2LYVA

Solution structure of the two rrm domains of hnrnp a1 (up1) using segmental isotope labeling
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
GSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the two RNA recognition motifs of hnRNP A1 using segmental isotope labeling: how the relative orientation between RRMs influences the nucleic acid binding topology.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing, transport protein
molecule keywords Heterogeneous nuclear ribonucleoprotein A1
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA02
3JB9k 1S79A 4PR6A 4WFBQ 2CPDA 3P6YC 2DISA 2KXHA 2DNHA 3MUTP 1Q81T 2LEBA 1UFWA 2DGQA 3CC7S 3CCVS 2HYIB 1YWXA 1OIAA 3MDFA 4WIIA 1XN9A 4WCEQ 1PO6A 2MY7A 1YHQS 1CVJA 2XB2D 2CPXA 2DNLA 2XSFA 4Y00A 1U1QA 2KN4A 1YITS 1IQTA 2LA4A 2M8DB 1VQ6S 1X4CA 5IFMA 3MD1A 3H2VE 2DNYA 3ULHA 2FC8A 1U1NA 1U1MA 1X5OA 4OZ1A 3S7RA 2MKSA 2QA4S 5HL7Q 3BO3A 3J7YU 4QQBA 3CCLS 5D77A 1VQPS 4FXVA 2E5IA 1OWXA 1QM9A 2CQDA 1L3KA 3UE2A 3HI9A 3NS6A 2X1GA 2KVIA 1BY9A 3OW2R 1VBYA 1FXLA 2MZQA 5LJ3Y 2DNZA 2KRRA 5CXTA 2MKJA 2DNOA 1DRZA 2LECA 1M5PC 5DDRC 1OPIA 1Q82T 2DNGA 1P1TA 2G4BA 2OSRA 1FHTA 1SJ4P 4U67Q 1JJ4A 2DHXA 4QU6A 1JMTA 3CCES 3PIPQ 2E44A 2HZCA 2RT3A 2DH8A 3CTRA 2MZRA 1NO8A 1WF1A 3MUMP 2JVRA 1NJIT 2CQ1A 1N52B 2RQCA 3S01A 2FHOB 1WHVA 1FJ7A 3FEYB 4CH0S 3BEGB 3G8TA 3MI7X 2DNMA 2G1DA 1X5TA 2CPEA 2I38A 1KQSR 1YJWS 4C4WA 1WHXA 5CA5A 1ZH5A 3TYTA 1HA1A 2HGMA 3CC2S 2CQ2A 2KG0A 1WWHA 2MQLA 2SXLA 4P6QA 1M1KT 3U1MA 2KT5A 5CYJA 2UP1A 4WKRA 1SJFA 2G0CA 5DETA 3VAHA 2ERRA 4CQ1A 1KOOA 5BJRA 1WG1A 1R8PA 2MJUA 3TO8A 1H2TZ 4W90B 1U2FA 3RW7A 3VF0B 4BS2A 1X4FA 2DK2A 2DO4A 5ITHA 2MQOA 4EGLA 2YKAA 2O3DA 3G6ES 3UCZP 2J8AA 2MKCA 2CPYA 3CPWR 4YB1P 5LXRA 2MSSA 2F3JA 2KM8C 1A9NB 2X1BA 1VBXA 1VQKS 1FNXH 2M9KA 2MQQA 2L9WA 2M4MA 2CQIA 3THPA 2M0GB 2M2BA 2HVZA 4IOAQ 2LQ5A 3PIOQ 3B4MA 3CCMS 1U1PA 2GO9A 1URNA 3EGZA 1KC8T 3MOJB 2JVOA 2KRBA 2ADCA 2VONA 1AUDA 2ZJQQ 4ZKAA 2BZ2A 4IO9Q 1K9MT 3MXHP 2KI2A 1KOHA 2AYEA 1VQ8S 2OSQA 1UAWA 4LMZA 1WEYA 3SXLA 3UD4P 5IQQA 5DDQC 3NNCA 3I56S 2DGUA 2RRBA 2DITA 2D3OR 1RK8A 3IWNC 2MY8A 2YH0A 3CCUS 2EVZA 4UQTA 1ZZNA 2KYXA 1K73T 2DNRA 3ZZZA 1WEZA 5GADU 1JJHA 2AYGA 2XNRA 1H2VZ 4F26A 5DDOC 2NLWA 3UCGA 2CPJA 4WFAQ 3P3DA 4TLQA 2B0GA 2KXFA 3US5A 1WTBA 3IRWP 3MD3A 2LCWA 1D8ZA 2XS2A 1SJ3P 5DM7Q 1VC6A 2FC9A 3VAKA 4FXWA 4TU8A 2MXYA 5D78A 2J0QD 1WEXA 1UW4A 5EN1A 2RU3A 2PE8A 3K0JA 3S8SA 2CPZA 2MQMA 1M5OC 1QVGR 2MZTA 2FY1A 2WBRA 2PEHA 1YJ9S 3R27A 1W2BR 2DNKA 2YWKA 5LSLA 2OTLS 3LQVA 1O0PA 2RS8A 2NZ4A 2CQHA 3B4DA 3VAIA 2LYVA 4C7QA 1WHYA 1X4EA 3CULA 1M5VC 1NU4A 3S6EA 2DHSA 4RU2A 3RW6A 1X4HA 2K3KA 3R1HA 5LJ5Y 1Q86T 1X5PA 2MGZB 2EK6A 2MZSA 4A8XA 3CCQS 2MMYA 2CQBA 2CQPA 2LKZA 4QPTA 2LA6A 2DHAA 2DGWA 1QVFR 3EGNA 2XNQA 5LXYA 1FJCA 5GVQA 3G8SA 2DO0A 4C0OC 2LMIA 2DNNA 3L3CA 1SJRA 2KFYA 1VQ7S 2I2YA 4YOEA 1DBDA 2DNQA 2RUGA 3VAJA 1G2EA 2XS7A 3Q2TC 1WELA 3V4MA 1WG4A 3J7ZT 2DIUA 1WG5A 2CQCA 2DH7A 3FEXB 4Z2XA 2KU7A 2YTCA 1U1LA 2J0SD 2KM8B 3CMAS 2N82B 1PGZA 2CQGA 2MKHA 4ERDA 1U1RA 2L41A 2X1AA 2CPFA 3VAGA 4J5OA 4LIRA 4IUFA 2DGXA 3NS5A 1YI2S 3CD6S 1A7GE 1FO1A 2E5HA 4TU9A 2N7CA 5JVHQ 1JJ2R 2CQ0A 2MJNA 2HGLA 3CCRS 1B7FA 2F9DA 1N8RT 1DZ5A 1U6FA 4YUDA 3NNHA 2QEXS 1S72S 3UCUP 2U1AA 2LXUA 4QU7A 1SXLA 1U1KA 5GMKa 2CQ3A 4V19X 1OO0B 1P27B 4M5DB 2GHPA 2MHNA 3THTA 5IM0B 1HD0A 3MURP 1X4AA 4ED5A 3LPYA 4WFNQ 2N3OA 3G9CA 1H2UX 2CPIA 3EX7B 1HL6A 1YTYA 2MPUA 2ADBA 2A3JA 2HGNA 3CMES 3UWTA 1VQ5S 3CUNA 1HD1A 3HHNB 2D9PA 3UD3P 2Q79A 1FJEB 3BS9A 1WI6A 2U2FA 2JWNA 1Q7YT 2MZJA 5MLCV 2E5GA 3ZZYA 4LJMA 5JVGQ 4TU7A 1DHMA 2RRAA 2MQNA 2RVJA 1VC5A 2DH9A 2AD9A 2M52A 2AYBA 1ZZFA 2FPHX 4OZ0A 2MKIA 1WI8A 3H2UB 3N9UC 2KH9A 2AYMA 3SMZA 3CF5Q 2VOOA 1X4BA 4IOCQ 2DHGA 2MSTA 2EK1A 2MYFA 3P5TL 5HO4A 1VQLS 2DIVA 2MZ1A 1YIJS 2BOPA 2K8GA 2OTJS 3CCJS 3DXBA 1M5KC 1D9AA 1M90T 3SDEA 4CIOA 2N3LA 2DB1A 1U1OA 2M70A 2V94A 3SDEB 3U1LA 1R8HA 3D2WA 5DDPC 3VAMA 2X1FA 3R1LA 4W92B 5DM6Q 4UY8T 3G71S 3CCSS 2D9OA 4F25A 3BO2A 5GAGU 1VBZA 3CC4S 5GAEU 3NMRA 4CH1A 2DGSA 2YH1A 1K8AT 2M7SA 2RNEA 2RS2A 3MUVP 3CXCR 3VALA 2J76E 1VQ9S 3BO4A 1VQMS 2MKKA 2DGTA 4F02A 1VQNS 5H1SV 2OIHA 2M8HA 2KHCA 2KXNB 1YJNS 2MB0B 2ZJRQ 1RKJA 2LXIA 2E5JA 2ZJPQ 1N54B 1U6BA 2VODA 4WF9Q 3VAFA 2RQ4A 3P49B 2VOPA 1UP1A 2QFJA 3DLLQ 4PKDB 2M88A 2JRSA 4Y0FA 2KG1A 5IM0A 3G4SS 2DNPA 1KD1T 2CQ4A 1H6KX 1VQ4S 2LEAA 2DGOA 1F9FA 1WHWA 2F9JA 1VQOS 2CJKA 4PRFA 1X4DA 1N88A 2CPHA 2XS5A 1VC0A 1SJQA 1X4GA 1X5SA 2MGZA 3Q2SC 3I55S 2JX2A 3TP2A 1WF2A 1WF0A 5GAHU 2MQPA 5FJ4A 1FT8A 2L08A 3NNAA 2DGVA 3G96A 2OJ3A 5LSOA 1X0FA
chains in the Genus database with same CATH superfamily
