1SJ3P

Hepatitis delta virus gemonic ribozyme precursor, with mg2+ bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/rna
molecule keywords precursor form of the Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Hepatitis delta virus
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sj3P00
1U1LA 3CPWR 2DNHA 3B4DA 2CPDA 2MJNA 2EK1A 2J76E 1N54B 5DDPC 2A3JA 1U6BA 2DNKA 3CD6S 2KRRA 2CQGA 2DNLA 1WTBA 2K8GA 4WF9Q 1HD0A 2FY1A 1D9AA 2VODA 5CXTA 2MB0B 2MMYA 3VAIA 4W90B 1YHQS 2CPZA 3DLLQ 2DGVA 4W92B 1PO6A 1ZZFA 3H2UB 2XB2D 5DDQC 2V94A 5GVQA 1K73T 2WBRA 3UCZP 4QQBA 2I2YA 1OPIA 2OTLS 4WKRA 2X1GA 3MD3A 3VAGA 2XS7A 2LEBA 2ADBA 1UP1A 2LA6A 3UD4P 5LXYA 2MZTA 1L3KA 1M5PC 4F02A 3P6YC 2RRBA 1U1QA 4TU9A 3Q2SC 4WFNQ 2CQCA 1M5OC 2PE8A 3CCVS 3U1MA 4YB1P 2MKHA 2HGLA 1WWHA 1FNXH 3CXCR 1FJCA 1WHVA 2LQ5A 1VBXA 2LA4A 3HHNB 2RS2A 2HYIB 2KFYA 1SJ4P 2NLWA 2NZ4A 4UQTA 1JJ2R 2E5GA 3G8SA 3CMES 4CH0S 5LSOA 5JVGQ 3MI7X 2RQ4A 4LMZA 5GAGU 2DGWA 4F25A 1P27B 3TYTA 2OTJS 3CCUS 4IO9Q 3V4MA 3R1LA 4OZ0A 2DNMA 3K0JA 1QM9A 3VAJA 2KVIA 2U2FA 2LXIA 4IUFA 3VALA 2AYMA 2KRBA 4RU2A 1U1PA 1WG4A 2XNRA 1WEXA 1M5KC 4TU8A 1CVJA 2MKKA 2RU3A 2RT3A 2N82B 3CC4S 1X0FA 2AYGA 2QEXS 4QU7A 2LECA 1F9FA 3G6ES 1YI2S 3SMZA 5JVHQ 2CPJA 2RUGA 2CPFA 2MZRA 3EGZA 3VAFA 2DIUA 2ZJRQ 2MZSA 3BO4A 1X4AA 3Q2TC 4J5OA 2DHGA 2KG0A 2YH0A 3CCLS 2HGMA 2E5IA 2DGSA 1WG5A 1ZH5A 2E44A 2DK2A 2X1BA 2B0GA 3MURP 1X4HA 2DHXA 2O3DA 5CA5A 1D8ZA 1AUDA 2M88A 4FXWA 4F26A 3G71S 1SJ3P 3UWTA 2DO0A 2DNOA 3CC2S 2ZJPQ 3G96A 2AYBA 3MOJB 3LQVA 2M8HA 1VQ6S 1FJ7A 1H2TZ 2DITA 1SJRA 1WF2A 4PKDB 4C4WA 2FC9A 2JX2A 1OWXA 3ULHA 3S7RA 2JWNA 2MQMA 1VQOS 2OSRA 2YKAA 1WHWA 2M2BA 1DRZA 5FJ4A 1FXLA 1WF0A 5CYJA 4WFAQ 1HA1A 1NU4A 1KC8T 2CPHA 4C7QA 2MQOA 1A7GE 2M0GB 2MGZA 2DNQA 4UY8T 1U6FA 2RRAA 1QVFR 3UE2A 2DGUA 3CTRA 3BEGB 1PGZA 1VQ8S 2XSFA 2MY8A 3THTA 3SDEA 1WG1A 1DHMA 2AYEA 2CQIA 1U1OA 1XN9A 2CQPA 1R8PA 5LJ3Y 1HL6A 4Y0FA 2MKCA 2L41A 2XNQA 2CPIA 2F3JA 2MYFA 4YUDA 3BS9A 1FHTA 1K9MT 2OIHA 5HO4A 2U1AA 3FEXB 2HGNA 2DISA 1IQTA 2D3OR 1U1MA 1YWXA 3FEYB 4IOCQ 2KM8B 3EX7B 3UD3P 2KXFA 2DO4A 3THPA 4PRFA 1KQSR 4TU7A 1Q82T 4C0OC 4V19X 1KOHA 2G4BA 2XS5A 2KHCA 2MZJA 1N8RT 1VQ4S 2FHOB 4TLQA 3U1LA 1VQKS 3IRWP 3EGNA 2KYXA 1SXLA 2N3OA 3P3DA 5DM6Q 1WEZA 4CIOA 4EGLA 2DNYA 2KT5A 4ZKAA 1X4EA 3IWNC 2DNGA 1NJIT 1VQ5S 3R27A 3P5TL 3NNHA 2BZ2A 3N9UC 2CQ2A 4PR6A 2M52A 4Z2XA 2L08A 3SXLA 3MUMP 2MGZB 2MKIA 3MUVP 2RS8A 3CMAS 2DGOA 2MQQA 3CULA 3NMRA 2CQ3A 5LXRA 4WIIA 2LXUA 2N7CA 3J7ZT 3SDEB 2M9KA 2KU7A 2DNZA 1UW4A 3NNAA 2DHAA 3L3CA 2UP1A 4YOEA 3G9CA 1VQMS 1N52B 3D2WA 1H6KX 1U1RA 2FPHX 5EN1A 4ERDA 3S8SA 1SJFA 2M70A 2CQ0A 1Q81T 3NS5A 2CPYA 1VQPS 3S01A 5IM0A 1QVGR 2CQDA 3CCMS 1YITS 1VBYA 1WF1A 5DDRC 3J7YU 1A9NB 4CQ1A 1VC0A 2MXYA 2PEHA 2MPUA 2I38A 2RVJA 1URNA 1KOOA 2QFJA 2KG1A 3CCRS 2F9DA 3TO8A 2AD9A 3NNCA 3I55S 3BO2A 3UCGA 3P49B 2DB1A 1X5PA 1RK8A 1K8AT 1YTYA 1WELA 2VOPA 2D9OA 2RQCA 2J0QD 2GHPA 5DM7Q 1BY9A 3CC7S 2D9PA 3OW2R 1DBDA 4ED5A 4OZ1A 3CCJS 5HL7Q 3R1HA 3ZZYA 2ZJQQ 2MJUA 4LJMA 1FT8A 1VQ7S 2HVZA 3CCQS 1VC6A 2LMIA 1S72S 2OSQA 1KD1T 1X5TA 2N3LA 4IOAQ 2G0CA 3CCSS 2MKJA 2QA4S 1M1KT 4Y00A 1X4BA 3CCES 2FC8A 1YIJS 1WI8A 1G2EA 2DNRA 2L9WA 3I56S 5D78A 1WI6A 1W2BR 2VONA 2DNNA 1N88A 3VF0B 2KM8C 3VAHA 5LSLA 5IM0B 5IFMA 2MZ1A 1DZ5A 4A8XA 2MSSA 1U2FA 2KXHA 2MQNA 2MSTA 1YJ9S 3DXBA 2F9JA 2LEAA 3HI9A 2E5HA 5ITHA 2LKZA 1ZZNA 2CQ4A 2CQHA 2DH9A 2HZCA 3S6EA 2YWKA 3ZZZA 1M90T 4FXVA 1OIAA 2M7SA 2DGTA 2JVRA 3PIPQ 3UCUP 1FO1A 2J0SD 2M8DB 3US5A 2MQPA 1FJEB 5GAHU 2SXLA 2VOOA 2RNEA 4P6QA 2DH8A 2DH7A 2LYVA 2MY7A 2MZQA 1WHYA 3JB9k 1VQLS 1UFWA 1VBZA 1X4GA 1M5VC 5IQQA 5GADU 2MQLA 3MUTP 2CQ1A 2ADCA 1U1KA 1RKJA 1NO8A 2CQBA 3TP2A 2X1AA 2KN4A 5MLCV 1HD1A 2CPEA 4WFBQ 2EVZA 2KH9A 3RW7A 5DDOC 2CPXA 1Q86T 2X1FA 2ERRA 1X4FA 2LCWA 2G1DA 1JJHA 2YH1A 2XS2A 2EK6A 5LJ5Y 2BOPA 1O0PA 3G8TA 1YJNS 1WEYA 3RW6A 2MHNA 2DHSA 5DETA 2YTCA 1VQ9S 1JJ4A 2KI2A 1X4CA 4CH1A 2Q79A 1H2VZ 3PIOQ 1SJQA 4BS2A 2DGXA 2E5JA 1H2UX 1OO0B 3CF5Q 2JVOA 2KXNB 3CUNA 3H2VE 1B7FA 1Q7YT 1P1TA 3NS6A 2DGQA 4QPTA 2CJKA 2J8AA 5BJRA 3B4MA 5D77A 1R8HA 3G4SS 4LIRA 1VC5A 3MD1A 1X5OA 1U1NA 1X5SA 4M5DB 2OJ3A 2GO9A 3VAMA 3MXHP 2MKSA 2K3KA 1YJWS 2M4MA 3MDFA 1UAWA 3VAKA 1S79A 5GMKa 4U67Q 1WHXA 3LPYA 2DIVA 3BO3A 1JMTA 2JRSA 5H1SV 1VQNS 4WCEQ 5GAEU 4QU6A 2DNPA 1X4DA
chains in the Genus database with same CATH superfamily
