5L9NA

Structure of uridylylated glnb from escherichia coli bound to atp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
92
Chain Sequence
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II 1
publication title Effects of T-loop modification on the PII-signalling protein: structure of uridylylated Escherichia coli GlnB bound to ATP.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Signaling protein
total genus 22
structure length 92
sequence length 109
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l9nA00
4CO5A 4IYQA 1QY7A 4NYPA 4ZK7M 3L7PA 4CO3A 1XK8A 2E66A 1P1LA 4OZJA 4USIA 3O8WA 3TA0A 1PILA 1Q1KA 5D4LA 1V6HA 1VHFA 2JJ4D 3AA8A 2XZWA 4NYOA 1GNKA 1NAQA 1J2VA 2GW8A 3N5BA 1NH8A 2O67A 2EG1A 2GNKA 2NS1B 3LF0A 4USHA 1UL3A 1UMJA 4YB6A 2DCLA 4C3KA 2XBPA 2XG8A 1V3SA 3HLUA 2ZFHA 2NUHA 3OPKA 2V5HG 3NCPA 5L9NA 4WK1A 4YB7A 4CO1A 2J9DA 4E98A 1NZAA 2XULA 4D3HA 5D4NA 4C3LA 3AH6A 4OZNA 5DS7A 4CO2A 1V9OA 3GSDA 5DRKA 4YB5A 1NH7A 4RWXA 4AFFA 3TA2A 2RD5C 3BZQA 1V3RA 3AA9A 2PIIA 4R25A 4CO4A 4WK3A 3TA1A 3DFEA 3M05A 4RWWA 4Y65A 1O5JA 3MHYA 1VFJA 2ZOMA 2Z0GA 2J9CA 1KR4A 1OSCA 4USJC 5D4OA 1O51A 4D3GA 4CO0A 2NUUG 2VD3A 4Y6IA 2GX8A 1HWUA 1UKUA 2EG2A 2J9DE 4C3MA 1H3DA 1UFLA 3O5TB 4CNZA 2CZ4A 2J9EA 4RLEA 5D4PA 4OZLA 2O66A 4RX6A 3X3UA 3AHPA 4CNYA 3CE8A 3NCQA 3NCRA 3T9ZA
chains in the Genus database with same CATH superfamily
3AOBA 1GQEA 3ZTQA 4ZVOB 4ED7A 4ECSA 3D7SB 1FEHA 4C11B 1KFDA 2E1PA 3TNVA 1AYEA 4B3MJ 1GAOA 5ETTA 4OJHA 3AB4B 2N82B 4U7UD 1FD8A 4DX5A 4NCGA 1ELOA 1A6LA 2A3JA 1UWBB 3OTCA 4KFBA 4HTJA 1SV5A 4A8YA 5F41A 1HARA 1FJEB 4Y2MA 4L76A 2HQGA 4NCBA 1U1MA 1HIYA 5HL7Q 4BDPA 2UU9J 3NAIA 4LFCF 1IBKJ 1IQTA 1TQLA 2DRDA 3ZTSA 4DLGA 2PSZA 3MCMA 4OI3A 3CB4A 3MCSA 4HACA 3Q23A 1NK4A 2XTJP 3FEYB 4A8OA 3T1HJ 5JVHQ 2V8PA 1IKXB 5KFJA 2B56A 4Q0BB 2W9BB 3VGUA 3NCRA 4HEA9 1RKJA 1S7HA 2QO3A 3MXHP 1S1VB 1TKTB 5KFBA 2G4BA 3R5DA 4ES3A 1M5HA 3AOAA 1XMBA 1Q8LA 4WFZA 3A13A 3LF0A 5IV4A 4CLTA 4HDHA 4FKYA 1RTJA 1EB0A 4KYZA 2GVDA 2PI5A 3T5HA 1IQZA 2JC0A 1LFWA 2I1RA 3IG1B 3DHWC 5KFKA 2HURA 2W25A 1WELA 2OI2A 5EX0A 2VPWB 1HBOB 5L9XA 4X4RA 3J7YI 3M8QA 4F4ZA 2HZCA 5ETLA 4B3TJ 4CP5A 2LYVA 1HPZB 2ZNYA 5KAKA 2PFDA 3ZZUA 2GX8A 3NP5A 3P8BB 4TXSA 2QE5A 4TU7A 5KT6A 5F8LA 1BHNA 5CH7B 2ZEJA 2V8DA 2VH7A 5K14B 3IWLA 3PRDA 3OD2A 3K58A 4ZPCA 2XHCA 4OFZA 1QY7A 3I0SB 2Q1LA 3OFEA 3DOMA 5GAGI 4AL7A 1LWXA 4HDGA 1MNEA 2JZ5A 3AXKA 2HGMA 4M5IA 1RT5B 3C15B 2VKRA 1CULA 3PFEA 2R7UA 1XNRF 2ZE2A 3PW7A 1O6XA 2W1BA 4CDIA 5EDWA 4YUDA 5T7LA 1KKHA 2DNHA 3UI3A 2X1FA 2EFPA 4AQYF 3KK1B 2RUGA 3OR2A 2XMJA 2P9CA 3MM7A 2YWGA 1TVRB 3CVKA 2FJEB 1YK9A 2DGUA 3K89A 1ZPWX 3K17A 4UF4A 1E6VA 2BA9A 1V3ZA 3SBMA 3PRVA 1LW2A 5DO2A 1SQEA 4HH0A 3RW6A 1EHWA 2EC2A 3FEZA 3FSXA 5AXLA 3OXFA 4HTIA 3ULHA 3NAHA 1KONA 2XY5A 1RHMB 3M8PA 1QE1B 3BBBA 5C5JA 2K1RB 4BHQA 4ECYA 1AZSA 3PIPQ 2FHJA 2KVIA 1SL1A 4M5KA 3M8ZA 1RYSA 1HBUA 5G0RB 4FS2A 1DFDA 4IO1A 3H90A 4NZ0A 4OX7A 3D68A 2AQ4A 2R7OA 1S6PA 1EQMA 1MU2A 2XBPA 1N33F 3MOZA 2BW7A 3QT7A 3VWSA 2CPJA 1VQMS 5IQ6A 2QN6B 4YDDB 2UVUA 4N8OA 4C8LA 1VIOA 2JEIA 2FJXA 4B9MA 4OLPA 3FKBA 2HWHA 4LSLA 1YJ9S 1NK5A 1C4CA 2IDEA 1YSJA 5KT7A 1KWMA 2M9KA 3KYLA 1HMVA 2ZH4A 3TZXA 3A8KA 1Y3JA 3CDAA 4BC7A 1CC8A 1R0BG 4DR4F 3QPIA 5LJ3Y 4I6WA 3QQCD 1Z2ZA 1I94J 4CLZA 2P6SA 2Y9HA 3UN2A 3V6KA 4NOHA 2BYCA 2MQPA 4ZK7M 3U27A 1S9EB 1N56A 3E51A 5KTQA 2YNIB 2A1BA 4DFMA 4AXJA 2RS2A 3DOLB 1UA0A 2QLJB 2VA3A 3N01A 5B09A 3S8SA 1GMUA 1WC5A 1H7XA 2BEFA 4LF2A 2VA2A 3FCVA 4LFAF 3J81j 2J9DA 3JTNA 2QV6A 3Q24A 2G1HA 5F0WA 2I0XA 4DV3F 2QFIA 3D2WA 5LT5A 1JLEB 4ED2A 2MDAA 4L3NA 1SKUB 4ZHRA 5HI7A 2IYIA 2ZD1B 3BDPA 2ZH5A 4DR6F 2CJ9A 4PUOA 3IBFB 3BF4A 1N5YA 1RQ0A 1HWUA 3UDCA 1UFLA 1ZM9A 4PG7A 2CZ4A 4OV6A 2OPPB 3SDEB 3TQEA 8ATCB 2HNDA 3CMAS 3MOJB 3RU0A 1N48A 5I4MA 1DAXA 4CO3A 3MR5A 3FBCA 2Z2ZA 3C46A 1G7CB 3MM9B 1ZA1B 4I2QB 3MMAB 1ZZFA 5BR8F 3HHLB 4CH7A 1O0PA 3GCWP 3QIPA 2VG7B 1A0OB 3C2PA 2JLEA 2KJVA 2V67A 5CYMB 1WOOA 2HQIA 2C2DA 5T14A 5HVHA 3QSIA 2CWKA 2RILA 2JDJA 2DGOA 2OKQA 1NK0A 4GKJJ 5CYJA 4HHJA 5ETRA 1O51A 5KG0A 4K7QA 2EG2A 3W2VB 5HJYA 5A0YB 3M9NB 2KTQA 3FVYA 3DRXA 4NLOA 2DKOB 4G65A 4ZVFA 2R8GA 2JNJA 1LWFA 3KOAA 1WSRA 1K9MT 2ZH2A 3DI6A 2YBVA 2UUBF 4PWDB 4W98A 3V6DA 4DV1F 5M2PA 4DUZF 4KHPJ 4H4KA 4NWBA 1WKKA 2UXCF 2UV8G 3QWPA 5B0BA 1RHQB 1S7IA 2M5YA 3LTOA 3SSSA 4F67A 2B7BB 3KXDA 3MM8B 1HNVA 3PYFA 1P1TA 2D9OA 1UZDA 3R27A 1IBLF 2Q66A 2C22A 4LF4J 3VGSA 4H4KC 3NNCA 4X4VA 1T11A 1Y5LB 1Q7LB 4R8UB 4JI5J 2RNEA 2VJVA 1R0AB 4KTQA 2BJ1A 2XCAA 4RU2A 1RU1A 1S6QA 1PAUB 2FLOA 2E7XA 4KBIA 4CCHA 3Q8QB 1IR2A 3DC2A 2MKKA 2XI2A 4KQZA 3V81B 1GX5A 1VQ4S 4Q45A 4JI6F 3PJ9A 2R3VA 3C19A 2G2ZA 1OYEA 3KLVA 3M2UB 3N5BA 4J9LA 2OIHA 1SUQA 3FK4A 4ICLB 4R5PA 4F04B 4ZVPB 3HD2A 3KLEA 2XLKA 4QBUA 8RUCA 3EYZA 4E98A 3F41A 3UN3A 1K44A 4TLQA 1J5EF 1KOHA 4N5SA 2V8HA 4CM0A 3QAEA 3LPEA 4JV2A 1D9DA 1WKJA 4WK3A 2YKNA 3MM5A 2ZKTA 3PDNA 5L1JA 1U1RA 1VGYA 2C2MB 4KKOB 1FNXH 1RBLA 4N41A 4NCGB 2WW4A 4UQTA 4MK9A 1N5SA 4G3IA 3AD8C 4KFBB 4WJBA 5G4DA 3W3SA 1S12A 2BJ3A 2MKIA 1F5BA 3CE8A 1P6TA 4HI1A 