4ES2A

Double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
84
Chain Sequence
HMMLVLITYDVQSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLGYTKVEHIGAKPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0342 protein
publication title Double-stranded endonuclease activity in Bacillus halodurans clustered regularly interspaced short palindromic repeats (CRISPR)-associated Cas2 protein.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 19
structure length 84
sequence length 89
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4es2A00
3B8HA 2E1RA 2I8EA 3E3XA 4MAKA 3ZZ0A 1ELOA 4ES1A 3B78A 2BM1A 4QR1A 5G4DA 1U2RA 3ZZUA 4ZCMA 2XEXA 2IVYA 4ZCKA 4MYUA 2ZITA 3OQ2A 2L9NA 4QR0A 4ES3A 1N0VC 4TNOA 1ZPWX 1ZM3A 2BV3A 4FN5A 2NPFA 3EXCX 3UI3A 2I0XA 1N0UA 4QR2A 1VI7A 3B82A 1KTVA 3ZZTA 2J7KA 1T95A 4ZCIA 2WBMA 2BM0A 1ZM4A 4ES2A 1FNMA 4MYTA 1P9QC 1ZM9A 4ZCLA 4M1KA 1DARA 2KDOA 2CVEA 3LH2S 1ZM2A 2EFGA
chains in the Genus database with same CATH superfamily
2UXCF 1YG0A 3UDLA 2RKIA 3E2EA 2ILYA 4DPTA 1Z1ZA 2BRLA 2MZ1A 1VOMA 2MYFA 3VGUA 3JSMA 4C7QA 5C42A 2ZHOA 2YQ1A 1AYEA 2AJ4A 4DN9A 3PW0A 2ZDPA 1TFYA 4X66F 1PJ7A 2MSSA 4LF2A 5C24A 1LKZA 2WVDA 4GKJJ 4WFYA 2MKYA 5F9LA 5IWAF 2HRTA 3CW2C 4LSNB 3K8WA 2KXNB 1I3OB 3JS9A 1BC6A 4KTQA 1X0PA 3JYTB 2YNIB 3RBDA 1TK5A 1S9GA 1FNXH 3HPOA 2A2CA 1HARA 4P72A 3DI6B 4A8WA 3M6VA 1U1PA 3ZZ0A 1DRZA 3I82A 1ZAWA 2BJDA 4JUZA 4RNHA 2XY6A 3Q2TC 3NAIA 3NWRA 2NXCA 4I2PB 3QT7A 3EDRB 4ATNA 1IBMJ 4QW8A 2CPIA 3ULHA 3PO5A 4I7FB 3ONQA 1T9WA 4MKBA 4WTYA 2W2QP 4Y2MA 3MEDA 2PSZA 3HVAA 5BYSA 4D3GA 1NDLA 4FXDA 1HI1A 3NMAA 1YJ9S 3AY0A 4JI1J 5I4MA 2R42A 5HL7Q 2R7VA 3OT9A 1VJWA 1W7WA 3O3LA 4IDKA 3JQMA 4OYXA 3J7YU 4B3RF 1TKXB 1Z4UA 2XG8A 4DU8A 3C6UB 2KO1A 4LRBA 7FDRA 2OHDA 2IFXA 3OPKA 1M0SA 1JLGB 2DHXA 4PXBA 1WELA 3ZTRA 1UP1A 5IC6B 4F8RA 4RLEA 1M5VC 4OZ1A 4K4WA 1OSDA 2QE5A 4OYIA 1LXNA 4DL4A 3M9OB 4GC6A 3MCMA 4RX6A 3KUEA 4I56A 3TZWA 1A7GE 2B4OA 2JNJA 5CD4A 2JHEA 3D3BJ 3FCVA 2ZD1B 2DNKA 1S1UB 3H59A 4M5JA 4J9VA 4JI7F 4LSNA 3DDIA 1UW4A 1RHMB 1Q16B 1VBZA 1GFWB 3JYTA 2YNIA 5D4OA 4W90B 4OLPA 4DUZJ 3HSDA 4CZCA 2FZCB 3DI6A 3KLEB 1YJRA 3PV8A 2ZEJA 1TL3B 1AUSL 4ETZA 3PO4A 3T1AA 2ZVSA 1B4SA 2Q1LA 2AYEA 3M8ZA 4IG3A 3BSCA 4JI2J 3CCLS 5A0YA 1YLXA 5DZ7A 2WSCC 3M8WA 3KJQB 1LWCB 4I2PA 4OHXA 1OJ4A 2WSFC 2VQFF 1YBUA 4I7FA 3CJ2A 1P27B 2E5LJ 4Z37A 2AD9A 1PC4A 2GV1A 4PEOA 5KT6A 2V69A 3L95X 4LJMA 3PR5B 3HVTB 4OYMA 1FKOB 1FX4A 1ZBTA 4F4YA 3T5KA 4YS2A 1NSPA 1CS4B 4DN0A 4ZP9A 1DQAA 4FXVA 5HJYA 2KT5A 2FVQA 3SI8A 1BHNA 2DEIA 3M6XA 2D41A 1Y11A 1FJEB 1D8YA 1HQEB 3DHWC 4OQJA 1TKXA 4Q43A 2G13A 2QL7B 2ZKUA 3CCVS 2CDRB 2YWGA 2YNHB 2GMLA 4Q45A 2VDIA 2B5JB 3K59A 2L08A 3V6HA 1JLGA 3I0SA 1SCJB 4NLPA 4DZ6A 2LA6A 3K5NA 2CNNB 4JI0F 3US5A 2DGWA 1RTJA 4MYTA 2XGPA 1VGYA 1B99A 2XS5A 3WC0A 4DV4F 3HZGA 3W9IA 1VQ5S 3IR6B 3G82A 5A76A 3PX0A 3HVWA 1IBLJ 5DGAA 1ZPVA 4TQRA 4MK9A 2HBZB 1HYSB 5IM0B 3OL9A 3DRRB 1XMOF 3K5MA 4USMA 1W2BR 4X4TA 4ZVPB 2Q6BA 2ZD1A 1Q8LA 4BCAA 1S1UA 2ZNZA 3CGIA 3KK1B 4GRSA 4KYZA 3M2RB 3OQ2A 2OJ3A 1VK3A 1PCAA 1KTQA 3T1HF 4C8LA 1NXIA 3NGSA 2DXEA 3E8OA 1ELOA 2ZH8A 4RWXA 2C3YA 1TK8A 5F8HA 3JSRA 3KLEA 1QUPA 2VQEF 1NK6A 3C8YA 2VBWA 4QYZK 4ALZA 4FNIA 4DSKA 3JTNA 4RW9A 4P2XA 3FZ2A 1R89A 4UOHA 2RT3A 3IGVA 3VTIA 2KU7A 5DETA 1LWCA 4RNMA 5LSRA 1HNWF 4DF8A 4L3KA 2EBEA 2RSQA 3W5ZA 3CIMA 4KGVB 1EX8A 4PYDA 1NSKL 1X4EA 5FIIA 1TUGB 3ADAC 3IBWA 2E7XA 4K8RA 1N32F 4DL0C 4B3MJ 3HVTA 3ZNJ1 2EK1A 1PO6A 1FKOA 3F44A 1NSAA 2H4WB 1CS4A 2BKPA 1R0AB 4K4ZA 3CJ3A 1K9MT 1Q8KA 2XI3A 5E33A 1EETB 3CCQS 3KG1A 1HQEA 3MR7A 3I87A 2F65A 3KHRA 2QLFB 2YWEA 7FD1A 4QU7A 2FC8A 3OR1A 1U0HB 2YNHA 5EX3A 3G4SS 1SKWA 2BACA 3PFOA 1NZAA 3NG8A 3PRVA 4F3OA 3IMQJ 2J6SA 1RT2A 3MM7B 2KXFA 3LP2B 1RB0A 2EW9A 4B17A 3EXYA 2WOMA 2HMIB 2UP1A 3JAMU 1IBCB 5J1EB 2IHR1 3PYFA 1Y5LB 5HLFA 4RL1A 5LMUJ 3I32A 1HYSA 5IM0A 2CQCA 3DRRA 4PPZA 3B4DA 1T7PA 1XNQJ 3CC7S 3UDCA 3GR0A 3QT8A 1NK0A 2VDHA 1OMSA 4BWJA 4X62F 5KTQA 2JH3A 3VAHA 2X7IA 3M2RA 2DIUA 4DF4A 2ZH1A 2UV8G 5DDRC 2C22A 3CJ8A 2J76E 5HANA 2HEKA 5HQLA 3KFWX 2LDYA 2OPRA 3CJRA 1FVSA 4C8KA 4PXEA 3H25A 1Q8BA 2HRYA 3N6NA 2W9BB 1X4HA 1YITS 2VL1A 3EICA 3KLIA 1QLNA 1DHMA 3LPEA 1DJ0A 4NMXA 2XZTB 1LNQA 2XCPA 1S7HA 3BM7A 5L9XA 2EG2A 1JIHA 1R8BA 2HRUA 1Q7YT 1YQHA 4X65J 2CZ4A 2N7CA 3MTJA 2P2CB 4F0KA 1YJWS 4C0BA 3G87A 2A10A 2XLKA 4ZN1A 4C9DA 4U9RA 1SL1A 1H2VZ 1TK0A 1IBKJ 4J5OA 4YQWA 2CJKA 3LF0A 3HZEA 4KH1B 2KG0A 3OFEA 3WDOA 3PKYA 3MAAA 5MLCV 2N3LA 3T9NA 1R0AA 2F8HA 1NPRA 3TW0A 1BUXA 2XLJA 3OXLA 1EETA 2IAJA 4JP8A 1VC5A 4KO0A 2B9YA 1PYTA 5IT0A 2PE8A 1VQPS 2CUYA 1WI6A 3A3PB 3EVMA 3VAGA 4OL8A 3W3SA 1U0HA 2MZSA 4OI0A 4C8OA 2DRDA 4EO6A 3DRSB 2GW8A 4K5RA 2BVZA 3M1VA 1X4BA 2JVRA 3G8QA 5DG8A 3MM7A 3A8IA 1NKBA 1U2FA 1CJVB 1U4BA 3LP2A 1QJHA 4LSZB 2H4YB 4JV2A 2HMIA 2HKEA 3MUTP 3HF5A 3P3DA 3GYNA 1WDTA 3RGIA 5J1EA 2LCWA 3D1OA 5KFNA 3D0GE 4PABA 2QT7A 3BEGB 3MXHP 3TJ8A 3PR4A 5FLXY 3IO1A 1JK9B 5E5NA 2HIQA 4QIEA 2PN6A 3HK2A 3K7RA 4RBTA 3OUYB 1GXTA 3LW5C 1X4DA 4Z2XA 4ED3A 5JJBA 1D9DA 5JVHQ 3W5YA 4RWWA 2Z0GA 4F50A 1FWKA 