3N0VA 1Z2LA 2VBYA 3LH2S 3W9JA 5EUHA 2CVIA 5AE1A 4WE1B 1F3VA 4QIEA 5B09A 3TWZA 1LK7A 4W92B 1ZZFA 3H2UB 4WKRA 3MD3A 5A8RB 1RDRA 3N01A 1EZZB 1UZDA 5D0GA 1B0VA 4CO1A 1IR1A 2MZTA 3LF0A 5HATA 4BDPA 3AB2B 2HS0A 2DVIA 4M5LA 1ZS6A 2KFYA 1HR0F 1HYSA 2OD4A 3R5JB 4ANEA 1MMLA 1KHWA 4JOUA 2QRRA 4JYAJ 4YEAA 2H51B 3I4HX 3J80U 4M5MA 4ZPBA 3DOMA 3EZOA 2XNRA 1EQMA 5HJXA 5KFSA 4DF8A 2RT3A 2FHJD 2QEXS 2YKMB 4DR3F 2X3DA 4QU7A 4DBQA 2FD2A 1PIEA 2IRUA 2IMWP 3NS7B 1RAEB 2ZC4A 2Y1LB 1EP4A 1HNIA 3RTVA 1JLEA 2UVUA 2YNGA 3CSKA 2ZOMA 4KO0B 3ZTRA 3DMJA 4Q43A 4ZP6A 3LQVA 2M8HA 1H2TZ 2DITA 4C4WA 2FC9A 1TKTB 4P71A 2K3IA 2L48A 4Y28C 3QYYA 2YQ3A 4FNHA 1XWLA 2BJ3A 2GA7A 5F0WA 1XIQA 3TA2A 4OJ3A 1F2GA 3DN9A 5HQMA 4LQ9A 1KC8T 3BV8A 1U45A 5A0YA 3GSIA 2D69A 3DKDA 3NBPB 1EQ0A 4IH6A 4WTOB 4M94A 5D0EA 4A4JA 3HSZA 3MECB 3QGIA 1LW0B 2UVVA 3NXZA 1Z1ZA 3K5MA 3EPIA 3MM8A 4TYAA 4L75A 2JFDA 2CZ9A 2M5YA 2L9DA 2DR8A 2DNYA 4DN0A 1NJIT 3H4BA 5LMNF 1R43A 2V2ZA 2QLWA 3PKYA 3CDEA 5IS2A 2DNZA 1KONA 3L3CA 3D2WA 1N5YA 1TAUA 3Q8PB 1ITPA 5G4DA 3S8SA 3R9LA 1Q81T 1JLAA 1UA1A 1JKHB 1UEKA 1WF1A 3J7YU 1IWGA 1QTMA 4B3OB 4Y2KA 5KFKA 1AXQA 4GKKF 2BM0A 3H8YA 2OHDA 5K8OA 2WRMA 4DQRA 3NGRA 1SV5B 1RCOB 2LQ9A 4KC5A 1N0UA 4C2MA 2V8VA 3EDRB 4KPYA 2OSQA 3RU0A 3OUYB 2FYXA 4LSZB 3D68A 1RTDA 1I94J 3MZIA 4WTYA 3GIJA 4KHRA 2VONA 1GMWA 4PWDA 4ZLJA 2MZ1A 1U2FA 2FLLA 3O5TB 2DT9A 1M0SA 3PO5A 5ITHA 4ZVEA 2YNIB 3FNNA 3UQSA 2PGCA 4NYZA 4OV6A 3US5A 4OX7A 1H73A 2ZH7A 4DSFA 2DY1A 3BGRB 3RBZA 2ZM6J 2NSBA 3VTIA 3H0PA 1JLBA 1M5VC 4J9MA 2POKA 1DTTB 1NO8A 2OPRA 1IBLF 2D7SA 3Q86A 2KH9A 2NPFA 2ZWOA 1JJHA 2Q6CA 3DOKA 3OHAA 3CJTA 1YJNS 3KDOA 4ID5B 4UOGA 3N5FA 3OLAA 1RB0A 5DGAA 6FDRA 3PFEA 3G82B 1B7FA 5L39A 2Q6BA 5D0HA 2ASJA 2B43A 5CD4H 2HFUA 2H65B 2QLJB 4LFBF 5K14B 1D09B 2HNDA 2HQCA 2BACA 3CMQA 3ENVA 2K3KA 1NK9A 1TKZB 1S79A 4B3SJ 3D6HB 1J2VA 1X4DA 4N76A 1KQGB 3D0GE 2RKIB 2R8IA 1RWMB 3H5YA 3GG0A 2K8GA 2VPXB 4NA2A 2GGPA 4LF8F 2VODA 3UNYA 4M5KA 2XYPB 2DGVA 2V94A 1K73T 1HQ2A 3PKMA 1V6HA 3GTYX 4WP8A 2ALZA 2V8GA 3HFVA 3EGWB 3P96A 2H4WB 3Q2SC 2RJZA 2VG6B 3V5RA 3M8PB 5LOQA 1FNXH 1NXIA 4IG3A 2UU9F 3H7HB 1NNDA 2HFOA 4U95A 3AY0A 2BE7D 2OFGX 3TR5A 2C2OB 4LF6J 2OTJS 2AGOA 4X4VA 3R1LA 3TANA 1HNVB 1C0UB 2YNFB 3VAJA 2BA9A 3CB4A 1I3OB 2AHOB 3BQ1A 1XNQJ 2CVEA 3TUJC 1RAAB 2P9GA 2CJYB 2CPJA 3Q8VA 3CJ0A 1BGXT 4LF1A 1HI1A 3GYGA 3AAWB 3E01A 2FVSA 5F9LA 3RR7A 2VQEF 3T41A 3GFZA 5FLXY 4MTPA 4NLPA 2DHXA 1XQIA 1DJ0A 4CO3A 3K57A 3OTBA 4XAKA 1E6VA 4PKDB 3JXOA 4LBIA 4JV2A 1RTIA 4D3GA 2C2KB 4DR6J 3TJAA 3M2VB 4DQPA 2GIFA 1RT4A 1VRUA 4PYAA 5I3PA 1WNEA 1HA1A 3MEEA 4KV8A 2MQOA 2BJ7A 4M8LA 1GX5A 3AA8A 3PACA 1ROFA 3VV2B 1WORA 1U1OA 8RUCA 3JQKA 2F3JA 3QATA 2UUAJ 4QIFA 4Z37A 5KT6A 4ZLLA 2IVMA 3FEYB 2XMWA 2B8QA 3IM8A 3RGIA 1KQSR 4YY3J 3CDAA 1WC6A 2H5IB 2BV3A 1TL1A 2V5HG 4I2PB 3M2UA 2B9WA 1FA0A 3J81Y 2E9RX 2CKWA 5C7PA 3DRRB 2DRDA 2PSZA 3LUYA 3N9UC 3JSMB 2MKIA 4M95A 3CJKB 1N34J 4DL2A 2JEGA 3LGHA 4YOEA 3GCWP 3KLHB 1QVGR 2MQ8A 2CQDA 3M2RB 1VBYA 1WC5A 1FF2A 3W5XA 1U2RA 1URNA 3BR8A 2CRLA 1SI9A 3TO8A 1FE4A 2ZITA 3QZ7A 2XBPA 1ULRA 3QMQA 2PMWA 2LFVA 3MR2A 3SQGB 4FKXA 3PO4A 3NOCA 3WC0A 4TNOA 2EI5A 4IQXA 4O4GA 4DZ6A 1S72S 2E7WA 6FD1A 3EE3A 1X4BA 3JSYA 1MMNA 4RW9A 4ATNA 5D78A 3W61A 1YZ7A 1RQ0A 1N88A 5EWFA 4NE9C 4LSNB 4DUZJ 1ZM2A 1IKVB 4DPOA 3LP2B 3CE8A 2V8PA 5BYSA 4BHQA 4CRJA 3PYDA 3KXDA 3NWRA 3GFXA 5KFNA 2ZHAA 3EGVA 4R25A 1EJ7L 4TKTA 4USMA 4QYZK 1D9FA 4X65F 4KQZA 4DWIA 4JUZA 4EBEA 5HBMB 1X9MA 3DGVA 4B9VA 1WHYA 3AOAA 3PX6A 4NCBA 4Q8EA 2IM0A 2CQ1A 3ZZUA 3TP2A 5J2QB 1JXLA 4J9LA 4K5RA 4IYQA 1UCNA 2KZZA 3P5BP 1NMEB 1TK8A 2CZ4A 2KO1A 2GVDA 2CZVC 2O66A 3DU6A 3H5XA 4Z7CA 2BOPA 4G1PA 2VDHA 2GO8A 3RB4A 1XMOF 3RW6A 4CCHA 1UJ5A 2YNHB 2E5LF 4X84A 3ZXWA 2E5JA 1BQMB 2E1AA 2XSJA 4FYVB 3CUNA 4YDDB 1Q7YT 2ZDPA 3MM9B 2IA6A 5M2PA 1JB0C 3I5AA 2FB0A 3KJVB 1VC5A 2FLPA 4DL4A 3DHXA 2GO9A 3BGRA 5F8NA 4CM2A 4V1Ak 3FMBA 2JRSA 1KRPA 1NDKA 4N5SA 2EK1A 1RAFB 5HANA 1HBOB 2ZD1B 1NB2A 1LWFB 4I69A 1HD0A 1HNZJ 1YK9A 2BKOA 4EK2A 2LQBA 1REVA 3IRXA 4ZPVR 3UCZP 2I2YA 2YQ1A 5D4NA 5J2NB 3PRVA 5KG4A 2RDIA 3RZAA 2XCPA 1B7YB 2MLZA 4Q5VA 2DR9A 1VHIA 4F02A 3DLKB 2R42A 4HYKA 1HHTP 1WWHA 2PDAA 2GHWA 4EZ6A 1TUVA 3KJNB 3KK1B 3W2VA 5LSOA 1LWCB 1Q1KA 3CCUS 4LFCJ 1HLWA 4QBUA 1CS4B 3TW0A 2UXBF 2APOA 1U1PA 1F3FA 1WEXA 4IH5A 4N8NA 2C2MB 3JTOA 5DO2A 2RU3A 4DV2J 1OYDA 3F73A 2AW0A 2FJXA 4JV1A 3KK3A 1F9FA 2MZRA 1PYTA 2ZJRQ 1JLGB 2KDOA 2MZSA 4IDKB 2HLUA 1FKAF 1Q95G 2VPZB 1WUUA 1U24A 2NSCA 5HMZA 4G1QB 4ZVPB 3IWLA 5K8PA 2DEJA 2BUNA 2XWYA 1SKSA 5DRKA 1IN0A 1TUGB 3T6JA 3HLUA 1GMUA 4KH1B 1QAYA 4C8KA 1NSQA 2VG7A 5HMYA 3CIZA 2UVRA 5L38A 2YY3A 4NEYA 2OEJA 5GMEA 2DY9A 1U2CA 1NU4A 1K1QA 3UDCA 1X7VA 1SJ1A 3D5MA 3M6VA 3W3SA 3ET6B 3RRKA 3BEGB 2XSFA 3KLVA 4C8YA 2QIFA 2BBEA 5DS7A 2MKCA 4YUDA 2FZKB 4CLLA 2VBXA 2ALYB 4NZ7A 2AWZA 1Y7PA 1PBAA 1U1MA 3NY0A 5E0OA 4IOCQ 3OFEA 2EFNA 1QTNB 3NGDA 2YXLA 3A3PB 4J91A 2FHOB 1OQ3A 2KYXA 2Q43A 4ZKAA 2YVSA 2GZOA 4OJ1A 5E33A 3KUHA 1B99A 4DV7F 4PUOA 4CTAB 4L3NA 3BPSP 1S9FA 2LEPA 2CQ0A 3SBMA 2CDQA 4DX5A 4MYTA 3R8YA 4NCGA 3IBFB 5DJBA 1S1WB 1SKRA 3D0IE 4U7UD 3PYEA 1G4CA 1RT1B 2FJAB 1GNKA 5LMUJ 3M7VA 3T1HJ 2CA9A 1RT7B 3KLFA 4ELTA 2LMIA 1VMBA 1QSYA 2G0CA 4E8UA 4C8OA 3UDEA 3QGHA 4IOBA 1Y9OA 4ZHRB 5DGBA 4DR2F 1QAXA 2Z2LA 4QIGA 1FRMA 2B8PA 3KLHA 4UW2A 5DG8A 3DC2A 4A48A 2GNKA 2MSTA 4NLGA 3IFEA 1EKRA 2JEJA 2E5HA 1KKHA 2ZWPA 2B6AB 2CQHA 5EX3A 2DJWA 2DGTA 3PW7A 1G3OA 3AD8C 2J0SD 3IMQJ 1FJEB 3RB0A 5GAHU 1J5EJ 2J5AA 3JB9k 1UFWA 2EXUA 2FQQB 2IYIA 4NA3A 4UTGA 4JI8F 2PT0A 3DRPB 2ZKTA 5KTQA 1AFJA 5IT4A 4TQSA 1C4CA 2BJDA 3W2WA 4IRKA 2I5JA 3KMSA 5EWEA 5CZXA 2R7WA 3C15A 4LSNA 5AJ3F 4WJBA 4CH1A 2WOMA 4TYBA 3MAAA 2OPQA 1OY6A 2JJ4D 4WKYA 2EPIA 5BJRA 