1SJ3P

Hepatitis delta virus gemonic ribozyme precursor, with mg2+ bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Hepatitis delta virus
molecule tags Translation/rna
molecule keywords precursor form of the Hepatitis Delta virus ribozyme
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sj3P00
2MKHA 3CCVS 2DGXA 2QA4S 3CCUS 2DNHA 1HL6A 2DH9A 2DNPA 5DDRC 4PKDB 2K8GA 2SXLA 2KM8C 2XB2D 1U1QA 1WG1A 2AD9A 1FJEB 3THTA 4F25A 2CPHA 2N7CA 2MQNA 2MSSA 4CH1A 1QVGR 3CMAS 2MQMA 3LPYA 5LJ5Y 2CPJA 2MZJA 3J7YU 2HGMA 4WIIA 2CPXA 2CPDA 1U1RA 3EGZA 4OZ1A 5DM7Q 1KOHA 2F9DA 5MLCV 2MQPA 3CD6S 1X4CA 2HGNA 2M8HA 4FXWA 1RKJA 3UD4P 1YJNS 2RS8A 4YOEA 1NU4A 4IO9Q 2CQ3A 4Y00A 4WFNQ 2YH0A 5HL7Q 5JVGQ 2MQLA 1KOOA 2J0QD 1WHXA 1X5SA 5BJRA 3CCRS 2CPFA 1VQMS 5DETA 2KH9A 2DGQA 1SJ4P 2LCWA 2KFYA 3B4MA 1W2BR 3MDFA 2KXNB 2KU7A 1VQ6S 2JWNA 2YKAA 4YB1P 1X5TA 2U2FA 1S72S 2FC8A 2ZJRQ 3UCGA 2DGVA 4TU9A 4W92B 1ZZFA 3MXHP 1UW4A 4IOAQ 2MZRA 1FJ7A 2MXYA 2CQ4A 4ED5A 1U1MA 1UAWA 2L08A 3S6EA 3MUMP 2XS7A 2O3DA 2GHPA 3P3DA 1B7FA 1CVJA 2KXFA 5DDOC 1VQ7S 3CC2S 3V4MA 2F9JA 3I55S 1X4EA 2KN4A 2KG0A 4A8XA 1WEYA 2LQ5A 3THPA 5DDQC 2JX2A 5FJ4A 2DK2A 2D9OA 3B4DA 5HO4A 3S8SA 1X5OA 2FHOB 1M5PC 2I38A 4LJMA 2KM8B 1YJ9S 1WHYA 3CCES 1K8AT 1K9MT 2DNZA 3MOJB 2DO0A 1R8PA 2BOPA 3FEXB 3VAKA 2YTCA 2KVIA 2OSQA 2NZ4A 2MGZA 2FC9A 3G96A 2LEAA 2L41A 1VQKS 2GO9A 3MD1A 2DHGA 2DGTA 1D9AA 3CMES 2XS5A 1FO1A 2EK1A 3NS6A 2MB0B 4PR6A 2MQOA 2VOPA 2E5JA 5DDPC 2OTLS 2DNOA 2VODA 1N8RT 1JJ2R 1HD1A 1SJRA 3CCQS 5LSLA 3G6ES 2CQGA 1QVFR 2RVJA 2DNYA 1FJCA 2QFJA 3TYTA 1X4HA 2MQQA 5LXRA 1X4DA 2MZ1A 2RUGA 3VAHA 1KC8T 2ZJQQ 4UY8T 3U1MA 2LYVA 2NLWA 2PEHA 2M70A 5GADU 2J0SD 3OW2R 4CQ1A 1NO8A 1U1NA 1DBDA 1WELA 2LXIA 2HGLA 2CQCA 1SJFA 1X4AA 1YTYA 2KXHA 2KG1A 1HA1A 3UE2A 2L9WA 2RQCA 2DGUA 3TP2A 4PRFA 5IQQA 3R1HA 5LXYA 2DHAA 2PE8A 2MGZB 3TO8A 3DLLQ 2KRRA 4IUFA 3P49B 1ZZNA 4OZ0A 3RW7A 4TLQA 1Q81T 2CQPA 4WFBQ 2CQHA 2KYXA 3BO2A 2Q79A 1AUDA 2X1BA 1SXLA 1U6BA 2E44A 4WCEQ 3IRWP 1YI2S 2LXUA 3SDEA 1WHVA 3G71S 1NJIT 3I56S 3NNAA 2ERRA 3MD3A 3Q2TC 2CPIA 2CQIA 3L3CA 3CXCR 2DNRA 1PO6A 1SJQA 3NNHA 2KHCA 4QPTA 2DH7A 5D77A 1U1OA 1Q82T 3VAGA 1D8ZA 3VF0B 1WI8A 5CXTA 1X0FA 3NNCA 2LKZA 1ZH5A 3UD3P 1YITS 2MMYA 3CCSS 2CPYA 1K73T 3G9CA 1S79A 1VQ9S 3D2WA 2BZ2A 1WG5A 2CQ0A 3EX7B 1YIJS 4RU2A 2N82B 2XNRA 4F02A 3VAMA 3UCUP 2A3JA 1P1TA 2M2BA 2DGWA 4J5OA 4LMZA 2MY7A 2RT3A 2U1AA 1M90T 2K3KA 2RS2A 5LSOA 2M4MA 2MJUA 1UP1A 1WI6A 2X1AA 3IWNC 3S01A 2VONA 1FNXH 2G0CA 1M5KC 2DNGA 2WBRA 4M5DB 3J7ZT 1DHMA 2J76E 2KI2A 2CQ2A 5IM0B 2F3JA 2M0GB 3P5TL 4W90B 2N3LA 3RW6A 2E5HA 2MZTA 5JVHQ 4Z2XA 3CPWR 5GVQA 1X4FA 2CQBA 3US5A 3CCLS 2DNLA 2X1GA 3SDEB 1RK8A 2M88A 2OJ3A 3FEYB 4TU8A 2DNKA 4LIRA 2DNNA 1KD1T 1JJHA 2MY8A 4ZKAA 4ERDA 1KQSR 2CPEA 1YHQS 1N52B 2AYEA 1X5PA 4UQTA 3VAJA 2DNMA 2DGOA 3G4SS 2DO4A 1VQPS 2DHSA 2RRBA 1OO0B 1U6FA 1YWXA 1VQNS 1U2FA 1OIAA 3ULHA 3EGNA 1QM9A 2CQDA 1O0PA 3CTRA 2MYFA 3CF5Q 2KT5A 2CJKA 5IFMA 4QU7A 3ZZYA 1L3KA 3NMRA 4V19X 2LMIA 5ITHA 3R1LA 2MZSA 5CYJA 2DIVA 1YJWS 2FY1A 3G8TA 2DISA 2XSFA 2DIUA 1H2UX 3CCMS 1FXLA 2N3OA 2XS2A 1HD0A 2I2YA 2ADBA 1G2EA 1SJ3P 2E5GA 3NS5A 2G4BA 1X4BA 5GAGU 4QU6A 2JVRA 1N88A 2RU3A 1WWHA 1U1PA 3CULA 2RNEA 1XN9A 1VQ8S 4TU7A 4CH0S 1U1LA 3U1LA 2EVZA 3SXLA 2VOOA 5H1SV 1M1KT 2G1DA 2DHXA 3JB9k 4CIOA 2AYGA 2MKJA 1M5OC 2OIHA 2MJNA 3HHNB 1WEZA 1WF0A 1H2VZ 2YH1A 1VQ5S 2OTJS 2E5IA 1WF2A 1VBZA 2MKKA 1FHTA 3DXBA 4Y0FA 4C4WA 1Q7YT 4F26A 3VAIA 4U67Q 5DM6Q 5D78A 1WG4A 2DITA 4EGLA 5LJ3Y 3S7RA 3ZZZA 2DNQA 3UCZP 2EK6A 3BEGB 2AYBA 2MKCA 2JVOA 2LA6A 2QEXS 2M7SA 1WTBA 4QQBA 2MPUA 1JJ4A 2MHNA 3N9UC 2D9PA 1IQTA 4WF9Q 2RQ4A 3R27A 3G8SA 2KRBA 2MZQA 2YWKA 4C0OC 1FT8A 2AYMA 2JRSA 2M9KA 3P6YC 1WHWA 3MI7X 1Q86T 2X1FA 2DH8A 3PIOQ 2M52A 1M5VC 2J8AA 1N54B 5EN1A 1VQ4S 2ZJPQ 5GMKa 4FXVA 4YUDA 2MSTA 3VALA 2ADCA 1H2TZ 1A7GE 2V94A 1VBYA 1DRZA 2RRAA 1VC6A 2MKIA 5GAHU 1R8HA 5IM0A 4P6QA 1PGZA 3Q2SC 3CC4S 4IOCQ 1BY9A 1WF1A 2OSRA 3CCJS 2LA4A 3UWTA 3MUVP 1A9NB 1U1KA 2XNQA 3H2VE 2LECA 3BS9A 3H2UB 3CUNA 2LEBA 3HI9A 4C7QA 2CQ1A 2FPHX 1URNA 2DB1A 1F9FA 1VQOS 3BO3A 3BO4A 3SMZA 2DGSA 1P27B 2MKSA 3K0JA 2D3OR 5GAEU 1UFWA 1DZ5A 3PIPQ 1X4GA 4WFAQ 1VBXA 3MURP 2CPZA 3CC7S 3LQVA 3VAFA 4BS2A 1OWXA 2HVZA 2HZCA 5CA5A 1VC0A 1H6KX 2HYIB 4WKRA 2M8DB 2UP1A 1WEXA 1VC5A 1VQLS 1OPIA 3MUTP 2B0GA 1JMTA
chains in the Genus database with same CATH superfamily