3DLBA 4KV8B 2IBOA 2J9DE 2KVIA 2FHKA 2BQRA 2HVEA 2QL5B 3DOMB 2KKHA 1Y0HA 4URSA 1SJ4P 4Y28C 2J0QD 2DCLA 1VIXA 3GIJA 3KLFB 1ZETA 3CWJA 4G1QA 1K1SA 5HJXA 2NQPA 4HYKA 4GVBA 4CO1A 2DPJA 4DCJB 1S79A 3EWGA 4DV7F 3QZ8A 1VLYA 1DFDA 1LOUA 3HKZD 3QGIA 2ATCB 4ED6A 1SXLA 2HVZA 3S1TA 3OTDA 1KHVA 1NH8A 4ANEA 1MSWD 1PAUB 1G6BA 3OXGA 1RKJA 4IH7A 5DG7A 3LANA 2MZTA 1SQEA 3RW7A 2J5AA 3J80U 4LF6F 3A12A 2EBGA 5L1JA 2OPQB 1M1HA 2BZ2A 1X0FA 2OEMA 3CDAA 2G2YA 4MIAA 5AJ3J 5J2MB 3MPUB 1N5SA 1VBKA 2KJVA 4B9LA 4WE1B 2LXFA 3MCNA 2HGMA 5LJ5Y 1CJVA 4CI0B 1M1KT 2HNDB 3W66A 3PFEA 1Y7PA 2RIJA 5AE3A 4L72B 1XTZA 3NGRA 1FE0A 2FHMA 4K2XA 2EG1A 4LREA 1RT6B 2LFVA 3D7SB 1U6ZA 3KLGB 4WKYA 3DC2A 4FP9A 3BKFA 5L1IA 3F56A 4NLQA 3KXDA 1FKPB 3LP0A 2E9TA 1KOHA 2AJ2A 5KG5A 4B3SJ 4WF9Q 2IM2A 3G8TA 3CCUS 1U25A 4KV8A 2MZRA 4IRCA 1U09A 3A3OB 3NOGA 1T0TV 4MKAA 1K1QA 3DLKB 5D0RA 2GGPB 3DOMA 1RHUB 1U02A 3K0JA 3PRDA 4EWTA 2OLWA 3AXMA 4A8YA 4TYBA 5IXUA 3OLBA 1XNRJ 1OQ6A 5D0GA 5KFWA 1SBRA 3GFZA 2QLBB 4S0MA 2VHGA 4OMFG 1G1XA 4A8OA 1XC9A 4JYAJ 1QE1B 3OTOJ 3BN7A 4DBQA 2A6MA 2PA3A 4RU2A 2CJYB 1KFDA 1EJ7L 2UXDJ 4UZCA 3UR0A 3J7ZT 3KDOA 3HP6A 3NXZA 5FDLB 2Y8YA 4JI6F 2OPQA 3H4DA 4OYWA 4B3TJ 4WPAA 2R7RA 1RWPB 2XZDB 2QIFA 4WXWA 3PIPQ 2BJ1A 5J2MA 2W4DA 2MXYA 4J9LA 4WE1A 4DSEA 1UL3A 2YNFB 2HHPA 4DV2J 2OEKA 3WX4A 4FBUA 4XDDA 2HNDA 1YK9A 5JVGQ 1CQNA 3UR3C 2IMOA 2ERRA 5GAEI 1CC7A 4YUDA 1F5CA 1RT6A 3M6UA 1AFIA 2DR8A 3BO3A 2KT2A 3KLGA 4DCPB 1VHIA 4NLVA 3BGUA 3G9CA 1FERA 5F0WA 2LA4A 2YX7A 2DH7A 4G1PA 1VQLS 3T5HA 1FKPA 1T3OA 2B43A 5K14B 1S48A 2B7BB 4CO3A 3I9ZA 2QZ8A 5LXRA 1RBOB 3RAQA 1Q53A 4F2SA 3BGRB 4ZPWR 3DLKA 1WOSA 3UDVA 2GGPA 4X64F 3MWBA 1SB6A 2PC6A 2L48A 1FO1A 4C0OC 1T9YA 3ICLA 4DPUA 4Y65A 1TP7A 4DV1F 3T19A 3AH6A 1MWZA 2M7SA 2Y1RI 2DTJA 2LXUA 3UCGA 2V2ZA 4CT9A 3V4MA 4P2SA 1KSPA 4LF5F 4DR4J 3QRPA 1QE1A 3DCAA 3VAJA 2MKHA 2XY7A 2DGXA 1N5VA 2HVHA 2LXIA 2G0JA 3E01A 2FLOA 4GKKJ 2VFSA 1T3NA 4JI5F 2V8GA 5CYJA 5FDLA 1WC4A 4RW4B 3FBBA 2KHCA 1HHQA 5I3QA 1K0VA 2O5DA 3M8YA 4N7TA 2GC8A 2OH2A 2NCKL 1S6UA 2LYVA 2OPSB 2MKSA 1FRKA 4TLQA 1XMQF 1N33F 1RT4B 4LSLB 3NKYA 5D0EA 3F73A 2C1EB 2YNFA 1C1CB 1AXQA 2HQDA 1N8RT 1MMDA 2XMKA 3ZZTA 1U1QA 2VD3A 3D0HE 2ZBIA 4M5MA 3QRRA 4J9KA 1VHFA 2QG9B 1SQFA 3B78A 1HNXJ 4ELTA 4IRDA 1KDNA 5J1NA 4CH7A 3SYZA 3FZBA 4DR5J 3V6KA 2RU3A 4UUWA 2J7UA 1X5SA 1EP4B 2WK4A 5FJ4A 2VG6B 5HROA 4AQYF 5D4NA 2B9WA 1LV5A 4DSIA 5A8RB 1Q1KA 4LFAJ 5J2NA 4MYUA 1XWLA 4C8NA 4KKOB 1FCAA 2HLTA 4DR1F 4KHPF 5HSPA 1UPPA 2PEHA 5K14A 2OIHA 2PMHA 3C16A 4BDPA 2GQCA 4MT1A 1RWWB 1HWIA 1VRUB 5E3PA 2C2NA 3BGRA 4C98A 4PPDA 1VQ9S 3QGPA 5K8MA 3KUHA 2VOPA 4YB1P 2BEFA 2XS7A 3EM1A 4LFCJ 4DX5A 3WBZA 5KG4A 4CLYA 1YRXA 1P1TA 2XMTA 5AXKA 1IJFB 1YWXA 1S4EA 3L7OA 2ZC3A 3G6ES 1TFWA 3ZZOA 4WYWA 4EYHB 3L09A 1I6JA 3KG0A 4W98A 3D4JA 3QFHA 2BUNA 1Q86T 2HK2A 2UU9F 4USHA 2ATLA 2JLEA 5GAHI 3C6TB 1N0UA 2O01C 2PFDA 1VCTA 2R8GA 1HMVB 4RW4A 5AE2A 3NL0A 2CJXB 2CWKA 4DR7J 3BYPA 4DPWA 2H51B 2XWXA 4CLWA 3N9UC 5A8WB 2YKMB 3RBZA 4OJ3A 1D9AA 4LSLA 3I55S 4DR2F 1TKDA 1C1CA 2CNOB 3O6QA 3KK3B 2VJVA 3VQTA 2R7WA 2AZ1A 3DRYA 3W62A 4X66J 5LXYA 1VS3A 2V67A 1CBKA 4F4AA 2PDAA 1K44A 4TU9A 3GIIA 2NUUG 3BN4A 4DPYA 2U2FA 5IWAJ 2POKA 2NS1B 1EP4A 2VG6A 1R27B 3GLJA 5A8RA 6AT1B 3EUNA 4MTPA 3HJFA 3CCES 3D6MB 2NZCA 2AJFE 4KKOA 2VASA 2VODA 2P9CA 3VVTA 3FQLA 4PG7A 4L3NA 3DGPB 5KFSA 3TJ9A 4ZDNA 3W8PA 3SZ2A 2KYZA 4C97A 1IR1A 1OO0B 4HHHA 4OV1A 4DV5J 3B4MA 2UUAJ 4ZITA 4DLEA 1JLAA 5HMWA 2MHNA 3GJQB 4FYWB 5D6GA 2G2OA 3UVJA 1I51B 3AAWB 2FJBB 3GJSB 1F3FA 2M88A 1JXLA 4RJVA 1WC1A 3TI0A 2EWHA 1LK7A 3CMES 1DLOB 3CDBA 1FDAA 5CCMA 3HSZA 1S10A 3MD3A 2P5VA 5KFKA 4G3IA 1CPZA 3TA0A 3MURP 4NXMF 1ZM2A 4IFYB 3TA1A 3NAHA 4B3RJ 1X9SA 3A13A 3JQJA 1MW7A 2FTRA 5KFBA 1S12A 3CD7A 2PGCA 4A4JA 4EK2A 3C6TA 4WFBQ 3J81Y 5T7LB 4K7QA 4LBPA 1HMVA 4RW7B 3DMJB 1DQ9A 2WSEC 3AT1B 2C28A 4MKVA 5E3CA 1R7IA 2C2OB 2JFKA 5A8WA 2YKMA 5A6WA 4TY8B 1DURA 3KK3A 4NX9A 3NEKA 1FRHA 4YB5A 3U1MA 4M5NA 5ITHA 3QATA 1NSQA 1H0HB 2OSRA 1HQ2A 2MY8A 1WORA 4N47A 1BXNA 1FDBA 1FRJA 3J7AN 2HURA 4JI7J 4NCGB 3RRKA 4B9TA 3HHKA 4YEAA 4IOAQ 3N4WA 2W9AA 2CQ1A 2FD2A 3ET6B 1TMMA 5KFLA 1IKYA 3R6LB 1HD0A 4NWBA 4DQIA 5IC4B 1QUVA 2ABYA 2B4UA 3BS9A 3FKBA 1R8CA 4YOEA 2J0SD 5J1PA 3DGPA 1J5OB 1O6XA 2HLUA 2DCUB 3DLJA 3TR5A 1F2GA 2QLWA 4M5LA 1TKZB 2QFIA 4IO1A 1NDCA 2NXUA 4ZMMA 4LF7F 5K8OA 3EXCX 4ITSA 1JXVA 2MLXA 1Y10A 4DL6A 4P75A 1FRLA 3R7NB 4K0KJ 1DLOA 2LQ8A 4DFKA 5E41A 4C8ZA 2N3OA 1FF2A 3G86A 5GAGU 2P9GA 1YRUA 4KHMA 3R1HA 3TOQA 3M8SA 3KMQA 3HX9A 2AP6A 2AYGA 2RRAA 1RP5A 2DGOA 4IFYA 1SV5A 1WG5A 5DQGA 2CVIA 1FA0A 2F5GA 5LM7E 3AD7C 3UI3A 4X2BA 1XJWB 2DHSA 1SC6A 2DH8A 3KK2B 4Q2LA 2HNYA 5L8RC 5T7LA 3QNWB 4I67A 4UOFA 2XMUA 3LALA 1GMWD 4OV6A 4RW7A 5KG7A 3DMJA 1S77D 2DISA 4JI0J 4IKAA 1MNEA 3HI9A 3D68A 1JJ4A 5BJRA 4DV4J 4IFVB 4TY8A 2DGUA 5ETRA 3NCQA 3W61A 3PY8A 5IQ6A 4B9VA 2UUTA 5C7PA 3H5UA 2LVWA 2FJAB 4DDFA 2VZ9A 4B3OB 4NOHA 4Y2KA 1U0SA 2DNYA 2GMJA 4CTAB 2JDJA 2K1RB 1UEVA 4PYAA 2ROGA 1FX2A 2C2EA 4NCGA 1C4AA 4FPRA 4O23A 3FJ2A 1UVMA 3T1HJ 1IKWB 2DO0A 1BWEA 3ET6A 4TKTA 1L3SA 2IY5B 4X4OA 