2LYVA

Solution structure of the two rrm domains of hnrnp a1 (up1) using segmental isotope labeling
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
GSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing, transport protein
molecule keywords Heterogeneous nuclear ribonucleoprotein A1
publication title Solution structure of the two RNA recognition motifs of hnRNP A1 using segmental isotope labeling: how the relative orientation between RRMs influences the nucleic acid binding topology.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lyvA02
2EK6A 3Q2TC 2A3JA 2XS7A 2V94A 2VONA 2CQIA 5DDRC 1JJ4A 4Y0FA 3TYTA 3VAIA 1WG1A 3P49B 2M8HA 2N3LA 1N52B 3G8SA 2DNLA 4WFNQ 1FNXH 2CPZA 1U6FA 2LCWA 2M0GB 2DO0A 1VQ9S 2J8AA 2MSTA 1FJ7A 1UFWA 1U6BA 1DHMA 2E44A 2MKCA 1YJNS 4J5OA 3BO3A 2KI2A 1P1TA 3MUTP 1WELA 2BZ2A 2AYEA 4OZ0A 4WKRA 1OWXA 3H2VE 4F26A 2VODA 4A8XA 2MGZB 2PEHA 2AYBA 2HGLA 4YUDA 5DM6Q 3NS5A 4TU9A 2UP1A 4F02A 1VQ5S 2MQOA 3VAMA 5CXTA 1SJFA 1X5OA 2KXNB 2X1BA 3J7ZT 2G0CA 2HZCA 3UD3P 1UP1A 3ZZYA 3CC2S 2F9JA 1A7GE 1FJEB 1WF1A 1VBYA 5IQQA 1R8PA 3VAGA 1L3KA 1YIJS 5GAHU 1Q86T 1KD1T 2KHCA 1X5PA 1N54B 1WEZA 5DETA 3CC7S 2QFJA 2RRAA 3FEYB 3MD3A 1A9NB 5IFMA 1M5VC 1OIAA 4LMZA 3EGNA 5ITHA 2KG1A 3G96A 3EX7B 1H6KX 2VOPA 1WF0A 1U1PA 3PIOQ 1S79A 3MUVP 1K73T 4RU2A 4QU6A 4W92B 4ZKAA 2LYVA 4M5DB 1U1QA 1U1KA 2LEAA 1XN9A 3OW2R 1VBXA 2N82B 3UCZP 2DH9A 3JB9k 2CPFA 1Q82T 4QQBA 2MSSA 3S8SA 1WG4A 2AYGA 1D8ZA 1FJCA 4W90B 1Q81T 2DK2A 1VQPS 2MGZA 1WI8A 3U1LA 1VC5A 2EVZA 2RQ4A 2RS8A 2LMIA 2N3OA 2KH9A 2CQ0A 2GO9A 1FHTA 1JMTA 1URNA 2CPJA 1KC8T 3V4MA 2FC8A 1X4GA 1NJIT 1ZZFA 2O3DA 4CH0S 2XS2A 2MKJA 2MY8A 4YOEA 2MY7A 4WFAQ 3HI9A 3K0JA 2YH0A 2KXFA 2MKSA 3R27A 4U67Q 2G1DA 2F3JA 3VAFA 2CQ1A 2X1AA 3CMES 3THTA 2DNNA 1N8RT 2BOPA 2E5JA 5LXYA 2CPXA 2D3OR 1WEXA 3CUNA 3CCQS 2KRBA 1G2EA 2MMYA 2FHOB 4TLQA 2RUGA 2CQGA 2DHAA 4Z2XA 3DLLQ 3FEXB 1W2BR 3MD1A 2DHGA 4F25A 2DGXA 5CYJA 2DGSA 1R8HA 2I38A 1PGZA 4C7QA 1M1KT 2DNGA 1VC0A 2MYFA 2CPEA 2DNKA 2QEXS 2NZ4A 1RK8A 5LXRA 4FXWA 3NS6A 5CA5A 3Q2SC 2PE8A 1VQLS 5FJ4A 5BJRA 2M52A 4LIRA 2DIVA 2MQLA 3UE2A 3G4SS 2VOOA 2CQDA 4CH1A 3MXHP 3VAHA 2MZTA 2LEBA 2CQ3A 1M5OC 2D9PA 2MQNA 2U2FA 3CCMS 4TU8A 3LPYA 4Y00A 2WBRA 3MUMP 3CCLS 1SJ3P 2KG0A 2HVZA 1O0PA 2JX2A 2CQCA 1WEYA 3I56S 2M70A 5LJ3Y 3BO4A 2LECA 1WF2A 4PKDB 1M90T 3CC4S 3UD4P 1U1LA 2B0GA 2KVIA 5D77A 3ZZZA 2RS2A 4ED5A 1WHXA 3J7YU 3CF5Q 2DB1A 2DGUA 3MURP 2CPHA 2L41A 2CPIA 3US5A 2DGVA 3BO2A 3D2WA 3CULA 2X1FA 2MZSA 2RT3A 2N7CA 4IUFA 1S72S 1X4HA 1X5TA 2OSRA 5LSOA 4UY8T 5D78A 2RVJA 3CCUS 1BY9A 1M5PC 2X1GA 2DNRA 2K8GA 2MQMA 2AD9A 1RKJA 2RRBA 2CPDA 1DBDA 2DHXA 2J0QD 1JJHA 1WHWA 3H2UB 2LXUA 3N9UC 2LQ5A 1WG5A 2DNMA 1YI2S 2OTLS 5H1SV 1VC6A 2HYIB 3P5TL 2FC9A 1X4BA 1QM9A 5HL7Q 2CJKA 2MKIA 5JVGQ 2DNPA 2MKKA 1JJ2R 2DITA 2ADCA 2KT5A 2F9DA 3MI7X 3U1MA 2E5HA 2ADBA 3CCSS 2DH8A 2MKHA 4CQ1A 1DRZA 1YTYA 2OTJS 2DGQA 1UW4A 1H2UX 1VQNS 2DGOA 2LXIA 3NNAA 5JVHQ 1X5SA 2D9OA 3SDEB 3R1HA 1X4DA 5DDPC 2LKZA 3RW6A 1HD1A 3IRWP 1NO8A 1WWHA 1KQSR 1QVGR 2DGTA 1U1RA 3MDFA 5IM0B 3RW7A 1P27B 2DNQA 2YH1A 1VQ7S 1X4FA 3G71S 2CQPA 1VQ8S 2DNOA 2YKAA 1DZ5A 2NLWA 3UCGA 2MPUA 2XB2D 2MB0B 2E5IA 3CCES 2M7SA 3VALA 3PIPQ 2YTCA 3B4DA 2KN4A 3B4MA 2MJUA 1VQ6S 3TP2A 3S6EA 3NMRA 3HHNB 2ERRA 4C4WA 4WCEQ 2K3KA 2U1AA 5GMKa 2FPHX 1X4EA 1UAWA 2MQPA 1SJQA 2RQCA 3CXCR 2JVOA 2CQ2A 1YJ9S 1U1OA 1VBZA 3BEGB 3MOJB 1KOHA 5DDQC 2ZJRQ 2CQHA 2KXHA 4CIOA 1OPIA 2DNHA 1U1NA 4UQTA 2M88A 1SJ4P 1U1MA 3CD6S 5DDOC 2DNZA 3SDEA 1X4CA 2XS5A 3SMZA 3VAKA 3SXLA 4C0OC 2HGMA 5HO4A 4EGLA 1WI6A 2MXYA 4ERDA 1FO1A 3G8TA 2DGWA 2DNYA 2SXLA 2XNRA 4BS2A 1YJWS 5IM0A 2KU7A 1K8AT 1X4AA 1YITS 3EGZA 4PR6A 1SJRA 2JRSA 3CCRS 5EN1A 2ZJQQ 2KYXA 2KM8C 2Q79A 2J0SD 2XNQA 2RU3A 3CPWR 4WFBQ 2J76E 4V19X 1WHVA 4YB1P 1K9MT 4IOAQ 2M2BA 3R1LA 2M9KA 1FXLA 3CMAS 1NU4A 2FY1A 3S7RA 2DISA 2CQ4A 2DH7A 4WF9Q 2DHSA 4PRFA 2M4MA 2ZJPQ 1U2FA 1VQMS 2MQQA 3G9CA 4TU7A 1F9FA 1WTBA 3NNHA 3UCUP 1YHQS 4OZ1A 3L3CA 1D9AA 1WHYA 1IQTA 2DIUA 1M5KC 3TO8A 2KRRA 5MLCV 3NNCA 2LA4A 4QU7A 2MZ1A 1VQOS 2MZQA 3DXBA 2RNEA 2CPYA 3ULHA 2OSQA 1H2TZ 1KOOA 5GAGU 1ZH5A 2JWNA 4QPTA 4IO9Q 2MZRA 2MJNA 2AYMA 2CQBA 2JVRA 1YWXA 3IWNC 2OJ3A 4IOCQ 2KM8B 1QVFR 2GHPA 3I55S 3G6ES 2M8DB 3P6YC 1B7FA 1HD0A 4P6QA 4WIIA 1Q7YT 1PO6A 2L9WA 2DO4A 1CVJA 2E5GA 3CCJS 1AUDA 3CCVS 1H2VZ 3BS9A 2QA4S 5DM7Q 3VAJA 2MZJA 3S01A 1VQ4S 2EK1A 1HA1A 5GAEU 3CTRA 2I2YA 1HL6A 2XSFA 3VF0B 1VQKS 2L08A 2G4BA 2KFYA 2YWKA 1ZZNA 4LJMA 3P3DA 1N88A 2LA6A 5LJ5Y 2HGNA 1SXLA 5GVQA 1X0FA 1FT8A 2MHNA 2OIHA 4FXVA 5LSLA 3LQVA 5GADU 1OO0B 3UWTA 3THPA
chains in the Genus database with same CATH superfamily
