5L9NA

Structure of uridylylated glnb from escherichia coli bound to atp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
92
Chain Sequence
b'MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II 1
publication title Effects of T-loop modification on the PII-signalling protein: structure of uridylylated Escherichia coli GlnB bound to ATP.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Signaling protein
total genus 22
structure length 92
sequence length 109
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l9nA00
3GSDA 1VFJA 3MHYA 3X3UA 1NH7A 1UFLA 4C3MA 3AHPA 1NH8A 1NZAA 1Q1KA 1QY7A 3O8WA 2NUHA 4YB7A 4Y6IA 3TA1A 1XK8A 4IYQA 2O67A 2E66A 4OZLA 2ZFHA 2XG8A 2DCLA 1PILA 2V5HG 4E98A 2VD3A 4USHA 2XZWA 4CO5A 4RX6A 2PIIA 4R25A 1UMJA 4RWXA 4CNYA 1NAQA 3NCPA 2J9DA 5D4NA 4ZK7M 4WK1A 2GNKA 2XBPA 4C3KA 1UKUA 3BZQA 3T9ZA 2EG1A 2J9EA 4C3LA 1V3RA 4CO3A 1V6HA 2RD5C 2NS1B 3CE8A 3TA0A 4YB6A 3NCRA 1J2VA 2J9DE 2CZ4A 1HWUA 4RWWA 4Y65A 3NCQA 3AH6A 1UL3A 1O51A 1V3SA 3DFEA 4YB5A 5DRKA 4CO2A 5D4OA 1H3DA 2ZOMA 4NYOA 4USJC 4CO4A 1GNKA 5DS7A 5L9NA 1KR4A 2EG2A 4OZJA 3AA9A 2JJ4D 4D3GA 5D4PA 3O5TB 1OSCA 4WK3A 3HLUA 4CO1A 3N5BA 3OPKA 1P1LA 3TA2A 4AFFA 2O66A 4D3HA 3AA8A 4CNZA 4OZNA 4NYPA 3M05A 4USIA 2XULA 2Z0GA 3L7PA 2GX8A 1O5JA 2NUUG 1V9OA 2J9CA 5D4LA 1VHFA 3LF0A 4RLEA 2GW8A 4CO0A
chains in the Genus database with same CATH superfamily
5KFRA 1RWOB 4GVBA 3CJRA 4DV4F 5KFEA 3E8OA 3E3XA 3RB6A 1VGYA 3N9UC 1GTHA 3PX4A 2FLOA 2DNNA 2P6SA 2B9EA 5B0AA 4F0MA 1M1HA 4QWDA 4NLUA 1AYEA 1AUSL 3BKFA 3TAMA 1UA0A 3LQVA 3ZXWA 1NK0A 3QFWA 4DJBA 3R5DA 2F5GA 3CD7A 1UZDA 2H1YA 2VICA 2Z2LA 4IH5A 5T7LB 3D68A 2HRUA 3BO2A 4X4OA 2YWFA 5CZXA 2HBQB 2M52A 3UE2A 4WIQA 2K3IA 5FDLB 2X3DA 4LF7F 1FEHA 4I68A 4DV3F 4X66F 5F8HA 1OPZA 4DL7A 2SXLA 4B3SJ 2WHOA 4ETZA 2R42A 1BHNA 2VBYA 4DPTA 2F7VA 3ENWA 2HBRB 5GAGU 2V5HG 2L9WA 4JI6J 3PHEA 3O1LA 4I6WA 1XWLA 4ILMA 4B02A 3TAQA 2QYGA 4DFPA 2Z30B 5LXYA 3K17A 2GGPB 2M9KA 3RYLA 2CPDA 2L3MA 2WVDA 3QRPA 2YQ3A 3DRPA 3UD4P 3TZYA 1SQGA 2H4WB 2ZWOA 1NKBA 1D1UA 1Y3JA 1VC6A 4DFKA 2EWHA 1VRTB 2YKQA 3N6NA 1S9EB 4EBCA 4ECTA 2UU9F 3MMBB 3G9CA 3S7RA 4UY85 4CM0A 2KO1A 3LP0B 4O0NA 1Q86T 4L72B 3TZZA 5HP1A 3R1HA 2C2OB 3ISZA 3MEDB 4C3MA 4NEYA 1HBNA 3QQCD 2NUHA 3OLAA 3FUYA 3RRHA 1YRUA 3P4UB 4CLFA 3UW1A 1QJHA 1RZMA 1EAYC 4R25A 1HD0A 3EGVA 3BQ1A 1T9UA 4KH1B 1HNVB 1TL3B 3DU6A 4KV8B 2RQMA 2G2OA 4QJVA 3RTVA 4GMKA 4LQ9A 4UT4A 4DR1J 1XR6A 3T1YF 2IVFB 3GV8B 1PYSB 3NS5A 1VK3A 1L3SA 2JC0A 2PC6A 4K4TA 4BCAA 3VF0B 1GXTA 2CPFA 3PEJA 4C8KA 4TKTA 4Y0FA 2MZSA 2BQ3A 5M2UA 4K0KJ 1B0PA 2KFYA 1SC3B 4JI8F 2ZKTA 1R8CA 3SQOP 1S6PB 2D74B 2YNGB 3G2XA 1RTIB 1JNRB 1T05B 8ATCB 1XMQF 3JSMB 4EWTA 1X4GA 4ZIWA 1AROP 4UZCA 3W9HA 3CWJA 1S1WA 1K47A 3TVYA 1T0TV 4DCPB 1KVJA 1F3FA 2YBVA 3W62A 4E98A 2ASLA 4A8QA 3EDQB 1HPZA 3KDNA 1UVKA 3EZOA 4PG5A 2DHXA 5KFIA 3LWLA 5F3ZA 3CIZA 5HLFB 1O0PA 2JFDA 3QRQA 3MECA 5GMEA 2CJQA 1VOMA 2FJAB 5BYRA 1SUQB 1NJIT 3LW5C 1OY8A 1K1SA 2C22A 2AV5A 1U6ZA 4FPRA 3H4DA 1M5PC 5KG2A 4IDKB 4F3OA 4KT0C 1DQAA 3BYRA 2I6WA 3QBCA 1NHVA 4DU8A 3M30A 1R8PA 2V34A 3OL8A 5BR8F 2CAJA 1X31C 3MMJA 1RHMB 5HJYA 5I3UA 2VU5A 3OV7A 2IRYA 3O6QA 1LWEA 2NUUG 1IQZA 2LFVA 2GZOA 1U1NA 5F8GA 3Q0AA 4LF7J 2YXLA 2OH2A 3GV5B 4LRDA 5L1KA 1RTDB 1S6QA 4DV3J 2OPPA 4X66J 1ZS6A 4C98A 3OT9A 2WK4A 1RTHB 2FHJD 1U8SA 2MTLA 4USWA 1IKVA 1J5EF 3LH2S 4GKJF 5EWEA 2DIUA 4B9VA 2JFKA 3HFKA 1S1XB 2C42A 5B0FA 1F2HA 3KMSA 4OHXA 3G87A 3S1TA 3D6TB 2FHOB 2AWZA 3K59A 3PY8A 2ZH6A 1QE1B 1VR6A 4RNNA 3PW0A 4HH0A 3CO0P 2ZNYA 3BGRA 4YR2A 2BW2A 2Z8QA 2W7OA 1D8YA 1RWUA 4YOEA 1RWPB 5KAKA 2HIYA 5DZ6A 5DQHA 4N47A 1HQUA 4U6PA 4L3NA 2GV1A 1TV6B 3P3DA 1URNA 2G1HA 3PCOB 4ZVQB 5J2NA 3A3OB 4ZPDA 3DCAA 3KG4A 2UU9J 3KWMA 5E2QA 4C8OA 3QT7A 3PEHA 3DI6B 4EBDA 5HROA 1HWKA 2CYYA 5GVQA 5HL7Q 1MG7A 2V69A 1PJ5A 4ZP8A 4UOCA 3TQEA 5D6GA 1P9YA 5EGYA 1CC8A 4O3OA 4AQYF 3VAFA 5KFZA 3R6LB 4NEZA 2OJ3A 4ZITA 1FDBA 2GO9A 3OHAA 1XIQA 4NLWA 1XQIA 2POKA 1U0HA 4LR7A 3UNYA 2EFOA 3G8QA 1NMEB 2VG5A 2NYIA 3FFIA 1UW4A 1I51B 2XMWA 2NSCA 2HGMA 5IT9Y 3GCXP 4QR0A 4QIVA 2H5IB 4NMXA 3RAQA 2MLXA 2VUGA 3T1YJ 4A48A 4IOBA 4OYMA 5AXMA 4FF2A 3PRDA 2NREA 4UW2A 3PJWA 3JSRA 4EYHB 1DRZA 2F3JA 1FVSA 4ZP9A 1FTRA 4JI8J 4CP5A 4MYUA 3HHLA 2XNRA 3J81j 1LWCA 2OP5A 2H54B 2ZC3A 4DQSA 2RILA 5F8IA 2MY8A 5LM7E 2V50A 2OMLA 1XMQJ 2CQ1A 2GMHA 1MROA 4ILRA 4TU9A 3J7YI 3V6HA 4OV6A 2AYGA 3EWGA 4MAKA 2KG0A 2WB1D 2VD3A 1X4FA 3K5LA 3PRVA 2OTJS 1H98A 3CVKA 3IA0A 1ZM9A 2RU3A 3ZTQA 1AA1B 5K14B 3TP2A 1FRLA 3T9ZA 2W9AA 4WFYA 1RWNB 4I67A 2QJ3A 3PIOQ 2QGFB 3QZ7A 2W9CB 1G7CB 3GE9A 1NHKL 2ZWPA 3VQTA 1QD1A 2WSFC 1Y4ZB 3KKFA 3CCES 4QIGA 2CDQA 3MPUB 1CJKB 2C2DA 1ZA1B 1RU1A 2XNQA 3HJVA 1VYAA 4EFAC 5H1SV 3GCWP 3DXBA 4RUCA 2YWEA 3MM7A 4GC6A 5BR8J 3CDWA 2V2VA 4AT1B 1HQ2A 3ETOA 4XPEA 3CC7S 2ALYB 1SJ1A 3SZ2A 3OSPA 3CC4S 2VPWB 1V5VA 3Q8QB 1IBCB 2C2MB 2VFVA 4LVOP 2ZD1A 2K06A 3LUYA 4QWAA 4I6YA 2MKKA 3G82A 3SEOA 2YKNB 5EWFA 2CIMA 2IYGA 1F2GA 3B4MA 3MGJA 1HFEL 4F3QA 4NLVA 2F8HA 1NK5A 2VA2A 1J5EJ 3I0SB 3ISNC 4ER8A 2JRSA 4GKJJ 2YNFB 4NASA 1YZ6A 5D77A 