1M1KT

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m1kT00
1U6BA 2B0GA 4V19X 2YTCA 2CQ2A 2AYGA 3ZZZA 2X1BA 3CULA 1SJ3P 2KYXA 4YB1P 2X1GA 3LPYA 5DM7Q 2XNRA 1JJHA 2J76E 3JB9k 4QU6A 3CC7S 2M9KA 2MJUA 2LA6A 2ZJQQ 1DBDA 1U1LA 2MQNA 2O3DA 5LSOA 2MHNA 2HZCA 2DO4A 4P6QA 5JVGQ 4F02A 1KOHA 4WCEQ 1B7FA 4LIRA 2MSTA 1FJ7A 3MOJB 2LYVA 3U1MA 3UE2A 2ERRA 2M0GB 3SXLA 3G6ES 1QVGR 3VALA 4M5DB 2LEAA 2MZSA 2U1AA 3VAMA 2K3KA 3CMES 2RT3A 1YTYA 1JJ4A 4Y00A 2DNYA 3Q2SC 1VC6A 1X5PA 3G96A 3ZZYA 1VQPS 2L41A 2NLWA 2M8HA 1FNXH 3BO3A 3MURP 4CH0S 1SJ4P 1VQLS 1YHQS 3NNHA 3MUVP 3SDEA 1DZ5A 3EGNA 1N54B 1Q7YT 3DLLQ 2JVRA 5DM6Q 2N3LA 1NJIT 4BS2A 2E5HA 4C7QA 3NNCA 1PO6A 2CQ4A 4OZ1A 2ZJPQ 4UY8T 1UP1A 5LXRA 3P5TL 5GAGU 3UCGA 3CCSS 1KC8T 3VAKA 1WG1A 2DHSA 3VAHA 2DNQA 2LXUA 3UWTA 1M5OC 3THTA 2MZQA 2AYMA 3MUTP 2CQ1A 3S01A 1F9FA 2CPEA 5CA5A 2FHOB 1X4FA 2DISA 3TP2A 2DO0A 3H2UB 2MZ1A 3S7RA 1A7GE 2PEHA 2ADCA 2CPFA 1D9AA 5DDOC 1VQ8S 5IQQA 5DDQC 2MPUA 1WWHA 1OWXA 2CQDA 1UAWA 1WEXA 5LJ5Y 2OJ3A 4TU9A 2MKJA 2FY1A 2FPHX 1M5VC 1X4GA 3U1LA 2RNEA 2SXLA 5GADU 2D3OR 4QPTA 3MD3A 2CPXA 2DNLA 2KN4A 3UD4P 1WG4A 2PE8A 2KXNB 2DGXA 1U1NA 1QVFR 2CQCA 2M4MA 3CF5Q 1N88A 2VOOA 1WI6A 1IQTA 1X4EA 4TLQA 2RUGA 2M2BA 1CVJA 2LQ5A 4IOCQ 4Z2XA 2XNQA 1M5KC 2DNGA 5GAHU 1H6KX 4QQBA 2GO9A 1K8AT 2LCWA 4YUDA 3CCES 3VAJA 2RQCA 1U1KA 2DNOA 3CMAS 3CXCR 2QFJA 2MJNA 4IUFA 2OTJS 2CPZA 2CQPA 2KM8C 2X1AA 1FO1A 2KG1A 3SDEB 1HA1A 5LJ3Y 2J0QD 2RRBA 2DGWA 1P27B 3CC4S 3MXHP 2DHGA 3G4SS 2JVOA 2FC9A 1P1TA 2K8GA 2LA4A 1U1MA 2DIUA 3J7ZT 2KHCA 3US5A 1JMTA 1K73T 1UW4A 1VC5A 2DK2A 3MD1A 1YI2S 2OIHA 2OTLS 5GMKa 1L3KA 2BZ2A 2MMYA 2KRRA 3B4MA 2KT5A 1SJFA 1M1KT 3NNAA 5DETA 2M8DB 1Q82T 2G1DA 1RK8A 1YJNS 2XB2D 2DGTA 2DNHA 2KI2A 1H2UX 5GAEU 1VQ5S 3CPWR 1NU4A 1NO8A 1HD0A 2CQIA 2QEXS 2E5IA 3HI9A 3D2WA 3CCMS 1WG5A 1URNA 1M5PC 3H2VE 2XS2A 1WHYA 1WF1A 1KQSR 2KFYA 2D9PA 2G0CA 1FJCA 3TYTA 3J7YU 2L08A 3BS9A 3IWNC 1KOOA 4EGLA 2OSRA 2Q79A 1A9NB 3CTRA 3UCUP 2DH7A 2MQOA 4C0OC 3UD3P 3K0JA 2MY7A 4FXVA 1YITS 2DNNA 3CCUS 2LXIA 3P3DA 2DGVA 2MZTA 3LQVA 4RU2A 2MKKA 1ZH5A 4TU8A 3G8TA 3SMZA 2CPYA 2X1FA 2DB1A 1D8ZA 4YOEA 2EK1A 4OZ0A 2XSFA 2YKAA 1VQ9S 2VOPA 2YH1A 2DH8A 1ZZNA 1WEYA 1VQ4S 2MQPA 3BEGB 5LSLA 2CPDA 2HYIB 3CCJS 2YWKA 2KM8B 5JVHQ 3V4MA 1WI8A 2MKHA 2HVZA 2KXFA 1VQ6S 1U1PA 3CCLS 4WFBQ 1SXLA 1Q81T 1BY9A 2CQ3A 5ITHA 3Q2TC 3FEYB 2MYFA 1FJEB 2YH0A 2AD9A 1VQKS 1N52B 2MQLA 1SJQA 2RVJA 2MQQA 2CPIA 2LKZA 1WHWA 3RW6A 1WELA 5LXYA 4LMZA 4PKDB 4WIIA 2DHAA 2MGZA 2E44A 1WF2A 3R1HA 2ZJRQ 4IO9Q 2CPHA 1OIAA 2MZRA 4QU7A 5CXTA 1W2BR 1ZZFA 5H1SV 2MZJA 4UQTA 1VQ7S 3OW2R 1K9MT 2I2YA 2MB0B 1WHXA 2DNRA 4LJMA 5BJRA 2KH9A 3VAIA 3FEXB 1X5TA 5HO4A 3P6YC 1U6FA 2LECA 3L3CA 2J0SD 4WF9Q 2J8AA 2KG0A 3CD6S 1YJWS 1X5OA 1X4BA 3P49B 2KVIA 4ED5A 2M52A 2NZ4A 1HD1A 2E5GA 1R8HA 2DH9A 5GVQA 3IRWP 1DHMA 2XS7A 3DXBA 2DNZA 2DHXA 2LMIA 2JWNA 2KXHA 1VQOS 1FXLA 5MLCV 1FHTA 1O0PA 3MI7X 3PIOQ 2MSSA 2CQHA 2AYEA 2EK6A 1WEZA 1X4DA 4CIOA 1X4CA 2L9WA 2M70A 2DGQA 1U1RA 1WF0A 5IM0A 5DDPC 2OSQA 4WFNQ 3PIPQ 4TU7A 1YJ9S 4U67Q 1SJRA 4F25A 2U2FA 5CYJA 2CQ0A 2JRSA 3VAGA 2RQ4A 2BOPA 1H2VZ 1VBZA 1WTBA 2N3OA 1S72S 1N8RT 2DGUA 3I55S 2RU3A 3BO2A 2RS2A 2F3JA 2VODA 2EVZA 3RW7A 2UP1A 2N7CA 4W90B 3MUMP 3EGZA 2E5JA 4WFAQ 3NMRA 1VBYA 3S6EA 3HHNB 2D9OA 3BO4A 2FC8A 1X4AA 2RS8A 3CCQS 4FXWA 2RRAA 2QA4S 2KRBA 5FJ4A 2MKSA 2JX2A 3CC2S 5D77A 1AUDA 1FT8A 1OPIA 2MKCA 2HGNA 2GHPA 3VF0B 2LEBA 3R1LA 5D78A 2V94A 2DGSA 3CCVS 3UCZP 1U1QA 1YIJS 1G2EA 1DRZA 1XN9A 2M7SA 1M90T 2N82B 4CH1A 2MGZB 3CUNA 2M88A 3R27A 1PGZA 2F9JA 2WBRA 1JJ2R 4PRFA 5IFMA 1VBXA 2VONA 1OO0B 3B4DA 1X5SA 2DNMA 2DIVA 3TO8A 5DDRC 4F26A 1R8PA 4J5OA 5HL7Q 4W92B 2MKIA 2DNKA 3N9UC 2I38A 3EX7B 3CCRS 2DNPA 2KU7A 1U2FA 5EN1A 3S8SA 2F9DA 2AYBA 3I56S 1X4HA 3VAFA 2CPJA 4IOAQ 1QM9A 3NS6A 2CQGA 4CQ1A 1VQMS 1VC0A 1U1OA 3NS5A 2DITA 2G4BA 4Y0FA 1VQNS 3MDFA 2MQMA 1HL6A 2A3JA 2XS5A 1YWXA 1WHVA 1S79A 1UFWA 2MXYA 2CJKA 1RKJA 4PR6A 2MY8A 4WKRA 3G71S 5IM0B 1Q86T 1KD1T 1X0FA 2HGMA 4A8XA 2CQBA 2HGLA 4ERDA 4ZKAA 2ADBA 4C4WA 2DGOA 3G9CA 3THPA 1H2TZ 3G8SA 3ULHA
chains in the Genus database with same CATH superfamily
2V2ZA 2ZM6J 5J2MA 3FSIA 3DLEB 2AX1A 1SUQA 1JJCB 3E8OA 3VWSA 2AYGA 3QLHB 4Y2AA 4EYIB 2VG5B 4V1Ak 1UWBB 2D3ZA 5DM7Q 1JJHA 5K14B 3WX4A 2DD8S 5L1IA 3CC7S 1Z2ZA 2MJUA 5HMWA 4EO6A 4QWAA 4DV0F 2LA6A 2ZJQQ 3J7YI 1T3OA 2CKWA 5THWA 1IR2A 6AT1B 3X1LB 2B6AA 2Z30B 4I6YA 4ICLA 5A6PA 2V2KA 2DO4A 3MPUB 3W66A 1KOHA 3SFGA 5KTQA 3SI8A 1C1CB 2NPFA 3OFHA 3MM7B 4IDKA 2J9DE 5BR8J 3JYTB 3MOJB 4ZJLA 2CZ4A 3G82B 1J5OB 1NM2A 1CJKB 4X62J 1NEEA 1JLCB 5DRKA 2XMJA 4JI4F 3A12A 3VALA 2LEAA 2DJWA 1UWBA 2YKNB 4M63A 2PD1A 1MU2A 2WRMA 5J1NA 1I1GA 3VAMA 4KTQA 4A46A 2V2VA 4PG6A 2ZVIA 4USMA 4RNMA 2FLLA 2ZUGA 3IG1A 2PGCA 2DNYA 4UOHA 4M5IA 3R9LA 2C2EA 3G96A 2EC0A 2FZCB 3RAXA 4B9NA 3PO5A 3UDVA 1VQPS 3DGVA 2ZH8A 1HW9A 3P8BB 3MEEA 3DRRA 4ZVRB 1HPZA 1S7HA 1J5OA 3VGSA 3OLAA 1SJ4P 3HFZB 4HACB 2A10A 1FEHA 2RDIA 2V63A 2B4OA 4ECYA 3T5KA 3MPVA 3BKFA 3VQTA 3MMBA 3NGKA 5AXNA 2AV5A 