4ES2A

Double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
84
Chain Sequence
b'HMMLVLITYDVQSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLGYTKVEHIGAKPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0342 protein
publication title Double-stranded endonuclease activity in Bacillus halodurans clustered regularly interspaced short palindromic repeats (CRISPR)-associated Cas2 protein.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 19
structure length 84
sequence length 89
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4es2A00
4MYTA 5G4DA 1FNMA 1ZPWX 4QR0A 4ES3A 4TNOA 3B78A 3UI3A 2BV3A 1DARA 1ELOA 4ZCKA 1ZM3A 2I8EA 3LH2S 2WBMA 3EXCX 2L9NA 4ZCIA 2I0XA 4QR2A 4M1KA 4MYUA 2XEXA 4MAKA 4ZCMA 4ZCLA 2EFGA 1VI7A 2BM1A 1KTVA 3E3XA 4FN5A 4QR1A 4ES2A 1ZM9A 1N0UA 1N0VC 2J7KA 2KDOA 3ZZTA 2ZITA 3OQ2A 1ZM2A 2IVYA 3B8HA 1T95A 3ZZUA 3ZZ0A 1U2RA 4ES1A 3B82A 2E1RA 2NPFA 1P9QC 2CVEA 1ZM4A 2BM0A
chains in the Genus database with same CATH superfamily
5H9EJ 1HWUA 4ECSA 4NXNF 3PW0A 5CYMB 1F5AA 5ETTA 2BBEA 2BOAA 2FC8A 3M8WA 4ECTA 1DQ8A 2IM1A 3VWSA 6AT1B 3NGDA 2ZHBA 3RAXA 1ZZFA 3UCGA 4WE1B 3QIPB 1RT5A 2UVRA 2HZVA 2XWYA 1WHXA 1R43A 3RTVA 1KLNA 2C3UA 2YX1A 3H59A 2Y8WA 3H98A 2HGLA 3GU0A 3CWJA 3EDRB 4ED8A 1AUDA 1S1UB 3AB4B 2NUUG 2RF2B 3F0NA 2YKQA 3R7BB 1YZ7A 4E2FB 4F02A 1S5ZA 3OFGA 1EHWA 1IKXB 3L95X 1R8BA 2AYMA 4K4SA 2KKHA 4H4OB 3CULA 1FJCA 1HNXJ 1FKPB 2QX0A 2BX6A 3M2UA 1SV5B 2CDRB 2MKYA 2MKJA 3ZZTA 4ZP6A 2E7XA 4OZJA 3HM9A 2GHWA 2K7JA 4OI0A 1YBTA 5ETQA 3G8TA 3KUHA 1U1KA 4FYDA 2V67A 4PR6A 3FRYA 5JXSA 2C3YA 2BW7A 4PAAA 1ZBTA 1EX8A 3IG1A 4OX8A 1WC5A 1OYDA 5IV3A 2HMIA 1V5IB 1R8CA 4F4WA 5CXTA 1KD1T 1B4SA 1SC4B 3KFWX 1BD6A 2N4CA 4M63A 4WU2A 5D0HA 2BKOA 1C2PA 2KRRA 3JAMY 1GMVA 4DX8H 2I38A 3DYAA 4DL4A 1M5OC 4LF5F 2AJ4A 1YTYA 1MROA 4NLVA 1AYEA 4ERDA 1LV5A 2KXNB 3ZZRA 4DEZA 4IOBA 1LFPA 1MNEA 2F4VF 3LP1B 4ZJQA 4FF2A 3QQCD 3PR5B 2EG2A 3UD5A 5KFIA 3KJFB 4FF4A 3BGOP 4LIRA 1LWCB 4PPDA 2CJBA 2GJ2A 5F8GA 4TU7A 2AGOA 1RBLA 4QWBA 4UUXA 1WC4A 3QRPA 4HACA 5LT5A 3SV4A 4DR6J 1FO1A 4USMA 1UEUA 4GKKJ 5IM0A 2R3VA 2EK1A 1S6QB 4N77A 2DIUA 1JLGB 1ZPVA 3MDFA 2AJ1A 3TJ9A 4ILRA 3D68A 1HBOB 5KFMA 1UVNA 1S9GB 3DHXA 2F8HA 1TMMA 3MPVA 4Q0BB 2A3JA 3PCOB 3J7YU 3ZZUA 2P9EA 1X4BA 2YWEA 3M2VB 1SQFA 4OI3A 4NXNJ 3ILLA 4OZ1A 2FLOA 3NGRA 4HT5A 2GIFA 1C0UB 5U47A 1N6QB 2HNDA 5KFKA 2Y9HA 1JB0C 1YJRA 3OSNA 1EAYC 2CPDA 1RHQB 1SB6A 2DO0A 1HL6A 1WWHA 5A8RA 4RX6A 4WTOB 2VBZA 3UFCX 5IS2A 1JKHB 2DGWA 4UZCA 4ES1A 1HHSA 2FVRA 4DFMA 4NLSA 3GG0A 1JJ2R 2CFXA 2V2QA 2Z4PA 4TYBA 4NE9C 2ALZA 3NNCA 2MDAA 3KJQB 3P4UB 2VFVA 3BH6B 2XYHB 4NLXA 1HPZB 4YB7A 2ZE2B 3GSIA 3ITHA 1K47A 1C1CA 2OLWA 5CA5A 1RT4B 4ALZA 1E6YA 2EXUA 3VCDA 1AFIA 4UW2A 1ZPWX 4C97A 2QV6A 3V6JA 5KFOA 2LKZA 5I3UA 1Q4RA 4MK9A 2LECA 2HNZB 2X3DA 3DOKB 1WOPA 3L09A 2Z58B 4ZCMA 1FRIA 1CC8A 3DU5A 4MFBA 2DHSA 2Y3YA 4HI1A 4WYWA 2BW2A 3G86A 2YX4A 2Y1JA 2XO6A 4RW9B 1YWXA 4KC5A 4M5HA 4LF5J 2OO4A 2H4YB 1K8AT 1X4GA 1T9TA 1T0TV 2F4VJ 2MXYA 3SDEA 4ECVA 1CBKA 2PFDA 2XS2A 4X66J 4KTQA 4N8OA 2R8JA 3GJRB 5CYMA 1R7IA 4F2SA 2D69A 5C24B 1T02A 2HQFA 2J0WA 2X3GA 2FHOB 4E8UA 1YK9A 3GILA 1J2VA 3QIPA 3GQCA 3M6WA 2LQ5A 3AODA 3OTCA 2C2DA 3GIKA 4AD6A 4K5SA 1JLBB 5A6WA 4DQPA 3O44A 5K8OA 1WHYA 1S1UA 2FD2A 2RF2A 4YDXA 5CYJA 3PRDA 5A8KB 4PRFA 1KQKA 4H4OA 1VQSA 2KTQA 1SKSA 1DFDA 4YEAA 1SV5A 3TAMB 2J8AA 2JDJA 4HDHA 5EN1A 2B4PA 2HLUA 2RH3A 4S0MA 4L74A 2YQ1A 4WF9Q 2F5GA 1OY9A 3EPGA 4RBTA 3ZNJ1 5BYRA 3K5LA 4HYKA 1OQ6A 5M2PA 3KG0A 4EUVA 3OVSA 2F4FA 4JV5F 3R6LB 1MWQA 2VIHA 2B9YA 2PFFB 2HZCA 4NA3A 1S77D 3RZAA 3ZTOA 4G1QB 2MQNA 1W26A 5HMZA 2JJ4D 4MTPA 2OH2A 3H2LA 2BVZA 3PRVA 1X0FA 5KT4A 2LEBA 1U09A 1JQGA 1BWVA 1UMJA 3AAWB 3OLBA 1KTVA 3G6VA 3LP1A 3G2XA 4K0KJ 2CVEA 2F3JA 3RBXA 3JSYA 3MM5B 4PG4A 4QR2A 5LM7E 5M2UA 2B4OA 4EEYA 1VCTA 3HFVA 1LWCA 4OX9J 4DSKA 3K17A 5D4LA 1Y9OA 1WKLA 2H3EB 3N01A 1R8AA 4DLEA 3AA8A 3OFHA 3TEGA 3PW2A 3MWBA 4NYZA 1VOMA 5IV4A 1S6QA 3D3BJ 3BO2A 2MZRA 4DR7F 4M95A 3LALA 1CLFA 1H2UX 1VIOA 2X1AA 5EX3A 3GMGA 4QPTA 2L9WA 1HBOA 1S9GA 1RAOA 4DBQA 2GMJA 4Q0BA 2QFIA 2FGCA 2V34A 3MZIA 2LU1A 3SEOA 4IRKA 2FJEB 2BMBA 3M2VA 3G8SA 4USWA 4TNOA 2ZNYA 5HMXA 3A12A 5L8RC 1N6QA 2FDNA 3HO1A 1K0VA 2VICA 3D1QA 5GMDA 4I64A 1SPBP 1A7GE 5KG2A 2HLTA 1U7LA 1SKRA 5ETOA 2MHEA 1RAAB 1DQ9A 1JKHA 2HNYB 3PFEA 2CG8A 4Q8FA 4BC9A 3NEKA 4F7VA 1QVGR 1OIAA 5CYQB 1OYEA 3QGPA 2DNZA 1RAIB 2XNQA 2WB1D 1L3KA 1NRKA 2MGZB 1SJFA 2J7KA 4LBHA 4PPZA 3HT0A 1T9YA 2E1RA 4LF1A 3MFHA 2WOMA 1X4HA 1HPZA 2A6MA 2BDPA 1R89A 3QBCA 2QYGA 1IBLF 2IVFB 2ZE2A 3CPWR 3SSQA 3DGVA 4YR2A 2OUGA 2D9PA 2R2SA 4JI7J 4I2QB 2N7CA 2AF6A 2FJAB 2MKCA 4AUKA 1T3OA 1XC9A 4URSA 4C3KA 4EO6A 1HR0J 1RT4A 1IWGA 2XNRA 1XIQA 1B70B 4JV5J 3P8BB 1H38A 4LQ3A 2HNZA 2RD5C 3DOKA 3GJSB 1SIZA 4NWBA 2NYIA 1PJ6A 4X4VA 4ZIVA 2GAGC 3WZ0A 1UPMB 4K50A 1Y4ZB 4P7TA 1YJWS 1KEKA 3DDKA 3HF5A 2IVYA 1V3ZA 2X1GA 1FVSA 3NOCA 2R2RA 2RS8A 1RISA 1WI6A 2C42A 3F44A 1WD6A 5C24A 3EDQB 1GX6A 5A0YB 3B78A 3NGUA 3I4HX 3OW2R 2M3DA 2WSEC 3CC4S 1DAXA 1Z1ZA 4UOGA 4RWXA 4CO0A 1UVLA 4AL5A 3MR3A 1S7IA 