4ES2A

Double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
84
Chain Sequence
HMMLVLITYDVQSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLGYTKVEHIGAKPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BH0342 protein
publication title Double-stranded endonuclease activity in Bacillus halodurans clustered regularly interspaced short palindromic repeats (CRISPR)-associated Cas2 protein.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 19
structure length 84
sequence length 89
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4es2A00
1ZM4A 1FNMA 3OQ2A 1ELOA 2E1RA 4QR0A 3ZZ0A 1ZM3A 2ZITA 3E3XA 4ZCKA 2EFGA 3LH2S 4FN5A 1U2RA 4TNOA 2BM0A 3B82A 2KDOA 2I8EA 1T95A 3ZZUA 1N0UA 2CVEA 4ES3A 2NPFA 4M1KA 2XEXA 4QR1A 1ZM9A 2BM1A 2L9NA 5G4DA 1P9QC 4MAKA 3UI3A 4ZCIA 4MYUA 4MYTA 2J7KA 2IVYA 3ZZTA 4ZCMA 4ES1A 2I0XA 2WBMA 3B78A 3EXCX 4ES2A 2BV3A 1DARA 1ZM2A 3B8HA 4ZCLA 1KTVA 4QR2A 1VI7A 1ZPWX 1N0VC
chains in the Genus database with same CATH superfamily
2CPJA 2BJ3A 3PX6A 4X64J 2XBPA 3HSZA 4FBUA 3AQPA 1L3VA 2X1FA 1V6HA 4ETXA 1KP6A 4IFVA 2IMOA 1S59A 4GVLA 1EQ0A 4LR7A 3WHIA 3DI6B 2EVZA 2KXFA 1U24A 1HWUA 5L9NA 3JTNA 4M5KA 1RT3B 2M70A 3UW1A 3I0SB 4AE5A 2GMHA 2PD1A 3W8PA 3MAQA 1K44A 1X4HA 3I6PA 3MZIA 1Z1ZA 1WI8A 3C6TB 1X9MA 4QWEA 3CNQP 2KTQA 4I0WA 1S77D 1FFWB 5H9FK 1QVFR 1R0AB 4FZVA 2W2PP 2FHKA 2H1YA 1ZM4A 2P6TA 4FS2A 2VA2A 3DRSA 1NMEB 2OD6A 1YJVA 3MD3A 3FSYA 2YKNA 4NLOA 1FTCA 1Q5VA 1WTBA 1FNOA 3ZZPA 3M8YA 4P72A 5IC4B 5T41A 4GO7X 4QBUA 2MQOA 3G6ES 3KMSA 4FKYA 1T0TV 2ZZMA 3OVBA 4I4BA 4GKKF 5C2CA 4DQRA 2HS0A 4GO5X 2MGZA 2XS7A 2CPIA 1KS2A 5KTQA 4YP3A 1GK8A 1SB6A 2X51A 2W8LA 5EWFA 4GRSA 4P75A 1YGYA 5B0FA 4HDHA 3RRGA 1AFJA 3LP2B 5LMNF 3LQVA 3C2PA 3UN3A 2QSFA 2CWXA 5LJ5Y 4NLDA 3MPDA 1M5SA 3MCNA 4M94A 2YWGA 1X5PA 3HD1A 4TY8A 4LRFA 3JTPA 3MCSA 3HHNB 3M6VA 2ZH5A 4UW2A 5H9EK 1Q8BA 4DDFA 4F0KA 2M9KA 5DG8A 3H5XA 2K7KA 4M5LA 3C14A 2WVFA 4UF4A 3UD5A 2FY8A 2DGSA 3CD6S 3DLKB 1RTHB 2JC1A 3W8GA 4HH0A 3CVKA 5FLXU 1K9MT 3OJUA 4D3GA 1I51B 3UVJB 2VOPA 1H0HB 2B5JB 1T3OA 2R8JA 3DLHA 3GFXA 3N01A 4EGLA 3GIIA 1DURA 4L3KA 4CLWA 2V8DA 2F8HA 4G65A 4J9UE 4G1QB 2IDEA 1QAXA 5IV3A 4EO8A 1O6XA 2GO8A 2QC3A 4PQAA 1WC6A 3G9CA 4RX6A 2W4PA 5IV4A 3BZQA 2PA8D 2XMUA 4F8RA 3D1HA 2IY5B 1W2IA 3W66A 4DX7A 4TKTA 4CO0A 2QTWA 1I6JA 3D0HE 3KK3A 1LFWA 2DGWA 4A46A 1VJWA 3I5AA 2CG4A 4LBPA 2B7CB 2F65A 4DN0A 3AJDA 5F0UA 1VLYA 2F1FA 3QYYA 2GHVC 7FDRA 5A6PA 1KDNA 1UETA 3OHBA 3DLEA 1I3OB 1HNZF 2BOAA 2UV8G 2W9AA 3D67A 3GU0A 2DVIA 4KC5A 1CC8A 5LMUJ 4IG3B 3MM9B 1B4SA 5IT4A 2FVQA 5DDQC 1S4FA 3DXBA 2HGLA 2MZJA 4WFBQ 2AJ2A 1QTNB 5L9XA 1RHUB 5HMYA 1EKSA 4CDIA 1OYEA 1HNVA 4QR0A 3HFKA 3BH7B 3MEDA 2V68A 5LXYA 4F4ZA 2NS1B 3K5NA 2X1AA 3ET6A 2DRDA 4OJ3A 4DFPA 4P10A 1GTEA 2PMHA 3B6BA 1ZM2A 2H5EA 2XTJP 3KJNB 2VQFF 4WBFA 5E41A 4HEA9 1B99A 2J76E 4Z2XA 5HQ8A 3RW6A 5D4LA 1S6OA 3AOAA 1NSKL 1S1XA 3GJSB 1S10A 4JBCA 1IBKF 4WYWA 3MR3A 5IQ6A 4CZCA 1HL6A 4NA1A 3NG8A 2Z4PA 1FKPA 1RT5B 2J7UA 2J7KA 4RNNA 3S7RA 1VCTA 4F3QA 1RWWB 4N5SA 3JYTB 2EW9A 3JSRA 1KRPA 2RVJA 4DR5F 3BB5A 4ICLA 4Y00A 2R8GA 3BGOP 1C0TB 3BPDA 3ZTSA 1IKXA 2XYGB 4HTIA 3AAWB 4IYQA 3DLGB 1GMVA 2CQHA 3R1LA 4USTA 2MHEA 2XWXA 1FHTA 4IR1A 3QJJA 2GJFA 4AL6A 4ZVUB 2W25A 2C2KB 3U1NA 3R7NB 2HLTA 3K8WA 3KK2B 1KFDA 4QYZJ 3CCES 2Z30B 2ROEA 1RGVA 3NCQA 2YKAA 4Q8FA 1R31A 3DRPA 2VG7B 2RH3A 4RBUA 1TAUA 2JL9A 1UWBB 2KRBA 2FC8A 1U6BA 3LGMA 1WEYA 3DI6A 1GH8A 4ITSA 1UAWA 3IM9A 4EK2A 3QGPA 4RKUC 2ZKTA 1F9HA 4ED6A 2LDIA 3KNGA 1FDDA 2ZH1A 1N32J 4DV3J 4KGMA 3TEHB 3T6JA 1CJKA 3NWRA 3BGRB 3HCXA 1NH8A 4J7CA 4X66F 4NXNJ 2C3MA 5D15A 3FQLA 2VIHA 2VBWA 1MU2B 4NRUA 1T9YA 2HAFA 3QIPA 2HWTA 3TWZA 4C7QA 1ZETA 4W92B 3I87A 3VAMA 4B3RF 4AYBD 3IXQA 2EBGA 3M32B 1D8ZA 5DG7A 3D28A 2OH2A 2YQ3A 2KT2A 4CH7A 4BWMA 3FSIA 4KB7A 5HMWA 3I5BA 5CZXA 5D3GA 2R3VA 3PXGa 2UXBF 4U67Q 1OY9A 2YWEA 1EP4A 2R9LA 5H9FJ 2CJBA 1F5BA 1JLAB 2C2EA 3US5A 5BJRA 1RA7A 3SBMA 1WF2A 1NBEB 3EXCX 4F26A 3LP2A 2PSZA 2MQMA 2YTCA 3QFHA 1KWMA 4PG7A 2HNZA 3FEYB 1XMQF 2MLYA 2OELA 3O44A 1AW0A 3KJVB 1TKTA 5F9NA 3D6FB 2AX0A 2XI3A 1RTDA 4YQWA 3CJ4A 2F4FA 1O51A 4A8WA 1NSAA 3H59A 4DR7J 4OYBA 3EX7B 5KG6A 1TKXB 2VV5A 2QYGA 2DRBA 2OJ3A 4RUHA 4LF9F 5ETKA 5IT0A 4FYWB 1SIWB 1IKYA 4QW8A 1FDBA 4BDPA 4ZS6A 4YS2A 2HK2A 4C3KA 4DV7F 5GADU 3UVJA 5J2PA 4WP3A 4L76A 4ZCIA 5A2QU 4ECVA 3M2VB 3TUJC 2B5JA 1VBXA 1Q86T 3EUNA 3NNHA 3TUZC 4OIXA 3QRRA 3NGKA 4E8UA 4DPUA 1FXRA 5KFFA 2XWYA 1S1UB 2AYGA 2DGQA 3ENAA 1XR5A 1F60B 4U7UD 3OW2R 3MI7X 1UJ6A 3CCWA 1WNEA 4OI0A 5KOXA 3DYAB 2IDLA 1KHWA 3DGPB 1WI6A 4DV0F 2OEKA 4YB1P 1GT8A 4BS2A 5H9EJ 2DGVA 4ZA1A 1ZZFA 5KFRA 4AXIA 1U48A 4FXVA 4DMZA 4RZRA 1HQ2A 1N5QA 3NGUA 4WJBA 1X5OA 4CTAB 1R89A 3L3CA 3RRKA 1AT1B 2HFNA 1S1VA 3M8WA 5A8KB 1H73A 1HWJA 1CULB 2GV1A 1B0VA 2CADA 3VF0B 4E98A 4FNHA 3PW2A 1O0PA 5B0DA 1ZA1B 1A7GE 2KJVA 3HZGA 3MECB 3HFZB 3D6TB 2KDOA 1UW4A 2V67A 3HXMA 3QLHA 4BWJA 2PEHA 2FVRA 1SL2A 5K9FA 2JEGA 4ZPDA 1Q78A 3PW5A 1SQFA 2GQ2A 4FVCA 2W01A 1AXQA 2FVSA 3F44A 4TLRA 4WU3A 4IQMA 1U47A 4NZ6A 3RBZA 1Y9OA 1LWFB 5J2MB 4DV5F 4B3MJ 2CQBA 