1M1KT

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m1kT00
2MKSA 5DDPC 5CA5A 2XNQA 3CF5Q 2YKAA 3NNAA 1X4BA 2DH9A 4C0OC 2MJNA 3D2WA 5GAHU 3PIPQ 3VALA 1X0FA 3JB9k 2X1BA 2CPDA 4J5OA 3MI7X 3RW6A 1OO0B 1G2EA 3IWNC 1WF1A 2MZRA 1SJ4P 2M52A 2ADBA 1A9NB 2KRRA 3SDEB 1WG5A 2D9OA 3CMES 2FPHX 1K9MT 1WF2A 1NU4A 3CTRA 2CQHA 3U1MA 1X4CA 2CQPA 2CPJA 3G71S 1N52B 1VC5A 1X5PA 2DNQA 3G8SA 2NZ4A 3BO2A 4YOEA 2RQCA 1FJCA 2G0CA 2DH8A 3R27A 2AYMA 2J8AA 5MLCV 3BS9A 1WHXA 1L3KA 1YI2S 1X5OA 2RRBA 3TP2A 2DGOA 2U1AA 3L3CA 2DNOA 2DGUA 3VF0B 1YHQS 1K73T 1SJ3P 2CPYA 5GAEU 1U1OA 4BS2A 5JVHQ 1B7FA 2O3DA 2GO9A 1WHYA 1N88A 3UWTA 2OTLS 3UCGA 5DDQC 5D77A 1WTBA 3S6EA 2G4BA 3VAGA 2CPFA 5HO4A 3VAFA 1SJFA 4Y00A 1ZH5A 2MXYA 2RUGA 4F02A 1PGZA 2DNPA 2MY7A 4QU6A 3CCES 3Q2SC 2FC9A 1JJ2R 2DHSA 5EN1A 3ZZZA 2LXIA 3MXHP 2N82B 1WF0A 1WEYA 3US5A 1YJNS 4W92B 3HHNB 2E44A 1M5VC 1KQSR 3FEYB 3B4MA 3VAIA 5ITHA 1M5OC 2JRSA 2V94A 3ZZYA 2N7CA 1U6BA 2DIUA 4V19X 2F9JA 2HGMA 4WF9Q 2VOOA 1QVGR 2MQMA 1URNA 3P5TL 3NNCA 1M90T 4YUDA 3EGNA 2CJKA 2M4MA 1WI6A 1KOOA 1YJWS 2CQIA 1Q86T 1H2TZ 3NS5A 1VBXA 3FEXB 2MZQA 5DM7Q 4EGLA 2MGZA 1QM9A 3ULHA 4Y0FA 1X4HA 3V4MA 1W2BR 3CCUS 2M70A 2KM8C 2QEXS 4CIOA 3P6YC 2DNRA 2CPHA 3SDEA 1OWXA 1WHWA 2KH9A 2DNGA 2HGLA 2JX2A 2MB0B 3CC7S 2CQDA 3CCSS 3J7ZT 1X4GA 3I55S 2DHXA 2KFYA 4WKRA 2JVRA 3MURP 2ERRA 1Q7YT 2LXUA 2L41A 2LECA 2G1DA 4ERDA 3BO4A 2LQ5A 1UFWA 2KI2A 2AD9A 2YTCA 1RKJA 2FY1A 1U1KA 5GADU 2LKZA 5D78A 1DRZA 2DGQA 3G8TA 2LA6A 2VODA 5JVGQ 2CQ4A 3BEGB 2XNRA 1S72S 3THPA 2KRBA 3CC4S 5BJRA 2KU7A 3DXBA 2J0QD 4C7QA 5DM6Q 3H2VE 3NNHA 1ZZNA 4CQ1A 4TU9A 2RT3A 3MDFA 2DNNA 4P6QA 4ED5A 2VOPA 3CULA 4C4WA 4QU7A 2RQ4A 2AYEA 2L08A 2ADCA 2DNHA 5LJ3Y 2I2YA 3CXCR 1X4EA 4QQBA 1U1LA 2CQBA 4RU2A 2KG0A 1U1PA 1ZZFA 2KG1A 3CCMS 1YJ9S 1IQTA 1WI8A 2K3KA 1KD1T 2BZ2A 4FXWA 3BO3A 2GHPA 1M5KC 1OIAA 4U67Q 4WCEQ 3TO8A 4WFAQ 4YB1P 1WHVA 1D8ZA 1X5SA 4WFBQ 1YTYA 2X1AA 3G9CA 2CQ2A 1U1RA 3U1LA 1RK8A 2DB1A 5LSLA 5IM0A 1PO6A 2DISA 2DHAA 3CPWR 4IO9Q 2MKKA 4OZ0A 4LIRA 5LJ5Y 2CPZA 2WBRA 1YIJS 2CQGA 1N54B 3UCZP 3Q2TC 2MQPA 3MUTP 3MUMP 1JJ4A 3MD3A 3SXLA 1FT8A 1WEZA 2XSFA 3NMRA 2M7SA 1UAWA 2MQOA 5IFMA 3VAKA 1FO1A 3UCUP 2M9KA 2RVJA 1A7GE 2XS5A 2MJUA 2E5JA 2CQ1A 1DZ5A 2HGNA 3TYTA 1FNXH 1P27B 2EK6A 4IOAQ 5CXTA 2D3OR 1VQ9S 3HI9A 2DITA 2F9DA 2X1GA 1CVJA 4PKDB 2DO0A 2DO4A 1VBYA 2KYXA 1WWHA 2JWNA 4M5DB 2KN4A 4IUFA 2BOPA 4QPTA 3PIOQ 1U6FA 3P3DA 2OTJS 2LEBA 2XB2D 1UP1A 3CCVS 3OW2R 2MKCA 2DIVA 2KHCA 2MSSA 1U1QA 1VQ5S 3NS6A 2CQ3A 2OSRA 1X4DA 1YITS 2M8HA 1NO8A 2CQCA 3VAJA 3LPYA 2DGSA 1HD0A 2ZJRQ 3EGZA 1F9FA 2MZ1A 3UD4P 2L9WA 2JVOA 3CUNA 1NJIT 3G96A 2HVZA 1WEXA 2A3JA 5GVQA 1SJQA 2MKIA 1AUDA 2N3LA 1VQKS 3G6ES 3B4DA 5DDRC 1FXLA 2I38A 1X4AA 1UW4A 2FHOB 2MZSA 1U1MA 2Q79A 1Q81T 1VQ7S 3R1LA 2DGVA 2J76E 2OIHA 3P49B 4W90B 5FJ4A 2MGZB 2N3OA 3I56S 3CCJS 1VC6A 4LJMA 1DHMA 2M2BA 1M1KT 2QA4S 5IM0B 5CYJA 1VQ6S 2ZJQQ 1HD1A 4Z2XA 4TU8A 2RRAA 2AYBA 2DNZA 5DETA 2DNMA 2E5GA 2DNLA 2MMYA 2MZTA 3SMZA 1H2UX 4CH1A 2PEHA 3CCQS 2KXFA 2YWKA 3S7RA 3K0JA 2X1FA 2MY8A 1HL6A 2MPUA 1YWXA 1R8PA 2E5HA 2MHNA 2RNEA 4F25A 2AYGA 2DGXA 1VBZA 2MQLA 1JMTA 4OZ1A 2CQ0A 2CPIA 2DK2A 3RW7A 1WG4A 2MYFA 2CPEA 2RS2A 3CC2S 1HA1A 1FJ7A 1N8RT 4A8XA 2DNYA 2LMIA 3DLLQ 1DBDA 2DGWA 1KC8T 2MKJA 1SXLA 2M88A 1M5PC 5DDOC 1VQ8S 4FXVA 2XS2A 2MQNA 2LEAA 1VQNS 2DHGA 2KXHA 3CCLS 2K8GA 1WELA 1O0PA 1X4FA 2OSQA 3CMAS 2YH1A 2HYIB 2DNKA 5LXYA 1X5TA 3VAHA 2UP1A 2RU3A 1VQMS 3R1HA 1H2VZ 4WIIA 1VQPS 5IQQA 3H2UB 3UE2A 5GAGU 4TLQA 1SJRA 2D9PA 2KT5A 2YH0A 3J7YU 2QFJA 4PRFA 1FHTA 3UD3P 2EVZA 3MUVP 1OPIA 1U2FA 3IRWP 2DH7A 3G4SS 1Q82T 1R8HA 1K8AT 4CH0S 2MZJA 2E5IA 2MSTA 1BY9A 1QVFR 2CPXA 3S01A 5H1SV 2KM8B 2MQQA 2M0GB 1D9AA 2F3JA 5LSOA 1U1NA 3VAMA 1FJEB 3N9UC 5GMKa 3MOJB 2FC8A 1WG1A 2LCWA 2MKHA 2HZCA 4F26A 5HL7Q 1VQOS 4UQTA 3CCRS 2OJ3A 2VONA 1XN9A 2KXNB 3LQVA 2RS8A 2M8DB 3THTA 1KOHA 1VQ4S 1VQLS 3S8SA 2EK1A 2LYVA 2KVIA 3CD6S 1H6KX 5LXRA 4UY8T 2SXLA 2U2FA 3EX7B 2PE8A 2XS7A 2LA4A 4IOCQ 1JJHA 4WFNQ 2NLWA 1S79A 4ZKAA 2ZJPQ 4PR6A 1VC0A 2J0SD 4LMZA 3MD1A 2B0GA 1P1TA 4TU7A 2DGTA
chains in the Genus database with same CATH superfamily
4ICLA 3KDOA 1TFYA 4DSIA 2ABYA 2HK2A 2MKSA 3FFIA 5DDPC 4LIWA 2XNQA 3RJMB 2FLNA 1RT5B 3QT7A 4ZVPB 3K58A 4I56A 3SFUA 1KQGB 5T7LB 1TR0A 6FD1A 2MJNA 2Z2YB 2ZITA 3KLIA 3VGSA 5JJBA 3IS9B 2DVIA 3H2LA 2F8MA 3LP2B 5GAHU 3PIPQ 3OHAA 4TY8A 4DUTA 5F3TA 2BOPA 2YKMA 5D0RA 2CVEA 3FRZA 3THVA 5J2MA 2X1BA 1CG2A 4EI2A 1HIYA 3IBFB 2QSWA 3MEGB 2Y8WA 1IKYB 4LFBJ 2BE9B 1NK9A 5KFCA 1HNZJ 3RW6A 3IWNC 1Q95G 1Y5NB 3IXQA 2MZRA 2FDNA 1SJ4P 2QGFB 2PEBA 4JB8B 3N6NA 4ZPWR 2ADBA 1W25A 4NLVA 3P96A 1XIQA 1RJJA 3K5PA 4KSEB 4ER8A 3LH2S 1RAGB 1WG5A 4B3OB 2RE1A 2AQ4A 1KFSA 4Q2MA 4NCBA 4AYBD 3NXZA 3H42A 3MCSA 4NLPA 1S1VA 2J7KA 2HQDA 2QT7A 2CQPA 2EG2A 2HNZA 2Q1LA 4ZP7A 1DARA 4N41A 2HIYA 5L8RC 1PJ7A 3CJKB 1JWWA 1R0AA 1HWKA 2CJ9A 3R27A 1AB8A 4QIVA 3HVWA 4O3OA 4ZIWA 2OPPA 5MLCV 2F40A 5L38A 1YX2A 2LFVA 3FZ2A 3DRRB 4HHUA 4O0NA 4JI0F 3DDIA 3SSRA 3CCWA 3QRPA 5KG6A 2RRBA 4RW8A 