2Z58B

Crystal structure of g56w-propeptide:s324a-subtilisin complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPWVEKVEFDHQAVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Requirement of left-handed glycine residue for high stability of the Tk-subtilisin propeptide as revealed by mutational and crystallographic analyses
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 9
structure length 66
sequence length 66
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2z58B00
3BPSP 4OV6A 2Z30B 2ZWOA 3VV2B 3GCXP 2W2OP 1V5IB 3WIVA 2QTWA 4JP8A 2PMWA 2W2MP 2XTJP 2ZWPA 3A3PB 3BGOP 1ITPA 3A3OB 3AFGA 4NE9C 4YN3B 1SPBP 3P5BP 3QFHA 2Z2ZA 2Z57B 3T41A 3WHIA 3GCWP 1R6VA 3VHQA 3SQOP 2W2NP 3CO0P 4NMXA 3H42A 1SCJB 2W2QP 2W2PP 3A3NB 4K8RA 2Z58B 2Z56B 2E1PA 2Z2YB 3CNQP 3WIUA
chains in the Genus database with same CATH superfamily
2FUG9 2KZZA 2F4VF 2E7WA 4RKUC 2J7WA 3KOAA 2AJ2A 2V69A 2ZUAA 2KT2A 4NLYA 1ZM2A 2W9AA 1WG4A 3MM5A 2UUCJ 3FBEA 4UUXA 1YJTA 2DXDA 1JNRB 1H7XA 3DGVA 3KMQA 4LR7A 2VDIA 4PXCA 1N33J 3PXGa 2UVWA 1ZM4A 3BR9A 2GAHC 2BJ1A 2BVZA 3BDEA 3DI6B 3CJKB 1H2VZ 2RDDA 1NM2A 2ZBRA 4ZLLA 3EDQB 3J7YI 3KLIA 1XIQA 5K14B 2HQ3A 3X1LB 3DRXA 4DF8A 2CQ4A 3IAM9 5MLCV 2DNGA 4EK2A 1DRZA 2MY8A 4DWIA 1RTIA 4F25A 1TUWA 4DU7A 3GFYA 3ICLA 1IQZA 7FD1A 4JOUA 4NLXA 3DRSB 3JB9k 2X7IA 2MZQA 4WKRA 2NXEA 4GKKJ 4L3KA 3A3NB 3NBPB 1D09B 3OHAA 2LFVA 5ETKA 3E01B 1HWJA 2DBBA 1TKXB 5IC4B 4KBIA 2G4BA 1RT3A 1U2RA 4GO5X 2XS5A 1X0PA 2BJEA 2CUYA 4QU7A 3J7ZT 2OPSA 4PUOA 3FMWA 4NLTA 3PY8A 4EUVA 1FRKA 2GO9A 3ZNUA 5GADI 2WSCC 1A6LA 5IWAF 4R5PB 1JNZB 2IIHA 1HYSB 3AT1B 4ZP7A 1SKRA 3MM9A 3IAS9 5THWA 1MNEA 2XS7A 5EX0A 2DPJA 3UQSA 5A0YA 5EX3A 4XPEA 4D3GA 3KNAA 2W9BA 3MCSA 4WP9A 2WVBA 3MMBA 2D9OA 2H51B 4LVNP 2C22A 2LP4A 5IM0B 3K17A 1C0UB 4P73A 5HSPA 3O44A 3RU0A 5JMNA 3EDRB 4K4SA 2K8GA 2FLLA 3IG1B 2GV1A 1UA1A 2JL9A 2BQUA 2GQ2A 2R42A 1X5PA 1RHRB 2VFVA 4HHHA 3Q23A 3F0NA 1QE1B 3K8VA 4IR1A 2RF2A 2AYMA 3MPUB 1VJQA 1CEZA 1S6PA 3NWGA 2AU0A 4X4RA 5DQGA 3MMCA 1S12A 3R9LA 5J2NB 1D1UA 2AV5A 2FIUA 1JLAB 3NWRA 5E3CA 5GAGU 2JNJA 2R8JA 1U7LA 2J0QD 3NMRA 4O3RA 2UP1A 3QRRA 1RLDA 2HQFA 3IR6B 1DURA 1SV5B 3PTWA 3UNGC 4GO7X 2E1RA 4LSLB 3TP2A 2PFDA 3G82A 1XMOJ 1S0OA 3ZTRA 5BR8J 4CCHA 4G1PA 2R4FA 2R7UA 4HEA9 1G1XA 1HNIB 3KLFA 1T9WA 1VQOS 4RW8A 3N01A 4I6WA 2KG1A 3O6QA 2M7SA 3ZNJ1 2KT5A 3C14A 4DXLA 4TY8A 4ZP9A 4ZITA 3VVUA 2HRYA 2WOMA 1RT1B 2HNZA 4LR9A 3VQSA 2IAJB 2RDIA 5F8MA 3A13A 4PG7A 1U09A 4KB7A 3EGZA 1SJRA 2J0SD 3KUHA 3W63A 4IG3B 1PG5B 5M2PA 3QAEA 2V2QA 5KFYA 3VAIA 1YBAA 3DOMB 1S9GA 2C2KB 1XR5A 5KFOA 3DYAA 3QJJA 3IS9A 3TQEA 1YJ9S 1WF1A 2DK2A 1SXLA 3FCVA 2J7UA 1Q8KA 1QSLA 4FYVB 1UAWA 3CIZA 2C28A 2HVIA 3F56A 3RRGA 2YVSA 3D6HB 2Y9HA 4CRJA 3MEGB 2H4WB 1ZA1B 3H59A 2B7CB 2PGCA 2XQCA 1HWKA 1HFEL 1EHWA 1GX5A 1WKKA 4F04B 3M32A 1CULB 2KFZA 4FF2A 3TX0A 2OO4A 1I6JA 1MLAA 4L75A 4IG0B 5GAHU 1FJCA 2XY5A 1F2HA 2GHVC 2VKRA 2CJAA 1IKWB 2OPQB 2UUBF 3OTEA 1VCTA 5KG2A 1PBAA 3VAKA 2YWGA 1U1MA 4OJ3A 3BQ1A 2IJNA 2OSQA 2QN6B 1YJWS 1NH7A 4KPCA 3GJQB 4L6V3 4Z7CA 2G0JA 4JV0A 2HSEB 1N0VC 1NZ8A 6FDRA 5J2PB 2CQ0A 1YHQS 4EEYA 2MQMA 2VBXA 4USMA 2ZWOA 4ZHRA 3T6BA 4DHVA 1NK8A 3R2CJ 1HARA 4DPXA 4P9SA 3I4PA 2D3OR 3HCXA 2DHAA 2CXEA 1RLCL 1RT7B 3OFFA 2ATLA 2QE5A 4I6YA 1DARA 4FXWA 1BQNA 3QO9B 1PKUA 2MZRA 1MG7A 1X9MA 3SXLA 5A76A 2OLWA 4JI2J 2OSRA 4B9NA 4MJKA 4WBFA 4GC7A 3UI3A 2DNYA 4OZNA 3UD5A 1FX2A 2V68A 2DNPA 4C11A 1R89A 3JAMU 1CJUA 4KO0B 1KVKA 1KR4A 4RO0A 4YMEA 3MUVP 3JSYA 2WVFA 2RJZA 4V1Ak 4HH0A 4ZLPA 1HNWJ 4CO1A 1UPPA 2YKMA 3H0PA 1U47A 3M8QA 3M6XA 5DLFA 1REGX 1K47A 1JLBA 3M6WA 3T6JA 4F3OA 4IFYA 4I7FB 1JXLA 1YX2A 5F8HA 4IFVB 4F36A 4CT9A 4FNIA 4C3KA 3AA8A 5KT2A 3H20A 2XSJB 5D3GA 3QGHA 4AFFA 2ZH9A 2HRUA 2J0WA 3VAGA 2IVFB 2QX0A 1UVIA 4LF8F 1RAOA 1HKAA 3R1HA 4HACB 4FN5A 3D6TB 1R0AB 5E3AA 4QPXA 2UXCF 2CQBA 5HMWA 2UVUA 4FDFA 2FLOA 4S0MA 5KFJA 2EXUA 2I5JA 5FLXY 2V8HA 3BBCA 4DZDA 4NLGA 1RGVA 2MQOA 2R8GA 3C16B 5LXRA 2D3ZA 2DGWA 1Q7LB 3H90A 2AT1B 1T11A 2KJVA 3I5CA 1B7YB 2KKHA 2D74B 2FVRA 2GVDB 3E51A 4MT1A 4ZCKA 3I0RA 4QU6A 1KFDA 3C6TB 1RT5A 4KGXB 1PC5A 3PACA 4DR1F 3CJ4A 5L8RC 3HMJG 5DM7Q 1U6BA 3OXGA 4ES1A 4AXIA 4RU2A 4J9OA 1FJGJ 3N4WA 5A8WB 3ETOA 2BJ3A 2VD3A 4DS5A 2KDOA 4DV5F 3T3FA 2XYGB 3DGPB 4ED0A 5DO2A 3RB0A 1HD1A 3M2RB 1YITS 1EETB 2BKPA 2IYIA 4ECVA 4B9VA 4AUKA 3THVA 2ZZTA 5DQHA 4RW4B 2C42A 1AA1B 3W65A 2LA4A 4HDHA 1RAFB 1WC3A 4DR3J 2VG6B 3MR3A 1BC6A 1ZA2B 3TI0A 3PV8A 2MGZB 3MR6A 3MECB 2ZM6F 4O3SA 2QV6A 5I3UB 4YB6A 5E41A 4J9QA 3TX8A 4DI6A 1S0MA 4ZP8A 1CJTA 1J5EJ 4FYDA 3QMQA 1IVZA 2KYZA 3IBWA 2MZSA 4TLRA 1WF2A 3J81j 1VI7A 2BXJA 5KFRA 3DDIA 3MMJA 2ACMA 1NJXA 5D0GA 4AQYF 1QVFR 1B3TA 2VFTA 3AA9A 1KRPA 4DN0A 3T1HF 4QQBA 2GX8A 4LVOP 2HIQA 2OGUA 2R7QA 3BM7A 1OMSA 2RU9A 5KOXA 2Z4PA 1ZTWA 3QGGA 2KRRA 3U1LA 2K7JA 2W4CA 2RHQB 4X2BA 3UCZP 2QLXA 4OI1A 4MKBA 4GMKA 1DTTB 4PKDB 3HVAA 4ZPVR 1NEEA 