1S6UA

Solution structure and backbone dynamics of the cu(i) form of the second metal-binding domain of the menkes protein atp7a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
GEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
publication title Solution Structure and Backbone Dynamics of the Cu(I) and Apo Forms of the Second Metal-Binding Domain of the Menkes Protein ATP7A.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6uA00
5B0CA 4F67A 5B08A 2IFXA 1Q53A 1YRXA 1ULRA 2KT2A 3KNGA 1W2IA 2IYIA 1YJRA 2FTRA 5F0UA 2ROGA 1S6OA 4A47A 1U7LA 1URRA 2BUNA 3HFKA 3CJKA 5KAKA 3LGNA 4FNHA 3WDOA 1FEEA 2OFGX 5F0WA 1SI9A 2K7KA 5B0GA 2BJEA 2QLWA 1S6UA 2RSQA 1V3ZA 1YJUA 1SB6A 1QUPA 5B0DA 1FD8A 3KG1A 3T9NA 2HIQA 2L3MA 1X8DA 2EW9A 2ROEA 4FNIA 2GA7A 2XMTA 4ZA1A 1IUJA 1AFIA 2ZDPA 1VQSA 2OAUA 2GO8A 3BR8A 2N4CA 2ASYA 4NL5A 3BF4A 3TRGA 1Y3JA 1KVJA 2N7YA 5B0BA 5T7LA 4HH1A 4YEAA 3DXSX 3LO3A 1CC7A 1OQ3A 2HFOA 4Q2MA 1R6YA 1YG0A 1OPZA 2K1RA 2BYCA 3E8OA 1N5TA 2GCFA 1FESA 1Q8BA 4NPOA 5T7LB 2HLUA 2KT3A 1SQEA 4EFAC 2KYZA 2OD4A 1K0VA 2HLTA 2HQIA 2LXFA 2JDJA 2K1RB 2LDIA 1GXUA 2XMVA 2ROPA 4Q2LA 2W4DA 1N5SA 2QIFA 4A48A 4DL0C 5IXUA 1X0PA 1AW0A 2G9OA 1VQYA 3BGUA 1YJVA 2FB0A 2OD6A 2OMOA 1CPZA 3HHLC 4OIXA 2Q3PA 2QLXA 3HDSA 3TOQA 1TUVA 3QGPA 4DPOA 2XMJA 3I9ZA 4Y2KA 1LQ9A 2IYGA 2XMUA 3HHLB 2AP6A 2QYCA 3MCSA 1TZ0A 3DCAA 4HL9A 1MWYA 2RU9A 4A46A 2K2PA 2RMLA 4HI2A 2AW0A 3VTIA 2XMKA 1JK9B 3F44A 2OFHX 1TL4A 2PGCA 4Y2IA 3BN7A 4YDXA 3FRYA 3HHLD 3HF5A 5B0AA 3HX9A 3K7RA 2K7JA 2KKHA 5K9FA 1FE0A 2AJ0A 2HFNA 1APSA 1OQ6A 1WD6A 1N5VA 2BJDA 3IWLA 2CRLA 3IWXA 3FGVA 3HHLA 1AFJA 1FVQA 1N5QA 3KG0A 2W4CA 2AJ1A 1Q8LA 1RJJA 1Y0HA 4U9RA 3BB5A 3FMBA 2LQ9A 3KKFA 2GFFA 4OJ3A 5A6PA 2GGPA 2W4PA 3LGMA 3QMQA 1OSDA 2VH7A 1Y3KA 2OKQA 1YJTA 1TL5A 4QOTA 3MZIA 1MWZA 2PD1A 1FE4A 1JWWA 4ZOSA 3UDCA 1X7VA 3BDEA 1XBWA 4HI1A 3GZ7A 2ZDOA 1CC8A 2GGPB 1Y9OA 1TR0A 1P6TA 2OP5A 2XMWA 4OJHA 4OJGA 4A4JA 4DN9A 2FIUA 5B0EA 3TNVA 5B09A 2LQBA 5B0FA 5A6WA 2ACYA 1KVIA 1KQKA 3CJKB 2N4DA 4OJ1A 3BM7A 2GV1A 2VV5A 2FHMA 4Y2MA 1Q4RA 2XMMA 1GXTA 1P8GA 2RILA 4HH0A 1FVSA 2BBEA
chains in the Genus database with same CATH superfamily
4P75A 3PYGA 1S5ZA 4CLFA 2XLKA 2YKNB 2F4VF 4OZLA 1ZM4A 4DCJB 1RKJA 5HVGA 3H8YA 3OTOF 1HNVB 1TKZA 2OMLA 1FA0A 2DNYA 3RB0A 3IAM9 4DI6A 5AE3A 1GTEA 3ENVA 4KY3A 4OQJA 4HYKA 5T7LB 2C2RA 2UUTA 2ROPA 3HVAA 2EFVA 4QYRA 4ETXA 3UR3C 2CNKB 1C2PA 4DR1F 4OLPA 5HLFB 1VQNS 1JMTA 3MMJA 3KK3B 4I7FA 3W8GA 1W2BR 3D0HE 3KHGA 3BN4A 2XEXA 1CLFA 1Z2LA 2AGOA 2IPOB 4QIVA 3CDBA 2RHSB 4HLBA 3Q8SB 1P6TA 3SDEB 2FZKB 1DQ9A 4K8RA 4ED1A 1KLMA 3MR5A 3TP2A 4KHRA 3RBXA 1KFDA 3R9LA 1H2UX 4F67A 1JKHB 5B7WA 1D09B 3T5LA 2W24A 3VGUA 5G0RB 1BUXA 4C11A 1B4SA 3B4MA 3ILJA 2R42A 2J8AA 2DHXA 2R4FA 2CPHA 4JI8F 3MPYA 3DGPA 1IJEB 2R7SA 1NDKA 4OX9J 3JSBA 2XTJP 1NPRA 1TKXB 4IQMA 2HW3A 3HPOA 2LEAA 3G82B 2EKYA 3JTOA 3R3TA 2DNRA 1HLWA 5B0AA 3IWNC 2OHDA 5K9FA 1OQ6A 4DZ6A 1MN7A 3AQOA 3M6VA 2DH8A 2B9XA 5GAEU 2DHHA 1S57A 2F65A 3A3NB 1EX8A 5ETMA 2RDJA 2MLYA 2W7OA 4N56A 1FVSA 2B9WA 3AAWB 2U1AA 2CKWA 5ETRA 2QN6B 1RCOB 1YJRA 4IH6A 5J2MA 2KFNA 2XS7A 2K7KA 2QA4G 3MFIA 1Q82T 1Q16B 1EP4A 3B78A 3QT5A 4USUA 1B0PA 3TQEA 1S4FA 3PIOQ 3NNAA 1N5TA 3U1NA 1EKRA 1WC0A 1S97A 4K4YA 1HBMA 4DV4J 3CEDA 4TN2A 4RL1A 3T5JA 1KP6A 5AT1B 1CJVB 4L75A 2FC8A 2VJVA 4LR7A 4KKOA 1LK7A 3IBWA 2DY1A 4DHVA 2VG7B 3RAQA 2H65B 1GMVA 2DRBA 3GV5B 3HXMA 3MMBA 2O3DA 1YIJS 2RE1A 2FHMA 1I5OB 3ZZYA 1AYEA 2V6AA 1HHSA 3WDOA 2HNDA 2AWZA 4TYAA 1TKDA 3KG1A 5LSLA 3BR8A 3KLFB 2V34A 3OD2A 5A0YA 2H54B 2ZC3A 4KQZA 3V6DA 4FVMA 5KFBA 2OD4A 2W1BA 2ZH7A 1DJ0A 3RJMB 5E3PA 1S76D 3SSRA 1X5OA 3D0GE 2DGTA 1OS5A 1TUVA 3QGPA 3KHRA 4RBTA 1LQ9A 2QYCA 5D0HA 2R8GA 4K4SA 4KO0A 3BN7A 1HBOA 2DPIA 2V9KA 1XWLA 2EWHA 1V5IB 2M7SA 4DJBA 3SQOP 1UZDA 3KG0A 2O5DA 1T9UA 3C46A 5KFHA 1U6ZA 1T05A 4LQ9A 3VQSA 2HS4A 1J5EJ 2RF2A 1WF0A 3CDUA 2IJRA 4LF9F 3MM7A 3KUGA 2QG9B 2CQ0A 2R7WA 4K4VA 4YB5A 2UXDJ 1DARA 1WI8A 1QDUB 1RB0A 3G96A 2EKNA 4J9UE 1S6UA 1VGYA 3M32B 3P3DA 2KFYA 4KHPJ 1AROP 3LA0A 1AB8A 4KHMA 3QQCD 5CYQA 2Z8QA 4R0JA 4PQAA 1DQAA 4ECUA 4WFNQ 4O23A 1SV5B 2DRDA 3MAAB 2XMVA 4DLEA 4DOZA 1VRQC 1YJVA 5C2CA 3G6VA 1QSLA 3L9ZA 4QW9A 1R43A 5LL6d 3H7HB 2PEHA 1RTDB 5FLXY 2LLZA 2WW4A 4N47A 4G3IA 5GAGI 2VFVA 3SFUA 3UN5A 3CJ8A 2QA4S 5BR8J 3EZ5A 4H4OA 1X31C 3N01A 5HJYA 2QL5B 2QJ3A 3CC4S 3GV7B 4RWWA 4L3NA 1Y4ZB 4QWEA 3NNHA 5HROB 1RWNB 4RX6A 1WG1A 3ZZZA 1VBZA 1FRMA 2DD8S 3C16A 5FDLA 4NCGA 1WC5A 3N5FA 4XPEA 3DRSA 1IQZA 4GO5X 1F1BB 1H7WA 1NJXA 5KFVA 3H25A 4ZPVR 2LA4A 1XEZA 2CDRB 4DQQA 4JI3J 3C15A 4WBFA 4FXVA 1X5SA 4I2QB 2H5JB 3AA8A 3GFXA 1WOOA 3QFWA 2FZGB 3N6LA 1KS2A 5D0GA 5LOQA 3R8YA 2RMLA 2CJAA 5LMUJ 2ZUGA 5KOWA 4YHHJ 4QR2A 1JLGA 4YDXA 4K4ZA 3AB2B 2BQ3A 3KMSA 2ZNYA 3OXFA 5L39A 3IC1A 3PW4A 3K5NA 2DGXA 3T1YF 2FLNA 5KG2A 3I56S 3OTEA 3EGZA 1IBCB 2NSBA 1RA6A 5A6WA 4YFUA 1J5EF 3Q8RB 1YJWS 2IA6A 2VG5B 2MHEA 2QT7A 1U7LA 2BUNA 2ZWOA 4UT4A 4WFBQ 5B0GA 2GC8A 1HQEB 2UXDF 2ACMA 1FD8A 2ROEA 3H5UA 3IBCB 4MH8A 3WBZA 2WZ1A 3ZTRA 4KGXB 4G1QB 1SC1B 3IP0A 4RO0A 3I31A 