2LYVA

Solution structure of the two rrm domains of hnrnp a1 (up1) using segmental isotope labeling
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
b'GSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoprotein A1
molecule tags Splicing, transport protein
source organism Homo sapiens
publication title Solution structure of the two RNA recognition motifs of hnRNP A1 using segmental isotope labeling: how the relative orientation between RRMs influences the nucleic acid binding topology.
pubmed doi rcsb
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA02
2F3JA 2OSQA 2I2YA 2NZ4A 3Q2SC 3THPA 4TU9A 2DGTA 3MXHP 3MD1A 1F9FA 1JJ4A 2DH9A 2B0GA 3VAIA 2MKIA 4C4WA 3H2VE 3G71S 2X1AA 3TP2A 5GAHU 2MQLA 1WG5A 3K0JA 4U67Q 1VBYA 2AYGA 1NO8A 2CQHA 2KXNB 3EX7B 1VC0A 2J76E 2DGSA 3BO2A 2KT5A 1WF2A 2BOPA 2KG1A 4BS2A 2CPXA 2CPHA 2OIHA 1VBZA 4UQTA 1O0PA 2DGWA 3CMES 3L3CA 2JRSA 4M5DB 2MSTA 3BO4A 2RS8A 3J7ZT 2CQGA 2MKCA 2DGVA 1WHYA 2DO0A 3TYTA 3UCGA 5CXTA 2LQ5A 5DM7Q 4WF9Q 2CQPA 1JMTA 4WFNQ 2MQQA 1U1KA 3RW6A 2AYEA 1FNXH 2ADCA 1BY9A 1Q7YT 1H6KX 2E5GA 4TU8A 3CCQS 3I55S 2DNKA 5D77A 2CQ0A 2KU7A 3S7RA 3CCRS 2HGLA 3G8SA 1FJEB 2OTJS 4ERDA 5GADU 4V19X 2KXHA 4C0OC 4CIOA 2ZJRQ 3CD6S 3HHNB 2DNYA 3CTRA 2DH8A 1U1LA 1YJNS 2BZ2A 3NS6A 5JVHQ 2AD9A 2DHGA 5HL7Q 3G96A 2YWKA 1YIJS 1KOHA 2M4MA 1WF1A 1VC6A 2KHCA 5GMKa 1X4FA 3P6YC 1WEXA 2DNPA 5CYJA 3CCLS 2VONA 2MHNA 1N8RT 3VAHA 1M5PC 2CJKA 3UD4P 2G0CA 1M5KC 3CC2S 1P1TA 5GAEU 5DDQC 1FHTA 4QPTA 5GAGU 2RNEA 3CCMS 2M52A 2LCWA 1HL6A 3IWNC 2ZJQQ 2DGXA 2CQBA 2DHXA 1H2TZ 3G6ES 1NJIT 1OPIA 2UP1A 4OZ1A 2D9OA 2VOPA 4ZKAA 3CXCR 1S72S 2U2FA 2M8DB 3CC4S 5MLCV 2N7CA 4CH1A 2DNMA 4WIIA 1VQ9S 1WG1A 2MPUA 1IQTA 2YTCA 2XS5A 1X5TA 2V94A 2MMYA 1L3KA 2FHOB 2XNRA 1UFWA 2AYBA 2RQCA 3CPWR 1VQ6S 5LXYA 2GHPA 1SJFA 1H2VZ 5LJ3Y 2LECA 5LJ5Y 1WHXA 1YJ9S 1WHVA 5IQQA 4Y00A 4RU2A 4WFBQ 2LXIA 3BEGB 2MGZB 4F26A 2VODA 2I38A 2FPHX 1WI6A 4P6QA 2MQMA 2AYMA 3FEXB 3CCJS 1P27B 1N52B 2CPYA 5DETA 2KG0A 2LA4A 3UWTA 2DNOA 2MY7A 3MD3A 3SXLA 1X0FA 2MKKA 4EGLA 1PGZA 1PO6A 1X5SA 1W2BR 2MZRA 3DLLQ 1M1KT 2MGZA 3CCUS 2E5IA 5LSLA 2G4BA 1SJQA 4TLQA 1KC8T 5DDOC 1M5VC 2MKHA 2MQPA 4F02A 3V4MA 1RKJA 2LXUA 1KOOA 4W90B 1X5PA 2D9PA 2MZSA 2XS7A 1FO1A 4TU7A 5ITHA 2J0SD 1NU4A 2HVZA 3CCSS 1U2FA 1UAWA 2E5JA 2CQ1A 2MZQA 3CUNA 1X4DA 3R1LA 1U1QA 3CCES 1U1NA 3IRWP 1WEYA 2DGUA 2DNNA 2U1AA 1KD1T 1X4AA 3EGNA 3LPYA 3VF0B 1URNA 1R8PA 2DIUA 2DITA 1YJWS 2HZCA 1SJ3P 1VQMS 2KYXA 3SMZA 2DB1A 4QQBA 1YWXA 2LYVA 1OWXA 1WHWA 2DISA 2M88A 3NMRA 2RQ4A 3UCZP 4IOAQ 1B7FA 2F9JA 3VAJA 2MJNA 2KI2A 1M90T 4A8XA 2KXFA 3CMAS 1SJ4P 2L9WA 2LEAA 2JVRA 2MKJA 4IOCQ 2EVZA 2D3OR 4WFAQ 3I56S 2EK6A 1WG4A 3NNHA 1N88A 3NNAA 2CQIA 2M0GB 1ZZFA 5LXRA 1HD0A 2DNHA 2EK1A 2N3LA 2ADBA 3VAMA 3U1MA 2X1BA 2ERRA 2M7SA 5D78A 3N9UC 1VBXA 3D2WA 2MZJA 2KM8C 2CPZA 2CPJA 3S01A 2MYFA 2J0QD 2LEBA 3JB9k 2HYIB 2HGNA 2DGQA 5DM6Q 5EN1A 2RRBA 4LIRA 3VALA 1HA1A 2SXLA 2CQDA 1FJ7A 3US5A 4F25A 3R27A 5BJRA 1WTBA 2MZ1A 4QU6A 1YTYA 1D8ZA 2MSSA 1VQ7S 3B4DA 2YH1A 1VQPS 3MOJB 1S79A 2DIVA 4C7QA 2LMIA 1DZ5A 3G4SS 2KN4A 2GO9A 3CC7S 1JJ2R 5DDPC 2OTLS 3G8TA 3P49B 3ZZYA 2YH0A 2JVOA 1VC5A 3MI7X 1Q82T 2DNRA 2CQCA 2RUGA 5CA5A 2N3OA 2XNQA 3VAKA 5IFMA 3BS9A 2N82B 2K8GA 2K3KA 3MUTP 3MDFA 1RK8A 3P5TL 4W92B 1U1OA 2MY8A 2KFYA 1U1RA 2MZTA 1QVGR 3UE2A 2DO4A 4Y0FA 2CPFA 2CQ4A 1DBDA 3FEYB 2MQNA 1H2UX 1VQNS 3THTA 4Z2XA 4IO9Q 1FT8A 1X5OA 2FC9A 5IM0A 3UCUP 4J5OA 3S8SA 2DGOA 1Q81T 1K73T 4YB1P 5FJ4A 2JWNA 4CH0S 3DXBA 3UD3P 1ZH5A 5H1SV 1U1PA 3S6EA 3SDEB 2MQOA 1XN9A 2DNLA 2F9DA 2XB2D 2YKAA 2MB0B 2DK2A 1DRZA 1WEZA 2RS2A 1A9NB 2KRBA 2M9KA 2ZJPQ 2JX2A 4PKDB 2CPIA 1WWHA 1ZZNA 2OJ3A 1FJCA 1JJHA 1Q86T 3CF5Q 2X1FA 3LQVA 1VQ8S 3B4MA 3ZZZA 1SXLA 1UW4A 2XSFA 1SJRA 1U6BA 2KVIA 3HI9A 1YI2S 2DNQA 1U1MA 2QFJA 2CPEA 2HGMA 3BO3A 2KM8B 2G1DA 2M70A 1N54B 4OZ0A 2OSRA 4LMZA 4WCEQ 1X4GA 3TO8A 2J8AA 4CQ1A 2O3DA 1VQOS 1WELA 1K8AT 2FC8A 2MXYA 2DNZA 4WKRA 2MKSA 3J7YU 3R1HA 3MURP 5GVQA 2CQ3A 4PR6A 2DH7A 2DNGA 2RT3A 1QVFR 3Q2TC 4YUDA 2CQ2A 2PE8A 3H2UB 5HO4A 3MUMP 3P3DA 2CPDA 1AUDA 1UP1A 1KQSR 2FY1A 4YOEA 4FXWA 3NS5A 3ULHA 1VQ4S 1M5OC 4IUFA 1A7GE 2Q79A 2DHAA 1K9MT 3OW2R 2QEXS 3CCVS 4QU7A 1VQLS 4ED5A 2NLWA 2LKZA 4LJMA 2M2BA 1R8HA 5JVGQ 1CVJA 2MJUA 4PRFA 5IM0B 1X4EA 5DDRC 3NNCA 2DHSA 2RRAA 2WBRA 2A3JA 2X1GA 1YHQS 3PIOQ 3U1LA 2KH9A 2VOOA 1DHMA 2E44A 1OO0B 3G9CA 1QM9A 3CULA 3SDEA 2QA4S 1FXLA 2LA6A 1VQKS 3MUVP 1WI8A 4FXVA 3VAFA 2RVJA 1HD1A 1X4HA 1D9AA 1X4CA 1X4BA 2E5HA 1YITS 5LSOA 3RW7A 2L08A 3VAGA 2L41A 1WF0A 2PEHA 1G2EA 1U6FA 3EGZA 1VQ5S 2RU3A 2KRRA 2XS2A 3PIPQ 2M8HA 4UY8T 1OIAA
chains in the Genus database with same CATH superfamily