3NNAA 2GJ2A 1SKWA 1HMVA 5J1EA 2DGUA 1LW0B 3V81A 4ANCA 1O8BA 3R5GA 4OJHA 3P96A 2ZH3A 4JI8J 2HHHJ 4F4XA 5A8KB 2RU3A 2FHJD 2HWIA 2CJQA 2JC1A 3VAFA 1BMQB 1YLXA 3QATA 4B3RF 1RAIB 2V8PA 1HD0A 4L3NA 1NDPA 4ZVQB 4P2XA 1FDAA 4NLOA 4Y2AA 4LBPA 2XI3A 4KHMA 2BQ3A 2KB2A 2B6AA 3GIIA 4DLEA 2CQDA 4ECWA 3BB5A 3T19A 3FDSA 1E6VA 3MMAA 4LRCA 2DHGA 4CH7A 2D69A 2I6WA 1Y4ZB 2VBZA 1JLGA 4NXMF 3SIPB 2VB6A 2RS2A 2MB0B 4RNMA 5HATA 1RTJB 4DQSA 5DGAA 5T7LA 1OSCA 4PPZA 1MMNA 4NRUA 1SBRA 2NXJA 3J7YU 2UZAA 4K4VA 2RT3A 2HHWA 2B0GA 5ETPA 3DOKA 4G1IA 4MMOA 1UJ5A 4I56A 2FJEB 2E7VA 2WK4A 1ZOTA 1GH8A 2FDNA 1T05B 3TUPA 2NR0A 4RU9A 1RJJA 1DAXA 4DCJB 5J2QA 2J8SA 2Y8YA 1N5QA 1FRMA 4BS2A 2VG7B 3LP0A 2PEHA 3K59A 4A8WA 2OEJA 1J5OA 2QRRA 5CZVA 4YDXA 2DR8A 4G65A 1QAXA 3UVJA 3F44A 3TA0A 1NBEB 2J9DA 1WTFA 2E5LJ 5KFZA 3R6LB 3AB4B 1YJRA 2O01C 2JX2A 1NPRA 5AXLA 4CNYA 2QT7A 1HHSA 3MFHA 1VHIA 4NYPA 5GMKa 3RG6A 3OSPA 1SUQA 1KONA 5SUHA 1LWEA 5GADU 2RQMA 2ZH4A 4RW7B 5B0EA 5HO4A 3PX4A 3O5TB 1CQMA 4KJIA 4DSKA 3MAQA 4KFBB 3ENAA 2PI5A 3BS9A 5HVHA 2VONA 1TL3A 2XY6A 3OFGA 4DQPA 2IRYA 3LPEA 3RR7A 1R3NA 4M94A 2W2NP 3U7JA 1ZETA 3TAPA 3RGIA 3D68A 1SH0A 3CC4S 1ELOA 2OEKA 1WC0A 2RH3A 3KK2B 2GIRA 4D3HA 3Q8PB 4V19X 5C25B 1LWFB 4GKJF 1MROA 2ZBIA 3SDEB 2EVZA 4CDIA 4I64A 5EWEA 5DG8A 2HLTA 1VLYA 2ZBQA 2IM1A 3THTA 2DNLA 1VC6A 1S1UB 3AQPA 3UCGA 1HI8A 2GQQA 3V4MA 2HHPA 2FC8A 5HVGA 1K1SA 3BSOA 3PX0A 4NLDA 3LGNA 4OYBA 4JYAJ 2DEIA 2M3DA 2PDAA 2AGPA 3M1VB 3PFEA 2HGMA 3M9NB 1U1PA 4QWAA 1S10A 1B7FA 3CDAA 3D5MA 1X4DA 1EP4A 2HLUA 3G8SA 1IJEB 1Z2LA 2BQRA 4PAAA 3SCLE 4OIXA 2AJ4A 2UXBF 4JI1F 4I0WA 1GK8A 4K2XA 4MTPA 4O44A 1EJ7L 2ZNZA 2WVCA 3DOLB 1GAOA 1DBDA 2V4JB 1SPBP 3W2WB 4C4WA 1KQSR 5L9XA 2DXFA 2L48A 1FNXH 4JV5J 1C4CA 3ET6B 1FE4A 4N8NA 4P52A 4UY85 2RUGA 3NOGA 4RUAA 4DR7F 2FGOA 4IRDA 1U2CA 3QLHB 5DDPC 4XDDA 2QLFB 1OO0B 2VQFF 4LF6J 3CGIA 3MUMP 4NLVA 3HZEA 2L08A 5KFBA 4JI6F 3JTNA 3M8YA 4W98A 3TRGA 1I5OB 3HD1A 4J9SA 2VFRA 4KGZB 1VQ4S 3PM9A 2YKNB 1E6YB 3CCTA 4WZMA 3SQGA 1JLQA 3ZTQA 4PXBA 2QMUB 3DMJB 2CJ9A 2DHHA 4AD6A 1VBZA 2J5AA 1KBRA 3EZ5A 3PVXA 2CAJA 1EQ0A 5CYJA 2ERRA 4C0BA 3OT9A 3OL6A 4ZCLA 5EUHA 3T9ZA 2EEYA 4WFYA 2DIUA 5IQ6A 4NWBA 3KG0A 3V6JA 4GVBB 2J6SA 4J9KA 5SZTA 2H4YB 4HDGA 3PX6A 2C1EB 3BYRA 2FLPA 3V6DB 3TARA 4K0KJ 3RRHA 3KK1B 2W7AA 2EG2A 4ILRA 1NSPA 2B51A 2B9YA 3AAWB 5KFIA 2JLEA 2QA4G 5HJXA 4DX5A 5CYQB 4RX6A 5B0CA 2DNOA 3IRXA 2HWHA 4QJVA 4KHPF 3M05A 3DU6A 2RRBA 2CIMA 3N79A 2H1YA 2PI4A 2CADA 4Q0BA 1NAQA 3VAMA 1JJHA 1VHFA 2ZC4A 4F2SA 2B4OA 5AXMA 1UJ4A 5HP1B 5DGBA 5F8IA 1VBKA 4OHWA 3HHLC 3EE3A 3LUYA 2ZBCA 3S01A 2HFZA 3I0SB 4W92B 1RT6B 1CG2A 3BN7A 5LMUF 1DTQA 4M5LA 2L9DA 1S1TB 4P71A 4ID8A 2JLGA 4C9DA 2RE1A 5C42A 1JXVA 2HFOA 1DLOA 1RYRA 2V5HG 2R2UA 1FKOA 4HR2A 3T5JA 1CS4A 2VA3A 4E98A 2LDIA 4N8OA 2CDQA 4WTOB 4AYBD 4YFUA 1X4FA 3D1OA 3NOCA 1TR0A 1FKAF 3TVYA 1LNQA 1EX8A 1WACA 1L3VA 2R7OA 1WOSA 3IM8A 3SSRA 3NL0A 1RHQB 4O3PA 1JKHA 5IOLA 1HWIA 4DPOA 3OTOJ 1WDDA 4NLWA 1V3ZA 2F40A 3MUTP 2VU5A 4ECXA 5D0EA 4KGMA 2PO4A 4JI3F 4O0NA 2DO0A 3CJ0A 5EDWA 4NMLA 5KFQA 4DPTA 2IMOA 2M4MA 1TKTA 3DU5A 2Z2ZA 4FPIA 3GCWP 3KKFA 4YY3F 2HBYB 4ZN1A 4QWEA 2DGOA 2XWXA 5AXNA 4LF4F 1WI8A 4Y2KA 3LPYA 3W8GA 2OD4A 4DL4A 4EBDA 4ZPAA 2Q6BA 2E9RX 4K5SA 1HBMA 1W2IA 5KFTA 4HVZA 1GXTA 1FDDA 5ETSA 4LREA 5ADZA 3ELHA 3LTOA 2A2DA 3TR5A 2ZH2A 2JSXA 3G86A 2NUHA 2I8EA 3BGFA 5F8GA 2IJRA 4QZVB 3H7HB 2FPHX 2IHR1 1RE1B 2QFIA 2R9LA 4B3TJ 2CPIA 3P4UB 5L1KA 4ES3A 2DNQA 3GE9A 2VL1A 4NI2A 3FGVA 4HTIA 3AD9C 4FNHA 1S1VA 3DLEA 3CJQA 2XZDB 3KHGA 3HLUA 3D0GE 3GV8B 1RADB 2EFOA 1N5TA 4Y2CA 2GHPA 2A2CA 2KO1A 3U1NA 1BQMB 3KHHA 1XR6A 1SQEA 5RUBA 3K57A 1LV5A 1YIJS 4J37A 4XTTA 2Y0BB 4QIVA 3QJPA 4LRAA 3G8TA 4DR2F 4X65F 1NK4A 4FKXA 4KY3A 1VQNS 3H4BA 5LMNJ 4OZ5A 2PSZA 5LM7E 2YNFB 4I2QA 2Q1LA 3TOQA 4WZQA 1R8CA 4UOGA 3ILIA 5KFCA 3LGMA 5E3RA 4X4OA 1PAUB 2BW7A 4O3QA 4QBUA 5AJ3F 5B0BA 3MM7A 3MOZA 1TKZA 2JDJA 3M4XA 4B9LA 1X4CA 5HROA 1FDBA 1PO6A 4DL2A 1SH3A 4ED4A 2QZ8A 2SXLA 3FZBA 1CJVA 4WF9Q 5J2NA 4JI4J 4EU0A 3M8SA 3OV7A 1ULRA 1P1TA 2YPYA 2IC3A 2WCXA 3NS6A 2ZWPA 1V5VA 2Z57B 3QBCA 4DV0J 4C3LA 3O2IA 3AXKA 5HQMA 3V4IB 5DZ7A 1SL2A 4LR8A 2N7CA 1VISA 1HNVB 2LU1A 4O0IA 5EGYA 2DVIA 4WKYA 1RAJA 3LWLA 1IBLF 3A8KA 4OYMA 4A8MP 2ZDPA 1F3VA 4X66F 4OX9J 5DJBA 1X4EA 4ECUA 4IR9A 4DR4J 4E8UA 2V9KA 3M6UA 2WVDA 2VASA 2V2VA 3A1YG 2BZ2A 1U8SA 4QCLA 1V9OA 3PJ9A 2CZVC 2ZVSA 3KK3B 3MM6B 3AQOA 1CVJA 4F67A 5KFEA 4HL9A 3V6HA 5T41A 1RB0A 4YHHF 4RNFA 2BJ9A 3CJ5A 2R7WA 1YTYA 1XNQJ 2CWXA 2E66A 2HAFA 2CRLA 3JYTB 1ZPVA 2FC9A 2A0FB 5A6PA 3G6YA 2YNGA 5BXIA 3AJ2A 4DN9A 2XSFA 2XO7A 3FC9A 1TUVA 4R0JA 1TL4A 3TZWA 2IRXA 1LWCB 4U7UD 2ABYA 2P5VA 3K5NA 4DV2J 1WHYA 4UZCA 5FD1A 3B54A 1S1XA 1X5SA 4CH1A 1JJCB 3DLKB 3AFGA 1HNZJ 3KJFB 1U1QA 3C8YA 3Q0AA 5IXUA 2F9DA 1IUJA 2CG8A 5GAEI 1ZAWA 2W2OP 3K2YA 4BHQA 3LQVA 3M2VA 4B3SJ 2RKIA 4NYZA 1WI6A 3KJVA 1NK0A 3NS7B 4DQQA 1N8RT 