1SJ3P

Hepatitis delta virus gemonic ribozyme precursor, with mg2+ bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords precursor form of the Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Hepatitis delta virus
molecule tags Translation/rna
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sj3P00
2LA6A 1OWXA 3VALA 3CCES 3NNCA 2CPZA 2MZQA 1YIJS 1UP1A 2EK6A 2RU3A 2RVJA 2HGNA 4WFBQ 2MKHA 3NMRA 1ZZNA 2CQBA 4F26A 2DO4A 2DNNA 2DNGA 1NJIT 3CD6S 1P27B 3UE2A 5IQQA 2MSSA 2XNQA 4LJMA 5LXRA 4TU9A 1M90T 3CCVS 5HO4A 2DGUA 2DK2A 2L41A 1QVGR 2J0SD 1U1NA 1KD1T 2CPDA 3J7ZT 2M4MA 2MJUA 2XS5A 1JJ4A 2PEHA 3MOJB 5CYJA 5H1SV 1VQPS 3R1LA 3CC4S 3MUTP 2OIHA 4WCEQ 2G0CA 2FPHX 2ADBA 1A9NB 2DGVA 5GADU 4P6QA 1DBDA 1U1RA 3PIPQ 3I56S 2LXIA 2CPJA 1DRZA 2JVOA 1VQNS 3TO8A 4V19X 3H2UB 3OW2R 1UAWA 4WFNQ 2AD9A 1RK8A 2MKSA 3MUVP 5BJRA 4QPTA 2VOOA 2M2BA 4F25A 5LXYA 3JB9k 5ITHA 5LSLA 1H2UX 3S8SA 1FXLA 5MLCV 4UY8T 2MQMA 4U67Q 2NZ4A 5LSOA 3G4SS 5DDOC 1X5TA 1N8RT 4FXVA 2CQDA 2MPUA 2V94A 1VBXA 2RQ4A 2YWKA 1SJ3P 1M5OC 1U1LA 3H2VE 1S72S 2KG0A 2K8GA 1FNXH 2LA4A 2KI2A 2MZJA 5D78A 2MGZB 2DB1A 2OJ3A 1KOOA 2X1BA 2KM8B 2ZJRQ 1X4DA 2HVZA 3NS5A 1R8HA 3ULHA 2LEAA 3IWNC 4IUFA 1X0FA 1HL6A 1YHQS 1H2VZ 4UQTA 3HI9A 5CXTA 4YB1P 4CQ1A 2DNMA 2MQLA 2CPFA 1X4AA 1UFWA 2DNRA 2RS2A 4OZ1A 1NO8A 2O3DA 2MZSA 3G9CA 2N82B 2M8HA 2HGLA 4PR6A 2FC8A 1SJFA 4TU7A 2CQ4A 3D2WA 3UD4P 1SXLA 2L08A 1VC0A 1SJQA 1WEXA 2MKJA 3US5A 5DDRC 1O0PA 2DH7A 1SJ4P 2ZJQQ 2G4BA 2KYXA 2MQPA 3MURP 1SJRA 3UCZP 2M88A 2BOPA 2M0GB 4PRFA 1G2EA 2JX2A 1VQOS 5GAHU 3BS9A 3K0JA 2RRAA 2QFJA 2E5HA 2FHOB 4WIIA 1X4FA 3LPYA 3P49B 3SXLA 1X5PA 2KRRA 3VAMA 2MQNA 3VAFA 2LCWA 1M5PC 2CPEA 4WKRA 1YTYA 2YTCA 4YUDA 1R8PA 2MGZA 1X4BA 2E5JA 2KH9A 2LQ5A 3VAIA 1U1QA 2AYMA 1N52B 1K73T 3VF0B 3ZZZA 3CC2S 2DGQA 2KHCA 1XN9A 2AYEA 3U1MA 1WEZA 1WELA 1OO0B 1X4EA 2RUGA 4OZ0A 3CCMS 3BEGB 4IOCQ 2MY8A 3G8SA 1KC8T 1VC5A 2OTJS 2MKCA 2MB0B 2RS8A 2KG1A 4TLQA 2HYIB 1WI6A 5GAGU 3EX7B 4PKDB 3MUMP 3PIOQ 2KVIA 3B4MA 1FJ7A 1JJHA 1K8AT 2SXLA 2F9DA 1W2BR 4IO9Q 4C4WA 1HA1A 3DXBA 2LEBA 3CCQS 2DNKA 1UW4A 2AYGA 2M70A 4WF9Q 2E44A 1YJ9S 3BO3A 2ERRA 2CPYA 2CQ2A 1RKJA 1N54B 3FEXB 1N88A 3CMES 2KXNB 1WEYA 4M5DB 1QM9A 2LYVA 3FEYB 2DITA 4CH0S 4ZKAA 2KFYA 2DNZA 1QVFR 2FY1A 1VQKS 3CUNA 3TYTA 2DIUA 1F9FA 3UCUP 2MZTA 2HZCA 3CCLS 2MSTA 2L9WA 3MD3A 2CQPA 3UD3P 2CQ1A 2YKAA 2DH9A 3P3DA 3UCGA 4CIOA 1YITS 2I2YA 5IM0B 4LIRA 1X5SA 3CCJS 5DM6Q 1VQ5S 1U2FA 3VAHA 1D8ZA 2DNPA 2MJNA 3BO4A 1PO6A 1K9MT 4Y0FA 5DM7Q 3G96A 2CQ0A 2DHXA 4RU2A 5DETA 2ADCA 2MMYA 2FC9A 3MD1A 5D77A 2N3OA 1WWHA 1HD1A 3CPWR 2JWNA 2RT3A 4Y00A 4BS2A 2VOPA 1FT8A 1P1TA 1WHYA 2D9PA 3CC7S 1URNA 1WTBA 2M52A 3CMAS 1X4CA 1YI2S 2JRSA 3G8TA 2LKZA 4C0OC 2DHAA 2KU7A 3J7YU 1IQTA 2N7CA 3HHNB 2MHNA 1FJEB 3S7RA 2F3JA 1YJNS 3G6ES 1Q86T 2CQHA 3CULA 3RW6A 1WHXA 2LXUA 1M1KT 2MQOA 2X1AA 3CCRS 2U1AA 2U2FA 5GAEU 3R1HA 2G1DA 1M5KC 2F9JA 2J0QD 3VAJA 1B7FA 1VBYA 1WG1A 4CH1A 3I55S 3LQVA 1U1PA 2QEXS 1CVJA 2BZ2A 3EGNA 3S6EA 2DISA 1PGZA 2B0GA 2DGTA 2DHSA 2MXYA 5GMKa 1WG4A 1FO1A 4WFAQ 1WF0A 3BO2A 4QU6A 4FXWA 1AUDA 4ERDA 3SDEB 4QQBA 2YH1A 2I38A 2EK1A 1X4GA 1JMTA 2VONA 3G71S 4ED5A 1A7GE 3ZZYA 3CF5Q 2XB2D 4F02A 1VBZA 1VC6A 1FHTA 1YWXA 2KRBA 1L3KA 2OSRA 3EGZA 2NLWA 2MZ1A 1NU4A 1WHVA 1HD0A 2J8AA 2DIVA 1VQ7S 1VQLS 2RQCA 1BY9A 2MQQA 4IOAQ 4W90B 2DGWA 1DHMA 5LJ3Y 2J76E 2CJKA 1U6FA 5CA5A 3B4DA 1WG5A 3IRWP 3MI7X 2JVRA 3VAKA 2HGMA 3N9UC 1M5VC 3MXHP 2DGSA 2E5GA 2CQGA 5JVGQ 1KQSR 3TP2A 5JVHQ 1H6KX 5DDPC 2ZJPQ 2D3OR 2DNQA 3CCUS 2K3KA 2WBRA 2KXHA 2VODA 1JJ2R 2DH8A 3DLLQ 1WI8A 2LECA 2XS7A 3SDEA 1KOHA 4Z2XA 5IFMA 1VQ8S 2CPIA 2QA4S 3P6YC 4YOEA 1ZZFA 2CQ3A 2M8DB 2X1FA 2RNEA 3Q2TC 4A8XA 2DNLA 3CXCR 2KXFA 1WHWA 2DNHA 2GO9A 3RW7A 2MY7A 2OTLS 2CPXA 2CPHA 1WF1A 1OIAA 2GHPA 2DGXA 3CTRA 4W92B 3Q2SC 3V4MA 3L3CA 2DNOA 1U1KA 5EN1A 3VAGA 1Q7YT 4J5OA 5HL7Q 2DO0A 1Q82T 2CQCA 2D9OA 1VQ6S 1ZH5A 3S01A 1Q81T 2YH0A 3R27A 1D9AA 2A3JA 2OSQA 1VQ9S 2MZRA 2E5IA 2LMIA 2MYFA 2PE8A 3U1LA 1OPIA 2CQIA 5GVQA 2XS2A 1X5OA 4TU8A 2N3LA 2KM8C 3NS6A 2M7SA 2DNYA 2KN4A 1X4HA 3THPA 3MDFA 2KT5A 4LMZA 3NNAA 2M9KA 5LJ5Y 1S79A 2EVZA 1YJWS 3SMZA 2MKKA 2MKIA 1VQ4S 2AYBA 2DHGA 4C7QA 1DZ5A 4QU7A 2DGOA 2X1GA 1U1OA 2UP1A 5FJ4A 1U6BA 2XSFA 3THTA 1H2TZ 1VQMS 5IM0A 2XNRA 1FJCA 2Q79A 1U1MA 5DDQC 3P5TL 3NNHA 1WF2A 3UWTA 2RRBA 4EGLA 3CCSS
chains in the Genus database with same CATH superfamily