4QU6A 3H90A 1RTZA 2YY3A 2W01A 4ZJLA 4I6WA 1GXUA 1WACA 1J5OA 5C5JA 4UY85 1H7XA 3VAIA 4FBTA 5K20B 1HR0F 2CZ9A 2IIHA 2M4MA 1CLFA 4ZVSB 1TKZA 1IM6A 1RI7A 2W2MP 4DX7A 2RRBA 2FJXA 2DNLA 1ZS6A 3PEHA 2HNZB 3K8VA 1V3ZA 2MKCA 4JV5J 1ZAXA 5CD4H 1Q8IA 4NMLA 4NLUA 4BHQA 5CAAA 4KE5A 5DDQC 1EZZB 2ZBQA 1N5TA 3HCXA 2RQKA 2AGQA 2HBQB 2V8VA 2LLZA 3X1LB 3TAQA 2C3UA 2OKQA 1U48A 4ED0A 3W2WB 3PCOB 1NK5A 3CO9A 3FNNA 4E8UA 5LL6d 1RT5B 3J7YI 5EHHA 5BR8F 3TEHB 2V6AA 4UT4A 1KFSA 1X7VA 2M0GB 1TL7B 1EKRA 5B0CA 3FFIB 3KK2A 4WWSA 2EKNA 2ZH3A 3G96A 1NZ8A 3TVYA 2VF3A 2YKNB 3R5BA 1JLQB 1JLCB 3JSBA 3DNCA 3GP9A 3SDEB 1EB0A 1FXDA 3PDNA 2EFOA 2KJWA 3OJSA 4LFBF 3R6GB 2BRKA 5H1SV 4KPCA 4FF3A 1YX2A 3BF4A 3NLCA 4H4KC 2DY9A 4ZPBA 2IM3A 3SSRA 4X4VA 2DITA 2CQGA 5THWA 4B3OA 3MR2A 2WW4A 4F3QA 4QOTA 1H72C 2E9RX 3QSIA 4CTAA 2E1CA 1C1BA 1UW9A 3IAS9 4ENOA 4ZVTB 1SKRA 4AYBD 5J2PB 2K1RA 2B0GA 3LTOA 4ZVFA 2LQJA 1QAXA 4YY3J 4H4KA 1FEHA 1IKWA 1X60A 2MSTA 1MROB 1TMJA 2WTFA 3LOUA 4O3NA 3G71S 1JJ2R 1U49A 3BPSP 3PHEA 1KQGB 1NHKL 5F3TA 1UVLA 1NJYA 5F0UA 4EZ6A 3KLVA 3Q8VA 4DSJA 3GMGA 1X5TA 3PM9A 2CNKB 3VVUA 4DX8H 1WG4A 2HNZA 5HO4A 1FFSB 1RWVB 2XMMA 3HHLD 4O4RA 2BE7D 2W7AA 2RJZA 4Y2IA 2VBZA 3PYDA 2H1YA 4QPXA 3T6JA 3W2WA 3QO9B 3MEGB 2H5IB 4MH8A 3H40A 1RT5A 1LFWA 2B4VA 2RUGA 4C8MA 2J9EA 5B0BA 1TL7A 4J91A 1QY7A 3VHQA 3FFIA 3VZHA 1TUWA 4HDHA 1ACMB 4KC5A 2M8DB 1TR0A 2B7CB 3M32A 3N01A 2YKNA 4WP3A 1JLQA 1JLCA 2QA2A 3SDEA 4N76A 5C2CA 4BS2A 2HZAA 3L4BC 2KI2A 3H5YA 5F3ZA 4URGA 3WQPA 2CPXA 1HWJA 3A3NB 4MJKA 3TZZA 3R9LA 5AXNA 2J6UA 2BMBA 4PAAA 1NH7A 4DL3A 4RBVA 1HQUB 5DRKA 1XR7A 3FRYA 1SPBP 5H9FK 4C6AA 5J2PA 4A8XA 4G1IA 3BGLA 1S6OA 4U7UK 2VA3A 1WD6A 2JFDA 2GO9A 4NZ0A 1FI4A 1N34F 5GVQA 2XB2D 1G7CB 5A6PA 4PZVA 3OJUA 4F4XA 4USWA 3P5TL 2YWWA 1VQMS 4H4MB 2COLA 3D6TB 1MROA 5E0OA 2QFJA 1AT1B 1QDUB 1EIYB 2Z30B 2QJ3A 4DQSA 4LF8F 1P1LA 3ZNUA 2RMLA 3GV8B 3M7VA 1XN9A 3TQ1A 4FYVB 4L6V3 2HQFA 3H42A 3FEZA 1HA1A 2L3MA 2AQ4A 5M2UA 5ETNA 5DS7A 3CSKA 2MEWA 5L46A 1NLKL 3EDQB 2M5YA 3D66A 4ZPCA 1BQNA 2W24A 2M8HA 4XK8C 1F60B 2F9DA 3AJ1A 3TVZA 2G0IA 3PRBA 3IP0A 4EBDA 3R7SB 2GAGC 5L1KA 3OVAA 2BBEA 2ZE2B 3QO9A 3MEGA 3Q8QB 4F3MA 1FD2A 3AODA 4W4MA 3V81B 2GVZB 3LP1B 4LF6J 5IV4A 3RB6A 1HI8A 1NO8A 1R0CB 3NBPB 2A2DA 3NCRA 2CQ4A 4WBFA 2C2MB 3QLHB 1WSRA 2W2PP 3UPFA 4YR2A 2IYGA 2YVSA 5BYRA 1S6QB 3GJTB 2JLFA 3ETOA 2ACMA 2XGQA 2FJEB 3MECB 2V8HA 1GEHA 1BY9A 1VC6A 2IJRA 2ASYA 4YB6A 4GKJF 5IT9U 1Y3KA 3X3UA 4X4NA 3CC4S 3BZQA 1R6YA 4PR6A 3HHNB 4F02A 1HQUA 3SQOP 1AFJA 1LEOA 4CP5A 4IQMA 4USJC 5KT3A 1HWLA 2FY1A 2D69A 3EGWB 5D8HB 2GIRA 2WRMA 1UA1A 1IQZA 4LQ9A 4EO8A 5CYQB 2MZQA 2DXDA 2ZWPA 2R7QA 5HBMB 1ZZNA 2LU2A 3MMAA 4H4MA 3NS6A 4OJHA 3DLHA 2ZM6J 1EQ0A 1P8GA 3BQ1A 5KFEA 1SJ3P 1HBUB 4QWEA 3THVA 2DHHA 3BSOA 1O5JA 3C3LA 1TV6A 4OZ0A 5HP1B 1FTRA 2D3O1 2AHOB 2BE2B 1I1GA 1KLMA 2B4PA 1RWOB 3RB3A 3TZYA 3SCLE 4AT1B 1SH0A 1YGYA 2XZWA 3DU5A 3FSYA 3IRXB 2FLNA 1G2EA 4Y0FA 3AD9C 4Y6IA 4PRFA 2EFPA 3PXGa 1U45A 3GIMA 2XS2A 2Y1IA 2ZUGA 1YVFA 2IJNA 2BM1A 2YQ3A 1U6FA 3FMBA 3QWUA 4A8SA 1PGZA 2EFQA 2ZE2A 3A8KA 4QPTA 1NPPA 1FNMA 4M95A 1RA6A 3IGNA 2F7VA 2FYXA 2FQQB 1H6KX 2GVZA 3LP1A 5HI7A 1UJ5A 3NBPA 2AEJA 2VC0A 3KHHA 4NXNJ 5I3PA 3QLHA 2AGOA 1GX5A 4XPCA 1BD6A 4ID8A 1IWAA 3OL8A 3IC1A 1S6QA 4U8YA 4P74A 3DDNA 3JSMB 1X5PA 2BW7A 3MECA 2BJ3A 2C2ZB 3T3FA 4UW2A 4EI2A 5KFXA 2DNQA 4ER8A 3OLAA 4DR6F 5D3GA 2MTLA 1X4GA 2RF2B 2I5JB 4F4KA 1RWUA 4F4WA 1HKAA 4J9UE 1YZ6A 4DUZF 2O66A 4F36A 2P9EA 1SKSA 2LECA 3DOKB 2X1AA 2JEFA 3MR6A 2KFNA 3BR8A 2WB4A 4YN3B 1YJVA 3R5GA 5B7WA 3HD2A 2IYIA 5CYQA 1K8AT 4QWCA 2AWZA 4ZS6A 4WU2A 5HBMA 4V19J 2ALZA 4RW6B 4LF4F 1URRA 1URNA 2DPIA 3D5MA 2DGVA 5CZXA 1HNIB 2RNEA 2XI2A 5C2GA 1KTVA 1I94F 4Y3CA 1QSYA 2Z4PA 2J7WA 5HP1A 1KVIA 2JRSA 2BE2A 3CXCR 2ZH5A 4J9OA 2E5LF 3MM9A 3MOZA 2CJAA 2PIIA 1TU0B 2DKOB 4DV3J 2FVSA 2YPYA 2VUGA 3JAMY 2NZ4A 2FZGB 3D0IE 3IRXA 1NBEB 3MEDB 2PEBA 1BMQB 2VONA 4C3KA 3B8HA 2BJ7A 2VJUA 4DJBA 5L1LA 2R2UA 2QMXA 4MIWA 3J7A1 3T5LA 1UCNA 2BABA 5AE1A 3VGVA 1R3NA 2DEJA 3L7UA 4E2FB 2R4FA 3FBEA 2HBRB 1KC8T 3CMAS 4JI5J 2HK3A 4GO7X 1A6LA 4QYRA 2YX1A 3KG4A 1PSDA 2X1FA 4M1KA 3ILOA 2FDNA 3QAUA 7AT1B 4EZ9A 1Q82T 3CJTA 3K5LA 3I4PA 2R7TA 1ZH5A 1IR2A 3UNYA 2AKWB 3F0NA 2O67A 4WFZA 2UUBJ 1KN6A 3SCIE 4LVNP 1U2RA 2DRBA 4OYAA 3G2XA 5F8LA 2FY8A 2B8PA 3H20A 1ITPA 2D74B 4TNOA 3V4IA 1LXJA 4OYPA 4YDXA 1NUEA 3LAMA 2RF2A 5DM6Q 1S1XB 2WBMA 3CVKA 1J27A 4AQYJ 2I5JA 2HGNA 3HM9A 3C46A 1Z2LA 2UXBF 3S01A 4WYLA 4HR2A 3DOKA 4Q7AA 4DR1J 1FFGB 4X4RA 4KHPJ 2O1PA 3BQ2A 2BW2A 1S9FA 5CYMA 2HWTA 5D4PA 4QQBA 4OZ3A 1XBWA 2VPYB 4RW6A 1DQ8A 1QVFR 3UD3P 2VBYA 2W2OP 1HNIA 1Q95G 3H4BA 4IG3B 3SFGA 3QT5A 5A0YB 2CQHA 4NYZA 1RKIA 3W9HA 3ZO7A 2JZ5A 1DBDA 4R8UB 1G3OA 2VKZG 3O44A 2Q43A 4B3MF 3TAMB 3CD5A 2F63A 4E98A 2XNRA 3W7BA 3L3CA 2YX4A 1GMWA 4B08A 3CB4A 4IG0A 3RTVA 4L75A 3JTOA 4IUFA 2C2RA 1MMLA 5DG9A 3CF5Q 2HHUA 1F3VA 1V5VA 2QSFA 3VV2B 3VAKA 2WZ1A 1L3UA 3W2VB 4PWUA 1RWKB 2F4VF 4ED7A 3PKMA 4R0JA 3OHAA 3P8BB 3I0SB 2GFFA 2QLJB 2NXEA 3A8JA 4K2JA 1RTJB 1Q4RA 1UJ6A 4DR2J 2RDJA 3GFYA 1D3WA 4YHHJ 4LRAA 3G82B 5LMUF 