3BGOP 4UOHA 2NREA 4IDKA 4WK1A 4ZCIA 3M8ZA 4Y2CA 1QUPA 1CJTA 2DNHA 1LXNA 2UUAF 2R2RA 3DGVA 1KLMA 4HHHA 4ELUA 1ZAWA 1UFWA 4DUYJ 4Q8FA 2HWTA 5J1EB 2QFIA 4IOBA 3DDNA 1FESA 3SBMA 3MR5A 1TKTB 1YWXA 4PG4A 2HYIB 4C3KA 4WIIA 4AE5A 2CZVC 2W2OP 4OI2A 1PO6A 1PYOB 2EFQA 1DQ9A 2COLA 1NHVA 4NLRA 1L5UA 2GVZB 4P10A 3EM1A 3Q22A 2QA1A 4O23A 1O6XA 1J2VA 1GK8A 4ZS6A 5A76A 4R5PA 4ECTA 2BYCA 1T9YA 1V3RA 5KFIA 4Z7CA 3M8YA 2GW8A 4ES1A 3C6UB 1NJZA 4IQXA 1UL3A 2H5EA 3KWMA 4OZNA 2UUTA 2XYHB 4DV7J 2M8DB 4BWMA 5D4NA 3IGNA 3M8PB 4KIAA 4CT8A 1D8YA 4TQRA 1ITPA 2J9EA 2OLWA 3HSDA 4U9RA 4HT7A 4I2QB 1KQKA 1PYTA 1WOOA 3C8YA 3MMJA 4G6VB 2Z57B 4UF4A 1FVSA 4XAKA 1E6VB 3BKFA 2XMMA 2QA4S 4ECRA 1VRTB 1S1XA 3ELHA 5HP1B 3IO1A 4OIXA 5KOXA 2ZZNA 2LXFA 4QQBA 2B5JA 4GO7X 4QR1A 5D77A 3ZZTA 3CCLS 1U24A 1H0HB 2HHHJ 1IVZA 2LU2A 1OWXA 4FKYA 1QM9A 3DRPB 1L3KA 3I0SB 4ETZA 4GVBB 2NR0A 2HFNA 2HHWA 1C1CA 1BY9A 3KHHA 1JLBA 1RHMB 4H4MB 1R0AB 2FJVA 4P7TA 5E3CA 3SFGA 1VBYA 2PMZD 3NL0A 2JLFA 2MZQA 5LJ3Y 1F5CA 4FS2A 3CW2C 2B9WA 2DNZA 2KRRA 4ZJOA 1L3VA 4DLEA 3GG1A 2HKEA 1HPZB 3A8EA 4CCHA 1EJ7L 2GS8A 5DDRC 1Q82T 1MU2B 4TXSA 1MROA 4M5LA 3GQCA 2YKMB 3C14A 2CG4A 4FF4A 3V81A 2G4BA 1PJ5A 4DBQA 6AT1B 3KHRA 1U49A 1FHTA 3A8KA 4OYZA 4U67Q 3DI6A 2DBBA 4IFVA 3H40A 4QU6A 1S1UB 1JLAB 2XS2A 2YKNA 4JI6J 3QSIA 3IS9B 3I32A 4PQUB 1VOMA 2XLKA 1J5EJ 2VG5A 1VI7A 1RUSA 3W66A 2KVQE 1QAJA 2ZZTA 3CDAA 3CCZA 4A8OA 5M2UA 3NRBA 2J5AA 4YHHJ 2G1HA 1WF1A 4FP9A 3BR9A 3PACA 4YR0A 2RQMA 2VUGA 1WKKA 4P74A 1Y00A 2VG7A 2XO6A 1RAAB 2F8HA 4NRTA 2RQCA 2FHOB 1XNQF 5C42A 2P6TA 3FEYB 1QD1A 3HHEA 3LWLA 2R8JA 2AKWB 3BEGB 3LW5C 1FJ7A 2IYIA 1NDLA 4P2FA 4YDDB 2AGPA 1XMQJ 3HMJG 2DNMA 3WBZA 1F5BA 4X84A 1LWXA 4JI4J 1QAYA 1YJWS 1E6VA 2GVZA 3R5DA 3JQKA 4YP3A 3I5BA 2F4VJ 3E2EA 1DARA 3CO9A 2VG7B 1HA1A 1UEKA 2HGMA 2V5HG 3T19A 2R9LA 2GMJA 1D1UA 2W7AA 1U26A 4GKJF 1WWHA 4O3OA 1D3WA 1JWWA 3KJNB 2HBQB 1WTFA 2KT5A 5KG0A 5C2CA 2IDEA 3DDKA 4DS5A 3TVZA 4JV1A 5AJ3F 3UO0A 5ADZA 5F8MA 4ID5A 5B08A 2P9CA 1KOOA 2MQ8A 2QYCA 5IV3A 1UZDA 3R2CJ 1TKXA 3VGTA 2VZ9A 4DV2J 4M94A 1Y5LB 2A6MA 3M8WA 1NCLA 2KZZA 4RW9B 1KHWA 4ECVA 1MROB 1YQHA 2N4DA 3GYXB 1SV5B 1RYRA 1FRMA 2BVZA 4MK8A 4A8SA 1NBEB 4LSLA 2D69A 1FX4A 3VF0B 3UN2A 5HMWA 4UT4A 3GLJA 1CQNA 2DK2A 2FIUA 3QO9A 3BPSP 2HFUA 2MQOA 4IYQA 3TA1A 2PD1A 3CF5Q 2C2DA 4P75A 3PZPA 4ALZA 1UW9A 2O3DA 4LR9A 3C46A 4DV2F 4USMA 3MAAB 4WU2A 2HHUA 2J8AA 3CJQA 4P2XA 2Z2YB 4X4PA 4OLOA 3CPWR 1SIWB 5J2NB 5LXRA 1WUUA 3N0VA 3T6BA 2KM8C 2PN6A 1A9NB 4WE1B 1KTVA 1WORA 2CKWA 2KB2A 4HVZA 3UFCX 4B3SJ 3FMBA 2JOQA 2WSFC 4FXDA 1HWKA 2WCXA 4DDFA 4HH0A 5J2PB 3THPA 3GV8B 3N28A 2DR8A 2VFTA 1H7WA 3DI6B 1TUWA 5LMNJ 1RHUB 2V8HA 5E33A 3CJSA 2OELA 4LQ9A 4I69A 2VIHA 2WW8A 3PFEA 2D41A 1U1PA 2HAFA 1SKRA 4K4TA 1URNA 4ICLA 2PMHA 2V4JB 4WFXA 4B9UA 3MM8A 4MAKA 4QR0A 4PYAA 3W2VB 5B0CA 4N47A 4E0DA 3MXHP 5GAHI 1KOHA 1JKHA 1YBAA 1LOUA 1ACMB 3IG1B 4JI3J 3SXLA 2NXJA 2UXBF 4LR7A 4ZP8A 4KPYA 4FPRA 2YPZA 3F56A 1FXRA 2VH7A 1PYSB 2ATCB 2D3OR 4Q0BA 2CJBA 2CNKB 2MY8A 3RG6A 3CCUS 1BQMA 2DT9A 1HBMA 2HSEB 5KFVA 3CVKA 1EQ0A 2V2ZA 4DUZF 1HWIA 4M5GA 1EAYC 3CCTA 2XY7A 1XIQA 1YX2A 4K5RA 2ZHAA 4BC7A 3NCQA 4DV6J 1WC5A 4O44A 1RYSA 3GE9A 4RW7A 3N6NA 3R5GA 3AQOA 4KKOA 3KLFA 2XNRA 2F4VF 2BACA 2ZE2A 3QT5A 2Z30B 3QLHA 4F26A 1UWBB 1BQXA 2NLWA 4TYAA 4FVCA 5DDOC 2IVMA 4N56A 1N33F 1H72C 2HURA 4DX7A 2ZEJA 3EXYA 4GC7A 3TQ1A 3G82A 2AIRB 1LWCB 2XMKA 3EGVA 5A8WA 1KRPA 2GJIA 2HS0A 2RF2A 4RW8B 3DLGA 3RR8A 1C1BB 3MD3A 3IRWP 5JMNA 1HNXJ 1NSPA 5DM7Q 3OL9A 2KT3A 1Y3JA 4OYMA 3KXDA 3SQGB 1VC6A 4LF1A 2FLNA 2HHQA 4CLSA 2Q66A 4C8KA 2MXYA 1RB0A 1FFSB 2HZAA 2WB4A 4L72B 5D78A 5HROA 1RTZA 1UW4A 2UV8G 2V8GA 5GMDA 2C3UA 3W8PA 4ZPBA 5EN1A 3JQMA 2HLUA 5E41A 1R0CB 5G0RB 2V68A 3AD8C 3HHLC 3ZZRA 1QVGR 3SIPB 1SUQB 3V4IB 2N4CA 2Q43A 3ISNC 1RT5B 3Q8PB 3BN7A 5LSLA 2Y3YA 4LF5F 1ZETA 4DSEA 3MMCA 1UVJA 1VS3A 1XERA 2QIFA 3M2RB 2NZ4A 5K14A 4ILLA 4KGVB 2MLXA 4OV1A 2OMLA 1FDBA 1S0NA 4CLZA 5K8OA 1RWNB 1X4EA 2RB7A 5I3PA 3TJAA 3HHDA 1AYEA 1CG2A 3S6EA 4F36A 2RJZA 4HI1A 3ZC4A 4ELVA 3L95X 5ETVA 1X4HA 4RL1A 2K3KA 3T1YF 1IKXA 1EHWA 4EO6A 5KFWA 3BV8A 1RE1B 2WVCA 2R7RA 2I5JB 1X5PA 1FNOA 1JLGA 3PW7A 3X1LB 2A1BA 3CWJA 1U2CA 4A8XA 4UZBA 2PMWA 2VPYB 3CCQS 1LW0A 4I7FA 3DRRB 4N5SA 2CQPA 3OUYB 3R6LB 1RT1B 4ZIVA 2DHAA 2E5LJ 2V34A 3BSCA 4GC6A 4X4VA 2GIRA 4NX9A 5DG7A 1MN9A 1T95A 2ZD1B 4DV4F 5GVQA 4OJ1A 3DRYA 3QZ7A 2C42A 1LXJA 3AD9C 1FKOB 3D0GE 4N76A 3EVMA 2DO0A 3WX8A 3T1YJ 2LMIA 3CIZA 1FKAF 1YG0A 3D3CJ 4ID8A 5E3QA 3W5ZA 3L3CA 1HQEB 1XWLA 1EIYB 5DG9A 1SJRA 2GJ2A 2KFYA 3SSRA 2ZD1A 2I2YA 1EP4B 1QUVA 2BABA 1S48A 4JP8A 3MPYA 2HQFA 3VAJA 1GMVA 2BMBA 3AOCA 2XS7A 3H59A 2BJDA 2HQCA 1VJQA 1TUGB 3GR1A 1S4FA 2ZBCA 4R8UB 5KOWA 4YR3A 2PA8D 4CLFA 3J7ZT 4LF9J 2CQCA 5B0BA 2RF2B 4RW8A 5AE3A 1SL2A 1BLUA 5KFEA 1JLFA 2AW0A 3D1QA 3OXGA 4ZIWA 1XMOJ 2GIQA 3HX9A 5HVGA 3G6XA 1U1LA 4LFAF 2XMJA 3BF4A 2J0SD 1JLCA 2P5VA 4BHQA 1U1RA 5KFUA 4R25A 5BYQA 4YB6A 1LWEB 4NLTA 1TQLA 2HBZB 4CO1A 3GILA 1MWYA 1U8WA 2B6AA 1V5IB 1C2PA 3HT0A 2C3MA 5HBMA 3U1NA 3JSYA 3HVAA 2W7PA 2OD6A 3NOGA 4YY3F 2Y0SD 5A2QU 3EZOA 3NS5A 3O2IA 1K47A 4LFAJ 2C2MB 3O6QA 3WC2A 3MM5B 3CD6S 3KHLA 4JV5J 1Y7PA 2AZ3A 4C8MA 4OHYA 1ZPWX 1GTHA 2ASYA 2V8VA 1A6LA 2FLLA 2N7CA 4OI0A 1F3FA 4ZPWR 2Z8QA 2EW9A 3HPOA 3T5HA 1JJ2R 4GVLA 5LT5A 1X7VA 2CQ0A 4USWA 1N8RT 2J0XA 5F8HA 2V6AA 1RT6B 5CZXA 1U7LA 4YUDA 4NZ7A 2V8DA 3LPEA 3SYZA 5ETNA 4UUXA 2ZM6F 3DOMA 3LP1A 3PM9A 2W25A 2J8SA 3B82A 2AQ4A 2VG6B 1GXLA 3QGGA 4NZ6A 3UI3A 5CCLA 2VJVA 1P27B 2GHPA 1EP4A 