3B4MA 3SV4A 1ELOA 3G4SS 2ZBCA 2HMIA 1YSJA 3W5ZA 4TY8A 2W2OP 3MXHP 2W7AA 3OR1A 3TNVA 1RHMB 2B7CB 2OLWA 3UO0A 3HK2A 2HRUA 1U1LA 3AQOA 2DNHA 4USUA 2B9EA 5E5NA 2J76E 4ED3A 3Q8YA 1WDTA 1RT5B 4WF9Q 3AXMA 2HQDA 1S9GA 3GFHA 5CYMA 2QJ3A 1RACB 3DDNA 4O3RA 1IQZA 2J9EA 3ZZOA 3MPYA 5J2PA 2HFSA 5LM7E 2RRBA 2IM3A 3CCVS 4AT1B 4PQUA 3HT3A 1WHVA 2W1BA 2HYIB 1YZ6A 2DXFA 4WXOA 3OVAA 4LT6A 2Z56B 3C8YA 2R2UA 1UWBA 1V3RA 4FDFA 3HX9A 5F8LA 1N32F 2AYMA 2KRBA 5HQLA 4HI2A 4TQRA 4UF4A 2EKYA 4WXWA 1AZSB 4CO4A 4CO2A 3M8SA 4F3QA 1HWIA 3G6ES 3KHHA 3MAQA 2DIUA 3H40A 4MKVA 4OHVA 3NGKA 4DI6A 3BR9A 1U0SA 1IR0A 3HFZB 1UVKA 2DK2A 2ROGA 1VBKA 4ZPAA 4NXMF 1RGVA 1UTAA 3ILOA 3PFOA 1NZ8A 2VICA 2Z58B 2G2ZA 1UPPA 4DR4F 1CS4A 2JWNA 1VQOS 4O0IA 4ETZA 2AEFA 1TL5A 1FXLA 3G6YA 2ZBIA 4E0DA 1U6FA 4E98A 5I42B 3BH7B 5KG6A 5A8KB 1FNOA 1CJTB 2V69A 4DXLA 1WJ9A 2B56A 2L41A 1H0HB 2BVZA 1SC6A 3THVA 1RYSA 2OIHA 2IRYA 3K5LA 2DISA 3KLEA 2KXFA 3QRRA 3OR2B 4C0OC 2C2RA 2R2SA 1DLOA 2XC9A 3ILJA 2J6UA 3HHLC 4ZJLA 3DGPB 3CW2C 3T1YJ 4K0KJ 1PJ6A 3F56A 2CQ2A 2Z2YB 1N56A 5A8WA 3NMRA 3GIKA 2N7CA 2XMAA 2H5EA 2KU7A 1WC0A 4M63A 3E51A 3R6GB 4B3MF 2FPHX 1TL7A 1VQPS 1V5VA 4B08A 4J9VA 1Q8LA 2OEKA 2ZH8A 2UV8A 2GQCA 1S0VA 3C66A 5K20B 4KFBB 4JI0J 4OHYA 1NDPA 2QFJA 1RXOB 3FUYA 1WKKA 2Y8WA 1VIXA 3FK4A 2QN6B 1UFLA 2R7XA 4USHA 4DZDA 2RB7A 1R89A 4YDXA 3ZZYA 2WVCA 3VGUA 4LR7A 1T0TV 2QGFB 4DOZA 4OLOA 2RF2B 3KLIA 2OFHX 4DV1F 1RWWB 4Q0BA 5LSLA 4HACB 2F9JA 1FD2A 2CADA 2Z4PA 4C48A 4AQYF 2YWKA 2E1PA 5A76A 3V4IA 1N48A 1X9WA 4XPCA 2EFPA 2SXLA 2ASLA 4M5DA 2DXDA 4AXJA 4IKAA 2CNOB 2Q3PA 4NI2A 1BUXA 3CDWA 1HPZA 3QO9B 3K58A 1MN9A 5J1NA 5MLCV 2RH3A 3C14B 4YQWA 4O44B 2OPSA 3SSQA 3JYTB 3VR1A 4JI4F 3MPWA 2AX0A 2ZE2A 1H38A 3CEDA 2BE9B 3CO9A 2KL8A 1YLXA 2OPPA 3M32A 2ZH5A 3H2VE 5LL6d 1X8DA 2QO3A 1IKXB 3NGSA 2J8AA 1FD8A 5B0BA 1EARA 1BWVA 4K50A 4XO0A 4USKA 5B0GA 2W8LA 2M4MA 1QD1A 2YX4A 3IGVA 5HLFA 5D6GA 1WHXA 4WU3A 4USTA 1GTEA 4OYAA 3ELHA 1BXNA 3ITHA 2B9YA 4MFBA 4HHJA 2CPDA 2Z2ZA 3CD6S 5CZVA 2F4FA 1RHQB 5CXTA 2HKEA 2IVYA 4HR2A 3R97A 3VAGA 2W9CB 2ADBA 4K4TA 4I1TA 4IFVB 4WWSA 2JC1A 1ACMB 4G3IA 5KG1A 1TV6B 4TU9A 4WFNQ 1LQ9A 1NRKA 2Y0SD 4C0HA 4EBCA 2MKHA 3TARA 4X4SA 2IRXA 2BJ1A 1ZM9A 1YGYA 2RQ4A 2VB6A 3LP1B 1SQFA 3LALA 1FNMA 3IAM9 3AODA 3VALA 4ZVTB 3HHLB 5FD1A 4JI3F 4ZK7M 2CNLB 2ZBQA 3ZFVA 1VRTB 1YI2S 5IT9Y 3TAQA 2PMHA 1X4AA 4RR5A 2E66A 4WPAA 1ZH5A 2FJVA 1HFEL 4IG0A 2XQCA 1FVSA 4DSEA 3GG1A 2O3DA 5KFVA 3MEKA 3H2LA 3HHDA 4A47A 1EETA 2ZJPQ 3G96A 2DD8S 1QDUB 1T95A 1F5AA 5E7OB 4JV5J 1KNZA 3TZWA 4F0MA 2KHDA 4HDHA 4EZ9A 2EC0A 5B0EA 3JTNA 3Q0AA 3UE2A 5E3PA 4B9NA 2MY8A 5C2GA 4A8FA 3LP0A 1F5BA 3MMBA 4URSA 4DR5F 3CWJA 1IBMF 1M5HA 1IKYB 2IBOA 1VK3A 2K2PA 1Y0HA 1VQKS 2L3MA 1HBUA 3BQ0A 1S6QA 2FDNA 2OMLA 3HVRA 1FDBA 3AD7C 2R7QA 3MUMP 3TX0A 1U48A 4USVA 2IFXA 3I0RB 2AQ4A 2CQ3A 3GYNA 4QOTA 2UP1A 1MWQA 2FJEB 4ERDA 4WK3A 2WVEA 1MWZA 1KSPA 3CJ3A 4DV3J 1FK9B 1B4SA 3J80Y 3LA0A 2XMTA 3CCRS 2VFVA 4DLEA 2Y3YA 2GAHC 2HEKA 1MU2B 1JNZB 1RTJA 2D9PA 3RJMB 1DBDA 4ED5A 2LQ8A 4ILMA 3R1HA 3RAXA 4OYXA 4ICLB 1HQEA 2HW3A 2DBBA 3BB5A 3L95X 1VCTA 3D0HE 1IM4A 4G1IA 4ECZA 4BCAA 2VD3A 1CSJA 2VA2A 1VS3A 3JQMA 2HHHF 2L9WA 4ZDNA 2KM8C 4ECYA 1DZ5A 3QT7A 4ZN1A 1YJ9S 3UW1A 2HS3A 1E6YB 1T9UA 2BW7A 3W66A 3TJ9A 2BE2B 1A6LA 3PM9A 2O1PA 4I0WA 5IV3A 3CJSA 3J7Z5 2BQUA 2DH8A 3G2XA 2LYVA 3OSNA 5B0AA 1SUQB 5GADU 3T3FA 2E9ZA 4UUXA 1HR0J 4X4QA 3G86A 2KZMA 1U0HB 3GB0A 3Q8RB 1HHSA 2A10A 3HP6A 4DPUA 2RILA 2YTCA 2UUCF 2GVZB 4TXSA 1L3VA 4C8NA 8AT1B 5LT5A 3MGJA 1JLFA 3RAMA 4FYDA 3FZ2A 1NHUA 5D3GA 2CJKA 4JI7F 3OL6A 3A3NB 4DR3J 4HDGA 3PYFA 2VV5A 4LUBA 5L46A 5KT3A 1U1NA 3MPUB 3PCOB 1KP6A 4OZ3A 1WC4A 3D66A 3HZEA 3AA9A 3A8JA 3ONQA 5BYRA 4TY9A 5HROA 2B5JB 3P45B 5D4LA 2OKQA 1RAGB 4EFAC 2NYIA 1RAIB 3HJFA 4MKBA 3OQ2A 2HNYA 1Q4RA 3DLEA 4P72A 3VAIA 1YHQS 4OJHA 2B4PA 3JTPA 5DDQC 2WBRA 2X1GA 1PSDA 2NXEA 1UP1A 2J0WA 1FTRA 3KJQB 4J9UE 1L3UA 1OPZA 2W2NP 1WC1A 3MM7B 3P6YC 3OJSA 4L72B 1PILA 3JS9A 2ZEJA 1RWVB 4ELVA 2GQ2A 3J7A1 1G7CB 5KFHA 4MKAA 5D0RA 1IBCB 7FD1A 3TVKA 2A2DA 4CH0S 5C5JA 3FQKA 3T19A 2RD5C 3W60A 4OZ0A 4LF9F 4NMXA 3QZ8A 2VH7A 2R9LA 2IJNA 5H9FJ 2P6TA 1ZA2B 3KHRA 4OFZA 2MKKA 1TL3A 1V3SA 3BSNA 3B6BA 3DRYA 3D3CJ 4KPCA 1H98A 3DLGA 4F04B 5LMNJ 2QLBB 2WZ1A 1T3NA 3FMWA 1YRUA 1S9EB 3HHLD 1Q0NA 3BDEA 2E44A 2BR0A 3EDQB 4XPEA 1KFDA 1UVNA 3EICA 4NCAA 1AUDA 3OTDA 3P4UB 2PFFB 2KJVA 4X4RA 3MOJB 2XMKA 2UUTA 3IP0A 1RU2A 1RP5A 1YJTA 1BWEA 4GKKJ 5FIIA 4R5PA 3O3LA 3V81B 4CLUA 5KFFA 5IC6B 5KG0A 5KAKA 2NXJA 3LAKA 1NKCA 3ENWA 3K2YA 4ZPDA 4ZJQA 1S1XB 2WSEC 1HWUA 5K9FA 3FSYA 5LJ3Y 5AE3A 3OL8A 2AJ0A 3LAMA 3IBCB 2KM8B 4PG5A 3EX7B 3DLHA 3MMJA 1RZMA 1HQUB 4KR0B 4H4OA 1VQ4S 2RSQA 4ZOSA 2BMBA 3HSGA 4KT0C 2XMUA 2ASYA 3GIRA 4KTQA 3C16A 1R0BG 1VQ5S 5T7LB 4NLVA 3NNHA 2VHGA 3SXLA 1S7HA 4LF4F 2ZH1A 3KNGA 2EG1A 3M30A 3EYZA 3EJMA 3I9ZA 3IG1B 3J7ZT 3SDEB 4EU0A 1N52B 1FRHA 1IBLJ 1IR2A 3UFCX 3BGFA 2BJEA 3GLJA 2RVJA 1KOOA 3PTWA 5KFUA 2XMVA 4OJGA 2F4VF 1NK0A 3G8QA 2D9OA 2H1YA 3MM6B 1S7IA 1BY9A 1SH0A 3NMAA 1CJUA 3PR4A 4M5JA 2J6SA 4LFBJ 