2PFFB

Structural insights of yeast fatty acid synthase
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
2006
structure length
2006
Chain Sequence
MDAYSTRPLTLSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGSISERIVDCIIRLPVKWETTTQFKATHILDFGPGGASGLGVLTHRNKDGTGVRVIVAGTLDINPDDDYGFKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGSQEQGMGMDLYKTSKAAQDVWNRADNHFKDTYGFSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDLKSKGLIPADATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRDELGRSNYGMIAINPGRVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAGDLRALDTVTNVLNFIKLQKIDIIELQKSLSLEEVEGHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Fatty acid synthase subunit alpha
publication title Structural Insights of Yeast Fatty Acid Synthase
pubmed doi rcsb
total genus 233
structure length 2006
sequence length 2006
chains with identical sequence E, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01575 MaoC_dehydratas MaoC like domain
B PF08354 DUF1729 Domain of unknown function (DUF1729)
B PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
B PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis
B PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta
B PF17951 FAS_meander Fatty acid synthase meander beta sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2420 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB01
3.30.70.2430 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2pffB05
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 2pffB03
2H1YA 3G87A 5CZDA 3HMJG 3IM8A 3EZOA 2G2OA 2G2ZA 2VZ8A 4RL1A 5DZ6A 2G1HA 2QJ3A 3R97A 3H0PA 4RR5A 2JFDA 2VZ9A 3SBMA 3HHDA 1NM2A 3HJVA 2G2YA 1MLAA 2JFKA 2PFFB 5CZCA 3TQEA 3QATA 2QC3A 2UV8G 2CUYA 2C2NA 3K89A 2HG4A 3IM9A 2VKZG 3RGIA 4QBUA 3PTWA 5DZ7A 2QO3A
chains in the Genus database with same CATH superfamily
4RWXA 5K8MA 1XR7A 1DRZA 1UMJA 3TAQA 3HCXA 4NXNJ 3LTOA 3CWJA 4O4RA 2G0IA 2JEJA 4I67A 2LEPA 3HD1A 2LVWA 2HWTA 1BQMA 1ZA2B 5D0EA 3MD3A 2BQUA 2O1PA 4NZ6A 5LOQA 1FRIA 4K2JA 5AXMA 3UDVA 3UCUP 3G6VA 5A8RA 1GMVA 5J2PB 4NMXA 3HMJG 3IR7B 2PFDA 2EVZA 3EUNA 2R2RA 4KHPJ 3V4IA 2V69A 1QE1A 4QW9A 5HMWA 1IWAA 2VOOA 4Q45A 3QRRA 3P96A 4F0KA 3PNIA 4M5LA 2MLZA 1QUVA 2BQ3A 4CYUB 4F3OA 2HPUA 1PAEX 3M7VA 4JI7F 2H5EA 1RBOB 1HARA 4F3QA 4KPCA 3TX0A 2UZAA 3P45B 2HFVA 2CQGA 2GO9A 1LEOA 2DR5A 3IRXB 1X4HA 2ILYA 4TVAB 2K2PA 3I9V9 2WONB 3D1OA 3CMES 4RX6A 3FSYA 3TP2A 2Z2LA 4HEA9 1WC5A 4CCHA 4RW4B 1HBOB 4IKAA 2LQBA 3R5CA 1VQSA 1TL7A 1Z1ZA 3LGNA 3BGRA 1YRUA 3NRBA 4URQU 2W4PA 4N47A 4ILMA 2VC0A 4FF3A 1R8PA 3MMAA 4LSZB 3TA2A 3CE8A 4RO0A 2ZJRQ 2RQCA 1CULB 3EPGA 2NZ4A 3ZTOA 2BRKA 4EEYA 4OYWA 3Q8VA 1S6PA 3MPVA 1XR5A 3Q2TC 4IQXA 2BMBA 3NY0A 5H9EJ 3D0IE 1JB0C 1FO1A 3KDOA 1UFKA 3C14A 3DDIA 1CJUA 3K59A 2GNKA 2OFGX 2I9SA 2CJ9A 4ED7A 3IFEA 3MCMA 1HPZA 1RT5A 2B4UA 2UXBF 4BBYA 1AXQA 1U02A 3T3FA 4HHHA 3KNGA 3OSNA 2PN6A 2M3DA 4Q43A 3MD1A 4WKRA 4H54A 3C15B 4RBTA 3I31A 3OUYB 4KSEB 3ZTSA 3MEKA 1EHWA 3PRDA 3T1HJ 2GFFA 1F3VA 2VHGA 1RB0A 3WZ0A 4DQIA 1HIYA 4HDHA 5BYQA 4J90A 1FA0A 3BH7B 5HN0A 5D0GA 2BDPA 2F4FA 4HLBA 2VH7A 1HWLA 2EPIA 2DCUB 3K89A 2CDRB 5KFAA 4NLSA 3B6BA 3KLGB 1TP7A 2RJZA 5DM7Q 2OPPA 1E6YA 1H7WA 3MTJA 2YPYA 4KH1B 4F50A 5ETNA 5HO4A 4DV4F 3TANA 4RNMA 4NLWA 1JLGB 2L48A 1S77D 1IJEB 4P6QA 1T0TV 3DRSA 3HT0A 5DLFA 1LW2B 2L9NA 5AE3A 2I2YA 3R1HA 2P9CA 2JX2A 3GMGA 4M95A 2MZQA 1JQGA 4KO0A 4M5IA 3W2WA 1HR0F 2H3EB 1UEVA 1HHSA 4LR9A 1S9EA 3D6MB 3TAPA 4DN0A 4YEAA 2LQJA 1NO8A 4IOBA 2KG1A 2OD4A 3CCJS 3FFIA 1NRKA 5C42B 1IQTA 3M32A 5E3CA 5C7PA 4C0HA 1S1WB 2CQPA 4X64J 1VK3A 2PGCA 2GZOA 1ZZNA 2KXHA 4KKOB 4WFYA 1U1QA 4W92B 2HGLA 1RABB 5HLFB 2KB2A 2GIRA 2QGFB 2ATCB 3ZZZA 2XMMA 5CYMB 3QBCA 3H8YA 3M6VA 3EM1A 3KJFB 4U7CA 5IC6B 1RTZA 1HI1A 2WSFC 2V8DA 5T14A 2H65B 3ZFVA 4DV2J 2KH9A 2VA3A 1SJRA 2M7SA 3NMAA 1UVNA 5CD4H 3QT7A 3OTOF 4DJBA 2FZGB 2XLIA 1UVIA 2FLOA 2KYZA 2XCAA 1Y7PA 2GGPB 4L3KA 4R0EA 2DHGA 9ATCB 3D54A 4DCJB 3DM2A 1N5QA 4OJ1A 1Q4RA 5LXRA 1EKSA 3JS9A 1U26A 4F4YA 2YX1A 4O3SA 1GQEA 1M0SA 1RHJB 3R5JB 3ETOA 4NLDA 3KLFA 1ZH5A 1HL6A 3R9LA 1CJTB 2O67A 4DFKA 4OI3A 3P8BB 4U96A 4TLRA 2PD1A 4ZCIA 4X4TA 2D74B 2CNOB 5IM0A 5D8HB 3NNCA 1HNIB 4MK8A 4K5RA 4C3LA 1JKHA 1BGXT 1U6BA 1EETA 1HWJA 4I2PB 3GV8B 2ZM6F 1MMNA 2QSFA 3TYTA 4LFCF 1QAXA 2CPHA 3D68A 2WTFA 4L6V3 1C1CA 2MSTA 5J1PA 2VG7B 3OHBA 2XWYA 4QOTA 3HKWA 4WPAA 2BANB 4PQUA 1KVKA 5BR8J 1SI9A 1YJWS 5KFCA 2IM0A 2HQCA 4M5JA 4XK8C 3W66A 2HZCA 3PJXA 1FKOB 3GB0A 2EC0A 5AXLA 3QJPA 2WVEA 1MW7A 4NX9A 4WYLA 3KJVB 5HP1A 1SCJB 2DH7A 1FXLA 3ONQA 4KY3A 1R43A 3BDEA 1E6VB 1FRHA 3ADAC 4TN2A 4B02A 3ENQA 3ULHA 1XMOJ 5DGBA 3UD5A 2P2CB 1WKJA 3IAM9 2HW3A 3HZGA 4P7VA 2G0JA 4IRDA 3LP2A 3CO9A 2QFJA 5KFIA 4QIWD 1TKXA 3FQKA 5L1LA 3K5LA 1N52B 4OQJA 1HMVB 4TY8B 2DO0A 2GVDB 5B09A 2DTJA 3W1YC 3VHQA 3IBFB 1CQNA 3G82B 4Y2IA 4GVBB 1IBLF 2IVFB 3ZZOA 3GLJA 3BGUA 3MM5B 4PR6A 2R7RA 1L3VA 1C1BB 4OZNA 3POTB 3MI7X 3SQOP 2BJDA 1KQKA 1Q0NA 3HHLC 1SQEA 1DARA 5FDLA 4X84A 2QA2A 3J7Z5 3MEDA 4MFBA 2ZBIA 4H4MB 5IWAF 4KHRA 2FTRA 3HKZD 4ZLNA 5DLGA 1B4SA 2FLPA 3WIVA 1IBMF 9RUBA 3KMSA 1X9MA 3KHGA 4JV2A 2Y8WA 3Q86A 4MIAA 3L3CA 5F8GA 2A18A 3JQJA 1FKPA 