2B5JB 1N34F 2QRRA 2CQ4A 2X1BA 3DC2A 3E01A 1GMUA 2HVZA 1TK0A 4WF9Q 2AEJA 1JLBB 1XC9A 2W9BA 3RZAA 1NSQA 2Q43A 4ECWA 5D15A 1GK8A 3J81Y 4LJMA 4DLGA 4HACA 3C46A 4IG0A 3HFVA 1RBAA 1F0XA 1VBKA 4DPYA 3GFYA 3B6BA 4PQUB 2HFSA 4DG1B 3A8JA 4WK3A 1PGZA 3HLUA 4BC9A 3Q8UA 2E9RX 3QJPA 4HTJA 4OX9F 2ZH2A 4CNZA 3NBPA 3V4MA 1SL2A 2PI4A 4CZCA 1FKPA 3I5CA 4LF6F 4JI1F 1G3OA 4DQRA 2X51A 2CPHA 2JEFA 3QT5A 3CTRA 3FMBA 2B4UA 2DH8A 3ILLA 4MK9A 1WC1A 1HBOA 3C14B 4KFBA 5KFMA 2O01C 4RBTA 4AQYJ 3RBXA 4K7QA 4OI3A 3TZXA 3CPWR 3LPYA 2ABYA 5F0UA 2KZMA 1ZOTA 1YKWA 2CJBA 3BQ2A 4QWCA 2IC3A 4ED0A 1RT5B 2JVRA 4W90B 4IG3A 1T94A 3FCHA 3DDKA 1FDAA 5A8RA 4HEA9 3AB4B 4MFBB 1MN7A 2OFGX 1T9XA 3AQOA 1R3NA 1NB7A 3HVRA 2DGOA 4AFFA 5DO2A 1IR2A 3MM8B 4TY9A 2E5GA 2ZH3A 5I3QA 1HMVA 1F1BB 4P7VA 1JNZB 4ZIVA 2OPRA 3LA0A 1RT6B 4DL0C 4DHVA 3HDSA 2ZH8A 1MNEA 1TUWA 2GVDA 3SV4A 4HR2A 3MAHA 2DEJA 4FXVA 3D4JA 3ZTPA 2RRBA 2JHEA 1NPPA 2XTJP 4XDDA 1CLFA 5ETLA 1D0EA 4FS1A 1LFPA 2CNKB 1S0MA 3QO9A 2CRLA 2D3OR 2CNLB 2BANB 1S7IA 4DS4A 3CIMA 2VG6B 3MEEA 3I4PA 1RWKB 1JLGB 2GMJA 2FVQA 1BQNA 1I5OB 2AJ2A 3M2UB 4PXCA 2DPJA 3IWLA 4JI5F 4OZ2A 2RT3A 4O4RA 4B9UA 2XI3A 3RW7A 4LSNB 4MKAA 2GQ2A 1RT7B 1PG5B 1XR5A 2WAQD 3SCJE 1QTMA 3IN5A 3DKDA 4ANEA 4P2MA 1WG5A 2APOA 3ET6B 2BA9A 2NZCA 3DGPB 1ZYQA 5GADU 1DLOA 1EARA 4E0DA 1NSKL 1WHWA 3AHPA 3PG9A 5KFGA 4JI7F 2IA6A 1BQXA 2I2YA 2M5YA 2BOAA 2FLLA 5B7WA 3N01A 4ZVGA 4HHHA 3D7SB 1EB0A 3LANA 2BE9B 4ECZA 2J6SA 1LW2A 3QGPA 1WUUA 4TQRA 4YFUA 1ICEB 1RGVA 4C0BA 1REGX 1N48A 4LFBJ 3GIRA 1R7IA 2CQBA 3M2VB 4ANDA 3BH7B 1S59A 1J2VA 1NDCA 5LSOA 1N5TA 2OD6A 4DV0J 1U24A 1URRA 2A1BA 1O51A 3W64A 3C2PA 3CT9A 2ATCB 1RTZA 1NDKA 4K5SA 3OR2A 4QYRA 1WG4A 1VBXA 3OPKA 4DR7F 3N6MA 1DARA 5J1NA 1VQYA 2E1CA 1RB0A 3L95X 1QAYA 5FJ4A 3CCTA 1S72S 4OX9J 4ED8A 3K8VA 4NRUA 2YQ1A 3DN9A 3BR8A 4JI1J 1RT4B 1IKWB 2XS2A 2Y8YA 3UQSA 4RZRA 1FKAF 8RUCA 2B0GA 2F65A 3MAAB 1QTNB 2XWYA 3UPFA 2YKMA 2J7UA 3UFCX 4H4KC 4F67A 4DV5F 2HWIA 1BC6A 1ZPWX 2ZJQQ 3Q83A 1R8BA 4M1KA 4I2PB 3BREA 3IRWP 1ZZFA 2O5DA 5AXLA 4U9RA 3MPYA 3PR4A 3T5HA 4C11B 1R31A 2M2BA 4DPWA 3KJVA 3IFEA 1N5YA 1WDTA 3Q24A 2G0JA 2Z56B 4CTAA 4JBCA 1XR7A 4ZVTB 3C3LA 1FERA 2RF2B 1WG1A 5T7LA 2JH3A 2WSEC 2CVEA 1D8ZA 1K44A 3AXMA 1ACMB 3SFUA 5B0EA 3K7RA 2RQ4A 2OHDA 4C8MA 1S1UA 2PN6A 2PD1A 4C6AA 5CYQB 2XYGB 1W7WA 1RHQB 1NDPA 4M5IA 1WF0A 4J9UE 3U1NA 2F9JA 3UCZP 4PXDA 3CO9A 5J2PB 2ZJPQ 3GJQB 3GR1A 4HDGA 1VQ5S 2V9KA 5ITHA 3F41A 1FX2A 4ZPCA 3NP5A 4UQGA 3KLIA 4TLQA 2WSCC 4IQXA 2CG8A 2DD8S 1U2CA 2CG4A 1Y3KA 2IDEA 4U7UK 4OI4A 3CEDA 4I2QA 3NAHA 5LT5A 1D9DA 1F9EB 2DT9A 2FVSA 5D4OA 1B64A 3OFEA 4W92B 3E2EA 3TANA 1UEKA 3GJRB 5IV4A 3CJ3A 4K4WA 4JI5J 4EUVA 1MMLA 2HHUA 3CCQS 1E6YA 4DL3A 2AX1A 2IMOA 4OYWA 3NLCA 1RHUB 4P74A 3GV7B 1TFYA 1TKXB 1QVGR 1SB6A 2C3MA 4F8RA 3QFHA 3IAM9 4W4MA 2CPEA 4IRKA 2QL7B 2PEBA 4CDIA 2HSEB 1WOOA 3IR5B 1OQ3A 4OI1A 5HO4A 1RYRA 2PIIA 5M2RA 3D2WA 3MMAB 2MMYA 4WE1B 5L9XA 4EI2A 1AB8A 5CCLA 4WFZA 4F4ZA 2CXEA 5KFAA 1IKYB 5B08A 3QPIA 2ZVSA 3GILA 2R7WA 1RAIB 3HSGA 2CQGA 2ZE2A 1NHUA 3J7A1 3DMJA 3NMRA 5KFVA 1HWUA 4WPAA 4CI0B 2AP6A 4PWDA 2D41A 1FJGF 5HJXA 4ID5B 2GAHC 1VI7A 2E7XA 3M8PB 4V19J 3R5CA 1VIOA 2EI5A 5LSLA 1UJ4A 3NAIA 2HURA 2BW7A 4DWIA 1RI7A 4OYZA 2P9EA 3HSZA 3M32A 3MZIA 2HNYA 3DRRA 2VA3A 4DR7J 3MM6A 3LP2A 1IKXB 1KOHA 2DNOA 4TY8A 1FJCA 2IY5B 1LK5A 3HHDA 8AT1B 1G2EA 2J0WA 3J7ZT 2UV8G 3O44A 2B9YA 5K9FA 2KI2A 3HKWA 1RT2B 3ZTSA 3CJQA 4NZ0A 4BS2A 3WIUA 1SKRA 5SZTA 2RHQB 1RA6A 4C0HA 3T1AA 2HHTA 2Z2YB 1YJVA 1NBEB 4CH0S 2VASA 3GFZA 4M63A 4DV5J 1D3WA 1ELOA 4AL7A 2Q1LA 2O3DA 4DX5A 3BGLA 5CA5A 1VS3A 4OJ3A 3UVJA 1JLFA 3KLFB 4LREA 2A2DA 3BQ0A 1KKHA 2DIVA 1NZ8A 4XDCA 4OZ1A 2C2NA 2IPOB 3J81U 1YJRA 2DO0A 2FB0A 1LW0B 2OUGA 3TRGA 4USKA 1TQLA 2J6TA 1PBAA 5RUBA 2PT0A 3HJFA 5AE2A 4AXIA 3H4BA 1TL7A 3M1VA 4DPXA 1IR0A 1OJ4A 1IWAA 3W7BA 3NGRA 4H4MB 3J7YU 2VG7B 4MKYA 1N0VC 1S6OA 3PYEA 2XM3A 2DY1A 1FXRA 4QIEA 2HZVA 1Q81T 3V81A 2RHSB 4KYZA 3PHTA 1V6HA 2XEXA 1S1XA 1P1TA 3VZHA 5HMYA 2ZVIA 4DSEA 3T41A 4MK8A 1HARA 1RYSA 1H2VZ 2EC0A 3PW2A 2BJDA 2HAFA 5D0GA 3M6UA 3NGKA 2DB1A 3IGVA 1RAGB 1F5AA 3HT3A 4PXEA 2HQ3A 1RAJA 1DTQB 3FEZA 3PACA 3SBMA 4PQAA 1REVB 2RNEA 2HMIB 2MZQA 2NYHA 3WHIA 3R7NB 1WHYA 2V8PA 3EPIA 1KS2A 2B6AA 5HSPA 1UJ6A 1R8AA 4J91A 2HHQA 5EDWA 2R2TA 1U1QA 4OHWA 1VQ6S 1VBYA 3UN2A 4ZS6A 3W60A 2XCAA 3CD6S 2AF6A 5J1EB 3DLGA 3FSXA 3MURP 1LXNA 2GVZA 2K1RB 1IJFB 7FDRA 4U7CA 1N32F 5CYMA 5KFCA 2M0GB 2CPYA 4A8XA 4P72A 2J7WA 3V4IA 1GMWD 2ASDA 1S0OA 4RW9A 3W2VB 3S6EA 4CO2A 4USJC 4O44A 4ECUA 4DDFA 3H2LA 1ULRA 3DLKA 4C4WA 1FKOB 4OJGA 1TL4A 3IS9B 3FDSA 2V4JB 4NLOA 2EEYA 3EVWA 2BABA 4DV1F 1FWPA 3AOAA 1BQMA 4PG4A 5KG3A 1NPRA 2G0CA 4F02A 3NL0A 2F8MA 3EXCX 3LGHA 4LF9F 1UPPA 3P5TL 2LXFA 4UUXA 1N6QA 2RJZA 3ZZUA 4DL2A 1KONA 2XYHB 4F25A 4PUOA 1LNQA 3IG1A 2CVIA 1QSYA 4G1IA 1LK7A 1KD1T 5IV3A 2OI2A 4JI4F 4O4GB 1OYEA 2HNZB 5K14A 4LRCA 4Y65A 1U1OA 3SDEB 3DFEA 3IBFB 4NYOA 4DL5A 3TUZC 3MTJA 4ALZA 3R9LA 5I4MA 2RSQA 1ZM4A 1N8RT 4J9KA 1I94F 5E3CA 4DFJA 3KYLA 2OEJA 4WBFA 5GAHI 4F3MA 3D1OA 3FC9A 1CJKA 5ETNA 2FZKB 2QFJA 3UDEA 2XWXA 