2VDIA 2XSJB 2IMWP 4JI4J 1VK3A 3CDAA 3IR6B 3FSYA 4I2QB 2DTJA 5E3RA 4HKQA 4QIGA 4LSLB 2NXUA 4FF1A 3MXHP 3GIRA 4JI1F 3AD9C 4X2BA 1YZ7A 3IM9A 5HQ8A 2VKZG 1RTJA 3H2VE 3G71S 1RT6A 2J9CA 1V6HA 2X1AA 1SJ1A 4ED1A 4YR2A 1WG5A 1Y7PA 4OYMA 2E9TA 5E33A 1RLDA 2DYAA 2GC8A 5KFVA 3TVZA 2AYGA 1T9VA 2VIHA 2CQHA 2XTJP 1YZ6A 5IOLA 3JTPA 4ZCMA 2N4DA 4FNIA 4G1QA 2J76E 2DGSA 4WE1A 4C2MA 3IWLA 2BE2B 1VGYA 3I9V9 1TKTA 2BOPA 1L5UA 3MM7A 4PG4A 3TAMB 1UKUA 3I87A 3GJSB 3BSNA 2AEMA 1ZM4A 1O0PA 2DGWA 3PRDA 1H38A 4KAIA 5KOWA 4E2FB 5JJBA 1RT2A 4NCBA 2RRNA 1WOPA 5J2MA 2RHSB 1OYDA 3AQOA 3D0HE 4CLWA 3KHGA 1B64A 1IKYA 4DR2J 1PJ5A 1DARA 2W4CA 3DYAA 3CJKB 4PWDA 2DGVA 1EETA 4HT7A 2LU1A 4M1KA 3D7SB 3MM9B 4DWIA 4K8RA 3UCGA 3TYTA 2AHOB 3B54A 2LFVA 1LK7A 4DV6J 2LQ5A 1RT4B 5AT1B 3GQCA 1GQEA 2BX6A 2O01C 3HVWA 1SL0A 1LFPA 2LQBA 3CIZA 4LR7A 4WFNQ 1FDBA 2YNHA 4ENOA 5GAGI 4O3SA 3JSRA 2BKOA 4ER8A 4TLRA 1Q7YT 4P2SA 1LWCB 1YJVA 4TU8A 2YY3A 5D77A 1KSPA 1G7CB 1SQFA 3BQ0A 2NREA 2ZHAA 3CCRS 1QAYA 5CYMB 4N5SA 1FJEB 5FD1A 1VI7A 2BJEA 1J2VA 4Y2CA 1K47A 4B9NA 1CS4B 3POTB 1CULB 2A6MA 2ABYA 2KXHA 2ZJRQ 3ZTSA 1VK8A 2HAFA 4OYOA 4Z37A 3PFEA 4IG0A 2HS4A 2DH8A 1EARA 2VC0A 2E5LF 4UOCA 2CJXB 3FFIA 4L3NA 4JI8F 4DEZA 4ZLNA 3EPGA 4OL8A 2AX1A 3HVAA 2IJFA 4PYAA 3GV7B 2DHGA 2AD9A 1EQMA 1RHRB 1KOHA 5L39A 3FMWA 3SCLE 3E8OA 1FFSB 2KHCA 5BR8F 1ZS6A 3OQ2A 4ED0A 3D6FB 1F1BB 1RJJA 1FD8A 3MAHA 4KGMA 4DX7A 5DG9A 3PKYA 2GHVC 4QYRA 4KHPF 5CYJA 2NSCA 4KKOB 5L8RC 5KFXA 2HNDB 1PYTA 2HHXA 1VLYA 1ZM2A 1HI0P 3W65A 2WRMA 2MHNA 5G0RA 3WIUA 1L3UA 1GX5A 1RWUA 2APOA 1N8RT 3AXMA 4QR1A 2CJKA 3UD4P 4B9VA 2UXCJ 2QA1A 3CC2S 1P1TA 1PYOB 1T03A 5DQGA 3QSIA 4DV7F 2NZCA 3HF5A 3QGIA 2OFGX 2JL9A 2G1HA 2BE9B 2OD6A 3AB2B 3MCMA 4QPTA 4DX6A 4R5PA 5DZ6A 1VISA 2GGPB 1D0EA 3LTOA 2VASA 3R97A 2BKNA 2C2EA 1ZOTA 3WC2A 1NKCA 3ENQA 2ILYA 4XPEA 4EK2A 3CE8A 2DHXA 1NJIT 5HP1A 3PW4A 1NK9A 2ZZNA 1BUXA 2KFZA 3SI8A 2D9OA 2OPSB 3HJVA 1TMJA 4W4MA 1ZTTA 1Y00A 1HLWA 4M5DA 4PWWA 5F8MA 1S72S 2VG6A 1EB0A 2M8DB 4UTGA 2D3UA 2N7CA 4ES3A 4U8YA 3SSSA 1LW2A 4HT5A 4CH1A 3MTKA 1N56A 1FK9A 3I0RB 3HCXA 2GMLA 2XEXA 3MM8B 4KV8A 4P7VA 2XS5A 1X5TA 2Y1IA 1BQNB 3C16A 4C8OA 2AJ0A 4ZVEA 2XNRA 2M3DA 5AXNA 3CPWR 2FDNA 3R5BA 1RWNB 4B17A 2O1PA 4CT8A 3MCOA 3KWMA 2XO6A 2I5JA 1YJ9S 2FLLA 5K20B 4XK8C 1VHIA 3E01B 3OTDA 3DMJB 1RAFB 2DY1A 5A8WA 1T9WA 5KFHA 1NLKL 3T1AA 4LF2A 1BD6A 1SQEA 4X4NA 1GMVA 2MGZB 2AF6A 1XR7A 1H73A 3RRHA 4FF4A 4YHHF 4P6QA 4I69A 1H3DA 2O5DA 4B9LA 4FPRA 2AYMA 4GVBB 1N52B 2CPYA 2VPWB 4S0MA 5CAAA 2LA4A 2KG0A 2DNOA 4MMOA 5DRKA 3MD3A 2CZ9A 2JLFA 1SC6A 1TFWA 1U8SA 3SEOA 4EGLA 2MKKA 4OHXA 4A4JA 4WXOA 1X5SA 1TL5A 3G6YA 1K0TA 3IA0A 3O44A 2D3O1 1M1KT 3PM9A 1AFJA 1KN6A 2XWXA 2VPYB 2VZ9A 3I0SB 5LSLA 5SZTA 2C42A 5DDOC 2R42A 3C19A 2AZ1A 3VGVA 1KEKA 4AQYF 4ECSA 2FB0A 1UJ5A 4CTAA 1NAQA 2WSFC 4RW8A 2QT7A 4DL3A 3PZPA 2I1RA 3T1YJ 2VG5B 3D5MA 2R7WA 1S0VA 2JFKA 2OUGA 5I3PA 4DR5J 3DLEA 1HBNA 1Q8BA 2B6AA 1KOOA 1J5OA 1X5PA 1JLQB 4X66J 2A10A 2MZSA 4F36A 3EGVA 4BDPA 2ZBQA 2H5JB 5K8PA 4YY3J 3GP9A 2GVZA 3H0PA 1QTMA 4JI8J 4JI7F 3OVBA 2CQ1A 2MZQA 5D0GA 4CRJA 1T8EA 3K5LA 4B9MA 1X4DA 5ETQA 4OLPA 4ZVQB 3R1LA 4JI3J 4CP5A 3CCES 3AJ1A 2AJ4A 2HQFA 3CJKA 3KUGA 2QG9B 1UVLA 2DNNA 3HP6A 4D3HA 1KD1T 3PEJA 1ZETA 4UOHA 5KFKA 2XC9A 3LPYA 1O51A 1NB7A 1EP4A 4M5NA 1IBKJ 3IR7B 5I42B 4DQSA 1N34J 1U7LA 2QYCA 1IKVA 2XCAA 1SJ3P 3POTA 2ZWPA 3SMZA 1UEUA 4NE9C 4OYAA 1YWXA 3V2UC 2LYVA 2RD5C 1NKEA 3I82A 1WHWA 1RAIB 1YJRA 3OFGA 3KJVA 3FQLA 3P45B 4IOAQ 1T3NA 3VAJA 1N34F 2B56A 1F3VA 4X65J 1RWXB 4YDDB 3VV2B 1FKOA 1YBUA 2MJNA 3MAQA 5HROA 1SB6A 1ZPWX 2EEYA 2XLJA 3KLEB 1S4FA 1QE1B 2IA0A 2ZM6F 3KHLA 1NDPA 2CWXA 2KXFA 2W1BA 3CMAS 2VB6A 2GJIA 2LEAA 3GLJA 3KXDA 2JVRA 2MKJA 5D4NA 1RAGB 3UN2A 3M2VB 2H4YB 4P7TA 3LANA 4F3MA 4QPXA 5HN0A 5HLFB 2Z0GA 1P1LA 3GJQB 4ID5A 1Q8KA 4LSLA 2GA7A 4USWA 3W2WA 1A9NB 3TUZC 4ZJOA 1RWPB 3PW0A 1N88A 1TKXB 4Q8FA 3J80Y 3U1NA 1FRIA 1ZZFA 1KTVA 4OHWA 5J2MB 1HD0A 3A8KA 2WB4A 3KLFA 2EK1A 4ZPAA 2HBZB 2ADBA 2HHWA 1Q5VA 2CDQA 1MG7A 2VDHA 2R8JA 5T14A 4L74A 1IKWA 3UI3A 1U4BA 2Q1LA 1MWQA 1ZM9A 2XQCA 2HLTA 2HZVA 3FMBA 3A3NB 2MZJA 4ZVPB 1KONA 3M9OB 3H42A 5KG4A 1UZHA 3ZTPA 3UN5A 3Q86A 4CH7A 2CG4A 3QBCA 1S1WA 4DLEA 4DL7A 1ITPA 2NQPA 2CJAA 2DT9A 1Y3JA 3DU5A 2HYIB 4DPUA 1WORA 4LBHA 1TK8A 4Y6IA 1S77D 3LUYA 3ET6B 4CLPA 4X4SA 4R5PB 5LT5A 3H4DA 4Q45A 1Z2LA 2DJWA 3DXSX 4I2PA 4KTQA 1FX4A 4OJ1A 2SXLA 4QOTA 1DY3A 2ZVIA 2HEKA 3P96A 2CQDA 3OXLA 2PMZD 1LNQA 2EBEA 5HJXA 3QJPA 2HHTA 3US5A 4OHZA 5J2PA 2V67A 2P9CA 3OBIA 4P71A 4NLRA 4QW8A 3UR3C 4P52A 3QLHB 5J1NA 2XCPA 4NXMJ 3WHIA 3EYZA 1UVMA 4TVAB 1SL2A 4RW7A 5J2PB 5D0EA 2Z2YB 3R7BB 4AXIA 2WK4A 3G82A 1NHUA 3JQMA 2LMIA 3KG4A 4C7QA 3G4SS 1SL1A 1DZ5A 1IBLJ 1OPZA 1YBAA 2KN4A 3TEHB 4I2PB 4EU0A 1YBTA 3EUNA 3DKDA 3TQEA 5DDPC 1N6QA 3P49B 3K2YA 2AEJA 2F8EX 2XY6A 1VC5A 2UV8G 3DLJA 4BBYA 2FTRA 3DRSA 5A8KA 5CA5A 1RHJB 1HWKA 2VFTA 2YKMB 1C1BA 3AA9A 2ATCB 3QFWA 2NSBA 2ALYB 3BS9A 2V50A 3M1VB 1IXKA 4RW6A 1ZPVA 4V1Ak 4ZS6A 5AXMA 3GONA 1BWEA 3V4IA 2H5IB 2HVEA 1JXEA 2ZD1A 1UJ4A 2D1CA 2K3KA 4GMKA 2IVFB 1FFGB 8RUCA 3MUTP 1RYSA 1RK8A 2YWWA 3JAMY 2HNDA 1P8GA 3TA0A 3W2VA 3AOAA 1QSLA 1KVKA 5A6WA 4I56A 2UU9J 3NMAA 1WJ9A 2V2QA 1ICEB 3LH2S 2H9ZA 4NCGA 3KK2B 1HQ2A 2CPFA 2BW7A 4FPIA 2CQ4A 4EO8A 3MMJA 7AT1B 1GMUA 1IKXA 3O5TB 5ETVA 3KLFB 1RU1A 1OYEA 3IXQA 4Z2XA 2ZDOA 4IO9Q 4AQYJ 1NNDA 3L09A 4J5OA 5ETLA 4DV1F 3MEDA 3M1VA 5IT9U 1QSSA 2JWNA 1IWGA 2CJQA 1RHKB 2WW8A 1R8BA 4NLSA 4CH0S 5IV3A 2R8GA 4EUVA 1YG0A 3D3CJ 5IT4A 2AJ1A 