1M1KT

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m1kT00
2BZ2A 2B0GA 2DHSA 3MDFA 2KG0A 2RT3A 2E5GA 4UY8T 5LJ3Y 2XS7A 1YWXA 2EK1A 4U67Q 4W92B 2YKAA 1YTYA 2MJNA 1ZH5A 1NO8A 3G8SA 1X4DA 3TYTA 2AYGA 1YJWS 2LQ5A 2MQQA 1K9MT 5JVHQ 3CCQS 1X4GA 3FEXB 2MKJA 3NMRA 4FXWA 3R27A 3BS9A 4PRFA 4TU7A 1X5TA 2CQCA 2DO4A 3MUTP 1FO1A 1VQ8S 2XNQA 3B4DA 3MI7X 3S6EA 3VALA 2DGXA 3CUNA 5FJ4A 2DNMA 2RU3A 2J0QD 2CPIA 2HYIB 1IQTA 2MY8A 4C0OC 4WFBQ 4Z2XA 1VQMS 2KM8C 2RRBA 1X0FA 1KOHA 2A3JA 1U1NA 3L3CA 1KD1T 1FJCA 3LQVA 1X4EA 2CPXA 3G6ES 1UP1A 3ULHA 2CPYA 2DB1A 3CPWR 2DIVA 1VBZA 2FC8A 2J8AA 4C7QA 1VQ7S 2U1AA 2KU7A 1K8AT 1VQKS 4LMZA 4OZ1A 5DETA 3MXHP 4OZ0A 2YTCA 1KC8T 1VQ6S 3PIPQ 2KN4A 2MKIA 2F9DA 3P6YC 2HVZA 1PO6A 3FEYB 5ITHA 1URNA 2HZCA 2U2FA 1OIAA 5HO4A 5IM0B 2RS8A 5D78A 5GADU 1VC5A 5D77A 2M7SA 2VOPA 3UCZP 1KOOA 1UW4A 2KXNB 2EVZA 2MZJA 4FXVA 5DDPC 3MD1A 3MD3A 1M5OC 1XN9A 2DGQA 2BOPA 2M9KA 1S72S 3BO3A 2SXLA 2MZTA 3H2UB 4IUFA 2LEAA 2L41A 2NZ4A 4TLQA 2UP1A 3Q2TC 3VAFA 2KVIA 2KYXA 2CPDA 3MUMP 5CYJA 4ZKAA 1WELA 1A7GE 2MKSA 2MQOA 3BEGB 2CQ3A 2CQIA 1VQ9S 3P5TL 2DNZA 1U2FA 4PR6A 3UCGA 2CQPA 3EGNA 3J7ZT 2DNPA 2D9PA 1WEYA 2AYEA 1WF0A 1M5KC 1WHWA 3CXCR 4WIIA 1D9AA 1FJ7A 1SJ3P 4WF9Q 1N52B 1U1PA 2DNYA 1HD0A 3MOJB 1VQOS 2QFJA 2MGZA 3V4MA 3CCVS 3G96A 2YWKA 2CQ2A 5LSLA 2CPEA 1YJNS 2JVOA 2KFYA 2GHPA 1O0PA 5DDRC 1RKJA 2N7CA 2DGVA 1X4HA 2LYVA 1WHXA 3CMES 2ERRA 3UWTA 1WF1A 3CMAS 2E5IA 4C4WA 2CQGA 3RW7A 5IM0A 2DNRA 2MXYA 4WFNQ 4CH1A 2DISA 1N8RT 2MQNA 1CVJA 3D2WA 2X1FA 1WF2A 4V19X 2KHCA 5GAHU 3NNCA 2EK6A 3G9CA 3VAJA 3S8SA 3S7RA 2MQMA 2RUGA 1UFWA 5LSOA 1SJ4P 2KH9A 3OW2R 2DO0A 2VOOA 2YH1A 4J5OA 1W2BR 2MZRA 2M8HA 1H2TZ 4CH0S 1WI8A 2MYFA 2JRSA 2CQBA 3NS6A 2G0CA 3IWNC 2RQCA 3DXBA 2D9OA 3Q2SC 1FJEB 2MB0B 1JJ2R 2DGTA 3G71S 2MY7A 1YITS 5CA5A 2ZJRQ 1DBDA 2ZJPQ 2LXUA 5DDQC 5MLCV 5DDOC 3IRWP 3CCJS 3CCSS 3LPYA 2MGZB 2DNNA 2MKCA 3CC4S 1VQLS 2XSFA 1VQNS 3CCRS 1U1KA 3B4MA 5LXYA 4Y0FA 4CQ1A 3VAGA 1OWXA 1VC0A 3US5A 1WHYA 3P49B 4P6QA 2M88A 2DHXA 3VAKA 2DH8A 2RNEA 2MSSA 1OO0B 1WEXA 2CQ1A 2QA4S 3CC7S 2XS2A 1M5PC 2PE8A 3SMZA 3PIOQ 2OJ3A 2KRRA 2J76E 4LIRA 3NS5A 3CTRA 3DLLQ 3BO2A 2AYBA 3CD6S 1X4CA 2CPHA 5JVGQ 2MMYA 2V94A 2N3LA 3THPA 3EX7B 3NNHA 2M0GB 2I38A 2LKZA 1VC6A 1WG5A 2MKKA 1U1QA 1Q7YT 2LA6A 2KM8B 2FY1A 1QVGR 3THTA 3TP2A 3SDEA 1X4AA 3ZZYA 1X5PA 4WCEQ 1JJHA 2MPUA 3UE2A 2DH9A 2JVRA 2G1DA 1JJ4A 1YJ9S 4F26A 1QM9A 5CXTA 2DNHA 3BO4A 3I55S 3JB9k 2LCWA 2KXFA 1DHMA 2F3JA 3VAHA 4IO9Q 1UAWA 1VQ4S 1RK8A 1N88A 2MSTA 2MHNA 1N54B 4QU6A 2DNQA 3ZZZA 5GAGU 2E44A 2X1AA 2RVJA 2OSRA 1AUDA 1SXLA 1Q86T 3U1LA 2L9WA 2YH0A 1D8ZA 1L3KA 2XS5A 1HD1A 2CQ4A 3G4SS 2ZJQQ 2LEBA 2CQ0A 2LECA 1VQ5S 2OSQA 2OTLS 1QVFR 1FXLA 1ZZFA 3K0JA 2ADBA 2DITA 2VONA 5GMKa 1H2VZ 2LA4A 2CQDA 2CQHA 1Q81T 2PEHA 5IFMA 2CPZA 1R8HA 4F02A 1U1LA 4TU9A 3UCUP 2D3OR 2AD9A 3N9UC 2O3DA 3SDEB 1P27B 5BJRA 2ADCA 3CC2S 3R1LA 2KXHA 5LJ5Y 2XNRA 1WHVA 2LXIA 1WTBA 2MQPA 5H1SV 1S79A 3VAMA 2CPFA 2DNGA 4W90B 1G2EA 2MJUA 3CCUS 4BS2A 2F9JA 2DK2A 2KT5A 1SJQA 4RU2A 1F9FA 2M4MA 2QEXS 2JWNA 5HL7Q 4QPTA 2AYMA 1M90T 2RRAA 3VAIA 2I2YA 1NJIT 1VQPS 2FC9A 3SXLA 3CF5Q 2CJKA 3NNAA 1K73T 2DHAA 2RQ4A 4WKRA 2E5HA 5DM7Q 2OTJS 3H2VE 4QQBA 3P3DA 2MZSA 2MKHA 2X1GA 3MUVP 1WI6A 5DM6Q 4IOAQ 3I56S 2M8DB 2DNLA 1VBXA 2L08A 2XB2D 2K8GA 4ED5A 1M1KT 3CULA 2FPHX 1HA1A 2DNKA 2M2BA 4TU8A 2N82B 5IQQA 3TO8A 3HI9A 1X4BA 1WG4A 2DGUA 2KRBA 5GAEU 2DHGA 2E5JA 5LXRA 4M5DB 2X1BA 2GO9A 3MURP 1X5SA 4YOEA 1FT8A 4F25A 1PGZA 2VODA 3CCES 1SJFA 1KQSR 3UD3P 3UD4P 2KI2A 1U1OA 4CIOA 1FHTA 2RS2A 2DH7A 1WWHA 2DGSA 2WBRA 2K3KA 3VF0B 3G8TA 2M52A 1FNXH 1JMTA 1WG1A 4IOCQ 1YHQS 1U1MA 1B7FA 2FHOB 1NU4A 1R8PA 1DRZA 2HGNA 1WEZA 1ZZNA 4A8XA 1HL6A 3S01A 1U6BA 2KG1A 2DGOA 4PKDB 2HGMA 2M70A 5EN1A 2MZQA 3J7YU 1X5OA 3U1MA 1H6KX 4UQTA 4LJMA 2MZ1A 1M5VC 1SJRA 1BY9A 3CCLS 1X4FA 2DGWA 1OPIA 4WFAQ 1A9NB 3R1HA 2G4BA 2Q79A 2JX2A 3RW6A 1YIJS 1DZ5A 1P1TA 2J0SD 3HHNB 4EGLA 1U6FA 2MQLA 2HGLA 4QU7A 1YI2S 4YUDA 2DIUA 1Q82T 2OIHA 1VBYA 2DNOA 1U1RA 1H2UX 3EGZA 2NLWA 4Y00A 2CPJA 5GVQA 3CCMS 4ERDA 2N3OA 2LMIA 4YB1P
chains in the Genus database with same CATH superfamily
2BE7D 3CWJA 4M5DA 3SV4A 2XYPB 3HKZD 5HMYA 5IZHA 4KO0B 3OV7A 4LF6F 1ZH5A 3TYTA 2HW3A 2AKWB 3GTYX 2NR0A 4DV0F 4O3PA 5JXSA 4NLPA 4Q44A 3NKYA 3H5XA 1T9VA 2AMCB 3D54A 3QSYB 1Q5YA 1R6VA 3D1QA 4KBIA 1X0FA 3NL0A 3GG1A 3LQVA 4HDGA 4ZMMA 3G6ES 1B3TA 4NLVA 5HVHA 1WNEA 4IQMA 3PNIA 2F9DA 4LF8J 1T03A 1KKHA 5ITHA 4KTQA 4LQ3A 4EEYA 1R0CB 2YKQA 2HAIA 2GMLA 2VQFJ 4IR9A 1S1WA 1Q8BA 3UN2A 5AE1A 3DLBA 4C0HA 2IYGA 3DLKA 1RWUA 2QA1A 3OL7A 3KNAA 1X31C 5HK4A 3GSIA 4FNIA 3CGIA 4ID8A 2DNPA 3DOLA 4F04B 1M5KC 3FCWA 1EARA 5A8KA 4DFJA 3MECB 4K8RA 1N52B 1KTVA 1RT6A 4WK3A 3A1YG 5KFIA 3G96A 4QR1A 2KFYA 5FLXY 2ZHBA 3K8VA 1NXIA 5KFLA 1UVJA 5KT6A 2AEJA 1SI9A 1N5TA 1N6QB 4CH1A 2DNRA 4O4GA 2X1FA 3W62A 4OLPA 1UA0A 3I0RA 2XY7A 3MWBA 2WK4A 1W2BR 2F4VF 1Q79A 1N56A 3QMQA 4YHHJ 5KG3A 3UR3C 4B3RF 2H51B 1K0TA 4X65J 3V81A 1ZAXA 4DPXA 3M9OB 4DG1A 3M7VA 3EMTA 3VAGA 4DV7J 3PJXA 