3EZUA 1MW7A 2MZQA 2JLEA 3BN4A 2ZHOA 1D0EA 3WC2A 4F26A 2NXUA 4F7VA 1SL0A 4AE5A 4TU9A 2QYCA 2L41A 3H4BA 4X4RA 3NG8A 1P1LA 2R7OA 2E7VA 3LOUA 4CO4A 2GIRA 1JLQB 4MKBA 4AQYJ 3PZPA 2AEMA 1DBDA 3LPEA 1AUSL 4PYDA 5HMWA 2QFIA 5HQLA 2GV1A 3IAS9 3HLUA 3V5RA 1KLMA 3DMJA 5T7LB 3QRPA 1RXOB 4LSZB 2Z30B 4I7FA 4NLTA 1OPZA 4U67Q 1RTJB 2B8QA 2BJ8A 3OUYB 1HHSA 3EGWB 2HFSA 2KG0A 3LP0B 3TQ1A 2FJBB 2VPYB 2OEKA 1X4DA 1IR0A 1FWKA 4KV8B 4IH7A 4X65F 2I1RA 5ETVA 4FYDA 2CPFA 2GQ2A 1ITPA 1IKWA 3OTCA 4ZVOB 2J6SA 1IWGA 5F8NA 1RT2B 3HFVA 4DFKA 2JZ5A 2W2OP 5J1EA 3PX4A 2HIQA 3VCDA 4X66F 4CNYA 4ZJQA 3ZZOA 4G1QB 2Y8YA 5GMDA 1F9EB 3TR5A 3K5PA 4X84A 2ZH9A 1RWXB 2B9YA 3HCXA 2HW3A 2HRTA 1QE1A 2C1EB 4PCQA 3K7RA 4O0IA 4OZNA 5LOQA 4CO3A 3V4IA 3BKFA 3K17A 2KG1A 2XY7A 1RJJA 3QFWA 1JLFA 4FKYA 2UZAA 3VQSA 4WU2A 1TUGB 1TR0A 4USVA 4HHJA 4YMEA 3A3PB 2OPQB 1ZM3A 3TOQA 2QL7B 2YNHA 2A6OA 3W8PA 1T3NA 2JH3A 3JSBA 4FNIA 1RKJA 8RUCA 4JB8B 4EUVA 3OR2A 2IIHA 4OMFG 4OZLA 1R0BG 1T7PA 4NLVA 4DR7J 3JTPA 2DITA 1YJRA 5DZ7A 1JKHB 3IS9B 4LR9A 2IM1A 3DC2A 2FVQA 2AX1A 1WKKA 3ZZTA 4OYAA 4C8KA 5DRKA 4ED2A 3ENWA 3LWMA 4DSIA 5DM7Q 3U7JA 1RHJB 2FC9A 1WWHA 5F8JA 3CPWR 5BYQA 4DR4J 5K8PA 1LWCA 1CS4B 4MKVA 2GGPB 1U47A 3VVUA 1ZM2A 2LKZA 1WUUA 2WCXA 4WK1A 1WOOA 2N7CA 1QAXA 4PPZA 2EFQA 3ZTSA 4ZP6A 3MMBB 5J2MA 2VPXB 4KY3A 5SUHA 1FJGJ 1B7FA 2HVEA 1VJWA 4ECYA 4CH1A 2QEXS 4AD6A 3W66A 2H9ZA 2QLFB 3K2YA 3BO2A 4FXWA 3GLJA 1CQMA 1TV6A 2B4OA 2C2EA 1XMQJ 3EGZA 3PFOA 1IBCB 4JI0J 2ZD1B 4WPAA 3PY8A 1Z1ZA 3D7SB 1M1HA 3BR9A 1KONA 1DFDA 1SC3B 3OFGA 1HNWF 3GG1A 3UDEA 1SC4B 2HKEA 1HWIA 3JQMA 4L6V3 1WC4A 3N01A 3C14A 2HGMA 3PRDA 3P5BP 2V9KA 4TY9A 4P7TA 3CCUS 4DPOA 2E7WA 4RW4B 1RAEB 1UA0A 1S1UB 4Q8EA 3DU6A 2XO7A 3N4WA 1TU0B 1RAGB 4F4ZA 2EW9A 3UNGC 1RYSA 1S10A 1L3VA 2GMLA 1OIAA 2GHPA 3D1QA 3FEZA 3P8BB 3IXQA 1N5YB 1EETA 3R27A 4G3IA 1VQ9S 2H1YA 4OFZA 4TU8A 2H5IB 4USWA 1SBRA 3CJQA 1SVDA 1EKSA 2WOMA 3MOZA 3R5DA 1M0SA 4RZRA 2MKKA 1VQ4S 5D4PA 3K5LA 4QU7A 1RT6A 2DGOA 3PYGA 2PSZA 4X62F 3P4UB 4DQQA 4MMOA 4DR3J 1GK8A 4FF4A 2WBMA 1I1GA 2WONA 1HBOA 4A46A 3VALA 3HP6A 3RUBL 2PDAA 2YQ1A 3B82A 1UCNA 7FDRA 4P72A 2J0SD 3A1YG 1IM4A 1S9FA 2M4MA 2GHVC 1BXNA 2C2ZB 1S1VB 5D6GA 1IBMJ 2RKIB 5HI7A 5H1SV 4U8YA 3ISND 2BM0A 4EYHB 3MCOA 3P45B 2CPJA 1SUQA 3D5MA 2FB0A 2AP6A 1VLOA 5IC4B 4J9PA 4JOUA 2E66A 4DV0J 4DPWA 3M2UA 1HBNB 1H2UX 2Z0GA 4I0WA 2IA6A 2NZ4A 5LSOA 2ZKUA 1X5TA 1HMVB 1S6PB 5A8WB 1M5OC 1FDNA 5DQIA 2GFFA 1RTZA 4K4XA 4WZQA 1KR4A 2XC9A 8ATCB 1H2VZ 3RR8A 3MM9A 4QPXA 2MQLA 4L73A 2XLJA 4PXEA 1IJFB 3SZ2A 4I68A 2AHOB 2WHOA 2OP5A 1M1GA 3KYLA 4TU7A 4TNOA 3ICLA 2GC8A 4ZN1A 1S57A 2Q43A 4P75A 1JLCB 2LVWA 1NEEA 3C16B 4F4XA 3CDEA 2YX1A 3I0RA 4B08A 3TW0A 4MKYA 4K50A 2AEFA 1EZZB 2AT1B 3NWRA 4G65A 1YJTA 2AEJA 4DR2J 3MM7A 2EWHA 3ETOA 2NPIA 2KHCA 4M5MA 2R42A 1KC8T 1XIQA 4JI3F 2OTJS 2JJ4D 4GKKJ 4TLQA 1JXEA 3CJRA 1G3OA 1VIXA 1YRUA 3HT3A 2IM2A 3DXSX 3MEGA 2CWKA 1SKUB 2V8HA 5KG4A 3F0NA 1BWVA 4YS2A 3KJVA 3BR8A 1N88A 3FZBA 1RA7A 2KXNB 1WEYA 3GIIA 3FEYB 3OL8A 4CO1A 2CADA 1T8EA 4A8SA 4ZJLA 2EBEA 1K1SA 1CPZA 1FESA 2MSTA 3KWMA 3AOBA 1H0HB 5EX0A 2IC3B 3GWCA 2VBWA 2AJQA 3GJQB 3AXMA 3SFUA 2ADCA 3JSRA 4OI2A 3TZYA 3IGVA 4X4QA 1NPRA 2JNJA 5HROA 3TAPA 4ZVTB 1OSDA 2BJ7A 4MIAA 5HVHA 2C3YA 2HRUA 3PYFA 3J7YU 2VZ9A 4WBFA 2H54B 3RR7A 2GCFA 3GFXA 4WE1B 1M5KC 4K4TA 3MM6B 1VRUA 3EGNA 1NPPA 3M8ZA 1PGZA 3ZTRA 5I3QA 1V6HA 3MAAA 1X4GA 3LP2B 2HHTA 4HTJA 1G6BA 1S99A 2YKNA 1M5SA 2JLFA 3T9ZA 2ZH3A 2KRBA 4OI1A 2OSRA 5DO2A 2AZ1A 4USJC 2UVUA 4IOAQ 2DGWA 3AB4B 2ZM6F 2HLTA 1Y11A 2ZWOA 4LF7J 3R7BB 3QRQA 4YY3J 3FBFA 5AXLA 2JVRA 3T3FA 4O3QA 2VFRA 4EK2A 3KMQA 3SCIE 2ZJPQ 3ZNUA 2K3KA 1RBLA 1LKZA 3BGLA 3KXDA 2BJEA 1XJWB 2RNEA 4AFFA 1QAYA 3VZIA 3NGKA 5HVGA 2CPXA 1WF1A 1FTRA 1Q7YT 1PBAA 4Y2CA 4LF4J 2NYIA 1D9AA 2A3JA 2DEJA 4DS4A 1DARA 4Z7CA 3J7AN 2M7SA 3Q8PB 5LM7E 1T03B 3MDFA 4DSFA 3VHQA 1HR0J 1X9SA 4LF5J 4ATNA 4R0EA 2JOQA 3MGJA 5B0FA 3ONQA 3BQ0A 1IVZA 1VRTA 1FK9B 1P8GA 4P9SA 4YFUA 4ZPCA 2ZHBA 1RT1A 3GQCA 4RX6A 5HK4A 3G6VA 2RVJA 1RT5B 5ETPA 3TVKA 1VOMA 1P27B 2RD5C 4OZ5A 3WIVA 3O2IA 3KK1A 3DLBA 1XERA 5KT5A 4MIBA 3HFKA 4B3SF 1QDUB 5CZXA 4QIFA 4DHVA 1BC6A 4M63A 9ATCB 5CQGA 4QW8A 3N0VA 2PGCA 2ZH5A 2QGFB 3DFEA 1OQ3A 2ROEA 2KFZA 5CYMB 1W26A 2GMJA 4ZVHA 5A2QY 2HEKA 2X3DA 3MR3A 3TZXA 2A0FB 4Q5VA 4K0KJ 4H4KC 4DS5A 2MPUA 4HLBA 4YN3B 1OMSA 5B0BA 3MHYA 2KFNA 3D6FB 2VC1A 2R7UA 1NRKA 1KOOA 2Q6BA 1TELA 2XQCA 3M2VA 1X0FA 4DV7J 3K59A 3CO9A 4UQTA 3HI9A 5CXTA 4M94A 5D0EA 1X4AA 1S6QB 4QYRA 1S9GB 5KFDA 1JLBA 4MIWA 2AJ1A 4UUXA 3TA0A 5HLFB 1X31C 3HHLC 3PR4A 4UT4A 2W2NP 1N6QB 1C2PA 2M88A 3K0JA 1NBEB 3W5YA 3C15B 4OJ3A 4LF9J 1BWEA 2KL8A 4LSLA 3KLHB 4FF1A 1UWAA 1M5PC 1U02A 5ETNA 2CPEA 1R8PA 1UETA 4CO0A 1FEEA 1K0TA 3KG4A 4J9VA 2BDPA 1A6LA 3QIDA 3RB6A 2C2DA 5KFWA 2RUGA 3BEGB 4IOCQ 2IJFA 4DG1B 2QL5B 2DPIA 4RUBA 4JUZA 4RWXA 2G2ZA 3MR7A 3R8YA 1P6TA 1UVNA 2A2CA 1XEZA 3R9LA 4HTIA 2CJQA 5KFLA 4ZVEA 1LFWA 1QM9A 4Q45A 1RISA 3HHLD 4C2MA 1TUVA 3M2RB 4A47A 2FGOA 2HAFA 4OYIA 2NS1B 2MLYA 1PO6A 2PA3A 1SQEA 4Y0FA 2YX4A 1JLQA 4ETXA 3AQOA 3RBXA 1T02A 5C5JA 1FKOA 4BC7A 1YRXA 1N34J 1P1TA 1VS3A 4I2PB 3OFEA 5T7LA 4URGA 1Y5NB 2YWHA 1GTHA 3G6ES 4UY85 3QAUA 1RTJA 1EB0A 4FPIA 4DV3J 4DOZA 3H25A 3OUYA 1NHKL 2F9JA 3PJXA 3KLIA 3CGIA 4A8WA 1CVJA 2FJVA 4JI7F 4JI4J 1R43A 2IVMA 4WFAQ 1RI7A 4QU6A 2ZBCA 3OHBA 4X2BA 4U8VA 3RBDA 4ED5A 1S6UA 3E01B 3VGUA 2R2UA 1YWXA 4F8RA 3AD9C 4A48A 4WTOB 3LAMA 1Y0HA 4M5JA 3M30A 3X3UA 4W90B 2XYPB 1DHMA 4G6VB 2J76E 3K8WA 3RRGA 1TL5A 4RW9B 5J2PA 3VAKA 3F73A 2V9WA 5HMXA 4PG6A 3K8VA 5JVHQ 3JXOA 1YG0A 3ZXWA 1NSKL 1AYEA 1GTEA 2JL9A 2M8DB 4A8XA 4DQIA 4Y6IA 3CXCR 2DNHA 1CQNA 1NB7A 2R7RA 3I4HX 2DCUB 3Q2SC 3EVWA 2XYGB 4CO5A 2WAQD 5HL7Q 2OPQA 2Y1RI 2K2PA 