5HK4A 4I64A 3UD3P 2PN6A 1BXNA 1V5IB 2L9NA 3SSQA 5H1SV 2ZH6A 4EEYA 2KO1A 3FBBA 1U1PA 3TJAA 4M5GA 3W9HA 4K4ZA 3TEGA 3MECB 1XN9A 4ED2A 4DCOB 4YR0A 2UUCF 2DK2A 3VVTA 4K4VA 2PGCA 4YHHJ 2CUYA 2QSFA 1S1VB 3HULA 3DOKA 1NJYA 4LFCJ 4DV0F 4Q2LA 1S59A 2L48A 3AH6A 5IWAF 2YQ0A 1GX6A 1RWKB 3D0IE 1KRPA 2OJ3A 1IWAA 1FRXA 3ZNJ1 1E6YB 3MAAA 1PILA 2DR8A 2RDJA 2ILZA 4DOZA 2X1FA 1CPZA 1VQ8S 4R25A 3ZZZA 3DYAB 2D74B 1EX8A 2XSFA 4OI3A 4JV0A 4USMA 2GS8A 3E3XA 1EZZB 2HK3A 4F4XA 7FDRA 1UVJA 3QWUA 2BBEA 3BO3A 3N5FA 3BGUA 1HW8A 4KE5A 1WC5A 1UWBB 3U27A 2KM8B 2CADA 2E1AA 2RH3A 4MIBA 4F4WA 1S48A 2OSRA 3SV4A 4B3OA 1HBMA 3WQPA 1S9GA 1LXNA 1RWWB 2W4PA 4DQRA 2VBZA 2C1EB 3SCIE 3UNYA 4HI1A 3NCQA 5LSRA 3RBEA 1VQOS 3L4BC 3V81A 1VJWA 3GG1A 5D6GA 2HHSA 3OSNA 2DCUB 1VQSA 3PXGa 4DN0A 1FE0A 4DR2F 1F2HA 3MGJA 4J9UE 2AGQA 3MCNA 1GMWA 1C1BB 1TMMA 4OI1A 4QWCA 4C3MA 2B8QA 3KLHB 4ZHRA 2PIIA 3R1HA 3DLGB 2EXUA 4EBCA 4PR6A 3OLBA 1E6YA 2DNGA 2RT3A 4DG1B 4MYUA 1QVFR 3Q2TC 4DR4F 1RU2A 4B3RJ 1E6VB 1IBLF 1PAEX 1JJCB 4MFBA 2D7SA 2CQ2A 4PG5A 3DDKA 3DOKB 4PPZA 5HO4A 1MW7A 1KWMA 2OEKA 1IJEB 1CJVB 2CPDA 3PRVA 1UP1A 2HNZA 3SBMA 1VDHA 2B9XA 3H90A 2HWIA 3BGLA 4HVZA 2FY8A 3NS5A 3HVRA 1RSCA 3X1LB 3M7VA 3MMAB 4RNOA 1M5OC 4IUFA 4FF2A 2W8LA 1A7GE 2Q79A 5KFUA 5F41A 2ROPA 3KNGA 5KT3A 3OW2R 1K9MT 1BQXA 2D3ZA 1WKKA 2QEXS 4H4MA 1DJ0A 4IH7A 3CCVS 4USUA 5K14B 3Q8QB 4DSJA 1DQAA 3Q8UA 4ED5A 4Q8EA 3M6XA 2PEBA 2V4JB 2M2BA 2FD2A 2G2OA 3HHLA 3HHEA 5JVGQ 4LF4F 3GFXA 4MJKA 2JH3A 3D68A 4B3OB 1IVZA 1U49A 3T5HA 2VV5A 1RWMB 2FVSA 3CEDA 4LF1A 2Z58B 1UVNA 2RRAA 5E5NA 2WBRA 2QRRA 4AFFA 3PR4A 1LWFA 4U6PA 5JMNA 3U7JA 2ZDPA 4KO0A 3L7UA 4R8UA 1XR6A 3PFOA 4ZPTR 5F8JA 3RTVA 2XI2A 3OFFA 4QR2A 3S1TA 4P75A 3CULA 4DUTA 1FRHA 2P8IA 4ZJQA 1NMEB 2EKYA 3H5YA 2QA4S 3GYGA 1F6TA 1PBAA 1U24A 1BQNA 2LA6A 2QLWA 3C16B 1VQKS 3MUVP 4RW6B 1WI8A 3D0GE 3J81Y 1IN0A 1ZBTA 3VAFA 1NSAA 3CDWA 1R0CB 1LK5A 4K59A 1LWFB 2JHEA 4PAAA 4WP9A 1FWLA 4BC9A 3WBZA 4BLGA 5HBMB 2YPZA 5KFEA 5KT7A 3OVSA 4NLVA 4DL5A 1PBUA 2WHOA 1SKUB 2K1RA 6AT1B 5HSPA 2C2ZB 3T9ZA 1X4CA 4DQIA 1UL3A 3OXFA 4N8OA 1N5TA 3ICLA 3PHTA 1UJ6A 3HHLB 1WC1A 4IDKA 3BYRA 4LIWA 2ZUGA 4GRSA 1TUVA 4U8VA 3N6NA 3C14A 4CLSA 4Y2MA 2L41A 2B8PA 2FLPA 2RF2A 5D0HA 2HQDA 1XMOF 1S1UB 2ZKUA 2ZM6J 1QY7A 4LUBA 1RDRA 1WF0A 2B4UA 4DL0C 4C8LA 3OL7A 4BHQA 1TK0A 2VODA 1RT7B 1VR6A 2K1RB 4NA3A 4DUYF 4UY8T 1OIAA 3ISNC 2ZC4A 4YN3B 3KUHA 2V69A 5K8MA 4P10A 2B7CB 2C3YA 3IP0A 5HVFA 1E6VA 1NCLA 3THPA 5DZ7A 4TU9A 3HPOA 3QT7A 2XY7A 1WKLA 5C24A 1F9FA 1PCAA 1Z4UA 4PZVA 5FLXU 1JJ4A 2B0GA 3B8HA 5CQGA 3TI0A 4JI5J 3LW5C 3PYGA 2ACYA 4HTIA 1PYSB 4DR7J 2QFIA 3RU0A 4CT9A 1JLFB 2J6TA 2Y1RI 5L1LA 3K0JA 3M6UA 1NHVA 1VIXA 3W8GA 1OQ3A 2NS1B 1HIYA 4O3OA 4CYUA 1S9EB 2AX0A 5KG5A 2KXNB 3EX7B 3Q24A 4DUYJ 1VC0A 3HT3A 3BBBA 2FJBB 3TANA 4G3IA 1FESA 2IJNA 1RB0A 1LWEA 2C2KB 1FWPA 2KG1A 4NLXA 4BS2A 2CPHA 2KVQE 2ZH8A 2YKMA 4DZDA 3DRSB 2IA6A 2OIHA 1WDDA 4JYAF 3CMES 2XLIA 2HQGA 2ZNZA 4PPDA 3L3CA 1RAHB 4M5DB 1LWCA 2MSTA 2C3PA 2Z4PA 4OJ3A 3KYLA 2VJVA 2W8KA 4GC6A 3BO4A 2RS8A 4KPCA 5KFZA 5KFFA 2JNJA 2CQGA 2HWHA 3J7ZT 5U47A 3Q8RB 1XR5A 2VF3A 4B02A 3RR8A 3JXOA 3NGRA 3HVTA 3RYLA 1K0VA 4OQJA 4N56A 4KRWA 1HMVA 1UMJA 3HKZD 4MTPA 3SSRA 2BJ9A 4J91A 4O44A 4OI4A 2XMTA 3ZZRA 4ZLJA 3A12A 4OV1A 3ILJA 3K8VA 3TWZA 3HVTB 5MAOA 3K59A 2CQPA 1JMTA 1S4EA 1Q16B 1FWKA 1VIOA 2IC3A 1U1KA 1GXUA 2AYEA 4O4GA 4ICLB 3GMGA 1BY9A 4PG8A 1FNXH 5ETKA 1JLAA 4DSLA 4KPYA 5F8IA 2ZH4A 4NYOA 5CHCB 4OI2A 4J9MA 1ZAXA 4PCQA 4M5HA 4XIUA 1JLEA 1NHKL 2GQQA 1HR0F 1WDTA 3BKTA 1EKSA 5L38A 3H5XA 3HD1A 4DPOA 3ETMA 3TW0A 4DBQA 1TQLA 4V19X 1NSQA 1XNRF 1URRA 1RADB 3AD8C 4CIOA 3OTCA 5H9EJ 4MIWA 4K5SA 2DNYA 3MEDB 4FYDA 1MMLA 3A8JA 5F3ZA 1MU2B 1MNEA 2VG7B 3NS6A 1KLNA 1FTRA 4F4AA 5JVHQ 3PDNA 3RB4A 1RTDB 5CCMA 5HL7Q 2OPRA 3G96A 2M4MA 4NLOA 3RGIA 2G0JA 1WF1A 1VC6A 2V2ZA 3LWLA 3IMQJ 2IHR1 3MEEB 2VPXB 1KBRA 3HHDA 2QMUB 3P6YC 3W7BA 3EM1A 1RA7A 2H4WB 2OH2A 2QV6A 5KG3A 4U7CA 1M5HA 3TJ9A 2GQ2A 2J9DE 2ZKTA 4NA1A 4ZOSA 3VAHA 1JLAB 1R8CA 4EBEA 2G0CA 3PEHA 3ITHB 3L7OA 4HDHA 2BJ8A 2Q43A 4CDIA 1HBNB 3F73A 2YWEA 1FHTA 2FJDB 3UW1A 5GAGU 2VD3A 2M52A 2KL8A 3CCMS 1S0NA 2FUG9 2LCWA 2F8HA 1MROA 4IRKA 5KFAA 1S1VA 2Y3YA 4CTAB 3IRXA 1CJUB 3IWNC 1OMSA 5BYQA 1FI4A 2BV3A 4LBIA 4UZCA 3H8YA 3K8WA 2CQBA 1TAQA 1I94F 1OPIA 1TVRA 1MU2A 3BV8A 5EWFA 1CJUA 4ZPWR 5C42A 5CZXA 3CXCR 2A2CA 2A6OA 4B3MF 4N76A 5HBMA 1Q78A 4RW9A 1TZ0A 4L3KA 2DNMA 1VMBA 4WIIA 1UCNA 5J2NB 1VQ9S 1SVDA 1WG1A 3LALA 2GIQA 2ASJA 1A0OB 4J9KA 4NYZA 4L75A 1S10A 2XZDB 2B7BB 2DXEA 2V94A 5KFNA 2JLEA 4ZPBA 1QLNA 2FHOB 2HRYA 3AA8A 3WX4A 4DSEA 4DFPA 4XDDA 5A2QY 1UFWA 4DL6A 2AYBA 1RT2B 4NZ0A 3CJSA 2RQCA 2HFOA 2IDEA 3V6HA 1EAYC 1L3SA 4ETXA 1HPZB 4DL2A 1SJFA 1S7HA 4KHPJ 1H2VZ 1KTQA 1RAOA 1WHXA 2HSEB 4ZP9A 2V5HG 4PUOA 5IQQA 4QW9A 1WACA 4HHJA 2QL5B 1MMNA 1N5SA 3M8YA 4HI2A 4DJBA 5IQ6A 4CI0B 4WFBQ 4JV2A 4KFBB 2KKHA 1C0TB 2OAUA 1SV5B 1H98A 3I31A 4IH5A 3DRRA 3OR2B 4C8NA 2QGFB 1C4CA 1YVFA 3D6HB 2NXEA 2FPHX 1WI6A 2MEWA 4HH1A 2UUBF 4HEA9 4DXLA 3BN7A 1U47A 3KMQA 2UUWA 2MQMA 5EGYA 3AY0A 4JV5F 4OZNA 3FEXB 3H25A 3CCJS 