1M1KT

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m1kT00
1JMTA 2XNRA 3G96A 2DHXA 1X0FA 3UD4P 2MY7A 2DHAA 1WF2A 3UD3P 2M0GB 1AUDA 2KXFA 2KFYA 3CCES 2DNMA 2NLWA 2DGSA 2FPHX 1ZZFA 1UP1A 2YKAA 3MURP 2AYGA 2CQGA 2RQCA 1X4GA 1Q7YT 4TU8A 3EGZA 2U2FA 1SXLA 3R1HA 1FXLA 4BS2A 1ZH5A 5IFMA 3G8SA 3UCZP 3BO3A 1M90T 2M70A 1K9MT 1Q86T 3VAFA 3L3CA 4CQ1A 2XSFA 2DK2A 4PR6A 1JJ2R 3N9UC 3S01A 3NS5A 2MKIA 2CQ0A 3S8SA 3BEGB 3RW6A 2K3KA 2CPDA 4F25A 2HVZA 2CQ4A 2RVJA 1VQ4S 1VQOS 3VF0B 4WFNQ 2KRBA 1DRZA 1H2TZ 4F26A 2CQCA 3H2UB 1KC8T 1WF0A 1X5TA 5CA5A 1VQ5S 4QU6A 1M5OC 1OO0B 2KM8C 2VODA 1S72S 1VQ7S 2CQ3A 1R8PA 2MZ1A 2M7SA 2L9WA 2LKZA 3THPA 3LQVA 4Z2XA 2CPIA 2LEAA 2F9JA 2M52A 4FXVA 1YJNS 1WEYA 5JVGQ 1N88A 2AD9A 2ZJQQ 3CC2S 3CCVS 2KN4A 1SJFA 1NU4A 3CF5Q 1VQ9S 4TLQA 3P49B 1S79A 3CC4S 3R27A 2MKCA 5LXYA 2QA4S 5CXTA 2X1AA 1YHQS 2MMYA 2RUGA 2XS5A 2CPHA 5DDOC 5CYJA 4Y00A 3SXLA 2LECA 2RQ4A 2DHSA 5LSOA 1VBYA 2DIUA 2F3JA 1OPIA 1U1RA 1B7FA 1X4CA 2OJ3A 3IRWP 1U1KA 4WFAQ 1U1PA 1Q81T 2CPEA 5D77A 2N3OA 1UW4A 3I56S 2JVRA 1G2EA 2KYXA 2MQMA 3EX7B 2MGZB 3NNCA 2MZTA 4M5DB 4WIIA 2L41A 3PIOQ 2DHGA 3R1LA 5LSLA 5GADU 2DNPA 4IOAQ 4WF9Q 1WI8A 2MB0B 1WEZA 2YTCA 1SJRA 2J8AA 5DDQC 4P6QA 3CC7S 4QPTA 2DIVA 5GAGU 2KG0A 3RW7A 1DBDA 3OW2R 1KD1T 1U1LA 2DB1A 4IO9Q 1SJ3P 4CH1A 2DGWA 2DNYA 1L3KA 1OIAA 3CCLS 1VC5A 5DETA 4RU2A 2ADBA 3I55S 3VAMA 3G8TA 1VQPS 2DNLA 1CVJA 2V94A 5HL7Q 1ZZNA 2X1GA 1U6BA 1JJHA 1A7GE 1KOOA 2LYVA 5LXRA 2CQDA 2KT5A 2K8GA 3U1LA 1HD0A 2XS2A 4WCEQ 2OTLS 2CQBA 2OSRA 5FJ4A 1HA1A 1RKJA 1YTYA 1X4HA 2DGVA 3VALA 2HGLA 3CCJS 2MQLA 1U1QA 3CMAS 2CPZA 2DITA 2BZ2A 4YUDA 2SXLA 2CPYA 2N82B 2M4MA 3TO8A 3JB9k 2VONA 1PGZA 2BOPA 2MZJA 5HO4A 3P5TL 3VAJA 1VBXA 1VQNS 3MDFA 1P1TA 2DGTA 3NS6A 2DO4A 3UWTA 2DH8A 2J0SD 2KG1A 2LXIA 2U1AA 2E5GA 2LQ5A 2J76E 2MZRA 1IQTA 2KHCA 2PE8A 5GVQA 2PEHA 4YOEA 2AYMA 2NZ4A 2DISA 2RS2A 1N52B 3MI7X 2N3LA 1VC6A 3B4DA 2DGOA 4C0OC 2MJNA 1WHYA 2MQQA 2XB2D 3MOJB 1FNXH 1VC0A 2VOOA 2DGXA 2KU7A 1HD1A 2MZSA 2XNQA 4ERDA 4J5OA 2M88A 2CPJA 5IM0A 3CCRS 2WBRA 1FHTA 1WF1A 1WG1A 1NO8A 1NJIT 3Q2TC 5GAHU 1VQLS 4A8XA 1WEXA 3US5A 2E44A 2RT3A 3MXHP 1Q82T 2DNGA 1YJ9S 1X4BA 1YJWS 1VBZA 3DLLQ 2MQPA 1WHVA 1XN9A 1YIJS 3CCSS 1PO6A 2Q79A 3NNAA 2HGMA 3V4MA 3BO4A 1WI6A 3CCUS 3VAGA 3G6ES 2E5HA 1A9NB 1YI2S 4UQTA 2D9OA 2LEBA 1VQMS 2X1FA 3IWNC 3H2VE 1KQSR 3SDEB 3HHNB 1URNA 1U2FA 3FEYB 1VQ8S 4WKRA 1QVGR 2MZQA 2ZJRQ 3SDEA 1H2VZ 2RRAA 2D9PA 1W2BR 4V19X 1R8HA 2ADCA 5DDRC 5GAEU 2XS7A 2DO0A 2RRBA 3BS9A 5JVHQ 1FO1A 1QVFR 2G0CA 1DHMA 5H1SV 1M1KT 1X4AA 2A3JA 1WELA 2LXUA 1FJEB 4Y0FA 1H6KX 2MSTA 2ERRA 3G9CA 3EGNA 2OSQA 1UAWA 3Q2SC 3MUVP 1VQ6S 2CQ1A 2DNOA 2LA6A 1U1OA 1FT8A 1X5OA 2X1BA 3TYTA 2YH1A 2EK1A 1BY9A 2CQPA 3LPYA 3CUNA 2MKKA 2OIHA 2I2YA 3CPWR 3TP2A 4F02A 5DM6Q 1M5PC 2J0QD 3UCUP 2DNNA 2EK6A 2JX2A 4PKDB 2KM8B 1QM9A 2MKJA 2MQNA 3G71S 2DGUA 2MHNA 2CPXA 2D3OR 3P6YC 1D8ZA 3VAKA 1X4EA 3K0JA 3VAIA 2M8DB 5MLCV 2OTJS 1D9AA 2QFJA 2I38A 3CD6S 1WG5A 4CIOA 3VAHA 3FEXB 1M5VC 2MYFA 3NNHA 1WG4A 5IQQA 1SJ4P 2M2BA 2MKSA 4IUFA 3MD3A 2F9DA 5D78A 2LMIA 2FY1A 2MQOA 2CQ2A 2EVZA 3CULA 4ZKAA 1P27B 1WWHA 2VOPA 3CCQS 2KVIA 2HZCA 2FHOB 5EN1A 2CQIA 3CXCR 1RK8A 1X4DA 2QEXS 2MPUA 2GO9A 2YH0A 4LMZA 4PRFA 1OWXA 1VQKS 2KRRA 2MY8A 2KXHA 5IM0B 4QQBA 3MUTP 2ZJPQ 1M5KC 3ZZZA 2DNKA 1KOHA 4EGLA 1SJQA 1DZ5A 4W92B 2RU3A 2DH9A 2JWNA 2DNQA 3THTA 1YWXA 3D2WA 3MUMP 2M8HA 4C4WA 5GMKa 2HYIB 3CTRA 1YITS 1HL6A 3SMZA 3UE2A 2DGQA 4WFBQ 2KH9A 3B4MA 3CCMS 2N7CA 2MXYA 5DM7Q 1X5SA 4TU9A 5ITHA 2MJUA 2DNZA 3ZZYA 2LA4A 3P3DA 3S6EA 2RNEA 3G4SS 1WTBA 2AYBA 4LIRA 4ED5A 2DNRA 4OZ1A 3UCGA 2CJKA 4YB1P 3HI9A 5LJ3Y 4OZ0A 3U1MA 2AYEA 4LJMA 1WHXA 3PIPQ 4TU7A 2LCWA 2MKHA 3DXBA 2FC8A 5DDPC 2G1DA 2CQHA 1F9FA 4CH0S 2JVOA 3NMRA 2JRSA 2O3DA 1O0PA 1N54B 1FJCA 2KI2A 2RS8A 2GHPA 2FC9A 1H2UX 2M9KA 3CMES 1FJ7A 4QU7A 1U1NA 1X5PA 4C7QA 4UY8T 1JJ4A 2HGNA 3ULHA 3BO2A 4FXWA 2MGZA 2DH7A 1K73T 5BJRA 2CPFA 2MSSA 1N8RT 4W90B 1K8AT 2G4BA 2E5IA 4U67Q 2DNHA 1WHWA 1U1MA 1UFWA 2KXNB 2UP1A 2L08A 2E5JA 4IOCQ 2B0GA 3MD1A 1U6FA 3J7YU 2YWKA 1X4FA 3S7RA 5LJ5Y 3J7ZT
chains in the Genus database with same CATH superfamily
3D1HA 2X3DA 4OX8A 1FRHA 4OYXA 2M0GB 5AE2A 2KXFA 1SPBP 2DGSA 1UP1A 2IM3A 4ZP6A 1O6XA 4EMDA 2HHVA 5AE3A 2XWYA 2M70A 2GHVC 3MCMA 3T19A 2G13A 1MN7A 5HMWA 4TQSA 1S9EB 3NS5A 2HKEA 2YWGA 2R7RA 3S1TA 3CD5A 2FZCB 2ZBQA 3AD7C 4ID5A 5FDLA 1FWLA 1OO0B 2I0XA 4URGA 3ZTSA 3PKMA 4FS2A 4X4PA 4FXVA 3P5BP 1N88A 1TVRA 4KSEB 2FY8A 1H7XA 2KN4A 4DL0C 1ZETA 3KHHA 4ALZA 3PRBA 4DFMA 3OR1B 3LGHA 2WOMA 4ED0A 5ETRA 2D74B 3TVKA 3MAHA 1YJ7A 4EFAC 1FXRA 4OX9J 1NHVA 3GP9A 4U7UD 4GC6A 2KYXA 1S4EA 1TFYA 2O67A 4FBUA 4ZP9A 1P8GA 2PFDA 2YTCA 1G1XA 3KK1A 2VJUA 2NREA 1SL2A 3KLEA 2BE2B 2QJ3A 3H25A 4MYTA 3J7AN 1HWIA 1QTMA 2VUGA 1NHKL 1C1CB 4IYQA 2B8PA 4NCBA 1HNZF 3I4PA 2SXLA 1IBKJ 5HO4A 1LXNA 1AYEA 1VBXA 3QGHA 3VGSA 4M5NA 2V8DA 4TY9A 4LFCF 4HACA 4H4KA 3TX0A 3D0GE 1R31A 1F60B 1SC1B 1FKOA 3RR8A 3TX8A 1T9TA 1YDLA 4WK3A 1F9HA 2FUG9 4C0OC 3KJVA 2F5GA 1HIYA 2PA8D 4M5LA 2BKNA 