1G1XA 4J9VA 4B9UA 3EPIA 3H4BA 4JI6J 3LPEA 1IM6A 2CNNB 4RBUA 1SKUB 1XMOF 2ILZA 5L46A 4HHUA 3ZZTA 3QAUA 2D69A 2FGCA 2QL5B 3RYLA 2BDPA 1L3SA 4J9QA 5DG8A 1S0NA 4JI2F 3UDVA 8ATCB 3K5NA 4NLWA 3D1OA 1RE1B 2OPPB 4F4AA 1RK8A 1ICEB 3RRKA 1HNIB 3RB4A 2WSCC 3MMJA 3BKUA 4A8KA 3M8PB 3EGVA 3IWLA 1HD1A 2OEJA 4B17A 1C0TB 3A12A 3DGPB 1TQLA 1VHIA 1V3ZA 4N7TA 5KFPA 2LA4A 1Q81T 2CQDA 2HQIA 1U1LA 4LSZB 4C97A 4JB8B 1CC7A 2ILYA 5LJ5Y 4F4KA 1VHFA 1IJFB 3BDEA 1HR0J 2J6TA 4UOGA 5IQ6A 5IT0A 2EKNA 4EZ6A 4CDIA 4DUYJ 4KHMA 2QJ3A 4GRSA 4DV1J 1SQGA 5SZTA 2XEXA 3HZGA 4C6AA 5C42A 4WU3A 3GFHA 3TEHB 5IQQA 2OI2A 3HX9A 1I94F 4ECVA 4DR5F 2BRLA 2H48B 5DG9A 3ELHA 1HW9A 2UXDJ 1PSDA 4ID5A 1Y5LB 1RYSA 1VJWA 2AJ4A 3PEJA 2DH7A 2VIHA 4ENOA 4OIXA 4KKOB 1B7FA 3B54A 4MKYA 5DRKA 4EYIB 1EQMA 3QIPA 1N0VC 5EN1A 2F8MA 4LR9A 1T0TV 5KT7A 5KFGA 4FPIA 2RQMA 2HBYB 1NHKL 4NLXA 3JXOA 4R8UB 4WZQA 2OIHA 3LGHA 4CH7A 3A3NB 1YSJA 2CDQA 2ROPA 5LMNJ 3PFEA 5AXNA 4DLEA 2LMIA 4F0HA 3WZ0A 1EKSA 1JLFB 2E5GA 1UJ6A 2PA8D 3I87A 5IXUA 2ZZNA 4DV2F 2V2KA 5K20B 2AYGA 3ENWA 4DR3F 4LSLB 2Y1RI 2VBXA 5A2QY 3HM9A 4YS2A 4OQJA 2VKZG 4P72A 1H73A 2PGCA 2DNMA 1VLYA 1WC4A 4DFMA 3J80Y 4DWIA 1X4EA 3HFKA 3W63A 1UP1A 1RI7A 5DLGA 2NXCA 4YB6A 2CNKB 1M1GA 3W64A 3GIKA 1VBZA 3PO5A 3OJUA 3BSNA 2JOQA 3MMCB 2ZH3A 3MECA 4X66J 4FS2A 4W4MA 2Z2LA 1URNA 3OTDA 1CJVA 2PMHA 2M7SA 1X7VA 2WB4A 3C16A 3UCZP 4NI2A 4YQWA 1YJRA 1DURA 3LUYA 4DV3J 4DXLA 3FEZA 4GC7A 2F5GA 3RJMB 2V8GA 1IR2A 2B9EA 2JH3A 3P45B 1X8DA 2CZVC 2CPDA 2UVVA 4FYDA 4NYZA 2CZ9A 1TFYA 4NLDA 1WF0A 2K2PA 1QE1B 4TYAA 2B7CB 4XTTA 1AB8A 2FQQB 4U7CA 4LR7A 4C3LA 1L3UA 1WHXA 1UVMA 3NXZA 2W8LA 3TNVA 1WC6A 3AJ1A 3NY0A 4B3OA 1RLCL 1XK8A 2XLKA 2G2OA 2BM0A 3OTEA 3G82B 3PR5B 4ANEA 4DR7F 2HVHA 1KR4A 5KT5A 4MH8A 2BVZA 4DFKA 3JYTB 2Z8QA 3TJ9A 2XZDB 3O44A 1LWCA 1XJWB 5IV4A 3UFCX 3PW0A 4A8SA 3CJQA 3SSSA 3E2EA 4Y0FA 3US5A 1FDNA 4Q0BB 2ATCB 1HNIA 4KRWA 2KJWA 3ENQA 3M8PA 1FD2A 4IRCA 1WUUA 3T3FA 5AXKA 2V8PA 3OHBA 1ZM3A 2CVEA 1U48A 2RIJA 4EO6A 3QNWB 4NLYA 3M8WA 1YGYA 2HIQA 3ZZYA 3M05A 1JJHA 3NGRA 3GQCA 4MKVA 1JLAB 2BRKA 4F26A 1V5IB 1T11A 2DNHA 2KXFA 2AF6A 2B9WA 3FRZA 3NAHA 2EXUA 3NG8A 5C24B 5GAGU 4LF1A 3EXYA 1TMJA 5HP1A 4X4QA 1FRMA 3NEKA 1TKXA 5D3GB 2DITA 3MCMA 3PX4A 1RT5B 4F02A 4DS5A 4FBTA 1GTHA 1SL0A 4ZCLA 3J7A1 4LBHA 4OZJA 1X0PA 5KFQA 2YNIA 1NAQA 3OVBA 4TVAB 2O01C 4W98A 1IBKJ 4K2JA 1SIWB 3MF5A 3FMWA 2GHWA 2VFVA 2R7QA 2K06A 4KHRA 2YNGB 3DLHA 2HIYA 1HWIA 3J81U 1LOUA 1D0EA 2ALYB 2VHGA 3GCWP 3CNQP 1PAEX 1BXNA 4WU2A 3WX8A 5E7OB 3IXQA 2K8GA 4ED5A 4OV1A 4FF2A 3C14B 1EJ7L 3GJRB 4J90A 2GIFA 5ETRA 1FK9A 1YK9A 4EFAC 4X4UA 1NB2A 2F7VA 1WD6A 2OEKA 3GB0A 4B3SJ 2VBYA 1U47A 4MK9A 2C2EA 5JMNA 3T5HA 1LV5A 2YQ0A 3KJQB 3LAMA 4OJ1A 1MWQA 2FLOA 5KFUA 1JLFA 4PQUB 2JDJA 2CKWA 1R8PA 3VWSA 4HH0A 3VHQA 3CDUA 2JLGA 1MNEA 4NASA 3KG1A 1FRKA 1XMBA 4PKDB 1JQGA 2M70A 2QYGA 1T9TA 4I2PA 1BY9A 4B9TA 2ZM6J 3KLGA 1HWUA 1B0TA 3Q23A 4DUZJ 3PYEA 5T14A 4K4TA 3M32B 2UVWA 2XI3A 1PILA 1S7IA 2IIHA 2IFXA 1YJ9S 3UNGC 2DTJA 1RTZA 1NK7A 3W60A 3CJ3A 3DLJA 2A6MA 3MHYA 3MR6A 3W8GA 1K9MT 3R27A 2VF3A 2YX7A 2DO4A 3FZ2A 4QWDA 5BYRA 3S6EA 3MMBA 2DGXA 3KUGA 5J2PA 2CPIA 2HYIB 2V63A 4O23A 2HVIA 2W2NP 1KOHA 1S6QA 2OD6A 1MWZA 1HPZB 1J2VA 4J9RA 4LF8F 2DR8A 1R7IA 4MK8A 3LP0A 1SC4B 2ZD1A 5DETA 2VQFF 3OTCA 4ANDA 4YR0A 2R8JA 2PMZD 3BGLA 3JSYA 3KK2B 2VFRA 1WACA 4NZ0A 2RS8A 1ZM9A 2DXDA 2QMXA 3AODA 2HLUA 3J7YI 4GMKA 4K4UA 4NXMF 1M5OC 2H65B 2IRYA 3DNCA 5ETVA 3UQSA 1S49A 4YDDB 1T8EA 3H7HB 3KHRA 3WHIA 1RA6A 1VIXA 4ZPTR 1ZBTA 2BW7A 2ZEJA 2DNZA 4EUVA 1RLDA 3LP1B 2XZTB 2VL1A 5A6WA 2AYEA 1BLUA 3QFHA 4PCQA 2AP6A 4BWJA 1R6YA 2D1CA 2ATLA 1TTHB 1KHVA 1WORA 2W2OP 2ZH8A 2NREA 2JEGA 3SCJE 2DR5A 3T19A 2DISA 1TUWA 1SVDA 1KFDA 1S4EA 2MQMA 3AQPA 3GPAA 4YHHF 2DO0A 4GVBA 5HBMB 4X65F 2CJ9A 2MYFA 2Y1LB 1PC5A 3NBPB 3Q2SC 2E5LJ 2F8HA 1RGVA 2ZZTA 4RX6A 2ZJRQ 4UZCA 4DV7F 4I2QA 1IKXB 2DNNA 4JV0A 1ZA1B 2VFUA 1U1KA 2V69A 4X62F 1DFDA 5L38A 5EGYA 3IBWA 3P5BP 4ZVRB 2IMOA 3U1NA 3PJ9A 1M5PC 4N8OA 1QTNB 3Q8YA 4JYAJ 2EWHA 3GMGA 1BQMB 5D3GA 1Z2ZA 3NCPA 4JI3J 2MKKA 2ZH5A 1FE4A 1UETA 2CRLA 5ETSA 3MR3A 5DQGA 4XK8C 5KTQA 4QR0A 2FD2A 5CXTA 3I55S 2F3JA 3H42A 1O5JA 2MHNA 5AJ3J 4DV5J 5KG1A 1NCLA 4RZRA 4N76A 1F5AA 3SQGA 2OMOA 2YH0A 3PRDA 1L3KA 4Z7CA 2CQ0A 4KJIA 1S5ZA 2GQQA 2DRBA 1FKPA 4ZVFA 3TUJC 1S1XA 4JI8J 3C14A 4O3RA 2HFZA 1IUJA 2O3DA 3TJAA 1HR0F 2IM1A 1NK8A 3KYLA 3R6GB 2C3OA 2N4DA 4R5PA 4ZLPA 4Q8FA 3OLAA 3CDWA 4DUYF 2M4MA 4DJBA 3MCSA 2V8VA 1TK5A 1M0SA 1ZM2A 3CD0A 1KRPA 3HJFA 2UZAA 3GILA 1DTQB 4P2XA 2J0XA 3AFGA 2M2BA 3W7BA 4C2MA 2Z58B 4DSKA 2HS0A 5HATA 3P4UB 2UXDF 1UJ4A 2DBBA 1S9FA 2DHGA 2PN6A 3M32A 4YOEA 2OPSB 3J7Z5 3C46A 4WFYA 4ED7A 4I67A 4RW7B 4QPXA 1F5CA 2XC9A 5DZ7A 3RAMA 2WONB 1ZZNA 4WKYA 3IG1B 1WC0A 4P2SA 4TY9A 5HMZA 1E6VB 4RW6B 4V1Ak 1OPZA 3R1HA 4M95A 4KYZA 3ITHB 2BUNA 3HP6A 1RAFB 2DIUA 2GJ2A 3BSAA 2VG6B 1HPZA 5KFBA 2UV8G 3D3BJ 2IM2A 4ED2A 5B0CA 5H9EJ 2W4DA 3KK2A 3BQ0A 3CJ4A 4IO1A 2YWWA 1YTYA 1NO8A 3EWGA 4P73A 3WIVA 2HURA 2B6AB 3GYXB 1IJEB 2J9EA 2A18A 1X5TA 