2YKMA 3C14B 3W5YA 2ZH2A 1U45A 3DHWC 1S1TB 2DY1A 4CNZA 4ZVOB 1KFSA 2R3VA 1VRQC 2H65B 5A8RA 4NWBA 2F8MA 1SBRA 3AJ1A 3B78A 1IR0A 3SFUA 3WDOA 4WFNQ 5L1KA 1LWFA 4EZ9A 1H2UX 4F0MA 3G9CA 1YJTA 1YTYA 2MPUA 2OP5A 3HSGA 4WFYA 2HGNA 4CLWA 3BYRA 1N4LA 3C66A 3CMES 1FWLA 2C2NA 2P9GA 1VQ5S 4CLUA 4JI7J 5KFFA 4MKAA 1TV6B 2ZVIA 1JIHA 2CVEA 3LH2S 3QIDA 1SH3A 2V67A 5KFNA 1KVJA 3IBWA 2HQIA 2VDHA 5IWAJ 4ZP9A 5D4OA 3TJ8A 4DL0C 4EZ6A 4HTJA 2W9CB 1TMJA 1IWGA 3AY0A 3D1HA 5CHCB 3Q8SB 1N5YA 2E5GA 4PPZA 5KG6A 3ZZYA 4A8YA 1DHMA 2J9DA 3EJMA 5CAAA 3MFHA 2O01C 2ZITA 1Z2ZA 3RJMB 4ER8A 4Z7YA 4WFZA 3MWBA 4OI4A 2IY5B 5CYQA 1IR1A 1C4CA 2Y9HA 1ZZFA 4Y2AA 1Q8IA 2H3EB 3OTEA 2CDRB 4HL9A 2MKIA 1WI8A 5ETOA 1VBKA 1HBNB 1HMVB 1FRHA 2VV5A 3IGVA 3M2UA 1LKZA 3KJQB 4RUHA 2ZNZA 4X4TA 3OVBA 2AYMA 1VDHA 4DZDA 3QSYB 1SC1B 3BBBA 4IH7A 3BQ2A 2J6SA 5KT3A 2V4RA 5A0YB 1U09A 4E98A 3O44A 2ZH6A 2B56A 1RWXB 4PG7A 5HO4A 2DR7A 3O5TB 2XMTA 1S0MA 2IBKA 3D3BJ 2W9AA 3QBCA 4DV0F 2DPIA 1M5KC 4YR2A 1U8SA 4DV5F 1RJJA 3DRPA 2ZH8A 4CIOA 3RUBL 1LW2A 2N3LA 2E9TA 1U1OA 3M1VB 2BRKA 3T9NA 2LP4A 1H98A 2V94A 2R8GA 5HN0A 1CJUA 1HBOA 3EVWA 3G82B 2VASA 3R97A 1QLNA 3E3XA 4L3KA 3GV7B 4O3SA 4RU9A 1Z4UA 1ZOTA 3VAMA 4HYKA 3U02A 1LWEA 2HNDA 1PSDA 2HFOA 4J9QA 4DG1B 3PCOB 3F44A 1EB0A 4DL3A 2HRTA 2YWGA 3E8OA 5D0EA 1FNMA 5B0EA 1H7XA 5J2QA 2AJFE 5K8PA 4UY85 1C0TB 1R27B 4LVOP 4XIUA 3FQLA 2HNYA 1JLAA 2RS2A 3DOKA 1T9VA 4ZITA 3MUVP 4Q7AA 2R2SA 1RWWB 4GKKJ 3D0HE 4JI4F 1WC6A 3E01A 3UDCA 2DGTA 2ACYA 5IC6B 2OD4A 2BW2A 1VCTA 2CRLA 1N5YB 4LBHA 1VIXA 4DR1F 1IBMF 2W2QP 2H51B 1BHNA 1S1WB 3BGRA 2NXNA 2ZOFA 2MB0B 1S9GB 2GO8A 2YNFB 2VG5B 1RKJA 2J7WA 2E5JA 3PX4A 1SC6A 1FWKA 3KHGA 1UJ5A 2BR0A 1EETA 1U6BA 3NBPA 4LRAA 2HVIA 2RQ4A 3RZAA 1G7CB 1LW0B 1W26A 2A0FB 1S9FA 3DLLQ 1U6ZA 3V81B 4CM2A 3R5AA 1NB7A 3DCAA 4PG6A 2AU0A 2KG1A 1IKYB 3FCHA 4PQUA 1RSCA 2YBVA 3FJ2A 8RUCA 5ETMA 4ZLPA 4U7UD 4IKAA 3QYYA 4F3QA 1H6KX 1UPMB 3QGHA 4IH6A 3TA2A 2HZVA 2F9JA 2CJKA 1UFKA 3AXKA 4K8RA 3OTOF 4RNFA 5C24A 5I4MA 2OUGA 3SCJE 3W61A 5CCMA 1X4GA 2HVDA 2FQQB 4QR2A 3AT1B 2MGZA 4ECWA 4QWEA 4B3SF 4JI1F 5KFZA 3TUJC 4ES3A 1WF2A 1WF0A 4KR0B 4NXMJ 2XZTB 4OI1A 2DXFA 4X62J 4PCQA 3AA9A 3KK1B 2PSZA 1VQSA 3PW2A 3J7AN 1BWVA 1FEEA 3NEKA 3X3UA 4ECQA 4Z37A 1D09B 4J9KA 2MEWA 2L08A 1C0UA 4F0HA 1PILA 4Q2LA 2IAJA 4LFCJ 4WWSA 4PUOB 4P2SA 3JB9k 4GVBA 4WFBQ 3MM7A 3EDRB 2CPDA 2BDPA 1XNQJ 3P6YC 1FD2A 2KXHA 3CO0P 1TKTA 3HZGA 4ZCKA 2GA7A 1R8BA 4NXMF 5BR8J 2CZ9A 2PC6A 2V2KA 2LEBA 4NMXA 5HK4A 4Y3CA 1PJ7A 3BKTA 3MMBA 4LRDA 2CXEA 5HP1A 4DWIA 3BBFA 4QW9A 2D7SA 3FUYA 4ILRA 3GZ7A 4MJKA 4WZQA 5I3UB 1X31C 5D3GA 3M7VA 1OIAA 2GHWA 3MDFA 4RKUC 1XN9A 5CD4A 4USUA 4ZVTB 3NWRA 2ZH9A 5KFXA 1YHQS 2ZBRA 5EWEA 4DSJA 4ECUA 3DYAB 1CVJA 3A4TA 2EEYA 3BZQA 4H4KC 2HHSA 2Z58B 2C1EB 2XSFA 1WKJA 3NGTA 3MMBB 1S5ZA 5ETRA 2KN4A 3GYNA 1U4BA 1IQTA 1S9EA 1LW2B 2Y8WA 1VQ6S 4LQ3A 4LBIA 4Q8EA 2WVDA 5FIIA 1X4CA 3W2WA 3MD1A 3H2VE 1MW7A 5IFMA 5DLGA 3ULHA 3BQ1A 1U1MA 4L6V3 1KTQA 4RX6A 4F2RA 2ZWPA 1WACA 3M05A 3KUHA 4QZVB 3AB2B 4LF4F 4NCBA 4LRBA 3QGIA 4MTPA 3KLEB 4EMDA 5H9FJ 3JAMU 1UA1A 1NXIA 2V4JA 1XBWA 1TR0A 3DXSX 2CQDA 1FF2A 3HCXA 3UE2A 2QMXA 2FJAB 3AOBA 2PI5A 4G1IA 4IR1A 2UZAA 2NQPA 1AT1B 4ZLJA 4M5MA 3MMAA 4FYVB 1FXLA 1RWMB 3LP2B 2OHDA 3MR2A 1HBUA 5CXTA 1GH8A 2LQJA 1EZZB 1FRLA 2LECA 4WP8A 2D74B 3LP2A 3JXOA 3AH6A 1WOPA 1FXDA 1UJ4A 4TY8A 4PAAA 5DJBA 1PKUA 4Q43A 2OSRA 4LF8F 1D9DA 1Q4RA 3KJFB 1TMMA 2GIFA 2QSFA 4JI7F 4RNNA 1JJ4A 2DHXA 1CC8A 2ZC3A 1JMTA 3CCES 1DTTA 2KJVA 2E44A 2KT2A 4YEAA 5DZ7A 1NZ8A 4C97A 2HZCA 2PA3A 1XTZA 5LL6d 4O4GB 5LSRA 1YJRA 1NPKA 3NCRA 1G1XA 1RGVA 2WOMA 2W2MP 2J9CA 1S97A 2B4UA 2MZRA 5EWGA 4UZCA 3LP0A 3UDEA 1CJVA 2OPQB 3KDOA 2JVRA 4MFBA 1O51A 3DRSA 3PXGa 3DYAA 4DX6A 3FGVA 1M1GA 3WIVA 4LT6A 3OFFA 1IKWA 2C3OA 2L48A 4KRWA 1VHFA 3K57A 5G4DA 3TA0A 4JBCA 3ISND 2ACMA 3GMGA 4O0NA 2FLPA 4YHHF 3C6UA 1UVLA 3C2PA 1SUQA 2I38A 3GV5B 1KQSR 3ZXWA 3SSQA 3D6HB 4WZMA 3H2LA 1RHJB 3K5LA 3QLHB 4J9RA 3RRKA 3PEHA 3PG9A 5KG4A 4ZA1A 1TELA 4J9LA 2NS1B 4DXLA 4ECSA 2CQ2A 2KG0A 4FKXA 2MQLA 1HBOB 4ZCMA 2JL9A 4ECYA 4DR1J 3FBEA 1S6OA 1V3ZA 2DEJA 4NEZA 2O1PA 1GXUA 2IJFA 4LRCA 1XC9A 3KMQA 1SJFA 4WXOA 1H74A 5CYMA 2G0CA 4ED4A 3OT9A 5DETA 3GSIA 2P9EA 3P45B 4CM0A 4CQ1A 3PR5B 4X64J 2RMLA 2Y1JA 1X9SA 2CJXB 3U7JA 1R8PA 4ED0A 4CWBA 4AQYJ 1Q78A 2MJUA 4KH0B 4OX7A 5EHHA 2IRUA 2YQ3A 2FD2A 4FN5A 3BQ0A 3KK3A 2BJ3A 2V8PA 3Q0AA 1R6VA 4NLOA 4F3OA 4ANEA 1U2FA 2ROPA 3RW7A 2HHHF 3FMWA 3CJ2A 4QWCA 2IA6A 3EE3A 1KLNA 4CDIA 4F2SA 2DCUB 4J9OA 4DR2J 1RHKB 1I51B 3UNYA 3UCZP 2E7WA 1W2IA 2L9NA 3NBPB 4QIVA 3VTIA 3UPFA 1JLEA 4YB1P 3K58A 3BDPA 4KHPJ 1WOSA 1OQ6A 1ZPVA 4HACA 4PXEA 3PX6A 4GO5X 2M4MA 3TAQA 1IXKA 2NZCA 2M0GB 4USHA 2HVZA 1NK9A 5D0RA 1UJ6A 2VL1A 3OFEA 2NYIA 4KHPF 2GQQA 4XDCA 4D3GA 3CCMS 4IFYB 4RUBA 2ALZA 4LF6J 2GO9A 3LA0A 4XO0A 4J9PA 4RBVA 1KC8T 4B3TF 2KRBA 3EGZA 2HW3A 1AUDA 4IRKA 2ZJQQ 2Y8YA 3K89A 2B9EA 1HBUB 1S1TA 3FVYA 4UOCA 4YN3B 3QJPA 2QG9B 4DSLA 3PHTA 1KVKA 1WSVA 3GJRB 2OSQA 4FPIA 4TKTA 1N0VC 1WEYA 3MCMA 3NOCA 4OHWA 1SL1A 1RU2A 2WHOA 2ZNYA 5K5MA 5DDQC 3JSRA 1B4SA 5K14B 4ZOSA 