2LYVA

Solution structure of the two rrm domains of hnrnp a1 (up1) using segmental isotope labeling
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
b'GSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoprotein A1
publication title Solution structure of the two RNA recognition motifs of hnRNP A1 using segmental isotope labeling: how the relative orientation between RRMs influences the nucleic acid binding topology.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing, transport protein
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA02
2KN4A 2LXIA 1X4BA 5JVHQ 3CC7S 2MJNA 3BO3A 2FY1A 1Q81T 4ERDA 1OIAA 2CPEA 2CQ1A 4RU2A 2DGVA 2EK1A 3NNAA 2MQNA 2VODA 2LMIA 2DGSA 1UP1A 2DHGA 2F9JA 2CPXA 4Z2XA 1K73T 2AYGA 4CH1A 2X1GA 2OSQA 2HZCA 2HVZA 1VQNS 1HA1A 1X5OA 5DDPC 1WHWA 1P27B 1WHYA 1SJ3P 2DNRA 3H2VE 1VC0A 1KC8T 4F02A 1X0FA 3MXHP 3CCLS 2NLWA 4UY8T 2QEXS 3IRWP 5LXYA 2A3JA 2MXYA 1VC6A 4LMZA 2DB1A 2ZJPQ 4QU7A 3S7RA 3CF5Q 1WTBA 4IUFA 3P49B 2CQCA 1K8AT 2VOPA 3MUVP 1YIJS 1YJWS 2OSRA 2SXLA 3H2UB 2XNRA 3CTRA 1M1KT 2LA4A 2M4MA 5CYJA 2MKIA 2DITA 3I56S 2ADCA 2MKJA 2DNZA 1YTYA 3NNHA 2CPIA 1QVGR 1L3KA 3P6YC 2AD9A 1N8RT 2CJKA 4FXWA 1VQ9S 2DH8A 3G96A 5DDQC 3CCES 1A9NB 2AYEA 1U1RA 2FC8A 2KG0A 2CQDA 2RT3A 3MD3A 2YKAA 3G8SA 3UD3P 1A7GE 1O0PA 4CIOA 5LSOA 3P5TL 2DHSA 3EX7B 5JVGQ 1UFWA 2DIUA 5GVQA 1HD0A 1FXLA 3ZZZA 3VF0B 1HD1A 5FJ4A 4WFAQ 1PO6A 2DGWA 3LPYA 3MUTP 4WFNQ 3IWNC 2MKCA 4OZ1A 3CD6S 1NJIT 2XNQA 1VQ5S 2LKZA 5IFMA 3VAHA 1CVJA 2DH7A 2DHAA 2FHOB 2MMYA 5LJ5Y 3PIPQ 3CCSS 1JJ4A 1VQLS 2MQPA 3EGNA 2MZJA 1VQMS 4OZ0A 3VAJA 1M5PC 1QM9A 5D78A 4BS2A 2PE8A 3BEGB 2I2YA 4PKDB 1FJCA 2DGUA 2MQQA 2U2FA 3CMAS 2DISA 2CPFA 3UCGA 1N52B 5D77A 1R8PA 3HI9A 4A8XA 4YB1P 4WFBQ 2MGZB 1ZZFA 2F9DA 4M5DB 5IM0B 1YITS 2LQ5A 2YH0A 1UAWA 5BJRA 2LXUA 2DGOA 1F9FA 2RUGA 2KM8C 1VQ4S 1YJ9S 4YOEA 3CPWR 5LJ3Y 5EN1A 1U1PA 2J8AA 1URNA 3CC4S 2L41A 3UCUP 2N82B 1SXLA 2LEBA 1FT8A 3K0JA 5GAEU 2E5IA 2I38A 2K3KA 5HO4A 2KYXA 3HHNB 2RRAA 3Q2SC 2ZJRQ 5DDOC 3OW2R 2J0SD 3TO8A 5LSLA 2JVRA 1U1NA 1G2EA 1M5OC 2DO0A 2DNNA 2ERRA 1X4CA 1XN9A 2DNYA 2MGZA 4ED5A 1BY9A 3CCVS 2AYBA 1WG5A 2FC9A 2D9PA 2KFYA 3CXCR 1VQ7S 4F26A 3R1LA 2MB0B 2KRBA 1VQPS 1D8ZA 4PR6A 2DNQA 2MKKA 4V19X 4WKRA 1VQOS 1WF1A 2JRSA 4C7QA 2KM8B 1WI8A 1JJHA 2DIVA 2MSSA 1X4HA 4WIIA 2MPUA 3CCMS 4C4WA 1WI6A 2GO9A 3THTA 2CPYA 4YUDA 4WCEQ 2KI2A 3CULA 1Q7YT 3CMES 2QFJA 1Q86T 1OO0B 2X1BA 3NS6A 1X5SA 1U1LA 1RKJA 1M90T 2M9KA 2XS5A 2RS8A 1FJEB 4FXVA 1QVFR 4TU9A 2YTCA 3S6EA 2OTLS 2VONA 2DGQA 1R8HA 2U1AA 1DRZA 1U6BA 2DGXA 5LXRA 1DHMA 3VAGA 4EGLA 2VOOA 2M0GB 2CQHA 2M8DB 3SMZA 1KOHA 2L08A 2K8GA 3ZZYA 4ZKAA 5ITHA 2MZTA 2BOPA 2CPZA 1SJQA 3B4MA 1M5KC 2J76E 5DDRC 3VAKA 3G6ES 2RNEA 4QU6A 2N7CA 1H6KX 2CQ0A 2DGTA 4U67Q 3UD4P 2YH1A 1YJNS 3FEXB 1U1QA 2DH9A 3US5A 2CQIA 3UWTA 1H2TZ 2MZRA 1H2VZ 2MY8A 2RQ4A 3PIOQ 1JJ2R 1WF0A 2DNPA 5GADU 3U1LA 5GAHU 3SDEB 2KU7A 1RK8A 1VC5A 3DXBA 4F25A 1WF2A 1NO8A 2E5GA 1PGZA 2JWNA 1KOOA 4W90B 2CQ4A 2CQBA 1YI2S 1VBZA 1X4DA 2RU3A 1JMTA 2XSFA 1VQ8S 5GMKa 2M8HA 3FEYB 2N3LA 4LIRA 3P3DA 5CXTA 3UCZP 1AUDA 2QA4S 2CPDA 2X1AA 2EVZA 3L3CA 3VAMA 3MOJB 1Q82T 2DK2A 3U1MA 1W2BR 3SDEA 2XS2A 3NNCA 2E5JA 3TP2A 2JVOA 3ULHA 5MLCV 2XS7A 2WBRA 2DNKA 2ZJQQ 1VBYA 2UP1A 1N88A 2V94A 2KXNB 1OPIA 1DBDA 1FO1A 1WG4A 2Q79A 2PEHA 1FJ7A 5DETA 2M52A 2HYIB 3MD1A 3J7ZT 4PRFA 5CA5A 2CQPA 4LJMA 2G1DA 1IQTA 2MQOA 2DNLA 2G0CA 2NZ4A 5IM0A 1X4FA 1X5PA 2F3JA 3THPA 4Y00A 4UQTA 4WF9Q 2CQ3A 3BS9A 4C0OC 1U6FA 1WHVA 2CPJA 2HGNA 3EGZA 1U2FA 2MKHA 2RRBA 1H2UX 3SXLA 2D9OA 2LECA 1YHQS 4TU7A 1VQKS 3VAFA 1X4EA 2KXHA 1ZH5A 2D3OR 2N3OA 2M2BA 2DNMA 2CQGA 2GHPA 2DNHA 3NS5A 1OWXA 2DNOA 4IOAQ 3BO4A 1WHXA 2CQ2A 2O3DA 3R27A 2RS2A 3S8SA 3VAIA 5HL7Q 2AYMA 1WEZA 2MYFA 3CC2S 2MQMA 4IO9Q 3CCQS 4CH0S 1ZZNA 2MSTA 2RVJA 2MZQA 2M7SA 3CCUS 1K9MT 2KG1A 1WELA 3TYTA 1P1TA 3Q2TC 1S72S 2J0QD 4TU8A 3DLLQ 1VBXA 2KHCA 2MKSA 3S01A 1SJ4P 1NU4A 2HGMA 3G9CA 3B4DA 3CUNA 2MHNA 2G4BA 3G8TA 3BO2A 2OTJS 2HGLA 2E44A 2KT5A 1WEYA 2RQCA 2YWKA 3MI7X 3JB9k 1SJFA 2KH9A 1U1OA 3RW7A 2XB2D 1WWHA 2KRRA 2KXFA 3MURP 3R1HA 2DO4A 2M70A 2E5HA 3I55S 2L9WA 3MDFA 1HL6A 2JX2A 3G71S 2KVIA 4IOCQ 1X4GA 3VALA 1S79A 5H1SV 1B7FA 4J5OA 1FNXH 1FHTA 2M88A 1U1KA 2MZSA 2MJUA 4QPTA 1UW4A 1SJRA 5DM7Q 2B0GA 4Y0FA 2OJ3A 1KD1T 2X1FA 2EK6A 1D9AA 4P6QA 1N54B 2FPHX 3UE2A 2LCWA 2ADBA 1U1MA 1VQ6S 1WG1A 3CCJS 1X4AA 1M5VC 5DM6Q 5GAGU 3CCRS 1WEXA 2MQLA 3N9UC 2LYVA 2LA6A 2DNGA 3MUMP 3LQVA 1YWXA 4TLQA 4CQ1A 3NMRA 1X5TA 2BZ2A 3J7YU 2MY7A 3V4MA 2LEAA 2OIHA 2MZ1A 1KQSR 5IQQA 2CPHA 3G4SS 3RW6A 1DZ5A 3D2WA 2DHXA 4W92B 4QQBA
chains in the Genus database with same CATH superfamily
