5L9NA

Structure of uridylylated glnb from escherichia coli bound to atp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
92
Chain Sequence
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of T-loop modification on the PII-signalling protein: structure of uridylylated Escherichia coli GlnB bound to ATP.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II 1
total genus 22
structure length 92
sequence length 109
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l9nA00
4CO4A 3NCRA 4RWXA 4RWWA 4CO3A 3LF0A 1V3SA 2V5HG 3GSDA 2PIIA 2NS1B 3O5TB 1NH7A 2J9DE 3NCQA 3AA9A 3AA8A 1VHFA 5D4OA 5DS7A 4OZJA 2GNKA 1UMJA 2XBPA 1J2VA 1UL3A 4WK3A 1V3RA 5D4NA 5D4PA 4YB7A 3AHPA 3TA0A 3AH6A 2XG8A 2RD5C 2J9EA 3O8WA 2ZFHA 4YB6A 1UKUA 3N5BA 4CO5A 1QY7A 4OZLA 4C3LA 4AFFA 5D4LA 3DFEA 4CO2A 4YB5A 2J9CA 3CE8A 4USJC 3M05A 2JJ4D 1V6HA 4RLEA 5DRKA 4Y6IA 4R25A 4CO0A 2NUHA 3MHYA 1NAQA 4C3MA 3HLUA 3OPKA 2J9DA 2NUUG 1HWUA 4NYPA 4C3KA 4USHA 2EG1A 3L7PA 1OSCA 3TA1A 1Q1KA 4NYOA 4Y65A 4CNYA 4D3GA 4WK1A 1O51A 4ZK7M 1UFLA 4D3HA 1H3DA 2O67A 1O5JA 3X3UA 4OZNA 1GNKA 2XZWA 2EG2A 2DCLA 1XK8A 4USIA 4CNZA 1NH8A 1P1LA 1PILA 1VFJA 4CO1A 4E98A 3NCPA 2VD3A 2CZ4A 1V9OA 4RX6A 2O66A 4IYQA 1KR4A 2GW8A 2GX8A 3BZQA 2E66A 3T9ZA 2XULA 2ZOMA 2Z0GA 5L9NA 1NZAA 3TA2A
chains in the Genus database with same CATH superfamily
1ZM2A 2ZWPA 3K2YA 2HWTA 2PD1A 3TVKA 5B09A 3DKDA 1ZAXA 2IRYA 3RUBL 1VQYA 4UOGA 2HWHA 1VQ5S 4CP5A 1SJ3P 2DCUB 1HMVA 1UJ4A 3GSIA 2W7AA 2HK3A 3B4MA 5HATA 1OSDA 1GAOA 4OI0A 3D6TB 1N33J 1IR1A 2EVZA 4I67A 4USVA 4WXWA 4DV2F 5GAEU 5DGAA 2YX7A 4OLPA 2KVIA 3ISZA 3W64A 5I3UA 4FF1A 2DRAA 4X4VA 2BJ7A 3Q89A 7FD1A 1SUQB 1SH3A 1X4BA 3HCXA 1DAXA 1KLNA 1R27B 4OZJA 3H98A 4W92B 1S12A 1M1HA 2JNJA 5HROB 2PMHA 2CQ1A 2QA4S 3PO4A 1YBTA 3C14B 2H5JB 2LQBA 2PGCA 2YTCA 3NKYA 1T8EA 1FO1A 5DZ7A 5ETSA 3VTIA 1D09B 2VZ9A 1AW0A 2NXEA 3DHXA 3K59A 2DEJA 4O23A 2FLLA 4X62F 4XPCA 4LR7A 1B0VA 2KN4A 1H2VZ 4IUFA 3PKMA 4BS2A 5D4LA 3QIPA 2FY1A 3N28A 2CWXA 5T41A 5AE1A 2MSSA 5D8HB 1BGXT 1HPZA 4C8OA 1TK8A 5GADU 4RU9A 4XO0A 2ADCA 3HK2A 5CABA 3NAHA 1NHKL 3KG0A 3UI3A 2AEMA 3NAIA 4M8LA 2DNQA 4PUOB 3MECA 3DGPB 5T7LA 3R1LA 1V6HA 2WOMA 1U1NA 4ZDNA 5I3QA 2CQ2A 2R8IA 4QYRA 2AJFE 4PXDA 3LANA 1HWIA 2RDJA 4DV2J 3TAPA 4DEZA 4KHPJ 1NAQA 3H5SA 4UY85 2UV8A 1YKWA 2HPUA 1F60B 3SYZA 4ZCIA 3O1LA 1A6LA 3W62A 3BYRA 4P2MA 1VGYA 1JLBB 4ECUA 3AQPA 4P2XA 2IVMA 3M8QB 2EG1A 2H1YA 4NYZA 5JMNA 1MROB 2CPHA 3TZWA 2GIRA 2ASLA 4M1KA 2BX6A 2CPZA 2WAQD 3OJSA 2PC6A 2L9WA 3QYYA 3N6NA 3LWMA 2DGUA 1R31A 4NYOA 5FIIA 2GIFA 4PG8A 2VG5B 2OEJA 4D3GA 1YQHA 4X62J 2RU3A 2YWFA 1IJEB 3UO0A 1BMQB 3G6VA 1VR6A 4D3HA 2BQ3A 2WBRA 3ZTOA 3FBEA 2YNGB 4P10A 3OSPA 3TUPA 3D68A 4WCEQ 1HR0J 3HX9A 2XY5A 4L3NA 3DI6A 2XZWA 5SUHA 2DCLA 3TJ8A 5C7PA 1HPZB 1T9VA 3I9V9 4TN2A 1P1LA 2AJQA 3M2UA 3GFYA 3WC2A 4PKDB 2ZBRA 3EVMA 3KWMA 5DJBA 3T41A 2IMOA 1PAEX 3FK4A 4EBCA 2A1BA 3FEXB 3R5AA 3CCUS 1I6JA 2F4VF 3AAWB 3RTVA 1K1SA 3G6ES 2HBZB 4KRWA 5GADI 4DSKA 3CB4A 2DTJA 2YKPA 2Z2YB 2AYGA 4DV4F 4GKJJ 2E66A 4X2BA 1ZBTA 4HI2A 2CDQA 1LWXA 1SJQA 4Y2AA 1VQ7S 1Q7YT 3TUZC 3K58A 5J2PB 3EDRB 3D3BJ 3NGTA 1X4CA 2XULA 4LIRA 1Q8IA 2KXFA 3AODA 3IS9A 2BV3A 4W90B 1UVNA 1MNEA 5G0RA 2M2BA 3Q8UA 3MAAA 4OLOA 3W5ZA 4DSFA 3CDEA 4XDDA 2YH0A 3OFHA 4NMLA 5GAGU 1U2CA 3VGUA 4XAKA 2UVVA 2OI2A 3C66A 5J2QA 2VOOA 4ER8A 3FEZA 4J9RA 4JV1A 2VQEJ 1KLMB 3BGRA 2R2SA 4DG1A 1U1OA 3GB0A 2KRBA 2SXLA 3KFWX 3SCLE 5AJ3J 4RU2A 2CQDA 4B3MJ 2R3VA 4NZ6A 4ZVHA 2OH2A 5HO4A 1SV5A 4I2PA 5ETVA 5CYMB 4MKVA 1S1VB 2V8GA 1U4BA 2UXBJ 3N0VA 1J2VA 1H38A 3CJ3A 1R8AA 4OI1A 2BQUA 2EKYA 1S4EA 1JK9B 3MDFA 3AH6A 2XO6A 2B6AA 1P27B 3KJQB 3BJYA 1N36J 2J9EA 1RHMB 2RD5C 4DCPB 3SQGB 1YBAA 2P8IA 2R7QA 3BB5A 2KT5A 5E7OB 3JSBA 3I0RA 1RT5A 3EGWB 2MLZA 2WW8A 5KG4A 2GS8A 3VF0B 2AGQA 4F3OA 1FEEA 3OTDA 3ZO7A 5L1IA 3I0RB 1HI1A 3G2XA 4N7TA 4PQAA 4AYBD 4CM0A 4LFCF 3VAJA 3E3XA 3KNGA 3TJAA 4M63A 4F67A 4LRCA 1NZ8A 1TQLA 4WFXA 2DNRA 1HQEA 3DRRB 3THVA 3TEGA 1RAEB 4LF6J 1PJ5A 3PXGa 1Q8BA 3IRXB 1RT4A 1DQ8A 1NUEA 5T7LB 2QA4G 4B3RJ 1I1GA 1RT2B 1CC7A 2G0IA 2BRKA 2CVEA 1TK5A 2JEJA 4J91A 2AU0A 3ZNJ1 4EGLA 2BR0A 1LV5A 2AV5A 1D8ZA 1N4LA 2HQ3A 1FNMA 3PRVA 3MXHP 2OPSB 1L5UA 2XSFA 4L3KA 2R7TA 4LSZB 1CS4B 2YWEA 1FKPB 1NSAA 4AD6A 4TQSA 2XI3A 4AL6A 2RRNA 3MR2A 1V5IB 2HMIB 2R7SA 4CYUA 4RW8B 3ET6A 3OXFA 2ZH4A 5GMEA 1GX6A 4CLPA 5L8RC 2JC0A 4Z7YA 4HTJA 1RTDA 2QL9B 3IBFB 4J9UE 2VA3A 3MD1A 4EFAC 2OD4A 2RHQB 3B78A 5B0DA 2OPQA 4MFBA 1FXLA 1TVRB 3P96A 5C2CA 1R89A 2CPFA 3H0PA 3HULA 1SUQA 4N77A 1RHQB 2Z2ZA 3CJKA 2XB2D 4ED6A 3FVYA 3BSOA 3H2UB 2HURA 1WI8A 1Y00A 1WHWA 1NH8A 1ZS6A 1WOSA 3QGGA 1U1KA 1T0TV 2LP4A 2QMXA 3PYFA 1YJ7A 4X64J 2W01A 1TFYA 3D7SB 4JYAF 1BLUA 2IRUA 4DLEA 3AD9C 2RF2B 4DS4A 1YRUA 1HA1A 2RKIB 4P2SA 2HNDA 2C2EA 1VBXA 2MKYA 2IDEA 2Y9HA 2ATCB 4RJVA 4G65A 4ZLJA 3MZIA 2JWNA 3H7HB 4LR9A 2VFRA 1R8BA 5CAAA 1VBZA 1MW7A 3P3DA 4GMKA 4F25A 1IBLJ 1QUVA 4KAIA 3SSSA 2I5JA 1FNXH 2RDDA 3J80U 3T5JA 1KSPA 2W7OA 5BR8J 2JZ5A 5CD4H 2IM0A 1FKOB 4RUBA 3W9JA 1REVB 1W26A 3WBZA 4R8UB 1FFWB 1S6PB 2YWWA 3JTOA 2LU2A 3PX6A 