4JV1A 4B3MJ 2BEFA 3FBCA 4BCAA 2JEGA 4ED7A 3QO9B 1CSJA 4LBHA 3NMAA 1PJ7A 2KYZA 1VQLS 5CH7B 2XGQA 3G6YA 1HNXF 5IXUA 2ZH6A 1Q82T 1EARA 1F2HA 2YNGB 3O44A 1GMUA 1N0UA 3KUEA 2HMIA 4R0EA 1TK8A 3V81A 2APOA 4NRUA 2CUYA 3H8YA 4J91A 1HPZB 3HHNB 1URNA 1HI0P 4I4BA 5IWAJ 3FSYA 5CHCB 1JB0C 1J2VA 3BREA 5DQHA 4WTYA 3M8WA 2UUCF 4DCJB 2G0CA 1T95A 5CABA 2R9LA 2A3JA 2V4JB 3SV4A 3BGFA 1FCAA 4DQPA 2HEKA 2HFOA 4Y2IA 3VQSA 4AYBD 3KK2A 3IO1A 1TAUA 4CO0A 3THVA 1S0MA 2BV3A 4F0HA 2I2YA 4F02A 5HP1B 3UCUP 4DV1J 5C24A 4I56A 5IS2A 3MPWA 4C98A 2MKJA 2K1RB 3OLAA 5LMUJ 1S1UB 3M8QA 2RHQB 2HHPA 4F4YA 1EQ0A 4WE1B 4IDKA 3L7UA 1IKVA 4C3MA 3I4HX 4C3KA 1CQMA 2EW9A 3TI0A 2EVZA 1B0PA 1P27B 1QLNA 4LRFA 1YRXA 2ZE2B 1XMBA 1I5OB 4QBUA 2J7UA 4I6WA 4Y2MA 3WIVA 4HHUA 3VWSA 1U8SA 1SJQA 3OTDA 1LW2B 4A8FA 3TA1A 4LF7J 2RE1A 1KFDA 3QSYB 1F1BB 1DFDA 1N33J 3HHLB 2XI3A 1C0UA 2QL7B 2RRNA 3QBCA 2DVIA 3QMQA 4RW7A 5B0BA 5AJ3J 3HI9A 3U27A 2FLPA 1IBCB 4MAKA 3VTIA 2JLEA 2OH2A 3PIPQ 1X7VA 5CYQB 2AHOB 2NZCA 3FZ2A 4CH0S 2JRSA 1PC4A 3MAAB 2HVEA 1NKCA 4J9NA 4KIAA 2Q43A 2W2OP 4EO6A 4JI3J 2E5IA 4PYDA 1T3NA 3J7A1 1UFWA 5ETLA 5F9NA 2L08A 2V4QA 4JV5F 3SYZA 4IFYA 2YKPA 3O3LA 1Q1KA 2FJEB 4ECVA 2CAJA 3EZ5A 2IM1A 4LFBJ 3MURP 4BWJA 5ADZA 2RQCA 3T5HA 1FXLA 1QDUB 2YNIA 1S4FA 5ETSA 4KJIA 2MKIA 4DV6F 1U0HB 1FK9B 3DRSA 3NAHA 2HS3A 2KT2A 4IR9A 2VBXA 1S0NA 1UW9A 4DL7A 2HNDA 3CCVS 4RJVA 3CF5Q 1JNRB 2Y1IA 1UL3A 2MKCA 4A8MP 4YMEA 5CXTA 5HQ8A 2FJVA 4DOZA 2MMYA 4HI2A 1EKRA 5DDOC 5F9LA 1VBYA 2DIUA 2B56A 1IBLJ 2WVFA 1R8BA 1KTVA 3FK4A 1NEEA 2L9NA 3H5YA 3OFGA 3D6HB 2VL1A 3OJSA 4DR7J 2DHGA 1E6YA 3IMQJ 2CFXA 2V69A 1QAYA 1P1LA 2RHSB 4Y3CA 3QIDA 2VPXB 2DIVA 1NK9A 1EIYB 5KFWA 3C2PA 2PGCA 2RQMA 1OIAA 4OX9F 5E41A 2J6SA 4GMKA 4QIWD 2PT0A 4ZPTR 1A7GE 2RU9A 5A8KA 2QV6A 3M8PB 5KOWA 4ED2A 1RKJA 1Q0NA 3VVTA 1S6QA 5B7WA 3EYZA 4DL3A 3BDPA 2B4UA 1T3OA 3GYXB 2C2OB 3FCHA 1RTDA 2QRRA 2O01C 3LP2B 2LQ5A 4J37A 2ZZNA 4RBUA 3DGVA 1GXTA 4DS4A 3HVRA 3FQKA 3MEEB 3T9NA 3QAEA 3NOGA 1CPZA 4ZVHA 2QA4G 1ELOA 4LF9J 5I3UA 1IBKF 4X84A 1Q79A 3H7HB 4DPOA 3ZZPA 4EO8A 2DRAA 3EJMA 1KHVA 2B9YA 4F36A 1UA1A 3ENWA 3RRGA 3WX8A 2MQPA 2OO4A 5HJYA 5LT5A 2AV5A 2WW4A 1RAOA 3CWJA 1SV5B 4G1PA 5A6PA 1VQMS 2VFTA 1GQEA 4B3MF 4FXDA 1IKXB 4DQQA 4V19X 2DO0A 2X7IA 4PXBA 5HSPA 4Y0FA 2UXDF 1NCLA 3G9CA 1S9FA 3TUJC 2JLGA 1F3VA 5DLGA 3DLBA 1S57A 1FT8A 5F41A 2FVSA 1CS4B 4FNIA 3IAM9 3TP2A 2J0QD 2IAJB 2QT7A 1QE1A 4PKDB 3I82A 2EC2A 3MZIA 1YZ7A 4DBQA 4QZVB 2CPXA 4PEOA 2R7XA 1DY3A 2CYYA 3L7PA 4DX6A 2ZDPA 3HVTA 4CIOA 4NMXA 4XIUA 4PYAA 3BH7B 2J0WA 1XIQA 2A0FB 2E7WA 3CO9A 2DD8S 2EFNA 1W26A 3K8WA 4NZ0A 1SKWA 4MFBA 1SCJB 3JTPA 3I6PA 2EPIA 3NCPA 1SBRA 2JWNA 2OPSB 3D2WA 4UTGA 2M8HA 3LP0A 4DSIA 2Q6CA 3MR6A 3U1NA 4C6AA 4GKKF 2LEPA 5KFFA 2AJQA 1CJVB 2KFZA 4GVLA 5CD4H 1RCXB 3UCGA 4C0BA 2HZAA 1IJEB 3H90A 2CIMA 4RNFA 3HK2A 2N4DA 5DDPC 4LF7F 1F9FA 5EHHA 1NBEB 1BGXT 3FGVA 2KI2A 3FFIB 3RZAA 2FC9A 4NRTA 4WBFA 4B9UA 4GVBA 1VHFA 2VG5A 3N01A 2FJAB 7AT1B 1AZSB 5HROB 5AJ3F 1K8AT 1VK8A 3ZO7A 4CLKA 1CJKB 2EFOA 2B9EA 4OX6A 2C3PA 3JQMA 4UZBA 1MU2B 1TL3A 1X4FA 2PMZD 2ZM6F 3J7ZT 3MGJA 2DHXA 4QIGA 2MY7A 4JI2J 2J8SA 2QC3A 3OUYB 2MLZA 3D6TB 5FLXU 2B4VA 5AT1B 2I9SA 2J7KA 3RB4A 1UEKA 4WYWA 5D3GB 3IM9A 3MCNA 3S8SA 4JI6J 4WYLA 3M8RA 1KC8T 4BC7A 1FXDA 1EP4A 1MROA 4YN3B 3IBWA 3EMTA 1RTHB 1L5UA 4CO3A 3NY0A 5K8PA 1YJNS 3ITHB 2VQFJ 1WKLA 4J9VA 2AF6A 3C14A 3C6TA 3BBFA 3QGPA 3KTQA 1S79A 5L46A 2BW2A 1D1UA 1PYTA 4RL1A 2X1AA 1QSLA 1NSKL 2UUAJ 2XS5A 2CPHA 3BH6B 3L7OA 3SXLA 3Q8PB 4A8KA 1NZ8A 4MK7A 2H5IB 2ZNYA 4O3QA 4OYZA 2IA0A 2CPEA 5D77A 4A47A 3DNCA 2UXCF 4ZS6A 4USIA 5GAHI 1WSVA 1ZOTA 5K20B 3OW2R 2R2SA 4QWBA 5HAOA 5F0UA 4AL7A 3N5BA 3G6VA 3KNAA 1U6BA 4JI5J 2IVFB 3QSIA 3IRXA 2K8GA 3KLIB 3A3OB 3T41A 2JH3A 3NGKA 3N5FA 5C2CA 1U1QA 2EKNA 2CPZA 1T02A 1EETB 1OPZA 5A8RB 3KJNB 2XYPB 3HJVA 3DOMA 2XI2A 4DV2J 2E1RA 3HHDA 2OPQA 2YKMB 2D3O1 5C7PA 1CULB 3QLHA 4OJ1A 1T9UA 2PEHA 4DZ6A 3D1OA 4ZLNA 4PG4A 1N52B 1UVMA 2ZNZA 1VC6A 4OHVA 4NPOA 2DGOA 2OPPA 1S0OA 4WP8A 1VC0A 3W2VA 2MZSA 2W4DA 3OTOJ 4J5OA 5CD4A 4DPYA 1IWAA 3Q2TC 4A8XA 3ISND 1LEOA 1HYSA 2YQ3A 3PW4A 1G4CA 1NZAA 1XN9A 2UVRA 3AAWB 3OHAA 5DZ6A 2AEJA 4NXNF 1S1WB 4CI0B 5C25A 4R8UA 4KV8A 3QGGA 4LF9F 4FF1A 4IFVB 3Q0AA 1NXIA 2D69A 2OFGX 2HQCA 1JXLA 1TP7A 4KPCA 3LH2S 4FN5A 1RA7A 3H42A 2CDQA 4X4QA 3MEGA 4JP8A 2IMWP 3UO0A 1PBUA 2OIHA 5LMNF 2NPIA 3UD5A 2ZWPA 2NYHA 4CTAA 5CYMA 2LU1A 3CJ4A 2W7OA 1OS5A 4C2MA 2QFJA 2I38A 4A8YA 3ZNUA 2JDJA 4X4RA 2BANA 1YBTA 5J2MB 3CMQA 4IUFA 4G1QB 2YWFA 3PACA 3BPDA 1HHQA 2CQ2A 1BUXA 3NKYA 4Q7AA 2XSJA 2KVIA 3OT9A 2ZFHA 2I1RA 4RUAA 3CXCR 3M7VA 3IBCB 3GJTB 5K9FA 3AQOA 1NJXA 1NJZA 3M9OB 4QQBA 4TVAB 4KFBB 3MECA 2Y9HA 1R6YA 2HK2A 2Y8YA 1MMLA 1UMJA 3BDEA 3UQSA 1UETA 1RJJA 2KH9A 3CCMS 2G0JA 2MJUA 2GQCA 2L9DA 1PILA 3GFYA 1EJ7L 1N34F 2CJKA 3JQJA 5KOXA 8RUCA 4Q8FA 2AYEA 4LJMA 1UJ4A 5E7OB 4JI0J 3WDOA 1QJHA 4DV5J 5KFLA 2EEYA 3TNVA 2GIRA 4PQUA 5KG1A 5F8HA 2GAGC 3IWXA 1N8RT 2UV8G 3I5AA 3POTB 1U1MA 5T7LA 4DG1B 5B08A 1H98A 3OFHA 2GMLA 1OY9A 4KGZB 1KVJA 