4NA2A 4BHQA 4LF4J 4K4XA 4XIUA 1RT4B 2E7VA 1AB8A 3GV7B 4DUZJ 4OYPA 2VB6A 2KKHA 3BDPA 2WW8A 1GEHA 4F02A 1RT7B 4NLSA 2KRRA 3D6MB 2QFJA 4JYAF 1I94J 1RT5A 3EGNA 1S79A 2Y0BB 4TVAB 4NXMJ 1U49A 2D9OA 2BYCA 3TX8A 4KO0B 2CUYA 3GILA 2A18A 4Y2KA 1NJIT 2UVUA 3J7A1 4DSLA 3VGTA 5KT7A 1PG5B 2DHSA 1BMQB 1KR4A 1URNA 3CWJA 1R8BA 2CNKB 1OPIA 1HMVB 1M5KC 4YY3F 2FGCA 2CQIA 4F04B 1U0HB 4DXLA 4CRJA 1WUUA 3PNIA 1RE1B 1KQSR 4LF6J 3UR3C 3W5XA 2DCLA 1JWWA 4Y6IA 1SL1A 2YKOA 4LF8F 2VG5A 3PTWA 2FIUA 1V3RA 1JLFB 3GZ7A 2UXCF 4TU9A 2BJDA 4EMDA 3DLBA 2DNQA 1C0UA 3CJ8A 2FC9A 1S5ZA 2EFVA 2VKRA 2AX1A 1RU2A 5KFEA 2EFQA 4KH0B 1SL0A 2O3DA 2WVBA 3H5SA 2UVWA 3W2WA 1GXLA 1VRTB 3PVXA 3WC0A 1XJWB 4W98A 4ZCKA 2RILA 2BM0A 1H2VZ 3CE8A 1M5PC 4IOAQ 1SKSA 4DN9A 3QWUA 4WFYA 2RRBA 2FQQB 3PG9A 4NYPA 1M5VC 2N3OA 2L9DA 1JK9B 3W9IA 5E2QA 4USJC 1YI2S 1HIYA 1U0SA 3WC2A 3RB4A 4B3OA 3CXCR 3FCWA 1IKWB 3VZIA 1KSPA 5HROB 1OSCA 1KTVA 1GNKA 4DV6J 2FLLA 3RBEA 4DQSA 4X4VA 2MJNA 3ZTRA 2V9KA 2Y3YA 4ZP6A 3BJYA 4YUDA 4GKJJ 3DLLQ 3TA2A 2ZH3A 5CYJA 4MIWA 1Y0HA 1XMOJ 2W4CA 4DPWA 3HHLD 5IXUA 4USKA 2XS5A 5HP1A 2ZJPQ 2NYHA 2YQ1A 1SCJB 3FBCA 5AJ3J 1GFWB 4OYXA 2ZFHA 1Y7PA 1H72C 3ITHB 1M5OC 1VQNS 3CIZA 4LBHA 2V69A 1N34J 4LJMA 2X7IA 4TQRA 1UVJA 3MR2A 1U02A 2A3JA 4FNIA 4XK8C 4A8SA 1W2BR 2WHOA 3PX4A 1N54B 3PJXA 2NZCA 2AYMA 3U7JA 4CLUA 4RWXA 2R7VA 1FRXA 3J81Y 3VAIA 5F8MA 4D3HA 2JRSA 4U7CA 2FHJD 1CJTB 5E0OA 2E7XA 4C48A 3DOMB 4BC9A 5BYSA 2DH8A 4M63A 1A0OB 3HT3A 2BE2B 1OSDA 2E5LJ 2YWWA 3TVZA 2W1BA 3ZO7A 4UOGA 3HHLB 4W90B 3T5KA 4RU2A 2KT5A 3FKBA 3S01A 4N76A 1NAQA 4C2MA 3CCQS 3Q0AA 1Q8LA 4YB7A 4CLKA 4RW8B 2XY5A 4DSIA 2VFUA 3L4BC 3T6BA 2J0WA 3GV5B 3VGUA 3BBFA 5A8WB 5CHCB 5E5NA 3JXOA 4IH5A 1ZAWA 1KQFB 3H2UB 2I1RA 3GCXP 3SQGB 2UXDF 2HQ3A 5KFAA 2ZZNA 1S1UA 5CABA 4JI0J 3HM9A 5KFXA 1YJRA 2HWIA 2VG6B 3NEKA 1F6TA 4NCAA 1R8AA 3ISZA 4RNHA 1NDLA 4YDXA 3DYAA 4FKXA 2CDQA 3DGPA 3R9LA 3NNAA 1CC7A 2I6WA 3PKYA 2MQPA 3SSSA 2MZ1A 4PYDA 4F4KA 5HK4A 3OTCA 4ECXA 3JS9A 2HS4A 1SH0A 2VPXB 5E7OB 4WFAQ 1MROB 3TAQA 1JNZB 2MYFA 4UT4A 1FKOB 4OX6A 5HLFB 2BABA 4A8XA 2UUBJ 5A8KA 4UY8T 3B78A 5IOLA 2LYVA 1CULA 2F40A 2YY3A 1RBAA 4MK8A 3M8ZA 3OXLA 5IT9Y 1DQ8A 1GXTA 3T5LA 3IS9A 5KOWA 3KWMA 3MEEB 2IM3A 1HBOA 3MECA 5IS2A 4JI2J 2BRKA 5K5MA 3GR0A 4EBCA 3SFGA 4LT6A 3RBXA 4DR3J 4QIEA 3A8JA 1X0FA 5CXTA 2LP4A 1FJCA 2HRUA 3SZ2A 2E1AA 4O3SA 3MM5B 3Q8RB 3DDKA 1VQMS 3W7BA 4HT5A 3CMES 2QMUB 1VQYA 2IVMA 5KFHA 3ISND 4IG0B 3PEHA 2QA4S 3AB4B 2UUWA 3FMWA 2AV5A 3GFHA 4M8LA 4ZPTR 1QSSA 3JAMY 2V5HG 4KHPF 1RT1B 1RT4A 3P5BP 3IG1B 2EFNA 3I31A 3D66A 1X5TA 1RT7A 1TL1B 1HWLA 3HX9A 2YNIB 1F9EB 3H42A 1ACMB 1QAJA 2AJ4A 4QOTA 2Y8YA 3GB0A 5RUBA 1WF0A 2RQKA 3BBCA 5JXSA 2ZJQQ 3CCTA 3C15B 3LAMA 3NGTA 1N52B 2JEFA 2VQEF 4DV4F 2BANA 2WRMA 3K5MA 1RTZA 2V2VA 1PJ6A 2N3LA 4WFNQ 1GTHA 4CLFA 2C28A 4IFYB 1E6YB 5KFBA 5GMEA 1NJXA 3QNWB 5CYMB 4QYRA 4CLLA 1U0HA 1RXOB 2OPQB 3TA0A 4ZJQA 2HHUA 5BR8F 3FRYA 1T9VA 5KT4A 2WTFA 1Y5NB 4LRCA 2M3DA 4PPDA 1VQOS 1R6YA 1U1KA 3CW2C 4J9KA 3CF5Q 4OI2A 1IKVB 3MMCB 2W7OA 5F9LA 2CQPA 3PO5A 2K06A 3H40A 2RKIB 1P6TA 3MMBB 1UEUA 4OQJA 3HSGA 1RTIA 2ZKUA 3R5DA 3G2XA 3MPYA 1VRTA 2E5JA 5KFVA 2H5IB 1F9FA 3DU5A 1NDPA 3CUNA 2XLIA 2J8AA 4R0EA 2QA2A 2RE1A 2HVEA 4TLQA 3TO8A 1G7CB 2R7TA 5DQGA 3O6QA 1WG1A 2VU5A 1CQNA 4ED3A 2A6OA 2KJWA 4CH0S 4N7TA 3G8SA 3TOQA 2YNHA 2GQQA 1G6BA 1HBMA 1IKWA 4EZ9A 2B4UA 3V6KA 2MKIA 2HVIA 3N4WA 2CJ9A 4WTYA 1H74A 2B8PA 2Q66A 3AOBA 3UDEA 2LEBA 1NHVA 5HSPA 4OL8A 1R7IA 4O44A 3WDOA 2FB0A 3E8OA 4NI2A 5H1SV 1DARA 2MJUA 3RB6A 1FK9B 4LR8A 1S57A 3BPSP 3ITHA 3W9JA 4IQXA 2ZHBA 2RRNA 1UZDA 2J6UA 1N5TA 1FE4A 4X4PA 4LF7J 3CSKA 3HZEA 2E1RA 2D3O1 1U7LA 2CNOB 3PRVA 3QAEA 4JI8J 3VAFA 2YKMB 2CPHA 3CCUS 3GIJA 2M4MA 1VC0A 3AFGA 4NLYA 5CYQB 4O3RA 3K0JA 1OO0B 1WOSA 3KHLA 4JI7F 4KYZA 4OHWA 2G2ZA 3SYZA 2IVYA 2D3ZA 1X4DA 5KFPA 1GMWA 5B09A 1NCLA 1KC8T 4G1PA 1LWCB 2ALYB 4IRDA 2KG0A 2IPOB 3NL0A 4UY85 2F9JA 2XLKA 4DSKA 3AH6A 1T05B 2JOQA 4KGZB 3K2YA 1F5AA 5L46A 3E01B 4WE1B 5A8WA 5CA5A 1YBAA 2VDIA 2P6SA 3H7HB 3C3LA 3PCOB 5J2QB 3GE9A 3R7BB 1RISA 3SQGA 3DLJA 3PR4A 1C2PA 1B3TA 2B8QA 1UFKA 1RHMB 1N36F 3V6JA 2VG6A 3CCMS 4FYXB 1D9AA 3E2EA 2JSXA 3AA9A 3EGVA 4UOCA 4H4KC 3A12A 3WIVA 5CCMA 2NUHA 2V4JA 4DL2A 2E1CA 2BACA 3R6LB 4NEYA 5GADI 5HL7Q 1NK8A 4UUWA 1NSPA 4ZVEA 5D4PA 4B08A 3Q23A 3MR7A 2F4VF 4RW7A 1FKOA 2NXEA 3OL7A 1UVMA 3RR7A 1E6VB 1YDLA 2QO3A 2UUTA 2R2TA 1KQGB 1SKWA 2CG8A 2MDAA 1HD1A 1YWXA 3AT1B 3P5TL 5LSLA 2DIUA 3OUYA 2B4OA 1CJVA 3RW7A 2OUGA 4L73A 3UO0A 4ZVHA 2KO1A 4N77A 1K0TA 3D6HB 2EEYA 1IVZA 2QFIA 4K4WA 3ZZRA 1S6QB 2OPRB 2SXLA 4PXDA 2HQGA 4NOHA 1N0VC 2CJXB 2GJIA 3K57A 3IBCB 2D1CA 1LFPA 3MR5A 5FLXY 1ZTWA 3VV2B 2ZH8A 4QR1A 5DO2A 5B0BA 4K5SA 2HNYA 3O8WA 3K7RA 2BZ2A 4ZVOB 3AB2B 4E0DA 1WKLA 3BSNA 5B7WA 1JKHB 4IDKA 3HFVA 1V3ZA 4J9VA 1W26A 2NSCA 3OD2A 1XC9A 4K59A 4DR4F 3CDEA 2ZNYA 2MEWA 2RU3A 5AE1A 2J0SD 2FY1A 1Y10A 2GVDB 4NCGB 2CQ4A 4LSLA 2DR7A 2D7SA 2MHNA 5T7LA 1TL1A 2YNIA 3D0IE 4DV1J 4P74A 2EXUA 5K14B 1Q79A 4RW6A 1NZAA 2LQ8A 2L48A 1TP7A 4FF2A 2OFHX 3C15A 1BUXA 4B3TJ 1IJEB 4TU8A 5L8RC 1NKCA 3FBEA 2H4YB 