1SJ3P

Hepatitis delta virus gemonic ribozyme precursor, with mg2+ bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Hepatitis delta virus
molecule tags Translation/rna
molecule keywords precursor form of the Hepatitis Delta virus ribozyme
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sj3P00
5DDQC 5IFMA 1YIJS 2CQCA 5GAHU 1U1PA 3SDEA 3R1LA 1UP1A 2X1AA 3BO4A 2E5IA 1VQ9S 2M4MA 2CQ0A 3CCRS 5CYJA 1RK8A 3UWTA 2MGZB 2MKKA 1WF2A 3L3CA 2RU3A 1VBXA 1OO0B 2MZSA 4J5OA 2YTCA 1JJHA 1VQ7S 2K3KA 3CCSS 2ZJPQ 1XN9A 1X5PA 1WHWA 1WEXA 3CTRA 1R8HA 2MSTA 1X5OA 2CPYA 1X4BA 3OW2R 2MQLA 3R1HA 1X4HA 1U1MA 2F9JA 1N8RT 1HL6A 2GHPA 4TU9A 4V19X 3B4MA 4F25A 1U6BA 3MD1A 1FT8A 2RRAA 1M5PC 3MUMP 3V4MA 2KG0A 3THPA 1YJWS 3BEGB 3CCMS 3Q2SC 5LSLA 2MMYA 2DH8A 2D9OA 3P49B 2DNKA 3EX7B 1SXLA 1ZH5A 3G8TA 2U1AA 1U1KA 2JVRA 4QU6A 2VODA 2M2BA 2CQ1A 2KXNB 2KFYA 2OTLS 3UE2A 5DM6Q 1YHQS 3UCZP 1SJ4P 1FJEB 3VAGA 4F02A 4WCEQ 2KYXA 2MKSA 1M5KC 1RKJA 2N3LA 3IWNC 2JWNA 2E44A 4LJMA 2BZ2A 1SJQA 3TO8A 2MKHA 2RS2A 2DNPA 2NLWA 3U1MA 3G71S 5LXYA 1JJ2R 3ZZZA 1VQPS 1BY9A 4YUDA 1DZ5A 1HA1A 2CPFA 2XNQA 1OWXA 1S72S 1PGZA 1QM9A 2SXLA 3VAKA 4CH0S 2LECA 1K9MT 3MOJB 2XS7A 1K8AT 5GVQA 5GAEU 3NMRA 1L3KA 4A8XA 2LKZA 2DGUA 3EGZA 1VQMS 3NS5A 3P5TL 3CD6S 1U6FA 3CCQS 3UCUP 2ZJRQ 3UCGA 2QFJA 3VAFA 3VAMA 4OZ0A 2CPIA 2HGNA 4P6QA 2PE8A 1SJRA 3N9UC 2KI2A 2CPZA 2N82B 1JJ4A 3MD3A 1PO6A 3THTA 1KD1T 1DBDA 2B0GA 2DNMA 2X1FA 2LCWA 3I55S 2YWKA 1QVFR 2KH9A 2F3JA 4RU2A 3ULHA 1KOOA 3R27A 3UD4P 1DHMA 3G8SA 1U1LA 3U1LA 1NU4A 2A3JA 2DNGA 3US5A 2LA4A 2CQGA 3RW7A 3S8SA 1YJNS 2VOOA 2U2FA 3DXBA 2MGZA 1WF0A 2XS2A 5MLCV 1A7GE 2JRSA 2HZCA 2JVOA 3J7ZT 2VONA 2RQ4A 3S6EA 1VQ5S 1Q82T 4PRFA 4PR6A 2CQBA 3FEXB 4FXVA 2MZRA 5IQQA 3CMES 3CCLS 3LQVA 1U1QA 3CMAS 1WEYA 2D9PA 3VF0B 2J76E 5DDPC 1M5VC 2M7SA 1ZZNA 3BO2A 3NNHA 5BJRA 1R8PA 2L9WA 2LEAA 1WG1A 1HD1A 2YH0A 2XB2D 2OTJS 3P3DA 1WHYA 3H2UB 5HL7Q 3J7YU 2NZ4A 1KQSR 5DETA 2DNYA 2DO4A 5EN1A 2MJNA 4WKRA 3BS9A 2EK1A 2KT5A 1X4AA 2HVZA 2RNEA 2MKCA 2KHCA 2DIUA 2UP1A 2LQ5A 2M52A 5IM0A 1WF1A 1WHXA 2MY7A 2DHAA 2PEHA 4FXWA 2AYBA 1YWXA 2I2YA 2KXFA 3JB9k 1VQKS 4TLQA 4ED5A 4Y00A 1G2EA 5DDRC 1VQNS 2DHGA 2RT3A 2OJ3A 2CJKA 4LIRA 1URNA 2VOPA 3EGNA 3MUTP 1F9FA 4UY8T 1WI6A 3HHNB 1WEZA 4TU7A 4CH1A 1X5TA 2M8DB 2RRBA 1QVGR 1DRZA 2MPUA 4ZKAA 1WI8A 2M9KA 2DGQA 1P1TA 2CQHA 5D78A 1O0PA 4CIOA 2KRBA 1VC5A 2BOPA 2CQ4A 2EVZA 3MDFA 5CA5A 2KN4A 1X4DA 2E5GA 2DH9A 2E5HA 2EK6A 4PKDB 1K73T 4WFBQ 1YI2S 1N88A 2HGMA 5IM0B 4UQTA 2FY1A 2RQCA 5GADU 1UAWA 3CCVS 2MQNA 3I56S 2N7CA 3S7RA 2CPJA 3MURP 2AD9A 1D8ZA 2DGSA 2MZJA 2MKJA 3CXCR 2CQDA 3S01A 3Q2TC 1FO1A 4W92B 1A9NB 2DISA 2DNRA 2YKAA 4WFAQ 3SMZA 1IQTA 2XSFA 1KOHA 2M0GB 3CCJS 1OIAA 3D2WA 1JMTA 1M5OC 3RW6A 3MUVP 2CPEA 2XS5A 2ERRA 2DNLA 2LXIA 2LEBA 5HO4A 3G4SS 2KU7A 4W90B 2MKIA 5LJ5Y 4IUFA 3P6YC 2CQPA 2DH7A 2DNNA 2L41A 3VAIA 2CQ2A 2D3OR 2LYVA 3CC2S 1M90T 4QQBA 2MQQA 2AYEA 2DGOA 2WBRA 2DGVA 3CF5Q 1AUDA 1VQ6S 2N3OA 2X1BA 2M88A 1FXLA 1UFWA 1P27B 2LMIA 1H2VZ 2E5JA 2MXYA 1NJIT 1B7FA 1YJ9S 3VAHA 2L08A 2J0QD 3G9CA 2K8GA 4QPTA 5CXTA 2HGLA 2JX2A 4IO9Q 4BS2A 3HI9A 1X4CA 2DK2A 4IOAQ 4LMZA 1U1NA 1S79A 2I38A 2MZQA 1OPIA 2F9DA 2HYIB 3CC7S 2CPHA 1Q7YT 5GAGU 4EGLA 2ADCA 2CQ3A 4OZ1A 2YH1A 2KG1A 2G0CA 2AYMA 2MQOA 2KM8B 5D77A 1M1KT 5DDOC 1FNXH 1X4EA 2M70A 2J0SD 3SXLA 3PIPQ 4YOEA 3B4DA 2DHXA 2DNZA 1N54B 2G1DA 2DGXA 2KM8C 2KXHA 2MHNA 3SDEB 5H1SV 1U2FA 1X0FA 2QA4S 4WF9Q 1U1RA 2MSSA 1FJCA 2O3DA 3CCUS 1YTYA 3DLLQ 2FHOB 4QU7A 1U1OA 2MY8A 5JVGQ 4C4WA 5LSOA 1WTBA 2CQIA 2CPXA 3VAJA 3G96A 1X4GA 4WIIA 3MXHP 2M8HA 1W2BR 2DNQA 3PIOQ 2RUGA 2QEXS 1H2TZ 1HD0A 1D9AA 1WG5A 3TYTA 2KRRA 5DM7Q 5LJ3Y 3CC4S 3CULA 1VQ8S 3CPWR 4IOCQ 2MQPA 4C7QA 2Q79A 4U67Q 1CVJA 2LA6A 4ERDA 2AYGA 2CPDA 3FEYB 3ZZYA 1VQ4S 4M5DB 1Q81T 1VQLS 3CUNA 3NS6A 2OIHA 2MYFA 2DITA 1VC0A 1X5SA 2DGWA 3NNAA 1NO8A 1YITS 2DIVA 4WFNQ 3MI7X 2DO0A 1WG4A 5FJ4A 2X1GA 2FC8A 4CQ1A 5ITHA 1SJFA 5GMKa 3UD3P 2DHSA 1WELA 2DB1A 4C0OC 2RVJA 5LXRA 1VBZA 2DNHA 4Y0FA 2V94A 2J8AA 3VALA 3G6ES 1SJ3P 1H2UX 3TP2A 1FHTA 1VQOS 2G4BA 2ZJQQ 1VC6A 2MB0B 1UW4A 2ADBA 2MZ1A 2DNOA 2FC9A 2OSQA 1FJ7A 4F26A 2MJUA 2GO9A 5JVHQ 2RS8A 1WHVA 2LXUA 1ZZFA 4YB1P 1Q86T 1X4FA 2KVIA 1H6KX 2XNRA 4TU8A 3CCES 1VBYA 2MZTA 3IRWP 3BO3A 3NNCA 1KC8T 2OSRA 2FPHX 1N52B 3LPYA 4Z2XA 1WWHA 3H2VE 2MQMA 3K0JA 2DGTA
chains in the Genus database with same CATH superfamily