4C0BA 2CVEA 2N3LA 3NS6A 3CSKA 2KN4A 1F6TA 2CFXA 1S9EB 4AQYF 4B9TA 1DTQB 1HIYA 5IT0A 2DVIA 1FRXA 2CJYB 2VG6B 2GZOA 3LGHA 2DRAA 1QTNB 2LQ8A 1RTIB 2JSXA 3TA1A 2PT0A 3K5MA 4X4VA 1LNQA 3QLHB 4KC5A 2LDYA 1FTCA 2E1AA 2HFZA 2V2ZA 3FUYA 4TVAB 3NCQA 2DNGA 2ZBIA 1CS4A 1C4CA 5D3GB 4NA2A 5LXRA 4C3LA 4DX7A 5ETOA 4ZPDA 4K8RA 1Q8LA 2VA2A 3MMBA 3H2LA 3BDEA 1VQPS 3GV5B 2KTQA 2ROPA 2FQQB 2IVYA 3I56S 2LXIA 1QSSA 4QIWD 3NOCA 4QIVA 4NRUA 4P52A 1UAWA 1J5EJ 3OVBA 1MLAA 5J2QA 1KDNA 1V5VA 3JB9k 1TK8A 2WVCA 5GAHI 3NMAA 1MN7A 3G4SS 2CNNB 1CLFA 2B9WA 2VFVA 2ZD1A 1VBXA 4DCJB 3J80Y 2OPSA 4OHZA 3GIRA 3I0SA 3M8QB 5KG3A 4F50A 3NS5A 1GH8A 1SQGA 3ZTQA 1NSPA 1HL6A 4F0MA 3KDNA 2DNMA 3FBBA 5A8RB 2R8IA 4OHYA 2Y3YA 3D6TB 4CLSA 2ALZA 1IKXB 4YB6A 4DCPB 1SH3A 1TQLA 5LL6d 1X8DA 1NH7A 1U49A 2J7WA 3D2WA 1S1UA 3IBWA 3W2WB 4I1TA 3KLGA 1IXKA 2ZJQQ 4PPDA 1UVMA 3NGTA 5K8MA 2ZC3A 5E7OB 1WC0A 2BJ3A 3ILIA 4UOFA 4KIAA 4LUBA 1U8WA 4LIWA 2YTCA 3DOMB 1FKAF 5KFCA 4ZDNA 1FWPA 1HYSA 3PO5A 1FDBA 2ATCB 5A6PA 3ZZZA 2W01A 3UFCX 3GJSB 4ED0A 4AXIA 1MSWD 1PSDA 4DN0A 1J5OB 2MY8A 2WVBA 3G8SA 1BQMB 4B02A 2MEWA 4TY8B 1QUVA 5HATA 4DR4F 1JJHA 4OJ1A 1S0NA 1HA1A 2OHDA 1RAOA 1EAYC 1K47A 3G86A 2FD2A 4EBEA 1NK6A 1GFWB 1U2CA 1U26A 5CHCB 4KKOB 2ZH8A 3NGRA 4DL6A 4IRKA 2A18A 5AE3A 5HQ8A 3SCKE 4YQWA 3BYPA 3LUYA 2D1CA 4CLWA 3A4TA 1FJGF 5T14A 3U1NA 4R0JA 4ILRA 1XC9A 2KZZA 1HI8A 3MR2A 4LSNB 3CCLS 3BH7B 2HBQB 4HEA9 2V69A 1JK9B 4YR0A 1LW2B 3RBZA 4DR1F 2MJNA 1K9MT 3VVTA 1HHQA 4NYPA 3HSJA 3EVMA 4YHHF 2DEIA 3FC9A 2V2KA 1S7IA 4WU3A 4UQGA 4UZBA 4O4GB 2EG1A 3G8TA 1ZM4A 3HZGA 3MEDB 1HBNA 2V34A 4ZK7M 1XK8A 2YPZA 1IWAA 4ECQA 2WB4A 2X1AA 2HSEB 3CCRS 4YEAA 2W2QP 2HHXA 5A8WA 4DV5J 2LQ9A 2J0QD 4URSA 4PXCA 4DLEA 2ZOFA 4ZLLA 2XEXA 4EFAC 2XMJA 2DHSA 1JX4A 1HNXJ 1W2IA 2F40A 1MNEA 1R8CA 1QD1A 2V8GA 1AUDA 2DT9A 5L39A 1NH8A 1Q5YA 2C28A 2E5LJ 2NXEA 1DY3A 4E8UA 3ILJA 3I87A 3L9ZA 1RSCA 2F4VF 4KHPJ 2J8AA 3RJMB 1WDDA 3L7PA 4ER8A 4KPYA 4BHQA 2WSEC 2XMUA 2LFVA 2AW0A 4X4SA 3BPSP 2CVIA 3NWGA 4QR0A 5KFZA 1T9TA 5D0HA 2KXHA 3PFEA 1BMQB 3DLLQ 1KQFB 2XS7A 3SDEA 4JI2F 1AW0A 2A2DA 5D4OA 5I3UA 3CTRA 3C6TB 1ZTWA 4MJKA 2YNIB 2IVFB 5F0UA 3CNQP 2PEBA 3S01A 2WW8A 1KRPA 1SI9A 1CULB 1YK9A 2CQIA 4AUKA 5H9FK 2KM8C 3T6JA 2DNYA 1Z4UA 1D8YA 2B56A 2M9KA 1I6JA 1IR1A 3GILA 5D0GA 5K9FA 2IC3A 2GMHA 4N8NA 4WFZA 2Y1JA 1QAJA 4X4TA 3KLFB 2JHEA 4DV0F 1FJCA 4DR5J 2PMWA 4P7VA 2JLGA 1RTHB 3V6HA 1U09A 1N48A 1Q8IA 5E3PA 4IOBA 4X64J 2EK6A 4KGXB 2HGNA 1TVRA 4O3NA 3CD6S 3UE2A 1RWKB 2ZFHA 3A12A 2NPFA 5F3TA 2V0NA 4DV4F 3CW2C 1SH0A 3HVAA 1JJCB 4JV2A 3Q8SB 2GVZB 5I3PA 5F41A 3MPWA 5IWAJ 4NMXA 4WE1A 1PC5A 2UUAF 3MM6A 2GNKA 1CJUA 2XMTA 3PIPQ 2RB7A 3TO8A 1XNRJ 4IG0B 3IN5A 2X3GA 2HHPA 2BE2A 5J1PA 4Q43A 2CNKB 1KQKA 5A0YA 2CKWA 3D0IE 4NPOA 1VCTA 1U1LA 2OI2A 3CDWA 3DLHA 4RW8B 5C42A 2P6SA 5DGAA 4KR0B 1PBUA 3M8WA 3WDOA 3PG9A 5KOWA 3D3CJ 2JEGA 3C46A 2VPWB 3FFIB 3M9OB 2FLLA 1U6ZA 2DR7A 2XCPA 2J9DA 1C1BA 2IYIA 2QTWA 1RWWB 1AXQA 5DDRC 4ZLJA 2ZH7A 1LXJA 1DLOA 4IYQA 4R8UA 2VDHA 2VV5A 4NXMJ 2BA9A 7FD1A 3LW5C 3ITHA 3JTOA 4QW9A 1X4FA 3LPYA 4A8QA 1X5PA 4CZCA 1LQ9A 1YTYA 1DURA 2KVQE 3UN2A 4RO0A 3DRPA 4HDHA 2W7AA 1YDLA 3NOGA 2E1MC 1TAQA 3DOKB 4LRBA 1T03A 1FDAA 2MB0B 1ZAVA 4DL7A 3PYDA 4PKDB 2H3EB 4WIQA 4ZMMA 3BGRB 1IR2A 4PG8A 3NAHA 2SXLA 5EGYA 3RAXA 3QNWB 2KO1A 2E44A 1FK9A 3AY0A 5EX3A 2EEYA 2ERRA 3CIMA 1VI7A 1VLYA 2BOAA 1EARA 1VQYA 5L38A 3MMCB 2C3PA 5IT9Y 2DXFA 3PR5B 3CE8A 3DOLA 2ZHAA 3CCJS 1S4EA 4GMKA 2UUTA 2CQ0A 4NCGA 2NUHA 3NKYA 3DLKB 3H20A 2GIQA 2CRLA 3JSYA 2V8PA 4ES1A 4PWUA 5KFGA 4FS2A 4U9RA 3PX6A 1E6VB 1VHIA 4LF1A 3O6QA 2YNGB 3MM8A 4J91A 2ZE2B 5K5MA 3I55S 1KN6A 1I3OB 3S6EA 1LWXA 2GIFA 1H38A 1R0AA 2BW7A 2GVDB 5ETSA 1UFLA 3TQEA 3ZZYA 1S6QA 2AU0A 1L3KA 4K2XA 3UR3C 2NCKL 1S97A 1XNQF 4L3NA 3J81U 1A0OB 2DIVA 2CG4A 4JI1F 4LF4F 1N6QA 3Q8RB 5C7PA 3T1HF 3C15A 4HHHA 3DRRB 3DKDA 2CQGA 1HR0F 4C98A 3KLHA 4CWBA 1R8BA 3NBPA 4DL2A 2QJ3A 2ZZTA 3IBFB 3IM9A 1WI8A 4LR7A 2QA4S 3P6YC 1HBMB 4ENOA 3IRXB 2V50A 4DPTA 4DG1A 3RW7A 2PFFB 2OTLS 5EWGA 3PHTA 5EN1A 3M6VA 4RNOA 3UQSA 2OD6A 5KT3A 5FDLA 2IRXA 4C8LA 2W9CB 2IAJB 2J9CA 4WKYA 2LDIA 4E98A 3OV7A 4LRAA 1VDHA 3RRHA 2BUNA 3MPUB 2Z57B 2KT5A 2OFGX 4S0MA 1VFJA 4WTYA 1MN9A 1GT8A 5GADI 1NHUA 3SMZA 1HHTP 3M2RA 3R5AA 3GTYX 1ZBTA 1BE4A 3I82A 4XPEA 1H2TZ 2GQQA 1HW9A 2ALYB 3MPVA 3NNHA 1XMBA 3UWTA 4DZDA 5AJ3J 1Y9OA 1KFSA 2DY1A 1OWXA 4RW7B 4K0KF 1SH2A 4I4BA 1C4AA 5KFNA 1U7LA 1T9XA 2RF2B 2DR5A 4KTQA 3QIPB 4I2PA 4ZLPA 2QZ8A 2XNQA 2HQIA 4O3PA 1FKPB 2QA4G 4LF6F 2BJ9A 3BGOP 3TAMA 4CI0B 2MLZA 4LF8J 4EBDA 4RUCA 4N41A 2QLXA 4OX6A 1NSAA 1F3VA 2YNFA 1UL3A 2C2OB 1KS2A 2J0WA 3AODA 5LMUF 1Q5VA 2MKSA 1RT7A 3L7OA 1WOPA 3LWLA 3S8SA 3MFIA 1WKJA 5MLCV 1LWFB 3BN7A 1DJ0A 3ZO7A 2R7WA 4QWBA 1U4BA 1RWVB 1S72S 4K4ZA 1MU2A 2VKRA 1FNXH 3G82A 2MGZB 2OKQA 4N76A 3M8RA 1FXDA 2RMLA 4ZA1A 4RW9A 4K5RA 2DXEA 1YZ6A 1RAFB 5KFVA 4ED7A 4KH1B 1SJFA 1IM6A 2VQEF 3V6DB 5B08A 7AT1B 3H5XA 4J9NA 2MQPA 3MURP 1SJRA 4I6WA 1G2EA 5B0GA 1H3DA 4CT8A 2NSBA 1D3WA 1XMOJ 5C25B 5HVFA 5CZVA 4I6AA 4KSEB 2V67A 2VQFJ 4LT6A 4DXLA 