2LXFA 3MD1A 3GPAA 1S1TA 3ISNC 2W4DA 2QIFA 1WDTA 3CD6S 4RNOA 4GVBA 5J2QB 2AQ4A 1GAOA 2DISA 3KDOA 3F56A 4DV0J 4NLXA 5KFQA 2YNFA 1WSVA 1LNQA 3UPFA 3AJ1A 2KZZA 2WOMA 3CTRA 3NGKA 4C0HA 4YR3A 4UZCA 2XZDB 3CT9A 3DMJA 4RW9B 1OSDA 2B4OA 2E1AA 3MM5B 3OBIA 2UVUA 1RHMB 2DGVA 3C8YA 2VG6A 2PIIA 3A8IA 1RA7A 4J9MA 3GWCA 1PJ7A 4MKVA 3M2RB 1Q53A 1SJFA 5GMEA 1TU0B 2BJ9A 3C6UA 1K47A 4AL5A 4N41A 4FF2A 5F41A 3NRBA 3EGNA 1TAQA 2DHSA 3L09A 3TUIC 4O3NA 3GE9A 3GB0A 3O5TB 1S59A 2O66A 4JI3F 2MKHA 4P9SA 2HHSA 1XJWB 3KLEA 3SCIE 2G9OA 3GR0A 2J9DE 4CIOA 1MROB 4P71A 4RU9A 2ILYA 2BR0A 1SH3A 2HURA 3DCAA 2RIJA 1RZMA 1T9XA 2C2NA 3MM9B 1YDLA 1HNIB 1KHVA 3G87A 1IBLF 2XCAA 5LMUF 3CCTA 2AJ0A 1HPZA 4CLZA 1N0UA 1HR0J 1WKKA 1YKWA 4ZVGA 1T8EA 3QRQA 1JWWA 2DNNA 4WF9Q 3KFWX 2VBXA 2ACYA 5DO2A 3AJ2A 2EG2A 4OJ1A 1ZA1B 3TR5A 3JSMA 4PWDB 4C9DA 2V4JB 4A8KA 3TVYA 3UE2A 4DSIA 1S7IA 4K2XA 4X65J 4NE9C 4CLUA 5D77A 5AJ3F 2LMIA 3D3BJ 3RRKA 1RGVA 3PYDA 5KFFA 3BBFA 5IV3A 1IQTA 2CDQA 5J1EB 2W25A 4ED8A 1FESA 3EICA 4JI4J 1RU2A 4QU7A 2DNMA 1BXNA 2K2PA 1XK8A 3WX4A 2WTFA 2LDYA 4LF8F 3LWMA 3IXQA 1FXRA 2BJDA 4EBCA 2DKOB 5HBMB 1DY3A 1IR2A 4HT5A 3KTQA 1UW9A 4YR2A 4HEA9 5J2PA 3I4HX 3AB4B 1ZM2A 3FFIB 4U7CA 4H54A 5T41A 1XNRJ 2VFRA 2M9KA 3TVZA 2V4QA 2F9JA 2FJXA 1VJWA 4KE5A 1WHWA 3D9BA 2ZVIA 1RUSA 1KLNA 2CQ4A 1YJUA 3O44A 2BA9A 4Y00A 3DFEA 4JI2J 4I67A 3G6ES 3N9UC 1TAUA 1C1BA 3WX8A 3IR5B 8AT1B 1TMJA 1S1WA 2IAJB 2CQ1A 2J6TA 3SQGA 2HAIA 2BJ7A 4K5RA 2IC3B 2ZE2A 3KLGA 2YNGA 3MM6A 2L9NA 5EUHA 1VQYA 3PFEA 1V3RA 3FEZA 5IS2A 3N6MA 4ZITA 2XMKA 2A3JA 1X4DA 1L5UA 4KV8B 3U7JA 5IQ6A 4ALZA 4WYLA 4QIGA 1N5QA 4FDFA 1YJ7A 4UUXA 5U47A 2KG0A 1DTTB 3KOAA 5KFGA 2Y1IA 2EXUA 1VC0A 3KUHA 4I2PA 1NB7A 1KFSA 4PPZA 3H5YA 3AOBA 3AJDA 2UV8G 5AXMA 4WCEQ 4JV5F 3NGRA 1RCXB 3CD0A 2F63A 3L4BC 3TAMA 2IYIA 1QY7A 4ECVA 1HARA 2MXYA 6FDRA 4QBUA 2RSQA 1TTHB 2CQCA 3BH7B 2CVIA 2HBYB 4OFZA 3CSKA 3BO3A 5KFUA 3UQSA 2QV6A 1JJ4A 4UOHA 3DRPB 5C25A 4ZCLA 4MKYA 5BXIA 1U1RA 1EKSA 4HT7A 4LJMA 2LXUA 1J27A 3H4BA 1MMNA 2MZQA 2WBMA 3BH6B 2HZVA 2ZH3A 4HR2A 5CHCB 2RJZA 2C3PA 1KOOA 2YWHA 3MURP 4Y0FA 3E3XA 2JHEA 1NKCA 2D41A 3DRRA 1CJUA 3DLGA 1TVRA 4ES1A 4U7UD 3UD5A 3GZ7A 6AT1B 2EFPA 1TR0A 1D8ZA 3J81U 3OLAA 2HHUA 5J1PA 1R6VA 3RTVA 1MNEA 3IMQJ 4ANCA 1XNRF 3OV7A 1IM4A 5E2QA 1WNEA 1HNWJ 1JJCB 1DQ8A 1S9GA 1ZAWA 1KSPA 3VGSA 1XR6A 3UW1A 2XCPA 2VOOA 3MF5A 1DFDA 4BS2A 3FQKA 2MKKA 5H9EK 4O3PA 1GNKA 3CC7S 3BQ1A 1A7GE 1K8AT 1MWQA 4DUYF 4JI2F 1B7FA 3K5MA 2HFSA 3KYLA 5LJ5Y 2Q1LA 3OSNA 1QAYA 1RAOA 2OPRA 2HQIA 3OR2A 2VD3A 1N5YA 1Y00A 5ETQA 2CQBA 1U48A 5JVHQ 5K8NA 3KG4A 5LJ3Y 2MPUA 3EZUA 3EYZA 3QJJA 1RT3A 4CYUB 3EVOA 3ZTQA 1CJTA 4GC6A 3MFHA 2D9PA 2K3KA 4P2FA 3FGVA 2MEWA 3BKFA 1ICEB 3R5CA 4F02A 5BYRA 3S7RA 4EYHB 1TL1B 5HAOA 3CJ0A 1HHQA 4M95A 3MEDA 1WC3A 2XYPB 1LW0A 4IH7A 2FYXA 5D0EA 4FYXB 3M1VB 5IV4A 4P7TA 2XS5A 3OT9A 3EM1A 4JYAF 1JLAB 2DYAA 3V6JA 1I94F 1DRZA 3P8BB 1SKUB 2UP1A 2KXFA 2EW9A 5DRKA 5DDQC 2CPFA 2X51A 1CS4A 2VZ9A 2JLFA 3LOUA 2E9ZA 2GQQA 2YH0A 2V2VA 4KIAA 2PA8D 1FFGB 1RT6A 2BANA 3TA1A 4MIBA 1FKOB 3FUYA 2OGUA 2QGFB 1U4BA 2K1RB 4PXDA 3OHAA 1S1UA 2GHPA 5HATA 2IMWP 5FD1A 3ZZPA 1JNRB 1NXIA 3V4MA 4ERDA 1ZYQA 2E5LJ 4TNOA 3GIKA 1S1XA 1BQNA 1UL3A 3F44A 2O67A 4DV7J 3GIMA 4JV2A 3CCVS 4ATNA 3GTYX 2GMLA 4DL2A 1N5VA 2VBZA 4YOEA 4OI2A 4GKKJ 2P9GA 2FLOA 3GCWP 2MLZA 3BB5A 3KKFA 4XTTA 3PHEA 2GVDA 3DOLB 4USTA 4ES2A 4WP8A 1EQ0A 4G1IA 1IKXB 5CABA 3W7BA 1IR1A 1VFJA 3ZNUA 4IG3A 4E98A 4DFMA 3RB3A 1HNWF 3VWSA 2MKYA 1R0BG 2AYMA 4PG8A 3HHDA 4RR5A 2DNZA 3LP0B 3HT0A 3HMJG 2ZJQQ 4OZJA 4KSEB 4X4RA 4LRCA 5IXUA 4N76A 2LU1A 4K4UA 4QWBA 2ERRA 4D3GA 4M1KA 1RP5A 4DR3J 4NLUA 1LK5A 3VQTA 3WZ0A 4K4WA 4CNZA 2CRLA 5I3UA 3R7NB 3GP9A 2I2YA 3VAFA 3UD4P 2D1CA 1G6BA 2VA3A 3EX7B 3NEKA 1QAJA 4ZP8A 1S6QB 1VRUB 5KFDA 3PW2A 3ADAC 1ZTTA 4FS2A 5MLCV 4AL6A 3GYXB 2JL9A 4AFFA 3DHXA 4J9QA 3M8WA 1PAEX 6FD1A 3NBPA 4ICLA 1WHXA 4WXOA 5K14A 1JLEA 4UOGA 2NLWA 3HZEA 4MK9A 4DV3J 3I32A 2DH7A 4F0MA 2XG8A 2F8HA 2P9EA 2OSRA 1OPIA 1FRJA 2LYVA 4DR7J 4G65A 2XY7A 3DM2A 1GTHA 1B0TA 2BE2A 1N33J 3FC9A 2ZH6A 2XSJB 3I9ZA 1CQMA 3T3FA 3DKDA 4RW6A 3EGWB 3CCQS 3M05A 2E5LF 2XYGB 1JXLA 3LW5C 5AXLA 3D1HA 4YR0A 1MMLA 1KRPA 2B56A 1XR7A 2U2FA 4I56A 3R27A 2W4PA 4ZVOB 4ZDNA 1FRHA 2GGPB 2H4WB 5B0EA 5L46A 2FHOB 3CO9A 4FP9A 3MR7A 1TL3A 4IFYB 4AXIA 3V6KA 1NZ8A 4NMXA 2RILA 2KTQA 1NSKL 1TKTA 2C2MB 1YX2A 3W2VA 2YX7A 3PRDA 2G13A 4IRDA 3H90A 1WTFA 2R7VA 3LP2B 4JP8A 1QSSA 4Y2CA 2WVDA 3SZ2A 4N77A 1QUPA 2GW8A 3CGIA 3G9CA 2Z2MA 4PEOA 5GVQA 3DHWC 3W60A 1X4GA 4B3MJ 1TQLA 2HLTA 3BKUA 4A8YA 1SJQA 1WHVA 1UJ5A 2OD6A 3AA9A 2QLBB 2CPYA 2GIQA 2MKJA 4LRFA 4NEZA 1S48A 4F0KA 1FJGJ 2VPXB 4Y3CA 2COLA 2MYFA 3RYLA 5I3PA 3BBBA 4WFAQ 4DN0A 3D7SB 1TK8A 5HLFA 3FMBA 2F5GA 2YKMB 5A8RB 4KJIA 2HHHJ 4D3HA 5F3TA 1MSWD 3UCZP 2BRLA 2X1AA 1R27B 1S0VA 1YZ6A 3SCJE 1JXVA 1LW2B 1JIHA 4AE5A 4BCAA 4OZ0A 1M5OC 4OHVA 1PILA 1JLQA 3UI3A 1J2VA 3R6LB 2RB7A 4LREA 3UVJB 2HS3A 5GAHI 3SCLE 3I87A 3BYPA 4JV1A 1F9EB 1FD2A 1VCTA 3JYTB 4ITSA 2L3MA 4ECSA 4PXBA 4HHUA 1JKHA 1Q5YA 4QIWD 4DMZA 4ZP7A 2RUSA 4LRAA 4F7VA 3R2DJ 