  3A13 A;  2A1B A;  2KXH A;  4NRT A;  3AD7 C;  1MLA A;  5KFD A;  3GYN A;  3GE9 A;  4KQZ A;  1ZAW A;  4GKK F;  4LF8 J;  3DOK A;  3R2D J;  1BQX A;  4ANC A;  2JL9 A;  1WKK A;  3BB5 A;  3VAJ A;  3MTJ A;  2L08 A;  2CJX B;  2DNL A;  4WK1 A;  2EK1 A;  3C66 A;  2ALZ A;  1QM9 A;  3DOL A;  2V5H G;  1VOM A;  1NB7 A;  2RB7 A;  3M2V B;  2OPP B;  2ZH8 A;  5KFM A;  1C4A A;  3DLH A;  4DQI A;  2VC0 A;  4ELT A;  4DF8 A;  4UY8 T;  2YNH B;  1KQK A;  2HHV A;  4J9S A;  2IM2 A;  1WWH A;  3QSI A;  4OYW A;  4HH1 A;  4YEA A;  4USW A;  5HAN A;  4OI3 A;  3J81 U;  3PYD A;  1K73 T;  2BXJ A;  4RPF A;  2YVS A;  4RBT A;  2Y8W A;  3M8R A;  2YY3 A;  2A6O A;  2MPU A;  4C6A A;  1RTI A;  2KVI A;  1GEH A;  3MM9 B;  1LW2 B;  1RA6 A;  1UVI A;  1OYE A;  4K4V A;  2GW8 A;  2MZR A;  5BR8 J;  2XGP A;  2B7B B;  4U8Y A;  2ZM6 F;  4OLO A;  1GTH A;  4EGL A;  2IDL A;  4MK7 A;  1VLY A;  1KD1 T;  3UD5 A;  5KT7 A;  2UVV A;  5KOW A;  3G6X A;  3DLK A;  2Y1R I;  1RQ0 A;  2HAI A;  3VCD A;  2QMW A;  4DQR A;  1X60 A;  3MEE A;  3PCO B;  3ILL A;  3HSG A;  1N56 A;  4K8R A;  1TL3 A;  3K8W A;  4K0K J;  2JEG A;  1TL1 B;  2WB1 D;  2AF6 A;  1T05 B;  2DTJ A;  3IWL A;  1F9H A;  3W62 A;  4DEZ A;  2VQE J;  5DGA A;  1VQ4 S;  5F8G A;  2MJN A;  3QLH A;  4JYA F;  3KJN B;  3CF5 Q;  3KJV A;  3P49 B;  3BM7 A;  4KKO B;  2XC9 A;  3SMZ A;  3KUE A;  3CJ3 A;  2E1A A;  1SC6 A;  1SL1 A;  4N76 A;  2AJ0 A;  3V4M A;  2ZOF A;  3KOA A;  2GIF A;  2P8I A;  3W9J A;  4JI0 F;  1BLU A;  1VIS A;  4CO0 A;  2V2V A;  1UFL A;  2MEW A;  3DLB A;  1JJ4 A;  1SJF A;  1NJY A;  1VRT B;  3FUY A;  3TVY A;  5GVQ A;  2KHD A;  3OPK A;  4NLW A;  4FYX B;  5DG9 A;  4PYD A;  3EZU A;  2CPX A;  2EKY A;  1ZA2 B;  2HQ3 A;  3R3T A;  1Y3J A;  4CDI A;  5FII A;  4DG1 A;  2C3M A;  3DXB A;  2E5H A;  3IP0 A;  3VQS A;  2DHH A;  1TK8 A;  1RBO B;  2WK4 A;  3NAH A;  4DR1 F;  2AYM A;  4NYO A;  5ETN A;  2FVQ A;  2VAS A;  3VGU A;  3FZB A;  2B7C B;  3THV A;  3MFH A;  2R7V A;  3M9N B;  3LP1 A;  3ICL A;  4ZP8 A;  3C19 A;  4A8K A;  2F4F A;  4OJH A;  1MML A;  3HZE A;  3KJF B;  3D68 A;  9RUB A;  4DZ6 A;  1HHS A;  4WBF A;  1SV5 B;  1CLF A;  1SKS A;  1PC5 A;  3IA0 A;  2Y1I A;  1WC1 A;  3P3D A;  2BAN A;  2VPZ B;  1KQS R;  1FVS A;  3LP2 B;  5M2R A;  2Q1L A;  2J6S A;  2FYX A;  3N6N A;  3UN3 A;  1UFW A;  4QPT A;  2VG6 B;  1WD6 A;  4EYH B;  3CJ0 A;  4LRE A;  3QRR A;  1NXI A;  5E5N A;  2FD2 A;  1JJ2 R;  4PG4 A;  2DPI A;  1RWO B;  5ETP A;  2EFP A;  4KGK A;  1X4C A;  3GJT B;  2RF2 B;  2DR9 A;  2HWT A;  3IG1 B;  4DR5 J;  5EWE A;  1RT4 B;  3T1Y J;  3H5Y A;  2HW3 A;  1RTD A;  5HAT A;  1K1Q A;  4HI2 A;  1VQL S;  1N0U A;  1TP7 A;  4M63 A;  3OD2 A;  4DHV A;  5F3T A;  4C98 A;  5HLF B;  5EWF A;  3EIC A;  3S7R A;  4XIU A;  2GGP A;  3SCL E;  3MUM P;  5KFU A;  2YPZ A;  4K4T A;  1ARO P;  5F8N A;  3BEG B;  2JFK A;  5GAD I;  3UO0 A;  5FLX U;  3N4W A;  1GK8 A;  3QT7 A;  2NSB A;  1TV6 A;  3TO8 A;  1RDR A;  3T41 A;  3RW6 A;  3IBF B;  2DT9 A;  3VQT A;  2ZD1 A;  1HQE B;  3FBC A;  2NCK L;  4CZC A;  2BVZ A;  2ZWO A;  3IRX B;  3JAM Y;  2R8G A;  5L1J A;  2W9A A;  1FTR A;  3O6Q A;  2V34 A;  3HM9 A;  4KAI A;  4J9Q A;  3ZNU A;  4C8L A;  3UW1 A;  4RW8 A;  3SQG B;  1RK8 A;  4HYK A;  4NMX A;  5I3Q A;  3MEG A;  4RWX A;  2V4Q A;  1XIQ A;  2XWX A;  2BAC A;  1QSY A;  5DDQ C;  4ZVT B;  1KC8 T;  3TA2 A;  4F3M A;  5K20 B;  1U1P A;  1YJW S;  5LXR A;  2OPQ B;  4RWW A;  5ADZ A;  2LDY A;  1PAU B;  3B78 A;  1P9Y A;  1D09 B;  2EVZ A;  4FKX A;  4XTT A;  1URN A;  5CYQ B;  2MSS A;  5DLG A;  2RSQ A;  2HWH A;  1NAQ A;  4J7C A;  4MYT A;  3L09 A;  2W2P P;  2M88 A;  2HYI B;  2PC6 A;  1BGX T;  2RU3 A;  1B0P A;  1P1T A;  2OEK A;  3PW0 A;  4DX6 A;  1EB0 A;  3CE8 A;  3X1L B;  1B4S A;  3GFX A;  4WFY A;  1HBN B;  2H4Y B;  2HMI A;  3OR2 B;  3RB0 A;  1Q8I A;  4K2X A;  2XHW A;  4WP8 A;  4JB8 B;  4TNO A;  4IRK A;  2G2Y A;  4PYA A;  4CLY A;  2AIR B;  4A8S A;  1S9E B;  4HDH A;  3TZY A;  3GIL A;  3K7R A;  3MCS A;  3H4D A;  3NNC A;  4WTY A;  1T3N A;  4DR3 F;  3I9Z A;  3SSS A;  1QAY A;  3EVM A;  2FJD B;  4N56 A;  2KXN B;  5ETQ A;  5K8O A;  3M30 A;  5KOX A;  2QN6 B;  2ASY A;  2NYI A;  3EZ5 A;  2RHS B;  5KT3 A;  1WOO A;  2WSF C;  3D9B A;  4QR1 A;  5D0H A;  3M8P A;  4JV0 A;  2KM8 C;  3W65 A;  5T14 A;  5D0E A;  2HEK A;  4O3Q A;  1Y3K A;  3MEC A;  5EHH A;  2IYG A;  3SCI E;  1LNQ A;  3EUN A;  2HRY A;  3UI3 A;  1IWG A;  3FMW A;  3CJK A;  3OLA A;  2B9Y A;  1EQ0 A;  3M8Q A;  1BQN A;  1HR0 F;  2CQ3 A;  4NXM F;  1CSJ A;  1S0V A;  3E2E A;  3A3N B;  1OYD A;  4ZVG A;  4LF5 J;  1HWK A;  2G0C A;  1RI7 A;  1RT7 A;  1JLC B;  4OHW A;  2HAF A;  3GCW P;  2KT3 A;  1PBA A;  3VAF A;  5KFB A;  2QRR A;  2XMW A;  3I82 A;  3JQJ A;  4FYY B;  3HJF A;  4IG0 B;  4ZA1 A;  1RP5 A;  2MKK A;  1UA0 A;  4F0K A;  4OHY A;  3QYY A;  4N47 A;  3KUG A;  4ES3 A;  3TJA A;  1WUU A;  1KTV A;  2AX1 A;  1N34 J;  4H4M B;  4YB6 A;  4CYU B;  3JSY A;  1AFJ A;  3IR6 B;  4O23 A;  1VHI A;  2GAH C;  1RLD A;  3G2X A;  2P9E A;  1FNM A;  5DDR C;  3CCJ S;  3NRB A;  2JEJ A;  2GO9 A;  3M9O B;  5H9F J;  2G1H A;  1B70 B;  2IJR A;  2UXB F;  3OXG A;  4DPT A;  1WHW A;  2OPR A;  3QGH A;  4HHJ A;  1DTQ B;  1SQE A;  1JNZ B;  4HTI A;  3M8Z A;  2M8D B;  1WKL A;  4ZPC A;  3AJ2 A;  1HPZ B;  4B9V A;  3MM8 A;  5K14 B;  2BX6 A;  4ED8 A;  2GC8 A;  3OR1 B;  4QW9 A;  4JP8 A;  4LR7 A;  1QSS A;  2C22 A;  3AQO A;  3OL7 A;  4J9V A;  3QRP A;  2IJF A;  5I3P A;  4O3O A;  5B0C A;  1LWF A;  4M5D A;  3PYE A;  