5L9NA

Structure of uridylylated glnb from escherichia coli bound to atp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
92
Chain Sequence
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II 1
publication title Effects of T-loop modification on the PII-signalling protein: structure of uridylylated Escherichia coli GlnB bound to ATP.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 22
structure length 92
sequence length 109
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l9nA00
4IYQA 1NZAA 2VD3A 4YB6A 2GX8A 4RWXA 4AFFA 4CO1A 4C3KA 2XG8A 3L7PA 5DRKA 1V3RA 3HLUA 3NCPA 2PIIA 3TA1A 4D3HA 3T9ZA 3NCQA 1P1LA 1Q1KA 2V5HG 3N5BA 4USHA 4CO0A 4CNYA 1NH7A 3X3UA 4NYOA 1XK8A 3BZQA 4RX6A 1UFLA 1J2VA 3MHYA 2XBPA 1QY7A 4NYPA 1V3SA 1VHFA 2RD5C 4CO3A 1UL3A 3AA8A 3LF0A 2CZ4A 2EG1A 1GNKA 4YB5A 3AA9A 2XZWA 1HWUA 4USIA 1NAQA 2Z0GA 1UMJA 3O8WA 3DFEA 3NCRA 1PILA 2ZOMA 3TA2A 5L9NA 2J9CA 3OPKA 4C3LA 1O51A 4OZJA 4RWWA 5D4OA 4CO2A 4C3MA 4D3GA 1VFJA 4CO5A 5DS7A 1O5JA 1V9OA 2JJ4D 4E98A 4ZK7M 4YB7A 2ZFHA 5D4LA 1OSCA 4Y65A 4WK1A 3O5TB 2NUUG 2GNKA 2E66A 4USJC 5D4NA 2GW8A 4Y6IA 4CNZA 4CO4A 4R25A 4WK3A 1NH8A 1H3DA 1V6HA 2J9EA 1KR4A 3GSDA 2O67A 2O66A 4OZNA 4RLEA 3AHPA 1UKUA 2NUHA 2NS1B 2J9DA 3CE8A 2DCLA 3M05A 2EG2A 2J9DE 4OZLA 2XULA 5D4PA 3TA0A 3AH6A
chains in the Genus database with same CATH superfamily
2LLZA 1Z2LA 3H25A 1EP4B 4M5KA 3T1HJ 4A4JA 2LQJA 2HHUA 2R8HA 3M8SA 4CM0A 4ZVOB 5CYQA 2PMZD 2ZJPQ 3MCSA 5EHHA 3MGJA 4QOTA 2F1FA 1C4AA 3CT9A 3BQ0A 3QMQA 5L9XA 1NSQA 1HWUA 2D69A 4YP3A 5M2RA 1AA1B 1RU2A 3MAAB 2CQBA 2EFNA 1JJ4A 1FCAA 4DR6J 3DXSX 5IOLA 1VC6A 2K3IA 4FPRA 3CJ2A 4ECTA 3OL8A 2ZBIA 2UZAA 1SKWA 4WKRA 1IQTA 2CJBA 4DG1A 4QIEA 4DCPB 2Y8WA 4C11B 2HNYB 1VQ6S 4I67A 1SJRA 2FZGB 1YTYA 1H7WA 1HI0P 1Y00A 3A3NB 4WU2A 5D4PA 4PG8A 2DNNA 2GX8A 1RWXB 3NLCA 5LMNF 2MSTA 2XM3A 3H5YA 5C5JA 2L41A 3LTOA 3KLEB 4TY8A 2NZ4A 5A6PA 3C14B 3PYFA 3UDVA 3N5BA 4CNYA 3N6MA 4NLQA 4K4YA 4ILLA 3M9MB 2YKOA 2RNEA 4C0BA 3LAMA 4J9MA 3GJSB 2UU9F 1SQEA 4UOGA 1UL3A 1RT5A 3GJRB 1NHKL 4LFBF 3KUGA 1AB8A 4FP9A 2Y1RI 2HZAA 2OEMA 5BYSA 2ZJQQ 3BKTA 4RWWA 4MK7A 3PRBA 4DR1J 5HN0A 3W64A 1S1TA 2PA3A 2AYBA 4FVCA 2EC0A 1V6HA 3TJ8A 1K1SA 1ZA2B 4WP9A 3KLHA 2X51A 4P73A 4PRFA 3W60A 4CI0B 4YDDB 4NLGA 1T11A 3KXDA 2UVRA 2K2PA 1QLNA 2UVVA 1TMMA 4JI4J 1UVJA 2C3PA 3UVJA 3SCJE 4P74A 2OD4A 3W3SA 4ER8A 2I6WA 3KK3A 1HD0A 2BANB 2MDAA 4LIWA 1WC3A 1Q78A 3C15B 4DX6A 4JUZA 4EYHB 1VBKA 4PQUB 3C2PA 4DPUA 3MWBA 3EDQB 3TVYA 2HWHA 2XMWA 4CWBA 2ZZMA 3M6UA 1ULRA 2RHQB 4WZQA 3OFEA 4CO2A 4OZ5A 2HQFA 3G6XA 2DNRA 5EUHA 4AYBD 4C97A 3MF5A 4FYYB 4U95A 4IH7A 3N9UC 1XERA 1U24A 4RL1A 1KTVA 3E3XA 2VPYB 3M8QA 3GSDA 1M90T 2KVQE 2DNQA 1SH3A 2AJ2A 1R8PA 3UFCX 3ET6A 5D0RA 3HPOA 2FHOB 2Q1LA 4WTOB 4TU9A 3R3TA 4IYQA 2DH9A 1VS3A 1K44A 4ZITA 3M8PB 4R5PA 1DQ8A 2CADA 5BXIA 4G1IA 2OUGA 3GYGA 4HLBA 5J2QA 2E9TA 1OJ4A 3M7VA 5G0RB 2B4PA 1AT1B 4CTAA 2F5GA 4NOHA 1VQKS 2GIFA 4DV7F 1Y11A 4F4YA 2AU0A 4C0OC 1S10A 3PJXA 1OYEA 4DR5J 4Q2MA 2IMOA 1RWPB 1RXOB 1TL1A 5D0EA 5A2QY 2E5LJ 4Z2XA 3K2YA 3TUIC 4X66J 1Q8BA 3RYLA 4EZ9A 1R8AA 3GQCA 4YDXA 2ZFHA 2YNIA 1N32J 1XNQF 1VQ4S 3NWRA 3R7NB 2E1AA 1NK0A 2H9ZA 4DSIA 1VR6A 2ZC4A 4IQMA 1YRXA 2GVDB 4CLFA 2YNHB 4N8NA 4FDFA 5IV4A 3WDOA 4KFBB 4Y28C 4PKDB 4PXCA 3MR2A 3BBFA 2ASDA 3CJKA 4XPCA 5DM6Q 4LRDA 5KG3A 2DEJA 2VD3A 2VPZB 1TKZA 1EETA 4OV1A 5DZ6A 5M2UA 3W7BA 2ABYA 5IXUA 3D2WA 2KFZA 1YQHA 2BX6A 4YUDA 1N48A 2JZ5A 3QBCA 5LSOA 3SSQA 4XDDA 4GVLA 1RTJA 2VF3A 1X5OA 1HPZA 2POKA 2KT5A 4ELUA 3RAQA 2UUBF 3MUMP 1RHRB 4LF9J 2DXFA 2P6SA 1YIJS 3G6YA 3A3PB 4LF7J 5LJ5Y 1HNVB 3OUYB 3RW7A 2J0WA 1FRMA 2DYAA 1VGYA 3W9HA 4LMZA 2M70A 3M6VA 3N6NA 2W9CB 1X5TA 3ZZOA 2KYXA 2HVEA 4EMDA 2V50A 4EUVA 1NH8A 1L3TA 3V4IB 5HVFA 3FBFA 3KLVA 1GEHA 3S7RA 1JK9B 4WFZA 2UXDF 1UWAA 5B0FA 2IRUA 1DY3A 1HI8A 1T03A 2PFDA 1HLWA 1RT3B 1HIYA 3RTVA 5FJ4A 4LBHA 4PZVA 1SJ4P 2K8GA 2HK3A 1CSJA 3SCKE 3MEKA 4F4WA 2IM0A 4K5RA 1YVFA 3CDBA 1EJ7L 5C25A 5L39A 1CC8A 1BY9A 3MM6B 4LF5J 3OV7A 3RBXA 4AUKA 3ZNJ1 4QIVA 1SIWB 4P71A 4YB5A 4I56A 4UTGA 1RKJA 3VV2B 3AQPA 5HJYA 2E5IA 4ZKAA 3WBZA 1RYRA 2WHOA 1UWBB 1TVRA 1RKIA 2OTJS 4G3IA 1FWKA 1R0BG 2XI3A 3K5OA 5IM0B 3JYTA 4LFAJ 5HMZA 3P6YC 4CO4A 3MTJA 2CVEA 3OQ2A 1UFKA 3WC0A 3BR9A 2FZKB 3KLGB 4ZVEA 1KKHA 3NL0A 4PPZA 3LGMA 3BM7A 4X4RA 1Q8LA 1KONA 1G3OA 1S9GA 4JP8A 2GO9A 2W4CA 4HL9A 2VBXA 3CW2C 1TKTA 4IQXA 1N34F 1CVJA 4B9TA 3W5ZA 3KTQA 1FJEB 3BO2A 3R5BA 4XO0A 4DL2A 4A47A 1PJ7A 1YBAA 4A8KA 2KG0A 1LW0A 1NJYA 4B3TJ 3R6GB 1FO1A 2VDIA 2Z30B 1RADB 2J0XA 4NLXA 3NGUA 3ISZA 2VU5A 5F9NA 3HHLB 4J9LA 5J2PA 4LVNP 2JLFA 3K58A 3KLFA 1KQFB 1APSA 1KD1T 3JS9A 4ZP7A 3KK1B 2XMVA 3SDEB 3CD5A 4DPXA 3A8JA 3P5BP 2CFXA 2XO6A 1VQNS 4QWAA 2WOMA 4WPAA 1QAIA 3K8VA 3IC1A 3BF4A 1VMBA 2YNFB 1M0SA 4DV2F 4NXMF 1IN0A 1T02A 1Q4RA 3QWUA 3CGIA 1S72S 3QLHA 2XTJP 4OYMA 1HARA 4FF1A 1DFDA 5AXNA 2ILZA 3HLUA 3EXCX 1PG5B 3C19A 4JI2F 3QZ8A 3NGSA 1FRHA 4DZ6A 1FKOA 1XK8A 4ECSA 3EGNA 4KAIA 1G2EA 2ZOGA 3B82A 5H9EJ 1X9MA 1WC1A 3QAUA 1MNEA 4FPIA 3JSMA 3H59A 2CG8A 1SI9A 3M1VB 1REVA 1G7CB 3UCZP 2MYFA 3R7SB 