2AGPA 2RQKA 1XR5A 3CCQS 2HVHA 4EWTA 5AT1B 1X5TA 4Y34A 1QE1B 2LLZA 1M1KT 5BXIA 4KGXB 3CCES 3I56S 1KLMA 4FP9A 1GK8A 3PG9A 1S97A 2YBVA 1YJUA 3O2IA 3NL0A 1RWNB 4OZ2A 4LF8J 4EO8A 4ZLPA 4RNFA 4ILLA 2CQ4A 3SQOP 4FXVA 1AA1B 3BM7A 5I4MA 3KUGA 3C6UB 3EVOA 1KEKA 2M8DB 2W01A 2PMZD 1SCJB 3PX0A 2IHR1 4RW4B 1G6BA 4IFYB 4B9UA 4URQU 1TUWA 2CAJA 2KT2A 5KFLA 2UU9J 4UZCA 1OSDA 2EVZA 3MR6A 5L8RC 1MN7A 5DDOC 2CPXA 3D4JA 3OLBA 1S99A 4BC9A 1IXKA 2HRYA 2GMJA 1HI0P 3MMAB 5DG9A 4P2XA 3BZQA 3UN5A 1HARA 1AB8A 1WEYA 2DTJA 4J9SA 1FDDA 2G0JA 4ECXA 2Q79A 4RWWA 1UVMA 2J7UA 1RA7A 3X1LB 2RHSB 1LWXA 1P1TA 2F7VA 2G0IA 5D77A 1WSVA 4KRWA 4RW7A 2NS1B 5B0CA 5F8JA 4K2JA 2VQEJ 1UAWA 2IM1A 1XERA 3LPYA 3BO3A 5J1EB 1VQNS 3IR6B 3K0JA 5J2MA 3GPAA 2LU1A 3HSJA 1N54B 3MEGB 2WONA 4UUWA 3HKWA 5HMWA 2FY1A 3H42A 4U9RA 3TVYA 1IVZA 3FSIA 3GIMA 5GVQA 2LDIA 1LW2A 1F0XA 1NH8A 1HIYA 1L3KA 1HBMB 2BW2A 3SI8A 4QIVA 1NBEB 3PRBA 4HKQA 4DCOB 4KHPF 1FJCA 1UVJA 1R0AA 2A6MA 3FSXA 4NOHA 4EI2A 4RX6A 2QL9B 1RABB 1RT2A 3MI7X 4URGA 4ELUA 4OZJA 3V4MA 2BJ8A 3SCKE 1TVRA 4PXDA 4LR9A 4IUFA 1FKPB 4RU2A 2C3PA 3WC2A 1B64A 1RLCL 2FVCA 3B54A 1CJKA 2VBWA 3CC4S 1X0FA 4ZVRB 3DYAA 1T03B 4XTTA 4PWWA 2N7YA 1GAOA 4NYOA 2GAGC 4ED1A 2W4CA 4ZVGA 1JLCA 4B9TA 3IBWA 4DSKA 4N41A 2IAJB 1VI7A 2X7IA 3MURP 3L4BC 4GO5X 1C1CB 2J7KA 3DM2A 1J5OA 2ZH6A 1FEEA 1KHVA 2G2OA 4FN5A 3T5JA 1O5JA 3FKBA 1OWXA 2ZH4A 1VQSA 2VDIA 3LO3A 2M2BA 4I2QB 4KE5A 3OJUA 4A8SA 4DV0F 2MGZA 2HQFA 1AW0A 1Y5IB 3I0SB 1H3DA 4OHZA 3AJDA 3H4DA 1WG1A 3OVBA 1CJVA 4CNYA 1S9EA 4F4XA 5HO4A 1U8SA 1IQTA 4F8RA 1U8WA 4J90A 3UD3P 2DEIA 1DTQB 2KHCA 4KJIA 1HBNA 4NLDA 1O6XA 4G6VB 1C2PA 3AH6A 1D9DA 2RDJA 4DS4A 2I9SA 4PG8A 2ZH9A 1S6PB 5I3QA 2F5GA 4X65J 1R8BA 3QWPA 4GC7A 5C42A 2AEMA 3RG6A 4XDDA 2V68A 1NPKA 3CCTA 4R8UB 2XO6A 4UZBA 3PNIA 3FFIB 1S1VB 4FZVA 4LIWA 4ZPTR 3M9OB 1K44A 3LTOA 3MOZA 3CJQA 1JNRB 3KLGA 1SJFA 1RT3B 2CPYA 3S01A 3I32A 1BQNB 1PC4A 3QIPB 5C25A 3TI0A 4Q45A 2KG1A 1XMOJ 2YWGA 4BWJA 1RLDA 1Y3JA 2E5LJ 3QJJA 3DU5A 1YTYA 2VOPA 4GMKA 3BJYA 4K59A 2W9BA 4DHVA 4XK8C 3RB3A 2MJUA 4LJMA 3TRGA 1FT8A 3MFHA 5C24B 2HVZA 1TK5A 5EX0A 2MEWA 4DX8H 3CT9A 2MKJA 4RW8A 4F4YA 2QA4S 2AJ1A 3BKFA 1D8YA 2FVPA 4CO5A 5ETRA 3C6TA 3LW5C 4YB7A 5L1LA 1KQFB 4FF1A 2ZH2A 1FDAA 2R7OA 3QLHB 3HI9A 4L73A 3WX4A 2JLEA 1F9HA 4H54A 2HZCA 3S6EA 3O8WA 1MNEA 2J7WA 4M1KA 1IKWB 2I8EA 4NZ0A 4H4KC 3GILA 2MKYA 4MIAA 2RNEA 3CJ4A 2XEXA 1VQLS 1VBZA 1LWEB 1QAIA 1X4GA 3IS9A 1UW9A 4JBCA 1IM6A 3W5YA 2KN4A 1S59A 2ZBPA 3RW7A 3MEDB 1X4FA 4YHHF 3NWGA 3W62A 3IR7B 2DHSA 4Y6IA 1X4CA 4YR0A 4C3LA 2UXBJ 2OP5A 2QMXA 1H2UX 4J9PA 2JVOA 2PFDA 3KWMA 2BANA 2BYCA 3VCDA 3H90A 4OX6A 3GJQB 4LIRA 2OJ3A 1VJWA 2ZNZA 3GFYA 3Q8QB 1S5ZA 1ZTWA 4TN2A 2F1FA 4NLYA 5H1SV 2DNPA 1M5KC 1SVDA 4JI5F 1SBRA 3FJ2A 2FHJA 4ED8A 4HHHA 2A3JA 1FFGB 1JIHA 4QWEA 2WSCC 1AROP 4N7TA 2OGUA 2P2CB 2EFGA 1RBLA 2RDDA 4EO6A 2YWEA 1FESA 2GIRA 3V6DB 2XS7A 4J9KA 3K5PA 5LXYA 1RTHA 3MM5A 3OPKA 1RHKB 3W65A 1T9YA 1F1BB 4WP3A 3FBCA 1GEHA 2A0FB 4ECVA 3L7OA 3H98A 4DCJB 1M5SA 1X60A 8ATCB 2LQ5A 3W63A 5L9XA 5KFTA 2AMCB 4KH0B 5KG7A 4DV5F 3H59A 4PYDA 3T5KA 2PA3A 5JVGQ 4AE5A 3DI6B 5KFMA 3M1VA 2YKNA 5GAGU 2BM1A 5HP1B 1BLUA 3R3TA 1UEVA 2DNMA 3KK2A 3LOUA 1WG4A 3UD5A 1PC5A 3QWUA 1F5CA 3PXGa 3JSRA 3M4XA 2LECA 5JVHQ 1Q16B 5I3UA 3EVMA 2XY7A 3CCLS 1BMQB 4KKOB 5K5MA 4WIQA 4ZVSB 4DV7J 4BWMA 3SFUA 1SJ3P 1WOSA 5B08A 3EXYA 1FJ7A 3N5BA 4P7TA 4KHMA 3W8PA 2OSRA 2HBYB 2NQPA 3SFGA 2N4CA 2DR7A 1CC7A 3VZHA 2CPHA 4M5HA 5E3QA 3H25A 3LGMA 2GMHA 1VQ8S 2DRBA 2AGQA 3DLBA 5HN0A 5E3CA 3HVTB 4RNMA 1HL6A 1VIOA 1P9QC 1S0MA 4DR2J 1C0TA 3QT5A 5A6WA 3PEHA 1S6OA 2MZJA 1N8RT 1JLQB 2FZCB 1Q5VA 5H9EJ 1ZAVA 1V9OA 2JEIA 2H4YB 1SXLA 2JLGA 3B78A 4EGLA 3WZ0A 4NLRA 3CDUA 1WSRA 3A4TA 1W7WA 3ZTPA 1S4EA 3NGTA 3TAMA 4Z2XA 3QRQA 1WD6A 1XEZA 1VFJA 5CYQA 2CNNB 1IBKF 2YWHA 5KOXA 2O5DA 1FRKA 4JI8J 4WBFA 1JWWA 1CLFA 3OBIA 2RAQA 5IM0A 3BGUA 5CCLA 2WTFA 3T9ZA 3EZUA 2E1MC 4I7FA 2MPUA 4OIXA 2V4JB 3BO2A 1C4AA 5AJ3J 1Q5YA 3E8OA 4Z7YA 1MWYA 5KFWA 3DRSA 3HPOA 3DOLA 2UUBF 2B51A 3CC7S 1V5IB 4DR1F 1MROB 1WACA 4MK9A 3W8GA 2BKNA 2HNZB 5JMNA 3GJSB 4PZVA 4H4MB 1VC6A 1ZBTA 2IC3A 4WU2A 5FDLB 3TA0A 1R6YA 4WZMA 1X0PA 1TK0A 1G2EA 1FVQA 1HNWF 4ZIWA 2ROPA 3ZTQA 2X51A 3IXQA 2ZH3A 2MQNA 2HK2A 3NLCA 3RYLA 2LEAA 3WDOA 2V2KA 4BC7A 3ZZZA 1HMVB 3LWMA 2VG5A 1DFDA 4ED4A 5GAGI 2R7UA 4K4SA 4CLWA 2C3MA 4JI6F 2CJXB 1S1UB 1ZPVA 1BQXA 4CLKA 3PY8A 3E2EA 4A8YA 1S1TA 1YJ7A 4KAIA 3RUBL 2YWWA 4F67A 3POTB 2CPEA 4OQJA 1ZTTA 3EMTA 4WE1A 2VQFF 5B7WA 3J7YI 1N32J 1RTZA 1SJQA 2DGXA 5A8RA 2VU5A 1T05B 1KS2A 4C8MA 4FPIA 2RMLA 4BLGA 2XY6A 2QYCA 4ZS6A 3VHQA 1YRTA 1ZOTA 1YJVA 3MD1A 2BQRA 4GVBB 4RBTA 3UVJB 3MDFA 5ETPA 3HZGA 1TKDA 2DIVA 2PEBA 5E3AA 2QV6A 3TZZA 4CP5A 5A6PA 3D1OA 4C11B 4A8XA 3TX8A 4NXMJ 4O0NA 1GXTA 4USIA 2C2ZB 2WW8A 2F63A 2ILYA 2XZDB 3EVWA 1Q7LB 4P73A 3R7SB 1H7WA 4LSLB 3R5AA 2MB0B 2FZGB 1UZHA 5ETKA 4DR4J 5HMXA 2ZDOA 7FDRA 3TJ8A 2YKMA 1UEUA 3W9IA 2E1RA 2NYHA 3UD4P 3BH6B 3M05A 4KBIA 3F44A 5F0UA 2J9DE 4YB1P 3RAQA 2V8HA 2RS2A 2XLIA 4O3OA 4KO0A 4K4XA 1U4BA 4HI1A 5B0DA 2DR5A 4F25A 