5L9NA

Structure of uridylylated glnb from escherichia coli bound to atp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
92
Chain Sequence
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of T-loop modification on the PII-signalling protein: structure of uridylylated Escherichia coli GlnB bound to ATP.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II 1
total genus 22
structure length 92
sequence length 109
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l9nA00
4D3HA 1NZAA 3M05A 4RWWA 3TA1A 4CO5A 4CO2A 4ZK7M 1HWUA 1XK8A 4USHA 4OZNA 2GW8A 3LF0A 1UL3A 3N5BA 2O67A 4YB6A 1UKUA 4USJC 1UMJA 5DS7A 2DCLA 2NUHA 4WK3A 3NCQA 3BZQA 3OPKA 2RD5C 5DRKA 4Y65A 4RLEA 1H3DA 1V3SA 1O51A 1NH8A 1QY7A 4CNYA 5D4NA 3L7PA 4YB7A 2XZWA 1KR4A 2J9DA 4NYPA 2J9DE 4CO0A 5D4LA 3DFEA 5D4PA 4C3LA 3NCPA 2XBPA 4OZJA 3MHYA 1UFLA 3AA8A 4RWXA 2ZFHA 3CE8A 2JJ4D 2EG2A 1VHFA 3AH6A 3TA2A 4YB5A 2GNKA 1Q1KA 2V5HG 3O8WA 4OZLA 4CNZA 3X3UA 2PIIA 4NYOA 5L9NA 4CO3A 4E98A 2GX8A 2XG8A 2J9EA 2CZ4A 3GSDA 2ZOMA 2Z0GA 1J2VA 1GNKA 2NS1B 4WK1A 1PILA 2EG1A 4R25A 2VD3A 1V6HA 4IYQA 4C3KA 1V3RA 3HLUA 1P1LA 1VFJA 3T9ZA 4D3GA 1O5JA 3O5TB 3AHPA 2NUUG 5D4OA 4AFFA 4USIA 2XULA 2E66A 2O66A 1V9OA 1NAQA 2J9CA 4C3MA 4CO1A 3TA0A 4CO4A 3NCRA 1OSCA 4Y6IA 4RX6A 3AA9A 1NH7A
chains in the Genus database with same CATH superfamily
4RBUA 3ET6A 4RWWA 1HQUB 5KT6A 1KNZA 1PSDA 3QT7A 3ETOA 2KT5A 3BREA 3LOUA 3QT5A 5AXKA 1JLAA 1XK8A 3K5PA 2RDJA 2UUCJ 4HACB 2C3MA 3LF0A 3CCUS 2FVRA 3NGTA 4LRDA 2VJVA 1CQMA 4ETXA 1KS2A 4PABA 3B78A 4GKKJ 1HBMA 2LEBA 4DV3F 1X9MA 2HFZA 3GFZA 4CRJA 2HWHA 1SKSA 3R97A 2GGPB 4QYRA 2X1GA 1S1VB 4NLWA 1CS4B 1H72C 2OPQB 3BZQA 3MPWA 4FYVB 1RWMB 5ETLA 4QW8A 4EZ6A 1NBEB 2BUNA 2HHTA 3UD5A 1FWKA 3NKYA 5D15A 5DRKA 4IFVA 2G2OA 2GO8A 3W2VA 5KT7A 2C2EA 1S1UA 1WF2A 3GFXA 1TK8A 5ETRA 4O0NA 3BBCA 3OXLA 4W4MA 4DSKA 2A18A 2VUGA 3OLAA 4R5PA 2FHJD 1WC5A 2OI2A 3MGJA 2HFSA 3A4TA 3FBBA 1L3TA 2EBGA 1S1WB 1BQNB 3BGUA 2GS8A 3BPDA 3HT0A 3IWXA 3O44A 2PFFB 3GU0A 3OT9A 2RU9A 1IR0A 1C0TB 4A8KA 4RUCA 4PRFA 3KK3A 1TKXA 1FKPB 2WCXA 3AXKA 4C8NA 3RRGA 2HVHA 4P72A 1O8BA 2C28A 3NGUA 4CO0A 1YRXA 1NEEA 3LO3A 2HGNA 3ENWA 4RW6A 5A8RA 3HVTA 2MQNA 1HBOB 1PJ5A 1ZPWX 2DGSA 1VC5A 4KH1B 5J1PA 2HMIB 5KG3A 4ILLA 3VV2B 3LP1B 3DU6A 1TV6B 4B3TJ 2VG5A 2HQCA 1O0PA 1YJ9S 2UXCF 2FZKB 3CD0A 4JV5F 1S4FA 1X4AA 3TA2A 1X4BA 1HBUA 5C42A 2ABYA 1R89A 1S59A 3J7A1 4X4OA 3T3FA 1KLNA 3PYGA 5B0DA 3Q8SB 3C2PA 4C9DA 3JS9A 1YQHA 2CQBA 2L08A 2VBXA 2OKQA 3OXGA 3IP0A 4E98A 7FDRA 3K5MA 2AYEA 1HKAA 3IO1A 1SC6A 2DITA 2CZ4A 2KVQE 3BDEA 3DLKB 4WPAA 2Z0GA 3VGSA 1EAYC 1GNKA 2RSQA 2NS1B 1IM6A 3HF5A 4ZIVA 2R8IA 2AYMA 2HVEA 2H4YB 4MIWA 4OHXA 2E1PA 1GT8A 1P6TA 4O4GA 4KYZA 3WX8A 4UQGA 2UU9J 3NNAA 1YHQS 3GONA 4LSLB 2HVDA 3W5ZA 4UOCA 1R8BA 2I6WA 3GPAA 3AB2B 3AOAA 3GIIA 2PO4A 2AJQA 4JV5J 4DX5A 2F63A 3DXSX 4PZVA 3PYDA 4P75A 1K9MT 1N32J 1EKRA 4I2PB 2B56A 3DXBA 3PIOQ 5CHCB 1TFYA 3TRGA 1K44A 1C1BA 1RCXB 5KFOA 2KM8B 4A8MP 1QJHA 2C3UA 2DR8A 4JI6J 3CMES 2A1BA 3EXCX 3KWMA 3N6NA 3D66A 1Q95G 3PO5A 1S57A 3QLHB 2VPYB 2BRKA 1FE0A 3MM5A 2HK2A 3RRKA 4CYUA 4NCGA 1T05B 4M5JA 2FVQA 2FJDB 4IQXA 3DLEB 1NZ8A 4QWCA 1RT7B 4X4RA 3P6YC 2KDOA 2CWKA 3F44A 2WW4A 3HHDA 4NLTA 5IWAJ 3BQ0A 1PGZA 3QJLA 4Q2LA 4RO0A 3M8ZA 4NLPA 3R7SB 4IOCQ 1RTHB 5BYSA 3W5XA 4F04B 2VB6A 2YWFA 1RADB 4M5DB 4YDDB 4QWDA 3PM9A 1NK6A 2H48B 4B9NA 1J27A 3WC2A 3K2YA 3MM9B 4KKOA 1KN6A 1JLCA 3PFEA 8AT1B 5C2GA 1CJTB 1RZMA 1AFIA 2B4VA 4F2SA 3ZTOA 1BQMB 1VMBA 2OMOA 1RLDA 1JMTA 1BQXA 1U2CA 2BJ9A 3EWGA 2V2KA 3FKBA 3LW5C 4KFBB 4UZCA 4USMA 2KJWA 2YKNA 1RHKB 1VQOS 2R8KA 1WOOA 3D6MB 3ILOA 2CNKB 3OTCA 5B0FA 1IKVB 3D28A 3KHLA 3KJFB 5LMUJ 4YFUA 1VBYA 4ZPDA 4NLVA 3VCDA 4CCHA 1MROA 2B9WA 3TJAA 1KDNA 2AYGA 1QD1A 2D41A 4WIIA 3Q8QB 3J7YU 4PEOA 2KXHA 4X62F 3PW4A 2WONA 3PJWA 5HL7Q 1YJTA 3BR8A 2HWTA 1YTYA 1CS4A 2V2QA 3KK1B 4DQRA 2CQ0A 5A6WA 2H5IB 3R8YA 1UFKA 1H3DA 2MLZA 2BMBA 4CM2A 4UOGA 4B3TF 2G1HA 3PV8A 1UA1A 1PYOB 2DGQA 5BXIA 5DG8A 5D0EA 2QGFB 4K8RA 5KTQA 1M5VC 4C8KA 4K4ZA 1RAHB 4L73A 4RL1A 4C98A 3PIPQ 1T94A 1GXUA 1Y3KA 3PW7A 2CQHA 4J9RA 1BQNA 5C7PA 1M1HA 1F0XA 1FKOA 1HFEL 1NHVA 2FIUA 1Y0HA 2J7WA 2RVJA 1R43A 3I0SA 1CJVB 4PAAA 5MLCV 2QLBB 3QYYA 5KG0A 1EHWA 1NKEA 3K0JA 4WFZA 2VQFF 3NCPA 5KFIA 3ISZA 3D7SB 1T3OA 3EVOA 1FNMA 3BR9A 1EARA 2PEHA 1RE1B 3CIMA 3J7Z5 4ECRA 4UW2A 1J5OB 2JEJA 1TL3A 3DRPB 2ZJRQ 3RAMA 3UI3A 2DRAA 3OR1B 1TQLA 3DHXA 3DDIA 2QYGA 4MKAA 4TYBA 3KHGA 2YH0A 2Z2ZA 3OSNA 2PIIA 2G2YA 2CZVC 1Y10A 2B4OA 3IR7B 3DU5A 3U1NA 1Q4RA 2AP6A 2DO0A 3BBBA 3C6UB 1HI8A 1SUQB 2W01A 3I9ZA 3VZIA 3DI6B 4FYXB 4X84A 1ITPA 5JVHQ 2DGOA 2XTJP 5FDLA 5HLFA 2M52A 2F65A 1JLGB 1IVZA 4LF6J 3LP0A 4DV6J 1RLCL 1HR0F 2HBYB 3NBPB 1UVNA 3DKDA 2YQ3A 4ZVEA 5D8HB 3GTYX 2CJKA 1P1TA 1PC4A 3O3LA 3ZZPA 4J9SA 3SFGA 4QU6A 2ATLA 3NMAA 2ZH9A 3SCLE 1RWPB 2MKJA 1UVKA 4H4KC 2RNEA 4U6PA 3C16A 4ED8A 3A3PB 5KT2A 3MUTP 3FMBA 3LQVA 2F7VA 1R31A 2KTQA 1R8AA 4RNNA 1RTJA 3KLFB 5F8GA 4ICLB 4YR0A 4ILMA 3UDEA 2HMIA 4IG0B 4CLWA 4Z7YA 2ASDA 1XTZA 2QMXA 1C4AA 2ZVSA 2IVYA 3E01A 1LOUA 5KFHA 4DL0C 1NAQA 