1SKSA 4OX9F 4RW6A 4EO8A 4I6AA 1XWLA 5CQGA 4X66J 2RHQB 2R9LA 5HATA 4ZVQB 2HIYA 5D4LA 3HKZD 1RBOB 3MURP 4HACB 2ZJRQ 2V8VA 4F4KA 1UMJA 3JSYA 2LFVA 3Q8RB 4B3OA 2UZAA 1RT6B 4CTAA 1U0HA 1GTEA 3OUYA 4M5JA 2EC0A 2FHOB 2B4VA 4DPYA 1JLGA 3W5YA 1Q16B 3IC1A 2VG5A 2PMWA 1FE4A 2M8DB 1SKRA 1QUPA 2QEXS 5HMZA 4K50A 4EYIB 2LCWA 3Q8SB 2G0CA 2GZOA 1RTJB 5C24B 2GVDB 2YNHA 3QIDA 1KP6A 1N52B 3H4DA 1PIEA 2FGCA 3DLGA 2DBBA 2ZKUA 3OW2R 4UT4A 3MECA 2W2NP 5F8HA 4J37A 1XNQJ 3SV4A 3MUMP 2G0JA 2NZ4A 4K4SA 5EN1A 3M8QB 1SQGA 4B3MF 1FRKA 2IIHA 5K9FA 1IBCB 2DXDA 2ZDOA 1ZM3A 4CLWA 2IA6A 2PFFB 4GMKA 2X1AA 3TARA 2Y8YA 3HDSA 4HR2A 1XTZA 3ZZRA 2OEJA 4RJVA 2VICA 3BDEA 4RUCA 1WC1A 4U95A 2MKSA 3GV8B 2MB0B 1VQNS 1U1LA 2ZBRA 2XS5A 1I5OB 2G9OA 4PWUA 4IQXA 2ZZTA 3OL9A 2UU9F 1S10A 4OL8A 1IBKF 4TYBA 3BGUA 2EFGA 1CULB 4Z2XA 1VQ7S 3P45B 5IQQA 2ZE2B 3T1HF 2E5LJ 4NLSA 3W60A 1KD1T 1SB6A 5K5MA 4O3SA 5T7LB 3TVZA 1FESA 2HWTA 4J9UE 3OR2B 4RBTA 2HW3A 1JLBA 3MM7B 1EARA 2AYGA 5HLFB 3PX4A 4B9SA 1K1SA 2YX4A 1AFJA 1E6VB 2F1FA 3OHAA 2DR7A 4C0HA 2XY7A 1LW2B 1FRHA 1MN9A 1RWNB 2NS1B 3PO4A 2W4CA 1UL3A 2N4CA 3GIRA 2VC0A 4LR8A 1X9SA 2LDYA 3M8PB 1MMNA 2I5JA 1R27B 3GFYA 1SQFA 1X5PA 1R31A 3KLIA 4FXVA 1AZSB 4CLYA 2DXFA 1HBUB 4CH1A 1BQNA 4CI0B 3ILOA 5K8NA 2GIFA 3HHDA 4KPYA 1YBUA 2H5EA 2B9XA 1VRQC 2BDPA 4B3TF 1S6PB 4WCEQ 3HT3A 1MU2B 2BKPA 4EZ9A 2BABA 3D5MA 3KG1A 2CQ1A 5ETSA 4F4AA 1AB8A 4X4UA 2KH9A 5KFNA 3DRPA 1WKLA 3KK2A 4B9NA 5KT2A 4QPXA 1JJHA 2BE9B 4O44A 5E3QA 4CNYA 5E2QA 2L08A 3AT1B 2ZM6F 4LSLB 3TVYA 4WU3A 2CJAA 3B6BA 3BO4A 4Q7AA 2RUSA 3VGVA 3I0RA 2VB6A 3JSMA 1F2GA 2JJ4D 4FF4A 5E3CA 3ONQA 4YR3A 1HMVB 3W9JA 1MW7A 4ZVSB 1U47A 1IKYA 3DLKA 4HVZA 3TO8A 3DMJA 1D9AA 1EETA 2IRYA 4LRAA 5LM7E 4CO1A 1SC3B 2DH8A 4FBUA 1U09A 4V19J 4KT0C 4E0DA 4CM2A 2V2ZA 1TK8A 5D3GA 3UDLA 2XNRA 4IR9A 1PO6A 2FJDB 3QSYB 4ECZA 5L46A 4K5RA 1FE0A 2HGLA 4I69A 4RWWA 4YY3J 1U4BA 1AXQA 2F4VJ 2W9CA 3QGHA 4ES1A 1GXTA 3W2WA 3HVTA 4PYAA 1HQEB 1RZMA 3F0NA 4FVMA 2WCXA 4Y2AA 2H1YA 2HQFA 4ZVGA 4CQ1A 2HHPA 3Q8PB 3T9ZA 2XMUA 3D9BA 2NSCA 4MKVA 4Q2MA 4DFJA 4X84A 4ZHRB 3TX8A 4CYUA 1HLWA 5AJ3J 3WX8A 2ZJQQ 1RAOA 1QLNA 1N5YB 2VASA 4ZCLA 1YRXA 2ADBA 4I67A 5E3RA 2QA1A 2GAHC 5BYQA 5MAOA 3FSIA 3QBCA 2PE8A 4OI0A 3M7VA 4IDKB 1Z2LA 4PEOA 1IKWA 3QJPA 1NUEA 5KFEA 2HNDB 2CQCA 1X4GA 5CXTA 1DY3A 4LRFA 4CLKA 1RA7A 3DCAA 4F4YA 2KN4A 3W7BA 2N7YA 3G6XA 1VBYA 4OZ0A 4HKQA 3G71S 1C4AA 1RXOB 4ZCMA 3RB6A 2VFRA 3T1YJ 3QIPB 4WFAQ 3OV7A 4MK8A 2WRMA 4KHRA 1XEZA 1I94F 3NGUA 5IM0A 3Q89A 4UOFA 2VV5A 5BYSA 2UXDJ 1WF2A 3GP9A 4EK2A 2GVZA 4RW8B 2GV1A 4WZMA 1G4CA 7FD1A 1I3OB 2EXUA 4I0WA 4RW9B 2OFGX 3BR9A 4ZP8A 2FHKA 1IKVA 3FDSA 4WYLA 2VFVA 3VAIA 4WK1A 1LFPA 4J9SA 1EKSA 5IC6B 3NMAA 1TUWA 2ROPA 1LWFB 2GAGC 5IT9Y 1BWEA 2CPXA 3T5KA 1IVZA 3MWBA 2J0SD 4NE9C 3V6DB 3W5XA 1NDKA 2D1CA 5D78A 3D6TB 3PM9A 4Y2IA 2DITA 1KR4A 1TV6A 3H59A 3OXGA 4OI4A 4LQ3A 2MY8A 2P6TA 1IBMF 1HNVB 4WXWA 4BCAA 1Q78A 4HHHA 1U0SA 2G0IA 2C3MA 3BR8A 2AJQA 2HYIB 1CBKA 4XIUA 3ELHA 2N7CA 3D3CJ 3PACA 4K5SA 4GKKJ 2ZVIA 3LGHA 2CIMA 2R2SA 3BN4A 2HK3A 3R5GA 4RNHA 4P71A 4PRFA 5KFYA 2ACYA 3J80Y 1RHJB 4KAIA 3J7AN 4QYRA 3DOKA 1CJTA 1EP4A 1UTAA 4V19X 2HGNA 3AH6A 2ZOGA 5KFGA 4I1TA 3T5LA 2LP4A 1NH7A 3HVWA 3Q86A 2B9WA 2C2OB 1ZYQA 1S49A 3AXMA 4GKJF 4RU9A 2KZMA 3E01A 3G4SS 2JHEA 3R5BA 4DBQA 1SUQB 3CCVS 1Q8BA 5THWA 4R5PB 1T9TA 3DNCA 3KLEB 2F63A 4CLFA 3SV3A 4YHHJ 1VQ5S 1B0TA 3HK2A 2R7TA 1CLFA 1IXKA 2EI5A 3DYAA 4ZPAA 3OJUA 1TUVA 5HSPA 2I38A 1IM6A 5HMYA 4F2SA 3AJ1A 1DQ9A 3KKFA 2DR9A 2YKNB 4ZVEA 4KHPF 1Q1KA 1V5IB 3IR6B 1Q4RA 3BSAA 3ILJA 1TFWA 2K3IA 3C6TA 4RR5A 4F26A 9ATCB 3KHHA 1T3OA 1ZZNA 5LSLA 1XIQA 2YWFA 2LVWA 1KHWA 4LR9A 2HK2A 1RUSA 2VODA 3LWMA 2XS7A 1NJYA 3G8TA 1C1BA 2J7WA 1D8YA 1FWPA 5KFMA 4RW6B 4GVLA 4UQGA 1VJWA 2ZBIA 1QJHA 4JI5F 4LRDA 1HA1A 4A8QA 2WAQD 1TL5A 1VHIA 4DV6F 1U26A 1U49A 2RQ4A 2FZCB 1HW8A 1QTNB 3CJ2A 4LIRA 3LAKA 5ETMA 1U0HB 1Y10A 2BR0A 3OUYB 2DCUB 5KFQA 3X3UA 1O8BA 1SC1B 2WOMA 2ZC4A 1JLGB 3OTDA 2DNYA 1NK8A 2JEJA 2R7VA 3A3PB 2VG5B 2YKOA 4DSEA 3B82A 3SEOA 1VHFA 4K4XA 1NO8A 1J2VA 2ZWPA 2DXEA 5RUBA 2AJFE 3M9MB 1TL1A 3IRXB 3GZ7A 1VQLS 2YNHB 3KG0A 2CPDA 3LP0B 1N8RT 3DLGB 2HFUA 4ZMMA 1SIWB 4DPXA 3I82A 4RBVA 2BJ8A 2ALZA 1KDNA 4RPFA 3MECB 4Z37A 2WVDA 2RD5C 3MTKA 4WP3A 3UR3C 5SUHA 3K2YA 1YRTA 1N0UA 2MYFA 4B9VA 4I7FA 5DZ6A 4DV0J 4FYDA 1HW9A 1U1KA 3D6FB 1H74A 2DHSA 1M5OC 2DT9A 2MGZA 2ASJA 5JMNA 3QJJA 4IYQA 1NBEB 4PG8A 1NB7A 2ZH9A 3OVSA 2IAJA 1S48A 1DZ5A 4X66F 1LOUA 2N3LA 1U25A 4NLYA 3QT6A 2W7OA 4ILMA 3VAFA 5HVGA 3UPFA 2RRNA 2K06A 3NBPB 2CJKA 4DV4J 3OXLA 3GB0A 2FLPA 2XZDB 1JLBB 3Q22A 3RG6A 1B99A 1FA0A 1VYAA 1W26A 1OYDA 3CGIA 2U2FA 2JLGA 3H2LA 2XO7A 1NK6A 2ASLA 2FVPA 1UJ5A 3NLCA 2ATCB 2FY1A 3Q2SC 3EVWA 3K5MA 4NLWA 1FO1A 2VD3A 2BMBA 2EFNA 3D66A 2PA8D 4DN0A 6FD1A 3QJLA 4QWCA 1GXLA 1DURA 1XR5A 3KLIB 4MFBA 2QL9B 1XNQF 2I8EA 3M8YA 2W2PP 1BQNB 1EAYC 1PBUA 1WSVA 1X4FA 2QIFA 4KIAA 2CPFA 4NYOA 1W2BR 2GGPB 1RWOB 2KT2A 1TMMA 1DBDA 3GG1A 4ZLPA 2HQCA 4J9MA 2XMKA 2R8JA 3KK2B 2DIVA 3PKYA 4A8XA 3CCTA 4O44B 4HT5A 3OVBA 4PCQA 2C3YA 1JJ4A 3B78A 4TU8A 1Q5YA 4YB5A 5EX3A 