5F8JA 1WF0A 1EP4A 3PRVA 1Q5YA 1FRLA 3EVMA 5IQQA 4I4BA 4ZPWR 4LSLB 1VK3A 2XC9A 4K4UA 5HROA 3CJSA 4KGZB 2JLEA 2GJ2A 1A6LA 2BMBA 1UEUA 1S6QB 4QR2A 3KUHA 2NS1B 4DSEA 4OI6A 4YN3B 4TQSA 4DDFA 5IZHA 3AH6A 3D7SB 2YVSA 4BS2A 3IM8A 1PSDA 1JQGA 3M9NB 3B54A 3MAAA 1M1HA 3FCHA 1IWAA 2HIQA 4Y34A 2IJNA 1BWEA 2CAJA 2PEHA 2VQFJ 2PFFB 5KFUA 1XR7A 2HHTA 1G1XA 1N5YB 2ZHOA 4C6AA 1ICEB 4OHVA 2JNJA 4C11A 4CYUB 3H4DA 3HP6A 5CZXA 4ED4A 3G8SA 2B4UA 1UCNA 1ZM2A 1VIXA 3V2UC 5L46A 2M0GB 3LA0A 3CDEA 3DDNA 3O1LA 2KH9A 4WU3A 2DGTA 3GB0A 3J81U 3KLEA 3CIMA 5D8HB 1GXLA 4CO5A 3C14A 1QVGR 2B9EA 4EBDA 5A8RB 1T3OA 4WK1A 1SKRA 2NUUG 3U1NA 2VIHA 4KRWA 4A8MP 2B6AB 1A9NB 3EMTA 4N41A 4H4MB 1YJ7A 1VI7A 2NXCA 1SC1B 2QA2A 2XULA 4MFBB 3SSRA 1J5EF 3BS9A 4B3RJ 4ED6A 5B0CA 2UUCJ 1D8ZA 1LKZA 1IJEB 1NDKA 2AZ3A 5ETTA 4OYIA 2J6SA 1F6TA 3ILLA 2I9SA 3UPFA 3IWNC 2XMKA 3QRQA 1C1CB 1KFDA 4DV6F 3CEDA 3TEGA 4JI1F 1JLFB 2BABA 1ZTTA 1UAWA 5KFPA 1XEZA 1F5BA 1U1MA 2IDLA 3MI7X 1FERA 1RQ0A 1RYSA 2IDEA 3Q2TC 3E01B 3HCXA 3NAIA 3SMZA 5CXTA 3CD7A 4ECUA 5C2CA 2VUGA 4KE5A 3CUNA 3H8YA 2RRNA 1CBKA 3CO0P 2NXUA 3C15A 2B43A 2DO4A 5IFMA 4PQUA 1EZZB 3IA0A 1U2FA 3TR5A 2QSWA 4E0DA 4UT4A 1HI1A 2ZH9A 4OFZA 3Q24A 3LALA 3PKMA 4DUYJ 3C46A 2PMWA 4PQAA 3J7YI 2CQGA 3D1QA 3NCQA 4DCJB 4J9SA 4ZJLA 3TWZA 5KFIA 2IRYA 3LANA 4N76A 2AQ4A 2ZD1A 5E2QA 4N56A 3I0SB 2YPYA 1YK9A 1JXVA 2Z8QA 2DIUA 4RO0A 2X7IA 2CPDA 2R2SA 3UR0A 1NSKL 2QLFB 2DNPA 1B3TA 2BEFA 2LDYA 3M8PA 1S77D 1M5VC 4OHYA 1KQGB 2YWWA 2CRLA 3DDIA 2WVDA 5LXRA 1S79A 2DTJA 3EGWB 5G0RA 4HT7A 2ZHAA 1OMSA 4FNIA 2J0SD 2EFQA 2CQIA 3MM9B 4NA1A 3G6VA 3JAMU 2RDJA 2RILA 2ZUAA 3DM2A 4RWXA 1KVJA 2ERRA 3EGVA 2R2RA 2K1RB 4F2SA 2W01A 2EFVA 3C16A 6AT1B 1FNMA 1UFLA 4O0NA 5MAOA 3W9JA 2GVDA 1U6FA 2YNHA 4E2FB 5HVHA 3KHRA 4M5MA 2HNDB 4KFBA 2XSFA 1PYTA 5E5NA 3MOJB 3OPKA 5GADI 4L74A 2R7XA 2YQ0A 3TZXA 2W9BB 3UCUP 1FHTA 4ZVHA 2EW9A 2XQCA 1VC0A 2XMJA 1ZAXA 2B8QA 2JVOA 4J37A 3K5MA 4ENOA 4WBFA 2A0FB 1S12A 3KG4A 1VQ9S 4OI4A 5AXKA 3FBBA 2XHCA 2D3ZA 3FEXB 3MTKA 2QYCA 2V2QA 4MTPA 1Q81T 4DR3F 1HNVA 1IQZA 3H2UB 3OUYA 2WBMA 3SQGA 2ZBQA 3T9ZA 4QPTA 2W9CA 3EDRB 3HJVA 1VRUB 1U1QA 4ZLNA 4QYZJ 1QDUB 3DLKA 4C7QA 1KQKA 1WI6A 2N3LA 3MPWA 3V4IA 4Y0FA 1UJ6A 4WZMA 3GFYA 3Q2SC 3WC2A 4OV6A 3IN5A 5DM7Q 2RQ4A 2XMUA 2PEBA 2VBWA 1RT3A 2CJ9A 2V8GA 3O44A 1N56A 3U7JA 4DL4A 1H6KX 2JEFA 3MEEB 1MMLA 5KFYA 1YITS 1FKPB 4ZVGA 5KG7A 1RB0A 4F26A 3GMGA 3Q86A 2LQ5A 3CCVS 2E66A 2X1BA 4WFXA 4YR2A 3MM6A 3PX0A 3DHWC 4EWTA 2EFOA 1C1BB 4FS2A 2DGWA 3HSJA 1NB7A 2UXBJ 2AEJA 3D0IE 3IWLA 4LF6J 2YX1A 3MOZA 2R4FA 1IKVB 2WRMA 4DMZA 2GMLA 1T9XA 2QN6B 4GO5X 2C2NA 4A8XA 2M9KA 3ZC4A 1M5SA 1ZZNA 1X0FA 4V19J 1K0VA 4ILMA 3H4BA 5A2QU 5SUHA 3DRSB 4QWCA 1XQIA 3OFHA 5A8KB 4HDHA 2QA4S 3MURP 1YJ9S 4USHA 2MHNA 4I6WA 2FLPA 5IM0A 1R8BA 2RSQA 2Y0BB 2NSCA 3LPEA 4DF8A 3CSKA 2DH7A 2H1YA 3KLGA 1C0UA 4TLQA 3I6PA 2IBOA 2XZWA 4ECXA 2JL9A 2D9OA 2GAGC 5LXYA 1QAYA 2FJAB 2YKQA 4C8MA 3OLAA 1YLXA 5KFLA 3B8HA 1ITPA 5DETA 2FC8A 4N47A 5CHCB 3AY0A 1LK5A 4ECYA 5L1JA 4M5JA 4J9UE 5HANA 2VQEJ 5GMEA 3H98A 2AW0A 8RUCA 2VB6A 3HKZD 3T41A 3OT9A 2QL5B 1TKXB 4Y6IA 3TI0A 1Y5IB 1CULA 4ZP8A 1JB0C 1FFWB 2PO4A 3HHLA 4G1QB 3PY8A 2YWKA 3GYNA 3PHEA 2XGQA 4KPYA 1WC5A 3UDCA 2ZH3A 3KK1A 1Y9OA 4DR2F 2XLJA 5I3PA 3ITHA 2CJYB 3Q23A 3W63A 2JC1A 4CDIA 2L3MA 5DQGA 4U7UD 1RHMB 4FN5A 3ZXWA 1UA1A 5E41A 4OYXA 3SXLA 2IAJB 2YNFA 2A1BA 3NGKA 4UOCA 4F02A 4JYAJ 1UVKA 4P7VA 3T5KA 3SV3A 1K0TA 1RTHB 5K5MA 4RZRA 2DGOA 4OLPA 5J1EB 3CCSS 1X9WA 2BJDA 4KIAA 2E1CA 4Q0BB 4K4SA 1U2RA 2ALZA 1HBMB 1SJFA 4WE1A 3D6FB 3WX4A 2L9NA 2I0XA 2MQLA 5I3QA 4M5GA 1HNWF 4X4OA 3DLEB 3DRPB 2HVIA 4F3MA 4Z7CA 1UEVA 1PYOB 3P49B 3M1VA 2EK1A 2Q79A 1S99A 3VALA 1AZSB 4DV0J 4F4KA 2RF2A 2ZITA 1S1UB 3ZTSA 1N52B 2AD9A 3D5MA 3GIMA 1REGX 1VQLS 4LSLA 3I9V9 3B78A 1NNDA 3IBCB 3IAS9 4PABA 1S6QA 4RNMA 2KO1A 3LF0A 1YDLA 3VQTA 1B0TA 4DU7A 1VQ5S 2WAQD 3VVUA 2W1BA 3QT6A 1EAYC 2DRDA 4PWUA 1Q53A 4OYWA 4R0JA 1CJUB 1EARA 3L95X 2BJ3A 2IC3B 3G6ES 5DS7A 5ETMA 2DNLA 1BD6A 5D4LA 4BCAA 1N8RT 3CJQA 3NGDA 1N5YA 3POTB 1FNXH 4EFAC 1AUDA 4ZDNA 1KLMB 4CYUA 4JI3J 3PM9A 5ETNA 2MZJA 3N5FA 3PRDA 4P2XA 1H0HB 1BQMB 5GAEU 1JLBB 1QSLA 2CZ9A 2LQ9A 5L8RC 1T95A 2OFHX 3DOKB 3CXCR 2PI4A 1Y0HA 1LWXA 3R7BB 1RBLA 3CJ5A 4HVZA 4FF3A 5E3PA 4KPCA 1ZPVA 5IWAJ 1A0OB 2UUAF 1DAXA 5A8RA 1KHWA 1IM4A 3MEGA 1M1GA 3H5UA 2XB2D 2EI5A 2B6AA 1FI4A 1UTAA 1RLCL 2IM2A 2V2VA 1SKUB 3IBFB 4MFBA 2LKZA 3DDKA 4UQGA 1TUWA 4C3MA 4QIWD 3QSYB 1ZAVA 1FJ7A 1HHSA 1C1CA 1UPMB 4IOBA 1QM9A 2UUTA 1WD6A 2X1AA 4C98A 2W9AA 2C3YA 1FT8A 1JLQA 1FX4A 3EPGA 3TA0A 2JDJA 1BQXA 3FCWA 2GMJA 2VFRA 2HPUA 3E01A 4GKJF 4IKAA 3Q8QB 5C7PA 3ADAC 2OTLS 1NMEB 1HHQA 3VGVA 3T5JA 2VICA 5B0GA 1HR0J 2QTWA 2EK6A 1SIZA 1U26A 5KT5A 1EQMA 1IBKJ 1D8YA 2BJ1A 4C8KA 5KFDA 2L08A 3ZZUA 3G96A 4FBUA 1IBMF 5MLCV 3JTNA 2JWNA 4IOCQ 3UR3C 3PV8A 1YG0A 3W1YC 3OTOF 2DNOA 4M5IA 4NI2B 3I9ZA 3DGPB 5AE1A 2OO4A 5IT4A 3OTBA 4JV5F 4MH8A 5HO4A 4QYRA 4ZHRB 4DQPA 4WTYA 2PSZA 1FFGB 1S1VB 3FFIB 4PXEA 4NLWA 2HRTA 2HHQA 2MKCA 1Q0NA 3G9CA 4HDGA 3CDWA 2BJ7A 2IYGA 3MD3A 3IM9A 3AHPA 2KJWA 4MAKA 4G65A 