2ZC4A 4B3MJ 3B4DA 4DU7A 4XDCA 2AW0A 3C2PA 4LRDA 4UQGA 2KM8C 4ZVQB 5KFKA 1N0UA 2RRBA 5KFVA 1Y9OA 1U1NA 3LP1A 3VTIA 4DL4A 1Y00A 1PYTA 3FBCA 1QTMA 3MEEB 4ECUA 4DF8A 4LMZA 5BR8J 3QZ7A 3PZPA 3V4IA 2YTCA 2UXCF 3Q83A 3IR7B 3RAQA 1KVJA 5CYMB 4USWA 2FHJA 2L48A 2VOPA 1WDTA 3NGKA 4RNMA 2QT7A 3MAHA 3TAPA 1TL7B 3MD3A 2BR0A 4LF7J 2DGQA 1U0HA 1AZSB 1NDCA 2VBZA 2UU9F 1VRQC 2A2CA 2LEAA 3WX4A 5K8MA 2VJUA 2L41A 4KHPF 3HLUA 3ILOA 4L3KA 5HBMA 3T6BA 1RBAA 4QCLA 1U2FA 3HFVA 4UUXA 3AXKA 3UCGA 1LWFB 3NBPA 5KFZA 5IT4A 4CO3A 1Q7LB 3DRPA 3CE8A 5F8LA 2OHDA 3CJKB 1MW7A 4XPCA 1T9XA 4ZHRB 2HZAA 2BQRA 1SIZA 3TUPA 1MU2B 1VOMA 1YQHA 4N5SA 4P7VA 4UW2A 2ZOMA 2KHCA 2ZNYA 3DI6B 1SCJB 4WE1B 4RL1A 5LSOA 3OR2B 5HSPA 1Q53A 5M2PA 1U25A 4ED1A 4M63A 4AQYJ 2GFFA 3UVJB 1HQUA 3OL8A 5AXMA 3KHHA 3CDBA 2VPYB 3CCSS 2MKCA 3PEHA 3HVTB 1XC9A 4CQ1A 4ELVA 1WHYA 2DHHA 3P49B 4G1QB 4AXIA 2AEFA 4LRBA 2JLFA 2MHEA 2E1PA 2PI5A 2UXBJ 2YNHB 3DLLQ 3DRYA 1X4CA 4ECQA 2COLA 1X4AA 2W24A 1N33J 3VVUA 2AJ2A 3T5LA 1EHWA 4YY3J 4WFZA 4C9DA 1KLMB 1ZETA 3L7PA 1T94A 3C6UB 3LP2B 4CRJA 2PEBA 5KFJA 3KXDA 2E44A 1SBRA 3MM9B 5K9FA 5B0GA 3G4SS 2ZH4A 4JI7F 1VQ5S 1H7XA 2C2KB 2OTLS 3RB6A 3HHLD 2IJRA 5CCLA 4LQ9A 1HKAA 2BE2A 3DM2B 1IBKF 2Q66A 3M9NB 2NS1B 2HHUA 1KSPA 1PG5B 4UT4A 2BOAA 3EDQB 1SH2A 5C25A 2CPFA 1T3NA 4PXCA 1EP4B 3AD7C 4EBEA 2F9JA 3D0GE 2DK2A 2OPSA 4RU2A 3E8OA 2I2YA 2LP4A 8RUCA 1K73T 2IVMA 4DX6A 4B9VA 2A10A 2X1GA 4LFCJ 1WI6A 3H4DA 4TY8B 1ZA2B 3TUIC 4P52A 2OO4A 1UKUA 1HYSB 3DU5A 4H4MB 4RW6A 4F3OA 4IYQA 3PYFA 2EKYA 3ITHA 1DARA 4F8RA 9RUBA 4GC6A 3MURP 1Y10A 1FT8A 4WBFA 2D7SA 1S0OA 5GAGI 4J91A 3TVYA 3PW5A 3UD4P 5FLXU 2RSQA 4NLSA 3JQKA 3HT0A 1FXDA 4LVOP 2HGNA 5HJYA 4USHA 5A0YA 2R7RA 5H9FK 2XMWA 2ZM6F 3IM9A 3VGTA 2B6AA 3MM6A 1HL6A 2KG1A 2VDHA 2P8IA 3IWXA 4H54A 1YZ7A 2RJZA 1CS4A 5DJBA 1FKOB 1RT2A 2GGPB 2HAFA 2JL9A 2JEJA 3NGDA 3H5YA 5B0AA 1FF2A 1P9YA 1H2UX 3MEEA 1L5UA 1BC6A 1AA1B 2BZ2A 4EK2A 2P2CB 2BANB 1O6XA 1S1TB 3W9IA 5CYMA 3CJ2A 3K5OA 4YDXA 1TUVA 5I3PA 4O4RA 1X4GA 4PAAA 2FVSA 2MKJA 5IOLA 2YWGA 4TU7A 3MUTP 4WZMA 1UFLA 1RTJB 2YVSA 1ZAVA 1I3OB 4JOUA 2HFUA 3QQCD 5SUHA 1M5HA 4QYZJ 4OX9J 2FY8A 4DZ6A 4MJKA 1LWFA 1RTDB 2CPYA 3HSJA 4DV4J 1KEKA 1WSVA 2C2MB 1VQKS 4C7QA 1F0XA 2YKMB 3EZOA 2EEYA 4OZ0A 1VRTB 3CJKA 2ASYA 4DR6F 1VQ6S 2RF2A 4ZHRA 1AYEA 2EFQA 1H72C 2AHOB 4BCAA 4BWMA 4QW8A 2X3GA 4IG0B 2VPWB 5A76A 1UW4A 5B0BA 5DDPC 2XHWA 1JLBB 3CT9A 3BO3A 1RHQB 4NA3A 2EW9A 5F9NA 2NZ4A 4DPUA 2DD8S 2KVIA 1JLEB 4WE1A 2PO4A 3VVTA 4OX8A 1A7GE 2IYIA 2Y1JA 2W9BB 3UVJA 1NZAA 3JAMU 1D9AA 2R7SA 3GYGA 3BM7A 2QFJA 4QW9A 1FERA 2VU5A 3PACA 5IV3A 3B6BA 2DYAA 4YB7A 1S9EB 2V5HG 4G1QA 4KV8A 2Z30B 2WZ1A 1S9GB 4IFVB 3RUBL 1FFSB 4PPDA 3D9BA 1F2HA 2YNHA 2POKA 4LF4J 3LTOA 4WTOB 4DL2A 2KT2A 5T7LB 3S7RA 1MMDA 4A8OA 2E5LF 3OFGA 2VC1A 1FNMA 2D9OA 1JJ2R 4TN2A 2VG7A 2QLWA 1RT3B 4M5GA 5GMEA 5EDWA 2EPIA 3PO4A 3BDPA 1XBWA 1P9QC 3KJVA 1KLMA 3C6UA 3EPGA 3CCRS 3LP2A 3BH6B 1VC0A 4NLOA 2M88A 3G6VA 3RBXA 3T6JA 2AJ1A 2QA4S 4DSLA 4ETXA 4JI3F 4OX7A 2FJDB 1HBOB 1QUVA 4F67A 4QWAA 1HNXJ 3DM2A 5EHHA 3PM9A 4FYXB 4ZIVA 4RWXA 1YJVA 2Y9HA 4F50A 4DPTA 5AJ3F 3TJ8A 5HROB 2V4QA 1XNRF 1X9SA 1S97A 4HHHA 4QR2A 1KLNA 2FJAB 4M1KA 2DNQA 1X9MA 3BKFA 4CO4A 5A2QU 2DJWA 3UNYA 1KWMA 1S7HA 1DY3A 2GVZA 4M5IA 4B02A 4YR3A 2GAHC 2AIRB 1RU1A 1H2VZ 4OX6A 1M5SA 1R8HA 1LW0A 3BF4A 4L3NA 4XDDA 3TAMB 1QAJA 1UL3A 2AU0A 2ZE2B 4PQAA 4RNFA 1FRIA 2JFKA 2G0IA 3BZQA 2R8KA 2H5EA 3RG6A 4IR1A 3KUEA 4MKBA 4UOHA 2RQ4A 1Z4UA 2O66A 4LSNA 3M2RA 1UCNA 4USVA 1V9OA 2OMLA 3G2XA 1GT8A 3J81j 3L9ZA 1TMMA 3W1YC 2E5JA 3HJVA 2G13A 2QLFB 5AE2A 3UPFA 4ED8A 1WJ9A 4CIOA 1WWHA 2BANA 4QIEA 4CCHA 3UDEA 3G8TA 1JMTA 4KAIA 1DLOA 2B4PA 4NZ7A 1FRLA 4FF1A 4LBIA 4NCBA 3MMAB 2HGMA 4OYPA 3U1MA 4J9KA 4ZPCA 3KDOA 4DSEA 4WFAQ 4I7FB 4PXEA 2WVBA 1CJTB 2QGFB 4M5MA 1GXTA 2ZH6A 1RTDA 1S6UA 3EGZA 2NLWA 2WOMB 2N3OA 4DPYA 5C2CA 1VRTA 2B0GA 3MDFA 5HAOA 1NKCA 2KG0A 2L9DA 2A6OA 2I6WA 1RP5A 5EWGA 2ZVIA 4B3MF 3IM8A 3DLEB 4KR0B 3QGPA 2CQCA 3EICA 1FO1A 1IKWA 1QAYA 1HI8A 3W2WB 3CUNA 1ZPVA 5B0DA 2RU3A 2H1YA 1AW0A 1IQTA 1WKLA 2F4VJ 1ZTWA 3O8WA 3LAKA 3R5AA 5K8PA 4B3RJ 2W9BA 1K8AT 2FVCA 3U7JA 2VV5A 3GIMA 8AT1B 4WTYA 2RMLA 4A47A 3DHWC 1XNQJ 3AJ2A 3P6YC 2HVZA 4LF7F 4L73A 1G6BA 1VC5A 1C2PA 1S9EA 5FIIA 2HRYA 5THWA 3DRRB 2WAQD 3DOMB 2BA9A 4IFVA 5I42B 1AUSL 2IY5B 4IUFA 2R7WA 4A8WA 3L7UA 3VAFA 2KYXA 4NRUA 5T7LA 4KQZA 1WELA 3KK1B 2AGOA 2CQIA 2B8PA 3EGNA 2WHOA 3J7ZT 3GYNA 4NYPA 4B9LA 2RD5C 3NLCA 2JNJA 1U1PA 2IRUA 3W5YA 1R89A 4CO1A 2VQEF 2YXLA 2EFVA 5E2QA 1FX4A 2ERRA 3UWTA 1HBOA 4MFBA 4OMFG 5GAHU 5K14A 4NRTA 1KVKA 4AQYF 3D3CJ 4KC5A 1NK5A 3UR0A 1H2TZ 2Y3YA 2QMWA 2ZKUA 1YBUA 2IA6A 2MEWA 4C8MA 3I9V9 4O3OA 1D1UA 1DQ9A 2ZJPQ 1L3VA 1C1CB 2WTFA 2XMJA 1BQNB 2UXBF 3LF0A 1IQZA 1N36F 3PV8A 2PE8A 5F3ZA 2OJ3A 5D0HA 4RW4A 4LFBF 2DKOB 3CVKA 1N5SA 2XI2A 1N33F 4CLZA 2V9KA 1VC6A 2G2YA 2IAJB 1X9WA 4ZPWR 4YY3F 2HVDA 1I94J 4WJBA 1JNZB 1TL3B 2P9GA 2VG5A 2B9XA 4X64F 4IO9Q 3T1HJ 4ECSA 2GO8A 2ZITA 5KG0A 4CLLA 1VK8A 4Q2MA 2YBVA 3KFWX 2CQ4A 3OFEA 2VFSA 1IBMJ 