2VIHA 1LWFA 4M5GA 4OZJA 3HPOA 1NSKL 1T9TA 2PC6A 2M0GB 2CA9A 1FJ7A 1T3NA 3T5JA 1MG7A 3IP0A 5A8RA 4OZ0A 3GIKA 4WKRA 2BJDA 4DFPA 3H20A 1N5VA 4F02A 5HVFA 3W8PA 1SJFA 3IWXA 3X3UA 2IFXA 2Q6CA 2KXNB 3R5BA 3ZZYA 3IFEA 1PYTA 2UV8G 2G2OA 4ZP9A 2C42A 4H4KC 5I3UA 4DX5A 3BR9A 2O67A 2HEKA 4ZN3A 1YZ7A 3PR5B 2ZHAA 3M8ZA 1H7WA 4NZ0A 4KJIA 3LAMA 4QU6A 1UWBB 4PG6A 2C2KB 4OZLA 3TVZA 1HWKA 5HQMA 3EVMA 2O1PA 2UUCJ 1WI8A 2J9EA 2R2RA 1RWNB 3T41A 4C8LA 2GO9A 1DQAA 4JI6J 2CPJA 4Y2KA 1IKVB 4RZRA 3OVBA 3PYGA 3GZ7A 1FVQA 4K4VA 2A18A 2DRDA 3GPAA 5E3CA 4L3NA 2E5JA 5J1EA 2AIRB 1N6QB 4TN2A 2F1FA 2V63A 1ICEB 4F25A 2BE9B 1YBAA 5F8LA 8RUCA 1HW9A 2ILZA 2B8QA 5ETVA 1KQKA 5CA5A 2CZ9A 2DIVA 1H38A 3GQCA 2MZTA 2ROPA 2D9PA 3EZUA 2KFZA 2JX2A 4DV1J 3IG1B 5D77A 3HX9A 3PX4A 1BLUA 4KO0A 1L3SA 1WHXA 2E7XA 2W9BB 4USUA 2AF6A 2F8HA 3KXDA 2RT3A 4Z7CA 1S72S 3MEDA 4B02A 2FQQB 2DRAA 5B0EA 4WXOA 4KE5A 2KB2A 2KFNA 2LQ5A 4YDDB 4DL3A 2R7SA 3PRDA 4BC9A 1QM9A 1KDNA 3OV7A 5KT4A 5CZVA 2EFPA 4DV0J 1UVMA 1IVZA 3CCSS 1F2HA 5GAEI 1Q8BA 4ETXA 3HFKA 2AZ1A 2G9OA 2F65A 1S76D 4ZPVR 5DRKA 3PHEA 3IM8A 1QVGR 1SIWB 1U1RA 1QE1B 3IR6B 5LMUJ 1VQ8S 1U24A 5KFUA 5DQGA 4PUOA 2XB2D 2DEJA 4QWCA 2ZKTA 3GILA 1R8AA 4K50A 3BBBA 2MKYA 4B3MF 3KLHA 4GVLA 1DLOA 5KFKA 3PX0A 1QJHA 2EC0A 5KT2A 2JOQA 1U1OA 1F9EB 2HS0A 1F6TA 4RR5A 3ET6A 1S57A 2HQIA 1NJXA 3I82A 3ZTOA 1REGX 1BQNB 4IR9A 5L1KA 5C25B 2C3OA 2DGWA 4LVNP 3ETMA 4QYZJ 3K5LA 2LQJA 4DLGA 1TKXB 5BXIA 5E3PA 1IKYB 5HJXA 2VBWA 1RWKB 4X4OA 1S1UB 3RBZA 1BMQB 4DCPB 3VZIA 5J2QA 3UDCA 2HS4A 4C11B 2GVZA 3R1LA 1CQNA 1N5QA 1TL3B 4EZ9A 1JKHA 2O01C 1F5BA 4X64F 1U47A 1OSCA 1D09B 1E6YB 4ES2A 1WHYA 2ALYB 3UPFA 3I0SA 4NLXA 3TO8A 1NK6A 2PMZD 4P10A 5FDLB 3GE9A 1VQOS 3ZC4A 3KFWX 2GZOA 1P1LA 2CNNB 7FD1A 1EARA 3RYLA 2IMWP 5G0RA 4ZPDA 2ZDOA 4DR5J 2X7IA 2DHHA 2N4CA 2JL9A 3FRYA 4B3RF 1TV6A 2VFTA 1MU2A 1AW0A 1AZSB 1QSSA 1VQKS 3P45B 5H9FK 1U0SA 2ZDPA 1NHKL 5E7OB 4H4OB 2AJ0A 3T1HF 2HGNA 4LR8A 2BE2A 4CO0A 1FT8A 2OIHA 3BGLA 1B0TA 3LGNA 2RE1A 4WBFA 4U8YA 3IR5B 2GVDA 4HLBA 1IR2A 2ZM6J 1U6FA 4FF1A 2J8AA 1Q8IA 2E44A 3I5BA 1KFDA 4ZVRB 3MUTP 3T9NA 5IXUA 2WOMA 4USWA 3H2VE 1XBWA 2HNDB 2QYGA 2AYBA 1NLKL 1WKLA 3NS5A 2MQOA 4BHQA 4NA2A 4P71A 1VOMA 1TKZA 5DETA 1A9NB 3DFEA 1TMJA 1S48A 3KLIB 4F67A 3HHKA 4NE9C 1N5TA 3BGOP 3QGIA 4B3MJ 4RUBA 4A46A 7AT1B 2N82B 1ZA2B 4O4GB 4QQBA 2MSSA 2RAQA 1MN7A 4DCOB 2ZUAA 3VGTA 2JEJA 1S9GB 4J9QA 3V6JA 1PSDA 2OPPA 2MKJA 3C6TA 3IS9A 2DBBA 2GJFA 4AE5A 4P7TA 1FEEA 4IH5A 4RWWA 3GB0A 1JWWA 2DHAA 3HSGA 4TVAB 4UW2A 4W98A 4JUZA 4OX9F 5BR8F 3MD1A 2JEIA 1DAXA 2GW8A 4A47A 4ZVHA 1R43A 2CPEA 2DJWA 1SL0A 4URQU 2NXNA 5BYSA 3JYTA 1KKHA 2ZUGA 5C24A 1LXJA 1XMBA 2CQDA 3K57A 1PIEA 4DCJB 4CH1A 3HLUA 3QWUA 3CJKB 1IQZA 3CCLS 4JI8F 2OGUA 3W2VB 3G87A 2C3YA 2ALZA 2ZOMA 1TUVA 4OV6A 1PBAA 2DB1A 4ED1A 2YBVA 3N0VA 1U6ZA 2L3MA 5KFLA 2DGVA 2FYXA 4KKOB 1EKRA 1X5TA 4IFVB 2AQ4A 4JB8B 3D3BJ 1JLQA 2K8GA 2AD9A 4NYZA 2FJEB 1FXRA 2J0QD 3KG0A 1YI2S 4N77A 3MPWA 5D4LA 2IVFB 4YY3J 1RAIB 3T1HJ 2F9DA 1L3TA 2XWYA 1N48A 3I0RA 1Q16B 3M32B 3MOZA 2HLTA 2EFVA 5KFBA 3CCWA 3RW6A 2IJNA 1C4AA 4DUYJ 4LSZB 1RU2A 1VRUA 3W5XA 3J81U 5KTQA 2HMIB 1WC6A 2KJVA 2M7SA 2HHPA 3MPYA 2WONA 3PIPQ 5I3QA 3TP2A 4IRDA 4X4NA 4MFBB 4PQAA 2HVDA 4FYXB 3C14A 2UVWA 4JI2J 2R8HA 3NMAA 4CP5A 5DQIA 1NJWA 2BE7D 2CJYB 1CS4A 4KGKA 4AUKA 4ERDA 5GAHI 4F7VA 5IM0A 2YX4A 2ASDA 3CJ8A 1RKIA 3CB4A 4B08A 4F04B 2BKNA 3K5NA 5EN1A 2AJ2A 2E5LF 3QBCA 3ILIA 1TL1A 5ETNA 2XBPA 2HBYB 3S7RA 2QN6B 1N5YA 4FF3A 2AT1B 3PXGa 1OMSA 2UUWA 4ANEA 4P75A 1KQGB 4KTQA 1U48A 2FHJA 4ALZA 1M5KC 5KFSA 4HKQA 2FHJD 5EX0A 1FRXA 4ZVEA 3J81Y 1SKWA 2MZRA 4Y2AA 2CZVC 1D8YA 5K9FA 3IWNC 5D0RA 3GMGA 4QW8A 3JXOA 3GFYA 2Z4PA 1U2RA 4DX6A 2MEWA 4U6PA 2HHUA 4OI3A 3E2EA 3X1LB 4QYZK 4JI1J 4L75A 3VAJA 5D4PA 3B8HA 3S01A 1D9DA 3C2PA 2J6TA 2W4PA 3OTOF 2VJVA 3FBCA 4Y28C 3MECA 2Z2LA 1VISA 1PG5B 2YWEA 3AD7C 2JJ4D 5JUMA 2HBRB 3E01B 2V94A 4X4RA 3MCSA 1GAOA 3MTKA 4NMLA 5B08A 3J7YI 3VAIA 3JSMB 1HNIA 3BKUA 1N33F 3EJMA 4ZN1A 2CDRB 2YKMB 1Y10A 1U6BA 5ETOA 1Q1KA 4USHA 1MROB 1RT7A 1UJ4A 2Q6BA 4NLRA 3LGHA 3NGUA 5KFZA 2PEHA 2Y1RI 5DM6Q 1TL7A 1VQYA 4U7UK 1RTZA 1JB0C 1KLMA 3PDNA 1APSA 4NLYA 1CG2A 3J7ZT 3UD3P 2DR6A 2V2QA 1M1HA 1N34F 5KFNA 1V5IB 2BA9A 3OLAA 3EGNA 3UN3A 2KG1A 3EPIA 3OHAA 4ECSA 5AE3A 1K73T 2Z30B 1WKKA 2NS1B 4C6AA 4JI3F 3MM8B 4ETZA 3PHTA 5L9NA 2V9KA 4I1TA 5EUHA 3OBIA 2LMIA 5KFYA 3F56A 3K58A 4HR2A 3GIRA 3V4MA 3MAAA 1IN0A 2MY7A 4D3GA 2HURA 3CMQA 3AODA 2DXEA 1M0SA 2V4RA 4QWDA 1U25A 4USMA 4IQMA 2JSXA 2XLJA 4JI5F 5K8NA 3GP9A 2BXJA 1BXNA 3M8WA 4MT1A 5D4OA 2BANB 3KNGA 5THWA 1GMWA 3EICA 2I38A 1GMWD 2DNGA 2K06A 2EFNA 3RAXA 2QLXA 1I5OB 4NCGB 2PE8A 5B09A 1I94F 1VLYA 4RPFA 3G4SS 4MYUA 2ZWOA 4DPYA 4FVCA 1T9VA 3Q0AA 4UOCA 3BN4A 2R7XA 2LECA 1WNEA 4MIWA 2XEXA 2IPOB 3ZXWA 4IO1A 4DG1B 1S4FA 4I67A 1S1WB 3V2UC 3Q8PB 4DPWA 4J7CA 3BGRA 4YQWA 4N8OA 4Q2LA 2OSRA 5LSOA 4DS5A 5D78A 2HZVA 2EBEA 1YRTA 2HAIA 3QT6A 3SQGB 3OHBA 1C0UB 3DRSA 4A8QA 3H2UB 1WG5A 4ZHRB 1SV5A 2W2PP 4CQ1A 2QTWA 1YTYA 2BJ7A 1UW4A 1TR0A 3IBWA 2ZD1A 2N4DA 1L5UA 2JLEA 3BH7B 3IRWP 4B3TF 2AEJA 4UOGA 1XR7A 3MDFA 1FRKA 3RAMA 4HH0A 4DL6A 1IM4A 3CCTA 4ILLA 1HNZJ 4W4MA 1PYSB 4HDGA 1RT3A 2KN4A 2R4FA 2Y1LB 3R6GB 2XYPB 1HBOB 1R7IA 3NLCA 1C1CA 4CTAB 1XMQF 2QMXA 3HULA 3MOJB 2VC0A 1X0PA 5SUHA 1XNQJ 4ZPTR 7FDRA 1UVLA 1IJEB 4J91A 4DSEA 1KHWA 2MXYA 4FS1A 4HT7A 5KFCA 3QO9A 1FKOA 1XJWB 2P9EA 5F0WA 1YITS 3ZZTA 5KFTA 5CHCB 2V5HG 2K2PA 3IAM9 5HBMA 1VRTB 4UOFA 1HFEL 5CYQB 3H5SA 1AROP 4CLYA 5A8KA 2M2BA 2WVBA 1T95A 4WK1A 