1C4AA 1AZSB 3C66A 2GJFA 1XBWA 4RJVA 1RAFB 2AMCB 3AQPA 3I0RB 2W01A 4X4QA 3BSCA 3NWRA 3KJFB 1HHTP 4FVCA 4ZN3A 2P5VA 3R2CJ 1JLAA 2AEFA 3M8WA 1FT8A 1FXDA 1HA1A 3T5KA 2YNHA 4F7VA 1NU4A 2YKNA 1UETA 3KHGA 3JS9A 2PFFB 1T3NA 1TAUA 1YQHA 3W5YA 3I0SA 2BX6A 2FLNA 1JK9B 4B9NA 4ANCA 1RT1B 3ITHB 3M8QB 4JB8B 2X3GA 1YZ7A 2E5LJ 2K7JA 2P8IA 4CWBA 4F4WA 4URGA 1BWEA 1HWJA 4ENOA 1IBMF 2HHHF 1RHRB 2H5JB 3PFOA 5ETVA 5HVGA 2HZCA 4U8VA 1DFDA 1YGYA 2ATLA 5T41A 2XSJB 1NH8A 1NZAA 4MTPA 4CLTA 1C4CA 1NUEA 2UUAF 4HHUA 2ZITA 1JIHA 1FFGB 4B3OA 4OJHA 4OIXA 1OMSA 4PXBA 3DM2A 2OPQA 3BPDA 3DLEB 3MR3A 4PPDA 2ZBRA 2MLYA 2PFDA 2KFNA 3RRGA 3IR7B 2QMXA 2XLKA 3P96A 2RE1A 3MM9A 1WF2A 5ETOA 4WKYA 3C16B 1HYSA 3TZWA 3G8SA 5H9FJ 4P52A 1UJ5A 1DAXA 1C0TA 1X4CA 2Y0BB 4P75A 3D6HB 3OUYB 1JMTA 2DR7A 1UVIA 2UVRA 4R5PB 2A3JA 1N56A 4KO0B 3A8KA 3TI0A 3GIMA 2Y1JA 1TL5A 3CXCR 4USIA 3GLJA 3ADAC 1ZBTA 1I6JA 3ZZ0A 1KQFB 5LXRA 1WEXA 2HVIA 1AXQA 4P2XA 4DV1J 1P27B 2YNIB 4WXWA 4TXSA 2MJNA 2P9GA 2C2ZB 4LF9J 1NK7A 3PNIA 3T6BA 1RDRA 2RKIA 1QAXA 4CLYA 3BO4A 3HHLD 2XMJA 2YX7A 3W3SA 2HHSA 3BSNA 2VPZB 3EM1A 2DITA 2XI2A 3I32A 1SBRA 1SQEA 3ZZOA 2B43A 3CDAA 1GQEA 4A4JA 3EDRB 1O6XA 1HR0F 3V6DB 1U6FA 1KLMA 4FYDA 5I42B 2MEWA 3MDFA 3MFIA 1T3OA 3IMQJ 2GJIA 4FYYB 5D4PA 2BM1A 3M8ZA 3FK4A 1U1PA 3HF5A 2HBYB 4HTIA 4FYVB 1E6VA 1SKUB 2RH3A 3EPGA 1RT3B 3W66A 2JEIA 3ILJA 4KY3A 4NI2A 3FZBA 4YDXA 4ICLA 3ZZYA 3G71S 3IBWA 4F4AA 3TWZA 2Q79A 1RABB 3A8IA 5IT4A 1XMOJ 5BJRA 2BJ8A 1S0NA 2XMVA 1SC4B 3M7VA 2WONA 2N3OA 5D3GA 4DSKA 4NCGA 2E66A 3NY0A 4DFMA 5A76A 1QUPA 2IDLA 2MJUA 3DGPA 1WOPA 3HI9A 1LWFB 3VQSA 1JLEA 3T6JA 3R5AA 2QA1A 2G0IA 2DXFA 1DQ9A 4CRJA 3TO8A 4N76A 1CG2A 5DGAA 4MK7A 3PW7A 3GG0A 2Z58B 4FNHA 4X4TA 1VJQA 1KVKA 1HD1A 3OXFA 1UWAA 4K59A 1UEUA 2ZKUA 1U02A 4V19X 3PR5B 2FDNA 1T9TA 4EO8A 1BWVA 3FEYB 3C6UB 1WI6A 2UVUA 2UVVA 1KWMA 5DDPC 3TEHB 1TKTA 2IFXA 3CDBA 3OL7A 1U26A 4FYWB 3OW2R 2EBEA 4C8YA 1I3OB 3V2UC 1TVRA 1PAEX 9RUBA 2M8HA 4R0JA 1GTEA 1YJWS 1IBMJ 2FJBB 2HHHJ 1MU2B 3D3CJ 4KIAA 1K9MT 5IM0A 4DR2F 5C2GA 4AD6A 3THVA 4Y2CA 3OR1A 4KGMA 4WFBQ 3D5MA 1N52B 2UUAJ 1F9FA 1NPKA 3G8TA 1L3VA 3E51A 3CCZA 3VVTA 5D4NA 2VH7A 4ECSA 3CCLS 5KFPA 2DNRA 3H25A 4GO7X 4ECXA 3OQ2A 3CMQA 1SKWA 1V3SA 1WKJA 4IR1A 2QE5A 3NGSA 1JLCB 4ATNA 5L9NA 3AY0A 1VK8A 1C0UB 4ED4A 2M70A 1YJUA 1KSPA 2J0SD 4JI0J 2CKWA 4J90A 1NJWA 3A8EA 1EQMA 3JQMA 3N5BA 4PWUA 2EK1A 4I7FB 3GIJA 2VPYB 2WOMB 4MIBA 4KKOB 4EZ6A 4N8OA 2V4QA 2J9CA 1EETA 1XEZA 2IAJB 4C7QA 5C42B 1WELA 1YIJS 3DYAB 2WBMA 4M5DB 1UEVA 4IO9Q 4U67Q 2N7CA 3QLHA 1WI8A 1PIEA 4UZBA 4BDPA 1K0VA 3OHBA 2FPHX 4LFAF 4UY8T 3CF5Q 3PIPQ 1J5OA 3OSNA 4LSLA 4C3KA 4YHHF 4DL6A 3ELHA 4O3RA 2B4PA 3VALA 2FY8A 1S1TB 4OHVA 5ETPA 1FJ7A 2FY1A 1T03B 4Q0BA 2MSSA 3W61A 3CULA 1HR0J 4IOAQ 1Y9OA 1RA7A 4LR9A 1R0AB 4Q2MA 1YJ9S 2BZ2A 1M5HA 3HHNB 3L4BC 2MDAA 1Q79A 1S5ZA 2EPIA 3NNAA 1TMMA 1BGXT 4IFVB 4C8LA 5E41A 5CD4A 2QA4G 3HHEA 2UUBJ 1XJWB 1ZPVA 3ISND 2PO4A 1UWBB 3AOBA 1FJEB 3IRXA 2NZ4A 1CVJA 3H5UA 5KG5A 1HW8A 1DBDA 1SJRA 4CQ1A 1VQ7S 4Q8FA 1PILA 2XSFA 1VDHA 2P9CA 4OQJA 2BDPA 2ZBCA 2IIHA 3IR6B 4ZHRA 3MPDA 2FQQB 2ACMA 3UD3P 3G96A 2EC2A 3BO3A 4NLDA 3UDLA 2RD5C 1ZM3A 4A8KA 1HI0P 1S10A 1F6TA 3C6TA 2BEFA 1H74A 5THWA 5C7PA 3RB4A 1VQ9S 5FD1A 4JI2F 2DVIA 2HQFA 4ITSA 1X4AA 3NKYA 4DV7F 1U49A 4KQZA 4MKBA 4B3SF 3BPSP 5KTQA 1HBUB 2AGQA 1HNWF 2Q3PA 1RHJB 4CIOA 2VFSA 3H40A 2E1PA 3SCIE 3M05A 1FA0A 4Q7AA 4JI6F 4H4OA 2UZAA 4G65A 5KFQA 3OL9A 3K57A 1NJZA 1YK9A 3I31A 4G1QA 2ZH4A 4PYAA 1T02A 3MOZA 1YJTA 1IKXA 3ETMA 3C15A 3R3TA 2LKZA 4DR2J 2GO8A 3DLLQ 2DO4A 4ZN1A 2ZOGA 4XK8C 5C25B 1X5TA 2LDYA 3D54A 4KPCA 2BE2B 3EZUA 4DR5F 3LOUA 4R8UB 1VQPS 4ED5A 3CCVS 1X9MA 1R43A 3KJQB 2DNKA 2D3O1 2GIRA 2QL5B 1KTQA 3W8PA 5DDOC 1FRJA 4Y00A 4KGVB 1FK9B 2MZRA 2EG2A 4IRCA 3SCKE 2C2KB 3V6JA 2VONA 3KLHA 2MSTA 3PTWA 3KK1B 4A47A 4PWWA 3KLEA 4B08A 3AD9C 5A2QY 4LBPA 1DTTA 2F63A 4KH0B 2MB0B 2HLUA 1LEOA 1L3KA 4GVBB 2V94A 1FX4A 1JKHA 1RAEB 4O23A 4ELTA 2Q6BA 4PG8A 2QSFA 5HI7A 1OY9A 1NJYA 5C24A 1CJVA 2KG1A 4H4MA 3TAMB 2HWTA 4FBUA 2QIFA 2G2YA 3H90A 1S9FA 5B0CA 1HQEA 4X84A 4LT6A 4TNOA 2CQ3A 5CAAA 2XHCA 2HK3A 2DNHA 3NNCA 2WW4A 1CJUA 5ETRA 3CJTA 4FPIA 4WTOB 2MKSA 4ZVHA 3KUEA 3QGIA 1OS5A 3B8HA 4KE5A 4Q43A 4K2XA 3QGHA 1TKZA 2BOPA 4DX8H 2D69A 1Y7PA 4NYPA 2XHWA 2VQFF 5AXNA 5F8NA 2K7KA 4RNMA 5GAHU 2C3PA 1Q16B 4OX8A 4RLEA 2E1MC 1FVQA 3QGGA 1IN0A 1N88A 2DR9A 3TX8A 2J5AA 1ZAXA 3ENAA 3HD2A 2W7AA 2FHJA 4UUWA 1VC5A 2YY3A 2ASYA 2A6OA 1SJFA 4ERDA 3NGTA 1QAJA 2AZ3A 2B8PA 3DOKA 4LBHA 4BHQA 4NLYA 4RO0A 3PX6A 4JV1A 5KT4A 3H59A 1VQLS 1VQ4S 3QIPA 1SL1A 1HBMA 3M6VA 1CQMA 3DRPB 4TYAA 2CA9A 5GADI 2R7QA 2IVYA 5JXSA 4OYAA 4JI2J 1GAOA 1CS4A 2JX2A 4DF8A 2NXUA 3R2DJ 4DV7J 3OFGA 2NR0A 2DCUB 1N5SA 2R3VA 1HNWJ 3UN3A 2FYXA 3MEKA 3N28A 4LR8A 4ZVEA 2OSRA 3QNWB 4U7UD 4LF5F 3SV3A 5HP1B 4M5MA 3IS9A 2XMUA 2KVIA 4K4VA 3TA1A 1SC1B 2MGZA 1HBNB 2LMIA 5KFLA 4CYUA 5KOXA 4W98A 4Z7YA 2HHWA 4IOCQ 3M2RB 1QDUB 2NPFA 3I82A 4ZPVR 2G1DA 1WKLA 2R7XA 4DR5J 4QU6A 1JXVA 5A0YA 2ERRA 3CE8A 3TA0A 3D1HA 4NL5A 4F50A 2ZZTA 2LECA 3LP1B 1MMNA 1W26A 2I5JA 2L9NA 1APSA 1RLDA 