2Z58B

Crystal structure of g56w-propeptide:s324a-subtilisin complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
b'NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPWVEKVEFDHQAVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Requirement of left-handed glycine residue for high stability of the Tk-subtilisin propeptide as revealed by mutational and crystallographic analyses
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 9
structure length 66
sequence length 66
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2z58B00
3SQOP 3CO0P 3VV2B 3A3PB 3P5BP 2QTWA 3A3NB 2W2OP 3AFGA 2Z56B 3WIVA 4NMXA 2W2QP 1ITPA 2Z2YB 3A3OB 2W2NP 3T41A 1SPBP 3CNQP 4K8RA 2PMWA 2ZWPA 2W2PP 3VHQA 4JP8A 4OV6A 3WIUA 1V5IB 3WHIA 3H42A 3GCXP 2Z57B 1R6VA 4YN3B 3QFHA 2ZWOA 2Z30B 1SCJB 2Z2ZA 2Z58B 2W2MP 2E1PA 3GCWP 3BPSP 4NE9C 2XTJP 3BGOP
chains in the Genus database with same CATH superfamily
2WW8A 3L4BC 3VZHA 1S6OA 2C2KB 1TKXA 1L3VA 2XGPA 4BLGA 3CCJS 2XZDB 1RT4A 2M2BA 4ZLNA 4ZP7A 1LNQA 1X5PA 1SL2A 3DM2B 1NAQA 3OTDA 4HH0A 3DLLQ 3EGZA 2DGSA 3W65A 3EDQB 3M2RB 4MFBB 2XGQA 3D68A 3N6LA 1O6XA 1DTTB 1XMOF 2C2DA 2RDJA 4YR0A 1TKZB 1O5JA 1Y4ZB 4CRJA 2CQIA 4NCAA 3WIUA 5J2MB 2IDLA 1YG0A 3UVJB 2BJDA 2GJ2A 3MPWA 3VCDA 5HBMB 1S1TB 2AEMA 5KFPA 3BM7A 4P2SA 1RAAB 1SQGA 4ECSA 2KB2A 3HHDA 3QMQA 2OSQA 2J7UA 1KLMA 3PW0A 4LIWA 3CJ3A 4LRCA 4LFAF 3CJTA 2A2CA 2DH8A 4DL2A 4B9UA 4TQRA 3TUJC 3UDVA 1FDAA 2EPIA 2ZH3A 1WC5A 2PT0A 3FSXA 3W8GA 2HNZB 4CQ1A 4HT5A 4KO0A 4JBCA 4X4QA 1SH0A 4J91A 1GAOA 5K14A 3OTOJ 1N32J 3NAIA 2C2RA 4RZRA 2AJ2A 3DDIA 5KFOA 2RUSA 3TWZA 4PG4A 1TZ0A 1UP1A 1JLGA 1QY7A 3Q8QB 1FRXA 3DC2A 3IM8A 1DBDA 5CYJA 1RT3B 5ETLA 2AGPA 2JEJA 3L7OA 3KNGA 1EQMA 4M5HA 2XZWA 4LQ9A 5F41A 1EJ7L 2KG0A 2RU9A 2IM1A 2Z2MA 1DURA 4FBUA 2D9PA 3D9BA 2V34A 5CXTA 4PWWA 5K20B 1NSPA 3SZ2A 2G0CA 3NGUA 1VC6A 3I55S 3CEDA 5JUMA 1BHNA 1WELA 5EHHA 2BJ3A 3EXYA 1N5SA 2VPXB 3FJ2A 3PRVA 3C14B 4ZOSA 2WVCA 1UVJA 2N3LA 1XIQA 3W9JA 1EP4B 1HBMA 4X65J 1YBAA 2KVIA 1LWXA 1YVFA 1IN0A 3N5FA 2BYCA 3MEEB 1KFSA 2FDNA 1KQGB 3G96A 2YX1A 3H2UB 2R9LA 3VQSA 4NEZA 4UUWA 2B6AB 1K9MT 2CQ0A 3AD8C 2RHQB 5D3GB 1KSPA 5DLFA 4ZVFA 1S9GA 4CZCA 2C2MB 2YNGB 5LMNF 3QT7A 2B4VA 3CB4A 4FZVA 2C3UA 3RR8A 4KE5A 4DFPA 4F2RA 3IBWA 4DN0A 4Y00A 2JNJA 4CT8A 4P72A 1T9TA 1TTHB 2GNKA 2KVQE 1FWPA 2HFVA 5HP1A 3X3UA 2HWHA 5CZVA 1SCJB 2KM8C 5GAEU 4WKYA 4TN2A 2U2FA 3CW2C 5AXMA 1ITPA 2O66A 3F56A 4AFFA 4I2QB 4WWSA 5E5NA 4JV1A 1UVMA 1OQ3A 5M2RA 5IFMA 2QA4G 4WTOB 3GCXP 1XR6A 3R7SB 3M2UB 4ZDNA 4HDGA 1WWHA 3P8BB 2IVMA 3O5TB 2WBRA 2Z2LA 1T02A 1Y10A 1SKUB 4YR3A 3CCWA 1VC5A 3QFHA 2A18A 4DV1J 2CDQA 3QNWB 3MMBB 1A0OB 1HNZF 5KG4A 1VOMA 5KG6A 2UXDJ 3AA8A 4IYQA 4W92B 1VR6A 3CJ8A 3F73A 3I4HX 4EEYA 1QVFR 5ETVA 3UR3C 3A12A 4ZPBA 2QA2A 2MZJA 4WFNQ 2E5HA 4KH0B 2Y1RI 3QJLA 4BBYA 3M8YA 1LWCB 3AD9C 1X31C 5DETA 1DAXA 2NUHA 4PXCA 3ENVA 1I51B 2FC8A 3IR5B 1ZBTA 4IFYA 1HWLA 2RRNA 4ECRA 1MU2B 2RT3A 1U0HB 2VICA 3D3CJ 2UVUA 2JX2A 4DV5F 5KTQA 4LRDA 2FHKA 4AXJA 1PG5B 4YN3B 2UUAF 3CC7S 4LF6F 2VQEF 1IBLF 4CH0S 3PIPQ 3ZNJ1 5KFSA 2IJNA 3RW7A 3HPOA 1FRLA 4BC9A 2AYGA 1RWXB 2JC1A 1TK8A 3IGNA 3VAKA 4IO1A 1RT2B 2FYXA 3VAFA 3SQGA 5AE3A 2HFZA 2XS7A 3OFFA 3RZAA 4P9SA 2VFSA 2XG8A 2LQ5A 4TU8A 3KLFA 1KVIA 1CQNA 2MZTA 1LKZA 1F5AA 3HHLB 2ABYA 4F4YA 2WSEC 1PSDA 1U47A 1F5BA 3UCUP 1K47A 3MUVP 4RNFA 2IRYA 3TYTA 3UWTA 3V81A 3LOUA 1BGXT 4GVBA 2YWFA 2ZBIA 5HI7A 3OT9A 2DO0A 2JLEA 4ZLJA 3QJJA 4USKA 3P45B 3TNVA 3TA1A 4DFJA 3N01A 4GC6A 5GADU 3DXSX 3C19A 1U48A 5DLGA 3MEDB 1NPKA 1P27B 1F3FA 3J7YI 3V4IA 3HZEA 5CAAA 3N9UC 2LDYA 1CS4A 3E01A 3R3TA 1HNVB 1RABB 5HMWA 3Q89A 1V5VA 4DX5A 1N88A 3KLIA 4UZCA 4LBHA 4L74A 4DF4A 2CQ4A 4DV7J 4DR5F 3OR1A 2V2VA 4YUDA 1RT6A 1TKTB 2DR8A 2CQCA 3UDLA 3MCMA 1PGZA 2GJIA 2BE7D 1VQKS 4Y28C 5M2UA 3DLGA 2YKAA 1CEZA 3IBCB 2IM0A 1TR0A 2XHCA 4K50A 4X62J 3TZYA 1FNOA 4M94A 4CTAB 4HH1A 2Y1JA 2HAIA 1TV6A 2CUYA 4L6V3 3GFXA 1EZZB 1OSCA 3GP9A 3CCRS 4CYUB 3ETOA 3KG4A 2RQKA 3FRZA 3MCOA 2DJWA 2QG9B 2AGQA 4QOTA 4YDXA 5BJRA 2PMWA 4NXNJ 3H0PA 4A8OA 3P49B 2KI2A 3QZ7A 3W9IA 2DHAA 1X4HA 4RWXA 1UWAA 4WP8A 2HS4A 4ELVA 4I64A 4A4JA 1DTQB 2G0IA 4K4SA 5DZ7A 3CC2S 1ZAVA 2IJRA 2X3DA 4V19X 3BREA 5E3PA 4R5PA 4Y2CA 4ZMMA 4C6AA 3KK2B 2JLFA 5HJYA 1IKWA 3A3OB 3R7NB 2GJFA 2U1AA 1ROFA 3H4BA 4ICLA 3S01A 3VAJA 3BBFA 2M70A 4TY8B 2K1RB 4ANCA 4NXMJ 4CO1A 4F0HA 3M1VB 3D54A 4AL6A 2OJ3A 3PIOQ 4USIA 1L3UA 4OLPA 1VJWA 5L1IA 1BMQB 3IBFB 1KN6A 4ZJOA 1VISA 4E0DA 1HI1A 4UOFA 1WKJA 2MKKA 2RB7A 1JLFA 1B0PA 3KKFA 3SQOP 4V19J 2BRKA 3MPUB 1SKRA 3DRSB 1D1UA 4OV6A 4P2MA 1R3NA 3Q8VA 5DG8A 3H2LA 1JKHB 1RT7A 3GSDA 3GU0A 4G1QA 2CPIA 3Q2TC 2XY6A 4F3MA 4IRDA 2AF6A 2ZE2A 4DL0C 3TA0A 3PEJA 3DRXA 5KT7A 3I9ZA 2OPQA 2LMIA 2AYEA 3BPDA 1WOOA 5IV3A 3E3XA 4ETXA 4ZCKA 1HBNB 2KHCA 2CJQA 2FVPA 1B70B 4A48A 2FTRA 2DXDA 4MMOA 3SSRA 1YDLA 2FVRA 1JJCB 1J5OB 2BE2B 4QIWD 1SQEA 2VPWB 1F3VA 1S6QA 1H6KX 2EFQA 2BKPA 3PYEA 5KFZA 2UXBF 2HHQA 1RAFB 3BKUA 3HDSA 3MM7A 5C24A 3N79A 2B0GA 1HNXJ 1RTZA 1Y9OA 1FF2A 1SC6A 1GTHA 5J1NA 2F9JA 1FESA 3HHEA 1YZ7A 4QZVB 4C8LA 4ECVA 4H4KC 3HHKA 1TELA 1RTJB 1N48A 4IFVA 3GYGA 3FKBA 1NDKA 1IKYA 4QWDA 4CLSA 3KLHB 4DL4A 4IH6A 2QFIA 3OVAA 1S6PA 1HNIA 3MEKA 5KT3A 2XM3A 3Q22A 2DHSA 4HKQA 4NWBA 1GXUA 2HHHJ 3ULHA 4BWJA 1MROB 5B09A 2DRDA 4ZVSB 2RMLA 5IQ6A 3MD1A 1P1TA 5IWAF 1RHUB 4KRWA 3GZ7A 1GFWB 3N4WA 2HVEA 1FRIA 3FZ2A 2V9WA 3MMJA 1FKPA 1VQ4S 4W98A 3NNAA 2E9TA 1VCTA 4A8FA 3KK3A 2PIIA 1HPZA 4CH7A 4K4WA 5G0RA 1H2VZ 1OY8A 4ED3A 1TUWA 3T5KA 4OYXA 4KGVB 2WTFA 2DIVA 4AQYF 5A8WB 4EO8A 2BRLA 1TK5A 4OMFG 2HNYA 2JH3A 3W2WA 4IQMA 1LOUA 1WSRA 1FO1A 4RPFA 5HANA 1B0TA 3OFGA 4N8OA 1P6TA 4GKKF 2ZKTA 2LDIA 2VKZG 4IKAA 2DGVA 2GIRA 4UUXA 4IO9Q 5D0GA 2XYHB 4H4MB 2HW3A 4LF7F 2GCFA 2QMXA 2DNYA 2O5DA 3WBZA 2YWGA 2R7XA 1LK5A 2JEGA 1F0XA 3KXDA 5LSRA 1Q8BA 2IYIA 4PWUA 1RTHA 3CIZA 2AJFE 3EUNA 3G2XA 3OFHA 1IBKF 4X64F 4F3OA 4X2BA 1RBLA 4RL1A 4BWMA 4Y34A 2DNPA 3MOZA 3ITHB 2YPYA 2V63A 4MAKA 4G3IA 5EWEA 1WC6A 1WEYA 2JEIA 4LF9J 3UN5A 2AZ1A 1JIHA 2CNNB 2L9NA 3W66A 4I7FA 1RISA 4ALZA 2ZH8A 5ETQA 3JSRA 3KLVA 1LEOA 1VIXA 5DG9A 4HHUA 3P3DA 4DV6F 4U6PA 2COLA 4AE5A 1NH8A 1FXDA 2LEBA 2H48B 2IAJB 4IUFA 5KT2A 1WD6A 5KG2A 2KYZA 4NCBA 4ZPAA 4NA1A 2DXEA 4KGKA 3IM9A 4JI3J 2CWXA 4LSNB 1TMMA 3KUHA 1YHQS 3IG1A 5L1KA 4ZP6A 3RB4A 1Z2LA 3J7AN 5J1EB 5BXIA 1CVJA 2DD8S 4ED2A 3HJFA 2HBRB 4TXSA 1MSWD 2WW4A 4WZMA 4EUVA 4M5DB 3OPKA 3FZBA 4OYWA 4RR5A 1KC8T 1JLAA 1QD1A 4FXVA 2HIYA 3GV7B 3WC0A 4EFAC 2RU3A 2ZH9A 2MJNA 3TR5A 3NGTA 3TO8A 2R8GA 5L1JA 4LSLA 3NCPA 2EW9A 1HHTP 4ZHRA 2AHOB 2EFOA 2B56A 2XMTA 3TAPA 3M32A 1S79A 1G6BA 1S4EA 1HBUB 5B0EA 4ZVRB 3OV7A 1UFWA 1Y7PA 4DR2J 1QSYA 1XC9A 1NKCA 5DDOC 2R7SA 4OFZA 2OAUA 4CNZA 1UMJA 2F9DA 2DNNA 2LA4A 3K8VA 3DI6B 2AX1A 3G6YA 3QT6A 1WC4A 3PJ9A 1W25A 2J9DA 3NMAA 3B6BA 3M6XA 4DL3A 4FXWA 4ELUA 1UJ6A 5FLXY 1JXEA 5A8RA 3BYRA 3VR1A 2I9SA 5D0EA 2CDRB 3C6TB 4URSA 4I68A 5IT9U 4OIXA 1T3NA 3PDNA 1M1GA 5H9EK 1CJTA 3FMBA 2IY5B 1K0TA 2MQQA 2VFRA 2IM2A 2QA4S 4C8KA 5CH7B 1SJQA 4UT4A 2QLBB 3H5XA 4ZCMA 2HBYB 2RF2B 4YQWA 1HQEA 4EGLA 2OIHA 3T1HJ 1D8ZA 3PR5B 2ZITA 2OTLS 2EC0A 4J37A 4ZVEA 2MKIA 1NM2A 1WHVA 2HQIA 5DQIA 1IKVB 1E6VB 2QRRA 1FA0A 1YBUA 2E7VA 1GX5A 1VDHA 1T3OA 3MR3A 1NDLA 1WUUA 4ZPCA 2VFUA 3UW1A 4RW7B 4GO7X 4DUYF 3SXLA 3KFWX 5DJBA 1PJ7A 1C1CB 2LXFA 2ZBCA 1OY6A 1K0VA 4RW9B 4KYZA 2EBEA 3QBCA 2RNEA 3CCLS 4KY3A 2DITA 3MR2A 2GVDB 1SH3A 1HWIA 2W7PA 1ICEB 2D41A 3C8YA 4CDIA 2IC3A 3TJ9A 3QT5A 2YWKA 1TL1A 1RWMB 3P6YC 3SBMA 5HSPA 1P8GA 2XYPB 3M8SA 3L3CA 3M05A 1HD0A 3PHTA 5EN1A 5T7LB 3WX4A 2MGZB 3UI3A 4G1IA 3T6JA 1LWFA 2MPUA 2QN6B 5KFVA 4LF4J 3HHNB 2OEJA 3CIMA 2AMCB 2Z8QA 2N3OA 3RGIA 4B08A 2DY9A 1ZM3A 3FEZA 5A2QY 2YNHA 1ZPVA 2XLJA 4MH8A 4DPUA 2LQ8A 5DZ6A 3TJAA 2B9EA 3HFVA 3MCNA 4LFCF 4DR4F 3DGVA 5HROA 4JOUA 1H2UX 1EETA 3CDBA 2CJAA 3VGSA 1DRZA 2W9CB 5D78A 1HHSA 1FTRA 1CG2A 1L5UA 3LA0A 2DCUB 2QLXA 1FRKA 1I94J 4RU9A 3W8PA 1VQLS 3NMRA 2KL8A 4WE1B 1IBMJ 4FNIA 4O44B 3VGVA 4YEAA 3TP2A 1S72S 2FVQA 4GVLA 5DO2A 4XDCA 2GO9A 2RIJA 3X1LB 2PSZA 5LSLA 2J8AA 3KHHA 2MJUA 1ZM9A 3M2VA 3IWLA 3KDOA 4J9PA 1VBKA 4XTTA 3W2VA 2I5JA 4ERDA 3TAMA 5DRKA 1RTDA 1RTIA 3IA0A 1VS3A 4RUAA 2I2YA 3OL6A 2BACA 1UVNA 3C16B 3RBDA 1ZOTA 4TU7A 8ATCB 1IKXB 3QIPB 2NLWA 3M9OB 3I5CA 2PEHA 3G6VA 2BW7A 4LFBF 5GAGU 1T11A 2YNIB 4WIIA 1H7WA 4JYAF 4GO5X 2B9XA 1NPPA 1Q16B 1WI8A 3UN2A 5KFWA 2XMWA 2R7RA 2R7VA 4IG3B 2HVDA 1NHKL 2ASJA 4B9VA 1VRUB 3MM9B 1XTZA 2VPYB 4R8UB 2HRUA 2Z56B 3KG1A 4DCJB 1LXJA 2XWXA 1VLYA 1IWGA 4DMZA 5LSOA 1N5VA 1NB7A 4JI7F 2CNOB 3EXCX 4Q0BB 1PO6A 2G1HA 4KTQA 2QLJB 3ISND 2ZM6J 4FP9A 1O51A 4J9KA 2W2OP 4DU8A 2EFVA 5AXNA 4OYPA 3ISNC 2FLNA 3HLUA 3PG9A 4N8NA 2XSJB 3CDWA 1PYOB 4L73A 2RQCA 2W1BA 4G6VB 4B17A 1URRA 3CVKA 3BGRA 4YS2A 1S9EB 4OJHA 4ATNA 2Y8WA 1SC1B 2OPPA 2MXYA 5J2NB 2EK6A 2Z0GA 1Q79A 4I6AA 3CJ0A 3KHLA 4OZLA 3CMQA 1Y11A 1F9EB 3FNNA 3BBCA 4B3MF 1PC4A 1UAWA 4ZS6A 4YHHJ 3KWMA 1NKEA 2N7YA 1FX4A 3MAHA 5AE2A 5KOWA 2AW0A 4UW2A 4RO0A 4JI6F 4RUHA 3R2CJ 2ALYB 1P1LA 1SH2A 3GB0A 1ELOA 1XNRF 1NZ8A 1H72C 4ZVOB 3TEGA 3IR6B 1FK9A 3AD7C 1Q8LA 2KHDA 3LAMA 2YKMB 1SBRA 3QLHB 4AYBD 2UVRA 3HSDA 1NJIT 2WONA 3FK4A 1D0EA 1FKOB 1S7IA 3MWBA 3LP2B 4JV0A 2BMBA 2CQHA 3MPVA 1PYTA 1YZ6A 1JB0C 1PJ6A 1RADB 3RB0A 2A10A 2F4VJ 1RAEB 5D4NA 2OEMA 1RLCL 5BYSA 2B8PA 4Y2MA 3GTYX 5HJXA 2KM8B 3KJQB 4C8NA 1REGX 4ES1A 1Y00A 4MK7A 2W7AA 2YWWA 5A2QU 3D6HB 4ECZA 2ZOFA 4IQXA 2E29A 1HBOB 1T94A 1RQ0A 5KFNA 3R5CA 4DV0J 5ITHA 4CLFA 3L7UA 3KLEB 2YVSA 2UXCF 2W8KA 4MKAA 4ID5B 3OJSA 1X0FA 3C2PA 3AA9A 2VZ9A 5HL7Q 1M5OC 4MT1A 4PZVA 5I42B 1Q1KA 2R8KA 2V2QA 1NJWA 2HEKA 2HHSA 1TUGB 4IDKA 3HHLD 3C6UB 2ZH5A 4UOGA 2XC9A 1RT5A 1NK6A 1HMVA 2VB6A 5IC4B 4PWDB 4OZNA 4M95A 3HHLC 2WBMA 3A13A 3LWMA 1FKAF 3PR4A 3EYZA 3KTQA 2D74B 1RT1B 1F60B 2NR0A 4C8MA 1N5YA 1D9DA 2DRBA 2DNGA 3H5YA 1LV5A 2OMOA 2HPUA 2HHVA 3DYAA 2UUWA 1GMWA 3U1LA 8RUCA 4OZ1A 3MM5A 1Q8KA 1NJYA 2JRSA 3MTJA 1F1BB 4RUCA 4NZ6A 2QYCA 1T8EA 1BXNA 3G6ES 1RHMB 4RW8A 2HK2A 2MY8A 3EX7B 2CNKB 2VODA 4K4VA 1OQ6A 2EFGA 4LBPA 4Y2AA 3PKYA 4ZP8A 4U9RA 3SSQA 1LWEA 5EWFA 4QWEA 4K0KF 2X1GA 3NBPB 2D3UA 5MAOA 