1SJ3P

Hepatitis delta virus gemonic ribozyme precursor, with mg2+ bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords precursor form of the Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Hepatitis delta virus
molecule tags Translation/rna
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sj3P00
1X0FA 1X4AA 1FNXH 2E5IA 2CQIA 3TYTA 2MY8A 1JJ4A 1W2BR 1R8HA 2DH9A 1BY9A 2RUGA 1WEZA 2KYXA 2PE8A 1N52B 1U1KA 2AD9A 4F26A 5DETA 2DGQA 5GMKa 2CQHA 1YWXA 2MKJA 2LECA 1KC8T 2KH9A 2DIUA 2DNNA 2BOPA 4IOAQ 1H6KX 2MB0B 2KXFA 3CC2S 3R27A 4CH1A 2OTJS 1B7FA 1HL6A 5LSLA 2LXIA 2RRBA 4QQBA 1X4FA 3CCUS 2RU3A 1Q7YT 1M5KC 3G8SA 2E5JA 2VONA 4F02A 2D9OA 3CD6S 2DO0A 3SXLA 4ERDA 4Z2XA 1VQPS 2LEAA 3B4DA 4PKDB 2AYEA 1VQ4S 1ZZFA 4ZKAA 1U1QA 1VQLS 2A3JA 1VQNS 4RU2A 3P49B 3G4SS 2XB2D 2KRRA 4EGLA 4W90B 1A9NB 2CQ3A 1WI8A 1P1TA 3US5A 2EK1A 1HA1A 2HVZA 1DZ5A 2XS5A 2N82B 2X1AA 3ZZZA 2WBRA 1R8PA 4F25A 3IRWP 1U1OA 1FJEB 4PRFA 2JWNA 4WFNQ 4WF9Q 1U1LA 1G2EA 3S8SA 2KG1A 2BZ2A 2XSFA 1WF0A 3MD3A 2DH7A 4U67Q 5CYJA 1X5OA 1VQMS 1UW4A 3PIPQ 2DNZA 1H2VZ 2M4MA 3BO4A 4LIRA 1VBYA 5DDQC 4TU8A 5ITHA 1NO8A 2DB1A 1KOOA 2DNPA 3CPWR 1UAWA 2JVRA 2DK2A 3PIOQ 3VAKA 4FXWA 5HL7Q 2DGUA 2DNGA 5LSOA 1FO1A 5LXRA 5EN1A 3CMES 1YTYA 3CC4S 5JVGQ 1WELA 3CXCR 1D9AA 3NNAA 2MMYA 2KG0A 1RKJA 5MLCV 3SMZA 2J0QD 2F9DA 2JVOA 1QVGR 2G1DA 1WI6A 3TP2A 2MKCA 1O0PA 2U1AA 5LJ3Y 2DNRA 3VALA 2DNOA 3DLLQ 2MGZA 3CCSS 2X1FA 5D77A 1IQTA 4CQ1A 1VC5A 3UCUP 1WEXA 3G8TA 2LA4A 3D2WA 2DIVA 1X4HA 1A7GE 4YOEA 2MZ1A 2M88A 4WFAQ 1U6BA 1OPIA 2CPHA 3S01A 1U1RA 1U1MA 3OW2R 1X5SA 3CCJS 3CULA 2KRBA 2M8HA 2CPIA 3Q2TC 3S7RA 1KOHA 1H2UX 5BJRA 1VC6A 1HD1A 2JRSA 4QPTA 2DGTA 2VODA 4WKRA 1RK8A 1WG4A 2RNEA 2MZTA 5GAGU 2FC8A 2MY7A 2Q79A 1S79A 2MPUA 2DGWA 1SJ4P 1OWXA 2HZCA 1DHMA 3MD1A 5HO4A 2NLWA 2LQ5A 1XN9A 4WFBQ 2FHOB 2KFYA 2U2FA 2B0GA 1D8ZA 3DXBA 3CCRS 3VAFA 1JMTA 3MDFA 3G9CA 2LYVA 2MQMA 3VAJA 2M2BA 2RS8A 3UD4P 5FJ4A 2CPYA 2MJUA 2MSSA 4C4WA 1N88A 2HYIB 1VQ6S 3CCQS 1WHWA 4UQTA 1WG1A 2M9KA 3CMAS 3BEGB 2E5HA 2EK6A 1M1KT 5JVHQ 3BO2A 5DM6Q 5DDOC 1VQ7S 2CPJA 2LMIA 3UWTA 2CQBA 2G4BA 1WEYA 1ZH5A 1X5TA 1HD0A 4TU7A 3VAGA 1WWHA 2N3LA 4P6QA 4OZ0A 2M52A 3U1MA 3VF0B 3NNCA 2OSRA 2L9WA 3I56S 2KM8C 1S72S 3THTA 5IFMA 1SJFA 1X4DA 2CQGA 3NNHA 3NS5A 2LXUA 2J76E 3ULHA 1K73T 3EGZA 2MZRA 2CPFA 1DBDA 3JB9k 3R1HA 2MQQA 1N8RT 3HI9A 2DHAA 3FEXB 1NJIT 1Q82T 2CQCA 2MQPA 1X4CA 4BS2A 5IM0A 1OIAA 1PGZA 2LKZA 3R1LA 2YH1A 3CTRA 2YWKA 2DNLA 1WHXA 2ADCA 2F9JA 2F3JA 2DHGA 2J8AA 4M5DB 2PEHA 1L3KA 2MKKA 1Q81T 3S6EA 3J7YU 1X5PA 1QM9A 2VOPA 2CQ1A 2MZQA 1M5PC 1M5VC 2JX2A 2MXYA 1X4BA 1Q86T 3NMRA 4LMZA 5GVQA 3B4MA 3V4MA 2HGMA 2MSTA 2CPZA 1VBXA 2CQ0A 2DHXA 1SJ3P 4QU6A 2KXHA 3VAIA 2DNMA 3TO8A 2VOOA 2I2YA 1AUDA 5LXYA 2XS7A 4Y00A 2MHNA 3CCVS 1YITS 2KN4A 1CVJA 2MKSA 2MYFA 5LJ5Y 3BO3A 4CH0S 4CIOA 2XS2A 3I55S 3CCLS 1UFWA 2N3OA 2E5GA 2RT3A 3LPYA 3MURP 2D3OR 5DDRC 4TLQA 4ED5A 3J7ZT 3VAHA 2KU7A 1YJNS 2M8DB 1WF1A 1F9FA 2MQLA 2YH0A 3N9UC 5IQQA 1WF2A 2CQPA 2RQ4A 2QFJA 1VQ8S 2L08A 3CF5Q 1OO0B 4J5OA 1YI2S 4YUDA 1U6FA 2I38A 2DGVA 2CQDA 1NU4A 3L3CA 2FPHX 2YKAA 3G96A 2AYBA 1FJCA 2E44A 1YJWS 1U1NA 3P5TL 1VQ9S 2DGOA 2YTCA 2DITA 4IO9Q 2OSQA 1FJ7A 2D9PA 2DHSA 2M70A 4WIIA 3SDEA 2DNQA 2RVJA 1U2FA 1YHQS 5GAEU 4YB1P 2MQNA 1QVFR 2OTLS 2SXLA 2DH8A 2KHCA 2RQCA 4QU7A 2RS2A 3P3DA 3P6YC 5IM0B 4W92B 5DM7Q 2XNRA 2DNYA 4WCEQ 2QA4S 2MZSA 2X1BA 2UP1A 1VC0A 2V94A 1WTBA 2DNKA 3NS6A 2M7SA 2QEXS 3UCGA 2DGSA 3VAMA 1VQKS 2GO9A 1UP1A 2OJ3A 2KM8B 1K8AT 2ERRA 2K3KA 1M90T 1SXLA 3RW6A 2KI2A 5D78A 2LEBA 1K9MT 4V19X 3THPA 2G0CA 3G71S 1KQSR 3U1LA 3MOJB 2MGZB 4C0OC 1FHTA 1JJ2R 4FXVA 2KT5A 2OIHA 2ZJQQ 2MKHA 3FEYB 2CPXA 2FC9A 2LCWA 1ZZNA 5GADU 2J0SD 3UD3P 2HGNA 2MKIA 1X4GA 2LA6A 3MUMP 1WG5A 2N7CA 2DISA 5CXTA 2DO4A 2O3DA 1FXLA 3MI7X 3CCMS 1WHYA 2XNQA 3HHNB 3MUVP 3CUNA 2L41A 2CPEA 3EX7B 2GHPA 3BS9A 5DDPC 4TU9A 1M5OC 2NZ4A 2MZJA 2AYMA 1SJQA 3UE2A 2KXNB 2AYGA 2EVZA 3ZZYA 2DNHA 3H2UB 1FT8A 1P27B 4IOCQ 3UCZP 2MQOA 5CA5A 2MJNA 2RRAA 1VQ5S 2ADBA 1SJRA 1DRZA 2ZJRQ 3RW7A 2M0GB 3G6ES 1VBZA 1JJHA 3LQVA 2CQ2A 4LJMA 4PR6A 2DGXA 1N54B 1PO6A 1KD1T 3Q2SC 1U1PA 5H1SV 4UY8T 1URNA 3K0JA 3H2VE 4Y0FA 2CJKA 4A8XA 4IUFA 3IWNC 2CPDA 3SDEB 2FY1A 1YIJS 3CC7S 1YJ9S 2KVIA 3CCES 1VQOS 1WHVA 2CQ4A 3MUTP 2HGLA 2X1GA 2ZJPQ 1X4EA 3EGNA 4OZ1A 2K8GA 5GAHU 4C7QA 3MXHP 1H2TZ
chains in the Genus database with same CATH superfamily