5L9NA 1NZAA 1JKHB 3G6YA 2GHPA 3RW7A 1PIEA 1RT1A 1R6VA 2E1PA 4ZVGA 3GJQB 3HKWA 3MGJA 4OYWA 1TL7B 3DOKA 1VQPS 3T19A 2HGNA 5ETOA 5IZHA 1TAQA 4ZP6A 3ZZOA 4X4SA 3IGVA 3U27A 5LXRA 2E9ZA 1N32J 1H2TZ 1S6QB 1RT2A 2V34A 2NS1B 2YKMA 3A8IA 4EZ6A 5A2QU 3IP0A 3PIOQ 4JYAJ 5D4OA 2R7WA 2F8EX 2VG5A 5ITHA 5KFVA 4P7TA 4OL8A 1FWPA 4C8LA 1WTFA 2JFDA 4PXBA 2F40A 4DV6F 1EP4B 1FJGJ 3VVUA 3MM8B 2V50A 4W4MA 1QE1B 2EFPA 2KH9A 2ZKUA 2JX2A 2ZVIA 2R7UA 5DQGA 3SEOA 2HFVA 2V6AA 1MN7A 2DYAA 1HL6A 1RCXB 2C3UA 3A8EA 3D1QA 3DOMA 5K14A 3T9NA 3TAMA 5BR8F 4KV8A 4OZ0A 2AIRB 3FBFA 2XHWA 3VWSA 1PYOB 3ETMA 5DZ6A 2LQ9A 2OELA 1JLGA 3MPYA 2DVIA 2RUGA 1XWLA 2VQEF 3FDSA 4DL4A 2V4JA 4F4XA 2XC9A 2XCPA 3LGHA 4JI1J 3MTKA 3LP0B 1LEOA 2MQLA 3GPAA 3W2VA 2MB0B 1CSJA 2CAJA 4PWDA 1AYEA 2BEFA 1O0PA 5D6GA 1GX5A 1X31C 1N5QA 4Y6IA 5A8RB 1B4SA 2YNFA 2CPIA 3W2WA 3TZYA 5ETQA 2O01C 3RRHA 2R8KA 3MOZA 3QJPA 2Z2LA 3AXKA 4AT1B 3GP9A 1G2EA 2ROGA 1GTEA 4LQ9A 1XNRF 1RP5A 4CT8A 5C5JA 5J2QB 1N5YB 4F2RA 2B43A 2W25A 2ACYA 3GIMA 3MUMP 3EYZA 5AE3A 2V63A 4K4TA 4JI3J 1T7PA 5FDLA 1B70B 1FWLA 2AX1A 4YDDB 1X8DA 2FD2A 2QV6A 3PJXA 3ENWA 5CYQA 5D78A 3TZXA 1DJ0A 2CPYA 2MJNA 3NS5A 4DWIA 4NLGA 3T6JA 4ALZA 1IVZA 2AJ0A 3N5FA 1CQMA 4ED7A 4DQQA 3O3LA 2OSRA 1NJWA 4QPTA 5DO2A 3UVJA 2CJYB 1Q86T 2JOQA 1CJUA 4TYAA 3MR5A 2DHHA 3MMCA 4QIWD 2J7WA 4OI3A 3N4WA 3UD4P 2VBWA 3R7BB 3TAQA 3EXCX 5M2UA 1OJ4A 5KOXA 4DPYA 2DR8A 2IM2A 5F8NA 3DLKA 3ICLA 5CA5A 2Q66A 4CNZA 4WIIA 2KHDA 1DTTA 2MMYA 3SCKE 5LJ3Y 2DKOB 4A47A 4UQGA 2POKA 3PYGA 2KM8B 1UEKA 3ADAC 3OTOF 4ILMA 1F5CA 4PXCA 2RJZA 4U67Q 4PWDB 1N0UA 3DCAA 3K89A 4ZVFA 5F3TA 1HW9A 2VFTA 1VQ4S 4PABA 2CQBA 2W24A 5ETKA 3RBXA 4A4JA 5B0BA 3D3CJ 1IKWA 5F0WA 3ILLA 4X4QA 4MK7A 4DR1F 4H4KA 3F44A 3PKYA 3IBWA 1ELOA 2EI5A 3PTWA 1Q5VA 1R43A 4NPOA 3VCDA 1VK8A 4CLKA 2ZOMA 3LH2S 2LU1A 2VDIA 1TL1A 4IG0A 4E2FB 4CDIA 5KFEA 2UUBF 4CH7A 2GGPA 3GMGA 4J90A 4ZJOA 3D0HE 5AT1B 1VRTA 2V9KA 4PZVA 2PSZA 1BHNA 2LEBA 2HS0A 4K0KJ 2HSEB 3HHLA 1YK9A 3VALA 4Q43A 1QJHA 4MIAA 2FDNA 3DLLQ 1ZA2B 3MMCB 2RMLA 2DY9A 5J2MB 2MDAA 3W66A 4O3OA 2ZHOA 3FCHA 1QAJA 2HVHA 2HZVA 4I6YA 2DH9A 2RHSB 1YJ9S 2OPQB 1QLNA 3JQKA 2K1RB 4M5JA 5HMYA 5L39A 4CIOA 1KTVA 3CJQA 3IC1A 3RBZA 1GQEA 2EFQA 4OYMA 1VIOA 3KOAA 2NLWA 4BHQA 2F4VJ 4RW7A 3QBCA 3N6LA 4WK3A 3US5A 3RR7A 1UWBA 4YY3J 2UVUA 4ZCKA 2ZNZA 1WD6A 2MQMA 5C24A 3NGDA 1KLMA 3A3OB 1TKZA 1FTRA 1O8BA 3BGRB 4DR1J 4PRFA 5C24B 1ZTTA 4OYBA 3CCLS 2MGZA 3DI6B 3W3SA 1SQEA 1V5VA 3MMAA 3EVWA 3WX8A 1PJ6A 3HFKA 1RLCL 4BBYA 1IXKA 1N88A 1N5SA 6AT1B 2BRLA 4XK8C 3BSAA 3NLCA 1G7CB 3WZ0A 1ZAVA 2ZD1B 5J1EB 5L1LA 1E6YB 2F4FA 1WG1A 2PMWA 3DM2B 2OPPB 2XWYA 3OFEA 4YR2A 4Q2MA 1WDTA 2LMIA 2XNQA 2E7XA 3SSRA 2R2RA 1KD1T 2DPJA 4B9LA 4K50A 3CCTA 3HHLB 3QWUA 3IG1B 1KC8T 5KG1A 3G8QA 4G1PA 1JB0C 1KTQA 2KYZA 3M2RB 3K5PA 3L7UA 3CCVS 1D9AA 2MLXA 1IBMJ 1FFSB 1S0NA 1LW2A 3L09A 1SBRA 2ASYA 4DOZA 1VCTA 3IRXA 3RGIA 3V5RA 1QD1A 1WHVA 4C3KA 2G4BA 2DGXA 3MFIA 2LXIA 3TUIC 4DV0J 1NNDA 1FX4A 3VAIA 1URNA 4C8NA 4BWMA 4WJBA 2D9OA 3ZZ0A 4K4VA 3D4JA 2CPJA 2ZBQA 3OQ2A 2WRMA 1RTJB 3H20A 2NSCA 5CYQB 3CSKA 8AT1B 4KJIA 2V2QA 2W2OP 1OQ6A 1GMWD 5F41A 3D1HA 4CNYA 3OTOJ 1HQUA 2D9PA 1TUWA 4BLGA 1N56A 1SV5B 4I2PB 5LT5A 2ZZNA 1U2FA 2Z8QA 1C1CB 4QPXA 1RAOA 3M9OB 3EGNA 4OX9J 4C8KA 3X3UA 4WYWA 2BDPA 4X84A 1F9FA 4IO9Q 2E9RX 3KJVB 2AEJA 1AUDA 5HK4A 4U8YA 2DR6A 3FSXA 5KFRA 1UAWA 3CC4S 2QT7A 1K0VA 3EGVA 1LWFA 1YGYA 2JHEA 3ITHA 5KT6A 2ALZA 3PCOB 3C15B 1H6KX 4M5KA 3PZPA 4LF6F 2ZD1A 1OYDA 3FSYA 3HHKA 2F5GA 4O44B 1NB2A 2ABYA 5L38A 2O5DA 2ZC4A 4KGMA 1NRKA 3IBCB 2MTLA 4EYHB 4J9VA 4GC7A 4JI3F 2F9JA 3G4SS 1S10A 1VC6A 3HSJA 4YP3A 1IUJA 2DO4A 4UOCA 4DUZF 2CKWA 3TX8A 2B9XA 1VOMA 1TV6A 3EWGA 3V81B 1UP1A 3CTRA 3ONQA 1YZ7A 2D69A 3FMBA 4IH7A 1KHVA 4QJVA 1GEHA 5LSOA 2QMWA 2FVRA 1U09A 2JLGA 4RBUA 3PG9A 4M5DB 2FHMA 2ZM6J 3UW1A 4ED8A 1NSPA 1RGVA 5DM7Q 1S6OA 4EYIB 1NEEA 1H0HB 1VBKA 2OGUA 2CJAA 2MQOA 3AY0A 2B51A 2RQMA 4IOBA 4Q2LA 2ZH3A 4ZVRB 4MT1A 1VQMS 4P7VA 2HRTA 3NCRA 3R1HA 2FY8A 4OQJA 4ED4A 4I2QA 1HQUB 2OMOA 5HVHA 3TI0A 2HHHF 4NLOA 2DH8A 2W2MP 3HO1A 1IQTA 1R3NA 1T9TA 1HIYA 1UPMB 5IXUA 4MJKA 3PVXA 5E0OA 4OV6A 3ZZPA 2BANB 3KLIB 1JLEA 5IM0A 2VC1A 4YHHF 2J9DE 5H9EJ 1BQXA 1WEXA 2MLYA 2YNIB 1JJ2R 4ZVQB 5DS7A 4DCJB 3OTCA 2HHTA 3D6MB 3D1OA 4TU8A 2GNKA 4FKXA 4FPIA 3CD5A 5DLFA 2AX0A 2PA3A 4USMA 3RU0A 2JVOA 3RBEA 4J9NA 3POTB 3J7Z5 3T1AA 2B9WA 3BGFA 2F8HA 2YKOA 2GAGC 2F9DA 4ECSA 2NREA 2ADBA 2VBXA 3I82A 5KOWA 3MAHA 2F8MA 4YR3A 2FIUA 5F8MA 3SV3A 4WKRA 2G2OA 5J1NA 3NGSA 2IA0A 3CMAS 5K8NA 3G8SA 5HQ8A 2VQFF 3M2VB 3QLHA 3PEJA 3KXDA 1FDBA 4NRUA 2UUWA 5HSPA 4CH0S 1VBYA 5AJ3F 1RWMB 4OFZA 1U0HA 1VQ9S 5F8GA 2BYCA 3R6GB 1FK9A 4OJ1A 1N8RT 4QYZK 3LPYA 5KT3A 2JLFA 1R6YA 3PM9A 3UD3P 1N5YA 1TL1B 2KO1A 2FLOA 4CO0A 4RZRA 4IKAA 2ZH6A 3M2UB 5ETTA 2AQ4A 1UVIA 2V2ZA 1YITS 5HL7Q 1GXUA 1RA7A 1RXOB 1NPRA 1ZZNA 1M5KC 4RUAA 5AXLA 1DLOB 3H2VE 3MEKA 3OPKA 1XC9A 1RLDA 1FKOA 3DOLA 1UEVA 2LLZA 3GLJA 1AB8A 3O6QA 5EX0A 4R8UA 3KLIA 1QSSA 4DUTA 4Y2KA 3DRYA 2C2RA 3MCSA 4USHA 2GVZB 5KFBA 1HD0A 2KG1A 4DSIA 3LP0A 3T1HJ 1JLBA 1NPKA 1LNQA 4NXMJ 