2YWEA 2XLKA 4ID5A 5KFVA 3CWJA 5AJ3F 2CPZA 1JJ4A 3UNGC 1RT4B 2KU7A 3WX4A 4GC7A 1CULA 1KHVA 4J9MA 2ASLA 4OIXA 3BYRA 3HDSA 3BSOA 1PAUB 1T9VA 4HTJA 1QE1A 5JMNA 2M88A 2DKOB 2IA0A 5EX0A 3D1HA 1PG5B 4OYPA 3SSSA 2C3PA 1XC9A 1KBRA 1WKKA 2WB1D 1RT3B 4BBYA 4Y2IA 3HFVA 1CJKA 2E1MC 3ZNUA 1QUVA 1CJTA 3FFIB 2YNHA 1L3KA 4PWWA 2HHHF 1HNWJ 3FGVA 1SVDA 2HNZA 2X51A 4F4WA 4YB6A 1RKIA 2DNHA 4JYAF 4WE1B 4QU7A 4DPWA 2NSBA 2P9GA 1UMJA 2ZZMA 2HQIA 1SXLA 2CG4A 3R5GA 4JOUA 2EXUA 1N6QB 2KFZA 4AQYF 2MMYA 1IBKJ 1F5BA 5J2QA 3J7AN 1T9WA 2NUHA 4DR4J 1MSWD 3C15B 2DEJA 3IS9B 3MEKA 1VJWA 1TAUA 3CCZA 2PFDA 2FLLA 1TKZA 2BM0A 2QA2A 4ANCA 3JTPA 1TKTA 1NK0A 2CA9A 5KFYA 3LPEA 2QL9B 3UN3A 3MCMA 4ID8A 4B3RJ 4WP8A 3W64A 1LW2B 5JXSA 4YQWA 2XGPA 1FJEB 1F3VA 4I2QB 2VICA 2BJEA 2GAGC 2HIYA 3OFEA 3OTBA 1OYEA 4NLYA 2VA3A 2HS4A 1BC6A 3GB0A 2AJ1A 1HD0A 4DMZA 1I94F 2UXBF 4CLKA 2OP5A 3PZPA 2FZCB 2OEJA 1RAEB 3GSIA 3T1YJ 4Q7AA 1H6KX 4MJKA 1EB0A 1I3OB 1K0TA 5IM0B 4DR6F 2MQOA 5GAEU 2E7XA 4DSLA 2AZ3A 2UZAA 4ZVPB 3ENQA 2P5VA 3GE9A 4K4TA 1DHMA 2YKMB 1VI7A 2DEIA 1LWXA 2WOMA 8RUCA 5HSPA 3TAMA 2IRUA 4K0KJ 1KP6A 1BQMA 2EG2A 5HN0A 1N36J 3CCES 2HNDA 2EW9A 1A7GE 4ZHRA 1TAQA 3SFUA 3W2WA 2AIRB 4B3SF 1OQ3A 2P6TA 1LFPA 2I8EA 2IAJB 3Q83A 1FRIA 4MIBA 4USKA 3VQTA 4DWIA 1S99A 2WHOA 2E5GA 1PBUA 1WI6A 2RIJA 2WZ1A 3RR8A 4JI7J 2BKOA 4JI1F 1BY9A 4RJVA 1TL5A 1IR1A 1SUQA 3CF5Q 4YN3B 4CLYA 5D78A 1BMQB 4NEYA 2RRNA 5LM7E 2DTJA 3I4HX 4CQ1A 4DDFA 1WEZA 3LH2S 5F41A 1HQ2A 1FE4A 1OS5A 2LYVA 1SJ4P 1XNRF 3NGSA 3WHIA 1NK9A 1FD8A 2F4VF 2YBVA 1N36F 3R7BB 1RA7A 5M2UA 1HD1A 3QSYB 3RJMB 4MYUA 2KZMA 1X5TA 2IDEA 4JI0F 2QZ8A 2MTLA 3I31A 5SZTA 1MWZA 2W2NP 2L9DA 4DL7A 1SKRA 3W66A 2UXDJ 3AD9C 3CEDA 3G82A 3M30B 4F7VA 1HHQA 3OUYA 4G1IA 1SIZA 4PYAA 2XCAA 2IYIA 1WTBA 1Q16B 4IOAQ 3QLHA 1GTEA 5KG1A 3BO2A 2PMHA 1X5PA 1SC3B 1XBWA 3EPGA 4DCPB 1R6VA 4USIA 1RGVA 1VQYA 2E66A 1BD6A 2O66A 3DGVA 1DTQB 4PQAA 4JI6F 3M8QB 5E5NA 3VAMA 2FJXA 2ZNZA 2V9KA 1TL3B 1PAEX 2EFGA 2VPZB 2WBRA 3DRPA 3T19A 3O6QA 5DG7A 2E7VA 1SL1A 3BN4A 1HWLA 3TA0A 3JB9k 3NCRA 3MMBA 1UJ4A 3G6YA 1QSLA 4BC7A 1HIYA 3SDEA 1OY8A 3C6UA 2MJNA 3GYGA 2MPUA 4O3NA 4FN5A 4TNOA 2HAFA 3RGIA 4V19X 4BLGA 2M3DA 3JYTA 3TR5A 4OZNA 2V69A 3DLGB 4LFBF 3G71S 1Z2LA 4PYDA 5K14B 2JL9A 4Q0BA 4XIUA 3B8HA 1T9XA 3MAQA 3A13A 4DV7F 3UD3P 5C25A 2DNLA 3D0HE 4LF1A 2O3DA 3OQ2A 1ZOTA 5T14A 4IFYB 3PVXA 1H2VZ 3AOBA 1JLFB 4ANEA 3KK1A 4B3OA 4PXEA 4X64J 3BDPA 4OHYA 2EFOA 4H4MA 3UDVA 3C16B 5CCMA 3UW1A 1XNQJ 2ZBRA 1NMEB 3CJKB 4EWTA 2DNMA 3VHQA 1T03B 3G8SA 1NJYA 1SL0A 5K20B 2J0XA 3B4MA 4GRSA 2I5JA 4P73A 1Y5LB 4KH0B 5EWGA 2IPOB 3RUBL 1F1BB 3L95X 4OZ5A 1W2IA 3OL9A 1O51A 3MECA 6FD1A 4ZVOB 4K5RA 4WP9A 4ED2A 3DM2A 3PO4A 3OVBA 5L38A 2CNLB 4B17A 1X5SA 3QATA 2KN4A 1RAAB 1L3SA 5E33A 4UUXA 4YB7A 1S77D 2XZWA 1QM9A 3K59A 2FGOA 1WHYA 4MAKA 2OIHA 1VRQC 5KFRA 5ETNA 3PKMA 4DEZA 4ZVGA 2WSCC 1VQLS 2DYAA 3QGHA 1FWLA 1Q79A 2VV5A 2YWKA 5DDQC 5KFJA 3V6DA 1WEYA 2HWIA 4RNOA 3QJPA 3F73A 3R5DA 1LWFB 2YKAA 3AA8A 4I0WA 4ZN3A 5KG5A 2ZD1B 4KQZA 4OX9J 3NAIA 2V9WA 2B5JB 3W3SA 4RW4B 4RW9B 4QIEA 1XMOJ 2HVIA 5KOWA 1XR7A 3I9V9 2HFOA 2QL7B 2AEJA 4Y34A 2HRTA 2GVDA 3MOJB 3Q8PB 3N6LA 2ZH3A 4DV6F 4RBTA 4CTAA 3SV3A 4ED7A 1ZM9A 5HANA 3X3UA 1JXLA 1MMNA 2NCKL 2RT3A 3ILJA 4NYOA 3G6XA 2ROPA 1N6QA 1RABB 4IDKB 1GMUA 1TUVA 2LDIA 3VGTA 3H40A 4EBDA 2DPJA 3KOAA 1FRKA 1M5HA 2E1CA 2HFNA 2J76E 2PDAA 4MMOA 2AMCB 8ATCB 2RHSB 3LAMA 5ADZA 2UUCF 3FUYA 4E2FB 1HNXJ 1VQNS 1EZZB 2DGWA 1P9YA 1FRHA 3MFHA 3IMQJ 1ZAVA 3GZ7A 3NG8A 4KB7A 2NREA 3JTNA 2E9TA 4N41A 2UXCJ 1FNXH 1QVFR 3HVAA 4XTTA 3MUMP 3MEDA 1RACB 2K06A 3EGWB 3WIUA 4N56A 4QYZJ 1O6XA 1U09A 1F60B 3T9NA 1M1GA 1K47A 1S7IA 2PGCA 4U8YA 1H73A 4CH0S 4F0HA 5IS2A 2BQUA 4X64F 3MPVA 4UT4A 3Q86A 4N47A 3HT3A 2AX1A 1LNQA 2B43A 2VQFJ 1Y5NB 2QT7A 1FJCA 1LWEA 1BGXT 1YG0A 3MM8A 3AHPA 5LXRA 5DQGA 2NUUG 1GMWA 4ECXA 3NY0A 3IR5B 2JNJA 4QIWD 2XHWA 3PRDA 2JFDA 3IC1A 4OX7A 4Y3CA 3NS7B 4OI1A 3TAMB 4N76A 5I42B 1ZPVA 1RHQB 1WC3A 2Z4PA 3HX9A 3TVZA 1C0TA 2ZZNA 4ZJQA 2DY9A 4QR0A 4RW7A 2D9PA 3RBZA 3TJ9A 4FXVA 3RB3A 3PRVA 2Z2YB 2B6AB 1Z2ZA 2IAJA 3NL0A 1SJ1A 3GFHA 2R3VA 1HBOA 4WFNQ 5AE3A 2XI2A 3MMBB 3CPWR 4NMLA 2R2UA 2LFVA 3M05A 5HMYA 4X62J 1C4CA 1XN9A 3HHLB 3IBWA 4I7FB 5A0YB 4RPFA 3PEHA 1TL1B 3TEHB 2RS2A 4DUZF 1UL3A 3OTDA 2N7CA 1T02A 5IQQA 2KVIA 2GCFA 5E2QA 1KTVA 1GMVA 1Y7PA 2XMKA 4O3SA 4N8NA 2HK3A 3KLIB 2RH3A 3M6UA 1DY3A 3LP2A 1TKTB 1U0SA 1UEUA 2ALYB 4P7TA 2XMMA 3KLHA 1WHXA 4NXMF 3QRPA 4YDXA 1U1KA 1JLFA 2OPSB 4Y65A 2H65B 1TELA 4CT9A 1S9GA 4YHHJ 2F4VJ 2DXDA 1JQGA 3CNQP 1RKJA 1S0VA 4I2QA 5AXNA 1OIAA 1QUPA 2R4FA 3BO3A 1WF1A 1XMBA 4JV0A 3VVUA 1BHNA 2RDIA 2DGTA 3EXYA 1I1GA 3TZYA 5KT3A 3M2VA 5D0RA 5KG7A 1TMMA 2D3O1 1YZ7A 2CZ9A 2IA6A 2CKWA 3L09A 5J1NA 5KG4A 2BQRA 2MKHA 5HI7A 2W8KA 2ZH2A 3BGRB 3MF5A 4O4RA 5DJBA 4JI1J 4ZPBA 2IJRA 4DFJA 1DAXA 5E41A 4DF4A 4DG1A 1T8EA 5AXMA 2EBEA 1NRKA 3D0GE 5KFDA 2XSFA 1KVIA 3DOMB 4CH7A 2F3JA 3QGPA 3V6DB 3JSMB 3R5CA 1L3VA 3ZFVA 4XPEA 1SB6A 4PXCA 3CCVS 4Q44A 4NA2A 2W9AA 1DQAA 4CP5A 1BUXA 1ZAXA 2G13A 1TL7A 3I4PA 4ZPTR 4DFKA 4ZVSB 4DV1J 1CEZA 4CH1A 