4DV6F 5HATA 2HNZA 1WACA 3D6MB 4BWJA 3MUTP 1HLWA 4LBIA 4OZ5A 4G6VB 4QPXA 2J0QD 2XS7A 1X4DA 4J9NA 2B9XA 1A6LA 1S1VA 1UVNA 1X5PA 3T5JA 3HSDA 3BN4A 4KB7A 2N4DA 4C8NA 2HLTA 1QVFR 1S1WB 4QIWD 1LWXA 1YDLA 2IYIA 4HDHA 2K8GA 2KT5A 2R8HA 4IRDA 4N77A 3DGVA 1C1CA 3R97A 3I0RA 2ROPA 3LO3A 1S77D 1RTJA 2BKNA 2RDJA 4WWSA 3TQ1A 2WBRA 1HPZB 2VKZG 3H98A 1T8EA 1W2IA 4A8SA 1OWXA 4EU0A 2MPUA 2ROGA 3NOGA 1X4HA 2N7YA 4CO3A 2RDIA 2AGOA 3MECB 4UOGA 2OIHA 1TMJA 3RG6A 3A3PB 2NXEA 2DPIA 1MMDA 4YB5A 3KFWX 1VRQC 3MEGA 4Y28C 1EP4A 2EXUA 2A10A 3M30B 4EZ9A 4HKQA 1QM9A 2GC8A 5E0OA 2VDHA 1ZH5A 2B4VA 2HQDA 3SSQA 5KG1A 1X4BA 2AYBA 3HP6A 1KQGB 5I3UB 1GH8A 1KOOA 1LWEB 2VQFJ 5IQ6A 3GSDA 4ECVA 2RUGA 4KRWA 5EN1A 1UFKA 5HQMA 2MKCA 3CNQP 1GMVA 2HAIA 1TL1A 4HVZA 2DNPA 1YBUA 1S6QB 2OPPB 1QSSA 4WZQA 3U7JA 2BE7D 2HRYA 3HHLC 2XB2D 1AW0A 1IKVB 3K0JA 3UD5A 4P2SA 1IM6A 2E44A 4HT5A 1X0PA 3CJ2A 3F73A 3BKUA 4J9OA 4KTQA 3HZEA 2UXDJ 3AJ2A 3M9MB 1A9NB 3RB3A 2IRXA 3BGRB 1R27B 3I5BA 4P10A 2ZM6F 3AH6A 4OV1A 1GNKA 2UUTA 2RUSA 5DS7A 1NB2A 2J76E 3AT1B 3THPA 2N4CA 1UAWA 3AB2B 3NWGA 3UN5A 4ZCMA 1HQUB 4WU2A 4RKUC 2ZUGA 3DOMA 1SJQA 3MF5A 2VBZA 2HVEA 1F5BA 2V9WA 3GIIA 2V8GA 1SL0A 1O8BA 1P8GA 3DXSX 4QR2A 3TW0A 5J2NB 4X2BA 1N5VA 1U4BA 4C8ZA 3K58A 4I0WA 3W2WA 3ILIA 3IWNC 4F4KA 3KK2A 1WC0A 1KRPA 5K20B 2X7IA 3X3UA 2BRKA 4LF5J 1SH2A 4LIWA 1FNMA 4ES2A 5CABA 2XS5A 4RU9A 1YTYA 3GSIA 2C3YA 3JTOA 3A1YG 1X60A 1MW7A 4USHA 2PA8D 5EX0A 1L3TA 2ZJRQ 3G6VA 2D3ZA 2OFHX 1KBRA 1U0HB 5BYSA 4F04B 3DLHA 3BKTA 3G86A 3OD2A 2VG5B 3MCOA 2Z4PA 3FFIB 4ES1A 4HLBA 5KOWA 2RIJA 4X4RA 4ZLLA 3LAMA 1KEKA 4ZP6A 4O3QA 3OJSA 4YS2A 4PAAA 2RAQA 3U27A 2HYIB 4JOUA 1S49A 3IWXA 4QYZK 2HHXA 4XO0A 4DSLA 3ZNUA 2EBGA 4A8WA 1FWLA 4DV6J 2RB7A 2KB2A 3K5PA 1XN9A 2VPXB 2YQ0A 3H42A 1GT8A 4CCHA 2IMWP 5H9FK 2FLPA 1RBOB 1CQNA 2NQPA 4XPCA 3HHLB 2DGXA 5I3PA 5MAOA 2QA4S 2X1FA 1LWCB 5JUMA 3OTBA 2HPUA 2QYCA 4J9MA 2AIRB 3I5AA 2DXDA 1MROB 2R9LA 3EVOA 3S01A 4RR5A 4GC7A 2D9PA 3H0PA 4DZDA 4MMOA 1RUSA 1C2PA 3NRBA 1EQ0A 4RWXA 3GR0A 2HZAA 4QR1A 2BJ9A 4WXOA 1X9SA 2ZBQA 3QMQA 3DHWC 4TLRA 1VQMS 3VAMA 2AU0A 4PG6A 1RKIA 3GJSB 4ELUA 1M0SA 1PBUA 3BBFA 3KG0A 1HNIA 3VR1A 3M6XA 7FD1A 1CULA 4USTA 3GQCA 1RP5A 3UDVA 4KJIA 1N54B 3MM7B 4X4NA 4MJKA 3RBDA 3L7PA 2BVZA 1XNQJ 3EMTA 1WDDA 4LQ3A 1UFLA 4ZKAA 1YI2S 2AGPA 1SV5A 2DTJA 2ZD1B 3N4WA 2ZH1A 4FVMA 5KG7A 5KFYA 2DRBA 1FWKA 3G82B 3OXGA 1X5SA 2D7SA 3I9V9 5A8WA 4QPTA 1U45A 5A2QU 2L48A 1JJ4A 3KNAA 1IWGA 3KUHA 1SH3A 3PW4A 4JP8A 2YPZA 3HX9A 4L75A 4RW6A 2HNDB 1W25A 3E01B 2OTLS 4NPOA 3PYDA 2DGTA 2YH1A 2W9BB 2WW8A 3HD1A 2KDOA 4NXNF 3RAXA 1MSWD 2ZM6J 4HACB 4IG0B 3POTB 2LU1A 1X5OA 1L3UA 1FI4A 5SUHA 2YKOA 3QAUA 2QSWA 2J7KA 1C0UA 1NNDA 3NBPB 1FFWB 4L74A 4WFAQ 2CJYB 3KHHA 1FKPB 2R4FA 2CQIA 2LA4A 4QW9A 4ZCKA 4LFBF 2F1FA 3HVTA 2BJ1A 4DV0F 1HBOB 4DPUA 1WTFA 3JSYA 2GFFA 4KFBB 2G13A 1WJ9A 1QLNA 1VBZA 5KFXA 4DS5A 1HNZF 2DHSA 2XMKA 4F4XA 3MM5A 4NZ6A 2DGWA 4KBIA 3HO1A 1RQ0A 1WD6A 5L1JA 5D78A 3OFFA 3PO4A 4IO1A 1WKKA 3NCRA 1JLQA 2IC3B 2FJEB 2AYEA 1VQSA 2GIQA 2R2SA 4ED3A 3TARA 2HQCA 1SH0A 2MKYA 4C0OC 3KHRA 3J80Y 5A8RB 1K0TA 2QLJB 1HI1A 3TUIC 3V5RA 1IM4A 3UCGA 3RUBL 1SI9A 5J2QA 2DRAA 4EO6A 2IM2A 4AL6A 5F8JA 1QSLA 4ZLNA 1HMVB 2DGUA 2MZ1A 5G0RA 3O2IA 2CQHA 5L1IA 2OPRB 4RW8A 1ZTWA 3KLGA 3N79A 2DGQA 3ENQA 2EK6A 2W8KA 4OZLA 3T3FA 2GVDB 2E1RA 3DRSA 1YITS 2DJWA 1NEEA 5L8RC 5CD4H 5J2MA 4RX6A 3ONQA 2MYFA 4OYXA 5A8KA 1YLXA 1GFWB 4GKKF 4PRFA 2WCXA 1LKZA 3QO9B 4NE9C 3HSJA 1B3TA 2LEBA 1Q8KA 3CGIA 1RADB 5JVHQ 1Y5LB 3OFHA 3BF4A 3MEEB 1S9GA 2GAGC 2HIQA 4ZDNA 3L7OA 1BQNB 1VRUA 4UOHA 1CJTB 2C1EB 3J7AN 4ZVSB 5HBMA 4F2RA 1GEHA 4DF4A 4LSZB 2JEGA 4DR3J 2PSZA 4A8YA 4OZNA 2E29A 4ZPAA 2GHPA 4NXMF 2MQMA 2D9OA 3PV8A 1N33F 2GIFA 4P9SA 5E3PA 5EHHA 1WSVA 3I96A 1DLOB 3VCDA 2CUYA 4BWMA 2F40A 4ZVUB 3RAMA 2G9OA 4DN9A 2PI5A 1FESA 3QAEA 3CJSA 3CCSS 3M8YA 5C2CA 2OPSA 4ZJLA 1D09B 2RS8A 1ZA2B 2FZCB 2G4BA 2CQDA 2BQUA 3Q8SB 1LW2B 3Q8RB 2FVRA 4B9SA 3MOJB 1RWXB 3WQPA 2RU9A 1XTZA 3H5SA 1C1BA 3B4DA 5ETSA 3SQGA 1PJ6A 2V2QA 5E3QA 2D1CA 4NXNJ 2QLXA 1VIXA 4D3HA 3OR2B 3TUPA 1KHWA 3H20A 1DURA 2R7VA 5IS2A 3W5XA 3M8RA 2KJVA 2DEIA 3MR5A 2CPXA 5K8MA 4Z2XA 2VBWA 4FF4A 2V67A 3R5GA 2VQEF 3W65A 4M95A 3PVXA 1QY7A 3O8WA 1F9HA 3NXZA 4QIFA 4RBUA 4IFYA 1OYDA 2R8IA 2LEAA 2E5IA 5AJ3J 1HHQA 2L41A 2YWHA 5ETQA 4AYBD 1IVZA 5AXKA 4K4YA 2E7WA 4WFXA 2YKMB 3MMCA 1S97A 3GFXA 1SVDA 3CJKA 1KN6A 1X4EA 1P9QC 1HNZJ 4Q5VA 4MT1A 4RPFA 3H8YA 4O0IA 5B0GA 2R8KA 3AFGA 4YB6A 4E2FB 2AKWB 1RU2A 4GO5X 2V68A 4TVAB 7AT1B 2W4PA 3UI3A 2FHKA 2ZH9A 3G4SS 3KJVB 1UVLA 2CJXB 1N5YB 3FSIA 1WTBA 2PDAA 4CTAB 4F0KA 2B7BB 2LCWA 3SCLE 2VODA 2AD9A 4X4SA 2DNLA 4WYWA 2PMHA 4CO0A 5K8NA 2R7RA 4B3RF 1S1UB 2HKEA 1NH7A 2KXHA 2V8VA 1T11A 2MKIA 2JLFA 4EEYA 3BS9A 1KFDA 2W2MP 2AZ1A 3MPWA 5G4DA 2MXYA 4OI2A 1YJNS 1UKUA 3PKMA 4J9SA 2J8AA 1BUXA 3OLBA 1MN9A 2HS3A 2LA6A 5KFBA 3KLIB 3D28A 4WIIA 2AJ4A 5CZVA 4GKKJ 3IAS9 3EYZA 4UQTA 1RACB 2G2ZA 2VV5A 4I64A 1JQGA 2OLWA 2KFZA 2KH9A 4I2QB 2IJNA 3BDPA 4DL4A 1HI8A 4UTGA 5D0EA 3LGNA 2DRDA 5FDLA 4Y2MA 2QG9B 4PR6A 2QZ8A 3AD7C 3AXKA 1QAIA 1E6YB 2WTFA 