4BDPA 2MJNA 3MTJA 4IG3B 4ERDA 2A10A 5J2QB 2VODA 4UZBA 4KBIA 2AYGA 1V6HA 3OUYA 4KPYA 1KC8T 4RLEA 2NLWA 2HHQA 3AH6A 1LW0B 2HEKA 5K8MA 4JI1F 1Y7PA 1VJWA 3DLHA 1FI4A 1YJWS 3KNGA 4USTA 3BYRA 3M4XA 2J8SA 2I9SA 4XO0A 4JI6F 4B9LA 3FCVA 3G8SA 5A0YA 4ECTA 2K06A 2DHSA 4L73A 1G7CB 3UDVA 5ETPA 1R0BG 4C6AA 3BGFA 4PABA 3OL6A 4ECZA 1CJVB 3MMCA 4WFAQ 4WFZA 1N36F 4QYZK 2IM1A 1RAJA 3JQJA 4Q5VA 1VHFA 3I0RA 2QJ3A 2JLGA 2I8EA 1VQLS 1UFLA 1LEOA 2CWXA 5F0UA 4KHPF 3W62A 4CLKA 5LSRA 1R0AB 1FDAA 3HT0A 4WWSA 3PXGa 5IM0B 1Q5YA 3VGTA 4YB7A 1WKKA 4OLOA 1F9FA 3UDCA 4DFMA 4QIEA 1FDBA 1CPZA 3M8QA 5GAEU 3W9JA 3K8VA 1DLOA 4FF1A 1GTHA 3TO8A 3TAQA 2VC1A 1G2EA 4MAKA 1S5ZA 4DV2J 1EETB 3GFXA 2HSEB 1REGX 1Z2ZA 5F0WA 3FFIA 5KG3A 1WI6A 3J7Z5 1X9MA 2C2EA 3BBBA 2G13A 4DR5J 2DR9A 4X84A 3KMQA 1N48A 5KFCA 1LW0A 3ETOA 4ZOSA 2VOOA 1NSQA 2V2ZA 2K8GA 1RT5B 1X9SA 1JXLA 2IBOA 1TL5A 2EBGA 4DF4A 2D3UA 2DH9A 4JI2F 3TR5A 4K0KJ 3SDEB 5JUMA 4K5SA 1QSLA 3FCWA 3M6UA 4UF4A 2PA3A 5J1EB 4R5PB 2ZOGA 1F6TA 3W5YA 3MPWA 1SC1B 1KOOA 4WP8A 1CJVA 2IMOA 1VBZA 2RU3A 3GP9A 5GMKa 3AY0A 4WFYA 3L3CA 4Y2CA 3I5CA 4UOHA 1EIYB 2O5DA 5MLCV 3MEDB 5KFGA 2ZBQA 1JLFA 2BV3A 3ZTRA 1DBDA 4KPCA 1IBLF 4RU9A 2OHDA 2Y0SD 3SCKE 1RT7B 1R0AA 2C1EB 4PRFA 5LM7E 2JC0A 2DEIA 2YNFA 4ZJLA 2NZ4A 5IM0A 2GGPB 2LECA 4TU7A 3KK3B 1Q8BA 2HRUA 5D0EA 2HQIA 3NS5A 1F5AA 3BO4A 4AD6A 3K7RA 3I6PA 5I3UA 2V67A 4NLSA 4YEAA 3SQGA 1CLFA 2QLXA 1S72S 1VBXA 2MKSA 3IWXA 4CTAB 3TQ1A 2HHPA 3H25A 3JTPA 1NK4A 3NOGA 1BHNA 2RQCA 3BV8A 3MM6B 2JEIA 4DR4F 4J37A 3LALA 4A8YA 2ZUGA 3MHYA 3DI6B 4A48A 4GO7X 2YPYA 5C7PA 1VLYA 4QPTA 3AOBA 4DBQA 4DPTA 1HHQA 3PACA 2AGQA 2C42A 3H42A 2QLBB 5IZHA 4MIBA 1S6PA 2ZH3A 3MPDA 4CZCA 5A8WA 2DEJA 3TI0A 4I1TA 4QWEA 5KFQA 1X4BA 1F3VA 4NRTA 2ZH6A 1OIAA 4ECWA 3MR2A 2DGSA 3SSSA 3I0SB 2JH3A 4NXMJ 3MEDA 2R2UA 3T5JA 4NXNF 3GSIA 3X3UA 1DJ0A 1WHWA 2UXBF 1R7IA 1OY6A 2CNLB 4RNFA 3IRWP 2I1RA 1RT7A 4RNHA 3MGJA 1F3FA 4ED8A 5M2RA 1HFEL 2J9DA 1DQ8A 1GMVA 2XNRA 4C8KA 2GGPA 3DOKA 4DV4J 2LLZA 3DOMB 3DYAB 1B64A 4ES1A 4PXCA 4L76A 3KFWX 4AXJA 2P9GA 1L5UA 2HAFA 5DDQC 3MMAB 3A13A 2J6SA 4FF2A 5U47A 5IWAF 3BH6B 4HVZA 4USVA 2GJIA 5B0CA 3CIMA 3R2CJ 1Y5NB 2VDHA 1HQEA 5DZ7A 2NXUA 2JL9A 1RA7A 2QN6B 5JXSA 1TP7A 3DM2B 3MAHA 2MKCA 2WONB 4LFCF 3QRRA 5BR8F 1XEZA 4DFPA 3MM6A 3HFZB 4C98A 2V4JA 4DSJA 4FVCA 3EGNA 2J6UA 2JC1A 2NXNA 2XCAA 3CT9A 1QM9A 4BBYA 3AA9A 2DR5A 1PJ6A 3AA8A 4IFVB 4Q2MA 6FD1A 4OYZA 4KQZA 4RW6B 2FZKB 3OXFA 3BH7B 5EUHA 1RB0A 2Z2YB 1XWLA 2QYCA 1TL4A 5KT5A 4DSIA 2Y1RI 3FEZA 4U9RA 1I94J 2K3KA 3QZ8A 2KYXA 1XNRJ 5KFTA 1SL1A 4LRDA 5K9FA 2DNNA 2J0XA 2JLEA 2UUBF 3F0NA 4NL5A 2YNGA 4FNIA 4J91A 2VQEF 5HI7A 5L9NA 1YRUA 1P6TA 5CCLA 3I0SA 3GG0A 5HVFA 2GO9A 1TKTB 3CMES 1W26A 2QFJA 4BLGA 3H4BA 2W2QP 4Z37A 4GKJF 2XSJA 4L75A 1DRZA 1S1UB 2GAHC 2BMBA 3TX0A 4U7UK 3FSXA 1B0TA 2CQHA 3GB0A 4OYWA 1NXIA 1Z1ZA 4IR1A 4LFAF 1RCOB 3KG0A 3MAQA 4LSNB 5HK4A 4JUZA 5L1LA 2ROEA 5IOLA 3UWTA 3MMAA 2PI5A 2ZH8A 1KDNA 1RQ0A 4LREA 1QSYA 1AFJA 2KU7A 4EEYA 1SC6A 2NQPA 5M2PA 4EUVA 3EE3A 1IBCB 2YWFA 1RE1B 1FTRA 1KRPA 5D4PA 1QAJA 1UL3A 2F8HA 4K7QA 3QPIA 4I6YA 2WONA 2N3LA 1S97A 2HQ3A 1C4AA 1PYSB 4LF2A 3VAMA 1Y00A 2KZMA 2DK2A 3L9ZA 2JVOA 4QIWD 3DN9A 3PFEA 3D28A 4CO4A 4K8RA 1OPIA 2ATCB 4Q43A 3H59A 3D68A 4MFBB 4QWDA 1S76D 4RW6A 1SVDA 1T0TV 2OP5A 4LJMA 3HKWA 4HDHA 1ZBTA 2G0JA 1T03A 3VCDA 1X5PA 1LK7A 2CQ3A 4ZVFA 2IYGA 3EGZA 1JXVA 3F41A 4URSA 3Q8RB 5B08A 3OV7A 1S7HA 3GYNA 4KGVB 5IV4A 4LF1A 3T1YF 3I5BA 2UVUA 3C16A 2VBZA 1N5YA 3VAIA 2K2PA 2K7KA 5EWFA 2B4VA 5LT5A 2VF3A 2IRYA 5C24B 1TR0A 3OSPA 2H9ZA 1UEUA 2UVVA 2E29A 2C2MB 2VASA 4ECYA 4ED1A 2DT9A 1UJ5A 4YHHJ 3K8WA 3SBMA 2QA1A 5AJ3F 4DL4A 1S1UA 2Z56B 3UPFA 5LL6d 1HNXJ 4C3KA 1IUJA 3OFGA 3FNNA 2XLIA 2YPZA 3HSZA 3DHWC 4AL7A 1U1KA 4LSNA 2DPIA 3W63A 2XMAA 2FJWA 3LUYA 1PBUA 1RAOA 4WPAA 5E33A 4DDFA 4GKKF 3RBDA 1S0VA 2GAGC 2W2PP 2J7KA 1WEXA 2ZBRA 4X4NA 2C3MA 2ILYA 3T9NA 1V5IB 4MKYA 2FIUA 4PQAA 1KQSR 2C2OB 4AYBD 2QLFB 1ZA1B 2XYGB 3KHGA 1FJGJ 4QQBA 4G1PA 3FK4A 3PV8A 3VVTA 4LFBJ 3NS7B 2HHVA 2BE9B 4RWXA 4JI3J 1XERA 3UR0A 3TVYA 2DHGA 2QE5A 1VRQC 2AJQA 4CH1A 1S1VB 2X1GA 4WXOA 2HZCA 3G82B 3ILJA 2B8PA 2CRLA 3H7HB 2ZBCA 2OD4A 2W7PA 4YP3A 1MROB 1C2PA 1LWFA 3QJJA 1YIJS 2AZ3A 4UW2A 1E6YB 4DV1J 3QFHA 1VYAA 3EXYA 3RRKA 1S0OA 4NRUA 4J9QA 3A12A 2AW0A 2K1RB 2H5IB 4ZCMA 3CD7A 1BQNB 4ID5B 2UVWA 4HLBA 2GV1A 5LSOA 4JV5F 4N8OA 2UUCJ 1SIZA 2DIUA 4LUBA 1XMQJ 2HK2A 2Y8YA 1J5EJ 3KKFA 3UVJA 4KT0C 2HNYB 1VLOA 5IFMA 2F8MA 3GU0A 5KFFA 4NWBA 3PIPQ 4OQJA 2VG6B 2YWGA 4JI0F 3RRGA 2Q3PA 3D6HB 3K5OA 2FHMA 2CFXA 3UCGA 3QT6A 4NLVA 3D0GE 4ZLNA 4K59A 3QLHB 2QX0A 3CJ5A 3KYLA 2OEMA 2F9DA 3LWMA 2B43A 3C8YA 4NI2B 2XY6A 1IKWB 1S9EB 2IHR1 5G0RB 1SXLA 2OPQB 1LNQA 2VUGA 3GIJA 2KJWA 4B3OB 2F8EX 1XN9A 4KGZB 2PN6A 2FC9A 5F9LA 1T9XA 1QSSA 4NLWA 2KFYA 1VQ7S 4N76A 1IBMF 1T11A 3ONQA 2HBYB 5HLFA 5HATA 3GJTB 4CLWA 2QL9B 3ILIA 3T1HJ 4WIIA 1HWLA 4WTOB 5KFJA 1S1VA 3PR5B 1NUEA 3CULA 2XTJP 3G82A 1M90T 3CJ0A 5D0HA 1ZTTA 2FLNA 1R8HA 2IIHA 1RABB 5GAGI 1KOHA 1YJRA 2CPZA 1E6YA 3PX0A 1RTIA 3ZTPA 2ZH7A 1VOMA 2VA3A 4TVAB 3ZXWA 1TUVA 3BJYA 2K1RA 4K4UA 1WNEA 1HBOB 1LXNA 4LVOP 2NXCA 2LQJA 3M2UB 4LT6A 1RBAA 2V8PA 4YN3B 3GFHA 1X60A 5CZXA 1JMTA 2RQMA 2XGQA 3RZAA 3VZIA 2HNYA 5CXTA 4H4OB 4R0JA 2CPDA 4DR1J 3MOJB 1I6JA 3JQMA 2E1CA 2EC0A 2UP1A 4USHA 4LR9A 1JLCB 2MDAA 2ALZA 2C2RA 2ZD1A 4ZLPA 2HYIB 2HMIB 3DOLB 2Q43A 1VGYA 3QLHA 3W3SA 2MQOA 2PI4A 3NBPB 5HQLA 1E6VB 2DCUB 1RWVB 4KSEB 1IKWA 4JV1A 2DCLA 5G0RA 3CDWA 1YJVA 2GHPA 3K89A 3EUNA 2OPQA 2W8LA 3TUIC 