3MMCB 4CH0S 2K3KA 3DI6A 2NXUA 2RRAA 5E33A 1JLBA 3M8YA 2KG0A 3TP2A 2FTRA 3ONQA 3N0VA 4X62F 3UNYA 2LQJA 3ZFVA 1C4CA 2HFSA 1KHWA 3C15B 2MQOA 4K4TA 3D28A 2CQIA 2A0FB 2ZBPA 1UWBA 3TAMA 4QW8A 3KKFA 5LSLA 1WG1A 3BJYA 4PQAA 3QSIA 1IR2A 1FDAA 3D6TB 2ZBQA 1FJEB 2Q66A 2Y1IA 2AWZA 5L38A 8RUCA 5CCMA 1JXEA 1OO0B 2MKIA 1NK5A 1C4AA 3TA0A 4NLWA 2DB1A 2FZGB 5DLGA 3ZNUA 1ACMB 1PO6A 4PG7A 2NS1B 5HATA 4JI6F 2C2RA 2M88A 3M9MB 3CCES 3L9ZA 4GO7X 4FBTA 2XMWA 5J1EB 2DR6A 4C6AA 2M2BA 1WKJA 2HRUA 2UUBJ 3MPDA 4OYMA 3M8SA 4U7UK 1IBLJ 2JZ5A 1EP4B 4YB5A 3BKTA 4ZP9A 3BO4A 3ZTSA 1X8DA 3BN7A 4N47A 1TL5A 4QU7A 2ZOMA 4ED4A 2QLBB 3QNWB 4UF4A 5GMEA 4EU0A 3UPFA 4LRCA 3BO3A 1QLNA 3J7AN 4U7UD 2X7IA 1Q7YT 4DX5A 4HDGA 3V4MA 1U2FA 3PFOA 5A76A 4F26A 3LH2S 2YNFB 4ZPVR 4FYVB 4J9RA 2E29A 3GIIA 4PQUB 3KK2B 4LR7A 3DM2B 2YQ0A 1DLOA 1CS4B 2DPIA 4DJBA 3A13A 2ZVIA 2CNNB 4HTIA 2PO4A 2CQ0A 3C19A 4DUZF 1X9WA 5B7WA 1R0CB 1YJVA 1WJ9A 2COLA 2EK6A 3CIZA 2MZJA 1W2IA 1NCLA 2G13A 2YTCA 1SJ1A 3HPOA 3V6HA 4A8KA 4LJMA 5HLFB 3CC2S 3DOMB 3SCJE 2OPPB 4FBUA 3CJSA 2HNYA 1ZA2B 5A6PA 2H65B 3DHWC 3KMSA 5CYQA 4X62J 1JLCB 1H7XA 5D8HB 4N8NA 2MQ8A 5JVHQ 1URNA 4K8RA 2OD4A 4C8NA 3VR1A 3ENAA 2DNQA 2MGZA 2DEJA 3AA9A 4LFBF 2AZ1A 3CCLS 4D3GA 3IGVA 3M8RA 2OD6A 1B99A 4CLWA 3WIVA 1Q16B 4YR0A 2CPXA 5F8JA 1D9DA 3BBFA 3T1HF 4CNYA 2DRDA 3A3OB 4I2QA 4I68A 4FVMA 3P6YC 2AEJA 3QFWA 4Q8EA 2LVWA 3CNQP 2I8EA 2HRYA 2V2ZA 2KU7A 3LA0A 4XIUA 1ZM3A 1X4EA 4X4NA 2D3ZA 4EK2A 3A8KA 3MMAB 3TAQA 3MI7X 4EBDA 2AU0A 4FS1A 2W9CA 3WC0A 3RB3A 1LWEB 3SSRA 1U47A 3VQTA 2FZCB 2DCUB 3HHLD 3CVKA 2BE7D 3GIJA 4CNZA 3D6MB 3FBFA 3MAQA 2HGMA 4FP9A 2RHSB 2NR0A 1Q79A 2G2OA 4M5DB 4X4TA 1XNQF 2V8GA 3MM6B 3FSYA 3MCNA 4Y6IA 3IWNC 3Q2SC 4ID5B 1IKWB 2XCPA 1RCOB 3EMTA 2PD1A 5A0YA 2B9WA 1S0VA 3CIMA 3O1LA 1KDNA 2MLXA 3QFHA 5ETPA 1RHRB 1R6VA 2ZOGA 5G4DA 1KHVA 3MMCA 2IJFA 2PI5A 1VK8A 1B0TA 1XR6A 1BGXT 3WHIA 3KLGB 1FI4A 1UEVA 2KI2A 3R5DA 3CB4A 4TY8B 4I56A 1S59A 3C15A 4YP3A 4L3KA 3TANA 4F4ZA 3H42A 1H2TZ 2GJFA 2FY1A 4LFCF 4M8LA 3DNCA 1WTBA 3KK3B 4ES3A 4AE5A 1WF2A 2I1RA 2DGVA 5DQHA 1VQ8S 3DRYA 4RO0A 4IFVB 1HQEB 4JV0A 2Y1LB 2GC8A 5FIIA 1PG5B 4ECUA 2HHUA 2AGPA 2IPOB 2QMWA 3CDAA 2CYYA 4W92B 1AZSB 1HQ2A 2B8QA 2XS5A 1XWLA 3CC7S 2OFHX 3MUVP 4BWJA 4LFBJ 1X4AA 3G8QA 3D5MA 2GMHA 4ECRA 5KT3A 4ECQA 2BJ1A 1I5OB 1WOOA 1Q95G 3FUYA 1EP4A 1RWOB 1M5VC 4U7CA 4DR3F 4FKXA 3TX0A 1S48A 1RKJA 2XY6A 3W8GA 4QJVA 5FD1A 3SI8A 3MR7A 3DRSB 3TVKA 1N32F 2BE2B 3HJFA 4F36A 2CPEA 4IH7A 2R7WA 3PDNA 2Z30B 2LXUA 3R3TA 1FTCA 3W64A 1A9NB 3L7OA 1NSAA 4LF8J 1GAOA 2JEFA 2YNFA 3RGIA 1ZAVA 4NEYA 3DDIA 5J2QB 4PQUA 3GPAA 3K5MA 1ZZNA 2J6TA 4IH6A 4CO3A 5GADU 2DPJA 2HIQA 3DM2A 1UFKA 2UVWA 2CQHA 3GV7B 2AJFE 2ERRA 4Z2XA 1HWLA 2AD9A 1CS4A 1YZ6A 3BBCA 1NK0A 3EM1A 4ZCLA 2WCXA 3UCZP 1T03B 2IHR1 5HSPA 2QL7B 1XNQJ 2DNNA 1S72S 2XI3A 3LF0A 4HH0A 4DCJB 4L75A 5KFXA 1ICEB 4NCGB 1WNEA 3NWRA 2M4MA 2CZVC 4C2MA 1DQAA 5L39A 4MK7A 1P6TA 5DG8A 3BQ2A 5HLFA 1S1WB 3DOMA 3BBBA 2DXDA 2OPPA 2D7SA 1N5YB 2L3MA 2MJNA 3D6FB 4OX7A 1RTZA 3O6QA 2H1YA 2NZ4A 1JLCA 1RA7A 1Q82T 4EYIB 1QVFR 2ACMA 3EZUA 4IG3A 5D0GA 4K59A 5LSOA 4Q2MA 2FVSA 5CCLA 3H25A 3TX8A 4LREA 2MQPA 1SIWB 1M90T 2KFNA 4R5PB 1FXDA 5K8NA 4LFCJ 1MWZA 3IBWA 2GS8A 2EPIA 1FWKA 3FMWA 1U8WA 4IKAA 4LR9A 1M5KC 3AXKA 3CDEA 4L6V3 4WFAQ 2ILYA 2HHHJ 1RBAA 3K5NA 4TXSA 2DNOA 3QWUA 3NRBA 1OPIA 1F2HA 1GEHA 4Y28C 1T9XA 1VQYA 4OHWA 2GV1A 1RI7A 3G6XA 2OFGX 4ZS6A 2ZHOA 3N4WA 1SKUB 4NZ0A 2OKQA 2E66A 2PT0A 3MMAA 2ZH1A 4DS5A 4HEA9 3VV2B 3FSIA 1WKKA 2ZH4A 1LWEA 2IIHA 3HLUA 4PG8A 2W2MP 3Q23A 1RTDA 4OI1A 1U8SA 1HBMB 2AMCB 7FD1A 1FNMA 4C98A 4KGXB 2V0NA 1NK8A 4TLRA 2UXBF 2WBMA 4YN3B 4M5DA 4DR3J 1TQLA 3MM6A 4R25A 2RMLA 1N32J 2MSTA 2F8MA 4ID5A 3NL0A 4DWIA 4FYXB 1IKWA 1VLOA 5ETNA 4OLPA 5DG9A 3RYLA 2M8DB 1YJ9S 1RUSA 1S99A 2VOPA 3UNGC 3TA1A 3I6PA 1R8HA 1G1XA 1HI0P 1IKVB 4DV2F 2QYCA 2BJ7A 3H5XA 4ECZA 1XMQJ 3BDPA 3KLGA 3AQOA 3KDOA 4PABA 2I2YA 1G3OA 2W2OP 1O8BA 4TY8A 2MY8A 4O3QA 2RHQB 2IA0A 2KVQE 2H5IB 1V3RA 5JVGQ 5AXLA 4M5NA 3KK3A 1Z2ZA 2F40A 4WWSA 2HIYA 1GMWD 2GX8A 2VH7A 4K4VA 3FQKA 4LRAA 4IFVA 5K9FA 2D9OA 2OPRB 7AT1B 3CDUA 2CQ4A 1KVJA 2P8IA 4O4GA 1VQLS 2VFRA 1LQ9A 2RSQA 1A6LA 1FWPA 3EWGA 4OZ5A 1AZSA 2HFOA 4LSNB 2YY3A 2MB0B 4YHHF 3B8HA 5L1IA 2P6TA 2KJVA 4Z7CA 3HVAA 4J9VA 4A8YA 4BDPA 1URRA 2GVZB 4DCOB 2E5LF 2XY5A 1UA1A 3NCRA 2Q1LA 3CCMS 4WZQA 2FJDB 4NMLA 5M2RA 1VQ5S 1S4FA 3K5OA 1B64A 2J76E 3QGHA 2Y0SD 3T6BA 1PGZA 4HI2A 1HMVB 3HFKA 4USTA 3ISZA 3UCUP 3QATA 3H7HB 1GXLA 4QWCA 1UAWA 2B9EA 3DRSA 2ZC4A 4KPYA 2HBYB 3I4PA 4J9OA 2AX0A 3ENWA 4X2BA 2FLNA 3TUZC 3BREA 4ZK7M 3NNHA 2IAJB 3MOZA 2OHDA 4PWDB 5KT5A 4X64F 2JL9A 4WZMA 3LANA 4I6WA 1KN6A 1FRMA 5J2QA 4CIOA 2HHQA 5K8MA 3IO1A 1YI2S 4DN9A 1IBMF 5KOXA 1SUQB 3UDVA 1RT1B 5BXIA 5D77A 2GFFA 4Q2LA 1T03A 2WVDA 3G96A 3SMZA 4F04B 2UUAJ 1NK9A 4CYUB 1MG7A 1UVJA 4NCGA 4WFYA 2P9CA 4Y2IA 5F8IA 5KFQA 5ETLA 3PIOQ 1FKOB 2J8SA 2YWFA 1EQ0A 3JB9k 1T3NA 4MH8A 4OZ2A 1S1WA 4QOTA 1FRJA 1S79A 1TUVA 3D3CJ 4K2XA 2YX7A 3HSGA 4QR1A 2OI2A 4DV2J 4Y3CA 1PC5A 2KFZA 2J0QD 1N5YA 1N36J 4Y2KA 3S6EA 4WPAA 3NMRA 4QIGA 4ED1A 3PG9A 