2LYVA

Solution structure of the two rrm domains of hnrnp a1 (up1) using segmental isotope labeling
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
GSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoprotein A1
publication title Solution structure of the two RNA recognition motifs of hnRNP A1 using segmental isotope labeling: how the relative orientation between RRMs influences the nucleic acid binding topology.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing, transport protein
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA02
2U1AA 2BZ2A 3Q2SC 4U67Q 1X5OA 4C0OC 2CQ2A 5CYJA 2KI2A 3V4MA 3R1HA 3D2WA 1VQPS 2M0GB 2DB1A 2YTCA 1IQTA 2RQ4A 2HVZA 1N88A 1HD0A 1WWHA 4F25A 2EK6A 2RU3A 2AD9A 2RQCA 4YB1P 2X1AA 2DGOA 2E5GA 3NS5A 2RS8A 2DNGA 1RK8A 2Q79A 2DNQA 1KD1T 1X4CA 2XNRA 2M88A 3CD6S 1WG4A 1DZ5A 2XS7A 2M9KA 2ERRA 1H2TZ 2ZJPQ 1X5PA 2DHXA 5EN1A 3CULA 2KU7A 2N3OA 3CCJS 2FC8A 1X5SA 1M90T 5HO4A 3G96A 5JVHQ 1VBYA 2MQPA 4Y00A 3EGNA 3I56S 4WKRA 1YHQS 1FJEB 3I55S 2DNMA 2CPDA 2U2FA 2K8GA 2CJKA 3UD4P 1U1OA 2OJ3A 5CA5A 2LA4A 2KG1A 3VAIA 4Z2XA 2RUGA 1NU4A 1VQKS 1N52B 2G4BA 4WFNQ 2JRSA 2K3KA 3NNCA 4LJMA 2AYGA 2F9DA 1VQ7S 1P1TA 2EVZA 1VQ5S 2V94A 4WFBQ 1R8HA 1U1NA 2QEXS 2MKSA 4FXWA 2RRBA 2XS5A 2LEAA 3PIOQ 1AUDA 1VBZA 2X1GA 2GHPA 4C7QA 1VQ8S 3BO3A 5D78A 1G2EA 3MD1A 2KXHA 2MQLA 2XNQA 2KM8B 3MUMP 4FXVA 2LA6A 1XN9A 1WHVA 1FT8A 3S8SA 3CC2S 2DNYA 3UCUP 2KFYA 1U6FA 4IO9Q 2YH0A 2MJNA 2MZJA 5LXRA 2QA4S 3H2UB 3U1MA 1VQLS 4PR6A 1OIAA 1HD1A 2XSFA 4F26A 1VQ9S 2CQDA 2DGWA 4ERDA 2DITA 4A8XA 5DDRC 1SJFA 2RNEA 3RW7A 4OZ1A 1U6BA 4P6QA 5LJ5Y 3BO2A 1URNA 3UCGA 2ZJQQ 4Y0FA 4BS2A 3TO8A 1DBDA 1WF0A 3UCZP 3ZZYA 3VAGA 1WTBA 2E5IA 1WEXA 3THPA 2MXYA 2DGVA 1H2VZ 3PIPQ 2MZQA 2LXUA 3MDFA 2LEBA 1ZH5A 3TYTA 3MUVP 1SJRA 4QPTA 4UQTA 3CC4S 1VC6A 3S7RA 4PRFA 3NNAA 1KC8T 2SXLA 5IM0A 3CC7S 2LECA 2CPXA 2JVRA 3CCQS 2X1BA 2BOPA 5GAHU 4M5DB 5FJ4A 2CQ3A 2HGNA 2MSTA 2B0GA 1PO6A 5DDPC 4QU7A 3CPWR 1K9MT 3N9UC 2DGTA 4QQBA 5GAEU 1WF2A 1WHYA 2D9OA 2J8AA 1A7GE 1YTYA 3CXCR 2LXIA 3NNHA 1H6KX 3UD3P 4YOEA 3CCES 1NJIT 1DHMA 3CUNA 2F3JA 2QFJA 2MKJA 1CVJA 2MZRA 3VAFA 4UY8T 1QVGR 3UWTA 4J5OA 3J7YU 1UW4A 1M5KC 1JJ2R 2LYVA 1JMTA 3G9CA 5DETA 1K73T 4W90B 1OPIA 2DGXA 5DDQC 3MUTP 3CCRS 3VAJA 2N3LA 2KN4A 3SMZA 3VF0B 3CMES 3FEXB 5IM0B 2OTLS 2AYMA 3CCLS 2MGZA 4EGLA 2XB2D 1VC0A 2MY8A 3NMRA 2N82B 1N54B 2VOPA 1F9FA 2OSRA 3NS6A 2MJUA 2DNPA 1QVFR 2CQIA 2GO9A 2CQGA 1JJHA 2E5HA 1KOOA 2KYXA 2CQ0A 2KVIA 2G0CA 2HYIB 5DM7Q 3BO4A 2OIHA 5HL7Q 2LMIA 3BEGB 1DRZA 1SJQA 4RU2A 1N8RT 4WCEQ 1U1QA 2CQ4A 1X4BA 2DH9A 3CCMS 5CXTA 2LQ5A 2M2BA 2ADBA 3G8SA 2NZ4A 2DNLA 5GVQA 2J0QD 2DIUA 1X4AA 4WFAQ 3OW2R 2JX2A 3DLLQ 2VONA 1M5PC 1WEZA 1FO1A 3MOJB 1R8PA 1X4HA 2MQNA 2E5JA 2LCWA 1WHWA 5H1SV 5DDOC 3HI9A 2MKCA 5LXYA 1YJWS 2JVOA 3US5A 1WI8A 2M52A 2MSSA 2FC9A 4W92B 2CQBA 3P6YC 1SXLA 2VOOA 1VBXA 3SXLA 3VALA 4IOCQ 1HL6A 2KT5A 2MKHA 1W2BR 3K0JA 1WG5A 1Q7YT 1FJ7A 2KG0A 2CQPA 5BJRA 2MQOA 3MD3A 2OSQA 4LMZA 2M8HA 1M1KT 2KH9A 2MQQA 4QU6A 2CQCA 2KRRA 2HGLA 1VQOS 4PKDB 2DNNA 1VQMS 3CF5Q 3HHNB 3IRWP 1NO8A 2L41A 3EGZA 2OTJS 1UAWA 1PGZA 2WBRA 3P5TL 5ITHA 1OWXA 3CMAS 2DNHA 2LKZA 4OZ0A 3MI7X 3J7ZT 1X4GA 2E44A 4F02A 2MZ1A 1FXLA 1M5OC 2L9WA 2MQMA 2MZSA 1X0FA 1YJNS 2X1FA 4IOAQ 1X4FA 4LIRA 1YJ9S 3L3CA 3CCVS 1FJCA 3MURP 2DHSA 2CPIA 1QM9A 1YITS 4WF9Q 1RKJA 3G4SS 1KQSR 3S01A 5IQQA 2DGQA 1WHXA 2M70A 1WEYA 2YKAA 2MHNA 1U1LA 2XS2A 3B4DA 2FPHX 3H2VE 2DO0A 3IWNC 2DHAA 3VAMA 1VC5A 1U2FA 1U1RA 1KOHA 3SDEA 3DXBA 1Q86T 3FEYB 2A3JA 3G71S 3JB9k 1WI6A 2F9JA 2PEHA 1B7FA 3CCUS 1X4DA 1FHTA 4YUDA 2G1DA 1SJ3P 2DHGA 2DNZA 1L3KA 5LSOA 2FHOB 2CPEA 5GAGU 5GADU 3TP2A 2KXNB 2KXFA 1S72S 5MLCV 1VQNS 2RVJA 4V19X 2DH8A 1YWXA 2KHCA 4CH0S 2KM8C 2MZTA 1D8ZA 4CH1A 5IFMA 3CCSS 3LPYA 1UP1A 3U1LA 1Q82T 2FY1A 1K8AT 2UP1A 2YH1A 1SJ4P 2MYFA 2M8DB 3UE2A 2ADCA 2CPHA 3R1LA 3R27A 2RS2A 1ZZNA 4C4WA 2DK2A 3Q2TC 2PE8A 2CQHA 4IUFA 2YWKA 2J76E 2AYBA 2I2YA 2MKIA 2NLWA 2DIVA 3SDEB 1BY9A 5LJ3Y 3EX7B 1HA1A 2DNKA 2EK1A 3RW6A 5GMKa 2CPFA 1Q81T 4TLQA 5JVGQ 1O0PA 2CQ1A 3S6EA 4CIOA 2MGZB 3P3DA 2DNOA 2M7SA 1P27B 1S79A 3G8TA 2DGSA 2HGMA 2KRBA 4TU7A 2D9PA 5LSLA 2J0SD 3MXHP 1YIJS 2DGUA 2CPZA 2ZJRQ 2RRAA 2VODA 1WF1A 2DNRA 2JWNA 1OO0B 2N7CA 2MMYA 2M4MA 3ULHA 1ZZFA 1U1PA 2HZCA 2MY7A 1A9NB 2DISA 2D3OR 4CQ1A 3VAHA 2CPJA 2DO4A 3LQVA 2CPYA 2DH7A 1M5VC 3B4MA 3G6ES 3ZZZA 4TU8A 2RT3A 3VAKA 4WIIA 1U1MA 4ZKAA 1JJ4A 1UFWA 2MKKA 1VQ6S 1X4EA 3CTRA 1H2UX 2MPUA 1X5TA 5DM6Q 3THTA 4ED5A 1YI2S 3P49B 2MB0B 2AYEA 3BS9A 2O3DA 1U1KA 1WG1A 1FNXH 2I38A 1VQ4S 1D9AA 5D77A 1WELA 4TU9A 2L08A
chains in the Genus database with same CATH superfamily