2GQQA 2MMYA 3UFCX 3A3PB 4XO0A 1JLEA 2R7TA 4DBQA 2RH3A 1KOOA 2IHR1 4P2XA 1FJCA 4LF6F 2WW4A 1UA1A 4DL7A 1G4CA 2ERRA 1U1LA 3MR5A 3BPDA 1NSQA 1W25A 3BKUA 1BWVA 1PBAA 4UZCA 1UKUA 4IH6A 4AD6A 5HVFA 2QMWA 4CI0B 2HHTA 2V4JB 2VBYA 3CCSS 1DQ9A 2MKCA 2OP5A 2IA6A 4UY85 2G2YA 4L75A 1VQNS 2HFSA 3UD3P 4LSNA 4CLWA 2E1CA 2R42A 4NA3A 5GAHI 3RGIA 1FERA 5DQGA 3MM7A 7AT1B 5F3TA 3BZQA 4DV3J 4HI1A 2V68A 5KFUA 2L9DA 4F25A 5AXKA 2IYIA 4IG3A 2X3DA 1R31A 4NLUA 1GMUA 2D9PA 3FUYA 4RPFA 4OLOA 4Q0BA 1H72C 4GKJJ 2UV8A 3BREA 2Z57B 1VQ5S 1D9FA 1HD0A 3LOUA 4C8LA 1N8RT 1RWKB 1PC5A 4OZ3A 4CP5A 2Z2MA 1RAJA 1RT4A 2JVOA 3P4UB 2HLUA 3BGFA 1HBMA 2LCWA 2ASJA 2RAQA 1IN0A 4WU2A 2BZ2A 4F04B 5LJ3Y 1RKJA 3AAWB 2N7YA 4USUA 3MEGB 1YVFA 4F67A 3DCAA 3DOKB 1YWXA 2Q3PA 5J2QB 4GC7A 4FPIA 1S10A 3HVWA 1U1KA 1NSAA 1WWHA 3VGUA 3I4PA 4WZMA 2QLFB 1T05A 3OR1A 1M5HA 4ICLA 4C8YA 4GVLA 4NLOA 3PM9A 2VQFJ 1RTJB 2QA1A 2HVDA 3HHDA 2KHCA 3K5OA 3TUJC 2N3OA 2HSEB 4K50A 2XULA 2QRRA 2WW8A 4F4WA 3DLEA 3KG0A 3UI3A 2IY5B 4PWDB 3D2WA 5A8KA 1MU2A 3I4HX 5T7LB 2VB6A 5HBMA 2KT2A 3GCXP 3VTIA 5CH7B 1BUXA 5I3UA 1YBTA 1CS4A 1B3TA 4I7FA 4C11A 1NJYA 3EZOA 1DTTB 4LBPA 4AXJA 5EWEA 4DX5A 3QNWB 2X7IA 3M05A 3CJSA 1LFPA 3RRHA 4NA2A 1F0XA 1H38A 1CLFA 2MGZA 1F9FA 3PHTA 3KTQA 3TVYA 1TVRA 4ERDA 3MM8B 2C3MA 2E5LJ 2E7WA 2ZHOA 3VQTA 5A8WA 3C6TB 1WORA 1Q16B 4USWA 1NK0A 3QRQA 4M5HA 4YB6A 2DNKA 3IS9B 2DNOA 1L3TA 3H5YA 2MKKA 1NK9A 3SSRA 5D3GA 2ZE2A 2ZWPA 2BE9B 3HFKA 5IS2A 2LFVA 1DQAA 5DG8A 1T03B 3S01A 4IO1A 4WTYA 4DS4A 2ZWOA 3TZYA 1LOUA 4OI6A 2J6UA 2P9GA 2B5JA 3T6JA 3NGKA 2A2CA 2JC1A 2MZTA 2MPUA 1YJVA 2GAHC 1NK5A 4DV6F 4ZCKA 1ZM4A 3A3OB 3LWLA 5D15A 1RT2B 4KJIA 1UPMB 4QIVA 4EU0A 4NZ0A 3EZUA 3SEOA 4ANCA 2ZM6J 3DLGA 1KHVA 1QD1A 2EG1A 4RUBA 1JLFA 4B9LA 4YFUA 1RGVA 3Q24A 4PWUA 2XSFA 5KG4A 4X66J 3NGDA 1HW9A 5LSLA 4MKVA 3A13A 2MQPA 3ZZTA 3BGLA 3HDSA 3HVTB 4RU9A 1Y0HA 1Y5NB 3OVAA 1TL1A 5IV3A 1FDDA 2ZZNA 1KD1T 2AF6A 4FKXA 1NZ8A 2JNJA 4UOFA 3R6LB 4YR3A 1S0MA 2NYIA 3HSZA 1TAQA 2QG9B 4IFYB 4MK9A 4OIXA 1C0UA 3N9UC 3R5DA 3VAMA 4WFXA 4USJC 3QATA 1XERA 5ETKA 5FIIA 4FF2A 1KVIA 4YB5A 1ZM3A 2F7VA 3W5ZA 3D3BJ 5E3RA 3E8OA 1Y5IB 5LMNF 4JI1F 1MWQA 2CJAA 5CABA 4M63A 2DK2A 3MPWA 2AJFE 1H0HB 1RAEB 1N33F 1H3DA 4LFBF 3DLKA 3TJ9A 1ZYQA 4GKKJ 1Q7LB 2AEMA 1Z2ZA 1WG5A 4J9QA 3M8QA 3LP0A 3N79A 3JYTB 4PABA 4DUYJ 1BXNA 1WEXA 1PC4A 4J9SA 3PXGa 3C8YA 3I5AA 3R8YA 4A8OA 1UVMA 2HHHF 5F8IA 1FEHA 2Y0BB 5HSPA 3GG1A 4DL4A 2E5HA 3CC7S 3MUTP 1KTVA 1RCXB 4RBVA 2HFNA 2G2ZA 2AJ2A 5BYRA 1KOHA 5B0CA 3NXZA 3IWNC 2C3UA 2HZVA 3L7OA 2K8GA 4ZN1A 5KOWA 5D0HA 1WOPA 4X4NA 1HWIA 2V63A 4ID8A 3W61A 5KFYA 3NP5A 2XSJA 2HNZB 2VJVA 4DF8A 1N54B 4L72B 5HVHA 1NJWA 4Q8EA 4UUXA 3KHRA 1S9GB 3KLIA 3K58A 1UW9A 5KG2A 3RB0A 1M5KC 1TL5A 1MMDA 4DR7J 4LRAA 4ZDNA 2G1DA 2MHEA 5F8NA 2B9EA 1TL3B 3H5UA 3IMQJ 1LK5A 1VIXA 2W1BA 4K4XA 2I5JB 4CM0A 4PAAA 3E3XA 2AWZA 3HHLB 2KZZA 3R5AA 3WX8A 3SV3A 2OLWA 2CPJA 4ID5A 3TEGA 4CQ1A 2Y1JA 2RDDA 1EKRA 3SI8A 2ROGA 3TEHB 4ZA1A 4DDFA 3Q8QB 2AX0A 4USIA 1RAAB 3JSBA 3MOJB 4B9NA 2V8PA 4JV5J 3OR2B 3G6YA 2XB2D 1N6QB 5DG7A 3QT6A 5GMKa 2DT9A 3QAEA 1IR0A 2IFXA 3DRPB 1X8DA 3SDEB 2B0GA 4DWIA 2DIVA 2V94A 3ITHB 2YX4A 3A4TA 3PW2A 3Q83A 1IKVB 1TKTB 1VRUA 3RBEA 4RLEA 3CCRS 3AQPA 1N0UA 1HBNA 3CIZA 4IDKA 3LW5C 3ZZYA 2FZKB 1CPZA 3I5BA 2V2ZA 2CPYA 4ILLA 3T1YJ 2BE2A 2MKHA 2CPXA 1ZAXA 4EK2A 3MCSA 1KR4A 5BYSA 4NXMF 3D66A 3KK3B 4DL0C 4X62F 2DRBA 3TQEA 2RNEA 5ETRA 1S76D 3V81A 4OX9F 2HMIB 2QO3A 2WOMB 2LKZA 5F3ZA 3VAGA 5C24A 4FNHA 4ETXA 1WI8A 2BXJA 3D9BA 3BH6B 1RE1B 3SQGB 1N5TA 4WE1A 3KKFA 4AFFA 4C8KA 4LIRA 2AD9A 1Y00A 3OTCA 3AXMA 2IJFA 4PXDA 1CJVB 3IR5B 4FN5A 1YG0A 3D1QA 4O3RA 4JUZA 2LXUA 4C3MA 4X4UA 2C28A 5K8PA 2BJ3A 2R7XA 5I4MA 3CO0P 1F3FA 5AE2A 3HX9A 5B0AA 1VCTA 2KM8C 1UFLA 2CQ2A 1JJHA 4J37A 3OXFA 2NUHA 5HROA 5IQ6A 2UUAF 4DR6F 4MK7A 2VV5A 3LAKA 3V4MA 2W25A 2FHOB 1SC3B 1N5VA 2XO6A 4QYZK 1OMSA 4NLGA 3QT8A 3EGZA 1RTHB 2HQDA 1ZOTA 3QO9A 1VLYA 3EVWA 3TAMB 4RJVA 4OYPA 1FRMA 4A8SA 2DNMA 1RWPB 3J7A1 4DSJA 2VUGA 4I2QA 4JI4F 5JMNA 4KV8A 2HS3A 2FYXA 3MR3A 2GCFA 2UUBJ 3IM8A 1TK0A 2DXDA 3D67A 4ZVUB 1L5UA 4DXLA 5L46A 1G2EA 4QWAA 3DGVA 2GJ2A 4UZBA 2B3TB 1FFSB 4QIGA 2UXDJ 5J2MB 4ZLLA 2M2BA 4QR0A 2IVYA 1S1XA 3NBPB 4LMZA 1UETA 4RW6B 1S1UA 3CD6S 4DV6J 3GFYA 2WBMA 2WSCC 2W2MP 2GQCA 2G2OA 2HKEA 3THVA 3BF4A 1IR1A 2KFNA 3QLHA 4B17A 3BV8A 1G3OA 1EARA 4PEOA 4U67Q 1SKUB 4I6WA 5LT5A 2B56A 1Q78A 3LAMA 1D9DA 2V9KA 1YZ7A 2HVZA 4ZVHA 2DH8A 1LWXA 1RT6A 4AXIA 4UOGA 2B8QA 2YQ1A 4V19J 5ITHA 5DO2A 2CZVC 4MAKA 1EIYB 4JOUA 1RHQB 4DPTA 1X4DA 5CCLA 1D09B 2IMWP 3Q8RB 2R9LA 3KXDA 3L4BC 2W7PA 2O66A 2ZD1A 3M8PB 3TZZA 2QMUB 4CO1A 3QYYA 1UPPA 4B3TJ 3CCES 4IRKA 2HNYA 1RAFB 2FIUA 5KFJA 5L9XA 3WDOA 4OZ5A 2CJQA 2ZHAA 1SB6A 4X2BA 2RUSA 3CCZA 4OX6A 5THWA 1TUGB 1NBEB 2ZOFA 2I0XA 5CXTA 2W7OA 4CYUA 3VGVA 3ILLA 1A7GE 1CSJA 4F7VA 2ZNYA 3ET6B 2FJWA 5HMZA 1QTMA 1Y9OA 2ZITA 4A8KA 2H9ZA 2HQGA 4YOEA 2CRLA 2AJ4A 1WDDA 2GJFA 4PG8A 2BRLA 4RL1A 3LALA 4IOAQ 4RKUC 4YUDA 3FMBA 1X9WA 3N01A 2FVPA 1HBOA 3DYAA 2B9YA 3NL0A 5D4LA 4P10A 4RR5A 1XNQJ 3I0SB 2O5DA 2DNNA 4JBCA 3UCGA 1FRJA 1S0VA 1XNRJ 1XMQJ 4OV6A 1IBKJ 3UDEA 1S1VB 4ELTA 3I0RA 1R6YA 2VG6A 1DJ0A 1TUVA 4A48A 2RT3A 1FJGF 3RYLA 1U49A 