1S9FA 4ZIWA 4GKJF 2H54B 3N9UC 1WACA 4R0EA 4DSFA 4FS2A 2FHJD 2UUCF 4X4UA 2XQCA 1QSLA 4NEZA 1QJHA 3U7JA 5KFWA 2LU2A 2DGTA 1J5OB 2VL1A 3CD7A 3M30A 2YKAA 1HNWF 2JHEA 3RRHA 2FYXA 1JXVA 4CLYA 3HHDA 1VYAA 3D1HA 1SH3A 2XMJA 3FBEA 2B56A 5KG3A 2QLXA 2C3OA 4LF6F 3EUNA 3RB0A 2DJWA 1Q5VA 4BLGA 4ETZA 3SV3A 2E5IA 3VAFA 1LK5A 3D2WA 3BPDA 2VB6A 2XMUA 4QYRA 2M70A 2V9WA 3QPIA 2XLKA 1YSJA 1Y10A 3QGGA 2FZKB 1W7WA 1R31A 4X4RA 4CO5A 4YHHJ 4EZ6A 3R2DJ 1X5TA 1PBUA 3FKBA 4UOHA 1FNOA 4C4WA 2WRMA 2E5LJ 3GSDA 1ZM2A 2ATLA 1HBMA 2KXHA 3BV8A 5H9FJ 4MT1A 1UZDA 4AYBD 1W25A 3OUYB 1Q8BA 3Q0AA 2YBVA 3DRXA 1FWLA 3GWCA 2BQUA 2ZH3A 1O51A 4MAKA 1RB0A 5KFHA 4UY85 3W61A 2WSFC 3FZ2A 3TJ8A 1YVFA 3A8EA 1Q1KA 5EWGA 2FPHX 3GYXB 4U8VA 4JI3F 1HHQA 1NKCA 2GGPB 2E1PA 4X64J 4RWWA 3Q8QB 4WU3A 3GG1A 5ETRA 1Q5YA 1XNRF 4USJC 2OJ3A 4LUBA 2GO8A 3CSKA 1X5OA 3Q8VA 3IN5A 1LKZA 4OYBA 1NH7A 1IKVA 4DQQA 2P2CB 1XR7A 1IVZA 5B0GA 2L41A 4NLPA 1D9FA 5B08A 4PG5A 3DCAA 3FBCA 2PGCA 2MKHA 4GC7A 1YHQS 3EE3A 2UV8G 2ZZNA 4ZVFA 5ITHA 2P6SA 4F2RA 4G6VB 1HWIA 1VQ7S 4RUBA 4QIFA 2HVZA 3MUTP 3HD1A 4HHUA 2KG1A 4C3LA 2R4FA 2ZKTA 4DLGA 1VQNS 3OV7A 2YKMB 1GT8A 5E3RA 2ZH6A 2XMVA 5L9NA 4DQIA 2JVRA 2G0IA 2OPRA 4WKYA 1VHFA 4B9VA 2QFJA 1HKAA 1RJJA 1RCXB 1H2VZ 1VJWA 3MAHA 2AHOB 3BYPA 2R8IA 5E2QA 4EO8A 3N5BA 2V50A 1HW8A 1X31C 4A48A 2JNJA 1X4FA 2DCLA 2PSZA 2XB2D 2CXEA 1RWXB 5AT1B 1N0VC 1HNWJ 4CLSA 5D78A 2KRBA 4WXWA 1HMVA 5HVHA 1P8GA 4LF6J 1KQGB 3S1TA 5T41A 2HS0A 2HQ3A 3T5KA 4J91A 2IAJA 3NBPA 2IDEA 2QMUB 4PWDA 4NA2A 2VPYB 2CJAA 1TR0A 4DV4F 2IYGA 4QPXA 2MQLA 1YGYA 3CMES 4X65F 4DV3F 5L46A 2DR5A 2ACYA 3HHEA 1APSA 1SUQA 1RT1A 2EKYA 5EX0A 1KVIA 2KVIA 3PY8A 2ZD1B 1UPPA 2ZH8A 1SC1B 3W66A 4CYUA 4XO0A 3IBFB 5E7OB 3ZXWA 3M8PA 3BSOA 2BRKA 5LOQA 4DN0A 3D66A 2VG7B 2OIHA 2UVVA 3VAMA 4J9UE 1C1BB 1HQUB 4B3RJ 3P5BP 5F8MA 1FKOA 1UVMA 3ADAC 1VIXA 1NDKA 8ATCB 3GFHA 3U27A 4HT7A 1S9EB 1WUUA 1FT8A 4AL7A 1XNRJ 4WBFA 2ZDOA 4C8YA 4IO1A 2X51A 1JK9B 4PXBA 1KFDA 1R6YA 1NDCA 1V9OA 4NOHA 3HSJA 3I5BA 4KHRA 4F4KA 4QIWD 2ADCA 1C0TB 2RKIB 2EI5A 2MLZA 3UWTA 1QTNB 2UUWA 1FX4A 2CPJA 5IWAF 1T05B 1KQFB 2R8HA 4N5SA 1JX4A 4P9SA 1UJ5A 3MHYA 4DPYA 2J5AA 1J5OA 2IYIA 1Q8IA 3W63A 4YOEA 3H2VE 3K0JA 3P45B 3FEXB 3I31A 1TAUA 1WELA 4B9MA 3NS5A 5K5MA 2RQMA 1K9MT 1MMLA 2VG6B 3OFEA 5GAEI 1SQGA 3ELHA 1U2CA 1TUGB 1VRTB 2Z56B 5SZTA 1UVKA 3T1YF 3O8WA 4UQGA 3FSXA 3KHRA 3NKYA 5DO2A 1FKAF 3C6UB 1FRHA 3UR0A 1Y3KA 2V8HA 2CZ9A 1QTMA 2LEAA 4OJ3A 1PYOB 1R3NA 2BUNA 3NS6A 1HIYA 1WC3A 4Q45A 4F3OA 1U0HA 2WVEA 3CJ5A 5L1JA 1RHMB 4C8OA 3SZ2A 3AFGA 3UE2A 1QY7A 5DRKA 3OUYA 4P2FA 4J9KA 2F9DA 3K89A 4ZDNA 5B09A 2HS3A 2LA6A 3RAMA 1LEOA 3B4DA 3UR3C 4CLFA 2FJVA 4RNMA 2OEMA 1HWKA 2BOPA 1CC7A 1FHTA 4W4MA 1JJCB 2GGPA 1OWXA 2KT3A 4ZP7A 3Q2TC 2DHAA 2E1MC 4JI4F 4R0JA 2LQ9A 4MKBA 4LVNP 3CD5A 5FLXY 4DV4J 1RK8A 1K1QA 5J2MB 2G1DA 1N48A 4FXDA 4OL8A 3FJ2A 4X65J 4DV3J 1ZM9A 3Q86A 2JSXA 1KR4A 4CO2A 4WFZA 4OQJA 3CCRS 2AJQA 5GAGI 3CDBA 2PEHA 2D3OR 2K2PA 5EWFA 1Z4UA 1L3VA 4XTTA 4O44A 2ADBA 2GVDB 2EC2A 1U25A 2D3O1 1KOHA 1VC0A 1H98A 4ZP8A 3K5PA 4PWWA 4LRFA 1N8RT 2ZM6F 2Q79A 1RAFB 3LWLA 1UJ4A 1LNQA 5KOWA 3JTNA 4USVA 4DUYJ 5DM6Q 3CMQA 1TVRB 5K8PA 3MAAB 1XK8A 1IJEB 3KNGA 3W62A 3KHGA 3A3NB 4ZHRB 2DNPA 3S8SA 3OFFA 3KTQA 3C66A 5ETKA 4OV6A 1QDUB 3BS9A 1UW4A 2V8VA 1J27A 2RDDA 4OJHA 3TWZA 4RU9A 3CCQS 4JUZA 1TTHB 1LFWA 3BQ1A 3PVXA 1FCAA 1U1MA 3ILIA 2H4WB 1TKTB 3I5CA 1WORA 5I42B 5KG6A 1EB0A 4JYAF 1YKWA 3TW0A 3GFZA 1AT1B 3MM9B 3DLEB 3THVA 1N34J 3OPKA 2NXNA 2FJXA 3T1YJ 3EYZA 3HVWA 5HQ8A 4IUFA 2MEWA 5IC6B 3UDEA 3DN9A 4YQWA 3UDLA 2KM8B 2PMHA 3F41A 3KDNA 4ZLPA 2YNHB 2Q6CA 4ED2A 2DVIA 2HG4A 2LDIA 5HP1B 3NXZA 3AH6A 3WIUA 3HKWA 5DS7A 1PYTA 3UW1A 2CJQA 3T5LA 2OELA 4CRJA 5HK4A 3IMQJ 4ES2A 2VG7A 2UUTA 2HAIA 4L76A 1C1BA 1HQUA 3Q22A 1TL7A 4PG6A 4DSJA 4CZCA 4JI4J 1S9EA 2AEMA 4ITSA 2KM8C 2H48B 2RS2A 3G87A 3BR9A 1Q8KA 1WG4A 4LBPA 3TQEA 2CQCA 1C0TA 1RGVA 2RKIA 4ENOA 2LLZA 4CQ1A 3T6JA 1NHVA 1T05A 3SFUA 3SIPB 3W7BA 4NA1A 3ZZZA 1Y11A 3BSNA 2OPQB 2Y0BB 3T1AA 1B7FA 4ED3A 4NZ6A 1NBEB 1TL1B 4ZLLA 3QRQA 2HHXA 5KG4A 1PJ7A 3DXSX 1RAEB 4USKA 2ZM6J 3HHLA 1HNVB 3AXMA 1RTJB 1WHWA 3S7RA 2M7SA 3J80Y 4OYZA 4WFXA 2IJRA 4PYAA 1Q53A 2VG6A 3KLEB 1SQEA 3Q8SB 3PJXA 2R7XA 4RNNA 1VQ6S 1VRTA 2RU3A 2XS7A 1PAEX 4CI0B 3ZZOA 3HVTB 3SYZA 2V4RA 1FE4A 3CD6S 2GQQA 1SC3B 3C6UA 4N56A 3UN3A 3Q24A 2OPSB 1HBUA 4C0OC 2N4DA 1RT3B 1XMOF 3AJ2A 1HI8A 3V5RA 2CQ1A 5KFBA 1O5JA 4YB6A 1JMTA 2AJ0A 4QCLA 2XG8A 4DPTA 1U49A 4DPOA 4MMOA 4DF8A 2Z8QA 4X4SA 1S6PB 2LCWA 2YH1A 4JYAJ 2OGUA 4B3MJ 2JC0A 1DTQA 4G1IA 2O1PA 1HARA 1F3FA 2IMWP 5F41A 3THPA 3HZEA 3CJKB 1B3TA 4IR1A 3A8JA 2VBWA 2ZNZA 2ZUAA 3HK2A 4KFBA 3TVZA 4R8UB 3CXCR 3HJVA 1UZHA 3CCTA 1KONA 5J2MA 4NYPA 1TL4A 2GIQA 2QLJB 2HURA 2O66A 4P71A 4DU8A 1M1GA 1VBKA 4LF4F 4NI2B 3MMJA 4DS4A 3SSSA 3ENQA 5AE1A 3CO0P 5DZ7A 3ZC4A 4IYQA 2WHOA 2ZH2A 1S1VB 4DL6A 2GVDA 1HLWA 2QL9B 2EFGA 3PX4A 5D3GB 4TVAB 4I67A 2C28A 3BGLA 4JI8J 5D6GA 3W3SA 2QL5B 2V8DA 4DG1A 4Y00A 2NZCA 4CLPA 3R8YA 1N0UA 1FJ7A 2EBGA 4A8MP 3VVUA 3MGJA 1UJ6A 1WEYA 2OMOA 1TVRA 1D09B 3OTOF 5HO4A 2MY7A 2AEFA 5JJBA 3MAAA 