2AYMA 5U47A 2DGQA 3W63A 2OPRB 3MCSA 1FFGB 4OZ3A 1RP5A 4IQXA 5DZ6A 1KVJA 1DTQA 1HPZA 3MUMP 4WWSA 3B4MA 4GVBB 1N34F 3HXMA 3TA2A 4KAIA 2M70A 5KOXA 4M5DB 4DV3F 4KHRA 2C3MA 2WVFA 2IM0A 3QWUA 2HHUA 4RBVA 3U02A 2H4WB 2DIUA 1CJKB 5B0EA 4CO2A 4EZ9A 3AHPA 1F2GA 1IBKF 1X0PA 4YR2A 4DQPA 2MMYA 1R8AA 2VBZA 2KB2A 1HD1A 2HVDA 1TFWA 4O3RA 3O8WA 1V3SA 2EKNA 4FNHA 3GZ7A 1I5OB 2DHAA 2EFOA 2JFDA 2DHHA 4K4VA 2BMBA 5ETMA 1N32F 4HH1A 2D3UA 2LEPA 3VAJA 4NCBA 4IH5A 4PWWA 1NDCA 1NHVA 3QSIA 1W7WA 1FRMA 5A8RA 1VC6A 2RQMA 3M9MB 5F9NA 4DL5A 1IKXA 1JB0C 4YDDB 2R3VA 4P2MA 2NXJA 3T1YJ 3W2WA 4KHMA 4C97A 2XMMA 3MWBA 4L72B 3QGPA 3IGNA 3W2VB 5I42B 1TKZB 2XZWA 2EC0A 3D0HE 1UWBB 2VFTA 2Y1LB 3EDRB 4OYPA 1T11A 3N9UC 1M5VC 3IMQJ 2FGCA 4PG5A 4DUTA 4ZPWR 2ACYA 3DOMA 1N0UA 3SCJE 3GG0A 3SQGA 1KOHA 1S1XB 4WP8A 2Q3PA 4I67A 5L9NA 1VQ8S 4BLGA 1APSA 1ZZFA 3Q8VA 1KFDA 4TY8A 2VKZG 2MY7A 4DX6A 2BE7D 1RHKB 1HNZJ 2CPHA 4ES2A 1LEOA 3V4MA 1NCLA 1TL3A 1S1WB 4KQZA 2CQCA 2D9OA 1FWLA 1H74A 4JI6F 1N33J 1EP4B 2QYGA 1NDPA 4BC9A 1RB0A 1FERA 3VTIA 3SIPB 3THPA 3LF0A 2IY5B 5F8HA 3QT7A 3RB0A 4Y28C 1FEHA 4MK9A 1VISA 1RWUA 2EVZA 4YR3A 2G1HA 2OPPB 4LSNA 3UNYA 4IFYB 4EO6A 4NA3A 2HHVA 1D9FA 2ZKTA 4WFXA 3UI3A 1ROFA 3MM5B 4ZP9A 1HKAA 1T9WA 2FJXA 4A4JA 1MMNA 3A8EA 2IJNA 3QO9B 1RAAB 5F8GA 4OV1A 5CD4H 2YKQA 2MKHA 1GXTA 3ILOA 3IC1A 3NMRA 2O5DA 4CLLA 3I96A 4JI8J 1G1XA 3DLEA 3MF5A 3GU0A 3RZAA 2HS4A 4FBTA 4KGMA 5KFBA 2F63A 1JQGA 1A9NB 4PYAA 3KDOA 1C0TB 4Q0BB 1I94F 3NAIA 2D69A 4V19X 1IQZA 1B0TA 4WFNQ 4C9DA 1LOUA 1PIEA 2UUBJ 4B3MJ 3SSSA 5ETKA 4TKTA 1MWQA 3M32A 1LW0B 2FY8A 5DDOC 2B6AB 4NLUA 1QJHA 4RL1A 4DV1J 2CQDA 4MFBB 2OLWA 1B0VA 3RB3A 2HHQA 4PG4A 5ADZA 3SV4A 5SZTA 1TMJA 4IO1A 1IKVA 3KHRA 2OD4A 4CYUB 2N82B 3H7HB 1ZS6A 3OFHA 4NLDA 2FC8A 2HURA 4OI6A 2VBYA 3P96A 3D67A 2OH2A 4AL7A 3JYTA 3R2DJ 3DYAB 3OPKA 2D3O1 4NCAA 5IXUA 3BS9A 2ZWPA 5B0CA 2E5HA 3KJNB 3C6TA 2MQNA 3VAFA 2LCWA 1TK0A 4ES3A 1VK8A 2W4PA 3QAEA 3ET6A 2IJRA 2NYHA 3U1MA 1WELA 4FYWB 2K1RB 3DDIA 5A8KB 3M8YA 2HAIA 1Y4ZB 1Y00A 1REVB 5A76A 1DTTB 1W2BR 3SYZA 3CJSA 1UVJA 3O3LA 3A3OB 5HP1B 2N4DA 4JYAF 5KFFA 2UXBF 3KHLA 4EU0A 1FRKA 3M1VB 2F8MA 1RTHA 4J9RA 4MK7A 2C2NA 1TFYA 5GAEI 4WFYA 2ZBPA 3VV2B 4UW2A 4DV5F 4CH0S 4Y65A 2BJDA 2HZCA 2ZUGA 1Y10A 5IV4A 2KDOA 1VK3A 4HVZA 3UD3P 4CIOA 2J9DE 5IM0B 2E5LF 1QTMA 2XWXA 2BX6A 2DHXA 3E2EA 2FHJD 2NXCA 1X9WA 3MD1A 2N3OA 4LBIA 1XQIA 1ZAXA 3CCZA 4DWIA 3PRBA 3CMAS 1BQXA 3GCXP 2P9EA 4DZ6A 4HACB 2CXEA 2VHGA 4PQUB 1M1KT 2VJUA 4EEYA 2UXCF 4B9VA 2B4VA 4QR2A 4RW8A 1QSLA 4X4NA 3ZZRA 3PW5A 3T5LA 2YBVA 3CJKB 4QQBA 3DM2A 3D54A 1F3FA 2EK1A 4DV6F 3FFIA 2V8DA 1TKXA 5KG6A 2EFGA 2F4FA 5C2CA 4OX9J 3MMAB 4H4MB 5CA5A 3B4DA 5L1IA 3HSDA 1FRIA 3OQ2A 1SKWA 3I5BA 2O67A 1EHWA 1Q0NA 1IN0A 4X66J 4GVLA 1IJEB 4AT1B 4O44B 5K14B 4PAAA 2HNDA 2WK4A 3DHWC 1D9DA 1TL7A 3DOKA 3J7Z5 1U48A 4LQ3A 2NZCA 2E1PA 1V3ZA 4ZN3A 2QMUB 3BGRA 4X64F 3V2UC 3R7NB 4ALZA 4Y2IA 4IQMA 3HMJG 2CZ9A 5CH7B 3M6WA 4Y2MA 1NJWA 5GVQA 3OTDA 3KLEA 3R6GB 1X4HA 3PRVA 1RWNB 4U7UD 3QT8A 4RPFA 3MMCA 4DMZA 3FRZA 2BANB 2EFPA 4NLXA 3Q83A 2XSFA 3H40A 3T5JA 4QIGA 1KLMB 3DMJB 2UUCJ 4F4AA 2LXFA 1GNKA 4Y34A 4I7FB 3LGNA 2RILA 3G2XA 5BYRA 1JLAB 1UP1A 4IG3B 1JIHA 2HFVA 1F9HA 3GONA 1ZETA 3B54A 4USIA 4IDKA 2E7XA 1FRLA 2FJEB 5HO4A 3POTB 2WTFA 1E6VA 1KD1T 2YNGA 1Y3JA 2UVWA 2YKMA 3QT5A 3O1LA 3HHKA 4RBTA 3CJ8A 3OW2R 4U95A 2HFNA 3EYZA 3CD0A 2HZVA 1WC6A 2GVDA 4ILMA 1CEZA 5J1EB 3ETMA 2B7CB 2AJ0A 1HBUA 3N6NA 5KFEA 4NLRA 1PAEX 1R8HA 2H48B 2LEAA 2VC0A 1QE1B 1UTAA 1IKYA 2OELA 2IMWP 2Q66A 2HK3A 1OY8A 3ZZUA 3MR5A 2FJDB 3AJ1A 2M3DA 4N77A 3CD7A 3EMTA 2CQ4A 4H4OA 3MTJA 2Z58B 2DR9A 1SJ4P 5KTQA 4KPCA 3H8YA 2CA9A 4ZCKA 3IRXA 4PRFA 3SQOP 4OHXA 2YNHB 5DG9A 1U45A 2CG8A 5KT2A 4CLFA 4DSEA 1R3NA 3OR2B 4MH8A 1VR6A 3GR1A 1RQ0A 3FSIA 3VAIA 2W9CA 2IAJA 1U1QA 4UF4A 1N52B 3VF0B 1S4FA 1T94A 3TVYA 3OBIA 1XN9A 3DHXA 4ICLA 4B3RF 1LWEB 3GPAA 4UOHA 2MKCA 2Y0BB 2YWEA 4M95A 2V6AA 4URQU 3NGDA 2FUG9 4XK8C 4DUZF 4ZVRB 1SIWB 2VBXA 1RU2A 2XULA 1KHVA 3JAMU 1HNVB 2B7BB 3A8KA 5CABA 3RAQA 3KG1A 4FDFA 1KBRA 3DNCA 4HR2A 3FVYA 1FRJA 5J2MB 3DI6A 2RF2A 4PEOA 4ED6A 3IP0A 3QT6A 2P6TA 2FVSA 4ZHRA 1XR7A 2VFUA 2B5JA 1RHRB 3QGIA 5E3AA 3CJ5A 5CYQB 4Q2MA 4FP9A 1TV6B 3SEOA 4L3KA 2UXDJ 1FD8A 1HWJA 2IHR1 3ISNC 2DD8S 3CDBA 3EVOA 5L1LA 2XMVA 4K5SA 4Q8FA 4QWEA 2LU1A 2EFNA 2W2MP 4NWBA 3C14B 3N79A 5EUHA 4C8NA 4EWTA 4OYOA 1T95A 1SV5B 3KK3B 4OX7A 4HH0A 3MAHA 4L74A 2Z2LA 1L3TA 3KHHA 1FHTA 3KHGA 3LP1A 3ZNJ1 4TN2A 4NL5A 4OJGA 2R7VA 2W7OA 4ECTA 1DAXA 2OMLA 1BLUA 2G13A 3DCAA 3MI7X 4ELVA 2YWFA 3KMSA 4Y2AA 1N0VC 3VWSA 5C25A 2WOMB 1H6KX 4B9MA 2G2OA 1RCOB 2W7PA 2Z4PA 3GFZA 1JJ2R 2RRNA 3GCWP 1RT6B 3FDSA 1RHMB 3Q2TC 1YVFA 3DDNA 2Y0SD 2DNLA 5KT4A 2KXFA 3J81j 4MK8A 2B51A 2XI3A 2WONB 1HBOB 2JEIA 3AD8C 3QGHA 3L3CA 1U1KA 2V2VA 3VAGA 4JV1A 3PO4A 5C2GA 4WYLA 4DI6A 4K4YA 2ZDOA 3L7UA 3MTKA 1Q81T 1Q78A 2YH0A 1MWZA 2PE8A 4KYZA 2FLPA 4A8YA 8AT1B 4J9QA 2Q6CA 1IUJA 5DQHA 1JXLA 4OYMA 4LMZA 4Y3CA 5LJ5Y 2E1CA 4KO0A 2XSJB 1YJWS 1CJKA 1KQGB 2DBBA 2XMWA 3BB5A 3VR1A 1U6BA 4R25A 1JXVA 2VG5A 1Y7PA 2UU9J 