2I1RA 1X4FA 3W7BA 5IT9U 1AFJA 1CULA 1S5ZA 4NCAA 2UVWA 1J5OB 2H5JB 4KC5A 1LQ9A 2VPYB 3AD8C 3K17A 4Q8FA 2YH1A 1WHWA 3GZ7A 4OYXA 2RSQA 2YNGA 3IBCB 2DIUA 5ETLA 4B9UA 2KYXA 4FYXB 1AZSB 5JUMA 3QIPA 1H2TZ 2PI5A 2W4CA 4K4VA 1NDKA 2F8MA 5KG0A 5B0EA 1K47A 4P2SA 1AFIA 4O4GB 3BO3A 2FHKA 3OUYA 4DL2A 3DOMB 3QGGA 2W2NP 5CHCB 4KTQA 1FK9B 2ZH8A 4N5SA 4MYUA 5H9EK 3DGPA 4NI2B 1IVZA 1RBLA 1JLAB 3A12A 2PC6A 3RW7A 4F2SA 5HI7A 2QL5B 3NS7B 3PEHA 4I56A 1YSJA 4G1QB 3CJKB 3FRZA 2ASLA 2A10A 4HYKA 3M9OB 3GWCA 3R3TA 3MCOA 3MECB 1NUEA 1FXRA 3EICA 3M8SA 1FXDA 3CJ3A 4XDDA 2MSSA 4RU2A 2E1MC 4WP8A 2YTCA 2CDQA 1HNZJ 2VPXB 4D3HA 3ENAA 2RD5C 1R6VA 5L8RC 3M6UA 1NAQA 3PYDA 2LMIA 4I6YA 2ZVIA 2P6SA 4C0BA 4NASA 4PZVA 2HNDA 4U7UK 1RP5A 1I3OB 3RRGA 3H90A 3RG6A 2J6SA 2IYGA 1TELA 1WSVA 2D1CA 2RE1A 1RUSA 3TRGA 4C8ZA 1H2VZ 5F8LA 3PZPA 2ZVSA 3HSGA 1JJCB 4KT0C 1VRTA 4OZ2A 3TUZC 4KKOA 1CJKA 2MHNA 4C9DA 2BACA 3PYGA 2OD6A 3ZTQA 2QLWA 4I1TA 3NS5A 2YNFB 3J7ZT 1KDNA 2V34A 3C3LA 3F0NA 1HKAA 2CKWA 1S97A 2GVZB 2CADA 3PACA 4DPXA 3BM7A 4FKYA 4KPYA 1H2UX 5GAEI 3ZZPA 3V6DA 5F8MA 5B0DA 4X4RA 4HACA 1VBKA 2IBKA 3BSOA 3MMBA 1RT3A 1IKXB 1RHKB 5IT0A 2GGPA 3NEKA 4JI3J 2XMVA 3KLEA 3CB4A 3FDSA 4M94A 1LFWA 4ZLPA 4KQZA 2AP6A 3GYNA 4UY8T 3OL8A 1HD1A 4ED1A 1R27B 1RLCL 2QLXA 2COLA 3PFOA 1S6QB 2E7VA 3M30B 4NEYA 4DFMA 2CJBA 2G13A 4P52A 4DOZA 1RWXB 1BY9A 1KFSA 1VIOA 4F0HA 2XI2A 1M5VC 3T19A 3DMJA 5FLXY 3H2UB 4TNOA 4ZPBA 1NLKL 4YHHF 1NSPA 3B54A 2CQHA 4QW8A 1VQ6S 1D9AA 2P9EA 4J9LA 2GMHA 3FK4A 4RNOA 1LKZA 1U48A 3MM6A 3E2EA 1IKYB 2N82B 4PYAA 5HQ8A 2XLJA 5IFMA 2R8HA 3GR0A 4QYRA 1F60B 1RTDA 1HYSA 3N28A 4Q7AA 1FKOA 2KM8B 3A3NB 4DPOA 1M1GA 1UCNA 4LRBA 5K5MA 2DGOA 8RUCA 4X65F 1YRTA 1I94J 4DHVA 2JEIA 4BCAA 4FBTA 3LWMA 1ZZFA 1GTHA 4ZP9A 4JYAJ 1ROFA 1DTQB 1ITPA 4WKYA 4IG0B 4Z37A 3BSAA 4DX7A 1VBXA 3ISND 3MCNA 3SV4A 1URNA 1CEZA 3SBMA 4DR2F 4N8NA 3W9JA 3DOLA 2UU9F 1VRQC 4LF8J 4USTA 1PYSB 5SZTA 4KGKA 4TY8A 2FDNA 1HQUA 3IM9A 4RW9A 5J2NB 1O0PA 4K7QA 2H48B 1IKWB 1REVB 3HJFA 2L9WA 3I32A 1U1PA 4ZJOA 3POTA 4NRUA 1MN7A 2QN6B 4DUZJ 1HNVA 1FHTA 2Y1LB 2QIFA 3G6ES 3ISZA 2YKQA 1X4GA 1NKEA 2E9RX 4RNNA 4OYZA 4MTPA 3KUEA 4Y3CA 2DR9A 1JLBA 5I3QA 1DQ8A 2V2KA 1SXLA 3UDLA 4CH0S 3ENWA 1VQMS 5J1EA 3AXKA 2GS8A 3CDWA 3B8HA 2B6AB 2G9OA 2NXUA 1HQEB 2OEMA 3JAMU 3CJ0A 3DLLQ 5A8RB 5D4OA 4EBDA 3D28A 1H98A 4DCOB 3S7RA 4UW2A 3F56A 1KKHA 2BQRA 3VAJA 4KR0B 1QE1B 3FSXA 5HMYA 4N56A 4FVCA 4TLQA 4EZ6A 3QAUA 4QCLA 3KHHA 1MWYA 1KLMA 1TFWA 3U27A 1FX4A 1P6TA 1U09A 2DD8S 2Y8YA 2VPWB 1PYTA 2NSCA 3D5MA 3UQSA 4K5SA 3BSNA 4A8MP 1NDCA 2NUUG 1Q86T 4FS2A 3TA0A 2V4RA 2ALYB 3S8SA 2C2MB 1U7LA 5CAAA 5CYJA 3M2VB 1TL7B 3D6FB 3QMQA 2SXLA 4FXVA 1D1UA 4NCGA 1XJWB 4K4YA 3BKFA 5ETTA 2BA9A 3I82A 2BKOA 2ZOGA 2M5YA 2BABA 1UVKA 3HF5A 4UUWA 4ZVEA 3MMAB 4ED3A 2HK3A 1Z2LA 4OX8A 3PY8A 1NXIA 5L38A 4ZMMA 2FGCA 2YKPA 2IJNA 3IO1A 2CWXA 3CW2C 1S6PB 2CZ9A 5DZ6A 5KFNA 3K57A 3PRBA 4WBFA 4LF7F 3TI0A 1VQLS 3HZEA 3C14B 5KFMA 3DLHA 3KMQA 4KBIA 2WB1D 2HFUA 2DNPA 5J2QA 3S1TA 3EX7B 1RT5B 4ZS6A 3T9NA 4JI6F 3OFGA 5I3PA 4OYMA 2OPSA 3UVJA 3H5SA 2YQ3A 3F73A 2PEHA 1O51A 4WXOA 2DB1A 1GMWA 2VFSA 1D8YA 2LQ8A 1QVGR 4PKDB 1T9WA 3CJ2A 4C7QA 2J7KA 3FCVA 1TU0B 4KIAA 1RACB 5B08A 4KRWA 4EMDA 1YJTA 2WVCA 5E41A 1YITS 2H1YA 2BJ8A 3GPAA 4Q5VA 1FESA 1SC4B 4PWDA 2HS4A 3O6QA 4WCEQ 3K8VA 2YWGA 1NHVA 5T7LA 2UV8G 2OPPB 1E6YB 1V3RA 4HHJA 2QL9B 1R8CA 5KFOA 1DY3A 3KNAA 1FVSA 3P5TL 1JNRB 1JLQA 3M8YA 2KHDA 3BDPA 1M90T 3DRSB 2FJXA 1B64A 4QJVA 2FJDB 4B3OA 4HDGA 4AT1B 2D69A 4LR7A 4KO0B 3MM8A 3W2WB 2QEXS 3CJQA 1KBRA 5RUBA 3G8QA 3OLAA 2VBWA 1FI4A 3FFIB 3HHEA 2FJVA 4TQSA 3CMQA 4FYYB 2CQ4A 3IS9A 2F3JA 3RZAA 1LW0A 1RWNB 1U0HB 3FZBA 2KZMA 2J76E 3M1VA 2CPDA 2VD3A 1ZAWA 2I38A 5B0GA 5L1IA 4WP9A 1GXTA 1TV6A 4J9MA 4AQYJ 4HTIA 4Y00A 2D9OA 4JI2J 2C2RA 1T03A 2W7AA 2X3GA 4RNFA 5CZXA 3BQ0A 3CCVS 1S0OA 4BDPA 2DH9A 1ZAVA 2M4MA 2AGOA 2M9KA 5KFRA 1F6TA 2GW8A 4ZPDA 4XPEA 4H4KA 5IC4B 1RTIA 2YQ0A 2E9TA 3KK2A 2CAJA 6AT1B 2ACMA 2AJ1A 5C2GA 5D4NA 2J9EA 1QVFR 3UW1A 3ZZRA 1RT2A 2HVIA 1HNWJ 3BO4A 4ZPTR 5DJBA 2OHDA 4NMLA 3PW0A 4AMMA 4ZP6A 4ZOSA 4G6VB 3GU0A 3MURP 4P74A 3BYPA 1WACA 2W2QP 3LQVA 4JI8F 4R0JA 1SJQA 2M70A 4NLPA 3DM2B 3EXYA 4Z2XA 1RAOA 4KHMA 4HVZA 4ANDA 1RBAA 4YY3F 1YJRA 3HM9A 3OTEA 5AJ3F 1TMMA 2WVBA 2AGPA 1GNKA 4CO3A 4O23A 1K0VA 4IOCQ 2IC3A 4LF9F 2OPQB 3HLUA 3Q23A 3MM9B 4IR9A 4J9OA 2LA4A 5JXSA 2VQEF 5EUHA 1S9FA 2N4CA 2V8GA 3I6PA 2BVZA 5IM0B 2D3O1 1N32J 4OYBA 1BHNA 1Q5VA 2QTWA 4QWBA 2VIHA 4USVA 3D1HA 1YK9A 1JKHB 1OSCA 1GXUA 1EETB 2HAFA 2CPIA 3DXBA 4X4QA 4DQQA 2HYIB 4ZPAA 1HNXJ 2DHHA 1RYSA 3VAFA 1X5PA 2NZCA 2DHAA 2XG8A 3I96A 1FJ7A 1C1CB 2E1RA 2KRBA 3QZ8A 4DR3J 4DR5F 2FB0A 4ECWA 1R0BG 2GJIA 1TFYA 2C3YA 4PQUB 1OY6A 4B3RJ 2ZKTA 1V5IB 1JJ4A 2KKHA 4X4OA 1JXEA 4M5DA 1WOSA 4ES1A 3MR6A 2E1AA 2FY1A 3JSMA 2ZJQQ 1MROA 3R7SB 6FDRA 1KWMA 2WVDA 3L09A 3IP0A 3TJ8A 5EGYA 3BN4A 1LXNA 1XQIA 1P9QC 3OJUA 3GTYX 2Q79A 2CWKA 2LYVA 1UL3A 4NWBA 2DNGA 1VC5A 3UN2A 2V4QA 1S7IA 2VBZA 4LBHA 5B7WA 1WF1A 4DLGA 1YGYA 2ASYA 4DQSA 2F4VF 5FJ4A 3CD5A 4G3IA 1VHIA 1MLAA 4WF9Q 3RB4A 3LP2B 1ELOA 2XZDB 1TKXB 1EQ0A 1WNEA 3B4MA 2QX0A 3G4SS 4ZP7A 3IXQA 2R3VA 3JAMY 2ILZA 3QSYB 3D0GE 5AE1A 3B78A 3E01A 4J9VA 2HNZA 3BN7A 