2LYVA

Solution structure of the two rrm domains of hnrnp a1 (up1) using segmental isotope labeling
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
GSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the two RNA recognition motifs of hnRNP A1 using segmental isotope labeling: how the relative orientation between RRMs influences the nucleic acid binding topology.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing, transport protein
molecule keywords Heterogeneous nuclear ribonucleoprotein A1
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA02
2MZJA 3CF5Q 5GADU 1U1OA 1U6FA 2BZ2A 3EGNA 1URNA 5CA5A 1O0PA 3FEYB 2FHOB 1VQ6S 3VAMA 3P5TL 3JB9k 2O3DA 2EK1A 3VAHA 3DLLQ 4BS2A 1M5PC 1H2TZ 5LSOA 2MQLA 2M9KA 1VQ5S 2HVZA 2MJNA 5FJ4A 2DITA 1WI6A 2MGZB 4CIOA 5HL7Q 5EN1A 4YB1P 3CCSS 2ZJPQ 3CCMS 2DO0A 3IWNC 2M7SA 3TO8A 2XS2A 3G4SS 2RNEA 5LXRA 1HA1A 2DGTA 1N52B 3MOJB 1ZZNA 1RK8A 4U67Q 2J0QD 2DNRA 2EK6A 1DRZA 3S01A 1WELA 2ZJQQ 1YTYA 1X4FA 4UQTA 2MZQA 2E5JA 2DH7A 3P49B 1H2UX 2CQIA 1U1LA 2G4BA 1WHVA 3D2WA 4ED5A 1WF2A 3THTA 1R8PA 2CQ2A 4ZKAA 3BO4A 2K8GA 1X5OA 1WEZA 2LCWA 3NNAA 3VAIA 2A3JA 4WFBQ 2RRAA 1P1TA 2HZCA 2UP1A 4TLQA 2MQNA 2KN4A 2E5HA 2DNNA 1XN9A 2MZRA 2DHGA 1IQTA 3VAFA 4Y0FA 4V19X 2DNZA 2M4MA 4WF9Q 1X4GA 2DIUA 1U1PA 5DDOC 2DNKA 3BO2A 2BOPA 2MSTA 5CYJA 1M5VC 2DHSA 4OZ1A 4TU7A 1FXLA 1K9MT 2VODA 1U1NA 3UCGA 4F25A 3CMES 1SJ3P 4EGLA 1RKJA 1WHXA 4CH0S 5LJ3Y 2KG1A 1JJ4A 2MZSA 3UCUP 1NU4A 4P6QA 2RS8A 3NS5A 3G96A 2N3LA 2MQQA 2RS2A 2CQGA 1YIJS 1U1QA 4C4WA 2MKKA 2F3JA 1WF1A 3L3CA 3VAJA 3CCRS 2E5IA 2DGQA 2E44A 5JVGQ 2JVOA 1VQLS 2XNRA 2RU3A 3CCLS 1QVGR 1QM9A 1FJEB 3BO3A 1X4CA 2KFYA 2MKSA 1Q81T 3I55S 2G1DA 3N9UC 2DNOA 5DM6Q 3US5A 2GHPA 3CTRA 3THPA 3B4MA 2KI2A 3G71S 2M8HA 3MI7X 1YHQS 3CCVS 2CQPA 1VQKS 5LJ5Y 3NMRA 1H6KX 3PIOQ 1OO0B 1FJCA 2DNMA 2CQ0A 4QQBA 4OZ0A 4Z2XA 1VQ4S 1VQPS 1Q86T 1QVFR 3UCZP 1JJHA 1YJNS 4PR6A 2B0GA 2RQCA 2MYFA 1S79A 3MURP 2DHAA 4M5DB 1G2EA 3G8TA 2YH0A 3S6EA 2DH9A 1VQNS 2QA4S 2N7CA 2KRBA 1HD1A 2KRRA 2MZTA 1VC6A 2L41A 5LXYA 2DIVA 3V4MA 4PKDB 2KM8B 4C7QA 2OSRA 2ADCA 2DO4A 3CC4S 1WG4A 2YH1A 2JX2A 3Q2SC 2D9OA 2N3OA 2M52A 1X4AA 2N82B 2HYIB 1JMTA 1WEYA 3MD3A 2X1GA 2MKJA 1OWXA 1WI8A 2RQ4A 3P6YC 4J5OA 2F9JA 4WFAQ 3CXCR 5GAHU 1KOHA 1VQ7S 1WTBA 2RUGA 1D8ZA 2FC9A 4CQ1A 4QU7A 3LQVA 2I38A 1NO8A 2LA4A 3B4DA 1F9FA 2D3OR 1FJ7A 2RRBA 5D78A 1HL6A 1K8AT 4YOEA 3NS6A 2VONA 1U6BA 1Q7YT 1UW4A 3G9CA 5H1SV 5ITHA 5MLCV 2NZ4A 2CPXA 4UY8T 1X4HA 4F02A 3MD1A 2XSFA 3BEGB 3NNCA 3CD6S 2YKAA 2KU7A 1DHMA 4C0OC 1M90T 2CPIA 5D77A 5IM0B 1NJIT 3MDFA 3R27A 2KH9A 2PEHA 1S72S 3H2VE 3G6ES 2LECA 1ZH5A 1W2BR 1SJRA 2MQPA 1UAWA 2LA6A 3S8SA 2MSSA 1X4BA 3CC2S 1OIAA 3LPYA 1B7FA 2CQBA 3VF0B 2AD9A 2CQDA 4QPTA 3VAKA 4FXVA 1YJWS 2MMYA 2XS5A 4F26A 1SJQA 2CQCA 2CQHA 2SXLA 1FO1A 5LSLA 3UD4P 2M0GB 2OTJS 4YUDA 4TU8A 3HHNB 2J0SD 3IRWP 4LIRA 4IOAQ 1VC5A 2DGUA 1VQ8S 3UE2A 1JJ2R 1P27B 4IO9Q 1K73T 2CJKA 5DDPC 2HGMA 1R8HA 2JVRA 3K0JA 2JWNA 3I56S 3EX7B 1DZ5A 2DGVA 1FT8A 1WHYA 1PGZA 2FPHX 2X1FA 2VOPA 3J7YU 2KYXA 4Y00A 4WKRA 2CPYA 2ADBA 2GO9A 2OJ3A 3P3DA 3FEXB 1YITS 5DDQC 1KC8T 1HD0A 2CPFA 2DGSA 3R1LA 2DGXA 2YWKA 2LEAA 4IUFA 3J7ZT 3CCJS 3CCES 1PO6A 1N88A 1X4EA 2MY8A 3RW6A 4FXWA 5DETA 1U2FA 4WIIA 1OPIA 1X5SA 2OSQA 5DDRC 3VAGA 3CUNA 2LQ5A 1SJFA 1A9NB 1ZZFA 1WF0A 2DHXA 1U1KA 2MB0B 1DBDA 2D9PA 1VBYA 2MPUA 3ZZZA 1FNXH 3SXLA 5GAGU 2AYGA 2MQMA 4WCEQ 2KXNB 2OIHA 3G8SA 2FY1A 1WEXA 1Q82T 2F9DA 2AYMA 2MJUA 2V94A 5IFMA 3UD3P 3S7RA 2MKHA 3MUMP 2NLWA 2M88A 2DNPA 2RT3A 2LKZA 1WG1A 1WG5A 2DB1A 3MUVP 2K3KA 4ERDA 1A7GE 1YJ9S 1BY9A 1H2VZ 1N54B 2HGLA 1SJ4P 2LXIA 3PIPQ 4PRFA 2X1AA 2M2BA 3HI9A 1VQOS 5JVHQ 3U1LA 5GAEU 2MHNA 2DGWA 3CCQS 4RU2A 1D9AA 1U1MA 1VBXA 2OTLS 2DNLA 1KOOA 1WHWA 2DNGA 1X5PA 2MKCA 3BS9A 1FHTA 5DM7Q 2KT5A 2LYVA 1VQ9S 3SMZA 1VQMS 2MZ1A 2M70A 4W90B 2KHCA 2FC8A 2L9WA 3DXBA 2KXHA 3H2UB 2PE8A 2MXYA 3CPWR 3OW2R 1KD1T 1UP1A 2DK2A 4CH1A 1YWXA 2U1AA 2KVIA 2MGZA 2CPDA 2KM8C 3MUTP 1YI2S 3EGZA 1N8RT 3UWTA 5IQQA 3CULA 2YTCA 2MQOA 3CCUS 3U1MA 2DNYA 5HO4A 2CQ3A 5CXTA 2Q79A 3NNHA 2E5GA 2CPZA 3CMAS 2DNQA 5GVQA 2RVJA 2KXFA 2XB2D 1X5TA 3R1HA 2XS7A 2CPEA 2L08A 1X4DA 2CQ1A 5IM0A 3MXHP 3CC7S 2LEBA 2MKIA 1AUDA 1WWHA 4TU9A 2AYEA 1VC0A 1UFWA 2DNHA 2X1BA 2DH8A 2KG0A 3SDEA 2DISA 3Q2TC 4QU6A 2QEXS 2AYBA 2U2FA 2LMIA 2DGOA 3SDEB 4LMZA 2M8DB 2J8AA 1CVJA 4LJMA 3VALA 5BJRA 3ZZYA 1VBZA 2EVZA 2VOOA 2XNQA 2HGNA 4A8XA 4WFNQ 2ERRA 3TYTA 1SXLA 1M5OC 2LXUA 3TP2A 2I2YA 4IOCQ 2CPJA 3ULHA 1KQSR 2JRSA 4W92B 3RW7A 2MY7A 5GMKa 1U1RA 1L3KA 2G0CA 1M5KC 2CQ4A 1X0FA 1M1KT 2CPHA 2J76E 2QFJA 2ZJRQ 2WBRA
chains in the Genus database with same CATH superfamily