3M4XA 2CPZA 3R6LB 1GXLA 4JP8A 4K4UA 2J6TA 1ZPWX 4IRDA 5KFYA 3F44A 1VMBA 2BV3A 5GMEA 1AROP 1EX8A 1OS5A 3Q8UA 5EWFA 2DK2A 2CPDA 4OX8A 3J7ZT 2RJZA 4CLTA 4DV2J 4F0HA 2HNZB 3MM9B 4M8LA 3CC4S 5F8LA 3MUTP 2ADBA 1XTZA 1UJ6A 1UW9A 2Z56B 2W8KA 2RUSA 1U25A 2WRMA 3DLGA 2AD9A 4CM2A 3Q86A 5C24A 5ITHA 3W60A 2R9LA 3FRYA 4GKJJ 3I0RB 2FJWA 2F8EX 1XMOF 4RBUA 3LALA 2KM8B 2ZM6J 5F9LA 1UWBA 3A8JA 1R7IA 4BDPA 4K59A 5GAGI 3PKMA 4DUYJ 2RS2A 2OO4A 4TQRA 3JSMB 2O3DA 2BM1A 2MZSA 5DGBA 1V3RA 1MG7A 4PR6A 1YBUA 4C8ZA 4F4WA 1S1XA 1VC0A 2F8HA 2MKJA 4A8MP 3MEGB 2IRUA 2G4BA 2CJXB 3H0PA 4YB7A 1BQNB 5KG2A 2C2KB 3LANA 1VQOS 3OTOF 2XM3A 2AGQA 3CJ4A 2BVZA 3O44A 1RDRA 1RYRA 4WKRA 3GIJA 1S1WA 1ZTTA 2RDDA 1U0HA 2BEFA 2GA7A 4DX8H 1WEZA 2QA2A 1X4EA 5BR8J 3W8GA 4GC6A 1QSYA 3QJJA 1FJ7A 1RUSA 4IFYA 4C4WA 3FK4A 1S59A 4KFBB 1J27A 1R27B 2AYGA 3H5YA 4B9SA 2XGPA 3I32A 5HROB 1AZSA 2LU2A 1VJQA 1VIOA 3RG6A 4D3HA 1LK7A 2R7QA 1WJ9A 4P10A 3TJ9A 3TYTA 3KTQA 1B70B 4F2SA 1HI1A 2HNYA 3MAAB 1D8ZA 3BO4A 4UOCA 3C8YA 2R8KA 1XWLA 3M8PB 1Q53A 2YKNB 2PIIA 1AA1B 4Q0BA 3GV7B 3BJYA 2RT3A 3T1YF 3WQPA 1NZ8A 5BXIA 2OEJA 1F1BB 4NEZA 2L9NA 2FLOA 3S7RA 3RW6A 3MR6A 1HNIB 5L8RC 2K06A 5LMNJ 1RADB 3R1HA 2J5AA 1H98A 5ETRA 1U1PA 2FIUA 3KOAA 4LFAJ 2YH1A 4NYOA 4RW6B 1GMUA 1F2HA 3N28A 4X4UA 3CJ2A 3PV8A 1FRHA 4WZMA 1ACMB 3SSRA 5KG0A 4FF3A 3EPGA 5KFIA 1Z2LA 4M1KA 2ILYA 1WSRA 4LFCF 3BKUA 1U6FA 2MHEA 3GYGA 4J9LA 5KFOA 3NL0A 4RLEA 4V1Ak 2ZZNA 2QT7A 3BQ2A 3HFZB 2BE9B 5HJXA 3RGIA 1RTDA 3EICA 4NI2B 3PEJA 3DRYA 4Z2XA 2MLXA 5IFMA 4DR6J 2DTJA 5EWEA 2EI5A 2X7IA 2FVRA 1NNDA 2P9CA 4ZPVR 4RUAA 3RTVA 1DTTA 3FMWA 4LR8A 1RT1B 3CJ0A 4PUOB 3H98A 2K3IA 5HP1A 1MROA 4JI8F 3OVSA 2ZOGA 2VFSA 4MTPA 2MZRA 3KK1B 1TKTA 2XLIA 3EPIA 2YY3A 3NGUA 1WACA 3PX0A 2GS8A 2IRYA 1OYDA 2MKIA 2N7YA 2DHGA 4C7QA 3LH2S 1HFEL 3THTA 2UUBF 4B3MF 5IM0A 2XNRA 1R6YA 3M8SA 3LA0A 3CCSS 2FVPA 4DV1F 3IWLA 1ZZNA 2CQBA 4B9UA 3C3LA 4BWMA 3DLJA 2XLKA 2KT3A 4ZVPB 3IG1B 4K7QA 3GIKA 4DU8A 4OLOA 2JC1A 1RGVA 3M2VB 3R97A 1N5VA 1FVSA 4ECRA 3OHAA 3GJTB 2DGVA 1PG5B 1S0MA 2IM3A 4USMA 1NJXA 1DRZA 5A6WA 3H2UB 1YJVA 3MUVP 2XGQA 5BJRA 4QPTA 3CJKA 1TK5A 2M2BA 4JI7J 1PJ5A 3LTOA 1UZHA 3SV3A 5LSLA 1QUPA 4WJBA 1FXLA 3AJDA 3N6MA 1GEHA 3CDUA 3OXGA 1TMMA 1CJTB 3IR6B 4O0NA 1FNMA 3H2VE 1F5CA 3UDVA 3MMAA 3C19A 2LA4A 1PAUB 5J2NB 1DQ8A 2DB1A 4XDDA 2GQCA 3MEEB 4F67A 5E2QA 4RUHA 2RSQA 4IFVB 1YHQS 3BKTA 4CQ1A 1UFWA 3OSPA 2CJAA 5CCLA 3MAQA 2HZAA 2ROGA 4O44A 2B43A 3G9CA 3GP9A 3UD4P 1SXLA 2CJBA 3QZ7A 1O0PA 2HQDA 2KYXA 1ZOTA 2M0GB 1VYAA 5GAHU 1IBLF 3I9V9 3BBBA 4GO7X 1V9OA 1WNEA 2KRRA 3HKZD 3L09A 1C1CB 3UO0A 4NXNF 3LP0A 4JI5F 2D7SA 3FSYA 5B7WA 2E5JA 4ZCIA 3L95X 4KV8A 2HWTA 5H9EK 1J2VA 3ZZ0A 1YLXA 3ENVA 4C8MA 2YWGA 1PYSB 3PW4A 3K58A 2BANA 1HWUA 3RAMA 1FVQA 4IO9Q 2C2RA 1RT2A 1K1QA 1FKOB 2LEBA 2AZ3A 5J1NA 2KJVA 5JXSA 3BSCA 2AV5A 3H90A 5M2PA 2VG7B 2RE1A 1ZA1B 1EKRA 1N54B 2AKWB 4C48A 4ITSA 4G1QA 1JLAA 4IG3A 4PXBA 3NLCA 4OI0A 1ZA2B 2FY1A 2ZVIA 3PNIA 3UCUP 3KLIB 3TNVA 4CLPA 4XIUA 3POTA 4OHVA 2YKAA 3P3DA 1YITS 3TAQA 2HHHF 2QLJB 3Q24A 5M2RA 3W64A 2UV8G 2DCLA 1SL2A 3G96A 4F3QA 3TX8A 3B78A 2V5HG 4U7UK 4OX9F 1KTQA 4BS2A 2B4UA 3HVTB 1AT1B 3M30B 1X4CA 2JRSA 2Z2YB 1IQTA 1NSQA 2R7SA 1YJNS 5H9EJ 3T6BA 3R5CA 3KUEA 2LXUA 5J2PB 1W25A 1JKHA 3IS9A 2MQOA 2HFUA 1JNRB 3LQVA 3THVA 1B7YB 3BREA 2MXYA 4J9SA 4J9OA 4O3OA 1P9QC 1VBZA 3UR0A 1KTVA 1WHVA 1HD0A 1U0SA 4ECSA 2GGPA 1RABB 1VQLS 1JLEB 3UW1A 2VDIA 3QQCD 2CWXA 3T5KA 4IKAA 3W9IA 5D8HB 3GB0A 4ZS6A 2WBRA 1GX6A 2DH8A 4NLSA 2RAQA 4OI3A 3PW2A 2PMZD 3Q22A 2QN6B 2LQJA 2QLBB 4YOEA 3J81Y 1LWEA 2UUCF 5AXMA 1TKDA 2O66A 1GMVA 4W4MA 1K0VA 2D3ZA 2HMIB 1TP7A 4J5OA 3OR1B 3X1LB 1O6XA 5E3RA 3M05A 3TVZA 2XS2A 1HNVA 4NZ0A 2PO4A 1GMWD 1WORA 4B9LA 3PXGa 2EKYA 1NK8A 1NK7A 2AYBA 4RW4A 3T19A 4O23A 2ASLA 2UP1A 1UA1A 1V5IB 5ETQA 4DN9A 1REGX 1O51A 2Q79A 5J2QB 2Z2ZA 5CYQA 4AXJA 4DR7F 4DR1J 4NZ6A 4F3MA 3N5FA 4G1PA 4DSJA 1N5YA 4WFBQ 1RT4B 3FJ2A 2K7JA 1RAIB 4YHHJ 5M2UA 5DS7A 3BF4A 3EGVA 3BSOA 2XO6A 2OPSB 1NDKA 3PDNA 3I0SB 3D68A 1QVGR 2XBPA 1SC6A 2CNOB 2ZBQA 3AD7C 2OIHA 3TI0A 1F60B 3HHDA 1VQNS 1PYTA 1SIZA 1SV5A 1PILA 3KK3A 2XY6A 5K8NA 2VOOA 1E6YB 3KLGB 1VBKA 4I2QB 2KYZA 4NA1A 4KGKA 4P2XA 2R2SA 4DU7A 2GX8A 5G4DA 5KFAA 4RR5A 2F4VJ 1TTHB 1HYSB 5E0OA 3ULHA 2QX0A 1S1VA 4A8FA 3BBFA 4D3GA 2RKIA 1XMQF 2ZZMA 2DNRA 2Q1LA 4IRCA 4JI0F 3V81B 3AFGA 2M8HA 5HAOA 4ZVFA 4ED4A 1WEXA 2VA3A 2E1RA 4JI2J 1WC5A 2AJFE 2ZH1A 1HMVA 1S6PA 2WSCC 3RYLA 2EFVA 3EZOA 2VPZB 1YSJA 2MTLA 2AJ4A 5L1JA 1FD2A 4NRTA 2ZNYA 1MMLA 2KH9A 3QBCA 4ILLA 1ZAWA 3CCMS 3EUNA 3HK2A 3UN3A 3HX9A 3SCLE 3W65A 2UXDF 3Q8QB 3PHEA 3OJUA 2XSJA 3NGSA 5THWA 3N5BA 5FIIA 4DF8A 3VGSA 1JLCA 2XHCA 4C8YA 1T3OA 1WKLA 3C16A 4TYBA 4XPCA 4AL5A 1GX5A 2QA1A 2FHJA 2NQPA 1L3SA 4ANCA 4PZVA 1TL1B 2FHKA 3Q23A 2HRYA 1VQKS 1FXRA 1R6VA 4KT0C 4CP5A 3MD3A 4QWAA 4DR3F 3PEHA 2I0XA 2BXJA 3UCGA 5DLFA 1X5SA 4DV4J 5KG1A 3BSNA 3QJLA 2HNZA 5B0DA 2W8LA 4WK3A 2UUAJ 4WP3A 4ZPBA 4OQJA 1KWMA 3A3NB 3DN9A 3AA9A 1NDLA 1HWKA 1YI2S 2CZ4A 4A8KA 3NRBA 1IBMF 1VRQC 2WVDA 3CT9A 3N6LA 3OL6A 3GSIA 3FCHA 