2PFFB

Structural insights of yeast fatty acid synthase
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
2006
structure length
2006
Chain Sequence
MDAYSTRPLTLSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQFKATHILDFGPGGASGLGVLTHRNKDGTGVRVIVAGTLDINPDDDYGFKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGSQEQGMGMDLYKTSKAAQDVWNRADNHFKDTYGFSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDLKSKGLIPADATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRDELGRSNYGMIAINPGRVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAGDLRALDTVTNVLNFIKLQKIDIIELQKSLSLEEVEGHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fatty acid synthase subunit alpha
publication title Structural Insights of Yeast Fatty Acid Synthase
pubmed doi rcsb
molecule tags Transferase
total genus 233
structure length 2006
sequence length 2006
chains with identical sequence E, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01575 MaoC_dehydratas MaoC like domain
B PF08354 DUF1729 Domain of unknown function (DUF1729)
B PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
B PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis
B PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta
B PF17951 FAS_meander Fatty acid synthase meander beta sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2420 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB01
3.30.70.2430 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB05
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 2pffB03
5CZDA 3R97A 3EZOA 2QC3A 2H1YA 2CUYA 3G87A 2JFKA 3PTWA 2UV8G 2G2OA 5DZ6A 4RR5A 2VZ8A 3TQEA 3RGIA 1NM2A 5CZCA 2VKZG 3QATA 2VZ9A 2G2YA 3HJVA 1MLAA 2PFFB 4RL1A 3K89A 3IM9A 3H0PA 3HMJG 2JFDA 3SBMA 5DZ7A 2G1HA 2C2NA 3HHDA 2QO3A 4QBUA 2G2ZA 2HG4A 2QJ3A 3IM8A
chains in the Genus database with same CATH superfamily
2EFPA 3E01B 2FJVA 2HYIB 2C42A 4M63A 1RAOA 2LA4A 4FXVA 1TMJA 1KBRA 3KLFA 2GA7A 2IJNA 4UOCA 1NM2A 2HHVA 3OR1A 3BO4A 4IDKA 5H9EJ 2LQ9A 3AOBA 1XK8A 1BWVA 2YNHB 2X3DA 2YKPA 5CCMA 4M5GA 3ZTQA 4M94A 4MKYA 3GYXB 1RT4A 3ENWA 5A0YB 4QPTA 1Q7LB 4ZPCA 1VFJA 1IBLF 4CYUA 2BACA 2XMMA 3DLHA 2C3OA 3MCNA 1B64A 3SQGA 4YY3F 3CO9A 2MHEA 1IJFB 4DUZF 3SV4A 2ZH7A 3H4DA 3SV3A 2NLWA 2LCWA 4MJKA 2AV5A 1A7GE 1KLMB 1FNXH 2AHOB 2KTQA 2AYBA 2WRMA 2Q66A 2FHJA 4JV2A 2WTFA 6AT1B 1F2HA 5KT3A 2BOAA 3LO3A 4I7FB 3W9JA 3LP2A 5D4OA 5HLFA 3DOMB 2HQCA 3MFIA 2HFVA 1P9YA 1UVLA 2OPPB 3W65A 1N8RT 4HL9A 2XLKA 5ETNA 3BR9A 2W9AA 3ZXWA 2VF3A 4E2FB 4IUFA 2W2NP 1KTVA 3FC9A 2VODA 3GJQB 5A8RA 5LSLA 3PYGA 4ED6A 5CZCA 1W2IA 2KU7A 5BYQA 3VGTA 2DGOA 4JV1A 1FNOA 4K4ZA 1VQ4S 2R8IA 2HKEA 3UNYA 2AD9A 3NLCA 3BGOP 2Y1RI 3TANA 3RU0A 3P6YC 3NGRA 3KLGB 4Z7CA 3L09A 4JI1J 2R2UA 4U8YA 3ETOA 1IM6A 3ENQA 3VWSA 1S9FA 5HVFA 2EK1A 2V8DA 2UUCJ 4F67A 2PE8A 4C11A 3GWCA 4B3MJ 3QRRA 4B9SA 2RMLA 3G8QA 1L3KA 2V0NA 2H1YA 1U6ZA 1KVIA 1S6QB 3TVZA 1NK8A 1KN6A 1XNQF 2N7CA 4GKKJ 1T03A 3L3CA 2B8QA 4KGXB 1NSQA 2CVIA 5KFKA 8AT1B 2HFNA 3I0SA 1FEHA 2HRUA 1WSRA 3BZQA 2DR5A 2CJAA 1RAFB 2J7UA 2W7OA 4I2QB 3M30A 4FF4A 1SJQA 3BPSP 2DNKA 4B17A 4NLRA 1IXKA 4H4KA 3LA0A 2OPQA 4HH1A 2AU0A 2DO0A 1Z2LA 3TI0A 1KD1T 2HNZB 4QW9A 3I9V9 3HI9A 3OL9A 1FDNA 3LH2S 1HI1A 1PC4A 3R5DA 2Z8QA 2UVUA 3OFGA 1EETA 4DR7J 3GSDA 3GYGA 4B02A 5C2CA 1ZA2B 5IM0A 5C5JA 4FF3A 2E66A 3MECA 4AXIA 1WACA 3I0RB 1TVRB 3MEGA 3T5JA 1RYSA 1S49A 2IRXA 2GJFA 4KB7A 4UW2A 1BXNA 3CULA 3DLEB 3DM2B 1N33F 7FDRA 1HW8A 3RB0A 1TKXA 3SSRA 3LWMA 1LWFB 2HHUA 1CJUA 5F9NA 2CJXB 4K5RA 1RA7A 1Y10A 3DLBA 2E5JA 3IR6B 3VAGA 1FCAA 4Y0FA 4DPTA 2OLWA 4HT7A 2RE1A 1TAUA 1JJ2R 2V8GA 4PPZA 1S79A 1N36J 3POTA 3TR5A 1FA0A 4C3LA 4AQYJ 3QGHA 2PD1A 2AEJA 1DBDA 2HWHA 2IC3A 1FRIA 4JI8F 3MM9A 4UTGA 3D5MA 4PG8A 2AJ1A 3HJVA 5HI7A 4C48A 1XMQJ 2R2SA 4B9UA 2JFDA 1Q5VA 5B09A 5IWAJ 5B7WA 3H98A 4NLYA 4YR2A 1BQMA 3BKUA 2JFKA 4YB6A 3IA0A 1U6FA 1CJTB 3JYTB 1S76D 1U0HB 2RKIA 4ILMA 2EG1A 1B3TA 1TKTA 4C8ZA 4NLOA 3TAQA 4NXNJ 1SKSA 1DLOA 3T19A 5J1EA 1S12A 3L7OA 1SL0A 1BWEA 4HTJA 4YDXA 1WEXA 2RQCA 2VKRA 2PMZD 2DB1A 2CQ3A 1VRTA 1S57A 2V4JA 4ECTA 1YKWA 3N28A 3KMSA 4X62J 4ELVA 1UP1A 5HQMA 3M6XA 2WOMA 3T1YF 1E6VB 2WB4A 2XI2A 2QC3A 3AY0A 5CYMA 2K1RA 4LBIA 1EKSA 4AXJA 1FKOA 2R7RA 4IQXA 5I3UA 4DWIA 2A2DA 5HANA 2UU9J 4ZCIA 1IBCB 3SFUA 1OY6A 3D7SB 2DKOB 4I4BA 3NGUA 4NA2A 4V1Ak 2DPIA 2A6OA 2J9DE 1OIAA 2E9RX 2FLLA 2GC8A 4CM0A 5DQIA 3R97A 1Q95G 2HQDA 2KG1A 4DF8A 5AT1B 3ZZPA 4WXOA 1JLCB 1NO8A 1X4AA 4F4YA 2LXIA 2GCFA 3BSAA 4K4YA 1S9GA 2LLZA 1ZZFA 3CXCR 1YBTA 3FEXB 2VONA 1S1XA 3G96A 2OPSB 3W8PA 2RDJA 4OX9J 4L73A 3V5RA 2GVDB 2MZTA 4C7QA 2JEFA 4PABA 3OR2A 2RRAA 3GIMA 4QR2A 2ZBRA 3CD7A 2JEJA 2FZCB 1LWEB 5K14B 2F4VJ 2M5YA 2E1MC 1UJ4A 4PQUB 3PRBA 4IQMA 1JJHA 1JQGA 1ICEB 4U9RA 1JLGA 1IBMF 5M2RA 5DRKA 2JEIA 4DEZA 3MD1A 2ZH6A 4B9NA 4B3OA 4RW6B 4EBEA 3HF5A 2HSEB 4KHPJ 1VBZA 1NNDA 1EQMA 4CT8A 1S72S 1TQLA 2BKNA 5LJ3Y 2FDNA 4FYYB 4RWXA 4CLYA 2MSSA 2MKSA 4AUKA 2OELA 4ZLPA 4K4VA 3E51A 1RZMA 3DLJA 2PN6A 1RK8A 3HHLA 3MPUB 1X4HA 3M6UA 1RBOB 2VC0A 2JX2A 1RDRA 4B08A 2FHOB 5KFVA 1QVGR 2ZJQQ 5FLXU 2PT0A 4XAKA 4RNNA 4ZP9A 5CZVA 2WHOA 1K0TA 2OPRB 3HD1A 5L9XA 2BBEA 4ED4A 1FVSA 2XMKA 1PYTA 1HYSB 3MM5B 