4RWXA 2DTJA 3C6UA 2QA1A 2RKIA 1WF2A 2PC6A 4GO7X 3K5NA 3DYAA 3ZNJ1 2CKWA 1M5HA 3ZTQA 1BXNA 2W1BA 1Q86T 1B99A 5GAGI 3PFEA 4RZRA 4AXIA 3QJLA 2HVZA 3TZXA 4ID5B 5FDLB 4JI2F 1K1SA 4LRBA 1B7YB 2Y0BB 1R8PA 3R5BA 4P71A 1RQ0A 2M52A 3VGUA 1RWOB 5KFGA 4UQGA 4CLTA 2NR0A 3BPSP 2FVPA 4PABA 3KOAA 1XBWA 4JI6F 4UUXA 2WSFC 5GMDA 3ZZ0A 1HHTP 3ILIA 5B0AA 1ZYQA 2YWEA 2RILA 5KFDA 3HKWA 4GC7A 1V6HA 3M1VA 4CM0A 4KH1B 2VQFF 1OJ4A 1Q81T 1G2EA 4USUA 4KB7A 3PEHA 4K4SA 3K8VA 4IOAQ 3C8YA 4DFJA 3KK1B 2UUAF 2D3UA 3FSIA 1UJ5A 3KLEB 3O5TB 3HHLC 4D3GA 2J6TA 1NJYA 3H40A 4ZIVA 4ZJOA 2V94A 3HCXA 1BQMA 4FNHA 1WC0A 1NKEA 1Y0HA 1UFLA 4KE5A 1NDKA 2QL5B 2PI4A 2JOQA 3BSOA 2JHEA 3CMAS 2BZ2A 2VONA 3KHLA 3TARA 1FX2A 4TYBA 4HACB 2J0SD 2KG1A 4JI5F 2ZEJA 4JB8B 1FKOB 5IV3A 3BBBA 3FBFA 5GVQA 3ZTRA 3A3NB 4EU0A 1HLWA 4OYMA 4FF4A 3HSDA 4ERDA 1GTHA 5IM0A 2ZH9A 3CJSA 3I9V9 1WG1A 1WC6A 1WORA 3AJ1A 3BSNA 1NO8A 1SIWB 3G6XA 3PYFA 2HMIB 1YBAA 2E9TA 3V81B 2V34A 2B6AA 1RYRA 4EI2A 1VBZA 1WHVA 2GQ2A 4OV6A 1WSRA 3CCUS 4A8OA 2HLUA 5J1NA 1YI2S 4X4UA 3FEYB 4ECSA 3GR1A 1FESA 4USJC 1NJWA 2XS7A 2ATLA 3M6XA 1UPPA 1JXEA 2GZOA 2HQFA 4ZA1A 2YH1A 1PC5A 2CQPA 3AFGA 5DM6Q 4F67A 2DNNA 3TA0A 1LOUA 3B6BA 3DU5A 2MHNA 3GFHA 2ZZMA 4D3HA 2BX6A 1F5AA 4XO0A 3FEXB 2MYFA 3DOKB 1KVKA 3D6FB 1NK4A 1TMMA 4J9LA 2PN6A 2VOPA 4KH0B 5KG5A 2GNKA 1HNWJ 1QUPA 3ILOA 3TUZC 5EN1A 4IH6A 2VKRA 3CT9A 1HI1A 1NPRA 4P2MA 1OSCA 4ZP8A 1SB6A 5HMXA 1SKSA 2UVUA 3MPYA 1K0VA 3TEHB 5KFYA 2ALZA 4U6PA 1C0UB 4ZVRB 1TFWA 4NI2A 3RG6A 2N7CA 3FDSA 4N77A 4NZ6A 4TU9A 3EUNA 3P3DA 3GFXA 3S6EA 1IR0A 1F6TA 3CDBA 4RW7B 3FSXA 1S1XA 3N0VA 1WD6A 1YJRA 2RMLA 4DR2J 1FERA 4DCOB 2BQRA 1UCNA 2O66A 4DCPB 1N32F 3PJ9A 1R3NA 2ZHOA 4QU7A 4WXOA 5DQIA 2DH7A 3Q8SB 3HFZB 2QYGA 2V9KA 4ZVTB 2ALYB 5AXKA 4ANEA 4IFYB 4MTPA 4ETXA 4DV5F 4K2JA 1HW9A 3R8YA 5J1EA 3G96A 2BA9A 2BE2A 5HN0A 2KFYA 4PAAA 2OAUA 4UZCA 2YNIB 4M5GA 1BWEA 3UCZP 4WFZA 5M2UA 2VBYA 3ETOA 1RWMB 1SC4B 5KT4A 2QLWA 4F4AA 4ZVFA 1Q5VA 5F8NA 2VG7A 2DJWA 2Z0GA 1LNQA 3FRZA 3F0NA 2F4VJ 2HFSA 1X9MA 1BWVA 1U02A 4RNMA 4Z2XA 2RIJA 4K2XA 2HNDB 2BJDA 1Y5NB 3QFWA 2GJIA 1NU4A 4TLQA 3FNNA 3NGRA 2YKNB 1WKJA 4C97A 3OFEA 5DG8A 3MCSA 2GIQA 2QMUB 1B4SA 2NS1B 2RUGA 4YB6A 5L1LA 1RB0A 3DDNA 2F3JA 4DUYJ 3PM9A 1X0PA 1F5BA 4HL9A 1E6YB 3EWGA 2N3OA 3MM5A 3NNCA 1FTRA 4JYAF 5L1IA 2DNPA 4M5DA 3AT1B 5A6WA 2C3OA 4U7CA 1ICEB 4OLPA 3BYRA 2W9AA 2E1PA 4G1IA 4HI1A 4IR1A 2MLXA 3UN2A 3RW7A 1DBDA 2DB1A 1XTZA 4C8MA 3KLGA 1D3WA 4PQAA 1TKTA 1CJTB 5DETA 2E5LJ 5DGAA 5DJBA 1CVJA 3A1YG 1JJHA 4FYVB 3BZQA 1TR0A 3AY0A 5I4MA 2G2OA 1NDCA 4U8VA 1S6QB 1Z4UA 2VFVA 1QAXA 3R5AA 2MQLA 2ROGA 1RAIB 2PA3A 1KLMB 1RTDB 3K7RA 4Q2LA 1VQNS 2M3DA 4R5PA 1RTZA 2ACYA 2E5GA 5K14B 4JV2A 1CEZA 1SUQA 3O2IA 2BM0A 3KYLA 3NAIA 3OBIA 3MMCB 3CDAA 1FNXH 3EVOA 3OTBA 3FMBA 2M88A 4RW9B 4NXMJ 1FHTA 4LRAA 1WF1A 1WEXA 1NK5A 3W65A 2BKPA 8ATCB 3ILJA 1V9OA 1JLQB 3HHLA 5KFMA 4LF4F 2B51A 3IAS9 1WI6A 2OMOA 2AJ0A 1A9NB 3H2VE 3G2XA 1WACA 3BR9A 2Z58B 1AW0A 3QT7A 4OJHA 1TZ0A 2UXBJ 1VR6A 4RLEA 5ETPA 1C0TA 2W4PA 5CYQA 2JL9A 1X4AA 3A8KA 4CRJA 1VQ6S 2N7YA 4FYWB 4ZPWR 1SVDA 1HQEA 2A1BA 3CW2C 1QE1B 5DO2A 2Z2ZA 5L38A 2EK6A 5JUMA 2FB0A 1Q8KA 2EG2A 3Q8YA 4JV0A 4Q8EA 3VAKA 4RUHA 1D9AA 3IWLA 1WG5A 4TKTA 2OI2A 2W7PA 4ILRA 2HHHJ 4NLGA 2RAQA 4O23A 3OTEA 4CO4A 1WDTA 1RAAB 2MQOA 3CULA 2GVZB 2V50A 3G82A 5D4PA 3VHQA 4DHVA 1RHQB 3E51A 1MNEA 1U6ZA 3HHEA 2VD3A 3GILA 3C16A 5EWEA 1SKRA 3IA0A 1E6VA 1RT5B 1U0HA 3ZZTA 5DGBA 3UDLA 3M8ZA 3LP0B 1TUWA 1SC3B 3PW0A 3GU0A 1BQXA 2YWHA 5KFCA 2LDYA 3HD2A 1SJ1A 3ONQA 5J2NA 2BYCA 5E3AA 2RNEA 3DLKB 3HD1A 3ADAC 3C15B 2H1YA 2XZTB 5KT7A 1DLOA 1YRUA 4CLUA 2FC8A 5CQGA 4DR4F 2XHCA 1O0PA 4C9DA 1HNVB 2VG5B 5ETNA 2FDNA 1H2UX 1FJ7A 2EBEA 5T14A 4AXJA 3I31A 3RBEA 4AFFA 3T3FA 2FLOA 4DR2F 2HWTA 4L75A 2B0GA 2E7XA 3PNIA 3J7YU 2IA6A 1L3VA 3R5DA 2UUBJ 5AE1A 1AUDA 4OL8A 4Y2AA 4Y6IA 3EICA 2E9RX 3GZ7A 5GADI 4DUZJ 1RAJA 5KG2A 2X3GA 5D0HA 2IYIA 3G8SA 3MMAA 4N41A 3IR7B 4FF2A 4PR6A 3K59A 2ZH2A 1JJ2R 3AXMA 4CLYA 3SCLE 5BR8J 5KFKA 1EP4B 1MROB 1C1BA 2KRBA 4P74A 4F26A 1RT2A 1FFGB 1YK9A 4CT9A 1M5OC 1JXVA 1T03B 4LREA 2VODA 3AB2B 1KN6A 2CPIA 3OSNA 3MEEA 5JVGQ 1R7IA 2K7JA 2XYGB 1YBUA 4CM2A 2DCUB 1TV6B 1RISA 1HW8A 5LXYA 1TL4A 5GMEA 1RXOB 3M2VB 4O3NA 3W8GA 4FKYA 2XY7A 1NDLA 3KDNA 1RHJB 4RUCA 4TY8A 1X4CA 4ZMMA 1U1KA 1RKIA 3SSSA 2MQMA 3DKDA 3CEDA 4RR5A 2VIHA 4KQZA 4WF9Q 5BYQA 1JLGA 2GVDB 4S0MA 1U49A 2DRBA 1IJFB 2KG0A 2Z4PA 3CCTA 3JSBA 4DUYF 3GIKA 1VC5A 3MM7A 1K0TA 4OYAA 1GX5A 3I55S 3VAMA 2DBBA 3N79A 3IRXB 1IKWA 3K58A 2LYVA 1W25A 4OYOA 1RT6B 5AXMA 2IAJA 2XS2A 3NLCA 1HA1A 4A4JA 3CJKA 2M4MA 2BOPA 3Q8VA 2OPQB 2DR8A 2UU9J 4IQXA 1RBOB 2GCFA 1BQNA 3GMGA 4JBCA 2OPPB 2EXUA 3V4IB 4HH1A 1P9YA 4OV1A 1UJ6A 1ZS6A 1URRA 2XGPA 2MQQA 3W2VB 2VQEJ 2UVWA 3D3CJ 3RB3A 4OFZA 1LFPA 4G65A 1U47A 1HYSB 3EPGA 2R2TA 1R8AA 3UVJB 3W7BA 2HHQA 3T1HJ 2E44A 3W66A 4ECRA 4J9MA 1KQGB 5C25B 4R8UB 3ZZOA 4KV8B 2P9CA 2IJFA 1ZM4A 1FRIA 3V6KA 1W7WA 4OQJA 3RAMA 3A3PB 1DTQA 2GA7A 2HFUA 2OPRB 3Q83A 4NXMF 2B43A 2VC1A 4J9OA 2EFVA 4UOFA 3NCQA 