3BQ2A 2KZZA 4B3OA 2AWZA 3ELHA 4ZPAA 3CC2S 2KJVA 4MTPA 1HNWJ 3GR0A 2KG1A 4O23A 2ZZNA 4DG1B 3BDEA 5HVHA 1T9UA 2ASYA 4K4XA 1FEHA 2R3VA 3PKYA 1C0UB 5AXKA 4F4WA 2VD3A 4OYOA 2WB4A 3N6MA 2Y1JA 1FRHA 2XB2D 2GMHA 4PG4A 2MKYA 2DO4A 4TXSA 2O01C 5GAEI 5H1SV 1PCAA 3NCRA 1SBRA 4LRFA 5H9EJ 4DX6A 4I6AA 4H4MA 4E8UA 1DY3A 3ZZPA 2C22A 2OJ3A 3NGRA 3HMJG 2ILZA 3CJTA 4P10A 2CJQA 4RNMA 4LIWA 4FS1A 2R2RA 1CQMA 1U1MA 2I5JB 1WG1A 2RHQB 5DM6Q 3H5UA 4DU8A 1B0PA 4CQ1A 1QTNB 3M2UA 4CLSA 4FDFA 3ZZ0A 1UEVA 1K0VA 4DN9A 3QMQA 2OPRA 1JJCB 2EG1A 2F5GA 2DHXA 1C0TB 3TAMA 3BO3A 1MWYA 1XJWB 1RLDA 4H4OA 2ZH9A 2DGVA 3PHTA 3ENVA 4IRCA 4LRAA 2FB0A 1JLCA 5DDPC 3OJSA 2JZ5A 1EKRA 2HMIA 1VC6A 3NBPA 1NM2A 3L95X 3M6VA 5EDWA 1E6VA 1SH3A 2V68A 1SKSA 1ZYQA 1AFIA 1YRTA 4A8SA 3MM7B 1NNDA 2R2TA 1NPKA 3ENWA 5KG4A 3PY8A 2VQFJ 2AYEA 3TZXA 3ZO7A 4KHRA 5F3ZA 3QIPA 4AL5A 1FXLA 4DG1A 1YKWA 1GX6A 1HD1A 3WX8A 1HIYA 2MTLA 3CSKA 3IM8A 4USMA 1PO6A 3M6WA 4WFNQ 4OYIA 4O4GB 5KTQA 2ZUAA 1FKOB 3R5GA 2W2MP 4OL8A 3T6JA 3H5YA 4ZMMA 3VAJA 2I2YA 2W1BA 2IM3A 1FJCA 3H4DA 2WZ1A 3MPUB 3U7JA 3HI9A 5ETKA 3MR7A 5DQIA 4N56A 1R8BA 2I5JA 3FKBA 2L41A 1ZETA 3K0JA 3OTEA 3BQ1A 5E2QA 2DO0A 1KHWA 3OR2B 1G1XA 2Z2LA 1C0TA 4DUTA 3NMAA 2Q6BA 3KLHA 2ZFHA 4LVNP 1YGYA 4C7QA 1FRJA 3MM8A 1P8GA 1GK8A 1VMBA 1RT6B 2D3ZA 3EZUA 1TKXB 4F8RA 1JKHA 4DI6A 1OQ3A 3FBFA 3S6EA 1U6BA 2FZCB 2HW3A 3CDEA 2BX6A 5K14B 4LF7J 3ZZYA 1UVMA 3NWGA 1CEZA 2V8HA 4DFJA 2JDJA 4OYBA 3KLIB 3JQKA 4U67Q 4DV0J 1ZM9A 3U1LA 5EX0A 3EPGA 4RW9B 1WF2A 4WP9A 3Q23A 5ETVA 4WJBA 2M8HA 2RKIA 1GMWA 4ZCIA 5K8PA 4Y2AA 4I67A 4P75A 4ENOA 1FKOA 2V50A 4NCGB 3U1MA 3PR4A 2OD6A 3ULHA 2WBRA 1N88A 1EB0A 2KXNB 3O8WA 1FO1A 4P2SA 3R7NB 5IT0A 2Q79A 7FDRA 1FJ7A 3VVUA 1IBKF 3J7ZT 2BXJA 2ZE2A 2XY5A 1SV5B 4LSLB 1CC7A 1WC4A 2CZ4A 4MMOA 1OJ4A 2XMWA 3JSBA 5LMUF 2D9OA 1RUSA 1ICEB 2DNMA 3OL9A 3W8GA 1PC4A 4HTIA 1Q95G 1Q8KA 2W7AA 5L1IA 3OR2A 1WEZA 3TAPA 4JI5J 3RR7A 2WW4A 4FYYB 3CCUS 1PAEX 3J81j 4DLGA 3W8PA 2HWIA 4F3QA 2VFVA 4ZIWA 3KJNB 4J9SA 4I7FB 1XNQJ 2ZC3A 3SEOA 1IM6A 2YKOA 3NGDA 4ZP9A 5KFDA 5E3PA 5HMZA 1JLEB 2N4DA 4AQYF 1UEKA 4KHMA 1N0VC 3BGLA 2CWKA 3OFEA 3G71S 1X4GA 3VALA 2KT2A 1FHTA 2ZM6F 4NYPA 4KR0B 4RUBA 4QCLA 2FJXA 1CULB 3EVMA 3Q83A 4I2QB 1NDKA 4DQQA 4X4PA 3FRZA 4DV5J 3THVA 5AE3A 1M5VC 4K5RA 4YB5A 3GYXB 3IG1A 4RW9A 2A6OA 1C1CB 5RUBA 2W9BA 3LGMA 3EWGA 4I69A 1FWLA 4X4VA 4B3MJ 2GS8A 4X64J 3CC7S 2R7SA 4IH6A 4PG8A 4DR2J 2J6TA 1NCLA 3KHRA 3CVKA 4OJ1A 5HVGA 3JSRA 8ATCB 3KK2B 4O3SA 2YX1A 4QW8A 2HQFA 3JSMB 1X0FA 2ROGA 3C19A 5A8KA 4Y2KA 2ZKTA 4RBTA 5JMNA 1IVZA 4CYUA 2VFSA 4LF4J 2XMKA 2ZH4A 3TQEA 2BANA 1M1KT 2EFGA 1N34F 2DITA 3CD0A 3HZEA 4ANEA 1IJEB 3P4UB 1VRTB 3LTOA 3CCES 4NLPA 4J9KA 4C8OA 1GH8A 4PQUB 5BYSA 2KVQE 1Q79A 4IR9A 4IQXA 1UW9A 4ZPWR 3G87A 1IR1A 2B9EA 1KBRA 1UFWA 4LF6J 4C0BA 1N0UA 1HR0F 1KHVA 3D6TB 4G1IA 2VV5A 4F4KA 1RHQB 4P72A 4HDGA 3M9OB 3GZ7A 2UXCF 3OBIA 2KB2A 1JLEA 3RB6A 1RI7A 2R4FA 3CCTA 4QR0A 1KTVA 5KFWA 2BJ3A 4M5JA 1G3OA 3J81Y 4F36A 3D3CJ 5ETNA 4KV8A 2RB7A 1REVB 1R8PA 4WZMA 1CULA 4DJBA 3M05A 1XQIA 1N5SA 3IGVA 3Q8QB 1HPZB 2LEBA 3OPKA 1C1CA 3FSYA 1BWVA 3JAMY 4PXEA 1T95A 2B5JA 4ZVQB 3SCJE 2KTQA 3BKFA 2H4YB 2GMLA 1NK9A 2JFKA 5B0GA 4RBUA 4QR1A 1Q4RA 2W4PA 1F2HA 3JYTA 4C2MA 5D3GB 1LFPA 3KK2A 2ZZTA 4DX7A 2HS4A 4WKYA 2PEBA 2XS5A 2M9KA 3MCOA 4PPDA 4H54A 3Q22A 2YTCA 8RUCA 4PEOA 2U1AA 3ENAA 1VISA 5LXRA 3VAGA 4CLPA 3ENQA 2D7SA 1U25A 4GVBB 4RUCA 3B6BA 1M5KC 3MM9B 5HAOA 4NLXA 2F65A 1H6KX 2PD1A 2DGTA 1VRTA 3W2VA 1Z2LA 1DQ9A 2EXUA 1FFGB 4CLYA 4URQU 3IS9A 4HT5A 2CJYB 1K44A 1ZOTA 1TAUA 2OEJA 3PYEA 1KQFB 1RTZA 4W90B 4GVLA 2CIMA 2FD2A 2AU0A 2Z2MA 5BXIA 2A0FB 3G2XA 2DRBA 2DXFA 2RD5C 5HQ8A 1Q82T 1HYSA 2OPPA 3H40A 2YWEA 5C5JA 2BR0A 1REVA 1OSCA 1Q7LB 5CZVA 4DU7A 4DR5F 1RU2A 2VPWB 2YY3A 3K5MA 3D9BA 1C1BB 3R5DA 3D4JA 2E9ZA 2DNHA 1FA0A 1RT3B 2RS2A 1R89A 5KFKA 4ECRA 1AXQA 2HZAA 1CJUB 1NKEA 3EICA 2J7UA 1WELA 1ZPVA 3GMGA 2PIIA 4AT1B 1XR5A 3VHQA 4K0KF 2OTJS 1DARA 3ZNUA 1CJTB 2KRRA 1HWKA 5DQHA 3VGSA 3K5NA 2L9WA 3MDFA 4OZ2A 2KVIA 1B7FA 4J5OA 2XYPB 2M88A 1K1SA 1S9GA 3MM9A 4J7CA 4ED7A 2IM2A 2ZWPA 2MZSA 4ECSA 2IMWP 4A8OA 5CABA 2BQRA 1HBNB 1KD1T 3I32A 2R7UA 3LP0B 1ITPA 2VG5B 2X51A 3AXMA 1WDDA 2QIFA 3N9UC 4X4OA 3MF5A 3MUMP 3R2DJ 1NJXA 1CC8A 5IT9Y 2HKEA 3BSOA 4D3GA 3G4SS 3QJLA 4RUAA 2LXIA 1OY9A 1J2VA 3HPOA 2R7RA 5IT9U 2BDPA 5F41A 1JXEA 3MCSA 3PVXA 1BUXA 2CPXA 1K73T 4ECXA 4CDIA 2QL5B 4NCBA 1VC0A 1NJZA 3N5BA 1M5HA 2VFRA 2UUAF 5ETOA 3TA1A 4G1QB 1B0VA 3M2RA 4ZPTR 2CQCA 3MUVP 1XR6A 2BOAA 4OZNA 2WSCC 4QIGA 2NZCA 2YKNB 4HACB 4OI2A 3P6YC 1C1BA 3UQSA 1QJHA 1RT3A 5T41A 1B7YB 4HTJA 3S1TA 1O0PA 4DZ6A 1YG0A 2KDOA 2RU9A 3L09A 3KJVA 1TL3A 2E66A 1SB6A 2GO8A 3V5RA 5FJ4A 3KMSA 2OAUA 2V4QA 2AMCB 3BDPA 1TKZB 1CVJA 4RW4B 1N36J 1JJ4A 2L9NA 2ZNZA 2MQPA 5BYQA 3W64A 2MZJA 5E3RA 2PC6A 2FJAB 2AF6A 1M5PC 4PCQA 3V6DB 3GONA 3HKZD 2M3DA 3U27A 2BVZA 5D0GA 1HI0P 4KHPJ 4OJGA 1RTHB 4UOFA 2ZOFA 4M5DB 2FGOA 2XWXA 4DPYA 1UAWA 4KTQA 2IBKA 1Q8IA 3UD5A 4U7CA 2BJ9A 2RUSA 1T7PA 3Q2SC 3CCVS 1WG5A 3AJDA 2D9PA 4ZVTB 3VGVA 1NAQA 1FWPA 1LOUA 2FUG9 4PR6A 4DV4F 4CLTA 2HHSA 2KM8B 1YSJA 