4XDDA 1RWOB 2BV3A 1KEKA 3DLKB 2DH9A 3C15B 4FZVA 1RT2A 1WEZA 2PC6A 4UOGA 3C6UB 2ABYA 2PE8A 4L75A 3T1YJ 4F26A 1U0SA 3H4DA 2QYCA 3QFHA 1NAQA 1IJFB 3HXMA 1ZM4A 2RRBA 4KBIA 1KTQA 3FRYA 4ITSA 1N0UA 1B0VA 1Q7YT 4Z2XA 2A1BA 4DR2F 4K2JA 2UXDF 2K06A 4PUOA 4UTGA 2BKNA 1RDRA 2HAIA 1T9TA 5ETQA 5GAGI 2ZBCA 4ZS6A 1U0HB 1TR0A 3MCMA 4Z37A 3MGJA 3WIUA 2F5GA 2OO4A 1SCJB 3BO4A 4LIRA 3K8WA 5HAOA 2DB1A 3SQGA 1HNXJ 3KG1A 2GX8A 3Q8QB 2AZ1A 3PCOB 4S0MA 3KUGA 3FEZA 3KOAA 4F2RA 3POTB 4Y2CA 5IV4A 1GH8A 4ZN1A 1RKJA 4DV3J 4RBVA 4K4ZA 2NYHA 4RUCA 2VPXB 4B3TF 3PJ9A 4FPRA 4MJKA 1KLNA 3EVWA 5KG7A 2LA4A 1DTQB 4ATNA 1A7GE 2UV8A 2Y3YA 2BM0A 2OEKA 1XERA 2MZ1A 2M88A 3OR1B 1T05A 3JQKA 2BA9A 2FLOA 2VPWB 3RG6A 4X4NA 4UOHA 1RWKB 1OWXA 3MEDB 4G1IA 3RBXA 2HZCA 1RBAA 3K5LA 4RW7B 1YBAA 4ZVTB 2F63A 2LYVA 1NPPA 1HFEL 2M2BA 1SQEA 1YRTA 4C4WA 3BJYA 1QAIA 4KKOB 2IM0A 4A8QA 3PY8A 3LANA 1HBUA 4P73A 3NKYA 5DZ7A 1MG7A 5DG8A 3M9NB 1ZBTA 4FXDA 4DCOB 1RADB 2HMIA 1VLYA 2AHOB 3WDOA 2GVZB 3NL0A 1I94J 2XWYA 4ZPVR 4IDKB 1KQKA 2OAUA 3HKWA 3DLGA 1QJHA 3TWZA 1X5PA 2IAJB 1QM9A 1HWIA 1QTMA 2XMTA 5BYRA 2XY7A 1KR4A 3OXGA 3MM9B 1S1VA 4NXNJ 4Z7CA 4M5NA 4NRUA 1U26A 4PCQA 3OLAA 4DLGA 5HMYA 3BGUA 4CYUB 2COLA 1SBRA 4Y00A 4LF2A 1SV5A 3KLEA 4JI2F 1TK8A 4LVNP 4Q8EA 1EJ7L 4F3OA 2DCUB 4ED1A 3RGIA 2POKA 3A4TA 1XK8A 3CF5Q 3PFEA 2K2PA 1ZAWA 3SV4A 2DGVA 2DXEA 2CQDA 2Z57B 5RUBA 1OMSA 2O01C 1FJ7A 4OI4A 4ZPCA 3QT8A 4KGZB 1YHQS 4YB1P 3KWMA 3E8OA 1RKIA 3GU0A 4ZLPA 3BGFA 4ZVHA 4P2MA 2IA6A 3OPKA 2QA4S 4P2XA 2UZAA 5ETRA 5LT5A 3CDBA 5AJ3F 2Z58B 1H7WA 4YMEA 1S7IA 4P7VA 4ZP9A 5KG3A 4RL1A 1KQSR 4DR5F 1Z2ZA 2DY1A 3CDAA 2QL9B 3FCHA 4RNOA 5EWEA 4U7UD 3BR8A 5CXTA 1NSQA 1EAYC 1T8EA 2RJZA 2ZOMA 3UE2A 4FKYA 4JV5J 1P27B 1WKKA 2O1PA 2MJNA 3E3XA 2YNIB 4LREA 4NASA 1UJ6A 2YPZA 2HHSA 3OT9A 5CABA 2HBRB 1NEEA 5E33A 5H1SV 3H2VE 2JJ4D 1SI9A 4Y0FA 5J2NA 2FQQB 1BGXT 4FVMA 3UR3C 4URGA 2CQ4A 3I32A 3TAPA 2XZWA 4KFBA 4DQIA 4UQGA 1W2BR 1H2TZ 1FDDA 3ZC4A 3W7BA 1R8HA 2HMIB 2KYXA 2BBEA 3M30A 2NREA 4IOAQ 3TZYA 1MROA 5D0HA 4LSNA 4RJVA 1ITPA 5DJBA 3BYRA 2VDHA 2V9KA 1IKXA 4ED4A 1R8AA 3WX4A 4URSA 2AYEA 1ZETA 3DLGB 3GWCA 3W8GA 3MM6B 4RU2A 2B3TB 4W90B 4ZVQB 2YQ1A 1OSCA 3GFYA 3IRWP 2WBRA 3KLIA 3O6QA 1TL1A 1AROP 4EO6A 1HNVB 5D6GA 2KG1A 5K5MA 1F2HA 1IUJA 2BJ9A 4RU9A 1HR0J 4RNNA 3J7Z5 4WFYA 1U2CA 4JI8J 2ALYB 1RHMB 2CJQA 2B4VA 3VAKA 3PIOQ 1YBTA 1W7WA 2J7WA 3ZFVA 1T9UA 1FO1A 3CC4S 2DEIA 1KQFB 2BX6A 1S1XA 3I0RA 1T9VA 3PFOA 2RF2B 1S49A 4BWJA 2YKNA 2L9DA 2ZKUA 4DWIA 2HWTA 2Y1IA 2X1FA 1PBAA 4ECWA 4ZVEA 2EFGA 2LQJA 4B08A 3LH2S 5E7OB 1NPKA 4WK1A 2HHHJ 1NMEB 3Q2TC 5LSRA 2VODA 2W9AA 4EZ9A 4RUHA 1NZ8A 2MDAA 4LBHA 4FYXB 3M1VB 3H20A 1TUGB 4USWA 1WOOA 4IG0B 1WC6A 3Q8VA 3MDFA 2GCFA 3IRXA 1NLKL 4GKJJ 3MWBA 4DL6A 4JI1F 2F4FA 3AJ1A 5A8WB 4ENOA 2C22A 2GJ2A 2EK6A 5JVHQ 3UN3A 5DM6Q 1AUSL 1FEEA 2IJRA 3PW4A 1ZH5A 1TL4A 1RHQB 3MFHA 2VA3A 4DCJB 1OS5A 2AV5A 2B56A 4G1QB 2AF6A 2Q6CA 5IFMA 3MR6A 5LMNF 2B7BB 4X4SA 2A2DA 1G4CA 4O3QA 5KFZA 2HFNA 5ETMA 1K0TA 2BYCA 2DHAA 4NLQA 1BWVA 3GYXB 2W2MP 1B7YB 2YBVA 2A18A 3HPOA 3K5OA 1Q81T 5BR8J 3FRZA 4DV7F 1CC7A 4I67A 3A12A 3AJDA 3RRHA 3TX8A 1XR6A 1RT7A 3M30B 4RUBA 2VOOA 4P2FA 1MROB 3D1HA 1N32J 2W2NP 2F7VA 3CCVS 2FJVA 4ZOSA 4YHHJ 1IKXB 1IN0A 2UUCF 5IT9U 3N5BA 1VQSA 3QSYB 2R7SA 1Z1ZA 1KS2A 3OL7A 4A8YA 4JYAF 4YY3J 4EFAC 3N9UC 4IFYA 3H4BA 1UZDA 2G1HA 2WVEA 1UPPA 2YKAA 3CJ8A 3GYGA 1S9FA 1KVJA 3OFHA 2IYIA 4HI1A 5KFFA 4QW9A 4M8LA 1RAIB 4A8SA 3VTIA 1JLAA 2DJWA 3T1YF 2V8PA 2LP4A 1GEHA 2J6TA 1A6LA 1QUVA 3S1TA 3HHDA 3H59A 1S1XB 4KPCA 3I0RB 2ERRA 3CDUA 2K3IA 3GG0A 3MTJA 3M32A 4QBUA 3MAAA 3CJ4A 3N4WA 4K0KJ 2BE7D 3IS9A 4KR0B 3ZO7A 1S4EA 4B9SA 2HK2A 3PKMA 4ED8A 4ZP6A 4UOCA 1F9HA 5F8IA 2YKPA 3QZ7A 3UD3P 3F0NA 1WG5A 3T41A 5C2CA 3KLGA 1RT5B 1YGYA 2P2CB 3CVKA 1F5AA 2BR0A 3HJFA 4DMZA 3SQOP 3PV8A 1TKTA 2CVEA 1HNXF 5AXKA 3Q8RB 4ANCA 1SH0A 5EWFA 2RIJA 2DGXA 1Y5NB 2PD1A 2YXLA 2HNYA 4KHRA 3VV2B 1PJ5A 4DV3F 2ZBQA 4XTTA 1D9FA 4J9MA 3QMQA 5AT1B 3MUTP 3KLHB 2FVCA 4Y28C 4LFCJ 4KIAA 4RNFA 2JC0A 2ROGA 4ECXA 3AFGA 3R9LA 2GVDA 3JAMU 2RUGA 4C97A 3SSSA 1N52B 3MPUB 3FQKA 4KGVB 3CC2S 4ZLNA 1H38A 1D9DA 3BPSP 2OD6A 4R0EA 3LAMA 1R0BG 4Y2KA 1FKPA 5KT4A 3BN7A 1QAYA 1FRMA 2OH2A 1VQLS 5HJXA 2CA9A 4OYAA 1NM2A 1WTFA 3MR3A 1P8GA 3KJQB 2VKRA 1S1UA 4GMKA 2WSFC 4C11A 1V3RA 1RT7B 5HQMA 5J1EB 3UDCA 4X4OA 2GMHA 2ZOFA 1BD6A 2WOMA 3S8SA 3QZ8A 1VQMS 3GFZA 4C9DA 4AXIA 1M1GA 4TU8A 3FSYA 1I94F 1KOOA 2CZVC 2BE9B 4OLPA 1XJWB 3HJVA 2EWHA 2AT1B 1YTYA 3GCWP 4IFYB 4X65J 3BQ2A 4OZJA 1P9YA 3HFVA 2HHVA 2MKCA 1UW9A 3GG1A 2YX4A 2G2OA 5HMZA 4NL5A 2DIVA 2N4CA 1W26A 4AL7A 3OFGA 1M1HA 3OW2R 4NYZA 3CCJS 4P52A 3W5XA 4HYKA 4M5IA 4C0BA 4DN9A 1HNZJ 3O2IA 4IH5A 4ZK7M 1RTDA 2MHEA 4O3OA 3ENWA 3QAUA 1HWJA 4ETZA 1UVJA 4PPZA 3Q24A 1EQ0A 2VG6A 2MLZA 1PYSB 2DCLA 1NJXA 1NUEA 4NCGB 4Y2MA 1R0CB 2YWFA 3BF4A 4IRKA 1RA7A 5L9NA 1TKTB 3NG8A 3QIDA 3GIMA 1DBDA 2QX0A 2MQQA 3ZNJ1 4DLEA 3HI9A 4WKYA 1RYSA 1VRTA 4DSLA 1XC9A 2FGOA 3CT9A 5C24B 4MAKA 2EBGA 3AB4B 4ED3A 4G1PA 2C42A 4NYPA 4CZCA 1EHWA 3B4MA 2GVDB 5J1PA 1WC0A 2W24A 4DUTA 2CPZA 1UETA 4LUBA 2OPSA 1TL7A 4JV5F 4DR1J 3MECA 3I55S 1TVRA 3CCLS 1S0VA 2D3OR 4LVOP 1RGVA 2VQFJ 1GAOA 3IBFB 3ETOA 4GVBA 3W65A 3VAHA 1GMWA 4L72B 3RAMA 4X64J 3LP0A 1C1BA 1RT1A 2QFJA 1D0EA 2E9TA 4PG7A 2HKEA 2DR9A 3T5KA 3W9JA 3DN9A 4DZDA 4WIQA 2ASLA 4HHJA 1NSKL 3V5RA 1N36J 2HFOA 4WIIA 2WZ1A 1TAQA 1LWCB 2H48B 1R89A 4YP3A 3GQCA 3EZOA 3BN4A 2XNRA 2HS3A 2Y8WA 2IM2A 1R27B 2UP1A 5CD4A 3DI6B 3NGRA 3U27A 5H9EK 3C2PA 5B0GA 3EMTA 3BKFA 3CCTA 1KBRA 5D78A 2XO7A 1PYTA 5M2RA 2B7CB 2KZMA 1YRUA 3JXOA 1IBCB 3W5YA 1MWYA 1DFDA 2OIHA 2V4QA 2CPXA 3T5LA 2BACA 4AUKA 3QLHA 2N7CA 4YS2A 1SQGA 1CBKA 4WE1B 2NZ4A 1HR0F 1ZM3A 2UUWA 4DUZJ 2OFGX 4IOCQ 2XSJA 