4FF3A 2Y3YA 1VHFA 2C3UA 2PE8A 2BBEA 2VJUA 2MKJA 4NXMJ 3RBEA 1N33J 4M5LA 3VAHA 4K4SA 3CDUA 3OTDA 3Q8PB 3HM9A 3UO0A 1XNRF 5F8LA 4DBQA 4QBUA 1NK9A 1I1GA 1KHVA 4KPYA 3DHXA 5U47A 5EUHA 2E9TA 5KFTA 2EKYA 2GGPA 2GMLA 2CQ0A 2XBPA 4CLZA 3M2RA 3MD3A 4U8YA 1GMWA 3BYPA 5B09A 1B0VA 5HAOA 2CZ4A 4N41A 2ZE2B 3R5BA 3DMJB 3NNHA 4PWDB 4M8LA 1VQNS 1W2BR 1VRTA 3I6PA 2RQCA 1S9EA 2LQ8A 3K5OA 3MMBA 4DX7A 4RW7B 5KFNA 3FBEA 3LP1A 4Z37A 3LP0A 5GAEI 2BRLA 3BM7A 4PKDB 3M32B 4JV0A 2HNYB 1V3ZA 3DRRB 4FF1A 3MM6B 3LP2B 3MEDA 1YVFA 3NMAA 4LF8F 2ZC4A 1SPBP 4YUDA 1EKSA 2HEKA 4TY8B 2FJVA 5ETKA 1M90T 2ZBPA 1B70B 2VQEJ 3ILOA 2BJEA 4B9LA 1HNVA 2YX4A 1TL3A 2DHAA 4YR3A 4KV8A 4Y34A 5MLCV 1P6TA 1FEEA 4DV4J 5HANA 5DZ7A 2KM8C 3GJTB 1QUVA 2MKHA 1ZAVA 5IQQA 3EVMA 3KHLA 4CLSA 1OQ6A 4DXLA 1RBLA 3PXGa 2W1BA 2XYPB 4RBVA 4IH7A 4CO4A 4CT9A 1ZETA 2MQLA 3LWMA 2IVMA 3ICLA 3UVJB 4X62F 4L73A 2F4VF 1JLFB 2ZDOA 1U47A 4CO1A 1S6PA 2YNGA 4NMLA 1RTIA 3FBFA 1G1XA 3BSAA 5F9LA 1T05A 2ZNZA 2OELA 3IGNA 3JSMA 2AT1B 2QT7A 3ULHA 2KTQA 4WP8A 1R89A 3SIPB 3QZ8A 1GX5A 3MR6A 3HK2A 3CD0A 3DLBA 4B3RJ 1OY6A 2RVJA 4ZCLA 1TL7B 3WDOA 2CPJA 3M1VB 3GFHA 1U6BA 2XLJA 2XZWA 1HWIA 2N3LA 1N36F 5HLFA 3KG1A 4F26A 2YWGA 3V81B 1PYOB 4K4UA 1SUQA 2W25A 2V4RA 3IO1A 2OMOA 4N7TA 3TVZA 3WC2A 5IWAF 3B78A 4IDKA 3FRZA 5DDRC 3VGSA 2QL9B 4JYAF 2CJAA 3BDEA 4WCEQ 1SXLA 2JJ4D 1BE4A 4UF4A 2OEKA 1MWQA 4GVLA 1CSJA 4OHZA 2VJVA 1H6KX 5D4LA 3WX8A 4JV2A 3J80U 1OPIA 1RTDA 2MHEA 1NK8A 1PC4A 4EGLA 1S76D 3CSKA 3ZNJ1 1RTHA 2IBKA 2QO3A 4I4BA 2ADBA 3ZO7A 4WJBA 1Q82T 2CPZA 2ZZNA 3KJNB 2B6AB 1WHVA 4B3MF 2EKNA 3GP9A 2HRTA 2QA2A 2KM8B 1HKAA 3ZZPA 1XNRJ 1AFJA 3PKYA 1B7FA 4TN2A 4I69A 3ZZTA 2ZH7A 4FP9A 1QE1A 2E5LF 1TUVA 3DLGB 2EG1A 2ZBIA 2GVZB 1R0BG 4J9VA 3NGUA 2YKAA 4ZJQA 5CYMB 4A8OA 3W9IA 1FTCA 3HKZD 4DLEA 1JJ2R 1H2TZ 3FNNA 2CWXA 2JVOA 3V4IB 1UA1A 4RW9B 3FQLA 1T7PA 1AUDA 1TV6A 3PRBA 3GYXB 3TJ9A 4O44B 5HQ8A 5LMNF 2DH7A 4LF4F 1UZHA 3P5BP 2QLBB 3DLKB 1EX8A 4PEOA 3DI6A 4PCQA 3R27A 2ZHAA 4JUZA 4RUHA 1BQMB 2HFOA 4YB7A 4LF8J 1YRXA 3BB5A 2BJ7A 4XIUA 3L7UA 1N6QB 3FCWA 5FIIA 4TQSA 4PUOB 2ILYA 3IG1B 1Q53A 5K5MA 2VDIA 1FDNA 1PSDA 4KHPF 4L76A 2EFPA 2DHGA 3CJ5A 4NCAA 4E8UA 4NWBA 4WP9A 4Q45A 3ZTRA 2IM0A 2J9DE 5F41A 4Y2IA 3ZTOA 3CCRS 1PAUB 3KNGA 1EZZB 4OZ3A 5KFWA 1RWVB 4DUYF 4RL1A 3MXHP 3A13A 4X62J 3I87A 2F4VJ 5KFJA 1KQSR 3T1HF 4ETXA 2VC1A 2DNMA 2JNJA 1ROFA 3M8SA 3OVBA 4DSJA 1DQ8A 4A8FA 4K8RA 2GS8A 5M2PA 2ZH5A 2EFQA 3H2VE 2CNOB 5JJBA 4P7TA 2ZDPA 3CCUS 1Q5YA 1JLAB 3KK3B 2GA7A 5LJ5Y 1RISA 1U1RA 5F9NA 3IXQA 1N4LA 1GX6A 3D1QA 2YNHB 1KTVA 2L9DA 2W4CA 5JMNA 4DMZA 3UR3C 3TNVA 1N36J 4M5HA 5HMZA 1U0SA 1X8DA 2W9CA 1VC0A 2IM1A 4QU7A 3L09A 5HMWA 5IWAJ 2BMBA 1FD2A 4AUKA 4JYAJ 2RDDA 2Y1RI 2HNDA 1XMOF 3GMGA 3QJJA 2DHHA 2F4FA 4KSEB 3UCUP 2B3TB 1SQFA 4DSIA 3AAWB 2MQPA 3AD8C 5L46A 4J7CA 2C2RA 2YPYA 3POTA 2W2NP 4OFZA 1R6VA 3R8YA 4NZ7A 2HGLA 2VB6A 3Q8YA 3K89A 1IBLF 3DU5A 4HHJA 1GXUA 3IC1A 4QWEA 3ZZRA 1EHWA 4K50A 2FUG9 3MD1A 2QLFB 2ILZA 4B3OB 2YNFA 1M1KT 3MCMA 2BYCA 4B3MJ 2B5JA 3DM2B 2OPQB 3GTYX 4MYTA 4O3SA 2Y8WA 3EGNA 2LDIA 3KLVA 1JLBA 2W2OP 4NCBA 3QIDA 1B0TA 3MM9B 4NA1A 2M7SA 2FC8A 3DDNA 5DLGA 1HYSB 1NK6A 1WC3A 2DR6A 5E3AA 4PQUA 3PZPA 4A46A 5IC6B 2B9WA 1JX4A 2HFVA 4DG1A 5IT0A 1S7HA 4TYBA 5DGBA 1C0TB 2L08A 1NK4A 2YWKA 4U96A 3GZ7A 2LQBA 5LMNJ 2X1GA 2KYZA 2HFZA 3S8SA 4LF4J 3RR8A 4USMA 1H2UX 3QT8A 3GWCA 2YX1A 1NSAA 3EE3A 3MHYA 1HHSA 3VAJA 2AJFE 3B82A 2F9DA 3C14A 2HHPA 1NXIA 4EYIB 2U2FA 3FKBA 2ZFHA 4PABA 2XG8A 2V8DA 3N6LA 4LRAA 1JB0C 2M3DA 2RKIB 4ID8A 5BYQA 2J9DA 3KOAA 5KT3A 4JI0F 1EIYB 3JSBA 4J5OA 3DOLB 4USUA 2H3EB 1V3RA 1D9AA 3M9NB 1RT5A 3RW6A 4KHPJ 1WC5A 4M5KA 3KMQA 4N56A 2Y0SD 1SJ3P 3THTA 4DCOB 2CJ9A 1XERA 2CDRB 1EKRA 5KFDA 2UXBF 4MFBA 2UVWA 4F2SA 2NXJA 2VC0A 4BC7A 1KLMB 2B8QA 2QMUB 4OZJA 2J6UA 4NLRA 2RRAA 4KGZB 3FZ2A 5L39A 2BM0A 2GHVC 4ZP7A 3MM8A 1UVJA 2H9ZA 3MFHA 4DUYJ 4HL9A 2HBZB 3AA8A 2CPIA 1CJTA 3D0GE 3H5YA 5HVHA 1FRHA 1IUJA 3NGDA 5KFFA 1E6VB 2VL1A 2PEHA 1RT6A 1KLNA 1IJEB 3MI7X 1RE1B 3T1HJ 3X1LB 4NI2B 4ICLB 6AT1B 1FCAA 3BV8A 1BLUA 2XY7A 5KG0A 3M4XA 2WONB 4NLPA 1Y5NB 3D6FB 5D3GB 1Y0HA 3HXMA 4NCGB 4FS2A 4ED6A 4U95A 6FD1A 3PJXA 1BMQB 4ZCIA 5L1LA 3Q22A 2OKQA 4CLLA 3K8WA 4ZLPA 2RMLA 1JLEB 2BANA 3KUGA 2XGPA 1OIAA 2VG6A 5H9EJ 4J37A 1FXLA 4G1PA 1JLGA 1PYTA 2UP1A 3CB4A 1RAHB 4TU8A 3TOQA 1PJ7A 3M2UA 2Z2MA 4PYDA 5EWGA 2DKOB 2AJQA 3MPVA 1RWWB 2HQGA 2KN4A 4KR0B 1UTAA 4LSNA 2UUBF 3ENVA 1KFSA 3C8YA 2DNGA 3I9ZA 1RT7A 1N34J 4URQU 2E9ZA 5C5JA 1YHQS 1TKTB 1U8WA 1FNOA 3ET6A 4B3TF 1PCAA 2JC1A 1TVRB 3MCNA 3DRXA 3H5XA 5IFMA 1M5OC 4OX7A 3HZGA 5HVFA 3AODA 4Y3CA 4EK2A 5IM0B 3JXOA 2WZ1A 4NLGA 3JTNA 4LF1A 3W1YC 1U1MA 3D67A 1IBLJ 3MUVP 2IHR1 4ZVFA 3GONA 3T19A 1KDNA 2ACYA 4C9DA 3OR1B 4EMDA 2E7VA 4CO5A 3QSYB 3G6XA 2IM3A 4DR6F 4LF6J 2VF3A 4DX6A 2BKOA 2OO4A 2ALZA 3BZQA 3KDOA 1X0FA 1YRTA 3VWSA 3M2VA 3MAQA 3UNGC 4CH1A 2YH0A 4YQWA 1T9YA 2CWKA 1FE4A 5FLXY 2V63A 2H4YB 1UL3A 5KG6A 2IJRA 5AT1B 3K5NA 1RCXB 4NLTA 3M6WA 3QRRA 2CFXA 3JQJA 2I38A 3BN7A 1H38A 4FXWA 3SYZA 2NXNA 4OLOA 5GAEU 1F3VA 1RT4A 1M5VC 1IKWA 1EETB 2CZVC 2KXNB 4YDDB 