1WC3A 1DLOA 3TJ9A 4F4XA 4OZNA 5F8HA 2L9DA 2WZ1A 1IQTA 4LFAF 2EK6A 3PYDA 3DLEB 3MM7B 2E5GA 3GQCA 2CJ9A 2A6OA 1Z1ZA 4RUAA 4BWMA 2XS7A 3CJ2A 3KG1A 4UQGA 5F8IA 4J7CA 3W66A 2FC8A 2RDDA 1M90T 4DL4A 3CNQP 1B64A 3L95X 3M8WA 1VQSA 1BXNA 1FJEB 3SCIE 4A8YA 2IA0A 1NU4A 2G4BA 1VJQA 1N34F 4B02A 4J91A 2HFVA 3EJMA 3G6XA 1VS3A 1RAEB 2DNYA 3UCUP 3R5BA 1VQLS 2MLZA 4F4WA 1LFPA 3K2YA 1ULRA 3EWGA 3SV4A 1OJ4A 1URNA 3DGPA 1KRPA 2GO8A 1TL5A 3RB0A 4LF4J 3OR2B 3A13A 4KT0C 1CBKA 1OMSA 4K8RA 2AMCB 3S7RA 4DQSA 5ETPA 1KONA 3PFOA 4IFYB 4E8UA 5DLGA 2HK3A 4NX9A 2UU9J 4JI2J 4ZVTB 5I3UA 2R7UA 3CPWR 2IVYA 1SUQA 2XM3A 2VASA 2D9OA 4DEZA 3CJQA 1R8AA 1NJIT 4JI3J 1IWAA 5RUBA 1QVGR 4JYAJ 1HFEL 5KFTA 3D0HE 4OYWA 1BLUA 2AQ4A 1TKZA 3C16A 4OI4A 2GQQA 2HHVA 4CT8A 4L73A 1IKXA 2IYGA 3W9IA 3MEDA 1CLFA 2VOPA 3Q89A 2B6AB 1KBRA 2BJ8A 4A8OA 1S1XB 3LO3A 1HQEA 2VA3A 2QLJB 1C1CA 2C2RA 4NRTA 3MMAB 3T5KA 2OEJA 4UW2A 5CXTA 3Q8RB 2M2BA 2ZZTA 2LP4A 5EHHA 2Q43A 2HKEA 2MLXA 4I2QA 2IPOB 1HWJA 2W4CA 2DR6A 1KQFB 3KK3B 3KK2A 1TKTA 2HLUA 5EUHA 5HQ8A 4WXOA 3MD3A 4KGXB 3AA8A 4DUZF 1WACA 4O0IA 2I0XA 3NBPB 2RKIA 1U2RA 3QFHA 4FVMA 4DQPA 4IDKA 3V6JA 2ZNYA 3MPVA 4ECQA 1FXLA 2MQMA 2RDIA 3CCVS 3MURP 4ED0A 1GMUA 4FXDA 5IQQA 4PWUA 2YWFA 1YJRA 2A18A 3OQ2A 4CTAA 3QATA 1XMOF 1CC7A 1MSWD 5I3PA 3BGRB 2E66A 3JB9k 1WOOA 1J5OA 2W01A 2P9CA 3QSIA 4F4AA 3LA0A 2NXEA 3EICA 1PYSB 4RX6A 4F2RA 4A48A 2UUAF 3EXYA 4CH0S 2ZH4A 1IR0A 2ZKUA 4XK8C 4HL9A 2YKNB 4NZ7A 1YZ7A 1NK6A 4OHXA 1JWWA 4C0HA 1V3RA 2JNJA 3VTIA 4LF5F 1IN0A 1HA1A 2ASDA 1OSCA 4RR5A 2APOA 3NCQA 1HPZB 1S79A 2F8MA 4CO0A 1D9FA 4LF7J 2Z30B 1JNZB 1C2PA 1BE4A 4RU9A 1YBTA 3VGUA 4DR2F 2E1CA 4MKVA 1ZZFA 1C1BB 1WC4A 1PKUA 3M2UB 2EW9A 2ZWOA 2CXEA 5J2MA 1MMDA 2H3EB 1KN6A 5F3ZA 4LIWA 2VBWA 2VDHA 2UV8A 4IH7A 1IKWB 1VFJA 4KRWA 4ED5A 4XPCA 2ZVSA 1RLDA 2I38A 3PYFA 1D9AA 4KY3A 3NGRA 3HPOA 1IJEB 5HQMA 1N32J 2YNGB 3VVUA 2UXDJ 4F50A 1NDLA 1SCJB 4LFBJ 1SH3A 4KIAA 2YKOA 1M1GA 3BDEA 3MGJA 3RBEA 2K06A 4DV0J 1KD1T 3TVZA 4ZK7M 4QW9A 1RJJA 5FDLA 3N5FA 5KG2A 3CULA 5JVHQ 5K8NA 5KFEA 2BJDA 3KLEA 1HMVB 1F1BB 2JEIA 3HMJG 1U1OA 4HYKA 4X4SA 4JI4F 4ECRA 3TRGA 5CH7B 2H54B 4WP3A 2LFVA 1LWCA 4A47A 5A6PA 1UA0A 1QSSA 5B0BA 4LBHA 2LA6A 1DQAA 3QO9A 4DV1J 3CC2S 4UOHA 3DNCA 4DV2J 4NLUA 4J9VA 2Y0SD 2RNEA 4OZ1A 1BMQB 1LV5A 1V9OA 1IXKA 3L7OA 4KGZB 1PJ7A 2GFFA 2GZOA 3NKYA 1WF0A 5E3QA 2ZBRA 2MXYA 4RNFA 5J1EA 1JLGA 4DS4A 1F9EB 3W5YA 4ZDNA 1FJGF 4RL1A 3D4JA 2IJNA 4R0EA 3HDSA 5GAHU 1ZETA 5L39A 1A0OB 1SQEA 1KSPA 2XMTA 1JLBB 2BRKA 4RWXA 3D3BJ 3K58A 3DLBA 2PMZD 2F65A 2B9XA 4H4OB 4AE5A 2CWXA 4J5OA 4NRUA 1UW4A 2XHCA 1HNWF 1RT4A 1N36J 1HNZJ 2C3MA 3G87A 5DETA 1OPIA 2JFDA 4USUA 1ITPA 4CWBA 2W4PA 5L9XA 3MFIA 3MM5B 1TK8A 1N54B 1C0TB 2ATLA 1FK9B 4OL8A 2OP5A 1I6JA 4RW9B 4LVNP 2UXCJ 4TXSA 2VICA 5KG3A 4RU2A 4L3KA 2IAJA 2HHPA 3OUYB 4DL0C 3DLLQ 5E41A 3OTBA 2C3YA 3MOJB 4USWA 1NK0A 2VA2A 1BQMB 1WI8A 3I4PA 3P6YC 4CH7A 2IM1A 3NCPA 1ZM2A 2BANB 3VALA 4Y2IA 2MKHA 3UDLA 3I96A 1HYSB 2MQOA 1X8DA 4LMZA 2ACYA 4L76A 1VRUB 3X3UA 3K5NA 1REVB 2J5AA 4L74A 4B9VA 1VQMS 3C15B 2GGPA 1I5OB 2L41A 3PY8A 1PGZA 2DNHA 4R5PB 1HI8A 5CZVA 3RRHA 1W25A 4AL5A 4JV5F 2V5HG 3OFEA 3QT8A 4C98A 1X4FA 1FJCA 2C2OB 1HMVA 5J2NA 2O1PA 3IM8A 3S01A 3IBFB 3FBEA 1PC4A 1WJ9A 2UUCJ 2RU9A 2BM0A 3BSCA 3U02A 4NEZA 1VC5A 2XLJA 1KOHA 1FXRA 1B7FA 3W65A 3QLHB 1V3ZA 4Z7CA 4ZVEA 1FHTA 1JKHB 2V8VA 4QYZK 3CJKB 2OMLA 1WKKA 4HI2A 2VUGA 4ZLLA 1U0HB 4ZP6A 1RT3B 2OUGA 1LW2B 1UTAA 4X4QA 2ADCA 3IN5A 1CS4A 4FYYB 4ZLJA 2NXCA 2ZKTA 1IWGA 2YNHB 5LJ3Y 3TQ1A 2EK1A 2B8PA 1X0PA 1IKYB 2LQJA 2DNOA 4DL3A 4DU7A 2HGMA 3QYYA 3T19A 2BXJA 2XMWA 1F6TA 4ELUA 4I1TA 4AL6A 2VODA 1HNVA 1R7IA 1OO0B 1QAIA 2V4JA 3TAMB 3UI3A 5L1IA 4ED7A 4F0MA 8AT1B 4CQ1A 2CPJA 2DH7A 4P72A 3BF4A 3G86A 4QJVA 2ZITA 4HACB 2CAJA 5KFXA 2DXDA 3H5UA 4YDXA 2DCLA 2QA2A 1RTZA 1YI2S 3W7BA 5A76A 3LP1B 4C8NA 3E8OA 2BE2B 2PGCA 4XDCA 3GFYA 4N8NA 2H5JB 5D15A 4C0OC 2HWTA 2YTCA 5HAOA 2DD8S 2RU3A 2VG7A 4LF8F 3OUYA 1XR5A 5L1KA 2JEJA 2KZZA 2M88A 3K5LA 1KVIA 1LWFA 2YKPA 1DZ5A 2GJFA 4TYBA 2QZ8A 3LTOA 3BGUA 3MEEB 4V1Ak 1VBYA 4Q0BA 4HKQA 2FJVA 3I55S 2B3TB 2BR0A 3EM1A 3AB4B 2C3OA 2XZTB 1HBUB 5DRKA 2H4YB 4Y28C 2RUGA 3IGVA 4P9SA 4WFNQ 3PRVA 2B5JB 3FUYA 2LEAA 2OPPB 1GAOA 3M9NB 1CJKB 4I6WA 1VGYA 3UO0A 4X84A 1WHVA 2OLWA 4QW8A 4M63A 2MZJA 2PN6A 4TN2A 2VPYB 5A8KA 2J6UA 2VG6B 4DFPA 3DU5A 3PHEA 1TTHB 2AZ1A 4Y0FA 4KR0B 3E01A 2F4VJ 2VHGA 5KFLA 2DVIA 1GX6A 1NKEA 4X4VA 2IYIA 3W9HA 2PO4A 3MDFA 2ZH3A 1J5EF 3T6JA 1B0TA 1C4AA 1WOSA 1QD1A 2ZZMA 4ZPCA 1WDTA 4EWTA 1MW7A 3M1VB 3MR7A 4X4TA 2GMLA 1K9MT 1X9MA 1NCLA 4ZVSB 1F0XA 4NOHA 1KR4A 2GJ2A 2LXIA 1H6KX 4UUXA 1U8SA 4DSJA 3O3LA 2MZRA 4DR4F 4ELVA 4R25A 3G9CA 3PEHA 4O3SA 2DGXA 2OTLS 3NY0A 2KHDA 2ZD1B 2HIQA 4P2SA 2OSRA 4X4UA 1FF2A 2Y3YA 1JLQA 3BH6B 4PXDA 1JJHA 1NLKL 4LR7A 3N0VA 2CQ0A 1T0TV 3TAMA 4RLEA 4AFFA 1NJXA 2HQ3A 1ICEB 2VU5A 2PDAA 3BDPA 4G6VB 2OH2A 1QDUB 1BQNA 3M32A 3GV5B 2UVUA 8ATCB 2I8EA 4ED2A 4ES2A 5K14A 5LMNJ 3DLGB 2CNKB 5BJRA 2O01C 1SIWB 2KRRA 2G13A 2HGLA 3GV7B 3TANA 2DNNA 4OX8A 3C6TA 3PKYA 2BJ7A 3GIIA 3EGZA 2HVHA 4K50A 3M05A 1FRKA 1CQMA 2BKPA 2MZ1A 2FLPA 4NYZA 1LW0A 1RKIA 5HMXA 3AY0A 3MM8A 1FFSB 2KT2A 2XYPB 1REGX 3JQMA 3OJUA 3RRKA 2FHMA 1FFWB 4Z37A 2DHAA 2B5JA 3WX8A 3DXBA 1Q86T 3G6VA 1WI6A 3CCUS 2W2QP 3NOCA 3NGUA 3PO5A 3BKTA 4W4MA 1HQUB 3M8YA 3BBBA 4ECYA 3AOBA 5C7PA 4OHVA 2UP1A 2YH1A 4DPXA 1RAFB 5KOXA 2IVMA 3MR5A 1GTEA 1U6ZA 1EQMA 1T3NA 2KT3A 2R7RA 2HHUA 3SDEB 4ZP9A 3DMJA 1NZ8A 4XIUA 5GMKa 2WCXA 2JLEA 2W24A 1MG7A 4CIOA 2DEJA 2PA3A 2FD2A 