3H8YA 1BHNA 2EK1A 4MFBA 1UPPA 1Y3KA 1J2VA 4DLEA 4IFYA 1E6YA 2VFRA 1S6PB 1R8PA 4B9UA 1S9GA 3GIKA 3G82B 4DLGA 2XSJA 3SIPB 4KR0B 4KBIA 3KDOA 2OPQA 4N8OA 3ZTOA 2ZE2B 1KVJA 2CXEA 3UN5A 4NZ7A 1A6LA 2RUGA 1RWPB 3T5HA 1VRUA 3POTB 3S1TA 3THVA 4KKOA 3CC4S 4ZIWA 1HQEA 1LXNA 1IKVA 3MMCA 2F63A 2Y9HA 2L41A 3GFYA 2FUG9 3EZUA 1IR2A 3T3FA 1RAIB 2MKCA 3KLGB 4WK3A 4OYMA 3TA1A 4X4UA 1HD0A 4ECRA 1UMJA 2H54B 2ZEJA 3LA0A 4DEZA 1GAOA 2XZTB 4KSEB 2RQCA 4DR1F 2VF3A 2UUCJ 1S12A 3HSDA 1RWNB 3AD9C 1FRHA 4J9PA 3P45B 2I9SA 4CLYA 1FFGB 2HSEB 3J7Z5 1R3NA 3EE3A 1IM4A 2OI2A 2I0XA 3MUTP 1FJEB 2PA3A 3HVTB 1IWAA 4FF4A 1AZSA 2WSCC 2AGPA 3ETMA 3Q8YA 3JSMA 2BKPA 2IAJA 4AFFA 3MOZA 4YR3A 3GYXB 4ECSA 2RQ4A 1O5JA 2I5JB 4DQIA 3TQEA 4ZITA 2HMIB 4FDFA 3FJ2A 2JFKA 1JLGA 2B4VA 2BJ9A 4DL4A 1XR7A 4DPYA 5KT5A 3PJ9A 4CO5A 2J9EA 1CEZA 1RHKB 5LOQA 4USHA 1DTTB 1UVLA 2FJVA 2M5YA 1R8CA 1T7PA 4ANEA 1L3SA 1NPPA 5LJ3Y 5DLGA 2DXDA 5AXLA 4GC6A 1LKZA 4A8KA 1FK9A 4G6VB 4NWBA 3KJFB 1HWIA 5JMNA 2HBQB 1DJ0A 1IR0A 1UEVA 1DZ5A 2JHEA 2CVIA 5C25A 3LGHA 1YQHA 2DB1A 1QLNA 3MGJA 4NLPA 4YEAA 4R0JA 4CIOA 2GFFA 1ROFA 1WG5A 2G4BA 3W61A 3R1HA 2LA4A 2VFSA 5KAKA 4K8RA 3NNCA 2GGPB 3HHLC 1KKHA 1M5HA 5CYQA 3CPWR 4K4ZA 2GMLA 1TK5A 4LFAJ 4DUYJ 4C8KA 2P9CA 1VQKS 2KN4A 1Q5YA 2RS2A 1EX8A 5D0RA 1DLOB 4CLZA 3TEGA 5KG0A 2JEIA 1VDHA 1NUEA 1TVRA 1LW2B 3NAIA 1C1BA 1FA0A 2Q6CA 4PEOA 4YB5A 3ILOA 4WIIA 1VJQA 3E01A 4GMKA 5LXRA 2O67A 4UQTA 5B08A 5IC6B 1HI0P 3HJFA 3PZPA 1X4GA 2NCKL 5J2QA 4HACB 3AJ2A 4DFMA 1F3FA 4KT0C 4IKAA 3QT8A 1BQNA 4AQYF 4YN3B 4R8UB 1FDNA 1YG0A 2MKHA 1LQ9A 5AXNA 2IM1A 4MKVA 2GZOA 3DRRA 4JV1A 2OGUA 2R7SA 4AT1B 2ABYA 4NASA 2GNKA 3NOCA 2XS2A 2HVHA 1FD2A 4DV2J 3KUHA 4EYIB 1FJGJ 3OPKA 2JFDA 4USMA 2ZUGA 2YKPA 2ZH7A 3CD7A 1U1MA 5DG9A 2J5AA 1SVDA 3M2RA 4TY9A 2B4PA 2F8MA 1VQ4S 2HVDA 1TL4A 1ELOA 2CIMA 3ILJA 3PEJA 5GAGU 3C6UB 2MLZA 3OBIA 2PC6A 2J9DA 1IR1A 4ZPAA 4KGKA 3TR5A 3PJWA 3LP0B 1NK7A 3PW0A 1N6QA 1NZ8A 2IYGA 3BKFA 4MH8A 2BUNA 1T11A 2FLPA 2B0GA 4URSA 2LEAA 5MLCV 4X2BA 3R97A 2WONB 1YVFA 3M1VB 5HATA 5IZHA 4URQU 2JZ5A 1WHXA 3KLVA 2V2KA 3MM6B 2XG8A 5A2QY 4P73A 1FTRA 3CJ3A 3FBBA 4PABA 3D7SB 2IBOA 1LWEB 4LF2A 1SJ3P 4DX8H 1RSCA 4LR9A 2MQLA 4DL6A 5KFIA 5C7PA 5L38A 3FSXA 4X4OA 5ITHA 1TKZA 3QO9A 2GVDA 3UWTA 4A48A 3PIPQ 4HHHA 3MURP 2YQ0A 1Q95G 1VOMA 2E9RX 2HFOA 3VVTA 3S8SA 4OI6A 1QUVA 3V6HA 3GWCA 1KNZA 2E5HA 3M7VA 1RUSA 4UZBA 2CQDA 5IWAF 4NXMF 3VR1A 5C42B 4Q44A 1VK8A 4WPAA 3BS9A 4O4RA 1Q16B 3IAM9 1RA6A 1N48A 4EBEA 1YIJS 3F0NA 4WCEQ 5I4MA 1ZA2B 1BXNA 1R43A 2I38A 1Y5LB 4L72B 1LEOA 2ZD1A 4YR0A 1IBLF 2MY7A 5CZVA 3NP5A 2VA3A 3CJ2A 4LRDA 8AT1B 4XAKA 3TUIC 1NPKA 1EARA 2RD5C 4ZP7A 4LF6F 2YX1A 2QG9B 2KYXA 4CYUB 1D8YA 4WYLA 1HNIB 1WHWA 3K89A 2DNRA 3ZZYA 2MKYA 2D3UA 2IJRA 4MMOA 1JNRB 5K8OA 3T9NA 2MY8A 1WWHA 3OL6A 1HFEL 3BEGB 2GHWA 3T19A 2IA6A 1BGXT 2VICA 3LW5C 5KFWA 2VODA 7AT1B 3KMQA 2WCXA 4HL9A 4ANCA 5GMKa 1YRUA 1ZM3A 2NLWA 4O3NA 3JTOA 1VS3A 4RL1A 1RK8A 4B9LA 3MM8B 3MMAA 3KG1A 3MPWA 2F5GA 4M5IA 1CS4B 4RNMA 3KLHB 2Y8WA 2BQUA 3HVRA 5KFJA 4NZ0A 2ZHAA 5HJYA 4DR6J 2I5JA 3N6MA 2HMIA 3ILLA 4P2FA 1CSJA 3MUVP 4KGVB 2VC0A 4K4TA 5M2RA 2KT3A 3V5RA 1X0PA 2W24A 2HFZA 2AJFE 4LIWA 1RT2B 3GG1A 4F0HA 2E9TA 4OMFG 5HO4A 4GKJF 1S6UA 4LQ9A 2GAHC 1XMOF 1SPBP 4DL7A 1BD6A 3T9ZA 5L1IA 4ALZA 2R2SA 4OZ3A 5KFTA 4F3MA 2GQCA 2VPWB 3TANA 4NYZA 4E2FB 4HI2A 1SKUB 4DZ6A 2DIVA 4ZPCA 1T03B 3ENVA 3BGUA 1VISA 3F56A 2GJ2A 1JJ4A 4KGXB 4DCPB 2MKKA 2FZCB 1REVA 4MAKA 2OHDA 4NLGA 1B7FA 1JXVA 2W9BB 2VQFJ 1WC1A 5K8PA 2K8GA 4EEYA 3IGNA 3FMBA 1HHTP 1M1GA 2YWKA 4O0NA 2GGPA 2YNFB 3DMJB 3E3XA 3OHAA 4P52A 4A8YA 4RBVA 1HBUA 4CQ1A 2B3TB 1G1XA 5JJBA 4B9MA 3OTBA 4PG6A 2BV3A 2PT0A 4I6YA 1Q82T 3NGDA 3NCRA 1WSVA 1DLOA 4K2XA 1LW0A 4I7FA 4TXSA 1RWOB 5C2GA 3G87A 3NS5A 3CMAS 2IFXA 4F0MA 2QMWA 4J9LA 2HS3A 3IFEA 1LW2A 2QMXA 2ZBIA 2KVQE 1XNQF 1PJ7A 5I3UA 2HAIA 2UU9J 2IBKA 2HFUA 4CT8A 1KBRA 7FD1A 4CM0A 5J2NB 4ED7A 3NY0A 4LVOP 4KE5A 1HBNB 1LXJA 2MZQA 2X1GA 1RB0A 4V19J 2BJ1A 3OR1B 2JLFA 1HNWF 2B6AB 5E3RA 1CJUB 3HP6A 4Q0BA 2ATCB 4PWDB 3L95X 1UFLA 3BYPA 1WC0A 2NPFA 2E66A 2N7YA 4KTQA 3KUEA 4ZLPA 1VGYA 1ZPVA 3OL8A 2A10A 4YHHJ 2BE7D 4K4UA 1SJ1A 3TRGA 2DNGA 5T14A 2HNDA 1UA1A 2UUBF 1SC4B 3OTEA 2DNZA 4OZJA 5J1EB 2MQNA 5FDLB 3KOAA 3IR7B 2D9PA 1ZYQA 2BE9B 3GQCA 3BSAA 2OPPA 3UCZP 4QQBA 3WQPA 1XBWA 3UDCA 2P8IA 1VLOA 5U47A 4JI2F 1CPZA 1IBMJ 4XPEA 3M1VA 3BSCA 4TN2A 4DR3F 4X66J 4OZ1A 2VOOA 1NHUA 1YLXA 4Q2LA 1NEEA 4DL5A 2CJQA 3MM6A 3QWPA 4K50A 2ZDOA 1X4FA 3FFIB 5I42A 3HD2A 3IGVA 4RWWA 3OQ2A 1MG7A 4DSJA 3CJKA 4F4YA 1YJ7A 4OYZA 3IM8A 1NDCA 3R5GA 3SDEB 2EG1A 2MQ8A 3ZC4A 4J91A 2UP1A 2FHMA 1VHIA 2J9DE 3D1OA 3NS6A 2OKQA 3CDAA 4Q8EA 2DK2A 1VIXA 1MMLA 3VCDA 3I32A 3DN9A 2GIQA 2AWZA 4DZDA 1UEKA 4I2QA 2IRUA 2Z8QA 2GS8A 4BCAA 3J80U 4ZDNA 1RHJB 1FCAA 1Z4UA 1IN0A 4OZNA 4J9NA 1FNXH 1TMJA 1VC5A 5DLFA 2LU1A 1AA1B 2RDDA 3EPGA 2BQ3A 1EZZB 2CKWA 1U2RA 1IBCB 1XMQJ 1AUSL 2GVZB 4I67A 1ICEB 2V8HA 1IJFB 2NZ4A 5HBMB 2BJ7A 4ZCLA 5ETLA 2BJEA 3EGZA 1JLEB 1UVNA 4HVZA 3D4JA 3Q2TC 2DGTA 3QJPA 3MEGB 4GVBA 2DISA 2PDAA 2W8KA 1VMBA 1HNIA 5ETOA 3HJVA 4U6PA 2J6TA 1XEZA 