1AZS B;  2HBZ B;  1PYS B;  5BXI A;  2ZUG A;  3OBI A;  4GC6 A;  1F3F A;  3C14 A;  2J8A A;  2OFH X;  3Q8Q B;  4XK8 C;  1EAY C;  3LAN A;  1DUR A;  2X3G A;  2J6T A;  4IDK B;  1HQU A;  2B4O A;  3QAE A;  4C48 A;  2OP5 A;  1FHT A;  4ZCL A;  1SC3 B;  3BR8 A;  3I56 S;  1I94 J;  2KN4 A;  4JV1 A;  2YH1 A;  4IG3 A;  4EBD A;  3UN2 A;  2AEM A;  1D3W A;  1S6P B;  3BO4 A;  2YNI A;  2W9B B;  1ZH5 A;  1R0B G;  4RLE A;  1VQY A;  4A8F A;  3OSN A;  2V0N A;  3HX9 A;  4Q8E A;  4OV1 A;  3TAQ A;  5IC6 B;  4HTJ A;  3O3L A;  4I69 A;  1HI0 P;  3KMS A;  5HN0 A;  5I42 A;  2CAD A;  1WEY A;  4ECR A;  5D15 A;  2R8I A;  2W4C A;  1FRI A;  3BKU A;  1WHY A;  2MST A;  1E6V A;  1M0S A;  3L4B C;  1BQM A;  4NLR A;  3MTK A;  4I0W A;  4YP3 A;  1FX4 A;  2YH0 A;  1UVK A;  3V6J A;  1RCX B;  2QL9 B;  4X2B A;  3KJQ B;  4TLR A;  1YSJ A;  3MDF A;  3IO1 A;  2BJ3 A;  3QAT A;  1NND A;  4PG8 A;  2MY8 A;  3OTO F;  2NUH A;  3W9I A;  1IR0 A;  5CAB A;  3FKB A;  2HQG A;  1H73 A;  1XK8 A;  4O0I A;  3HVR A;  4AFF A;  1F5A A;  2XI3 A;  1UL3 A;  4DL5 A;  2FZC B;  2MZT A;  2JX2 A;  1T3O A;  3VGV A;  1X5P A;  2CPD A;  2GJF A;  4DSI A;  4RBU A;  4ECT A;  5A6P A;  1HNX F;  2Z8Q A;  4F7V A;  2KYZ A;  4DCP B;  1RCO B;  4QJV A;  1RT1 A;  2EBG A;  2K1R A;  5C2G A;  4PG7 A;  1L5U A;  3C8Y A;  2ACY A;  4W98 A;  1S49 A;  5LMU F;  5D3G A;  3D1O A;  4ANE A;  2GIR A;  1ZZF A;  2KVQ E;  4TKT A;  3MEK A;  5AE2 A;  3CO0 P;  1IJF B;  2ZE2 A;  1S1U A;  3ONQ A;  1LW0 A;  4ED6 A;  1VQN S;  3HFV A;  1S1V A;  5HRO B;  3SSQ A;  4NLV A;  2DGS A;  1WTF A;  2DNR A;  1NK0 A;  2AYB A;  1NJZ A;  4H4O A;  3KLH B;  2CJY B;  1N5T A;  4FDF A;  1ZM2 A;  3PVX A;  1X4H A;  3E8O A;  5DM7 Q;  2YX1 A;  2QC3 A;  1WG4 A;  3D0G E;  4O44 A;  4BLG A;  3BDP A;  2BA9 A;  3AXM A;  4AXJ A;  2RUS A;  3D67 A;  4P2F A;  3GU0 A;  1XMQ F;  4ECX A;  3I6P A;  1IKV B;  5KFS A;  3PKY A;  1UWB B;  2XI2 A;  4HL9 A;  1B99 A;  4RUH A;  3VTI A;  1IR2 A;  4FF3 A;  3CJ2 A;  2FJX A;  1YZ7 A;  4WJB A;  2FJW A;  4I64 A;  4ZS6 A;  3B82 A;  5B0E A;  1CJV B;  2PD1 A;  3A3P B;  3RB3 A;  2OD6 A;  3AJ1 A;  1NK6 A;  3P6Y C;  2FHJ D;  2QLB B;  2WON A;  4OYZ A;  2HNZ B;  2M0G B;  1AT1 B;  4W92 B;  1RT3 A;  3NKY A;  4KY3 A;  2RKI B;  3H0P A;  1U2C A;  2Q43 A;  4DPX A;  1PYO B;  2J0W A;  2R4F A;  4CCH A;  2Y1J A;  2K2P A;  4DR6 F;  2Z57 B;  1KP6 A;  4X4Q A;  2VFU A;  2UXC F;  2Y0B B;  3CDU A;  3SSR A;  1RT2 B;  4AQY J;  4TYA A;  2M2B A;  4DPO A;  2F1F A;  3AXK A;  3IS9 A;  1R6V A;  1TL7 A;  1V3Z A;  1OS5 A;  4L73 A;  4M5H A;  3OUY B;  3HSJ A;  3G8Q A;  3DYA A;  1WDT A;  4YB5 A;  1UPM B;  1X5O A;  4Z7Y A;  2O66 A;  5DZ7 A;  4X4U A;  4Q8F A;  4CT8 A;  4ZJO A;  4DX7 A;  5KFI A;  3R1L A;  4X64 J;  3H2U B;  3R5G A;  1Q95 G;  2J9C A;  3UCU P;  2C3U A;  5J2M A;  1RWU A;  4K5R A;  1L3V A;  3DGV A;  5THW A;  2PN6 A;  4J9M A;  3K5O A;  4NZ6 A;  1FWP A;  2KYX A;  3V81 B;  2FHO B;  1RAA B;  3GB0 A;  4KFB B;  5CD4 H;  1BC6 A;  1KWM A;  1WAC A;  3BYR A;  1TKZ A;  1KOH A;  4RW4 B;  4J9R A;  2DCU B;  2W9C A;  3ZTS A;  3PXG a;  4F36 A;  3MR6 A;  4F4W A;  3IBW A;  4I6W A;  1K1S A;  1NSA A;  3MMJ A;  1GXU A;  1XMO F;  2DJW A;  1SPB P;  4M5N A;  4CWB A;  1JLF B;  1PG5 B;  3MR2 A;  1Q0N A;  2E5G A;  3LTO A;  4RW9 B;  3KFW X;  1N48 A;  1L3K A;  1IQT A;  5GAD U;  3T5K A;  1QDU B;  1Y5I B;  2L9D A;  1JXL A;  5HK4 A;  4ID5 B;  2XLK A;  3IM9 A;  4E0D A;  3RR7 A;  4GKK J;  1FDN A;  2RIJ A;  4OI6 A;  4B3R F;  2CAJ A;  5KG5 A;  4RKU C;  4Q0B A;  2CPY A;  3EXC X;  1F2H A;  4WP3 A;  3ZNJ 1;  2HHT A;  3MM6 B;  2DNN A;  1J5O B;  3H20 A;  4L3N A;  2HQI A;  2NZ4 A;  3TEH B;  2W2N P;  3KLF A;  4ZK7 M;  5DO2 A;  1R0A A;  4A8X A;  4LFB J;  4DV4 J;  3VAL A;  2LVW A;  2A3J A;  3O2I A;  1NPP A;  4CIO A;  2RJZ A;  1NDK A;  4P9S A;  4BHQ A;  4OFZ A;  2UU9 F;  2QZ8 A;  1Q7L B;  5C24 A;  1YJ7 A;  4K4X A;  1VQP S;  4CH0 S;  2J7U A;  4YHH F;  3EPI A;  2KL8 A;  3ISN C;  3HHL A;  2DGX A;  1XWL A;  1S1W B;  2D3U A;  2VPW B;  3QT8 A;  4M5L A;  2QA2 A;  1RT6 A;  4KPC A;  1R27 B;  2XQC A;  2DGU A;  1ROF A;  2LFV A;  2R2U A;  1CJU A;  5LMN F;  2FY1 A;  3G82 B;  1TVR B;  1S1T B;  4A4J A;  3TWZ A;  2W7A A;  3WC0 A;  4IQX A;  1UPP A;  1EP4 B;  3IR7 B;  4C8K A;  2ZEJ A;  4MFB A;  4B9L A;  3AA8 A;  5A0Y A;  3KLI A;  1G1X A;  4PQU A;  4O4G A;  1H2U X;  1R0C B;  3HD1 A;  5H9F K;  5LSR A;  5EN1 A;  3SDE B;  3HHL C;  1VRU A;  5L9X A;  1EHW A;  2GIQ A;  3BN4 A;  4V19 X;  2HZA A;  1JWW A;  1GMU A;  5C2C A;  1RAJ A;  1NKE A;  1C0U B;  3JB9 k;  4NYP A;  4C3M A;  1T9X A;  2ASD A;  2LXI A;  4JYA J;  2QSF A;  2IVF B;  2DK2 A;  1EKR A;  1W7W A;  4K4W A;  2ZUA A;  1QVF R;  2DR6 A;  2A6M A;  1ZS6 A;  4QYR A;  2BQ3 A;  2UUA J;  2FC8 A;  2CG8 A;  4N7T A;  2IRU A;  2JNJ A;  5KFH A;  4PXB A;  3IFE A;  3GV8 B;  4JI0 J;  2HND A;  3SI8 A;  2ADC A;  2V50 A;  2PEH A;  1UZD A;  2E9T A;  1G7C B;  3EGV A;  1NEE A;  2MQQ A;  4DV6 F;  2B8P A;  3UD4 P;  3KKF A;  2DB1 A;  5D0G A;  3PW4 A;  1LWC B;  1MWZ A;  4MT1 A;  1KOO A;  4DLE A;  1RZM A;  1JLE B;  3R5J B;  3D6M B;  1MRO A;  3T1A A;  3MMA B;  3PDN A;  2E7W A;  2BJ9 A;  3WZ0 A;  4OL8 A;  3Q83 A;  2LEB A;  5IC4 B;  3MCN A;  1CUL A;  2R9L A;  3NBP B;  4FVC A;  2HVI A;  3OFH A;  5G0R A;  3KK3 B;  1LEO A;  4WF9 Q;  1TMM A;  4FPR A;  1RAH B;  5HBM B;  4K2J A;  2ZHB A;  1NZA A;  4ES1 A;  1J27 A;  4PPZ A;  2UXD J;  4TY8 B;  2V8V A;  4ED0 A;  1KHV A;  3FVY A;  3FRZ A;  4JI8 J;  3CNQ P;  