1WI8A 5LOQA 1JJHA 1L3SA 3IR6B 4PUOA 3MR3A 3GIMA 2HIYA 2X1BA 5B0EA 4ZITA 3CIZA 3LAKA 3PHEA 3KJFB 1I3OB 1FJEB 2NUUG 1H7WA 3A8KA 1SC3B 2Z0GA 4W98A 3SMZA 4DHVA 3BSAA 3X1LB 2RE1A 1U8WA 2YKNA 4HACA 2AIRB 4CO0A 5D0RA 3UD4P 2A2CA 3FEXB 2HVEA 3E01A 1TV6B 1Y3JA 3FZBA 5KFZA 2WOMA 4I4BA 2MZRA 3PIOQ 2W01A 3FZ2A 3BGUA 1L3TA 5GAHU 3OVAA 2PGCA 4JI2J 1UJ6A 4F0KA 3TZWA 4X4UA 5KFBA 1LWCB 3CCWA 3RB4A 3DDNA 3MEKA 4OHZA 1X4DA 2HFZA 4J9NA 4XK8C 1SIWB 3DCAA 3LAMA 3NOCA 3T1AA 3OFHA 2HS3A 3R5AA 3NEKA 2KFNA 2BQ3A 3H5SA 1XNRF 3KHHA 4XDDA 3HK2A 1YBAA 2HAIA 1M5SA 4M5LA 3A3PB 1MG7A 4RUHA 3IXQA 2Z57B 2B4PA 3MM5B 4RL1A 2IPOB 1RTJB 4WXWA 1RTHA 4UOGA 4FN5A 3CNQP 4Q8EA 1IR0A 4QR2A 1H2UX 1Q1KA 1RWUA 3MPVA 5KT7A 4MIWA 2E1MC 2F4FA 3KXDA 2DNOA 2BW7A 3W65A 3MCMA 1V3ZA 2AYMA 2HHHJ 2HIQA 2MQMA 2VC0A 1NSPA 2CDQA 1RBOB 2EFPA 4ES3A 3MMJA 3DLLQ 4MYUA 3UN3A 4U95A 1H3DA 2YWKA 1Y4ZB 1BGXT 4AFFA 2KXFA 3C14B 2HFNA 2V4RA 2V34A 3PO4A 4U96A 2D74B 3F73A 1UKUA 4WFXA 4Y2MA 1T05B 2RDIA 3PRVA 4OLPA 1EX8A 3H0PA 4Y0FA 1WACA 3D0HE 1APSA 2NXJA 4P6QA 4TY8A 1O5JA 3CJQA 2IC3B 3N5FA 4WYWA 3A3NB 2NPIA 2FVQA 1LWCA 4K2JA 2MZ1A 4P7TA 2IAJA 1OMSA 4KRWA 2WTFA 4LF9F 2HVHA 3BQ0A 5ADZA 4ANCA 2FY1A 4M95A 4X65F 3BN7A 2XHWA 1FNMA 2F9JA 4Z2XA 3Q8UA 4E0DA 2ASJA 1HA1A 2FHKA 5MAOA 2BYCA 3LWLA 1LQ9A 2R2SA 3MM5A 3O5TB 1RTJA 4NXNJ 2DR6A 1EJ7L 1Q0NA 2F1FA 4B9NA 5EHHA 2FVRA 3S7RA 2UXBJ 3P49B 3DLJA 3MMBA 1MU2A 3L7OA 2YX7A 4LF5F 2ADCA 2FHJD 4HL9A 2IJFA 4MK9A 2FC8A 1RBLA 2KG0A 1VRUB 3AQPA 1HNXF 1S12A 3MD3A 3P5TL 1TAQA 5KFXA 5L39A 4LBHA 3Q8PB 4WTYA 2C3YA 4RNOA 1GEHA 3T3FA 2VPYB 3T9ZA 1ROFA 3TOQA 4TYAA 4K50A 1U49A 1T9YA 1NJIT 2LKZA 1RYSA 1WTFA 2PSZA 2NSBA 5LJ5Y 5CYQB 4LFCJ 3HHEA 3QBCA 5A6PA 1TU0B 5BR8J 2HPUA 5EWGA 5KFVA 4BS2A 3EDRB 1UTAA 2BW2A 2XZTB 1T05A 4ELTA 1U6ZA 3WHIA 1S77D 2NREA 3V2UC 3M8PB 4YB1P 3RB3A 4JI3F 1NHUA 3L7PA 1YITS 4NLDA 4EU0A 4F50A 4ECUA 3BR8A 1UETA 1YJ9S 3K2YA 2B9WA 5DQGA 2IC3A 4KC5A 4USIA 3UCUP 1CS4A 1FT8A 4DL2A 3M32B 2FJVA 2ERRA 2MGZA 4ED5A 4KY3A 3DRYA 2MB0B 4B3RF 4YDXA 2DNQA 2JRSA 2HQGA 1VBKA 2UUBJ 2FJDB 3CJ2A 1JK9B 2RDDA 3JTOA 4UUXA 2VQEJ 3THTA 2G0IA 3U1NA 5C42B 5KFNA 4IG0B 2XMVA 2RS8A 1JLQB 4LBPA 2DGQA 1XMQF 2VKZG 1TL1A 4ZP6A 4GKJJ 5ETSA 2IYIA 2OELA 1S48A 3DGPB 3RRHA 2F4VF 4JV0A 2XO6A 1U1QA 4Q45A 2YH1A 4Q0BB 2HQCA 2CQIA 1XK8A 5I42A 5KG1A 2YQ1A 1JJ2R 3H90A 1WKLA 4NASA 1UWAA 1VC5A 3OXGA 4BCAA 4OHXA 4H4KC 4V1Ak 4B3SF 3K5LA 3CJRA 5DZ6A 4QYRA 4LIRA 4PXBA 3UCZP 1FFSB 4HT7A 4DEZA 2UV8G 3N6NA 2X1AA 1SH0A 3IBFB 3AD9C 2EC2A 3NNCA 2CJ9A 4DCPB 5DLFA 3TJ9A 5D4LA 4G3IA 2PEHA 1DAXA 1U7LA 3M8PA 3MZIA 4FP9A 1LWXA 5CYMB 4KKOB 1X4FA 2DPJA 5FIIA 1WHVA 5DLGA 4AL6A 3OJUA 2M2BA 1RXOB 3M32A 4DR7J 2QV6A 1LKZA 5IS2A 5E7OB 1RP5A 2LU1A 4JBCA 2AHOB 3V6KA 2EPIA 3KG1A 3QT8A 3PDNA 1D9FA 2K3IA 1KN6A 1WC3A 2NPFA 3KK1B 2AKWB 3PW5A 4PWDB 5C42A 3G8TA 2XYHB 2AGPA 1H7XA 4DPUA 3RYLA 3VGUA 1HWJA 3RW7A 1W7WA 4P9SA 4ILMA 5KT6A 5B0FA 3ZTSA 1IKXB 3I55S 1PILA 4B9UA 1HL6A 2JX2A 4WU2A 2GJ2A 3MECB 2YX4A 4DPWA 5KT3A 1X7VA 1FNXH 4ECVA 1FRXA 1NDPA 4AUKA 3DGPA 1LWEB 1UFKA 3HM9A 2HHXA 5AXMA 4AXIA 2R8IA 5J2NB 3GG1A 5H9EK 1RAHB 4Q0BA 3PEJA 4DR1F 3E51A 1N54B 1S99A 3B82A 3Q8SB 2VKRA 1MMNA 4IKAA 2HFUA 5CCMA 3NMRA 4GKKJ 4ZN3A 2HHWA 5KFOA 5KG0A 4DSKA 3W1YC 1QE1A 5A76A 5JVHQ 4DLEA 4X62J 3HVTB 4NA3A 1WSVA 4RU2A 2YXLA 6FDRA 3M1VA 3CE8A 4FS2A 1JQGA 4OI3A 2P2CB 3SFUA 2NXEA 1YJUA 3MXHP 3PW2A 3RAQA 2CG8A 2GVZB 5CYMA 3B54A 4RW7B 4IG3A 2GIQA 1VR6A 5J2QA 5JJBA 3BKUA 3TA0A 3DU5A 3IFEA 2OPSB 1EKSA 3KDNA 3I56S 2BKNA 4K4ZA 3FBBA 4DZDA 2AEMA 1JNZB 3W61A 1GNKA 1ULRA 2CNOB 1OQ6A 2V9KA 3CB4A 3AJ2A 2V2QA 3FBCA 3UD3P 2LVWA 2GVDB 2DY9A 3OLAA 5L8RC 2V63A 3DXSX 3FRYA 3LPYA 1FWKA 3TRGA 1VQ5S 4DF8A 2IA6A 1Q8LA 2WVBA 1NBEB 1S4FA 1IKXA 3MCNA 3MECA 1N52B 9RUBA 3PJXA 4MKVA 3B78A 5IC4B 1UJ4A 1MN7A 4PYDA 1WD6A 2HRTA 1QUPA 3IBCB 3M2VB 1VCTA 2E5IA 2J5AA 3OTBA 2RH3A 4LF8F 4HR2A 3FBEA 2VBYA 1Y5IB 1X4CA 3QQCD 2KRBA 5A6WA 1VQPS 3TNVA 5K20B 2E5LF 1IBMJ 2KL8A 4M5MA 1O8BA 2YNHB 3KUEA 3J7A1 2DHHA 1EETA 5CAAA 4KGXB 4FXVA 4RPFA 1SL2A 1VK3A 2GVZA 2O1PA 3HF5A 4R8UB 4RW7A 2OUGA 1T9WA 4KH1B 2BJDA 1D09B 2RNEA 1KFSA 1HNVB 2N7CA 2QTWA 3CGIA 4ZPDA 3HXMA 1SPBP 2W7OA 3RTVA 3SIPB 3BPDA 4JV2A 2EKNA 1FD2A 5AE1A 4X66J 1RT5A 4OX8A 1PGZA 4FPIA 4K4TA 4YR0A 3IO1A 1IKYB 4TN2A 2BABA 1SQGA 2CNNB 3Q0AA 2QA4S 1S1TB 3SCLE 1S10A 3SDEA 3TP2A 3SZ2A 5J1EA 2ZC4A 4R5PA 2DNKA 1HI1A 2UXDF 3G8QA 2WVEA 1AROP 5G4DA 2ASDA 5IV3A 3MAAB 3GJSB 2CQPA 1QAXA 2ACYA 3QGPA 2DNLA 2H5EA 3A8EA 4TKTA 4CO5A 2CJAA 2V69A 1FTCA 1YHQS 1X4EA 2PDAA 5I3QA 2NR0A 2N7YA 1CG2A 2CQGA 3M2VA 2AZ1A 1HQUB 1LK5A 2P6TA 4HHUA 3R27A 1NSAA 4MT1A 2DVIA 5HL7Q 4LF7F 3QAUA 4OI1A 3OSNA 3B8HA 5HMWA 2KHDA 4IDKB 3CJSA 3POTB 5GMDA 3CJ3A 2J0QD 4TU8A 3QWUA 1KP6A 3KK3A 1WUUA 5B0AA 4M1KA 1FX4A 2FJBB 2OO4A 5LMNJ 1J5OB 1SC4B 4CNZA 5L1KA 1FXRA 2RMLA 2LU2A 2EFNA 2RAQA 4OV1A 4R8UA 4A4JA 1F60B 3BR9A 2L48A 2E1PA 4CTAA 3GIRA 2IDEA 5EX3A 1RYRA 3HVRA 3K5PA 3R8YA 2QMWA 1MNEA 4ZVHA 1DQAA 1EQMA 1KQGB 3UE2A 1S1XB 3HFKA 3RG6A 3DI6A 3AODA 4P7VA 2ZBIA 2LA6A 1YWXA 2BZ2A 2JHEA 4TQSA 5E0OA 2OIHA 2UU9F 2IFXA 