2BJ9A 2MKHA 5KT6A 1QE1B 3PKYA 4X4OA 3CCUS 1CJKA 1HL6A 4X4QA 1NRKA 2YVSA 2DYAA 1RJJA 3D66A 2ZVIA 3K7RA 4URQU 1T94A 3L7PA 3NCQA 3P45B 2E1PA 1FVSA 2LP4A 4H4MA 4QR1A 4DV0F 1U8SA 4WK1A 5B08A 1LWXA 3GU0A 2R8IA 2R7TA 5CZVA 4AQYF 5F8JA 5ETSA 3C16A 5L1LA 2UVUA 4CH1A 1QVGR 1C1BB 2B5JA 3LPYA 1RAIB 2HHPA 2BVZA 4KGMA 3T19A 3J7YU 5DLFA 5KT2A 4ED7A 3R2CJ 3CJ2A 3D9BA 4I69A 4WIIA 2WK4A 4LF4J 3KUGA 3B6BA 1QAXA 1FWKA 1S9EA 4DFJA 2YNGA 1ZETA 2CJYB 3ENVA 5F8GA 4FYWB 4NLTA 2OKQA 4YY3J 3SZ2A 4F3MA 3I0SA 5HP1B 2VG7A 1FESA 4F2RA 2M5YA 2HG4A 1LFWA 1J27A 5MLCV 2MQPA 4ZPVR 3CD6S 2HGNA 5KG1A 3OHAA 1TFYA 2ASDA 2KKHA 3OR1A 3JSMB 3EYZA 3PX0A 4P71A 3R8YA 1OY8A 4ATNA 1RT2B 3AD8C 4RW4B 4ILMA 1IR2A 2D74B 5I3QA 4PXCA 2VG6B 2KL8A 5J2QA 1DURA 5H9EJ 3BH7B 1RU1A 3W9IA 3MTKA 3RBEA 3H7HB 2XTJP 4DZ6A 1GQEA 4LRDA 2VPWB 2PD1A 1KSPA 3T5JA 4NLUA 2WOMA 4KB7A 4EO6A 1LWEB 4DQSA 1U24A 4JI4J 4IFVB 1FKOB 3DGPA 4RBVA 1S1TA 1RAHB 2B7BB 2CPFA 3CCRS 1FRLA 1IWAA 3HHKA 1VQMS 4DR7J 2HSEB 1IKWA 3AQOA 5D6GA 2ZC3A 3KKFA 1YKWA 3O6QA 2KFYA 1IR1A 1W2BR 3MDFA 2D1CA 2GHVC 2JWNA 1F6TA 2QE5A 3MECA 1X5TA 3JQJA 1ZTWA 1HWKA 4MK8A 3R6GB 1V5VA 2FC8A 3GJRB 2NREA 1N5VA 3BPSP 3MEGB 3HHDA 1VHIA 2ROEA 2ROPA 4TU9A 4B3MF 2VIHA 3MXHP 1RT1B 4IOAQ 2HRUA 2GVDA 2BUNA 6FD1A 1PIEA 1VBKA 3W8GA 5D8HB 4IH6A 3BJYA 1FJ7A 2UXBF 2CQ4A 2GIFA 2LVWA 3GCXP 1U1MA 5HMZA 3FMWA 4M5DA 4N76A 2IRXA 2FJVA 4ZP8A 4OLPA 4B08A 3M2RA 2W4CA 3CSKA 3FDSA 2GHPA 3GFHA 2B3TB 3LH2S 3FVYA 2KXFA 2V67A 4N7TA 3BGOP 4JI6F 4A47A 4A8YA 3RR7A 1S6PB 1VLOA 4WU3A 2G4BA 2WAQD 2CXEA 2OAUA 2F9JA 4LUBA 3E01A 4LF4F 4K4VA 2K3IA 4KY3A 4KYZA 3M6UA 4H54A 1CJUB 1UEKA 1JLEB 2KN4A 1IR0A 1PAEX 2LU1A 1CG2A 2NSCA 1F5AA 3LF0A 3Q86A 5IS2A 1B3TA 4PAAA 1WEYA 1IKVB 4LT6A 1T03A 5C42B 2QLWA 3MM9B 2RQKA 4LFAJ 3NGSA 1CJVB 1UETA 3DDKA 1Q16B 1RAFB 2OELA 3QLHB 1Y5NB 4USTA 2DK2A 4YP3A 2FLOA 1DTQA 1MROB 3JQMA 3QNWB 2IYIA 2QMUB 3DRSB 3ZO7A 4HLBA 3OJSA 2OGUA 1FE4A 3LO3A 3BV8A 3W62A 1G1XA 4OZLA 2GO8A 1T05B 4ZVQB 2DNZA 1WACA 1R6YA 1R8PA 3LTOA 2BACA 4X4RA 3TQEA 3CO0P 1MWQA 1Q8KA 4ZVHA 2HNZA 2IIHA 4M8LA 3TZXA 1EETB 1T3OA 2BJEA 3QAUA 2MGZA 2V2ZA 2J6TA 4DJBA 4TYBA 2RKIA 3PACA 3W5YA 4DR2F 2ILYA 4ELUA 2F5GA 2IVFB 5B0CA 1X9WA 1DQAA 1NZ8A 5G0RA 2R7RA 1N5YA 3PJXA 2V8HA 4MIAA 1Q7LB 3LP0B 2DPIA 1FKPA 2HQIA 4FYXB 4I6AA 2JL9A 3FC9A 4HR2A 5J2PA 2CZVC 4PR6A 3IG1A 5FLXU 1SL1A 3A8IA 3G6VA 1D09B 3PKMA 3GJSB 4L74A 4DR3J 1U49A 2YNIB 3HX9A 4DQRA 4KH1B 2VODA 1N8RT 2Q6BA 1JJ2R 5C42A 4EBEA 1RAGB 4NLPA 1PAUB 1MWZA 1W7WA 3V5RA 3WQPA 5HQMA 1WC4A 3CCQS 4EEYA 4XDDA 3OVSA 1UPPA 5EGYA 2ASJA 3ZTPA 1HWJA 1Q0NA 3DKDA 3GFXA 1NKCA 1I51B 2DNYA 3D7SB 5LMNF 5DQIA 2MQQA 1S6PA 2BEFA 1QDUB 1RT4A 1YJRA 2B9EA 2QC3A 4DPXA 3GFZA 2RUGA 2K7JA 1VGYA 2FLPA 2IC3B 1JK9B 4NLVA 1KC8T 1N5TA 3MOZA 1RDRA 2GA7A 2ZJQQ 2AEJA 3T1HJ 4DR3F 1P9YA 2GV1A 1PYTA 1J5EJ 4NOHA 2NLWA 2PEHA 1AUSL 1O6XA 3KFWX 3V6KA 2DCUB 1VRUB 2Z8QA 4KT0C 1EP4A 3ILOA 4YFUA 2FUG9 5JXSA 3A12A 5K9FA 3K5LA 3TUZC 4RZRA 3CJ0A 2J6UA 1IBCB 2HGLA 4H4MB 1KKHA 8RUCA 5D3GB 5HVFA 2POKA 2IJRA 3M2VA 2KG1A 1KEKA 1Q53A 3UE2A 2RH3A 1WTFA 2Y1IA 4K5RA 2RHSB 2E1MC 1G3OA 1PJ5A 3AD7C 3GZ7A 3ONQA 4QR0A 2RQCA 2V8GA 5BYQA 1HHQA 3ENQA 1LEOA 3IBWA 3OUYB 2H54B 4PRFA 4WTYA 5J1NA 1QUPA 1R89A 4HHJA 2DHAA 3M8PA 3DLLQ 2VF3A 1EARA 1IBLF 4K50A 1QAIA 4FVMA 3OQ2A 5C24A 5A8KB 2Q66A 2FTRA 1JLFA 4U7CA 3ILJA 1LNQA 4O44A 4DQIA 3P49B 3I82A 2IBOA 4M5KA 2BE2B 2XHCA 2UV8G 5A2QY 2CQHA 2KYXA 3OHBA 1UL3A 4PYDA 3GB0A 4YB7A 4L3KA 3H4BA 3QSYB 2IA6A 1U6BA 2OPPB 1XNRJ 3ILIA 2L9NA 1CEZA 2Z0GA 4CO3A 4ELTA 3QGPA 2WB4A 4ZJQA 1FI4A 4HI2A 3AY0A 2RIJA 2LXUA 2ZOGA 4KKOB 4OYBA 2K1RA 2PA8D 3UNYA 5E41A 3LGHA 3UR0A 2W9BB 1Q5VA 4CH7A 3H98A 2YNGB 5KFAA 1T9UA 2VG5A 1J2VA 4G1QB 3CD5A 2CPIA 2JJ4D 1U0HA 2CQIA 2VQEF 2PFFB 5B0FA 2FDNA 2VQFF 4ECQA 4WIQA 1WOOA 3L3CA 4KRWA 1PO6A 4KHPJ 2OEMA 4Y2MA 4ZDNA 2DR6A 5IWAF 4D3GA 3AXMA 3PW2A 3EM1A 2RDDA 3LPEA 4LVNP 4LSZB 5AE2A 2W4DA 1U1OA 3C6TB 3DRPB 2XI2A 3VAGA 4UOFA 1SL0A 4QYZK 3OUYA 1HBNB 1P8GA 3MAAA 3POTB 3QWUA 1K1SA 2H1YA 5F8LA 5FLXY 4DSFA 3QIPB 4QWEA 2XMKA 3F73A 1Q79A 4WKRA 3RBXA 3TAMA 3DYAB 2RUSA 4I2QB 1HNVB 4RNFA 5KFBA 5DS7A 1KR4A 2MHEA 1VQ9S 2KYZA 4U95A 2IMOA 3PHEA 1WG5A 5D0HA 1RAEB 4X62F 2QFIA 5HK4A 2N82B 1HHTP 4F02A 1S6UA 1VOMA 3DHWC 2AGOA 5KFOA 3DLEB 1AYEA 3MPDA 5HMWA 2EW9A 1H74A 1UEUA 2OD4A 4C8KA 1KBRA 4PPZA 2MY7A 4Y28C 2RT3A 3N28A 4RX6A 4W4MA 2O67A 4P2MA 4NYOA 3DC2A 4HKQA 2FD2A 1LV5A 5LSOA 5J2NB 1EAYC 2GQCA 4M5LA 1VR6A 1WI6A 1YBUA 2HBQB 1UKUA 1AT1B 3EGVA 2A2DA 3L09A 3M05A 3OFHA 3S01A 1T3NA 1X9SA 4A48A 1VC0A 4HHHA 2MQ8A 2XMVA 1ZA1B 2QIFA 2DNGA 2EG1A 2FB0A 1E6YB 4PWDA 1NH8A 1WUUA 3SCJE 2BJ8A 3W61A 2CQ2A 3HT3A 2FJXA 1Y4ZB 3J80U 1VYAA 3RRHA 2MLYA 3K17A 4JI1J 4W90B 3GV8B 1F9HA 5JVHQ 1NHUA 3SCKE 3ZNUA 2OI2A 3UDVA 1XMOF 5E3AA 4KO0A 2V9WA 4OYZA 1A0OB 1TKTB 3W2WA 3CCLS 1G6BA 5CH7B 3A8EA 4U8VA 4WP8A 2XS7A 3VVTA 2N7YA 3OLBA 5D4OA 1S99A 4J9VA 1B99A 1S9GA 1FERA 3ITHB 1U0HB 2Z2MA 3A4TA 3L4BC 1S1VB 4KFBB 4NXNJ 2F4VF 1N52B 4LFBF 3GQCA 1JNZB 3M2UA 3VCDA 3KJQB 2DVIA 2FVCA 2DGOA 2QYCA 3RG6A 5L38A 4NWBA 2GVZB 2C3YA 4ZA1A 4XPCA 2ZM6F 3G4SS 3EZ5A 3PVXA 1T0TV 1VQPS 1HYSA 2UXDJ 1EQ0A 2EFGA 2RF2B 1LW2B 3K89A 3M8RA 4P10A 1RT6B 2F4FA 2P9GA 3SQOP 3K57A 1NK9A 4QIGA 1ZM9A 3MM5A 5J2MA 1X9MA 2K06A 4KR0B 3IM8A 1NEEA 3CEDA 5E0OA 2V63A 5HATA 2IVYA 2FQQB 4PABA 1TL3B 2CDQA 5LMNJ 2MYFA 3BR9A 3BKFA 1OSDA 3A8JA 2WHOA 3AOAA 2KT5A 2OMOA 2VL1A 3QAEA 4M63A 2ZH2A 2R8GA 3C2PA 4B3RJ 2DRAA 1SKSA 4QU7A 4DG1A 4TLRA 4P2XA 2W7AA 2V4QA 1L3VA 4O3RA 1RT2A 1REVA 4JI5F 1HNIA 3D6FB 1L3SA 1G4CA 4P72A 4V19X 3NMRA 2WRMA 3TWZA 4JI7J 1GX6A 1UTAA 2GX8A 3HHLA 2OMLA 3TVZA 5ITHA 2HIQA 5H9FK 5FDLA 4F2SA 2UU9J 5CYQB 1IBLJ 2MZSA 2CG8A 3D0IE 3LP2B 3NCRA 2YQ0A 3OXLA 2HS0A 