4AT1B 2VBZA 3IS9A 1YGYA 1R6VA 2ZHBA 4OZLA 2GJIA 2VONA 4KHMA 4XIUA 2GHPA 3DRRB 4X4QA 4ZCIA 1S1XB 1RWOB 3HXMA 3FDSA 4DSFA 2FGCA 2G1HA 4RNNA 1X5PA 1FDDA 3T1AA 3W2VB 3IG1B 3D68A 3CJ0A 1XIQA 3PR4A 3MAQA 3RB3A 1PIEA 2J6UA 2RS8A 2MSSA 4C8OA 2VZ9A 2MQQA 5A0YB 4ZS6A 4FYVB 5HLFB 2YKMB 3A8EA 2N4DA 2CJKA 3MM9A 3GV7B 2FZCB 3SZ2A 4DLEA 1LNQA 1BWVA 2MXYA 4N8OA 2HHHF 4USKA 2QZ8A 1AFJA 2JHEA 2OPRB 2FVCA 1I51B 2J9CA 2VG6B 1IJFB 3PCOB 2V8PA 4Q8EA 4X4PA 1Q8IA 4I6AA 1IKYB 1KBRA 1F5AA 3KJQB 2K1RA 1DURA 2RU9A 1IBLF 4P72A 2V94A 3AT1B 4DPTA 3MFHA 2P8IA 3MCMA 3FSYA 3DLBA 1RAFB 2HS0A 2R7RA 3BB5A 2J9DA 1TTHB 4K8RA 5HP1B 1RCOB 5IC4B 2R8KA 2CQ2A 3D0GE 4ZIVA 4OMFG 2WW8A 3UNYA 9ATCB 1I6JA 1S9EB 2IIHA 5LM7E 5D15A 4DOZA 3R5DA 1VQOS 2F9JA 1NJZA 1WOSA 2FDNA 4JOUA 5CCLA 2DHHA 3WIVA 4FZVA 2DIVA 4KHRA 1GNKA 4WYWA 1RABB 3A8IA 3FKBA 2R2TA 3DFEA 4C3LA 4R0EA 4EZ6A 3RAMA 4WF9Q 2DH8A 3FZ2A 3G87A 2W7PA 3NNCA 3KLIB 4V1Ak 3F56A 5F8HA 1VRUA 4JI0J 1XTZA 5D78A 1EIYB 5LL6d 4QWDA 4LF8F 3HHDA 3CJ4A 1GXUA 2OPQA 4LBIA 4U7UK 2HKEA 4DG1B 4NASA 4DSLA 1GQEA 4JI5J 3NXZA 4AQYF 3QATA 3VCDA 4IDKB 1SJ3P 5ADZA 4M63A 3MEEA 3U1LA 1FFSB 1FKPA 3R2DJ 4B02A 2DNZA 5KFEA 3RG6A 2L48A 2XZDB 3T19A 3D67A 1WG4A 2VOOA 3GTYX 3TZZA 1Q86T 4ED5A 1C1BA 1QUVA 2ZDOA 3TP2A 1IKVA 1NSPA 1TL7B 4RNHA 2Z0GA 4P52A 2Q66A 4UZCA 3G2XA 4CIOA 1WG1A 1WC6A 3DRSA 1OPZA 1XWLA 5A8KA 1NSAA 5D0HA 3PNIA 4N7TA 2HHXA 4NX9A 3QGGA 3OJSA 2D3OR 2GQCA 2KDOA 4ZA1A 1OQ3A 4CLPA 1QJHA 1QUPA 4QW8A 3TVKA 1S1TB 2V2KA 2HQDA 4KTQA 3TEHB 1RT1B 5T41A 3V4MA 2B4VA 2HWIA 1WSVA 3EVOA 4YFUA 4HTJA 4B9UA 2V63A 1FVSA 1GTHA 3TUJC 1U1NA 4K50A 2CPJA 5DDOC 3E8OA 4ELVA 1S57A 1KP6A 2IY5B 3LWLA 3BEGB 1PBUA 3UCGA 2GZOA 1T94A 4DEZA 4HACB 3T1HF 2QFIA 2AIRB 4W98A 1DARA 1HL6A 1SQFA 2IVMA 4G1QA 5KT7A 2HBQB 2DR8A 3JTOA 1D3WA 4NLTA 4Q8FA 2CJAA 1OSDA 4NA2A 3F73A 2XY5A 1ZTWA 4F0HA 1CEZA 4LSZB 3ZZTA 1SQGA 1X4EA 3TQEA 4ZK7M 4F8RA 4C8ZA 1S59A 2GNKA 2LVWA 2JRSA 1NU4A 4P2SA 2IAJA 3G8QA 4AXIA 4DR6F 5HATA 4JI8J 3GZ7A 1RTHA 5J1EA 4GVBB 3M8QB 2N7YA 2BKPA 4Q0BA 2DHXA 3ELHA 4RPFA 2O1PA 2YH1A 2MKKA 4IR1A 1HBMA 5J1PA 2J7KA 3VR1A 2BV3A 4DPYA 1WTFA 4FYWB 3FQKA 2OSQA 2YWGA 2ZVSA 2JX2A 3QQCD 3QRRA 2M8HA 2VFVA 1SPBP 3DLEA 3DRPA 1U0HB 2VA3A 2BZ2A 1YBTA 2G2ZA 3WX8A 3K0JA 4CT8A 3NCRA 4RW9B 2MLYA 2DVIA 1N36J 1AZSA 2ZH5A 2CDRB 2ZBCA 4NRTA 4K4TA 4OJGA 3GFXA 9RUBA 2MKIA 1FDBA 1S1UA 1U47A 4WKYA 4YB7A 4JV2A 2HYIB 3KJVB 2B4OA 3T3FA 1Q95G 3QJJA 2R8JA 3CD6S 1IBMJ 1SUQB 2CPFA 2XMTA 4DR1F 4HR2A 3US5A 3H2LA 5KG5A 3M05A 2OP5A 2Z57B 1NPKA 2D74B 3NS7B 1WF1A 2W4PA 3PXGa 1N0UA 3UW1A 1HYSB 3R5CA 2AGOA 2YWHA 2MPUA 1CJUA 4JV5J 5JVGQ 1FX2A 1SL0A 2IC3A 3TA1A 2YKPA 5CQGA 3DLHA 2B3TB 3QGHA 3BGFA 4LF1A 2B7BB 2LEPA 2FJWA 1WI8A 4JI4F 2YXLA 3POTA 4BLGA 3CC2S 1EETB 3QPIA 4OX7A 3WZ0A 4UY85 1KLMA 1FXRA 3L7OA 1TZ0A 2XS5A 4IFYB 2CWKA 3DLLQ 2FVRA 4OYOA 1LXJA 1BQMA 3HFKA 2W4DA 4NPOA 3CC7S 4K4XA 1PILA 4JI6J 2HFVA 5CZVA 1RTJB 3DNCA 1JLBA 2CJXB 2ZNZA 5K8PA 3DOKA 5FLXU 1HPZB 4IO9Q 4EGLA 2BM1A 2G0CA 4Q43A 3OFGA 2N7CA 1LQ9A 2ZH1A 2F4FA 1T9UA 1PJ5A 1OSCA 1XBWA 3FMBA 3QSIA 2W2MP 1HW9A 2HQCA 3NWGA 3KK2A 5EN1A 1NBEB 2Q6CA 3RU0A 2W24A 3HFVA 4DQSA 4IRKA 2OFGX 3AJDA 1JKHB 1LV5A 2WVBA 2P2CB 4O3OA 2KZMA 2AHOB 3K5NA 3K59A 4FKXA 1XMBA 2YX7A 3CVKA 1U6ZA 2FJXA 2WSFC 4H4KA 2PMHA 4X64J 3OXGA 2GMHA 2V67A 2DR6A 1XJWB 4O23A 2AYEA 4LT6A 2KM8C 3W65A 5EX3A 2DITA 4XPEA 3KJNB 1AFIA 2C2RA 1F5CA 1YX2A 2ZWPA 2ZOFA 3GWCA 2IFXA 2VJUA 2OEKA 1VQSA 2HWTA 1F9FA 2F9DA 2RE1A 1K73T 2ZKUA 3C6TA 4MKAA 4DR5F 4LSNA 4DL0C 4ED2A 2BE7D 5ETPA 2E5LF 4X66F 3HHEA 3K7RA 1U09A 4K0KJ 1WTBA 4RW4B 2EKYA 2R8GA 1N32F 1S6PB 2CPXA 2DISA 4NI2A 4KSEB 3V6KA 2GAHC 1SL2A 3GR0A 4QQBA 1UFWA 1D9DA 2CNKB 2QX0A 2DRAA 4ZHRA 1BQNB 1QTNB 3GCXP 2A2CA 1D9FA 2DB1A 1RAIB 5HVGA 4J9RA 1TKTB 4DS4A 2CUYA 1S0MA 3IWXA 1O8BA 1YRTA 5F8NA 3BSCA 4DL3A 3BKUA 1VC5A 3CMQA 1LW0B 5EWFA 3RUBL 1F0XA 1SL1A 5I3UB 3DRRA 1YJRA 1D09B 3UE2A 1S1XA 3SCIE 5KG6A 2QA1A 3SFUA 3GLJA 3OHBA 4Y00A 4LF9F 2HMIB 4F50A 4RW8B 4P6QA 4USVA 3W2VA 7FD1A 1E6VB 4Y65A 2HVDA 3AOBA 4LF7F 2UXCJ 2ZH2A 2XI2A 4R8UB 5A0YA 2C2OB 5HLFA 4RR5A 5BJRA 2Y1IA 4ITSA 3TANA 2G1DA 5FD1A 4X62J 2OPRA 4J9VA 2CPHA 3PTWA 2DNYA 3PW4A 2VG6A 2AJ0A 4IH6A 3BYRA 1IKYA 1G4CA 3GG1A 1P8GA 2MQ8A 1X4CA 1T9YA 4N77A 2DNMA 4ES3A 1TK5A 3S8SA 3VVTA 2FIUA 2FLLA 5HP1A 1FA0A 3MMCA 4DV4J 1R89A 3PFEA 4LF5F 3ULHA 2I5JB 4C48A 4EBEA 1HNZJ 3QT5A 3L9ZA 1S9EA 1MSWD 1KOHA 4EU0A 1Y5LB 5HMXA 3S01A 1UW9A 2CQHA 4C8YA 3ILJA 3OVBA 2FTRA 5E7OB 1XMQJ 4KGVB 4RW6B 4NCBA 5JVHQ 3CNQP 2DK2A 3BN7A 4KO0B 2J0QD 3RRHA 4LFAF 1S6UA 5HROB 3IGNA 2CG4A 2M7SA 4GO7X 3VAMA 3LW5C 5SZTA 5DDRC 3I56S 3BQ2A 3KFWX 4OI2A 3KLIA 1GT8A 2CQCA 2FPHX 2C2KB 2E7XA 4LVOP 2QMXA 1B7YB 3I4HX 4WFBQ 1FJGF 1RA6A 2GFFA 2OMLA 5GAHI 3PKYA 3OVSA 3FMWA 3LPYA 4J9OA 4B3TF 3OR1A 2AJFE 5AXMA 1FKAF 3QFHA 4ZPTR 1SBRA 4DPWA 3DCAA 4IDKA 2GA7A 2VC0A 2MQNA 1FWPA 3J80Y 1TP7A 4C8NA 1RHUB 1C0TB 4JV0A 4W90B 2VDHA 2LU2A 4QJVA 4I2QA 3UNGC 1SJ1A 1VQ7S 1VDHA 1UZDA 2BW7A 4WWSA 3AD9C 1F9EB 2OELA 2B9WA 4PXDA 5B09A 1TL7A 3AOCA 2JH3A 2KFNA 4EK2A 4LRFA 1LWCB 4GKKJ 3FEZA 3H40A 1FK9B 