5HVFA 3TYTA 3L9ZA 1TKTA 1YBTA 1S4FA 1GTHA 4IH7A 2Y0BB 2UXCF 4C8LA 2N82B 3N6LA 2AYGA 4L74A 2V4QA 3IO1A 2ZC3A 3NBPA 3M9NB 2DHGA 3HJVA 5ETLA 3MWBA 3DXSX 4NLUA 3UN2A 4HH1A 3MECA 4ANDA 1RAHB 1LW0A 1V3ZA 4B3MJ 4FXWA 4ECQA 1HYSB 2B4UA 2HQ3A 4GO7X 2BX6A 1RBAA 4EYIB 4F4KA 3RBXA 3RBDA 1NEEA 2BDPA 5CHCB 4QCLA 4FYWB 4X4UA 3DOMB 1DRZA 1SB6A 5IV4A 4LF7F 2E1CA 4RBVA 3CTRA 3CDBA 4NLOA 2AYEA 2CQPA 3PW0A 4NPOA 1EP4B 1HNIB 1K9MT 3O6QA 1JKHA 1B3TA 4Y2AA 1JLEB 3JAMU 4DV1J 1SC4B 2YNGB 4B3OA 4JB8B 1HW8A 3MPVA 1VYAA 3DMJB 4DL0C 2G4BA 4O4RA 1RI7A 1T8EA 1MMDA 4AQYJ 1SV5A 2H3EB 1X4EA 4DPWA 2VJUA 3RRGA 1X31C 2QL5B 2BZ2A 4PR6A 4DLGA 5A0YB 2AT1B 3OUYA 5LXRA 2W9AA 2XLJA 4ED0A 1H6KX 2V6AA 4FBTA 3NCRA 3HVTA 3ETOA 1NSAA 5F8HA 1KDNA 3HD2A 1KBRA 1WTFA 2I38A 2H54B 1NZAA 4JI4J 2YNIA 3DLJA 1JXEA 2GX8A 1NB7A 5ETOA 3MM8B 2CJ9A 4USJC 4UY85 1NPRA 2COLA 1FFSB 3OW2R 1QY7A 4PXBA 2NR0A 3L7UA 2MLXA 3BPDA 3D6MB 2WCXA 1QAJA 1DTTA 1LXNA 3VVTA 5BR8F 3HO1A 4X64F 3O1LA 1FTCA 1N5YB 2DNRA 1KR4A 5EDWA 1AUSL 2DNNA 3BGLA 1TZ0A 1JLAB 4CYUB 2NCKL 4ID5A 4DF4A 1MW7A 4RLEA 2KYZA 2KTQA 3UR0A 4OI1A 3G82A 4FNIA 2C2DA 4X66F 2N4DA 5IXUA 1B0PA 2R8GA 2HQIA 3RB6A 5K14A 2MQPA 5F8MA 3N6NA 4FS2A 1U26A 1TKZA 2RIJA 1BHNA 4PXCA 4ZVHA 4CLPA 2ADCA 2R2TA 5ADZA 4AFFA 4H4MA 4OYBA 1QSLA 1TP7A 2WVFA 3TUIC 4RU9A 1HD1A 4DUYF 1RTDB 5D15A 2RKIA 2UXDF 2FY8A 2HFVA 4PWDB 3G8TA 5DLGA 2KT3A 1VQ9S 1F9EB 3DRXA 5KT5A 2ZOFA 1VLOA 2IJRA 4ES3A 3PHTA 4JI3J 3MTKA 1DURA 3PX4A 1KFSA 5EGYA 4OZ5A 1R8HA 2VG6A 4RPFA 3M8PA 1ZA1B 2F8HA 3AOBA 2XYHB 2D3O1 3QSIA 1JLBB 5GMKa 3IA0A 4KGKA 3HVWA 4WYWA 3AHPA 4EEYA 1JMTA 3KTQA 2IMOA 1CPZA 2OPRB 3VZIA 1SH3A 5IQ6A 2R8JA 1HNVA 3NAHA 1C0UA 2YNFA 3IC1A 2DNLA 3DOKB 4B3RF 4CH7A 5L1JA 5IWAF 2MMYA 3CD0A 3CD7A 3FBFA 4NYPA 2CPZA 2IIHA 2AJFE 4K5SA 4DV4F 5HJYA 2OTLS 1KTVA 4P2FA 5AXKA 4OI0A 3HDSA 2HNDB 2AX1A 2VASA 4ZPCA 3Q22A 4YP3A 1B0TA 1Y5LB 4D3HA 4N8OA 4UQTA 3VQTA 4DR5J 1U7LA 4WFZA 1IBMJ 1P27B 2EEYA 4IO9Q 3SV3A 1NDLA 1QM9A 3JSBA 1O51A 4NRTA 4OZNA 2Z2MA 1TFYA 3M2VA 3TVZA 2GGPB 1EAYC 3GJTB 3PYGA 2IY5B 3GU0A 2QFIA 2CYYA 1RUSA 4ES2A 3VAFA 4ECSA 3BGOP 5HVHA 5AXMA 3ETMA 3VGSA 2V2VA 4OI3A 2WHOA 4IG3B 6AT1B 4OX9F 1JXVA 3CCZA 4EUVA 2AKWB 5KFZA 4ZP7A 4QW8A 1VQ6S 4I2PA 3GMGA 1FDNA 4A8WA 2JX2A 3DRRA 5A2QU 4HHUA 2YX7A 3ADAC 1SPBP 3JSMA 1XTZA 3CJKA 2RRAA 4UY8T 4U7CA 1QVFR 4QWDA 4X62F 5D8HB 1FCAA 2CXEA 3E01B 4J7CA 5CABA 1RISA 1UPMB 4DX6A 4DSIA 2DCUB 3M2RA 1EHWA 3OXFA 2HHHJ 3FVYA 1Y3KA 2DO4A 4RNHA 3THPA 3OTOF 2W25A 4LREA 3U1LA 1E6VB 2I1RA 1RTIB 4QIWD 3NKYA 2E7VA 5D4OA 1WEZA 5ETVA 4RKUC 2B3TB 2MTLA 3SQGA 4UOHA 2C3OA 1RT4B 1VRUB 2Z8QA 4PG4A 3C3LA 3MEEB 4KV8B 4RWXA 3CMAS 3H20A 3N4WA 2C2NA 4DV6F 4OYZA 4DL3A 4QR1A 3NNAA 2AJ4A 1URRA 4EMDA 4ZCMA 5EN1A 2KJWA 2HVEA 1VC0A 2Y1JA 1IKVA 3LP2A 2LP4A 4B9MA 3GCXP 2UUCJ 3C46A 1TL1B 4DPYA 3M2UB 3BSOA 5HQ8A 2FHMA 4HL9A 2QA4G 2HS4A 1TTHB 2VL1A 2XTJP 3MCOA 1RHUB 5HBMA 1ICEB 4JI7J 3RBEA 2JH3A 4NLTA 1N5VA 1KVJA 3KOAA 1VQ7S 1CULB 1FI4A 5J2QA 4PXEA 4OHXA 3CCSS 3U7JA 1YKWA 2E7XA 4CM0A 3VF0B 4JI2F 1L3TA 2YNHA 1LV5A 5KFIA 3R5BA 2R7VA 3PVXA 1U09A 1UWAA 4ED6A 4ZVUB 2RE1A 2GJ2A 4CNZA 1BQMA 4DJBA 4KYZA 5JJBA 5KFGA 3MM9A 2JL9A 2JNJA 3BBFA 4B3TF 2HPUA 3MR7A 5HVGA 2C42A 5KFYA 1W2IA 5DQGA 1FRIA 1APSA 3KJVA 1RWKB 3A12A 4P6QA 2DH7A 5AE2A 2NXUA 2H9ZA 4YB5A 4O4GB 4QWCA 3T5HA 3R5CA 1TQLA 2FJWA 2ZFHA 1HBOA 4OYIA 3VGTA 4RW9B 2ZD1A 4RO0A 4IR9A 3SEOA 1LWFA 2XS2A 3MR3A 3L09A 2DCLA 4NXNF 1H7XA 4QJVA 1O0PA 4UOFA 2MHNA 4ZVFA 1N36F 4LF9J 4PCQA 4CYUA 4ETXA 1N5QA 4F7VA 5J2NA 1OO0B 4RUHA 1GXLA 1GMWD 4X4NA 2ILZA 4K4VA 1H74A 4CI0B 2XWXA 2V34A 1S0OA 3DLKA 2WBMA 1X5OA 1X5SA 5SUHA 3OT9A 1PYSB 3FDSA 3R7BB 3A8IA 3KK1A 3HHKA 1RAOA 3MFIA 2BEFA 1LWCA 4U8VA 2HHQA 4IO1A 7AT1B 1AYEA 2GVDB 3OL9A 2DNKA 1GMVA 2CQGA 4HH0A 1D9AA 4DR7F 5KOWA 1NKEA 3DLLQ 5D4PA 3ZZ0A 3BQ2A 2XSJB 4WFYA 2VIHA 1ZM3A 3AJ1A 2LA6A 1JLGA 4OI2A 2YWFA 4F0HA 1MG7A 3J7AN 4IDKA 3HULA 4DCPB 4GKJF 4G1QA 5GAHI 2JSXA 3HHNB 1VK8A 2KB2A 2W2PP 4LF5F 2ATLA 5KFRA 2GJFA 4KIAA 3NRBA 3D1HA 2LXIA 1RYRA 3C19A 3QBCA 4IR1A 3IAS9 3G87A 1FERA 4TU8A 1LK5A 2CWXA 1REVB 3IRXB 5SZTA 4L6V3 3M6XA 4RUBA 1GQEA 3ET6A 3SMZA 2RUGA 4DL7A 2NREA 4Q8FA 5IOLA 4LF4J 1UETA 2R4FA 2E5IA 2GC8A 3O44A 2HHTA 1X4HA 4DEZA 2HVDA 2WW4A 1S12A 4F26A 1W25A 1HNXF 1T9XA 3W2VB 3A8EA 1PBUA 2WSFC 1CQNA 3T9NA 4QWAA 2FUG9 2WVDA 4CT8A 2F4VJ 1NJXA 1PG5B 4OHWA 4KGMA 3R7NB 5EHHA 3R5GA 1N6QB 3FC9A 2HIQA 1FJGF 3GJRB 1WF0A 4TLRA 3KKFA 2O67A 5LSRA 4DL6A 1QUPA 3TQEA 3KK3B 1NSPA 2Z30B 2A18A 3THTA 2CNKB 2CQIA 3WHIA 4CTAA 3D54A 1XN9A 5B0FA 4P2MA 1QSSA 2CPIA 3AFGA 2U1AA 3PW5A 2HFNA 2XGPA 3MAHA 4LFAF 3KHLA 2VF3A 1RKIA 2QG9B 3OSPA 3TUZC 1S1WA 3TOQA 4TU7A 1AFIA 3QPIA 2MHEA 1N33F 4O3SA 4KY3A 2LU2A 2VG7B 5KT4A 2XLKA 1PYOB 2XI3A 5CD4A 1RT1A 2KT5A 1K0TA 1REGX 2QLFB 4X2BA 1TFWA 2WVBA 4PG6A 5L9NA 4HT5A 1RT7A 4YS2A 2XM3A 3MUVP 2W24A 4ZHRA 2FLOA 2KVQE 1VQMS 1NJWA 2M70A 1WOPA 3CCMS 1XNRF 5HI7A 4E2FB 3QNWB 2PEHA 3HCXA 4C8ZA 3CJ2A 1NH7A 4OV1A 2YKQA 2B6AA 4U6PA 1Q79A 3HT0A 1WELA 2RQCA 2GHPA 2XZTB 2QA1A 4HTJA 2AP6A 1PAEX 1EX8A 1RT6B 