2HLTA 4ZCLA 2JL9A 3M1VA 1FDDA 4P7TA 4ZA1A 3BSAA 3JSYA 2JWNA 4I56A 4LF6F 3OTOJ 1ZM9A 3S1TA 5GADI 5K5MA 2VFVA 3GR1A 3VAKA 2VV5A 1XMQF 2XWYA 1P9YA 5DM6Q 4IG3B 4S0MA 3MMBA 5KFYA 3VVTA 4KQZA 3M6UA 1UZDA 3A8IA 4YB5A 3CD7A 1T95A 2HWHA 5IC6B 4LF2A 3IRXB 4HR2A 5IOLA 2KI2A 5T7LA 1LWXA 1VRTA 1HD0A 4DCPB 2HHHF 4NWBA 2V9WA 4CLZA 2X1AA 2DGOA 2PSZA 4OYAA 1RBOB 2IDLA 4JI8J 3PX0A 4KE5A 4NZ0A 2XNRA 2QTWA 2E7WA 2XYGB 5HJXA 2V6AA 2DHXA 2ZM6F 2QSWA 2XO7A 2V67A 3DKDA 3CIZA 2BDPA 3PO4A 2DJWA 4F3MA 3WIUA 1JXLA 3VAIA 1SC6A 3IS9B 3M8QA 4KPCA 2XEXA 3QPIA 4CI0B 4JI1J 5J2PA 2XS5A 1SPBP 1FFGB 1AUDA 4ICLA 4B3RF 4C7QA 2XNQA 1RWOB 3KMQA 3S8SA 1OY8A 3CJ3A 2AF6A 4U7UK 1XR6A 2VFSA 3DHXA 2GVZB 4NA3A 1RWPB 3HSJA 4KKOB 5LMUF 2EBGA 2ZJQQ 3TUPA 3TO8A 2ZH6A 1WTBA 7FD1A 3FFIB 4N5SA 2B7CB 4OX9J 3IBCB 2R42A 4J9SA 1OQ3A 1SJRA 4UQTA 1H72C 2ZBIA 4Y2CA 3W64A 4DDFA 3ZTSA 2YPZA 3R2DJ 2C42A 1XQIA 3KLGA 2MSTA 1Y7PA 3DOKA 5DDPC 3FBCA 4B9NA 1AZSA 1Y0HA 4DOZA 5F8JA 2CDQA 1QUPA 3RBXA 4O0NA 1EHWA 4KSEB 2P8IA 3LAMA 4ES3A 1S4FA 4L6V3 2LYVA 1U45A 2KO1A 4HTJA 1BWVA 2N3LA 2KN4A 4DV7F 4O4GB 3EGWB 3JSMB 3CCLS 4N47A 1VC0A 1PBAA 1KS2A 1O6XA 2R7VA 3Q8SB 1IBMJ 3FNNA 2YNIB 3ENQA 1B7YB 2JFKA 2DT9A 3D1HA 2CDRB 1DRZA 4R8UB 1YK9A 4WZQA 4ZS6A 2Y1RI 2X7IA 3OW2R 4QBUA 4J9MA 3HI9A 4RUHA 4ZLNA 2E1RA 2HBZB 1UVKA 4AUKA 1RP5A 2AW0A 1SXLA 2IIHA 1NK8A 1IKVA 4YY3F 1H3DA 3SXLA 1WORA 3ZO7A 4AT1B 1Q7YT 1FESA 1LXJA 4DUTA 2KH9A 4QR0A 2B9WA 4DR7J 4JUZA 3NWRA 1NO8A 1RT7A 4K5RA 2DCUB 4D3HA 1UAWA 2WBRA 3OR1B 1FRXA 2I6WA 3T1HF 2XSJB 2HURA 3R5JB 4LBIA 4G3IA 5I42A 2RE1A 4DN9A 2W8LA 1C4CA 4LSNB 1X0FA 4DU8A 5G0RA 4YMEA 3P96A 4WF9Q 2KVQE 4EEYA 3SSQA 4URSA 4G65A 3JSBA 2RD5C 3QMQA 4K4WA 1RAOA 4WYWA 1HNXF 2J6SA 3MMJA 1JNRB 4USHA 3SBMA 5F3TA 1R0CB 4DPUA 5SZTA 4F36A 2NYIA 2WONB 1SJ3P 2DNZA 3A8JA 2HNZA 3LGHA 4DPWA 4USMA 3NWGA 1ZPVA 3BV8A 1VQNS 2AGOA 1GQEA 1TL1B 3KKFA 1D8ZA 1RSCA 5IFMA 4PYDA 1J2VA 3NLCA 4UZCA 3UE2A 4DUYF 4JI7J 3R27A 4RBUA 4L3NA 1SKRA 2I2YA 2FVCA 2NLWA 3CJ0A 4NYPA 4UOFA 3H8YA 3ILLA 1AUSL 2VBXA 3GJSB 1I94F 4LRCA 4ZVOB 2MGZB 2M7SA 1MN9A 1HQ2A 4OQJA 4NCBA 2RAQA 1BHNA 3GG1A 2YVSA 2DGUA 3PJXA 2B4UA 2IVFB 2DNRA 3Q8UA 3KHLA 2N7CA 3GB0A 1H7WA 1HR0J 4KHMA 1UJ5A 2D3OR 2BOAA 1E6VA 1VK3A 3A3OB 3GYXB 4M5LA 3Q23A 2L48A 4ZKAA 1S6OA 4DV5J 1T11A 2MPUA 3GP9A 3KTQA 4PPZA 2MB0B 4F0KA 3AD8C 1UFKA 3BS9A 2Y1IA 1DQ8A 5E3CA 4DL7A 1HW9A 3V6KA 1LK7A 2CQ2A 2ROPA 1O5JA 3GYNA 3CJTA 4AXJA 1NK9A 2J9DA 4QWCA 4R8UA 3O1LA 1RYSA 1RLCL 4Q45A 2HZVA 1RHMB 5E5NA 2YBVA 3NEKA 4UTGA 4MIBA 3VGTA 2YX1A 1KQGB 3K8WA 1TL4A 1CG2A 3ZZTA 4WK3A 4KAIA 1N33J 3I56S 4LF4F 4U8YA 1RAJA 3P8BB 3KJNB 4UZBA 4FDFA 2Q66A 1Q78A 3TUJC 1XMBA 2RUSA 4LJMA 4WFBQ 1CEZA 4PAAA 3OPKA 4CNZA 2HRTA 4RW4B 4KHRA 4JI2F 1NK4A 3DRXA 1RHQB 5FLXU 3IG1B 1U6FA 2HBQB 1FRIA 2AJQA 2FHKA 2YNFA 4JI3F 3NOGA 2XSFA 1VQ9S 2CJXB 3ZZPA 3KUGA 3FJ2A 4JYAF 1SJFA 2YWWA 1P1LA 5GAGI 1EARA 3IXQA 3ZZYA 3UDVA 3THPA 1S9GA 2DGVA 1H2VZ 4B9SA 5EX3A 3MEKA 4PRFA 4Y34A 5HSPA 2AEFA 4I2PB 1UWBA 1BD6A 2VBZA 3AXMA 2QLWA 2ZZNA 3PM9A 2HGNA 4QR1A 1GXTA 1KFDA 3MMCB 1RTJA 2PI5A 4YOEA 3IWLA 3CUNA 3ZZ0A 1ZA2B 3FBBA 3DRPB 1FTRA 3J81U 1U25A 1FD8A 1SKUB 3EYZA 4Z7YA 1QTNB 3IC1A 5DZ6A 1Y5LB 4H4KC 5KT7A 4KO0B 2QA4G 2VF3A 1JXEA 1UEKA 1EJ7L 2MGZA 1RQ0A 2V8DA 4B3MF 2RB7A 1JLCA 5KFJA 2UVRA 1IBKJ 3I0SA 3QGGA 3DRSB 3BO4A 3BEGB 1RE1B 3T5JA 1S76D 2WAQD 3R6LB 2BJ3A 1EETB 1GMWA 5C2GA 3GJRB 2DIUA 4C9DA 1WSVA 2HBYB 5J2QB 5HROA 4IOBA 5C42A 3DOMB 4UY85 2MKCA 1TVRB 1CJTA 3TARA 2FJBB 3TA0A 1UVNA 4W92B 5DJBA 4ZJLA 4LRAA 3U1NA 1HL6A 2XCPA 4MKBA 4PXEA 4OIXA 5H9FJ 3C6UB 3HKZD 4PG8A 3KLHA 3SV3A 5A8WA 3UN2A 1GMVA 4JI6J 5KG1A 2HHXA 1S59A 3GU0A 4ECSA 4DFMA 2CFXA 2AKWB 2NSCA 3I87A 3GMGA 1XIQA 4IOAQ 3QWUA 2PD1A 4RNNA 5CYMA 5BXIA 5E33A 1MWYA 2MHNA 3B4DA 2UUBJ 2FY8A 1RISA 4FVCA 3CJ8A 4NLXA 3DLKB 2XG8A 4M1KA 2J7UA 2L3MA 4LF7F 2R7OA 3LP2A 1RADB 3T5LA 2KKHA 2ZDOA 2L9NA 4B9TA 1RTHB 2XMUA 3CCSS 2FJXA 1FEHA 4TYAA 1T9XA 4TQRA 4RW7B 3BZQA 2CQHA 1HHQA 2FVRA 2C3PA 2MHEA 3MR3A 4OLOA 3M30A 3KYLA 4URGA 2HQCA 1TUGB 4ZP8A 3ITHA 2DGSA 1D8YA 2CJAA 4ZITA 2B56A 1N32F 4I64A 2GS8A 3PJWA 5KFVA 4LFBF 3HO1A 5IT0A 3MCSA 2Z2MA 2X3DA 4I0WA 3TQEA 4ZMMA 3LPEA 5IXUA 1N5YB 1VHFA 4MIAA 1RA7A 4NYOA 3LH2S 4G1PA 2XQCA 3CTRA 2AZ3A 3OLAA 4DCOB 3DHWC 3KK1A 4DX7A 1IR1A 1NSQA 2BE7D 2C22A 1T05A 2DRBA 4CLSA 4GVBB 1UPMB 2E1AA 3D28A 1RT1B 3HZGA 3R1HA 4FF1A 4DL5A 1N88A 2YKMA 2RS8A 4JI5J 2WVEA 4DV3F 1L3SA 4NCGA 4GRSA 1N6QB 5M2PA 4QIVA 6AT1B 3QNWB 4EK2A 2WW8A 2N3OA 4CLTA 5JUMA 1ZM4A 3HJFA 3R2CJ 5BYRA 5HK4A 2LQ8A 1Y4ZB 3PVXA 1WD6A 1ZBTA 5DG8A 1DJ0A 1VQ5S 3K5PA 2QO3A 1UPPA 2MKSA 3PIOQ 3W8PA 3TUIC 3OSNA 2QC3A 3FBFA 4RW6A 2HNYB 1FE4A 3V4IA 4F4KA 4FF4A 4LR9A 3H2UB 1KTQA 5KFUA 3AAWB 4F0HA 1VMBA 2DRDA 4DR3J 3BO2A 2FYXA 4JOUA 3ADAC 1SQGA 3JAMY 4BDPA 1HNZF 4H4MA 3VAGA 5KG5A 3RR8A 4RUCA 2ZC3A 1Q8KA 3K5MA 1KDNA 2QA1A 5IWAJ 2BBEA 3PCOB 3R5GA 3FKBA 2C2EA 1NM2A 2J7KA 3Q22A 4FS2A 3PYEA 1L3TA 4K7QA 2R7TA 4M5DB 2CZVC 2ZOFA 5K8OA 1YTYA 3QIPA 3G82A 3D54A 4NMXA 3QGPA 1DHMA 5A0YB 4TLRA 3EVWA 1MROA 2OEKA 3FGVA 5LM7E 5KG6A 3IR7B 3GFHA 2AX1A 2GIQA 