1I94F 2DNOA 4MYUA 2L48A 3CWJA 4OJ3A 4JV0A 1EETB 4X66F 4WYLA 2HIQA 3G82B 3CT9A 3JTPA 3R8YA 1GMWA 4ZHRB 1BWEA 2V68A 3GR0A 5CCLA 4QU7A 1RDRA 1FEHA 3GYGA 2HNZB 4KH1B 4OZNA 4I68A 4WTYA 4CTAB 3DC2A 3QAUA 2DT9A 4I6WA 3I5BA 3NY0A 4DR3J 2KVQE 3FFIA 1WEZA 4CWBA 5GMKa 4NLYA 2IMWP 4Q8EA 1P8GA 1S9EA 1S7IA 2R7OA 3BPDA 3ZTPA 1WC6A 3M8SA 3MEGB 2E1AA 5ETMA 2W9CB 2VKRA 3TEHB 1WDDA 2CJBA 4TY8B 1RISA 4YMEA 5H9EK 4AQYJ 5HLFB 3LGNA 2E5LJ 2LEPA 1T95A 2VIHA 3K8VA 5J1EA 3MWBA 4CRJA 4CCHA 2C1EB 2OO4A 4F7VA 1XN9A 2F63A 4WFZA 3UE2A 2R7VA 4GRSA 1FRJA 1S1XB 2DJWA 3MR7A 3NGKA 4B9TA 4ELUA 4J9MA 1HNWF 4AUKA 1DTTB 5D3GB 1Y10A 2CG8A 1GMUA 1O6XA 1RAAB 1RADB 2EFGA 3IXQA 4FZVA 1HHSA 1WKLA 2I9SA 2VH7A 2WVBA 4RUCA 1S6PA 2AYBA 2C42A 3EICA 2P9CA 2V4RA 2HHUA 4QIGA 2X51A 6FD1A 3HSZA 4DR4J 1TZ0A 1VI7A 2B9YA 3W2VB 2AZ3A 1EQ0A 5C2GA 3QRQA 4RKUC 4M5HA 5G0RB 4BC9A 2ZWOA 2BW2A 1RT4B 5L46A 3CUNA 5DG7A 1PO6A 2K1RA 1Z2ZA 4C0OC 4N5SA 1WI6A 2HQCA 2H4YB 3KDNA 1TL3A 3LF0A 5L9XA 3RRKA 4ZLLA 3I0SA 2HHPA 2WK4A 5ADZA 2C28A 4J9SA 5JVGQ 4DQRA 5GAGI 3MM6A 1NH7A 4OJGA 2E5HA 2VJVA 1LWCA 3QGPA 2QIFA 4WZQA 1LK7A 2UP1A 4G1QB 2KZMA 1RBAA 4R0JA 4TNOA 3W5YA 1SVDA 2ZZTA 4H4MB 2DITA 3HD2A 4HH1A 1T05A 1PKUA 2QA1A 5BYSA 1YJTA 5IT9Y 2Y0SD 2Q6BA 2QA2A 1HNWJ 4JI4J 2CVIA 1WELA 2XY7A 2XMTA 1PJ7A 3BYPA 4NWBA 1GFWB 1HBNA 2IBOA 1M5SA 1R0BG 1U49A 5F3ZA 2V69A 1M5PC 2IJFA 2MSTA 4KTQA 3QFWA 1WC5A 4F0MA 5JUMA 3EZOA 2XGPA 3AB4B 3UQSA 2D1CA 2YQ3A 3S1TA 2MGZB 5LMNJ 3VAHA 4A8YA 1SXLA 3BR8A 4DL7A 3DDIA 4WFBQ 2NZCA 4RNNA 1TKZB 3M05A 4CLWA 3IN5A 3PW4A 2XS5A 2AWZA 4OZ2A 1A0OB 3GCWP 4DS5A 1XIQA 4OZ3A 2W7PA 1RK8A 1VYAA 4KGVB 4F0HA 1Z2LA 4ERDA 1OQ3A 2VODA 2RS8A 3FNNA 3UD5A 1Y11A 2GCFA 2VBZA 4LREA 2IC3A 2OD6A 3E8OA 3MMBA 3HLUA 5K8PA 1MMDA 4K5SA 4IG0B 1ICEB 1UTAA 4QZVB 4YR0A 2B4OA 1Q81T 2BE9B 1P6TA 3KNAA 3PDNA 3WQPA 3K5OA 4Y0FA 1G1XA 5F8JA 5KFSA 3DU5A 1GH8A 3GJRB 4LF4J 1S1WB 3PIPQ 1NK6A 3C6UA 3W7BA 4J9KA 4WU3A 3TA1A 2NXJA 2B4PA 2ZOFA 4MIWA 3K17A 3MM5A 2A2CA 3R6LB 4FPRA 4OX6A 3ULHA 1U6FA 3IMQJ 4DL5A 2HHQA 2IVFB 3M2RA 4AQYF 4QWEA 2XLJA 3QPIA 1RCOB 1TKTA 2GQ2A 2QZ8A 1UFLA 2X3DA 3S7RA 4DCOB 4DV4J 4GKJF 1BQMB 1OY9A 4ZVTB 1PC4A 1I94J 4LMZA 2KKHA 2DHAA 3KUHA 5K9FA 3N9UC 1T3NA 1GXTA 4DR6F 2JL9A 3P4UB 2LVWA 1HNZJ 2FVQA 2OSQA 2AJ4A 3CIMA 2LKZA 2EC2A 3CNQP 3OXLA 4TLQA 4U9RA 3ENAA 1BD6A 1GTHA 3H5YA 3V81A 3C2PA 3L7OA 3ZZUA 1J27A 1QTMA 4FF2A 3TANA 3GZ7A 2YX4A 3HZEA 3GJTB 1SCJB 4KFBA 3ZZYA 3JSMB 3T1HF 2F1FA 2HMIA 2OJ3A 3F56A 3QIPB 4HHJA 4ZPWR 3KJVA 4FYDA 1IKXB 2B4VA 3KKFA 3LP1A 5IQQA 4Y34A 4ZMMA 1HWJA 1OPIA 3PFEA 3FEYB 4I56A 3CD7A 3QO9A 4K2XA 2DNYA 1F9EB 4X4NA 2Q1LA 3PJ9A 1NDKA 3KLGB 4RNOA 2VOPA 1YG0A 2COLA 2GVDB 2XZTB 4LT6A 1TKDA 4U6PA 4DV7F 2MZTA 2FC9A 2XMKA 2BE2A 2VFSA 3MF5A 3Q2SC 4HL9A 4LRBA 4ECTA 3JB9k 3ELHA 3OFFA 4UW2A 2WCXA 5A8RA 3RW6A 5H9FK 1A7GE 4QU6A 1RAFB 5E3QA 4DPWA 4L73A 5IWAF 2ZNYA 2K8GA 2KXNB 3LOUA 3H90A 2W8KA 4DPXA 2R8HA 5LMUJ 1N34F 1HQ2A 4HEA9 4OYXA 1U1LA 3D6FB 2ZBCA 2YKNB 2HVEA 3PV8A 2HFUA 2FHJA 3NCQA 2XNRA 1AROP 5A8KA 1M90T 2NPIA 3ZZZA 5IT0A 5KT7A 1Q5YA 4WP3A 2C2KB 3M8RA 4UUXA 4DZ6A 3KTQA 2IJRA 4S0MA 5AXMA 2N3OA 1S97A 1RAIB 2UZAA 3W5XA 2X1AA 1IKVA 2ZJQQ 5B0GA 2V8DA 3PO5A 4OV1A 3CDUA 1TTHB 2GHWA 5D0RA 4EMDA 2QSFA 1U45A 2J6SA 2UXDJ 2FGCA 3MM8A 3W1YC 4CLFA 4X4PA 1Q4RA 3MMAB 4QR1A 2H48B 4YFUA 3Q8SB 5DETA 2W2NP 3CCZA 3P45B 4NEYA 3KLEB 1J5OA 3X1LB 1CJVA 3EJMA 2MYFA 2JSXA 3TRGA 2R9LA 4K4YA 2DY1A 2LDIA 4KV8B 3BQ0A 3DFEA 2KFZA 1NK8A 3IR7B 3D5MA 3EDQB 4NRTA 1RKJA 4I64A 2Z30B 1KHWA 4ES3A 2YX1A 3C16A 8RUCA 4DQPA 2QFJA 2E7VA 2QGFB 3VR1A 1KONA 4K4WA 4C2MA 1RT5B 1RHUB 3DXBA 5E2QA 4AL7A 1K47A 3FSIA 3KHHA 3SQGA 1RTIB 3GIIA 3GILA 2HVIA 3G87A 2QLXA 4KR0B 4A8KA 4KGKA 1U47A 1BUXA 1X60A 4OX8A 3L3CA 2OPRB 4Q44A 1S0OA 4C3MA 1ZYQA 4O3PA 2UVRA 1D1UA 3F73A 1ITPA 3E01B 5IC4B 2GQQA 4Z7CA 2J8AA 2C3MA 4DV5J 2DHXA 3CJ8A 3PR4A 2X1BA 4K4UA 3LP2A 2HRUA 3HHDA 4UTGA 4K5RA 4Y2MA 3VAKA 1JJ4A 4RW4B 5J1PA 1GMVA 2Y1LB 3BR9A 4I2QB 4WZMA 4AXIA 2PEBA 3HI9A 1W2IA 4DG1B 1NU4A 2J76E 2FQQB 2OP5A 2CQGA 3DU6A 3JTNA 4KKOA 3OUYB 3VGSA 1S79A 1M1GA 3IO1A 2R2UA 3M8QA 3MM5B 4ZVOB 3J7AN 4ELTA 4RNMA 2RH3A 1FRKA 1WOOA 4NCGB 1TKXB 1Y0HA 2XMJA 3HJVA 4M5IA 2VICA 1VQOS 2YBVA 3B82A 3S01A 1GNKA 4ZCMA 4B9UA 1ZOTA 4C9DA 1WACA 4USKA 3OL7A 2BUNA 2J0SD 2XMVA 5C42A 1YJVA 5J2NA 5D15A 3L9ZA 2RE1A 2YWGA 4IDKA 3UFCX 1SH0A 3E2EA 2HWIA 5A8KB 3VAGA 2IIHA 4HHHA 2HLTA 2WVDA 3IWLA 3B8HA 4WFNQ 4DV0F 1HI0P 4B9MA 1IKYB 5LM7E 2N4CA 5FDLB 2DB1A 4LJMA 5HI7A 3RRGA 4PG5A 1EHWA 3ZFVA 3EPGA 3HFZB 3VVTA 4F8RA 4B3TF 2CNOB 1IM6A 2BJ3A 4EWTA 1KKHA 1FJGF 1G6BA 1Q7LB 2C3PA 3UVJB 2NQPA 1N33F 1HQEB 2HYIB 1R7IA 4U7UD 2W2QP 1UVMA 5EX3A 2CZ9A 4QYZJ 4I1TA 3CCES 2AJ2A 3CCWA 1ROFA 4WP9A 5K8OA 3TQ1A 1XBWA 4ED5A 3O44A 4PUOA 3TQEA 1TFWA 2R2TA 2VPYB 3KHLA 1F0XA 1KOHA 2BZ2A 1IBCB 1NDCA 3QO9B 4PPZA 4PR6A 1N6QA 1XNQF 5HROA 2KRRA 3DRPA 4ECQA 1FTCA 1YSJA 3R5BA 2MKKA 4NLXA 1V3SA 1DTQB 3GV8B 3NNCA 3ZNUA 2AYMA 1ULRA 3R27A 4MH8A 2IAJA 3S6EA 1FRIA 1DTQA 4MKBA 4H4MA 3W2WB 5KFDA 1S9GA 2C2DA 4CZCA 1QM9A 4ECYA 1YLXA 4M5NA 1AFJA 1WNEA 4JP8A 4FYWB 