2IMWP 2UUCJ 3PM9A 4DR7F 2CPXA 3MUTP 3DOMA 2FPHX 1YBTA 1OPIA 3GMGA 4PPDA 1K1SA 1V3ZA 3CDEA 2E44A 2FC9A 2XY7A 4RW6A 2KT5A 4P2XA 1ZH5A 4B02A 2EI5A 3A3NB 6AT1B 1UPMB 4OI6A 2J76E 1O8BA 4PUOB 2ZBQA 3QAEA 1HR0J 4P73A 4KT0C 5LMUJ 2ZDPA 1MMNA 3CJ5A 1D3WA 2ZBPA 4HVZA 1BQNB 3FGVA 1R8AA 3PJWA 2M8HA 2O3DA 5SUHA 3GONA 3MEGA 1H3DA 4ED8A 1U6BA 5C2CA 4UZBA 3QATA 4B3SJ 1IR2A 3G86A 3OHBA 4YMEA 4MYUA 2HNDA 3H25A 3BGUA 1S1WA 4A46A 5DS7A 4NLDA 5LXRA 4KO0B 1HLWA 1X4BA 3PCOB 1TP7A 1D9FA 3PTWA 3R2DJ 4A8XA 3AQPA 4ZPDA 1N36J 3OTBA 2BABA 4NLRA 4W90B 4URQU 5LXYA 3CCVS 1QAYA 4LRFA 5KFJA 2VQFF 3CSKA 4I6YA 4Q2LA 3HF5A 4JV5J 2VDHA 4GKJF 3AOCA 3DXBA 1FHTA 2XO6A 4DR1J 4WP9A 1B7YB 2CPEA 5ETOA 3ZZTA 2IDEA 4OX7A 2AD9A 1WEXA 5AJ3J 2MSSA 4USJC 2KFYA 1VQOS 2QT7A 4PXDA 2HQFA 1VBXA 3DOLA 2V67A 2Z4PA 4J7CA 5DM7Q 3R5AA 2GW8A 2NQPA 5THWA 3AJDA 3ZZPA 2FLPA 1HNWF 4PCQA 4A8YA 1BWVA 5J2MA 2GZOA 1HBMB 2DK2A 2PI4A 3UVJA 3NCRA 4F7VA 4NA2A 1VC0A 4ZJQA 1S1TA 2MHNA 5KFIA 2K7JA 2GX8A 3DMJA 1YRTA 3IAM9 4P74A 2OPRB 3Q24A 3EGVA 1N5QA 2BV3A 2W2PP 3IC1A 1WG4A 4DXLA 2OHDA 4YY3F 5EX0A 4U7UK 3CCSS 2MZRA 1S9GB 2RRBA 2R7QA 5KFUA 2HMIB 5GADI 3THTA 4P10A 4F50A 2HNZA 4A8KA 4JI0F 1R27B 5DGBA 1G4CA 2WSFC 3A1YG 4LF8J 2HQCA 3L95X 1JLQA 2V0NA 1CJVB 2LLZA 1R0CB 2V5HG 2DYAA 2W01A 4ED5A 4M1KA 2V8DA 1N56A 3HSZA 3S7RA 2ZJPQ 3TAQA 2Z2ZA 2DNMA 1X9SA 4NOHA 2HG4A 4QPXA 1Q53A 2D1CA 1WG1A 3WIVA 1Q5YA 4AL7A 3GJSB 2JEFA 4LVNP 2L3MA 3HVWA 4YOEA 3LF0A 3CF5Q 4Q44A 3O44A 3NS5A 5MLCV 5L39A 2GA7A 3BSNA 2QZ8A 3SSSA 4DSKA 2E1CA 4B9SA 3CD6S 5JJBA 4J9VA 2IMOA 4DR6J 2NS1B 1YITS 5KFYA 2CWKA 2FJXA 1YJ7A 4X4NA 2C2OB 3GLJA 3CJ4A 2C1EB 1EP4A 3TZZA 3HMJG 4IG0A 4GRSA 4P52A 1YTYA 1HL6A 2C3MA 2FGOA 1UJ5A 5HATA 1JJ4A 2CQ2A 4IFYB 2XLIA 3OTEA 1QM9A 3LP0A 4F04B 1FWKA 3F0NA 1OWXA 1I3OB 5F8HA 2UV8G 2B6AA 1FNMA 1KR4A 3POTB 5CYQB 4I67A 3J80U 5D3GA 1KDNA 1C1BB 3RRGA 2YNGA 1EKRA 3GYXB 2VG7A 2A3JA 3JSBA 2DISA 3SQGB 1YJ9S 3ZTQA 1S0MA 2AWZA 3DLJA 2GVZB 1T05A 4QW8A 4M5LA 3TW0A 2KU7A 4MKVA 3NOCA 2YTCA 3FCWA 3R6LB 1LW2A 1WC3A 4OI1A 4CLTA 3HVRA 1X4DA 4P7VA 3LGNA 1NKBA 4PR6A 2I0XA 3LO3A 4I2QA 2UU9F 3T5JA 2IRXA 3TI0A 3NY0A 5CCLA 3DLBA 3BH7B 5HLFA 4HLBA 1X7VA 3AAWB 3ZZ0A 2DGTA 1LW0B 1XMOJ 1WDDA 3U1MA 4E2FB 2AJ1A 1FJGF 2H5IB 4CM2A 1Z4UA 4KHPF 1NK0A 4Y65A 1RACB 4ECTA 3B8HA 2CPFA 3EMTA 1UW4A 2MKCA 1OJ4A 3V4IB 3MMCA 3MMBA 1CS4B 1WC1A 1UPPA 3NS6A 2XB2D 2AYMA 4EZ9A 3NCQA 2CXEA 1WKKA 5H9FK 1WNEA 3MGJA 1U49A 2E66A 3ENWA 3OR1B 2L41A 3G6XA 2E5IA 5JVHQ 2H5EA 2BE9B 4LFAJ 2J8SA 1T9VA 4RU2A 1CULB 3CDUA 4HTJA 3DLGB 4UY8T 3FCVA 4RBUA 5FDLB 4KPYA 3T3FA 1C0UB 3MM6B 4LF1A 3DRYA 2RS8A 3ZNUA 1U0HA 4OJGA 2P6SA 4N77A 3I5AA 5RUBA 2MQLA 4C98A 2F7VA 4DL5A 1KVKA 4DL6A 2MKHA 1JLEB 3PNIA 2R2SA 1NRKA 4QCLA 3NGDA 1RAIB 2W7OA 1CJKA 3G71S 4L3KA 3TANA 1J5EF 4MKYA 3QQCD 1S5ZA 3J7A1 5C7PA 4K59A 4K2XA 5CYMB 1U6FA 4F4AA 3RRHA 2HVZA 1JK9B 2GO8A 2XO7A 1DHMA 5BR8F 4A8MP 3D0GE 4C97A 1FDDA 3W9HA 1H2TZ 2VIHA 4C8YA 3FDSA 2ZBRA 3M6UA 2VFTA 3FFIB 3VHQA 2DNZA 1IBCB 4P71A 3RBXA 4Y0FA 2J5AA 3CPWR 1HW8A 3R5BA 1WI6A 1QUPA 3MEDA 1TL5A 3UFCX 3DOKB 3A3PB 4C11B 4F0MA 3W5XA 2KXFA 4LRBA 3ADAC 4KHRA 3R1LA 1V5IB 3GIRA 2B5JA 2CADA 4QQBA 2ZOGA 3QZ8A 3HCXA 1UKUA 3TARA 4RNMA 3MECB 4KGZB 3RU0A 2B51A 1U2CA 2HGMA 3DRPB 1ZZNA 3PZPA 2FLOA 2FZCB 4DZDA 4K4TA 1K1QA 5LMNJ 4LQ3A 2NSBA 3RB3A 2LQ9A 3NWGA 3QFWA 2E7WA 2ZE2B 3RAXA 1WHYA 2PA3A 4K7QA 4E8UA 4CYUA 3OBIA 1WSVA 2YQ1A 3MURP 5KFQA 2L9WA 4FVCA 2M88A 3MZIA 5KAKA 4DPYA 2AZ3A 1OYDA 3OHAA 2XNRA 3DHXA 5F3TA 4WFZA 1R8HA 2V6AA 2W4PA 2DNLA 4CO4A 4UQGA 1S6QB 1EX8A 2N82B 3BEGB 1WKLA 3MM7B 5C24B 3KJNB 4PQUB 2HQDA 3KK2A 3I6PA 1U45A 4ED1A 3UCGA 3OL7A 4NLXA 5DDQC 1RWKB 1HNZJ 3CD7A 1VQMS 1Y3KA 2ZEJA 5K5MA 3IN5A 4C0BA 4TY8A 1IKYB 5D15A 2Z58B 1PBUA 4EYHB 4HT7A 3BPSP 3M1VA 1K8AT 3H4DA 1S6PB 5G4DA 4EI2A 4KV8B 2KZZA 1H38A 4C0OC 4QWAA 4J9OA 4DFKA 2GMJA 1U24A 2QO3A 2V4JA 4ZPVR 5B0AA 3SDEB 3DLKB 1SC4B 5HQ8A 1FVSA 1BUXA 3N5BA 2R2UA 1Q86T 4DV5J 2FQQB 1AZSB 4FYWB 1SUQB 3Q8SB 2CJBA 4KBIA 1FKPB 3CULA 2UUAJ 4LF6J 2VQEJ 1RKJA 1IBLJ 3KK3B 1MMLA 1S0NA 2HURA 3MM8B 1X4EA 1FT8A 1VQ9S 3Q8RB 2MB0B 5F8NA 3NKYA 1AROP 2ROGA 2H5JB 3D0HE 3EVMA 2DGWA 2FJAB 3J7YU 2DTJA 3HSJA 2EBGA 1HBNA 1DQ8A 4F4KA 4ZIVA 1ZM4A 2VV5A 4DV4F 1NZAA 3M8QB 4XK8C 2LQJA 5GAHI 1NHVA 3HO1A 2QMUB 3MR7A 1J5OA 2BE2A 3BQ1A 2XY5A 2LEAA 4ECXA 4CP5A 2VPZB 4DX7A 4XIUA 2J0WA 2FHOB 3FQKA 1FD8A 1AUSL 3AOBA 5T41A 2G2OA 3H98A 1AB8A 1D8YA 3T1YF 1T9YA 4Q43A 1RTJA 2QSWA 3H59A 1TFYA 1C0TB 2CQ3A 3D67A 1YKWA 2JOQA 5E7OB 4IR9A 4DPTA 3IWNC 4DR5J 4JI2F 2EVZA 2JC0A 3KMQA 2B7CB 2ZD1A 2LP4A 4YP3A 3I0SA 1MWYA 2DKOB 1TFWA 1F9HA 1JNRB 2Z30B 2AJQA 3V6DB 3CO0P 2XMKA 3JAMU 3QWUA 4F4ZA 4JI8F 1X9WA 3JSMB 2Z57B 1KKHA 3DLEA 4FDFA 2E1AA 1RWNB 2X1FA 5AXKA 2XCAA 4O3QA 1XNQF 4OQJA 3GJTB 1TL4A 1N34F 4DV3F 4CLWA 4DCPB 5A8WA 1KFDA 4I6WA 5EDWA 4C3LA 1WHXA 2R7UA 3EGNA 1UEVA 3ENAA 1U1OA 3EVOA 1LFPA 3BS9A 1O0PA 1YGYA 1RJJA 5D77A 4PKDB 4ITSA 1AA1B 1R8PA 3GR0A 3P5TL 4DUZF 2QJ3A 1FFWB 1IQTA 3VF0B 1MW7A 2BX6A 4KAIA 2Q1LA 2KT2A 2VDIA 4H4MA 5H1SV 2ZZMA 1SIWB 1N33F 4JI4F 4UF4A 3WX8A 2GQQA 1FDNA 3TA2A 4B3TF 4RUBA 1UFLA 4D3HA 3QJPA 1QAJA 3OXFA 1REVB 3W63A 2BJ9A 4ZHRB 3BR9A 2ATCB 3SV3A 5L8RC 4O3PA 2IYGA 1S1XB 5A8KB 1Q7YT 3K5MA 2IA6A 1JLBB 4OJ3A 2QX0A 1ULRA 3ET6B 1UL3A 5DM6Q 2WRMA 3Q8PB 1U6ZA 2C42A 3WDOA 2ADBA 2WCXA 3LW5C 1XQIA 2DNKA 4DHVA 4KPCA 3NLCA 1GQEA 1JNZB 2DXFA 5B0GA 4HHJA 4LREA 1RHJB 2BJ1A 3U27A 3RAQA 1KLNA 3QO9A 2H9ZA 1PBAA 1R6VA 3G4SS 4RX6A 2GQ2A 1CJTB 1KWMA 1X4AA 1DLOA 4C2MA 2IAJA 4Q45A 2UUTA 4DDFA 2HHUA 1GT8A 1Y5IB 3CD5A 2O67A 3FEYB 2UXBJ 4LSNA 1RWOB 2YKNB 4TQSA 2DEJA 4A8SA 2R3VA 3GV5B 3MXHP 5J1EA 3HM9A 2E7XA 1JMTA 1V9OA 2AP6A 1N6QA 4JI5F 1TKDA 3CWJA 1H73A 3PV8A 4AT1B 2ZH6A 2FGCA 3I0RB 4Z2XA 2QA1A 1VQNS 5ETMA 2FVCA 2DPJA 2DR5A 3LP1A 1XMQF 3EE3A 3DRRB 2X1AA 4F36A 2I1RA 1U7LA 5EX3A 3QGGA 1FRHA 2OPSB 3M9NB 2JZ5A 2XQCA 1RHRB 3IFEA 2FIUA 5ETPA 1HBUA 3K0JA 2EK1A 5IWAJ 2MQPA 1TL1B 4PXBA 1VJQA 2ZJRQ 1OO0B 3C15A 2KN4A 1ZZFA 3R27A 5LOQA 2RRAA 1AXQA 4PXEA 1S9FA 1XERA 5HK4A 3GJQB 3I5BA 2IPOB 3DI6A 1X4GA 1RCOB 5DDRC 4DPWA 1NDPA 4P2FA 4M5KA 4N41A 3ZTPA 4AQYJ 2MY7A 3KUGA 5D4PA 3M7VA 2KXNB 1U1MA 1E6YB 2H65B 5ETKA 1N54B 2YNHB 3C6TA 5H9EJ 1VGYA 3SIPB 4X4PA 5D4LA 3MR6A 2BOPA 4K5RA 3PHEA 2YPZA 4GKKJ 2E5LF 4WYWA 5GMKa 1WOSA 4BHQA 2AEFA 1BQXA 1OMSA 3PX6A 1EETB 3UDEA 2HK3A 4LF7J 1XWLA 4ZN3A 3B78A 1B99A 3THVA 2R7OA 4KSEB 1A6LA 2AIRB 4ZVGA 3IRXA 3JS9A 1IKVA 3PYFA 4OZJA 4CO2A 5IM0A 1E6VA 5AT1B 1SJ4P 1IBKJ 4X64J 5JMNA 5M2PA 1JLCA 3RB6A 2CPJA 3ZXWA 2ZVIA 2BZ2A 2DO4A 1R0AA 2VBXA 3W2VB 1HQ2A 2QEXS 2VG6B 4RW9A 1KTVA 4CO0A 3LH2S 2GS8A 3DU6A 2A6MA 5EUHA 1S6UA 3G8SA 2DRAA 4EO6A 5HMZA 2ZZTA 1T9UA 2QL9B 2EKNA 3AH6A 2ZZNA 2RKIB 3DN9A 1T7PA 3D6FB 4RJVA 1Q81T 3QWPA 1FTCA 3QPIA 1S48A 4FNHA 5T7LA 2GGPB 3PY8A 2CJXB 1RZMA 1TMJA 2LFVA 2V2ZA 4DV6J 2MGZA 4H4OA 1NBEB 1VFJA 3M6WA 3CJKB 3K59A 2A0FB 1Q4RA 1YJNS 2VU5A 3MPDA 3M9MB 2KRBA 2AV5A 3K2YA 5CZXA 2C2EA 4U8VA 2A1BA 3MAQA 2YKPA 2ZJQQ 4LR8A 3W62A 4ZLPA 3LQVA 3NP5A 1FCAA 1JX4A 5KFDA 2YH1A 1KHWA 4M5MA 2GAHC 2W9CA 2ASLA 4N5SA 2BJ8A 5ETNA 1HWJA 3V5RA 4G65A 2B3TB 2BJ7A 2D3O1 3M8RA 3QAUA 1SB6A 2F1FA 3I96A 3I87A 3HD2A 4TY9A 2YKOA 2JLGA 2CKWA 1NK8A 3QYYA 1ZPWX 4YB6A 1KHVA 2XWYA 3BGLA 1WORA 2YX4A 5CD4H 4DQRA 2AX0A 2DR6A 3OSNA 3AOAA 2H3EB 5GVQA 3Q8YA 5J2QB 3OFEA 2O1PA 3SCKE 1NNDA 1Q5VA 2BQ3A 2YQ3A 2DHXA 3M30A 3JSYA 1UVLA 2YX7A 1KVJA 3L7PA 2D3ZA 1D09B 3QIPA 3MD3A 4UOCA 3N6MA 5ETRA 1HARA 2M52A 1U02A 2IRUA 2B4OA 2FJDB 3HKZD 2R4FA 4ZA1A 3OXLA 2WONB 4IG3A 3CUNA 1VRUA 5LT5A 4LJMA 2DT9A 1ZS6A 2OGUA 1S57A 3ZC4A 4Z7YA 3OJUA 3BYPA 4A47A 4U95A 2MKYA 2YXLA 5KFMA 4Q0BA 3BN4A 3QSYB 5J2PA 4NZ0A 1I6JA 3CCMS 2AKWB 1B4SA 3EVWA 4DQPA 5D8HB 3PW5A 4NLSA 1OSDA 3HD1A 1IVZA 1RWVB 4NPOA 4DUYJ 1QLNA 2GMHA 5CQGA 2GHVC 1S9EA 1RWWB 1UZHA 1CQMA 2FY8A 2VASA 2IFXA 5E33A 1OY9A 5I3QA 4O4GA 1YIJS 3NAHA 4ZVPB 2OP5A 3GPAA 1HMVB 3SV4A 4D3GA 4WFAQ 4Q2MA 2CPDA 5E2QA 5LJ5Y 1BC6A 1R7IA 3HX9A 1IJFB 2NUUG 5IT4A 3M8PA 5F0WA 3CCQS 2JVOA 3PO5A 4CLUA 5F8IA 3ILOA 4ECQA 2Z2YB 5B7WA 2WSCC 2QGFB 1NSQA 1X9MA 2XMMA 3MM5B 2HAFA 3LGHA 3J81Y 2ILYA 2ZH2A 4EWTA 4OX8A 3QGPA 3J81j 1RU2A 1FI4A 2DY1A 2ATLA 2V8GA 3PVXA 4LFCJ 1QUVA 3JQKA 4DR4J 2XMJA 1FKOA 4LR7A 3PJXA 1LWEB 1W7WA 1S77D 2P9CA 3CCZA 1G2EA 1S1VB 1UEKA 1U1NA 3DGPB 1RK8A 3K8WA 4DL7A 1G3OA 4ZLLA 4RW6B 3ZZZA 4CT9A 2HYIB 4URGA 1V6HA 3C46A 3KG0A 1RU1A 1NJXA 1RAOA 2XI3A 1FD2A 2ZHAA 3MUMP 5KFHA 3KLEA 1IQZA 1TQLA 3D0IE 2K3KA 1NSAA 1FRMA 5CD4A 4ID5A 2ZOMA 2HZCA 2B9YA 4M5GA 1VRTB 5I42A 1NU4A 1U2FA 5E3AA 4NE9C 1U2RA 3MDFA 3NS7B 4RNNA 1EIYB 2J6SA 3O2IA 3C6UA 2MZSA 1WF0A 4Y3CA 5SZTA 3H20A 2HNDB 3BSAA 5HQLA 3KHRA 1H74A 2XULA 4J9UE 4LFBJ 3OD2A 4DSFA 2PI5A 8AT1B 2B4PA 4M8LA 1RT1A 4FF4A 4JYAJ 1X60A 3NXZA 1UA1A 2M3DA 3WC2A 2HWTA 4MIWA 2XMVA 4AD6A 3HI9A 4U7UD 1NK7A 3ZTSA 5K8OA 1GXLA 1WACA 1CC8A 2DGUA 1DFDA 2KDOA 2NSCA 2VBYA 2N7CA 1F2GA 4EMDA 1UWBB 4RW4A 3G82B 4YDDB 3D7SB 4J9SA 2KT3A 1RSCA 3JTOA 1PIEA 1VI7A 1PCAA 1WC0A 1SJFA 1M5VC 1NEEA 1U8SA 4JI7J 4NZ7A 1DQAA 4X4VA 3O3LA 5HMYA 2XBPA 1A7GE 3NBPA 2CG8A 3DOLB 2L9DA 3Q83A 3OVSA 3K57A 1QSLA 2FVSA 4NCGB 1J2VA 2CPHA 1FX2A 4U67Q 2V8HA 3H2VE 1QTMA 6FDRA 3ZTOA 1S10A 3UD3P 2UUBF 1YQHA 2YNFB 2VG5B 2E5JA 4HACA 4RWWA 3MHYA 2SXLA 4B3RF 1NUEA 2BM1A 4PUOA 1DJ0A 1NK4A 3MFIA 2HGLA 5C25A 3DMJB 1Q0NA 1BQNA 1X5TA 2VA3A 2F8EX 4B3MJ 1UW9A 4OI4A 3UQSA 5AXLA 3R5GA 2G0JA 3H5UA 4JI6J 3OR2B 1JJHA 1PILA 4MYTA 4OZ2A 4LF5F 1R31A 4ZVHA 1XNRJ 3FCHA 5B0DA 3EZUA 2ERRA 3IGVA 1JLQB 3LUYA 1KOHA 1M1HA 3E8OA 4YB1P 4NLQA 4WCEQ 4U7CA 2OD4A 3MAAB 2YQ0A 3CTRA 3D2WA 4LIRA 1VQSA 3AB4B 2ZH7A 4ED0A 1Z1ZA 4NI2B 3D4JA 4ZCLA 4EBCA 1M5SA 2XMUA 3PACA 4CM0A 3W5ZA 1V3RA 3A8KA 3K5NA 4WJBA 3BZQA 3BQ0A 1S0OA 1W2BR 2D69A 3Q86A 5CHCB 1RA6A 3GIMA 4DN9A 2OKQA 4PYDA 2WOMA 3A8IA 4ETZA 2DB1A 3J81U 1FJ7A 1RLDA 3M8ZA 2OSRA 1XR7A 1WTBA 4Q8FA 4F8RA 4JI1F 2F8HA 1MWQA 2G9OA 3DU5A 1T03B 3W64A 3FMWA 3DKDA 2UXCJ 3OL9A 4HI1A 3EJMA 3FC9A 1KD1T 3HJVA 3SFGA 4NEYA 4O3OA 4IG0B 1RHQB 4DR3F 4S0MA 3US5A 1NDCA 4MTPA 4LBIA 3T41A 2A6OA 3AHPA 3GG0A 1U0SA 3E2EA 1VK3A 4NLPA 4ILMA 2QL5B 2ILZA 4NLOA 4DV2F 2CFXA 