2HPUA 1OY8A 4K4UA 2R7SA 3N6LA 4RU9A 4KGXB 4CO5A 3EE3A 3GV5B 4M5HA 2K3IA 5LSOA 5DDOC 2MQ8A 4P73A 3KKFA 1S1XA 4CO4A 3QGGA 1U1KA 1JLFB 4OJ1A 2MQNA 1HNZJ 4DHVA 2IVYA 1RXOB 2XTJP 3FEYB 1RAFB 4CDIA 2G0CA 1T9VA 2YQ0A 5ETSA 1REVB 1RT7B 2HAFA 4ID5B 2DNGA 2YWFA 3J80Y 4QIWD 3S6EA 1IKXB 1FE4A 2N4DA 2BOAA 2ZC4A 3TARA 2EC2A 4RW9B 3EVWA 4AL5A 2VV5A 4YFUA 1WEZA 2F9JA 4O0IA 5KFQA 3VAMA 2HFVA 4N8OA 2AF6A 5KFDA 2VB6A 4LR9A 4R8UA 1V5IB 2B3TB 2VG7B 3PG9A 4EYIB 3HXMA 1IBKF 4ZLPA 1HHSA 4DSFA 2R3VA 3TAMA 5KG6A 5B0AA 3QRQA 3IWXA 3MFIA 2E7VA 1AZSB 5HAOA 3ZTSA 3GV7B 3PW7A 2F8MA 1PG5B 5F8MA 2HGLA 4NXMJ 4IH6A 2NREA 4U95A 5EWFA 1U1OA 3F41A 4DV6J 2WVEA 3DN9A 4DV0J 2RHSB 1X9WA 3QMQA 3GE9A 4UUXA 3Q86A 3W2VA 1J5EF 3TAPA 3OR1B 4OHZA 1S1TB 1KVKA 3OHBA 2RRNA 3DXBA 2X3GA 4NA3A 1VLOA 5JMNA 2QA1A 4NA2A 2E1AA 4H4OA 4F26A 1LFPA 1RT2B 1T02A 1SC3B 3ZZZA 3UNGC 2BM0A 4N41A 2RUSA 2VPXB 2H5EA 3O8WA 2WOMB 5HMYA 2ACYA 1F9FA 2YWKA 1FDNA 1NCLA 3GJRB 1N48A 1OY9A 4CRJA 4QWAA 5HLFB 1HI0P 1KBRA 4QIFA 4ECWA 2XMVA 3OL7A 1ZM9A 4ECSA 3TA2A 4AXIA 4P71A 2EC0A 2GS8A 2V4JA 4MK7A 3HJVA 5CHCB 4DU7A 2FPHX 2V4RA 1JLFA 3SV4A 3RU0A 1R31A 2D1CA 1RAGB 4FDFA 5KG3A 2FUG9 3Q8YA 1B7FA 4ZPDA 2H3EB 2OPRB 1REVA 1RT7A 4ID5A 4FYXB 3BO2A 4NLYA 3PW4A 4I68A 3BGOP 3HHLA 1IKXA 4Q2MA 2GHVC 4LF9J 2C2KB 3KLIB 1GX6A 1IM4A 5JUMA 4V1Ak 1RU2A 1VC0A 2ZWOA 4HVZA 2I8EA 1IUJA 4FVMA 3GYGA 4KBIA 4UQGA 4FYYB 4AL6A 3RR8A 3VZIA 1QTNB 2VG7A 3BKTA 3C14A 2XO7A 4NZ7A 1QVGR 1LWEB 2HSEB 2ZH7A 4ZP7A 1TKTB 1JMTA 1RYRA 3MPWA 1AZSA 2E9ZA 5BXIA 4FKYA 4C3LA 3DM2B 2ZZMA 3M30B 3M9NB 3G6XA 3EVOA 4OX9J 3AFGA 3MAAB 2WB1D 1T9UA 3ZZPA 3QZ7A 2DO4A 3J81j 1CVJA 4HEA9 1VQYA 2IAJB 1HHTP 2W7PA 1VBXA 4KO0B 5AJ3F 1U24A 1UAWA 2ZJQQ 3DKDA 2V8PA 4CLLA 4JV0A 1L5UA 1S1TA 1Q81T 5A2QY 1MN7A 4K4TA 2OMOA 3SCKE 2AW0A 3N5BA 3CJ5A 3R27A 1C4CA 3M1VB 4DQQA 3KTQA 3EZOA 2AYMA 2J8SA 2VKRA 4UOCA 5C25A 2Q66A 5KFIA 1U8WA 3MMJA 2CRLA 4I69A 1SL0A 2GJ2A 4NLGA 1WEYA 4MK8A 2V8DA 4XO0A 1C0TB 1F5AA 4FF2A 3V6DA 3Q0AA 1ZTWA 4RO0A 2NYHA 3IG1B 3W64A 3TYTA 2H65B 1XMBA 2GVDA 1BQMB 3POTB 4RUHA 4C0HA 3ILIA 3NRBA 1Y3JA 2IA0A 4B3SF 3FCHA 2BX6A 1M5HA 3ZZRA 3M2VB 1FJGJ 1YJTA 2BANB 2LEPA 2VU5A 1GNKA 1PILA 3PW2A 1HR0J 4J9RA 5DQHA 4OHYA 4MIBA 2YPZA 3H5SA 5ETKA 3R5JB 1V3SA 2C2DA 1XIQA 1C2PA 3I5CA 4G1QB 1FT8A 4GVBB 4YP3A 2MZJA 5KFUA 3WX8A 1RQ0A 1LWEA 3CMQA 2CNLB 3T1YF 2D3OR 2VA2A 3NS5A 1TKTA 2XHWA 3OTOF 2AJ1A 3CJKB 2AEMA 2Y0SD 2IVFB 1RTDA 4CH0S 3MUMP 3DM2A 2ZOMA 3AQOA 3M30A 4MKYA 4B02A 5KOXA 2AU0A 2Y1JA 2Q3PA 4WFXA 2DNHA 3KLHB 2CKWA 4GC7A 5H9EJ 1K73T 4B3TF 1SI9A 5GMEA 1DARA 2R7OA 2DR5A 3EX7B 1RUSA 6FDRA 1S97A 5D78A 2Y8WA 2QV6A 2XNQA 3VF0B 3JSYA 1YKWA 1IWGA 1VISA 1WEXA 3HFVA 3RR7A 3SSQA 1NJZA 4LFBJ 2MQQA 4FS1A 1ROFA 4DI6A 2FJDB 2I9SA 1BGXT 2ALYB 3W8GA 3ENAA 1X4CA 3VGSA 4NL5A 1C0TA 3CPWR 5AXMA 1FEEA 2OFHX 1AW0A 1V9OA 2VG5B 2ZBRA 4KRWA 4J90A 3NNCA 3PVXA 3IG1A 1YDLA 3Q8PB 2MGZA 4OX8A 1U47A 3OW2R 1BQMA 2V0NA 3POTA 2DNRA 3BH6B 1Q5VA 1DY3A 1APSA 4USKA 4C48A 5HQ8A 4CLSA 2UVVA 2X3DA 3LP0B 4LR7A 5DM7Q 5KG1A 3M2VA 3R8YA 3P49B 2CG8A 2MMYA 3CO0P 2AZ3A 4HDGA 1U2CA 3ENQA 1KQFB 2BANA 1K0TA 4ILRA 3UD4P 2Z2LA 5DLFA 4OYBA 1RT3B 2CYYA 4ED8A 3VAFA 1RJJA 1ICEB 2XY5A 1H74A 4RKUC 2RILA 3V6JA 2BV3A 1S57A 4Q5VA 1CSJA 1H7WA 1NU4A 2EK6A 1RAAB 3Q8RB 3SEOA 3KMSA 4ANDA 4ED2A 2UUCJ 2V63A 4JOUA 1N36J 5GAGI 3SSSA 4DR4F 3LGNA 1F0XA 1WDDA 1XR6A 3CJKA 1BWVA 3GCWP 1S0OA 5LMNJ 4V19X 3W60A 2CG4A 1CJKB 2IMWP 3OVSA 3OFGA 4GKKF 3IM8A 5EUHA 3BBFA 1A0OB 4JI8J 1FJ7A 3KLHA 3N6MA 2PMZD 3MPDA 1MG7A 3T5JA 2JVOA 1CULB 1IKVA 1TUVA 3FSXA 1ZM3A 3RRHA 3Q2SC 1HNVA 2FZKB 4QW9A 3QSYB 4DFMA 4ZVEA 1W26A 2KYXA 2CPEA 2XLIA 3ZC4A 2MJUA 2XMAA 4UQTA 3BQ0A 2G9OA 3IR7B 5B0DA 3L7PA 2MKJA 1QM9A 2VG5A 3OL6A 3RG6A 2RB7A 2HW3A 4LFAF 1ZPWX 1HWUA 3U27A 2JEGA 1MU2B 3ISND 2F4FA 2KRBA 1F9HA 4I1TA 1E6VB 4FXWA 2QL9B 4DS5A 3WIUA 4EBCA 1RADB 4ZCKA 2EVZA 4NE9C 4ZOSA 2H5JB 3PIOQ 2DY1A 2IJFA 3THTA 3W65A 1RT3A 2OD4A 2IM0A 1T9TA 3DHXA 4ZP6A 2BOPA 3ETMA 1LK5A 4ZPTR 4WTOB 3W5XA 4DR3F 2FJVA 3NGUA 5D0HA 3C15B 2YWHA 1U1NA 3TUJC 4K4XA 3RAMA 2WVBA 5MAOA 3HSJA 1YHQS 4ZPAA 4DCOB 3FRZA 1TQLA 1IJEB 5B0GA 1F1BB 3IFEA 4JI4J 3GYXB 2QC3A 3EJMA 3GZ7A 2CADA 2XYHB 4F2RA 4Q44A 4OIXA 1UFWA 1VQ8S 5CA5A 1QAYA 1CJKA 1HPZB 2NR0A 4Y2AA 3H2LA 5F41A 4O0NA 4R5PB 3CJSA 2HAIA 2I38A 3E01B 4NEZA 3WHIA 4DR7F 1CULA 4OJGA 5ETOA 2F3JA 2M2BA 2N82B 3H2VE 1NK4A 1T03A 3N0VA 1S0NA 1SJRA 4PQUB 1F5BA 3CD6S 4CLTA 1NJWA 2V34A 4OI2A 2PA8D 2B51A 4MFBB 3GQCA 3TNVA 2OO4A 1YJNS 3AJ2A 4I2QB 2KXHA 3UCUP 2I6WA 2ZZNA 1JNRB 3AHPA 1GMVA 4TVAB 3PJWA 5HROB 4O3RA 3FVYA 1MU2A 3DYAB 3FQKA 4ECYA 5J2NB 1FRIA 1OPZA 3MEEB 4G6VB 4ZP8A 4X4QA 1WHWA 2X51A 1E6VA 2DT9A 4QR0A 2LP4A 1HL6A 4HACB 4A8QA 3SQGB 2R2RA 3C16B 4DV5F 2UUAF 2UV8A 2WVCA 3UWTA 2P6SA 1V3RA 3BJYA 2K3KA 2J7KA 3ZTQA 4FF1A 2F1FA 2V50A 1FDDA 4KY3A 2Y1LB 3C15A 3CCRS 5BYQA 3BBCA 3HO1A 2I0XA 4PG4A 5ETLA 3OSPA 1WOPA 4M8LA 1UMJA 1WWHA 4KGKA 3UDEA 4BC7A 4WFNQ 4CQ1A 5A8KB 4UTGA 2BJ8A 3OV7A 1U1RA 3GR1A 1RHJB 3D6FB 2VPWB 1HPZA 3BH7B 1PBUA 3K57A 3AOBA 2AEFA 2ZH6A 1SL2A 2H48B 1S6PB 4R5PA 2WVFA 1FESA 5IOLA 