5SZTA 2DGOA 3AH6A 2NYIA 3FCWA 3PFOA 1AROP 2H4YB 2VA2A 1JLAA 3OFHA 2CDQA 3U27A 4C98A 1K73T 3D5MA 2F8EX 5BXIA 3SCKE 1Q0NA 4CLZA 5C25A 1S6PB 2I8EA 3IRXB 5GAEU 1U1OA 3N01A 4DSLA 4M5LA 1K1QA 1EJ7L 4CCHA 2K7KA 4JYAJ 1BQMB 3E01B 1BWEA 1UVJA 4IYQA 3MPUB 1JQGA 5F8IA 1N0VC 2EXUA 2GO9A 3UWTA 3MM7B 4DV1F 1SPBP 1Z2LA 1REVA 3GV7B 1HQ2A 2KO1A 1CJTA 3I6PA 4OJ1A 2RUSA 2YX7A 1FVSA 4I7FA 1C1CB 5K5MA 2CPFA 2OEMA 1CLFA 1O51A 1UMJA 2BJ3A 4B3MF 3UDLA 4Q8FA 2CJYB 4HHHA 2ZH4A 2VDHA 4NASA 5J1EA 4Y65A 3ET6A 2MXYA 1LKZA 2RSQA 3L7PA 4PQUA 3TZYA 2PIIA 5JXSA 2LU2A 4GO5X 4USVA 3Q2SC 4EK2A 1HWJA 3Q23A 5IT9U 1JJ2R 3RR7A 2DHSA 1WKKA 4ZOSA 5H9EK 4BWJA 3ZZZA 1NH7A 5H9FK 2V2ZA 4EO6A 2E5LJ 1FWKA 1AZSB 2N82B 7FDRA 4I6YA 1SKSA 1WEYA 3Q8VA 2BVZA 1IKVB 2OAUA 2XY6A 3AD8C 4N76A 1KQSR 4LR8A 2DY9A 3B4MA 3O6QA 1HW8A 2FVCA 5IV4A 4X2BA 1IR1A 4CH7A 4MKYA 3FGVA 2DRAA 1UW9A 3NGUA 1TMJA 4K8RA 2N7CA 1HARA 1S9EA 2P9EA 1SC3B 2XBPA 3I31A 4IO1A 1SH0A 2IC3B 3HVAA 4L73A 2UZAA 2UU9J 4JI1F 2BX6A 4PZVA 2VOOA 2MQMA 4C9DA 1JLEA 4IG0B 1Z2ZA 5L9XA 4DS5A 3OSNA 4YUDA 1FK9A 1VDHA 1LW2B 4LBHA 2IMWP 2NUUG 5A76A 1MNEA 2ZH5A 2B56A 3GQCA 2AJQA 2PC6A 5HQLA 3FEXB 1HHTP 3CCTA 2JEJA 4HH1A 1TL3A 4NPOA 4ZVQB 3M8ZA 1TKXB 2OD4A 4NYOA 4K5RA 2MGZA 2DR8A 2CVIA 4DPXA 4OL8A 4Y0FA 1QTMA 1UEVA 1PC4A 1LQ9A 3CEDA 2V0NA 2GQQA 2CJXB 1W2BR 3MTKA 3IWLA 2DY1A 2M70A 1FK9B 3ZZTA 4ZP8A 4B17A 3D6HB 3EZ5A 2AX1A 2FZKB 1T7PA 2EC0A 2GCFA 1RTHA 4P2XA 3OL8A 4YFUA 3W9IA 2VFTA 3CIMA 3F0NA 5HI7A 2CPHA 1WHWA 3GSIA 2KH9A 2DNGA 2HGLA 5BYSA 2MB0B 3CC7S 1HFEL 1NJZA 4DN0A 4CO2A 1I1GA 4C8OA 4F2SA 3V81A 2KFYA 4F8RA 2QLXA 3SFGA 5ADZA 1RAAB 3GP9A 1RQ0A 3V4IB 4MKAA 3DLBA 4X4SA 3EVOA 5D8HB 2HWTA 3GJTB 2E9TA 1N32F 3EZUA 3HFKA 2YVSA 1LW0B 2LQ5A 3TQEA 1UFWA 4NLUA 4B9SA 2BJ9A 3DLGB 4KGVB 2ZZTA 3ISND 4FF3A 1CPZA 3KDNA 3M2VB 3ZC4A 3LO3A 2Y0BB 4DFMA 3IAS9 5GADU 2EG1A 3FK4A 2VC0A 4RUHA 3OTBA 3BEGB 1M5HA 2BA9A 1X0PA 2NXUA 3OJUA 1RTJA 1VK3A 4DDFA 4MH8A 3OSPA 2P9GA 2OEKA 1YJRA 4LF6F 1NBEB 3KLEB 3M8YA 2VJVA 2D1CA 1SKRA 2DYAA 2BANA 4I64A 1BQNA 1PCAA 3D1QA 4DI6A 4QWCA 2VD3A 1NM2A 5HLFA 4FXDA 4DU7A 1NHUA 3NOGA 1YVFA 2K06A 3M2UB 5D15A 3RU0A 3VZHA 4F0HA 3T41A 2VQFJ 5DJBA 4RPFA 4J91A 2KVQE 2E66A 1HWIA 3MECA 1UJ5A 3PEJA 3PJXA 3B82A 3FJ2A 2RQ4A 3FSXA 1VRUA 2GHVC 3K2YA 3PCOB 4RW7B 2UXDF 1JLAB 1JNRB 2DNHA 4NZ0A 5FDLA 2I2YA 1S97A 1RU1A 2XMJA 2BANB 3PHTA 4OYPA 4OYZA 2Z57B 4QQBA 3IR6B 5FLXU 2WTFA 3H4DA 3VVTA 4PG6A 2BRLA 5FLXY 2N4CA 4RU2A 4USUA 1H38A 2V4JB 2FIUA 3CCMS 1IQTA 3DHWC 4I2QA 4LFCJ 4JV0A 1RT2A 1AFIA 2WZ1A 2JEIA 1Y3JA 3QRRA 4AL6A 1K0TA 3BQ0A 3AOBA 1TV6A 3UDEA 5B0BA 5M2PA 1VS3A 2IVMA 4OX6A 1M5KC 4X4OA 4WFAQ 1S7HA 3TO8A 3M2VA 1SV5A 1LWCA 3DI6B 1VI7A 1X5SA 4WFBQ 1YTYA 1HR0F 3UD5A 5AXLA 2IJNA 2UVRA 5LSLA 5K8NA 2ZOFA 2DISA 1NPRA 3QYYA 4F4ZA 2ZHBA 1RT2B 5CAAA 2MKKA 4DR2F 1N56A 1W7WA 4M94A 2EFOA 2UV8G 4PG7A 5LJ5Y 3GILA 1HR0J 5HP1A 3RB6A 1AXQA 4Q44A 1CJKB 3KK1A 3W9JA 1RAHB 3H7HB 4NLOA 3V81B 3QNWB 4KHRA 1FJGF 2OEJA 4LSLA 4K4XA 1J2VA 4PYDA 1EP4A 5ETNA 2MQPA 3Q2TC 1JJ4A 3D3BJ 3MD3A 3A3PB 2IYGA 4WKYA 4KPCA 5EX3A 5KFXA 2XSFA 3DOKA 3NMRA 2M7SA 1UAWA 3IR5B 2VPZB 4TY8B 1QY7A 5IFMA 2HHHF 1TP7A 1RWWB 2M9KA 2RVJA 2XO7A 3FQLA 1OYDA 3ZZOA 3B78A 3MR5A 2AGPA 4B9LA 2E5JA 2W9CB 2ZBPA 3BGOP 2WOMA 3W63A 4IFVB 5BYRA 1IVZA 2RF2B 5E2QA 1C4CA 1BQXA 4IOAQ 1AW0A 3WHIA 3T1YJ 3UFCX 4CLWA 2HFVA 3M9MB 2D3OR 2DITA 3IGNA 1RTDA 4JI3J 1V9OA 5U47A 2AJ0A 3HSJA 4PG4A 8AT1B 3D6TB 2F4VF 4PKDB 2DO0A 3DXSX 4ECQA 1N36F 4HTIA 5I42A 3OXLA 2IRYA 3QRQA 1XJWB 3EWGA 2HMIA 1HBOA 2HVEA 5F8MA 3IO1A 1Q4RA 3DGPA 2IVFB 2HAFA 2HVDA 1F0XA 1XR6A 2KN4A 3KXDA 1FDDA 1OYEA 1S0MA 4JV5J 3ITHA 1VBKA 3JXOA 4FPRA 4NLRA 3P3DA 1NZ8A 4H4OA 3VGVA 1NDKA 2HNYB 4OYIA 4EEYA 3MCOA 1B7YB 4KTQA 4DCJB 3OW2R 4YB6A 4C97A 5DS7A 2DIVA 4LSZB 2UUWA 2Y1JA 2C2DA 2BKOA 1HHSA 1NK4A 3SEOA 2CQ3A 1CJUA 1GT8A 2OSRA 1NK6A 3TAPA 4KFBA 4X64F 2ZVIA 1U48A 2GX8A 1S6UA 1XK8A 1RWMB 2EBEA 5IT9Y 2GVZA 1BMQB 2AZ1A 3GCXP 4K0KJ 4BWMA 5IWAF 3KLFB 4DPYA 2ZJRQ 3QAUA 5K8PA 5EGYA 4OZLA 5LMUF 1UCNA 2GS8A 1S59A 2FJBB 2ZKUA 3MEDA 2VG7B 2OD6A 4Q5VA 2L9WA 1NSKL 2DHHA 2QC3A 3ZZRA 1SC4B 3CUNA 4DV3J 1FD2A 4DL7A 1WDTA 2ROGA 3NL0A 1VMBA 2XYPB 1TTHB 5E3PA 3LWMA 1IQZA 1ZH5A 4IFVA 2ZEJA 2KJWA 3UDCA 1VIXA 3JQJA 4JI4J 5KFWA 4CT9A 1AUDA 1REGX 1VQYA 4XTTA 3H5YA 1SL2A 1H74A 5DDRC 4GKKF 1FXLA 2VUGA 3D7SB 1WC4A 1X4AA 1OQ6A 1FRMA 5AXNA 1Q81T 3GLJA 1EX8A 3CW2C 4DR6F 1VQ7S 4AQYJ 2LQ9A 1OY6A 3MPDA 3OTOJ 4L6V3 1R8AA 3UPFA 3M32B 1Y4ZB 2JLEA 3D4JA 2FYXA 4NLDA 2QE5A 1N5YA 1T11A 4IRKA 4LF4F 3GWCA 4IDKA 1SV5B 1Y10A 4CI0B 2N3OA 1ZAXA 3NCPA 4M8LA 2CJBA 2M2BA 4WK1A 1RE1B 4DL6A 1ZM9A 4CYUA 1DAXA 3AJDA 4DCOB 5I3UB 3D1HA 5L1KA 3G87A 2C22A 1JLGB 1U0HA 2R2UA 3HHKA 1VRTA 1YZ6A 4F2RA 3RAQA 2VFSA 4F3QA 2AGQA 2DNMA 2E5GA 2HHWA 1T94A 1FRKA 4OYBA 3VGTA 4ES1A 1J5EF 2V2QA 4PPDA 2VBYA 2J7UA 2DPJA 4DLEA 2Y8YA 2KXFA 2GIRA 2V68A 3ENAA 3K5OA 2V9KA 4DR4J 2X1FA 1PC5A 4X4RA 1HL6A 2YNGB 3HPOA 3R2DJ 4YQWA 5C24A 1N48A 2YXLA 3CT9A 1R8CA 1IR2A 3MCMA 2E5HA 4FYVB 4Y2CA 4UOCA 3SIPB 4DV0F 1LWFB 