3NWGA 3BZQA 2CKWA 3I0RB 2IBKA 1ZH5A 3JSMB 2Y1LB 3B54A 4OIXA 3TR5A 2E5LF 1IKYB 2B51A 3DLKB 2YKMA 3DMJB 1EETB 1Q86T 1KBRA 4I64A 2NZCA 2NYIA 2JEGA 3JQJA 1CQNA 4CRJA 3TQ1A 2IM2A 2FC8A 3BQ2A 3CJ5A 4QR1A 1DTQA 3KTQA 1BQXA 3ET6A 3H5UA 4TVAB 4RX6A 3TWZA 3QGIA 5D3GB 2PGCA 4OI1A 3CPWR 3PYDA 2VBWA 2QL7B 2HHXA 2E5GA 3GWCA 5M2UA 4ZP9A 2YKAA 1HL6A 2DHXA 2FIUA 3T19A 1VIXA 2E5HA 5IT9U 4KHMA 2XZWA 1YDLA 2AF6A 5IC4B 2W9CB 2M88A 3W2WB 2I2YA 1TK5A 3HVTB 3BH6B 4ZJOA 2K7JA 2XYHB 2XLIA 2RS8A 2ZH1A 4RZRA 4C11A 3OFGA 2RJZA 1H2UX 2H9ZA 1DLOA 3BYRA 2XWYA 3AA9A 2O01C 4J90A 3S7RA 4CYUB 4QIGA 3VHQA 4IG0A 3HM9A 1C0UA 4PWWA 2QT7A 5BYRA 4RL1A 2J8AA 4PPDA 3BEGB 4V1Ak 5HO4A 2AEMA 4DFKA 4USKA 2HAIA 1IKWB 4S0MA 2AJ2A 2RF2A 1KQSR 1UEVA 1YTYA 4IUFA 3ZNJ1 3PW4A 5F8NA 5F8MA 1HWLA 4IKAA 4DCOB 4K4TA 2XYPB 2KT5A 4W4MA 1RCXB 2KHDA 3HFZB 1XK8A 4DLEA 4I68A 1RTHA 5HANA 4AQYJ 4P73A 5C2GA 2W9BA 5CZXA 2MLYA 2C2NA 2GNKA 2XQCA 5EHHA 5AXMA 5AE2A 4ETZA 1S1VA 1PJ6A 3CJKA 2IPOB 3CJRA 3FGVA 5ADZA 2DRAA 1ZTWA 5IM0B 1IUJA 3M6WA 1X9MA 4ITSA 4X62J 3BYPA 4OZNA 2LA4A 5L39A 4UOGA 5SZTA 2VKZG 3OBIA 1RA6A 2EW9A 4JI3J 3Q83A 3R2DJ 4J9OA 4X4OA 3DFEA 4YY3F 4Y65A 4USJC 5D4OA 1B7YB 3RTVA 1GXUA 4C2MA 2F4VF 2RHSB 4J7CA 1S9GA 3TUIC 5KT4A 1C0TA 3GYGA 1VR6A 1HBOA 3M9OB 1QDUB 1NPRA 1RLDA 1RI7A 2CVEA 1VBZA 2JEFA 2XSFA 1HNWJ 2WBMA 2OMOA 5L38A 2HWIA 3FFIA 3DLHA 1NHUA 1YX2A 3LH2S 3Q8UA 5C2CA 1EZZB 5AJ3F 3EGZA 1TV6B 1S0VA 1REVA 1H6KX 2J5AA 3RGIA 1GMWD 4MH8A 3CD5A 3LOUA 4OZ2A 2RAQA 4OJ3A 3GV7B 2LXIA 1VK8A 2NYHA 2ZFHA 1S59A 4ZN3A 1C1CA 3TZYA 2A6OA 1R0CB 2C2EA 2HRUA 4J9RA 2GCFA 1RAJA 1WF1A 1UVNA 3HPOA 2R7SA 4XDDA 1U1NA 2ROGA 2B4UA 4EGLA 1X4BA 2LU1A 1M1GA 2VDIA 3FJ2A 4KR0B 4DQQA 3T1YF 1KFSA 1TKXB 1CEZA 1TVRA 1VQYA 4YMEA 2C3OA 1FJ7A 1H3DA 3DOKB 5DG7A 1CJTB 1EP4B 3MEEA 1UJ4A 5HBMA 4WTOB 1DHMA 1SVDA 1NLKL 3M6VA 2UXDF 1MWZA 2Q6CA 1IJFB 4U8YA 3N4WA 3E01B 2H5IB 3LUYA 4JYAJ 1PSDA 2OHDA 3Q0AA 4K2JA 1FT8A 4QOTA 2W2QP 5ETPA 4ZPBA 5F9LA 1KTVA 2GIRA 1N88A 3FEXB 5G0RA 4X64J 5ETVA 5AE1A 4M5DA 4BBYA 3ISND 3AD9C 2ZH8A 2FLNA 3NOCA 2XCPA 4ECTA 2WVEA 2DTJA 4YDXA 2O1PA 3UCUP 3AAWB 3UN5A 3D0HE 3C6TB 2HHHJ 3D54A 3QT5A 1UVKA 4NA2A 1SH0A 3RZAA 1VI7A 1MSWD 2A2DA 3CMES 2Y1IA 2V2VA 1C1BB 1AUSL 4ZLJA 2KM8C 1SL2A 3JTPA 4JBCA 3UVJA 4GKKF 4WE1A 2KI2A 4KO0A 1AFIA 3TAPA 3D3BJ 1HNIA 1L3VA 2X3DA 4WIIA 3OR1A 2X7IA 1REGX 2C1EB 2ATLA 3F73A 2XC9A 2RVJA 4A8KA 4WKRA 2GJFA 1PCAA 2AIRB 3B8HA 1S9EA 4C0BA 3CCES 3R1HA 2HVDA 4NLRA 1BWVA 3W61A 3M32A 5J1NA 2AU0A 2WOMB 2LKZA 3WC0A 3OQ2A 2QA4S 3VZIA 3DOLA 4I2PA 2XEXA 5J2NA 1R43A 2MXYA 3PHTA 1YJTA 2B6AA 2NSBA 4FNHA 1UPMB 4EEYA 1F9FA 5GAEI 2CQDA 1MWQA 2EFQA 2GO9A 3PEHA 4BWJA 3A4TA 1TKZA 1TL1B 1N34J 1SL0A 3KUGA 3I96A 4YHHF 1TELA 2OO4A 2YWEA 1JLEA 2VQEJ 2L48A 4GC7A 4DZDA 2R2TA 3OFHA 4ZLNA 1IN0A 3UD5A 4DV1J 3DU6A 1Z1ZA 9RUBA 3MGJA 3BB5A 3I31A 4GC6A 2HAFA 3TOQA 1FFGB 3ZTPA 1NJIT 3AJDA 4LREA 3LGNA 3D0IE 4URGA 3CCZA 3SDEA 3IA0A 4WP9A 2DPJA 5I3PA 1IBLJ 4F0HA 3PKMA 4FYYB 2DNMA 4CT8A 1BUXA 2BZ2A 1Y5IB 3EUNA 2MGZB 4ZVTB 4TQSA 4MK7A 2FUG9 2VJUA 4H4MA 1K47A 2NXCA 3HHLA 1U7LA 1Q7YT 5K8PA 1Y0HA 4USTA 5L1LA 1KEKA 1IR0A 4ECRA 1YGYA 5KT5A 3C3LA 3IO1A 4A46A 4PG6A 2FVQA 1FWLA 2FLLA 2B4OA 1ROFA 4QWBA 3CD7A 4ANDA 2J6SA 2WBRA 4YFUA 2C2ZB 1K0TA 3BGLA 1WACA 3GILA 2MPUA 1RAHB 3FQLA 4LMZA 2HRTA 2C2KB 1X8DA 1Y00A 4CO5A 4KGXB 4ZVRB 1UEUA 4QWAA 1S1TA 3EGWB 4F4WA 1S1XA 2JVRA 3JXOA 3NEKA 5ETNA 4Q2LA 1ZTTA 2FYXA 4O3OA 3W63A 2BJEA 1EKRA 4DL7A 2UVVA 4A8MP 2B43A 2UUAJ 3RBEA 4FYWB 2HHSA 1V3SA 2RB7A 3KG4A 4OX6A 3FQKA 4MFBB 1VJQA 1HFEL 1RT7A 3CCLS 3L4BC 2R42A 4MIAA 1NSPA 1PGZA 3MUTP 2VOPA 5CHCB 4DN9A 3DLJA 2MQNA 4TNOA 3G8QA 3IM9A 1NJWA 1EIYB 2Y1RI 5J1EB 1VFJA 4CLPA 2J9CA 4DV5J 1FHTA 2HFZA 1GMVA 4DX7A 3RAMA 5H1SV 5K8MA 5KFZA 1M0SA 3VR1A 3LP1A 1X60A 3HVAA 3N0VA 4ZPVR 1YBTA 5DLFA 3M30A 4RUHA 4JP8A 3QGGA 4OYIA 2YX7A 4OZ3A 3I56S 5GADU 3ISNC 4HL9A 2YKMB 4NYZA 5H9FJ 4P7TA 1K1QA 1NXIA 4P9SA 3A1YG 1R3NA 4C9DA 4DV4F 1DTQB 4ZCKA 1KC8T 1BQMA 3ET6B 3GJRB 4OHWA 2WSEC 1CG2A 3JQKA 1RT1A 2ADCA 2E7VA 3GCXP 2LQ5A 1F5CA 2CG4A 5DLGA 2OPQA 3CDUA 1U8SA 4Q8EA 3BO3A 1TL4A 4DU7A 3G6VA 2IYGA 1VRUA 2Y8WA 2JC1A 1S72S 4NMXA 1JXLA 3IM8A 3I5BA 4EYHB 5J2QA 5LSRA 1ZETA 1DLOB 2W7AA 1Q0NA 1FX4A 4KKOA 1P27B 1JQGA 5B7WA 4CT9A 3MDFA 3PIOQ 2PMHA 5DDRC 4IG0B 1HYSA 3G82A 3PRBA 2R8HA 1C0UB 1RCOB 2X1BA 3EPGA 2DGXA 3EXYA 5F3TA 1M90T 4KGVB 2DPIA 3TYTA 3U02A 4YQWA 1HI8A 3CEDA 1URNA 3LGMA 3ZFVA 2RF2B 3AQOA 3AJ2A 4USWA 2BKNA 1N54B 4NLDA 3R5JB 2BE2A 2HVZA 2MQLA 2PN6A 3G96A 2GQQA 1ZM4A 1RTHB 5A76A 3MAQA 1HBNA 1RT6A 5EUHA 3DM2A 1TL7B 4WFXA 4F3MA 2VQFF 2F8EX 4D3GA 1XR6A 2Z2YB 3CJKB 3DLBA 3CCSS 1WG4A 4LF9J 2VC1A 3H20A 4LJMA 1RT3A 1D1UA 4DQSA 3LANA 3UR0A 1IWAA 4QU6A 5C24A 1NSKL 4L73A 4XPCA 3HVRA 2ZZMA 1KLNA 2AYEA 2HBZB 2OELA 3CJ3A 4M8LA 1S79A 3D67A 1M5PC 4ECWA 3CSKA 5KFCA 4L6V3 3JQMA 1S9GB 4LF6F 1C0TB 2KRRA 1XN9A 1YVFA 3OTEA 1S4EA 3TEGA 3MD1A 2AHOB 4LF5J 3GFXA 5FLXY 3VQSA 5I3QA 2PA3A 4ZIWA 3FFIB 1HI1A 3QMQA 1X4DA 2B5JA 1N6QA 1T9WA 3HF5A 2LXUA 5IT4A 1CQMA 1O5JA 3ITHB 1REVB 3IRWP 2Z8QA 3KMQA 2BKOA 2DEJA 5CABA 5E3PA 