2COLA 3JAMY 4OX8A 1PAEX 3PX6A 3D4JA 4OX9J 2J7UA 3D1HA 2H5JB 2A2DA 3C66A 1MLAA 3H42A 3FBEA 4DL6A 4ECRA 2XLIA 3KDNA 3ENVA 1RA7A 2K3KA 3HDSA 4OI1A 2Z4PA 4ID5B 1RT1A 2VG5B 3BGLA 5DGBA 4HKQA 1NDCA 3A1YG 4BDPA 2ZBPA 4FYXB 2B7CB 2JSXA 1KC8T 3K57A 2FD2A 3TX8A 4FNHA 5HBMB 2QLWA 2MHEA 2CQ1A 4L6V3 3RBEA 3UDLA 1HNXJ 4DUTA 3LUYA 4HACA 1WC0A 2C3OA 2R7WA 3EE3A 2VL1A 2H5IB 2M5YA 2V4QA 1RAEB 1N88A 1SVDA 4DQRA 3WHIA 3PACA 2HHVA 1RAHB 2DCLA 2MGZB 4LF4J 2EG2A 1RT4B 3QGPA 3HVRA 1T9VA 4CRJA 4MK9A 2G0JA 1YSJA 3AJ2A 2VPWB 1WKJA 1YJVA 1V5VA 2EEYA 1P1TA 1W7WA 2QEXS 1RDRA 3N01A 1R3NA 1OYDA 1U0SA 1RU1A 4J9QA 2O5DA 2H54B 1WHVA 2J5AA 3GFZA 2RUGA 4CH1A 2A6OA 2F65A 1I94J 1Y3JA 5DO2A 3V5RA 2BBEA 4DHVA 1X4AA 1NKEA 1FEHA 2VQFF 4PYAA 4RKUC 4C2MA 3QT7A 4LIRA 5BR8J 2ZD1B 1RBOB 1MN9A 4GVBA 3UI3A 1ACMB 4ED0A 2AX0A 5GAGI 3MM8A 5I42A 4DV3J 1WACA 1FXDA 4OX6A 3OVAA 4M5DB 2HHSA 1VCTA 3ZZZA 4DXLA 3GV5B 1U0HA 4IUFA 2QRRA 3MM5B 1NPPA 2WVEA 4RW9A 4ANDA 1FWLA 4CT9A 4KQZA 1ZS6A 3D9BA 3TVZA 2KHCA 4NA3A 4KBIA 1H73A 5KFBA 1DHMA 4YY3J 5GAEI 3N4WA 2FVPA 4CO0A 1L3KA 4QIFA 2O3DA 4HHJA 3KJVA 1ZM9A 2QL7B 2XWXA 2IJRA 3DM2B 3AQOA 4B3RF 3MECA 1T9TA 3KHHA 1SUQA 2NYIA 3HM9A 2HG4A 2R42A 5K20B 2UUCF 4FS1A 4MKYA 2YQ1A 4F4XA 3C16B 2HLTA 3OTEA 1EQ0A 1HYSA 2OPPB 4DU8A 4C4WA 1NHUA 1JLGA 2ZH7A 4AD6A 4NXNJ 3CPWR 2AYGA 2M88A 1RWKB 4X4UA 3Q8YA 4K2JA 3CDUA 2PA8D 5F8LA 3SFGA 4Q7AA 3CCJS 3Q89A 1GH8A 5C2GA 4NLVA 1N6QB 1MG7A 2G2YA 5F0UA 5KFAA 5A8WB 1TELA 4KHPJ 4IFYA 4BC7A 2KKHA 3ZTOA 1XC9A 3PW5A 1XNRJ 4LQ3A 3PHTA 3GP9A 1WOPA 4B3SJ 3DU5A 2E1MC 4PR6A 3BKFA 3FCVA 2FY1A 1WEXA 5DG9A 1V3RA 3MR6A 3CULA 3NCPA 4DBQA 1NJXA 3W61A 4YB1P 4ZVFA 1UVIA 4PWWA 2QC3A 3J7Z5 3HVTA 4FF2A 4DUYF 2ZVIA 1Q8KA 2QGFB 5J2MB 4IH5A 3SQGB 5K8MA 1N5QA 4ZLLA 2ZM6J 1HBUB 2BXJA 3AA8A 1M5PC 1FVQA 2BW2A 3A4TA 2CPIA 2KN4A 3DU6A 4USMA 3A12A 3NG8A 4M5HA 1IM6A 4CLYA 1JKHA 1HQ2A 4TLRA 2DXDA 4FXDA 3CCUS 3DLKB 1R0CB 2JEIA 2DHSA 2JFDA 4O44B 1JLAA 1SH2A 1KFSA 3ETMA 1N5VA 1Z2ZA 5J2NB 4NZ0A 1ROFA 3ILIA 1T3NA 1VJQA 2BM0A 2B0GA 4ES1A 2SXLA 1I3OB 1IBCB 3L7UA 2J7WA 3PJ9A 1Q7YT 5F3TA 2X3DA 4MJKA 2F63A 1RAOA 1JLCB 2YTCA 2KJVA 4KKOB 3EM1A 4DX7A 3B4DA 2BYCA 2YKNB 3W2WB 2QE5A 3CCWA 4ED7A 3MR5A 5CD4H 2W25A 4RUHA 2OLWA 2D3O1 1N54B 2MTLA 4L72B 4URQU 4RW4A 2DY9A 4LJMA 2FJVA 1S6PA 1UMJA 4LR9A 2IVYA 1RSCA 1O51A 4KGMA 2GC8A 2IMWP 1C0UB 1E6YB 1V3ZA 3MFIA 1BQNA 2CYYA 3H90A 3G4SS 2NXJA 3TO8A 3IP0A 2M52A 4J5OA 5A6WA 2LCWA 4IRDA 3NGRA 2HW3A 4A8WA 3BDPA 4OZNA 3LAKA 2MLXA 3BGOP 1FJGJ 3E51A 1YKWA 2HNZB 5DLGA 3ENQA 2BKOA 4AXJA 5I3UA 1FE0A 1CULB 3KG0A 1BGXT 3BV8A 3IGVA 2RS2A 1PC4A 2HMIA 4RW8A 3T1YJ 2QMUB 1F9HA 1E6VA 4U7CA 3L09A 1Q79A 1IKWB 2ADBA 3LP2A 1LWEB 5CYJA 4R8UA 3GFHA 2GQQA 3ITHB 3AXMA 4X4NA 2YNGB 1WDDA 3MUVP 4MIWA 5HJXA 4RJVA 3O3LA 2LYVA 2HFSA 1AW0A 5ETLA 4QWBA 3CJ3A 3RBDA 3RB0A 2FYXA 1DTQB 4PXBA 2E7VA 4BHQA 2BJ8A 1MU2B 2F4VJ 4J9KA 2HRYA 3FJ2A 2ROGA 4DV1J 1TU0B 4NCGB 5F0WA 4H4KC 1NJIT 4ICLB 2Q6BA 3MMBA 5ETRA 2HIYA 1FRKA 2KG1A 2O01C 3R9LA 3L3CA 3UO0A 4WIQA 2QYGA 4ALZA 2DRBA 3HMJG 2CQ3A 2NSBA 4B9MA 4WE1B 2ZC3A 4G6VB 4I1TA 2I5JA 3DHXA 1NZAA 2UXBF 4QR1A 2ZWOA 3PO5A 2HVZA 4LF6F 4ZVSB 3LWMA 3HULA 2MKYA 1QTMA 4KV8A 2A18A 1AYEA 4H54A 5C42A 1W26A 3D6HB 4CLZA 2RF2B 1IR2A 1RLDA 2HHWA 4KR0B 1FDNA 4RW6A 2G2OA 2EG1A 2YWFA 4KO0A 1WKKA 2HQIA 5DG8A 2AEMA 1RISA 2GCFA 4X65J 1UPPA 3M30B 1N33J 4PUOB 2QFJA 4YR3A 4A46A 4I0WA 1ZETA 4DL7A 5LT5A 1JNRB 1VRTB 2R9LA 4Y2IA 2LP4A 4CLUA 2IA6A 2ADCA 2DKOB 3QWPA 4NLPA 2VQEF 4RNFA 3MR7A 4M8LA 2MZRA 2W2OP 3PYDA 3Q83A 4PAAA 1IKXB 8AT1B 3VWSA 4X84A 1KTQA 4OHZA 4RUBA 1C0TA 1HD1A 1QAJA 5ETVA 5KT6A 3MXHP 3C6UB 1YZ7A 2KYZA 1RWMB 4O0IA 3LGHA 3DLGB 2KI2A 1BUXA 1F60B 1U02A 3HSGA 2NCKL 2YX4A 4I68A 3NBPB 4NL5A 4Q2LA 4CP5A 2BQUA 2OAUA 3FEYB 1UW4A 2GGPB 3MEGB 1X5SA 4URGA 1CS4B 2XS7A 2FJDB 1LWCA 5K9FA 3G71S 1FK9A 4JYAF 1X60A 1VJWA 1EB0A 1J5OB 3N79A 2FVSA 4DR4J 2KT3A 4JV1A 2J9EA 4DZDA 1CG2A 1L5UA 3BSAA 3PW7A 4EO6A 5T7LB 1HNIB 2HBZB 5D0GA 4I64A 4J90A 2BQRA 1U2CA 1NM2A 4EO8A 4ID5A 5KG1A 2VG5A 5D6GA 3SBMA 5KOWA 3HO1A 4KYZA 3CCRS 4UUXA 4NMLA 1VHIA 2V6AA 1TFWA 1JLQB 5HBMA 1NKBA 1F3VA 4JI7F 1F2HA 1WKLA 4DV0F 3UN3A 1NUEA 3CMES 1NK6A 5KFGA 2MGZA 1RT4A 1VYAA 3OTCA 5L1IA 2CKWA 3S6EA 2CJQA 4RU2A 1L3SA 4P10A 4Q45A 3R6LB 3DOLB 2LQBA 3PR5B 4M1KA 2D1CA 2JJ4D 1YI2S 5KFKA 2OD6A 1NK7A 2VFUA 1TV6B 1NPRA 4HH0A 1X4FA 1Q5VA 1XMOJ 2N3OA 1S7HA 3T6BA 2BVZA 1YBUA 3DN9A 4IOAQ 2R7OA 2BJEA 4YHHJ 1JLEB 1LXNA 2GV1A 4G1PA 4LBPA 3CJ8A 3EX7B 5KFCA 1Z4UA 2JEJA 4JI3F 3PX4A 1L3VA 3RB6A 2Z2ZA 2C42A 3J80U 3IS9B 5KT2A 4IRCA 3R1HA 7FDRA 3MHYA 1URNA 1NXIA 2EVZA 1UJ4A 4M5DA 4BWMA 2IJFA 4KT0C 3EUNA 4Q44A 5KTQA 1X4DA 1YJNS 1QVFR 3CO9A 4DSJA 5IQ6A 5IWAF 4OIXA 1HMVA 3MM5A 3LP0B 5EWEA 3PDNA 3G82B 3CCLS 1HW8A 3V81A 2WW4A 3EZOA 4OYAA 3GIRA 3FVYA 4DPOA 4RBTA 2P5VA 4UOFA 1Y3KA 3EXYA 2Z56B 3EZ5A 4A8FA 2J8SA 2E1RA 1SC4B 5CABA 2ZNYA 2H3EB 3DGVA 5EWGA 4GMKA 2XMAA 1JJ2R 3VAKA 4CLKA 1CJKB 4ETZA 4QW9A 3PJWA 2BQ3A 5CAAA 3PZPA 2HSEB 2NQPA 1QSYA 2OPPA 1I1GA 2EC2A 3JQJA 1NB2A 4F36A 1TAUA 1U45A 3VGUA 2XS2A 3CWJA 2Q3PA 1C2PA 4B9LA 1F3FA 