2PFFB

Structural insights of yeast fatty acid synthase
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
2006
structure length
2006
Chain Sequence
MDAYSTRPLTLSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQFKATHILDFGPGGASGLGVLTHRNKDGTGVRVIVAGTLDINPDDDYGFKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGSQEQGMGMDLYKTSKAAQDVWNRADNHFKDTYGFSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDLKSKGLIPADATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRDELGRSNYGMIAINPGRVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAGDLRALDTVTNVLNFIKLQKIDIIELQKSLSLEEVEGHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fatty acid synthase subunit alpha
publication title Structural Insights of Yeast Fatty Acid Synthase
pubmed doi rcsb
molecule tags Transferase
total genus 233
structure length 2006
sequence length 2006
chains with identical sequence E, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01575 MaoC_dehydratas MaoC like domain
B PF08354 DUF1729 Domain of unknown function (DUF1729)
B PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
B PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis
B PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta
B PF17951 FAS_meander Fatty acid synthase meander beta sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2420 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB01
3.30.70.2430 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB05
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 2pffB03
2G2YA 1MLAA 2QC3A 3IM8A 2H1YA 5CZCA 2PFFB 4RL1A 3K89A 2JFKA 5CZDA 3H0PA 3PTWA 2VZ8A 2CUYA 2G2OA 2VKZG 5DZ7A 2HG4A 2QO3A 3HJVA 3TQEA 4QBUA 3HMJG 3R97A 3EZOA 3HHDA 2UV8G 3SBMA 2QJ3A 3RGIA 2JFDA 3G87A 4RR5A 1NM2A 2G2ZA 3QATA 3IM9A 5DZ6A 2G1HA 2C2NA 2VZ9A
chains in the Genus database with same CATH superfamily
2VG7A 2BOPA 2V2ZA 4PABA 3SCJE 3BKFA 2BE7D 2AF6A 2MMYA 2DRAA 3W2WA 3KDOA 4N41A 4LSLB 1FK9A 3FZBA 3PZPA 1HIYA 3LGHA 1WKKA 2MQPA 5I42A 3EDQB 4DL3A 3THPA 3BBBA 1HQUA 2IA0A 2K7KA 2QMXA 3UI3A 1A0OB 1HBNB 2VPXB 1HI8A 5AJ3F 5KFWA 4LFBF 4ELVA 2DGXA 5IT9U 1WUUA 3G8SA 3PRDA 2AD9A 4PKDB 3CC2S 4WYWA 3GZ7A 4A48A 4F3OA 3AB4B 3D1HA 2BR0A 1FDNA 3GSDA 3TZXA 1WACA 3SQGB 1UL3A 4ZN3A 4QYZJ 1ZS6A 4K8RA 1N36F 2P9CA 4OX6A 5MLCV 4Q5VA 1Y5LB 2BKOA 1Y3KA 3KMQA 4ETXA 4FS1A 1S12A 2D1CA 2HLTA 2OPSA 3IS9B 4PG7A 3NGRA 3T41A 2QSFA 3KJNB 2NR0A 3M05A 4ZVTB 1QVGR 4YB6A 5BR8J 4FF2A 2MKHA 2N3LA 1U02A 4URGA 4ZVUB 1NXIA 4G1QB 2MZTA 3D0IE 2IDEA 5E3AA 2ZD1A 3NRBA 2PC6A 4PEOA 4WE1A 3FKBA 1TQLA 3LAMA 3BPDA 5K9FA 1WC5A 5CQGA 1S6PB 1N5SA 3DRSA 4C8MA 2VONA 3PIOQ 2YPZA 1RUSA 1NSPA 3UVJA 3JAMU 3M6WA 3KLGA 3I87A 3AJ1A 1RU2A 3CDEA 2G1DA 2AJ4A 1S6QA 1T03B 3ZZTA 2LP4A 1SXLA 2D9PA 4OI1A 2F4VJ 4ECXA 1IR0A 2R7TA 5LJ5Y 3MOZA 4G65A 4I6YA 4LF1A 4ELTA 4K4SA 4RW7B 1F2GA 1BMQB 1N52B 3LTOA 3LQVA 2OFHX 2RHQB 1V9OA 1T8EA 1XEZA 2QL7B 5MAOA 4QWEA 1H38A 4PPDA 4B9UA 4QIGA 2QTWA 1KRPA 2AZ3A 1NSAA 2PN6A 1T0TV 1UW4A 2HYIB 2ZZMA 2MLZA 2NSBA 4WK1A 2V4JB 3X3UA 2E1PA 3BN4A 3H5SA 3RBDA 2EWHA 3MMCA 4QWBA 4OV1A 3UO0A 2FIUA 1Q4RA 3M2RA 1DHMA 2H5JB 1SPBP 1TKTB 3SCIE 5IT4A 3SEOA 4NMLA 5F8NA 3SCKE 3O5TB 4JI1J 3G6VA 2KDOA 2C22A 2XS2A 1SC3B 4JI3F 5ETRA 2J9DA 2GS8A 4FBTA 2OPQA 2J0QD 2DR5A 4C2MA 1RJJA 3NCQA 1MMDA 2J8SA 1MNEA 4CNZA 3E01B 1DURA 2F1FA 3DOMA 3Q2TC 1SKUB 3M4XA 4W4MA 2CWXA 1U0HA 4HTJA 4CH7A 5DETA 2Z56B 1YSJA 1R27B 3SMZA 4OHYA 1OY6A 3CGIA 2KG1A 1EP4B 4NLYA 2EI5A 4B3MJ 2MKYA 2RHSB 3H5UA 4N77A 2YKPA 3GV7B 2DCLA 4WFAQ 3QSYB 1FO1A 1ZAXA 1Q8BA 1B3TA 2HZAA 4A46A 4OI4A 2FY1A 2F7VA 4Q0BB 4Y34A 4YB7A 4IH6A 2IA6A 3T5HA 3IAS9 1XTZA 1PILA 1SBRA 2WONA 1RT6A 5ETVA 1LWCB 3S8SA 1BQNA 3MPWA 4HTIA 4OLOA 2ZEJA 2MGZA 4K4TA 2I6WA 4TQRA 2QL9B 2XGQA 3C16B 4JI2F 2D41A 3L09A 4RW9A 4P9SA 1CBKA 4MKAA 3FK4A 2DRBA 2GHPA 1TK0A 6FD1A 2R2RA 1FRLA 2HK2A 1NMEB 4X4VA 1AROP 5KFRA 4OZ3A 1S1UA 3K8WA 2HVEA 5KT2A 1MWZA 2GHWA 2FDNA 2DHHA 2R42A 4UOCA 2QZ8A 2QN6B 1YLXA 2IM2A 3ZC4A 4QIFA 4DV4F 2BJDA 2G2ZA 2OTJS 4P74A 2V8HA 4P73A 2NYIA 1RWKB 4B3SJ 4DF8A 3GILA 5F41A 3EZ5A 3NAHA 4DFPA 3T1HF 4NLVA 4ED2A 3OFFA 1DTQA 2EK6A 3F44A 2LKZA 2LMIA 4OHZA 2RVJA 3ILLA 4O3SA 4PUOB 1MSWD 3R7NB 3H20A 2KTQA 3RBXA 4C4WA 1X8DA 3TAMA 1SJ1A 4C97A 3LP2A 4LF8F 2PO4A 2JH3A 1S1WA 4F26A 5D78A 1RCXB 2QE5A 1T9VA 4P72A 3GFZA 1VK8A 2B6AA 4X4SA 1JK9B 3BN7A 4F50A 4LF4J 3MECB 2MZRA 1R7IA 2WSFC 5BR8F 2GJ2A 2KJVA 1VRQC 1WI8A 3I9ZA 3W60A 1HNIB 3OLBA 3BGUA 2GCFA 3LP0A 3KKFA 2EW9A 3AOBA 4DSKA 4L3KA 3TARA 2V68A 1XQIA 2B3TB 4NZ7A 1VDHA 1NO8A 1FNMA 3KLVA 3P4UB 2C2EA 2EBGA 2HIQA 1KN6A 1CULB 2BUNA 2GO9A 2FC9A 3ZTRA 4B17A 1RTZA 3GB0A 5H1SV 3TJ8A 3ZZYA 3C15B 3MM5A 4K4WA 4LSNA 2R2TA 3AB2B 1QM9A 4IYQA 3VGUA 2RF2A 3HFKA 3SQGA 4LR9A 3R5AA 1GH8A 2F9JA 2F4VF 1E6VA 3T19A 2EFPA 2EG2A 3KJVA 4P75A 3KK2A 4FVMA 1IBMF 2WZ1A 2HNDB 2YKOA 3C8YA 1JJ4A 4ATNA 3T1AA 3TI0A 3M7VA 4NXMJ 3RAMA 2DO0A 2KHCA 1IKYA 1TUGB 3UCZP 3MMBB 2RS8A 4LF5J 1S7IA 4WKYA 2JFDA 4QYZK 2K1RA 2YXLA 3K58A 1N88A 5HROA 1WTBA 4RUHA 3M8PA 3POTA 3Q2SC 2CJAA 2FJDB 4ZPVR 4I2QA 1IM6A 3R6GB 4A8WA 3HLUA 3AQPA 4WIIA 3GFHA 2G4BA 3GONA 3UCUP 3DLJA 4TYBA 1KP6A 3PCOB 2MEWA 3FDSA 1BWEA 2NREA 2H48B 