2XYHB 1U1QA 3GZ7A 3BH6B 4HHHA 3C14B 1IQZA 4LFAF 5GAHU 5EWGA 4D3HA 3VCDA 2DR9A 4DV6J 3BGRA 1PC5A 1FVQA 2KJWA 4OYIA 3OXGA 4Z7YA 4N47A 3C16B 3DGPA 5K20B 2CPDA 1RYRA 1K1QA 4A8XA 4LBHA 2DISA 4DSKA 4V19J 1NPRA 3KK3B 3F56A 2VB6A 1L3UA 4OZLA 2E9ZA 3NXZA 3QBCA 4ANDA 2B4UA 4W98A 4Y28C 3UE2A 4MKAA 1QSLA 3T1HF 2DIVA 3V6DA 2JJ4D 4R8UA 1C0TA 2I5JA 3N79A 1ZAWA 3GYNA 2ZBQA 4Y00A 2CPJA 1FRMA 2E5GA 1RT7B 1HBUA 4P72A 3BQ0A 1HBMB 5IT4A 3W3SA 2AJFE 4JV0A 5M2UA 1Q8KA 4ID5B 2V8HA 2Y1LB 1XBWA 4IG0B 3BPDA 3WZ0A 1FJEB 2D3OR 4NRTA 5A8KA 3L7PA 4BDPA 4O3NA 4HH0A 1L3SA 2BXJA 2JLGA 1RCXB 1U1MA 4F50A 1VK8A 4CLFA 3HHDA 1J5EF 1V5IB 5KFIA 4RBTA 2XS2A 3MM7A 5HVHA 2GGPB 2XCAA 3LAKA 4AFFA 2K8GA 4Y3CA 1HNXJ 3O3LA 2CG4A 2NXJA 1XMOJ 3IWXA 4N76A 1YJRA 3K2YA 2XS5A 2VG6A 2RF2A 5HMYA 3QT6A 1MG7A 3F44A 4P9SA 4ZJQA 2DY1A 3AD9C 2MSTA 2VU5A 3AQOA 4P6QA 1T0TV 1KP6A 4Y2IA 5LMNJ 3TJAA 1TTHB 1XTZA 2V5HG 3MR3A 3D0IE 4X64F 2DEIA 4DU7A 4UZBA 4BHQA 1RUSA 5E33A 1PAUB 1WKJA 3OJUA 4DV7F 3AH6A 1G7CB 4DS4A 1TUGB 1LK5A 5BR8J 4ECZA 1KRPA 5AJ3F 4ZA1A 2F5GA 1UPMB 3HMJG 3BGFA 3CCRS 4JI6J 4DL7A 2F8MA 3AA9A 3NGKA 4YR0A 4O0IA 4UY85 2GQQA 3IS9A 4LF6J 3LGNA 3MEDA 4WE1B 2FC8A 1OQ6A 4NPOA 2ILYA 1TMMA 2FZKB 2Q6CA 2ROEA 4PYDA 3NOGA 4WYWA 3DOKB 3X1LB 3AT1B 3EGNA 4ZVTB 5F8IA 4PYAA 4LF9J 2YBVA 4P2MA 4G1PA 3FBBA 2ZH8A 3G82B 2B3TB 2YKMB 4JI4J 2XSJA 3QQCD 1VBKA 4X84A 2RJZA 3UCZP 1QY7A 2OMLA 2ERRA 3U1NA 2H48B 5EWEA 4Y2MA 1S6OA 2YTCA 3Q83A 3ITHA 5CZXA 4M95A 4RPFA 2KJVA 1S1UB 2HS0A 2NXUA 3G9CA 2QV6A 4KY3A 3SSSA 3HLUA 2C2MB 1QLNA 3VF0B 1X0FA 4DL0C 1SC3B 3HDSA 4FYWB 1U24A 4JI0J 1Q81T 4LUBA 1YJNS 2PIIA 2CIMA 1X0PA 2HNYB 2IA0A 3EGWB 2CWKA 5H9FK 4ZP8A 3PKMA 1HHQA 2WBMA 1F9FA 4OYOA 2FJXA 3CDAA 3B78A 3MAHA 5EGYA 2DNGA 2GVZA 2X1GA 3C19A 2W2MP 4C8MA 3P5BP 4WF9Q 2BW7A 4ID8A 2VC1A 2ZM6J 3K5LA 1D9FA 2J8SA 3KLFB 2A1BA 1M5PC 2E5HA 3QO9B 1SQGA 2H4WB 3IGVA 3CC4S 3PCOB 5CAAA 3QJLA 4U7UD 1KHWA 3OR1B 2MQMA 4IDKB 4N8OA 2RRBA 3RB6A 3AJ2A 3H90A 3MR2A 3H2UB 2MJUA 1TK5A 1IKVA 2HNDA 4FDFA 1REGX 1RT4B 3C8YA 3FEYB 2IYIA 2XS7A 1OY9A 2QJ3A 4CYUB 2HHTA 4DV0J 1HL6A 2VA2A 4B3RJ 3S6EA 1MNEA 3HKZD 1JKHA 4NLQA 5KFUA 3Q8UA 2HRTA 2YX4A 5GAGU 1JMTA 1X4GA 4C9DA 1T95A 3KMQA 1R0AA 2BANA 1VK3A 2EKNA 3AB4B 4F02A 2ASDA 2AJ0A 4CO4A 5C24B 2YNGA 2PC6A 3GV7B 3LP2B 3CC7S 5I42A 5D0RA 2Y3YA 4ZPAA 1RTZA 1FFWB 5LMUJ 4J9LA 1DTTA 5KFRA 5JXSA 3M8QA 4I6WA 2E7XA 3O44A 3FQKA 5HVGA 1J5OA 2QSFA 2PO4A 3QJJA 3THVA 5A8RB 4O4RA 2UXDJ 1O5JA 2A10A 1YJWS 4J9MA 4FPRA 2DCLA 5DGAA 1E6YA 2IVFB 3NG8A 4ED2A 2W1BA 1N5VA 3CMAS 2FB0A 2IPOB 2FVPA 4ZPBA 4NL5A 2ZWOA 2C3UA 1R0BG 4CLZA 3BBCA 1HW9A 1FRHA 4DR7F 4OYAA 3G6YA 2ZH1A 1ZYQA 1UJ5A 1RLCL 1FWPA 1UZHA 1ZM2A 4DCPB 4C11B 4K7QA 3M9NB 2IA6A 1R31A 3LGHA 2XB2D 4OYXA 3WDOA 4MMOA 3K5NA 3MF5A 5ETKA 4JV5J 3ONQA 3H2VE 3TAMA 3HD2A 2D9PA 4M5IA 2XYPB 1HPZA 1RT2B 4KGKA 3DLKB 4C0BA 1T03B 4NA1A 1S0MA 3MPDA 1KEKA 3Q8RB 3TA2A 2PI5A 3Q8SB 3I0SB 3CJKA 2XMWA 3OTOF 2HHWA 5EUHA 1GEHA 3MMBA 1QTNB 4AL7A 2WZ1A 5G4DA 4TQRA 4ECVA 3M30B 4AYBD 3R1LA 4ZIWA 4ECQA 4DR2F 4X4SA 4ZHRA 2OPQB 1N36F 5A6PA 3GPAA 2Q43A 1LFWA 2IBOA 5E0OA 2OUGA 4BC9A 4DQSA 4DX5A 2ZJPQ 4DR3J 2R7OA 2DJWA 3KLEA 5A8WA 3H42A 2DNOA 2QIFA 3GFXA 2R42A 3GSIA 1TKZA 3FDSA 3CW2C 5IM0B 1U1RA 4Q2MA 3AOAA 3MEGB 4ANEA 1DQAA 4B3SF 4EK2A 4OV6A 4PG4A 1Q8IA 1IWAA 1PGZA 1IR2A 4IH7A 1BQNA 1S1VA 1GFWB 1GXLA 4J7CA 2EK6A 4Y6IA 3UPFA 2LEAA 1TKXB 2DNLA 1R43A 2FUG9 5D78A 1SKWA 1H73A 3KHLA 3LW5C 3A3PB 2AYEA 2E1AA 3HCXA 3NNCA 3ZZZA 2AGQA 2BV3A 3F0NA 4KHMA 3R8YA 1UW4A 4PG5A 4AE5A 4WFYA 3LPEA 3POTB 5FD1A 3PXGa 3DRPB 1EB0A 2W01A 1F9EB 2DNNA 2IC3B 2R7SA 4MAKA 1GTHA 3HFKA 3TA1A 3MM9B 2QGFB 1UMJA 4UZCA 3V6KA 3ZTRA 2P5VA 2MZJA 1YX2A 2YH0A 4HLBA 4Y34A 4RWWA 2C3YA 1BQMB 2ZNZA 2NZ4A 4RNOA 5F3TA 3U27A 3VZIA 4OLOA 4DCJB 3BDEA 5KT5A 1N5TA 2DGQA 3DHXA 2L9WA 2RKIB 2XMAA 1AFJA 4U7UK 3RBXA 2GMJA 4NI2A 3HSJA 3BSOA 5C42B 5IV3A 1QUPA 3PX6A 1CJKB 4B3TJ 1TKTB 1U2FA 4C8YA 2WK4A 1SVDA 3GFZA 4GVBA 3N5FA 1RAAB 5GMEA 3GMGA 1QAXA 1DLOB 1H2VZ 3W2WA 5J1EB 4MTPA 1UVMA 1WHXA 4ZPWR 2FY8A 2ILZA 3ILLA 2V69A 2H54B 2IM3A 1VRTB 2GHPA 1AYEA 3DLGB 2Q1LA 2V4JB 4OX9F 4FYXB 5KFYA 2KO1A 2XMUA 2HVHA 4USJC 3MTJA 3ZZOA 2HZVA 4WCEQ 3GG0A 2BM1A 2RNEA 4RZRA 2CQ0A 3MR5A 4DPYA 2WOMB 1KSPA 3D2WA 1N54B 4TYBA 3LGMA 2F4VF 3TJ9A 1KLMA 3UVJA 1WKLA 2CZVC 5CYMB 2YWHA 3H59A 3WIUA 4OYBA 3PIPQ 2MDAA 3HP6A 1FKOB 4OX8A 2DR6A 2RHSB 2FHMA 1FWKA 4TY9A 2B43A 5I3UB 3R7BB 4RKUC 2QA4G 4GKJJ 1Q7YT 6FDRA 3MCOA 1U1LA 1S1WB 1EZZB 5I3PA 3W1YC 5KTQA 5JVHQ 5IC4B 3MTKA 1DTQA 4RNHA 4QJVA 2YY3A 1K44A 3VVUA 3CCWA 1MWZA 2C2KB 1VS3A 1DARA 1RT5A 1ITPA 4WIIA 1JLEA 4CLSA 3ZFVA 3KJVA 4IRCA 4QZVB 3LF0A 4ETXA 1UWAA 2E1RA 1V3ZA 3EE3A 2V4RA 1D09B 2GNKA 3CJTA 2KT5A 1IBLJ 3G86A 3PYFA 3JQJA 3PVXA 1S9GB 3M05A 3D66A 1IKYB 5HJYA 2Y9HA 2VPWB 1SIZA 2PI4A 2VICA 1S1XB 1SKRA 2VOOA 2W2OP 2KG0A 4DUZJ 3OR2B 2LFVA 5FJ4A 1KKHA 3ISNC 1QSSA 3PX0A 2QMXA 3HHNB 2QT7A 1HHTP 4LRFA 3SBMA 2VFRA 4DMZA 3GCWP 3C3LA 3VALA 4K4TA 1VC5A 1U4BA 3QIDA 2ZVSA 1JLGB 4JOUA 2XGQA 3KLIA 1DRZA 2MY7A 2K3IA 2IYGA 2HAIA 3CJQA 2HBQB 4DI6A 5L46A 4B3OB 2P8IA 1RWVB 3QLHA 2CQPA 2ATLA 2E5LJ 1XEZA 3C15A 3KK2A 2GIRA 1UTAA 1FNMA 3J81Y 1RCOB 2A0FB 3IP0A 2HIQA 3IC1A 2NSBA 1WG4A 3TRGA 