4K2JA 1Y9OA 3C6TA 4KB7A 1F9HA 4JI2F 1UMJA 4ZN1A 1IJFB 1V3ZA 1B64A 4O0NA 5D4PA 3PX4A 2QYGA 4LIWA 2J6TA 3BM7A 3BDEA 4JV5J 4F0KA 3AHPA 4NXNF 1FVQA 4DN9A 4ELVA 5THWA 2FVPA 1U26A 1W7WA 2HQFA 4FYXB 4ICLB 4PWWA 5CYJA 3GYXB 4NL5A 4C3LA 3OW2R 4URQU 2XYPB 1MLAA 1IN0A 3K5MA 2DXDA 4IRKA 5I42B 2ZC3A 1EAYC 5HN0A 3BGLA 4KO0A 1XNQJ 3TR5A 3CGIA 4U8VA 1WHYA 1VS3A 3HF5A 3BO2A 1YBUA 1UA0A 1T11A 3SDEA 2MXYA 2OPPA 4ZLNA 2V67A 3VAMA 2G2ZA 1XR5A 1N6QB 5HBMB 2YQ0A 2I2YA 1B7YB 1TMMA 4JI7J 5AXNA 2DNKA 4ED0A 2AF6A 4RL1A 4HH0A 2IY5B 4NEZA 1BQNB 1E6VB 3MD3A 1AUSL 1VLYA 3SFGA 3I56S 2VG6B 3EGZA 3CDWA 1AXQA 4Q0BB 2UU9J 3KDOA 1JLFB 2VG6A 1YWXA 3ZXWA 2JH3A 3KLFA 2KFYA 1N54B 1EB0A 1RZMA 4DFPA 1NKEA 4FNIA 1S5ZA 3I4PA 1QAIA 4Q8FA 4I7FB 2C2MB 3CW2C 3I5CA 5ETLA 2J8SA 1YRTA 3UDEA 2GC8A 4DR7J 1APSA 2HNZA 2KJWA 3T1YF 5G4DA 3D28A 3BGUA 5CD4A 8ATCB 1H3DA 3MR6A 2DHSA 2V8VA 2XEXA 2D3UA 4LBHA 2QLWA 4BCAA 3SBMA 3WHIA 1RTHB 1C0TA 3A8JA 4ID5B 1CEZA 1R0CB 1DY3A 5J2MA 1KP6A 3I6PA 1VQSA 4ITSA 4O4GB 5LJ5Y 4HTIA 4NCGA 1RT3B 1WC4A 3B6BA 3BV8A 1Y5IB 4OHXA 5KFIA 4BC7A 3MUTP 1B7FA 4M5LA 2JEIA 2FJBB 2W4DA 2WZ1A 1EIYB 1ZTWA 4PQUA 3BKFA 4ZVPB 4JI7F 1KVJA 3A3PB 1UJ5A 2JRSA 2CZ4A 2Z57B 4OYPA 5D0EA 4J9PA 1M5VC 1UVJA 1KQGB 5DGBA 1UJ6A 3NEKA 3VZIA 3CJRA 3J7YU 1FX2A 2HQGA 1D3WA 1H98A 2MHEA 4NI2A 3HKZD 2ZBIA 1WHXA 3FGVA 1U7LA 4OYAA 4CM2A 1TVRA 3CDAA 4W98A 3FBBA 4RW7B 1SKUB 3BZQA 3KJFB 4R5PB 4MYTA 1N5VA 1NXIA 3UPFA 4ZVSB 1HBOB 3MCNA 3HHEA 4EEYA 2HZAA 1EKRA 2XSJB 4TY9A 3QZ8A 2XHCA 4HDHA 5HJXA 3R7NB 1RBOB 2FGOA 2HFOA 3CCRS 4YY3F 2B3TB 2MKCA 2JVRA 2HNDB 2OPRA 2CQIA 3CJ2A 4ZA1A 1M5HA 3A1YG 3OHBA 1AFIA 5K8MA 4LFCJ 3AD7C 1KN6A 3LAKA 4RW9A 2B4UA 1X0FA 3QJJA 1FJCA 2JDJA 1WORA 2W4CA 1IR2A 2DNPA 3FBCA 1S7HA 2V5HG 2GGPB 5E5NA 4F04B 3WIVA 2ZJRQ 2ZE2B 3DLEB 2W9BB 1ZA1B 1WF2A 3MMJA 2JFKA 3PYEA 4FYYB 4IFVB 2HQDA 3EMTA 4OMFG 4UF4A 4ETZA 2XGQA 4EBEA 2DEIA 2AYEA 2BE2B 4O0IA 3FJ2A 1LXJA 1EARA 2QN6B 1P1TA 1SQFA 2Z56B 2DO0A 3DDKA 5U47A 4JI6F 2XBPA 2FHKA 2CQ4A 5D4NA 2RQCA 5KFZA 1DHMA 1NK9A 1HNZF 1YJWS 4DSLA 3I96A 1RTDB 3D0IE 4YB7A 3LO3A 4TU7A 2E29A 2KI2A 2V2VA 2V2KA 2DNGA 3OV7A 4R0EA 5KFXA 2VF3A 2X7IA 3AJ2A 3MURP 1FD2A 1H72C 2MQNA 4YB6A 3T5HA 2BQRA 4EO8A 1VQ6S 5HMZA 3KLHB 4OI2A 3FRZA 3T6BA 2M70A 2GFFA 4OZLA 4AL5A 5KFUA 2RT3A 1NHVA 2ROEA 4I4BA 3LWLA 1VLOA 4ED3A 1RQ0A 1MWYA 1S1UA 3GQCA 2BOAA 2CFXA 2PE8A 3V6HA 2YH1A 2BJDA 4U96A 3BSCA 1UWAA 3PRBA 5IOLA 3IWNC 4USJC 3R5GA 4KY3A 4OX9F 1SL2A 1U0SA 1X5OA 1VK3A 2I6WA 2OTLS 4NXNJ 2WBMA 3LUYA 3IGNA 4J9OA 1F3VA 4DF8A 2UUAF 5CYMA 3CC7S 1C0UB 2HBQB 2B5JB 1CJUB 1YZ6A 2LXUA 4QIEA 5DRKA 3R5DA 4ZCLA 4CI0B 4TY8A 4ZJQA 1C1BB 1NPPA 2HNYA 4ID8A 5GVQA 1YTYA 5FD1A 2P6SA 4JUZA 5A76A 5I3UB 1N48A 1KQKA 1MG7A 2ZITA 5KAKA 4Y2IA 3TAMB 2GJ2A 1RTIA 2G9OA 4C11B 4P72A 2HK2A 5DLGA 2AEFA 2HIYA 2ZBPA 4URGA 4KE5A 1X9SA 5HMWA 1BWVA 4DX8H 4LFBJ 3DMJA 1X4GA 1TUGB 1F6TA 1S9GB 3M6VA 3NMAA 2QO3A 3H8YA 3BDPA 1U1RA 3E01A 4DPUA 3TNVA 3Q83A 3DNCA 5JVHQ 2B8PA 3PR5B 2DNMA 1SJ4P 4X64F 3D67A 3M8ZA 4NX9A 3N79A 3JYTB 2C3YA 3M8YA 2FHJD 2IYIA 2YKQA 3Q8VA 1RAJA 4P75A 1SJ1A 4B3OA 3V4MA 4WE1B 2OLWA 2VPWB 4B3OB 4RNFA 2DHGA 4RO0A 2KG0A 3SCJE 2UUAJ 1UVLA 3QQCD 4DI6A 2I38A 1IBLF 3GR1A 1RU2A 4Y00A 4UUWA 2YNHA 1RJJA 4DZDA 3IAS9 1EZZB 3AFGA 3UR0A 1CS4A 5AXKA 4QW9A 2QJ3A 3KLEA 1KVKA 2BXJA 3UCGA 4P73A 5GAHU 2BMBA 1JLEB 5B08A 5IM0B 3OL6A 3K5LA 1L3VA 3NBPB 3DYAB 2GJFA 2DK2A 3HSGA 4JV2A 1U2RA 1DFDA 2HGMA 2O3DA 4MK8A 1RAHB 2ZDPA 4J37A 4C0BA 4LSNB 1KDNA 4CLTA 2M4MA 3NOCA 4DR7F 1HWKA 2P9EA 5A6WA 5E3CA 5KFQA 4J9LA 1PBUA 2F3JA 3QMQA 3MPUB 2IPOB 4PPDA 3WIUA 4Z37A 1LW0B 3R5CA 1X7VA 3UDCA 5GAEI 2MKSA 2QSWA 4C8MA 3I4HX 4IR9A 4TLRA 2Q79A 5M2PA 3MM9A 4IOAQ 2QG9B 3A4TA 1P9YA 5LXYA 2QMUB 4WTOB 3MOJB 1C4CA 3ZTSA 3BREA 5E3PA 1VRQC 2WONB 1QDUB 3KLFB 1T94A 2ILZA 5BYRA 3HVTA 1HR0F 2GMLA 3FRYA 5IC6B 4PG4A 4JI0F 5DG9A 2XLKA 2E5IA 3DRSB 3HVWA 3ILJA 2R7RA 4DF4A 3OSNA 3CJ5A 4UY8T 4K59A 1JX4A 1DARA 2CDRB 1RHJB 1XTZA 2LCWA 1VHFA 3TZZA 3W8GA 5IQ6A 1J5EF 2V9WA 3BN7A 1LWCB 5KFWA 3AD8C 4ED1A 3IR5B 1U1QA 1F2GA 1S49A 1EKSA 3KLVA 3DOLB 4A46A 2JC1A 1YJRA 2DGQA 3MPDA 4HT5A 4NOHA 2XYGB 4UZCA 3AOCA 2YXLA 3DDNA 1Q78A 4XPEA 5EGYA 2AW0A 1TK0A 1I5OB 3THPA 3T5LA 3V4IB 4LF7J 5IWAJ 2ZH1A 3KJNB 2NCKL 4DV7J 4DXLA 2XY6A 4QIFA 4ECWA 5K5MA 4AFFA 1MU2B 2FJDB 4J9QA 1J5OB 2ZH9A 1RI7A 2VG7A 1MU2A 3HZGA 1RWUA 5IS2A 3CE8A 2Q3PA 4WBFA 4DL3A 1LW0A 1DQ9A 2LFVA 4IDKB 3OLAA 4FKYA 4FVCA 1HBUA 1UW4A 2CJXB 3QGIA 2JJ4D 2DH7A 5HQLA 1LXNA 1H73A 1ZM4A 4K4ZA 2P9GA 4KYZA 1HI8A 5HAOA 2FLPA 1IR0A 3BH6B 1LOUA 4A8SA 5HP1B 2HGLA 2VL1A 3U7JA 3SCIE 1UZDA 4QQBA 1RACB 3W9IA 4G3IA 1K44A 4OI6A 3J7ZT 2DNZA 1Q0NA 5A0YA 3HP6A 2Q43A 1IBKJ 4DUZJ 1IM4A 3OXGA 2J0QD 4WPAA 5M2RA 1U6ZA 3OL8A 2WSEC 4TXSA 3TOQA 3DOMB 3DLKB 4TKTA 3DRPB 2HQIA 2GA7A 2ZE2A 1K0TA 2E5LF 2CADA 1WJ9A 2K3IA 1BXNA 4HACB 3QFHA 3VV2B 2FYXA 5IFMA 2HW3A 3HT0A 2RRAA 3C14A 3TX0A 1SC3B 4F26A 4FF3A 3EM1A 2W2PP 4NLDA 1S77D 2DISA 1RWNB 2HBRB 1X0PA 1NCLA 1PSDA 7FDRA 1GK8A 1Q82T 1RHRB 3KG4A 4DR2F 2AHOB 2Z2MA 1RBLA 4ZVEA 1LW2B 3M6XA 3OL9A 1ZPWX 2IM1A 3LALA 2R4FA 3Q8QB 