1R8PA 2Y8YA 1CJKB 2RT3A 4J9SA 1QM9A 3M8QB 1YG0A 4LSZB 1JNRB 4ZHRA 1ZH5A 1EETB 2KJWA 4ZCIA 1T11A 3ISNC 4OI4A 3NMAA 1ELOA 2HFZA 2PN6A 3FNNA 4DHVA 4F67A 4GC6A 4K4ZA 1CG2A 3BGUA 7FDRA 4C3MA 2ZBIA 1TKTA 3DLKB 4TQSA 5D0EA 2SXLA 1Q78A 5I42A 5KFCA 3H8YA 4YFUA 1NPKA 2HHPA 3UI3A 2AZ3A 2XLIA 4IOCQ 4RUHA 4ED5A 4UT4A 1X5PA 4A8OA 1S6OA 4E0DA 3MM9A 2R7RA 2IM0A 3DLEA 2VDHA 3EVOA 2WOMB 1BUXA 3PO5A 3NY0A 3QGIA 4DR2F 3VGTA 4F4YA 4KT0C 3LOUA 5F8HA 5DJBA 3JS9A 2QSWA 3MR5A 2WVFA 2RUSA 3U1MA 1KVKA 5GAGU 3KHLA 1TAQA 2W1BA 2GIRA 3MTKA 4ANDA 2W2NP 2YNHA 2I6WA 3PW5A 1YJNS 2HWHA 1YLXA 3W9JA 4CWBA 1SJRA 4LIWA 3TYTA 3ETMA 5HP1A 2GZOA 3UD4P 3KLHB 4ILMA 1X9SA 1IWAA 3M9OB 3KJVA 3PO4A 3DRPB 4B17A 3RAQA 3MCOA 2O67A 2RVJA 5LSRA 2F9JA 1QAJA 4JI1F 1K0TA 1FESA 3N6LA 1CQNA 2WVBA 4F0HA 2BJ3A 2FLLA 2M5YA 2N7YA 1U4BA 1Q86T 4K4YA 4Y65A 2XY7A 1N54B 4KBIA 1PCAA 4Q5VA 2YH0A 3CJQA 4URQU 2GJIA 2JVOA 4LF4J 4Q44A 3BKUA 4LF9F 2JC1A 3KK1B 4ETXA 5HJXA 3RW7A 2ROEA 2CJ9A 2OPQA 3RU0A 2BQ3A 1R27B 1HW9A 4OJ1A 1Y0HA 3DI6B 5A8WB 1EKSA 2WAQD 1TL1A 4A8XA 1IUJA 4UOCA 3FC9A 3SCKE 3U02A 2CPFA 2FJWA 4LFAF 4CO1A 1HNVA 1LW0B 2RRBA 1YITS 1RTJA 3X3UA 4CCHA 2YQ3A 2VF3A 4MKYA 1SBRA 3KLEA 4RW8B 3OTEA 3JSBA 3CCWA 3THTA 2OEJA 1JJHA 1UWBB 1S6UA 1RT2B 4WFNQ 3OBIA 3GJTB 1RT7A 2HQCA 2HQIA 3HVTA 3PYFA 2RNEA 4DZ6A 4KJIA 2VC1A 3MPUB 4ILLA 2POKA 3O5TB 1LXJA 4TKTA 1L3UA 2OPSA 3HZGA 1RT3A 4QIEA 2V5HG 3MXHP 3ZZPA 1B0VA 2R7OA 2DXFA 2JX2A 1JLFB 3Q89A 4ICLA 2RILA 1LOUA 1S6PA 4JI5F 3NAIA 1T7PA 4W90B 1TK0A 1FDBA 3AB2B 1BHNA 1RTHA 3P49B 2MZ1A 1F60B 1N4LA 5KFAA 5KT6A 3CJKA 4FVCA 1TK8A 3J7A1 3V2UC 5J1PA 1WG5A 2I9SA 3FFIB 1Y5NB 3HVRA 1BE4A 2W7OA 1DTTB 1RWUA 3GLJA 4R8UA 3CCVS 1X0PA 4YUDA 1BMQB 1FA0A 1ZETA 4QU6A 1VI7A 1HHTP 3CCSS 2QLFB 5GVQA 1RWKB 4ZKAA 4PXDA 4WK1A 2HHSA 2WB4A 1K73T 4MJKA 3HT3A 2U1AA 4NI2A 4OI2A 1NK4A 4DZDA 2DRBA 5L9XA 1S1VA 1F0XA 3K7RA 3R5JB 4KE5A 4DMZA 4OYIA 5D3GA 5G0RB 1H72C 5CZXA 1UTAA 1DLOB 5J2PB 3LP0B 2RAQA 4K4WA 2IRXA 4OHVA 2DEIA 3W2VB 3OR2B 3A1YG 1J5EF 1AROP 1RU2A 1CJKA 1Q7LB 3PHTA 3AHPA 4OHXA 2R7QA 4C11B 3M8QA 3IRWP 4ZOSA 1TP7A 1XMBA 4LVOP 5IQ6A 1AW0A 1U24A 4LF9J 3P3DA 5CQGA 4J9MA 5MLCV 2CNOB 2AKWB 1EETA 2AJ2A 4NPOA 4DPXA 4QWDA 2UXCF 3EGNA 4MKAA 1GNKA 3Q8RB 1T94A 1W2BR 1LXNA 4OV1A 5KFLA 2HBQB 3H4BA 4NLRA 2RQKA 4ELUA 2W2PP 3DLKA 2BKPA 2G2YA 2PE8A 3QZ8A 5B0DA 1Y7PA 2IBOA 5A2QU 2FVCA 3M8ZA 5ETSA 2VV5A 3UD3P 2XTJP 3FEZA 2HYIB 1NSPA 1HA1A 2PA8D 3B82A 2DHXA 3R5BA 2BA9A 3SCIE 4DOZA 3WDOA 4BS2A 2WZ1A 3W65A 4DV6F 3BF4A 1KBRA 2JLFA 5F9LA 3N79A 4H4MB 4UOFA 3J7YI 3JXOA 1I51B 1BQNB 4B3SF 3G6YA 4FF3A 2HBZB 4C8ZA 1X4DA 1VRQC 1P1TA 5LJ5Y 3AY0A 2HFVA 1VQPS 3BGRB 1MMDA 4JI5J 2A2CA 2W9CB 1PJ5A 3DKDA 3KLHA 1RBOB 4I7FB 3DRPA 2BJ8A 2D1CA 5HROB 4JOUA 1RWWB 2E7VA 5LL6d 1N5VA 2V6AA 4OZ3A 2DY9A 1VLYA 4O3RA 3RR8A 2Q43A 1RAJA 4A8QA 4P72A 1RE1B 3LPYA 4B3TF 1NDLA 4OMFG 3JQKA 2YPYA 1JLEB 3KK1A 4ZVQB 4UZBA 2HHWA 3US5A 2PC6A 2W9BB 5KG0A 3LGHA 1WC1A 4FPRA 1P9YA 4ED0A 2RRNA 3VGUA 2AYGA 3FGVA 4JB8B 1L3TA 3JTOA 2AW0A 5A8WA 2J0SD 2FHMA 4CH1A 2CVIA 3RG6A 4DR7J 2R7TA 5E3QA 3DMJB 3OR1B 2F65A 2C2ZB 1LW0A 2NXJA 3OJSA 4LRBA 3DGPB 3OVBA 5HQLA 4RW8A 2QEXS 2DO4A 1F5CA 4UY8T 2DNYA 1J5EJ 3M7VA 1RT2A 4KH1B 1O6XA 3FMBA 3OT9A 4BC7A 1HNXF 2QG9B 4OHYA 3R1LA 3MM7B 2BKNA 2N82B 3D4JA 3TZXA 2CNKB 5KG5A 4BHQA 1KNZA 4KPCA 3ZZYA 2DKOB 5HVGA 2Z2YB 1S76D 1KQSR 2CQ3A 3VALA 1S57A 1RZMA 1WI8A 4ZVHA 1A0OB 2DIVA 3LWMA 4JV2A 3K59A 3JAMU 2NSBA 1JLFA 2H9ZA 2HQGA 5F8NA 3CJTA 3WC2A 4DXLA 3UVJB 1GMUA 5B0CA 4KHMA 4I0WA 4TYAA 3S01A 5J2NB 2DNLA 2XULA 4KB7A 3CUNA 1RT6A 4K2JA 2G0CA 3EX7B 5A2QY 4YMEA 4DV6J 1GXTA 3ZTPA 3FFIA 1M5SA 4AXIA 1DTTA 4M94A 3HMJG 4KAIA 1I94F 2KL8A 3MPWA 3DDNA 5CZVA 1BQMB 2DXEA 2BANA 3QAEA 2MHNA 1AB8A 2VDIA 2ZHAA 2ZZTA 1G7CB 2J9EA 2VPXB 4YS2A 3NOGA 3HX9A 1RSCA 4KIAA 1S0MA 1SL2A 1JIHA 5HI7A 5G0RA 2M0GB 3KLFB 4PCQA 4XDDA 2R8GA 1RLDA 3DU6A 5J2PA 2V94A 2CWKA 1G4CA 1YRTA 3LP0A 5GMKa 1NU4A 4QW9A 3W2VA 1IBKF 9RUBA 3OR2A 3L3CA 4O3OA 2VKRA 2H5JB 2UZAA 3FCVA 4HVZA 1WDTA 4CLZA 4C11A 3ETOA 4B3TJ 1HYSB 5C2CA 1CVJA 1CQMA 1H73A 1UETA 3M2RB 4NLOA 2IJNA 3KXDA 2XO7A 3K8VA 4DV7F 4RR5A 2M8HA 3M9NB 4QZVB 2F63A 5KFRA 4MK8A 3PACA 2EEYA 5MAOA 4P2XA 1S1TB 5C25B 2EKNA 2LMIA 4F50A 2J9DE 2W01A 4C0HA 1ZM4A 2V68A 3WX4A 2B51A 3M32B 2E5HA 1DURA 4IG3B 2W8LA 1RA6A 2XMKA 4A47A 3C6TA 4MIBA 2ZOFA 3TRGA 5CAAA 2XSFA 4NLQA 4CM0A 5HMWA 4B9LA 2DY1A 1X60A 4PEOA 2BJ9A 3KLIB 5C7PA 3NAHA 3CGIA 3BPSP 1P27B 4H4MA 4JBCA 2JEIA 4JI6J 3OL6A 1BQNA 4NYOA 1PC4A 1U1LA 2X1FA 3GFXA 1SJ4P 5DQGA 4DL5A 3HHNB 2NPIA 3K57A 3BEGB 4C7QA 3VAHA 3OHAA 4CO4A 5JUMA 3B6BA 1KP6A 3BGRA 5HANA 4KGZB 3PXGa 4ER8A 1RTDB 2VKZG 3LGMA 4I7FA 3RJMB 3CJRA 2HZAA 2ZDPA 3C8YA 3M6XA 5HROA 2XMTA 4KYZA 4IQMA 4H54A 5IT9U 3PTWA 3W5ZA 2R7VA 4C48A 2B8PA 4IG0B 4NLYA 1QUVA 2DNGA 1I94J 1FDDA 4ED7A 2VFUA 3I0RB 4CTAB 1SKWA 2LQBA 4X66F 3MD1A 3GIMA 5DDRC 2J7WA 3RBEA 5H9FK 2VU5A 2QE5A 2R7SA 4L3NA 1JLEA 2RIJA 1Y5LB 3T9ZA 4QYZK 2W9BA 2DR7A 2DH7A 3FVYA 5ETMA 3P5TL 4BWMA 2V8PA 4O3SA 2Z2ZA 2DD8S 3D0HE 4AQYF 2R2UA 1FEEA 3IGNA 3IFEA 5FJ4A 4I2PB 4I6AA 3DMJA 3OR1A 3GB0A 