1S6UA

Solution structure and backbone dynamics of the cu(i) form of the second metal-binding domain of the menkes protein atp7a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
76
Chain Sequence
b'GEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKIEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title Solution Structure and Backbone Dynamics of the Cu(I) and Apo Forms of the Second Metal-Binding Domain of the Menkes Protein ATP7A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6uA00
2GGPB 1OQ6A 1XBWA 2ROEA 2PGCA 4HH1A 2HFOA 2BBEA 2IYGA 2QYCA 2XMMA 4DN9A 4NPOA 1GXUA 1YRXA 2EW9A 2KKHA 1ULRA 2XMVA 3KKFA 1QUPA 3HX9A 2HLUA 1P6TA 2QLXA 1FEEA 2FTRA 2XMTA 3E8OA 3HHLC 2GGPA 4HI1A 1Q8LA 1V3ZA 1VQYA 1N5QA 2L3MA 2AJ0A 3CJKA 1N5VA 1AFJA 2HIQA 2BYCA 2VH7A 3IWXA 2K7KA 3KG0A 1CPZA 3BR8A 4OJGA 2ASYA 2G9OA 3HF5A 5F0UA 2OFHX 2N7YA 1CC7A 1FD8A 1S6UA 1X0PA 1Y9OA 2RU9A 2ZDOA 3FGVA 5T7LA 5B0CA 1S6OA 2CRLA 3DCAA 1AFIA 1CC8A 5IXUA 1YJVA 2Q3PA 5B0AA 4YEAA 2GO8A 1N5TA 1X7VA 3FMBA 3FRYA 2N4CA 3CJKB 2BJEA 2GA7A 1U7LA 2W4CA 2LDIA 3HHLD 2BJDA 4OIXA 2QLWA 3IWLA 3LGMA 3QGPA 2OD4A 4OJ3A 4ZA1A 5B08A 1AW0A 1Q53A 3BDEA 1P8GA 4HI2A 1RJJA 2FB0A 1YG0A 2XMKA 2FIUA 5T7LB 1W2IA 1IUJA 1OQ3A 4HH0A 3WDOA 2OKQA 3MCSA 1TL4A 3KG1A 3VTIA 4Q2LA 4DPOA 2FHMA 4FNHA 2IYIA 1K0VA 1JK9B 3I9ZA 3TNVA 2K7JA 1Q8BA 3HFKA 4Y2MA 3F44A 2BUNA 4A46A 2OMOA 2ZDPA 5B0BA 1Y3KA 1FE0A 2LQBA 3LGNA 2GV1A 2LQ9A 4OJHA 4YDXA 1GXTA 2RSQA 1FVQA 1URRA 4Q2MA 5KAKA 1WD6A 2W4PA 5K9FA 3BM7A 2ROGA 2PD1A 5B0GA 3T9NA 1Y3JA 2HQIA 4EFAC 1TUVA 1Y0HA 1N5SA 1Q4RA 1FESA 2OAUA 4Y2IA 2QIFA 2XMUA 1FE4A 2XMWA 1OSDA 2AP6A 4FNIA 4QOTA 5A6WA 1R6YA 4A47A 1FVSA 3BB5A 3DXSX 4OJ1A 2HFNA 1MWYA 3KNGA 5B0EA 3K7RA 5B0DA 1TZ0A 1YJTA 1LQ9A 2AJ1A 5B09A 1SQEA 3HHLB 1X8DA 1SI9A 2OP5A 3BGUA 1YJUA 4HL9A 2K1RB 2GFFA 3TRGA 3MZIA 2GCFA 4A48A 2K2PA 2KYZA 4DL0C 1TR0A 3BN7A 2IFXA 3LO3A 3HHLA 1OPZA 4F67A 2OFGX 2RILA 3BF4A 2K1RA 3QMQA 1KQKA 2VV5A 1TL5A 2W4DA 5A6PA 2KT3A 2OD6A 1MWZA 1APSA 3GZ7A 1VQSA 2N4DA 1KVIA 3UDCA 3HDSA 2JDJA 4ZOSA 2HLTA 2XMJA 2ROPA 4U9RA 2AW0A 1KVJA 2ACYA 1JWWA 1YJRA 2LXFA 2KT2A 2RMLA 4NL5A 5B0FA 5F0WA 1SB6A 3TOQA 4A4JA 4Y2KA
chains in the Genus database with same CATH superfamily
2XB2D 2IM2A 2HQ3A 1YJNS 4I67A 3PDNA 2B4PA 3PFEA 2QLXA 3JSMA 2E9TA 4YUDA 1SKRA 5IC6B 2DBBA 1PG5B 2CJQA 4DR4F 4ANDA 1OIAA 3ZTSA 2CKWA 5KT6A 1K9MT 2LMIA 3C14B 2B9WA 2XNRA 4CNZA 1LNQA 4K8RA 2VODA 1NO8A 4A8WA 4K5RA 1GMVA 2A1BA 1MN9A 1C1CB 2AV5A 4DSEA 2BOAA 3TVZA 1C1BB 4QWDA 5D4OA 3OFGA 1VIXA 1JLBA 2IJNA 1NLKL 4D3HA 1X4GA 3EZUA 4DV7J 3K8VA 3JAMU 3EUNA 4DV4F 2HNYB 2LKZA 2H1YA 4OX9F 4UOHA 1UKUA 2E1RA 2XY7A 3MR5A 3KNGA 1RWUA 5ITHA 3OXLA 4J9PA 2HHHJ 1PAEX 4M5HA 2V4JA 3RRHA 3BR9A 3DGPA 3L7OA 4IFYA 2Y3YA 1PYSB 3SCKE 3UE2A 3Q2SC 4R8UB 1SL1A 1NJXA 2DGQA 2APOA 1U2CA 4RNMA 2QE5A 2HYIB 1YJRA 2Q66A 2Z2YB 4KIAA 2BBEA 2ADCA 1WC0A 5H9FK 4U7UK 2L9NA 2FTRA 4CTAB 3KLHA 2W01A 1N5QA 1S6QB 4KV8B 3KG0A 2YPYA 1M5SA 4JI3F 1O5JA 2BEFA 3ILJA 3KK3A 2LQ8A 1UCNA 3LPEA 2C3UA 4WP9A 4CQ1A 2Y1JA 2HVZA 2JEFA 3K0JA 4OI3A 4P52A 3BO2A 4RUBA 1YBUA 1RTZA 2AD9A 2CPIA 4DUZF 1FNOA 1B7FA 1NBEB 3RB3A 3FVYA 4EBEA 3MMCB 3KLEB 3EGWB 4RW6A 3WC0A 4B9TA 4H4KC 1Z2LA 4ES1A 5GADI 1V5IB 3VQSA 3BB5A 2D9OA 3P96A 2XZTB 2GS8A 2DNGA 4BC9A 1RT3B 4DR6F 5L1JA 3RAQA 4DR3F 4X4RA 1FWLA 5IWAJ 5HSPA 3Q24A 3CJ3A 1S1VB 3JTPA 5D15A 1XTZA 2X7IA 3CVKA 2M0GB 2DVIA 2DITA 3NEKA 2G2ZA 4WIIA 1GXUA 2MKKA 3R5JB 4DLGA 2ZJQQ 1VJQA 1RBAA 2FJBB 5T41A 5CD4A 4F4WA 2AYEA 2VC0A 4RBUA 2IJRA 1H3DA 2ZUAA 1EKRA 5J2PB 5LMNF 5AXMA 1DBDA 4MFBA 4CM2A 3DDIA 2VU5A 5FDLA 3W8PA 3BO4A 4WZMA 4FPRA 3W9HA 3B8HA 3W2WB 1F1BB 1YG0A 5FIIA 2W8LA 2AJ2A 3HFZB 3M2UA 3AQPA 1RAGB 4FNHA 4I6YA 3R5CA 1LWCB 1NB2A 5ETKA 4WP8A 3ZZRA 2IVMA 3IWNC 1FRHA 3IFEA 2V50A 3TANA 3DDNA 2QIFA 2AP6A 4AXIA 3EZ5A 4F36A 3QO9B 4UZCA 3KK1A 5E3RA 3CMAS 2WHOA 1S6PB 4ZDNA 5K8NA 4ZLPA 2HEKA 2H9ZA 2YQ0A 4DR5F 2MTLA 5HANA 3NCRA 3N5BA 2I5JA 3OL6A 2UUTA 1U6BA 2ZM6F 3T9ZA 3FMWA 1BD6A 2JVRA 3HX9A 4DN0A 3NNCA 3OTOF 1SC4B 2AKWB 2ZBQA 3DMJA 1ZZFA 1R0AA 1PIEA 3CCTA 4ZLJA 1XC9A 1Y5IB 4RW8B 4KKOA 4HI2A 3CDBA 3N28A 5HMZA 1QTMA 2PN6A 3O8WA 3V81B 1VBKA 2ZOGA 3CDEA 5A0YA 4PG8A 2CPZA 1S7IA 1KBRA 1HNXJ 2ALZA 4TNOA 3SYZA 3AOBA 3DNCA 1H6KX 1RT6A 4DL3A 2G13A 4URQU 3M7VA 3EICA 4A48A 4C8KA 3KLIB 3LO3A 2IMOA 4AXJA 1ZPVA 1HFEL 2PT0A 2X1FA 3A13A 3NGKA 3T5HA 5KG4A 4RNHA 2JOQA 3QQCD 2L08A 1U1QA 1Q8IA 3MHYA 2C3PA 1BY9A 3R7SB 2HRUA 3IN5A 3HVRA 2GVDB 2XY5A 3A1YG 4N76A 2C2ZB 2OTLS 2O1PA 3P3DA 3D1QA 3UW1A 2WBMA 1IWAA 2YKAA 2WK4A 3POTB 4ZP6A 4ED1A 3AOCA 4DPTA 4USKA 4NA1A 2B3TB 4KBIA 3LOUA 4USTA 1FF2A 2R7SA 2M52A 3CC7S 2ZVIA 3D6FB 3B4DA 2HFUA 3M8SA 4CH1A 3DGVA 1FRIA 1JLQB 1FRKA 2BRKA 3ISNC 3GSDA 2QLBB 1VQ6S 4DQPA 1IKVB 3H2UB 1UPMB 4DL4A 2X3DA 3DLEB 1N32F 3D6HB 1NK9A 1X31C 1RB0A 2OLWA 1NKEA 4JYAJ 4X4VA 2RS2A 1H7XA 3SCLE 1TQLA 3IS9B 3E8OA 4NCGB 3NCQA 1KONA 4IO9Q 1YKWA 2CPXA 1DLOA 3TVKA 2VBYA 2YNIB 1D9DA 4XK8C 5E3QA 5GVQA 4QBUA 2LA4A 3TQEA 3K2YA 5KG5A 1RWNB 1TKTB 2H5JB 4JI7F 2XGQA 1RHMB 2BJ7A 1RAHB 3PKMA 4OQJA 1FVQA 