3OHAA 2OEJA 2VKZG 3RZAA 1ZPWX 3NKYA 1N6QA 2H48B 4CLTA 5E3CA 1C4CA 5A8WA 2MJUA 1HR0F 3TYTA 3BYPA 3AJ1A 2DGUA 4I7FA 1IBKF 4PCQA 3UD5A 2DEIA 3RRKA 2VBYA 3QJPA 2UVUA 4OHXA 4ZLPA 3OSNA 2JEGA 1NHVA 4ZCKA 1RE1B 4I69A 4ZPVR 5D77A 2OGUA 1YRUA 2F3JA 4GC6A 1VQPS 1TFYA 4WJBA 2QLBB 2FC9A 3OW2R 5ETOA 2CVIA 3FZBA 2Q43A 4R25A 5DQIA 4WK3A 4ZVQB 5J2MA 2BRKA 3OL9A 4HT5A 1HBUA 2OPSB 4Y2KA 2QA4G 4LF2A 3R8YA 3P96A 4Y2MA 2A3JA 2Y3YA 1HQEA 2GHVC 2J6TA 1JXLA 4O44A 2OPQB 4O3PA 2NLWA 3HSZA 2E44A 3PIPQ 4DFKA 5J2NA 2DBBA 1S76D 1RJJA 2JC0A 3M8ZA 3QAEA 2ZJRQ 4OQJA 4X4TA 4IFVB 1JLCA 2FHKA 1KVKA 2XYHB 1B99A 1P27B 4ED3A 1RGVA 4KKOA 2AGQA 1A7GE 2RMLA 3M2UB 1VFJA 3NRBA 1LOUA 1MWZA 2VA2A 2YKNA 3W2WA 3WQPA 3RB4A 3F44A 2KT2A 2AGPA 3GG0A 4OLOA 1B7FA 3V6JA 1LK7A 4WP8A 4OZ0A 1X4BA 4ZVTB 5H9FK 3W66A 3LO3A 1TK0A 3GILA 4B9VA 5GAHU 4JB8B 2C3UA 4CO1A 5THWA 3ZTPA 2HGMA 2HVHA 1RP5A 1CLFA 1UVNA 1E6YA 2HFNA 2XGPA 1W25A 4DR7J 2HBRB 3M2VB 1NK4A 3K17A 2F8EX 3SYZA 2C2DA 3TRGA 4J9NA 1HWJA 2FGOA 2H65B 1NDPA 3TW0A 3ZNUA 2HNZA 4PYDA 3NMAA 4DV5J 3Q0AA 3M8RA 4XAKA 2ZOMA 5L9NA 5M2PA 3HZEA 3OTDA 1WELA 3TQ1A 4ECQA 4OHWA 4EBCA 2DPJA 2IM1A 4A8YA 2JVRA 2GJFA 5KFTA 1LW2A 2RRAA 3CCQS 1RBAA 3BQ1A 4FYDA 1RTIB 4WFYA 1BMQB 1MMDA 5FLXY 3SCLE 1IKWA 1B64A 4TXSA 3P4UB 2CPYA 1LWEA 2W2PP 4IG0A 2Y9HA 3GV8B 2AX1A 3HT0A 1KDNA 4DF4A 1S4FA 2W7AA 2YNGA 2J9DE 4JI0F 2WCXA 1TL4A 1HHTP 1LEOA 1WSRA 2MB0B 1DTQA 1JNZB 3TZWA 1XN9A 1MU2A 3QT8A 2CQPA 4F3QA 5FIIA 3PYEA 4PG7A 1PBAA 4NCGA 2DXEA 1J27A 4JI5F 3C3LA 4ICLA 4DS5A 4HYKA 2RVJA 1FEEA 3NMRA 4HH1A 1K47A 4ZN3A 2GIQA 3MMAB 5B0AA 4CCHA 4YS2A 3RAXA 4KY3A 2PE8A 2GQ2A 2XCPA 1SXLA 3H7HB 4HI1A 1VBYA 5D4OA 3UDEA 4TN2A 2IBKA 4UF4A 4TYBA 4JI7J 1WHWA 1XR5A 4IG3B 5CCMA 2CQ4A 4M5LA 2DR5A 4B3MJ 2MZTA 3GYXB 1X9SA 1N5TA 2NUHA 5JXSA 4QU6A 4TU7A 3KHLA 4Y2CA 1RHJB 3AOAA 4DX5A 3M30A 4PUOA 2KFYA 2W7OA 2QLXA 1BXNA 4HTIA 3BBCA 2R7SA 2CPEA 4D3HA 1P1LA 1VRTA 2C3MA 1H2UX 2W2NP 4UOHA 2VG7B 1F2GA 2E29A 2FUG9 3DLJA 5GAGU 2Y0SD 3RGIA 2MKSA 3S1TA 4NYPA 1DQ9A 1N5SA 1Y4ZB 4Y3CA 4CO3A 3DC2A 3QZ7A 1BLUA 3VAHA 3F0NA 4HHHA 1EHWA 2UUWA 2XWYA 3T5LA 2RQCA 3G86A 1S0NA 2NPFA 2D41A 1XR6A 1IKXA 3Q8SB 4FKYA 1HWKA 4HI2A 1YWXA 2V8DA 5K14B 3HSDA 1O5JA 4FXWA 4DUZF 2KB2A 4EEYA 1RTZA 3TX0A 3C6UA 2E9RX 3E2EA 4U67Q 3L4BC 3DLGA 3IMQJ 1P6TA 2CPZA 2O66A 2AMCB 1U1LA 1VLOA 3NBPA 2QT7A 2LA6A 4L75A 3FK4A 4L3KA 1QE1B 3R5GA 2GGPA 3AODA 1T05B 2BR0A 5KFWA 1UJ5A 4LQ9A 1CS4A 3IR7B 3HZGA 5EX0A 5KOXA 2FB0A 3KK2B 4DFJA 3TOQA 3ZTRA 1OS5A 2E1PA 3CMAS 4JI8F 2KXHA 5CYMA 1WHXA 2ZKTA 2KU7A 2HLUA 2DHGA 2V8HA 1J5OA 4OJHA 1KRPA 3HX9A 3M6WA 3MMJA 4DJBA 3NNAA 2E7WA 2B51A 1R27B 1VBXA 3DI6B 3GSIA 5T7LA 1HNIA 2BRLA 3VAFA 2F8HA 4ZJOA 1TK8A 3JQMA 4A8SA 3PO4A 1B4SA 1NLKL 2F40A 1HBOB 1FDAA 1RZMA 1EKRA 4UUWA 3R27A 3GONA 4MT1A 4OYBA 4CQ1A 4C9DA 1N36F 5D4NA 1GMWA 1SV5B 1YZ6A 4OJ1A 1NKCA 5LMNJ 5KFVA 1P9YA 3KYLA 4LUBA 2EBGA 4CH0S 2C28A 3CE8A 3C6TB 1ZH5A 4USUA 4X2BA 4LSNB 3K8WA 3HI9A 3CJTA 5E0OA 1SB6A 1U1PA 1QSSA 3O2IA 3M2RB 2HAIA 1S1WB 2ASYA 4QR0A 3DOLA 4MYUA 5F9LA 2UU9J 4DN0A 4HEA9 4LFBJ 2LDIA 4QIGA 1DTTB 2K7JA 5ETKA 1TV6A 3DYAB 2HBYB 1FXLA 4E8UA 3R2CJ 5ETQA 2C2ZB 1JLEA 2KM8B 1HFEL 1RT6A 5AJ3F 4ERDA 2EKNA 1VBZA 3P5TL 1RCXB 3GIIA 3J81j 2Z2MA 4RBUA 5HQMA 2W2QP 4D3GA 2V9KA 2WB4A 3PW2A 3SIPB 2R7QA 3BR8A 3SI8A 3MCNA 2KXNB 1S0OA 5F8GA 2WB1D 3NNHA 4B17A 3D1OA 3GIJA 4JI6F 1R8CA 3C8YA 2JOQA 4FVMA 2FJBB 4ECVA 5DQHA 1U1OA 2MQMA 1M5OC 1FE4A 2ASJA 4W4MA 3THTA 3LP0A 3JSRA 2B9YA 3G82A 3HK2A 4AFFA 4ZVUB 1GX5A 1RT2B 3KKFA 1TMJA 3KWMA 3KDOA 3X3UA 1RUSA 1JJCB 3M8WA 3AB4B 3KG1A 4ECZA 3IR5B 1NEEA 3OBIA 1OWXA 4X64F 1S5ZA 4B3OB 3NGTA 2DJWA 1CQNA 5B0DA 4ZVRB 3LQVA 4KGKA 1OQ6A 3EZUA 4NWBA 1CJKA 2I2YA 3HD1A 1KOOA 5L1KA 4XTTA 1GMVA 3JTPA 3CIZA 4YR0A 2HNYA 4DFMA 1KNZA 4NMXA 3MMCB 2P6TA 5HK4A 5DDQC 5FDLB 4USJC 1JIHA 1KR4A 1IR1A 1ZM3A 2RHSB 1IWGA 4RLEA 3W8GA 3UQSA 2W8KA 1RWWB 1JMTA 3IR6B 4JBCA 2B5JB 4YOEA 3QO9B 4XDCA 3CCES 1QAXA 4C0HA 4K0KF 3HD2A 4DV7J 2HFOA 1ZM4A 3NS5A 3QFWA 3D54A 2RKIB 2KL8A 2RRBA 3I96A 4DSKA 1VHFA 2V4JB 4ANEA 3MD1A 2OPSA 3EICA 2LXIA 1LFWA 1DJ0A 1L3UA 1XNQJ 2V69A 4B9NA 3BGUA 1X0PA 1MMNA 2NZCA 2GO8A 5KFJA 1KQSR 4ELTA 5HQ8A 4P75A 3ZZRA 2HK2A 2UVWA 2MEWA 4Z37A 1TL3B 3OR1B 3KJFB 2HFZA 1HWIA 4TYAA 2GW8A 4MIBA 2CQ0A 2BA9A 3DOMB 3U02A 2Y8YA 3UN2A 1RI7A 2CIMA 4F3OA 1TUGB 1X4GA 2BANA 3PFOA 4I2QB 4OZ2A 3AB2B 3V6HA 2BE2B 4K2XA 4V19X 1MWYA 2MLZA 2MY8A 4X4VA 2UXCF 4IFVA 3MEDB 4RU9A 3EYZA 2AJ1A 4N5SA 2M2BA 3VTIA 3M2UA 4KC5A 2XMMA 2OH2A 2UUBJ 5G4DA 4NCAA 4OI3A 2MZ1A 1R43A 4X62F 4M94A 4RX6A 2RDIA 2XY6A 2XBPA 1PYSB 5KT4A 1MW7A 3KUEA 2P9GA 5H9EK 1VQ8S 4MMOA 3CTRA 3DXBA 4QBUA 4PG5A 1DBDA 3KMSA 1Q7LB 4YMEA 3P45B 3NY0A 3TA2A 1WORA 4ILRA 5F8MA 3ZTQA 4UQTA 4A8QA 1OY9A 2EFPA 4IO1A 1CJTB 3KHGA 3M2VA 4DV4F 2BE9B 2UXDJ 2IPOB 2LECA 2VC1A 1S97A 4TKTA 4K4VA 2QV6A 1H98A 3ZZYA 3GPAA 2V0NA 1HNZF 2PC6A 4O3QA 4RBVA 2RJZA 3GR1A 1UA0A 3ZO7A 1OIAA 3TUPA 3K89A 1PKUA 1WC4A 1XMQF 5DRKA 3T5HA 4RW7B 1PJ6A 2DR7A 1T8EA 1Q1KA 1T9WA 4DUZJ 4PPDA 1H74A 1RTIA 1VLYA 3M32B 3QIPB 4BBYA 2GS8A 2XLKA 4CH7A 4OJ3A 3W5XA 3HHNB 