2BE7D 2HVEA 4M5GA 3TVKA 3CDBA 3HD2A 2AEFA 2RVJA 3LGHA 2DKOB 4JI0J 1S9GA 3GFZA 4LQ3A 2LXIA 1B70B 5FDLB 3D4JA 1IXKA 3QIDA 2F1FA 3MEDB 4MFBB 4A8XA 1UZHA 3NS6A 4XDCA 2HIYA 4BC9A 3MUVP 5I42A 2I5JA 2IDEA 2CYYA 3OLBA 5KFQA 2BOPA 3QSIA 5H1SV 5HANA 4P7TA 4C8NA 1F5CA 1U2FA 2K1RA 4RUHA 4FYDA 5EWFA 1JLEB 2W8KA 4MKAA 4WZQA 4E2FB 3M2UA 3GJSB 1HBUB 2NLWA 1OS5A 3KFWX 2IRUA 1FX2A 1PG5B 4Y2MA 1N5SA 2HEKA 3OR2A 2DXEA 4Y6IA 3C16A 1JLCA 1TZ0A 1KTQA 3D6HB 1H7XA 2KI2A 1TK5A 2F63A 2A6MA 1EB0A 4Q44A 1UJ4A 1V6HA 4K4ZA 1IKVA 1TKTA 1I6JA 2AYGA 1VQOS 2ABYA 4LSNB 2KO1A 2K7KA 5J1NA 3IGVA 4BC7A 2AHOB 2X1GA 3U02A 1DURA 3MM7B 3PFEA 3RTVA 1HHTP 3MZIA 3RU0A 3AB4B 2JH3A 3UR3C 1CQMA 4X4PA 2LLZA 2AGQA 1GH8A 2CQ1A 4WIIA 3RUBL 3ELHA 3BYRA 4JI6J 1P8GA 3KK3A 4RUAA 2HWHA 4EBCA 4FPRA 2MYFA 4Q0BB 1LWCA 1SPBP 4LF5J 1SC6A 6FD1A 3HHKA 1XR6A 1IUJA 1JNZB 4CT8A 2M88A 4LF4J 5AXNA 1KSPA 2UUCJ 1RT4B 1S6OA 3FNNA 3TUIC 2XGQA 1V5VA 3MXHP 5KTQA 3EJMA 3JQKA 2OTJS 4W98A 3KG1A 3OL6A 1VISA 2GHPA 4ZVSB 4USMA 5CD4A 1HI0P 2LEAA 3HHLD 4EO8A 4UOHA 1B7FA 1RWOB 2LA6A 4MIBA 3NGUA 4GMKA 4UOCA 1FEEA 2H4WB 2YNHA 4Y65A 3FEYB 4ITSA 4TYBA 2RU3A 1T05B 3OR1B 4ELUA 3BQ1A 4ICLB 2PDAA 2EFVA 2UVVA 1AW0A 3GIJA 2DY1A 1QAIA 3CTRA 5KFGA 1VQPS 3EXCX 4HI2A 5AT1B 3DLEB 1OYDA 3FC9A 2V2QA 1WTFA 4QIEA 2HHUA 2JDJA 5A8KB 1MU2B 2ZUGA 2CQCA 2XY6A 5HBMB 2CQ3A 3EDRB 1T3OA 4DR1J 1J5EF 5I3UB 2CNNB 1CS4B 4I7FB 2YPZA 2WZ1A 4C11B 4R5PA 2I6WA 4FP9A 4NE9C 1NJZA 1IJFB 2IIHA 1SC1B 2CNKB 1ZBTA 3N4WA 3U1LA 5GAHU 3VR1A 1U6ZA 1V9OA 1WHYA 3MR2A 3NCRA 2NSBA 4A47A 3H2VE 2DNHA 3MHYA 1SKWA 4DPYA 1U24A 4S0MA 2MGZB 4H4OA 5DQIA 3NBPA 5LMUF 4FS1A 2Y1IA 5KG5A 2ROPA 2RF2B 2OSRA 2C2OB 2UVRA 1N34F 1X7VA 5A8WB 4CLKA 5M2UA 1MSWD 2OELA 3PVXA 1PO6A 1VJWA 5G4DA 3S6EA 2J5AA 4CM2A 2RHSB 1Q5YA 4M5NA 5D3GB 2FUG9 2ZE2B 4XTTA 1YRXA 2KL8A 3W5YA 1JX4A 2PO4A 4B9VA 1SIZA 4OJHA 4DV7F 3KLHA 2M8DB 4DPUA 2BYCA 5D4PA 4CLYA 5HQLA 1NK6A 1J27A 4DV5F 3N5BA 2E5JA 2JL9A 1KP6A 2NXJA 2PT0A 2YKNA 1WF2A 2YKMA 2B5JB 4KE5A 3JSYA 3OBIA 5HK4A 2J9CA 5EX3A 5KFSA 2M8HA 2MEWA 3T5JA 4NYOA 1FDNA 4R8UB 1VQ8S 2PE8A 3B4DA 1CVJA 4B3SJ 3K5MA 2RB7A 3J81U 1R8BA 3DLGB 3SXLA 3CD0A 4LFAF 1JLFB 1JK9B 2HRUA 2RU9A 1UWBB 4LVOP 3O44A 2VZ8A 2LDYA 3RB3A 4LSLA 4DV0J 4BHQA 3TARA 2E5GA 2YWEA 2JZ5A 4A8YA 1S1TA 4K2XA 3ET6A 3DFEA 3LGMA 4L76A 3CCUS 1RA7A 2ZDOA 4WWSA 3C19A 4ER8A 2HBYB 1S4FA 1KN6A 4NXNF 1ZM9A 3W63A 4E98A 3OFEA 2F9JA 1SH3A 3UO0A 1RT1A 1KQGB 2K7JA 2D3UA 4U8VA 1SUQB 4HTJA 3AFGA 3UCZP 3C46A 5CZDA 2EFGA 7FD1A 2W9CA 1MWZA 1R8HA 2L08A 3OTDA 1YIJS 3L9ZA 2EC2A 2F8EX 3SIPB 1FWPA 3IA0A 1IM6A 3I0SA 3IWLA 1FJEB 3CDEA 4KHPF 2CG4A 1K0TA 2V2VA 1K1SA 4PG5A 3G96A 2OMOA 1SL0A 1RK8A 4YDDB 3Q8SB 2YWFA 3OJSA 3WQPA 2C2NA 2DNYA 2OI2A 1URRA 4K8RA 2ZHBA 2FHJD 3DLKB 5IOLA 1S79A 1NJXA 3BBCA 1LK7A 2CQIA 2W9BA 4JI7J 2A6OA 2E7XA 1RHMB 3ETMA 3LP0B 2DR7A 4NA1A 4DQRA 1L3KA 1AZSA 3PR4A 1RQ0A 2MKSA 3H0PA 2WVFA 4FZVA 1QSYA 2ZBCA 3J81j 3KK1A 4RWWA 2ZUAA 4CLUA 3U1NA 1UJ5A 1LWFA 1DLOA 1RCOB 3KHLA 1FK9A 2XHCA 1T95A 1W2IA 2FQQB 1T11A 1WEYA 1DZ5A 3MEEB 5DG9A 2Q6BA 2YXLA 3FEZA 1SQFA 2QLBB 2XSJB 4L3NA 1PIEA 3ZZUA 1OPZA 1S59A 3CJKA 3EGVA 3ILIA 3QZ7A 5M2RA 4DU7A 2J8AA 4P2FA 3A8EA 4M1KA 5F8HA 1OQ3A 5EX0A 3I56S 5E33A 5K14B 3GIRA 5E0OA 2YKOA 4EYHB 2AKWB 2UXBJ 3IR6B 3T1HF 4NLRA 4OFZA 4ID5B 4P9SA 1N0VC 1TKZA 1A9NB 3US5A 2R2SA 1NK4A 2DNRA 3ICLA 3FVYA 4GO5X 4MKYA 1F2GA 1Y3KA 1Q81T 1VFJA 2XS7A 3DKDA 3PEJA 2MZ1A 5KG1A 1CG2A 1N48A 1U1MA 3BB5A 4IQMA 3BSCA 3H4BA 2V8VA 1A6LA 2MKYA 2YNIB 2W24A 3I5CA 1S99A 4V19X 3OTBA 2CA9A 1WJ9A 2HHPA 1X9SA 3THPA 1VRUB 3NG8A 4YMEA 2VFTA 1FNXH 4DV4J 3T5KA 1HBNB 1C0TA 5DETA 4IDKB 1VQKS 1BQNA 4QIFA 1Y10A 3MAAA 1PGZA 2LQ9A 3CF5Q 4PXBA 1YJ7A 1NJIT 1NPRA 4YB7A 3EVOA 3VV2B 1HR0J 3OVSA 3L7UA 2ALZA 1HFEL 4X64F 3CCLS 3MAQA 2Y9HA 2QYCA 2RMLA 3MGJA 2LP4A 3KUHA 4JB8B 2VODA 1X5OA 2RRNA 3BKTA 2QZ8A 3J7AN 2QA4G 5C24B 4WFNQ 1RAIB 2CIMA 4DZDA 2BOAA 1K73T 3DU5A 4CIOA 3H42A 2KRRA 2MZRA 4WE1B 1AT1B 2CQDA 3M30A 3FRYA 2MB0B 5GADI 3FMWA 2HHSA 1S57A 4DV2F 4IO9Q 2VZ9A 2HWIA 3HXMA 4QYZJ 4QR2A 2OSQA 2EWHA 1OQ6A 5CCMA 2M0GB 1OSDA 5C25A 2NYHA 4ZHRB 1U1RA 5JVHQ 5EWGA 4CNYA 4YR2A 4ZPCA 3OTOJ 3VGSA 5HROB 2FC9A 3R97A 3O1LA 2CVIA 2ROEA 2WHOA 3VAKA 3DLBA 2ZZTA 1RKIA 4ATNA 1KS2A 3Q0AA 3FZ2A 3QO9B 3PTWA 1WC1A 4GO7X 1RXOB 2L3MA 5K9FA 2IBOA 2IJRA 1T02A 4I2QB 2R8KA 4QWCA 4KV8B 4GC6A 3J7YI 2AU0A 3AJ1A 2HFOA 1DTQA 3WHIA 1GTEA 4IG0A 4DX6A 4U8YA 3TZXA 3D0HE 4DV7J 1I5OB 1D0EA 1FWLA 2VG5B 5G0RA 4AL7A 4P71A 3GCWP 3DHWC 2EI5A 4CO0A 5A0YA 2IAJA 1OO0B 1NSKL 1S1XB 3LPYA 5BR8F 4LFCJ 1GXLA 4CO5A 4N76A 1F1BB 1OJ4A 1S1UB 1UWAA 4E0DA 1QLNA 2DGXA 3J81Y 5ETQA 3SFGA 4URSA 1REVA 2QV6A 3QLHB 4I6AA 5BXIA 3W9HA 2O01C 3PJ9A 2X51A 2FJEB 1RAGB 5U47A 2HVHA 3AOBA 3GIKA 5B0FA 5KFKA 3FKBA 2DPIA 2GX8A 4DEZA 4KFBA 3RAXA 5ETPA 1EP4A 3LH2S 1ZPWX 4YP3A 4CNZA 1V3SA 1XMOF 5ADZA 3NNAA 1RT6B 2VPZB 3CC2S 2RILA 4OYIA 4C0OC 2PFFB 3RRKA 3M8RA 5DDRC 1QTNB 1UZDA 2ZD1B 2D41A 2B6AA 2JVRA 4QU6A 1HQEA 3L7PA 3LP1A 3C6UA 2HNYB 1T3NA 4PYDA 3Q8PB 3C2PA 2JJ4D 3BGOP 4J9KA 1IBLJ 1WC6A 2PEBA 3AODA 4LF1A 4C48A 4HH0A 4EI2A 4O44A 2DRAA 2VJUA 1FNMA 2RDJA 4LREA 2FJAB 2NCKL 5HL7Q 1WI6A 4IYQA 1RT7B 3CMAS 1WHXA 2C3PA 1R0AB 1NPKA 5IWAJ 1SJ4P 