1S1WB 5HVGA 4QYZJ 3AD8C 1M5OC 1NKEA 2Z8QA 1UEUA 5CZVA 3V5RA 2CPHA 2MQLA 1HBNB 1S0MA 2XBPA 4PQUA 2L9WA 3J7Z5 3MPYA 1KQKA 1N5QA 4ZIWA 3MGJA 3AXKA 3BBBA 4MFBA 4NLWA 4DR6J 3HSGA 4I2QA 4PG5A 3RYLA 2YNGB 3CT9A 3MOJB 3D1HA 5KFTA 4ZIVA 4U6PA 1UWBB 1Y00A 4X4UA 2HFSA 2VICA 3M8PB 3DYAA 1R43A 4ZCMA 1XEZA 3MEEA 3O2IA 2AYBA 2ILZA 5IV3A 8AT1B 1RCXB 2DNNA 4NRTA 4ZHRB 2V2QA 1Q5YA 3RRGA 1KQSR 4LF4J 4QCLA 4DSLA 4HACA 2W8KA 3KHLA 4A8MP 3SQGA 2EKYA 4WIQA 3RAXA 2KB2A 1RAIB 2NLWA 3HDSA 2H9ZA 1I94J 4NASA 3KNGA 4RUCA 1JLBB 3BR9A 5LJ3Y 1JLAB 2XYPB 4ZCLA 4DPOA 3UVJB 3CDEA 3OTBA 5F8GA 4K0KF 4PXDA 4HH1A 3OSNA 2KZMA 3OBIA 2K2PA 5KFMA 2E5IA 2AMCB 3RBXA 1EARA 3BPDA 4ZKAA 1LQ9A 2KG1A 1B7YB 2J9DA 5M2RA 3E3XA 1GTEA 1FTCA 2EEYA 2CQIA 1EAYC 5A8KA 4IQXA 2L9DA 4ZJOA 1L3VA 4JI3F 4DUYJ 1GAOA 2PMWA 2RHQB 4P9SA 3C6UA 3P4UB 4WK3A 2AT1B 2YBVA 2DIVA 1S6PA 4BC9A 5DO2A 4QWBA 4ZVUB 3DU6A 4DUTA 3O1LA 1S1WA 1UEKA 1ZA2B 2UXCJ 1KNZA 2W4PA 2A0FB 4TY9A 2IDLA 5KT4A 5I3UB 4LVOP 4LRFA 2JWNA 5ETTA 2HHHF 4XAKA 1S99A 3JXOA 2LDIA 1HBNA 1K47A 2EI5A 2OEJA 4R25A 4ANCA 3FCWA 2I2YA 3MM8B 3P6YC 5B0FA 1JQGA 3QJPA 4U67Q 1T05B 2A18A 3EZUA 2R8JA 3AJDA 4KH0B 3R1LA 2DHAA 2Z56B 2WW8A 3BO4A 2HVDA 2YNGA 1OQ3A 3DLGB 3R2DJ 3C2PA 4QIVA 3M8RA 3EGNA 4OYOA 1RCOB 2UXBJ 2M52A 4HI2A 1KR4A 1UWBA 2CJBA 5GADU 4P7VA 3M8PA 3UW1A 4O3PA 3FC9A 1D09B 1IKYB 4IH5A 4PWWA 4ZLLA 1TL3A 3EZ5A 3CJQA 2ZBPA 3SFUA 4HHJA 4ZHRA 1FFWB 2QGFB 3GIRA 1DAXA 2D9OA 1FXRA 4HL9A 2DYAA 3SV3A 1JKHB 5T14A 4ILMA 2Z57B 1QSSA 1JLBA 1B3TA 4JV5F 2JEIA 3T41A 2MLZA 3MZIA 3NGTA 1UZDA 1WJ9A 3RZAA 4L74A 1PAEX 2JOQA 2QLXA 3SXLA 1RDRA 2QA4S 3V2UC 4ECUA 2LKZA 2CIMA 3RJMB 4M5KA 3QT6A 1FHTA 2FGCA 3FBCA 4C11B 3BYRA 2NYIA 3UD5A 4AD6A 4OI3A 1KVJA 1S1VB 2ASJA 3I5AA 1SIZA 1SV5B 4OHVA 1GXLA 3D2WA 4ES1A 3Q8SB 4TU7A 3VCDA 2B5JA 2F4VJ 3MCSA 2HNYB 5RUBA 3DRXA 4QWDA 1RBLA 1YZ7A 4Y34A 1TAQA 5F8JA 3LO3A 1LW0B 2DBBA 3CCMS 5I3UA 2IRYA 3P45B 4HTJA 4C2MA 5E3QA 2LQ5A 4IRKA 3MM8A 2CQPA 4CO2A 4OFZA 4KIAA 2M3DA 1T05A 3IM9A 1H98A 3KK1A 4C4WA 4NLTA 3MM6B 2DB1A 5HATA 3DLGA 4YY3F 1SQGA 4DOZA 2NXJA 2VC1A 1RT1B 3Q83A 2ADCA 4ZLNA 2IPOB 1TELA 2SXLA 1NEEA 1TVRB 4F4ZA 3MPVA 5B09A 2B9XA 3MM5B 2DGSA 1LWXA 1KS2A 3ZTPA 1MN9A 4OI1A 3LWMA 1JKHA 1VJQA 2Z2ZA 1B70B 4ZPVR 1U8SA 3BREA 4OLOA 4X84A 2ZVIA 1KHWA 2YKOA 2VQFJ 2CQ2A 1YI2S 1RAHB 1E6YB 3DLLQ 1BE4A 5HMXA 2W9CB 4KT0C 1YTYA 5IT9Y 1ZAVA 3ZFVA 3Q24A 3R97A 4N5SA 4ED1A 3GSIA 5F8NA 3R5DA 1WF2A 1TTHB 1CG2A 4RW8B 2V5HG 4C11A 5DQIA 2BQUA 2Q79A 2A1BA 1UFLA 3Q22A 3EPGA 1S1VA 1JWWA 4P52A 3THPA 1CJUB 1J5EJ 2VIHA 4C3MA 2ZH9A 2KZZA 3OXFA 4ILLA 4CYUB 2ZDOA 2HS0A 3GG1A 1LW0A 1UA0A 4DQRA 3Q8UA 3NWGA 4OZJA 5KFOA 3ELHA 5K9FA 3GIKA 5IS2A 2FHOB 3TUPA 2PT0A 5K5MA 2K06A 4TYAA 4LRCA 2JSXA 2RAQA 1RHQB 2H54B 1U1LA 1XMOJ 2R8IA 3WZ0A 2RQMA 1D9FA 3TEGA 3MM6A 1P9QC 1R8AA 5FD1A 1VQ7S 1C1BB 2MQPA 3OTEA 3VQSA 1RE1B 3R3TA 2W1BA 5HVFA 1RT1A 3TWZA 3GPAA 5E3AA 3AA9A 2RD5C 2F40A 3P96A 2OELA 4F0MA 2KT3A 3ISZA 2ZZTA 2RVJA 4M5IA 1PYOB 2FGOA 4PWDB 3D6HB 2W9BA 3TX0A 1TVRA 2VQEJ 2E44A 2Z2YB 5D15A 4J9SA 3GFHA 2GX8A 3GCXP 3MM5A 3EGZA 2PI5A 2J8AA 4P2FA 1U1MA 1TL5A 2HHTA 1VK8A 2VFRA 1KP6A 4TQSA 3QIDA 3S7RA 1HNWJ 1F2HA 3BKUA 4ETXA 3FMWA 2QEXS 2GJIA 1WF0A 1H2TZ 1E6YA 1D1UA 1UKUA 1L3KA 2W9CA 2CWXA 2JC0A 1N32J 3SMZA 3CULA 4ZVOB 2CQ3A 4OI6A 3TP2A 3NGDA 3Q23A 2PI4A 2N4CA 1NAQA 4QBUA 2U1AA 1Q0NA 4RW8A 3CIZA 1X4FA 2CA9A 3QPIA 2BA9A 1CJUA 1S72S 3ISNC 1YRTA 3NGKA 1KD1T 2W7OA 5ETMA 3DRSA 4EFAC 5EWGA 5HVHA 1JNZB 4TLRA 2DK2A 4UF4A 1NRKA 2RDIA 1FVQA 3M32B 4CYUA 2ZH4A 4CLFA 1FD8A 3BV8A 3GFXA 3OTCA 2JEJA 4RUBA 5EN1A 1FWLA 2HBYB 4U7UD 3B6BA 1H73A 3IA0A 2HFZA 2XSFA 1XQIA 1WI8A 4O3QA 3CCJS 4DFJA 1Y9OA 5HK4A 1X31C 1NHUA 4WK1A 4X62J 3OUYA 3AQPA 2HFOA 3KJNB 4DX6A 2FLPA 4O3OA 2B9EA 4DZDA 3K58A 2Y9HA 3LAKA 4ERDA 4ZVGA 2MPUA 4CH1A 3PJXA 2HYIB 2PFFB 2ZM6F 3MHYA 4PWDA 1HWKA 2JLGA 1NB2A 3SCJE 4HKQA 5ETPA 4C8YA 2GA7A 1N6QB 1S49A 1OS5A 3CUNA 3KLFA 2CPFA 3LGMA 4KGZB 2ZNYA 2BXJA 4NRUA 5E2QA 5KG2A 2FIUA 2R9LA 1MLAA 4USTA 3T1YJ 4LMZA 2RH3A 3HD1A 4M63A 1BQNB 4HI1A 3G8SA 2M70A 2R8HA 4NCBA 1CQMA 2O3DA 1WHXA 2V4QA 1RSCA 2BE9B 3T6BA 2HZVA 4F7VA 2BKOA 4UOGA 1VQ6S 4WZMA 1UPMB 4K4VA 4HH0A 5KFJA 2MY7A 3H98A 2HS3A 2IA6A 1EQMA 2V9WA 4NXNF 2MLYA 2XHCA 3DLEB 4P6QA 4FNHA 4GVLA 2IM1A 5T41A 4OHWA 4P7TA 4O4GB 5G4DA 3PZPA 1YIJS 1RABB 3NNHA 3MF5A 3TRGA 4PCQA 1KKHA 1WSVA 1VRTB 1EKSA 3UN2A 1W2IA 5D4LA 2MB0B 3I56S 4FYDA 4IO9Q 1YBAA 2GNKA 4EEYA 1WG1A 2QYCA 1GK8A 4HT7A 1KWMA 4U7CA 2VFTA 1W25A 4LQ3A 1XK8A 2HWHA 3GONA 4NZ6A 1JXEA 5CH7B 3VR1A 2FVPA 2DNOA 1X9MA 2WCXA 5A2QU 3W63A 5ETVA 4CNZA 3FGVA 1VQ4S 2RS2A 3MMAB 1RISA 4YMEA 4WKRA 4B9MA 4DWIA 3PYEA 1N6QA 3NNAA 3K17A 1F6TA 1TV6B 2OPPB 3CD0A 1PYSB 2HFNA 5KT2A 1GH8A 2CFXA 1KRPA 1RACB 4DV3F 1KLMB 2XSJB 4EGLA 1YJ7A 1G4CA 5KFPA 2LEAA 3SBMA 4DV7J 2WBRA 4ZVRB 3QQCD 3BGFA 2YKAA 4IOBA 1PJ6A 1RU1A 1D0EA 3H8YA 5AXLA 3MUVP 2W4CA 5KT5A 3BDPA 4QIGA 1S76D 3O5TB 1IR0A 3B82A 5LT5A 3IRWP 4O44B 4KJIA 2BDPA 1R8PA 1XERA 3HHDA 5AT1B 5KFAA 4M94A 3DLEA 3Q89A 3ZZYA 4B9UA 4PXCA 3UCZP 4N8NA 3ZTOA 2MDAA 1SH3A 1FRMA 4O4GA 4DPXA 2BJ9A 3CDUA 2W25A 