3OTBA 2FVRA 4Q44A 3RR7A 5F0WA 1YBUA 4C0HA 5B0AA 3BYRA 2JVRA 4NMXA 2KKHA 3DU6A 3GU0A 3DRSB 3OQ2A 4M5KA 4RW7A 3HHLB 2BQRA 2HGNA 5ETLA 4QYZK 2VFSA 2Z2YB 2ZHOA 3JQMA 3JQKA 4NCGA 5L39A 1FKAF 3BGUA 2HRYA 2CXEA 3CTRA 1PCAA 2DXDA 3MCMA 3OXFA 3J7AN 3JTNA 4ZCLA 3NCPA 3OT9A 5E3AA 2U1AA 3H5SA 4I2PA 2CJQA 3EX7B 2A2CA 2CPIA 1IBKF 1FX2A 5D3GB 2DRBA 3QFWA 3IBFB 1XNQJ 3FFIA 2QFJA 4CO1A 2CNNB 3BGRB 3D68A 2XBPA 3R2CJ 4KYZA 2GHVC 3PR5B 3TOQA 1FKPA 3DGPB 4EO8A 4LSNB 4P74A 1P1TA 4LRBA 2R7VA 3PW4A 4KE5A 2OD6A 2VPXB 1LXJA 1QUVA 3KK1A 3ZZRA 4IO1A 3RAXA 2XZDB 1XMOF 1UEKA 3PHTA 2GJIA 3H20A 3CJRA 4ECUA 4X4NA 1TL1A 1NK7A 2E9TA 3V6DB 3T9NA 2KB2A 4R8UB 1C0TB 3DYAB 1HNWF 3C6UA 5M2PA 3OTCA 4MYTA 2Z2LA 2V8VA 2W24A 1FXRA 2R9LA 5LMNF 2D41A 1HBUB 1CJTA 2J76E 1VI7A 4J91A 5H9FJ 1WC3A 1D0EA 4YB7A 1UVIA 4K0KF 3R9LA 2HG4A 2JC1A 4JI6F 2R8KA 4ECRA 3BM7A 3NGSA 3RJMB 1NDCA 5A8KB 2LYVA 3GB0A 3KNAA 4TLQA 4LF6F 2CQCA 2G1DA 1WC4A 2ZBCA 4ZVHA 4PXDA 2GMLA 4QWBA 2VFUA 1C1CA 2FC9A 3P45B 3MM7B 3AJDA 2FYXA 1OPIA 3SIPB 1WEZA 4PQAA 3OVBA 1R6YA 1MSWD 1MROA 4LF9F 2RF2B 1NJIT 4AMMA 3KFWX 1RWMB 2XWYA 5KT4A 4JI4F 2Q79A 4EUVA 3L7UA 4Q45A 3I5AA 2QLWA 3ZZUA 1B0TA 4X4QA 2H5EA 3JB9k 3DDNA 2XHCA 1BUXA 2AP6A 4O44A 1VR6A 4DL3A 2AZ1A 1GX6A 3NAHA 3SZ2A 1GMWA 2BQUA 2B7BB 3GR1A 2AYMA 3MAAA 4QIGA 3IS9B 3OV7A 1N4LA 2UVWA 1HKAA 4JBCA 1VQLS 2JDJA 3ETMA 1XQIA 3MEDB 5E3QA 1ZH5A 4F36A 2N4CA 3R27A 4HVZA 1TP7A 3UDCA 1JLAA 5EN1A 5HQLA 2DITA 4K50A 2E29A 4DXLA 1T05A 5IQQA 2FTRA 2KL8A 2W2QP 1R3NA 2VBZA 3DNCA 2OHDA 4YEAA 3AB2B 3K89A 2N82B 4DSIA 4UUWA 2QSWA 1SH3A 3MR7A 4K59A 2XSJB 3MMCA 3GIIA 1EHWA 4U6PA 3CF5Q 2MQ8A 1F1BB 1FESA 4CNYA 2RUSA 1U02A 3L9ZA 3VAKA 2KFNA 4URGA 4PXCA 4O4GA 3ET6A 2KT3A 1W7WA 5HROA 3NWGA 2X3GA 3K5PA 4WIQA 2NQPA 3D4JA 2GIQA 3ITHB 4YB5A 5F8JA 2OFHX 1JB0C 2WW8A 2NR0A 4B9LA 5D77A 3OVSA 3W66A 4A8FA 1CVJA 3G4SS 1BD6A 4DV0F 4ZIVA 3A8EA 3EM1A 3EUNA 3PW7A 4ES1A 1UA1A 2HBYB 1FRKA 3M6VA 4CWBA 5F8MA 2ZBPA 4PWDB 2GO9A 4YHHF 3MMAA 3PRVA 2H9ZA 3G87A 1VQSA 4EO6A 3BSNA 2N4DA 2NZCA 2ASJA 4PRFA 3CDUA 1PYOB 2GMHA 3BDPA 3CCTA 4CP5A 1W26A 2CADA 4DR6J 1UKUA 1WC5A 2OPRA 4NMLA 1IBMJ 3UW1A 1IQTA 1RB0A 1Y4ZB 4NRUA 3MM5A 4M5HA 1WOSA 4ILLA 1X4EA 5LMUF 2G2ZA 1V3RA 4C4WA 4Y65A 2OGUA 3CCES 2WW4A 1NXIA 5L1LA 4J9KA 3M2VA 5HN0A 2UXDF 5DDOC 1IKVB 2BRLA 3FVYA 2MB0B 2OKQA 2HNDB 2OEJA 2YNIA 2R7UA 2FLOA 2OP5A 1N5SA 1TZ0A 5IZHA 1X31C 3OD2A 4A47A 3BBBA 4F0HA 3DHWC 1Q16B 2HK2A 3FCWA 1JKHB 5B0DA 2FPHX 2HWIA 1YJTA 2LQJA 2X7IA 4YOEA 2BJ3A 2HQGA 2QYGA 3BH7B 2BANB 1C2PA 2BJ9A 1BY9A 1FWLA 4MIBA 2E1PA 2MZRA 1K8AT 4I64A 3V6HA 1QAYA 4ZJOA 2HQIA 3GONA 4KT0C 4P10A 3PJWA 3QJPA 5GAHI 2V68A 3VZHA 1HIYA 1OQ3A 4C2MA 1V3SA 5FDLA 4F4KA 1YRTA 5I42B 2B8PA 4LFAJ 1TFWA 1B4SA 3QGIA 1DTTB 3HSGA 1Y5LB 3T6JA 1J5OB 2IDEA 2CWXA 1SKUB 3W62A 3T5HA 3KG4A 4MYUA 1T9WA 4NLXA 1SC1B 1E6YB 1VJQA 2W25A 5C7PA 3QSIA 3UFCX 3NCRA 1D3WA 3CCZA 1Y5NB 3M2RB 4CIOA 2UVRA 2CPHA 4OI1A 3UDVA 4MKVA 4OMFG 4IR1A 3FRYA 2HHXA 2BABA 1R0CB 3DMJA 4EYHB 4K4WA 1VQ6S 2BDPA 1S7HA 1SXLA 2WAQD 4DBQA 4FN5A 3NGDA 1SJFA 4HKQA 5L38A 1DURA 4P2SA 4DX8H 4B9MA 4CLKA 3CUNA 2A3JA 3H0PA 1P8GA 2KH9A 2V2QA 4LRDA 3MOZA 2FVSA 3DXSX 5KG2A 5I4MA 4YQWA 2OIHA 3RRGA 3TAMB 4NXMF 1HPZB 4KH0B 2K3KA 2R7XA 2XMJA 1ZM4A 5L1IA 3CJKB 2LQ8A 4P7VA 2FHJD 4DL5A 2VUGA 2CNLB 4N56A 3W5XA 4DV4J 3OUYA 2G4BA 5CZDA 2AJ2A 4ECWA 5AE2A 2WVCA 3MMBB 2NXNA 1J5EJ 2UUAF 4GRSA 3ICLA 2M8DB 4ZHRB 2GAHC 2FIUA 3MUTP 2ASYA 2KRBA 3QWPA 1VCTA 4JP8A 2RB7A 2HHHF 2LQ5A 2RSQA 1YJUA 2JOQA 3CIMA 2IM0A 2G0IA 5K8PA 4RUAA 1XN9A 5A8WB 2YKMA 2FHKA 1S0OA 5KFDA 4RBVA 2Z57B 1TKZB 1VMBA 1LW0A 3E8OA 1LEOA 3QAUA 1SL2A 4DUTA 2CQIA 4KIAA 1NK6A 2ZH9A 4FNHA 4OFZA 4R5PA 5A76A 4DV7J 1BQNB 1SPBP 5AJ3J 1S1VB 2PGCA 4ZVOB 4RBUA 2HHQA 3IFEA 1DQ8A 1S1UA 2RD5C 4XTTA 4WKRA 2KYZA 4USWA 2ZC4A 1LXNA 3PFEA 1RT3A 2HAFA 1AUSL 5E3PA 4UQTA 5KFHA 1B7YB 2YWGA 5KFBA 3D6MB 3HHEA 4ERDA 3CJ2A 2FGOA 2BX6A 3CJSA 3SMZA 5KFXA 1NPPA 3CD5A 3EDQB 1ZTWA 2CRLA 1UJ6A 1N6QA 2B7CB 3V4IA 2JZ5A 1EJ7L 2DT9A 5HMWA 2R7WA 1WG5A 1NSKL 4BWJA 2YH1A 3OFFA 3JSRA 4GKJF 4HACA 4HHUA 1Y11A 1S6PA 5F8HA 2N7YA 1VHFA 3GTYX 3R7SB 5L9NA 4QYZJ 2ZD1A 1VBXA 2ZZNA 5KG1A 2EKYA 5E7OB 5GADU 2M52A 4DR1F 3QO9A 4FXWA 3ILIA 4UQGA 1G1XA 1HI0P 3IG1A 4ED1A 4NI2B 4DL6A 2QE5A 3MCSA 5KFQA 2OFGX 1XR5A 2H5IB 3JSYA 4ED5A 4I6AA 3MPYA 1RA6A 4GVBB 4OI4A 3CCVS 4E98A 3W2WB 1RWXB 1HQEA 3UN5A 1JWWA 2QO3A 1NB2A 3OSNA 4ELUA 3NS6A 2F9DA 3RTVA 4OZ1A 4FZVA 1A9NB 3ELHA 2UV8G 5J1NA 1VIXA 3TNVA 4EYIB 1BC6A 4QOTA 3D1HA 2OTJS 4IOAQ 2R7QA 3NY0A 1YZ6A 4H4KC 4H54A 1SJ3P 5DZ7A 2QYCA 3UVJB 3DOLA 4R0JA 1EP4A 3GCXP 4KFBA 4F4WA 2KVIA 4RU9A 5C24A 1NK0A 1NJWA 5KFFA 2WVDA 1WNEA 3VAIA 5IS2A 7FD1A 1QAJA 2XGPA 5T7LA 5GAEU 2MKHA 2B0GA 1DTQB 2QLFB 4X4VA 2DH8A 2UUTA 1YITS 2BYCA 4WFXA 4Y2CA 1FJ7A 3LP0B 1SI9A 1RT5B 3SDEA 2E5LF 1JLEB 4C8LA 2MZSA 3KJVB 1TUVA 2MY8A 1YJ9S 2DGVA 2EFVA 1IR1A 4DFJA 4WJBA 1Y3KA 2J0XA 5CA5A 5AE3A 4AL5A 5HJXA 1NRKA 1NH7A 3OTDA 5D4NA 2RDDA 5GAGI 1NKCA 2HEKA 1NZ8A 4KO0B 5U47A 3BQ2A 3QGGA 2AF6A 4L74A 3IGNA 5HK4A 4ZVRB 3O5TB 4NLTA 5DG8A 1AT1B 2HPUA 2HW3A 4OZNA 3KG1A 3RAQA 1REVA 4U95A 3K5MA 3FCVA 4DX7A 1OSCA 3KLIB 3HZGA 4WK3A 3CCJS 2EI5A 4FYVB 4QIWD 3VAMA 1Q53A 4RNFA 1RT2A 3KHRA 