3RW6A 1CC7A 2HS0A 3V2UC 5G0RA 1KQFB 3EXYA 1RTHB 3SCKE 3N0VA 4RUHA 2FDNA 4DR7F 1ZM3A 1K9MT 1Y5NB 4IRKA 3T41A 1E6YA 4TLRA 4FBTA 3VAHA 2CJQA 2DXEA 3K57A 2PMHA 4XIUA 1G3OA 2RKIB 4DV1F 3PEHA 4W4MA 1I6JA 1REVB 3G82A 4DR6F 1X9WA 3J7ZT 3HD2A 2B0GA 1FE4A 2POKA 2ABYA 1RT1A 3IG1B 2M2BA 4M5NA 2HNZB 4TU9A 1SL1A 3BQ0A 3PKYA 4YUDA 3EDRB 1VQLS 1SKRA 1IN0A 4NI2B 1F60B 2RDIA 1GFWB 8RUCA 4ED7A 3FJ2A 1TMMA 3JTPA 1HWKA 2Z2LA 3OJUA 4NZ0A 2J9EA 2VBWA 3DDKA 5B0DA 3MPWA 1X8DA 4B3SF 2FJDB 4IOAQ 3HZGA 2NPIA 3W9JA 1XC9A 3QBCA 3GJTB 3MI7X 1X4FA 3HVRA 3AD8C 1TL7B 4WP9A 1VHFA 4DR4J 2JOQA 3GU0A 5LMNJ 5CYMA 2JJ4D 3QZ7A 2CJBA 3P96A 5E0OA 3MR6A 4P10A 5EDWA 4DR2J 4DZDA 1QTNB 3IN5A 3I0RB 2FY8A 2HRTA 1WF1A 2W2MP 1RT2A 4KAIA 3FCVA 3L7PA 3TAPA 2GV1A 2E9TA 1OWXA 5E3QA 3M2UB 4Z7YA 4CLTA 4KPCA 1FFSB 2HHPA 2HWIA 1FEEA 5AE1A 2WB1D 1BHNA 2CG4A 2ZKUA 4RUBA 1U24A 2JEIA 1GMWD 2ATCB 3IM8A 4UW2A 3DDNA 1SJ3P 5C42B 4NX9A 3KLFA 4CLYA 4DL0C 4DV6F 3TA2A 2LA6A 5HMXA 4BBYA 2V2ZA 1SKWA 5DG7A 4L73A 1NH8A 1HNZJ 4LRBA 3BREA 4FF1A 2BJ1A 2E66A 1RWVB 1FKPB 4N5SA 5DDOC 4EI2A 3QO9A 1VQPS 3MMAA 2I0XA 2HHVA 4OJ3A 1C1CB 2FHKA 2Y9HA 4HHJA 4YY3J 3DOMB 2OEMA 4OHYA 3FCHA 5ETKA 3H2VE 4CM2A 4DXLA 1UVKA 2HG4A 4C8YA 4YDDB 3DLHA 5KAKA 3ULHA 2ASDA 2JC1A 3T9NA 2KM8B 5HANA 1R0AB 4LF5J 3QRRA 5KG4A 3HLUA 2KVQE 1NRKA 4P2SA 2MGZB 1SXLA 2GCFA 2DNKA 4B17A 1N32J 2ASJA 1ACMB 3E2EA 4WPAA 1SV5A 5THWA 1VQOS 1K73T 3MAAA 1RYSA 2MY7A 3MPVA 5LSRA 2MHNA 5LMNF 3IWLA 4A8XA 2N82B 1N0VC 1S49A 2W2QP 3GIJA 4WWSA 3C14B 2MQPA 2UVVA 1MWZA 2C42A 2MY8A 4NZ6A 2DNLA 4WFYA 3KJQB 1ZZFA 4O44A 1NDLA 4R5PA 2RHQB 1R8PA 4H4MB 2K06A 3FSXA 1Z2ZA 1LWCA 2IM0A 3AOAA 4ZHRB 2MB0B 1IBMF 2G4BA 1CG2A 4OV1A 2OTLS 4ZP9A 4JI6J 3NLCA 1U1PA 4FPIA 3M8ZA 2RD5C 1VQ8S 4M5KA 4J9NA 1PJ6A 1S99A 4WU3A 3HP6A 1WSRA 2CWKA 1T9WA 2HNYA 5I42A 4XAKA 2O01C 4FS1A 2MDAA 4NWBA 3GMGA 1X4EA 1R6YA 4PAAA 2MKCA 1T95A 4FZVA 2JEGA 3NP5A 2L9WA 3THTA 1H98A 4IH5A 2HK3A 2DR6A 1C4AA 1HW9A 4I6AA 3ZTSA 3PV8A 2J0WA 4TU8A 1U09A 1HW8A 3OL6A 4ETZA 4ELTA 1M0SA 1A6LA 1RT4A 1FI4A 4NEYA 2OPSA 2A2DA 3AT1B 1KC8T 3H40A 2XI3A 1UFWA 1TFYA 2XMWA 3R2CJ 4X4UA 2XY6A 1UMJA 4ZIVA 1N36F 4K4TA 2MSSA 4E2FB 2KU7A 4KGZB 4BWMA 4I1TA 1YZ7A 3PR5B 1NHUA 1VI7A 4YQWA 2QLWA 2UVWA 2DTJA 5AE2A 3MEEA 4TY8B 1F2GA 2VG5A 1JLFA 3I0SA 2B3TB 3TARA 3G71S 2IVFB 5D4LA 1QLNA 3ISND 2UUCJ 1ZPWX 4ID8A 3P5BP 1HQEA 5HP1A 2NYHA 1S9EA 4U67Q 2EPIA 3NMAA 4ED0A 1JB0C 1RAIB 2B5JA 5L38A 3KK1A 1S0OA 1RK8A 3HHLB 4P6QA 2ZH2A 1NDPA 3D3CJ 1TELA 5JJBA 5E41A 2E1PA 2QX0A 5KFLA 2VC0A 4K7QA 3SXLA 3QT6A 3SSSA 4HKQA 3PJWA 5J2QA 4LF6F 4LFAJ 3TVKA 3I96A 1PYOB 3ISZA 1Y11A 2OPQA 3MECA 3S6EA 4GKJJ 5LSOA 3A3PB 3DLEA 5B09A 2HQDA 3M8QA 3QLHB 3T1HF 1SUQA 4RW9A 4ZVEA 4CP5A 1KNZA 4MTPA 4LSLB 3J7YI 3BGRA 2KZMA 3OJSA 4JI7J 4X4SA 3PZPA 1FTRA 3HKWA 1I3OB 5F0WA 4U6PA 2H4YB 5J2NA 1IUJA 3M2RA 2CNLB 3IAS9 2YX4A 3HHKA 3MOZA 2YY3A 4I4BA 1ROFA 1U25A 3CMQA 4N7TA 2BMBA 1N5SA 2OH2A 4J9SA 5CCLA 1FXLA 5EWGA 1UETA 2DR5A 3MDFA 4IQXA 2QSWA 2XLJA 3VZHA 2DCLA 3NS5A 4OYMA 4NLWA 3OPKA 4CT9A 4DPUA 2IVYA 4K0KJ 2JZ5A 5KFKA 2P9CA 4I7FB 7FD1A 1XNQF 3MM9A 1HNIA 3W62A 1EARA 4DSLA 3BDEA 2E1MC 4DPWA 2QRRA 5F8LA 2R7QA 3D6FB 1NHVA 4NOHA 1Q5VA 2HZAA 3IRWP 3EE3A 4ED3A 3K5PA 3ZZUA 1FWLA 3F41A 2HVIA 2JVOA 1RTZA 5C2GA 2FVRA 4PWDA 1UWAA 1SC4B 1RADB 3L7OA 4OI6A 4TVAB 2CPXA 4NLQA 5LT5A 4ILMA 3GSIA 4CO5A 3J80Y 2JWNA 1UPPA 2HLUA 1H0HB 2ZBQA 3D6TB 2Z0GA 3QNWB 2XQCA 5IT4A 1CULA 3DGPB 5J1EA 1HMVA 1S0NA 4DSJA 1X4CA 2HK2A 2CJKA 1U26A 4DDFA 1HYSA 5AXNA 5CYJA 3VAIA 2DNGA 3IS9B 2HFNA 4OZ1A 2DNHA 4E8UA 1X4AA 4OYXA 2CIMA 4NA2A 3JAMY 2FJAB 3IR7B 1IBKJ 2E5GA 1NSAA 3GILA 4LVOP 7FDRA 2GO9A 4GKJF 1M1GA 4Y28C 1F5AA 4B3RF 5SUHA 4CO3A 2W2PP 4LFCF 1EB0A 1HD1A 1N34F 2WW8A 2YKOA 3NGTA 1XMOJ 2UXCJ 2HPUA 2CPJA 5GADI 3DRXA 5L1KA 1X5PA 4JI7F 5J2MB 1IKWA 3G86A 3LAMA 3TJAA 4EUVA 4CLKA 1RHKB 4DX6A 3M9NB 1PIEA 3CCUS 1EP4B 2PE8A 3HO1A 5A76A 4NXNJ 1RWKB 3LF0A 4TYBA 3A8EA 3BR9A 1KN6A 2VDIA 2XZTB 4KR0B 4OYBA 2IAJA 1GX5A 2UUBJ 3V4IB 4FN5A 4CH7A 3A12A 1KONA 3OVSA 1JK9B 1ZZNA 2VA2A 1HBMB 1FE0A 3CNQP 3VALA 2GNKA 2F4FA 3FNNA 1NK6A 3LQVA 4W90B 4U9RA 2F4VJ 1VQ6S 1S72S 2RNEA 2KH9A 1UVNA 1ZOTA 3OTOJ 3OL7A 4ZOSA 1Q95G 3DLJA 3R1LA 1MLAA 4C7QA 1VQ7S 4IYQA 2D3ZA 3NWGA 1T3NA 2ZOFA 4ZPBA 2FVPA 2G2ZA 3KNGA 5HL7Q 1S6OA 5CA5A 4ZS6A 3KMQA 5JMNA 4DR1J 2XHWA 5GAGU 1OSCA 2MZJA 3U1MA 1HWIA 3D66A 4BWJA 3DC2A 2BW2A 1NK5A 3HT3A 3M2VA 4YB7A 4NPOA 1LFWA 1JQGA 4B3OA 1U02A 5CZXA 1NAQA 1S1VA 2BV3A 3V6DB 2ALZA 2C3UA 2XSFA 3THVA 4CH1A 3MXHP 1H2VZ 3W66A 2ATLA 2KKHA 5A8KA 4KO0B 3OL8A 3MHYA 2X1FA 3MMCB 4C8NA 2YX1A 2HHTA 2GFFA 5ETOA 4WYWA 4QOTA 3MZIA 2WVCA 1E6VA 1YJNS 2L48A 4A4JA 1T05B 3DU5A 2ZC4A 5ETNA 2DGSA 3BKTA 2IJNA 3CCRS 2RF2B 4KBIA 4C8LA 1NEEA 1U0SA 1U45A 4AYBD 4JI8J 4QQBA 3MM7B 1M5SA 4PWWA 4OYWA 5KFOA 2OO4A 3A8KA 3ITHA 3O2IA 5DZ7A 4EO8A 2VFTA 4ZVHA 4PWUA 1OYEA 3G4SS 5E3AA 1RQ0A 4NLDA 4P74A 1RHRB 5L1IA 2F9DA 5CYQB 3DDIA 4F2SA 4LF7F 1OY8A 2J7KA 1YSJA 3OLBA 4QWAA 5IT9Y 1CPZA 3ZZRA 4PG4A 4X66J 2AKWB 1GH8A 4X4VA 3EPGA 3D68A 1M5KC 3DLKA 3DLBA 4JUZA 1N52B 3AXMA 2NQPA 2CZ9A 