2XS5A 1VR6A 3PG9A 4IG0B 4CLUA 3T1HJ 1REGX 3UCUP 4DV0F 1GXLA 2RILA 3MFHA 3HHDA 2O66A 2DT9A 4OYXA 4NZ0A 3KOAA 1VQSA 1ZAWA 2DRBA 2CQBA 1X5PA 3CD7A 4R25A 4NLQA 4ZPCA 3KLVA 1QDUB 1HNIB 2IPOB 2EBEA 5F8HA 1WTBA 4ZPAA 3CCES 2DTJA 1IKYB 4JP8A 1DQ9A 1AFIA 1RTHA 2RKIB 2DB1A 4X4QA 3NS6A 1X7VA 1UVKA 3QGIA 1YDLA 3CCZA 3TW0A 1ZM9A 3KK2B 1W2BR 3D0IE 2B9EA 1OJ4A 4KGKA 4C98A 1UEUA 3IMQJ 1UJ5A 3UN5A 2RVJA 3R27A 3AB4B 3DHXA 3PYDA 4K0KF 2DGWA 3K59A 5IC4B 2PSZA 1UJ4A 3TUIC 4F67A 2CQHA 4RWXA 4CLLA 3RAXA 4JV5F 1MWZA 4DR1J 2V2QA 2XYPB 4WKRA 1ZZNA 1ZM4A 1SIZA 3UR0A 5AJ3J 1NDLA 1A9NB 5K14B 2GMHA 4BS2A 1BMQB 3GWCA 5EHHA 2EBGA 4RNOA 4ZHRA 3M9MB 1HW9A 4KHMA 3CO9A 4WXOA 2E5IA 4ZKAA 3F56A 5F8IA 1VYAA 2IVYA 2UVWA 4LBPA 4BLGA 2E7XA 3ZO7A 2M4MA 1Q95G 4B3OB 3MM9A 2I38A 2HHSA 1HWJA 3P4UB 3IR5B 2AIRB 5D0EA 1S0OA 4PEOA 2DGXA 2F8EX 3PXGa 4M5KA 1FXRA 2GIFA 2DRAA 3K7RA 1A7GE 2CXEA 3BGRB 4LF9F 3ILLA 1CJVB 2ZHOA 3TAMA 3TWZA 4AFFA 4NLOA 1NPPA 2AGPA 3K5NA 1F5CA 4DSKA 1VS3A 4MMOA 3TI0A 3ZZUA 3UDVA 1VOMA 3CXCR 1S76D 1NHVA 1U8SA 1LWFB 2E7VA 3N6LA 4KY3A 2MKYA 3A12A 4YB7A 3DOMA 2RH3A 1HNWJ 1IN0A 2K3KA 1RP5A 1TELA 3CD0A 4H4KA 3QIPB 1NDCA 3VAIA 1NZ8A 3DRSB 2VQFJ 4NOHA 3MMAB 2JHEA 2VHGA 3MMBA 4QYRA 3UN3A 5D8HB 3G87A 1YRTA 2LP4A 4PWDB 2OEJA 5ETOA 1NDPA 1VHFA 4CO0A 1GK8A 3CMES 1B3TA 3WDOA 3UVJB 1RXOB 3MUMP 2C3OA 1LWEB 3TNVA 4CP5A 4V19J 2VG7A 4DSLA 3ILIA 1QSSA 2CIMA 1N56A 1VK8A 2P5VA 3DM2B 3PIOQ 3QJPA 1EIYB 2PO4A 5F3ZA 3A8IA 2DGTA 1UPPA 2KZMA 1RSCA 4DL6A 4R5PB 2EFQA 3W2VB 3BBCA 2CPDA 3W64A 1G4CA 2OTJS 3LP2B 1YIJS 3R6LB 3CCUS 3SQGB 4RW4B 3GR0A 3P45B 4DUTA 3AXKA 5A8KB 1ULRA 2IAJB 3H7HB 1NJZA 4L75A 2HBQB 1C0UB 5KFUA 1FKOB 2ASYA 1VBYA 4B3RF 4Y3CA 1DTQA 1KOOA 1PGZA 4LJMA 2HK2A 4MK7A 4JV1A 1JNZB 7AT1B 3EGZA 1RJJA 2YNGB 4NYOA 4DPOA 5D77A 1OO0B 3I9ZA 2MZJA 3QWPA 5F8JA 1QE1B 4EFAC 4DV1J 4DL2A 1CLFA 1WEZA 3FRZA 1M0SA 3QRRA 2Q6CA 4XAKA 2V8VA 2F40A 2K1RB 1RA7A 1BHNA 4ES2A 5JVGQ 3I82A 1Y4ZB 2LDYA 3QFWA 4M5IA 3CCWA 4E2FB 1T03B 3D4JA 2N3OA 2KDOA 2J9DE 4TYAA 1CQMA 2AJ4A 2DY9A 2GHVC 1QUPA 3IBWA 1WF2A 2F4VF 1BUXA 3HF5A 4WTOB 2VG6A 1CQNA 1UTAA 3G82A 4JI5J 2GO8A 1U09A 3K57A 4X4SA 4OIXA 4K50A 3H5UA 3AQOA 1IR0A 1C2PA 3MCSA 1S12A 3QPIA 1UW9A 1T9XA 3R5BA 2ASDA 5AE2A 4ATNA 1IBLF 3SV3A 3LUYA 2FJWA 1WDTA 3NGTA 3PACA 3EDRB 1RT2A 3MXHP 4V19X 4DXLA 3W63A 2HHXA 1AYEA 1S9GA 4LF8F 4RNFA 1CS4B 3C6UA 5HVGA 1BQNA 3R2DJ 2OMLA 1HD1A 5I3PA 1VIOA 3MCNA 2BRLA 2NLWA 1U4BA 3M4XA 4PUOB 1KQKA 1KR4A 2AMCB 4JV0A 3K58A 1KLMA 1WOOA 1AT1B 2B6AA 2ZE2A 1U0HA 3R3TA 1TU0B 2DNMA 2QRRA 3K5PA 3H5YA 2B5JA 1I1GA 2DHAA 4X4PA 1TFYA 3WX4A 3EJMA 4W4MA 3GCWP 3NGUA 4HI1A 1QUVA 4DL7A 2BANB 3RUBL 4HEA9 4J91A 4IR9A 4TLRA 3RRGA 3AOAA 3GQCA 2XQCA 3NAIA 4FBTA 3I0RB 3CJKB 2VFRA 4OL8A 1B4SA 4JB8B 4UT4A 2J0QD 1WF1A 1TL4A 2OPSA 3HSJA 4A8KA 5BR8F 2C2RA 4F02A 1FA0A 3P5BP 4LFCF 1P1TA 1FNMA 5KG7A 2Z2MA 1RT1A 4ZPDA 3DLKB 5GADU 2UXDJ 1IR2A 1PBAA 2WVCA 1SC6A 4WBFA 3M30A 1DTTB 1VHIA 3IG1A 1MG7A 1HPZB 3M6WA 1V3SA 1TK8A 3H4BA 3DXBA 4C0HA 5C24B 2A2DA 3ZZ0A 4WFYA 1J2VA 2ZITA 3H98A 4OFZA 2WCXA 1R0CB 4DU8A 2EKNA 2L9DA 2XTJP 2EFVA 4U9RA 3IBCB 4NXNJ 4UUWA 4JUZA 4G65A 3MPYA 1WHVA 1RHQB 3CJ2A 4WU3A 4TQRA 4N47A 3MM8B 2RUGA 1TTHB 3TYTA 4OJGA 1UP1A 3F41A 3OL8A 4ECYA 3UO0A 3W5XA 2DISA 5AE3A 3LWLA 2IDEA 2C2OB 4BHQA 3DRRA 3KUHA 2FUG9 2P9GA 4ECZA 2XYGB 3I5AA 1JLEB 3ILOA 2YKPA 5HLFA 1FFWB 4LF5J 4YR2A 4O0IA 5J2NA 1S97A 4LF6F 3LF0A 4Q0BB 4N7TA 3BM7A 2HQIA 2VONA 3A8JA 4C8MA 1FESA 1JLAA 1M5VC 1JJ2R 4CO5A 3KG4A 3I0SA 1KFSA 1K0TA 3OPKA 3OFEA 3LQVA 4DS5A 1M1KT 2HQDA 1Q7LB 5T14A 1B64A 1D0EA 4CLWA 2B51A 3CJ0A 2DNQA 2BQUA 3RBEA 3BJYA 2EW9A 1YTYA 1X5TA 2AU0A 4ILMA 1KHVA 3QLHB 4U6PA 3B82A 3T5LA 3D7SB 2VDIA 2B8QA 2U1AA 1C1BA 1NK7A 2LYVA 1U7LA 1K44A 2DPJA 4JOUA 4F0HA 3PYEA 4J37A 1LK5A 4WIQA 3DOLA 2HNYA 3W65A 4USUA 4P2FA 4XO0A 1H7WA 3RB6A 1XMOF 1FKPB 2KFNA 2CWXA 2A2CA 1FWKA 3GCXP 3ENVA 2DGUA 1N34J 4F4XA 2H4YB 1IBCB 4R8UA 5B0DA 1YJTA 2AJ1A 4E98A 2AGQA 4LRAA 1MW7A 1IBKF 2VPZB 3M1VB 1V3RA 5GMKa 3M2VB 4C4WA 1RKIA 4ECRA 2E5GA 2I2YA 1T3NA 4DSJA 4DR7F 4QW9A 1S6QA 3JSMB 2VL1A 5D4LA 2B7BB 2YNHA 1QY7A 3CJQA 1FJEB 3GFHA 5KFFA 3IBFB 1HMVB 1R43A 1EB0A 3KUGA 4X4TA 2DHHA 2ZDOA 3GYGA 1X9MA 1NH8A 2IRYA 4TYBA 2NYIA 3THTA 4YEAA 2X1BA 4YY3J 3KJNB 2R7OA 3CGIA 1HHQA 1NSAA 4BBYA 4X64F 3MMCA 3KLEA 4JI6F 4CDIA 4QYZK 1REVA 2QC3A 4LVNP 1NK0A 1QM9A 4IDKB 1FJCA 3PNIA 3J80Y 3HP6A 4IKAA 2IM0A 1DZ5A 3T5KA 3DGPB 4IFYB 4MYUA 4ZLNA 3QAEA 3IA0A 2XGPA 2GIQA 3D28A 2FC8A 4U7UD 5A6PA 1L3TA 4ZOSA 2HRTA 3EWGA 1KVJA 4BCAA 3ENAA 4FDFA 4CO3A 4OV6A 4FF1A 2IBKA 3WIUA 2KKHA 3TVYA 1T7PA 3UWTA 2A6MA 3NGRA 1R6VA 8RUCA 3Q23A 2AJ0A 3PHTA 2HHTA 3W2WA 1T9VA 5HVHA 4PQUA 1LWCA 1DHMA 2B4VA 2WONA 4XDCA 2XLIA 1TMMA 4J5OA 5E7OB 3O5TB 4M8LA 2HBZB 1CBKA 3GJQB 2XM3A 2IM1A 3D6MB 3U1LA 3C16B 5GAGI 2DNHA 4HDGA 1TL1B 1R8HA 1S6PA 2OPPA 3BPDA 3J80U 1C4CA 2HVDA 1I94J 3H40A 1WI6A 4LQ3A 2I6WA 3HCXA 2GFFA 1Q1KA 2ERRA 5DRKA 3GFXA 1F2GA 2R7WA 4OYWA 3SV4A 1N32J 1NM2A 3VV2B 4TXSA 2BZ2A 2J7WA 1XWLA 3P8BB 1ZPWX 1RWWB 3I9V9 4DHVA 4QWCA 2BV3A 1GMWD 2R42A 1RYSA 2V2KA 1VBZA 1KS2A 1DJ0A 