4QYZJ 4TQSA 4AXJA 1YRUA 9ATCB 2VBWA 4LBIA 4H4OB 1TU0B 1RXOB 4P2FA 4DV3J 1Q7YT 2V8GA 2W2QP 2W9CB 5B08A 2CVIA 4K4TA 4NLRA 2B4PA 2XCPA 2L41A 2MLZA 4DEZA 1T7PA 1TV6A 3UDLA 4RW6B 2KT3A 1HI1A 4B3OA 1N34J 4H4KC 4YB5A 4F4KA 3GFXA 1FRLA 4CYUB 3S7RA 2F5GA 5ITHA 4N76A 3H8YA 1SJ1A 4ID5A 1T0TV 1XEZA 1NZAA 1B70B 1VRTB 2O3DA 3ITHA 5LJ5Y 2XY7A 5KFDA 2CNLB 2VBYA 2OAUA 3ZFVA 1S7HA 2KZMA 3BPSP 4RR5A 2ZD1A 1XNRJ 2XMKA 2KFNA 2Q43A 1NUEA 2FGCA 1BUXA 3QRQA 2HQDA 3WBZA 2YKQA 4WFXA 4P10A 1C1BA 4RJVA 4DSFA 5LT5A 3C6UB 3CCRS 3QIDA 4KH0B 1WKJA 2V8DA 4P2MA 4G3IA 2AMCB 1N36F 1JLEA 4YQWA 1FXDA 5DDOC 3TAQA 2HMIA 1WNEA 2AJ0A 3PDNA 2LMIA 3EXCX 3J7A1 2G1HA 3DHWC 1N54B 4BLGA 2DR5A 9RUBA 3JSMB 3I96A 1H73A 1FA0A 1LEOA 3DNCA 4X4SA 2XSJA 5ETTA 5CXTA 4KQZA 5DETA 2E9TA 3D54A 4PG5A 1W7WA 4A8OA 3OW2R 4TYBA 1UWBA 4ZVOB 2J6UA 1YVFA 2JLFA 5HQLA 2MKIA 2V50A 3QZ7A 4F0MA 2H48B 1S99A 3CD5A 4MFBB 2RB7A 1U48A 1WEZA 4YB1P 1FKPA 4N77A 4OYXA 5C2GA 2GMHA 2ZH8A 3R27A 1RT4B 2EI5A 2QL5B 5B0FA 3JS9A 1BWEA 3W62A 3F41A 1I94F 2OPRA 2LEAA 3MAHA 2JEGA 2W7PA 1U1RA 3MD3A 2OPPA 4USVA 4A4JA 3THPA 2Y1JA 4DJBA 5F9LA 1HBNB 1LFWA 4NEYA 3FEXB 2HWTA 1FX4A 2MKSA 1AFJA 1B64A 3ENVA 1H6KX 4QYRA 5H9EK 1ICEB 3HSJA 1RYSA 3NY0A 3QT8A 2YKPA 4EYHB 3W66A 3KLEB 3UDEA 2G2YA 3J81Y 1VQSA 2F7VA 1IBMF 1FWKA 3QYYA 1FNOA 2XC9A 1WC4A 3GIJA 3UFCX 2BUNA 2HS4A 2MQ8A 1S97A 5L1LA 1P27B 3HVRA 1U26A 3MAAA 4Y6IA 3IA0A 2OUGA 1AFIA 2CPFA 4ZPBA 3Q2SC 3MEEB 1SJFA 3OR1B 5GAGI 1CSJA 4DFJA 3BZQA 3RAQA 3GYNA 4M5GA 3KMSA 2FVSA 4J9LA 3DCAA 2Q79A 3QPIA 4DUZF 2HK3A 1UVMA 4ZKAA 3G87A 4B3MJ 4OHZA 4LF7J 2F8EX 2V34A 2EC0A 3AODA 2VH7A 1P9QC 2FJBB 3BQ2A 3N0VA 3RBEA 1SJQA 1VRUB 1P8GA 2VKZG 2EWHA 1TL7B 5HJYA 2KYXA 2R7SA 1WSRA 1N32J 2VFUA 4Q43A 5EHHA 2AZ3A 2UU9F 3KTQA 3L95X 3N6MA 2AEMA 1Q1KA 2CPEA 1KVIA 1FFSB 4KPYA 1J2VA 2B8PA 2IDEA 5D8HB 4DUYJ 3KFWX 1MU2A 1S0NA 2UXDJ 3W60A 4YUDA 3FRZA 2HS3A 4DV4F 2NPFA 2D9PA 1B0VA 4O4GA 5E7OB 1BY9A 3MWBA 5A2QU 2BYCA 4JBCA 2EW9A 5BJRA 1J5EF 1NHKL 2G2OA 3CCUS 2CVEA 5H9FJ 2C2RA 1U6ZA 2X1FA 4USTA 1TFWA 1LWXA 4JI5J 3CE8A 1UJ6A 5IQQA 2G0CA 2WRMA 3MCMA 1S0VA 2FB0A 3MCOA 3NNHA 3M2UB 5F9NA 1U1NA 2W24A 2CDRB 1Y5NB 5GAHI 1TL5A 1T3OA 3H40A 1FNMA 1GMWD 2QG9B 3HSDA 1KOOA 1N6QA 2BW2A 2MSSA 4E0DA 1FK9B 1JLFA 2VOOA 3I4HX 5D77A 1DQ8A 2X1AA 4KKOB 2RNEA 1P6TA 1HQEA 2KG0A 5C24B 1YBUA 1X5TA 3AOCA 1RKJA 3CCSS 2BANB 2F4VJ 3JXOA 3POTA 4F3MA 1GXUA 2EC2A 2UUAF 3K5MA 4O4RA 2HHHF 3DRRA 3PZPA 3FBFA 4TNOA 3QT5A 1SQFA 4OFZA 3D28A 3QFHA 2ZITA 1YSJA 1UEKA 4DFPA 1IKVB 2VQEJ 1Z2ZA 1RT2A 2P9EA 3HHLA 3QT7A 5LOQA 1HNXF 4ZVFA 2VF3A 4PABA 3WHIA 5HBMB 4WFNQ 1YQHA 1SCJB 2DH7A 3BDPA 2IVYA 4UOHA 4OI3A 3I55S 4Z7YA 3NLCA 4V19J 3LANA 5GVQA 5KT7A 1S76D 1WORA 4CM0A 1H2UX 4CLTA 2GGPB 3G8QA 1WEXA 3OTCA 2K7KA 1F5CA 3BJYA 2AEFA 3LGHA 3CCZA 3OUYB 3MGJA 2CNOB 4Q44A 1S1WB 4RW9B 2E1PA 2UVRA 2ASJA 3GP9A 2AQ4A 4PQUB 4AL5A 2VPZB 3L4BC 4M8LA 1HPZA 3I32A 2MJNA 1RAGB 4OHYA 2QA2A 2ZZNA 3GQCA 2AP6A 3FSYA 2IFXA 2QJ3A 3AB2B 2ZNYA 5KG6A 2YNIB 4TN2A 3MM5B 4NA1A 1VDHA 4R8UA 3MURP 4X4PA 3QSIA 2O67A 2PD1A 5C25A 1T9XA 3OTDA 5IWAJ 1OY6A 1WELA 4ZCMA 2BX6A 3PKMA 3J7AN 3OFHA 1REVA 1VBYA 2VDHA 4CLZA 4ZDNA 3UD3P 3KLIB 3MTKA 1S4EA 1L3TA 2OEMA 4C48A 2AYGA 2ZOMA 3HX9A 3T41A 1NH8A 2LLZA 2UVVA 3N5BA 5ETRA 2FZKB 3I82A 5IT9Y 1SJ4P 3EUNA 2WVEA 1JJ4A 2YQ0A 4HHJA 3CT9A 2YQ3A 3IXQA 1VFJA 3NGSA 3MDFA 1WC6A 2E9ZA 4WU3A 1CC7A 1M90T 2E29A 1FRIA 1OQ3A 2EKNA 5KT5A 3HPOA 2NSBA 1RT3B 3GFHA 1PGZA 3EGNA 2OPSB 2ZJPQ 1VMBA 4IOAQ 4LRBA 2XM3A 4PUOB 1T9YA 3AD7C 2DEJA 3PHTA 5KFHA 2JHEA 3CF5Q 2HBZB 1HWUA 2Q6CA 3IGVA 4TLQA 3NGDA 3DXBA 1WHVA 3L9ZA 3HT0A 4I4BA 3MM9B 2AKWB 2EPIA 2VG5A 4DCPB 2DNMA 1WDTA 5ETVA 3BO3A 5D0RA 1LW2A 2IPOB 3Q8RB 2VJVA 2EG1A 1XC9A 3NEKA 2W9BB 2GMLA 4UOCA 1SVDA 4EI2A 1VIXA 2MZ1A 3MMBB 1RCOB 4NA3A 4IQXA 2CJKA 2FTRA 4C8LA 4OZLA 3IFEA 1WWHA 1SL0A 4LJMA 4X4NA 1S48A 2ZH7A 3R1LA 1PJ5A 2RF2B 2IA0A 3JTOA 1S6PB 4BBYA 3W61A 2R8KA 4IH7A 3MMCB 4NE9C 3A8EA 1RAAB 4KIAA 5IFMA 2VFSA 2JOQA 1S6QA 2R3VA 1N5SA 3EMTA 4FF1A 5LSLA 2YY3A 2A3JA 3NCRA 1KP6A 5D4OA 3G82B 1MWQA 4O3OA 2ZHBA 1QAIA 3RB6A 1I3OB 3H5XA 1NB2A 3KLFB 4LF9F 2RS8A 3BYPA 1LFPA 4RW8B 1W26A 2YWWA 1OWXA 2V94A 3HHEA 3JQJA 3C14B 4TY8B 3GR0A 5K9FA 2LQ5A 4UY8T 2CQ3A 3I6PA 1MWYA 1HQUA 4RNOA 4ZVRB 2WW8A 2WOMB 5MAOA 2HNZB 3KG4A 1CPZA 2BJ7A 1HBOA 4EO6A 2IRUA 2QIFA 4ANDA 1CJKA 2NXNA 2XI2A 2KXNB 4LSZB 5KG5A 4DSJA 3KLGA 2MLXA 1K0TA 1OS5A 3NCPA 2W7OA 3DXSX 4B02A 3DRPA 3S8SA 1LQ9A 4U95A 1RU1A 4DS4A 1HIYA 3DYAB 2JJ4D 2EBGA 3IS9B 4ED2A 4DQRA 3TZXA 1PYSB 1WHXA 3W64A 1RWMB 4IO9Q 1NHVA 1RAHB 4DUTA 3PO5A 2FVCA 3MPDA 5DQIA 1U1KA 1F6TA 2HZVA 1NK7A 3M32B 3FNNA 1LXJA 3PW7A 2ASDA 2QL7B 2DPIA 4Q45A 3SEOA 1RBAA 4WYLA 3G9CA 1TMJA 3P3DA 2YWFA 2C2EA 2RHSB 1MWZA 5B0GA 5HQ8A 3Q83A 2QGFB 1UMJA 3VF0B 1EKSA 2HQGA 3GYXB 4Y3CA 3WDOA 5F3TA 2RUSA 1NDKA 1RHJB 1B0TA 4I68A 2B4VA 1SH2A 3PYFA 1G7CB 1H98A 2M9KA 3R2DJ 2YPZA 4OZ1A 5DDQC 2P8IA 