1RWVB 4BWJA 3MMCB 1DHMA 4OJGA 4OZLA 1VHFA 2ZH5A 1IBMJ 1CC8A 4EYIB 1QAYA 1JWWA 5CZVA 2HFZA 3DYAB 2CZ4A 1U2RA 3DRRA 2D3OR 3M2VA 4ECUA 3V2UC 2BEFA 1MMLA 2IMOA 2XLKA 4OI1A 2Z2ZA 4LF6J 4U9RA 3M9MB 2EBGA 2XYHB 1JJ2R 3FJ2A 1RYRA 5KT3A 2R8JA 1UJ6A 3I0RB 2VG6B 4YQWA 2OPRB 4OX7A 5A2QU 1WOOA 3NGSA 2PA8D 4NZ7A 1WEZA 2V6AA 3W2VA 1KRPA 2Q43A 3RB6A 3DI6B 2AYMA 4C8MA 4PQAA 4DV3F 2V67A 2LU1A 4DX8H 2BKPA 3V5RA 2YNGB 3TX8A 3PHEA 3VVTA 1SBRA 1A0OB 2P8IA 2EG2A 3QIPB 4B9SA 1XEZA 2QC3A 3P49B 3LA0A 3IN5A 1RJJA 3JQMA 1H73A 1VK8A 4GKJF 3M6WA 2DPJA 1YZ6A 1APSA 3EWGA 3ZNJ1 1TQLA 2MKJA 5K8NA 2W4DA 3RR8A 1YJ9S 2I8EA 2BM1A 2P5VA 1I51B 3DGPB 4WP3A 2DBBA 4RW8A 3FCWA 3EDQB 2XZTB 1VBYA 1EX8A 1F5BA 3NGTA 5HQMA 5KT7A 4QPTA 1T8EA 4L73A 3RBDA 3CUNA 1M1HA 2RDIA 4JV0A 2MY7A 3IAS9 3GILA 4ED0A 1SJ1A 2MKIA 1JMTA 4YR0A 2ZH1A 1FT8A 2ZH7A 2JLEA 1NNDA 2B9XA 4D3GA 3IGNA 5IZHA 1G6BA 2IVMA 1U1OA 4NOHA 2VQFF 1F5AA 2HNDB 2JLGA 3UN3A 4NLXA 2FLNA 1S12A 2Q6CA 2H4YB 1FTRA 1X0PA 3X1LB 1Q95G 3OL9A 4I64A 5DQHA 1U0HA 3QJLA 5DZ7A 4DCPB 2J7WA 3B82A 5DRKA 1B99A 1NB7A 1VRTB 2XYGB 4ZP8A 1N56A 4MJKA 2HGNA 1CJKB 2CNLB 1S72S 2GC8A 1C4AA 3ILOA 3UNGC 1TK8A 2EFQA 2FVCA 1MNEA 4H4KC 2VFVA 3PV8A 2NPFA 5D0RA 5F0WA 3PRVA 1FRKA 2HHQA 4C97A 5D77A 4WFAQ 1IQZA 3BR8A 3N6NA 3H59A 3V6DB 3R2DJ 2DXFA 5KOXA 3FCHA 2E5LF 4HACB 2LU2A 3G86A 4I4BA 2DCLA 3MMBB 3TQ1A 1WG4A 3U1MA 3OL7A 1QM9A 2Z58B 1RT3B 4UQGA 4ED6A 1YDLA 3PIOQ 4N7TA 4DSFA 3AD9C 3OT9A 2RKIA 2FPHX 3KLEB 5GVQA 3VVUA 3CJRA 3I55S 4WFBQ 4CTAA 4ECTA 7FDRA 3G87A 2HURA 3CJ5A 1KEKA 3T5LA 4NLQA 3DHXA 2OPQA 2VL1A 3MM9A 4A8QA 5K8OA 4QWEA 4IH5A 1KLNA 2V8HA 3JTPA 5CZCA 3UR0A 3DMJB 2YY3A 1LWEA 2CVEA 3QGPA 4DFJA 3EMTA 1DBDA 2EW9A 2AW0A 4A8WA 1CC7A 1XC9A 2VA2A 1VR6A 1C4CA 4OHVA 1QDUB 3H98A 4WYWA 4C8OA 1SH0A 4OHYA 1Y5LB 4FXWA 4FYWB 2AV5A 2DGWA 2QL7B 4X66F 3MM6B 1SIWB 4IFVA 4QZVB 2ZH9A 2FHMA 4DF4A 4F02A 2NXNA 3KJQB 2JLFA 1Q7YT 1N5YA 2VONA 4UTGA 2JSXA 3M9NB 4F4ZA 3AH6A 5ETSA 2B4PA 2HAIA 2ADBA 1RTDB 1HYSB 2HQFA 1AA1B 2N4DA 5KFWA 5H9FJ 1RWUA 2MY8A 3HT3A 1KFDA 1B7YB 1YJUA 1HW8A 4Y2AA 4AMPA 3CVKA 3M2RB 1ICEB 4C6AA 2AJQA 1UP1A 1T9UA 3X3UA 4XPCA 2XMAA 2HS0A 2E29A 1WC4A 4ZCMA 4MIWA 2MXYA 2VICA 1HWKA 2DHSA 3UD4P 2KJWA 5J2PA 3DOLB 5GAEU 4DSEA 4OZJA 4B9MA 1VQ4S 1QAJA 1HQUB 2HQ3A 2KXFA 3R1LA 4RW9B 4C98A 4KGZB 2YWKA 5EDWA 5CYQB 3TJAA 3R5BA 4XIUA 4GKKF 2Z30B 1XIQA 3DRYA 1XBWA 2F8HA 2MJUA 3OXLA 4O0IA 5LMNJ 4JI1J 1K8AT 4K4WA 2QLJB 2GHVC 1N33J 4LFBJ 4DUYF 2A3JA 1S4EA 5KFVA 2QFIA 3IRXA 3HP6A 2BJ7A 3FSIA 1HNVB 2WONA 2GA7A 5DGAA 3CPWR 1BD6A 4Y34A 4ZN3A 5EN1A 1PJ6A 3HHNB 3H5XA 4N8OA 3QRPA 4RW4A 2DGUA 1WG1A 1JLBB 4J5OA 2IM1A 5A6WA 2HHHJ 4EFAC 5JVGQ 1AUSL 4NEZA 1DFDA 5KFBA 5J1EB 2YVSA 1ZS6A 4J7CA 3W62A 3O5TB 4YDXA 2DR6A 4PUOB 4ANEA 3SYZA 3Q8UA 2PMWA 3HSJA 2Z0GA 1HBUA 3EE3A 1EQMA 1JXVA 5A2QY 2H51B 2O3DA 4CO2A 2RHQB 3GJQB 5KFZA 5LSOA 1WUUA 4OZ0A 4DR7F 4WJBA 1QSSA 2FVSA 4LIWA 4DL6A 2ZH6A 1KLMB 2VDHA 3CIMA 3PDNA 4DL5A 2JC0A 1Y3JA 1OPIA 3UPFA 1YBAA 2ZEJA 3JSRA 1YBUA 3ZZ0A 2QSWA 4J9NA 3OPKA 5DDOC 3FBEA 4CO4A 3SSQA 2JEFA 3C15A 1NM2A 4F2RA 3GJTB 4CZCA 1VQYA 4RNHA 3PKMA 2ZDPA 2C3OA 3PW4A 2NPIA 2VU5A 3BR9A 2R4FA 5E7OB 1U47A 2MZJA 4NCGB 4CH1A 2GQ2A 1UVJA 4JV5F 3GFXA 3HJVA 3T5HA 5HJXA 3PO5A 4B3MF 2P6TA 4IH7A 4K4SA 3AA9A 2GMLA 3Q2SC 4DPWA 2OUGA 2C2KB 5HAOA 3CDUA 2RS8A 3QGHA 3I9ZA 4L74A 3KLGA 3PX6A 3GV7B 2RRBA 5E3AA 1B0VA 4PPZA 1Q1KA 2OGUA 2DR8A 1JLGA 4OYAA 2E66A 4OJ3A 1ZPVA 2DNQA 3T1YF 2XTJP 1LW2A 4K4TA 3KUGA 3RAQA 1L3UA 1WKLA 4ZKAA 2OPSB 3UVJB 2AX1A 1WF0A 1TTHB 1YTYA 1GK8A 1UTAA 1S49A 2DJWA 4NXMJ 2WBRA 2AIRB 3MPYA 4X62J 2C2EA 5C42A 4I0WA 3O3LA 4NLVA 2E5IA 2K3KA 3PCOB 1IWGA 3NNHA 2Q1LA 1S1WA 2XBPA 4OX9J 2HHWA 1TMJA 1YQHA 2DGTA 5HMXA 4QR1A 5HLFA 4WXWA 1M5OC 1YLXA 3OQ2A 4ZPVR 5CYMA 3R7NB 2FVRA 1VJQA 3NOCA 1YI2S 1NH8A 2ZBQA 4NPOA 1FKAF 2CUYA 3P6YC 1EJ7L 4CLTA 1ZTTA 2QE5A 3DRXA 2MZSA 4Y0FA 2XS5A 1VQ9S 1JLQB 5KT2A 2IM2A 2KTQA 3HO1A 3N6MA 1F2HA 1VS3A 1Q82T 3NCPA 2XYPB 2XNQA 4DG1B 4YS2A 1PILA 2MJNA 1XMBA 2CPZA 1HA1A 4B3OB 4A4JA 3IG1B 1K9MT 1HLWA 4CH7A 1RZMA 2RF2A 3DC2A 3U7JA 3QPIA 2N3LA 4ALZA 3WX4A 2UUAJ 4DR6J 1LW0B 4G65A 2AQ4A 3M1VB 1CJTA 1X4AA 2EKNA 1Q79A 2YX7A 2UUBF 1WDTA 3EGWB 1TV6B 4K4UA 4JI4J 5IXUA 3TNVA 1VOMA 2GIFA 1FTCA 3TW0A 3ZC4A 4UQTA 4WK1A 4PXCA 2AYBA 1HNIA 2UXDF 4ED8A 2E44A 5KFEA 4HKQA 2R8GA 4I2PA 2E1PA 3QWPA 3ZTPA 4BWMA 5C5JA 2J0WA 1RTIB 3OV7A 3KK2B 5E5NA 3QGIA 4DR4F 3EZ5A 2J9DE 1FD2A 1ZM2A 2VG7A 2AYEA 2ZOMA 4RW7B 4R8UA 2BANA 4AL6A 1U1NA 2DRDA 1WKKA 1ZETA 1Q8KA 3WC0A 3MMJA 4WIQA 1NDLA 2ADCA 1IR2A 2X1FA 5KFPA 1T9VA 1UWBA 5E3QA 2MQOA 3GJRB 1NHKL 1EAYC 3J80U 1NPPA 4J9RA 1TUWA 5MLCV 3KJVA 1SH2A 3W64A 4QQBA 2E9ZA 5DDQC 3DN9A 1VYAA 5E3PA 5A76A 2V0NA 3D6TB 2A1BA 4PCQA 1E6VA 2UXCF 3OD2A 2D7SA 1SKRA 2IC3B 2BW7A 3NAHA 4CRJA 1W7WA 2ZH3A 2VOPA 1FRXA 1SUQA 3AQOA 3M8WA 5LXYA 2NXCA 4CT9A 3L95X 3CCMS 4W4MA 2WSEC 1HMVA 4ECSA 3PX4A 4NRTA 3ZXWA 4B3TF 2GVDA 4ECVA 1X31C 2R8IA 4O0NA 2B4OA 2FZCB 3G82A 1PJ7A 4O3PA 4GVBA 4F3MA 2JRSA 3SFUA 5ETMA 2GHWA 3MM5A 4PRFA 3TOQA 1C1BA 1NB2A 3TR5A 4NYPA 3NLCA 4KB7A 4M5DB 2DITA 2BV3A 1PAUB 2W9AA 1SV5B 3JSMB 1YX2A 4TXSA 3W60A 4H4MA 1MROB 2B43A 3CGIA 5F0UA 5GAGU 8ATCB 3EGNA 3NCQA 4WK3A 1V3ZA 1TR0A 2R7SA 