1R8AA 1XEZA 2IA0A 1UW4A 3S1TA 4ED0A 1CC7A 4K4TA 4NCAA 4WF9Q 2RUSA 5KG3A 1QAIA 4OYPA 3C8YA 3V81A 3M2UB 1RAFB 4DV7F 3ETOA 3FFIA 2J5AA 2DO4A 2MQNA 3EVMA 2DGOA 5JUMA 2W9AA 2HHPA 3BV8A 3EYZA 3F0NA 1KQSR 4DMZA 2WW4A 2HHHF 1TUVA 3MD1A 4U95A 4N77A 2YPZA 3KLIA 4LSNB 2R7TA 3THPA 2GQ2A 2N82B 4FXVA 2FJVA 2ZOMA 2OP5A 2NCKL 2MKHA 3TZZA 5GAEI 2V4RA 1RTDB 4JI1J 2IBOA 1S9FA 1EARA 1NB7A 1RAIB 3GPAA 4HH1A 5L1LA 4OI1A 3DMJB 3M8YA 1F5AA 1R0AB 3GR1A 3VAMA 1FK9A 2GVDA 2XMAA 2LU2A 1NK8A 4NLXA 2R7VA 2AX0A 2G9OA 3R1LA 3TZYA 4ZVFA 4ECVA 3TUZC 3I31A 3POTA 2ZEJA 2XC9A 2DHXA 2GA7A 1KWMA 2LDIA 4DS4A 4ZA1A 1B0PA 2GHPA 5A0YB 4N8NA 1YLXA 1Q86T 4NEZA 2EI5A 3VAGA 3J81j 3LGNA 4NCBA 1GXTA 1TKZB 5KAKA 4CIOA 1RT6B 2J8SA 5IWAF 2QSFA 2ZHAA 3U1NA 1TZ0A 1IKVA 3RU0A 3QYYA 2XO6A 2XYHB 3DLEA 4J9LA 4IFVB 1F3VA 2QZ8A 1EKSA 1SUQA 1TV6B 4UW2A 3R9LA 1LW0A 4QW8A 2I1RA 3IS9A 1CULB 4NCGA 3FBCA 2I8EA 1VQOS 2L48A 2XNQA 2XZWA 1SJFA 5LXYA 1WG4A 2CJ9A 2G1HA 2NYHA 1TK5A 1AFJA 4C97A 5DQGA 4MIWA 1YZ7A 1KD1T 1TKTA 5HK4A 5HBMA 1BGXT 2QLWA 3BO3A 2HSEB 3BSAA 4DBQA 4KB7A 2FHMA 3T5JA 1UVMA 1S9EB 3RGIA 1XERA 4P71A 2ZDPA 2V4QA 1M5OC 2DR6A 2J9CA 4LVOP 1JIHA 2ZOFA 4WJBA 2HZVA 2HQCA 3HULA 1DAXA 2RJZA 3KJVA 4FVMA 2BJ1A 3ZC4A 3CD6S 3WHIA 3QT7A 3DRPB 2IM3A 1RHJB 1CJTB 1NSQA 1Q16B 1I3OB 2QO3A 1K47A 1NSPA 3HT3A 2RF2B 1E6VA 2VFTA 1HNIA 3BBBA 6FDRA 4ZPTR 1V5VA 2C2NA 3W61A 4DV5J 1IKYA 3CCMS 1LXJA 4B17A 1PYOB 3JQKA 2DGSA 5D0GA 2RKIA 2SXLA 2R2RA 1DLOB 1BWEA 2CPEA 3FCVA 1NUEA 4DQIA 2ZZTA 2G0IA 4IOBA 4GKKJ 1HNXF 1Q53A 1ZM2A 1L3VA 1W2IA 5C42B 5DDPC 1YI2S 4PAAA 1LWXA 4PPZA 4EWTA 1ROFA 1URRA 5C25B 2D3O1 3IM8A 4PCQA 2CPYA 3D1HA 2F7VA 4USHA 3GE9A 3U7JA 2MKSA 2VA3A 1U1OA 3SBMA 5LM7E 1WEYA 3GV5B 2HS4A 3EGNA 3OT9A 2KRRA 2KXHA 3D2WA 2BOPA 1NSKL 2KVQE 1VQYA 2RDIA 5KT3A 1FFGB 2KXNB 4DU7A 1NK6A 1D9AA 2Z30B 2MZRA 4MKAA 1TFWA 4B3OA 1S77D 2VBXA 4OHYA 2V2ZA 2AYMA 4NE9C 1MNEA 2BE2B 2MKIA 3A4TA 2P2CB 2W25A 2KXFA 2HS3A 1Y3KA 3RBXA 3PJXA 1FX2A 1WC1A 4ZCKA 5DM7Q 3FKBA 2YKMA 4OX6A 3TX0A 4K4VA 2W7OA 1TUWA 1FRLA 3HPOA 4CRJA 3QT8A 6FD1A 2XS2A 4CT8A 3PO5A 5CZVA 4KR0B 3LAKA 3TA2A 1DRZA 1LWFA 1RTIB 1HBNB 4RU9A 4WYWA 1JJCB 3RBDA 1EHWA 4RX6A 1S49A 3EVWA 3QZ8A 3ITHB 5IFMA 3LW5C 1HW8A 4MIAA 1RAEB 4J9SA 3DLGB 3MMAA 4B9UA 1UVLA 1GX6A 4LREA 4ZHRB 1YITS 4NEYA 5F41A 4X62J 3GV7B 1HI1A 2XLKA 1CSJA 3I96A 2NXEA 4UOFA 1UWAA 4PWDA 1D09B 4ED2A 4DR2J 2GMLA 4C0OC 3L95X 2A18A 2CRLA 3AODA 2ALYB 4LRBA 2V68A 2EFPA 3PVXA 2R8JA 1U6ZA 1DARA 3MM9B 3JSBA 1RYRA 2DHSA 4ZLLA 4AL7A 4Q2LA 1ZA2B 2IC3B 3T1HF 3PR5B 4F4YA 3HD2A 1AUSL 3NS5A 4OJHA 2CDQA 3H25A 5A2QY 1JLCB 2EC0A 3W2VA 4TU9A 2Z2ZA 2EXUA 3N0VA 1RZMA 3BSNA 1WJ9A 3R8YA 1Z2ZA 1SI9A 5KOWA 3OTEA 2WVFA 2YWEA 4YHHJ 3SQGA 2XHCA 2RNEA 2NXNA 3Q8RB 2YWKA 2MY7A 1HWKA 4IRDA 3L7UA 2OD6A 2IAJA 2LQ5A 5ETRA 3UDLA 2ACYA 2ZHBA 1WUUA 4B9LA 1F9HA 3BREA 2NXJA 5A8RA 1RUSA 4DF8A 3AD9C 1ELOA 3MMBB 2QX0A 1U1NA 4MKBA 4F3MA 4A8OA 1J5EJ 3BGLA 3HHKA 1JNRB 3QBCA 5D0HA 4DUYJ 4TY9A 4AE5A 3CJRA 2XG8A 1TVRA 1A6LA 3TJAA 4UUXA 2BJEA 3T1AA 2NREA 2KN4A 4ZVSB 1KSPA 2QMXA 3VVTA 4TQSA 3VTIA 2ZKTA 3T6JA 5F8NA 4G6VB 4PZVA 2X3GA 1RU2A 4OZLA 4OHWA 4DV6J 2D7SA 1X5OA 2OJ3A 1B0VA 3ET6B 4P10A 4EUVA 1JXVA 1SJ1A 1Q81T 3MCMA 1C4AA 5A2QU 2MLZA 4A8XA 3M8RA 2WVBA 1KQGB 3JQMA 3GJSB 4DR1F 4QWBA 3G2XA 2XI2A 4NLRA 2RRBA 2HQGA 2R8HA 3OSPA 1VBXA 4W92B 2EKYA 1FRJA 5AJ3F 2DNZA 1R8CA 1S4EA 2R8GA 2MHNA 4K2JA 3CJTA 2RRAA 1S0MA 4WK1A 1SL0A 2PFDA 1YRXA 5F8LA 5SZTA 3AB2B 4ECXA 1URNA 1DTQB 4QCLA 2EPIA 3AY0A 5IXUA 2VC1A 1VRUA 1KKHA 2A6OA 1T9UA 2KVIA 3CIZA 2WSCC 5KFQA 3GJRB 3HVTB 4DV2J 1T94A 3D6TB 2AEJA 5L9NA 2HHUA 2GNKA 1WKKA 5BYQA 3IAM9 2V69A 4YDXA 1H73A 2KG1A 2MKCA 3QJLA 1Z1ZA 2G0CA 1U47A 4DQQA 4PUOA 3ONQA 2MKJA 3L09A 1VCTA 2LA6A 4DL5A 2Z0GA 4KGZB 2ATCB 2IRXA 3QJJA 4W90B 2EK6A 1HNWF 5C2GA 4QIGA 4WFNQ 3GFYA 1TL5A 1EETB 2N4DA 3CEDA 3QT5A 3PO4A 1FERA 2VQFF 2Y8YA 4RUHA 3D68A 3ZTRA 2ZH4A 1M1HA 3JSRA 4FYWB 4LUBA 1FRXA 2GJFA 2CWKA 1FEEA 3K17A 1IKXB 4FZVA 4WU2A 3VVUA 4EI2A 3CJKA 2W8KA 4YQWA 1FJGJ 2XEXA 4H4MB 1RLCL 1VMBA 1HQEB 3ZFVA 3D3CJ 3DLKA 2M8DB 4K7QA 4F50A 2K7JA 2DR8A 1ZS6A 4IR1A 4R0EA 4ZJQA 1HPZA 2NPIA 4DPXA 4P7VA 3ENWA 2JRSA 2JL9A 1Q4RA 5C24A 1S9GB 4KH0B 3VQTA 3C6UB 4C6AA 4DCPB 2LQJA 2VBWA 5JXSA 1S0VA 3ZZPA 1XN9A 2CPFA 2H5EA 3L7PA 2ZE2B 2ZD1A 1U0HB 4ECSA 3SCJE 4CH0S 3A3NB 5BYSA 2DNYA 2OPQA 4GKJJ 5E33A 3MM8A 1N0UA 3FSXA 5AXNA 3LAMA 2V8PA 4K2XA 2VH7A 3NXZA 1SH3A 3IR6B 1T11A 2RQMA 2V8HA 2Z58B 3PEHA 1X4DA 1JLEA 1UETA 3MUTP 2HG4A 2CG4A 2OPSB 1SJRA 4J7CA 1JKHB 2OGUA 5DG7A 2YWWA 4DV1F 3MEDA 4HR2A 1WEXA 2WB1D 3CDUA 1TL7B 5LSOA 1S4FA 3BKFA 3R6GB 3AHPA 2FVSA 5LOQA 3M30B 2DPIA 5GAGU 1N6QA 4FVCA 4JI8J 2XMWA 1HARA 3KMQA 1N5YB 1X8DA 2D1CA 3PW4A 4NI2B 3VZHA 4LMZA 2KFZA 3BEGB 3J81U 2LU1A 4WKYA 2LLZA 3D54A 3I6PA 3MPDA 2DNPA 3HI9A 3KDOA 2M8HA 3QLHA 3TOQA 4ZK7M 2IYGA 4IQMA 4JI5F 3PTWA 2QL9B 2H5IB 2HLUA 2BXJA 3W66A 1T9TA 5C7PA 3AD8C 3UFCX 2XSJB 1WSVA 4M94A 4F0MA 5HP1B 1VQ9S 1TL3B 1DQ8A 2R3VA 2E9RX 3AH6A 2FQQB 5HLFB 1FKPA 1YK9A 3MTKA 3GTYX 2KT5A 5KFIA 4ZVPB 1U49A 1IR1A 1RHUB 1JLAB 3O3LA 5CCLA 3I4HX 3MWBA 