5H9FK 4N77A 3MM8A 5DETA 4FYVB 2V8VA 4F3QA 2RKIB 1HNWJ 4X4RA 3SYZA 3SXLA 2W7PA 4QYZJ 1T95A 4X65F 3MMAA 2O66A 2EBGA 3NLCA 1F9HA 4OJHA 4XO0A 1S6UA 1RT1B 5KFLA 1W2BR 2MZRA 3CD7A 3FC9A 3DLLQ 5HJYA 4MK7A 2E5IA 3HXMA 2DD8S 2UXBF 4DV1J 3NBPA 4RNMA 2PFFB 2VKRA 2G4BA 3H4BA 1C1CB 2CKWA 3BBFA 5KG2A 4ED7A 1JLFA 2OTJS 4CLTA 1LWXA 4FS2A 1DTTA 2IAJA 3MPYA 8AT1B 2XGQA 3M32B 4ECWA 3PX6A 5KFWA 1WD6A 2RB7A 2VFVA 3QPIA 4JI2F 4DX8H 4DQPA 4CM2A 2HPUA 9ATCB 3KLHA 2F5GA 4C8KA 3V4MA 1RKJA 1JIHA 4F02A 4KH1B 4DV3F 2QLFB 2COLA 1BGXT 2HQIA 2P2CB 5GADI 4GO7X 4OHYA 5GMDA 3CCSS 5G0RB 1U2FA 5C5JA 5E41A 1XERA 3NAHA 2DBBA 2E5JA 3TR5A 1RWOB 4I4BA 3QATA 3W64A 2IVMA 4OLOA 1RZMA 2GHWA 1YKWA 1S1UA 3IRWP 2V6AA 1MN7A 4LF5F 4DR1F 1RAEB 1HHQA 2IM1A 2PMWA 4NLTA 1X4AA 2W9BB 4E0DA 4X62J 4YDXA 1NRKA 2VFRA 2GCFA 1WC4A 2XWYA 1B0TA 3MPUB 1UVIA 3QJJA 1YRTA 2V4JA 3MM6B 5I3UB 3WDOA 4QWEA 1N5VA 1YJWS 2WBMA 2E1PA 1IQZA 3CJQA 2NUHA 1VQMS 4ATNA 2DB1A 4O23A 3BM7A 1S0OA 4J9VA 1LW2B 3GR1A 4A8FA 4DFKA 3U02A 5I3UA 2RQ4A 3PW5A 3PO5A 1N36F 3AT1B 3IN5A 3L9ZA 2JSXA 3GIMA 2FGCA 3JSMA 2YKOA 3AFGA 5HQLA 2ZH3A 4F4ZA 2P9GA 4EZ9A 4C98A 1LKZA 2J9EA 2QIFA 2W9BA 1KVIA 2NYIA 2JJ4D 4M5IA 1M90T 1TTHB 1Y0HA 2WAQD 2LQ9A 3OL6A 1RCOB 2ZHBA 5KT5A 2EVZA 4DV5F 2EK6A 5E7OB 5AXKA 3M2UB 3MF5A 1JNRB 4HHHA 4K2JA 3I4PA 3IM8A 4ZHRB 2ZEJA 4KJIA 2P6TA 5B08A 1CC7A 3R2DJ 4LFAF 3ISZA 2CQIA 1C0UB 2M0GB 1LQ9A 2R7TA 2NUUG 4ILMA 3IS9B 2ZFHA 4H4KC 5BYSA 3EGWB 1R7IA 2N3LA 2OKQA 4FDFA 3W5YA 2VBYA 4RU9A 2GV1A 2D41A 2M7SA 4LF9J 4ES1A 1KFDA 4OZLA 2FJEB 1BQMB 2AWZA 2MLXA 4ZPDA 4EFAC 4WTOB 4OV6A 4J9OA 4IFVA 2QLJB 5LMNJ 3C46A 2BM1A 2AV5A 1HWUA 1HNVB 1OSDA 2IM0A 2Z56B 1IM4A 2CPZA 3DOMB 3M2RB 3OT9A 2ZC3A 3KJFB 3S01A 3W66A 5L1JA 1OSCA 5L1IA 1J5EJ 3QT6A 4LVNP 1CJVA 4UOGA 1NH8A 4Y28C 5AE2A 3RBXA 1ROFA 5E3CA 2HMIB 3D28A 2R7OA 5D4LA 3KG1A 4AL6A 2HGNA 3J7A1 2KDOA 1V9OA 2HQ3A 3H5SA 4C11B 3DC2A 3DM2A 2GVZB 4B3RF 2HFNA 4N8NA 4OIXA 2WZ1A 4RKUC 4WP8A 3MZIA 5D4PA 5EN1A 4LIRA 1GT8A 4DF8A 4BC7A 1UFKA 1NZAA 3OJSA 2B6AB 1J5OB 1TL4A 4ZPVR 1MMDA 3DLEB 3RG6A 1X31C 4DS4A 2WVCA 5JXSA 4WZQA 1TK5A 1AYEA 1PC5A 3H40A 3WX8A 1JLBA 3R27A 1C0TA 1WTBA 1GNKA 3UDCA 2JC0A 2K06A 2B4VA 2RAQA 4DV7J 4XTTA 1X9SA 1IBMF 3QMQA 2MSSA 2YNIA 3R5GA 1LEOA 4ZCKA 3VQTA 1VQ7S 3R5AA 4RW4B 2UXCF 3LP2B 4A8KA 2BKPA 1JXLA 4V19J 3DOMA 1CJKB 1TP7A 1V3SA 3FZBA 3M2RA 3V6KA 3KNAA 2W2PP 1T05B 4YP3A 3K5MA 2AU0A 2Q3PA 3QSYB 4J9PA 4GVBA 2FHMA 2P5VA 4OJGA 3J81j 2JVOA 4DG1A 3ZZ0A 5BR8J 1Q82T 3I9ZA 3BGRB 2F1FA 2UUBJ 3VVUA 1VFJA 3VAKA 4G6VB 1RGVA 5I4MA 2F4VJ 5KFIA 1S5ZA 1SH2A 3QT5A 4LF7J 2K8GA 2F65A 3A13A 2JEFA 3HLUA 1TVRB 1T3OA 4DV0J 5KFQA 4LT6A 3GV8B 2BQ3A 2C3UA 4W92B 4R0JA 2MY8A 2PO4A 1RT1A 2MZTA 2LQ8A 1R0BG 1TL3A 2GIFA 1TELA 3CGIA 4MYTA 4X66F 4CLFA 2XM3A 2ZH1A 4CO1A 2G9OA 1C1CA 5KFSA 1SQGA 1Y9OA 3M6VA 2N4CA 1QD1A 1JB0C 1FT8A 1X5OA 3UCUP 1P6TA 4C8YA 4NLGA 3RBDA 1TKXA 1Q81T 1HQEA 4DV6F 5FJ4A 1DQ8A 2BDPA 1FK9B 1IUJA 2HIQA 2HKEA 3DXBA 1FNMA 5H9FJ 4NOHA 1D09B 5M2PA 2OP5A 2A1BA 3CD5A 3M2VA 5KG1A 1B70B 4DQQA 4WBFA 2DRBA 1OY9A 3CJ5A 2RIJA 4NCGB 4AE5A 2HHHF 1NPPA 5KFRA 4DR3F 1VLOA 2DNLA 2XB2D 2EW9A 2YKAA 2Z30B 1EJ7L 3ADAC 1WEZA 3OR2A 3ZO7A 2MB0B 3QRPA 1KKHA 2B3TB 2J7KA 3MPVA 3HHNB 2M9KA 2ZJPQ 4E8UA 1FRMA 2JX2A 4AYBD 4PKDB 2CPIA 2HG4A 5DS7A 4YFUA 1ZZNA 1JX4A 1FXDA 1DURA 3Q83A 5HI7A 2PD1A 3KG0A 3LQVA 4NXNJ 3NWRA 4FKXA 1J5EF 4ZPCA 1N0VC 3R8YA 4MKAA 2QX0A 4K5RA 5LMNF 3GFZA 1U6BA 4UW2A 4ANCA 3HI9A 3MR3A 1YI2S 4Y2IA 1U1MA 4YB5A 4LBPA 3NEKA 2QTWA 4WFZA 3BN4A 1YRUA 3IR5B 3ZC4A 4LF9F 2G1DA 2JC1A 2M70A 3HHKA 4YQWA 4OZ0A 3UFCX 4NXNF 3HD2A 2AGPA 2IAJB 2JFDA 3IBWA 4LMZA 3RRGA 4WCEQ 1X4GA 3GWCA 5KFPA 4U96A 4JI4F 2J8AA 2RJZA 1EQ0A 1SUQA 3GV5B 2E5LJ 2Y0BB 1Y11A 4RWWA 5LMUJ 2QA4G 2DNZA 4WKRA 2H1YA 2A18A 3KJQB 1RAJA 2HNYA 4FVCA 1B0VA 3MURP 2EC2A 1GTHA 4PQUA 1MSWD 3MFHA 3Q89A 1RT5B 1SC1B 3PX0A 2FVPA 2CZ4A 3D9BA 1ZYQA 2Q66A 1XTZA 2W2MP 4NXMF 1B7YB 4JI3F 1TV6B 2ZUAA 3ZFVA 3G82B 4CYUB 3MUMP 2R4FA 3GIIA 3SZ2A 1F0XA 4URGA 1KQSR 2V34A 2FY1A 4MKVA 1C2PA 4FXWA 4P73A 1FKPA 3TZWA 3TAQA 3SCKE 4Q0BB 1HNVA 2RQKA 1GTEA 2JOQA 1NJZA 1VQ4S 4Y34A 2DHAA 4KB7A 2JEIA 1N5QA 2VBXA 2ZE2B 3M8SA 2MTLA 2QMWA 5C24B 1IM6A 3IG1B 2NLWA 5LOQA 2BEFA 5D8HB 2A2DA 2IM3A 2XYPB 3GG0A 1CVJA 2F8MA 1HQUA 1LOUA 3FK4A 2FHJA 5IM0B 1PJ7A 5B0AA 4LFAJ 2XO7A 3DOLA 4F2SA 1HNIA 2FZCB 2DHSA 3Q22A 2EG2A 1AROP 1FDAA 2A3JA 2OPPB 2X1GA 3AODA 1N33J 3IO1A 2H3EB 2V2KA 3PIOQ 3HHLD 3OPKA 3U1LA 2KH9A 1DHMA 2VOOA 4ZVHA 1JLBB 2V8HA 5F8HA 3PV8A 3LOUA 4ICLA 4KBIA 3OHBA 1RBOB 4J7CA 4DV3J 3JQKA 4HACB 1TV6A 3SDEA 2VL1A 2BANA 2HBYB 2Z2MA 4QIWD 1S1TB 1U2RA 3RUBL 2WVBA 4QWAA 1RT5A 4HH0A 3GYNA 2AMCB 1VRUA 3NCRA 5GAHI 3HZGA 2V68A 2RVJA 4HHUA 4L72B 2VG5A 2E9ZA 3DN9A 2HMIA 1FVSA 4OX9F 2VG6B 2XSJA 1D9AA 4NZ6A 3I96A 4CNZA 3PY8A 1X4BA 3R9LA 4IRDA 1JLQA 4IH6A 5HMZA 2GNKA 3I4HX 4L76A 1RTIA 4HACA 3DLBA 1NPKA 3JYTA 3H7HB 5A6PA 1XMOJ 2KZMA 1UVKA 2L08A 3HSJA 1HFEL 2VQEF 2ATLA 5EX3A 4A8MP 2OPPA 1XC9A 1H0HB 5A8RA 2JDJA 4CM0A 2XMAA 5B0FA 3FSIA 3BSAA 1RTZA 3MM5B 4OZ2A 1NDKA 5GMEA 3EGZA 3PIPQ 2MLZA 2LLZA 1Y3KA 3BQ1A 4AL7A 4DL4A 