2OLWA 2ADBA 1UEUA 2KJVA 5B7WA 2AJFE 4ILMA 2AD9A 4EMDA 4RU9A 2KL8A 5BJRA 3R1LA 4J9PA 1Q16B 4OI6A 1S4FA 3FVYA 2B5JB 2G1HA 3VAMA 1Q1KA 4W90B 2ASJA 3UN5A 2NUHA 4LFCF 4ZP9A 4FZVA 4MIWA 4WKRA 4DV2J 1NB7A 1N4LA 4OYWA 1GXLA 1LW2B 3MMAA 5A8RB 2DRAA 3MTJA 4DLGA 1S99A 4URQU 3KLIA 1I1GA 4WXOA 5FDLA 5D4NA 1NH8A 4HACB 4I7FA 2ACMA 4JP8A 4CT8A 1CJTA 4F0KA 3I32A 4NLUA 1LWXA 3BJYA 3ET6A 4FS1A 1RBLA 4M5DB 1VMBA 4KGXB 2WOMA 1SJFA 1IBCB 2XCPA 2DPIA 3RBEA 3R8YA 4MYTA 3CMQA 2DY1A 5I3QA 4MK7A 1REGX 3W5XA 2BBEA 1JXEA 2VA3A 3V6KA 1NEEA 3A13A 1X5OA 1RT4B 3GV7B 1U49A 3W2WA 2UUAF 3IGNA 1LKZA 4OZ5A 4QBUA 4DSJA 5HN0A 2MLYA 4PXDA 3LANA 5D6GA 5KG5A 1N32F 3VGUA 4ES1A 1LK5A 2DHSA 3HO1A 3V5RA 1GFWB 2HRTA 3SSRA 7FD1A 3TQEA 4FN5A 3CCQS 1FD8A 3DOMA 4GKKJ 4WYLA 5I42A 4OX9F 5IC4B 1FFGB 4ZVOB 5A8KB 4DR7J 1RT6B 3Q8UA 1XWLA 2MQ8A 4P2MA 3I4PA 1VQ7S 2YKNB 4BBYA 2Z4PA 2Z0GA 3D6HB 2EFGA 4F4XA 3KG4A 2CNLB 2GX8A 5HVGA 1JK9B 3I0RB 3OL6A 1KOOA 1XN9A 3JSBA 2SXLA 1CJKB 3EDRB 3FSYA 2UP1A 5CABA 3RR8A 1NK6A 3PW2A 4DG1B 2F63A 4S0MA 1PKUA 3V6JA 3CO0P 1RCOB 3EGWB 4URSA 5D0EA 3CCVS 1C1CA 3CW2C 1BQNA 5BXIA 3HCXA 4LF4F 1JLQB 4FF3A 1FDAA 2Y0BB 5ETOA 5CQGA 4CI0B 2QIFA 3DXSX 1R0BG 3EZ5A 2BJDA 3PR4A 2YWFA 2RQKA 1NJZA 4DL7A 3FSIA 4QIVA 2HVEA 2C3YA 3GCXP 1SC6A 3R2CJ 2IPOB 3FBBA 2MGZB 4O3QA 4CP5A 1VQNS 4LFAJ 3KOAA 3AA8A 2V0NA 1JNRB 3O1LA 2RNEA 3ZTOA 2W1BA 4ZVUB 2UUBF 2RKIB 2CQ1A 2OEMA 5KFNA 1TAUA 1HNXF 1OY9A 3CTRA 5D0GA 2QC3A 4ZVGA 1XMQF 1MMLA 3IO1A 4NPOA 1WSRA 2V50A 3EX7B 4HKQA 1KQKA 1C4CA 2NXNA 4JV1A 1X5PA 3K2YA 3FC9A 2R7OA 2HQCA 2QA2A 2B5JA 4DMZA 1MSWD 2OPQB 1R8AA 3I0SB 2Y1IA 4ZPAA 2QRRA 1TK0A 2C22A 4QU6A 3TI0A 2OSRA 1AUDA 2XY6A 1UA1A 3B78A 3ZZOA 2XS5A 3T5JA 4ES3A 2FYXA 1LW2A 3K58A 2ZBIA 2PC6A 5A8RA 1RDRA 1Y5IB 4E98A 2NPIA 4HACA 2LEPA 4ID5B 3UD5A 4ZP7A 3KK3A 5J2MB 2Z56B 2ZDOA 2ZH9A 4PG4A 1TKTB 4J9UE 2ZHOA 4BS2A 3CJSA 3O6QA 5HL7Q 2AYMA 5G0RB 2RRAA 4HR2A 4USUA 3PDNA 3OFHA 2FTRA 3CF5Q 3QIPB 4RR5A 3H2VE 5DQHA 1VBXA 2L08A 2MDAA 2H5IB 1A0OB 3PYGA 1RT4A 2WVEA 3OPKA 4NLGA 2DR9A 2B43A 2KRBA 5IC6B 2BKPA 5LXRA 2HPUA 2XTJP 5M2UA 2XSJA 4HEA9 2UUTA 4ZCKA 2C3PA 2WW8A 4A48A 2ASDA 4MIBA 3QAEA 4C48A 1KQSR 1U24A 2W2PP 1FHTA 2CG4A 3RB3A 4F4WA 2AQ4A 1YHQS 4AL7A 4Y34A 1DRZA 5E3AA 4X4VA 4NXMJ 3BPSP 4DL0C 4HT7A 3I9ZA 1E6YB 1ZS6A 3S01A 2DGOA 2MZQA 1OSDA 3OBIA 1BWVA 3CCLS 4QYRA 3OHAA 2G4BA 2VICA 3RW6A 1RACB 3D6MB 3MR7A 2KHDA 3IS9B 2HGLA 4EBCA 1F9HA 5CCMA 1CJVB 3DC2A 1FEHA 2YKNA 2QN6B 3C16B 4U6PA 2CWKA 3BBBA 3U27A 4NI2B 2RT3A 3VZHA 1RWWB 2XS7A 2YKAA 2B56A 1KP6A 4EBDA 1F6TA 4PPZA 1N34F 3T1YF 2GAGC 1CJKA 4X4NA 1PJ7A 2J0QD 4N47A 2AJQA 3TRGA 4F0MA 1VQMS 1KD1T 2Q1LA 2IHR1 3DHXA 3W66A 3L3CA 2HNZA 5LMUJ 1XNQF 4RBTA 3KHLA 4NL5A 2J7KA 2IJFA 4QJVA 1S76D 4K4ZA 1FJGF 1PO6A 4K4XA 4DZDA 4X62J 2FJBB 1OY6A 4K50A 3QJPA 2GQCA 1JLQA 4B3OB 3KLVA 4Y28C 2ZZMA 4EZ9A 2XO7A 1UEKA 5KFCA 3QRPA 2Z57B 3C3LA 3ENVA 2G9OA 5E33A 1NSQA 5KOWA 1VRUA 3PW4A 2FJVA 2E7XA 2MQOA 1LWCB 3LWMA 4PR6A 1RA7A 2RH3A 1SPBP 2PSZA 1WTFA 1GMWA 4IRDA 2DNYA 2GCFA 2MGZA 3VQSA 1IKVB 2YKOA 3MR5A 1FI4A 2YWKA 4DL5A 4DQQA 5KOXA 3I5CA 4ANCA 5DDRC 1HHSA 2LYVA 3A8IA 2J0WA 1HNVA 3JS9A 2RKIA 3DKDA 2GNKA 1HWJA 4KH1B 1GH8A 3TWZA 1N8RT 1HNZJ 1T95A 4DI6A 2E1AA 2EK6A 3NS7B 3S8SA 1RU2A 2YNFB 3M6VA 3LOUA 4J5OA 2VPZB 1WI8A 1CEZA 3TVZA 1U45A 2W7AA 4OZLA 3FCVA 2QFIA 3OQ2A 5MLCV 2OPQA 1IBLF 1VS3A 5DGBA 3I0SA 1XR6A 5HVFA 1G3OA 2OPRB 2R3VA 3FCHA 5HP1B 2JC1A 4HI2A 1TKXB 3KMQA 3D6FB 4ALZA 2Y8YA 2MSSA 1OO0B 3NMAA 4ED4A 3SMZA 3M2UB 5D15A 1RWXB 4DDFA 1XR5A 4F36A 2YNIB 4GKJF 2KT3A 5FD1A 4B3TF 2ZVSA 2HNDB 4LRAA 1NHVA 5T41A 2E9TA 3T1HF 5J2MA 2RUSA 2GHVC 1TKTA 2HMIB 4F4ZA 3G8QA 4AD6A 2MSTA 1U0SA 3HD1A 1NJXA 5G0RA 1PYOB 1IBMF 5GAHI 4IQXA 4K2XA 4ECRA 2R4FA 3DU6A 1JXVA 2DCUB 1TV6B 1FK9B 1QVFR 1S1VB 4IH6A 3M9MB 1YRXA 3BSCA 1N5QA 4ZOSA 1UVNA 2R2UA 3SEOA 3KG0A 1NBEB 2XBPA 1BHNA 2HK2A 1RWPB 2XMAA 1S57A 1V5VA 1GNKA 2QYCA 2QEXS 3O3LA 3VAIA 3G87A 1NJIT 1IKYB 2CJKA 4CLTA 3NNAA 4KFBB 3IR6B 1RAIB 4OI0A 4I2PB 2JSXA 2FHJD 4ZJOA 3KLGB 3HHLC 4L6V3 5DM6Q 2YQ1A 1QSSA 2UVRA 1E6YA 3AY0A 3N5BA 1NJYA 2VKRA 5DQIA 1HA1A 1P8GA 2BQUA 2F40A 3IS9A 4L76A 2DY9A 1CJUB 2R9LA 5B0FA 1X5SA 3AA9A 4BHQA 3FMBA 1RWVB 2UXCJ 1NSKL 3PXGa 3N28A 4A4JA 5L9NA 4KPYA 2X7IA 3MMBB 5J2PB 1TFWA 2B7BB 2WB1D 4C8ZA 2UU9J 3KLHA 1DAXA 3FSXA 1WC3A 1S6QB 1TU0B 3AOBA 3I31A 3KLEB 1SJRA 4KHPJ 2E29A 4DR1F 1PBAA 2K7JA 3LP0B 1YIJS 2F8EX 3H59A 2ZD1B 1DQ8A 1J27A 1Q82T 1HBUB 3QRRA 3GV5B 3CEDA 4F7VA 3MCOA 4Q5VA 1YBTA 4PXBA 3NGTA 1LEOA 3AJDA 1YJ7A 4CM0A 1K44A 3OUYB 3MM7A 4GKKF 4EU0A 3ETOA 1X4DA 1YJWS 3Q8RB 2B8QA 2ZH7A 1MG7A 1VQSA 4FYYB 4K0KJ 1HLWA 1OQ6A 4UOCA 1JKHA 3MZIA 5FJ4A 3MTKA 2HHWA 2VH7A 4WFBQ 3L09A 3TANA 3CJ0A 2MLXA 4KIAA 3M2VB 5HMXA 1ZTTA 1JLCB 1N5YA 4UTGA 4OZ3A 1IKVA 2ZNZA 1GAOA 3IMQJ 5HO4A 2KDOA 2CAJA 2KB2A 4B9NA 4K7QA 2MZJA 1NPKA 2LQ8A 3FQLA 4GVBB 2FJXA 2LLZA 4ED0A 3H2UB 2HG4A 2FDNA 1FTCA 2LFVA 2YNFA 2AGPA 2HS4A 3JTPA 3KWMA 4ZKAA 4ECWA 3D0HE 2NYIA 5RUBA 2CZ4A 3P5TL 4I2QB 5CZXA 2RE1A 1G7CB 3CXCR 4WIIA 4OYMA 1HD0A 3VCDA 