3HJFA 1R0AB 1CJVB 2HFUA 2ACYA 4F04B 4OYPA 3I4PA 3HVAA 3DRXA 3NEKA 1U25A 1S49A 1T0TV 2C2MB 4LR7A 3VAJA 4MIAA 4USWA 2GVZB 1U49A 3T9NA 3RRGA 1N34J 3DMJB 1WEYA 2BACA 3MM8B 5I42B 4ZCMA 1DLOB 4K4WA 3MMAA 2U1AA 2ZZNA 4UW2A 2A10A 2DT9A 1S48A 2HZCA 4YB6A 3PW0A 3BREA 3FRZA 2XG8A 2X1FA 4DFPA 4TQRA 2DGVA 2ROPA 4ZOSA 3BBBA 2DR9A 3FNNA 4Y2AA 2ILYA 4KH1B 1KN6A 1ZAWA 2R7VA 2XZTB 2HS3A 2VODA 4IG3A 3BSOA 2KRRA 4GKKF 2M8DB 1JWWA 2YBVA 5L1LA 3VHQA 3JQKA 4OX9F 5K8NA 2MZQA 1IR0A 4NYZA 2WTFA 4BWJA 3MECB 3R1LA 1GX6A 4F4ZA 4NLOA 4DV2J 4NXMJ 1TAQA 3PEJA 3NP5A 1Q82T 2J76E 2DNHA 4ZPCA 3W62A 3BDEA 2VG7A 4WCEQ 3EWGA 5KFFA 2DNGA 3GU0A 4ZPAA 1JLGB 4JI2J 2KVIA 5AJ3J 3TNVA 1HNXF 1X7VA 1ZOTA 2PDAA 2K06A 3ENAA 1O6XA 5K14A 1WG5A 4LF4F 5K8OA 2RUSA 2VFTA 1K9MT 3ICLA 4TNOA 1BC6A 3BZQA 3BGRB 1HQUB 1JJHA 2EFGA 4F67A 3AD7C 2RD5C 3HHLC 3H5SA 1UWBA 2QL9B 4NLDA 2EPIA 2ZE2B 4HHUA 2CXEA 1WUUA 2B56A 3HVTB 2L9DA 1QE1A 2A6MA 5KFRA 1T05A 1CPZA 1NDLA 2QG9B 4ES2A 2ACMA 2H5EA 1I94F 1ZA1B 2AT1B 1FF2A 4LRAA 2ZEJA 2HZVA 1NO8A 1WWHA 5L38A 3PIOQ 1V9OA 4ZN1A 5BR8F 2BDPA 1MROB 4ECWA 1W2IA 3HFZB 3QJLA 3I0RB 2ZZTA 4FBTA 4KB7A 2VOPA 5KT3A 1JLAB 4TY9A 3Q22A 2F7VA 3PYGA 4U6PA 2KXFA 3DI6A 3EGZA 2KTQA 1GTEA 4DV3F 3CB4A 4K59A 3PEHA 1UVMA 3G8TA 3IO1A 2IHR1 4QPXA 2I1RA 3R5JB 3Q8RB 3M4XA 3ZFVA 2M3DA 2HS4A 4P2FA 2AYMA 2NR0A 1HBOA 2YKAA 5F3ZA 5JMNA 2MKJA 3UD3P 1NH7A 3I32A 3D3BJ 5ETSA 1PO6A 2D7SA 3QGIA 1SV5A 3HHLD 1D9AA 1TL5A 1U1RA 4AE5A 3SDEA 4YY3F 1VOMA 2K7KA 4USIA 2CNOB 1O0PA 2MKHA 5LSLA 2DGXA 2V4RA 4PWDB 1S4EA 2YWEA 3M2RA 4FF4A 3OLBA 1U1KA 1S1WA 5F8IA 4USTA 2XEXA 3ISNC 3NS6A 3LOUA 1DTTA 4CNZA 3TAMB 3TJAA 1J5EJ 3HKWA 4J91A 3DYAA 2PI5A 2QIFA 5U47A 2O67A 4NXNF 1VISA 2LEAA 1RTDB 3OXFA 5IV3A 2DGSA 3P3DA 3FRYA 2OKQA 4C3KA 4DV6J 3NOGA 1M1KT 2QJ3A 3R97A 4JI1J 1N4LA 1PGZA 4UY8T 3VF0B 4KHPF 2VFSA 1GFWB 2FHJA 2KHDA 1XNRF 4B3SF 2VV5A 4QYZK 1J2VA 1VQYA 3RR8A 3MZIA 4OL8A 3UWTA 3M9OB 3EPIA 3O8WA 2MY7A 2WZ1A 3IBWA 2MZSA 3LP2B 4P2MA 1IVZA 2ZM6F 1RT2A 1BHNA 5E3AA 3CF5Q 3ISND 3D28A 2U2FA 4H4OB 3D6TB 3AFGA 3CD0A 3O5TB 3I31A 2HEKA 3OD2A 2X1GA 3U1MA 5KFMA 1NCLA 4U8VA 4ZP9A 3CCZA 3D66A 3ONQA 4B3OA 2WK4A 5GMKa 4O4GB 1RACB 1GAOA 4ZP6A 4RUAA 4ZVPB 2CA9A 1X31C 5KG4A 3MMBB 3J7AN 1RT7B 1UETA 4QWEA 3AAWB 1FTCA 3JSYA 4S0MA 5RUBA 5T14A 3OL7A 2HAFA 3IRXB 3CCMS 2BUNA 2DO0A 5FDLA 2VH7A 1RAAB 2V34A 2G13A 1NJWA 4AL6A 3EJMA 2EBEA 4ANCA 1R6YA 3X1LB 2G0IA 1LFPA 4O3RA 1MWQA 3FC9A 4UZBA 4KV8B 1TR0A 2XY7A 2D3UA 2RQMA 2FVQA 5IT9Y 1WEZA 5C42B 4DL5A 4RUCA 1VQMS 3Q8VA 2B5JA 2PN6A 3QO9A 4MKVA 4DX8H 1WHYA 3V6DB 2RH3A 2MQOA 4H4MA 3H0PA 1BE4A 3SQOP 1GK8A 4BC9A 2RKIA 5C24B 4LRCA 2CWXA 2VPXB 2WONB 1NK9A 3OJUA 4B08A 2RAQA 1WJ9A 3BO3A 2OMOA 2V9WA 2V4JA 4F0MA 3QNWB 2YPZA 2M4MA 2YY3A 5HL7Q 1HBNB 3DKDA 1JLFA 4Q5VA 2LQ8A 1TL3A 4LR8A 4U9RA 3VAIA 2C1EB 3IAM9 3FSXA 4M95A 1AROP 1KWMA 2XYGB 4QU7A 1V3SA 3DOMA 4OYZA 3U27A 3T1YF 3MM7B 3AA9A 1GMWD 2BE2A 1U8SA 2WVFA 3MEDA 1AXQA 2UP1A 3H5XA 2I8EA 3VAGA 2W8LA 1R31A 2XNQA 1ZYQA 4LFCF 3MPDA 3GIKA 4KJIA 1Q16B 3HHKA 3QRPA 4TVAB 1KSPA 3SEOA 4DR3J 5JJBA 1NK8A 2ZDPA 1FD8A 1VK8A 2F4VF 3W5YA 1DQAA 1NRKA 3I5AA 3OR2B 2B8PA 4DV1F 3N6LA 1OY8A 1QD1A 5LJ3Y 2Z58B 1NK5A 5D3GB 3I0SA 2RIJA 5AT1B 2JLGA 2ZUGA 3GJTB 3B6BA 4DQQA 1CJTA 2CDQA 4P9SA 1ZBTA 5KG2A 2P9EA 1KS2A 3BN4A 3IXQA 3JSBA 2BJ9A 2QSFA 3OXLA 3CDAA 3AD8C 3H2VE 2CZ4A 1VIOA 1IUJA 3T6JA 1Y5NB 4LREA 1S7IA 2WVCA 1EKSA 2NXEA 3N0VA 4XK8C 5GMDA 3I5BA 2QO3A 3M8YA 4RW7A 5HMWA 4DI6A 5EDWA 2ZH8A 3LP1B 2CQDA 4I6YA 4I2PB 4E98A 1RWNB 4O3NA 4X65F 3M32A 1SCJB 3QIPA 1G6BA 1N33F 3CCTA 2BOAA 2L9WA 3IRWP 1R0AA 4A8OA 1CJVA 1FTRA 2PT0A 1S9FA 1PAUB 4CLLA 4ID8A 5E3QA 4ZPBA 3VGTA 2HQGA 1H38A 1D1UA 2XSJB 2FHMA 2ZH4A 3FUYA 2HURA 2HNDA 4K7QA 1LWFB 2GVZA 2APOA 4Z7YA 5HQLA 2FLOA 2RDDA 4NLSA 1PCAA 3DMJA 3BJYA 2W9BA 1Y10A 2VKRA 3VQSA 3FBCA 5BYQA 1DLOA 4WXOA 2OSRA 2C22A 2RT3A 3I5CA 4NLYA 5KFXA 3QIDA 5EGYA 4J7CA 2V8VA 1RAJA 2X3GA 4WIIA 1UP1A 1HMVB 4WXWA 5HMYA 1HWLA 5CYQB 4U8YA 2E5JA 2LMIA 2ZH6A 3V81B 1GXTA 2FQQB 3A13A 4F25A 4DR2J 5B7WA 1DRZA 4ZPDA 2B9XA 4CZCA 2GHWA 4DR4F 1PC5A 4KH0B 2YH0A 3I55S 1P9QC 5IT0A 2AEFA 1OY6A 2DY1A 1URRA 3TARA 1R8HA 3MDFA 3M6XA 3OFFA 4W92B 3GJQB 4K4ZA 4NLRA 4ZCLA 4O3SA 3THPA 5AE2A 4CLSA 3OSPA 4GRSA 4EYIB 3FQLA 2IRXA 2WSEC 4WP3A 5LMUF 5AXLA 2N4CA 4URSA 2XNRA 1HA1A 5BYRA 3RJMB 3RBZA 1HNWJ 1FESA 2OI2A 4TY8B 4I7FB 1CQMA 2VASA 5KFOA 4C8LA 3BGRA 1X8DA 3GE9A 2HGLA 1HQUA 3ENWA 4DCOB 4YEAA 1TQLA 3TAPA 1H3DA 2LXUA 2R3VA 2AWZA 3Q8UA 1B0PA 1RT5B 2ZE2A 3NOCA 2GIRA 2HHPA 5ITHA 2RU3A 1W2BR 4NZ6A 4FXVA 5DGAA 1XMOF 4L3NA 1YJTA 4YHHF 2R2UA 1FRJA 4P7TA 4OZ1A 4TU8A 2Z2YB 2UV8G 4NYOA 1MROA 1HQEB 1SC6A 2CZVC 1QY7A 3I0RA 2Y1JA 4X4SA 5IC6B 1N0VC 1RAGB 5HSPA 3MAHA 3I87A 3KLHB 2NYHA 1DZ5A 4L76A 2J8AA 1B70B 1YHQS 2P9CA 3Q8PB 3ETOA 3UD4P 5HI7A 2PGCA 4F2RA 1TKXA 2V68A 3FSIA 3UVJB 1H2TZ 5H1SV 5AE3A 3KK3B 3KMQA 4OI0A 2ASLA 2FJEB 2DHAA 1WNEA 1I5OB 2MJNA 2OHDA 5J1NA 4NEZA 2EWHA 4CLWA 2UV8A 4ZMMA 4M5NA 2HQ3A 4NE9C 1RHQB 3VZIA 5KFHA 2UUAJ 3K5PA 1KHVA 4NZ7A 4PWDA 1GMUA 3MPVA 5E33A 5I4MA 2H4WB 3HVWA 2C2EA 4DN9A 3CC4S 2Z2LA 3TJ9A 