5DQGA 1LWFA 5D78A 3HHNB 4CYUA 2ADBA 4URSA 4HI1A 2EK1A 1WEXA 3BO4A 5HMWA 4H4OB 3D1QA 3I6PA 3DXBA 1JXEA 2KJVA 4USIA 5D3GA 2BEFA 2DBBA 2QO3A 2B4PA 1U2FA 2BACA 2J9DA 2ZFHA 5ETSA 3C16B 5FDLB 4NCGB 1OYDA 2GQ2A 1UVJA 4OL8A 2HIQA 5E33A 2M8HA 2KN4A 1SJ4P 3PFOA 5CZVA 1GMWA 3W63A 2YQ1A 3RG6A 4RBVA 5DDPC 5KT6A 2OMOA 3WQPA 1NNDA 3ZZ0A 3H42A 3ZNJ1 1FKOA 4WKRA 2AW0A 1A0OB 3HHLD 2XO7A 1S10A 3IGVA 4MK7A 1JLGB 1RHJB 1J5OA 2DR7A 2OKQA 4J5OA 4PG5A 4J7CA 4CLWA 4LUBA 2OP5A 4IR9A 3MPDA 3QZ8A 4PZVA 1H2TZ 1B70B 2BM0A 1VOMA 4M5DA 3CIZA 3DOLA 2BE9B 1C0TA 3GONA 2I5JA 4ECRA 1XR5A 2JFDA 2XGQA 4WJBA 2IY5B 1QAXA 1N54B 5BJRA 4YEAA 1OQ3A 3BSCA 3G8SA 4EO6A 5HMYA 4B9VA 2LDIA 4NCBA 5M2PA 3UWTA 3H2LA 5C5JA 2CQPA 2LQJA 3E51A 2RQCA 4MKBA 1K44A 1S1TB 2IYGA 3VAKA 4ZVQB 2WSEC 4IG0A 1HIYA 4LF9J 1EETA 2A6OA 4X66F 2D69A 3R5AA 1Q8KA 4O3OA 2NXJA 4DR5F 3IWXA 1UTAA 1R0CB 1WTBA 2HMIA 1NM2A 2VH7A 1UKUA 2ZWPA 4P2XA 5CQGA 5KG1A 2ZH5A 2UZAA 3R5GA 1YHQS 4V19J 1RAAB 4NLSA 1HKAA 4L3KA 2LKZA 4DU8A 3A8JA 4ZKAA 2Y1JA 2MZRA 1RTJB 4KGVB 4HDGA 3OL9A 2VG6B 1HI1A 1RXOB 2DGWA 3PXGa 3MR3A 3LGNA 1CBKA 1RAEB 2PT0A 3C6UB 3H5SA 1RAGB 4LBPA 2H48B 5A2QU 1NCLA 2VQEJ 3AD7C 2AZ3A 2NREA 1CEZA 3GV8B 1T03A 1YG0A 2ZM6F 5EGYA 4DSKA 4PCQA 4LVNP 1OMSA 4DBQA 2Q6CA 3RU0A 2HYIB 5LXRA 3KLEB 1N48A 1YTYA 4O3QA 2LVWA 3AOCA 5KFSA 4LSNA 3TAQA 1FKAF 5IOLA 4F4ZA 4F50A 2M8DB 2BX6A 1SH0A 2R8IA 4DCPB 1H7XA 1HPZB 2J0SD 3W5ZA 2LCWA 3OXLA 1X7VA 2ZH8A 2DEIA 2VFUA 3TEHB 9ATCB 2CPDA 5K8OA 3HVWA 2RS2A 4FYYB 2XGPA 1F5CA 2PN6A 5KFAA 3C3LA 1Q78A 1GQEA 3KLIB 4A8FA 3UD3P 4KH0B 4NLPA 4IFYA 4CO2A 4OZ2A 3AFGA 2R8HA 4Y34A 2ZZMA 4QJVA 2HBZB 3I9V9 4YB6A 2ZJRQ 3T1YJ 4B9SA 1RABB 2B9EA 2XMJA 5LM7E 4DF8A 3CDAA 1RACB 4CT8A 1VRTB 2MJUA 2B6AA 3HF5A 2BOPA 3MTKA 4JI5J 1Q79A 4RW7A 2Y1RI 2WSFC 5L1LA 4RNMA 1S9FA 1PGZA 3RRHA 2MSTA 4C0OC 3U1LA 3MCNA 3QATA 3F0NA 2PMZD 3NOGA 4DS4A 2L08A 2UXBF 2DXDA 3UCGA 5J2PB 3R6GB 2HVZA 4USJC 1KVIA 2CADA 3NXZA 2QFJA 4PABA 5A8RA 5ETPA 3ZZTA 1UWBA 2KT2A 3G8TA 2V50A 4JI0F 3I55S 3T5HA 2AJQA 4WKYA 2E7WA 3OUYB 4ZCMA 4IFVA 1BC6A 5ITHA 2F3JA 1FRKA 1T9TA 2YWWA 2NXUA 2KI2A 3UVJA 2ILZA 3GJRB 2EBGA 3NAHA 2E44A 4K50A 2LFVA 2IRUA 2VQEF 4F3OA 3JYTA 3R7BB 1S1WB 3R5DA 3SQGB 4IDKA 4CCHA 1WORA 2ZE2B 2LXIA 1HBNA 3MM6B 3V81B 2OI2A 2CJXB 2RAQA 4UQTA 3PO4A 4J9LA 5IWAF 1HWUA 5CCMA 2ZBRA 2OTJS 4L6V3 3PX0A 3Q23A 2A1BA 3Q89A 1UA0A 2DT9A 3NGSA 1WWHA 1MW7A 2FIUA 1S0MA 1RAHB 5L8RC 2D7SA 4ZN3A 3BM7A 3KJFB 4PYDA 2CJ9A 1VC6A 1T9YA 1U47A 3TYTA 3M6UA 3FMWA 3HFZB 3IG1A 2FJWA 4RBUA 1Z4UA 3TAMB 3M8PA 4ENOA 2W2OP 2HNZA 4ZVPB 4DUZF 3FDSA 3QPIA 2ADCA 3H59A 2LEBA 3ILIA 2EVZA 4PR6A 1KOHA 4C0BA 2N4CA 2DNPA 1SH2A 3CUNA 1Y10A 4BC9A 1IBLJ 4CO1A 4F4XA 4RKUC 2W01A 4LIRA 4ZVTB 1YK9A 5C25B 3H20A 2MZTA 3EJMA 5HMZA 2VBYA 1UP1A 3FKBA 3J7A1 1FO1A 3P49B 1AFJA 3DLLQ 5EN1A 4JI5F 1H72C 3T19A 2CQHA 2FHJD 1NBEB 2MQ8A 2Z4PA 5DETA 3DRRB 5AJ3J 1U2CA 4UTGA 1CJUB 4OJHA 3DLGB 2CXEA 1TVRB 4DFKA 2BXJA 4N8OA 2YWKA 3DI6B 2B9YA 4AQYF 1AA1B 5KFJA 1JNZB 4ECQA 1R8HA 5F0UA 4Q5VA 1IKYB 1S9GB 3CJ5A 5F8IA 2V8HA 3TI0A 2KYXA 2WCXA 3M2UA 1YGYA 2G1HA 3Q8UA 3FSIA 3HJFA 3FRZA 4LF8J 3U27A 1SVDA 2W9CA 3BBCA 3W65A 3GFHA 1NUEA 3PCOB 3MUMP 2X3DA 3B4DA 2J8SA 3ELHA 3M6WA 4KTQA 3OR2B 2QLXA 3KLHA 2UUWA 5C42A 2RU9A 4HI2A 2DGQA 4FXWA 2BOAA 2AJ2A 1GX6A 4NXMF 3BGFA 4X84A 1SIZA 3ZZOA 1RT3B 2V8VA 2VQFF 2Y0SD 2X1GA 4USMA 2W4CA 2APOA 1KTVA 4CTAA 2VPWB 4Z37A 4ES3A 1S12A 4YN3B 4WK1A 5JXSA 2CA9A 5KFPA 3OTDA 3LALA 3EVMA 3RR8A 3TEGA 4I69A 1S77D 1C1CA 3I5CA 1M1HA 2UV8A 2BQUA 1LW0B 5DS7A 4U95A 5DLGA 4QR0A 1Z1ZA 4NRUA 1U1NA 1AZSA 4AUKA 4FNIA 3ONQA 5DQHA 2RRAA 2PMWA 3LO3A 2WHOA 2HFOA 3K5OA 2DGUA 3CCMS 5FLXU 1RT6B 3IRXA 4DL6A 4Z7CA 1U1QA 1R0AA 2BANB 4A48A 4LSZB 2B7CB 2ZBPA 3BYRA 4B3TF 3FK4A 2YWFA 2MGZA 1P9QC 2HHXA 1S1UB 1TZ0A 1C0UB 4ZPTR 3ILLA 4J37A 3W2WA 4JV5J 1S1XB 1QUVA 4UF4A 2HQ3A 1F5BA 1QSYA 1BD6A 2QZ8A 4DQSA 2EI5A 2FJBB 2EC0A 1B64A 2OELA 3VAJA 4IOCQ 4DN9A 4WTYA 3OXGA 3HSDA 1ZAVA 2GVDB 3C14A 2IBOA 4L72B 1BQXA 2QL9B 1WJ9A 3OQ2A 2XM3A 2VPZB 2QYGA 4OHXA 1F3VA 4C8KA 4FKXA 2DPJA 1I1GA 5C7PA 1VDHA 3PDNA 1WUUA 2EBEA 1V3ZA 2HBRB 2KHCA 4QU6A 4ZHRA 4ZK7M 3K2YA 2CPZA 2N7YA 4KGKA 4CDIA 3NNCA 4XDCA 1GT8A 1UCNA 3KJVB 2EK6A 3MWBA 2GMJA 2GQCA 3BGUA 4MFBB 2HWTA 2Q3PA 3W5YA 4DQIA 2AP6A 3DOKB 2DVIA 2E5HA 1B99A 4NLTA 4K2JA 2ZH1A 1FHTA 1NK9A 1SKSA 2P6SA 3LAKA 2JNJA 5I3UB 2D3UA 4ZLPA 5IM0A 5C24A 4DUYJ 2K8GA 3IO1A 1FX2A 2D74B 2KXNB 4K4XA 4O4GA 4IO9Q 2I9SA 2NSCA 3OTCA 1OY9A 1RWOB 1M90T 2QL7B 1HNXF 2BQRA 3TZZA 2JVRA 1DZ5A 4ICLB 4XPCA 3A3OB 3PRVA 2ASYA 4B9MA 1S6PA 4GO7X 1EHWA 1JLBA 4QWCA 3BSNA 4EFAC 2J7WA 4TY8A 2GVZB 1UVIA 2C1EB 1X0PA 5ADZA 3W1YC 3D28A 5J1NA 3CJ4A 3DM2B 4USVA 1VISA 4DPOA 1H6KX 2QLJB 1P27B 3CF5Q 2PGCA 2KG1A 4RW6B 2DK2A 5GAHU 3SYZA 4OX6A 2XULA 4UZBA 3HHLA 1N6QA 4JYAJ 3PEJA 2AMCB 4IR1A 3CJ3A 2E7XA 3CWJA 1I94J 4DX7A 1UEVA 1RHQB 1JJ2R 1F9HA 3GFYA 1PYTA 3TNVA 3HM9A 3C6TB 1C4CA 1PC4A 1SCJB 2FLPA 3CJKB 2BKPA 4RU2A 2QTWA 3TANA 1TL3B 5B0CA 2HEKA 3D5MA 1QTMA 3S8SA 3VCDA 1ZA2B 4DQPA 3GCXP 4KFBA 3QLHA 2P6TA 3W2VB 2OFGX 2KM8C 2FGCA 1R8AA 3WIUA 