1SJFA 4KHPF 3LW5C 4LUBA 1LFWA 2ZDOA 1QTNB 4NZ0A 1WOPA 1URRA 1PILA 3TVZA 4K4XA 3HT3A 2RQKA 2YPZA 4P6QA 4AE5A 1DQAA 4YHHJ 5KFYA 5F9LA 3TJ9A 2XQCA 4A8QA 1VJWA 4I69A 2Q6CA 3CULA 4O4GA 4N47A 2VJUA 4MK9A 1ZZFA 2PDAA 4ZLPA 4PCQA 3CDBA 1OPZA 4B9SA 1C2PA 4IYQA 4IH5A 4RBVA 3J80Y 2ZJPQ 2XSJA 4A8WA 5KFJA 1RWVB 4PQUB 2BVZA 4FN5A 5BJRA 4OI4A 2F65A 2VFUA 4PYDA 4DMZA 1S1VA 2GMHA 3DHWC 3OTEA 1LQ9A 4O44A 1L3UA 2QYCA 3BKUA 1NK4A 2M52A 1S9FA 1XMQF 2PI4A 4N76A 1Q95G 3KHRA 4RW6A 4JV5F 4ILRA 2J5AA 2FHOB 5H1SV 1SIZA 2WVEA 3TUJC 1YIJS 1F3FA 1FNOA 4P52A 1HYSA 4RWXA 5CQGA 4CLLA 1NDPA 3JSRA 3R7SB 3KUGA 2IDLA 4CO3A 2ALYB 4U7UK 2V8HA 3KK1A 1WTBA 1WKJA 3HMJG 5KFFA 1OY6A 2P2CB 3MM9B 3P5BP 3WDOA 1X4AA 4ZITA 4ZPDA 1XEZA 4JI8F 3LGMA 2VV5A 3NGRA 3AA9A 4Q0BA 3AA8A 1S0MA 1S48A 2AT1B 1S57A 2FTRA 1TELA 5KFMA 3H4DA 4CLYA 2GQCA 3QT8A 4KHRA 4Y28C 3SZ2A 1F2HA 2BKPA 2W9BA 2DBBA 2OPSA 4KC5A 3THTA 1VRTB 3U02A 3T5KA 2RQ4A 4TYBA 3EZ5A 2ZH2A 4EZ9A 3OFGA 3J81Y 2UUCJ 1HARA 3BSNA 3HXMA 2V94A 2OHDA 3TYTA 1ZAWA 1RT1B 2HFSA 4A48A 4CYUB 4JI5F 2GAHC 3EXYA 1FKPA 5HLFA 4CLZA 1S1TA 2HFNA 2OEMA 1KVIA 2XS7A 2YWHA 1VRUB 2WB4A 2WVCA 3H25A 1NK7A 1NKCA 2EBGA 4X4RA 1CVJA 2BOPA 1HHTP 1IBKF 4JI0J 3B54A 4ZPVR 2Y8WA 2H5EA 1TKXA 2AMCB 2E1CA 4DPTA 2JEGA 1CJKB 3NS7B 2MPUA 1X4FA 4MMOA 2R7XA 3CCMS 4A8MP 2K3KA 1RWWB 4QR0A 2HKEA 1P9QC 2MQ8A 3MTJA 4DDFA 2DXFA 3J7YI 1SKWA 3MM7B 5H9FJ 1DBDA 2IYGA 1SKSA 2VPZB 3BBBA 1AZSA 3G86A 3FCWA 3OR1A 4OZ1A 2G1DA 1NB7A 3MCOA 3VAFA 3M32A 3EZUA 1B0PA 1RABB 3G71S 1JMTA 4USUA 4FVMA 3RBDA 3RB0A 2DR7A 1NMEB 3FQKA 3QT6A 3RB6A 3U1LA 3LP2B 3U1NA 4DSEA 1LWFB 4K7QA 4PYAA 4TVAB 2D41A 4ZIVA 2Y1JA 2KYXA 1UA1A 3LP1B 1JJCB 4DN0A 2W9AA 1Q1KA 1JLQB 3CEDA 4ANDA 2DGOA 4F50A 2YKAA 4NLPA 1QSYA 2HNYB 4KBIA 2KM8C 4EU0A 5LSLA 1LFPA 2XZDB 2DR9A 4DQIA 4O3SA 2O67A 3MEEB 3VGVA 2CNNB 1L3SA 2R42A 2GVZA 3ISND 2D7SA 3CXCR 3GV7B 2A3JA 1ZPVA 3E51A 3V6JA 1EX8A 1VRUA 3C6UB 4USIA 4BWJA 1ZM3A 3CJSA 3N6MA 5KFCA 3SXLA 5KT5A 1TMJA 4ANEA 3OBIA 1UVKA 5KFTA 2BBEA 4WFAQ 2ASDA 2HHHJ 1VFJA 2CNKB 5J2PA 4L74A 4X65J 2YNFB 2RU9A 2MKJA 3D6HB 4DR5F 3OR2A 3KLHA 1B0TA 3Q23A 1ZH5A 4OZ5A 4UOHA 4PEOA 3SMZA 2DGSA 2RVJA 2YKMB 2B0GA 5BXIA 4DU7A 3VQTA 2LA6A 2NXNA 3V2UC 2FJEB 1OO0B 4ANCA 1N34J 1AT1B 5A6PA 4R5PA 4F36A 3SV4A 2YPYA 3GFXA 1VQNS 5I3PA 2FJAB 1Y5NB 3DLJA 1LWEB 3R5JB 4OIXA 4Z2XA 1U8SA 4KKOB 1RTHA 4OYIA 5EHHA 3OUYA 3GIJA 4LF8F 3SI8A 4HYKA 2PFFB 1X5PA 3M6UA 3PRDA 1I51B 2ZKTA 1JLAB 1HLWA 1HNIB 3SSQA 2AKWB 2CUYA 4ETXA 3ILIA 3RJMB 5KFHA 2AGOA 1D8YA 3IM9A 4HDGA 4OYZA 2Z0GA 3GG0A 1PCAA 1FK9B 3NP5A 3Q22A 5I42A 1X9WA 5D0GA 2EFVA 1YVFA 3R3TA 3BO3A 1FJ7A 5AE2A 4RW9B 2GMJA 4DV3J 3NRBA 1HNVA 5DQHA 3HVRA 2DR5A 3S8SA 2VU5A 4P74A 5CXTA 4F4WA 4A8FA 3NMRA 2LQ5A 2VDHA 2BM1A 4DHVA 3QIDA 4QW8A 1JQGA 1SL0A 3DM2A 3CC2S 1D9FA 4FF4A 4CH1A 1XMOF 2NZ4A 3JQMA 4C97A 2GZOA 5KG0A 1NJXA 2B8QA 4XTTA 3GG1A 2WTFA 2EFOA 2IRXA 4NCAA 1N5TA 2ZHBA 1FRLA 3P49B 4FYVB 7AT1B 1K8AT 5B0FA 2H4WB 3IWXA 3H5UA 3LPEA 2E5GA 1V3RA 1TAUA 1XR7A 3OR2B 2RUSA 2C2ZB 1DRZA 2HHVA 1JLFA 4DX6A 3LQVA 4LQ3A 2RF2A 4K8RA 3UNGC 1D9DA 3ETOA 2QLJB 4YEAA 5ETPA 1UKUA 1Y4ZB 2KHCA 3BN4A 4U95A 2YKNA 2CJKA 5F9NA 1JXVA 3MECB 3NS6A 1WC0A 2CJ9A 2I0XA 3BH7B 2KB2A 2RDIA 3QT7A 2XCAA 1GXLA 5KG3A 1OY8A 2HEKA 1MWZA 2DRDA 3MM6B 1WUUA 1QUPA 1T9YA 5B7WA 5GAHI 5C25B 4K0KF 3UN3A 4WWSA 3NG8A 2G2YA 2KT3A 2CG4A 3P8BB 4DL0C 1RYRA 2FJVA 2HVDA 3EPIA 1T9XA 2G1HA 2QLBB 9RUBA 2MEWA 2EK1A 3QZ7A 1T05B 3DLHA 2OFGX 4ZVUB 1RUSA 1TKTB 3ZTQA 4K4SA 1Y7PA 1S1XA 1R8HA 1X5TA 2ZOGA 2VG7B 3M1VB 3F0NA 4FNHA 4B08A 2I1RA 4FXVA 2MZ1A 2M0GB 1KOOA 4P9SA 4C11A 3DLBA 2Y1RI 2Y0BB 1SC1B 2MQPA 3VZHA 1T03B 2FJWA 1U8WA 3ISNC 4DX7A 1HWUA 2J7KA 2A18A 2G13A 3TW0A 3UN2A 3K0JA 1YRXA 3HJFA 3MM7A 4UOFA 5KFGA 2UUCF 4JBCA 3PFOA 5KFNA 1WC1A 2EC0A 1FXDA 1PAUB 2ZUAA 3BPSP 3AJDA 4LFAF 2E9TA 1MMNA 2XMAA 1RWKB 2YNGA 4B17A 3OLBA 4M95A 2CQ3A 3A13A 3R2DJ 1K1QA 3MFHA 1BC6A 2KXHA 4QWAA 5L1KA 3MAQA 3H59A 2Z4PA 3CJTA 2PEHA 2WB1D 2Y3YA 5HQMA 4V19X 2ZH7A 2MY7A 3OD2A 2A2DA 2R8GA 3CCSS 4LVNP 2B6AB 3M7VA 3CF5Q 2IA6A 3FZ2A 2HVZA 4IFVA 1TUVA 4NLRA 2KT2A 1VJQA 4USTA 3W65A 1XK8A 3WX4A 2VASA 5LMUF 2FB0A 5KG7A 1YHQS 3M8PA 4LRAA 5MAOA 4ZPBA 2I5JB 3FUYA 4IG3A 2QRRA 5DDRC 2WSFC 3IG1A 2X1FA 4YS2A 1TP7A 1S4FA 4YDXA 3IS9B 2J7UA 1F5AA 1KQFB 2XO7A 3M9MB 1HWLA 3CO0P 2ZVSA 2OMLA 3K7RA 4FS2A 3IRWP 4O3RA 2PO4A 2WSCC 1SB6A 1M0SA 2LEAA 4OYOA 4I6AA 4ZKAA 3MR3A 1JXLA 4LSNA 4B3MF 4M94A 2QLFB 1KR4A 2E1MC 1C4AA 5RUBA 4YOEA 2CPXA 4C8ZA 2OAUA 4ZJLA 1B99A 3SFUA 2J0XA 2XM3A 2CIMA 2MKIA 2DD8S 2E7WA 3POTA 4CLUA 2VA2A 1JXEA 1F5BA 4KSEB 1OMSA 3I32A 4HT7A 2EK6A 2WW4A 3T3FA 2HHXA 3EE3A 2FLNA 1R0AB 1OIAA 4M5GA 1HNIA 1ACMB 3SIPB 2IHR1 1L3KA 3H5XA 2YNHB 4JB8B 4L72B 4IQMA 4FS1A 2CNLB 1I3OB 4CO4A 3C19A 5D0HA 3TWZA 2FVSA 4MIBA 1NK5A 4DLGA 3HHLD 4NLUA 3UDVA 4ES1A 4KQZA 1KRPA 2IBKA 3H2LA 2IC3B 3MMBB 2NSBA 4WFYA 5KG5A 4F2SA 2KDOA 4GVLA 1W2BR 2CPEA 5KFKA 1PBAA 4IRDA 4X4UA 2UUTA 3H40A 3ENQA 1MN9A 5KFOA 1DLOA 2FPHX 4NI2B 1CC8A 4IR1A 5DDQC 1S6UA 3KMQA 2WVFA 3ZZTA 5IV4A 2MZRA 3M30A 3AOAA 3I9ZA 1UL3A 1OWXA 2GO8A 4DV1F 4PXEA 