2JLGA 5B0DA 2AW0A 2B4OA 3WZ0A 4C2MA 3EGWB 2MQQA 4Y2KA 1ITPA 4LMZA 2B56A 1LV5A 3MAAA 3QLHB 2QC3A 3JYTB 2DCLA 1VHIA 2VBXA 4FKYA 4CH7A 1JXEA 2V2ZA 1FHTA 4CNYA 2HS4A 1X7VA 4DSFA 2PGCA 1J5OB 4JI3F 2LQ9A 2FVPA 4LSLB 4I2PA 5D8HB 1G4CA 2JSXA 2FJWA 4X4VA 3EICA 2C3OA 2ZUAA 2VIHA 2V6AA 4C11A 4CLPA 1N0UA 1VLYA 3TX0A 1TU0B 5KFSA 3OTEA 5DJBA 2UXBJ 4Q0BB 4D3GA 4QW8A 3GG1A 3G6YA 2RF2A 2DNYA 4RU2A 2W2PP 1Q8LA 2ZHOA 1MLAA 1KQKA 1BXNA 1KVIA 1YBAA 5CYQA 3A12A 3WC0A 2KU7A 1YG0A 4RW4B 4CLUA 2DNQA 3A3NB 1Q7LB 2LEPA 2NLWA 4Q8EA 5IT9U 2H65B 5J2PA 5E3RA 2FJDB 4X4PA 3SMZA 3D0HE 2QV6A 3IRXB 2MZTA 1H7XA 1HIYA 4WFNQ 3QYYA 4FN5A 4LFCF 4NOHA 2R7UA 4K5RA 3PM9A 3R7SB 2B7CB 1N5QA 2KRRA 1VQKS 4NYZA 1UPMB 4ZHRB 1D9FA 4QZVB 4ED2A 4JI7J 2P2CB 4I1TA 2NSBA 3SSRA 2UUWA 1Q95G 3Q86A 2CQ2A 3D66A 3C6TB 4K2JA 3RBZA 2A18A 1HW9A 2HVHA 1RLCL 2KZZA 4ILLA 1JWWA 4B9MA 3AA9A 2DNZA 3TA2A 3OJUA 3F56A 2GX8A 1S0VA 2YTCA 4X65F 2WVCA 4RW7A 4ZPBA 4H4OB 1TKXA 4B3TJ 4H4KA 2WVFA 2BXJA 5DG9A 3CJ8A 4NLSA 5LMUF 9ATCB 4G1QB 2R2RA 2AJ1A 4YR0A 2I0XA 4TU7A 3C15B 1WC6A 3MMAA 2HW3A 2A0FB 5F3TA 1JXLA 4WE1A 1YBTA 2R8JA 4ZK7M 5DM6Q 1IKYA 3HVWA 2DK2A 4DR6J 5K8PA 2Z2ZA 5ADZA 3VVUA 4ID5A 1CBKA 3M8PA 5K8OA 1KP6A 5E7OB 1Z1ZA 3VAKA 1AT1B 4F4YA 3GYNA 2HWHA 2KKHA 3N0VA 3MCSA 2OSQA 2JWNA 1FRXA 1KC8T 1PC5A 3P8BB 3KLHB 4QOTA 3OTOF 3CMES 3FVYA 5ETTA 2BR0A 3FCVA 3AJ1A 3JQKA 4DZ6A 3KLEB 3GIKA 2K3KA 2RRNA 4GRSA 2HQIA 1DTTB 2CADA 1WWHA 4OJ1A 1FRKA 5GMDA 2VOOA 2XLIA 4DI6A 3U1MA 5B0BA 1RT2A 5D0RA 3VAGA 1JKHB 2KVQE 3TJ8A 2VFUA 2Y1IA 4H54A 2QMWA 4N8NA 3OBIA 5DQGA 1J27A 1T95A 2I9SA 4AXJA 3K5MA 5C24B 4P71A 1CJVB 4JI3J 1S12A 3T5LA 2C2EA 2OAUA 2M8DB 1HQEB 2WVEA 5DRKA 3KLFA 4KAIA 4CLWA 2QFIA 2DGVA 1DHMA 1RSCA 3TR5A 1Y5IB 1S57A 5LJ3Y 1CJUB 4O3PA 5DM7Q 3P45B 2ADCA 1NM2A 3Q2SC 1LW0A 2XULA 3D9BA 5IC4B 5GMKa 1TKZB 4J9PA 2E1AA 4DV2F 1Z4UA 4DR4F 4LIRA 2XZTB 2IRUA 2J0XA 3SI8A 1H0HB 3TJAA 2EW9A 1VFJA 2LYVA 3GU0A 2LLZA 2V0NA 1UVMA 2VG7A 1WORA 2DY9A 2JEJA 1Z2ZA 4WTYA 3TYTA 3MUMP 4XTTA 2MY7A 2U1AA 3U02A 4LFCJ 2HHVA 3AJDA 3DOKB 4ZVOB 2AJ0A 4IQMA 2FD2A 1K1QA 3UDCA 5F8MA 1SKSA 2EFNA 5CQGA 3EXYA 2Y1LB 2IA0A 3D3BJ 2R2UA 4WKRA 3QIPB 1HBMB 4XAKA 1SCJB 3KTQA 2XZDB 4YP3A 1Q0NA 2KRBA 4YY3F 1TK8A 2ZOFA 5DG8A 3H7HB 2EVZA 4X64F 1CS4B 1DTQA 2XMMA 5JVGQ 1S48A 1NRKA 1R8HA 1REVA 2A2CA 2HMIA 2YVSA 1F5CA 1FJGJ 2DXEA 5DLFA 1Q8IA 1Y00A 2BQRA 4X65J 2B51A 2H5EA 5AE1A 2N82B 4OYBA 2UXDF 1IXKA 1RXOB 4NX9A 3CCWA 2MGZB 5LMUJ 3BEGB 1VJWA 4CYUB 1WEZA 5J1EA 1M5SA 3VZIA 1NO8A 3FBCA 4ECYA 4MIAA 2I1RA 2K1RA 1U1KA 2V2KA 2DR8A 1Z2LA 4Q2LA 1VQOS 1ZM2A 2COLA 1K73T 1TKDA 1KNZA 4C3LA 2XO7A 4FDFA 3JAMY 5A0YB 4OI6A 3GYGA 3W2VA 1LXJA 3C19A 3GB0A 4C48A 3F0NA 2JDJA 2ZOMA 2BUNA 4I6AA 1NDLA 4DQQA 2HGNA 2I5JB 1LQ9A 4F36A 4ZMMA 5KG4A 4CLKA 5CHCB 1FKOA 1P1LA 4DQPA 2V4JA 3ZFVA 2E5JA 5KT2A 4FBTA 2W7PA 2Z0GA 3BR9A 4UOFA 4Q44A 4IR9A 4BLGA 1S1VB 1NCLA 4WU3A 1S4EA 2IJFA 3OTOJ 3WBZA 1CPZA 2LU2A 3SFGA 3TAPA 1Q1KA 2XMAA 1Y10A 1U1LA 3DNCA 4ED1A 2RS2A 4J9LA 1C1CB 3G6ES 1RTJB 3CUNA 2YWWA 1TR0A 3MTKA 1Q78A 2BKPA 3KK3A 2KXFA 2LXIA 4O4GA 4Z7CA 4KGXB 4PG7A 2O1PA 3SDEA 4AL5A 3IP0A 2MHNA 5KT5A 4MIWA 1L5UA 4M5NA 3SXLA 3VGTA 1XMBA 4F0HA 5DG7A 3MEGB 2OGUA 2OEMA 3OVSA 1EP4B 1U48A 5FLXU 3NOCA 1AZSA 4YN3B 4O3NA 3L3CA 3EGZA 3R7BB 1WHXA 3FBBA 3PX0A 2GW8A 1WOSA 1TZ0A 4P2FA 2MQOA 1RHKB 1TP7A 4DV2J 4DR4J 3CJ0A 5GAGI 1RJJA 5DDQC 2W24A 2XY6A 2DH9A 2UXCF 2CJKA 1TL1B 3QWUA 1H7WA 1HNXF 1U09A 3I56S 2E5HA 4YB1P 3D0IE 2DISA 2GHWA 4JV5F 2W4DA 3KXDA 2MLZA 2LQJA 3BGUA 3FMWA 1RT1A 3ITHA 3M8QA 2FIUA 4HYKA 3CDEA 3DLJA 3BJYA 4DUZF 2BACA 1XNQF 3OVAA 3U1LA 4DQIA 4RNFA 4QYZJ 3FSYA 2FC9A 4DU7A 3J7Z5 1X9WA 1N32J 1TELA 1U2FA 4YY3J 2O66A 1MWZA 2HG4A 4OMFG 3DOMB 4X64J 2HK2A 4ZA1A 1G6BA 5CCMA 2KHCA 5IZHA 2VKRA 2XSJA 4OI0A 3W2WB 3MR2A 3KK2B 2BJ3A 2FTRA 4KHRA 4Y6IA 5KFHA 3BSOA 3JB9k 1CC7A 3NG8A 1MWYA 2NPIA 4V1Ak 3PW5A 3EUNA 2EFVA 3DLEA 2RQKA 1LOUA 4OHYA 4M94A 3OXLA 3VGUA 1Q4RA 3HMJG 4DOZA 2XCPA 1YSJA 2AYMA 3R5JB 3C16A 4P6QA 4ZVPB 2ROEA 2FGCA 3IBCB 2VFRA 2ZHBA 4OYOA 3DOLA 3OUYA 4S0MA 1VISA 1UCNA 3DRYA 4ZPWR 4ES3A 2F8EX 2HS0A 3W9JA 5DETA 4R5PA 1EJ7L 4KO0A 1WNEA 3HCXA 5HROB 1CEZA 3CC2S 2M4MA 1IQTA 4JI4J 1RCOB 1V9OA 5T14A 1DZ5A 4NLXA 1TFWA 2YNIA 5LSRA 1B7YB 3R6GB 3P49B 1I94J 1XK8A 1H72C 1BD6A 5ETMA 1A0OB 3PFEA 4DN0A 3JTPA 4ECRA 1T9WA 2CQCA 2UUCF 3QATA 1JJHA 4ED7A 3FQKA 1IBKF 3SSSA 4USVA 4DPOA 2VHGA 3OL6A 3IM8A 4OLPA 1Y11A 4L3KA 2HVDA 2JL9A 2FHMA 2M88A 1RAAB 1OSDA 3V6DA 1RWMB 1FRMA 4RWWA 2LXUA 5I42A 4LRFA 2KT3A 5KT6A 1FF2A 3RB0A 1TAQA 3RJMB 2DYAA 1PO6A 3O5TB 3M9OB 4RNOA 1HNIB 3H2UB 5L38A 3TEGA 4FZVA 1RT3A 1CULB 5CH7B 4K4XA 1Q7YT 5F0WA 2KT2A 1YX2A 2HFUA 3NS7B 1BY9A 2WB4A 2GCFA 3BBCA 5A6PA 2QTWA 3TUJC 3IM9A 4IUFA 2LVWA 1RKJA 3DDIA 3A4TA 1SV5B 5LOQA 4NRTA 4QWBA 4YEAA 4HI1A 1LWFA 4YMEA 2QX0A 4N5SA 4OL8A 1ZAWA 2UXCJ 2R7OA 1FRIA 1HNXJ 5A8WB 4L6V3 1NAQA 2GNKA 5E5NA 3EX7B 2J9EA 4J9RA 4IH6A 4JV5J 4DR3F 2NCKL 4RNHA 2J8SA 4C97A 4EBEA 3LPEA 1NKEA 1A7GE 2CNNB 3VTIA 4RW6B 1H73A 5KFKA 1Q8BA 2KL8A 2VOPA 1FFSB 4PZVA 4M5GA 1ZTTA 3RRKA 3C6UA 2I8EA 5H9EK 4RUBA 4DUZJ 2EFGA 