4GRSA 1G6BA 5IXUA 4JV1A 1YJTA 4L73A 3DGPA 3PV8A 1GFWB 4DUZJ 4NL5A 3PW4A 3OXGA 1IBKJ 3ZTQA 3D6HB 1ZA1B 3MEEB 3AT1B 2ATCB 3K58A 1TKDA 3MM7A 4DPUA 5D15A 2QIFA 4DV7J 3QRRA 3W1YC 3QIDA 4DU7A 1WSVA 3TO8A 4O4GB 4OYXA 1U1QA 2Q6BA 4EZ9A 2XGQA 1RKIA 1GXUA 2XYPB 2VG5B 3M4XA 2B5JB 4OHZA 3WX8A 1U2RA 3UVJA 4LQ9A 2LXIA 2ABYA 3D0IE 1RAGB 3MF5A 3EICA 5CABA 2FB0A 2NUHA 1X9MA 2V4JB 3RRKA 2XWXA 3DOLB 2UXDF 5J2NA 2IC3B 1S1XB 1UW9A 5C2GA 1NUEA 3T1HJ 2BM0A 1FVQA 1IXKA 3V4IB 1RACB 2NREA 2A1BA 4B3OB 4K0KF 1FK9B 2AYEA 1K1SA 5LXYA 3Q83A 3JQMA 1BQMA 4M5LA 5EWEA 1S97A 3OQ2A 2A2DA 2CPYA 1HD1A 1CSJA 4QR0A 3ET6A 4DFPA 2GHPA 2VASA 3SCLE 5L1KA 2VPZB 4OX9F 3MECB 5D4PA 3TOQA 6FD1A 4LF7F 1SXLA 3KUGA 1U6ZA 1PYSB 4U95A 4I4BA 4B9SA 3IRXB 1NKEA 4CLUA 1SI9A 2XLJA 3KLFA 3LP2B 1KLMB 5LMNF 3N5FA 1RDRA 3KUEA 2LFVA 4ZPBA 1RABB 2HW3A 2DISA 1D9AA 5AXMA 4YR3A 1IBCB 4KKOB 2QTWA 5F8LA 1KSPA 5DG7A 3E01B 2OEKA 4HTJA 4FYWB 5IT9Y 1FRKA 1ITPA 1HYSA 2OAUA 3M2RA 3OLAA 2IBKA 1Q81T 4RNHA 1NJIT 4WE1A 2WONB 3IM8A 2DTJA 1S1TA 3MURP 2DITA 5C25A 4AQYJ 4WCEQ 5IC4B 3LAKA 3M32A 4J37A 4Z37A 5KG7A 4ZVRB 2W4PA 5E0OA 1FERA 1IKXA 2LQ8A 3M30B 5L1LA 1EARA 1N33F 5T7LB 3CE8A 4WKRA 1Y3JA 2B9XA 2PI4A 3W9IA 4DL7A 1FKPA 3UDCA 5IFMA 4C9DA 5E3AA 3D54A 3KLIA 1RWVB 2EVZA 4ZVEA 3G6ES 2UP1A 2J7UA 2XHWA 2ALYB 4JI7F 2IMOA 1OSDA 4ZVGA 3MR6A 2HWTA 1VC6A 1HR0F 2AYBA 3OL8A 4ZPWR 4P10A 2DNRA 1NK6A 4GMKA 2CRLA 3UN2A 4ZCKA 2LA4A 1M0SA 4PYDA 2CDQA 2BR0A 3W9HA 2KHDA 1F3VA 1MN9A 3W8PA 3D1OA 4O0IA 1V3SA 4KQZA 2UXDJ 4KH0B 1VS3A 4NX9A 5DGBA 4ZPTR 3C16B 1N5QA 4FDFA 1OPZA 4PZVA 1F9FA 4IG0A 4P74A 2HWIA 4K4UA 2BABA 3A3PB 2Z0GA 2OSQA 4CTAA 3I0RA 2FC9A 4EI2A 3AD8C 2VQFF 3FZBA 2KZZA 3AD9C 4TU8A 1U1RA 3TUIC 2YKNB 2VOOA 2OP5A 4NMXA 1RHKB 1NJWA 3B54A 4X84A 4OZLA 1HNZF 4LF7J 2C3PA 1VRUB 5HJYA 3IR7B 3OTDA 4RNFA 5LMNJ 4I2PA 5AXNA 3M1VB 2ASYA 1JLGA 3CJ0A 1N52B 2VFTA 4OX6A 5K20B 1FX2A 1S0NA 4ANEA 1BWEA 2OTJS 2CJKA 1VK3A 2FUG9 3MEEA 3GE9A 3MR2A 3IAS9 5EGYA 1C0UA 1TFYA 5JMNA 5H1SV 2EFNA 1CJVB 1HD0A 1NAQA 4LT6A 4X4QA 1F2GA 2ZWOA 3KLVA 1HFEL 4ZVSB 2PMWA 2ZBRA 1NM2A 3EZOA 1K44A 3SBMA 3RBDA 4TN2A 4PWUA 1D8YA 1UWAA 1O0PA 4DFKA 4PKDB 1H6KX 4H4KC 2EWHA 3FEYB 2VG5A 5KTQA 3ZO7A 2B5JA 2FQQB 1QAYA 4QWEA 2ZVSA 2BRLA 2I5JB 5E41A 3CTRA 1KOOA 4RLEA 2HGNA 1D1UA 2OSRA 1N33J 2V4JA 2RU9A 3DOLA 2ZFHA 2UUBF 2IC3A 2NXCA 1S1XA 2NCKL 2KYZA 1RTIB 4EMDA 3DLHA 4F4AA 1NSQA 1EZZB 3HHKA 4CT8A 3V4IA 2QT7A 2EFPA 1FDNA 2EFOA 2DHHA 1PBAA 2MZQA 4B3OA 1FK9A 1S4EA 2MJUA 1NHUA 5CD4A 1XJWB 3T5HA 2CKWA 1NJXA 3NBPB 5HQMA 1MW7A 3I55S 4AFFA 3VHQA 5KFPA 4OJGA 3OL9A 5E5NA 4B9NA 1HI1A 4U9RA 1IR0A 3MECA 5I4MA 3SFGA 3BR8A 5F3TA 5KT2A 2C2EA 3IRXA 3LP2A 1JLQB 1KLMA 1IQZA 1WC0A 3TA2A 2ILZA 4RW9A 2ASDA 3W5XA 2UXBJ 4RL1A 1LWXA 1KS2A 2CQ2A 3PKMA 1AXQA 3M8PB 1IQTA 2O01C 3K8WA 3X1LB 4KKOA 3C3LA 2VQFJ 3E01A 1FJGF 1DBDA 3VAGA 1YRXA 3VAIA 4FKYA 1QD1A 4AXJA 3IWXA 4G1PA 4GVBB 3QYYA 1HNZJ 4OZ0A 4CDIA 4JI2F 4G3IA 2WONA 1M1KT 4Y34A 2HHTA 2EC0A 4PXCA 4M5MA 2L48A 3JSRA 1MMNA 4K5RA 3H40A 2GNKA 5H9EK 3HSZA 3I9ZA 2HSEB 2Z2LA 2DNHA 1DJ0A 3Q8YA 4FXWA 3CW2C 2F8EX 1RYSA 1P9QC 2WW4A 4ZVTB 3QJPA 5A8KA 5GADI 2ZUGA 5T7LA 1XTZA 2YWKA 1T8EA 4L72B 4KGKA 4LR8A 5AXKA 2PEBA 2ZH9A 1QAIA 4KHPF 4I69A 3KWMA 3PRBA 4LBIA 5DGAA 4RNOA 3A4TA 3GR0A 1RXOB 1VHIA 4F3QA 2XI2A 4NRUA 4Y2AA 4WYLA 4EGLA 1RWPB 2KH9A 2MYFA 2AQ4A 1LW2B 2OMLA 1WF1A 1SL1A 3BM7A 2QRRA 2DGXA 4Y2MA 1U0HB 1NK7A 3J7Z5 1U1NA 2YVSA 3GV5B 4EYHB 4G1QA 4NXMF 3GYGA 5CH7B 5LJ3Y 4RZRA 1H0HB 2C2KB 3HP6A 3AJ1A 3C16A 3BKFA 2XSJB 2CADA 3N6NA 4KV8B 4Z7YA 3J81j 4I6YA 1VJQA 2V4QA 5F3ZA 2DHGA 2LP4A 3MM5A 1YX2A 2LYVA 3IC1A 2CUYA 2J9DA 1KWMA 1UKUA 3VF0B 4RU2A 1FFGB 2YKNA 1V6HA 3T3FA 2D41A 4DDFA 1UFWA 1NEEA 1VRUA 3RW6A 4D3HA 1FEHA 5DDOC 4ZVOB 2QA4G 3N28A 1IBMJ 4Y0FA 2ZITA 1NPPA 3JTPA 3L7UA 3G82B 3PX6A 3M1VA 3OJUA 4O44B 4H4KA 3AOBA 4NASA 4YY3F 2M9KA 3GZ7A 3DLGB 2DGOA 4DX7A 1QSSA 3R7NB 4A46A 1FJGJ 3DLLQ 3CO9A 3LO3A 2IY5B 2E7WA 4USUA 2HVDA 3DC2A 3P96A 1XERA 1OJ4A 2HPUA 1X5SA 4CH7A 2V63A 2PDAA 3BGFA 1CJVA 3IXQA 1N5TA 2W4DA 1TZ0A 1VBZA 4JI2J 2DRAA 3RB6A 4OZNA 2BXJA 1TUWA 2K06A 4YDDB 5KFSA 4GKJJ 3G71S 3CCUS 2QSFA 5F9NA 2UUCJ 1VC5A 2CAJA 1VQOS 4PXEA 2CIMA 2RQCA 4ZN3A 3OHBA 2I5JA 1N88A 1FRXA 4XPEA 1YIJS 1WC6A 2DNKA 2W4CA 1FFSB 4M5KA 1AUSL 5KFFA 1RTIA 1VISA 5J1NA 5I3PA 3FDSA 2CPZA 4ZVUB 3CMAS 1Y5IB 4KHPJ 1VGYA 4DF4A 3NWGA 4KGVB 2APOA 4Q7AA 3H5YA 3C14B 4A8SA 4DSIA 3NLCA 3TUJC 3VVTA 1YRUA 3T9NA 3W5YA 4WIIA 3H20A 4A8WA 4FN5A 2ZEJA 2YKOA 4C8KA 3GFYA 3DLBA 2IRUA 1VDHA 3KOAA 4LF8F 5ADZA 3TVYA 4IFYB 2DR8A 4NXMJ 1SH0A 1JLQA 1U1OA 2JRSA 1NH8A 3BQ0A 2YPZA 4IRCA 4JP8A 5AJ3F 3I0SB 2NSCA 2DH9A 4B9TA 3E2EA 4OFZA 4UUWA 4KY3A 2F1FA 5EUHA 2FHKA 1CJTB 3TZZA 2PA3A 4JI3J 3G9CA 2K7KA 2CQPA 1TL7B 3NCPA 4RUAA 1RLCL 4MYTA 5RUBA 3QJLA 2CWXA 1Q8LA 1HNIB 3TI0A 1EJ7L 3EJMA 3GCWP 1RWNB 4RW6B 4GVBA 1S7HA 2HAFA 2QLWA 2QO3A 3KHHA 3HD2A 3PEJA 4ZPDA 1GH8A 5I3QA 1U48A 3LW5C 2YNIB 2HBRB 4LRDA 2ZZMA 3R5AA 4DR1F 3QT8A 4YY3J 2ZJRQ 4ZPCA 5KFEA 3GCXP 1G2EA 5KFZA 2HFNA 4U6PA 4XAKA 3HHLB 4CP5A 4BBYA 3I87A 1CEZA 4J9PA 1R0AB 1OSCA 3KMQA 1YJUA 2RQ4A 