2QMUB 5JUMA 1HWJA 4OX6A 1DZ5A 1BWEA 1RT1B 2R2RA 1JJ2R 3MTKA 4OZ1A 1IKWA 3WQPA 2ASYA 2ROGA 3ZNJ1 4B3OB 3GMGA 2CQGA 1JK9B 1Q8IA 2CXEA 1S6QA 4LRFA 4BWJA 3SSQA 2BYCA 1H7WA 3KDNA 4DPOA 1OWXA 1JNZB 1YDLA 2RUGA 1QSSA 1F2HA 1LEOA 3PYFA 1P9QC 3AXMA 3DCAA 3DYAB 2PD1A 4XDCA 4GC6A 3FCWA 2DXEA 2RJZA 3NS5A 4B9VA 4ZLPA 3C46A 1N54B 4K4YA 2QN6B 2E7WA 1UP1A 4CLLA 5CABA 4ZLNA 2BKPA 1AFJA 2DXFA 3CUNA 1DARA 2G9OA 3DM2B 2ACYA 1P1LA 5EWFA 1RT5B 4I6YA 2SXLA 4NXMJ 4PPDA 1YITS 5D6GA 1T11A 2GVZB 2C1EB 1M5SA 1B4SA 2FVPA 2FJAB 2MKIA 1IXKA 1ULRA 5K8NA 3M8WA 1F5CA 4ERDA 2G0CA 2IDLA 4CLSA 1K0VA 1X4GA 2B8QA 1TZ0A 1K1SA 4B02A 4DUZJ 2VG6A 3BM7A 2V0NA 3LALA 3AODA 3LGHA 3T1AA 4JYAJ 3O2IA 2KO1A 3TI0A 3IWLA 4UUWA 4DV5F 3MR6A 1TK0A 3HO1A 2YX7A 4OV1A 2W7AA 4F0MA 1SPBP 2ZBIA 5B0EA 2W8LA 3IXQA 3UVJB 1JLQA 2LA4A 4KGMA 4UQTA 2GVDB 2QMWA 4OYWA 4DXLA 2KG0A 3HD1A 5HROB 2AD9A 4M5HA 4V19J 4Y6IA 4ZA1A 4ES3A 2DPIA 3R3TA 2B3TB 3H4DA 1CSJA 2DHXA 1NH7A 3C6TA 3EPIA 4PQUB 1HMVA 2OAUA 1X4FA 4G6VB 3BKUA 3N01A 4DZ6A 4OX8A 1VYAA 1WNEA 4NRUA 3UDCA 4CO5A 2HHSA 4O0IA 1M0SA 2VBYA 4JUZA 3ITHA 3D3CJ 2FPHX 2VQEF 1N34F 1QSYA 4B9TA 4DS5A 2CPFA 4NLGA 3A1YG 2O67A 2CJYB 5C25B 4B9LA 4TQRA 4OJ1A 2XO7A 1ZETA 3ISNC 3FMWA 3GV8B 3FK4A 1NDCA 3BH7B 3UO0A 5KT4A 4CM0A 3J81Y 1HHTP 2VPXB 4KT0C 2BJDA 2UUBF 4DU7A 4E0DA 4DR3J 5D0HA 1Y5IB 5HP1B 2R7WA 2E1RA 2LXIA 4FNIA 4L3KA 2BOPA 1NK8A 2FJVA 1QTMA 2HNYA 3EDQB 1RTDB 3GYXB 2I5JB 3J7YI 4MKYA 3KDOA 2H9ZA 1KQGB 3ELHA 3V6KA 3NBPA 4OZ3A 4U96A 4ZOSA 3FZBA 4JI5J 3GR0A 2U2FA 3DRSA 3QAEA 3QQCD 1R0AB 2Y8WA 3CT9A 2A10A 3C14B 1F6TA 1R8HA 2H5JB 1ZS6A 2F4FA 4AXIA 3OW2R 4UY85 1DFDA 5CYMB 1XMQF 2LLZA 4WYWA 1B7FA 2BXJA 4OYOA 3Q89A 1RU1A 2J9DA 4ZVTB 2DGVA 2VQEJ 2CVIA 2GHPA 2NYHA 2VDHA 1U6BA 1RTHA 5J2NB 4KHMA 2QLXA 4OZJA 4UOHA 5HAOA 3U7JA 3D1OA 2X7IA 2YQ0A 4FXDA 3BGOP 4O3QA 1Q8LA 2C3YA 1RISA 3M32A 5AXLA 3TO8A 3R1LA 1YI2S 1UZDA 2ZUAA 2KFNA 4DS4A 3QAUA 2NYIA 2CQPA 3HHLA 2VKZG 2IBKA 3CO0P 2B0GA 2J6UA 2AW0A 1MN9A 1HNVB 2FJEB 1HNZF 4U8VA 3I96A 3PJXA 3D0IE 3HFZB 2OTLS 1FFWB 4LRBA 1UTAA 4DV3J 2QIFA 3Q8VA 2J8AA 4M1KA 3OBIA 2OEKA 3QFHA 2GX8A 1GK8A 1UW9A 2H54B 4H4OA 4X4PA 4ZLJA 3UWTA 2EC2A 1PYTA 2H4WB 3LTOA 2AU0A 3I5BA 1IKWB 3PEJA 4L74A 6FDRA 4WK1A 1XMQJ 1Y00A 3IBCB 1A0OB 2ZHOA 4WCEQ 2UVVA 2HNZB 5D0GA 3DRRB 3J7ZT 2R2TA 4DV4F 2B9YA 4USWA 3PX4A 4I6WA 3MR7A 2ZM6F 1IBLJ 4ZN1A 4WKYA 3I5AA 2VIHA 3IWNC 4YEAA 5LSOA 5EUHA 4L6V3 2OPRA 4K2JA 3L3CA 2COLA 1E6VA 3SCKE 1RAJA 4OYXA 3QRQA 4IG3B 1U8WA 4DX7A 5F3ZA 3OL7A 2JX2A 2ZNYA 2MQMA 3QT6A 4XDDA 3RB4A 2EKNA 1NK4A 4EK2A 3H98A 1WSVA 2QE5A 4C48A 2L48A 5FLXY 1QTNB 1R8CA 1NO8A 1O5JA 2DGUA 2HS0A 3N9UC 3BBFA 5AT1B 3PXGa 3VGUA 4A8YA 1DBDA 2YKQA 2WW8A 4G1PA 3R6LB 3G6ES 4IH5A 3TAPA 2QX0A 2YPYA 1HQEA 5CZVA 2UP1A 4ENOA 2LDYA 5DETA 4LQ9A 1R27B 4YY3F 4F2RA 4QWBA 3Q22A 3M2UB 4ES2A 4DQQA 5A2QY 4ECZA 3DLBA 2D3ZA 1X0PA 4X2BA 2J7UA 1TUWA 2KB2A 2VFTA 1IJFB 2FY8A 4P2FA 2HAIA 2HHXA 3F41A 4USTA 1SH0A 2CQIA 2LVWA 4D3HA 3ZZRA 3CW2C 2V4QA 2B7BB 2XMWA 3DI6A 1GTHA 1TL1A 1SC4B 2GAHC 5HMXA 4RKUC 4WP3A 2E5HA 2JDJA 1EQ0A 3NWGA 1WD6A 2MQPA 3RW6A 4A8FA 4QR1A 3PHEA 2BE7D 3RAXA 4DR6J 4MFBA 3EGVA 4OI6A 4M5GA 3WDOA 4PG8A 3TZZA 2H3EB 1KSPA 4UF4A 5KFTA 4L3NA 4USJC 1NSQA 4CDIA 3FEXB 5B0GA 5L1IA 3CO9A 1FESA 1JXVA 5BYQA 4NCAA 2NZ4A 1RAIB 4C8YA 3BQ1A 3M6XA 1S0OA 2B9EA 2OPSA 4U95A 4URSA 3PX6A 3TJ8A 1NB7A 1S9GB 2GGPA 2RD5C 1KRPA 3SQGA 4RW8B 3V4MA 4FF4A 1RBLA 2OPQA 2BM1A 3UQSA 1N0UA 5C2CA 5IC6B 3M7VA 1H98A 4ZP8A 1UPMB 3CXCR 1S1TA 2HIQA 3KLFA 2OD6A 3BQ2A 5J1EB 4M94A 1CBKA 4IO1A 2PE8A 3KLVA 4FVCA 2CG8A 4PG5A 4HKQA 1GAOA 1VRTA 3TNVA 4CLZA 2WVFA 3IN5A 4G65A 2IIHA 4CNYA 1HARA 4A8WA 1TFWA 4R5PB 3MR5A 1RAGB 2E5IA 4TLRA 3HSJA 2V8DA 3M6VA 1Q5VA 2HS3A 4MH8A 3MTJA 3DOMA 3D6FB 2RS8A 1LK5A 2PT0A 3UCGA 1Q86T 4HTIA 4TN2A 4NXNF 3PR4A 3G96A 1K8AT 3BSCA 3MHYA 1NJIT 1JNRB 4PUOB 2BOAA 4Q5VA 2ZH5A 3BSAA 3BO4A 3HFKA 4I6AA 2FQQB 1ZA1B 1WDTA 4ZPAA 5HBMA 2XC9A 1RBOB 1CG2A 2NXJA 1UFWA 3DOLA 2V34A 2GZOA 2KT3A 4OL8A 1ZBTA 4CLUA 1DRZA 4K2XA 2DVIA 1S76D 4WE1A 1VK8A 4ZJOA 2V50A 1WG5A 1M5KC 1B99A 3S01A 2D9OA 4YP3A 5E3AA 2DISA 1X7VA 5GMKa 4WTOB 4ECUA 2NZCA 3JSYA 4KTQA 1K73T 2A2DA 3LUYA 2M7SA 2D69A 3B54A 2BX6A 2PI4A 5KFAA 2C2OB 1VQ6S 3DLGA 2MSSA 2XZTB 3BGFA 2J0QD 2NXEA 3GILA 1QAXA 2IC3B 4M8LA 3FQKA 3ZTPA 4QPXA 1WC1A 4Z7CA 2M4MA 4K7QA 4OYBA 2I38A 1RHUB 1L5UA 4DQSA 3NNHA 5LMNF 1PC5A 1UJ5A 2XY7A 4LF8F 1IQZA 5CAAA 1IBLF 3Q2TC 2VC0A 5CA5A 2YH1A 2E9ZA 4NLXA 5DG9A 2GIRA 1KQSR 5IT9U 4DR5F 2V94A 2AGPA 1MLAA 1D9DA 2WAQD 1X4CA 2BACA 2BVZA 1KC8T 3PNIA 1RBAA 2UVWA 3MUVP 3G8TA 4OFZA 2ZITA 3M32B 1XR5A 2LQ5A 4OYIA 5D4OA 1RK8A 3ADAC 2YKMA 2APOA 4AL7A 3TAQA 4PG6A 2PA8D 1AXQA 4GKJJ 2GMLA 4X4NA 2XYPB 5HJYA 5ETVA 1CJUA 2RF2B 5BJRA 5KFXA 5CYQA 3GIJA 1TMJA 1KLMA 2YNIB 3V5RA 2OFGX 4CYUB 1IKXB 2NXCA 3E2EA 4KJIA 1C2PA 3W8PA 2ZKUA 4X65J 3MCNA 3EE3A 2CQ2A 2L9NA 2E5LF 5HK4A 4KR0B 2GMJA 5A8RB 1SJRA 2FB0A 2DBBA 4P9SA 4YUDA 4BDPA 3LAKA 1FA0A 4IO9Q 2OHDA 1U02A 1NNDA 4M5DA 3T6BA 4KPYA 4JI3F 1WG4A 2XY6A 4W90B 1U6FA 3QIPB 3V6HA 1VC6A 4KGZB 1G6BA 1RDRA 1RWKB 3N5BA 4DR1J 4LF4J 