1JMTA 5KFBA 2GCFA 1W26A 2IA6A 5IM0B 5DQHA 1HW8A 3NS6A 1QVFR 1HI1A 3R7NB 4WYLA 2GO9A 2CQGA 3BR8A 5MAOA 1ACMB 2E5HA 2RF2A 4B9MA 2LMIA 1XJWB 5AXNA 1N8RT 3TEGA 3W8GA 1U1QA 5EWEA 3CGIA 3MAHA 4P7VA 4LFAJ 3GONA 5GVQA 2J0QD 1X4AA 3WZ0A 1N56A 5HBMA 2VONA 4DBQA 4WE1A 2E5JA 4MT1A 3K57A 2J6TA 2M52A 3MCMA 2G2YA 2QYCA 3W2VA 2QMWA 5HJYA 3I9V9 3BPDA 3QZ7A 4PABA 3M8PB 1AYEA 3HT0A 1VQOS 4B9UA 5KFGA 4I7FA 2YXLA 3IM9A 2HFZA 3SQGA 1Q8IA 1SIZA 4KH0B 3AB2B 3N6NA 3B6BA 3W9JA 3M9OB 5B0GA 4E2FB 1RHRB 4OHZA 2YPYA 2XTJP 4C8ZA 5KFMA 4NLQA 4LIRA 2GW8A 2FJWA 2CPIA 4QYZJ 3ET6A 4ETZA 3JS9A 4EYIB 2PEHA 3QBCA 1IBLF 2W9BA 1FD2A 4URQU 2Y1LB 1LXNA 4NPOA 1JLFB 2D1CA 1S6QA 4DG1A 1S4EA 1S12A 3GE9A 4V19X 1T94A 1E6YB 2FLNA 1U49A 4RZRA 4CDIA 1Z2ZA 1Q82T 5GAHI 3BR9A 5KG0A 3R1LA 4WPAA 4ANEA 5ETRA 2ZE2A 1VR6A 2AYBA 2OAUA 2PMWA 1ZS6A 3KLFB 3ZTOA 5IT4A 1VK8A 3IGNA 3TJAA 2VL1A 2CPFA 2V8GA 2BW2A 3SCKE 4PQUA 2D69A 4M5HA 3SQOP 4O44B 2JC0A 2W2NP 3MXHP 4NI2A 3A3NB 2DY9A 2XY6A 3MR2A 3J80U 2GJIA 4ZPBA 3N4WA 5C2CA 3A8EA 1EQ0A 1QAJA 3OVBA 3QRQA 2NCKL 3K17A 3HVTB 3R5DA 1UFWA 3RB3A 2GVDB 1TL7A 3QAEA 1A6LA 3RTVA 4NLYA 4ZVGA 5L1JA 4I6AA 1DAXA 5DS7A 1S99A 4ER8A 1XNRJ 1EP4A 1S1TA 4DSIA 2V68A 3V4MA 3ILOA 4DUZJ 4HH1A 2VFRA 5CYQB 1VIXA 1RK8A 3OHAA 3HHLA 4ZVRB 2G0JA 4M5JA 2JLGA 2YQ0A 3MOZA 3GJTB 5L38A 3AHPA 1F5BA 4WTOB 3VZHA 2JZ5A 4YHHJ 4DSFA 3T9NA 2FVPA 1UCNA 4MFBB 5M2RA 2U2FA 3MEGB 2CJKA 2F4VF 2K8GA 2R2SA 3TWZA 2W1BA 3TZYA 5CA5A 3ZTRA 3N79A 2WVFA 1RCOB 4EMDA 1P9QC 1DLOB 3M8PA 1YDLA 3MPWA 4D3GA 4FXWA 4JV2A 3CWJA 4DR5F 1G2EA 4F3OA 1QAYA 2KM8B 2COLA 5U47A 4ECWA 2QG9B 3ENWA 4QWEA 3U1MA 2RILA 2UUAJ 4P74A 3H98A 1H73A 1CJVA 2F8EX 4ED1A 2FVQA 3QJPA 1DBDA 4X65F 2NSBA 9RUBA 2AT1B 2IFXA 3GCWP 3MUVP 4X4RA 3CC4S 3GR0A 3KLIA 1KC8T 3CC7S 3AXKA 2JVRA 4RNMA 1X9WA 1RTDA 2I5JA 1S6UA 2XBPA 2DR8A 2CQ3A 4KV8B 4BWJA 2V9KA 4DX5A 1WF2A 1WHYA 4C8MA 5D4NA 3V81A 4USKA 3VAFA 4UY8T 4HVZA 3PYGA 3DGPB 4OI2A 1U8WA 3R7SB 1Q8LA 2BRLA 3GFZA 2FVSA 4C8KA 2CZ4A 3M8ZA 3WQPA 3I32A 3DDIA 3SMZA 2C28A 1WTFA 3QRPA 4J9OA 4KH1B 1MWQA 1X7VA 3VCDA 2MJUA 2W25A 5I3UB 2A10A 3EVMA 3QQCD 1SUQB 2B8QA 1Q4RA 2G0CA 1VBKA 3J7AN 2HYIB 2AEJA 5HL7Q 2YWHA 4WCEQ 2DH9A 4JI0J 5K8PA 4FYWB 5EWFA 1M0SA 2RDJA 3DOLA 4AYBD 2IBKA 1U7LA 1FO1A 5KFQA 1TKZB 1R8PA 2MQNA 1EKSA 3HVTA 5DQIA 3US5A 2MSSA 2OEMA 1IKXB 1Q5YA 3MEDB 1W2BR 4ZLPA 1WG5A 1FJ7A 1VDHA 4F4ZA 3HVAA 2UXBF 3IMQJ 2FHJA 1HQEB 4JI4J 1C1CB 2VFTA 4HEA9 3IRWP 2P6SA 1K1SA 4OZ0A 1X4GA 5F9NA 3CD5A 4USTA 3EGVA 4M5MA 1VLYA 2O5DA 4V19J 2BYCA 2Z8QA 4K4TA 1TKTB 4WIQA 2AV5A 4DN0A 4ZPTR 3EUNA 2PFDA 1F60B 4XAKA 4DMZA 1QY7A 3C8YA 2RKIB 4A8KA 4Y2MA 4B9LA 2EKNA 4C48A 2ASJA 1NK5A 4IDKB 1DTQB 4NMLA 3BN7A 3ZTQA 1S0VA 3Q24A 2B7BB 2JC1A 3J7Z5 3VGVA 4BLGA 1NHVA 3EPIA 4CZCA 3OL8A 4ENOA 1UP1A 3LGNA 2POKA 4PUOA 4CTAB 3OVAA 4ES1A 3HSGA 2LU2A 3Q86A 1LQ9A 2MQ8A 2WTFA 1HNWJ 1PBUA 3C19A 3UR0A 1J5OB 3G8TA 5B0EA 4KV8A 3T3FA 4HHUA 1HWLA 4LRDA 4Q44A 3IO1A 4JI8F 1A9NB 3RB6A 3BM7A 1OY6A 3OFHA 1FNMA 2GNKA 3JXOA 3UW1A 3M6XA 1P6TA 1K47A 3LWMA 1R89A 2YWEA 1FX4A 5KFPA 4NA2A 1FNXH 5D77A 4JI1F 2OD4A 2OD6A 1PSDA 2RHQB 4NLDA 3OL7A 2OPSA 4XTTA 3PACA 4KFBA 5F8LA 3T6BA 2AJ1A 1TAUA 3PW7A 3MTJA 3NS5A 1RZMA 1JLAA 5J2MB 2DNQA 3KHGA 3JTOA 3MHYA 1RHUB 3E3XA 2GHWA 4MKAA 3BBFA 5KFFA 1Y3KA 3Q83A 1NKBA 1YZ6A 3RBDA 3N5BA 4JV5J 3PJ9A 1FRMA 5JMNA 2LVWA 2CG8A 2ZH9A 1RU2A 3H59A 2OJ3A 4TY9A 3VZIA 2CVEA 4IYQA 1T9VA 3NNCA 5IT9Y 4K4XA 1FKPA 3PW2A 2QE5A 1VBZA 1KLMB 1VQ8S 2W2OP 4TY8A 4DSEA 4DL6A 1XNQJ 2W9CB 4WFZA 5FDLB 2WB4A 4AQYF 2QLXA 3CDEA 2D74B 5F41A 4OJGA 1W2IA 3CDAA 4USJC 3KLEB 4A8XA 1FVQA 2P2CB 2BVZA 5LJ5Y 3B8HA 5B7WA 4OI3A 2R7SA 2R2RA 3EE3A 3FCVA 3LOUA 5D0HA 3PIPQ 2K3IA 1LWEA 3NNAA 1LWCB 1DTQA 2SXLA 3KG0A 4X4OA 1NMEB 2B4PA 4KGMA 1ZYQA 3QO9B 5H9FK 1IBMF 1PO6A 4CO2A 1TK0A 7FDRA 1A7GE 4WFXA 3V5RA 1VCTA 5B08A 1SBRA 3UD3P 3TI0A 2ILYA 2FJEB 3CJSA 3UWTA 3VWSA 3BKUA 2HVDA 1VIOA 3GILA 3B78A 3H42A 3D3CJ 1RI7A 1K73T 3VAJA 5DDQC 1D09B 1JB0C 5J1EB 3NGDA 1JLGB 3MR6A 4DSLA 4CLYA 3RRGA 3GIRA 1SKSA 1FVSA 2B4VA 1YJ7A 3BQ2A 4WBFA 4TKTA 1AFJA 3FDSA 3ZXWA 2CVIA 1H74A 4U6PA 3HSZA 2NUHA 2HVIA 2WVDA 6FD1A 2QLBB 5DLFA 4QZVB 3UNGC 1V5VA 5BYSA 2VIHA 1TELA 1Z2LA 4LF8J 3J81j 5GAEI 2JX2A 1RT4B 2R8IA 2LCWA 4A8WA 1KNZA 1FKOA 3SSSA 1Q79A 3I5CA 4X64J 4ID5A 2VC0A 1PCAA 4MYTA 4P2FA 4OJ1A 3F56A 3I82A 2MQQA 4QU6A 2D41A 1QAXA 1APSA 2AEMA 2IAJB 3P5TL 2ZH2A 3BBCA 3SI8A 3CVKA 4NE9C 2ZHBA 2LQBA 3MAAA 4Q8EA 4DLGA 3POTA 1NJWA 1QM9A 4JI7F 3LGMA 1KQSR 5D3GA 1TL3A 3NGSA 3KHHA 2E9TA 3D0IE 4FYVB 2DO0A 5ETQA 1U2FA 2DYAA 2B9YA 3FEYB 3SZ2A 1DTTB 2GGPB 4LT6A 1KLMA 3LALA 2ZEJA 2QL7B 1J5EJ 5HP1A 3W2WA 1WDDA 2P6TA 2W9CA 5GADU 4PG4A 5MLCV 5E3RA 1HR0F 2AGQA 4OYIA 3DN9A 3M2RA 3MFHA 3KJVB 5HMZA 5J2NB 3LPYA 4ED3A 2IMOA 2CPHA 1TK5A 1N5QA 1NSPA 2PE8A 3AFGA 1HWIA 3GG0A 4DR4J 2E9RX 2QYGA 1IM4A 4K4UA 2B51A 4PXBA 3AJDA 2FB0A 1Q81T 1WNEA 1NK7A 3DCAA 1SC1B 1T8EA 3NXZA 1UVJA 4C3KA 4QR2A 4NEYA 2WB1D 1XWLA 2KL8A 4ZCKA 3LANA 4IQMA 3R5CA 2A6MA 4IFVA 3W63A 2LDYA 1CS4B 1B4SA 2Q6BA 1M5VC 2WSCC 2VQFJ 4C0BA 1U1MA 1VQ6S 2EFNA 2FIUA 1O51A 3W5ZA 2FDNA 1X5TA 