2YY3A 3SCIE 3MMAA 2OPRA 3GCWP 3IWXA 3B4DA 3LP0B 3BR8A 2V68A 2AYBA 4DF8A 3P96A 3KNAA 3H40A 1QAXA 4OZ3A 4A8WA 2Q6BA 4DSIA 5C42A 4C8ZA 3ZZRA 2VG7B 1WHWA 2HMIA 3BO4A 3CT9A 2EKYA 4ZVQB 3BKFA 2JFKA 3G8QA 2BUNA 5CA5A 3CDAA 1F9FA 4X84A 1T05B 5KFAA 3UE2A 3JYTA 1TL7B 5HVGA 1KEKA 3GIIA 4UY85 4I69A 1CJVA 1LW2B 2RILA 3A8JA 4OX9F 4E98A 4MJKA 2EWHA 3KLGB 2OD6A 1VK8A 4P6QA 2VC0A 3HXMA 2GIFA 2BXJA 1BY9A 3UD5A 1NXIA 1RGVA 1PC5A 1BWEA 3NGSA 4K0KJ 2IHR1 5HLFB 5IQQA 2IVFB 4DR7J 5L9XA 5IS2A 2GC8A 3RTVA 1L3KA 1VHFA 2J9DE 1R43A 3BN7A 3R8YA 3LPEA 4WFYA 3PX0A 3MMCB 3N0VA 1XJWB 4DG1B 3OTCA 5E0OA 3VVUA 4HL9A 1IWAA 4Y2KA 1BE4A 1VBYA 4ZPTR 4N76A 1JQGA 2BANA 5D0RA 2VBZA 4KH1B 4FF2A 3PRDA 4CCHA 4KB7A 3A4TA 1GK8A 1IM4A 1YJTA 4WPAA 4L76A 3FQLA 3JTPA 3R5DA 1TL3B 4KKOB 1M5PC 2UZAA 3E51A 2VBWA 2KKHA 2PA8D 4ER8A 2DGQA 1EKSA 4O0NA 4H4KA 3CMES 1CBKA 4F67A 1YJVA 2FB0A 4X66F 2BM0A 2JL9A 3POTA 5CYQA 3UDCA 1S12A 1C1BA 1SVDA 2F63A 5DG7A 2IVYA 1CJKB 2HHTA 1FEEA 1RHKB 5F8LA 1U1KA 4RLEA 2VQFJ 3VALA 2GVZA 2E1RA 4B9MA 3O1LA 2KYXA 1N4LA 4GKJJ 1TVRB 3DFEA 2HZVA 1N0UA 4DU7A 3AODA 1HYSB 4QU6A 5FD1A 2H54B 1SI9A 2W24A 5IV4A 3KK1B 1S4FA 5FLXU 4KIAA 1S1UA 1LW0A 4HI2A 1FDBA 2OEKA 4C7QA 2ZC3A 2E1PA 2F3JA 1S97A 3FSIA 4R0EA 1MLAA 5KFTA 1HNWJ 2CJYB 2VKRA 3SCLE 4GMKA 2V9KA 4I2PA 1IR0A 3ENQA 1M5KC 2VOPA 1NHUA 1SIZA 1YJRA 2J6TA 5H9FJ 2PE8A 2XS2A 2WVBA 3HKWA 2B5JB 4F02A 1HI8A 4ES3A 2GFFA 2ROEA 1MWZA 4DS4A 4QYZK 2P5VA 1VQ8S 1QE1B 4JUZA 4C3MA 9ATCB 1WG5A 1NLKL 2Q43A 3GFYA 1CULA 1OIAA 4PRFA 4K4ZA 2Q3PA 5FDLA 1C0UA 2YWHA 4YY3J 3MM6A 4I4BA 2RE1A 2ZC4A 3MPYA 1VRQC 1Q82T 1RA7A 1U8WA 2XZTB 4Q7AA 2J7WA 2MZQA 3HZGA 4CIOA 2CVIA 1HWKA 2FJVA 5GMDA 4JI0J 1NO8A 2BJEA 4PEOA 1JLEA 2J7KA 4NMLA 3S8SA 3OTOF 5CABA 1N32F 1Q7LB 3CJQA 2AQ4A 1KTQA 3W60A 3KYLA 2KJVA 2G4BA 1HQUB 4FBTA 4KFBB 3VAGA 2ACYA 3CGIA 1I1GA 2MTLA 2NCKL 3R5JB 5I3UA 4WP3A 3GSIA 2FHMA 2LKZA 2MHEA 4NLVA 4LSZB 2KTQA 3OUYB 3KJVB 5KG7A 4PG5A 4WU2A 5CYMA 2X51A 3RYLA 1CJUB 3CC4S 4Q8EA 3F41A 2P9EA 2R8JA 4PYAA 1SV5B 3EPIA 4RBTA 4WIQA 2NXCA 4ZKAA 1KOOA 4IOCQ 2E9RX 2XI2A 2K06A 3BDEA 3L09A 3JXOA 1RXOB 4QWBA 4B3OA 2WB1D 3RW6A 3FFIA 5JXSA 3CNQP 4QIFA 2W9BB 1NH7A 3DOKA 5A6PA 2HQGA 4C11A 4X65F 4EBDA 2LU1A 5KFLA 3GJRB 4OL8A 3EDRB 1WOPA 2Y1IA 2V4JB 3T1AA 2CNLB 3MECA 4OI2A 4Z37A 3R9LA 4TVAB 4DSJA 4XPEA 5A0YA 4WF9Q 2KO1A 1KQSR 2ZHOA 2W8LA 2JWNA 3DRPA 3SMZA 4ZN1A 1T9XA 2F4FA 3D6MB 2OFGX 3GFHA 2XEXA 3HVTB 3PKMA 4L75A 1BQMB 5D6GA 3IS9B 2QFJA 3F44A 4NLGA 2QLWA 2LYVA 3HK2A 2HBQB 4N56A 1TKXB 3C3LA 5KG0A 5ADZA 3AY0A 5HAOA 4WFBQ 4L72B 4EYIB 3KOAA 4K4XA 4Y2IA 2AEJA 1RT4B 2CZVC 4NYOA 2EEYA 1LXNA 2UU9J 1U1LA 3NG8A 4M5NA 2B7BB 1DY3A 2ZVSA 3D1OA 1HD1A 2XHWA 2J9EA 3UNGC 5FJ4A 2PGCA 1SKWA 2W2QP 1FJGJ 2R7WA 1VIOA 1XBWA 4PQUA 4KHPJ 1H0HB 3JTNA 1ACMB 3THPA 1K73T 2HS0A 1DQ9A 2Q6CA 3V2UC 4DV1F 2K8GA 3FBBA 3NNCA 2DR9A 2CJKA 5B0FA 5L1LA 3OLBA 2UXDF 5GAEI 5HQMA 5K9FA 5U47A 1RWUA 4WFXA 2M8DB 1KLMB 4NRTA 1FFSB 4KV8A 2LECA 2R42A 2ZD1B 5IT9Y 3I0SB 2KFZA 4J9RA 1YRUA 3BGFA 3SDEA 4UTGA 3DLKA 2NXJA 1UZDA 2VHGA 5HVFA 1P9YA 1NPRA 3M4XA 1FXRA 4A8QA 1AZSA 2QYGA 1SUQA 3B4MA 1WJ9A 3BQ2A 5K14B 2MLZA 5F9NA 2HSEB 1VYAA 2CRLA 3SEOA 3T5LA 3MM8A 1YK9A 3DLEB 2QC3A 3ICLA 3TX0A 1J5EJ 1JLGB 5KFEA 3QSIA 3JB9k 2VONA 1R89A 4IOBA 3J7ZT 5K8MA 2BKOA 4OLOA 4OHYA 3BJYA 3TQ1A 4DQSA 4DSLA 2LVWA 1NSKL 5D0HA 3W5YA 2R8IA 3M8QA 1FE0A 3FSYA 5BR8J 1RWPB 2NZCA 1U1RA 3DM2A 1CC7A 4EBEA 3G87A 4CLKA 1TU0B 2MEWA 3M2RA 4MFBA 4MK9A 4PG8A 4WU3A 1DTTA 1TK0A 2I38A 1NK5A 4LMZA 1YRXA 4QR1A 4BS2A 1TKZA 2POKA 1LK7A 4CLZA 2MLYA 2VA2A 5KFCA 3LPYA 2XYGB 3QRPA 1Q8IA 4FVMA 3ONQA 3BSOA 1YX2A 4C8OA 5HBMA 2MKSA 3I31A 1C0TA 4J9QA 1SL0A 1J27A 3K58A 1PYSB 2RSQA 4DV7F 5A76A 2BEFA 2VJVA 3N6NA 3GIKA 2HRYA 4NL5A 1S76D 2HVIA 2OLWA 3MCSA 3RAMA 1R6YA 3D66A 4F25A 2JJ4D 4PQAA 1ZYQA 2Q79A 4X62F 1GTEA 2HHPA 2AJ4A 1T9WA 4QW9A 1ZM2A 2ZWPA 2HZAA 4USVA 3V6DA 4I0WA 5LM7E 3TJ8A 3KUEA 5KFFA 3QO9B 2VF3A 3FEXB 5HP1B 3W61A 3K5PA 3NEKA 4NXNF 4QU7A 3JSMA 3EICA 1GMVA 1UETA 2JDJA 4QWCA 1HIYA 2BR0A 2HHWA 1LQ9A 1DLOB 2KH9A 4LR9A 4CO3A 2H51B 4WYLA 2HFUA 2WVEA 1RT3A 1KS2A 1S7HA 4J9LA 3BDPA 4YR2A 4PG6A 4MIAA 3FBCA 3D5MA 4IOAQ 3VAIA 3CMAS 3BGOP 4UOHA 4O3RA 4DLGA 3DHWC 2MYFA 5DQGA 5E41A 3NWRA 7AT1B 1XN9A 1N6QB 3I82A 2HRTA 1GXTA 4NXMF 3C14A 1VQ7S 4CNYA 2WHOA 4J5OA 3OVBA 5IC6B 1GMWD 3K7RA 4ZITA 3H8YA 3EZ5A 1Z2ZA 3OL8A 2XS5A 2DR7A 3LP1B 2GV1A 1REVA 2XMAA 3MEEA 4QIGA 5F3ZA 3IAS9 2J0XA 5L38A 5HMXA 1S1XA 1UFKA 2QLFB 5A8KA 4FF3A 1JLBA 2A2DA 1JXLA 2Y8YA 4ILRA 4DUTA 4XDDA 3ET6A 1SXLA 2HFSA 5GAHU 4DOZA 4ID8A 3C15B 4F0KA 2CQ1A 2W9AA 3OSPA 3SYZA 4OZ5A 2XTJP 3VAMA 3L9ZA 2LXIA 2C3PA 1F5CA 2G1DA 3QT8A 5KFBA 2PMZD 5IXUA 3AXMA 4ANEA 3TUPA 5DQHA 1KQFB 3EWGA 4TYBA 4NMXA 5AE1A 1EQ0A 3O8WA 4F4WA 3KLFB 4M5JA 2XSFA 2RDIA 4ZP9A 3MFHA 2B43A 4DV4J 2FJWA 2ZUAA 4OHVA 1Q78A 1YSJA 3M2UA 3PEHA 4QR2A 1QJHA 4JP8A 3V81B 2EG2A 1XK8A 4GVBB 4KGXB 2K7KA 2R8HA 1HNXF 2YKNA 2CAJA 2WAQD 2AJ0A 3CJSA 3IRXB 3T1YJ 4C4WA 4JB8B 2K2PA 3VAHA 3E01B 1OPZA 5IM0B 3HFZB 2PO4A 2YKQA 1B3TA 3KLIB 4OYAA 4EZ6A 1JLCB 2YWEA 2DHGA 1AFJA 2OI2A 3I0RA 3NOGA 2CZ9A 1UCNA 1W2IA 4O0IA 1SC3B 1RT6B 1R0AB 1TAQA 4JI2J 1RI7A 5FIIA 2QIFA 2C3OA 3CXCR 1LWCA 3DRRA 3NRBA 2GIQA 2YH0A 1DZ5A 3BO3A 3AJ1A 2HHHF 1R8BA 3VVTA 2W2NP 2V4QA 3GR1A 1Y3JA 2J6UA 2OPSA 3GV8B 2K3IA 2BQUA 1MU2A 5E3QA 4J9MA 2UP1A 2KG1A 5LJ3Y 1TV6B 5F8JA 4USMA 1X5SA 3BV8A 1H98A 1NB2A 1RYRA 3AB2B 5KFKA 1L3SA 3WHIA 4JI8J 1AT1B 3GE9A 4H4OB 1RUSA 3DDNA 1YWXA 1XNQJ 3IP0A 1RT2A 2RD5C 1N34J 4DV3J 2BDPA 2QL7B 1E6YA 3PW2A 3V6HA 1X0PA 4ZJLA 4FYXB 1PAUB 3OQ2A 1FE4A 2W4CA 1S49A 4R5PB 3IMQJ 3HHLA 4FF1A 4FKXA 4K8RA 2ROPA 7FD1A 5B0CA 4OX6A 4K5SA 4DBQA 3C66A 2CQDA 1IKWB 3TX8A 4O3SA 4DUZJ 4CWBA 2APOA 2CJ9A 4FYDA 3TRGA 2RVJA 1R8CA 4N7TA 5KOXA 1ZTWA 4Q5VA 4ICLB 3UO0A 6FD1A 3R1HA 1HWUA 2P9GA 1N33J 4JI4J 1Q95G 1HKAA 3A8EA 1KNZA 2MQ8A 3D3BJ 4B3TJ 3CCES 2CPZA 2NXEA 2MSTA 3UPFA 1P9QC 2EFNA 5B0BA 3JQMA 1HNVA 1C2PA 3GYNA 4PAAA 1URNA 2CA9A 2WK4A 1EARA 1CLFA 1AW0A 5BYRA 3CCUS 1S0VA 1TKTA 3D1QA 2W4DA 1JLFB 4LUBA 3UCZP 2D3OR 4OHWA 2VG6A 4IRKA 3M6VA 2BOAA 2J0QD 4KHMA 1RT7B 2FHJD 4LF9F 3M30B 4G1QB 3BO2A 3WQPA 4CTAA 1M0SA 3EZOA 2RKIA 3MOJB 2OPQB 1AUDA 2R7TA 2B4UA 4OYBA 4LVOP 2M0GB 3TVZA 3K5LA 2GGPA 1VQ5S 4F4XA 2OO4A 3EGWB 4ED4A 3UN3A 4K4YA 2IBKA 1RAGB 4K2JA 5L9NA 4ECUA 1KBRA 1X4FA 3CJKA 4TLQA 1DTQA 1UTAA 1X4CA 4ZPWR 1KRPA 4DWIA 3P5BP 2V50A 5F9LA 4PPZA 3O6QA 3CCTA 4JI3F 4MK8A 1HI0P 2ZHBA 2JHEA 5ETSA 1TAUA 4CLPA 1B7FA 1JJ2R 1SKSA 5IT0A 2RAQA 4ZK7M 5J2PB 3Q0AA 5KG3A 4HHHA 2WVDA 1D9AA 3GIJA 3NL0A 2R2RA 4HEA9 4IFVB 5E3CA 2GHWA 4JI5J 3PXGa 2K1RA 2DIUA 2M4MA 3KMSA 3DLHA 5KT6A 2QMWA 2B9WA 1HNIB 1XMQJ 2OMLA 2PEBA 1QDUB 4DEZA 3IR7B 5E3RA 1SL1A 2J9CA 4NRUA 2PD1A 3PFEA 2ZNZA 1FVQA 4O4GB 1N52B 1KONA 4FPRA 3FBFA 4NX9A 4ED6A 4NLWA 2EXUA 1FXLA 1RP5A 3BBBA 3RJMB 5J2QA 4DR2F 4ZVTB 2DVIA 2DCLA 2V94A 1XMBA 3FRYA 1FJCA 3DRSA 1HPZB 4TU9A 5G0RB 1SJ1A 1JKHA 3CE8A 3M8PB 2DPIA 3UNYA 3HVAA 2HHXA 4ZIWA 5HN0A 3TOQA 3LGMA 1OS5A 4FYVB 2Y9HA 2IIHA 2E9ZA 5I4MA 2HNYB 2V8PA 2DGOA 3W2WB 2AGOA 3D6TB 4PABA 2HVHA 1EHWA 4IH7A 3FBEA 1GH8A 2LEPA 3K89A 3ELHA 3PX4A 2DH7A 2VD3A 2MMYA 2E5LJ 3S1TA 3T6BA 3IRWP 3V6JA 2PN6A 2P8IA 2HLUA 4J9NA 5DGAA 2LQBA 2MDAA 4LRAA 2CQBA 2KFNA 2CYYA 1ZTTA 3S6EA 3T1HF 2VJUA 1FFGB 2JFDA 4ED7A 3RR7A 5EWGA 2J0SD 1Y5LB 1RTHB 2EC2A 4QYRA 4O3NA 1QAIA 1MN7A 3D1HA 2RS2A 4FN5A 1UVIA 3VV2B 3G9CA 3KLHA 3QRQA 1ZETA 2F8MA 4ILLA 2LA6A 1RBAA 4X4TA 4USUA 4WXOA 2GHPA 1OYEA 4BCAA 1N0VC 5IOLA 1U1QA 4F26A 1B64A 4QBUA 1MROA 4TKTA 2WB4A 2E1MC 3WZ0A 3P4UB 2QSFA 1AYEA 2CIMA 1M5HA 1ZAXA 2M5YA 4I7FB 2I8EA 3R97A 1WF2A 2QV6A 3SI8A 4X4RA 4ANDA 1RCXB 2C28A 4ECYA 2UVVA 3QGIA 2W25A 4DZ6A 4YB7A 2BQRA 5BYQA 2V8VA 2KXHA 1VQPS 1HFEL 1RDRA 2ASYA 4OZ0A 1YLXA 4LF4F 4QJVA 4IRCA 1M90T 2DNRA 4DX6A 3I32A 3B54A 9RUBA 1R0BG 4B9LA 4RW4B 2VL1A 5LL6d 1UJ4A 2FJEB 3H42A 2VH7A 5HO4A 4EK2A 1X5OA 2L48A 2W2MP 3DNCA 3IG1B 2B8QA 4DPOA 1U26A 1LFWA 3CJ2A 3W1YC 1G1XA 4KC5A 2AU0A 2F40A 4LT6A 4N47A 1Y5NB 4W4MA 4AXIA 2Y0SD 3ETMA 1S1VA 1JLAB 4I1TA 1HHQA 3PRBA 1I94F 3DGPA 4DX8H 3VZIA 3KDNA 2IM3A 1IBMF 3D28A 4LSLB 3TEHB 4F2SA 1ZAWA 2V2KA 1N5TA 2OUGA 2FLLA 3J80Y 3H90A 2MLXA 2CVEA 4HACB 1GMUA 4RBVA 1YI2S 3OW2R 3M32B 3IXQA 5C25B 5C2GA 3FUYA 3ITHA 2RDDA 5B08A 2ALZA 1VQYA 3TVYA 3GFZA 1VRTA 4DQIA 3RBEA 2CZ4A 2M7SA 3ZO7A 2Q66A 2C22A 4RNOA 1K44A 3BH6B 3UD4P 1F2HA 1U25A 2HQ3A 4C3KA 1IM6A 2ASDA 4WK3A 3PW7A 1UA0A 5A8RB 2PDAA 2H4WB 2HWIA 2MQMA 2MQOA 2XNQA 3Q8UA 4TNOA 1YJWS 4NLTA 2HGNA 4X4OA 2XLKA 3V6KA 5EGYA 1TUVA 1UWBA 4KQZA 3R7BB 3G82A 2VUGA 3NGKA 1SJ3P 1MMDA 2DBBA 5K8NA 2FD2A 4FS2A 1HQEB 2HLTA 4CO5A 4L3NA 2JVRA 5I3PA 1JWWA 2CG4A 4IR1A 2HFOA 4USTA 4CLYA 2ZM6F 4OYZA 5GAGI 2GQCA 1EAYC 3DDKA 2WOMB 4M5DA 2WZ1A 4R25A 2VOOA 2NYHA 4X4SA 2JSXA 4NCGA 2FUG9 5D4OA 3ZZUA 1XEZA 2YNFA 2VG5A 3LANA 5KT4A 5ETTA 4OYMA 3T9NA 1X8DA 4G1PA 2IC3B 4HTIA 2V4RA 1Y0HA 4OI3A 3MMAB 4MIBA 4YHHF 2D7SA 3HFKA 2ZH4A 4ENOA 3LTOA 3T19A 4XO0A 3QIDA 1U4BA 1GEHA 1PJ5A 3CJRA 4TLRA 7FDRA 5J1PA 5C42B 2KRRA 4OYOA 3OR2A 2HBZB 1VHIA 1LWFB 5F0UA 2DNQA 4DJBA 2BA9A 1WEZA 1VQ6S 1RAJA 2OH2A 3M8WA 1MG7A 1FERA 4OHXA 3TZWA 4LF2A 5F8GA 4NA3A 4GC7A 3JYTB 3MAAA 1PAEX 3AQOA 1VLOA 5JVGQ 1NMEB 4NI2A 4O4RA 1IJEB 5HROB 2ZFHA 4H54A 3QRRA 2RF2A 4QPTA 4C9DA 4OYIA 4DLEA 3SFUA 2F4VF 2FHJA 4U8YA 1PKUA 2QTWA 1KQKA 2X7IA 2I6WA 3TUZC 1B0VA 2RQ4A 3U1NA 3GQCA 2ZNYA 5KG1A 4USHA 5CCMA 1AFIA 4DV0F 3DCAA 4C48A 4YB5A 5IZHA 2IA0A 3M2VB 3AFGA 4RW7A 2BANB 1BD6A 2IJFA 1T03A 4M63A 1C1CA 2I5JB 4DFMA 5HVHA 2C3YA 3TAMB 2PFFB 2UV8A 3NGRA 1RTDB 1RTIB 2OFHX 1XR5A 2RUGA 4XAKA 2DHHA 2GVDA 1RYSA 2YBVA 1W26A 4KJIA 1RAHB 4DPXA 3H7HB 1SPBP 4F3QA 3GILA 2C2ZB 2KZMA 4XPCA 1JXVA 3R6GB 1H7XA 1APSA 2DEIA 3RUBL 3MR5A 1U1PA 1WDTA 2CQPA 2BW2A 4CI0B 3I56S 3U7JA 3I9V9 2CQGA 3VQTA 2DNHA 1SJRA 4OJ1A 3HSGA 2N4DA 3Q23A 3JQJA 3KHGA 4Y6IA 2DH9A 3BSCA 1TL7A 3MI7X 4M5IA 1RBOB 3BKTA 1CSJA 3KLGA 1FNXH 4FPIA 5KFRA 2ADCA 1IR1A 4TYAA 3OXGA 4X4UA 2RHSB 3ILIA 1VMBA 2NYIA 1RKIA 2UUCF 1CPZA 3HT0A 1S1UB 3PYDA 4NYZA 2Y0BB 2ZH1A 1HW9A 4R0JA 4B9NA 2D9OA 4WE1A 1DARA 3BGRB 4NASA 4O44A 4WK1A 5DDPC 4MKBA 4I2PB 