2MQOA 5C25A 1QD1A 1GX6A 1J5OB 4HL9A 2BJ1A 3AY0A 1N54B 1YDLA 3PX6A 2AJ2A 1WD6A 1UFLA 3KK2B 4DQPA 4V19J 2ZJPQ 2R2RA 2R7WA 4C8ZA 3WHIA 3BM7A 1DLOA 2KKHA 3W3SA 5CCMA 2OPQB 2CNKB 2YNFB 1BE4A 2NS1B 2VC1A 3KJVA 1MMLA 4WYLA 2X3GA 1NH7A 3NGDA 5IOLA 7FDRA 4EBEA 4EBDA 5JMNA 2Y0SD 1VQNS 1MU2A 2KRRA 2P9EA 3R2CJ 4GKJF 4LFBJ 4HEA9 4N41A 4X66J 1FNMA 4P10A 2OPSB 4ECZA 1Q1KA 4CO2A 4LRFA 3OVSA 4U67Q 2FJWA 1JLQA 3JS9A 1V3SA 1QLNA 2Q66A 3PO5A 2GV1A 1JKHA 3U1NA 2ZWOA 4GVBB 4P74A 2B5JA 4ECVA 2DNGA 4Y6IA 1V3ZA 2CG8A 4QIFA 3THVA 3M2UB 4LBIA 1FRXA 2ZVIA 4JI6J 1N5VA 3KHRA 4QOTA 3BGOP 1HQ2A 3TP2A 5BR8F 1S6QA 5LJ3Y 2DNRA 4NCBA 3SI8A 1CJVA 3CO0P 2FLLA 1RAHB 3O44A 4P71A 4UUXA 2JEIA 2K1RB 4QCLA 1EKSA 3RBDA 4W4MA 3ILOA 1NDKA 2L48A 1N32F 3S7RA 4QPTA 4YHHF 4OYZA 1FA0A 4DXLA 4X84A 2W8KA 3KHHA 3PM9A 3MD1A 5CYMA 2KFZA 2NLWA 3AA8A 4TYBA 4Q8FA 4YY3F 5D8HB 2CJYB 4U95A 2CPYA 4CO5A 3OFEA 3BH7B 1VQ6S 2H5EA 2D69A 2GHWA 3QLHB 2R42A 4F4WA 2BOAA 1XBWA 4NPOA 4D3HA 1SL0A 2ZM6J 1B99A 3IR7B 4CO4A 4F4ZA 3ONQA 1FDNA 5C25B 2Z0GA 3DHXA 3G87A 2W1BA 2X51A 1K73T 4YR3A 3KLFA 4X2BA 2HFSA 2F65A 1P9QC 3A1YG 3FEXB 1SC6A 1TK0A 5KT5A 2HZAA 3KUHA 2MKYA 2LKZA 5DG7A 4U7CA 4B3SJ 3NGUA 1TELA 2J8AA 4RNMA 2PMWA 4K0KF 3H40A 3OSPA 4FF2A 1X4BA 5F8GA 3W2WA 2VH7A 2VASA 2CQ0A 2BJ8A 2VHGA 3PO4A 1NK8A 3BO3A 2EC2A 4PXBA 2EXUA 1CJUA 8AT1B 1TL5A 3PRBA 4M95A 3M9OB 2M8DB 4NLPA 2HWHA 1MU2B 2RDIA 3OQ2A 2HNDA 3QJPA 5H9EJ 4J90A 1FJCA 2H54B 4LFCF 3E01A 2O66A 3SSRA 3ZZUA 4NLOA 1IR1A 1JLQB 3HFZB 3MM8A 2C2EA 2B6AB 1LXNA 1JKHB 1U8WA 4E2FB 1YJTA 4NLGA 4ZCIA 1S9GA 2M5YA 3G82B 4KAIA 2QEXS 1MWQA 2KM8B 4FYWB 2PMZD 3KXDA 5IC4B 3T19A 3FVYA 3VQTA 3MPWA 3PG9A 4NA1A 3U1LA 3MOJB 5HP1A 1Q8IA 1S1WA 4N8OA 1QSLA 5B0DA 1JJ2R 2NZCA 3PW7A 4F0HA 1Y0HA 2MKIA 1X4GA 2OMOA 4K2XA 4FF4A 1F60B 4QR1A 1CPZA 3MI7X 1B3TA 2WBMA 3MMCB 2C3UA 3CUNA 4GO5X 2HQDA 4TKTA 2V34A 3TUZC 2DPIA 2VPYB 3H2UB 5CA5A 1LK5A 3NY0A 1SJRA 1U2RA 4RUAA 3JSRA 5CYMB 3N79A 1T0TV 4J9VA 1KD1T 5KOXA 3Q2SC 3K0JA 4X65F 1K44A 4EYHB 5EGYA 2D3UA 5ETVA 3DGVA 4R25A 4TLRA 1X4AA 1TKXB 1BY9A 2W4CA 3CE8A 5A2QY 2VUGA 2AD9A 2HHPA 3HHLC 3HSDA 3KLFB 2B9YA 5A76A 3R5GA 1X4FA 4QWAA 2IDEA 4OYBA 1M5KC 4IO1A 2VQEJ 4J9SA 2WB1D 4PKDB 1VQ4S 3RJMB 1LWEA 4BHQA 1AW0A 4F8RA 4O4GA 4ZPBA 3R7SB 2WB4A 3HHLA 3W2WB 4NLWA 3MEGA 3A8IA 5DGBA 2XHWA 2HVZA 5HROA 1JLFB 1U1OA 5KT2A 4WF9Q 3OL9A 2R7VA 3R5BA 5KFMA 1HNWJ 4UZCA 3E2EA 3PIPQ 2ZDOA 5DDQC 4TY8B 4GRSA 2B9XA 2WK4A 3I5CA 2AGPA 3VZIA 5J2PA 2GNKA 2UVWA 5LXRA 3RRGA 4B9UA 3CIMA 2W4PA 3RAXA 4IG3A 3TAMA 3QQCD 2KG0A 3M8RA 2Q43A 1TV6B 3SMZA 3GE9A 4Y2AA 5I3UB 3E01B 4I69A 4A8WA 1SKRA 1Y5LB 4QJVA 3KJNB 2ZNZA 4HKQA 3V6JA 1T9XA 2VL1A 5E3CA 2HK3A 1T02A 1S9GB 1HD1A 4DR1F 1SKSA 3IA0A 3J7YI 5GAGU 2MY7A 4EU0A 2OPPA 2VQFF 5A0YB 3QT5A 4FBTA 3PW2A 3ITHA 2FJAB 3M8PA 1LV5A 1T94A 2GMJA 4A48A 1FE0A 2WW8A 4H4KC 4X64F 1XN9A 2NUHA 3EUNA 4RW8B 1S1WB 4NI2A 4MFBA 2FHJA 2HYIB 4KH0B 4USIA 1S5ZA 1UMJA 4M5HA 3BEGB 1N36F 4MIAA 3BO2A 2VICA 1SKWA 4TU7A 2H4YB 4LF7J 1REVA 3UI3A 2OSRA 3F44A 1S72S 3THTA 5D3GA 4GO7X 3NNHA 5E41A 3BSOA 4BCAA 1GMVA 3JB9k 3R1HA 4OX6A 1E6VA 5FLXY 2HVIA 1ULRA 3ZTOA 2BABA 2V8DA 3GP9A 4ICLA 2QA1A 3IP0A 4I68A 1VOMA 4USJC 4ILLA 2UXCJ 3QO9A 3WX8A 4EI2A 2CQ1A 4NX9A 2HLUA 5GVQA 1UWAA 4H4MB 3PR5B 2DHXA 4CLUA 1NPRA 4N56A 2I2YA 3IR6B 4F4YA 2KJWA 4DUZF 4DR6J 1FKOA 3TUPA 3MMJA 3MHYA 2XMJA 4CIOA 1UFWA 4IKAA 4QPXA 4L6V3 1ZYQA 3DM2B 3W5ZA 2YVSA 1Q0NA 3OBIA 2E7VA 4KC5A 4DSIA 3LOUA 5IQQA 4MKYA 4WP3A 4DFPA 2J5AA 1YI2S 1HARA 4ILRA 2I38A 3AA9A 2WONB 4ZN3A 3DRSA 2EC0A 3HSGA 2DITA 1VHFA 1XMOJ 1IXKA 1JLGA 4WP9A 3GZ7A 5HK4A 4ETXA 5EWGA 3CWJA 2ZD1A 2J9DA 4B3OA 1JLCB 1UEUA 2P6SA 2V68A 1AXQA 4K50A 2VBYA 2ZH2A 3I87A 1HI0P 4QYZK 4HVZA 3QIPB 4DV5J 4J37A 3TUIC 4QIWD 4DHVA 3AXMA 1UPMB 1KN6A 5GMEA 1RP5A 2G13A 2Y9HA 2GS8A 4LRAA 3GIKA 2F8MA 1VDHA 4LFBF 4ED6A 2GJFA 4NE9C 4R5PA 3NBPB 3W2VB 2GIFA 5KFTA 4IRCA 3KHGA 3T9NA 2RDJA 1EP4A 4PG4A 2AYMA 1IBKJ 4I2PA 4C0HA 1T3OA 3UW1A 2E1CA 2CYYA 2ZJRQ 2IVFB 2ZDPA 4XIUA 5AXMA 1O6XA 2AU0A 2E66A 4JI6F 3KTQA 4DS5A 2ZZTA 4DFMA 2FY1A 1FWLA 4F2SA 3G6YA 3UVJA 5HANA 2B4PA 3QSIA 1X0FA 4A46A 3OTDA 1YQHA 5IT4A 4RX6A 1REVB 1HBNA 3R5AA 3PHTA 3FCVA 1H73A 4IRDA 1N6QB 5D3GB 2J6SA 5KFPA 2ZH9A 5E2QA 4GC7A 2R3VA 2D3ZA 1BLUA 3OSNA 4ERDA 3JSMA 1RABB 3SYZA 3FUYA 2V4RA 1VGYA 4MTPA 3UO0A 3QO9B 3BBBA 3IGVA 4ED0A 3DYAB 1RTHB 3KYLA 2ZM6F 4DPWA 5T7LB 4DFJA 2OKQA 2CADA 2R7UA 3E51A 4D3GA 3K5MA 3ZZ0A 5ITHA 1MMDA 2HHXA 4QR0A 3T6JA 3FMBA 3PJWA 3V2UC 4CO1A 2VU5A 4KPYA 1DQ9A 3V81B 5EN1A 4BBYA 4LSZB 1S6PA 4B3SF 1X60A 4ER8A 2CXEA 3QFWA 1Y7PA 1JWWA 1T11A 5IZHA 1WEXA 1JLGB 5F41A 4OI2A 2FB0A 3ZTSA 1FVSA 4KH1B 2DD8S 3KMSA 2V4JA 3OVAA 2MZTA 5C2GA 2RQMA 4O4RA 2ZH4A 2AJ0A 1J2VA 5DZ6A 2BW2A 4MIBA 1AB8A 1ZPVA 1UL3A 3FNNA 3UD4P 1MMNA 1PG5B 1PC5A 3KMQA 1FNOA 3D0HE 1GMWD 3NCPA 1XNQJ 2J0WA 4CNZA 1LQ9A 2XQCA 2IJNA 1VRQC 2YNHB 3M8YA 5DDOC 1RLDA 1T9YA 4P6QA 4NA2A 4WP8A 4ZVFA 3JSBA 1X4DA 4QYRA 4KO0A 4F4KA 3BDPA 4DPYA 1CQNA 3T1HJ 2EFVA 1HBMB 4LSLB 2R2UA 2ACYA 3M2RA 2F3JA 5C42A 1FF2A 2R7OA 2DBBA 1S76D 3PDNA 4Y65A 