3KLEB 2O01C 1PO6A 4U8YA 3LP1B 4DHVA 2G1HA 4LIRA 5HMZA 2VFTA 1FRMA 5HJXA 2LMIA 1RP5A 4FXDA 1SUQB 2V63A 2OAUA 4ZVGA 3CCZA 1U1PA 4UUXA 3LF0A 4YFUA 2ILZA 4B3SJ 1SJRA 3KHHA 1HWKA 5EX3A 5F0WA 2R8KA 2YX4A 2CNNB 2FLOA 3KTQA 2M88A 1OMSA 2JLGA 2DEIA 1OY8A 2NQPA 2HQIA 1U09A 4N41A 2HHPA 3AJ1A 4DV0J 1F2GA 3TZZA 3EWGA 4FF3A 2D3OR 1CS4A 2BW2A 4UOFA 2HHQA 4Z7YA 1RWUA 4RW9B 5M2PA 2J7WA 3BBBA 3RZAA 4F4AA 3NBPA 3Q22A 1BLUA 1ZS6A 1OQ3A 1HW9A 4F2RA 3IBWA 4L3NA 2XO6A 3OTOJ 4DF4A 4C8OA 4G1IA 3KK1A 4DS4A 3CC2S 4C4WA 2G0CA 5AXKA 1ITPA 5F3TA 2QEXS 3QT6A 2R7XA 2AJ0A 1KHVA 1JLCB 4FYYB 1SBRA 2AZ3A 2KL8A 2UZAA 4U96A 4IH6A 1P9QC 1G4CA 1FX4A 3NKYA 1TL5A 4BBYA 3O2IA 2DNYA 3FZ2A 1D09B 2EKNA 2DNPA 3KXDA 2X3GA 2V4RA 5LT5A 2Y1JA 3JQKA 4O3OA 2Z2MA 3HHDA 5DDPC 4YOEA 2VPZB 1SI9A 3RGIA 5C24B 1EETA 2H51B 4Y0FA 1BQXA 4ILRA 2MPUA 1PKUA 4LMZA 2EK6A 1S9EB 4DR2F 3EVOA 2W9BA 3T1YJ 3M6XA 1MN7A 1KLMB 3DMJA 3PW4A 2ASLA 1DBDA 4DV5J 1U1LA 4DWIA 2UVRA 3A8IA 2XMJA 4NA3A 2KB2A 3HLUA 1QDUB 3DFEA 1U26A 3W64A 4NLUA 2IA0A 1S99A 4WWSA 5DGBA 2FPHX 2WBRA 3AOCA 3ONQA 1S1WA 4I2PB 3HVAA 2QLXA 3OSPA 4JI1J 1NK4A 1MW7A 3PY8A 5E33A 4NYOA 3C16A 3GJTB 2K1RB 4JYAJ 3U02A 4FN5A 4OX8A 2LQJA 1UVIA 2HFVA 2VJUA 3QT7A 1S0OA 2KFZA 4Q5VA 1DHMA 4FPRA 2A2DA 2XMAA 4PQUB 2KI2A 2W7PA 3LGNA 2DT9A 4OFZA 1EKRA 3PYFA 3QT5A 1J5OB 3CDBA 4JV2A 2ZDPA 1VHFA 1OQ6A 4X65F 2ACMA 1RT3A 1HBNA 1R0CB 4ZCMA 1TUVA 3I0SA 1ZBTA 2O5DA 2FGOA 2U2FA 4C11B 2ZITA 4YY3J 3W2VB 2ILYA 3OFEA 1VQ5S 3DCAA 3RYLA 3N5FA 1CJUA 3FCVA 2FDNA 5KFGA 3BM7A 1TTHB 1B64A 2XMTA 3C6TA 2BX6A 5C5JA 1BQMB 3CT9A 4NPOA 2AP6A 2C2RA 2YH1A 1M1KT 1R0AA 2E44A 1G3OA 1S1TB 4B9VA 3H20A 3TYTA 3NMAA 3BN7A 2LLZA 3LANA 3QRQA 4IFVB 2U1AA 3DM2B 4PXBA 1TV6B 4I69A 5KFOA 3OTDA 3HI9A 3CCJS 4K2JA 3A3PB 5SUHA 2QLBB 2XMWA 4OI4A 3W65A 1H6KX 1H7XA 4EYHB 5EWGA 1FJ7A 2DHAA 2XMVA 1GQEA 2AZ1A 2CPYA 2B51A 3DC2A 4DCJB 2N7CA 1Y4ZB 3DRSB 2QN6B 2FJAB 5LSRA 4HH1A 2HRTA 5GAGI 2YKNB 1KFSA 1REGX 3EM1A 2MSSA 4DOZA 2ZC3A 2GC8A 4NLTA 1NKBA 3GONA 2HZCA 2Y1RI 2R7QA 2XQCA 2HEKA 2YH0A 1UA0A 2O1PA 2EKYA 3G86A 3N0VA 3QATA 3R5JB 5CD4A 1SJQA 2IM2A 2I8EA 3G6VA 3BF4A 2AW0A 4DV1F 4ZOSA 2CJKA 3SI8A 3Q8QB 3BKTA 5J1NA 3N9UC 1T02A 5G0RB 4IOBA 1JX4A 1R6VA 1OIAA 2E7WA 4OX9F 4B3TF 1QVGR 1TL7B 3DLKA 1D0EA 1RTHA 1WC3A 3HF5A 4CH1A 2ZWOA 4OV6A 2HHWA 1N0UA 3I4PA 2B56A 4LRBA 1FDAA 2EPIA 3BQ0A 4DG1B 2DHHA 2E5GA 2UUAJ 3CJSA 4B9TA 2ZC4A 2CQGA 1NO8A 5HBMA 3V4MA 4JI3F 4G1QA 1JLEA 5DGAA 2HHHF 4TY8B 3UE2A 3W62A 2KFYA 2HBYB 1BC6A 2KHCA 4ZVPB 4KJIA 5GMDA 3CTRA 3QGHA 3DOLB 4ES3A 1T9UA 5GAEU 2AKWB 4RU9A 3KLEA 3FEZA 4BLGA 1I5OB 4YDDB 3CGIA 2DHGA 3NAHA 3NMRA 4WIQA 1AYEA 1N5SA 3K5OA 4OYOA 2ADCA 2Z0GA 1SUQA 4U7UK 1YITS 5THWA 4ECWA 2WK4A 4ECTA 2R2UA 3D2WA 2XM3A 3UFCX 3T41A 1XIQA 2ZVIA 3ENWA 5KFSA 2KZMA 2UXDJ 2UUCF 3AODA 1TELA 1N33F 1X5SA 1XR6A 4DSEA 4IG3A 5KG5A 3G71S 3M6UA 3MM9A 2W2MP 2HRYA 4HYKA 2W7AA 1FD8A 2K2PA 5D6GA 3TUPA 4O0IA 4RW9A 1XNRF 4I64A 3AA8A 5B0AA 5KFQA 1WOPA 2FLNA 2F8EX 3UN2A 3UCGA 4UQGA 3RTVA 2QA1A 2ZHOA 1RWKB 1RQ0A 2MZTA 2D74B 2PGCA 3PIOQ 4HI1A 3SSRA 1T9XA 3DLEB 3K58A 2DEJA 1S49A 5B0EA 1BWVA 1KN6A 5DQIA 4P6QA 2OSQA 2OP5A 1FWPA 2CQ0A 1HQUB 4K5RA 4YB6A 2QV6A 1S48A 4USIA 5SZTA 5C24A 3JYTA 3MEDB 3T5JA 5GVQA 2CZ4A 1S9EA 2X1BA 2DKOB 4EO6A 1KLMA 1U8SA 3MF5A 3Q24A 3GYNA 2AEMA 1C0TA 4F25A 3KG0A 4ZIVA 3DLGA 1HA1A 2CQ1A 1NJWA 2NXNA 5F8LA 4ID8A 4KPYA 1PYOB 3RBDA 3LWMA 4I2PA 5DRKA 4DUYF 3QZ7A 4B9NA 1S1XB 2UV8A 3KK2A 2K1RA 4J9RA 1IUJA 4USUA 1VQ6S 1QD1A 1FKPB 1LK5A 1G2EA 3OR2B 4ZPWR 2VG7A 2P2CB 3ZZUA 3BREA 4UTGA 1UWBA 4DV4J 4GC7A 2XY7A 3AD7C 1FT8A 4OV1A 1HHSA 4DL0C 2C2NA 2B9EA 3WBZA 2C2DA 4C9DA 1MWZA 1IKXB 5DDRC 3ZZOA 2CQ2A 1EAYC 4P7VA 3W2VA 5EDWA 4RW4B 5E3QA 2RHSB 4DS5A 3R8YA 1PAUB 4CO4A 3H2VE 5D77A 1BWEA 4PXEA 2RMLA 5HANA 3BGRA 4EI2A 3OLAA 4Y3CA 3CD5A 4ZK7M 3B8HA 2UVVA 1K0VA 1MU2A 3EYZA 4QIFA 3DRPB 2ACYA 3V4IB 4DV2F 1S1TA 2VASA 3NS7B 1JIHA 4AD6A 1FJGF 4PWUA 2HBZB 1RLDA 3D54A 3KHRA 2HLUA 3H2LA 1FKAF 3OXGA 4WFXA 3DM2A 3VVUA 2VONA 2E5IA 1TV6A 1D3WA 3RG6A 3ILIA 2XNRA 3M32A 3B82A 2FTRA 1PAEX 4XPCA 4J9MA 4XO0A 3G6XA 5CCLA 3HMJG 3T1HJ 4LUBA 4IR9A 4NLQA 1HW8A 4Y2CA 2HKEA 2KFNA 2AMCB 1XTZA 4CT9A 1CJKB 1TAQA 1V9OA 1J5EJ 1JJCB 2RAQA 2VHGA 4NCBA 1GMUA 4F4WA 5KFKA 1JLAA 2VPYB 1RYSA 4C0HA 3HVWA 1K47A 2XMKA 1HARA 4DQQA 2EI5A 3QIPB 1KVKA 2AIRB 2CVEA 3TW0A 2EBEA 4ZP8A 2B43A 1U8WA 3D1QA 1AUDA 4OZ2A 4KAIA 5EX0A 2WB1D 2W4DA 1M0SA 1FRLA 4G3IA 2LFVA 5KT3A 3WZ0A 3KJVA 3QSIA 4TYAA 2YPZA 4RO0A 4KHMA 4MYTA 2ZM6J 3H0PA 2M7SA 5D3GB 5ETPA 1TKXA 2V2ZA 4ZHRB 3PV8A 5A76A 5G0RA 3TZYA 1EP4B 2CPEA 3P3DA 1YJNS 1D9FA 1TL7A 1VRQC 4WKRA 3MCMA 1YK9A 4USVA 3GJRB 5LSOA 4M5NA 1RCOB 4DFJA 1SC6A 4CP5A 3MPUB 2BQRA 2Q1LA 3M2VA 2HNZB 4DG1A 4F3OA 4USWA 4K4SA 2XCPA 2HWHA 4ED2A 2BDPA 2Z56B 1TKTB 2COLA 4JI6J 2RDJA 3BO3A 4JI7J 3GLJA 3TX0A 3OV7A 1YSJA 1RTDB 1VIOA 3TZWA 3EMTA 3Q2SC 4DI6A 1QJHA 4ILLA 1EJ7L 3M9MB 2HW3A 4ANDA 5F8GA 3DOLA 3I9V9 2W2NP 3GSIA 8RUCA 4KH1B 2N82B 2ZNZA 4Y65A 3G8TA 3THPA 4X4SA 4TQSA 1FXLA 3CDUA 1RKIA 4C8YA 1SC1B 2Y1IA 4EZ6A 2AF6A 2NPIA 1S7HA 2XULA 1IKYB 2Y0SD 3MMJA 2HQFA 1EHWA 