1JNRB 4J37A 2XMVA 1SQEA 3C46A 3P8BB 1HQEA 4HHJA 2GQ2A 3UN2A 5HVGA 4JI1F 2KB2A 3CO9A 1TTHB 3FCWA 2J6SA 2HHUA 3CB4A 4F4WA 3TA0A 1SV5A 5C25A 3KYLA 2MHEA 4U9RA 3N0VA 4KH0B 4C11B 3NGUA 5HP1A 2BE2A 1ZYQA 2RRBA 4DCOB 1RT4A 5J2NA 4A8YA 4RX6A 1TU0B 3ZTSA 1Z2ZA 5K8NA 3PO4A 3MUVP 1AA1B 1N34J 3P96A 1HYSA 4DFKA 1RT7B 1ZZNA 5E3QA 3B4MA 2UVRA 4DV0J 3V81A 2JDJA 3HO1A 3M30A 2CRLA 4KYZA 4TLQA 2ZZNA 3JQMA 4YR0A 2ZHOA 2G0IA 3AJDA 3HCXA 1QSSA 4J7CA 3HHNB 2PEHA 3UNGC 3QFWA 3UR3C 4OZNA 1YI2S 3A3NB 3OTCA 2QFIA 4ZPTR 5JVGQ 1VBZA 1V3ZA 4KY3A 4FBUA 3W64A 3QRPA 4QPTA 1JLGB 2AJ1A 4OZ1A 2W7PA 2Q43A 3GIRA 3GWCA 1FTRA 2W8LA 4DV1J 1NKCA 5KG4A 5CZDA 3D3BJ 1MN9A 1X4CA 2XG8A 1KSPA 2VJUA 1L3SA 1N32J 1EIYB 4UW2A 3P5TL 4UOGA 2WTFA 1FRXA 4Q44A 4QCLA 1OQ3A 1U24A 3M8YA 3IRXA 2YNFA 4QIVA 4H54A 2P9GA 1NJIT 1NK0A 3N5FA 4NI2B 1WHVA 3AH6A 1XBWA 4USIA 4F3MA 1HLWA 3ZO7A 4FS2A 3VAGA 3FNNA 2AU0A 4M1KA 4L3NA 3F56A 1I6JA 1U1OA 5A8WB 2I0XA 1WSVA 4P52A 1CJTB 1KKHA 3JQKA 2RKIB 1RTIB 1K47A 4DX7A 4PXBA 3D5MA 4K4YA 2YWHA 2XSFA 1WF1A 2RD5C 3DC2A 2G2YA 4WYLA 2R7XA 2XEXA 5IM0A 4IOBA 4M5DA 1GNKA 4NA1A 3FSIA 3QJLA 4B3SF 1TP7A 5F8HA 1E6YB 4ELUA 3PXGa 2CJXB 3DRRB 3QT8A 3KK3A 2R2UA 4X2BA 3HD1A 2V6AA 2BJ1A 3L95X 4IG0B 4HACB 2HG4A 1K9MT 1YJRA 4QQBA 1CPZA 1IBLJ 3IRWP 4NCGB 2E44A 2XSJB 2DYAA 4OI0A 2ZC4A 2NS1B 4DG1A 3R2CJ 2B5JA 1OWXA 3PNIA 4KFBA 2XBPA 4DV3J 1U1LA 4LJMA 2DGSA 9RUBA 2FHJA 2Q79A 4EGLA 2XLKA 2BRKA 1RHJB 3ISZA 1CJVB 3MPVA 3ONQA 5EX3A 5GMDA 4O3OA 1UFKA 2YWFA 4LF4F 5L1IA 4NEZA 3S7RA 4O0IA 3QLHA 2HPUA 3BH7B 3QZ8A 4DFJA 3HULA 4TVAB 5ADZA 3EX7B 2PT0A 1T05B 2WK4A 2XCPA 2VIHA 3GV5B 2CPZA 3DGPB 3RJMB 3DRPB 4TY9A 2MJUA 3T5LA 2ZWPA 3TANA 4ES2A 3C19A 2ZOMA 1UWBB 1O5JA 3GCWP 3NBPB 5KFPA 3FBCA 3KXDA 3OXFA 2QLXA 2ZBRA 1D09B 5DM7Q 1VHIA 4DV7J 2CPXA 1HW8A 4DV5F 3A4TA 2MQLA 3HHKA 4URSA 4WFYA 4TN2A 3HT3A 1RAHB 2MZQA 1LV5A 3HVTB 4WIQA 4P2XA 2VOPA 1H2VZ 2DGVA 4DN9A 3WZ0A 4EEYA 1KBRA 4NX9A 2VU5A 1FJGJ 4MKBA 3D3CJ 2ACYA 5HQMA 3TEGA 2J7WA 4NLTA 1DLOA 2BV3A 1VQKS 4QU7A 4LF5F 3NY0A 1B7FA 1YDLA 4V19X 1U1QA 2BRLA 3HHLD 1A6LA 2CA9A 2IVYA 3T9NA 2XYPB 3V4IA 1SI9A 4DQIA 3SSSA 1ZPWX 4OHXA 1KLMA 4KH1B 4BDPA 2VC0A 1I51B 9ATCB 2N7CA 3DN9A 2J9DE 2RJZA 1S9GA 4ILRA 5KFTA 5C42B 4R5PA 1EETA 3EWGA 3UWTA 2YX4A 3WC2A 8RUCA 1BLUA 3DMJA 2GVZB 4MFBA 1NHVA 4DHVA 1CC7A 4ZJQA 2RDDA 3M32A 3PRVA 2P2CB 2ZBIA 5DGBA 2LCWA 3O1LA 1UWAA 3PJXA 3GIJA 5LOQA 5KFQA 4X4RA 1NEEA 2DBBA 1HMVA 3I0SA 3ZZ0A 2CVEA 1M5SA 4IG3B 3JB9k 1KVIA 4FVCA 2VQEJ 1NHUA 4G1PA 4Q2MA 2FGCA 1XMOJ 3A3OB 1O51A 4C8LA 2EKYA 4RL1A 2RDIA 2CNLB 4UQGA 7FD1A 4DV0F 5E7OB 3SYZA 4USTA 3Q8RB 2HQ3A 3Q86A 3CE8A 1J5EJ 1U8SA 4ZP6A 3P6YC 3TVZA 1WDDA 2EK1A 1JB0C 4NLQA 2JSXA 4Z37A 3MCOA 2YKNA 2ZH3A 4OYAA 1WHYA 2RQKA 4OYIA 2A10A 2XI2A 2FZGB 1CS4A 3RAQA 3JQJA 2M52A 1LEOA 2BJ3A 2WHOA 4Y2IA 3M2UA 3MR3A 2V0NA 4K2JA 3CDWA 3MEKA 3J80U 3M9OB 3FQKA 2R8JA 1N32F 2WBRA 3CCJS 2BEFA 2I8EA 2GIFA 3JSMA 3VHQA 1NRKA 4FF1A 3J81Y 2AIRB 3IBWA 3NP5A 2YWKA 2OMLA 3PYFA 1XR5A 2VL1A 1HW9A 1BQMB 4ITSA 4E98A 1B0VA 5CYQA 1OJ4A 2AWZA 1NZAA 2HS4A 4X4TA 3D54A 5LMNF 3TAPA 3W5ZA 2FLNA 4CO2A 3SIPB 1R8AA 3R27A 4CLYA 2HFNA 4HH1A 3NCRA 4OHVA 3M8RA 4ANCA 2BANB 4JI5F 5KG1A 5L1LA 2PI5A 3OJUA 1SKWA 2NLWA 1LWXA 5DLFA 5HANA 3OR2B 5G0RB 4I69A 1PAUB 5BYQA 3VZIA 1LWEA 2FLOA 4FPIA 4YY3F 2GJFA 5LSOA 2CQCA 1ACMB 7FDRA 3HXMA 4WK3A 4JB8B 4WBFA 2BVZA 2HURA 3C2PA 3BSAA 4XO0A 3J7ZT 3H98A 3KHGA 1UMJA 4CO4A 2LEAA 4UOFA 1G3OA 1JKHB 1HI1A 2IVMA 2E7VA 2J9CA 2QRRA 3KLEB 3G71S 4M5GA 2DNRA 4F36A 1IBLF 5CCMA 4TU7A 3RRHA 2DO4A 1I94J 2V94A 4CWBA 2QYGA 5IT9Y 3HK2A 2C2OB 1EX8A 1FXRA 4PWWA 4NI2A 4OZLA 4Y28C 1X9WA 3CNQP 1FRMA 2KJWA 3BYRA 4LMZA 3HI9A 2I38A 3AXKA 5HBMB 1T9UA 2HQIA 4RPFA 3AXMA 5LJ3Y 2QSWA 2XQCA 4HHHA 1RWNB 4UZCA 1D9FA 2OHDA 4L72B 3MGJA 2YNHA 3LA0A 2XY7A 1TMMA 2IY5B 1JNZB 4N8OA 5KT5A 1O6XA 3DLKB 1RTIA 3CJ0A 2A18A 2OSRA 4KHPJ 3CJ3A 3OFGA 2KM8C 1QVFR 4A47A 3CJRA 2PFFB 4LF9J 2NCKL 3FEYB 4U8YA 2CYYA 4OYMA 2V8VA 3WDOA 1FWKA 3N6LA 5F3ZA 2IBOA 2D3O1 5HATA 1CC8A 3NNHA 5KFDA 3SQOP 4IOAQ 1QE1B 3GJSB 2CZ4A 4RW6A 1Y3JA 2RH3A 4U95A 3LH2S 1LOUA 2LQBA 4C3LA 4X4UA 1J27A 3LO3A 5KFBA 3S6EA 2LU1A 5J2QA 3T3FA 3W66A 3PHEA 3CF5Q 1K1SA 3T9ZA 3TZYA 1D0EA 3VVUA 2DNPA 5GVQA 3QRRA 2KT3A 4NCGA 5K8PA 2XSJA 1DJ0A 3BBFA 3KLHA 5T7LA 2JC0A 3QGHA 1DY3A 1NK6A 5HMZA 2QV6A 1OYDA 2M8HA 4ZVGA 3MMAA 3JAMY 4ALZA 3VGVA 2F3JA 1FJGF 4X4PA 4C48A 1BXNA 1P27B 2HNZB 4KR0B 1FFSB 1NBEB 2XGPA 3OUYA 4FF4A 2W9AA 1GT8A 1N33J 3NLCA 3PO5A 1OSDA 3B8HA 5D4OA 1W26A 3BGOP 5AT1B 1RTJB 2D69A 3MM7B 2NYHA 2Z30B 2R7VA 2Y8WA 5FIIA 5C2GA 1VJWA 4Q8EA 3I0RB 1I5OB 3BR8A 1R0AA 1EQMA 4NYZA 2KG0A 4GC6A 4FXDA 4HI1A 1KHWA 1FCAA 1T11A 3CO0P 1YRXA 3DOLA 2JVOA 1ZOTA 4UY85 3HM9A 1CQMA 2OD6A 3R2DJ 4K59A 4Y00A 3MCNA 3JYTA 1H3DA 2HMIB 5CXTA 4DXLA 3ZZPA 1BD6A 1WSRA 4EFAC 2XMUA 2FQQB 4YEAA 2VH7A 4JV0A 1S1VA 1SJQA 2QG9B 2M3DA 1TUWA 1XK8A 4DPWA 1GMWD 2ZDOA 4J9OA 5DZ7A 1AZSA 1BUXA 1RAJA 1Y7PA 2HWHA 2VQEF 4X65J 1XMOF 2KYXA 5A6WA 2V9KA 2RILA 4OLPA 1HNZJ 4TYAA 1HNXJ 2DRDA 3OQ2A 4WP8A 1S9EB 4V19J 2J7KA 2UUWA 3BQ0A 2AYMA 2ALZA 2MQQA 1X5TA 1ZH5A 3DGVA 3RZAA 1J5EF 1DTTA 4CO0A 4I6AA 3I56S 2WW4A 5DS7A 2WOMB 5KFFA 4FPRA 4E0DA 1SCJB 3K2YA 2M8DB 5IOLA 1YQHA 