4DQIA 1ZS6A 4FYYB 2DISA 2CQ4A 3SZ2A 3BBFA 4UZBA 2FZKB 2P8IA 1IQTA 4E8UA 4G65A 4O23A 1R31A 4DV4F 4FXDA 2XC9A 3KHRA 1EETA 1FFSB 1HNWF 3DKDA 4DR3F 4ZLLA 2PMHA 1GNKA 2RDDA 3W7BA 3M30B 4FP9A 4ZCKA 2RF2A 2CFXA 4WE1B 5AJ3F 4OI1A 2ZFHA 3HVTA 2B4OA 1HA1A 2W1BA 3VQTA 3K5OA 4X4VA 3QLHA 3D0HE 4G3IA 1EP4B 5LL6d 3U02A 4TQSA 1KR4A 1RSCA 1RP5A 1GEHA 2V2ZA 2A2CA 4Q45A 3THPA 2PSZA 3TZWA 2A3JA 4LF4F 1WC4A 5DDRC 1EB0A 5J2PA 3TYTA 3TAMA 1AT1B 1RAHB 2H4WB 2DO0A 2IBOA 2MSTA 4WZQA 4DOZA 1S97A 2V67A 1WORA 4F4WA 2C28A 4JYAF 2XLKA 3G6XA 2UUBF 3FSIA 4AL5A 1NDCA 3M2VB 3M6UA 1NZAA 5D15A 4HH1A 2UP1A 5B0AA 3ILOA 3MM7B 2PN6A 2B8PA 4B9VA 1NSAA 4LIWA 1KD1T 1MLAA 5HP1B 1N54B 3GONA 1JXEA 4WP3A 3K5PA 4FYVB 2XI3A 4WPAA 2KVQE 3MPDA 2LYVA 5M2UA 2LEAA 1XN9A 4J37A 1VBXA 2DH9A 3M8SA 4M94A 1KONA 4DR1F 4ZMMA 1XMQJ 4IH7A 3VQSA 3V6DB 3L09A 2A10A 3T19A 2N3OA 5T41A 4K4XA 2CQ0A 2YNHA 3ILJA 2Y1IA 1DJ0A 4DU8A 2C2EA 2XO6A 4WFAQ 2EFGA 2UUAF 2J5AA 2DR7A 2W2MP 4ED6A 1S4EA 3DLGA 1VBKA 3V6KA 3OJSA 1YZ6A 4WFYA 4TY9A 2KT2A 4NLGA 4E98A 1N36J 4UF4A 4PEOA 2OPSA 3KHLA 3TA1A 1VQLS 2MQLA 2VG7A 2O66A 4EBDA 2CG8A 4Y00A 4DV4J 4O0NA 4DR7J 4LFBJ 4GC7A 1UETA 2ZE2A 4OZ2A 4FKYA 3W3SA 5T7LA 1RA6A 4PPZA 1IBLF 2MZSA 3HD1A 3QGGA 3QJJA 3I32A 4BWMA 3K8VA 3TUPA 1M5PC 5CAAA 1B3TA 1IBKF 3BYPA 2OFGX 3DM2A 4MTPA 2HYIB 4CLWA 1HNXF 4GMKA 2EXUA 3DMJA 2JHEA 4L74A 4GVBB 4J9PA 4DLEA 2NZCA 2LXIA 3VR1A 4FPRA 5AXNA 4RUAA 4ZIVA 1HBNA 3RW7A 2DNQA 1F5AA 3G6YA 4IG0B 2YKAA 2NLWA 4RUCA 2GC8A 3H40A 1M1GA 1R0AB 4JYAJ 2UUBJ 3D6TB 2X51A 1DQ9A 1K47A 4K2JA 4CNYA 4C4WA 2UVVA 3CDUA 1REVB 3R5JB 2UU9F 1G7CB 4I2QA 2OUGA 4NLTA 2J9DE 2PI4A 2DNHA 1U1NA 1A0OB 4ED4A 1DY3A 5D0HA 1WI6A 3NBPA 3E51A 2SXLA 2OPRB 4N8NA 3MM5A 4NXMF 3WX8A 5KFFA 2W7OA 3TI0A 2NXJA 2ZJQQ 1NH7A 2KYXA 5LMNF 1RZMA 4WFBQ 3B82A 5G4DA 2BJEA 3TW0A 1N0UA 4PUOB 1S6QA 5U47A 4WK3A 2FJDB 1UVKA 4OZ1A 1DARA 3DRPB 5ETQA 4QU7A 4ES1A 1UFLA 1V3SA 4ITSA 3TVKA 3WX4A 3FGVA 5GAGU 1E6VB 1RBLA 4QPTA 2MJNA 3DI6A 1VCTA 4F36A 3LP1B 4NLDA 2VG5A 3P8BB 3I55S 3GSDA 2ASYA 2XSJB 3P6YC 2HRTA 5FLXU 3OUYA 1Q7YT 3N01A 1RLDA 2W4CA 4UZCA 3T1YF 3CCVS 3WC2A 2VA3A 3DDIA 1R0CB 5HJYA 2HHVA 4LSNB 3FCHA 2OO4A 3KK2B 1BWVA 4EBEA 3UVJA 3ITHB 4H4MB 1ZA1B 5D4NA 2B7CB 3UWTA 3M9OB 1NJZA 4QIWD 4O3QA 4DEZA 2QA1A 1Y4ZB 4C8KA 3SCLE 1BE4A 4Y0FA 1NK4A 3H4BA 1BQMB 3V5RA 2ACYA 3TUZC 4LF8J 4IKAA 2YVSA 3QPIA 3ENWA 2KKHA 4F3OA 4C8NA 4ANDA 4TU9A 3VAMA 3M7VA 1MNEA 1X5OA 3CNQP 4LF7J 3MM6A 3A8JA 1SH3A 2R7QA 2C3MA 1FI4A 1OY6A 1VRQC 1VGYA 3OTEA 2BKOA 3NKYA 4K4ZA 5ITHA 4I2PA 1H6KX 1RTIA 1SKRA 3OSPA 1S79A 3K89A 4A8WA 2ZHBA 4DR6J 2MHEA 4I64A 2R7RA 1X8DA 2UU9J 1JLGB 1VQPS 4DV7F 3BQ1A 1WTFA 5LM7E 4JI7F 1QD1A 1TL5A 3H98A 2AP6A 3GIIA 2H3EB 3DOKA 4LR9A 4B9UA 1RDRA 4UY85 2Y0SD 2OFHX 4KR0B 2VICA 3KJVB 3HI9A 4GO5X 3OR1A 2LQBA 4NXMJ 3RG6A 3FQKA 5CCMA 2RD5C 2ZBIA 3THTA 1CJVB 2AZ3A 5I4MA 1S99A 3CCQS 5LMNJ 4M5DA 4K7QA 1KP6A 3R2CJ 4DSKA 3G6VA 2PFFB 1R8BA 2NPIA 5GMEA 4U7CA 3ZO7A 2YQ3A 1BGXT 4RW9A 1UEKA 3LP2B 1BWEA 3DRRA 2YKQA 2UXCF 1VC0A 2MYFA 1Q7LB 4CH7A 5LXRA 2FJWA 1GXTA 3DGPA 4DR4F 3W65A 3V81B 3KG4A 4WZMA 3R5GA 3G82B 3FMBA 2QG9B 3OPKA 1R6VA 3QIDA 2FJAB 2GO8A 2B0GA 1T0TV 5B0GA 1DQ8A 4KV8B 3C6TB 1J5OA 1TAQA 3EWGA 1MWYA 2X1FA 4V19J 1HWIA 2C2OB 4IUFA 1Q4RA 4CO3A 1BY9A 3T1YJ 3QATA 1ZAWA 3FSYA 3CW2C 2LXUA 5H1SV 1LEOA 4J9UE 4DUZF 4N47A 5F3ZA 3CJQA 1X9SA 4FBTA 3CJ0A 3EVOA 2ADBA 1N5SA 2POKA 1BUXA 1DRZA 4DSJA 3HKWA 4LF6J 2B4PA 2D1CA 4KFBA 2F40A 5ETSA 3ZTSA 1YBUA 1M5HA 3PTWA 1U2CA 2MPUA 2YX7A 2G0JA 1IBCB 2AGPA 2ERRA 1P6TA 1UAWA 1SJQA 5IV4A 3PNIA 4DXLA 4CIOA 4PQUA 3NXZA 4UQTA 3DOLA 1X4CA 4O4RA 4J9LA 2HNYB 3PW5A 3C6UB 4ZITA 1YJWS 1X4AA 4LFAJ 3QIPA 2VFVA 2VJUA 3CPWR 2JC1A 2I6WA 4A8KA 4V19X 4YB1P 3NCQA 2F8MA 3SEOA 5L39A 3EXCX 2LVWA 2WONB 1CULB 4YMEA 1KN6A 1WTBA 3T1AA 1YHQS 3L3CA 3I5CA 1HI8A 2H5EA 2YNGB 2B5JA 3UQSA 5HATA 3JSRA 4L76A 1SCJB 3IO1A 4DFMA 2BR0A 2EG2A 3KUEA 1RTHB 2CJAA 5AE2A 4M95A 2OD4A 4OHZA 3U27A 2D3ZA 2E1MC 2Z58B 2J8SA 4HVZA 2OPQA 1C0TA 5M2RA 2IIHA 1EJ7L 2AX1A 1NKBA 1HR0F 2J9DA 4P6QA 1RYSA 3AXKA 3VWSA 2WBMA 2VQEF 3MMCB 1S6PB 5I42A 1FFWB 3CDAA 3MM9A 1FJGJ 3D1QA 1MWQA 3GU0A 4QR0A 1TL1B 1DTTB 4DF8A 2NCKL 2WVFA 2KFYA 2YWKA 1C1BB 5B0DA 3C46A 2HWTA 3LANA 2PEBA 2RJZA 4TY8B 4ECYA 1RTDB 4LF5J 3U7JA 2XY7A 3H0PA 2G2ZA 4C3MA 3ENQA 4PWUA 2FY8A 1N52B 5ETTA 4K5RA 4HTJA 1KRPA 2MLZA 3PW0A 1P1TA 1AFJA 2XM3A 1WELA 2XG8A 3R6LB 2RKIA 1BHNA 1S6OA 1HPZB 2HGLA 4PWDA 2Z2ZA 3MMBA 3K5MA 1NB2A 4KGZB 1XMOJ 2G0CA 3M2RB 2WB1D 2E29A 4P2SA 3CJ5A 1RJJA 4F4YA 3BKFA 1WF0A 1GX5A 1C4CA 5ETKA 4ZVFA 3TR5A 1HW8A 4X66F 5AXLA 2CPFA 1Q82T 2JZ5A 1D8ZA 4UUXA 2KJWA 4NLSA 4G1QB 2XZTB 5K8OA 5CYMA 2J6UA 3EMTA 2R8JA 3HHDA 4DSFA 1P9YA 4QWEA 2RS8A 2CVEA 1TKTA 4CI0B 5DGAA 5C42B 2W2NP 3OJUA 1URNA 4ZP7A 4PABA 5GMDA 4RW8B 1RBAA 2V69A 5IWAF 4F8RA 3QRPA 2UXDF 3FKBA 2FZGB 2XMUA 2UVUA 2AJQA 2K1RB 3DC2A 1YGYA 3Q8YA 4PG7A 3M4XA 2ZITA 4JV1A 3FEXB 4IG3B 3HM9A 3K2YA 3GWCA 4A4JA 2BYCA 3M6VA 2OD6A 2CWKA 1S1XB 3VAHA 2XYGB 2E1AA 4EYHB 3I56S 2M70A 3BO4A 3A3PB 4PKDB 1RAJA 1YRXA 2VPZB 3ZZZA 4ATNA 4N7TA 3KOAA 2YQ1A 5IC6B 4NZ7A 2QLBB 