3ZC4A 2ZM6J 2UUTA 1C1CB 1RE1B 3WQPA 4NLUA 4KGKA 1Q53A 3VV2B 3NCQA 3LW5C 3IFEA 1K73T 2OH2A 3NNAA 5JUMA 1U8WA 3CO9A 2HKEA 3SXLA 3F56A 3TVKA 1RAIB 3GPAA 1GNKA 1NAQA 3I55S 4URQU 2JVOA 4DX6A 2YH1A 2CA9A 4YB6A 2DO4A 4DR1J 2YNFA 5HLFA 2FB0A 1FTRA 3MEEB 1FNMA 2VPXB 5KFUA 5HBMB 4X62F 2X3GA 2OPRA 4C3LA 1VQSA 1Q79A 2HBRB 3KJVA 3H2VE 1T0TV 4JI3F 1AA1B 3WC2A 3NY0A 1U2FA 2KKHA 4UZCA 3BS9A 2ZOMA 5HQ8A 2R8IA 2RIJA 2Z2LA 4NLPA 5D6GA 2CFXA 3GFHA 1JJ2R 3KHLA 3HFVA 3BJYA 3CDWA 3DN9A 3KDOA 1SJRA 2JH3A 4A8SA 4M5DB 1HNWF 4DCPB 2J0XA 2DVIA 1XMQJ 4NLQA 1RWWB 3EZOA 1WNEA 3L7UA 2KM8B 4KPCA 1WTBA 1YRUA 1V6HA 3AA8A 3I9V9 3CJSA 2V2KA 2UV8A 3PJXA 5EWEA 1SJQA 1NEEA 3L7OA 4B9UA 1XMOJ 5ETOA 1OWXA 1WHXA 3VAKA 2WHOA 3JB9k 2J8SA 1LWCA 3UVJB 4WE1B 4DPTA 4CZCA 1QTMA 4F0MA 2P9EA 4CO4A 4KO0B 2BV3A 2QFJA 1HNIB 1SH3A 1ZAVA 3UD4P 3HHKA 4DV2J 5D8HB 1FEEA 3OR1B 1F3VA 3ZNUA 4Y34A 3MPDA 3JYTB 1VRTA 3U1NA 2J7UA 5E33A 4DL6A 2EWHA 3KLHA 3TUPA 1X5TA 3M32B 4C8OA 4X65J 4PXDA 2OGUA 5BJRA 4I2PB 2LEBA 5J2NB 3T3FA 3SI8A 2E9ZA 2B6AB 1YJWS 1P1LA 4NX9A 4JYAF 2DNPA 1HQEA 1S76D 1TKZB 2O67A 5FDLA 1HWKA 2RMLA 4FP9A 3K5NA 1ZOTA 4IQMA 2DY1A 4X64F 3SYZA 4OYXA 5C25A 1XR7A 1YJ7A 4QW9A 4BWMA 5KFFA 4LBPA 1JLQB 2F3JA 3POTA 3QT8A 4U67Q 3K5LA 3NMRA 2J6UA 1T03A 3O44A 4X4SA 4IDKA 4LFBJ 1IBMJ 2HHHF 1H98A 2MQ8A 1FF2A 3ZTOA 2ZH3A 2MZ1A 4HLBA 5CA5A 4O23A 3QRRA 4FBTA 3R1LA 2EFVA 4NI2B 1JKHB 1FRIA 2LEPA 2DGVA 1RHRB 5IOLA 3ZO7A 4H4MB 4DFPA 2FJWA 3PW5A 3ADAC 1KS2A 4O0IA 1R8BA 4PABA 2HS0A 5AE3A 2KG1A 1RTDA 4B3SF 2DGWA 1GK8A 3TAMA 1TK0A 4EU0A 3O8WA 1XJWB 2LXFA 1GFWB 3M2VA 3KMSA 4C8KA 4YR0A 3M2RA 1A9NB 2HZAA 2C42A 4NXMJ 1VC6A 3C6UA 1PG5B 4RW8A 2V5HG 1RWMB 4RW9A 4NL5A 1YZ6A 1FKOA 2DNOA 1YJUA 2RT3A 4OHXA 3P6YC 2RU9A 5KG2A 4OYMA 1S1TB 3QAUA 2OTLS 4FXDA 1Q81T 1S1XB 1B0PA 3BN7A 5DQGA 5HN0A 1N34F 2B3TB 2GMHA 3C14A 2VQEF 2GC8A 4WKYA 4CWBA 1NSQA 1Y11A 4LIWA 4WTYA 2HVHA 3DXBA 1RT7B 4P2FA 4U8VA 3P5BP 1FVQA 1RTZA 5DQIA 2RH3A 4QIEA 3OSNA 3M1VA 4UTGA 3QFWA 4J9VA 3W1YC 2MSTA 3SQGA 3M8SA 3MI7X 2J0QD 2WW8A 5AXNA 2NR0A 4ECQA 3G6ES 1RLCL 2XGQA 1WTFA 3LP1B 1AT1B 4AD6A 3M30B 2XYGB 4ETXA 3R8YA 4EWTA 2B9YA 5J2MA 2A6MA 3JS9A 4DV6J 2UUCJ 4RBUA 3PY8A 1NCLA 2VL1A 3D1OA 1FFWB 1Y4ZB 3NGTA 4YR2A 1KSPA 4ED6A 5D15A 2OD4A 4JI1J 4KSEB 1UFKA 1T9YA 3M8RA 5A8WA 2HRYA 2AJ1A 2YKPA 3VAGA 2RDDA 2XGPA 4BLGA 3I32A 1BQMB 3NS6A 3ZZ0A 1TKDA 3H40A 2AEJA 3MMBA 2ZUGA 3ENWA 1RT1B 5LMNJ 1RWUA 3BGOP 5FLXU 2OPQB 3HZEA 3PXGa 2ZWOA 1N5VA 2AJ0A 2F9DA 1VRUB 2XMMA 1RWPB 2WB4A 3T9NA 1NPPA 4ANEA 2UUAF 3ETMA 4PZVA 4PAAA 1YZ7A 1G1XA 2H3EB 5J2QB 1NB2A 3OTBA 2QSFA 4OJ1A 1QUVA 1UAWA 2JFDA 4GVBA 2BQ3A 3EICA 2IJNA 1HYSB 3G82B 3VTIA 3GMGA 5HROA 4B02A 3IBCB 3CXCR 4DV5F 2OSRA 1QVGR 1JWWA 1VLOA 3ETOA 3OT9A 4CIOA 4XPEA 2CQBA 3E8OA 4IO9Q 2RQMA 2PI4A 3GTYX 1FDNA 3TI0A 3UWTA 2Q6BA 2FJVA 3RUBL 3PCOB 1HNZJ 7FDRA 3GYNA 3CDEA 4WWSA 4DV7F 2BE2B 3FBBA 3MR3A 2VBYA 4KH1B 2ROEA 2WK4A 2QLFB 1PC5A 1D3WA 3RYLA 2KYZA 1HBNB 5IV3A 2V9WA 3DM2B 2MY7A 2B9EA 1JX4A 1FXDA 1WOSA 2HFOA 5KFPA 2DIUA 5KFTA 1JNZB 4Y00A 2XG8A 1S6UA 4IFVA 1GX6A 2OSQA 3SSRA 4DU8A 2J0WA 1IR1A 3UFCX 2D9PA 4DR5J 3P4UB 3I5CA 2BM1A 1RT3B 4ECXA 6AT1B 4ERDA 1J27A 3D1HA 1N5TA 4K4UA 3AB2B 4DEZA 4KGZB 3R5AA 3IRXA 3LP0A 2NLWA 3CJTA 2CPZA 1WC4A 1NKBA 1T05B 2W4PA 1RBAA 2WB1D 5EWGA 2WVBA 4BS2A 2AZ3A 1IWGA 4DOZA 3AY0A 2F5GA 5L1KA 2J6TA 1B4SA 3M4XA 2HHWA 3W65A 4JI0J 4JB8B 4TYAA 2Z57B 3FCWA 3WX4A 2GQCA 4ECUA 4UUXA 3M6UA 5CD4H 1NK9A 3B4DA 3CMQA 2AWZA 4DL4A 4OYOA 2B5JB 4ZA1A 1N6QB 4DCJB 4UOCA 3ENVA 4ZLLA 4TY8A 4ZCIA 1FKAF 3IR5B 1X4CA 1URRA 3H0PA 5DG8A 1KVJA 4ZKAA 1PYOB 1F60B 4F8RA 5A6PA 3KLFA 1KN6A 2BOAA 4D3HA 1YI2S 2OMLA 2WVFA 3BPDA 3BQ1A 2LQ9A 2OD6A 4HH1A 5I3UB 2CZVC 3NBPA 2H48B 2WSFC 3PX6A 2NXUA 1CJVA 4ZPDA 2YNFB 2V69A 3TZWA 3PZPA 1R8PA 2XZTB 3B4MA 4IR1A 1MMLA 4DQRA 4LF9F 4OZ1A 1X9WA 1HHQA 2FHJD 3H42A 2RRBA 2OPRB 3BSOA 3CJ0A 2EK1A 1UA1A 4ALZA 3KJVB 2B4PA 1H38A 1SPBP 4ZIVA 3ISZA 4NMLA 4KB7A 2F65A 2IM1A 3T1AA 3KJQB 4OX8A 4H4OA 3DDNA 4B17A 5KOWA 2C28A 5GAHI 4TU9A 2K8GA 2EG1A 1OQ6A 2ZNZA 4X4PA 2JWNA 1RT2A 1Z4UA 1HWIA 1HI0P 2OJ3A 1CJKA 4LF5F 2F8HA 4EBEA 5LSOA 1Y5NB 2EPIA 2HIQA 3O2IA 3NRBA 1LW0A 2GGPA 5A8KA 4DSIA 4AL5A 1HHSA 3TJ9A 3T41A 3MFHA 3W9HA 1WORA 1M5SA 3SCJE 3J81Y 5K20B 2IFXA 1TL3A 1S1UA 1HD0A 1VOMA 1S6OA 2GO8A 3AODA 2IM0A 4ID5B 4UW2A 2DHGA 4QYZJ 4DSFA 2J9EA 4IOCQ 1QAYA 2PEHA 3C8YA 4FF3A 1LWCB 1YJNS 2LECA 2IJFA 2Q43A 4HYKA 3LP2A 3I9ZA 4K4ZA 1BGXT 2QRRA 4C0OC 2JRSA 2BVZA 1PC4A 1PILA 2R4FA 1WEYA 2LQJA 3J7A1 4A48A 1NDCA 1Q95G 1VRTB 5GADI 2DH9A 4DR1F 3CD0A 4OHVA 1TAQA 3GV5B 3MM6A 4EFAC 3HLUA 4RNOA 5DM7Q 3KLHB 5GMDA 2FGOA 1AROP 2Q79A 3QZ8A 5D4NA 3M6XA 5H9EJ 4A8FA 3UNGC 2BACA 3ZXWA 3TANA 2RSQA 1RHKB 2PO4A 4O4GA 4ER8A 2Z30B 2DK2A 1HR0F 2CNOB 2PMZD 2KJWA 1OSCA 5FDLB 1W2IA 2CXEA 1KTQA 3LO3A 4DX8H 2WONB 5F8JA 3DXSX 3OTOJ 4NXNJ 3MEKA 4DS4A 2YQ3A 2IY5B 2CPHA 5C25B 2O5DA 4ZVHA 4DXLA 4C8MA 1CPZA 2L9WA 1XMQF 3SCIE 1HHTP 2AX1A 2RDIA 2BUNA 3POTB 1JB0C 3VF0B 3R7SB 1T03B 2MMYA 1N36J 1NK7A 1VDHA 3D6HB 4DHVA 3L9ZA 1TUGB 2GA7A 2KU7A 2P9GA 1B70B 4UZBA 1T95A 1FJGJ 2MKCA 3FZ2A 