1MMNA 3AOCA 4U8VA 4HT5A 3SIPB 4OX7A 4AL7A 2AGPA 1VRTA 2UUBF 1A9NB 4K59A 2K8GA 3LPYA 3H5XA 5EGYA 2L9NA 1WC0A 1C0UB 2EFVA 2IVMA 4Z7CA 4KB7A 2G2ZA 1M5PC 2KVQE 5D3GB 3KJFB 5KAKA 2ZKTA 5EX0A 2GCFA 2RU9A 4F25A 4J9PA 2GIQA 2D3UA 1NDPA 5EWEA 3MCOA 1PIEA 4PQAA 3LWLA 3GILA 4M5GA 2NPFA 2AX1A 1VQSA 3NCPA 4DFPA 5J2QB 1RTIB 2MHEA 1AA1B 3A4TA 1S59A 1BLUA 3I31A 1JB0C 2B56A 3MR3A 2OPPA 1IBMF 1Q78A 4DR3J 2HS4A 4L73A 4ECTA 3MM9B 1B64A 1GT8A 2XSJA 3CCTA 4PG8A 4L76A 4LBIA 1HIYA 2GHPA 4XTTA 5FLXU 4ED4A 2E1PA 3HVRA 4WXOA 4Z7YA 3IWLA 2GAHC 2CXEA 1CEZA 4JI1F 4USVA 4KSEB 1MWQA 2DR6A 3R5CA 1WTFA 1RZMA 2R2TA 1RAOA 4FZVA 4XIUA 4U96A 5CXTA 4IYQA 4O44A 2LQ9A 5LOQA 3ENVA 3K89A 3TQEA 4JI6J 1SC4B 1WTBA 2OPSA 2Z58B 4KHRA 4NYPA 1RT4A 2HIYA 3I6PA 3QWPA 4DQPA 3PEJA 3GG0A 4YHHF 3W1YC 2QA4G 2GMHA 4ICLB 3KNAA 2HQIA 4WFAQ 3MR5A 4CO0A 1OPIA 3MMCB 2MQMA 2QN6B 4J7CA 4RZRA 1C0UA 2KFZA 2XWYA 5DZ6A 2BR0A 4B9SA 2R7XA 3VALA 3QIPB 3M9MB 3V4IB 1N54B 3JQKA 4LBHA 1HNZF 3N28A 5B0EA 1SUQB 2XQCA 3AA8A 3QFWA 1J2VA 2KRRA 1RWXB 2NUHA 4RNOA 4TU8A 3DDKA 3RB0A 1WUUA 3R5AA 3CEDA 3MD1A 4BWMA 1H3DA 4ZN3A 2OSQA 5CYMB 4AXJA 2YTCA 4RBUA 3D3CJ 3IXQA 1KOOA 2DGTA 2V68A 1VRUA 3U1NA 5EDWA 3GU0A 5J2QA 3QGHA 1RTIA 2WAQD 4JI2F 1IVZA 5U47A 1B0VA 2UVWA 2JJ4D 6FD1A 1IN0A 3TO8A 1M1GA 1FXLA 1U6BA 4Y2CA 3QAEA 4HTIA 1NPKA 4X64J 1ZZFA 1RA7A 1NJXA 3MI7X 3WC2A 4DV1J 4KFBB 1X4AA 2ZH2A 2R8KA 4QR2A 5IQQA 3HFZB 4B9NA 4LF5J 3FDSA 3M2UB 4OZLA 1N52B 3BB5A 3BSNA 2BYCA 4DL2A 4DV6F 5M2PA 2QMWA 5KT7A 4DV0F 2XEXA 4NEYA 4IG0B 3E51A 2IC3B 3FUYA 1HD1A 1RTHB 4DL7A 1NDKA 4I6YA 2DNPA 3R2CJ 3CNQP 2FJWA 1T11A 2CJ9A 2XM3A 4I64A 4N56A 1S5ZA 1VDHA 3H7HB 4JBCA 4OZNA 2CPDA 2GQ2A 1KEKA 3LA0A 4ELUA 1ZOTA 3KWMA 4A47A 3NOCA 2FHJD 2WONB 1XMQJ 1N33J 3D28A 3ITHB 4ICLA 4YR0A 1IBLF 1FK9B 1M5KC 3DGVA 3MMCA 2GJFA 4F0HA 4PKDB 4K4YA 2FLLA 2DXFA 1JJHA 5I42B 2K7KA 2ZJPQ 2YKQA 3QIPA 4ES3A 4UY8T 2XMJA 2DR7A 4K5SA 2QTWA 1DZ5A 2RQCA 3BDEA 1NB7A 1SUQA 3D1QA 4FS2A 4I6AA 1WOOA 1FNOA 4CM2A 4P2MA 1HLWA 4PG6A 3CCZA 2BKNA 5L38A 1RLDA 4LF9F 1M5SA 2E7WA 3OR2B 1VQKS 5E7OB 5CQGA 3DXSX 1TAUA 1MWYA 1WC3A 4H54A 1T8EA 4USIA 4TN2A 8ATCB 4KAIA 2APOA 4P10A 2IDEA 3HKWA 2XULA 9RUBA 3AB2B 3IR5B 2ZUAA 4KFBA 2OD6A 4Q8FA 1OWXA 2CDQA 4WU3A 3D9BA 3TANA 1SC1B 3TJAA 3KDNA 5GMKa 4FVCA 2HQCA 3LUYA 4OX9F 4EU0A 3M2UA 1IXKA 3ENWA 3K5OA 3PNIA 5DDPC 2Q6CA 4JI3J 3UE2A 3A1YG 2IC3A 1RTHA 1SJ1A 1UVKA 3HHEA 3CTRA 2UU9J 3PX6A 2J0WA 4NI2B 2UVRA 1KLNA 4CNYA 3L9ZA 2XO6A 2VFVA 5KOWA 4OZ2A 3TZXA 1PKUA 3CJ0A 5JXSA 2EFNA 1R6VA 2XYGB 4H4OB 4OZ5A 4N77A 2HHHJ 2WONA 3UFCX 4XPEA 1UTAA 1WKKA 2G1HA 3ITHA 1DTTB 1FK9A 1O8BA 3PX4A 2DGQA 1NNDA 3CDWA 4MAKA 4A46A 5G0RB 3UO0A 3PHTA 2RQ4A 1D8ZA 1XNQF 5I42A 3EYZA 3RBEA 1BQXA 1Y4ZB 3QJLA 5KFVA 1UVJA 3PTWA 1NMEB 2V4JB 5E3RA 3ILLA 1AB8A 2YXLA 2OTLS 3HMJG 1FWPA 2D3ZA 1WC5A 3S8SA 1REGX 1FJGF 3EGVA 1T95A 1VYAA 3PACA 2R2SA 4HHUA 2VPZB 2E1RA 1T94A 1VFJA 2CJQA 3OR2A 2BQ3A 3K2YA 1KONA 3HHLB 2ZOGA 1O0PA 3KYLA 2CPZA 1T9XA 9ATCB 2K7JA 2X1BA 3RW6A 1S7IA 5CCLA 1VI7A 2BJEA 5K8PA 4OX6A 2KL8A 4NA1A 3IN5A 5D77A 2CPJA 1N88A 4X65F 3NS7B 3JB9k 3IS9B 4E0DA 1OYEA 4YDDB 1LWFB 4LUBA 3N5FA 1I5OB 2E1MC 3C14B 2OMLA 4DEZA 3JTPA 4LRDA 4NCAA 1UJ4A 2OI2A 2OFGX 1X5OA 4WCEQ 4RPFA 5H9FJ 5HN0A 3UQSA 2YH1A 2DHGA 3LH2S 1S9EB 5DLGA 5LSLA 2GO8A 2VFUA 3C66A 1WKJA 2E5HA 3H2UB 1N4LA 3R7BB 3M4XA 4NI2A 2VBXA 2HHSA 4RR5A 3KJVB 3ZXWA 4QJVA 1NKCA 3AB4B 2QO3A 1SH2A 3HT0A 4K4SA 3DFEA 2F8EX 1B0PA 4IFVA 2ROEA 4ZLJA 1UETA 5C25B 1P9YA 1HW8A 5F9NA 1DTTA 2MJNA 3VWSA 4USUA 4J37A 4F67A 3FBFA 1RHKB 3D67A 4BBYA 5G0RA 4ECQA 2A6OA 2WHOA 4DXLA 4AFFA 3V6DB 3HLUA 4IR9A 5GAEU 2ZHAA 3PW5A 1H2UX 1R0BG 2DRAA 1FRXA 1JX4A 3C19A 2GVDB 2DVIA 1O51A 2NSCA 3HHLC 4DG1B 3RB4A 1WHVA 2KFYA 4ZVHA 1NJIT 1FJCA 5HMZA 1ZM4A 4CCHA 1X8DA 2HFUA 4CWBA 3LGHA 3MDFA 2V9KA 2Y0BB 4GMKA 4WJBA 4CIOA 4ECVA 1OIAA 2IRXA 1U26A 4Q0BB 4UZBA 3EPIA 4I0WA 2RDDA 4NLSA 5KFGA 1WC6A 2UUWA 2KDOA 1NK9A 4URQU 2D7SA 1EHWA 2E29A 2HWIA 5ETQA 1Y5NB 3IS9A 4LF7J 3U1LA 2UUCF 3MEKA 4F04B 3NP5A 1N36F 2JC1A 3PYGA 1LWFA 2QYGA 3U7JA 1Q79A 1HBOB 5LMNF 2DD8S 2OP5A 2EXUA 8RUCA 1RWNB 2FC9A 4X4PA 1RTDB 1VRQC 2J9CA 4G65A 1QAJA 1Y5IB 5DJBA 4JI8F 3UN3A 1FKAF 4ED5A 2UVUA 3KOAA 1NK7A 3KUGA 2LU1A 4EUVA 1S9EA 1RBAA 1GTHA 2NSBA 2NXNA 3MAQA 4MMOA 2AJQA 2ASLA 2G1DA 4ZJQA 1QD1A 5KFRA 2C42A 3KJVA 4LR8A 4KR0B 3A8EA 1GQEA 2HZCA 2D9PA 2HHXA 2RS8A 1SVDA 1RGVA 3IAM9 1L3TA 2HG4A 1ZTTA 1QAIA 2J6TA 4R0EA 4LT6A 1NHVA 2HHWA 4DLGA 3TVKA 1SKUB 4EMDA 2A3JA 4KGMA 1QTMA 1OSCA 3GSDA 4IOCQ 3I4HX 3RUBL 4OI4A 2Z2MA 1TL1B 4DS4A 4OYZA 1UFKA 4X4SA 3HFKA 1B0TA 2LMIA 2QMUB 1JLEB 2HQGA 2GIFA 5GMDA 2MGZB 5GADI 3TUIC 1S4FA 1DTQB 2KM8B 4DG1A 4M5DB 5DGBA 3J81U 4ZK7M 1F9EB 4NLDA 2M9KA 4AE5A 3MTKA 1WKLA 1UVNA 2ASDA 5SUHA 4A8KA 1AROP 1VMBA 1LW2B 4CLKA 1CJTB 4NLRA 2ROPA 3D54A 4K50A 2PO4A 4Q0BA 3WIVA 4KQZA 2MQOA 3DRPB 1R8HA 3DOLB 3B54A 1V6HA 3G6VA 1TL4A 3I0RB 1XNRF 2C3MA 4EBEA 2ADBA 3HULA 2V94A 4YR3A 1UWAA 3OVBA 3CJ4A 2AJ0A 2Y3YA 4WP9A 3FEXB 4JI4F 1HBOA 1AUDA 1VIOA 2QRRA 5KG0A 4JYAF 4J9MA 4FKXA 2B6AB 3FSIA 5SZTA 4DL5A 2C3PA 4Y00A 2ZFHA 3IBFB 1PJ5A 