3GSDA 1M1KT 1WELA 4ZVUB 4PWDA 2R8IA 1H6KX 1NPKA 2ZZTA 3MEGB 1VQYA 4O4RA 4LIWA 3M05A 1NRKA 3GIJA 4ANCA 1NPPA 1AZSA 5CZXA 4CTAB 5CYMB 3CVKA 2DXEA 2FZKB 2V2KA 2D3OR 3MPVA 3K17A 2QLFB 3TZWA 2C2KB 4N76A 5HVHA 3AA9A 1I51B 2BANB 4MKVA 2M8DB 3DM2A 3MM9A 3WC2A 3V2UC 5C5JA 3A8JA 4ZVGA 3M4XA 3MD3A 2F9DA 1U48A 1WDDA 2O1PA 1TKDA 3ZFVA 2HZCA 3HP6A 2Q6BA 3HSGA 5D3GA 2GO9A 4EZ9A 1NSPA 1NH8A 4DSLA 3MECB 3GTYX 2R3VA 2EWHA 2DNKA 1DQAA 5D4NA 4CLWA 4Q44A 3MUMP 1R8CA 2IRYA 1GMVA 3E01A 4NCGB 1MWZA 1T05B 1H0HB 3A12A 2GJFA 2F65A 2VPWB 5K5MA 3BKTA 4I68A 4DPXA 3CIZA 3R6LB 3JAMU 2V6AA 1HQUB 4NZ7A 3LW5C 2QLBB 3PYGA 2V9WA 1DQ9A 3DXBA 2JFDA 1SL1A 4DI6A 1JLCA 1NSAA 4X4SA 1VRQC 3ILLA 1HNIB 3ENQA 3VVUA 1U2RA 2WK4A 2FGCA 2YNFA 5T7LB 4DSEA 4PUOB 1WHWA 3HFVA 5DZ7A 3MFHA 4K8RA 2P9GA 2DXDA 1HNZJ 3LO3A 3SQOP 5EGYA 2RKIB 1GNKA 3UD3P 5KFAA 1S6PA 3FZBA 4LFCJ 4ETZA 3DLHA 4ZDNA 2AYGA 3Q86A 7FDRA 4DEZA 3R9LA 1XMQF 2A18A 1U09A 3BO3A 4KT0C 3QT6A 4C8KA 4OZ2A 3VAFA 6FDRA 3N9UC 4WP9A 2UUBF 2GGPA 5A8RA 1CLFA 4WFNQ 3EVMA 2KL8A 2DHHA 1HNXJ 1VQ5S 4X2BA 4LRCA 2CQ3A 1CULA 2K7KA 2E9ZA 2MZ1A 2M7SA 3NGDA 2LKZA 4L76A 4OYPA 1XJWB 2KKHA 4BDPA 1RADB 3AA8A 5E3RA 3CC2S 1IQZA 4B17A 4I2QB 2CJYB 2JC0A 3I9ZA 4UUWA 5ETMA 3MMBB 2IC3B 1ZBTA 4OI6A 3VR1A 2EFQA 3M1VB 1B7FA 3IN5A 3PTWA 4F2RA 1KWMA 1XNQF 1UW4A 2KFNA 2MGZB 2GO8A 4L73A 3DHXA 3EXYA 2YKQA 4FP9A 4HVZA 1EZZB 4F04B 2OEKA 2HSEB 2BABA 1Q7LB 3N6MA 3UDEA 3UNGC 1WJ9A 5FD1A 1BQMB 2C1EB 1FRJA 4ZPAA 4MIBA 3BF4A 4ZN1A 1C2PA 5A0YA 1LQ9A 4WCEQ 1GAOA 2OSRA 4P2FA 2AEFA 2VF3A 1UVJA 1Q5YA 4YUDA 3BQ1A 1Y9OA 4Q43A 4L3KA 1PGZA 4NLVA 2HHUA 4B3TF 3GV5B 3ET6B 1YGYA 5J2MA 2C3MA 3NS6A 2UV8A 1ZAVA 2MQ8A 4B9LA 4OZ3A 2ZH3A 3N6LA 4C8ZA 3F56A 4EK2A 2HHWA 4PG6A 1VOMA 3JXOA 3U7JA 2KZMA 4DV0F 3PX0A 5CCMA 1SQEA 4KFBA 3EM1A 1FDNA 3LGNA 1NJIT 5ETTA 2B6AB 1S0VA 2CZ9A 4DJBA 2CZVC 4YHHF 2Q79A 4LSNB 3OPKA 2KJVA 3OTCA 2VQEF 2X1FA 2V5HG 3IS9A 1P9QC 1YVFA 3W5ZA 1U2FA 2GJ2A 2ILYA 2MZQA 1WUUA 3EZOA 3J80Y 2W2PP 2WB4A 4C8YA 1S97A 4BWMA 3IBFB 3NP5A 3DHWC 1ZM2A 3OJUA 3EGNA 4ZVPB 2CQ1A 1IWGA 2J7WA 5IT4A 1REVA 4Z7YA 4DX5A 2L3MA 2MKKA 4IH5A 4YQWA 3V6HA 4CO2A 1LW0B 3KMQA 3BSCA 3RB0A 1T9WA 3P6YC 3OXLA 2XG8A 1HWUA 4HLBA 2FJDB 4YY3J 3CD6S 2E1CA 4WIQA 4LF1A 4RNOA 2M2BA 3JSYA 1V3RA 1RZMA 4USKA 5KFHA 3C46A 4ZKAA 4OZNA 1LFWA 3CCQS 3RR7A 2FHOB 4IO1A 5CZVA 3TVZA 4E0DA 3NXZA 1RK8A 4F7VA 1JJCB 5DS7A 1RT7A 4DN9A 4WKYA 4XTTA 1ULRA 2OMLA 3W2WA 1YWXA 4NI2B 1HBNB 4ZLPA 1Z2ZA 2VA2A 4B9NA 1JLBB 1YG0A 1ZA1B 5KFTA 1S1XB 5KFOA 2EBGA 1X5SA 3WHIA 4DV7F 5BYSA 3PY8A 4OZ0A 2HFVA 2WTFA 3MTJA 2D3ZA 3GYGA 3JTNA 3DLJA 1LK7A 3KUHA 1N54B 2DYAA 4B3SF 5DQGA 3WX4A 2Y0SD 1HWLA 2LQBA 4C3LA 3CO0P 5HMZA 3HHLD 4YDXA 1R6VA 3AHPA 4ZPCA 2UP1A 2HIQA 2FHKA 5J1EB 4DR3F 4FPRA 2HRTA 4MKBA 3M6UA 2ZBRA 2DHAA 4YDDB 3PHEA 4H4OA 4FYXB 2NLWA 1A6LA 5LSRA 1EHWA 2CXEA 4FYDA 2BBEA 2PSZA 5IFMA 4OZLA 4IRCA 4B3OA 2X51A 3L3CA 2VG7B 5IT0A 1T9XA 4AT1B 3KJQB 3IXQA 4NLPA 1GMWD 4DPWA 2NUHA 3VV2B 3H2UB 2VICA 2ZH5A 4DQRA 4WU3A 5A2QY 5CA5A 4FBTA 2XWXA 2XY6A 2RDJA 1HHSA 4ED4A 2ZUAA 3ZTOA 2ZDOA 1FEHA 2VPZB 2MTLA 2YXLA 4ED6A 1RWWB 4IOBA 4IG3B 1KDNA 5E33A 1T7PA 4USWA 1RGVA 2QLXA 3QWPA 2Y1JA 2UXDJ 4MIAA 1RHKB 1S49A 1S48A 3MM5B 3IRWP 1WC4A 2DEJA 1U1PA 2E7VA 3EX7B 4M5DB 2C22A 1KEKA 5IC4B 3AQPA 4EBDA 1Z1ZA 4WPAA 4DR5F 3V6JA 1FDBA 3KLGB 3CNQP 4F3QA 1TKTB 5F3TA 5HJXA 4N7TA 5KTQA 3PYEA 1VQPS 4OX7A 5HL7Q 2I6WA 1D9DA 2KB2A 5KFIA 1FJGJ 3TR5A 2LXFA 3VALA 5L1JA 2ASYA 1NDPA 1X9SA 4R5PB 2ZUGA 2UZAA 3OD2A 3D3BJ 3HSJA 1OMSA 3DOKA 2V2QA 4ZLLA 2DY9A 1SUQB 4OJ3A 7FD1A 3FCWA 4U7UK 4GKKJ 3BGUA 1KHWA 4ZIWA 2XB2D 4EBEA 2Y1LB 4MKAA 5KG6A 3F73A 2IFXA 4KTQA 3UPFA 2HS0A 2ROPA 1S6OA 1FRLA 1GEHA 2E1MC 3MXHP 3M30A 1U26A 3R7SB 2HAFA 2VDIA 2XO6A 3IG1A 2XCAA 3IWNC 3RUBL 4B08A 1VQ8S 1C0TB 3QZ8A 3JSMA 2R8KA 2HURA 1Y4ZB 2Z8QA 1UPMB 4ECUA 4OLOA 2ZM6J 2J5AA 2PI5A 2K06A 1F0XA 4XK8C 4J9QA 2G2YA 1HQEB 2ROEA 4M5MA 2LA6A 3NBPB 1X5OA 3AOAA 4RUBA 3HJFA 3DRPA 3OHBA 2WAQD 2MHEA 4V1Ak 2O5DA 4J7CA 2ZITA 1KSPA 4DZDA 4N5SA 4F3OA 2OTJS 3OR2A 3J81Y 4NA3A 3J7Z5 1SJ4P 2KZZA 1OY8A 3NL0A 3G82B 2C2DA 3HM9A 2XMMA 2XC9A 3C16B 1HWKA 4HDHA 4NE9C 1NK6A 4NLWA 1E6VB 4OZ5A 2MPUA 4YY3F 4LMZA 1VQKS 4F3MA 3ZZZA 1I1GA 4HHHA 3UW1A 4W92B 2Z2LA 1RWVB 5THWA 1AB8A 3CTRA 1DARA 4RW4B 4ELTA 1ACMB 1B70B 1YITS 3RB6A 5J2NB 4WFBQ 1FEEA 2MXYA 2RJZA 1VFJA 1R89A 1S10A 1QAIA 4LIRA 4QW9A 1DLOB 4UT4A 2UXCJ 5MAOA 2YKNA 2QX0A 1WHXA 3PZPA 4DL2A 4URSA 2QE5A 3UNYA 3PVXA 4AQYJ 1XMOF 3AOBA 3GQCA 2GMHA 2KJWA 3RU0A 4X62J 3IGNA 4UY8T 4X4NA 4PWUA 2VFUA 4B9MA 4ZJQA 3GE9A 4QJVA 2JLFA 2MDAA 2KXNB 3R7NB 2E5JA 1L3SA 2UUWA 5KFUA 5HBMB 2VKZG 3X3UA 3S7RA 3DI6B 3NGTA 3MTKA 1RA6A 2NSCA 3MR2A 1CJTA 2DNMA 4J90A 1APSA 2XZWA 2CQGA 3FJ2A 3I0SB 3MMAB 3D67A 4CYUB 1SXLA 4WJBA 1KNZA 1BC6A 1K9MT 1YJTA 2B4PA 4CQ1A 2B5JA 3TQ1A 5KFJA 1KTQA 1C1BB 2I5JB 1RT2B 3RW6A 3PX6A 3R6GB 4I7FA 1KLMA 3KG0A 1JLAA 2OEJA 3HFKA 3P96A 5SZTA 5KFPA 1FI4A 1MWYA 2PMWA 4PPZA 3HZEA 1VQ7S 5K14A 3LQVA 3W64A 4NXNJ 3SV3A 3SIPB 2XMKA 2EFGA 2ZH7A 3MMCA 2AJ1A 5M2PA 3P49B 