2H51B 2RNEA 1H73A 2W25A 4W98A 3BBCA 4ZPAA 2AYGA 5CH7B 3AB4B 2DD8S 3CJ5A 4YDXA 5F8HA 1RT6B 2NXJA 3NS7B 1PJ6A 2LDYA 1NAQA 4N56A 2BKPA 3GIIA 1UEUA 4RX6A 4F4KA 3UNGC 2DK2A 5J2QA 3RW7A 4OFZA 1S0OA 1RT7B 4FN5A 4O3NA 4OHVA 3PO4A 1GH8A 1LWEA 3DYAA 3P45B 4X4PA 1IBKF 4CTAA 1HBOB 3PW0A 2HMIB 3PRVA 1KBRA 4N47A 4KPYA 1E6YA 3I0SA 4G1QB 3Q8UA 1DBDA 2DGWA 2Z0GA 4NZ6A 1KTQA 2ALYB 2F65A 2LU1A 3OTEA 4O4RA 4NA1A 1XTZA 1SXLA 1DQAA 3D68A 1QUPA 3LAKA 5KG0A 3W9HA 1M5PC 1GMUA 3EGVA 1YSJA 3AA9A 4ID5A 2ZH6A 2XS2A 1JLFA 3LP0A 1XMBA 2GIQA 2RHQB 3LGHA 1EIYB 3TJ8A 2DHGA 2UUAJ 2O67A 3CCLS 1MMDA 4RNNA 3ZXWA 3DU5A 4LF7F 3MOZA 2V34A 4ECYA 2Y1LB 1RHRB 5K14A 4NCGB 4DR2J 2VPXB 2YH1A 2HYIB 1MSWD 1PAEX 5K8MA 3BN4A 4X65J 4LF7J 1X5TA 4KO0A 1FX2A 2ASLA 2DR6A 1P9YA 1RAJA 4LFAF 4R5PB 5CZVA 4LSLB 1YLXA 4ZPCA 1FRLA 3I4HX 2AJ1A 5IQQA 4C6AA 2UUCJ 4TLQA 2QTWA 4DR3F 3TZZA 2Q66A 2Z30B 1S9FA 2YBVA 2HQ3A 2V6AA 4JBCA 4FNIA 2MHEA 1U26A 4KY3A 2OPRA 3JSYA 3ETMA 3PYDA 4DBQA 5SUHA 5M2RA 2VC1A 4DV4F 2EVZA 1FE4A 1W2IA 5E41A 1GEHA 3BKFA 3IGVA 1R8HA 3K8WA 5DG7A 1Q82T 2C3OA 3Q8YA 3I96A 3IAM9 4B3MJ 1HQEA 1MWYA 4K4UA 2HWHA 4NEZA 2VG7A 3WX8A 4R8UB 4P7TA 5AXKA 1VRQC 1FA0A 1ZAVA 4DV5F 2BR0A 3Q8SB 3G6YA 1UWAA 2KM8B 4C8KA 1QUVA 1TL3B 2B7CB 4J7CA 4NZ7A 1N34F 4B3TJ 1RT3B 3WX4A 4DPUA 3MAQA 1PYOB 3KUHA 3MEKA 1CJVA 5KFHA 1WG1A 3PR4A 4KKOA 4RNHA 1CC7A 2VB6A 3UI3A 5HL7Q 3KHRA 1UETA 3AA8A 2HURA 2EFGA 2B9YA 3QGPA 3JAMU 2GA7A 1RHJB 3CCRS 1U6ZA 3EPGA 1MU2B 4KRWA 2BJEA 2KXNB 1PIEA 3QLHA 3C3LA 1KRPA 4NRUA 2RS8A 2NR0A 1XR7A 4OHXA 4M5KA 4RR5A 3ZZ0A 3PZPA 3W65A 4RW7A 4BBYA 1URRA 1KOHA 5LOQA 1FFSB 3T5KA 1VQLS 1D8YA 1TKZA 1C0TB 4EU0A 3S8SA 1G1XA 2A0FB 3IP0A 2SXLA 3NOCA 4DV6J 2F5GA 2KFZA 2QMWA 2ZM6J 2C2RA 2GHWA 2LA4A 4IOCQ 1JJHA 4WFNQ 6AT1B 3K17A 3UN2A 2NLWA 3N0VA 3RRKA 1H72C 2ZBIA 3J81Y 3GIRA 4PWDB 1F6TA 1JLQA 4FF2A 2XYHB 1VC0A 4FDFA 3PYGA 4JI0J 3MD1A 4QIGA 1TQLA 3ZO7A 2XWXA 5EWFA 2PI5A 2J9EA 4LREA 2AIRB 3M6VA 1TAQA 3E2EA 2AKWB 2WRMA 1IM6A 3NEKA 3PXGa 3CF5Q 2RDIA 3W8GA 4EBCA 1NKBA 3NNAA 4OZ3A 5I3UA 3NCQA 1A0OB 3NWGA 2NSCA 4WP3A 4A8KA 2RKIB 4ZCLA 3VALA 3BGRA 4M5MA 1RBOB 3DGVA 1UEKA 2ATCB 1K47A 3GZ7A 3J7A1 1RT1B 2CPDA 2HQIA 3O5TB 2IJFA 3KK1B 4J5OA 3QT5A 3NRBA 5GMDA 1RCOB 1P9QC 2C1EB 1UVMA 2UUTA 3PRBA 4NOHA 4CLFA 1ZM2A 4QJVA 4DV5J 1A9NB 4I2PB 4KV8B 1XC9A 5GAEI 3W5YA 1N32J 2KRRA 2EPIA 2B4PA 2YNFB 5E3AA 3PW4A 2D9OA 3PNIA 4F3OA 4DQIA 4X4UA 4U7UD 4F04B 4QWBA 2EW9A 2OPPB 4YN3B 4ZVOB 2J6SA 2YKNB 2HFOA 2VH7A 2JZ5A 2GMJA 1J5EJ 1FE0A 3OR2A 1LWXA 2G2YA 3B6BA 3PX4A 1T0TV 1T05B 2G0CA 2DH8A 4R8UA 2AYMA 3WIVA 2ZWOA 5L39A 2HNZB 4TVAB 2BE2A 1L3KA 3BF4A 3GV8B 1U6BA 4K59A 5J1NA 1YI2S 3GU0A 4HDHA 3OJSA 2JEFA 2IVYA 3U02A 4B9UA 4PABA 2U1AA 2CNKB 2DNOA 4YHHJ 3N4WA 4FVCA 5LMNJ 2DGUA 2PGCA 3BBBA 3R5DA 3HDSA 5D0GA 3SQOP 1GFWB 1RABB 5DRKA 4EYIB 1RZMA 4B9NA 1NDLA 1Q79A 3KJVB 1WTFA 1B7FA 5T7LA 4OZ2A 4WPAA 1CSJA 2HZAA 3W7BA 5B7WA 4OV6A 3TEGA 1N88A 1VQSA 4USIA 5DDQC 4NLYA 5D77A 2BABA 2FQQB 2YKMB 4EBDA 4TY9A 1WTBA 2QA2A 3LANA 3VAGA 3IN5A 3E3XA 4Z7YA 5KFYA 1EARA 5HO4A 2ZH8A 5GAHI 1BHNA 2V8PA 3IBWA 5HJYA 4P72A 4FS2A 2CFXA 1HMVB 3M2RB 4F50A 2PD1A 2Z2MA 2Z4PA 3OR1B 1SJFA 2QYCA 3D66A 5E5NA 4DSJA 2GZOA 4ECTA 2JJ4D 2DNPA 4B3SF 2R8JA 1RTDB 1RUSA 1HMVA 2H54B 2RB7A 2ZE2B 3AXKA 3M2RA 4O4GB 1IKXB 1LNQA 3MMCA 5LL6d 4YS2A 4RZRA 4LF8J 4P73A 4ZCMA 4DFKA 8ATCB 3NLCA 3M9OB 3C14B 1LW0A 2IM2A 2NS1B 1F2HA 3AHPA 5FD1A 4CLPA 4PYAA 3PW7A 4C8YA 1NUEA 3A3NB 3BPDA 3ZFVA 1VYAA 4W92B 1DY3A 3HHNB 1F9HA 1RYSA 1HI1A 2XZTB 2CADA 3FEYB 3QIPA 1BC6A 2UUBF 2EEYA 2XTJP 5B0AA 1EZZB 1NNDA 1U24A 4WZQA 3DMJA 4U7UK 4DWIA 4ZLJA 2VPWB 4GC6A 2XLKA 2UUBJ 4RW9B 4DOZA 3H40A 2FHKA 2QMUB 1JX4A 4WF9Q 1WSRA 4IFYB 5T41A 2KDOA 1URNA 3HLUA 2BE2B 2BKNA 3R7SB 3R5BA 4NA3A 4RBTA 1NPPA 4QW8A 3EGNA 1T3OA 2AEJA 5IS2A 2CJKA 2YKQA 2DXFA 1PYTA 4K4SA 1JLGA 1YJWS 4JV1A 1BE4A 5HANA 1TKXA 2NZCA 1XMQF 3NS5A 4F4WA 2J6UA 4LF6J 2HBYB 2KB2A 4O23A 2WOMB 5MAOA 2RH3A 2EFVA 2ZC4A 4I7FB 4DN9A 2W9BA 2J9CA 3NWRA 3G6XA 4ILLA 4AL5A 4EGLA 3CJSA 3VVUA 4IDKB 4KYZA 4OZJA 1BD6A 4ETZA 5L1IA 3T1YF 2C3YA 3N79A 5CABA 1UA0A 1AA1B 1KR4A 4Y34A 3QJPA 4ZIVA 2JFKA 4CO3A 2QEXS 1JLEB 4CIOA 3L95X 4ZK7M 3DRXA 4WE1B 3LP1A 4FBUA 4NXNF 2UXDJ 2AU0A 2PMHA 5EWGA 3CDUA 5BR8J 1N5YB 5ETPA 2NXEA 2WONB 4CLKA 2FZCB 2P9CA 5F8NA 2IMOA 2VA3A 1RWOB 1X4GA 3H90A 5ETMA 2N4DA 3I4PA 2OHDA 4GC7A 2JVRA 3BGRB 3ISZA 1HNVA 5JUMA 2DCLA 1T3NA 1NDPA 2LECA 2FGCA 2G1DA 3T1HJ 1NZAA 4DL3A 3BO4A 1RAOA 1S1TA 3UNYA 3TNVA 2FY8A 2AD9A 4EMDA 1GMVA 4USKA 3NGDA 2MQ8A 2YTCA 3AQPA 4MTPA 1NJXA 4KGXB 2UXBJ 1EETB 1CC8A 2NPIA 1CS4A 1KTVA 1WOOA 3DM2A 2XGPA 4ED1A 4D3HA 2LKZA 4QPXA 4ECUA 3KLEA 4U8VA 2LA6A 3EM1A 4DV2J 4ZITA 4U7CA 4ELTA 3CIZA 5JVGQ 2CQ4A 1NSAA 3T9ZA 1TL1A 2IM3A 1D9DA 1C1BB 3QZ8A 5KAKA 2HNDA 2RRNA 3CD5A 2KRBA 4K2JA 3FMBA 4BDPA 4NMXA 3DXBA 1UFKA 7AT1B 4J9NA 2J0QD 2O66A 1SJ1A 1SI9A 3TJ9A 4LVNP 4KH0B 4CP5A 3NNHA 3I0RA 1XEZA 4QR0A 4CQ1A 2HRTA 1U49A 1PSDA 1VRUB 2JDJA 3FRYA 2BUNA 2DNNA 1CJUB 2YQ1A 4G3IA 2D7SA 5B0DA 3HSGA 1KHVA 4Y6IA 4ANDA 3FCVA 