4YP3A 1VI7A 3PR5B 3HD1A 2AYEA 3CJRA 1TV6A 5F0UA 2R7QA 4LF9F 4TU9A 1U02A 2CPEA 3Q2SC 3FVYA 2VG5B 1YRTA 1HNVB 3D2WA 6FDRA 2HSEB 2V4JB 4F25A 1PG5B 3BSNA 1K44A 3VR1A 1MMLA 3TX0A 3D6TB 4NCAA 5C5JA 1WG4A 1B99A 3OXFA 1LOUA 5EN1A 3THVA 1YRUA 1T3OA 1UETA 3NMAA 4KC5A 3EGNA 1F3FA 2V8HA 2NXJA 1NH8A 2KG1A 5BR8J 4DL2A 2HQGA 1MU2A 3QIDA 2BUNA 3N28A 2RQMA 3TVYA 1R8HA 4F2SA 1NRKA 4DV4J 2VG7B 3ETOA 5D4PA 2ATCB 2WK4A 2HNDB 1LWFB 2GIRA 1FT8A 3OT9A 5LXRA 2DEIA 2R2TA 3CW2C 4IH5A 2XULA 4Q8FA 4BC9A 4MTPA 2WVCA 1TKXA 2GIFA 4Q0BB 1MWZA 2QIFA 1SVDA 4KHPF 1LFWA 1X9SA 4NXMJ 2LEBA 1ZH5A 1DTTA 4CT9A 3N6MA 1XTZA 4ALZA 2CWKA 2CPXA 2X1BA 1WC1A 2BOPA 3OSPA 1H38A 2QMUB 3BB5A 5CZXA 4LFCF 4QU7A 5D0EA 1YJVA 3W1YC 2WOMB 5A8KB 3KJVA 3OVSA 3CCES 3TUZC 2QFJA 3C66A 4LF6J 2V2ZA 3WC2A 2VFUA 3HFKA 3E01B 5HVHA 2F5GA 2LXFA 4FYXB 4LUBA 4DR1F 3VF0B 3QJLA 2AYMA 1OS5A 4USVA 1R0BG 4NLPA 2R4FA 4GKJJ 5C25A 2VQEF 3AJ1A 1RTIB 3H25A 4LBPA 1IBCB 2HHHJ 2ZBPA 3GTYX 1K1QA 3SFUA 3CE8A 4P10A 4O3QA 2JEGA 2GAGC 2IY5B 1GT8A 1GTHA 2ZM6J 2E1PA 4A8MP 3O6QA 3I0RA 4G1QA 2KFZA 2P9EA 1JLQB 3RJMB 3IBWA 2YQ1A 4WP9A 2VG5A 3KDNA 3U27A 1NDPA 1UMJA 4K5SA 2G9OA 1HNIA 2GMHA 1PYOB 3DRYA 4FN5A 1WOPA 1T9UA 3J7ZT 4B3RJ 1F2GA 3VQTA 4F02A 2QLFB 1JJCB 1BQNB 3M32B 3LP0A 3HJVA 3FC9A 1FWLA 4W98A 1XK8A 3L3CA 1FRJA 1MMNA 5K14B 2RQKA 3QSYB 2DGQA 1WEYA 4OYMA 2DRAA 4ECVA 5DG7A 3KLVA 3V6HA 1G1XA 3C6TB 4DF4A 4DJBA 1HKAA 3H5SA 2DHGA 3M8SA 1L3KA 2HNDA 4Q2MA 5LSOA 2FHOB 2B43A 1LW0B 3OTDA 4B08A 3HF5A 3MM8B 4MH8A 1F9HA 4OI6A 1CC8A 3BGLA 4DLEA 1NSKL 1S49A 2EBEA 2RS2A 3Q2TC 2ZC4A 1S0NA 1VYAA 4IG0A 3LWLA 4DV6F 3NAIA 5H9EJ 4MYUA 4ZCMA 4C2MA 1BY9A 3SIPB 4DV7J 1F2HA 3S6EA 2EFOA 1P27B 4KYZA 3GIKA 1IVZA 4UOGA 3MAQA 3BKFA 2D9PA 5T41A 2BW7A 4ZPDA 4ZIWA 2WOMA 4CLPA 1CSJA 4FNHA 4JB8B 5J1NA 5L9NA 3TAQA 4L75A 3MM9A 3W5XA 2E7VA 2HFSA 4X62F 1RCXB 3P4UB 4RNHA 3M6VA 3JQJA 2F1FA 2Y8WA 2PA8D 4WU2A 3ZZZA 3T1YJ 2FGOA 3DMJB 3JYTA 4F04B 3F73A 4J37A 2DR7A 4OHWA 1F5AA 5GMEA 4C97A 2HS4A 4YY3J 2DXEA 2Y9HA 1WC0A 5CD4H 5CYJA 4GKKF 1JLEA 1RTIA 2C2NA 1SV5A 2RQ4A 1C0UA 3AQOA 4U9RA 3QWPA 3GV8B 3T1HJ 4Q2LA 2XZWA 2ZHOA 4ED6A 4Y00A 3MMBB 2N4DA 1H7XA 3I5AA 1Q53A 2EG2A 4PWDA 4QIFA 5ADZA 5T7LB 1HNXJ 4ZOSA 1VQ7S 2W8KA 4DPOA 1VRTB 2RRBA 1WKLA 2GHVC 5A8RA 4K4ZA 1FRLA 4FXVA 2ABYA 2OPRA 4TVAB 2UV8G 2YH0A 4LREA 5KOWA 3EDRB 4YN3B 2JJ4D 1OIAA 3ZC4A 2IM2A 3I4HX 2QX0A 5DDRC 1U6BA 3UVJA 4OJHA 4B3OA 2EC2A 2Z58B 2EKYA 3PW4A 4DUYJ 3M8QB 4CO5A 2F63A 5J2PB 4ZP7A 4ICLB 4ZN3A 3BQ0A 1L3UA 2FZCB 3MECA 4M5IA 3WDOA 1I94J 2A2DA 4ECZA 1RABB 3UR3C 4CO1A 3N01A 1H98A 2CUYA 2GA7A 4WWSA 3FCWA 3LW5C 2A2CA 3W61A 4DQIA 3PV8A 1U24A 3WHIA 1R43A 4DZ6A 5DO2A 1M5KC 1XR7A 3FEZA 3GIJA 2ZUAA 1Y3JA 5E3AA 1RA6A 3WX4A 1UVMA 3B54A 4RUBA 1ZA1B 3D1OA 3KLGB 3DOKB 3BQ1A 3TVKA 3NRBA 1TMJA 4GC6A 1BC6A 4U8VA 4DS5A 2H65B 2OIHA 1U09A 2KTQA 1AZSB 4ZJQA 2H5IB 2CQ4A 5DGBA 3G8SA 2NZ4A 1HBOA 1BGXT 1HHTP 1WEZA 1S1VA 4PQAA 2O66A 1RWUA 2CQBA 3MM6A 5CABA 4IOCQ 3CJ5A 2Q1LA 2ASLA 1RT6A 4DQQA 2BV3A 2XYHB 5EWGA 1O8BA 5F8MA 3CF5Q 3FSXA 4OX7A 4EFAC 3MI7X 4ILRA 3RAXA 2XWXA 2PI4A 2EFPA 5ETLA 3EZ5A 4FKXA 4N77A 2WHOA 1Y5IB 1EIYB 3LF0A 3QZ8A 1LKZA 4HI1A 2BJ9A 5KFAA 1YJ9S 4HHHA 1YITS 1IKVB 4IH6A 3DI6B 2VKZG 3AOAA 2HK2A 5HMYA 2IRYA 3VQSA 1S6PA 2FPHX 3H2VE 3BSOA 4NZ6A 4K0KJ 3IWNC 5HLFA 2HHQA 4ELTA 3DM2A 2A3JA 1RT7B 4DX6A 2VJVA 1X4DA 3SCJE 3PXGa 3ELHA 1MLAA 1Y5NB 1S7IA 4N7TA 5I42B 2RVJA 3H5XA 1KHWA 5G0RB 1YWXA 5A6WA 2KHCA 1KVKA 1RAAB 3WIVA 3AD7C 2E29A 3K7RA 1HBNA 1QTMA 5IC4B 1QE1B 4C4WA 5D0GA 4EZ9A 4IUFA 4OMFG 3DYAA 1IJFB 3SYZA 2OPQB 1S1WA 5BYQA 1O0PA 4DR6F 2V63A 2HNZB 3EDQB 1XNRF 4HTIA 2KRBA 3PW5A 2BQUA 4B3MJ 4ZPAA 2RIJA 3AJ2A 2HRUA 4UUWA 2XGQA 3HP6A 2MY7A 3DLEA 4FNIA 3MM7A 2G1HA 1FRHA 1NB2A 4NA1A 2DO4A 3EZUA 2Z4PA 3QT5A 2H1YA 1EAYC 3G6ES 4X4NA 4WXWA 4ECTA 2HS0A 4YHHF 2XY5A 2FJDB 3PDNA 1NBEB 1OYDA 3RGIA 1VQ4S 1WELA 2V4RA 2L08A 2Y0BB 2U1AA 3OL9A 3GIMA 1FX2A 2BKNA 2XI2A 2DB1A 4IR1A 4DI6A 1L5UA 1S9EB 4YB1P 2HHSA 3ISZA 2Q79A 1E6VB 3CSKA 2GC8A 3IP0A 3CD6S 2ZH7A 3ENAA 2R8JA 4XO0A 4OZ2A 4HHJA 4H54A 4YB7A 4A46A 1X5SA 9ATCB 4A4JA 1PJ5A 1UEUA 4BCAA 2R7XA 2XGPA 2IJRA 2CPDA 2HPUA 1HWUA 3KNAA 4KBIA 5JJBA 3OR2A 1S97A 1KLNA 1RHKB 5I4MA 2XHWA 2GMJA 2C2KB 4FPRA 2GHPA 3BO3A 2GAHC 2QL5B 4IFYA 2BQRA 1YSJA 3AODA 2ALZA 2IJFA 4ILLA 4J9RA 3U7JA 2J0XA 1EZZB 2HEKA 3TW0A 1Z4UA 3BJYA 2ZUGA 2BQ3A 3DI6A 1URRA 2ZWPA 4BS2A 4IR9A 3B82A 3UCZP 5KFIA 2Y1JA 2IRUA 2LXUA 3DDKA 1VC6A 1K0VA 1YX2A 3OV7A 2HHTA 2B6AA 2ACMA 2CADA 1NJYA 1S1XA 2YNFB 4QQBA 4JI0F 3C2PA 2MEWA 4CCHA 3MMAA 1ZM3A 1GXLA 2WSEC 4M5GA 1QE1A 1B70B 2DR9A 1FXDA 5AJ3F 2E9ZA 3EXCX 1S9GB 1X60A 2MDAA 4DF8A 1NAQA 2OPQA 3KK3A 1NPKA 4EBEA 2XB2D 1UWBB 3NMRA 2HZAA 1NUEA 4K4YA 1F9FA 2DNPA 4ECXA 2JLFA 3NBPA 1YLXA 1RWWB 1RTJB 3CCTA 1DQ9A 5B0DA 3UD5A 3AD9C 3CCMS 1X4BA 3T41A 4P2XA 4DV3J 4NLTA 1S0OA 4ITSA 2HVEA 2QV6A 3NS7B 3OD2A 2VOOA 2K7KA 3GCXP 2J0WA 4E0DA 3SCLE 1M1KT 4J9LA 1JLCB 4K2XA 3W62A 4DFJA 3A1YG 3I0SB 3BGRA 1S9EA 2G2OA 3TEHB 5KT3A 2W7AA 4Y65A 3K5OA 3OL6A 4WZMA 5HROB 5D0RA 5ETNA 2BEFA 2L9WA 5C42B 1CJTB 4I6YA 1YJNS 2X1FA 4GC7A 5HQLA 