2ZC4A 1VGYA 2F9DA 4B9TA 4DV1F 4ILRA 5IT4A 4WU3A 3K5NA 1Q53A 2LXFA 3GIMA 1BQMB 2Z56B 3CEDA 2FC8A 3EYZA 1XNQF 4ECXA 3AT1B 4G1PA 4AMNA 2WB4A 5F9NA 4DI6A 2VC1A 1XNRF 1ULRA 3HVRA 1XMQF 1IBKF 2NXEA 5EHHA 3H4DA 3VZHA 4EWTA 4NLTA 3MAHA 2KXNB 2PSZA 4YB1P 1SVDA 3DLJA 3V4IB 2C2DA 2B51A 2HLTA 4P73A 3GYGA 3MEEA 3PX0A 4CLSA 5IT9Y 4FXDA 1PCAA 2V4JA 3E01B 5ETVA 4LUBA 1FJGJ 1K1QA 2AJ0A 3DDKA 1GT8A 1Q8LA 4DZ6A 4N41A 3GV5B 4IR1A 3NWRA 3RBXA 2CJKA 5DM6Q 1B0TA 2Y1RI 3OSPA 2JWNA 4M5KA 2XY7A 4BLGA 3SCLE 2KG0A 5K14A 2Y3YA 2QT7A 2KVQE 5I42B 2C1EB 1Y4ZB 4EZ9A 1NKBA 1OY8A 3FBBA 2XQCA 2AEJA 3BGRB 5FD1A 1F9HA 3IBWA 5L1KA 2ZH2A 2K1RB 3F41A 3CJ4A 3DNCA 2MQ8A 1WC0A 4M5MA 2OEJA 3LANA 2G1HA 3JTOA 3M2UB 3CCWA 5KFXA 4LQ9A 1YHQS 4Z7CA 2WAQD 2R7OA 2VFUA 4ES3A 4HT5A 4B3MJ 3C16B 1JLCB 2B7CB 2YNIA 2WCXA 1FF2A 2QMXA 1BMQB 1CJUB 1BQXA 3MEGA 3FGVA 1P9YA 2R2UA 1X4CA 3DOKA 1HPZB 1HNZF 2VF3A 2HBZB 3TVZA 2XGPA 2CJYB 2KT3A 2CFXA 2VBXA 2R7UA 3MWBA 3WIUA 2GIQA 1R89A 2J6TA 3MFHA 3M4XA 2CQBA 3NWGA 2NQPA 1RTJA 3VAIA 1OY9A 1TAUA 2BW2A 3ZNUA 1LWCB 2LEBA 4ZVFA 3SSSA 4RUCA 1D8ZA 2NS1B 2OAUA 5MAOA 4TU8A 3V6JA 2AMCB 3G6XA 4HHUA 2XMKA 1VLOA 4OL8A 4ZCLA 3K8WA 2CQ0A 3RBZA 3W65A 1DTTA 1Q8BA 3HFVA 2JOQA 1FVQA 1FDAA 4DS5A 4KGXB 1UAWA 1U8WA 3BS9A 2VASA 5C2CA 2YNHB 4G1IA 3N6LA 1RADB 3G8TA 1NMEB 4ZVOB 4ZHRA 5GMEA 1S9EB 3BO2A 3JXOA 1RISA 2V9WA 5BJRA 3C6TA 4EO6A 2FLLA 3OFHA 4JI3F 2XCPA 2XWXA 4ZVGA 3M32B 3N5FA 4ECYA 3UN5A 2HG4A 2HBRB 1N36F 4AMOA 1HQ2A 4OV1A 1WSRA 2MTLA 1U25A 1NKCA 2VFRA 2EK6A 1GX6A 2BJ1A 3R27A 5KG3A 1NZAA 5KFFA 5KFHA 2DNZA 5DS7A 3G8SA 2X1AA 3GFHA 5KG6A 5CA5A 1OIAA 5FLXU 2RQKA 4R5PB 4YHHJ 3OXGA 2VG5A 8AT1B 2XS2A 3AOCA 3FQLA 3D7SB 3OW2R 3NOGA 1VC6A 5LM7E 3T9ZA 3PO4A 1O5JA 4H4OB 3SMZA 5ETOA 1KHWA 4DR4J 4LRDA 4AYBD 2ZKUA 3N0VA 1WTBA 4QBUA 2HQIA 2YWWA 4P2MA 2HGMA 2W01A 3HVTA 1S48A 3GIIA 1KQSR 1SJ3P 4MMOA 4NYZA 1HHQA 3KLFB 2KVIA 3J80Y 2LDIA 4UF4A 1I94F 3KOAA 1QY7A 1KONA 5KT4A 4O3NA 5F41A 2J8SA 4JYAF 4OHZA 2EFPA 2XNRA 5LJ5Y 1SKSA 1PJ5A 4X65J 4TU9A 4IFYA 4ED2A 3KLHB 4URGA 4LJMA 3F44A 2UXCJ 1O6XA 2VDIA 3A1YG 3CT9A 2YKNB 4KGVB 2YKMB 1NK8A 4LF8F 1VBZA 2AZ3A 1LXJA 4PPDA 5KT6A 1RHRB 3FBFA 1T94A 2FD2A 4DR2J 2JHEA 2UU9J 3V6KA 2LECA 2ZBRA 5HJYA 5M2PA 5A6PA 4MH8A 3T1AA 3RW6A 2OEKA 4LF2A 4DUZF 1VMBA 1YJNS 4FVMA 4ZJQA 3KDNA 1T9TA 4LSLB 5HVGA 3JYTA 5HP1B 5L39A 5D6GA 1M5PC 4YN3B 2EEYA 1S1TB 2ZZMA 4LBIA 4OLPA 3VGTA 4WTOB 4PXEA 3R6GB 1RT7A 4KH0B 1R0AA 4PWWA 1RT1B 1C2PA 1X4EA 3MMCA 4XAKA 3TUPA 1XN9A 4LRCA 1RU2A 2M52A 2JEGA 1GX5A 2HIQA 1UW4A 1L3SA 1FE0A 4F26A 2EBEA 4DV1J 2MQNA 1U45A 4PG7A 2W9CB 1PSDA 2IM3A 1WHVA 3Q89A 1RU1A 3W8PA 2L41A 4OYOA 1X60A 2Z4PA 2DHXA 4K0KF 3VAHA 1CBKA 3K7RA 2OPRA 1SL1A 2APOA 4ECZA 3DU6A 1FCAA 3VWSA 2PI4A 4ED5A 4CWBA 4HH1A 3W9IA 3QQCD 1VDHA 3ILJA 3SZ2A 3KWMA 2CPFA 4OI2A 3DI6A 1TL3A 2W9BB 1R7IA 4ZPWR 4LR8A 2GO8A 3HHLA 3HPOA 4Q2MA 4FF1A 3CSKA 4UT4A 2MLYA 4F8RA 3GG0A 3BEGB 1FKPB 2DGSA 2XO7A 2J9DA 4PG6A 3RR7A 5SUHA 2DO4A 4AE5A 2X1BA 4ZVRB 1N4LA 3PIPQ 3KK1B 5KFLA 2KFYA 4P72A 4TQRA 1LWFB 1DLOB 1ACMB 4DLEA 1JXLA 3GONA 3M6XA 1WELA 2BJEA 2FY8A 3HFZB 1AUDA 2ZH4A 1N6QA 4DSLA 2DISA 3EVMA 4Y2KA 1RA6A 3DRPA 3SDEA 3ITHA 2R2TA 4K59A 4DSIA 1ZTWA 2HBQB 1X4BA 2XMTA 1PKUA 2DEJA 4A8FA 2C2ZB 2OTLS 1RSCA 4O3OA 1XWLA 2J0SD 2YWHA 4LF7J 3K0JA 4CLLA 1SL2A 1X0FA 4ECRA 4ZVTB 2G4BA 3KLVA 1XK8A 5CQGA 2KFZA 4IG3B 1OWXA 4JP8A 3UNYA 2JFKA 2R7VA 1OYEA 4RZRA 1RWMB 4V1Ak 2XI3A 1TKZB 2HMIA 2MQQA 4J9UE 2WOMA 3K5PA 5KG7A 2GAGC 2RRAA 2RUGA 3QWUA 3CNQP 1AYEA 4W90B 2MQMA 5KFTA 1U0SA 3RJMB 3SQGA 1HBMB 1QUPA 2HK2A 3AJDA 2Z8QA 1T9XA 2CPEA 2IA0A 2POKA 1Y11A 1QJHA 4TU7A 1KC8T 3UE2A 2BKNA 2QA4S 2Q66A 2W8LA 1CJVA 3MTKA 3D3CJ 2G0CA 1JIHA 1VI7A 1DAXA 4Y2CA 1C0TB 3AB2B 3AY0A 2KT5A 1BQNB 2FVQA 1LNQA 1K44A 2YH0A 2C22A 1RI7A 3KG4A 3MAAB 2HHVA 4DL3A 4HL9A 3NAIA 4FNIA 5HATA 3JB9k 4DMZA 3V6HA 3MDFA 1AB8A 1BLUA 3HVAA 2OJ3A 1RTHA 3C66A 2OO4A 3GSDA 3TAMA 1T9YA 3NMRA 4ZIWA 2A2DA 5LSRA 3LO3A 4F4AA 4AQYF 1VQ7S 4JI5F 2F5GA 4JI2F 3GSIA 1XTZA 1N36J 2RIJA 3SCJE 2OMLA 3AJ2A 3T41A 3P3DA 2OKQA 3LF0A 1T7PA 1NCLA 3TZWA 1NU4A 2U1AA 3H20A 3IRWP 3OVBA 1UVLA 2KDOA 5J2MA 2IDLA 4I69A 1FE4A 2GMJA 4NLYA 1S0NA 1RDRA 1HNWF 1TVRB 4RW6A 3R2CJ 5C25B 3ENVA 2FJBB 4ELVA 3G2XA 3ZTRA 2KU7A 3CXCR 2CJXB 1IBCB 1BE4A 4QWDA 2J0QD 3A8IA 1KQFB 5GMDA 4DN9A 2FHJA 4JI8J 2RQ4A 1NEEA 3IWXA 2AZ1A 4QPXA 4YY3J 4DSKA 5AJ3J 2HRYA 1F9EB 4OHXA 1N32F 3M2RA 4LF9J 3LPEA 3VZIA 1UEKA 2VQEJ 5L1JA 4PG4A 3IC1A 3M8PA 3PKYA 1P1LA 2B8PA 5G0RB 5F9LA 1HNXF 1X5SA 4F4KA 2B7BB 4TYAA 5A0YB 2IAJB 4DR3F 2UUTA 2ZBPA 3FBCA 4I68A 3UWTA 4Q2LA 5H9FK 2RQMA 4DU8A 1HI8A 1UA0A 4B3RF 2BM0A 4AL5A 3AHPA 2QJ3A 5CYQA 5KT5A 2OIHA 2BBEA 1PBUA 1U2CA 4FBUA 4DR5J 4X4VA 3R7BB 2OH2A 3NKYA 2F40A 1R8AA 1TL1B 3KYLA 4EBEA 2DVIA 2XC9A 1X5TA 2JFDA 3QFHA 3O8WA 3TO8A 2BR0A 1TL4A 4J91A 4KFBB 1QSLA 4MYTA 2H54B 4KGMA 1EP4B 1U4BA 1U8SA 2QYGA 1C0UB 2F65A 2AT1B 4USHA 5L9NA 1G1XA 4FF4A 2J0XA 5GADU 5KFDA 3UDCA 2WRMA 2XY5A 1B0PA 1I1GA 4ZVQB 5E2QA 5LL6d 2F4VJ 2LQ5A 1GFWB 2V50A 4U7UD 3H2LA 3QFWA 1S1VA 1H74A 1N88A 2EKYA 4CLFA 4PUOA 2PIIA 1LV5A 4AUKA 3LP1B 3C6UB 4OZ1A 1REGX 2DGQA 1J5OA 4ZK7M 2BJ9A 3CCQS 4K0KJ 2C42A 4JI0F 4TKTA 3O2IA 3M8QB 2WK4A 4U6PA 3GE9A 4ETZA 