2G1DA 4YDXA 2QMXA 1WG1A 2BQ3A 2L48A 3TEHB 2B0GA 3DGVA 3KUHA 3SDEB 2B8PA 1OY6A 2I38A 3QPIA 3FBEA 2VONA 1JMTA 1S1TB 3C6UB 5D4NA 4DFMA 2HBYB 3R3TA 4O3SA 3JSMA 3LGMA 4NMLA 4U6PA 2FHMA 2HBRB 5I3UB 3OSNA 3HDSA 4UUWA 3WX4A 1FCAA 4OZJA 2MQQA 2FVCA 3EDQB 4TQSA 1BQNA 3FGVA 3CDAA 2PFDA 1OQ6A 4C8OA 2R8JA 1X60A 3TP2A 3GJRB 2KZMA 5DDPC 2D3OR 4N8OA 2F5GA 3TX0A 1RBOB 3QWPA 3LP2A 2GJFA 3C66A 3ZFVA 2DRBA 2QIFA 2UU9F 2P2CB 5KFXA 3IM8A 1WC3A 4W92B 4ID5B 2XZDB 4DR2F 3MPDA 1KNZA 4KFBA 1ZH5A 1TVRB 3PW0A 1RA6A 2CJ9A 2FZCB 2G0JA 4TYAA 3G8QA 4GKKF 2FYXA 1NUEA 2KJWA 4DV2F 2A10A 4NLQA 3R5GA 2J7UA 4ZITA 3FCVA 5K20B 5AT1B 1RCXB 2XMAA 3CEDA 1CJUB 1LXNA 3OFFA 4FN5A 4BCAA 2EG2A 4FYYB 2BJ1A 4NLYA 1U1MA 1FE0A 4ECZA 2BE2B 2LA6A 3M8PA 1S0OA 1VHFA 3HM9A 4GKJF 2YQ0A 5A0YB 2C22A 2UUWA 3ELHA 2RU3A 3OLBA 5I4MA 2GJIA 2DO4A 1CJVB 3MCMA 2GO8A 2MSSA 3AA8A 1CC7A 4QOTA 2OUGA 5C42B 5L1KA 1N36J 4KB7A 1HNIA 4LRDA 1JJ4A 2XS5A 1L5UA 2H5JB 4CTAB 4DUYF 4USUA 2QMWA 3KLVA 1RACB 5GADU 2HWIA 4XDCA 2CNLB 2QRRA 1JNZB 2B9EA 2YVSA 1C1BB 1RK8A 3GYXB 3BSAA 1N56A 5CAAA 4RNHA 5IZHA 2XI2A 1DLOB 4R8UB 4RW6A 1RT5A 3ITHB 4USKA 2YKOA 2V63A 3WBZA 4L76A 2RQ4A 5KT6A 2W2PP 1XNQJ 2ZC4A 2K8GA 3JQKA 3UPFA 2OJ3A 3DRPB 4JI1J 2OMOA 3TUPA 2A6MA 5BR8F 2AGPA 2AIRB 3T1HJ 2MQ8A 3CJTA 3JTNA 4ZCLA 2L3MA 4NI2A 1O5JA 4FYXB 4HDGA 5IS2A 5CYMA 4LF7F 4YY3F 2AF6A 1Q16B 2JX2A 1UKUA 5ETLA 2DJWA 2RRAA 2HQ3A 4Q44A 4CNZA 4PUOA 3PW7A 1B3TA 2NUUG 2QE5A 3AT1B 3DRSB 5HN0A 2AYEA 3QZ8A 2CIMA 1OO0B 3VGVA 3DOLB 2C42A 1S9GA 4RNMA 1RWPB 3Q0AA 2ZITA 4A8OA 3PIOQ 4NCGB 2ZOMA 5K8OA 2OGUA 4KRWA 5HLFA 1EIYB 4ZPAA 3ZTOA 2HWHA 4UTGA 1S6OA 4B3TJ 3CCQS 3K89A 3NCRA 3I31A 2H5EA 2L9DA 1FFSB 1YJ9S 3J7YI 2CPYA 1Y3KA 3QYYA 3I5AA 1NAQA 5LMNF 4LF5F 3FQKA 2P5VA 4UZCA 3MM8B 3U27A 1NK5A 3HJVA 3ISZA 3G6YA 1WSVA 3IG1A 4M5KA 2QC3A 4I64A 3FBCA 4LFAF 1NB2A 3BM7A 4LF6J 4CT9A 1R0AB 2POKA 4C11B 5D77A 2R8HA 2QLWA 4KH0B 3CC7S 1EQMA 1HQ2A 1OY9A 5LMUJ 3CJ3A 2YWWA 4PQAA 2Y9HA 2RU9A 4WXOA 4DPYA 4N47A 3T5HA 3TUIC 4CLYA 3OVAA 3NS7B 2U1AA 1CJTA 2G0IA 4HHUA 1Y5LB 4F3OA 3NBPB 5J2NA 3TUJC 2DISA 3MEEA 4DR6F 3TUZC 2OAUA 3UDLA 4G1IA 1WF0A 2RDJA 4IFVA 2W9AA 1PJ7A 4FZVA 1B4SA 1S7HA 1T9YA 3TRGA 1NJYA 3KK2B 2P9GA 3OD2A 1HQEB 2RQKA 2HBZB 1GAOA 1NU4A 3BH6B 5DG7A 4LBPA 5FDLB 2VQEJ 4XTTA 4DV7F 2HLUA 3IRWP 1GXUA 3HVWA 1C1CA 2DGSA 3BZQA 3H5SA 3HULA 6FDRA 3MEKA 2H51B 2AWZA 4N56A 2LECA 2CPIA 3E01A 3T41A 2I5JB 3V6JA 4QYZK 1WD6A 4N5SA 4LF9F 2JEJA 4ETZA 3M9NB 2IFXA 2XG8A 2DNOA 2PI4A 4F36A 2DO0A 2FDNA 4QCLA 2VG7A 2R4FA 1KVKA 2E5IA 2IBOA 1X9MA 3TAMB 2MDAA 2F7VA 3M6UA 2FLNA 2YNFB 4FYVB 2K7KA 1DZ5A 1U1OA 2H65B 2D41A 1ICEB 2BYCA 1URRA 3PCOB 1OYEA 4R5PB 1RT7B 1WF2A 4USTA 1IBKJ 2HK2A 4WXWA 2CUYA 2KT2A 3CCES 3NNCA 2XMKA 1YIJS 9RUBA 5EDWA 4FXDA 2DNNA 1T05B 3D6HB 3HVTA 1X7VA 3FKBA 1MU2B 2WZ1A 1M90T 3CCVS 3G82B 4C3KA 4HL9A 3PYEA 4DPUA 1S9EA 1NJZA 4C0HA 2BQRA 3MOJB 3MPYA 5CYJA 2H4YB 3GV8B 2VG6A 1OSCA 4WCEQ 4QYZJ 2G0CA 4P6QA 1N32J 1U1RA 1RTIA 3QMQA 1LV5A 1WTFA 3CCTA 4NASA 1R0CB 3QLHA 2ZH4A 3MFHA 2NSCA 5HANA 2MQMA 1YBTA 4FXVA 3RB4A 1SJ3P 5D3GA 1XR5A 1JLEA 3GYNA 4JI4F 5DJBA 3G87A 2X1BA 3FCWA 3Q89A 3FSXA 5F3ZA 1KKHA 4YB1P 2LLZA 3IA0A 4NLGA 1FI4A 1RKIA 1HPZB 1AB8A 2L08A 3SBMA 3KKFA 1S48A 4RNFA 2RHQB 3W61A 2YQ3A 2BOPA 4F4KA 3E8OA 3BDPA 2QFJA 3HSGA 2V2QA 2HMIA 2DYAA 1PCAA 3OR1A 4YUDA 3M8QA 1X4BA 2UVRA 2GW8A 1U24A 1SC1B 4OZ0A 1FX2A 3HZEA 4JI6J 3ENQA 4EI2A 1UEKA 2E9TA 3W9HA 5HJYA 2RS8A 2BACA 2N4CA 4NOHA 3D1HA 2VL1A 2V4JB 2PI5A 3UVJB 2KVIA 4NE9C 4PG7A 5CCMA 2F9DA 1H7XA 4BBYA 4H54A 2COLA 4OZ2A 4GO5X 5AXKA 4WF9Q 3F56A 2HPUA 3BBCA 4B3OB 3CMES 4NEYA 4YP3A 4C3MA 3FZ2A 3IBCB 3ZTPA 2WVEA 1Q4RA 1RT4A 1NMEB 3EXCX 1UMJA 4ED8A 4K4WA 2VH7A 4PABA 1J5OA 3PVXA 3J7A1 1BQMA 3EJMA 3D66A 1VQ5S 4CLZA 5DETA 3PTWA 4ZCMA 1UVLA 3JAMY 1S12A 4C6AA 1I94J 2M52A 1E6YA 4KKOA 2UVVA 3HHEA 5KG7A 4C0OC 3ILLA 5MAOA 4I2QA 4LRFA 3O5TB 5GAEU 3RRKA 4KE5A 3DGPB 5F8MA 3D0GE 3BGUA 2PMHA 3RBEA 1J5EF 2VUGA 4ZVGA 3GFYA 4FVCA 1LFPA 3SQGB 1LW2A 3PACA 4MKAA 2OFHX 4FKXA 4QWCA 4F02A 2ABYA 5D4LA 1SKRA 3V81A 3H59A 2J9EA 1QY7A 4O4GA 4EYIB 1JLGB 1TL3B 1NKCA 3M6XA 4QIEA 3MEDA 1P9YA 2A1BA 1UEUA 4E0DA 1Q1KA 2HQFA 2XYHB 1XR6A 4JV5J 3K5NA 3MXHP 1KQSR 2HS0A 5G0RB 1O8BA 2DNQA 4ZOSA 2OEMA 2QO3A 4RWWA 3MECB 4HKQA 1TAUA 1RWMB 3NCPA 2DXDA 2X1FA 2ASDA 2BKPA 4P74A 5KFMA 2GO9A 4AL6A 2RDIA 4EBCA 5HBMB 3TJ8A 3PM9A 3D1OA 2J0XA 2R2RA 1C0UB 1VQ6S 4OYXA 3R2CJ 2J7KA 4JYAJ 1T9VA 2LMIA 2MYFA 1OPIA 2UXBJ 2JEFA 3DLEB 4F04B 3WIUA 4DDFA 5B0AA 1CBKA 3D6MB 1SB6A 3NNAA 2CAJA 1TL1A 4CLKA 4LREA 4XO0A 1N5QA 2GAGC 3HVRA 2XWYA 4EMDA 5FJ4A 4HYKA 3UDCA 4E2FB 3VZHA 5IV3A 3OTBA 3P5TL 1YGYA 5KFKA 4NYZA 4J9MA 2DKOB 4Z37A 4FS1A 3M32B 4Q2LA 5T41A 4FBUA 2V68A 2YNIA 5KFSA 3D4JA 4CH7A 4U96A 4JBCA 5IOLA 3TEGA 4MT1A 2JFKA 1CULA 5A2QU 2BABA 5KFTA 2DGUA 4LFBJ 4MYUA 2B9XA 2MJUA 1UVIA 1IKVB 3KUGA 2UXCJ 5E3QA 5F0WA 3JS9A 4WP9A 2O1PA 2DR6A 3KLFA 2PD1A 4F25A 3R7SB 4HI1A 2ZUAA 5LXYA 4OYBA 4EO8A 1S1TA 2EXUA 4PWDB 5EHHA 3C6UA 3JYTB 4UY8T 4DV6J 3I6PA 4P71A 4LVNP 1SPBP 2V94A 1HQUB 2YWKA 1WOSA 4LF2A 1HNXF 2MZJA 