1U8WA 5JUMA 1Y7PA 1SC3B 4WFNQ 2IM3A 5KFQA 3NAHA 1U4BA 2LFVA 1OO0B 3ZZPA 2OIHA 3TAMA 1UEKA 1H2VZ 2IVFB 1MN7A 3F41A 1AUSL 5B0EA 3BSNA 2D9PA 1UVLA 1UZHA 1KEKA 2CNLB 3MPYA 4K5SA 3D6MB 1WF2A 3ET6B 4WYLA 1RWVB 2CNNB 1RTDA 3D3CJ 5A76A 4WFAQ 2IA0A 3WIUA 2XYPB 2IYIA 5CA5A 1TUVA 1U7LA 4R5PB 2DD8S 1K8AT 4OZ3A 2ALYB 3LH2S 5J2QB 2HRUA 3TAQA 4F7VA 4GKJJ 2N82B 1ELOA 4CTAB 1EX8A 7AT1B 4L73A 2R8IA 3OL6A 6FDRA 1LW2B 3J7YU 2NPIA 3J7ZT 2RQKA 2BOPA 2KRBA 3I82A 3VGSA 3A3OB 5GVQA 1TL1B 2AV5A 3BPDA 4DWIA 4IG0B 3TZYA 4LRBA 3RW6A 3D0HE 3OTOJ 4LFCJ 4IR9A 4H4OA 2YNIB 3CJRA 3LGNA 1CC7A 1B0VA 3B4MA 2E5GA 2NREA 2LU1A 3BPSP 3W8PA 2VJVA 1RK8A 2V2ZA 3EVWA 5KFSA 4A48A 4O4GA 3CJKB 2ATCB 1F1BB 1NZ8A 1FJCA 1X4HA 5KFNA 3HT3A 2HGNA 4AL7A 1TKZB 3BH7B 2H51B 2JFKA 1U48A 4YQWA 1RT7A 4OZJA 3J7A1 2LXFA 3IRXA 5IS2A 4QCLA 1IXKA 2R7TA 2Y1LB 2AJQA 2AJ4A 4RNOA 3QYYA 1K1QA 4ZIWA 1KVIA 3UN5A 1SJQA 5DJBA 2QLJB 1T7PA 1WDTA 4AL5A 4PEOA 3JXOA 3V6DA 1V5IB 5HAOA 3MUTP 3O6QA 2HHHJ 5E3RA 2XCAA 5DG7A 5C24A 4U96A 2WONA 5DLFA 3FGVA 3RR7A 4DR7F 5GADU 6FD1A 1IBLJ 5B08A 3PG9A 4ZJQA 1T03B 2R7UA 1VRQC 2DCUB 4O4RA 2BKNA 4CM2A 1HBNA 2DGQA 3AXKA 2FLNA 5CH7B 1KLNA 1SKSA 1SH0A 1M5KC 5DZ7A 4DV5F 2DNKA 2XHWA 2RB7A 5C25B 3MR3A 1HKAA 1JX4A 1S0VA 2G4BA 2WSCC 2AF6A 2ROEA 2XO7A 4ETXA 4KGXB 1FRXA 4QZVB 3MM7A 2MQPA 2FY8A 2I38A 3TUZC 1YJWS 2H4YB 1RWUA 4B9SA 1TVRB 4J9PA 4DLGA 2G9OA 2AKWB 5KAKA 4ED8A 3JYTB 8ATCB 2WBRA 4MYTA 3DGPA 3MPUB 3GCWP 3ZZ0A 3W9IA 5KFZA 5CYMB 5F41A 2DPIA 1S9GB 4NEYA 3OR2A 3JB9k 4NRUA 3BO4A 1S1VA 3FFIA 1JXEA 3BH6B 4EI2A 4DQIA 5D3GA 4ATNA 4LF8J 5LOQA 2QMWA 4MKBA 1TKDA 2MMYA 4ZLJA 3R5AA 2ZBRA 4ED1A 2VHGA 1FNOA 4MK8A 4AQYJ 2FHJD 1YJUA 1S6OA 1M5HA 2AZ1A 1U6BA 3MCOA 2NXNA 1D0EA 3SV4A 4PG4A 3THVA 5J2PB 3IG1A 3A8KA 3KLFB 5LMUJ 5IT9U 4NLUA 4B3MF 3DRYA 3L7PA 3J81Y 2LA4A 5DDPC 2PIIA 3LP1A 3P8BB 3VZHA 4I2PA 2YKMA 2E5HA 2ATLA 2V5HG 2LEBA 2F8MA 1FD2A 2WOMB 1ZZFA 3SSSA 3N28A 3IFEA 3KNGA 1Z1ZA 3PVXA 2E9ZA 1NAQA 3QLHB 1H7XA 3HF5A 1RHKB 4PG6A 1R7IA 5KG0A 3KOAA 2XSJA 3KNAA 2PD1A 4F4AA 2AP6A 3H20A 2YQ3A 1RT6B 1LWFA 1FKOB 1H72C 3K5LA 2KZZA 5CD4A 1OPIA 2OJ3A 4GC7A 4F0KA 1UKUA 5H9FJ 1FRIA 3JSMB 5B0BA 1WOOA 2EXUA 1REVB 5LSRA 3ILOA
chains in the Genus database with same CATH topology
1JLCB 5GAEU 1JLBB 1QSLA 2LQ9A 2YTCA 5L8RC 1T95A 2OFHX 1XMQF 3DOKB 2LLZA 5DRKA 3T5HA 1Z2LA 2KJVA 3H25A 3CXCR 1EP4B 4RW7B 2PI4A 1Y0HA 4KKOB 4A4JA 2LQJA 2DR7A 2HHUA 3B4DA 1T8EA 3CJ5A 2R8HA 3M8SA 4HVZA 1Q1KA 4FF3A 2BYCA 5E3PA 1ZPVA 4PPDA 2YKNB 5CYQA 2UUAF 3W2WB 1DAXA 5A8RA 1KHWA 2PMZD 1RTIA 1VLYA 3M32B 1IM4A 3MEGA 3H5UA 3QIPB 4BBYA 2ZJPQ 3MCSA 2QE5A 3MGJA 5EHHA 4QOTA 2XB2D 3CCWA 2XLKA 4ED7A 2EI5A 4CH7A 3MR5A 4OJ3A 5CD4H 2F1FA 1C4AA 2W25A 2B6AA 3CT9A 3HHNB 4RUHA 2IM2A 2OLWA 3HJFA 1R0AB 3BQ0A 1N54B 3QMQA 2ACYA 5L9XA 4L72B 4URQU 1HWUA 4RW4A 4LJMA 2FJVA 1S6PA 4YP3A 1UMJA 3I4PA 4MFBA 2IVYA 5M2RA 2LKZA 3HVAA 1O51A 3DRXA 2CQBA 3DDKA 4KGMA 1U25A 2EFNA 2GC8A 4UQGA 1JJ4A 1C0UB 1S49A 2IMWP 1FCAA 1E6YB 1V3ZA 3MFIA 1BQNA 4C3MA 3VAJA 3DXSX 1VC6A 2K3IA 2CYYA 4FPRA 3CJ2A 4MIAA 4ECTA 4QIWD 3G4SS 3OL8A 2ZBIA 2UZAA 1SKWA 3TO8A 4WKRA 1ZAVA 1IQTA 1U49A 1FJ7A 2CJBA 3T9NA 3RRGA 4DG1A 2M52A 1HHSA 4QIEA 4J5OA 5A6WA 2LCWA 4IRDA 1C1CA 4IOBA 4C11B 2HNYB 3DMJB 1VQ6S 1QM9A 2HW3A 2UUTA 4A8WA 4I67A 3BDPA 1WD6A 1WEYA 1SJRA 4OZNA 2X1AA 3LAKA 2BACA 4C98A 2W9AA 3E51A 3MM8B 5I42B 2C3YA 2HNZB 1H7WA 1DLOB 4ZCMA 4K4WA 1YTYA 1HI0P 1FT8A 1JLQA 3MMAA 2U1AA 2ZZNA 1Y00A 4UW2A 5DLGA 3ENQA 3EPGA 4WU2A 2A10A 2DT9A 5D4PA 4AXJA 3TA0A 2JDJA 1BQXA 5I3UA 1S48A 4PG8A 1FE0A 2HZCA 4YB6A 2DNNA 2GMJA 2VFRA 3KG0A 3PW0A 2HPUA 1BGXT 2GX8A 3BREA 3E01A 3FRZA 4IKAA 3NLCA 3Q8QB 2XG8A 2MSTA 3IGVA 5LMNF 4DFPA 2OTLS 4TQRA 2X1FA 2DGVA 2ROPA 3T5JA 2RS2A 4ZOSA 5B0GA 5C5JA 2L41A 3KLEB 3H5YA 1PC4A 4TY8A 2DR9A 2NZ4A 2HMIA 3FNNA 4Y2AA 5A6PA 4RW8A 2EK6A 1SIZA 1U26A 2ILYA 3N5BA 1KN6A 4CNYA 1ZAWA 5KT5A 2R7VA 3N6MA 1E6VA 4U7CA 2HS3A 4NLQA 4K4YA 4ILLA 1D8YA 4C8KA 2VODA 4IG3A 3L09A 3BSOA 1Q79A 3M9MB 1IKWB 2YKOA 5KFDA 2L08A 2RNEA 3ZZUA 3G96A 4FBUA 2ADBA 2KRRA 4C0BA 4GKKF 1IBMF 2M8DB 1JWWA 3LP2A 5MLCV 5L1LA 3LAMA 1LWEB 4J9MA 3JTNA 5CYJA 2UU9F 4R8UA 1SQEA 3GFHA 1UL3A 2JWNA 1RT5A 2GQQA 3ITHB 4IOCQ 3UR3C 4OX9F 5K8NA 3PV8A 2MZQA 1YG0A 3OTOF 2DNOA 4LFBF 1IR0A 4X4NA 4FP9A 2YNGB 2Y1RI 4NYZA 3MUVP 4MIWA 2WTFA 3I9ZA 3O3LA 5AE1A 2LYVA 1AW0A 4BWJA 2OO4A 3MECB 5IT4A 4QWBA 3CJ3A 3R1LA 3RBDA 1GX6A 3OTBA 4F4ZA 4JV5F 4NLOA 4MH8A 5BYSA 5HO4A 3RB0A 2ZJQQ 1DTQB 4RWWA 4PXBA 4QYRA 4MK7A 4BHQA 1TAQA 3PRBA 3PEJA 4ZHRB 5HN0A 4DQPA 1MU2B 3NP5A 4J9KA 1Q82T 2HRYA 4WTYA 1S1TA 2J76E 2PSZA 2DNHA 4ZPCA 1S1VB 3FFIB 4PXEA 3BDEA 4NLWA 2PA3A 2VG7A 3FJ2A 2ROGA 2HHQA 4NCGB 2MKCA 4WCEQ 5F0WA 2AYBA 3G9CA 5KFFA 2DNGA 4HDGA 4H4KC 4FVCA 1NJIT 2EC0A 1V6HA 4ICLB 2Q6BA 3MMBA 3CDWA 1K1SA 3MD3A 2IYGA 1FRKA 4ZPAA 1JLGB 2KG1A 2O01C 3L3CA 3AHPA 2KJWA 3KLHA 2X51A 4MAKA 4ALZA 4PRFA 2DRBA 3HMJG 2VBZA 2CQ3A 3IS9A 1YGYA 4CI0B 2KVIA 4YDDB 2ZHBA 4NLGA 2NSBA 4OZLA 4B9MA 2UVRA 3TNVA 2K2PA 2GJIA 4WE1B 1QLNA 2UVVA 1HNXF 2ZC3A 2VONA 4G6VB 4KHMA 4I1TA 2I5JA 4XIUA 2GHPA 3DHXA 1UVJA 