3N79A 3ITHB 2HK3A 4FPRA 4W92B 3OR1B 2XI2A 4XPEA 3WQPA 3ZC4A 3M30B 4ZIVA 3VV2B 5ETMA 2QSFA 2VHGA 1PAUB 4FNHA 3BSCA 3QRPA 2XZWA 3ET6B 3K58A 4C8NA 1X5OA 4F0MA 3TJAA 4URGA 2O66A 2QEXS 4JI5F 1ZPWX 3SCIE 3MAAA 3BBCA 2V2VA 1WTBA 2XWYA 2Y1IA 5GAHI 2LDIA 4FYWB 1RT2B 1PSDA 3RBZA 1MWZA 4MYTA 1YTYA 1QVGR 2YKPA 1HARA 4FXWA 3AQOA 4G6VB 1WOOA 5B7WA 5DG8A 1U02A 3UN2A 4J9OA 4DV6J 5IQ6A 1BMQB 4I56A 4CIOA 1EAYC 3IGNA 1P1LA 2MLZA 4PXDA 4Y34A 5GVQA 5EGYA 3DOMA 2BE7D 3DYAA 1SQFA 5AT1B 3IWNC 4X4TA 2F7VA 3CD6S 1J5OA 2BRLA 3Q24A 1UA1A 3J7AN 3KNAA 4DPOA 3KUHA 4O3OA 3UW1A 2LQ8A 2OKQA 3VQSA 2U2FA 3DM2A 2MLXA 4X64F 4IH7A 4L72B 4I6WA 2CAJA 2FHJA 4L74A 3KLEB 5BJRA 4E98A 2KM8C 2QRRA 2HQDA 1URNA 2G2ZA 1TQLA 4IFVA 4F4YA 3OFFA 3OLBA 2XM3A 3OT9A 3E8OA 2BJ8A 4YR3A 2HVDA 3QO9B 4YY3J 3CXCR 4UOCA 1IQZA 4CO1A 4F4XA 2UVRA 3UDEA 5D8HB 4DX5A 1SUQB 2MSSA 2XMJA 1CBKA 1NHVA 1ZM4A 3NGKA 2YBVA 4GO5X 1WORA 2FJEB 3D6MB 4X2BA 5KFHA 2HBZB 4QJVA 4PWWA 2DR7A 2M8DB 4TNOA 2GHVC 1RT2A 5C2CA 1TKTA 1NH7A 3RR8A 3US5A 3KUGA 4ER8A 1SI9A 2DKOB 2C3PA 3HT3A 4PWUA 1KLMB 3DRSB 2NCKL 4F25A 4DUZJ 3CW2C 1NO8A 5E41A 2AP6A 2CQBA 4DR3F 1RT1B 3PJWA 3W9HA 3T5HA 2CNKB 3HJFA 3OQ2A 1VJQA 3D67A 2NS1B 1RWPB 2XGPA 2EVZA 3DRPB 4Z7CA 2RRNA 2CDRB 1WSRA 2XS7A 2OH2A 4DV3J 1H72C 1VBYA 3V81B 5F3TA 3C66A 3GYGA 1DTQB 1X9WA 1CJKB 2XG8A 2XHCA 4MKBA 1AZSB 1IWAA 1IQTA 4K4YA 3HHLB 2QL7B 3V4IB 3KLEA 1IBKJ 3ZFVA 3WC0A 4OHVA 3PCOB 1X8DA 2NUHA 3QSIA 1ZH5A 3PG9A 2W8KA 3IR7B 4F3OA 1RHMB 2HBRB 4MFBA 5LMUJ 2HFOA 4OYMA 1N32F 2MYFA 4TY9A 1QUVA 5SUHA 2XMTA 2D41A 1NK8A 5J2MB 4D3HA 4KJIA 4ZN1A 1R6VA 2IRXA 2OMLA 3F56A 1SUQA 4O4RA 2AEJA 3DRRB 3G9CA 3CDBA 1RAIB 2G4BA 2IY5B 1H98A 4QWCA 3K59A 1FESA 1M1HA 5F8NA 1YBTA 2FVSA 3GWCA 5C24A 4C48A 4OX6A 1FKPB 3FVYA 3R5CA 3WIVA 4IOCQ 1Q5VA 2K7JA 4AQYJ 1L3UA 5DRKA 2R7XA 2JEGA 5D6GA 2DTJA 4LQ3A 2QMXA 2O67A 5DG7A 3UNGC 2HNDB 5DM7Q 3TW0A 2ZM6J 1RTDB 2W2OP 2W9AA 1KEKA 3BGRB 2Q66A 2PT0A 1HWUA 1X4AA 5C25B 1KLMA 1VFJA 2MQLA 3DRSA 3P45B 2XBPA 4C9DA 4JI7F 2C3UA 3J7YU 3FMWA 3OUYB 1GFWB 1RT1A 4F7VA 4KH0B 3I9ZA 1HMVB 2E7WA 3D1OA 3RGIA 4RKUC 1AW0A 1PG5B 4JYAF 1R31A 4Q8FA 5HJXA 3M7VA 1NHKL 2OEKA 4P2FA 4OYXA 1FEEA 2HVZA 1P27B 4LR7A 1IM4A 4C8LA 2WW8A 2LFVA 1DTQA 2VIHA 4UY8T 1CJKA 4NYOA 1AZSA 4N5SA 4QU7A 4IUFA 3V4IA 1KVKA 5HANA 2NSCA 4NLTA 5FLXY 3MEEB 4EI2A 2MKIA 2C2DA 5E3QA 1RACB 3QZ7A 4OX9J 2ZBPA 1TUGB 2FVCA 2P8IA 1N34J 3LP2B 5FLXU 2JSXA 3I0RB 2C28A 1MROA 4C8MA 5JVGQ 2PMHA 3VF0B 4ZVPB 4B3TJ 1HR0J 3C3LA 1R8AA 1BQNA 1HQ2A 1OS5A 4ID5A 2R7VA 2FHOB 1RZMA 4DXLA 1FKPA 2J9DE 2UXCJ 5D78A 3WX4A 2Q1LA 3HULA 2CPFA 2QLWA 2HNDA 4UTGA 4ZVGA 2YH0A 4ZVEA 1BQMB 3BGRA 2DGOA 1VQ4S 2VG6A 5C25A 3DHXA 1RAAB 4EBEA 2GQCA 3FFIB 1FRIA 4DQSA 5HO4A 1N4LA 2P9EA 2EFOA 1RHJB 4ZVUB 1BC6A 3EGWB 3GFZA 2XQCA 2AYBA 3TANA 1ACMB 1HMVA 3ADAC 4NI2A 2MKKA 4WKRA 4EK2A 1TZ0A 1S6UA 1DFDA 1S9EA 5H9FJ 4TLRA 2MPUA 3P5BP 4YUDA 4WCEQ 1V9OA 2H4WB 3NS6A 4M94A 2D3O1 4TU9A 4ATNA 3OTOJ 3PYFA 4GC7A 1NK7A 1EZZB 2FYXA 1BQXA 3MEEA 4ITSA 4NZ6A 4JI4F 1RDRA 4HHJA 2IDLA 1FD8A 2EFVA 3LP2A 1H2TZ 1KQKA 4JP8A 2VFUA 3PYGA 3OVSA 3PX4A 3DDKA 1O6XA 3Q86A 4DCJB 1RK8A 2XZDB 4ELUA 1YX2A 1JLFB 2JWNA 4OI0A 3KLFB 1DTTB 1H38A 3PW0A 2XSFA 2BJ1A 4IFYB 2RQKA 2YKQA 3KLVA 1HBOA 2BACA 2YNFB 4NMLA 4RNNA 1P9QC 2XS2A 4CLFA 2CJXB 2VG7B 3KTQA 3H98A 3PYDA 5DETA 3MD1A 9ATCB 3MR6A 5I3UB 5HMXA 1FNOA 1KWMA 3CDUA 1HHSA 4Q2LA 3SQGB 1BQMA 4ZVOB 2N4CA 2QSWA 1U2FA 3HCXA 3SXLA 4BHQA 1WC0A 2AGOA 5AXNA 2OFHX 3W2WB 2BE2B 1UA0A 1S49A 3EYZA 4J9LA 8AT1B 1KONA 1GXLA 1SKUB 4XDCA 3DOLA 4WBFA 2AX1A 3M8RA 3AT1B 3TYTA 3FGVA 2ZH1A 2IVYA 2VJVA 1JNRB 1I1GA 3EXCX 4YMEA 4N8NA 2VH7A 4ZPCA 2Z30B 3B4DA 3IM9A 1SCJB 1WEYA 2BBEA 3HHDA 3PM9A 3ICLA 2KH9A 2HZVA 1FX2A 5ETRA 1S6PB 1S79A 4ZVSB 5A8WB 5THWA 4ZS6A 4JI8J 1Q53A 1C0UA 4J9RA 4LSZB 3HHKA 2ZNYA 1JLAB 4DSFA 2WK4A 1RAEB 3BREA 5L38A 1VQ6S 3E3XA 1KS2A 3K17A 4O44B 2LYVA 4K2XA 3LQVA 1GQEA 3V4MA 2GW8A 4LRCA 3KLFA 5E3CA 3BGOP 1DTTA 2R8KA 2FLLA 4IFYA 3CJKB 1NJWA 2UZAA 3PO5A 2LMIA 2VBXA 1F0XA 1RWNB 3DOKB 4ZLLA 3C46A 3A4TA 2VG7A 4PPZA 1SJ3P 2HHHF 4A46A 4J90A 1XMOF 1K0TA 3CF5Q 3W5ZA 2VOPA 1SJ1A 1PJ5A 4FBTA 2UUAJ 1TFWA 2DJWA 3A3OB 2OMOA 1HQEB 3BZQA 3PFOA 4QW9A 4ZP8A 1L3KA 3W2WA 2BE2A 2CJKA 4UT4A 2DH8A 3RBEA 1PYTA 4IRKA 3NRBA 5CD4A 1A7GE 1WOSA 2V4JB 4LQ9A 5HSPA 2H48B 3QIDA 1KFDA 3DU6A 3MM7A 5C2GA 1SKWA 4WK1A 2CG4A 3QYYA 4B17A 2YVSA 3M9MB 2ABYA 2F63A 2R7TA 3IWLA 3MEGB 2AJ4A 4ALZA 3CEDA 5M2UA 3AFGA 1VQMS 2ZDOA 3DLBA 2ZVIA 3BKTA 2DRAA 2PE8A 4PKDB 1VS3A 3QAEA 2MQQA 3AOCA 1HBMB 3NCPA 3G6YA 4O4GA 1MMDA 3D1QA 1U26A 2H65B 1ZZFA 2KYZA 2PA8D 3IRXB 3NGTA 1JLAA 2YNGB 3D7SB 3T19A 2P5VA 2QT7A 1Y0HA 3CPWR 3NL0A 1X31C 3FC9A 1U1PA 3C6TB 4EFAC 4O44A 5F8HA 2DY1A 3GV5B 1S0NA 3PRBA 3HHNB 1IN0A 4P71A 1K1QA 3EZOA 3DLGB 2DNYA 2G9OA 3GCXP 2XSJB 4F26A 2CXEA 3CJKA 3RBXA 1WF1A 3KJQB 3PTWA 4ES2A 1TELA 1X4HA 1F5BA 1PBAA 4C4WA 3EVOA 1U09A 4FKYA 5EWEA 5B0BA 5HROB 1Q86T 3MFHA 3BSNA 4M5GA 2ALYB 1H0HB 3MR5A 4FXDA 1R43A 2M0GB 2L08A 2V8DA 2HVIA 4A8QA 1SL0A 2DRDA 2V8VA 5L9XA 1RT6A 2ZKUA 3O2IA 4OFZA 1TKXA 1RWOB 3FDSA 2FGCA 1PKUA 1V3RA 2MQ8A 