4QIVA 3IAM9 1BQNA 3DMJB 2QX0A 3KK1B 2VC0A 4GVBB 4J5OA 1RWOB 4TU9A 3M9NB 3NWRA 5KFLA 3I55S 4O3QA 4FDFA 4FBTA 5HMXA 1HFEL 2CPDA 2M88A 4U7CA 3JYTA 5C42B 3DRRA 5B0AA 3KK3A 2NPFA 5CZXA 3HVAA 3K5NA 4O4RA 2MQQA 2HAFA 2VBYA 3T1YJ 3PY8A 1J5EJ 2G0JA 3HSDA 3DGPA 4LRDA 2UVWA 1UZHA 2L9DA 2L3MA 2H54B 3MCMA 3UDLA 4C98A 1M5OC 4ATNA 1WKKA 2HLUA 2LYVA 6FDRA 1IKVB 4X4OA 2ILYA 4LFAJ 5JJBA 1N32F 4ICLA 1JLCA 2Z58B 2NUHA 1REGX 4RNHA 2FUG9 3CJKB 4A8OA 3A8KA 4PAAA 2MZQA 1GT8A 4PWUA 3K57A 2HAIA 3GU0A 4ZN3A 2N7YA 3CCJS 4MFBB 2F7VA 1X4HA 3KMSA 1XQIA 2MHNA 4C4WA 1MROA 2DGWA 3GYNA 4NYPA 4CT9A 2A0FB 5EDWA 5DM6Q 4ZP9A 4MKAA 4LF7F 3G6XA 1UFWA 1PC5A 2GO9A 4KPCA 3Q24A 1OSCA 1KNZA 2K2PA 2VONA 3CIZA 3R2CJ 3UCZP 3FKBA 1H74A 3M32B 3G9CA 3AJ1A 2VPXB 2C2OB 1HBUB 4EUVA 5EWEA 1Y5LB 2HRYA 2LQJA 4HHUA 3KK2B 2B7CB 4WK1A 1S76D 5FLXY 3Q8YA 2MJUA 4WKYA 5KTQA 2RIJA 3HVTB 4KIAA 1NJYA 1TL4A 1BY9A 4NA3A 4QR2A 2N4DA 5EUHA 5HANA 4F4YA 3CMES 1TR0A 1YJUA 3DXSX 3MAAB 4A8XA 2VFVA 2XYHB 2HS4A 2DXEA 4JI1F 2V4QA 2RAQA 2ZUGA 1TL5A 2LDYA 1WEYA 5FJ4A 1FDDA 1U1MA 5DDOC 3OHAA 1XMQJ 1QVGR 4N8OA 1H7WA 3NNAA 3H42A 1CPZA 1CJTA 1T3OA 1TL3B 4UZBA 4OHWA 5MLCV 4P71A 2QL5B 3MPWA 5D77A 3OVSA 3V6DA 4DFKA 2DPIA 4Q5VA 1V9OA 2WOMB 2QL7B 3D9BA 3VQSA 3GIKA 1UEUA 3DLEA 1FERA 5DDPC 1XNRJ 4P2FA 3ILOA 2LECA 3NBPA 5LOQA 3K8WA 2ZEJA 4G1IA 3W61A 1FCAA 2GW8A 3DOKB 4EO6A 4NXMF 3GE9A 1L3TA 2ERRA 2BKOA 3V4IA 1S1TB 5ETRA 3G82A 2H5IB 2M3DA 2J6UA 4MKYA 1R8CA 5HVFA 3HD1A 3CPWR 5J2NB 2O1PA 1H2UX 1CQNA 3HHLC 1OYEA 4ZP7A 2BJ8A 5DQIA 3W63A 4RW6B 1RT7B 2UV8G 1RT6B 1F1BB 2PN6A 5F8IA 5T14A 4XIUA 3KYLA 5IT9U 1CJKA 1NLKL 2A10A 3M1VA 5E3RA 1S6QA 3AQOA 2QE5A 3CJ4A 3TA2A 4DR2J 5KT4A 2VHGA 3GFHA 4DQSA 4N41A 4IRCA 1IWAA 4F02A 1EP4A 2N3LA 3BBCA 4RWWA 5F8LA 1VQLS 4ZPTR 1LKZA 3I5AA 3UCUP 4H4KC 1VHIA 4MTPA 5BYQA 3QJLA 5CH7B 1SJRA 5CCMA 2ASJA 1LK5A 5ETNA 3HM9A 3HFVA 3O5TB 1T9UA 5K14B 3FQLA 4DJBA 1HNVB 5HJYA 1FA0A 4FP9A 1HYSB 4HI1A 1RSCA 2GIQA 1FFGB 2WHOA 4NLVA 1W25A 4RW4A 4ZIWA 4KGXB 5FLXU 1EJ7L 3IA0A 2CQPA 3OVBA 1PYTA 3GIRA 3QSIA 3W8PA 2PA8D 3A3NB 4E0DA 4F4ZA 2W4PA 2ZM6F 2EPIA 2U2FA 3M4XA 4B9NA 4ID5A 1X4EA 2HG4A 4GO7X 4NLSA 2CQ0A 4C48A 1M1KT 1HNXJ 4Y3CA 3O8WA 4LFBF 1DZ5A 1E6VA 2QFIA 4AXJA 4LF1A 4WU2A 3VHQA 3JAMY 2OFHX 3BEGB 3I31A 3UN5A 2DNHA 4JI8J 4GVBA 4NE9C 2VB6A 4NLTA 4LF9F 4C8YA 4CO2A 2PI5A 4DUYF 2RS2A 2C3OA 4C6AA 2A6MA 2J9CA 1SPBP 2LQ8A 4JOUA 4DV5F 1FKAF 4G6VB 1RT6A 4OHZA 4DU8A 4L6V3 3G96A 4DR6J 1FRXA 1FE0A 4RLEA 1RHKB 1WSVA 3HDSA 1SI9A 1Y3JA 3EX7B 2N82B 3CD0A 3C46A 2BM0A 2H9ZA 3QATA 3RAXA 4XDCA 1RYSA 3FMWA 5B0CA 4NASA 5HP1A 5JXSA 3AT1B 3M2VA 3QLHB 1BE4A 4ES2A 2NUUG 3MEDB 1WG4A 4QWBA 2HS3A 2UXCJ 4NCBA 4RW8A 3AXMA 1Z4UA 5A8WA 2YNIA 3OT9A 1C1BA 3RB3A 2FZGB 4DR3F 1JLQA 2CQHA 3BQ1A 5KG6A 2ZHAA 4KO0B 2B5JA 4ECVA 4JI4F 4ECZA 2E44A 1T02A 2CA9A 3KLGA 1PG5B 2JEFA 2EW9A 3LAMA 2G0CA 4LBIA 3KHGA 2VQFJ 4HACA 1CULA 1WF1A 1S72S 3C16B 3PHEA 3MEEA 2B7BB 4KT0C 1K73T 3CD6S 4ZK7M 1FD8A 4EI2A 1Q8LA 4ZP8A 5LSRA 2A6OA 4DUYJ 1U02A 2BJ1A 2J0WA 3EVOA 2IAJB 1VQ8S 1WWHA 2FJXA 5D3GA 4QWDA 1VMBA 4QBUA 5B0EA 3D0GE 3RG6A 5I4MA 1SC6A 1N0VC 5F8HA 2H51B 3JAMU 1UETA 2B9EA 1VISA 1HKAA 3IM8A 3D2WA 3GJSB 2KTQA 2L9NA 3DLGB 4ZOSA 3AOBA 2P6TA 5KFAA 3DGVA 2CJQA 3QAEA 3CCQS 1RTJA 1NM2A 2AGPA 2M8HA 2DGTA 3ZZRA 4DV3F 4X4TA 2NYHA 3LTOA 3HPOA 2W1BA 5LL6d 2D3ZA 1RWPB 1MWQA 2BJEA 3RAMA 1KEKA 4GKKJ 1G3OA 4IFYA 4DX5A 1C1CA 2FZKB 3FFIB 3M8WA 2GX8A 3UR3C 5IV3A 2CYYA 2MZSA 3M8PB 3TVYA 1SH2A 1VDHA 3QGHA 4IH6A 3J81j 1QE1A 4NLQA 3ITHB 1HMVB 1FRMA 3QT5A 1RT3A 3UNYA 2HHWA 4M5MA 1H7XA 3Q0AA 5L1JA 1R8PA 3BGOP 5HVGA 4ECXA 1UW9A 1CJVB 1RAGB 1EETA 1Z1ZA 2H65B 2W8LA 1ZM9A 1UFKA 4B3SJ 1NK0A 1IBMF 2M9KA 4HLBA 4KGZB 2DGVA 2HBYB 4QWCA 3DRXA 1NJZA 2EWHA 3ZC4A 1FF2A 2D74B 2V0NA 5E41A 3BO4A 3TO8A 3RB4A 1HNXF 2V4JB 4CTAA 4KHMA 2EKNA 2PIIA 4DPOA 1RWXB 1A9NB 4OHVA 3JS9A 4Q7AA 1AZSB 4UT4A 4LF8J 1IKXA 3FCVA 2KL8A 4B3RF 2CWKA 1KQSR 4DR4F 3BF4A 2C2NA 1FE4A 2YY3A 3PYDA 4KFBB 3V6KA 1U1PA 4F3MA 2NXCA 2MY8A 5LMNF 2WONA 1E6YA 2ACMA 1YDLA 1VQKS 1IKWB 3TA0A 4ZPCA 1U0HB 3N01A 3QWPA 2R8JA 4YUDA 5KFPA 1WG5A 4RPFA 2XG8A 2IVYA 2UUBJ 3N5BA 2BW7A 4CO5A 1FVSA 1D0EA 2KJVA 3OVAA 4LF9J 2K06A 3RZAA 3U1MA 2XMWA 4USWA 3O2IA 5C25A 3WC0A 3IR6B 3NWGA 2NYIA 1IQZA 2KU7A 1X5SA 1KWMA 3DYAA 2VKZG 4F3QA 1EQMA 2CXEA 4B02A 4LF4F 1S0VA 2DRBA 1NHUA 1KBRA 4LSLA 4LVOP 3PJWA 3BBFA 4ZHRA 3NOGA 4YQWA 2OTJS 1HBNB 4R25A 3PACA 4ED2A 2X1GA 2RNEA 4N8NA 3J81U 1FDAA 1KFDA 3KK3B 3PEHA 1WSRA 2XTJP 3I0SB 3R97A 1UWBB 2AZ1A 1DURA 1LWEA 3Q2TC 2P5VA 2J9DA 4DSJA 4ILLA 2DIUA 3GV5B 1VIXA 5CHCB 2GV1A 1HBOA 2YWKA 4DFMA 4JI2J 3MPVA 4FXDA 4EBDA 3D54A 1ZETA 1YX2A 2D3O1 3L7PA 1NKBA 4L75A 1RTZA 2E5JA 4WP8A 3C15A 4ZS6A 5A2QY 2PMZD 4GC6A 3M6WA 1RE1B 2RSQA 4H4OA 2XLIA 1JJHA 2RB7A 3SDEB 1IWGA 2VUGA 1QAYA 2MKHA 2RKIA 2YVSA 4ZPAA 1N52B 1YJNS 2IM3A 2GJIA 4E8UA 5A0YB 1U6BA 1CULB 3ZTRA 1WF0A 2NR0A 2AP6A 1SL1A 3EUNA 1VC0A 3PW2A 3MUVP 2XMMA 1S1WA 1MMLA 1RA6A 1TV6B 2LA4A 3FZBA 4YB1P 2CRLA 2Y1IA 1PGZA 3HHNB 2JLEA 1JLGB 3CVKA 1SC4B 4LF5J 3UWTA 1XERA 1RB0A 1RKIA 4CO1A 1QVFR 2KZZA 4E98A 1FHTA 