2HRTA 4HYKA 1HBMB 1U2CA 2Y9HA 2HQIA 2VQEJ 5J2QB 3GB0A 3VGTA 3PZPA 1TQLA 4JBCA 2NXJA 4QZVB 1VQSA 2V4QA 4OYBA 4UOGA 4AL7A 5KFGA 2M4MA 1FWKA 4C8MA 3F0NA 3R7SB 1EB0A 1RK8A 2PD1A 4GO7X 5CYJA 3T1HF 2GIFA 2JHEA 4LFCF 3ISND 3RYLA 3VGVA 4RUBA 2NYHA 4OYAA 2ZH1A 1VBXA 4YMEA 4PUOA 1OO0B 3HHLD 1KP6A 3OXGA 2UVWA 1DLOA 1R31A 2GJIA 2NPFA 2ALZA 1IR0A 3MTKA 1S0VA 2R7OA 4J9SA 1KFSA 2LXFA 3CCSS 2ZJPQ 1XN9A 4PZVA 1U7LA 4DUZF 1H3DA 2VBYA 2DEIA 5CCMA 1X5PA 3MCOA 4K4TA 3PYGA 4N47A 4O0NA 3UN5A 3QAEA 3CTRA 3D7SB 3KLHB 1L3VA 2CPYA 2A2CA 2FD2A 4JI6J 1EQ0A 2WHOA 2E9RX 1HYSA 1NH8A 1XK8A 1K0TA 4ECUA 3GZ7A 1BQMA 1CQNA 1EHWA 2OD6A 2W01A 3DOKB 4DV2J 4YEAA 3OTEA 5J2PA 2IRYA 5KT3A 2Y1LB 4JI1F 4IOBA 5AXMA 1S97A 3M6XA 4M94A 2HQFA 1GK8A 5B0GA 2IJNA 3VCDA 4U7UD 4WFXA 1PBUA 2AWZA 1HNZF 3I6PA 1H98A 1YJWS 4OJGA 3E2EA 3QJJA 1KHWA 1UJ5A 3EVOA 4ZP6A 1VHIA 4ZIWA 3FRYA 2G9OA 4ATNA 2Q43A 1Q1KA 2Z2LA 4K0KJ 4NZ7A 1V9OA 4RW8A 3EXCX 5KTQA 3G8TA 1AW0A 1T3OA 3K17A 1T11A 4HH1A 4OFZA 3DOMB 5KFNA 3QRQA 2VODA 4QU6A 1TVRB 2JFKA 3UO0A 2KXNB 1HQEB 2MEWA 1LXJA 2PA8D 2Y8YA 3KTQA 4A8QA 5HJXA 3ZZUA 2HEKA 1WD6A 2VPZB 2PIIA 4HH0A 3UE2A 5L38A 5L1KA 3TZWA 2J6TA 1RI7A 3O5TB 4ECTA 4I56A 2ALYB 2MKSA 4PPDA 4M63A 3IWLA 2K06A 3NLCA 2BZ2A 2ASDA 2ABYA 3BSCA 4C2MA 1KNZA 3DNCA 2EKNA 1R27B 4ZLNA 3C6UA 5I42A 1DQAA 1UEUA 2BM0A 2ZH5A 3D66A 4QYZJ 4CO1A 1KONA 3ZZZA 4YDDB 4F4ZA 2CADA 1XMOF 1HA1A 2CPFA 2B6AA 4CI0B 4IQXA 5C24B 2FVRA 3D28A 3X3UA 1FX2A 4USHA 2SXLA 2VQFJ 1TK0A 1PGZA 2GW8A 2VL1A 1Q0NA 1MMLA 3A13A 5E7OB 1K9MT 2EBEA 1R7IA 4DUYF 1GMUA 4DL5A 2YKOA 1PAEX 1YBUA 1VR6A 2AJFE 3NS5A 1U6FA 1CJKA 3BKUA 3D67A 3HJVA 1QE1B 4PYDA 2RF2B 4KHPF 2B5JA 3QPIA 5F3TA 3M8PB 1FKOB 1NMEB 1OSDA 3PR4A 3H0PA 3TX8A 1HNVA 2NR0A 2I5JB 2D41A 2XLKA 5I3QA 1UPMB 2W2PP 1AYEA 4OYWA 4P6QA 3UVJB 3HO1A 2AX0A 2CA9A 2C2DA 2N82B 3OJSA 1JJ4A 1UVMA 3J7A1 1LW2A 3K59A 2N4CA 1BQNA 2YX1A 5CQGA 2HWIA 2YKPA 1XERA 2BJ1A 4XO0A 3T9ZA 4OHWA 3JYTB 4GC7A 2UU9J 4NCAA 4I68A 3T5KA 4FBTA 2E1RA 3BB5A 3IRXA 1UWBA 4DV5J 4PAAA 2IYGA 1T8EA 3OT9A 2N4DA 3A1YG 3LGHA 4OV6A 1JQGA 4A47A 1TKZA 1YK9A 3OSNA 2KH9A 3BQ1A 2WVCA 2AEMA 2YKMB 1S59A 3ULHA 1H7XA 1KOOA 3RG6A 3E51A 4I7FB 1UEKA 2P6TA 3PHEA 4N8NA 3R97A 1E6VB 1SB6A 3DC2A 3U1LA 2QL9B 5G0RB 3US5A 1EZZB 4A8OA 1FWLA 2XYHB 3JAMU 2XMJA 2QMUB 3BH6B 4UTGA 2U2FA 3DXBA 5M2PA 3BQ2A 4EYIB 3NG8A 1WF0A 2XS2A 5ETLA 2JRSA 2JVOA 4ZJOA 3J7ZT 2J6UA 3UFCX 4PCQA 4U8VA 1MW7A 2YX7A 1EQMA 1XIQA 3I87A 3G87A 3KHLA 2R2TA 3KJQB 1N32F 4OYXA 1Q82T 4PRFA 4DPXA 3LF0A 2CQBA 2WRMA 4QWDA 2B5JB 4WP8A 1JB0C 3D1OA 3DKDA 1SH3A 3KNGA 2XLJA 1ZTWA 4X64F 4LF4F 1FE0A 3HHDA 5IQQA 1F2HA 2GZOA 4GMKA 3J80U 3GJRB 4AXJA 2JEJA 4EU0A 2FVPA 2KB2A 4HR2A 4CLFA 4X4RA 4B9MA 2CG4A 2FDNA 3AT1B 4X2BA 2GVZA 2BABA 3FSXA 1T9TA 3TEGA 3G6YA 1XC9A 3UR3C 1CC8A 2ROPA 5CZXA 1EETA 3W63A 2M7SA 2NXNA 2AKWB 4AE5A 4D3GA 4PPZA 4DX5A 1KLMA 3CJ2A 3V81B 1JLGA 3NNHA 5FDLA 1GXTA 2GQQA 2RSQA 3SCLE 5BJRA 1BLUA 2LEAA 2GAHC 1HD1A 3W2WA 3AODA 2YH0A 4HHHA 3TQ1A 2NZ4A 4CLPA 1RCXB 2WVFA 4KR0B 5HL7Q 3DRPA 4R8UB 1QUVA 1CULB 5HLFB 1JLBB 3POTA 4IQMA 2JC1A 3DMJA 4DV7F 3P96A 1UMJA 4B3SF 4WKRA 3BS9A 2VICA 2GGPA 1TU0B 3G82A 1YVFA 3N5BA 1X4AA 4KGVB 4I67A 4DL4A 3L7PA 4PWDB 3F56A 4DF8A 1KN6A 2BKOA 4WPAA 2UP1A 4CT8A 1HHQA 2M52A 4F36A 1I6JA 4BBYA 4KPYA 5IM0A 1WF1A 2MY7A 1LNQA 4LQ9A 4MJKA 4FXWA 5ETTA 1FDNA 3DHWC 2AYBA 2BJEA 4DWIA 3CJ5A 2AGPA 2YWGA 3JB9k 2KZZA 4QW8A 4RW8B 2FZGB 1QLNA 4AL5A 2E29A 2JEFA 4JI1J 3J81U 1WC6A 3LO3A 4ZVEA 2EFNA 2WVBA 1I5OB 1HMVA 2XHCA 2OP5A 3M2UB 5GAHI 2DPJA 1VGYA 3NMAA 5DDRC 1EIYB 2RT3A 1VQNS 5H9FK 2OJ3A 2D3ZA 1URNA 3EGNA 3MUTP 4FF4A 4NLXA 1F9FA 4DV1J 3KG4A 3RR7A 3WIUA 1S9GB 3Q8QB 1WEZA 3HHNB 1M0SA 1BUXA 4P10A 2HMIA 2AV5A 2J9CA 1JLFA 2QSFA 5F8NA 1WI8A 1IM6A 1JLEA 2XC9A 1TKXB 2C3YA 5E5NA 1P1TA 3M32B 4ECWA 2QA4G 2V63A 1K1SA 2OPRA 4USJC 4E2FB 2WB4A 2JJ4D 4XDCA 3MDFA 1R43A 1RKIA 2GGPB 3GFZA 3GLJA 4N76A 5L39A 1B7YB 1TMMA 2FJBB 3DGPB 5SZTA 2UU9F 2EK6A 2ZHOA 2NUHA 5J1PA 4WFBQ 3ZO7A 1K73T 1W25A 3BBFA 5IM0B 5KFFA 1R6YA 4B9TA 3QGPA 2HAIA 1VCTA 2RQCA 2Y0BB 1EKRA 1MROA 1UAWA 2WONB 3AOAA 3H4BA 3N6NA 3QQCD 3NGUA 5FDLB 3CCVS 4P2SA 2B43A 5D6GA 1HI0P 4QCLA 4RU9A 4ITSA 3S7RA 4DLEA 1CJTB 5D4OA 2CPJA 4Y2MA 3NAHA 5DGBA 4PXDA 2AD9A 3CO9A 4G6VB 4E8UA 2PMWA 2EFGA 1KKHA 3NRBA 1VBKA 2BMBA 4KHMA 2UUWA 5JJBA 3PRDA 2ROGA 3H40A 3S01A 5IOLA 2AT1B 3MMCA 3J7Z5 5HLFA 3Q2TC 1A9NB 1KVJA 2Z2MA 3TAMB 2VG7A 2E1CA 1HW8A 1QY7A 1WC3A 3WX4A 4DV4J 3AHPA 1NDKA 3KLGB 4ED6A 5ETVA 2OEMA 3DI6B 2XSFA 4WU2A 1T9UA 2ZBQA 3BGRA 2R7XA 4K4VA 2RQMA 1OQ3A 4FVMA 1KQFB 2BQ3A 2CPEA 2XS5A 4R5PB 4EI2A 2I6WA 3QATA 4A46A 2LEBA 2QL5B 4PXBA 1O6XA 5HO4A 1IBMJ 3G4SS 2R7QA 1RWXB 3LP0A 3OFHA 5DG7A 3AB2B 2POKA 4RPFA 5DZ7A 3FRZA 3TA2A 5HQ8A 3KJVB 4LF5J 4JI5F 2IM2A 1WOPA 3CC2S 4DV3F 4RO0A 4CLLA 2AJ4A 5C2GA 1JWWA 2L41A 2CQ2A 1AT1B 1SC6A 3PRBA 4QIWD 3WQPA 4L3KA 2B4OA 6FDRA 1VYAA 3C14A 2YNGB 5H9EK 1VQYA 2GC8A 3MPYA 1W2IA 3JTOA 3OTCA 5JMNA 3OL6A 5GMDA 1UEVA 3DRRA 1CJVA 3K5NA 3D9BA 1VQ6S 3ENAA 2X1BA 1FK9B 2RUSA 4J9VA 4A8WA 4J91A 1NSPA 3CD5A 5ETKA 3FNNA 3IP0A 3NOGA 1VRTA 1H2VZ 2J9DE 2WONA 2ATLA 1EX8A 4KV8B 2DY9A 1SIZA 3A8JA 4Z7CA 2BX6A 5HVGA 1NBEB 1YJ9S 3PXGa 4C0HA 4DV6F 3IS9A 1EKSA 2L08A 2ZKUA 3FQKA 1Y9OA 4MKVA 4FF2A 3H5XA 3LP1B 1KVIA 2F8MA 5DQIA 3I4HX 3TVKA 3W9JA 2Q1LA 3J81j 1VLYA 4OZLA 1LW0A 1Y7PA 1X4CA 1YJ7A 5LL6d 5HVHA 4OV1A 1U1NA 4CH7A 4KKOB 1S79A 2IVYA 2W9AA 5E3CA 1Q7YT 2AW0A 5GAGU 3KK3B 4GKJJ 2RDJA 3V4IB 1H72C 3KLHA 4YB6A 1RP5A 3ZZRA 4C8LA 1S0NA 2DD8S 3O2IA 4WXOA 2RH3A 2KG1A 2EW9A 3LP2B 3LPEA 2ZE2B 4FYXB 4OX6A 3BM7A 3CE8A 4URQU 3DRXA 3M8PA 3MZIA 1NCLA 1Z1ZA 1X4EA 2H1YA 3M9NB 1FNXH 3BGFA 2V8DA 3HD1A 4NYPA 2LQJA 4YY3J 2Z8QA 4DR3F 3MOZA 2W9CB 2DVIA 2DNZA 3DLHA 3DOLA 1D8YA 