1SL2A 4ED4A 3GJQB 3LUYA 3O2IA 2YKNA 4OYPA 4MK8A 1TUVA 2AJ2A 5L8RC 2RHSB 2Z2LA 5CHCB 1GMWD 2N4CA 3R9LA 2UZAA 3EPGA 3VAMA 4P75A 3KLHB 3H4DA 2F9JA 5A8WB 2Q3PA 5SUHA 5HVFA 2G1DA 2VPXB 1HPZA 2V4QA 2HQIA 2C2MB 3LAKA 2KXFA 1S72S 1S48A 1SC4B 3I31A 3Q0AA 1OQ6A 3KHRA 2IMWP 4I69A 2HAFA 1C1BA 4NASA 5B0CA 1RWVB 1VQYA 3M2UA 2AJ0A 3HVWA 3P5BP 5CYMB 2YWGA 1PILA 4IRCA 3L7PA 2DK2A 2R9LA 5FD1A 3VHQA 2BABA 2FGCA 3A8KA 4LQ9A 1IKWA 3TJ8A 2MLYA 2WW4A 4P73A 2UU9F 1TFWA 4R0JA 1SC3B 3OFFA 4QYRA 1YIJS 4OI1A 4XPEA 3BN4A 3PX6A 3LP2B 3H5YA 1XBWA 3ULHA 2YNGA 1U1PA 1R6YA 4CM0A 1ELOA 4JP8A 3VAHA 5K8MA 2XMMA 5IS2A 2PT0A 4OV6A 4RWWA 3M30B 4MMOA 2E5LJ 4B3SJ 5K9FA 3P49B 3HVRA 3ITHB 2V50A 4CLWA 1JXVA 3DXSX 1DURA 2JH3A 1LK5A 1F3VA 1G3OA 2NXNA 5AXLA 4X2BA 1PAUB 4FZVA 1UA1A 1RHJB 1WWHA 2AD9A 4ZVUB 1DFDA 1XNQF 5T14A 1Y00A 4J9NA 3CCJS 1KVJA 3KK1B 4IRKA 2X3GA 1T05B 4O4RA 4P52A 2LA4A 1WC5A 3A4TA 4DQRA 5HVGA 4F67A 4YEAA 2LEPA 4HT5A 1P1TA 2V94A 1U1NA 3GZ7A 1AB8A 2YKMB 5KFSA 2VBYA 3MD1A 2KXHA 2MQLA 4OZ5A 4NCGB 4UOCA 2XLIA 2AX0A 1FCAA 1IBLJ 2C3UA 3D9BA 4IO9Q 3KJQB 1H0HB 4AD6A 1R6VA 1RAHB 1JLBA 2CQDA 2AJFE 2YX4A 2A0FB 4H4OA 3UN3A 2MTLA 3BREA 1YRXA 4KGVB 2E5IA 4KJIA 4C3MA 1SJ1A 1VLOA 2BX6A 3HULA 1N0UA 1LEOA 3MWBA 4EU0A 2ALYB 4RW6B 1SH2A 3MM5A 3V4IB 1C0TA 1V5IB 1FK9A 4G1IA 4MK7A 3N9UC 2AWZA 3KWMA 5JXSA 2P5VA 4RW9A 1Y10A 1UL3A 2OO4A 3NNHA 4MAKA 2CG4A 3M8RA 4CLFA 4O3RA 1CVJA 3L09A 1J27A 3TX8A 3PW0A 4H4MB 1T9TA 3J7YU 3DLHA 3E51A 3OTEA 4W90B 2IM0A 4X64F 2XMKA 1BQMA 1RWKB 4U96A 4RBTA 4ECUA 1RAGB 3GSDA 2BANA 2MY8A 4A8SA 1HYSA 1EKRA 3TA1A 3CDBA 4OHYA 2K1RB 1VRUA 1REVA 3UFCX 1X31C 3QIPB 2WVBA 3C15A 3G82B 1SJQA 1R0AB 4EO6A 4R5PA 1T9WA 4ZVFA 1MROB 2FLLA 4NXNJ 1M5PC 3JTPA 5H1SV 5LXYA 3NGKA 2CKWA 2KT5A 4RBVA 1B0PA 3BPSP 2OSQA 2XC9A 2M8HA 3RUBL 2RF2B 5H9EK 2UXDF 2CNLB 2CQCA 4X66J 4PKDB 4DV0F 2OTJS 3QLHA 1RACB 2QGFB 3ZTPA 4CNYA 5D4LA 2V69A 1JKHA 2ZHAA 4KB7A 3D5MA 4ZIVA 3CJKA 4DR5J 2E44A 5HBMB 2C2ZB 2FZGB 3IFEA 1M5OC 4WE1B 1U0HA 1RT3A 1NEEA 1OPZA 1LW2A 4GMKA 1Q5VA 4PEOA 3W2VB 1WHXA 3KOAA 2HG4A 1S1UB 4CLUA 4RNOA 2YNHA 2DY1A 5EX0A 4X65J 4YR0A 2OELA 4I7FB 4RW8B 3SQGB 4DV1F 1IKYA 3M6WA 4DV2F 3TP2A 2DH8A 5IV3A 4ZVHA 1RWXB 2PEBA 3WC0A 3GSIA 2ZBCA 2M8DB 1YGYA 4QIGA 3G8QA 2VQFF 3ET6B 2AIRB 5AXKA 4HACA 4CP5A 2DIVA 3EX7B 2Z2ZA 2EPIA 3RW6A 1CULB 4TLQA 5JVGQ 1Q95G 2CQ1A 3LP1A 2W9BB 2BE2A 3CCZA 3E2EA 1S6QB 4DG1B 3KDOA 3GYGA 3T1AA 1RYRA 1RDRA 4FS1A 2DISA 1YBAA 1GEHA 1N36F 3P45B 3K8VA 2ZE2B 3D1QA 5GMDA 3B4MA 4GO7X 1BQXA 3PG9A 4ZVQB 3MEEA 1HARA 5LT5A 2VB6A 1RXOB 2HMIB 3D67A 2HQFA 1NB7A 4CO3A 4PQUB 1OYEA 5BR8F 1ZAXA 2GQ2A 1U1KA 1B0VA 5ETMA 1HBUA 4NI2B 2BZ2A 2K1RA 2UXCF 3FMWA 1Y9OA 4DV4F 4BHQA 2UXBJ 4DFKA 2CRLA 1ZPWX 2HVZA 2CYYA 2OPPA 4B3TJ 2RQCA 1R0AA 1CJKA 2H9ZA 1NHUA 3MPUB 1M1HA 1I1GA 3QAUA 2Y8YA 1UJ6A 3ONQA 2VJUA 4K4VA 2PFFB 1TL7B 2MQPA 1RWNB 2VG6A 3FSIA 4K4SA 2DNMA 1MN7A 4BC7A 2B9EA 3CO9A 2NZCA 4Z2XA 4NXMF 3T5HA 5HATA 1EP4B 1S1TB 1P8GA 4PG5A 2JSXA 2ZOGA 2X1GA 4PCQA 5KT4A 5FLXY 1FDNA 3MUMP 3HHLB 4QOTA 2KFYA 2OFHX 1JX4A 4KGKA 3BGFA 2G2ZA 1IQZA 3RZAA 2DGWA 3JTNA 3RW7A 2UUCF 2FTRA 4N76A 2WSFC 3V2UC 1I3OB 1S1UA 4PXCA 4OYBA 2BM1A 1WEXA 3I5BA 1S9FA 3HHLD 3JSRA 3BGOP 4Q5VA 1FWPA 2DPIA 4YR3A 5L1LA 5KFZA 4NL5A 1Q7LB 4M5KA 5KG4A 1N34J 1BWEA 5C24B 2YY3A 2HQDA 4RW8A 2LECA 4GO5X 3TA2A 1FEEA 1UWAA 1ZAVA 2ZD1A 3R6GB 2QJ3A 4DCJB 2W2PP 2B0GA 4GKJF 3CMQA 3RB4A 3OBIA 2XMAA 5GAEU 2HAIA 5KAKA 2KFNA 3CXCR 3H0PA 2QN6B 2GX8A 2VKRA 3V6DB 1FWKA 2F3JA 2BACA 2FLOA 1CJVB 3J81Y 3RAMA 1HBMB 1JJ2R 5F0WA 5ETVA 2KYZA 4ZPWR 3CCRS 4U95A 2ROEA 2XMVA 1PYTA 2VPWB 3KLIB 1CULA 1RBAA 1RTDB 2I5JB 2FUG9 1HHSA 4CO4A 2N82B 3DRRB 3DLGA 5B0FA 1CJUB 2B4OA 4FBUA 3MTKA 3ZZRA 2KVIA 3PKMA 5DM7Q 1TQLA 1TZ0A 3IAM9 2W4DA 3V81B 3RBZA 1R8CA 1KP6A 2XLKA 1NH7A 4WFAQ 4NLRA 2OKQA 1AA1B 2PIIA 2KZMA 1X4HA 5DG9A 5F9LA 4JV1A 3BYRA 4KPYA 2HMIA 5G4DA 1GH8A 1UFLA 2J7WA 4OZJA 1TKDA 4QIEA 1WC6A 2J8SA 2D7SA 3HHNB 1HLWA 5AT1B 5F8NA 2EEYA 3CMAS 5K20B 5CD4A 3FK4A 2DHHA 3TAPA 3DOLB 1N0VC 1HQUA 3ISND 2JEFA 2EFQA 1RAIB 3MCOA 5KFOA 2K2PA 4AQYJ 4NLWA 4NLSA 3KJFB 4FYDA 1KEKA 3A3PB 2YKAA 2V0NA 2XS2A 1N4LA 1YKWA 1FI4A 1U1RA 3SDEA 3W3SA 2R7WA 3MCNA 1EB0A 1G4CA 2RMLA 2UVWA 2BA9A 4ID8A 2R8HA 4Y6IA 3BH7B 2CZ9A 2FHJD 2H4WB 3T1YF 2HRYA 3Q8QB 4TQSA 1XMOJ 3FZBA 3HD2A 4LVOP 4IG3A 2PC6A 4LSLB 5C24A 4O23A 5CCLA 1PAEX 3P3DA 1UVLA 3FMBA 3KG4A 1Q0NA 4B17A 4TU7A 2J0SD 5LSLA 3HHEA 1VHIA 3IRXA 2ZBQA 3MF5A 2RSQA 2ZFHA 2WBMA 4DXLA 2QFIA 1G6BA 4U7CA 5DZ7A 4WKYA 2F4FA 4X4PA 3V6DA 3H4BA 1NDCA 1TP7A 4PUOB 1UKUA 1HBMA 2ILZA 4YDDB 1JJ4A 1H2UX 4LF5J 3KNGA 2OGUA 2O3DA 3DLJA 3DRRA 4M94A 3DGVA 1NDKA 3H90A 2W9AA 1CJUA 2KJWA 2R8KA 2I1RA 2BJ1A 5HI7A 4U67Q 1GXUA 1X5OA 3IS9A 3UPFA 4IO1A 1VQPS 1D1UA 1VJWA 1FNOA 3FQLA 4YS2A 4DR2J 5CQGA 3EZOA 3M9MB 3CIMA 4DHVA 5KTQA 5IQ6A 1X4CA 1RGVA 1WUUA 3MZIA 3NL0A 2KU7A 2OMOA 3HFVA 5KFHA 2GVZA 3HHLC 5LMNF 3AQPA 2IBOA 4WFYA 3KUEA 2NPIA 4KKOA 4WK1A 2HFUA 2BKOA 3T9ZA 4PPDA 3FFIA 4U7UD 1NKCA 2K3KA 2OPSB 4KFBB 2AYGA 2F9DA 2NR0A 4M95A 5D78A 1JLAB 3D0GE 4ZHRB 2QA4S 5J1PA 4PR6A 1TMMA 2CJBA 2DTJA 1HD1A 