2DGSA 1T9VA 2HFNA 4RUAA 1DY3A 2JZ5A 1SIZA 1WEYA 1NKCA 4IKAA 5CXTA 3US5A 1MU2A 4Y2AA 4R0EA 4MH8A 2GQCA 1YJ7A 2H51B 3Q23A 5CYJA 3UWTA 3W8GA 1FNXH 2D3UA 2GQQA 3PYFA 2XY5A 1S79A 1VQ8S 4M5JA 1NJXA 2NXCA 3R1LA 3LAKA 1UFWA 3HVTB 3OTCA 3MWBA 5DQIA 3W5ZA 3HVAA 1UMJA 2LQ5A 4OYIA 3NCPA 4ELVA 2Q66A 3NEKA 3JYTA 3NS6A 3HHKA 3VHQA 3O3LA 3MM5B 5IXUA 3UR0A 4ZJOA 2JLEA 2ZZMA 4B9TA 4OX6A 2WVBA 3ZC4A 1JLCA 3L9ZA 5BXIA 1HL6A 1JLQB 2X1AA 3EJMA 2Q6CA 1KR4A 2XMTA 1B4SA 2FJXA 4I7FA 2WOMA 2VZ9A 4KKOA 4URSA 3CD5A 1RAOA 2WRMA 3PYGA 3Q2TC 2DBBA 4DCJB 1Q5VA 2IAJA 5AJ3F 1O5JA 5C42A 2GJ2A 5J2QB 3CMAS 3DYAA 3LF0A 3QWPA 2UV8A 4M5DA 5AE3A 1GXLA 1AFIA 3PDNA 5G0RB 3HFZB 4RW8B 3KLGB 4QQBA 4WZMA 2A6MA 2PMWA 3Q8VA 4RW4A 4G3IA 3RU0A 2R8GA 3FJ2A 1RK8A 5HMXA 3DRSB 3TVKA 1F60B 1FD8A 2XQCA 4LUBA 1NLKL 5J2MB 1UP1A 4IG3B 2UUCJ 2Y9HA 2W2QP 5A8KB 4WP3A 3BGFA 1IBKJ 1S1TA 3EZ5A 4LRBA 3VV2B 4DEZA 4CM2A 3BH6B 3LTOA 4MKVA 2XO6A 1T03A 1S9GB 2P6TA 2PMZD 1M1GA 3VGVA 3P6YC 1R0AA 1VRUB 4B17A 5HBMB 3RGIA 3QT6A 4ZPTR 3JAMU 2ZEJA 4LVNP 2JOQA 5J1PA 3QSIA 3BGOP 2Z57B 1LFWA 1U2RA 4DUTA 2ASJA 1M5KC 3WIVA 1ZZNA 1WF1A 4IFVA 2FVCA 2AHOB 1S6UA 3BBBA 2AEMA 3V6KA 2MZJA 4ECQA 1UWBA 3F44A 2AQ4A 3LALA 2R7TA 1TK5A 1IR1A 4FKXA 5KFOA 2O67A 4NLQA 1TUGB 1U25A 3HPOA 4WYLA 2QEXS 2OD4A 4CT8A 1OO0B 1S99A 2CQPA 2OPSB 5D0HA 1SJ4P 5EX3A 3PO5A 3T9NA 4OYPA 3MR7A 4HI2A 1HWLA 2XC9A 3HT0A 2R7SA 5HN0A 4PPZA 5KFUA 1C1BB 1HBUA 2AX0A 2IBOA 5HQLA 6FDRA 3SQGB 4KGKA 4FNIA 5A6WA 2QLWA 3GPAA 1B99A 1OSCA 4P73A 4OZ0A 4KC5A 4K4ZA 1VCTA 5IOLA 1SC6A 2BV3A 3CCMS 3N5FA 1S4FA 3I55S 2H48B 3HULA 1SIWB 5HK4A 3LGMA 2DR5A 4NA3A 1FDDA 3Q89A 2W8LA 2C28A 3K2YA 3FRYA 2KYXA 4IYQA 2LP4A 1WC4A 5C25A 3FGVA 2FGOA 1VMBA 4IFYB 1VLOA 3CW2C 3PJ9A 2MQ8A 2BE2A 3CJ4A 3FEXB 2V8HA 4I56A 4R8UA 3CCJS 1JJCB 2KJWA 4X4UA 3I4HX 4KHMA 1WSRA 4WK1A 4ZVRB 1NSPA 4DR1F 3MMCB 4BBYA 2K2PA 4ZOSA 3AOCA 1U7LA 1TTHB 4FXDA 3CJKB 2NS1B 4J9QA 3RR7A 1FO1A 1PKUA 2CZ9A 1R6YA 3NCQA 2XGQA 4HT7A 4LFAJ 1FK9A 5KT7A 1H3DA 4ZLJA 4K0KF 4QCLA 2PA3A 2VFTA 1K8AT 3WX4A 3VAIA 5LL6d 1UW9A 4YHHJ 2KHDA 2MQNA 4AE5A 3KK1A 2YKPA 5E33A 4NA2A 1R0CB 3W63A 1YWXA 2QN6B 4FYXB 2FZGB 4LF2A 4A8MP 1FE0A 3QJLA 1V5IB 3B54A 4HH1A 3ZZZA 1DJ0A
chains in the Genus database with same CATH topology
5KFRA 1WHYA 5IFMA 5I3PA 5MAOA 2QA4S 3EPIA 1M5OC 2X1FA 4OX7A 1LWCB 5JUMA 1KS2A 4DV4F 3HZGA 3OTBA 2B6AA 2HPUA 2QYCA 4Y3CA 5IM0B 5KFEA 4J9MA 1UJ6A 1R8AA 3E3XA 3E8OA 1VGYA 3RB6A 4NLGA 3N9UC 2HHQA 3JTNA 3I5AA 1U1MA 1GTHA 1MROB 5EDWA 2R9LA 3S01A 3MUVP 2IHR1 4ZVFA 2R2TA 4GC7A 2D9PA 3T19A 3PX4A 1U1QA 2ACYA 4OHWA 2FLOA 1VQ6S 4C9DA 2DNNA 3OR1B 1VBYA 2P6SA 4ZS6A 5B0AA 4MMOA 1C2PA 3NRBA 4CO5A 2XCAA 3G6XA 2IM3A 3CD6S 4QWDA 4RWXA 2AF6A 4DR6F 5J1EB 4NLUA 3GR0A 3DLGA 3FSXA 3MURP 2OO4A 1LXNA 4QR1A 2K1RB 1IJFB 3TAMA 7FDRA 3BZQA 2ALZA 4U7CA 4WXOA 1X0FA 1X9SA 1N32F 1UA0A 1YRTA 3LQVA 5CYMA 3VWSA 3M2VA 3QMQA 1NK0A 5KFCA 3MAQA 2M0GB 3DHWC 2CPYA 3R5DA 3UNGC 4DJBA 2YH0A 4TLRA 4A8XA 4YQWA 4CH1A 1VQMS 1FE4A 5FLXY 3CD7A 3VAMA 2AU0A 2J7WA 3V4IA 2ASDA 4PG6A 1S0OA 4RW9A 1UL3A 1RKIA 3W2VB 3S6EA 5KG6A 2Z2LA 4IH5A 5T7LB 4CO2A 4ELUA 4USJC 1M0SA 3K5NA 4O44A 4ECUA 3KG0A 1HNIA 4DDFA 2HRUA 3VR1A 3M6XA 4NLTA 3BO2A 3H2LA 7FD1A 4X4OA 2YWFA 3M6WA 5CZXA 1ULRA 3DLKA 2M52A 3GQCA 4C4WA 1RP5A 3UE2A 1FKOB 4KJIA 4OJGA 1TL4A 1N54B 3IS9B 2CFXA 3MM7B 2K3IA 3FDSA 2V4JB 4X4NA 4MJKA 5FDLB 4NLOA 3RBDA 3L7PA 4LF7F 1FEHA 2BABA 2I38A 4DV1F 4I68A 3BN7A 1H38A 1BQMA 4FXWA 4PG4A 3SYZA 5KG3A 4OLOA 2G0CA 5GAEU 2BVZA 4DV3F 4F02A 3NL0A 4X66F 2F8MA 1RT4A 3EXCX 1M5VC 1IKWA 5F8HA 1EETB 2CZVC 2KXNB 1OPZA 4YDDB 2SXLA 2JLGA 4DL7A 5B0DA 2AW0A 4LQ3A 2B4OA 1UFLA 4ZKAA 1YI2S 3WZ0A 4C2MA 3EGWB 2WHOA 2AGPA 4LF9F 1SV5A 2MQQA 4Y2KA 2DTJA 2ZD1B 3P5TL 4ETZA 2LXFA 4LMZA 2B56A 3N4WA 4UUXA 2VBYA 2ZH1A 4FVMA 5KG7A 1N6QA 1LV5A 2RJZA 5KFYA 3ZZUA 2DRBA 3OXGA 3QLHB 3JYTB 4DL2A 2DCLA 1KONA 2F7VA 3ENWA 5GAGU 1X5SA 2VBXA 4F25A 4PUOA 2D7SA 3I9V9 3IG1A 2V5HG 4CH7A 1JXEA 2L9WA 5A8WA 4QPTA 1U45A 1FHTA 3PHEA 3O1LA 2CVIA 2L48A 1QSYA 4CNYA 1JJ4A 4I6WA 2HS4A 1XWLA 4G1IA 3KNAA 4ILMA 4B02A 1X7VA 3TAQA 4DFPA 1LK7A 4DSFA 2PGCA 5LXYA 1KD1T 1J5OB 4JI3F 1SH3A 2GGPB 2LQ9A 2M9KA 3PW4A 3RYLA 2FVPA 3HX9A 2CPDA 4LSLB 2L3MA 4I2PA 5D8HB 2JSXA 2FJWA 4X4VA 4RW6A 2HNDB 2YQ3A 4JI4F 4O4GB 3DRPA 1W25A 2C3OA 3UD4P 2HNZB 3E01B 2OTLS 4NPOA 5K14A 4C11A 4Y65A 1U1OA 2DGTA 2YH1A 2W9BB 1NKBA 2WW8A 3SDEB 2KDOA 4NXNF 1D1UA 3DFEA 1N0UA 3RAXA 4NYOA 1VLYA 4DL5A 1Y3JA 3TUZC 3MTJA 4ALZA 5I4MA 1MSWD 1VC6A 2RSQA 1ZM4A 4DFKA 5KFSA 3OTEA 4J9KA 1N8RT 5DJBA 4Q0BB 4IG0B 4D3GA 1I94F 4QW8A 3GG1A 5E3CA 3G6YA 2RF2A 2EWHA 1VRTB 2YKQA 3POTB 2LU1A 4DFJA 1X5OA 3KYLA 1L3UA 2DNYA 1S9EB 3N6NA 4EBCA 4ECTA 2UU9F 4RU2A 5GAHI 3MMBB 5SUHA 4F3MA 1Q8LA 2ZHOA 3S7RA 4UY85 3G9CA 3D1OA 1KQKA 2KO1A 2YKOA 2QFJA 1KVIA 3LP0B 2QSWA 3QAUA 2J7KA 1C0UA 2XWXA 1C4AA 1NNDA 1YBAA 3NBPB 5CYQA 3C66A 3WC0A 4L72B 1Q86T 2KU7A 1XBWA 5HP1A 3R1HA 1YG0A 4WFAQ 4RW4B 3ISZA 3KHHA 2JEJA 1FKPB 2DNQA 2R4FA 3AQPA 1Q7LB 3I0RB 2LEPA 2NLWA 4X4QA 4Q8EA 2CQIA 3MEDB 3BSCA 4C3MA 5J2PA 2LA4A 1HHTP 5E3RA 1HBNA 4QW9A 2FJDB 4FVCA 2NUHA 