2MTLA 3KJQB 1W7WA 4O3PA 1K1SA 3SCIE 2DO0A 4CTAA 1OYDA 1FWLA 5J2PB 4JI4J 4H4KA 3CMQA 2KZZA 1N36J 4LFCJ 2C42A 2MMYA 1FO1A 5K8MA 4P2SA 3IMQJ 3RB0A 3PRDA 2BM1A 3FCHA 5KFMA 2CAJA 3A8KA 1S9FA 1U2CA 1FNMA 3DHWC 1FRKA 1OPZA 1NHKL 1UJ5A 3GTYX 4JV5F 3H5YA 1X4BA 4FBTA 4DR6F 3VGVA 2AQ4A 4M1KA 2ZH2A 3MWBA 2ZZTA 2OTLS 4KV8B 2F4VJ 5KFUA 3LPYA 3LH2S 2DNMA 4J90A 1T95A 1Q0NA 1LWFA 1F1BB 2XYHB 1S1VB 5J2MA 4QWBA 5KG3A 2CYYA 1DAXA 3SCKE 2RSQA 3ULHA 3EGWB 1VBKA 2ASJA 1TZ0A 3QZ8A 2QSWA 2KXNB 3HO1A 2AJQA 5CD4H 1FESA 1HQUA 2R7OA 4O4GB 3ZZTA 9ATCB 2PMWA 3QLHB 2ZH9A 3QIDA 3CJ5A 2A0FB 4KO0A 1YKWA 1VQ7S 4PG8A 4QPXA 3C66A 2P9GA 3M8QB 3AXKA 1SV5B 4MYUA 3JQJA 1Z2ZA 1RDRA 3J7YU 5KG4A 4OHZA 1P9YA 1N88A 4C6AA 3K17A 3VTIA 1UTAA 1X4AA 4DR4J 2FVCA 1H2TZ 3M05A 2DJWA 2EG2A 3DRYA 1HMVA 4PYAA 3VHQA 1YHQS 1U1QA 2CJAA 1YBTA 1CBKA 2D69A 2LA6A 4XDCA 4M95A 2RIJA 3CC7S 3MAHA 4MIBA 4UOHA 1VFJA 1VR6A 1U4BA 4OHXA 3OR2A 5AE3A 3VAJA 2WAQD 4X4RA 4Z7CA 1TL3B 3IA0A 1UL3A 4X64F 1UPMB 2Z57B 3SV3A 3MXHP 1JLFA 2XHWA 3ZTPA 4RPFA 2FHOB 1U2FA 2L9NA 4OJGA 2UU9F 2B7BB 2DBBA 2Z2LA 3GSDA 4MKYA 4V19X 2Z58B 2CNLB 2C3OA 2OTJS 3DU6A 3KFWX 4WFZA 4RW4A 3VAKA 1MLAA 1VC6A 1HNXJ 2W9CB 1YJWS 3B54A 4ETZA 2VDHA 3OT9A 1F2HA 4ED0A 3I82A 5JVHQ 2HHVA 2JVOA 5L1KA 3ELHA 1L3TA 1QE1B 3VQTA 1RKJA 3MTJA 3V4IA 2YXLA 4EUVA 2OSRA 1IXKA 4CO3A 2LQBA 2VG5B 4FF1A 3MEKA 4YHHF 2DH7A 4WK1A 2DGXA 2RRAA 1C0UB 5HROA 3MCOA 4NEZA 3TVYA 2AHOB 2V8PA 2ZBQA 3CCSS 2I2YA 3M8PB 1TQLA 2RU9A 4DR1J 3NWGA 1RZMA 3W2WB 1L3KA 2DH9A 5HMXA 5F41A 1IQZA 1RAEB 4L74A 3EJMA 3UDLA 3M9OB 5HAOA 1IBMF 4OJ1A 2KYZA 4JP8A 1RI7A 1K73T 3RJMB 4U9RA 3QGIA 3Q8SB 4Y2MA 4WU2A 3MD1A 5KG2A 3UD3P 3U1LA 1WC5A 3IRXB 9RUBA 3LO3A 3CDWA 3J7ZT 1TKDA 2ZVSA 4B3OB 5BYRA 2WSEC 3EDQB 3LALA 4V1Ak 2DNKA 2HVZA 1ULRA 2C2ZB 4YMEA 2EC0A 3QRPA 3FUYA 3W9HA 2EFGA 2CZVC 5DM6Q 2F9DA 1CJTA 2R2RA 1SJFA 2WVDA 3PM9A 4X62J 3WX8A 3DOMA 2CPZA 1ZM9A 3HHKA 3K5PA 2YWFA 5HP1B 3QAUA 2BE2A 4ZHRA 1RTJB 2B9WA 3KLIB 1ZPWX 3MOJB 2G0IA 2RHQB 2MKJA 3HHLA 1S0NA 4L6V3 4C8LA 5ETTA 2HHSA 4DQPA 1FF2A 3LUYA 2IM0A 2IHR1 2HURA 2KM8B 1KTQA 1LK7A 4RW8A 1NXIA 3KNAA 3WIUA 1QY7A 2LXUA 2R7RA 2CZ9A 3RRHA 2ASYA 2OPSB 4DCOB 3QMQA 5KFCA 2Z2YB 4J37A 3DKDA 3M8RA 2ZWPA 2KHDA 1VQLS 4LRAA 1Y3JA 3HK2A 3L7OA 1NKEA 2VBYA 5ADZA 1PJ5A 2GCFA 2XEXA 3SQOP 2R7WA 3HSJA 3G6YA 2ADBA 1EIYB 2FVPA 2HQCA 2LU2A 4A4JA 2FHJA 3U1MA 1JB0C 2P9EA 4LSZB 4F50A 2ZBRA 2HGMA 3CO0P 2MLXA 4Q7AA 2XCAA 4NL5A 5A0YB 3OFGA 1JJ2R 2IYIA 4I56A 3CULA 1ZH5A 2ZH6A 2WW4A 3B4MA 3GR1A 1MROA 4R5PB 1C4AA 4P2MA 4OYIA 3A3NB 3NGRA 2Z2ZA 2VJVA 3P96A 5HLFA 4B3SF 3K59A 3RB3A 3PKMA 4PUOB 4MKAA 2VUGA 3PR5B 2LKZA 2YNGB 2JLEA 4AQYJ 1PBAA 2V0NA 2DYAA 1N8RT 4M5HA 5LMUF 3MEEA 3A1YG 3DDNA 2BW7A 2DHXA 5GAEI 3J80Y 2QRRA 1CLFA 4ZKAA 3DRXA 3GIMA 3KUGA 3BGFA 3D3CJ 2V2QA 3MM5A 2MXYA 4PKDB 4PWWA 3MFIA 2GAGC 3NLCA 4F36A 1SKRA 4LF5J 1B7YB 3MM7B 2JDJA 1CQMA 4KV8A 3OTOF 4IG0A 3UR0A 1RADB 5F8NA 2XO7A 4QR2A 1VQ9S 5G4DA 3R5CA 4RR5A 3BH6B 2V8VA 1WC4A 3IBFB 2KH9A 5EHHA 2V9WA 1WKKA 1D9DA 1EQMA 1RT1A 5CH7B 1YBUA 3IG1A 4WXWA 3IS9B 4M5JA 3QFWA 2VD3A 3KYLA 1RBOB 1HBOB 4B9SA 3ZXWA 4O4GA 2RNEA 4KY3A 1S97A 2NREA 2HFSA 3MAAB 3OVSA 1LOUA 1KOHA 1P27B 4DF8A 3W5YA 4K4YA 4NLWA 5FD1A 2V8GA 3M8QA 1UFWA 1SV5A 1BY9A 3T1YF 4FYDA 3PACA 4LFBJ 2E29A 1WTFA 3D0GE 3VZHA 4JI5J 4XDDA 5D4OA 4A8MP 4WP9A 3TJ8A 4RUCA 5CYMA 4OI3A 2PI5A 5ETVA 1T94A 4X4TA 3JSBA 3I56S 1UVKA 4P71A 2POKA 3BKUA 2WBMA 3FK4A 4JI1F 3OFFA 3ADAC 4K4VA 3RAMA 3V6DB 2JH3A 2RUSA 2N4DA 2AEJA 5IWAJ 1U25A 1TL3A 2NYIA 3X1LB 3M2UB 3IO1A 3QSYB 3UNYA 2JVRA 2FD2A 1HR0J 2BANB 2RKIA 2VC1A 4FPIA 3MMBA 3ENQA 2AEFA 2AJ1A 2HBRB 3Q8PB 3GP9A 4WZMA 3C8YA 1WHVA 3KKFA 4LF1A 5ETSA 2KG1A 1IBLJ 4C98A 1V5IB 5HVHA 1NJZA 2E1PA 2W9CA 3BR8A 2WVEA 4C8NA 3KDNA 3K5LA 3UPFA 1N32F 4DV3F 3MTKA 2AT1B 1M1HA 3AXMA 5HVFA 4A8FA 3AHPA 4K0KJ 1ZOTA 3OJSA 1QE1A 4NXNF 6AT1B 3I9ZA 1X8DA 4K7QA 3ZFVA 5F8IA 1RJJA 3EZ5A 1MMDA 2F7VA 4C0OC 4ZN1A 2XSFA 3M8PA 2QLWA 1RTIB 2X3DA 2HIYA 1TK0A 1Q1KA 4JOUA 3PYGA 1RWMB 4CO1A 1PYSB 5J1PA 3W1YC 5B0CA 3IN5A 1VQPS 4QJVA 3MR6A 1RCXB 3S6EA 1DQ9A 5KFDA 3IP0A 4IRCA 5ETMA 3H5UA 4ZVQB 4A8OA 3OXFA 2HZVA 2NSBA 1HLWA 4RLEA 2H9ZA 2M2BA 4TU7A 1NU4A 1OS5A 4BC7A 2HZAA 3IRXA 1YZ7A 2AGQA 5EGYA 2YNHB 3OLBA 1JQGA 2NXUA 4CLTA 2BA9A 1HBMB 3Q83A 1DTQB 3FVYA 2YKMA 3R2DJ 4ED5A 2HHTA 4ZVRB 4O23A 3GV8B 2XB2D 4OHVA 1GMWD 3DXSX 4O44B 4WKYA 4U8VA 5KG7A 3BQ1A 1ZAVA 4OHYA 4RNOA 4NI2B 3SFUA 1U1OA 2KXHA 1QAYA 1RTJA 4DR7F 2JJ4D 4IO9Q 3RR8A 1FEEA 3KLIA 4Z37A 4OJHA 1LWCA 3TARA 2RS8A 1X4EA 3CEDA 2XMMA 4EWTA 1FEHA 4YR2A 3MPVA 2KU7A 1DRZA 3J81j 1T05A 3HULA 5DZ6A 5BYQA 3TNVA 2XZDB 4Y34A 1FI4A 1Q4RA 3L7PA 4WE1A 2V50A 5M2UA 2OPSA 3GCWP 4H54A 2UUAF 4QWAA 1YJTA 4QPTA 3JB9k 1H3DA 1MWQA 2J0QD 4PG5A 3A8EA 3IAS9 4NRTA 4ER8A 5KFLA 1DFDA 4NLRA 1WHYA 3DHXA 3SV4A 4ZPBA 5HN0A 3T1AA 3LAKA 1FXDA 1F0XA 2IMWP 1F5CA 1MWYA 2OEJA 4I1TA 2A1BA 2OIHA 5IM0B 5ETNA 5A0YA 3E51A 3HKZD 3PHTA 2PIIA 4OLPA 4Q43A 1XNQJ 1YZ6A 4ATNA 4R5PA 5D8HB 3UNGC 2HYIB 1E6VA 3H25A 4PUOA 3IWLA 4DU8A 2ZBCA 1FVQA 2YNGA 4B17A 4LQ3A 1HNWJ 2H3EB 3HKWA 1ZTTA 1FFSB 2DY1A 3Q86A 