3I56S 3NNCA 3O3LA 2RRBA 3N01A 2DITA 1RK8A 2IM3A 1DJ0A 4WK3A 3FDSA 1K73T 5C25B 1NUEA 1V6HA 2DNRA 3EZUA 4Y2IA 5KFSA 3M6XA 5KG5A 5T14A 3W60A 4N7TA 1RTHA 3K5PA 4ZK7M 3GIKA 2XWYA 4IG0B 2ROEA 4CO5A 1F1BB 2BV3A 4QPXA 3QAUA 3LWMA 3KLVA 1BC6A 4DPWA 4I2PA 3C6TB 2QL7B 4ZN1A 2FHJA 3PYEA 3MPVA 3UCGA 3T41A 1FTCA 4I2PB 4RBUA 3DN9A 4YMEA 2QN6B 1Y3KA 2O5DA 4LREA 4WFAQ 3TI0A 2UUCF 3US5A 2KXFA 1WTBA 2JLGA 5ETSA 3NLCA 5U47A 2BANB 2ZUGA 1TVRA 1KQFB 3VGSA 5EGYA 3TJ9A 1SJ3P 2FC9A 3K59A 2BJEA 1IR2A 4TU8A 3VAKA 2RRNA 4K4XA 3A8IA 5E0OA 3PX0A 3MR3A 2FVSA 4V19J 2HK3A 1RCOB 2MQMA 3PV8A 1XJWB 4PXDA 1AB8A 2WBRA 2HQGA 3LGMA 1I1GA 1Q8KA 1XR5A 4OYPA 1B0PA 2BJ9A 2DNKA 3M1VA 2YWKA 2JFDA 3QT7A 4WIQA 1S99A 5HATA 1DQAA 2I8EA 2RS8A 3M2VB 3IWLA 1IJFB 2FJBB 1UZHA 2CQHA 3NP5A 1R31A 3Q89A 5D6GA 3A12A 3HP6A 3BSOA 4PZVA 2GC8A 4OYBA 3J7A1 1RAIB 3DM2A 4FNIA 1MU2A 2LYVA 3CULA 4OYXA 4QIFA 2FJXA 2IM2A 2V2VA 3DLJA 1NU4A 1UTAA 1ZM9A 4R0JA 3JSMB 1RT7A 4IQMA 2DXDA 1HQUA 3R1HA 1KQGB 2J0WA 4U8YA 5LJ5Y 3FZBA 1Q86T 2MGZB 2MZSA 2HS4A 1UETA 1R0AA 2YXLA 4OI3A 2HFSA 5C24B 1HNWJ 2OKQA 2CQBA 2LKZA 3J81j 4I6YA 2LA6A 4K59A 4L75A 4LVNP 3KLGA 2W4DA 1IBKJ 1FJCA 4QOTA 1ZS6A 3ENAA 4I67A 2ALYB 4KB7A 3SEOA 1DFDA 3BJYA 1NJXA 2NSBA 4JI1J 4JI8J 4BLGA 5KFLA 3AD7C 4K5SA 4RNOA 3KFWX 1XMBA 4LF9F 2JFKA 1BD6A 4BCAA 2W9CA 1FJGJ 3QJJA 1GFWB 1R8AA 2XG8A 4N8OA 4PXBA 3G6VA 2OEMA 4DLGA 4DR6F 2DNQA 2RUGA 5E3PA 4JI5J 1V3SA 1IKVA 4K50A 3FFIA 1TL7B 4LFCF 3D6MB 1WG4A 5L1LA 2QRRA 4JV0A 2NUUG 4DV1F 4MYUA 5HQ8A 3M8PA 5KFGA 2BANA 1ZTTA 2DIUA 3HT3A 2IHR1 4HTIA 3UDVA 4CYUA 1J5EF 4H54A 5B0GA 1U25A 4LSLB 4RPFA 3G6YA 3ONQA 1NEEA 3EXCX 2KU7A 2BRLA 2ABYA 3ILOA 3B54A 4NMLA 3T6JA 4USKA 2AJ4A 4R5PB 9ATCB 4TLRA 3S1TA 3PYGA 4U8VA 2GQCA 3V6KA 1FRKA 2LLZA 2IYGA 1NDPA 2MKHA 3Q23A 1S10A 1FRJA 3GTYX 2QMUB 3MCOA 3OVAA 2L41A 4C9DA 4I2QA 3TR5A 3T5LA 2CPFA 2YKOA 4I4BA 3QGPA 2BJ1A 4J5OA 3UW1A 4X64F 3V6HA 4KGZB 3DOMB 3LP1B 1G6BA 3DKDA 2H4WB 3DLGB 4WP3A 2GQ2A 1A7GE 4OHVA 2DYAA 5L46A 1WDDA 3WIUA 1WNEA 2CJ9A 4ZVEA 3ISZA 2ZM6J 1HLWA 4DR5J 1N36J 1HI0P 3K8WA 4N41A 3UNGC 3POTA 2C28A 2HBRB 1VMBA 3QFWA 5IS2A 1ZA2B 2XSJA 2MJNA 4YY3J 3CCRS 4DR3F 1AROP 2JNJA 2K06A 2MDAA 4FBTA 5T7LA 1U6FA 2YPYA 4OX6A 5J1EA 2XLIA 1QTNB 3MM5A 3NS7B 1FCAA 5AXNA 2QEXS 2E9ZA 3UCUP 8ATCB 1FERA 2K2PA 3QZ8A 2VPWB 2KHDA 2M3DA 3CD7A 2IVYA 3G86A 4KFBB 1SXLA 2F5GA 3H98A 4HHJA 4ETXA 5GMKa 1U1KA 4NLGA 4ANCA 2ZH4A 2ZOMA 1KSPA 1TL1A 2R8KA 5A0YA 2V9WA 4DSIA 1RT1A 1Y4ZB 1J27A 1F9EB 2MHNA 1TAQA 4RW6A 3D6TB 1FKPB 1HD0A 5L38A 2F63A 3IBFB 1FKOA 3LO3A 5IWAF 5F3ZA 2LDIA 1ULRA 3FCWA 4B3RJ 3JTOA 5THWA 4MKBA 3BGFA 4IFVB 1P6TA 2QLJB 4DR4F 2HG4A 4M63A 2VG6A 1CC7A 3HULA 5DG8A 3VR1A 4I6AA 1ELOA 3FBFA 4JUZA 1XNRF 4XPCA 1RT2B 4B08A 2B7BB 1JLQB 4X4UA 2AZ1A 4MK7A 3UD3P 2HMIB 1MLAA 3HLUA 2FLOA 2U2FA 2AJQA 4CRJA 3DC2A 1Q7YT 1KWMA 2MZJA 2QA4G 3OFHA 3TAMA 3I4PA 4S0MA 3V2UC 4TU7A 2CFXA 4DV6F 4H4MA 5HVFA 3O1LA 4QIWD 3KJVB 4KHRA 2P2CB 2JJ4D 3TZXA 4HHUA 2M52A 2AYBA 4K2JA 3DOLB 4IG3B 3MPUB 4NA3A 3I82A 4PWDB 1OYEA 1DTQA 3MR7A 4X62F 1ZM4A 2VKRA 3JSBA 2KH9A 1SV5A 3IR7B 1XMOF 2H54B 2VOOA 3GG0A 3UVJB 3AQPA 1CQMA 2DHGA 4RW9A 3I6PA 1QAIA 4DN0A 2KFZA 4LSNB 1K0TA 4F50A 4OZJA 3KG0A 2JH3A 3SQGA 1FK9B 3D6FB 3ZNJ1 1S6QB 3MEDB 4ZLLA 3TUZC 3FSIA 3D4JA 3OBIA 1DLOB 2DB1A 4NI2B 2ZDOA 5F41A 2G2YA 1SQEA 4DU8A 4F67A 3GWCA 1R8HA 2K1RB 6FD1A 4DCPB 3MAHA 3TZZA 5K8MA 2FB0A 4DR7J 3HJVA 3H4BA 4LF5J 4CLTA 3SSSA 3SCIE 1QSYA 4ANDA 1ZYQA 1RTIA 2F4FA 4X65F 2D9OA 3PTWA 3IM9A 3QMQA 4DPUA 5GAGU 1VBZA 2NXCA 3UDLA 1BXNA 3NMRA 2DGSA 2K3IA 3M8RA 1TL4A 2RU9A 2HWHA 2YNIA 3MEGB 1S1VB 1RWUA 4R0EA 2YH1A 3CDEA 1RT3B 1VK3A 1DTTB 1HHQA 4KYZA 4NEYA 3UN3A 3OV7A 2R7WA 5HLFB 1F60B 2DRDA 3VALA 2V0NA 3HHKA 2MKKA 4X65J 3Q8UA 4LSZB 3KK2B 4I7FB 4EEYA 3SQOP 4ZLNA 3JYTB 4OHXA 1HHSA 3DHXA 3OR1A 2BM0A 5H1SV 3HM9A 5B7WA 1CJVB 2AV5A 2EG2A 2OPQA 3DU6A 5A6WA 4ED2A 2FHMA 2RDIA 4LF4J 5FDLB 3N5BA 4AL5A 4JI8F 4G1QB 5SUHA 3IS9A 3FQKA 3R9LA 2WVBA 2IJNA 2VBZA 1UEVA 5DQHA 2ZJPQ 1N54B 2D1CA 4KO0B 4C0HA 3KDNA 4C48A 4DCJB 3QT6A 3PW4A 3P49B 1YVFA 3PR4A 1C0UB 2OEJA 3RBXA 1UP1A 3UQSA 5KT2A 4C2MA 2QFJA 3I87A 3D67A 3MTKA 5C7PA 4CT9A 3H42A 4Q44A 4O4GA 1S9GA 2LU1A 3DMJB 3HFZB 4RW6B 1N6QB 2F65A 3ZTOA 2OPPB 1Y11A 2A6OA 1KD1T 1QTMA 1HNWF 3EYZA 3IC1A 2GZOA 4YB5A 2W24A 3PJWA 1R7IA 4AT1B 4K4SA 1WHWA 2Y1IA 3T5KA 4L73A 4PRFA 1X4DA 4ZHRA 3Q8VA 1TKXB 1N88A 4D3HA 4RZRA 2XS5A 2B7CB 2QT7A 3MPWA 1SJQA 1X5SA 2F8EX 1JB0C 1Y10A 3OJSA 2YNHA 3Q83A 4IO1A 3ILIA 5A6PA 1B7YB 5J1NA 1F9HA 3CDWA 4YFUA 1BGXT 5BR8F 1T94A 2EXUA 2OMOA 1YK9A 3IR5B 5GAHU 5J2MA 5FJ4A 1FT8A 3OD2A 5FD1A 1RCXB 5F0UA 5DS7A 4X66J 5F8GA 2YX4A 5IT9U 4X4SA 1JX4A 4X4NA 1T9UA 2FY8A 4PXCA 2XQCA 3G96A 5LSOA 1X0FA 2B9XA 2OJ3A 1S79A 2LQ8A 3H4DA 1XR7A 3ILJA 3GIMA 2DISA 3Q8RB 5I3UA 5D3GB 2BM1A 2QLBB 3AJ2A 4J37A 5IXUA 2GMHA 3MCNA 3MUTP 1PAUB 1Q81T 5IQ6A 4NA1A 4KAIA 1IUJA 1OPZA 4FF3A 2IRYA 1BQNA 1VLOA 3R7NB 2FDNA 3MEEB 4NCGB 1IBCB 2RHSB 3OL7A 3CCVS 3CC7S 1CS4B 4K4ZA 3C19A 4AD6A 1Q5VA 1SPBP 2IIHA 4HT5A 2C2EA 3AA8A 4WCEQ 2QGFB 2YY3A 3L4BC 4G1PA 4QYRA 1G4CA 5K8NA 5MAOA 3O8WA 