3I0SB 2D3OR 2YX1A 3I87A 2PMHA 5GAEU 3PRVA 1RQ0A 1UJ6A 1CEZA 1DY3A 3UCGA 4QIVA 2V0NA 2VV5A 4XIUA 4LR8A 4YN3B 1NHUA 1RWVB 1SKWA 1HMVA 3C15A 5M2UA 4M63A 2VQEJ 4Y2CA 1OQ6A 5IQQA 2HFOA 1FEHA 1SQGA 3OLBA 4OZJA 1RBOB 2B8PA 2DNKA 1HNZJ 4ILLA 1KTVA 3PHEA 4LIWA 4J9QA 4Z2XA 4BC7A 3QNWB 1XMBA 2GHWA 2F8MA 3M6VA 1UA0A 3IRWP 1SBRA 1VGYA 2Q6BA 3DOLB 2UXDF 1OS5A 3MCOA 1IXKA 4IDKA 4HKQA 2PDAA 3MM7B 5KT2A 4S0MA 2MZTA 4E0DA 1HBOB 3MD3A 2M2BA 1LV5A 2X51A 3LWMA 4NXNF 1VQ7S 4UTGA 4HVZA 3R5AA 2HGNA 1YRUA 1TKDA 3GIRA 2G2OA 4C2MA 4NMLA 2RB7A 4EYIB 2YNHB 1WHXA 2DRDA 3W60A 4IRKA 4DOZA 1L3KA 2CJKA 1BC6A 3W9JA 4J9RA 3HD1A 5D3GB 3Q89A 2Y8WA 3PRBA 4DWIA 3DCAA 4RW9B 1RADB 5KFEA 4LF5F 4OHZA 3TAQA 3TA0A 1REVB 1FDDA 2P6SA 2BQ3A 3PW5A 2ZKUA 3C16A 3CC4S 7FD1A 1YJWS 2HFSA 1IM4A 3DFEA 1PILA 1TL1A 4I68A 3JTOA 3D0HE 1T05B 1L3UA 1NRKA 2RAQA 4OYMA 4Y0FA 1ICEB 5E0OA 2UV8G 4OI6A 2MJNA 2MGZA 1N33J 2RD5C 3T41A 3KTQA 2EVZA 5F0WA 3I5BA 3OXGA 4Y2KA 3A8EA 2E66A 2QYCA 4P7TA 5KFCA 1FXLA 4F8RA 3OR2B 3OBIA 3RR7A 2CQIA 2J6TA 4PQUB 1JLFA 1OY6A 2WONB 2CDRB 2PE8A 2YVSA 2FHJA 1FO1A 1D9FA 3UCZP 4O0NA 4AUKA 2J9DA 2KHDA 3V4IB 1H74A 5DS7A 2OKQA 4LFBF 1N34F 5LSLA 2ZFHA 3BKUA 2HWHA 1L5UA 4LSNA 3FSIA 2HURA 1VQKS 5CYQA 5E3CA 4X65J 5K9FA 2Q43A 1RHRB 2OPPB 1HI8A 1NJIT 1RTDA 3FDSA 4OZ2A 4KH1B 1KQFB 3EPIA 1T9YA 4Z37A 4LBIA 1FKAF 3OR1B 3H8YA 5HI7A 3BN4A 1UFWA 2OFGX 4JI4F 4LF7J 4ECTA 2MLXA 4CYUB 2PMWA 2HGLA 3TJ8A 1PKUA 1NJWA 2QTWA 4DG1B 4DF4A 2HRYA 4L3NA 1N0VC 4YY3F 4ZVOB 1SPBP 3BQ1A 3D9BA 3RB0A 4O4GB 2YNFB 2CNKB 5HO4A 3FFIB 3OVSA 1B99A 5KFNA 3SZ2A 4ED6A 3DRYA 2I9SA 3QRQA 2HS0A 1GT8A 1TKZA 4F4ZA 1RDRA 1S0NA 4Y2MA 4KHPJ 3G6XA 3Q8VA 4Y65A 1HIYA 2EG1A 3DHWC 3VWSA 1UVIA 1ZETA 1UVJA 2W9BA 1CJUA 3B6BA 4QIFA 4IFVA 5ETQA 2MY8A 1FDAA 1NPRA 3N4WA 1TV6A 4CZCA 2BKOA 1QSLA 3PY8A 1CULA 2OPRB 1Y11A 4HHUA 3VGSA 1O6XA 2BE9B 2CZ9A 5HQMA 3G86A 4OYAA 2D69A 5J2MB 1FK9B 2MZ1A 2F9DA 1X4EA 2FHJD 2FLLA 2VASA 1RWKB 1FX4A 2UP1A 2W2PP 2CVIA 3Q8QB 5HN0A 2JC1A 1S1TA 2F1FA 4X2BA 3TZWA 3IGVA 1U48A 2MYFA 4RKUC 1N5TA 1S9EA 1N54B 2FVQA 1R7IA 1EQ0A 2JWNA 2J0SD 1R27B 5KFWA 2UZAA 5SUHA 3HFVA 2FGCA 2IA6A 3HJVA 4ID8A 2CQ3A 2ASLA 3LALA 3DRPA 1I94F 3HMJG 2XWXA 1CJTA 4AT1B 4L74A 2UUBJ 4IH7A 2RF2A 4CM0A 2GVZA 1X4AA 3AJDA 5L1IA 1SUQB 4IQXA 4MYTA 3F73A 1LW0B 2Y1RI 5DDQC 3BYRA 1NHKL 5FJ4A 3N79A 4NX9A 3MTJA 4B3SJ 3GZ7A 1S48A 3MDFA 4Y00A 4MK8A 2YKOA 3UQSA 2H51B 2DXFA 4GVBB 3BKTA 2ZBRA 1VQNS 2BX6A 2AGOA 3UDEA 2OUGA 2ZH9A 4CO2A 2HNZA 3IWXA 3BR8A 1TK0A 3MR7A 5B0CA 5HBMB 3Q8PB 1W26A 5LSRA 1SJ4P 2R4FA 5C42A 1JLGA 1X4BA 1QLNA 3IWLA 2ATLA 2FB0A 1NJYA 4HH0A 5C25A 4R0JA 5J1PA 1JK9B 3D3BJ 3V6KA 4HACB 5E5NA 1XMQJ 2DGVA 4PG5A 3MI7X 3KJVB 2B7CB 2XZDB 2OI2A 2AHOB 2DEJA 1SQFA 1IQTA 4QR1A 3VCDA 4JI1F 4ZCLA 3IC1A 3GYXB 4IYQA 1XR6A 3THVA 4DX8H 6AT1B 1X60A 4PG4A 1E6VB 3M8ZA 3HHLA 2BA9A 3M6XA 2J7KA 4ED5A 3BF4A 3LGHA 3H5XA 3TR5A 1IWGA 1KVKA 2NR0A 2CZ4A 2ZJPQ 5B0FA 4IG3A 1IBMJ 3I4PA 1LEOA 5L39A 2ZH6A 2UU9J 1FJ7A 1G2EA 1S57A 3KKFA 1U02A 2V9KA 5A8WB 4KC5A 1Q78A 1C0TB 2BR0A 2GAGC 3JSYA 2BE2A 4M5JA 5EUHA 3S01A 1Y00A 3LANA 4K4UA 1R8BA 4EBCA 1P9YA 2OEMA 3X3UA 1H38A 2DO0A 1BXNA 5IT4A 3GG0A 2BUNA 2JLGA 2ZUGA 3UD4P 3GYNA 3T9NA 1F9FA 1G7CB 3MURP 1RTIA 2F63A 3FQKA 1HBNA 3RRKA 3EX7B 5DG9A 4B9SA 5DDRC 5F8MA 2F5GA 1SQEA 2BM0A 1IKWB 3ITHA 4TU7A 2JEIA 1QSYA 3VAKA 4N5SA 3NOCA 5HMXA 4EZ9A 3DLGA 2YWFA 3EPGA 1UVNA 1KVIA 1HD0A 5G0RB 3AFGA 3N01A 5CYMB 3I5CA 1XBWA 3OHBA 1Q79A 1HHSA 3JQJA 1RABB 4ZVHA 4U8YA 4C0BA 2UV8A 1CJKB 2GZOA 3DC2A 5FD1A 3J7AN 4NASA 4RNNA 1I5OB 3G8TA 1RT7A 4J90A 2COLA 2IC3A 2C2DA 2J0XA 3BSCA 5K5MA 5I4MA 2VICA 2ZC4A 5IQ6A 2XMKA 1S79A 2OHDA 3PYGA 4B3TJ 1JLCA 2J9EA 2GIRA 3CUNA 3E01A 2YKMB 4KFBB 2RSQA 4X66J 2BW7A 1TMJA 2RU3A 3Q0AA 1OSDA 2C28A 4A8QA 3S7RA 4LQ9A 3T6BA 5D78A 5IT0A 1RAAB 2HAIA 5J1NA 2VG5A 1ITPA 3C19A 3HSDA 4C11B 4DV5F 3QGHA 2DXDA 1TUGB 3PX6A 3OLAA 1ACMB 3FUYA 1HR0J 3PR4A 3L9ZA 3H2VE 4FYYB 3MGJA 3FQLA 3PJWA 2IJFA 3I56S 2LXFA 2W2MP 3OV7A 1VC5A 4HHJA 1B70B 4NPOA 4CNYA 4GKKF 1M90T 3DKDA 2MHEA 2DK2A 1WC3A 2ASJA 4LT6A 2K06A 4C3LA 3U1MA 1Y7PA 5KFXA 1FHTA 1WF0A 4PWUA 3TA1A 3ET6A 3G6YA 2GJIA 3R5GA 1XNQJ 1F9EB 1U0SA 2HHVA 2OELA 1KRPA 4LR7A 2MSSA 2PD1A 5F3TA 1RA6A 3H90A 1WKJA 4I2QA 9ATCB 1RAJA 3QWUA 2AX1A 4H54A 1MWYA 2VFVA 4JI2J 4DSIA 3PW2A 4YFUA 3FEXB 2MZQA 5K8PA 3QRPA 2A0FB 3ETMA 4KAIA 4F3OA 4OYOA 2Z4PA 3H4DA 1LW2A 3M32B 2BE7D 1N36J 2NPFA 5A8RB 3OTDA 2WOMB 2WTFA 3EXCX 4EYHB 2J8AA 2UUWA 5J2QA 3UNGC 4KPYA 4I0WA 3HSGA 3KUEA 2VKRA 4LF2A 3QT6A 2R2SA 4JBCA 3G8SA 1VQ4S 1R89A 2GX8A 1TVRB 1JJHA 1H2TZ 5KFHA 3HVTA 1X4FA 4ZJOA 1DURA 2RRNA 2R7RA 2QT7A 2NXUA 2D3ZA 2NSCA 2QFIA 4FS1A 1ZTTA 2MMYA 3SSRA 3DOKB 8ATCB 4PXBA 1Y5LB 3CCQS 1GQEA 2JVOA 4Y34A 1XR5A 5EGYA 2W4PA 2KM8B 2EFNA 4B3MF 2PIIA 1VC6A 3MMJA 2NXCA 4ANCA 3K8WA 5H9EJ 2V63A 4WWSA 2RQKA 2BVZA 1EETA 5CA5A 1PBUA 3DU5A 1AB8A 3BGOP 3KHLA 4QWEA 5GAHI 3CD5A 3G6ES 4O4RA 4X62F 2WZ1A 2GAHC 1HKAA 4EEYA 4WFZA 5IV3A 1IKXA 2QA4S 2ZZMA 4TKTA 4DR2F 2QA1A 4DZ6A 1JWWA 2FJXA 1XIQA 2CJXB 2FPHX 5MLCV 1WOPA 2K3IA 3GONA 2HBRB 3B4MA 3FBBA 1U2FA 3UD5A 4H4MA 