2H3EB 5GADU 5K14A 3ZZOA 3DXBA 1U48A 3HSDA 3KLIA 1IKVB 3TEHB 2CQ4A 4E2FB 1TMJA 3U02A 4ZCLA 2IA0A 3M8SA 5FDLB 1GAOA 3MEGA 1YZ6A 3KLGB 1T03B 4QWBA 1W2BR 2E5JA 1W2IA 4EBCA 3TJ8A 4F2RA 2ZZMA 1T9TA 1HBMA 3C16B 2RJZA 1N5YB 5KAKA 2G1DA 1T94A 3GQCA 1Z4UA 1S6QB 1MW7A 3IRXA 4NCGA 3BS9A 4C0OC 2MKHA 2RRBA 1CSJA 2IVFB 1HNZJ 5DS7A 1T8EA 1XIQA 3C6TA 2D3OR 2N3OA 4H4KA 4RO0A 4DV7F 1GMWD 1KKHA 2XO7A 5J1NA 4U7UD 3GV8B 1NKBA 3GFYA 3NWRA 3DLGA 4ICLB 3K57A 1SV5A 4LSLA 4CH0S 1ZZNA 2J9EA 4DUYJ 2LDYA 5ETTA 3DNCA 3Q2TC 2ROPA 4YFUA 1UVJA 3IAM9 2KHCA 2B51A 3S01A 4MH8A 4OJHA 2WAQD 5HROA 2E44A 3VZHA 3SQOP 3JB9k 3ZZUA 3C2PA 2Q6CA 3R1HA 2IRUA 3HD2A 2GNKA 2BJ7A 2GQQA 4YDDB 2AEFA 3CO9A 4RBVA 4I7FA 4J9UE 4LRBA 2FY8A 3MFIA 4USKA 1MMLA 1TUWA 1TVRB 4OYAA 1RKIA 5CD4H 3UDLA 3SI8A 1NMEB 2BUNA 3NAIA 2MY7A 2VL1A 1IKVA 3Q8YA 4I2QA 1DZ5A 3D2WA 1HW8A 2V0NA 3HSGA 5FDLA 3KLGA 1NDLA 1LWFB 3NNAA 4LF9J 4NPOA 1JLGB 4DR7F 5F8IA 1YK9A 3T5KA 3A8JA 3LPEA 1JB0C 1R3NA 4DX8H 2GX8A 1C4CA 4X65J 1VQSA 1A6LA 3KOAA 5J1PA 3I31A 1U24A 3CCLS 1N33J 1NPPA 1KVIA 2MXYA 4DMZA 2LP4A 1S6QA 4GMKA 1TK5A 4EZ9A 1HNIB 2GMJA 5KFPA 2HRYA 4ED4A 3QNWB 2LA4A 3LANA 4P73A 3I9V9 4HHHA 4K4SA 1YBUA 4ETZA 3L4BC 2G2OA 2PO4A 2AD9A 3UVJB 2GIRA 3JSMA 1VQ9S 3G96A 4LF5J 2BKOA 4YB6A 4ICLA 1YQHA 3V6HA 5F8LA 2HFVA 3C15B 4QIVA 2FLPA 2R9LA 2EEYA 1AUSL 2V9WA 1M0SA 1WJ9A 3MUTP 4EYHB 2W24A 3R6LB 2B9XA 2XNQA 4PQUA 4WP3A 4Y28C 3HX9A 1URRA 3NKYA 2BM1A 4OZ0A 3H20A 3BEGB 5BYRA 1KR4A 2D69A 3RAMA 2DISA 5D77A 4DR6J 2GA7A 4X62F 2CKWA 1P9YA 1MN9A 4PYAA 2LXUA 1TVRA 5EN1A 5HLFB 1RISA 4DV2F 3AJ1A 2RRAA 4USUA 1WC5A 1HWIA 3GJQB 3R1LA 1D8ZA 4V19X 4ED2A 1FDNA 1HPZA 1JLGA 4CLLA 4B3RJ 2KO1A 1RTIB 2KI2A 2AJFE 3HP6A 4HI1A 4N77A 5KG5A 1X5SA 4RZRA 4ED3A 2YQ3A 2APOA 3EJMA 2YKMB 2PMWA 3M8ZA 2VZ9A 1DHMA 5KOXA 1I51B 3CJ4A 4P74A 1HNIA 5D3GA 3P96A 1SJQA 3J7YI 2XLKA 1RT4B 2HURA 5K8NA 4RX6A 4ZHRB 5KFYA 3UNYA 3JTNA 2F4VJ 4C8ZA 3EMTA 3CCZA 1H2VZ 2MY8A 1RHRB 2BKPA 1T3OA 3CDAA 3LP1B 4GVBA 3C15A 5AXLA 4CM2A 2HLUA 1LW2B 4QZVB 5IC6B 4MIAA 4Y65A 3OXLA 2B8QA 3CJ8A 2ZD1B 3QT5A 3FEYB 3HHLC 3P3DA 1RA6A 2V8GA 1HLWA 4B3SJ 1TL7B 2E9TA 4RJVA 1R0CB 4NOHA 4DFKA 1AB8A 1U45A 4EYIB 1T9VA 2VBWA 1WG4A 4XIUA 1Y11A 2XCPA 2M5YA 4A8MP 2M52A 2NYIA 3IMQJ 4ZLJA 1Y10A 3CWJA 3LOUA 4NLRA 3R5BA 1RADB 2F3JA 4QOTA 1EP4B 1S6OA 3O6QA 3I4PA 4OJ3A 3HDSA 1FK9B 2NYHA 5ETQA 1N5QA 3Q8VA 4N7TA 2MZQA 2RHSB 3JXOA 4JI1J 2H51B 4PG5A 2CUYA 2UV8A 4C97A 2CA9A 3G6VA 3UN5A 1RWXB 1R8CA 1K47A 1LXJA 3IAS9 4H4MB 3JS9A 1FVSA 2HGLA 3HVAA 1SJFA 4X66F 5T7LB 3NCQA 2V2KA 1CJUA 2YKMA 1WWHA 4JI6J 3E2EA 1G6BA 3D3BJ 2CZVC 1Y9OA 4GC6A 3DLKB 2VJUA 4CCHA 1RT4A 1KSPA 2OPRB 4XPCA 2B0GA 1VQYA 4ZHRA 2EK6A 1D9AA 1CJTA 2GQ2A 2IJRA 2E7VA 3TAMB 3M9NB 4USWA 3LP1A 2DNGA 4CWBA 3M6XA 5F8GA 1LW2A 4IRDA 3ZZRA 3WC2A 4LR8A 5DJBA 3PRDA 5KT2A 1ZA2B 1Q78A 2X3GA 3M8YA 1BXNA 1HBNA 3IR5B 1QAIA 3W5XA 4NXMF 2B7BB 5L1JA 2VPZB 3LP0A 2Z8QA 2VG5A 4R25A 1TL7A 1PYOB 2AV5A 1RWWB 2W25A 2AJ1A 1FKAF 1UP1A 2GIFA 3M8WA 4L3KA 4NA1A 1Y5LB 3ISZA 4IOBA 1U2CA 3H2VE 1FVQA 1FCAA 2XLJA 3T41A 4HYKA 3OL7A 3VTIA 1N56A 4C8YA 2Y3YA 1K8AT 4EBDA 2VDIA 3QIPB 1EP4A 2M4MA 2EKYA 5LMNF 2MKJA 2CPIA 3EGVA 1N8RT 4MK8A 1KLNA 3TVZA 1D1UA 1FK9A 2JOQA 4ETXA 3TARA 4G1QA 1U47A 2YKAA 4ZPVR 2CADA 3QGGA 3TVKA 2ACMA 1FE4A 2YQ0A 1UZDA 1YJ7A 4A47A 3R6GB 3R7BB 4QYZJ 2DGWA 3GPAA 4AE5A 4DS4A 4KFBB 3HO1A 4ANDA 3VAHA 3AXKA 1BD6A 1FRMA 5T7LA 3PZPA 4F4AA 2MMYA 1YJTA 2MHEA 1R27B 4WYLA 5F8MA 4CO3A 1V5VA 4X4RA 3DC2A 1JWWA 1UVNA 3DLKA 2DR8A 2EWHA 7FD1A 4WFBQ 3PW7A 4WK3A 1TKZA 4RW4A 2UUTA 1I94F 2RUGA 3KLHB 3TUJC 2WRMA 2J8AA 3MM8B 5GMEA 5E3AA 4RW8B 2Z4PA 2I38A 3V6DA 5D4OA 1QDUB 1A0OB 4QIFA 1JKHB 2FTRA 5KFSA 1IBLJ 4V19J 1EHWA 4M5DA 3OD2A 3GV7B 4LF8J 3G86A 4CO2A 3FMBA 4FYVB 2C2KB 4HH0A 3ETMA 5I3PA 3OL8A 2AJ0A 4B9SA 4DV6F 3QSYB 1HI8A 7AT1B 1RKJA 2E5LJ 3L7UA 2V6AA 4M5KA 2VONA 1FFWB 2DGXA 3LGNA 3TZZA 4NLOA 4IQMA 2I0XA 2BOPA 4UY85 1WDTA 2J76E 3VAKA 3G6ES 4QU6A 3CD5A 2CQ0A 1YJNS 3BYPA 3ZTQA 2RKIB 4FF4A 3D66A 5HP1B 1ZM3A 4DR4J 2XULA 3KDOA 3PKMA 4KYZA 4CI0B 4EZ6A 4NLGA 1PJ7A 1YI2S 4NLYA 2BM0A 3EPIA 4ED6A 1VQ8S 1TV6A 4ZK7M 2ZE2B 4KFBA 3EM1A 3JSYA 1JLBB 2BRKA 4C11B 1N6QB 2R8JA 1NZAA 4B9VA 4I68A 3R5JB 5J2PB 3EZ5A 2V94A 1RCXB 1YVFA 3DFEA 4UUWA 4YY3F 4ED0A 4NEYA 3KWMA 3KG4A 2J7WA 2PFFB 2YWHA 1ZAXA 2I6WA 3ISNC 2UXDJ 1KNZA 2VB6A 1GXTA 3IBWA 2CPJA 1FERA 3D0IE 4RW8A 3GE9A 3QGHA 2CZ9A 1MSWD 3ILLA 3N4WA 1EARA 1NK6A 2RVJA 5DGBA 1NSKL 4DN0A 2ZEJA 2DYAA 4YHHF 2EI5A 1D8YA 2A2DA 2HGMA 4OZJA 1RU1A 1B3TA 2KT5A 4OHWA 3MI7X 4JOUA 4DUZF 2C2NA 4KB7A 5IWAJ 4HEA9 3HVWA 1RHUB 4Y3CA 3IG1B 4NLQA 4RWWA 2W9BB 4XTTA 3BBFA 4R0EA 1L3VA 2OFGX 4B9TA 1O51A 1GMUA 2WB1D 3CO0P 1NEEA 3DKDA 2OI2A 4DV3F 3C14A 2ADBA 4I64A 3PW4A 3LH2S 4N41A 4NX9A 2CVIA 3SSRA 5HP1A 4USJC 1NKCA 3FJ2A 4TLQA 3NXZA 1FJGF 2DXEA 2POKA 2FZGB 4LFBF 4QPXA 2WVCA 2P6SA 3RW6A 5A8KB 1S59A 4CYUB 4OI4A 2UU9J 4OZ5A 2E7XA 3UO0A 1U0HB 1JLBA 1Q81T 4C11A 1N6QA 2BANB 1ZM2A 1RJJA 5J2PA 1GX5A 2OSQA 3MWBA 1VQNS 1WHYA 4OX7A 2DNRA 1FF2A 1RAFB 1IJFB 3RAXA 4LMZA 5A8RB 1HBUB 5GADI 4DV1F 3IA0A 4KO0B 4OI6A 1T3NA 3SFGA 