2V4J B;  3I5A A;  4ER8 A;  3CXC R;  1HBU B;  2V9K A;  3NCQ A;  1UZH A;  2OMO A;  3LWM A;  4OX9 F;  4QOT A;  2LQB A;  3MAA A;  2OFG X;  2ZJP Q;  1YBA A;  1TAU A;  5KG1 A;  1NH8 A;  1VBZ A;  3RBX A;  3EX7 B;  2XY6 A;  4QIF A;  2O67 A;  3P5T L;  3AJD A;  1RJJ A;  4K5S A;  4NLP A;  4DSE A;  4KC5 A;  3US5 A;  1ICE B;  3R7B B;  2YBV A;  4DL2 A;  4LF8 F;  3M1V B;  5B0B A;  4YOE A;  5J2P B;  2ZZT A;  3RYL A;  5FJ4 A;  4DL0 C;  1S0N A;  2ZC4 A;  3KHR A;  5AE3 A;  3ILJ A;  5KFJ A;  2BBE A;  2FVR A;  3EWG A;  1XR6 A;  3B8H A;  1SUQ B;  4GO7 X;  4LSN B;  2R7O A;  3IAS 9;  3Q23 A;  1P8G A;  4UW2 A;  1FWK A;  4LF2 A;  1NK4 A;  1LQ9 A;  2AW0 A;  3JTO A;  2HBR B;  2ZH3 A;  1N52 B;  5J2N B;  3NG8 A;  3KG4 A;  2G2O A;  1L3T A;  4CLK A;  5HP1 B;  2CYY A;  4LBI A;  5HJX A;  4NZ0 A;  2YKP A;  3ETM A;  3PR4 A;  2WHO A;  5DET A;  2VL1 A;  2GMH A;  3K5N A;  2KTQ A;  1JLG B;  4DR2 F;  3H5U A;  3U1N A;  1VLO A;  3CCZ A;  4IOC Q;  2DR5 A;  2FTR A;  2OD4 A;  1DTT B;  3UDE A;  2BW2 A;  1LFP A;  5L46 A;  3R97 A;  2Z0G A;  5KFG A;  1FNO A;  2QFJ A;  4F4K A;  4G65 A;  3MMC B;  5HL7 Q;  2B0G A;  2OPS B;  3TJ9 A;  3Q8P B;  4DN0 A;  3HXM A;  5AJ3 F;  4CTA A;  4DL3 A;  3BGR A;  3SQO P;  2CG4 A;  3PX0 A;  3UDL A;  1YJ9 S;  1V5I B;  2IM1 A;  1TUV A;  1TUG B;  4X62 F;  2RUG A;  3RBZ A;  2B9W A;  3OL9 A;  3DHX A;  1UKU A;  2H5I B;  1SL2 A;  4M5M A;  2Y8Y A;  2AT1 B;  2FY8 A;  4CLU A;  3ENV A;  5IS2 A;  4B9S A;  5HVH A;  4ITS A;  3IC1 A;  1V9O A;  2FVC A;  5LOQ A;  4ETX A;  4LFC F;  1VJW A;  3Q24 A;  2RVJ A;  1QVG R;  4RNN A;  5L39 A;  5A8K B;  4DR3 J;  4DI6 A;  3C6U B;  1RAO A;  4TN2 A;  4G1I A;  4UY8 5;  3CD5 A;  1RHK B;  4QIW D;  5EX0 A;  3NAI A;  4NCG B;  2J6U A;  3C15 B;  5K9F A;  2WB4 A;  1BWE A;  2AGP A;  3M2V A;  1VIO A;  2OPP A;  5DS7 A;  3BPS P;  3NCP A;  3HD2 A;  2VQE F;  1UCN A;  1WG5 A;  2F9J A;  1M1K T;  4BBY A;  1M5O C;  2AGQ A;  3QGG A;  4A48 A;  2I9S A;  3BV8 A;  4J9L A;  5HMZ A;  1KLM B;  3KNG A;  1H2V Z;  1Y9O A;  1WF2 A;  1T02 A;  1UTA A;  5LSO A;  1MWY A;  1RTJ B;  2VG5 A;  1FX2 A;  1QE1 B;  1NME B;  1C1C B;  4ZN1 A;  3VVT A;  1UP1 A;  3MM9 A;  1HR0 J;  1LW2 A;  2FUG 9;  4BS2 A;  3RBE A;  4NXM J;  2WVC A;  3PAC A;  3VZH A;  4QWA A;  2VA3 A;  3CCU S;  3NMR A;  2RQK A;  2L41 A;  2CQP A;  4C11 B;  4USI A;  3G71 S;  1FO1 A;  3BGF A;  2CQG A;  2X51 A;  3LGN A;  2VJV A;  4WYL A;  4F3Q A;  3JSM A;  2BDP A;  4LF1 A;  2R7U A;  1KLN A;  1O0P A;  4WP9 A;  2C2R A;  3TQE A;  4OZ5 A;  3NEK A;  5F8I A;  1IM6 A;  3GG1 A;  1TL1 A;  2IRX A;  4PKD B;  1S9G B;  4F4A A;  4KE5 A;  3T9Z A;  1U0H A;  1T05 A;  1VBK A;  4Y00 A;  1CEZ A;  3OVS A;  2J8S A;  1AXQ A;  4EO8 A;  3AOA A;  3D0I E;  1RT5 B;  4NLD A;  3BQ1 A;  2E29 A;  2CZ9 A;  1O8B A;  3PJX A;  3MUT P;  1CVJ A;  2B4P A;  3CD6 S;  3UCZ P;  4Y2I A;  2CVI A;  4F04 B;  4MKB A;  5EUH A;  4MKV A;  3OJS A;  2EKN A;  2Z56 B;  1MU2 B;  4C7Q A;  4KKO A;  2ZBR A;  1WNE A;  3UE2 A;  2CQ0 A;  1BE4 A;  2IA0 A;  2DR7 A;  1S12 A;  1H0H B;  4IFV B;  4EI2 A;  1GMW D;  2GVZ A;  1SKW A;  5LM7 E;  2MKJ A;  2R3V A;  1R8H A;  1XER A;  3GYG A;  4WWS A;  3T1Y F;  2FB0 A;  5IWA J;  1CS4 B;  3AB4 B;  3QGP A;  3HLU A;  4A8M P;  3HUL A;  4OZN A;  3FSY A;  2MKC A;  3DHW C;  2XYG B;  1SCJ B;  1VRT A;  2LQ9 A;  1C1B B;  2BOP A;  2ATC B;  4EFA C;  3PX4 A;  2XBP A;  4MKY A;  2DXF A;  1D0E A;  1YQH A;  4I7F B;  4ZKA A;  1VIX A;  3RR8 A;  1SBR A;  4Q45 A;  1KVI A;  3I96 A;  1TKT B;  2RS8 A;  1X5T A;  4H54 A;  2KI2 A;  2PSZ A;  3QSY B;  1SH0 A;  1HIY A;  1QAI A;  2RQC A;  4J37 A;  3P45 B;  2E1P A;  3J7Z T;  2OTL S;  1JLB B;  1YBU A;  3VAK A;  3MR3 A;  1KQF B;  1UVM A;  3QO9 B;  2HHS A;  1SV5 A;  4ID8 A;  4O3S A;  3BSO A;  2E7V A;  4DR4 F;  3DM2 B;  2DEI A;  4NI2 B;  3LP2 A;  3EE3 A;  2V67 A;  4F2R A;  1YTY A;  4LF9 F;  3H7H B;  4K4Y A;  1VFJ A;  2NS1 B;  4ERD A;  3I4H X;  4USJ C;  3MPU B;  2VG6 A;  2DH8 A;  2NZC A;  5JVH Q;  3FEX B;  2V68 A;  2YQ3 A;  3R7S B;  2XCP A;  3D4J A;  1HW8 A;  1RA7 A;  3PM9 A;  4X66 F;  1RT4 A;  1UWA A;  4QIV A;  4B9T A;  1REV B;  3TNV A;  1U09 A;  4TU7 A;  1FFW B;  4GO5 X;  5CH7 B;  1PKU A;  4IR1 A;  5HLF A;  2BKP A;  1RWW B;  3K89 A;  1N4L A;  2QLF B;  1FJG F;  2VHG A;  1S57 A;  3SIP B;  2KZZ A;  1U4B A;  4RW6 B;  1N0V C;  4U95 A;  1T9W A;  4QYZ K;  4LFA F;  2O01 C;  3PRD A;  2DKO B;  5E3C A;  1WKJ A;  1HQE A;  4YR2 A;  3VVU A;  5IM0 B;  3IRX A;  3LW5 C;  4HHU A;  3HK2 A;  1NHV A;  4MMO A;  1AFI A;  1NU4 A;  1IBM J;  4CLS A;  1R89 A;  2DR8 A;  1S79 A;  4UOH A;  2OEL A;  1U47 A;  4MH8 A;  3Q8S B;  1NLK L;  2HQC A;  2BR0 A;  2B3T B;  3I0R B;  3PW5 A;  3D1H A;  1JK9 B;  5DDO C;  4I1T A;  3NOC A;  2IA6 A;  2OPQ A;  5CHC B;  3D3B J;  1MSW D;  4YN3 B;  1X9S A;  5E3A A;  5CYQ A;  4R0J A;  4K4U A;  3C46 A;  2AZ1 A;  2W7O A;  4OQJ A;  3RJM B;  4B17 A;  2GVD B;  1OO0 B;  3NNA A;  3DOL B;  3ITH B;  3M7V A;  3QGI A;  2P6S A;  5A6W A;  2QA1 A;  2LDI A;  3QFH A;  4DS4 A;  5E2Q A;  1GNK A;  4LMZ A;  4J5O A;  1RSC A;  4EBE A;  1HBN A;  1HYS B;  3UR0 A;  2LXF A;  4OLP A;  3OR2 A;  1XTZ A;  4V19 J;  4WU3 A;  4Y2K A;  1VBX A;  2CVE A;  1N34 F;  1S9E A;  3CD0 A;  2HS0 A;  2X1F A;  2HZV A;  1PJ5 A;  1S6U A;  2JHE A;  3GFH A;  5DM6 Q;  1JLA B;  3U27 A;  3DRX A;  5GAE I;  3R5A A;  2Q6C A;  1DRZ A;  1HHT P;  3ULH A;  2N3L A;  1VQO S;  3TZX A;  2QYC A;  4DR6 J;  1NPR A;  2MGZ B;  1IBK F;  5DJB A;  2G13 A;  4YS2 A;  2LU2 A;  1T03 