1GX6A 2AMCB 2W2QP 1FRJA 3RB3A 1MN7A 3IM8A 2ZH6A 4JI6J 4HDGA 4ANDA 1NJWA 2IDLA 3EM1A 1FX2A 2KVQE 4C8YA 2F4FA 4DV6J 1HD1A 4WTYA 1MG7A 4QIEA 1B70B 3SV4A 2OH2A 5IC6B 5BJRA 4KHRA 2UV8A 2DNKA 1HPZA 1FE4A 2ZH1A 4KKOA 3GFXA 2JEJA 1RTDB 1MU2A 1EB0A 1NPRA 4MYUA 5L38A 1U49A 2XMMA 3PKMA 3PV8A 4DL5A 1RWUA 1NHKL 5K5MA 2VFTA 2CJ9A 4B9SA 4LUBA 2FZCB 5IXUA 4B9LA 2CQBA 2AYEA 4GO7X 1RT2B 1QAXA 4F2RA 1B99A 3RB4A 3MCMA 2QLBB 4V1Ak 4Q7AA 2ALYB 5L8RC 3LP1B 1Q0NA 1S1TB 4GMKA 3A8JA 4WU3A 1X9MA 3QT5A 1YTYA 1WDTA 5CZCA 4ZVOB 4B3RF 4DX6A 3UPFA 2FHMA 3VAMA 4ZK7M 1JJCB 2QO3A 3BDEA 3NEKA 3ZZZA 2HHHJ 4JI7F 4ECVA 2Y1RI 3KOAA 2B9YA 3ETOA 3AODA 2WSEC 5DGAA 1I94F 2H1YA 2KZZA 3DLHA 3GV8B 2VA2A 3NS7B 2EPIA 2OO4A 1SQGA 4F04B 3OTDA 3B78A 2CNNB 3DI6B 5THWA 1NKEA 4R25A 1ZM9A 2E5LJ 4ZVQB 3W8PA 3VCDA 2DPJA 5C24B 3DKDA 1MMNA 1VC5A 4U8VA 4RW4A 1RK8A 1KTQA 4LR8A 1S49A 3G87A 4M95A 2LQ5A 2D3UA 3D6MB 4F4KA 3T5KA 4KHPF 1Q81T 3MF5A 2M4MA 4LF9F 3UE2A 1VI7A 2P5VA 4ZLJA 2ZH5A 4OZ0A 2AW0A 4FNIA 3TVKA 1KQSR 1U8WA 2B56A 1UEKA 3DOKB 2CJYB 1FF2A 4B02A 3R7BB 4R0JA 3M9MB 4DEZA 1IBKF 1D9DA 1F3FA 4L74A 4MMOA 5H9EJ 3KG4A 5F8IA 2DHSA 3D9BA 3BV8A 1R0BG 3EICA 5BYSA 3QO9A 1HARA 4X4NA 2UXCJ 3BSOA 3TNVA 1IM4A 2OPPA 1IR1A 3ITHB 3A8EA 2JOQA 2XMTA 4ANEA 1YJWS 1MWYA 4ED3A 1N33F 3FQLA 2UUAJ 5KOXA 1FT8A 1KVJA 1ZM4A 4DZDA 2VBWA 2W7AA 3DLEA 4IOCQ 2ROGA 2IBKA 4KTQA 2EKNA 2GQQA 5J1EA 2VA3A 2KFNA 1TMJA 1XR7A 1C0UB 1B64A 4PCQA 2NPFA 2M88A 4DQQA 1U2FA 1NUEA 2AEMA 3C14B 4OYZA 4ZP8A 4J9SA 5KFNA 1RQ0A 1RYSA 1TFWA 4USMA 3DXBA 4EO6A 2HRYA 2DR7A 1N6QA 3FC9A 5DG7A 4PG4A 2UXDF 3PEHA 3ADAC 4K7QA 1H72C 1PC5A 1K1QA 1S99A 2BJ8A 1SJ4P 2CJKA 1ULRA 3D0HE 4CDIA 2KL8A 1S59A 2BKPA 1P1LA 2GAGC 1RAEB 1S72S 3W2VB 1TVRA 1VQNS 1OIAA 1WEZA 4AMPA 5M2PA 1U48A 3DLGA 1NCLA 4EZ9A 3HVWA 4USWA 4QR0A 4X65F 5KFAA 5LMUJ 3I31A 2F8EX 3KDNA 1HNZF 1HNXF 2RUGA 1SB6A 2ROEA 3ZZOA 5JVHQ 3CD0A 1S1XA 4PYAA 5ETMA 1WC3A 4BC9A 1M1HA 2CXEA 3J7AN 2XYGB 3E51A 4DCPB 3MEDB 4K5RA 3TP2A 5C7PA 4KPYA 1LK7A 3H4BA 4ECZA 2K3IA 4UUXA 1CJUA 4TY8A 2E5JA 4WZQA 2XHWA 4QJVA 4WPAA 1DQ8A 2CPDA 4N56A 4JI6F 5HQ8A 3PYEA 1RTHA 2R7SA 1APSA 5EWGA 2NQPA 2ERRA 5LM7E 1TKXB 3DYAA 3NOGA 3ENQA 1F9HA 3N79A 5CA5A 2Q66A 2UUTA 4PG5A 2UP1A 1SJFA 2Q6BA 5D0GA 4I2PA 2Q3PA 2C2ZB 3R5GA 3W65A 3CJ5A 1RT1A 1HWUA 1SUQA 2KHDA 1ZPVA 1RXOB 6FDRA 3PKYA 2XMAA 2IAJB 2DNNA 2VG7B 4OJ1A 2JHEA 1S9EA 2O67A 4ED0A 1JLFA 2LU2A 2IM0A 3J81j 3PEJA 1VLYA 1FK9B 1VBKA 3QGGA 2BJ7A 2WOMA 5I42B 4F4YA 3GP9A 1M1GA 3CCMS 3TO8A 2QEXS 2MJNA 3G82A 3LPEA 4N47A 3QAEA 4CH1A 2MXYA 1VK3A 4B3TJ 2HHHF 2DGOA 3I96A 5CD4H 5J1NA 4NLWA 3GIKA 3N5BA 5F8JA 3M6UA 2HFVA 1UEUA 2A2CA 3C6UA 4IFYA 5DQGA 3CIMA 2DHAA 2GVDA 3NKYA 2O66A 5M2UA 2HS3A 3OVAA 4C0OC 2HVIA 2E5LF 4NLPA 4FZVA 2HHXA 2OPSB 5HMWA 1X5PA 1S9FA 3EVMA 3OL9A 3R97A 1LXJA 4RBTA 1V6HA 2FD2A 1FVQA 4AD6A 3WIUA 5DDRC 1C1CA 2V9WA 2P6TA 5HVFA 4WTOB 3MM9A 2I5JA 1XN9A 2U1AA 3U1MA 1VQYA 2AGPA 3GU0A 4LFAJ 3EYZA 3KUEA 3DLBA 2ZD1B 2HHPA 1T7PA 4NOHA 1LKZA 1VQ9S 4WE1B 1S7HA 1FKAF 2AX1A 2Y8YA 2EEYA 2GV1A 1VQOS 4PG8A 3PFOA 1SL1A 5AJ3J 3D28A 3PG9A 5AXKA 2E5HA 4WFXA 4NASA 3HSGA 3W9IA 3KLGB 1S6QB 2W25A 4MKYA 2H5IB 3G96A 2UXCF 5EN1A 5D8HB 2HEKA 1WF2A 4YOEA 4N76A 1H6KX 2RNEA 4RNOA 3BGLA 1ZAVA 3BZQA 4QOTA 3UDCA 3TYTA 2RMLA 4CM2A 4ZPDA 1HI0P 4QZVB 1TZ0A 4YR3A 3AFGA 1IKVA 2UUAF 2BXJA 1NNDA 4FYXB 3HHLC 3QMQA 3MFIA 4PZVA 1U1MA 2HHQA 3IGVA 2HWIA 2DNGA 4TU8A 3RW6A 2WRMA 1H7WA 4PWDA 3ZXWA 1PJ7A 3MMCB 4JV5J 1WC4A 4S0MA 1PSDA 3QSIA 1WC6A 1ICEB 3M2RB 2YPYA 1VYAA 2W7OA 2H5EA 4DV2J 2PIIA 1RAFB 1YKWA 4F4AA 4WU2A 3RB0A 1N48A 3ISND 5GAGI 1VMBA 4DSFA 4ECSA 3KWMA 2C2MB 3G6ES 5HJYA 2W2MP 3CC4S 2XTJP 4I7FA 3PDNA 2NZ4A 4Y2KA 5HVHA 2PA3A 1YJ9S 2OPQB 2QL5B 5HAOA 1FEEA 3CPWR 2ZOGA 5EWFA 1XMQF 5D0RA 2ZH9A 1H2UX 3TZZA 3QJJA 2UU9J 2F9DA 5H9EK 1XNRJ 3R6LB 3DOMB 1U1KA 2BQRA 5LMUF 4QIWD 4LQ3A 4FN5A 1Q5VA 5KAKA 1U0HB 5A8RA 4O4GA 2XULA 4DI6A 4ECYA 2E9TA 5SZTA 4DS5A 2DNYA 3OW2R 2FHKA 2R3VA 3FRZA 1MROA 1S0NA 2QIFA 4KO0A 1N5TA 2P6SA 4ZHRB 3C14A 4XTTA 4RNMA 2DR8A 1B0PA 1UVJA 3RTVA 2MSSA 2J76E 2CQDA 3FRYA 3IR6B 1HNVA 3S1TA 4FXVA 3L9ZA 5B0FA 1NK5A 2WONB 1NKBA 2ZH8A 1RT6B 1BQNB 1R6VA 3AJ2A 1ZTWA 2MGZB 2EBEA 3OFEA 2DITA 4LVNP 1D9AA 3HVAA 4ZPCA 1Z1ZA 4ECTA 4HH0A 4RW9B 2GMJA 3TVYA 2W2PP 1RAGB 4AMOA 3ILJA 4DUTA 1RDRA 5JXSA 2MHNA 4DSEA 3EGZA 4N7TA 4NA3A 4AUKA 2MZ1A 1S1UB 4CLSA 4LRFA 1X31C 2R7WA 2AJ0A 1OPIA 3QPIA 1NLKL 2GMHA 1M1KT 4WFZA 4F25A 3R5BA 2PE8A 4X4QA 1TL3A 2F8HA 2MQNA 4I68A 3MEDA 3ZFVA 2WVBA 1FKOA 3RBEA 1X4HA 2IHR1 5KFIA 2WVCA 1OS5A 2RQ4A 2ILZA 4ECQA 4LRAA 1CG2A 4OL8A 2HQGA 1DTQB 4NWBA 2Z8QA 1YITS 4CO5A 2M9KA 1SJRA 1VJQA 4B3TF 4B3OA 4ZMMA 1RT3A 5DQIA 4CQ1A 5HK4A 3R7SB 1TKXA 1TK5A 1OY8A 5D4PA 1PAEX 5IQ6A 1KOHA 3TAMB 2MYFA 2DXFA 5ETOA 4J9MA 2J5AA 1YJVA 3WHIA 2YQ1A 1S1WB 4K50A 4IO9Q 2PD1A 2B6AB 4WFBQ 4LBIA 1CQNA 2GA7A 1ZAWA 3MCSA 1F5AA 3TQEA 3PM9A 2H4YB 4USHA 1YRTA 1S77D 3CT9A 3EDRB 1MW7A 2R4FA 4A8XA 3LP0B 4EK2A 1YHQS 3O8WA 1YZ7A 4DV4J 2IJRA 3CCLS 2RSQA 4XPCA 3DHWC 3NGTA 4LFAF 2CPIA 3UN5A 2GW8A 4DPUA 3CC7S 1LFWA 3PTWA 4Y2AA 3MM8A 3AHPA 3T1HJ 2E9ZA 1XWLA 5HQLA 3LWMA 2HFUA 1X5OA 3J7A1 3MM5B 4ICLA 4PXEA 4LSNB 1LQ9A 2J6UA 1S76D 4O44A 4Z7YA 2WB1D 1T95A 2G2OA 2RF2B 