2CQ2A 2OPRA 4MT1A 3CO9A 2WSEC 2A0FB 1IXKA 1LXJA 3CDEA 4JI7J 2HBRB 3M2UA 5IM0A 3MGJA 5J1NA 4K4VA 1TVRB 2RRNA 3RGIA 5IT9Y 3Q89A 3QT5A 4CZCA 2YH1A 1GXUA 1SQEA 2HNDA 4CLWA 1T7PA 3IWNC 4X84A 3Q86A 1S6PB 3G71S 3HD2A 1Q95G 3F44A 4LFAF 1TZ0A 3CJ5A 3QPIA 2LXUA 2GQ2A 3SQGB 2FIUA 4U8VA 4H4OB 2HMIA 3TA0A 1S6OA 5CYQB 4NLRA 1FKPB 5HQ8A 2CUYA 2DHXA 3M8ZA 1S1XB 2IM3A 2XS2A 1H0HB 1U8SA 2EG1A 1IR1A 1TV6A 3SCIE 3QYYA 4ED3A 1S1VA 2PDAA 5AXLA 2MMYA 3THPA 4R5PB 1WG5A 1PAUB 2J6SA 4ATNA 4N77A 1V3RA 3QBCA 4WCEQ 3SI8A 4Q7AA 4PWDA 2J9DA 2CVIA 2LQBA 1CBKA 1LFWA 2DH9A 1B4SA 2LCWA 3ICLA 2HQFA 1TKZB 3FRYA 2HS3A 5E3CA 1VQ4S 1N88A 5KT3A 1N54B 2BE9B 2J9CA 1RWKB 1IKYA 1YX2A 3HFZB 2PFDA 4KFBA 1FDDA 2NXJA 3W9HA 3C66A 2ZJQQ 2AX0A 1SC1B 1HBNA 5JJBA 2HHXA 2HRUA 1FCAA 3T41A 4ZPVR 4V19J 2W7PA 3V6HA 2XHCA 2PEHA 4LF5F 1Y0HA 3N9UC 2LU1A 4ZVEA 2HKEA 4DQRA 4U7UD 3RR7A 3JTOA 2IM0A 1VCTA 2XLIA 1RAHB 1CJUA 2NPFA 1H74A 2V6AA 4FDFA 2MQPA 3X3UA 4U8YA 4N41A 2CG8A 2YPZA 3EE3A 2JWNA 1AFIA 1NKBA 1TL1A 4OFZA 4QIWD 1B70B 2M8DB 4DCPB 2DNLA 4AFFA 1QSLA 3ETMA 3CJRA 3KLEA 3NWRA 3OXGA 1TR0A 4PABA 5H9FJ 1D3WA 4IRKA 3NCQA 3BYRA 3PW7A 2IJNA 1KHWA 3K89A 1HBUA 5HMWA 4XAKA 3WBZA 4DR6J 4GVLA 5HJXA 4HTIA 2VUGA 3OR1A 4IH7A 3OUYA 4IOCQ 3NCRA 4Q45A 4C8LA 5E5NA 5BYQA 3GLJA 4AXJA 3ZZ0A 3EYZA 1NHUA 4TQRA 2C3MA 1X4FA 1S1UA 3HHDA 3ZZRA 1DZ5A 2J0SD 2BEFA 2MQLA 4QU7A 1YI2S 4FPRA 3V4IB 3BGRA 2XMUA 2RHQB 1VBYA 4FKYA 4OI1A 3BGFA 4G65A 3M2VA 5GVQA 1MROA 2E9RX 1U26A 3V2UC 1JLCA 2VFTA 1U0HB 1TL4A 2FZKB 1YWXA 4CLYA 4Y3CA 5BYSA 2VDIA 4U95A 1BQXA 3TOQA 4A8MP 4DCOB 2XWXA 2XULA 2AZ1A 1NDPA 2APOA 3MI7X 2IC3B 4WP3A 5LMUF 1SKWA 4JBCA 2W4PA 3DRPB 4Z2XA 3P96A 2CPXA 3M30B 2LU2A 3AB2B 3CPWR 2U1AA 2KU7A 3VZIA 4KGKA 4OZ1A 2F4FA 1PCAA 5EX3A 3PIPQ 1GQEA 3OTOF 2DVIA 3FEYB 2FLPA 3W5ZA 2K3IA 3SYZA 4OYZA 1EQ0A 2HNYA 2J6UA 1BWEA 4DUTA 3QATA 4ZVSB 1GMVA 1CPZA 1S72S 4NCGB 5HANA 2F65A 1TVRA 2VC0A 1YVFA 1KQGB 1HQUB 4U9RA 1YG0A 3NGUA 3N6NA 1VQ9S 1CC8A 4TNOA 3J7AN 1LK7A 3DRSA 3D1HA 3MEDB 2YWHA 3ZC4A 1S6PA 2JJ4D 4RUAA 3IP0A 4HDHA 1FJ7A 1SJ3P 3ZTRA 1XNRJ 2HZVA 3W2VB 4H4OA 4PG8A 2AEMA 5CYQA 1RAOA 4WYWA 3H5UA 3MR2A 1QY7A 3ZTSA 1HNZF 4JI1J 2IBOA 1DQAA 1NSAA 1IWGA 4NZ6A 3MOZA 2HK3A 4PG7A 4NXNJ 1G4CA 2Q43A 1BGXT 1TAQA 5J1PA 3VAJA 3POTB 1UFWA 2A2DA 1RAJA 3P8BB 3NS6A 4G3IA 3Q22A 3I4HX 2R8GA 5ETPA 1YITS 1U02A 3IC1A 4USMA 5DDOC 4JI5J 4CT9A 1J5EF 1TKZA 4R25A 4QZVB 1VQLS 2BJEA 4RW9B 3FDSA 1NM2A 2IVFB 1NDKA 7FDRA 2ZH1A 2C2OB 2DH8A 1TUGB 3GJQB 1Q0NA 4NLTA 2BE2B 3Q0AA 3NS5A 3QT8A 2AYBA 2P6SA 3H5SA 4OJGA 2V94A 1BUXA 3K5MA 1RQ0A 2KM8B 5C25B 4FXDA 3DCAA 3IAM9 3UDCA 3UE2A 2JVRA 3R9LA 1FESA 2RDJA 4DL3A 1DHMA 2R8HA 1U09A 3BGUA 1RSCA 3OT9A 1SXLA 4PG5A 1GTEA 4UY85 1FRXA 2ABYA 4DPOA 3HSDA 2VONA 2V4JA 5F8IA 2GJIA 4ZPBA 4CWBA 3K8WA 4TU9A 3HPOA 5K8OA 1LWEB 3TARA 3HHEA 4DR4J 2B51A 2HFNA 1VGYA 2XNRA 2QMUB 2BJ9A 3C8YA 3D5MA 4P10A 2V9WA 4HTJA 2KT5A 3ZTPA 1F9FA 5A0YB 3CJ8A 1PJ5A 2H5JB 3MM6B 4QWEA 3BKTA 3E3XA 3M8QB 4DCJB 1CS4B 1HBMB 4ES2A 1RT2B 5CH7B 4CLPA 1BMQB 4IG3A 4LREA 2AWZA 1B64A 3R7BB 2HHSA 1R0AA 2IVYA 2XYGB 1WG4A 2NUUG 3BQ1A 2DRDA 3MM5B 3HSGA 4OI4A 4OL8A 4F25A 3KLFA 1DJ0A 3T9ZA 1WDDA 1FKAF 3D28A 2WBRA 4A46A 1OS5A 5U47A 1FNXH 1WG1A 2EC2A 2XMMA 4NWBA 2ZWOA 2FHOB 5A8WA 1D9DA 3IBFB 3EZUA 1PC4A 1I51B 1U6BA 1K1SA 1FVSA 1IN0A 1H6KX 1UZDA 2MZ1A 2HSEB 4BLGA 2IC3A 4NMLA 1A9NB 1QLNA 1R31A 3GFYA 3SCKE 1XTZA 1YBAA 2RF2B 4M5KA 3M30A 1C1BA 3TA2A 2DNOA 3I5BA 3AOCA 1VK3A 3BBCA 4HH1A 4KY3A 2YX4A 3N6MA 2V34A 3A4TA 1LFPA 2FHMA 4RBVA 3AXMA 1U4BA 2N4CA 1HNWJ 4K0KF 5LJ3Y 2VQEJ 3JAMY 3IN5A 1MMNA 3G8SA 1MLAA 4ZCIA 1NMEB 4ZLNA 3NMRA 4NCGA 1VQ8S 3RRGA 2W2QP 3GR0A 4RNHA 4DX8H 3BR9A 1JX4A 2RU9A 2GIQA 4E2FB 4LBPA 2GVDB 2Q3PA 3MEDA 2DB1A 3ZO7A 3M8RA 2DIVA 2EBGA 4KV8B 4ZN1A 5KFSA 1UWBB 3PX0A 2ASLA 3W2VA 5D78A 3QGHA 5KFDA 4X4OA 1N36J 1VISA 3GV8B 3DDNA 2QA4G 2C3UA 4DL6A 4I6WA 4LFBJ 4KO0A 4CO0A 4NX9A 4KB7A 3Q2TC 3MUMP 3POTA 3UI3A 2VG7B 1FXRA 1F3FA 3EM1A 3I96A 1QJHA 3KJVB 1J5OB 1WHWA 4A8YA 1FX2A 5F3TA 5JUMA 4O3SA 3MOJB 4DV6F 4HYKA 4X64J 4JI0J 2P6TA 3QO9B 5DGAA 1SKSA 4RW9A 5LSLA 2CPEA 2JVOA 1VR6A 3CJTA 2D3UA 1FNOA 2DGVA 2I5JB 2E9ZA 1Y4ZB 3IBCB 2BJ1A 2Q6BA 3BB5A 3HDSA 1CVJA 3D2WA 1TELA 4V19X 4PG6A 1CLFA 1V3SA 1YRTA 3HXMA 3R5GA 4EWTA 1SJ4P 3WC2A 1ROFA 2VOOA 2EFOA 1NSPA 3QRQA 2M8HA 1FDBA 2DXFA 1F1BB 1S10A 4WFXA 2FJEB 1H3DA 3CCJS 5C2GA 1SKRA 5KFMA 4J9NA 2XSFA 1FFWB 3U02A 1RAAB 5LXYA 1MN9A 1JWWA 2GVZB 2GS8A 1S77D 2O1PA 3KJNB 1LW0B 3GU0A 2P5VA 2IDEA 2HHTA 5KFRA 2KTQA 3WIUA 1FA0A 4NEYA 4ZPDA 1N6QA 5LT5A 3H90A 1LWEA 3BPDA 4JV5F 4N8NA 4RNNA 2RHSB 3GONA 4LSNB 2HFOA 3M2RB 3T1AA 4DN0A 4JUZA 3M8QA 4HVZA 3Q8VA 4DN9A 2L9WA 3GFZA 1HBMA 3ADAC 3H98A 2LEBA 4NMXA 2OSQA 4K5RA 3CCTA 1B99A 1VBKA 3H20A 1SUQB 4LF2A 1FTRA 2CPZA 2UUAJ 2EFPA 2QG9B 2ZC3A 4IH5A 1RHKB 2EFNA 4ER8A 2R42A 5B09A 2ZOGA 4RO0A 2JC0A 3MM5A 1N32J 1RHJB 3F73A 1RADB 1VIOA 1DLOB 2V8HA 4QPTA 1FRJA 1KONA 4YR2A 2DHAA 4DR2F 2OPPA 3N6LA 2PMWA 3ISNC 3MFIA 1UTAA 3MUVP 1NDLA 2XB2D 3DLGB 4Y2CA 2N82B 1NPRA 3GFXA 1C0TA 