3LAKA 5D78A 2RH3A 2ZJRQ 3ET6B 1XBWA 2GVZA 2NXNA 4DX5A 3IWNC 4IUFA 1AFJA 5IQ6A 1NO8A 4KHPF 3HHLB 4FVMA 1FA0A 4I69A 4LRCA 4IG0A 4J90A 2BW2A 1SJQA 3US5A 2Y1IA 1SCJB 2HHWA 3IAM9 1B99A 3W3SA 3SSQA 5KAKA 3P49B 3SXLA 3ZC4A 1F0XA 4ID5A 4USHA 3PKYA 2VJVA 2LQ5A 1BUXA 5D0RA 3TZWA 5E41A 3OXLA 3VGTA 1VC5A 3AB2B 4J7CA 3MCNA 4X65J 1WI6A 4ZIVA 4HT5A 3UD5A 3S1TA 2W4CA 1K8AT 4RJVA 3WC0A 3DXBA 3HSZA 3C2PA 2I8EA 4ECUA 1RT3B 1RLCL 2KHDA 3BO3A 4TLRA 2CQ2A 2G9OA 3OT9A 3FEXB 1SL1A 2VD3A 3RU0A 2PC6A 3CWJA 4ELUA 2W9BB 2FZKB 1Z2ZA 4ZKAA 3KJFB 5H9FJ 3ZZPA 1CJVA 4OYWA 3CUNA 2VIHA 2MZTA 2HIYA 4FF2A 2PN6A 2EBGA 4FPRA 4DR5F 1UVKA 1S49A 2DNPA 4CTAA 3DM2B 3BV8A 5AXNA 1B64A 4AYBD 1TKXB 3OL7A 2X51A 1KLNA 4M5HA 1FT8A 1URNA 1U8SA 2YXLA 3B8HA 3HJFA 1SQFA 4X4OA 1NK4A 3NXZA 1FJEB 5KFQA 1KVIA 4ECWA 5IWAF 3CULA 1WHXA 4J9UE 1S5ZA 3JQJA 4CM0A 1VGYA 1VBYA 1XNRF 4DSKA 4X4PA 3NEKA 2DRDA 2G2YA 2HNDB 5GMKa 3IR5B 1NK9A 1H73A 3TZZA 4ERDA 3IO1A 1T0TV 3TARA 1UEVA 4OL8A 1WDTA 1TL7B 5E3CA 1FFWB 3CF5Q 3QATA 2QSFA 3DLKA 3BQ1A 3FMBA 1YJUA 4V19J 1BY9A 4ZP8A 2ZBRA 4DCOB 2CJKA 3W1YC 1WG5A 3D28A 1F5AA 3QSYB 2ZE2A 1R31A 3KLEB 5JVGQ 3R5JB 2HQGA 1RWOB 1IKWB 2APOA 2I9SA 3DRSA 5JJBA 1MWYA 4NXMF 3AOCA 5RUBA 4DFPA 3HO1A 1GMWA 3TJAA 4B3RJ 2F65A 4F0KA 1CC8A 4NLWA 4DL4A 4QBUA 4NLOA 3WZ0A 2VU5A 3HD2A 4KGZB 4IDKB 2OSQA 1HNWJ 3U1LA 4DUZJ 3T1AA 4HI2A 1N36F 3DRRA 5AE1A 3V4IB 1ZM9A 5B09A 1JLFB 2YKMB 3IFEA 3H42A 1S79A 4W98A 4M5NA 4DL0C 1HBMA 4F2RA 4KJIA 1CG2A 4C11A 4QJVA 1UJ5A 4J9KA 1N5TA 2HQCA 4LQ9A 5FD1A 3OJSA 1G7CB 4Y2KA 2W4DA 5HQMA 4I6YA 3A8IA 1HBUB 2R7XA 4LJMA 4DQSA 2RIJA 1H72C 1U1NA 1RBAA 3WHIA 3J80U 1NKEA 4I56A 1IKYB 3A13A 2QSWA 4XAKA 5IC6B 3F41A 1NPKA 1BHNA 1YX2A 5KG5A 3OLAA 1LWCB 2GHWA 4ECVA 4X62J 4H4OB 5KT7A 4B9NA 2M5YA 4ZPTR 4RW7A 3KK2A 1HQEA 1N8RT 3QIPA 4P2SA 4ZIWA 1FNOA 1I51B 1FKPA 1QLNA 3CB4A 2AQ4A 3PJWA 1UZDA 1QAIA 3CCWA 4ICLB 3G6XA 3ADAC 3TWZA 3H5UA 1FE4A 1RLDA 4ED1A 2J6UA 4P2FA 3M7VA 4B3TF 2UV8A 1CSJA 2DH7A 3CMQA 2HS3A 2I5JA 4ED3A 3K57A 3UCZP 3KG0A 4DF4A 3V6KA 1LK5A 1BD6A 1LWFA 4WIIA 3QRRA 4GRSA 1N4LA 2MGZA 2AMCB 4LVOP 1PKUA 3DI6B 1K73T 2AX0A 3NY0A 2BBEA 2Y8WA 4GC7A 3VQTA 4ZHRB 2B5JB 1B0PA 3DU5A 3KNAA 5GAGU 3EX7B 4BWJA 2ZH2A 2C3UA 4OJHA 3V6DA 5FLXY 1PJ6A 1EETB 2DNKA 4DL3A 1UW4A 3DDKA 4O4RA 4R5PA 2DY9A 5E33A 4ZVSB 2LYVA 2CYYA 2KFYA 3EZ5A 1WC1A 1T05A 2P8IA 5KFHA 1MMDA 3E3XA 3I5CA 3T9NA 2OPRA 4HT7A 2QV6A 2I2YA 4LIRA 5AJ3F 3VAHA 4JI3J 1EQ0A 2YPYA 4GVBA 2BRLA 1NLKL 3LP1B 4CRJA 4Y00A 2VOPA 5DLGA 2I6WA 2W24A 5HMZA 4LF8F 3MMJA 4ZLNA 2KU7A 4M5DA 3KJQB 2ASJA 1Q86T 2CQHA 2IDEA 3W7BA 2U2FA 2C3OA 4F4YA 4PXDA 2PA8D 4CDIA 1S0VA 3IWXA 2HG4A 1RAHB 2CZVC 1SUQB 1TL4A 4DLGA 3GE9A 2VF3A 1D1UA 4M5LA 4IH6A 1AFIA 1RE1B 3L4BC 4ANDA 5DQGA 3GFHA 3M2UB 1PC4A 1PYOB 2XB2D 3OL9A 2E9ZA 2J8SA 2MZ1A 3D3BJ 1BGXT 2IDLA 4ZJOA 3OXFA 2RHSB 2O01C 4DQRA 3CO0P 3AH6A 1T9UA 4NLPA 1ELOA 2GJ2A 4DFJA 3HPOA 3OTOJ 4ELTA 3AQPA 1RAJA 4KO0B 3IR7B 4KBIA 4ZVQB 5CD4A 3HF5A 4J37A 2CQ3A 2BR0A 3OTEA 2VG5B 1WHWA 2D74B 3EWGA 1ULRA 2V4JA 4L75A 3W9JA 3UVJA 4P73A 2DGXA 2VQFF 5F8IA 1Q82T 3HD1A 3W2VA 2EPIA 5I42A 1TKZA 3CIZA 3MM7B 3ENAA 2ILZA 2XHWA 1X5OA 2ZDPA 4B3OA 1KP6A 4QR1A 4DEZA 1YKWA 3W5ZA 1FDDA 3EE3A 4JV0A 2VICA 2ZVSA 2FTRA 1EJ7L 3DLGB 2VASA 4KGVB 4OHWA 5KFPA 4YB5A 5DDQC 4TXSA 3W62A 5C24B 3KJVB 6FD1A 1U2RA 1OJ4A 2FJAB 3LO3A 2AJ2A 1NJIT 2DR8A 3QFHA 4DPXA 4RU9A 5IQQA 1EP4A 3UN5A 4Z7YA 2BRKA 4M5IA 4CLUA 2PEHA 3SI8A 3DGPA 2OPPA 3R1LA 2FPHX 1FF2A 2V4RA 5D15A 2JVOA 5E5NA 2EC2A 1JWWA 1G4CA 2DPJA 2WSFC 2Z8QA 3MM5A 2NR0A 4OIXA 4RKUC 4Q7AA 3MZIA 3QO9A 4U7CA 5LSRA 1TZ0A 6AT1B 2XY5A 5JMNA 3GMGA 3BYRA 1RHUB 4UOGA 4LBHA 1JLGA 1VRUB 2KI2A 4ZVUB 1F5BA 2ACMA 2HVZA 4LFCJ 4EZ6A 4B3SJ 1U0HB 2BKOA 5ETTA 5KFRA 3EM1A 1RZMA 4OZ1A 2R2TA 1C0TA 5G0RA 2HVIA 2HGLA 1YJ7A 4ANEA 3MECA 4OYZA 3TANA 4WYWA 1RHQB 1FX4A 1YZ7A 1LW0A 2ZNZA 2B3TB 3KFWX 2JDJA 1AZSB 2B6AA 2FHOB 5HBMA 3E51A 2Z2MA 3W5XA 4MFBA 3VAMA 1S76D 1UJ4A 1YRTA 4K2JA 2BQUA 1C0UA 1HARA 2F1FA 2W1BA 2YX7A 3CC2S 1DQAA 1Q8BA 3AXKA 1SJ1A 1HNZF 2HYIB 5IT9U 2HNYB 3AOAA 4CYUA 1Q8KA 1DQ9A 2BKNA 1Q7LB 5HMYA 1YBAA 1K44A 1N33F 3WX8A 3DYAA 4ECXA 1R89A 2HFOA 3D9BA 4B17A 3PJ9A 3R5BA 1NZAA 2DNZA 2IA0A 1QVFR 3HT0A 2LQBA 2QG9B 1F9FA 2GAHC 1ZPVA 4OLPA 2XTJP 4IR1A 2QL9B 1UPMB 2L9WA 4NX9A 2CQPA 5JUMA 2R8GA 2K1RA 3I9ZA 3FQLA 2CQ1A 5A8KA 2DH9A 1L3UA 1VRTB 5DM6Q 4M5GA 5L46A 1U2FA 1REVA 5HSPA 4NZ7A 2IPOB 4RU2A 3NP5A 2R7TA 4DSLA 2HVHA 2JWNA 4N7TA 2ASYA 5L9XA 1WHYA 2D9PA 1WTBA 2IBKA 1Y5IB 2XZTB 2E9RX 2IMOA 3M1VA 3I4PA 2CDRB 3QJPA 4PWDA 4MAKA 2C2MB 4H4KA 3HHNB 2LP4A 2MHNA 4OI4A 4RNNA 4JV5F 1KSPA 2F3JA 1UPPA 3QGGA 5KFJA 1HQUA 1Q95G 5LT5A 4DJBA 1RTDB 3BGFA 2WW4A 2BZ2A 4QWDA 2DGTA 1WG4A 1NKBA 1FO1A 5AE2A 1NK0A 4DBQA 3H4DA 3CVKA 3G71S 1TUWA 1A7GE 3HKWA 3GIMA 2V8VA 1D09B 4ZP7A 5DG8A 3HHLA 2NLWA 4CCHA 1VQ7S 4OV6A 2RQCA 1NM2A 3BPDA 5LJ3Y 4HACA 4PQUA 1MROB 1M5HA 1S77D 2HHSA 1TKTB 5IT4A 3GR0A 1IBLJ 4IR9A 2E5GA 3CD5A 1JLBB 2XCAA 2IYGA 1GQEA 4NXNJ 4JI5J 2VODA 2MKYA 2AGOA 3DRXA 1HW8A 3AAWB 3SFGA 3GSDA 2B4PA 5KFUA 4QZVB 3KNGA 1HI0P 4LSLB 1UFKA 1NXIA 2ATLA 1VQSA 4H4MA 1KHWA 3B6BA 4ID8A 1RT3A 2KKHA 4LFBF 3Q8YA 1HLWA 2WB1D 3AJ2A 1YQHA 4K4SA 2CDQA 3K5OA 2W9BA 5K14A 2ZH6A 1KEKA 2FZGB 3FNNA 2X1GA 2YKPA 3EXYA 2V4QA 1Q79A 1ZYQA 1VQMS 2E29A 2NREA 4MYTA 2VB6A 2JC0A 1RU1A 2ZEJA 1SKSA 1H7WA 1N5SA 2HHHJ 1HWLA 2RRBA 5BYSA 4EGLA 2W25A 5FLXU