B;  1P1L A;  4ZP6 A;  2HGM A;  2C2O B;  2BM1 A;  1APS A;  2I6W A;  1M5V C;  3SV4 A;  1PYT A;  5GAH I;  4H4K A;  3CMQ A;  1SIZ A;  1ZPV A;  1V5V A;  1VYA A;  4DL7 A;  1CC7 A;  1NSQ A;  1FWL A;  4LRA A;  1Q86 T;  3TAN A;  1X8D A;  4FXV A;  2C3P A;  1JLC A;  2J9E A;  2RH3 A;  5HVF A;  4X4V A;  2APO A;  4IKA A;  3ZZT A;  3J7A 1;  5CYM B;  5E3P A;  4IG0 A;  1Q53 A;  5KG3 A;  1Y7P A;  4CRJ A;  3W9H A;  2R2T A;  5HSP A;  3V6D B;  4A8Q A;  4ZP7 A;  1I94 F;  2ZC3 A;  2I2Y A;  3GJS B;  1BY9 A;  1XMO J;  2JLE A;  4QZV B;  1S4F A;  1U02 A;  4F25 A;  1WC6 A;  4AUK A;  1QJH A;  1YRU A;  1SH2 A;  4NLS A;  4O0N A;  2IC3 B;  1DTQ A;  3ET6 B;  4FNH A;  2K06 A;  4J9N A;  3F0N A;  4X4T A;  2OH2 A;  1VQ7 S;  1Q5Y A;  1S5Z A;  2DNH A;  1OY6 A;  3EYZ A;  4IRC A;  2CZV C;  4DPY A;  2WCX A;  4U96 A;  5EWG A;  5K8N A;  5K14 A;  2CZ4 A;  4DUY F;  4B3R J;  3OR1 A;  3IN5 A;  4X4R A;  2H48 B;  1YKW A;  2DIT A;  3MPY A;  1JX4 A;  1A0O B;  3THP A;  1F60 B;  1N33 F;  3UDV A;  4B3O B;  2HG4 A;  2OLW A;  5IQ6 A;  3S6E A;  1K0V A;  1N5Q A;  4LF6 J;  3WDO A;  2JEI A;  3LP1 B;  3FNN A;  4B3T J;  8RUC A;  4DS5 A;  3HHD A;  1FRL A;  4L3K A;  3UQS A;  5HMW A;  2IBO A;  5KFF A;  4FBU A;  2QO3 A;  1QTM A;  5HQL A;  1EET A;  4IDK A;  4P52 A;  4WU2 A;  4KTQ A;  5H9E J;  5BYS A;  2CPE A;  2PMH A;  4FPI A;  1B0V A;  2XS2 A;  2UU9 J;  4UTG A;  2X1A A;  4WYW A;  2ZHA A;  4DSK A;  1KFD A;  4JI7 J;  4FYD A;  3QIP A;  2DNZ A;  1EZZ B;  1UA1 A;  3NS7 B;  3KDN A;  1WOP A;  1SB6 A;  2Q6B A;  3U02 A;  2W9B A;  3H40 A;  4CQ1 A;  2CNL B;  4CO1 A;  1S48 A;  5LMN J;  1S76 D;  4C4W A;  2BM0 A;  1C0T A;  1S1X B;  4ILM A;  2I5J B;  2DNK A;  1WHV A;  4HAC A;  5D6G A;  4NLX A;  1YK9 A;  3R5B A;  3B6B A;  5KT5 A;  4NCB A;  1IM4 A;  4D3G A;  3Q2S C;  3JTP A;  1RWX B;  3N79 A;  4RJV A;  3MMB B;  5FLX Y;  4WFX A;  4NXN J;  1Y5L B;  2ZD1 B;  1HBM A;  1PIE A;  1QLN A;  3FDS A;  4G1Q A;  3S1T A;  3T1H F;  3BR9 A;  2VFR A;  3PRV A;  4RW7 B;  3MR7 A;  7FD1 A;  2ZVI A;  3NOG A;  3QWU A;  1I3O B;  3RAQ A;  4OYM A;  2FLL A;  3IWN C;  2MZS A;  5DQH A;  4DL4 A;  4C8N A;  4HLB A;  4RBV A;  1RAI B;  2BV3 A;  4UUW A;  4B08 A;  2QE5 A;  1S6Q B;  2CQD A;  3FRY A;  4JI4 F;  3B4M A;  2W01 A;  4CNZ A;  3CME S;  2LQ8 A;  1WJ9 A;  3S01 A;  3AOD A;  4DV2 F;  3SXL A;  2VJU A;  3WC2 A;  1G3O A;  4KB7 A;  5D4L A;  1LOU A;  3PG9 A;  4AQY F;  1Q78 A;  4KGM A;  3EXY A;  2LXU A;  1RAE B;  2VD3 A;  1FEE A;  3A12 A;  3KLG A;  4ZVP B;  1VR6 A;  2LEP A;  3GFZ A;  4DR7 J;  2AP6 A;  3KLH A;  2VOD A;  1MW7 A;  3VHQ A;  3R27 A;  2AJ2 A;  3M4X A;  1XN9 A;  4LRF A;  4X64 F;  1YBT A;  4ZVQ B;  4F02 A;  4C3L A;  5CZV A;  1NO8 A;  1IKW B;  3MCM A;  2W1B A;  2W25 A;  5JXS A;  1Z2L A;  4YUD A;  1UWB A;  2XNR A;  2BRK A;  3ZZO A;  2E1R A;  3BSN A;  3CW2 C;  4ECU A;  3CCT A;  1AUS L;  3W66 A;  2W24 A;  4WFB Q;  2NQP A;  5IT9 Y;  3QID A;  3PO4 A;  1CJV A;  3POT B;  2ROP A;  2HHW A;  2JLG A;  2ZH7 A;  4KO0 B;  3LH2 S;  3TA1 A;  3ZZ0 A;  2HNZ A;  1S77 D;  4ZLJ A;  3FBB A;  2RKI A;  1NPK A;  1KDN A;  4OJG A;  2OEM A;  2HRU A;  1YI2 S;  2E1C A;  3K57 A;  2R8K A;  2E7X A;  2CUY A;  1RWP B;  3IBC B;  3OSP A;  1U25 A;  2VUG A;  4ZJQ A;  3PW2 A;  5A8W B;  1DY3 A;  3BGU A;  4RZR A;  2YNF A;  1RT2 A;  1RWV B;  3L7P A;  1UMJ A;  3PFO A;  1BUX A;  5AT1 B;  4FXD A;  5KG2 A;  2JJ4 D;  4C3K A;  5B09 A;  2JSX A;  3DMJ B;  3BO3 A;  2AEJ A;  3OUY A;  4J9U E;  5KFR A;  2LQ5 A;  1VJQ A;  2RDJ A;  4EWT A;  1YJV A;  3U7J A;  3Q22 A;  1YRT A;  1JKH B;  2AEF A;  3MWB A;  2JRS A;  2ZBC A;  3D28 A;  2EC0 A;  2CDR B;  4LFB F;  2OPR B;  5B08 A;  2WVF A;  4DV4 F;  5B7W A;  2B8Q A;  3V81 A;  2HZC A;  1G2E A;  2C2D A;  4DR2 J;  4KFB A;  1RAG B;  2NR0 A;  1FES A;  2RU9 A;  4RW4 A;  1NJI T;  3GIK A;  2IY5 B;  2HGL A;  3KUH A;  1U1R A;  3AH6 A;  4OMF G;  3MM8 B;  4U7C A;  1YJN S;  1M5P C;  4EK2 A;  1GH8 A;  4OZ3 A;  2NRE A;  2NYH A;  3SCK E;  4C0H A;  5ETM A;  1DJ0 A;  3PHE A;  5AJ3 J;  1LWF B;  2V2Z A;  5A2Q Y;  4URQ U;  3W2V B;  1FRH A;  4ZHR B;  4X62 J;  2KDO A;  2NXU A;  2X1B A;  3G6Y A;  4FF4 A;  4ID5 A;  1FFS B;  5KTQ A;  1UFK A;  2DNY A;  2HHH F;  5CAA A;  2KRB A;  1R31 A;  3RB4 A;  3CDW A;  4DSL A;  5D8H B;  3AB2 B;  1W2I A;  2XYH B;  2X1G A;  4RL1 A;  3F73 A;  4LFC J;  2L3M A;  1HQU B;  2AHO B;  3LAM A;  2X3D A;  1UW9 A;  3NWR A;  1H7X A;  3SFG A;  3CWJ A;  3WIU A;  2XZW A;  4YFU A;  4DL6 A;  1O51 A;  2ZIT A;  5ETS A;  1J5O A;  4F2S A;  2MKH A;  1XEZ A;  2N4C A;  3MPV A;  3GV7 B;  2CJB A;  3HZG A;  2XLI A;  4MK8 A;  2VIC A;  4QQB A;  1TKX A;  4RUA A;  3NCR A;  2ZH1 A;  4R0E A;  4PZV A;  2XGQ A;  5A8R B;  3DRS B;  2UUA F;  3OTC A;  3R6G B;  4I67 A;  2MKS A;  5F0U A;  4OHV A;  2XO7 A;  1HW9 A;  1U1N A;  4LF4 F;  5C5J A;  1FRJ A;  2FZK B;  4L75 A;  3HT0 A;  1X4D A;  3Q8U A;  1S1W A;  3PFE A;  3MAQ A;  4WTO B;  2LA4 A;  2IJN A;  4KHP F;  2GX8 A;  2ZNY A;  4A8O A;  1HKA A;  2HFN A;  2HHU A;  2DHX A;  3W2W B;  3G82 A;  1HBO A;  5GMK a;  1ZTT A;  2ALY B;  4KHM A;  1TVR A;  1NHK L;  4RR5 A;  2MHN A;  2ASL A;  3OHB A;  2WSE C;  4TY9 A;  1VCT A;  1IJE B;  5GAE U;  3GR1 A;  4DFJ A;  3KYL A;  4ZVH A;  1EP4 A;  2L48 A;  5D0R A;  3NMA A;  3S8S A;  1YX2 A;  4PAB A;  2D9P A;  4ZVU B;  2JH3 A;  3M9M B;  2CA9 A;  2PO4 A;  5IOL A;  1UEV A;  1PAE X;  3W7B A;  2KU7 A;  1NDP A;  3TW0 A;  1RT1 B;  4AD6 A;  3M6U A;  3SDE A;  3QBC A;  5GAG U;  1VC6 A;  1HNV B;  3Q89 