4I64A 3WZ0A 4HLBA 1X8DA 3RTVA 3OTBA 5H9EK 2XB2D 3H5UA 3EWGA 3QT8A 3LGNA 4TY9A 1YBUA 1ZAVA 4Y00A 4USJC 3T1HJ 3MECA 1Q5YA 4B9TA 3HKWA 4OZ2A 4HDHA 3TEGA 3ENWA 3JS9A 4OYOA 5HQLA 3LOUA 2HAIA 2VPZB 4A8MP 2VU5A 5FLXU 2LFVA 1RTDB 5HJXA 1TFWA 2OAUA 2DNYA 2YKNB 3BH6B 4F3MA 4QWDA 3BN4A 4DR5F 3BSNA 1HI8A 5D0GA 2QYGA 5KFDA 3UN5A 3S7RA 2OH2A 2JEJA 2MKSA 3IRXA 5HL7Q 3T1HF 5KFPA 3J7YU 4TNOA 1NK6A 2VQFJ 4RLEA 3MEKA 4U6PA 1Q1KA 4KGKA 4FXVA 1CBKA 4QYZK 1S1UA 2VFRA 2OGUA 3D28A 4ES2A 2UU9F 4UW2A 3H8YA 2BEFA 3B8HA 5C42B 5F8NA 2XI2A 5HJYA 4MIAA 3RRHA 2KVIA 4LFBF 3HZEA 2BJ7A 4MK9A 2KFNA 1V9OA 4DQPA 4WPAA 1CULB 4E8UA 4ZVSB 1JXVA 2ZOGA 3ETMA 3ZTQA 4JI6F 2ZZMA 1FA0A 2MKJA 1DRZA 3QPIA 1APSA 1K1QA 1CULA 4KBIA 1JLQA 3GONA 1T9TA 4XPEA 2UUBJ 1I94F 1VRTA 2CJAA 1SC3B 1TL3A 1FDAA 2DNGA 4PWWA 1RTJA 1F0XA 3N79A 4RNHA 5KFTA 3E01B 4C3LA 3J80U 3KLGB 4DSFA 4I56A 5J1PA 5KG7A 4DJBA 2IC3B 1Y5IB 2J6TA 4UUWA 7AT1B 1TL5A 1QAXA 3RYLA 2BA9A 1M5HA 1KKHA 2RT3A 5DO2A 5B0AA 1FTRA 2DH8A 2IM1A 2O66A 3CTRA 5F8LA 5J2QB 3JSMA 7FD1A 1VR6A 2D3ZA 4M5DA 1NO8A 2AX1A 1NRKA 2HFVA 1RAEB 3IAS9 4CO2A 3DLEA 1NJIT 1RAHB 2H1YA 3FZ2A 4PABA 2Y1LB 1N5QA 1N0UA 1U0HB 2BKNA 3DLHA 1HNIA 4L74A 5GAGI 3PKMA 3S01A 1Q53A 2BBEA 4CH0S 5D4PA 4KFBA 1ZM3A 4X4OA 2DHHA 3G8TA 5L9XA 2AP6A 4DV3F 2WW4A 4NL5A 3HSJA 2AEMA 5AT1B 3G8QA 1U47A 2E1CA 4QW8A 4JI2J 1NNDA 1X5TA 2CA9A 5EX3A 2CPEA 2Z56B 1C0TA 1UKUA 3I5AA 1IBLF 1S49A 1WHXA 3IRXB 1MNEA 2WVFA 7FDRA 2GVDB 1CJTB 4NLSA 5JJBA 3OHBA 2EPIA 3SV4A 3WC0A 3PYFA 1U2RA 4G65A 5CA5A 1VK8A 1Z1ZA 4DV0J 2XY6A 4KE5A 1NPPA 3W5XA 4QBUA 4X2BA 3CC2S 2FJWA 1KONA 3BPDA 2K1RA 2SXLA 3M9OB 5DLFA 3BKUA 1FDNA 1WDTA 2BKOA 4Y6IA 4NLYA 4A47A 1TAUA 3MECB 2N7YA 1T05A 3OSNA 3VQTA 3QJLA 2GJFA 1R6YA 4TVAB 3AFGA 3MF5A 2W8KA 2ERRA 4F4WA 4HEA9 4DZ6A 3AHPA 4ZJQA 5BJRA 4I6WA 1WG1A 3OJUA 2Y1RI 2RUSA 2FTRA 2QV6A 4GMKA 3TO8A 2HHVA 1MWZA 1SKWA 4TQSA 1GX5A 3AOAA 4WBFA 1H2TZ 2HWIA 1E6YA 1CLFA 4W90B 1GMUA 2UUWA 4BS2A 4PWDA 5KFAA 4IFYA 3HHLD 2OFGX 3DOLA 3PYDA 2BQRA 2LDYA 3D1OA 4EGLA 2YKAA 5HANA 3UR0A 8AT1B 4B3OA 2NUHA 2XM3A 3JTNA 1VJWA 3G6ES 4HH1A 2JHEA 1WC1A 2OPPA 1PJ6A 2FZGB 1GT8A 3RGIA 3I0SA 3VZHA 2F3JA 3CD0A 4YS2A 3MZIA 1HBNA 1HMVA 2X1BA 2QLXA 5LM7E 3H5YA 1VBXA 2GAHC 1VQKS 2L9WA 2CQIA 3Q24A 3FRYA 2VBYA 2YNHB 2BX6A 4BWJA 5CYQB 4EBEA 1T9WA 1UPPA 3P8BB 2XMAA 4OI6A 2B4VA 3KUEA 2LQ5A 2XHWA 4A8WA 1HR0J 2DRBA 4IOAQ 4RW4A 1AXQA 2W1BA 4JV2A 2OPSA 3PIOQ 3B4MA 3EVOA 4DV4J 2AGQA 4KQZA 4A48A 4K4WA 1GEHA 1RZMA 2LQBA 2Z2ZA 4B9NA 1N32F 2ZH3A 4OX9F 4RR5A 5ETPA 3PKYA 1HYSB 3CIMA 3QRRA 4OFZA 4ZKAA 1GQEA 1T02A 2BZ2A 2XYPB 3GFHA 3OL6A 4DUZJ 2KI2A 4P2MA 5RUBA 1REVB 1HARA 2YWWA 3M30B 4DUYF 1T8EA 1RAGB 1JLBB 1QDUB 1MMNA 5L1JA 2HBYB 4JI5F 1S6PB 1NM2A 4MMOA 5IQQA 3WHIA 5BXIA 5KFCA 3PO4A 5HLFA 2AHOB 2DGUA 2VA3A 2XI3A 3IWNC 2HNYB 1UVNA 4DFKA 1ZZNA 2KYXA 3EGWB 3PEJA 3VCDA 2B5JB 4URQU 1IJEB 5B09A 1NJYA 2DXEA 1S1XB 5GADU 1RWPB 4A8FA 3IBCB 5HBMB 1OY8A 3OR1B 2B4OA 4URSA 4AFFA 4F0KA 4UOGA 3W9HA 4DG1A 1H2VZ 3DFEA 4ZJLA 4YQWA 1L3UA 1TFYA 5F8JA 2VDIA 4ED7A 3AAWB 3T3FA 3FSXA 3M2RA 5ETLA 2BE2A 2ZUAA 1VHIA 3AB4B 3OTCA 3KOAA 4YDXA 4EWTA 2DPJA 1S1VA 2HS3A 2H9ZA 3H90A 4TLQA 2B0GA 3H7HB 4DX8H 4EI2A 2HPUA 4QJVA 4LFBJ 1F3VA 2YX7A 1IWAA 5CZVA 1D8ZA 1MG7A 3NXZA 2R7SA 1BQMB 4M5KA 4FXWA 2XY5A 1RTIB 1OS5A 3IMQJ 4Q0BB 1N33J 1HQ2A 3RB3A 2E29A 1WEXA 2CJYB 3K0JA 3QRPA 2RD5C 2VC1A 3NGDA 2CPZA 1M5OC 3L09A 1YJUA 2E7XA 1JKHB 2XMWA 1CEZA 3JAMY 3M2UB 1YJ9S 2XLJA 3OL8A 1RISA 5M2RA 3CJRA 3QWPA 4B9SA 5E2QA 3TX0A 1PC5A 1O0PA 1O5JA 2CG8A 4Y2MA 1VQYA 3W65A 1TP7A 1I94J 3VAIA 3KLFB 5C5JA 3HD2A 4C7QA 1T11A 1BUXA 1WHYA 1YZ6A 2AWZA 2X3GA 2ASJA 2VHGA 4B3MF 1OSCA 2VQFF 2DHSA 4OJHA 1FVQA 2BXJA 2HMIA 2G2OA 3BR8A 4K4VA 5KG2A 1N56A 1OSDA 1WC4A 2X7IA 2W9BA 1VYAA 2XO7A 3E51A 2E66A 2H4YB 2AGOA 2EK6A 1AW0A 4DX5A 4DPOA 4ZPCA 2RIJA 1N5TA 3PRVA 4EBDA 2B8PA 5E5NA 2XCAA 2WZ1A 3ZFVA 5DQGA 3W3SA 1FRXA 1KBRA 2IBOA 3CMQA 3QNWB 5LXYA 2XGQA 2EI5A 1X9MA 5IV4A 2ZKUA 3ZZ0A 3KLHB 3G2XA 4FVMA 3G8SA 1N6QA 1S7IA 3ILLA 5F9LA 2W01A 4C0OC 2DNNA 4FNHA 1JXEA 1VQ7S 1U0SA 4BC9A 2DJWA 2XHCA 1DBDA 3V6DA 3OHAA 2UXBJ 1IBKF 4A8QA 4DQIA 1UVMA 4KO0A 1WELA 2NCKL 2OFHX 5K9FA 4ID5B 2I5JA 3GFZA 2ASDA 3MAQA 2QLWA 5DQIA 3Q8QB 1FD8A 5CH7B 3FEXB 1MN7A 2B51A 2B8QA 1NK4A 4P72A 1HWJA 2ZC4A 4Z2XA 3P5BP 3WQPA 1MMDA 1SB6A 1FI4A 2YTCA 2YVSA 3KK3B 4QYZJ 1FKPA 3D66A 2KM8B 1CPZA 2N82B 2CWKA 1XQIA 4KPCA 2CQGA 2V63A 4LF2A 4KJIA 1NH8A 2C2KB 1Q8BA 2WSCC 3OLAA 4RWXA 2ILZA 4DMZA 2D3UA 1WC3A 2WVEA 3LANA 2P8IA 1S0OA 1SI9A 1TTHB 4O4RA 3HKZD 4DV3J 1AFJA 3W9IA 3FBCA 2R7VA 4PYDA 4ZVRB 2UVRA 3BGUA 4MYTA 5EUHA 3OSPA 4NYPA 2CZ4A 3OXLA 5G0RA 3AJDA 2YWFA 2R2UA 1IBLJ 1HNVB 4CTAB 1NB2A 2E5HA 5HQMA 4P7VA 3VV2B 5LMUJ 4NXNF 1TZ0A 3B6BA 4DCOB 3TAPA 1FE4A 2ZVSA 5F3TA 5JVHQ 2KJWA 3RB0A 1N34F 3PJ9A 3H5SA 3HHLA 3K5NA 3IG1A 1C1BA 3L7OA 1B7FA 2HGLA 4DQRA 2Z0GA 5I42B 4QIGA 2RDDA 3MM8B 4NRUA 3R7SB 3NNHA 5AE1A 2UVWA 3DRXA 1S72S 3I9V9 5EDWA 4QU7A 3MM9B 3LUYA 2R7OA 4FYWB 2DCLA 5KFRA 2XGPA 1O8BA 1QY7A 3R7BB 2VQEF 4EK2A 3MFIA 2A18A 2IRXA 1S6UA 2HHXA 4RUAA 3A8JA 4HR2A 5IC4B 2MHEA 3V6DB 4DN9A 