2AX0A 4GO5X 4PQUB 3OBIA 1Q5YA 3AD9C 1WDDA 4JV1A 3EGWB 5A0YB 4EU0A 3BDEA 2YX4A 3TUJC 1H2UX 2FVPA 1IBMJ 2I2YA 3KDOA 2E5GA 3FQLA 3NS5A 1S1XB 2HRYA 3QT8A 2CRLA 3IRXB 3C16B 4IG0B 4RR5A 5KG6A 2QA2A 3WHIA 5DG8A 8ATCB 4HTJA 5KAKA 2IC3A 1LW2A 4RL1A 1S76D 3CULA 2JDJA 3E01B 2FLLA 4OHVA 3I31A 3GR1A 3ENWA 4ANDA 4Q2MA 5I3PA 5JUMA 2GC8A 2FLNA 2RHQB 1FDNA 2VOOA 1TL1B 1GMVA 3CJKB 2DHXA 2HNDA 1RTHA 3TR5A 1TL3A 1NJWA 1FRJA 2NXCA 3F41A 3A8KA 4AYBD 2J9CA 1M5OC 3K5MA 2OIHA 4FXDA 5L1JA 3DOKA 3HHNB 5CD4A 1UA0A 1N4LA 3M7VA 1IBKF 1K0VA 1H2VZ 1RT7B 4WE1B 4DSLA 1TKTA 2R8JA 3GIJA 2E5IA 4K4TA 3HHLC 3QT7A 3IS9B 3C3LA 4FF3A 4ZLJA 2MKKA 3KK2A 4NLXA 5LSRA 1FHTA 2YWHA 3M4XA 1IKVA 1V5IB 2HLUA 2ZBPA 1HNZF 4Y0FA 3QZ8A 1S1VA 2B4PA 2XC9A 3IGNA 2P9EA 1TL4A 2WVDA 2DT9A 4F26A 1P1LA 3VAIA 4DL2A 4BC7A 1XR7A 4U67Q 2CNNB 4U6PA 1U2CA 1WG4A 2C3PA 2DITA 2HVIA 2A18A 1R0AA 3RGIA 2XCAA 2VFRA 1JB0C 4HVZA 1JLQB 2ZH7A 2I0XA 4USJC 5LJ3Y 4N8OA 1KLNA 4K4ZA 3S7RA 2ZEJA 4HH0A 2DNQA 3TX0A 1HW9A 4DV3J 4C9DA 1FRMA 3I0RA 3UCZP 4F8RA 1YQHA 4MT1A 1ROFA 3MPVA 4WK3A 2A6OA 1ZM2A 4NYZA 3N79A 5HBMA 5DQHA 2UVVA 2H51B 1RTIA 4CLWA 4ZVTB 2HQFA 3GWCA 2VFVA 2MPUA 3QLHA 1JJ4A 1RI7A 2MHNA 1XNRF 3QGHA 2FJEB 1H38A 3M30B 3UFCX 3N5BA 1ZOTA 2CJXB 2J5AA 3QO9A 3AXKA 4ANCA 2RQ4A 2YWWA 2ZZTA 1X60A 3G86A 1U25A 2N4CA 3R27A 4OZ2A 3JSMA 3GPAA 4CTAB 3V81A 2CVIA 2MZQA 2YWKA 1FT8A 1PJ6A 1IM6A 5A8RA 2VBWA 4X84A 1P9QC 4OJHA 4C3KA 1I5OB 4X65F 3SI8A 1Q95G 2ILZA 3O8WA 4N56A 3PX4A 1VQ4S 1F3VA 4YUDA 3G6YA 2BYCA 3BBFA 2ADCA 2AJQA 2YQ1A 4AD6A 3DCAA 3PR5B 1VBYA 3W66A 2ZKUA 3TVKA 1XMBA 2HBRB 4IFYA 4IH5A 2ZUAA 4OX8A 5GAHU 1XQIA 4LF6J 4WWSA 5THWA 2CG4A 4FN5A 4P6QA 2GNKA 4USVA 4OV6A 2UVWA 4WXOA 2HS3A 2V69A 1IKYA 1QJHA 1BY9A 3GYXB 4FNHA 4M1KA 5DZ7A 4UT4A 3UWTA 3BYPA 5I3UA 2J0XA 3NBPA 2XNQA 1SUQA 1I6JA 5ETRA 1WKJA 6FDRA 4E0DA 4NX9A 5L8RC 3UN2A 3QPIA 4OX9J 3DM2A 4XPEA 1QE1A 2FPHX 3D6HB 2C22A 4J9RA 1RWOB 4YMEA 2YKNB 2AZ1A 4B9TA 4DV3F 3BO3A 2DGSA 4LRAA 1HBMB 4HDGA 4ZPDA 3NAHA 1S4EA 2HNYB 3O3LA 3MFHA 5A8KA 2UUWA 4UZCA 2UV8A 2AMCB 3B82A 1TZ0A 2WW4A 3FFIA 4DCOB 3PIPQ 2HBZB 1DJ0A 4O4RA 5C7PA 1GXLA 1DLOA 3BF4A 3JSRA 2JEIA 4YR0A 1OJ4A 2VKRA 1VI7A 2Z57B 2JEJA 3VAFA 4DEZA 3O5TB 3M8ZA 4F3QA 1H6KX 1WC1A 1QUVA 2Q1LA 2W2QP 3MM6B 3R7BB 1HNZJ 1VQLS 1JKHB 3HDSA 2BM0A 4NLOA 4U8YA 2HWTA 4O3PA 1JMTA 2YKQA 2K1RB 3PTWA 4DN0A 3OV7A 4BDPA 2A2CA 3RRGA 4LF7F 3FNNA 2E9TA 2QA4S 1SI9A 4CLTA 3LOUA 3N6LA 4TN2A 3EXCX 4KGKA 1HBUA 1WC3A 2BANB 2V0NA 3ET6B 3OR2B 4ED8A 3CVKA 4DF4A 1U1QA 4LVOP 4RBUA 3OTDA 4ZLPA 4AL5A 4RWWA 1BGXT 3THTA 3I5BA 1RTJB 4DU8A 1HPZA 2RQMA 5IV4A 4J9QA 1DQ9A 3HSGA 5KFYA 5DJBA 5C25A 1NK6A 4Q0BA 2JSXA 3WZ0A 4ED4A 4YHHJ 2CA9A 3J81j 2E5LJ 2CZ9A 2PMHA 1ZPVA 1TL5A 5BYRA 4UTGA 3R9LA 4N77A 2HGMA 1HBNA 2CPXA 5KFKA 3VGTA 1VS3A 2HNZB 3HO1A 1EZZB 2RMLA 2Q43A 3HFZB 3LA0A 4HI1A 2F9DA 4RLEA 1CJKB 2HVEA 1K44A 2KVQE 3FZBA 3HJVA 1KONA 3SBMA 5L1KA 4NA1A 4B9NA 3DLGB 3JSYA 1S10A 2EWHA 4ECYA 1KNZA 1LOUA 3MEEA 1CS4A 3DHXA 1UWBA 1JWWA 3G8QA 3RJMB 3LWMA 3MM6A 4YOEA 4IO9Q 2W9BA 1HFEL 4CI0B 2X3GA 4P73A 3VHQA 4WFNQ 3CJTA 4DL6A 4OYMA 2QN6B 3HFKA 2E66A 2HWIA 4DQQA 1FCAA 2EBGA 1S7HA 3M8QB 4MFBA 4ZHRA 3DYAA 5SZTA 3MMCB 3AFGA 2ZM6J 4DS4A 1DARA 3OTCA 5ETPA 1FTRA 2CZ4A 1WHXA 2IAJB 1YJ7A 3NGTA 2BE2A 3CDWA 3KJVB 5EX3A 4DPTA 5DETA 1RAJA 2B8PA 2NR0A 4NXNF 4A8WA 4TVAB 3DLGA 3WX4A 3CMQA 1FXRA 4QW8A 4LF5F 2YKAA 1PC5A 4I2PA 1HW8A 2BRKA 1IBMF 3HZGA 3PM9A 2ZJRQ 1WD6A 3UCGA 2ZH9A 2DGVA 4W92B 5KFGA 4QCLA 4L72B 4RUCA 1S0MA 4FF2A 4MK7A 1GT8A 3PJ9A 5B0EA 2MXYA 1BXNA 1UJ4A 3HKWA 3MMCA 4EO8A 3MUMP 4D3HA 2KJWA 2O3DA 5HN0A 5E3CA 1OQ3A 4NI2A 1VQ7S 4K4XA 2DTJA 3W5XA 2J9DA 5KFCA 1UZHA 3NXZA 4IO1A 3H5XA 2H9ZA 2MLXA 5A8RB 2A1BA 2QZ8A 4UOHA 3V6DA 1ZAXA 4DX6A 4B3SF 1TELA 1LK5A 3BGRB 1MN7A 3THPA 5J1EB 4ED3A 4ES3A 2JX2A 4UY85 1HBUB 4ZPAA 1VLYA 1VCTA 4PQAA 2GW8A 5K8PA 2QG9B 3AOCA 3B4DA 2DR8A 1RA7A 4K4WA 4JOUA 1FJGJ 2ZITA 2I38A 1UJ5A 1Z2LA 1Y10A 2OEKA 5E3PA 1YJ9S 5K14B 1W26A 2RSQA 3ENAA 5HVHA 3CCES 1ZM3A 2P9CA 4DX7A 5IQ6A 1URRA 2G9OA 2W01A 1MW7A 3OLAA 2KT2A 3MOJB 1RHUB 2G2YA 3KK2B 2QA4G 2BOPA 2VA3A 2YNIA 4HT7A 5GAGI 3LP1A 3BSOA 4GKKJ 3IP0A 3VAKA 2KVIA 3DM2B 4ECTA 5CQGA 3PEJA 3V6DB 1EP4B 4WTOB 5KOWA 3G96A 2ALZA 1N34F 2LEAA 4O3OA 5B7WA 2GJFA 4RW8A 4OI6A 3VV2B 3E51A 2FJAB 1VDHA 2DHGA 3ZZUA 1D9AA 2FY8A 3CMES 2PI5A 1DTQB 1MROA 5LL6d 5GAHI 4DCPB 4X2BA 3MR7A 5T7LA 1YVFA 5JMNA 3AH6A 2AJFE 2VG6A 5J2QB 2V68A 2GAHC 2C3MA 2WZ1A 4NA2A 3TX8A 4ED2A 4C8ZA 2VOPA 1JXEA 1C4AA 2E5JA 1N5SA 1OS5A 4CO1A 3NS7B 1QY7A 2MLZA 3A3PB 2DNOA 4J91A 4PCQA 1SBRA 2XWYA 1VHFA 3UQSA 5EHHA 4DR6J 3NGRA 5A76A 4O4GB 4JV5F 4HTIA 2EFPA 5HAOA 1QVFR 5KFJA 1RGVA 2BV3A 1SH3A 2HAFA 4HACA 1JQGA 4MKBA 4ZCIA 1FJCA 1MMNA 5GAEI 2YPZA 3AJ1A 3FJ2A 1X4HA 4CNZA 3GILA 1X4DA 2QTWA 2XGQA 3TZWA 3GV7B 6AT1B 1YX2A 5IT0A 4IDKB 4PXBA 4XDCA 5ETTA 2R9LA 4NYPA 5D15A 3H2LA 4K7QA 3UDLA 1FK9B 4DL3A 3KJNB 1RT1A 2J7KA 4OLOA 4RUHA 4WYLA 1FRKA 3U1MA 1F60B 2XO6A 2PT0A 3V6JA 1TK0A 2UU9F 3A3NB 2M70A 4FP9A 4CLPA 2ZH8A 4UW2A 3GFYA 1U45A 5DGBA 5L9XA 4CQ1A 4F0HA 1DBDA 3P8BB 