3DGPA 1T9YA 1X4BA 1C4AA 3OTBA 4M8LA 1D8YA 5KG6A 1KVIA 2X1BA 3KHGA 4LF9J 2BABA 4YN3B 1T3OA 4G1IA 1OY8A 1Y3JA 4OYAA 4X4SA 2D3O1 1NNDA 5D4OA 1EAYC 1B0PA 2PIIA 3E01B 1IKWB 2FGOA 4LR8A 3CSKA 1RT7B 3HKWA 1RXOB 5M2RA 3R7NB 2AGQA 3EUNA 2BKNA 4RUBA 3EJMA 3AD8C 1UPMB 4EGLA 3FQKA 3QGGA 4YUDA 1RWNB 2RDDA 2GVDA 3OXLA 3BBFA 1Q4RA 1NJWA 2CJYB 2VBWA 1QUPA 3V6DB 3CCMS 4ERDA 1FRHA 4YB1P 3CD7A 2H3EB 1UWBA 2E7WA 2QLJB 4I6AA 4ZVHA 4DSFA 5DG7A 2HWHA 1K0VA 3EVMA 2QSWA 4DQIA 5L9XA 2FVQA 3CIMA 1ZAWA 4DQPA 4KKOA 4WWSA 2XNQA 3D6TB 3A3PB 4F4YA 3VALA 1W25A 1URRA 2CJQA 4KGMA 3OSPA 1Q78A 2VJVA 1J5OA 1HQEB 4R8UA 1EETB 3QWPA 3QO9A 2U2FA 3TQ1A 1OIAA 2V8DA 3JSRA 4MFBB 4Q43A 5GADU 4EI2A 5K14B 1F9EB 5D77A 4WIQA 2I5JA 2JLEA 4DPWA 1H38A 4DOZA 2UUBJ 2KXNB 3TA1A 5K8NA 2M9KA 2OELA 2P9CA 2BACA 1HWKA 2V67A 6FDRA 1XMQJ 4LSLA 1AT1B 3GJSB 4YEAA 4CLUA 4ECXA 1IR0A 2MKSA 3BEGB 3PKMA 4ECTA 1RABB 2B4VA 3RU0A 3TVKA 4JI1F 2J9DE 1S48A 4OYXA 4NXNF 3RBZA 4RW4B 2GHPA 4X4RA 2XO6A 1RT1B 3MMCA 1SB6A 2NCKL 4Y2IA 1HHQA 4ZA1A 3Q8PB 3CMES 5F41A 3CB4A 1ZPWX 4ILRA 2QL7B 4PEOA 2G0JA 3J80U 2DCLA 5CD4H 2V2QA 3AQOA 3JTNA 4P75A 2MZRA 5C7PA 2JRSA 2ZH2A 2VG5B 1JB0C 3KKFA 2YQ3A 4PZVA 4JI5F 2G0CA 3OXFA 5GAEI 3PKYA 1O8BA 1ITPA 4WPAA 5CA5A 2XYHB 3DFEA 3SQOP 2FUG9 3HK2A 1F60B 2H54B 4BC7A 4P6QA 1QE1A 3LH2S 2W9CB 2AJ0A 2YY3A 4AT1B 4AL6A 2D41A 3LGMA 1NUEA 3ISZA 3DDIA 3MCNA 1RCXB 3BV8A 4TKTA 3D68A 3BO2A 4I6YA 2XMKA 2GMJA 2ACYA 5JVGQ 1SUQA 5L39A 2GW8A 1RZMA 2XWYA 4C8NA 3UW1A 1KFSA 4D3GA 3ILJA 3G82A 2A1BA 4LVNP 2NXUA 4J9OA 3BO4A 5D0RA 1UAWA 2ZWPA 3JYTA 2UUWA 1DTTB 4J7CA 2DR6A 2YPYA 4OYOA 2RVJA 3KLIB 4JI4J 3TZXA 3R97A 5FDLB 1OYDA 3MPUB 1HIYA 5LSRA 4Q0BA 3DLGA 1FXLA 4KPCA 1ZYQA 5G4DA 4DR4F 3ET6B 5GMKa 2RDIA 1VDHA 5IFMA 4UOFA 3SFUA 3DRXA 3TEGA 3UCUP 2Z2ZA 1QAXA 4OHVA 2AZ3A 1X60A 2V2VA 4F3QA 3ZZUA 4OV6A 2LXIA 3BN7A 3CDAA 2WVFA 3WQPA 4DF4A 4HL9A 2J7UA 1W7WA 2XGPA 1JLAA 1VQPS 1JLGB 3SXLA 2CJXB 3M8SA 2WRMA 5J2NB 3HMJG 3E01A 1N34J 2MKHA 2Z2YB 3I56S 3T1YJ 2I8EA 1RT7A 3OFFA 4JI6F 5C24A 4NE9C 2OP5A 3GP9A 3M1VB 4FF4A 1T02A 1WOPA 3NOCA 4OLOA 2LVWA 1RT5A 2DPJA 2CDRB 4M94A 2BXJA 2LQJA 3FZBA 1K47A 4KH0B 3V6DA 3N79A 2E1RA 2KI2A 1GMWD 1FJGJ 2IRXA 2RS2A 2DGSA 2K3KA 3VF0B 3MM8B 3MAAB 1NU4A 2LQ9A 1WEZA 2YNGA 2VZ9A 2BKOA 5L8RC 5IT9U 2N7YA 1I6JA 4RKUC 1EX8A 2H4YB 3A8EA 4EO8A 1OPIA 1HFEL 4PYDA 2JX2A 1R3NA 5L1IA 1U1RA 1CG2A 1HNWF 1GK8A 2J5AA 3MPYA 1HQEA 2C2RA 5E3QA 3MPDA 1EETA 1FEEA 2PT0A 4Y2KA 1YDLA 4UY8T 4U67Q 2ZBCA 4RUCA 2IMWP 4ZITA 2MJNA 4DV1F 2FZCB 2WBMA 2ZBRA 1JXLA 4PQUA 4PRFA 3SBMA 3RBDA 4X2BA 2NYHA 3QIDA 5KT2A 4ZN3A 3FKBA 4KGVB 2M5YA 3JQMA 2ZFHA 4M5JA 4Y2MA 3C6TB 4C0OC 1SC3B 1Y5NB 2E66A 1FJCA 4FP9A 5E0OA 1Q8LA 5LL6d 1VQYA 5B0EA 2GIRA 4ITSA 2C2DA 1IBLJ 1XERA 2NQPA 1KC8T 2MKIA 2CYYA 3ZNUA 3K7RA 2JZ5A 3R6LB 5ETLA 3WC0A 1RT1A 1REVB 4CLKA 2CJBA 4Q2LA 2OD4A 4HHJA 2XM3A 2J7WA 3ENAA 2HLTA 1AXQA 4TLQA 4GKJJ 4KT0C 2HQGA 4B3TJ 1EIYB 4UZBA 4MYUA 4IFYB 4CLFA 3NOGA 5J1EB 4JI0F 5LMNF 2HQDA 5D4PA 4C0BA 2BYCA 1T9WA 1UW9A 4OYBA 5ADZA 1PYSB 1I5OB 3PRVA 2HHHJ 3V4MA 4P2FA 2I0XA 4FKXA 1RHUB 2W9CA 4P9SA 3HVAA 2G2ZA 3MEGB 5F0UA 4I56A 4USJC 2MQNA 3NNCA 1HARA 4O0IA 3PG9A 2RUGA 2VASA 2HFSA 3PX6A 3MEKA 2CQBA 2VD3A 2UV8A 4K59A 3A8KA 1FJEB 1RWMB 1R43A 2WSFC 4I69A 5KFEA 2MY7A 1YLXA 1DBDA 3TUZC 5DDQC 1ELOA 4X66F 1NRKA 1EB0A 4YFUA 1U7LA 1VLOA 1DTTA 1OWXA 3K17A 4I0WA 4FNHA 2XCAA 3AH6A 2CWXA 2PD1A 9ATCB 5CAAA 1WEXA 3SSQA 1SV5B 1UVLA 4PWUA 3H0PA 1KQFB 4DV3F 4CNZA 4RPFA 4OYIA 5KFWA 2CPHA 3WDOA 3KK3B 4Q8EA 2ZBQA 2IBKA 2HWTA 4C8OA 4DX7A 4CO5A 2OKQA 1T05B 1RHMB 2XY5A 1QM9A 2HHVA 5CHCB 3JSMB 1NPPA 3CIZA 2F1FA 3GE9A 4ZJQA 1W26A 1HMVB 2FHKA 3THVA 1JLGA 3GSDA 4FYVB 2X1AA 2X3DA 1Q86T 3U1LA 1VYAA 1IKXA 5J2NA 4AYBD 1NLKL 2LECA 3DOKB 2XLJA 4OHXA 1CULB 3M1VA 2XSJB 4DR1J 1IM4A 2QE5A 4L74A 1APSA 1BQMA 5K5MA 2ADCA 4UF4A 1OQ3A 3OJSA 1Q8KA 2FLNA 1QDUB 1U2RA 1ULRA 3AB4B 4MIAA 2XZWA 1S79A 3N4WA 5H1SV 2D74B 3TR5A 2QSFA 1G2EA 4ZK7M 4B9SA 1M90T 2RILA 3RRHA 3MM8A 5HQMA 3MAAA 2OTJS 1RWOB 1YJUA 1RHRB 3NAIA 4N56A 4G6VB 4TXSA 1M1KT 4ELUA 3JQJA 5KFOA 5DO2A 3DYAB 1QAIA 5I3UB 4TU8A 3IFEA 1TL5A 3TO8A 4LF9F 4I1TA 3HI9A 4M5LA 2GV1A 1K1QA 3EVOA 3PJWA 4C11B 1GEHA 1GX5A 2PA3A 1WC5A 4NOHA 5KG2A 5D4LA 3CCES 3UD3P 2HBQB 3UDLA 3ZXWA 3TX0A 4QWBA 1U1MA 4U7UK 3FGVA 5I4MA 3K5PA 2E1MC 1OYEA 5L1KA 2BX6A 4DHVA 5C5JA 1AFJA 1M5VC 4NA1A 2HNZB 4ZJLA 3MPVA 3C6TA 2R2SA 1D9FA 1U6FA 3O5TB 3I82A 1DTQA 4ZS6A 4Y00A 2FLLA 3Q24A 2AT1B 3CCZA 4NA2A 2DEJA 3H8YA 1F2GA 1W2IA 1QD1A 2EK1A 3DMJB 1SH0A 3D4JA 4HLBA 2C28A 4NYOA 2ZDPA 1REVA 2YWEA 2RAQA 2Y8WA 5IWAJ 1VRUB 4BDPA 2FB0A 4RW7A 4OI3A 3OL9A 2L9NA 2WONA 3D67A 3IG1A 4B3SF 5KFYA 1KNZA 4FVCA 1E6VA 4TQSA 4IFYA 2HEKA 5J1EA 4CM2A 4K4WA 3AD9C 4OJ3A 4F3MA 2J8AA 2M3DA 3TZWA 1HNVB 2KN4A 5CZVA 2VG6A 4C3MA 3K57A 4O3NA 1UWAA 2DT9A 2R8IA 3NGSA 3SV3A 1N5VA 4ZCMA 5ETNA 5F8GA 4FXVA 2B9YA 5F8HA 2C1EB 3MEGA 1F3VA 3ZTQA 5KFAA 2CADA 4NCAA 1A6LA 4XO0A 2OFHX 2CQ3A 5EWFA 2IDLA 3RAXA 4DUZF 1IWAA 4QOTA 5DLFA 2BW2A 3BYPA 2V2ZA 1NK0A 3LW5C 4WF9Q 4L72B 4K4YA 