2GIFA 3NS7B 3LWMA 1HR0J 4B3OB 2HQCA 2YWGA 2VQEJ 1BC6A 2IBKA 1NK0A 3RBXA 2R2UA 3FFIB 3HJFA 2FLLA 2GGPA 2L9DA 2OI2A 3KK1B 1ZM3A 1WHWA 4PPDA 2E1CA 2VF3A 5JVGQ 3R3TA 4ECRA 3C16B 3OR2A 3I4PA 3RUBL 2MLXA 1RACB 3H59A 5B7WA 1X5SA 1FE0A 2WSFC 4CWBA 5D0GA 1S10A 2DYAA 1LWEB 3TZXA 1NUEA 1YSJA 2HIYA 1B4SA 3RBEA 1XERA 2OH2A 4J9SA 5HSPA 1CJKA 5GMKa 5IOLA 3SV3A 1X4EA 4C3LA 4B9SA 1VBZA 2ZJRQ 2CQHA 2UV8A 2FIUA 2HFZA 1OPIA 3TVYA 2W9CB 3T6BA 4Q0BA 5HO4A 5H9EK 5L38A 1HQUA 1RT5B 4EU0A 2LU2A 4KSEB 2VBYA 4X66J 2RRNA 2V0NA 3T3FA 3B54A 2RMLA 2BJ9A 1Q8LA 1SPBP 1OSDA 2J76E 3HVWA 2ZNYA 3IWLA 4RJVA 2JLGA 2XMTA 3HHLA 1U8SA 1K9MT 1FCAA 3R5AA 2G13A 4KC5A 3HHLD 1O8BA 4RW6B 2QMUB 1JLBB 1RT2B 3JQMA 3M8PB 2MQ8A 2V34A 1VQMS 3PW2A 4OYBA 3QFWA 4TU7A 2UXBJ 1GTHA 4F2SA 1EZZB 4FNHA 2LA4A 1SL2A 1HBMB 3DXBA 2OSQA 2CQBA 4B3SJ 2BOAA 2OJ3A 2Z2MA 2J7KA 3AD8C 1VDHA 1ZETA 4U8VA 1PO6A 1RT4B 2QL7B 4QCLA 3NGRA 3NGKA 1QTNB 2B6AA 4F4KA 4USIA 2MZJA 2IY5B 4IFYB 2W2QP 3QT7A 3FCWA 1A6LA 2HWHA 2DT9A 4OHVA 1S0NA 1CBKA 4L6V3 4ZIWA 1FK9B 3LTOA 4ELVA 2DR8A 1S1TA 2JNJA 4P74A 2EK6A 2B9WA 5KFRA 2G0IA 3MEEB 4CNZA 4NYPA 1OPZA 5K14B 4OYOA 2HW3A 2DNLA 1FNXH 3TJ9A 3EUNA 2NPFA 2H9ZA 2C3PA 1DURA 1EETB 4Z37A 2ZEJA 4OZNA 1QAYA 1FRIA 3SSRA 3Q23A 2VODA 4A8XA 4I0WA 1EAYC 1ZPWX 1RCXB 4O44A 4YP3A 2X1BA 2H5JB 4YFUA 1LNQA 2B56A 1BD6A 1FJEB 1WF1A 4ZVQB 1R8PA 1NDPA 1HQEB 3GR0A 1RA7A 3C3LA 1OIAA 1O51A 2C2NA 3AT1B 3GFZA 5J1NA 3W8GA 1JXVA 1U1QA 5EWFA 1VI7A 1NSQA 2F7VA 2IC3B 4DPTA 4CM2A 2DK2A 5E3AA 3HZGA 1JNZB 2AJ1A 3UDEA 4CLZA 1LXNA 1FHTA 4O3PA 1HNVB 1KC8T 2HNZB 2QFIA 2IM3A 4YOEA 4U9RA 2BX6A 4K4YA 3K0JA 5KFOA 6FDRA 5L1IA 3MMAA 4AL6A 1NNDA 5LXYA 1UWBA 5F3TA 3FBEA 2ZH1A 2BUNA 5C2CA 1FDAA 3OT9A 4N5SA 1PILA 2VA2A 2JFKA 1ZAXA 3GR1A 2UUCF 4HT5A 4OJ3A 3HSDA 3IGVA 3H5XA 4WTYA 1R3NA 1CEZA 1IKVA 3H42A 3VV2B 3GJSB 1UA0A 1SKSA 4G1PA 3HF5A 3SSQA 3NGDA 5KAKA 3TAQA 1T3OA 1WEYA 2HQ3A 4OX7A 1WF2A 1VR6A 4DZDA 3BR8A 3UW1A 1N6QA 4AYBD 4WKYA 3ZTRA 3DYAA 3IM9A 2ZZTA 2P9GA 4O3SA 2RRBA 2BQ3A 3QYYA 3UD5A 1XR5A 3MEKA 1NK5A 3I9V9 4CLLA 3P5TL 1LQ9A 4EO6A 1X4BA 4MKYA 1NK8A 4XAKA 3GG0A 2DH8A 4DV1F 3IG1A 2IRUA 1VQNS 1CJUA 1Z2ZA 3B6BA 5JVHQ 3FBFA 3R1HA 1UKUA 1X4DA 2DKOB 2F4FA 2W9BA 3BSCA 1WWHA 3DLEB 1VHIA 4ZOSA 5GADI 2Z0GA 1LWCB 4OLPA 3QFHA 2XMJA 4OYMA 3R8YA 3S6EA 4B9NA 4ILMA 2R7WA 1NPRA 3NG8A 1GFWB 4BWJA 4OV1A 1YJ9S 3D9BA 4YR3A 3HCXA 1U8WA 1W26A 3FSXA 1CC7A 1GMUA 2BKPA 4CLKA 4PAAA 2VPXB 5EWGA 2MLYA 1OJ4A 1YJRA 2R7TA 1TK5A 1DTQB 4DFJA 4H4KA 4X4TA 1QE1A 4Y65A 3NAHA 5LMUF 5E0OA 5IT9U 1VHFA 4X4PA 2HZAA 1H3DA 2QX0A 3MAQA 1XIQA 2QLWA 2VDIA 1CC8A 1QSLA 4NZ6A 2DPIA 4I2QB 5C25A 4M5IA 1RHQB 3ZZRA 1IKWB 5KFHA 4DV2J 1RAFB 3RTVA 1TKXA 2JVRA 3QGHA 5L8RC 1IKYA 2WHOA 4TNOA 2HWIA 2NQPA 1XK8A 4IH6A 1B70B 1S1UA 2ZH5A 5K5MA 3G6ES 3Q86A 4JI0F 1GX6A 4JBCA 3IA0A 4C11A 4K0KF 3H5UA 3Q83A 1TL3A 2VQFJ 2QA4S 4CT8A 3V4IA 3FMWA 3UO0A 3JTOA 2GQ2A 5AXKA 3POTB 5KFDA 1E6YA 1KTVA 3P3DA 5FDLA 3CSKA 5GVQA 4V1Ak 5IT9Y 3I6PA 5DGBA 4YR0A 4G6VB 3QGPA 2XS7A 2VONA 3GCXP 1PJ7A 4OJGA 4RX6A 4DR5F 1Q95G 4WFNQ 2NXEA 1JXLA 4RNHA 2AYEA 4FVMA 1VLOA 2AWZA 3SCJE 1XNRF 1WDTA 1AZSA 5CXTA 4ZA1A 3S1TA 2XI2A 3OSNA 1LW2B 4E2FB 3CIZA 3QZ7A 4H4OA 4TXSA 4ZVUB 1X5PA 2C2RA 1WEZA 2RRAA 2ZH4A 3OXFA 5M2PA 2R2SA 4M5LA 1U49A 4Z7YA 3TA2A 2FJVA 4OJ1A 1JLAA 2GMLA 2ZM6F 3KNAA 1TP7A 1V6HA 4OMFG 2Y8WA 5A0YB 1AUSL 1WG4A 3BM7A 2HNDA 1K0TA 1F1BB 1JX4A 2JLFA 1K1QA 3DLKB 4AQYJ 1OY8A 4QIVA 4I6WA 2A1BA 4R25A 4WTOB 2IVMA 2MY8A 1FDNA 2P2CB 2HHSA 3R27A 3VAFA 3CJ3A 3KLIA 3C19A 5A8WB 1XC9A 1G6BA 4OZ5A 3QAUA 4DN0A 3HKZD 4HACB 3C15B 3BQ2A 4O4GA 1PGZA 5HI7A 1M1KT 1LK7A 1NCLA 5AXMA 3PJ9A 4Y34A 4MKVA 2GIRA 1O5JA 3Q2SC 4LRFA 4CO2A 3V6HA 2VOOA 1S9GA 2HS3A 3KLFB 2MQNA 3LPYA 3NGSA 1O0PA 2XGPA 3CVKA 1U1LA 2RS2A 3A8KA 4ED5A 5IC4B 3CF5Q 4ECWA 4ID5B 1WJ9A 2L41A 4QJVA 4JI0J 4X4UA 4ECUA 2HG4A 5E3QA 4K0KJ 1B99A 2CNLB 1BQXA 3AA8A 4LRCA 3JQKA 1P8GA 2RVJA 3NRBA 3LGMA 5C7PA 1OQ6A 3D6HB 2GFFA 4GKKJ 3IC1A 1OYEA 5KG6A 1FDDA 3CJKA 4NX9A 4NLOA 3MI7X 3PVXA 4LBIA 2WW8A 4UQGA 3W2VA 3W9JA 3GYGA 3DGPB 2V8GA 5J2NB 2ZOGA 2FTRA 2D9OA 3PJWA 3J80U 2XMKA 2LKZA 3FJ2A 3J7AN 2NYIA 3NP5A 2Y0BB 3AOCA 4KKOA 4ZP8A 3G71S 1Q78A 3KLGA 1DZ5A 1T05B 4F4ZA 1U4BA 4IFVA 3PW4A 1VK3A 2ASLA 2XCAA 1HYSB 4TYBA 4FS2A 2OEJA 1QAJA 2YPYA 4JOUA 1XNRJ 3B4MA 3HVRA 2RH3A 3QNWB 1JLEB 5HQLA 4GRSA 4KGMA 2FPHX 4MIBA 4YY3F 2CNKB 4IOBA 4USTA 3M32A 4USKA 3MPVA 3E3XA 3DOMB 4R8UB 3M8YA 2WSCC 2IM1A 1HKAA 3ZZ0A 2VC1A 3LO3A 2HQGA 4DUYF 2C3UA 3G86A 2YPZA 4NL5A 1QDUB 2UVRA 2HMIA 2JRSA 3I31A 4M5HA 4CYUB 1S0MA 2KM8C 3HDSA 1EQ0A 1KWMA 3CD5A 2BM1A 4ECVA 4MFBA 3ILLA 2DR5A 3DN9A 1UEUA 1ZBTA 4NLWA 4JI2F 1S6UA 4OHXA 5KFAA 2IRYA 2ZJPQ 1U2FA 3MFHA 3LH2S 5JMNA 2ZC3A 5KG7A 4KHRA 1CQMA 3EDQB 1LK5A 1KOOA 3BZQA 1S5ZA 2JWNA 3NL0A 3AQOA 4CM0A 2R7UA 4OI4A 2BEFA 1Z1ZA 4AD6A 4OX8A 3MAHA 3LF0A 1JLFB 1SIZA 4X62J 3BYRA 2HHXA 4CLFA 4F2RA 3N5BA 3M8QB 4ZVGA 4KGXB 1Y3JA 2G4BA 1JIHA 2WVDA 1GTEA 4P9SA 1SXLA 4OFZA 2VPWB 3E8OA 3OXGA 3HVAA 2N3LA 1FRLA 1PAUB 5KG2A 4DF4A 2NYHA 2HRYA 4TQRA 1UVNA 2VG6B 3BO3A 3IMQJ 3D0IE 2DD8S 2GX8A 1FKPA 1IKXB 2G1HA 