4LF1A 4RPFA 2ZH1A 2UVVA 1U4BA 2NREA 4WU3A 3HKWA 3UCGA 3VV2B 3O44A 3JAMU 1FKPB 2MZQA 4ZCIA 4QPTA 4O4GA 3JSMA 3CCQS 4TY8B 3N6LA 2Z56B 2KJVA 3R3TA 2JDJA 2NUUG 4DPYA 2YNIA 3F41A 1Y11A 2MKJA 1S7HA 4H4KA 4CLLA 1TR0A 3MUTP 1KKHA 1SH0A 1LWEB 2OFGX 4LSLA 3FEXB 2C1EB 2HHWA 1FJGJ 2BMBA 2JOQA 2CQIA 1FERA 1T02A 3OTOF 4LF9J 3R8YA 3ISNC 3OR1A 2RRNA 1R3NA 2UUTA 3FCHA 2XSJA 3GFXA 2LDIA 3NAHA 3RU0A 1WHWA 5DDOC 4LSNA 2ROGA 4ETXA 2ZH5A 2JVOA 3AOCA 4FKYA 2ASYA 1QSYA 4FF2A 4LQ3A 1Q16B 3FQKA 3K0JA 3AA9A 4K0KF 1SQFA 2CA9A 5E0OA 3HM9A 4TNOA 2H48B 1OWXA 2M5YA 4HT7A 2WONA 2LKZA 1VOMA 2LQ9A 1CQNA 1G7CB 1UJ4A 3G2XA 4EYHB 4C3LA 2E1MC 3QRRA 2YQ3A 4LSZB 2YKQA 4YFUA 1FKOB 2IRXA 1TL1A 2XZDB 4ID5B 1HI0P 5THWA 3CO0P 3SFGA 3H2LA 4XDDA 2VDIA 2E7XA 4PG7A 1D3WA 3H40A 3J7A1 4EZ6A 2HWIA 4WTYA 4KHPJ 2LLZA 2EFGA 2CNOB 3W60A 3PX4A 1QUVA 2FJAB 4ZHRA 3MAAB 1XERA 3POTB 2M3DA 4LFCJ 1XC9A 2KM8C 2MZTA 4A8QA 2EG1A 1HWKA 4CH1A 2KDOA 5D3GB 1TL3B 2MYFA 1AFIA 2Z2YB 1ZTTA 2DBBA 1ZZNA 3UNYA 4OX9F 4EUVA 4LRFA 4RJVA 1ZAWA 1F5CA 4HDGA 2DNKA 1D0EA 5KG7A 4DR1J 2RH3A 3PHTA 5HP1B 3W2WB 3TZXA 2WRMA 4LR8A 1KQKA 1WKJA 3L7UA 3SEOA 3J80Y 2CPZA 5KFNA 3I9ZA 2F8HA 5IV4A 4K59A 1WF1A 3M2RB 2Z0GA 2M4MA 3SSRA 4J9KA 2QRRA 1RWMB 1PJ6A 3UDCA 2VQEJ 4QIWD 4ED8A 3GLJA 3Q8PB 3KFWX 3LQVA 2CPYA 3NP5A 5B09A 1R27B 4PWWA 5EGYA 3PNIA 4TU8A 5FIIA 4WIIA 3L4BC 1NSAA 1SL0A 1NJZA 4K2JA 5E7OB 7AT1B 4Y3CA 4OYOA 4Y2KA 2LU1A 4CLKA 5CAAA 1B3TA 4JBCA 4PYAA 3HLUA 5HN0A 3TR5A 1BUXA 5A2QY 2M0GB 4M8LA 1LNQA 4OYXA 3G6YA 4IFVB 4USIA 4IRDA 4OX6A 2DNGA 4RW4A 4PG6A 1DARA 4RKUC 2PMHA 5HANA 3NCRA 1FDAA 2EXUA 2M9KA 3IG1A 1FDBA 2HIYA 1YJUA 3Q8YA 3H7HB 3G96A 2C2DA 5KFRA 1YHQS 1TV6B 4MIWA 5D4OA 1D9DA 4DR7F 3HX9A 2AJ4A 1VQKS 1NPPA 1N52B 3ZNJ1 3D7SB 3KXDA 2QEXS 2QT7A 2AP6A 3F44A 2EC0A 4I2PA 3D68A 1K0TA 4N56A 2GV1A 4C6AA 4DWIA 2MJNA 1IM6A 1V6HA 3MMCA 4F26A 3TZZA 2DITA 3HXMA 5D6GA 1KHVA 2ZOMA 1ZTWA 3QT6A 1QJHA 2YX7A 3DRPA 1T9YA 1MU2B 4F8RA 5KFDA 4DV6J 2VD3A 1N48A 4KO0A 4QPXA 3CCWA 5KFKA 1AT1B 3HFZB 5EDWA 2Q6CA 3AH6A 1IR2A 3CB4A 1RBLA 2FQQB 3C46A 4C11B 2F7VA 4LRBA 1M5SA 3DRSA 2VZ9A 1TKXB 4FBTA 5AE1A 3JQKA 1FKAF 2HS3A 1EETA 1TAQA 3ILIA 1NZAA 2CNNB 2NS1B 4X62J 5J2QA 4WJBA 2W7PA 2ZNZA 3DOMA 4AXIA 3DDNA 1TVRA 3CT9A 3CMES 2CIMA 2ZDPA 4FPIA 4O3NA 3X1LB 3EVOA 5AE3A 1M5HA 4WP8A 3R5AA 3PZPA 3C6UA 1YQHA 4I4BA 1KOOA 2KYXA 1SL1A 5E3PA 3HHKA 2AU0A 1FA0A 4GKKJ 4NLGA 4QCLA 2XO6A 3PR4A 2ADBA 2DNLA 2J9DE 4DV5F 2K7JA 5IZHA 3WBZA 2XCAA 5ETSA 5B0AA 3DU6A 4CRJA 1YJWS 1RU1A 1V3SA 4MJKA 2VPZB 3QT7A 3I6PA 4MKYA 1AXQA 3HK2A 2KG0A 3UDEA 5ETOA 3ZFVA 5E2QA 2ZH8A 2V8PA 5C25B 2O67A 3ZNUA 5ETTA 3OXLA 4IKAA 3DLKA 4P71A 5KFWA 1YBUA 3NGTA 2MZSA 1N33F 4QWAA 1NPRA 2UUWA 3RYLA 1RTHA 2DHSA 2V2KA 1RB0A 3KMSA 3OFGA 3I0RB 1NHKL 1NXIA 4G1QB 1RKJA 1S57A 4M5NA 2M70A 3C3LA 4RW7A 2D3UA 4E98A 1U1LA 4C8LA 3OLBA 3FRZA 4FF3A 1HNIB 4MK9A 1N5VA 4J9UE 2OI2A 2NYHA 5KFCA 4IQXA 3ENVA 1RT5B 2EI5A 2HFOA 1YVFA 2KXNB 3LP0B 4HDHA 2XMJA 3L9ZA 4A8FA 1TUWA 4OI0A 2H5EA 3U1LA 3ZZOA 3M4XA 1K8AT 1SJ4P 2BJEA 2W7OA 3PFEA 1N5YA 3D6FB 1GX5A 3ICLA 2E5LF 4B3SF 1W7WA 4DZDA 1Q8BA 3R7BB 4ANCA 1UW9A 4HH0A 3QFWA 1AROP 1IUJA 3UN5A 3NG8A 4UF4A 3H20A 3PEJA 4GVBA 3K89A 1UEVA 2ZJRQ 5DGAA 3TNVA 1RT1A 2RRAA 4C11A 2CJYB 3QGIA 2MMYA 2V2VA 2HZCA 1CPZA 2I9SA 3DFEA 4J90A 4OYZA 1N6QA 4IG0B 2NXUA 2RT3A 1FE0A 4OZ3A 2MKKA 4ANDA 1L3VA 2IC3B 2MKYA 3IWXA 3THTA 1EX8A 1IBKF 1U26A 4UT4A 1GK8A 1KFSA 1PC5A 1NNDA 3MM9B 4N8OA 4QWBA 1VRQC 2HNYA 3K59A 2N7YA 1QLNA 3OJSA 4AL7A 2ERRA 4CYUB 1H2TZ 2ZJPQ 1WSRA 1X5PA 2XI3A 3FZ2A 3JYTB 5HO4A 2R8GA 1XMQJ 1YG0A 3IR5B 4WKRA 1ROFA 1YJTA 3UD4P 2CJQA 4PZVA 4N41A 5ETKA 2JRSA 1JLEB 2P9GA 3OXGA 2EVZA 4NLVA 2EFVA 1MNEA 1SV5B 3RAQA 1C0UB 3M2VB 4EI2A 5KT2A 5IT9U 4JI6F 1JK9B 4HLBA 2DR5A 2NQPA 2ZVIA 1XN9A 1JIHA 3D66A 4M5DA 1Q1KA 1S77D 3VGSA 3CDUA 2GQCA 1FTCA 2IM3A 4DPTA 1JQGA 2DKOB 5KT5A 1OY9A 4ERDA 4ILMA 4EBDA 5KT6A 2AGPA 1T03B 4RO0A 2EWHA 4P6QA 4EO8A 5A0YA 4F3QA 5AXMA 3AT1B 2UUBF 3IR6B 1U47A 1OSDA 3OTCA 2KB2A 4PWDB 2J9EA 1GNKA 5CCMA 2VC1A 3TYTA 5IM0A 5A8RB 3HSDA 2RJZA 4YB6A 4O3PA 1DY3A 4GVLA 4DR6J 2OPRB 4C8OA 1RT5A 2DPJA 5FJ4A 1R8BA 3C14B 3EMTA 2HW3A 4Q43A 2DGTA 2V34A 4OFZA 1U48A 5AE2A 2J8AA 3R97A 3UVJB 5A2QU 4B3OB 4NXNF 3D6MB 3PRBA 5LMUJ 3KUHA 4F4YA 1XEZA 2IHR1 4ZJOA 2D3O1 5DQGA 3Q8VA 3MPYA 4EGLA 3MECB 5I3QA 2IDEA 1RT2B 4Q7AA 4BBYA 5LL6d 4X66F 4OLPA 4Y2AA 3TZWA 3ETMA 1U2CA 2LQ5A 4ATNA 1HIYA 3CJ4A 4NLOA 4F7VA 4OJ3A 8RUCA 2G0IA 3OHBA 5L46A 2XY7A 1SKWA 2BE9B 3DC2A 3PTWA 1S10A 2IC3A 5D8HB 5M2UA 2FC9A 2QL9B 1VBXA 4DSKA 4YQWA 1ZOTA 2H51B 2CQPA 2J9CA 2Z57B 4L72B 2NPFA 2F40A 4JI5F 3TOQA 2QSFA 5ITHA 1KTVA 3A12A 4J9QA 2OHDA 3IA0A 1HBOB 1JLFA 1GFWB 4CYUA 1S1VB 1S0MA 4ZN1A 2X51A 3BYPA 3F0NA 1E6YA 3MM6B 4O3OA 3G4SS 1UZHA 1RT6B 2HBRB 4OV1A 3CDWA 3D6HB 3HHDA 2W2MP 3KLFA 2D3ZA 3FRYA 3HT3A 4ZPVR 3G71S 3M2VA 5LSRA 5LOQA 2VH7A 4YUDA 1SI9A 3PRDA 5GAGU 3MPDA 4O44A 3RG6A 4FP9A 3RR7A 1KWMA 4ZVPB 3HZEA 2DXFA 2HFNA 5HMWA 2JHEA 2R3VA 4DR3F 4P2MA 1AW0A 1T03A 2FY1A 2FZKB 4EBCA 1S6PB 4QWDA 3HCXA 3O8WA 2YWKA 2J76E 5AJ3J 3ILJA 5HLFB 5IWAF 3C16B 2MKIA 3FSYA 3DM2B 4I68A 2GVDA 1TFYA 3QJJA 4C8YA 1QSLA 3J7YI 4YR2A 1N5TA 4JV0A 3GPAA 3ZZUA 3M7VA 1PIEA 3C14A 3GWCA 2R2UA 1UVIA 4OZLA 2QMXA 4B3TF 1VISA 1HBNB 5CYQA 2A1BA 1N5SA 5F8GA 3QGHA 4CM2A 3CEDA 4I67A 1U0SA 3DYAB 4I2QB 1S5ZA 1TU0B 2AHOB 4J9PA 2V2QA 1X4EA 1RUSA 1R31A 1T7PA 1S1WB 3KK2B 3UQSA 1I51B 3IAS9 1RT2A 4MFBA 3MEGA 1SB6A 3CD0A 3O5TB 1WG1A 4KTQA 4DX8H