3ISNC 3BKUA 1FE4A 2HHSA 1FNMA 4RW9A 2WVBA 3OL8A 1VIOA 4TY8B 4DU7A 2RQ4A 1GXLA 2G2ZA 1JLQA 4OI4A 2J9EA 4LF6F 3TAPA 1T94A 5LMNJ 2MZTA 1JLGB 4KHPF 4DF8A 3RBZA 2BJ8A 3ZZUA 2QA2A 1R27B 2POKA 1LWEB 2VJVA 4XDDA 4FDFA 2Y8WA 4LBIA 3MM7B 4YP3A 1JKHA 1NK0A 1GFWB 2COLA 4ZCIA 3M32B 1IKWB 2R7WA 4H4MA 2R2UA 4C8LA 1KOOA 4CO5A 1I94J 1ZM9A 2H48B 2LP4A 3H4DA 4N8OA 3MR5A 3HF5A 4ZVEA 1Y3JA 2FZGB 3P8BB 1LKZA 3CJKB 4F8RA 1MWQA 4HEA9 3AB4B 5IT9Y 2CPYA 4ZVQB 2N82B 4UOGA 4FVMA 4K4YA 1BQNB 3MR7A 2DH8A 1V5IB 4X4TA 2GVZA 3MF5A 1FJGF 3B4DA 1HBMA 1N34J 2PO4A 1VDHA 3MHYA 4JI1J 1HD1A 3HT3A 1SIZA 1RT5A 2CPJA 3G86A 2WBRA 4LT6A 4NEYA 1NHUA 3US5A 2OKQA 4TLRA 2AZ1A 4USTA 2BRKA 3PG9A 1Q78A 2HNZA 2WONA 3OSPA 5CAAA 5E3QA 1DTQB 2M5YA 3WZ0A 5HVFA 2BJ3A 3DLKA 2Q66A 3C15A 4MK8A 4WKRA 2ZJRQ 1K47A 2XLIA 3SDEA 2D9PA 4UW2A 3DRXA 4PWDB 3DOLA 5BXIA 4J9RA 5AXLA 2NPFA 1HNVA 1XERA 4U9RA 3AH6A 2OGUA 2EK1A 2RSQA 4C11A 3CUNA 1V5VA 2XMAA 1WKKA 3JYTB 2HS4A 3H0PA 2KM8B 1QM9A 2MQNA 3G71S 1D8ZA 3DM2B 3MM9B 4FPIA 3EVWA 3W61A 3KLFB 1MW7A 4OHWA 2YX1A 2OEMA 2B7CB 1GT8A 2FY1A 2AWZA 5L39A 2D7SA 4NEZA 3BR8A 2IRXA 4DSKA 1Y10A 4Q0BA 4YR0A 4O3OA 1TL5A 2ZJPQ 2KXHA 2YPYA 4EGLA 4PG8A 2DH9A 3THTA 1T9YA 2IY5B 4WZQA 1A0OB 3K57A 1T03A 3E01B 3T1YF 4ICLB 5D0GA 1WC3A 4LR8A 2DNRA 2GQQA 3PDNA 2VPYB 1TV6A 4M5KA 4YB1P 2IIHA 3VZHA 4TU7A 4MK9A 3M2VA 1JLCB 1S9GB 2IM2A 4IRDA 5L8RC 4NOHA 3IR6B 3EGWB 4M5IA 4K50A 2YNHB 2YNFB 3EDQB 3DRYA 4O0IA 1JJ4A 3BO2A 4FXWA 2EG1A 2AGOA 1YQHA 1DQ8A 2G4BA 2GVDA 1T9VA 3RJMB 2VG6B 3CB4A 2RF2A 4QW8A 3KDOA 3CDUA 4AQYF 1PBAA 3N6NA 4P52A 1S6PB 4HTIA 3PW7A 3P45B 4X62F 3M8YA 3OVAA 3MWBA 1G3OA 1TELA 2L48A 5H9FJ 4TU8A 2GAHC 4HDGA 1HKAA 1RT6A 4J9KA 3T6BA 2BE9B 4WP3A 4DX8H 1RCOB 2ZWOA 4K4XA 5HQMA 2HWHA 2GGPB 4ENOA 2CPDA 2CQ4A 1H2TZ 3RRKA 5D8HB 1WF0A 1PG5B 3WIUA 4QU6A 4K0KF 2CJBA 4RW6A 2L9WA 9RUBA 2CVEA 1F3FA 2CADA 2F9JA 1YKWA 3V4IA 1N6QA 4LR7A 1IUJA 4ZN3A 3B54A 3TUIC 1VLYA 1CC8A 3MM6A 3MEDB 1UKUA 1BE4A 4IG0A 1RHUB 3DMJB 3UVJA 1F9EB 1RHRB 5KFRA 3K5MA 4DL5A 2OJ3A 2CA9A 1HWJA 1AROP 4I1TA 1WC5A 2KT3A 2YQ1A 3JTOA 5LSLA 2OPRA 3N4WA 3I5BA 1SJRA 4JI7F 2IHR1 1S5ZA 3HVWA 1O51A 3BSAA 2H3EB 3R3TA 3Q24A 1SJ3P 2QMXA 3SFGA 3VQTA 1TQLA 3LAMA 4LSLA 3HZGA 5EWFA 1U4BA 3MCOA 1J5EF 2AJFE 2OFHX 3G8TA 1Y3KA 1ZZNA 4BBYA 2ZH4A 4DFKA 5A0YB 4QYZJ 3QRRA 4WFYA 1X8DA 2HVHA 4Y2CA 2WVEA 3CCJS 1IR2A 3LAKA 2DITA 2IDLA 3TO8A 3JB9k 2GMJA 3P5TL 3MAQA 2V8HA 2DGTA 1FRMA 3QRQA 2CWXA 4ILMA 4PXDA 1I94F 5L1KA 2GC8A 2N3LA 3LOUA 1BLUA 1WHYA 2P6TA 2QMWA 3ZXWA 2Q1LA 4RX6A 2XNQA 2E66A 3W62A 5D15A 2V67A 2VFSA 3O1LA 1N32J 3W3SA 2XULA 4J9PA 4YB5A 1ROFA 3NG8A 3DLLQ 2XY5A 3CCSS 1JLFA 2HGMA 1FWPA 4NCGA 3IS9B 1T05A 1D9FA 1HMVB 1KQSR 4WTOB 4BLGA 4JI1F 1W2BR 4KKOB 1HQUA 2HBQB 5GAEU 1U24A 2RRBA 1FO1A 4QCLA 1FFSB 4BC9A 2E1AA 1G7CB 1FKPA 2LU2A 3UN3A 2NXUA 1REVB 3MEKA 1HNIA 1O5JA 4M8LA 4A8QA 1U1OA 1UVNA 2X1BA 2ZOMA 4YEAA 1JQGA 4N47A 4KHMA 4PUOA 1GK8A 1VYAA 5KFZA 2ASJA 2ZH1A 5E0OA 1VJQA 4FVCA 1L3TA 1KRPA 4AD6A 4B3RF 3LF0A 2W8KA 1OYEA 1CJUA 2CJ9A 1IR1A 2DR9A 4X65F 2P6SA 4F4ZA 1KS2A 3OXFA 1ZTWA 2KTQA 1SQGA 5D0EA 4DN0A 1VI7A 4UOCA 1RT7B 4YR2A 1HBOB 4CH7A 1TKXA 1WC1A 2LQJA 5EUHA 4DQSA 3W2WB 2MY8A 3NGUA 1DZ5A 2RU3A 2DNQA 5I42A 2NXEA 1TUVA 4C4WA 1AFJA 5I3PA 3KFWX 2CG4A 1QSYA 3UE2A 4CO1A 2K3IA 3K89A 5DM7Q 1RABB 1SH3A 3RTVA 4JYAJ 6FD1A 5C42B 1KKHA 2D1CA 4I2QA 1X31C 3D6MB 3MMBA 3GV8B 2IC3A 4P2XA 4ZVSB 3LTOA 2BRLA 1N0VC 4LR9A 2V68A 1Q4RA 1KR4A 4OYIA 2R8JA 3ULHA 5F8MA 1ZAWA 4I0WA 4OZJA 2MGZA 4X4VA 3HULA 1MLAA 1RTJA 3EXCX 2XMVA 4IH7A 4U67Q 2DNHA 3R97A 1UWAA 2W8LA 5FIIA 2J9CA 2R7UA 2ZBPA 5LJ5Y 4H4OB 5ETOA 2WVCA 1J5OB 1LXJA 4M5JA 3KLHA 4WZMA 1X4GA 3D68A 3AJ2A 4B3OB 1M90T 4QIEA 2JEJA 2CVIA 1IKYA 3D54A 3UN5A 2K3KA 3CCWA 4DUTA 1M1GA 2JSXA 2R2RA 2CQCA 3ET6A 4LVNP 2AJ4A 2C42A 1UZHA 4LF4J 2XO7A 3L9ZA 4FKXA 2R7OA 4KR0B 3LWMA 3RAXA 5RUBA 3R27A 1L3UA 3H20A 1TL1B 4ZOSA 1TL7B 1B3TA 2A2CA 4PXCA 2HW3A 3T9ZA 1MG7A 5LSOA 1UZDA 3NEKA 3SQGB 4ES2A 2BJ9A 4LSNA 4LF5F 2A2DA 5K8MA 1KP6A 1OQ6A 2ZHAA 3QT8A 3E3XA 2L41A 3BV8A 4ELUA 4DWIA 3TQEA 3TAMB 3FCVA 6AT1B 4FZVA 3PKYA 4OHXA 1KD1T 1Q8BA 2DNYA 1RI7A 4E98A 2H65B 1FE0A 3HO1A 2GV1A 2CWKA 4MH8A 5F3ZA 3MPDA 3C66A 4F0KA 1HD0A 5KFNA 1LW0A 2FYXA 2V8PA 3AODA 2QFIA 5FJ4A 5J2PB 5HANA 4QWAA 2MEWA 4USMA 3BJYA 2C28A 3IGVA 1S76D 2YKOA 2J76E 1RUSA 3OL9A 5D6GA 3W8PA 3UI3A 1J27A 3CCZA 1U8WA 3C3LA 2V2ZA 1YJUA 2FQQB 3D5MA 3CJ2A 1H74A 4YS2A 4KYZA 2R4FA 4F0MA 4DR4J 3M30B 3LP1A 5B0GA 3PV8A 3I32A 1HBNA 2RT3A 2H4YB 2HBRB 1PO6A 3IG1B 1JLBA 1S1TA 2JEIA 2E5HA 3JSMB 3W63A 1LV5A 5D4LA 5L9NA 4RU9A 3GJRB 1H2VZ 3FKBA 1V3ZA 3TZYA 1UEUA 3BS9A 3H5UA 3DGPB 4CNYA 1QVFR 1DHMA 4M5HA 4R0JA 2HAIA 3BN4A 4ANDA 1FJEB 4O44B 5KFVA 2W2MP 3Q2SC 2DNOA 1ZM3A 3DRPB 4H54A 3QATA 1O8BA 1VRUA 1S99A 2C2MB 2QIFA 3V6DB 3SSRA 1ITPA 3PXGa 3FUYA 5KG0A 3OR2B 2V8GA 1S77D 1M5VC 2WB1D 1NSQA 3EPIA 4CLSA 2G1HA 3W5XA 4UOHA 4CCHA 2HFZA 1RU2A 1EQMA 3OFFA 2VV5A 3J7YI 5J2QB 4DF4A 4MT1A 1M5KC 3B78A 3FBBA 4DLEA 4ZP7A 5GMKa 2HYIB 1SI9A 2XLKA 5F8IA 2DGQA 2QL9B 1TKZA 