3DXSX 3O6QA 3SMZA 2ZBIA 5KFMA 1RI7A 3Q22A 4WZMA 1GXUA 2C3MA 2UUAF 2ZD1A 4LT6A 4Q43A 1A9NB 3OR1B 1LFPA 2OEJA 2MZ1A 3PW0A 2WBRA 2Y8YA 2GHVC 1HQUA 2OLWA 2JC0A 2E29A 1UZHA 1FDNA 3LP1A 3WHIA 2XZWA 2AIRB 2W9BA 3NG8A 4WIQA 1XBWA 2R9LA 4EYIB 2KO1A 4TXSA 1VQ4S 1RE1B 1FXDA 1PAUB 2Q79A 4UUWA 1VQ9S 3K59A 3UNGC 1YRXA 1RWUA 4O3SA 1VBYA 3OVBA 2NPFA 5M2RA 1JLQB 4Q45A 3QWUA 4GMKA 3D4JA 1QE1A 1RBOB 5F9NA 3H2UB 1MU2A 2GIRA 3KNAA 4CH0S 4OX8A 4MK8A 4UY8T 3KHHA 1DAXA 2IJFA 4ZLNA 2NCKL 5HN0A 4FYWB 1SPBP 1XMQF 4OV6A 3Q2TC 4USWA 3OW2R 2HHWA 2RT3A 1R31A 1UA1A 3D0IE 2Q66A 4HL9A 1GMUA 3K8VA 2H1YA 4HTIA 2WONB 2OFHX 3SSQA 1E6YB 4DV5F 1RWWB 5KTQA 4UQGA 4KC5A 1D9FA 1MN9A 3RAMA 3TZWA 4RW4A 2AV5A 3IS9A 4I64A 3BZQA 4KYZA 1CJKB 4J9OA 4MKAA 1RT1B 4DPTA 4YS2A 3DRYA 3G2XA 2YTCA 2V8PA 1ZS6A 4R25A 2Q43A 3W61A 2HVHA 3GQCA 2N3LA 3MM8B 2RU3A 3HSGA 1SI9A 4KRWA 2G2OA 1SB6A 3QGHA 1PCAA 4V1Ak 2C2OB 2IVMA 1RT7A 5KT2A 1WOSA 2F8MA 2GIFA 2DNOA 2AHOB 2HHQA 3U02A 2KYZA 2YQ0A 3Q0AA 3SBMA 3J7Z5 2AU0A 2KHDA 2XLIA 4IO1A 1DLOB 2GJ2A 2V68A 3JXOA 3HHLC 4DQRA 1LWXA 2AYBA 4DL7A 1U0HB 3FQLA 3HI9A 3CD7A 4G1PA 3CDWA 5HQLA 2HVEA 1O5JA 2V9WA 2KRBA 3HJVA 5DLFA 3PW5A 1UEUA 3O8WA 4JOUA 3V4IA 1FX4A 5CYMB 1Q8LA 3C2PA 2YKAA 2CQIA 4C8ZA 4ECTA 1YJTA 3HVTB 2FLLA 3UDCA 1T02A 2PA3A 5L1JA 3PO5A 8ATCB 1RT2B 1L3VA 2YNHA 4C98A 4MIWA 1VK8A 4ANDA 1WKLA 1HBUB 1P8GA 1BE4A 2RQKA 2A10A 4Q0BA 2IBKA 4QPXA 2YPYA 3UCUP 3NGUA 2CZVC 5JUMA 5D8HB 2B4VA 2GHWA 2YWEA 3D2WA 3TO8A 2HGLA 4W92B 5F8GA 1D1UA 3R5BA 1RTIA 3M30A 3OFEA 2OIHA 3O3LA 3TW0A 3PYEA 3TUJC 4BLGA 4J91A 3K8WA 3LPEA 2N3OA 1LOUA 2IDLA 3DYAA 1SQFA 3POTA 2HQGA 4RUCA 1OIAA 3N28A 3E01A 3PR4A 2V0NA 2MQQA 2MQMA 1VBKA 3FSYA 3DNCA 2EEYA 1WOPA 2IDEA 3T6JA 1FK9B 4EMDA 1OY6A 4IOBA 3VVUA 3QO9B 4OX9F 2IM2A 3MMAB 1GK8A 2OPPA 1U1KA 4WU2A 2SXLA 3R7SB 2QA2A 2JEFA 3MMCA 4ZCIA 3AD9C 1FNXH 1R8BA 4NCAA 2RUGA 2XBPA 5A8WA 3W8PA 1TV6B 4C97A 4DS5A 1NKBA 3KK2A 2ZUAA 4PUOA 3QJLA 2MJNA 2DO0A 3HCXA 3CMAS 2YVSA 1URNA 3VGVA 2P8IA 4OMFG 5KFRA 2R2RA 4ELVA 1NH7A 2NZ4A 5IQQA 3Q86A 1G7CB 3RBEA 4ANEA 4DFPA 4DV1J 2MMYA 5L9NA 4DR6J 3KWMA 3S1TA 1YRUA 4N8NA 2QMUB 1D0EA 3AODA 1L3UA 2C3YA 2BKNA 1VR6A 4FXDA 5KFXA 1UJ4A 4EZ9A 2VDHA 4MIAA 2DHGA 4TU7A 2AJ1A 3BS9A 2DXFA 3FBCA 4ECYA 4W98A 3ENWA 2FHJA 2XO6A 3MEGB 4B3SJ 5HSPA 4F25A 4DV4F 2K3IA 1O0PA 4ED5A 4O44B 2VV5A 4R5PB 1NB2A 5B0BA 2YKNA 4J90A 2PSZA 1LWCB 1N56A 4WZQA 3J81j 1HNVA 2GAGC 5CXTA 2NS1B 4LQ3A 3LUYA 4ZLLA 2PFDA 2J76E 3Q2SC 3KUEA 3PJXA 1IR0A 4O4RA 3NKYA 3GIIA 4TQSA 1KWMA 5T7LA 1NLKL 1UFKA 2JFKA 3RRGA 3RBDA 2HNYB 5I42B 2B4UA 1FEHA 2BKOA 1KBRA 4I6YA 4DSEA 2KRRA 3PM9A 4U8VA 1DTQB 1PYSB 3J7YU 2DITA 5LXYA 3MPUB 3KK3A 4EZ6A 4ID5B 1H3DA 4P72A 3RBZA 1YRTA 1ZM9A 3NS7B 1VC5A 1X5TA 3ILOA 5KFNA 2NR0A 4X4TA 2E1CA 4MJKA 1HL6A 3SDEA 5DM6Q 1RT4B 1WG5A 3UN2A 2OPSB 1IWAA 3CMES 1R7IA 3CVKA 1YBTA 5RUBA 4P52A 4XDDA 2VL1A 4CI0B 1MMDA 2G2YA 2VONA 4DV6J 3TWZA 1FT8A 1SBRA 2QEXS 2O1PA 2MTLA 3US5A 3TUPA 4PQUB 2CYYA 3VAGA 3MEEB 1JLFB 4C8MA 1KEKA 4Q2MA 3IGNA 3I0SB 3EGVA 4LFBJ 1TKXA 3DN9A 4USKA 4G6VB 1UAWA 4QR1A 5HP1B 1HA1A 3D6HB 1S9EB 3BEGB 3GJQB 4KHPF 2B5JB 1YBUA 2OSQA 3KK1B 4TY9A 2PO4A 3ETMA 2R7XA 1YBAA 1FVQA 4RPFA 4V19X 2HGMA 2C2KB 1SIWB 3CJTA 3EWGA 3ZC4A 3UR0A 2OPQB 3MECB 2AEMA 4FPRA 4CNYA 5IZHA 2LQBA 1YWXA 3DLEB 2YQ3A 2HIYA 2E5JA 3MAHA 2E7VA 1UFLA 3M8QB 1GXTA 2FGOA 4QIEA 1WC4A 1SUQB 3GSDA 4E0DA 3R97A 4ZN1A 1P9YA 3PKMA 3BGRB 3PIPQ 5CH7B 1RTJA 5BR8F 3JSYA 2RH3A 5KG6A 4LR9A 4OYIA 5J2NB 1D9AA 4RZRA 3RR7A 2MKSA 4C3KA 3JQJA 2V8GA 5KFWA 2V4RA 4FVCA 1CJVA 2VKZG 1NJWA 1R89A 1ZTWA 3FBBA 2AX1A 3HX9A 5GADU 1TK5A 1XQIA 4ZJLA 4DCOB 4OYPA 1IBMJ 4DWIA 4OX7A 1U6BA 2VG7A 4EU0A 2RS8A 1Y3KA 2AYGA 4R0EA 1NJZA 2AX0A 2ZOMA 3DU6A 4OJGA 2WVBA 3TX0A 1HD0A 2HAFA 2G0CA 1NPPA 4YHHF 3VVTA 3BPDA 4KB7A 5GMKa 1I51B 2M0GB 3TZYA 4OI3A 1LXNA 3S01A 4LIWA 2IFXA 3W9IA 3FBFA 5D4NA 4B08A 4LRDA 3I5BA 2C28A 3H98A 3QWPA 4RW8B 4OYOA 1KVJA 5MAOA 3J81Y 1Q1KA 2IRXA 1HWJA 2ZDPA 1LEOA 3KLIA 4B9TA 1IXKA 1Y3JA 2X1BA 2GJIA 5DDRC 4X2BA 1RLCL 5GAEI 4B02A 1QVGR 3W64A 2R3VA 2H5IB 4LFBF 1FWKA 3K89A 3TQ1A 4WFZA 1CULB 1SJ1A 4A8SA 1HMVB 3ZTOA 1NMEB 3Q83A 1KHWA 2NUHA 1HYSB 2CQ2A 1N36J 2YNIB 4MYUA 3M8SA 2Y0BB 4DG1B 1VRTA 4Q8EA 3C66A 4RJVA 2G0IA 4FYDA 1JLCB 4NMLA 3BJYA 5T14A 1S4EA 1NJIT 4DV0F 3CULA 1L3SA 5HI7A 2FPHX 4F4WA 1B3TA 4PXEA 2CQDA 3NGDA 3M32A 1PSDA 3QAEA 1WACA 3HHEA 5D6GA 2NUUG 4IKAA 4KPYA 3CXCR 1VQSA 2OAUA 4OI4A 2DO4A 2RQMA 2AZ1A 3ET6B 1IKWB 1NO8A 2NYIA 3OUYA 2Y8WA 4LF6J 1N4LA 1EIYB 4MT1A 2NXEA 4CO4A 2ZEJA 1RISA 3ZO7A 1UEKA 4MAKA 1WC6A 3TJ9A 5K8PA 3P45B 4HACB 1S79A 4WXWA 1DBDA 2DR8A 3PX6A 1MWYA 1RTDA 3MOJB 4X62J 3T1HJ 3FRYA 5H9EJ 2V67A 4JB8B 4LBIA 3V81A 3RAXA 1B7YB 5H1SV 3FCWA 4YP3A 3IBFB 2PD1A 5HROA 2EG1A 2D3O1 4DU7A 3M6XA 1R3NA 4YB1P 1FTCA 1CSJA 1K0TA 2ASLA 4MYTA 3H5XA 4OYZA 4ZPWR 2FTRA 4OI0A 1HR0F 3HULA 2ZKTA 2BJEA 1WHYA 1AFIA 2GO8A 2VUGA 1FDBA 3TRGA 3HK2A 4Y65A 1IKVB 1LWEB 4I2QA 1V9OA 1FNOA 3V6HA 2V69A 2QMWA 1VMBA 3M2VB 4GVLA 1XNQJ 3PY8A 2IHR1 3EPIA 1YQHA 4B3OB 4C4WA 4X65F 1S1VB 4PG6A 1Q7YT 4NLVA 1RDRA 1G4CA 4H4KA 4Y2AA 3WC0A 