1RHJB 3ZTSA 4R0JA 1VI7A 1YJRA 1Q5YA 3I31A 2EKYA 4MYUA 4ZVOB 4Q45A 1U1OA 2DY1A 4I68A 2KJVA 5DGBA 4K4UA 1EETB 1SCJB 2JL9A 4PAAA 3FEYB 2V2VA 1IBKJ 4OYZA 2WW4A 4B9UA 1HNWJ 2R7OA 3LW5C 1C0UB 1ZM2A 4WTOB 3L4BC 1CQNA 2BJEA 2HQIA 4TLRA 3V6HA 1S97A 2EK1A 2GJIA 4B3RJ 3UO0A 3VAHA 1NB7A 3W9HA 3FBCA 5IXUA 1C1BB 1M5PC 4BS2A 1P8GA 3BR8A 5D3GA 3LP2A 1S5ZA 1DFDA 2B9WA 5KG6A 1UA1A 1VDHA 4O4RA 5F3ZA 3PX0A 1HHQA 2M9KA 2QV6A 2RF2B 4MTPA 1HWJA 2HVZA 3HVAA 4P74A 2B5JA 4IH6A 1R0AB 1F5AA 2GVDB 2DY9A 3GIRA 3IMQJ 4NYZA 3RBZA 3TA2A 2EI5A 4DX6A 2OLWA 4JI3J 5EN1A 5IQ6A 4B3MF 4ZJLA 4USJC 2MLZA 3FQLA 1OYEA 1FX4A 2DO0A 3CCMS 2QA1A 1SIZA 2OGUA 7FDRA 2VASA 1ZM9A 4P75A 2CFXA 3M6UA 1UWAA 4ES2A 1ULRA 2VQEJ 2RNEA 4Q43A 4QW9A 2FLNA 2XS2A 2XM3A 3A12A 5DRKA 4OX9F 1YRUA 2YNIB 4DG1A 1QAYA 3EWGA 4A8WA 1TVRA 3CD7A 3KG4A 1REGX 1ZTTA 1PC4A 2Q1LA 1LWEA 4RUHA 3N0VA 3F73A 2R8GA 1NBEB 3BGLA 2J0QD 1Q16B 2EK6A 5JUMA 4LF1A 2D1CA 1DRZA 4FYWB 2GAHC 2DR9A 4FYXB 1YTYA 1RBLA 2C3MA 3UDVA 2NXNA 5I3UA 5KFNA 2ZBRA 1X4FA 5C42A 1R0BG 2HFOA 2Y3YA 4UOHA 4D3HA 5T14A 4ECRA 3AQPA 2MZQA 3P49B 1NDCA 1JXVA 1R31A 4R8UA 3ZZPA 4Y6IA 3RR8A 4NLTA 2BOAA 1FJGJ 3CD0A 4CLTA 3D2WA 4PYAA 5A2QU 4YR0A 4KO0A 1GXUA 3MPUB 1WF2A 1WORA 3LUYA 2ZD1A 3SQOP 4WKYA 3QGGA 4ZVUB 1OY8A 2BEFA 3NWGA 3QPIA 2Y9HA 2UXDF 2UVRA 3W65A 2NUHA 2YQ3A 2K8GA 3DOKB 2ZDOA 3W62A 2AU0A 3W66A 3OTEA 1QAXA 3EVOA 3DHXA 2A3JA 3SBMA 4WFBQ 4F4ZA 2RRAA 1PJ7A 3NL0A 4DMZA 1P1TA 5DGAA 1NDKA 4QZVB 1JJCB 2RE1A 3PG9A 4ZP7A 4P7TA 1TV6A 2BJ8A 4RW8B 1LWEB 2MZRA 2RKIB 2V4QA 1NZ8A 1LKZA 4DV0F 4HEA9 5A6WA 4MKYA 4Y0FA 1X8DA 2BJ1A 2W9BA 4V19X 2Z8QA 4WF9Q 2W9BB 3HSGA 1RTJA 1IQZA 5EWGA 2BOPA 3G6XA 5HJXA 2JDJA 5CYJA 4UT4A 3KK2A 3SI8A 5J2QA 2GMJA 4TU7A 2ZH6A 2XY7A 2DTJA 3GTYX 3CJKB 1G6BA 4O44B 4ETZA 3T1YJ 3BM7A 3UCGA 3CMES 4JI6J 1LXJA 1UFLA 1T03A 4U8YA 1RKJA 4X84A 3DRSB 1N5YA 3OFHA 1QDUB 1LWFB 1TMMA 3MZIA 3T9NA 1JJ4A 1IUJA 3UCUP 1ITPA 3UN3A 2JEIA 3QJJA 3CIZA 2DPJA 2DEIA 1B0VA 2W4PA 3PW4A 3LWLA 1RT3B 3KJVA 2CQGA 4WK1A 2MKKA 2B43A 4CCHA 2F3JA 1RXOB 2UXBJ 1VYAA 4EUVA 3B82A 3M2RB 1VQLS 3HHDA 2DHHA 2RH3A 2QLFB 2XWXA 8AT1B 3CCLS 1QM9A 3THVA 1QVGR 1S6PB 3BO3A 1F3FA 2XG8A 5E3PA 4D3GA 2AJQA 1FTRA 1BLUA 3OVBA 1C1BA 4HTIA 4XPEA 2MLYA 3I55S 2J9DE 4ITSA 1RBAA 2O66A 3QAEA 1D9FA 4B3RF 2B9XA 2BX6A 3PDNA 1MWQA 2E7VA 1L5UA 4HVZA 2AX1A 3A13A 2BR0A 1MU2A 2DR6A 2GHPA 4IR9A 3KK3A 1SC3B 3FRZA 4GKJF 1WOSA 1GT8A 2FZKB 3THPA 4QW8A 1R8AA 4DWIA 1F9EB 1LWXA 1R8BA 1YBTA 2V0NA 3BGOP 3W5ZA 1KWMA 3MI7X 2K2PA 3GV8B 4WYWA 1Q95G 3CCVS 5EHHA 1VQKS 5K14A 1TL1A 2XY6A 2XMWA 5LJ5Y 4YQWA 2DNMA 2CQ0A 2WB4A 1MN7A 2GO8A 1IBLJ 4QQBA 4OZ0A 2KT3A 5IZHA 2A2DA 2HHQA 2QN6B 2OPPA 1VQ4S 2VC1A 4JI8J 1AW0A 2R3VA 1O8BA 3TAPA 1JJHA 5KT3A 4PR6A 5AT1B 2OEJA 4RKUC 1SQGA 1K1SA 3NP5A 3MMBB 4M5DB 5IWAF 3JSMB 5KFQA 4PWUA 3MPVA 4IQMA 3VZIA 1TAQA 3L9ZA 2QA4S 4OZLA 3RBXA 2N7CA 1TK8A 1HD1A 2YX7A 5T7LB 4HACA 2XO6A 4DV5J 3NAHA 1EIYB 2L41A 1RBOB 2HQCA 1YVFA 1I51B 3WIUA 3QWPA 1Z1ZA 1RACB 4PKDB 3V4MA 5D4OA 2KM8B 1JLGB 4ZN1A 2E9TA 3EMTA 4KKOA 2C3YA 1EQ0A 1W26A 4PWWA 1RT2A 1UKUA 3DLKA 4X66F 2ZZMA 1VRTB 2YH1A 3MM9A 3LGMA 2JX2A 2V2KA 3N6MA 3O1LA 4Z7YA 3X3UA 4ZCIA 3TW0A 2HHPA 1RTIB 1WC0A 4JV1A 4CRJA 3PV8A 2E1RA 5C42B 3BSCA 5LL6d 1KQFB 4N56A 5KT6A 3M2UB 5B0AA 3R9LA 2B6AB 3RRKA 3MD3A 3MWBA 5A76A 2ZH1A 4EZ6A 1WI8A 4JI1F 4X66J 3P6YC 4J5OA 5D15A 4DR5F 1SL1A 5LT5A 1UVIA 4RWWA 1RDRA 2JHEA 4QIGA 3I5CA 3WX8A 2LVWA 4YR2A 1VQ7S 1WTBA 4CQ1A 1UVJA 3SSRA 5HVGA 4LRAA 4NEZA 2LA4A 1LNQA 1HBNA 4I2PB 4KV8A 4LBIA 1OQ6A 2EC2A 3DKDA 4ZPDA 3TR5A 3UD5A 4CO2A 2ZITA 5LOQA 4J9KA 1I1GA 3BPDA 1CSJA 2G0IA 1S57A 3DMJB 5HVHA 3UN5A 3H4BA 4DL7A 1NK6A 2E5LJ 1DY3A 5D0HA 2VONA 4K0KJ 1ZM4A 4RW7A 4PPZA 4L74A 4U95A 5C2GA 3G9CA 4K4VA 4ZPVR 5ETPA 4PG4A 5A8RB 3B6BA 1UZDA 3BV8A 2CPXA 1QSSA 2NZ4A 1NHKL 2CXEA 2WK4A 2XSFA 3BEGB 2HK2A 2YNHA 4RW6B 1NK0A 3M8QA 4Y2KA 2JNJA 3G6VA 5D77A 3A8JA 4I4BA 4P10A 3WC0A 1HBOA 5IM0B 2E1PA 2JH3A 4C3MA 4NLWA 4ZK7M 2ZM6F 2RHQB 4GKJJ 3MDFA 1NLKL 2XO7A 4ECZA 2PEHA 4NLXA 4A46A 2HK3A 4GMKA 2M5YA 2UV8A 3RAQA 1PILA 3O2IA 5DG8A 1NMEB 1W2BR 3BBBA 3R5DA 1MN9A 1SJRA 1UEKA 3BYRA 3RGIA 2C2NA 1FNMA 1J5EJ 3QT5A 3UVJA 1HKAA 3S8SA 1VK8A 2HFZA 1X4BA 3FC9A 1XR6A 3G8QA 3CJ0A 3UVJB 5MAOA 4DV2F 4B9VA 4LUBA 2ZZNA 1D8YA 1LWCA 1B7FA 3VF0B 4LF5J 2CQDA 2JC0A 1T9VA 2HFNA 2BANA 2NZCA 2CKWA 4FXVA 4NX9A 4QPTA 4K4XA 1U48A 1EETA 4ECXA 2ZFHA 5IT9U 4QOTA 2CIMA 2R7RA 2CQHA 3R7BB 4DFMA 5RUBA 5LSLA 2OTJS 1YGYA 1G7CB 1RA7A 2CNLB 4YB7A 2HW3A 5DQIA 2RQKA 2K7JA 2ZC3A 4TU8A 2JLEA 3JSRA 3M8PA 4KGVB 1RWUA 4IRCA 3HF5A 4H4OA 1PYOB 3HFKA 4I56A 4KR0B 4P73A 1T02A 2P8IA 5JXSA 1FCAA 2BE7D 3A8IA 4NWBA 4RJVA 2FLLA 2RIJA 3J80Y 4OYWA 2BJ3A 3ZC4A 4J9SA 1N6QB 1XK8A 2DGUA 4X4TA 5CHCB 1LQ9A 4OHVA 3UE2A 2QL9B 1DJ0A 4XO0A 2Y0SD 2FQQB 3DLLQ 3PXGa 1FXDA 3DNCA 3A3NB 5DO2A 3HULA 6AT1B 4HL9A 2WONA 3ONQA 1JLQB 4RO0A 2JVRA 1BUXA 3QFWA 3A8EA 4CP5A 2JWNA 3GLJA 4ED2A 4QWBA 5IS2A 4ZVQB 3EX7B 3UDLA 4G3IA 1LFWA 1FT8A 2X1FA 2BABA 3HPOA 2EEYA 2VOPA 4DS4A 1B64A 2CPYA 2QT7A 4U7CA 3PM9A 3ZFVA 1TUGB 2GO9A 2YWGA 3TJ8A 2OJ3A 4JI2J 1HQ2A 1NZAA 3H0PA 2Y1LB 4Y2MA 3CCTA 2DGSA 4NMLA 2AEJA 4RNNA 4IH7A 2Y8WA 1TKTB 3DRPA 3HMJG 3R1LA 2DGXA 4MAKA 3POTB 2BUNA 3U27A 5BR8J 5E2QA 1AFJA 3MMCA 2PFFB 4ZJQA 4CYUA 1VJWA 2UUTA 2VPZB 4C8MA 3IA0A 3H5YA 2NXUA 3CCJS 4UOCA 1KNZA 5B0EA 5F3TA 1PO6A 4HLBA 4WFYA 4AE5A 2VZ9A 2GW8A 1S99A 3K7RA 4FXWA 5DETA 1I6JA 2QTWA 5KG7A 2I8EA 2XLIA 1XBWA 3G82A 2ZH4A 1I94J 2L9NA 3HVRA 1OPIA 1FRKA 3ZZRA 3PX4A 4KHPJ 5F8MA 5DDRC 4C8LA 1DURA 