2UUBJ 3PO4A 3ZZYA 2Y1LB 5A6WA 4USWA 4DG1A 3GWCA 1V3SA 1EB0A 1SQFA 1GNKA 2OPPB 2P2CB 4NLUA 3RG6A 4B3RJ 3B82A 1RE1B 1HR0F 5LMUF 3HULA 1U09A 1IXKA 3Q2SC 3CO9A 4ZCIA 1MNEA 4RKUC 2LU2A 3BF4A 3T9ZA 4V1Ak 1C4CA 2ACMA 2EFPA 5KT5A 2NXNA 2RH3A 4B3SF 1ZA2B 3GG1A 2DGXA 5K8PA 1TL3A 2BBEA 2L08A 4KKOA 4QIVA 2PC6A 3ZFVA 4FKYA 3C16A 4LF5J 4WTYA 2M9KA 4UQTA 3EM1A 1IKXA 2H1YA 3HT3A 1FK9B 1G7CB 2YNIA 2XCPA 2NPFA 4JV2A 3LAKA 4ZVUB 2N4CA 1C4AA 2G2YA 3H5SA 3K5OA 1NJZA 4YFUA 2HIQA 2WVFA 5KG5A 1N36F 2FJBB 1NCLA 2HS3A 2FY1A 4FYYB 2HFNA 3ILLA 2BVZA 3BB5A 3MM9A 1KP6A 4Z7CA 5I3UB 2ZKUA 4KGMA 4JV5F 3MTKA 4R8UA 4CH1A 3AXKA 3TQEA 4ECWA 4NLYA 1TVRA 4U96A 4K4UA 2Y3YA 3ILJA 4DR1F 2HKEA 2X3GA 3N28A 1HYSA 2UVWA 1QSSA 2F5GA 4FXDA 2PMHA 4ELTA 5AJ3F 4DSEA 3LALA 3UR0A 2VC1A 1BLUA 1RB0A 3NNHA 1QVGR 3SCJE 2IBOA 3KK1A 4P75A 5GMEA 4AUKA 2NZ4A 3VGUA 4OHZA 2XSJA 4B3OB 2AT1B 3FVYA 4OV1A 4JI1J 4OI0A 3VWSA 2OELA 3TUIC 3V4MA 3TVKA 1NK9A 4NYPA 3JAMY 2MQNA 4HR2A 1UVKA 4DCOB 2F65A 4DR3J 4HYKA 1MN9A 1FEHA 4RNHA 2FZGB 4QIEA 5J2NA 4IDKB 4IH5A 4QYZJ 1FRJA 4DV2J 1RT5B 4BC7A 2KJWA 4J90A 4WBFA 1A9NB 3HP6A 1QE1A 2CPYA 3AT1B 3LWLA 4KR0B 2P6TA 3PFOA 5A0YB 3ISZA 2FZKB 4CLLA 2LXUA 1UEUA 1N5YB 3EPGA 1GX6A 2ZDOA 2MZ1A 1WF1A 3DYAB 3VGTA 2VFVA 2BKNA 2GMLA 2E5GA 2DNOA 1F6TA 1YJUA 1N8RT 1QTNB 4LF8F 4HDHA 2YKMA 3QLHA 4DS5A 1S59A 4OX9J 1FWLA 4RW8B 1ZA1B 3QGHA 2PFDA 4FS1A 1HA1A 1HQUA 4DI6A 4EU0A 4KFBA 2G2ZA 3W7BA 3LP2A 2QE5A 1L3TA 4WKRA 5KFXA 5L46A 1S99A 3PW4A 3OUYA 3KJVA 5T14A 2O01C 1IUJA 3MF5A 3VTIA 3DOMB 4C0HA 1CJUA 4WZQA 1T0TV 2RJZA 1FJEB 1SV5A 1I5OB 3OLAA 4QR0A 4WXWA 3CD0A 3J7Z5 2EG1A 2GAGC 4DR6F 3G8TA 5KFGA 1HBOA 5C5JA 2OTJS 4BDPA 3K17A 4AL5A 2MKJA 2C2NA 2W9BA 3ZZOA 4P7TA 3RBZA 3RRKA 3IO1A 3MEGB 3ZTRA 3AJ2A 2NREA 1T95A 3KJFB 2V69A 2ZUGA 3PYGA 1VBZA 2H4YB 4B9TA 1WTFA 3TZXA 4PWDA 1M1KT 1S1WB 4DQQA 2NPIA 3I4PA 3U02A 5F8MA 4O23A 4X66J 4ES2A 3T5HA 4PG7A 3HVTA 2X1BA 2G13A 3W3SA 2LCWA 1BQMA 4I56A 3IS9A 2ZWOA 2R2TA 2NXUA 2RQMA
chains in the Genus database with same CATH topology
3SQOP 3CO0P 3VV2B 3A3PB 3P5BP 2QTWA 3A3NB 2W2OP 3AFGA 2Z56B 3WIVA 4NMXA 2W2QP 1ITPA 2Z2YB 3A3OB 2W2NP 3T41A 1SPBP 3CNQP 4K8RA 2PMWA 2ZWPA 2W2PP 3VHQA 4JP8A 4OV6A 3WIUA 1V5IB 3WHIA 3H42A 3GCXP 2Z57B 1R6VA 4YN3B 3QFHA 2ZWOA 2Z30B 1SCJB 2Z2ZA 2Z58B 2W2MP 2E1PA 3GCWP 3BPSP 4NE9C 2XTJP 3BGOP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQO P;  3CO0 P;  3VV2 B;  3A3P B;  3P5B P;  2QTW A;  3A3N B;  2W2O P;  3AFG A;  2Z56 B;  3WIV A;  4NMX A;  2W2Q P;  1ITP A;  2Z2Y B;  3A3O B;  2W2N P;  3T41 A;  1SPB P;  3CNQ P;  4K8R A;  2PMW A;  2ZWP A;  2W2P P;  3VHQ A;  4JP8 A;  4OV6 A;  3WIU A;  1V5I B;  3WHI A;  3H42 A;  3GCX P;  2Z57 B;  1R6V A;  4YN3 B;  3QFH A;  2ZWO A;  2Z30 B;  1SCJ B;  2Z2Z A;  2Z58 B;  2W2M P;  2E1P A;  3GCW P;  3BPS P;  4NE9 C;  2XTJ P;  3BGO P; 
#chains in the Genus database with same CATH topology
 2WW8 A;  3L4B C;  3VZH A;  1S6O A;  2C2K B;  1TKX A;  1L3V A;  2XGP A;  4BLG A;  3CCJ S;  2XZD B;  1RT4 A;  2M2B A;  4ZLN A;  4ZP7 A;  1LNQ A;  1X5P A;  1SL2 A;  3DM2 B;  1NAQ A;  3OTD A;  4HH0 A;  3DLL Q;  3EGZ A;  2DGS A;  3W65 A;  3EDQ B;  3M2R B;  4MFB B;  2XGQ A;  3D68 A;  3N6L A;  1O6X A;  1DTT B;  1XMO F;  2C2D A;  2RDJ A;  4YR0 A;  1TKZ B;  1O5J A;  1Y4Z B;  4CRJ A;  2CQI A;  4NCA A;  3WIU A;  5J2M B;  2IDL A;  1YG0 A;  3UVJ B;  2BJD A;  2GJ2 A;  3MPW A;  3VCD A;  5HBM B;  1S1T B;  2AEM A;  5KFP A;  3BM7 A;  4P2S A;  1RAA B;  1SQG A;  4ECS A;  2KB2 A;  3HHD A;  3QMQ A;  2OSQ A;  2J7U A;  1KLM A;  3PW0 A;  4LIW A;  3CJ3 A;  4LRC A;  4LFA F;  3CJT A;  2A2C A;  2DH8 A;  4DL2 A;  4B9U A;  4TQR A;  3TUJ C;  3UDV A;  1FDA A;  2EPI A;  2ZH3 A;  1WC5 A;  2PT0 A;  3FSX A;  3W8G A;  2HNZ B;  4CQ1 A;  4HT5 A;  4KO0 A;  4JBC A;  4X4Q A;  1SH0 A;  4J91 A;  1GAO A;  5K14 A;  3OTO J;  1N32 J;  3NAI A;  2C2R A;  4RZR A;  2AJ2 A;  3DDI A;  5KFO A;  2RUS A;  3TWZ A;  4PG4 A;  1TZ0 A;  1UP1 A;  1JLG A;  1QY7 A;  3Q8Q B;  1FRX A;  3DC2 A;  3IM8 A;  1DBD A;  5CYJ A;  1RT3 B;  5ETL A;  2AGP A;  2JEJ A;  3L7O A;  3KNG A;  1EQM A;  4M5H A;  2XZW A;  4LQ9 A;  5F41 A;  1EJ7 L;  2KG0 A;  2RU9 A;  2IM1 A;  2Z2M A;  1DUR A;  4FBU A;  2D9P A;  3D9B A;  2V34 A;  5CXT A;  4PWW A;  5K20 B;  1NSP A;  3SZ2 A;  2G0C A;  3NGU A;  1VC6 A;  3I55 S;  3CED A;  5JUM A;  1BHN A;  1WEL A;  5EHH A;  2BJ3 A;  3EXY A;  1N5S A;  2VPX B;  3FJ2 A;  3PRV A;  3C14 B;  4ZOS A;  2WVC A;  1UVJ A;  2N3L A;  1XIQ A;  3W9J A;  1EP4 B;  1HBM A;  4X65 J;  1YBA A;  2KVI A;  1LWX A;  1YVF A;  1IN0 A;  3N5F A;  2BYC A;  3MEE B;  1KFS A;  2FDN A;  1KQG B;  3G96 A;  2YX1 A;  3H2U B;  2R9L A;  3VQS A;  4NEZ A;  4UUW A;  2B6A B;  1K9M T;  2CQ0 A;  3AD8 C;  2RHQ B;  5D3G B;  1KSP A;  5DLF A;  4ZVF A;  1S9G A;  4CZC A;  2C2M B;  2YNG B;  5LMN F;  3QT7 A;  2B4V A;  3CB4 A;  4FZV A;  2C3U A;  3RR8 A;  4KE5 A;  4DFP A;  4F2R A;  3IBW A;  4DN0 A;  4Y00 A;  2JNJ A;  4CT8 A;  4P72 A;  1T9T A;  1TTH B;  2GNK A;  2KVQ E;  1FWP A;  2HFV A;  5HP1 A;  3X3U A;  2HWH A;  5CZV A;  1SCJ B;  2KM8 C;  5GAE U;  4WKY A;  4TN2 A;  2U2F A;  3CW2 C;  5AXM A;  1ITP A;  2O66 A;  3F56 A;  4AFF A;  4I2Q B;  4WWS A;  5E5N A;  4JV1 A;  1UVM A;  1OQ3 A;  5M2R A;  5IFM A;  2QA4 G;  4WTO B;  3GCX P;  1XR6 A;  3R7S B;  3M2U B;  4ZDN A;  4HDG A;  1WWH A;  3P8B B;  2IVM A;  3O5T B;  2WBR A;  2Z2L A;  1T02 A;  1Y10 A;  1SKU B;  4YR3 A;  3CCW A;  1VC5 A;  3QFH A;  2A18 A;  4DV1 J;  2CDQ A;  3QNW B;  3MMB B;  1A0O B;  1HNZ F;  5KG4 A;  1VOM A;  5KG6 A;  2UXD J;  3AA8 A;  4IYQ A;  4W92 B;  1VR6 A;  3CJ8 A;  3F73 A;  3I4H X;  4EEY A;  1QVF R;  5ETV A;  3UR3 C;  3A12 A;  4ZPB A;  2QA2 A;  2MZJ A;  4WFN Q;  2E5H A;  4KH0 B;  2Y1R I;  3QJL A;  4BBY A;  3M8Y A;  1LWC B;  3AD9 C;  1X31 C;  5DET A;  1DAX A;  2NUH A;  4PXC A;  3ENV A;  1I51 B;  2FC8 A;  3IR5 B;  1ZBT A;  4IFY A;  1HWL A;  2RRN A;  4ECR A;  1MU2 B;  2RT3 A;  1U0H B;  2VIC A;  3D3C J;  2UVU A;  2JX2 A;  4DV5 F;  5KTQ A;  4LRD A;  2FHK A;  4AXJ A;  1PG5 B;  4YN3 B;  2UUA F;  3CC7 S;  4LF6 F;  2VQE F;  1IBL F;  4CH0 S;  3PIP Q;  3ZNJ 1;  5KFS A;  2IJN A;  3RW7 A;  3HPO A;  1FRL A;  4BC9 A;  2AYG A;  1RWX B;  2JC1 A;  1TK8 A;  3IGN A;  3VAK A;  4IO1 A;  1RT2 B;  2FYX A;  3VAF A;  3SQG A;  5AE3 A;  2HFZ A;  2XS7 A;  3OFF A;  3RZA A;  4P9S A;  2VFS A;  2XG8 A;  2LQ5 A;  4TU8 A;  3KLF A;  1KVI A;  1CQN A;  2MZT A;  1LKZ A;  1F5A A;  3HHL B;  2ABY A;  4F4Y A;  2WSE C;  1PSD A;  1U47 A;  1F5B A;  3UCU P;  1K47 A;  3MUV P;  4RNF A;  2IRY A;  3TYT A;  3UWT A;  3V81 A;  3LOU A;  1BGX T;  4GVB A;  2YWF A;  2ZBI A;  5HI7 A;  3OT9 A;  2DO0 A;  2JLE A;  4ZLJ A;  3QJJ A;  4USK A;  3P45 B;  3TNV A;  3TA1 A;  4DFJ A;  3N01 A;  4GC6 A;  5GAD U;  3DXS X;  3C19 A;  1U48 A;  5DLG A;  3MED B;  1NPK A;  1P27 B;  1F3F A;  3J7Y I;  3V4I A;  3HZE A;  5CAA A;  3N9U C;  2LDY A;  1CS4 A;  3E01 A;  3R3T A;  1HNV B;  1RAB B;  5HMW A;  3Q89 A;  1V5V A;  4DX5 A;  1N88 A;  3KLI A;  4UZC A;  4LBH A;  4L74 A;  4DF4 A;  2CQ4 A;  4DV7 J;  4DR5 F;  3OR1 A;  2V2V A;  4YUD A;  1RT6 A;  1TKT B;  2DR8 A;  2CQC A;  3UDL A;  3MCM A;  1PGZ A;  2GJI A;  2BE7 D;  1VQK S;  4Y28 C;  5M2U A;  3DLG A;  2YKA A;  1CEZ A;  3IBC B;  2IM0 A;  1TR0 A;  2XHC A;  4K50 A;  4X62 J;  3TZY A;  1FNO A;  4M94 A;  4CTA B;  4HH1 A;  2Y1J A;  2HAI A;  1TV6 A;  2CUY A;  4L6V 3;  3GFX A;  1EZZ B;  1OSC A;  3GP9 A;  3CCR S;  4CYU B;  3ETO A;  3KG4 A;  2RQK A;  3FRZ A;  3MCO A;  2DJW A;  2QG9 B;  2AGQ A;  4QOT A;  4YDX A;  5BJR A;  2PMW A;  4NXN J;  3H0P A;  4A8O A;  3P49 B;  2KI2 A;  3QZ7 A;  3W9I A;  2DHA A;  1X4H A;  4RWX A;  1UWA A;  4WP8 A;  2HS4 A;  4ELV A;  4I64 A;  4A4J A;  1DTQ B;  2G0I A;  4K4S A;  5DZ7 A;  3CC2 S;  1ZAV A;  2IJR A;  2X3D A;  4V19 X;  3BRE A;  5E3P A;  4R5P A;  4Y2C A;  4ZMM A;  4C6A A;  3KK2 B;  2JLF A;  5HJY A;  1IKW A;  3A3O B;  3R7N B;  2GJF A;  2U1A A;  1ROF A;  3H4B A;  4ICL A;  3S01 A;  3VAJ A;  3BBF A;  2M70 A;  4TY8 B;  2K1R B;  4ANC A;  4NXM J;  4CO1 A;  4F0H A;  3M1V B;  3D54 A;  4AL6 A;  2OJ3 A;  3PIO Q;  4USI A;  1L3U A;  4OLP A;  1VJW A;  5L1I A;  1BMQ B;  3IBF B;  1KN6 A;  4ZJO A;  1VIS A;  4E0D A;  1HI1 A;  4UOF A;  1WKJ A;  2MKK A;  2RB7 A;  1JLF A;  1B0P A;  3KKF A;  3SQO P;  4V19 J;  2BRK A;  3MPU B;  1SKR A;  3DRS B;  1D1U A;  4OV6 A;  4P2M A;  1R3N A;  3Q8V A;  5DG8 A;  3H2L A;  1JKH B;  1RT7 A;  3GSD A;  3GU0 A;  4G1Q A;  2CPI A;  3Q2T C;  2XY6 A;  4F3M A;  4IRD A;  2AF6 A;  2ZE2 A;  4DL0 C;  3TA0 A;  3PEJ A;  3DRX A;  5KT7 A;  3I9Z A;  2OPQ A;  2LMI A;  2AYE A;  3BPD A;  1WOO A;  5IV3 A;  3E3X A;  4ETX A;  4ZCK A;  1HBN B;  2KHC A;  2CJQ A;  2FVP A;  1B70 B;  4A48 A;  2FTR A;  2DXD A;  4MMO A;  3SSR A;  1YDL A;  2FVR A;  1JJC B;  1J5O B;  2BE2 B;  4QIW D;  1SQE A;  2VPW B;  1F3V A;  1S6Q A;  1H6K X;  2EFQ A;  2BKP A;  3PYE A;  5KFZ A;  2UXB F;  2HHQ A;  1RAF B;  3BKU A;  3HDS A;  3MM7 A;  5C24 A;  3N79 A;  2B0G A;  1HNX J;  1RTZ A;  1Y9O A;  1FF2 A;  1SC6 A;  1GTH A;  5J1N A;  2F9J A;  1FES A;  3HHE A;  1YZ7 A;  4QZV B;  4C8L A;  4ECV A;  4H4K C;  3HHK A;  1TEL A;  1RTJ B;  1N48 A;  4IFV A;  3GYG A;  3FKB A;  1NDK A;  1IKY A;  4QWD A;  4CLS A;  3KLH B;  4DL4 A;  4IH6 A;  2QFI A;  3OVA A;  1S6P A;  1HNI A;  3MEK A;  5KT3 A;  2XM3 A;  3Q22 A;  2DHS A;  4HKQ A;  4NWB A;  1GXU A;  2HHH J;  3ULH A;  4BWJ A;  1MRO B;  5B09 A;  2DRD A;  4ZVS B;  2RML A;  5IQ6 A;  3MD1 A;  1P1T A;  5IWA F;  1RHU B;  4KRW A;  3GZ7 A;  1GFW B;  3N4W A;  2HVE A;  1FRI A;  3FZ2 A;  2V9W A;  3MMJ A;  1FKP A;  1VQ4 S;  4W98 A;  3NNA A;  2E9T A;  1VCT A;  4A8F A;  3KK3 A;  2PII A;  1HPZ A;  4CH7 A;  4K4W A;  5G0R A;  1H2V Z;  1OY8 A;  4ED3 A;  1TUW A;  3T5K A;  4OYX A;  4KGV B;  2WTF A;  2DIV A;  4AQY F;  5A8W B;  4EO8 A;  2BRL A;  1TK5 A;  4OMF G;  2HNY A;  2JH3 A;  3W2W A;  4IQM A;  1LOU A;  1WSR A;  1FO1 A;  4RPF A;  5HAN A;  1B0T A;  3OFG A;  4N8O A;  1P6T A;  4GKK F;  2ZKT A;  2LDI A;  2VKZ G;  4IKA A;  2DGV A;  2GIR A;  4UUX A;  4IO9 Q;  5D0G A;  2XYH B;  4H4M B;  2HW3 