1B0VA 2FDNA 3W61A 4KY3A 3PYDA 4A8SA 2FGOA 4JI1F 4HHJA 1MMNA 1FVSA 2B4UA 4OX6A 3TEHB 4JP8A 4LF2A 4ED0A 4QBUA 1ELOA 3MEGB 1FDBA 4CO4A 1YLXA 2YKPA 3FEYB 2NREA 3E01A 4DPXA 3BDEA 3RZAA 4R0JA 3BSAA 3JSMA 1RAAB 3GFXA 2YKMA 3G8QA 3W2WA 5EWEA 2YKNB 4X65F 1MROA 4W90B 2ABYA 1T11A 1S7IA 1WC0A 2KYZA 2CUYA 4NCBA 4RNMA 4C8ZA 1W25A 3RRKA 1IBMJ 4CRJA 1S7HA 2X1AA 2AW0A 3QSIA 3VTIA 4KAIA 1OYDA 3FDSA 2RUGA 3F41A 4DL5A 5HROB 3PRVA 4NEYA 2VFUA 5CYJA 4KHMA 3MM8A 2JDJA 1YK9A 5B0BA 1YDLA 2NZ4A 4XPCA 4AXJA 3UI3A 4ZCIA 2LEBA 1RT6B 2DEIA 1PJ6A 2I5JB 1NHUA 4NLVA 3CCMS 3TA0A 3RU0A 3D6FB 1I51B 4LUBA 3CD0A 2HVIA 3JSBA 3KJNB 5LJ3Y 3H8YA 2PI5A 4XO0A 2ZH2A 4LQ9A 4DSLA 4HI2A 1SJ1A 3HXMA 2XMVA 1RT1B 3P5BP 3US5A 1HWLA 2BANA 4ICLB 3DNCA 5KFMA 4QIFA 3KYLA 4DV3J 4DBQA 2P6TA 5DG9A 2ATLA 1S77D 3EGWB 2DHXA 1PJ5A 4NCGA 3HHLC 4KPCA 1LW0B 1LKZA 1F9HA 3KUHA 4C0BA 1B7YB 6FD1A 2MKKA 2GCFA 4DR2J 2ATCB 2FGCA 2ZH7A 4FF2A 4IDKB 2MKHA 4ER8A 4DG1A 3TRGA 4CO5A 3MCMA 3OVSA 2BQUA 2IA0A 1S1WA 4NCAA 4CLPA 1J5EJ 2BJ3A 5F8JA 1AFIA 2D3UA 1UFKA 2CQPA 1RYRA 4DFKA 2VUGA 2E5IA 2OMLA 2AU0A 3VGUA 2Q1LA 4F4XA 1QSYA 3SQGA 4LREA 1C0UA 1PC4A 2HFVA 3NMRA 4ZHRA 1FD2A 2B9XA 9RUBA 1CJTB 2GGPB 1NHVA 1XWLA 3A13A 3KHHA 2OHDA 2DVIA 4GC6A 3Q24A 3H2LA 4PG8A 5KFIA 2WVEA 2LQ8A 1TELA 1HMVB 3FEZA 1EKSA 8AT1B 4G1IA 2I9SA 2DNYA 2XNRA 4BS2A 1K0VA 3TAPA 2K7JA 4X65J 3SYZA 3WQPA 3SI8A 1HNZF 4RU9A 3M1VB 3W64A 5HK4A 1S9EA 2IM2A 4Q7AA 1HBOA 4WF9Q 2E7WA 1VJWA 4CTAA 1FWLA 4PRFA 4X4SA 2WSEC 3CJ4A 4LSLB 1Z4UA 2IDLA 3MFIA 3UCUP 3QRRA 2B9EA 2YNFB 1XNQF 1EQMA 1YX2A 2BJ8A 5MLCV 4RW4A 5EHHA 2MZQA 4ECTA 2W01A 3NOGA 3FUYA 4NOHA 1YWXA 4Q0BB 2A6OA 1RTJB 1Y0HA 4C9DA 5E3RA 3PKMA 1VRTA 4ZVPB 2D41A 4NEZA 1B7FA 5D8HB 1TUWA 3MGJA 1P9QC 4DI6A 2LLZA 4JV0A 2Z8QA 4KGVB 4A48A 1N0VC 3HHLB 1IWGA 1HL6A 4FF4A 2XSFA 2O5DA 3AJ1A 3HT3A 3SFUA 3QJPA 2RQMA 1N32J 1TVRB 6AT1B 1N4LA 2LA6A 1OQ3A 2CXEA 1OS5A 3DRYA 3H5YA 3LQVA 3H4DA 4URGA 2IRXA 1NBEB 3Q2TC 2NUHA 1HWUA 2M8HA 1RAGB 2LCWA 4ZJLA 1UFWA 4EK2A 5RUBA 2MKCA 4FBUA 2X3GA 1HBUB 4K4SA 4Y2IA 2HK2A 3M30A 1U02A 1I1GA 4WE1A 2MGZB 1Q8KA 5FD1A 3LP0B 5HLFB 3CC2S 1X9MA 1EP4A 4LVOP 1L3KA 5F9LA 1TK8A 2V8VA 5IV3A 2QFJA 2RU9A 2V4QA 3D68A 1V3RA 1KVIA 3PIOQ 2HLUA 2HVEA 4W92B 2HBZB 5KFPA 4QYRA 3M2UB 4YDXA 5B0FA 2DXDA 2C2ZB 1S9FA 3S8SA 4NA1A 3OL9A 2HQDA 4XIUA 4ELTA 3M2VA 2YQ0A 4DV6J 4M8LA 2GAGC 3AH6A 4Y2MA 2Y1JA 4EZ6A 1SUQA 4DQPA 3MM7A 3NWRA 4JV5F 3RRHA 4B9TA 3HHEA 1NJIT 1FTRA 4CH0S 2XS2A 3JTPA 4P7VA 2E7VA 5KFXA 2OLWA 3DLJA 1TMMA 3RB3A 1FA0A 3OFEA 1N8RT 2BOPA 2HHHF 2RQKA 2IAJB 4PZVA 2KRBA 2FHOB 4P2FA 2C22A 4KH1B 4ANCA 4ZPBA 4P2MA 5A2QU 3GIJA 4J9VA 3CJTA 3ZFVA 4M5JA 1L3VA 1RK8A 3CWJA 3WC0A 3V6DA 3RB0A 1SC3B 2R2TA 4LIRA 4P72A 2ZZMA 3MXHP 2YNIB 4JV2A 2WBRA 2FJBB 4GO7X 1O6XA 4LFCF 1M90T 3T9ZA 3FRZA 2CJQA 1UWAA 1MW7A 2VFSA 1NZ8A 2HBQB 4B9MA 1KNZA 2HFSA 3VGSA 2GJ2A 3EE3A 4LF9F 3MMAB 4OZ3A 3OXLA 3KJQB 1N36F 1T03A 1JLCB 2DNRA 3CT9A 2Y3YA 4R5PB 1KQFB 2J7UA 1F0XA 3ENAA 3M6WA 1FX2A 1HI1A 1J2VA 2DNPA 3HD2A 1JJ2R 4NRTA 4C2MA 3KK3B 3LA0A 4LFBF 4DR7F 2FVQA 4NRUA 1FRJA 2W7PA 2DGOA 3SDEB 4MKBA 1G3OA 2V4JB 3RGIA 2CAJA 4GKJF 1KQSR 5A2QY 5DG7A 3RR8A 1RWVB 5J2MB 2AGOA 3MCNA 2B7BB 4H54A 4I6AA 1XTZA 4DPOA 3D4JA 5F8MA 2PD1A 3HHNB 3KTQA 3DYAB 4KRWA 2RDJA 5T14A 2QIFA 2CQ2A 1KOHA 5DDQC 3ZNUA 4GVBA 2DY9A 2HFOA 2Y9HA 1SJ4P 2W8KA 5D3GB 2OMOA 3DHXA 4RKUC 4C0OC 4YHHJ 4ZK7M 2LDYA 3GFHA 1FO1A 4MK8A 4IG0A 1CJUB 3EGZA 1V9OA 4PR6A 4U95A 2GIQA 1R0AA 4URSA 3CJSA 3IXQA 4ILRA 1UJ5A 3HT0A 4EMDA 4JV5J 3IAS9 1REVA 1UVJA 1T8EA 3MTJA 2DHSA 1S1VB 1WDDA 1Z2LA 3QT5A 1F9FA 1QUPA 4J9KA 2HHHJ 3A12A 5DZ6A 2MZ1A 1SQEA 2OPRA 4I7FB 1NAQA 2QA4G 1H2TZ 3GJTB 1ZH5A 4F3MA 2AYMA 2NSCA 2LFVA 1LWFB 3Q8QB 2YKOA 1PKUA 1QVFR 2XY5A 1EIYB 2MTLA 2LU1A 2GJIA 2EI5A 2WVCA 5A8RB 4I69A 1IXKA 3R5DA 1UCNA 3W1YC 5GAEU 2I2YA 1AB8A 4LFCJ 5E33A 2F5GA 4LJMA 3DRPA 2OEMA 1H98A 5CABA 1RWMB 5I3UB 3VZHA 4K5SA 5LSLA 4A8FA 3RJMB 3BV8A 1E6VA 1W7WA 1WKJA 2WB4A 3QZ8A 3GJRB 4LF9J 2HRUA 1ACMB 3LP1A 1B0PA 3Q8SB 2BBEA 1EHWA 4OYPA 2XSJA 1VS3A 1YJNS 3TOQA 2CYYA 2E66A 1QTMA 2BZ2A 3CO9A 1UMJA 4EUVA 1UL3A 3J81j 3A3NB 1IUJA 4LSNA 1N56A 5K20B 5AT1B 2ASJA 2VKRA 3KK2A 3SFGA 1WSVA 3ITHA 4Q44A 2F9JA 4H4MA 1YIJS 2QA2A 3V4IB 3OLBA 2E1RA 1U7LA 4GKJJ 1F60B 4EWTA 1M5VC 3N28A 2BACA 5J1EB 5MAOA 3ETOA 3PCOB 1BQMA 4LRDA 3CJRA 3DU6A 5IT0A 1UZHA 4LF8F 2R7VA 4TLRA 4NPOA 4IR1A 1Q79A 3HJVA 5HAOA 2XGQA 1VC5A 2QL9B 2HKEA 5EX3A 4LF7F 3PKYA 5I3PA 3BGUA 1FWPA 2J7WA 3FQLA 4FPIA 4NA3A 1RHJB 2GNKA 1IM6A 2MKSA 2AHOB 3OFFA 1XR6A 4ED3A 4PG5A 4KO0B 1U26A 5KT6A 2XYHB 4Z2XA 1K44A 3R7BB 4DR6F 1RE1B 4N56A 3MEDB 3P96A 4YS2A 3FZBA 4C7QA 1JLGA 1JLAB 2EG1A 4C8YA 5E2QA 3SV4A 3PX6A 2HHTA 3WHIA 4TU8A 3PZPA 1SJ3P 3KJVA 4ZLPA 2FVSA 3CC4S 1CPZA 1AXQA 4DX8H 1CJVA 3FVYA 1KSPA 4C0HA 3FNNA 5GAGI 1R8CA 2I0XA 3H90A 4NLPA 3BDPA 3LP2A 2B9YA 1FEHA 2CPDA 3KLHB 2AV5A 4J9RA 1DLOB 3V81A 1SC4B 3G82A 2E9ZA 2Q3PA 3ET6B 5LT5A 3UNYA 5L46A 3AHPA 4KQZA 4KV8A 5K8MA 2H51B 4HTIA 1F2GA 2V8DA 4ZPCA 3GIMA 2KL8A 3MR3A 2R3VA 3AXMA 4WP9A 2IJRA 3WIUA 1VQ7S 1X4FA 4MK9A 1SQGA 3SBMA 3AA9A 2MB0B 4QZVB 3CCES 