4DR4F 2BACA 3EXYA 1GTHA 4DFJA 4K7QA 4Q43A 3I5AA 4WXOA 4Y2CA 2HHHF 3DFEA 4OYOA 1H7WA 1SJQA 4YB1P 2VFSA 1VQMS 3PEHA 2VD3A 4RKUC 4E98A 1VBXA 4J9LA 2KYXA 1YDLA 3F73A 2W2QP 1LW2A 1TELA 1HBUB 3KG1A 2NQPA 2QN6B 2FGOA 5J1EA 4EBCA 3HHLC 1WEZA 2WSCC 2BZ2A 2VPWB 2DR9A 2M52A 1GQEA 5DLFA 3KNAA 4CLTA 1NZAA 2W8KA 2AIRB 4NCBA 2O5DA 2XSJA 3I56S 1TMJA 1AFJA 4KV8A 1DTQB 2NPFA 2E1AA 3RRGA 3VTIA 1KFSA 3FCHA 4C0BA 1ROFA 3TEHB 3VZHA 2C2MB 2VA3A 4IR9A 1JWWA 1PIEA 1XN9A 3HSDA 3PZPA 4M5IA 1UP1A 3Q8UA 4OI6A 2VODA 2AT1B 1TK5A 2HHVA 1KKHA 1UL3A 4QBUA 3FQLA 3NGTA 2Y1RI 2NXEA 4KFBB 1TKZB 1M1HA 3H2UB 3HFZB 4TQRA 4DI6A 3PJWA 1F5BA 1RAHB 3W2WB 3T5JA 1CJUB 3Q8PB 4J7CA 2ROGA 2IFXA 3KK2A 1Q0NA 2JWNA 3G82A 2B4UA 2ZH5A 3NGKA 2BJEA 2MZSA 4OYAA 4PUOB 4RPFA 2B6AB 1XMQF 5AJ3J 1F1BB 2WBRA 1ZAWA 3DLGA 3EVWA 3QMQA 2ASJA 5BYSA 3PW7A 4DG1B 4DQRA 3CDWA 1PILA 2WVCA 1VR6A 2BM1A 2XMAA 3PJ9A 3IP0A 3FBBA 3QO9B 2J6UA 3DLJA 1VQ9S 4CT9A 2P9GA 4ELVA 4WIQA 5IWAJ 2HFUA 5B0EA 4ZPAA 4LF2A 4DL2A 2L08A 4DR1J 4G65A 3DXBA 4OYPA 2NLWA 4F8RA 2LDYA 1P1LA 4V19X 1EKRA 1N56A 2FLPA 3EVMA 4USHA 1D3WA 4ID8A 2PMZD 4KR0B 1OS5A 2ZC3A 2XZDB 5IT4A 2K1RB 1B7YB 2CPIA 4DR4J 4EBEA 4J5OA 1T9WA 2VONA 1V5VA 3R9LA 2MQQA 3I9V9 1TFWA 4IO9Q 1FE0A 3BN4A 3ZZ0A 3C14A 2G0JA 1TL3B 3HXMA 3QAUA 2E9TA 4HHHA 4RBVA 1UA0A 1XBWA 2N3LA 3C2PA 3CEDA 5DDQC 3HDSA 2RE1A 2VBYA 4ZJOA 3R5CA 5FDLB 3H0PA 2C1EB 2H51B 5DM7Q 4IFYA 5THWA 4P7VA 1S12A 3LUYA 4MYUA 4RW7B 3K2YA 2J9CA 1FF2A 3ULHA 5KFDA 2QGFB 2KT5A 3I0SA 4FNIA 3ENVA 4RW4B 3D0GE 2E5JA 3KJVB 1I1GA 1GX5A 5D4NA 1YBAA 2W9AA 2KN4A 4C8MA 1E6VB 1R0BG 4LSLB 3R7SB 1U1PA 1SJ3P 1CJTA 4ZITA 1L3SA 2UUAF 1CULB 1MLAA 3EGZA 4WP3A 4X4PA 3F56A 3V6DB 4AL6A 1RYRA 4IRDA 3TARA 1Z2LA 1HNIA 3D7SB 3MFIA 3GV8B 4RW6A 3J81U 1D0EA 3JYTB 4KO0B 2VHGA 1YQHA 3RB4A 4P52A 2R7UA 1F9HA 2K3IA 4ANCA 3NNAA 2J0XA 2J6SA 2C2OB 2YNIA 4NZ7A 3QT5A 4DX6A 1N5SA 2GA7A 1N36F 2ZH7A 3ILJA 3WQPA 1RU1A 3SQGB 2JFKA 1VFJA 2A6OA 4DV5F 1NJZA 1TV6B 1U0SA 2ZJQQ 4B02A 1R0AA 1EIYB 2JH3A 4XDCA 6FDRA 3CJ3A 4O23A 4KSEB 1NNDA 4BCAA 5HMYA 4URGA 3MEGB 2IM3A 4FZVA 4JI0F 2W25A 2CJYB 2Z2MA 1IKYB 4F3MA 1RT7B 1Y00A 1HQEA 3BSCA 4DCPB 2CNLB 3VAKA 1NB7A 4ED6A 4LMZA 2IA6A 2DK2A 2GO9A 4NCAA 1WDDA 4KRWA 1MN7A 1I3OB 1PAUB 2BJDA 2XEXA 2KB2A 3C46A 1JNZB 4IH5A 5KG1A 1F6TA 5B0AA 1KTQA 3ISND 1IM6A 2V2KA 4ZLNA 5AE2A 2K8GA 1VBYA 1GK8A 3N6MA 5LMUF 2G1HA 4ICLB 1QAXA 4M5JA 4NLDA 3CF5Q 2DH8A 2HS4A 2OTLS 2PIIA 2R9LA 3WBZA 3GTYX 3TR5A 1RTHB 3V81B 2XZWA 2XCAA 2ZKUA 3NP5A 2G9OA 1HBNB 1NB2A 2BE2A 4P6QA 4MIAA 4N7TA 3VGVA 2MSSA 4TLQA 3LTOA 3HCXA 1U6BA 3T41A 4DL3A 1TKZA 5GAHI 4CLLA 4FF1A 2KZMA 2H5EA 4IQXA 2VBXA 1D8ZA 3W2WA 2EG1A 1CJUA 2B0GA 2GAHC 2BQRA 1NO8A 5C42B 5HL7Q 3PKYA 1EQMA 5IOLA 2V69A 4DR5F 3GR1A 3BDEA 2MZTA 4F25A 4PUOA 1IR1A 2B6AA 5D0RA 2EW9A 3V6KA 4WJBA 2XBPA 1REVB 2GMLA 5IQQA 3VGSA 4TU9A 5GAEU 1FFWB 2V9KA 2AX1A 2P5VA 1RADB 3E8OA 1JLAB 4ECXA 4DV0F 4DPWA 2L9DA 4O3NA 3MPYA 8AT1B 3OD2A 4M5GA 3QO9A 2V2VA 3IR5B 2UVUA 1NJYA 3LGNA 3GP9A 4DSLA 3QJJA 1F9EB 3OSPA 3T19A 1JXLA 1NKBA 1JJ4A 1KRPA 2AP6A 4U8YA 3MUMP 3J81Y 4MKVA 2ZBCA 5BJRA 3OVAA 3G4SS 3TNVA 2W24A 4CM2A 2XMMA 4O3PA 3M05A 2F7VA 2KDOA 3EZ5A 1UCNA 9ATCB 4DV5J 1NSKL 1U26A 4R5PA 4NRTA 3BSAA 4DV1F 1TKXB 2K1RA 3DRRB 5KFGA 4MIWA 2CA9A 3MEDB 5B0BA 4JI0J 2ZWPA 2HK2A 3PIPQ 2E9RX 1TL3A 2E44A 1NPRA 2C22A 1FD8A 2W7AA 2HEKA 2JLEA 2BE9B 2CPHA 4DQSA 1DZ5A 2XM3A 1FRLA 2R8KA 1FXLA 1FTRA 4XK8C 4QQBA 4DSEA 1UVIA 1XMOJ 3CD0A 4WP9A 2GCFA 5ETVA 5FDLA 5HBMB 2E9ZA 4RW7A 4O0NA 2VJVA 4CLKA 5LMUJ 3OTBA 1WOSA 2KFYA 3TZYA 3TQ1A 1NDPA 2AV5A 4W98A 4RW4A 3JSMB 3M6VA 5C5JA 3IM9A 4FNHA 1BQXA 4EFAC 3LQVA 1FXRA 1E6VA 3MD3A 4LSLA 4QYZJ 1CULA 3R6GB 4ELTA 5KFVA 3V6DA 4TY9A 2CZ4A 3HKZD 5B0FA 5F0UA 4J90A 4B3RF 1OMSA 1RWMB 3JYTA 4KO0A 3O2IA 2QA2A 4OIXA 4ZJLA 5KFNA 2NYHA 5IT0A 2WK4A 2QJ3A 2RUGA 3HI9A 3MMBB 4IDKB 1LWFB 4DR5J 3GJQB 2DT9A 2YNGB 3PYEA 5CD4H 3AOCA 3CCZA 1T95A 3L7PA 3PYDA 4O4RA 3MCSA 1FD2A 1NLKL 1FNXH 1XQIA 3VAJA 5EDWA 1DY3A 5SUHA 1SC6A 1ZTTA 3SQGA 3UQSA 2MQMA 3TAPA 3CJ8A 2O3DA 3IAM9 3H5UA 1TV6A 4DV0J 3RUBL 2A18A 1QUPA 4USIA 2CQGA 2D3UA 1X7VA 3OTOJ 2I0XA 2HK3A 3MEGA 4NLTA 5T14A 3H90A 4NLUA 1IKYA 1GTEA 4X4OA 4N41A 1SH2A 3U1LA 3CJ4A 1WTFA 3BB5A 4ECWA 2JEGA 1BC6A 3VZIA 1NMEB 1MU2B 2DBBA 2MTLA 4NLGA 1DHMA 2YWWA 1DRZA 2YXLA 4LSNA 5CHCB 1U02A 2JEJA 1ZS6A 1WEXA 2R42A 3OXFA 2GVZA 3R5GA 3EXCX 5K14B 2N3OA 2G4BA 3R27A 4K4XA 5E3CA 2XGPA 4DV1J 1IJFB 3MM8B 2B7CB 2ROPA 4U67Q 1IN0A 2FVPA 3EPIA 2EBEA 3V81A 4F0MA 3CJ2A 2MKSA 1DARA 1RT6B 2JLGA 3LPEA 4DR2J 5DQIA 1HBNA 2FVQA 5KAKA 5FLXU 2IVMA 1GMWA 5DETA 1QE1B 2HVHA 3IS9B 1WHVA 1ULRA 5HVFA 1M5HA 2VA2A 3MOJB 3KYLA 4RBUA 2BANB 2DYAA 2YWGA 2VQEF 3L4BC 3FK4A 5IZHA 4F0KA 1NXIA 5C42A 2Z57B 3NG8A 4DUTA 3SQOP 2QC3A 2HQDA 3AOAA 2A10A 4F4XA 4WP8A 2B43A 3LAMA 4ZVPB 2GQ2A 3CT9A 1REVA 4HLBA 2CQDA 2FJBB 2HVIA 4ECYA 2FIUA 1VMBA 1OY8A 4JI1J 3POTB 1JLAA 3QLHB 4GVLA 1MWYA 3TZWA 5KFUA 3PNIA 2RJZA 3BH7B 3ILOA 4DUYF 3NGSA 2GHVC 1OY6A 2IM2A 4EWTA 4XPCA 4V1Ak 1T9UA 2BYCA 3FCWA 3MCMA 2JOQA 2UU9F 1QSYA 1M5PC 4ZMMA 4RJVA 3QWPA 2DNMA 4IOAQ 3IWLA 4B08A 1RT5B 5BYQA 