3BPSP 1S1VA 2LQ5A 4UUXA 3CUNA 5F0UA 2XZTB 3CJ4A 1WF0A 4HT7A 5ETVA 3K58A 2B8QA 1RHMB 1DARA 2RILA 3TUJC 2A0FB 1DBDA 1T0TV 5KFYA 3JTPA 4X4OA 1VBYA 4KC5A 2MPUA 3S1TA 4NYOA 1FNXH 3K0JA 1SB6A 3UQSA 2E7XA 4OZ2A 1V5VA 4P9SA 4WE1A 3Q8UA 1MMDA 2OPRA 3I6PA 3CD5A 3M2UA 4P2FA 1KTQA 2CZVC 4WCEQ 4ED1A 4XAKA 4CO4A 3G8SA 3CJ5A 4GVBA 4PG8A 2FY1A 2KZMA 1WEXA 5I3UB 3OLAA 1F0XA 2MJUA 2V94A 2Z2YB 3FFIA 5IC4B 3S7RA 5IFMA 4OQJA 2APOA 3MUMP 1NB2A 4LSNA 3TQEA 4J37A 4DCOB 3L7UA 4LSNB 2F8HA 2OMLA 2RT3A 1NAQA 4ES3A 2QLWA 2HFSA 1ZH5A 1HNVB 4DUZJ 4LFCF 3SYZA 1RT1A 1H7XA 4NCAA 1IR1A 2J6UA 4A47A 5KFOA 4AL6A 1X7VA 2B4VA 3BQ0A 2Q3PA 1N54B 2RQMA 2WVBA 1U0HB 2UZAA 5EDWA 4LF6J 2B9YA 4IDKB 5KFLA 2LXIA 2J5AA 1ROFA 1U0HA 3W2VB 3PIPQ 2HWIA 1ACMB 4IDKA 3W2VA 1QUPA 4ZITA 3FCHA 2V5HG 3K89A 5KFVA 5GAEU 3BQ2A 1VQOS 3W3SA 2DGWA 3CCQS 5KG0A 4PG6A 1SI9A 1FEEA 1X5PA 1BQNA 1SQEA 4WP3A 1BQNB 2RKIA 2LLZA 4CNZA 1XMBA 3BGRB 3L7PA 4B9TA 4FBTA 4WU3A 4ZLNA 4X62J 1FXRA 2R42A 3MECB 3QMQA 2KXHA 2MXYA 2PE8A 5KOWA 3CPWR 4FYDA 3DLGB 1XNRJ 2DK2A 3CWJA 1RT5B 2U1AA 5K8OA 1KVJA 3SSSA 3FQKA 1LV5A 2P9EA 2MGZA 3MUTP 4KV8B 3KMSA 3SCKE 3JAMY 4DF8A 3M8YA 4IR1A 3T5KA 5FLXY 5AXMA 4WIQA 5KT2A 3D5MA 3T19A 4YMEA 1S9FA 4C8KA 3D1HA 4FBUA 3CULA 1TAUA 5KOXA 4L75A 3VQSA 2DNYA 1LWCB 3N6NA 2J7KA 4DQQA 4JP8A 4DL6A 5CXTA 3DRSA 3QQCD 4ZP6A 4ANEA 2FHJA 4Q5VA 1N5YB 4QIFA 2DD8S 2FVRA 1XIQA 4OJHA 3BDPA 2VBZA 3GFZA 3CMAS 3CT9A 1XTZA 3FSYA 2B8PA 5A8RA 1YBAA 3FUYA 1FKOB 1F9HA 1HBUB 2V8HA 2GJFA 4LREA 2KXFA 1N32J 3IBFB 3OTBA 2XB2D 3R1HA 1EHWA 1NSQA 3N5FA 1SC1B 3ILOA 1H38A 2CQ1A 2PDAA 4C6AA 1HBOB 5IM0A 1U8SA 3CE8A 5CQGA 2XQCA 4PQUA 1WUUA 1R89A 1FVQA 4N5SA 4DZ6A 4EMDA 1VRUA 3HDSA 1AUDA 4EYIB 3WQPA 3KTQA 3J7AN 1VRQC 3RAMA 1WWHA 1SUQA 5J2MB 1NPPA 3IG1A 2AYEA 1R0CB 2W4CA 3H42A 4YFUA 4KPYA 1HWIA 3R2CJ 1GAOA 3G2XA 4OLPA 2OP5A 2X1BA 5ETNA 2MHEA 3NS7B 4LF7F 1RQ0A 2BVZA 3CJSA 1KLMB 3KXDA 2BANB 2CNOB 3DLEB 2UUWA 4J9RA 2HS0A 3LGHA 3R5BA 4DN0A 1N5TA 1IM4A 4B3SJ 3MR3A 4IRDA 4JI0J 3SDEB 1CJKB 2QLBB 4UTGA 4LMZA 4CI0B 5KFAA 2LFVA 4B9LA 4DSIA 3I96A 4F36A 1UVLA 3CB4A 2XTJP 1FDBA 1NJYA 2Z56B 1F1BB 1ZAVA 3M8PB 3C6UB 4LRCA 5K14B 3BYPA 3DN9A 3GCWP 3J7Z5 1Y0HA 1RWVB 2KFNA 2J9EA 1S1WA 4F4WA 2PD1A 2B7BB 4FF1A 5HP1A 3TYTA 4FNHA 1SXLA 2QYGA 2NCKL 4C0HA 3TP2A 4Y2CA 1AUSL 4AXIA 2CWKA 3OLBA 2RF2A 1MMNA 2I2YA 3LP0A 1RAAB 2OUGA 5CZXA 3PHEA 1LW2B 1JLFB 3NEKA 4UZCA 4ZVRB 1SKWA 1UPPA 1WKLA 2JRSA 5LSRA 1KDNA 1RB0A 2GA7A 3MHYA 2AV5A 5KAKA 2C3OA 1X0FA 3QIDA 3OT9A 3D3BJ 1N56A 3CJ8A 3DOMB 2C2MB 5HK4A 3H7HB 3ITHB 5U47A 3KUEA 4U7UK 1HNWF 2Q6BA 2MDAA 2MZJA 2RUSA 3DYAB 4DX8H 3Q0AA 4C48A 1SL2A 2B9EA 2IC3B 4GC7A 1U6FA 3ISND 3EGNA 1URNA 3O5TB 4LRDA 4WFZA 2VHGA 2CZ9A 3A4TA 4LF6F 1OY6A 4LQ3A 2FHOB 3C6UA 2BMBA 3SFGA 3ZXWA 4LBHA 3E51A 3SFUA 3P5TL 3JB9k 2FGOA 4ECSA 3LP2B 5F8LA 3RRHA 1WDTA 1AA1B 3RZAA 5ETOA 3MR2A 1CC8A 4HYKA 3C3LA 1MSWD 3H2LA 3WDOA 3M32B 3OJSA 4B3OA 4JI4J 4I6YA 4BHQA 3K5OA 5LSOA 1RA6A 2I5JA 2MQLA 5A8WA 3C19A 4ANCA 5CAAA 4X2BA 3GSIA 4DF4A 1WJ9A 3GV7B 2V8GA 2MJNA 3GIJA 5FJ4A 2YPYA 5B0FA 2BW7A 2YKMA 1NK8A 1RHQB 2XMTA 1U0SA 4IG0B 4ANDA 2XCAA 5HL7Q 2AEFA 3IR7B 3DXSX 3FBFA 4I2PA 4J9LA 3KNAA 1MW7A 2DJWA 4IFYB 3AXKA 3IWNC 1U2RA 3GQCA 2JEFA 3ITHA 4JV2A 1SH0A 1ZOTA 2QC3A 1L3UA 4FF4A 5B0CA 3PNIA 3TO8A 4C3KA 1JLCA 4LF4F 4OI1A 4HR2A 1GMWA 2DGTA 3MPYA 1N52B 5CZVA 1PKUA 2AIRB 4X65F 3FFIB 1T8EA 1S1XA 1TU0B 1WC6A 3CO0P 1RK8A 1BC6A 1M1HA 1FRIA 3SSQA 2IDEA 1Y4ZB 2BKPA 4DZDA 3MR7A 1VLYA 4TN2A 3S01A 3OHBA 1U4BA 2ZJQQ 2J8SA 2OH2A 2HQ3A 4NZ7A 5EUHA 4JV0A 1RLDA 3TX8A 3T41A 1RTHB 2ILZA 5B7WA 3TZXA 3KK2B 5J2QB 3Q23A 4DLGA 4EK2A 3PKMA 1H2UX 5EWEA 1FX2A 1L3TA 2ZKTA 3DRYA 1OYDA 1H74A 2QO3A 1FERA 5GAEI 1HI8A 2MEWA 1GTHA 4NA1A 2GIRA 3HKZD 3VQTA 5H9FJ 5F9NA 5SZTA 2ZVSA 3THTA 4F50A 5L8RC 1R8PA 3K17A 4Y65A 3W9JA 3C66A 3ZZ0A 4CH7A 3PFOA 4HKQA 3IBWA 1KLNA 2F8MA 1S7IA 1DTQA 1WEZA 2LCWA 3NGSA 2C3UA 5M2UA 2PO4A 3VAIA 1N5QA 2PA3A 3N4WA 1UWBB 1FWLA 3LPEA 3J81U 4CO0A 2NXJA 2HZCA 3H20A 1AB8A 4J91A 3DLHA 3TOQA 3SV4A 3NY0A 3VZHA 2DNNA 1PAUB 1UW9A 4DSFA 2A6OA 1D0EA 3QIPB 1S9EB 2YKOA 3G86A 4WK3A 1IQTA 1TKTA 2P2CB 1SKRA 2R8IA 4F0KA 5F8GA 2M4MA 4ECUA 1UA0A 3J7A1 5ETRA 3MM5B 4ICLA 4OI0A 3F44A 5DDOC 1K1QA 2HQGA 4DPXA 4C8NA 1BWVA 1U49A 4OZ1A 4WP9A 4DFJA 3BKUA 1FXLA 2F65A 2R7QA 3BB5A 4MKBA 5A8WB 3JAMU 1HQUA 3E01B 1FDDA 4M5DA 3JSMA 4DPTA 4N41A 2ZH7A 2RDDA 1U1NA 3UNYA 4F25A 1PC5A 2VA2A 2Y1IA 3AJ2A 2E66A 4G1IA 4HI1A 4E8UA 3OVSA 2LQBA 4ZLJA 4CH0S 1OPZA 4A8QA 3U7JA 1A0OB 5LJ3Y 3M2VA 4ECYA 3D6MB 3A8KA 4O23A 5L1IA 4WJBA 1NU4A 4FYYB 5HROB 2GQCA 4P6QA 1DAXA 1UZHA 3G96A 2WAQD 2YNIA 4X4RA 4JOUA 4ZVEA 2MQQA 1S1TB 4AYBD 1RHUB 2G2OA 4C8YA 2QRRA 4BBYA 3VAJA 4OL8A 3MAHA 3PJWA 4H4KA 2Q6CA 1UL3A 3M8WA 2JSXA 3MEGB 4OZNA 2AWZA 4BC9A 1U6ZA 3AY0A 2ZH3A 2R9LA 2JVOA 2WVDA 3W5XA 5FIIA 3EUNA 4RNFA 2RU3A 4EYHB 4EZ9A 1FJEB 4W4MA 1CJTA 3T6BA 5B09A 2BE9B 1IKVB 5KG2A 2MKSA 2KFYA 4J9NA 1JIHA 3IC1A 3N28A 2O01C 2DBBA 2V67A 3GFXA 3OR2B 4ENOA 3QT6A 4EO6A 2ZUGA 2B51A 2E9RX 2EBGA 3HP6A 5J2PA 1IVZA 2C28A 1HHSA 5KFEA 3CIMA 4ZOSA 4ZHRA 5HQ8A 4O0IA 4UOFA 2IAJB 