2POKA 1XMOF 3RRHA 3LAMA 3IWXA 4DR2J 2GJ2A 4O3RA 2EBEA 4DUYF 2HPUA 1Q8KA 2VDHA 3KUHA 2BX6A 5D0HA 3V4MA 2W24A 4DMZA 4F3QA 1FRLA 1CSJA 1NMEB 3P96A 1RTDB 3HFKA 1PBAA 3TAMB 2CZ9A 3M2VB 2GMJA 3D0GE 3M2RB 4DV2F 1ACMB 4KV8A 3T5JA 1UVMA 5DM6Q 2H4WB 4DDFA 4PQUB 2XSJA 5F3ZA 4ELVA 2HLTA 3C6UB 1UW9A 5HJXA 2VBZA 3TAQA 2E29A 4DSLA 1EJ7L 1N5QA 5E7OB 4DG1A 3RW7A 4X65F 5D4PA 2WSCC 4P72A 1M5VC 1R8AA 1FKOB 2VG6A 4X4NA 4PQAA 2C2RA 2CQ0A 3OLAA 4F36A 1GTHA 3C16A 2YY3A 2X1GA 4PR6A 3C14B 2BANA 4U7CA 4O3PA 1SIZA 3E2EA 1LKZA 2BM0A 4Y0FA 3U1MA 1VS3A 4NCAA 3CC2S 3C66A 4HHUA 4K2XA 1F3FA 4FYXB 2VFTA 3ZZOA 1FERA 3S1TA 1VISA 2AJ4A 4LF8F 2HVIA 2M70A 2HZVA 2YQ0A 4LFBF 3M1VB 2V50A 2D3OR 3SQGB 3GJTB 2IA0A 3VGTA 5F8IA 4DQIA 3R2CJ 2NXEA 2NUUG 2CQGA 4L72B 3MPWA 1TAUA 5KFOA 3Q2TC 1XQIA 1OO0B 1JLCA 4OV1A 5J2MB 3FMBA 2N4DA 4PYDA 4RUAA 3KFWX 3VALA 3EE3A 3R7BB 1NM2A 5KFHA 1UWAA 2MEWA 1TKXA 2HBQB 4EBDA 2Z4PA 1A7GE 5A8WB 4LVNP 2NPIA 2ZH7A 4RNFA 4OYZA 4NXMF 2AX0A 2Z2MA 1PYSB 1UW4A 1U1OA 1WDTA 1PJ7A 1SBRA 3QGPA 4ED0A 2YVSA 3MMBB 2MJUA 4ILRA 4KRWA 3GIJA 2WTFA 1H73A 3OL8A 2XWXA 3VZHA 1UCNA 3P49B 1JJCB 1NDLA 2F4FA 2V0NA 4J9PA 2QA4G 3US5A 4OJGA 1KQKA 1LK7A 5LMUJ 5D0EA 2CJBA 2R7RA 4M5HA 3F44A 4L74A 4WFNQ 4FVCA 5JXSA 3LQVA 3THTA 3LA0A 2MHEA 5GVQA 1WG5A 1OY6A 1LXNA 4ZJLA 1OMSA 3FMWA 3VCDA 2W7PA 2MLXA 1W25A 3AHPA 3EMTA 2DR8A 4GVBB 1OY9A 2CUYA 3DU5A 2GJIA 4DL0C 2VONA 5HROB 2CPIA 2MZTA 2KO1A 4GO5X 4YP3A 3HSGA 2KT3A 4JOUA 1B7FA 4TKTA 5C7PA 3R9LA 2Y0BB 4URSA 4WU2A 3HD1A 3ZZPA 4AUKA 2LQBA 1MG7A 3CT9A 3CJ8A 2QYGA 1VQ6S 4IFYB 1RU2A 2IC3A 4A4JA 3TJ8A 4OYAA 3BGRB 1JXEA 4DR3J 4QZVB 3QYYA 2K2PA 4QPTA 2UUCF 2XMVA 2QC3A 4C97A 4GRSA 2BE7D 2JX2A 4JI1F 3UCZP 1BD6A 1R8CA 3NXZA 3CC7S 3R7NB 3SSQA 1F9HA 3I4HX 3CDBA 2EBGA 4IFVB 4M94A 1FFSB 1PAEX 1QSSA 1VQKS 4O3NA 1WJ9A 3LPYA 4EUVA 2DNGA 2KXFA 4AYBD 1SCJB 1EQ0A 4USVA 5LMNF 2GFFA 2FD2A 5A8RA 4WFBQ 3T6BA 1RADB 3QO9A 3GR0A 3PW2A 4TN2A 5LJ5Y 1KNZA 4JI7J 3K7RA 5I42A 1DQ8A 4USHA 2GHPA 3SMZA 3J81U 2Y1JA 3W5ZA 4ZPWR 4NASA 2NUHA 5F8GA 4LF1A 5GMEA 2BQRA 2DGTA 3RAXA 2ILYA 3W8GA 3N6MA 1FKPA 3NS7B 1V9OA 4FPRA 1EX8A 1S57A 4FZVA 1WG1A 2ZDPA 3MR6A 5KG6A 3UO0A 4FS1A 1L3SA 3WBZA 4TY8B 3NGKA 3RB0A 3OSPA 3QLHA 2A18A 1DRZA 2ZC3A 2JOQA 1HNZF 2QSWA 3KLFB 2AYBA 1CJUA 3R5CA 1TR0A 4C8NA 1OSDA 3KWMA 4NA3A 2MZQA 5B08A 2G2YA 4UY85 2HHTA 3G9CA 1CJVB 1FK9A 3PNIA 1X7VA 3SCLE 2OEKA 3WHIA 2MJNA 2DHAA 5KFLA 4DR5F 2AEFA 1L5UA 2L9DA 5DGAA 4NEYA 4WPAA 3L3CA 2V8GA 1F2HA 1APSA 3DHXA 4EMDA 5IWAF 4TQRA 2QX0A 1MLAA 1S99A 3GLJA 3HJFA 4H4OB 2CPYA 5EWFA 2V34A 5KOXA 1CC7A 4KGMA 1G3OA 5C42A 1RT2B 5HQLA 1T02A 3S6EA 1UKUA 1CJKB 3W62A 4M5NA 1YG0A 3CC4S 2XHWA 1M1HA 5HMWA 1DQAA 4JI0F 1D9FA 1QD1A 3HHEA 5J1EA 1LW0B 5A8KB 3TJAA 4OYPA 1SC6A 5CYQA 5LOQA 3P3DA 1JLFA 1KRPA 1QAXA 1B64A 4Y2KA 1KQFB 3UE2A 1VCTA 2CNNB 1K8AT 1SI9A 3PW0A 1FI4A 1TL3B 1S1UB 3LALA 1CS4A 1H7WA 3K8VA 1AUDA 1F9EB 1ZA2B 1SV5B 3R3TA 3EZUA 3MFIA 2QLBB 2CYYA 4ZP6A 2DRBA 1FTCA 5CCMA 4EZ6A 2QMXA 2AKWB 4Y2CA 5L9NA 5LXRA 1WI8A 3X1LB 3TUJC 4QR0A 4DPUA 5H9FK 2VQFJ 2LA6A 1U1QA 3DLLQ 4U96A 1MN7A 3G6YA 1OPIA 2K3KA 3LP2B 4R25A 1UVJA 1U2CA 4UY8T 2W2OP 2XMAA 4F3OA 2XMTA 2UVRA 1LK5A 3AQPA 3KJNB 1BE4A 3MM6B 4OLOA 3TZZA 2ABYA 1KVIA 5GMKa 2EEYA 3BGFA 2RQCA 3ILLA 1XBWA 3MPYA 1X5OA 2MZSA 3O6QA 3A8EA 3N9UC 1BXNA 4O4GB 1U24A 4P2XA 5E5NA 4LF6J 4DJBA 3GR1A 4OZJA 3KK3A 3KHRA 5DJBA 2GMLA 1Y9OA 5J2PA 3GIKA 3EX7B 2A2CA 3CJ4A 3E3XA 4N76A 1SH2A 3ILIA 1RB0A 2LQ8A 2OUGA 3NCPA 3NGDA 1YJVA 2IRUA 5KG4A 1FRMA 5MLCV 1NZAA 2GQ2A 1WUUA 1ZS6A 1UVIA 4P2SA 2W8KA 1HQUA 1RDRA 2DGSA 2ZH6A 3DRRA 1X4HA 4DPOA 2NQPA 2KHCA 3H2UB 2IBOA 5F9NA 3MEGA 2GIQA 3J80U 4O0NA 1S4FA 2RQKA 1RWVB 3HO1A 2IVMA 1FVSA 3K8WA 4YB1P 3K5PA 4WP8A 2HNZA 4X4QA 3DOMB 2MZRA 4CNZA 2XY6A 1ICEB 3HSZA 3BH7B 2G2OA 1TL7A 2E1CA 4OZLA 3ENQA 1MROA 1FDAA 3NKYA 2E1AA 2I9SA 4O4RA 3V2UC 1JLAA 2VHGA 4F7VA 4KV8B 3VVUA 2B8PA 2ZHAA 2XSJB 2YXLA 3AOCA 2P5VA 4JI2J 4HT7A 1F0XA 3MR2A 3UDEA 2AV5A 2HFSA 3GE9A 1KLMA 2IM3A 4DG1B 1WHVA 3H25A 1FD2A 3MAAA 3WIVA 2VG6B 1U1PA 1X31C 4TY9A 1RABB 1V3RA 3DGPA 3KNGA 2IVYA 3C16B 3PR5B 1HD1A 3R97A 3NL0A 3KJFB 2CRLA 1BY9A 1WEXA 2BANB 3BO2A 3OTOF 4OYBA 4NXNF 2JFKA 2MZJA 4Y6IA 2CVIA 3PVXA 2MQOA 3SZ2A 5KFWA 3ZTRA 2BRLA 2NPFA 3ITHA 3FZBA 2N3OA 1LEOA 4TLRA 1TMJA 1N36F 2XB2D 1OY8A 2X51A 3IWNC 3EXCX 4O3QA 1J5OA 2PDAA 2AZ1A 1SXLA 2NXNA 3L95X 1FJGF 2DR6A 4K8RA 3QZ7A 3DDIA 2OFHX 3EDQB 3RR7A 4Y28C 4DR2F 1JLCB 5IT0A 1YBAA 4WF9Q 2XNQA 1PYTA 4DQPA 1D8ZA 3EVOA 3A8JA 2L9NA 3FC9A 2ZZNA 2YPZA 5A2QY 2DO0A 1JXVA 3MMCA 1SJFA 5ITHA 3DLEA 3CCJS 3HXMA 4WZQA 1YHQS 5GAEU 2HHQA 2HS4A 3O1LA 1WD6A 3MAHA 4WIQA 4FDFA 2MSSA 1QVFR 3ENAA 2C3UA 3SFUA 2M8HA 3H98A 2W9AA 1CVJA 4OQJA 1RWXB 2E1MC 1S0NA 4USIA 2ZJPQ 4MIWA 2V4JA 1L3KA 2HS3A 1S9FA 2D3O1 2PD1A 3HSDA 2CJQA 2FY8A 4LT6A 2Z58B 1YIJS 3I5AA 3GIIA 2JL9A 2YX1A 6FDRA 2BJ9A 1SJ1A 3HULA 2XULA 5B0EA 3FBEA 4PUOB 2YTCA 3EJMA 2R7XA 4IOAQ 3IS9A 4AL6A 4F02A 3BM7A 3U1LA 1H2VZ 4ZDNA 2V6AA 3PV8A 3TA1A 1VK3A 4R0JA 2VBXA 2H54B 2CJXB 1JNRB 3HKWA 4ZS6A 2MQMA 2W01A 3H5YA 4B08A 4J5OA 3EVMA 2IC3B 3ZZTA 1HNXJ 2I6WA 3RBZA 