3M9MB 1FEEA 2G1DA 2B9EA 3MM8A 4RW9B 2KM8C 4FF1A 2RIJA 1UA0A 2HQGA 3M6VA 4AT1B 3RBEA 4N7TA 4PQUB 1XEZA 3BKTA 4CM2A 1ROFA 3SDEB 2W9BB 2J5AA 1C0TB 4Q44A 1T05B 1RYRA 3PRVA 3M8YA 3BSAA 3EGWB 1X7VA 4MK9A 4R5PA 3HT3A 2RILA 3MMAB 4DXLA 3MR3A 2OMLA 4PXCA 2HPUA 2MSSA 4B3TF 4CO5A 2NXUA 3L95X 1YTYA 2VG6A 3DLLQ 5BYQA 4ZVFA 4JV1A 3OV7A 1QSYA 5IV3A 2MY8A 2YBVA 4C4WA 2CDRB 2QV6A 4FDFA 1RTHB 3FEZA 4LF9J 2OO4A 4AXIA 3MEKA 1JLQA 3DU5A 3FKBA 3AQPA 2CQIA 4MIBA 1RAAB 1RJJA 4CLWA 4MK8A 1NZ8A 4M5LA 3VAJA 3RB0A 1GXLA 1TKTB 5K8NA 2LQ8A 2LDYA 2XWXA 1FDAA 1WOOA 2WSCC 3PY8A 5EWGA 3ZTPA 4NYOA 3M8WA 2ACMA 2XY6A 1DQ9A 1MROB 1IKVB 3VQTA 1NKCA 5A8RB 5J1NA 2KJWA 2KT2A 4LREA 4Y2KA 1DJ0A 1U26A 2XYPB 4UZCA 2HHUA 1F5CA 2FB0A 3BN7A 4DQQA 4NXNF 3CULA 5IWAJ 1VQ8S 5F8JA 3OFFA 3RGIA 2CJQA 3HD2A 4JB8B 3CPWR 1SKWA 4IDKB 2H5JB 3BGRB 5IXUA 2FTRA 1IBMF 4N5SA 4JP8A 1ZTTA 1L3UA 2W9CA 2ZZMA 5KG3A 4ES3A 4ZPCA 1RTZA 3EXYA 2AYGA 4DSJA 4ILLA 1RBOB 1C0TA 2QLXA 3HKZD 1TZ0A 4I2PA 1VISA 4LRFA 5DRKA 4CYUA 3PW4A 1Q81T 1D09B 3SQGA 3GJTB 3NGKA 4DV1F 4NLGA 4O44B 4HTIA 1VC0A 2F65A 4TVAB 4LSNA 1S1VB 4XTTA 4ZA1A 3J80Y 1I51B 3NNAA 1TV6B 1IM4A 2DIVA 4P2XA 4WFNQ 2OPQB 2EPIA 3R6GB 4JV2A 1EP4A 2AGQA 2W4PA 1Q95G 1NHKL 2QLWA 4FNHA 1IKXA 2I5JA 3FBFA 2EBGA 3DRRB 3MEDA 4BHQA 3C46A 2ZNYA 4ED1A 3ZZ0A 3K7RA 7AT1B 1CS4A 5HAOA 4BDPA 3IN5A 4X4VA 2BJ3A 1U8SA 2BE2A 3CIZA 3HT0A 3HPOA 2UUAJ 2WOMB 3PEJA 2V34A 1QAXA 3G6ES 1U0SA 1X8DA 2XMTA 3OXFA 1VQOS 4ILMA 2ZJQQ 1VC6A 4ZVTB 3HFZB 1UW4A 4O3OA 2FHJA 2MZ1A 5K14A 3UN3A 5K5MA 2RD5C 2DY1A 2KFZA 1T9YA 3GU0A 2J8SA 2OMOA 1F3FA 2KDOA 2OUGA 4ILRA 4EK2A 2VA3A 2C2OB 4FYDA 4F26A 4M5IA 3IAS9 1UVIA 5B0CA 4PUOB 3VGUA 3W66A 1P9QC 3R5BA 2PSZA 4ZPAA 5KG6A 3ZTSA 5K8OA 3KNAA 1WHVA 2WTFA 5KG1A 1WKJA 1RAIB 1ZZFA 1RHQB 3BBCA 3MECA 1Q86T 4GKJF 1QJHA 1RT7A 1T03A 4A8SA 2MZTA 3N79A 3BO3A 2R8KA 3EM1A 1D1UA 3TJAA 5AE1A 3JSMA 3DHXA 5C2CA 2V2ZA 5KFKA 3CD0A 5B0EA 2Y1IA 4JI5J 1WWHA 4NYZA 2XMWA 3H2VE 4NL5A 2MQMA 2HG4A 2XMAA 4XK8C 4YHHF 1XNRF 2IC3A 1VRUB 2O67A 4M5KA 4P7TA 5IFMA 1S1UA 1YIJS 1GNKA 2OKQA 3H4DA 5BYSA 1U1PA 5THWA 5T14A 1FESA 3SDEA 3HZGA 3DGPA 1F2GA 2ILZA 4Q5VA 1UP1A 2AJ0A 3ZC4A 3KUEA 3MMBB 1SC4B 2X1AA 5I4MA 2E5IA 3MAAB 2W9BA 3DYAB 1RA7A 4DN9A 2P2CB 1B70B 4F3MA 2VIHA 1T05A 1M90T 2FHJD 5SUHA 3TJ8A 1VQ9S 1RZMA 3TW0A 4B3MJ 3B54A 5E0OA 3W2WB 4Y65A 2JEGA 2QO3A 2Z30B 1JLCB 3V5RA 3L3CA 4KT0C 2RU3A 1DTQA 2OPQA 1XMQF 1P1LA 3ZNUA 1TKDA 2CDQA 3T41A 5JUMA 2QA1A 4DS5A 1SKSA 3DXSX 3O44A 2R2UA 3I0RA 4ZHRB 2IJRA 2ZZTA 3N28A 2AGOA 1LXNA 1VHFA 3HVAA 3R3TA 2XGQA 4JOUA 4IR9A 4IFVA 1WHWA 1WEXA 2HLUA 4WKYA 2FLOA 1Q8BA 4P75A 4P72A 1RB0A 2AHOB 2MSTA 2VG5A 3J7YI 1RT2B 3OW2R 4ZVOB 4MYTA 4PWWA 1X4HA 2HBZB 1RTIB 1HL6A 3IC1A 1KSPA 4DUZJ 1RTJA 5A2QU 3PCOB 4KSEB 1HWKA 5LMNJ 3MD1A 1FT8A 2DHHA 3E8OA 1NHUA 2H4YB 5AXLA 2UXDF 2E7VA 1FRKA 3MUMP 3CW2C 1M5PC 1FKOA 1I94F 3V4MA 1BQMB 3CMQA 4Z7YA 1Q4RA 3THPA 4DPWA 1KVKA 3Q22A 4CP5A 5DG8A 4BWJA 3BV8A 4EBDA 3KUHA 1FK9A 2ZNZA 4BLGA 3KK1B 2ZM6F 1FE4A 2D9OA 1SJ1A 1JXEA 2ZC3A 1CJUB 1R8CA 1U02A 2ZH2A 3P49B 1C2PA 4N77A 1J5OA 1SXLA 1F9EB 5ETRA 1AXQA 4NRTA 4PQAA 1KFDA 1MU2B 2GQCA 2U1AA 3BKFA 4H4KC 1Z2ZA 2JVRA 1Q53A 1M5SA 1OSCA 2YX4A 4B3TJ 3KHHA 2CWXA 2CQ1A 1BD6A 1UJ6A 3MPVA 4K2JA 4B9SA 3FMBA 4AQYJ 2OTLS 1JXVA 4ID5B 1R89A 4MTPA 2ZDPA 4V19J 2J9EA 2K1RB 2LFVA 3GYGA 3AB4B 1RAFB 3CIMA 1YHQS 2UUBF 1FJEB 3VAGA 2XGPA 4OHXA 4WCEQ 1RAEB 4RL1A 4RW6A 1M5KC 3CDEA 4Z37A 5B08A 1QUPA 3ICLA 3HKWA 1Q5YA 2XSJA 1NEEA 3MMBA 1SJQA 5U47A 1VDHA 3TO8A 1RT6A 3WBZA 4YDXA 4OL8A 2NLWA 3RR8A 1TL1A 4UF4A 2V2QA 3U1MA 4UQGA 2QLJB 2IMOA 4YUDA 3H8YA 2XNQA 1OWXA 3WC0A 4DFPA 4LUBA 4DLGA 2VQFF 4MKAA 2LECA 1A0OB 2GJFA 2XS7A 1S6QB 3NMRA 3CJKB 3HSJA 3QT6A 4USVA 4P74A 1L3KA 1OY9A 1HKAA 2IVMA 1SBRA 2LDIA 3GG0A 2VZ9A 1RCOB 2RKIB 3BPDA 2D3UA 3MGJA 1SH0A 3GG1A 4KGXB 3P5TL 1QSLA 3CD6S 2G0IA 2LQBA 3MM7A 4U9RA 3EPIA 4DFJA 1F6TA 1AA1B 1EETB 3GONA 3MMAA 4NCGB 1QDUB 3UCUP 3SSQA 2HQDA 2E66A 4ZVQB 3WX8A 2F4VF 4FKYA 4L76A 2HHXA 2UXBJ 2QT7A 3HULA 2CPIA 2RJZA 4ETZA 3CCTA 3B6BA 3AJDA 1X0PA 4O4GB 5CYQA 5K8MA 3N9UC 3VVTA 2Z56B 2BM1A 2P9EA 3MD3A 1OY8A 2GS8A 2BRLA 1G4CA 3CDAA 5FLXU 4ECQA 1MWQA 1DBDA 1UFLA 1GQEA 2B0GA 4WE1B 2XULA 3KLIA 3SIPB 2QLFB 2HFOA 4ZCIA 2X1FA 3T6BA 3D6FB 2YWKA 1RWMB 1VI7A 1LKZA 1OPZA 2GO8A 4LSLB 4RNMA 4C9DA 4F2RA 1UWBB 2V6AA 1HHSA 2F3JA 3E01B 4RU2A 1G7CB 3R27A 4P7VA 3MCSA 3UD4P 1DHMA 4F2SA 2XM3A 1CJKB 1O51A 3L9ZA 2R2SA 1NK7A 1S49A 2A3JA 4RNFA 1DTTA 3ZNJ1 3QSYB 3NL0A 2LA4A 3HFKA 3RW7A 1KDNA 4QPXA 4A8FA 3OFEA 1P9YA 4CLYA 1YJNS 1SKRA 4Q2LA 4LF8J 2VOOA 1CLFA 3FBBA 5KFCA 4ZCMA 1RBLA 4M5JA 1HW9A 4ZPVR 1XQIA 2HZCA 4ECRA 1NK9A 1RT4A 5HANA 3DYAA 4P73A 2RAQA 3TZXA 4TQSA 3QZ8A 1C1CA 1KRPA 1VQ5S 1WKLA 2NPIA 4PR6A 3PX0A 3RJMB 1KQGB 5DS7A 3FEXB 4QIFA 4DL2A 2KFNA 4DR1F 3FZ2A 1RT2A 2BYCA 2Q6CA 3AJ1A 2AX1A 2F8HA 2L48A 2WSEC 3B8HA 3QIPA 2EEYA 4BC7A 2DR8A 4F3OA 3I31A 1Q79A 2HHWA 1APSA 1IVZA 3MCNA 1U1QA 3PYEA 1RWNB 1YJRA 1F1BB 2CRLA 4X65F 2D9PA 3VR1A 2YY3A 3OL8A 3CMAS 4I2QA 2HAFA 3R2CJ 1Y5LB 4C3KA 5DDPC 3T1AA 1ZZNA 4UZBA 2MHEA 