2CPYA 1RAEB 5BR8J 1N5YB 3AOAA 1YBTA 2CQDA 2ZBCA 2UXDF 4FF4A 4GO5X 4LIWA 4WP8A 4D3HA 3U02A 3KHGA 1RHRB 4A8FA 3MFHA 5GAHU 2KTQA 3UN5A 1YSJA 2DNMA 1IKVB 5L9NA 2GQQA 1RK8A 2AIRB 2HHQA 4TXSA 2ZJRQ 3CC2S 4QR1A 1NK8A 4CT8A 5KFFA 1HNVB 1UVIA 2DJWA 3M8QB 4DV2F 4NLXA 2CQBA 2FVRA 2KN4A 5K8NA 2QSWA 4RNFA 3GWCA 3OFHA 3CCSS 1WHYA 2KH9A 4WIIA 3W9JA 4LIRA 2W2NP 1YJUA 1ZYQA 3P5BP 5KFZA 2KM8C 1HBMB 2NPIA 1U7LA 1N0VC 4PUOB 2B8QA 1XR5A 4NLOA 4RNNA 3QJJA 1TL1A 4CLZA 2GZOA 1GMUA 2JX2A 3MMBB 4ECRA 3NMRA 5IZHA 1JLEA 5KFCA 2V2KA 2XC9A 1DTQA 4M5DA 2I1RA 3GB0A 4FPIA 2IBKA 1IQTA 3FK4A 2E5GA 4O3SA 2XMWA 1VQOS 4IR1A 2CQ0A 2DH9A 1LW2A 4BLGA 2OAUA 3NY0A 1CJTA 1RWMB 4CLPA 1H38A 3IBCB 3DRPA 3DOLA 4JV1A 3QYYA 3I0RA 2CAJA 2OGUA 2R7UA 1M90T 2L41A 3QBCA 5KFHA 2N7YA 1ULRA 2VH7A 2B6AA 1VQNS 4ZCIA 1RLCL 4QZVB 4I4BA 2C3OA 1WNEA 3PJ9A 2HQ3A 2OTJS 3OD2A 3V81A 4NPOA 5CABA 2V2VA 2J0XA 1ZA1B 1N5YA 1JJCB 1S0VA 1N56A 1SJQA 1SIWB 4A48A 2EPIA 1RYSA 3MAHA 4ECXA 2RKIB 2MKKA 3TX8A 2AV5A 3I96A 4KPYA 3N79A 4ZVQB 5IFMA 2DNZA 5C42B 3VGTA 2FB0A 1CC8A 2ZOFA 2X1GA 4J9NA 3M8QA 3CCWA 4ELVA 1PBAA 4ES2A 4ZA1A 3I9V9 2E5JA 1T03B 2P6TA 4CM0A 3GTYX 4XDCA 5C24B 1P6TA 1VR6A 1HNXF 4DR5F 1OYDA 4AUKA 1HBMA 4PUOA 1WF1A 2MKIA 5B08A 4Q8EA 4JB8B 4HLBA 4J9QA 3MMBA 4NYOA 2KHDA 2W8LA 1SJFA 1S9GB 4FN5A 5H9EK 2AX0A 5HQMA 1N34J 3ILJA 3IWNC 3EMTA 1NM2A 5KFYA 2JL9A 2ZHBA 1OY6A 2EFGA 5L39A 2QX0A 2G4BA 4LF1A 2ZITA 1HBUA 2UZAA 3T9ZA 5IT4A 2YKPA 2HVIA 4YB7A 4DMZA 4LF8J 4RUAA 1HFEL 3BSAA 3ZZUA 2E66A 2LEBA 2PD1A 2LQBA 3CE8A 3M6WA 1QSLA 3K5PA 2VOOA 3I5BA 4LFCF 1UZHA 2CZVC 1RAJA 2OUGA 2YH0A 5ADZA 3H0PA 1HW9A 5F8IA 2GHWA 1Q7LB 4DUYF 2P8IA 4W92B 4IDKB 2FVCA 2IRUA 3HT3A 1TZ0A 2XCAA 4WZQA 2HHVA 2FHJA 3OFFA 2RE1A 1VBYA 3M05A 1PC5A 3LQVA 3G6YA 4ECZA 4CLUA 3TUZC 1Z2ZA 2DR9A 2CVEA
chains in the Genus database with same CATH topology
1HMVA 4P6QA 4JV0A 4FNHA 4RW7B 2IM1A 2UXCF 5T41A 1YG0A 3DMJB 4OHWA 1DQ9A 4P7TA 1L5UA 1S1TA 2WSEC 2RKIA 3UDLA 5A2QY 1Q81T 3E2EA 4O4GB 2ILYA 5G4DA 1Z1ZA 2BRLA 2C28A 4K4TA 2MZ1A 3PZPA 2OMOA 3SCKE 1VOMA 2MYFA 2AW0A 3N5BA 5E3CA 1YIJS 3NNHA 1R7IA 3MF5A 3CJ5A 3R27A 3TRGA 1C4CA 3M1VB 3JSMA 4C7QA 2JFKA 4DQQA 4PCQA 5A8WA 2YKMA 5A6WA 5C42A 4TY8B 3KTQA 2ZHOA 2AYMA 1DURA 2VKRA 4UOCA 1VRTB 5C25A 3KK3A 2Q66A 4NX9A 1W2IA 5KFIA 2AJ4A 5D4LA 3MMJA 1FRHA 4YB5A 4DN9A 2ZDPA 3U1MA 3PW0A 1TFYA 2MB0B 2CRLA 4I69A 3I56S 4X66F 1SL0A 4FYDA 2GJ2A 4IO9Q 4NLGA 1WEYA 2MSSA 4MK8A 5ITHA 2V8DA 1YBAA 2GNKA 5C24A 1LKZA 4XO0A 1C0TB 4EEYA 1H0HB 1WG1A 2OSRA 2MY8A 4N47A 4WFYA 1FDBA 1F5AA 2QYCA 4FF2A 3V6DA 3Q0AA 4HT7A 5F9LA 1FRJA 5IWAF 1ZTWA 4U7CA 4LSNB 3K8WA 2KXNB 4NCGB 2VFTA 3IG1B 3RRKA 4B9TA 3TYTA 1W25A 4LQ3A 3HHKA 1XK8A 1XMBA 4YEAA 4IOAQ 1BC6A 2HWHA 4KTQA 3N4WA 2W9AA 1BQMB 2CQ1A 2FD2A 4NZ6A 1JXEA 1X0PA 3JYTB 3POTB 5CH7B 2YNIB 5KFLA 3VR1A 2FVPA 3RBDA 4RUHA 4C0HA 1TK5A 2DNOA 1S9GA 1FNXH 3NRBA 3HPOA 1X9MA 2A2CA 1IKYA 1Y3JA 2WCXA 1HARA 1HD0A 4NWBA 3DI6B 4DQIA 2IA0A 4A8WA 3M6VA 1QUVA 1U1PA 4B3SF 3FCHA 3ZZ0A 2ABYA 1M5HA 2B4UA 3ZZRA 1DRZA 4CNZA 3I82A 3M2VB 3BS9A 3FGVA 1ZAWA 1R8CA 2BJDA 2J0SD 4YOEA 1YJTA 1VQ4S 4JUZA 4RNHA 5J1PA 3DGPA 2RS2A 3MMAB 1RISA 1J5OB 2BANB 2LEPA 2XY6A 3Q2TC 1GNKA 4YMEA 4WKRA 3NAIA 2HLUA 1PILA 3PW2A 4B9MA 2DCUB 3DLJA 3TR5A 4DWIA 2QLWA 1F2GA 1N6QA 3NNAA 4J9RA 5DQHA 1TKZB 4I2PB 4IO1A 4OHYA 4MIBA 3H5SA 1TV6B 2OPPB 1V3SA 3CD0A 4ATNA 2C2DA 2NXUA 4QW8A 2HFNA 2CPIA 3ULHA 4ZMMA 3PO5A 4LF7F 5K8OA 1C2PA 3EXCX 4ITSA 5KT2A 2CFXA 4I7FB 1GH8A 3ONQA 1KRPA 4DV3F 3I5CA 1KLMB 4G1QB 2XSJB 1FT8A 4MKBA 4EGLA 4YP3A 4DL6A 4WTYA 2MZJA 5KFUA 1FRLA 5KFPA 4Y2MA 1RQ0A 3MEDA 2LEAA 1DLOA 2PSZA 3HVAA 1LWEA 5BYSA 4D3GA 4DFKA 5E41A 3T1YF 2D3OR 2VA2A 3NS5A 4C8ZA 1TKTA 2N3OA 2XHWA 2WBRA 4FXDA 1FF2A 1HI1A 3G86A 3OTOF 2AJ1A 3CJKB 2Y0SD 5GAGU 2P9GA 3BGFA 2YKAA 3NMAA 1YRUA 1YJ9S 2IVFB 4IOBA 3AY0A 4KHMA 3R1HA 5I4MA 3TOQA 5HL7Q 3M8SA 1RTDA 4CH0S 3MUMP 3KMQA 1VJWA 2R7VA 3DM2A 1D0EA 3HX9A 2ZOMA 3AQOA 3M30A 3H8YA 2AP6A 2AYGA 4MKYA 5AXLA 3O3LA 4IDKA 3MUVP 4B02A 2RRAA 1RP5A 5KOXA 2AU0A 2W4CA 2DGOA 4IFYA 5KT5A 4QIGA 3BDPA 1SV5A 1WG5A 2Y1JA 3J7YU 4B3RF 5DQGA 1TKXB 2CVIA 1Z4UA 2Q3PA 1FA0A 1S76D 3O5TB 4WFXA 2DNHA 2XG8A 3KLHB 3UI3A 1IR0A 2CKWA 4GC7A 3B82A 3C6UB 5LT5A 5H9EJ 1K73T 3IRWP 4B3TF 4O44B 2KO1A 4X2BA 4KJIA 1SI9A 2BDPA 2DHSA 1R8PA 7FDRA 1SC6A 2IFXA 2DH8A 1DARA 2R7OA 2DR5A 3EX7B 1XERA 3HHDA 3OPKA 3KK2B 1M0SA 4Q2LA 2HNYA 6FDRA 5L8RC 1JLGB 5T7LA 1S97A 2DHXA 4PXBA 5KFAA 4M94A 4I67A 5D78A 2XMUA 3DLEA 3ZZYA 4B9UA 4PXCA 3LALA 3UCZP 2QV6A 1WELA 4N8NA 4RW7A 2XNQA 3VF0B 5KG7A 3DMJA 1UP1A 3JSYA 4F8RA 4RLEA 2MDAA 1SH3A 1FRMA 2DISA 4O4GA 1S77D 1M5VC 4OZ1A 4IKAA 4K4WA 1MNEA 1OSDA 2QE5A 3HI9A 1WEXA 3CDUA 1LXNA 1MMNA 2W25A 3RR7A 1JJ4A 4HT5A 3SSQA 4DL4A 5BJRA 4OX7A 1NJZA 4IFVB 3M9OB 2MQQA 4AL7A 4TY8A 4FS1A 2AGPA 2DGUA 1VRTA 3NCQA 1ROFA 4GC6A 2UUBF 1A9NB 3PY8A 2FJDB 2I9SA 4K59A 2K8GA 1BGXT 3LPYA 4RX6A 3H5XA 5IQ6A 4B9VA 4I56A 1A7GE 2UUTA 2B4OA 5EGYA 3H5UA 2L9NA 2LVWA 2FJAB 1X4CA 1C0UB 2EFVA 4NL5A 2JHEA 4DDFA 2IVMA 2VZ9A 4B3OB 4NOHA 4Y2KA 4KB7A 1C0TA 1M5PC 2ZD1B 2DNYA 2DNKA 3CPWR 2GMJA 5AXMA 