4O44B 3GP9A 1UEUA 3MUMP 1D3WA 1FWKA 3MFIA 2DEIA 2XMUA 1YKWA 5IQQA 1RLDA 4ED4A 3OHAA 4TY9A 3R5GA 2K3IA 2PMZD 3TA1A 4CLPA 5B0BA 3OFFA 3PG9A 2CG8A 2ACYA 4EUVA 4FDFA 4B08A 4ZLJA 5JJBA 2XM3A 3P5BP 4O4GA 3THTA 3LUYA 3DOMA 2ASDA 1R3NA 3J7YU 1FDBA 4RBUA 2XZWA 1NH7A 2EXUA 4CLZA 3DRRB 3W3SA 2HRTA 4ECQA 1J2VA 3CCTA 5K20B 4NI2A 1FNOA 1JLAA 2W2PP 2EFNA 4O3QA 4P75A 2CXEA 3CJTA 2J7UA 3E51A 3W8GA 3M8ZA 1WD6A 4G1QA 2H5IB 4IUFA 1NHUA 2R7QA 2YKAA 3CDAA 3KLIB 4F36A 1W26A 3BPSP 4KYZA 1NK7A 2R7WA 3W2VB 4ES2A 4USKA 3MECA 3Q22A 3HULA 4U95A 3G9CA 4IRCA 4Z7YA 4A46A 3MOZA 4LVNP 2Z2YB 3H40A 3PJWA 4LT6A 4R25A 2HZAA 3CJ8A 3TWZA 2RS2A 4LF5F 4ZITA 4OI0A 1S6UA 5T41A 2DYAA 2V5HG 1IM4A 3HK2A 3AD7C 3A8JA 1G7CB 1GAOA 4LF4F 2KJVA 1R0CB 5DDPC 1RWWB 2UUCF 1MG7A 4RW8B 4HR2A 1M5SA 3BBFA 3JTNA 2OFHX 4ZIVA 2MQLA 2YNFA 2IPOB 3H7HB 3HSDA 2W2OP 2MLXA 3KJNB 2XEXA 3ISNC 2BX6A 2MDAA 2GVZA 4ENOA 3Q8YA 4F4XA 3RAMA 4KAIA 2BE2B 1O8BA 2ZC3A 4C3KA 2B4VA 1NDPA 4OI4A 4ZJLA 1UFWA 1WC3A 3BJYA 4DG1A 2HHXA 1IKXA 1SQGA 3V81B 1MN9A 2N7CA 4MKBA 3IG1A 3PW7A 1BWEA 3A8KA 2DGVA 2VKRA 4N77A 3SCKE 2VKZG 3T6BA 1ZA1B 4FYVB 2Y0SD 1SJFA 2DNLA 2DY9A 4DUTA 5GAGI 2IRXA 4ZVPB 2K06A 1FFWB 3PW5A 1M1KT 5KAKA 2B9WA 1U6FA 1S6QA 1EZZB 3BBBA 4EGLA 4DR1F 4C2MA 3CC4S 2UP1A 4OHWA 3MPDA 2KN4A 4JI5J 2NREA 2GV1A 4DQPA 4GRSA 3HI9A 1BC6A 1J5EJ 2XMJA 3BQ2A 1KVJA 1FRLA 3DXSX 2XMWA 1GMWD 2A0FB 1P27B 4E8UA 5F8JA 2EFOA 3MR7A 1IKYA 3VCDA 2EK1A 4RW7A 1FD8A 5LMUJ 2BUNA 4MT1A 1Z4UA 2PMHA 1PYOB 1RHUB 1N34J 3PYFA 3WC2A 1W2BR 3GR1A 3GYXB 2UVUA 2RKIB 1KNZA 1S7HA 4HT7A 4CTAB 3G71S 3GQCA 4J9PA 2YBVA 4Y28C 4NCBA 2ZNZA 4LRFA 3VALA 3FEXB 5D78A 1RAHB 4NL5A 2ZFHA 1TKDA 3EPIA 1P1TA 2NR0A 3MF5A 4OMFG 4DFPA 3NGRA 4DV5J 1LWEB 4JV1A 3WBZA 4F0MA 2FGOA 3QT5A 2ATLA 3W5XA 1VC0A 1AROP 2IRYA 5J2NA 4B3SF 2D3ZA 3PR5B 2PA3A 4X4SA 3VF0B 2UUWA 3DDNA 4QU7A 3AA8A 1HWUA 3H25A 3CULA 4IFVB 1IKWA 2U2FA 3CD7A 2ZJPQ 3I87A 4DV0F 3ZO7A 1Q8IA 1H6KX 4M8LA 4C4WA 5IV4A 3K2YA 4BS2A 3QJJA 1N5YB 3VQSA 4LFAJ 4WFZA 3PYEA 3AOAA 3MPUB 3SCIE 4CDIA 2XHWA 1SV5A 1GEHA 1FFGB
chains in the Genus database with same CATH topology
1S4FA 4RWXA 5K8MA 4NXNF 1KN6A 2B4OA 1ZM9A 3CCES 4O3PA 1XR7A 4E98A 4IRKA 2HNYA 3OFEA 4F3MA 2JRSA 2F9JA 2FIUA 1SH3A 5KFJA 1DRZA 3SFUA 5L9XA 3WDOA 1RT1A 1UMJA 3TAQA 1KQGB 4OZ5A 2CJQA 2ZHAA 2K7JA 2GHWA 3CWJA 4O4RA 1SB6A 2D3UA 3MM5A 4X2BA 4PRFA 3TOQA 1C1BA 1SUQB 3CCZA 4HTJA 2JEJA 4OX6A 3TR5A 4I67A 5THWA 2LEPA 4NYPA 2ZOFA 3NLCA 3UCZP 3C46A 4KB7A 5CZDA 2LVWA 2HWTA 1BQMA 2I0XA 2EFGA 7FD1A 2W9CA 1MWZA 3MD3A 2O1PA 2BQUA 5CXTA 4NZ6A 4M5DB 2W7OA 2DITA 2BV3A 1R8HA 1A7GE 1CSJA 2L08A 3OTDA 2W9AA 1YIJS 2ZNYA 2FJWA 1SV5B 1FRIA 5HMZA 3JSMB 1QTMA 2F8EX 5AXMA 4TXSA 1Y9OA 4H4MA 1MROB 2B43A 3CGIA 5F0UA 5GAGU 3IA0A 3I0SA 3IWLA 3G6VA 2ZITA 5A8RA 4A8KA 3CDEA 3UCUP 2H9ZA 1FJEB 4KHPF 5J2PB 2CG4A 3EGNA 3NCQA 1K0TA 4YOEA 2CRLA 2AJ4A 4WK3A 1V3ZA 3HMJG 3IR7B 1TR0A 4PG8A 2BRLA 2EVZA 3EUNA 2ZC4A 2R2RA 2R7SA 4RL1A 1VGYA 3V4IA 3LALA 2F9DA 4IOAQ 1K1SA 1QE1A 4QW9A 4B9TA 4RKUC 4YUDA 5HMWA 4DV1F 2VOOA 3FMBA 4PG5A 4ILRA 5IT4A 2OMOA 3G96A 4WU3A 4Q45A 3K5NA 1Q53A 1X9WA 2LXFA 3N01A 1SL0A 1RK8A 3P96A 4YDDB 3Q8SB 2YWFA 3PNIA 3OJSA 3GIMA 1HBOA 2FVPA 3DYAA 1BQMB 2B9YA 2C2NA 3CEDA 3NL0A 2FC8A 1QUVA 2DNYA 3EYZA 1URRA 2BQ3A 2ZHBA 5D4LA 4F3OA 2FHJD 2HPUA 1XNQF 3DLKB 4ECXA 4G1PA 2H5EA 4JI7F 1HARA 2WB4A 4F3QA 5F9NA 2VC1A 1XNRF 1ULRA 3HVRA 1XMQF 2UZAA 1IBKF 1S79A 1NJXA 4RR5A 1LK7A 2CQIA 2CQGA 2GO9A 2O5DA 3I0SB 5EHHA 2DNNA 2W9BA 3VZHA 2E7XA 4JBCA 3H4DA 3UCGA 1FRJA 3LP0B 1S0VA 2DR7A 4NA1A 2DR5A 3IRXB 1X4HA 4DQRA 4EWTA 2ILYA 4NLTA 3MAHA 2KXNB 2PSZA 1S1VB 4YB1P 2K2PA 4ELTA 3I0RA 3I9V9 2WONB 3DLJA 1R6YA 1L3KA 3V4IB 2VG6A 2C2DA 3D1OA 1DJ0A 1TUVA 2B51A 4A48A 2HLTA 2RT3A 1FJGF 3CMES 4RX6A 3RYLA 3FSYA 3MEEA 1U49A 3PR4A 3PX0A 1RQ0A 2I1RA 1X4FA 2MKSA 2Z2LA 3TP2A 3W7BA 4FXDA 5IT9Y 4HEA9 2V4JA 1AFJA 3H0PA 3E01B 4CCHA 4RW4B 4LUBA 1HBOB 4IKAA 1K1QA 2AJ0A 2UVWA 4NCAA 2LQBA 1J5OB 3R5CA 4FZVA 3DDKA 4KC5A 1QSYA 1LQ9A 2ZBCA 1GT8A 2VPYB 1VQSA 1Q8LA 1Z1ZA 3LGNA 4Q8FA 2YH1A 3KK1A 4RWWA 1WHWA 3GZ7A 2RSQA 3BGRA 3GV5B 4N41A 1YRUA 4IR1A 2CJKA 3NRBA 1UJ5A 4URQU 3U1NA 2W4PA 5DM6Q 1B0TA 1LWFA 4N47A 1DLOA 2Y1RI 3OSPA 2JWNA 2VC0A 4ILMA 2YNGA 3KHLA 4FF3A 1FK9A 1R8PA 3MMAA 2DIUA 1T95A 1W2IA 2XY7A 3SCLE 3TA2A 4B9UA 1WEYA 2KG0A 3CE8A 2KYXA 1DZ5A 3MEEB 5JUMA 5DG9A 5K14A 3QIPA 2Q6BA 2RQCA 2ZJRQ 1H2TZ 2PI5A 3FEZA 2QT7A 5I42B 3EPGA 2XSJB 2NZ4A 2W4CA 2BRKA 4K4VA 1Y4ZB 2F8MA 4L3NA 4EZ9A 4EEYA 1NKBA 5KG0A 3ZZUA 1OPZA 5B0EA 4P2SA 1S6PA 3MPVA 1XR5A 3Q2TC 4IQXA 1AFIA 3CJKA 3BGRB 4O4GB 5FD1A 3BO3A 3QZ7A 3IBWA 5L1KA 2FHKA 5M2RA 3OUYA 4DL2A 2J8AA 2ZH2A 2K1RB 5H9EJ 3F41A 3D0IE 3QGGA 1JB0C 3CJ4A 3A8EA 1FO1A 3DNCA 4M1KA 5CHCB 4KTQA 1FK9B 3K59A 2ZH8A 5F8HA 4N5SA 3LANA 2GNKA 2OFGX 1OQ3A 2I9SA 2G1HA 3JTOA 4MYUA 3DGPA 2CJ9A 4ED7A 5EX0A 3IFEA 3M2UB 3CCWA 3I56S 1HPZA 5KFXA 1RT5A 2B4UA 5E33A 5K14B 4LQ9A 2UXBF 4BBYA 1YHQS 1AXQA 1JLAB 3T3FA 5E0OA 3KNGA 2YKOA 3OSNA 4EYHB 2PN6A 2PC6A 3RW7A 2WAQD 4F2SA 2R7OA 2M3DA 5HI7A 4Q43A 3IR6B 3PEHA 3MD1A 2VFUA 4I56A 1YSJA 3T1HF 4ES3A 4G1QB 4HT5A 4WKRA 4H54A 3CJKB 1JLCB 4NLRA 4RBTA 3I31A 2B7CB 3FRZA 4OFZA 3OUYB 4ID5B 4KSEB 2YNIA 1N0VC 3MEKA 1TKZA 