3CNQP 4B3SJ 1R89A 1T9UA 3CWJA 4USUA 4LQ9A 2PC6A 1RJJA 2L3MA 4M5LA 1ZPVA 1P8GA 4MJKA 2RKIA 2JLFA 3RAQA 3TX0A 3NS5A 3NGSA 3JYTA 4NLVA 3JSBA 3FCHA 1WC6A 2H4YB 2DNRA 4F50A 1N32J 4DS5A 3IP0A 2IMWP 3MEDA 2IHR1 2GW8A 2DNLA 1YQHA 2F8MA 5HK4A 3GONA 4N56A 3PEJA 4U6PA 1ZM2A 5DQHA 5HQMA 2H51B 2YPYA 4K0KJ 2HHVA 2LMIA 5DG9A 3G86A 2D41A 3CUNA 2QL5B 2O3DA 2DH7A 1RAFB 5KFVA 3OL7A 5A8RB 1RT4A 5LMUF 4XO0A 3K5OA 3QO9B 5I42B 1NPKA 2VFSA 3V5RA 1JLQA 3DI6B 5F0UA 3OL6A 2COLA 3PYEA 1X5SA 3RB3A 4NRTA 4CLLA 4FF1A 3BKTA 4XK8C 4AE5A 5FD1A 1TU0B 2A10A 2KFNA 1FKPB 5ETKA 3GQCA 5FIIA 2EKYA 3D4JA 3H7HB 4L75A 1G2EA 4ZP7A 1OIAA 4F0KA 2V9KA 2ZUAA 1WDDA 3IGVA 4NI2A 1SC4B 1TZ0A 2CQHA 2MLZA 2QMUB 1JKHA 2VIHA 2XO6A 3ICLA 2FZKB 4CH0S 1S1WA 3QLHB 3CF5Q 2DCLA 2CNKB 3HMJG 1GMWA 4KY3A 2M0GB 1V5VA 3S01A 3NNHA 4DR3F 2IMOA 1WF0A 4DL2A 3MR7A 1CJUB 1E6YA 1RTIA 2CQPA 3FRYA 1VQPS 1WHYA 1X0PA 1Q82T 1S6QB 4C7QA 3VAHA 2FDNA 2MKYA 1UZHA 4M1KA 2FJBB 2R8KA 4PXCA 2V68A 4PXBA 5J1PA 2R7QA 1FK9B 5HP1A 4M5MA 2V4RA 2ZITA 2FVSA 1D09B 4C8YA 2RE1A 3QRQA 1PKUA 3H4BA 1XC9A 2LEAA 4J91A 4RW7A 3BPSP 4PG5A 2AW0A 1VQ8S 2CNLB 3DRSA 4YEAA 2CQ3A 2VPYB 3KLGA 4B3RJ 2W8LA 3RRGA 5A6WA 2QGFB 1KHVA 4JI7F 1YJRA 2FVRA 3TW0A 4LBHA 5ETQA 5C42B 1RACB 3OVAA 1LNQA 1Y3KA 5KFIA 2HQDA 1VLYA 3CULA 3G87A 2AGOA 3MM5B 3EDRB 5B0DA 5CYQB 3RRKA 3W66A 1JLFB 3UDVA 4ZITA 2OAUA 1IJEB 3BQ0A 2CQIA 3DDKA 1R6YA 1T7PA 3JTOA 4PXEA 4N8NA 4F2RA 1CS4B 1I1GA 4LF7J 1WOPA 4JI8J 3BSNA 1F5AA 4CO0A 4DV7J 4LF4F 4MAKA 4RW4A 3VAJA 2M2BA 2QG9B 2Y3YA 1FDDA 3MTJA 1DTTA 3K0JA 2MQQA 4DR7J 1P9YA 3FSYA 4G6VB 3BBFA 2KFYA 4NPOA 2NREA 4NYPA 1HBMA 4WYWA 2LDIA 4OI2A 3IAS9 1QSYA 4B3OB 4CTAB 2DD8S 2U1AA 3G8SA 3RBXA 3MUVP 1T8EA 1NHKL 4LR7A 4IRCA 2HLUA 1WC3A 1DARA 3NG8A 4P2MA 3KHGA 3N5FA 5L8RC 5FJ4A 1UP1A 5CD4A 2B8QA 4ZOSA 2BBEA 2UP1A 5DDQC 4E2FB 2QYCA 1FJCA 3TA2A 3J7YU 3MMJA 3KK3B 4Z7YA 4ED4A 2CJYB 2XS2A 2FVCA 1M5KC 4NA1A 2UXBJ 5J2PB 3LWLA 1F6TA 1RAAB 2KL8A 3SCKE 2ZVSA 3IAM9 5CAAA 4WXOA 3I4PA 3DRYA 4H54A 1UETA 4G1PA 2VOOA 2LLZA 4IG3A 5L1IA 2KDOA 1L3UA 1VQ9S 3TEHB 5B0CA 3PX0A 5IS2A 3CCMS 1TTHB 1HQUB 2M3DA 5GAGU 3DRRB 2UVWA 3IGNA 4ANCA 1RGVA 3A3OB 2V2QA 1T3NA 4JV5J 3MEGB 1C2PA 1AW0A 2RU3A 5A2QU 1FWKA 4PPZA 2VU5A 4QIVA 4QIWD 4MTPA 2HNZB 2J76E 4C8ZA 2ACMA 2DNQA 4ENOA 4JUZA 4ED8A 1TFYA 1YKWA 3RB4A 4IH7A 3PO5A 4QJVA 1MROB 2KXHA 4CLSA 5IXUA 4NLGA 2JSXA 4DL3A 4DPWA 1U45A 2AT1B 4NLTA 4WFYA 1JLAB 4JV1A 4EI2A 1OPZA 2OEMA 4JI4J 1YLXA 3AFGA 3H8YA 1RK8A 2V4QA 4YS2A 1M1KT 1VMBA 2DYAA 1K0VA 4ELUA 3BREA 4KJIA 3V4IA 1NZ8A 3VVTA 2WVCA 1BMQB 1OQ3A 1KLMB 4KE5A 1NJZA 1NSAA 2OPSA 1TP7A 3MAAB 3CO0P 2HMIA 2CADA 1T05A 4ILLA 2FQQB 5DDOC 2KVQE 4ZN1A 2ASYA 1SKWA 3I87A 3QRPA 1RSCA 3DGPB 1UPPA 1LWEA 2LU2A 3BBCA 1FX2A 2I5JB 2E5JA 4HI2A 3CIMA 1S5ZA 1I6JA 2MKHA 4MMOA 3HHNB 4MIBA 4ED1A 1X4EA 1U6FA 4G1QA 3W64A 2BRKA 1YWXA 2HHUA 4C3KA 2EVZA 4DF4A 2ASDA 3OPKA 3CTRA 1JMTA 2BJDA 3MCOA 4YB7A 3A3NB 2D3ZA 3PFOA 2KZZA 4GO7X 3HCXA 1HQ2A 3UCGA 1RAEB 4A8WA 4RWXA 1NHVA 3A8IA 3CW2C 3EWGA 3HSJA 1UVLA 1UFWA 3DRPB 4P52A 4W92B 1J5OB 2E1RA 3M05A 2DEIA 5KFDA 4LFCJ 2Z0GA 3KUEA 3R6LB 2MTLA 1N0VC 3GU0A 2WZ1A 2MHNA 1U48A 4QQBA 5KG3A 5I3UA 1UJ6A 4QIFA 3OHBA 3JSRA 3EZ5A 2HEKA 1YITS 4LSNA 4MT1A 2O66A 2D74B 5DGBA 2D3UA 4C4WA 3L7PA 4OMFG 4U7UK 2HFNA 2IDLA 3MMCB 4AXIA 3DLEB 1T9VA 3FRZA 4I56A 4K4WA 2YNGA 3NGRA 4JI2F 3A12A 2HNYA 3DGVA 2ZBCA 3CJQA 1F1BB 2ALYB 3EM1A 2CQ4A 3FNNA 2XM3A 4LRCA 4QU7A 1HR0J 1RWKB 2C3PA 2E7WA 3GYXB 3BKFA 4ES2A 2F40A 1OS5A 1VC5A 5E3AA 2R7WA 3BKUA 2V4JB 2FTRA 2RRAA 3RR8A 4Z7CA 2W2MP 1HKAA 5B0AA 2E44A 2E9TA 4MYTA 5D77A 3KNAA 4FYVB 5HVFA 4X4TA 3QWUA 4IOBA 1UWBA 4PKDB 5K8OA 3IS9B 2ZHBA 4ID5A 4QYZK 3N79A 2APOA 3K57A 1FDBA 2AGPA 1PJ5A 4BC9A 4XAKA 2YWHA 4DUYJ 3MPVA 3Q8YA 5CCLA 4OYWA 3MF5A 2DNZA 1XNRJ 3TRGA 3PJWA 3FBFA 5E41A 1IKXA 5DETA 1RP5A 4Q0BA 4AT1B 1N4LA 2KG0A 2RKIB 5KFXA 2FC9A 3OJSA 3JAMY 5DRKA 1B0VA 1R8HA 4N77A 2R2RA 3W9IA 4AFFA 4EBCA 1NKCA 3TUZC 3DKDA 1TKTA 2B7CB 4JV0A 5B0GA 5H9EK 3MEDB 4M5GA 5U47A 1QAIA 4KC5A 4FNIA 2F9JA 2OTJS 2YH0A 2GVZB 5KT3A 2ZOFA 4F4XA 2J9DE 4ZJQA 1VBKA 3HJVA 3VQTA 1G6BA 4DSKA 2BXJA 2A0FB 2QMWA 3RBDA 4YOEA 4ED5A 3IG1A 3TP2A 1U2RA 2WONA 2DJWA 3MZIA 3WDOA 4FXWA 4MKYA 2R2UA 1IKVB 4QCLA 1RT4B 2QTWA 2E66A 2P8IA 4MKAA 3V6HA 4IRKA 2FZGB 1SJ3P 2HFVA 3MPUB 1LQ9A 3OFFA 5KG1A 4G1IA 2CDQA 3U7JA 1HPZA 1WEZA 4LF8J 1QM9A 1JK9B 3HT0A 4CLUA 1N33J 2G13A 2J7KA 2KYXA 3HHLD 1D0EA 4YN3B 3PHEA 2E9RX 1VQOS 4B9TA 5DS7A 4ATNA 5K14A 4CO2A 1FXRA 4MYUA 4NEZA 3IXQA 3I0SA 2D69A 2DNKA 4LUBA 5D0RA 4W90B 4FPIA 1GT8A 4N47A 1Q8IA 1RT5A 1S1WB 3C15A 1HNXF 4A47A 2BOPA 2RDJA 2M7SA 2ERRA 3MD3A 5T41A 3HX9A 1ZAWA 4DR4J 1E6YB 3VAMA 1RTIB 3KK1A 1FNOA 5KFRA 1KVKA 5HAOA 3V6JA 4PQUA 3H5XA 1ITPA 4RKUC 4Q43A 4FKXA 2XLJA 4NZ7A 1N32F 2CAJA 5JJBA 4Q8FA 1U6ZA 2YKQA 4NZ6A 4C6AA 2QA2A 2DGQA 2DY9A 1H0HB 1W7WA 4J9NA 1RAGB 5HP1B 5LL6d 1KOOA 4UUWA 4X2BA 1XERA 4K0KF 1RISA 1FRJA 3N6LA 1QE1A 2FHMA 3WZ0A 4LFAJ 4P6QA 3CCUS 4OI6A 2K1RA 4RW7B 1U02A 3QFHA 3W8PA 3CIZA 2DB1A 2P2CB 4FN5A 3DRSB 2YWKA 4DV3J 3KLGB 1RYRA 1HWJA 3J7Z5 3DYAB 3EPIA 5LXYA 1X4AA 3L09A 