1RHUB 5F0WA 4ED5A 1BWVA 1MG7A 4C0HA 4NLTA 3M2UA 4Y2MA 1S1WA 3HP6A 2QJ3A 1GK8A 3MAAA 2ADCA 2YNIA 4O3QA 1F5AA 5C2GA 3NGKA 4OHWA 1ZAWA 2J8SA 4QBUA 1EQ0A 1IKXA 1Y5IB 3LA0A 1RXOB 5F8GA 1LOUA 2HSEB 3SCIE 1B0TA 1Y00A 1XWLA 5IT0A 2KG0A 5CD4H 1U1PA 3R2CJ 4OLOA 1YJ9S 2W8LA 1RTHB 1WI8A 2K3KA 3Q89A 1DJ0A 5KG4A 5H9FJ 3VQTA 2BZ2A 2IDLA 3C6UB 4FXWA 3BGFA 4EYHB 3TVKA 3SCJE 3QATA 4USHA 2B5JB 3C16A 4HL9A 1R3NA 1UPMB 1OIAA 4U67Q 4WCEQ 2RF2A 4DFPA 3MMJA 2R8GA 1Q8IA 3CDWA 5F9LA 4ED7A 2E9RX 4LSNB 2BQRA 2HHSA 1FXDA 4JI8F 5CD4A 2X1AA 3BQ1A 3G9CA 1GTEA 3W60A 1U1RA 1ELOA 3U1LA 1RK8A 3OLAA 3RGIA 2IPOB 3Q83A 2WVDA 1IXKA 3GE9A 4LIRA 1KP6A 1KQKA 3OTDA 2HS0A 2L9DA 3OFFA 1HPZB 4OYAA 1YIJS 2VFVA 2FLPA 2CQGA 1YQHA 3VCDA 4ZVGA 5ETLA 1G7CB 3IA0A 1UZHA 1FKOB 3A8JA 2W4DA 3UCZP 1C2PA 3ZZUA 1RAFB 4LBPA 3BJYA 4DV7F 2K2PA 2ZBRA 4LSNA 3U1NA 3TQ1A 1RA7A 3MR7A 1RP5A 3SXLA 1FT8A 3KLIB 2FJDB 3M8PA 4CO1A 5ETVA 4QWAA 2OP5A 2MQOA 2IY5B 1DTTA 1L3TA 3ZNUA 1MROB 2PSZA 4MT1A 2MJUA 5KFPA 1FNMA 5HQMA 3CMQA 1OSDA 2HGNA 3IG1A 2ZVSA 4MIAA 1ZOTA 1FVQA 1VOMA 2L48A 4X4QA 2RMLA 3RB3A 2MEWA 4JOUA 5IC6B 1VQ9S 2ZUGA 3RUBL 2CWKA 5AE2A 2DRBA 3D0IE 4LFCF 1MMNA 2ZH1A 4Y2AA 1QLNA 1T95A 2FZGB 4ZPBA 3CO9A 1G6BA 2FGOA 3H59A 1IBMF 2DR9A 4UOGA 4PEOA 1TVRB 1ZPVA 3MPWA 5J1EB 3BQ2A 4DSKA 2KYXA 4HI2A 3T19A 5J2QB 1X9SA 1WWHA 3HK2A 2R42A 4DR6J 4DR1F 1R8BA 4XDCA 1B70B 4QPTA 2Z2LA 5G0RA 5KFEA 1C1CA 1U6FA 3PIOQ 1SC6A 1OPZA 1YBTA 3OVBA 1XQIA 4UZBA 2Y9HA 5ETQA 1P6TA 4LFAJ 2CZ4A 2GAHC 4L76A 2R9LA 3BV8A 3R6LB 3B8HA 3LGMA 5A8KB 2MSSA 3EUNA 4OYXA 3GV5B 4ECVA 4DR3J 4EO8A 1U1QA 1VQ5S 3GPAA 2FJEB 3ZTSA 1TKTA 1DQ9A 1OSCA 3FBEA 2M8HA 2AV5A 5B0GA 3R7BB 2R7VA 1C4AA 3R5AA 5AJ3J 3VAJA 4NWBA 3GIMA 2HLTA 1QDUB 1MLAA 1HD0A 3V5RA 5HVGA 3L4BC 3UD4P 1RWNB 1U4BA 4IRCA 2JC0A 1V6HA 5ETSA 1IWGA 1FKPA 1EETA 2HVZA 1WEXA 3I87A 1EB0A 1YKWA 3KJNB 4BHQA 1FF2A 2DEIA 1KWMA 2BACA 3DCAA 4FPIA 1AYEA 4KAIA 3KFWX 4M1KA 4FYYB 5L1LA 3M30B 2FHJD 3K7RA 4OZNA 2KYZA 2YWEA 4JI3F 4NLGA 1GTHA 2F4VJ 5EUHA 3HFZB 1Z4UA 2BBEA 3SSSA 5LT5A 3KWMA 4ZP6A 4CYUB 3D6FB 5BR8F 2R8HA 4EZ6A 2XI3A 3AY0A 1H98A 2BRKA 3QLHB 3EVMA 2R7OA 2FHOB 1KONA 2MZSA 3IBCB 4NL5A 2NPFA 4GMKA 3Q8RB 2VPYB 2JOQA 2M3DA 3KHHA 3V6KA 1IBKJ 3BSAA 2DGVA 2J76E 2QLWA 4XDDA 3RZAA 3GCWP 4IH6A 4WTOB 2C3MA 5DG9A 1UWBA 3Q22A 3T1HF 1HNZF 5A8RA 4FBTA 2YPYA 3LUYA 2OLWA 2MGZB 2CRLA 4LBIA 3I56S 3QT6A 4QWDA 3PX0A 1AT1B 1DHMA 1KKHA 1WC6A 2OFGX 2W4CA 5C5JA 3F41A 4WFZA 3FUYA 4FNHA 2QA4S 3BN7A 4HHJA 4F0KA 3HD2A 2ASYA 2ZHAA 1LW2A 2BJ1A 1VQ6S 1M1GA 5AE1A 1F3FA 1RT4A 4M5JA 2YKOA 4DX6A 3K57A 3BDEA 1N5VA 4TU8A 2RRAA 5A6PA 1ZETA 2AYBA 3A8KA 1R89A 2DNLA 2MMYA 3DLHA 1CULB 3MMBB 3SYZA 3TARA 1U45A 2PEHA 1RA6A 5IT4A 3NGTA 2YWKA 3SQGB 3K0JA 3I9ZA 1G3OA 3JS9A 3N6LA 2MY8A 4IH7A 1KVKA 3C8YA 3GR1A 1B0VA 2XSJB 1JLCA 2IRUA 4CLUA 5F8JA 1YZ7A 4DR5J 3ONQA 1Q53A 1ROFA 1IUJA 2UUCF 2DGXA 4USTA 4DJBA 2C2MB 1ITPA 2F4FA 1T9YA 2V8GA 2OPSA 4QR1A 1JMTA 2NUHA 3MCNA 2ZZNA 3OTCA 2XMUA 3AB2B 4GKJF 3KMSA 1I6JA 4B3RJ 3KHLA 3BH7B 3UVJA 4OQJA 1ZM4A 3EDQB 2MYFA 4ILRA 2C2NA 2W2NP 4MKBA 4Y28C 4ZJQA 3CC2S 2YX4A 1QAXA 3MM6B 4U9RA 1HA1A 2X3GA 2CA9A 4KH1B 2F7VA 2G13A 1N8RT 1A6LA 2B6AB 1FTRA 1WUUA 3O3LA 2ZE2A 3QFWA 4G65A 3F44A 4O4GA 3CO0P 4A8XA 2BQ3A 1KC8T 4U96A 2MKJA 4KKOB 2QL7B 3OR1A 4HT5A 5FDLB 3H0PA 5DDOC 2AMCB 4AE5A 2WVFA 2MQNA 4PQAA 2W9CA 2RDDA 3PEHA 4OI6A 1SKWA 1VQNS 5IC4B 3T1AA 1TK0A 1J27A 1OS5A 2P8IA 4ANCA 5M2UA 3M05A 1RT7A 4HH0A 1M1HA 5D4PA 4KHPJ 1O0PA 3WC0A 2XEXA 3E01A 1X4FA 5KFJA 2PI4A 1NHVA 1S1XA 4E8UA 2H1YA 1RT6A 4KT0C 5KFFA 1CJTB 5LXYA 4YR3A 1L3UA 2UP1A 5KOWA 3J7Z5 1WD6A 1JKHA 1T9UA 3RYLA 4DV6F 3IR7B 2XSJA 4WIIA 5H9EJ 3J7YI 1VQPS 3H2UB 5DO2A 1NCLA 4FVMA 1SJRA 4ZN3A 5HP1B 4B9MA 2XYGB 4AL7A 1T9VA 4JI1J 2IFXA 2D9PA 1VK8A 2KT5A 3DKDA 4NX9A 2CJQA 2QL5B 4CLLA 2HHVA 2QLBB 1S7IA 3W3SA 4PRFA 2M5YA 2G2ZA 4J9MA 1ZA2B 3IRWP 5KT4A 4K4TA 3PW5A 3ILIA 3C66A 2AJ4A 1HQUA 2C2EA 4JI7F 2LVWA 1BY9A 2W01A 1QVFR 5J1PA 1R0AB 3LTOA 3MPVA 2CPXA 2VG6B 1VIOA 3M8QB 3S01A 5H1SV 3QWUA 2MQQA 2EFPA 3WBZA 4O44A 3QMQA 4USWA 5IV3A 3VAMA 1JK9B 4IQXA 3MOJB 1I5OB 3I5BA 1UWBB 3TAMB 3HFVA 2VFUA 3PO5A 3Q24A 1BUXA 1QAYA 3HVRA 2XZWA 2YNIB 3EDRB 3MPYA 4ITSA 4LQ9A 4UQTA 3S1TA 3TUJC 2OJ3A 3L7OA 4GKKJ 1GMWD 1XN9A 2RD5C 1F2GA 3MM5A 3KUEA 1HBUA 3N28A 5C7PA 2VICA 3THTA 2M8DB 2VQEJ 1VJWA 5CYQA 1IM4A 2EWHA 4DXLA 1QE1B 1Y7PA 1RWPB 4I4BA 1RTIA 4JI5F 1R0CB 5HK4A 2EK1A 2GQ2A 2GAGC 1VHFA 2BXJA 3R5JB 3UR0A 1Q1KA 3HX9A 4UY8T 1LFWA 1H0HB 4LF2A 3EX7B 2PE8A 3KK3B 4LF9J 4JYAF 4HDGA 3PYFA 2C2ZB 5IOLA 3NBPA 1UVKA 3DLEA 5A2QU 4JP8A 4RKUC 2E1PA 3CJ8A 3HT0A 4QOTA 4PR6A 2QL9B 2WSFC 2E1MC 2WVEA 3C19A 4I1TA 3TA1A 4CNZA 4DPOA 5A8WA 4IG3A 4X66J 2XG8A 3DRYA 3PX6A 1HBMB 4PXCA 1DTQB 1N5TA 1JLQB 2RQMA 3QBCA 3PFEA 3E51A 4Y2KA 3HZGA 5CA5A 5LMNF 1TK8A 2V8HA 4PG5A 4QWEA 2GV1A 2YKAA 2IDEA 4QZVB 4ECXA 1D1UA 2ZD1A 4RWWA 3M4XA 2WB1D 2WVCA 3MM6A 5A2QY 3DM2B 3V4IA 4B3TF 1PJ5A 4NYPA 3V6HA 3U7JA 4YP3A 3AOCA 4J9UE 3ITHB 2QA4G 3GYXB 4OYMA 5B0CA 4KIAA 4J9SA 4OX7A 4LRBA 3RRGA 2I5JB 3RB0A 2JH3A 