A;  2UXD F;  2OKQ A;  2YKQ A;  2WOM B;  5GAH U;  1GMV A;  1WC3 A;  4LIW A;  2XM3 A;  1C0U A;  2J0X A;  4JI8 F;  3MOJ B;  3DRR A;  1E6Y B;  1X4A A;  2MKY A;  4UST A;  2CQ4 A;  1WDD A;  4O3P A;  1ZM4 A;  2E44 A;  5JJB A;  5DQI A;  4HKQ A;  4FS1 A;  2GNK A;  4M94 A;  4ZMM A;  2R7W A;  2DY9 A;  3TJ8 A;  1NSK L;  4DQP A;  1JQG A;  4H4O B;  4GVB B;  4DU7 A;  2W2Q P;  2AV5 A;  2IIH A;  1F9E B;  2K8G A;  1W26 A;  3LGH A;  4DOZ A;  5KFO A;  1ZET A;  4ZIT A;  2VBX A;  3DCA A;  2DH9 A;  3VV2 B;  1OPI A;  4KH1 B;  4GVL A;  5DRK A;  4W4M A;  4YDD B;  2WVD A;  3RRG A;  3HSZ A;  3LGM A;  3UR3 C;  3T5L A;  2CPI A;  1LWC A;  1FDA A;  6FDR A;  2MQP A;  4EMD A;  2OSR A;  3TUP A;  1FRM A;  1N6Q A;  1PSD A;  5H9E K;  2EG2 A;  3MMA A;  1AB8 A;  1X7V A;  4X4P A;  3W8P A;  3I9V 9;  1WSR A;  1MMN A;  2WON B;  3KWM A;  3HHN B;  3NBP A;  1TQL A;  1U1K A;  1R3N A;  3O5T B;  3KK3 A;  5AXK A;  1RT3 B;  3CJR A;  2BUN A;  1D8Z A;  3NLC A;  4J9O A;  2GQQ A;  4X65 J;  5HBM A;  5KT4 A;  3W3S A;  3VGS A;  4B3M J;  5BYQ A;  2AWZ A;  3RW7 A;  1M1H A;  2CJA A;  4CI0 B;  4DR4 J;  2ZVS A;  1FTC A;  2IVM A;  4PXD A;  3TX8 A;  3F56 A;  4LF9 J;  2KFY A;  1KHW A;  2OJ3 A;  3NWG A;  3ZTP A;  1WSV A;  5AXL A;  1HBU A;  3IS9 B;  4YB1 P;  1REG X;  2V8D A;  4CNY A;  3BDE A;  2NXC A;  1GX5 A;  2NXJ A;  2JWN A;  3I0S A;  1FJ7 A;  3QT6 A;  2YKO A;  4X66 J;  4OZ2 A;  4BC9 A;  1HNI B;  2H4W B;  5ETR A;  1Z4U A;  3IGV A;  4F3O A;  4M5I A;  1EJ7 L;  1LWE A;  2HIQ A;  2WRM A;  5KFK A;  1VC5 A;  3PO5 A;  3GWC A;  3CVK A;  3MED B;  2K7J A;  1BXN A;  3H5S A;  3ISZ A;  5CXT A;  4ED1 A;  3HT3 A;  3M1V A;  1FJG J;  4CP5 A;  1YWX A;  2DEJ A;  5J2P A;  3R1H A;  4L76 A;  1KVJ A;  1KBR A;  3CCR S;  4LF7 F;  4NLQ A;  1UJ4 A;  4LFA J;  1BMQ B;  4ED4 A;  1SUQ A;  4CO2 A;  2W9C B;  1B7F A;  3KMQ A;  2H3E B;  4CLF A;  2VU5 A;  3H59 A;  2GHV C;  4QR2 A;  3A8J A;  3C6T B;  4OV6 A;  3L3C A;  2V63 A;  4Y34 A;  2B9E A;  2DNG A;  3MM5 B;  5J2N A;  2KFZ A;  2IPO B;  4U6P A;  4MIA A;  4PR6 A;  3PIP Q;  4I2Q B;  5IT9 U;  5HP1 A;  2AMC B;  2GA7 A;  4ZVF A;  4CLL A;  1UEU A;  2VBZ A;  4WZQ A;  4QBU A;  3OL6 A;  1RYS A;  2V4R A;  4R5P B;  3PJW A;  1J2V A;  1GX6 A;  3KG1 A;  4GRS A;  2YQ1 A;  3QFW A;  1S7I A;  1IKX B;  1LV5 A;  1Q16 B;  5K5M A;  4NML A;  2GQC A;  3MMC A;  2H54 B;  2OPS A;  1HD1 A;  5HMX A;  2F65 A;  1YG0 A;  2DHS A;  3CJT A;  3H2V E;  2VDI A;  2ZBI A;  2GFF A;  2ZBQ A;  1ITP A;  2NXN A;  4ELV A;  4K59 A;  3GPA A;  5BYR A;  4U8V A;  5RUB A;  5L9N A;  3AHP A;  1EX8 A;  1AA1 B;  3L9Z A;  3AAW B;  3DLE A;  4QWB A;  1ZM9 A;  3H25 A;  2JVO A;  5T7L A;  3JYT B;  2VKZ G;  1WI6 A;  3KLE A;  1ZM3 A;  1XR7 A;  1TTH B;  4NZ7 A;  5KFY A;  5A8K A;  4NA2 A;  4KHR A;  4UOG A;  3C6U A;  5HQM A;  3FC9 A;  1HWJ A;  3ELH A;  3R9L A;  4NCG A;  1Z1Z A;  3C15 A;  2VA2 A;  1IBK J;  1ZPW X;  4DCO B;  1SQG A;  3PEJ A;  4CLT A;  1R43 A;  3N6L A;  3RRH A;  3OW2 R;  1DQ9 A;  2PDA A;  4NLT A;  1RB0 A;  3BJY A;  2GO8 A;  4PUO B;  3T6B A;  3KHH A;  3NY0 A;  4ZVE A;  5IV3 A;  3SZ2 A;  3FFI B;  4LVN P;  2YX4 A;  4Y6I A;  3CDE A;  4O4R A;  5E41 A;  1TR0 A;  2DNP A;  2RRA A;  5A2Q U;  3D2W A;  3TP2 A;  2IFX A;  2V8H A;  2V6A A;  4DJB A;  2KT5 A;  1RTJ A;  4HT7 A;  2QMU B;  2HGN A;  2FVS A;  1QE1 A;  5IWA F;  3IRW P;  3EDQ B;  1Q5V A;  1WI8 A;  4OX8 A;  1CPZ A;  1MWQ A;  1XMB A;  5AE1 A;  3NGT A;  4O4G B;  1S72 S;  1KQG B;  2R42 A;  2FZG B;  4C11 A;  1VRU B;  3M2R B;  4OHZ A;  4TU9 A;  1NK7 A;  3QZ8 A;  2OEJ A;  1KTQ A;  3IR5 B;  2YTC A;  1KN6 A;  1U26 A;  1DHM A;  2ZDO A;  3W5Z A;  4YY3 J;  3JXO A;  2Q79 A;  4P10 A;  4AXI A;  2BJD A;  1NDL A;  1TZ0 A;  3NL0 A;  1KKH A;  4QWC A;  3V6K A;  2RDD A;  4Y2C A;  1S9G A;  3X3U A;  2D3O 1;  2FHJ A;  4ED5 A;  4MYU A;  3D0H E;  1VK3 A;  4D3H A;  2HND B;  3N0V A;  1N5V A;  2UVW A;  3EMT A;  3LUY A;  4J9K A;  2MB0 B;  4WE1 B;  1RT5 A;  2EI5 A;  3ENQ A;  3M32 B;  2BE9 B;  3MR5 A;  4DUY J;  4X4O A;  5U47 A;  1MU2 A;  2CRL A;  2MLY A;  4IR9 A;  2FQQ B;  4IFV A;  1N33 J;  3I87 A;  1WOR A;  3AD9 C;  3QJJ A;  2FPH X;  4ILR A;  3A8K A;  2FJB B;  3MCO A;  4TYB A;  2EFQ A;  1U6F A;  1CS4 A;  4NLO A;  2XWY A;  1CG2 A;  2XSJ A;  1FXD A;  2M3D A;  1RWK B;  3ZZZ A;  2JLF A;  3PW7 A;  4U7U K;  2YKN A;  2EC2 A;  5CZX A;  3H98 A;  5DG8 A;  4C8Y A;  4QW8 A;  4Y28 C;  3IMQ J;  1SI9 A;  2HFS A;  3G4S S;  4JI3 J;  1SVD A;  3QJP A;  2LLZ A;  2Y0S D;  2BJ7 A;  1U48 A;  4WK3 A;  2IMW P;  3J7Z 5;  3CDB A;  1YGY A;  4HDG A;  2B43 A;  2AJQ A;  2J7W A;  3SYZ A;  3BRE A;  4IOA Q;  3QPI A;  4ZVS B;  2LKZ A;  2YWW A;  2FDN A;  2BE7 D;  1FKP B;  1NH7 A;  1HNZ F;  2NUU G;  1IBM F;  3GIM A;  1JLB A;  5FDL B;  2VKR A;  1BWV A;  1OMS A;  3F41 A;  2M8H A;  3ILI A;  3RZA A;  1U7L A;  4F4X A;  1FFG B;  3QO9 A;  2DH7 A;  1SQF A;  3CD7 A;  4NRU A;  3M6W A;  4WFN Q;  1JIH A;  2MQN A;  4NEY A;  3DM2 A;  1TL4 A;  3D5M A;  1FRK A;  2FJA B;  4NI2 A;  2R7R A;  3O44 A;  4DV7 J;  5DLF A;  2CQI A;  3VF0 B;  4DWI A;  5IT0 A;  3WHI A;  2HWI A;  4WFA Q;  3VWS A;  1N5Y A;  1UJ6 A;  2Y1L B;  1FKO B;  3CC4 S;  5B0F A;  1A9N B;  1D9A A;  2M70 A;  4IQM A;  3T1H J;  1VI7 A;  1REV A;  4WKY A;  4Q5V A;  4KH0 B;  1TUW A;  2XZD B;  1QD1 A;  2ATL A;  4ED3 A;  2B6A B;  2ADB A;  3T3F A;  2RML A;  2MQO A;  4WKR A;  4CT9 A;  2FVP A;  4Y65 A;  4IFY B;  4YB7 A;  3AOB A;  2NPI A;  3ZZY A;  2UUC F;  5LSL A;  5D78 A;  5L38 A;  4BWM A;  4KGX B;  