4I64A 4P7TA 4ZPVR 2B3TB 1S6PA 4DV7F 1Q7YT 4I67A 4YN3B 2CIMA 1FXRA 1T0TV 4LBIA 4ZA1A 2ZOMA 1UVMA 2OEJA 2VDHA 3R5CA 4HH1A 5DQHA 4BS2A 1RTIB 3NNCA 4ZP6A 4LFCF 3T6BA 1YZ6A 2HRTA 5E0OA 3K2YA 5K8OA 4OZ1A 1SC3B 1FCAA 3MM6A 4PPZA 1GMVA 3D54A 1YKWA 1UP1A 5HI7A 1RT1B 2WVBA 1N56A 1SB6A 2LDYA 5J2NB 1RGVA 3MR6A 1S1UA 2W9CB 1T05B 3ENQA 3TAMA 2R2UA 1R0AA 3MAAB 4AE5A 4DU8A 3VAKA 1LWCB 4DR6F 3D66A 4PPDA 4RX6A 1SPBP 3EYZA 4L74A 2AYMA 1C0TA 3QPIA 1S99A 4JI8J 3BKTA 3FSXA 3S01A 3Q83A 1RTIA 2ACYA 3TVYA 3M9OB 4WE1A 3SBMA 1R89A 4F3MA 2YNIA 3AQOA 4YQWA 4QR0A 1O51A 2X7IA 5C7PA 5HJXA 3RZAA 4WTYA 2EFQA 1EP4A 3PRBA 4GKJJ 5DDOC 4CM2A 3HK2A 2R7RA 3L09A 4X84A 4B9LA 3KMQA 2O5DA 4BBYA 2FJWA 3S1TA 3Q8UA 5G4DA 2Q6BA 3AB4B 1K1QA 3IWLA 4B3TF 3UVJA 3O2IA 3JTNA 4DLEA 3IGVA 4F8RA 4JI6J 2JEIA 1F1BB 1FRLA 4P7VA 2RQKA 2VG5A 2ZNYA 5IV4A 4UTGA 2IVYA 2BJ3A 1X0PA 3PX6A 1Y11A 2BVZA 2IM0A 2L9DA 2DRBA 1E6VB 3KNGA 5IS2A 5L1JA 1KVJA 3QQCD 2V34A 2SXLA 2D3OR 1NZAA 2D3UA 1T9VA 2JH3A 3BGRB 4LFAJ 3M8ZA 3MFHA 4F36A 2DGXA 3IMQJ 1RE1B 2GW8A 2PMHA 1SVDA 1VLOA 1HBNA 3G8QA 3M4XA 1WC5A 2YKPA 2EKYA 5A0YA 4EI2A 2E1CA 1SL0A 5G0RA 2VOOA 1WC0A 3EMTA 2RE1A 4X65F 1V9OA 3PM9A 3HZGA 4O3QA 2Z2ZA 2XMVA 2M2BA 3GFZA 2LQ5A 5D8HB 2XNQA 2GQ2A 2PMZD 1M5KC 4Q2LA 4LFBJ 1EB0A 1VBKA 4EUVA 5GAHU 1FX2A 5KT4A 4WP3A 2RRNA 1O6XA 4FF3A 1H6KX 1VJQA 2N4DA 3SCLE 1DTTB 1R0BG 5K9FA 1K8AT 1DQAA 3KJVB 2V67A 1FKOB 2UU9J 1RSCA 5KFXA 2B51A 1IN0A 3D9BA 3CXCR 2VFTA 2QFJA 2B4VA 5BR8F 1BGXT 1R0CB 3AJ1A 3H40A 1JNZB 2POKA 3OSNA 3TAPA 2Z2YB 3ZTQA 4RPFA 4ZLPA 1LWEB 2YQ3A 2J9DA 2R8GA 3DRPA 2IM2A 3K58A 2J7WA 5H9FK 1HHTP 2RRBA 4RBUA 4B17A 1LW2B 2DGWA 2ATCB 4Z7CA 4WFXA 3CIMA 2ASLA 1D1UA 1DJ0A 5HANA 3M9MB 2DHGA 1NZ8A 3I0RB 2FC9A 4N5SA 2LFVA 2WSEC 4EZ6A 4DX6A 5EWFA 4ZCKA 2DIUA 5CYQB 1AROP 2HSEB 1TL4A 2GMLA 4Q45A 2FLOA 2LLZA 1JMTA 2QC3A 3NAIA 3JXOA 2EWHA 3MCNA 3KK1B 4E0DA 3GPAA 4ANCA 3I9ZA 3MPWA 2J6TA 1QUPA 3EVMA 2RH3A 3W5YA 2DK2A 2CUYA 3CJ0A 1VC5A 4PG8A 2FJXA 1JKHB 3KKFA 4FYVB 3C6UB 3L9ZA 4DXLA 1YRXA 4ZMMA 3D28A 2UUCJ 3B4MA 4WZQA 1WACA 1TR0A 1YGYA 4K8RA 1CPZA 2KT5A 2AJ4A 2JLFA 3O5TB 4B3MJ 1Q5YA 4OI6A 3RB6A 1VDHA 2RD5C 3QIPA 1V3RA 3HHEA 1RT5B 1M1KT 4LQ3A 1Q82T 1RK8A 4CLTA 3HHLA 1ZAVA 1RZMA 1NU4A 4OYOA 2DRDA 4WBFA 4AT1B 3AJ2A 3EXCX 1IM4A 5E2QA 2CQIA 1EP4B 4JP8A 3IC1A 2YQ0A 4ED0A 3D2WA 1HFEL 2HFNA 1NHKL 1WG5A 2RKIB 2CNLB 2XHCA 3GMGA 1KHWA 1KHVA 5DO2A 3OJSA 3WC0A 2VFRA 3HT0A 2L3MA 1WHYA 2OPSA 4KV8A 4WJBA 3UN2A 4KGMA 3F73A 1CULA 2AHOB 1HNIA 3BH6B 2GQQA 3D4JA 1DARA 1RT5A 1VRTB 2G0CA 2HRYA 2VASA 4NLTA 4HR2A 3HFKA 2JL9A 2GGPA 4DSJA 3R2CJ 4DEZA 2K7JA 3RB4A 2XCPA 2FHKA 3GIMA 1HBOA 1KOOA 1S0MA 5KT2A 5KFLA 1A9NB 1SKSA 1F5BA 2BE2B 2H4YB 2HBRB 3DDIA 1E6VA 4NYOA 2MY7A 2XMWA 4UUWA 3ILIA 4DPYA 3OTOJ 1N36F 1WDTA 4CWBA 1NSAA 2GC8A 1Q78A 1ZOTA 4USUA 2DGVA 2NUUG 2MKKA 2VC0A 4DL3A 1ZH5A 3W63A 1N0UA 4PG7A 2WTFA 1RTHB 4EEYA 4LR9A 4JB8B 1HBNB 2HBQB 2CPYA 2DB1A 3C46A 2FLNA 1D8ZA 4I2QB 4V19J 4YOEA 1SQFA 2GGPB 2RAQA 3DMJA 3QT5A 2AZ3A 3NWGA 4OZ0A 2XSFA 3ZTOA 3Q23A 2DYAA 4IG3B 3RYLA 1IKWB 2DH8A 1X8DA 4LSLA 4J9SA 4ED1A 2FJAB 2IC3A 1VQ4S 3KNAA 1VMBA 4NRTA 5KFWA 2J9EA 2XY6A 3TANA 3V4MA 3IR5B 1HWLA 3M8RA 4Q2MA 3T41A 1VLYA 1RTDB 4RZRA 3LP1A 3SZ2A 2XCAA 3CCLS 2A6OA 5EDWA 1NPKA 4WFBQ 5DZ7A 4JI1J 1X31C 4KY3A 4DV1J 1KFDA 2NR0A 2HHTA 2CJ9A 1TL1B 4JV0A 1WC3A 3N6NA 3H0PA 4XK8C 3AD7C 4DN9A 1JXLA 1RDRA 2F5GA 2NXEA 4OHZA 4NCAA 3WHIA 5B0EA 2Y0SD 5GAEI 1OQ3A 3FKBA 4IFVA 1VK8A 2RVJA 4YR0A 2VPZB 2WSFC 3OUYB 4F50A 4LSLB 4QWBA 3VGTA 2GIRA 4PXBA 2E7XA 5LXYA 2R7QA 4OIXA 1RTJB 1N5QA 4RW7A 3WBZA 1RWVB 3POTB 1HWJA 1SKUB 4JV5F 2E44A 3BBFA 2AGOA 5F9LA 2KTQA 4XDDA 2YPZA 1WOSA 1OIAA 2YY3A 3BBCA 1VOMA 1FK9A 2W24A 4QU7A 3W3SA 4Y2KA 4KJIA 4IH7A 3VZHA 4B02A 3OW2R 2FGCA 2IFXA 4NZ6A 1K9MT 3HJFA 4B3OB 2MB0B 1UJ4A 4K2JA 4OJ3A 1IKXA 1SV5B 4URQU 4P52A 1EAYC 1NPRA 3KJQB 3SCJE 1PCAA 4KH0B 4IFVB 2GHVC 2OGUA 1KWMA 4CLYA 9RUBA 3AD9C 2LECA 4N76A 3L3CA 2XO6A 4ILRA 4ZIWA 4ID5B 1N5SA 1VHFA 3CD0A 2J5AA 4ZITA 3CD6S 1JKHA 1RB0A 3OV7A 1LOUA 1RWKB 2G2YA 3W7BA 2W1BA 5KFDA 1YJWS 5A6WA 1RKIA 1XMBA 2VU5A 3KWMA 3P49B 3W9HA 2M52A 4G1PA 3QWUA 1PYOB 4Q43A 4B08A 1KVKA 1SC1B 5DJBA 4DJBA 1Q1KA 3SIPB 1RCXB 1HD1A 2OHDA 2E5GA 4X64J 1GXTA 1R8HA 1S1XA 2GAGC 3IRWP 4J9PA 3QRPA 1RT3A 4K4XA 3DXBA 2DNZA 2DHXA 1HHQA 1K0VA 4RW9B 2JWNA 4K4UA 2QMUB 3GWCA 3KXDA 1VQOS 1MMDA 2AJ0A 3MI7X 3TZZA 2W9AA 4LRDA 2DCUB 2HNZA 3DNCA 4CZCA 4M5KA 5SZTA 1ZM2A 1NLKL 3OR1A 2UUCF 2GIQA 2MKYA 1H3DA 4M5HA 1JLCA 3GV8B 4CIOA 2MQ8A 1RBAA 4IO1A 5HMZA 2ZKTA 5HATA 3PW7A 1F3VA 3FFIB 3OD2A 3NCPA 1JLEB 4DV5J 2OSQA 4UOGA 4FDFA 3ZZ0A 5D15A 3PIPQ 1U0HA 2E1AA 1KTQA 1SJRA 2U2FA 3UI3A 4LF4J 3BSCA 3EZUA 1Q16B 3QATA 3FBBA 2JNJA 4N8NA 4H4MA 3CO9A 4RWXA 3VAGA 2VB6A 2HHUA 4E2FB 2UUTA 1VBZA 1M0SA 1AZSA 1W26A 1HI0P 3MEEB 4B9MA 4N56A 3NY0A 3EE3A 1R27B 4NLRA 4KR0B 3I55S 4QIWD 4FS1A 1U2RA 1FESA 3PFEA 3QMQA 4DCPB 2RS2A 3I5AA 4DR2F 3DLHA 4MFBB 1UZHA 2WONB 3RW7A 3FC9A 3OL8A 2UP1A 4PUOA 4ZVEA 2N7CA 4DR4F 3MM5B 3CEDA 5DQGA 4OHVA 2OMLA 2XI3A 3FBFA 3MMBB 