1M5PC 4B3MJ 1VISA 2L3MA 2E5LJ 3HVWA 2HQIA 3I9ZA 1B0TA 3R5JB 3VGVA 1SJ3P 4LRBA 2DNMA 3TO8A 2FLNA 3L09A 2XS7A 1YITS 4RO0A 4WYWA 4USMA 4FS1A 5K20B 2RT3A 4Q0BB 5DDRC 2QO3A 3MM7B 4L74A 1X0PA 3JSMB 5U47A 5L1LA 3SSQA 4EMDA 4M5KA 1WF1A 1KVKA 1WSRA 3D66A 1RSCA 2ZNYA 3W62A 1X9SA 1GNKA 2C2KB 2PFFB 2HW3A 2JHEA 1RT3A 2HFVA 3R6LB 3SDEA 3OR2A 2HHWA 1YSJA 3WC0A 5THWA 4GKKJ 3BR9A 5F8HA 5IM0B 4W92B 2V63A 2UV8G 2AEJA 3DGPB 2KZZA 4C2MA 1ZA2B 1F3VA 2CZ9A 1TU0B 2VQEF 3M8QA 3C14A 3VGUA 3HVTA 1VK8A 5A8KB 3KG0A 3N28A 3LP2B 2F40A 1F3FA 1FHTA 3NLCA 1B64A 1RUSA 4P72A 4F67A 4OV6A 1HNWF 5IWAJ 4KHMA 3SCJE 2MZJA 1Y3KA 1GXLA 1FT8A 1RB0A 3SFGA 5M2PA 1VQ5S 4N47A 2XEXA 3CNQP 2C2OB 1V9OA 3I96A 1JJHA 2YWHA 3PW0A 5JJBA 5K8NA 1KLMB 3ILIA 4C8YA 2KVIA 4TYAA 2RD5C 5HBMB 4ZVRB 3H5SA 2V67A 4DSJA 5IV3A 1NKCA 2HNZA 2JLGA 1JJ4A 1IM6A 2YKQA 3RUBL 3UFCX 2ZE2B 2CQHA 2DNNA 4KO0B 2QT7A 4KRWA 2RB7A 1G6BA 2FGCA 3BZQA 3C46A 5B0CA 2VONA 4OLOA 4WZMA 3M2RB 3EJMA 1LWFA 1SH3A 4DF8A 5C42B 3UDVA 1U1QA 3V4IA 3EWGA 2XB2D 2W2QP 1A9NB 2AIRB 3J80Y 1MN7A 2IBOA 1P1TA 3AD7C 3J7AN 1JLBA 1DJ0A 1NHVA 2BANB 2P9CA 2N82B 1YLXA 2HS0A 4QWEA 1NJYA 3AB2B 5D4OA 3D6TB 2CNOB 4WPAA 1X5OA 1IBLJ 3GJRB 4I1TA 2KO1A 1H2VZ 2I1RA 2VFUA 3MM5A 4NMLA 3CPWR 3QBCA 4L73A 3T9ZA 2QJ3A 2KHDA 4Q45A 1PJ6A 3MMBA 3O8WA 4N76A 3FJ2A 1HBOA 5I42B 2HZVA 3OTOJ 4DPTA 2UXCF 1O0PA 4USUA 1RT3B 2XULA 3TARA 4CQ1A 4I6YA 1PYOB 4C3LA 1O51A 2CZ4A 3GILA 2CPHA 4IFVA 3K58A 3CULA 2HHTA 5BJRA 1SVDA 3FFIA 4YDXA 1BQXA 4DV0J 1HW8A 1FVQA 4HHHA 3QWUA 1SUQB 5E3AA 1S79A 3VWSA 1PKUA 4X4VA 2FHOB 2B0GA 4ALZA 4YR0A 1KWMA 1UVKA 3ISND 4EYIB 3L7UA 2FVSA 4V1Ak 2V8VA 3WC2A 1F2GA 2HLTA 2B8QA 3NGKA 2IC3A 1WORA 3A8KA 1QY7A 3O1LA 2E5HA 1XMOF 2ZUAA 4NLVA 2LMIA 2G4BA 4CH7A 1X5TA 1UZHA 1C0UA 4IYQA 3WQPA 5KFLA 2CJ9A 2JNJA 3EGZA 2MZRA 3D9BA 3C66A 3IWXA 4NLSA 3G6XA 2MQPA 4DV5F 2BQ3A 3CTRA 5I4MA 1JNZB 3D1OA 5K14A 3W1YC 2UVVA 5HJYA 1WNEA 3MEEA 3MCOA 1XR5A 1P1LA 1M5VC 2HNZB 3OTBA 5HLFB 2MSTA 3NGSA 1GFWB 4C98A 4B9MA 3I4PA 3IM8A 5F9NA 2GC8A 1KNZA 1AUDA 3R3TA 2MLYA 2I8EA 1L3TA 2BM1A 1IBKF 5L9XA 2MKSA 2CUYA 3TI0A 4K4VA 2JEGA 4F50A 3IR5B 1CJTA 1G1XA 3MURP 3RAQA 5L39A 4USVA 2AX1A 1XMQJ 1CS4A 4YFUA 4DV1J 1HMVB 4KGXB 4OJGA 1RAEB 1TQLA 3QRRA 3QRQA 2V50A 3I82A 4DR3J 1OO0B 1Q79A 3PKYA 3PYDA 1HPZA 1T03B 2E44A 2OHDA 4LF1A 1TAUA 4LR9A 3M2VA 4TN2A 2FUG9 3DDNA 5KFDA 4HT5A 2BVZA 2XM3A 2XMUA 1AFIA 2KJVA 1N5YA 3BGLA 2WW4A 3ET6B 5L46A 3JQJA 1WTBA 2DR6A 2DNKA 3L95X 1AYEA 1QAXA 1VQKS 2GO9A 2VC0A 1Q8KA 4LFAJ 1YBUA 3DKDA 1M0SA 3RW6A 1B70B 2NSBA 4HT7A 2ZWPA 3NP5A 1RHKB 4NEYA 2V8GA 3QT6A 4PYAA 3FK4A 4CCHA 3D6FB 3PXGa 1T7PA 2KT5A 5KT7A 5F3TA 2D1CA 4DL3A 3A3NB 1ZM9A 1RTJA 1R0AA 4OFZA 2HVDA 3TZWA 2XMAA 3KK1A 3CCMS 2XNQA 4A8OA 4BLGA 1H3DA 2XLIA 2GAGC 2JFDA 2OGUA 3FFIB 1M5OC 2QRRA 2J8SA 1HQEB 1JXVA 4IH7A 2XMMA 4ZHRB 4JBCA 1FK9A 1W2IA 1RHUB 5MAOA 4PYDA 3GJTB 2IVYA 5A8RA 4A8XA 2FY8A 4NCAA 5ETNA 4LIWA 1TFWA 2MY8A 2R8IA 4L76A 5IT0A 1FX2A 3D28A 3BSAA 1C0UB 2QG9B 4I6AA 2MKJA 4B02A 3K5NA 1U45A 5H9FK 3D7SB 4DN0A 5DLGA 3TZXA 1OY8A 2EKYA 4PXEA 1RAGB 5K14B 1VQPS 1C4AA 3B4DA 4CT8A 1C0TA 1XNRJ 1BMQB 1WI8A 3ENAA 3TNVA 3SBMA 1IWGA 1KRPA 3KDOA 2JWNA 1LFPA 1ZPWX 3TEHB 2FHJD 3NCQA 2N7YA 3BQ0A 5A6WA 1PAEX 3DOKA 1F5CA 4CLFA 2VFVA 2GMLA 3ISZA 1O5JA 2WVBA 2C3OA 4HH1A 4OI3A 1CS4B 3JAMY 1AZSA 4QWCA 3V6HA 1KKHA 2DR8A 2CDRB 2MQ8A 3T1HF 2I0XA 3P96A 1ZTTA 4CNYA 1NK9A 4L3KA 1RU2A 2AJFE 4CLSA 2FZKB 5ETLA 3HK2A 4NLYA 5CCLA 1RT2B 2PT0A 3HVRA 3EXYA 3DLLQ 2XCAA 3V6DA 4B3MF 1SB6A 1NB7A 2ZVSA 2E5LF 1BUXA 1CEZA 5F0UA 2RUSA 3RR7A 5BYSA 1OPIA 1N5YB 2KYZA 5CYQA 5AE1A 3FCWA 2DGTA 2QGFB 1WG4A 2AMCB 2XYHB 2E1AA 2FC8A 1SJ4P 4PUOB 1VS3A 1TK5A 3BH6B 1WUUA 1TFYA 3DXBA 4ID5A 4J9RA 2AQ4A 4J9OA 2R7XA 3C6TA 2BUNA 3D1QA 1R0AB 1M1KT 3K89A 1DQAA 3OV7A 3CEDA 3SQGB 2WVFA 5KFXA 3UWTA 4KTQA 2QYGA 1IQZA 4QWDA 2E9RX 1QUPA 4GKKF 1LOUA 1QE1A 2AJ4A 3J81Y 4RLEA 1NZAA 1FK9B 2CNNB 3HDSA 4K4UA 4ZCLA 5HATA 3X1LB 2W2PP 3BYPA 1N8RT 1ELOA 5EX3A 4PG8A 2FTRA 2CQCA 3GTYX 5GAEI 2DNLA 1WHXA 4PABA 3M8ZA 3JTPA 2HHQA 4XPCA 5DGAA 1D09B 2F8EX 2NUUG 1T05B 3LAKA 1VYAA 1VBXA 2ZFHA 4LR7A 3VAIA 2W25A 5IWAF 4C8MA 5KFYA 1SIWB 1CVJA 2MYFA 1YJUA 2E5GA 2DHHA 1M5HA 2FZCB 1N56A 3ZTPA 1HBUB 4R8UA 1EETA 4G6VB 3L4BC 3DDIA 1N5SA 2DEJA 3FZ2A 4L3NA 4C3MA 3HULA 1U6FA 3NAIA 4I56A 4RW9A 4FPIA 3GIRA 4HACA 4IOBA 4XO0A 1U1NA 2V2KA 3RRKA 3H25A 2LQ8A 1LWXA 1R8BA 3DOMA 1U2FA 3JYTA 2JLFA 4DS4A 2R9LA 4RWWA 2DH8A 2KHCA 2RQKA 1F9EB 4DFKA 3R6GB 5KAKA 1X9MA 1YX2A 2MZSA 2V94A 4OV1A 3OTCA 3UDLA 2H5JB 1U47A 2M7SA 3UCGA 4FYVB 4E98A 1REGX 2J6UA 2HEKA 1S1VB 4X4QA 2VBWA 1GMUA 2B9EA 1NH8A 1T3NA 2XMKA 4URQU 4WJBA 4K7QA 2EI5A 4FYDA 5AE2A 2HGNA 1SV5B 3KLEB 4FS2A 1ZS6A 5F8MA 1NK7A 2G0JA 4B3TJ 1IWAA 1IBLF 2PN6A 5D0GA 2GHPA 3BS9A 1QDUB 2AYGA 1LW2A 3HFKA 3UCZP 2RRNA 4Q5VA 2OMLA 3O3LA 1TMJA 3LQVA 4PR6A 5EUHA 1NDLA 5LL6d 5I3QA 5H9FJ 3OTOF 2D7SA 4FDFA 1VQOS 1NCLA 4CT9A 1KONA 3MXHP 4PQUA 4AT1B 3W64A 4ANEA 1QE1B 3H5YA 1LXJA 1KC8T 3K5PA 4G3IA 2XI3A 1RQ0A 4NLUA 2FVPA 3R27A 4DV0F 4CH1A 1B7FA 2RHQB 1N5TA 3AH6A 4OI1A 4CTAA 4FP9A 