A;  4LF7 F;  2GCF A;  2QMX A;  2DNY A;  2O5D A;  3WBZ A;  2YWG A;  2R7X A;  1LK5 A;  2JEG A;  1F0X A;  3KXD A;  5LSR A;  1Q8B A;  2IYI A;  4PWU A;  1RTH A;  3CIZ A;  2AJF E;  3EUN A;  3G2X A;  3OFH A;  1IBK F;  4X64 F;  4F3O A;  4X2B A;  1RBL A;  4RL1 A;  4BWM A;  4Y34 A;  2DNP A;  3MOZ A;  3ITH B;  2YPY A;  2V63 A;  4MAK A;  4G3I A;  5EWE A;  1WC6 A;  1WEY A;  2JEI A;  4LF9 J;  3UN5 A;  2AZ1 A;  1JIH A;  2CNN B;  2L9N A;  3W66 A;  4I7F A;  1RIS A;  4ALZ A;  2ZH8 A;  5ETQ A;  3JSR A;  3KLV A;  1LEO A;  1VIX A;  5DG9 A;  4HHU A;  3P3D A;  4DV6 F;  4U6P A;  2COL A;  4AE5 A;  1NH8 A;  1FXD A;  2LEB A;  2H48 B;  2IAJ B;  4IUF A;  5KT2 A;  1WD6 A;  5KG2 A;  2KYZ A;  4NCB A;  4ZPA A;  4NA1 A;  2DXE A;  4KGK A;  3IM9 A;  4JI3 J;  2CWX A;  4LSN B;  1TMM A;  3KUH A;  1YHQ S;  3IG1 A;  5L1K A;  4ZP6 A;  3RB4 A;  1Z2L A;  3J7A N;  5J1E B;  5BXI A;  1CVJ A;  2DD8 S;  4ED2 A;  3HJF A;  2HBR B;  4TXS A;  1MSW D;  2WW4 A;  4WZM A;  4EUV A;  4M5D B;  3OPK A;  3FZB A;  4OYW A;  4RR5 A;  1KC8 T;  1JLA A;  1QD1 A;  4FXV A;  2HIY A;  3GV7 B;  3WC0 A;  4EFA C;  2RU3 A;  2ZH9 A;  2MJN A;  3TR5 A;  3NGT A;  3TO8 A;  2R8G A;  5L1J A;  4LSL A;  3NCP A;  2EW9 A;  1HHT P;  4ZHR A;  2AHO B;  2EFO A;  2B56 A;  2XMT A;  3TAP A;  3M32 A;  1S79 A;  1G6B A;  1S4E A;  1HBU B;  5B0E A;  4ZVR B;  3OV7 A;  1UFW A;  1Y7P A;  4DR2 J;  1QSY A;  1XC9 A;  1NKC A;  5DDO C;  2R7S A;  4OFZ A;  2OAU A;  4CNZ A;  1UMJ A;  2F9D A;  2DNN A;  2LA4 A;  3K8V A;  3DI6 B;  2AX1 A;  3G6Y A;  3QT6 A;  1WC4 A;  3PJ9 A;  1W25 A;  2J9D A;  3NMA A;  3B6B A;  3M6X A;  4DL3 A;  4FXW A;  4ELU A;  1UJ6 A;  5FLX Y;  1JXE A;  5A8R A;  3BYR A;  3VR1 A;  2I9S A;  5D0E A;  2CDR B;  3C6T B;  4URS A;  4I68 A;  5IT9 U;  4OIX A;  1T3N A;  3PDN A;  1M1G A;  5H9E K;  1CJT A;  3FMB A;  2IY5 B;  1K0T A;  2MQQ A;  2VFR A;  2IM2 A;  2QA4 S;  4C8K A;  5CH7 B;  1SJQ A;  4UT4 A;  2QLB B;  3H5X A;  4ZCM A;  2HBY B;  2RF2 B;  4YQW A;  1HQE A;  4EGL A;  2OIH A;  3T1H J;  1D8Z A;  3PR5 B;  2ZIT A;  2OTL S;  2EC0 A;  4J37 A;  4ZVE A;  2MKI A;  1NM2 A;  1WHV A;  2HQI A;  5DQI A;  1IKV B;  1E6V B;  2QRR A;  1FA0 A;  1YBU A;  2E7V A;  1GX5 A;  1VDH A;  1T3O A;  3MR3 A;  1NDL A;  1WUU A;  4ZPC A;  2VFU A;  3UW1 A;  4RW7 B;  4GO7 X;  4DUY F;  3SXL A;  3KFW X;  5DJB A;  1PJ7 A;  1C1C B;  2LXF A;  2ZBC A;  1OY6 A;  1K0V A;  4RW9 B;  4KYZ A;  2EBE A;  3QBC A;  2RNE A;  3CCL S;  4KY3 A;  2DIT A;  3MR2 A;  2GVD B;  1SH3 A;  1HWI A;  2W7P A;  1ICE B;  2D41 A;  3C8Y A;  4CDI A;  2IC3 A;  3TJ9 A;  3QT5 A;  2YWK A;  1TL1 A;  1RWM B;  3P6Y C;  3SBM A;  5HSP A;  1P8G A;  2XYP B;  3M8S A;  3L3C A;  3M05 A;  1HD0 A;  3PHT A;  5EN1 A;  5T7L B;  3WX4 A;  2MGZ B;  3UI3 A;  4G1I A;  3T6J A;  1LWF A;  2MPU A;  2QN6 B;  5KFV A;  4LF4 J;  3HHN B;  2OEJ A;  3CIM A;  2AMC B;  2Z8Q A;  2N3O A;  3RGI A;  4B08 A;  2DY9 A;  1ZM3 A;  3FEZ A;  5A2Q Y;  2YNH A;  1ZPV A;  2XLJ A;  4MH8 A;  4DPU A;  2LQ8 A;  5DZ6 A;  3TJA A;  2B9E A;  3HFV A;  3MCN A;  4LFC F;  4DR4 F;  3DGV A;  5HRO A;  4JOU A;  1H2U X;  1EET A;  3CDB A;  2CJA A;  3VGS A;  1DRZ A;  2W9C B;  5D78 A;  1HHS A;  1FTR A;  1CG2 A;  1L5U A;  3LA0 A;  2DCU B;  2QLX A;  1FRK A;  1I94 J;  4RU9 A;  3W8P A;  1VQL S;  3NMR A;  2KL8 A;  4WE1 B;  1IBM J;  4FNI A;  4O44 B;  3VGV A;  4YEA A;  3TP2 A;  1S72 S;  2FVQ A;  4GVL A;  5DO2 A;  4XDC A;  2GO9 A;  2RIJ A;  3X1L B;  2PSZ A;  5LSL A;  2J8A A;  3KHH A;  2MJU A;  1ZM9 A;  3M2V A;  3IWL A;  3KDO A;  4J9P A;  1VBK A;  4XTT A;  3W2V A;  2I5J A;  4ERD A;  3TAM A;  5DRK A;  1RTD A;  1RTI A;  3IA0 A;  1VS3 A;  4RUA A;  2I2Y A;  3OL6 A;  2BAC A;  1UVN A;  3C16 B;  3RBD A;  1ZOT A;  4TU7 A;  8ATC B;  1IKX B;  3QIP B;  2NLW A;  3M9O B;  3I5C A;  2PEH A;  3G6V A;  2BW7 A;  4LFB F;  5GAG U;  1T11 A;  2YNI B;  4WII A;  1H7W A;  4JYA F;  4GO5 X;  2B9X A;  1NPP A;  1Q16 B;  1WI8 A;  3UN2 A;  5KFW A;  2XMW A;  2R7R A;  2R7V A;  4IG3 B;  2HVD A;  1NHK L;  2ASJ A;  4B9V A;  1VRU B;  3MM9 B;  1XTZ A;  2VPY B;  4R8U B;  2HRU A;  2Z56 B;  3KG1 A;  4DCJ B;  1LXJ A;  2XWX A;  1VLY A;  1IWG A;  4DMZ A;  5LSO A;  1N5V A;  1NB7 A;  4JI7 F;  2CNO B;  3EXC X;  4Q0B B;  1PO6 A;  2G1H A;  4KTQ A;  2QLJ B;  3ISN D;  2ZM6 J;  4FP9 A;  1O51 A;  4J9K A;  2W2O P;  4DU8 A;  2EFV A;  5AXN A;  4OYP A;  3ISN C;  2FLN A;  3HLU A;  3PG9 A;  4N8N A;  2XSJ B;  3CDW A;  1PYO B;  4L73 A;  2RQC A;  2W1B A;  4G6V B;  4B17 A;  1URR A;  3CVK A;  3BGR A;  4YS2 A;  1S9E B;  4OJH A;  4ATN A;  2Y8W A;  1SC1 B;  2OPP A;  2MXY A;  5J2N B;  2EK6 A;  2Z0G A;  1Q79 A;  4I6A A;  3CJ0 A;  3KHL A;  4OZL A;  3CMQ A;  1Y11 A;  1F9E B;  3FNN A;  3BBC A;  4B3M F;  1PC4 A;  1UAW A;  4ZS6 A;  4YHH J;  3KWM A;  1NKE A;  2N7Y A;  1FX4 A;  3MAH A;  5AE2 A;  5KOW A;  2AW0 A;  4UW2 A;  4RO0 A;  4JI6 F;  4RUH A;  3R2C J;  2ALY B;  1P1L A;  1SH2 A;  3GB0 A;  1ELO A;  1XNR F;  1NZ8 A;  1H72 C;  4ZVO B;  3TEG A;  3IR6 B;  1FK9 A;  3AD7 C;  1Q8L A;  2KHD A;  3LAM A;  2YKM B;  1SBR A;  3QLH B;  4AYB D;  2UVR A;  3HSD A;  1NJI T;  2WON A;  3FK4 A;  1D0E A;  1FKO B;  1S7I A;  3MWB A;  3LP2 B;  4JV0 A;  2BMB A;  2CQH A;  3MPV A;  1PYT A;  1YZ6 A;  1JB0 C;  1PJ6 A;  1RAD B;  3RB0 A;  2A10 A;  2F4V J;  1RAE B;  5D4N A;  2OEM A;  1RLC L;  5BYS A;  2B8P A;  4Y2M A;  3GTY X;  5HJX A;  2KM8 B;  3KJQ B;  4C8N A;  1REG X;  4ES1 A;  1Y00 A;  4MK7 A;  2W7A A;  2YWW A;  5A2Q U;  3D6H B;  4ECZ A;  2ZOF A;  4IQX A;  2E29 A;  1HBO B;  1T94 A;  1RQ0 A;  5KFN A;  3R5C A;  4DV0 J;  5ITH A;  4CLF A;  3L7U A;  3KLE B;  2YVS A;  2UXC F;  2W8K A;  4MKA A;  4ID5 B;  3OJS A;  1X0F A;  3C2P A;  3AA9 A;  2VZ9 A;  5HL7 Q;  1M5O C;  4MT1 A;  4PZV A;  5I42 B;  1Q1K A;  2R8K A;  2V2Q A;  1NJW A;  2HEK A;  2HHS A;  1TUG B;  4IDK A;  3HHL D;  3C6U B;  2ZH5 A;  4UOG A;  2XC9 A;  1RT5 A;  1NK6 A;  1HMV A;  2VB6 A;  5IC4 B;  4PWD B;  4OZN A;  4M95 A;  3HHL C;  2WBM A;  3A13 A;  3LWM A;  1FKA F;  3PR4 A;  3EYZ A;  3KTQ A;  2D74 B;  1RT1 B;  1F60 B;  2NR0 A;  4C8M A;  1N5Y A;  1D9D A;  2DRB A;  2DNG A;  3H5Y A;  1LV5 A;  2OMO A;  2HPU A;  2HHV A;  3DYA A;  2UUW A;  1GMW A;  3U1L A;  8RUC A;  4OZ1 A;  3MM5 A;  1Q8K A;  1NJY A;  2JRS A;  3MTJ A;  1F1B B;  4RUC A;  4NZ6 A;  2QYC A;  1T8E A;  1BXN A;  3G6E S;  1RHM B;  4RW8 A;  2HK2 A;  2MY8 A;  3EX7 B;  2CNK B;  2VOD A;  4K4V A;  1OQ6 A;  2EFG A;  4LBP A;  4Y2A A;  3PKY A;  4ZP8 A;  4U9R A;  3SSQ A;  1LWE A;  5EWF A;  4QWE A;  4K0K F;  2X1G A;  3NBP B;  2D3U A;  5MAO A;  2IMW P;  2UUC J;  3PM9 A;  4DR7 F;  2CPX A;  3MUT P;  3DOM A;  2FPH X;  1YBT A;  1OPI A;  3GMG A;  4PPD A;  1K1S A;  1V3Z A;  3CDE A;  2E44 A;  2FC9 A;  2XY7 A;  4RW6 A;  2KT5 A;  4P2X A;  1ZH5 A;  4B02 A;  2EI5 A;  3A3N B;  6AT1 B;  1UPM B;  4OI6 A;  2J76 E;  1O8B A;  4PUO B;  2ZBQ A;  3QAE A;  1HR0 J;  4P73 A;  4KT0 C;  5LMU J;  2ZDP A;  1MMN A;  3CJ5 A;  1D3W A;  2ZBP A;  4HVZ A;  1BQN B;  3FGV A;  1R8A A;  3PJW A;  2M8H A;  2O3D A;  5SUH A;  3GON A;  3MEG A;  1H3D A;  4ED8 A;  1U6B A;  5C2C A;  4UZB A;  3QAT A;  4B3S J;  1IR2 A;  3G86 A;  3OHB A;  4YME A;  4MYU A;  2HND A;  3H25 A;  3BGU A;  1S1W A;  4A46 A;  5DS7 A;  4NLD A;  5LXR A;  4KO0 B;  1HLW A;  1X4B A;  3PCO B;  1TP7 A;  1D9F A;  3PTW A;  3R2D J;  4A8X A;  3AQP A;  4ZPD A;  1N36 J;  3OTB A;  2BAB A;  4NLR A;  4W90 B;  4URQ U;  5LXY A;  3CCV S;  1QAY A;  4LRF A;  5KFJ A;  2VQF F;  3CSK A;  4I6Y A;  4Q2L A;  3HF5 A;  4JV5 J;  2VDH A;  4GKJ F;  3AOC A;  3DXB A;  1FHT A;  2XO6 A;  4DR1 J;  4WP9 A;  1B7Y B;  2CPE A;  5ETO A;  3ZZT A;  2IDE A;  4OX7 A;  2AD9 A;  1WEX A;  5AJ3 J;  2MSS A;  4USJ C;  2KFY A;  1VQO S;  2QT7 A;  4PXD A;  2HQF A;  1VBX A;  3DOL A;  2V67 A;  2Z4P A;  4J7C A;  5DM7 Q;  3R5A A;  2GW8 A;  2NQP A;  5THW A;  3AJD A;  3ZZP A;  2FLP A;  1HNW F;  4PCQ A;  4A8Y A;  1BWV A;  5J2M A;  2GZO A;  1HBM B;  2DK2 A;  2PI4 A;  3UVJ A;  3NCR A;  4F7V A;  4NA2 A;  1VC0 A;  4ZJQ A;  1S1T A;  2MHN A;  5KFI A;  2K7J A;  2GX8 A;  3DMJ A;  1YRT A;  3IAM 9;  4P74 A;  2OPR B;  3Q24 A;  3EGV A;  1N5Q A;  2BV3 A;  2W2P P;  3IC1 A;  1WG4 A;  4DXL A;  2OHD A;  4YY3 F;  5EX0 A;  4U7U K;  3CCS S;  2MZR A;  1S9G B;  2RRB A;  2R7Q A;  5KFU A;  2HMI B;  5GAD I;  3THT A;  4P10 A;  4F50 A;  2HNZ A;  4A8K A;  4JI0 F;  1R27 B;  5DGB A;  1G4C A;  2WSF C;  3A1Y G;  4LF8 J;  2HQC A;  3L95 X;  1JLQ A;  2V0N A;  1CJV B;  2LLZ A;  1R0C B;  2V5H G;  2DYA A;  2W01 A;  4ED5 A;  4M1K A;  2V8D A;  1N56 A;  3HSZ A;  3S7R A;  2ZJP Q;  3TAQ A;  2Z2Z A;  2DNM A;  1X9S A;  4NOH A;  2HG4 A;  4QPX A;  1Q53 A;  2D1C A;  1WG1 A;  3WIV A;  1Q5Y A;  4AL7 A;  3GJS B;  2JEF A;  4LVN P;  2L3M A;  3HVW A;  4YOE A;  3LF0 A;  3CF5 Q;  4Q44 A;  3O44 A;  3NS5 A;  5MLC V;  5L39 A;  2GA7 A;  3BSN A;  2QZ8 A;  3SSS A;  4DSK A;  2E1C A;  4B9S A;  3CD6 S;  5JJB A;  4J9V A;  2IMO A;  4DR6 J;  2NS1 B;  1YIT S;  5KFY A;  2CWK A;  2FJX A;  1YJ7 A;  4X4N A;  2C2O B;  3GLJ A;  3CJ4 A;  2C1E B;  1EP4 A;  3TZZ A;  3HMJ G;  4IG0 A;  4GRS A;  4P52 A;  1YTY A;  1HL6 A;  2C3M A;  2FGO A;  1UJ5 A;  5HAT A;  1JJ4 A;  2CQ2 A;  4IFY B;  2XLI A;  3OTE A;  1QM9 A;  3LP0 A;  4F04 B;  1FWK A;  3F0N A;  1OWX A;  1I3O B;  5F8H A;  2UV8 G;  2B6A A;  1FNM A;  1KR4 A;  3POT B;  5CYQ B;  4I67 A;  3J80 U;  5D3G A;  1KDN A;  1C1B B;  3RRG A;  2YNG A;  1EKR A;  3GYX B;  2VG7 A;  2A3J A;  3JSB A;  2DIS A;  3SQG B;  1YJ9 S;  3ZTQ A;  1S0M A;  2AWZ A;  3DLJ A;  2GVZ B;  1T05 A;  4QW8 A;  4M5L A;  3TW0 A;  2KU7 A;  4MKV A;  3NOC A;  2YTC A;  3FCW A;  3R6L B;  1LW2 A;  1WC3 A;  4OI1 A;  4CLT A;  3HVR A;  1X4D A;  4P7V A;  3LGN A;  1NKB A;  4PR6 A;  2I0X A;  3LO3 A;  4I2Q A;  2UU9 F;  3T5J A;  2IRX A;  3TI0 A;  3NY0 A;  5CCL A;  3DLB A;  3BH7 B;  5HLF A;  4HLB A;  1X7V A;  3AAW B;  3ZZ0 A;  2DGT A;  1LW0 B;  1XMO J;  1WDD A;  3U1M A;  4E2F B;  2AJ1 A;  1FJG F;  2H5I B;  4CM2 A;  1Z4U A;  4KHP F;  1NK0 A;  4Y65 A;  1RAC B;  4ECT A;  3B8H A;  2CPF A;  3EMT A;  1UW4 A;  2MKC A;  1OJ4 A;  3V4I B;  3MMC A;  3MMB A;  1CS4 B;  1WC1 A;  