1I3OB 2XMMA 3IRXA 5JXSA 5ETRA 2FHMA 3B4DA 4KT0C 5J2QB 1VQ6S 1HARA 5KOWA 2GVZB 3GG1A 2H65B 2M3DA 2R8GA 1JKHB 3CDEA 1RWWB 4X64J 3MR5A 2Q66A 4QIGA 3SSSA 1RXOB 1W2IA 5J1PA 3I0SB 2DNZA 1FXDA 4LF6F 4ZVTB 1UJ6A 4BLGA 3L95X 2KU7A 2D74B 4S0MA 1H73A 3ELHA 5G0RB 2NXUA 2DRBA 1GH8A 1S59A 3DXSX 4RBTA 1NPKA 4RWXA 3IGNA 2R7OA 3O8WA 3KLGB 2M9KA 3EVWA 2AEFA 2HSEB 4B3RJ 4CLSA 1TV6B 2R8IA 2LQ9A 4RBUA 1MU2B 3GV8B 4LR7A 2PFDA 2CDQA 2AMCB 3QMQA 5E5NA 2KRRA 2HNYA 1IWAA 2FD2A 3C6UA 5FLXY 2BE2B 4OI6A 4Q8FA 4F4AA 4LFAF 2FLPA 2GVDB 2LEPA 3DU5A 3LUYA 3GLJA 2V2KA 4WIIA 2H54B 4O3OA 2WOMB 5KG0A 3KMSA 1CULA 3FZ2A 2YNGA 4NLQA 2CZ4A 1N88A 1TKZB 5BYQA 2CADA 1XQIA 1VK8A 3SCKE 1RTHA 2VD3A 5EDWA 1OO0B 1U0HA 3BF4A 3MR7A 5AE1A 1NDKA 2RSQA 3UDVA 4ID8A 4B9LA 2A0FB 3CIMA 1G1XA 3CEDA 1WG1A 2GAHC 3CD7A 4NXNF 1DHMA 5CH7B 2BV3A 2PDAA 3D3CJ 3MMCA 4O0IA 3HSJA 5L1LA 1S6PA 2DY1A 5KFGA 5KFQA 1FJGF 4F26A 3ENVA 4DN9A 1LWXA 2XMAA 3ADAC 4P52A 3U1NA 1DTTA 5KG5A 3GYXB 4DDFA 8ATCB 1D9FA 3HK2A 1C1BA 5HMYA 3RRGA 1U45A 2OPPB 3QQCD 1VBYA 3IS9B 5GAHU 5HVGA 4DL2A 2KHCA 3TEGA 3RAQA 4TY8A 1RTDA 4LF5F 3CC7S 5IFMA 2W24A 2FVRA 3W5ZA 2BABA 1RQ0A 3VHQA 2QC3A 2VDHA 4DS4A 2AKWB 2YXLA 2WRMA 4ZS6A 3PEJA 3EM1A 4OX9J 5BR8J 3UCZP 5H9EJ 5HVHA 1D1UA 3LWLA 3A3OB 1FJCA 2XLIA 4DPUA 2YWFA 2CJXB 1HPZA 3JYTB 1F3FA 3F0NA 1Q5YA 5C24B 1XMOF 2BMBA 3M2RA 4Q5VA 1GT8A 1HHQA 1FKPB 2PGCA 3A4TA 2HFUA 3L9ZA 4JI8J 2YH0A 1MWZA 3PRBA 2AX0A 5IZHA 2CQ1A 1SC6A 3CMES 2KTQA 2E9RX 2D3OR 4DL4A 1Y5NB 4TLQA 2CQGA 1WOPA 3DLLQ 5DS7A 5F8GA 3AY0A 3K59A 4DL0C 2DGXA 4NI2A 4MIAA 4G1QA 1JLQB 3CE8A 3NS6A 2XQCA 3W2WB 5C42A 5HN0A 4XDCA 2VHGA 2CQ3A 3K7RA 2V8HA 4RW8A 4IQXA 3I0RB 1TAUA 3J7YU 2ROGA 2KDOA 4A8MP 1H7XA 2QJ3A 4EI2A 4O3RA 2K1RA 2ZBPA 5HANA 2YWHA 2ZBCA 4C8MA 5DG8A 1JK9B 4IG3A 4DQQA 1VRUB 3DLBA 4PG4A 3MR2A 3TUJC 4MMOA 1DBDA 1HIYA 3N9UC 2DNMA 3TQEA 1VC6A 2VBXA 3C14B 1S1XA 1DFDA 4UTGA 4XTTA 2DITA 4CCHA 5BYRA 5L1JA 2QL5B 1NPPA 2HHQA 1KFSA 2IM0A 2EC2A 2JEGA 3L7OA 1CS4B 4ZJQA 3T6JA 5IM0B 4NXNJ 4B3OA 2OEKA 4C97A 3OD2A 4ZVSB 3FFIA 4C48A 2E5LJ 3KK1A 1QAXA 3WIVA 1H72C 3MPUB 4MYTA 2RQCA 4YB5A 4F0HA 1N5YB 1KEKA 1FF2A 4PCQA 3UFCX 2RUSA 1TQLA 3C16A 1KVJA 4NASA 3QSYB 3TUIC 1VFJA 3SMZA 3SXLA 3MF5A 4WYWA 1RHMB 1LWEA 4L3KA 1MMLA 1PYOB 1J27A 3ISND 3M9MB 2XMWA 5C2GA 3TX0A 1LOUA 4YB7A 2V6AA 1FXLA 1NU4A 1TUGB 2VZ9A 3KLEA 3GV5B 4CT9A 2W4DA 2W2OP 1SB6A 2F4VF 3G9CA 2VL1A 1ROFA 4HDHA 3D5MA 4FYDA 2W9CA 2DIUA 3OTOJ 2HHWA 2E9TA 2KT3A 2RNEA 1RT5A 3MECB 4M1KA 4ECXA 3N5FA 2PA8D 2AJ4A 1WC5A 1I6JA 2GHPA 1HNIB 3J7A1 3SIPB 1N33J 1X31C 3ICLA 1HD0A 2BVZA 4P73A 1GXUA 2DO4A 5KG1A 4RW6A 1JLBA 1RT7B 4ECQA 1RT2A 4XPEA 3M8PA 3C8YA 2EWHA 1S12A 1UTAA 3UDLA 5DZ7A 4WFZA 4IRKA 1S9EB 3AD9C 1TL7B 3DDNA 4LRBA 3EPGA 2UXBF 1KLMB 4RNNA 3NOCA 1HBMA 4L72B 4PXEA 2FLNA 1N34J 1ZM4A 1GMVA 2MHNA 4FXVA 1VJQA 3RB6A 3Q22A 4J9NA 1JJ4A 3VVTA 4B3SF 4HEA9 4RW4B 4AFFA 3WZ0A 3P49B 3G8SA 2IDEA 9ATCB 2CPZA 2QO3A 2QZ8A 1VQ9S 2DXFA 2RHQB 1RT4A 2XO7A 2XTJP 4JI3J 2XCPA 4ZPAA 3DDKA 4IFYA 2EFOA 2Q43A 1JNRB 1Y9OA 4MH8A 4I68A 1FWKA 3MAAB 1FK9A 3H7HB 2C2MB 3MD3A 4RUHA 1T9XA 5KT3A 5DLGA 3G96A 4JI5J 3MEEA 5K14A 4RU2A 3I87A 2LP4A 1TZ0A 3A8IA 1VMBA 4LT6A 4J9OA 4DSIA 2COLA 3RBDA 1TU0B 1RAEB 3D67A 1T94A 5EGYA 2EVZA 2XWXA 1I94J 1UPPA 2KH9A 2UUTA 4U7UD 2FC8A 2R42A 1ITPA 1HQEA 2DR9A 2LDIA 3N6MA 4QWAA 1IR1A 3O2IA 4C8OA 4K8RA 1WEXA 5F9NA 2NR0A 3P4UB 2ZH9A 2R9LA 3BGRB 2IC3A 4ZLNA 2K7KA 1CLFA 4Q8EA 2XULA 3AFGA 3I4HX 2F4VJ 4IRCA 1FESA 1PAEX 3DRSB 4RW7A 5BJRA 2M52A 2HQFA 3W62A 2HFNA 1HNVA 2HNZA 2QLFB 2GMHA 2F8EX 1YG0A 1SV5B 2GV1A 2CQCA 4PXBA 1SUQB 2ZD1B 1V5VA 4B3TJ 1B64A 4A8YA 3DLHA 3HFVA 3SCIE 3VVUA 2JC0A 1SVDA 1RKJA 1VQSA 2ZWPA 1RT3B 2APOA 4OLOA 2ZC4A 2W25A 5DJBA 4ENOA 2MKIA 2ADCA 1C1CB 3BJYA 3IBCB 2GMJA 4U96A 2DGQA 4OYZA 3Q89A 3NNAA 1NH8A 4OQJA 1TFYA 1WOSA 4QPXA 4ZCMA 2H5IB 4LRAA 2DGTA 3QO9B 1FKOB 5L9XA 2DNOA 4QW9A 4FKXA 2WK4A 1YVFA 4FDFA 5HBMB 2YTCA 3RR7A 3GCWP 4D3HA 4HHHA 5A8KB 5LOQA 4WCEQ 1T03B 3F73A 2WZ1A 3BEGB 1SC1B 3K17A 3BSNA 4WXWA 1UVIA 3PO4A 1R27B 1UA1A 1U1MA 3LW5C 4DJBA 3GV7B 2E1PA 2J0XA 2JEFA 2Z56B 2QYCA 3LPEA 1VIOA 3DLEA 3MHYA 2NXCA 2PIIA 1HLWA 1LWCA 3R9LA 1IJFB 1RLCL 3PJXA 4DMZA 1HNWJ 3TNVA 2Q79A 4DR3J 3ZZOA 3N6LA 2LXFA 4QIEA 1WOOA 3HFZB 3FCVA 1KTQA 2FY1A 2CIMA 4UT4A 2RF2B 5AJ3J 2DH7A 3M05A 2M4MA 1NMEB 3HVTB 1NK7A 4BDPA 2MQQA 2QGFB 1SL1A 3NNHA 1IR0A 3QLHB 4ED2A 3C66A 4Q43A 1DTQA 3TJ8A 2CPYA 5KT5A 1FX4A 4DL7A 5CQGA 5IS2A 4LF4J 3DGVA 5J2PB 4DWIA 1Y5IB 3AB2B 3OL8A 3TAMB 1RB0A 3N79A 5A6WA 2IMOA 1JQGA 4OHWA 4F0MA 3CCJS 1YJUA 5K8PA 2IYGA 3BB5A 2HK3A 1NJYA 3QWPA 2L08A 2WTFA 2ZVSA 3BPSP 3LOUA 2XY6A 4YB6A 1X0FA 3OFHA 1IKWA 4Y6IA 4DV2F 3TWZA 3D6MB 5F0UA 2AGQA 4K4UA 2YX1A 3MCOA 2KZZA 5D6GA 3BGFA 2KI2A 3T5HA 1NKCA 3KUGA 4XDDA 4DR1J 2VQFF 1RADB 4MK7A 4K2XA 3W9IA 1RWPB 3POTA 2YNHB 3CDBA 4OIXA 2ZH3A 4LBPA 2UUAJ 3W9HA 4RLEA 1SQFA 4EFAC 3DLGB 4WJBA 4ZKAA 1NM2A 5SZTA 4OL8A 1FFGB 3BQ0A 2BJ1A 2AYGA 5DO2A 1Y00A 2OPSB 2DCUB 2RQ4A 2VG7B 3PR4A 1LW2A 1RWXB 1X4GA 1ZZFA 2O3DA 1ZOTA 1FRMA 5E41A 1LFPA 3DHWC 4KIAA 5A6PA 3NEKA 2ZE2B 2BRKA 1RABB 4DZ6A 4PXCA 