2HRTA 3QMQA 1UVMA 3DGVA 4ID5A 4P7TA 4X64J 1R3NA 1YTYA 1T9YA 4NCAA 4HH1A 2ALYB 3DOKB 1IUJA 2QLBB 1MNEA 5IWAJ 4B3RF 2NUUG 4JI3F 3E3XA 1AA1B 2DGUA 3GYNA 3TP2A 3RUBL 1B7YB 1WOSA 2H5JB 5IQQA 2R2TA 3QGIA 3JAMU 4DUTA 3T41A 2MGZB 3VVUA 4B3TJ 2HFSA 2ZNZA 5ETLA 1N6QA 2JFKA 2OP5A 2KRRA 3OL8A 4IUFA 4LF5J 3UDEA 4F04B 4JI3J 1VRQC 1CSJA 5C2GA 1ZZNA 3FUYA 3G2XA 4PXDA 3RW7A 3KLEA 1Q81T 1HPZB 2Q79A 2X1BA 2GJIA 5HVGA 3V6HA 1SXLA 2BX6A 4MKAA 2E44A 2QLXA 1SC1B 2R7WA 2XI3A 3KHHA 1NSAA 4GRSA 3K5PA 1GMWA 3KK3B 1UFLA 3SDEA 4ER8A 1RCXB 1OYDA 3IA0A 1YRTA 4DV6F 1APSA 1NH7A 2G1HA 3I56S 1SQGA 2WSCC 5ADZA 1TVRB 2RJZA 2GVDB 4C98A 2V8PA 5KG2A 5KFNA 4LQ9A 3D67A 4LRBA 4R0JA 3ZZ0A 2VJVA 1QSYA 3OXFA 2VFUA 1RA6A 4RBTA 2XM3A 3DRXA 3EDQB 1LK7A 3MAQA 1NDCA 5KFTA 4OYAA 3QFHA 4JV2A 4P7VA 2DH7A 1S1UA 3CCWA 1DTTA 2GMLA 3TQ1A 3C14A 3QT5A 2ZH3A 3HP6A 3KHRA 4F4KA 4C8YA 1D8ZA 3VF0B 4DXLA 2QL5B 1F2GA 5H9FJ 4K8RA 4NCGB 2UUAF 2RB7A 3UD3P 3WBZA 4MYTA 1CQMA 1H98A 5CYQA 3MTJA 2CPYA 5CZXA 4CWBA 2XGPA 2WOMB 2F4VJ 3G9CA 4PWUA 4M94A 4I6WA 2BZ2A 2CQ0A 2OPSB 4MKVA 3EX7B 3PW0A 1YIJS 3TJAA 4DU7A 1NXIA 3R5CA 2HHUA 1P1TA 2DGWA 2GVZA 1NAQA 1VMBA 2JHEA 2Z2ZA 3TAQA 3TARA 2EI5A 1M90T 4ZJOA 4DR4J 2CVEA 1NK7A 3I9V9 2ZDPA 1EKRA 4ZVGA 1LWCB 4DX5A 4IG3A 3THVA 2FJWA 2MJUA 3MEKA 4ZJLA 2X1AA 1L3TA 3I32A 1SC3B 1RE1B 1T9VA 4PYAA 1JX4A 5AXNA 1MSWD 4A8FA 3ZTSA 3D1OA 1TU0B 1ZPWX 3CB4A 5GADI 4IRDA 3TVYA 3PZPA 2PDAA 3H5SA 2WBRA 3PRBA 4M5DB 1H0HB 1UCNA 5A6WA 3J7ZT 2J76E 1DHMA 2KI2A 4J9LA 1TK8A 2W1BA 3PO5A 2IM2A 2N3LA 3Q8QB 1HNWJ 1XERA 4QJVA 4LSLA 3IR7B 1TV6B 5GVQA 4B9SA 2MDAA 3C14B 5KFEA 4EYIB 3OSPA 1SUQB 2HHQA 2DNLA 4QWBA 2LEPA 3IFEA 2FIUA 1N56A 1H73A 2OJ3A 4USHA 2NZCA 3HZEA 4TU8A 1RWXB 2JH3A 3BGRA 1S9EB 4DQPA 1JJHA 1EJ7L 1RLCL 1GTHA 2KT3A 1PKUA 2HNYA 2CPEA 3F44A 1FFGB 1LW0A 4AFFA 4NZ7A 2I5JA 2B9YA 4MJKA 3HMJG 3KLGA 3M9OB 2D3O1 5B0GA 4JI4F 4NLRA 3N6NA 2HFZA 1YJTA 2CJBA 2DHSA 1HI8A 2LQBA 2QX0A 2QO3A 2RRBA 3CJ4A 4MIWA 1WC0A 3TA0A 3MCMA 4J9MA 1YWXA 3EPGA 4OHXA 3QT6A 2ZH5A 3BQ1A 1N36F 3EMTA 2UUBJ 2ZE2A 3H59A 3CDAA 4KPYA 1VQNS 3FGVA 5A6PA 3DI6B 4O3NA 3EGNA 3IXQA 4HL9A 4YR2A 2DJWA 2RKIB 2VPZB 3E8OA 2VKZG 2C2RA 4MFBB 5A8WB 3CF5Q 1S9GB 3ITHA 1JLCB 4ED0A 2CUYA 1FTCA 1S0VA 3NL0A 1WSVA 2CJKA 5IFMA 4PG6A 4WXWA 3KUHA 3ZZYA 1YBTA 3TJ8A 1D8YA 4ZVFA 3HLUA 1M5SA 1VIXA 4O0NA 5KFIA 1R31A 4F36A 1U26A 1FEHA 1XIQA 1FNOA 4WZMA 2D41A 3OFGA 2HVDA 2LMIA 3HCXA 1Y11A 3I0RB 4NCGA 3BZQA 4OFZA 1EB0A 4QBUA 4DFKA 2I8EA 3R1LA 5CYJA 5EWFA 3GIRA 4M5MA 1J5EF 3DI6A 3ZTOA 1YJWS 1SH0A 1T9XA 4PUOB 3M8QA 2G13A 2R7VA 4QYRA 3T9ZA 4V1Ak 2C3UA 4JV0A 2HURA 2HQDA 3CCMS 2YKMA 5DG7A 3DRRA 5IT9Y 4KH0B 2WONB 3W2VA 1G2EA 2B4VA 1UFKA 2BE7D 1ULRA 1X4BA 2YXLA 2QGFB 3ZZRA 1R43A 3BN4A 5FD1A 3M2VB 3TA2A 5GAGU 1OY9A 3BREA 1N88A 4WJBA 5IV3A 3KK1B 4CLLA 2B9WA 5E33A 4QWAA 4RU2A 1KHWA 1XN9A 2V4JB 2AJ0A 2PO4A 2BKNA 1AZSA 4CH0S 1U1LA 2EVZA 2O1PA 3LP2A 1FD2A 4AXJA 1NB7A 2G2OA 2NYHA 3JB9k 2E5LF 1TKZB 2QSFA 1IJFB 1MU2A 1T9TA 2DXEA 4M5IA 4P74A 2HWHA 4LIWA 1RU2A 1XTZA 3FFIB 2GIRA 1Y7PA 2BMBA 2K7KA 4LSLB 4CT9A 4NZ6A 1AFJA 4MYUA 3Q89A 4IDKA 4CLYA 1C2PA 3EVOA 5HQLA 1S1UB 2V2KA 2OTJS 4Y2KA 4LRCA 3C6TA 3DRPA 1VBZA 3PCOB 3VZHA 4EZ9A 3HVTA 4ZP7A 3DXBA 1NBEB 2F8MA 5D4PA 4JB8B 4NLSA 3M9NB 1NK0A 3M6XA 3PJWA 1HNXF 4Q8EA 4C4WA 1Q8IA 3NOGA 2Y1RI 4OX7A 1JLFB 1CULA 3V2UC 3PX6A 2HNDB 5KFPA 1GEHA 4ID5B 5M2UA 5DM6Q 1N5YB 3QO9B 5AJ3F 4GC7A 1RAAB 3DN9A 9RUBA 1V3ZA 4EGLA 4MKYA 4WYWA 5CHCB 2E1RA 3ZZZA 3KLHB 4F4YA 1JLBB 4I4BA 3T1AA 2BR0A 2KO1A 2M3DA 1LFPA 4DN9A 2AT1B 3EDRB 3JXOA 4NLYA 4F67A 1NSQA 2JLGA 3ICLA 2AYBA 3PFOA 2A0FB 4KSEB 1N6QB 2QEXS 4RWXA 2M7SA 1YSJA 4QQBA 4USUA 1N32J 3K2YA 2D9PA 1RAOA 1I94J 4Z7CA 3K8WA 3ET6A 3OR2A 3CD0A 2YWEA 2D7SA 1X8DA 2ZBCA 3LALA 3J7YI 4WF9Q 1Z1ZA 2KFZA 3WIUA 1ZYQA 1FKPB 4RU9A 5K20B 5K8NA 3CCZA 3KK1A 2JOQA 2WW8A 4KC5A 1EIYB 2QRRA 5IOLA 1C4CA 3G8SA 2C2MB 2JRSA 1J5OA 2V5HG 1WHWA 2ZOMA 1HQ2A 4DBQA 2W8LA 3CIZA 2DH8A 4WPAA 2EFNA 5C5JA 2YWFA 4FZVA 5F8NA 4A8SA 1NNDA 4RW6B 1XNQF 4I1TA 3BPDA 1UEVA 2ZJPQ 3MCNA 1AXQA 1TMMA 2XMUA 2MSTA 4FXVA 5GMKa 3J81U 1Q4RA 1SC6A 4USKA 1DRZA 2X51A 1CULB 1TKZA 3L7UA 3KTQA 2P6TA 2PMWA 1VC6A 2A6MA 5AXLA 1S1XA 1CPZA 4JYAJ 5IM0A 2Y8YA 4NLDA 1PGZA 3CC4S 2XMJA 3GG0A 4DR7F 3I96A 4ZP9A 2ZUGA 3W8PA 1WF1A 2OSRA 4ETZA 1HBOB 3EICA 2EKNA 3NGUA 5F8HA 4ZITA 2IMWP 1DFDA 1BD6A 1A9NB 1KRPA 3CUNA 4IRKA 3CDUA 3KG4A 4ZCMA 5KT3A 2YNFB 4YEAA 2BJDA 4K59A 3SYZA 2W9AA 2ZHAA 3SCIE 1PJ7A 2DB1A 2V2QA 5KFFA 2UUCJ 1URNA 4DR4F 2YKOA 4I68A 1RTIB 1N36J 1P27B 1X0PA 4Y6IA 3K0JA 3GP9A 2IM1A 2YPYA 4ZPCA 3FCVA 3W63A 5GAEU 2VPXB 4W98A 3T1YJ 2W2MP 1HKAA 4ZLNA 2ZHBA 3NWGA 2C42A 3MURP 2CPZA 5EX0A 2XYPB 3BR8A 2DPJA 1UVIA 2HIYA 2R2RA 1OWXA 2VBYA 4B17A 1HBOA 3A13A 4ID8A 2YNHB 3GONA 5J2NA 3R5JB 3OTOJ 3FSYA 2HYIB 4NCBA 4DDFA 4DHVA 4WP9A 1YZ6A 1VFJA 4R0EA 5D4LA 4Q5VA 3MUTP 3KNGA 1RWPB 1RABB 1JNRB 1GNKA 4ZVOB 3MR3A 1FDBA 4I7FA 1F1BB 1RWNB 5DG9A 3Q8PB 3CCVS 4B9VA 3J7AN 2DNHA 1FD8A 3C15A 5K5MA 2DH9A 4C0HA 3TZZA 2DNPA 4R8UA 5DDRC 5EDWA 3RB0A 4PKDB 1CJVA 2K8GA 5ETVA 3KG1A 2EXUA 4RUAA 