3K7RA 4J9UE 4ZHRB 3H42A 4OX8A 4AL6A 1CBKA 4MIWA 2RVJA 1WOPA 4A8XA 4EZ6A 4LF5J 4RNNA 4NCBA 4A8YA 4F4AA 3HFVA 5CAAA 2B56A 1VQ6S 3GYGA 4P72A 4ZVEA 4UW2A 1T9VA 3LO3A 4LF8J 4IRCA 3MHYA 5KFMA 1HHTP 1BQNB 2W4PA 1F2GA 4LSNA 2NPIA 2UXCJ 3PR4A 1UCNA 4H4KA 1VQMS 3SSSA 4P2SA 4EBCA 5J2MA 4DL7A 1RZMA 3OXLA 5G0RA 1L3SA 2J9CA 1X4GA 2XMVA 4C11B 3IBFB 1T03A 1LKZA 1CJUB 4DX8H 2OIHA 2C3MA 1HQ2A 2J9DE 3W2VA 5DG7A 3CB4A 2CJBA 2YKMB 4ECZA 3JQMA 4C8MA 3M8QB 3TAMA 3HSGA 4KC5A 2WONA 3TA2A 1R8HA 5BYRA 2FVQA 1GNKA 3OR2A 1JLBB 1IR2A 4IFYB 4M5JA 4CI0B 3IRWP 1VK3A 3PJXA 4W90B 1NK6A 4QIEA 1TZ0A 2DR6A 1AROP 2PE8A 1D3WA 4WTYA 4ZPDA 5D3GB 2GJFA 3AH6A 3KHLA 1U2FA 3FRYA 4DV5J 2HFSA 4MKVA 4C6AA 3GZ7A 2MQLA 1Y00A 3EYZA 3HVTA 3QWPA 3C19A 3GR1A 4RLEA 1HBUA 2ZZMA 3W9IA 4JP8A 4K5RA 2ZJQQ 1PYTA 1HR0F 2QMXA 1MN7A 3W9HA 1X9SA 3D4JA 2I5JB 4BWJA 2VHGA 4FP9A 5I42A 1S72S 2XLKA 2JEIA 2PIIA 1M1HA 2I9SA 4DG1A 3RJMB 4HLBA 1RA6A 2ZHOA 2JWNA 4MIBA 4PG8A 3L7OA 2A18A 1RSCA 5HMZA 2ZM6J 1R6VA 3UN5A 2Y1RI 3BSCA 5C5JA 4BC9A 1VBXA 2Z30B 3WIVA 4DR5F 3BBBA 1RT5B 3N9UC 3Q86A 1LXNA 4C8KA 3HZGA 2AGQA 1YJNS 4USWA 2DRBA 5A8RA 1BGXT 4DU8A 3B4MA 1F9HA 1WUUA 4TU7A 3CD0A 2BKNA 4HH1A 3T1HJ 1MSWD 2OHDA 2XG8A 1F60B 1YBTA 4OYOA 4NLQA 1N5VA 2LECA 5KFKA 2KM8B 3RYLA 4ED7A 1OPZA 1TL1A 2B5JA 4EZ9A 1D9DA 1TELA 1KLMA 3KLVA 4A8FA 2HVEA 3PYDA 2CQPA 2YX7A 1UVKA 3GB0A 1NPKA 5HL7Q 1S59A 1RU2A 2PC6A 2XWYA 3ZC4A 4B9SA 1CQNA 1AB8A 4BCAA 3ENWA 3KJQB 4A48A 3OL8A 2GMJA 5KOWA 1H74A 2DD8S 3HD2A 1VQYA 2HRTA 3SFGA 1CJTB 1LWCA 4B3RJ 3RAMA 1LOUA 3EPGA 4J91A 5I3PA 4Q8FA 2B9XA 4WIIA 1I1GA 1Y7PA 4DF4A 2XBPA 1R8AA 2XULA 3DC2A 1N48A 3VGUA 4PPDA 2V2ZA 2DO4A 1FWLA 4NLSA 3HXMA 1WTBA 4NXMJ 4ZVPB 2E44A 5IT4A 3QIPA 3VZIA 2K2PA 1JJ2R 4Q8EA 4QYZK 4Q2LA 3PW5A 4IRKA 1UA0A 2RQ4A 3Q8QB 1FF2A 1V6HA 3FFIA 1OPIA 2QA4S 1RAEB 4CNZA 2HNYA 4ECTA 1YK9A 4OYWA 4CLFA 2EKYA 3D0IE 3VALA 5F8JA 3MPWA 1RTDB 2OKQA 2DHXA 1HMVB 5J1EB 4KGVB 1XNQF 3V81B 1TQLA 3FBBA 3TVKA 1VRQC 4L76A 5IS2A 3R8YA 1NK5A 5L39A 4K4ZA 5IV3A 2YWKA 2RILA 2Z2MA 5KG7A 3HFZB 3N6NA 5HLFA 2QLBB 3D3BJ 4RBVA 2ALZA 3PEHA 1J27A 2CPJA 5JJBA 2ILZA 2V4RA 3SYZA 4KE5A 3NGUA 3WIUA 4F4YA 2B6AB 1VRTA 4ITSA 2LXIA 2DRAA 3NGTA 2AYEA 4RUBA 1E6VB 3CMAS 3D67A 3MMAB 4ZPTR 3EICA 2ZH5A 1ZYQA 2VOPA 1OQ6A 5M2RA 3DM2A 5KT3A 2Z0GA 1K1QA 1UW9A 3SBMA 4GVLA 2DYAA 1ITPA 4WYWA 2BACA 3PW2A 3NGKA 2DR9A 2UUWA 5T7LB 4CLUA 1IR0A 3UW1A 1C0TA 1P1LA 1ROFA 2JFDA 3BSAA 2DITA 1Q78A 3OLAA 4CTAA 2WSEC 3DOKB 3CCES 1S6UA 5FLXU 3CCJS 1PAEX 1UEUA 1RA7A 2AF6A 3NMAA 4CO3A 4NPOA 4OHVA 5K8PA 4L72B 4WU2A 3BGRA 3GONA 2ASLA 3TYTA 5J2QB 2VPXB 3HHNB 2OI2A 3CIMA 3TO8A 1SJ3P 4AE5A 3LP0B 4KV8A 3SV3A 4KYZA 3RB4A 4F3QA 4J9MA 3RW6A 4GKJJ 4R25A 1J5OB 3MEDA 4LRFA 3UVJB 1VR6A 1TP7A 3GSIA 4RWXA 1VQPS 3AOAA 3R7BB 3P49B 2QEXS 4RNHA 1VS3A 3MTJA 2ZFHA 4QIGA 1SKUB 4BDPA 5E3QA 3PYEA 4L74A 5KG4A 4K50A 4HT7A 1SUQB 4F26A 4DV1F 3ISND 4ILMA 1LWEB 4CLLA 1WHWA 3BQ0A 1NMEB 4M5DA 4OI2A 2BJ8A 3W5XA 2IBOA 2CQ1A 2DNNA 2DH8A 3T1YJ 3I56S 1ZZNA 1TL3B 1CLFA 4Y00A 3LALA 3LW5C 3PW0A 2UXBJ 4JI1J 4LF2A 2HBQB 3M30A 4UUWA 3V6KA 4CLSA 2R7XA 3FSIA 2LA6A 4OYPA 3GG0A 4ED3A 3BKUA 3KNGA 1NDLA 4UOFA 4DL3A 4OV1A 2MXYA 2YH1A 3KJNB 1MROB 3H2LA 3CEDA 1U4BA 1LK7A 4MK7A 5ETMA 4CLYA 3AJDA 2GIFA 2CPZA 4DR7J 1Y5LB 2V67A 1KQKA 3M8ZA 3UR3C 1G6BA 1O0PA 2VQFJ 1DZ5A 3CCWA 3PNIA 1K73T 1N5YA 1VQ8S 1RISA 4JI6J 1UVJA 4PWDA 2L9NA 2VICA 3MEEA 4P7TA 1RI7A 1IQTA 1SC4B 1M5PC 4URGA 4OZJA 2XMMA 3ZTSA 3CNQP 4NXNF 2OFHX 3WX4A 1TMMA 3Q8VA 2E1AA 1RTZA 4PYDA 4DX7A 3PRDA 1NB7A 3T9NA 1EP4B 2DR7A 4ICLA 1L5UA 3QSYB 3H5SA 3C15A 1VRUA 3R5BA 2HHXA 3IMQJ 1XJWB 2X1BA 5L46A 5HI7A 4KR0B 1KFSA 2HVZA 2J7KA 4O44B 1H0HB 3G96A 2FJWA 3CW2C 5KFGA 3DLJA 3L09A 4MKAA 5L1JA 3OTBA 4WFAQ 1C4AA 2ZH1A 2D3O1 2CQIA 2WHOA 4ETXA 5J1NA 3K0JA 2R2RA 2W2PP 2KXHA 2R8HA 4NCGA 1S79A 3KG1A 2NXUA 1L3UA 4KHPJ 1JK9B 3RB3A 5K20B 1JLCB 1KWMA 4JI7J 2M8DB 1NO8A 4KH1B 1SI9A 4PYAA 5D4PA 2QSFA 4ZLJA 1YJVA 1QSSA 1TVRA 2I2YA 2CJXB 2YNHA 4Y34A 2KVQE 3IWXA 1MN9A 5DZ6A 5H9FK 4ZJQA 3SQGB 2HZCA 2NZ4A 1JLQB 4NLPA 2WB1D 4LRDA 3TANA 1FRHA 2M2BA 4DZ6A 5LMUJ 4TVAB 4LUBA 3D6MB 1KLNA 3TEHB 2O5DA 4B08A 3J80Y 3HVWA 2ZOFA 1V5IB 3M2UA 1XR7A 4ZPCA 3M7VA 4B9TA 1UZHA 3BF4A 4ED1A 3ETMA 4LFBF 3BEGB 2GIQA 1Z4UA 4WXWA 3HJVA 3BV8A 5AE3A 4Z37A 2AJFE 1EB0A 1QVGR 2MHEA 3CPWR 2CYYA 1JMTA 4MYTA 2FHMA 1NJWA 1HHQA 1FERA 1IKXA 3HF5A 1N0UA 4IUFA 4DPUA 5JXSA 2V0NA 2GJIA 4DUYF 5IT0A 2P6TA 3QT6A 3HKZD 3IRXB 4X84A 1IBCB 3ILLA 2L9WA 3MPVA 3KYLA 5AT1B 2UV8A 1DJ0A 2LQJA 1KVJA 3CULA 1ACMB 1K8AT 2R7VA 4LQ9A 4Q0BB 2HHTA 2ADBA 2ZJRQ 1Y10A 1B0PA 2U1AA 3HI9A 5CD4H 3CXCR 4L73A 2FHJA 3M8PA 1QLNA 1UWAA 2LQ8A 3CD7A 1TK8A 4GRSA 4JI0F 4YY3J 2W25A 3DLHA 4CQ1A 1DTQB 4Y65A 1X8DA 5HBMA 2FJAB 4RZRA 3D1HA 3B8HA 1JQGA 2JC0A 4J9VA 2JZ5A 3ZZPA 5C42B 3HT3A 2YXLA 1FVSA 1FKOB 4I2PA 1NSKL 4OLOA 1K9MT 1CS4B 4IH6A 3FCHA 3P6YC 2CWKA 8RUCA 4YN3B 4CO2A 4CP5A 4DV6F 3PJWA 3NXZA 