3DRRB 2C3PA 1NZAA 1X7VA 4X4QA 4ZCIA 2UXBF 1S1XB 1ZOTA 4QR1A 3SCJE 3HXMA 3PO5A 2HVZA 2PDAA 3FDSA 4DSFA 4LF6F 2FGCA 2OD4A 3W3SA 3LWMA 4RNNA 1X5PA 1FDDA 5K14A 3KK3A 1WG5A 1HD0A 2BANB 4LF4F 3T1AA 5K8OA 2MDAA 4KV8A 2VFTA 3W2VB 2A18A 1K9MT 1QTMA 3IG1B 3ICLA 4LIWA 4TNOA 1Q78A 4H54A 1BC6A 3BZQA 3BGRB 3CJ0A 5C42A 3RB3A 3PR4A 3MAQA 2J6UA 1HQUB 2RS8A 1JJHA 2EFGA 2MSSA 4JUZA 4C8OA 4EYHB 4F67A 2RF2B 2VZ9A 2RD5C 3HHLC 3H5SA 2HHWA 4PQUB 4KR0B 2MQQA 3C2PA 1UWBA 1FDNA 4RW6A 4NLDA 4ZS6A 3MWBA 2EPIA 2ZE2B 5A0YB 5HLFB 2YKMB 2EG1A 3A8EA 2N4DA 2YWFA 2CJKA 3MM9A 4KO0A 3GV7B 3SZ2A 2B56A 2HQIA 5DG8A 4DLEA 3HVTB 2L9DA 2MXYA 1QE1A 4N8OA 2HHHF 3TVYA 2HWHA 2XMWA 1RISA 2QZ8A 1T05A 2GCFA 2JHEA 2OPRB 5KFRA 1AFJA 2FVCA 2J9CA 1CPZA 3M30B 4ES2A 4PUOB 2QFJA 3M6UA 2H5EA 2VG6B 1IJFB 1I94F 1ULRA 2ZZMA 4Q8EA 4X4PA 4YR3A 1Q8IA 4I6AA 1FF2A 4A46A 4I0WA 1ZETA 4DL7A 1IKYB 5LT5A 4WZQA 1F5AA 3OFEA 1NO8A 4CO2A 4OZ5A 2K1RA 3G6XA 1JNRB 1WWHA 2DNRA 5L38A 1VRTB 3PIOQ 5EUHA 1DURA 1V9OA 4AYBD 4C97A 3MF5A 2RU9A 1IBLF 5BR8F 2V94A 3MFHA 2BDPA 4IH7A 1MROB 4ECWA 1W2IA 3FSYA 3DLBA 2R9LA 3N9UC 4Y2IA 3QJLA 1XERA 1U24A 3I0RB 1KTVA 4FBTA 3E3XA 4KB7A 2VOPA 2HS0A 5KT3A 2VPYB 1JLAB 4TY9A 2IA6A 3Q22A 2ADCA 3M8QA 2F7VA 3GSDA 2R7RA 4U6PA 1M90T 2KXFA 2DNQA 3DI6A 3EGZA 2KTQA 3BB5A 1SH3A 3QWPA 1GTEA 2J9DA 1R8PA 4NLPA 3UFCX 2VQEF 3CB4A 4DV3F 5HP1B 4K59A 3PEHA 4RNFA 1UVMA 4M8LA 3G8TA 3HPOA 2FHOB 2MZRA 2Q1LA 3IO1A 2IHR1 4QPXA 4TU9A 3R3TA 4IYQA 2R8KA 2DH9A 2I1RA 1VS3A 2CQ2A 3M4XA 3D0GE 3ZFVA 2M3DA 4OMFG 2WW8A 3Q8RB 2HS4A 1IKXB 3M8PB 4R5PA 1DQ8A 2AYMA 3VWSA 4X84A 2NR0A 1HBOA 1KTQA 4OHZA 1I6JA 2YKAA 1S9EB 1C0TA 5F3ZA 1HD1A 2MKJA 1QAJA 4G1IA 4DOZA 1NH7A 3I32A 3UD3P 3R5DA 5KT6A 1PO6A 3MXHP 3C6UB 2D7SA 1VQOS 2F9JA 4HLBA 3QGIA 5J2QA 2E9TA 1NJZA 2KYZA 1SV5A 2FDNA 5G0RB 4JOUA 4O0IA 2B4PA 5CCLA 3DLGB 2KI2A 3HHLD 4CTAA 1D9AA 1F60B 1TL5A 1U1RA 4AE5A 4NOHA 4FZVA 3SDEA 1VQKS 4YY3F 4DV7F 2DIVA 4KHRA 1GNKA 2YX4A 4I68A 1VOMA 3NBPB 4F4YA 2K7KA 4C0OC 4NL5A 4Q2LA 2AU0A 4WYWA 1S10A 4USIA 3PJXA 2BQUA 2OAUA 1O0PA 3FEYB 1UW4A 2GGPB 2MKHA 3MEGB 2R2TA 3DFEA 1X5SA 4Q2MA 5LSLA 2DGXA 4URGA 2V4RA 4PWDB 2YWEA 2IMOA 4C3LA 1TL1A 4R0EA 3M2RA 5A2QY 4EZ6A 3RAMA 2XS7A 4Z2XA 2FJDB 4WF9Q 3K2YA 4FF4A 3OLBA 1LWCA 2DH8A 1U1KA 3TUIC 5K9FA 3G71S 1S1WA 3FZ2A 5F8IA 1FK9A 4JYAF 1Q8BA 1VJWA 2W7PA 3RYLA 4EZ9A 2XEXA 3NNCA 3ISNC 1R8AA 3GQCA 3NS6A 3KLIB 2ZFHA 4YDXA 3LOUA 1J5OB 2YNIA 3F56A 5F8HA 1VRUA 3N79A 2FVSA 1XNQF 1DTTA 1XTZA 1VQ4S 5D78A 2E1AA 4CNZA 3TAMB 2KT3A 1NK0A 4JV1A 3HKWA 5LL6d 2H9ZA 2J9EA 3DYAA 4DSIA 4QWDA 1CG2A 2PI5A 2QIFA 1L5UA 2ZC4A 4IQMA 1YRXA 4LF8F 3BSAA 2YNHB 4N8NA 2O67A 5U47A 3PW7A 3HHDA 4EO6A 3CJ4A 5T7LB 4NXNF 1HNIB 3WDOA 1GXUA 2OPQA 4KFBB 4Y28C 4I64A 2BQRA 4PKDB 4U7UK 4PXCA 3MR2A 2LEAA 4EO8A 2ASDA 1RTDB 4ID5A 3OXFA 3CJKA 4XPCA 5KG1A 4DG1B 2VG5A 5D6GA 2DGSA 3P3DA 3FRYA 5DM6Q 5KG3A 4DSLA 2VD3A 1GQEA 2VPZB 1TKZA 5KOWA 4AQYF 3VCDA 2OKQA 1EETA 4IDKB 4C3KA 4OV1A 1SJ3P 3HO1A 1M1KT 5ADZA 3CCRS 5M2UA 1N4LA 4M63A 4UUXA 1PGZA 3MEEA 4UY8T 3U1LA 3VF0B 4KHPF 3W7BA 4NMLA 2ABYA 5IXUA 1FKPA 2VFSA 3D2WA 4B02A 2DNZA 5KFEA 1TFWA 2KFZA 1JLQB 1YQHA 2FHJA 2KHDA 1XNRF 5HBMA 4YUDA 1NKBA 4B3SF 4JI7F 2L48A 1NJWA 1N48A 2JZ5A 5LSOA 2VV5A 4DV0F 1J2VA 3SSQA 3T19A 1WG4A 2VOOA 4XDDA 1Q86T 1RTJA 4ED5A 1VQYA 1X5OA 1C1BA 1QUVA 2ZDOA 1HPZA 3RR8A 2POKA 2KT5A 3TP2A 4ELUA 3RAQA 2UUBF 3CMES 3MUMP 1NK6A 1IKVA 3MZIA 5KFGA 4OL8A 3UWTA 4RNHA 2MGZA 3M9OB 2P6SA 1RT4A 3EPIA 2Z0GA 1YIJS 3OTCA 2Q66A 3O8WA 2MY7A 5L1IA 3G6YA 2CKWA 3S6EA 3IBWA 4CIOA 5LJ5Y 1HNVB 2CJQA 2MZSA 3LP2B 3OUYB 3RW7A 1WG1A 2J0WA 2ZM6F 4RU2A 1L3SA 1RT2A 1FRMA 3DRSA 1OPZA 1VGYA 5E3AA 1XWLA 4Q45A 3DOLB 4LMZA 2LQBA 5A8KA 3PR5B 1JXLA 2M70A 4M1KA 3M6VA 2D1CA 3N6NA 2JJ4D 3PNIA 2W9CB 1YI2S 3CF5Q 3ISND 2HHXA 5KFKA 1X5TA 2OD6A 3D28A 2U2FA 3ZZOA 4NX9A 4H4OB 1NK7A 2KYXA 2VFUA 3QGGA 3CD0A 3O5TB 3I31A 3OJSA 2D3OR 1TV6B 2GQCA 2X1GA 3U1MA 2KDOA 5KFMA 4EUVA 4ZA1A 1NH8A 4HH0A 1X4FA 1L3TA 3V4IB 4ZP9A 1OQ3A 3CCZA 3KLVA 2N3OA 1S7HA 3T6BA 1QJHA 1QUPA 2BVZA 4QW8A 3DN9A 3ONQA 2R7OA 4IOAQ 4B3OA 2BJEA 3TVKA 3S7RA 1JLEB 1JK9B 1S1TB 2WK4A 1LXNA 2V2KA 5GMKa 2GV1A 4G1PA 4O4GB 4KTQA 4WFZA 2UXDF 1GAOA 5B0FA 2IRUA 4ZP6A 1RT1B 1HI8A 4RUAA 1T03A 3EX7B 5T41A 1RT3B 5KG4A 3V4MA 3RTVA 3MMBB 5FJ4A 1RT7B 1Z4UA 5KFCA 2JEJA 4JI3F 1UETA 4QWEA 3PX4A 2B4VA 1FTCA 2HWIA 3AAWB 3JSYA 1L3VA 3RB6A 1SJ4P 2K8GA 4YFUA 1CSJA 4HTJA 2C42A 3SCKE 4B9UA 1FVSA 1GTHA 3TUJC 5T14A 1U1NA 3OL7A 4K50A 3IS9B 3MEKA 4F4WA 2IM0A 2CPJA 5DDOC 3IRXB 4K5RA 3CCMS 2BUNA 1YVFA 3CC2S 2DO0A 5KT2A 4IRCA 3CDBA 3E8OA 7FDRA 3R1HA 4ELVA 5FDLA 5C25A 5L39A 1CC8A 3LWLA 1BY9A 3MHYA 3BEGB 3MM6B 1URNA 2VH7A 3OV7A 3UCGA 2EVZA 1T94A 2G13A 1UJ4A 4M5DA 4BWMA 4DEZA 4AL6A 3T1HF 2IJFA 4KT0C 4AUKA 3EUNA 2EBEA 4Q44A 1R6YA 5KTQA 3X1LB 1X4DA 1YJNS 1QVFR 4QIVA 3CO9A 1SIWB 1LFPA 4DSJA 4O3RA 5IQ6A 4KV8B 1DARA 4YB5A 4OIXA 1HL6A 5IWAF 1TR0A 1HMVA 2D3UA 2IVMA 2RQMA 3MM5A 2XY7A 4G1QA 4I56A 5KT7A 3LP0B 2DR8A 2FVQA 5IT9Y 1WEZA 3JTOA 1D3WA 5EWEA 5C42B 4NLTA 1RKJA 3AQPA 3PDNA 4DL5A 3CCLS 1HW8A 4Q8FA 2E5IA 2CJAA 4ZKAA 4RUCA 3WBZA