1VISA 1HQEA 3TUPA 4PABA 1UEVA 1VRUB 2N7YA 2DR9A 2VBZA 2G0JA 4CT9A 1F6TA 2H48B 4ICLB 4O3QA 3FRYA 2YX4A 5IT9Y 4KGXB 1IUJA 2N3LA 2WSEC 1SV5B 4RBVA 1RLDA 1XNRJ 1S1UB 2E5JA 2ZNZA 3UD3P 3KLFA 1RWXB 1NU4A 4O3NA 1BLUA 4YHHF 1N88A 4P74A 5IM0B 4L72B 3A8KA 3PW0A 1PO6A 1E6YB 1Y5NB 3MFIA 4MTPA 3AA8A 2J6SA 4MKYA 2YTCA 1S7HA 3OFFA 1QVGR 2FY8A 2KO1A 1VLYA 4RZRA 2LXIA 4DL0C 2DD8S 3MM5B 4M5NA 2AYBA 4J9KA 4LRFA 3FBFA 3AT1B 1LFPA 3FCWA 1J5EF 1YQHA 1N4LA 3N5FA 2KJVA 4DUYF 4PPDA 2BMBA 3R5DA 4I6WA 4NWBA 3O1LA 2DY1A 2M7SA 4NMXA 1GNKA 2JH3A 1HYSB 1SIWB 3VGUA 5MAOA 2EK1A 3L4BC 2HWTA 3EMTA 1JKHA 2V9WA 5F0UA 1UFKA 3M8PA 1U2RA 4XPCA 2V6AA 5KT5A 5BXIA 3V6DA 2Q3PA 5B0AA 4DV6F 1TL7A 2W4CA 4A8SA 3W5YA 4XTTA 3FK4A 4M5GA 3EXYA 4PKDB 4C3KA 2Z57B 2BM1A 5HROB 4KO0A 5IT9U 1S99A 4OMFG 4Z7CA 1N5YA 2QLJB 2GV1A 2KU7A 3W1YC 2UUCJ 4FBUA 4DX5A 4NI2A 1F3FA 1G6BA 1WG1A 1TKXB 3P6YC 3VHQA 3GILA 2QMUB 1DQAA 1FDNA 4LSZB 2ZD1B 2XI3A 3M9NB 2OPQB 2RT3A 1MWQA 5DM6Q 2Z2LA 1FNXH 5U47A 3NMAA 2J0WA 2E5HA 1UWBB 4OLPA 5H9FJ 2FZCB 1SB6A 2XSJA 1VRTA 2UXBJ 3H2LA 1K73T 3OTBA 2DNOA 5HP1A 1TL3A 2XMTA 1NAQA 4TLQA 2GGPA 3DI6B 3ZNUA 3BH7B 2MPUA 5C2CA 4DV2F 4P72A 2CFXA 2B43A 1DFDA 3CULA 2FVPA 1M5HA 4K4WA 2N7CA 4LR9A 1HBMB 2L9WA 1Z4UA 3MEDB 5CYJA 4DEZA 1NMEB 2BJ8A 1KN6A 3IRXB 4YB6A 1H98A 1N6QB 4I7FA 3UN2A 2LQBA 2NS1B 2D41A 1VI7A 5EDWA 4EK2A 4I2PB 4KYZA 4Q45A 2IRUA 1O0PA 4RBTA 1MMNA 3GFZA 1M5PC 4UY8T 1I6JA 3B78A 3TRGA 1JQGA 1BWVA 5LJ5Y 3GIIA 3HVWA 3R7BB 3OTCA 3SIPB 2HVEA 1FT8A 2CPJA 5DGAA 5CZXA 1FJGF 4A4JA 2PGCA 4OX8A 3LP1A 4P9SA 3VAJA 4X4OA 1D8YA 4WFXA 1RT4B 3NP5A 2U2FA 2FGOA 3BZQA 2NUHA 1RHKB 2RS8A 2XHWA 5DETA 3NKYA 2W9CB 4C8YA 2FZKB 3DLBA 4ETZA 2DR5A 3N6MA 3R2CJ 4A8FA 4OJ3A 4LFBJ 1KDNA 3US5A 5ETLA 3MM7A 1XJWB 2CNOB 4MH8A 3DU6A 1RT5B 5CHCB 1H0HB 2KRBA 1Q8BA 3QAUA 4OX7A 4ZVUB 4AD6A 1HBOA 1G3OA 4OZ1A 4CLZA 1QAJA 2F4FA 1FTRA 1K1QA 4QOTA 4IH5A 4ED4A 3TP2A 2VPYB 1N8RT 4GKJF 3M8WA 1YSJA 1YJUA 3LP0B 4JI4J 3CDWA 3OVBA 3NAHA 3R7NB 4EGLA 4IOCQ 2D74B 4CWBA 3C15B 2AJQA 5ADZA 3JYTA 4U8VA 4HTJA 1HQUA 3WC2A 5DZ7A 5D3GA 2AZ1A 2IMWP 3SSSA 1UA1A 4RW9A 2FDNA 3ZNJ1 2L3MA 2JLFA 2JEGA 2NQPA 2ZBIA 5IZHA 2ZJRQ 2R7UA 3J7ZT 1MMDA 4DX7A 3BQ0A 1BQXA 3I55S 2ADBA 5KG0A 3CSKA 4Q43A 3OQ2A 3W62A 4ZIWA 2ZH3A 2Z56B 4ED7A 2QV6A 4OLOA 2KG0A 2R8KA 2W2OP 1T05A 4JI8F 1S59A 2IYIA 2W2QP 3SSQA 3OSNA 1VQ5S 3HSZA 2CADA 2Q79A 2P9CA 5M2PA 1NPKA 3BBFA 3A3PB 2M5YA 2HKEA 2K8GA 2AQ4A 4P2SA 5KFTA 4F2SA 1UMJA 3HVAA 4KGMA 1KFDA 5HATA 9RUBA 4CLSA 4DPYA 2XLJA 2HHWA 3HDSA 3OR2A 4ETXA 1JX4A 4M95A 4FXDA 1EX8A 2LVWA 3E51A 4F4KA 3ZTPA 2ROEA 3KWMA 1T8EA 2E1CA 4C3MA 2HZAA 5KTQA 4DQSA 4M5MA 4ZITA 2JJ4D 2OFHX 2FJDB 1X0PA 3V4IA 3MAAA 1PAUB 3W3SA 4ER8A 2XO7A 5HJYA 2OD4A 1ZTWA 1XR7A 3K5LA 2VF3A 1LXNA 1VQMS 4FYDA 2YH0A 2HMIA 2GO9A 4TN2A 2AYGA 2KYXA 2D9PA 2OAUA 3OR1A 3MR2A 5A6WA 4OZ0A 1FVSA 2OH2A 1F0XA 1F5BA 3E2EA 3P5TL 2FVCA 3NGSA 2E7WA 2CQCA 4P2XA 4CYUA 2DNRA 2MGZB 5LJ3Y 2UUAJ 2BACA 4PXEA 4O44A 2VQEF 2IFXA 3OFHA 3G96A 4ZPWR 5LL6d 5E3PA 1N52B 4DG1A 3GIJA 3NBPA 1HNZF 3UDCA 5F8GA 1RWPB 3P49B 2JC0A 2KM8C 3NLCA 4X84A 5HAOA 4O4GA 2YNFA 3DN9A 1NDKA 1ZM3A 2IIHA 3U27A 2DXEA 2CJYB 1JLFB 1HBUA 3EDQB 5ETNA 2H4WB 4FF4A 3D1OA 3CNQP 4LF4J 4DZDA 2WW8A 3GLJA 1IJFB 2Y1LB 4UQGA 4ED3A 5CXTA 4TY8B 4Q44A 3TAPA 2VKZG 4KE5A 2FIUA 4I69A 2O3DA 5CYQB 4P2MA 2KFYA 3CCJS 2HFVA 4Q7AA 1WHWA 3T19A 4USJC 3KLGA 2KL8A 5C5JA 1K8AT 2OPRA 4ECUA 3PX0A 3VR1A 2V8GA 2HNDB 3KHRA 2E44A 3NWGA 3TEHB 1WC5A 1OWXA 3JB9k 5J2MA 2KTQA 3EGVA 4O3OA 4NLVA 1RACB 5BJRA 3HZGA 4IO1A 2KJWA 1NK4A 3FZ2A 3O6QA 4I1TA 3SEOA 4ZCMA 4PXCA 3SMZA 3K5OA 2V2VA 1XQIA 2QA4G 1V3ZA 1L3SA 2CJBA 4UF4A 1RGVA 3HHNB 3SDEB 2HHQA 5IS2A 1Q5YA 3C6TB 3FNNA 1YX2A 3LPYA 1T9WA 1I51B 2W9BB 1CJUB 1FE0A 1S5ZA 1YVFA 1BQMA 3GG1A 3C3LA 1VC0A 4KT0C 2C2KB 4NLDA 1N33F 2VFSA 3V6JA 4RPFA 2LEBA 4M5DA 4G1QA 2ABYA 3DYAB 5DDOC 3MEGA 2RDDA 4GVBA 1TAQA 2XCPA 4AL6A 2YWHA 5LMUJ 4KHRA 4LF1A 2BJ3A 4WFBQ 3KHGA 5A76A 4O3RA 3M8QB 2B4OA 3SXLA 2YXLA 4RUAA 4EO8A 1CG2A 3M9OB 1S1TB 1HHTP 3OJUA 4H4OB 2EG2A 3KNAA 3CWJA 4MJKA 3PM9A 2MB0B 4J9NA 4JI0J 3R97A 2IDLA 1U45A 1YJVA 3MECA 4DFKA 3CJ8A 2BKNA 4X65F 4HACA 3J7YI 1VRQC 1P8GA 4ILRA 4Q8FA 5T7LB 2AF6A 5KFJA 3VGVA 5D6GA 1KNZA 2MDAA 2KZZA 1RE1B 3WBZA 2A3JA 2CQPA 3ZZTA 2C1EB 2GVZB 2X1GA 3KJQB 1AUDA 4LF7F 4A47A 2PEHA 4NLPA 3RR8A 2OSRA 2E5LJ 3MM6A 2L41A 1RTJA 1S10A 2Z8QA 1MU2A 2RDJA 5KG2A 4WTYA 2CPHA 4DV3J 4UOGA 4G1PA 1W7WA 2KT3A 4C9DA 4ZP9A 4B08A 5A8WA 3IM9A 2HLTA 3ZZYA 4NYZA 4NL5A 1C0TA 4C8OA 4KSEB 1X9WA 4I56A 2DCLA 2HNZB 3JS9A 1ZAXA 4J9UE 1IQZA 2FC9A 4L6V3 3RB4A 2DEIA 1JLGB 4RWWA 4DJBA 3EVOA 3FEYB 1SH0A 4KHPF 1MROB 1SCJB 5KFLA 4XDDA 5E41A 5ETVA 2HW3A 3SQOP 1LKZA 3UI3A 4N8OA 4UY85 2VPWB 4EBDA 1R31A 2EFOA 4CLTA 2QA2A 5AXKA 3PIPQ 2MQOA 1IKWA 3GMGA 1OSCA 4YOEA 2GQCA 2P6TA 2AWZA 1HWLA 3HHLB 5KFGA 3FEZA 3B54A 4OZNA 5GAHU 1WNEA 3VAFA 5G0RA 2E1MC 3ZTOA 5CYMA 4OHVA 1OPZA 1P9QC 2YKNA 4IG3B 1CJKA 4U67Q 2HK3A 2RHQB 4FF3A 1WTFA 1AZSA 2OIHA 5J1EA 4ZVTB 3OL9A 1JJ4A 3TUJC 3CMQA 1VFJA 4NA2A 2N4CA 5JVHQ 1HNVB 5DG8A 1J27A 3FSYA 4KFBA 2NZCA 3H5SA 1YBTA 2BW2A 4BWMA 