2GO9A 4LJMA 3T5JA 2IM0A 2OH2A 4J7CA 4O44B 3THTA 2QLWA 4DV2J 3SYZA 2MHNA 4DV0F 1NLKL 4TXSA 4TU7A 2VF3A 1YBTA 5DS7A 1QVGR 4NE9C 4DPXA 3QO9B 3NCQA 2OPRB 3W2VB 1MWQA 3GCWP 2CJAA 1HW8A 3FJ2A 4U7UK 1WG1A 3ENVA 5EHHA 2AQ4A 1HNWF 1M1KT 4X4VA 3MD1A 1F2GA 2H5EA 1XNQF 1F5AA 4P2MA 2CPDA 1AYEA 2D74B 3S7RA 5A8KA 4JI4F 4Q8EA 1MW7A 4DV4J 2X1BA 2BZ2A 1T95A 5KFSA 4DL3A 4PPZA 1VQ5S 3TEGA 1RWVB 2DRDA 1TTHB 2Y1JA 4LUBA 4TY8A 2JLGA 1N8RT 1NH8A 4GVLA 1EJ7L 3KK3B 3LWLA 2V8PA 4DV7J 4LF7J 1EP4A 4J9VA 2K2PA 3NWRA 2XSJB 3HHEA 2EWHA 4RW6B 5EGYA 3D9BA 2C2NA 1HYSA 5ETSA 2DJWA 1XIQA 2OUGA 2XWYA 4NRTA 5F0UA 2KM8C 3T41A 2ZH8A 4ZCKA 2JVOA 3EUNA 3H25A 3H8YA 3SCJE 4JI2F 2IFXA 5L1LA 4EU0A 3PHTA 2XMTA 4ZPVR 2R7SA 2XYGB 1MWYA 1V5VA 2CIMA 4TLQA 2HQFA 4YB5A 1WDDA 1RT7A 2R8GA 1N5SA 1D8YA 4N77A 1VDHA 1UZHA 3PW5A 1N88A 4RW7B 2CPIA 4NPOA 4NX9A 5LJ3Y 4RUAA 1X9SA 3B82A 2PA3A 4H4OB 4UOFA 3NEKA 3OR2A 5G4DA 5RUBA 4X4SA 2KYXA 2WVCA 2WRMA 4EUVA 1W7WA 1NJXA 2HQDA 2LQ8A 1LQ9A 3GIMA 1IR2A 4JV2A 2AV5A 3KLEA 1S9FA 1TL4A 2UXDF 2CWXA 2ZHAA 5KFZA 3ZZZA 5HLFB 5J1EA 3OSPA 2YNFB 1C0UB 3HKZD 4ATNA 2C2KB 4DR2J 2OJ3A 4P52A 1YKWA 1U48A 1FVSA 3I87A 3KLIA 1D9AA 1VIOA 3AAWB 3KJNB 4Z2XA 2NPFA 2GC8A 2DNQA 4ILRA 4KV8B 4TU9A 2WONB 1X60A 2QA1A 1A6LA 1RU2A 5MAOA 3H42A 2LA6A 2FTRA 1ZZNA 3G87A 1SJFA 4TY9A 5LMUF 2WK4A 4ZP6A 3K17A 1P8GA 3I5CA 5L9XA 1MU2A 4EMDA 4ZPCA 3O5TB 1FEHA 4HH0A 1HQEB 1N5QA 1S79A 1TUGB 1W25A 4J9QA 3AJ1A 3IAM9 2MQQA 1N34J 2ZBPA 2CNOB 2X3GA 2VBZA 4IG0A 2YNGB 3MMAB 4OZ0A 2DD8S 3CJ5A 2FC8A 4RU2A 2M8DB 3Q0AA 3CDUA 4WWSA 4DUYF 1HW9A 4QWAA 4B3SJ 1HHSA 3NOCA 4KAIA 4TYAA 2HYIB 1CJUB 4DQIA 1RT2A 2LCWA 3H2LA 3I0SB 1KTQA 1TU0B 4ECYA 1F9HA 1BLUA 2FGCA 1GQEA 4NLUA 4Q8FA 5IWAF 2AJFE 4XPCA 4LF5J 1VCTA 3FNNA 1NK7A 3AT1B 2W2QP 1NZAA 1YJ7A 1RWNB 3TA1A 1YJNS 1U1OA 4FS2A 4ZVQB 1U1MA 4UZBA 2KZZA 2D3OR 2GHVC 5IOLA 2OLWA 5F0WA 3GJRB 5HO4A 3SQOP 3M8YA 2BA9A 4GVBB 3N79A 3CCJS 4QIGA 5HQ8A 2EEYA 2OFHX 4OYAA 2CPEA 3US5A 2C42A 3MEDB 4ED1A 3M8PA 2LXFA 3PDNA 2KHDA 5M2RA 4F36A 3E8OA 4ED5A 1N32F 3QWUA 3THPA 4MIAA 4QW9A 4NWBA 3OFHA 3KJVA 4R8UA 3PRBA 1NKBA 2Y3YA 3HULA 4CT8A 2VFVA 4Y2KA 2CJ9A 1TKZB 4KRWA 3TVYA 1R6YA 1KVKA 4K4SA 1S12A 1H2UX 3ISND 3JAMY 2FLPA 4LF2A 2HW3A 1APSA 3PR5B 3Q23A 1CQNA 1X4EA 3H90A 2I9SA 4NLRA 5A8KB 1PCAA 2FJBB 1E6YA 3ZZTA 2ZJQQ 1XERA 3S1TA 5FLXU 1HI0P 4Q2MA 1IKYA 2Y8YA 3CJ8A 4DUTA 5I42A 2IY5B 4L72B 1GMWD 2BW2A 2UUTA 3L7PA 3HK2A 1DQ8A 1JX4A 1KR4A 2XMVA 1EP4B 1I5OB 2R7QA 2VZ9A 3UR0A 2QC3A 1VBKA 2XM3A 1AW0A 5FD1A 5CD4H 1AT1B 2XBPA 4J9OA 1T7PA 1D3WA 4DI6A 3OHBA 1RHMB 1RHRB 2RILA 3UPFA 1RP5A 1WC0A 1KD1T 2KKHA 1S5ZA 1XQIA 1YGYA 2Q6BA 2A0FB 2RAQA 5ETPA 5K8MA 4ID5B 2RKIA 1ZM2A 2K1RA 1QAJA 3MPDA 1B3TA 2OEMA 3MAAB 2JH3A 2KT2A 1JB0C 3F56A 1AUSL 2LEPA 4GO7X 4CNZA 2RRAA 4HHUA 4LBHA 2UVUA 5KFUA 3D67A 3I55S 2W9CA 4EEYA 2BR0A 2HZAA 2RB7A 1QE1B 2GQ2A 2J9EA 4HHHA 3AB4B 5B0AA 2MKYA 1LW0A 4EO6A 1KQKA 4RNFA 3KLHB 3T1YF 2R7VA 3K57A 2J7KA 1PYSB 2MHEA 2YVSA 3VF0B 2QRRA 4XK8C 4DPYA 3LGMA 3ITHB 2UXBJ 2EG1A 1XJWB 4F25A 4QIFA 4LBIA 2LQ9A 3IGVA 3OFGA 5GAHU 5D3GA 2Z2MA 4NZ0A 3UDLA 2KG1A 3MEEB 3UN5A 3JXOA 3HJFA 1MMDA 2V68A 2YNFA 3AQPA 4P71A 3G2XA 2IJFA 3TYTA 4JI2J 1SIWB 1SH3A 1DTTB 1CC8A 3FEZA 4YY3J 1X9WA 1Y4ZB 3BGRA 4WF9Q 2F8HA 4MKBA 4DL5A 1RTJB 2ZWPA 1RYSA 1Q81T 4GO5X 1HNXF 1RTDA 1MNEA 1SQFA 5F8IA 3RG6A 3U1MA 9ATCB 3BKFA 5HP1A 3EMTA 5T7LB 3THVA 5KFKA 4P2XA 3G82B 4Y2MA 2E29A 4C11A 2OGUA 2Z8QA 3CC7S 3DGPB 4LVNP 3ZTQA 3FZ2A 4E8UA 3KK2B 2OSQA 5LSRA 4HH1A 3EZUA 1U7LA 4FKYA 5I3UA 2XULA 3VGVA 3G86A 2MDAA 3CSKA 2G2ZA 2YNGA 3ETMA 3KKFA 3MMAA 5EX3A 4LFCJ 4CO1A 3RRHA 4C97A 5I4MA 4JI8J 3H5XA 1VQ8S 2KFYA 3MFIA 4HLBA 2X3DA 2GJ2A 1CVJA 3GP9A 1RT1A 3H20A 3CJ3A 3DMJB 5IXUA 3HHLD 1SKUB 2RU3A 1ACMB 2LP4A 2QSWA 4X4UA 5KG6A 5LL6d 3NGDA 4ANDA 3BPSP 1S6PA 3W62A 1EETB 2PI5A 2GQCA 3NRBA 1H7XA 4USHA 1NJWA 4C8ZA 3ZZ0A 2GW8A 1NDKA 2QG9B 2QSFA 2DH9A 4DV2F 5DLFA 5DGAA 1JLAB 2FHMA 2R42A 4NASA 5C24A 2QTWA 2XMAA 1U1QA 1U2FA 3OD2A 4LREA 5L8RC 1FK9B 2EI5A 5ETQA 3QO9A 1B0PA 2CVEA 3C15A 2XHCA 3MZIA 3ZZUA 1RSCA 3EX7B 2LEAA 2ILYA 2MGZB 3TANA 4LMZA 3LGNA 3AJ2A 4BWMA 3TP2A 3RZAA 2XNRA 2RQKA 3B4DA 2LQBA 3I6PA 2L9WA 2OTJS 2HLTA 4RLEA 1NDPA 1RWWB 3HVRA 2ADCA 2FLNA 1LW2A 4AE5A 4J91A 4L76A 3K5LA 4WKRA 3MCOA 4LSZB 3M9MB 1SQGA 1S1UB 4J5OA 2UUAF 1S4EA 1XR6A 4FZVA 1B0TA 2JC1A 3W9JA 4F3MA 2QA4G 1D9FA 4C8LA 2Q6CA 1NKCA 1RXOB 2JRSA 2YKOA 5J2MA 1HBNB 1NSPA 1HWKA 1YBUA 4LIWA 2FYXA 1ZM3A 2ROEA 3IA0A 4Y2AA 3WC0A 4PWDB 4ZS6A 3IGNA 3QZ7A 3OVAA 4DCOB 2YPZA 4FPRA 2FHOB 1VLOA 3RYLA 4F67A 1N33J 5F9LA 1AUDA 4HHJA 1DURA 4PQUA 3V81B 1HMVB 2CNNB 3R9LA 4IRDA 2M8HA 2ILZA 1U1RA 2CJBA 3ICLA 2ACMA 2ZE2B 2ZFHA 3P4UB 4HR2A 3LP1A 4AYBD 2ZD1A 1S7HA 4DL6A 4B08A 2B5JA 2ZBQA 2GNKA 1F3FA 2X1AA 1NPPA 2W4CA 1SI9A 2YKPA 4M5KA 3ZZOA 2RKIB 2JWNA 2CDRB 3IM9A 1DLOB 4J9UE 5ETTA 1P27B 5JJBA 2N82B 5JVGQ 2CPHA 2DY1A 1Q7YT 4C4WA 2ZOMA 1NXIA 4MK8A 5L46A 2HQ3A 4IR1A 2BDPA 4A8OA 2ZOFA 4N8OA 1UA0A 2DK2A 5F8MA 1QLNA 3OTEA 3SMZA 3GJSB 2V8GA 4F3QA 3Q8RB 1N56A 1WI8A 2LU1A 1HNIA 1M90T 2XLIA 2XLJA 1GXTA 1V3ZA 4O4GB 2AEMA 3EJMA 