3BN7A 3N6NA 3KWMA 2QV6A 2R8KA 3EXYA 3OL7A 5T7LB 2CPXA 4RO0A 1G2EA 2BRLA 4TYAA 1IBLJ 1Q53A 1TTHB 3NY0A 4DQSA 3W60A 3TANA 5A0YA 3OQ2A 4YEAA 2HIQA 4OYIA 2DNKA 2QEXS 1IBKJ 2CJ9A 2FVPA 2D3O1 4FXWA 2OAUA 3DM2B 3DLKA 2ZOFA 4AQYF 3VGVA 1HNXJ 3UR0A 4RNOA 4Y3CA 3DMJB 1NKEA 5HMXA 1XEZA 4WU3A 3HSZA 2HVZA 4OYWA 3RB4A 1FTCA 3UD4P 4OHYA 2QMWA 5A8WA 2VKZG 4QR2A 3B78A 5IQ6A 2CPHA 1HBNB 4HACA 5F41A 2N7CA 3DCAA 3C15A 1T9YA 4EBCA 1X4HA 2EFQA 3PACA 4I4BA 1URRA 4WIQA 3KMQA 2MQMA 4ZLJA 2WCXA 4ECZA 2DCLA 2XHCA 2OTLS 3AAWB 4ZJOA 3D66A 3KLFA 4PWWA 2FHKA 1BQNA 5HL7Q 4DV5F 5ETPA 3EZOA 2E5HA 3PY8A 1YRUA 1S49A 4Y2CA 1NSPA 2KO1A 1H2UX 1PCAA 3J7Z5 3ZZUA 1TKDA 1HD1A 3K8WA 2BW7A 4ID5A 4QOTA 3NBPB 4AXIA 5KFEA 2W8LA 3MM5B 3HP6A 4ED8A 5D0EA 3UN5A 3UCGA 3ZZPA 2VBZA 5IT4A 2QRRA 2GQCA 3Q8VA 2MJUA 3IR7B 1FKAF 2RIJA 3OTDA 3R5CA 4GKKF 1S6QB 3JTNA 2VB6A 3L7UA 3CXCR 3GTYX 4USJC 2JH3A 3OVAA 2XHWA 2KXHA 4OI2A 2M88A 5J2NA 3CD6S 2OELA 3O5TB 2VV5A 1QY7A 1FNOA 3G8TA 4ES3A 5HMZA 1HHTP 2I8EA 3DI6B 1T05A 2ZNZA 1VIXA 1RHKB 2Z2YB 1S0VA 1HYSA 2VG5B 2ROEA 5CZXA 2J0SD 2XNQA 2ZVIA 2RHSB 3JAMU 2AEMA 1WHVA 3OUYB 1JLEA 4PXDA 4ELUA 3HZEA 4OYAA 1YJ7A 3IRXB 3QAEA 1SH2A 5KFWA 3NGTA 2CG4A 1V3ZA 2F63A 3DOMA 3UVJB 4R8UA 4ZPWR 3D54A 4PYAA 1KHVA 2L48A 4CYUA 3QT8A 2D7SA 4DX7A 4IOCQ 2VU5A 2C2DA 4N41A 3D1OA 1GXLA 2M8DB 3KHGA 3OTCA 2YY3A 1KBRA 4KH0B 4DUTA 2P9CA 2L9WA 1CVJA 4FNIA 4UUWA 5B0CA 3BS9A 2XZWA 4P2XA 3PYEA 1ZM2A 3MM6B 1YBTA 3OL6A 2MDAA 2Y8YA 2OKQA 5LJ5Y 2P6SA 1M5SA 4CZCA 3GYNA 2ZHOA 3BREA 4BBYA 1NK9A 5KOXA 2HPUA 4I2PB 1RTIB 3R2DJ 3JAMY 1G4CA 1UZDA 4M5NA 1UPMB 3HO1A 3IN5A 2GQQA 4J5OA 5JJBA 1JLFA 1T02A 4X62F 1OWXA 4DV5J 4DV7J 3M8QA 1Y11A 4KB7A 1WSRA 4YUDA 4JI7J 1R89A 4N76A 3DOKB 1R6YA 2EKYA 3QRQA 4K4WA 2HZCA 4BCAA 2IA6A 3MR6A 1UP1A 1SBRA 3O1LA 1AYEA 5IQQA 3VAGA 1Q86T 3OR1B 3AOBA 1FERA 4O3NA 3KKFA 3EX7B 4M5KA 2VOPA 1ZM9A 1ZAVA 2DTJA 4M5DB 1QLNA 1U1KA 1CSJA 1U0HB 2VG6A 1OY9A 2V2VA 5ADZA 1RHUB 3I5AA 1IKXA 4RW9B 2UXCJ 3GSIA 3DRRB 1GK8A 3U1LA 1C2PA 1FRHA 4AT1B 2CRLA 2NUUG 1T9UA 4CLTA 4F0KA 4DR4J 1FNMA 1JMTA 3G2XA 2B3TB 3PW7A 4LQ3A 2CVIA 4ZCLA 2VASA 3MEGA 4FYWB 3KDOA 3M9NB 4IYQA 2QSFA 3UNGC 4USVA 4WP8A 1MMDA 1Q0NA 3CUNA 1J5OB 4ED7A 1QAIA 2HVHA 1YJVA 3PFOA 3BPDA 2J0WA 3CDWA 2YKNA 3AOAA 2DHGA 3JS9A 4NYOA 5KG3A 1KS2A 2DGSA 1R8HA 2XZDB 4CDIA 5F8IA 4A8OA 4LF1A 5F8HA 4DUZJ 3R7NB 5CD4A 1IBMF 4QWBA 3MUMP 3THVA 2V8PA 1EX8A 4NLUA 2UZAA 2A6MA 1F3VA 2J6SA 4KFBB 3PEHA 4EYIB 3ISNC 2DGUA 3MURP 2CPIA 4KHPF 4EEYA 4L73A 5HROA 2IHR1 2X3DA 2NSBA 5KFVA 3CCUS 2L9NA 2YWWA 3D28A 4HHUA 2ZBQA 4CLUA 1JJHA 1MSWD 3J80Y 2V9WA 1D3WA 2M5YA 2QT7A 1RT6A 2ILYA 2RB7A 3NCRA 3W5YA 4NI2B 2I5JA 1WACA 3EDRB 2KT5A 3U1MA 3QJLA 3R7SB 4PQUB 2OTJS 1RHRB 1RBOB 3DOLB 2VPYB 1U09A 3SQOP 2B43A 3IBFB 3Q8UA 2PT0A 5DDPC 1NO8A 1JJCB 1Y5LB 1RT1A 3T5KA 2YH1A 4ICLA 2A2DA 4I6YA 1UW9A 4DV3F 3ISZA 4ZVOB 2FB0A 3QIPB 3VALA 2WW4A 3JSYA 3KLVA 3TZYA 3MWBA 4Q2MA 1LW0A 3W63A 1ZTWA 2VH7A 2K3KA 3KDNA 2MQPA 1X7VA 2JVOA 4DR2F 3T5LA 3ZTPA 2CJBA 2J9CA 3PG9A 4IDKA 1TK0A 5DDOC 4C98A 3VAKA 2B5JB 3CGIA 2B51A 1J5EF 3EYZA 2WAQD 2FLOA 1SJRA 1RWUA 2ZH8A 2OPQB 1C0TB 5F8NA 2W7AA 3BSOA 4F50A 1HHSA 2H4YB 3CO0P 3CMAS 1KVKA 1CJTA 5I42B 3MM9B 2OP5A 1WC1A 3ZNJ1 1RU1A 2EEYA 1L3UA 3NWGA 1D9AA 1HMVA 1NEEA 2N7YA 5DQHA 3BBCA 3MZIA 1MN9A 2H48B 3ULHA 3L7PA 2GS8A 2ZZNA 4HI1A 4K59A 1RGVA 3ONQA 2KM8B 3M1VA 1S0OA 4JI4F 1RUSA 1AA1B 3MMJA 5KT7A 1ZTTA 2E5GA 1AUDA 1H2VZ 2RKIB 4LSLA 4PWDB 4MJKA 1VQ4S 3MMBB 2PA3A 3CTRA 4FN5A 2YNFA 1T7PA 3KLEB 1YQHA 1NDLA 4WWSA 5CD4H 4KHPJ 2W9AA 3H25A 1PC5A 2CQIA 1RTJA 1X60A 1F5CA 2EKNA 4DHVA 1ZYQA 1RWOB 2B4VA 1NRKA 2BW2A 3O44A 5LSRA 1FD8A 5CYMB 3EZ5A 1SKUB 4KYZA 2G2YA 1VQ5S 1TKTB 4NMXA 4ZDNA 2ACMA 1N32F 1A7GE 1TVRA 2EW9A 1D0EA 4B17A 5A76A 4F3QA 1TFWA 4WFXA 5IWAJ 1HI0P 1KLNA 2RILA 1WC3A 2PMWA 4LMZA 2UXDJ 4X4QA 4OI0A 2IJFA 3L4BC 3M6XA 1U1PA 3MUVP 4KBIA 3WBZA 3O6QA 4I56A 2BM0A 3OFGA 2I1RA 2QSWA 3OW2R 5ETLA 3JB9k 1HBUA 1NXIA 2HAFA 1Q81T 3AQPA 3ZTQA 2MGZA 1T9WA 1WUUA 4CO1A 5FIIA 2ZBRA 4HL9A 1YJTA 4K4TA 3PO5A 3LP0A 1PBUA 5HLFA 3FC9A 3I9ZA 3KG1A 3Q8RB 2EBGA 3PM9A 2KXFA 4X2BA 4U67Q 2G1DA 2F3JA 3KJFB 3CJ2A 1LV5A 3GJQB 2DNNA 4EO8A 2V68A 2MMYA 3CCZA 1Y7PA 3M2UA 1W2BR 4RBVA 3DRXA 3TX8A 1GQEA 3D7SB 4DV6F 2QLJB 2C1EB 5FJ4A 2JFDA 4MKAA 3LALA 3UE2A 2D69A 1M5OC 1H0HB 1NB7A 2U2FA 2KG0A 2P5VA 4RL1A 3OR2B 2CNOB 4DQRA 3BH6B 2KVIA 1RAOA 4WYLA 2IAJA 5C5JA 4JI4J 2GHVC 3N4WA 3TZZA 3BO2A 4J9MA 3D2WA 3CULA 2DPJA 3EGVA 4MAKA 4E0DA 4UY8T 5HMWA 2X1GA 4PYDA 4YN3B 2CKWA 1RI7A 5KG4A 1CJKB 4YR2A 3I96A 2BQRA 2FC9A 2YNIA 2CJKA 2Z57B 3TQ1A 3LAKA 3UR3C 1FE4A 2ZH6A 1Y3KA 4RW7B 2QE5A 1HQ2A 3JQJA 3W66A 4X84A 3FBBA 1HQUB 5CYQA 1P27B 1YKWA 4BC7A 2EPIA 3UN2A 4NWBA 1JLCA 2IVYA 1R0BG 3D1HA 3FK4A 4R5PA 1K1SA 2H1YA 2U1AA 4KPYA 4LBHA 3NCPA 3KK3A 4M63A 3OTBA 2V50A 4UOHA 3WDOA 3M8RA 2IYIA 4JI6F 3NAIA 3SDEA 2XS5A 2V4JA 2HGMA 4EGLA 3AJ2A 3PV8A 1ZPVA 1Q5VA 1K8AT 2FUG9 5J2MA 4AL7A 4C3KA 1LFWA 1X9WA 3CCRS 3D0GE 4TKTA 5H9FJ 3HMJG 2RU3A 3A1YG 2KZMA 4J90A 4IOAQ 2ZKUA 4R0EA 3TJAA 2B6AB 2CWXA 1QUVA 1HWJA 2VFRA 1UEVA 1H74A 2AJFE 5DLFA 3R97A 2GA7A 4QR1A 5D3GA 5CCLA 3AJDA 4YHHF 3NNCA 3A8EA 1WD6A 2FVCA 2PO4A 2RDIA 2K3IA 1S1TB 4IO9Q 5KFJA 3VCDA 3F44A 4RNFA 3PYFA 1SH0A 4FZVA 2BDPA 3PFEA 1SI9A 3O3LA 2FZCB 5HQ8A 1ULRA 5ETMA 4DU7A 3AB4B 5DM7Q 1S1VA 5HP1A 1TL4A 2EK1A 2GHWA 4OYXA 4O44B 3VF0B 4HYKA 4WU2A 1RISA 1RCOB 1ZZNA 2KHDA 4XK8C 2FJXA 4ZP6A 1VYAA 4DV0F 3TARA 4I7FA 3BKTA 4OJHA 4M5MA 5GADU