3DKDA 3DLKA 5LOQA 1GX5A 4DUYF 1F60B 1HA1A 1U45A 1RTJA 3QLHB 4J9UE 2VG7A 3C15B 3KK2B 1JXEA 2W9CA 3SSQA 3KYLA 4MIWA 1KFSA 1MWQA 2RT3A 3PEHA 5A6WA 1V6HA 1FT8A 1NK9A 4PWWA 1A6LA 3NOCA 1S1TA 4DV3J 5HSPA 3Q24A 3MPVA 1TK0A 4RW7B 3RBZA 3AOCA 2QLXA 1UCNA 2YQ1A 4LQ9A 2YXLA 4ZVPB 4NCGB 4S0MA 3UDLA 4BS2A 2CYYA 4Q0BA 5ETRA 2QA1A 4H4OA 2DRDA 1RGVA 2DIUA 3UD5A 1FTRA 4I2PB 1P1LA 4ER8A 2PMHA 3CEDA 5DM6Q 4EWTA 4X4OA 2Y8WA 1PIEA 3CMES 3FFIB 1G3OA 1NCLA 1GXTA 3J80U 3N01A 4O3QA 3OVAA 3MAQA 3UI3A 3AD7C 1RAJA 3BN4A 1GH8A 3TQEA 1K0VA 4ZVFA 2DR7A 1FRLA 1FKPB 2BVZA 1U1OA 3OTOJ 3KTQA 1H2TZ 4LF7F 1RISA 3EZ5A 2G0CA 3PNIA 3OHBA 2UXBF 4WTOB 4DX6A 1SUQA 4DR2J 3J7A1 4ZJLA 3U1LA 3KK1B 1QDUB 1AUDA 3M32A 3DRPA 3A3OB 5K5MA 2B5JA 2P6SA 2AX1A 3KJQB 1UL3A 4QR1A 4LF5F 4LF8J 3MR6A 1AA1B 2ALYB 4X66F 4X65F 1TL1B 1NHUA 5SUHA 5J2NA 1K73T 4LF4F 3QFHA 3C6UB 3FGVA 2MLZA 2V94A 4DPXA 1ZETA 3T1AA 1X4FA 3BBFA 3TVKA 3RW7A 4ZPDA 1NJZA 1BGXT 2IAJA 3QMQA 2MZ1A 2IBKA 2DHGA 3M2UA 1Y3JA 4B3SJ 2GAGC 3HHLD 1SBRA 3IM9A 3H2LA 3ZTOA 1JJ4A 3P3DA 5C42A 1CJKA 4ZS6A 4PKDB 2MQQA 1N0VC 3FMBA 3MI7X 1LKZA 1FRXA 4ZP7A 1NAQA 1XJWB 3EXCX 2VD3A 5AXLA 3L95X 4F7VA 4OIXA 5T41A 1NHVA 4A8QA 1KVJA 2ZDOA 2DHXA 5AXKA 3DLGA 3TUZC 1Y0HA 2I38A 2KHDA 3KUEA 4OYMA 5F41A 1C1CB 2RIJA 4OI0A 3N9UC 3TJ8A 4CRJA 3DRYA 4OJGA 2J9DA 2K2PA 3H5XA 1MROB 1I51B 1WWHA 3HHLC 4UOGA 4JYAJ 4HYKA 4ILRA 1WHVA 2DBBA 3PEJA 2DH9A 4LBPA 3UNGC 3OXLA 1S1WA 1PILA 1RHKB 1YZ7A 1HR0F 1VQ7S 1NSPA 2CNOB 1JLQA 1HI8A 4IR9A 1R8AA 1KOHA 3CD0A 4NLPA 1L3VA 1Z4UA 1KQKA 1NK4A 1ZAVA 1NPKA 2VG5A 2GHWA 3OFHA 4O44B 1RTHB 3AAWB 1NUEA 4KJIA 3C46A 3TZYA 1YRXA 5J1PA 1FXLA 2XC9A 1PBUA 2BE2A 1U2CA 4ZKAA 1KNZA 4RX6A 4A4JA 4NA3A 3MAAB 3PHEA 1Q78A 1YVFA 5IFMA 1IKYA 2NUUG 2ZE2A 3PJ9A 4W92B 4C8NA 4I6YA 2NUHA 2HVZA 2ABYA 3CJ5A 4IFYA 2CPXA 1J2VA 4WZQA 2JRSA 3IN5A 2C3MA 3Q8QB 4WTYA 1JLAB 4MIAA 3X3UA 4XPEA 5LL6d 3R5JB 2XLIA 1MMDA 3MUMP 2FJWA 4TU8A 1T05B 3EGVA 4F0KA 2Y1IA 2ROPA 3BKFA 3LANA 2KZMA 2CZ4A 4DV1F 5ETQA 4DR6F 4K4UA 4M5LA 4YDDB 1KFDA 3MMCB 4MFBA 4R0EA 4DOZA 4P75A 3M8WA 1X5PA 4TY8A 2DGXA 3O8WA 3MXHP 3G2XA 1MU2A 2DXEA 1RU2A 5IV4A 4O4GB 1RWWB 3ET6B 5HROB 1R8HA 1NBEB 3CCQS 4UF4A 1IM4A 1S7IA 4OLPA 1HWUA 3R6LB 4DL2A 4OZ5A 2DRAA 5LXRA 4HEA9 5D0HA 1RP5A 5F0UA 4USUA 1JJCB 3DRSA 3JSMA 1WTFA 4F3OA 5ETTA 3US5A 1CSJA 3IWLA 3W2VA 1RHQB 2CQHA 2EVZA 2BZ2A 3MMAB 2Q3PA 2B51A 4HI1A 3HSDA 4HDGA 1Y5IB 3UD4P 4LMZA 5KFPA 2BE9B 3QRPA 4USKA 1H38A 5LM7E 2W9BB 2UXCF 1S99A 5D15A 4F25A 2MYFA 5D3GA 2X1FA 1T02A 4Y2AA 3K8WA 2VA3A 4MH8A 1SJRA 1RKJA 4QR0A 3KLVA 2DTJA 1DY3A 2J0WA 1N5QA 4NYPA 4DQIA 4R25A 1HNIA 2C3PA 1ACMB 2EG2A 4LSNA 9RUBA 1XNRF 2DGSA 3M2VB 2OSRA 4DF4A 1PKUA 1UAWA 5F8NA 2QA4S 3EVOA 2YNIB 1OYDA 4JB8B 1UVKA 2ZOGA 4P73A 2I1RA 2FLPA 3VAJA 2E5IA 2F3JA 2HLUA 1HMVB 2H4YB 2MMYA 1YK9A 2ZH4A 2NPIA 3D0GE 1Z1ZA 4C3KA 3DYAA 1HNZF 3A8IA 1RADB 2Y1JA 2VDHA 3HK2A 3QNWB 2XSFA 4OI2A 1TV6B 3VQTA 1C0UB 4Z2XA 4M5MA 4UOFA 4DPUA 4MK9A 4W4MA 3N0VA 1IBKJ 4JI3F 2E7VA 2Z0GA 4OJHA 5FDLB 4DN9A 3RW6A 4KC5A 3BF4A 3BB5A 2HURA 3BJYA 4CLLA 1TUWA 4KTQA 4QYRA 7AT1B 3OTEA 4OYZA 2V2KA 4DV4F 9ATCB 3UCUP 2P9EA 2V63A 4HDHA 4OX6A 2XULA 2N3LA 1MW7A 1NDKA 2F65A 4NEYA 1VQNS 1YSJA 2GZOA 2DVIA 3G71S 4UY8T 3U02A 3PTWA 1CS4A 5DZ6A 3OLBA 3H4BA 4AL6A 2DGUA 5BYRA 3NCQA 3M8SA 4RUCA 3QT5A 1URRA 5HL7Q 2W4PA 3DMJB 2RQMA 3KNGA 1YRUA 3GFHA 2KRRA 4CLTA 2HS3A 2J7KA 4UOHA 1HNWJ 3AXKA 1WTBA 1RWKB 3DXBA 1F6TA 5F9LA 3FRZA 1NLKL 1SJ1A 1U8SA 3RBDA 2MZQA 4X4RA 1FK9A 1VLOA 3N6LA 2YQ3A 3FCHA 4RNMA 4DV2F 2VDIA 3S1TA 3PDNA 3W63A 2AGOA 4CTAA 1W25A 4QWDA 4K0KJ 2C2RA 2HVEA 2NXEA 2JNJA 3I31A 3SCLE 2CAJA 1VQYA 1OJ4A 2D7SA 2XWXA 4OYWA 2PA3A 2CA9A 3TA0A 2M2BA 5KFMA 1GNKA 1WC6A 3OUYB 3QATA 4FYDA 3HT0A 1GMUA 4DSLA 2QMWA 1IR0A 1VRQC 1PJ5A 4ZVEA 1LWCA 2RUGA 4NWBA 2YWWA 2UVVA 1TL3A 3PR4A 1KONA 2XY5A 5KFJA 4A8MP 3J80Y 2CJ9A 1U2RA 3IRXA 4USIA 3LUYA 4PXBA 3C66A 4N7TA 2NYIA 2D3ZA 3WIVA 3NAIA 3VGSA 3N4WA 2DD8S 1CULB 3EYZA 5KFWA 1GQEA 1KTQA 2PA8D 3V4MA 2WVFA 2ZUGA 3CDEA 3CCSS 3BO3A 4ANCA 2HGMA 5KFTA 1LK7A 1LW0B 2VJVA 3JS9A 4F8RA 2DHAA 1SQEA 3M8RA 2W7PA 2ZH2A 4R5PB 4M1KA 4FBTA 2BW2A 4ZN1A 3FZ2A 2JC0A 3Q2SC 3HT3A 3KJNB 5CQGA 3K59A 1FE4A 2F63A 2UP1A 2EWHA 3AHPA 4DR5F 2BKPA 1RT3B 4PXEA 2WONA 1FD8A 2YVSA 3H25A 4ED0A 3DDKA 2Z30B 3ZO7A 3MM6A 5KT2A 1RI7A 1JXLA 1H72C 2YQ0A 5GMDA 2HMIA 3WX8A 4XK8C 3CDWA 4PWDA 3V81A 1N6QB 3V4IB 3TEGA 2MKYA 4N41A 2F4FA 3HX9A 4U67Q 2O1PA 3HPOA 2CQ4A 4I69A 2M70A 4HACB 2NPFA 5KFGA 1X60A 2DY9A 5HQ8A 1S6PB 4TN2A 3ZZYA 2ZD1B 1Q79A 2IRYA 1T3NA 3Q8VA 1N34J 1VGYA 2XNQA 4XPCA 4YFUA 4RJVA 4C98A 3IG1B 2BKOA 5KT7A 4Q2LA 3H40A 1FJGF 2NSCA 3CGIA 4A46A 4YS2A 4IFVB 2W4CA 2E7WA 4ECSA 4EEYA 4NASA 1FDDA 2F8EX 1TELA 3M8PA 1S59A 2D9OA 1HQEB 2MKJA 2F40A 3HXMA 3N6MA 2ALZA 2LA6A 2J6TA 5DLGA 2R2RA 5B0GA 1U1KA 4HTIA 2WBRA 5DJBA 3V2UC 1O6XA 4NEZA 4YHHJ 4DPWA 5MLCV 2WSFC 5HBMB 1JNRB 4KGMA 2GFFA 4QWCA 1RT1B 2CPEA 3DOLB 4C0OC 1EP4B 2CPYA 2YX1A 4RW9B 3EDRB 4LRCA 4KFBB 2YX7A 1QTMA 1RBAA 1U48A 1NKBA 3MGJA 1OWXA 4WU3A 2LDIA 1I94J 3SCJE 2CQGA 4EI2A 3H5UA 3VV2B 2JEGA 4KSEB 3GIJA 2VQEF 2V50A 2ZEJA 5T7LB 4EFAC 5HMZA 3QGPA 1PYSB 2CPZA 4FVMA 5DM7Q 1HNVB 3CJ3A 3N6NA 2ZHBA 5L8RC 2B9XA 4ZITA 2CDRB 2VPYB 4W90B 