1AB8A 3BJYA 2OSQA 2NZ4A 2HS0A 1AA1B 1B0PA 2KJVA 3BR8A 1I1GA 2UVUA 1AFIA 3DFEA 3MM5A 1DFDA 3T3FA 1U0SA 3MEKA 4ECUA 3VAIA 2OEJA 2I9SA 1HBUA 3TP2A 4J9RA 2MQLA 1DTTB 3VCDA 1F3FA 1WNEA 5D4OA 1DTQB 2GZOA 4CO3A 2VU5A 2Z57B 4U67Q 3N5BA 3MHYA 1NO8A 3EVMA 3R5CA 4A8QA 5E3AA 4J9LA 2KT5A 2RDDA 5FIIA 1KDNA 2RF2B 5DQHA 3N4WA 3K89A 2CPXA 3M8QB 4BCAA 1SC3B 4MAKA 1N4LA 3QWPA 1BWVA 2G2YA 2B4PA 1NB2A 2XULA 1VRTB 2Y0SD 3LP0B 3DRXA 3DGPA 4DV5J 4ED3A 1RTIB 2OD4A 3NGDA 1UZDA 5E3PA 3FRZA 4X4UA 1K44A 4JI0J 4H54A 3LGMA 4RZRA 4F50A 4FYWB 4NMLA 1NDLA 2BUNA 1O6XA 2NPFA 2HVIA 4ZVRB 4MKYA 1GXLA 3LP0A 4ZVOB 2CAJA 4RL1A 4O0IA 1SV5A 3QGHA 3G6VA 2ZOFA 3OTEA 1WHYA 4UOFA 3KOAA 5IXUA 2R7XA 3C2PA 5CXTA 3UDVA 3PHEA 4CO4A 1QAXA 3EICA 4K0KF 5ETTA 4RR5A 4WF9Q 3GFYA 4G1PA 4FS1A 1VS3A 3TX0A 1KP6A 3NAIA 3EXYA 1KLMB 5J1EB 2HBRB 4PXDA 3AQPA 4QCLA 2AW0A 1H6KX 3N6MA 5B0DA 5T7LA 3CCQS 2GAHC 3I55S 2DNKA 3HFZB 4P72A 4IKAA 5L9NA 3OUYA 2CQ0A 3S7RA 3GIJA 4IRCA 4TYBA 2HGLA 1K1QA 2YKNA 1U26A 2DHHA 2YVSA 3ENVA 3M32A 5HQMA 3TAMA 5HMYA 1AZSB 5GADU 4F4YA 4LF5J 4ERDA 4ECQA 2Y1LB 4KHRA 4H4OA 2H48B 4C0OC 1HYSB 1NZ8A 4K7QA 4WFXA 2IBKA 3CD6S 3FSXA 1RHUB 3H5UA 2DCLA 2K2PA 3SQGA 3T6BA 4DSFA 4YB7A 2OPSA 2BZ2A 3UVJB 3B82A 5HLFA 2PT0A 4LRAA 4RW4A 1YQHA 3M2UA 5KG6A 1REVB 5KG7A 3Q0AA 2VHGA 1H7WA 2Q6BA 1YIJS 4EWTA 3RR7A 2BW2A 3JQJA 3T19A 4MFBB 1CLFA 1SH3A 2IRYA 4DR3J 2GJ2A 5GMKa 4B3TF 1NUEA 4J9NA 1W26A 4K4WA 3VGSA 1FKPB 2X3GA 5DJBA 5KFMA 4M63A 1PSDA 4FZVA 3T6JA 4Y3CA 3BDEA 4WFYA 2VONA 4ZITA 2OPQB 5J1PA 1FTCA 1M5PC 3R7SB 1BMQB 4D3GA 3GFHA 5LM7E 2YNGB 4USJC 2OLWA 4U7UK 3NWGA 1M5KC 3MAAB 2BACA 1AUSL 4TYAA 1IKXB 4AD6A 5GAEU 4ELUA 1C4AA 1R3NA 1WSRA 3IC1A 1RT4A 1RTHB 1XEZA 2XMJA 3FQKA 3HFVA 3ZTOA 1YJUA 2HNYB 3EVOA 5ETNA 1B4SA 2BRLA 1HL6A 1XIQA 4XDCA 5AJ3F 4JBCA 4IQXA 2BANB 4DUZF 4DU8A 2BJ3A 2IYIA 4DV4J 1YGYA 5F8GA 3LGNA 1PC4A 1X9MA 2ZH5A 1Q95G 1FERA 4WP3A 4LF6F 2U2FA 5THWA 3ZZTA 2UUTA 5MLCV 5BXIA 1XNRJ 2MPUA 3QIPA 2E7XA 4C0HA 3MMBB 4RNHA 1TL1B 2CNLB 2DR7A 3JTOA 2MMYA 4MIAA 1L3KA 1WTFA 4MK9A 3E51A 5ETRA 3UPFA 3EE3A 5GAEI 4Y2KA 3DI6A 1VQ6S 4BWMA 5LXYA 2GHPA 5F9LA 1ZA2B 5IC4B 4TY9A 2G13A 4FYXB 5LJ3Y 2LECA 5HATA 5LJ5Y 1SPBP 3BKFA 2ZHOA 2HFVA 3UR0A 3BKUA 4Y00A 4DCPB 2BJ1A 3J7AN 1JLCA 2CJ9A 1RTHA 2XMUA 3QT8A 4XAKA 4CLZA 5CZVA 3M30A 5KFGA 3QZ7A 2LXIA 3BEGB 3O1LA 1HMVB 4F26A 3C15A 2QL7B 3MR7A 2XG8A 3LAKA 3VQSA 2IBOA 4I2QA 2HFZA 1APSA 2PI4A 3AOCA 1YX2A 1R0AA 2NR0A 5A8KB 2KTQA 4J37A 5IT0A 2R2RA 3ZXWA 2AKWB 2E1CA 1TKDA 1QSYA 1N6QB 2HZAA 2RDIA 3QIPB 3N79A 4CLUA 3OLAA 2MY7A 4ED8A 1FCAA 3QQCD 2VA2A 1GFWB 2HLUA 1B99A 2OPRB 1PO6A 4KR0B 1TL3B 4N41A 3QJLA 2W4DA 5F0WA 3OJUA 2ZZMA 3G8QA 2KYZA 3P4UB 3CCUS 1VQYA 3KLVA 4PXCA 1VRQC 4O3QA 3FDSA 3VR1A 4B3SF 1NBEB 5K8NA 2CZVC 4M8LA 5F8NA 1HBMB 1FVQA 1RISA 2B51A 2B43A 1UW9A 4URQU 4F0HA 2MKHA 3FCWA 2VQFJ 5KG0A 3PVXA 2BQUA 2QC3A 3BH6B 1TKZA 3TQ1A 5SUHA 1XWLA 1HHTP 1LW0A 4EO6A 3NRBA 5CD4A 4W90B 1XBWA 2D9PA 5FDLA 1YLXA 1FO1A 2XS7A 3PKMA 1M0SA 2WOMB 4TU7A 4ECRA 3R5JB 5EX0A 2HVZA 2J5AA 2J0SD 6FDRA 1R31A 4DV2F 1TKZB 3KLGB 3LP1A 2UVRA 5J2NA 2W2NP 4JP8A 3FZ2A 4UUXA 4DPWA 5KFTA 1WSVA 2NXCA 2YNIB 3P5BP 3I5AA 1U1QA 3PJWA 1NK8A 4LF8J 1TKTB 4RUCA 3TJ8A 1U1NA 4RBUA 4O4RA 2OEMA 4FP9A 2L3MA 1WEYA 2DGUA 3NGSA 4O3NA 1ULRA 1CJKA 3KLEA 1HR0J 4UY85 1T9UA 3CJ4A 3EGNA 1FKOB 2XMVA 2MHEA 3VF0B 3HM9A 3PYDA 1F60B 3MECA 2X3DA 3EVWA 2J7UA 4IO1A 4RW7B 3VTIA 2F4FA 5B0CA 3KJVB 4WYWA 2DIUA 4JI6J 2J6UA 1R89A 4H4OB 2B9EA 5D15A 2KYXA 4Q7AA 3W62A 1KQKA 1R27B 4QQBA 5L9XA 1XK8A 1D8YA 4PG6A 4B9UA 1OWXA 3W63A 4GKKF 3G86A 2DISA 3M8PA 2W7OA 1HI8A 1G4CA 3UCZP 1FNOA 1O5JA 2F9JA 3B6BA 1H72C 1NDCA 2DEJA 1U02A 3OSPA 1G3OA 2BMBA 1KLMA 5J1EA 1AW0A 4RUHA 3M30B 2KI2A 4A8XA 1L3VA 1SH0A 2L9WA 2ZOMA 5C7PA 1NPRA 3A1YG 4O0NA 1N48A 2HS3A 4WFAQ 3I56S 2FVQA 1REVA 1WG4A 2PA3A 1XMQJ 4KO0B 5KT2A 3NNHA 4FKYA 3PG9A 5LMUF 1HBOA 2W2QP 2C2MB 5E3QA 4DPTA 4G65A 1S99A 4FBTA 4TKTA 3NNAA 3IAS9 2CRLA 5LXRA 4IFYB 2EPIA 3NKYA 2IY5B 4DF4A 2ROEA 4NA2A 3D6TB 3VAMA 2X1BA 2ERRA 4RW9B 2MKYA 1SBRA 2UV8A 4ZIVA 2BXJA 2YPYA 3FBEA 1J27A 5IZHA 4JI5F 1EP4B 2HURA 5DG7A 2Y1JA 1FEEA 2ZWOA 5DGBA 3W5XA 2X7IA 2QLXA 2KM8C 1QAIA 4NCAA 3IWXA 3HDSA 3CDUA 3AJ2A 4F2RA 1YRXA 1Y10A 3OXGA 1FD2A 2PFDA 3IRXB 3OL8A 3TZXA 2LEBA 3T1HF 3JB9k 4GKJF 1V3RA 3RB3A 1FJGF 4WZMA 2DVIA 3BSOA 4CNYA 2Q6CA 4ES2A 5CABA 5DM6Q 2IIHA 2VICA 4F8RA 3Q8YA 3GILA 1NSKL 1AXQA 2F63A 4NX9A 2VQEJ 3BGFA 1S1XA 2RRBA 1HA1A 2HRUA 3DDNA 2G0IA 3G2XA 3KK3B 4PWUA 1S57A 1FF2A 2WB1D 5F3TA 4DR5F 1P9QC 4IYQA 4DHVA 3D4JA 3JAMU 2V4QA 5F0UA 3T1YF 3WIVA 3O2IA 4CLYA 1FJ7A 4F25A 2BRKA 2YX1A 2R8HA 1S12A 2E1MC 2P9EA 1AT1B 3C8YA 7FD1A 2MZ1A 3UO0A 2R7RA 4QU6A 2BM0A 2HHQA 1YTYA 5DLFA 3MM6A 4C48A 1R43A 4URSA 3TZYA 3QGGA 3RB0A 3LPEA 5I42A 3ELHA 4NPOA 1RTDA 5F9NA 4WPAA 3ZZOA 4OI0A 2WONB 2V4RA 2KHDA 4PG7A 3MOJB 2DIVA 4W98A 2R7SA 4OZ3A 2YQ1A 4EYIB 2CNOB 1FKAF 3DLKB 4ALZA 2GO9A 2BVZA 2XHCA 4KHMA 2FGOA 3THVA 1JJ2R 2AJ2A 4U95A 5DLGA 1IKWB 1CC8A 1TUWA 2YH0A 2LVWA 3ZZYA 2RMLA 3MI7X 2IDLA 3CB4A 2CQCA 2RUGA 5HANA 1JLGA 3OFHA 1Y5IB 2N3OA 1DLOB 2XNQA 4LF8F 2AIRB 