1IJFB 4IOBA 4YEAA 5BYQA 3W2VB 4NI2B 3VWSA 2XCAA 1S0NA 2FLLA 1G2EA 1WF1A 2CUYA 2R7SA 1I3OB 1YJVA 2LQ8A 3GFZA 4IQMA 4K5SA 2ZNZA 1B64A 4HT7A 2G2OA 2DR7A 3MR3A 4WP8A 3ENVA 2A2DA 4M5NA 4N8OA 5KG2A 4DLGA 3KG1A 2BOAA 2FPHX 2MLYA 3NGRA 3CMES 1K9MT 3TEHB 3IG1B 3M8QA 3U1MA 4MMOA 4OJ3A 5J2PB 2HPUA 4R0EA 4MIBA 2CPJA 3HHEA 3G71S 1U2CA 2E29A 3BREA 2DNQA 1APSA 2VDIA 3KK2A 5KFUA 2OPRB 5D3GB 1U8WA 4YOEA 2RQCA 8RUCA 2YY3A 1SIZA 1RHKB 2ILZA 2KKHA 2UVWA 4A4JA 4O0IA 3BS9A 1WHXA 1Q5VA 3HJVA 4QIWD 3CDBA 2HS3A 1ZPWX 1X5OA 2W2OP 3FCHA 3IWXA 1PILA 3L3CA 2DT9A 5B08A 2R2SA 1X31C 4GVBA 3F73A 3QO9B 4MKVA 5A6WA 3VF0B 3JQMA 2W7PA 1CJKA 1YJUA 1YRUA 1HPZA 2WVBA 2ZWPA 3BH6B 3ZZPA 2YWFA 1TUGB 3A3OB 4RNOA 4GKJJ 3N5FA 3EZOA 1RHMB 2JL9A 3LF0A 2G0JA 1PYSB 1UZDA 2GJIA 3DDNA 2YWWA 5GMEA 4XPEA 2O3DA 2CIMA 2B3TB 2C2OB 2XWYA 2DXEA 3T6JA 1Q78A 1S1XB 2V4RA 1TL5A 1XMQJ 2FJWA 1NDCA 4ZLPA 4K4WA 4ZP9A 2ILYA 4L72B 2G4BA 2NYHA 5DZ7A 3KMQA 1T03A 1RWVB 2DRDA 4XO0A 1XNQF 1FDBA 1TV6B 1UFLA 1X8DA 2EFQA 2Y3YA 3PG9A 5K14B 5D0HA 1UJ4A 1FFWB 4RUAA 2A1BA 3I9V9 2Q3PA 5KFAA 2YNHB 5DGAA 3O2IA 4ES3A 5DGBA 2RUGA 3NBPB 3ISNC 1N34J 1JLFB 1S76D 2MY7A 5HROB 4QU6A 4KBIA 1TMMA 1WOPA 4WYLA 3I0SB 4G1QA 5J2NB 3UO0A 4AD6A 4DCPB 3CCES 2H48B 1D9FA 4KHPF 5EN1A 5DQHA 2PO4A 5KT2A 4PQUB 2GJFA 3I32A 4ENOA 3Q8PB 1YJ7A 1YJTA 3T6BA 2P2CB 4ECZA 1YJNS 2RILA 5B0EA 2A2CA 1LWEB 2E44A 2Q6BA 3DYAB 3W64A 4QIEA 4O3RA 4U8YA 3I5AA 1EQMA 1M5OC 5KFNA 2WW4A 1OY9A 3JAMY 1PKUA 3X1LB 2ZKTA 3G8QA 1T9TA 2F9JA 4N7TA 3MR2A 3UR3C 2HGMA 1IBCB 1QVGR 5E33A 1Q16B 4JI6J 5CYQB 2ZM6F 1RDRA 3P5TL 3DRRA 4NLWA 2OELA 3IRXA 3H5XA 1N6QA 2UU9F 4WE1A 1HBUB 5I3PA 1M90T 2OPQB 4DV2F 3Q0AA 4NLXA 3GFXA 1F5CA 1WI6A 1KOOA 1HI8A 3G82B 1Q86T 1H2TZ 1UTAA 2BW7A 2V50A 3M30A 1S10A 3AJ2A 1FNOA 4CO5A 2HAIA 3DI6A 4P2FA 4ZVSB 3V2UC 3TWZA 1T03B 4DG1B 2QRRA 3D28A 4ZVUB 2O01C 1KDNA 3DRSB 1S1VB 3NAIA 3MTJA 4WWSA 2YNFA 4X84A 3CD0A 3ULHA 3VZIA 2XLIA 4MJKA 1X4HA 3CE8A 2R8KA 2OPQA 2O5DA 2HVHA 3V4MA 4Z7CA 3HCXA 3CCUS 3BSNA 1EHWA 2WK4A 4KC5A 2KM8C 3HVTA 3QGIA 4R0JA 3TZXA 4KJIA 3HHLB 1NRKA 4WP9A 3P6YC 4WU3A 1VGYA 4CLTA 1TKDA 3TA0A 2UVUA 3HSDA 2VQEF 3LPEA 4B3OA 1OWXA 4RW4A 1IWAA 4LRDA 4F3MA 2JX2A 4PXDA 4PWWA 2CQDA 3RAXA 1JLBA 4C11A 3OVAA 3J7ZT 4USMA 3I55S 2DHXA 5F8LA 4KB7A 4P75A 3OTOF 1KHWA 2ERRA 2L41A 3IS9A 1W26A 2LQBA 3HT3A 2ASJA 4ERDA 5DLGA 2E7XA 1JJCB 3OXFA 3TA2A 3Q8QB 2XHCA 4UUXA 3CSKA 2FY1A 5HROA 3T5JA 4RU9A 1DRZA 4JI8J 3DN9A 1U25A 5KFKA 1L3VA 1V3RA 3THPA 3CC4S 4MK7A 4P71A 5BJRA 4KFBB 2FLOA 3L9ZA 3ILOA 4OJHA 4Q8EA 2HBZB 4J9OA 5DM6Q 2AW0A 4I68A 1ZZNA 4B9VA 2C3UA 2AF6A 3DU6A 4LQ3A 4OI4A 2G9OA 3WQPA 2PFDA 2HK3A 4P2MA 3PM9A 2VOPA 3CULA 3K5LA 4C4WA 5KFIA 4TQSA 3DNCA 1S0VA 4LFBF 4ILMA 1GQEA 4UZCA 2DBBA 2AYEA 2XULA 4YY3J 1QSSA 5KFQA 2WB4A 4H4OB 2IA6A 3QJJA 2V69A 1C0TA 3CXCR 1FESA 4Q2LA 4CNYA 3TANA 2WW8A 2Z58B 3QGHA 1U1LA 2FVQA 2CQBA 2NXCA 4M5HA 1U09A 5HAOA 5I3QA 4QYZK 3MEEB 5HMXA 2AGOA 2W24A 3PVXA 4DS4A 2VJUA 5ETOA 4ED4A 2HFSA 5ETRA 3PR5B 1C1BA 4ZCKA 3KKFA 4B3SJ 1GX5A 1XNRJ 5KG5A 1U7LA 1WORA 2GHPA 1MMLA 2ZOGA 3MMAB 4BC9A 3KK3A 5HVHA 4K4VA 4ZPDA 1KLMA 5L46A 1D3WA 1FI4A 1D8ZA 1WHVA 3D0GE 4TN2A 4DX8H 2UUAF 4TYAA 2VKRA 2VASA 2JNJA 2DJWA 2VFRA 1S1TB 2DB1A 5IM0A 1PO6A 2CNNB 1VFJA 2JSXA 2DHAA 2V2KA 2VG5A 2YKPA 4OZ0A 3CPWR 4OHZA 2DR5A 4I2PA 1N33J 2CPZA 2C3PA 4WTYA 3BDPA 2MKYA 1N54B 4ZPVR 3D1OA 4G1IA 4H4MA 3FBBA 5K9FA 4MIWA 2Y1RI 1RT1A 3W1YC 2O1PA 1T8EA 2HHHJ 4A8MP 2ZBQA 4ZLLA 1Y5LB 1S48A 4WK3A 2KT2A 1WEZA 4CDIA 2KZZA 2XMMA 1CEZA 3BPSP 3VAKA 4A8YA 1A7GE 1Q8LA 1JXVA 1XR5A 4PXEA 1EAYC 1FKPB 5EHHA 1YGYA 3KYLA 4DV4J 1JIHA 2OUGA 3JSMA 2XS5A 3JTOA 3LP0B 4LF1A 3GSDA 2CQ1A 1DZ5A 2BQUA 4UQGA 2JLGA 3K59A 4P52A 3TYTA 5A8WB 1FNXH 1N36J 3TVZA 1OY8A 2CZVC 1R43A 4JI2F 4CRJA 2AJFE 4DPWA 3R7NB 3ENWA 3GB0A 4KV8A 2V9WA 2X1GA 3BYRA 1XERA 2MLZA 2HHTA 3ZTPA 3BBFA 2FVRA 1VBYA 2J7WA 4JI2J 5HMYA 5A8KA 2CNOB 3POTB 2GVDA 4J37A 3ZNJ1 3K89A 4OYWA 5G4DA 5AXMA 4Q0BA 1R27B 1PG5B 2JWNA 1YBUA 3HULA 3MECB 4M5DB 1LK7A 4HR2A 1BLUA 4MFBA 3ZTOA 5B09A 4J9RA 4ZCIA 2Y1IA 4IUFA 3OVSA 3TUIC 4X62J 2LEBA 4PG8A 1S57A 3RBXA 2V67A 3DMJB 4MFBB 4M5DA 2KT3A 1BQNB 3TI0A 1EKRA 1X9MA 1F60B 3H5UA 4WJBA 5IZHA 4EBEA 1TVRA 2KHCA 3NS6A 1S6OA 1X4DA 3CNQP 3MFIA 2B9WA 1TELA 3PJ9A 2R2TA 4KQZA 1YITS 1G4CA 1NO8A 2GJ2A 1JNZB 3EJMA 1SIWB 2P5VA 2CQCA 3MF5A 4RLEA 3LPYA 3ZTRA 2DGSA 3GR0A 2VV5A 5AT1B 4F0MA 1CBKA 3EGZA 4O3SA 1SH3A 4X64J 1S77D 1TAUA 1AFJA 1HWUA 2MZ1A 3PKMA 1T9WA 2VIHA 2IYIA 3QIDA 1TUVA 3L7UA 2NSBA 2JVOA 3CJKA 1JXEA 4K0KF 1NJIT 1I94J 4JI4F 2VG6A 4NXMF 1S1UB 3G86A 3C15B 4DUYF 1XMOJ 3NCRA 3DLGA 2COLA 1FCAA 3M8PB 1NK0A 4DV3F 4C8LA 2FJAB 3A8EA 3EE3A 1SJQA 2B43A 3M8WA 1LK5A 2HS4A 3ICLA 2MKIA 5T14A 2V8DA 3DDKA 2N3LA 1MROA 2IBKA 3AXMA 4RBUA 1VQKS 2R4FA 1SQFA 3ELHA 4OJGA 2D69A 2I38A 4ZVFA 3OBIA 5HMWA 4IR9A 1UW4A 4DL2A 3HO1A 2Q79A 4C0BA 4IFYA 3R1LA 3DFEA 4ZA1A 2OIHA 3LP1B 3D3CJ 3KOAA 1RGVA 3P5BP 3ENQA 1UVLA 3P49B 1D09B 3OUYB 2FVSA 1TK5A 4USJC 1TL7A 2R7UA 2HFNA 2I6WA 1HYSA 2H65B 1E6VB 3R5GA 1M1KT 5D3GA 