4MK9A 5GAGI 3AJDA 1DQ9A 3DRSB 4F4ZA 1NK5A 2W4DA 3EVMA 3C14A 4RR5A 1IKYB 2CQ3A 5GAHI 1LFWA 2AF6A 3N0VA 3EGNA 1VFJA 1BWVA 1Q5YA 5E7OB 4DUYJ 5CQGA 2ATCB 3MM6B 5F8NA 1OSDA 5M2PA 4I2PA 4NOHA 2IBOA 2ZH7A 2C2RA 3PG9A 1LV5A 1SQEA 2DNKA 3DLLQ 4ECTA 1REVA 2VC1A 3HJVA 1YBAA 3IR6B 3M4XA 3MD3A 3P5BP 5HMWA 1FRLA 1G7CB 1ZH5A 4LFBJ 4F4XA 3M8QA 4AFFA 3MECB 2NPIA 3MM8B 3DGPA 4OV6A 5IC4B 3KK2A 4LFCF 4Y00A 1VS3A 1RT2B 1FRMA 5F8JA 2AZ1A 5C42B 3SZ2A 2AJ2A 3L7OA 2RQCA 4M63A 2BJ1A 4O23A 3J80U 3J81j 1IBMJ 3ZXWA 1S9EA 1YZ6A 4WU3A 4ZDNA 1XWLA 2W9CB 1HQUA 4HDGA 3PY8A 4J90A 2CADA 2EFVA 4B9SA 4MT1A 4RW4A 3A12A 3CJSA 4ZK7M 1HWUA 2CQ4A 3QMQA 2HZVA 3SCIE 3DOLB 5K14A 2RRBA 2Y1IA 2HSEB 1WELA 2P9CA 2V8VA 3NAHA 1EETA 4QJVA 4CIOA 2J0WA 4JP8A 2HBZB 4OI2A 1HBMB 1N5YA 1I51B 3QSIA 4F8RA 3H4BA 3AFGA 2Y1LB 4B9MA 2R7TA 4LSLA 2HG4A 4LF4F 5C5JA 3M8PB 3OL8A 1OY6A 5KFPA 4IDKA 4NI2A 3IG1B 4H4MB 3CJRA 3QGIA 4JI3J 5I3QA 2BABA 5DZ7A 4KC5A 3P49B 4B3RF 3O1LA 2DR7A 4A8XA 3NMRA 1FJ7A 4C0BA 3NP5A 4X66J 3QRRA 4DJBA 1RAFB 3LA0A 3DLHA 3G4SS 3E51A 3HSDA 3EZOA 4HT7A 1F9EB 3KMSA 1S1WA 3HKWA 4ZPWR 4C6AA 5DQHA 3WIVA 1Q0NA 4TQSA 2IMOA 3AD8C 3I0RA 3CD6S 1YX2A 2G0JA 2CJQA 2FUG9 3DHWC 5LXYA 4JI7F 2PEBA 1S6OA 3GCXP 3EVWA 2OMLA 4C8OA 1FTRA 3TX0A 1FRXA 1KEKA 5D4LA 4IOBA 2IMWP 4PWDA 3M1VA 2LKZA 1JJHA 1LWEB 1YWXA 2XYHB 3HZGA 3MCSA 3GJQB 4WFXA 5E3QA 5IT0A 3J80Y 4JI5F 2YQ1A 1X5OA 4KY3A 5B08A 4URGA 4PR6A 3PKYA 3CE8A 2JJ4D 2K1RB 1K1QA 1HL6A 4P10A 2MSTA 2J6TA 1TR0A 2QFIA 4FDFA 1FDAA 4CTAB 1B0VA 4DPUA 1IKXA 2HGMA 3V4IA 3O8WA 3TUPA 4OLOA 4ED3A 2UUBJ 3MXHP 3DLKA 4R0EA 1LW0B 3V2UC 4ECQA 1YK9A 3CC2S 3VQSA 5GAEI 1KKHA 5DM7Q 1J2VA 3HHLC 1I94J 3U02A 5LOQA 4O3PA 2VJUA 1PILA 3CGIA 3QIPA 4LIRA 4O3OA 4IQMA 4PXBA 3GIKA 3HXMA 3CULA 1S6UA 2FLOA 4ES1A 5D3GB 2DNOA 4OYMA 4KGKA 2XS7A 2LXUA 2W1BA 3RBDA 1UVMA 3DNCA 3H59A 5ETOA 3E3XA 2IHR1 2DHHA 1S72S 1VRTB 2MXYA 4V1Ak 1AA1B 4DSFA 4RU9A 4X65F 3CDBA 3HLUA 1VQMS 4Y0FA 5IV3A 3FSIA 4OHWA 1IN0A 4FP9A 3T6JA 1Q8BA 2KHCA 3FC9A 1LWCA 1VRUB 3UE2A 1SL2A 5CXTA 4W92B 3U1LA 2VODA 1UW4A 1J5EJ 2VOOA 1Q7LB 4DN0A 3NLCA 2R8JA 1OMSA 2QLJB 4C7QA 2YTCA 4DV5J 4NZ7A 4OHZA 4D3GA 4DU8A 4GKKF 2JVRA 1Y11A 4LSNA 2PSZA 5H9FJ 1FX2A 5HQLA 5I3UB 1KWMA 3K5OA 4AD6A 2HHHJ 4FF3A 4Z37A 4FS1A 3B6BA 1AZSB 1FVQA 5IZHA 1V5IB 2XWXA 5J2PB 4DR5J 5A76A 1R0BG 2DO4A 2XSJA 5A6PA 4B9UA 1ZZFA 2BJ3A 2GHWA 3MMCA 4S0MA 4CO4A 2AGQA 2GJIA 1JLQB 4PKDB 3C3LA 4QCLA 2MY7A 4RUHA 4WZQA 1JLBB 2MZSA 3CMQA 1CULB 1WOPA 1UEVA 3LWMA 1RQ0A 1QAYA 2QA4S 2QFJA 3OXFA 3JSMA 3HI9A 4HDHA 2O1PA 2WVEA 3QNWB 1EIYB 4M95A 3PJ9A 5LJ5Y 3FBEA 1JLGA 5G0RB 2XCPA 1RT3A 1FK9A 1FXDA 2MEWA 3LP0B 5HQMA 1ICEB 2JLFA 3FFIA 2N4CA 5F9NA 4ED0A 1MROB 3CC4S 2RE1A 3T1HJ 4ELVA 4UY8T 4YOEA 4DR7J 1C1CB 1FXRA 1UCNA 3J81U 3TZXA 1IUJA 5DO2A 2DCLA 4WK3A 4YR2A 1GEHA 3UD4P 3G9CA 5HVHA 3R27A 1RAOA 3AY0A 3DN9A 4XO0A 2HHWA 3CJTA 4CZCA 3BN7A 1FWPA 2YX1A 3M8SA 1SV5A 2DH8A 3CCLS 2M2BA 3L4BC 2BJ8A 1RTIB 1ZTTA 2XQCA 1IWAA 1T9UA 2EKYA 2VPWB 4JI8F 1X31C 2HBQB 4EBEA 2O5DA 2B4UA 4QYZK 3M2RA 4OJHA 2ZDPA 2ZZTA 1FNOA 4NMXA 1HBNA 2DRBA 4Q45A 2P2CB 1XEZA 3K8VA 4OJGA 5CH7B 1YRTA 4I1TA 1W2BR 2VG7A 3UR3C 3BH6B 2KXNB 4ER8A 4ELUA 2N3LA 2HRUA 2MQ8A 5F8LA 2GA7A 3SBMA 4YMEA 4FNHA 1SH2A 1VC0A 4F02A 1RT4A 3FRYA 1WEXA 1FEEA 3N4WA 1VQ9S 1HWIA 4I68A 1WC4A 2W9BB 4CLPA 2F5GA 1DJ0A 1VJQA 2WVDA 3WBZA 2VHGA 1FD2A 4ELTA 4ZVUB 4BC9A 4WXWA 2NQPA 4ZVRB 3NNCA 2J8SA 4X66F 1S97A 2CUYA 2HRYA 2RMLA 3OR1A 1VHFA 2WOMB 3FBFA 2KXFA 2Y1RI 2YNHB 2ZKTA 4FPIA 3UVJA 3KLGA 4JV1A 1BXNA 3W60A 4G1QA 4F26A 2HNDB 4KHRA 4O44A 3PW0A 2Y0BB 3CIZA 2MB0B 2NXUA 1HLWA 2HKEA 2B7CB 2UV8G 5HVFA 3M9NB 4K4UA 3A8KA 1HA1A 4PCQA 1X4HA 2PC6A 5L9NA 5H9FK 1H0HB 2XG8A 3C6TB 3KNAA 3QJJA 3LANA 4KGXB 1B7YB 3N6MA 1N0VC 4QZVB 2VBWA 2GMHA 3MURP 4DF8A 2JOQA 2QEXS 4LFAF 5DLGA 4OJ3A 3C19A 3KG1A 3BKTA 3H0PA 4FBUA 2VD3A 2V2ZA 4L75A 4P7VA 2C3OA 5GVQA 2A6MA 3FRZA 5B09A 3K58A 4C3KA 2VFRA 2DNPA 2ASJA 4JI0J 2DGXA 3DRRA 4EI2A 4N7TA 1IBMF 2WBMA 3F0NA 1U8SA 7AT1B 2GV1A 3BB5A 4J9NA 3GFYA 4A48A 3UCUP 2DHAA 3HD2A 4FYWB 3CDWA 3MI7X 4HVZA 4IH6A 4DFMA 3JAMU 2N7YA 4IG3A 4ICLA 1FDNA 4OI4A 1HPZB 1S1XB 2Z56B 5IM0A 1RCOB 1N33F 2EK6A 2VONA 1GXLA 4QOTA 4CWBA 3E01B 5BYRA 2OPPB 3TOQA 2JZ5A 5BR8J 3H5YA 2MKCA 2XMJA 2OSRA 3Q8YA 2ZH1A 1CLFA 4DLEA 1RT6B 1RHJB 2DT9A 1AB8A 4RUBA 3CMAS 2DNNA 1VQ7S 3GV5B 4DOZA 1FDDA 1WHVA 2A3JA 2J9CA 1DTQA 2RQ4A 4H54A 4ZHRB 1TKXB 1L3UA 2ZEJA 3POTA 2HZCA 3V4IB 4W98A 1UVJA 1FX4A 1FHTA 1ELOA 3ENAA 2MZJA 2GQQA 2MQLA 4PXDA 2BE9B 1FO1A 2LU2A 3GG0A 3TW0A 1U45A 4NA3A 1SJQA 3V81A 1AROP 3PACA 4K4WA 1OJ4A 2OELA 2VG5B 2X1FA 5L39A 2J6SA 1U0HB 3P3DA 5F3TA 4CO2A 3T5HA 4QBUA 2IVFB 1M5OC 4WFYA 1PJ7A 1KVJA 3GV7B 1HBUB 3X1LB 4K5SA 2HFUA 2W7PA 1IWGA 4JB8B 1NHKL 4F0KA 3ONQA 3VAIA 5J2QB 2E9RX 1GH8A 5LSLA 2P8IA 2AYBA 1VIXA 3IRXB 3KMQA 2P6SA 1A9NB 1TKDA 2R7UA 3GQCA 2YWGA 3RBXA 4FKXA 1G1XA 2C2MB 3KG4A 3QBCA 4ZKAA 3DDNA 1S49A 1VRUA 1PJ6A 2CFXA 4C8MA 1NPKA 5DZ6A 2IRYA 4DBQA 4RW8A 1SV5B 4KO0A 4QQBA 3FSYA 1Y9OA 1Y3JA 3H7HB 3IFEA 1RA6A 1T03A 2UU9F 5DDPC 1FJGF 3VWSA 2W24A 2I0XA 2YXLA 3CDEA 5DM6Q 1JXEA 