1RWXB 3TA1A 4FPRA 1XK8A 3D2WA 1S9EA 1JKHB 5AXKA 4EO8A 1RACB 3VAJA 2X51A 4ECSA 3PEJA 2P2CB 2E5GA 3OQ2A 4IO1A 2MMYA 2K1RA 2YNIA 2F1FA 1YDLA 2XZWA 4X62F 3MM8A 1AUDA 4WE1A 3HDSA 2W8LA 1VQKS 4FVMA 2VQEF 2CPDA 2HG4A 1QTNB 2FYXA 1TKTB 2PMHA 3BGUA 2YKOA 1OSDA 3MI7X 5E3PA 4Q2MA 4P74A 1IBKJ 3CUNA 2K3IA 2VODA 3T5HA 1UFWA 3QGPA 1ZAXA 5M2UA 3QGIA 4DR2J 4X65J 2HFNA 2DIVA 2V8VA 2X3GA 3VV2B 1HBMB 1Q8LA 2FJXA 2ZKUA 1T3NA 2HNDA 1KHVA 3M9MB 3RBXA 2BRKA 4CO4A 3AJ1A 2HHUA 3NAHA 3NS5A 1C1CA 5KFFA 2IM0A 2H65B 4KTQA 3LP1A 5AJ3J 4B17A 2DGSA 3DLGA 4GC6A 3H5UA 4ZP6A 1X5OA 4LFCF 3TJAA 2WTFA 3W5ZA 2AW0A 1SC1B 4NI2B 4WXOA 4YR3A 1S1VB 2CA9A 1AZSB 3DLEB 4PXDA 2ZE2A 1U24A 2CQHA 1NSQA 1VC5A 1MMLA 3KLHA 1FT8A 5FDLA 5GMEA 5HMXA 1U0SA 1NPPA 1YZ6A 1D9AA 2WBRA 2ZH6A 3QNWB 2BR0A 4RPFA 3TW0A 3I5BA 4IKAA 1IKYA 3CO0P 3L7PA 2V63A 1IBLJ 3SFUA 3HKWA 3F73A 2D7SA 4I2QB 4J9PA 5ETOA 2OJ3A 4X66J 2NZCA 1PIEA 2XMJA 2J76E 1DFDA 5D4LA 2ATCB 4DBQA 2AJ1A 1R0BG 4B9UA 2C3UA 5HVFA 3QZ8A 2DY1A 3GSDA 3NP5A 3T5KA 3H5YA 3HHKA 1PCAA 3MM7B 1SIWB 1TKZB 3W8PA 3IO1A 5HROB 4ECRA 1VQ5S 4DV7F 3WC2A 4HKQA 1NJZA 3OD2A 4CLWA 4YHHJ 2LQ9A 5CCLA 5CYMA 2LVWA 3OVSA 2GC8A 4H4MA 1CJVB 4A8QA 1KOHA 2HK2A 2UV8G 5CHCB 2FD2A 4IH5A 1X4BA 3PR5B 4X64F 2IC3B 4ZOSA 4JV2A 1U02A 4M5MA 1BD6A 4TU9A 2I38A 3IWNC 4HYKA 4ZVHA 2JVRA 3LAKA 1U0HA 2EK6A 1YRTA 2AHOB 1S5ZA 1RWNB 4RBTA 3AHPA 1RTHB 4F0KA 5KFVA 2OMLA 5AE1A 3MR7A 1G3OA 3RTVA 4ZS6A 2GVZA 2NREA 5F0WA 2HYIB 4G1QA 2RD5C 2DB1A 1PSDA 2P6SA 3FQLA 3MZIA 3UDVA 5E2QA 1RCXB 4ZIWA 2EFQA 3SMZA 5B0AA 2H5JB 3BR8A 3R7NB 4LFAF 2IBKA 1Y11A 5AE2A 4PEOA 3PYGA 4TQRA 4RUHA 3G4SS 2RAQA 1AUSL 1K0VA 4WFBQ 1XMQF 2LXUA 2RSQA 1FD8A 1WEYA 2YNGB 2C2ZB 3CVKA 3IR5B 4FXVA 4DSIA 1O5JA 2FY8A 2GHWA 3DI6A 4F7VA 3CJKA 4ECQA 3UD4P 1BQXA 2FHKA 1VQLS 2BE7D 2D41A 1S1XB 3KWMA 4DL6A 2KU7A 5K14A 1EAYC 4UT4A 4P6QA 1NKBA 3DDKA 2VV5A 5H1SV 2RQKA 1MW7A 3OL9A 5D15A 2XMUA 4DDFA 4WJBA 5DG9A 4YR2A 5JVHQ 4DR6F 3M2VB 4NEZA 3DRSA 2RKIB 2PEBA 3KJVB 3C3LA 2R2SA 1BE4A 1Q5YA 1W25A 4HHUA 3NBPA 2MHNA 2KL8A 2CPYA 1N36J 2I0XA 2IA6A 3W3SA 1OIAA 3D9BA 3W1YC 4OMFG 5KG1A 3E01A 1FD2A 3FEZA 1TKXA 4K4WA 4FXDA 2Z2YB 1YZ7A 3HULA 5IZHA 3VWSA 3ZZRA 1H3DA 4PG6A 2HFVA 3FJ2A 4RL1A 2ROPA 2UUCF 1TV6B 4B3OB 1GQEA 4I69A 4PXEA 1JX4A 1N33F 1F9EB 4MKYA 2R7RA 4R5PA 1D0EA 3JQKA 4ZK7M 1M1KT 1K44A 1HYSA 2JFKA 4ID5B 4N41A 3ITHB 5B7WA 4RUCA 2BE2B 3JAMY 2BM0A 4ZVUB 2G0IA 3B82A 2ZD1B 2XNQA 1KQGB 3UDCA 1EIYB 2A6MA 5E0OA 5IM0A 5J1PA 1C0UA 2BBEA 3C66A 3CDUA 3N5FA 1C1BB 1I94J 1UZDA 3IG1A 3WZ0A 4GKKF 1U8WA 1JLEB 3OBIA 1FFGB 2HMIB 2C3YA 1QE1A 3OLBA 5CA5A 1GMVA 1BWVA 2QSWA 3HO1A 1FCAA 1KSPA 7AT1B 5HANA 1I51B 1JLAA 2E5HA 4K2JA 5LSOA 4LF5F 1FJ7A 1OJ4A 1EQMA 2M0GB 3FMBA 3UCUP 4NZ6A 2EFVA 4N7TA 4Y28C 4M5IA 1SV5A 4LSLA 1QM9A 1UWBB 2OFGX 1QSYA 3CJSA 1IBMJ 3C46A 4XAKA 1FI4A 4CWBA 1ZM3A 3V5RA 3ZXWA 1HNIA 2O66A 3VGSA 1FKPB 1JXEA 4LMZA 2GA7A 1DY3A 2HGNA 1Q0NA 4K4UA 2DTJA 4ECYA 2HHSA 2ZEJA 4DPWA 1HW9A 1RDRA 5K8MA 1U1LA 1RT1A 2OPRB 2JEFA 3GWCA 2XHWA 2IAJA 4DQIA 1KQFB 2BOAA 3CJTA 4ZVGA 1QUPA 2OPPB 4XIUA 4DUZJ 2MLYA 4DOZA 3GJTB 4X4QA 5C2CA 2A10A 1URNA 3SV4A 1GTHA 4IG3A 3DOMA 1KN6A 2Z58B 3ADAC 2IMWP 5GMDA 3UWTA 5H9EJ 5F0UA 3MFIA 5BYSA 2UU9J 2B43A 2DCLA 3VCDA 2XO6A 1EKRA 4QWCA 4F8RA 1XMOF 1T95A 2L3MA 1VLOA 5BR8F 3MEGA 3KDNA 3KUEA 3PCOB 5ETNA 1FFWB 2MKYA 3B78A 1CULA 2HW3A 3MAAB 5CABA 3EGVA 1UETA 4OZ0A 4IG0A 2D1CA 4DV4J 3EGWB 3GTYX 1IKWA 2OPQA 2I1RA 4NOHA 3IWLA 2HIYA 3CTRA 2ZBPA 3EX7B 1NU4A 1T94A 5LSRA 3GCXP 2VPWB 3EXYA 2QLJB 2QC3A 1SQGA 4U8VA 2KN4A 4DCOB 5J2PA 2Q3PA 2XYHB 4UZBA 3UN3A 2DT9A 1R27B 4FYWB 2VA2A 2K3KA 4CZCA 4LQ3A 4N56A 2WB4A 4FS1A 3HK2A 2MY7A 4KSEB 3CDBA 3QQCD 1RWKB 4J9RA 2PMWA 3WX8A 4DFKA 2XMTA 1RT7A 2YKAA 5ETQA 4DSEA 2W1BA 3QO9A 1UL3A 1R7IA 1PILA 6FD1A 5D4NA 4IDKB 3P8BB 4ENOA 1RTDA 1Q5VA 3RBZA 1MU2B 3VGTA 4K8RA 5ETLA 3VQTA 2QLWA 4TKTA 3QRPA 4KO0A 4O4GB 2UUAJ 1Y5IB 2HGLA 4MH8A 3DHXA 2BEFA 2H9ZA 2BDPA 5E5NA 3R5DA 5KFLA 2LXFA 2MTLA 2P9CA 1URRA 4BC7A 1QY7A 4C8YA 3MPYA 1RHKB 1Q79A 5EN1A 4FYYB 3I87A 1QD1A 2AD9A 4I7FA 5I4MA 3PW4A 2QMWA 4IFVA 4C3MA 1HNXJ 2FY1A 1NJYA 5CD4A 4QW8A 3G71S 2D3UA 4O23A 5HK4A 2DGVA 2EFPA 2MKJA 3HM9A 2YX4A 1RWVB 1N6QB 1EARA 3W5YA 3TVZA 1JLFB 4J5OA 4QOTA 5KFNA 2A6OA 2XLIA 4HACA 4IYQA 1R0AA 1XMBA 4NX9A 3NKYA 4U67Q 1HQEB 4JI2F 3Q2TC 2CPHA 1U25A 2HVDA 3CJ8A 8AT1B 2AJQA 2Z56B 3POTB 2BKOA 3FEYB 1VQ9S 3C16A 3NGRA 1RP5A 4U7UK 1T02A 3OXFA 2Z2LA 1Q8IA 1AT1B 3DRRB 3O8WA 1TUGB 1HNWF 2CQGA 4C97A 3PFOA 2H5IB 3SCKE 4CLKA 2F65A 2XGPA 5KG0A 2CKWA 4FS2A 3LP2B 3TQ1A 2GVDA 2ZDOA 2BMBA 1YJ7A 5A6WA 4U9RA 3C6TA 4DL5A 1RT2B 5KFUA 1IM4A 2HQIA 1R31A 3HHLB 2MQNA 4DL0C 5I3QA 4CLPA 3H98A 3GLJA 6AT1B 5T14A 3TWZA 2PN6A 3G2XA 5A8WA 1JB0C 2HAIA 1Q86T 2DGTA 3CMES 1KS2A 4PWWA 3BH7B 8ATCB 2E5IA 1V3SA 3DGPA 3LH2S 4HT5A 4NRTA 3M2RA 1EETA 2G13A 3J81U 5D78A 2N82B 2MYFA 1HPZB 1R8PA 4RW4A 2CZ4A 5CQGA 2DJWA 4UF4A 2N7YA 7FDRA 4QWDA 