4WKYA 4F4XA 3THTA 1T03B 4OZLA 2GHVC 2AF6A 4E2FB 2ZWOA 2WOMB 4QCLA 3BREA 3ZTRA 3ZTSA 3MM6B 2V50A 1VLYA 2AT1B 3W62A 2N3OA 1FFGB 5KFYA 3EX7B 4ZPDA 4K4UA 2BW7A 1HL6A 2FUG9 3I5CA 4N77A 1HYSA 2A3JA 1OY6A 2R4FA 2F40A 4H4OB 1F2GA 4XDDA 3UWTA 4Q5VA 1HNZJ 4RW4B 5E3RA 3L9ZA 4DL2A 1J5OA 3F41A 3HHNB 1FX2A 1XEZA 3TAMB 2GV1A 1HD1A 2HRUA 2D9PA 3R5BA 2D3O1 1KP6A 1SC4B 2Q79A 1HI1A 1WI6A 4PEOA 4KC5A 3GB0A 3GFXA 2C22A 5MLCV 3RAMA 1UEUA 4DR6J 2LVWA 3MOZA 4KT0C 1SCJB 5JVGQ 4DR4J 2IC3A 3TUIC 3MMAB 2ZKTA 1OMSA 2RRAA 2MQNA 2RVJA 3PY8A 3DOKB 4WP9A 2AD9A 3DU5A 4PG5A 5HVHA 3K17A 1RBAA 3LGHA 4NE9C 4C0BA 2FPHX 4C8OA 4OZ0A 3HXMA 4C6AA 3NGKA 2I9SA 3H2UB 4ITSA 3CB4A 4NCAA 2GCFA 2CWXA 4WTOB 4FF1A 1T9XA 1PCAA 1R0BG 1SVDA 3NY0A 4L3NA 3SMZA 1E6YB 4F7VA 1YJ7A 4WYLA 2W8LA 1SJ1A 3MAAA 4IOCQ 2VPXB 2UXDJ 4Q45A 2CJQA 4F4YA 1SH0A 2V9KA 3CJKB 3M8QB 2DIVA 1AA1B 4RUCA 2MZ1A 2K8GA 4LF7F 4NLVA 3TQEA 3CCJS 2OTJS 4KH1B 3M2VA 1G3OA 1RACB 3I0RB 2B3TB 3OTDA 5L9NA 2UUAJ 1T3OA 4CTAA 2CYYA 4LR8A 4MIBA 5D4LA 2Q3PA 4ZPTR 2JDJA 3HJFA 3A1YG 3U1LA 1KLMB 4MIWA 3RRGA 4NYOA 2KTQA 3D2WA 2UVUA 5DDPC 2BE2B 1HIYA 2IM0A 3D68A 1SKUB 2PO4A 3M8QA 1S4EA 4AYBD 3JQJA 3LALA 2NPFA 4DF4A 4W92B 1RT4A 1RP5A 2UXCF 4NA2A 3FKBA 4OQJA 3CCSS 2BQ3A 3VGUA 1AZSA 3BO2A 3R8YA 3W9JA 3CC4S 3K5MA 1NSKL 4LBPA 3TVYA 4ATNA 5HSPA 5H9EJ 2NYHA 1VISA 2LEPA 3C15A 1K8AT 2M7SA 4DR7F 5KG3A 3ADAC 2HFZA 4NLXA 5D8HB 1KN6A 2GAGC 1A0OB 3FRZA 3QIPA 3F73A 2HNZB 2J76E 3LAKA 4KHMA 1NPRA 5CQGA 5E3AA 4UQGA 4DL6A 1RA6A 2GVDA 2CDQA 4OMFG 1LK7A 2MKYA 1C4AA 1YRTA 3M30A 4OJGA 1NAQA 1P9YA 5KFBA 2GFFA 1KFDA 2I0XA 4MH8A 2XC9A 1KS2A 3K2YA 4ZVHA 4ILMA 1K0VA 4U7CA 4ZMMA 2IMWP 5D0HA 1HW9A 2ZJRQ 1SIZA 5E7OB 2CADA 2HHTA 2YWHA 1GNKA 4DPYA 4ZVPB 2FZKB 2QO3A 2W7OA 3BM7A 2O67A 3VAFA 1WJ9A 3ITHA 2VOPA 4K0KF 2NPIA 4JV5F 2IVFB 1TL3B 2YNGB 2QL5B 4I68A 4DPXA 3PW0A 2R7UA 4DHVA 4EO8A 4OX9J 1S12A 1WSRA 4CLKA 2YKPA 3ZZOA 5JUMA 4Y0FA 2BUNA 1T03A 2V4QA 3G87A 5A2QY 1YDLA 3G4SS 2IFXA 4CLYA 2DNPA 2GX8A 1LFWA 2LEAA 2DGOA 1F9FA 1JNRB 1RTJB 1VQOS 1OY9A 2XWXA 5DGAA 2CPHA 3TW0A 5C2GA 3M32B 4DF8A 3MMCB 1TVRB 3Q2SC 4NASA 2JX2A 2BJ8A 5CYMB 2VFSA 2YNFA 4KGMA 3W1YC 2ZH7A 2Q1LA 2VICA 1H73A 3DMJA 1TK8A 1VRUB 1WKLA 2G0IA 3HVWA 3OFGA 2MQPA 2EFNA 3TARA 4EU0A 3KLIA 2XZDB 2F1FA 1YSJA 3DDIA 3QATA 4OV6A 3OTOJ 5H9FK 1L3SA 5LMUF 4USTA 5HROB 2DGVA 4NXNJ 1D9FA 1QSLA 4GRSA 1HKAA 4AXIA 1RWOB 4PR6A 4LF6F 1Q16B 1CS4A 4F8RA 1S59A 4URGA 3I31A 5L39A 2ATLA 3IN5A 2QC3A 4A4JA 1KHVA 4HI2A 3DLKB 1N5VA 3C16A 2DGQA 1RT6A 1QSSA 4C11B 2E9RX 3KK2A 2XYGB 1M1HA 3LTOA 4B9LA 1RDRA 2J6UA 4MT1A 3A3PB 2ASLA 2AJ2A 2MY7A 2KKHA 2UXCJ 1UCNA 4QWAA 1IQZA 1BMQB 2PGCA 2C2OB 3ZTPA 4C11A 4O44B 2CPXA 2HEKA 2XCPA 2YNIB 2DNLA 3MEGA 3IM8A 4ZDNA 4KV8A 2GGPA 2AJ0A 1U1QA 1NH7A 1EKRA 1YITS 2LA4A 3PRBA 3RR7A 3KNGA 3FC9A 2ZDPA 2I1RA 5AJ3J 2IMOA 4R8UA 3GPAA 1OJ4A 5CABA 2UU9J 3NG8A 4GKKF 2QMWA 3DRSB 4O3RA 2FYXA 2FVCA 3HVRA 2FC8A 1U0HA 4TYBA 4WXWA 3EPGA 3PJXA 1U1NA 1D0EA 1H3DA 1X5OA 4DQSA 2JSXA 2BKPA 4OZ1A 2EFGA 2BOAA 1YLXA 3BO3A 2K7JA 1CJKB 4B3MJ 3IXQA 4RO0A 1VQPS 1M5SA 2ILYA 1W25A 3HVTA 3HSZA 4CO0A 3CJ3A 4KGXB 2E5IA 1B0TA 3RBEA 3HI9A 5KFJA 3GFYA 3NS6A 5AXKA 2JEGA 2WSEC 2X1GA 3AXMA 4WYWA 1BWEA 5KFKA 1Y5NB 2BE7D 4ED8A 2FHKA 2RSQA 3DGPB 3OW2R 2APOA 3RB4A 1YRXA 3LP0B 2ZBQA 2W9BB 3SI8A 2FVQA 1KVIA 2DNOA 1M5PC 1EARA 3GIJA 1OPIA 1RHRB 2AEJA 3F0NA 4IG3A 3ET6B 4NLPA 5LMNF 1NSQA 1J5OB 1P1TA 2HK2A 4WU3A 3QRQA 4Q2MA 4CZCA 5A8KA 3TVKA 1B64A 2WONB 1SJ4P 5T41A 3C3LA 1LEOA 3PIPQ 2OPRA 2Z2LA 2CAJA 4C8LA 4FZVA 4H4KA 5HMYA 1RT5A 3VHQA 4FYYB 4DV5J 3V4IA 2WTFA 4CH7A 4M5JA 3NWGA 3RAXA 4F04B 3TWZA 4JI2F 5HMZA 4LF8J 1NHUA 3MUMP 4BBYA 4X66F 2R8IA 4J9SA 3EICA 2CQ1A 4DU7A 1W7WA 4F4AA 5KFQA 4DL5A 3RB6A 1RA7A 2R2TA 1N52B 3POTB 2EC0A 3H5XA 3TZYA 1V5VA 2EFPA 1WHVA 1K44A 4OHZA 3BB5A 2Y0BB 3I96A 1RLDA 3MI7X 4DQQA 1FJGF 3C15B 3GJQB 3OLBA 3KYLA 1TKDA 2L3MA 1TKZB 1XR6A 3M6WA 1R3NA 3C16B 1GMWA 2G1DA 2DR6A 3TNVA 3LF0A 2XMUA 3MPDA 3IWXA 2FHJD 4C4WA 4ZP6A 3CT9A 4DPTA 5EWFA 4X4QA 3W63A 3FCVA 3HHLB 3K7RA 3HK2A 2PI4A 1TL1B 4CLLA 1ZH5A 4B9VA 2DRAA 3TYTA 1YKWA 4JYAF 4USVA 4C3MA 2QLFB 2L9DA 3CDUA 1EKSA 2RKIA 4P6QA 5F9NA 1KR4A 1RAFB 3I9ZA 3MHYA 4O3PA 3U1MA 1M1KT 3KG1A 3KK1A 3GJTB 1RABB 4O3NA 5CYJA 1HNXF 2UP1A 1LWCA 1OQ3A 5JXSA 5A8WB 2JEFA 4WKRA 1ZAXA 1QE1A 3VAHA 4FYDA 1NDKA 3R6GB 5GMEA 1HW8A 1RU1A 4IRDA 1TL7A 3CNQP 2H5IB 1RBLA 1FK9A 4DR2F 3OQ2A 2R7QA 4Y2KA 1RWKB 2E7VA 3ET6A 4IH5A 3A3NB 1FRIA 3BSAA 3PHEA 2G13A 4DOZA 5GAEI 1DLOA 2QTWA 4NI2A 5B0DA 1M0SA 1FE0A 5IT0A 1YBTA 2ZBIA 1IKYA 1X4FA 2DO4A 1DTQB 3BDEA 2ZFHA 4CO3A 5ITHA 2ROGA 4B3RF 3LAMA 3FBBA 3DGPA 1HFEL 4AQYF 1Z2LA 4UOFA 4PUOA 3PFOA 4C8YA 1TK5A 3ITHB 3FK4A 2RQKA 1U48A 5I3QA 1HNZF 1S6PA 2G0JA 2MKCA 1NLKL 2CPYA 4B9MA 2VD3A 1NSAA 1RI7A 4P52A 2MSSA 3KMSA 3TANA 1SKSA 2HRYA 4NLDA 3JTPA 4QWBA 3HVTB 1JK9B 1HPZA 2M9KA 4HDGA 9RUBA 3SCLE 3W2VA 2MQQA 5J2NA 1FNXH 1KNZA 2EBGA 2QZ8A 2RAQA 3BGRB 3N6LA 2VJUA 4PWUA 5L8RC 2M2BA 3ENVA 4DS4A 1GTEA 2J7KA 5A8KB 1C1CB 4XK8C 3CD5A 2VFUA 3TZWA 4K2XA 4IRCA 3P96A 3J7YI 3W2WB 1NK7A 4QIEA 3D9BA 3PVXA 2KZMA 2C2ZB 3WX4A 