3W60A 2SXLA 3PNIA 2ZDPA 1WC1A 4NZ7A 4DL3A 2KFZA 3NNHA 4M8LA 2Y8WA 1GXUA 2XY7A 3QWPA 2L9DA 1LV5A 2UUCF 2YWWA 3FQLA 1UVLA 2QC3A 2CQDA 4UQGA 1BLUA 1J5EF 4IYQA 1RWMB 4QBUA 4F2SA 1S4EA 3PEHA 4ECQA 4WZQA 3QFWA 4KV8B 3TZYA 1B70B 4LFAJ 5KFEA 4DL6A 3GTYX 1N5TA 1VRUA 2RIJA 1D9DA 3VWSA 4I2PB 5SZTA 3RJMB 3V6JA 2HG4A 3AOAA 2QO3A 2DGUA 2B6AB 2DBBA 5KFAA 2B5JB 1OPZA 5HQMA 2QLJB 2VICA 5CYQA 2FDNA 1RWKB 5KT4A 2WHOA 3JYTB 2WSFC 4ZJOA 2N82B 4CT8A 2XEXA 2BA9A 2ZITA 4FVMA 3O44A 4DL7A 4DOZA 3T1HF 1U0HA 3D54A 3DRXA 3HD1A 4OX9F 2L3MA 2WBMA 2C2ZB 4NZ0A 5H9FK 2X3DA 2ZOMA 1SH2A 3TX8A 3CMQA 3BM7A 3W2VB 5T14A 2OTLS 3T1YJ 3BF4A 5A8RA 1HBUA 5DGAA 4KO0A 4U8VA 3GLJA 2MZTA 3IS9B 2XMUA 2FQQB 4B3TF 2H1YA 4MJKA 4HI2A 1D0EA 4IG0A 4KAIA 2ZH2A 1JLQA 2HHUA 3O1LA 1B4SA 4WU3A 5AJ3J 2JFDA 2P9CA 1HYSB 2OPPB 1ZTWA 3FQKA 2AX0A 1UVKA 4KGKA 3HHLD 2RF2B 4CH7A 2VU5A 1H74A 1KTQA 1T02A 1NH8A 4DR3J 1HW9A 4DPXA 4I2PA 3J81U 1I5OB 1VDHA 1TK0A 2ZJQQ 2VFTA 1FRLA 3AHPA 3DLEB 3T5LA 4P2MA 2B6AA 4DSLA 5K5MA 5CA5A 4O0NA 2QZ8A 3T6BA 2G0CA 1HKAA 4Y00A 2W2NP 3O3LA 4DQRA 2HGNA 2Z2ZA 1PIEA 1VQKS 3JAMU 3VAFA 2PFDA 1VHIA 4FYDA 3IP0A 3MPYA 3N28A 1J27A 1UMJA 3OTOF 1HNWF 4B9MA 2CQ2A 2O3DA 3S8SA 3D5MA 4KKOA 4IO9Q 1NJYA 4YQWA 5HJYA 1K9MT 2RILA 1N32J 1NDCA 1IXKA 3AD8C 1S9GB 4F67A 2QGFB 3SV4A 5ETLA 2R42A 3CUNA 4A8WA 3BO2A 2FLOA 1NB2A 4EMDA 3OVBA 1YZ7A 3MURP 3NP5A 3QJPA 1D3WA 4L3NA 4JV5J 3LF0A 4IO1A 4M5HA 3KK1A 4YR2A 4PWDA 1NZ8A 1VK8A 4DL0C 2XMMA 5E5NA 2H5JB 5KG7A 4O3PA 4K4WA 2FPHX 3ILOA 2QA2A 3G6XA 3CCJS 3DMJB 4S0MA 2B7CB 2DD8S 4FZVA 4BC7A 2R8HA 2D1CA 1LWEA 2LEAA 5J2NA 2RF2A 4N47A 6AT1B 4FKXA 4JI0J 1AYEA 2WVFA 3D6FB 3GIIA 3AD7C 4HKQA 4JI7J 4MK7A 5KOWA 2KN4A 3W9IA 3M2RB 1RSCA 4NYZA 2CQ1A 4DQPA 2EK1A 2AT1B 3NY0A 3LGHA 2VPXB 3DLEA 3SYZA 4JYAJ 4P2XA 3WIUA 2GCFA 2A3JA 1UVIA 3NAHA 3WDOA 1OYDA 2MLYA 3OTDA 4FYXB 4B08A 3HVTA 1FRKA 2IM0A 2KKHA 4KE5A 5CYJA 2VQFF 1PC5A 3KJVB 1TL3B 1NK5A 4IH5A 4Q44A 1ZS6A 3TUZC 2A1BA 2X7IA 1A9NB 2G1HA 4ILLA 2JEFA 1TFYA 1YDLA 1WOPA 2OPSA 4JI8F 4TQRA 1HD0A 1MLAA 3GR1A 3ZZZA 1UWBB 1HHTP 2ASLA 3R97A 1TK8A 4NA2A 1NPRA 3UFCX 4DWIA 2DH7A 5L46A 2DHAA 2R7WA 1B99A 2GVDA 4J9VA 1XMBA 4WIQA 2HWTA 1ZAVA 3OHBA 2IVMA 5KFLA 2WVDA 4A8KA 3CMAS 1NRKA 1OY8A 1GT8A 5CQGA 2LQ5A 3FCHA 5KFUA 1UPPA 3DMJA 2DXDA 2ZHAA 1U2RA 2ZJRQ 4PUOB 5DDOC 1Y3KA 5LSLA 2JVRA 1XC9A 1U1NA 3F44A 3GILA 3RUBL 3WZ0A 3BPSP 2HS0A 4U6PA 1U0SA 2C3OA 4O0IA 4OYPA 4B02A 1VIOA 3CCMS 4X4SA 5KFMA 2A6MA 1U1LA 2HHTA 3E01B 1QY7A 4OZ3A 2WOMB 5I4MA 3HFVA 3QRQA 1KVJA 1ZAWA 4NCAA 2CJBA 3GCWP 4ZKAA 5ITHA 2ZVSA 2BQUA 4O3RA 4DV0F 3HJVA 3B4MA 1YLXA 3QT7A 1QLNA 5DDRC 2E1RA 2AJ2A 2YNHA 1FE0A 3I87A 5HBMB 2J0WA 4JI4J 4M5IA 2RQ4A 2CVEA 4UZCA 3BN4A 3Q89A 2EFQA 3VQTA 4DS5A 1BE4A 4FBUA 1HNVA 1UWBA 1F5CA 4PG6A 4A8FA 1CQNA 3N01A 3N0VA 1F2GA 1AUDA 4ZPBA 4OIXA 2ATLA 1TMMA 3HSJA 3AB2B 4ZVRB 3ISND 2LQ9A 4DSEA 1U8SA 2B3TB 1IKYA 5CH7B 2F40A 3NGUA 3GIKA 1S1TA 2QA4G 1F9HA 5A2QY 4WF9Q 3THPA 4OMFG 4UQTA 3W7BA 3TUPA 3W66A 4DL5A 3ZTOA 4ID8A 1RLCL 1OWXA 1NK0A 3I96A 5A2QU 1WHXA 1IWGA 2W9CB 2B56A 2IJNA 2G2YA 3CCQS 2MSTA 3KHLA 3DDIA 1XNQF 3IC1A 1HQUA 1SJ4P 4KIAA 1MWQA 1NU4A 3VR1A 2MHNA 2COLA 4QWAA 2WSEC 2QG9B 2B4OA 1U1OA 4TY8B 1ELOA 4IDKA 4ELVA 2E5HA 2R7QA 3POTA 4EO6A 1UZHA 4O3QA 3P8BB 2EG2A 2HWHA 5FD1A 3MOZA 2IAJB 1SJRA 4DV5F 2FVPA 3BB5A 5KG2A 2GFFA 5KFRA 5HBMA 4OV6A 2LCWA 3SSQA 2GC8A 3C6UB 2JLFA 3NG8A 3RU0A 5KG6A 4F4ZA 3CCRS 3LW5C 1F1BB 2JJ4D 2QYGA 4I0WA 4BWMA 4CM0A 2WCXA 4B3MF 1Q16B 2A18A 2XC9A 2YNIB 1W25A 2RDJA 4DR2F 3PJ9A 3MTKA 5IQQA 2CPHA 1WKJA 1U4BA 2BEFA 1HNZF 4CP5A 1JIHA 3J80Y 2CPEA 1RHKB 2W4DA 1S1XA 3MMBB 2PMZD 2MQNA 1MU2B 5F9NA 4Y2IA 4NEZA 4LF4F 4CLUA 3ITHA 4F02A 1FDDA 3J80U 1TTHB 5LXYA 3OR1A 5CHCB 4DUYF 3IN5A 4ZCKA 2DB1A 2ZJPQ 3H5XA 1NLKL 3M30A 1XMOJ 3R3TA 4NE9C 2OSRA 3I4HX 3H2UB 3CTRA 1AA1B 3TEGA 2DNZA 4CNYA 3ET6A 1UCNA 1QD1A 3GJRB 4ILRA 2E9RX 1RAGB 4BC9A 4ZA1A 1U1RA 5DG9A 4LF6F 2W9CA 1QTMA 1OSDA 3RB0A 2RT3A 1TKDA 3EX7B 3SV3A 5AE2A 2GZOA 4ZJQA 2EW9A 5IT4A 4GRSA 1UPMB 3QATA 4OZ1A 5K8OA 4X4QA 4P52A 4Z7YA 3WBZA 2Y0BB 1EQ0A 1IR2A 3CCSS 4WE1B 5F8JA 3N6LA 4MKAA 2LEPA 1CS4B 2R7OA 5D15A 1G4CA 2XI3A 4JB8B 4A8XA 5HMYA 3I82A 1RGVA 2MGZB 2AQ4A 1S57A 4YS2A 4C3MA 4OHYA 2V5HG 4YOEA 3C6UA 5LJ3Y 3D1HA 4KGMA 3CC4S 3FUYA 1X0PA 1N33F 2B9YA 3OW2R 2J0SD 1VIXA 1M5OC 2YNIA 2HNZB 2ZH5A 1BY9A 1N5VA 2ZHOA 1GTEA 4L6V3 2QMUB 1FXDA 1TL1B 1VQOS 5D4NA 4FF3A 1F9EB 2DIVA 1V3SA 5DO2A 4ZDNA 2CPYA 4TYBA 2LXFA 3H8YA 1Q7YT 1OO0B 3QO9A 5I42B 1QVFR 1S1WB 2Y1LB 4DQIA 3OHAA 2OGUA 4EGLA 1VI7A 1S7IA 4RR5A 3EVWA 4LBIA 4PZVA 3AB4B 4U8YA 4F0HA 4J9PA 3UR3C 3FSIA 2HFSA 1QAYA 4PAAA 3R7SB 1R6YA 4K4VA 1WF0A 2DNPA 1DURA 2W4CA 4CT9A 3LO3A 3HLUA 1XBWA 4DR6F 2E5GA 4NMXA 4EWTA 3DGVA 2B4UA 4NLUA 4G65A 2ZHBA 1S0MA 3HZGA 4WE1A 3I5AA 3A8IA 3ZNJ1 4F3MA 5B0DA 1H73A 4J9MA 5HN0A 2H54B 5IXUA 3OTCA 3PX6A 3H2LA 1S9FA 3DRPA 1U6FA 4M63A 3R9LA 2BJEA 4Y6IA 2LQBA 2KXHA 4CRJA 3V81A 1LFWA 3ZZTA 2RSQA 4HH1A 2JEJA 3GSDA 4IOAQ 3NLCA 2R8GA 2HNZA 3HHLA 4DV7J 4W4MA 2UUWA 5A0YB 4CLZA 2CYYA 1WC6A 4EO8A 2M7SA 4PG7A 2E1AA 2HLTA 1P1TA 2QFIA 4ZP7A 4O3NA 2HBQB 3MMCB 3TA2A 1AT1B 2J9CA 2ZWOA 4OZLA 2EBEA 1SQEA 1M1GA 1S1WA 2KT3A 2M70A 5J2MA 1XTZA 3LA0A 4M5NA 4C3LA 1JX4A 4F04B 2OLWA 3DRRA 3A1YG 1OYEA 2MJUA 3EDQB 3UI3A 3QGIA 1UW4A 1BWEA 2Y9HA 2X1FA 1QE1B 4Q7AA 5KFIA 3TWZA 1XR7A 2VA2A 2Z58B 2GHWA 5GAGU 3M1VB 4XAKA 4DCOB 3AAWB 3M8QB 4BWJA 4C0HA 1DLOB 1YRXA 1X5TA 1SKRA 2JNJA 2MEWA 2GJFA 1NB7A 5B09A 3NGSA 1RTDA