1S6QB 3CSKA 4NASA 4C97A 2N82B 4LSNA 4CCHA 1G1XA 1LFWA 5HAOA 2CNNB 1TFYA 1R6VA 3EZ5A 1M1GA 2QE5A 4ID8A 2C28A 4USVA 3W5ZA 4GC7A 1JQGA 4PRFA 3HX9A 1ZAWA 3P5TL 2ZOGA 3PACA 2ACMA 5M2UA 2J6SA 1QVGR 2RQMA 4ECVA 1CQMA 3TARA 4FN5A 3UE2A 3JSBA 3OTBA 4DUZJ 4X64J 1TAUA 2I5JB 5E2QA 3NY0A 4YR3A 1DBDA 1A6LA 2LQJA 2MQNA 1VQNS 4C8ZA 3T5LA 3MR6A 3THTA 2KZZA 3V6DB 2FC9A 5IM0A 4AUKA 2Y8YA 1RKIA 1U0HA 1K73T 1N32J 2R8IA 4DU7A 3MFIA 1IBMJ 2A0FB 4KSEB 4RPFA 2V8DA 4X4PA 9RUBA 3TA2A 1VCTA 1ZH5A 5A8WB 4DR4J 3DMJA 4QIVA 1S9EA 2W2OP 3KK2A 3S6EA 3SDEB 3EPIA 2F9DA 5KT4A 3HK2A 1CJTA 2VG7A 1CBKA 1DTQA 1WC0A 1R8AA 2RS2A 2KRBA 2Z2ZA 4ITSA 1QJHA 3MPDA 3QAUA 1W25A 1FX2A 1PG5B 2RILA 3FBCA 2XHWA 4NLPA 2FJWA 3EJMA 1PIEA 4IR9A 2R9LA 3UN3A 1JKHB 1NK5A 3W3SA 3NP5A 1T9YA 3GU0A 1WWHA 3NCPA 1Q8IA 4LRFA 3NOGA 1JJHA 3C6UA 3V6JA 1Q86T 3T5JA 2CWKA 4NYPA 3B4MA 2BQRA 5KTQA 4BWJA 1SXLA 4ZP6A 2R2SA 3FUYA 4U7UD 1SJRA 4ZLLA 5H9EK 3V6DA 2KVIA 6FD1A 1VYAA 2IPOB 2X51A 4GO5X 2W01A 3VGUA 2W9AA 1FEHA 3K58A 2QFJA 2WVFA 2ZBCA 4DPYA 2OHDA 5D3GA 2LU2A 2W9CB 1HWJA 4X64F 2OMOA 4RW8B 3OHAA 2HQCA 2KFNA 1IJFB 5C42B 3EDQB 4YS2A 2CFXA 3JYTB 1S0MA 2HNZB 2UUAJ 2O3DA 3EXCX 1VJQA 2VUGA 3AXKA 3I6PA 3NBPB 3IGNA 5IC6B 3TA1A 4LF7F 1S6PB 1ZM3A 3GSDA 4IFYA 1I5OB 2FC8A 3TZZA 2QYGA 2WOMA 1K8AT 3PJXA 1V5VA 2HRTA 1CS4A 2QSWA 1I51B 2CJYB 2MKSA 3CCTA 4G1IA 4QWDA 3K57A 1MROB 3D1QA 2WVEA 1HBUB 1I3OB 2YWGA 4DV4F 3SIPB 2CQ3A 4L73A 1NXIA 2XY5A 3ENWA 4USTA 5ETSA 2UXDF 3EMTA 2ALZA 1H7XA 2GVDB 4OX8A 2HHUA 4RUAA 5L46A 2ZVSA 4P2FA 2IRUA 3M9MB 1T94A 3M8RA 4G1QB 2PE8A 1MN9A 2D69A 4WE1B 2IFXA 5DO2A 3X3UA 2ASDA 1RCXB 5B0EA 4X4VA 1HBOB 4FXDA 1GH8A 4HLBA 1AUDA 5B7WA 3DRRB 4KKOA 4QIFA 1U25A 4YOEA 3H2LA 3CO0P 4O3PA 3NXZA 3ULHA 1NK4A 3KHHA 2WVDA 4KH0B 1EETB 3BQ2A 1UWBA 1FXRA 4ZCLA 4OYZA 2QMXA 3IBFB 2AT1B 2AP6A 3HJFA 2FZKB 3CDBA 2YXLA 1RYRA 1IBKF 1XNQF 1CQNA 2BYCA 4B3TJ 1RA6A 5C2CA 1HPZA 4WJBA 4X84A 4X62F 4ED4A 1FDNA 2HBQB 3FEZA 3W1YC 3NOCA 3CIMA 2H54B 4A47A 2MJUA 3KJNB 2YBVA 1W7WA 2CA9A 2H65B 3QYYA 5DDRC 5K14A 4DR6J 4CO5A 1N33F 2FHJD 3IBCB 3L7PA 4DI6A 3Q8VA 2WSCC 3VHQA 4ZIWA 5CYMA 4GKJJ 3AJDA 3T1HJ 1UTAA 2MLYA 4JI7J 2FJAB 1F5BA 2E44A 3RRKA 4IOCQ 3A8IA 4YY3F 1SKWA 4RBVA 3E2EA 4K4UA 4NRTA 5BYRA 4N7TA 3ZNUA 2I8EA 4ZP7A 1QE1A 2R7QA 2FLOA 4LRBA 4B08A 4TXSA 2VJUA 3CT9A 1FXLA 3BBCA 3CMQA 3OR1A 3RZAA 3VWSA 2E7WA 4N47A 2V2VA 5A0YB 3ILOA 3O3LA 4ZN3A 2GJFA 2GGPA 3BGRA 5KFJA 4IR1A 4PWDB 3JS9A 2VFSA 3NGKA 3K5PA 3KLGA 4K0KJ 1HD1A 1UPMB 4LRDA 1T0TV 3D66A 4ZP8A 3KHRA 2E5HA 3OTOJ 4WU3A 2CVEA 5LSOA 2KB2A 1H74A 3RW7A 1WOOA 2CDRB 2E1RA 3UDLA 4PQAA 3CJ3A 3DCAA 1HARA 1X9WA 3PYEA 3W9IA 1BQMA 1K1SA 1Y5LB 3M9NB 3VAGA 4M94A 4LR8A 1RT6B 1LWEB 3HSZA 3KLIA 1GXTA 4OYPA 1V3ZA 4HTJA 3BB5A 4NRUA 4Q43A 2K7KA 3OD2A 1M1HA 1NJXA 5CCLA 1G2EA 4X4OA 1U6FA 3SQOP 2DPJA 1VQ5S 4FBUA 4F67A 2RU3A 2XS2A 2YNGA 1IR0A 2GW8A 2F3JA 2VFUA 1Y5NB 4Y2AA 2I2YA 4KY3A 3Q2SC 5CYQA 1RBAA 2DY9A 2V9KA 2WCXA 4L6V3 1U45A 3SV3A 2XLKA 2DGTA 3FJ2A 2C2OB 1KQGB 1LXJA 3MD1A 4NLUA 4JI6F 3UDEA 2DH9A 3KK1B 4I1TA 5ETMA 2MKIA 2ZH9A 1NH7A 1JLEB 2DRAA 4C4WA 3T5KA 3R7NB 3HT0A 2R3VA 3C14B 2DXDA 3DRYA 4RWXA 5HVGA 5GAHU 1S97A 1R6YA 3LF0A 3RBZA 3I5CA 4OX7A 4Y65A 1VBYA 4O4GB 1NKBA 2IMOA 2YNHB 1NK6A 1XMBA 3DI6B 4PABA 4IDKB 3BO2A 1WF2A 4PYDA 1UWAA 1UFLA 5F8LA 2R8KA 3OL9A 3TRGA 4B3MJ 3FKBA 2KT3A 5LL6d 1TL1A 1DLOA 3O6QA 1JLGB 1VBZA 3A4TA 1TL7A 3LP1B 4UQTA 4ZVUB 4DX5A 1HNXF 2JRSA 2YX7A 2JLGA 1NK7A 3QNWB 2DR5A 3I32A 2H51B 1RBLA 1VBKA 2V63A 5E0OA 1C0UA 2ASYA 1XNQJ 2AGOA 3DM2B 4USIA 2MKCA 4GVLA 1M5SA 5L1KA 2DR9A 3N0VA 2WONA 3W8PA 2HHVA 3N6LA 2N7YA 1ZA1B 2DO0A 4O3RA 2BR0A 3FRYA 1N32F 1U8WA 4FNHA 5DM7Q 4DFJA 1T7PA 2XMMA 5ETPA 4TQRA 3MCSA 4WKYA 4WK1A 5C25B 2MQQA 3QAEA 2MDAA 1N5YB 4B9SA 2ADCA 2OELA 2PA8D 2XZWA 3ILLA 2E5GA 2QN6B 2GO8A 1GAOA 3D3BJ 3NG8A 4ZVFA 2FVCA 2KU7A 4P9SA 3BDPA 2C22A 3G8SA 2LDIA 2J0WA 3DLHA 2Y8WA 4C11A 3FGVA 3V5RA 1RE1B 2NXNA 1R0AB 2XYHB 4IG3B 3PYFA 2W7AA 2VH7A 4OZ5A 2FZGB 3I5BA 4RLEA 5JUMA 1NK0A 4GKKJ 3CTRA 4ZN1A 1U1LA 4B9TA 3PR5B 1YJNS 1PKUA 3C15B 3LP2A 4ID5B 3W61A 5AXLA 2WTFA 1FRKA 1UA1A 2EFVA 2YWKA 4H4MB 4RX6A 3QIDA 2OI2A 4IG3A 3RAMA 1HKAA 1QDUB 4FVMA 4ZVGA 5KFOA 3IFEA 1X4FA 3KTQA 1RAAB 4K2XA 2J0XA 4RJVA 4K4TA 3CCZA 1WEXA 4A46A 2DNPA 4CZCA 2C2DA 3LO3A 4JI2J 4LFBJ 1L3TA 3GSIA 3RAXA 2GQCA 4LR9A 4EZ6A 3GZ7A 2HVDA 1SIWB 3CCLS 2DKOB 3CWJA 3HKWA 3HFKA 3EZOA 5HVHA 5EDWA 3CJ8A 1MWZA 1LW0B 1HHSA 1OY8A 2OFHX 3MMBA 4M5LA 3AB4B 5B0GA 5DDQC 5B0BA 3CVKA 3TVYA 1IKVB 2RNEA 1UEKA 1U2CA 4Q2MA 4ZMMA 2M5YA 1F5AA 4USKA 3RW6A 1UEVA 1SIZA 1Z2ZA 2ZJQQ 1YJTA 2FIUA 4P2MA 2UXDJ 4EBDA 3GPAA 1T05A 3TUPA 3EWGA 4JUZA 4JV5J 3QO9B 3FCHA 2DGXA 1JWWA 3V81B 5AJ3J 1H2TZ 4CO2A 3G6ES 2UP1A 2HK2A 2Y9HA 4OZ1A 4ZVSB 1RT3A 3CD0A 2VOPA 1REGX 2HIYA 1OS5A 4ZKAA 4DLGA 4ECYA 1S9GB 2JEJA 1WOSA 2B9YA 5G4DA 3J80U 3FBFA 3CJTA 2H5EA 1BHNA 3M8PB 3CC4S 2F4VF 4M95A 2HHPA 2YKQA 1IQTA 2YTCA 3M8QA 3B78A 5A0YA 2EWHA 3NS7B 2VC1A 2FLNA 1S1TA 3LA0A 1W2IA 2F7VA 2XYGB 5HMXA 4DR7F 2IRXA 4M5JA 4A48A 2F40A 4WK3A 3DGPB 1CEZA 3MEGA 3KUEA 3PTWA 5DGAA 2AJQA 1RXOB 1WHVA 1KQFB 4JI1J 