4KPCA 4NEZA 4WJBA 4JI3F 4RUHA 4ELVA 1FD2A 3DLKB 1VRQC 4O0IA 1WG1A 4MFBA 4Q7AA 2ASYA 1N36F 1JLGB 1AB8A 2Y0SD 3DCAA 2B7CB 3JTNA 4HDGA 4K59A 5ETQA 4OZ5A 4ZLJA 1KQSR 2NREA 1C4CA 3C6UB 3PFEA 2FVSA 2DRDA 2DO4A 2MLZA 4I1TA 3BSNA 5C42A 4I6WA 2MJNA 4IRDA 2IBOA 3THVA 3BR9A 2Y1RI 2EK1A 1CJTA 2KT5A 1Q5VA 4M95A 2IJFA 5A8KB 2FLLA 2DIUA 2GX8A 3EZOA 3D3BJ 3OFGA 5F8IA 2AZ3A 2LQ5A 3IFEA 5D3GB 3N0VA 4NE9C 2IA0A 3DOMA 4CTAB 1YZ7A 4FKXA 3RB6A 7FD1A 3QRRA 3W7BA 2KXFA 1KTQA 1RTDA 5KG5A 1L3TA 4CLKA 2UVUA 1SUQA 3AH6A 4HHJA 4MT1A 5F9LA 5FLXY 1NUEA 3BDPA 3D54A 1VQKS 3PKYA 3M1VA 1FFWB 4OX9J 4CWBA 2BJ8A 9ATCB 4TLQA 2QIFA 1VLOA 4NLQA 5AJ3F 4Y00A 4W4MA 2DHGA 2HK2A 3RU0A 2CJKA 4LIRA 4KRWA 5AXKA 2B9WA 1CSJA 3I4PA 3DLGB 3C6TA 3MEGA 4HDHA 3HF5A 5HN0A 1RU2A 5AT1B 1HBOA 3ENQA 5F0WA 1RAHB 2FZCB 3L7UA 4TU7A 4KTQA 3DRSB 3ZTRA 5J2PB 2CJBA 4LBIA 4DCJB 4ZKAA 5C5JA 3KK2A 4JI8J 2DGQA 3D1HA 4TNOA 2JLEA 2VASA 2IFXA 1WDDA 2V68A 5KFVA 1IKWB 2KRBA 5DO2A 3TUIC 4CIOA 1VC5A 2OFHX 4YY3F 2EVZA 4DR3J 2BOPA 2QE5A 3I5AA 3T5LA 2KN4A 3DDNA 1WC1A 1R6VA 2DH9A 4Y28C 1CEZA 1RHRB 1FTRA 4CNYA 1QD1A 1HYSB 1PYTA 1FRXA 4JYAF 1KR4A 1CG2A 1ACMB 3FCWA 2R7WA 1N88A 1YI2S 2GMLA 1W7WA 2HVDA 3W60A 5D3GA 4RW4B 3EZ5A 5I3UA 3PNIA 5HROB 5E3QA 3GJQB 5L46A 3K57A 1RUSA 5HP1B 2FLNA 2DTJA 3LW5C 4JI6F 3MURP 4NX9A 1D8ZA 1REVB 3MM9B 3NWGA 5A6WA 3JQKA 2MZJA 2YKNA 3MAAA 3CXCR 1NJZA 3KG0A 4YB5A 4A8KA 5HQMA 1RT1A 2B51A 1S1WB 2KL8A 2V9WA 5KFXA 1U0HA 2GHVC 3JAMY 4RZRA 2FVCA 2ZDOA 4EUVA 4B08A 3D6MB 3H20A 5HI7A 1IQTA 4DL7A 2LU1A 4ED7A 5A8KA 3CCJS 3D2WA 1U2RA 3G86A 3RW6A 1V3RA 3IO1A 1C1CB 2DXFA 4JI4J 2DNLA 1GFWB 2WK4A 4R25A 5JXSA 2O5DA 5IT9U 3CSKA 2ZEJA 4L6V3 3QFWA 2H54B 1RT5B 3Q89A 2MKIA 1NPPA 1NSAA 4LIWA 3TANA 3RAQA 3PKMA 2DH7A 3ADAC 2DNNA 2D3OR 3CGIA 2GAGC 3C15B 2LYVA 2YNFB 4NRUA 2MQQA 2AYEA 2DGOA 5DLGA 2PI4A 1T9VA 4DQIA 1R0AB 2DGVA 2UUBJ 2KO1A 1AUDA 5CH7B 1GX6A 1NPRA 4ES1A 3CDUA 5J1EB 2QJ3A 4N8OA 1P27B 2LMIA 2FQQB 4DU8A 3W5YA 2XYGB 4MKBA 4ES2A 5DLFA 2E5JA 1UWAA 1GEHA 2AIRB 3NGRA 3W2VB 4DL0C 2MXYA 4AQYF 3GYNA 4DBQA 3MR6A 2XMVA 3L09A 2A10A 4DR2J 2ASJA 1L3SA 3C19A 2QGFB 4B3RF 1KEKA 4ZVSB 3NGDA 1N6QB 3G9CA 1NNDA 1S7IA 4OYZA 1RA6A 2JX2A 4EWTA 2PC6A 4F0KA 3NXZA 5IWAF 3T6JA 3HI9A 4IO9Q 2XCPA 3D0IE 2XCAA 4Q8FA 2ZBRA 3G6XA 4DV6J 4DZDA 1N5TA 4FZVA 2I38A 1RYSA 1OPIA 2HYIB 4I0WA 2P9CA 2HHSA 3DM2B 3OXLA 4IH7A 1T9XA 3MWBA 2RKIA 2XI2A 4KGKA 4EGLA 1SUQB 5KOWA 2V4RA 2IIHA 3MFIA 2CQ3A 4OZ1A 2YH1A 1AFJA 4ER8A 4DPTA 4NMLA 1LWFA 5M2UA 4HACB 5LMNF 2KM8B 3LWMA 2W4DA 1R8AA 1PBAA 3V4IA 5DDOC 5KG4A 4CYUB 4J9OA 3QWPA 2M70A 3V6HA 3SXLA 4YOEA 3D3CJ 3QT8A 2DHXA 4L72B 4USUA 2FHKA 3A3NB 1N54B 5HATA 5KFZA 4LF5F 2V8PA 3LAKA 4X62F 3LAMA 1Q8KA 3UDVA 5KT6A 3W65A 3DLBA 2PDAA 3OR1A 4DUTA 3KHGA 4ECYA 1R0AA 1IBKJ 4N41A 3IAM9 3N4WA 1U2FA 4F7VA 2QA4S 1PC4A 5MAOA 5H9EJ 4K4YA 3C16B 1U1RA 4K0KF 4WF9Q 4USMA 1FJCA 1NXIA 2O3DA 1Y5NB 4OYOA 1PSDA 2EFVA 2UXCJ 4G1QA 1SIWB 3K58A 2BR0A 3PDNA 1F3VA 3KWMA 1U1OA 2PO4A 3M05A 2E7WA 2H3EB 3TAMA 1SC1B 2RRNA 5I3PA 3CJ0A 3SBMA 4KH1B 1TL7A 4Q43A 3RUBL 3N01A 3G96A 4RBVA 3AOBA 4C97A 1CULA 1SVDA 4FS2A 1XMQJ 1JJCB 4C98A 4FPRA 1RTHA 2IHR1 3M2VA 3RTVA 2V2KA 4TLRA 5HROA 2J6SA 2JH3A 1HR0F 4ZVHA 3PX4A 1LEOA 4PG8A 2CVEA 3BBBA 2QEXS 3AXKA 1HQEA 1S5ZA 3UNYA 5KFJA 1HARA 4ELUA 4GKKF 1H2TZ 1VS3A 4Q2MA 1HD0A 2MKYA 4KY3A 1E6YB 5LSRA 4DR7F 2F40A 4HACA 2RHSB 2OPPA 2AU0A 3VZIA 2ZOMA 3HDSA 2YKNB 1TP7A 1ULRA 4Q45A 1H38A 3GFHA 2V9KA 4ID5A 1V5VA 1N5YA 4Q0BB 3CO0P 2DKOB 3JQJA 4MIWA 4HT7A 5F8HA 4U67Q 2C2MB 3CJTA 4ZVPB 1CVJA 4C11B 1RLCL 1VMBA 1JK9B 2UZAA 3QYYA 1S6PA 5ETMA 2CPDA 1WOSA 3OHAA 1MG7A 5J2NA 5IT9Y 1RT3A 2R3VA 4K7QA 1VQLS 2UXCF 4U96A 3UR0A 1NAQA 2OIHA 1JIHA 2X51A 4UY85 1W26A 1Z2LA 1X5SA 3RAXA 2EI5A 2DGWA 4G3IA 1WSRA 2AZ1A 1G3OA 2GFFA 2HFNA 2Y1JA 4ED3A 2DCLA 5HK4A 1B3TA 5FJ4A 3R6LB 1TK8A 1FD8A 2NSCA 1HMVB 4CQ1A 4O4GA 1SJFA 3TJ9A 1S1VA 3O8WA 4OI6A 2G2YA 4IDKA 4ED0A 2DB1A 3BYPA 3DFEA 2XLIA 2HVEA 3AXMA 2BOAA 4XDDA 3TRGA 4C0OC 4EFAC 2BBEA 1FX4A 1MNEA 4Y0FA 3DOKA 4W98A 1VBZA 3PO5A 5F0UA 3CVKA 3SCJE 2H5IB 2HS4A 2K3IA 3KK3A 2XY7A 4B9NA 1SPBP 5F8GA 3JTPA 2WCXA 3MM7B 1SJ3P 4OHVA 1C0UB 3TP2A 3Q8SB 1FHTA 1NB2A 2FVQA 2G4BA 4WZMA 3AY0A 1S48A 3QBCA 1JLEB 1HBUB 3W2VA 4DX7A 2MB0B 3GR0A 1SCJB 2R7RA 2ADBA 5IC6B 3D4JA 2FC9A 5CYMA 2BW2A 2CYYA 1FCAA 5EWEA 4YN3B 4ALZA 1H73A 2YKQA 3KLEA 2RMLA 3P8BB 4ZVUB 3TR5A 2FY8A 1Y00A 2JZ5A 3QMQA 1K47A 4H4MB 4JV0A 2YNHB 3VGSA 1TL7B 2MJUA 2Z57B 2W2MP 4M5DA 3NY0A 4ZVRB 3V2UC 4OZ2A 3D6HB 4QWEA 5KFPA 3HXMA 4LR9A 2RDIA 2RS8A 4EBCA 4LSZB 2QZ8A 4NI2A 4ZPDA 3U27A 5L9NA 4FS1A 1D0EA 3QIDA 3GV5B 2R8GA 3OVBA 1Q8LA 3TZYA 1FRHA 1H6KX 2LQ9A 2OPSA 5ETPA 4TU8A 2XNRA 2VPWB 2QN6B 1NJYA 1R3NA 1TFYA 1SQEA 3NNCA 4EYHB 3N6LA 2OSRA 4I64A 1V3ZA 2OPPB 2XTJP 4Z2XA 1XR5A 3GWCA 4X4NA 4NLOA 2I0XA 4PWDA 4Y6IA 2VH7A 1TVRA 2RU9A 2YQ3A 3FVYA 2X7IA 3EE3A 2CQCA 2D1CA 3K89A 4F4AA 2QLBB 3KLGA 3H5YA 2IM1A 2JEIA 2YPZA 2IA6A 4OLPA 3TAQA 3H59A 1H0HB 3GIMA 3HLUA 1S12A 1FNOA 1NJWA 2F4VJ 3VWSA 1G6BA 3Q86A 3ET6A 4OI4A 1REGX 3MECB 3CCRS 4RW9A 2V4JB 2FJVA 3MPDA 3UWTA 