chains in the Genus database with same CATH topology
1HW9A 2BZ2A 2K1RA 2UXCF 1DLOA 3V6KA 3Q2SC 1LK7A 3FVYA 4F4XA 2VG5B 4OZNA 1YRTA 2CQ2A 3FMWA 5F8HA 1Y9OA 4DV4F 1HNVB 2ROPA 1O5JA 3GYNA 4AXJA 3D2WA 4BHQA 2J9DA 6FDRA 2L9DA 4DFKA 1NK9A 1IQTA 2CRLA 1ZPWX 4QWCA 2V4JB 2HVZA 4LFAF 2CYYA 2OPPA 4R8UA 4F25A 2EK6A 3O1LA 1RYSA 3DLEB 2RQCA 3MM7B 2E5GA 3GQCA 3BSNA 1R0AA 2CJ9A 2H9ZA 1NHUA 3VR1A 4Q45A 1MMLA 1Z1ZA 5E5NA 4RUAA 4BWMA 4NCAA 4MIBA 5C5JA 1WG4A 1I1GA 2XS7A 2YX1A 3QAUA 3OXFA 1KQGB 3CJ2A 3K8WA 1LOUA 3KG1A 4UQGA 5F8IA 5EN1A 1UJ6A 3THVA 1TL4A 3ONQA 4K4VA 2PFFB 1CG2A 1YRUA 3ZZTA 1T3OA 2FC8A 1UETA 4KAIA 4WK3A 1M90T 3NMAA 4DL4A 2MQPA 2VG6A 1B64A 3FSIA 4KC5A 3EGNA 3L95X 3I56S 1VQSA 4LF4F 4K4SA 1RAJA 1FJEB 2V8HA 2DNMA 3SCIE 4BC7A 4A8YA 1NH8A 2IA0A 2Q66A 1Q78A 3CO9A 2KG1A 4DL2A 4Z2XA 3TUJC 4NXMF 1NU4A 3T5HA 1MU2A 1XMBA 1EP4B 3QIDA 1S1TB 2G4BA 2BUNA 3N28A 2RQMA 1P8GA 4PG5A 4LJMA 3TVYA 1N34F 4B02A 4WFBQ 1CEZA 1R8HA 2JSXA 4F2SA 3G6XA 3OPKA 1NRKA 2ZOGA 2X1GA 4CNZA 2VG7B 4PCQA 5KT4A 1VS3A 4RW4B 4KHRA 4JI2F 3ETOA 5FLXY 1FDNA 5D4PA 3MUMP 1NK4A 2WK4A 2HNDB 3HHLB 1LWFB 2GIRA 3DRXA 1FT8A 4QOTA 2DNYA 3UCUP 3R5BA 2KFYA 3IG1B 1U6FA 5LXRA 1FRIA 2OFHX 1JX4A 2AJQA 2FHKA 4KGKA 1VQLS 2R2TA 2YNFA 4IH5A 3BGFA 2XULA 1IQZA 4Q8FA 4BC9A 4MTPA 4F4WA 4JI3F 2XSFA 3RZAA 1VQ9S 1TKXA 3ZZPA 2DGWA 4Q0BB 1LFPA 3JTNA 3FJ2A 4JYAF 3K2YA 1MWZA 1SJFA 1ULRA 3RW7A 5GAGI 1P1LA 2UUCF 2FTRA 3SV4A 4N76A 2WSFC 3IXQA 1URNA 3DGPA 3V2UC 1KRPA 2GO8A 1TL5A 2QIFA 3RB0A 4KHPF 3OR2B 4PXCA 1S1UA 1LFWA 3ZZYA 2BM1A 1WEXA 3I5BA 4KT0C 3THPA 1S9FA 3HHLD 3JSRA 1S9GA 4Q5VA 2DGVA 2DPIA 1H2VZ 4YR3A 1X9SA 5L1LA 5KFZA 2LEBA 1ZH5A 1DTTA 4CT9A 4NL5A 5EX3A 4B9SA 1Q7LB 3N6MA 3MEKA 3S7RA 4DQSA 5KG4A 4PRFA 1XTZA 1BWEA 5C24B 2YY3A 4Y34A 4ALZA 4RW8A 2LECA 2CPXA 1KONA 2X1BA 3PFOA 4GO5X 4I2PB 4IFYB 3TA2A 4E8UA 1FEEA 2BOPA 1UWBA 1BD6A 1ZAVA 2ZD1A 2VBZA 5DLGA 3OSPA 4NX9A 2QLWA 2ZZNA 3PM9A 5I3UA 1H38A 3BB5A 2HGNA 5CZXA 4LFCF 2B0GA 4QR1A 2R7UA 4GKJF 4QU7A 3CPWR 1GXTA 3RB4A 2IVYA 1SUQA 3OBIA 1KFDA 1YJVA 5GAEU 2VASA 2D9OA 2WOMB 3MMCB 2HAIA 5A8KB 5KAKA 3CXCR 2KFNA 1RTJA 4DEZA 3KJVA 2PI5A 1R8AA 4YOEA 3OVSA 3CCES 2GX8A 2VKRA 1NJIT 3V6DB 3IWLA 3TUZC 3CUNA 2F3JA 2QFJA 2BACA 3C66A 3ZZ0A 2FLOA 3J81Y 1QVGR 3WC2A 3RAMA 2VFUA 3HFKA 3E01B 1HFEL 1HBMB 3DRPB 5KFTA 1JJ2R 3D0HE 1FTRA 5F0WA 1U25A 1BLUA 1FD8A 2AQ4A 2LXFA 1TKZA 2KYZA 4ZPWR 4LUBA 3EYZA 4DR1F 3CCRS 4OI4A 3IC1A 1Y5LB 2ROEA 4H4KC 2XMVA 2GQQA 5KT7A 4KO0B 2HHVA 4CT8A 2VPWB 3VF0B 2QA4G 3KLIB 1IKXA 2IYGA 1JXEA 3QJLA 2AYMA 2MGZA 1RQ0A 1OS5A 1RTDB 2I5JB 2FUG9 2V8DA 1HHSA 3MEDA 4CO4A 2N82B 1CLFA 2VOPA 4B3MF 3DRRB 3DLGA 5B0FA 2B6AB 2B4OA 4NLPA 4FBUA 3MTKA 2RB7A 1JLCA 3ZZRA 5KFJA 4A8OA 1S1XB 2UVRA 2R4FA 3LO3A 2KVIA 3I0SA 1HQEA 3PKMA 3QGGA 2VA3A 5DM7Q 5C25A 1C1CA 1TQLA 1TZ0A 3DRSB 4NRTA 3AJ1A 1RTIB 2VQEF 3BO4A 2C2RA 3BEGB 3IAM9 2W4DA 3MMAB 3H25A 3T5JA 1S76D 3V81B 2WAQD 1R8CA 3T5KA 1EETB 4UW2A 5CXTA 2XLKA 3Q8RB 2M2BA 1NH7A 2DIUA 5EHHA 4C9DA 4WFAQ 1K1QA 3SFUA 5J2QB 5HROA 3CE8A 4NLRA 2OKQA 2Q43A 2PIIA 4O3QA 2JEGA 2KZMA 4IOBA 1X4HA 5C42A 4I2QA 4UY85 5DG9A 5F9LA 2MKCA 1TVRB 4JV1A 1HWJA 4KPYA 1GT8A 3TARA 2W4CA 2FJBB 3TA0A 1UVNA 1KQFB 3KK3B 1GTHA 4W92B 5DJBA 2HMIA 3KK2A 4A8MP 3O6QA 1TKTA 3U1NA 3I0RA 2HLUA 4G1QA 5EUHA 5G4DA 5HQ8A 1HL6A 1GH8A 2KFZA 2XCPA 1UFLA 4WXOA 2J7WA 4MKBA 4PXEA 2P9EA 4OIXA 3MD3A 1JLQB 5H9FJ 3AA8A 4OZJA 1TKDA 4DUZF 3C6UB 1WACA 3IBWA 4O0IA 3HKZD 2I0XA 2VG5A 3NBPB 4QIEA 3U27A 4PG8A 2RKIA 1UMJA 4K5SA 1U2RA 2D7SA 2G9OA 3KLHA 3HHNB 3SV3A 1HNIA 2GMHA 3DRYA 4FVMA 5A8WA 4DQPA 4IDKA 4FN5A 3V6JA 5F8NA 2ZNYA 3CMAS 3J7ZT 3MPVA 1F2GA 5KG1A 3VQTA 4ECQA 3TAPA 3DOLB 4F02A 2HHXA 1N0VC 1FXLA 1HQUA 4DFMA 4ECSA 3ISND 2MQMA 1BQNB 2RDIA 2CFXA 3M32B 2JEFA 3LP0A 2EFQA 2NSCA 3I87A 3GMGA 1XK8A 5KFOA 2K2PA 4IOAQ 3QWUA 3L3CA 1FRJA 3CCVS 4NLWA 3MURP 4ED0A 1MMNA 5K14B 4NLSA 4FYDA 4FXDA 2PD1A 2RQKA 1KEKA 4RNNA 5CYMA 5IQQA 4PWUA 2YWFA 1YJRA 2A18A 2DGQA 3OQ2A 1WEYA 4CTAA 2YKAA 5E33A 2V0NA 2DRAA 1MWYA 4ECVA 5DG7A 2MHNA 1XMOF 3KLVA 2XS2A 1N4LA 3B4DA 1CC7A 1MSWD 3V6HA 5I3PA 1U1RA 3BGRB 3SDEA 1RISA 4FVCA 3W3SA 1G1XA 3C6TB 2E66A 3JB9k 2R7WA 1J5OA 4DF4A 4NLXA 4DJBA 3DLKB 3H5SA 2XG8A 2P9CA 4M1KA 2DHGA 3M8SA 1L3KA 2HNDA 2J7UA 2L3MA 4Q2MA 5LSOA 4LF7F 2FHOB 2RMLA 2UVWA 2B43A 4RX6A 4F2RA 4A48A 1LW0B 2UUAF 3OTDA 2BA9A 4B08A 3HF5A 2R7OA 3LP2A 3EXYA 3T5LA 2KKHA 4ID8A 2ZDOA 2R8HA 2L9NA 4Y6IA 3MM8B 4MH8A 4OI6A 4CH0S 1CC8A 2ZH4A 4B9TA 2FHJD 1RTHB 1IR0A 2XMUA 2ZKUA 3CCSS 2FJXA 4XK8C 4HL9A 3BGLA 1FEHA 2YKNB 4DLEA 4NZ7A 1NK6A 4TYAA 1S49A 2EBEA 2RS2A 4TQRA 4RW7B 3BZQA 3Q2TC 2ZC4A 4OHXA 2CQHA 3T1YF 1S0NA 1JWWA 2FVRA 4IG0A 2HRYA 3LWLA 4DV6F 3NAIA 2C3PA 4C0HA 3Q8QB 1V3RA 2MHEA 3MR3A 5H9EJ 4TQSA 4MYU