2CA9A 2RDIA 4F4AA 4IQXA 2H9ZA 4NA2A 5IT4A 2HNZA 2EFGA 3NLCA 1S7HA 3DMJA 2HNZB 2KI2A 3SEOA 4O3NA 4K8RA 2K06A 2XC9A 3G71S 2M8HA 2ZBCA 3IWXA 2CQPA 4KT0C 4FVMA 3MEDA 4HH0A 4EFAC 2UVUA 3NMRA 1H6KX 1JKHA 5FLXU 1HBMB 1FJCA 2UXCJ 2UUCF 3B8HA 3SCLE 3V81A 1EKSA 3GR1A 3KFWX 3Q83A 2CWXA 3I9V9 1LW2A 5KT7A 4WXWA 3CNQP 4AT1B 4X4QA 4MK8A 3V6JA 1EJ7L 3GIMA 1Q86T 2IJRA 4B3MJ 4E0DA 1S12A 1QVFR 3QJPA 4OV6A 4LF9F 3T5LA 1Q5VA 1NH7A 1IKXA 1KP6A 1TUWA 1ZPWX 4CO1A 4CLZA 1G2EA 3CJKA 3G8TA 5A2QY 3FZ2A 4DV6F 2HVHA 2JEGA 2PT0A 5KG5A 2KRRA 4JI7F 1XEZA 1TL5A 1T9WA 2ZD1B 4I1TA 4KKOB 4KHMA 3DYAA 4LRBA 3V6KA 3N01A 1MMLA 4DV3J 3UR0A 3D0GE 5LXYA 5LMNJ 3TJ9A 4F4YA 4R0EA 3MR6A 4M5JA 4E2FB 1SBRA 3VGSA 4L72B 1RWNB 2HSEB 4ZVFA 5L9XA 1TL4A 1D09B 3W61A 4JI7J 4RW8A 5DJBA 1L3VA 3CDUA 2IVYA 3Q2SC 1WDDA 3BKTA 3KLIA 1NDLA 2HYIB 1JMTA 3M1VA 1WEYA 1CS4B 3KLIB 1SL0A 1IWGA 1GXTA 2X1GA 3MAAB 4LFAF 4YP3A 3JSYA 2VD3A 2RQ4A 2VQFJ 2EFQA 4OX8A 4LFCJ 2H54B 2G2ZA 4DOZA 3IG1B 2GMLA 1YK9A 5KFUA 1GXLA 3M05A 4ZJOA 1D8ZA 5JMNA 3LQVA 4LF8F 1SPBP 1F9FA 1WC4A 1PYSB 3FBBA 1UEUA 1FK9A 2KHDA 2LEPA 2RRBA 3TAMB 5BYQA 3KK3B 2FVQA 2FJBB 3RR7A 2PMHA 3D6HB 2JOQA 4OHXA 4CM2A 3NS6A 4IRKA 1FKOA 1U6BA 2J7WA 1H73A 2Z2ZA 3HD1A 2JLFA 1MNEA 4NPOA 1HR0F 3KLHB 4PUOA 2J6TA 1UW4A 3ILLA 3R5JB 2YNHB 3MPWA 4DHVA 2OMOA 1IR0A 2Z58B 3FEZA 4I64A 2HQFA 1QTMA 5H1SV 4PG7A 5MLCV 1X60A 4UY8T 5KG1A 4F02A 4M95A 3MM6B 2V6AA 1VHIA 3OUYA 3NNCA 4EI2A 2WVCA 2XSJB 3HHKA 2J7UA 2WB1D 1DHMA 4C0OC 1HPZA 4PQUB 1UVMA 5AXNA 2OFGX 2ZKUA 4B9SA 1YX2A 1SC4B 3D3CJ 2N4CA 1KKHA 3O6QA 1M5SA 1JNRB 4KAIA 1ZM3A 4M5HA 1Z4UA 4KJIA 2XYPB 1ZTWA 1RYRA 2WONB 2ZVIA 1QAJA 1UAWA 1BMQB 1RT4A 1RU1A 2BM0A 2I9SA 2LA6A 2C3PA 4OJ1A 2MSSA 5AE3A 5J2PB 5ETMA 2GFFA 2YWFA 1A6LA 2Y0BB 1OIAA 5KFFA 5HLFB 1HLWA 1FDNA 2GVZB 2HHVA 1NNDA 3GMGA 5DG9A 2AD9A 3VAKA 3D6FB 4K4TA 4KQZA 1NK5A 3PYFA 2XGPA 2XS5A 3K5LA 2FY8A 1SJQA 4NMXA 2EFVA 4H4OB 3MEGA 4CZCA 4FYVB 1FO1A 1Y10A 2F8EX 2M0GB 3KG1A 4WE1B 1YJ7A 2LDYA 3MM5A 4ZIWA 2R7VA 3HHNB 3CSKA 2N7YA 5HI7A 3QAUA 3IRWP 1TR0A 3I0RA 5K5MA 2IVFB 5THWA 4ZPAA 5KFZA 3KLFA 4WBFA 2OKQA 2HNYB 2QJ3A 4PCQA 5G4DA 4M5MA 5KFRA 5IV4A 4RUCA 1VQ8S 5I3QA 3JTOA 1JJ2R 3OXLA 3OV7A 5C25B 1IBMF 2VG5B 3LAKA 4K5RA 2AGOA 1YRXA 2ZH9A 2CJKA 3QYYA 1ZYQA 4K2JA 5HSPA 2AHOB 2HGMA 4XTTA 3GJTB 4U9RA 4YHHJ 6FD1A 3V4IA 1VMBA 1PSDA 5KG4A 3OJUA 3EGVA 5DG7A 1WHYA 3K59A 4FXDA 5F41A 2XMVA 3J7YU 2ATCB 2KYXA 3ISNC 1WC1A 1VRTA 2W01A 1H0HB 3LP1A 3M30A 2WVEA 4DQPA 3LP1B 4F2SA 4I67A 4EBCA 4NXNJ 1FJGF 4OYXA 3P3DA 4KH0B 3VGTA 3KKFA 4DBQA 5L38A 1YITS 2V9KA 1AT1B 1KC8T 1X9SA 1GH8A 1HD0A 2CPFA 3C8YA 4NLSA 2RDJA 3QSYB 2B6AA 4EEYA 1NRKA 2RSQA 2VDIA 1XNQF 4TY9A 4QCLA 3UFCX 4QIEA 3PY8A 3PACA 3J7ZT 3MAAA 5I3PA 2I0XA 2EFOA 3T6JA 3W2WB 2MY8A 1X4EA 3RW6A 3R6GB 3T3FA 2BM1A 2L48A 3N79A 4A8KA 1JX4A 4IKAA 5C25A 4CIOA 1U2FA 4WIIA 5AE2A 4RNMA 2NXEA 2ALYB 2ZZTA 1X5SA 1V5IB 2ASJA 2BACA 2WSFC 4LT6A 1SJFA 1ZZFA 2BXJA 3ENWA 2R8KA 3HLUA 3UPFA 5M2PA 4IFYA 3AD7C 2X3GA 1Q0NA 3QT7A 4M5LA 1J2VA 4Q8FA 1U47A 4JI3F 2D9PA 5J1PA 1E6VB 1IJFB 4DL5A 1RADB 1SV5B 5HAOA 3PJ9A 3SXLA 1LW0B 2GS8A 5E3QA 4AXJA 4F0MA 3F41A 2IY5B 3EZ5A 2DXEA 1HHTP 3AD9C 3M1VB 2KXNB 3DLGA 2EXUA 2HS4A 3Q8YA 1FF2A 3QZ7A 3KYLA 3PFEA 3FNNA 4DSJA 3UD3P 4K5SA 1B7YB 2UU9F 5KFJA 2NLWA 5C24B 4C11A 1N6QA 1RGVA 2RJZA 4ZVSB 5L9NA 2HMIA 1TL7B 2DNPA 4NZ6A 1KQKA 4KYZA 3DRRB 5AXLA 4CWBA 2LKZA 4ED3A 1AFIA 1EB0A 1NSPA 4P52A 1NHVA 4FF3A 3HSZA 2FHJD 1FA0A 2WRMA 3MUVP 2BQUA 3CGIA 4J90A 3JYTB 2FJWA 1YJ9S 4WZQA 1BY9A 2FJEB 2R2SA 3RB4A 3AHPA 2GJ2A 1SJ1A 2QLXA 3AFGA 1FD8A 1RAOA 4CT8A 1YLXA 1RT3A 2ASYA 5JVHQ 2WBMA 2MHNA 3RB0A 5CH7B 2UXBF 4F0HA 4X62F 3KJVB 2YKQA 3M9MB 1SH2A 1D9AA 4KGMA 3PW5A 1WKJA 4OMFG 5HROA 4RU2A 2H65B 1VGYA 5KTQA 4JI4F 4C9DA 1CJVB 2FB0A 3RBDA 1FHTA 2KT5A 3HT0A 3MM6A 4KGXB 4DR7J 1GMVA 3CCWA 2ZH8A 2A6MA 2R7SA 1XJWB 4EBEA 1VQMS 2P6TA 1L3SA 1MROA 2MZ1A 3PR4A 1S6PA 6FDRA 2ALZA 4W90B 2IJNA 3LOUA 3MGJA 2L9WA 4LSLA 3H2UB 3GFHA 4NL5A 4Y28C 4TQSA 1YRTA 3NOGA 3PO5A 3OW2R 5E5NA 4JI6F 1S1WB 1JXEA 3EM1A 1KD1T 1JK9B 3FRYA 5A8KA 3SQGB 3MMJA 5L1KA 5HP1B 4C97A 1N48A 4HH1A 3SQGA 3B54A 4F04B 3KK1B 3L95X 1PCAA 2CG4A 2VPYB 3NAIA 3NBPA 1H7WA 4CLPA 3KDOA 4M5KA 3W5YA 2W8KA 3CCUS 1CJKA 2CAJA 3U1MA 5HJYA 3M2VB 5HO4A 4K4YA 3I5BA 3C46A 4B17A 4CLSA 1Z2LA 2HIQA 3NCQA 4ZVPB 9RUBA 5HMXA 2YX4A 3PW7A 4RBVA 1Y5NB 3A3PB 2ZC4A 4J7CA 5GADI 2E1CA 3H5XA 4KHRA 1OMSA 5A0YA 3IS9B 3ZTOA 3EICA 5KG3A 3IS9A 3EVMA 2OPRB 3SV3A 2XS7A 3WHIA 3PVXA 3NKYA 1RT6B 3MM8B 1IBMJ 1R3NA 1X4DA 2HAIA 3QSIA 2HHHF 2GNKA 5F0WA 3R3TA 1GMWD 1NDPA 5KFCA 2V63A 3VGUA 3IRXA 2LEBA 2IA0A 5LMNF 1S6UA 2H1YA 2G9OA 4ZMMA 4K4ZA 4IG3A 1RU2A 1JLBB 1WKKA 3MR5A 2AJ2A 3AOCA 2OD4A 4DV7F 4CM0A 4F4XA 1VC0A 1UFWA 4PG5A 2XLKA 4KRWA 4I7FB 2VKZG 2DH8A 2KG0A 3TI0A 3AH6A 3SDEA 3W2WA 1R8CA 2BJ9A 4HDGA 4DPYA 2VICA 1FFWB 4ZHRB 2EFNA 2QX0A 2V69A 5EX3A 2QEXS 2R7TA 2HEKA 2LMIA 3JQJA 3ZO7A 1TKDA 2DRBA 2PGCA 3T9ZA 4AQYJ 4ZP8A 2HAFA 2PI5A 4NXMJ 2QLJB 4ED7A 4M5GA 4LJMA 1JB0C 1BD6A 4F3MA 2BQ3A 2HLTA 4N47A 2W24A 1JLCB 4N76A 5F8JA 2EVZA 1T05A 2VOOA 4V19J 2EFPA 3I0RB 3TA0A 