3HHNB 4AQYJ 3RW7A 2ZHBA 4UTGA 2FJWA 3W8GA 3TUIC 2ZC4A 3RB0A 4FF1A 4KHPF 3KJQB 4HI1A 1DTTA 2VG7B 4DX8H 3N5FA 4ED6A 2FVCA 4BHQA 3M1VB 4ED4A 4NYPA 1C1BB 2EVZA 2J9DE 3FSXA 3JSRA 4LF7F 3OLBA 5KT5A 1JLBA 5E3CA 3CCWA 2K3IA 5KFEA 2UUAJ 2PMZD 1PBAA 2HBRB 3W1YC 4PG4A 1NM2A 3OL6A 1VQ4S 2O01C 3PCOB 2P9EA 4ITSA 3CJQA 3W65A 1NSAA 2M70A 3MM5B 3JYTB 4O3RA 3W2WB 3AH6A 5KFNA 2FZGB 5IT9Y 2W2MP 2AHOB 1FDBA 2OD4A 2ZDOA 3M2UA 4GVBA 4RNHA 2V5HG 4ECSA 3RBEA 3OHAA 3KLGB 5IQ6A 2KJVA 2QYCA 3QIDA 4WU2A 1VQKS 1FKAF 3UCZP 2AEFA 1WWHA 3GJTB 4CO3A 3W63A 4Y2CA 4CLTA 5GADU 3HM9A 3MAHA 2V63A 3HSGA 1RWXB 2MYFA 4R8UB 5KOXA 4EYIB 3SI8A 2JLEA 1YJRA 3K5NA 2K7KA 4ZCIA 4KFBA 4J37A 2V4JA 1FJGJ 3P8BB 4ECWA 2Q43A 4DV1F 2GIQA 3DRYA 4IYQA 2HLUA 3SXLA 2V4RA 3D2WA 2ZJPQ 3RR7A 1IKVA 2F8EX 2HGLA 4DQPA 2V8HA 1PIEA 1WTFA 4A46A 4FVMA 2YX4A 4EO8A 3FQLA 3MMJA 3BSNA 3P45B 1YLXA 2VDIA 3SIPB 2G4BA 3C8YA 1FKPA 5GMDA 1T0TV 3SQGB 3T9ZA 2Z57B 1MN7A 1NHUA 3JTOA 4CLFA 3AOCA 4ZMMA 4QR2A 2W9BA 4GKJF 3EZ5A 2BW7A 3T5LA 1S10A 5T41A 1URRA 4LFAJ 4AT1B 3SEOA 1RJJA 2LECA 4OYZA 4USUA 1ZTWA 3OFFA 1NB2A 5CCLA 2OPPA 4P2SA 1TVRB 4ECVA 4NLSA 2AT1B 4XAKA 1N5TA 3CCTA 3MMCB 4LVOP 5KAKA 1M5PC 5AE1A 2CPXA 1RT6A 3W9HA 2C22A 3DLJA 4DSJA 2AX0A 2CDQA 4C3MA 5KFFA 1PO6A 4DSIA 2QL5B 2VFUA 2FC9A 2ZUGA 3M8RA 1OSCA 4DCJB 3KXDA 1REGX 4ZITA 4DX6A 5DQIA 3POTB 3OTOJ 1EQMA 3I56S 2H1YA 3ZTRA 4LF8J 5ETMA 2ZH6A 2RUSA 4K4VA 4LQ3A 5E3RA 2V6AA 1XNRJ 4I67A 1VOMA 4NA1A 1RWUA 3HZEA 1UAWA 3JQJA 3PFOA 3VR1A 1ZYQA 2IYGA 2KRRA 5HBMB 2K7JA 3BEGB 3FCVA 3R6GB 4USVA 1OO0B 2W4PA 4ZIWA 1U4BA 1UJ6A 1YJVA 3W61A 2CPJA 3MOZA 5BR8F 3QGGA 4ZCMA 5IFMA 3VAGA 1C1CA 2IM3A 1IQTA 3TVKA 1X4DA 4OZ2A 2DH7A 4IFYA 3EDRB 2F9JA 1RUSA 5CZXA 2JHEA 3CCSS 3OVSA 3P5TL 3M9OB 3IRXA 3NOGA 3CJ0A 3D1QA 1G2EA 1RTIA 2W2OP 1Q8KA 4I69A 1NSKL 1BE4A 2HEKA 3K89A 3LP2B 1T9TA 3VALA 2E5LJ 1HPZA 1S1XA 2YWHA 5T7LA 1G3OA 2QJ3A 3TWZA 5GAGU 2B9XA 1HNIB 3HCXA 3PX0A 2ZWOA 4QWEA 4NEZA 1YJWS 1JWWA 3R7NB 5ETKA 6AT1B 5IT4A 1IJEB 1H38A 4FYDA 3MPUB 1B64A 1VR6A 2FHJA 3TUZC 3H2UB 1SCJB 4LT6A 1FCAA 1RI7A 4TY8B 3M2VB 3UFCX 2HURA 2E44A 2PN6A 3ZZYA 1X8DA 3ILLA 2ERRA 3TARA 3BS9A 4PG7A 3GG1A 3MM6A 2PMWA 1JIHA 3W5YA 1UWBA 4ZLLA 3V6JA 3JQMA 1NU4A 4PUOA 3DMJA 3KUHA 4ZVHA 3QPIA 2MZ1A 3NS6A 4TU8A 2YWWA 2B51A 2G0IA 3PYEA 1X0FA 1UFLA 2CJXB 2K8GA 4KKOB 2BQ3A 2ALZA 5FIIA 2XEXA 2J0SD 1VISA 2AWZA 4YHHF 3OTOF 3TZWA 2KL8A 1U0HA 2FVSA 2HHUA 2DNRA 1CPZA 4PWUA 1FFGB 4WFBQ 4DR2F 2EFQA 2Y9HA 2DNZA 3BF4A 1Q1KA 5CYQB 4F4AA 1OPZA 2YKNB 5C24B 4C2MA 1S0MA 3QWPA 3MWBA 1N4LA 4IR9A 4OZLA 1TL7B 4DR4F 3OJUA 1S9EB 3C66A 2BE2B 3NGKA 1WUUA 1WJ9A 2ZOGA 4BCAA 2R8HA 1WF0A 4RBVA 4A4JA 2MGZA 2HHQA 3GSDA 3K7RA 1FXLA 3RAQA 1LKZA 1EX8A 1VBXA 1U47A 3W9IA 3H5UA 4AXJA 3RTVA 1CJKB 1WC6A 2F9DA 3KUEA 3PTWA 4MTPA 1Q78A 3VAHA 2F1FA 1VGYA 4R25A 4KO0B 3KLEB 1N5YB 2RHQB 3BJYA 1WACA 4Y28C 1RYRA 4LF5F 2EFPA 2V4JB 3MPYA 3OJSA 1R0CB 3AQOA 4TKTA 1NJZA 1T3NA 3CD7A 2IJNA 3D6TB 4I4BA 4NI2B 4IRKA 4M5LA 4DHVA 3IS9A 1OYDA 2VU5A 3K8WA 2CAJA 2EPIA 2XI3A 3FCHA 3NXZA 3BGLA 4ZVFA 3S6EA 2EC0A 4JBCA 1FKOB 3HHKA 2JSXA 2ZBCA 2BRLA 1YRUA 3KFWX 3MDFA 2EFNA 2RQMA 2W2PP 2C2ZB 2WSEC 1GFWB 1R8PA 4DR7F 1EKSA 1VQSA 3A8IA 2NSCA 3DOKB 4MKVA 4OMFG 2L41A 3CCRS 3QFWA 1MU2B 2XMUA 3L7UA 1FT8A 2RF2A 1TP7A 2ZE2A 1KLMB 1HI1A 1KFDA 2YNIA 1SKWA 1V9OA 2XS5A 3RU0A 3FBCA 1G4CA 3MR3A 2XS2A 1F9FA 1PKUA 1T9YA 4DZDA 5B7WA 2N3OA 2BANA 3CVKA 3Q24A 4A47A 5A8WB 2W7OA 4EGLA 5CD4A 1Z1ZA 1RB0A 1DLOA 4RX6A 3D6HB 4ZP9A 5HROA 1OPIA 3G8QA 1Q82T 4OLPA 2ZM6J 1WSRA 3H2VE 2POKA 2HHPA 2BJ7A 4HEA9 3HMJG 1S6QB 4P74A 5KG2A 1UEKA 4BS2A 3DDKA 2DNGA 1KFSA 4HI2A 1ZM4A 2I1RA 3D68A 1CC7A 4FYYB 4DN9A 5FDLB 5KFCA 1UWAA 4URQU 1KQFB 2VASA 3H5SA 3Q2SC 5A2QU 3DYAA 1NCLA 5L1KA 2HVZA 3VAFA 3UNYA 4DV0J 3JQKA 1VK3A 2NR0A 4KHPJ 4X4TA 2D7SA 3OV7A 2JEGA 2A6OA 3OR2B 2F40A 3CTRA 2WB4A 3ILIA 1VHIA 2DHGA 1RT5A 3OPKA 2QLFB 4K50A 3P96A 3L9ZA 1LK7A 2GVZA 2VFSA 1OY9A 4DLGA 3RB6A 4DSEA 1XMOF 4KE5A 3CD5A 2VH7A 2VL1A 4I64A 2DR9A 5EN1A 4OX9F 1D1UA 1REVB 1RTZA 2QV6A 5AJ3J 1JKHA 2AKWB 4OI3A 4F4KA 1V3SA 4X4QA 2VG6B 2XO6A 1NPRA 1U26A 5GADI 2BEFA 2LMIA 1GX5A 1KOOA 1QY7A 1TVRA 4QIVA 2JC0A 2MLXA 4QPTA 2V67A 4FXWA 1HYSB 4KV8A 2OO4A 3MM7A 4DG1B 4C0HA 1LWCB 1FI4A 1S48A 4KGVB 5CYMA 4F4YA 4RZRA 3A8JA 4P6QA 2XY5A 4U7UD 3FDSA 3VZHA 1IM4A 3DFEA 3M30A 3MEGB 4R0JA 3D54A 1U2RA 1N48A 2Z30B 1NDLA 4DL4A 1IBCB 2R7OA 3HVTB 2KH9A 4JI4J 4G3IA 4F50A 4M5IA 1TV6A 5LMNJ 1UVIA 2K3KA 4C0OC 1D0EA 2CQ1A 4I56A 4U7CA 1U49A 1RWOB 2M9KA 4LF6F 5K5MA 4TVAB 5DDOC 4U9RA 1QDUB 3G6VA 2GFFA 1WOSA 2MZQA 2NXNA 1H74A 1W26A 3QT8A 3SDEB 1GX6A 3IG1A 1WKJA 3R1HA 1OQ6A 2JFKA 4DR1F 5E0OA 1B70B 1N52B 3IM8A 4J9LA 4NL5A 1UPPA 4AL6A 4DPTA 4LR9A 5LT5A 4WFAQ 1U1PA 3KHHA 2B8PA 1S0NA 1C0UA 3KNGA 2FY1A 1I6JA 3EM1A 2GIFA 2MZRA 2CQCA 2Q66A 3GYNA 4IKAA 4ZP7A 2MLYA 3KYLA 2VKRA 4WZMA 3LPYA 1R0AA 2V2VA 3R2CJ 2BBEA 3MR2A 3I0RB 3R5AA 3PW2A 1Z4UA 3MEEA 4YS2A 1S1VA 5I3PA 9RUBA 3SV4A 5H9EJ 4MK7A 1SBRA 5HJXA 5HMZA 5HATA 4KSEB 1VQPS 2ZVIA 2UVRA 3KJVB 1R3NA 4IFVB 4CI0B 3KHRA 2E5JA 5EDWA 5J2NA 2I2YA 1UVLA 2DHSA 3CJ4A 2KRBA 