chains in the Genus database with same CATH topology
4WXWA 3M4XA 3EZUA 1U09A 2KT2A 1MW7A 3CCES 1N48A 2CPZA 3NNCA 2MZQA 2XMKA 1YIJS 2JLEA 3BN4A 1GXLA 1Q8IA 2ZHOA 4IOBA 2EK6A 5E3PA 1D0EA 3WC2A 5EDWA 2HGNA 4K4UA 1TVRA 4O3NA 4FXDA 4F26A 2J6TA 1ZPWX 2DNNA 2NXUA 1T05B 3CD6S 3UE2A 3HVTA 4IRDA 1X7VA 5KFYA 3F44A 1SL0A 1VMBA 2ZFHA 4AE5A 2BV3A 2NPFA 4TU9A 1MU2B 1AROP 1M90T 5F3TA 2V0NA 3CCVS 4DV4F 1OS5A 4C3KA 5EWFA 1SH0A 3HVAA 2QYCA 2DK2A 4JV2A 2L41A 3H4BA 4X4RA 2CPDA 4HL9A 4OX8A 3NG8A 3J7ZT 1S9EA 1P1LA 2RJZA 3Q8SB 2R7OA 4C0HA 1NJZA 2BQRA 3LOUA 4CO4A 5I3PA 5F41A 2HNZB 3MPWA 3MOJB 3MPYA 2GIRA 1JLQB 3MM9B 4MKBA 4WE1A 5CYJA 3GV8B 4M8LA 3CC4S 5F8LA 3MUTP 2VG6A 3PZPA 1OSCA 1PC5A 4WCEQ 2G0CA 2ADBA 4QYZJ 1XTZA 2UUAF 4P6QA 1DBDA 1UJ6A 3MM6A 1U1RA 2GNKA 2XMTA 3PIPQ 2W8KA 1RTIA 3QMQA 5HMWA 2RB7A 3TO8A 2GV1A 1U25A 2WRMA 3DLGA 3HLUA 3IAS9 4IG0B 1LV5A 1WTFA 3CCTA 3V5RA 1KLMA 3DMJA 3IN5A 2AD9A 2X3GA 2HHPA 5T7LB 3QLHA 2ZH4A 5C24A 2BE2A 5J1PA 5ITHA 4NLTA 4I7FA 2R9LA 4Q43A 3MFHA 1OPZA 2NSCA 1KQKA 5A0YA 2MQMA 4U67Q 2CKWA 1RTJB 3FRYA 3D0IE 4FXVA 4NPOA 3I0RB 2FJWA 2F8EX 1XMOF 3OUYB 1HHSA 3RB4A 1SJ3P 5D3GA 1XR5A 3EGWB 1U1LA 3CDWA 2KG0A 1JLEA 3LP0B 3GYNA 4JI4F 4RBUA 3DLHA 5DJBA 4RW8B 5C42A 2P6SA 2X1BA 3TQ1A 2FJBB 3LALA 2VPYB 3FSXA 4KR0B 2KM8B 1X4DA 5DGAA 1IR0A 5F9LA 1UWBA 5F3ZA 3WDOA 4KV8B 4IH7A 5KOWA 1R7IA 4BDPA 4X65F 4YB1P 2JEGA 2I1RA 4FYDA 2LLZA 3C46A 2CPFA 4K59A 5GAGI 3PKMA 2VPWB 2OO4A 3FFIB 2RS2A 3IA0A 4NLGA 4TQRA 2GQ2A 3JSMB 2O3DA 3M9OB 1IKWA 2BM1A 2MZSA 2FLLA 1U6ZA 5DGBA 1RKIA 1V3RA 2DR7A 3OTCA 1HPZB 2XCPA 4PR6A 2J9DA 1C1BA 2IYIA 4C8ZA 2J6SA 4F4WA 2L08A 1S1XA 3KKFA 1AXQA 1VC0A 2F8HA 1S48A 2MKJA 4RNFA 1RT2B 5DDRC 5F8NA 2ZH7A 1LXJA 4A8MP 1DLOA 2IRUA 3MEGB 4IYQA 2YQ3A 4R8UA 4DFKA 2G4BA 2VV5A 4YB7A 1BQNB 2JZ5A 2BOPA 5J1EA 2BA9A 7FD1A 5KG2A 3PX4A 2HIQA 3LW5C 4F4KA 3LANA 3VCDA 4X66F 3ITHA 1VQOS 3OTOF 3E8OA 3JTOA 3BDPA 2QFJA 4CNYA 4QW9A 1X4FA 3LPYA 2AGQA 3CJ4A 2BVZA 3ZZOA 4A8QA 1X5PA 4CZCA 2HMIA 1LQ9A 4G1QB 3O44A 1RDRA 3OR1A 1RYRA 1YTYA 3GIJA 1DURA 4WKRA 1S1WA 4YUDA 3M8QA 3TR5A 1X4BA 3K5PA 2UVRA 4X84A 1ZTTA 2ZH9A 2B9YA 2GW8A 3DRPA 4HDHA 2W7AA 2HW3A 1U24A 2E1MC 1TAQA 1QE1A 4PCQA 3K7RA 2GA7A 4DX8H 1WEZA 2QA2A 4OZ0A 4O0IA 1X4EA 4OZNA 3HZEA 4CO3A 3DOKB 3ENQA 3V4IA 1T03A 1FDAA 2E9TA 2MB0B 1ZAVA 2RS8A 2BACA 2KG1A 1RJJA 4GC6A 2XY7A 1JLFA 4DL7A 2N4CA 4NOHA 3D1HA 2VL1A 2V4JB 2UZAA 4PKDB 3VQSA 2PI5A 4WU2A 1QSYA 4ZMMA 3BGRB 3QJJA 2KVIA 4PG7A 5CCMA 1TR0A 4PG8A 3NAHA 1FJ7A 4IFYA 2SXLA 5EGYA 2F9DA 4C4WA 1H7XA 4BBYA 4HHJA 4YMEA 3RAXA 4H54A 2OPQB 2COLA 4KFBB 1R27B 1ZM3A 3TOQA 1N5YA 2AYGA 2KO1A 3H5YA 4GO5X 5AXKA 4B9SA 4WF9Q 2E44A 3F56A 2YNHA 2XGPA 1FK9A 3I32A 3AY0A 5EX3A 5HROB 2ERRA 1T3NA 2JH3A 3JSBA 4FNIA 2HPUA 1RKJA 2LU2A 4B3OB 4EUVA 3CIMA 1VI7A 1VIOA 1VLYA 3OR2A 3CMES 4OMFG 4OZLA 1T7PA 4NLVA 1VQYA 4YP3A 4C3MA 3FZ2A 3JTPA 2DITA 4D3HA 1LK7A 1Q4RA 1YJRA 2R7QA 1RT4A 1JKHB 3IS9B 5L38A 3EXCX 3MMCB 2C3PA 2IM1A 1UMJA 3TYTA 3DC2A 4ED8A 4K4WA 3KTQA 5IT9Y 2FVQA 2AX1A 3PR5B 3ZZTA 2VH7A 3CE8A 1J5OA 3PVXA 3DOLA 3J7A1 1BQMA 2ZHAA 3CCJS 1VQ5S 4C8KA 4GMKA 5DRKA 4F2SA 1HI1A 2HNYA 4ED2A 1D8ZA 2UUTA 3ENWA 3BO4A 4UOCA 3LWMA 4DSIA 3C8YA 5DM7Q 2CQ0A 3U7JA 1XWLA 4NCGA 2R8KA 3M8PB 1Q53A 5DETA 2FC9A 4ZCMA 2YKNB 1WWHA 1UVLA 5F8JA 3JAMY 2PIIA 3CPWR 5BYQA 2NUHA 4Q0BA 3GV7B 3NKYA 3DLKB 3BJYA 2RT3A 3H20A 2GIQA 1LWCA 5K8PA 3T1YF 2CRLA 3JSYA 2M52A 4ES1A 2GGPB 1U47A 4PWUA 1E6YA 5KFGA 4KKOA 4FS2A 1ZM2A 2UVVA 2LKZA 2WCXA 3HHEA 5KG7A 4WK1A 2L9NA 4C0OC 1RTHB 2N7CA 4U9RA 3PX6A 1E6VB 5MAOA 2FLOA 3O6QA 1QAXA 3S7RA 4PPZA 3RW6A 2YNGB 4I2QA 3MR6A 2EFQA 1HNIB 4ZP6A 5L8RC 3MM8A 3O5TB 3MMBB 5J2MA 2ZE2B 2VPXB 5K5MA 5GAEU 3RRKA 4KE5A 5SUHA 3R1HA 1FJGF 5F8MA 2J5AA 3D0GE 3BGUA 1B7FA 2PMHA 1H98A 1VJWA 4ECYA 4CH1A 3RBEA 3I55S 1J5EF 1U1PA 2QEXS 1KN6A 2VUGA 3S6EA 2FIUA 4ZVGA 3GFYA 4FVCA 1LFPA 3SQGB 3G6VA 2H9ZA 3KOAA 1LW2A 3PACA 3K2YA 3BO2A 4MKAA 4FXWA 2OFHX 2YH1A 1H38A 1R0AA 1CQMA 1TV6A 2B4OA 4NYOA 1UFLA 3ZZYA 1S6QA 4QWCA 4RW6B 2C2EA 4F02A 2ABYA 3N28A 5D4LA 4X4UA 3CJ2A 3PV8A 1FRHA 2AU0A 1SKRA 4WZMA 1L3KA 4K2XA 3V81A 3EGZA 3PFOA 3SSRA 3UR3C 3H59A 5KG0A 4FF3A 3EPGA 1S97A 1XNQF 2ZD1B 4L3NA 5KFIA 1Z2LA 2J9EA 4M1KA 2DIVA 1QY7A 2CG4A 2ILYA 3PY8A 1Z1ZA 4O4GA 4EYIB 1JLGB 1TL3B 1NKCA 3BR9A 1KONA 3M6XA 4JI1F 4QIEA 4LFCF 1DFDA 3MEDA 4LF4F 1N6QA 2A1BA 3OFGA 1UEUA 3Q8RB 1U6FA 1Q1KA 4E0DA 1HNWF 2MHEA 3GG1A 4J9LA 5KFOA 3T1HF 1HWIA 3NL0A 4L6V3 3N01A 4RLEA 1XR6A 2ZZNA 2QT7A 3K5NA 3BQ2A 2HGMA 3DRRB 3MXHP 1KQSR 2CQGA 1HR0F 4C98A 3KLHA 2HS0A 5G0RB 1R8BA 3PRDA 1RTDA 1O8BA 2V9KA 3NBPA 4TY9A 4P7TA 2DNQA 4ZOSA 3CCUS 4DL2A 3PEJA 4DPOA 2E7WA 2QO3A 4RWWA 4RW4B 3DRYA 1WI8A 1UA0A 1S1UB 3MECB 4Z2XA 5IFMA 4HKQA 4Q8EA 3DU6A 1TAUA 2XO7A 3N4WA 2DTJA 5EWEA