1S6QA 5KFYA 5DM7Q 2OPRA 2HK3A 4KFBB 4PR6A 2V4JB 2M52A 2GIFA 1KEKA 3H4DA 1S4EA 2QLJB 4DPTA 3MM7A 4C3LA 2MZSA 1JKHA 3GG0A 4RJVA 3CCLS 4RW7B 4M5GA 2YPYA 2LCWA 4AL5A 1B0TA 4DBQA 2DXEA 3TJAA 1WEXA 1JXLA 4B3MF 2OD4A 4ZJOA 3OUYB 1TUGB 4XTTA 1OY6A 4AUKA 1CJVB 3GFZA 4LF4F 3R2CJ 4NCGA 3PFEA 3MDFA 3SMZA 3H4BA 4FVMA 4DUZF 3FNNA 2BVZA 2M8DB 3HT0A 2G0JA 1RAAB 4DFKA 5K14A 4IH7A 4WP8A 4EBDA 5BXIA 3MAAA 1I94F 2M0GB 4GKKJ 3ISNC 6FD1A 5MAOA 2RT3A 1PIEA 1Y00A 1K8AT 4WF9Q 2L08A 2HNYB 3VWSA 4F7VA 4O3QA 4NMLA 5LMNJ 4ZLJA 3FEXB 5K8NA 4IDKB 2QGFB 3GMGA 1C4CA 1S6PA 3G82A 2QL9B 2LECA 3FC9A 2GO9A 4MT1A 4MK9A 2FYXA 2RF2B 6FDRA 4CLSA 2CJYB 2ZE2A 3R27A 4ELVA 3BN4A 3EVMA 5DQHA 4LSLB 4KHRA 1XK8A 5T7LB 3BV8A 3POTA 4DU7A 3I5CA 2LVWA 3PW7A 3LOUA 3V6DA 3D9BA 4RW6B 4ELUA 4ED4A 3M2UA 2IC3B 1HYSB 1RHRB 4ENOA 4Q45A 3SEOA 3J7YI 3THTA 2JX2A 3KLGA 1TMMA 4B02A 1WOOA 3QGGA 4AL7A 2C3YA 4H4MB 1NK6A 1EB0A 5KFZA 4HT7A 3QBCA 4MFBB 2EFPA 1PC4A 3RU0A 2VL1A 3IRWP 1S9GB 1RT6B 3PDNA 2XSJB 2APOA 2N4CA 5EWEA 3FRZA 2A6MA 1BE4A 4JUZA 2QL5B 1U1NA 3ICLA 1RHQB 3O3LA 4AXJA 1S7IA 4ED1A 1VRUB 1WORA 3HVTA 2GMJA 4KKOB 3BSOA 1WDDA 1HQEB 3BDEA 1T9TA 5E3CA 3MFHA 4N56A 5A6WA 3ZZZA 3HHEA 2K3IA 3UQSA 1UCNA 4PRFA 4KRWA 1NSQA 2PFDA 2XY6A 3NGSA 2VBZA 4X4QA 4C8MA 4DV6F 4ZVTB 2QYCA 3J7AN 2FJXA 1V5VA 3ZTQA 3BO2A 1DTTA 3IWNC 1HNZJ 1WJ9A 3T1HF 2EFOA 3QPIA 3OL9A 2QT7A 1JLQB 3DOKB 1IWGA 3IC1A 3B4DA 5GAHU 5D0HA 2C2OB 2XNQA 3LPEA 1UZHA 4ZN3A 3LTOA 4LREA 2CWKA 1J5EF 1UKUA 2CDRB 1WELA 3HPOA 5AJ3F 4DJBA 1P8GA 1AZSB 1YJ9S 1Q7LB 2GA7A 4PZVA 2DXFA 1U1RA 3JSMB 3L09A 2IAJB 1N34F 2VKZG 4FYVB 1Q8IA 1YRXA 3EVWA 1RBLA 1DTQA 5DZ7A 1WF1A 5LL6d 1RABB 1Y5IB 1JLGB 4Y2IA 4ECQA 2HPUA 2B9XA 2PFFB 1U45A 2KM8C 2ZH4A 3AD8C 3M8SA 1IBKJ 1LNQA 1R27B 1XWLA 2ZM6F 1GX6A 3KHGA 1SIZA 3SXLA 4M5MA 2E5LF 2E9ZA 3G8QA 3D68A 1J27A 3P4UB 3M9NB 3UDVA 3I0RB 4CNZA 2HQDA 3UCUP 2GX8A 3FBFA 5C25B 2LXFA 4DR2J 4NLXA 4N47A 3CJRA 2JWNA 4DR5J 3I4HX 2XHCA 5ETRA 5F8HA 4HACA 3RAXA 3SSQA 4A8QA 2XC9A 3N6NA 4JI6F 1SH2A 4JI0F 2P5VA 3Q8VA 4HKQA 1HI8A 4R8UA 2H48B 1CVJA 2H5JB 4OYWA 3GPAA 2Q79A 4CO2A 4DSFA 1KQKA 2IJNA 1W25A 2DR6A 2IRXA 4ZP9A 4OZ5A 1R8HA 4QU6A 3D3BJ 5IM0A 2H65B 2WVCA 5DS7A 2R8HA 4HTJA 1TVRB 4F4XA 1C1BB 3NXZA 1FERA 4I6AA 1R0BG 2FJBB 4QWDA 3IR6B 4C8ZA 3P8BB 2JEJA 3MHYA 2J0XA 1ZZNA 3MUMP 5ETQA 4JI4F 4OZLA 4J5OA 2L3MA 4PCQA 4X65J 2BEFA 3QJLA 3C6UA 1Q8KA 3O5TB 3CJTA 2V6AA 3PO4A 3TAPA 1HPZB 1LWXA 1QTMA 2FZKB 4ZLLA 4PPZA 4LFCF 3LP0A 1BQNB 2DTJA 3PYEA 1ZAXA 1JLBB 3EICA 3I55S 2WONA 3CB4A 1RAHB 1T3NA 4KFBA 3DRRB 4CCHA 5AE2A 1H98A 2ZOFA 1IM6A 1WSRA 4C3MA 2DO4A 1UW9A 4S0MA 2PN6A 3TVKA 2BR0A 5A8RB 4N8NA 3PX0A 3GJQB 2OLWA 3RUBL 1SH3A 1LWEA 8ATCB 1VYAA 3G96A 3M2RB 4LBIA 4DPXA 4B3RJ 2V34A 2DGOA 1DY3A 1NB7A 4WXOA 4IUFA 4NMXA 4OI1A 1QSLA 5LM7E 1O8BA 4KQZA 2E1MC 4FP9A 2DR5A 1N6QB 2R8IA 3M30B 4OZ0A 2UXBJ 2BKNA 1A9NB 2EWHA 4KPCA 3ZNJ1 3PRBA 1Q53A 4WTOB 1KVIA 2DPIA 4W4MA 3ZZ0A 1JJHA 4MJKA 1L3UA 2G2YA 5C42A 1S72S 1OWXA 3CJ0A 1JMTA 1P1LA 4A47A 2CPXA 4QIGA 3X3UA 2ASDA 2DNLA 4CNYA 1VK3A 3BGLA 3DNCA 1HKAA 2C2MB 3LWLA 2JC0A 2K7JA 4QIVA 3O1LA 2AU0A 2YVSA 1M90T 1Q81T 1TKZB 3QO9B 3RAQA 2RF2A 1U6FA 2AYEA 2A2CA 3EXYA 5FJ4A 4IRKA 4X84A 3PHEA 1QAIA 2MQQA 1FWKA 3R6GB 5CQGA 3NRBA 4CYUA 3F73A 4KIAA 4UZCA 4M5DB 2FZGB 2IC3A 4LF9J 1HYSA 2FJDB 4OX9J 4RNFA 5JUMA 3EDRB 4LSNB 2LQ9A 1RYRA 2M8HA 3W5ZA 3V81B 1HHQA 4H4MA 1T9WA 2ALZA 4DV7J 2XYPB 1SC3B 1X4CA 1GX5A 1RACB 5B0GA 4QW9A 1RT6A 1H2UX 4QU7A 2ZD1B 5K20B 3TAMB 2V4QA 1HNXF 5I3QA 1KLNA 3G4SS 4JI3J 5L39A 1S76D 2QJ3A 2HHHJ 2ROPA 3MM8A 2O66A 4JV0A 1S0VA 1RLCL 3SCLE 1X7VA 3R5BA 3WX4A 4ID5B 4MIAA 2WZ1A 5D0EA 1WKJA 2DNOA 3KLHA 3W60A 3CIMA 2G1DA 4HHUA 3PFOA 3KLFB 1NRKA 1NK0A 1RT2A 2LEPA 3M4XA 1XQIA 5D4NA 3W3SA 3BR9A 1PYTA 2C1EB 2R42A 1QSYA 2LDYA 2V94A 2D41A 1RAOA 1PGZA 4LVNP 2NXCA 2FJWA 1N33J 2QA4G 1C1CB 2DNNA 5F3ZA 2C22A 2DD8S 4URGA 1JLQA 3DOKA 5DETA 1N5YB 4ERDA 4ELTA 2DGUA 1X60A 3MMAB 1NNDA 2XZWA 2OMOA 2FJEB 3ETOA 1XNRJ 3KG4A 1T03A 4QCLA 3C46A 2YWHA 2XGQA 4LF7F 2ROGA 1V3SA 4JI8F 1YRTA 4J9SA 2EC2A 3BYRA 4IOCQ 4U95A 1VBYA 4OX7A 2YNFA 2RQMA 4L75A 2MB0B 4ZVFA 4H4OB 2QX0A 3FDSA 2QLFB 1MSWD 1GXUA 2NXJA 1NK5A 2DR9A 1NPRA 4DL3A 4X62F 2K3KA 1OJ4A 3N79A 2DRAA 2DNHA 3NOGA 3P49B 2CPFA 3AY0A 2AD9A 4DPOA 3CCRS 1FE0A 1T8EA 2C3UA 4C0BA 4P9SA 1B70B 4QWCA 2ZBPA 2F3JA 1SQGA 2G9OA 3I0RA 1SJ4P 4CM2A 3F41A 5F8JA 1QUPA 4PG4A 2W2OP 3OVAA 2ZOGA 5IQQA 1TU0B 1XN9A 2BBEA 2BJ8A 4X4NA 1REVB 5CAAA 5L1JA 1XMBA 1LV5A 2J9CA 2C3PA 5KT2A 5J2NA 4ZJLA 3TQ1A 3R3TA 4CLPA 1WDTA 1D1UA 1H7WA 1HBUB 2Q3PA 2HGNA 2J6SA 3OR1A 2JNJA 4OYAA 1F3VA 2B6AA 2H4WB 3IWXA 4Y28C 5AXMA 3AQOA 2RDIA 3BQ2A 4NX9A 1P1TA 2IRYA 4PWDA 1LW0B 4I7FB 1VQSA 2DITA 2BOPA 1VI7A 3TZXA 2BKOA 4WZQA 4ECZA 2W2QP 2WOMB 2PI4A 4LF8J 3U27A 1S0MA 2UXCJ 1PCAA 5I3UB 5D0GA 2OFGX 2Y1LB 1HPZA 5J1EA 3Q89A 5I3PA 5FDLA 2CQ3A 4FS1A 4DX5A 2GHPA 1X9WA 4HHJA 1NM2A 2CPDA 1JLBA 1KOOA 1Y11A 1RAGB 2R7UA 4OLOA 3J81U 1FRJA 4Q0BB 5HQLA 2CRLA 2OEMA 3VGSA 4QIWD 4Q2MA 2DR8A 5A8RA 4ZMMA 4LF5F 3FFIA 5E3PA 2HHXA 3TJ9A 1WEZA 1VQ8S 1APSA 2YX7A 3I96A 2IJFA 4HLBA 2XGPA 2HNDB 3QQCD 