1KQGB 3MUTP 3AY0A 5HK4A 1FJ7A 3AHPA 5A8KB 4TQRA 2LQ9A 1P1TA 5DG9A 4JI4F 4B9LA 1GXLA 1IVZA 3ETOA 3GYNA 1E6VB 1Q8IA 2F40A 4L74A 4R8UB 4Y2MA 2P2CB 4WE1B 3CDEA 3SIPB 3OVAA 5B08A 1SJRA 2R7RA 4HHHA 3ZFVA 2ZZTA 1URRA 5KG0A 2DEJA 3DI6A 3ITHB 2DCUB 2FY1A 4G1QA 1RT5B 3N79A 2VJUA 1UVLA 3QIPB 3GJSB 3JS9A 1IWGA 1IKYA 2B7BB 4O0NA 1BQMB 3E8OA 3M9MB 3QAUA 3VGTA 1SQEA 2AJ4A 1NKEA 2CVEA 3MD3A 2VHGA 1FNMA 1Q86T 3RW7A 3NMRA 4M5LA 4EBDA 1PG5B 5KT3A 4NRTA 4HTJA 4B3RJ 4X62F 2XC9A 3DLKB 4LFCJ 1N34J 3VAMA 1RJJA 1FRIA 3MM5A 1LWFB 1L3TA 4CO0A 2H5EA 4O0IA 4C3MA 2HFUA 1G2EA 1VQMS 1VLYA 2V2QA 2XI2A 3PHTA 5DJBA 4OLOA 1KD1T 2V63A 2OJ3A 3OFGA 3L3CA 3HSJA 5EHHA 5D3GB 1TKZB 2C2ZB 1K1SA 4A47A 1WDDA 4IRCA 1NK7A 5EX0A 5D15A 1BLUA 3NCPA 1F2HA 3P6YC 2CUYA 4QYZJ 4M8LA 1N8RT 1T11A 5IT0A 4EEYA 1VYAA 1M1KT 3EXCX 1MROA 2ZHAA 3UFCX 1AW0A 4MMOA 4ZIWA 4CZCA 3OTBA 3NL0A 2W8KA 1V5VA 4ZCKA 1VIOA 1TL4A 3B8HA 3SV3A 3SV4A 3THPA 2CNNB 3BPSP 4S0MA 2LQ8A 1C0UA 1KLMB 1T7PA 2LQ5A 3QFHA 1J5OB 2ZITA 4WIIA 1ELOA 5F8NA 2V4JA 2CG8A 2FC9A 4LF1A 2V8DA 4C11B 2Z2YB 4X4PA 1RLDA 2QSFA 1V6HA 2E1RA 2VIHA 3CE8A 2YKQA 4M5DB 3PX4A 2I1RA 3QSIA 2M3DA 2CZ4A 1RKIA 1C0TB 2I5JB 2ZHOA 4NL5A 1F3FA 3FVYA 2XB2D 4ILRA 1X4BA 4H4KC 1OJ4A 1WEZA 1W25A 2ZZNA 5K20B 3CCSS 2JDJA 4Q2LA 1QVFR 1H73A 4FYVB 1VBXA 4CLLA 2VODA 5D0RA 2HQFA 3VV2B 4RUAA 3KJVA 1RHUB 2R8JA 5HBMA 2CQGA 1RBLA 3G8QA 4IG0B 3W5XA 4MFBA 1EETB 2X3GA 5HQMA 3HD1A 3DOKA 4GRSA 3ZTPA 4DL5A 3JQMA 1YITS 3FFIA 1JX4A 1TL5A 1X0FA 1PJ5A 1AT1B 2HMIB 1T3OA 1ZPVA 2EC2A 1XERA 2MLXA 3KDNA 3RZAA 3HSZA 1FJEB 4ZJQA 1X9SA 1W7WA 1H38A 4M63A 1FJCA 4QYZK 4LF7J 3NCRA 2HRYA 3L7UA 4U96A 4L76A 4I68A 4NYZA 5KT5A 4RNNA 4NLOA 2LEPA 3D1OA 2C2DA 2GA7A 2CNOB 3BO2A 4HDHA 3B54A 2M4MA 1VQ5S 2X7IA 2XS2A 5ETVA 2IC3A 2BE7D 1LXJA 2VOPA 1T03B 4WFXA 1YI2S 3I5AA 2A6MA 3BV8A 1F9FA 2HQCA 4KKOB 2XMUA 1FFWB 2GVZA 4KV8A 1Q81T 4LMZA 3KJNB 4LSNB 2L9DA 1DTTA 1FRXA 1NHKL 4URQU 1X9MA 4M5MA 3AQPA 3MMBB 3X3UA 3CCZA 2Y3YA 4ZP6A 3L95X 3VZIA 1F6TA 2BW7A 2AGQA 2F1FA 2QA1A 4DV7F 5EX3A 2HNDB 3QRPA 3M8RA 1TUWA 4GKKF 1UPMB 1IM6A 3EVWA 4ZMMA 3C6TA 3M4XA 3K0JA 3CJKA 4IUFA 4PXCA 5A0YB 4WK3A 3DRPA 2J0QD 4AXJA 4QZVB 4ZPDA 4A8MP 4KGMA 2W7AA 5IFMA 1FWPA 4NLRA 4QWDA 3ENAA 2VU5A 1ZH5A 4AT1B 1HBOB 1VQKS 2F7VA 4F4AA 4DV2J 2C22A 5K5MA 5D4PA 4A46A 3VTIA 2W9AA 5HVHA 5H9FJ 2NXCA 5CAAA 3JQKA 2B6AB 3OR1A 1FRLA 2M70A 1G1XA 1Y0HA 3N5BA 4RW7B 1ZAXA 1M5VC 3LGMA 3WC2A 2H9ZA 4M94A 4DR3F 3CPWR 3UN3A 3CCWA 2BBEA 1QM9A 3J80U 2IA0A 4M5GA 2BABA 2HFVA 1UWBB 1FERA 3X1LB 2J9CA 2BVZA 5KFEA 1L3KA 5AXKA 3T6BA 4IFVB 4HH1A 3ENQA 4C2MA 4DR5J 1WEYA 4CWBA 3NWRA 4LR8A 3B82A 2EFOA 2VICA 2FB0A 7AT1B 3HDSA 5F8MA 3JAMU 3MCSA 4IDKB 2FUG9 1RU1A 5FJ4A 2A2CA 4DV3F 2ALYB 3VR1A 1HBNB 1B0VA 3MCMA 2FQQB 4ELUA 2XWXA 4WP3A 3UDEA 1WKJA 2HVDA 3P5TL 1YJ9S 5F8JA 4LF4J 2WONA 4AD6A 2CPEA 5A6PA 1TL1A 4OYAA 1N33F 2RRNA 1DURA 1CQNA 4B9NA 5KG3A 2YPZA 3P4UB 1RSCA 3OFFA 3M1VA 3T9ZA 3TZXA 3DRSB 3W3SA 1JLAA 3QYYA 5DZ6A 2ZM6J 4HH0A 1NSQA 2ZH9A 2V94A 2QLFB 5KG7A 3C15B 1CJKA 4ZVFA 2RVJA 4ZVSB 1U2RA 3M8PB 3RGIA 2R2TA 2KJWA 2QC3A 2OEKA 3MM8A 2J5AA 1WG4A 2K1RA 2BJ3A 2DRAA 5H9FK 2R7OA 1X4HA 2D3OR 4YMEA 4AL7A 9RUBA 2IIHA 4ZLJA 2BJ8A 4DFJA 4DV2F 1XN9A 4B9UA 4JV0A 1DLOA 2DHAA 2D9OA 4ER8A 2XYHB 1U0HA 4B3MF 5HO4A 2DJWA 1XTZA 1H74A 1NDCA 4DEZA 4ED4A 3Q8YA 4JBCA 1IKXA 1Y9OA 1UW4A 1RBAA 3EZOA 3H0PA 5KFYA 2BZ2A 2OUGA 1FJGF 2CQ3A 2A18A 3HVTA 5KT4A 1CVJA 2MZSA 3PRBA 3Q24A 3GG1A 4NLYA 4X4NA 4OZ5A 2KXHA 3LPYA 2Z57B 4CRJA 1RWPB 4WTOB 2AD9A 1IJFB 3LTOA 1HBUA 2G0JA 2HHHF 3LP0A 4F3QA 2I8EA 2XMTA 2W7PA 2XWYA 2HWHA 5F8HA 3VF0B 4GVBB 1TFWA 2VFSA 4ECZA 1LV5A 1NU4A 4F0HA 2W9CB 2R7TA 3HFVA 2YNFB 2RRBA 2ZNZA 4P2MA 2WOMB 2JEJA 2UXBJ 4DPXA 2DGOA 4Y6IA 1UJ6A 5KG5A 3DMJB 3KLHB 2WAQD 2F8EX 2MQLA 4JI0J 4DX5A 2JH3A 2JRSA 1S6QA 1VRUA 4LF4F 4CTAB 1VJQA 2ZDOA 1D3WA 4OHWA 4Q44A 4QPTA 1FK9A 2CWXA 2P5VA 2R2SA 3BSAA 5BYQA 4M5JA 3OSPA 1TP7A 4M5HA 1SL2A 2G1DA 1T94A 2ROGA 3D54A 1KR4A 2KFZA 3CD5A 3B6BA 1O6XA 3NCQA 5IT9U 3BSOA 5M2UA 1AZSB 1TV6A 2EFGA 4C3LA 2VC1A 4OZNA 3CCES 1KTQA 1NK4A 5IWAJ 5HQ8A 4O3RA 1RYRA 2KT3A 1NK8A 5DGBA 4A8QA 2DR9A 3I4PA 1Y5IB 2XSJA 1PKUA 2IMOA 4ZPAA 2PI4A 3IRXB 4NYPA 3IM9A 5KFZA 2WB4A 2R8KA 2WVEA 2J6UA 2FZCB 3LH2S 4DX8H 4U7UK 3W2WB 4C6AA 2XY5A 3D6MB 3IFEA 3V5RA 3MAQA 5E3CA 4TKTA 2GGPA 2IM3A 4DUZJ 4FF3A 4F4KA 2FD2A 3JSMB 4OHZA 3QGIA 5KT7A 4DR4F 4ECWA 5B0FA 3RUBL 1ZETA 4DL4A 3MEGA 4PKDB 3LP2A 3PVXA 1NPKA 2EFQA 5EWEA 4I6WA 1DHMA 3MR2A 4DR2F 2FVCA 2KT5A 2PEBA 3EUNA 3WIVA 4ZA1A 2VPYB 3QT7A 2E9RX 2BDPA 5F9LA 3MTJA 3GFZA 3BGOP 5L9XA 3FZBA 2LU2A 1TUGB 2BYCA 1U8SA 4BC7A 2DB1A 4Z2XA 4P73A 3K17A 5BYSA 2FVQA 1XMBA 2VB6A 2L41A 1EQMA 2ZH4A 1QJHA 3DGVA 4X4OA 2Y1LB 2FJEB 1KDNA 4ED2A 4OZ3A 4GC7A 2IM1A 4F36A 3K7RA 4OI1A 4AQYJ 1WD6A 1DTQA 4F3MA 2YKMA 2Z30B 3TUZC 3CO0P 4ID5A 1AUSL 2VF3A 2XHCA 2WRMA 3IA0A 1MG7A 4ZJOA 5KFIA 4EWTA 4ZVUB 3Q8PB 1LW2A 2YBVA 1KQKA 5IM0B 2AGPA 1NK0A 1HNZF 5C24B 2XMMA 4X4QA 3BQ2A 4O4GB 2C2EA 1C1BB 1ULRA 1LKZA 2HFZA 1BWEA 1QAIA 1EAYC 3HFKA 1RAJA 4QIFA 1KKHA 2BM1A 3N6NA 3KLGB 3PW7A 3T5KA 4NXMJ 2YNGB 