4DPUA 2VL1A 4ZVTB 2LXFA 2PIIA 4DV6J 2ACYA 1TKXB 2YXLA 4DL4A 2H3EB 3ZZUA 2ERRA 4CNYA 1JQGA 1T9TA 2VBYA 4QPXA 1R6VA 3D66A 1NKBA 1F60B 1IKXB 2WZ1A 2HIYA 4WTYA 5KFMA 3O44A 1HNVA 3ULHA 2AKWB 2ZH2A 3CO9A 3RW7A 4X4UA 3AAWB 1L3KA 4OX9J 2X7IA 5K9FA 2IIHA 5CD4H 2CQ4A 2BE2A 1SIWB 1M1KT 2Z30B 4P2SA 4B3TF 2W9AA 3IP0A 2QFJA 3OSPA 4Q44A 1OQ3A 4GVLA 4USHA 4DUYF 5A6PA 2GX8A 4OFZA 3V2UC 2ZM6J 3FVYA 4MMOA 4F3OA 2IBOA 1CULA 2H5EA 4PEOA 4QWAA 4QYZK 2B4UA 4N7TA 4NCGA 4DXLA 1T05B 1N36F 1G4CA 2BQRA 2E29A 1YKWA 3IM9A 3M32A 3VAMA 2HURA 1RAIB 1GEHA 2Z4PA 3A1YG 1U8WA 3GIIA 1FVSA 2GAGC 1Y9OA 4HTJA 4IO1A 4NRTA 1WC3A 2HMIB 2FVPA 1TV6B 2VB6A 4KFBB 2QSFA 3F0NA 5L46A 5T41A 4E98A 2WSEC 2R8HA 1LFPA 2FYXA 4ED8A 2VFTA 2IM2A 2PMZD 4ZCLA 3TEGA 4YR3A 2BRLA 4ZP9A 3ZNUA 4K0KF 4OYAA 1WOPA 2DITA 3ZZTA 1RAFB 1IWAA 2YPZA 3C14B 2VDHA 1O5JA 2WOMA 3VVTA 2Z2LA 2WOMB 4YB1P 3CCSS 2H5JB 1U7LA 3ZNJ1 3HFVA 3Q8QB 1IM6A 5F8IA 2DXDA 4QWCA 3GZ7A 2LQ8A 2M7SA 1JLAA 2Y8YA 1C4AA 2B56A 2HBYB 3G4SS 2BDPA 2V2ZA 2Z57B 1FRHA 3R7SB 3J81j 4JBCA 1LWFA 1N0VC 3QIPA 3H5SA 3MOJB 3GCXP 1W25A 4DS5A 1YBUA 1HYSA 3HHLC 3T5HA 5D0EA 4ZPWR 1ZPVA 4OJGA 2P6SA 1HR0J 4FPIA 1U26A 4YDXA 1HIYA 3PR5B 1WELA 2YNGA 2IM3A 3OL9A 3DDNA 4QIWD 2R2TA 4CT9A 5LMUJ 4I69A 4DFKA 3LP0B 1Q4RA 4DI6A 5AE1A 2UVVA 2E5JA 2IPOB 4UQTA 2DH7A 2NYHA 4LR9A 2CQIA 4J9VA 2G4BA 4BCAA 1YZ6A 1W2IA 4A8FA 4M1KA 4BDPA 1S48A 1C1CB 1RHRB 2ZE2A 4ZCKA 4EO8A 4JI2F 4ZCMA 3BKFA 2P5VA 3QLHA 5DLGA 3FK4A 3DLEA 2KL8A 2FIUA 1X5OA 2VUGA 4LFAJ 1QUVA 1UMJA 5KT5A 4HHUA 3NNAA 4X4NA 4XIUA 4TY8A 1I94F 2IAJA 1QE1A 1U24A 4C2MA 4FN5A 1Y5IB 1RYSA 3NMAA 3LWMA 5C5JA 1IN0A 2KN4A 2CNNB 3NRBA 5BR8F 2HHWA 4MIWA 3BH7B 5H9EK 1XN9A 3EYZA 3C2PA 3KUHA 3OPKA 4DDFA 2ACMA 2DHGA 2QL7B 2AQ4A 1KTVA 4USKA 4B9NA 2PFDA 4Q0BB 3WC2A 4F67A 3LTOA 1IKVA 3MCMA 1HBMA 1N0UA 2C2KB 4X4SA 1VOMA 4JV5J 2HNYA 2F40A 2HNDB 2PSZA 2CADA 1CJUB 3PEJA 4ZLLA 1W7WA 4URGA 2R2UA 1U1PA 3TX0A 2MQ8A 2V34A 3AOAA 3BO2A 5D8HB 3FGVA 1Y5LB 1M5VC 3OTOJ 4M94A 1GK8A 3TUPA 4DUYJ 1GMUA 1K9MT 3PRDA 4G1QA 4H54A 3D6TB 4P72A 1B0PA 5SUHA 2VODA 3P8BB 5CYMB 1SJ3P 1U25A 2IA6A 4EGLA 1YJVA 4JI8F 1WHXA 1C2PA 4FP9A 4PWDA 1VQYA 4DG1B 2KG1A 3I4HX 2DRAA 2MZSA 3Q8RB 2W7PA 4DFPA 3EE3A 2CJBA 4G1PA 2GHVC 3W7BA 2ZUAA 1EZZB 2RS8A 3NS5A 2VV5A 2ZOFA 3UDCA 5GMDA 1JKHB 3KHLA 2HHXA 2N3LA 5ETLA 3LH2S 5HBMA 3K5NA 2RS2A 1YIJS 4C4WA 4MYTA 2XYHB 1SKUB 5KFGA 4QBUA 2F4VJ 1V6HA 3GG0A 1VISA 3R5CA 2MLXA 5JJBA 4YY3J 4R8UB 3CCRS 3DC2A 3DCAA 2DGQA 2E44A 5JVGQ 1RTHA 4RR5A 1N33F 4DPOA 5J1NA 3H4DA 1B70B 3IR6B 2IRXA 2A18A 1NK4A 2E9ZA 2W2PP 1TL3B 2OO4A 4KFBA 4NXMF 1UTAA 4LSZB 4AQYF 2GIQA 1TL3A 3N9UC 5EWFA 5DM6Q 1IBCB 2IFXA 2RHSB 1RWXB 3GJSB 3HZEA 1HW9A 4YB5A 3EDRB 3BN7A 4PZVA 3FSIA 2FD2A 2B3TB 4ECQA 4G6VB 3CDBA 4L6V3 4MFBB 1IJEB 3US5A 3EPIA 1BGXT 4LVNP 3QGHA 4DR4F 1TUVA 2OHDA 3CTRA 3B4MA 4CLFA 2DR5A 4ZPCA 5CABA 1E6VA 4CLWA 4FS1A 3BH6B 1VHFA 3DGPB 4DR1F 1KFSA 5HMZA 3MEEA 1PAEX 3NGKA 2NQPA 1S9EA 2XLJA 4F8RA 1RTJB 3PIOQ 1OO0B 1RWOB 3PJXA 2D69A 3BZQA 3HHLD 2B4PA 5KFSA 4Z2XA 4XPCA 4NZ0A 5C24A 2VJVA 4DV5F 2WW8A 2GIFA 2JLGA 4JI0F 2KVQE 1APSA 3UCZP 4OYBA 5I4MA 4C11B 1YJNS 4ECTA 4O44A 2OI2A 1PIEA 2YNGB 3BBCA 2B0GA 2AJ1A 2MYFA 1S79A 4H4MB 3TA1A 1FRLA 2RQCA 1S9GA 1HQUB 3E01A 3S6EA 3VCDA 1ZAXA 3VV2B 2DH9A 1VQNS 1S6QB 2YKNA 1K0VA 2KRBA 2W9CB 3KMQA 1F5CA 2D3UA 3D9BA 3GPAA 4DQIA 1DQ9A 2VBWA 5CCMA 1FKAF 2ZH5A 3RBEA 2QE5A 1RSCA 1T94A 4ZA1A 2KB2A 2R7WA 2DIVA 2GZOA 3BSNA 2CUYA 5KFHA 4C7QA 4EBDA 2OSRA 2ADCA 2YBVA 3CC4S 1WG4A 3DOLB 2UUAF 4WZMA 3AB4B 2YVSA 3ISZA 2CJYB 2YKPA 4DR5J 2AW0A 1HWKA 3CJTA 5DZ6A 3Q8SB 4NLOA 4JYAF 4FPRA 3POTA 5E41A 2N82B 4K4SA 4RBUA 3MMCB 4TVAB 2MKJA 3CJ3A 1FRXA 3T1AA 1OWXA 2GHWA 3P96A 4CLYA 4NLDA 3BREA 4ZLPA 1HNZJ 1BE4A 4UY85 4AUKA 3OR2A 4OI6A 5CYQB 2IVMA 2DXFA 4QWEA 3CXCR 2HNDA 3KHHA 2VQEF 4USUA 4U96A 5KFBA 3G87A 1KOHA 3NWRA 1S1VB 2FC9A 3PYGA 2OAUA 1FTCA 2W9CA 4TNOA 2I38A 1NO8A 1OSDA 2G1HA 3B4DA 3DM2B 4UOGA 2AJFE 3MPDA 4S0MA 2HRUA 4RL1A 4LR7A 1BQMA 2RMLA 2KFZA 3IXQA 5AXKA 1X0PA 3RJMB 1VQSA 2HRTA 5IWAJ 2OPSA 4W98A 3CJRA 3KOAA 4RW9B 4YDDB 2IYIA 4AD6A 3ZTPA 5ITHA 2XMMA 4DV1F 4Y2AA 3N5BA 5KFKA 1RABB 1X4HA 3MD1A 4Q7AA 3V81B 3A3OB 3PKYA 3OL8A 3KLFB 2ATLA 1RTDB 2YWEA 2KU7A 4O3SA 1K0TA 3IBCB 1M90T 2DT9A 2C2ZB 2HLUA 2AJ4A 2WHOA 3HFZB 2DEJA 2YWWA 3DLBA 1NJIT 1B99A 5T7LA 3ILIA 4AL5A 3R27A 4CLLA 1SQFA 1U09A 3EXCX 2CZ4A 4DR3F 1S72S 1UVNA 3H2VE 1NPRA 1TMJA 2BE2B 3NOCA 3W8PA 2MQPA 2GVZA 3CDEA 3VWSA 4DV4J 5H9EJ 1KFDA 4BLGA 2EG2A 2ROPA 3LPYA 1HNZF 1PYTA 1Q79A 3G82B 4OYOA 4RBTA 4RW4B 2CQBA 1S77D 4OI2A 5HQMA 2XZWA 3HK2A 2ILYA 1UPMB 2F5GA 3BDEA 4LRFA 3H25A 1YJWS 2NPIA 5IT0A 1CULB 2HRYA 2KYZA 5DZ7A 3OXGA 4NCGB 4F26A 2PMWA 2HQDA 1UEVA 3L09A 4YUDA 1VIOA 4R5PB 9ATCB 5HMWA 1YDLA 1CJUA 3QWUA 2PI4A 3MFIA 3HT3A 3PZPA 1S4FA 2J0SD 1TKXA 5E3AA 4LIRA 5GMEA 3D28A 3LALA 1ZA1B 4LIWA 4USTA 4DU8A 3ETOA 4A48A 2C2DA 4KB7A 4EU0A 3KLGB 8RUCA 1S1UA 2Z0GA 3HHEA 1FE0A 3AA8A 1HARA 1YG0A 2HKEA 2GCFA 2HVEA 4X4PA 1JNZB 1P27B 2BKNA 4O3OA 1K73T 3DRXA 4JUZA 5K8PA 4DV0J 4MK7A 4OLOA 3F56A 1S9GB 4RW7B 4YB6A 1IBKF 1PG5B 1R8HA 3H90A 1RJJA 