4R0EA 1TKDA 2VG6A 3CJ3A 2AEJA 3TJ8A 3M6VA 2PA3A 1AYEA 2MGZA 3ILJA 2EBEA 3MECA 1H72C 2JRSA 2ZKTA 2P9GA 5I3UA 4R8UB 3FQKA 2E7XA 3D3CJ 3GU0A 3A3PB 5KT6A 4NZ0A 2MZJA 4A47A 2GS8A 1RWOB 1Y9OA 2F63A 1REVB 1KTQA 3UN2A 4FYXB 5U47A 5L9NA 1FJGF 1UVNA 3U1MA 4QW9A 1VK8A 4RWWA 2A1BA 1XTZA 4XO0A 2OTLS 4WPAA 2VC1A 1DTTA 2HKEA 2J8AA 2M88A 5LXYA 2F4FA 1KNZA 1UKUA 3CCVS 4ANEA 2XYPB 3ZZ0A 3T1YF 2QTWA 4DR3F 1LW0A 2W2MP 4TU8A 3K5LA 2DH9A 3SQOP 2B4UA 1FWPA 1UPMB 2J6TA 2B8QA 1S6OA 5A8KA 3B6BA 2VIHA 3EVOA 4KAIA 5EWGA 4OI4A 1R43A 1VYAA 2V9WA 4FZVA 5D6GA 2ZUGA 3UPFA 2DGQA 2FVPA 2JH3A 2KVIA 2VG5B 3LOUA 4N5SA 4U7CA 4EFAC 2CFXA 1LW2B 4LF9J 1M5OC 2RMLA 2V6AA 3D1QA 1JLCA 2LEPA 3CMQA 4J90A 4IOBA 2IM2A 2ILYA 2IJFA 3HJFA 2Z8QA 3MXHP 1UFLA 2MJUA 3FBCA 1S49A 1Y3JA 3D7SB 1YRXA 2HFUA 1RTJA 2KHDA 2G1DA 3LA0A 2IY5B 2XGQA 1VOMA 3ULHA 3R6GB 1RWWB 1ZTTA 4C0OC 1R0CB 2B9EA 4PR6A 2LYVA 2M8HA 2CNNB 4ALZA 3R5JB 4JI8F 4CO0A 1T05A 1S6QB 4FVCA 2XHCA 4QIWD 2ZVIA 4ZCIA 1FXRA 1X9WA 3A8IA 3S1TA 3O3LA 1H38A 2VG7A 3I5AA 1M5KC 1UP1A 1X60A 2NXCA 5K8NA 1Y3KA 3CD6S 2X3DA 4ZPWR 2HHQA 3ONQA 3OVBA 3G6ES 1GFWB 3VVTA 4FBTA 4JI7F 3M8RA 1WJ9A 4C8NA 1Q4RA 3E3XA 4LF1A 4ZLNA 5K8OA 2CG4A 1DQAA 1NXIA 3ILOA 4QWBA 1HQUB 3DRYA 5KT4A 2BOPA 1HBOB 4RW7A 4C2MA 2HS0A 3OJSA 5LJ3Y 1CJKB 3J7Z5 4KFBA 1S9FA 1Q16B 3KLGB 4F2RA 1HLWA 1A7GE 2CZ9A 4ELVA 3DRPB 4M5KA 3ZZTA 4DX6A 2LCWA 1B4SA 1HWLA 2C2MB 1L3KA 2HVHA 2G2ZA 1GMWA 1NKCA 3NAIA 3KK2A 3SZ2A 2XCAA 1RWUA 3UO0A 1LWFA 3PRBA 5BYQA 5JUMA 3SDEA 4U6PA 1PYOB 2FJDB 2BA9A 3NCQA 3TNVA 3T5LA 1FHTA 2E5LF 1S1UA 2WAQD 4ES2A 4USKA 4FKYA 3AY0A 1FXLA 1KD1T 4UQTA 1RTIB 4LIWA 2POKA 3AXMA 2KJWA 2YTCA 2DNZA 4FF3A 2OD6A 3CJRA 3M1VA 3ZZOA 3RBDA 5DS7A 5IT9U 2DHSA 4U8YA 2VC0A 2MKHA 2JEJA 2HQCA 4YR0A 2CPXA 3EZUA 2Y1LB 2WZ1A 2HPUA 2YBVA 4O3NA 4IOCQ 2H3EB 3N6LA 4X4TA 3D6FB 3BGOP 4PWUA 5F8LA 4M63A 3TUIC 3ISNC 4C8ZA 2MEWA 1SC6A 3DOLA 4LIRA 1SIZA 4HI2A 2FJVA 2V4JA 1IWGA 3Q24A 3CJ2A 4OYZA 3A4TA 4A46A 3W2WA 2Y8WA 4Y0FA 1H7WA 2G9OA 4LSNB 3ISZA 3ET6A 2VJUA 2HHVA 3Q8YA 1HR0J 1QDUB 5J2MB 4ZJOA 3MD1A 3QLHA 5A0YB 2QL9B 1N4LA 5G0RB 1SB6A 2N3LA 4JB8B 5KTQA 1T03B 1F0XA 3UR0A 5LL6d 5DLGA 5L1IA 4DSLA 1QTMA 1B99A 1FTCA 3CWJA 3W2VB 1AZSA 4JYAF 1S57A 1M5SA 2YKNA 3TAMB 1E6YA 3G6XA 3L3CA 2F3JA 3ZO7A 2WONB 4CH0S 2IDLA 2XNRA 1S7IA 5DRKA 3OR2B 1CC8A 4DR5J 1GT8A 3DMJA 2LKZA 4K7QA 4PG4A 4W4MA 3LWMA 3D66A 1IBKF 4WK3A 3EVWA 1ZH5A 3KDOA 4MAKA 1P9YA 3GIRA 4GVBA 4E2FB 2WSFC 2W8KA 3GMGA 3E2EA 4A8KA 4EMDA 4QPTA 3V6DA 3I9ZA 3HVTB 3KK1A 1U1OA 2R7TA 4CM2A 2BV3A 2ASYA 5DM6Q 2W4DA 1FESA 2PA8D 1M1GA 2QYCA 1HBUB 2J0XA 4JV5F 3IGNA 4ELTA 3HFKA 4U96A 3GFZA 5CYQA 3CC7S 3FZ2A 1IM6A 5I42B 4LF6F 3RW7A 4DG1B 1Q82T 2RQCA 1NHUA 2BE9B 4ER8A 2GCFA 3NRBA 1H2TZ 3QJLA 3KXDA 4BWMA 2UUBJ 5HP1A 4M95A 4I67A 1BLUA 5KG3A 1WOOA 2ADCA 1W2BR 3I0SA 1FRJA 1XERA 2KHCA 2JVOA 1Q95G 1RT6A 2QO3A 1A0OB 1F5BA 5A8RB 4ETZA 1RTHA 1QUVA 2AWZA 1S1TA 3IM9A 2DISA 2GNKA 4OX7A 1S9GB 4ZN3A 1YKWA 2ZOGA 1GTEA 1YJUA 4P75A 2NYIA 3DLLQ 1UFKA 1VQ7S 1TAUA 2E1MC 2GW8A 3Q8SB 4K0KF 2DNKA 3IP0A 2CQ2A 4WFZA 3DKDA 1TL1B 2NQPA 2B5JB 1D8ZA 1XN9A 1X31C 3QFWA 3GILA 2CJYB 3GV7B 4EBEA 1KLMB 1X4HA 1YI2S 2YWHA 3R7SB 2R2TA 3SCJE 1DHMA 1KTVA 4OZ3A 3TZZA 4MK8A 2BABA 2WBMA 1WC5A 1WKLA 3BBFA 2VPYB 2H54B 3H2VE 1FEEA 4QIFA 1NSAA 5F8NA 3BGLA 3SSQA 3RZAA 1XWLA 3FKBA 1RABB 2HEKA 3EM1A 4K4XA 2K06A 2N4CA 1O6XA 2PMZD 1SL1A 2F9JA 2R8IA 4UQGA 4Q5VA 2MQPA 4M1KA 3EWGA 4ZJLA 3RRKA 5KFPA 2W01A 3DFEA 4YEAA 3QIPB 4YP3A 1M5VC 4Z2XA 4USJC 2QFJA 4PCQA 5G4DA 2ROGA 3FFIB 5IC6B 4CO5A 2KXFA 2HNYB 1FE0A 2AZ1A 3EPIA 1WG5A 5KFXA 4J7CA 1X4AA 4ZA1A 2MQQA 2ALYB 2XLJA 3OTOF 1HA1A 4ZVSB 3KUGA 4DPYA 1Q8BA 4LBHA 4OI6A 1KKHA 2MPUA 3ZTOA 3ZTPA 1U6FA 4K4YA 3O1LA 4X4VA 4AT1B 1OY8A 3A8JA 4M5NA 3CCQS 5HLFB 2XMWA 4ZMMA 1PC4A 2DGXA 2FQQB 1QAJA 2F8HA 1G4CA 2IYGA 2NLWA 1BQMA 3NG8A 3GG1A 3BSNA 1YWXA 4DR1J 2QYGA 2YWEA 3TUZC 5HAOA 2XS2A 4QR0A 2BE2A 1OYDA 1Y0HA 3PHEA 3GV5B 1GX6A 2YNFA 2MKKA 3DDNA 2KRBA 2X1GA 3DM2B 1FEHA 4PZVA 1T8EA 3CCMS 2O1PA 1DQ9A 4DV1J 4TY9A 3BREA 1YGYA 2LQBA 4OLPA 4ED6A 1JWWA 3OSNA 4Q7AA 4FBUA 1C0TB 1OY9A 4OJGA 4CTAB 4JUZA 3BO2A 4B3TF 2VUGA 5B09A 1A9NB 4F0HA 4NLUA 3MCNA 2NCKL 3BGRB 3VHQA 1IR1A 2DCUB 3CDEA 1NRKA 2Y0SD 1C2PA 4X4UA 4KV8B 3I0RB 4NA2A 3TUJC 2RDJA 1FO1A 1NLKL 3MEDB 3FSXA 2AIRB 3BKFA 3W9JA 2NS1B 3IBCB 1F5AA 1HL6A 3K5PA 3V4IA 1FTRA 4KGKA 4OYIA 3FVYA 3K5OA 2EFGA 1UW4A 1HNVA 4AQYJ 2ACYA 5LMNF 1XQIA 4TXSA 3B4DA 2AX0A 4ILLA 2C3OA 1FRXA 3A3OB 1KC8T 3QWUA 2PT0A 3K58A 5JVGQ 1UVLA 3PO4A 4P7VA 4OL8A 3I31A 1HW8A 3P45B 4NXNJ 4M5DB 2GQCA 3KK3A 3MM6A 2XB2D 4HI1A 2LEBA 4K59A 3VAHA 3CC2S 1MMDA 4OZ2A 4N47A 3TJ9A 1HI0P 1KDNA 3GIKA 3JYTA 1IXKA 4JI4F 4EYIB 3M30B 3OPKA 3CSKA 1NCLA 3U27A 4AL7A 2COLA 2DY9A 3L7UA 4DV0F 1RHMB 2ROEA 2MZTA 3TZYA 1TK5A 1TFYA 2AX1A 3DN9A 1PJ7A 3DLKA 3CCLS 2KTQA 1VGYA 4OX9F 1LK5A 3PIOQ 1N5YB 4DR4F 4HTJA 1ZBTA 2OMOA 2BRLA 4PWDB 1VIOA 3MR5A 3BH6B 