1D8YA 4YY3F 1RAFB 1RTHA 5ETLA 4CM0A 3J7AN 4Q8FA 2VQFJ 1Q8BA 1S6PB 2HRUA 3PG9A 4K5SA 3JB9k 3G6XA 1JLBB 3A13A 4F04B 3ZXWA 4PQUA 3T1AA 1D9DA 1PBAA 5DM7Q 3K5LA 2W8LA 2DNQA 1FF2A 1U6FA 5FIIA 2B8PA 1EJ7L 2RKIA 4LF5F 3UDVA 2WSCC 1REVA 2AJFE 1U49A 1WF2A 4I2PB 3AH6A 3D67A 3UNYA 1SQGA 4J9KA 4HVZA 2HGNA 1EZZB 2GS8A 1N32F 1U1OA 1VLOA 1N6QB 2AEFA 2KL8A 4LBHA 4CQ1A 3M9OB 4X64J 2DY9A 3PNIA 5DGAA 2Z2ZA 4NI2A 3EMTA 3CCLS 4TLQA 3FBEA 3GYGA 1T0TV 2PC6A 2UU9J 2ZOGA 3JTNA 4F2RA 4B3TJ 1SC3B 2FJVA 3LGHA 1REGX 1M5PC 4DLGA 4KFBB 3QGGA 4A8WA 3FZ2A 4DPYA 3RB4A 5CD4H 1Q7LB 3LANA 1YVFA 4EK2A 2M88A 1TL7A 2V5HG 1FCAA 4XK8C 4FBUA 1VK3A 4JI6F 2KVIA 4UOFA 1OO0B 4P7VA 2HKEA 3H4DA 4DUTA 4DSFA 3MGJA 3CCJS 5E5NA 2ZD1B 2ZHBA 2LP4A 5F3ZA 4UOCA 4URGA 2GMHA 3PACA 1NZAA 3I0RA 1N88A 1HQUB 3ICLA 2J0XA 2AT1B 5EWFA 1BMQB 2WVFA 4LF2A 3QMQA 3SEOA 1WC1A 3BDPA 5KFTA 2DIUA 3LP1B 2KDOA 2AF6A 5DG8A 1JJHA 2W9BB 2R2UA 2QFIA 3QJPA 1Q4RA 4F26A 5IC6B 4PPDA 4JI1J 2JX2A 1YLXA 2CPIA 2FVSA 4PRFA 2GJFA 1VHIA 3KLVA 3A1YG 1ITPA 4RNHA 2OPRB 1NSPA 4Q7AA 3QT8A 1N5YB 2XNQA 3GG0A 1QE1B 3KHLA 4EGLA 1MU2B 1OPZA 4RW8A 4DF4A 2QMXA 3N4WA 1SC6A 1K0VA 3CC2S 4J9VA 2ZVSA 3F73A 2Z56B 4C48A 1Y5LB 1CJTB 3GR1A 3Q8VA 2LECA 3RB6A 2YH1A 1NJYA 3TOQA 3OHBA 4BHQA 2B51A 4NASA 5JVGQ 3PYFA 1U1LA 1FKPA 5KOXA 2DIVA 2UUCF 4I0WA 2E5IA 2K7JA 3W9HA 4BDPA 1APSA 4NA1A 3MEKA 3PTWA 3NOCA 1HNXJ 2V2KA 3MEDB 1PC5A 1BWVA 4RLEA 1FDAA 3DOMA 4U8YA 4RW4B 2YNIA 4UY85 5ETTA 3TJ8A 2N4DA 4DG1A 4X64F 1VS3A 2A0FB 1TK0A 4LFAF 1JLCA 1CS4B 1W2IA 2HSEB 2KB2A 1PBUA 2XMAA 2MQOA 2WK4A 4CLPA 2UU9F 4FNHA 3BGLA 3CIMA 2PI5A 1Y7PA 4FKYA 2I6WA 1V3SA 3JSRA 3UO0A 2QE5A 1Q0NA 1U8WA 2MQNA 4ECXA 2GAHC 4ED6A 1RT7B 1HQ2A 2AYEA 1BQNB 3FEYB 1T9VA 1P1LA 4ZPCA 3ET6A 4J9PA 1M5HA 4RWXA 2CFXA 4OIXA 5D4OA 5IC4B 2CJYB 4Y2KA 2MKIA 1O8BA 3R1HA 1AUDA 2Z58B 2EFNA 3KXDA 2IRYA 3VHQA 4EBEA 4HACA 1GEHA 4ILLA 2HBQB 1F0XA 2VKRA 1R8CA 1PO6A 1WELA 4M5IA 2YKPA 4IG3B 2B8QA 2RQ4A 4H4MA 4ZVRB 3EDQB 1AXQA 3GLJA 4QW8A 3NS6A 3FEXB 2YNHB 4K0KF 1S7HA 2PDAA 1K1QA 2UUAJ 4Q0BB 4JI1F 4XO0A 2PFFB 2JLEA 3C19A 2NZCA 2ZJPQ 2M52A 1ZBTA 3SI8A 3R5JB 1BGXT 2JSXA 2CAJA 4K59A 3AXKA 1U1MA 5HJXA 1RTIB 3CJ2A 3M30B 5K8MA 1RWMB 4C8OA 4NYOA 2M5YA 5I4MA 2AEJA 3Q8QB 1IKVA 1LWEA 4NLGA 4J9RA 5G4DA 2XNRA 3DYAB 1HFEL 3HKZD 3OFHA 3POTB 1HI8A 3M8YA 4A8OA 3E01B 2J7UA 3CW2C 3UDLA 3G6YA 3PJ9A 1WI6A 4F8RA 3TA0A 2J6SA 1KVKA 2C3OA 4NA3A 2HZCA 2YXLA 1SL0A 1CC8A 2JLGA 5SZTA 2Q6BA 2OPPB 3CJQA 3NBPB 3O1LA 5K14B 1JLEB 3GIRA 4PG7A 4DL3A 2RDDA 3LWLA 5E7OB 1XMQJ 3M7VA 5I3QA 5HVFA 5GMDA 5A8WB 2B43A 4R8UA 2H3EB 1IBKF 4WE1A 3KK2B 4PUOB 4FF4A 1VIXA 5CD4A 1HWLA 2VASA 3BF4A 2BE2B 3CJSA 5DQIA 2N7CA 4DV5J 1W26A 4USHA 3CB4A 1O51A 2BRKA 2R7UA 1BY9A 1UVMA 3TX8A 1QD1A 2W2NP 1RT5A 3QIPA 1XMOF 4NZ7A 2YWGA 5KFCA 2UXCF 1RWXB 1X60A 3K58A 3SFGA 3NAIA 5A2QY 4F4YA 1BQMA 3QIDA 1HHTP 3IR6B 4KH1B 1XIQA 4RNFA 4Y2IA 2NXNA 3NY0A 3QSYB 3MCOA 3A4TA 1HI0P 4NXNF 4PYAA 2GX8A 3MUVP 2DH9A 5E3RA 2I38A 1TKTB 2H51B 2UUBF 3CJRA 3I82A 2GZOA 4LSLA 1FDDA 4QCLA 4KT0C 1KQSR 4CLSA 2UVRA 2ZBCA
chains in the Genus database with same CATH topology
1PILA 1JLQA 3OVAA 3UI3A 5B08A 1U47A 1J2VA 1SJRA 3M6UA 3TYTA 3FMWA 2R7RA 3ZFVA 3IG1A 2RB7A 2FJWA 2XLKA 4RBUA 1Z4UA 2YKNB 2F4VF 3TAMB 1URRA 3M8PA 4OZLA 1ZM4A 2HNZA 2HS3A 5GAHI 3SCLE 1RKJA 3I87A 5KG0A 3H8YA 4DUZF 3FDSA 3QPIA 4JV1A 3OTOF 1FD2A 2ADCA 3H59A 3DI6A 1HNVB 3ITHB 3JYTB 2DCUB 4ITSA 2LEBA 2FY1A 2L3MA 2EVZA 4G1QA 4ECSA 4PR6A 1RT5B 4PXBA 1KOHA 1JKHA 1TKZA 3N79A 4C0BA 2OMLA 2N4CA 3QIPB 1FA0A 1SH2A 2DNPA 4QIWD 4DMZA 3CUNA 2DNYA 3RB0A 4ZP7A 3IAM9 4BC9A 1GTEA 5AE3A 3ENVA 1IKYA 2B7BB 3RW6A 1CC7A 2HS0A 4CO1A 4OQJA 3V2UC 5G0RA 4F4XA 4RKUC 1KQFB 4HYKA 1BQMB 3E8OA 3EXYA 3QAUA 1RTHB 4LIRA 3M9MB 5T7LB 1SQEA 2AJ4A 1NKEA 3SCKE 2CVEA 3MD3A 2UUTA 3N0VA 5C25B 2C2RA 4RUHA 2ROPA 2FDNA 3HVAA 2EFVA 4QYRA 4DR7F 1ZM3A 3H20A 1K9MT 1FNMA 1Q86T 4ETXA 3RW7A 3UR3C 1Y5NB 3NMRA 4IRKA 1C2PA 1E6YA 4TLRA 4DR1F 4FBTA 4OLPA 3VAHA 5HLFB 2MZTA 1VQNS 4EBDA 2CJQA 5HMZA 2VBYA 1JMTA 5KT3A 1UP1A 3MMJA 4NRTA 3KK3B 4HTJA 3K57A 2PMHA 3J7A1 4I7FA 4XIUA 4X62F 2XC9A 1FO1A 1G3OA 1W2BR 2RKIB 3D0HE 3DLKB 3KHGA 3P49B 4DV1F 3BN4A 3PEHA 2XEXA 1CLFA 1AFJA 1Z2LA 2AGOA 3DLLQ 5EN1A 3VAMA 1REVB 1I6JA 4JI5F 4DR6F 3T19A 1RJJA 2CQHA 1FRIA 2FHJD 4QIVA 3CDBA 3MM5A 1LWFB 4HLBA 4CO0A 1X9WA 1L3TA 3J7ZT 2H5EA 4O0IA 2B0GA 2Z4PA 1FE4A 4C3MA 5DETA 3Q8SB 3DRRB 2POKA 1G2EA 1P6TA 4OJHA 3SDEB 3DLGB 2ABYA 1DQ9A 1VQMS 1RT1A 3IG1B 4ED1A 1TVRB 1VLYA 2M2BA 4DFKA 2XI2A 1KLMA 2BXJA 3MR5A 5DJBA 2HNZB 4N8OA 4OLOA 3TP2A 2YWKA 1KD1T 4TU9A 2OJ3A 1SL1A 3BQ0A 3PKYA 4KHRA 3DI6B 4YUDA 1KFDA 3OFGA 3L3CA 2B9YA 4AQYF 1VQLS 1H2UX 5EHHA 1SKRA 1IN0A 4F67A 5D3GB 1TKZB 1JKHB 5KFJA 1JNZB 4ECQA 1F60B 2RDIA 5B7WA 4ED7A 1R8HA 5F0UA 4Q5VA 3FJ2A 3T5LA 1K1SA 2W24A 1IKYB 4A47A 3JTPA 1HWKA 1S9GB 3CJ5A 5F8IA 2Z2LA 3OJUA 2V8HA 4NZ0A 4IRCA 3TI0A 2J9EA 2KYXA 2VBWA 3DDKA 2WCXA 5G0RB 1NK7A 5EX0A 5B0DA 4C11A 1BLUA 3NCPA 3MPWA 1X8DA 3M2UA 3P6YC 4B3SF 1YGYA 4QYZJ 3FSIA 2FJDB 3B4MA 4M8LA 3HJFA 3FRZA 1N8RT 4IOAQ 3U27A 3HZGA 2J8AA 2DHXA 5IT0A 