3OXFA 5FLXU 4W90B 2HMIB 1TV6A 3IXQA 4J7CA 1HNVA 3MEKA 3MGJA 1JIHA 2EI5A 1VBYA 4LR8A 5CAAA 7FD1A 3HO1A 3MMAB 2YWWA 3HHNB 1JLGA 1WC4A 2D9OA 2E1MC 2IVMA 3IS9A 3K89A 2OUGA 4I1TA 4OYZA 4WPAA 4XO0A 4JI5F 1SL2A 3UQSA 4R8UB 2B7BB 4FVCA 4LBHA 5CCLA 3OT9A 4YR2A 4HLBA 3PKYA 5HSPA 2H9ZA 1XJWB 2YNHB 1SH3A 2CNOB 1FRKA 2JX2A 2Z0GA 3OTCA 4I4BA 4NA1A 5D77A 1TL1A 5KFTA 1JLFA 1AUDA 2Y8YA 3OVSA 1GX5A 4C97A 2GHPA 5HMYA 4DFMA 4ZP9A 1LWCA 4DF8A 4WP9A 3C15B 1IR1A 1SUQB 2AJ2A 1HMVA 1T9YA 2V94A 3QLHA 2DGSA 4GO5X 4NI2B 4QJVA 4R0EA 3UR0A 4DV4J 2QGFB 4ZVSB 1YJRA 3HXMA 3CJSA 4TY8A 3POTA 4F4WA 2XLJA 2WOMB 4R8UA 3ZFVA 2BQUA 2KKHA 3BGFA 3TJAA 2QMWA 3C66A 1EETB 2NYIA 4WXWA 4NX9A 3T1YF 5KG7A 2F9JA 1JJ2R 1HBMB 2CZ9A 3HHLC 4GVBB 3L95X 2YKQA 3QT7A 1OO0B 1CG2A 3NGTA 3AHPA 4IDKB 4ZPTR 2BANB 1XMOF 1UA1A 4F02A 4QYZJ 2IIHA 4ICLB 1Q4RA 2DIVA 2N7YA 3TO8A 4HDGA 3NS7B 4DL7A 3QJPA 3PEHA 2B9WA 1MU2B 3OHBA 4I7FA 4NOHA 2NXUA 2ZC3A 4WXOA 2KHDA 5L9NA 2I38A 3P4UB 2BJEA 1NAQA 1CJKA 1BQMB 2DNPA 4IFYB 1X9MA 3V6JA 4CLUA 5KFFA 2M5YA 1DFDA 3HZEA 3JSYA 2AYBA 2IA6A 5KFSA 2ZBQA 3HD1A 3GCWP 4QYRA 4X4OA 1RHRB 5GMEA 3MR3A 5IT9U 4JI3F 1TK0A 3ITHB 4RW9A 3EZ5A 1T9TA 4HYKA 1T9XA 4DQQA 3BSNA 3NS5A 4YP3A 4DR5F 2NREA 2MHEA 2H4WB 2HQIA 3K5OA 3BM7A 3KHRA 1IBKJ 2VBWA 3JQKA 2Y1LB 5A0YB 4USHA 3WC2A 1RTZA 2VHGA 3OR1B 1S79A 5LMNJ 1N5YB 1UFWA 5G0RB 4DV3F 3GJTB 1SCJB 3J80U 1IBLF 4PWDB 4P2XA 3MPDA 3L7PA 1KD1T 5B09A 1KR4A 3VVUA 5KG1A 1H38A 4DPOA 1FVQA 5A8KA 5KFNA 1WKLA 2CQBA 2HGLA 2QYGA 4OFZA 3OBIA 3PR5B 4ECRA 3L4BC 3KJVA 2DGOA 1LXJA 2NSBA 3QAEA 2A18A 3KJNB 3QGPA 3G8SA 3ULHA 1ZYQA 3F0NA 2R7UA 1M5SA 3A4TA 3GG0A 4DX5A 3FCHA 3C6TA 3NBPB 1SJ3P 2KYXA 1QTMA 4KGXB 2W7OA 2AX0A 3LPYA 1KTVA 2FB0A 2EKNA 2J76E 3PRDA 3D1OA 1NBEB 4TY9A 2RDDA 4QU6A 3IGNA 2M9KA 1RWNB 1RT1A 1PBUA 1L3SA 3MEGB 4C8MA 5HAOA 5C24A 1RU2A 4WK1A 5F0UA 4RL1A 1U1LA 1T7PA 5LSOA 2V68A 4B3SJ 3GJRB 5HROB 2HZCA 1BQNA 5JVGQ 5HP1A 2HBZB 2OFHX 1B7FA 4QIVA 4RUBA 5KT7A 1FI4A 2R7WA 2NYHA 2MSTA 4PQAA 5FIIA 1NHVA 4ED7A 2RU9A 2DXFA 3H42A 3OXGA 3G6ES 4DL6A 5JJBA 2W2MP 3IP0A 4ECWA 1D09B 1J27A 3BSAA 3SV3A 1MN7A 2K3KA 3I0SB 3AAWB 3BPDA 3VV2B 5F0WA 5KFGA 3OXLA 1PSDA 3MEGA 2FUG9 1U4BA 2HS3A 2W2PP 5EWGA 3L7OA 4RNHA 4Y00A 3JS9A 2HS4A 2QT7A 4HI2A 1FKPB 1S6QA 1HMVB 2ZH5A 1S49A 3W8GA 3T1AA 4ENOA 3H90A 3BH7B 2ACMA 2XGPA 2C22A 3PYDA 5EHHA 1A0OB 1TKZA 2QG9B 3JAMY 4ZLJA 3HVAA 3GIKA 4L6V3 1OY6A 2M8HA 1TMMA 4LQ9A 5ETVA 5F41A 5K8NA 2ZOFA 3H5SA 4KKOB 5LOQA 2BRKA 3JQMA 2KZMA 4C0BA 1YHQS 1AFIA 3NNHA 3MM8A 5J2QB 3MUVP 3SDEA 1PC4A 2BUNA 4URGA 3W2WB 1KQKA 1HBMA 2ZBCA 3EGNA 4GVBA 2CVEA 4A8QA 4O4GA 5D4NA 2F65A 5D4OA 3I5CA 5DLGA 5DM6Q 2O66A 1VQSA 9ATCB 2VQEF 5HMXA 4FP9A 5HQLA 3D67A 1JB0C 1NUEA 2HHHJ 4QCLA 1YBTA 2DBBA 3FQKA 3PJ9A 2HLUA 4OYAA 2RHSB 4ZS6A 2HVHA 5CYJA 1L3TA 1EQ0A 2E5HA 2G2OA 2GX8A 5CZXA 1UVNA 4MK8A 3ZTSA 4L3KA 4B9VA 4J37A 4RNNA 4TQRA 1RWWB 2VD3A 2C2OB 2B8PA 3QBCA 4J90A 3RB0A 4PXEA 1KSPA 4NCBA 1Y9OA 2PC6A 4DU7A 4Q8FA 2UXBF 3MMCA 5BYRA 4O3PA 2B5JA 3KDNA 4C6AA 5GAGU 1QUVA 2E7WA 1WG1A 1XMOJ 2DCLA 1N33J 4WK3A 4O4GB 3SSSA 2LXUA 2IAJB 4CLWA 4F0MA 4LBPA 4MYTA 5B0BA 2BW7A 1DTTA 3SQGA 4K5RA 4YY3J 2OAUA 2I5JB 5HLFA 1F9FA 2F8EX 5A2QY 5CA5A 3GYGA 4A4JA 2FHOB 3F41A 5I3UB 2DISA 2YWEA 3ET6A 1B99A 1YJUA 3CJ4A 3K5PA 2FJDB 2OPPB 2V8VA 1YSJA 5E3RA 4CTAA 2DO0A 3M2RA 1IM6A 3H2UB 2HPUA 1LK7A 1W25A 1XR7A 3EUNA 1APSA 4DG1A 1U2CA 1FFWB 1A7GE 3D6HB 2CPFA 1HQ2A 1MN9A 4FN5A 5ETPA 1D9AA 4ECXA 2ADCA 5AXLA 4JI7J 4JI3J 2QE5A 4HHJA 4O44B 4ZVUB 2B9EA 1S57A 2MPUA 3Q8PB 1OYEA 2CQDA 2AP6A 3FRYA 1UAWA 4K59A 4NLYA 5L38A 3KLVA 2DY1A 1MROA 3I31A 2VKRA 1LKZA 4RU9A 1RHUB 2OD4A 3U02A 4DR5J 2OJ3A 2KL8A 4Y3CA 4U6PA 5I3UA 2ROEA 4X66F 3IO1A 4R25A 2V4QA 2MLYA 1Y00A 4UOFA 3C6TB 4USTA 3DHXA 1NHUA 4IH6A 4NLDA 1REVB 2BKNA 5ETMA 4DV3J 4MT1A 1S1WA 3LP0A 4MK7A 3NG8A 2CJXB 1C4AA 2P8IA 2QSFA 2RNEA 4Q44A 3PYEA 2Y1RI 1HWUA 2Y1IA 2J9CA 3C6UA 4NMXA 1S1TB 4LF2A 5T7LB 3L7UA 3AXMA 2LQ9A 3R6LB 5C5JA 3B6BA 4ZJQA 2JHEA 2KXNB 1U1NA 1QVFR 1G7CB 4B9TA 1TKDA 4DF4A 1VS3A 2CQCA 1YBUA 2OEKA 2AKWB 5M2RA 1HQEB 1RAFB 3K17A 3W1YC 1BHNA 3DM2B 4LF5J 4OZNA 2HRUA 2RMLA 3N28A 2AEFA 4ED2A 2X3DA 1AA1B 4Z2XA 3G6XA 1RLDA 2OPSB 2BMBA 2ILYA 4F4AA 1UVIA 5D0EA 3RUBL 3UO0A 1RAAB 2RF2B 2ZDOA 4RW6A 3V6HA 5DLFA 2H48B 1V3SA 3SSRA 3CVKA 5ETTA 1MSWD 2V69A 3VR1A 2Z57B 1PJ5A 3DHWC 3QZ8A 4C11B 4YUDA 3CCES 1GMUA 4YEAA 3VAJA 3CJ3A 1PC5A 3I32A 2FZKB 4IQXA 1VYAA 2DNOA 2XS5A 1Y5IB 3CJTA 4ZLLA 3BYRA 3GIIA 3RR7A 3V4IB 4UUXA 4IUFA 3AJDA 1F0XA 1AYEA 2BE2A 3DDKA 3FBCA 2AW0A 2P6TA 2ZNZA 3PNIA 3VZIA 3KHHA 1SQEA 1T95A 3GQCA 2KG1A 2EG1A 3A8EA 4A48A 3MM8B 3A1YG 3GTYX 3SDEB 1HA1A 5KG4A 4K4YA 5B0GA 3ILJA 4HL9A 3GP9A 3EVWA 4URSA 1LFWA 5B0CA 3G4SS 4RBVA 2JVOA 2XYGB 3OL9A 2VPXB 4OX7A 3KMSA 3KUGA 1XIQA 2BACA 2WVFA 3ETOA 3IRXA 3N6MA 3NLCA 4RLEA 4DL0C 3OHAA 4LF8J 1U48A 5L46A 3V6KA 1SH0A 3FFIA 1ZM9A 4IH5A 4ZVOB 3N0VA 1KLNA 4C9DA 2KHCA 4CLLA 2XMKA 4FBUA 2V5HG 3M32A 1KLMA 3CJ8A 4DWIA 4EO8A 4LVOP 2AEMA 2P9CA 5KFPA 4LF5F 3AFGA 3UDEA 1VCTA 1DQ8A 1TP7A 2HK2A 3OTDA 