4WFZ A;  2BW7 A;  4XDD A;  2VZ9 A;  3TUI C;  1RXO B;  2HKE A;  4RW6 A;  4BC7 A;  2HFV A;  4F50 A;  3CIM A;  3BO2 A;  1WF1 A;  4JI4 J;  4G3I A;  2OUG A;  4LSL B;  2BYC A;  2DYA A;  4LIR A;  4DV2 J;  1N5S A;  2D69 A;  2XG8 A;  2AU0 A;  1Y10 A;  4UF4 A;  4CTA B;  3H90 A;  2O5D A;  1JJC B;  3CCM S;  4UZC A;  2ABY A;  3VAI A;  2DHA A;  2VBW A;  1LWX A;  1FD8 A;  3I0R A;  1S9F A;  2VG7 B;  2L9N A;  3TRG A;  2IMO A;  5GMD A;  2M5Y A;  5MLC V;  2G1D A;  1U45 A;  1DZ5 A;  2V8P A;  4QIE A;  4GC7 A;  3H42 A;  3BN7 A;  4FN5 A;  3KK2 B;  1PCA A;  2N82 B;  4OI2 A;  5EX3 A;  5KT6 A;  2H51 B;  3WIV A;  2HHX A;  3NGD A;  4S0M A;  1LXJ A;  3L7U A;  4HVZ A;  2F3J A;  4V1A k;  1UJ5 A;  3GG0 A;  2GVD A;  4AND A;  1N32 J;  2DBB A;  4QPX A;  1S4E A;  3ITH A;  3EGN A;  5C42 B;  2G0J A;  3EDR B;  1RTH B;  2QL5 B;  4QWE A;  4URS A;  1HYS A;  3P4U B;  1HAR A;  4ZLL A;  3D1Q A;  5HMY A;  3W60 A;  4DU8 A;  2MQ8 A;  4B3S J;  2Z58 B;  1R8C A;  2R2R A;  3R5C A;  1HI8 A;  5KG7 A;  1PC4 A;  2QLW A;  2OSQ A;  4R8U B;  2CPJ A;  1JLA A;  2VG5 B;  4FBT A;  1VQS A;  1F9F A;  3OFG A;  2IYI A;  1RHM B;  3K17 A;  3P5B P;  3E01 B;  2MGZ A;  3IGN A;  1T95 A;  4JV5 F;  2XMJ A;  1T03 A;  2DNO A;  4USM A;  5HI7 A;  2PE8 A;  1SJ1 A;  1X9W A;  2G2Z A;  3A1Y G;  3G8S A;  2QL7 B;  2CNN B;  2KT2 A;  4HI1 A;  5LJ5 Y;  3JSM B;  3FBE A;  4F4Y A;  1NK9 A;  1KNZ A;  3V4I B;  2YQ0 A;  4MIB A;  2A10 A;  4RNO A;  2V69 A;  3DLG B;  4LT6 A;  5J1E B;  1QTN B;  4ES2 A;  4ECQ A;  2G0I A;  4P74 A;  2AYE A;  4LF6 F;  3N28 A;  4NA3 A;  4B3T F;  3ADA C;  3RTV A;  3GZ7 A;  2B5J B;  4PPD A;  1NKB A;  1U0H B;  2XMV A;  4AL6 A;  2DY1 A;  5CYM A;  4KGZ B;  4ALZ A;  1WF0 A;  2M52 A;  4MIW A;  5D4N A;  5LL6 d;  2E9Z A;  2J5A A;  1KS2 A;  1OIA A;  3JQM A;  2U1A A;  1ZYQ A;  3V6D A;  1DAX A;  3OTB A;  1R8P A;  1K0T A;  2HVZ A;  1OJ4 A;  3KK1 B;  1P9Q C;  2CNO B;  4KJI A;  3ZZR A;  5J2Q A;  2ERR A;  3DGP B;  3UN5 A;  1OY9 A;  4JI7 F;  3FZ2 A;  1RAD B;  2AJ1 A;  1VBY A;  4NWB A;  4P71 A;  2GVZ B;  4ENO A;  1FNX H;  5EDW A;  2B56 A;  2WSC C;  3HP6 A;  1N8R T;  2IC3 A;  3N5F A;  2XY7 A;  4RUC A;  4DQQ A;  3ET6 A;  2RRN A;  1L3U A;  3ZO7 A;  4KSE B;  1KR4 A;  4QU7 A;  4OYI A;  2HNY B;  2HHH J;  2LQJ A;  1X4E A;  2YWH A;  4P6Q A;  1HWU A;  3HO1 A;  2HQF A;  3BBB A;  3LF0 A;  3LPY A;  2UP1 A;  3U1M A;  3NGS A;  4N8N A;  4FF2 A;  2DGQ A;  1PJ6 A;  2QLX A;  4NXN F;  3CJ5 A;  3BGO P;  3DRP A;  1WEX A;  4UOF A;  4B3O A;  4NE9 C;  1BD6 A;  5KFL A;  1F2G A;  1IBC B;  2GMJ A;  3K5L A;  4QCL A;  2GML A;  1FE0 A;  1QSL A;  4PG6 A;  1WHX A;  4LRD A;  2DNM A;  4ZJL A;  1OSC A;  1UEK A;  4BCA A;  3PJ9 A;  3ETO A;  2MYF A;  4QYZ J;  4ZVR B;  3CSK A;  4UUX A;  2MY7 A;  2CDQ A;  1FDB A;  7FDR A;  3OLB A;  1ZAX A;  1Q79 A;  4GKJ F;  5CA5 A;  4LF4 J;  1U2F A;  3GON A;  4OI4 A;  1WTB A;  2R8H A;  3OXF A;  1KFS A;  2OAU A;  4ELU A;  1FER A;  4F67 A;  1ZTW A;  3OJU A;  4DUZ J;  3KG0 A;  2DVI A;  3EGW B;  4KHP J;  3EGZ A;  4C2M A;  3BBF A;  4NLG A;  2HVH A;  4JI6 F;  2YKM B;  2COL A;  2Z2Z A;  3HFK A;  1JMT A;  1S1X A;  5K8M A;  2I5J A;  4U7U D;  4DR7 F;  3LAK A;  2I0X A;  2XMU A;  2UV8 G;  5J1N A;  3Q86 A;  2QEX S;  3HVA A;  1RYR A;  4Q44 A;  4ICL B;  2DGT A;  3TEG A;  3MMB A;  1CJT A;  1M5H A;  3HVT A;  1Q1K A;  1EKS A;  4PEO A;  3UWT A;  4OZJ A;  1T9T A;  2WVB A;  3LO3 A;  4PWD A;  4B9U A;  4RW7 A;  1YZ6 A;  4ZPV R;  4DV3 J;  4DFK A;  3K59 A;  4IH7 A;  2UUT A;  3CCS S;  1U1Q A;  4AYB D;  1HNW F;  1FKA F;  1RGV A;  3MM7 A;  1B0T A;  5F9N A;  2MLX A;  4CM2 A;  1S99 A;  2ZH5 A;  3HF5 A;  1S6Q A;  1SJ3 P;  2QIF A;  4OI1 A;  4CH7 A;  2GZO A;  3MHY A;  5HAO A;  4DUT A;  2KO1 A;  1NJX A;  3FSX A;  2MZJ A;  1URR A;  3W5Y A;  2D7S A;  2RHQ B;  2E5L F;  2R7X A;  1RU2 A;  4PRF A;  1C4C A;  3MOZ A;  2IAJ B;  3FCW A;  4IO9 Q;  3BBC A;  2RQ4 A;  2KFN A;  2QG9 B;  3NS6 A;  1JB0 C;  4WIQ A;  1FF2 A;  3TX0 A;  4ZN3 A;  3VAM A;  1JNR B;  4PG5 A;  4EZ6 A;  5KFV A;  3FSI A;  2YXL A;  2VPY B;  4P2S A;  1P6T A;  2BJ8 A;  3PYG A;  3BGL A;  1IN0 A;  1VS3 A;  3PEH A;  2BMB A;  3DOM B;  4I4B A;  2BZ2 A;  1U8W A;  2WBR A;  1ULR A;  1T7P A;  4K4Z A;  4P72 A;  2W7P A;  1ZZN A;  1IKW A;  2CQ1 A;  4DX5 A;  1IXK A;  2D3Z A;  5KFC A;  4MKA A;  2RIL A;  4W90 B;  3C3L A;  2QV6 A;  2PT0 A;  1IKY A;  3ZZU A;  3HJV A;  4ED2 A;  1XR5 A;  1W2B R;  3TYT A;  3A8E A;  4A8W A;  2Z2M A;  3POT A;  2XTJ P;  4EBC A;  6FD1 A;  1U6Z A;  1KRP A;  5C25 B;  4KO0 A;  2R7T A;  2QT7 A;  4P75 A;  2F8H A;  2H1Y A;  1C2P A;  1IWA A;  1LK5 A;  3Q0A A;  1VHF A;  4EO6 A;  2GCF A;  5ETV A;  3DI6 B;  2OGU A;  4ILL A;  1N36 J;  4YR0 A;  1G6B A;  3HKW A;  2G4B A;  1GMW A;  5A8W A;  2DD8 S;  1NKC A;  2K3K A;  3UVJ B;  3OT9 A;  2VON A;  3MAH A;  1FA0 A;  1FK9 B;  2VFT A;  3W64 A;  2QFI A;  3GFY A;  2H5J B;  1YVF A;  1J5E F;  4ZDN A;  3M2U B;  2KHC A;  2KB2 A;  2VF3 A;  4LF7 J;  2XS7 A;  2LCW A;  2J9D E;  4USV A;  3DMJ A;  4YQW A;  2F7V A;  3DLJ A;  4IOB A;  2JC0 A;  2W8L A;  4ATN A;  1WC0 A;  4NL5 A;  5E3Q A;  3DN9 A;  3FBF A;  3I31 A;  1JKH A;  5J1P A;  2YNH A;  1LK7 A;  1XBW A;  2QX0 A;  5I3U B;  1GXT A;  4FZV A;  1QY7 A;  1MN7 A;  1T9U A;  6AT1 B;  3GV5 B;  1CJK B;  3D3C J;  8AT1 B;  1KVK A;  4GMK A;  2G9O A;  3Q8R B;  2FGC A;  3BKT A;  2A0F B;  4Y2A A;  4G6V B;  2UVR A;  3HHE A;  4UQT A;  2AD9 A;  1X4B A;  1YHQ S;  2QSW A;  4ZLN A;  3D7S B;  2E9R X;  5KFW A;  2BE2 B;  