3HP6A 3ZZZA 4DR6J 1B3TA 1RKIA 5KG7A 4LRBA 1IM4A 1MWYA 4B9LA 4C3MA 3O5TB 2GHWA 3UW1A 3PR4A 4Y3CA 4ELTA 1MMDA 5BXIA 1JIHA 2W4DA 3P5TL 4E8UA 5IZHA 4K59A 3FUYA 1KQGB 1NDPA 2ZHOA 2F7VA 2QLXA 2YWWA 2AGQA 3R6GB 1VBXA 3CCQS 4C98A 1H2TZ 1NH8A 2Y0SD 3THPA 5BR8J 1NJXA 2EFOA 4EO6A 2NCKL 4RW4B 1RHUB 2VPZB 2FPHX 5DDPC 1Y7PA 2L41A 4OHZA 5AXKA 1DTTB 4K4YA 4U9RA 5D0GA 3T6JA 4RUBA 4P7VA 2BJ7A 1HBMB 2MKJA 1T94A 2KB2A 3D6MB 2HQ3A 2AP6A 2AD9A 2DHHA 4K4VA 2KRBA 2E5IA 4M63A 2YNIA 4N7TA 1LXJA 3N28A 3RJMB 1Q5VA 2G1DA 3O3LA 2IRXA 3I6PA 4DL5A 1VC0A 2CWXA 3IMQJ 4Q44A 8AT1B 3PTWA 4DUTA 3K59A 2FJAB 1R7IA 1NKEA 3MCNA 4IH5A 2KXNB 4DF8A 4USMA 1R6VA 4ED3A 2ZBQA 4B3RF 2UUBJ 3HZGA 2ZD1A 3J7ZT 3SQOP 2V94A 3ZZYA 4DUZJ 4DSJA 4IRDA 2UXCJ 4ECVA 3UQSA 4IG3B 1ZAXA 2NXJA 4DI6A 3GG0A 2QZ8A 2HVEA 1S0OA 4F25A 3WIUA 2ILZA 2OPPA 2OLWA 4J9KA 2M52A 4IH6A 4I6YA 4I7FB 4P74A 5KFAA 4OZ5A 2PIIA 2GS8A 4IFYA 1FCAA 5HMXA 1BC6A 2DISA 4LF7F 3GFZA 4JI8F 3BGRA 3MHYA 4XTTA 3MM9A 4I2QA 4LSZB 3MMAA 2V63A 4M95A 3UD3P 2UUWA 4FF2A 4NRUA 4LVOP 3N6NA 4RO0A 2IAJB 4QWDA 4R0EA 4WBFA 1FXLA 1P9QC 4UOHA 2VG7A 4DZ6A 4DR7F 4Q5VA 3UNYA 4OHYA 5CYMA 1OJ4A 4MKBA 4C48A 3PYGA 1DJ0A 2DNNA 1NNDA 2KFZA 1ULRA 1S77D 5KG5A 4P10A 5E0OA 2XMWA 2AMCB 5EGYA 3HHLC 4JI6J 3TA0A 3V4IB 1H72C 2VUGA 1I51B 3CD6S 1U6BA 2DR5A 4L3KA 5IWAJ 2OPSB 3THVA 3W2VA 1LV5A 3EGNA 5GAHU 2HMIB 5A0YA 1SJ4P 2XI3A 5DZ7A 4ZVUB 2IJRA 2Q3PA 2YQ1A 3KDNA 3EGVA 2IVFB 1S97A 2H65B 4RNNA 2HSEB 2B0GA 2QLWA 1NRKA 3AD7C 4ZPTR 4QWEA 1LWEB 5B0FA 4QW8A 1J5EJ 5IFMA 3H5SA 4PWDA 1UEKA 2AYMA 2UXBF 3QATA 1BLUA 1X0FA 4NLXA 4G1QB 2EKNA 4LBIA 3GJQB 1WWHA 3QNWB 7AT1B 2K7KA 3Q8VA 2BQUA 2CPEA 5CZVA 5AT1B 2VFUA 2GHVC 3GIMA 3GSIA 2CG8A 1S0MA 3MM8A 2M4MA 2OP5A 4ID8A 4XDCA 4DV0F 2QJ3A 1T9XA 1ZBTA 4OX9J 4JV5F 4PG4A 3CCWA 3JAMU 1NU4A 4R8UA 1WI6A 1WC0A 3D1QA 1R0AA 2PT0A 2VF3A 5KFSA 1WHWA 5M2RA 3PG9A 3BV8A 2HG4A 2Z56B 3G2XA 3M8WA 3OLBA 1GH8A 3BSCA 4LSNB 2H5JB 1L3TA 3GSDA 1FRXA 3V81A 2SXLA 4JI4F 2PEBA 3NOGA 3HI9A 4QR2A 1GEHA 4RNMA 4I4BA 3IR7B 2EK6A 4P75A 2YNGB 2BW2A 3SIPB 3SFGA 4KH0B 3M2UA 2HNYB 3CCRS 3IBWA 2VZ9A 4ICLA 2CQ2A 2ZBPA 1QAJA 3IN5A 2CDRB 2HBYB 5JVGQ 3NWRA 4DWIA 3D28A 4RLEA 4J9QA 2D7SA 1QSLA 3GJSB
chains in the Genus database with same CATH topology
4TLRA 2WOMA 2ZC4A 1GQEA 1JLGB 3OTDA 4O0IA 2DNYA 1R8BA 1N36F 2XB2D 2HS0A 5AE3A 2KG1A 4ED7A 1NK8A 2JEJA 1RTDA 4ECSA 4B3SF 2DGWA 2R7VA 2X51A 2VG5B 3TAMA 1TK0A 4EU0A 1FEHA 3O8WA 2YKOA 4DSEA 3IWNC 2LXFA 3M2VA 3EXCX 4C11B 3KMSA 3B82A 4C8KA 4O3QA 1J5OA 2PDAA 1KFDA 3SEOA 1VHFA 3M2RA 4YR0A 4K4XA 3TNVA 1NO8A 1J2VA 1SXLA 1GAOA 1A9NB 3L95X 4OJHA 3AB4B 2AJFE 3M9MB 1TL1A 2C42A 1FJGF 1VC6A 2N82B 3QZ7A 3IRXB 2OFHX 1FD8A 3GZ7A 3C6UA 1VQLS 2YNHB 3KG0A 2CPDA 4Y28C 3RR7A 3LP0B 4NCGA 4DR2F 4RW8A 1JLCB 1ELOA 3DLGB 2V5HG 1N8RT 1A6LA 4ZMMA 1SIWB 2A3JA 3I82A 4RBVA 1UWBB 3OTCA 2ALZA 5IT0A 4KFBA 1YBAA 3MECB 4RW9A 4NL5A 4WF9Q 4HTJA 2XNQA 1SV5A 4A8YA 4Z37A 4DQPA 5F41A 1FKOA 1D8ZA 2DNOA 1YJUA 2RT3A 1HARA 4OHXA 4Y2MA 2RU9A 1FJEB 5KG2A 3P6YC 2L9NA 4NCBA 1S1TB 2ZZNA 2RD5C 3QAUA 1U1MA 2OTLS 4FXDA 5A2QY 1Q81T 5HL7Q 1S1XB 4BDPA 2DO0A 3MMCA 3MTKA 1B0PA 3NAIA 1SJFA 3UR3C 3BN7A 4LFCF 5ITHA 5SUHA 1IQTA 1TQLA 3DLEA 5DQGA 3CCJS 5HN0A 3HXMA 4DLGA 2PSZA 1N34F 2B3TB 3K2YA 4OI3A 2GMHA 1YRTA 3CB4A 3MCSA 3Q23A 4WZQA 1N0UA 1NK4A 3FEYB 4A8OA 2MYFA 1YHQS 4B9VA 2VQEF 4I7FA 5GAEU 4FYDA 2HHQA 5JVHQ 1HW9A 2GC8A 4WKYA 1U1KA 2HS4A 3O1LA 1IKXB 2DHSA 1WD6A 4LIWA 3MAHA 2B56A 4WTYA 2DT9A 5KFJA 1M5OC 4Q0BB 2MGZA 2W9BB 2HVHA 3DXBA 1RT7B 2ASJA 2MSSA 1QVFR 2C3UA 3SFUA 3QJJA 3NCRA 4HEA9 2M8HA 3H98A 1RKJA 1S7HA 2W9AA 1CVJA 4IYQA 2QO3A 4OQJA 4PG8A 1NB7A 1S1VB 3MXHP 1FVQA 1TKTB 2E1MC 5KFBA 2ZH9A 2G4BA 1S0NA 3OVSA 2IAJA 1S48A 5DQIA 3R5DA 1DZ5A 4X66F 2RH3A 4QIEA 4USIA 1LOUA 2N3LA 3OSNA 3M1VA 4ES3A 2ZJPQ 4MIWA 2V4JA 1M5HA 1L3KA 2HS3A 1XMBA 2MSTA 3SQGA 3M8SA 3MI7X 1Q8LA 1S9FA 4WFZA 1U25A 4NLYA 2PD1A 2W7OA 2J0QD 4ILMA 2CJQA 3VAFA 2WW8A 4LT6A 3LF0A 1YIJS 3UPFA 5AXNA 2NR0A 4ECQA 3I5AA 3G6ES 2RRNA 3GIIA 2XGQA 2JL9A 4HDHA 2YX1A 1RTJA 1WTFA 3NBPB 3LP1B 6FDRA 2CJKA 2PI5A 3T5HA 1SJ1A 3OXLA 3GB0A 3M30B 4ETXA 1IQZA 2JC0A 4EWTA 2B9YA 5J2MA 2XULA 2FLPA 5B0EA 1LFWA 2I1RA 3IG1B 3DHWC 4PUOB 5KFKA 2YTCA 1JLBB 2R7XA 3Q22A 4IOAQ 3IS9A 4AL6A 4F02A 3BM7A 1FA0A 3U1LA 1H2VZ 2W25A 4ZDNA 1WELA 4RBUA 3PY8A 2VL1A 3CGIA 3D1OA 5EX0A 2VPWB 1Y4ZB 4YR2A 1HBOB 5L9XA 1KSPA 3PV8A 4X4RA 3TA1A 2U2FA 2JLGA 3H2LA 2XO7A 1NK6A 1VK3A 4R0JA 2VBXA 2ASLA 4ED6A 2OD4A 3J7YI 2FVPA 3M8QA 4KSEB 1UJ5A 3M8RA 3NLCA 2HZCA 4F4ZA 2FY1A 1JNRB 5A8WA 3HKWA 4ZS6A 3Q2SC 2HRYA 2MQMA 2AJ1A 2LYVA 2YKPA 3H5YA 3K5MA 4B08A 3VAGA 1HPZB 4J5OA 2ZNYA 4NLWA 1FO1A 2XGPA 5KAKA 2VD3A 3ZZUA 2EFNA 2GX8A 3NP5A 4TXSA 2QE5A 4TU7A 2PA8D 2IC3B 3I32A 3ZZTA 5KT6A 4DN0A 1BQMB 6FD1A 5F8LA 3NS6A 1R89A 3QJLA 4QWCA 1GXLA 3ZZ0A 5CH7B 3H40A 1TKDA 1DURA 1XR5A 3CWJA 3KLIB 4LQ9A 2PC6A 3MMBA 1RJJA 4MFBA 2V8DA 2ZUGA 2L3MA 2VH7A 1ZPVA 3ENWA 5K14B 1P8GA 3IWLA 3PRDA 4MJKA 2RKIA 1RT1B 1XNQF 2I8EA 2JLFA 3K58A 3RAQA 4ZPCA 3NS5A 3JYTA 4NLVA 4OFZA 1QY7A 1BQNB 1RWUA 3JSBA 3FCHA 3I0SB 2Q1LA 2OPQB 3OFEA 3DOMA 