2UVVA 3TWZA 5GMKa 1L3KA 3D3CJ 1R7IA 3JSMB 2AJQA 3AT1B 2QL9B 4TLRA 2IAJA 4CP5A 4U7UD 3LP1B 1UJ6A 3HJVA 2GVZB 2HQCA 3K7RA 3M2VB 1SJFA 4OZ5A 2CYYA 2W7AA 4LF4F 2QYCA 4G65A 2G1DA 3ET6B 5FLXY 3ZZTA 2KI2A 3UD5A 1WC6A 2PO4A 2DVIA 2QTWA 3CPWR 3A8IA 2GJIA 5KFZA 5J2MB 2KYZA 3DDNA 1HD0A 4RW4B 8RUCA 1QDUB 3R3TA 4LF6F 2UXCJ 1CC8A 2QEXS 2VJUA 3OR2A 3KJFB 3MMAA 5B08A 1WTFA 1ROFA 5IV3A 4O44A 4XPEA 2V8HA 4OI3A 3H2VE 1KS2A 4K5SA 1WF1A 4O3OA 1KQSR 4ATNA 2KO1A 2C3MA 1V5VA 5D78A 2BJ7A 2UV8G 5F9NA 3JTPA 1EIYB 1L5UA 1VR6A 1QAXA 3TNVA 2WB1D 4PXDA 3HHKA 2IDLA 3UFCX 3KOAA 4CO1A 5HN0A 3E01A 2VFUA 1ACMB 4QWCA 1NDPA 4EGLA 2DPJA 4DR7F 2OSRA 3GG1A 1F5CA 2XG8A 2RJZA 2DH7A 3DOLA 3W9IA 2MQOA 4JI7F 4C3LA 2O1PA 4FXVA 2VBYA 1YITS 2LXIA 3OTEA 4NLVA 1D9FA 4J9QA 2MZTA 4OHXA 1TK8A 4MTPA 3UDCA 2IRXA 3OFGA 2JC0A 5HJYA 2ZD1B 3QWPA 2APOA 2BM0A 1NK6A 5L1LA 4FZVA 3HT3A 1S1XB 4X66J 1RT3B 3DRRB 4J9UE 3DM2A 1YRTA 1VQ9S 5I42B 2HS0A 3C19A 3T1HF 2VOPA 2ZH4A 1B0PA 1WC1A 1FA0A 2HQDA 2QA4G 3RBZA 2MQPA 1QAYA 2DPIA 4HACA 4AFFA 3GZ7A 1G1XA 1RBOB 5F3ZA 2NXNA 1Y3JA 2NPIA 1WI8A 3PJXA 2K7KA 4J9RA 1VQ6S 2JSXA 3D0GE 4X62F 1Q81T 1BY9A 4J9OA 1UA0A 4AL6A 2ZD1A 3DXSX 1S12A 3C14A 3R5GA 3AOAA 3D5MA 1RXOB 4ED8A 2Z8QA 3JTOA 1NJXA 2DR7A 3UNGC 2OH2A 1YRUA 1RWXB 1N52B 2RILA 3WZ0A 1ZA1B 4C3KA 1SJQA 5A76A 1HYSB 4IG0B 1RAJA 2CPIA 1WHWA 2H51B 1MG7A 2WW4A 2IBKA 1S4EA 1WSVA 2V8DA 1O8BA 1I51B 2QA1A 1YJTA 1IJFB 1ZTTA 4ZVPB 5D3GA 4Q5VA 3MR7A 3W61A 3TVKA 1KONA 1SL1A 5FDLB 5HVGA 3DYAB 1TL7A 1OQ6A 2A6MA 1QLNA 2OPQA 5H9FJ 5C42B 1W2BR 3FUYA 4UQTA 1VQ7S 5EX3A 4PUOB 3M2UA 4PWDA 2J7UA 1B4SA 2HFVA 2VKZG 2DNRA 4OYIA 5BJRA 2KH9A 1RWUA 3VAIA 3IS9B 4DV7J 2VG7A 4JV5J 1F3FA 2QLJB 1AT1B 3CCWA 4XIUA 3GV7B 1CBKA 2ZDPA 2XTJP 4TYBA 4Y65A 1LWXA 1D3WA 5AJ3F 3D1QA 4PYAA 3GCXP 2KG0A 5C25B 4LF1A 4IRKA 5K14A 3JSMA 2GAHC 2HK3A 3KUEA 3BN7A 1X5OA 3UDLA 4OZ3A 5LMUF 3DOMB 1XMQJ 1GK8A 1J2VA 3ZC4A 3H5UA 1NJYA 4CLFA 1K47A 3M7VA 4OZ2A 2QJ3A 1UFKA 4ILLA 1G4CA 1XQIA 4LT6A 2NXCA 3ENVA 3KG0A 4K7QA 4NI2A 4O0NA 5I3PA 2R8IA 2FVPA 1JWWA 4OV6A 1FX4A 2YX4A 4DUYJ 3BSOA 1P9YA 4GO7X 1YLXA 3W60A 5ETOA 2KXHA 2N4CA 5F8HA 4DR6J 4RW4A 1Y7PA 4KC5A 3BQ1A 1MNEA 1IWGA 1BQNB 1Q0NA 5MLCV 1RAEB 1CJUB 1O0PA 1FHTA 5E3PA 3DRSA 4JI8F 2IJFA 1B0TA 2V4JB 2P9EA 4Q7AA 3T9NA 3FK4A 2J7KA 4KAIA 1S76D 3ILOA 4DZDA 4ZCIA 2CQHA 2AYEA 1JX4A 2EK6A 4MAKA 2HNYA 1S9GA 2L9WA 2M70A 4I0WA 5C2GA 4HH0A 3QSYB 5J2PA 1RAIB 4WFNQ 2C3OA 3H4DA 4RUHA 1LWFB 3N6LA 3E01B 4HI1A 1GTHA 2CQ0A 2EPIA 4NZ7A 2IVFB 4JI0F 2QLWA 2OPRB 1BWVA 1BQMA 2QL7B 2RQ4A 3T6JA 2D69A 3U27A 3T5JA 1B64A 1FD8A 4I68A 1OJ4A 1WTBA 2P2CB 1UMJA 1S72S 1UEVA 1J5EF 1VK3A 1S6PB 4IFYA 4UOCA 1PBAA 2GIFA 3N5BA 5ETSA 3RBXA 4CH7A 4DSIA 4Q8EA 3MM9A 1R8BA 2IJNA 1O5JA 4GKKJ 1NSKL 1NDLA 1C1CA 2CRLA 2JFKA 2W9BA 3R7BB 5IXUA 3SV4A 1FF2A 2E5JA 2FVRA 3KTQA 3KLGB 4DR7J 3R7NB 3WQPA 4LFAF 2W01A 1X9WA 1QAIA 4GMKA 2GV1A 2CNKB 1I6JA 4DDFA 3MM6B 2R7XA 3MCOA 3J80Y 3IAS9 4FF2A 2G9OA 4P73A 3J7A1 2JOQA 2OMOA 2RS8A 2P6SA 1SQGA 4XTTA 5AXKA 2W8KA 2MLZA 2RRAA 5FJ4A 1R43A 2QV6A 3CC2S 3LF0A 5E33A 3KK3B 3Q0AA 1C0TB 1FT8A 1OPIA 1ZBTA 2MKCA 3RGIA 3TA0A 7FDRA 1Z4UA 3H8YA 5HQ8A 3EWGA 3LPEA 4CO4A 2W9BB 4C8LA 1U6ZA 1WDDA 2HURA 1HYSA 2BQRA 1FNMA 4QR1A 4ZHRA 3KLGA 3KLEA 2UXDJ 2YNIB 1TZ0A 3IR7B 2I5JA 1OMSA 3D0IE 4UY85 3CNQP 4O23A 3EJMA 1NCLA 4M5GA 2AWZA 1ZTWA 1EARA 1YIJS 1HR0F 5T41A 2BKOA 3E2EA 4MIBA 4BC9A 2CDRB 2MGZB 3G6VA 1I94J 2H1YA 3O3LA 2RSQA 4BCAA 3IFEA 5GAGI 4CNYA 2IRUA 2ZH7A 4P72A 4DFJA 3M2UB 3C3LA 2Q6CA 1ZPVA 2XC9A 5IFMA 4PRFA 2LDIA 3VHQA 1GAOA 3AY0A 3ADAC 2VQFJ 1UETA 4PYDA 5C2CA 3PVXA 4QIGA 1TVRA 4C48A 2Z4PA 2AT1B 3GIRA 4AL5A 2VICA 4AXIA 4DSFA 2DXEA 4J5OA 5HL7Q 3Q24A 4EWTA 4F67A 1NKEA 2MKIA 2V9KA 2G2ZA 3EX7B 3CCRS 3THVA 1TELA 1U2FA 1YQHA 1IKVA 2K2PA 2QLFB 2R4FA 2XSJA 3IM8A 3S8SA 3R2DJ 2KVQE 3H5YA 3W64A 2HQ3A 2OI2A 3OFEA 2ZH3A 1UPPA 5KFVA 5F8LA 5A2QU 2CPJA 4Y28C 3A3PB 3M8SA 3N5FA 4F0HA 4ED3A 3UD3P 1FRHA 4ECTA 3NS6A 1VQMS 4UZCA 5D0HA 1TUGB 3QT6A 1ZAWA 5T7LA 5BYQA 2YNGB 1UWAA 3KK2B 2W8LA 2G4BA 4LSZB 2WCXA 4Y0FA 1B7YB 1HL6A 4M8LA 3HVWA 2G0JA 3W2WA 4AUKA 2DEIA 5LMUJ 2MXYA 2ILZA 4USVA 4UQGA 3KUHA 1XMQF 2CJKA 4ELTA 3MEDA 1RKJA 5E7OB 4PR6A 1LK5A 2FDNA 1FDAA 4B9SA 3JQJA 5J2PB 1Q86T 3QT8A 1N4LA 2H5JB 2HGMA 1QTNB 4OMFG 5LM7E 4A8XA 2IHR1 3EGVA 2YBVA 1YJ7A 4A47A 3R5JB 3PY8A 3DLBA 2HVEA 2C1EB 2OPRA 4ZKAA 4GC6A 2ADBA 4KIAA 4C4WA 2AMCB 3G9CA 1LEOA 2GNKA 1N5VA 2ERRA 1Y0HA 4RR5A 2XO7A 2C2KB 2HIYA 3FMWA 1TL3A 4KPYA 1RACB 4OX8A 2HQFA 3ZZZA 1GMWD 2X1BA 3CULA 4PWWA 2X1GA 3D0HE 1RT7A 3R5BA 3O8WA 2XYPB 3X3UA 7AT1B 2HWHA 4H4KC 4U7UK 1PIEA 3HKZD 4P75A 1U0SA 2LQJA 3E3XA 4HEA9 1TKTA 4MKYA 3ZNUA 1UL3A 2BM1A 5IZHA 4FS2A 4JI0J 1HNZJ 2OPPA 1Q8BA 3A8KA 3NAHA 1C2PA 1EZZB 4I2PB 1OY8A 4MIWA 2XMAA 4DUZJ 3M9NB 3HVRA 2Z58B 3K8WA 2PT0A 1FJ7A 1M5HA 4KGZB 3U1MA 5LSRA 4K4TA 2M0GB 4FVMA 4DG1B 2VBXA 1PG5B 4C2MA 4X4RA 1L3VA 1QVGR 1RTJA 4RW7B 1J5EJ 2UVUA 1FFSB 4U96A 2MZSA 2U1AA 2BJ1A 1GX6A 2BEFA 1RT7B 5F8IA 2B8QA 3OFFA 2Y1JA 2BX6A 1SIWB 4IR1A 2AU0A 2KB2A 2BXJA 3PCOB 1YTYA 