2ZHAA 2DO0A 3SXLA 2ZEJA 4DU8A 4C48A 4ECYA 2HQ3A 1K47A 2BRLA 2JFKA 5KFVA 1Q5YA 1XWLA 3CJSA 3MCNA 2HBZB 2RDDA 2V8HA 1R8PA 4Q2MA 3CJKA 4PRFA 1U1LA 1N34J 2C2NA 2NCKL 2V9WA 5JUMA 5A2QU 3I4HX 2XSFA 1WF0A 3OVBA 1VIXA 5CD4H 2QZ8A 4RWXA 1E6YA 3M6VA 5J2NB 1UAWA 4FBUA 3OL6A 1AT1B 4CI0B 4KFBB 2DPJA 5E3PA 3OL8A 3DU5A 4Y3CA 1WI6A 3N01A 1CC8A 2AWZA 3DOMB 3D2WA 2XYGB 4LSNB 3JYTB 5IXUA 1RTIA 4RBTA 2QMXA 5EX0A 4CM2A 3S01A 2KRBA 2HRUA 3R97A 4PPDA 4DSFA 4WKRA 1RK8A 1XMQF 3G6VA 3OUYA 4DV1F 1L5UA 3SCIE 4UUWA 4F4XA 3C16A 1QSSA 2LQ5A 5L1JA 2DRBA 2H1YA 2U2FA 3KLIB 3PX4A 1JB0C 1TL1B 4DR3F 1P6TA 3UNYA 4GVLA 2IMOA 4OI6A 4DR5J 2CPJA 3DNCA 2CQBA 2BKPA 1HHSA 3KHLA 2VB6A 1IJEB 1OJ4A 1LW2B 3VF0B 2I5JA 2AX0A 2IM1A 5B09A 4MKVA 1EX8A 2NPFA 4UY85 4CLWA 4KJIA 3FBCA 2XBPA 5J2MA 4TNOA 5SUHA 2YKNB 4ES1A 3H5UA 1NJWA 1X4CA 5KFJA 4LFAF 1OSDA 1R6YA 3HSZA 1D8YA 2PEHA 1L3KA 3S6EA 4OX9J 3J7YU 3LWLA 4PQUB 3KUEA 1UVIA 3VVUA 2VD3A 1DQ8A 4W98A 4LF6J 3H7HB 2RHSB 4MK8A 2J0XA 3PYFA 1O8BA 1CG2A 1NK6A 2EFQA 1CSJA 4CTAB 3IRXB 4NLRA 5FLXU 2GFFA 2FYXA 5SZTA 3J7ZT 2YQ0A 4DG1A 4TQSA 4QIEA 1F9FA 5KFCA 2RQ4A 2L08A 2EEYA 2YWEA 4Y34A 1Q8LA 1NU4A 2NXEA 3QGHA 3EPGA 4FNIA 3TQ1A 4JOUA 4JI3J 5KFEA 1YJWS 2YTCA 2D9PA 2OELA 1L3VA 2ACMA 2MQNA 2YNGA 3PEHA 1FJGJ 1FDBA 2VJVA 4TXSA 3FBBA 1YK9A 3C6UA 2GQ2A 3W61A 1ZM2A 1BC6A 3AD9C 1SXLA 1VK3A 1XNRF 4P9SA 3IN5A 3GMGA 2CAJA 3AOCA 2XLJA 2BQRA 5DS7A 2EFNA 2IPOB 1GXTA 1CQMA 3B82A 2GQCA 3FMWA 3Q8YA 1RTIB 3D68A 2DO4A 2HRTA 4P75A 3EGVA 5CZXA 3LTOA 3TX0A 3TJ8A 4O0NA 2Z56B 2EVZA 1RU1A 4WU3A 1S48A 2QC3A 2VFRA 1K0VA 2FJXA 3CDWA 1PILA 3Q89A 3MCSA 3C16B 4J9QA 4YR2A 4CLPA 3CD5A 1R43A 3RR8A 3MPVA 2KB2A 2BE2A 1JLAB 3CC7S 3CDEA 1Q78A 4NXNF 1S7HA 4J91A 4OZNA 2UXBJ 3GPAA 3B6BA 4PG5A 1Q7LB 3GLJA 2C2DA 1TZ0A 3PHEA 1V5IB 1XTZA 2QFIA 1U1KA 2RKIA 2R7RA 4MKAA 3TR5A 1VR6A 2MB0B 1DTQA 3V6KA 2C2ZB 2W7AA 5J2MB 3M32B 3AQOA 3SV3A 3MAAB 5LSLA 2LXIA 4QQBA 3OR1A 2HQGA 5KFQA 3IS9B 4DL4A 1U09A 1UJ5A 4O3SA 2LEAA 3RU0A 4JP8A 4K8RA 2BQUA 3KLGB 1MLAA 1PIEA 2YY3A 1RXOB 3AJ2A 3F41A 4HH0A 3ZZZA 1IR2A 3Q23A 4LF4J 2NXUA 3IMQJ 2JC1A 2LQBA 3UR0A 1GK8A 2ZC4A 2NXNA 3EVOA 2HNYB 4HTIA 5BXIA 2JSXA 4FXWA 2WVCA 4DG1B 2V6AA 3TA2A 2G2YA 3CMES 4LBPA 5I3PA 2GVZA 4UOFA 2Z30B 4U9RA 1D9AA 4KYZA 4F3MA 5MLCV 2G1DA 4IDKA 2MTLA 2PA8D 3FBFA 2BRKA 3DRYA 3I0SA 3OFFA 5KOWA 2YNGB 3ENVA 3DFEA 2HFUA 4OHZA 3DRRA 2H9ZA 4AL5A 3AAWB 1UEKA 2M8HA 1H2UX 3FGVA 1FKPB 3MM9A 2C3MA 1DARA 4UF4A 2IMWP 4NZ6A 4CYUA 1S1UB 4C11B 1Q53A 4WFBQ 1UVNA 2WOMB 2C2RA 2E9ZA 1FX4A 4NZ7A 4ZPTR 2QSWA 5K9FA 1WG1A 1FERA 4J7CA 1S6UA 3HF5A 1ZOTA 3FSXA 4DR4J 4A47A 2N3LA 3GR1A 1NDPA 1JNRB 3U1MA 3FQLA 2CQGA 3ULHA 2J76E 3LUYA 4E8UA 4NRTA 3R7NB 3R1LA 3NAHA 2CFXA 2R2SA 2BE2B 4OZ3A 1K1SA 3H98A 1B4SA 2J9EA 2IA0A 3TRGA 1BHNA 3TW0A 2GO8A 1EIYB 4LMZA 2C3YA 4R0JA 3BB5A 2RKIB 1RTDB 1TL3A 2LFVA 4JI8F 2LDIA 2W7PA 1FKAF 2MHNA 3N6LA 4MMOA 2YQ3A 5LJ5Y 2N4DA 3Q8PB 3BBFA 3M6UA 2VG6B 1NRKA 5GADI 1RA6A 3ILJA 4XK8C 2B9WA 3NWGA 1UTAA 2UVUA 4C6AA 2CQPA 3ICLA 1GQEA 1F6TA 2XO6A 2YNIA 5EHHA 1RZMA 3A8JA 4AE5A 2VFSA 1VQ9S 2HHHF 5GMDA 5HI7A 2M70A 1FESA 2DNQA 4B9NA 3RZAA 5L38A 2XCPA 2QL7B 1VRTB 2RS2A 2Y1LB 1R3NA 4PAAA 1HWUA 1UVMA 1ZTWA 1UJ4A 2PIIA 4C8LA 4MK9A 2F4VJ 3VAMA 5CHCB 3R8YA 1S10A 2L9NA 2RU9A 3HD2A 2KI2A 1K9MT 4LRDA 2H4WB 3C8YA 5JXSA 2GGPA 3I0SB 4NLDA 4FVCA 2HQFA 1T9WA 1TL7B 1U48A 2LQ9A 3FEYB 1N34F 3MECB 3MM6A 3DRRB 1ZAVA 1TVRB 1EARA 3AOAA 5HVGA 5D4PA 3CIZA 1DURA 1WC4A 4I4BA 3LP0B 1C1BB 1RT1B 3C19A 4DQRA 2VDIA 2HWIA 1HNVA 3LF0A 2XY5A 8ATCB 2Y0BB 3GONA 3AHPA 1HKAA 3HHKA 2YKMA 2RH3A 2C2MB 4FF3A 3CCES 2ILYA 1WHVA 3SCLE 3UNGC 2QA4G 3EGNA 4K4SA 4X4TA 2RE1A 3TJAA 3IAM9 3TYTA 3HP6A 2WSEC 2RF2A 4UW2A 3GB0A 3NCRA 2ZZNA 2DGQA 5GMKa 2CRLA 2ZKTA 2LECA 2DIUA 3D54A 3UN5A 2OTJS 1W25A 3L7PA 1HWLA 4CLZA 2RU3A 3G8SA 1U02A 2Y1JA 4C3KA 3AOBA 2V2ZA 3PZPA 3M1VA 2FJEB 3RB0A 1IKVA 1WKJA 4LR8A 1CJKA 2E7WA 2IYGA 1HA1A 1N0VC 4IG0A 1FJEB 4MK7A 1UEVA 4DSKA 1ROFA 3D6HB 1TL3B 2XSJB 2KVQE 2YX1A 2O5DA 4ID8A 1N33J 3BV8A 3ELHA 5A8WA 2Z8QA 1VBYA 3BDEA 5ETKA 3QATA 3NS7B 2DK2A 1G3OA 2E1PA 4DCPB 4KV8A 4G1QA 2VA2A 3J7A1 4MH8A 1X7VA 1NDCA 3IG1A 2OUGA 1RLCL 3J80U 2KDOA 3EZ5A 1NHKL 2JVOA 2G0IA 1DLOB 4OX9F 3HZEA 2VFTA 2EW9A 5AXLA 2DNOA 4WTOB 1Y11A 2ZH8A 3CCSS 5D77A 4E0DA 1LFWA 1X4HA 4Y2IA 3H5XA 3PR4A 3KJVB 1NKBA 3VR1A 4LF6F 1U6BA 3BREA 1F1BB 1KOHA 4CLLA 1JK9B 2AEMA 4HHUA 3OTEA 2Y1RI 4DX8H 3GJSB 2KFYA 2DXFA 2GGPB 4O3NA 2AEFA 3EGWB 4QIGA 3D0IE 2M3DA 4JI3F 2GIQA 3MFIA 3FZBA 4P7TA 4CRJA 3EE3A 4DUYJ 1CLFA 4U96A 1WEYA 3DRXA 2B5JB 3MPDA 4BC9A 3VAGA 1WWHA 1NJZA 2YKOA 4JB8B 1FJGF 2M52A 2HHUA 1U25A 5J2QA 3L7OA 5D0EA 2ATLA 1G7CB 4U8VA 1FWPA 3W60A 2NYIA 1S6QB 1CJVB 3IC1A 4DQSA 2XMWA 2YKMB 3EYZA 4O23A 4M63A 2HBQB 4DQQA 2DHGA 3N0VA 4ZCKA 2ZBRA 2HFZA 2MZQA 1TUVA 1X31C 3OLBA 3Q22A 4J9PA 4Z7YA 4AD6A 3ZTRA 2ROPA 2MLXA 3LP1A 1HQUA 4CP5A 4WU2A 4DX7A 1NK5A 3MAHA 2CIMA 2ZH5A 4RW4A 1RT5A 1VIOA 3QGGA 3HMJG 3NOCA 4DDFA 3EZUA 1S59A 3GFHA 1Z2LA 1IKVB 4NEZA 2HVEA 1CJKB 4OQJA 4K59A 2QIFA 3UD5A 1TKDA 2IIHA 5KFAA 2UXBF 3HO1A 5L1KA 1H7XA 