4ZCKA 4X4PA 4LFBF 2P5VA 3OLAA 3SMZA 2F1FA 3D0HE 3HVTA 1JLAA 3RRHA 1YRUA 2QV6A 3IRXB 2MZTA 1H7XA 4DV0F 1HBOB 1FT8A 1FXDA 1HA1A 1WTFA 3T5KA 4WFNQ 3JSYA 2GFFA 3QYYA 4FN5A 3UW1A 1QJHA 4KFBB 4LFCF 2G13A 4NOHA 1QLNA 2YNHA 1VBZA 4R25A 1HD0A 2R7UA 4K5RA 1NU4A 3BQ1A 5KFXA 3PM9A 2B7CB 2YKNA 4DS5A 1HNVB 1UETA 1HNZF 1TL3B 2DHSA 3KHGA 3DU6A 1N5QA 2KRRA 2XMKA 1VQKS 4KV8B 4F4XA 2PFFB 2RQMA 3MM5A 4NZ6A 1T3NA 2DGWA 4KBIA 4NYZA 1RQ0A 4QJVA 4ZHRB 1D9FA 3HO1A 4QZVB 3RTVA 4GMKA 4LQ9A 1WD6A 4ED2A 5L1JA 1TAUA 1YQHA 5D78A 3OFFA 4I1TA 3I0SA 3PO4A 1XR6A 3T1YF 4IO1A 2FLNA 1JK9B 2NSBA 2IVFB 3NCRA 1JLQA 3GV8B 2IC3B 3NS5A 4B9NA 1VK3A 1L3SA 2JC0A 2FJEB 2UUWA 3SSRA 2AYEA 1VQSA 2PC6A 2CQ2A 1RT1B 2GIQA 3ITHB 3M8QB 3C6TB 4BCAA 2R2SA 4K4TA 4ED3A 3TARA 2A18A 3VF0B 1HW9A 1GXTA 1SH0A 2HVHA 2CPFA 2KZZA 4C0OC 4ILLA 2X3GA 3PEJA 1JWWA 4C8KA 4TKTA 3KHRA 4B9MA 3J80Y 3AA9A 4Y0FA 2MZSA 5A8RB 2K7JA 1K0TA 2BQ3A 1HI1A 5M2UA 3TUIC 4F4WA 4URGA 1BWEA 1B0PA 2DNZA 1HWJA 2KFYA 3V5RA 1IM4A 3TA2A 3UCGA 4JI8F 2ZKTA 1SI9A 3OJUA 3F56A 1R8CA 5J2QA 2DRAA 1IBMF 1S6PB 4EO6A 2D74B 2YNGB 2HHHF 2GX8A 1S0VA 2IM2A 2YTCA 4X65F 4AL6A 1RTIB 3PFOA 1JNRB 5F8JA 2HZCA 1T05B 4RW7A 4ZPBA 1XMQF 1QSLA 4H4OB 1TKXA 1HMVB 2DGUA 3JSMB 4EWTA 1X4GA 4H4KA 2MZ1A 1DFDA 1YGYA 1AROP 2BXJA 5DG9A 2ATLA 5G0RA 3CWJA 3O2IA 2CQHA 5L1IA 1S1WA 2OPRB 4RW8A 5T41A 2XSJB 3KLGA 1ZTWA 1NH8A 1NZAA 3N79A 4MTPA 4NLSA 1C4CA 2DGQA 3TVYA 5LMUF 4G1QB 2UUAF 3ENQA 2ZITA 1JIHA 2EK6A 2R2RA 2W8KA 4OJHA 4OZLA 3T3FA 4B3OA 4OIXA 2E1RA 3DRSA 2AJ1A 4YR0A 1YITS 2I0XA 2DJWA 1KVJA 4TU7A 1NEEA 4PXBA 3MMAA 2HW3A 4E98A 5L8RC 5CD4H 5J2MA 3DM2A 5F3TA 2OPQA 4A8QA 2ASLA 1HPZA 1JXLA 4RX6A 3ONQA 3DLEB 1UVKA 4WE1A 3MR3A 4PG5A 2MYFA 2DHXA 4PPDA 5KFIA 5A8KA 3LWLA 5F3ZA 2R8JA 4ZK7M 5DM6Q 1IKYA 3CIZA 3HVWA 5HLFB 3RRGA 4GKKF 2KFNA 1O0PA 2DK2A 3IR7B 2QMXA 2JFDA 4PRFA 3MECA 5K8PA 2CJQA 2XLKA 2WCXA 3P96A 1LKZA 3QO9B 1VOMA 2RE1A 2LEBA 2FJAB 5BYRA 3CGIA 1SUQB 3MM9A 5JVHQ 1Y5LB 5ADZA 1NJIT 3OFHA 1WF2A 3BF4A 3LW5C 1K1SA 4ID5A 4WKYA 2AV5A 2C22A 1HYSA 1U6ZA 4FPRA 3MEEB 3H4DA 1M5PC 1S9GA 3G8SA 5KG2A 4IDKB 4F3OA 4KT0C 1DQAA 2HIQA 3M8PA 5K8OA 4ZDNA 5H9FJ 1NHVA 3M30A 1UJ5A 1DAXA 3L7OA 1BQNB 5E7OB 1Z1ZA 1VRUA 3VAKA 1C0TA 1X4CA 3OUYB 1JMTA 1R8PA 2DR7A 4F4YA 5HBMA 3GYNA 2HWHA 2KKHA 4F2RA 1UVIA 3OL8A 2UVRA 4DF4A 5BR8F 3N0VA 3MCSA 2OSQA 2JWNA 1FRXA 4R5PB 3MMJA 2JEGA 2A3JA 1N56A 4KO0B 1KC8T 2PSZA 1PC5A 5I3UA 3TI0A 3GIMA 3OV7A 3KLHB 4OZNA 2IRYA 4A8YA 2Y1JA 1TL5A 3O6QA 3CXCR 4USIA 1LWEA 4QOTA 3OTOF 2E29A 2NUUG 1IQZA 1ZBTA 4ZPAA 3CMES 2GHPA 4NXMF 3FVYA 1I6JA 2MQMA 3ZZ0A 2BR0A 2D9OA 1KQFB 1U1NA 3PV8A 5LXRA 5F8GA 3AJ1A 1WEXA 3Q0AA 1N33F 3KLEB 2HVIA 1AXQA 3GIKA 2K3KA 2RRNA 1P27B 2YNIB 2OH2A 4WXWA 3GV5B 2HQIA 5L1KA 5E3PA 1DTTB 1RTDB 4TXSA 5EHHA 2MJNA 1WWHA 3I96A 1S6QA 2OPPA 1DLOB 4OJ1A 1FRKA 3VCDA 2VOOA 2XLIA 2P9GA 4C98A 2WK4A 4BWMA 2F40A 1RTHB 2FHJD 3U1MA 5B0BA 1RT2A 1U8SA 3RAMA 2G9OA 4DN9A 1IKVA 1NK7A 3PNIA 1J5EF 3VAGA 3LH2S 3T6BA 4GKJF 1JKHB 1RDRA 2PI5A 2RKIA 1FESA 1QAXA 5EWEA 3BO4A 3QAEA 2VFUA 3CCSS 2DIUA 3HHLD 2Y1IA 4B9VA 2JFKA 4H54A 3HFKA 2QMWA 1S1XB 2C42A 2XMJA 2YX7A 3W3SA 2HHSA 5B0FA 3KMSA 4OHXA 3BSNA 2VPZB 2OPSA 4N8NA 3S1TA 2RS8A 2DITA 3OBIA 5DQGA 2XI2A 3I32A 2FHOB 2AWZA 1SBRA 3K59A 2G4BA 2CQDA 2BQUA 1T95A 2I9SA 3PY8A 3Q8SB 2ZH6A 1LW2B 1QE1B 4AXJA 4RNNA 1SQEA 3ZZOA 4HH0A 3Q8RB 2B43A 3PW0A 2FVRA 3CDAA 3K5MA 2ZNYA 1GQEA 5C24B 4B9SA 3BGRA 4YR2A 2BW2A 3MOJB 2Z8QA 3T5LA 2C2EA 4A4JA 2W7OA 1D8YA 1RWUA 2OAUA 4YOEA 2RU9A 1XTZA 3H5SA 1C1BA 5KAKA 2M8DB 1HR0F 1HQEB 3B4DA 3V6DB 1U6FA 5DRKA 3SQGA 1KLMA 3KLFA 4KAIA 5DQHA 4FYDA 5I42B 5E3QA 2DGVA 3MDFA 4N47A 1T3OA 3MFIA 1DHMA 1HQUA 2D1CA 3TR5A 1Y5IB 2GJIA 4U6PA 4L3NA 5D4PA 5LJ3Y 2GV1A 4O3PA 2BM1A 5DM7Q 1TV6B 2QLXA 3P3DA 2ADCA 1U1PA 3HF5A 1VIXA 4HTIA 4D3HA 1URNA 3Q2SC 3OR2B 1E6VA 1KHWA 5J2NA 4ZPDA 1LW0A 3DCAA 2RH3A 3EPGA 2XULA 3H20A 3KG4A 1DURA 1RT3B 3KWMA 5E2QA 4C8OA 5GMKa 2R7VA 1TKZB 4J9PA 2E1AA 5IS2A 3M8RA 2KJVA 3MR5A 2JEIA 4DV2F 3PEHA 3DI6B 4EBDA 3FZBA 1Z4UA 4YDXA 2CPXA 4ICLA 4DR4F 4LIRA 3ZZYA 5K8MA 3G71S 5HROA 3IBWA 2IRUA 2J0XA 3SI8A 1H0HB 2Q79A 1HWKA 2CYYA 2EW9A 1VFJA 2LYVA 5GVQA 5HL7Q 4Z2XA 2VBWA 4FF4A 5IT4A 4ZP8A 4UOCA 2LLZA 5BJRA 2VQEF 1S0NA 2XMVA 5D6GA 3PVXA 4M95A 1QY7A 3O8WA 2WONA 4QIFA 5EGYA 2N3OA 1CC8A 5D3GA 4RBUA 4O3OA 2V0NA 4AQYF 4NCGA 2E66A 4DSKA 4IFYA 3VAFA 5KFZA 4DFMA 1UVMA 2R8IA 2VG7A 1QUPA 2OJ3A 2MJUA 2LEAA 3DGPA 2E5IA 1FDBA 2GO9A 2L41A 3HI9A 3OHAA 1Z2ZA 1LWFB 2YWHA 4NLWA 4WTYA 2POKA 3TYTA 3VQSA 4AYBD 1JLEA 3MUMP 5AXKA 4K4YA 3T6JA 2E7WA 4WFXA 2YKMB 2MY7A 3R5AA 2EFOA 2U1AA 3MMCA 3U02A 2QA1A 2VG5A 3G8QA 1S97A 2HHVA 3DOKB 2NYIA 2AJ0A 3GFXA 3FFIA 1UW4A 4IQMA 2FD2A 1DQ9A 3CJKA 1KN6A 1K1QA 3TO8A 2XMWA 3UDCA 4N76A 1X4EA 5F8MA 1CG2A 1P9QC 5DGAA 2NSCA 4MK7A 4Q5VA 3H5XA 1SKSA 2EFNA 2HGMA 3H8YA 5CQGA 3GG0A 3PW7A 4O0IA 5B0GA 3EXYA 4FNHA 2R8KA 5IT9Y 4X4TA 2IA0A 4YB6A 2R2UA 4WKRA 4GO5X 4QR0A 3QIPB 4QIVA 1HD1A 1HBMB 3OXFA 3RAQA 4K59A 4XAKA 1UEUA 2ZKUA 2VUGA 2W4PA 4A48A 3KTQA 3UI3A 4V19X 4IOBA 5AXMA 4FF2A 2FHKA 4YP3A 3PR5B 2FDNA 3PRDA 2ZH9A 2NREA 4EO8A