2WK4A 3V2UC 2HG4A 3BKTA 2ZJQQ 2ACYA 4UQGA 2G9OA 1DY3A 3DRPA 1YQHA 1VISA 3VGVA 4PUOB 3BYPA 3BN7A 1W2BR 2W7PA 5IFMA 3FRZA 4KSEB 1M1GA 3MMCB 2MSSA 3GV5B 3SCIE 3WBZA 3M8RA 1NJYA 4NCGB 1T9TA 3IM9A 2P8IA 4JV0A 1ZZNA 2JDJA 3SCJE 3IWXA 3B8HA 1U47A 4PWUA 2V4RA 2J9CA 2ZUGA 2IBKA 2R3VA 2MQLA 3KLFB 1FEHA 3ZZTA 4KHPJ 1CULA 1A0OB 2B4OA 2V2QA 4ZCIA 2X1FA 2ERRA 2LCWA 4I68A 1RT5A 4DFJA 2Z0GA 3NOGA 3GIIA 1RJJA 1Y00A 4K4ZA 2K7JA 4C3MA 3FCWA 1GXUA 3CF5Q 3I82A 3NS6A 4U96A 3M8QB 1VOMA 4W4MA 4O3PA 3AJ2A 1TU0B 4I67A 4DFMA 4LVNP 4V19J 4O23A 4WCEQ 1NKBA 5GMDA 2FTRA 2ZZNA 3B4DA 1Z2ZA 2Y1IA 2HHSA 4X4TA 3KNAA 3W2WB 1UFKA 1NUEA 2I5JB 4BBYA 2D3ZA 1SQEA 3C15B 4HVZA 4A46A 1AZSA 1OPIA 2WOMB 4NZ6A 1NHKL 4RW6B 2HLTA 3MAAB 1Y5NB 4Y2CA 2OPQB 1Z4UA 2P9EA 2OAUA 4DV0J 2C1EB 3U1MA 2HMIB 4F4WA 4TY8B 4C6AA 1U49A 4OI6A 3OR1B 4B9SA 2DYAA 5AXLA 4F0KA 2Y9HA 2B9XA 2E9TA 4S0MA 5KFJA 4YFUA 1LEOA 4GC6A 1P6TA 4FKYA 1FRXA 3QIDA 1XMQF 5H9FK 1UMJA 5JUMA 1ZPWX 2HZAA 4Y65A 3KJFB 2LDYA 2W4PA 1S9GB 2HIYA 5E41A 2VPYB 5CYMB 1RHJB 5I42A 4IRCA 2IPOB 1S48A 5A8KA 1CJTA 1NK8A 5J2PB 5KT2A 4JI1F 4NLWA 2HGMA 5K8NA 4PQUB 1WG5A 1TKXB 1UJ6A 1R7IA 5M2RA 1M1HA 4DQIA 1N5TA 3G71S 2DO0A 3OR2A 1FFWB 1QLNA 1CEZA 2EG2A 4UT4A 1UWBB 1HWJA 4WYLA 3SZ2A 3DGPA 3NG8A 2YKAA 2QA2A 3A13A 4I6AA 1AT1B 4O3NA 5FJ4A 3KHGA 2C2EA 1RSCA 2XHWA 2M0GB 4ECTA 5JXSA 3ZNUA 1PGZA 3D6FB 1F60B 5KFCA 4F50A 3KYLA 1DHMA 1N0VC 4J9RA 4AD6A 5DZ7A 3BS9A 5ETQA 1ZYQA 2K1RB 2D1CA 4U7UK 2GCFA 3GZ7A 4KFBA 4PAAA 4PRFA 4CLYA 4OZLA 3QGPA 4JYAF 3GV7B 4F4AA 5F3ZA 1GT8A 4DQQA 1PJ5A 1D1UA 3FZBA 1N6QA 2DNGA 3R27A 1KWMA 2LXFA 3BN4A 2ACMA 2RF2A 4OYWA 1OY9A 4OI4A 2DHAA 1PCAA 3A3OB 1LNQA 4ZLNA 3W9HA 4PABA 1TELA 4MK8A 4M5GA 4YHHJ 4HACA 2PI5A 2NZCA 3GR0A 3KLEB 1CG2A 1TAQA 2W4DA 4NL5A 2F9DA 5G0RB 3I87A 1WOOA 3I55S 1DLOB 1NK5A 2G13A 3PZPA 1WC3A 4ZCKA 2J0QD 4B9LA 5RUBA 2HAFA 3KG4A 4QW9A 4MH8A 4MT1A 2K06A 4ZMMA 2MLYA 1RE1B 1LFWA 1RCXB 3U27A 4ZITA 4A8KA 1R31A 1T9VA 3QO9A 1KD1T 4CWBA 5A8WB 4UOCA 2BRKA 3A1YG 3C14A 4C3KA 1WI8A 4O44A 2ZZTA 1TL7B 3GV8B 3JYTA 4JI5J 4KGVB 3KDNA 1F2HA 3EWGA 4MIWA 4AL6A 4A8QA 1QJHA 1OMSA 4MMOA 3D9BA 5F3TA 2W8KA 2R7SA 1IKXA 1VLYA 1TL4A 1FXRA 4QYZJ 1SC1B 2VC0A 3BREA 4NEZA 2VOOA 1RWXB 1DQ9A 2C22A 3PR5B 1RT6A 3MUTP 3QFWA 4J9OA 1HWKA 1JQGA 4WFBQ 1Q86T 4DV5J 3KLIB 1FWPA 2EK6A 4Q0BB 2EFOA 1R8CA 3ISZA 4NRUA 4NLQA 4HEA9 3MMCA 5IT0A 2CFXA 4P10A 1H2VZ 2HAIA 1OQ6A 2W9CA 2B4VA 4IFVA 4LRDA 3BF4A 4QPTA 3TZXA 3QFHA 1TV6A 3V4IB 4F2RA 2KKHA 3QRPA 4M5DB 2FIUA 3ZZRA 4YR3A 4NI2B 1I94F 3KFWX 2P6SA 5ETNA 1HPZB 4Q2MA 2JEFA 4FVMA 3K7RA 1YJRA 4QU6A 4FVCA 3CPWR 4M5IA 2EW9A 2ZKUA 3LP1A 1XMBA 2OPSB 5L1KA 4QPXA 3PRDA 2BQ3A 2C28A 4RBUA 3CCWA 2UVWA 3CIMA 3HHLA 2ZE2B 2F65A 2VFSA 2QL7B 3BYRA 4QQBA 4GRSA 3ENAA 2W7OA 1VRTA 2VBZA 2OPPB 3CJ5A 3M32B 4DN9A 3KG1A 3L7PA 4P7VA 2ZM6F 4YR2A 4LVOP 3ISNC 1U1QA 1M5OC 3M8QA 2IDLA 1R6VA 1IUJA 3M8YA 3M8WA 3CXCR 4N47A 1SJ4P 5HLFB 4RZRA 3IN5A 5GADI 3ITHB 3UN3A 4MFBB 1U02A 5DLFA 4ZP9A 3D1QA 2Q1LA 4EBDA 2B7BB 2YQ0A 1RBOB 1WKLA 3OD2A 3MR5A 3OFHA 1I51B 1VHFA 5ETSA 4XDCA 2CPFA 3EGZA 4RW6A 3OTEA 3HSDA 2PIIA 2D3UA 1IBKJ 2DKOB 3F0NA 4DSJA 3F41A 2DPJA 4B3SF 2PA8D 2HWTA 1LOUA 2GMLA 2I6WA 1Q8IA 5CA5A 1IKYA 3CD5A 1FRLA 2RUSA 5J1PA 1SC3B 4YN3B 1SL2A 1SJRA 2J0XA 3FBEA 1WDDA 1FX4A 2HFZA 1R0CB 2FHKA 3TEHB 3UPFA 4F2SA 3MCSA 3JQJA 3HFKA 2L9NA 2UUBJ 4RNNA 4DR1J 1DQAA 2DNQA 4RNOA 3I0RA 3Q23A 3TEGA 2IA0A 4MJKA 3AT1B 2WB1D 4N56A 1S76D 2NXCA 1TKXA 4IG0B 2MDAA 4LF6F 2XMJA 1FK9A 1HNWJ 1Q82T 4MKYA 1B70B 1EETB 3EM1A 4YB6A 2P9CA 4W98A 1QUVA 3EGNA 2NPIA 1XNQF 1MU2A 2N3OA 3HF5A 3KG0A 3FQLA 1XR6A 5L1IA 4ICLA 3UNGC 4QR0A 3OXLA 3OL7A 4C9DA 4CLSA 1I5OB 4JI6J 2XI2A 1WKJA 1ZETA 3ENQA 2M9KA 5DG7A 4CZCA 3LP0B 3MMBB 1FXDA 2ZVSA 1U1RA 2EFVA 1SKUB 1JK9B 3PHEA 3Q8UA 3U1NA 4NASA 2K1RA 1A9NB 4CQ1A 2MXYA 2X3GA 4HTIA 1E6YA 3NNCA 2BE2A 2VQFJ 3DFEA 2QT7A 4DR6F 2DRAA 2HBZB 1UVLA 2P5VA 1RK8A 4P2SA 1HBUB 3NGUA 1S6QB 2AIRB 5DM7Q 2KFZA 2R7TA 3ICLA 3Q8SB 1MSWD 2ATCB 1BE4A 3NAIA 3W1YC 3HD1A 1SUQA 4WP9A 4ZN3A 2DPIA 2XZWA 1VR6A 2BOAA 1VRQC 2UUAF 3K59A 4Y00A 1U0HA 1OY8A 2F40A 4C97A 2F8MA 1TMJA 1S77D 4KGZB 4YY3F 2I0XA 2FJDB 4FBUA 4ES1A 2GVZA 3DXBA 2IYGA 5G0RA 4CLTA 1RADB 3CNQP 5HK4A 1T02A 1RTJB 2KFNA 2DR6A 1N34F 5IC4B 2MY7A 3CJ8A 2MZQA 2VFUA 1HQEB 3UDLA 4MYUA 2FVRA 3JAMY 2B5JA 1RHRB 2X1AA 1ZAWA 2PD1A 3M8ZA 4ITSA 3QJPA 3KUEA 5FLXU 4USWA 2YH1A 1UJ4A 1T11A 5CCMA 5DETA 2KI2A 5KG3A 1EB0A 1NCLA 1NSKL 3QQCD 5E3RA 3ILLA 5KFOA 2UXCJ 2WB4A 1D0EA 1Y11A 4F3OA 2VUGA 4G65A 3MM7A 3FBBA 3SSSA 2EKNA 4LF2A 3DNCA 4K2XA 4DU8A 5AXNA 4U67Q 3CO0P 4NLXA 3HXMA 3EPGA 5GAEU 5DQHA 4K4YA 4LRCA 3MCMA 2FJBB 2CJAA 4DUZF 5T14A 1VGYA 1S57A 3PJ9A 4W90B 1PO6A 2XB2D 4CLZA 2CJBA 4ZCLA 1NK4A 2HK3A 2LEBA 1K1SA 3J81U 1JLFB 3Q83A 4Q44A 5F9NA 4LF7J 5D3GB 1UKUA 1M5PC 1LKZA 2VZ9A 4Q7AA 2BABA 2PE8A 1PAUB 2EBEA 2BXJA 3DCAA 2NLWA 1X9SA 5T41A 2QSWA 5HROB 4K4WA 4DU7A 1GH8A 1GFWB 3AQPA 2HNYB 5DZ6A 3V81A 3PEJA 3DLEB 2HSEB 2QE5A 2CG4A 2J6TA 4ZVQB 2DXEA 4DQSA 1UVIA 1S1XA 1CC8A 4WZQA 3BO4A 1L3SA 4U8YA 3Q2TC 1KVKA 1J27A 3AXKA 2DGSA 