4L6V 3;  3DDN A;  3W2V A;  4ZHR A;  3PKM A;  5B0A A;  3IM8 A;  1RAB B;  3GCX P;  2BJE A;  2R2S A;  3TI0 A;  3WQP A;  1MNE A;  2CQH A;  2EPI A;  4DMZ A;  4JOU A;  1X0F A;  4LR8 A;  3QAU A;  3MUR P;  2GS8 A;  1JLQ B;  4I6Y A;  5KFZ A;  3HFZ B;  2U2F A;  2UVU A;  5H1S V;  3A3O B;  1UVN A;  1EET B;  4YME A;  2HQD A;  1BHN A;  3VAH A;  4Z7C A;  1I5O B;  1V3R A;  1A6L A;  3BYP A;  2ILZ A;  4PWU A;  4ZOS A;  4DV0 F;  4OYP A;  5B0G A;  3QIP B;  2GHP A;  3DU6 A;  1S97 A;  5HJY A;  4EEY A;  2QGF B;  3CPW R;  1B3T A;  4CLP A;  5AXM A;  3LWL A;  3RGI A;  1IBL F;  1DAR A;  2NSC A;  1JXV A;  2KXF A;  2F40 A;  3TAM B;  3T5H A;  1C0T B;  2IHR 1;  4K7Q A;  4ETZ A;  4XO0 A;  2LMI A;  3CT9 A;  5A8R A;  3DRS A;  4FYV B;  2C2N A;  4HAC B;  3M8Y A;  1U1O A;  1T8E A;  4DV5 J;  3VGT A;  4KYZ A;  2P6T A;  3CJQ A;  2ZOM A;  3P8B B;  3PR5 B;  5FD1 A;  4AT1 B;  1MN9 A;  1UVL A;  2WW4 A;  2A18 A;  3EJM A;  3DLL Q;  4PXC A;  1HBM B;  2VBY A;  1T94 A;  3GMG A;  4G1Q B;  3N9U C;  4CH1 A;  2AGO A;  2J7K A;  1Q7Y T;  5DDP C;  3Q8V A;  3W2W A;  3QJL A;  4JI1 J;  2HSE B;  1NSP A;  4KV8 B;  2HK3 A;  3BSA A;  4Q2L A;  1UAW A;  3ZZP A;  3G8T A;  3LAL A;  7AT1 B;  1ZOT A;  2VQF J;  2C2E A;  2BEF A;  2CXE A;  4U9R A;  3BH6 B;  1U1L A;  1VQM S;  1RBL A;  4J9P A;  1HMV B;  2MLZ A;  2LEC A;  1XJW B;  1U1M A;  2EG1 A;  2QTW A;  3K0J A;  3H4B A;  2DGO A;  3E51 A;  5HO4 A;  3C16 B;  4X65 F;  4K50 A;  2AJF E;  2YNG B;  3NXZ A;  2IDE A;  1A7G E;  2HUR A;  1YJT A;  1SJR A;  4Q2M A;  1DQ8 A;  2MDA A;  5KG0 A;  1HNV A;  4B3M F;  3PYF A;  1B64 A;  1FI4 A;  2RQM A;  1T0T V;  3MPW A;  3OXL A;  2WOM A;  3DDI A;  2HFU A;  3GII A;  2B51 A;  1YIT S;  4LR9 A;  1SKR A;  1E6Y A;  2YWK A;  3JSB A;  2MMY A;  3CC2 S;  2XMA A;  3NGR A;  4RUB A;  3KLG B;  4C8Z A;  1VQ9 S;  3FQL A;  1G4C A;  4I2P B;  2RF2 A;  4X4N A;  1RHR B;  3IG1 A;  1DLO B;  4GVB A;  2NPF A;  2XHC A;  2XO6 A;  1N54 B;  2ZH4 A;  3LP0 B;  5KFT A;  1F3V A;  3QQC D;  1H6K X;  5KFE A;  4AL7 A;  2E5J A;  2KG1 A;  2UUB J;  4ECW A;  3N6M A;  1RAC B;  3H5X A;  4IYQ A;  2HPU A;  2VV5 A;  3HKZ D;  3QZ7 A;  3IWX A;  3J7Y I;  3BS9 A;  1Q8B A;  4NX9 A;  3PX6 A;  5DGB A;  1XNR J;  4L72 B;  3V5R A;  3T6J A;  5KT2 A;  1GFW B;  2V8G A;  3JAM U;  1S59 A;  1SC4 B;  3FQK A;  4LRC A;  1HNZ J;  2UUW A;  4OHX A;  2LU1 A;  1YIJ S;  4M95 A;  2O1P A;  3SQG A;  5KFN A;  4K4S A;  5M2P A;  2C1E B;  4LQ9 A;  1Z2Z A;  3L95 X;  3KXD A;  2QA4 G;  5E33 A;  5DG7 A;  2EFG A;  2X7I A;  4FF1 A;  4TLQ A;  2YNF B;  1TK5 A;  2Z30 B;  4NEZ A;  3ENW A;  5D4P A;  3DOK B;  5KG4 A;  1QAX A;  1RKJ A;  3CTR A;  4WII A;  3MZI A;  1H3D A;  2YWF A;  1CC8 A;  2ZJR Q;  4XPC A;  2RAQ A;  4Q43 A;  4FYW B;  1HWI A;  2AQ4 A;  3HCX A;  1HNI A;  4FNI A;  4X84 A;  2FIU A;  2F4V J;  3PTW A;  2QMX A;  3I5C A;  3FCV A;  2P9C A;  4YDX A;  4NYZ A;  3MED A;  3BH7 B;  4N41 A;  4UQG A;  2UUC J;  2DPJ A;  1XNQ F;  1FT8 A;  2F63 A;  2B4V A;  3HVW A;  4ECV A;  4DF4 A;  1V6H A;  1ZAV A;  4UOC A;  1SKU B;  2VFV A;  4DV1 F;  2C42 A;  4NPO A;  2ZDP A;  3ZTO A;  1T9V A;  1DFD A;  1S10 A;  1RTI B;  1RHU B;  4AE5 A;  3C6T A;  3MXH P;  4JI2 F;  2W2O P;  3MM5 A;  1ZA1 B;  1K47 A;  1VK8 A;  4LVO P;  4DFP A;  2CJ9 A;  1OY8 A;  3AD8 C;  3UCG A;  2ZH9 A;  2DCL A;  4I2Q A;  1H7W A;  3GR0 A;  3G6V A;  3U1L A;  1U2R A;  4XPE A;  3PRB A;  4OX6 A;  5ETL A;  5M2U A;  1T11 A;  3CCW A;  3LOU A;  4PXE A;  1K44 A;  4I6A A;  4FVM A;  3DLK B;  2CFX A;  4R5P A;  4DBQ A;  1PO6 A;  2RE1 A;  1IKX A;  3MEE B;  3I55 S;  4M5K A;  4ED7 A;  1KEK A;  4Z2X A;  1TL3 B;  2NXE A;  4JI5 F;  3G9C A;  1K9M T;  4ZPB A;  3OV7 A;  1TFY A;  3THT A;  1IR1 A;  2W4P A;  4UZB A;  1GTE A;  3T5J A;  2PFD A;  4RX6 A;  4A47 A;  4YY3 F;  3QLH B;  3CCL S;  4QR0 A;  3JYT A;  3NGU A;  3GIR A;  2AZ3 A;  3KJV B;  4A46 A;  3JQK A;  4OJ1 A;  1NM2 A;  3GP9 A;  4H4M A;  4CYU A;  2PA3 A;  1N88 A;  1TKX B;  3OVB A;  5IXU A;  4ZIV A;  5JVG Q;  4XAK A;  3GIJ A;  2DIS A;  1RWM B;  3EVW A;  4DSF A;  5KFX A;  1SL0 A;  1X9M A;  3I4P A;  2DIU A;  1HI1 A;  4JV5 J;  5CCL A;  2JOQ A;  2W4D A;  3HI9 A;  1YJR A;  4P2M A;  3OVA A;  2ZM6 J;  5LJ3 Y;  1FJC A;  1HPZ A;  4Z37 A;  2CIM A;  1VRQ C;  3SCJ E;  3TVK A;  2EFV A;  1HLW A;  1P27 B;  2HLT A;  4PUO A;  2XS5 A;  1CQM A;  2I1R A;  4DG1 B;  3HPO A;  3FFI A;  4USU A;  1HBO B;  5HVG A;  3SV3 A;  2VFS A;  3O1L A;  4RU9 A;  1AZS A;  5AXN A;  3DNC A;  5G4D A;  1D8Y A;  2CWK A;  4FXW A;  1LFW A;  2VIH A;  4HHH A;  2J9D A;  4CO3 A;  2OML A;  1Y4Z B;  2P5V A;  2A2C A;  3M05 A;  1F0X A;  1OQ3 A;  1U8S A;  4P2X A;  2W8K A;  3M2R A;  1TU0 B;  3CCQ S;  2LEA A;  2BAN B;  5IZH A;  3OTE A;  4JI3 F;  4RO0 A;  1DQA A;  4PCQ A;  3K8V A;  2HVE A;  2FLN A;  4WZM A;  3FCH A;  1S0M A;  3DRR B;  2MTL A;  2ZBP A;  3WBZ A;  3UFC X;  1RU1 A;  1Q82 T;  2H5E A;  1V3S A;  2PII A;  1KON A;  5CD4 A;  1FRX A;  4NAS A;  2ZH6 A;  1S6P A;  2PMW A;  2AYG A;  5JUM A;  1O5J A;  1RTD B;  5HQ8 A;  3CUN A;  3G96 A;  3AT1 B;  2XEX A;  1Q8L A;  4G1P A;  4OZL A;  3CGI A;  1DBD A;  5L1I A;  1PIL A;  4WE1 A;  3M6X A;  4JV2 A;  2GGP B;  2V2K A;  3M32 A;  3I5B A;  3PZP A;  3CUL A;  4DV7 F;  2LYV A;  1NBE B;  3K5P A;  1SXL A;  2OIH A;  4ZPA A;  2HRT A;  3ISN D;  3O8W A;  1TV6 B;  2J76 E;  2FGO A;  1N6Q B;  1PBU A;  3OFE A;  2CQB A;  3D6T B;  3EM1 A;  4DR1 J;  5DQG A;  1U24 A;  3J7A N;  1X4G A;  2VB6 A;  3CJ4 A;  4OIX A;  4HT5 A;  4RW8 B;  1FVQ A;  4DFM