1HWLA 1T9TA 1UPPA 5C2GA 3TNVA 4Q44A 4RU2A 4ECTA 3QLHA 2XGPA 3CDEA 1Z1ZA 3FNNA 3BF4A 4TY8A 1F2GA 1FFWB 3PRBA 4KGKA 4WU2A 1Q7LB 1YDLA 3ZZUA 3ITHA 3UVJA 4C0BA 1RABB 3ENAA 3C6TB 4HR2A 4OHVA 5CYQB 2CYYA 3AOBA 2I38A 3WC0A 3BZQA 3W9JA 4DS5A 2UVVA 1IKYB 3A8EA 2C2NA 2XMKA 2ZBIA 2RUSA 5ADZA 1HYSA 4I6AA 3EZUA 3JSYA 4DDFA 2GIRA 3IG1A 2VBWA 4A8SA 1B3TA 3GB0A 1P27B 1U6ZA 5EWEA 2J7WA 1HNXJ 2HHHJ 3IGVA 3ET6A 4ZVTB 3UWTA 4OI6A 3MTJA 4KT0C 3TUIC 1X0FA 3GTYX 1PGZA 2PDAA 2R2TA 3W2VB 4LRCA 1S1WB 2CVIA 5IV4A 5KOXA 2MGZA 2NXJA 4IG0B 4FF3A 3N01A 3R6LB 1SJQA 4TLQA 4Z7CA 1N0UA 2I6WA 3HSGA 2D3OR 3K17A 1KC8T 1JK9B 4YB6A 3Q23A 4F4KA 1U09A 4PUOB 1SC4B 2B9WA 1S9FA 1M5VC 2E29A 3BR9A 4PQUB 4ZJLA 1RWVB 2RE1A 4DFMA 2MQPA 3KK1A 3NL0A 4JI0F 2LXUA 3MPWA 4WYLA 4DZ6A 3QRQA 4WTYA 1F9EB 3DNCA 3OR1B 4ETZA 4DR1J 5ETOA 5ITHA 1NU4A 3DDIA 3TX8A 5K9FA 3HO1A 1UAWA 3F41A 1S49A 2QO3A 3R5DA 4C3KA 2BE7D 3CUNA 4O44B 1FJGJ 2V8PA 1DQ9A 2CG8A 4U9RA 2QZ8A 3D54A 2DR6A 5IT9Y 4KIAA 5KFBA 4ECZA 4OFZA 2QL9B 1XJWB 2U1AA 4ZK7M 2AZ3A 2XI3A 1YJ7A 3NGUA 3EDRB 3KFWX 4E98A 4LSZB 2FJVA 1URNA 1R8PA 1GK8A 2NCKL 2C3OA 4NMXA 1X0PA 2EG1A 3OTOF 2DITA 2RKIA 3W60A 3D67A 2XZTB 3M6WA 2HZCA 2GFFA 4KGVB 4M5KA 4F0MA 4AXJA 1MLAA 2ZE2A 3DOLB 2KT2A 5KFDA 3GYXB 3ZTRA 3GE9A 3C3LA 1DAXA 4M5MA 2M88A 4I6YA 3OUYB 2J9DA 3CNQP 1NJWA 3NMRA 3CJ2A 1SI9A 2YNFB 1B7FA 1UETA 1KS2A 4Q0BA 5RUBA 3GCWP 1D9DA 3GJRB 2ZBPA 1XMQF 2I0XA 1Q1KA 1PJ6A 3IAM9 4KFBA 4NLQA 1RTJB 1SJ4P 2IVYA 3D1OA 3CW2C 3MMCB 1ACMB 2C2RA 4JYAJ 2OO4A 3M4XA 4DN9A 1ELOA 3CJRA 5KFYA 4C3LA 2R7VA 4TN2A 2K7JA 1KVJA 3R6GB 2GMJA 2CJBA 2ZH7A 4DR6F 1X7VA 3V4IB 2HFSA 2DNHA 4DSKA 2OGUA 4RBTA 2Z2LA 2O67A 5I3QA 3U1MA 2R2UA 4Q5VA 3BPDA 5D78A 3N9UC 3A3PB 1VBXA 3MOZA 3D2WA 1FRLA 2BA9A 3MEEA 1RHMB 2HAIA 2Z8QA 4NEYA 2XMWA 3PNIA 4J9SA 1S6PA 5HP1B 2IC3B 1WC6A 1QAJA 3KDOA 4CLLA 5HROB 2CPJA 3KMSA 1EIYB 4NL5A 2UXBJ 2MYFA 3ILIA 2J0QD 4QJVA 4R0EA 3ZZPA 1GEHA 5EHHA 4A8OA 4RNNA 1HI1A 1OJ4A 2EKNA 4OYIA 1I6JA 3BREA 4C8MA 3T41A 3LAMA 4LF6J 2IM2A 1JLCB 2DGQA 2DXFA 5IS2A 3OVAA 4DV2J 4LFCF 1HNWF 2DEIA 4ANDA 1VOMA 3LGHA 2JZ5A 4LF4J 1JKHA 4ED6A 3D6MB 2DPIA 3DLKA 3F44A 3VALA 5EUHA 3HMJG 4PEOA 3G6XA 1LV5A 3N28A 4LQ9A 3UQSA 4I6WA 5KFCA 1CJTB 3PO4A 3QRRA 2VQFF 3WZ0A 4R8UB 1NM2A 2PSZA 5BJRA 1VHFA 3A3OB 4TY8B 5A8RB 3Q8SB 2W25A 2UUAF 2BE2A 4OYBA 1FE4A 3QGPA 1Y4ZB 3BH7B 5K8OA 1D8ZA 1TUGB 3MR5A 4ILRA 5DG8A 1ZTWA 2E9RX 1Q4RA 3B4DA 2W9CA 2YH1A 1VQPS 4A8YA 2GX8A 3J7Z5 5D3GB 1S79A 2CXEA 4ZDNA 3RJMB 1RI7A 1HQEB 2ZBRA 1S76D 5AE1A 4IQMA 2YX4A 3CC7S 2OTLS 3G8TA 2GVDA 1BE4A 1Q0NA 2CIMA 2UU9F 4OZJA 1JXVA 4F3OA 2DNRA 4OX6A 3CO9A 1SKSA 3VZHA 2PC6A 1IR2A 2EFNA 3F56A 4RUBA 4WWSA 5IFMA 3RB6A 1U0HB 2E66A 3OFEA 2FJXA 1O8BA 3M8WA 2EFGA 2HVHA 3MDFA 1KHWA 2AJFE 5B09A 3DRPA 3FVYA 2KFYA 3SFUA 3W2WB 1U1RA 1U1OA 4K4XA 3BPSP 3PW7A 4F7VA 3MM9A 4A8WA 2DO4A 4Y0FA 4NZ7A 4JV1A 2EC0A 1RLCL 4I67A 3DLGA 4KYZA 4RNFA 4X4QA 2EFOA 3AD7C 3I0SA 4ELTA 2OMLA 3ZTQA 2G2ZA 3FEYB 2BJDA 1H2UX 5CH7B 3TOQA 3IS9A 5C25A 3SCJE 1FRJA 4B3SJ 1CSJA 1KR4A 1WC3A 2POKA 3SQGB 2DGOA 3S8SA 4YB1P 3K7RA 2CNKB 2JEGA 4DSIA 1G6BA 1YK9A 4P74A 4I68A 1RQ0A 3TVKA 4QBUA 1HNZF 4LQ3A 3C6UB 4YEAA 2BABA 4ILLA 5IWAJ 4NI2B 2YKNB 4USHA 4K4SA 1WUUA 1Q8LA 1RT3B 2PI5A 2V8GA 2HWTA 5DQIA 1OQ6A 2NPIA 2MQOA 5T7LB 3UD5A 3BSCA 4J90A 5FLXY 1TU0B 2KJWA 3C6TA 3MEGB 4QR0A 1Q79A 3VGTA 3FFIB 5A76A 1DRZA 4TQSA 3CCWA 4ZLPA 3PX4A 1BC6A 3G87A 1YSJA 1GMWD 2VPZB 1IR1A 2EFQA 2PMHA 4NLDA 1RHQB 2QA2A 3R2CJ 3HZEA 1CULA 4UUWA 3PCOB 3ETOA 4JOUA 2LXFA 4MK8A 3F0NA 4AT1B 1X60A 1XQIA 3VZIA 1FJCA 1OY6A 4OMFG 4RO0A 4DPXA 3M05A 4ZCIA 3CF5Q 1QTNB 3JTNA 4IOBA 1NEEA 1VRUB 1S7IA 1X8DA 1UW4A 2OPQA 4MT1A 4OYXA 4WIQA 3AHPA 2P6SA 3HSDA 1WKJA 1S6OA 1T02A 3DHWC 1S1XB 4KQZA 3BYPA 4DMZA 2HW3A 2DNQA 3K5NA 4NLWA 4LFBF 2CPEA 1D3WA 1HW9A 2HGMA 4AL5A 4QYZK 4LVOP 1SUQB 1PAUB 2W24A 2ZITA 3L95X 5KT6A 2HFUA 2MQ8A 4YMEA 3GIKA 1N54B 1T9XA 2ZNYA 5T41A 4EMDA 2ROGA 2YWFA 4NI2A 4UQGA 1Q53A 4HDGA 4XPCA 3QZ8A 4J9QA 4HYKA 4I0WA 3TO8A 4C9DA 4CQ1A 1RP5A 2GMHA 2RHQB 4KGXB 8ATCB 4NEZA 3QFHA 4EYHB 1T03B 1WELA 2MXYA 1HQUB 3GJTB 4UT4A 3BGOP 4K4YA 2B5JA 4LSNB 1AZSA 3J7YU 1S6QA 2UUCJ 2QJ3A 3HHLC 4KGZB 2LDYA 1QUVA 3D1HA 5GVQA 1IBCB 4F0KA 2DH7A 4TNOA 5D0RA 3MR2A 4KC5A 5M2RA 2B5JB 4F04B 3K5OA 2UVWA 3DRPB 4YUDA 3H2UB 1N5YA 1HNZJ 2ZZTA 4I7FA 4K50A 2BOAA 3C66A 3ONQA 3P3DA 2ZD1B 1TR0A 1RT7A 4WXWA 3J81U 4Z7YA 4OX9J 1KHVA 3CJ0A 1FDDA 1SCJB 2LEPA 2WSEC 3H20A 3SFGA 4LREA 4ZA1A 1CG2A 1T11A 5KAKA 4PXBA 3GR0A 5CD4H 3E01A 4CO0A 1JNZB 2AEFA 3H59A 3NGTA 4UZBA 4EI2A 3Q8PB 1BLUA 2FHKA 5J2QA 4MH8A 1VQLS 1HWIA 1KFSA 4QU7A 2IJRA 1RUSA 3UNGC 4ANEA 3FCVA 2LKZA 4CWBA 3J7YI 4LJMA 3KK3A 1R8HA 3JSMB 2K3IA 2ASLA 2XBPA 3DU6A 2AQ4A 5AE3A 1VRTA 2B4OA 1TL7B 2NYHA 1P9YA 1X4EA 3KKFA 3P8BB 1FA0A 4P2XA 4DCJB 4X4TA 5J2QB 1D1UA 3NNCA 1Q5YA 3DHXA 3I0RA 4KV8B 1YHQS 3KLIB 2LP4A 1OO0B 2YKPA 3MMCA 1U48A 4PXEA 3G9CA 3PJ9A 2DRDA 1QM9A 2QLBB 3DGVA 5K5MA 1MWYA 4QWBA 2L9DA 2ZH2A 2WW4A 2EI5A 4I7FB 2IYGA 4ECXA 4QZVB 3QO9A 2UZAA 4IFVB 4NWBA 4FYYB 1NSPA 2R7UA 1QUPA 5FDLB 3MWBA 3RAQA 2YNFA 2J8SA 2YWHA 3TUJC 1RACB 2FQQB 2YQ3A 1EKRA 3PW2A 4FXVA 4MKBA 3OV7A 1ZAVA 4OYWA 4H4KA 1KNZA 2RSQA 1HNIB 3O8WA 1X4HA 4QIEA 1I94J 3ISND 1UA0A 2V0NA 5EWGA 4NLYA 4UF4A 1YITS 2EFPA 1F5CA 3R3TA 2E7VA 3H98A 4JB8B 3KDNA 4C6AA 4CLKA 2V9WA 4ELVA 2FYXA 3T9NA 2GAGC 3AAWB 5A2QU 3GCXP 4HL9A 3MM7B 2RU9A 2FVRA 5HMWA 1D9FA 2PEHA 3LWMA 3TAPA 2VA3A 1EHWA 2KRRA 1SKRA 1N36J 2M8HA 3M8ZA 2BJ7A 2C3MA