4XDCA 1M0SA 1SV5A 4RX6A 4KGKA 1LW0A 2VFUA 4OV1A 2CVIA 2DGVA 3AJ1A 3CDWA 4KSEB 3KLEA 3BGFA 4BWMA 1JLGA 4DR2J 1TK5A 1NKEA 4Y00A 2HVDA 1RT2B 3DLKB 3HCXA 3R6LB 1J27A 1N4LA 2ADBA 3FEXB 2EBEA 3VGVA 4YS2A 4P71A 1X9MA 1RAEB 5DDQC 1K44A 4AFFA 2HBZB 4Z7CA 4CTAB 1CS4A 7AT1B 1S10A 2UVWA 4O3RA 3NGUA 4B3SF 4DSEA 4LBPA 7FD1A 3PW2A 2ZOMA 4NLUA 4DUTA 4B3TJ 1KVIA 3GJQB 4IUFA 4NLGA 4DEZA 4JYAJ 4R25A 3HJFA 1S4EA 3D67A 1VR6A 1HNIB 3O8WA 3QBCA 2V8DA 1DTQB 3OXFA 3FCWA 3ET6B 1XNQJ 4QYZJ 4WKRA 3KK1A 3HSDA 5IC6B 3J81Y 1G3OA 5C7PA 4RZRA 3UN2A 1U1KA 4K7QA 3KLEB 4I6WA 1P6TA 2VC0A 4ED0A 1D1UA 1R27B 1HQEA 2WCXA 5EX0A 1XC9A 1F2GA 3TWZA 2L9DA 1JLEB 3JQKA 1RKIA 5KFDA 2AYGA 2MQMA 4LR8A 4PABA 3EDQB 2B7CB 4XDDA 3ENAA 2QGFB 2OIHA 1NSAA 4A8YA 4B9MA 1HBUA 3VHQA 1CEZA 5ETSA 1Q82T 1S0VA 3OUYB 2W2NP 3P4UB 2NUUG 4MIBA 5HQLA 1HNXJ 4FKXA 2VIHA 2MKHA 2HHSA 1RUSA 3QFHA 5LM7E 2M88A 2V2QA 2VG6B 4OI3A 2NPFA 3NBPB 1KVKA 1WG5A 1WG1A 2DB1A 2YNFA 3HVWA 5KFTA 1NJZA 4F4KA 4NCBA 1AROP 2K3KA 3MCSA 2LQ9A 4OI4A 5CCLA 3M9OB 4ERDA 3GE9A 1A7GE 1XMQF 4I6AA 1H2VZ 3EJMA 2O5DA 5L39A 4GKKJ 5IT9Y 1PBUA 2HGLA 3M8RA 3KJFB 2HWHA 3TQ1A 4RWXA 3QRPA 2X1AA 3HI9A 2AT1B 3GSDA 2V4JB 3HVTA 2YWHA 1CPZA 2KO1A 1XNRF 2ZWPA 3KJNB 1U1MA 2DVIA 5C2CA 2OTLS 3W60A 2DNLA 3HZGA 1UCNA 4G65A 2DNGA 5HBMB 4CO3A 4DL2A 1Q8BA 2HFVA 3HJVA 2IHR1 2XI3A 4LSLB 4RW4A 3WZ0A 3OL7A 3AODA 1J5EF 1VQ9S 2XCPA 4K50A 3SMZA 2PN6A 1Y3JA 2FZCB 1CJTB 2XYGB 1XMOJ 1SVDA 1KBRA 2H4WB 1R6YA 1MG7A 4PQAA 1Q7LB 3UNGC 1HI0P 2C1EB 1TL1B 4KIAA 2QSWA 3DGVA 2BYCA 3EXYA 4MJKA 2ZBQA 4M5NA 4DPWA 3NCPA 1YWXA 2H51B 1TK0A 3RTVA 1VK3A 2XBPA 3D1QA 4K59A 3OBIA 2KVIA 2YKMB 3O3LA 1YI2S 2A10A 2QG9B 1IXKA 2O67A 3OFFA 1N8RT 2DR8A 3SCJE 3UWTA 3GFYA 1R43A 5IQQA 2F4VF 3AJDA 4GRSA 3TEHB 1OJ4A 2I6WA 1QJHA 2Q79A 2QMWA 2EC0A 3NGDA 2BRKA 4RW9A 3PO4A 4J9UE 4PWDB 2E5GA 2CPZA 1F6TA 3KWMA 2LQJA 3DLJA 2CJXB 4NI2A 4ALZA 4GVBB 5KFWA 3Q22A 3E3XA 1QD1A 3C16A 1O51A 1X5TA 5AJ3F 2CPEA 3BSAA 1T9YA 3IFEA 1FWKA 2ZBIA 4F2RA 2YX1A 2XHCA 4UQGA 2IC3A 4LF8J 3V5RA 5F8NA 4LFBJ 1M5HA 4IG3B 1Y11A 1VIXA 2AEMA 2C42A 5HVFA 4WFXA 2MKIA 5FDLA 2VKRA 3OHAA 4M8LA 3DRRA 2FJXA 3GP9A 3OTCA 4DX7A 5GAHI 4NXNF 3C6TA 4KE5A 5AJ3J 4TU9A 3QT8A 4CO5A 4ZS6A 3RG6A 1HWLA 2DNHA 2FUG9 1VCTA 2YY3A 2BBEA 3CW2C 3DU6A 3OFGA 4MFBA 5J1EB 4MKVA 4OX7A 4EWTA 4ECWA 2CYYA 3Q2TC 4QU6A 3FJ2A 2VFSA 2HZVA 3RB3A 2AYBA 1KHWA 2U2FA 3J7YI 3BJYA 2DGOA 3T1HF 1UWBA 2W4DA 2V4RA 4TKTA 1S0OA 1ELOA 5HATA 2FJVA 2UXCF 3M8SA 3GYNA 1HBNB 2HHTA 5BYSA 3TZWA 2J8AA 3FDSA 1Y7PA 3KJQB 4C8OA 1CVJA 2J0XA 4OZ3A 2X3DA 4DCPB 3DGPA 3P5BP 1VBZA 4V1Ak 3SCIE 3UW1A 1RWWB 3MCNA 1FI4A 2HGNA 2FVSA 1P9QC 1K47A 1RAGB 2AP6A 4MT1A 4A8XA 2AZ1A 4DV3F 1P9YA 4PXBA 2D74B 2XHWA 4OIXA 4H4MA 2LU1A 3TAQA 2CVEA 1FDAA 5KT4A 2CPJA 3FKBA 1ZAWA 1FRMA 3DI6A 2GGPA 3TARA 4W92B 1D3WA 4FNIA 5GMKa 2MY7A 2A1BA 3M9NB 1KQGB 4HDHA 3CMQA 1FEHA 3CJQA 1C1CA 2J76E 2ZE2B 3KLHA 1N34F 2NR0A 2VA3A 2D3ZA 1T9XA 2P9GA 1N36J 4L3KA 2A2CA 1NKCA 1ICEB 4KTQA 3CF5Q 4HHJA 3VR1A 5GADU 2BW2A 2QA4G 2BZ2A 1VS3A 2EPIA 2MTLA 1RT6A 1U02A 2EG1A 2WVFA 1O0PA 2F4FA 3MM8A 4Q2MA 4O3PA 5CA5A 4U6PA 3PTWA 3RAXA 4OHWA 1WOOA 1VQ6S 1HPZB 2QL5B 4TQRA 4K4WA 1MROB 2HS3A 3BGRA 1RTDA 2O3DA 2N4DA 3JXOA 1QLNA 3PHTA 4DV2J 2IYGA 1SH3A 1X9WA 4LF5F 2GV1A 2ZDPA 1C0UA 1H2TZ 1S0MA 2EKNA 4LQ9A 4IYQA 5DS7A 4L3NA 2IM1A 2QMXA 2D41A 4KPCA 1RT4B 4ED6A 1J5OB 1VQ5S 2FJDB 4MK9A 1WI6A 2MGZB 2NREA 4ELUA 1TFYA 3GV5B 1RE1B 2COLA 1YSJA 2VF3A 4NASA 4Y3CA 5E7OB 1FFSB 2CJQA 2YQ1A 4WWSA 2ZJPQ 1T7PA 3KNGA 4NLVA 2DCUB 4FF2A 1IKWB 3I0SB 1XR5A 1EP4B 3E2EA 3I9ZA 5LXRA 2ZWOA 1HA1A 3KUGA 2QIFA 2VBXA 4PXCA 1FNOA 2UU9J 5M2RA 3ETMA 4QIVA 3D0IE 3GB0A 4NYPA 4WYLA 3T1YF 1ZZNA 4U67Q 4ATNA 3J80U 3C16B 2DNRA 1PJ6A 5G0RA 2W8LA 4JI5F 3LA0A 2FHMA 3BR9A 3K2YA 4ILMA 1BWEA 2XZDB 3MMAB 3M2RA 2VJUA 4C0BA 3TVKA 4X65J 1LEOA 4GKKF 1VRUB 1U1LA 4DJBA 2J9CA 2POKA 1HWUA 3PCOB 1REVA 1WHVA 3QLHB 4OX6A 4RU9A 1SUQB 3BSOA 2C2OB 5J2MA 4ED5A 2ABYA 4OHYA 4U7UD 2OFHX 3TJAA 4DR2F 4L73A 2HHHJ 3MEKA 2CQ2A 3W9IA 4ZKAA 2NSBA 4L76A 3BO4A 4CLKA 1RWMB 4GC6A 1F2HA 1KLMA 2F63A 1Y00A 4J9PA 2W7AA 5J1EA 4ZDNA 3SZ2A 1FKPA 2UP1A 5B0DA 4TLQA 3DOKA 3MM9B 2MQNA 2WSCC 4KGZB 3TZYA 4UUWA 2UXDJ 2AJ0A 2E5HA 3AT1B 1N5SA 1RTIA 3PX6A 2HVIA 3BGUA 3MF5A 4TYBA 1AYEA 4MH8A 5FDLB 8ATCB 4ID8A 4QR0A 1KONA 2W2QP 4CTAA 3VAFA 3EVWA 4ELVA 2DNZA 2AMCB 3HXMA 1X4GA 2DIUA 3EZUA 3HHLA 3M8ZA 3M4XA 1GNKA 1CC7A 1VJQA 2AX0A 2FDNA 2BA9A 2RD5C 4PPDA 4IG0A 2DNKA 3TUZC 2MSTA 1AZSB 2DHSA 1VBKA 3K5PA 3HSJA 4ID5A 4PYDA 3MMBA 3C14A 3TZZA 1N32F 2RRNA 2KT2A 4DQRA 3KG0A 1RT1B 1NH8A 3OQ2A 2HHUA 1BHNA 5HN0A 1WTFA 2EW9A 2OEKA 2R7UA 3D0HE 4NEYA 3D7SB 2K3IA 4URSA 3AB2B 1S59A 5KFPA 1S1XB 3B78A 4URQU 1RLCL 1KN6A 3DFEA 2Y1JA 1U1QA 2W25A 2ZNYA 1LK5A 1RTZA 4A8MP 1WF1A 4ZPBA 3L3CA 4DR3J 4Y34A 2E5IA 1FE4A 4O4GA 4I2QB 2V68A 2XWYA 5DQGA 5J2NA 2W2OP 4I2QA 2XNRA 2HPUA 5K8NA 2ASDA 5L1JA 3R5GA 2IRUA 3EGWB 3HHLB 2CRLA 2IM0A 4LVOP 1XMQJ 3MECA 2UV8G 3JYTA 1RWPB 1X4CA 4UF4A 5I42B 2YNFB 2D7SA 2Z2MA 3AXMA 5L1LA 4DV1J 4AL7A 1Q81T 4OYIA 2FVCA 1GFWB 3FZBA 1Z2ZA 2G1DA 1YZ7A 4JB8B 3UI3A 2DNOA 1C4CA 