3MAQA 2OSQA 4LRCA 2UUBF 1K0VA 1SKUB 4WPAA 2P8IA 1S1XA 2O01C 4B3MJ 1PC4A 3CJ4A 4V1Ak 1Q8KA 4GC6A 1D1UA 1V6HA 4C11A 4ZN3A 4HLBA 2RIJA 2HBYB 4OI2A 3NWRA 3L3CA 3M2RA 2FLNA 2RQCA 4ZMMA 2JFKA 4B3SF 2FZGB 1D3WA 1S1WB 2RE1A 1Q5VA 1MMLA 2A10A 2KI2A 3PFOA 2FYXA 2CQ4A 3J7Z5 4M5LA 3T1YJ 4N56A 2XMMA 4LRDA 1YWXA 3HJFA 4M1KA 1KOHA 2FVRA 1HWUA 1HQ2A 3IXQA 4NXMJ 3H0PA 2HVHA 4AYBD 1RT7B 3TX8A 4FXWA 1HWIA 2EC2A 1H2UX 1Q7YT 5EWEA 2MQQA 2J6UA 4EO6A 1XMQF 3N9UC 3RG6A 1WELA 2JX2A 2HWIA 2O5DA 3E01B 3SI8A 4DR4J 4O23A 2VB6A 3IGNA 2IVFB 4OI4A 3ENQA 4ERDA 5AT1B 3MEEA 2PI4A 2PA8D 2VDHA 2LEAA 4YR0A 4FNIA 2VG5B 3NNHA 3QSYB 2VUGA 3OUYB 4QIEA 1YBAA 4F25A 3M32A 5HMWA 1IBMF 3BN7A 4DV4J 2H65B 3G6VA 2DH7A 2UU9F 4OX9J 2WOMA 3PKYA 4B9NA 4DCOB 3Q22A 1SH2A 4FYXB 1RCXB 4ID5B 4NA3A 1LK7A 1GH8A 4FN5A 2B9YA 4DPWA 4FKYA 4CLYA 3GU0A 3U02A 4ZN1A 5EX0A 1WG5A 5I3UA 1R8PA 1P27B 1T3OA 1YGYA 3DOKA 4CLPA 5DQIA 1EP4B 3CE8A 3PCOB 1OMSA 3PJ9A 1M5KC 5H1SV 5L38A 3VAHA 3M6UA 4NLYA 4JI3J 4LFAF 4AQYF 5KFDA 4ZS6A 4URGA 4YDDB 3F44A 2B4UA 2AJFE 4I2QB 2QMWA 4Y2IA 4DUZJ 3WIVA 2UVVA 3PV8A 2HVIA 2BDPA 2MQ8A 1J5OB 2MQMA 3OW2R 3BGUA 4HL9A 4DCJB 3KMSA 2H3EB 4LSLA 3MZIA 3PEJA 4HTIA 3CIMA 1LW2B 1RBLA 1X0FA 4EMDA 3NMRA 3O44A 1WDDA 4DLEA 1NEEA 3HT0A 1X4CA 3NOGA 1FD2A 2JDJA 2VA2A 4HT7A 4BWJA 5J2QB 4YMEA 5I42B 3OVAA 2F8HA 4RW7A 4OYBA 3ZXWA 5HQ8A 4DR6J 4DR3J 2CNLB 1T95A 3W9IA 4DN9A 4G3IA 2CQGA 4C8ZA 3SFUA 3E3XA 2DH8A 4OI0A 5F9LA 2J7UA 4ICLA 4DFJA 2PC6A 2M9KA 4OHXA 4F0KA 3LA0A 4L73A 4HYKA 3TQ1A 5JJBA 4B3TF 3OHAA 2W7AA 1SV5A 3ISND 3EZOA 4QU7A 1S1UA 2HGMA 3C14A 1WC6A 3KFWX 4FF2A 4EU0A 4X66F 1KEKA 3MOJB 1QVFR 5LMNJ 2C2MB 4PR6A 1C1CA 4DPUA 5IM0A 2ZH1A 4FKXA 4UQTA 1E6YA 2W24A 4WCEQ 2MQPA 4KPCA 1N5SA 1HLWA 2XMUA 3MM5A 1JXLA 1HR0F 1FXDA 3Q86A 3MR6A 3ZTQA 4URSA 3BPSP 2CNNB 4F26A 4F4AA 4J9MA 4NLGA 5KFKA 5ETSA 1TP7A 4DFMA 5GMDA 2XMJA 2ROPA 2QN6B 2RMLA 4W98A 1HYSA 4NLSA 4RU2A 2IY5B 3O2IA 2UXCF 4ZJLA 2ZH7A 2VD3A 4FPIA 4RL1A 4DR5J 4WE1B 3HLUA 2FLOA 4F2RA 3AA9A 2ZM6J 2PI5A 4CTAA 5IV4A 1XNQF 4KV8A 4J9OA 3PRDA 5HROA 4L3KA 3OTOJ 4U96A 5K8MA 4FS2A 2BJ9A 1AA1B 2R7QA 3BDEA 4K59A 2F9JA 2V5HG 2W2NP 3KG1A 3MEKA 4Y2AA 3KLFB 1TKXA 2DH9A 3FZBA 4JI2F 3Q8YA 4QR2A 3V6HA 1GMWA 2PMZD 1UFLA 2R8IA 3G8QA 1JLBB 2V8DA 1RISA 4ECQA 1JB0C 2ZC3A 1ZYQA 3OXFA 1N36F 4Z7YA 5EX3A 1UWBA 3Q8UA 1T0TV 2XWYA 3A3OB 1RT3A 1APSA 3CDAA 4O3PA 2HIYA 3RW7A 5I3QA 2DR7A 2V4JB 2C3MA 3CJSA 2CQ1A 3DI6A 1U25A 1U1MA 4ELVA 2FJAB 1S1VA 2C22A 3CT9A 4FP9A 5CH7B 4ZPVR 3M8PB 4NLTA 1HBMA 2CUYA 4YR3A 3V6DB 2AT1B 1JXEA 4ECWA 3VZIA 1S6UA 4OZ3A 3DLHA 2I0XA 4YS2A 3KLHB 1YJ9S 3IRXA 1YHQS 5AE1A 2DHGA 2E1AA 4KO0B 5J2PA 4QYZJ 4B9VA 1YJ7A 1KLNA 3LTOA 1IJEB 3KK3B 3ADAC 3MF5A 1IVZA 4I2PA 2WVEA 4ENOA 3HFKA 1QD1A 2G4BA 3NCPA 3VGTA 2YBVA 2MQLA 4B9MA 2F65A 1QJHA 4RR5A 1V9OA 4LIRA 5AXLA 1QTNB 1U6FA 4UOCA 2QL5B 4RW6B 3QO9A 5KFRA 2E1PA 2K2PA 2MEWA 2MLYA 4PWWA 3I32A 2Y9HA 1F60B 2W4DA 4NLWA 5CABA 1VRTB 1RT4A 3MAHA 4ZIVA 1KC8T 3D67A 5DLFA 3T3FA 2GGPB 3Q83A 2W9CA 1PJ6A 2R9LA 1EJ7L 3HHLC 4KTQA 4WK3A 3QFHA 2YH1A 2EWHA 3VF0B 4C8NA 2FY1A 1U8WA 4DSFA 2J76E 2JZ5A 2PFFB 1FD8A 3D66A 3GSIA 1WOSA 1RT5A 1FFSB 4A8YA 4HDHA 2BABA 1RU1A 1GMUA 1XNRF 1HL6A 2WRMA 4K4ZA 4I7FB 4RW8A 2AEMA 3WQPA 4MFBB 3EE3A 4I64A 5FDLB 2LFVA 2OMOA 3QGGA 3KYLA 3WX8A 4CH7A 1T02A 4C8LA 3H59A 2QFJA 2JEJA 3AAWB 2ROGA 1FRMA 3GIMA 3KDNA 1SJQA 3LP0A 4B02A 4PYDA 4JI7J 1LOUA 1A0OB 1SL2A 2DIVA 5ETPA 4KJIA 4KQZA 2WB4A 1RI7A 1WI8A 2QJ3A 2VFUA 1TR0A 1UZHA 2CG8A 3SCIE 4GC7A 3KK1B 3LP1B 4DV0J 1H72C 2MZSA 3K89A 1FDBA 4USWA 2EEYA 3QATA 2YQ1A 5HJXA 2I5JB 5L1KA 2JLEA 4KGVB 4ELTA 3NS7B 5THWA 1SC1B 2VOOA 3FMBA 2HPUA 1U1KA 3LGMA 3MPWA 2UUCF 1F2HA 2ACMA 5KFZA 5HMYA 1OY8A 4GMKA 2C2EA 2UVRA 3OD2A 3KXDA 2DJWA 3DLLQ 4KKOB 2WAQD 3V5RA 2NUUG 1Y10A 2RHSB 3D0GE 1QAYA 4P75A 1GTEA 4MK9A 2ZWPA 1VQLS 1ZAVA 1VK3A 1U1RA 4DQRA 4ZVQB 3C2PA 2CJAA 2KYZA 3KJFB 2UXBF 3JYTB 2LECA 2V67A 1JLQA 1HQUB 4X4UA 2CZVC 4K0KJ 3C46A 1RWOB 3IR7B 3PW7A 2AW0A 5KG1A 4DDFA 2ZVSA 1GX5A 4RLEA 2P9EA 1UEKA 2CQ2A 3ZZOA 1NXIA 4JV5J 1XK8A 1NKBA 2HIQA 2BYCA 3RTVA 1CPZA 1Y9OA 2XY6A 4L76A 4DFPA 3GV8B 2WVDA 1X4HA 4QR0A 4K5SA 4N41A 3J7YU 2C42A 4PRFA 3NG8A 4RJVA 1KP6A 2CA9A 2C3YA 5JMNA 2YNIA 2VJUA 1BE4A 4Y28C 2NSBA 3EM1A 1VDHA 3CCSS 1SVDA 2R2UA 2NZ4A 2QLFB 5DJBA 1R6YA 2AZ3A 4PG7A 4IG0A 2GMJA 1M1GA 4ITSA 4YB1P 1ZA1B 5KOXA 4E8UA 2B56A 3VALA 2Q1LA 1N48A 3QMQA 4LF9J 1K1SA 8AT1B 3UR3C 2DIUA 3CF5Q 1GAOA 5KFMA 3AJ1A 2CAJA 3HK2A 3MAAB 4UZBA 2HFZA 4TY8A 1R0BG 1OYEA 2ZWOA 5D4NA 4ZPBA 3BDPA 1EQMA 1JMTA 4AL5A 2FHKA 3BSOA 5CAAA 4BDPA 4DI6A 3D5MA 2HMIB 1NK5A 3K5MA 1FCAA 4EZ6A 2HNDA 5ETMA 1SKSA 2W1BA 2ZBPA 1WKLA 5RUBA 5BYRA 3KK2A 4K4XA 1Y0HA 4Q8EA 3ULHA 1X5SA 4QWAA 3AXMA 4GO5X 3G4SS 4O44B 2DKOB 2VJVA 2Y0SD 3NBPB 3LH2S 1GEHA 4ELUA 4QU6A 3IP0A 2JSXA 1MLAA 5KFSA 2BQRA 4TVAB 1AXQA 4C48A 5G4DA 2KH9A 4JV2A 3CCLS 1HBUB 1RWMB 1YZ6A 2XS7A 4CO1A 5KT4A 1NCLA 1Q82T 2QGFB 4FYVB 5K14A 3SDEA 5K20B 3C6TA 2ILYA 4Q5VA 3RAMA 4F7VA 4B3RJ 3RYLA 3KLGB 1RTHB 1AROP 1EAYC 2H54B 4CLKA 5KFAA 1WHYA 1WORA 2MJUA 1B7YB 4NLUA 1VLOA 5DZ6A 3DYAA 3SFGA 1FE4A 