2MGZB 1T9WA 2HURA 3ENVA 4MFBB 1QTMA 1RWUA 2HZVA 4B3OA 2KJVA 4ZS6A 4DPYA 3WHIA 5D4LA 1XMOJ 2MZSA 3GTYX 1IJFB 2HNZA 4J5OA 2YTCA 3HHLC 1JJHA 3K8VA 1LFWA 3MPWA 4LVOP 2B3TB 2L9NA 4M5MA 4M5NA 4NWBA 2K3KA 1D9FA 4LBPA 3TEHB 3KLEB 2AF6A 1SL1A 1HLWA 1VK8A 3M7VA 4LFBF 4LF2A 3JXOA 3IR6B 3MCMA 1TUVA 1LWCB 2VUGA 2V8HA 4YS2A 3EVMA 3F44A 1KLNA 2UVRA 1FVSA 1R8HA 1IN0A 2Q3PA 2WSFC 5HSPA 4FNIA 1PG5B 3M30A 2V8GA 2VJUA 5KFQA 1BQNB 2MQLA 4J9KA 1BE4A 3FFIA 1P6TA 5HJYA 1LW2B 4EO8A 1N8RT 2F1FA 4IFVB 2VJVA 4ECZA 2COLA 3LTOA 4TU9A 4LSNB 4V19X 3PVXA 1TL3A 1S77D 1S76D 4TY9A 1FFSB 1S4FA 1SQGA 5E3RA 3DLEB 4C0BA 5DQGA 1U6BA 3OL9A 2P6SA 2MDAA 2G2ZA 3R7BB 5DZ6A 4OQJA 4WTOB 1HNVB 1RABB 2JLFA 3PG9A 3MAQA 2HHQA 4KGMA 2YNFA 4KAIA 1DTQB 1OYEA 2VFRA 1FFGB 3TX0A 5K9FA 9RUBA 3CCMS 3SSRA 2NSBA 1E6VA 2YPYA 3FMWA 1Q16B 4KKOA 3DRSA 2VFTA 2MMYA 5LSLA 2CUYA 4Y2IA 3H5SA 2LEPA 4USIA 2PGCA 4ZIVA 3PTWA 3TUZC 2DNKA 3EX7B 4Q8EA 4KFBB 2CZVC 1I1GA 1ZH5A 4IG3A 2YWFA 5E3PA 4F4XA 3KUGA 3KLIB 4QIVA 1U1KA 3KJNB 2DR7A 3IBWA 2M5YA 3RBZA 1UCNA 1VIXA 1F5AA 1C1BB 3HFVA 4GVBA 1GTHA 5KT2A 3HHKA 2Z4PA 1CQMA 1S1XB 4K5SA 1HHTP 3FBEA 3SYZA 2BEFA 3UCZP 4IYQA 2HSEB 1SJ4P 3ILIA 3D68A 2P8IA 1RKJA 2N3LA 3IWNC 4MKYA 4EO6A 4ZP7A 2FJWA 4LJMA 2K2PA 2EG2A 1X31C 1TAQA 2RS2A 3K5OA 3BR8A 3DOLB 1TTHB 4KE5A 4X4OA 2ZZNA 4K50A 2J7WA 4ANEA 1FJGJ 5J2MB 3C15A 1TELA 2QX0A 4XPEA 1JJ2R 1VQPS 1RT6B 4QYRA 3BH7B 1S72S 4H4MA 1NHVA 1QM9A 3LH2S 3VAKA 1MU2A 3MOJB 6AT1B 4RR5A 5GAEU 3I32A 1K8AT 1UFKA 4ZP8A 1N32J 4ZPTR 4K8RA 4OHYA 4CM0A 1NDCA 2LKZA 3RZAA 2R8IA 1U09A 1FNMA 2OI2A 4RW4A 5F41A 2ZH7A 4K4XA 2UV8G 2DGUA 2CJAA 4RWXA 4UUWA 1C0UA 3A4TA 4ZCKA 1ZETA 1KLMB 2ZBIA 2K7JA 3HVTA 4AD6A 2JNJA 3QO9A 2HRYA 3IR5B 2E9TA 4CZCA 4X65J 3PV8A 4NA2A 2ZJRQ 4IG3B 3UCGA 3H2LA 3VAFA 3VAMA 2WVEA 1F0XA 2V0NA 4OZ0A 2VFUA 3ZZTA 3FZBA 4DL3A 2VHGA 4DSKA 4NXMF 1FRJA 4K4UA 2A1BA 2PE8A 1UKUA 1JKHB 3M9OB 3SZ2A 2XI3A 4DR6J 2CPZA 4ANDA 3W5XA 2GCFA 4CLUA 2A18A 3UI3A 2HVIA 4LF1A 1M1HA 5G0RA 2XMUA 2CIMA 3RAMA 3THTA 1GTEA 3UD5A 1KD1T 1N0UA 2IDEA 3C2PA 4CNZA 2DNMA 4KYZA 1HIYA 3QGGA 1TL5A 5BR8J 3QSIA 3JS9A 1RHMB 2P5VA 2HHHJ 3I55S 1HBNA 4LF6F 3C8YA 4GO5X 2I8EA 2BXJA 4I2PB 4I6AA 4A8YA 4G65A 1YJTA 1VK3A 3HSGA 4DSFA 3G8SA 6FD1A 3A12A 1ZS6A 1U1LA 1NK4A 4RUAA 1HI1A 4OJHA 2DNGA 1ZA2B 1H74A 2ACYA 5CD4A 1LFPA 2CQGA 2ZC4A 1DARA 3KDOA 1VRTB 3T19A 1TKXA 3E01A 3W8GA 3FBCA 1QAJA 1TL4A 2YXLA 1YRUA 1A7GE 2DR6A 4GVLA 5CYQB 2RHQB 1UPPA 4LFBJ 2VFSA 2RQ4A 4H54A 3MHYA 3QO9B 3FFIB 4FXVA 1ZM2A 4CRJA 4X64J 2L3MA 3FSIA 3HVTB 2MZRA 1ZM9A 3PHTA 5EDWA 4UW2A 4DR4J 1HQUB 3LGMA 3LQVA 3CJSA 1S1TA 1IKYA 3OUYB 4CLTA 3U1NA 3ELHA 1WEYA 1TFWA 4U7CA 4P2FA 3DMJB 2UUTA 3K5LA 1RWPB 2H48B 3RRGA 1UTAA 2XBPA 2GVDB 1AZSA 2A6MA 1ICEB 3BO2A 4CLSA 2M8DB 2C42A 4J7CA 4KH0B 3MM5A 3AOCA 3TVYA 1HWLA 2HWHA 2L9WA 4DQPA 2AJ2A 2DYAA 5KFWA 3MEEA 4YQWA 4NEYA 3GQCA 3P45B 2X3GA 4C48A 2AMCB 3J7YU 1K1QA 3QGIA 5EX0A 4ZVGA 1MMDA 2BKPA 2ZWPA 4IG0A 4LR7A 1ZYQA 5FD1A 2IBKA 4KBIA 3TOQA 4RJVA 5A0YA 4F04B 4JYAJ 5G4DA 1NK6A 4CCHA 2HHHF 1V6HA 2BJDA 4RW6B 4PG4A 3W1YC 4O3QA 5E3AA 3FJ2A 2HVZA 3BJYA 2RNEA 3QIPB 2C2EA 1XTZA 2KHCA 1RDRA 4UOFA 1YBTA 3QRPA 1C1BA 1MLAA 3IG1B 2BE7D 2VKZG 1U0HB 2KTQA 5D8HB 4LRBA 3FUYA 2CZ9A 2DHAA 2PEHA 3MMJA 3VQSA 4DUYJ 2HFVA 3BZQA 3HP6A 2I2YA 1KTVA 4L75A 3PJ9A 4KFBA 3ZZPA 3M2RA 1LWEA 3HHLA 3I96A 1P8GA 4USTA 4NI2B 2QRRA 4FBUA 3CJRA 4ED5A 5DJBA 4E98A 3JYTA 4ZPBA 2NXEA 2Z2YB 2HKEA 5KFBA 3M8QB 4X66F 2VOPA 3GYXB 2HBQB 3CD7A 4IFYA 3TA1A 4EMDA 4UY8T 3QZ7A 2MLYA 3V6DA 4NLVA 4QWBA 4OX9F 4OI1A 3MF5A 3EUNA 3IS9B 1S4EA 1N0VC 1IKXB 2WW4A 2VC0A 3CWJA 3IBFB 4RBUA 4JI2F 1OYDA 4DZ6A 3ETMA 3Q8RB 2MPUA 3EJMA 2A6OA 2W24A 1QVGR 2M9KA 2VB6A 1UL3A 4HTJA 1FRLA 3D0GE 5K20B 3FDSA 1O0PA 2VG5B 3CCZA 4P9SA 2APOA 2JSXA 2PI5A 2CQ4A 2FJAB 2V4JA 1YLXA 3M1VB 3TUJC 5D0GA 5CA5A 3W3SA 5KAKA 1J27A 1X4DA 1Y3JA 2E5GA 1FWPA 3DDKA 5A0YB 4WXWA 2HHVA 2Y8WA 3KMQA 1NLKL 3LP1A 1X9WA 3E3XA 2ZD1A 3CEDA 2LLZA 3OBIA 3ZTOA 3TI0A 1R0CB 2R7SA 3IG1A 2HW3A 4UQTA 2IAJA 1LOUA 4KC5A 2R2RA 2FY1A 4KHPJ 3MM5B 4WYLA 4NLUA 4M8LA 1VOMA 2MQNA 3A3PB 4L3NA 3I56S 4FF3A 2O1PA 3IM9A 3D0HE 4NOHA 2ZKTA 1MN7A 2ZHBA 2I1RA 2IMWP 2BKNA 2DGSA 2PFDA 1FRIA 2MKJA 2GVZB 4EZ9A 3ET6B 2JFDA 4RWWA 4IG0B 4KO0B 2X3DA 2Z58B 4P71A 2GJ2A 2ZBPA 5EWFA 4XIUA 4ED4A 3NOCA 2G1HA 3NBPA 4FYWB 4PG5A 4CDIA 3H25A 3NGSA 1RHUB 1U25A 4DR7J 4WP9A 4WFAQ 3BSOA 4NMXA 4A8MP 2V5HG 2ROEA 4K2XA 5KFTA 3T9NA 1UZHA 3UW1A 3WC2A 5L1LA 1M5OC 3FGVA 1PIEA 2E1MC 5AE3A 2FHMA 2DBBA 3MUVP 4DCOB 1NM2A 4ZLPA 2LXIA 5H9FJ 3GIKA 2ZM6J 1IBKF 3IWXA 2KU7A 3IBCB 4PQUA 2E7XA 3GCXP 3QGHA 1WUUA 2OHDA 1RAJA 5CD4H 4MYUA 3LUYA 1HNWF 3HM9A 4IUFA 3P6YC 3IR7B 2PMZD 3K5MA 2R42A 4C8KA 3KFWX 2QG9B 4X62J 3N6MA 1XNRJ 3FCVA 1IR2A 2XMKA 1HFEL 1MN9A 4LF9F 1S1WA 2A2DA 3BPSP 4OJ3A 4ZCLA 3QLHB 5KFIA 2WBRA 4DI6A 2FJXA 3CF5Q 2DT9A 1TUGB 1PJ6A 2GIQA 3CCWA 3SCKE 1XR6A 1Q7LB 2W2OP 4J9UE 3BQ0A 1D9DA 1FXLA 2UXBF 4AUKA 2DJWA 1ITPA 2AJQA 5RUBA 4JUZA 1NJIT 4RLEA 2KZMA 1XR7A 3VAHA 4YFUA 3CDBA 5L1IA 4DSLA 1B0VA 2VPXB 5F3ZA 5CXTA 4WFZA 3PX6A 1RTJB 2HGLA 