2R4FA 2W9CA 2NPIA 4EEYA 3GFHA 2CPHA 1M1KT 3MUMP 3EXCX 1XC9A 3B4DA 4JI8F 3MPYA 3DGPA 1MROA 1IJEB 2ZHAA 2R7SA 3MI7X 1X4FA 3JSBA 3UFCX 3HVRA 1AW0A 3M6WA 4KTQA 1TKXB 3OR2B 4MMOA 4IQMA 4CZCA 2QLXA 3KLHA 2HW3A 3HPOA 2UUWA 3OTBA 1VHFA 3NL0A 2LEAA 2W8KA 5C42A 2RU9A 2EKYA 4HI2A 2DGQA 4FXWA 3JTOA 3R3TA 2JOQA 1GX6A 4NXMF 2DNRA 3BGFA 4X84A 4ZCKA 1VIOA 1TL4A 1SIZA 5B0AA 3B8HA 5CYMA 3IWNC 2JJ4D 3ZZOA 3QZ7A 2CJBA 5K9FA 3P96A 1RT3B 1OQ6A 2V8VA 3SV3A 3SV4A 5E0OA 2VQFF 3THPA 2Y0SD 3MR6A 2X1GA 5EDWA 2W4CA 3AQOA 2APOA 1KTVA 3M6VA 1C0UA 1KLMB 4CTAA 1T7PA 2DH8A 2VPWB 4Z37A 3IN5A 3I0RB 2LQ5A 2B9XA 4ES3A 1J5OB 1WF1A 2ZITA 5GAEU 4WIIA 1RT2A 4KAIA 1ELOA 4WK1A 5JXSA 3L7PA 5F8NA 5KFPA 3OTDA 3LALA 3TAPA 3RR8A 2RDJA 2V4JA 4I69A 2GV1A 1S77D 1C1CA 2W7OA 2ZBCA 3I5CA 4N56A 2E9TA 2FC9A 2V8DA 1OWXA 4C11B 5E3QA 1FVSA 2UV8A 3M2UB 2B9WA 2BQUA 3AAWB 2U1AA 4X4PA 2CKWA 1LW0B 2QSFA 1YJRA 5DS7A 1V6HA 4IH6A 2E1RA 5DLGA 5J2MA 2KFNA 3CE8A 2HHPA 2XS7A 2YKQA 4QR0A 4M5DB 2HWIA 1FEEA 1Z1ZA 3PX4A 2I1RA 2M3DA 2K7KA 4NRUA 1U1NA 5AE1A 2CZ4A 2WB1D 2QA4G 2CG4A 1RKIA 2ZKUA 1C0TB 4AUKA 1U24A 2I5JB 4FNIA 2JEIA 3MFIA 2ZHOA 1Q82T 1Q16B 1EP4A 4NL5A 3B78A 3ONQA 5DQHA 2RRAA 1B0PA 3FVYA 3LO3A 2WHOA 2HFOA 4UW2A 3DDNA 1SJ3P 2XB2D 1S4FA 2DGUA 3K5OA 4ILRA 3PIOQ 3CCMS 1N5TA 3NNAA 3U1NA 1X4BA 4H4KC 5C42B 1WEZA 1W25A 1RT6B 2ZZNA 3CCSS 3IRXA 4DL6A 1U1QA 2JDJA 4NX9A 4Q2LA 1R0AA 2BANB 4A48A 3KLFA 1S97A 2B7CB 4DL0C 1QVFR 4DV6F 4K4YA 4B3TF 3TA2A 2LA6A 5HMXA 2YWFA 1VBXA 2MGZA 1P9QC 2VODA 2HHXA 1S1UB 4BBYA 1TZ0A 1HBMA 1C0UB 1SKWA 4RUAA 3CEDA 4TN2A 3T5JA 4ZPTR 3KJVA 5DG7A 2FC8A 4J37A 3W2WA 1NH8A 2R8JA 5HBMA 1S1XB 2CQGA 3G8QA 4IG0B 3BREA 4MFBA 4FF1A 1EETB 2X3GA 2E66A 1FKPB 4N5SA 5DDOC 1QUVA 4KKOA 1LK7A 3QO9A 1VQPS 3IBWA 3DOKA 2HQ3A 3MMAA 1F5BA 1QSYA 1BD6A 2I0XA 2HHVA 2QZ8A 4DL5A 4DQSA 4OJ3A 1YITS 1C1CB 2EI5A 2FHKA 3FFIA 4DHVA 1JX4A 2FJBB 2EC0A 1B64A 1TL5A 2VG7B 1X0FA 3RAQA 2HMIB 3VAJA 4IOCQ 1T3OA 1ZPVA 4DN9A 1XERA 4WTYA 3OXGA 4HHJA 2DRBA 3GV5B 4OHYA 1ZAVA 3RZAA 3HXMA 3MMBA 3FCHA 2O3DA 1FJEB 1X9SA 3H2VE 1YIJS 2RE1A 1H38A 4M63A 2FHMA 2IBOA 4L72B 1BQXA 3ZZYA 1FJCA 1UVKA 2HG4A 2HRYA 3NCRA 3OQ2A 1HHSA 4C8YA 4YDDB 2VPZB 4OHXA 4C8KA 2DPJA 4I68A 3DLHA 4NYZA 1I1GA 5KAKA 5KT5A 3WDOA 4RNNA 3PDNA 2HNDA 2EBEA 1V3ZA 2AWZA 2KHCA 3ULHA 4TYAA 4NLOA 2ASDA 2JC1A 1TKDA 2LEPA 3D1OA 3KG1A 3T9NA 4ZHRA 4QU6A 5LSLA 2C2DA 2GA7A 2KM8B 4ZK7M 3BR8A 3BO2A 1R0AB 3KLFB 4HDHA 2M4MA 3K2YA 2CPZA 2N7YA 1VQ5S 4KGKA 5KG4A 3HLUA 2XS2A 1NRKA 4P2SA 2IC3A 2MGZB 3NNCA 5A0YA 1LXJA 1SXLA 4XDCA 2GCFA 2ZC3A 2DNKA 4KQZA 1GT8A 3V6DA 4B17A 2VOPA 4FVMA 5KFBA 2OD4A 1T03B 4WFXA 2ZH7A 1DJ0A 1YI2S 3KJVB 2EK6A 5E3PA 3MWBA 2GMJA 2ASJA 1S76D 3I5AA 2GQCA 3SSRA 3BGUA 1X5OA 4MFBB 2HWTA 3E2EA 1F9FA 2Q3PA 3D0GE 2DGTA 1OS5A 1TUVA 3QGPA 3KHRA 4RBTA 4DQIA 4KKOB 1LQ9A 2XMUA 2AP6A 2QYCA 3DOKB 1SV5A 5THWA 1VQOS 2R8GA 1K73T 4KV8A 4K4SA 2DVIA 2E5HA 1RYSA 2MY7A 4KO0A 3MPVA 3BN7A 1HBOA 1Q81T 4NLTA 2DPIA 4LMZA 4LSNB 2L9DA 1DTTA 2V9KA 2MHNA 1FRXA 5LSRA 2ZH1A 5LMNF 4URQU 1XWLA 2EWHA 4DJBA 2M7SA 1X9MA 3IWLA 1FHTA 3KG0A 4A8XA 2O5DA 2N82B 1NK9A 1N0VC 1S49A 3AQPA 3MMBB 3C46A 3GIJA 5KFHA 1U6ZA 1SKSA 2P6SA 3LAKA 3X3UA 5I3UB 2MQPA 1T05A 2D3UA 3CCZA 4LQ9A 2UVVA 4ZP6A 3L95X 1MWZA 2C42A 2MY8A 4NZ6A 3VZIA 3VQSA 2HS4A 2DNLA 4WFYA 2RF2A 4ZLPA 5IM0A 1ZZFA 4O44A 1WF0A 3CDUA 5C24A 2K8GA 3IO1A 4R5PA 1R8PA 2F1FA 2AGQA 4LF9F 2QA1A 4H4MB 2D74B 2KXNB 4K4XA 3FSXA 4DV7F 4O4GA 2UVRA 5EX3A 2HNDB 3MM7A 1Z2ZA 1LWCA 2IM0A 4IO9Q 2I9SA 4ZHRB 2CQ0A 2NSCA 3M8RA 3OTCA 2R7WA 1M90T 2MB0B 1IBMF 2G4BA 1CG2A 1HNXF 4OV1A 2BQRA 4K4VA 4GKKF 4YB5A 2OTLS 4ZP9A 4ZMMA 1DARA 1WI8A 3C6TA 3M4XA 3G96A 3NLCA 3K0JA 1U1PA 3CJKA 2JVRA 4IUFA 2RD5C 4PXCA 5A0YB 1S6UA 1VQ8S 1VGYA 4J9NA 3M32B 3P3DA 2KFYA 1DZ5A 1S99A 4WU3A 3HP6A 1AROP 4ICLB 4XPCA 4WK3A 3DRPA 2J0QD 2HNYA 4AXJA 2ASYA 4KHMA 4XAKA 5I42A 2O01C 4QZVB 4FS1A 4ZPDA 5CYQA 2Z8QA 4B9MA 4R0JA 4PQAA 4A8MP 1S6PA 2MDAA 4GO7X 4NWBA 4KGMA 1DQAA 1JLBA 3GMGA 1X4EA 4ECUA 2W7AA 1R6YA 5IFMA 4QWCA 4WFNQ 4NLRA 4QWDA 3BSNA 4O23A 2MKCA 1T95A 1SV5B 2J7WA 4TY8A 4EFAC 4FZVA 2JEGA 1ZH5A 3NP5A 2XMVA 2L9WA 1UVIA 1HBOB 1VQKS 4DLEA 4OHVA 3THTA 1H98A 4IH5A 4DOZA 1X0PA 1YJVA 5ADZA 3G6VA 3D28A 5J1NA 3CJ4A 3DM2B 2F7VA 1QSLA 1C4AA 4DPOA 1HW9A 1H6KX 2C22A 5K5MA 4I6AA 5D4PA 4QW9A 3PV8A 4A46A 1P27B 3VTIA 3CF5Q 1R43A 2W9AA 2J0WA 2PGCA 5LL6d 2KG1A 5H9FJ 4TU8A 1U09A 1HW8A 2PEHA 2DK2A 4RW6B 5GAHU 1RTDB 3SYZA 5FLXY 4OX6A 2LLZA 2XULA 4N47A 3OL6A 4G3IA 5GAGI 4ETZA 2B6AB 3HHLA 3OR1A 1FRLA 1N6QA 4ELTA 2M70A 1M0SA 1A6LA 1G1XA 1RT4A 3PEJA 1Y0HA 4IR1A 3N5BA 4RW7B 2VFVA 1ZAXA 3CJ3A 2E7XA 3SFUA 1M5VC 3CWJA 3LGMA 1UEVA 2OPSA 1JJ2R 2QA4S 2A2DA 1KC8T 3EZ5A 4H4OA 3H40A 3N01A 2XI3A 3CC4S 3GV7B 1UFWA 3GFYA 3WC2A 1TFYA 4RWWA 4L3NA 1Y4ZB 2XMWA 4QWEA 2H9ZA 3TNVA 3HM9A 3C6TB 1C4CA 1PC4A 3NNHA 2FLPA 4M94A 5HROB 4DR3F 4RX6A 3CJKB 3CPWR 4RU2A 1WG1A 4X4UA 3CCWA 3ZZZA 2XY6A 3TANA 1UMJA 1VBZA 1FRMA 2DD8S 2BBEA 1TL3B 5B0CA 1QM9A 5FDLA 4NCGA 3D5MA 1N36F 4K4TA 1QTMA 2IA0A 2MSSA 3S8SA 3VCDA 4DQPA 2KU7A 2BABA 4KFBA 3QLHA 4I1TA 4BWMA 2P6TA 1UWBB