1D1UA 2EFOA 5DO2A 2YX7A 3TA1A 1YJRA 4Q43A 1NNDA 5KFOA 1HNZF 3X3UA 3KLHA 3TJ9A 1Y5IB 2OEJA 4KV8B 5GAHI 2PGCA 2DGSA 3IG1B 4PWDA 3MF5A 2VJUA 4V19X 3H8YA 3I9V9 3G71S 2DR5A 2PSZA 8RUCA 3T3FA 2YWGA 3IO1A 3AODA 2FC9A 2J0SD 3W8PA 2QLJB 3MUMP 2LA6A 1TKZA 3MR5A 1RISA 4KQZA 4LF4F 5LOQA 4OHYA 3EM1A 2HURA 1CJUB 3HHNB 1HIYA 4OI0A 1HI8A 4ZIVA 5J1EA 2NXCA 2WCXA 3ZNUA 1F5BA 4LF9J 2HNDB 3J81j 4TQRA 1N5QA 1Q4RA 4CLKA 1PO6A 1HHQA 1URNA 1URRA 2PA3A 2J7UA 3QAEA 2CPDA 2HS4A 1F0XA 1YIJS 1KFSA 3MM8B 2KL8A 4DPXA 2X1GA 1IR0A 1RWPB 2XWXA 4A8KA 4C7QA 1FNXH 2E5IA 4OJ3A 3M05A 3HVAA 4OYXA 5B0FA 5DETA 1YWXA 5J2QB 1N4LA 1IM4A 2DRAA 2ASDA 2HPUA 1FD2A 1R8CA 2A6OA 2WTFA 5HP1B 4ELTA 3NMAA 3NRBA 3U02A 1TP7A 3HT3A 5KG1A 4DPUA 3NGTA 2R8GA 2B8PA 2VZ9A 2DKOB 2QSFA 4K4WA 4IQXA 3K7RA 2Q1LA 2X1AA 2VIHA 2WRMA 1SQFA 5K8OA 4H4KA 3LP1B 1HQUB 4DR4F 2A2CA 2DH7A 2QL5B 4USKA 1UW4A 1RWVB 3HT0A 2XG8A 4NCGA 4RW4B 2R7QA 2DNPA 4JI5J 5EDWA 2JVRA 4DU7A 1FXDA 2PI5A 4ECTA 3JTOA 1KP6A 3QJJA 1SC4B 1RCXB 4PG6A 1B0PA 2ASYA 1EKRA 1H72C 2Z2ZA 1OPZA 1NSAA 2BKOA 1C2PA 3UCUP 2O67A 3PRDA 4F7VA 5C24A 2ZUGA 1U8SA 2FJBB 1JJCB 4N77A 5T14A 2CPIA 1VC6A 4U7UK 4I64A 2JRSA 1LWEB 3UDEA 3DXSX 3O5TB 2Q79A 4DL2A 5CQGA 4O4GB 4PWDB 2VBXA 2RAQA 3HHLB 3N6MA 2XTJP 3MEGB 5HROB 3TUJC 2NSCA 1JMTA 2MQMA 3DDKA 2RS8A 2MSSA 1J5EJ 2E1MC 3CCQS 3CJ5A 3RB4A 1TKZB 3GFXA 3TQEA 3CJ2A 4UZBA 1VLOA 2H3EB 2FZGB 4CO3A 1VFJA 2LVWA 5J2PB 2H65B 2R7TA 3I56S 1RBOB 4IG3B 3TAMB 2LXUA 1KTVA 3QGIA 1LWCA 4OHWA 2W2OP 2F4VF 4I2QA 3NXZA 1PGZA 5BYQA 2XHCA 1RBLA 3K17A 3DI6A 4X66F 3K57A 3DLEA 4DV4J 1S0NA 2DY9A 1Q86T 3OXLA 2PFDA 1ICEB 3MTKA 2OPPB 1FCAA 2P6TA 3CD0A 3J81U 3ITHB 3M8PB 3VZHA 3WIVA 1IKWA 3C3LA 3BQ1A 4PXCA 2XGQA 4NI2B 4MFBB 1MSWD 4WE1A 3TA0A 1GT8A 2MQLA 2YH0A 4Q7AA 4JI7J 2ATCB 4J9NA 1PAUB 4ECRA 1J5OA 2GJIA 2CG4A 3G96A 2PEBA 3M9MB 2OSQA 4DL7A 2CVIA 1S77D 5F9LA 3CJ3A 1RAOA 5KFHA 2RVJA 3KK2A 5GAEU 3R5DA 2SXLA 4MT1A 1QAJA 1E6VB 1D3WA 2W01A 2ZC3A 3MOZA 4AQYJ 3D4JA 4ICLB 1U49A 3IGNA 2QLFB 2UUBJ 2X1BA 2F8HA 3FDSA 3PACA 5HN0A 2AJ1A 1FFSB 1PBUA 2OPQA 2YNFA 3Q0AA 5LM7E 1S12A 4HDGA 2XGPA 3H0PA 1RACB 2OPRA 4RKUC 2ZHOA 2ZH3A 1I51B 4U6PA 2MKHA 4ED2A 1FKOB 3P4UB 3BSNA 2DISA 4ZVPB 2XMVA 4ECUA 1L3SA 1WHYA 1N33F 3ZTQA 3MR2A 2L41A 1SL2A 5DDPC 1SJQA 2DNHA 1VJWA 4N7TA 1VBKA 4K5RA 4CDIA 2BJ3A 4DOZA 1TUWA 1XR7A 3I31A 2M0GB 3DRSB 3TVKA 4DV2J 1U1PA 4K4TA 3EDQB 3T5JA 5CAAA 5KG0A 2CJKA 1RHJB 3IWNC 1DY3A 3T1AA 1N48A 1R7IA 1RWUA 2HGLA 2ZD1B 1NB2A 3M2UA 4B3OB 2K8GA 4ANDA 3VGTA 2CQIA 1RI7A 2JZ5A 5E3QA 1RAJA 1FFWB 1U24A 5KG5A 3QRPA 2DTJA 2K1RA 4LF5J 3T6BA 3PVXA 3KJFB 1U7LA 2LDYA 4KE5A 3CCUS 4I2QB 5HVFA 5G0RA 3CD6S 1S57A 2LEPA 3NOGA 4R5PB 3P5BP 1CULA 4KB7A 1ZZFA 5F3ZA 1OQ6A 3DLEB 3P45B 2A3JA 4F3QA 2HSEB 3TZZA 1RCOB 1LNQA 4RBUA 3GIJA 1EP4B 4YB7A 4KHPJ 2D41A 2EK1A 4KSEB 1KHVA 2E29A 1DZ5A 4BWMA 4F25A 3CMQA 4ZJLA 4I2PB 4DUYF 4EWTA 4YEAA 3QNWB 1MN9A 1IKWB 3GSIA 3K59A 1GTEA 3GSDA 3QGPA 1RTZA 3QWPA 3JQMA 2ZHBA 2QLXA 4YB6A 1FRLA 5HL7Q 5KFUA 3UVJB 1IKYA 1L3UA 5C7PA 1RYRA 4C8NA 2F9DA 3WBZA 4ZPAA 4PZVA 1HBNB 2U1AA 3QJLA 4LT6A 3VALA 4JI0J 2PMHA 4AXJA 2AGQA 4B9VA 3ENQA 3DLHA 1X5SA 2EBEA 1NK4A 4C8OA 2I9SA 2QN6B 2ALZA 4RZRA 3FC9A 2EG2A 2IVMA 3QYYA 2UUTA 4JV0A 3TANA 2WVDA 4EO8A 4DL5A 2OPRB 4H4OA 1PSDA 3UQSA 3VAJA 2BXJA 3IAS9 1HYSA 5B0BA 4B17A 1AFJA 1Q16B 5KFSA 3OJUA 4ZLLA 1Y4ZB 4RW6A 2EPIA 2W9BA 2Q6BA 1VQ7S 2J9CA 1PC4A 3HHEA 5F8NA 4OZ0A 3CD7A 3F56A 2KM8C 1SJFA 2HAFA 1S6PB 3I6PA 1Y3JA 3NS5A 4KGMA 2RILA 3ADAC 1M5SA 2B6AA 3M7VA 2VF3A 4ZIWA 4I7FA 2JEFA 1S6OA 3LGHA 1S9EA 1PCAA 4OYPA 3G82A 4CLTA 2MKKA 4JI4J 2FLPA 2APOA 2JX2A 3RBZA 1Z4UA 2V4JB 3I5BA 1HHTP 4LF8J 4ZVSB 2IRYA 4DL0C 1UA1A 4WFZA 4LF9F 3RYLA 2XS2A 2N3OA 2ZZMA 1I5OB 4YN3B 5G0RB 5F0WA 4TLQA 4QIVA 3PTWA 3MMCA 1MNEA 2JL9A 2QA2A 1CULB 4B9LA 4U8YA 2VG5A 2EG1A 5HQ8A 4J5OA 3L3CA 4OX7A 2ZH6A 1EB0A 1RAFB 3HCXA 5ETTA 2XC9A 2DGOA 1WC5A 3IXQA 3GR0A 1YG0A 1RWWB 5DRKA 3TEGA 3H90A 1QVFR 3Q86A 1BQNA 2H5IB 3EVMA 4ZVGA 1TKXA 2DNYA 1H98A 4HTJA 4WCEQ 1FE4A 1JXEA 1S97A 1IKYB 2CJBA 3NS6A 4I6WA 1NK0A 2K3KA 2P8IA 1HW9A 3THPA 2DXDA 4X62J 1RT6A 4X4PA 2KFNA 4C0OC 1FFGB 4FXVA 2R8JA 1WC3A 2LCWA 4LF7F 3IBCB 3ISNC 2Z4PA 5HMXA 3M4XA 3D67A 3KK3A 4HR2A 2G2ZA 3KNGA 4ZJQA 1JLFA 3AXKA 3ZZYA 3ZZTA 5CZVA 4WFXA 1Q8BA 4JI5F 1V6HA 3SEOA 2ADBA 1NXIA 3Q83A 5K8PA 3RB6A 3RW7A 2UVRA 4H4OB 4LJMA 3CJRA 2B51A 4TY8A 2P5VA 5AXNA 1HYSB 4DR7J 4QW8A 2FVRA 2VBZA 3SDEB 3OR2B 5M2UA 3W9HA 1XQIA 4MYTA 3HZGA 2GW8A 5KFNA 4RW6B 4M5DA 1SC3B 2W9BB 2JEJA 2LLZA 1LKZA 3BGRA 4DR6F 4NWBA 5F8JA 1TV6A 1MWZA 5I3UA 1GX5A 2G9OA 5E0OA 2AP6A 3M8QB 1RWXB 2EFPA 3C14B 3HVTB 4DX6A 5B0AA 1HL6A 2VV5A 4I7FB 4WWSA 1HLWA 1S9EB 3KKFA 4A8MP 4ZKAA 5D4LA 4XDCA 4J9KA 3DLJA 1J5EF 4LRCA 5A0YA 5E5NA 2FJDB 3US5A 3PYGA 5L1IA 4OZLA 3DHWC 3G86A 1J27A 4HDHA 1G2EA 3LPEA 4RW8A 4CO0A 2BZ2A 3KFWX 2FHKA 5CYJA 4B9TA 5KFGA 2HQCA 2DNZA 2M4MA 2XLKA 4H54A 3GIIA 4NZ0A 4EZ6A 3MR7A 2FDNA 5LSOA 3DOLA 2VG5B 3N6NA 4Q44A 4LQ3A 4XAKA 1VQYA 2MMYA 2JDJA 1BQMA 3R2DJ 1FRKA 4DV4F 3I5AA 4QZVB 2MGZA 1IQTA 1C1CA 1PJ7A 3G8TA 2R8HA 4YOEA 2AGOA 