3ICLA 1S5ZA 3ZTPA 3HHLA 3MM6A 1A9NB 2JNJA 1E6VB 3KJVB 3KK2B 2QT7A 5H9FJ 2BM1A 5B0BA 5FJ4A 3VAHA 4LF8J 4H4MA 3SFUA 2BX6A 3VAFA 5FLXY 1KLNA 4OX7A 4NRTA 1FHTA 1IKYB 2BOAA 1NJYA 3PW2A 3GIIA 4IFVA 3RUBL 2CPFA 4TLRA 4DQPA 1RADB 2HGLA 1IBCB 2K1RB 3VWSA 5HJXA 3KK1A 5HROB 5ETNA 4DWIA 1X60A 4OX8A 3JSRA 1RWOB 3M8PB 5HLFA 3POTB 2F8MA 4ED5A 4I2QB 2QFJA 2YH0A 1X7VA 2OTLS 4JV5F 2F63A 4PPZA 5KFMA 1KC8T 4X62J 2DGQA 2Z4PA 4EMDA 4DV2F 3CDBA 4WJBA 2VC1A 4OYBA 2QC3A 1HQEB 3FCVA 2E1MC 4A8FA 4USUA 4LVOP 4DR4J 3BBCA 1T9TA 4ED8A 1SV5B 4RBUA 2MY7A 3CEDA 5C25B 1IBMJ 3QGPA 5HP1B 1N4LA 2JRSA 2BE2B 4LSZB 3EPIA 5I4MA 1RT4B 5J2NB 4CTAA 3MR5A 2Y0SD 1DZ5A 2UU9F 1XNRF 2KU7A 3F0NA 1KTVA 1HYSB 4X84A 5ETPA 2VV5A 1F9FA 3OD2A 1HWJA 3V81B 3TRGA 2ZITA 3M30B 2LQ8A 4ZVRB 2KXFA 4FXWA 4GVBA 1SQFA 1KDNA 3K8VA 3Q22A 2L48A 1UFWA 2CZVC 3DRYA 2N82B 2VG6A 3I4HX 2EFQA 1C4AA 4ZVHA 2G1HA 3GTYX 2CAJA 3PRBA 5A8KA 3DDIA 5K8MA 1ZM2A 4EUVA 2EFGA 2R7RA 3R1HA 2OI2A 1S97A 2PMZD 3KG0A 2LYVA 3CW2C 1V5VA 3CULA 2HQFA 8AT1B 2NXNA 4DOZA 3TA1A 2IRXA 1BHNA 5CABA 1EZZB 3QWUA 4TU9A 4KV8B 5A6PA 4OYOA 2HFSA 1U45A 4XPEA 1F9EB 3IRXB 2YNFB 2N7YA 3W3SA 4CCHA 4C9DA 1NM2A 2IPOB 2NXCA 3W7BA 3MMJA 2MTLA 2OEKA 2KVIA 2DNHA 3A12A 2ADBA 1ZA1B 3EJMA 3MOJB 2AYBA 4JI0J 2UV8G 1RISA 1U6FA 2FTRA 1RYRA 4I56A 1FERA 4KSEB 2JVRA 3PYGA 2UVUA 4DR3F 5L9XA 1RT5A 3JSYA 1JLBA 2C3YA 4ZIWA 2MZJA 1NJZA 5IM0B 4M5DB 4F3QA 4HT5A 4JBCA 1TL1A 4ZHRA 1KQFB 2HRTA 2HK3A 3IWNC 1XC9A 4OJGA 4P7VA 3FBFA 4HDHA 3V6KA 3KK3B 1F0XA 4YFUA 3C6TB 3HMJG 3LWLA 3HHDA 5IC4B 1ZM3A 2F40A 3A3PB 5EHHA 4AXJA 3TQ1A 1REGX 5GADI 2V63A 4IQMA 1XNQJ 1P1TA 1IKXA 3EGVA 1JLQA 2LA6A 3IR7B 1KVKA 5GADU 1IUJA 2B43A 2AJQA 3HZEA 5GAHI 3SDEA 4DG1B 2DJWA 2B5JB 3EVWA 2J0XA 2KFZA 4RBVA 4KFBB 1FNOA 3H40A 2YKAA 1WHXA 1T02A 1YZ6A 3LALA 2K06A 2Z58B 1FRHA 3NG8A 5LL6d 3T5JA 4Y0FA 1AB8A 2VFUA 2A0FB 1FWPA 5A0YA 1JLEA 1RCOB 4H4KC 1EAYC 3QLHB 2I9SA 4Q43A 1DFDA 2DXDA 1U1RA 3N01A 2VDHA 3PJ9A 1ZA2B 3QZ7A 4OI2A 1D8YA 1LW0B 1VRUA 3OL6A 4CI0B 1WG4A 4PQUA 2MQ8A 3G8TA 2GFFA 5AXLA 2KXNB 4EBEA 3F41A 1L3VA 5LT5A 4WFNQ 2VZ9A 3CCVS 4RWWA 1B0TA 3V2UC 2VICA 2ASLA 4NCBA 1TKZA 4L75A 1YX2A 2IRUA 1H73A 1H74A 4PR6A 3NWRA 2EXUA 2AEFA 1F2HA 2XWYA 3CCZA 2RRAA 2LFVA 2HZVA 1GQEA 2DPIA 3U27A 2GGPA 4OYWA 1VQMS 2KYZA 3NOCA 2NPIA 3GE9A 2J0SD 3IWXA 3HP6A 2KI2A 4EYIB 1NK8A 3CDUA 2A6MA 2IM3A 2ZNYA 3QIPB 3UNYA 2CQ2A 1DLOB 2A2DA 2X1GA 3P3DA 3DM2A 3EUNA 8ATCB 3T1YF 1N8RT 3H25A 2YKQA 2HFZA 3V4IB 3TUPA 3SBMA 4PXCA 2DISA 1NPPA 2HVDA 1KLMB 1Y0HA 1FD8A 2FJBB 2I1RA 3H7HB 1YG0A 1RI7A 2FJEB 4P6QA 4RZRA 1BY9A 1S9GB 1QSLA 1UW9A 1FFGB 2HAFA 3UD5A 3ET6A 4X62F 2CQ1A 1PBAA 4R5PB 5I3UA 3PW0A 1GMWA 4ZP7A 1EETB 3OXGA 2ZM6J 2YNIA 3DMJB 3HSZA 1LXNA 4MFBB 4DV5J 3I5BA 1U7LA 2VKRA 2QX0A 1TR0A 3GJRB 4DR4F 1HBUA 3BREA 4USKA 3M32B 1UZDA 2PSZA 1N0VC 4JI4J 1G4CA 5L39A 2R7UA 2ZH7A 1U26A 4U67Q 1RLCL 3I55S 1TV6A 2D7SA 1AT1B 2V69A 1HMVB 3I0SB 1YK9A 5DJBA 1T9YA 1AYEA 3UN3A 4I6WA 1BWVA 4DR5J 4ECUA 4OZ5A 2QA1A 4J91A 1U6BA 2VQFJ 4OYXA 5AE3A 2QLFB 5L1KA 2MZSA 3AOCA 2AQ4A 3MD3A 3C66A 1IKWA 2KO1A 4MIAA 5DQHA 2ASJA 4GO5X 4NPOA 4HEA9 1YBTA 5FD1A 5SUHA 3WBZA 2YKNB 2HS0A 3L7UA 4K4XA 5E33A 4WKRA 2BJEA 2H51B 1FRKA 2JJ4D 2GX8A 1U2CA 2VZ8A 1CS4B 4LBHA 1X4AA 2C2DA 1VCTA 1J2VA 1WKLA 2ZVIA 4PAAA 3KG1A 3M2UB 1UA1A 1V5IB 4DLEA 5AE2A 3OVBA 2X1FA 3N4WA 5T14A 1WKJA 3RR7A 2DGWA 5I3QA 4DS4A 2HVZA 4NZ6A 1OMSA 1RKIA 3JSMB 2FGOA 5KFYA 1AUSL 2BYCA 3MZIA 4OX9J 5U47A 4MJKA 4LF7F 1M0SA 3CJKA 2R8IA 5CYQB 3KLFA 2APOA 3GG1A 1UEVA 2BABA 4JI0F 1H7XA 5HI7A 1KHVA 2XZDB 2ZHAA 3TOQA 2VASA 3EPGA 4OZJA 3FUYA 2MB0B 1VIXA 3FMWA 1M5HA 2NSCA 4UY8T 3JTPA 4M5KA 4F0KA 5AXNA 2YNGA 4JI8J 4XAKA 1LWEB 1UVLA 3IBFB 3IN5A 4DPTA 4IKAA 3BSCA 1FA0A 4K4UA 3I4PA 3H5XA 2V8GA 1N56A 4B9VA 2QJ3A 1M90T 1FEHA 3BKTA 3MR7A 1XNQF 2IFXA 1TFYA 2DT9A 3BJYA 2XNQA 3VAJA 4DL6A 1HKAA 2BBEA 4KGXB 3DXSX 4H4KA 1AW0A 3EXYA 5J1PA 1P9YA 3NGSA 2CFXA 2FUG9 1R89A 4KV8A 4I67A 5KG6A 4K2XA 1UAWA 1WI6A 4EI2A 1JXEA 2KFYA 5FDLA 3M8SA 5KFCA 4ZVSB 4Q45A 2HHWA 1KEKA 1JLCA 3MD1A 5L1JA 1RKJA 1OY9A 2CJQA 3VQSA 1R0CB 4ZCMA 2KRBA 1LNQA 4O3QA 2YNHB 4AXIA 5LMNJ 4LBPA 1J5OA 3VR1A 1NH7A 2CQ4A 1X9SA 2J8AA 4DL2A 4JI5J 1TUVA 1U25A 1VFJA 4IRCA 2CADA 3DLLQ 4HVZA 4O0NA 1N5YB 2HBQB 2RS2A 4J9UE 3THTA 5IV4A 1FFWB 5KFKA 2WCXA 5KG0A 2NUUG 3CCQS 4PQAA 3K17A 3CJQA 1JWWA 3N6NA 4YY3J 2X1AA 1FKPA 2HGMA 3NL0A 3I5AA 4K4VA 1PYTA 2XY5A 4RW6B 1RBAA 1NSQA 4MK9A 4J5OA 3C6TA 4CT9A 3VTIA 4ZLNA 5J2QB 1JLAA 2RDJA 2IYIA 3DU6A 2RU3A 1I1GA 1IJEB 5DDQC 2UUBJ 2AGOA 2VPZB 2B8QA 4KGMA 4M5JA 4LFCF 3SXLA 3KLHB 5T7LB 3NWGA 5IT0A 4CO1A 3MMAB 4F8RA 1SKRA 3UD3P 4J9LA 3H59A 1Q7YT 4CYUA 4JYAJ 3OT9A 3ULHA 2R2SA 3OUYB 2CQPA 1EHWA 3G8QA 5B0AA 5GAEI 4JP8A 1UPPA 1MWQA 3RGIA 4IO1A 2COLA 5GAEU 1KQKA 2QA4G 3Q83A 1R0AB 4NEYA 4ZVPB 3FFIA 1LW0A 3M1VA 3IGNA 2X51A 4CLWA 1IWGA 4DR2F 2XS7A 3EMTA 5AE1A 3DOLB 4H4OA 1T9XA 1HBOA 5ETKA 3MPYA 2ZM6F 3ISNC 3GPAA 1SJ3P 4OYPA 1BE4A 1WD6A 3JYTB 5E0OA 4DLGA 3D6TB 3Q8YA 1NB2A 4C3MA 1NPKA 3LGMA 4JI4F 4YR2A 3VAKA 2VG5A 4I4BA 3H8YA 2ZVSA 1S1VB 4RWXA 4DU7A 2BACA 3MEEA 4KHMA 1G6BA 1K44A 3A8IA 5C5JA 3IA0A 3QIPA 4TKTA 1AZSB 2CPHA 4DR5F 3RBZA 5ITHA 2OEJA 2CPJA 3LF0A 2VQFF 1R8CA 3GJQB 1FESA 3EE3A 