2EC0A 2EBEA 4LRFA 4LRCA 1O0PA 3DDKA 1X4HA 2DR7A 4RWWA 3CMAS 2GC8A 4C4WA 1SV5A 3RW7A 1YZ6A 1SJ1A 3IGVA 3BGOP 4NLQA 3G9CA 2ROEA 2HQ3A 4DQSA 1JJCB 1TL7A 2KH9A 3B82A 3KUHA 4GO7X 4LF5J 1AZSA 4CH0S 3OD2A 3RZAA 2X51A 2ZHAA 2KKHA 3KNGA 1ACMB 2DGTA 2FZGB 1T05A 3QSIA 3JSMA 5GADI 3B4MA 4OHZA 3D66A 1HMVA 3QZ8A 4MAKA 3A8JA 2MTLA 3PIOQ 4OHWA 2KRRA 2JEFA 3M8YA 3DOKA 1MU2A 2UUCJ 3PTWA 1CULA 2N3LA 2LKZA 4DFPA 1CQMA 5AE3A 1QVGR 4ZVTB 4CNYA 1JIHA 3DI6A 2JFDA 4O44B 2MPUA 3OR2A 1C0UB 3UO0A 2G1DA 2MLZA 5F8MA 1NK9A 1ZM4A 4JI4F 2CJAA 4JV2A 2R7UA 4ICLB 2KO1A 3ZZZA 5KFFA 3L95X 3HVTA 2PFFB 3GG0A 3R5DA 2XG8A 3DYAA 2CQHA 1PBUA 2YKPA 5I3UA 1R8CA 2D3OR 2ROGA 2QLXA 3CC2S 2OH2A 5F8JA 2KXHA 4C11A 4IKAA 4P74A 1RUSA 2I1RA 2GA7A 4HI1A 3ZFVA 1NK4A 4MMOA 2DNGA 1BE4A 1KDNA 2QL9B 3BSOA 4B08A 1SL2A 5KAKA 2ZUAA 3F0NA 1GMUA 3SIPB 4YB5A 3FUYA 3KLHB 4R0JA 2AX1A 2FVRA 4ILLA 4QQBA 3SCLE 1KBRA 3G6YA 6AT1B 4JYAF 1FE0A 4DSIA 3EXCX 3AOAA 1XIQA 2OFGX 1RAEB 3MM9A 3CD5A 3QFWA 5DS7A 2DNKA 1Q5VA 1TP7A 3R5JB 4RW8B 4C98A 1L3TA 3AHPA 1UEVA 3W9JA 4YP3A 3MM7B 2KZZA 5EUHA 3DN9A 3BREA 3OTOJ 1LQ9A 3T9NA 3HVWA 3Q8QB 4DV5F 2NSCA 5L1LA 1EP4A 2M52A 4ZDNA 4Z37A 4I68A 3DMJA 4WP9A 5IS2A 1JKHB 4CTAB 3K59A 1RTIB 4A8XA 1YRUA 3QJLA 1SQFA 5F0WA 4JI8F 2DGWA 5KFHA 5HLFB 4OZNA 4TY8A 2WCXA 3G6XA 4OZ2A 3DGVA 3FNNA 4WK1A 3TX8A 1VI7A 1F5BA 1N5YB 5LOQA 1HYSA 4H4MA 4BC9A 5E41A 4I64A 4ZP6A 3KDNA 2K7KA 1UPPA 1M1HA 1CSJA 3SFGA 3H2LA 1KTQA 4IDKB 4J9LA 1UZHA 3FK4A 3RTVA 5KG7A 2MQQA 5JVHQ 3FEXB 4FXWA 2W2MP 3BS9A 4Y65A 7AT1B 1S0MA 4LF6J 5J2QB 3C15B 3I5AA 3HSZA 2C2ZB 2XMVA 4DV0J 2MY8A 3QGIA 2A3JA 5H9EK 1OMSA 3VGVA 1FKOA 2DEIA 2LDYA 1RTHB 2GGPA 4UUWA 1N48A 4FYWB 4DBQA 3ZNJ1 5HI7A 3MXHP 3W3SA 1YKWA 1J5EJ 4URGA 3OLBA 2HZCA 1U6ZA 5IM0B 4ECZA 3J81Y 3N01A 3HHLB 3N5FA 1S1TA 2BOPA 3QLHB 2MZTA 2XQCA 2B3TB 4PWWA 5KFTA 3W8PA 3M6WA 4M5HA 4MKAA 4C3KA 1FWLA 3N0VA 2HHHF 3PVXA 1RTJA 2D9PA 2NSBA 4U96A 2E1CA 1R27B 1NH7A 1VQOS 2GJFA 4WP8A 1RAGB 4ELTA 2YKMA 1D09B 2AV5A 1P1LA 3LWLA 2HWIA 4ZVPB 1WF1A 5DZ6A 4D3HA 4WFNQ 4IG0A 1WF2A 4LT6A 3Q8SB 4PWDB 5E3PA 5GMDA 1JLBA 2HHQA 4NEZA 1EZZB 3HT3A 2RQCA 2R2RA 3DXBA 2VA2A 1XR7A 1JLEA 4O44A 1C0UA 3S1TA 4ECYA 4J9MA 5CD4A 5BR8F 3IRWP 4KGZB 3KMSA 1RYRA 3CC4S 3A3OB 3D0IE 4ETZA 2IA0A 4ICLA 1HBNB 3VAKA 1MWYA 3FBFA 3H25A 4CYUB 2BJ8A 2J76E 4LIRA 3TZYA 3PY8A 1S0VA 3IR5B 1S9GA 3IA0A 3NNHA 2M0GB 2BV3A 2I38A 2BM1A 1Q7YT 2WW4A 2KZMA 2W9AA 2QLBB 3W65A 4J9SA 3FJ2A 1T9UA 4DX5A 5F9LA 3ILLA 4L75A 1XMOJ 3HULA 3ONQA 4I4BA 1JJ4A 4P7TA 1RISA 3JB9k 1TL1B 3C19A 3E51A 3QT7A 1RT3A 4JI2J 5AT1B 5MAOA 4F2SA 1XQIA 2KYZA 4LUBA 4QIFA 1S12A 2R2TA 1EKRA 1D8ZA 2B4UA 1Z1ZA 1Q8IA 2UVUA 3GIJA 2BJ3A 1ZZFA 2KVQE 4USKA 3SDEB 3OVAA 2EI5A 4RW8A 2QX0A 4KSEB 3HZEA 4C8KA 1HI1A 2GMHA 1WHVA 4E8UA 4USTA 4ZLJA 4XPEA 1WTBA 1OSCA 3OR1B 2MJUA 3CCUS 1SJQA 2QO3A 2QV6A 3FFIB 4X4PA 4AL5A 2FC9A 5HROA 3QJJA 2RB7A 4CLSA 2E5HA 1B0VA 5L1JA 3HF5A 6FD1A 5DM7Q 4F2RA 1VFJA 4CTAA 3IAS9 2LDIA 2MZSA 1S1UB 4H4KC 3R5BA 1RTIA 3PRBA 2Q6CA 1R8BA 4HT5A 1HQ2A 3CULA 3R2DJ 2FPHX 3BGRB 2L3MA 1RB0A 2WVDA 5HLFA 1YJTA 1MROB 1MN7A 3X1LB 1NKEA 4J37A 3VQTA 2GO9A 1WC1A 2W7OA 4PUOB 3NP5A 4ZIWA 2W4CA 3TAMA 1ZOTA 3GIRA 4DR5J 2ZE2A 4Y6IA 1U1OA 2CA9A 1XEZA 3R5CA 4IDKA 1P6TA 2W8KA 4PYAA 3TZZA 2FVPA 4RLEA 4UQTA 3PHEA 5ETQA 5J2QA 2O67A 3C15A 2HHPA 3VGSA 3MAQA 2MKYA 2LXFA 2FJWA 3K5LA 2O5DA 5EX0A 1RTHA 4GO5X 3M6XA 1BD6A 3TW0A 2CPJA 1PIEA 4FBUA 2HNYB 4DV6J 1Y7PA 3VR1A 5IWAF 3BH7B 1CQNA 2GZOA 2K1RB 2H4WB 4W92B 4K5SA 4O0NA 2LQ5A 3HHLA 2VB6A 1S59A 1HHTP 2D3ZA 3QLHA 2QTWA 4DR3J 3DRSB 4AUKA 2H9ZA 3NRBA 2ZBPA 4KE5A 3BN4A 3ULHA 1UFKA 1H7WA 1NZ8A 4CO2A 2V4RA 3IRXB 2FC8A 3PHTA 5E3RA 3B8HA 4Y2AA 5LM7E 2E7VA 3L4BC 1O51A 4A8QA 3VV2B 3TAQA 2HFVA 4YMEA 1WOSA 4ZLLA 2EVZA 2NXEA 4B9MA 3MD1A 4WXWA 4QYZK 3UN3A 1OJ4A 4M5NA 2OGUA 1RKIA 3MFHA 1B7YB 3DLEA 5CYJA 1AROP 2CQPA 4QIGA 4AE5A 2DXEA 4JV5J 1FWPA 1WEYA 4OI2A 3GZ7A 3FBEA 5ETKA 4MTPA 1T03B 3GWCA 3H40A 4TLRA 1YJNS 1RKJA 2PI4A 4RJVA 2B4OA 2N7CA 1HW8A 3F56A 1S1WB 4QWCA 2CXEA 3OSNA 2E5IA 4CYUA 2CQGA 2MXYA 1Z2LA 4OHYA 3DLKB 3PCOB 1PJ6A 2R7TA 4H4KA 1VJQA 3DRRA 2ZUGA 3OW2R 5KG4A 4E0DA 4K4SA 2P9EA 2BJ7A 1TKDA 4OJHA 3CCWA 2MB0B 1LXNA 3LALA 3M4XA 3DOLB 4C8YA 4DV4F 3KK1A 2J8SA 4Z7YA 3ILIA 2WVCA 3LPYA 3BR8A 1WOOA 5HQLA 1UVKA 4FVMA 5A6PA 4DR2J 3QT6A 4R0EA 2UUCF 2V4JB 3CC7S 4O4GB 2JEIA 1U2CA 3LGNA 4EYHB 2QZ8A 1QSYA 3CD6S 3PYDA 1WKJA 1U1QA 2LA6A 3KJFB 2FY1A 3GJTB 3THTA 3TP2A 3O2IA 3SDEA 3L7OA 3G86A 4XIUA 4X4TA 3HVRA 4ZP8A 3V81B 2HBZB 3VAHA 3FFIA 2KFNA 4IG3B 2Y0SD 3LA0A 2CIMA 3M6UA 3T5KA 4A8FA 2OAUA 2BQ3A 2ZKTA 1R0AB 2BMBA 1SH3A 2XGQA 3K0JA 3EVWA 1Y3KA 2ALZA 4RUHA 4G1PA 2C42A 2R7VA 3LO3A 3KLFB 1P27B 2ZOFA 2VPXB 2R7XA 3BQ2A 2IAJA 1HI0P 1UMJA 4PUOA 3PFOA 5A8WB 3I6PA 1UJ5A 1TK8A 5ETMA 2V68A 1TL3A 1KS2A 4DEZA 3SZ2A 2C2NA 3P3DA 3AT1B 5EWEA 4IOAQ 1FWKA 1U8WA 2XMTA 1KN6A 3NWGA 4P71A 3GIIA 3D7SB 3R3TA 1C1BB 2I9SA 2DGUA 5GAEU 4DS4A 3AAWB 3MPWA 2JHEA 1V6HA 5KFXA 1PGZA 5KT4A 2VODA 4LIWA 2EG2A 1LNQA 5B08A 2KFZA 3OVSA 1FVQA 3F41A 1RJJA 2K1RA 1Y11A 2Z2MA 1SL1A 3HHKA 4USIA 3ZZPA 5C42B 3QWUA 1H98A 3R7SB 3J7YU 2OUGA 1GX6A 4LJMA 3GR1A 5D8HB 4RNOA 3KTQA 3ISND 2W25A 2CNOB 2W01A 2Q79A 1P1TA 3HHNB 4TYBA 1IVZA 2NZCA 5F8NA 3RB0A 3W61A 5ETTA 1HWLA 4ED6A 2YX1A 1RBOB 4IOBA 1WKKA 3IRXA 1UVIA 2CFXA 4DU8A