3SDEB 3R3TA 3W61A 4PCQA 2HHSA 3B8HA 3H8YA 2YKOA 1FE0A 2F8HA 2YWFA 3EZUA 3CB4A 4IRDA 1AW0A 3WHIA 3IBCB 2HFOA 3IR5B 4QIEA 2O3DA 1D9DA 4ES2A 1IKXA 1RSCA 4C3MA 3Q2TC 3M2RA 4DV3F 2K7KA 2BR0A 4C6AA 1ZAXA 1MN9A 3OL8A 1Q8LA 5CH7B 4F4XA 2J0QD 2QMUB 3CJ0A 1NHKL 4QW8A 4OQJA 3A4TA 1FXDA 3R7NB 3PFOA 1REVB 3QIPA 1WF1A 1HHSA 1S5ZA 2P6TA 3K17A 3IR7B 3PV8A 4N77A 3OL7A 2H51B 3I96A 4FVCA 4L6V3 3TX0A 4WPAA 4TLRA 3B54A 4DQQA 1KLNA 1FF2A 5L1KA 1CQMA 4NYZA 3TW0A 5FLXY 2VL1A 4K8RA 3HM9A 1ZM9A 2LQBA 5KFCA 4E0DA 4U96A 1P27B 1NEEA 3R5BA 1RTJB 3W9IA 4OX7A 1D8YA 2FQQB 3PKYA 2P9GA 2VG7B 4J9RA 2W9CB 3NGTA 4RL1A 2WCXA 2FGCA 2C1EB 2KM8B 1S4FA 1HBOB 3IO1A 2XO6A 1UPPA 1H2UX 3P4UB 1C4CA 4U7CA 2YNFA 4NLDA 1S1TB 3DI6A 1BMQB 3LP1A 3DU5A 4CCHA 2YWKA 3DDIA 1VYAA 2QL7B 1SQFA 4Q8FA 4LF8F 1WHWA 4NCBA 4J37A 2NXCA 1EAYC 3G8SA 3SQOP 2BQ3A 4WU2A 4M5NA 5JUMA 2XCPA 1PJ6A 1S97A 3GG1A 3Q0AA 4FNIA 4Q0BB 1HFEL 4H4OB 4AMOA 2B6AA 3K8VA 4MKBA 4K2XA 2XYGB 5HAOA 4CLWA 2ZJRQ 1NU4A 1YJ7A 4DFPA 1T9UA 2UV8A 3VVTA 3EPIA 4NXMJ 1F3VA 5DG7A 2M7SA 1Q86T 2W8LA 3M6WA 4PG7A 2WSCC 1QM9A 3JXOA 3EXYA 1HQUA 4ZLNA 1AROP 1TL7A 4ELTA 1RWOB 3P5TL 1XR6A 5DG9A 5G0RB 3D1OA 5F8GA 1B0PA 5KFSA 3WQPA 2UUAJ 2BUNA 5DGBA 1SUQB 4J5OA 2J8AA 2OSQA 2DO4A 3MOJB 2IHR1 3M32B 5IT9U 3B6BA 4HHJA 2BA9A 3TWZA 2B5JB 2CNKB 1NK5A 4TVAB 5BYSA 1CG2A 3K5OA 2HHHJ 4TNOA 4HI2A 2ACYA 2OI2A 4JYAF 3E2EA 5J2NB 2MJNA 1X4CA 3NRBA 3HVWA 3JTOA 5E3RA 3DC2A 1ZPWX 4I56A 2RQKA 1SCJB 1J27A 5DDQC 1WELA 4Q8EA 2Y8YA 3HKWA 2IAJB 3M2UB 3R6GB 4IYQA 4CO3A 4YR3A 2ASLA 1F5BA 3W5YA 3VAFA 2LECA 1YQHA 2HLTA 2QLJB 2RU3A 2YPYA 2CJKA 3RB3A 4YMEA 3WC2A 1WOPA 4LT6A 3SFGA 1SC6A 1DJ0A 1T9VA 4QWEA 4EU0A 1Q5YA 4NZ0A 3THTA 4YN3B 5RUBA 4OJ1A 2PEHA 1KQSR 2IFXA 1ULRA 1HQ2A 1CC7A 2GQCA 2Z2ZA 1AZSA 1A0OB 1KR4A 5KT6A 4LQ3A 1NJXA 5E2QA 3BS9A 2XO7A 4LREA 3FSYA 1EX8A 1MMNA 1M5SA 3B82A 5C25A 1LFPA 2BMBA 2ZHAA 3I4HX 5K8NA 2V2VA 2L9DA 8ATCB 1O0PA 5GADI 1ZBTA 1WC0A 3ISND 3TZXA 4OZ0A 1JLQB 5MAOA 4DR1J 3TZZA 1FD2A 2HVDA 2VASA 4ZVGA 4ED7A 5B08A 3LP0A 2VG5B 5EHHA 3G6XA 1F5CA 2AZ3A 1T94A 3W7BA 2D1CA 3I6PA 3FJ2A 2DHSA 2BE2B 1H7XA 5F8LA 4NZ7A 3LALA 2AYGA 3LPYA 3OW2R 2F1FA 3L4BC 2ZE2B 4FPIA 4FS1A 1WC1A 1HBNA 2HFUA 4IFYB 3J81j 4KO0A 4Q7AA 3HSZA 3C2PA 4A8WA 3I9ZA 4ES3A 5E5NA 4OHWA 2D3O1 3LWLA 3KUHA 2BJEA 4DG1A 2GO8A 2AQ4A 4WFNQ 3FK4A 1SV5B 4WK1A 4RLEA 1OSDA 1FI4A 4OHVA 4PR6A 1RLDA 4OZ2A 1M1GA 5GAEI 3VQSA 4Z37A 2AMCB 4MFBB 3HULA 1QJHA 4TY8B 2D3UA 4XO0A 1MU2B 3MUVP 4ECXA 1C1BA 3ZZ0A 8RUCA 2QG9B 3FSIA 2DNRA 5D8HB 3D3BJ 2GIFA 2CQDA 2E44A 4IOCQ 4CH1A 1JK9B 3D1QA 2CQ2A 4LIWA 2KXNB 1UA0A 1VIOA 2A18A 1X9WA 3AJ1A 1U49A 3BN7A 2G1HA 4ZOSA 4ECYA 1HD1A 1VQ8S 2NS1B 4OZ3A 3JSMB 5AXNA 1GAOA 2XY6A 2VQFF 3KOAA 1D8ZA 1TU0B 1YLXA 1RT6A 1WG1A 4N8NA 3W2VB 1DQ9A 4DCOB 5CYJA 1GMWD 2MEWA 4G65A 4NLGA 1T9XA 3QT8A 3D67A 2AIRB 3DRRA 3UD3P 1EKRA 2L9NA 2QL5B 2DNPA 2ACMA 4QU7A 4K2JA 1LQ9A 4DPOA 4ZLJA 3FBEA 4DDFA 3S7RA 1U47A 1N32F 3A8KA 1FO1A 2PDAA 3TUPA 1BHNA 2YKNA 3GP9A 4DUYJ 1U26A 2IJRA 2CJBA 4NLUA 4XDCA 4CM2A 1WORA 2H5JB 1HNIB 4DV5F 1M0SA 2XEXA 3J7YU 3VR1A 3PG9A 2E1CA 2ATCB 3W9HA 1VJWA 4LF1A 1HLWA 3PIOQ 4DR4F 4FP9A 1KWMA 1CC8A 4LR7A 1CLFA 2G9OA 5CCLA 1JXVA 2MKKA 1LWXA 3HHKA 4OI3A 1S48A 2A6MA 4PZVA 4LR9A 3CC2S 2I8EA 3LOUA 3MMJA 2UUBF 4M5DA 1H7WA 4PEOA 3Q22A 3D0HE 1WF0A 2W2PP 4LSLA 3VGUA 1WF2A 4IRKA 4CI0B 2VH7A 2CDQA 5THWA 2EXUA 3HVRA 3RYLA 5IOLA 4DU8A 2EC0A 4QIVA 1XR7A 5HP1A 2DK2A 3I55S 3RZAA 1HWIA 2W8KA 4U8VA 3TQ1A 1ZA1B 2NCKL 5KG7A 2R8HA 3B4MA 2Z56B 1F2GA 2FJAB 1IKWB 2HIYA 2P2CB 1M1HA 2IJFA 3M1VA 4CLPA 2V34A 1S0NA 3GR0A 4O3OA 3JAMU 2O66A 4LF7J 3C6TA 4J9OA 2J5AA 4RW8A 3P49B 1JLBA 1MLAA 2BJ8A 1RAGB 1R6VA 2HFZA 3MEEB 4F0MA 2CPFA 2UXBJ 3T5KA 3R5AA 1Y9OA 5D4LA 5DETA 2H65B 2G2OA 3MM8A 2V67A 3RB4A 1UWBB 1I3OB 2KDOA 3D3CJ 2OJ3A 3FBCA 3BR8A 1CS4B 3D54A 4LF5J 3IBWA 3SXLA 2X51A 4OV1A 2LU1A 1LV5A 4X66J 4X65J 4XDDA 3CT9A 3PX4A 4RR5A 4JI2F 1EQ0A 4LF4J 1RTDB 3CMQA 2X1BA 1VQPS 4DZ6A 2VBYA 3GQCA 4ZLLA 4FF2A 1WHYA 1FK9B 3CDBA 4M5JA 2KZZA 5ETVA 1YJVA 2SXLA 1GK8A 3CO0P 4KV8A 3ZTPA 1RTHA 4CTAB 2B9YA 4AMPA 3GFYA 5DDPC 5J2QA 2AEMA 1O51A 1WDDA 1SJ4P 1Q8BA 2MQLA 4OHYA 2WB1D 1XMBA 3R1HA 2IRUA 2I2YA 2M3DA 4G1QA 3PW5A 2UZAA 1BLUA 1Q4RA 4YUDA 1I6JA 3KUGA 2RS8A 4D3GA 2ZITA 3ILOA 2ZZMA 2XMVA 1VISA 4AMNA 1LWCB 5CYQB 1TL3B 2O67A 5C2GA 2K7JA 1VRUB 1S10A 2AX0A 4WZMA 1ZTTA 4HT5A 3IRXB 2RH3A 1P6TA 4KKOA 5LSOA 2RVJA 3CE8A 2MKIA 2DGTA 3G6VA 3GLJA 2IY5B 3ZC4A 1S9EB 2MHNA 2BE7D 2Q6BA 4FXDA 3HO1A 4QCLA 3FSXA 3HFZB 1GT8A 1FEEA 1B99A 2DXFA 3HFVA 4PG6A 2HFSA 3GJTB 1HR0J 1ZOTA 4EZ6A 4I67A 5B0BA 3LTOA 3QAEA 1RE1B 5IT9Y 4H4MA 5DLFA 4RW4A 1SB6A 4DZDA 1N34F 3J81U 4WP9A 2POKA 2MGZA 1URNA 2EFQA 1DHMA 5E41A 4CDIA 1ROFA 5JJBA 4URSA 1N0UA 1PO6A 3A1YG 1ZZNA 2KN4A 4LSZB 3UO0A 4JI5J 1BQXA 2WONB 3MWBA 1R89A 3U1MA 5D0GA 3MDFA 2EBEA 3MFHA 5EWFA 3MM6B 2B56A 4J90A 3PRDA 1Q82T 4KBIA 1OS5A 2HMIB 1UVJA 5BXIA 3QZ7A 3V81B 3EVMA 5JVGQ 1NJYA 4DSFA 1U25A 3SQGB 1N48A 1X9MA 1VQ9S 1R7IA 2R8GA 1YI2S 1OMSA 2JLFA 1WD6A 2ZKTA 3NKYA 4DV1J 3HVTA 2W9BA 4JI1F 2MLXA 3BKTA 2HQFA 2LEPA 3SEOA 3EICA 1I94F 2J6UA 4O3SA 3UN3A 3NEKA 2HBZB 2C2EA 4ZCMA 3GIRA 1Y7PA 5KFNA 2UUCF 4NYOA 1QSYA 2KXFA 3KDNA 2KVQE 4B3MF 1T9TA 4CH7A 