4DQSA 1XR7A 2LU2A 2D3OR 3EZOA 4NLRA 2PEBA 1I5OB 1KR4A 4HHHA 2C2EA 4GO7X 5HANA 2V4JA 3HVTB 4TY8B 2C22A 3DM2A 3IWLA 2PC6A 3KDNA 3H8YA 3H98A 4USIA 1GQEA 1FK9B 3TAMA 5GAGI 4DR6J 4Q2LA 2CG8A 1YHQS 1NM2A 3GR0A 5B0BA 1QY7A 1RCXB 1CG2A 3MM7A 3SIPB 3UDEA 2E7WA 2UUBF 4Z37A 1AXQA 3Q86A 3KLVA 2I1RA 1UFKA 5CYQA 1VQPS 1NEEA 1LOUA 2GGPB 3FCVA 3JQMA 4IFVA 1RZMA 4B02A 3W1YC 4YHHF 5I42A 3FSXA 3MURP 2DHAA 4G1QB 3WIVA 2YH0A 1DLOA 4NLYA 5F9LA 2PA8D 3U02A 4J9QA 1KS2A 2CNKB 2MZTA 2HBQB 4ETXA 2FLOA 2UUAJ 1VFJA 2R4FA 1VC6A 2XMJA 3DOLA 4QYRA 1Y3KA 2IMOA 2FZGB 1HW8A 1S1TA 2NYIA 2ZHOA 1XWLA 1CBKA 2JJ4D 3OTDA 3I87A 1IKYB 1MLAA 1Q8IA 2DO4A 2K7KA 2QMUB 3JS9A 3M30B 4OJ3A 3Q8PB 2AGPA 3RYLA 1FJ7A 1Q1KA 2GQ2A 2HWTA 2V50A 3GJRB 5KFXA 3T5JA 3PW0A 2FLPA 1EKRA 3AOBA 1FKPB 3I32A 3DDIA 1FD2A 4DCJB 3TUIC 5ETKA 1NUEA 1S49A 2D9OA 2N3OA 1I3OB 1RI7A 2M52A 2G2YA 1X4AA 2VFRA 3MMAA 3NXZA 3QO9A 5ADZA 2CJAA 3DRPB 3QO9B 4LF7J 1JLBA 1U2CA 3K5MA 2VG7B 2IRYA 4QR2A 5D3GB 2BV3A 3UR3C 4CYUB 3QATA 4I7FA 5HMYA 1ZBTA 4DU7A 2F9JA 3PEHA 4ICLB 4WFAQ 3RRGA 4ZN3A 5GAHU 4DR1J 1S1UB 1IKWA 2RUGA 4CDIA 3PRVA 4QU7A 3IGVA 1R0AA 1TZ0A 3RU0A 5D78A 3W63A 2OD6A 1HL6A 4X64F 1D9DA 2GQQA 1K8AT 2JFDA 3X1LB 4YOEA 2QYCA 4LF2A 1JLQA 2ZNZA 4NI2B 4JI5J 2XEXA 1Q7YT 4LF9J 2HZAA 4WPAA 5IOLA 4NA3A 2JZ5A 2IBKA 4PXDA 4DUZF 4USVA 4TYAA 3V4IB 3CJ2A 4FZVA 1TVRB 4RNHA 1LXNA 4HT5A 3QRRA 1HMVA 3C15A 4GO5X 2O1PA 4YN3B 2OEMA 3DDKA 1Q78A 3CD6S 2YKAA 3QGIA 3R5AA 1WSRA 2CPIA 4BC7A 5BYRA 1GTEA 1REVB 3QZ8A 4DV4F 1P1LA 2M3DA 1T3NA 3ELHA 3PYEA 4ID5B 5J2NB 4RLEA 5DQHA 1E6YB 1RISA 2KH9A 3I4PA 4YY3F 1S6QA 2DPIA 2OPQB 3G6ES 1C0TB 2H48B 2ZOGA 1XERA 2LECA 3M7VA 3HM9A 4B3OB 1T11A 2YQ0A 2B5JB 3ILJA 2I5JB 2J9DA 2LP4A 2XMKA 1B4SA 1MWZA 3GYXB 4N8NA 4J9MA 3LO3A 4X4VA 1M1GA 5ETQA 2VH7A 3CC2S 4C8ZA 3L7OA 4UZBA 1UETA 3M6WA 2NS1B 3P45B 1CJVA 1RT7B 3IR5B 3D1OA 2MMYA 2CQCA 3D54A 3MEEB 3N6LA 4O4GB 5E3RA 1HQEB 2SXLA 3DU5A 3OTOF 2GMHA 3HKWA 3R8YA 3UD4P 5H9FK 4MKAA 2VFVA 3OL6A 1JXLA 1RAJA 4DR4J 4N77A 2RU9A 1XMOF 1B3TA 4DX5A 4RUBA 1T9UA 2V8PA 4ILRA 1U45A 3U1NA 4RW6A 3Q89A 4ES1A 4IOAQ 2FJAB 4DSLA 3QRQA 1S76D 1VC5A 4OHZA 1HNIA 1LK7A 2G13A 3ET6A 4DL0C 3DI6B 1OS5A 4ELTA 4IO9Q 1DTTA 2QZ8A 1VLOA 2YKNB 3GONA 3MTKA 4OZJA 3ZTQA 3WX4A 3R97A 2FHKA 5DDPC 4PUOB 4QR1A 1H72C 1BQMB 1YJUA 3KHRA 4P2MA 2ZHAA 1T03B 2ZEJA 4A4JA 5CD4A 3I56S 2OPSB 1N33J 1JLEA 2VPXB 3CDAA 2IDLA 3W64A 2F7VA 2R2RA 1S0NA 1PGZA 1DZ5A 1HYSB 2FPHX 4M5IA 4M63A 2MKYA 3TVZA 3BQ1A 3QJLA 3IAM9 4MIAA 3H59A 3BBFA 3MM7B 1QAIA 5IV3A 1TP7A 3FMBA 4A8SA 2GC8A 3ENQA 1N34J 2J0WA 1TQLA 4DL3A 5D6GA 1R7IA 1WACA 3IRXB 2BJ7A 4NOHA 4USMA 3Q24A 4KH1B 4NE9C 4Q8EA 3OSNA 2YWKA 2LEAA 1DLOB 2RB7A 4U8VA 1B0TA 3IGNA 4FKYA 3CCES 3TANA 1N88A 3HO1A 1FFGB 3ADAC 4B08A 4CLUA 2E1MC 1DTTB 3IN5A 5HLFA 5KFIA 1NCLA 1SKSA 2CDQA 2OSQA 3VAGA 4RPFA 1A9NB 1SC6A 3LANA 1RP5A 2RAQA 3QGPA 4P7VA 3BN4A 2DHXA 4KY3A 2ROEA 1V3RA 4JV5F 3OFEA 3NG8A 1UJ4A 2MB0B 3MCOA 1BXNA 1EP4A 3RB6A 1S6OA 4KHPF 3ZZZA 5GAGU 4OZ5A 2V9WA 2W1BA 3GWCA 1EAYC 4R5PA 5G0RB 2G0JA 1HFEL 3JTNA 5A0YB 3IM8A 3V6DB 4TXSA 2EWHA 4IFVB 3TRGA 3G6YA 1TELA 1TTHB 2AYMA 2F9DA 2OPPB 1YQHA 2VG6A 2VPWB 3RUBL 2R7XA 4ZVGA 4C3LA 3OR1A 3MAQA 4LF4J 3K57A 4RNOA 5D0RA 1NXIA 3OR1B 3IO1A 2VG5A 4FVCA 3KLGA 2ASLA 2ROGA 3ENVA 3NGTA 3OD2A 3CEDA 4N8OA 5CYMA 2W7OA 2DRDA 5F8HA 2UUCJ 2FGCA 1F3VA 2KKHA 1NSKL 1WSVA 3R2DJ 4HACB 1H98A 2OPQA 1X31C 4F7VA 1SJ4P 4OYPA 4PRFA 2HFUA 2L3MA 1MU2B 2M2BA 3DOMA 4OYMA 1N5VA 1ZA2B 3D68A 3U1LA 2AZ3A 3MFHA 3I5AA 3ICLA 3KHGA 3LGNA 1O6XA 3GILA 1VBXA 3E8OA 1KOOA 1WHWA 3C15B 3CCZA 2MKCA 3BS9A 2X51A 1KHVA 3K8VA 4USWA 5DM7Q 2LYVA 4WU2A 4Y2IA 5E33A 1RT7A 1T3OA 4PXEA 4JI1J 4ER8A 4ILLA 2XULA 5E0OA 4NRUA 3T1HJ 3VTIA 2BKOA 2M70A 3V6DA 1ZETA 5D0GA 2KHCA 2JEJA 2FC8A 2DKOB 4DSKA 3DXBA 3GYGA 3MEDB 4ZIVA 2CDRB 4ZVHA 1E6YA 1NHUA 1OSCA 3AA9A 1HI1A 2XGQA 1UP1A 1EARA 1KSPA 4CH1A 1F5BA 4X64J 2XY5A 2BJDA 1C0TA 3ZTRA 4DN9A 2GVDA 1IR2A 1QSYA 2KM8C 1AZSA 2CPDA 2HBRB 5B0GA 3EGZA 4NLQA 3GU0A 3WBZA 2ZBPA 1KEKA 2IMWP 3HD2A 1NK9A 1WNEA 4BWJA 2YTCA 2MQOA 2J6SA 4HI2A 2DR7A 2JFKA 4NLPA 4I0WA 2CQ3A 1NPKA 1FRJA 5K20B 4LFBF 1Q53A 2HG4A 1HNXF 3NNHA 2KZZA 3TNVA 4ZPTR 3HX9A 3FMWA 4O3QA 1XQIA 3JSBA 5K8MA 2VQFF 2DNQA 5GVQA 1HMVB 1GX6A 2DCLA 3NCRA 2QA2A 2RVJA 1WC5A 2XMAA 2NXCA 2KDOA 3PRBA 4RUAA 2XI2A 1PJ5A 1EQMA 2H4YB 2KJWA 2Q66A 2FTRA 1CQMA 1DQAA 2E1AA 2L08A 1NJWA 1PBAA 1QTNB 4DV7J 1FWPA 2E5LF 5E3CA 3MXHP 3CC7S 1QSLA 1EX8A 5EGYA 3C6TB 2KTQA 2P9CA 4XK8C 2Q43A 3M8QB 3PYDA 3BF4A 1UJ6A 1OY9A 2VU5A 1ZS6A 2AGQA 1UJ5A 1NJXA 4IOBA 2F1FA 4KO0B 2W2MP 2B4OA 1RAHB 1V3SA 1JWWA 4UW2A 2LDIA 4QWDA 2V8VA 3GIKA 1RT5A 4P2XA 4K2XA 2CJ9A 2NSCA 1Q8KA 3LAMA 3VVUA 1J5OA 2DISA 5LMUF 1BQXA 3IAS9 4WXOA 3MOZA 5D4LA 3H40A 2R8JA 2ZHBA 1WD6A 1QE1B 1V3ZA 2OELA 5ETTA 4FS2A 1Q8LA 1G1XA 1IKYA 3H5UA 1DQ8A 2M8DB 3CVKA 3M6VA 5FD1A 3I82A 3I0SA 2JC1A 2C2RA 3QNWB 3VALA 4WP8A 4ECVA 4KBIA 2Y1RI 5BJRA 2WTFA 1CLFA 4QJVA 5DLFA 3ZZYA 1V9OA 1JLAB 1MWYA 2XNQA 1KRPA 4Q0BA 3EPGA 2DYAA 1RWKB 4O0NA 4H4KC 5A8KB 4WFNQ 4J9OA 3R7NB 3OVAA 1T95A 1URRA 4DR6F 2H5IB 1RCOB 3GG1A 2VG7A 3NGRA 3K8WA 1GX5A 4C98A 3LF0A 3TVYA 1H3DA 2LXUA 3AD8C 5D4NA 1M5OC 2QFIA 5D4PA 3Q8VA 3W8GA 2XSJA 1RHKB 4IOCQ 1NK7A 4DLEA 1TL7A 1YJTA 3D4JA 3DHWC 5BXIA 1KQSR 1TKZB 2K1RA 2XMUA 1U1RA 2UUBJ 2G0CA 1TKZA 2K1RB 1M5KC 4IH5A 3ZZOA 1IBLF 1TFWA 4DR7F 3FBEA 1JLFA 1FESA 2IJFA 3M6XA 3MTJA 2CPHA 4A8OA 5B08A 2D3O1 4FDFA 1UVKA 3AQOA 4YEAA 4ED4A 4F3QA 2AF6A 2ZJRQ 2WBRA