3D0IE 4CI0B 1ZM2A 5HMXA 1IKXB 2JVOA 5D15A 1UFLA 3RAQA 2JC0A 2ADCA 2VONA 3MOJB 3M9MB 4IO9Q 2EKYA 5FDLA 3GIRA 1K9MT 1IM4A 2XTJP 4I0WA 1K1SA 2AYEA 2W4CA 4OJ3A 2XSJB 1VQ8S 1UAWA 4LMZA 3UD4P 2EFOA 4NLQA 4EUVA 4KSEB 5DZ6A 2WK4A 2AJ1A 1Q8LA 2E1AA 2CUYA 3PDNA 4WTYA 4EBCA 1NKCA 1P8GA 1ZBTA 2WRMA 2YQ0A 3GP9A 4XTTA 4X4RA 3DLBA 2YH0A 1WD6A 1AUSL 1B3TA 2EVZA 2A2CA 4UQTA 1T05B 3QO9B 3KLEA 1XMQF 1RT7B 2KL8A 2R42A 5F0WA 3ZZZA 1PAEX 1WEZA 4CNYA 5IT4A 5I42A 1FEHA 1REGX 3BH7B 3ICLA 3NGSA 1KEKA 2QE5A 1JJHA 1RT4B 2AYGA 3DM2B 1VIOA 4U95A 4M8LA 2CPJA 4FBUA 3R2DJ 4A8KA 1FWPA 1RAOA 3GCWP 3P3DA 3D54A 3QIPB 3ZZPA 4C98A 4GKJJ 1Q0NA 4P9SA 2WB1D 3CJ5A 1VGYA 2ZH1A 2GGPB 1UVKA 3OR2B 2EWHA 1BE4A 2KYZA 2MLZA 2HQ3A 2LCWA 2AMCB 4N8NA 3ZO7A 2AEFA 4ED3A 1X60A 4WJBA 2IA0A 2WBMA 1IN0A 5IT9Y 1PBAA 3H25A 3EPIA 2J0QD 2BE9B 1SQFA 4NYZA 2FVRA 2RU3A 1GMWD 2PE8A 1URRA 3KUGA 4ZVUB 3S8SA 1JLCB 1OYDA 3RBDA 1HHTP 2MZTA 1CJUB 2B9YA 3IFEA 4FYXB 4B02A 2FY1A 3J7Z5 1S0VA 2PEHA 3R27A 4ZVQB 1W2BR 2RILA 4ECZA 1N5SA 1NMEB 2HIYA 4AUKA 2XEXA 3OPKA 3BGLA 4J9NA 4J7CA 3LQVA 2DR9A 2OTLS 3W8GA 2RE1A 3MM7B 4DL7A 4ENOA 5M2PA 2UUBF 4ZHRB 3B4DA 2QX0A 1HNIB 1YRUA 3ENQA 1IKVB 3FEZA 2POKA 3KLIB 1REVA 4OX8A 1M5VC 3V6JA 4W4MA 1RTHB 3CCWA 3GJSB 4RU2A 3RW6A 4L76A 3T1AA 4J9VA 1S77D 4I1TA 3CEDA 1UWAA 3A13A 2FVPA 3M32A 4A46A 1RT2A 5DGBA 3TX8A 2HVEA 1F6TA 4MKYA 2RHQB 2OPSB 2MMYA 2QL9B 1CSJA 2XULA 2VKZG 3EZ5A 4G3IA 4QPTA 2DGWA 3RU0A 1TUVA 1TU0B 1QVFR 2CNLB 2XNQA 3EGNA 1JNZB 3HFVA 4NLWA 1JLGB 3NGRA 3FSYA 3W64A 1NHKL 4LUBA 5J2PA 4EYIB 3THVA 2CNNB 3CGIA 4J91A 2HIQA 2XBPA 2UV8A 2J7UA 5KT5A 2ZHOA 2PFFB 3OVSA 4B17A 4YOEA 1XK8A 2VB6A 3SV3A 1AZSB 4UTGA 5IOLA 3L7UA 1R8CA 1SQGA 1G2EA 2HNDB 5KTQA 3Q2TC 1I5OB 3MM9A 3V4MA 4M5NA 2XMVA 5KFOA 4NZ0A 1LWFB 3KG4A 4RBTA 1RT3A 1HQUB 1WG5A 4JB8B 1S76D 2DH7A 4F4KA 5LOQA 3KNAA 1S1WA 3IA0A 5BYSA 2B4PA 3HD1A 3HDSA 3OXFA 3MGJA 2JZ5A 4TN2A 5T7LB 1Q7LB 3NGUA 3M9NB 2JEIA 1JLEB 2PFDA 3I0RA 3CMAS 1I6JA 2RKIB 1R43A 3CE8A 5KT7A 2X51A 1T3NA 3ZNUA 5KAKA 1RADB 1PGZA 4ERDA 1RHQB 1Q95G 1YJVA 4LF7J 2PEBA 1GAOA 3J80Y 2X1AA 1N34J 1N36F 3VAGA 4LIRA 1Q79A 1RKIA 2YKQA 4JOUA 4IUFA 1PG5B 1NKBA 2DGXA 4Y65A 2DEIA 2R7TA 2PDAA 2UUCJ 1YI2S 2RH3A 2X3DA 2F7VA 1FO1A 2C3YA 4OZ3A 3UD5A 5CD4H 4DV7F 4O3QA 4IDKB 1B0VA 4RJVA 5GADI 4TU9A 5L1IA 1L3TA 4C8ZA 2H48B 3Q86A 1S6QA 3MEDA 2MLYA 1UWBA 2FGCA 3T9ZA 2J9DE 4KKOB 3GIIA 4JYAJ 1R89A 2KO1A 2DKOB 4O0IA 3BYPA 4F4ZA 4ZN3A 6FDRA 4MFBB 2F9DA 1JLFB 1ZA1B 3MCSA 3H20A 3R5JB 1DZ5A 1S7HA 1PC4A 3MEEA 2V2QA 4NCGA 4NLUA 4USIA 1HQEA 2U1AA 1UA0A 4OYAA 3VVTA 2LXUA 5K20B 4Y34A 2CQ3A 3VVUA 3KLHA 4DFPA 2B6AB 3HF5A 1YGYA 4ZCLA 2GNKA 3C6TA 3ETOA 1OO0B 3FFIB 3PNIA 3CJKA 3VZIA 5IZHA 3U27A 3J81Y 4V19X 4DR3J 3PW5A 1FFWB 3DLEB 1PIEA 4IG0A 5FLXY 3KJVA 4ELTA 1LK5A 4M5DB 4ED6A 1SL0A 5IM0B 3MM6A 2ZH5A 2FJDB 4M1KA 5C25A 3MURP 1LV5A 3N4WA 1F2HA 2DTJA 1X4AA 3GR0A 4ZPVR 5J2MB 4B3TJ 1ZTWA 2YWEA 2GMLA 2LQ9A 3LPYA 4ED5A 1LQ9A 1B99A 1FDDA 3M4XA 3M6UA 2CPIA 3KKFA 2W4PA 4JI0J 2ADBA 5KT6A 3OUYA 2WAQD 2VQEJ 1X9WA 4J9UE 1S57A 3CUNA 1SH2A 2FGOA 2VA2A 1U02A 4K0KJ 2E1PA 2W2NP 2QJ3A 2KDOA 2K7KA 4BDPA 1QJHA 3GYGA 4Y28C 3K5OA 4OLPA 1FJEB 4OZ5A 3BS9A 5ETQA 4FF2A 3CJTA 2JWNA 2VC0A 4NPOA 3SCKE 2MTLA 4CLPA 3QWUA 1TV6A 4JI0F 4LJMA 4FS1A 4P71A 2EKNA 3CJ4A 1NK0A 4H4OA 1EX8A 5KT4A 2WONA 4DL4A 2RDJA 4EYHB 2DH9A 4DUTA 1VC5A 4AL6A 1H38A 1T7PA 4B3OB 1QE1B 3DRRA 2NSCA 2QSWA 3QFHA 4KTQA 2G9OA 3VGVA 2E1RA 3QQCD 4TY8B 4OL8A 1UVIA 1MSWD 2IDLA 1IM6A 5A8RB 2P6SA 4ZP7A 1HNVA 4FDFA 3T5JA 3A3OB 4HACB 3N9UC 1WC0A 4M5IA 1S9EB 2Q6CA 4G1QA 1AFIA 3CJ0A 5HAOA 4KV8B 1ICEB 1X4BA 1MWQA 3TOQA 4RWWA 2H5JB 4PQAA 3SZ2A 2MSTA 4U96A 2C2RA 2EK1A 2MYFA 1LFPA 3P5TL 3PRDA 4OYIA 5ETKA 4ZVFA 3GSDA 4EFAC 3JYTA 1T0TV 1VQLS 1RXOB 1YIJS 2BOPA 3PO5A 3QAEA 2B43A 2CNOB 5KFMA 1RTDA 3DXBA 2EFVA 2ZE2B 1D9AA 1M90T 2JC1A 3SDEA 1NK8A 2AX0A 3VQSA 1P1LA 1RWVB 3N5FA 1TKZA 2M70A 3MTJA 3OR2A 3DLKA 2G2ZA 2Z2MA 5EX0A 1CJKA 3CSKA 1NZAA 4MKVA 1DQ8A 2PT0A 1EQMA 3SDEB 3IR6B 4PG8A 3NMAA 1IKWB 3P4UB 3M8SA 1HBMB 1UMJA 1ROFA 3IP0A 4K4YA 2EBEA 3TEHB 4CO4A 5HI7A 4ED1A 1DAXA 3R1LA 1JXLA 2X1FA 1GX6A 4RW7B 2I6WA 4ZPAA 5DM6Q 1RLCL 3G71S 4UY8T 2IAJB 2NXEA 2DY9A 3UVJA 4F25A 2UVVA 3VWSA 4V1Ak 1BQNB 1P9QC 5GAEU 3TUPA 4C8NA 1KDNA 4CH1A 1VRUA 2YX1A 3GCXP 2HQDA 2PIIA 4HKQA 4CYUB 3IAM9 2HLTA 2RNEA 5B0FA 4NOHA 4RNMA 2OI2A 1Y9OA 2EG1A 2IJRA 2VF3A 1LNQA 2VBXA 3CXCR 1VQ9S 2HVHA 3BO4A 1VQMS 2DD8S 3FNNA 4PPDA 1MMLA 3W7BA 5F8IA 3J81U 2A2DA 4LRFA 1NKEA 1VQNS 4F02A 5AXLA 2R7XA 2XZWA 3EDQB 4LSNA 4CP5A 2DVIA 3NAIA 3H0PA 2OIHA 2M8HA 5AXMA 3D7SB 2KHCA 3D5MA 2KXNB 1HWUA 1YJNS 1PBUA 4DFMA 4KY3A 4M95A 1JQGA 1NDCA 3NCPA 2LXIA 2Q6BA 2M5YA 4DFJA 2YNGA 4DEZA 3CJ8A 1NK5A 4M5HA 4LIWA 4YB7A 3EUNA 1DY3A 1GXTA 3I4HX 4IR9A 2VODA 1VFJA 2NXUA 2W2PP 5KG1A 1RQ0A 5DRKA 4AXJA 4WF9Q 5BYRA 4ZVGA 4ECXA 5AE2A 2CVIA 2QA2A 1EETB 2YQ1A 1IBMJ 1NJWA 1XNRJ 1TK0A 4PKDB 4DV1J 4AL7A 3UR3C 5SZTA 1N32J 2JLEA 4K7QA 3R3TA 2OO4A 2M88A 2JRSA 3Q8YA 3M6VA 1I3OB 3AODA 5IM0A 2EC2A 1RBOB 2VBWA 3R5CA 4P73A 1F5AA 2OPRB 4ICLB 4W98A 2CQ4A 2FZCB 3ZZUA 1VQ4S 2E5LF 2R8HA 3NAHA 2BQUA 4JI3F 3TRGA 3N6MA 4OYWA 3RBZA 1B70B 3HFKA 5ETTA 4U7UK 4DSKA 1Y0HA 2ZHBA 2DR5A 1DURA 3GU0A 2Z4PA 2ZBPA 3DNCA 1JJCB 1X0PA 1VC0A 2C3PA 2HNZA 3KTQA 3I55S 2IPOB 2VFVA 3TP2A 2OEKA 3K8VA 2FJEB 2HHPA 3CDBA 3EMTA 3NKYA 2E1MC 5KFHA 2CIMA 3MR6A 4WE1A 4J9MA 2V69A 1HR0F 2A10A 4J90A 3V5RA 1YZ7A 1N48A 3BBCA 2UXDF 3NNAA 1RAJA 3L7PA 3HO1A 4DI6A 1HWLA