4F36A 3PDNA 3HKZD 4PPDA 3T5LA 2AJ2A 4NWBA 4A8MP 1HI8A 5KFEA 3GYXB 1HQUA 2DNOA 2HZVA 3HMJG 2QMUB 1WF2A 2GW8A 1HNZF 1PJ7A 2MQMA 3NCQA 2OD6A 3Q24A 3I9V9 4K8RA 3VQSA 1WHWA 3C2PA 2ABYA 4OLPA 5T7LA 2XCAA 5CYJA 4WFAQ 1TL3B 5KFDA 2AZ1A 3DLGB 3IG1A 3SDEA 4F3MA 4ECWA 2HVIA 1I6JA 2M3DA 3M9MB 4OYPA 4NLSA 2MYFA 2V8DA 5BR8J 1FHTA 3PJWA 3FEXB 4X64J 1CQMA 5KT7A 2OI2A 1YWXA 3I4PA 3QT6A 1P9YA 2QX0A 4LFCF 1KOHA 4DMZA 3UR3C 2XY5A 3AD9C 4TLQA 5H9EK 4K4UA 3IRWP 4PEOA 5F8GA 2CJQA 4R5PB 2NXNA 3MM6A 4DV2F 2V9WA 3UDVA 4X66J 3SIPB 4Y3CA 2D41A 5KFQA 2EBGA 2MQQA 2ZBRA 4J9QA 1QE1A 4WK1A 4DFPA 3QGGA 3VWSA 3G9CA 2A1BA 2PC6A 4P75A 4FYYB 2AF6A 4OYMA 2OH2A 2A6OA 4DUYJ 1NHVA 2UXDJ 1FWKA 5DDRC 4C98A 2XGQA 2Y1RI 2CG8A 5ETTA 4H4OB 2YKOA 3UCGA 1X5PA 2HQGA 4LRBA 3N28A 3C6UA 5GAEI 2OEMA 1N4LA 2RHQB 4RW4A 3C16B 2YPZA 1NLKL 4IFYA 5HL7Q 1GX6A 1S49A 1D3WA 3J81j 3M30B 4ENOA 2UZAA 1PKUA 2N3LA 3K17A 4FF4A 4DDFA 1MLAA 1FX2A 4DL5A 2BRLA 3MMAA 4ALZA 2OMOA 3GQCA 1YBAA 1Q8BA 3IR5B 5A2QY 1KN6A 4B3RJ 3TAPA 1OJ4A 2HHPA 2DHHA 5IWAJ 1H72C 3PW2A 4Q2LA 3NCPA 2OELA 4RJVA 4DV4J 1NDCA 1OIAA 2GS8A 2JVRA 3UCUP 1NJZA 3OXGA 4ILRA 3NEKA 4I6YA 2AZ3A 4I64A 4EYHB 2AU0A 1CJUB 4QZVB 4LRAA 5IQQA 4HLBA 3FCHA 4DSLA 1SIZA 5J1EA 4CDIA 2LVWA 3KMQA 2K7KA 3DDIA 1RU1A 3WIVA 2XYGB 3ISND 1R8AA 3MEGA 1KLMB 5M2UA 4ED7A 3T6BA 1RWOB 4J37A 4YMEA 5KFBA 4AL7A 1NAQA 3PIOQ 4BS2A 4WFXA 4RUCA 2PI4A 4FF3A 2KXNB 3SCLE 4B17A 5LMUF 3B82A 1HBMA 3T1HF 3K8VA 3I6PA 3CGIA 2ZHBA 2H5JB 3Q89A 4R0JA 4HT7A 1YJWS 3VAKA 1SL1A 4ECRA 4FPRA 2ZZMA 3QAEA 4OX9J 3ZTSA 3I31A 2MJNA 5DDPC 1S10A 5KFAA 1FKPA 2VFRA 1JX4A 3PJXA 1OS5A 1P1LA 2J9DA 3GSDA 1T03A 4DG1B 1KQKA 4P52A 4ZA1A 1J5EF 1IWAA 3HHEA 2CQCA 4X62J 2R2RA 3ZC4A 4RW7B 2IAJA 2HURA 1FKOB 1Y10A 3EZ5A 2NZ4A 2HRTA 1C1CA 1S6UA 1S0NA 1KVIA 3CMES 3U02A 1SKWA 4LBHA 2DGWA 5J2MB 3V6HA 3OTOJ 1IJEB 4FF2A 2RRNA 2WONB 2H48B 4Y2MA 2KVIA 2U2FA 1LXJA 3R2DJ 4I2QA 4OL8A 1HW9A 2QYGA 2IVFB 1CVJA 1IJFB 1NK6A 1T7PA 2R8HA 3I0SA 1LW2B 4NA1A 5K8MA 3GWCA 3HM9A 2HHUA 2HHVA 3CJRA 4J5OA 2YH0A 4QR2A 3BBCA 4DV6J 2HHXA 2VFTA 1D8ZA 1R0AB 1I1GA 2WAQD 1DTQA 3UWTA 1P8GA 3ZNJ1 3FRYA 2PO4A 1RT2B 4L76A 1NPPA 4DS5A 2VC1A 1CBKA 3ULHA 4DUTA 3S7RA 1TVRB 4LBPA 3UI3A 1S6PA 1DQ8A 1CJKB 2ZHOA 3ILIA 1A7GE 4CO0A 2HBRB 4AXIA 3DYAB 2DGUA 2VJVA 2EFQA 2HHWA 4R8UA 4ID8A 3FFIA 1S1VA 1JLCB 1R8PA 4AUKA 2XNQA 1RT3A 3W7BA 1BQNA 2D3OR 1RAJA 3QIPA 4TVAB 1K0VA 3DM2B 1J5OB 4JI2J 4I56A 1R3NA 2R7RA 1YDLA 3H5UA 4V19X 1OYEA 2XS5A 2QZ8A 3N6MA 3I5CA 1U25A 1JJCB 2NUHA 3P3DA 5HSPA 1HWLA 1HHQA 4PQAA 3FEZA 3IWNC 4B3TJ 3A8KA 3K5NA 4P9SA 4P74A 3VVUA 4ECUA 2V9KA 2RQMA 2M52A 2L08A 5C24A 2MGZB 2RS8A 3DDKA 2D74B 1R27B 5CAAA 3CULA 4WIIA 2CDRB 2XHCA 3D67A 2JZ5A 1EKSA 1CJVB 2AV5A 1W26A 3W64A 2QLXA 2VKZG 5BYQA 1G1XA 4NXNJ 5ETMA 3QLHA 1C1BB 3LANA 2AD9A 3BSAA 1N36J 1HBNB 4PPZA 4N77A 1RWUA 1IKWA 4R0EA 1T94A 4AL5A 2XMMA 3OVSA 2HWIA 3WQPA 1BD6A 1LWEA 2ZUAA 1ZAXA 3QSYB 2FLNA 5C42B 1RA6A 3QAUA 3MTJA 5U47A 4IOAQ 4CT9A 3MEDA 2HWHA 4A8OA 2C3UA 4DFKA 1YIJS 3P8BB 4XIUA 2CWKA 3KLGB 2V63A 2AJQA 3D6TB 2VPWB 3QT8A 5CH7B 4RUAA 3M6WA 5C25B 3BKUA 3I5BA 4DR7J 1N5SA 3EXCX 3T1YF 4K0KF 1M90T 1YVFA 2M7SA 2GV1A 3FCVA 1VDHA 2YPYA 2W9BB 3GONA 3R5DA 2V0NA 1EIYB 2IDEA 3MF5A 4GKJJ 2CIMA 4J9NA 2CQBA 4LR8A 4RW8B 2W2QP 3LGNA 2XULA 4KB7A 2NUUG 2F8EX 4MK7A 1RWPB 1SQGA 4LF5J 3C6TB 4JI0F 1XC9A 2JHEA 1KLNA 4DX7A 1JJ4A 4ZJOA 3PV8A 4MIBA 3V6DA 4LRFA 1Q8KA 2G1HA 2ZNYA 4F4ZA 1T9WA 2EWHA 1DARA 2DGQA 2YX1A 2R8KA 2IJFA 3VAMA 9RUBA 2MKSA 3MPDA 3N79A 3IS9B 1L5UA 1ZM4A 3OFFA 2PN6A 3DI6A 5HP1A 1HNXJ 2YKPA 3BSCA 1TMMA 2FGCA 5CQGA 3G6VA 1U6BA 3NP5A 3OFGA 2G2YA 2KRRA 1OSCA 2QTWA 4AYBD 1WTBA 3T1AA 1XJWB 3SSRA 2W2MP 1XK8A 1FJGJ 1FE0A 1XR7A 3D7SB 1YG0A 2BANB 1Q53A 2J8SA 4KKOA 3R6LB 2HGLA 1FRJA 3BBBA 5THWA 2IM2A 1VBXA 2LA4A 5KFPA 4LQ3A 3ZZPA 1JJ2R 2E5GA 3G8SA 2UUWA 5C2CA 4LFAJ 4LMZA 4OYOA 1N33J 4ZVOB 3RRHA 2VA3A 3DHWC 2OO4A 2QC3A 5KG2A 3SYZA 3V6KA 4ED2A 4DG1A 5IZHA 4O3QA 3PW4A 1RTHB 3MM5B 4PG7A 2KG0A 4DPXA 2LQJA 4CLFA 2V50A 2X1BA 3TZYA 2B0GA 1FKOA 2UV8G 2JC0A 2M88A 3K8WA 1XNRJ 2A2CA 3CC2S 2AYBA 1JLQA 3M1VB 2YKNB 1SIWB 5F8IA 1UL3A 2CUYA 3KK2B 2JFKA 1YRXA 2ASDA 2Y8YA 4NMLA 5KFXA 3LWLA 4H4KA 1XBWA 2GQQA 2FGOA 4JP8A 4C7QA 4NX9A 5EWGA 4X4OA 1SH2A 4K7QA 3R2CJ 5E2QA 5DQIA 5I3UB 1O8BA 1LFPA 2O01C 4ER8A 2JLFA 2QMWA 4Y0FA 3GR1A 1KTQA 2HGNA 2JOQA 3AB4B 3WX8A 4ZPWR 2V4JA 3M6UA 3MHYA 3FGVA 3V6JA 2XG8A 5DM6Q 2GJIA 2ZOGA 4CIOA 1TR0A 1NM2A 4I6WA 2VKRA 3OTCA 3TQ1A 3HVAA 1MROA 3P5TL 2HNZA 4ZIVA 4RL1A 1BC6A 2DGOA 5FDLA 2V67A 2LXUA 3X3UA 1F6TA 1UW4A 3BDPA 3NS5A 4QWBA 1SL0A 4C0BA 1YITS 2OUGA 2Q66A 1C0TB 4X4PA 4JV5F 4Y2IA 5MAOA 3P49B 3ZO7A 2DB1A 2XO7A 1HMVA 4FS1A 1K8AT 9ATCB 3ZTOA 2FVQA 3EUNA 4QYRA 3QJLA 1Q78A 3GP9A 1UA0A 4OZ1A 3CCJS 5KG5A 1S1UA 5HAOA 3TAMB 2HBQB 1HKAA 1FWLA 3D3BJ 1K47A 3POTA 5CYQB 2FC8A 2BKPA 2ZVIA 4MAKA 1WI6A 4IQMA 3VAHA 5IM0B 3RR8A 2KXHA 2GFFA 3OHBA 4I7FB 4IRDA 3S1TA 2BJ9A 1C1BA 4B02A 1T05A 2LKZA 4DPTA 2DH9A 1YX2A 4FXDA 2GHVC 3LPEA 3DRSB 3PIPQ 1FO1A 1U6ZA 3DOLB 3G6XA 3IGNA 4GVBA 1DAXA 3H5SA 2Z57B 3UVJA 5IT9U 3I96A 1U1KA 1RKJA 2IC3B 4OMFG 4C11A 3CVKA 1YBUA 2EC2A 2ROEA 4DV3F 4OX8A 2G1DA 3OV7A 5LJ5Y 1T3OA 3K5OA 4LSLA 1Y4ZB 2E29A 3WIUA 2RU9A 3TUPA 2C3YA 4FYXB 1XMQJ 3AOCA 3K89A 4I4BA 4M5NA 1VJQA 2GIQA 2VG5B 2AEJA 5F41A 3GE9A 3E3XA 1NK7A 4JI1J 4L3KA 4GVLA 4ZP8A 3MCNA 1S1TB 3D28A 4ANCA 1VQYA 3TA1A 2QSFA