1YBUA 1RHJB 1ZOTA 3CCJS 2KXFA 2DGQA 4LFAJ 3R1HA 2RDIA 4AT1B 1U45A 4P75A 2B3TB 1TKXA 3DRRA 4HR2A 4V19J 3U1NA 3C6TB 4DL0C 3E3XA 5AE3A 3MEDA 2QMXA 1ZAXA 2X1BA 2CJXB 3I82A 2KO1A 5GAHU 2XHCA 2C2NA 4U96A 1NZ8A 1ZTWA 3B4MA 3MEKA 3NCQA 3M2UB 1N34F 3VQSA 3ICLA 4QWAA 2MLYA 5E3PA 5DDPC 2LXFA 2EFQA 4HKQA 4HL9A 1X4CA 5HBMA 1H74A 1CPZA 2RDJA 3PX0A 5BR8F 1S0OA 3IG1B 4QIVA 3MTJA 5HN0A 3O3LA 1RHUB 1YJ7A 2U2FA 4KGMA 3GYNA 4P2SA 2XC9A 2FHJA 1U6FA 1KC8T 1NHKL 2W7PA 1ZYQA 2HMIB 1HWJA 3R97A 4WTYA 2VC0A 3E51A 2B4VA 4HHJA 4C8LA 3D67A 3JSMA 2D74B 2ZJPQ 3JQJA 3QT7A 2RB7A 4P2MA 2WTFA 4HH1A 3UN5A 3DYAB 4P73A 1MROB 3KJNB 2IRYA 2QA1A 4I1TA 1PSDA 2E1CA 1S49A 1SL0A 1REGX 2Q3PA 4ZN1A 2MKKA 2E5GA 3I96A 1TU0B 2VQEJ 3H5SA 1BLUA 3PYGA 3MMBA 5DZ6A 4IDKA 2CQBA 2HKEA 1LWFA 2QZ8A 3PR4A 2YNGA 3GIRA 4GO5X 3QT6A 2GW8A 2KHCA 4B9UA 3EGVA 4A4JA 4HACB 3W60A 3IBCB 2L9NA 2YKPA 3J7ZT 1H3DA 5IM0B 2HVEA 3J80U 1PKUA 3EGWB 1OQ3A 3RR7A 4J9QA 4FYYB 2VUGA 1LK7A 5KFTA 2AGQA 4OYWA 2XZTB 3D9BA 5KT7A 2DGSA 2YKMA 1T9VA 3OXLA 5HAOA 2BEFA 2GQCA 3A8IA 1MSWD 2HNDB 1SVDA 1MU2A 1BXNA 2UXCJ 2UU9J 5KFJA 3H4DA 2DGUA 2LEPA 1SCJB 2VJUA 2XYGB 5A8RB 1B0PA 1VQKS 2R2TA 3HULA 3BZQA 4RUCA 4ZLJA 3AD7C 4WFBQ 2HRTA 2MPUA 2KT2A 5K14A 4J9NA 3IR6B 2IDLA 3TJAA 3MM8A 4FPIA 4UQTA 2BV3A 4N76A 4B3MF 1RP5A 3R2CJ 3I32A 1UFLA 3NS7B 2UV8A 3UO0A 5EHHA 1RQ0A 2CG4A 1VQ4S 3QSYB 2VZ9A 1UEKA 1WSRA 3QZ7A 1BY9A 3OL7A 3AQPA 1QE1A 3RBZA 2JFDA 3ZTRA 2G2ZA 3IS9A 2EFVA 3ITHB 4B3SJ 1C1CB 5F0WA 2WW8A 3TUPA 1E6YB 5BR8J 4A8FA 3M6UA 3SXLA 1XR5A 3ET6B 1WF0A 4OLOA 5LXRA 2B7BB 4WK3A 5I3UB 2QA4S 2YWHA 5D4OA 3GONA 2ASLA 4M1KA 4UTGA 3IA0A 1IM4A 4MFBB 3BYRA 1L5UA 4DR6F 2ZD1A 4FXVA 3AJDA 4GKKF 1AA1B 2FY8A 1I6JA 1S10A 2MMYA 3FRZA 3POTA 3KG4A 3PM9A 4ATNA 3QLHA 4JI8F 2C3MA 5KFYA 1XEZA 4ZA1A 3SDEB 3PHEA
chains in the Genus database with same CATH topology
1FNMA 4C98A 2BXJA 3MXHP 3ZZPA 2V0NA 1NK8A 5H9EJ 4TLRA 1HWUA 2UXBF 1B0VA 2R7OA 2WBMA 2JX2A 1JLFB 4ECSA 4M5DA 1TQLA 4YDDB 5KFSA 4ICLA 2RILA 3MM6A 4NXNF 3PW0A 3G71S 3CCUS 1LOUA 5CYMB 1F5AA 2QSFA 5F9NA 1S6PA 4R25A 3NAIA 4JI5F 1VC5A 2BBEA 2RMLA 2MSTA 2FC8A 1VQOS 4PXEA 1T7PA 2F8MA 4W90B 1TK0A 1FDBA 2CIMA 4ID5A 3AB2B 4DWIA 4ECTA 3NL0A 1DQ8A 2IM1A 2RQCA 1IKWA 3OHBA 4OLPA 5DG9A 1RTHA 2I5JA 3RYLA 3VWSA 3P49B 3NGDA 1N88A 2MZ1A 1FRXA 2ZHBA 1F60B 1ZZFA 3RAXA 2M8DB 3UCGA 4XPEA 1YIJS 4WE1B 1YJ9S 1N4LA 2DNKA 2W4CA 3QIPB 1S99A 1RT5A 5KFAA 2UVRA 2XWYA 1WHXA 1R43A 3CJKA 5KT6A 2VOPA 4FVCA 1TK8A 3J7A1 3UNGC 3RTVA 1KLNA 2C3UA 3TA1A 3I6PA 5KFFA 3V2UC 1RTIA 2YX1A 5J1PA 1R8HA 1WG5A 3H59A 2I9SA 3FFIB 1Y5NB 3H98A 2HGLA 1G1XA 3HVRA 3CWJA 5J1NA 4ED8A 2W7OA 5I3PA 1DTTB 1RWUA 1HI0P 3FDSA 1AUDA 4R8UA 2CPZA 3CCVS 1X0PA 1IKVB 3CMAS 4YUDA 1Y5IB 1FA0A 1S1UB 3AB4B 4DV2F 1ZETA 2NUUG 2QYCA 2RF2B 4QU6A 1VI7A 1HHTP 3CCSS 2YKQA 1VGYA 5GVQA 4DF4A 3NWGA 3H5XA 4ZKAA 2APOA 4Q7AA 4PXDA 4ECZA 4WK1A 2HHSA 3H5YA 4F02A 2WB4A 3OFGA 4A8SA 1IKXB 3L95X 3BDPA 1K73T 3KLGA 1R8BA 3AQOA 4MJKA 3HT3A 2U1AA 4OI2A 2AYMA 1NK4A 2I2YA 4DSIA 4K4SA 3NLCA 3TUJC 1G3OA 1O8BA 2KKHA 1YRUA 2MY8A 4H4OB 4TY8A 3T9NA 3CULA 1FJCA 4WIIA 1FKPB 4O3QA 2DRBA 3H20A 3M2UA 5L9XA 1S1VA 4A8WA 2IA0A 1F0XA 1SV5B 3K7RA 4FN5A 4KE5A 4DMZA 2MKJA 3ZZTA 4ZP6A 2E7XA 2YKOA 4OZJA 3HM9A 2GHWA 4C8KA 3GFYA 1V3RA 3DLBA 5D3GA 2K7JA 5JVGQ 5G0RB 4OI0A 2IRUA 5AXLA 3KK3A 3KOAA 4LF8F 5CZXA 5ADZA 3TVYA 3G8TA 1Z2ZA 2F40A 1DLOB 4IFYB 1U1KA 4FYDA 5J2PB 4PR6A 2DR8A 3FRYA 5JXSA 1SH0A 1JLQA 2GX8A 2VH7A 1U1OA 2C3YA 2JRSA 4K4VA 1NH8A 3LP0B 4K4WA 3BQ0A 3FQKA 4IFVA 1ZBTA 2IRXA 3IG1A 5K9FA 2D9OA 4OHVA 4OX8A 2OPRB 3CDUA 4IRCA 2CQ4A 3W2VB 1KVJA 5AJ3F 3I0SB 2NSCA 4O4GA 1VQLS 3OR2B 2VFRA 1LQ9A 2DH9A 2RSQA 1A6LA 3A1YG 1J5EF 4B9TA 2HMIA 4OFZA 4OZ5A 1AROP 4UUWA 3E2EA 1R8CA 4F4WA 5CXTA 1Q7LB 1KD1T 3AHPA 3KFWX 1BD6A 2F1FA 2HFOA 2N4CA 2R7QA 4LSNB 3M8QA 4M63A 4OHXA 4WU2A 4ZOSA 5EUHA 2FHKA 4C11B 3IRWP 2YY3A 1TP7A 1XMBA 4LVOP 1C2PA 5IQ6A 2KRRA 1AW0A 2MB0B 1U24A 4YHHF 3JAMY 2PA3A 3B8HA 3P3DA 5L1IA 3G9CA 2P6TA 4DX8H 2K7KA 5CQGA 2KJVA 2CQPA 4J9MA 5MLCV 2I38A 3NCPA 4RUAA 3HVAA 1EETA 4A8YA 3DYAA 4NPOA 4BDPA 1URRA 4QWDA 4MYTA 2UXCF 4DL4A 1M5OC 4LF5F 2AJ4A 3EGNA 1YTYA 1MROA 4MKAA 4NLVA 2E5LF 1GNKA 3QJLA 4ERDA 1Q8LA 2XY5A 1LV5A 1HNIB 2KXNB 3TI0A 1UA1A 3NCRA 2Q1LA 3ZZRA 3Q8RB 1T94A 4RW6B 3CCMS 1W2BR 4WZQA 1LXNA 4IOBA 4DEZA 1S7HA 1LFPA 1MNEA 2QLWA 2FJDB 4OV1A 4NMLA 5KFLA 2F4VF 5M2RA 1VQ5S 2QO3A 3LP1B 1S4FA 3KHHA 3H4BA 3K5OA 4NLRA 2RQKA 4FF2A 1B64A 2J76E 3QGHA 4ELUA 2Y0SD 3T6BA 3PEJA 4ZPDA 1PGZA 3PR5B 1GH8A 2EG2A 3DLKA 4HI2A 5I3QA 1HMVB 1U48A 3LW5C 3HFKA 2YNIB 3ISZA 3UCUP 2PE8A 5KFIA 3QZ8A 5B0DA 1Y7PA 2IBOA 1GXLA 2FVCA 4FF4A 2VV5A 4QWCA 1UAWA 3DRSA 3UD3P 2ZZMA 4LIRA 2ZC4A 3R5AA 3FEZA 4KPYA 4DR1F 1LWCB 3I4PA 4PPDA 4J9OA 2AX0A 2CJBA 2HYIB 3ENWA 4X2BA 2ZJRQ 2FLNA 3TUZC 1HA1A 2PA8D 3B82A 2GJ2A 3BREA 4ZK7M 2IAJB 2DHXA 5F8GA 3NNHA 4ZPCA 3MOZA 2BA9A 3R5BA 3SCIE 4TU7A 2AGOA 4QWBA 4DOZA 5KFEA 3WDOA 4PWDB 4UUXA 1G2EA 5KFZA 2HFNA 5KT5A 4X64F 5LT5A 2JL9A 4BS2A 4U6PA 3LANA 4XAKA 3HHLB 4WZMA 3SV4A 4BBYA 3I87A 4DV6F 1FO1A 3BF4A 1UEUA 1CEZA 4I6WA 5IM0A 1KN6A 4J9PA 