chains in the Genus database with same CATH topology
2NREA 4IDKA 4WK1A 4ZCIA 4Y2CA 1QUPA 2DNHA 1LXNA 2UUAF 2R2RA 4ELUA 1KLMA 1ZAWA 1UFWA 4Q8FA 2HWTA 5J1EB 4IOBA 3DDNA 1FESA 3MR5A 1TKTB 1YWXA 4PG4A 2HYIB 4C3KA 4WIIA 4AE5A 2CZVC 4OI2A 1PO6A 1L5UA 2EFQA 1DQ9A 2COLA 1NHVA 4NLRA 3Q22A 2QA1A 4O23A 1J2VA 4ZS6A 4R5PA 4ECTA 2BYCA 1V3RA 5KFIA 4ES1A 2GW8A 4IQXA 3C6UB 1NJZA 1UL3A 2H5EA 3KWMA 4OZNA 2UUTA 2M8DB 4BWMA 5D4NA 3IGNA 3M8PB 4KIAA 4CT8A 1D8YA 4TQRA 2J9EA 2OLWA 4U9RA 4HT7A 4I2QB 1KQKA 4XAKA 3C8YA 3MMJA 4G6VB 1FVSA 1E6VB 2QA4S 2XMMA 4ECRA 5HP1B 1VRTB 1S1XA 3IO1A 4OIXA 5KOXA 2ZZNA 2LXFA 4QQBA 2B5JA 4GO7X 4QR1A 5D77A 3ZZTA 3CCLS 1U24A 1H0HB 2LU2A 1OWXA 1QM9A 3DRPB 1L3KA 3I0SB 4ETZA 2NR0A 2HFNA 2HHWA 1C1CA 1BY9A 3KHHA 1JLBA 4H4MB 1R0AB 4P7TA 5E3CA 3SFGA 1VBYA 2PMZD 3NL0A 2JLFA 2MZQA 5LJ3Y 1F5CA 4FS2A 2B9WA 2DNZA 2KRRA 1L3VA 4DLEA 3GG1A 1HPZB 3A8EA 4CCHA 5DDRC 1Q82T 1MU2B 4TXSA 1MROA 3GQCA 4FF4A 2YKMB 2CG4A 3V81A 2G4BA 4DBQA 1U49A 3KHRA 1FHTA 4U67Q 3DI6A 2DBBA 4IFVA 3H40A 4QU6A 1S1UB 1JLAB 2YKNA 3IS9B 3I32A 4PQUB 1VOMA 2XLKA 2VG5A 1VI7A 1QAJA 3CDAA 3CCZA 4A8OA 5M2UA 3NRBA 2J5AA 1WF1A 4FP9A 3BR9A 3PACA 4YR0A 2RQMA 2VUGA 1Y00A 2VG7A 2F8HA 2RQCA 4NRTA 2FHOB 1XNQF 5C42A 2P6TA 3FEYB 3HHEA 3LWLA 1FJ7A 2R8JA 3LW5C 3BEGB 2IYIA 4YDDB 2AGPA 3HMJG 2DNMA 3WBZA 1F5BA 4X84A 1QAYA 1YJWS 1E6VA 3R5DA 4YP3A 3I5BA 3E2EA 1DARA 3CO9A 2VG7B 1HA1A 2HGMA 2V5HG 3T19A 2R9LA 2GMJA 1D1UA 2W7AA 1U26A 4GKJF 1WWHA 4O3OA 1D3WA 1JWWA 1WTFA 2KT5A 5KG0A 3DDKA 4DS5A 3TVZA 4JV1A 5AJ3F 5ADZA 5F8MA 4ID5A 5B08A 2P9CA 1KOOA 2QYCA 1TKXA 2VZ9A 4M94A 1Y5LB 2KZZA 4RW9B 1KHWA 4ECVA 1MROB 1YQHA 2N4DA 3GYXB 1SV5B 1RYRA 1FRMA 2BVZA 4MK8A 4A8SA 4LSLA 3VF0B 5HMWA 1CQNA 2DK2A 2FIUA 3QO9A 2MQOA 4IYQA 3TA1A 2PD1A 2C2DA 3PZPA 4ALZA 2O3DA 3C46A 4DV2F 4WU2A 2HHUA 2J8AA 4X4PA 4OLOA 3CPWR 1SIWB 5J2NB 5LXRA 3N0VA 3T6BA 2KM8C 2PN6A 1A9NB 4WE1B 1KTVA 2CKWA 2KB2A 4HVZA 3UFCX 3FMBA 2JOQA 2WSFC 4FXDA 1HWKA 2WCXA 4DDFA 4HH0A 5J2PB 3THPA 3GV8B 3N28A 2DR8A 2VFTA 1H7WA 3DI6B 2V8HA 5E33A 4LQ9A 4I69A 2WW8A 3PFEA 2D41A 1U1PA 1SKRA 4K4TA 1URNA 4ICLA 2PMHA 2V4JB 4WFXA 4B9UA 3MM8A 4MAKA 4QR0A 3W2VB 5B0CA 4N47A 4E0DA 3MXHP 5GAHI 1KOHA 1JKHA 1YBAA 1LOUA 3IG1B 3SXLA 2UXBF 4ZP8A 4KPYA 4FPRA 3F56A 1FXRA 2VH7A 2D3OR 4Q0BA 2CJBA 2MY8A 3CCUS 1BQMA 2DT9A 1HBMA 5KFVA 3CVKA 4DUZF 1HWIA 3CCTA 2XY7A 4K5RA 2ZHAA 4BC7A 3NCQA 4O44A 1RYSA 3GE9A 4RW7A 3N6NA 3KLFA 3AQOA 4KKOA 2XNRA 2F4VF 2BACA 2ZE2A 3QLHA 4F26A 3J7Z5 5DDOC 1UWBB 1BQXA 2NLWA 4TYAA 4FVCA 2IVMA 4N56A 1N33F 3EXYA 4GC7A 3TQ1A 1LWCB 2XMKA 5A8WA 1KRPA 2GJIA 2HS0A 2RF2A 4RW8B 3DLGA 3RR8A 1C1BB 3MD3A 3IRWP 5DM7Q 3OL9A 2KT3A 1Y3JA 3SQGB 1VC6A 2FLNA 2HHQA 2Q66A 4C8KA 2MXYA 5D78A 2WB4A 4L72B 5HROA 1UW4A 2UV8G 5EN1A 2V8GA 2C3UA 4ZPBA 2HLUA 5E41A 5G0RB 3HHLC 3ZZRA 1QVGR 1SUQB 3V4IB 2N4CA 2Q43A 3ISNC 1RT5B 3Q8PB 3BN7A 5LSLA 4LF5F 1ZETA 4DSEA 3MMCA 1UVJA 1VS3A 1XERA 2QIFA 3M2RB 2NZ4A 5K14A 4ILLA 4OV1A 2OMLA 1FDBA 1S0NA 5K8OA 1X4EA 2RB7A 5I3PA 3HHDA 1CG2A 3S6EA 4ELVA 2RJZA 4HI1A 3ZC4A 3L95X 1X4HA 2K3KA 3T1YF 1IKXA 4EO6A 5KFWA 1D9FA 2R7RA 3PW7A 2I5JB 1X5PA 1FNOA 1JLGA 3X1LB 2A1BA 3CWJA 4A8XA 2VPYB 3CCQS 1LW0A 4I7FA 3DRRB 4N5SA 2CQPA 3OUYB 4JV5F 1RT1B 2DHAA 3BSCA 4GC6A 2GIRA 4NX9A 5DG7A 1T95A 2ZD1B 4DV4F 5GVQA 4OJ1A 3DRYA 3QZ7A 2C42A 1LXJA 3D0GE 1FKOB 4N76A 2DO0A 1FKAF 2LMIA 3CIZA 1YG0A 4ID8A 5E3QA 3L3CA 1HQEB 1XWLA 5DG9A 1SJRA 2GJ2A 2KFYA 3SSRA 2ZD1A 2I2YA 1EP4B 1QUVA 2BABA 1S48A 3MPYA 3VAJA 2XS7A 3H59A 2BJDA 4R8UB 3GR1A 1S4FA 2ZBCA 5KOWA 4YR3A 2PA8D 3J7ZT 2CQCA 5B0BA 2RF2B 4RW8A 5AE3A 1SL2A 1BLUA 5KFEA 1JLFA 2AW0A 3D1QA 3OXGA 4LFAF 1U1LA 2GIQA 3HX9A 3G6XA 2XMJA 3BF4A 2J0SD 1JLCA 2P5VA 4BHQA 1U1RA 5KFUA 4R25A 5BYQA 4YB6A 1LWEB 4NLTA 1TQLA 4CO1A 3GILA 1MWYA 2B6AA 1C2PA 2C3MA 5HBMA 3U1NA 3JSYA 3HVAA 2W7PA 2OD6A 4YY3F 4X4VA 2Y0SD 3NS5A 3O2IA 3O6QA 3WC2A 3MM5B 3CD6S 3KHLA 1Y7PA 4C8MA 4OHYA 1ZPWX 1GTHA 2ASYA 2V8VA 1A6LA 2FLLA 2N7CA 4OI0A 4ZPWR 2Z8QA 2EW9A 3HPOA 3T5HA 1JJ2R 5LT5A 1X7VA 2CQ0A 1N8RT 2J0XA 5F8HA 1RT6B 5CZXA 1U7LA 4YUDA 4NZ7A 2V8DA 3SYZA 4UUXA 2ZM6F 3DOMA 3LP1A 3PM9A 2W25A 3B82A 2AQ4A 2VG6B 1GXLA 3QGGA 4NZ6A 3UI3A 5CCLA 1P27B 2GHPA 1EP4A 2YKMA 1U45A 2ZH2A 3DHWC 1S1TB 4CNZA 1KFSA 5A8RA 4NWBA 2F8MA 1SBRA 3AJ1A 3B78A 1IR0A 3SFUA 3WDOA 4WFNQ 5L1KA 1LWFA 4EZ9A 1H2UX 3G9CA 1YJTA 1YTYA 2MPUA 2OP5A 4WFYA 2HGNA 1N4LA 3C66A 3CMES 2P9GA 1VQ5S 5KFFA 4MKAA 1TV6B 3LH2S 1JIHA 2CVEA 3QIDA 1SH3A 5KFNA 1KVJA 3IBWA 2HQIA 4ZP9A 5D4OA 4DL0C 4EZ6A 4HTJA 2W9CB 3AY0A 3D1HA 5CHCB 3Q8SB 1N5YA 2E5GA 4PPZA 5KG6A 3ZZYA 4A8YA 1DHMA 2J9DA 3MFHA 2O01C 2ZITA 1Z2ZA 4WFZA 3MWBA 4OI4A 5CYQA 1C4CA 1ZZFA 4Y2AA 1Q8IA 3OTEA 4HL9A 2MKIA 1WI8A 3IGVA 1HBNB 1HMVB 1FRHA 2VV5A 3M2UA 4RUHA