chains in the Genus database with same CATH topology
3N0VA 4FVCA 3ITHA 2B9YA 1GXTA 4MFBA 3CPWR 4HHJA 1Z2LA 2EW9A 2CPDA 2ZKUA 3LP1A 2VBYA 3LH2S 4USIA 1XMBA 2WW8A 5EUHA 2ILYA 2OPSB 3CD6S 5L1KA 4QPXA 5CZVA 3PRDA 2CVIA 2BQ3A 5AE1A 1Q7LB 2C28A 4WE1B 4QIEA 1H7WA 4RBUA 4LSLB 5B09A 3R5AA 5CXTA 3CCWA 2MB0B 2UVWA 3CIMA 3HHLA 2ZE2B 2IVYA 5HMXA 1LK7A 4W92B 2VFSA 1ZZFA 2ZDOA 3H2UB 7FDRA 4WKRA 4QQBA 3MD3A 2YKMA 2W7OA 1VRTA 5A8RB 2W9CB 2VBZA 1RDRA 2OPPB 3N01A 3VAGA 1UEUA 3CJ5A 2ADBA 3M32B 4DN9A 4K4TA 3KG1A 2E1RA 3L7PA 4I1TA 4IFVB 1B0VA 3UD4P 4CO1A 3M05A 4P7VA 2ZM6F 4YR2A 2JC1A 2MZTA 3LF0A 4LVOP 4G3IA 3ISNC 4KBIA 1TV6B 5KG1A 3F44A 1U1QA 4TU9A 5F0UA 4WFNQ 1LQ9A 1NRKA 2J9DE 2Y0SD 4C0HA 3M8QA 1M5OC 4YB1P 3AB2B 4EBCA 2HS0A 4BDPA 3RAQA 2MKHA 1IUJA 2DVIA 3TARA 4X4SA 3CXCR 4N47A 2V8HA 2RS2A 2XLIA 2KFYA 2IRXA 1SJ4P 4O3OA 1HR0F 5HLFB 4RZRA 1ZM9A 4KO0A 4K4XA 3IN5A 1HYSA 1U4BA 2OD4A 1YGYA 4HI1A 5B0DA 5GADI 2DR5A 2RQ4A 4F25A 3ITHB 4MFBB 2VB6A 1MMLA 3TYTA 1KHWA 3LP1B 5DLFA 1TKTA 4JOUA 1S4FA 1GTHA 2QRRA 4ZP9A 4IH7A 3LALA 1FNMA 4YEAA 3I4HX 3D1QA 3IAM9 2Q1LA 4ZPBA 3VALA 4EBDA 3DOMA 2B7BB 3HHLB 2XNRA 5FD1A 4JI3F 5KFSA 4ZK7M 4DF8A 2UXCF 4C8LA 2RT3A 2N82B 3N6LA 2AYGA 3MR5A 3OFHA 2FHJD 2QEXS 2YKMB 3ZFVA 4DR3F 1VHFA 1VRTB 4QU7A 4XDCA 4DBQA 2V4QA 1YI2S 5IT9Y 2CPFA 3TAQA 3IO1A 2FD2A 3EGZA 2PMHA 2ZC3A 3NBPA 4RW6A 2IRUA 2IMWP 1X4AA 3M9NB 2DHGA 2ZC4A 3OTEA 2PIIA 2D3UA 3MWBA 1EP4A 1HNIA 2E66A 3DXSX 4DSJA 3F41A 2DPJA 4NLUA 2FJVA 1ZH5A 4HH1A 1HFEL 3MECA 4B3SF 2PA8D 2HWTA 1LW0A 1LOUA 1V3ZA 1JLEA 1FVSA 2GMLA 4IG0A 3RTVA 4DSEA 2UVUA 3GG1A 2O3DA 5KFVA 1Q8IA 2YNGA 3CSKA 3MEKA 5CA5A 4FXWA 4ECQA 1IKYA 2ZOMA 3CD5A 4KO0B 1HYSB 2B4UA 3DMJA 3H2LA 3HHDA 1FRLA 4A47A 1EETA 4Q43A 5J1PA 2ZJPQ 3G96A 2HQ3A 4ZP6A 2DD8S 3LQVA 2M8HA 1H2TZ 4GO7X 1SL2A 2DITA 1SJRA 1T95A 4EYIB 1F5AA 2J0XA 4C4WA 5E7OB 2FC9A 4F4KA 2HFZA 1TKTB 1KNZA 2K3IA 3RBDA 1NEEA 2L48A 2FHKA 4Y28C 3QYYA 2YQ3A 4FNHA 1XWLA 2KHDA 5CHCB 3UPFA 2BDPA 4QCLA 2GA7A 5F0WA 4F2SA 3MCSA 3TA2A 4OJ3A 4HDHA 4EZ9A 4X4UA 1F2GA 3DN9A 1DRZA 3HFKA 2L9NA 2EC0A 4QU6A 1SB6A 4LQ9A 5B0EA 1KC8T 3JTNA 1U45A 4RNNA 4LF7F 5A0YA 1DQAA 2DNQA 3Q0AA 3UE2A 4RNOA 2E1CA 4RBVA 3I0RA 3CTRA 3CDBA 5E3PA 4NLOA 4B9NA 3Q23A 2MY8A 3NBPB 2IA0A 4A8FA 2AYEA 3LP0A 4IH6A 1F5BA 3MMBA 2CQPA 4URSA 3PW0A 4NPOA 4MJKA 4M94A 4A4JA 2WB1D 1EP4B 1HNIB 4N56A 1K9MT 1S76D 3O6QA 3MECB 3QGIA 1JKHA 4DR5F 1LW0B 1TKXA 4IG0B 1JLEB 4Y2AA 2UVVA 2MDAA 3CWJA 4LF6F 2YNGB 2XMJA 1IBMF 1FK9A 4B3OA 1M5HA 1Z1ZA 1IKYB 1HW8A 3MPVA 2IBOA 3DMJB 1VK3A 1Q82T 4MKYA 1EETB 4DL0C 3K5MA 2G4BA 3EPIA 2K2PA 1Y0HA 4YB6A 2P9CA 4O4RA 3MM8A 1VQKS 4TYAA 1QUVA 3EGNA 1RI7A 2JFDA 2L3MA 2NPIA 1XNQF 1HBUA 1MU2A 2M5YA 2N3OA 3BQ0A 1T8EA 1S6QA 1MMDA 2L9DA 3HF5A 3KG0A 2DR8A 2FDNA 2DNYA 3FQLA 1SV5A 2OMLA 4DN0A 1X4EA 3HVRA 1XR6A 5L1IA 3RRGA 1NJIT 3H4BA 5LMNF 4ICLA 1FDBA 3UNGC 2BZ2A 2R7QA 4PR6A 3MUMP 4DLGA 4QR0A 3OXLA 1U48A 1R43A 3OL7A 4C9DA 5A0YB 2QLWA 3PKYA 2IFXA 3I0RB 2XI2A 3OUYA 3CDEA 1ZETA 2AQ4A 2CQ3A 3GYNA 3ENQA 5LXRA 2W9AA 2XLJA 4ED0A 2M9KA 5IS2A 2DNZA 1KONA 5DG7A 4QOTA 3L3CA 2UP1A 4CZCA 3LP0B 3MMBB 3D2WA 1H6KX 1FXDA 1N5YA 1TAUA 2ZVSA 1U1RA 2FJEB 2EFVA 3Q8PB 4FBTA 5G4DA 4ERDA 3S8SA 3NCRA 3HVTA 4WK3A 1MWZA 1Q81T 3ETOA 1KSPA 3CJ3A 1JK9B 3PHEA 3U1NA 1JLAA 1UA1A 5F8HA 1JKHB 1WF1A 2K1RA 3J7YU 1A9NB 4CQ1A 2MXYA 2X3GA 1QTMA 1FK9B 4B3OB 1WTFA 2I38A 4HTIA 1E6YA 3J80Y 4Y2KA 1NZAA 2XMTA 1AXQA 5KFKA 4GKKF 3CCRS 2YNIA 3NNCA 2BE2A 2BM0A 2VFVA 3DLJA 4DLEA 3DFEA 1JXEA 2GX8A 3H8YA 2QT7A 1NB7A 3MM8B 4DR6F 2CJ9A 2DRAA 5K8OA 1UVLA 2P5VA 1RK8A 4P2SA 1HBUB 1MU2B 2WRMA 4USJC 4DQRA 4UY85 1JNZB 1S6QB 2COLA 5DM7Q 2KFZA 1RTJA 2R7TA 1SV5B 2D9PA 3ICLA 3OW2R 1QY7A 1DBDA 3Q8SB 1MSWD 4PXBA 4ED5A 2NR0A 4ILMA 3R1HA 3NAIA 3RAXA 2LQ9A 4ICLB 4KC5A 1N0UA 1HQEA 2WCXA 2HW3A 1QAJA 1SUQA 2DBBA 3BB5A 4C2MA 2V8VA 4KPYA 3L95X 1DTTA 2OSQA 2DPIA 3D0HE 2XZWA 3RU0A 3OUYB 1LXNA 1IM4A 4G1IA 5BR8F 3HO1A 4ECZA 2UUAF 1RTDA 3MZIA 3K59A 4BCAA 2VD3A 4Y00A 1CSJA 2VA2A 4X64F 4WTYA 3GIJA 1VS3A 2F40A 3O1LA 1FTCA 1N5YB 2DNRA 4C97A 2F8MA 2L9WA 2HHHF 1KR4A 5EDWA 4KHRA 2VONA 4ZDNA 2DNNA 4PWDA 3BGLA 1S77D 2KM8C 4ECYA 1TZ0A 4YY3F 2I0XA 2MZ1A 1DZ5A 1JLAB 2FJDB 4FBUA 4ES1A 1U2FA 4ID5A 4DF4A 2FLLA 1MW7A 1YJ9S 3DXBA 3UW1A 3O5TB 2DT9A 1M0SA 2HS3A 4RLEA 1E6YB 2IYGA 2KYZA 3PO5A 3UR0A 2KTQA 5ITHA 4ZVEA 2YNIB 2BE2B 3FNNA 1A6LA 4OI1A 5G0RA 3PM9A 4FNIA 2C2DA 4X66F 2N4DA 3UQSA 2PGCA 4NYZA 5IXUA 2O1PA 1B0PA 4I0WA 2R8GA 2HQIA 3RB6A 1T02A 5K14A 4OX7A 3US5A 1RTJB 2MQPA 2ZH7A 4DSFA 3BGRB 3N6NA 5F8MA 2KFNA 3J7Z5 1N34F 2NSBA 4FS2A 2BQUA 2DH8A 2LYVA 2MY7A 1U26A 2MZQA 2VFUA 3VTIA 3OSNA 1JLBA 1TKZA 1HQEB 5B0AA 1M5VC 2RIJA 3UDLA 4MYUA 1SUQB 5GADU 4PXCA 4ZVHA 4J9MA 2ADCA 2FVRA 2R2TA 2POKA 1DTTB 5ADZA 4AFFA 1NO8A