1BQNB 1NHUA 1TMMA 4OHXA 4OMFG 3PYEA 1U1MA 2GHVC 4ZLJA 3SFUA 2V5HG 1LWFB 3CB4A 3KNAA 4H4MA 4JV2A 3FSIA 4O3RA 5KG4A 4ZP8A 3V4IB 2CNLB 1LK7A 3R7BB 3DCAA 2MPUA 3CJ0A 1U4BA 2BJEA 3LALA 4C8KA 1AA1B 1JLBB 2Z2YB 3BKUA 5G4DA 4FKXA 4IH6A 4JI7F 3CCRS 1RT6B 1NKEA 1KDNA 3VGSA 4OYIA 5FJ4A 2MJUA 3DM2A 4BC7A 2ZH7A 1JLEA 2M9KA 3CMAS 3OJSA 1SL1A 3KK3B 2E1RA 5K8MA 2D74B 3KDNA 3MM5B 3HM9A 3MAQA 1FRIA 2FVQA 4RNHA 4DZ6A 2WONA 4WBFA 3MMBB 3HLUA 1UKUA 1TTHB 1Y00A 2XY6A 2HIQA 1X9WA 4AQYF 3NNCA 1WKLA 2UU9J 1UA0A 1HBOB 3IBWA 5HMWA 2R2TA 2ILZA 2CKWA 2UUBF 4HI2A 4J9UE 5LMUJ 5DQIA 5IT9Y 4OJ1A 1JLCA 1NJIT 2AZ3A 3GV7B 1X8DA 2ZBIA 2NQPA 3PW5A 1WACA 3A13A 4ED7A 1JX4A 3SIPB 2KTQA 3G2XA 4RR5A 5KFIA 4QWBA 4M5DB 4ZMMA 4IFVB 3QIPA 3BGRB 3HHLD 3M8WA 4YQWA 4G65A 1QTNB 2HGMA 3SCKE 5LXYA 4RPFA 2IY5B 3NBPA 2PI4A 3W2VA 1S1TA 1FXRA 2GQQA 4YB5A 4DPOA 4CH0S 2DVIA 3EDRB 1I3OB 3LPYA 5DQGA 1JIHA 2IC3B 4DV2F 3CO9A 1WDTA 2K7KA 2F1FA 1ZA1B 3IFEA 3KLVA 2OLWA 1V5VA 3GV5B 3AT1B 2FPHX 2W7OA 2AYBA 5KFWA 4IO9Q 2OFHX 4X4UA 2DHSA 2CJAA 2QMUB 2XYPB 3TAQA 2E7XA 3P8BB 4USHA 4QU7A 5DM7Q 1YZ7A 4LF5F 2W9CA 4EK2A 1VC0A 3DOLB 2QLBB 3MEEB 2JOQA 1N6QA 1A0OB 2A10A 2UUAJ 1XNQF 1BQMB 4M5GA 2HG4A 3KG4A 1NBEB 3LW5C 2MGZB 3U7JA 1C1CB 4KHPF 3M6XA 5GADU 4M1KA 4OHVA 2ZBPA 2ASJA 5L8RC 1CJTB 2O3DA 1FXLA 2IHR1 1XIQA 2FIUA 3EX7B 4TU9A 2LU1A 5DQHA 3K2YA 3DYAA 1RTHA 5ETSA 3DRPA 1FDAA 5B08A 4HLBA 1ACMB 4JUZA 4DV6J 2RRAA 5T7LA 1DRZA 1K1QA 2DRDA 3TOQA 2D3O1 1HPZB 4ZDNA 4NXMJ 4AFFA 5D4NA 3R5CA 1BWEA 2H51B 2I6WA 2OEMA 3M2VB 4USTA 3D3CJ 1UFKA 3NEKA 1FRJA 1YJ9S 1JLEB 3V81A 4MYUA 4JI0F 5B0EA 1C4CA 3BSCA 2AW0A 4FN5A 2V2VA 5HQLA 4O3PA 2R8KA 1UCNA 1SKUB 4DSEA 2KH9A 2QE5A 3CGIA 1OQ3A 4PXDA 5CH7B 2KXFA 2Z2LA 4ZITA 4KT0C 4F02A 4NYOA 1IBMJ 2X7IA 1R31A 2BMBA 5FD1A 1RTJB 1RJJA 3P49B 3G4SS 2A0FB 4EGLA 5ADZA 2DT9A 1SH2A 3LWMA 3KK1B 1KQGB 2PO4A 1DTTA 3CSKA 2GAHC 2WAQD 4AYBD 1S1TB 3GCXP 3ILLA 4J9LA 1JXLA 1WC1A 3MZIA 2QTWA 2NPIA 2YNHA 1NO8A 1RAAB 1OY6A 5A8RB 2VG7A 2C1EB 2DGUA 4MKBA 2EKNA 3Q8SB 1UWBA 4DI6A 4B3RJ 5JVGQ 1RT4A 2OD4A 3CXCR 3CW2C 3T5HA 3NNAA 2J0QD 1QVGR 4JI4F 4KY3A 3B54A 3OXFA 1HBMA 1VC5A 4LSLA 5KFRA 4DEZA 4LF8F 1APSA 2CDQA 4WFAQ 1Q5VA 4ZVOB 5HVHA 2HVHA 2W9CB 4EEYA 3DMJA 1C0TB 2IM3A 4ZA1A 3NWRA 4ZJOA 2DGWA 1JQGA 2WSCC 2B43A 3GV8B 5HO4A 3LO3A 3UN2A 1BXNA 5KTQA 3FBEA 3VAFA 4FNHA 4Q0BA 1LEOA 4DR2J 3MM7A 3D5MA 2DR7A 2UXDJ 5KT6A 1KSPA 1N88A 3DOKB 3HKZD 4UQTA 3H2LA 1WOSA 2YPYA 3CCWA 4WTYA 1AZSB 2IRUA 3A8EA 3A3OB 3DRPB 2HBYB 4AL6A 3EXCX 3IWLA 1YJVA 3HX9A 3M8SA 1Q82T 4F04B 4BS2A 3V6DB 5IM0A 2YH1A 1H0HB 3DGPA 2YWKA 1WOPA 4ECQA 1SJ1A 4X62F 2KT2A 1VI7A 2ZITA 2AKWB 1YVFA 1LW0A 3TVZA 2ROEA 5CYQB 2VOPA 2W4DA 5A8KA 3NMRA 2ZOGA 3M6WA 3LP2A 3JSYA 2LU2A 2KXHA 1OYDA 4PWWA 1Y10A 1RWNB 4OZ5A 3WZ0A 3TVYA 2RSQA 4WK3A 2KN4A 2VKZG 4ID5B 5ETOA 2Q3PA 6AT1B 1VRUA 1VCTA 1EZZB 5D0RA 1YJNS 3C6TB 4IR1A 5IQ6A 3MEKA 4GC6A 2HRYA 4DR7F 3RBEA 2HIYA 1VJQA 2BJ7A 1DTTB 9RUBA 2OI2A 1OYEA 5E3RA 3P5TL 1WDDA 4BDPA 2C3PA 5IC6B 2ZH1A 1KLMA 4OZ2A 4TVAB 4EBCA 1YZ6A 4ELVA 5HBMA 2RQCA 5HSPA 3P6YC 2Y8YA 2VG7B 1S4FA 4M5LA 1UWBB 4NLXA 2JH3A 2ZE2A 1RT4B 5C5JA 1K8AT 2P9GA 1M90T 3DLBA 1UVLA 1U6ZA 1IVZA 2G0CA 4OIXA 7FD1A 2BEFA 5FDLA 5F8LA 2ZJQQ 1GTHA 3HD1A 2XZDB 1I1GA 3PNIA 4K5SA 1I6JA 3DMJB 2BANA 2KXNB 4OYOA 4R8UB 1WSVA 1EETB 3ZZPA 4JI2J 5KG6A 2FHMA 1HI1A 3CJQA 2CWXA 4RW9B 3EPIA 4O0IA 3G6ES 1VBZA 1S99A 4HACB 4O44A 2CQ2A 3LA0A 1Q95G 4F4AA 3FKBA 1QSYA 2V0NA 3BPDA 2DYAA 4IUFA 4PQAA 4LQ9A 1T95A 3QPIA 3GJQB 2WHOA 2CJXB 1X4EA 3MPYA 3L9ZA 2QLWA 5GAHU 5I42A 3AQPA 4I0WA 1ZAXA 4QYZJ 4N8NA 1HNIA 3VVTA 3CCZA 4ES2A 4NMXA 2BOPA 1H6KX 2C28A 1KFDA 3LGMA 4XPEA 3DU6A 4X4RA 3G8QA 2E5JA 2D9OA 1R6VA 4M94A 3PRVA 5AJ3J 2FD2A 2W8LA 1HWKA 5DG9A 4M5MA 5DLFA 1SUQA 3UPFA 1LW0B 3RB3A 3PJXA 4Q2LA 2CQ3A 1YRXA 2NR0A 3IM9A 2XS5A 1XEZA 3D3BJ 4WFNQ 5T41A 2GZOA 2MEWA 3JTNA 3BBCA 3MD3A 3F73A 4CLYA 4ZP7A 4DF4A 3BKTA 2IJFA 2UU9F 4WZQA 4P2SA 3W9IA 1VRUB 2QV6A 2XI2A 5LMUF 1FRHA 1Y9OA 2GA7A 4OYWA 3GYNA 4OYMA 4K4XA 1YJ7A 1WELA 4ZPDA 1YKWA 2B4UA 4F0KA 4CM0A 2BDPA 4DX5A 3VCDA 2VPZB 4NA3A 1GXUA 4MIWA 1U1RA 1VMBA 4IQMA 5HLFA 4ILMA 2BJDA 2RNEA 2IRXA 3W63A 2K7JA 1MW7A 1DHMA 3AD8C 1D8ZA 3CJKB 5ETPA 4NLTA 3D6MB 3PX0A 3G9CA 3H42A 3SZ2A 5FIIA 5FDLB 3VQSA 1NSPA 1WJ9A 3MMAA 4F36A 4UT4A 1WHWA 4ELUA 2J9DE 3OHBA 1HMVA 3OHAA 1FEHA 3RTVA 1E6YB 6FDRA 2R4FA 4OJHA 1HD0A 3DLKA 3C15A 4ZCMA 1T03A 3CJTA 2L9WA 2NXJA 2J7KA 2CPFA 1FWKA 2B4OA 4OX8A 2OP5A 4O44B 1FTCA 1OIAA 2UUAF 3ET6A 3Q8UA 2ADCA 2F9JA 3DC2A 2MXYA 1SPBP 9ATCB 3V4MA 2V69A 6FD1A 1HNIB 4TY9A 4CWBA 4QU6A 3D0GE 1U0HA 3OUYB 4DBQA 2QMWA 5KFBA 2IFXA 4NOHA 4DV6F 3VHQA 3W66A 2X3DA 5A6PA 4ED5A 1VHIA 2KU7A 3ZZOA 4NXMF 1HQEA 4FYYB 4A4JA 3POTA 1WF2A 1VQ8S 4ZHRA 3LGNA 1OY9A 4YUDA 1DAXA 4FF1A 1KVIA 3EICA 2KT3A 4JI1J 4PWUA 3K8VA 2I5JB 2OTLS 1XMBA 4EUVA 1RE1B 3B8HA 3PEJA 1EQMA 2AJQA 1KHWA 3P3DA 4ZPWR 5D15A 5LMNJ 2IBKA 2GIRA 1FD8A 4PEOA 5KFKA 3ETMA 3ZXWA 1RWMB 4K4YA 1IBMF 1UP1A 2OJ3A 7AT1B 3MEDA 1SC1B 1S0OA 3ZZRA 2LEBA 4ES3A 5KG2A 4RW7A 3A3PB 4OL8A 1S0MA 4DV7J 4ECSA 3OD2A 4KKOA 5KT3A 2XZTB 5J1NA 2A6MA 2CWKA 1ZZNA 1RHRB 4WXWA 3HSJA 3QT7A 4DJBA 4QR2A 2BW7A 3MUVP 2JLEA 3B78A 2YWWA 2CPEA 4F0MA 2V2QA 4KGKA 2Z2MA 2UUCJ 5AE3A 4N5SA 1FTRA 4M5JA 2PDAA 4JYAJ 4B3RF 2LXFA 4WXOA 4UY8T 5IS2A 3MMAB 4A8FA 1FI4A 1H74A 5B7WA 4JV1A 1SIZA 2RMLA 4OZ1A 4YDDB 2IAJA 4ZVUB 2IDLA 3N5FA 4IR9A