2JLFA 5F9LA 3N79A 1FRMA 2EK1A 5J2QA 1R0AB 1S6QB 4H4MB 1OSCA 3KMQA 3J7YI 1YJUA 2RQ4A 2DIUA 4N77A 4CIOA 4DR4F 2HHQA 5K8MA 2BACA 1JLGB 3IO1A 1ZPVA 1YI2S 3MDFA 3EXYA 1GTHA 4DFJA 4DN9A 1IBMF 2AJ1A 1BQNB 5KOXA 4ILRA 4Q43A 4B3SF 3I5AA 3G6YA 4FF3A 1HBOB 4C8ZA 4WXOA 1X4DA 5KFMA 1SUQB 1UVNA 1P1TA 4Y2CA 1RT1B 5LJ5Y 2HHHF 1S9GB 3AY0A 3DHXA 2F8HA 3MPVA 3DFEA 4Q0BB 1H7WA 5D77A 2A3JA 2GFFA 4Q2LA 3J7YU 1T03A 3ZZUA 2P9EA 1SJQA 4YB1P 2VFSA 1VQMS 1X4BA 3PEHA 2VD3A 4RKUC 1VQPS 2YWEA 3M2VB 3G96A 4E98A 4OI3A 3SMZA 3BGRB 4OZ1A 1MMDA 4J9LA 1VBXA 1NK9A 2FLOA 2KYXA 2A2CA 4HT5A 3F73A 2W9CB 1C0UB 5U47A 1N6QB 2HNDA 1LW2A 5KFKA 1JB0C 1YJRA 3KLHA 1UVJA 1HBUB 3KG1A 4NCGA 4I7FB 3OSNA 4WFYA 2P9CA 2NQPA 3DRPA 4Y2IA 2FGOA 2CPDA 5J1EA 5F8IA 5KFQA 1SB6A 4EBCA 3PIOQ 1FKOB 2DO0A 3HHLC 1WEZA 2WSCC 2D1CA 5HROB 2YWFA 4JOUA 1HL6A 1WWHA 2BZ2A 2VPWB 3JB9k 1T3NA 5A8RA 2DR9A 2M52A 4RX6A 4MH8A 1GQEA 5LL6d 1N5VA 1S1WA 2VBZA 5DLFA 3KNAA 4QOTA 1NZAA 3UFCX 1FRJA 2W8KA 5IS2A 1JKHB 1VLYA 1S79A 1TUVA 4K2XA 4O3RA 3RR8A 2YX7A 4NCBA 2DGWA 4QR1A 2O5DA 2XSJA 3I56S 4ES1A 1HHSA 2Q43A 2FVRA 1AFJA 4KV8A 1DTQB 1RAJA 4A8QA 2NPFA 4Y3CA 2E1AA 1PC5A 2KFZA 2J0QD 1N5YA 4DFMA 4Y2KA 4NLSA 3S6EA 3RRGA 3NMRA 3VTIA 1KFSA 3GG0A 3FCHA 4QIGA 4C0BA 4ED1A 1ROFA 3VZHA 1S9FA 1JJ2R 3LPYA 4GKJF 3N9UC 1WACA 2CFXA 2VA3A 4R0EA 4B3TF 4DSFA 4IR9A 1JWWA 4OMFG 4FS2A 2FHJD 2Z4PA 4TYBA 2UUCF 4X4UA 1XN9A 1JLEB 3PZPA 3KK1A 1UP1A 4OI6A 1QSLA 2VODA 1TK5A 2ALZA 2HHVA 1UL3A 3US5A 3NNCA 2PC6A 2MDAA 4QBUA 2HHWA 3FQLA 2W9BB 1QJHA 3U7JA 5KG0A 4FPRA 5KFWA 2LU2A 2DGTA 2VFVA 2Y1RI 4KFBB 4NLXA 1J5OB 1HPZB 1TKZB 4YB7A 2RRNA 2VL1A 4ED0A 2AYGA 3FGVA 3CD7A 3H2UB 3M30A 1L3TA 3JTOA 2AW0A 5A8WA 2YKAA 2ZE2B 4TQRA 1HNWF 2JHEA 3PJWA 2J0SD 1F5BA 2FHMA 3RRHA 4CH1A 3W2WB 3HHDA 2CVIA 3T5JA 2R7TA 3Q8PB 2ROGA 3ITHA 3D1HA 1SH3A 2XMJA 5E3QA 3DMJB 1C1CA 3OR1B 2OLWA 2IFXA 5CA5A 1LW0A 3KK2A 2B56A 1RT4B 5KG3A 2QLXA 4ALZA 2C3OA 1E6YA 2JWNA 3OJSA 2B4UA 3VCDA 1AFIA 4UW2A 4LF6F 1ZPWX 4C97A 2QV6A 2ZH5A 3V6JA 3EUNA 3NGKA 3OVBA 2BJEA 2MZSA 3RB0A 2DJWA 5KFOA 2LKZA 5I3UA 4PUOB 1Q4RA 4MK9A 2B6AB 4ETZA 3SV3A 2HNZB 2LECA 2E5IA 3DOKB 4RW8A 1XMQF 2QEXS 3L09A 2WBRA 2DO4A 1F5CA 3VAFA 4UY8T 4ZCMA 1LK5A 2DNYA 1FRIA 1ZAWA 3D2WA 1CC8A 2VB6A 2XMUA 1RT2A 3DU5A 3DLGA 4QYRA 3QMQA 4MFBA 3FMBA 2ASJA 2DHSA 2M70A 4BC7A 2V9WA 3QPIA 2XLKA 4HI1A 1HNXF 5BYSA 1YSJA 3PW7A 4OHYA 4WYWA 4DG1B 3QGGA 3R1LA 4DQRA 3MM7B 1R31A 4X4RA 2BW2A 3G86A 4CO5A 2YX4A 4EZ6A 3CDWA 2Y1JA 2N82B 1X5TA 1PILA 4RW9B 1YWXA 4KC5A 1FNOA 2OO4A 5KG5A 4C4WA 2BM1A 2WRMA 4BHQA 3GSDA 1K8AT 1KNZA 1X4GA 1ZM2A 3ZZYA 2ATLA 3QO9B 1HBMA 2KXHA 2J6UA 5H9FJ 2MXYA 1S76D 1KQSR 3SDEA 2CQ3A 3VALA 4ECVA 4AYBD 1W25A 3OUYB 1Q8BA 1WI8A 3Q0AA 2XS2A 3DRXA 3DLJA 4ZVHA 3GWCA 2BQUA 2DIVA 3LWMA 2ZH3A 4JV2A 1VQ9S 3K59A 1O51A 2NSBA 1JLFA 2H9ZA 4CT9A 4KTQA 2P9GA 4MAKA 5KFHA 4N8OA 4ELVA 5F8NA 2R8JA 4UY85 2WSFC 5B0EA 5CYMA 1R7IA 4ZPAA 3WC2A 4F2SA 3FZ2A 5C24B 1T02A 1YVFA 3A8EA 4DL2A 1Q1KA 2L08A 5EWGA 5B0CA 2FPHX 4KHMA 3DXBA 2J0WA 4I0WA 2X3GA 3GYXB 4TYAA 2FHOB 4E8UA 3S01A 2NLWA 4F8RA 4JI3F 5J2NB 2LDYA 2DNLA 1P1LA 2XULA 4KB7A 3GILA 1J2VA 1RT6A 3CUNA 4V19X 2G0CA 1NKCA 2GGPB 3QIPA 3EX7B 3GQCA 1N56A 5A2QY 4RWWA 3Q8QB 2FLPA 4WU3A 3GG1A 3M6WA 2LQ5A 4YMEA 1XNRF 1GXTA 3OTCA 4USJC 2C2DA 4LUBA 4USHA 2OJ3A 1D3WA 2GO8A 3CSKA 4ID8A 3GIKA 2PMZD 1X5OA 3FFIA 4KR0B 1OS5A 2ZC3A 1M5SA 4AXIA 5IT4A 2K1RB 4K5SA 1DTTA 3IN5A 2CPIA 1LKZA 1JLBB 4M94A 4EBEA 3HMJG 5A6WA 4J5OA 4KAIA 1I94F 4DQPA 3MPWA 3O44A 1NH7A 2VONA 5K8OA 3DDNA 1IKVA 1WHYA 5CZVA 2MQQA 4DQQA 1S1UA 1BQMB 3I9V9 1XR7A 2FD2A 2RF2A 4YDXA 5B0GA 2L41A 1TFWA 2BANA 5CYJA 4IO9Q 1FE0A 3BN4A 3PRDA 3ZZ0A 4NLPA 1D9FA 5A8KB 5B08A 4PG5A 3DCAA 3QAEA 1TL3B 2MHNA 2PGCA 3HXMA 3QAUA 2MKHA 2E9TA 4GC7A 1YHQS 2ZHAA 4RBVA 4PRFA 1KQKA 4H4OA 1G7CB 1UA0A 2J9EA 1XBWA 2VPXB 1VQSA 2N3LA 3C2PA 3CEDA 2KTQA 1SKSA 3HX9A 1DFDA 2UV8G 4YEAA 2ZZNA 5DDQC 4ZVFA 4KIAA 1S0MA 1SV5A 3HDSA 5ITHA 2RE1A 2P6SA 3TAMB 4F2RA 1SL2A 2J8AA 2JDJA 4G6VB 4HDHA 1HWIA 1VQ7S 1JIHA 5EN1A 2VBYA 2B4PA 5HI7A 5G0RA 2M0GB 2HLUA 4QIFA 3KLFB 4PCQA 2RH3A 2HVZA 4XDDA 3R5CA 2R8GA 3MUTP 4WF9Q 5FDLB 2KG1A 5DM7Q 4C3LA 4IFYA 3EPGA 5THWA 2R4FA 3DU6A 5J2PA 2ZKTA 4DLGA 2V94A 4P7VA 1VQNS 4RBTA 3OV7A 3LUYA 2YKMB 1GT8A 4MYUA 4RW7B 2XMVA 5E3RA 2ZH6A 3K2YA 1YRTA 3LP0A 5BYRA 3K5LA 2J9CA 5L9NA 1FF2A 5GMKa 4DQIA 2JVRA 1NU4A 3ULHA 4HYKA 5KFDA 1OQ6A 5M2PA 2OPRA 3KG0A 4EUVA 3OVSA 2KT5A 4WKYA 4JV5F 1VHFA 4QW9A 3W2VA 4B9VA 2QFJA 3I0SA 1IBKF 2B9YA 4FNIA 3OR2A 3ENVA 4RW4B 1RJJA 3D0GE 1H2VZ 1VJWA 4O3OA 3L3CA 2E5JA 3MAHA 2PFFB 2VKRA 2HZCA 3KJVB 4NA3A 2UZAA 1I1GA 1S77D 3RZAA 2R8IA 1GX5A 4HVZA 5D4NA 5E2QA 1YBAA 2W9AA 2KN4A 4C8MA 4EO8A 1E6VB 4C11A 4LSLB 3N5BA 1U1PA 3ETOA 4G1QB 2MQNA 1HW8A 1SJ3P 1L3SA 2UUAF 1HYSB 4A48A 5HMZA 1CVJA 1CQMA 1UETA 3M2RB 4NLOA 3EGZA 1X4FA 2DCLA 2IJNA 2JJ4D 4MTPA 4X4PA 2XO7A 3K8VA 2OH2A 3F56A 4DV7F 3H2LA 3V6DB 2BVZA 2PSZA 2XB2D 1X0FA 2M8HA 4AL6A 5KT4A 2LEBA 1RYRA 4IRDA 3TARA 3M9NB 1U09A 1HNIA 1Z2LA 4QZVB 3MFIA 3GV8B 1UMJA 3AAWB 4RW6A 3OLBA 1D0EA 5KFRA 1KTVA 4MK8A 3JYTB 3G6VA 3PACA 4KO0B 5MAOA 1N0VC