1UPP A;  3NS6 A;  2XB2 D;  2AYM A;  4EZ9 A;  3NCQ A;  2CXE A;  1WKK A;  5H9F K;  1WNE A;  3MGJ A;  1U49 A;  2E66 A;  3ENW A;  3OR1 B;  2L41 A;  3G6X A;  2E5I A;  5JVH Q;  2H5E A;  2BE9 B;  4LFA J;  2J8S A;  1T9V A;  4RU2 A;  1CUL B;  3CDU A;  4HTJ A;  3DLG B;  4UY8 T;  3FCV A;  4RBU A;  5FDL B;  4KPY A;  3T3F A;  1C0U B;  3MM6 B;  4LF1 A;  3DRY A;  2RS8 A;  3ZNU A;  1U0H A;  4OJG A;  2P6S A;  4N77 A;  3I5A A;  5RUB A;  2MQL A;  4C98 A;  2F7V A;  4DL5 A;  1KVK A;  4DL6 A;  2MKH A;  1JLE B;  3PNI A;  2R2S A;  1NRK A;  4QCL A;  3NGD A;  1RAI B;  2W7O A;  1CJK A;  3G71 S;  4L3K A;  3TAN A;  1J5E F;  4MKY A;  3QQC D;  1S5Z A;  3J7A 1;  5C7P A;  4K59 A;  4K2X A;  5CYM B;  1U6F A;  4F4A A;  3RRH A;  2HVZ A;  1JK9 B;  2GO8 A;  2XO7 A;  1DHM A;  5BR8 F;  4A8M P;  3D0G E;  4C97 A;  1FDD A;  3W9H A;  1H2T Z;  2VIH A;  4C8Y A;  3FDS A;  2ZBR A;  3M6U A;  2VFT A;  3FFI B;  3VHQ A;  2DNZ A;  1IBC B;  4P71 A;  3RBX A;  4Y0F A;  2J5A A;  3CPW R;  1HW8 A;  3R5B A;  1WI6 A;  1QUP A;  3MED A;  1TL5 A;  3UFC X;  3DOK B;  3A3P B;  4C11 B;  4F0M A;  3W5X A;  2KXF A;  4LRB A;  3ADA C;  4KHR A;  3R1L A;  1V5I B;  3GIR A;  2B5J A;  2CAD A;  4QQB A;  2ZOG A;  3QZ8 A;  3HCX A;  1UKU A;  3TAR A;  4RNM A;  3MEC B;  4KGZ B;  3RU0 A;  2B51 A;  1U2C A;  2HGM A;  3DRP B;  1ZZN A;  3PZP A;  2FLO A;  2FZC B;  4DZD A;  4K4T A;  1K1Q A;  5LMN J;  4LQ3 A;  2NSB A;  3RB3 A;  2LQ9 A;  3NWG A;  3QFW A;  2E7W A;  2ZE2 B;  3RAX A;  1WHY A;  2PA3 A;  4K7Q A;  4E8U A;  4CYU A;  3OBI A;  1WSV A;  2YQ1 A;  3MUR P;  5KFQ A;  2L9W A;  4FVC A;  2M88 A;  3MZI A;  5KAK A;  4DPY A;  2AZ3 A;  1OYD A;  3OHA A;  2XNR A;  3DHX A;  5F3T A;  4WFZ A;  1R8H A;  2V6A A;  2W4P A;  2DNL A;  4CO4 A;  4UQG A;  1S6Q B;  1EX8 A;  2N82 B;  3BEG B;  1WKL A;  3MM7 B;  5C24 B;  3KJN B;  4PQU B;  2HQD A;  3KK2 A;  3I6P A;  1U45 A;  4ED1 A;  3UCG A;  3OL7 A;  4NLX A;  5DDQ C;  1RWK B;  1HNZ J;  3CD7 A;  1VQM S;  1Y3K A;  2ZEJ A;  5K5M A;  3IN5 A;  4C0B A;  4TY8 A;  1IKY B;  5D15 A;  2Z58 B;  1PBU A;  4EYH B;  4HT7 A;  3BPS P;  3M1V A;  1K8A T;  3H4D A;  1S6P B;  5G4D A;  4EI2 A;  4KV8 B;  2KZZ A;  1H38 A;  4C0O C;  4QWA A;  4J9O A;  4DFK A;  2GMJ A;  1U24 A;  2QO3 A;  2V4J A;  4ZPV R;  5B0A A;  3SDE B;  3DLK B;  1SC4 B;  5HQ8 A;  1FVS A;  1BUX A;  3N5B A;  2R2U A;  1Q86 T;  4DV5 J;  2FQQ B;  1AZS B;  4FYW B;  1SUQ B;  3Q8S B;  2CJB A;  4KBI A;  1FKP B;  3CUL A;  2UUA J;  4LF6 J;  2VQE J;  1RKJ A;  1IBL J;  3KK3 B;  1MML A;  1S0N A;  2HUR A;  3MM8 B;  1X4E A;  1FT8 A;  1VQ9 S;  3Q8R B;  2MB0 B;  5F8N A;  3NKY A;  1ARO P;  2ROG A;  2H5J B;  3D0H E;  3EVM A;  2DGW A;  2FJA B;  3J7Y U;  2DTJ A;  3HSJ A;  2EBG A;  1HBN A;  1DQ8 A;  4F4K A;  4ZIV A;  1ZM4 A;  2VV5 A;  4DV4 F;  1NZA A;  3M8Q B;  4XK8 C;  2LQJ A;  5GAH I;  1NHV A;  3HO1 A;  2QMU B;  3MR7 A;  1J5O A;  2BE2 A;  3BQ1 A;  2XY5 A;  2LEA A;  4ECX A;  4CP5 A;  2VPZ B;  4DX7 A;  4XIU A;  2J0W A;  2FHO B;  3FQK A;  1FD8 A;  1AUS L;  3AOB A;  5T41 A;  2G2O A;  3H98 A;  1AB8 A;  1D8Y A;  3T1Y F;  1T9Y A;  4Q43 A;  1RTJ A;  2QSW A;  3H59 A;  1TFY A;  1C0T B;  2CQ3 A;  3D67 A;  1YKW A;  2JOQ A;  5E7O B;  4IR9 A;  4DPT A;  3IWN C;  4DR5 J;  4JI2 F;  2EVZ A;  2JC0 A;  3KMQ A;  2B7C B;  2ZD1 A;  2LP4 A;  4YP3 A;  3I0S A;  1MWY A;  2DKO B;  1TFW A;  1F9H A;  1JNR B;  2Z30 B;  2AJQ A;  3V6D B;  3CO0 P;  2XMK A;  3JAM U;  3QWU A;  4F4Z A;  4JI8 F;  1X9W A;  3JSM B;  2Z57 B;  1KKH A;  3DLE A;  4FDF A;  2E1A A;  1RWN B;  2X1F A;  5AXK A;  2XCA A;  4O3Q A;  1XNQ F;  4OQJ A;  3GJT B;  1TL4 A;  1N34 F;  4DV3 F;  4CLW A;  4DCP B;  5A8W A;  1KFD A;  4I6W A;  5EDW A;  4C3L A;  1WHX A;  2R7U A;  3EGN A;  1UEV A;  3ENA A;  1U1O A;  3EVO A;  1LFP A;  3BS9 A;  1O0P A;  1YGY A;  1RJJ A;  5D77 A;  4PKD B;  4ITS A;  1AA1 B;  1R8P A;  3GR0 A;  3P5T L;  4DUZ F;  2QJ3 A;  1FFW B;  1IQT A;  3VF0 B;  1MW7 A;  2BX6 A;  4KAI A;  2Q1L A;  2KT2 A;  2VDI A;  4H4M A;  5H1S V;  2ZZM A;  1SIW B;  1N33 F;  4JI4 F;  4UF4 A;  3WX8 A;  2GQQ A;  1FDN A;  3TA2 A;  4B3T F;  4RUB A;  1UFL A;  4D3H A;  3QJP A;  1QAJ A;  3OXF A;  1REV B;  3W63 A;  2BJ9 A;  4ZHR B;  3BR9 A;  2ATC B;  3SV3 A;  5L8R C;  4O3P A;  2IYG A;  1S1X B;  5A8K B;  1Q7Y T;  3K5M A;  2IA6 A;  1JLB B;  4OJ3 A;  2QX0 A;  1ULR A;  3ET6 B;  1UL3 A;  5DM6 Q;  2WRM A;  3Q8P B;  1U6Z A;  2C42 A;  3WDO A;  2ADB A;  2WCX A;  3LW5 C;  1XQI A;  2DNK A;  4DHV A;  4KPC A;  3NLC A;  1GQE A;  1JNZ B;  2DXF A;  5B0G A;  4HHJ A;  4LRE A;  1RHJ B;  2BJ1 A;  3U27 A;  3RAQ A;  1KLN A;  3QO9 A;  2H9Z A;  1PBA A;  1R6V A;  3G4S S;  4RX6 A;  2GQ2 A;  1CJT B;  1KWM A;  1X4A A;  1DLO A;  4C2M A;  2IAJ A;  4Q45 A;  2UUT A;  4DDF A;  2HHU A;  1GT8 A;  1Y5I B;  3CD5 A;  2O67 A;  3FEY B;  2UXB J;  4LSN A;  1RWO B;  2YKN B;  4TQS A;  2DEJ A;  4A8S A;  2R3V A;  3GV5 B;  3MXH P;  5J1E A;  3HM9 A;  2E7X A;  1JMT A;  1V9O A;  2AP6 A;  1N6Q A;  4JI5 F;  1TKD A;  3CWJ A;  1H73 A;  3PV8 A;  4AT1 B;  2ZH6 A;  2FGC A;  3I0R B;  4Z2X A;  2QA1 A;  1VQN S;  5ETM A;  2FVC A;  2DPJ A;  2DR5 A;  3LP1 A;  1XMQ F;  3EE3 A;  3DRR B;  2X1A A;  4F36 A;  2I1R A;  1U7L A;  5EX3 A;  3QGG A;  1FRH A;  2OPS B;  3M9N B;  2JZ5 A;  2XQC A;  1RHR B;  3IFE A;  2FIU A;  5ETP A;  1HBU A;  3K0J A;  2EK1 A;  5IWA J;  2MQP A;  1TL1 B;  4PXB A;  1VJQ A;  2ZJR Q;  1OO0 B;  3C15 A;  2KN4 A;  1ZZF A;  3R27 A;  5LOQ A;  2RRA A;  1AXQ A;  4PXE A;  1S9F A;  1XER A;  5HK4 A;  3GJQ B;  3I5B A;  2IPO B;  3DI6 A;  1X4G A;  1RCO B;  5DDR C;  4DPW A;  1NDP A;  4P2F A;  4M5K A;  4N41 A;  3ZTP A;  4AQY J;  2MY7 A;  3KUG A;  5D4P A;  3M7V A;  2KXN B;  1U1M A;  1E6Y B;  2H65 B;  5ETK A;  1N54 B;  2YNH B;  3C6T A;  5H9E J;  1VGY A;  3SIP B;  4X4P A;  5D4L A;  3MR6 A;  2BOP A;  4K5R A;  3PHE A;  2YPZ A;  4GKK J;  2E5L F;  4WYW A;  5GMK a;  1WOS A;  4BHQ A;  2AEF A;  1BQX A;  1OMS A;  3PX6 A;  1EET B;  3UDE A;  2HK3 A;  4LF7 J;  1XWL A;  4ZN3 A;  3B78 A;  1B99 A;  3THV A;  2R7O A;  4KSE B;  1A6L A;  2AIR B;  4ZVG A;  3IRX A;  3JS9 A;  1IKV A;  3PYF A;  4OZJ A;  4CO2 A;  5IM0 A;  1E6V A;  5AT1 B;  1SJ4 P;  1IBK J;  4X64 J;  5JMN A;  5M2P A;  1JLC A;  3RB6 A;  2CPJ A;  3ZXW A;  2ZVI A;  2BZ2 A;  2DO4 A;  1R0A A;  2VBX A;  3W2V B;  1HQ2 A;  2QEX S;  2VG6 B;  4RW9 A;  1KTV A;  4CO0 A;  3LH2 S;  2GS8 A;  3DU6 A;  2A6M A;  5EUH A;  1S6U A;  3G8S A;  2DRA A;  4EO6 A;  5HMZ A;  2ZZT A;  1T9U A;  2QL9 B;  2EKN A;  3AH6 A;  2ZZN A;  2RKI B;  3DN9 A;  1T7P A;  3D6F B;  4RJV A;  1Q81 T;  3QWP A;  1FTC A;  3QPI A;  1S48 A;  4FNH A;  5T7L A;  2GGP B;  3PY8 A;  2CJX B;  1RZM A;  1TMJ A;  2LFV A;  2V2Z A;  4DV6 J;  2MGZ A;  4H4O A;  1NBE B;  1VFJ A;  3M6W A;  3CJK B;  3K59 A;  2A0F B;  1Q4R A;  1YJN S;  2VU5 A;  3MPD A;  3M9M B;  2KRB A;  2AV5 A;  3K2Y A;  5CZX A;  2C2E A;  4U8V A;  2A1B A;  3MAQ A;  2YKP A;  2ZJQ Q;  4LR8 A;  3W62 A;  4ZLP A;  3LQV A;  3NP5 A;  1FCA A;  1JX4 A;  5KFD A;  2YH1 A;  1KHW A;  4M5M A;  2GAH C;  2W9C A;  2ASL A;  4N5S A;  2BJ8 A;  5ETN A;  1HWJ A;  3V5R A;  4G65 A;  2B3T B;  2BJ7 A;  2D3O 1;  3M8R A;  3QAU A;  1SB6 A;  2F1F A;  3I96 A;  3I87 A;  3HD2 A;  4TY9 A;  2YKO A;  2JLG A;  2CKW A;  1NK8 A;  3QYY A;  1ZPW X;  4YB6 A;  1KHV A;  2XWY A;  3BGL A;  1WOR A;  2YX4 A;  5CD4 H;  4DQR A;  2AX0 A;  2DR6 A;  3OSN A;  3AOA A;  2H3E B;  5GVQ A;  3Q8Y A;  5J2Q B;  3OFE A;  2O1P A;  3SCK E;  1NND A;  1Q5V A;  2BQ3 A;  2YQ3 A;  2DHX A;  3M30 A;  3JSY A;  1UVL A;  2YX7 A;  1KVJ A;  3L7P A;  2D3Z A;  1D09 B;  3QIP A;  3MD3 A;  4UOC A;  3N6M A;  5ETR A;  1HAR A;  2M52 A;  1U02 A;  2IRU A;  2B4O A;  2FJD B;  3HKZ D;  2R4F A;  4ZA1 A;  3OXL A;  2WON B;  4IG3 A;  3CUN A;  1VRU A;  5LT5 A;  4LJM A;  2DT9 A;  1ZS6 A;  2OGU A;  1S57 A;  3ZC4 A;  4Z7Y A;  3OJU A;  3BYP A;  4A47 A;  4U95 A;  2MKY A;  2YXL A;  5KFM A;  4Q0B A;  3BN4 A;  3QSY B;  5J2P A;  4NZ0 A;  1I6J A;  3CCM S;  2AKW B;  1B4S A;  3EVW A;  4DQP A;  5D8H B;  3PW5 A;  4NLS A;  1OSD A;  3HD1 A;  1IVZ A;  1RWV B;  4NPO A;  4DUY J;  1QLN A;  2GMH A;  5CQG A;  2GHV C;  1S9E A;  1RWW B;  1UZH A;  1CQM A;  2FY8 A;  2VAS A;  2IFX A;  5E33 A;  1OY9 A;  5I3Q A;  4O4G A;  1YIJ S;  3NAH A;  4ZVP B;  2OP5 A;  3GPA A;  1HMV B;  3SV4 A;  4D3G A;  4WFA Q;  4Q2M A;  2CPD A;  5E2Q A;  5LJ5 Y;  1BC6 A;  1R7I A;  3HX9 A;  1IJF B;  2NUU G;  5IT4 A;  3M8P A;  5F0W A;  3CCQ S;  2JVO A;  3PO5 A;  4CLU A;  5F8I A;  3ILO A;  4ECQ A;  2Z2Y B;  5B7W A;  2WSC C;  2QGF B;  1NSQ A;  1X9M A;  2XMM A;  3MM5 B;  2HAF A;  3LGH A;  3J81 Y;  2ILY A;  2ZH2 A;  4EWT A;  4OX8 A;  3QGP A;  3J81 j;  1RU2 A;  1FI4 A;  2DY1 A;  2ATL A;  2V8G A;  3PVX A;  4LFC J;  1QUV A;  3JQK A;  4DR4 J;  2XMJ A;  1FKO A;  4LR7 A;  3PJX A;  1LWE B;  1W7W A;  1S77 D;  2P9C A;  3CCZ A;  1G2E A;  1S1V B;  1UEK A;  1U1N A;  3DGP B;  1RK8 A;  3K8W A;  4DL7 A;  1G3O A;  4ZLL A;  4RW6 B;  3ZZZ A;  4CT9 A;  2HYI B;  4URG A;  1V6H A;  3C46 A;  3KG0 A;  1RU1 A;  1NJX A;  1RAO A;  2XI3 A;  1FD2 A;  2ZHA A;  3MUM P;  5KFH A;  3KLE A;  1IQZ A;  1TQL A;  3D0I E;  2K3K A;  1NSA A;  1FRM A;  5CD4 A;  4ID5 A;  2ZOM A;  2HZC A;  2B9Y A;  4M5G A;  1VRT B;  5I42 A;  1NU4 A;  1U2F A;  5E3A A;  4NE9 C;  1U2R A;  3MDF A;  3NS7 B;  4RNN A;  1EIY B;  2J6S A;  3O2I A;  3C6U A;  2MZS A;  1WF0 A;  4Y3C A;  5SZT A;  3H20 A;  2HND B;  3BSA A;  5HQL A;  3KHR A;  1H74 A;  2XUL A;  4J9U E;  4LFB J;  3OD2 A;  4DSF A;  2PI5 A;  8AT1 B;  2B4P A;  4M8L A;  1RT1 A;  4FF4 A;  4JYA J;  1X60 A;  3NXZ A;  1UA1 A;  2M3D A;  3WC2 A;  2HWT A;  4MIW A;  2XMV A;  4AD6 A;  3HI9 A;  4U7U D;  1NK7 A;  3ZTS A;  5K8O A;  1GXL A;  1WAC A;  1CC8 A;  2DGU A;  1DFD A;  2KDO A;  2NSC A;  2VBY A;  2N7C A;  1F2G A;  4EMD A;  1UWB B;  4RW4 A;  3G82 B;  4YDD B;  3D7S B;  4J9S A;  2KT3 A;  1RSC A;  3JTO A;  1PIE A;  1VI7 A;  1PCA A;  1WC0 A;  1SJF A;  1M5V C;  1NEE A;  1U8S A;  4JI7 J;  4NZ7 A;  1DQA A;  4X4V A;  3O3L A;  5HMY A;  2XBP A;  1A7G E;  3NBP A;  2CG8 A;  3DOL B;  2L9D A;  3Q83 A;  3OVS A;  3K57 A;  1QSL A;  2FVS A;  4NCG