2BZ2A 1OQ6A 3AOAA 2PDAA 2GIQA 1Q82T 4C3KA 5KG5A 3N9UC 2IJFA 2B9XA 1DTTB 3OPKA 2OKQA 2CQ0A 1K0TA 2ABYA 2AT1B 1LW2A 5F8GA 3IC1A 5B7WA 2XZWA 3D68A 3ZNUA 3UDLA 5D4LA 1GXTA 2MLXA 3ELHA 1SL0A 3FGVA 4BWJA 3OTEA 4DR1J 2HHVA 1Q78A 4RNHA 3QWPA 2DVIA 1X0FA 3ZZRA 1VOMA 3JS9A 3IM9A 1UJ5A 3H5YA 5I3PA 4OX9F 1HPZB 3MEGA 2JFKA 4KKOB 5J2PA 1MU2B 4P2MA 3I32A 4EU0A 3NAIA 3CCRS 2FZKB 5LXYA 5LSRA 1RHQB 1TKDA 3EGNA 3N28A 2PGCA 4FF3A 2ZJRQ 1RBLA 1SH3A 2NXJA 4F4ZA 1TL7A 3PW7A 1WOSA 4YHHJ 2W9BA 4NRUA 1UVKA 4JI8F 5K14B 2CWKA 3FBBA 2HLUA 2QMWA 4N5SA 4C7QA 1Y00A 4QU6A 4M5IA 3G6YA 2N4CA 2G13A 4ZIVA 1U1NA 4ZPAA 3H42A 4B08A 4JUZA 2DIVA 2XM3A 4DUZJ 5CYMA 5B0GA 1HR0J 1ELOA 3U1NA 1PYSB 3ENAA 4RUCA 4AQYF 1NAQA 3Q8UA 5D3GB 2V4QA 3OFHA 2XMWA 4USVA 2KM8B 4IH5A 4Y2MA 5KFXA 2FLLA 1RAOA 5KFVA 3BO2A 1GXLA 1RHRB 4R8UA 1HFEL 3HT0A 1R8HA 2J6TA 3B82A 3P5BP 1Q53A 4ZCLA 3BF4A 2DIUA 4RW4B 2CG8A 4OFZA 3V6DA 3BB5A 1B7YB 2R7OA 2BM0A 5LSLA 2CPEA 2JLEA 1L3TA 1Q8IA 2ZKTA 1F60B 1UP1A 4DJBA 4NCAA 3E2EA 3IR5B 1W7WA 1WG5A 2H9ZA 4ZOSA 4I1TA 2E7WA 1YJNS 4TNOA 3V4MA 4CM0A 3M2VA 3KUGA 4B3RJ 3TJAA 3DCAA 4MIBA 2G0JA 1PJ6A 2XC9A 2E66A 4KRWA 3PIPQ 2DXEA 2W2OP 1C0TA 3CDAA 3LUYA 4JI7J 1WC0A 2MKIA 3PYDA 2UUBF 4A8KA 4TQSA 4I0WA 3QO9B 1HHSA 4FYDA 2B9WA 2C2RA 2OPPB 4USJC 3IG1A 1ZBTA 2DNMA 2DHGA 2IMOA 3QT6A 3WC0A 4K0KF 2CNOB 1JXVA 2WVFA 1R8BA 2YQ3A 1IR2A 4JYAF 4P10A 3NGKA 3I82A 4HL9A 4ZLLA 1UETA 3NNAA 5BYRA 2HQDA 2RRNA 5HL7Q 2ZE2A 2D74B 3DLEB 1H98A 1X4EA 3L4BC 1Y4ZB 2BE9B 1NDLA 3KLIA 2DR6A 2VUGA 4QWCA 1N5YA 1CJKA 1GFWB 3PW5A 1C2PA 5J1EB 1LWFA 2CUYA 5KFGA 3O3LA 2VFSA 1NK7A 4DX5A 2D9OA 1Q1KA 3CCTA 4RW8A 1IBKJ 4IRDA 5BXIA 1FDDA 1N6QB 2W8KA 4F67A 3KUHA 1G2EA 1HNWF 5RUBA 5HO4A 4IDKA 2ZH4A 1G7CB 3IWLA 1FDAA 1HWKA 2Y0BB 5KT4A 4X66J 1TVRB 2C42A 4CZCA 2DEIA 4DUYJ 3DLGB 4ECRA 1U4BA 3DHXA 5HMXA 4C8OA 1VQ6S 2F65A 1R3NA 2W2NP 5ETLA 3SV3A 4C8NA 1PYOB 1NDPA 2R8HA 2BQUA 2UXBJ 1N54B 4E8UA 4YB5A 4XIUA 2HKEA 2FYXA 3CMQA 1S79A 1S1XB 3HFZB 2AP6A 2XO6A 3Q8SB 2W24A 5B0EA 3ILIA 2ZJQQ 2JEGA 2YX7A 5KFJA 2JEFA 2ZJPQ 1VGYA 2LXUA 1HWIA 2DEJA 5EGYA 3UDVA 2HBYB 4RNFA 1U0SA 1JJ2R 4F0MA 2VPYB 1CJUB 1MMLA 4TY8B 4Y65A 4ID5B 2KRRA 3MFHA 5KFSA 1REVB 2L9DA 3MAHA 3D1OA 2YH1A 2ZKUA 3RB6A 2QA4S 1KQGB 1RTHB 2E1AA 2UXDJ 3FSXA 2IVFB 1CVJA 3DYAB 4DR1F 4CNYA 1X0PA 4ZPWR 1Q79A 3M8QA 2MPUA 5A2QU 2FVCA 2PMHA 2MY8A 3BM7A 3W5YA 3OSPA 3H4DA 2FVSA 1UJ6A 4I2PB 2AV5A 3OXLA 4AFFA 4W98A 2GC8A 4NLGA 3NMAA 1RT1B 1SH0A 2ZWOA 3I6PA 1SUQB 4KGKA 4O3PA 4JV2A 2GJIA 1WELA 1YRUA 1VQ5S 4HR2A 2VBYA 4LSLA 2YY3A 1S6UA 2C28A 3FBEA 3MAAB 3QJPA 4Y6IA 1VRTB 1JLFB 3BQ2A 1R6YA 4YHHF 1HBNA 1UA0A 4ZLPA 2Y3YA 1IVZA 2LQJA 5IS2A 2BW7A 3RR8A 1RBOB 3G82B 3MUMP 3VV2B 3B4DA 2CQIA 1FXLA 2B7BB 4WP3A 2V2VA 2OUGA 3VF0B 2XHCA 2L9WA 4DUZF 2FB0A 2O5DA 4U96A 1HR0F 3IBCB 1RABB 2J7UA 2Q6CA 4DSLA 3KFWX 4FKXA 2DK2A 2U2FA 3IS9A 2MKJA 3C6UB 4IFYB 2KN4A 2RQMA 2GVDB 3M8ZA 4MK7A 3F73A 1EKRA 1DBDA 3WIVA 3V5RA 2AJFE 1QDUB 1IXKA 2FJXA 1AFJA 4QWAA 4CLLA 5KFUA 4A8MP 4U7UD 3QT7A 1C1CB 1UJ4A 4G1QA 4E2FB 2UZAA 3U7JA 3ENVA 3A8KA 3MM9B 3SSRA 2I5JB 1VC0A 3PHTA 4URQU 2EFOA 1NB7A 2IMWP 5C2CA 1S6PA 3W9HA 2VODA 1WG1A 5K14A 1AFIA 3OR1B 1YWXA 4DL4A 4GKKJ 2NUHA 3JSBA 1EARA 2LDIA 1T03A 1VQ4S 4C98A 4QPXA 3KHLA 3A1YG 2CQGA 2ILYA 4IUFA 4WWSA 1T3OA 4J9PA 5D0EA 3CJ4A 2RUSA 1KFSA 1FWLA 3UR0A 4RW7A 5D3GA 2IC3B 4HYKA 4L6V3 3BR9A 2WB4A 4UTGA 4NE9C 1BGXT 1PO6A 4FDFA 3G86A 1R8PA 5E3PA 2CQHA 1VISA 1VHFA 4CT8A 1CLFA 1IKVB 4MYTA 2V4JA 4B3MF 2MSTA 2CJBA 3TJ9A 1D1UA 3GLJA 4LR7A 5D0HA 3KNGA 2DNOA 1RLDA 3WX4A 4NYPA 1VQ7S 4PWDB 3D4JA 3Q24A 1TKTA 2B4OA 3HZGA 2IRYA 1GTEA 4XDCA 5ETSA 1I3OB 2M70A 4ZVFA 3GJTB 4YMEA 2YWEA 2DH8A 5KFLA 4QYRA 2GO8A 1K8AT 1RA7A 1X4DA 4OI3A 3AA8A 4I7FB 4RJVA 1SVDA 2NXEA 1UVNA 1PG5B 4X66F 3E01A 1OO0B 1V3SA 5KT7A 4DUYF 3FCHA 5F3TA 3D0GE 2P9EA 2FJWA 1HA1A 4HKQA 2H65B 1FTCA 5DRKA 2UXBF 2UVVA 1EP4A 5A8RB 4O4GB 3OL7A 4M5LA 2AYGA 2I2YA 4KGVB 3MXHP 3H2VE 4NYOA 2HFOA 2F5GA 2FC8A 1X5SA 2VHGA 4P2SA 2CDQA 1SC4B 2HVHA 3G6XA 5L9NA 1MROB 2CPYA 5DZ6A 4LQ9A 4KO0B 4I64A 5ETQA 4Q0BA 4NA2A 1RACB 2FHOB 1C4CA 3JXOA 2CQ3A 4QWDA 1QAYA 4DF4A 4AL5A 4DZ6A 3DRXA 1Q16B 3IO1A 3DFEA 1LWCA 2OP5A 4DL0C 1HNVB 3R5DA 5CYJA 3BDPA 4B9TA 1PGZA 3PVXA 3C16A 2OD4A 4OJHA 2MKCA 4NLXA 1WF0A 3NXZA 2X3DA 2WSCC 3K5OA 2GZOA 1U6ZA 3Q8QB 2B4VA 4YDXA 4IR9A 1KNZA 3K59A 2X7IA 2OJ3A 1XMQJ 4Y2CA 1TL5A 2Z0GA 3H90A 4KB7A 2EC0A 3M9NB 3BYPA 2W4PA 3LAKA 3KTQA 3HX9A 3GG0A 3O44A 3BO4A 4ZP9A 2K3KA 2V67A 1S0MA 2HWTA 2LEPA 4HHUA 3TX8A 1TL3B 1LK5A 4ZA1A 2FPHX 4ZKAA 3KHRA 2K7JA 4KJIA 1YGYA 2ZOFA 1FKOB 1Y11A 1NK9A 2C3PA 3DDKA 4PUOA 3OV7A 2RE1A 4ID5A 1REVA 1RU1A 4O3RA 3HDSA 5D15A 4B3OB 1XMBA 1RT3B 1L3KA 4U7CA 2C3UA 2OGUA 4YQWA 2CNKB 1AUDA 2W4DA 4P2FA 4NXMF 3D67A 5F9NA 5B0CA 4EBDA 3ZTOA 1S0VA 1QY7A 2HGNA 3MHYA 4KAIA 1QUPA 3FEXB 4G6VB 4AYBD 5IZHA 2CG4A 1UTAA 4CLUA 3MECA 2V34A 4FP9A 3UFCX 1SH2A 4LRBA 4NLDA 3NGDA 1HNIA 1FE0A 1RAIB 4XDDA 2MDAA 1WORA 4MIWA 4ED1A 2V8DA 2DY1A 3D6FB 1R43A 2EVZA 3MAAA 4O4RA 2XWXA 1VRTA 4BBYA 3HKWA 4MK8A 3G4SS 1QTNB 2XLJA 3EXCX 1CULA 3R1LA 5DO2A 3AD8C 4GKKF 3C15A 4UF4A 1IQTA 2ATLA 2KT5A 4LF2A 3MM8B 1PC4A 1PJ5A 3QNWB 1IJFB 4J9NA 1YJ7A 2ZC3A 3OLAA 2AX0A 4ERDA 1N0UA 3QRQA 4ICLB 1Q7LB 4O44B 4YDDB 2HNDA 2DNQA 5KG3A 2Z57B 3D1QA 3HHLB 3MM6B 2MLYA 5E3RA 4C0HA 1IN0A 3SCLE 3BKUA 4Z2XA 2OMOA 3MMBA 1N34F 2YQ0A 4H4MB 3RG6A 3CUNA 2VPWB 1Q86T 2WVDA 1RZMA 1OYEA 1EJ7L 2ZBPA 2N4DA 4OI6A 1RWVB 2DR9A 3NS5A 5CH7B 3M8WA 3RW7A 1GAOA 1A7GE 1B4SA 2H3EB 4IFVB 3ZZUA 4ED6A 1YJTA 2WVEA 2YTCA 1YJUA 3GMGA 4A8QA 3MR2A 1RHMB 3GYXB 5DDOC 2CDRB 4BS2A 5B09A 2VDIA 4AL6A 3FZ2A 3KK1B 2XS5A 1G1XA 1DARA 4UOHA 3H0PA 1NK4A 5HLFB 2DNZA 3RYLA 2C2KB 4Y3CA 1Y5IB 3LGNA 3OR1A 2K8GA 3CCUS 4J9KA 4C8ZA 2ATCB 1F5BA 2X1BA 2Z2ZA 2OPRB 4DV1F 1UZHA 5CAAA 2H4WB 4LIRA 4NXNJ 4M94A 1VQLS 2W9CB 4DL7A 4GKJJ 5T41A 4LF6J 4C11A 1VQSA 4ZN1A 1Q8LA 2B51A 2YWGA 3GCXP 3I5CA 2IC3A 2OAUA 4KT0C 3PW4A 3NCPA 2LQ9A 3Q8VA 1FRIA 4J9QA 4ILLA 5E41A 2R8KA 4CTAB 1RT7A 3US5A 1KR4A 1VQ8S 1OSCA 3QQCD 3PR4A 2Z2MA 2L9NA 1WOOA 3CJSA 3S01A 2KXHA 1F5CA 2L41A 1QD1A 2G0CA 4LRCA 2ZHBA 4GVBB 2M2BA 3CTRA 4BCAA 4YS2A 1KONA 3TUJC 1HL6A 2DGUA 3KHHA 2VG6B 1JLGA 1SC6A 3ZTQA 5A8KB 2V2QA 4MT1A 3SSQA 2LLZA 4DR6J 3AD9C 4A8OA 2D3ZA 1BQXA 1WWHA 2HSEB 4C0BA 4TXSA 2IM1A 4ZPBA 4DV3F 3HJVA 2OIHA 3KJFB 5GAGU 3WX8A 3HPOA 4ZITA 2VBXA 3RAXA 5LXRA 4LRDA 3BH6B 4F2SA 4KIAA 3GQCA 3OBIA 4ID8A 3Q89A 2DGTA 5A8WA 3ENWA 2FJVA 1DRZA 4GVLA 2VFVA 1CJTA 4RLEA 4G3IA 2XYHB 2RKIA 2KH9A 4L73A 3UW1A 3CXCR 3IP0A 3JTNA 1NDCA 3BSNA 1RGVA 4R0EA 4DCJB 1ZTTA 2R8GA 2Z2YB 2L3MA 2P8IA 1RT5B 2PA8D 3CJ2A 1E6YA 3TR5A 1JLBB 4CH0S 2FVPA 3DRRA 3GFYA 4OV6A 2ZZTA 2ZBQA 2GQCA 4DV7F 1TL1B 4M5NA 1GTHA 3QBCA 4IG0A 4HACA 2FLPA 5E3CA 5FLXU 4K5SA 1S6OA 4ETZA 1IQZA 2VKZG 3M6VA 1IKXB 2O01C 1JLQB 5E5NA 4RU2A 2E9RX 4AL7A 4ZVEA 2BA9A 3L7PA 3SDEB 1CJVA 2DNLA 2DHXA 4NLSA 2VF3A 4QW9A 1IWAA 1HQ2A 4AMMA 3OHAA 1RHUB 2KKHA 3NMRA 1BC6A 3BPSP 2XMJA 1K0VA 3BGRB 2W01A 1TELA 3J80Y 3H2UB 4IH7A 4L76A 3OTOJ 1GEHA 4CO3A 3HJFA 5A0YB 4O23A 1T05A 5B08A 1JLEB 2DY9A 3DGPA 3DRPA 3TX0A 1Q95G 2DH9A 3K5PA 4DR3J 2ASYA 3VQTA 2CKWA 1WEXA 1UWBA 4DSJA 2XO7A 3NBPA 4CRJA 2B7CB 4WF9Q 5KFHA 1P6TA 4OMFG 2J9EA 2ASDA 1VRUB 4DR7J 2DKOB 3IFEA 4IQXA 3QATA 4JOUA 3MPUB 2E5IA 1MLAA 5KT3A 4IR1A 2AHOB 4PQUB 4A8SA 2AGQA 4CLFA 1XIQA 2FVRA 3HVTA 1Y9OA 1TKZB 1X4GA 3HKZD 4OHWA 4DN0A 1F6TA 4X4OA 2HZCA 3L7OA 1XERA 1M5KC 4DSIA 3J7YI 4B9MA 4PRFA 2GGPB 4ZJLA 2ZFHA 2JEIA 2YKMB 1H2TZ 2X3GA 4NMXA 3J7YU 2HHTA 2GAHC 3K89A 2B4UA 3ILOA 3VVTA 3LW5C 2PI4A 4YB1P 3TEHB 2FJAB 2RIJA 3DM2B 1V3RA 1X4FA 2N3OA 5D6GA 3N6MA 4CLKA 1C1BB 3DDNA 2ZBCA 3CCWA 5IFMA 1FI4A 4CLPA 2XI3A 5C42A 1VBXA 4YP3A 3NNCA 3AY0A 2DH7A 1LFPA 1YIJS 1W25A 4KBIA 5A76A 2M5YA 2V4RA 4KC5A 3P49B 2GVZA 5JJBA 3T6JA 3MR6A 3THVA 3ET6B 4BHQA 4D3GA 2NXUA 1QAIA 4C6AA 3AAWB 5I3UB 4NXNF 2W1BA 2YNIB 2LXIA 3GYNA 4GKJF 4IRKA 1UVMA 1QTMA 4LF6F 4G1IA 4DPOA 3CMAS 2GIRA 3KJQB 1HBUB 1S57A 2QGFB 5KFZA 3DNCA 3U1LA 5D77A 3D6HB 4IG3A 4FYWB 1RSCA 5K8OA 3VALA 3PR5B 1TV6B 2DTJA 3LOUA 2NZCA 3UCGA 3HD2A 3RRGA 1U2RA 4HI2A 5EUHA 4QR1A 5CCLA 3AQOA 2C1EB 5EDWA 3TUIC 2EFNA 3T1YJ 2LA4A 3BGFA 4ILMA 2O3DA 1KS2A 1M5OC 2BMBA 2MQMA 4ZS6A 4W92B 1IKWB 5K20B 5IV3A 1Y10A 1JIHA 3CIZA 3FVYA 2MKSA 1ZZFA 3O2IA 4OJ3A 4ECWA 2HNYB 3QGIA 3MDFA 1ROFA 2OPRA 2JLFA 2Y9HA 4FKYA 2B0GA 1N5QA 4EBCA 4WZMA 2PFDA 3UD4P 3Q8PB 2V50A 3EVOA 4DR6F 2W9CA 4MAKA 2JL9A 3MI7X 4O3NA 2D3OR 1P9QC 3MTKA 5HN0A 1SKSA 1URRA 1BQMA 1F3VA 5AXMA 2DD8S 3CD6S 4ZDNA 4ES1A 5HSPA 1VS3A 2VBZA 4F4XA 3CJKB 4AMNA 2JZ5A 1HBMB 3KLFB 5A2QY 2BANA 4M5HA 4NLOA 1PIEA 2ROPA 2Q1LA 1RWXB 1NDKA 3OR2A 3SFGA 3VGSA 5G0RA 2E1RA 1O0PA 4ZJOA 1UPMB 4KQZA 4AT1B 3G9CA 1FDBA 1TK8A 2Y1LB 1VR6A 2YNGB 2DB1A 5E2QA 4X64J 3TA2A 4F02A 1QJHA 3D7SB 1JKHA 3IMQJ 2GMLA 5KFOA 3KLEA 1URNA 3O6QA 3R5JB 5F0UA 2XNRA 1RA6A 1SL2A 5DG9A 3FJ2A 3R3TA 2L08A 3VZHA 1PCAA 1UCNA 1R31A 3H2LA 5HMYA 1RE1B 1QLNA 5HBMA 5KT6A 3W5XA 4PWUA 1CSJA 4KPCA 2RQCA 2FY8A 1U1PA 5FDLB 3OL8A 2KZMA 3OTOF 1JXLA 4LF7J 1NH8A 1NZ8A 1JLCB 2LECA 3DLKA 3W8GA 2IYGA 2XLIA 3K57A 3EZUA 5F8MA 1FNXH 5J2MB 2FHJD 4Q8FA 1J5OB 1M5PC 2XZTB 3U02A 1TL4A 2KT2A 4WXWA 2XB2D 3PJWA 1HHTP 2OELA 5KG7A 2VJVA 1QE1A 1UKUA 2A6OA 5CZVA 2ACMA 3BQ1A 4DR7F 1ITPA 2CVIA 2C2NA 5CD4A 3RRKA 2MQOA 5DG8A 2RB7A 1FKPB 1FXDA 4OQJA 2OSQA 2B9EA 5F9LA 2MKKA 4UZBA 2VFRA 1JLAB 2IIHA 3FSYA 2OLWA 3CSKA 3IAM9 1UFLA 1S10A 2R9LA 5EX0A 3W62A 2HNZA 2EFVA 2VD3A 1GMUA 3MURP 1RB0A 3FMBA 3VAIA 1JJHA 1RWWB 3BGRA 3MUTP 1EKSA 4CLTA 5GAHU 3MPDA 4DBQA 1RTJA 3MM7A 4U6PA 1EQ0A 4CYUB 3QYYA 5ETTA 5IWAJ 4RO0A 2YWWA 3CD5A 3KNAA 3I0RA 4AE5A 2B8PA 1HHQA 7AT1B 2UUCJ 5KTQA 4DPXA 4M5MA 3BO3A 5M2RA 2HAIA 4PYDA 3RU0A 4LIWA 1L5UA 2E7XA 4NL5A 3FFIB 4D3HA 3M1VB 1WOPA 1FVSA 1XJWB 2CIMA 4H4OB 2HMIA 1HBOB 5EWEA 4DV6F 4CLZA 3OTBA 2RAQA 1RAAB 3I9V9 3R8YA 3E8OA 3J7Z5 2QLWA 2ZDPA 1S4EA 2C3MA 2WAQD 3CWJA 3HSDA 1VQPS 3EZOA 4NZ0A 2IJNA 4RU9A 2VG5B 4LFCJ 2JX2A 3MEEB 3B54A 3GSIA 3SZ2A 4WCEQ 2HHSA 2YKMA 1RHKB 4HT7A 1JMTA 3TWZA 2B4PA 1GX5A 1FJ7A 2H54B 3W2WB 1Q8KA 4J9RA 4ED7A 3AA9A 3VGTA 3LPYA 3IXQA 1C1BA 1FJCA 2PEBA 3CVKA 1HQUB 4GRSA 3PX6A 1YBAA 3CMES 4FNHA 1LW2B 3QFHA 4YUDA 3CJ8A 5DM6Q 2LXFA 5L46A 4DR2J 1S48A 2A3JA 3K5LA 4OIXA 2BW2A 2ZH2A 4DPYA 3HF5A 4M63A 4ED4A 4DX8H 3PACA 3MTJA 2RU9A 3CJTA 2HBZB 2G9OA 4PXDA 4EO8A 3QIDA 3T6BA 4J9VA 3Q0AA 1YVFA 4YN3B 1RTDA 2Y1JA 4F0HA 3ETMA 4U7UK 1D8ZA 1WHWA 2GNKA 3K5MA 1ZETA 3MEGB 3B6BA 