5ITHA 2IM0A 3ZZYA 1D8YA 4QWEA 2YQ0A 4KY3A 2H51B 3PW5A 4IG3A 2HHXA 2LCWA 2Q3PA 3QNWB 2CNNB 4L3NA 3NWGA 2W25A 5L9XA 1U2CA 1LWXA 2QLJB 4C7QA 4B02A 2HGNA 2QZ8A 3KLVA 2JFKA 2J9DE 5IWAF 1N36J 3MD1A 3RAQA 3MM8A 2F4FA 4OI3A 3A13A 2HPUA 2XNRA 1YLXA 4OYBA 1KFSA 2NQPA 3D7SB 3L95X 5G0RA 5FLXY 4CLLA 1Q7YT 1B64A 4DV1F 2B5JB 2XSFA 4I7FB 3S01A 1TK0A 5LMUF 1JLAB 2XZDB 3DLEA 1BD6A 4F25A 3X1LB 1DJ0A 4HR2A 2RDIA 1DRZA 3U02A 4EEYA 2Z2YB 3TRGA 2KM8C 5KT2A 3SEOA 2HNYB 3THPA 3F41A 4NWBA 2LEAA 4NA1A 2AD9A 2IYGA 3BBCA 4Z37A 1RT1A 1SJFA 2Z30B 4F4WA 4HHJA 4OI1A 4DV3J 4HTJA 2GIFA 2AX1A 4ZHRA 1NUEA 1VIXA 1NB2A 2NXCA 5F8LA 4LRDA 1OPIA 2WW8A 2QG9B 3I0RB 1N33F 3RRHA 2N4CA 3WC0A 3QIPA 1KVIA 3DLGA 3TJAA 3CC7S 4M94A 1JKHB 4KO0A 3EGVA 3BB5A 2P9EA 2R7VA 4NMLA 5A8WA 3PR4A 4IRKA 4H4MB 3NBPA 3G87A 1X9WA 4DLGA 4JI3F 1RT4A 9ATCB 1VJWA 5LXRA 3VCDA 1MMDA 4N56A 4MIWA 1X4HA 1JIHA 3NS7B 3N28A 5DRKA 5T41A 2FJWA 4E8UA 2BACA 3CD7A 4LF8J 4NLXA 4OYWA 3MDFA 1P1TA 3QT5A 4PWWA 1XC9A 4URQU 1GX6A 4W4MA 4LFBF 1SH0A 4PCQA 1IQTA 4ECQA 3EDRB 2AYMA 1HBMB 3SSQA 2W01A 4DXLA 1RWUA 3P4UB 1AA1B 4K5SA 2W7AA 4CWBA 5HK4A 1KLNA 1FVQA 4J9SA 3J81j 2F7VA 4KPYA 5J1PA 2HNZB 2WONB 2BQUA 4RW4A 1YJWS 3ELHA 2XCPA 4QIVA 4DV4J 1S1VA 3FBEA 2RB7A 2LEBA 2GX8A 3SDEB 5H9EK 2ZBCA 1R0AA 2VU5A 4R25A 2ADCA 2Y1RI 5DDRC 1XWLA 3DOLB 5E3CA 4PZVA 5HATA 2HBZB 5H1SV 3R2DJ 3KG4A 1VRTB 1RSCA 4C11B 1IBLF 2IRUA 4AL5A 2CJQA 4ID8A 4DR7F 1PCAA 1XMQJ 3ENAA 2B3TB 4UF4A 2DGUA 1JX4A 1LWCA 1G6BA 3C19A 5KFXA 3M2RB 3WBZA 2Y3YA 5HBMA 3DI6A 4L6V3 5MLCV 3FEZA 4DL6A 2XMUA 1RAGB 2FTRA 1RTIB 3OL7A 2LMIA 4J9UE 2B9XA 4AL6A 3I0SA 2MLYA 4CYUA 1TMJA 3PRVA 1WWHA 1C4CA 1TAQA 2BUNA 3DXSX 4Q0BB 3JQKA 1PJ6A 2CQIA 1UWBB 2HQIA 1HQ2A 2QO3A 2I5JA 2Z2MA 4Q2MA 4U95A 2LQ9A 3IFEA 1TTHB 5KAKA 1U0SA 1T8EA 2ZVSA 1XNQJ 3H5SA 2DNZA 2DY1A 2J6UA 4C0HA 4PG7A 5HI7A 5LJ3Y 3U1MA 5KFSA 5B0EA 4DS5A 2MKHA 2CQHA 2BE7D 2GHPA 2NCKL 1U1NA 2AKWB 3M2UB 1K73T 5EX0A 3ZTPA 1HR0J 2RF2B 4Q5VA 5K8NA 3DRRA 3KG1A 1LWEA 2WCXA 4DU8A 2QGFB 2OHDA 5LL6d 2GFFA 1WOSA 2YWKA 3H4BA 4B3TJ 4QWDA 2WSEC 4WFXA 4O4GB 2BDPA 3D0HE 2WZ1A 3TJ8A 2RD5C 3M32A 2FPHX 1ZZFA 2YKAA 3KK3A 4ZPBA 1LWFA 2LFVA 2WSCC 3EGZA 3GWCA 2P5VA 1Q8IA 2HQDA 4BS2A 1R0CB 1N36F 4JI4J 4LBPA 3NCRA 2CRLA 3KKFA 2QN6B 3RBDA 2YVSA 2F40A 4RW8A 4DV0J 2NXNA 2C3UA 2UVVA 2W9CB 5KFQA 3T5JA 1OQ3A 1VQOS 3KHRA 1Q53A 1IM4A 2VZ9A 4RW6B 2DKOB 4TQRA 3CIMA 1S72S 4XAKA 4YHHJ 1N6QB 1XEZA 2YY3A 4I2PB 4F2SA 1UTAA 2XMJA 3PFOA 3MM6B 3M9NB 4ECWA 4ZJLA 4RNNA 4WU2A 2XM3A 4IG0B 1YHQS 2XEXA 4M1KA 1XR7A 3GIRA 3GJSB 4QOTA 1U1RA 4USHA 2R7TA 2R8GA 1FX4A 2JVRA 3SCKE 3PIOQ 2P8IA 1WI8A 2MB0B 1WEZA 3PYDA 1JLEB 3BGRB 3QJJA 3OLBA 3SCIE 4QPTA 4DV3F 4RO0A 1N4LA 4LSLB 3HVAA 2DEIA 3EE3A 2XQCA 2DGWA 1H38A 1L3KA 4NLOA 2ADBA 4CLZA 2W9BA 1IM6A 3IC1A 2ZD1A 1MN9A 4GO5X 4LSZB 2CQDA 1N5YA 5C2GA 3JYTA 2XTJP 3GYNA 3SFUA 1VS3A 4HT7A 3KLFA 3HLUA 1X60A 3BN7A 3I5CA 2JJ4D 4E2FB 3Q22A 1I3OB 4A8WA 1OY6A 3HMJG 3RBXA 3AOCA 2QTWA 2RS2A 1RWKB 2FVQA 1OSDA 1TVRB 1D09B 1DTTA 3DN9A 4DV7J 2NXJA 4NLSA 5F0WA 4B9VA 4I6AA 3RGIA 2VOOA 1S12A 5IV4A 1W2IA 2WOMB 3R5CA 1EKSA 4LF8F 2XMTA 1NKBA 1NMEB 2IVMA 1PKUA 5GAHU 1AT1B 2LLZA 4CZCA 3R2CJ 4M95A 2W2NP 2IMOA 1JLFB 4KHRA 1TUGB 4B3SJ 3T6JA 1YJ9S 4IQMA 1JK9B 4ELVA 2H4WB 3BO4A 3VAGA 1HBUA 4UQTA 4ICLA 2HFNA 2IBOA 5B09A 3L4BC 4MKYA 5F8JA 1U7LA 1IVZA 4F4XA 2RRAA 5HLFA 2JEFA 4DR3J 1FKPB 1S9GA 3LALA 4CLFA 2GW8A 4N8NA 4ZK7M 2YNHA 3BQ0A 2EI5A 4DV4F 4RKUC 5KT3A 3T5LA 1BY9A 3LPYA 4RWWA 2FD2A 3CPWR 4F50A 3KJFB 1RLCL 4YB7A 1Q95G 4NYPA 2VG6A 2G9OA 1CJUB 4HT5A 2W2QP 4USVA 1S7IA 4ZITA 1Y11A 1WG4A 1RP5A 2ATCB 3R7BB 4DX7A 3E2EA 1WOOA 4CDIA 2VBWA 3K5PA 1TKXB 2PIIA 1RT3A 3KJVB 3TW0A 2IJRA 5ETQA 4PRFA 1OWXA 3DCAA 2KRRA 2ZBIA 3HT0A 5JMNA 5I42B 4DPUA 4DFPA 4DV2F 2VC0A 5SUHA 1XR5A 3PHTA 2R42A 1GXUA 2BM1A 4PPDA 1HL6A 2VBZA 5ETKA 3SMZA 2HHTA 1R43A 2LA4A 1WTBA 2OD6A 2AYBA 2JC1A 1K1QA 2F1FA 4DR5J 3OTOF 4ZCLA 3MEDA 2G1DA 2AEMA 3F44A 3DMJA 2JVOA 3NMRA 2XYHB 4ECZA 1NH7A 2EC0A 4CLPA 2H5JB 4JI8J 1GTEA 2C2NA 4ZPDA 1VQSA 2RH3A 4MJKA 3KK2B 1RTJB 1SL0A 2F8HA 2FHJA 5BJRA 1YSJA 3ICLA 2MSSA 1XQIA 5C24B 5A76A 3I87A 5JJBA 1NK8A 4Y34A 4QR1A 5EWGA 3MFIA 3M8QB 2FVRA 5IC6B 1X0FA 4IDKB 3KLHB 4XPEA 1IKVB 3H59A 2LQ8A 3KXDA 1N48A 3H5XA 5F8GA 3KWMA 1YJVA 4PXEA 3QRPA 3A8IA 4C8NA 2LDIA 2AU0A 3R1HA 2HIYA 1HR0F 1Q8LA 4WXWA 1IKYB 2VDHA 2CQ0A 4LQ3A 4KGMA 1S9EA 3OQ2A 2RVJA 3VF0B 2F8EX 2HG4A 4OIXA 4B9TA 2BOAA 4Z7CA 4LVOP 1X5TA 1RE1B 3HX9A 4G3IA 2A10A 4TYAA 4Y2KA 3HSZA 4DDFA 2Z56B 4ZCMA 3IR5B 2E29A 2GS8A 4JI4F 3CDWA 3JSRA 3TEGA 2V8VA 4OJGA 4CNZA 2FVCA 4XPCA 2F63A 3OR1A 3GG1A 1Y5IB 5CYJA 3KMSA 2FJXA 2B8QA 4DQIA 2C2EA 2H54B 1VCTA 2F8MA 4NLDA 3V5RA 1HMVA 1T11A 3LANA 4PG5A 1FDAA 1K44A 3B82A 4TNOA 4OI0A 4DR6J 1VLOA 4P6QA 4KKOA 5HMYA 5GAGU 3DC2A 1DAXA 4IO9Q 4JI0F 3HHKA 4MMOA 4NLRA 4CH1A 5IOLA 2RQKA 1FD2A 2ILZA 1DURA 2C3YA 2X1GA 1NNDA 4LUBA 1N5QA 2RDDA 4LFAJ 1NB7A 1NM2A 4QR0A 1PJ5A 2WRMA 1C1CA 1OYDA 2J0XA 1YTYA 2DGVA 3CJ0A 1PAEX 1WOPA 2CZ4A 3NRBA 1RHMB 1ZPVA 1TK5A 3CJTA 3RYLA 2EKYA 3NGSA 