chains in the Genus database with same CATH topology
4R0JA 1VI7A 1YJRA 3I31A 2EKYA 4MYUA 4Q45A 1U1OA 4I68A 2KJVA 5DGBA 4K4UA 1EETB 2JL9A 3FEYB 4B9UA 2R7OA 3LW5C 1C0UB 1ZM2A 1CQNA 2BJEA 2HQIA 4TLRA 3V6HA 1S97A 2EK1A 2GJIA 3VAHA 1NB7A 5IXUA 1C1BB 1M5PC 4BS2A 1P8GA 3BR8A 5D3GA 3LP2A 1DFDA 2B9WA 5KG6A 1UA1A 4O4RA 5F3ZA 3PX0A 2M9KA 2QV6A 2RF2B 4MTPA 1HWJA 2HVZA 3HVAA 2B5JA 4IH6A 1R0AB 1F5AA 5A8WA 3TA2A 4NYZA 4CIOA 2EI5A 5EN1A 2OLWA 5IQ6A 4B3MF 4USJC 3FQLA 3CCMS 2DO0A 2QA1A 1SIZA 7FDRA 2VASA 1ZM9A 2CFXA 3M6UA 4ES2A 2XS2A 1ULRA 2FLNA 2RNEA 4Q43A 4QW9A 5DRKA 4OX9F 1YRUA 2YNIB 4DG1A 1QAYA 1ZTTA 4A8WA 1TVRA 3CD7A 3KG4A 1PC4A 2Q1LA 1LWEA 4RUHA 3N0VA 3F73A 2R8GA 3BGLA 2J0QD 1Q16B 2EK6A 5JUMA 1DRZA 2D1CA 2DR9A 1YTYA 2C3MA 5I3UA 5KFNA 1X4FA 5C42A 2HFOA 4D3HA 5T14A 4ECRA 3AQPA 2MZQA 3P49B 1R31A 4R8UA 3ZZPA 4Y6IA 3RR8A 4NLTA 3CD0A 3D2WA 4YR0A 4KO0A 1GXUA 1WF2A 3LUYA 2ZD1A 4WKYA 3QGGA 3QPIA 3NWGA 2UXDF 2UVRA 2NUHA 2YQ3A 2K8GA 3DOKB 2ZDOA 2AU0A 3OTEA 1QAXA 3DHXA 2A3JA 4WFBQ 2RRAA 4F4ZA 3NL0A 4DMZA 1P1TA 4QZVB 2RE1A 4ZP7A 4P7TA 1TV6A 4RW8B 1LWEB 2MZRA 2RKIB 2V4QA 4DV0F 1LKZA 4HEA9 5A6WA 4MKYA 4Y0FA 1X8DA 2W9BA 4V19X 2Z8QA 4WF9Q 2W9BB 1RTJA 1IQZA 5EWGA 2BOPA 3G6XA 5CYJA 2JDJA 3KK2A 3SI8A 5J2QA 2GMJA 4TU7A 2ZH6A 2XY7A 2DTJA 3CJKB 1G6BA 4O44B 4ETZA 3BM7A 3UCGA 3CMES 1LXJA 1UFLA 1T03A 1RKJA 4X84A 3DRSB 1N5YA 3OFHA 1LWFB 3MZIA 3T9NA 1JJ4A 1IUJA 3UCUP 2JEIA 3QJJA 3CIZA 2DPJA 1B0VA 2W4PA 3PW4A 3LWLA 1RT3B 3KJVA 2CQGA 4WK1A 2MKKA 2B43A 2F3JA 4EUVA 3B82A 3M2RB 1VQLS 3HHDA 2RH3A 3CCLS 1QVGR 2XWXA 3THVA 1QM9A 1S6PB 3BO3A 2XG8A 5E3PA 4D3GA 2AJQA 1FTRA 1BLUA 3OVBA 1C1BA 4HTIA 4XPEA 3I55S 2J9DE 4ITSA 2O66A 3QAEA 1D9FA 4B3RF 2B9XA 3PDNA 4HVZA 2AX1A 2BR0A 1MU2A 2GHPA 4IR9A 3KK3A 3FRZA 4GKJF 1GT8A 3THPA 4QW8A 1R8AA 4DWIA 2V0NA 1R8BA 3MI7X 2K2PA 3GV8B 4WYWA 3CCVS 5EHHA 1VQKS 5K14A 1TL1A 2XY6A 2XMWA 5LJ5Y 4YQWA 2DNMA 2CQ0A 2WB4A 2GO8A 4QQBA 4OZ0A 2KT3A 5IZHA 2A2DA 2HHQA 1AW0A 2OPPA 1VQ4S 2VC1A 1O8BA 3TAPA 1JJHA 5KT3A 4PR6A 4RKUC 1K1SA 3NP5A 3MMBB 4M5DB 5IWAF 3JSMB 5KFQA 4PWUA 3MPVA 4IQMA 3VZIA 1TAQA 2QA4S 4OZLA 2N7CA 1TK8A 1HD1A 2YX7A 5T7LB 3NAHA 2L41A 1YVFA 3QWPA 1Z1ZA 4PKDB 3V4MA 2KM8B 5D4OA 2E9TA 1JLGB 4KKOA 2C3YA 2ZZMA 4X66F 1RT2A 1UKUA 3DLKA 1VRTB 2YH1A 3MM9A 3LGMA 2JX2A 2V2KA 3N6MA 3O1LA 3X3UA 4ZCIA 3TW0A 2HHPA 1RTIB 4JV1A 3PV8A 2E1RA 5C42B 3BSCA 5LL6d 1KQFB 4N56A 5KT6A 3M2UB 5B0AA 3RRKA 2B6AB 3MD3A 3MWBA 2ZH1A 4EZ6A 1WI8A 4JI1F 3P6YC 4J5OA 4DR5F 1SL1A 1UVIA 5LT5A 4RWWA 1RDRA 2JHEA 4QIGA 3I5CA 2LVWA 4YR2A 1VQ7S 1WTBA 4CQ1A 3SSRA 2LA4A 4I2PB 1HBNA 4ZPDA 4KV8A 1FJ7A 1OQ6A 3TR5A 4J9KA 4CO2A 4ILLA 2ZITA 1L5UA 1I1GA 1CSJA 3DMJB 3H4BA 1NK6A 2VONA 4DL7A 1ZM4A 4RW7A 4PPZA 4K4VA 3G9CA 4ZPVR 4PG4A 5A8RB 1QSSA 2NZ4A 2CPXA 2XSFA 2WK4A 3BEGB 4RW6B 2YNHA 1NK0A 3M8QA 4Y2KA 3G6VA 5D77A 4I4BA 3WC0A 1HBOA 5IM0B 2JH3A 4C3MA 4NLWA 4ZK7M 2ZM6F 3MDFA 2XO7A 4ECZA 2PEHA 4NLXA 4A46A 3RAQA 4GMKA 2M5YA 2UV8A 1PILA 3O2IA 5DG8A 1ZH5A 1W2BR 3R5DA 1SJRA 1FNMA 3S8SA 1VK8A 2HFZA 1X4BA 1XR6A 3G8QA 3CJ0A 5MAOA 2ZZNA 4DV2F 4B9VA 4LUBA 1B7FA 1D8YA 1LWCA 3VF0B 2CQDA 2JC0A 4QPTA 2HFNA 2BANA 4FXVA 2CKWA 4NX9A 4K4XA 1U48A 1EETA 4ECXA 2ZFHA 4QOTA 2CIMA 2R7RA 2CQHA 4DFMA 5LSLA 2OTJS 1YGYA 1G7CB 1RA7A 4YB7A 2HW3A 5DQIA 2RQKA 2K7JA 2ZC3A 4TU8A 2JLEA 3JSRA 3M8PA 4IRCA 1RWUA 3HF5A 4H4OA 3HFKA 4I56A 4KR0B 5EGYA 5JXSA 1T02A 2FLLA 1FCAA 4NWBA 2RIJA 3J80Y 3ZC4A 4J9SA 1N6QB 1XK8A 2DGUA 4X4TA 5CHCB 1LQ9A 4OHVA 3UE2A 1DJ0A 4XO0A 2Y0SD 3PXGa 1FXDA 3DNCA 5DO2A 4HL9A 2WONA 3ONQA 1JLQB 2JVRA 3K0JA 3A8EA 2JWNA 4ED2A 4G3IA 4QWBA 5IS2A 3EX7B 3UDLA 1LFWA 1FT8A 2X1FA 2BABA 3HPOA 2VOPA 4DS4A 1B64A 2CPYA 2QT7A 4U7CA 3PM9A 3ZFVA 2GO9A 2YWGA 2OJ3A 1NZAA 4Y2MA 3CCTA 2DGSA 4NMLA 4RNNA 4IH7A 1TKTB 3DRPA 3HMJG 3R1LA 2DGXA 4MAKA 3POTB 2BUNA 3U27A 1AFJA 5E2QA 2PFFB 3MMCA 1VJWA 2UUTA 2VPZB 4C8MA 3IA0A 3H5YA 2NXUA 3CCJS 4UOCA 1KNZA 5B0EA 5F3TA 1PO6A 4HLBA 4WFYA 4AE5A 2VZ9A 2GW8A 1S99A 3K7RA 4FXWA 5DETA 1I6JA 5KG7A 2I8EA 2XLIA 1XBWA 2ZH4A 2L9NA 3HVRA 1OPIA 1FRKA 3ZZRA 3PX4A 5F8MA 5DDRC 4C8LA 1DURA 3CUNA 1S1VA 2LQ5A 4UUXA 5F0UA 3CJ4A 1WF0A 4HT7A 3K58A 1DARA 2RILA 3TUJC 1DBDA 5KFYA 3JTPA 4X4OA 1VBYA 4KC5A 2MPUA 3S1TA 4NYOA 1FNXH 1SB6A 3UQSA 2E7XA 4WE1A 4WCEQ 1MMDA 2OPRA 3I6PA 3CD5A 3M2UA 4ED1A 1KTQA 2CZVC 1XC9A 1U49A 4XAKA 4CO4A 3G8SA 3CJ5A 4PG8A 2FY1A 2KZMA 1WEXA 5I3UB 3OLAA 1F0XA 2MJUA 2V94A 5IFMA 3FFIA 3S7RA 4OQJA 2APOA 3MUMP 4LSNA 4J37A 4LSNB 2F8HA 2OMLA 2RT3A 1NAQA 4ES3A 2QLWA 1HNVB 3SYZA 1RT1A 1H7XA 4NCAA 2J6UA 4A47A 5KFOA 4AL6A 1X7VA 2B4VA 3BQ0A 2RQMA 1N54B 2Q3PA 2UZAA 5EDWA 2B9YA 4IDKB 5KFLA 2LXIA 1ROFA 2J5AA 3W2VB 3PIPQ 4FF2A 2HWIA 4IDKA 3W2VA 1QUPA 1VQOS 3FCHA 2V5HG 5GAEU 5KFVA 3BQ2A 3W3SA 2DGWA