3GV5B 3BN7A 4PXEA 2FVQA 2HQGA 1WG1A 3OPKA 4ZIVA 1R8BA 4F25A 2AHOB 2P5VA 5D0RA 3UVJB 2AEMA 3HF5A 7AT1B 4LF1A 4OQJA 1RTDA 4MIBA 3CNQP 2MQMA 2RDJA 4J9OA 4OYWA 4IRCA 1VIOA 4NXMJ 3PW5A 2VBXA 4PG8A 5J2MB 3SIPB 2CPDA 1MN9A 3GJTB 1HI0P 4AL6A 1QSLA 1N33F 5L1IA 4OZ3A 1RP5A 3TZYA 1GTEA 3BQ2A 4J9SA 2DY9A 4ECVA 5DM7Q 4WFXA 1JLCA 1Y5IB 4Y2AA 3TA1A 3RAQA 2X3DA 3LUYA 1CQNA 4X4UA 1X4CA 3VGSA 4LFCF 4FF4A 4FXWA 5DRKA 3Q23A 4FDFA 1XJWB 5HLFB 3LW5C 2V6AA 3GG1A 2EEYA 4H4OA 4EK2A 1HNIB 1YJNS 3PO4A 3DLBA 2H5IB 1U47A 4I67A 3AB2B 4L6V3 1BQNA 1KTQA 3MM5B 1NU4A 4HEA9 3EUNA 3IS9A 2PI4A 4QPXA 4F4AA 2VA2A 3QJJA 4TQRA 5HMXA 2Y9HA 4F4XA 4RJVA 2CWXA 2ZH6A 5DLGA 3SCLE 5KFVA 4QW9A 4X64F 4FPRA 5BJRA 3KLFA 1N0VC 2Z58B 3HSDA 5B0BA 4GO7X 3CJ5A 1L5UA 3JSBA 5D4NA 2PMZD 2DGQA 2RAQA 3DLEA 4BWJA 3ZZOA 1LWFB 2LCWA 3GLJA 1S6QA 1DTTB 2UVRA 2LFVA 2QA1A 4ECRA 1VQ6S 3IC1A 2VBZA 4GVBB 1X7VA 1NDPA 1MLAA 1RHQB 2O66A 2XSJB 3DU5A 4ZCLA 1NK4A 4DV7F 2MTLA 3EVMA 2R7UA 2B6AA 5IT4A 1TKDA 1LWCA 2Y3YA 3Q24A 4B3TF 2EC0A 3U02A 4DV2J 4B3OB 1AZSB 2HBYB 3MMAA 3R5AA 1EKSA 4Z7YA 3ETOA 3DOLA 4BLGA 4J9PA 1HBMA 1N0UA 3VZIA 3VQTA 1PILA 1SIWB 5C2CA 1T9WA 3G6XA 1QAYA 5MAOA 4OYPA 1LWEA 2AGPA 3HJFA 4PG7A 2ZBRA 3I5AA 1DLOB 3QZ7A 1HR0J 2D3UA 3P3DA 1Y3JA 4P2SA 2FVRA 2HFUA 1CVJA 1B7FA 5DDOC 2PSZA 3MEEB 3CC2S 3AJ2A 1BMQB 1WC5A 3I55S 3SSSA 2P8IA 4CTAA 1FDAA 2AV5A 1EHWA 1X4EA 1FNMA 4E8UA 4KV8B 1TAQA 4XO0A 2FHKA 2KZZA 1VJWA 2WCXA 3IR6B 2I6WA 3AOBA 3HULA 5DDQC 5IXUA 3DU6A 7FDRA 2VG7B 4X4TA 5FJ4A 4CYUA 4NEYA 1WJ9A 3RAMA 2V8DA 4JI2J 2D9OA 1ZA2B 2QLJB 2R7QA 3BKTA 2FHOB 1FX2A 3ILLA 3MPYA 5HO4A 2H65B 4LJMA 4NL5A 2E9RX 2CADA 2X7IA 1WHYA 2G2ZA 1K8AT 1V9OA 1K9MT 2IHR1 1IKXB 3QRQA 1FFSB 2DR9A 3CCTA 4B3OA 1IM4A 2ZE2B 4RW7A 4KKOA 2J9DE 1UPMB 2Z30B 1VJQA 2OSQA 3FEZA 4KE5A 4FYYB 4OZ5A 1NHVA 2H5EA 4A46A 1OQ6A 2WVBA 2ZZNA 2UXCF 3BM7A 3TOQA 2L41A 1RT5B 1VQKS 3D6TB 1BWVA 1JLAB 3FBEA 4DV1F 2H4WB 1Q8BA 3MD1A 2XS5A 3OVBA 2J9EA 1FO1A 2ZWOA 5KG5A 4X4VA 3BSCA 1N5QA 2DBBA 3OFFA 3ADAC 3NS6A 4GVBA 5KT4A 4F3OA 2HHTA 3OL7A 1B4SA 3CO9A 2XMAA 4EWTA 4Q45A 2F65A 5IT9U 4EUVA 5KFMA 3KG0A 4ANEA 4HYKA 2HHHJ 1UVNA 1S1WA 2NXJA 5DDPC 1KVKA 2OPRA 3DLKA 3E2EA 2V9KA 3MM8B 2CJAA 2HFVA 4I56A 1WOPA 1KVIA 1HD1A 4G1QA 3KMSA 5J1PA 2B4OA 5LSLA 2DRBA 4K0KJ 1CLFA 4IFYB 1OYEA 3D0HE 3OXGA 4IYQA 3AT1B 3LGNA 2O5DA 3N01A 5L9NA 4P9SA 1DAXA 3TYTA 4F7VA 4ZK7M 3LP0A 1NDKA 5LXRA 3IO1A 1Q78A 1SKWA 1XNQJ 4OMFG 3H8YA 1CJUA 4TY9A 3GE9A 1GMUA 1RBOB 4U7UK 1SJ1A 1HWUA 4UY8T 1SQEA 5AE1A 2UUTA 4JP8A 1B0VA 4LF8F 5C24B 4NZ0A 5GADU 1GMWD 1TL1A 5A0YA 3HKZD 1KQGB 5FIIA 5KFUA 2J0SD 3HSJA 4DV5J 3KUEA 1UJ6A 3RBDA 1WELA 1C1CA 1TL7B 4USIA 2ASLA 4ELVA 4JI6J 1U02A 1I94F 2W7PA 5LMUJ 1RWKB 4C0BA 1SJFA 1AW0A 1C0TB 2IFXA 2ZHOA 3M32A 4O3QA 2DHHA 2KXHA 3HHEA 3UN5A 4AXIA 5K14A 1HA1A 3B54A 3OR1B 4ES2A 2J7UA 4PZVA 3D54A 4CO2A 5BR8J 1REGX 2C28A 3PRVA 1XC9A 1TV6A 1RQ0A 3QATA 3SEOA 3KOAA 2RRNA 4IOBA 2OLWA 2QT7A 4X65J 3MAAB 3POTA 1CC7A 2YNFA 4DPYA 3MR2A 2HHXA 4OHWA 5T41A 3R1HA 2CDRB 2RDIA 5LXYA 3MM9A 2HQCA 2YKNA 1LXJA 4QIEA 2Y1LB 2XQCA 2PE8A 3FQKA 1NJXA 1IN0A 3TO8A 1TK5A 4HDHA 1VRUA 2PN6A 2YQ3A 4P2FA 1S4FA 2FGOA 3IM9A 5F0WA 1BLUA 1FKOA 3DGPB 4Q8FA 1U09A 4KQZA 4OZ0A 2LDIA 2W7OA 4TLQA 1AUDA 1AROP 4Q44A 3BO2A 2ATCB 2NSBA 2XO7A 4UUWA 3W7BA 1KHVA 3MGJA 1GFWB 2LDYA 1Q1KA 1W25A 2B7CB 3VWSA 2XMWA 4WCEQ 3MECB 2H3EB 3BGLA 4ENOA 3MR6A 5T14A 2MEWA 1HQEB 2LQ8A 2LU2A 5HANA 3G71S 3QSIA 3N5FA 1NJIT 4YHHF 5JJBA 4ECUA 2ERRA 4X66J 5I42B 2JEGA 2DY1A 1UVKA 3MM7A 1CJTB 2H48B 1SCJB 2C2OB 4IFVA 4N47A 4YS2A 4KJIA 4A4JA 1HNWF 3C8YA 4CNYA 1C1CB 1TL7A 1RUSA 3U1NA 4ZLLA 3P96A 5HQ8A 3HHLD 4DL4A 4QPTA 2AGQA 2KJVA 5HJYA 2KZMA 2DD8S 4DMZA 4KO0B 1HYSB 1FWPA 1NJYA 1SQFA 2J8SA 2FHJA 1NPKA 1SVDA 3TUIC 3KLVA 2OFHX 3HXMA 4FKYA 1NSKL 3GCWP 2LKZA 4BBYA 1X0FA 1R6VA 4AT1B 3GYGA 5HBMB 1A6LA 2GAGC 2MMYA 4ZHRB 3CCSS 1YITS 1K73T 1S79A 4DUZJ 4EYHB 1H7XA 2G0JA 3QWPA 4DL0C 2XG8A 3H40A 2VJUA 2XNRA 3VAMA 4ECWA 2D69A 3UCUP 2NZ4A 4FBUA 2A3JA 1T11A 4GMKA 2M2BA 5GMEA 2VFTA 1IWGA 2EFQA 4J5OA 2COLA 1B64A 1S5ZA 1KQFB 4LMZA 2U1AA 4CP5A 2HK2A 2LQ9A 3TJ9A 3OJUA 4DR2J 2K3KA 2RS2A 1RTZA 1XR5A 1SC4B 3HHLB 2DCLA 3DDIA 2ZBIA 4RW9B 4JUZA 3ZZPA 4CLKA 4KGXB 5BXIA 2NCKL 1YK9A 3D0GE 2C2DA 2VONA 3GMGA 3R5BA 4FVCA 3JTNA 1FNXH 2A10A 1M5KC 3K58A 3A3OB 2ZVSA 4OI2A 4Q2LA 2F1FA 3UR3C 5F41A 4LF6F 3DNCA 3M2UB 4NRTA 2HZAA 4CT8A 3M2RB 4R8UB 1HI1A 3FBBA 1NCLA 1KQKA 2F3JA 3P5TL 1MU2B 4C8NA 3MZIA 3GSIA 4DZDA 4DSEA 3RW6A 1RACB 2HS4A 2MZTA 2V4RA 3IRXA 5CD4H 3ISND 4ILRA 3CPWR 3VQSA 5RUBA 3I4HX 1U48A 2CQBA 2APOA 2E1AA 2HEKA 2QV6A 1I1GA 1TKXA 3FCWA 1RT3A 2YNHA 3SQGB 7FD1A 3SDEB 1RK8A 1HHSA 2M88A 2BW2A 4GKJF 1O5JA 3D3BJ 2CYYA 4OX9F 2C3OA 4LIRA 3PHTA 1KD1T 2MY8A 2FHMA 4ERDA 4ITSA 4USWA 3NMAA 3WDOA 5KG4A 1YHQS 4NA3A 2Q3PA 3KLEB 1X5PA 2BJ3A 2EG2A 3U7JA 3IAS9 4PWDB 2DNMA 4IG0A 3R3TA 2ZD1B 3O44A 4X4NA 2R8KA 3M8YA 1YG0A 1FRIA 4TY8B 1OO0B 3FMBA 3HPOA 1U2FA 4DSJA 1OIAA 1PYOB 1NB2A 2VUGA 1YLXA 4B3MJ 1Q8LA 4G65A 2CQDA 2VU5A 2FZKB 1JLAA 2BANA 4G1IA 4R5PA 1H72C 3C6UB 2XCPA 3TI0A 4OV1A 