1X4FA 2QIFA 5GAGI 4AL7A 3HZEA 3PXGa 2DNRA 1N5VA 2AJ0A 4HDGA 4F50A 2F9DA 4KIAA 2CPFA 4DS5A 1MNEA 1VRUB 2JZ5A 2IMWP 2XMMA 2HGMA 4NYOA 1W2BR 3MEDA 2GGPB 2WB4A 3T9NA 1RT5B 2IHR1 2KT2A 2GW8A 2DNLA 2VKRA 1DBDA 3GG1A 3PFEA 4ZLPA 1XNRF 2UUAF 2R7UA 1YQHA 2F8MA 2ZE2A 4J9MA 3PW7A 2XMKA 4N56A 3PEJA 4U6PA 5EDWA 1ZM2A 1G1XA 4YUDA 5T7LA 5J2QB 2R8JA 2DNHA 3KK2B 5DQHA 3UI3A 2X1FA 2DIVA 2EFPA 3PKYA 4AQYF 3KK1B 4A8XA 3OTBA 2HHVA 3CCTA 2RUGA 2LMIA 2QSFA 4HT5A 4O44B 4OJ1A 5DG9A 3OVBA 4PCQA 1QUVA 3G86A 2D41A 3OR2A 2C3YA 3CUNA 1JJ4A 2XMJA 2P9CA 3B78A 4TU8A 1UAWA 2JFDA 4YB5A 2BQ3A 2O3DA 2DH7A 3MM7A 5EX3A 2YWGA 3NWGA 1TVRB 3CVKA 3BZQA 5KFVA 5A8RB 2FJEB 3OL7A 2CKWA 3I0RB 2IJNA 2IBKA 2DGUA 1HYSB 1RT4A 3VTIA 3GMGA 5LMUF 1ZPWX 5HROA 4XO0A 4B02A 1ZH5A 3JSMB 3K5OA 3QO9B 1E6VA 2BA9A 3CXCR 4DV5F 2OSRA 1QVGR 1JWWA 4OIXA 3TR5A 3ETOA 5I42B 1V3ZA 2E5LF 1IKYB 2B51A 3DLKB 2VFSA 3V5RA 1LW2A 2YKMA 3DMJB 4CIOA 1EETB 1JLQA 5DO2A 1Q86T 1SQEA 4XPEA 2CQBA 4I64A 3E8OA 4HH0A 3RW6A 4IO9Q 2NYIA 2RQMA 2PI4A 3DI6B 2JEGA 1CQNA 3FEZA 5F0UA 3OL6A 2COLA 3FSXA 1X5SA 3TQ1A 3RB3A 4NRTA 5AXLA 3OXFA 2IM2A 1FDNA 4HTIA 3ULHA 2FC8A 2Q6BA 3CJ5A 3NAHA 3UWTA 1KONA 3BQ2A 4XK8C 4QR1A 1DTQA 2XY5A 3KTQA 4AE5A 2FJVA 3M8PA 5FD1A 1BQXA 1QE1B 2A10A 2KFNA 3H5UA 5C5JA 7FDRA 1FKPB 3GYNA 3CDEA 4RX6A 2K1RB 3GQCA 5FIIA 4BHQA 2EKYA 4ECYA 3QGIA 4DV7F 2BE2B 5D3GB 2PGCA 3MR3A 4OI1A 3PIPQ 2FHJA 1G2EA 2KVIA 3CPWR 2VBYA 1SL1A 2ROEA 2WK4A 4ZP7A 1RYSA 2VBWA 1PC5A 1HBUA 1D3WA 1OIAA 3RYLA 2E5GA 2HHXA 3GWCA 2KYZA 1HBNB 5G0RB 5M2UA 2V9KA 2V9WA 3IGVA 4FS2A 4ZP9A 1DFDA 4IO1A 2YKAA 1TZ0A 2CQHA 1HL6A 3DM2B 2DHXA 1JKHA 2MY7A 2FIUA 3T19A 1JX4A 1VIXA 2E5HA 1FXDA 4KHMA 2XZWA 4NZ0A 4OX7A 3ICLA 2HFOA 2AF6A 4CH0S 2AQ4A 5KFPA 2DIUA 1S1WA 2R7OA 1S6PA 5KFTA 2W9CB 1JNZB 3QLHB 1MU2A 3CF5Q 2M88A 4Y00A 2DCLA 2XBPA 3W2WB 3HMJG 2I2YA 1N33F 1TK5A 3MOZA 2XG8A 1S6UA 3HVTB 4IFVA 1GX6A 2OSQA 3SSRA 2M0GB 2J0WA 3S01A 2K7JA 3NNHA 4DR3F 2IMOA 1WF0A 3UFCX 2RS8A 2XLIA 2D9PA 2ZH1A 4DL2A 4RZRA 4C11A 3VWSA 3OFGA 2RJZA 3I5CA 2CPJA 2BM1A 1VQMS 1E6YA 1RT3B 4ECXA 1H2UX 1RTIA 2CQPA 3FRYA 2H9ZA 1DLOA 5IQ6A 1VQPS 4ERDA 1WHYA 4YDDB 3D1HA 1N5TA 1X0PA 1Q82T 4K4UA 2UVUA 4N8OA 2XWYA 4C8LA 1VIOA 3AB2B 4DEZA 1S6QB 4C7QA 2JEIA 3R5AA 3IRXA 2FJXA 4OLPA 4LSLA 2HWHA 3AA9A 3VAHA 1YJ9S 2FDNA 2O01C 1NK5A 3S7RA 3LP0A 4QIGA 2NLWA 1C4CA 4M1KA 2CPZA 2FJBB 1YSJA 4IG0A 5KT7A 2R8KA 3HM9A 4PXCA 2M9KA 1NKBA 4PXBA 1C0UA 1T05B 5J1PA 2QT7A 3KYLA 2R7QA 1FK9B 1HMVA 2W4PA 5BYRA 2J8AA 2WB1D 4PPDA 2ZH4A 3BEGB 5EWGA 1Y3JA 5HP1A 4BS2A 5HO4A 3CDAA 4DFKA 2V4RA 4BC7A 4DOZA 2HAIA 2ZITA 3AY0A 1CC8A 2FVSA 5L1KA 1IKWB 4DR4F 3QPIA 4C8YA 5LJ3Y 2J6TA 4I6WA 2RE1A 1Z2ZA 2RF2A 3M4XA 2HHWA 1KQSR 1UEVA 1YTYA 4IUFA 3PW4A 5F8NA 5F8MA 4TYAA 3H4BA 3WX4A 1HWLA 4IKAA 2GQCA 4ECUA 1XC9A 4K4TA 2LEAA 4UUXA 2KT5A 2P6SA 3M6UA 5CD4H 1NK9A 3B4DA 3V6KA 4NOHA 4RW7A 2AWZA 2BYCA 2MQPA 4PG5A 4DL4A 2B5JB 4ZA1A 4ZK7M 2KHDA 2AW0A 1N6QB 3U27A 1VQ8S 1XK8A 3DRSA 4YEAA 2CQ3A 4DLEA 1S9EB 4I68A 1N56A 2VPYB 3E51A 1RTHA 4UOCA 5KTQA 3KLGA 2YNIB 2W8LA 3RRGA 5A6WA 1KHVA 3ENVA 4JI7F 2W9BA 1YJRA 2FVRA 5CZXA 4TY8A 2A1BA 3TW0A 2GNKA 4ZCIA 5C42B 1FKAF 3IR5B 5EHHA 4DFMA 5AXMA 4AXJA 2RS2A 3DOLB 3OVAA 1X4CA 1UA0A 5AE2A 2VA3A 4ETZA 3N01A 5B09A 1S1VA 1Y3KA 5KFIA 1URRA 5DG8A 3CJKA 3S8SA 3FGVA 5ADZA 1KVJA 2DRAA 1VLYA 1H7XA 4ZKAA 1ZTWA 3CULA 2VA2A 1F60B 5IM0B 4F8RA 5A6PA 2AGOA 4LFAF 1IUJA 3MM5B 5B0DA 2J9DA 3KLFA 1KN6A 3M6WA 5CYQB 3RRKA 1X9MA 4D3HA 4ITSA 3JTNA 4OZNA 1JLFB 2LA4A 1YI2S 2OMLA 5L39A 3BQ1A 2QV6A 2OAUA 1IJEB 2LQ9A 2OD6A 3Q24A 5SZTA 3BQ0A 2CQIA 2VKZG 3OBIA 4HH1A 1RA6A 2EW9A 5F0WA 5I3UB 2CZVC 2I0XA 3DDKA 3D2WA 4DV3F 1R6YA 5LT5A 1JLEB 4ED2A 2MDAA 3NBPA 4L3NA 1T7PA 4J9OA 4ZHRA 3JTOA 4PXEA 4X4OA 5HI7A 2IYIA 2WSFC 4N8NA 3DFEA 4YY3F 4F2RA 1I1GA 4Y65A 3PX6A 2NXUA 2ZD1B 3BDPA 2ZH5A 4DR6F 3BSNA 2CJ9A 4USJC 5D4OA 4PUOA 1F5AA 1GXUA 4C2MA 3RTVA 2F4VF 3BF4A 1N5YA 4CO0A 1RQ0A 4ZPDA 2YNFB 4LF4F 1S9GA 3TUIC 1HWUA 5KT4A 3PZPA 1C0TA 1R8PA 3B4MA 3UDCA 4IR1A 1HBOA 1MMLA 1UFLA 1ZM9A 3M9OB 4MAKA 4DQRA 4PG7A 4RW4A 2CZ4A 3VAJA 2M2BA 4OZ1A 1X9WA 4LF9F 1FDDA 1RI7A 2FHJD 2CVEA 1VBZA 2RRBA 2OPPB 2JEFA 3MTJA 1DTTA 2XSFA 2OPRB 3SDEB 3BSOA 3K0JA 2HNDA 3CJ0A 2MQQA 2WBMA 2EK1A 2OMOA 3CMAS 4ALZA 5L38A 3RU0A 1UA1A 3FSYA 3KJVB 4G6VB 3MOJB 2B4PA 1H38A 2HWIA 2KFYA 4NPOA 1N48A 2NREA 5I4MA 3FFIA 3ISZA 4NYPA 1HBMA 3DLHA 1NHUA 4WYWA 2LDIA 1DAXA 4OI2A 3IAS9 4NMLA 4CO3A 1QSYA 3LH2S 4KB7A 4B3OB 3MR5A 4CTAB 2IM1A 5AJ3F 3T1AA 4OX8A 2DD8S 2U1AA 3C46A 4H4OA 3G8SA 1G7CB 3MM9B 4I2QB 3EGZA 1TV6B 3MUVP 1T8EA 3MMAB 1S0VA 1REVA 1H6KX 1ZZFA 3DDNA 2J5AA 4B17A 5KOWA 2C28A 5GAHI 4TU9A 2K8GA 4IRCA 4MH8A 2EG1A 1OQ6A 5BR8F 2ZNZA 4X4PA 3CD5A 3HHLB 3LOUA 2JWNA 1RT2A 1Z4UA 1HWIA 2HLUA 4OJ3A 1O0PA 4CH7A 2LXIA 1DARA 3GV7B 1HI0P 1VK8A 3QIPA 2ZFHA 2VG7B 3NG8A 4LF5F 2F8HA 3KHGA 4EBEA 3C2PA 1C1CA 5LSOA 1Y5NB 2EPIA 2HIQA 2JLEA 2KJVA 3O2IA 3N5FA 3NRBA 5L8RC 5FJ4A 1UP1A 5CYMB 1LW0A 2GGPA 2HQIA 5A8KA 4DSIA 2C2EA 2C2DA 4ZOSA 2BBEA 2UP1A 4AL5A 5T14A 5DDQC 2HRUA 2QYCA 1FJCA 1HHSA 4J9RA 2GCFA 1RAJA 2RILA 2JDJA 3TA2A 1WF1A 2DGOA