1CBKA 3FC9A 3GONA 4LRFA 1AA1B 2U1AA 2QC3A 4LSLB 4IOCQ 4RBTA 5KG2A 2ROPA 2DIVA 5EWFA 4KH0B 2C22A 3J7A1 3IFEA 1FXRA 2EEYA 1RU1A 2AD9A 1U25A 3BKTA 3JSYA 1UPPA 1X9MA 2CQCA 2I8EA 3BS9A 2B56A 1SIWB 2DNLA 3V6DB 1S1UB 1VC5A 1FDNA 4F4AA 3QRPA 3PW5A 1Q16B 3TARA 1T9WA 2IFXA 2BACA 5F0UA 4NA1A 1S9EB 4IO1A 2XI2A 4DV6J 1MSWD 2E1RA 4WXOA 3NXZA 4DV1J 3OJUA 3JQJA 4IG3B 1QSLA 3MI7X 2PT0A 3CMQA 5CZVA 3PW7A 3RR8A 4JI6J 2Y8YA 4F4KA 4GKKF 4N56A 3CJ0A 3ET6B 3B4DA 1RT7A 1X4DA 2DNNA 1TL7A 3L4BC 2OIHA 4NMXA 1G4CA 1U24A 2YQ1A 3GSDA 4V19J 1XJWB 4FXWA 3JXOA 4C7QA 1T03A 3F41A 3KUEA 1HD1A 3QRRA 2V8PA 2M7SA 4C0HA 3P5TL 4HVZA 2NXUA 1HHQA 4L76A 4WF9Q 1IKYA 2XWXA 2X3GA 3KG1A 1KS2A 4B3SF 3PW0A 1QAXA 3OR1B 1FT8A 1S99A 2QTWA 3PHTA 3D66A 3C3LA 4B3TJ 4YN3B 2UU9F 1B3TA 2OUGA 3MEGA 3GWCA 3DRSA 4H54A 2W9CA 3JSMA 2FZCB 2AJ1A 2ZFHA 2KFNA 1C0UA 4PG7A 1QY7A 2ZH5A 1HBMA 1JWWA 4CQ1A 1XMBA 1PYSB 1FWKA 4MAKA 2BA9A 4FBUA 5E3AA 4I7FA 1KFSA 2BKNA 4YB5A 2BE7D 4TQRA 3ENVA 4IFYB 5IT4A 2QEXS 4Y2CA 4ENOA 2M8DB 1UCNA 4X66J 4WIQA 1JLCB 3QNWB 3MEDA 4NZ7A 1NSKL 2XMUA 3SQOP 5E33A 4DBQA 3Q8PB 3Q86A 4EK2A 3OTBA 4KPYA 1Y3KA 2BANA 3CO9A 3MHYA 4NLWA 1WC3A 4V1Ak 1CG2A 2K7KA 4RUHA 2RRBA 4URSA 4JI5J 2D3OR 4IQXA 1Q8KA 2EFNA 2L08A 4QOTA 3I87A 3BQ2A 4DFJA 2UXDF 4QCLA 2APOA 1BQMA 3GFZA 3AB2B 2BABA 2RILA 4UQTA 2EBEA 2L41A 3PX0A 1U48A 1FJEB 3NNHA 2FVCA 5GMDA 4X65F 1R0AA 4BDPA 2XS2A 4DR5J 2FC8A 3LA0A 4Y65A 4DL2A 1Q53A 4G1QA 3KK2A 2PFDA 3H4BA 3P6YC 1O51A 3C8YA 1K9MT 1OS5A 1JLAA 4OJHA 2K7JA 1O5JA 5K20B 4LR8A 4HR2A 2ZH8A 5A8WB 4H4OB 4LBPA 1XR6A 1NSQA 5DG8A 9ATCB 4NA2A 1SKRA 3PNIA 4RR5A 3R9LA 2EG2A 2GVDA 2OKQA 3NGUA 4GO5X 4LF2A 4CLSA 4B9VA 2CZVC 2EXUA 2H3EB 2GHVC 2ATLA 3G8TA 1HW8A 1NO8A 5HBMA 1FI4A 2M5YA 1Q79A 3NCPA 3VGTA 2HZCA 2VD3A 3NL0A 1S59A 5SZTA 1CLFA 3GTYX 4I0WA 4RX6A 4OX7A 2LXFA 3M30B 1FESA 2IJNA 1FRHA 4PG6A 3W60A 3Q8RB 1JKHA 4Q45A 4DL6A 2BJ9A 2ZZMA 2HHSA 1JNZB 1NBEB 1SQGA 2O66A 3A12A 1YI2S 2HFZA 2UXCF 1REVA 2N7CA 3W9HA 3RYLA 3T9ZA 1XMOJ 3GCXP 3L95X 4M5DA 3TP2A 3DN9A 5KT2A 4WE1A 4LF5F 1NJIT 5EN1A 4J7CA 3RAQA 4OHYA 3DLGA 3C6TB 1HBMB 3QSYB 2OEKA 4O3NA 1N36F 1NDLA 5EWGA 4ECRA 1JIHA 2MZJA 1C0TB 4HKQA 2UXBF 1CJTB 1JNRB 1TU0B
chains in the Genus database with same CATH topology
1ZM2A 3BQ2A 3K2YA 2HWTA 2PD1A 3TVKA 5B09A 3MFIA 1ZAXA 2IRYA 1VQ5S 1VQYA 3QJJA 2HWHA 2DCUB 1HMVA 1UJ4A 2W7AA 3B4MA 1OSDA 1GAOA 4OI0A 2EVZA 4I67A 4WXWA 4DV2F 5GAEU 2YX7A 4OLPA 2KVIA 3ISZA 4FF1A 5I3UA 2DRAA 4X4VA 7FD1A 1SUQB 1SH3A 1X4BA 1KLNA 1DAXA 1R27B 4OZJA 3H98A 4W92B 5HROB 2PMHA 2CQ1A 2QA4S 3PO4A 2LQBA 2PGCA 2YTCA 3NKYA 1T8EA 1FO1A 3VTIA 2VZ9A 1AW0A 3DHXA 3K59A 2FLLA 4O23A 4X62F 4XPCA 1B0VA 2KN4A 1H2VZ 4IUFA 3PKMA 4BS2A 5D4LA 3QIPA 2FY1A 3N28A 5T41A 5AE1A 2MSSA 5D8HB 1BGXT 1HPZA 4C8OA 1TK8A 5GADU 4RU9A 4XO0A 2ADCA 3HK2A 3NAHA 3KG0A 3UI3A 3NAIA 4M8LA 2DNQA 4PUOB 3MECA 3R1LA 5T7LA 1V6HA 2WOMA 1U1NA 4ZDNA 5I3QA 2CQ2A 2R8IA 4QYRA 2AJFE 4PXDA 3LANA 1HWIA 2RDJA 3TAPA 4DEZA 1NAQA 3H5SA 4UY85 2UV8A 2HPUA 1F60B 3SYZA 4ZCIA 3O1LA 1A6LA 1VGYA 1JLBB 4ECUA 3AQPA 2IVMA 3M8QB 2EG1A 4NYZA 1MROB 2CPHA 2GIRA 2ASLA 4M1KA 2CPZA 2WAQD 3OJSA 2PC6A 2L9WA 3QYYA 3N6NA 3LWMA 2DGUA 1R31A 4NYOA 5FIIA 4PG8A 3TI0A 2VG5B 1WTBA 4D3GA 1YQHA 2RU3A 2YWFA 1IJEB 3G6VA 4D3HA 2BQ3A 2WBRA 2YNGB 3OSPA 4WCEQ 3HX9A 2XY5A 4L3NA 3DI6A 2XZWA 5SUHA 2DCLA 1HPZB 3I9V9 4TN2A 1P1LA 2AJQA 3M2UA 3GFYA 3WC2A 4PKDB 3KWMA 5DJBA 2IMOA 4EBCA 2A1BA 3FEXB 3R5AA 3CCUS 1I6JA 2F4VF 3AAWB 3RTVA 1K1SA 3G6ES 5GADI 4KRWA 4DSKA 3CB4A 2DTJA 2YKPA 2AYGA 4DV4F 2E66A 4X2BA 1ZBTA 4HI2A 2CDQA 1SJQA 4Y2AA 1Q7YT 1VQ7S 3TUZC 3K58A 5J2PB 1X4CA 2XULA 4LIRA 1Q8IA 2KXFA 3IS9A 2BV3A 4W90B 1UVNA 1MNEA 5G0RA 2M2BA 4OLOA 4DSFA 3CDEA 4XDDA 2YH0A 3OFHA 4NMLA 5GAGU 2UVVA 4XAKA 3C66A 5J2QA 2VOOA 3FEZA 4J9RA 4JV1A 1KLMB 3BGRA 2R2SA 4DG1A 1U1OA 3GB0A 2KRBA 2SXLA 3KFWX 3SCLE 4RU2A 2CQDA 4NZ6A 4ZVHA 2OH2A 5HO4A 1SV5A 4I2PA 5CYMB 1S1VB 2V8GA 1U4BA 3N0VA 1J2VA 1H38A 3CJ3A 1R8AA 4OI1A 2BQUA 2EKYA 1JK9B 3MDFA 3AH6A 2B6AA 1P27B 3BJYA 2J9EA 2RD5C 3SQGB 1YBAA 2R7QA 3BB5A 2KT5A 5E7OB 3JSBA 3I0RA 1RT5A 3EGWB 2WW8A 5KG4A 3VF0B 2AGQA 4F3OA 1FEEA 3OTDA 5L1IA 3I0RB 1HI1A 4PQAA 4LFCF 4AYBD 3VAJA 3E3XA 3KNGA 4M63A 4F67A 1TQLA 4WFXA 2DNRA 1HQEA 3DRRB 3THVA 3PXGa 1Q8BA 3IRXB 1RT4A 1DQ8A 5T7LB 2QA4G 1I1GA 1RT2B 1CC7A 2JEJA 2BRKA 2CVEA 1TK5A 2AU0A 2BR0A 4EGLA 1LV5A 2AV5A 1D8ZA 1N4LA 2HQ3A 1FNMA 3MXHP 2OPSB 1L5UA 2XSFA 2R7TA 2YWEA 1FKPB 4TQSA 2XI3A 4AL6A 2RRNA 3MR2A 2HMIB 2R7SA 4RW8B 3OXFA 2ZH4A 1GX6A 5L8RC 2JC0A 4HTJA 1RTDA 2VA3A 3MD1A 4EFAC 2OD4A 3B78A 5B0DA 2OPQA 4MFBA 1FXLA 1TVRB 3P96A 1R89A 2CPFA 1SUQA 4N77A 3CJKA 2XB2D 4ED6A 3FVYA 3BSOA 3H2UB 1WI8A 1Y00A 1WHWA 1NH8A 3QGGA 1U1KA 2QMXA 1TFYA 4JYAF 1BLUA 2IRUA 4DLEA 2RF2B 4DS4A 1YRUA 1HA1A 2RKIB 4P2SA 2HNDA 2C2EA 1VBXA 3MZIA 2JWNA 2VFRA 1R8BA 1VBZA 1MW7A 3P3DA 4GMKA 4F25A 1QUVA 4KAIA 3SSSA 2I5JA 1FNXH 3T5JA 1KSPA 2W7OA 2JZ5A 5CD4H 2IM0A 1FKOB 4R8UB 1REVB 3WBZA 1S6PB 3JTOA 2LU2A 3PX6A 5L9NA 1NZAA 1JKHB 3G6YA 2GHPA 3RW7A 1RT1A 4ZVGA 3HKWA 3MGJA 3DOKA 1VQPS 3T19A 2HGNA 5IZHA 1TAQA 4ZP6A 3ZZOA 4X4SA 