chains in the Genus database with same CATH topology
1BC6A 1HQEA 3CWJA 2BZ2A 2C2RA 5E3QA 4M5DA 3SV4A 1EETA 1FEEA 2PT0A 4Y2KA 2BANB 3HKZD 1S1TB 5HMYA 3OUYB 5IZHA 4UY8T 4U67Q 2ZBCA 3MM7A 4GKKF 5CYMA 3CJ2A 4RUCA 4KO0B 3OV7A 2IMWP 4LF6F 2MJNA 1ZH5A 4DV1F 3K5OA 4EU0A 3ETOA 1X4DA 4YDXA 3TYTA 1TUVA 1YJWS 2WBMA 3Q8RB 2ZH7A 2HW3A 5I3PA 4O4RA 1VQSA 1X4GA 2FVSA 2MKJA 2NR0A 4DV0F 4O3PA 5JXSA 1OQ6A 1JXLA 4PQUA 2YWGA 4TU7A 4PRFA 4NLPA 4UOCA 3RBDA 4Q44A 4X2BA 3NKYA 3QIDA 3MUTP 5KT2A 1JKHA 3H5XA 4WZMA 2M5YA 3MZIA 5FJ4A 3MTKA 3D54A 2ZFHA 4Y2MA 1UFLA 3C6TB 1RTJB 2YVSA 2HHWA 1ZAVA 4C0OC 4JOUA 2VH7A 4WFBQ 3D1QA 1Y5NB 4KBIA 5SUHA 1M5HA 1X0FA 4QYZJ 2E66A 3NL0A 3GG1A 1FJCA 3LQVA 3L09A 4HDGA 4ZMMA 3TANA 3G6ES 4MJKA 4FP9A 1LWFA 3CJ0A 1RTDB 4KIAA 5E0OA 1Q8LA 2CPYA 4NLVA 5LL6d 1VQYA 1KEKA 5B0EA 3M2VB 5HMXA 2GIRA 1VQKS 4C7QA 1F0XA 1WNEA 2YKMB 4IQMA 4ITSA 2C2DA 4OZ0A 1VRTB 3CJKA 1XERA 3PNIA 1KC8T 2NQPA 2ASYA 4DR6F 1VQ6S 1ZTTA 2MKIA 1JLCB 1N5YA 2F9DA 2RF2A 4ZHRA 1T03A 1IKVA 2CYYA 2EFQA 2ZNZA 3K7RA 5ITHA 4BCAA 1GAOA 4EEYA 2JZ5A 4BWMA 4QW8A 5HO4A 2X3GA 4LQ3A 2KDOA 2YKQA 4IG0B 2KB2A 2HAIA 2GMLA 2VPWB 4B9NA 3WC0A 1RT1A 1REVB 4IR9A 1UW4A 5B0BA 2MZJA 5DDPC 2XHWA 1S1WA 1Q8BA 3FQLA 2CJBA 1JLBB 3CT9A 2FJXA 4Q2LA 5AE1A 2OD4A 3BO3A 3DLBA 4NA3A 4HHJA 2LLZA 4C0HA 4ED0A 3H2UB 2J7WA 2HG4A 2IYGA 3DLKA 2HLTA 2EW9A 5F9NA 2NZ4A 1AXQA 1RWUA 2FDNA 2QA1A 4TLQA 2DD8S 1FTCA 2KVIA 1JLEB 2YNFA 4KT0C 4WE1A 3OL7A 2AGPA 2PO4A 3KNAA 2HS4A 3JTPA 3KWMA 4OX8A 4ZKAA 1A7GE 2IYIA 4ECWA 3D0HE 2NYIA 4FNIA 3CGIA 2CZ4A 3P5TL 4ID8A 4I2QB 4MYUA 5CZXA 4IFYB 2Y1JA 5J1EB 4JI0F 2RE1A 2DNPA 1G7CB 5LMNF 5D4PA 4C0BA 3DOLA 2W9BB 1M5KC 3CXCR 2BYCA 1NZAA 4WIIA 1D9AA 5A8KA 4DFJA 5ADZA 2R7SA 3MECB 1N52B 1HD0A 1KTVA 1RT6A 3BM7A 2QFJA 4WK3A 4QW9A 3A1YG 3VCDA 1FERA 5KFIA 4KTQA 3PACA 3V4MA 3G96A 2I0XA 2CQ2A 2OPRA 4QR1A 2KFYA 5FLXY 2ZHBA 4YB7A 1S9EB 2V5HG 3K8VA 4G1QA 4KV8A 3CO9A 2WSEC 1IXKA 1S9GB 5KFLA 2W9CA 1UVJA 1LXJA 3HVAA 3CDEA 5KT6A 4IFVB 1SI9A 1N5TA 4PPDA 3MEGB 5F0UA 1N6QB 4I56A 4USJC 3M2UA 5IM0A 2DNRA 4CH1A 4O4GA 2X1FA 2MQNA 2YNHA 2POKA 3MGJA 5J1NA 4DL2A 3NNCA 4K4VA 1TVRB 2RRNA 1HARA 4OLPA 1UA0A 4O0IA 3I0RA 2KT2A 5IT9Y 5T7LB 3S7RA 2RUGA 1MMDA 2XY7A 3MWBA 2WK4A 3OFGA 4A8OA 2E5LF 4CZCA 2VC1A 2VASA 2YH1A 1GXUA 1W2BR 3PX6A 1SQEA 3MEKA 2F4VF 1FNMA 1Q79A 2CQBA 2HNDA 2VD3A 1N56A 1T7PA 3IWNC 2UV8A 3QMQA 4K59A 4X84A 2D9OA 5KG3A 3UR3C 1FJEB 1JJ2R 4B3RF 1R43A 2WSFC 1S6PB 4TN2A 4I69A 5KFEA 2VG7A 3G71S 2QLWA 2MY7A 1RT3B 3F44A 5EDWA 4LFAF 1TZ0A 2EPIA 1K0TA 1DBDA 3CJ5A 3QPIA 3TUZC 2LXUA 5DDQC 3PO4A 3BDPA 3V81A 1ELOA 1XBWA 1ZAXA 3M9OB 4X66F 1NRKA 1P9QC 2GQ2A 2FIUA 3SQGB 4DG1A 3KJVA 1KLMA 4H4OB 2HMIA 3TA0A 3C6UA 1S6OA 1U7LA 4YFUA 5CYQB 4NLRA 3EPGA 3CCRS 3LP2A 3VAGA 1DTTA 1OWXA 4I0WA 4FNHA 1VC0A 4NLOA 2XCAA 3AH6A 1FKPB 5HQ8A 2M88A 3G6VA 2DHXA 3PJXA 2PD1A 3T6JA 1G1XA 4B9UA 1WEXA 2AJ1A 1S1XB 2IM3A 3EPIA 2QA4S 3SSQA 4DSLA 4ETXA 2XS2A 1SV5B 4JI3F 1UVLA 1H0HB 1U8SA 2EG1A 4OX7A 4PWUA 2FJDB 1KQFB 1TV6A 1HBOB 3H4BA 4DV3F 3SCIE 4CNZA 3QYYA 5KFWA 4ED3A 1S1VA 2PDAA 2CPHA 5AXLA 3WDOA 3KK3B 2MMYA 4Q8EA 4RBUA 3THPA 1QUVA 4F67A 4R5PB 4QWAA 1WG5A 3DM2A 2IBKA 2HWTA 1XMOF 2ILZA 5EHHA 3PM9A 2J6SA 4C8OA 3ZZTA 4ATNA 4N77A 3QAUA 1V3RA 2FGCA 4WCEQ 3SI8A 4Q7AA 3RYLA 4PWDA 2BDPA 4RWXA 1YJVA 2J9DA 4CO5A 2OKQA 2CVIA 2LQBA 4J9QA 1L3SA 4F50A 1T05B 1LFWA 2DH9A 5DG8A 1S0NA 4JI2F 5AJ3F 2XY5A 3K5NA 5HROB 4NLWA 1QM9A 2V4QA 3D1OA 5CHCB 3JSMB 2HHVA 3CIZA 1XNRF 2LCWA 3ICLA 1X9SA 1TKZB 2OPPB 2F1FA 3FRYA 2HS3A 5E3CA 1S97A 3GE9A 4QR2A 1VQ4S 1KLNA 1RK8A 1N88A 2FJAB 5KT3A 3RRKA 1N54B 1HMVB 2J9CA 4M1KA 2DNQA 2FHKA 3THVA 1JLGA 3GSDA 1HNIB 1IKYA 2X1AA 3RB4A 1X9MA 2WSCC 1Q86T 4KFBA 3U1LA 3MMJA 1FDDA 1IKXA 4CO4A 4A8KA 3M8PB 5J2NA 3IWLA 1HD1A 2DJWA 3C66A 4AYBD 2ZJQQ 2AX0A 4B17A 1C0TB 2LECA 1S7HA 3DOKB 1TQLA 2XLJA 1V3ZA 5KFPA 1HBNA 4OHXA 4B02A 5JJBA 4YR3A 2HRUA 1FCAA 2HHXA 4ZPVR 4V19J 2W7PA 2LA4A 1H2VZ 2CQDA 3M1VA 3V6HA 1Q81T 2PEHA 4OX6A 1M5SA 2XSJB 1R8HA 2HQIA 1LW0A 4LF5F 1U1LA 3BF4A 1IM4A 2QE5A 1Y0HA 4L3NA 3N9UC 2LU1A 4ZVEA 4DQRA 4C97A 1APSA 4XDDA 1BQMA 3TAMB 5K5MA 3RR7A 3JTOA 1CC7A 2ILYA 2ADCA 1QAJA 1OQ3A 2IM0A 3OJSA 1UL3A 5LJ5Y 2XLIA 2AU0A 2FLNA 2ZE2B 1U2RA 2NPFA 1ULRA 4PQAA 3AB4B 4RNFA 2MQPA 4MIAA 4F4KA 2XZWA 1S79A 3N4WA 3X3UA 5H1SV 1FRIA 1VHFA 2D74B 3TR5A 4N41A 1IJFB 2QSFA 3BDEA 1G2EA 2JFKA 3BZQA 2J6TA 4ZK7M 2R8KA 2JWNA 1AFIA 4B9SA 1M90T 2H5EA 5IQ6A 5IT0A 4IR1A 2RILA 4EZ6A 4MKBA 4KHMA 3RRHA 2RQ4A 1NKBA 3MM8A 1TL1A 4OFZA 2OTJS 1Z4UA 1YJUA 2O66A 5SZTA 4LSNA 2XEXA 4QIWD 3HZGA 2M8DB 3NAIA 2DNLA 5C42A 4N56A 3M2RA 4AFFA 4G6VB 4TXSA 1QSLA 1M1KT 4ELUA 4WU3A 5KFOA 5DO2A 3DYAB 1QAIA 1V9OA 3GFHA 2OMLA 3KLEA 5I3UB 4TU8A 3IFEA 1TL5A 1GT8A 5IQQA 3TO8A 4LF9F 3OXGA 4I1TA 3HI9A 2GV1A 1TR0A 5H9FJ