2ASLA 1A9NB 2WCXA 3PRDA 1FF2A 2A10A 2GFFA 2QMXA 4HYKA 3US5A 3M9OB 3WZ0A 1BQXA 3GWCA 3MEGA 3R3TA 2R2SA 1NK4A 3FGVA 4DQIA 2R2UA 1X4CA 2DNRA 3DOKA 4HDHA 5BYQA 1FA0A 3ICLA 3FVYA 3MECB 4GO5X 4MKYA 1F2GA 1FXRA 1HPZB 1Y3KA 5HN0A 1HNZF 1Q81T 2BDPA 1VFJA 4HLBA 2XS7A 2VH7A 3TVZA 1FXDA 3CJ3A 3M8SA 1HWLA 4XDDA 2EPIA 3PEJA 2MZ1A 5KG1A 2DCUB 2MSSA 4RU2A 2E1MC 2YTCA 1CG2A 2CDQA 2VPXB 2XGPA 4D3HA 1U1MA 1N48A 3BB5A 2RD5C 5L8RC 2KT3A 2CFXA 3M6UA 4IQMA 2VBXA 2R7UA 1NAQA 3MWBA 2LMIA 3BSCA 3K89A 5KFAA 4I6YA 3H4BA 4NLSA 2P6SA 2V8VA 1A6LA 2GIQA 1R89A 2YNIB 2J6TA 3MFHA 4C0BA 3M4XA 2HNDA 1TP7A 2W24A 2CQBA 2RJZA 3KLGB 5DM7Q 3I5CA 2OPPA 1E6YA 1S99A 4U7UK 1RP5A 3RRGA 1H7WA 4V19X 3OTBA 3MTJA 2J6SA 4F50A 3NWGA 2NQPA 2IYGA 1RTJA 3VAIA 5HO4A 4DV4F 2HHPA 1X9SA 3TANA 3THPA 1TAUA 4RNMA 2BW2A 1VRUB 2D1CA 3NG8A 4NLWA 4YMEA 1JLGB 2RE1A 1LWCB 2VFTA 3TRGA 2LEBA 4C8ZA 2L48A 1S77D 1FNXH 1IJEB 4P6QA 1H2VZ 3T5KA 3DRSA 5F8LA 4ZVFA 3PZPA 1HBNB 1C0TA 5DETA 4IDKB 2ZVSA 3SSSA 5DLFA 1LW2B 4RUCA 1VQKS 4KT0C 1VRTA 3TUZC 2L9NA 1D8ZA 1BQNA 5AE3A 2NS1B 4KKOA 2I2YA 4QIFA 2OAUA 5MAOA 2MHNA 4TU8A 3V6JA 2BACA 4C9DA 1PGZA 3G6XA 2LQ9A 3R1HA 2OD6A 2P9CA 2JX2A 3GMGA 2XMKA 4M95A 2QLWA 2MZQA 4KO0A 3CF5Q 3W2WA 4I1TA 1HR0F 4PXBA 3NS5A 2YNFB 3J7ZT 4OL8A 4ZCLA 1NJIT 3K8WA 2CQ0A 1UEVA 1HHSA 3C3LA 1S9EA 3TAPA 4YB7A 4DN0A 4YEAA 2LQJA 1NO8A 2CKWA 4IOBA 3OVSA 2KG1A 1S97A 1DTTA 2OD4A 3CCJS 3FFIA 2ALZA 1HFEL 1NRKA 5C42B 4X64F 1IQTA 1Q8BA 3M32A 2JOQA 1FVQA 1FDAA 3CCLS 5E3CA 3PACA 3BM7A 3MAQA 4DS5A 4C0HA 2QYCA 1UAWA 1S1WB 2CQPA 2RMLA 3MGJA 1VK3A 4KPYA 1H2UX 2PGCA 1ZZNA 2KXHA 5GAEI 2VODA 1X5OA 2RRNA 3ZZPA 4KKOB 2QZ8A 3BS9A 3V6DA 5F8MA 4WFYA 2QA4G 1U1QA 2VASA 5B0DA 4W92B 5C24B 4WFNQ 4X4RA 2CIMA 2YNHB 2IBKA 4G1IA 3N6LA 2HGLA 3DU5A 1K73T 3G8TA 4CIOA 3BSOA 5HLFB 2KRRA 3MMBA 4ZHRA 2MZRA 4WE1B 2KB2A 2GIRA 1S9EB 2CQDA 3M30A 3FRYA 3BO2A 1RISA 2MB0B 2V9WA 5BJRA 3ZZZA 3FMWA 1RT3A 3C6TA 5GADI 2HHSA 4EO6A 1IKXB 2XMMA 2FLLA 3OFHA 5CYMB 4JI3F 3H8YA 5IT0A 3M6VA 2XCPA 2GGPA 2XWXA 4ZVGA 3M32B 4DV2F 4U7CA 2VZ9A 4IO9Q 2HWIA 1HI1A 3HXMA 3N5FA 2WSFC 4QYZJ 2V8DA 5T14A 2XMVA 4ECYA 3ZFVA 3KLEA 3CB4A 3FDSA 4QR2A 2KH9A 2OSQA 2VA3A 4M94A 2EWHA 2HG4A 1LFWA 1SJRA 4ZLPA 1OQ6A 5CCMA 2M0GB 1N36F 2M7SA 4KQZA 2AP6A 4OV1A 1OSDA 3GYNA 5C25A 3OL8A 4UY8T 1HD1A 4ED1A 3NMAA 1UVNA 5CD4H 1R27B 4ZHRB 1U1RA 2QLXA 3OTOF 1U25A 2COLA 3PFOA 1S6QB 4DJBA 1NKCA 2XLIA 3M30B 4DFMA 2CJBA 2G13A 5JVHQ 2VFRA 2EK6A 4DOZA 5EWGA 1GX6A 2FLOA 2KYZA 3R27A 1UVIA 1BY9A 5KG3A 1NZAA 5KFFA 5KFHA 4CNYA 4YR2A 4ZPCA 2XCAA 1Y7PA 2GGPB 1KFSA 1VIOA 2DNZA 2XI2A 1M5VC 3T19A 5DS7A 3G8SA 2X1AA 3DMJA 4R0EA 3GFHA 5KG6A 5CA5A 5HROB 3H2UB 2DHGA 4TNOA 2FC9A 4ZPBA 1OIAA 5FLXY 3D54A 4YHHF 3R97A 3O1LA 2CQHA 2CVIA 4QW8A 2RQKA 3DM2A 2ROEA 2WHOA 1N5QA 4R5PB 3VAKA 3DLBA 4OJ1A 1Q4RA 5LXRA 1VQ6S 1RKIA 1U26A 4ATNA 3OXGA 4F4YA 1KS2A 2YX1A 2VG5A 3Q0AA 4O3SA 1GQEA 2XS2A 1M0SA 3FZ2A 3QO9B 3KLFA 1D9AA 3ETOA 4NLDA 3PTWA 1ZH5A 1HL6A 2P9EA 3FQLA 4GO7X 2L3MA 3OW2R 5K9FA 4J9LA 2GMHA 2IBOA 4RNOA 1T02A 1LKZA 2O67A 1U48A 4I2QB 1VC6A 4DFKA 2R8KA 3T9ZA 4OI3A 3MM6A 3PO4A 4QWCA 1O5JA 4H4OB 3E2EA 3SMZA 4KV8B 4TLRA 1IKYB 2PD1A 4GC6A 2N82B 1KHWA 4ZCIA 5HQ8A 4X4TA 3J7YI 2AU0A 2XLJA 2D74B 4AYBD 5IFMA 2R8HA 2ZKUA 3N0VA 5IM0A 5D8HB 3GR0A 4QBUA 1WTBA 2HQIA 2HFOA 3AJ1A 1DTQA 1GTEA 3NNCA 2HGMA 4QYRA 4IG0A 1F60B 1HNIB 4MK8A 4K5RA 3D0HE 3HVTA 4C3LA 1JKHA 1BGXT 1RTDA 1HYSA 1S48A 3N28A 3GIIA 1KQSR 1U6BA 1D0EA 2VG5B 4Q7AA 5G0RA 1SJ3P 1EETA 1FKOA 4MMOA 4NYZA 4AL7A 1HWJA 2KM8B 4I2PB 3GV8B 3KLFB 2KVIA 4DPOA 2LDIA 3J80Y 2ZM6F 1I94F 3DHWC 1QY7A 3KOAA 1MMNA 2EI5A 1KONA 2QSFA 5KT4A 4CO0A 5A0YA 2IAJA 3TYTA 5K5MA 4O3NA 2DGOA 4LFCF 1QAXA 1OO0B 2CPHA 5F41A 4X65F 4L6V3 1YRTA 2WTFA 4OHZA 4JYAF 1C1CA 4DHVA 2JEIA 4BCAA 4FBTA 2EFPA 2XNRA 1S1XB 3LPYA 1ZZFA 5LJ5Y 3LWMA 2MSTA 1GTHA 2VG7B 5J1PA 5BR8F 1SKSA 1GXLA 3OHBA 2XWYA 4QOTA 4ZP9A 3HKWA 4CO5A 2BANB 4N76A 4TU9A 4IFYA 4ED2A 1S1UB 4E0DA 4PQUA 1QLNA 1ROFA 2DGXA 4LJMA 4URGA 3J81Y 1DTQB 3KLHB 4WKYA 3F44A 4IG0B 1SI9A 4URSA 3SFGA 1YJWS 5KFCA 4Z37A 2IM0A 3BSAA 1REVA 2QV6A 3ISND 1VBXA 4XK8C 2HZCA 3PJXA 3A1YG 3CT9A 3SV4A 2YKNB 1URNA 3QLHB 1FKOB 3GB0A 4I6AA 1CEZA 2EC0A 2YKMB 2O01C 1NK8A 1VBZA 4LF8F 1LXJA 4PPDA 3SBMA 2X51A 2FJEB 5AXLA 3QJPA 5U47A 5KT6A 4DR2F 4N8NA 2HVHA 1MW7A 3DOLA 4NX9A 4WYLA 2UU9F 3KJVB 3GIKA 5HP1A 5B0FA 5KFKA 1T94A 2FD2A 2DH7A 4KGKA 5SZTA 2GX8A 4TY8A 2DPIA 1FXLA 2FDNA 4DEZA 1HQUA 2JHEA 3IM9A 4RW9A 3ONQA 5J2NB 4KFBA 3RAXA 3V6KA 2LECA 1EP4A 1R43A 3BDEA 1E6VB 1O0PA 3LH2S 5M2PA 1ZPWX 1FRHA 4YP3A 4CNZA 5A6PA 4MH8A 1V3SA 1XMOF 3T1AA 5ADZA 3NNAA 3RW6A 1RT6B 2VPZB 4TN2A 3CC2S 4B02A 2RILA 3ENQA 3ULHA 4C0OC 2PFFB 5DGBA 1IKWB 1REVB 3HJFA 2L9WA 3I32A 3IAM9 4DUZF 1U1PA 2HW3A 1VMBA 1YJNS 4FVMA 3RRKA 3M8RA 3POTA 3HZGA 4P7VA 4NRUA 5DDRC 4IRDA 3LP2A 3CO9A 2QFJA 5KFIA 4LSLB 4QIWD 1TKXA 3JYTA 5HP1B 1HNVA 3FQKA 5L39A 5L1LA 3K5LA 2ZD1B 5D6GA 1M5PC 2D41A 1N52B 4OQJA 1HMVB 1FHTA 1S1TB 2B6AA 4TY8B 2QIFA 2JVRA 2DO0A 4QU6A 1HQEA 2ZZMA 3L7PA 4OLPA 3G6ES 3ISZA 2YKQA 5B09A 3LP1A 3C6UA 1X4GA 1NKEA 2DTJA 4PXEA 1RT7A 1CQNA 2E9RX 4RNNA 4Y2IA 4MTPA 2HNYB 4Y3CA 1R0AA 1T3NA 2DR9A 1JLBA 5I3QA 1RT1B 1C2PA 3Q8PB 1IBLF 1X4EA 3MMCA 4XAKA