2BE9B 1JJ4A 1D9DA 1WSRA 2JDJA 3Q2SC 5B7WA 1VC6A 2FJVA 1HKAA 3ZZYA 2AJ1A 3LOUA 4ZHRB 4L72B 3IWXA 2L41A 2CZVC 2NLWA 3OTBA 3M2VA 2R8KA 2XI2A 1CQMA 1QSSA 5D4LA 4DV1F 1FNXH 4NCGB 4ECQA 5KFYA 1BXNA 4F2RA 1VQLS 3RTVA 4C3MA 2RDJA 4O3RA 3LP0B 2XLKA 1FXDA 1OY9A 5KFCA 1HBUB 3GE9A 3M8QB 4Y2MA 1N54B 2P5VA 1JXEA 2GJ2A 3ELHA 2XGQA 4X4QA 2XHWA 2JVRA 1CS4A 1FJGF 4HT7A 6FDRA 3JAMU 2XULA 2ALZA 1TUWA 5KFIA 3F56A 1S1TA 1U24A 2N3LA 3KLIB 3OLBA 3A3OB 3CDAA 3FZBA 3TUPA 4F7VA 2ALYB 3D6FB 4ZPDA 2NUHA 2UV8A 2UXDF 4KHRA 4P74A 4C7QA 1S77D 2G1HA 3JSRA 3V5RA 5T14A 1GFWB 5L8RC 5I4MA 2XSJB 1LFPA 3R6GB 1B70B 3MTKA 4DV2F 5KG6A 4C11A 2FQQB 1HI8A 1FVSA 4I6WA 4PXCA 4F04B 2Q43A 1FNOA 4Y2CA 1TK5A 3BZQA 2HFZA 3N79A 4P71A 1RTHA 3LTOA 2VQFF 3OVBA 1GH8A 4LF9F 3HULA 4G1IA 4EBCA 1TFWA 3UWTA 2B4UA 3AOBA 1VIOA 3I96A 1SC6A 2MZQA 3M30A 4EBDA 3MUTP 3KLIA 3D3BJ 4U9RA 1GTEA 4EK2A 4DMZA 3ZZUA 4OZJA 2FZGB 2CPEA 2XEXA 3LAMA 3V2UC 5KFBA 3PW4A 1LNQA 2UU9F 5LL6d 3SQOP 4X64F 2BV3A 1RWMB 2LP4A 1F5AA 1CJTB 1RHJB 1ZS6A 3UN5A 2RKIA 1RA6A 3S7RA 1OS5A 3MR5A 4TN2A 2GA7A 2CG4A 2PEHA 3M6UA 4Q0BB 1A6LA 3IRXB 2F8MA 4KV8B 3TZXA 4NXMF 4M5DA 4ES3A 2DRAA 3Q8RB 2ZH6A 2R9LA 5IQQA 5DDQC 1RYRA 1VQ8S 1WWHA 1OWXA 3MECB 4YHHJ 1DTQB 2VA2A 3QJJA 1FD2A 2VL1A 3DFEA 1KLMB 1T02A 4USIA 5LJ5Y 4K4WA 2VPYB 4R5PA 4DFKA 4J9LA 3WIVA 3NMAA 4IYQA 4J9NA 2ROGA 2FY1A 1K1SA 2EFNA 4DV5F 3HSZA 4MK9A 4QR2A 3SCKE 3CCTA 5GADI 2GFFA 2VBZA 3GYXB 1R8AA 4LR7A 1RISA 2FPHX 4NYPA 1TMJA 4LRCA 1X4GA 4UZBA 3U1LA 2HNDA 1MLAA 2GVZA 3CWJA 4JI2F 1NB7A 1S6OA 2D7SA 2F4VF 4J9MA 4YB6A 1FK9B 1FRMA 1U09A 2YNHA 3R5DA 4ES1A 3B54A 3MFIA 2PEBA 4ELVA 1IXKA 3MD3A 4GVLA 4WWSA 8ATCB 3M6WA 3UD4P 5DQIA 2AGPA 1IKXB 1SV5A 2PE8A 5KOWA 3ZO7A 1WUUA 1QY7A 4PG5A 5U47A 4DPUA 1JLBB 2HAIA 3K5LA 3TVZA 4DR4J 1WI6A 4KFBB 4JV1A 3NXZA 4TLQA 1Q5VA 2ASDA 2YQ1A 2OEMA 3VCDA 4WZMA 2XMMA 1WORA 1RHMB 3M8PB 1ZA2B 3BDEA 2DNGA 4YFUA 1Z2LA 2A1BA 4IQMA 4CRJA 3MOZA 3DOKB 4QIEA 3PTWA 4RWWA 2BJDA 4NA2A 1H73A 3PYGA 1F6TA 1R3NA 2W4PA 4QQBA 4AL7A 1E6YA 1V3ZA 3DOMA 5EWEA 2RQCA 1HNZF 1IWAA 2FHJD 3C16A 1EQMA 3FSYA 2BANA 2AQ4A 1S9EB 1TU0B 2CNNB 2JEJA 1UVJA 4LIWA 1SKRA 4MKVA 5HK4A 3EICA 1N32F 1DY3A 2OTJS 4E8UA 1KRPA 1C4CA 4QYZK 1JLBA 5KFEA 3LW5C 2CPZA 2CQPA 4PEOA 1VRUB 2IA0A 2XBPA 3RRKA 2HVIA 2JEGA 1HPZB 1S6UA 1RP5A 4DR3F 4RBTA 1RAOA 2W2QP 5FD1A 4ZVQB 3M8PA 2FHJA 5LJ3Y 2ZHOA 4DV6J 1S0NA 4OL8A 4O4RA 3CCZA 5DG7A 4DV4F 1NDCA 4DPTA 2D74B 2V4JA 2ZC4A 1P27B 2IM3A 3CJQA 1WJ9A 3HMJG 1U0HB 3GR0A 3I5BA 3O6QA 5ADZA 1HWIA 1RABB 1P6TA 1XR5A 2OP5A 3QFHA 3RRHA 1RBLA 1YG0A 2LA4A 4ETXA 1TKXA 4NA3A 5RUBA 5I42A 2WK4A 3CE8A 3FCWA 3H2LA 3J7ZT 3US5A 3AH6A 3IAM9 4P2MA 1EJ7L 3MM7A 3EDQB 2LXFA 3JYTA 1HNWJ 2CVIA 2DT9A 4OYXA 3PEJA 2OTLS 2YNFA 1Z1ZA 3A13A 3DRYA 1JLAA 4OI0A 2VV5A 3TZYA 2BZ2A 2MMYA 4L73A 2KRRA 1D8YA 3ISZA 5KFKA 3FEZA 4NLUA 1QAJA 1U26A 4ID8A 3VGUA 4OYMA 2XZWA 2UXCF 4IG0A 4KH1B 5DETA 1KKHA 3KHLA 3HD2A 3FBEA 2UUBJ 3PKMA 2OLWA 4DX7A 1YJNS 2DNHA 4M94A 2XB2D 3D68A 4BLGA 1H2UX 5GAEU 3J81U 4A8YA 4I56A 1URRA 4DV2J 1Q95G 3BPSP 1RAGB 1KBRA 5F3TA 2Q1LA 4Q0BA 2VH7A 3CCMS 3W65A 2HIQA 3M1VA 2ZVSA 3G87A 4ZIVA 2R7TA 2CWXA 4F4YA 1IBKF 4KHMA 1M5PC 3W2VA 4JI5J 2XS2A 3MAQA 4OYBA 2XY5A 5LMNF 4K2XA 2EG2A 3EPIA 4WYWA 2D9PA 3NCRA 2FGOA 2H3EB 4WYLA 4MKAA 4YDDB 4CCHA 5C25A 1AZSB 1ICEB 3TYTA 1ZM4A 2C2MB 2WZ1A 4DS5A 2OO4A 2B4PA 3BS9A 3DCAA 3M6VA 1HARA 4DV0J 4K0KF 3CTRA 3UCUP 4X4NA 2HNDB 4N8OA 3QRRA 2ZEJA 3DGPB 2AGQA 1DURA 2DNNA 1Q8IA 1IKYB 2WONA 3CDEA 3GJSB 4NXNF 2CAJA 2F8HA 3PV8A 2XYHB 4A8OA 3P3DA 2BKPA 3MM5A 4RU2A 4NXMJ 4PQUA 3I4PA 1CQNA 1H7WA 5KOXA 2HHVA 5KFRA 1RWPB 4QBUA 5CYMA 2D1CA 1HNVB 2PI5A 4NMLA 1JLQB 2YXLA 3O44A 4P2SA 4ECSA 4A8WA 2X1FA 2W25A 2EK1A 1BUXA 3IBCB 2VIHA 1TKZB 2PFDA 2YKAA 3R5AA 2RQMA 3TX8A 4C8ZA 2QFIA 3T3FA 3TUJC 1ZZNA 1F60B 1RADB 4B3SF 1PILA 2ZBIA 2E5LJ 1FRIA 2QO3A 3TJ8A 4F4ZA 2HZVA 4KKOA 4I6AA 4OJ1A 1CJUA 5LSLA 4BHQA 2LQ8A 5M2PA 3DGPA 2KM8B 3CCJS 5JVHQ 2F4VJ 3BYPA 3DOKA 2C3PA 2MKHA 4TNOA 1GT8A 2HVZA 2YX7A 2MLXA 4USWA 4O3NA 5KFAA 3M8YA 4DQSA 2C2DA 2E9TA 3LANA 3ITHA 1IKVB 5ITHA 1XNRF 3PXGa 3Q2TC 2YVSA 3M8WA 4ECVA 2YH0A 5J1EA 2AD9A 1MWZA 4DR1F 3RAMA 3DC2A 5AE3A 4DX8H 2DR9A 2Q66A 1XTZA 2MQQA 3CJ5A 3QZ7A 1NK9A 2K1RB 2LKZA 4DCOB 4YS2A 4LF7F 1NK8A 3RW6A 2JFDA 4FPIA 4PKDB 1QD1A 2CJYB 4EBEA 4LMZA 2DHAA 2K06A 4ZPWR 2YWFA 4F3QA 4RNOA 4ETZA 3PACA 4LREA 1HLWA 2IMOA 2OD6A 3ISNC 1S48A 4LFCJ 2G13A 1UCNA 2IPOB 2VG6A 2Z56B 2B43A 3EM1A 3MM9B 4H4OA 4NEZA 2IRYA 2GMJA 2I2YA 2R7SA 3AD8C 2HZAA 3E51A 1WHXA 1UZDA 1QE1B 5DG9A 5HLFB 3FEXB 1X5TA 3P6YC 5CYQA 4GRSA 4I7FB 4DHVA 1VJWA 2NZCA 3Q8QB 2XY7A 3RAQA 4X4PA 2YKMA 2BDPA 4C8YA 1TQLA 2J0SD 3CDBA 3WX8A 3NBPA 4DV6F 1ZETA 2W4CA 3KK1A 3M2RB 2R2RA 2HHHF 2YWGA 1JLAB 4NWBA 5KG0A 2QLXA 4USKA 3KK3A 4I69A 1X4BA 2ZZMA 2DR8A 3BN4A 2KVIA 5C24B 4ED5A 3BB5A 4KB7A 2K3IA 2LEPA 4Y2IA 1UJ5A 3V6DA 3G86A 3GFYA 4L3NA 3VGVA 4LUBA 4CO2A 4ECUA 4TQSA 3F44A 4LRAA 5H9EJ 2A2DA 4NASA 2FIUA 3CB4A 1DLOA 4DSLA 2Y0BB 3LGNA 1N33F 1HNWF 1NNDA 3LP2B 4GKJF 5AE1A 1N5YA 4NLSA 2XMUA 