A;  2ROE A;  3J80 Y;  2W2M P;  3MEG B;  2DIV A;  2R8J A;  1JJH A;  1R6Y A;  4O3R A;  1HQ2 A;  4CM0 A;  1IQZ A;  4DPW A;  1XQI A;  3KHL A;  3A8I A;  3QT5 A;  3HHL D;  4F26 A;  3EZO A;  3R6L B;  3DFE A;  4KGV B;  4GKJ J;  3I0S B;  1FKP A;  1RLC L;  3IXQ A;  1Q81 T;  5FDL A;  4PWW A;  3CED A;  2E5I A;  2WAQ D;  1WC5 A;  2ZKU A;  2R7Q A;  3MF5 A;  1LKZ A;  3EPG A;  2F8E X;  1OWX A;  1LWE B;  4B02 A;  2HMI B;  4OZ1 A;  4JI6 J;  2KM8 B;  5IQQ A;  3MPD A;  2HHQ A;  5HRO A;  1RIS A;  2XMK A;  3T19 A;  2Q66 A;  2I8E A;  3GJR B;  1NCL A;  3OQ2 A;  2PI5 A;  2OI2 A;  1ZBT A;  3NGK A;  2DHG A;  2MHE A;  2JC1 A;  2VDH A;  2V2Q A;  2EK6 A;  3CB4 A;  1VDH A;  1N32 F;  2FJV A;  1GQE A;  3CDA A;  4B9N A;  1FKO A;  4ZIW A;  1F6T A;  3GSI A;  2PFF B;  2N7C A;  4ZCI A;  1IKV A;  2EFO A;  1WC4 A;  4QU6 A;  2IBK A;  1D1U A;  3M30 B;  1EIY B;  3MFI A;  2AX0 A;  2CQ2 A;  2HK2 A;  2B6A A;  5CQG A;  1HNW J;  2RNE A;  1QUP A;  4XDC A;  4IFY A;  3M8P B;  4B3S F;  1NK8 A;  1TMJ A;  2IM3 A;  3J81 j;  1NDC A;  3MEC B;  2MXY A;  4E8U A;  3C2P A;  4QWD A;  1FD2 A;  3B4D A;  1ELO A;  2QYG A;  3CJK B;  4N77 A;  1W25 A;  4LSL A;  3M8Q B;  3MI7 X;  1BQN B;  1EQM A;  2RD5 C;  4IH6 A;  5LT5 A;  3M8W A;  1RT7 B;  5BR8 F;  2E5L J;  3OL8 A;  4F8R A;  4A8Y A;  3D6F B;  4ECZ A;  5E7O B;  2UV8 A;  2XY5 A;  2O3D A;  2XMM A;  2CPZ A;  3WX4 A;  3K58 A;  2D3O R;  2VG7 A;  2ZNZ A;  2Z2L A;  3V2U C;  3NP5 A;  1OPZ A;  3DLE B;  2E1M C;  2VH7 A;  3PNI A;  4F0H A;  3KK2 A;  5T7L B;  1MMD A;  3KLE B;  4EUV A;  5EGY A;  2N7Y A;  4LQ3 A;  4K0K F;  3FJ2 A;  2ACM A;  1B7Y B;  2BKO A;  2BOA A;  4HR2 A;  2ZFH A;  1F5B A;  5C42 A;  3KTQ A;  2P2C B;  1RTH A;  4Y0F A;  2DGW A;  2RS2 A;  4OYA A;  1IVZ A;  3UDC A;  2ASJ A;  2K7K A;  1FXL A;  4NCA A;  5F8J A;  1I1G A;  2HS3 A;  3LPE A;  2ZZM A;  3W63 A;  3BPD A;  2Y3Y A;  4U67 Q;  4KR0 B;  4MTP A;  3CJ8 A;  5C7P A;  3BQ2 A;  1VQK S;  2ZWP A;  4IUF A;  1HHQ A;  1PJ7 A;  1JLF A;  1H72 C;  4DPU A;  3CCV S;  4M5D B;  4R8U A;  2Y9H A;  2VPX B;  4DDF A;  3R8Y A;  1LXN A;  4RW9 A;  2P9G A;  3RU0 A;  2ZH2 A;  3AQP A;  2FLO A;  2GJ2 A;  3E01 A;  3J7Y U;  2NLW A;  3C14 B;  5JMN A;  3DRY A;  3Q2T C;  4LRB A;  1YDL A;  4ECY A;  2EWH A;  1YRX A;  2PA8 D;  4URG A;  1VGY A;  1QAJ A;  1J5E J;  4LBH A;  1Y5N B;  2JDJ A;  3HSD A;  1VQ5 S;  2CWX A;  2BAB A;  2XMT A;  1HWL A;  1H38 A;  4MJK A;  1YJU A;  1X5S A;  2EEY A;  1NRK A;  5ITH A;  4C0O C;  3V4I A;  5DZ6 A;  5J1E A;  3DLG A;  2D74 B;  3ZTR A;  2YKA A;  3MM6 A;  3K2Y A;  1ACM B;  3TQ1 A;  4IG3 B;  2KJW A;  1XC9 A;  2POK A;  5F3Z A;  1FDD A;  2B5J A;  2UXB J;  5F0W A;  4FP9 A;  2YNI B;  3OFF A;  1VQ8 S;  1UVJ A;  2ZZN A;  4NA1 A;  1M5S A;  4KPY A;  5GME A;  3AFG A;  3DU5 A;  2V9W A;  1M5K C;  2RDI A;  5I42 B;  3KK1 A;  1F1B B;  1TEL A;  2RT3 A;  4HEA 9;  2HFO A;  1E6V B;  3DGP A;  1BQM B;  2C2K B;  4RU2 A;  1S6O A;  2M4M A;  2FHK A;  4ZP9 A;  2N4D A;  2PEB A;  4DR5 F;  4DUZ F;  2XSF A;  4KRW A;  5F8M A;  2CJQ A;  2XSJ B;  1I51 B;  1SIW B;  1Y11 A;  3UNY A;  3GQC A;  1HD0 A;  4PAA A;  2HNY A;  4I56 A;  1NUE A;  2XB2 D;  1S1T A;  2YKN B;  1TAQ A;  2DO4 A;  3FEZ A;  1WOS A;  3JTN A;  3D6H B;  5KFQ A;  5K8P A;  3MD1 A;  1VMB A;  3H8Y A;  2WBM A;  2LA6 A;  3KHG A;  3I32 A;  9ATC B;  2K1R B;  1NB2 A;  3TAR A;  4DV0 J;  1SC1 B;  1TFW A;  1YLX A;  5D3G B;  4DV3 F;  1H74 A;  5D77 A;  2VOO A;  4O3N A;  1FJE B;  2F9D A;  5IV4 A;  5IT4 A;  1IBL J;  2DRB A;  2ZE2 B;  3CMA S;  4C0B A;  1S1U B;  1LW0 B;  4M5J A;  4MAK A;  1S1V B;  3D54 A;  2BKN A;  2ZHO A;  4M8L A;  2KJV A;  3NS5 A;  4OYX A;  4Q7A A;  3QRQ A;  5KG6 A;  3W8G A;  3GYX B;  2VC1 A;  2FHM A;  1Y00 A;  1X31 C;  4O44 B;  2DGV A;  1TK0 A;  1N5Y B;  4ZLP A;  3V6H A;  4I68 A;  2KRR A;  1K8A T;  2KZM A;  1HL6 A;  2MZQ A;  5LXY A;  1WEZ A;  3G86 A;  2QA4 S;  2Z4P A;  3ZXW A;  3OTO J;  5SZT A;  1JLE A;  2YKM A;  1GT8 A;  1CBK A;  4P73 A;  2I38 A;  5B0D A;  2HFZ A;  3BSC A;  4J90 A;  5KFP A;  3DDK A;  4N8O A;  3GLJ A;  4DLG A;  4WPA A;  3HMJ G;  4ICL A;  1HNX J;  3RAM A;  8ATC B;  3J80 U;  1S0O A;  3SFU A;  2F8M A;  1Q4R A;  1WEL A;  1SH3 A;  4HH0 A;  2DRD A;  1TKD A;  3ZFV A;  2J0S D;  2ZKT A;  3H2L A;  3EVO A;  4M5G A;  1AW0 A;  5LMU J;  1RWN B;  2JFD A;  3M6V A;  5F8H A;  2DNQ A;  4TY8 A;  3CC7 S;  2EFN A;  2V94 A;  1RBA A;  2PI4 A;  3B54 A;  2V4J A;  1SJQ A;  5SUH A;  2D1C A;  3JSR A;  4EYI B;  3BZQ A;  3R2C J;  4E2F B;  1FCA A;  3QMQ A;  1R8A A;  1RKI A;  3UD3 P;  1TL7 B;  1RE1 B;  4C8O A;  3CJS A;  3DYA B;  3TVZ A;  1U49 A;  3VZI A;  4EZ9 A;  3NNH A;  1N36 F;  4FKY A;  5E3R A;  4KT0 C;  4LF5 F;  1RTZ A;  3BKF A;  1RUS A;  3KDO A;  1S7H A;  2QLJ B;  5J2M B;  2J0Q D;  3M8S A;  1XMQ J;  1UW4 A;  2IAJ A;  4Y3C A;  4DXL A;  3TOQ A;  4LBP A;  4X4S A;  2YX7 A;  1TKZ B;  3HDS A;  3BF4 A;  4JBC A;  1VQ6 S;  4LSN A;  2N3O A;  3VAG A;  2CPH A;  3RRK A;  4USK A;  3DOM A;  2D41 A;  4NOH A;  2FJE B;  4OYO A;  2M7S A;  2WTF A;  3LA0 A;  4P7V A;  2OHD A;  1I6J A;  3J81 Y;  4BDP A;  4LSZ B;  2M9K A;  2XYP B;  3TR5 A;  1M90 T;  2JEF A;  4TXS A;  2YWE A;  1T9Y A;  3A4T A;  2GJI A;  1NHU A;  2WVE A;  5BJR A;  3VR1 A; 
#chains in the Genus database with same CATH homology
 2F4F A;  2XM3 A;  2A6O A;  2F5G A;  2EC2 A;  2FYX A;  2VIC A;  2VJU A;  2VHG A;  2VJV A;  2XO6 A;  4ER8 A;  2A6M A;  2XMA A;  2VIH A;  2XQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...