3CE8A 2DO4A 5B0CA 4O0NA 5HVGA 3DRSB 1QTNB 4O3RA 2U1AA 2MZRA 4WWSA 2BJ1A 2NZ4A 3QJPA 2V4RA 1BHNA 4ED8A 4K4UA 1HBOA 2KU7A 1QY7A 4NLTA 3CCRS 3LP1B 1WNEA 3QO9A 3BM7A 1XMOJ 3CJ3A 1S1TB 3BKFA 1X4BA 4RNHA 4ZLJA 2YNGA 4X66J 3QGIA 2HK3A 5C42A 5AXNA 2AIRB 1PYSB 1FD8A 1HPZA 3J80U 1B0VA 5DLFA 1RWNB 5JVHQ 3O6QA 2DPJA 4LQ9A 2QSWA 2IDEA 2LXUA 3SZ2A 4NCAA 2ERRA 1PAUB 2V4JA 4GKJJ 1VRUB 1VBKA 3TYTA 1N56A 4NLYA 4UY85 1ZPWX 4V19J 5A8KB 1UVLA 1EX8A 2OD4A 2VHGA 5KG3A 1VMBA 5HP1A 3OVBA 3UDVA 1NAQA 4BHQA 3Q8RB 1Y7PA 4QWCA 4YFUA 2K1RA 1CBKA 1X4EA 3K0JA 4EBCA 3VAIA 4KGKA 1S1UA 4P2SA 3VAHA 2RUSA 2C2RA 1J5OA 2OUGA 4WE1A 3QWUA 2HRUA 4K5RA 4NLQA 2G0IA 5BYRA 3GV7B 1M5SA 3NWRA 1FNOA 3NOCA 5DG9A 1X4DA 3FVYA 2QEXS 1TU0B 2HQ3A 2CNKB 3CJ8A 2ZE2A 5I3UB 4ILLA 1VISA 3MUTP 3OXGA 1N5VA 1MSWD 4LF2A 1TKZB 1LW2A 1S7HA 4EZ6A 4LF6J 3B4MA 2R7SA 2BMBA 2XHWA 2FIUA 4KHPJ 2Z57B 3G4SS 4K59A 1HI8A 4OZ1A 3TUPA 2ZOFA 4ECYA 4O3PA 1IBMJ 1TL1A 4A48A 1TL7A 2AX0A 1WTFA 2BQ3A 2HVDA 4YR3A 2CJAA 2QYCA 5LM7E 2RS8A 1CC7A 3MAAA 3SQGA 2ASDA 1IXKA 3CSKA 4P10A 4O3SA 2HRYA 1H73A 4W90B 2AGQA 4RBVA 3GCWP 3MM8B 3R5JB 2IBKA 3TAMA 1RWPB 2VB6A 1U6FA 1GMWA 1UA0A 5U47A 1QAJA 2VASA 1JMTA 3HVTB 4JI8F 2I8EA 3UD4P 1CG2A 3CCES 5G0RB 1ZAXA 2V63A 3DU6A 4A8SA 3I96A 3PJXA 4QIFA 3UDCA 3ENVA 3E8OA 4K7QA 5LOQA 1GH8A 8AT1B 2WHOA 2A6MA 2CJXB 3UFCX 3VGVA 5J2PA 2DK2A 3DLEB 4MFBB 3LPEA 1SH2A 2DRDA 5DG7A 4M63A 1SKUB 3OV7A 1FK9A 4HH0A 5A2QU 2CNLB 3HPOA 1UVIA 3W1YC 3WQPA 5CCLA 1FTCA 3KNGA 4FF3A 4X64J 1RT1B 2MKYA 3AJDA 5H9FK 1HNWF 2ZJQQ 1QUVA 2PFFB 2JZ5A 1VQ9S 1PSDA 2ZVIA 5M2RA 2QA4S 2HVIA 4ZHRB 1RAHB 3QFHA 4I6YA 2LECA 1AXQA 4DSJA 2HZVA 2HBYB 2DHSA 4KGXB 1Z2LA 2UUTA 4GVBB 4WFAQ 2YX4A 2BKOA 3QIPB 3R5GA 3DLGB 3R1LA 2NYIA 2ZH8A 5DDQC 2J8AA 4KO0B 2H5EA 2DXFA 1TL3B 1ZA2B 4ITSA 3DGPA 5A8WB 3K5OA 3FQLA 1RLDA 5D4OA 3T1AA 4HYKA 1FWKA 1RAEB 4O44A 1BMQB 3DDIA 3M9MB 3CCLS 1RT4B 1JNZB 4RU2A 2DNLA 4K4ZA 1H7WA 5KFBA 3V6DA 4DR6F 4RBTA 3Q23A 3M8PA 1KQFB 3GCXP 4B9SA 3GR0A 4ZPVR 3ZC4A 3D0IE 1REGX 3FRYA 2EFPA 2MZJA 1I6JA 1V3SA 3VGTA 2HWIA 4FYYB 1P6TA 2LXIA 4U8YA 4I67A 1FVSA 2PE8A 3HDSA 4LFAF 3LP2A 4QYRA 3AD9C 4P73A 2DISA 3T1YJ 3MI7X 1Q16B 4ZVOB 3ZZRA 1T0TV 3EZUA 2MJNA 4QYZK 3TWZA 3C14B 3MOJB 3C6TB 2IJNA 1KQKA 5J2QA 2DGXA 1H72C 1U45A 1KBRA 2WVDA 2VFRA 3DDKA 3A8EA 3SI8A 1IN0A 2HLTA 3LUYA 2XLJA 4TN2A 4DPTA 4DMZA 2F4VF 3FMWA 4NYZA 1U25A 2DNGA 4WK1A 2KO1A 1S1VB 2GHWA 4DL4A 3Q8UA 2V0NA 3NNAA 3V4MA 1R0BG 3JS9A 3W9HA 1SV5A 1R0AB 3ETMA 1QVGR 2FHMA 1IKXA 1R8HA 3OL6A 2LVWA 4MYUA 4DSFA 3TANA 3Q89A 1RAFB 4KAIA 5D0RA 2MSTA 1UAWA 3MUVP 4X66F 1EAYC 1QD1A 3QPIA 2IVYA 1VHIA 1S59A 3W60A 4EYIB 1Y00A 3CJRA 1LWCB 1CS4A 3H2LA 1NK7A 1RU1A 1Y5LB 3GFZA 1AUSL 2P2CB 1M0SA 5E2QA 2FLLA 1F2GA 3DOMB 4RPFA 2PEBA 4GKJF 3K2YA 4L74A 5IQQA 2IPOB 3J81U 1VK3A 5KG4A 3SBMA 4K0KJ 4DR1J 1FRKA 2E5LF 2ZOGA 3QLHB 3QAUA 4QPXA 3LGMA 4NL5A 4FS1A 3PCOB 3UR0A 2FLNA 2JNJA 4K4TA 3TZZA 3HXMA 4AUKA 4P72A 2YH0A 2YPZA 2BXJA 4I64A 4OMFG 5K8OA 3TOQA 2ZKUA 5EDWA 3MPUB 2OPSA 5ETVA 2VA3A 2HNYA 2AQ4A 3D28A 1UVKA 1YRTA 3AXKA 3GIIA 3GLJA 3JAMY 3L09A 4ED5A 1CJVA 4JI7J 2CDRB 1NLKL 4I69A 4QR2A 3ISZA 2O3DA 1XNRJ 1FJCA 1YX2A 1B0TA 1J5EJ 2B4OA 3I0RA 3FFIA 4KBIA 4XDCA 1FDDA 2YX7A 3DRRB 1SQFA 5HROA 1IBMF 2CG8A 2UXBF 4IOCQ 1CJKA 4K4WA 1MU2A 3BGOP 3BYPA 2C2ZB 4NASA 3LA0A 1FF2A 2OELA 3KK3B 1LWFB 2J9DA 2AJ2A 2HQGA 3CJ5A 4ED1A 4U96A 3HKZD 2YBVA 3OUYA 2ZKTA 4ED3A 2U2FA 5G4DA 1ZH5A 2XSJB 4CT8A 2DR7A 4A46A 4RW8B 1PYOB 3CGIA 3W5YA 5I3QA 3D66A 3BEGB 2KDOA 2BR0A 2OLWA 2B9WA 3PRDA 1RBAA 3TAQA 1VQ4S 1RBLA 2AZ3A 3D4JA 2XMWA 4EWTA 2NUUG 1SC6A 4ECXA 3LWLA 2HHHF 2PMHA 2AGPA 3KUGA 3PO5A 3KHGA 3K5LA 1RTHA 5IZHA 1H3DA 2VH7A 1WEYA 3TVYA 3UR3C 1QSSA 3PR5B 3ITHA 5JXSA 3CC4S 4ATNA 2K2PA 4H4KC 1D0EA 5E5NA 1UEVA 4Y00A 1XR6A 3PEJA 1RDRA 3GB0A 4PQUB 4NLUA 4X64F 3M8SA 2W4CA 3GPAA 4C48A 3I56S 1KONA 4WIIA 1YZ6A 1HARA 5GADU 1ZTTA 2W24A 3M6VA 4KRWA 1EB0A 2BJ7A 3QYYA 4B3RJ 1U1LA 3W9IA 3C6UB 1VRTA 5KT6A 4W98A 2W9BB 4X65J 2ZD1B 1N5YB 3DYAB 2OP5A 3GSIA 5KT5A 2DR5A 4NYOA 1F5CA 3PJWA 2KT5A 3IM8A 2WBMA 3U1LA 1N5SA 2FHJD 2ZC4A 2OTLS 2CQBA 2KVQE 3KLIA 1PIEA 5GAEI 2HGLA 4EUVA 3M2RA 5IT9U 1EETA 3VAJA 2A6OA 3UWTA 3CD0A 1RTIA 1UFKA 2KHCA 2YKMA 4YOEA 4DUZF 2H9ZA 1DTTB 5KFEA 3G8QA 2XBPA 3M6WA 3OVSA 2R7QA 4L72B 1UWBA 3IP0A 2FJBB 3D9BA 5BR8F 2DR6A 4C8OA 2UUCJ 3PO4A 2ABYA 1JWWA 1N5TA 1HBUB 5EX3A 1YIJS 2PDAA 2DT9A 4TXSA 3G6ES 2D9OA 1CQNA 1FFWB 4IKAA 3PW2A 1S1WA 1HFEL 3O8WA 5KG7A 5HLFB 4IFVA 4K4VA 3QZ7A 2D41A 2ZHBA 3D1QA 4CP5A 4KC5A 4P75A 5E3PA 2OSQA 4Y65A 4X4OA 1AFIA 5HQLA 3VZIA 3MR3A 3M2UA 3BQ2A 3DFEA 4Q45A 1LK5A 1M5PC 3GONA 3A4TA 2JX2A 4HKQA 3TJ9A 2B7BB 4JUZA 2AT1B 2R8HA 3H98A 2ASLA 3SCJE 4O4GA 4F4KA 4NA2A 4AE5A 3NNHA 2MKSA 2KHDA 2YWWA 5D78A 4G1QA 3FC9A 2FGOA 4KGVB 4OI2A 1RT3B 5B0FA 1VGYA 4EYHB 5H9EJ 3MMJA 4GRSA 5B0DA 2CNOB 4JOUA 2BW7A 4P7VA 3T5KA 1RYSA 2W9CA 5IM0B 3GIMA 3GJQB 1KOHA 1S6UA 2UU9F 2DCLA 5IQ6A 4DR1F 3QQCD 2V2VA 4Y28C 1MMNA 3BGLA 3MOZA 1RWXB 4ECTA 3PX4A 4LF5J 3GG0A 2ACMA 1XK8A 2QSFA 4I2PA 1M1HA 4NX9A 4P9SA 4ER8A 2AP6A 2DPIA 4G6VB 3B8HA 2AMCB 4OHYA 4ES3A 4JV5J 1FRXA 3W9JA 3Q8QB 3T1HF 1FA0A 4OHZA 2AW0A 2M9KA 3CMES 1X5PA 1C4AA 2BVZA 3TA2A 2PD1A 2NSBA 2CPFA 2ZC3A 4ZCKA 1JLEA 3BGRA 3POTA 2BJEA 1RACB 4ES1A 3AD8C 4DG1A 4P7TA 1FKAF 1XNRF 3CJQA 3CDEA 4DV6J