2BM1A 2Y3YA 3A12A 1TTHB 1RHUB 2MSTA 3HP6A 4H4OA 3IR7B 5CZXA 4CT8A 1WG1A 3JSRA 1FDNA 4C8OA 4MYUA 5L38A 1M0SA 4XDCA 4ICLB 1Z1ZA 2W9CA 1ZPWX 4B9MA 1NNDA 3C15B 5F41A 3IN5A 4LFBJ 3PG9A 2MKCA 3US5A 1RK8A 4YS2A 3VGVA 4RW6A 1BXNA 4MIAA 4USHA 1TK0A 1V3RA 1XBWA 4CYUA 2B7BB 3HHLD 1G2EA 3MF5A 4DV2F 3BO4A 4URSA 1JIHA 2CQCA 1D8YA 5CCMA 1IJFB 4IDKA 1HNZF 2IVMA 2XZTB 2H5EA 4NCGB 3CO9A 2APOA 2FZGB 2AYBA 2FLNA 3H4DA 4WCEQ 4I1TA 5KAKA 2C2NA 1JLGB 5A2QY 4B3SF 4PRFA 4YDDB 3C6UA 1TVRB 2YNHB 1SKSA 4ZVTB 1IN0A 4LT6A 4C98A 2CNKB 4MK9A 3R3TA 4DV3F 3CDWA 3H2UB 3MR2A 4JI0J 4Y2IA 4M5HA 2XEXA 3JSMA 3S6EA 3I9V9 3M8WA 3Q8UA 1N56A 3RAXA 3OJUA 4C7QA 4A8SA 3P5TL 4UTGA 1N34F 2AGOA 1N88A 2HZAA 2YH0A 1UEVA 3RUBL 3BPDA 2IM3A 4YB7A 4DV6J 1IKXB 3ZZZA 4OV6A 4MFBA 4YOEA 1RKIA 4PQAA 4KT0C 3Q89A 3OVAA 2EK1A 2NSCA 3KHRA 3FK4A 1XNRF 3OFEA 3SI8A 4I6AA 1VJWA 3D0HE 1RT4A 2DNHA 2DRDA 4F4WA 1WD6A 4X62J 2RRAA 3LP2A 3M8PB 3VZHA 2LU2A 3VR1A 3V2UC 2QA1A 4NL5A 4F02A 1HBNA 1NK9A 5D0HA 1F9FA 3H25A 2F8MA 1WC1A 3EJMA 5FIIA 2FZCB 2KM8C 2C3PA 1PJ6A 2GFFA 4I2PB 1EZZB 3KLEA 3MOJB 3PRVA 2B9WA 4WP8A 2M70A 5F3ZA 4C0HA 1S4FA 1VC0A 5DDRC 1YG0A 3LAMA 3GJRB 1S9EB 4OQJA 3Q22A 2XMAA 2RRNA 3FUYA 2HURA 3AOBA 2OTJS 2K1RB 4LFCJ 2ZC3A 3OR1A 4QR1A 1RUSA 1GXLA 2N4DA 4CIOA 3E8OA 3MM8B 1T9TA 4WE1B 2DKOB 4ED5A 4WP3A 1Q81T 4USIA 1WF0A 3X3UA 4IQMA 1R6YA 1GEHA 2KFYA 3UNYA 4F50A 5KFWA 3NNCA 3ENQA 1AXQA 1F1BB 4WWSA 1ZAVA 3MEKA 2RIJA 2MDAA 1RQ0A 1TL7A 3N28A 1M5HA 1T9UA 2U2FA 2HNDB 1KEKA 1QAYA 2YX1A 1C1CB 4DLGA 2KH9A 3WC0A 2V2KA 2XTJP 4G6VB 3LP1B 3P5BP 4USUA 5HN0A 3EZOA 3BN4A 3K8WA 3OL7A 4DV7J 1F3FA 3DLGB 1TAQA 2BJDA 3U02A 4OYAA 3AD8C 3OHBA 4KHRA 2M52A 3GPAA 1N52B 5E33A 4Y2MA 2ZE2B 3JTPA 4KRWA 4J9NA 4X64J 3KLHB 4H54A 4OI0A 5FDLB 2YQ1A 2OELA 3DLBA 1SC3B 4URQU 5K5MA 2M5YA 1UTAA 2DNRA 1WSVA 3GIMA 2VZ9A 3C2PA 1RWPB 4B3MF 4LF7F 1NJIT 2V4QA 1ZM9A 1IWAA 4EWTA 1X0FA 1IKYB 4OJ1A 2HBRB 1NKEA 3G6VA 3J80U 4XPCA 5IV4A 1APSA 1N32F 2E5JA 4NZ7A 1X7VA 2Y1IA 4ERDA 4JV1A 1FJEB 1FK9A 1AW0A 3K89A 4ZIVA 3FCWA 4KKOA 3EVMA 3IC1A 2OH2A 4RBUA 5CH7B 4ELUA 5C24A 4DMZA 4NMXA 3R5CA 1FVQA 1O51A 2ZHAA 3JSBA 3WQPA 1RBOB 3M9OB 3VTIA 5HMYA 2BANA 4LFAJ 2UXDF 1ZS6A 3QAUA 3R5AA 2NYHA 1PBUA 3GJSB 2WW4A 4OHXA 5CYMB 1QJHA 1XMQJ 4H4MB 5KFAA 5FJ4A 4NASA 2E1CA 1R8BA 5GAEU 3SCIE 2KI2A 5B0DA 3T1AA 1ZZFA 4F4ZA 4XK8C 3PKYA 4QR2A 4WK1A 4WIQA 3W7BA 4JI3J 2EFNA 3HHDA 5EWFA 1IKVA 4FF4A 1OYEA 1Q53A 2GO8A 1S77D 2C2DA 2DXEA 4OX6A 1U0HB 4JI5F 2N3OA 2NUUG 4LF4J 3ZZYA 5C7PA 1U49A 2PFFB 1U45A 1RBLA 1D9FA 2B3TB 2GVZB 2J9EA 3BKTA 4ATNA 3RR8A 2GAGC 1DLOB 2GGPA 4G1QB 1KHWA 4EGLA 2LDYA 2C2OB 4DR6J 3OUYA 3LF0A 2GZOA 5KFSA 1S1WA 4RW9A 3UE2A 2FHOB 3HSZA 4ED8A 3TEGA 3R97A 4NCAA 2OP5A 2UUTA 4PQUA 4NYOA 2Q66A 3PIPQ 1BHNA 1NDCA 1GMUA 4TYAA 4DFMA 3ZZUA
chains in the Genus database with same CATH topology
3BPSP 4OV6A 2Z30B 2ZWOA 3VV2B 3GCXP 2W2OP 1V5IB 3WIVA 2QTWA 4JP8A 2PMWA 2W2MP 2XTJP 2ZWPA 3A3PB 3BGOP 1ITPA 3A3OB 3AFGA 4NE9C 4YN3B 1SPBP 3P5BP 3QFHA 2Z2ZA 2Z57B 3T41A 3WHIA 3GCWP 1R6VA 3VHQA 3SQOP 2W2NP 3CO0P 4NMXA 3H42A 1SCJB 2W2QP 2W2PP 3A3NB 4K8RA 2Z58B 2Z56B 2E1PA 2Z2YB 3CNQP 3WIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPS P;  4OV6 A;  2Z30 B;  2ZWO A;  3VV2 B;  3GCX P;  2W2O P;  1V5I B;  3WIV A;  2QTW A;  4JP8 A;  2PMW A;  2W2M P;  2XTJ P;  2ZWP A;  3A3P B;  3BGO P;  1ITP A;  3A3O B;  3AFG A;  4NE9 C;  4YN3 B;  1SPB P;  3P5B P;  3QFH A;  2Z2Z A;  2Z57 B;  3T41 A;  3WHI A;  3GCW P;  1R6V A;  3VHQ A;  3SQO P;  2W2N P;  3CO0 P;  4NMX A;  3H42 A;  1SCJ B;  2W2Q P;  2W2P P;  3A3N B;  4K8R A;  2Z58 B;  2Z56 B;  2E1P A;  2Z2Y B;  3CNQ P;  3WIU A; 
#chains in the Genus database with same CATH topology
 2FUG 9;  2KZZ A;  2F4V F;  2E7W A;  4RKU C;  2J7W A;  3KOA A;  2AJ2 A;  2V69 A;  2ZUA A;  2KT2 A;  4NLY A;  1ZM2 A;  2W9A A;  1WG4 A;  3MM5 A;  2UUC J;  3FBE A;  4UUX A;  1YJT A;  2DXD A;  1JNR B;  1H7X A;  3DGV A;  3KMQ A;  4LR7 A;  2VDI A;  4PXC A;  1N33 J;  3PXG a;  2UVW A;  1ZM4 A;  3BR9 A;  2GAH C;  2BJ1 A;  2BVZ A;  3BDE A;  3DI6 B;  3CJK B;  1H2V Z;  2RDD A;  1NM2 A;  2ZBR A;  4ZLL A;  3EDQ B;  3J7Y I;  3KLI A;  1XIQ A;  5K14 B;  2HQ3 A;  3X1L B;  3DRX A;  4DF8 A;  2CQ4 A;  3IAM 9;  5MLC V;  2DNG A;  4EK2 A;  1DRZ A;  2MY8 A;  4DWI A;  1RTI A;  4F25 A;  1TUW A;  4DU7 A;  3GFY A;  3ICL A;  1IQZ A;  7FD1 A;  4JOU A;  4NLX A;  3DRS B;  3JB9 k;  2X7I A;  2MZQ A;  4WKR A;  2NXE A;  4GKK J;  4L3K A;  3A3N B;  3NBP B;  1D09 B;  3OHA A;  2LFV A;  5ETK A;  3E01 B;  1HWJ A;  2DBB A;  1TKX B;  5IC4 B;  4KBI A;  2G4B A;  1RT3 A;  1U2R A;  4GO5 X;  2XS5 A;  1X0P A;  2BJE A;  2CUY A;  4QU7 A;  3J7Z T;  2OPS A;  4PUO A;  3FMW A;  4NLT A;  3PY8 A;  4EUV A;  1FRK A;  2GO9 A;  3ZNU A;  5GAD I;  2WSC C;  1A6L A;  5IWA F;  4R5P B;  1JNZ B;  2IIH A;  1HYS B;  3AT1 B;  4ZP7 A;  1SKR A;  3MM9 A;  3IAS 9;  5THW A;  1MNE A;  2XS7 