chains in the Genus database with same CATH topology
1X4AA 4PQUA 4XDDA 2CQIA 1TKXB 2BV3A 1KEKA 3DLKB 2DH9A 1BY9A 4FZVA 1RI7A 2JZ5A 1RT2A 1WEZA 2PC6A 5E3QA 3C6UB 2ABYA 2PE8A 2W4CA 1RAJA 3CE8A 5A2QY 2VUGA 1QE1B 1U24A 2AD9A 3H5YA 2HHPA 1LXJA 3HHLC 4F26A 5KG5A 2DTJA 3K5PA 3H4DA 1KC8T 2QYCA 1NAQA 4G3IA 2XI3A 3KLFB 1RQ0A 2K1RA 1IJFB 2B9YA 4NLUA 2FVPA 3R27A 4DV0F 3T6BA 4CH1A 1B7FA 3PVXA 3HXMA 1U7LA 1ZM4A 2RRBA 2LDYA 4KE5A 1X4FA 1KTQA 4KBIA 3FRYA 4I2QB 4QWAA 3CCUS 1N5TA 1N0UA 4ITSA 1B0VA 3AH6A 4OI1A 1Q7YT 1M5KC 4IO1A 4CTAA 5G0RA 3CD6S 4FP9A 4J9SA 2ZHAA 2LEPA 2DO0A 3SXLA 2WB1D 4Z2XA 4R5PB 4ECYA 2HQ3A 2BRLA 2JFKA 4PKDB 5KFVA 1VQ4S 4KB7A 1ZZFA 1XWLA 1LWEA 2A1BA 5F3ZA 1OQ6A 3DLEB 4BHQA 2A3JA 4DR2F 1AW0A 4F8RA 4O4GA 4F3QA 4ZPBA 2UXDF 2WB4A 4RBUA 3HHLA 1EP4B 4YB7A 3W2WB 3GIJA 4NLWA 4PUOA 2D41A 2EK1A 3MEGA 4KSEB 1RDRA 5DGBA 1KHVA 2E29A 2XHWA 2HVZA 5HROA 1DZ5A 2HAIA 1JLFB 4BWMA 5GAGI 2V8HA 1R8PA 4Q2MA 4F25A 5KT2A 1U1OA 3CJKA 4PRFA 2ZBCA 4I2PB 4WF9Q 3OL9A 1U1LA 4ZS6A 4DUYF 1TR0A 4EWTA 2V9WA 2R7VA 5JUMA 3R5BA 5KFMA 3I4HX 4YEAA 3E2EA 2XSFA 1WF0A 3OVBA 1VIXA 4Z37A 3MGJA 1IKWB 5CD4H 2OO4A 3PIPQ 2QZ8A 3K59A 2ZDOA 1GTEA 3BO4A 4LIRA 3K8WA 5DDQC 3GSDA 4TY8B 3QGPA 4RWXA 3QWPA 1E6YA 2DB1A 2ZHBA 2QLXA 4YB6A 2B9XA 3M6VA 3SQGA 2WK4A 5J2NB 3KG1A 3I5CA 1UAWA 2GX8A 3Q8QB 4FBUA 2AGPA 3OL6A 3VZIA 1FRLA 5HL7Q 4CI0B 3FEZA 5J2PA 3KOAA 2GNKA 2UVWA 5LXRA 3POTB 5KFUA 3RRGA 4B9UA 4F2RA 3CIMA 1IKYA 2W4PA 4KFBB 1L3UA 3RAXA 4IG3A 4Y2CA 1GH8A 3TAMA 2DPJA 5E3PA 3OL8A 3DU5A 2KG0A 1RYRA 1RKJA 3M8RA 2Q43A 4RBVA 4Y3CA 1TV6B 4C8NA 3SMZA 2F9DA 3WBZA 4ZPAA 3GE9A 4Y2AA 5I3UB 1WI6A 4K4ZA 1HBNB 2U1AA 3E01B 3N01A 4I69A 4LT6A 3VALA 1Y5LB 4A8WA 1SKRA 3QJLA 1CC8A 4RUCA 2AWZA 4QJVA 2VPXB 4B3TF 2PMHA 4FPRA 4MJKA 4AXJA 2AGQA 1KLNA 5KG7A 3D2WA 2LA4A 4B9VA 2ZNZA 4HKQA 4LSNB 3ENQA 1DTQB 4ATNA 1A7GE 5IXUA 3JYTB 3V6JA 2UV8A 2BM0A 1RTIA 4RBTA 1XERA 2MZ1A 2M88A 3OR1B 2QMXA 5EX0A 3DLHA 2VL1A 3S01A 5E3CA 1X5SA 2EBEA 1T05A 1NK4A 2KRBA 1T02A 2HRUA 4C8OA 2BA9A 2I9SA 2ALZA 1S9GB 4PPDA 1HD1A 4DR1F 1SKSA 2FLOA 4DSFA 4WKRA 2VPWB 3IA0A 3J7YI 4X4NA 1RK8A 5GAGU 2MY7A 4EU0A 4RZRA 2OPPA 2VQFF 2EG2A 1XMQF 2IVMA 5A0YB 3G6VA 4FBTA 3OUYA 4DV1F 3ITHA 1OWXA 3MEDB 4G1IA 3PW2A 2HZCA 2FJAB 3M8PA 3SCIE 4UUWA 1LV5A 1T94A 4F4XA 2GMJA 3QYYA 1QSSA 2UUTA 4A48A 1FE0A 2WW8A 2LQ5A 4H4KC 1XN9A 4JV0A 4EO8A 4X64F 3K5LA 5L1JA 3TANA 2U2FA 3KLIB 2DRBA 4RW7B 1YBAA 3PX4A 4DL5A 2OPRB 4H4OA 2NUHA 3EUNA 1PSDA 2LYVA 3UQSA 1JB0C 1HFEL 1TL1B 2M2BA 3VAJA 4DR3F 1SQEA 2BXJA 3IAS9 4RW8B 1S1WB 1YRTA 5B0BA 3BJYA 1QAIA 4C4WA 4KKOB 2IM0A 4A8QA 4MFBA 2FHJA 3PY8A 4B17A 2HYIB 3LANA 1P6TA 1Q16B 4USIA 5KFSA 1AFJA 1UMJA 1HBUA 3OJUA 2IMOA 3NKYA 3BEGB 1Y4ZB 4OI6A 4RW6A 1N36F 4MIAA 2EPIA 5DG8A 3M9NB 3BO2A 2W9BA 1ZBTA 2Q6BA 2CPJA 3DNCA 1VQ7S 2CQBA 1HHSA 2J9CA 1PC4A 3HHEA 1SKWA 4TU7A 3KHLA 5F8NA 2VB6A 4FXDA 1IJEB 2HMIA 1REVA 1VLYA 1LW2B 3UI3A 4OZ0A 3CD7A 3F56A 3VF0B 2OSRA 2I5JA 3F44A 2KM8C 1S72S 2AX0A 2IM1A 3THTA 3WDOA 5B09A 1SJFA 5E41A 1S6PB 3I6PA 4GO7X 5D3GA 3NNHA 1Y3JA 2XWYA 3NS5A 2NPFA 3BSOA 4UY85 4KGMA 2RILA 1M5SA 4BCAA 4KJIA 3JB9k 3R1HA 4ZPVR 2XBPA 5J2MA 4TNOA 4OX6A 5SUHA 2B6AA 1E6VA 2YKNB 4ES1A 2JEFA 4I7FA 3H5UA 1S6OA 4IDKB 5FLXY 1NJWA 1ULRA 1X4CA 2HVIA 2BABA 5KFJA 1KQKA 2V8DA 1S9EA 4LFAF 4ICLA 2QA1A 2OAUA 4I68A 1VOMA 1OSDA 1R6YA 3HKWA 1D8YA 4USJC 2PEHA 1L3KA 1QJHA 3DLGA 3QO9A 3S6EA 2MKKA 3J7YU 4ILLA 1X5PA 2IAJB 2FLPA 1QM9A 1HWIA 3LWLA 4ELUA 4PQUB 1QTMA 2APOA 2CQ1A 2XMTA 5BYRA 2JX2A 4NX9A 1L5UA 2XY7A 2HLUA 5GVQA 1Z4UA 1KR4A 3OXGA 1UVIA 2V4JB 3MM9B 4H4MB 1S1VA 3I5BA 1HHTP 2VD3A 1DQ8A 3PR5B 2DHXA 4NRUA 1U26A 4PCQA 3OLAA 4DLGA 5HMYA 3BGUA 4N56A 2IRYA 2I2YA 3IR6B 2COLA 4DL0C 1SBRA 4MK8A 2J0XA 4F4YA 2KJWA 4DUZF 4Y00A 1FKOA 3MMJA 1UA1A 1SV5A 4WFZA 3KLEA 1O8BA 3MHYA 1CG2A 4JI2F 1TK8A 1NK6A 2XMJA 4LVNP 2EFQA 4CIOA 4Q8EA 4LF9F 3RYLA 1CSJA 1UFWA 2N3OA 2XS2A 2ZZMA 4IKAA 4QPXA 4CTAB 5G0RB 3IRXB 4F3OA 2DCUB 5F0WA 4L6V3 1ZYQA 4TLQA 4QIVA 4NLRA 3MMCA 2GFFA 3DM2B 4ED1A 1MNEA 2JL9A 5SZTA 2QA2A 3J7ZT 4B9LA 2YVSA 2POKA 3OBIA 4DG1A 4QIEA 4TQSA 1F9FA 4KC5A 5KFCA 4DSIA 3LOUA 2VG5A 5IQQA 4MKYA 2RQ4A 2L08A 2EG1A 1XK8A 3CF5Q 3PFEA 2YWEA 2J5AA 4DFPA 2K2PA 1ZAWA 4J5OA 4Y34A 5HQ8A 1Q8LA 1HARA 3SV4A 1YI2S 4ILRA 2I38A 2DGVA 2CQDA 3AA9A 1NU4A 3L3CA 4OX7A 2ZH6A 2WONB 3QGHA 3DRSA 4FNIA 3EPGA 3TQ1A 4JOUA 5KFEA 2XC9A 2EC0A 1YJWS 2DGOA 3IXQA 2O01C 2YTCA 3GR0A 2DITA 4OI4A 1FJ7A 2D9PA 1VHFA 4ZPCA 1YG0A 1L3VA 5DRKA 1IXKA 1JLGA 1YHQS 4YB1P 3KWMA 2MQNA 3GZ7A 4ETXA 2YNGA 5EWGA 1QVFR 3CWJA 2ZD1A 2J9DA 3PEHA 3E8OA 1BQNA 1RKIA 4B3OA 1JLCB 4ZLPA 1UEUA 2P6SA 3BGFA 1FDBA 4ZVHA 4ZVGA 2IA6A 1TKXA 2DNYA 4TXSA 3OPKA 1H98A 1AXQA 4HTJA 4WCEQ 2QA4S 4K50A 2UZAA 1FE4A 1JXEA 2VBYA 3C6UA 1S97A 2GQ2A 1IKYB