2J9EA 2HK3A 1P9QC 5HLFB 5J2MA 4DN0A 1PJ7A 2V9WA 2KT2A 1WJ9A 1YTYA 4P2FA 2J6SA 3RRKA 2O01C 2ZVIA 1LNQA 1RTIA 1WI6A 3K58A 4GKKF 1YIJS 3M8PB 3KG0A 1R8BA 4ICLA 2ZWPA 1HMVA 3SCKE 2ZDPA 4TXSA 4NLVA 2QLBB 4KGZB 5A2QU 1IN0A 1RHUB 4O3RA 3P8BB 4IKAA 5CXTA 4CLUA 2CQBA 2LMIA 2B4OA 2X1AA 2L48A 1RKIA 2HHPA 1N5YA 2YPZA 1TV6A 1C0UA 4HR2A 2UXCJ 3NL0A 2OEKA 1S77D 3ULHA 2D74B 2EFNA 3JTPA 2M4MA 2DCUB 4ZVQB 5ETOA 4K4SA 3R5GA 1FX4A 3R2DJ 4PUOA 3SI8A 2JVOA 3N5BA 3OLAA 3A8JA 2DH7A 1NH8A 2YWEA 4ZPVR 3KLHA 3ZTSA 1CJVA 3DRXA 3M8ZA 2CKWA 4P7TA 1PSDA 3CNQP 4NCAA 4L3NA 3HZEA 4LIRA 4A8YA 3GJSB 2MXYA 3O2IA 2EC2A 1XNRJ 5EDWA 2Y0BB 5EX3A 3D28A 2HWTA 3I5CA 2OMOA 2VKZG 4FBUA 1X7VA 1N56A 2DYAA 4C8KA 1IKXB 5HO4A 3UCGA 2ADCA 2V8PA 3E3XA 1KQGB 3MPWA 5KFAA 3ADAC 1FTCA 1AXQA 1M5OC 1JIHA 4USMA 3D6FB 5J2PA 2HS4A 2OEMA 4WBFA 3I32A 3NBPA 3MHYA 1JLFA 1HNZJ 2EPIA 1T7PA 2XZWA 2IVYA 4AQYF 2I9SA 2DR8A 3QIPB 4ZMMA 5KG3A 1LW2A 4AT1B 2DNQA 2YKQA 2IM1A 1SH0A 4F4ZA 4GO7X 4JI3J 2AJQA 4LRAA 1XMQF 1EETB 2V6AA 5IWAF 4F2RA 4K4XA 2GQ2A 2QFIA 2V4QA 3DN9A 2N3OA 3MECB 2BEFA 4O3PA 2IVMA 2NREA 2PFDA 3RUBL 4DL4A 1ZS6A 4FF1A 3PACA 1R8PA 2AW0A 4LVNP 2BOPA 3G8TA 4ATNA 2G2YA 3FBFA 2PFFB 2HQ3A 4NXNF 5ADZA 2Z2MA 2YNFB 1CJUB 2MQPA 2L3MA 2EFOA 3FEZA 3DI6B 4UT4A 1X9SA 4L3KA 3M8YA 3LP1B 3SCIE 3JSBA 3PO5A 4TQSA 2AGPA 2DGWA 3DFEA 2JWNA 2C2OB 4KPCA 3M4XA 4X62F 4IG3A 1CULA 2U2FA 2ZFHA 1YHQS 3WX4A 4C8OA 1TR0A 1RBLA 1QE1A 2B9EA 4X4TA 2BRKA 3D6HB 2B6AB 5CD4A 1B7FA 4DLEA 4DV2J 3S01A 3W64A 2UU9F 3E01A 2J7WA 5LT5A 5F3ZA 2VV5A 3AD8C 2JL9A 3I5BA 4FS2A 2R7TA 3PO4A 3NNAA 1KVKA 5H1SV 4B9VA 3P96A 3I82A 1T8EA 1HQUB 4EBDA 4IH6A 1TL7B 1OYEA 4LFBJ 1WEYA 1NDPA 3G6ES 3PM9A 3EJMA 4IOBA 2YNHA 1M5HA 3NP5A 1TKDA 1I1GA 1X8DA 3PW0A 3AQPA 1FERA 4LFCJ 2QA2A 1RHMB 2OH2A 2ZZTA 1WOOA 5A0YA 3QZ8A 1SL1A 5B0FA 2MQOA 4DJBA 4J9QA 3NS7B 4CNZA 2BM0A 3GILA 3D9BA 3CIZA 1PAEX 1R8CA 3JAMY 3VHQA 2CQ1A 2GS8A 3BEGB 2IMWP 5LXYA 3MEKA 4KRWA 2LXFA 4JI7J 1M90T 1MWYA 1UFKA 2K1RB 4I0WA 1H0HB 4L75A 2WSEC 2GX8A 2ZH3A 3ENVA 4CT9A 2ZOMA 2D69A 4I7FA 4J9NA 2W7AA 4ZK7M 2BJ7A 5AXMA 4A8OA 2K06A 3DOMA 4RUBA 5DDRC 4KH1B 1VQKS 2OPPA 4I1TA 4IFVA 2B4PA 5ETMA 1X4BA 1CPZA 1I5OB 1Q0NA 2G13A 1M5KC 2I0XA 1WUUA 1X5OA 3I56S 4ZN3A 4A48A 4DR5J 3S8SA 3KHGA 3GV5B 4WFBQ 5SZTA 2FD2A 4DSJA 4KHPF 1M1KT 4USTA 3O1LA 1U8WA 5HMXA 1NSAA 3DLLQ 4IH5A 2MTLA 4RU2A 2KM8C 1IWGA 1S0VA 1FJCA 1AZSB 4JUZA 3BYPA 5HBMA 2HVIA 5IXUA 2C2NA 3ZZTA 1RT1A 4YY3J 4ZP6A 1NZAA 5C25B 4RW9A 3KLGA 2OTLS 1RWUA 5KFZA 1IJEB 1R27B 4L72B 1KOOA 3PY8A 2XHWA 4DS5A 5GVQA 2BJ1A 2MKCA 3EPGA 4J9VA 2G0JA 5IC6B 1HNVA 4F2SA 4LF2A 1RQ0A 2KXHA 3NMAA 4BC7A 1XIQA 1FJGJ 1RABB 1H6KX 1S6QA 2XI3A 1O8BA 4MT1A 5ETSA 5KOWA 3FNNA 2UUWA 4DV6F 1YDLA 3KHHA 3GE9A 3M7VA 5FIIA 1VQOS 5ITHA 3TP2A 3R5CA 3TO8A 3IWNC 1HBNB 3EZOA 2LP4A 2FVCA 2LXUA 2EW9A 2CUYA 5L1JA 1UEUA 2IMOA 3OHAA 4I2QA 2OO4A 5DQHA 2AT1B 4KHRA 3KXDA 4USHA 4LJMA 4LVOP 3CVKA 1B0VA 3F41A 4DG1B 3TX8A 1HWJA 3FMWA 4YP3A 1VBYA 1RAHB 5DO2A 2HZAA 2HNZA 3DCAA 1K47A 3SYZA 5JMNA 5K9FA 4ED3A 2C22A 3FQLA 2KYXA 4P2XA 4A8KA 1JX4A 1NDLA 2VQEJ 2XTJP 4YB1P 3ENAA 3O6QA 2XG8A 5H9EK 3ILJA 1Z2ZA 1KDNA 3CPWR 2J0SD 2BJDA 3A3NB 4GO5X 1C1BB 1D1UA 3K7RA 1QAIA 3I0RA 3EVWA 1TVRA 3IAM9 5EX0A 2LDYA 1UVNA 3OL6A 1WI8A 1AB8A 3TUIC 1U7LA 2Z4PA 3CSKA 4ETZA 5B0CA 3DLEA 1HBOA 3DM2A 5KG5A 1BE4A 1KHVA 2QEXS 2IM2A 4L76A 3WC0A 1LWFA 4DSEA 1CQNA 3GIKA 2KFZA 3IRWP 3QRQA 4ITSA 5K8MA 4DFMA 1UFWA 1RXOB 1RT6B 3MD3A 2VHGA 3TVYA 4B9TA 2FJDB 4G3IA 1ELOA 3T6BA 3CCLS 1VLYA 4ZVUB 3QPIA 3WBZA 3H5YA 1HNXF 3DRRB 1KS2A 2HZCA 3VAHA 2KFYA 1N52B 3QSYB 2ADBA 2O5DA 3BGLA 2XNRA 3TAPA 2I5JB 5A2QY 3FUYA 1H74A 3HJFA 1RACB 3CWJA 2CJYB 5ETPA 2M8HA 2MQNA 2YKAA 1V5VA 2YKNB 3QT7A 2IDLA 3BREA 4LR8A 2VFTA 5D0EA 3JYTA 1QVFR 1U0HA 4GVLA 2ZH5A 1W2BR 2GV1A 4CO2A 2VIHA 2DPJA 2OD4A 3Q89A 4RO0A 1U09A 2B4VA 2LEBA 4Q43A 2XMTA 1F0XA 5BR8F 1RU1A 5G0RA 4V19X 2R3VA 1N33J 1VC6A 1SC4B 1B70B 1C4AA 4ZDNA 2C2ZB 2LVWA 2JLEA 3ZNJ1 3RRHA 3FKBA 3LAMA 3CJ4A 1KQFB 2XM3A 5HATA 1VQ5S 2DNMA 4QQBA 3RAMA 2VFVA 4URQU 2CFXA 4M5DB 1TL4A 2P9CA 1MMLA 3Q8PB 1E6VA 1YGYA 4LSLB 3TEHB 2EFGA 3MZIA 4TKTA 3BQ1A 1KC8T 1YBAA 2RS2A 2VG6B 4A8SA 4JI8J 3KJFB 1RHJB 4OI6A 1PBAA 5KG6A 5HP1B 2KI2A 2FJBB 5KOXA 4CO0A 4ZVSB 2ZUAA 2EBGA 3OPKA 1OPZA 1EARA 1SIWB 2AEFA 2VZ8A 2PSZA 4GMKA 2ROGA 3M1VB 5KG0A 3AFGA 4UUXA 3GJRB 2RDIA 1RJJA 2VJUA 2AKWB 5IT0A 3C6TB 4RW8B 3T9ZA 1CBKA 1JLBB 4F3QA 2RHQB 3A12A 4PAAA 1WKKA 4NOHA 3UQSA 2C28A 2M0GB 5DQGA 3UR3C 1JLCA 5I3QA 4BBYA 5KFOA 3MM8B 3K0JA 2JSXA 4M8LA 3ZNUA 4KGVB 5BJRA 1GXUA 3W8GA 4KPYA 4F3MA 4F26A 2Y0SD 2OPSA 1HARA 2GVDA 1RHRB 2ZC3A 2RAQA 2QTWA 4JI0F 3Q86A 3UDEA 3T1YJ 1LWEA 4X4PA 5K14A 1UZDA 4CQ1A 4PQUA 4QIFA 1MN7A 4EMDA 1HWKA 1TAQA 4WP8A 5B0EA 3MURP 4KV8B 3CJ8A 4DHVA 3I4PA 4AD6A 3J7ZT 3OFEA 2CG8A 3CCUS 5J2QB 2PEBA 4N5SA 2ZM6F 3W60A 3F73A 4TU7A 3PZPA 4RW6A 1U0SA 1X5SA 4ED8A 4DQPA 4JI5F 2LU2A 4G1QB 2IIHA 2JH3A 5AE1A 3AA8A 5KFLA 2R2TA 3M9OB 1HWLA 4C97A 3PJXA 3EWGA 1T11A 3OJSA 1D9AA 4TYAA 3BSCA 4KKOB 1NKEA 2L08A 4O23A 3OBIA 1VDHA 5IQ6A 4B3RF 2M9KA 1SV5A 3NNHA 1H3DA 2XLJA 1YWXA 5D4PA 1APSA 2FZGB 2H3EB 4MK7A 5CHCB 3J7Z5 2R4FA 5K8OA 2RILA 4OYPA 4H4MB 5T14A 1VC0A 2C2DA 3NS5A 4RW4B 3NMRA 2V2ZA 