4OJ1A 3OT9A 2XY7A 4H4OB 1R8AA 1WDTA 4LBPA 3UNGC 3GJQB 2BJ1A 3J80Y 3Q8RB 2IBKA 2CNLB 4N8NA 4DL7A 1B0PA 1WSRA 1J5OB 2ZH1A 2VC0A 2B6AB 4ZPTR 1XBWA 2HHSA 3MM8A 3JTOA 4JI0F 4J9KA 3GIKA 2DIVA 2FY1A 4QIWD 2NXNA 4TYAA 1LQ9A 3JYTA 3G8TA 3SV3A 1XMOJ 2GFFA 2AJ1A 2HKEA 4GC6A 1T05A 4ICLA 4LBHA 2Q6CA 3NCPA 2OFGX 1FXLA 2N3OA 3KLFB 1HD0A 2HMIB 3KWMA 2XS2A 3I9ZA 2ADBA 3AA9A 1SJ3P 2UXCJ 2R3VA 1WORA 3PY8A 4QU6A 1RTDB 1TTHB 1V3RA 4RW4A 1C1BA 2YY3A 5F9NA 1NK8A 1TQLA 5LMUF 1GX5A 2RE1A 4ALZA 2RNEA 2D3ZA 3NBPB 4RNOA 1VQ8S 4NLQA 3BBBA 3QYYA 5IZHA 4IR9A 3RZAA 1KP6A 3PYDA 2ACYA 3SXLA 3HT0A 3DLJA 2DRDA 4CM0A 4QWDA 2JEFA 3IBFB 2Y0BB 3MF5A 5EUHA 5G4DA 3TANA 2I5JB 2OUGA 4DV4J 1FRHA 3DXSX 1S0NA 5ETQA 2W2PP 3W60A 2EC2A 1XEZA 2HMIA 3C6UA 2ZFHA 1NHKL 2MJNA 3IWXA 4X62J 4IKAA 1OMSA 1WEZA 3DOMB 1WF0A 3JTPA 4ZVUB 3D28A 3EWGA 3T6JA 2YWGA 4XK8C 2YH1A 1RT3B 4DV6J 1VQ5S 4IQXA 3M8SA 1WF2A 3CT9A 1M0SA 4K0KF 4AUKA 1QLNA 4JI7F 1PBUA 3W5ZA 2W4PA 3DOLB 3HD1A 2KFNA 3DFEA 1NMEB 5B09A 4C48A 3GIIA 4PUOA 2GQQA 1TVRA 2AF6A 4C8MA 3IN5A 2QL9B 2L3MA 4O44B 3NEKA 2ZD1A 3HSZA 4ED1A 4KHPF 3PFEA 3PYGA 4M95A 3FRZA 3A1YG 3NWRA 1R0BG 4HT5A 3T6BA 3H90A 4ZMMA 2R7OA 4NEZA 3W65A 5K8OA 1HWLA 1SKRA 4OI4A 2JC1A 2RILA 3BEGB 4IG3B 2FYXA 2IA0A 2QJ3A 1XR6A 2OEJA 1TUWA 4I64A 4DV7J 2AU0A 2JVOA 2VG5B 3QIPA 1S77D 2XZTB 4NE9C 4DSKA 4BHQA 4LSNB 4RUBA 4CYUB 1NUEA 3G82A 3SFGA 3AODA 2ZOFA 4WKYA 5KFHA 3N9UC 3OFEA 1TR0A 4B9UA 3J81Y 1D9FA 4ZS6A 1YDLA 1ICEB 2WVFA 4PG5A 1JLGA 1FXDA 1KLMB 2ACMA 3DOMA 4J9UE 4ZCKA 4CLFA 4DSIA 3GIMA 1IKXA 2CKWA 1G7CB 1CS4B 2AWZA 3HVWA 2XZWA 4C0OC 2AYMA 5B0DA 4RNNA 4B9MA 3PG9A 3MI7X 1BQMB 1Q86T 1SH2A 2X1FA 1U7LA 1SIZA 3PIOQ 2M52A 3EZUA 1W2IA 4ILLA 3F56A 1N54B 1TMJA 4FPIA 3T9NA 4PQUA 3D68A 3GSDA 5D0EA 3H5UA 5LM7E 3BQ0A 1U2RA 3EXYA 2R7XA 4LF9F 1CC8A 1H2TZ 1A7GE 2V94A 5SUHA 1GH8A 1F0XA 2BKOA 4YY3F 1N48A 4CLZA 1UVLA 5KFWA 2UXDF 4QZVB 4YR3A 3IBCB 3KJVA 3H25A 4KPCA 4PG4A 5HLFA 3UI3A 1C0TA 3M32B 4OHZA 3D1QA 3CCJS 4CM2A 4ECXA 2LA4A 4A8OA 4RKUC 4DV5F 4OIXA 2HLTA 3MUVP 3PW4A 5U47A 2XSJA 2HZVA 3Q8SB 3H2VE 2LECA 4KHMA 3BS9A 3VR1A 3H2UB 2C2EA 4N41A 5E7OB 2LEBA 4C7QA 3QJPA 2CQ1A 1TP7A 4I7FB 3NLCA 2XBPA 4CLUA 2KTQA 5DGAA 3BO4A 3JQKA 1EX8A 3SMZA 4RW8B 3WC0A 4YQWA 3S1TA 3IR5B 3KYLA 4DV2F 1KTVA 4J90A 4DFMA 2D3OR 3MHYA 1HMVA 2AP6A 4QR2A 5K8MA 3FSIA 2E7VA 1ITPA 2AJ4A 2XHWA 1X4GA 3UVJA 1HLWA 2LXFA 3TEGA 3RBZA 4NMXA 2B43A 1QTMA 3CGIA 3KDNA 3U27A 4TQSA 4BS2A 4R25A 3OL6A 1S0OA 3ZFVA 3Q83A 2OPPA 3TNVA 2M8DB 2UP1A 2DKOB 1WEXA 1VC5A 4GKKF 1QSSA 1FVQA 2B0GA 3MAHA 3QIDA 1RISA 4NLWA 1D1UA 4CCHA 2DGXA 5AE3A 4DOZA 3CJ8A 4K2JA 2B8QA 4UOGA 3IWLA 5E5NA 5J1EA 2XLJA 3MFIA 2SXLA 2KM8C 3UN3A 2XB2D 4BC9A 5F9LA 2HVHA 1C0UB 2B56A 2XYHB 4M5HA 3VGVA 2AD9A 2OPQA 2GCFA 1FJEB 4DR1F 2CPHA 5F8IA 4DUYJ 1F9EB 2W2OP 2N7CA 2MQNA 3AHPA 2MSSA 3CJQA 2N4DA 3M1VB 3CMAS 1VK3A 2GMHA 5DQGA 4DFPA 5LJ5Y 2CPJA 2MZJA 1E6VB 2FVSA 1JLEA 1M1HA 3MEGA 4OYOA 3BSAA 3MR5A 4YDXA 1U1RA 3B8HA 3EGZA 4OZ1A 2C2KB 2Y0SD 4RW7B 3X3UA 1SPBP 2W8KA 1Y0HA 3NAIA 4OYXA 1KVJA 2HPUA 5KFZA 3L95X 1KOHA 1N32F 4U96A 4R5PB 1OPZA 1IKWB 3QFWA 3KJFB 1FRXA 3ZNJ1 1FE0A 1IXKA 1GK8A 1JIHA 2M8HA 2GMJA 2C2ZB 4IQMA 2EPIA 4EBDA 1KDNA 1RKJA 1U0SA 2F8HA 3UD4P 4JI2F 2AJ2A 2UUBF 3W1YC 2XLIA 3LWLA 4LFAF 2XZDB 2AEFA 2RS8A 2BM1A 1SKUB 2WVEA 3UW1A 4IR1A 2NPFA 4DPWA 2JLFA 2CQ3A 3C19A 4RW6A 4Y00A 3UPFA 2YH0A 3HK2A 5HL7Q 3H20A 1B0TA 5JVGQ 3TAMB 2MQLA 1RYRA 1KOOA 1HIYA 2ASYA 2J0QD 3C15B 5ETMA 1UMJA 5D0GA 3CIMA 2CAJA 1FFWB 1RT5A 1HMVB 1X5SA 1IJEB 2R4FA 3FSXA 4ZP6A 3OTOF 5KOXA 1E6YA 4LF9J 3K5OA 2KH9A 4KAIA 1SJ4P 1Y9OA 3B4MA 2KXNB 2Z2YB 2KU7A 1B70B 4E2FB 4ZN1A 3N0VA 4AL7A 4Y3CA 3Q8VA 4YB1P 4WE1A 2KDOA 2VZ9A 5EWGA 3KK3A 1UWBB 5AT1B 2U2FA 5IC6B 4WP3A 4Y65A 3RAXA 3T1HF 1S72S 3LP1B 1TKXB 2F63A 4OZJA 1ZZFA 4I0WA 1UW4A 3VTIA 3WX8A 1F5BA 2C1EB 2MZRA 3MM7B 2DR5A 2UUCF 4OJ3A 1P6TA 5A2QU 1PC4A 2YKMB 4ED5A 1Y00A 5AJ3J 1UAWA 2L08A 2VASA 2ZKTA 3S6EA 3ZZTA 1NK5A 1Y5LB 1Z4UA 2OPQB 4QOTA 3M9MB 4F4ZA 1RT7A 1JJCB 4K2XA 3V4MA 4FS2A 4WZQA 4K4YA 5KT7A 4UOCA 1VQSA 5L39A 4G6VB 3H0PA 4RW9A 2KG0A 3Q22A 2CJ9A 4A8XA 3MWBA 4DL5A 4NPOA 3PR4A 1FF2A 4FKXA 4URGA 3KHLA 5G0RB 1RTHB 2LQ5A 3M8PB 2W9CA 1KFDA 4P52A 2ZWPA 5KG3A 4F4WA 3PNIA 4PEOA 2V2VA 1RHKB 3RYLA 1M5PC 3S8SA 1X5OA 2GQ2A 3LANA 2NQPA 1ELOA 3OVAA 2KM8B 5T7LB 5AXKA 2NXUA 3NY0A 3KXDA 4O0IA 2Y1JA 1R0CB 2JZ5A 2WVCA 2DO0A 1RWMB 1K1QA 1REVB 3G87A 1NKEA 5LT5A 4QYZJ 4A8MP 4ZVSB 2OPRB 3DLKB 3K59A 3UDCA 2P6SA 3J7A1 2OH2A 3FEXB 1N33J 2YTCA 4K4UA 3Q8YA 2NPIA 2AKWB 1GAOA 4GKJJ 1PSDA 2FC9A 3T5KA 5KTQA 4KGZB 4C2MA 2GO9A 1IBKJ 5A8WA 1BE4A 3DLHA 4L76A 1YZ7A 1NLKL 1SV5A 2DGTA 1SB6A 3GR0A 3W9JA 4DV0J 5ETNA 1JLGB 1NDLA 3WIVA 3W2VB 4B02A 3T3FA 2HQ3A 1PG5B 2EK1A 4DV4F 1ZTTA 1TAUA 1JLBA 2MB0B 1RKIA 2RF2A 2XWXA 1BQNB 4KGVB 2MQOA 4FF1A 2VHGA 5H9EK 1VRTB 3QRPA 5ETKA 1SL2A 1XMQJ 1NM2A 2OTLS 3HFVA 3TUPA 1HNXJ 2I9SA 2V8VA 3FKBA 3P4UB 1S49A 3ISZA 4MAKA 1T8EA 4KFBA 1FKAF 1SJRA 4AE5A 3IAM9 1S1TB 1LW0B 3CWJA 3JS9A 2CQGA 1QD1A 5ETOA 3NGDA 3G6ES 3CD7A 3R7SB 9ATCB 2G0IA 5KT5A 2RVJA 4DR5F 3CJRA 5B0AA 