1HLWA 3GMGA 2B9XA 3GJQB 3OXGA 5IM0B 3RTVA 4LF4J 1R31A 1QJHA 2JHEA 1NH8A 4I69A 2ZJQQ 1E6VA 4Z2XA 2PT0A 3BGLA 2GIFA 4N77A 4CWBA 4DQQA 2DNZA 4HACB 1FKAF 5THWA 3E8OA 1WACA 2IA0A 3OUYA 1CQMA 2XMWA 9RUBA 2B5JA 3CDAA 3ETOA 1RHQB 3OHBA 3S7RA 2W7OA 3CCQS 5B0FA 4TXSA 3KLGA 3QPIA 2MPUA 2Q6CA 5CCLA 4K4YA 3RBDA 4XIUA 1Q8KA 2R7RA 2KZMA 2XZDB 1YWXA 2YNHA 2KFNA 4DQPA 2HWIA 4YR0A 2GVZB 2HFZA 3UVJB 1VBZA 1WOSA 2MQLA 2YQ0A 4NLQA 4UT4A 1HD1A 4OZ1A 3GTYX 4XK8C 1N5QA 2J9DA 4C8NA 4EZ9A 3OFGA 4OI0A 2J6TA 1RAIB 2CPIA 1SQEA 2XMVA 3NY0A 4ALZA 3VTIA 1TU0B 1ICEB 1RBAA 4KGZB 5D6GA 5L1JA 3T5HA 3M6XA 2K7JA 2JC1A 4LRFA 5KT5A 5I42B 1LWFA 4A46A 4A8QA 3A1YG 1UA1A 2JLFA 2GVDB 3EICA 2KTQA 3POTA 4E98A 1FJ7A 1FDNA 1S12A 2DNYA 2LMIA 3EPIA 2E1CA 4CO4A 3DLLQ 3GJRB 2QFIA 3IC1A 4AXIA 1H3DA 2WBMA 1LV5A 2M88A 4IKAA 3ET6B 3GFHA 1VQ8S 3W2WA 1RB0A 2HNDB 2OMOA 4FXVA 5CHCB 5F41A 2LEPA 2E9ZA 1KN6A 1Q7LB 1REVB 1TL1B 5E7OB 2BM1A 4ED3A 2KXHA 3A8IA 2K8GA 2IHR1 2R7QA 1U0HB 1FEEA 1WELA 2LXFA 2FHJA 1WC5A 1TL7B 2I1RA 2B9EA 3PYEA 5DQIA 4LR9A 1S6PA 2HBQB 3RAMA 1V5IB 3P8BB 2QG9B 4I0WA 5HBMA 1PBAA 2DNKA 3FMWA 1N33F 5DLFA 1U8SA 1BQMA 3BR8A 3NMAA 3WZ0A 3R97A 3UQSA 4DL0C 3BSCA 3K8VA 4EWTA 4LF5F 2RU3A 4Q0BB 4FP9A 4X65F 4OIXA 1H2VZ 1IKWA 2R2RA 4F4YA 2FUG9 2QIFA 2Z8QA 5GAGU 5C42A 1JLBB 1RWUA 4C11B 2KL8A 4HLBA 1SB6A 4MYUA 1N5SA 2A6MA 4QYZJ 3CJTA 4B08A 2YH0A 2HHQA 3CB4A 2YWHA 4HVZA 3GG0A 3WC2A 2A6OA 4DG1A 3MUVP 3G4SS 4QCLA 1RLDA 2DH7A 2HHUA 1K8AT 2VZ9A 4MAKA 2ZH9A 1N0UA 2E5IA 2RJZA 4A47A 4AUKA 4YDDB 1XNQJ 2MSTA 3G82A 3J7AN 2D3O1 1GXLA 2W2PP 5HVFA 3FSIA 4RW6B 4DX7A 3GG1A 1HQEB 1HQUB 2BEFA 2F3JA 1N6QB 1UJ6A 3PDNA 3DRPB 5LSOA 1U1NA 3N9UC 1X7VA 1GMWA 2FC8A 2HFUA 2G0IA 2LCWA 2HZCA 2MKHA 3ILLA 3M32A 3MWBA 4ZPTR 4F26A 4RW9A 2ZH3A 4ED2A 1AUSL 1Q5YA 1VQOS 1BGXT 4FYXB 1TKTB 2VONA 3VHQA 3CD7A 4X62F 4CT8A 1NK5A 4URGA 3QIPB 2PFFB 4WXOA 2CG8A 1NSPA 2VBXA 1VQ4S 5F3ZA 3CJQA 4DZ6A 2AZ3A 2LYVA 3IFEA 2BM0A 1HYSB 3C14A 3QAEA 2YQ3A 3EXYA 3X3UA 4Y2IA 4ZMMA 2X7IA 5LXRA 3CD6S 2ZDPA 3MMAA 1SCJB 1RT5A 4CM2A 2DKOB 2IJRA 4PCQA 1HW9A 4LUBA 3PTWA 4DF4A 2JEGA 1WDDA 3MM5B 4U95A 3W2WB 4URQU 2FVPA 3TVYA 3KLFA 2ZJPQ 2ZOMA 1HI0P 1U47A 4LVOP 5ETTA 4LMZA 3AAWB 2F1FA 3MMCB 4FS1A 1YDLA 1P1TA 4TU7A 4HTJA 4I67A 1NXIA 3EVWA 1VJQA 2ALZA 3TR5A 2GW8A 5CCMA 3TZWA 4OI3A 2OGUA 4Q45A 2CZ9A 4YMEA 2K1RA 4MYTA 1QSLA 2NREA 1X4BA 2FJXA 2DH9A 4C0OC 2RDJA 1SH2A 4DR5F 3FNNA 3KJVA 2PA3A 4NCAA 3B54A 1YBAA 3D2WA 2QX0A 4DPTA 1X0FA 4K2XA 3JB9k 1T9XA 2VU5A 2R3VA 4H4MB 5LSRA 2BJ8A 4RUCA 1ZBTA 4DUZJ 3MI7X 2NXNA 1OO0B 1C0UA 5KFGA 1ZTWA 2EKYA 2Q43A 1U1MA 1FERA 1NEEA 2XO6A 2M52A 3HM9A 2LQJA 4KHMA 2J9DE 3OL6A 4R5PA 1S6QA 3QO9A 2B51A 2AX0A 3SDEB 4PAAA 3W8PA 2NCKL 1S49A 4XPCA 4DFJA 1WF2A 1B99A 1NU4A 3CTRA 3D0HE 2CQHA 3HZEA 5CQGA 2CNLB 1RT4B 1X4CA 1HNWJ 3C16B 5F0UA 1GXUA 1N52B 4ZVRB 1VC5A 4LF9F 1X5PA 3G8SA 2E5LF 4FF4A 1KNZA 2NZ4A 1ZM3A 3BO2A 1S9GA 3F56A 4QR2A 1FJCA 2F63A 4ZVHA 1HNVB 1V3SA 4DSFA 4FZVA 5I4MA 3JYTB 2J8AA 2D3ZA 2W8KA 4YHHF 4DMZA 4C48A 2HIQA 5C42B 1MW7A 1J5OB 1HBNB 5A0YA 1WNEA 3KJQB 1LEOA 1FRIA 1V3ZA 3QT8A 3RRHA 4G6VB 1BXNA 3HJFA 1IR0A 1FRXA 1KS2A 1S99A 2E1AA 3TP2A 2IC3A 1UVIA 1VISA 4N8NA 2LDIA 1SL1A 4M5GA 2CG4A 2PMWA 2VBZA 4O3PA 2IAJB 1YHQS 2FTRA 3M1VB 2XC9A 1SJ3P 4JI6F 1HKAA 2CPYA 4MK9A 4ZJOA 3H25A 3C46A 2QLFB 2XCPA 4BS2A 3FBCA 4C8MA 5JVHQ 1GXTA 3GONA 4WFXA 2Z2ZA 4Y3CA 3M9NB 4FF1A 2D41A 1WHYA 2WHOA 2KHDA 4BLGA 4D3GA 5IXUA 2OTLS 2QYGA 5EX0A 3UCGA 1TL4A 2AWZA 4ANEA 4UW2A 2P6TA 3R9LA 3MZIA 3S6EA 2HRYA 3GJSB 3BYPA 3FBFA 3KG0A 2W9BB 2R8IA 2QA1A 3O8WA 4C3LA 1HNXJ 4JI7J 4A8OA 4C3MA 1RWXB 3AFGA 1IKVA 2OI2A 3DLKA 5D0EA 3VAFA 1GX6A 4RWXA 4ECSA 5KFZA 4Y00A 2AJ2A 3DOMB 4J9QA 3SBMA 4LF8F 3M6UA 1K1SA 3EYZA 4F02A 1RU2A 3AJ1A 1PGZA 4M5IA 2GMHA 3SCLE 4F7VA 3GYGA 2FC9A 4L74A 3FEZA 5KG7A 3QSYB 2X3DA 1KFDA 2GO8A 2LXIA 4NA2A 2B4VA 9ATCB 1IBMJ 3MXHP 2QN6B 3L09A 1VRTB 4LT6A 1KVIA 1WF0A 1ZS6A 3C6TB 5KFBA 3CWJA 3DLKB 3US5A 3WDOA 3CCZA 2XY7A 2Y0SD 4FYWB 5HQ8A 1M5VC 4DR1J 4OMFG 3VAIA 4URSA 4IR1A 1FTCA 2GMLA 5ITHA 4HKQA 3GFYA 4UF4A 4ZS6A 2JRSA 3ADAC 4JI5J 1SQGA 2V94A 3ZZYA 2V2VA 3HHDA 4A48A 4ZJLA 5HSPA 3NG8A 3ILJA 3KLVA 2DIUA 2AT1B 4QW9A 3HMJG 2FJVA 2GGPB 4A8FA 4V19X 5KOXA 4ED0A 4KE5A 3AD9C 2WSCC 2HQGA 3MAHA 2W4PA 3SSQA 2CWXA 5EWEA 3NNCA 2E7WA 1VHIA 1F9EB 1XBWA 1YRXA 2CYYA 3LAMA 4O44B 5C25B 5IQ6A 2EC2A 3BSOA 1FX4A 2RHSB 1NSQA 3SZ2A 4UOFA 2IM0A 1FRHA 2M4MA 5HJXA 5KFVA 3KLGB 3QFHA 3DRSA 2CQIA 4DV1J 2K3IA 1X9WA 2HVIA 2DEJA 5KTQA 3D67A 4F4XA 2GC8A 1VBXA 1S9GB 3MHYA 4QIFA 1GAOA 2C28A 1RYRA 3NP5A 2MZQA 5D4NA 5DM7Q 1F3VA 1J5OA 4KGKA 3C2PA 2B8QA 4DR7F 3D9BA 1R0BG 5HMZA 1QM9A 4M63A 2R7WA 1DTTB 4JV5F 1PAUB 3ZTQA 3KUGA 3VGUA 4DQRA 4NXNJ 1CQNA 4DZDA 2UXCF 2BJDA 4HI1A 4H4KA 3TX8A 4NRTA 3OL9A 2HG4A 2ZH7A 2DNRA 3DOKB 1YRTA 4YY3F 1NK8A 1FKOA 2XMTA 1L3SA 1KVJA 3SDEA 5E3RA 4A8SA 1LFPA 4OX8A 2RAQA 3W5XA 3BR9A 5KFTA 3CCSS 2CDRB 3QJLA 2R7XA 2ZH2A 3OLBA 1GNKA 3LP2A 2JFDA 5KFLA 1F1BB 1VCTA 1Y9OA 4DL5A 4WKRA 3MURP 3VQSA 1Q7YT 2LXUA 2WCXA 5ETKA 1T05A 1NKCA 4M95A 