3R5CA 5J2PB 2LDYA 1DQ9A 3PX4A 4UQTA 2GHVC 4UUWA 2OEMA 1OPZA 1RT2A 5KFEA 5F0WA 1P8GA 1L3UA 4P7TA 3SI8A 4B9NA 2O1PA 3PFEA 4HLBA 3R9LA 3GIMA 5H9FK 3LP1A 4BWMA 1VBYA 1S1TA 1TL7B 2ZUAA 2XMKA 3HFVA 4EZ6A 1WJ9A 3EGWB 3PX0A 2W9BB 1KFDA 2R7QA 3DRSB 4LFBJ 4X64F 2VB6A 2HNYA 2WBMA 1RWPB 2C3OA 3D66A 3GR1A 4WXOA 3W1YC 4RKUC 3UVJB 2HW3A 1U47A 2YX1A 5KOWA 1FJEB 4CP5A 2QMUB 3DU5A 2BDPA 2PMWA 1GMVA 4C8KA 3E3XA 2HQCA 5IQQA 5DDPC 3A13A 1NSKL 3K7RA 5GMEA 1N36J 3UDEA 5CYMB 3DI6A 2EC2A 4M8LA 4KGZB 4EWTA 2DCUB 2BQ3A 3BS9A 5C24A 1Q5YA 2YVSA 2AZ1A 2AJ2A 1W2IA 1TAQA 3MWBA 3OSNA 1O8BA 4UT4A 4R8UB 5DLGA 4FYVB 1HBMA 4RUAA 2E1CA 1KD1T 2V2KA 1DAXA 4RR5A 3MAQA 3V6DB 4XK8C 4EYHB 4DMZA 4OZ2A 4QR2A 1AXQA 3P45B 3AD7C 3DOKA 3TW0A 2ZUGA 5F8LA 2EG1A 2HRUA 1F1BB 1HD0A 1RP5A 4BLGA 1NU4A 4KE5A 1Y5NB 2J0WA 2XCAA 1VIOA 4QBUA 3K0JA 2E5GA 1T94A 4K4ZA 3M2VB 5D4NA 3V6HA 2LEBA 4ER8A 1SC1B 4ZCKA 3ITHA 1C0TB 2BJ9A 3X1LB 3CCSS 2HBRB 4AQYJ 1VLOA 4MKVA 2M7SA 1FX4A 1SIZA 3IG1B 5JUMA 2V5HG 5KG2A 1Z4UA 3W63A 4F7VA 2W4CA 4FYYB 2LVWA 1KWMA 4RNNA 4NLRA 4QW8A 5IWAF 3OJSA 2XY6A 3TAQA 1GXUA 5J2MA 1WTFA 1WC1A 4W90B 2UUCF 3ZNJ1 1C0UA 2QA2A 2ZE2B 1W2BR 3KLIB 4JV1A 4Q2LA 1CJKB 2QYCA 3JTOA 3BEGB 4MTPA 1LWFB 4Z7CA 1Z2LA 1UVIA 1QAJA 3FEZA 3K5NA 4N8NA 2Y1IA 1QUVA 3C3LA 1HWLA 1X4BA 1CEZA 3OVSA 1NJXA 3HSJA 1M5VC 2AKWB 2V8PA 4RW8B 4J90A 1H0HB 1PKUA 3WQPA 4DQRA 3CD7A 1TAUA 3D2WA 2WW8A 4NLUA 4JI3J 2JC1A 1XR6A 4MH8A 1PBUA 3HHEA 2K2PA 3HVRA 3Q23A 4DDFA 3W2VA 3GYGA 2YBVA 5JMNA 2CZ9A 4IDKB 4DU8A 3QAUA 1GK8A 4DQSA 3AT1B 2HIYA 1WEYA 1FD2A 1K73T 2JLGA 2UVWA 3NS6A 4LT6A 3W61A 3OHBA 4K0KJ 3M6XA 4ES3A 3V6JA 1N5VA 5G4DA 1WNEA 2E29A 2POKA 1KOOA 3CCES 1VC6A 1T3NA 2QLJB 1QSYA 1JX4A 1U09A 4CIOA 2JWNA 4LREA 4PG6A 2A1BA 1D3WA 2RT3A 1YBUA 3TUZC 5CZXA 4BC7A 4RUBA 2AEJA 3UQSA 4ENOA 5GMKa 3TZWA 3KMSA 3J81U 1SIWB 2Z2LA 2M0GB 3W9JA 2BKNA 5B0DA 2ADCA 1DQAA 2SXLA 2ZNZA 5CHCB 3GR0A 4WP9A 1S4FA 3L3CA 2VOOA 4GC7A 3LP2B 3M8QB 4DFMA 4A4JA 1JQGA 4JI2J 1T9WA 2FVQA 1HNWJ 2OFGX 4P71A 6AT1B 1RWMB 3LANA 4ZCIA 1S0OA 3PY8A 3G2XA 2IAJA
chains in the Genus database with same CATH topology
2KYXA 2VG7A 2A2DA 4NLDA 5A6WA 2V9KA 2RILA 2X1GA 1HNIA 1FE0A 3P3DA 4OLPA 3SCJE 3DM2A 4TYAA 3EUNA 2AF6A 2MMYA 4XDDA 3OQ2A 3T1YF 1N8RT 3H25A 2DRAA 2MDAA 1S9EB 4V19J 2YKQA 3W2WA 2HFZA 2J7KA 2UUWA 4MIWA 3BQ0A 4ED1A 2V8DA 3V4IB 1R43A 2AYMA 3SBMA 4N41A 2EVZA 2ALZA 4LSLB 4PXCA 2DISA 4O4RA 2MQQA 1FK9A 1X5TA 3FZBA 2XWXA 1KLMB 1VRTA 4BBYA 1Y0HA 3HKWA 4MK8A 3RZAA 1FD8A 1J5EF 1ZH5A 1DTTA 4CO0A 3PZPA 2FJBB 4I6AA 3I56S 2MQPA 3G4SS 5I42A 4DL3A 3THPA 2I1RA 5DS7A 2XLJA 2WOMB 5KFFA 1HQUA 2IA0A 2K7KA 1YG0A 4FPRA 1RI7A 2FJEB 2QMXA 4P6QA 3EXCX 1HBNB 3UI3A 2VPXB 4RZRA 1HI8A 4E0DA 3R1LA 1BY9A 1S9GB 3K2YA 1QSLA 2M8DB 5AJ3F 1YQHA 1GX6A 5DO2A 5KFWA 4LFBF 4ELVA 2DGXA 4X62F 4GKKF 2CQ1A 1FRJA 4R5PB 3RB3A 1IQTA 5I3UA 3G8SA 3PW0A 4ZP7A 2ATLA 1EETB 2KT5A 3OXGA 2ZH6A 3MM8B 1PC4A 3IM8A 3PRDA 1IJFB 2AD9A 4PKDB 3CC2S 4J9NA 2YNIA 2ZC3A 3DMJB 4HDGA 4WYWA 1LXNA 3GZ7A 4MFBB 4A48A 4F3OA 3I5BA 3OLAA 3AB4B 3D1HA 2BR0A 1U7LA 1FDNA 2VKRA 2AX0A 1NJWA 3GSDA 1TR0A 4ERDA 1N0UA 1WACA 4ICLB 3SQGB 1UL3A 4C8YA 4DR4F 4QYZJ 1HBUA 3BREA 1HD1A 1Q7LB 4O44B 4WTYA 3M32B 1N36F 2PSZA 4YDDB 2HNDA 2P9CA 4OX6A 1N0VC 4QIEA 2DNQA 3SV4A 2OH2A 5MLCV 5KG3A 5BJRA 3D1QA 5L39A 4Q5VA 3HHLB 3MM6B 1Y5LB 5E3RA 2R7UA 4C0HA 2ZH7A 1IN0A 1U26A 1Y3KA 4U67Q 3KMQA 4KHRA 3SCLE 2UV8A 2DNKA 4ETXA 4FS1A 3I55S 1HPZA 4Z2XA 1FE4A 2D1CA 1TV6A 2D7SA 2ZH1A 2OMOA 2HLTA 2OPSA 3MMBA 4KKOA 1N34F 3GFXA 3IS9B 4PG7A 4H4MB 2JEJA 1HMVB 3I0SB 1MU2A 1RTDB 3CUNA 2VPWB 4MYUA 5L38A 1Q86T 2QSFA 5DJBA 1U49A 2XMMA 3PKMA 3PV8A 2N4DA 4OI6A 2NR0A 1VC5A 2DR9A 3M05A 1QVGR 4I6WA 4YB6A 3NS5A 4ECUA 4FF2A 4OZ5A 4DL5A 5CH7B 1RWUA 2QA1A 3RW7A 2MKHA 1GAOA 1A7GE 5K5MA 4IFVB 2VFTA 3ZZUA 4ED6A 1U6BA 1YJTA 2CJ9A 2N3LA 2YTCA 1YJUA 4LUBA 4B9SA 3GMGA 4A8QA 5IXUA 4B9LA 3MR2A 2CQBA 3GYXB 2AYEA 4URGA 5DDOC 4GO7X 4BS2A 5AE3A 5B09A 1RT2B 1QAXA 4AL6A 4G1QB 3FZ2A 5L1KA 2MZTA 3KK1B 4F2RA 2XS5A 1G1XA 2MZSA 3D0IE 2AQ4A 3MD3A 5E3AA 1DARA 2ZD1A 3NRBA 2PC6A 1IKWA 3C66A 3H0PA 3RB4A 1NK4A 2KO1A 4MIAA 4WE1A 5HLFB 4Q7AA 5DQHA 2DNZA 2ASJA 4GO5X 4NPOA 1TQLA 4HEA9 3LAMA 3LP1B 5L8RC 5K9FA 3RYLA 1S1TB 5CQGA 4GMKA 1S6PB 4Y3CA 1N5SA 5FD1A 5SUHA 3WBZA 4WU3A 1X9MA 1Y5IB 2YKNB 2HS0A 3DRSA 3LGNA 1YTYA 4K4XA 3OR1A 2K8GA 5E33A 4C8MA 3CCUS 4J9KA 4C8ZA 2VONA 3PIOQ 4WKRA 2BJEA 1F5BA 5CZCA 1FRKA 2X1BA 2JJ4D 2GX8A 2OPRB 4DV1F 4B3RF 2VZ8A 3UPFA 2FHMA 1X4AA 3M6WA 3KLGA 3VAMA 2C2DA 3I87A 3AJ1A 4ZK7M 2QO3A 3NGDA 1J2VA 3CDEA 4LIRA 2G1DA 2AJ4A 1S6QA 1T03B 3KG1A 3BDEA 4M94A 3ZZZA 3M2UB 1UA1A 1VQLS 4JI7F 2W9CB 4ECVA 4DL7A 3ZZTA 2Y1RI 4DLEA 3KOAA 2B9YA 5AE2A 3ETOA 5T41A 3OVBA 1SXLA 2WSEC 2X1FA 3N4WA 5DGAA 1I94F 2KZZA 2H1YA 5T14A 2D9PA 4OI1A 3RR7A 2DGWA 3DLHA 3GV8B 2VA2A 5I3QA 4C11A 4DS4A 1VQSA 2HVZA 2EPIA 4NZ6A 4ECXA 2OO4A 1IR0A 1Q8LA 2R7TA 5LJ5Y 2B51A 3OTDA 1RKIA 3JSMB 3MOZA 4I6YA 2YWGA 2FGOA 5KFYA 3B78A 3I5CA 2IC3A 4ELTA 2OAUA 4K4SA 4KT0C 4RW7B 3DI6B 3PW4A 1F2GA 1N52B 2BYCA 3NCPA 5THWA 1NKEA 2LQ9A 3LQVA 3MZIA 1FRIA 4J9QA 2OFHX 4ILLA 5E41A 4R25A 2R8KA 1V9OA 1ZM9A 5U47A 4CTAB 4MJKA 4LF7F 1M0SA 3CJKA 3VCDA 1T8EA 2DPJA 5C24B 2R8IA 1MMNA 1XEZA 1RT7A 