2W25A 4NLDA 4DL2A 3M2RB 3HPOA 2Q3PA 4AL5A 4LRAA 3S8SA 2DIUA 3DC2A 4NZ6A 4WBFA 3UN2A 1E6YB 3IAS9 2WVBA 2MZTA 3KUGA 1WORA 3DOKA 4HYKA 3I82A 2KI2A 2JEFA 1JLEB 4H4KA 2DIVA 1HNVA 2BV3A 2UV8A 2FDNA 2XB2D 2ADBA 2IM2A 5ITHA 3R5JB 5AE2A 2U1AA 1U1NA 4FBTA 2CYYA 2DR6A 4WTYA 1KONA 2BE2A 2CPYA 3ET6B 3U27A 2E1AA 5A8WA 2AJ0A 2CQDA 3AA9A 1KOHA 1LWFA 5K9FA 4WYLA 1MG7A 2Z58B 4DR3F 1U1LA 4NLQA 4LF9J 3BYPA 4HACA 2L3MA 4ALZA 1FTCA 4WIQA 1FERA 3VAJA 1YSJA 1VBZA 4OHVA 4EFAC 1UKUA 4MFBB 2GJFA 1LXJA 3VVTA 3CCMS 1TK5A 3R5BA 1WHWA 2C2DA 1D09B 3TX8A 2HNYB 2Q1LA 2J5AA 5SUHA 1YIJS 2WSFC 4IUFA 2IRXA 3EGZA 4IRCA 2MJUA 5HVGA 3CDAA 4HT5A 4K0KF 1D8ZA 4MYTA 2IM1A 5GMEA 3KG0A 3ULHA 4Q43A 3FVYA 2HPUA 3IBFB 2Z2LA 3OUYB 2JEIA 1KHWA 1WKLA 3FEYB 2UUWA 4LSNB 4LRCA 3A3OB 1ZAWA 1S1TB 3N28A 4U67Q 3ZTSA 4NXNJ 3EYZA 4M5MA 3W7BA 4A8SA 3A8EA 1Q53A 1R7IA 1AZSA 1ROFA 2D3UA 2G1DA 4K59A 5D4NA 5U47A 3T1HF 3I32A 1YJUA 2QO3A 3M6WA 5J2PA 4J9PA 2AGOA 5J2MB 1UWBB 2EK1A 3TQEA 5KFQA 1FRJA 1JJCB 2LQJA 4EZ9A 2F8MA 2BANB 5KFLA 3MM7B 3QZ8A 5D4PA 4C3LA 1MMLA 4EBCA 5DGBA 4KIAA 4OI0A 2MKSA 1CJVA 3GLJA 4LF9F 2FHKA 4C11B 5H1SV 3R2DJ 3D3BJ 2M5YA 4F3OA 2IVMA 5FJ4A 2BKNA 2HQGA 5KFGA 3CJ2A 4KBIA 4NLOA 3KTQA 2DCUB 4RWXA 2MKKA 4Q0BB 2MY8A 1U6ZA 3GR1A 3MAAA 5B0BA 2WTFA 5G0RA 4EYHB 1J5OA 5F8HA 4A8QA 2HHVA 3HSZA 2ZH4A 1SJ3P 1HR0J 4RNMA 4K4XA 1IBKF 2VOPA 2Q79A 5KFWA 5EWEA 3GIRA 5B0CA 2B6AA 2R2SA 4ETZA 2VA2A 2H51B 4LBPA 4GMKA 5DDRC 4YR3A 4WXOA 2CRLA 1FFSB 1U25A 2AJ4A 3GWCA 1U24A 4LR7A 1H2TZ 1S6PB 3CJKA 4I7FA 5A0YA 2A2CA 3WZ0A 5K8OA 1J5EF 3JSBA 1LXNA 1URNA 5H9EK 7FD1A 5KFMA 3Q8UA 4ZCLA 2B4PA 2DR5A 5IV4A 1V6HA 1JKHB 2KYZA 1NUEA 2RDDA 2IC3A 2XNQA 5L1JA 1V3RA 1SC1B 3TQ1A 1HNZJ 1E6VB 1ZA2B 4FF2A 2D1CA 2Y0SD 1YVFA 2XGQA 2M0GB 3A3NB 3TUJC 4YB1P 4DFPA 4ZJLA 2ZC3A 4IH7A 4B3MF 4LR8A 2DB1A 2R9LA 2FD2A 1FF2A 3NGRA 2N4DA 3MEGA 3D4JA 1VLYA 4J9KA 3BV8A 3ZC4A 4HL9A 4M5NA 3DRXA 2XZDB 5K8PA 3SSRA 2NLWA 3HP6A 4NCGB 3ZO7A 1T05A 2R7XA 3DLEA 4N5SA 2DNYA 4RW9A 5D77A 5THWA 3EICA 5CYJA 2HFVA 1UETA 4B3MJ 5E3PA 3VAKA 2YY3A 4G1QB 4NYZA 3CCQS 1JLEA 3IRWP 5KFBA 3T5KA 1QAIA 3D5MA 3CB4A 3MM9A 3AD7C 4WJBA 4KPCA 1JLCB 4OQJA 1N5VA 3HVWA 2R7RA 4NCBA 4AUKA 3VTIA
chains in the Genus database with same CATH topology
4RBUA 4RWWA 1HQUB 5KT6A 1KNZA 1PSDA 3ETOA 2KT5A 3BREA 3LOUA 5AXKA 1JLAA 1XK8A 3K5PA 2RDJA 2C3MA 3LF0A 3CCUS 2FVRA 1CQMA 4ETXA 1KS2A 3B78A 1HBMA 2LEBA 4DV3F 1X9MA 2HFZA 3GFZA 1SKSA 2HWHA 2GGPB 4QYRA 2X1GA 1S1VB 4NLWA 4QW8A 3BZQA 2OPQB 3MPWA 5GADI 4EZ6A 2BUNA 2HHTA 5KT7A 3NKYA 5DRKA 3W2VA 4IFVA 2GO8A 2C2EA 1S1UA 1WF2A 3GFXA 1TK8A 3OXLA 4DSKA 2A18A 2VUGA 3OLAA 4R5PA 2FHJD 3MGJA 1L3TA 2EBGA 1S1WB 1BQNB 3BGUA 3IWXA 3O44A 2PFFB 2RU9A 1IR0A 1C0TB 4A8KA 4RUCA 4PRFA 3KK3A 1TKXA 1FKPB 2WCXA 4C8NA 3RRGA 2HVHA 1O8BA 4CO0A 1YRXA 1NEEA 3LO3A 2HGNA 3ENWA 4RW6A 5A8RA 3HVTA 2MQNA 1HBOB 1ZPWX 2DGSA 1VC5A 2HMIB 4ILLA 5J1PA 5KG3A 3LP1B 3DU6A 1TV6B 2VG5A 1O0PA 1YJ9S 2UXCF 3CD0A 4JV5F 1S4FA 1X4AA 3TA2A 1X4BA 1HBUA 5C42A 2ABYA 1R89A 3J7A1 4X4OA 3T3FA 1KLNA 3Q8SB 5B0DA 3C2PA 4C9DA 1YQHA 2CQBA 2L08A 2VBXA 2OKQA 3OXGA 4E98A 7FDRA 3K5MA 2AYEA 3IO1A 1SC6A 2DITA 2CZ4A 3BDEA 3DLKB 2Z0GA 1GNKA 2RSQA 2NS1B 3HF5A 2R8IA 2AYMA 4MIWA 4OHXA 1GT8A 1P6TA 4O4GA 4UQGA 3NNAA 1YHQS 4LSLB 3GIIA 2AJQA 4UOCA 1R8BA 3AB2B 2PO4A 3DXSX 1K9MT 4I2PB 2B56A 3DXBA 3PIOQ 5CHCB 1TFYA 3TRGA 5KFOA 1C1BA 4A8MP 1QJHA 2C3UA 2DR8A 3CMES 2A1BA 3EXCX 3KWMA 3N6NA 3PO5A 3QLHB 2VPYB 2BRKA 1FE0A 3MM5A 3RRKA 4NCGA 1T05B 2FVQA 4IQXA 2FJDB 3DLEB 4QWCA 1RT7B 4X4RA 3P6YC 2KDOA 3F44A 3HHDA 4NLTA 3BQ0A 3QJLA 1PGZA 4Q2LA 4NLPA 4IOCQ 1RTHB 5BYSA 2VB6A 2YWFA 4B9NA 4M5DB 4YDDB 4QWDA 3PM9A 1NK6A 3WC2A 3K2YA 3MM9B 4KKOA 1KN6A 1JLCA 3PFEA 1AFIA 2B4VA 4F2SA 5DG8A 1BQMB 1VMBA 2OMOA 3LW5C 1JMTA 1BQXA 4DMZA 4KFBB 5FLXY 2V2KA 5EDWA 1NK4A 2KJWA 2YKNA 1VQOS 2R8KA 5B0FA 3OTCA 3KHLA 1IKVB 3D28A 1VBYA 4CCHA 4YFUA 4ZPDA 4NLVA 3VCDA 1MROA 2B9WA 2AYGA 2D41A 4WIIA 3Q8QB 3J7YU 2KXHA 4X62F 3PW4A 2WONA 3PJWA 5HL7Q 1YJTA 3BR8A 2HWTA 1YTYA 3KK1B 4DQRA 2CQ0A 5A6WA 1H3DA 4B3TF 3PV8A 1UA1A 2DGQA 5KTQA 1M5VC 4C8KA 4K4ZA 4C98A 3PIPQ 1T94A 1GXUA 1Y3KA 3PW7A 2CQHA 4J9RA 1BQNA 1F0XA 1FKOA 1HFEL 1NHVA 2FIUA 1Y0HA 2J7WA 2RVJA 1R43A 3I0SA 5MLCV 3QYYA 5KG0A 1NKEA 3K0JA 4WFZA 2VQFF 3NCPA 5KFIA 3ISZA 1T3OA 1FNMA 3BR9A 2PEHA 3CIMA 3J7Z5 4ECRA 4UW2A 1J5OB 2JEJA 1TL3A 3DRPB 2ZJRQ 3RAMA 3UI3A 2DRAA 3OR1B 1TQLA 3DHXA 4MKAA 4TYBA 3KHGA 2YH0A 3OSNA 2PIIA 2CZVC 2B4OA 3IR7B 3DU5A 3U1NA 1Q4RA 2AP6A 2DO0A 3C6UB 1HI8A 1SUQB 3I9ZA 3VZIA 3DI6B 4X84A 5JVHQ 2DGOA 5FDLA 5HLFA 2M52A 1JLGB 3LP0A 1HR0F 1UVNA 3NBPB 2YQ3A 4ZVEA 5D8HB 2CJKA 1P1TA 1PC4A 3O3LA 3ZZPA 4J9SA 3SFGA 4QU6A 2ATLA 3NMAA 2ZH9A 3SCLE 2MKJA 1UVKA 4H4KC 2RNEA 4U6PA 4ED8A 5KT2A 3FMBA 3LQVA 2F7VA 1R31A 2KTQA 1R8AA 4RNNA 1RTJA 3KLFB 5F8GA 4ICLB 4YR0A 4ILMA 2HMIA 4IG0B 2ASDA 1XTZA 2QMXA 2ZVSA 1C4AA 2IVYA 3E01A 1LOUA 5KFHA 4DL0C 1NAQA 2YWEA 2XLKA 4ID5A 5KFVA 3CWJA 5AJ3F 2CPZA 1JJ4A 3UNGC 1RT4B 2KU7A 3WX4A 4GC7A 1KHVA 4J9MA 2ASLA 4OIXA 3HDSA 3BSOA 4HTJA 1QE1A 2M88A 5EX0A 2IA0A 3D1HA 3SSSA 2C3PA 1XC9A 2WB1D 4BBYA 