4KAIA 2MGZB 2GVZB 1HYSA 4QU6A 4CO5A 2I6WA 1UEVA 1V9OA 1RAEB 5KAKA 3CCMS 3EGZA 3C14A 2CZ9A 4NLSA 3LQVA 2MLYA 2RU9A 2XQCA 1TFYA 1UFLA 2DEJA 2XY7A 1OY8A 4WXWA 1FRJA 1G2EA 3C16A 4X4UA 4J9SA 2NYHA 1X4DA 1K9MT 4ENOA 1DFDA 2DNHA 2QX0A 1F5AA 4F4AA 3TARA 1F9HA 4DLGA 3UWTA 3KK3A 1N88A 4WWSA 1JNZB 2VZ9A 1TK8A 3BO2A 1FDBA 3V6JA 4CH0S 4CZCA 2W4DA 1S4EA 1U6BA 4F04B 2ZBIA 3A13A 3HVTB 3DGVA 3IXQA 1R0AB 2RQ4A 3FZBA 2M88A 3GV8B 4FKXA 3CD6S 4USVA 1L3TA 1UW9A 1HD0A 1RWPB 1M5VC 1RT7A 4XIUA 1GMVA 2YNGB 2VOPA 1HBMA 3TUJC 1XWLA 5KFEA 5J2MB 2HGLA 4OZJA 3RG6A 2JHEA 2DNZA 4BCAA 1G6BA 4JV5F 4QBUA 2HBRB 4ID5A 4IO9Q 2PMWA 1RTIB 3QYYA 5GMKa 3M8QB 4OL8A 1NMEB 3RGIA 1T9YA 4IG0A 4I68A 3H7HB 4BLGA 1SH2A 4ICLB 1EIYB 5DS7A 2VQFJ 3T5LA 1TL5A 2KHCA 5D6GA 1CEZA 3AXMA 1G4CA 4P52A 4FKYA 3PYEA 1VHIA 4NX9A 2L41A 1NB7A 2GGPA 2FVQA 4E8UA 4KR0B 1RWNB 1N5YB 2OAUA 1QD1A 3QWUA 3T1HJ 2F9JA 1XC9A 3ISZA 4DR3F 2GW8A 3EMTA 3KDOA 1N32J 2F7VA 1YG0A 4RUHA 4OHZA 3VTIA 5LJ5Y 4PUOB 1IKWA 4WFZA 3KLHB 3TYTA 1CJVB 2ZNYA 2DNYA 3J7YI 2B9WA 1AFIA 4DV5J 4WP3A 1H98A 1FFGB 3IM8A 4G6VB 1FFSB 2ZKUA 2VPZB 1X5TA 4ALZA 1RAIB 4X2BA 3MEEA 3KWMA 1F3FA 4QWAA 4DR4J 3T41A 5LSRA 2DHHA 3TZWA 4PWUA 4EZ9A 1UWBA 1IVZA 2J9CA 3PYDA 4EBCA 1Q1KA 2WVEA 3RR8A 1Y00A 4WE1A 2UUBJ 2VBWA 4GC7A 4WYLA 2COLA 3PW2A 1WDTA 2RRNA 5J2PB 3DOKA 2QRRA 1RTDA 1S6UA 3OSPA 3NBPB 1JLFB 4OHXA 3UN2A 1ZM3A 2QL9B 6FD1A 3D6TB 4NLWA 4EGLA 2QN6B 3UR0A 1LW2B 1T3OA 1ZPVA 3NWRA 1K1SA 3B4DA 2APOA 3AODA 4NZ6A 3G82A 3KLEB 3HVAA 1GTEA 3IMQJ 2FY1A 4G1IA 2GJ2A 4X64J 2WVBA 4WFAQ 5CD4H 3T3FA 3VGVA 1LOUA 3IAS9 4J9PA 1DZ5A 4QPXA 2AWZA 4DFKA 1WSVA 5CABA 4Y2KA 4TU9A 4NE9C 1L5UA 1OO0B 1XERA 4K5SA 3BV8A 4LFBF 1U1PA 1IUJA 2CVEA 2AJ4A 4O0NA 4B3TF 4KQZA 4PPDA 5CYQA 1UETA 2MPUA 3KKFA 2V9KA 2XZTB 3M9MB 2EEYA 3Q23A 4LFCF 1VRUA 1U1NA 3THPA 5KG4A 2FLNA 3W5ZA 1VQMS 4BWMA 2QZ8A 4MK8A 4ZPTR 1VOMA 3RBEA 2Z58B 2VBXA 1S9EA 4OJ3A 4DQRA 3Q8YA 1PG5B 1FDAA 1FHTA 2FJEB 4WKYA 4ZCKA 5E3CA 3U7JA 4JI2J 4IG3B 4JI7F 2HNYA 4P71A 2R8JA 4Q5VA 3I87A 4GC6A 2ZOFA 1QE1B 1DAXA 2LKZA 3K57A
chains in the Genus database with same CATH topology
5J1EB 2ZZMA 2XMVA 2EFPA 4MTPA 1LWCB 5CYQB 1UVMA 1TL3B 1WHXA 4ZPWR 3E01B 1JLQA 2O67A 1HI8A 2ILZA 2K7JA 1VRUB 1S10A 2FJVA 4IR9A 2AX0A 2HYIB 2C42A 4M63A 1ZTTA 4WZMA 2IM3A 1VRTB 4HT5A 2CUYA 2GHPA 1R8AA 2LA4A 1KOHA 3IRXB 3DLGB 2Q1LA 2RH3A 1P6TA 4FXVA 2V4JB 3CD0A 4KKOA 5LSOA 2RVJA 3CE8A 4OX9F 2MKIA 4NLPA 1L3VA 1Z4UA 1KQKA 2DGTA 5KFYA 3G6VA 1NK4A 2KO1A 2XMUA 1ZAVA 2HVHA 4USJC 3MTJA 2VG5A 3ZZOA 2GHWA 3OFHA 3ZC4A 1S9EB 3GG0A 4O44B 4WCEQ 2GA7A 3KLFA 2MHNA 1RTHB 2BM1A 2RNEA 3AAWB 4RZRA 2CQ0A 2Q6BA 3MR5A 4KJIA 4FXDA 2WOMB 3C46A 1KSPA 3D2WA 1N54B 4TYBA 3HO1A 2IJNA 3LGMA 4QCLA 3FSXA 4UOCA 2F4VF 1NM2A 1KLMA 1YRXA 2CZVC 3OR1A 2HHVA 5CYMB 5J1PA 2YWHA 3BO4A 1FXLA 1GT8A 2XC9A 1FEEA 3H59A 2BE2A 4IDKA 4ZKAA 1KNZA 3PIPQ 5H9EJ 4PG6A 2LQ9A 2MDAA 1FKOB 4RX6A 4A4JA 4NA3A 4OX8A 3HP6A 1XK8A 3PHEA 2FHMA 1Q78A 4TY9A 1ZOTA 1YVFA 2B43A 5I3UB 2YNHB 5IFMA 4EZ6A 2YKPA 1IKYA 4RKUC 5CCMA 2QA4G 2NUUG 1Q7YT 2ZE2A 4W92B 4I67A 5B0BA 6FDRA 4C8NA 4I6YA 4M94A 4MKYA 3GYXB 1RT4A 2NUHA 2HVZA 2ABYA 3CJ5A 3QAEA 1U1LA 1S1WB 3ENWA 5I3PA 5IT9Y 4H4MA 4IFYA 2CPXA 1J2VA 5A0YB 5DLFA 4QPTA 4WZQA 1Q7LB 4ZPCA 2JRSA 3IN5A 1VFJA 5KTQA 1IBLF 2BACA 1SB6A 2C3MA 4RW4A 2XMMA 1N34F 3Q8QB 5JVHQ 4WTYA 3DLHA 3MTKA 1JLAB 2POKA 4MIAA 3X3UA 2C3OA 4XPEA 2MGZA 1URNA 5LL6d 2EFQA 1B64A 1DTQA 3SQGA 1DHMA 4YY3F 3CO9A 5E41A 4RNHA 4QJVA 2XLIA 2MHEA 1MMDA 3MUMP 2YY3A 1IJFB 3CCWA 1MWZA 2FJWA 1ROFA 4DUZF 3SV4A 5JJBA 4TU8A 1T05B 1VS3A 4URSA 1DARA 1RT5A 1N0UA 2ZH7A 4WIIA 1JLEA 3H4DA 1PO6A 3ZFVA 2NLWA 3SV3A 3KJVA 2Y1IA 2ROPA 3A1YG 1ZZNA 2KN4A 2LCWA 4IRCA 4QZVB 3LANA 3LF0A 2AV5A 1A7GE 4MJKA 4ETXA 2KZMA 1KLMB 2E1RA 2CZ4A 1BQXA 4DV1F 4DR6F 1V3ZA 2WONB 1FNXH 3MWBA 1R89A 3U1MA 2KTQA 4K4UA 2V4RA 4YDDB 2AYBA 2WRMA 3MDFA 2Q66A 2FHJA 2GNKA 1KFDA 4JV2A 2WTFA 2EBEA 2KT5A 3MMCB 4MFBA 4R0EA 4DOZA 3MFHA 5EWFA 3G86A 3MM6B 3PVXA 1S9GB 2B56A 3M05A 1IKYB 3PRDA 5KT3A 1Q82T 1X5PA 4TY8A 2DGXA 3LO3A 4I7FB 1OS5A 4KBIA 2HMIB 2VPWB 1SIZA 3O8WA 1UVJA 3MXHP 2PI4A 1S1XB 3LP2A 1SKRA 5D4OA 2VOOA 3QZ7A 5HLFA 1MU2A 3V81B 2KG0A 3MFIA 1UVLA 2OPPB 4O4GB 5JVGQ 1NJYA 5HROB 4DSFA 1R8HA 3OR2B 1N8RT 4HL9A 1U25A 5FJ4A 2XLKA 3SQGB 3BR9A 2W9AA 3ISNC 1N48A 1X9MA 1VQ9S 3CCQS 1R7IA 2R8GA 1IM4A 1YI2S 1QSSA 3PX0A 2JLFA 2QMXA 3HHNB 2QT7A 1WD6A 4OLPA 2ZKTA 3NKYA 1HHTP 1HWUA 4DL2A 3SBMA 2VFRA 3HVTA 2W9BA 4JI1F 4IUFA 1KTVA 4DMZA 3C3LA 2VODA 2LEPA 3VALA 5A8RA 4OZ5A 3SEOA 5LSLA 4ED6A 1I94F 2J6UA 4O3SA 2DRAA 5LXRA 4K4TA 2C2EA 4HEA9 1VC5A 1U4BA 1W2IA 1RP5A 3QIDA 2ZVSA 4ZCMA 5CZCA 2KU7A 5BYQA 1JLGB 5F0UA 2DGOA 4JOUA 1Y7PA 4JV1A 5KFNA 2UUCF 3DRSA 1FNOA 4NYOA 1WTFA 3KLIA 2XGQA 3JSMA 1QSYA 2KXFA 4K4ZA 1DRZA 1VQ4S 4F3OA 2R8IA 3US5A 2MY7A 2K3IA 1CSJA 2IYGA 3IWLA 4B3MF 3W2VA 2HAIA 4CH7A 2J9EA 2AD9A 2CQHA 1P9QC 3NLCA 2Y1RI 5HLFB 2EVZA 5J2MA 4DN0A 2BZ2A 3MMAB 3RU0A 3TANA 3P6YC 4B3OB 2V9WA 2Q3PA 3KLGB 2B51A 2KT2A 4HI1A 1YTYA 3QLHA 2J6SA 2CQPA 3L09A 3RRKA 2ATLA 1XEZA 2O01C 2R2UA 4HDGA 3KK2A 1RTIA 1Y5IB 1WI6A 2GIRA 3K58A 4GKKF 3ETOA 1FNMA 3UD4P 5KFPA 4LMZA 1YIJS 3J81Y 3M8PB 2HIQA 3IC1A 3KG0A 3ENQA 1H38A 3VWSA 1S9FA 2W9BB 2NSBA 