B;  1J2V A;  2CPH A;  1FX2 A;  4U67 Q;  2V8H A;  3H2V E;  1QTM A;  6FDR A;  3ZTO A;  1S10 A;  3UD3 P;  2UUB F;  1YQH A;  2YNF B;  2VG5 B;  2E5J A;  4HAC A;  4RWW A;  3MHY A;  2SXL A;  4B3R F;  1NUE A;  2BM1 A;  4PUO A;  1DJ0 A;  1NK4 A;  3MFI A;  2HGL A;  5C25 A;  3DMJ B;  1Q0N A;  1BQN A;  1X5T A;  2VA3 A;  2F8E X;  4B3M J;  1UW9 A;  4OI4 A;  3UQS A;  5AXL A;  3R5G A;  2G0J A;  3H5U A;  4JI6 J;  3OR2 B;  1JJH A;  1PIL A;  4MYT A;  4OZ2 A;  4LF5 F;  1R31 A;  4ZVH A;  1XNR J;  3FCH A;  5B0D A;  3EZU A;  2ERR A;  3IGV A;  1JLQ B;  3LUY A;  1KOH A;  1M1H A;  3E8O A;  4YB1 P;  4NLQ A;  4WCE Q;  4U7C A;  2OD4 A;  3MAA B;  2YQ0 A;  3CTR A;  3D2W A;  4LIR A;  1VQS A;  3AB4 B;  2ZH7 A;  4ED0 A;  1Z1Z A;  4NI2 B;  3D4J A;  4ZCL A;  4EBC A;  1M5S A;  2XMU A;  3PAC A;  4CM0 A;  3W5Z A;  1V3R A;  3A8K A;  3K5N A;  4WJB A;  3BZQ A;  3BQ0 A;  1S0O A;  1W2B R;  2D69 A;  3Q86 A;  5CHC B;  1RA6 A;  3GIM A;  4DN9 A;  2OKQ A;  4PYD A;  2WOM A;  3A8I A;  4ETZ A;  2DB1 A;  3J81 U;  1FJ7 A;  1RLD A;  3M8Z A;  2OSR A;  1XR7 A;  1WTB A;  4Q8F A;  4F8R A;  4JI1 F;  2F8H A;  1MWQ A;  2G9O A;  3DU5 A;  1T03 B;  3W64 A;  3FMW A;  3DKD A;  2UXC J;  3OL9 A;  4HI1 A;  3EJM A;  3FC9 A;  1KD1 T;  3HJV A;  3SFG A;  4NEY A;  4O3O A;  4IG0 B;  1RHQ B;  4DR3 F;  4S0M A;  3US5 A;  1NDC A;  4MTP A;  4LBI A;  3T41 A;  2A6O A;  3AHP A;  3GG0 A;  1U0S A;  3E2E A;  1VK3 A;  4NLP A;  4ILM A;  2QL5 B;  2ILZ A;  4NLO A;  4DV2 F;  2CFX A;  2YY3 A;  3SCI E;  3MMA A;  2OPR A;  3GCW P;  3IWX A;  3B4D A;  3LP0 B;  3BR8 A;  2V68 A;  2AYB A;  4DF8 A;  3P96 A;  3KNA A;  3H40 A;  1QAX A;  4OZ3 A;  4A8W A;  2Q6B A;  4DSI A;  5C42 A;  4C8Z A;  3ZZR A;  2VG7 B;  1WHW A;  2HMI A;  3BO4 A;  3CT9 A;  2EKY A;  4ZVQ B;  3BKF A;  2JFK A;  3G8Q A;  2BUN A;  5CA5 A;  3CDA A;  1F9F A;  4X84 A;  1T05 B;  5KFA A;  3UE2 A;  3JYT A;  1TL7 B;  5HVG A;  1KEK A;  3GII A;  4UY8 5;  4I69 A;  1CJV A;  1LW2 B;  2RIL A;  3A8J A;  4OX9 F;  4E98 A;  4MJK A;  2EWH A;  3KLG B;  2OD6 A;  1VK8 A;  4P6Q A;  2VC0 A;  3HXM A;  2GIF A;  2BXJ A;  1BY9 A;  3UD5 A;  1NXI A;  1RGV A;  1PC5 A;  1BWE A;  3NGS A;  4K0K J;  2IHR 1;  5HLF B;  5IQQ A;  2IVF B;  4DR7 J;  5L9X A;  5IS2 A;  2GC8 A;  3RTV A;  1L3K A;  1VHF A;  2J9D E;  1R43 A;  3BN7 A;  3R8Y A;  3LPE A;  4WFY A;  3PX0 A;  3MMC B;  3N0V A;  1XJW B;  4DG1 B;  3OTC A;  5E0O A;  3VVU A;  4HL9 A;  1IWA A;  4Y2K A;  1BE4 A;  1VBY A;  4ZPT R;  4N76 A;  1JQG A;  2BAN A;  5D0R A;  2VBZ A;  4KH1 B;  4FF2 A;  3PRD A;  4CCH A;  4KB7 A;  3A4T A;  1GK8 A;  1IM4 A;  1YJT A;  4WPA A;  4L76 A;  3FQL A;  3JTP A;  3R5D A;  1TL3 B;  4KKO B;  1M5P C;  2UZA A;  3E51 A;  2VBW A;  2KKH A;  2PA8 D;  4ER8 A;  2DGQ A;  1EKS A;  4O0N A;  4H4K A;  3CME S;  1CBK A;  4F67 A;  1YJV A;  2FB0 A;  4X66 F;  2BM0 A;  2JL9 A;  3POT A;  5CYQ A;  3UDC A;  1S12 A;  1C1B A;  1SVD A;  2F63 A;  5DG7 A;  2IVY A;  1CJK B;  2HHT A;  1FEE A;  1RHK B;  5F8L A;  1U1K A;  4RLE A;  2VQF J;  3VAL A;  2GVZ A;  2E1R A;  4B9M A;  3O1L A;  2KYX A;  1N4L A;  4GKJ J;  1TVR B;  3DFE A;  2HZV A;  1N0U A;  4DU7 A;  3AOD A;  1HYS B;  4QU6 A;  5FD1 A;  2H54 B;  1SI9 A;  2W24 A;  5IV4 A;  3KK1 B;  1S4F A;  5FLX U;  4KIA A;  1S1U A;  1LW0 A;  4HI2 A;  1FDB A;  2OEK A;  4C7Q A;  2ZC3 A;  2E1P A;  2F3J A;  1S97 A;  3FSI A;  4R0E A;  1MLA A;  5KFT A;  1HNW J;  2CJY B;  2VKR A;  3SCL E;  4GMK A;  2V9K A;  4I2P A;  1IR0 A;  3ENQ A;  1M5K C;  2VOP A;  1NHU A;  1SIZ A;  1YJR A;  2J6T A;  5H9F J;  2PE8 A;  2XS2 A;  2WVB A;  3HKW A;  2B5J B;  4F02 A;  1HI8 A;  4ES3 A;  2GFF A;  2ROE A;  1MWZ A;  4DS4 A;  4QYZ K;  2P5V A;  1VQ8 S;  1QE1 B;  4JUZ A;  4C3M A;  9ATC B;  1WG5 A;  1NLK L;  2Q43 A;  3GFY A;  1CUL A;  1OIA A;  4PRF A;  4K4Z A;  2Q3P A;  5FDL A;  1C0U A;  2YWH A;  4YY3 J;  3MM6 A;  4I4B A;  2RE1 A;  2ZC4 A;  3MPY A;  1VRQ C;  1Q82 T;  1RA7 A;  1U8W A;  2XZT B;  4Q7A A;  2J7W A;  2MZQ A;  3HZG A;  4CIO A;  2CVI A;  1HWK A;  2FJV A;  5GMD A;  4JI0 J;  1NO8 A;  2BJE A;  4PEO A;  1JLE A;  2J7K A;  4NML A;  3S8S A;  3OTO F;  5CAB A;  1N32 F;  1Q7L B;  3CJQ A;  2AQ4 A;  1KTQ A;  3W60 A;  3KYL A;  2KJV A;  2G4B A;  1HQU B;  4FBT A;  4KFB B;  3VAG A;  2ACY A;  3CGI A;  1I1G A;  2MTL A;  2NCK L;  3R5J B;  5I3U A;  4WP3 A;  3GSI A;  2FHM A;  2LKZ A;  2MHE A;  4NLV A;  4LSZ B;  2KTQ A;  3OUY B;  3KJV B;  5KG7 A;  4PG5 A;  4WU2 A;  5CYM A;  2X51 A;  3RYL A;  1CJU B;  3CC4 S;  4Q8E A;  3F41 A;  2P9E A;  2R8J A;  4PYA A;  1SV5 B;  3EPI A;  4RBT A;  4WIQ A;  2NXC A;  4ZKA A;  1KOO A;  4IOC Q;  2E9R X;  2XI2 A;  2K06 A;  3BDE A;  3L09 A;  3JXO A;  1RXO B;  4QWB A;  4B3O A;  2WB1 D;  3RW6 A;  3FFI A;  5JXS A;  3CNQ P;  4QIF A;  2W9B B;  1NH7 A;  3DOK A;  5A6P A;  2HQG A;  4C11 A;  4X65 F;  4EBD A;  2LU1 A;  5KFL A;  3GJR B;  4OL8 A;  3EDR B;  1WOP A;  2Y1I A;  2V4J B;  3T1A A;  2CNL B;  3MEC A;  4OI2 A;  4Z37 A;  3R9L A;  4TVA B;  4DSJ A;  4XPE A;  5A0Y A;  4WF9 Q;  2KO1 A;  1KQS R;  2ZHO A;  2W8L A;  2JWN A;  3DRP A;  3SMZ A;  4ZN1 A;  1T9X A;  2F4F A;  3D6M B;  2OFG X;  3GFH A;  2XEX A;  3HVT B;  3PKM A;  4L75 A;  1BQM B;  5D6G A;  3IS9 B;  2QFJ A;  3F44 A;  4NLG A;  2QLW A;  2LYV A;  3HK2 A;  2HBQ B;  4N56 A;  1TKX B;  3C3L A;  5KG0 A;  5ADZ A;  3AY0 A;  5HAO A;  4WFB Q;  4L72 B;  4EYI B;  3KOA A;  4K4X A;  4Y2I A;  2AEJ A;  1RT4 B;  2CZV C;  4NYO A;  2EEY A;  1LXN A;  2UU9 J;  1U1L A;  3NG8 A;  4M5N A;  2B7B B;  1DY3 A;  2ZVS A;  3D1O A;  1HD1 A;  2XHW A;  2J9E A;  3UNG C;  5FJ4 A;  2PGC A;  1SKW A;  2W2Q P;  1FJG J;  2R7W A;  1VIO A;  1XBW A;  4PQU A;  4KHP J;  1H0H B;  3JTN A;  1ACM B;  3THP A;  1K73 T;  2HS0 A;  1DQ9 A;  2Q6C A;  3V2U C;  4DV1 F;  2K8G A;  3FBB A;  3NNC A;  2DR9 A;  2CJK A;  5B0F A;  5L1L A;  3OLB A;  2UXD F;  5GAE I;  5HQM A;  5K9F A;  5U47 A;  1RWU A;  4WFX A;  2M8D B;  1KLM B;  4NRT A;  1FFS B;  4KV8 A;  2LEC A;  2R42 A;  2ZD1 B;  5IT9 Y;  3I0S B;  2KFZ A;  4J9R A;  1YRU A;  3BGF A;  3SDE A;  4UTG A;  3DLK A;  2NXJ A;  1UZD A;  2VHG A;  5HVF A;  1P9Y A;  1NPR A;  3M4X A;  1FXR A;  4A8Q A;  1AZS A;  2QYG A;  1SUQ A;  3B4M A;  1WJ9 A;  3BQ2 A;  5K14 B;  2MLZ A;  5F9N A;  2HSE B;  1VYA A;  2CRL A;  3SEO A;  3T5L A;  3MM8 A;  1YK9 A;  3DLE B;  2QC3 A;  3ICL A;  3TX0 A;  1J5E J;  1JLG B;  5KFE A;  3QSI A;  3JB9 k;  2VON A;  1R89 A;  4IOB A;  3J7Z T;  5K8M A;  2BKO A;  4OLO A;  4OHY A;  3BJY A;  3TQ1 A;  4DQS A;  4DSL A;  2LVW A;  1NSK L;  5D0H A;  3W5Y A;  2R8I A;  3M8Q A;  1FE0 A;  3FSY A;  5BR8 J;  1RWP B;  2NZC A;  1U1R A;  3DM2 A;  1CC7 A;  4EBE A;  3G87 A;  4CLK A;  1TU0 B;  2MEW A;  3M2R A;  4MFB A;  4MK9 A;  4PG8 A;  4WU3 A;  1DTT A;  1TK0 A;  2I38 A;  1NK5 A;  4LMZ A;  1YRX A;  4QR1 A;  4BS2 A;  1TKZ A;  2POK A;  1LK7 A;  4CLZ A;  2MLY A;  2VA2 A;  5KFC A;  3LPY A;  2XYG B;  3QRP A;  1Q8I A;  4FVM A;  3ONQ A;  3BSO A;  1YX2 A;  4C8O A;  5HBM A;  2MKS A;  3I31 A;  1C0T A;  4J9Q A;  1SL0 A;  1J27 A;  3K58 A;  1PYS B;  2RSQ A;  4DV7 F;  5A76 A;  2BEF A;  2VJV A;  3N6N A;  3GIK A;  2HRY A;  4NL5 A;  1S76 D;  2HVI A;  2OLW A;  3MCS A;  3RAM A;  1R6Y A;  3D66 A;  4F25 A;  2JJ4 D;  4PQA A;  1ZYQ A;  2Q79 A;  4X62 F;  1GTE A;  2HHP A;  2AJ4 A;  1T9W A;  4QW9 A;  1ZM2 A;  2ZWP A;  2HZA A;  4USV A;  3V6D A;  4I0W A;  5LM7 E;  3TJ8 A;  3KUE A;  5KFF A;  3QO9 B;  2VF3 A;  3FEX B;  5HP1 B;  3W61 A;  3K5P A;  3NEK A;  4NXN F;  4QU7 A;  3JSM A;  3EIC A;  1GMV A;  1UET A;  2JDJ A;  4QWC A;  1HIY A;  2BR0 A;  2HHW A;  1LQ9 A;  1DLO B;  2KH9 A;  4LR9 A;  4CO3 A;  2H51 B;  4WYL A;  2HFU A;  2WVE A;  1RT3 A;  1KS2 A;  1S7H A;  4J9L A;  3BDP A;  4YR2 A;  4PG6 A;  4MIA A;  3FBC A;  3D5M A;  4IOA Q;  3VAI A;  3CMA S;  3BGO P;  4UOH A;  4O3R A;  4DLG A;  3DHW C;  2MYF A;  5DQG A;  5E41 A;  3NWR A;  7AT1 B;  1XN9 A;  1N6Q B;  3I82 A;  2HRT A;  1GXT A;  4NXM F;  3C14 A;  1VQ7 S;  4CNY A;  2WHO A;  4J5O A;  3OVB A;  5IC6 B;  1GMW D;  3K7R A;  4ZIT A;  3H8Y A;  3EZ5 A;  1Z2Z A;  3OL8 A;  2XS5 A;  2DR7 A;  3LP1 B;  2GV1 A;  1REV A;  2XMA A;  3MEE A;  4QIG A;  5F3Z A;  3IAS 9;  2J0X A;  5L38 A;  5HMX A;  1S1X A;  1UFK A;  2QLF B;  5A8K A;  4FF3 A;  1JLB A;  2A2D A;  1JXL A;  2Y8Y A;  4ILR A;  4DUT A;  4XDD A;  3ET6 A;  1SXL A;  2HFS A;  5GAH U;  4DOZ A;  4ID8 A;  3C15 B;  4F0K A;  2CQ1 A;  2W9A A;  3OSP A;  3SYZ A;  4OZ5 A;  2XTJ P;  3VAM A;  3L9Z A;  2LXI A;  2C3P A;  1F5C A;  2G1D A;  3QT8 A;  5KFB A;  2PMZ D;  5IXU A;  3AXM A;  4ANE A;  3TUP A;  5DQH A;  1KQF B;  3EWG A;  4TYB A;  4NMX A;  5AE1 A;  1EQ0 A;  3O8W A;  4F4W A;  3KLF B;  4M5J A;  2XSF A;  2RDI A;  4ZP9 A;  3MFH A;  2B43 A;  4DV4 J;  2FJW A;  2ZUA A;  4OHV A;  1Q78 A;  1YSJ A;  3M2U A;  3PEH A;  4QR2 A;  1QJH A;  4JP8 A;  3V81 B;  2EG2 A;  1XK8 A;  4GVB B;  4KGX B;  2K7K A;  2R8H A;  1HNX F;  2YKN A;  2CAJ A;  2WAQ D;  2AJ0 A;  3CJS A;  3IRX B;  3T1Y J;  4C4W A;  4JB8 B;  2K2P A;  3VAH A;  3E01 B;  1OPZ A;  5IM0 B;  3HFZ B;  2PO4 A;  2YKQ A;  1B3T A;  3KLI B;  4OYA A;  4EZ6 A;  1JLC B;  2YWE A;  2DHG A;  1AFJ A;  2OI2 A;  3I0R A;  3NOG A;  2CZ9 A;  1UCN A;  1W2I A;  4O0I A;  1SC3 B;  1RT6 B;  1R0A B;  1TAQ A;  4JI2 J;  1RI7 A;  5FII A;  2QIF A;  2C3O A;  3CXC R;  1LWC A;  3DRR A;  3NRB A;  2GIQ A;  2YH0 A;  1DZ5 A;  3BO3 A;  3AJ1 A;  2HHH F;  1R8B A;  3VVT A;  2W2N P;  2V4Q A;  3GR1 A;  1Y3J A;  2J6U A;  2OPS A;  3GV8 B;  2K3I A;  2BQU A;  1MU2 A;  5E3Q A;  4J9M A;  2UP1 A;  2KG1 A;  5LJ3 Y;  1TV6 B;  5F8J A;  4USM A;  1X5S A;  3BV8 A;  1H98 A;  1NB2 A;  1RYR A;  3AB2 B;  5KFK A;  1L3S A;  3WHI A;  4JI8 J;  1AT1 B;  3GE9 A;  4H4O B;  1RUS A;  3DDN A;  1YWX A;  1XNQ J;  3IP0 A;  1RT2 A;  2RD5 C;  1N34 J;  4DV3 J;  2BDP A;  2QL7 B;  1E6Y A;  3PW2 A;  3V6H A;  1X0P A;  4ZJL A;  4FYX B;  1PAU B;  3OQ2 A;  1FE4 A;  2W4C A;  1S49 A;  4R5P B;  3IMQ J;  3HHL A;  4FF1 A;  4FKX A;  4K8R A;  2ROP A;  7FD1 A;  5B0C A;  4OX6 A;  4K5S A;  4DBQ A;  3C66 A;  2CQD A;  1IKW B;  3TX8 A;  4O3S A;  4DUZ J;  4CWB A;  2APO A;  2CJ9 A;  4FYD A;  3TRG A;  2RVJ A;  1R8C A;  4N7T A;  5KOX A;  1ZTW A;  4Q5V A;  4ICL B;  3UO0 A;  6FD1 A;  3R1H A;  1HWU A;  2P9G A;  1N33 J;  4JI4 J;  1Q95 G;  1HKA A;  3A8E A;  1KNZ A;  2MQ8 A;  3D3B J;  4B3T J;  3CCE S;  2CPZ A;  2NXE A;  2MST A;  3UPF A;  1P9Q C;  2EFN A;  5B0B A;  3JQM A;  1HNV A;  1C2P A;  3GYN A;  4PAA A;  1URN A;  2CA9 A;  2WK4 A;  1EAR A;  1CLF A;  1AW0 A;  5BYR A;  3CCU S;  1S0V A;  1TKT A;  3D1Q A;  2W4D A;  1JLF B;  4LUB A;  3UCZ P;  2D3O R;  4OHW A;  2VG6 A;  4IRK A;  3M6V A;  2BOA A;  2J0Q D;  4KHM A;  1RT7 B;  2FHJ D;  4LF9 F;  3M30 B;  4G1Q B;  3BO2 A;  3WQP A;  4CTA A;  1M0S A;  3EZO A;  2RKI A;  3MOJ B;  2OPQ B;  1AUD A;  2R7T A;  2B4U A;  4OYB A;  4LVO P;  2M0G B;  3TVZ A;  3K5L A;  2GGP A;  1VQ5 S;  4F4X A;  2OO4 A;  3EGW B;  4ED4 A;  3UN3 A;  4K4Y A;  2IBK A;  1RAG B;  4K2J A;  5L9N A;  4ECU A;  1KBR A;  1X4F A;  3CJK A;  4TLQ A;  1DTQ A;  1UTA A;  1X4C A;  4ZPW R;  1KRP A;  4DWI A;  3P5B P;  2V50 A;  5F9L A;  4PPZ A;  3O6Q A;  3CCT A;  4JI3 F;  4MK8 A;  1HI0 P;  2ZHB A;  2JHE A;  5ETS A;  1TAU A;  4CLP A;  1B7F A;  1JJ2 R;  1SKS A;  5IT0 A;  2RAQ A;  4ZK7 M;  5J2P B;  3Q0A A;  5KG3 A;  4HHH A;  2WVD A;  1D9A A;  3GIJ A;  3NL0 A;  2R2R A;  4HEA 9;  4IFV B;  5E3C A;  2GHW A;  4JI5 J;  3PXG a;  2K1R A;  2DIU A;  2M4M A;  3KMS A;  3DLH A;  5KT6 A;  2QMW A;  2B9W A;  1HNI B;  1XMQ J;  2OML A;  2PEB A;  1QDU B;  4DEZ A;  3IR7 B;  5E3R A;  1SL1 A;  2J9C A;  4NRU A;  2PD1 A;  3PFE A;  2ZNZ A;  1FVQ A;  4O4G B;  1N52 B;  1KON A;  4FPR A;  3FBF A;  4NX9 A;  4ED6 A;  4NLW A;  2EXU A;  1FXL A;  1RP5 A;  3BBB A;  3RJM B;  5J2Q A;  4DR2 F;  4ZVT B;  2DVI A;  2DCL A;  2V94 A;  1XMB A;  3FRY A;  1FJC A;  3DRS A;  1HPZ B;  4TU9 A;  5G0R B;  1SJ1 A;  1JKH A;  3CE8 A;  3M8P B;  2DPI A;  3UNY A;  3HVA A;  2HHX A;  4ZIW A;  5HN0 A;  3TOQ A;  3LGM A;  1OS5 A;  4FYV B;  2Y9H A;  2IIH A;  2E9Z A;  5I4M A;  2HNY B;  2V8P A;  2DGO A;  3W2W B;  2AGO A;  3D6T B;  4PAB A;  2HVH A;  1EHW A;  4IH7 A;  3FBE A;  1GH8 A;  2LEP A;  3K89 A;  3ELH A;  3PX4 A;  2DH7 A;  2VD3 A;  2MMY A;  2E5L J;  3S1T A;  3T6B A;  3IRW P;  3V6J A;  2PN6 A;  2P8I A;  2HLU A;  4J9N A;  5DGA A;  2LQB A;  2MDA A;  4LRA A;  2CQB A;  2KFN A;  2CYY A;  1ZTT A;  3S6E A;  3T1H F;  2VJU A;  1FFG B;  2JFD A;  4ED7 A;  3RR7 A;  5EWG A;  2J0S D;  1Y5L B;  1RTH B;  2EC2 A;  4QYR A;  4O3N A;  1QAI A;  1MN7 A;  3D1H A;  2RS2 A;  4FN5 A;  1UVI A;  3VV2 B;  3G9C A;  3KLH A;  3QRQ A;  1ZET A;  2F8M A;  4ILL A;  2LA6 A;  1RBA A;  4X4T A;  4USU A;  4WXO A;  2GHP A;  1OYE A;  4BCA A;  1N0V C;  5IOL A;  1U1Q A;  4F26 A;  1B64 A;  4QBU A;  1MRO A;  4TKT A;  2WB4 A;  2E1M C;  3WZ0 A;  3P4U B;  2QSF A;  1AYE A;  2CIM A;  1M5H A;  1ZAX A;  2M5Y A;  4I7F B;  2I8E A;  3R97 A;  1WF2 A;  2QV6 A;  3SI8 A;  4X4R A;  4AND A;  1RCX B;  2C28 A;  4ECY A;  2UVV A;  3QGI A;  2W25 A;  4DZ6 A;  4YB7 A;  2BQR A;  5BYQ A;  2V8V A;  2KXH A;  1VQP S;  1HFE L;  1RDR A;  2ASY A;  4OZ0 A;  1YLX A;  4LF4 F;  4QJV A;  4IRC A;  1M90 T;  2DNR A;  4DX6 A;  3I32 A;  3B54 A;  9RUB A;  1R0B G;  4B9L A;  4RW4 B;  2VL1 A;  5LL6 d;  1UJ4 A;  2FJE B;  3H42 A;  2VH7 A;  5HO4 A;  4EK2 A;  1X5O A;  2L48 A;  2W2M P;  3DNC A;  3IG1 B;  2B8Q A;  4DPO A;  1U26 A;  1LFW A;  3CJ2 A;  3W1Y C;  1G1X A;  4KC5 A;  2AU0 A;  2F40 A;  4LT6 A;  4N47 A;  1Y5N B;  4W4M A;  4AXI A;  2Y0S D;  3ETM A;  1S1V A;  1JLA B;  4I1T A;  1HHQ A;  3PRB A;  1I94 F;  3DGP A;  4DX8 H;  3VZI A;  3KDN A;  2IM3 A;  1IBM F;  3D28 A;  4LSL B;  3TEH B;  4F2S A;  1ZAW A;  2V2K A;  1N5T A;  2OUG A;  2FLL A;  3J80 Y;  3H90 A;  2MLX A;  2CVE A;  4HAC B;  1GMU A;  4RBV A;  1YI2 S;  3OW2 R;  3M32 B;  3IXQ A;  5C25 B;  5C2G A;  3FUY A;  3ITH A;  2RDD A;  5B08 A;  2ALZ A;  1VQY A;  3TVY A;  3GFZ A;  1VRT A;  4DQI A;  3RBE A;  2CZ4 A;  2M7S A;  3ZO7 A;  2Q66 A;  2C22 A;  4RNO A;  1K44 A;  3BH6 B;  3UD4 P;  1F2H A;  1U25 A;  2HQ3 A;  4C3K A;  1IM6 A;  2ASD A;  4WK3 A;  3PW7 A;  1UA0 A;  5A8R B;  2PDA A;  2H4W B;  2HWI A;  2MQM A;  2MQO A;  2XNQ A;  3Q8U A;  4TNO A;  1YJW S;  4NLT A;  2HGN A;  4X4O A;  2XLK A;  3V6K A;  5EGY A;  1TUV A;  1UWB A;  4KQZ A;  3R7B B;  3G82 A;  2VUG A;  3NGK A;  1SJ3 P;  1MMD A;  2DBB A;  5K8N A;  2FD2 A;  4FS2 A;  1HQE B;  2HLT A;  4CO5 A;  4L3N A;  2JVR A;  5I3P A;  1JWW A;  2CG4 A;  4IR1 A;  2HFO A;  4UST A;  4CLY A;  2ZM6 F;  4OYZ A;  5GAG I;  2GQC A;  1EAY C;  3DDK A;  2WOM B;  4M5D A;  2WZ1 A;  4R25 A;  2VOO A;  2NYH A;  4X4S A;  2JSX A;  4NCG A;  2FUG 9;  5D4O A;  3ZZU A;  1XEZ A;  2YNF A;  2VG5 A;  3LAN A;  5KT4 A;  5ETT A;  4OYM A;  3T9N A;  1X8D A;  4G1P A;  2IC3 B;  4HTI A;  2V4R A;  1Y0H A;  4OI3 A;  3MMA B;  4MIB A;  4YHH F;  2D7S A;  3HFK A;  2ZH4 A;  4ENO A;  3LTO A;  3T19 A;  4XO0 A;  3QID A;  1U4B A;  1GEH A;  1PJ5 A;  3CJR A;  4TLR A;  7FDR A;  5J1P A;  5C42 B;  2KRR A;  4OYO A;  3OR2 A;  2HBZ B;  1VHI A;  1LWF B;  5F0U A;  2DNQ A;  4DJB A;  2BA9 A;  1WEZ A;  1VQ6 S;  1RAJ A;  2OH2 A;  3M8W A;  1MG7 A;  1FER A;  4OHX A;  3TZW A;  4LF2 A;  5F8G A;  4NA3 A;  4GC7 A;  3JYT B;  3MAA A;  1PAE X;  3AQO A;  1VLO A;  5JVG Q;  1NME B;  4NI2 A;  4O4R A;  1IJE B;  5HRO B;  2ZFH A;  4H54 A;  3QRR A;  2RF2 A;  4QPT A;  4C9D A;  4OYI A;  4DLE A;  3SFU A;  2F4V F;  2FHJ A;  4U8Y A;  1PKU A;  2QTW A;  1KQK A;  2X7I A;  2I6W A;  3TUZ C;  1B0V A;  2RQ4 A;  3U1N A;  3GQC A;  2ZNY A;  5KG1 A;  4USH A;  5CCM A;  1AFI A;  4DV0 F;  3DCA A;  4C48 A;  4YB5 A;  5IZH A;  2IA0 A;  3M2V B;  3AFG A;  4RW7 A;  2BAN B;  1BD6 A;  2IJF A;  1T03 A;  4M63 A;  1C1C A;  2I5J B;  4DFM A;  5HVH A;  2C3Y A;  3TAM B;  2PFF B;  2UV8 A;  3NGR A;  1RTD B;  1RTI B;  2OFH X;  1XR5 A;  2RUG A;  4XAK A;  2DHH A;  2GVD A;  1RYS A;  2YBV A;  1W26 A;  4KJI A;  1RAH B;  4DPX A;  3H7H B;  1SPB P;  4F3Q A;  3GIL A;  2C2Z B;  2KZM A;  4XPC A;  1JXV A;  3R6G B;  1H7X A;  1APS A;  2DEI A;  3RUB L;  3MR5 A;  1U1P A;  1WDT A;  2CQP A;  2BW2 A;  4CI0 B;  3I56 S;  3U7J A;  3I9V 9;  2CQG A;  3VQT A;  2DNH A;  1SJR A;  4OJ1 A;  3HSG A;  2N4D A;  3Q23 A;  3JQJ A;  3KHG A;  4Y6I A;  2DH9 A;  3BSC A;  1TL7 A;  3MI7 X;  4M5I A;  1RBO B;  3BKT A;  1CSJ A;  3KLG A;  1FNX H;  4FPI A;  5KFR A;  2ADC A;  1IR1 A;  4TYA A;  3OXG A;  4X4U A;  2RHS B;  3ILI A;  1VMB A;  2NYI A;  1RKI A;  2UUC F;  1CPZ A;  3HT0 A;  1S1U B;  3PYD A;  4NYZ A;  2Y0B B;  2ZH1 A;  1HW9 A;  4R0J A;  4B9N A;  2D9O A;  4WE1 A;  1DAR A;  3BGR B;  4NAS A;  4O44 A;  4WK1 A;  5DDP C;  4MKB A;  4I2P B;  2UUB J;  3PO4 A;  3ZZY A;  2Y1L B;  5A6W A;  4USW A;  4DG1 A;  3GWC A;  1V3S A;  1EB0 A;  1SQF A;  1GNK A;  2OPP B;  2P2C B;  4NLU A;  3RG6 A;  4B3R J;  3B82 A;  1RE1 B;  1HR0 F;  5LMU F;  3HUL A;  1U09 A;  1IXK A;  3Q2S C;  3CO9 A;  4ZCI A;  1MNE A;  4RKU C;  2LU2 A;  3BF4 A;  3T9Z A;  4V1A k;  1C4C A;  2ACM A;  2EFP A;  5KT5 A;  2NXN A;  2RH3 A;  4B3S F;  1ZA2 B;  3GG1 A;  2DGX A;  5K8P A;  1TL3 A;  2BBE A;  2L08 A;  4KKO A;  4QIV A;  2PC6 A;  3ZFV A;  4FKY A;  3C16 A;  4LF5 J;  4WTY A;  2M9K A;  4UQT A;  3EM1 A;  1IKX A;  2H1Y A;  3HT3 A;  1FK9 B;  1G7C B;  2YNI A;  2XCP A;  2NPF A;  4JV2 A;  3LAK A;  4ZVU B;  2N4C A;  1C4A A;  2G2Y A;  3H5S A;  3K5O A;  1NJZ A;  4YFU A;  2HIQ A;  2WVF A;  5KG5 A;  1N36 F;  2FJB B;  1NCL A;  2HS3 A;  2FY1 A;  4FYY B;  2HFN A;  3ILL A;  2BVZ A;  3BB5 A;  3MM9 A;  1KP6 A;  4Z7C A;  5I3U B;  2ZKU A;  4KGM A;  4JV5 F;  3MTK A;  4R8U A;  4CH1 A;  3AXK A;  3TQE A;  4ECW A;  4NLY A;  1TVR A;  4U96 A;  4K4U A;  2Y3Y A;  3ILJ A;  4DR1 F;  2HKE A;  2X3G A;  3N28 A;  1HYS A;  2UVW A;  1QSS A;  2F5G A;  4FXD A;  2PMH A;  4ELT A;  5AJ3 F;  4DSE A;  3LAL A;  3UR0 A;  2VC1 A;  1BLU A;  1RB0 A;  3NNH A;  1QVG R;  3SCJ E;  2IBO A;  3KK1 A;  4P75 A;  5GME A;  4AUK A;  2NZ4 A;  3VGU A;  4OHZ A;  2XSJ A;  4B3O B;  2AT1 B;  3FVY A;  4OV1 A;  4JI1 J;  4OI0 A;  3VWS A;  2OEL A;  3TUI C;  3V4M A;  3TVK A;  1NK9 A;  4NYP A;  3JAM Y;  2MQN A;  4HR2 A;  1UVK A;  4DCO B;  2F65 A;  4DR3 J;  4HYK A;  1MN9 A;  1FEH A;  4RNH A;  2FZG B;  4QIE A;  5J2N A;  4IDK B;  4IH5 A;  4QYZ J;  1FRJ A;  4DV2 J;  1RT5 B;  4BC7 A;  2KJW A;  4J90 A;  4WBF A;  1A9N B;  3HP6 A;  1QE1 A;  2CPY A;  3AT1 B;  3LWL A;  4KR0 B;  2P6T A;  3PFO A;  5A0Y B;  3ISZ A;  2FZK B;  4CLL A;  2LXU A;  1UEU A;  1N5Y B;  3EPG A;  1GX6 A;  2ZDO A;  2MZ1 A;  1WF1 A;  3DYA B;  3VGT A;  2VFV A;  2BKN A;  2GML A;  2E5G A;  2DNO A;  1F6T A;  1YJU A;  1N8R T;  1QTN B;  4LF8 F;  4HDH A;  2YKM A;  3QLH A;  4DS5 A;  1S59 A;  4OX9 J;  1FWL A;  4RW8 B;  1ZA1 B;  3QGH A;  2PFD A;  4FS1 A;  1HA1 A;  1HQU A;  4DI6 A;  4EU0 A;  4KFB A;  2G2Z A;  3W7B A;  3LP2 A;  2QE5 A;  1L3T A;  4WKR A;  5KFX A;  5L46 A;  1S99 A;  3PW4 A;  3OUY A;  3KJV A;  5T14 A;  2O01 C;  1IUJ A;  3MF5 A;  3VTI A;  3DOM B;  4C0H A;  1CJU A;  4WZQ A;  1T0T V;  2RJZ A;  1FJE B;  1SV5 A;  1I5O B;  3OLA A;  4QR0 A;  4WXW A;  3CD0 A;  3J7Z 5;  2EG1 A;  2GAG C;  4DR6 F;  3G8T A;  5KFG A;  1HBO A;  5C5J A;  2OTJ S;  4BDP A;  3K17 A;  4AL5 A;  2MKJ A;  2C2N A;  2W9B A;  3ZZO A;  4P7T A;  3RBZ A;  3RRK A;  3IO1 A;  3MEG B;  3ZTR A;  3AJ2 A;  2NRE A;  1T95 A;  3KJF B;  2V69 A;  2ZUG A;  3PYG A;  1VBZ A;  2H4Y B;  4B9T A;  1WTF A;  3TZX A;  4PWD A;  1M1K T;  1S1W B;  4DQQ A;  2NPI A;  3I4P A;  3U02 A;  5F8M A;  4O23 A;  4X66 J;  4ES2 A;  3T5H A;  4PG7 A;  3HVT A;  2X1B A;  2G13 A;  3W3S A;  2LCW A;  1BQM A;  4I56 A;  3IS9 A;  2ZWO A;  2R2T A;  2NXU A;  2RQM A; 
#chains in the Genus database with same CATH homology
 3SQO P;  3CO0 P;  3VV2 B;  3A3P B;  3P5B P;  2QTW A;  3A3N B;  2W2O P;  3AFG A;  2Z56 B;  3WIV A;  4NMX A;  2W2Q P;  1ITP A;  2Z2Y B;  3A3O B;  2W2N P;  3T41 A;  1SPB P;  3CNQ P;  4K8R A;  2PMW A;  2ZWP A;  2W2P P;  3VHQ A;  4JP8 A;  4OV6 A;  3WIU A;  1V5I B;  3WHI A;  3H42 A;  3GCX P;  2Z57 B;  1R6V A;  4YN3 B;  3QFH A;  2ZWO A;  2Z30 B;  1SCJ B;  2Z2Z A;  2Z58 B;  2W2M P;  2E1P A;  3GCW P;  3BPS P;  4NE9 C;  2XTJ P;  3BGO P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...