1RT3B 4Y2IA 2E1MC 1QUVA 3FFIB 2YNHA 1L3KA 2HHHF 3FGVA 4F4WA 2HNZA 2X51A 4YB6A 1RKIA 2DNHA 4JYAF 4WE1B 4QU7A 2NSBA 2P9GA 1UMJA 2ZZMA 2HQIA 1SXLA 2CG4A 4JOUA 2KFZA 1N6QB 4AQYF 2MMYA 1MSWD 1F5BA 5J2QA 2NUHA 3IS9B 3MEKA 1VJWA 1TAUA 3CCZA 2FLLA 1TKZA 2BM0A 2QA2A 3JTPA 1TKTA 1NK0A 5KFYA 4ID8A 1LW2B 5JXSA 4YQWA 2XGPA 1FJEB 4I2QB 2BJEA 3OFEA 3OTBA 4NLYA 2VA3A 1BC6A 2HS4A 3GB0A 2AJ1A 1HD0A 1I94F 2UXBF 2OP5A 3PZPA 4Q7AA 1H6KX 4MJKA 1K0TA 5IM0B 4DR6F 2MQOA 5GAEU 2E7XA 4DSLA 2UZAA 3ENQA 2P5VA 3GE9A 4K4TA 1DHMA 2YKMB 1VI7A 2WOMA 3TAMA 2IRUA 1BQMA 2EG2A 5HN0A 3CCES 2HNDA 2EW9A 1A7GE 4ZHRA 1TAQA 3SFUA 3W2WA 4B3SF 1OQ3A 2P6TA 1LFPA 2I8EA 2IAJB 4MIBA 1FRIA 3VQTA 4DWIA 1S99A 2WHOA 2E5GA 3RR8A 1WI6A 2RIJA 4JI1F 1BY9A 1TL5A 1SUQA 3CF5Q 5D78A 2RRNA 2DTJA 3I4HX 4CQ1A 4DDFA 1WEZA 3LH2S 5F41A 1FE4A 1OS5A 2LYVA 1SJ4P 1XNRF 1NK9A 1FD8A 2F4VF 1HD1A 1N36F 1RA7A 5M2UA 2KZMA 4MYUA 1X5TA 4JI0F 5SZTA 2QZ8A 3I31A 1MWZA 2L9DA 4DL7A 1SKRA 3VAJA 3CEDA 3M30B 3OUYA 4G1IA 1SIZA 2XCAA 1WTBA 2IYIA 4IOAQ 1Q16B 3QLHA 1GTEA 5KG1A 3BO2A 2PMHA 1X5PA 1XBWA 3EPGA 4USIA 1RGVA 1VQYA 2E66A 1BD6A 2O66A 4PQAA 1DTQB 4JI6F 2FJXA 3M8QB 5E5NA 3VAMA 1UVIA 2ZNZA 2V9KA 1TL3B 2VPZB 2EFGA 2WBRA 3DRPA 3T19A 5DG7A 3O6QA 1SL1A 3BN4A 1HWLA 3TA0A 3JB9k 3NCRA 3MMBA 1UJ4A 3G6YA 1QSLA 4BC7A 3SDEA 3C6UA 2MJNA 2MPUA 4O3NA 4FN5A 4TNOA 4V19X 3JYTA 2M3DA 3TR5A 4OZNA 3DLGB 4LFBF 3G71S 1Z2LA 5K14B 2JL9A 4XIUA 3B8HA 3MAQA 4DV7F 3UD3P 5C25A 2DNLA 3D0HE 2O3DA 3OQ2A 1ZOTA 5T14A 4IFYB 3PVXA 1H2VZ 4B3OA 1JLFB 3KK1A 4OHYA 4PXEA 3BDPA 2EFOA 4H4MA 5CCMA 3UW1A 3CJKB 4EWTA 2DNMA 1T03B 3G8SA 1NJYA 1SL0A 2J0XA 3B4MA 2I5JA 1Y5LB 5EWGA 3L95X 4OZ5A 1W2IA 3OL9A 1O51A 3MECA 6FD1A 4K5RA 4ED2A 3PO4A 3DM2A 3OVBA 5L38A 4B17A 1X5SA 2KN4A 1L3SA 5E33A 4UUXA 4YB7A 1S77D 2XZWA 1QM9A 3K59A 1WHYA 2FGOA 4MAKA 2OIHA 5KFRA 3PKMA 4DEZA 4ZVGA 2WSCC 1VQLS 3QGHA 1Q79A 2VV5A 2YWKA 5DDQC 5KFJA 3V6DA 1WEYA 2HWIA 4RNOA 3QJPA 3F73A 3R5DA 1LWFB 2YKAA 3AA8A 4I0WA 5KG5A 2ZD1B 4KQZA 3NAIA 2V9WA 2B5JB 3W3SA 4RW4B 4RW9B 4QIEA 2HVIA 5KOWA 1XR7A 3I9V9 2HFOA 4Y34A 3MOJB 3Q8PB 3N6LA 2ZH3A 4DV6F 4RBTA 4CTAA 3SV3A 4ED7A 1ZM9A 1JXLA 3X3UA 1D1UA 1MMNA 2RT3A 1N6QA 3G6XA 4NYOA 2ROPA 4IDKB 1TUVA 2LDIA 3H40A 4EBDA 2DPJA 3KOAA 1FRKA 1M5HA 2E1CA 2HFNA 2J76E 2PDAA 4MMOA 3LAMA 5ADZA 2UUCF 1VQNS 2DGWA 1FRHA 3MFHA 2E9TA 1ZAVA 3GZ7A 3NG8A 4KB7A 2NREA 3JTNA 4N41A 1FNXH 1QVFR 3HVAA 3MUMP 3MEDA 3EGWB 4N56A 4QYZJ 1U09A 3T9NA 1F60B 4ZMMA 4CH0S 3MUTP 5HP1A 2PGCA 2BQUA 1FJCA 5IS2A 4X64F 3MPVA 4N47A 3HT3A 2AX1A 2B43A 1Y5NB 2QT7A 1LWEA 1BGXT 1YG0A 3MM8A 3AHPA 5LXRA 5DQGA 2NUUG 4ECXA 4Y3CA 3IR5B 4QIWD 5IT0A 2XHWA 3PRDA 2JFDA 3IC1A 4OX7A 4OI1A 1T7PA 3TAMB 4N76A 5I42B 1ZPVA 2Z4PA 3HX9A 3TVZA 1C0TA 2ZZNA 4QR0A 4RW7A 2D9PA 3RB3A 4FXVA 2B6AB 1Z2ZA 2IAJA 3NL0A 1SJ1A 3GFHA 1HBOA 4WFNQ 5AE3A 2XI2A 3MMBB 3CPWR 4NMLA 2R2UA 3M05A 5HMYA 1C4CA 1XN9A 3HHLB 3IBWA 4I7FB 5A0YB 3PEHA 1TL1B 2RS2A 4DUZF 1UL3A 3OTDA 2N7CA 1T02A 5IQQA 2KVIA 2GCFA 5E2QA 1KTVA 2XMKA 1Y7PA 4O3SA 4N8NA 3KLIB 2RH3A 3M6UA 3LP2A 1TKTB 4NXMF 1UEUA 4P7TA 2XMMA 3KLHA 1WHXA 4YDXA 1U1KA 1JLFA 2OPSB 4Y65A 4CT9A 1S9GA 1RKJA 1S0VA 4I2QA 5AXNA 1OIAA 1QUPA 2R4FA 3BO3A 1WF1A 1XMBA 4JV0A 2C28A 2RDIA 2DGTA 3EXYA 1I1GA 5KT3A 3M2VA 5KG7A 2IA6A 2CKWA 3L09A 5J1NA 5KG4A 2BQRA 2MKHA 5HI7A 2W8KA 2ZH2A 3BGRB 3MF5A 4O4RA 5DJBA 4ZPBA 4DFJA 1DAXA 5E41A 4DF4A 4DG1A 1T8EA 5AXMA 2EBEA 1NRKA 3D0GE 5KFDA 2XSFA 1KVIA 4CH7A 2F3JA 3QGPA 3V6DB 3JSMB 3R5CA 1L3VA 3ZFVA 4XPEA 1SB6A 4PXCA 3CCVS 4Q44A 4NA2A 2W9AA 1DQAA 1ZAXA 2G13A 3I4PA 4ZPTR 4DFKA 1CEZA 4CH1A 5JUMA 1HWJA 4OX6A 1DZ5A 1BWEA 1RT1B 2R2RA 1JJ2R 3MTKA 4OZ1A 1IKWA 2ASYA 2ROGA 4B3OB 3GMGA 2CQGA 1JK9B 1Q8IA 4BWJA 1S6QA 3SSQA 4DPOA 3GV7B 2BYCA 1H7WA 1OWXA 1JNZB 2RUGA 1P9QC 3DCAA 3DYAB 2PD1A 4XDCA 4GC6A 2RJZA 3NS5A 4B9VA 4ZLPA 3C46A 1N54B 4K4YA 2E7WA 1UP1A 1AFJA 3CUNA 1DARA 2G9OA 3DM2B 2ACYA 1P1LA 5EWFA 1RT5B 4I6YA 2SXLA 4PPDA 1YITS 5D6GA 1M5SA 2FVPA 2FJAB 2MKIA 1IXKA 1ULRA 5K8NA 4ERDA 1F5CA 1K0VA 2G0CA 1X4GA 1TZ0A 1K1SA 4B02A 2VG6A 3BM7A 2V0NA 3LALA 3T1AA 3O2IA 2KO1A 3TI0A 3IWLA 4UUWA 4DV5F 3MR6A 1TK0A 3HO1A 2YX7A 4OV1A 2W7AA 2ZBIA 5B0EA 2W8LA 3IXQA 1JLQA 2LA4A 4KGMA 4UQTA 2KG0A 2QMWA 2AD9A 5HROB 4V19J 4Y6IA 4ZA1A 4ES3A 2DPIA 3R3TA 2B3TB 3H4DA 1CSJA 2DHXA 1NH7A 3C6TA 3EPIA 4PQUB 1HMVA 2OAUA 1X4FA 4G6VB 3N01A 4OX8A 1WNEA 4NRUA 3UDCA 4CO5A 2HHSA 4O0IA 1M0SA 2VBYA 4JUZA 3ITHA 2VQEF 2FPHX 1N34F 1QSYA 4B9TA 4DS5A 2CPFA 4NLGA 3A1YG 2O67A 4B9LA 5C25B 4TQRA 4OJ1A 2XO7A 1ZETA 3ISNC 3FMWA 3GV8B 5KT4A 3J81Y 1HHTP 2VPXB 4KT0C 2BJDA 2UUBF 4E0DA 1Y5IB 5HP1B 2R7WA 2E1RA 2LXIA 4FNIA 2BOPA 1NK8A 2FJVA 1QTMA 2HNYA 1RTDB 3GYXB 2I5JB 3J7YI 4MKYA 2H9ZA 1KQGB 3V6KA 3NBPA 4ZOSA 3FZBA 3GR0A 2U2FA 3DRSA 3QAEA 1R0AB 3CT9A 2A10A 1R8HA 3OW2R 1DFDA 4AXIA 4UY85 5CYMB 1XMQF 2LLZA 4WYWA 1B7FA 2BXJA 2J9DA 2DGVA 2CVIA 2GHPA 1U6BA 1RTHA 5J2NB 4KHMA 2QLXA 4OZJA 3U7JA 4FXDA 3D1OA 4O3QA 1Q8LA 2C3YA 1RISA 3M32A 5AXLA 3TO8A 3R1LA 1YI2S 2KFNA 4DS4A 3QAUA 2NYIA 2CQPA 3HHLA 2VKZG 2IBKA 2B0GA 2J6UA 2AW0A 2FJEB 1HNVB 1HNZF 3I96A 3PJXA 3D0IE 2OTLS