4O3SA 3JTNA 5KFBA 3DXSX 2ZBCA 3AJ2A 3M05A 3H42A 5CD4H 1RAOA 5L46A 1FWPA 3BGRA 5DO2A 4ZCIA 2FLPA 3ICLA 3M8QA 1CJVA 1WC4A 3CTRA 5CCMA 1PJ7A 5KFVA 4PXDA 4WYLA 4H4OA 2KT2A 3BYPA 2EFGA 5DLGA 3BQ2A 1H2VZ 4JYAF 3TO8A 1P6TA 3R1HA 3MR3A 3BS9A 3X1LB 3QIPA 1S72S 5T7LA 2YY3A 2M88A 1SJ3P 5L8RC 1O8BA 3DRSA 3TJ9A 3CJ5A 2UVUA 5B08A 2F4VJ 1D8ZA 2QYGA 4I6AA 3GB0A 3KHHA 5DGBA 3GP9A 1OYDA 2GQQA 1BQMB 4A46A 2ZH5A 3UVJA 1FTCA 1LWEA 3HKWA 2UUAF 4MKVA 1EZZB 4Y6IA 4K4SA 1NH7A 4M5DB 4G1QB 3ELHA 4PQAA 3DM2A 4OJ1A 1OPIA 5EN1A 1LQ9A 5HVFA 3MEGB 2Y1IA 3BH6B 4NYPA 2GJ2A 1IBLJ 3FJ2A 2DNNA 2GCFA 4RO0A 2XCAA 5D4PA 3TARA 4R5PA 2VPXB 3NNAA 2ILZA 5IOLA 4QIWD 2E9ZA 4LF8J 3TAMB 2JNJA 4CLFA 4LF4F 3LP2A 2R7XA 2DCUB 4IOAQ 2YWGA 2YX7A 1WSRA 1MROA 1Q8LA 4RW4A 1NNDA 5A8KA 3MECB 1N5VA 1RCOB 2CVEA 3HXMA 4USVA 4YP3A 3DOMB 1IM6A 1C0UA 1S6OA 4QPXA 3HO1A 1FKOA 4OZ5A 4IH6A 2Y0BB 3DRXA 1AW0A 4OYZA 3ISZA 4QZVB 3S6EA 5HL7Q 2YNGA 2W7PA 5B0BA 3IAS9 4MAKA 2V94A 2POKA 1HA1A 2RQ4A 1ZH5A 1KTQA 3MM6B 4A8MP 3HZEA 2QG9B 1RTJB 1WACA 2VG7B 1MU2B 1QE1A 5BR8J 3UPFA 2VZ9A 2LCWA 4GO7X 4LFCJ 3GJTB 4GRSA 2M3DA 2OEKA 1KHWA 1NZAA 1U24A 2HZCA 3ZZZA 4CO4A 3S8SA 2FJEB 2K1RA 4J9VA 1PJ5A 1GFWB 2MSTA 3RJMB 1UL3A 3MPVA 5KG6A 1T03A 2KHCA 4OYIA 3W8GA 5B7WA 1FI4A 2QSWA 4IUFA 1HNVA 4IRCA 3FGVA 2E29A 1HI0P 2KB2A 3RZAA 3TZXA 3QZ7A 4X4NA 3CO0P 4CCHA 4LFAJ 4AQYJ 4DX6A 1OQ3A 3QSIA 5L9XA 3Q8SB 5ETTA 1PCAA 3CCVS 1GTHA 4WZQA 3AD7C 1UZDA 2LQ9A 3PYFA 1S1WA 1Y3JA 3W5ZA 3H20A 3WZ0A 4K4YA 1U1LA 2F3JA 2HFNA 2CYYA 4NRTA 2VIHA 5LMUF 5LXRA 3CB4A 4LF6J 2YKNB 5KFPA 2VOPA 2ZH8A 1WWHA 1SC3B 2YKQA 1CS4A 1VJWA 2XULA 4C7QA 2B9XA 2GW8A 4U7CA 2PEBA 5HQLA 2BKPA 1AZSB 5CQGA 5J1EB 3RW6A 1SXLA 4JI0F 1W25A 2OO4A 1RK8A 2MXYA 1TAUA 2CQ0A 3FCHA 2QEXS 1CVJA 4ZP7A 3MOZA 2XSFA 2RU9A 3MPUB 4YB5A 1PSDA 2BANA 5DQHA 3HHLD 5K8OA 2BJDA 2QL7B 3OL7A 3CPWR 2VG6B 3G82B 4OV1A 3I0RA 1S1XB 1LFWA 4XPEA 2WSFC 2R2TA 3V2UC 2E5LF 2G2YA 3HM9A 3JXOA 3OUYA 4USIA 1WD6A 4D3GA 3M2RB 5KFOA 4QJVA 4ED8A 3RBZA 1MSWD 1VQPS 5E3AA 4F3QA 2M70A 4HHHA 4DV3F 3PZPA 1XMOJ 1U1PA 3GIKA 1DTTA 1RT2B 1O51A 4ID5A 4CI0B 4NZ7A 3QIDA 3UNYA 1BQNB 4ZVGA 4WFAQ 2D3UA 1IBKJ 2UXCJ 2FD2A 5LT5A 2AEFA 3TEGA 3J81Y 7FDRA 2DNLA 3DLJA 1KLMB 3CCRS 1EP4A 2B6AB 5FLXY 3PX4A 4DR7J 2YQ3A 2B5JB 4KRWA 4PYAA 4NRUA 1MN7A 3MUVP 2ZZNA 3OJSA 5D0RA 1P1LA 3G9CA 3QGPA 3G71S 4ANEA 4ES3A 4MT1A 4P6QA 1U26A 4PG6A 3MEEB 2GC8A 3FBEA 2LEPA 5M2RA 1X9SA 1J5OA 1ZOTA 3BGFA 3NRBA 5GMEA 2HAFA 4TU8A 2X1AA 4X64J 1RKJA 1PC5A 2O67A 4JI6J 4MIBA 1G1XA 4Q0BA 3C66A 5B09A 1QAXA 1RT1B 1OY9A 5H9EK 5I42A 4WXWA 2XBPA 4QPTA 4ZP8A 4P73A 1UAWA 3IG1B 3NY0A 2B0GA 4F04B 2HQFA 2XMVA 2ZNYA 5F9NA 3HKZD 5I3UB 2LXUA 3V4MA 2ZH2A 2K7KA 5FLXU 1CC8A 5EWGA 4WP3A 2WBRA 1ZBTA 4USMA 2JFDA 1R3NA 2G1DA 5KT7A 2CQDA 1NKCA 4G1IA 4NZ6A 4I4BA 1Q0NA 2V34A 4ZVRB 2IHR1 1PYTA 3DRRB 4HT5A 3JAMY 2PA3A 4Q2MA 5E2QA 3Q2TC 3IO1A 3W7BA 5B0GA 3NGDA 4LSLB 5B0EA 3J7A1 5EWFA 2FHOB 5J2NB 1B0TA 4ALZA 3NL0A 4LBHA 4QQBA 3T1YF 4RUCA 3DDKA 2DYAA 5KFYA 3N6NA 4GVLA 4RW7B 3M1VA 3CC2S 4NXMF 3HHEA 1VQ8S 3CW2C 3M2VA 4WE1A 3FC9A 4ZVEA
chains in the Genus database with same CATH topology
2XB2D 2IM2A 2HQ3A 2XMMA 3I9V9 1YWXA 2BV3A 4DHVA 4QWCA 1VQNS 4M1KA 3HJFA 1KOHA 2FVRA 1YJNS 2AGOA 1HWUA 4I67A 3PDNA 1RYSA 2B4PA 3PFEA 2QLXA 2V2KA 3JSMA 3IXQA 2ZH9A 1VBZA 2E9TA 1KS2A 1DJ0A 4CO2A 4YUDA 1R8AA 1XEZA 2IA0A 2HVHA 1SKRA 4AYBD 1UW4A 1RT7B 3S1TA 2DBBA 2HNZA 3IWXA 3TX8A 4ED0A 3BR8A 2CJQA 4DR4F 4FXWA 1HWIA 1TK0A 1CC7A 4K4TA 4NCAA 4WF9Q 5B0CA 5HBMB 1OIAA 1H2UX 3Q8PB 1Q7YT 2CKWA 5KT6A 5KG3A 1K9MT 1QAIA 2LMIA 5LSRA 5EWEA 2MQQA 1SJ4P 2B9WA 3C8YA 2J6UA 3V81A 2XNRA 4CNZA 4EO6A 2R4FA 5C42A 3M2UB 1XMQF 1JLGA 3N9UC 1X4BA 2VODA 1QLNA 1NO8A 4A8WA 4K5RA 3IWLA 1WELA 2A1BA 2ATLA 2JX2A 2HWIA 2FB0A 2O5DA 4DV7F 1C1CB 3ETOA 3FFIA 1NJYA 3E01B 2AV5A 3SI8A 2J5AA 4HH0A 4DSEA 4O23A 2VB6A 3IGNA 2IVFB 1C1BB 4OI4A 3TVZA 3ENQA 4QWDA 2DO4A 5C25A 5D4OA 3OFGA 4R0JA 1VIXA 2MQNA 5J1PA 1JK9B 1JLBA 2IJNA 3V6KA 2DGOA 4ERDA 5JUMA 2W9AA 2HHPA 5E5NA 2DGVA 4D3HA 4PG5A 3MI7X 3EYZA 3KJVB 1KQSR 2B7CB 1X4GA 3MEEA 4DMZA 3EZUA 2PI4A 2HHHF 1IQTA 4QR1A 2PA8D 3K8VA 3VCDA 2LEAA 1TUVA 4YR0A 3EUNA 3MD1A 4JI1F 4DV4F 2HNYB 4ZCLA 4FNIA 2VG5B 2LKZA 4OX9F 3NNHA 4N77A 1UKUA 3KLIA 4LSNB 2E1RA 3IC1A 2R7TA 3GYXB 4IYQA 3MR5A 2XY7A 3KNGA 3THPA 1XR6A 2VUGA 2GQ2A 2N82B 1RWUA 4FXVA 3OUYB 4QIEA 2FJVA 3THVA 1YBAA 4DX8H 2ZOMA 5ITHA 2OP5A 3OXLA 4F25A 2MKHA 4PG4A 4J9PA 2V4JA 3M32A 3RRHA 1E6VB 5GAEI 5HMWA 3BR9A 3DGPA 3L7OA 1IBMF 2V4RA 3BN7A 1RTDB 2IBOA 3G6VA 4IFYA 1S9FA 2DH7A 3HHLA 2UU9F 2BA9A 3M6XA 3SCKE 3UE2A 2J7KA 3Q2SC 4R8UB 2WOMA 3BF4A 1SL1A 3PKYA 4ED5A 3H5XA 1NJXA 1NB7A 4B9NA 2DGQA 3TR5A 3Q22A 1SH2A 2APOA 4RNMA 2QE5A 2NR0A 2CZ4A 2HYIB 1YJRA 2ZJPQ 4ID5B 5B0FA 4IG3A 2Q66A 3I4PA 5L39A 4KIAA 4NA3A 1LK7A 4HH1A 2ZH6A 2BBEA 5L1LA 4OI1A 1FJ7A 3DMJB 4FN5A 2ADCA 1G2EA 1GH8A 1F5AA 3KKFA 2B9YA 4U7UK 5A8WB 2V9KA 3GR1A 4KC5A 1FK9A 2FTRA 2L9NA 3VAMA 1R0AB 4CTAB 3KLHA 1Q78A 2LU2A 1NK8A 4NLXA 1N5QA 1C0TB 3U02A 5EX0A 1S6QB 2AX0A 4KV8B 2BR0A 3JSYA 3KG0A 2R7VA 2BE2A 5EUHA 2G9OA 3R1LA 1WG5A 4ZVFA 