1BE4A 3HM9A 4NLQA 5IC6B 3CJ2A 4NLPA 4A8KA 4QIFA 3QGIA 1HQUA 5AT1B 1KNZA 3J81j 1U8SA 5J2NA 2E1PA 4G3IA 1DAXA 2Y3YA 4WFZA 1X4DA 2W9CA 1T05A 4B3TJ 1X4CA 2D41A 4WU3A 1MMNA 2DGQA 3QIDA 1LW2A 1UFLA 1WF0A 2ZE2A 4YB7A 3AXKA 4HHHA 5IM0A 4LSNB 1G3OA 4HKQA 1G6BA 1RA7A 4YB5A 2UUBF 1C1BB 4KRWA 4TYAA 4TU7A 1M1HA 4KGKA 2KZZA 5B0DA 3DI6B 1HNIB 4F25A 1N32J 2JRSA 3IBWA 1TVRB 5CD4H 1H2VZ 3PFOA 5KT5A 4FF1A 2X3GA 3W62A 4PWUA 5CXTA 4ECZA 4ZK7M 1HBOB 2N3OA 2ZBRA 1YBAA 3B82A 1N8RT 1I3OB 3PDNA 1FFGB 5KFUA 3BO2A 1M1GA 3TUIC 2RF2A 4RW6B 2E9ZA 3FMBA 3BGLA 3MPYA 3KLHA 3PJWA 3OSPA 1XNQJ 5F8MA 4WTOB 2EXUA 4B3RF 3BF4A 4LSNA 4X65J 2V50A 5HVHA 4MYUA 1S5ZA 4YDXA 2JLEA 3NMRA 3FRZA 2ROPA 2MTLA 3GJQB 1PYTA 3P5BP 1HHSA 4ITSA 2R2SA 4K0KJ 4LFBF 4WU2A 3HHLB 3UNYA 2WW8A 3BGUA 3C8YA 2FLPA 3BO4A 3QAUA 2PA8D 3NKYA 4UF4A 3DLKB 5KFJA 4NXNJ 2FC8A 1UPMB 2NSCA 3B8HA 1UVKA 3CCQS 4ZVFA 4RUCA 1RUSA 2XWYA 3MTJA 3NGRA 2QL5B 5ETNA 3PHTA 3MEDB 4FKXA 4CT9A 2MKSA 2EBGA 4HVZA 2BJ9A 5EGYA 1TFYA 1FE4A 3WIUA 5IWAF 2C2RA 1T03B 2XZDB 2HGNA 3VF0B 1Q7LB 4Z37A 4EU0A 1NB2A 1VI7A 4DOZA 2QRRA 3H7HB 1S4FA 4ZLNA 4ZVGA 2GMHA 2E5LF 1BWEA 3CCVS 4WIQA 3LWLA 2X51A 1CSJA 4AXJA 3OUYA 3T9ZA 1F9HA 2H54B 4Z7YA 1U1QA 3DLGB 3GR1A 3I9V9 2CWKA 2VDIA 1TL3B 1XN9A 2M7SA 3I82A 3KG1A 4RKUC 2N82B 4CH1A 4X4VA 3OVAA 3GSIA 4N7TA 3PX0A 2H5EA 4DS4A 3J81Y 2Y9HA 3MCSA 1XNRJ 5SUHA 1IQZA 3R27A 5D0GA 4J9KA 4JOUA 4C8OA 1FRXA 2HHQA 4ED6A 2W2OP 1MROB 1VBXA 3HLUA 2R7OA 3PW5A 3CD5A 2ZZTA 4DR1J 2BQ3A 3B4DA 3PR4A 2M3DA 4B3OA 3TR5A 2ZH1A 5DDRC 4LF7J 1P9QC 3FNNA 4F26A 5BYSA 5MAOA 1PKUA 2HBYB 1IBCB 5D6GA 1ELOA 4LF8F 3N9UC 2C42A 1B0VA 3QRQA 3I4HX 3CJRA 4B3MF 2FJEB 4CDIA 5EN1A 1MMLA 1U25A 3AODA 1FRJA 1N6QB 1XK8A 1C0UA 5IT9Y 2B9YA 3ZNJ1 1XBWA 4AD6A 2R8HA 3VAFA 4NPOA 3I0RA 2VFSA 1UEKA 2HKEA 4DCJB 1WKJA 2YPYA 1CC7A 2KFZA 1BLUA 1TUVA 2CQGA 2DY9A 5AXMA 4CQ1A 4CNZA 4HDHA 3GU0A 3LO3A 2VPWB 4IKAA 4X2BA 3LP2A 3R97A 1XERA 4YMEA 1Q8LA 4M1KA 1EX8A 4CTAB 2IM1A 1FEEA 1PAEX 1IBMF 3HHDA 1RAHB 2A3JA 2MQMA 2WB4A 3D7SB 3M8QA 4E98A 4U95A 4NLXA 3ZTRA 2F4FA 4Y6IA 1VQYA 5KFQA 1IJEB 4YR3A 3C2PA 2HNZB 4WKRA 3G71S 5IM0B 1HI1A 4AQYJ 5CCMA 1HBUA 5E5NA 2H5IB 2QN6B 1I5OB 5DS7A 2CA9A 2KT2A 5AE2A 4USJC 2L9NA 4FXDA 4ERDA 4DUTA 1SKWA 3J7AN 3IA0A 3OTOF 1N36J 3GYNA 3OPKA 3QO9A 3KFWX 3THPA 4QWEA 4F4XA 1H2TZ 1FXLA 1S1VB 1U6BA 2B0GA 1S1WB 4G1QA 2AEJA 1JK9B 2DR6A 4IRDA 4V19X 2YTCA 2CQ2A 3AA9A 3GIJA 3FQLA 4ID5A 4MH8A 3PHEA 3QYYA 4YB1P 3GSDA 2XNRA 1AFJA 1GNKA 2LVWA 1OPZA 3M05A 4ZOSA 3KLHB 3JB9k 1NXIA 2UVWA 1Q53A 2QZ8A 4R0JA 4LVNP 1DBDA 2IYIA 1VHIA 2MQNA 4U8YA 2O3DA 5D4PA 3T5LA 4DQIA 2MHNA 4CYUA 3TEGA 2JJ4D 2HFOA 5CABA 1FDNA 4P6QA 1T8EA 1MWYA 4H54A 4N47A 1HQEA 4WCEQ 2QSWA 1TV6B 3LALA 4LIRA 3QO9B 5H9EK 2R3VA 5JMNA 1F2GA 5ETKA 4ZN1A 1UTAA 2LYVA 2Q3PA 3UE2A 5LT5A 2CFXA 4PZVA 4G1QB 3SXLA 3K57A 4CM0A 4JI1F 3CJKA 2B56A 1JLGB 3PRVA 4M5DB 1CJTA 5ETQA 4JYAF 4FPRA 2HFUA 3CMES 3I6PA 3SYZA 3T1HJ 1XNQF 3MECA 3HP6A 1FKAF 5HQMA 2IYGA 4LRFA 4DSEA 3GFHA 1WKKA 2IDEA 4B3RJ 4MIAA 2RT3A 2OPQB 2E29A 2WAQD 3AB2B 1FDBA 5KT6A 4KHPF 1X5PA 4BWMA 2ZHBA 2DXDA 5EX0A 3U1NA 5EUHA 1EHWA 3Q8VA 3HCXA 4F0KA 2C28A 4KO0A 4EZ9A 3H5XA 1DTQA 2EFPA 1FDDA 1SC4B 3EVOA 3HFVA 3DMJB 2HFSA 2VG7B 3CSKA 5JUMA 4OI4A 3EGWB 4XAKA 2ABYA 3W5ZA 2KFNA 4RW8A 4QZVB 4K4VA 1Y3KA 4H4MB 3MURP 4CH0S 3BO3A 2KJWA 2COLA 3DLJA 2KJVA 2PN6A 2FJBB 2RB7A 4HHUA 1RT6A 4ZN3A 1UVLA 2GVDA 1DZ5A 5IWAJ 2F7VA 3DLLQ 4OJHA 2RIJA 3Q89A 4U8VA 1GMWA 1EETA 2VF3A 1CJVB 3CDUA 1NJWA 5E3AA 1NH7A 3TZWA 1U47A 2J0WA 4A8MP 3LGHA 2E1RA 3FGVA 4KO0B 3K5MA 1NJIT 4OQJA 2WHOA 1LW0A 4O0IA 1S97A 4H4KA 2I0XA 3DLEA 1PO6A 2FY8A 3TA1A 2DEJA 3DOLB 4CI0B 3OJUA 2CQ4A 2FYXA 3TJ9A 2ZJPQ 4UY8T 2YX1A 1YVFA 3LWMA 5LXRA 3P5TL 2F1FA 4F2SA 1NK7A 1NRKA 3CT9A 3N4WA 3UCGA 5AJ3J 1NDKA 3CCSS 1S9EA 1KC8T 2DHSA 3VAHA 2BE7D 2DNQA 3HVTA 3UN3A 2BYCA 1M5OC 3THTA 2J6SA 4A8SA 2UUAF 1RYSA 2BABA 1JLFB 5K5MA 1LWFA 2CQ1A 4N77A 1BD6A 5CHCB 3HSJA 2PSZA 4FNIA 1LW0B 1X4FA 1JNRB 5CZVA 5HBMB 3QJLA 2PFFB 3C15A 2A0FB 3UW1A 1JLQA 3UR3C 3K59A 4J9VA 3ZTPA 2HLTA 4DLGA 3TP2A 5GAHI 3T19A 4DUYF 4C8KA 1RHQB 1LQ9A 3TA2A 3NL0A 2EEYA 2E7VA 2WBMA 2L48A 1JQGA 3BR9A 2MZ1A 3RR8A 4NLGA 4X4TA 2DTJA 2WOMA 4C98A 4WKYA 5HVFA 3RJMB 4DFPA 4P2FA 2YKNA 2KDOA 4NLOA 4QWDA 3C14B 3HPOA 1UKUA 3NCQA 5H1SV 3W9JA 1H7XA 2DHHA 1WEXA 1VFJA 2Z2MA 2HW3A 3BV8A 3TOQA 5A8KB 1T94A 3WDOA 1S1VA 3VTIA 1SH2A 5HBMA 3IN5A 4TU9A 2MKJA 3MR2A 1IBMJ 2JEFA 4DR2J 2ZZNA 4RJVA 1K44A 3GLJA 2A2CA 4PABA 3RBDA 3U7JA 5D3GB 2FVQA 1H0HB 3IR6B 3P45B 4PAAA 2RHQB 5ETLA 1M5VC 2K1RA 3DYAA 4G6VB 5DGBA 4ZCMA 2V4RA 4C8NA 4AQYF 2YNFB 5CD4A 4NRUA 5GADU 2O01C 4QPTA 5E3CA 3BREA 2CPXA 2DNLA 2GJFA 1NSPA 2KN4A 3BKUA 4CLSA 1WG4A 2EFVA 2YKOA 2C2NA 2EFOA 5HROA 2EC2A 3HX9A 2CADA 2M4MA 5J1PA 1N88A 3CF5Q 4H4OB 2HWIA 4ZCLA 1IQTA 2ZBPA 1X4EA 4GKKF 4CO0A 1W7WA 2RUGA 2J6UA 2VC1A 4W4MA 4ZJOA 1CVJA 4IOCQ 1TAUA 4S0MA 2YKMB 3W2VB 3IM9A 3G2XA 4DZ6A 2AJFE 3MAAA 4MFBA 1RJJA 4M5NA 4CLKA 3N01A 3M1VB 3ZZOA 4DQPA 1XEZA 4K4SA 2GO9A 3CMQA 2LCWA 5BXIA 3TW0A 2GO8A 1U1KA 1WD6A 