1BC6A 5EHHA 1CBKA 1WC5A 4NZ0A 4BS2A 4MMOA 1FF2A 2CNNB 2XZDB 3FC9A 4NCGA 4ED2A 4CO2A 4IOAQ 1R0BG 4JV5J 2MZQA 4OJ1A 1IUJA 3M2UA 1WKKA 4F67A 4S0MA 2CPHA 3KJFB 2N7YA 4FP9A 4KV8A 5HMXA 3T5HA 3GE9A 4DX6A 2YNIA 1JLCA 1SC3B 2B9XA 1K0VA 1YJVA 3KK2B 1NK5A 2ZH9A 2ADCA 3HJFA 3W61A 2G0CA 4KJIA 3ZZOA 1QSSA 2XY5A 2CVIA 2MQOA 2WZ1A 1PJ5A 4CTAA 2MQ8A 3AQOA 3QAUA 5D77A 1Q8IA 3AJ2A 1M1KT 3DU6A 5J2NB 5J2QA 5B09A 2J0SD 1B99A 4LRDA 1WDTA 5J2MA 1D3WA 3B4DA 2FLPA 1TV6A 5BYRA 2DCUB 3NCQA 1KQKA 1A6LA 4FYYB 2E5LJ 1S10A 4UOHA 1T3NA 3N5FA 1SL0A 2DGXA 1J5EF 3QNWB 1F60B 1LWCA 2F7VA 4YHHJ 1RWKB 2KXHA 3G8QA 1IBLJ 2MHNA 1B0PA 4NXMJ 4MAKA 4OI0A 1N5VA 1X0FA 4DG1A 4IO1A 4QBUA 4FXDA 2R7UA 1UETA 1DLOB 1RAOA 1RHKB 3QT7A 3CCUS 2DR9A 4WU3A 4Y3CA 5KFDA 5KFAA 5KT5A 1YQHA 1TR0A 2FHOB 1TL1B 2FZKB 5E41A 1GX5A 1MWZA 3P4UB 4OI3A 4TKTA 1CJVB 1NZAA 4KB7A 4X4SA 2EC2A 3SV4A 4J37A 5L9XA 5DGAA 4DEZA 1S6OA 1CJUA 3GSIA 2HS0A 1X4GA 2V2VA 1PILA 4WIIA 1SI9A 2HFUA 5CYMB 1T94A 1UVKA 1ZAXA 2M8HA 2ZH8A 4NLPA 4OZNA 3PIOQ 2RUGA 1N33F 3TUPA 2DXEA 2F8EX 2VDIA 3OTOJ 2GNKA 4M5GA 3NCPA 1JLQB 1JNZB 2KRRA 3SFGA 3CC4S 1SV5B 3BN4A 3VTIA 4KGZB 2BW7A 1TK5A 3VVUA 1HNIA 4ZK7M 1NDLA 3BYRA 5HP1A 3M8SA 2HFZA 4DJBA 3HK2A 2G0JA 2C1EB 3U7JA 2MQPA 3SEOA 1Y0HA 2IAJB 3ITHB 2V67A 3ISZA 2W1BA 4U7UK 3SI8A 2QC3A 4ZITA 2CKWA 4PG6A 4ERDA 5C7PA 1JLAA 2H5EA 4X84A 3ZZYA 4M5DB 4DFKA 3PW0A 3CUNA 3MEDB 4G1IA 3OLAA 2E5LF 4ZHRA 4JI8F 4DPOA 1OS5A 2MYFA 2VBXA 4QYZK 4HT5A 3R5GA 5BR8F 3MEGB 3GSDA 1FJGF 1S9EB 2W4CA 1NO8A 1GAOA 1IBLF 3D5MA 2Y3YA 3IXQA 5HMZA 1LV5A 3MI7X 4BWMA 4DR5F 2DO0A 2PA3A 2X1GA 4X4TA 2VFVA 2XEXA 5D0RA 3KDNA 1X9MA 2FC8A 1XMBA 5D4NA 4ZN3A 1YJUA 2VC1A 2QL7B 3NCRA 5ITHA 5GMKa 3UD3P 2DHSA 1FERA 3GIIA 4HEA9 2B4PA 3SQGB 1YBAA 1N48A 4J9RA 1MWYA 1TKZB 4O3PA 2V94A 2IM3A 2JL9A 1PAUB 1N33J 2ZBCA 2AEJA 4G1PA 3SQOP 2MLXA 2B4UA 2D3O1 3F41A 4C11A 8AT1B 1QAIA 1H2UX 1GXUA 1RGVA 2VDHA 3BGLA 5A8WB 2C2RA 2R7VA 1FRMA 1WC4A 2VBZA 4ZDNA 4X4PA 4K4SA 1FXRA 1ZBTA 5KOXA 3GIJA 1KHVA 2D7SA 3QLHA 1FJ7A 2FJDB 3HSDA 4DU7A 4LF4J 2YWEA 3TVZA 3H5UA 2KVQE 1FKPB 1IXKA 3I5CA 4FYVB 4WBFA 4B02A 1NKBA 1LK7A 2C28A 3M8ZA 1PYSB 2R8HA 3QJPA 2R9LA 4NASA 1FKAF 5JVHQ 4OYIA 1I3OB 1RWVB 4ZN1A 1T7PA 4KHRA 4WK3A 2PEBA 2AEFA 2NQPA 4TYAA 4X66J 2KVIA 4C3MA 1GT8A 2YWWA 5EUHA 3MMCB 1VBYA 3T1YF 3IRWP 3OQ2A 5IT4A 1VIOA 3MM6B 4H4OB 1KC8T 1F5BA 1SQFA 1S6UA 5B0DA 4DV3J 1N52B 1PJ7A 4IRCA 1HNWJ 2D74B 2XHWA 3R8YA 1HBUA 1HQUA 1RT5A 4OX8A 2XO7A 3GV8B 1NB7A 1RADB 2WB1D 4YB7A 5DDQC 5E33A 2W8LA 3IGVA 4PG7A 5KFUA 5GAHU 2CXEA 2ZD1B 1BMQB 3AAWB 1AZSB 2O66A 3BGOP 4U6PA 4JI3J 2CNOB 5T41A 4IKAA 3HVWA 4L74A 3R1LA 2MTLA 2YNHA 5CABA 2ZHAA 3BO4A 5B0AA 3UDLA 3UDEA 4DSIA 2EFQA 4YR3A 2CQ0A 5D0HA 2KHDA 4J9QA 2MKKA 4DR2F 3MEEB 1O5JA 2OLWA 4DR6F 2H65B 1WF2A 4B9VA 4JV5F 2RDDA 5A8WA 8ATCB 5KFRA 3AD7C 4AL6A 1JLFB 4GC6A 1RQ0A 2RB7A 1WTFA 1VQ7S 2C2ZB 1KWMA 2PN6A 4O44A 3I5BA 2YKMA 3SCIE 3NGTA 1EARA 4Y34A 3HX9A 4ETXA 4RUCA 3Q8VA 2VF3A 5EX3A 2ZVSA 3DLGA 2BANA 3NEKA 1YSJA 2WBMA 5HBMA 1LWXA 3IRXB 3K5PA 3MR5A 3PM9A 3KYLA 2BRKA 1X5OA 1X4BA 4C8YA 1WJ9A 3EMTA 4KQZA 4RW7A 2KYZA 1EP4B 2I9SA 4NLTA 4ZP9A 4NXNJ 3R1HA 1U49A 1U1MA 4P52A 4OMFG 2F9JA 1OJ4A 2GHPA 1LWEB 1RSCA 3B4MA 4OHZA 4UUXA 4F25A 3OTOF 1N56A 2H51B 3I0RB 3I0SA 1BWVA 1S9GA 3QWUA 3KHRA 1RT4B 1SV5A 3A8EA 3AD8C 2AJ1A 4I6YA 4O23A 5AE2A 2VU5A 1FTCA 5ETSA 2HMIB 3HZEA 4E0DA 4EZ6A 5KFOA 2RRAA 1E6YA 1XJWB 2CNKB 2D69A 2OPRB 2KG0A 2B7BB 3M32A 4DF4A 4O3SA 2XQCA 3BEGB 3ITHA 2ATCB 4DV0F 1ZPWX 3WDOA 3Q2SC 5FIIA 1IWGA 1RE1B 2DH8A 2HZAA 4ECVA 4DQSA 1RU1A 3EDQB 5T7LA 1QAYA 4F4KA 3M2RB 2JOQA 3ENWA 5HVFA 4HVZA 5ETNA 1S6PB 3PW7A 2EG1A 2ZWOA 2C2KB 5C24A 4WK1A 2KT3A 2M2BA 2B8QA 2QFIA 4QR2A 1PKUA 5B7WA 3H42A 2KFYA 3OHBA 2ILYA 3R5AA 4DV5F 5DM6Q 5E2QA 4LFAJ 2BQRA 5B0BA 4LF7F 1NRKA 2QYCA 2BACA 2ZOFA 3ISNC 1UW9A 3DGVA 5I42B 4F02A 2KYXA 5CZVA 3UNGC 4R0EA 2GQ2A 2JWNA 2E44A 2CAJA 2WVDA 2KKHA 2W7AA 5C42B 3Q8YA 1V5IB 1HR0J 5IQ6A 7FDRA 2MKHA 1YKWA 2DNPA 3BREA 3GJSB 3M6WA 3GIRA 4QJVA 4ZJQA 4GKKJ 3O1LA 4K4ZA 2V69A 2ZUAA 3I82A 1J2VA 4U8YA 3DI6A 5KG0A 3G71S 4DL6A 4LF8F 5LXYA 4F0HA 1Z4UA 2EKYA 1BY9A 4I4BA 1DZ5A 1EAYC 2WW8A 3C16A 3NAIA 1PC5A 3PJXA 4PEOA 1WSVA 4QIGA 3U02A 1DY3A 4KO0A 4QIEA 1HWUA 4ZPWR 3TQEA 4CH0S 5IV4A 2JLGA 3EPGA 3OPKA 5GVQA 5B0FA 3KLFA 2PT0A 3ILLA 4JI4F 3HCXA 4HI2A 4C8NA 1QTNB 4A8XA 1RWWB 1IKYB 3GR1A 1BXNA 2AQ4A 1S0MA 4GVBB 4FPIA 3ZXWA 2HIYA 1OMSA 1YX2A 3EICA 3PFOA 5D4PA 4LVNP 1VQMS 3EGZA 4HI1A 1HWJA 1C4AA 2GVDA 5KT7A 3CCQS 1T02A 1RAGB 5IC4B 1U8WA 2QFJA 1CPZA 2IRXA 1NPKA 3PYFA 2NXCA 2HGNA 3TWZA 3I0SB 4MIAA 1SJRA 3FCHA 2KI2A 3S1TA 4JI2J 4CT9A 2FYXA 3P5BP 4OX7A 1N36J 2VA2A 4A4JA 1PO6A 2E9ZA 4HKQA 1DTTB 3UQSA 4QWCA 3EWGA 3OVSA 3A8IA 1TAUA 1H7WA 2LCWA 4LMZA 2B56A 1S57A 2VQEF 2R8JA 2HNDA 4PYAA 5T7LB 2OD4A 3C6TB 3Q24A 2VBWA 4B3RJ 1HBNB 1UA1A 1YRXA 1UVNA 4NLYA 3JSBA 1S99A 2ZFHA 1NU4A 2J9DA 4I69A 2VPYB 3UN2A 1ZM4A 3SFUA 4A48A 3S8SA 3PR5B 2FGOA 3F73A 4EEYA 1QVFR 2J0WA 4GRSA 4RKUC 4O3NA 3J81Y 4UT4A 2MGZA 4LQ3A 1GMWA 2J7UA 4DV4F 4NLRA 3OL7A 5MLCV 1ZPVA 3HHEA 4NLDA 2ZOGA 