5I3UA 1R8PA 1P27B 1M5SA 1T3OA 1YGYA 3DOKA 3S01A 1Y00A 3TUZC 4ECVA 4JI3F 1O5JA 3I31A 3KK3A 3LANA 5DQIA 3POTA 4K4UA 1EP4B 3CE8A 2XC9A 2C3UA 4CQ1A 2DHXA 2Y1JA 2GA7A 1R8BA 1M5KC 2LDIA 4DS4A 4EBCA 2HVZA 4ZA1A 2JEFA 5H1SV 3K0JA 4OI3A 5L38A 3BO2A 1B0PA 2GHPA 3VAHA 3X3UA 1H38A 2DO0A 5A0YB 3M6UA 4NLYA 5IT4A 4N8NA 4LFAF 2AD9A 2CPIA 4AQYF 5KFDA 4ZS6A 4DUZF 1Q86T 3GG0A 2EI5A 3VAGA 4URGA 4YDDB 3F44A 2BUNA 2JLGA 1FNOA 2B4UA 2AJFE 3LGNA 4NCBA 2ZUGA 1B7FA 3RB3A 3FVYA 4I2QB 3UD4P 4EBEA 1GXTA 3GYNA 1TKZB 5KAKA 3MMCB 3KLEB 3EGWB 4CIOA 2QMWA 3T9NA 4RW6A 1F9FA 3WC0A 1RT6B 4B9TA 4Y2IA 1G7CB 5IWAF 4H4KC 3MURP 1RTIA 1Z2LA 2QSFA 3FQKA 4ES1A 5GADI 1HBNA 3RRKA 3EX7B 3VQSA 3BB5A 2D9OA 3PV8A 5DG9A 2UVVA 2BDPA 4B9SA 2HVIA 1J5OB 2ZHAA 3U1NA 3P96A 1TZ0A 1IKVA 3RU0A 5DDRC 3QYYA 5F8MA 2MQMA 1SQEA 2BM0A 3OW2R 1IKWB 3ITHA 2DNGA 3BGUA 3DLEA 4HL9A 4TU7A 3KMSA 4J9LA 1QSYA 4LSLA 3MZIA 2JEIA 3PEJA 3VAKA 4HTIA 4BC9A 1RT3B 4IFVB 4DR6F 5L1JA 2QZ8A 3CIMA 1LW2B 4X4RA 4DR3F 4N5SA 3RAQA 1X0FA 3NMRA 5HMXA 3O44A 4DLEA 4EZ9A 1SUQA 3DLGA 1NEEA 1TV6B 4UW2A 3Q24A 2YWFA 3CJ3A 3EPGA 1X4CA 1LW0A 1S1VB 3JTPA 1UVNA 4QW8A 2I1RA 3IS9A 1KVIA 1FD2A 2JDJA 2VA2A 4HT7A 4BWJA 1XTZA 4NCGA 5J2QB 4YMEA 1HD0A 5I42B 5G0RB 3OVAA 2F8HA 3CVKA 3N01A 4RW7A 5HQ8A 5CYMB 3I5CA 2M0GB 2I8EA 2DVIA 2DITA 1VQOS 1T95A 1XBWA 2L48A 4DN9A 4G3IA 3OHBA 1Q79A 4WIIA 1HHSA 1GXUA 2XNQA 2CQGA 2XZWA 2MKKA 4C8ZA 3SFUA 4DLGA 3E3XA 1SJFA 2DH8A 4ZVHA 4OI0A 5LXYA 5F9LA 2J7UA 2ZJQQ 4C0BA 1WG4A 2UV8A 4ICLA 2CJ9A 4DFJA 2PC6A 3DC2A 2FJBB 5T41A 2M9KA 1TK5A 5FD1A 1AFJA 4OHXA 4C97A 5DQGA 4F4WA 2AYEA 2VC0A 4MIWA 4HYKA 4RBUA 4RNNA 3TQ1A 5JJBA 1H3DA 1KD1T 4B3TF 5J2PB 5LMNF 5AXMA 3G8TA 3OHAA 1RT7A 1DBDA 1TKTA 4MFBA 2W7AA 1SV5A 2COLA 5FDLA 3ISND 3BO4A 4QU7A 2IC3A 5HBMA 4WZMA 1BGXT 2C2DA 1S1UA 4FPRA 2J0XA 2QLWA 3BSCA 2HGMA 3BO3A 3B8HA 5K5MA 5I4MA 3BSAA 2ZC4A 3W2WB 1YG0A 2XMKA 5FIIA 5IQ6A 2W8LA 1S79A 3KFWX 4FF2A 4EU0A 3M2UA 4DBQA 4KB7A 1KEKA 4X66F 3AQPA 2FHMA 1JLCA 4FNHA 3T5JA 1QVFR 3MOJB 2J9EA 4I6YA 1UVMA 2GIRA 1S9EB 4PR6A 3R5CA 1C1CA 3CUNA 1LWCB 3E01A 1XERA 5IM0A 2ZDPA 2ZH1A 3ZZRA 2IVMA 2YKMB 4UQTA 2V4QA 4KFBB 1M5OC 3IWNC 1E6YA 1FRHA 2J9CA 2RSQA 4LVOP 1JIHA 2ZOFA 4WJBA 2W24A 3IFEA 4WCEQ 2MQPA 1N5SA 1DAXA 3TANA 2RU3A 3DDNA 2RJZA 3Q0AA 2QIFA 2XMUA 1OSDA 2AP6A 4AXIA 4FVMA 3KJVA 2C28A 3MM5A 4A8QA 1JXLA 3ZC4A 3S7RA 3EZ5A 3CD6S 4LQ9A 3QO9B 5D78A 3T6BA 5IT0A 3DRPB 1HR0F 2HAIA 1FXDA 5J1NA 3MR6A 2IM3A 2VG5A 3KK1A 5E3RA 4URSA 3CMAS 2WHOA 4C11B 1Q16B 4DV5F 3QGHA 4F26A 2QO3A 3HT3A 1S6PB 4ZDNA 2RF2B 4J9MA 3PX6A 3OLAA 4NLGA 5K8NA 4ZLPA 5KFKA 1E6VA 2H9ZA 3PR4A 1TP7A 2VFTA 1HNIA 4DFMA 3H2VE 4DR5F 3MGJA 3NCRA 2XMJA 3FQLA 3PJWA 2IJFA 3N5BA 4ZPTR 2ROPA 6FDRA 2I5JA 3I56S 2LXFA 2RMLA 3OL6A 2UUTA 1HYSA 4NLSA 1U6BA 3OV7A 2ZM6F 4RU2A 1VC5A 1IKYA 4HHJA 3T9ZA 3CCMS 4NPOA 3FMWA 3O2IA 1LXJA 4B17A 4CNYA 2UXCF 1BD6A 2JVRA 3HX9A 4DN0A 2DGSA 2VD3A 2ZH7A 3NNCA 4GKKF 2RKIA 3OTOF 2SXLA 4WE1B 1M90T 3HLUA 2R2RA 2MHEA 1DLOB 2FLOA 1BWEA 3DMJA 4F2RA 2DK2A 2CPEA 3AA9A 1ZZFA 1R0AA 3CCTA 2PI5A 4CTAA 1XC9A 2ASJA 1XNQF 4LT6A 1Y5IB 4DQIA 4KV8A 4J9OA 3PRDA 5HROA 4IOBA 4C3LA 3U1MA 4RW8B 5K8MA 4FS2A 1Y7PA 5KFXA 1FHTA 1HNXF 4KKOA 1WF0A 2R7QA 1Q53A 1ZM2A 3BDEA 4HI2A 4K59A 4PWUA 2F9JA 2V5HG 3TA1A 1L3VA 1W2IA 3CDBA 3N28A 3KG1A 5HMZA 1QTMA 3MEKA 2PN6A 3G6YA 2GJIA 3O8WA 4Y2AA 3KLFB 3V81B 2ZOGA 5C42B 5DDPC 3CDEA 1TKXA 2HHVA 2DH9A 1YI2S 5A0YA 3FZBA 4JI2F 4PG8A 2CPZA 4QR2A 3V6HA 4PPZA 4EWTA 2ALZA 2MSSA 1KRPA 1ROFA 2PMZD 1UFLA 1URRA 2R8IA 3G8QA 2PD1A 4TNOA 5C25B 1JLBB 2V8DA 5F3TA 4PCQA 3SYZA 1RA6A 1RISA 4I2QA 1RAJA 2CPYA 3D1HA 3QWUA 2AX1A 4ECQA 3DNCA 4H54A 1MWYA 2F7VA 1JB0C 2VFVA 4USHA 1H6KX 2ZC3A 4DSIA 1RT6A 1ZYQA 4DL3A 3PW2A 3OXFA 2G13A 3GE9A 4URQU 4YFUA 1N36F 3FEXB 3U7JA 2MKSA 2MZQA 4A48A 5EX3A 1UWBA 2VA3A 5K8PA 1U1OA 3KLIB 3LO3A 4C8KA 2IMOA 4AXJA 2XWYA 4KAIA 1ZPVA 4F3OA 1HFEL 2PT0A 2Z4PA 2HHXA 3H4DA 2X1FA 1RT3A 1WEYA 1LW2A 1APSA 3CDAA 3GV5B 4O3PA 3RW7A 5I3QA 2DR7A 2HS4A 2V4JB 3M32B 2C3MA 3EGNA 2CQ1A 3DI6A 2NPFA 5A8RB 3NGKA 1U25A 1U1MA 4ELVA 2FJAB 1S1VA 3T5HA 2C22A 3CT9A 5KG4A 3OTDA 2WOMB 4RNHA 2JOQA 3EXCX 2WTFA 2J8AA 2KRRA 2UUWA 4FP9A 4EYHB 5CH7B 5J2QA 3UNGC 4KPYA 2KXHA 4I0WA 3D2WA 4ZPVR 2BOPA 2L08A 2VKRA 3M8PB 2R2SA 4JBCA 4NLTA 3G8SA 1U1QA 1Q8IA 1HBMA 3MHYA 1VQYA 4YR3A 3V6DB 1VQ4S 1R89A 2RDIA 5KT3A 1JXEA 2GX8A 2C3PA 2KXNB 4ECWA 1TVRB 3VZIA 1NK6A 1JJHA 1H2TZ 5KFHA 1D9AA 1S6UA 3HVTA 1BY9A 2MZRA 1X4FA 1DURA 2RRNA 4MKAA 1TFWA 2HRUA 3IN5A 4B3OA 3HVRA 3DLHA 2R7RA 1S77D 2QT7A 2I0XA 2VBXA 4OHYA 2XY5A 3KLHB 2NXUA 1YJ9S 3A1YG 3IRXA 1YHQS 4N76A 2AYMA 5AE1A 2D3ZA 2NSCA 2OTLS 2O1PA 2DHGA 2E1AA 3P3DA 4KO0B 3D1QA 1MNEA 2BE2B 3UW1A 2MKIA 4FS1A 2MMYA 1ZTTA 4B9VA 2WBMA 4QYZJ 1KLNA 2YKAA 2WK4A 3SSRA 3DOKB 1IJEB 1Y5LB 4PXBA 3KK3B 3MF5A 3POTB 4ZP6A 4I2PA 3CCQS 4ED1A 2W25A 3HFKA 1GQEA 2JVOA 2G4BA 4Y34A 2KXFA 2HS3A 3NCPA 1Y3KA 1XR5A 2MQLA 3PJXA 5EGYA 4NA1A 2W4PA 2B3TB 2KM8B 4B9MA 4KBIA 4ZCKA 5DM7Q 1QJHA 2EFNA 3LOUA 4B3MF 2YKMA 2PIIA 4OX6A 1V9OA 1FF2A 4LIRA 1VC6A 5AXLA 3MMJA 2R7SA 2M52A 4K4VA 2W7OA 1FRLA 3CC7S 3HPOA 3K8WA