3SFUA 3PDNA 1LWFA 2PIIA 2WONA 2YBVA 4S0MA 2QFJA 2KHDA 3I4PA 3T1YF 2IY5B 2ABYA 2LLZA 3FRYA 4J7CA 2MZ1A 2PFDA 1CBKA 1YBAA 1BQMA 1RSCA 3VAHA 1DY3A 3PYFA 2L48A 4XAKA 3VGUA 2CWKA 3R6LB 1F5CA 3QGGA 4LR9A 5FDLB 3MMAB 2CNOB 1RZMA 1JKHA 3TAPA 2GS8A 3ZXWA 4OYIA 2CJQA 4ETXA 2LYVA 4JI0J 4LF7J 4ZPBA 4RPFA 4C6AA 3D3CJ 1EETA 2DXFA 1IVZA 4L3NA 2QMWA 4C97A 2XMMA 3OW2R 1NO8A 3I0SB 4URSA 2LXIA 5HP1A 2OO4A 4DG1B 1U1NA 2CQCA 1X4AA 2UXBJ 2B51A 2JFDA 4FNIA 4CLSA 1S97A 4Y2CA 4QWCA 1D0EA 5KG7A 4OZNA 4KTQA 5E2QA 1RB0A 3DMJA 2ZZMA 4Q0BB 4LF8J 1YJVA 2L9WA 4L73A 3RB3A 4LRFA 1NPPA 2B5JB 3CDEA 2HFNA 3ZC4A 4CDIA 3KLIB 3FBCA 4I6YA 5HMYA 2R2UA 3I87A 5GMDA 3C66A 2YX1A 2W2NP 3IGVA 5BR8F 2OPSA 4LSNA 4USMA 1YRXA 1JXVA 4OHYA 1MWYA 4WBFA 1LXNA 1S7IA 1S59A 3CJSA 1H3DA 2HK3A 4EFAC 1NSPA 2CQPA 3M30A 4WFBQ 5CABA 4H4KA 4Z37A 5C25B 2R2SA 4U7UD 2WSEC 5F0UA 1V6HA 2BA9A 5E3QA 2IVMA 3MEDB 1U4BA 2R42A 2Z4PA 2HFOA 2NUHA 3IRWP 1YI2S 2JLEA 4DLEA 1XMQF 2E7WA 2IRYA 1RYSA 2QMXA 1WHVA 1PYSB 1WKLA 2YKPA 3HVAA 4AQYJ 3NNAA 3MD3A 2NXEA 3Q2TC 1NKBA 1KFSA 4FYDA 5BYSA 2DEIA 2KB2A 4K4SA 4NLGA 4ZN3A 3PYEA 2IAJA 1BHNA 4NMLA 4F0MA 3WC2A 3CXCR 4O23A 1D3WA 2DNRA 5HSPA 1BWEA 3M8WA 1SJQA 2P2CB 4UQGA 4JI1F 2ZDOA 3D5MA 4KHRA 2BQUA 3NNHA 2KHCA 1HQUA 3MMBB 2HHVA 3BH6B 4LBIA 1R27B 5D77A 4CZCA 3T5LA 1IKYB 1Q82T 4PWWA 4Q7AA 1E6VA 1RHJB 2H4YB 2EFVA 4UZBA 1FK9A 2BQ3A 1WI8A 3W64A 3NG8A 5CXTA 1ZH5A 1FWLA 4YB5A 2VDIA 2XY5A 5KFRA 3D2WA 3BGFA 4MH8A 3RR8A 1FDDA 1I3OB 4HACB 4DR1J 1R0AB 3OL9A 3B78A 5D3GA 2VD3A 2R7SA 3MPUB 1K0TA 3BKUA 4DV1J 1YRUA 4EBCA 3R97A 4DWIA 1OY6A 3FCHA 4ZVEA 2ZH4A 2M4MA 4DUZF 3MCOA 3DDNA 1UP1A 1XWLA 3IWNC 5KFQA 4RNHA 1JXLA 1WNEA 2BABA 2FHJD 3SSQA 3MMJA 4JI5J 4MK9A 2Y8WA 2G0CA 3QRRA 3DRYA 3W3SA 4WFZA 1RHMB 1ZBTA 2IJFA 4BWMA 4ECZA 4A8KA 3RB6A 2HHHF 4N5SA 4FBTA 3KMQA 2ATLA 2GJ2A 4ECSA 4ZPWR 4E98A 5IM0B 2M0GB 1UA1A 4O3SA 1KLMA 2AX1A 2E5HA 2VDHA 3DRSA 2B9XA 2VQFJ 3V81B 2BJ7A 2IM3A 2XULA 4H4KC 4Z2XA 2DR7A 2PGCA 4V19J 3J7Z5 1X4FA 2EBEA 5CCMA 3EPIA 3US5A 2AZ3A 4UF4A 4X66F 1T7PA 2X1GA 1FEEA 4M5GA 4OX6A 1KN6A 2I1RA 2VC1A 3FEYB 1T03B 1WC6A 2DNKA 2LQJA 2DNNA 4TKTA 2W9CB 4DPUA 4HHUA 2BDPA 2UUAJ 2YX7A 4ZKAA 4UUXA 2Z2LA 2CFXA 4CRJA 1MG7A 1KQSR 2DEJA 1RBLA 1S9FA 4O4GA 2BW7A 2AYEA 2PA3A 1NJZA 2BQRA 2Z56B 4QIVA 4UQTA 2GZOA 4Y34A 1PBAA 5KFSA 3VAJA 1RWUA 3SV4A 1NPRA 2DO4A 2BBEA 1UW9A 3MEDA 3OTEA 3GTYX 1RT4B 2QYGA 5M2PA 4ZVRB 3IMQJ 4DLGA 2FZCB 1DQ8A 1U6FA 2NS1B 4YB6A 3PEHA 4A8QA 1EQMA 4C3MA 3HVTB 3ULHA 1S12A 5I42A 1QM9A 4G1PA 4TNOA 1T95A 2W24A 2WTFA 1H7WA 3CJKA 5KFLA 3RTVA 1O0PA 3CTRA 3L7OA 3M6WA 2PEBA 3NRBA 5CAAA 3C46A 4LFCJ 1RXOB 2F40A 4MMOA 3PXGa 4FYVB 2AQ4A 1ZM4A 2WB1D 3BB5A 5DO2A 3R5GA 1S6OA 1C0UA 2VV5A 4JV5J 1L3UA 1RWWB 1XK8A 3D1HA 4OI1A 2ROGA 2F8EX 1JLQA 4X4PA 2HAIA 1AB8A 2E29A 3O1LA 3OSNA 5J2PB 3KLGB 2VICA 1L3KA 4JI8F 3KHGA 1HR0F 1ZS6A 3DMJB 4C8LA 4B9LA 1S1WB 3AB4B 2BE9B 1RT6A 3PRDA 4ZIWA 3H5YA 1UVJA 1UZDA 3EVWA 4F50A 3EJMA 4C11A 4RNMA 1KS2A 2DISA 2XSFA 4J37A 2CNKB 3N6MA 2DIUA 3G82B 3QJLA 2BXJA 3ZTRA 3P5BP 2JNJA 2EFOA 1GXTA 5KFXA 3LAKA 4YDDB 3ZTQA 1M5HA 2V50A 2JVRA 3M1VA 2BOAA 2J6SA 2RU3A 4EZ6A 2XMTA 2XLKA 2L9DA 3CW2C 3FZ2A 1WWHA 5F3TA 3UD5A 5CCLA 1U1PA 3R2DJ 4LFBJ 1IQZA 4TU7A 2OD6A 3V4IA 1M1GA 3KLIA 2E9ZA 3U1LA 1WKKA 4NXMF 1HQEA 3NOCA 3K5NA 3NKYA 4TXSA 3M6VA 5H1SV 1M1KT 2G1DA 4ZVPB 1O8BA 1TUGB 2XEXA 2GIQA 3BGUA 4DCJB 2VB6A 4DI6A 4CIOA 4ED6A 1ZAVA 1CJTA 4KBIA 5F3ZA 3ELHA 3UO0A 1QAJA 2AYGA 2MKJA 2FJDB 4K5SA 3CDBA 4DUYF 2VH7A 3BBCA 3NGKA 2E1CA 3DRRB 1V3SA 4JBCA 4RO0A 3RRKA 3JYTB 2R8HA 2BRLA 3KLHA 3CJ3A 3KNAA 2NYIA 4QIFA 4M5JA 4B3SJ 5HI7A 3PW7A 3MPWA 3Q8UA 4Y2IA 2IDLA 4OI0A 4EI2A 3ETMA 4F0KA 3BYRA 3EE3A 3W9HA 4DR6F 2V4JA 2QL7B 1O51A 1F3FA 2AIRB 4JI8J 1AFIA 2GGPA 3D4JA 5E3RA 1X31C 4DX8H 3RB4A 4JYAF 2FJBB 2V34A 4ICLB 5D78A 1D9DA 4EMDA 4ZOSA 2FGCA 4CO5A 1MMLA 2JC0A 4J9NA 2XY6A 4NI2B 4LR7A 4OL8A 5HROB 5LOQA 3K8VA 4X4SA 1VQYA 1KWMA 3OTBA 1RWVB 3H4DA 1MMDA 2WSFC 1BC6A 4KV8A 1R8CA 4WU2A 3OD2A 3BDPA 2EK6A 2XYGB 1U6ZA 2ZC4A 1N34J 2VPYB 2IYGA 5CYMA 2ZBQA 3SSRA 2MKCA 5DZ6A 2LA6A 2J0WA 4U9RA 1WTBA 3AJDA 1TUVA 2AW0A 3HM9A 4L75A 5HJXA 1NZAA 1RHRB 4DPOA 5EWEA 2B4UA 1IQTA 3CE8A 5L46A 3HVRA 1SV5B 4ES1A 1YGYA 1HQUB 3MMBA 4GVLA 1BUXA 2IJNA 2QLFB 5AXMA 4DF8A 3EZOA 3FK4A 2KRBA 1Y3KA 4MTPA 5KG0A 1FJGF 2M9KA 3H42A 4LREA 3P6YC 1QTNB 1RBAA 2VQEJ 1U8WA 1VRTA 2UZAA 3FBFA 4OI3A 2RD5C 3AAWB 1M5VC 2J8AA 2OHDA 4LQ3A 4FS1A 4WFYA 4C11B 5EN1A 3QQCD 1F2HA 3I6PA 1HNVA 5M2RA 2J7WA 1S48A 3JAMY 3VALA 4NASA 2IDEA 2BKPA 4CO4A 2MKYA 2VFSA 1RADB 4BCAA 3BSNA 2MKIA 2RRAA 1R8HA 2FZGB 4IH7A 1RCOB 4M5NA 4CO0A 2F7VA 3HD2A 1LKZA 3Q2SC 3NP5A 4IOCQ 3Q0AA 4C8OA 1S57A 8AT1B 2EKYA 1VISA 3R7NB 3ISNC 3TEHB 4NRUA 1TFWA 1Q7YT 4Q43A 1U1KA 5IC4B 4I2PB 4TY8A 3V4IB 3NNCA 3X1LB 4YN3B 1FA0A 1HWIA 1R7IA 1RLDA 1OSCA 3HI9A 3LAMA 3QBCA 1F9FA 4I2QA 1VQOS 3MCSA 1UWAA 2IPOB 1T02A 2IRUA 2QSWA 4P75A 4XTTA 2MKSA 2PC6A 3AQPA 2CIMA 4OJGA 5KFDA 3LGMA 3PV8A 1ZAWA 2IM0A 3N4WA 4G3IA 3AA8A 1YJUA 3TRGA 3TW0A 1UFWA 2GHWA 1K47A 2WBMA 3D6MB 4KIAA 3F0NA 3I5CA 1DZ5A 2HHWA 1RTJA 4WFAQ 2W25A 4XIUA 1VK8A 1ACMB 1FX4A 4DR5J 5HROA 1VBXA 1HARA 1S6QB 3L9ZA 3LQVA 4PPDA 3IG1B 2DXDA 3T5HA 3RU0A 3CC7S 1PCAA 2HVZA 2HZCA 5CA5A 1BQXA 2O01C 2RU9A 2E7XA 3R5DA 2C2NA 3O2IA 3SQGA 3W2WB 4C3LA 5I3UB 4LR8A 2K2PA 1GXUA 1OPIA 1Z2ZA 2ZNYA 4DS5A 4LF2A 5CYMB 2GGPB 5I4MA 5F8MA 2HW3A