chains in the Genus database with same CATH topology
2XI2A 4XPEA 4NXMF 3CC7S 2B7BB 4BDPA 2MJNA 5L1JA 2VPZB 4IH6A 2R7SA 3LP0A 3ZC4A 4PG8A 3M30B 2J6TA 2Z8QA 2VG5A 3MTJA 4IG3B 4ERDA 2QSFA 3CVKA 4OJ1A 4R25A 2A10A 3KHRA 4FNHA 5J2QB 3BSCA 2AV5A 2W25A 2VODA 3JSRA 2AJ1A 1FKAF 1UP1A 2XZWA 4KBIA 4NA1A 2AYGA 1V6HA 1Y5LB 3KK2B 4C8NA 3K58A 4O3SA 2YX1A 4QW8A 1X5OA 3OUYA 3ISZA 4IOBA 4KPYA 3H2VE 1KC8T 3JSMB 1FVQA 1X0FA 4RLEA 4URGA 1FCAA 2NLWA 2O66A 2ROGA 2XLJA 1ZPWX 3AH6A 2QEXS 4JI5F 2HHQA 5A8KA 4HYKA 4Y2KA 1LW0B 2ZKTA 3SCIE 3VTIA 3OL7A 4RBTA 1N56A 5K8MA 4C8YA 4JI1F 1Y7PA 2VFSA 1WTBA 2XWYA 2Y1IA 2XMKA 1VJWA 1K8AT 5GAHI 4EBDA 3DLHA 2LDIA 3QIPB 2ZH4A 1YJWS 1EP4A 2BANA 1M1KT 2M4MA 2EKYA 1RT2B 3KNGA 2EFGA 1N34F 1PSDA 2DITA 3M4XA 1MWZA 5LMNF 2MKJA 4MYTA 1YTYA 2I9SA 3CD0A 2CPIA 2YKPA 3HZEA 4XO0A 1QVGR 1HARA 1IJEB 1N8RT 4MK8A 1VRTB 4FXWA 3AQOA 1KLNA 4G6VB 3TVZA 5B7WA 1D1UA 5DG8A 1FK9A 3CCES 4J9OA 4NLPA 4JI6F 4J9KA 2JOQA 4C8OA 1GH8A 4ETXA 4PQUB 5IQ6A 5BYSA 3TARA 4G1QA 1Q79A 1U47A 4B9LA 4IR9A 4I56A 2YKAA 3G8SA 4IQXA 4ZPVR 5A0YA 3QGGA 4ZPWR 4ECTA 4CIOA 3TVKA 2DHSA 1G7CB 1FE4A 1UFWA 3IGNA 1P1LA 4C0BA 5GVQA 4PXDA 4Y34A 5EGYA 1N0UA 1HR0F 3DOMA 1KHVA 3BGFA 3DYAA 4A47A 4ECZA 3OL6A 4G1IA 3MMCA 2VV5A 4WFAQ 4QYZJ 4F4KA 2DGWA 4WFZA 3IWNC 4HDGA 4AE5A 1N36F 4X4TA 3M9OB 2IM1A 2F7VA 4DS4A 1RAJA 4KFBB 3CD6S 3GZ7A 1J5OA 4Q5VA 3HO1A 3VAHA 1VHFA 2BRLA 3I0RA 3OBIA 2UXCF 1BD6A 3Q24A 1FRMA 1UA1A 2KB2A 5T7LA 3PZPA 2JLGA 1JLEA 3RB6A 1RI7A 2I8EA 2R4FA 2MMYA 3CCTA 1VQLS 4QR0A 3KNAA 4DPOA 1KTVA 1UFLA 1YJTA 2MHEA 1R27B 4WYLA 5KFWA 5F8MA 1G3OA 3J81Y 4O3OA 5F0UA 3UW1A 4KHPF 4CO3A 4X4RA 4KV8A 3DC2A 2OKQA 1JWWA 3VQSA 1UVNA 2U2FA 2RB7A 3DM2A 5LSRA 3DLKA 1REVB 1R0AB 4X64F 1R8PA 1FDAA 4IH7A 4L72B 2DR8A 4WZMA 2EWHA 4I6WA 7FD1A 4WFBQ 3PW7A 4WK3A 1TKZA 4DJBA 4RW4A 2FHJA 3PXGa 3M05A 5IM0B 4YB7A 2UUTA 1N5SA 5BJRA 3KLEB 1I94F 4OLOA 3IGVA 1F9FA 3Q8QB 2RUGA 4E98A 2KM8C 3KLHB 2QRRA 3UDCA 3TUJC 2WRMA 2J8AA 4DFMA 3MM8B 4QIEA 1HPZB 1FDBA 1URNA 5E3AA 4RW8B 1CPZA 2Z4PA 2LEBA 3M8QA 5GAEU 1TQLA 2I38A 4IFVA 3V6DA 3OPKA 4F4YA 1C1CA 3FSYA 3K8VA 3OFFA 1DLOA 5D4OA 1GTHA 3JAMY 4FF1A 4PXEA 3OLBA 4QIFA 3TO8A 1T95A 3TAQA 2VC1A 1G2EA 2B5JA 1JKHB 4MAKA 3E8OA 2FTRA 5KFSA 4YR3A 3SCJE 2KTQA 4V19J 1EETB 3QO9B 4M5DA 3GV7B 2GMLA 1NK9A 3CXCR 3G86A 4UOCA 1IQZA 2JFKA 4CO2A 3GFXA 4CO1A 5B0GA 3FMBA 4RBUA 4QR1A 4F4XA 1Q4RA 4HH0A 2UVRA 2W4PA 3JYTA 5D8HB 1Z2ZA 1SUQB 4C2MA 2MSSA 5F0WA 5D3GB 1LFPA 3FFIA 2XMJA 5I3PA 5KG3A 1WI6A 1NHVA 2AJ0A 3OL8A 1ZM4A 3J7Z5 4B9SA 1X9MA 3NGKA 2C2EA 4DV6F 3KK2A 1HI8A 2G13A 4GO5X 2DR9A 2HS4A 4X84A 4WKYA 1RKJA 2XS5A 2M9KA 2FJEB 4PPDA 4H54A 3Q22A 3KMQA 1N48A 4X2BA 5KFCA 2YTCA 1LW0A 2VONA 5KFHA 2U1AA 3ETOA 4ZOSA 4QJVA 2DGXA 5LXRA 3VAGA 3ENQA 3LGNA 2DR7A 2VOOA 2M8DB 2D7SA 2K8GA 4TNOA 1U25A 1RT5B 4NLOA 4IQMA 1X9SA 2I0XA 4RUCA 2BOPA 2GHVC 4UY85 1RT2A 1M5KC 3MM9B 2J76E 1JXLA 3VAKA 2IBOA 1TL5A 3G6ES 1TKTA 4NLXA 4QU6A 2EBGA 3CD5A 1H6KX 4DF4A 2PD1A 2CQ0A 2DGTA 1YJNS 1VRTA 1NH7A 2D3UA 2DH9A 3RR8A 3US5A 3W2VA 2RKIB 1Z2LA 4JI2F 4FF4A 3TR5A 1SI9A 1DQ9A 2C3PA 3HT3A 4PWUA 3SDEB 1KLMB 5JUMA 3DRSB 4K5SA 3IS9A 4URQU 5HP1B 1QSLA 1ZM3A 3M6UA 2PA3A 2XULA 4HT5A 4F25A 2ZOGA 4R5PB 5J1EB 1ZOTA 1NO8A 1TAUA 3MPWA 3PKMA 1KQFB 5E41A 1KOOA 4W90B 4CI0B 2AP6A 2CIMA 2CQBA 4EZ6A 2IMOA 2FD2A 4DR3F 4NLGA 1YI2S 4NLYA 1RT1B 2BM0A 1VBZA 3EPIA 2RU3A 3PJWA 4ED6A 3T5HA 1VQ8S 1TV6A 5GMKa 4ZK7M 2ZE2B 4KFBA 3HJFA 3OQ2A 2NS1B 2AU0A 3JSYA 1JLBB 2XGPA 2Z2MA 3AY0A 4WFYA 2BRKA 4C11B 1N6QB 2EVZA 3L3CA 3DRPB 2RD5C 2DRBA 2R8JA 1NZAA 4Y2CA 5HQ8A 1Q82T 2RRNA 3I5CA 4B9VA 2O5DA 1HYSA 5MLCV 2XS7A 4I68A 2OPPA 3MEDB 5KFGA 5J2PB 3H40A 3EZ5A 2OH2A 1VBYA 2YWEA 1JLFA 2BV3A 2V94A 3V81B 1DBDA 1IBLF 5F3TA 1YVFA 5C5JA 4RU9A 3C66A 3DFEA 2BR0A 4UUWA 4YY3F 1DTQB 1X9WA 4ED0A 2Y0SD 3KWMA 3SCKE 2XG8A 1REVA 1RT7B 3KG4A 1R0AA 2J7WA 2PFFB 4PRFA 2YWHA 1ZAXA 1OSCA 4MKBA 1Q7LB 2JC0A 3ISNC 5CZVA 4K4YA 1IQTA 2YNFA 3HHLB 1KNZA 2NZ4A 2VB6A 5IM0A 3V4IB 1GXTA 3KLEA 3ZFVA 3WC0A 3IBWA 2CPJA 4OHVA 1FERA 1X8DA 2GGPB 2NUHA 3D0IE 2LECA 4TU7A 1ZH5A 4DR5F 2VPWB 2YY3A 4W92B 3KK3B 3K5MA 2W8KA 1Q8BA 4RW8A 3IR7B 3GE9A 4F3OA 1C1BB 3R5DA 2HRUA 2DNHA 2E9ZA 2HQIA 3NS5A 3QGHA 1FA0A 4MFBA 1RT3B 2HFOA 1F5AA 3BO4A 2RS2A 3K7RA 1MSWD 3I6PA 5I3UA 1R89A 1N32F 2MYFA 4TY9A 4NLSA 1QUVA 3N4WA 5KFKA 4ECRA 5SUHA 1AXQA 1NK6A 2RVJA 2XMTA 2D41A 4YEAA 3SQGA 5DGBA 4DN0A 1NKEA 2J7UA 1CLFA 1WELA 2QLXA 5J2MB 1NK8A 1ZPVA 3GMGA 2PIIA 4D3HA 1S72S 4KJIA 2IRXA 4YHHF 1VBXA 2OMLA 3F56A 1SUQA 2MKSA 4O4RA 2EI5A 1D8YA 3DRRB 3IWXA 4CTAB 2A2DA 2HGMA 2HHPA 3TQ1A 1XR5A 3G9CA 3H25A 3CDBA 4K0KF 4OZJA 3JTPA 2G4BA 2OTJS 1NK4A 1DARA 2KT5A 1H98A 4OHWA 4QWCA 3K59A 2RQCA 3MI7X 1FESA 5F8NA 2FVSA 3MM6B 2JEIA <