2XM3A 3TJAA 5D4LA 2X51A 1F5BA 2KI2A 4EUVA 4RNMA 1XNRF 5J2PA 2R7TA 5JMNA 4L3NA 1RKJA 1WKLA 1LWCB 2ZHOA 4LR7A 5HATA 4CLYA 4PUOB 1K0VA 1U1KA 2FD2A 1P1LA 2MLXA 3C15A 2VHGA 5D78A 2DGQA 3G8TA 1ULRA 2FHMA 4IG3B 2VODA 2UXBF 2XNRA 1SL0A 1UKUA 2CKWA 1JB0C 1S72S 5HN0A 3FFIB 3DC2A 4TKTA 3M7VA 4JUZA 4X4TA 4ID5B 1DFDA 3M8SA 3J80U 2HRUA 1I94F 3UN5A 2H5IB 4NXMJ 2KU7A 1MWZA 2PN6A 4C7QA 3H2VE 3MM8A 1D0EA 1S4EA 2DPIA 4TU9A 3MFHA 2RT3A 4PUOA 2PDAA 1VLOA 1K44A 3N5BA 3G2XA 3MDFA 1DLOA 2ASDA 3MAAB 4P6QA 1KQFB 1LXNA 2HZVA 1RKIA 4QU7A 3BGUA 3PY8A 1QE1A 3A13A 5DQGA 1AZSA 4PPZA 2L08A 3UW1A 2YNGA 5LJ3Y 2CAJA 2V8VA 1X4EA 4AQYF 2HLUA 1EP4B 2I0XA 2XMAA 2OFHX 1HHQA 4X4NA 4NLSA 2RIJA 3I0RB 3V6DA 1B4SA 2EI5A 3FSYA 2POKA 1Y3KA 1ZZFA 2ZUAA 5EDWA 3JTPA 2KG1A 3HHLA 4N5SA 1R7IA 3MGJA 3D54A 1KD1T 3DLEB 4XAKA 5KFSA 2W2MP 3FQKA 5DG8A 2A18A 3UN3A 3SQGA 3JSMB 3BO3A 2G1HA 4RW6A 2A10A 2XI2A 2HBRB 1RACB 3DRPA 3A12A 2DXDA 4DSEA 4YB1P 1CS4B 1ZTTA 1T02A 1NMEB 4RL1A 1SUQA 4DEZA 2H5EA 3CJRA 2CQ2A 3MR6A 3RBZA 1QAJA 2UV8A 1Z1ZA 3QZ7A 4IO9Q 3C6UA 4PXBA 1IKWB 5CYMB 3T5LA 4Z37A 4OHYA 4UY85 3HHLD 3LW5C 1RWKB 4OX9J 2WBRA 2V4JA 2IAJA 1MN7A 2I5JA 1MU2A 4MK8A 4CZCA 4F4AA 2J0WA 4C2MA 1IN0A 3PHEA 5A8RB 5RUBA 3TW0A 1QD1A 4WBFA 4RW8B 2GGPA 3MUTP 4OYOA 3MUMP 2VQFF 1DQ8A 1SUQB 1H7XA 3AQOA 3KTQA 2ZC3A 4OZ5A 3T3FA 4NYZA 4E0DA 4H54A 3GYNA 2OKQA 5HBMB 2WAQD 4GVLA 1KEKA 1FO1A 2ACYA 4WYWA 2BYCA 3O44A 2VG5B 1FRJA 1VLYA 5CYMA 2XGQA 3AODA 5K8OA 3KHGA 1NJWA 5KT7A 3IMQJ 1IBLJ 3R6GB 6FDRA 4ES2A 2W1BA 3CGIA 1FFGB 4DUYJ 4C8ZA 4ZVTB 1IBLF 1P27B 1KLMB 2EK6A 4YB7A 5CXTA 4J9VA 1R6VA 4ATNA 3MEEA 4S0MA 5L9NA 3V6JA 1WC3A 3HI9A 2H5JB 1S6QB 5J2NA 4ID8A 2F9DA 4Q7AA 4I2QB 1B3TA 1CVJA 4G1PA 3PJWA 3MEDB 2HHXA 2DO4A 4ED8A 3RBEA 2GNKA 5GMKa 3V6DB 4WXWA 2XY5A 2BW2A 3BZQA 4YB5A 4ED6A 1L5UA 1IKYA 1JKHB 1IJEB 2QV6A 5KFRA 1OJ4A 4IG0A 2QSFA 5KFMA 3W5ZA 1NB2A 1R6YA 3P4UB 2P6SA 4RNFA 3HKWA 2OTJS 4B9TA 2F8HA 2V63A 2XB2D 3JQKA 2MDAA 1NHKL 1UP1A 1FEHA 1O6XA 3CCVS 1FDAA 2QO3A 2RQKA 1O5JA 1M5SA 2OPSB 4J9LA 1ZA1B 1H7WA 2MKCA 5KT3A 4CLSA 3QQCD 5LM7E 1DLOB 1U2RA 1RBLA 1FJGJ 4HEA9 1UPPA 2HW3A 3AD7C 5E3QA 5G0RB 3J81j 4F36A 3TUZC 1N4LA 2ZZMA 2I9SA 1SBRA 3MM9B 3I5CA 4OV1A 5GAGI 1RISA 4GO7X 1F9FA 1RT3A 1RAEB 1NPKA 4I6AA 2L3MA 4PWUA 5FIIA 3EMTA 3JTNA 5AJ3F 4JV2A 1QTNB 4DR7J 2PMZD 2ZFHA 3D6MB 3IM8A 4IRDA 1QSYA 3HF5A 4X66F 3G96A 2EKNA 4DV0J 1ZYQA 4EFAC 2A3JA 1O8BA 3WIUA 5GVQA 1WJ9A 2YX1A 2MTLA 4HACA 1B0PA 2XMKA 4IH5A 2BE7D 5DZ6A 3KNGA 3HHLC 1KSPA 4TLRA 2RU9A 4ELUA 2DCUB 3RB4A 3G6ES 2W2QP 3B4DA 4YR2A 1Q8BA 3BKUA 4RW4B 4QYRA 4AXJA 2IBOA 1RTZA 4DL4A 2QZ8A 1OQ3A 1HNIA 3HKZD 3KLHB 4DHVA 3HVTB 4AT1B 2BMBA 3K5NA 3PV8A 2UVVA 3PRDA 4NI2A 3UCUP 1SC1B 3DHXA 3RR8A 2C42A 2CXEA 3T9NA 2GFFA 5F9NA 4K4ZA 4OLPA 3OV7A 4W90B 1CULA 2HQFA 3MMBA 1RCXB 4ECWA 5FJ4A 3R5CA 2VBWA 3CCJS 3PKYA 1YK9A 4CM0A 1VC6A 3CJ3A 4LJMA 3TRGA 4E2FB 1Y0HA 3AT1B 4WFYA 4ZHRA 3GIJA 2N7YA 3LGNA 4X4VA 3OQ2A 1OMSA 5CYJA 3SI8A 3DOLA 1RSCA 4TYBA 2AP6A 2NQPA 5KG1A 2XQCA 3JSRA 4DU8A 2AHOB 2YKNA 3R3TA 2VKZG 4FKYA 4ZDNA 5DETA 2MZTA 3JSBA 1TUWA 3OD2A 3FVYA 3SMZA 1H2UX 3EXCX 4CH1A 3SV3A 3BM7A 4NEYA 5LMUJ 4RJVA 4CTAB 1WC0A 3J80Y 1VR6A 1SVDA 3CVKA 4L3KA 1E6YB 4LF5J 3H4BA 3W66A 2ZNYA 1R8PA 3NKYA 3TX0A 1FWPA 2MHNA 3W2VA 1XMOF 4F25A 1DURA 7FD1A 5CZXA 3CDEA 4OI1A 4CO0A 4P9SA 2W9AA 3NAHA 4RBVA 4BC7A 2ROPA 5J2MB 5HLFB 1PBUA 2CQ0A 2WSEC 5K20B 2QLJB 3EGWB 3H20A 1RLCL 2UXCJ 1WG4A 2CPEA 1HWLA 3C6TA 2W7AA 1M0SA 3LALA 4OI2A 2RS2A 1YG0A 4UUWA 5C24B 4UOHA 4ZVEA 3G6VA 3TAQA 1RTJB 4B3RF 2ACMA 2XHWA 1ACMB 1U02A 3KNAA 1KLNA 2DTJA 1HBMA 4F67A 5GADI 1WC1A 4NMLA 5E3CA 4WU2A 2BDPA 2H9ZA 3I82A 4J9PA 3CJ0A 3OPKA 4AFFA 3VR1A 4ICLB 4DQSA 3LWLA 3TAMA 4WZMA 2L9NA 1X60A 1I51B 3DOMA 4DF8A 3A4TA 4NE9C 4J90A 2B7BB 2AEFA 2LEAA 4P2SA 3J81U 1QAIA 4FYDA 2J5AA 3R8YA 3QGGA 3OFEA 2BJ7A 4I6WA 4P74A 2H3EB 2FB0A 2VL1A 3OR2B 3DOLB 4C3KA 4K50A 5AE3A 4LRAA 2OSQA 2ZDOA 1NB7A 3CMAS 3W61A 3MM7A 4ZHRB 2B4OA 1TKZB 3OL7A 1JXLA 1RTIB 2J0XA 3QSIA 4GRSA 4OX9F 4DX5A 3H98A 3VAHA 2WONA 4DR4F 3FDSA 3FC9A 3CJ2A 2E1RA 4GVBB 4WIQA 1S5ZA 1WSVA 4Q43A 3DGPB 1U0SA 2EFNA 3KG4A 1MN9A 1VQMS 3M1VA 4DV7J 4ETXA 2HKEA 1NKEA 1UVNA 3UE2A 1Y11A 2C2KB 4TQRA 1HNIB 2BV3A 3H8YA 3HSZA 3KLHA 4H4KC 3H5SA 4R25A 3MEGA 4B02A 5E0OA 1FD8A 1RI7A 2CJAA 4KGMA 4ZLNA 1EKSA 3J7YU 1NJYA 1LXJA 4P10A 3Q86A 3TOQA 3KK2B 3K5MA 2QFJA 2YPZA 3PACA 1FHTA 3UD3P 4L75A 3UDVA 3JYTA 1OPIA 1U2FA 5IWAJ 2OO4A 2RKIA 3SV4A 2MZJA 1HBNA 4CH0S 5A0YB 3FZBA 3W62A 1P8GA 3GIKA 1HNXF 2E7VA 4J9KA 2ATLA 4U6PA 3BKTA 5KG3A 5KFOA 1UL3A 4FKXA 3PW2A 3AOAA 3FKBA 2YWGA 5D4OA 2OH2A 4ELVA 2M0GB 1D9AA 3O1LA 3HXMA 1FWLA 2LP4A 2EBGA 1MWQA 2HQCA 3QWPA 4RUBA 2IIHA 2KJVA 2V5HG 1FJEB 3N6MA 3IM9A 4V19J 3M8RA 4ZN1A 2D3UA 3HD1A 4PWDA 2B6AA 1C0UB 4DUZF 1TZ0A 3LQVA 2H4WB 4P7VA 2GQCA 5KT6A 2VF3A 1NLKL 2APOA 2XLJA 2HNYA 1S1WB 3RG6A 5KFDA 2PA8D 1RADB 3DLJA 2Z56B 1TFWA 1S9EB 4RO0A 1NK7A 2ROEA 3OT9A 2D74B 3MM8B 4KO0B 1WKJA 2KVIA 2AEMA 2HEKA 1H6KX 2IRXA 2OMLA 4LRCA 4TNOA 3VV2B 4BCAA 2B4UA 2U2FA 3BB5A 1S1UA 2LLZA 3KJFB 4KR0B 5C2CA 2K1RB 1SKUB 1V5VA 2V4QA 4NCGA 4ECRA 4K7QA 2B8PA 1HNWF 2XS7A 3M6WA 3TUPA 1S4FA 2QMXA 2ZD1B 4UTGA 3CJ4A 1JLCB 1S79A 4V1Ak 2IM1A 4W4MA 4ZKAA 4A8WA 3MM9A 1DTQA 2J0SD 3NGSA 2B0GA 3LOUA 4HYKA 1FXRA 3R1HA 2ZBCA 1CJVB 2DGTA 2HHPA