1JKHA 2L9DA 4OYMA 4C8OA 4RNHA 1Y5IB 3OR2A 2VONA 2BE9B 2OELA 2W7OA 1N6QA 4IRKA 1HNZJ 4WIQA 5BXIA 3S6EA 1JLBA 3ONQA 1X60A 1ZA1B 3POTB 1XWLA 5C25B 1U24A 4R8UA 1O8BA 4F0MA 4QW9A 3M4XA 1N4LA 2Q66A 4RW7B 4WZQA 3UVJA 3CMES 3CCLS 3W8PA 3BDEA 2AP6A 2VG7B 4XPCA 2FGCA 2O01C 3NWRA 3OTDA 3V81A 3AD9C 4CO4A 2E1PA 1PYOB 3VF0B 2XMMA 2J76E 2CJ9A 3TZZA 3HVRA 1M5VC 1FEHA 1QE1A 2VD3A 2EWHA 3DRPB 1TUWA 1Y11A 1N5QA 3W5ZA 2VG6B 4BCAA 2OEKA 1R8PA 1RXOB 2HQCA 3PW2A 4DR4F 3WIVA 4OZ3A 2XB2D 2EFOA 1UZDA 2HLTA 2R4FA 3ETOA 1WHYA 3H2UB 2W2NP 3P3DA 3G82B 3PEHA 4OZJA 4QR0A 4LR8A 5DETA 5AXNA 1U4BA 4RBTA 1TKTA 4OLOA 5A76A 2DNYA 4QR1A 4DMZA 5EN1A 1JNRB 3GILA 3V6JA 1ZAWA 1REVA 1IQZA 2IPOB 3MM9A 4MK7A 3R9LA 2OFGX 5GAGI 4B9LA 2OAUA 1FI4A 3QJLA 2DXDA 5M2RA 3GPAA 1IWAA 1ELOA 2MKCA 2NUUG 5L8RC 4IR1A 1AUSL 4R0JA 5EGYA 2Z2ZA 3GP9A 1XBWA 2XZWA 4G1QB 1R8BA 3O3LA 1WHXA 2ZE2A 1WORA 3W64A 2ZH6A 1UVLA 1XNQJ 4O4RA 3OJUA 1YWXA 3VZHA 4OIXA 3OR2B 2XZTB 3KG1A 3OLBA 2JC0A 4NA1A 5KFLA 2UVVA 4J90A 4ENOA 1S1XA 2HNDB 1UJ4A 5GMEA 4YR2A 3R5DA 2W8KA 2B8PA 3ILJA 4RNOA 3HSZA 2HBRB 1M5HA 1V3SA 1FDBA 3PACA 4WE1A 4ECXA 4X4UA 3DN9A 3OVAA 1G2EA 2NCKL 2BJ7A 3R5JB 4M1KA 4C3LA 1LW0B 4ECSA 4DQRA 5CAAA 2YVSA 3CJ8A 3HHLB 3GMGA 3Q8PB 2HQ3A 1J5OB 1DFDA 3SSSA 2GMJA 2GHWA 1WI6A 1NKEA 1NSKL 4USWA 5KFHA 4YR0A 4JI7J 4CH1A 4LT6A 1X5TA 4F4WA 2RRBA 2HNZB 3DLEA 4HLBA 5K14B 2IM0A 3I9V9 4IFYB 4ZJLA 1OY6A 1DRZA 4PXEA 3RB4A 2EFPA 2C3OA 4HHUA 3WZ0A 2G13A 4DR1J 1J5EJ 3C66A 2CQHA 3JSYA 1T95A 2HVHA 5D78A 5J1EA 4DFMA 1PCAA 4PWUA 4DR5J 4F50A 4JI7F 1FXDA 3KOAA 3LGNA 3R7NB 4Y2AA 3H7HB 4H4KA 3DDIA 3PJWA 4OYPA 4WWSA 4LRAA 1NK0A 3QT5A 4QWAA 1KS2A 2E5HA 1U47A 1CS4B 1KBRA 5D0EA 3OSPA 2HNYA 3H98A 4TY8A 4OI2A 5IZHA 4PKDB 2YQ0A 4B3SJ 2CNLB 5A2QY 3EDRB 5A8RA 4DDFA 1T0TV 2HGMA 5ADZA 1WACA 2HFSA 5HMYA 5GADU 1DQ8A 4ELTA 3KJVA 2RE1A 3CDWA 4XAKA 4J9LA 5HBMB 4F3QA 3LP0B 3LWLA 2NYIA 2N7CA 3EVWA 3CNQP 1S6QA 4DOZA 3JSMB 4BC9A 4I2QB 3GFYA 1U45A 2CQDA 2GV1A 3RBXA 3SV3A 1FO1A 2DPIA 4W92B 2C22A 1NK8A 2P9GA 3GV7B 2DISA 2DNRA 3V6KA 1IKVA 2YKAA 3FK4A 2K1RA 2LVWA 1HPZB 3SMZA 1UVJA 1KOHA 2M0GB 5KFSA 3Q0AA 1OIAA 2E1AA 1JMTA 1RHJB 1FKPA 2HIQA 1YG0A 4NLSA 3PW5A 5KFMA 2ASLA 3L7OA 3ZTQA 3LA0A 3LANA 2ERRA 3CJ4A 4K5RA 3QFHA 2K7KA 1NSQA 3PYDA 3OR1B 1MSWD 4W90B 4IH6A 1IJEB 3K8WA 1X9SA 1HI8A 3ILOA 4AYBD 3ZFVA 4ZLLA 5LJ5Y 1GH8A 3DLKA 3L4BC 3A8KA 2GIRA 2CQPA 1NDPA 2IYIA 3M2VB 5LM7E 3VAIA 1YDLA 2LP4A 4IH5A 4Y2CA 4B3MF 3NBPB 2HNYB 3MM6A 4H4OA 1MMNA 4PABA 4TY8B 4QQBA 5F8MA 3EYZA 2BQUA 3T5JA 3BGUA 4LF7J 4LFAF 3UPFA 2UUCF 4USKA 2N3OA 1NH7A 1S1TB 3OUYA 2M88A 4NA3A 2DEJA 8RUCA 2W7PA 1UFWA 2PFFB 2IDLA 1BGXT 3MPUB 4NLWA 4DV7J 3LALA 1ZOTA 3AA9A 1SKUB 2EXUA 3CJ3A 3O6QA 3JQMA 2BJ9A 2ZITA 4ICLA 4WFYA 1B7FA 3B78A 3TAPA 4I7FA 4CO3A 2OH2A 2QSWA 2ZH3A 5GAEI 2J0QD 4C6AA 1AROP 2K8GA 4QPTA 3T3FA 5LMUJ 3VV2B 3M8QA 4LRCA 2DK2A 3KLVA 4DSEA 1LK5A 5KG2A 5AJ3J 3VHQA 3W9IA 1RTIA 3T1HJ 3KK1A 4LFCJ 1BHNA 2F9DA 3CC7S 1YGYA 3D1QA 4DCPB 1N34J 5HMWA 1N5YB 4Q0BA 1VJWA 2B4VA 3CB4A 4FVCA 2UXDJ 3KMSA 1S0OA 5KFEA 3GFXA 3MFHA 3H90A 3LP2A 1FA0A 4NCBA 4NZ6A 3KXDA 1LQ9A 2YQ1A 4DPUA 1HBOB 2HRUA 2QMXA 4JI0F 1YZ6A 1RT3B 2AYMA 2NS1B 2CJYB 3G2XA 4N56A 3RRHA 2YNGA 1N34F 2B6AB 4M5HA 2DRBA 2HHTA 2G2OA 3PIPQ 3DM2A 4YP3A 1HBMA 2JDJA 2W25A 4J9PA 3M30B 1I94J 1RWOB 3DRYA 4URSA 4JI0J 4ID8A 5IT0A 3AA8A 5F9NA 1CC7A 2BANB 2XSJB 4CO0A 1XNQF 3KLFB 2R7TA 5H1SV 2V50A 3GCWP 1IBCB 3KKFA 2FIUA 3IMQJ 2RF2A 5LOQA 2GMHA 4O3RA 5HQLA 1T03B 2LU2A 1VRUA 2IC3B 2BA9A 3NKYA 5ETOA 1S1UB 3TA0A 1TMJA 4B17A 3LOUA 4U95A 1IR1A 2HBYB 1VJQA 3NP5A 2GA7A 4QU7A 4J9NA 2HWTA 3M6UA 5JVGQ 4P2MA 4NPOA 5IS2A 3CJKA 2UUAF 3W62A 3FSYA 5LSOA 2Z0GA 1WTBA 3JSRA 2V8VA 2OPSB 1Y10A 2CPXA 1AFIA 4DN0A 5F8LA 5GADI 3J7AN 1Y4ZB 4WP3A 5A6PA 3MXHP 1W2BR 2EC0A 2DNQA 3CJQA 5KFYA 2WAQD 1DURA 4ZOSA 2H4WB 3G6VA 5L1JA 2OGUA 1S9FA 1JX4A 1HNXF 3MR7A 1HQ2A 5C25A 1EJ7L 1D9AA 2H9ZA 2QMWA 2FJEB 4MH8A 1WG5A 4TQRA 1G1XA 3TYTA 1B4SA 4DG1B 2C3PA 3T1YJ 4ED8A 5DM7Q 5LJ3Y 1RBAA 4WTYA 1K44A 5KT4A 2ZH4A 4J9MA 4B3OB 3MR2A 3IGNA 4ZMMA 4F8RA 2ZUGA 3MM8B 3IM8A 3Q23A 2RQKA 3DLJA 2C3UA 2B9YA 3Q83A 1B64A 2IY5B 2XO6A 2HHPA 4DV0J 2BV3A 4IOCQ 4C7QA 2QA2A 1IKWA 1F9HA 2Q79A 1VFJA 5DQHA 1HPZA 1ZAVA 4QOTA 3TNVA 2ZVIA 4CLZA 5KG7A 2BUNA 1GMWD 2LA6A 3K2YA 4RNNA 1S7HA 2Q6BA 2WOMA 3BF4A 3FEYB 4TN2A 2A0FB 1VQ4S 1LWFB 4LBHA 1L5UA 2BVZA 5LT5A 1DAXA 3IA0A 1YRTA 2HS3A 2CG8A 3C3LA 3NS6A 1B0TA 2VKRA 4TXSA 3PO4A 3B82A 2DITA 1JXLA 3MAHA 4B9UA 3X1LB 4EBEA 4DS4A 1YITS 1SL2A 2DRAA 4FN5A 2YWHA 5I3UB 1WG4A 3MTJA 2CFXA 2M3DA 4ANCA 2UV8A 1BQXA 2DR5A 1Y3KA 3R2DJ 1S9EA 4RX6A 4V1Ak 2J7KA 1WELA 2QYGA 2BE2B 3NS7B 1HWIA 1HNIB 1U6ZA 1NJXA 2PMHA 2RVJA 5CCLA 3RRKA 4LSLA 2DNHA 5LXRA 3EGVA 1TL3B 2BDPA 3V6DB 2F5GA 2YNIB 4DX8H 3R5CA 1M1GA 1JLAB 1SH2A 2CWKA 2FUG9 2J8AA 3Q8UA 4LF6J 3CT9A 2XG8A 4ICLB 3M8RA 3VALA 3EZUA 4F4YA 5LMUF 2OEJA 2J0XA 4D3HA 3HMJG 2CZ4A 3A3OB 2DNOA 4WYWA 1URRA 2OSQA 4URGA 2CJXB 5CHCB 1HNXJ 2F4FA 4L73A 1RTDB 2IRUA 3I9ZA 4HL9A 4C8ZA 3C14B 5DG9A 2IVFB 1FDDA 2W2QP 1ZM3A 1Q78A 1RT7B 4UOCA 1FVQA 3UDCA 3RBDA 1RISA 2GO9A 3RB3A 4X4QA 1RLDA 4DHVA 3FQLA 2LXUA 5K8PA 4DV2F 2F63A 1WNEA 4AFFA 4YB1P 1OQ6A 1N5SA 1X4FA 3AFGA 2C2NA 1RT1B 3CCES 2C3MA 3OD2A 3TARA 3OTBA 3D6TB 2NZCA 1RACB 2FPHX 4KIAA 2QTWA 3LPYA 1WC0A 2UUCJ 2OTJS 3W9HA 5D15A 4K4WA 1GMVA 2XWYA 2VV5A 1U48A 1BWEA 3K0JA 4TYBA 2DGTA 2HK3A