chains in the Genus database with same CATH topology
3RB6A 4QIWD 2VPWB 3E8OA 3OXGA 4O3QA 3HVAA 4DEZA 3Q22A 2QA1A 4J9NA 1Y4ZB 1JJ4A 4C8KA 3SCLE 4Y0FA 1LWFA 4B3SF 4HEA9 4RW4B 4AFFA 2N3LA 1FRLA 3WZ0A 1NK4A 3P49B 4OZJA 3HPOA 3G8SA 3H4BA 5KG2A 2PC6A 4DF4A 1BQMB 2CPZA 3V5RA 2HRYA 2QO3A 2M0GB 2QZ8A 1VQ9S 2ACYA 4TQRA 3TUZC 1FJ7A 1T3NA 4IKAA 1UVNA 2VG6B 3BO3A 3T5JA 5A8RA 1RT4A 3D0IE 2XO7A 2DD8S 2GX8A 2YVSA 4OZ0A 1FKPA 3GIKA 1IKXB 4WKRA 1B0VA 3QPIA 3ENWA 2FDNA 2XCPA 2BJDA 2KKHA 4ZPAA 4A8SA 2FGOA 4F3OA 4JI1F 4DFPA 3H20A 4C8NA 4HHJA 1MMNA 3DDKA 1FVSA 1N5VA 2B4UA 4TU9A 4F02A 4OX6A 4IFYA 2EFOA 3VAMA 1MNEA 1X5OA 2Q43A 1JNRB 3IWXA 1SJFA 3MM6A 3X3UA 2IFXA 1Y9OA 2Q6CA 2KXNB 4MH8A 4ED0A 4I68A 3R5BA 1SH3A 4QBUA 1ELOA 3ZZYA 2R7QA 3IFEA 2UV8G 1FK9A 2C3MA 3MEGB 1FDBA 4ZP9A 2C42A 4CO4A 4H4KC 5I3UA 2YKPA 1VGYA 3BR9A 3OTEA 2O67A 3FEYB 3MD3A 3NKYA 4K4ZA 4RUHA 3PR5B 2ZHAA 2NREA 5KT3A 5ITHA 3E01A 4I2PA 5DLGA 3G96A 1H7WA 1H6KX 1RTIA 1SKRA 4NZ0A 3MEEA 3BDEA 4KJIA 3RZAA 3OSPA 1S79A 3LAMA 4R0JA 3BSAA 5K14A 3I87A 3JSMA 4RU2A 4QU6A 1TZ0A 1UWBB 4A8WA 3GFXA 1VMBA 2ZHBA 4PG6A 2YKMA 4LT6A 3G8QA 4OZLA 2MHEA 4I64A 4J9OA 3TVZA 1HWKA 4DSIA 3W2WA 2COLA 5EWEA 2YKNB 2R7RA 4X65F 1MROA 1X8DA 2O1PA 3RBDA 4W90B 1JLGB 2ABYA 1VQPS 1T94A 4DV7F 1WI8A 5EGYA 3BQ1A 2EVZA 2J9EA 1WTFA 2KYZA 2XWXA 2R2RA 4JI7F 1TL5A 4NCBA 3H98A 2AP6A 2KH9A 4C8LA 4RNMA 3GIIA 2UUTA 3DOKA 2GO9A 1DQAA 4C8ZA 4B9UA 1RDRA 2CPJA 1W25A 4Y2KA 4UY85 1IKVB 2Y0SD 3RRKA 2OFHX 2FC8A 4KR0B 4RZRA 3OVBA 3KJVB 1HQEA 3HI9A 3GZ7A 1FVQA 4GO5X 4K4VA 2DR9A 3OR1A 2A18A 2LDIA 3N6MA 2LQBA 4QWAA 1S7HA 3FQKA 5CCMA 5E3CA 2RD5C 2ZBIA 2AW0A 3O2IA 3THTA 4L3NA 2X1AA 4C8OA 3VTIA 2E5JA 5I4MA 5J1EA 1S99A 1WEXA 4KAIA 5F9NA 2NR0A 3FDSA 3CCQS 2ZH9A 4M5DA 2RUGA 3F41A 4DL5A 2R9LA 4DSKA 3G6VA 2PFFB 3BGRB 5HROB 1N6QB 1R8BA 2NPIA 2IC3A 4TN2A 2F1FA 4U7CA 2K7KA 2VFUA 4F25A 5CYJA 1CLFA 4KHMA 4Q8EA 2YQ3A 1BGXT 4RW9A 1YBAA 3MM8A 2JDJA 3LP2B 5F8LA 3DRRA 1HW9A 2ILZA 2XULA 2YKQA 5B0BA 1VC0A 2UXCF 1BWEA 2MYFA 2NZ4A 1Q7LB 4CH7A 3I4HX 1KQKA 5LXRA 2FJWA 4XPCA 4IRCA 5CA5A 1FESA 1GXTA 3DRSB 4AXJA 4RW7A 5BJRA 2M52A 3UI3A 2DIVA 3DGPA 4DR4F 1H38A 3GQCA 4ZCIA 2HFNA 1HNVA 2LEBA 2MZTA 1RT6B 3V81B 2HNZA 2GMHA 2F8EX 2ROPA 3KG4A 2I5JB 2D9PA 1YG0A 4WZMA 1NHUA 1SV5B 4NLVA 3EZUA 3CCMS 2KFZA 3FMBA 3TA0A 3RU0A 3OPKA 2GV1A 2JX2A 4LUBA 3QIDA 2CQCA 3CD0A 2HVIA 3JSBA 4PXBA 2FJAB 5LJ3Y 2GO8A 3H8YA 1SUQB 3IG1B 2B0GA 3HX9A 5D77A 1BLUA 2ZD1B 4KO0A 3PX4A 2PI5A 5B0GA 1L3SA 1WHXA 1DQ8A 4KV8B 4XO0A 2ZH2A 2E7XA 4LQ9A 3C6TB 1J5OA 1TAQA 4DSLA 1B64A 4HI2A 1MWYA 1SJ1A 2W9BB 3HXMA 4A8YA 2XMVA 1RT1B 3US5A 2AF6A 2F8HA 3DLHA 2X1FA 2RT3A 4V19J 1HWLA 2BANA 4ICLB 1HWIA 3DNCA 5KFMA 4IUFA 1S72S 3SCIE 1Q4RA 4QIFA 3MEDA 4B02A 2DRAA 5B0EA 3KYLA 4CO3A 1BY9A 4DBQA 2P6TA 5DG9A 2JC0A 2ATLA 1S77D 1ZAWA 1RKJA 4WXOA 3EGWB 4KE5A 3FSYA 1VQSA 1RT3B 2DHXA 4NCGA 3HHLC 2APOA 1LW0B 4OLOA 2KB2A 2KFNA 1LKZA 2LXUA 2LQ5A 2ZC4A 2W25A 4YDDB 5H1SV 4DL3A 2R7SA 4DUZF 5DJBA 3PRDA 4BC9A 1QM9A 4N47A 4C0BA 2MKIA 5F3ZA 3OV7A 5KT4A 6FD1A 5CZVA 2MKKA 2GCFA 1X9SA 4FBTA 2EFPA 2ADCA 1C1CB 2FGCA 1UVMA 3BJYA 3CJ0A 2ZH7A 2GMJA 2ADBA 3CCSS 4FF2A 1N5SA 4IDKB 2MKHA 2POKA 5GAEI 1Q8BA 1DRZA 2DGQA 4DSJA 3NNAA 1NH8A 3HFKA 3HKWA 4ETXA 4OQJA 4DG1A 3TRGA 2B4PA 4CO5A 2D1CA 2G9OA 1TFYA 4KFBA 3OVSA 2BQUA 1S76D 2IA0A 4ZPVR 5DRKA 4QPXA 1S1WA 4ZCMA 3PHEA 2F40A 4NCAA 1QVGR 1SIWB 2DGTA 1U1RA 3QO9B 1FKOB 1M5HA 5F8JA 2D3UA 1AFIA 5L9XA 1QE1B 3IR6B 2CQPA 1VQ8S 2DNOA 1RYRA 1U24A 5KFUA 5DQGA 4QW9A 4DFKA 2VUGA 2MPUA 4PUOA 2YX7A 2XB2D 2WK4A 2E5IA 2OMLA 2AU0A 1YVFA 4QWCA 2ZKTA 2Q1LA 3GILA 1R8AA 5HBMB 4F4XA 1QSYA 4K50A 4B3MF 2AGPA 2YTCA 3SQGA 3KLHA 1C0UA 3RR7A 1PC4A 4D3HA 3NMRA 5A8KB 1DLOA 4ZHRA 5KFKA 2ERRA 3PX0A 1QJHA 1FD2A 4WCEQ 1P6TA 2EC0A 2B9XA 5KT2A 2JOQA 1UAWA 1T03B 1SJQA 1FJGF 3F73A 2GGPB 1NHVA 1XWLA 1U1OA 2HS0A 3KHHA 3BEGB 2DVIA 4GC6A 3PNIA 3BSNA 4WXWA 3Q24A 1UVIA 3PO4A 3H2LA 4PG8A 5KFIA 1R27B 4CIOA 4PQUA 2HQIA 1NJXA 3I82A 1UA1A 4UQTA 3DOLA 1U1MA 1BQNB 4IR9A 3LW5C 1X4CA 1HMVB 4O4RA 4DJBA 4J9LA 3FEZA 3GV7B 2HNYB 5L1KA 3PW5A 2J0XA 2JEFA 3C6UB 5C25B 2C3OA 2QYCA 4G1IA 1VIOA 2DGWA 2I9SA 3DLEA 2DNYA 3MHYA 2XNRA 4LVNP 4BS2A 1YJWS 2PIIA 4QYZJ 1K0VA 3K5LA 1LWCA 1X4AA 2LQJA 1IJFB 3TAPA 4DLGA 1TKXB 3PJXA 5E3PA 2K7JA 3SYZA 4DMZA 1IKYB 3SI8A 3TNVA 2Q79A 3QIPA 2VBWA 2VFVA 1HNZF 4RU9A 3M1VB 4X4OA 3ZZOA 3CPWR 1S1UB 2JC1A 4A8KA 3VZIA 1S9EA 3N6LA 3UDCA 5J2QA 2LXFA 4QIEA 4V19X 2HS4A 2IM2A 4YB1P 4C11B 3R1LA 1KTQA 4Q7AA 1CQNA 1N5QA 1HBOA 1TL3B 3NCQA 2FY1A 4EZ9A 1JKHA 2F8MA 2O01C 2CIMA 3SEOA 1F5BA 2RF2B 4X64F 5L39A 2DH7A 1U47A 1OSCA 3M05A 4WF9Q 2E7WA 1VJWA 2LVWA 2WONB 3EXCX 4CTAA 4PRFA 4X4SA 2M4MA 2WSEC 3CJ4A 4LSLB 4YMEA 3HVTB 1NK7A 4BDPA 2MQQA