chains in the Genus database with same CATH topology
2IMWP 2XSJB 1VK3A 3CDAA 3IR6B 3FSYA 4I2QB 2DTJA 5E3RA 4HKQA 4QIGA 4LSLB 2NXUA 3MXHP 4JI1F 4X2BA 5HQ8A 2VKZG 1RTJA 3H2VE 3G71S 1RT6A 2J9CA 1V6HA 2X1AA 1SJ1A 4ED1A 4YR2A 1WG5A 1Y7PA 2E9TA 5E33A 5KFVA 2GC8A 3TVZA 2AYGA 2CQHA 4ZCMA 3JTPA 2N4DA 4FNIA 4G1QA 2J76E 2DGSA 4WE1A 4C2MA 3IWLA 2BE2B 1VGYA 3I9V9 1TKTA 2BOPA 1L5UA 3MM7A 4PG4A 3TAMB 1UKUA 3I87A 3BSNA 1ZM4A 1O0PA 2DGWA 3PRDA 1H38A 4KAIA 5KOWA 5JJBA 1RT2A 4NCBA 2RRNA 5J2MA 3AQOA 3D0HE 3KHGA 1B64A 1IKYA 1DARA 2W4CA 3DYAA 3CJKB 4PWDA 2DGVA 1EETA 4HT7A 2LU1A 4M1KA 4DWIA 3MM9B 3UCGA 3TYTA 1LK7A 2LQ5A 1RT4B 3GQCA 1GQEA 2O01C 1SL0A 3HVWA 1LFPA 2LQBA 3CIZA 4WFNQ 5GAGI 1FDBA 2YNHA 4O3SA 3JSRA 4TLRA 1Q7YT 4P2SA 1LWCB 1YJVA 4TU8A 2YY3A 5D77A 1G7CB 3BQ0A 2NREA 2ZHAA 3CCRS 1QAYA 5CYMB 4N5SA 1FJEB 5FD1A 1VI7A 2BJEA 1J2VA 4Y2CA 4B9NA 3POTB 2ABYA 2KXHA 2ZJRQ 1VK8A 4C8LA 3HHNB 4Z37A 3PFEA 4IG0A 2HS4A 2DH8A 2VC0A 2E5LF 4UOCA 4L3NA 3FFIA 4JI8F 4DEZA 3EPGA 4OL8A 2AX1A 3HVAA 2IJFA 3GV7B 2AD9A 2DHGA 5L39A 1KOHA 3FMWA 3SCLE 3E8OA 2KHCA 5BR8F 3OQ2A 4ED0A 1RJJA 3MAHA 1FD8A 4KGMA 5DG9A 3PKYA 4KHPF 2GHVC 4QYRA 5CYJA 2NSCA 4KKOB 5L8RC 5KFXA 2HNDB 2HHXA 1VLYA 1ZM2A 1HI0P 2WRMA 2MHNA 5G0RA 1L3UA 1GX5A 1RWUA 2APOA 1N8RT 2CJKA 4QR1A 4B9VA 3UD4P 2QA1A 3CC2S 1P1TA 1T03A 5DQGA 4DV7F 3QGIA 3HF5A 2OFGX 2JL9A 2OD6A 4R5PA 2FLLA 3AB2B 4QPTA 1D0EA 2KZMA 2GGPB 2VASA 2C2EA 3WC2A 1ZOTA 1NKCA 3ENQA 2ILYA 4XPEA 3CE8A 2DHXA 1NJIT 5HP1A 3PW4A 1NK9A 2ZZNA 2KFZA 3SI8A 2D9OA 2OPSB 1ZTTA 1Y00A 4M5DA 5F8MA 1S72S 2VG6A 2M8DB 2D3UA 2N7CA 4ES3A 3SSSA 4CH1A 1LW2A 4HT5A 1N56A 3MTKA 1FK9A 3I0RB 3MM8B 2GMLA 2XEXA 4KV8A 4P7VA 2XS5A 1X5TA 2Y1IA 1BQNB 4C8OA 2AJ0A 4ZVEA 2XNRA 2M3DA 5AXNA 3CPWR 2FDNA 3R5BA 4B17A 2O1PA 4CT8A 3KWMA 2I5JA 1YJ9S 4XK8C 3E01B 3OTDA 3DMJB 5A8WA 5KFHA 3T1AA 1BD6A 1SQEA 4X4NA 2MGZB 2AF6A 1XR7A 3RRHA 4FF4A 4YHHF 4P6QA 4I69A 1H3DA 2O5DA 4B9LA 4FPRA 2AYMA 1N52B 2CPYA 2VPWB 2KG0A 2LA4A 2DNOA 4MMOA 5DRKA 3MD3A 2JLFA 1SC6A 1TFWA 1U8SA 3SEOA 4EGLA 2MKKA 4OHXA 4A4JA 4WXOA 1X5SA 1TL5A 3G6YA 1K0TA 3IA0A 3O44A 1M1KT 3PM9A 1AFJA 1KN6A 2XWXA 2VPYB 2VZ9A 3I0SB 5LSLA 5SZTA 2C42A 5DDOC 4ECSA 1KEKA 4AQYF 2FB0A 1UJ5A 4CTAA 2WSFC 1NAQA 4RW8A 2QT7A 4DL3A 3PZPA 2I1RA 2VG5B 3D5MA 2R7WA 1S0VA 2JFKA 5I3PA 3DLEA 1HBNA 1Q8BA 2B6AA 1KOOA 1J5OA 1X5PA 1JLQB 2A10A 2MZSA 4BDPA 5K8PA 1QTMA 4JI7F 3OVBA 2CQ1A 2MZQA 4B9MA 1T8EA 3K5LA 1X4DA 4OLPA 3R1LA 3CCES 3AJ1A 2AJ4A 3CJKA 1UVLA 2DNNA 3HP6A 4D3HA 1KD1T 3PEJA 1ZETA 5KFKA 2XC9A 3LPYA 1O51A 1NB7A 1EP4A 3IR7B 5I42B 4DQSA 1U7LA 2QYCA 1IKVA 2XCAA 1SJ3P 3POTA 3SMZA 1UEUA 1YWXA 3V2UC 2LYVA 2RD5C 1NKEA 3I82A 1WHWA 1YJRA 3OFGA 3KJVA 3FQLA 4IOAQ 1T3NA 3VAJA 1N34F 2B56A 3MAQA 4B9UA 4YDDB 1FKOA 2MJNA 5HROA 1SB6A 1ZPWX 2XLJA 3KLEB 2ZM6F 1S4FA 1QE1B 2IA0A 3KHLA 2KXFA 3CMAS 2VB6A 2GJIA 2LEAA 5D4NA 2JVRA 2MKJA 4F3MA 4IOCQ 2D3OR 3M2VB 4P7TA 3LANA 4QPXA 5HN0A 2Z0GA 1P1LA 4ID5A 3W2WA 4LSLA 2GA7A 3TUZC 3PW0A 1N88A 1TKXB 4Q8FA 3J80Y 3U1NA 1FRIA 1ZZFA 1KTVA 4OHWA 5J2MB 1HD0A 2WB4A 3KLFA 2EK1A 4ZPAA 2ADBA 2HHWA 2CDQA 2R8JA 5T14A 1IKWA 3UI3A 1U4BA 2Q1LA 1ZM9A 2HLTA 3FMBA 3M9OB 2MZJA 1KONA 5KG4A 4CH7A 2CG4A 4DL7A 1S1WA 4DLEA 2NQPA 2CJAA 2DT9A 1Y3JA 3DU5A 2HYIB 1TK8A 4Y6IA 1S77D 3LUYA 4X4SA 4R5PB 5LT5A 3H4DA 4Q45A 1Z2LA 2DJWA 3DXSX 4I2PA 4KTQA 4OJ1A 2SXLA 4QOTA 3P96A 2CQDA 3OXLA 2PMZD 2EBEA 3QJPA 2HHTA 3US5A 4OHZA 5J2PA 2P9CA 3OBIA 4NLRA 4QW8A 3UR3C 5J1NA 3QLHB 2XCPA 3EYZA 1UVMA 1SL2A 4RW7A 5J2PB 4AXIA 2WK4A 1NHUA 3KG4A 2LMIA 4C7QA 1SL1A 3G4SS 1DZ5A 1OPZA 1YBAA 2KN4A 4I2PB 4EU0A 3EUNA 5DDPC 1N6QA 3P49B 3K2YA 2F8EX 2XY6A 1VC5A 2UV8G 3DLJA 4BBYA 2FTRA 3DRSA 5A8KA 5CA5A 2VFTA 1HWKA 2YKMB 3AA9A 1C1BA 3G6VA 4JI3F 4MKYA 2NSBA 3BS9A 3M1VB 4RW6A 4ZS6A 1IXKA 1ZPVA 5AXMA 1BWEA 3V4IA 2ZD1A 1JXEA 2IVFB 1UJ4A 2D1CA 2K3KA 4GMKA 3MUTP 1RYSA 1RK8A 3JAMY 2HNDA 1P8GA 3TA0A 3W2VA 1QSLA 5A6WA 4I56A 3NMAA 3KK2B 3LH2S 4NCGA 2H9ZA 2CPFA 2CQ4A 4EO8A 3MMJA 1IKXA 3O5TB 3KLFB 3IXQA 4Z2XA 2ZDOA 4IO9Q 1NNDA 3L09A 4J5OA 4DV1F 3MEDA 3M1VA 1QSSA 2JWNA 2CJQA 2WW8A 1R8BA 4NLSA 4CH0S 2R8GA 4EUVA 1YG0A 5IT4A 2AJ1A 4I64A 3UD3P 2PN6A 3SSQA 2L9NA 5H1SV 2ZH6A 4EEYA 2KO1A 1U1PA 4K4ZA 3MECB 1XN9A 4ED2A 4YR0A 2UUCF 2DK2A 4K4VA 2PGCA 2QSFA 1S1VB 1NJYA 3DOKA 4DV0F 4Q2LA 2L48A 3AH6A 5IWAF 1GX6A 1KRPA 3D0IE 2OJ3A 1FRXA 1E6YB 1PILA 2DR8A 2RDJA 2ILZA 4DOZA 2X1FA 1CPZA 1VQ8S 4R25A 3ZZZA 3DYAB 2D74B 2XSFA 4OI3A 4JV0A 3E3XA 4F4XA 7FDRA 1UVJA 3QWUA 2BBEA 3BO3A 3N5FA 3BGUA 1HW8A 4KE5A 3U27A 1UWBB 2KM8B 4F4WA 2E1AA 4ELTA 2RH3A 4MIBA 3SV4A 1S48A 2OSRA 4B3OA 1HBMA 1S9GA 1LXNA 2W4PA 4DQRA 2VBZA 3SCIE 5LSRA 1HHTP 4HI1A 3NCQA 3RBEA 1VQOS 3V81A 1VJWA 3GG1A 5D6GA 2HHSA 3OSNA 2DCUB 1VQSA 3PXGa 4DN0A <