chains in the Genus database with same CATH topology
2MKHA 5KT6A 1QE1B 3PKYA 4X4OA 3CCUS 1HL6A 4X4QA 1NRKA 2YVSA 3K7RA 1RJJA 4URQU 1T94A 3L7PA 3NCQA 4QR1A 4H4MA 1FVSA 4DV0F 1U8SA 4WK1A 5B08A 2R8IA 2R7TA 5CZVA 4AQYF 5F8JA 5L1LA 2UVUA 4CH1A 1QVGR 1C1BB 2B5JA 3LPYA 2HHPA 2BVZA 4KGMA 3T19A 3J7YU 5DLFA 5KT2A 4ED7A 3CJ2A 4WIIA 4I69A 2WK4A 1QAXA 1S9EA 4DFJA 1ZETA 2YNGA 3ENVA 5F8GA 4NLTA 2OKQA 3SZ2A 4F3MA 3I0SA 5HP1B 2VG7A 1FESA 4F2RA 2M5YA 2HG4A 1LFWA 5MLCV 2MQPA 4ZPVR 3CD6S 2HGNA 5KG1A 3OHAA 1TFYA 2ASDA 2KKHA 3OR1A 3JSMB 3EYZA 3PX0A 4ATNA 1RT2B 4RW4B 4ILMA 5I3QA 2D74B 4PXCA 2VG6B 5J2QA 5H9EJ 1DURA 3MTKA 3RBEA 1GQEA 1KSPA 2VPWB 2PD1A 3T5JA 4NLUA 2WOMA 4KB7A 4EO6A 1LWEB 4DQSA 1U24A 4IFVB 1FKOB 3DGPA 4RBVA 1S1TA 3CCRS 2B7BB 2CPFA 1FRLA 3HHKA 1VQMS 1IKWA 3AQOA 5D6GA 2ZC3A 3KKFA 3O6QA 2KFYA 1W2BR 3MDFA 2D1CA 2GHVC 2JWNA 2QE5A 3MECA 1X5TA 1ZTWA 1HWKA 4MK8A 2FC8A 2NREA 1N5VA 3MEGB 4TU9A 3HHDA 2ROPA 2ROEA 4B3MF 3MXHP 1RT1B 4IOAQ 2HRUA 2BUNA 6FD1A 5D8HB 4IH6A 3BJYA 1FJ7A 2UXBF 2CQ4A 2LVWA 1U1MA 5HMZA 3FMWA 4M5DA 4N76A 2IRXA 2FJVA 4ZP8A 4OLPA 4B08A 3M2RA 2W4CA 3CSKA 3FDSA 2GHPA 3GFHA 2B3TB 3LH2S 3FVYA 2KXFA 4JI6F 4A8YA 3RR7A 1S6PB 4WU3A 2WAQD 2OAUA 2F9JA 4LUBA 3E01A 4LF4F 4K4VA 2K3IA 1XMQF 3M6UA 4H54A 2KN4A 1JLEB 2NSCA 1IR0A 2LU1A 3LF0A 1CG2A 1F5AA 5IS2A 1WEYA 1IKVB 4LT6A 1T03A 5C42B 2QLWA 3MM9B 2RQKA 1UETA 3DDKA 1Q16B 3QLHB 1Y5NB 2DK2A 4YP3A 2FLOA 1DTQA 1MROB 2IYIA 3DRSB 4HLBA 3OJSA 1FE4A 3LO3A 1G1XA 4OZLA 2GO8A 2DNZA 1WACA 1R6YA 1R8PA 2BACA 4X4RA 4ZVHA 2HNZA 4M8LA 2NZ4A 1EETB 1T3OA 2BJEA 3QAUA 2MGZA 2J6TA 4DJBA 4TYBA 2RKIA 3PACA 4DR2F 2ILYA 4ELUA 5B0CA 2IVFB 1X9WA 1N5YA 1DQAA 5G0RA 2R7RA 3PJXA 2V8HA 4MIAA 1Q7LB 3LP0B 2DPIA 1FKPA 2HQIA 4I6AA 2JL9A 5J2PA 2CZVC 4PR6A 3IG1A 1SL1A 3G6VA 2YNIB 3HX9A 4DQRA 2VODA 1N8RT 2Q6BA 1JJ2R 5C42A 4EBEA 4NLPA 1MWZA 3V5RA 3CCQS 4EEYA 4XDDA 5EGYA 2ASJA 1HWJA 3GFXA 1NKCA 2DNYA 5LMNF 5DQIA 2MQQA 1S6PA 1YJRA 1RT4A 3GFZA 2RUGA 2K7JA 1VGYA 2IC3B 1JK9B 4NLVA 1KC8T 1N5TA 3MOZA 1RDRA 2GA7A 2ZJQQ 4DR3F 2GV1A 4NOHA 2NLWA 2PEHA 3KFWX 3V6KA 2DCUB 1VRUB 2Z8QA 4KT0C 1EP4A 4YFUA 2FUG9 5JXSA 5K9FA 3K5LA 3TUZC 4RZRA 3CJ0A 2J6UA 2HGLA 4H4MB 5D3GB 2POKA 3M2VA 2KG1A 1KEKA 1Q53A 3UE2A 2RH3A 1WTFA 2Y1IA 4K5RA 3GZ7A 2E1MC 1G3OA 3ONQA 4QR0A 2IMWP 2RQCA 4EBDA 2V8GA 5BYQA 3IBWA 3ENQA 3OUYB 4PRFA 4WTYA 5J1NA 1QUPA 1R89A 4HHJA 2DHAA 3M8PA 3DLLQ 1IBLF 4K50A 1QAIA 4FVMA 3OQ2A 5C24A 5A8KB 2Q66A 2FTRA 1JLFA 4U7CA 4DQIA 4O44A 3P49B 3I82A 2IBOA 2BE2B 5A2QY 2UV8G 2CQHA 2KYXA 3OHBA 1UL3A 4YB7A 3GB0A 3H4BA 2IA6A 1U6BA 2OPPB 1CEZA 2L9NA 2Z0GA 4CO3A 4ELTA 3QGPA 2WB4A 4HI2A 3AY0A 2RIJA 2LXUA 2ZOGA 4KKOB 2W9BB 2K1RA 2PA8D 5E41A 3UR0A 4CH7A 3H98A 2YNGB 5KFAA 2VG5A 1J2VA 4G1QB 3CD5A 2CPIA 2JJ4D 2PFFB 2CQIA 2VQEF 5B0FA 2FDNA 2VQFF 4ECQA 3L3CA 1PO6A 4KRWA 4Y2MA 4ZDNA 5IWAF 4D3GA 3PW2A 4LVNP 5AE2A 2W4DA 1U1OA 3C6TB 3DRPB 2XI2A 3VAGA 1SL0A 3OUYA 1HBNB 1P8GA 3POTB 3QWUA 1K1SA 5F8LA 5FLXY 4DSFA 3QIPB 4QWEA 2XMKA 3F73A 1Q79A 3TAMA 3DYAB 5KFBA 4I2QB 1HNVB 4RNFA 1VQ9S 5DS7A 1KR4A 2MHEA 2KYZA 2IMOA 3PHEA 1WG5A 1HHTP 4X62F 4F02A 2N82B 1S6UA 1VOMA 3DHWC 2AGOA 5KFOA 3DLEB 5HMWA 2EW9A 1UEUA 2OD4A 4C8KA 4PPZA 2MY7A 4Y28C 2RT3A 3N28A 4RX6A 2O67A 4NYOA 3DC2A 4HKQA 2FD2A 1LV5A 5LSOA 5J2NB 2GQCA 1WI6A 3M05A 2F4VF 1UKUA 1X9SA 3OFHA 2A2DA 3L09A 3S01A 1VC0A 1T3NA 4K4UA 4A48A 2XMVA 2QIFA 2DNGA 2EG1A 2FB0A 1E6YB 4PWDA 1NH8A 3SCJE 2CQ2A 3HT3A 2FJXA 1Y4ZB 3RRHA 4W90B 5JVHQ 1NHUA 3SCKE 2V9WA 1XMOF 5E3AA 4KO0A 1TKTB 3W2WA 3CCLS 1G6BA 5CH7B 3A8EA 2XS7A 2N7YA 3OLBA 5D4OA 1S99A 1S9GA 3ITHB 1FERA 1L3VA 2Z2MA 4KFBB 1S1VB 4LFBF 1N52B 3GQCA 1JNZB 3M2UA 3VCDA 2DVIA 2FVCA 2DGOA 2QYCA 5L38A 4XPCA 4NWBA 4ZA1A 2C3YA 4RNNA 2ZM6F 3G4SS 3EZ5A 3PVXA 1VQPS 1HYSA 2EFGA 2RF2B 1LW2B 3M8RA 1RT6B 2P9GA 3K57A 1NK9A 4QIGA 1ZM9A 3MM5A 5J2MA 1X9MA 4KR0B 1NEEA 3CEDA 5E0OA 2IVYA 1TL3B 2CDQA 2MYFA 3BR9A 5G0RB 1OSDA 3QAEA 2WHOA 4M63A 2KT5A 2OMOA 2VL1A 2ZH2A 2R8GA 3C2PA 4QU7A 2DRAA 1SKSA 4DG1A 4TLRA 2W7AA 2V4QA 4O3RA 1RT2A 1REVA 4JI5F 1HNIA 1L3SA 4V19X 3NMRA 2WRMA 1GX6A 3HHLA 2GX8A 3TVZA 2OMLA 5ITHA 2HIQA 5FDLA 4F2SA 5CYQB 2MZSA 3D0IE 3LP2B 3NCRA 3OXLA 4GO5X 2HS0A 2AX0A 4PQUB 3OBIA 4JV1A 3EGWB 5A0YB 4EU0A 3BDEA 2YX4A 3TUJC 1H2UX 2FVPA 2I2YA 2E5GA 3FQLA 3NS5A 1S1XB 2HRYA 4IG0B 2CRLA 3IRXB 5KG6A 3SI8A 2QA2A 5DG8A 4HTJA 5KAKA 2IC3A 1LW2A 1S76D 3CULA 2JDJA 3E01B 2FLLA 4OHVA 3I31A 3GR1A 3ENWA 4Q2MA 5I3PA 5JUMA 2GC8A 2FLNA 1FDNA 2VOOA 1TL1B 3CJKB 2DHXA 2HNDA 1RTHA 3TR5A 1TL3A 1NJWA 1FRJA 3F41A 4AYBD 2J9CA 1M5OC 3K5MA 2OIHA 4FXDA 5L1JA 3DOKA 3HHNB 1UA0A 1IBKF 1N4LA 1H2VZ 1RT7B 4WE1B 4DSLA 1TKTA 2R8JA 3GIJA 2E5IA 4K4TA 3HHLC 3IS9B 3C3LA 4FF3A 2MKKA 3KK2A 4NLXA 5LSRA 1FHTA 2YWHA 3M4XA 1IKVA 2HLUA 1HNZF 4Y0FA 3QZ8A 1S1VA<