2UXCF 2EK1A 1R8BA 1WG4A 2V8DA 3TRGA 1S99A 3OTBA 4ICLA 4F67A 2FVRA 4Q44A 3RR7A 5F0WA 4F25A 2PE8A 4C0HA 2MYFA 4C11A 1HMVA 3GWCA 3SCKE 2ZDPA 5B0AA 5D3GA 2X1FA 4TXSA 2JVRA 4NLVA 4B9SA 1T02A 2RMLA 3G8QA 4Y2AA 3K8WA 2KKHA 1L3KA 2VA3A 3DU6A 2V0NA 3DRSB 4MH8A 1SJRA 3OQ2A 1RKJA 4QR0A 2H1YA 3KLVA 1IN0A 1U6ZA 2DTJA 1KVIA 4RW7A 1S6QB 2J0WA 3TVZA 4O3RA 1NK8A 1N5QA 3HHLB 4IKAA 1KN6A 4NYPA 2BQRA 2HGNA 5CXTA 2CQBA 2VFSA 2LMIA 1XNQF 2ZHOA 4DQIA 2B4OA 2X1AA 4R25A 2L48A 2N7CA 1RKIA 2HHPA 1HNIA 1T03A 2C3PA 2EG2A 1N5YA 4LSNA 3L3CA 2CVIA 5KFKA 1TV6A 1XNRF 4NCGA 2DGSA 3M2VB 1C0UA 2HFNA 3I0SA 2OSRA 5L39A 4DF4A 1FKAF 3BGUA 2HRYA 1UAWA 3CTRA 3NL0A 2QA4S 1S77D 5F8NA 1FEHA 3OXFA 2HRUA 2YNIB 3ULHA 3JTNA 2D74B 2EFNA 4ZCLA 3JTPA 3NCPA 3BZQA 1UVKA 2ZOGA 2DR5A 2M4MA 5E3AA 2DCUB 2CJAA 4K4SA 2J7UA 2W7OA 4I2QB 3M30A 2U1AA 3H5SA 4I2PA 2I1RA 4PUOA 4FF4A 2CJQA 3SI8A 2JVOA 3EX7B 2A2CA 2FLPA 2CPIA 1SJQA 2E5IA 2F3JA 3N5BA 3OLAA 3VAJA 2DNKA 4B17A 2DH7A 1IBKF 2HLUA 1NH8A 1IXKA 2YWEA 4NLRA 4ZPVR 3KLHA 1HMVB 2MMYA 3DRXA 5D3GB 4H4KA 2DRBA 2CKWA 2OPQA 4P7TA 3FFIA 1PSDA 4HH1A 2QFJA 4NCAA 4L3NA 4CO1A 2ZH4A 3HZEA 4LIRA 2AU0A 4A8YA 2MXYA 3O2IA 3BGRB 2DO0A 1Z2LA 3TI0A 1KD1T 2NPIA 3D0GE 2XBPA 5EDWA 1Z1ZA 2GHVC 4C3KA 2HNZB 4QW9A 1HR0F 3DYAA 5EX3A 3D28A 3PR5B 2HWTA 3TOQA 1HNZF 1FKPA 3I9V9 3HI9A 3OL9A 1FDNA 2Y1JA 3LH2S 1HI1A 4EO8A 4LSNB 3I5CA 1PC4A 3HK2A 1P1TA 2OMOA 2XSFA 3R5DA 2Z8QA 1TV6B 4OI2A 3VQTA 3OFGA 2UVUA 1C0UB 2VKZG 4FBUA 1X7VA 2R7VA 1N56A 1EETA 3PW4A 4Z2XA 4KE5A 2OD6A 3GSDA 4MK9A 2VPXB 4B02A 4C8KA 1IKXB 3N0VA 5HO4A 3UCGA 2ADCA 4JI3F 5IM0A 3E3XA 4OJHA 2Z0GA 5FDLB 1KQGB 3MPWA 1LXJA 5C5JA 4FF3A 2E66A 1QUVA 3MECA 5KFAA 3KK1A 4AXIA 3ZZRA 1WACA 3I0RB 1TVRB 3MEGA 1FTCA 4DN9A 1AXQA 4IO1A 3T5JA 3RAXA 1M5OC 3RW6A 4KC5A 1RYSA 1S49A 1JIHA 2IRXA 3BF4A 1XMOF 3BB5A 3BJYA 5J2PA 2HS4A 4KB7A 3I32A 4KTQA 3NBPA 4UW2A 2GJIA 3MHYA 4QYRA 3H20A 1JLFA 3OTEA 2EPIA 1T7PA 3CULA 3DLEB 3DM2B 2XZWA 4ECUA 4X4NA 1TL1A 2IVYA 4AQYF 2I9SA 1NK7A 2E9TA 1N33F 3V6DB 2DR8A 7FDRA 3QIPB 3T9NA 2V2KA 5KG3A 4ZMMA 4DV4F 1HW8A 2KB2A 4R8UB 3UCUP 2P9EA 1C0TB 1LW2A 1TKXA 4HDHA 4OX6A 3SSRA 3LWMA 3RB0A 1LWFB 2HHUA 2XULA 2DNQA 3DYAB 1HNWF 3C6UA 2YKQA 5F9NA 2IM1A 2N3LA 5M2PA 1SH0A 1MW7A 3OTCA 4F4ZA 4MYTA 2Z2LA 4K5RA 1RA7A 2V8VA 4GO7X 2W24A 1FXRA 2R9LA 1VQNS 2AJQA 5LMNF 3DLBA 2E5JA 1YSJA 3IR6B 2D41A 1XMQF 3VAGA 2DVIA 1HBUB 1EETB 1FCAA 5IWAF 4Y0FA 3G71S 2OLWA 4UY8T 4HT7A 2RE1A 4F2RA 1TAUA 3U02A 2J76E 3PTWA 4K4XA 1JJ2R 2V8GA 5DZ6A 3OLBA 3H4BA 4AL6A 2DGUA 4PPZA 5BYRA 1VI7A 2GQ2A 3NCQA 2V4QA 3M8SA 1S79A 4RUCA 3DN9A 2N3OA 3MECB 5H9FJ 4O3PA 2IVMA 1URRA 3POTA 5HL7Q 3TR5A 1D0EA 2NREA 1FA0A 4DL4A 4YB7A 4C3LA 1UVIA 4K0KF 2W4PA 4FF1A 3DMJB 3QGHA 3PACA 2PD1A 1R8PA 2HG4A 2JC1A 2RQMA 3KNGA 1YRUA 1DBDA 2KRRA 2HWHA 2AW0A 2IC3A 3GFHA 2HS3A 4LVNP 4JI6F 4ECRA 2R8KA 3BM7A 2J7KA 1FRIA 4JI8F 1WTBA 3MM9A 3D5MA 4PG8A 2BOPA 5A8KB 3DXBA 2AJ1A 2LYVA 3G8TA 3GB0A 4ATNA 3KNAA 5F9LA 4TLQA 2G2YA 3FRZA 3HJVA 2PFFB 2HQ3A 1SJ1A 1U8SA 5HI7A 3RBDA 2MZQA 4NXNF 4X4RA 2R2SA 4B9UA 2JFDA 5ADZA 4LF6F 1FK9A 5B09A 2Z2MA 2CQCA 2YNFB 3N6LA 2G1DA 5B7WA 2ZBCA 2MQPA 3H98A 4ZVHA 2YQ3A 2L3MA 2EFOA 4PXDA 2GMLA 3FCHA 3DI6B 3FEZA 1X9SA 4RNMA 4DV2F 4NLYA 3LP1B 4YR2A 1BQMA 3SCIE 2JFKA 2VFUA 1C1CA 4QWBA 3JSBA 3IA0A 4YB6A 3PO5A 1U6FA 3S1TA 4TQSA 3PDNA 2FC9A 2AGPA 2DGWA 2AGOA 4CTAA 3MM7B 1W25A 4QWDA 3JYTB 1OPIA 1S76D 3DFEA 2JWNA 2C2RA 1WEZA 4PQAA 2RKIA 3M4XA 3OVBA 3I31A 3SCLE 4X62F 4IG3A 2EG1A 1R6YA 4ILMA 2U2FA 1MSWD 1MROA 4LF9F 2RF2B 1VQYA 2ZFHA 2D7SA 1TKTA 2XWXA 1YHQS 1NJIT 3KFWX 2PA3A 3WX4A 4C8OA 3TA0A 2M2BA 4C8ZA 4NLOA 3TAQA 5KFMA 1GNKA 1TR0A 2XWYA 3OUYB 1QE1A 5KT4A 3QATA 4FYDA 4X4TA 2BRKA 1SKSA 1DLOA 3T19A 4DSLA 2B6AB 5J1EA 2QMWA 3L7OA 4JI4F 1B7FA 4DLEA 1IR0A 2Q79A 1SL0A 1BWEA 4ZVEA 1LWCA 4HTJA 2RUGA 4NWBA 4EUVA 3S01A 1TL3A 4YDXA 4Q45A 2UU9F 1WEXA 2UVVA 2RQCA 3E01A 2J7WA 3I5AA 2QLWA 5LT5A 3ZZUA 3PR4A 1KONA 2XY5A 2VKRA 5KFJA 1B0TA 2PMZD 5F3ZA 4A8MP 2DB1A 2VV5A 3J80Y 2CQ3A 1VRTA 2CJ9A 1U2RA 2JL9A 3I5BA 4FS2A 2R7TA 3IRXA 2V4JA 4X4QA 4ECTA 2H5EA 3JB9k 3DDNA 3N28A 3KMSA 3PO4A 4USIA 3LUYA 4PXBA 3NNAA 2AP6A 3C66A 1UP1A 4O44A 5H1SV 4ELVA 4B9VA 2NYIA 4DL3A 3P96A 1GX6A 3I82A 3NAHA 3M6XA 2D3ZA 3SZ2A 1T8EA 2WOMA 3T1YF 1E6VB 2WB4A 1HQUB 4EBDA 4IH6A 2BQUA 2XI2A 3NAIA 2B7BB 3GR1A 5CYMA 3AY0A 2QC3A 2K1RA 3N4WA 4AXJA 2DD8S 1WEYA 3G6ES 3PM9A 3EYZA 1FKOA 5KFWA 2AYMA 2R7RA 1GQEA 1KTQA 2PA8D 4IOBA 4IQXA 4QIGA 5I3UA 2YNHA 1M5HA 3IS9B 3OV7A 3V4MA 4DWIA 3NP5A 2A2DA 1N4LA 3CCSS 1I1GA 2ZUGA 1X8DA 3CDEA 3AQPA 1FERA 3BO3A 3PW0A 2HGMA 2UVWA 5KFTA 1LK7A 4ZCIA 3SFUA 1LW0B 2QA2A 4JBCA 1VQLS 2OH2A 2JDJA 4I4BA 4F8RA 5A0YA 2DHAA 3QZ8A 3MEDB 5E3QA 5B0FA 1SL1A 1ZH5A 1SQEA 2MQOA 2N4CA 3R27A 4NA2A 4HVZA 3M8RA 4DJBA 2W7PA 2ZH2A 4R5PB 4J9QA 1TP7A 4M1KA 3UDCA 1JLAA 4CNZA 2BM0A 5EN1A 3GILA 4FBTA 2DPIA 2BW2A 2DITA 4K50A 3CIZA 2E29A 1R8CA 2J9DE 3JAMY 1OIAA 3FZ2A 2E9RX 2FLLA 2GC8A 2JC0A 2CQ1A 3BEGB 3Q2SC 3HT3A 1T05A 2IMWP 5IQQA 2FTRA 5LXYA 5DQIA 5CQGA 3R97A 3K59A 3MEKA 1FE4A 1R3NA 4KRWA 2KG1A 2LXFA 2VBZA 3DNCA 2UP1A 2EWHA 4YEAA 4DF8A 3AHPA 4DR5F 1M90T 1MWYA 3ZZPA 3AB2B 1RT3B 4PXEA 2K1RB 2WONA 1FD8A 3K89A 4I0WA 1H0HB 2N82B 2YVSA 4WXOA 4DSI<