3IGVA 3U27A 5LXRA 2E9ZA 1H2TZ 1S6QB 1RT2A 2NS1B 2YKMA 4EZ6A 3PIOQ 5D4OA 2R7WA 2F8EX 2VG5A 5ITHA 5KFVA 4P7TA 4OL8A 4C8LA 1WTFA 2JFDA 4PXBA 2F40A 4DV6F 1EP4B 3MM8B 2KH9A 1QE1B 2EFPA 2ZKUA 2JX2A 5DQGA 3SEOA 1HL6A 2C3UA 3A8EA 3D1QA 3DOMA 5K14A 3T9NA 3TAMA 5BR8F 4AL7A 4KV8A 4OZ0A 2XHWA 3VWSA 2LQ9A 1JLGA 3MPYA 2DVIA 2RUGA 1XWLA 2VQEF 3FDSA 4DL4A 2V4JA 4F4XA 2XC9A 2XCPA 3MTKA 3LP0B 2MB0B 2MQLA 3W2VA 1CSJA 4PWDA 1O0PA 5D6GA 1GX5A 1N5QA 4Y6IA 5A8RB 2YNFA 2CPIA 3W2WA 2O01C 3RRHA 3MOZA 3QJPA 2Z2LA 1G2EA 2ROGA 1GTEA 4LQ9A 1XNRF 1RP5A 4CT8A 5C5JA 5J2QB 1N5YB 4F2RA 2B43A 2W25A 2ACYA 3GIMA 3MUMP 3EYZA 5AE3A 4K4TA 1T7PA 5FDLA 2AX1A 4YDDB 1X8DA 2FD2A 2QV6A 3PJXA 3ENWA 5CYQA 5D78A 5DGBA 1DJ0A 2CPYA 2MJNA 3NS5A 4DWIA 4NLGA 3T6JA 4ALZA 2AJ0A 3N5FA 1CQMA 4ED7A 4DQQA 3O3LA 2OSRA 1NJWA 4QPTA 5DO2A 1Q86T 2JOQA 4TYAA 3MR5A 3MMCA 4QIWD 2J7WA 4OI3A 3N4WA 3UD4P 2VBWA 3TAQA 3EXCX 5M2UA 5KOXA 2DR8A 2IM2A 5F8NA 3DLKA 3ICLA 5CA5A 2Q66A 4CNZA 4WIIA 2KHDA 1DTTA 2MMYA 3SCKE 5LJ3Y 4A47A 4UQGA 2POKA 2KM8B 3OTOF 1F5CA 4PXCA 2RJZA 4U67Q 4PWDB 1N0UA 3DCAA 4ZVFA 5F3TA 1HW9A 2VFTA 1VQ4S 2CQBA 2W24A 4A4JA 5B0BA 1IKWA 5F0WA 4X4QA 4MK7A 4DR1F 4H4KA 3F44A 3PKYA 3IBWA 1ELOA 2EI5A 4NPOA 3VCDA 1R43A 1VK8A 2ZOMA 3LH2S 2LU1A 1TL1A 4IG0A 5KFEA 2UUBF 4CH7A 2GGPA 3GMGA 3D0HE 1VRTA 2V9KA 2PSZA 2LEBA 2HS0A 3HHLA 3VALA 4Q43A 1QJHA 4MIAA 2FDNA 3DLLQ 3MMCB 5J2MB 2RMLA 2MDAA 4O3OA 2ZHOA 3FCHA 1QAJA 2HVHA 4I6YA 2DH9A 1YJ9S 2OPQB 1QLNA 2K1RB 5HMYA 5L39A 4CIOA 1KTVA 3IC1A 1GQEA 2EFQA 3KOAA 1VIOA 2NLWA 4BHQA 4RW7A 3N6LA 4WK3A 3US5A 3RR7A 1UWBA 2UVUA 4ZCKA 2ZNZA 1WD6A 2MQMA 5C24A 3NGDA 1KLMA 3BGRB 1TKZA 1FTRA 1O8BA 4PRFA 5C24B 1ZTTA 3CCLS 2MGZA 3DI6B 3W3SA 1SQEA 3MMAA 3HFKA 4BBYA 1IXKA 1N88A 1N5SA 2BRLA 4XK8C 3BSAA 3NLCA 1G7CB 3WZ0A 1ZAVA 2ZD1B 5J1EB 5L1LA 1E6YB 1WG1A 3DM2B 2OPPB 2XWYA 3OFEA 4YR2A 4Q2MA 2LMIA 1KD1T 2XNQA 2E7XA 3SSRA 2R2RA 2DPJA 4B9LA 4K50A 3CCTA 3HHLB 3QWUA 3IG1B 1KC8T 5KG1A 3G8QA 4G1PA 1JB0C 1KTQA 2KYZA 3M2RB 3K5PA 3CCVS 1D9AA 1S0NA 1LW2A 3L09A 1SBRA 2ASYA 4DOZA 3IRXA 3V5RA 1WHVA 4C3KA 2G4BA 2DGXA 1URNA 2LXIA 3TUIC 1TAUA 1NNDA 3VAIA 4K4VA 4C8NA 4BWMA 4WJBA 2D9OA 3ZZ0A 2CPJA 3OQ2A 2WRMA 1RTJB 3H20A 2NSCA 5CYQB 3CSKA 4KJIA 1OQ6A 5F41A 3D1HA 4CNYA 1HQUA 2D9PA 1N56A 1SV5B 4I2PB 5LT5A 2ZZNA 1U2FA 2Z8QA 1C1CB 4QPXA 3M9OB 3EGNA 4C8KA 3X3UA 4WYWA 2BDPA 4X84A 1F9FA 4IO9Q 2E9RX 3KJVB 1AUDA 5KFRA 3CC4S 3FSXA 1UAWA 2QT7A 1K0VA 1LWFA 1YGYA 2JHEA 3ITHA 5KT6A 2ALZA 1H6KX 3PZPA 4LF6F 2ZD1A 3FSYA 3HHKA 4O44B 2ABYA 5L38A 2O5DA 2ZC4A 4KGMA 1NRKA 4EYHB 4GC7A 4JI3F 2F9JA 3G4SS 1S10A 1VC6A 4YP3A 1IUJA 2DO4A 4UOCA 4DUZF 2CKWA 3TX8A 2B9XA 1VOMA 1TV6A 3V81B 1UP1A 3CTRA 3ONQA 3FMBA 4IH7A 4QJVA 5LSOA 1KHVA 2QMWA 2FVRA 1U09A 2JLGA 4RBUA 4M5DB 2FHMA 4ED8A 3UW1A 5DM7Q 1RGVA 1S6OA 4EYIB 1NEEA 1H0HB 2MQOA 2CJAA 3AY0A 2B51A 2RQMA 4IOBA 4Q2LA 2ZH3A 1VQMS 4P7VA 3NCRA 3R1HA 4OQJA 4I2QA 1HQUB 2OMOA 2HHHF 4NLOA 2DH8A 3HO1A 1IQTA 1R3NA 5IXUA 4MJKA 3PVXA 5E0OA 3ZZPA 2BANB 3KLIB 1JLEA 5IM0A 2VC1A 4YHHF 2J9DE 5H9EJ 1BQXA 1WEXA 2YNIB 1JJ2R 5DS7A 2HHTA 3OTCA 3D1OA 4TU8A 2GNKA 5DLFA 3CD5A 2AX0A 2PA3A 3RU0A 2JVOA 3RBEA 4J9NA 3POTB 3J7Z5 3T1AA 2B9WA 3BGFA 2F8HA 2YKOA 4ECSA 2F9DA 2NREA 2ADBA 2VBXA 3I82A 5KOWA 3MAHA 2F8MA 4YR3A 2FIUA 5F8MA 3SV3A 4WKRA 5J1NA 2IA0A 3CMAS 5K8NA 3G8SA 5HQ8A 2VQFF 3M2VB 3QLHA 3PEJA 1FDBA 4NRUA 2UUWA 1VBYA 4CH0S 5AJ3F 4OFZA 1VQ9S 5F8GA 2BYCA 1N8RT 1FK9A 4OJ1A 3LPYA 5KT3A 2JLFA 1R6YA 3PM9A 3UD3P 1N5YA 1TL1B 2KO1A 2FLOA 4CO0A 4RZRA 4IKAA 2ZH6A 3M2UB 2AQ4A 1UVIA 2R7UA 1YITS 5HL7Q 1GXUA 1RA7A 1M5KC 1ZZNA 4RUAA 5AXLA 1DLOB 3H2VE 3MEKA 3OPKA 1XC9A 1FKOA 3DOLA 1UEVA 2LLZA 3O6QA 5EX0A 4R8UA 1QSSA 3KLIA 4Y2KA 3DRYA 2C2RA 3MCSA 4USHA 2KG1A 5KFBA 1HD0A 4DSIA 3LP0A 1JLBA 1I94F 2DNOA 4MYUA 2L48A 3CWJA 4OJ3A 4JV0A 1EETB 4X66F 4WYLA 2HIQA 3JTPA 3CT9A 1BWEA 4ZHRB 3GR0A 5CCLA 4QU7A 1RDRA 1FEHA 2HNZB 4OZNA 4I68A 4WTYA 4CTAB 3DC2A 3QAUA 2DT9A 4I6WA 3I5BA 5GMKa 3FFIA 1WEZA 4Q8EA 4NLYA 2IMWP 1P8GA 1S9EA 2R7OA 3M8SA 3MEGB 2E1AA 2W9CB 2VKRA 5HLFB 2CJBA 4TY8B 1RISA 4YMEA 3LGNA 2LEPA 1T95A 3K8VA 5J1EA 3MWBA 4CCHA 2OO4A 1XN9A 4WFZA 3UE2A 2R7VA 1FRJA 1S1XB 2DJWA 3NGKA 4B9TA 4ELUA 4J9MA 1HNWF 4AUKA 1DTTB 5D3GB 1HNZF 2EFGA 3IXQA 4FZVA 1HHSA 2I9SA 4RUCA 2VH7A 2AYBA 1S6PA 2HHUA 2C42A 2V4RA 2P9CA 4QIGA 2X51A 6FD1A 1TZ0A 1VI7A 2B9YA 3W2VB 4RKUC 5DG7A 5G0RB 4BC9A 3CUNA 2BW2A 1RT4B 3PO5A 2K1RA 1Z2ZA 4C0OC 4N5SA 1WI6A 3LF0A 5L9XA 1TL3A 3RRKA 3I0SA 2HHPA 2WK4A 5ADZA 2C28A 4J9SA 5JVGQ 4DQRA 5GAGI 3MM6A 1NH7A 4OJGA 2E5HA 1LWCA 3QGPA 2QIFA 4WZQA 1LK7A 2UP1A 4G1QB 2KZMA 4R0JA 4TNOA 4H4MB 2DITA 1T05A 4HH1A 2QA1A 5BYSA 1YJTA 2Y0SD 2Q6BA 2QA2A 2CVIA 1WELA 2XY7A 2XMTA 4NWBA 1HBNA 2IBOA 1M5SA 1U49A 5F3ZA 1M5PC 2IJFA 2MSTA 4KTQA 5JUMA 2XGPA 3AB4B 3UQSA 2D1CA 2YQ3A 3S1TA 2MGZB 3VAHA 4A8YA 4DL7A 1SXLA 3BR8A 4WFBQ 4RNNA 1TKZB 3M05A 3IN5A 3PW4A 2XS5A 2AWZA 4DS5A 2W7PA 1RK8A 1Z2LA 4ERDA 1OQ3A 2VODA 2RS8A 3FNNA 2GCFA 2VBZA 5K8PA 2IC3A 2OD6A 3E8OA 3MMBA 3HLUA 1PO6A 1MMDA 4K5SA 4IG0B 4QZVB 4YR0A 3EGZA 2B4OA 1Q81T 3KNAA 1P6TA 3PDNA 1G1XA 3K5OA 5F8JA