1S1UB 1FEEA 3H59A 4CTAB 2OFHX 1AW0A 1V9OA 2VG5B 4KRWA 2JDJA 5D3GB 2K1RB 1UEVA 3NNCA 2ROGA 4JI7F 4LSNA 3PVXA 4NCGA 1C4AA 1UW4A 4FPRA 4O23A 2C2EA 3IG1A 5KAKA 3Q8PB 2MGZA 4OX8A 2ZKTA 5EX0A 1Q16B 1U47A 1VBZA 3OW2R 3FJ2A 1UVMA 2GCFA 1BQMA 1IKWB 2DO0A 2V0NA 1BWEA 3JYTA 3POTA 2YNIA 2DNRA 2RU9A 4OLPA 5D4OA 4W90B 4F25A 4TKTA 4J9PA 2GIQA 1L3SA 2D3UA 4X4OA 4CZCA 1APSA 3DI6A 4QU6A 3KLEB 5EWEA 5HQ8A 1YJRA 2UVVA 4PQAA 3LP0B 2YY3A 3PV8A 5DM7Q 5KG1A 1TL3B 3LWLA 3M2VA 2NPFA 3GILA 2AX1A 2MMYA 3P49B 1VQSA 4HDGA 3NCPA 3QJJA 4DFPA 4ETZA 3ENQA 4I6WA 1GXUA 1KQFB 5J2QB 1WACA 1J5OA 1RTIB 2BANA 3T1AA 3PO4A 5C5JA 1K0TA 2ZVSA 4UY85 4ILRA 3UD4P 2Q1LA 2AYEA 2MHEA 1H7XA 4IG3A 3VAIA 4FBTA 3BSCA 2Z2LA 3CCLS 5A0YA 5DLFA 1HR0F 1RT3B 2CYYA 4ED8A 1BLUA 2M4MA 2WSCC 1CLFA 3I31A 3VAFA 1RJJA 1JB0C 1LWCB 1TKZA 4I2PA 2B56A 3MR3A 4OHXA 2XY5A 1RI7A 2OPPA 4RKUC 2RILA 3V6JA 2BV3A 2WSFC 1IBMF 1Q78A 2RRBA 2VQFF 2FJXA 2DNLA 2HS4A 1CSJA 4Q5VA 1H7WA 3PEHA 1NU4A 2HNZB 2EK6A 4ECTA 3K8VA 4I7FA 1V3ZA 2MKCA 3CJ2A 1ZAXA 3MM9B 1P27B 5CD4H 3Q8RB 1B64A 1Q8IA 4NMLA 4NLUA 4BHQA 4Z37A 1GT8A 2XSJA 3CCTA 3SEOA 4PG8A 2AD9A 4KE5A 3KMSA 5DDQC 1PC4A 2GV1A 1N5TA 5KT6A 4ED2A 2RQKA 2AGQA 2GHPA 4JOUA 3L95X 2V8VA 2LLZA 3X1LB 4LJMA 3PR5B 3TAQA 3HVRA 3HVTB 5GAGI 3SSSA 4DR4F 1FKOB 2C3UA 2OKQA 4WXOA 1ZBTA 1U48A 3LGNA 1F0XA 4F4YA 3T5KA 3IWLA 4ED0A 1XR6A 3CJKA 3W2WB 1CEZA 4JI1F 1S0OA 1NK5A 3CO9A 4DN0A 3FNNA 4ZP9A 4E8UA 4V19X 1DQAA 5LL6d 4FXVA 4KSEB 2KT5A 2FVQA 3SI8A 1RT5B 3J7YI 2CG4A 5EHHA 5BR8F 3R5CA 3M6XA 2D41A 1WTFA 2IMWP 1FJEB 1D8YA 1HQEB 3DHWC 3OVSA 1KFSA 3OFGA 4GKKF 4OQJA 1TKXA 1X7VA 5EUHA 4Q43A 2G13A 2R2TA 2ZKUA 1FJ7A 3KLHA 3CCVS 2M0GB 3N6MA 4FZVA 2YWGA 4XIUA 2PMZD 5CXTA 4IYQA 4O44A 2YNHB 2LQ9A 2GMLA 3ENVA 4Q45A 3T5JA 2JVOA 5B0CA 3FFIB 2B5JB 3K59A 3KK2A 1IKVA 2L08A 3V6HA 1JLGA 2ZH3A 3G96A 1TUVA 3TVYA 3I0SA 3FSXA 4NLPA 2YKNB 3R5BA 1WTBA 2LA6A 1ZM3A 1JLQB 3RRHA 1JLCB 2OPSA 3K5NA 3JSBA 3DNCA 4KHRA 3Q2SC 4NYPA 1HNVA 1RT4A 3I6PA 3QWPA 4JI0F 3SDEB 3US5A 4DQPA 2DGWA 1RTJA 4MYTA 2XGPA 1FXDA 3PEJA 3PDNA 3GG0A 4YHHF 1VGYA 2EFOA 4QW9A 3WC0A 2QA4G 2XS5A 2KJWA 3OJSA 2GMHA 3HZGA 4DV4F 2BRKA 5H1SV 4DFMA 4LFBF 1VQ5S 3IR6B 4ZVEA 4ICLB 3PX0A 3KNAA 3HVWA 4FF3A 2HQIA 4WFAQ 3BF4A 2KYXA 5DGAA 1ZPVA 3MR5A 2CPEA 3NLCA 4TQRA 2XLIA 4MK9A 4H4KC 4CO0A 1OPIA 4ZPBA 2IM3A 3MMCB 2MJUA 3ZC4A 2MQMA 3SSRA 5IM0B 1HYSB 3OL9A 4X4VA 3DRRB 4RZRA 4UQTA 2DITA 1C0UA 3K5MA 3BQ0A 2CQGA 2G9OA 5THWA 1XMOF 2XWYA 4B3OA 3IR7B 1W2BR 3MR2A 4X4TA 5B0DA 2BR0A 4F3QA 4B9SA 2Q6BA 2ZD1A 1Q8LA 4BCAA 2R7XA 4QOTA 1S1UA 2ZNZA 3L7PA 2MKJA 3CGIA 4CTAA 3VALA 3QIPB 2E1CA 1C1BA 2E9RX 1QM9A 2VG5A 3KK1B 3IAS9 3M9MB 1SKRA 3OL6A 1N54B 3V4IB 4AYBD 5J2PB 2K1RA 2RB7A 3M2RB 3OQ2A 1HNZF 4LFAF 2HW3A 2B0GA 1ZPWX 4ZVFA 3N28A 2LQJA 1HWUA 5B0EA 3U27A 1SUQB 2OJ3A 1QAXA 2JEGA 1MU2B 1VK3A 3ISND 3AA8A 1J2VA 2KRRA 4H4KA 1KTQA 3T1HF 1FEHA 2KRBA 2NUHA 4C8LA 4RNOA 1IKWA 4TU8A 3E8OA 1ELOA 3DDKA 4I1TA 2ZH8A 1E6VB 2MSTA 4FXWA 4RWXA 2C3YA 3RB0A 4DS5A 3R5AA 4EBCA 1TK8A 5F8HA 3CEDA 3JSRA 3MD1A 4BWMA 4ZCKA 2EVZA 1MROB 1H3DA 1QUPA 3KLEA 2OSQA 2VQEF 1NK6A 5CYMB 3C8YA 2VBWA 4AXJA 2YTCA 4RBUA 2WTFA 3LOUA 4O3NA 4ALZA 3G71S 3IXQA 1KOOA 2DGTA 1JJ2R 1U49A 1VRUA 4FNIA 4ZOSA 3U1NA 4DSKA 5EDWA 3PIOQ 5J2QA 3QGHA 1RTIA 3JTNA 3PHEA 4RW9A 2WAQD 2IJFA 3THTA 4JI2F 3FZ2A 1R89A 1KQGB 5U47A 1B0VA 2UVWA 1RT3A 2JJ4D 6FD1A 5F3TA 1UVLA 2RT3A 1IN0A 3IGVA 3TO8A 1NJYA 2OD4A 1FXLA 1U6BA 5F0UA 2IM0A 2KU7A 3VTIA 5DETA 3DHXA 1LWCA 4Y2CA 3QAEA 3KLVA 4EZ6A 4ZP6A 4HTIA 5LSRA 4RNMA 1HNWF 4DSJA 2BOPA 3GMGA 1LK5A 4ZPTR 4DF8A 1X5TA 1ZZFA 3PM9A 4DR3F 2EBEA 1RA7A 2FJVA 4DX8H 2RSQA 1NJXA 1WG4A 3CIMA 3MI7X 3WC2A 2HNZA 2YWHA 1U1NA 3TUJC 5HO4A 4K4XA 3RAMA 1X4EA 5FIIA 3IBWA 2XMMA 3HHLD 5MAOA 4KFBB 2E7XA 1YHQS 4ZPAA 3FRZA 4O4RA 1N32F 1TQLA 1X4AA 4DL0C 2ZH2A 2W7AA 2R8KA 4QR2A 2RJZA 3HVTA 4Y2IA 2VBZA 5IQQA 2EK1A 1IJEB 1PO6A 1FKOA 3F44A 5B0GA 3IFEA 4B9NA 4QPXA 3FDSA 3T6JA 3M2UB 4OZLA 3W2WA 3GYXB 1N52B 3BB5A 3BSNA 2BYCA 3GZ7A 4DL2A 4DV6F 4K4ZA 5M2PA 2QMWA 1R0AB 3QO9B 3MEGB 3CJ3A 4Q44A 4F2RA 4OIXA 1UFWA 5KT7A 4DV0F 1K9MT 1VQ8S 2XEXA 5CA5A 4MH8A 1QAYA 2XI3A 4IG0B 3H40A 1RT5A 3E51A 5E33A 2IC3B 1LFWA 1EETB 1HPZB 1HD1A 1RTHB 3CCQS 3KG1A 2NR0A 4DL7A 1HQEA 2B4VA 2RUGA 3I87A 4Y2AA 4I6YA 3H2LA 5F41A 3KHRA 4C8MA 2DNPA 2J9EA 4R5PB 2HAIA 2I38A 5B0BA 2FJWA 2YWEA 7FD1A 4QU7A 2FC8A 3E01B 3OR1A 2YNHA 2CJ9A 5EX3A 4DR7F 1QY7A 4I64A 3FFIA 4N56A 3VZHA 4OJGA 3G4SS 1SKWA 4HDHA 2BACA 4KC5A 3PFOA 1NZAA 3NG8A 4JBCA 4OZNA 2F3JA 2CPDA 2M8DB 1TR0A 2B7CB 2M2BA 3M32A 3N01A 4F3OA 2GQ2A 2YKNA 2N82B 1KEKA 1JLQA 4ELUA 1JLCA 1ZOTA 2J6SA 1RT2A 3H2VE 3MM7B 2QA2A 3SDEA 2KXFA 4N76A 3KWMA 1NK4A 3LP2B 4BS2A 2EW9A 4A47A 4B17A 2FHJD 1T03A 2WONB 3EXYA 3N0VA 1S0NA 2KI2A 2WOMA 1SJRA 3H5YA 5F3ZA 4PQUB 1F5BA 2HMIB 3CD6S 3D28A 4URGA 2UP1A 3ITHB 2CPXA 1NJWA 4ICLA 1HWJA 4MJKA 4YR0A 1IBLF 1FK9B 4OI2A 1M5KC 2PA8D 5AXNA 5J1EB 2J6UA 2IHR1 1Y5LB 2B51A 5HLFA 4MFBB 3I32A 3MMCA 1HYSA 5IM0A 3GQCA 2CQCA 4PKDB 3DRRA 4K4YA 3TNVA 2FLLA 2OO4A 1NH7A 4DL3A 1YJNS 1JJHA 3AJ2A 1HQUB 4RBVA 5DRKA 4I2QB 4PPZA 5I42B 2KXHA 3B4DA