5CYQB 3US5A 5MAOA 4QWEA 3KLFA 1KR4A 2APOA 3GG1A 4PPDA 1UEVA 1H38A 4B9UA 4QIGA 2BABA 1VQ8S 4RW4A 1OSCA 1RK8A 1KTQA 4JI0F 1KRPA 1H7XA 3PR4A 1S49A 5HI7A 2Z2MA 4M95A 2L9NA 2D3UA 2LQ5A 2PN6A 3G87A 1UW4A 3S01A 2HYIB 2ZZMA 2KXHA 1KHVA 2NSBA 4F4KA 3T5KA 4KHPF 4WK1A 1F5CA 1Q81T 2ZHAA 3MF5A 3TOQA 2VASA 2L41A 2M4MA 4LF9F 2V4JB 3UE2A 3EPGA 1VI7A 2P5VA 4OZJA 3X3UA 2G0CA 2ZH5A 2MB0B 3BN4A 1VIXA 3H5SA 3RBDA 2EWHA 3FMWA 4OZ0A 2AW0A 2ZHBA 3MMCA 1M5HA 2NSCA 4FNIA 3TVKA 2M2BA 1KQSR 4UY8T 4QWBA 3JTPA 4OV1A 2FIUA 5AXNA 2B56A 2YNGA 3CTRA 1UVLA 1Q4RA 1LWEB 3M2RA 4XAKA 4BCAA 3IN5A 1KONA 3DOKB 3TUJC 4IKAA 3BSCA 1FF2A 1FA0A 1HL6A 2DGUA 4B02A 1DHMA 3I4PA 4K4UA 3KHHA 2VG6B 1JLGA 1SC6A 3H5XA 1TKTB 4R0JA 3SCIE 5IT4A 3M9MB 2V8GA 4DEZA 1N56A 1IBKF 4B9VA 3SEOA 1D9DA 5A8KB 2QJ3A 4NMLA 5F8NA 3SSQA 3SCKE 1FEHA 4MMOA 5H9EJ 3O5TB 1M90T 2LLZA 3KG4A 1XNQF 2IFXA 3G6VA 1TFYA 2KDOA 4DSLA 2DT9A 5F8IA 2DHSA 2C22A 4A8OA 3BJYA 2XNQA 2XS2A 4JI3F 2D3ZA 1BQXA 1WWHA 2J9DA 3QO9A 4C0BA 1HARA 5BYSA 3VAJA 4TXSA 2IM1A 4ZPBA 4DV3F 4DL6A 4X4NA 2BBEA 3BSOA 3HJVA 3TNVA 3DXSX 1IM4A 2OPPA 4H4KA 2OIHA 3EXYA 5J1PA 1AW0A 3ITHB 3A8EA 5GAGU 2CFXA 2FUG9 4FBTA 1R89A 4KV8A 4I67A 2JOQA 2OPQA 3HPOA 2J0QD 2VBXA 2DR5A 5KG6A 4K2XA 4C2MA 3RAXA 1RJJA 5LXRA 1UAWA 2XMTA 1WI6A 1JXEA 3NCQA 1MMDA 2KFYA 4F2SA 4KIAA 1MNEA 3GQCA 4CNZA 3OBIA 3E01B 1DURA 4ID8A 2DGTA 5FDLA 3M8SA 2F1FA 3DOMA 5A8WA 5KFCA 3ENWA 1YJWS 2FJVA 4Q45A 1DRZA 3Q2TC 2HHWA 1MWYA 4ED3A 1KEKA 2VFVA 3M4XA 1JLCA 4RLEA 1N33F 3FQLA 3MD1A 4HTJA 5L1JA 1RKJA 4G3IA 5KOXA 1FT8A 4CH7A 2CJQA 1KVJA 5DETA 2RKIA 2KH9A 3UW1A 3CXCR 1YSJA 1R27B 1ZM4A 3SMZA 3VQSA 4ZCMA 2KRBA 3JTNA 4O3QA 2YNHB 4AXIA 2VBWA 1J5OA 2W7AA 3BSNA 1RGVA 3VR1A 3DLEA 4OHYA 1NH7A 2CQ4A 4R0EA 3CGIA 2KG1A 1X9SA 2J8AA 1ZTTA 4DL2A 4IOCQ 1EP4B 4NLYA 2EI5A 2R8GA 1TUVA 2ROGA 2IBKA 1U25A 4KTQA 2L3MA 2GQQA 1VFJA 4IRCA 5J1EA 3DLLQ 1RT5B 4HVZA 2VA3A 1N5YB 2KFNA 3H5UA 1XR7A 1C0UB 2PA8D 3CJ2A 4N77A 2RS2A 1E6YA 2YKPA 4PCQA 2NPFA 3THTA 1B64A 2M88A 3TR5A 3GV7B 1JLBB 2DCLA 4CH0S 4DQQA 5KFKA 4WFAQ 3DRRA 2FVPA 1U2FA 2WCXA 5KG0A 1FO1A 2NUUG 3GFYA 1ZAXA 3CCQS 4PQAA 1Q8BA 4ZP8A 1JWWA 2GQCA 3N6NA 4J9SA 5KFNA 4DV7F 1RQ0A 4OI4A 4A46A 1TL1B 2X1AA 1RYSA 1TFWA 1FKPA 2HGMA 2FY1A 1GTHA 3NL0A 3DXBA 2F7VA 3I5AA 4IG0A 4EO6A 4K4VA 2HRYA 2XY5A 4RW6B 2DR7A 4Q0BB 4Y34A 2FLPA 4MK9A 4J5OA 4YB7A 3C6TA 5E3CA 4CT9A 4IH6A 2IA6A 3T5HA 1N6QA 4K5SA 3VTIA 3IAS9 5J2QB 5DG7A 1JLAA 1XTZA 4PG4A 2UXDF 3PEHA 1PILA 1SBRA 2WONA 2IYIA 2RDJA 1S6OA 3DU6A 4ETZA 1IQZA 2RU3A 1RT6A 1LWCB 2VKZG 3S8SA 1BQNA 1PC5A 3M6VA 3MPWA 1I1GA 4HTIA 1K1QA 1S99A 1IKXB 4OLOA 1IJEB 2O01C 2MGZA 4K4TA 1SJ4P 5DDQC 1JLQB 2AGOA 5E5NA 4TQRA 2CJKA 4RU2A 2VPZB 2E9RX 1ULRA 2XGQA 4ZVEA 4AL7A 2BA9A 3D0HE 4KGMA 1P1LA 4LFCF 1S72S 4JI2F 3SXLA 3KLHB 2D41A 3L09A 3NWGA 5T7LB 3W2VB 1TVRA 4RW9A 3L7PA 5IT0A 3SDEB 4CO1A 4MKAA 1VQNS 1OIAA 2DNLA 2DRBA 1WEZA 2DHXA 2GHPA 4NLSA 1TK0A 4QW9A 5M2PA 1U48A 3MMAB 3OHAA 6FD1A 2R2RA 3DLGA 4F8RA 2KKHA 3NMRA 1FRLA 1SKRA 4EZ9A 3UD3P 1BC6A 2XMJA 1K0VA 3BGRB 3HVWA 4X4VA 1AROP 5KFRA 4J9LA 1S1UA 3H59A 1Q7YT 3K8WA 3J80Y 4QR0A 4X65F 5KFAA 3H2UB 4IH7A 3ULHA 1MWZA 5KT2A 2R2SA 3OUYB 3I31A 2GHWA 2F8EX 2FDNA 4CO3A 1HNZF 1HNXF 2RUGA 2CQPA 1SB6A 3HJFA 2ROEA 3G8QA 2HHXA 3ZZOA 5A0YB 4O23A 4UOCA 5B0AA 5JVHQ 1T05A 5GAEI 5B08A 2QZ8A 2IM2A 3ZC4A 1JLEB 3CD0A 1S1XA 4QIFA 4DV4F 3DGPA 3DRPA 3RGIA 4IO1A 2COLA 4BC9A 2DH9A 2BJDA 5GAEU 2G2ZA 3K5PA 2OTJS 1KQKA 2ASYA 3VQTA 2CKWA 3E51A 1WEXA 2V8HA 2QA4G 3MEDB 4K5RA 1R0AB 1UWBA 2NYIA 3TP2A 4DSJA 2XO7A 3NBPA 3FFIA 2B7CB 4KPYA 4DF8A 1LW0A 4WF9Q 3GILA 5F41A 5KFHA 3M1VA 3EZ5A 3IGNA 1P6TA 2X51A 4OMFG 3NAHA 1LK7A 4DFPA 3T1HF 4NLVA 3H4BA 4DR2F 4ECZA 2K3IA 2J9EA 2ASDA 1VRUB 4ED2A 2XS7A 3OFFA 4UUXA 5AE1A 1DTQA 3IFEA 3DOLB 2EK6A 4TY8A 4H4OA 4IQXA 3QATA 3F44A 2E5JA 4JOUA 2E5IA 4WZQA 1MLAA 2LKZA 2XHWA 2LMIA 4QJVA 5KT3A 4IR1A 4PQUB 4OHZA 1DQ8A 2RVJA 4A8SA 1HBOA 2CPDA 4N56A 3MPYA 2AGQA 2ZM6F 4JI6F 4O3SA 4PUOB 1MSWD 5HQ8A 3ISNC 1RTHA 2R7SA 2FVRA 1SJ3P 1APSA 5EWGA 2NQPA 3H20A 2KTQA 3HVTA 2ERRA 1Y9OA 1TKXB 3DYAA 1WD6A 3JYTB 3ENQA 5E0OA 4DLGA 3N79A 5CA5A 1TKZB 1X4GA 4C3MA 3HKZD 4C4WA 3LGMA 4OHWA 1X8DA 4DN0A 3TAMA 4X4OA 2Q66A 2UUTA 4JI4F 1SJ1A 2HZCA 4YR2A 4PG5A 4C97A 2UP1A 3VAKA 2VG5A 3LP2A 4LF8F 4I4BA 3H8YA 2PO4A 2JH3A 1SJFA 2ZVSA 1S1WA 2Q6BA 1S1VB 5D78A 4F26A 4RWXA 4I2PA 2QE5A 2Q3PA 3L7OA 1XERA 2BACA 3MEEA 4KHMA 1M5KC 3CJ5A 1G6BA 3GFZA 1VK8A 4DSIA 3J7YI 4B9MA 2B6AA 4X4SA 1JK9B 1RT1A 3BN7A 4PRFA 2GGPB 5C5JA 2ZFHA 1HWUA 2JEIA 1SUQA 3IA0A 3QIPA 4TKTA 2YKMB 1H2TZ 2X3GA 2KHDA 4F50A 3J7YU 2HHTA 1ZPVA 3MECB 3K89A 2B4UA 2MZRA 1R7IA 2CPHA 4DR5F 2WSFC 6FDRA 2GJ2A 5BR8F 3PKYA 3LW5C 5ITHA 2PI4A 2KJVA 1WI8A 2IAJB 4YB1P 2DNNA 2VG7B 4OJ1A 2JHEA 3I9ZA 1HNIB 2FJAB 1S9EA 2RIJA 2CPJA 3DM2B 3OLBA 3BGUA 1V3RA 2GCFA 3LF0A 1R8CA 3LP0A 2VQFF 1X4FA 2O67A 2N3OA 4ED0A 1FESA 1JLFA 3KKFA 2LU2A 2BZ2A 1OQ6A 5D6GA 3N6MA 2IM0A 2EW9A 2PDAA 2GIQA 1Q82T 1C1BB 3PEJA 1VLYA 3DDNA 4C3KA 5KG5A 2ZBCA 3CCWA 3N9UC 5IFMA 1FK9B 4DSKA 2IJFA 2B9XA 3TARA 3QGGA 1DTTB 3OPKA 2XI3A 2OKQA 2B3TB 2CQ0A 5C42A 1VBXA 4YP3A 2WOMA 3AY0A 5I42B 4F4YA 2DH7A 1LFPA 3NNCA 2ABYA 1W25A 4KBIA 4NZ7A 1YIJS 1NO8A 1LW2A 1FNMA 3KLVA 2M5Y<