chains in the Genus database with same CATH topology
4ICLA 1TFYA 4DSIA 2ABYA 3FFIA 2MKSA 5DDPC 4LIWA 2XNQA 2FLNA 1RT5B 3K58A 4I56A 3SFUA 1KQGB 5T7LB 1TR0A 6FD1A 2MJNA 2ZITA 3KLIA 5JJBA 3IS9B 2DVIA 3H2LA 2F8MA 3LP2B 5GAHU 3PIPQ 3OHAA 4TY8A 5F3TA 2YKMA 2CVEA 3FRZA 3THVA 5J2MA 2X1BA 1CG2A 2QSWA 3MEGB 1IKYB 1NK9A 5KFCA 3RW6A 3IWNC 3IXQA 1Y5NB 2MZRA 2FDNA 1SJ4P 3N6NA 4ZPWR 2ADBA 1W25A 4NLVA 3P96A 1RJJA 3K5PA 4KSEB 3LH2S 4B3OB 1WG5A 2RE1A 2AQ4A 1KFSA 4Q2MA 4NCBA 4AYBD 3MCSA 4NLPA 1S1VA 2J7KA 5AXKA 2QT7A 2CQPA 2EG2A 2HNZA 2Q1LA 4ZP7A 1DARA 4N41A 5L8RC 3CJKB 1JWWA 1R0AA 1HWKA 2CJ9A 3R27A 4QIVA 3HVWA 4O3OA 2OPPA 5MLCV 2F40A 5L38A 3FZ2A 4JI0F 3DRRB 3SSRA 3CCWA 5KG6A 2RRBA 4RW8A 5SZTA 2DGOA 3AH6A 2NYIA 3PFOA 1AROP 2VA2A 1JLAA 3OFHA 2CDQA 3U27A 4C98A 1K73T 3D5MA 2F8EX 3SCKE 5C25A 1S6PB 2I8EA 3IRXB 5GAEU 1U1OA 3N01A 4DSLA 1K1QA 4CCHA 2K7KA 1BWEA 1BQMB 3E01B 1UVJA 4IYQA 5F8IA 1N0VC 2GO9A 3UWTA 3MM7B 4DV1F 1Z2LA 3GV7B 1REVA 2KO1A 3I6PA 4OJ1A 2YX7A 1FVSA 4I7FA 1C1CB 5K5MA 2CPFA 1CLFA 1O51A 1UMJA 4B3MF 3UDLA 4Q8FA 2ZH4A 5J1EA 4Y65A 2MXYA 1LKZA 2RSQA 3L7PA 4PQUA 2PIIA 5JXSA 2LU2A 4GO5X 3Q2SC 1HWJA 3Q23A 1JJ2R 3RR7A 2DHSA 4ZOSA 4BWJA 3ZZZA 1NH7A 4EO6A 2N82B 7FDRA 4I6YA 1SKSA 1WEYA 2BVZA 1IKVB 2OAUA 2XY6A 4N76A 1KQSR 4X2BA 3B4MA 3O6QA 1HW8A 2FVCA 4CH7A 4MKYA 3FGVA 2DRAA 2N7CA 1HARA 1S9EA 2P9EA 2XBPA 3I31A 4IO1A 1SH0A 2IC3B 3HVAA 2UZAA 4JI1F 2VOOA 2MQMA 4C9DA 1JLEA 4IG0B 1Z2ZA 5L9XA 4DS5A 3OSNA 4YUDA 1FK9A 1LW2B 2IMWP 2NUUG 1MNEA 2ZH5A 2B56A 3GQCA 2AJQA 2PC6A 3FEXB 1HHTP 3CCTA 2JEJA 4HH1A 1TL3A 4NPOA 2MGZA 1TKXB 2OD4A 4NYOA 4K5RA 2DR8A 2CVIA 4OL8A 4Y0FA 1QTMA 1UEVA 1PC4A 1LQ9A 3CEDA 2V0NA 2GQQA 1W2BR 3MTKA 3IWLA 2M70A 3ZZTA 1FK9B 4B17A 4ZP8A 3EZ5A 1T7PA 2AX1A 2GCFA 1RTHA 3OL8A 4YFUA 2VFTA 3CIMA 5HI7A 2CPHA 1WHWA 2KH9A 2DNGA 2HGLA 5BYSA 2MB0B 3CC7S 1HFEL 1NJZA 4DN0A 4CO2A 1I1GA 4C8OA 4F2SA 3V81A 2KFYA 4F8RA 2QLXA 3SFGA 5ADZA 3V4IB 3DLBA 1RQ0A 4MKAA 5D8HB 4X4SA 2HWTA 2E9TA 1N32F 3EZUA 3HFKA 2YVSA 1LW0B 2LQ5A 1UFWA 4NLUA 4B9SA 3DLGB 3ISND 4FF3A 1CPZA 3M2VB 3ZC4A 3LO3A 4DFMA 3IAS9 5GADU 2EG1A 2VC0A 4RUHA 3OTBA 3BEGB 1M5HA 2BA9A 1X0PA 2NXUA 3OJUA 1RTJA 1VK3A 4DDFA 4MH8A 3OSPA 2P9GA 1YJRA 4LF6F 3KLEB 1SKRA 2D1CA 2BANA 4I64A 1BQNA 3D1QA 4QWCA 2VD3A 5HLFA 4FXDA 1NHUA 1YVFA 3M2UB 3VZHA 3RU0A 5DJBA 2E66A 1HWIA 3MECA 1UJ5A 3PEJA 3PJXA 3B82A 3FJ2A 2RQ4A 3FSXA 1VRUA 2GHVC 3K2YA 4RW7B 2UXDF 1JLAB 1JNRB 2DNHA 4NZ0A 2I2YA 1S97A 2XMJA 2BANB 2WTFA 3H4DA 4QQBA 3IR6B 4PG6A 2BRLA 5FLXY 2N4CA 4RU2A 1H38A 2V4JB 2FIUA 3CCMS 1IQTA 3DHWC 4I2QA 4JV0A 1RT2A 1AFIA 2JEIA 1Y3JA 4AL6A 1K0TA 3BQ0A 1TV6A 5B0BA 5M2PA 1VS3A 2IVMA 4OX6A 1M5KC 4X4OA 4WFAQ 1S7HA 3TO8A 3M2VA 1SV5A 1LWCA 3DI6B 1VI7A 1X5SA 4WFBQ 1YTYA 1HR0F 5AXLA 2IJNA 2UVRA 5LSLA 5K8NA 2ZOFA 2DISA 3QYYA 4F4ZA 1L3TA 2ZHBA 1RT2B 2MKKA 4DR2F 1N56A 4M94A 2EFOA 2UV8G 4PG7A 5LJ5Y 3GILA 5HP1A 3RB6A 1AXQA 4Q44A 3KK1A 3V81B 4NLOA 4KHRA 1FJGF 4K4XA 4LSLA 1J2VA 1EP4A 3Q2TC 2MQPA 1JJ4A 3MD3A 2IYGA 4WKYA 5EX3A 5KFXA 2XSFA 3DOKA 3NMRA 2M7SA 1UAWA 3IR5B 2VPZB 4TY8B 1QY7A 5IFMA 2HHHF 1TP7A 2M9KA 2RVJA 2XO7A 3FQLA 3ZZOA 3B78A 3MR5A 2AGPA 4B9LA 2E5JA 2W9CB 2WOMA 4IFVB 5BYRA 2RF2B 5E2QA 1C4CA 1BQXA 4IOAQ 1AW0A 3UFCX 3M9MB 2D3OR 2DITA 3IGNA 1RTDA 2F4VF 1V9OA 5U47A 2AJ0A 4PG4A 4PKDB 2DO0A 3DXSX 1N36F 4HTIA 5I42A 3OXLA 2IRYA 2HMIA 1HBOA 5F8MA 3IO1A 1Q4RA 3DGPA 2IVFB 1F0XA 1XR6A 2KN4A 1S0MA 1FDDA 3ITHA 4NLRA 4FPRA 3P3DA 4H4OA 4EEYA 2HNYB 4KTQA 3OW2R 4YB6A 4C97A 5DS7A 2DIVA 2Y1JA 2UUWA 2C2DA 1HHSA 1NK4A 3SEOA 2CQ3A 1GT8A 2OSRA 1NK6A 3TAPA 4KFBA 4X64F 1U48A 2GX8A 1S6UA 1XK8A 2EBEA 5IT9Y 4BWMA 5IWAF 3KLFB 2ZJRQ 3QAUA 5K8PA 5EGYA 4OZLA 5LMUF 4Q5VA 2FJBB 2ZKUA 3MEDA 2VG7B 2OD6A 2L9WA 3ZZRA 3CUNA 1FD2A 4DL7A 2ROGA 3NL0A 1VMBA 5E3PA 3LWMA 1IQZA 4IFVA 2KJWA 3UDCA 1VIXA 5KFWA 4CT9A 1AUDA 1VQYA 3H5YA 1SL2A 5DDRC 4GKKF 1FXLA 2VUGA 1X4AA 1OQ6A 1FRMA 5AXNA 1Q81T 4DR6F 1VQ7S 2LQ9A 4L6V3 1R8AA 3UPFA 3M32B 1Y4ZB 2JLEA 1N5YA 4NLDA 2QE5A 4IRKA 4LF4F 3GWCA 4IDKA 1SV5B 2N3OA 4CI0B 1ZAXA 3NCPA 4M8LA 2CJBA 2M2BA 4WK1A 4DL6A 1ZM9A 1DAXA 5I3UB 3D1HA 5L1KA 2C22A 1JLGB 2R2UA 3HHKA 1VRTA 4F2RA 3RAQA 2VFSA 4F3QA 2AGQA 2DNMA 2E5GA 2HHWA 1T94A 1FRKA 4ES1A 1J5EF 4PPDA 2VBYA 2J7UA 2DPJA 4DLEA 2KXFA 2GIRA 3K5OA 2V9KA 2X1FA 1PC5A 4X4RA 1HL6A 2YNGB 3HPOA 4YQWA 5C24A 1N48A 1X9WA 3CT9A 1R8CA 4Y2CA 2E5HA 4DV0F 4UOCA 1LWFB 2RNEA 2W25A 4ZPAA 2AYGA 5CH7B 3AB4B 2DD8S 3CJ5A 4YDXA 5F8HA 1RT6B 2LDYA 1NAQA 4N56A 3GIIA 1UEUA 4RX6A 4F4KA 2DK2A 5J2QA 3RW7A 4OFZA 1S0OA 1RT7B 4FN5A 4O3NA 4OHVA 3PO4A 1GH8A 1LWEA 3DYAA 4X4PA 1IBKF 4CTAA 1HBOB 3PW0A 2HMIB 4N47A 4KPYA 1E6YA 3I0SA 4G1QB 1DBDA 2DGWA 2Z0GA 4NZ6A 1KTQA 3OTEA 4ECQA 2LU1A 4O4RA 4NA1A 1XTZA 1SXLA 1DQAA 5KG0A 1QUPA 3LAKA 1M5PC 4ID5A 1YSJA 3AA9A 2ZH6A