chains in the Genus database with same CATH topology
4HYKA 1HBMB 2HQIA 5J2QB 3GB0A 3PZPA 1TQLA 4JBCA 4QZVB 1VQSA 2V4QA 4AL7A 5KFGA 2M4MA 4C8MA 5CYJA 1RK8A 2PD1A 4GO7X 3T1HF 4LFCF 2JHEA 3ISND 3RYLA 2ZH1A 1VBXA 4YMEA 4PUOA 1OO0B 3HHLD 3OXGA 2UVWA 1DLOA 1R31A 2GJIA 2NPFA 2ALZA 1IR0A 3MTKA 1S0VA 2R7OA 4J9SA 1KFSA 2LXFA 3CCSS 2ZJPQ 1XN9A 4DV6F 1U7LA 4DUZF 1H3DA 2VBYA 5CCMA 4K4TA 1X5PA 4N47A 3KLHB 3QAEA 3CTRA 1L3VA 2CPYA 2A2CA 2FD2A 2WHOA 2E9RX 1HYSA 1NH8A 1XK8A 1K0TA 4ECUA 3GZ7A 1BQMA 1CQNA 2OD6A 3DOKB 4YEAA 3OTEA 5J2PA 2IRYA 5KT3A 4JI1F 4IOBA 5AXMA 1S97A 3M6XA 4M94A 5B0GA 3VCDA 2IJNA 4WFXA 2AWZA 1HNZF 3I6PA 1H98A 1YJWS 4OJGA 3E2EA 3QJJA 1KHWA 1UJ5A 4ZP6A 3FRYA 2G9OA 4ATNA 2Q43A 1Q1KA 2Z2LA 4NZ7A 1V9OA 4RW8A 3EXCX 5KTQA 3G8TA 1AW0A 1T3OA 4HH1A 4QU6A 4OFZA 5KFNA 2VODA 1TVRB 2JFKA 2KXNB 1HQEB 1LXJA 2PA8D 3KTQA 4A8QA 3ZZUA 1WD6A 2VPZB 2PIIA 4HH0A 3UE2A 5L38A 5L1KA 2J6TA 1RI7A 3O5TB 4ECTA 4I56A 2MKSA 4PPDA 4M63A 3IWLA 3NLCA 2BZ2A 2ASDA 2ABYA 3BSCA 4C2MA 1KNZA 3DNCA 1R27B 3C6UA 5I42A 1DQAA 1UEUA 2BM0A 2ZH5A 4QYZJ 4CO1A 1KONA 3ZZZA 4YDDB 4F4ZA 1XMOF 1HA1A 2CPFA 2B6AA 4CI0B 4IQXA 5C24B 2FVRA 3D28A 3X3UA 1PGZA 4USHA 2SXLA 1TK0A 2GW8A 2VL1A 5E7OB 1MMLA 1K9MT 2EBEA 1R7IA 4DUYF 4DL5A 2YKOA 2AJFE 3NS5A 1U6FA 1QE1B 2RF2B 4KHPF 2B5JA 3QPIA 5F3TA 3M8PB 1FKOB 1OSDA 3PR4A 3TX8A 1HNVA 2NR0A 2I5JB 2D41A 2XLKA 5I3QA 4P6QA 3HO1A 2AX0A 2C2DA 2N82B 3OJSA 1JJ4A 1UVMA 3J7A1 1LW2A 3K59A 2N4CA 1BQNA 2YX1A 5CQGA 2HWIA 2YKPA 1XERA 4XO0A 3JYTB 3T9ZA 4OHWA 4GC7A 4NCAA 4I68A 3T5KA 4FBTA 2E1RA 3BB5A 3IRXA 1UWBA 1T8EA 2IYGA 2N4DA 3A1YG 4A47A 3OSNA 2KH9A 3BQ1A 1TKZA 1QVFR 2YKMB 3ULHA 1H7XA 1KOOA 3E51A 4I7FB 3PHEA 2P6TA 4N8NA 3U1LA 3DC2A 1E6VB 1SB6A 5G0RB 3US5A 4A8OA 2XMJA 4EYIB 2U2FA 3DXBA 5M2PA 3BQ2A 3NG8A 1WF0A 2XS2A 2JRSA 2JVOA 3J7ZT 2J6UA 3UFCX 4PCQA 1MW7A 2YX7A 3I87A 3KHLA 2R2TA 1N32F 1Q82T 4PRFA 3LF0A 2CQBA 2WRMA 4QWDA 2B5JB 1ZTWA 1JB0C 3D1OA 2XLJA 1SH3A 3KNGA 4LF4F 4X64F 1FE0A 3HHDA 5IQQA 4DQIA 4GMKA 4AXJA 2JEJA 4EU0A 2FVPA 2KB2A 4X4RA 4B9MA 2CG4A 2FDNA 4X2BA 3FSXA 2BABA 3G6YA 1XC9A 3UR3C 1CC8A 2ROPA 5CZXA 1EETA 4AE5A 2M7SA 4D3GA 4PPZA 1KLMA 3CJ2A 3V81B 1JLGA 3NNHA 5FDLA 1GXTA 2GQQA 2RSQA 3SCLE 5BJRA 1BLUA 2LEAA 1HD1A 3W2WA 3TQ1A 2YH0A 2NZ4A 5HL7Q 4KR0B 3DRPA 4R8UB 1QUVA 5HLFB 1JLBB 3POTA 4IQMA 2JC1A 3DMJA 4DV7F 3P96A 1UMJA 4B3SF 4WKRA 3BS9A 2GGPA 4I67A 1YVFA 3N5BA 1X4AA 4DL4A 3L7PA 3F56A 4DF8A 1KN6A 2UP1A 4CT8A 1I6JA 2M52A 4KPYA 4BBYA 5IM0A 1WF1A 2MY7A 4LQ9A 4MJKA 4FXWA 1FDNA 3DHWC 2AYBA 2BJEA 4DWIA 3CJ5A 2AGPA 2YWGA 3JB9k 2KZZA 4QW8A 4RW8B 1QLNA 4AL5A 2E29A 2JEFA 3LO3A 4ZVEA 2EFNA 1HMVA 2OP5A 3M2UB 5GAHI 2DPJA 1VGYA 3NMAA 5DDRC 1VQNS 2RT3A 2OJ3A 2D3ZA 1URNA 3EGNA 3MUTP 4FF4A 4NLXA 1F9FA 3KG4A 3RR7A 3Q8QB 1S9GB 3HHNB 1WEZA 1M0SA 2HMIA 2AV5A 2J9CA 1JLFA 2QSFA 5F8NA 1WI8A 1JLEA 2XC9A 1TKXB 2C3YA 5E5NA 1P1TA 3M32B 4ECWA 2QA4G 1K1SA 2OPRA 4USJC 2WB4A 2JJ4D 4XDCA 3MDFA 1R43A 1RKIA 2GGPB 3GFZA 4N76A 5L39A 2FJBB 2UU9F 5SZTA 2EK6A 2ZHOA 2NUHA 5J1PA 4WFBQ 1K73T 1W25A 5IM0B 5KFFA 1R6YA 4B9TA 3QGPA 2HAIA 2RQCA 1MROA 1UAWA 2WONB 3H4BA 3CCVS 3N6NA 5FDLB 1HI0P 4NCBA 4P2SA 2B43A 5D6GA 4QCLA 4RU9A 4ITSA 3S7RA 4DLEA 5D4OA 2CPJA 4Y2MA 3NAHA 5DGBA 4PXDA 2AD9A 3CO9A 4G6VB 4E8UA 5JJBA 2EFGA 3NRBA 4KHMA 2UUWA 3PRDA 2ROGA 3H40A 3S01A 5HLFA 3MMCA 3J7Z5 3Q2TC 1A9NB 1KVJA 2Z2MA 3TAMB 2VG7A 2E1CA 1HW8A 1QY7A 3WX4A 3AHPA 3KLGB 4ED6A 3DI6B 2XSFA 4WU2A 2R7XA 3BGRA 4K4VA 2RQMA 1OQ3A 4FVMA 1KQFB 2BQ3A 2CPEA 2XS5A 4R5PB 4A46A 2LEBA 4PXBA 5HO4A 3G4SS 2R7QA 3LP0A 3OFHA 5DG7A 3AB2B 2POKA 5HQ8A 3TA2A 3FRZA 3KJVB 4JI5F 2IM2A 4DV3F 2AJ4A 1JWWA 2L41A 2CQ2A 3PRBA 1SC6A 4QIWD 6FDRA 1M90T 2B4OA 3C46A 2YNGB 1L3SA 1VQYA 2GC8A 3MPYA 1W2IA 3JTOA 3OTCA 3OL6A 1UEVA 3DRRA 1VQ6S 3K5NA 2X1BA 1FK9B 4A8WA 3CD5A 3FNNA 1VRTA 1H2VZ 2J9DE 2WONA 2ATLA 4KV8B 1SIZA 1YJ9S 3PXGa 4C0HA 3IS9A 2KFNA 2L08A 2ZKUA 3FQKA 1Y9OA 4FF2A 3H5XA 3LP1B 1KVIA 2F8MA 5DQIA 3I4HX 3TVKA 2Q1LA 1VLYA 4OZLA 1LW0A 1Y7PA 1X4CA 5LL6d 4OV1A 1U1NA 4CH7A 4KKOB 1S79A 2IVYA 2W9AA 5E3CA 1Q7YT 2AW0A 5GAGU 3KK3B 2RDJA 3V4IB 3KLHA 4YB6A 1RP5A 3ZZRA 4C8LA 1S0NA 2DD8S 3O2IA 4WXOA 2RH3A 2KG1A 2EW9A 3LP2B 4URQU 2ZE2B 4OX6A 3BM7A 3CE8A 3M9NB 3DRXA 3M8PA 3MZIA 3PW4A 1Z1ZA 1X4EA 1FNXH 3BGFA 2V8DA 4NYPA 2LQJA 4DR3F 2Z8QA 3MOZA 2W9CB 2DVIA 2DNZA 3DLHA 3DOLA 1D8YA 3M9MB 1FEEA 2G1DA 4RW9B 3MM8A 2KM8C 4FF1A 2RIJA 1UA0A 3M6VA 3RBEA 4PQUB 1XEZA 2W9BB 1T05B 1ROFA 3SDEB 2NREA 2J5AA 1C0TB 4Q44A 1RYRA 4R5PA 3BSAA 3EGWB 1X7VA 4MK9A 3HT3A 2RILA 3MMAB 3MR3A 2OMLA 4PXCA 2HPUA 2MSSA 4B3TF 4CO5A 2NXUA 3L95X 1YTYA 2VG6A 3DLLQ 5BYQA 4ZVFA 4JV1A 3OV7A 1QSYA 2MY8A 4C4WA 2QV6A 1RTHB 3FEZA 2OO4A 4AXIA 3MEKA 1JLQA 3DU5A 3AQPA 2CQIA 4MIBA 1RJJA 3VAJA 3RB0A 4MK8A 1GXLA 1TKTB 5K8NA 3PY8A<