2KVIA 5DJBA 1NH7A 3SDEA 4CWBA 1NDKA 5HI7A 1RAFB 1RWVB 2CQCA 1WACA 5D78A 1KD1T 4QZVB 2CA9A 4ES1A 5KFNA 5JVGQ 3M30A 2OPPB 2VH7A 1HI1A 4TNOA 1SXLA 4NLVA 2VBXA 2VZ9A 3SCJE 3GIRA 2ATLA 3L7UA 4PAAA 2MGZB 1WG4A 4C97A 1CG2A 2Q6BA 2IIHA 3V2UC 3W63A 5I42B 4NE9C 3HDSA 1UJ4A 3FQKA 3CJKB 2GIRA 3M6WA 4LFBF 1YJUA 4HDGA 1H38A 2PEBA 1U6ZA 2GW8A 4JI5F 3CJQA 2GVZA 3VALA 3DDIA 3IR5B 2R4FA 5KG1A 1DQAA 3R7SB 4I68A 2J8SA 1TUWA 1X31C 2AGOA 1FX2A 3VAGA 5IT9U 1JXEA 3MEGA 4EU0A 2MZRA 4M5DA 3A13A 4I2QB 2XLJA 4ZLNA 3C14B 2ZUAA 1B0PA 3GYGA 4TYBA 3LP1A 4LSNA 2RB7A 4J9QA 2YBVA 1HR0F 3V81A 1L5UA 1QM9A 3D5MA 5KT6A 1MMNA 1FRIA 5AT1B 5EN1A 5DDOC 2WB4A 4PXCA 2CFXA 2HG4A 4ILMA 3A3OB 3OSNA 3K8VA 3TAMA 4JB8B 2DPJA 1URRA 2AYBA 4CI0B 2ZOMA 3NCPA 4ZPVR 4J9OA 2RJZA 2DCUB 4ECUA 3JAMU 2QZ8A 1NK9A 4ID5A 4K0KF 3Q8UA 1UP1A 2LXIA 1NB2A 4GVBB 3VQSA 1TFWA 4IO1A 1WD6A 2L9WA 1X9SA 1TFYA 2Q43A 4DUTA 4DX6A 2G2OA 3DGVA 1PBUA 3KK3B 3KLFA 4P2XA 5L1LA 5FIIA 2ZJRQ 3VAHA 4R25A 4F2SA 5HVGA 3EZOA 1JLCA 4ECYA 1PILA 3CO9A 3N28A 1YTYA 3FGVA 5E3AA 1C1CA 3H98A 2QE5A 1N56A 1FVSA 1N5YA 3L9ZA 1SQEA 3CCVS 1Z2LA 2WSFC 3CD0A 2PMZD 3TP2A 1RAJA 2NR0A 2PO4A 1XERA 4JV5J 3ZNUA 4I6WA 1HNVB 3NBPB 2DY9A 2YKQA 3ET6B 4F67A 3A4TA 3KK1B 2LQ5A 1NJYA 1AROP 4H4OA 3N5BA 3PYDA 5IFMA 2BMBA 2ERRA 5GAHI 4KHPJ 1VBZA 2IVFB 3FZBA 2QIFA 4LFAF 3JSYA 2MKSA 2HIQA 1MN9A 3UD4P 2MSTA 1I1GA 4QYZK 1RU1A 3UI3A 1Q7YT 3OFHA 4ZVSB 1NLKL 1TK8A 4MTPA 2QL7B 1MNEA 4HR2A 3R5AA 4P7TA 1PC5A 1N5VA 3JQMA 3BO4A 1EETB 2NUUG 2VQEJ 4ED8A 3TI0A 5EUHA 3P6YC 1N4LA 1UWAA 4PQUA 4MK7A 4ICLB 1AFIA 5HQMA 2BXJA 4RBTA 1J5OA 4EFAC 4MKBA 3H90A 4FXWA 2PE8A 1RWXB 4C11A 4RUBA 2G13A 2OMLA 4ES2A 1S1WB 2B9YA 1IQTA 5BR8J 2BRLA 4Y2AA 1YX2A 3C16B 1BQMA 1K1QA 3C19A 2VFVA 2XI2A 3N6LA 3EPIA 2OO4A 1TR0A 1PSDA 2WOMA 1KONA 4RUAA
chains in the Genus database with same CATH topology
2FGOA 2YKMA 2CPJA 3PX6A 2U2FA 4ED5A 4C11B 2ZITA 2XBPA 2MJUA 3W2VB 4FBUA 3RB6A 2ILYA 3AQPA 2HHTA 3OFEA 1L3VA 1VQ5S 2X1FA 3DCAA 3RYLA 1FK9B 1V6HA 3N5FA 4ETXA 3ITHA 4IFVA 4O23A 3GV8B 2XB2D 2FDNA 2IMOA 5KFGA 4IQXA 3BM7A 4OHVA 2ZHBA 3DXSX 1B64A 2RRNA 2XMTA 3DI6B 4O44B 4WKYA 2J6UA 3C6TA 1N5TA 2EVZA 5C5JA 1BQMB 1FE4A 2KXFA 5KG7A 4X4PA 3BQ1A 1U24A 3CT9A 1HWUA 1ZAVA 5L9NA 3CSKA 4NPOA 2AP6A 3HZEA 2E1RA 3JTNA 4OHYA 2C2RA 1RT3B 1U7LA 2YH1A 2M70A 3UW1A 4RNOA 3SFUA 3QAEA 3VAFA 1R0AA 3I0SB 2E44A 1M1KT 4AE5A 1U1OA 2KXHA 1QAYA 1RTJA 4DR7F 2JJ4D 1G3OA 2YKMB 4IO9Q 3RR8A 1S1TB 1FEEA 2CPHA 3KLIA 4B9VA 4Z37A 4OJHA 1LWCA 3H20A 3TYTA 2RS8A 3CCUS 1X4EA 3TARA 3GIJA 3NMAA 3CEDA 2GMHA 2M4MA 2PD1A 3BN7A 1VC0A 2XMMA 2LLZA 3LANA 4EWTA 1FEHA 4IFVB 4NLYA 3MAQA 4YR2A 1X4HA 3MPVA 3I6PA 5CYQB 2KU7A 3MZIA 2U1AA 3DM2B 4O3RA 1Z1ZA 4PXBA 1DRZA 3K0JA 1WI8A 3C6TB 1OO0B 1X9MA 1TV6B 1T05A 4QWEA 3KHLA 5BYQA 4JI7F 3TNVA 4I69A 2KTQA 4I0WA 1S77D 4OHWA 4Y34A 5KFOA 3OTDA 3SYZA 3HI9A 1Q4RA 1QVFR 1R0AB 2IVYA 2D3ZA 3L7PA 4WE1A 3CCJS 4FZVA 1X4DA 5KFPA 2FHKA 5M2UA 5SUHA 5B09A 1ZM4A 2XMWA 4OI4A 2P6TA 1KC8T 4FS2A 2OPSA 4G1PA 2VA2A 4H54A 1LWCB 3DRSA 4IRDA 2UUAF 4QWAA 1YJTA 4QPTA 2KG0A 3JB9k 2OD6A 1H3DA 2J0QD 4PG5A 1H6KX 1YJVA 3NL0A 3MD3A 4UY85 3A8EA 3IAS9 4NRTA 1H7XA 4EYHB 2F9JA 5EWGA 3FSYA 2XLKA 5KFLA 4DSKA 2YKNA 4NLOA 1DFDA 3AH6A 4NLRA 1WHYA 3DHXA 3SV4A 4ZPBA 1T05B 5HN0A 3T1AA 1FTCA 1FJ7A 2DHAA 2JOQA 3LAKA 2XMVA 1GQEA 1FXDA 3K2YA 1WTBA 2CPYA 1F5AA 1FNOA 3ZZPA 3E01B 4WE1B 2B51A 1F0XA 5T41A 3DC2A 5A8WA 5CA5A 4GO7X 1YBAA 2IMWP 4QBUA 2MQOA 3G6ES 2N7CA 2P6SA 1F5CA 1Y4ZB 3KMSA 1MWYA 3C3LA 3DRSB 4I1TA 5J2QB 2A1BA 3GE9A 2OIHA 1RISA 5IM0B 3SQGA 2FJAB 5LSRA 3DLJA 4HH1A 5A0YA 3E51A 3PR4A 5GAGI 1C2PA 2YKNB 1N36F 2ZZMA 3HKZD 3OVBA 2PIIA 1KFSA 4I4BA 3V6JA 4OLPA 4Q43A 2VG6A 3CCMS 4GKKF 2MSSA 4DOZA 2ZC3A 4ATNA 4DQRA 1D9AA 2GC8A 4R5PA 2HS0A 2JSXA 3E2EA 5D8HB 4GO5X 3UNGC 4NLTA 2MGZA 1NKBA 2XS7A 2HYIB 2CPIA 1KS2A 2HZCA 2Y1RI 3AA9A 1E6VA 4UOCA 5KTQA 4YP3A 4H4KC 1SB6A 2R7QA 2X51A 2W8LA 3H25A 5EWFA 4PUOA 2YH0A 1UA0A 2O1PA 5CCMA 2EKYA 1YGYA 3G86A 2NUHA 3N0VA 5B0FA 3IWLA 2V4JA 4HDHA 4DL2A 1SJQA 2ZBCA 3RRGA 1FVQA 1AFJA 2IM2A 2I8EA 3G6VA 3BF4A 3LP2B 2AW0A 5LMNF 2YNGA 4ZOSA 4DV1F 2E1CA 3LQVA 2CJKA 2BACA 3SI8A 3C2PA 4B17A 3Q8QB 4LQ3A 2QSFA 5J1NA 3N9UC 1T02A 5GADI 5G0RB 3HKWA 5LJ5Y 5HL7Q 4NLDA 1NK8A 4IOBA 1ZTTA 4UUWA 1JX4A 1M5SA 4ZVEA 5D4PA 4B08A 3Q23A 2F4VF 1OIAA 2E7WA 4RW7A 4OX9F 4M94A 4B3TF 1FKOA 1S6QA 5KFYA 2YWGA 3OL7A 5DM7Q 1QVGR 1X5PA 1UVMA 2OPRA 3RR7A 1E6VB 3DLKA 2QO3A 4KFBB 1D0EA 1RTHA 2UUTA 3HF5A 4CH1A 2R2TA 1KQGB 2HHWA 1N0UA 4TY8A 1SKWA 4PR6A 2MDAA 2UXDF 1HD1A 3I4PA 3JTPA 2V4JB 1YWXA 3MCSA 3HHNB 2B56A 3P5TL 5LSLA 1FDAA 2M52A 2DIUA 3OUYA 3M6VA 2ZH5A 1KEKA 2B4OA 3RW7A 4UW2A 3H4DA 2EPIA 3BQ0A 4ZVHA 1Q8BA 4DG1B 2KO1A 3MM7A 4N77A 4DDFA 1K0TA 2E5GA 2M9KA 5DG8A 3H5XA 2K7KA 4B9TA 2ZC4A 2CQGA 4C3LA 1NO8A 2MZSA 1JKHA 3GG0A 3ZZRA 4K4WA 3CCLS 5HBMA 4RW7B 1S6QB 3V4MA 2LCWA 2DGSA 3CD6S 2OPRB 4AL5A 3DLKB 1RTHB 2SXLA 4JI3F 1B0TA 4PXDA 4G1QA 1JLEA 2JC1A 5DGAA 2HHHF 4TY8B 3UE2A 4DBQA 4HH0A 2KFYA 1WEXA 1JXLA 4NOHA 1N0VC 4B3MF 1BC6A 2OD4A 3CVKA 2GJIA 2KHCA 3K57A 2D1CA 3OUYB 1K9MT 3OJUA 1LFPA 4KJIA 