chains in the Genus database with same CATH topology
3D1HA 4WFXA 4O4GB 5J1EA 3D0HE 3G96A 2BDPA 4OX8A 3MR2A 2BA9A 1FRHA 2BE2A 2M0GB 5AE2A 2KXFA 2RD5C 5HN0A 2KFYA 3M32A 2DNMA 2DGSA 2FPHX 1ZZFA 2OAUA 1APSA 1UP1A 2YKAA 3KK3A 4ZPBA 1LWFA 2XZWA 2CQGA 2IM3A 3FJ2A 2WSCC 2YNIB 3I0SB 3MMAB 3EGZA 4ZP6A 3GWCA 2P5VA 1BWEA 1SXLA 1Q8IA 4BS2A 2HHVA 5AE3A 3UCZP 4WJBA 1KNZA 1N36F 1BC6A 2XWYA 2M70A 1K9MT 4WFZA 1YJTA 2B4PA 2VBYA 3ETOA 5M2UA 2GHVC 4CQ1A 2B5JA 2CRLA 3KKFA 3NCRA 3T19A 2G13A 5HMWA 4TQSA 3RBDA 5KT4A 1S9EB 2QLWA 5KFJA 2YVSA 3NS5A 3TQ1A 1KTQA 4ZVFA 2F40A 1C1BB 4RW8A 5F8NA 2C3UA 2UVVA 2YWGA 2I5JB 2W9CB 1RT2B 2VG7A 5KFQA 3T5JA 3PX6A 2R7RA 3RW6A 2DJWA 4I7FA 1OQ3A 1KLMA 2Z0GA 1VQOS 3KG0A 1Q53A 3KHRA 1IM4A 1JLAA 3FRZA 3S1TA 2VZ9A 3CD5A 3HFKA 3P96A 5SZTA 4ID5A 4RW6B 5FDLA 5KFPA 1OO0B 4TQRA 1MWYA 3CIMA 4PPZA 3HZEA 1S72S 1VQ7S 1X9MA 5K14A 2I0XA 4URGA 4XAKA 1N6QB 1XEZA 3PKMA 4RNMA 4FS2A 2YY3A 4X4PA 3LQVA 4Z2XA 2RIJA 4K2XA 4FXVA 2HNDB 3SV3A 2XMKA 4I2PB 1N88A 1TVRA 2EFGA 2BJDA 2ZH7A 4F2SA 4KSEB 3MMCA 2AJ1A 1H7XA 1Y5NB 5M2PA 2KN4A 2GJIA 2XMJA 4DL0C 3P49B 1NU4A 3PFOA 4TLQA 3FNNA 3ISNC 3MM6B 3M9NB 4ECWA 1ZETA 3KHHA 2YKNB 4ALZA 3PRBA 4DFMA 3OR1B 1FE4A 4C97A 2WOMA 4WU2A 4RNNA 4ED0A 3OFEA 5DG8A 2HHSA 4IG0B 1FNMA 3MCSA 2XEXA 4RW9A 1YHQS 2GIQA 2NS1B 2RUGA 2D74B 4M1KA 3OL8A 1VIOA 3TVKA 3MAHA 4YB6A 1XR7A 5L1LA 4TY8B 2RQ4A 1GXLA 3DDNA 4QOTA 2F3JA 1U1RA 4EFAC 1JLQA 4OI4A 2J9EA 1FXRA 3PM9A 1X0PA 4USHA 1NHVA 4LF6F 1F5BA 2R7TA 2R8GA 4HL9A 1E6YB 2N3OA 3TAPA 2JVRA 3MM5A 4GC6A 1T94A 2KYXA 3SCKE 2O67A 1TFYA 2MZTA 3NNCA 1JLGB 3PIOQ 4KHPF 1FTRA 4JYAF 4DF8A 5L1IA 2DNPA 4FBUA 4ZP9A 1P8GA 4M5DA 1WI8A 2MB0B 1WEZA 1JLEB 2YTCA 3BGRB 5A6WA 3ZZUA 3OLBA 2QA2A 2C3OA 4U7CA 3QJJA 1R27B 3SCIE 4OLPA 2POKA 4QPTA 1G1XA 2W9AA 4DV3F 1LWEB 3KK1A 4HI1A 4G1IA 4IR1A 4XDDA 1N4LA 3RW7A 1DBDA 4LSLB 2NREA 3HVAA 2DB1A 1SL2A 1XTZA 3MM7B 4YP3A 1JKHA 4C8MA 3KLGA 3KLEA 1NK0A 1D3WA 2DGWA 4PQAA 1H38A 1L3KA 4NLOA 2BE2B 1TKTA 2COLA 4ZCIA 3M32B 5DETA 1IKWB 5DGAA 2ADBA 3H25A 4MYTA 5DJBA 2R7WA 1CVJA 4H4MA 3A1YG 2W9BA 2R2UA 1JJHA 3IC1A 2ZD1A 1KOOA 4C8LA 3BZQA 4GO5X 4CO5A 1TR0A 2CQDA 1HWIA 1N5YA 1QTMA 3AY0A 2VUGA 1ZM9A 3JYTA 1C1CB 5I4MA 3GYNA 3H4DA 4N8OA 3MR5A 3HF5A 3SFUA 4ZVEA 4IYQA 1S6QB 1Y3JA 1LKZA 1VS3A 3CJKB 4NCBA 1Z4UA 2VFVA 1QAXA 3R5AA 4F8RA 1HNZF 2MQLA 2ROGA 4HEA9 3AB4B 3I4PA 5IT9Y 2SXLA 2CPYA 2N82B 2PA3A 4HT7A 1KLMB 3KLFA 5HO4A 1RTDB 4FVMA 1LXNA 3HLUA 4K4YA 3K7RA 4Q2LA 1VBXA 1BQNB 3BN7A 3I5CA 1VQNS 2JJ4D 2M3DA 3QGHA 4R5PA 3Q22A 2DH8A 2V8DA 4TY9A 4LFCF 4A8WA 4H4KA 2ACYA 2E5GA 5K14B 3D0GE 3HMJG 1R31A 4JV2A 1F60B 4X4TA 1CEZA 1SUQA 3O2IA 1FKOA 3RR8A 3TX8A 2RS2A 3MF5A 2BM0A 2FVQA 1FJGF 4WK3A 3KYLA 1OSDA 2FUG9 1TVRB 3NAIA 3B4DA 3OBIA 1DTTA 3DN9A 1HBMA 3MMCB 4C0OC 3KJVA 4NLSA 2PA8D 5F0WA 2PO4A 4B9VA 3CDAA 1FNXH 4I6AA 2VOOA 4JV1A 1W2IA 3MHYA 1HD1A 3OTBA 3HT3A 3FMBA 2WOMB 3R5CA 1SIZA 2M88A 1RT5A 2CPJA 4BCAA 2JEGA 4LF8F 3G86A 2WBRA 2XMTA 4LT6A 4RW9B 4ED7A 1NKBA 1FHTA 3QO9B 1WF1A 2IVMA 1CSJA 3NMAA 5GAHU 2KYZA 1VQLS 1WEXA 5CH7B 2XGQA 1NHUA 3G6YA 1HNXF 3US5A 1NK5A 2LLZA 2OKQA 4CZCA 4M95A 5IXUA 2ZH6A 2IMOA 1JLFB 4KHRA 4TLRA 1Q82T 1V9OA 3O44A 2YNGB 3T6JA 1JLQB 1YJ9S 1N0UA 2BRKA 2HMIA 4R0EA 4IQMA 1JK9B 1Q78A 2HNZA 2WONA 3HHLA 5KFMA 3OSPA 5E3QA 1DTQB 2M5YA 3WZ0A 3V81A 1TK8A 2B51A 2APOA 1WI6A 3IAS9 3BO4A 2OMOA 1HBUA 3VAGA 2AJ0A 1A9NB 4UQTA 4NRUA 4ICLA 2HFNA 3H8YA 2IBOA 5B09A 1HPZB 3DLKA 3H2VE 2Q66A 1WACA 3HHNB 4MKYA 1URNA 1HI0P 3BR9A 4I4BA 1AW0A 4MK8A 1U7LA 4WKRA 5F8JA 4OJHA 2ZJRQ 2XLIA 3SDEA 4F4XA 1TZ0A 3FSYA 2RRAA 2D9PA 5CHCB 1JB0C 1J2VA 4RLEA 3BREA 5DQHA 1C0TA 4UW2A 2W4PA 4WTYA 5HLFA 3DRXA 2JEFA 2UUCF 5CYQA 4PWDB 2G0CA 1FKPB 2JL9A 1S9GA 1T95A 1X4AA 2R9LA 2A3JA 2V4JB 3DOLA 3LALA 3SV4A 2GW8A 4N8NA 4ZK7M 4J9RA 3BGFA 1FCAA 4DQPA 5AXLA 2YNHA 3BQ0A 2EI5A 2HFOA 4Y2IA 2NPFA 3VQSA 1HNVA 1XERA 4U9RA 1VQ6S 4AYBD 4DV4F 2N7YA 4RKUC 3AH6A 5KT3A 4ZPWR 3KK2A 3IO1A 3T5LA 1HQEA 2EK1A 1BY9A 2A1BA 2RSQA 4C11A 1TAUA 4CO0A 3THVA 3LPYA 1QE1B 3CUNA 1S0MA 4RWWA 2BV3A 5DO2A 2FD2A 2I2YA 3CPWR 4F50A 4F02A 3JYTB 5L38A 5HP1B 2HS4A 3UCUP 5C24A 2EK6A 4I56A 5IS2A 2KM8B 3MPWA 4C98A 5JUMA 1QM9A 2FB0A 2MKJA 2EG2A 4YB7A 2MQNA 2K1RB 3G71S 3OLAA 4NYPA 2VG6A 2G9OA 4JV0A 4Q8EA 1D8ZA 3DM2B 1S1UB 3M8QA 3MM9B 3VAKA 2HHPA 4HT5A 4RUHA 3KLFB 4F4YA 1D9AA 3IWLA 1WG5A 4TKTA 4WE1B 4IDKA 1MW7A 1WG4A 1RP5A 2W7PA 1IKVA 4OHWA 4ILRA 2YX1A 4NLGA 4C3MA 3I4HX 3E2EA 4C3KA 2B7CB 4O23A 1CQMA 2EW9A 3DI6B 3OTEA 1GT8A 3TI0A 2FY1A 4CO4A 2AWZA 2VBWA 2MQOA 2EVZA 3CULA 5L39A 1B0PA 1P27B 2D7SA 3BR8A 3K5PA 5D4PA 1QLNA 4DHVA 3E51A 2IRXA 1MNEA 1TKXB 2PIIA 1YRXA 4DSKA 1RT3A 3KJVB 3TW0A 1U6ZA 2ZE2B 3HHEA 2VD3A 3GILA 1SKRA 5EWEA 1XMBA 4Q0BA 3IA0A 4YR0A 4O3OA 4QBUA 4PRFA 1OWXA 2J7UA 1E6VA 3DCAA 4I6WA