1EKRA 4BDPA 1TTHB 1RU1A 3CMAS 1XC9A 2F63A 4GC7A 5K20B 1R0AB 2GCFA 1QJHA 2LU1A 2MJNA 2I9SA 4A8FA 1IVZA 2V2QA 2W4DA 2UVRA 3HHLD 1SI9A 1KQGB 3H20A 2KM8C 2X1AA 1IKYA 1FO1A 2WVDA 4DQRA 3R8YA 3T1YJ 3TQ1A 3BGOP 3RRGA 4JYAJ 1DLOB 1RT6B 1RT2A 2EFGA 2HAFA 4P10A 2J0QD 1ITPA 2HNYB 4UW2A 1V6HA 5CYMB 1Y4ZB 4KHPJ 5C42A 5J2QA 5KG2A 1HW8A 1NJZA 3CC4S 3MXHP 1HQUB 1HR0J 4PQUB 2ZWPA 2HG4A 1P1TA 2K8GA 5KFHA 3UVJB 1S9FA 1N48A 5IQ6A 1I94F 3G82A 4KQZA 1N0VC 5A8RA 4DI6A 4QW9A 2V6AA 2ZE2B 1U1MA 4OHYA 4KPCA 3HKWA 4OV1A 2NQPA 2YNGA 2G0IA 5M2UA 3MF5A 3KK2A 5HP1B 2V9WA 2HHXA 3W5XA 5IOLA 4MMOA 1D0EA 2CXEA 5IT0A 1K73T 1NH8A 4TY8B 4AYBD 1UW4A 4DPWA 2FVCA 3QSIA 1YI2S 3MD1A 3ENAA 2OIHA 2I1RA 1RT2B 1U8WA 2J8SA 2B9XA 3IG1B 2UZAA 4CLPA 2R2TA 1PAUB 2J0XA 2V8GA 4RO0A 3Q86A 1LV5A 2FVSA 3HVTB 1YK9A 5JXSA 4EMDA 4K4ZA 5J1EB 1NKCA 4M5MA 1GEHA 1WOPA 2VFVA 2PDAA 1WOOA 3NNAA 2M8DB 3D6MB 1H72C 2ASYA 3SQGB 1FKPA 1S6QB 2D3O1 2HHSA 2DGTA 3EGZA 2R42A 1IBLJ 2DKOB 3DRSB 4ANDA 1VQ5S 4ELUA 1UW9A 2ZH9A 1S0OA 1NO8A 1SJ1A 1GXLA 4IR9A 3V81A 3BDPA 5IC4B 3MWBA 2MDAA 4KT0C 3M6XA 2E5IA 4NYZA 3CD7A 3HI9A 1N5TA 4NL5A 3TI0A 3CDWA 3P96A 1TAQA 2FHMA 3FVYA 3SEOA 1NK4A 4NEYA 1URNA 1P1LA 2ZWOA 3GFXA 2UUAJ 1MW7A 3ONQA 1QE1A 1BMQB 3HSDA 2BW2A 1T9UA 2QMXA 2VG6B 4ZP8A 3BQ2A 3DN9A 1RHKB 3KLEB 3SSQA 1KDNA 1T03A 1FJCA 2RUSA 4XDCA 5GMDA 1LWEA 3AQPA 2V0NA 4NLWA 4OLOA 3J7YU 1ZAXA 2L08A 3BJYA 3RU0A 3IWNC 4EYHB 2Q79A 2PI4A 1FTRA 3V81B 3TAMB 2ZHAA 4C0OC 3SFUA 3PZPA 2Y8WA 3K0JA 2O67A 4ZP7A 2ZH2A 3V6DB 4N41A 3CCUS 4HTJA 3TEHB 5F8NA 1HWKA 3NP5A 3A8JA 1H74A 3NOGA 3DLGA 4WFYA 3LQVA 2KT3A 3KYLA 5DZ6A 2PA3A 3DRPB 4OZLA 2QA2A 3VVTA 4TU8A 3G8TA 3CW2C 4OX6A 5D0RA 3A3NB 3D6TB 3SMZA 4CT8A 1EKSA 4ER8A 3NGSA 1Y5NB 4WE1B 1CLFA 5F8GA 1HNXJ 3H59A 4NZ0A 4ZVTB 3KG4A 4CO5A 3NGDA 2VZ9A 5F8JA 3FDSA 1T11A 1S59A 3B78A 3K5NA 2YH1A 3AA8A 4B9UA 4DL5A 1WEYA 3FJ2A 1Y5LB 1YZ7A 1YJVA 3BEGB 2CPDA 4FYYB 1K0TA 4DUZF 2HYIB 3G6YA 2YWKA 1YDLA 2YWHA 3QGGA 2DR5A 2IMWP 2R8JA 3ETMA 2GHWA 1C1BA 2KXFA 5KFMA 3RBEA 3Q22A 3GILA 1U1PA 4OX9J 1SXLA 4HT5A 1CS4B 4ZPAA 2CQ3A 5DGAA 3ZZPA 3FEYB 3ICLA 2MYFA 5B0FA 1FJEB 1X60A 3AOCA 1X9SA 2ZITA 1R6VA 1VQKS 2MQLA 1FWPA 1REGX 3MCMA 1S0VA 1T3NA 1TL5A 1R31A 3HF5A 3DI6A 3QIPB 2VUGA 3ZZRA 1WELA 4JUZA 1P8GA 4RUAA 2HHPA 1DQ9A 4WIIA 4CO3A 3PYFA 1XWLA 2XZTB 2MGZA 1REVA 3R1LA 2VQEJ 3BGRA 3I0SA 1WF2A 3J7Z5 3R1HA 2PMWA 3KLFB 2ZJRQ 2FTRA 2CPHA 1RCOB 2MZRA 2WVCA 3JSBA 3TRGA 4IO9Q 1JXVA 1VRTA 1ZZFA 2ZKUA 2MZJA 3I87A 1F9EB 1SIZA 2OELA 3M30B 5KT3A 1N34J 4ILMA 1PYSB 4U7CA 1AW0A 4LJMA 3NOCA 1FJGJ 2HWTA 5HO4A 3DLKA 2UXBJ 1U6FA 2BA9A 3OL6A 4ES2A 4TKTA 3GV5B 4WF9Q 3M32B 4MJKA 2J8AA 3H98A 3LA0A 3DU5A 1FWKA 4MKBA 4QPXA 4OI2A 2ZOGA 4YY3F 1FKOA 2WVEA 4IRCA 5I3QA 2CJAA 1TKTB 2IBOA 2XLIA 3KLFA 5B0AA 2HHWA 2NZ4A 4ANEA 1B3TA 4OI1A 2DH9A 5GVQA 3NGUA 1MWQA 3R7SB 1DHMA 2XS7A 5L9XA 2LMIA 3RB3A 1R6YA 3MHYA 4L75A 2OKQA 4FNHA 3UPFA 2XMTA 4IG3A 4W98A 1IUJA 4DN0A 3TUZC 3V4IA 4LF9J 2IC3B 3D1HA 4WP8A 2E66A 4TXSA 1H98A 4I2QA 3Q8SB 1V5IB 2ZUAA 3NRBA 4L76A 2E9RX 5DG8A 2ZM6F 4KYZA 2HVDA 4OYPA 3PIOQ 1NK5A 2MEWA 2MSSA 4IOBA 4K50A 2NXJA 3VQSA 1NK0A 3GONA 3MMCB 3TQEA 2AF6A 5L1KA 4OLPA 2B5JB 2GQCA 1WEZA 3GB0A 2C3UA 3CJKB 1FERA 2CJBA 1LXNA 2LU2A 3QNWB 5KFOA 1U1RA 4X4SA 5DDPC 1OSDA 1Q79A 4ZDNA 4ED4A 2WSCC 2GZOA 1YJ9S 4PG4A 3PO4A 4U67Q 3IBFB 2UUWA 2FD2A 2JC1A 1KVIA 5E41A 3PW0A 3TARA 4NCGA 2BOPA 1VRQC 1RQ0A 3CO0P 1NSQA 2IY5B 1ZM3A 1PJ6A 1BC6A 4YHHF 1FTCA 4J91A 1U49A 1PJ7A 4DBQA 3QFWA 1N6QA 4HTIA 2V8PA 2AIRB 5KAKA 2I8EA 3PW2A 1FE0A 2DGUA 4RW8B 3ENWA 2RU3A 4JI4J 4JV2A 4FBTA 5CH7B 3DU6A 2F3JA 2VODA 2OFGX 2EVZA 2BR0A 5KG5A 3EXYA 4X4UA 1ZPWX 4LRBA 1C0UB 1L3UA 1FWLA 2BBEA 2GVDB 3BBBA 3C16B 1KQFB 3RG6A 3DRXA 4I2PA 2Z2LA 4DL2A 1U45A 4JI2J 4FYDA 1GQEA 4ZPCA 2BRLA 3K8VA 1KEKA 4WFAQ 3O1LA 1U02A 3MUMP 1T9WA 2EW9A 3Q8YA 1KP6A 4C0HA 4D3GA 2PIIA 1VRUA 2H65B 3FCVA 3S6EA 2QX0A 4DSKA 1NPPA 4M5JA 2NS1B 4O3SA 1CEZA 2HQGA 2ZFHA 3LGMA 1X4AA 2KFYA 2BOAA 4FXWA 4NE9C 2QA4S 5E3QA 5CQGA 2KRBA 1YX2A 1CULB 2W2NP 3OR2B 3PG9A 3T5HA 1XR6A 3ILLA 1Y10A 4OHWA 3EPGA 3KHGA 1RI7A 2XM3A 1VGYA 1HNXF 3CIZA 3EDRB 1TKXB 2LEBA 1NMEB 3LUYA 1W2IA 1S10A 2B7CB 2F40A 2EBEA 3H4BA 4FYWB 4P9SA 4F3OA 4M95A 3MZIA 1GXUA 4KE5A 3UCZP 1G2EA 4Y34A 1QSLA 1DRZA 2QLBB 5IT4A 1M90T 3W8PA 2HEKA 2CDQA 3CGIA 3NWRA 4OYWA 4OX9F 1R8CA 2M88A 6FD1A 5L39A 4CYUB 4QW8A 5ETRA 4DPXA 3CUNA 1HIYA 1VIXA 1JLEA 2AZ1A 2P9GA 1BQXA 1U7LA 1UEUA 4JBCA 2WBRA 3NEKA 4KSEB 5FDLA 3TX0A 4DR3J 1PGZA 4FF4A 5K8MA 2VONA 4TVAB 1RLCL 3LAKA 4ZVHA 1IKWA 2XWXA 3OL7A 1X5SA 4OJGA 2DNMA 2ASJA 3MAHA 3SCIE 3QGHA 1KN6A 1OSCA 2CG8A 1R8PA 4QOTA 1SBRA 3HSGA 2W7PA 4W92B 2R7VA 4ALZA 2XQCA 2DNKA 3ISND 1RTDA 1ULRA 2KU7A 5KG3A 2F9DA 3PX4A 8AT1B 3I56S 1X4HA 5A8WA 2I6WA 1S1UB 2GS8A 4IOAQ 1QM9A 1N34F 1QSYA 4ZPBA 3HDSA 2HMIA 4D3HA 2CJQA 2VA3A 1VC0A 4XPCA 4CLZA 1RT4B 3BQ0A 4LF6J 1Q8KA 4KFBA 3ZXWA 2ATLA 1U1OA 1WNEA 2DITA 4F4KA 4BWJA 1OYDA 4BC7A 4UT4A 1AB8A 2IJRA 2C3YA 3MDFA 4JI6F 5K8PA 3BR8A 1VQNS 3H25A 1S7IA 1VISA 1YWXA 1WHVA 1AXQA 1NKBA 1F2HA 4FYXB 3TAQA 1AUSL 1IR0A 2NCKL 3LH2S 2JLGA 4DL4A 3OQ2A 5A8RB 4FKYA 2MY8A 4EFAC 3MMJA 2VJVA 1RWOB 1E6YB 3DKDA 4M5LA 5A8WB 1X0FA 1KFSA 1TL7B 4KGVB 1S9GB 4PCQA 3EZOA 2B6AB 2LQBA 2JZ5A 4R5PB 3KDOA 1CJVA 2BJ8A 1X7VA 1RT4A 3FZ2A 2QIFA 4RNFA 2C2ZB 4KBIA