3MR5A 4D3GA 5FLXY 3CTRA 3QGHA 4AUKA 3GFZA 1ZTWA 2VOPA 3DOLB 4LF4F 4NCGA 3PFEA 4ES3A 3MDFA 2ZH8A 4QR1A 3SMZA 1H0HB 5DO2A 2B5JB 5GAEU 1T3OA 3H4BA 5B0BA 2R8JA 4FVMA 4K5SA 4DUZF 2HNYA 3DLHA 3GFXA 3O8WA 3K7RA 4RU9A 2BZ2A 3KLEA 3FEZA 3AB2B 4E0DA 3FNNA 4YDDB 2BVZA 3BSNA 2M8DB 3N01A 5B7WA 1JKHB 4EGLA 3CGIA 2DHGA 3GIIA 4IDKA 5K14A 1DURA 4IH7A 3NAHA 4EBDA 4DFKA 2V8DA 3NMRA 1V3ZA 2F8HA 2NSCA 1I94F 2M0GB 1XC9A 4G1QB 4K59A 4DR4F 1N5SA 3K5OA 1QAXA 3ISNC 2ADCA 3CDEA 2ZNYA 6FD1A 4EO8A 2Z0GA 1SUQA 2GO8A 4U7UK 5MAOA 2RT3A 2RU3A 4PQAA 1Y00A 5AE1A 1YITS 3G9CA 5THWA 4RX6A 4ECWA 2W4PA 1K8AT 2WK4A 4ECTA 2FY1A 2J0SD 4WF9Q 3BZQA 2L08A 4NCGB 2PA8D 2XMUA 2R2UA 4F8RA 3D2WA 3UFCX 2CQ4A 4LSLA 2DR7A 3D1HA 1W2IA 2D7SA 2HNYB 3VWSA 2MHNA 5T7LA 1TL1A 3ENWA 5KFSA 2KZMA 4TKTA 4CO0A 4O3QA 2YNIA 4NMLA 2UUCF 1I6JA 3D0IE 3FEXB 3D0HE 5K8NA 4IDKB 5K14B 1N33F 3KK3A 1Q79A 3GMGA 1X5SA 1LFWA 2DGWA 1XR6A 4A46A 1C4CA 1VJWA 4RW6A 1NZAA 1S6PA 3I5AA 4DSEA 2CG4A 2B7CB 2L48A 4IG3A 5KG5A 4DN0A 1TP7A 3G71S 5F0UA 4FF2A 2LECA 3M6UA 3MM9A 2GO9A 2OFHX 4MK9A 2HRYA 4HYKA 1VLYA 2W7AA 2F1FA 1IJEB 1FD8A 3QYYA 2GHVC 7FDRA 2RF2B 6FDRA 4TU8A 2K2PA 5L8RC 5A6PA 5D6GA 2ZE2A 3R27A 4O0IA 4ELVA 1NKCA 3BN4A 5DQHA 4LSLB 4RW9A 1XNRF 4KHRA 1UETA 1XK8A 3H8YA 4I64A 5T7LB 3OHBA 3DLEA 1HNZF 2EK1A 3AA8A 5B0AA 4MFBA 5KFQA 2UV8G 3POTA 2W9AA 2FLNA 3I5CA 1Y3KA 2LVWA 3PW7A 2F8EX 1J2VA 3UCGA 2DVIA 3LOUA 4KC5A 3V6DA 4DLEA 4IFYA 4RW6B 1E6YA 2VFRA 1S6PB 1CC8A 1R8PA 4B9UA 1S9GA 3GIKA 4IG3B 4UQGA 3RTVA 4ELUA 2QA1A 2ZHOA 3M2UA 4DLGA 3MM9B 2XSJA 2IC3B 5IT4A 1HYSB 1RQ0A 4KR0B 2FVQA 2MZTA 4KBIA 4Q45A 5DDQC 1S4FA 3DXBA 2OPQA 3SEOA 2D74B 2HGLA 4N8OA 3J7YI 3THTA 2MZJA 4WFBQ 2JX2A 3KLGA 2PGCA 2ZE2B 4B02A 3PIOQ 1KVJA 5L9XA 3QGGA 4AL7A 5HMYA 4HI1A 4NZ7A 1A6LA 2C3YA 2RUGA 3SSRA 4H4MB 1NK6A 5KFZA 4HT7A 3T5HA 4QR0A 1HNVA 3DLEB 3K58A 3HFKA 1VRUA 3MEDA 4F4ZA 5LXYA 4MFBB 2NS1B 3POTB 2EFPA 3S1TA 1PC4A 3THVA 4KKOA 3CC4S 1S49A 3K5NA 3RU0A 5B0EA 2X1AA 1KN6A 1HQEA 5DQIA 1LXNA 2VL1A 4OJ3A 4P6QA 3IRWP 1S9GB 4DFPA 1RT6B 1IKVA 3MMCA 2L41A 1GTEA 3GFYA 2FUG9 3PDNA 2XSJB 3EZUA 2APOA 2OSQA 3T3FA 2OP5A 2PMHA 2N4CA 1ZM2A 2H5EA 2VQFF 2MKCA 5EWEA 3FRZA 2CQ0A 3KLGB 5E41A 1HQUB 4K5RA 4YB6A 2QV6A 4WK3A 4JUZA 4HEA9 1S48A 2J76E 4Z2XA 1U1NA 3ICLA 4USIA 5HQ8A 3TA1A 4X4UA 3O3LA 3RW6A 5SZTA 4AXJA 4ED1A 1HD0A 5C24A 5D4LA 1VRUB 3JYTA 4ECRA 3MEDB 3T5JA 3HVTA 1S6OA 1UMJA 4DEZA 5GVQA 1GAOA 2GMJA 4KKOB 2CZ4A 3BSOA 1S1XA 1S9EA 1S10A 2X1BA 1HQEB 4JBCA 1IBKF 3BDEA 4KSEB 4WYWA 2RQCA 3MR3A 5E3CA 4DR1F 3MFHA 4N56A 4EO6A 1KLMA 5IQ6A 4CZCA 1U8SA 1HL6A 3MF5A 3Q24A 3GYNA 4NA1A 5A6WA 1FRHA 3HHEA 2K3IA 3UQSA 3ZZZA 1C0TA 4J9PA 4F25A 4PRFA 2I9SA 2Z4PA 3NG8A 4KRWA 1FKPA 3J7Z5 1RT5B 2J7UA 3KG0A 2XY6A 1R3NA 3DLGA 1HA1A 1IM4A 2J7KA 2CQ1A 2VBZA 1NJWA 4RNNA 3S7RA 2I0XA 4X4QA 5F8LA 4C8MA 4F3QA 3MUTP 1FJEB 4ID8A 4KPYA 4N5SA 3JYTB 4DV6F 2PA3A 3HVTB 3RBDA 3LWMA 4I2PA 5DRKA 2EW9A 4DUYF 3QZ7A 4FF4A 4B9NA 3JSRA 1S1XB 1KRPA 2QYCA 2WSCC 2AGPA 2RVJA 4DR5F 2UV8A 2FJXA 3BO2A 1DTTA 3BB5A 3JSMA 4ICLA 3IWNC 3KK2A 4Y00A 2IAJA 4AFFA 3T1HF 2K1RA 3MOZA 2EFOA 3GYXB 4YR3A 3QPIA 2RQ4A 4ECSA 4J9RA 1O5JA 1TK0A 2R8GA 1IUJA 2I5JB 4DQIA 1C0TB 2HMIB 3OL9A 2QT7A 1JLQB 3DOKB 1VQ6S 1IKXA 3IC1A 4HTIA 3B4DA 3AAWB 5GAHU 1FKPB 1LK5A 3FJ2A 2XNQA 3OR2B 2JFKA 4IYQA 4ZPWR 1G2EA 3DLGB 2VG7A 2CQHA 1JLGA 2B4VA 3R1LA 2MHEA 4DL4A 3ZZUA 3BREA 2XWXA 1J5EF 1FHTA 4IR1A 1XR7A 3QJJA 1UKUA 1WELA 4AL6A 3HPOA 5AJ3F 5KT5A 4DJBA 1UWBA 2W25A 4GC7A 4CO5A 1P8GA 2J9EA 3U1NA 1YJ9S 2XY7A 1CEZA 1Q7LB 2GA7A 2HLTA 1FT8A 4OV1A 3K8WA 4USHA 1HHSA 1U1RA 4DL0C 1DTTB 3JSMB 3L09A 3KK2B 1KFDA 4QYZJ 2IAJB 1UVLA 3CCES 2VKZG 3WBZA 1N34F 1Q8IA 2C2DA 1YRXA 2FJVA 4C9DA 2M5YA 1MWZA 2ROEA 1R8CA 1IKXB 1T7PA 1RGVA 3NCQA 2YKAA 5DDRC 1DTQA 4Q8FA 1L3SA 1R31A 3ZZOA 1WF1A 2CQ2A 5LJ3Y 5DLGA 3DRPA 5LL6d 2VG7B 1Y5IB 5AXLA 2RH3A 1JLGB 4Y2IA 4GC6A 4P7VA 3W2VA 5EDWA 4RW4B 4ECQA 4RBUA 5E3QA 1LKZA 4A8KA 1FK9A 4G6VB 2HPUA 4NWBA 4DS5A 1TAUA 2JL9A 1UWBB 4CO4A 3H2VE 1HWIA 2KRBA 2FC8A 1U6BA 3LGMA 2B9XA 1DJ0A 1IR0A 1WEYA 3DI6A 5D77A 1GH8A 2PFFB 1UEVA 4ITSA 1DZ5A 1UAWA 1U45A 1BWEA 2JHEA 2CVIA 4PXEA 5C25A 2RMLA 2KM8C 3QGPA 2ZH4A 3BGRA 1YQHA 2DB1A 3G4SS 3OLAA 3MGJA 4NLPA 4YEAA 1QLNA 4RKUC 4Y3CA 4R0JA 4CIOA 2ZKTA 3M8SA 1R27B 3CD5A 1XWLA 4ZK7M 3B8HA 2ZM6F 2GFFA 2UVVA 1K0VA 1MU2A 4ED6A 1GX6A 1ROFA 3EYZA 4QIFA 3DRPB 2ACYA 3KHGA 2LDIA 3V4IB 3KNGA 1FDDA 4DV2F 1S1TA 2VASA 1SIZA 1WG5A 2G4BA 3SXLA 1JIHA 2E5LF 3R1HA 2E9ZA 2ZH1A 2LA4A 1FJGF 2VFSA 3G8QA 4PWUA 5KAKA 3NNCA 4KGMA 2GGPB 3HHLC 3D54A 3KHRA 3M9NB 2HLUA 3H2LA 5CYQA 1M5HA 1FKAF 3I0RB 3T6JA 4CNZA 3OXGA 4WFXA 3DM2A 3UCUP 2GX8A 2VONA 2E5IA 1TV6A 3CPWR 5C25B 4K4ZA 1D3WA 3BGRB 2GMLA 2LXFA 1NH8A 1TK5A 2XNRA 3M32A 4C8KA 3B82A 4X66F 4NLXA 2P9CA 4N47A 1VQKS 2C3MA 2FTRA 2JWNA 3FQLA 4XPCA 2KN4A 2VBWA 4J9MA 1MU2B 4XO0A 5CCLA 3HMJG 3G6XA 3I4HX 2RS2A 4NRUA 1DLOB 5KG0A 4LUBA 4IR9A 5F8HA 4NLQA 1HW8A 2JEIA 4Y2CA 3RAXA 3QIPA 2HWTA 3SSQA 2KFNA 4C7QA 1ZETA 4W92B 1XTZA 1TVRA 3I87A 4CT9A 2XC9A 4A8QA 3N6NA 1LW2B 3NAIA 3VAMA 1C1BA 4JI6F 1SH2A 1TAQA 1V9OA 4JI0F 2P5VA 1FA0A 2Q6CA