chains in the Genus database with same CATH topology
5J2MA 3FSIA 3DLEB 2AX1A 1SUQA 3E8OA 3VWSA 2AYGA 3QLHB 4Y2AA 4EYIB 2VG5B 1UWBB 2D3ZA 5DM7Q 1JJHA 5K14B 3WX4A 2DD8S 5L1IA 3CC7S 1Z2ZA 2MJUA 5HMWA 4EO6A 4QWAA 4DV0F 2LA6A 2ZJQQ 3J7YI 1T3OA 2CKWA 5THWA 3X1LB 2B6AA 4I6YA 4ICLA 5A6PA 2V2KA 2DO4A 1KOHA 3SFGA 5KTQA 3SI8A 1C1CB 2NPFA 3OFHA 3MM7B 4IDKA 2J9DE 3JYTB 3MOJB 2CZ4A 1J5OB 1NEEA 1JLCB 5DRKA 2XMJA 4JI4F 3VALA 2LEAA 2DJWA 1UWBA 2YKNB 4M63A 2PD1A 1MU2A 2WRMA 5J1NA 1I1GA 3VAMA 4KTQA 4A46A 4PG6A 4RNMA 2FLLA 2ZUGA 3IG1A 2PGCA 2DNYA 3G96A 2EC0A 3RAXA 3PO5A 1VQPS 2ZH8A 1HW9A 3MEEA 3DRRA 1HPZA 1S7HA 1J5OA 3OLAA 1SJ4P 2A10A 1FEHA 2RDIA 2B4OA 4ECYA 3T5KA 3MPVA 3VQTA 3MMBA 3NGKA 5AXNA 2AV5A 4I64A 4P7TA 4ZPVR 2B3TB 1S6PA 4DV7F 1Q7YT 4I67A 4JV5F 2CIMA 1FXRA 4ZA1A 2ZOMA 1UVMA 3R5CA 4HH1A 5DQHA 4BS2A 1RTIB 3NNCA 4ZP6A 4LFCF 3T6BA 5E0OA 3K2YA 5K8OA 4OZ1A 1FCAA 3MM6A 4PPZA 3D54A 1UP1A 5HI7A 1RT1B 1N56A 1SB6A 2LDYA 5J2NB 1RGVA 3MR6A 1S1UA 2W9CB 1T05B 3ENQA 3TAMA 2R2UA 1R0AA 4AE5A 3VAKA 1LWCB 4DR6F 4PPDA 4RX6A 3EYZA 2AYMA 1C0TA 3QPIA 1S99A 3FSXA 3S01A 1RTIA 2ACYA 3TVYA 3M9OB 4WE1A 1R89A 4F3MA 2YNIA 3AQOA 4YQWA 4QR0A 1O51A 3RZAA 4WTYA 2EFQA 1EP4A 3PRBA 5DDOC 2R7RA 3L09A 4X84A 4B9LA 3KMQA 2O5DA 4BBYA 2FJWA 3S1TA 5G4DA 2Q6BA 3AB4B 1K1QA 3IWLA 4B3TF 3O2IA 3JTNA 4DLEA 3IGVA 4F8RA 2JEIA 1FRLA 4P7VA 2RQKA 2VG5A 2ZNYA 2IVYA 1X0PA 3PX6A 2BVZA 2IM0A 2L9DA 2DRBA 1E6VB 3KNGA 5IS2A 5L1JA 1KVJA 2SXLA 2D3OR 1NZAA 2D3UA 3BGRB 2JH3A 3MFHA 2DGXA 2GW8A 2PMHA 3M4XA 3G8QA 1HBNA 5A0YA 2YKPA 2EKYA 2E1CA 1SL0A 5G0RA 2VOOA 4X65F 2RE1A 1V9OA 3PM9A 3HZGA 4O3QA 2XMVA 2M2BA 3GFZA 2LQ5A 5D8HB 2XNQA 2GQ2A 2PMZD 1M5KC 4Q2LA 5GAHU 4EUVA 5KT4A 4FF3A 2RRNA 1H6KX 2N4DA 3SCLE 1DTTB 5K9FA 1K8AT 1DQAA 3KJVB 1FKOB 5KFXA 2B51A 1IN0A 3CXCR 2VFTA 2QFJA 2B4VA 5BR8F 1BGXT 3AJ1A 3H40A 1JNZB 2POKA 3OSNA 3TAPA 4ZLPA 1LWEB 2YQ3A 2J9DA 2R8GA 3DRPA 2IM2A 3K58A 2J7WA 1HHTP 2RRBA 4RBUA 4B17A 1LW2B 2DGWA 2ASLA 1D1UA 4WFXA 3CIMA 1DJ0A 3M9MB 2DHGA 3I0RB 2FC9A 4N5SA 2WSEC 4EZ6A 5EWFA 4ZCKA 2DIUA 5CYQB 1AROP 1TL4A 2GMLA 4Q45A 2FLOA 2LLZA 1JMTA 3NAIA 2EWHA 3KK1B 4E0DA 3I9ZA 3MPWA 2J6TA 1QUPA 2RH3A 1VC5A 2DK2A 3CJ0A 4PG8A 2FJXA 1JKHB 3KKFA 3C6UB 1YRXA 4ZMMA 3D28A 3B4MA 4WZQA 1WACA 1TR0A 1YGYA 1CPZA 2KT5A 2AJ4A 2JLFA 3O5TB 4OI6A 3RB6A 1M1KT 2RD5C 3QIPA 1V3RA 3HHEA 1RT5B 4LQ3A 1Q82T 1RK8A 3HHLA 1ZAVA 1NU4A 3AJ2A 3EXCX 1IM4A 5E2QA 2CQIA 1EP4B 3IC1A 4ED0A 3D2WA 1HFEL 2HFNA 1WG5A 2RKIB 3GMGA 1KHWA 1KHVA 5DO2A 3OJSA 3WC0A 2VFRA 2L3MA 1WHYA 2OPSA 4KV8A 4WJBA 4KGMA 3F73A 1HNIA 2KFYA 2GQQA 1DARA 1RT5A 1VRTB 2G0CA 2HRYA 2VASA 4NLTA 3HFKA 2JL9A 2GGPA 4DSJA 4DEZA 2K7JA 3RB4A 2XCPA 2FHKA 3GIMA 1HBOA 1KOOA 1S0MA 5KT2A 5KFLA 1A9NB 1SKSA 1F5BA 2BE2B 3UD3P 4UUWA 1E6VA 4NYOA 2MY7A 2XMWA 1N36F 2GC8A 1Q78A 1ZOTA 2DGVA 2NUUG 2MKKA 2VC0A 4DL3A 1ZH5A 1N0UA 4PG7A 2WTFA 1RTHB 4EEYA 1HBNB 2CPYA 2DB1A 3C46A 2FLNA 1D8ZA 4I2QB 4V19J 4YOEA 2GGPB 3Q23A 3DMJA 3NWGA 4OZ0A 2XSFA 4IG3B 3RYLA 1IKWB 2DH8A 1X8DA 4LSLA 4J9SA 4ED1A 2FJAB 2IC3A 1VQ4S 3KNAA 1VMBA 4NRTA 5KFWA 2J9EA 2XY6A 3TANA 3V4MA 3IR5B 1HWLA 3M8RA 4Q2MA 1VLYA 1RTDB 4RZRA 3LP1A 3SZ2A 2XCAA 3CCLS 5EDWA 4WFBQ 1KFDA 2NR0A 2HHTA 2CJ9A 1TL1B 4JV0A 3N6NA 4XK8C 4DN9A 1JXLA 1RDRA 4OHZA 4NCAA 5B0EA 2Y0SD 5GAEI 1OQ3A 4IFVA 4YR0A 1VK8A 2RVJA 3OUYB 2WSFC 2VPZB 4F50A 4LSLB 4QWBA 5LXYA 2GIRA 4PXBA 2E7XA 2R7QA 4OIXA 1RTJB 1N5QA 4RW7A 3WBZA 3POTB 1HWJA 2E44A 2AGOA 5F9LA 2KTQA 4XDDA 2YY3A 1OIAA 4QU7A 2W24A 1VOMA 1FK9A 3W3SA 4Y2KA 4KJIA 4IH7A 3VZHA 4B02A 3OW2R 2FGCA 2IFXA 4NZ6A 1K9MT 3HJFA 4B3OB 2MB0B 1UJ4A 4OJ3A 1IKXA 1SV5B 4URQU 3SCJE 4IFVB 2GHVC 2LECA 4N76A 3L3CA 4ILRA 4ID5B 1N5SA 1VHFA 3CD0A 2J5AA 3CD6S 1JKHA 3OV7A 1LOUA 3W7BA 1YJWS 5KFDA 5A6WA 1RKIA 1XMBA 3KWMA 3P49B 2M52A 4G1PA 3QWUA 4Q43A 4B08A 5DJBA 4DJBA 1Q1KA 1HD1A 2E5GA 1GXTA 1R8HA 1S1XA 4J9PA 3IRWP 1RT3A 4K4XA 3DXBA 2DNZA 2DHXA 1K0VA 4RW9B 2JWNA 4K4UA 3GWCA 1VQOS 1MMDA 2AJ0A 3MI7X 2W9AA 2DCUB 2HNZA 3DNCA 5SZTA 1ZM2A 3OR1A 2UUCF 2GIQA 1H3DA 3GV8B 1JLCA 4DFKA 4CIOA 3PW7A 4IO1A 5HMZA 2ZKTA 3FFIB 3NCPA 1JLEB 2OSQA 3PIPQ 2E1AA 1KTQA 1SJRA 2U2FA 3UI3A 3BSCA 3EZUA 1Q16B 4N8NA 4RWXA 3VAGA 4H4MA 3CO9A 2VB6A 2HHUA 2UUTA 1VBZA 1M0SA 1HI0P 4B9MA 3MEEB 4N56A 1R27B 4NLRA 4KR0B 3I55S 4QIWD 4FS1A 1U2RA 1FESA 3PFEA 3QMQA 2RS2A 3I5AA 4DR2F 3DLHA 4MFBB 2WONB 3RW7A 3OL8A 2UP1A 4PUOA 4ZVEA 2N7CA 4DR4F 3MM5B 3CEDA 5DQGA 4OHVA 2OMLA 2XI3A 3MMBB 3OXFA 4W90B 2HMIB 1TV6A 3IXQA 1HNVA 3MEKA 3MGJA 1JIHA 2EI5A 1VBYA 7FD1A 3HO1A 3MMAB 3HHNB 1JLGA 2D9OA 2E1MC 2IVMA 3IS9A 4I1TA 3PX4A 4XO0A 1SL2A 3UQSA 4R8UB 2B7BB 4FVCA 4YR2A 5CCLA 4HLBA 3PKYA 1S9FA 2H9ZA 2YNHB 5A8RA 1SH3A 2JX2A 1FRKA 2Z0GA 3OTCA 4I4BA 4NA1A 5KFTA 5D77A 1TL1A 4ES1A 1JLFA 1AUDA 3OVSA 1GX5A 4C97A 2GHPA 5HMYA 4DFMA