A;  5EX0 A;  2DPJ A;  3UQS A;  5A0Y A;  5EX3 A;  4XPE A;  4D3G A;  3KNA A;  2W9B A;  3MCS A;  4WP9 A;  2WVB A;  3MMB A;  2D9O A;  2H51 B;  4LVN P;  2C22 A;  2LP4 A;  5IM0 B;  3K17 A;  1C0U B;  4P73 A;  5HSP A;  3O44 A;  3RU0 A;  5JMN A;  3EDR B;  4K4S A;  2K8G A;  2FLL A;  3IG1 B;  2GV1 A;  1UA1 A;  2JL9 A;  2BQU A;  2GQ2 A;  2R42 A;  1X5P A;  1RHR B;  2VFV A;  4HHH A;  3Q23 A;  3F0N A;  1QE1 B;  3K8V A;  4IR1 A;  2RF2 A;  2AYM A;  3MPU B;  1VJQ A;  1CEZ A;  1S6P A;  3NWG A;  2AU0 A;  4X4R A;  5DQG A;  3MMC A;  1S12 A;  3R9L A;  5J2N B;  1D1U A;  2AV5 A;  2FIU A;  1JLA B;  3NWR A;  5E3C A;  5GAG U;  2JNJ A;  2R8J A;  1U7L A;  2J0Q D;  3NMR A;  4O3R A;  2UP1 A;  3QRR A;  1RLD A;  2HQF A;  3IR6 B;  1DUR A;  1SV5 B;  3PTW A;  3UNG C;  4GO7 X;  2E1R A;  4LSL B;  3TP2 A;  2PFD A;  3G82 A;  1XMO J;  1S0O A;  3ZTR A;  5BR8 J;  4CCH A;  4G1P A;  2R4F A;  2R7U A;  4HEA 9;  1G1X A;  1HNI B;  3KLF A;  1T9W A;  1VQO S;  4RW8 A;  3N01 A;  4I6W A;  2KG1 A;  3O6Q A;  2M7S A;  3ZNJ 1;  2KT5 A;  3C14 A;  4DXL A;  4TY8 A;  4ZP9 A;  4ZIT A;  3VVU A;  2HRY A;  2WOM A;  1RT1 B;  2HNZ A;  4LR9 A;  3VQS A;  2IAJ B;  2RDI A;  5F8M A;  3A13 A;  4PG7 A;  1U09 A;  4KB7 A;  3EGZ A;  1SJR A;  2J0S D;  3KUH A;  3W63 A;  4IG3 B;  1PG5 B;  5M2P A;  3QAE A;  2V2Q A;  5KFY A;  3VAI A;  1YBA A;  3DOM B;  1S9G A;  2C2K B;  1XR5 A;  5KFO A;  3DYA A;  3QJJ A;  3IS9 A;  3TQE A;  1YJ9 S;  1WF1 A;  2DK2 A;  1SXL A;  3FCV A;  2J7U A;  1Q8K A;  1QSL A;  4FYV B;  1UAW A;  3CIZ A;  2C28 A;  2HVI A;  3F56 A;  3RRG A;  2YVS A;  3D6H B;  2Y9H A;  4CRJ A;  3MEG B;  2H4W B;  1ZA1 B;  3H59 A;  2B7C B;  2PGC A;  2XQC A;  1HWK A;  1HFE L;  1EHW A;  1GX5 A;  1WKK A;  4F04 B;  3M32 A;  1CUL B;  2KFZ A;  4FF2 A;  3TX0 A;  2OO4 A;  1I6J A;  1MLA A;  4L75 A;  4IG0 B;  5GAH U;  1FJC A;  2XY5 A;  1F2H A;  2GHV C;  2VKR A;  2CJA A;  1IKW B;  2OPQ B;  2UUB F;  3OTE A;  1VCT A;  5KG2 A;  1PBA A;  3VAK A;  2YWG A;  1U1M A;  4OJ3 A;  3BQ1 A;  2IJN A;  2OSQ A;  2QN6 B;  1YJW S;  1NH7 A;  4KPC A;  3GJQ B;  4L6V 3;  4Z7C A;  2G0J A;  4JV0 A;  2HSE B;  1N0V C;  1NZ8 A;  6FDR A;  5J2P B;  2CQ0 A;  1YHQ S;  4EEY A;  2MQM A;  2VBX A;  4USM A;  2ZWO A;  4ZHR A;  3T6B A;  4DHV A;  1NK8 A;  3R2C J;  1HAR A;  4DPX A;  4P9S A;  3I4P A;  2D3O R;  3HCX A;  2DHA A;  2CXE A;  1RLC L;  1RT7 B;  3OFF A;  2ATL A;  2QE5 A;  4I6Y A;  1DAR A;  4FXW A;  1BQN A;  3QO9 B;  1PKU A;  2MZR A;  1MG7 A;  1X9M A;  3SXL A;  5A76 A;  2OLW A;  4JI2 J;  2OSR A;  4B9N A;  4MJK A;  4WBF A;  4GC7 A;  3UI3 A;  2DNY A;  4OZN A;  3UD5 A;  1FX2 A;  2V68 A;  2DNP A;  4C11 A;  1R89 A;  3JAM U;  1CJU A;  4KO0 B;  1KVK A;  1KR4 A;  4RO0 A;  4YME A;  3MUV P;  3JSY A;  2WVF A;  2RJZ A;  4V1A k;  4HH0 A;  4ZLP A;  1HNW J;  4CO1 A;  1UPP A;  2YKM A;  3H0P A;  1U47 A;  3M8Q A;  3M6X A;  5DLF A;  1REG X;  1K47 A;  1JLB A;  3M6W A;  3T6J A;  4F3O A;  4IFY A;  4I7F B;  1JXL A;  1YX2 A;  5F8H A;  4IFV B;  4F36 A;  4CT9 A;  4FNI A;  4C3K A;  3AA8 A;  5KT2 A;  3H20 A;  2XSJ B;  5D3G A;  3QGH A;  4AFF A;  2ZH9 A;  2HRU A;  2J0W A;  3VAG A;  2IVF B;  2QX0 A;  1UVI A;  4LF8 F;  1RAO A;  1HKA A;  3R1H A;  4HAC B;  4FN5 A;  3D6T B;  1R0A B;  5E3A A;  4QPX A;  2UXC F;  2CQB A;  5HMW A;  2UVU A;  4FDF A;  2FLO A;  4S0M A;  5KFJ A;  2EXU A;  2I5J A;  5FLX Y;  2V8H A;  3BBC A;  4DZD A;  4NLG A;  1RGV A;  2MQO A;  2R8G A;  3C16 B;  5LXR A;  2D3Z A;  2DGW A;  1Q7L B;  3H90 A;  2AT1 B;  1T11 A;  2KJV A;  3I5C A;  1B7Y B;  2KKH A;  2D74 B;  2FVR A;  2GVD B;  3E51 A;  4MT1 A;  4ZCK A;  3I0R A;  4QU6 A;  1KFD A;  3C6T B;  1RT5 A;  4KGX B;  1PC5 A;  3PAC A;  4DR1 F;  3CJ4 A;  5L8R C;  3HMJ G;  5DM7 Q;  1U6B A;  3OXG A;  4ES1 A;  4AXI A;  4RU2 A;  4J9O A;  1FJG J;  3N4W A;  5A8W B;  3ETO A;  2BJ3 A;  2VD3 A;  4DS5 A;  2KDO A;  4DV5 F;  3T3F A;  2XYG B;  3DGP B;  4ED0 A;  5DO2 A;  3RB0 A;  1HD1 A;  3M2R B;  1YIT S;  1EET B;  2BKP A;  2IYI A;  4ECV A;  4B9V A;  4AUK A;  3THV A;  2ZZT A;  5DQH A;  4RW4 B;  2C42 A;  1AA1 B;  3W65 A;  2LA4 A;  4HDH A;  1RAF B;  1WC3 A;  4DR3 J;  2VG6 B;  3MR3 A;  1BC6 A;  1ZA2 B;  3TI0 A;  3PV8 A;  2MGZ B;  3MR6 A;  3MEC B;  2ZM6 F;  4O3S A;  2QV6 A;  5I3U B;  4YB6 A;  5E41 A;  4J9Q A;  3TX8 A;  4DI6 A;  1S0M A;  4ZP8 A;  1CJT A;  1J5E J;  4FYD A;  3QMQ A;  1IVZ A;  2KYZ A;  3IBW A;  2MZS A;  4TLR A;  1WF2 A;  3J81 j;  1VI7 A;  2BXJ A;  5KFR A;  3DDI A;  3MMJ A;  2ACM A;  1NJX A;  5D0G A;  4AQY F;  1QVF R;  1B3T A;  2VFT A;  3AA9 A;  1KRP A;  4DN0 A;  3T1H F;  4QQB A;  2GX8 A;  4LVO P;  2HIQ A;  2OGU A;  2R7Q A;  3BM7 A;  1OMS A;  2RU9 A;  5KOX A;  2Z4P A;  1ZTW A;  3QGG A;  2KRR A;  3U1L A;  2K7J A;  2W4C A;  2RHQ B;  4X2B A;  3UCZ P;  2QLX A;  4OI1 A;  4MKB A;  4GMK A;  1DTT B;  4PKD B;  3HVA A;  4ZPV R;  1NEE A;  3NNA A;  2GJ2 A;  1SKW A;  1HMV A;  5J1E A;  2DGU A;  1LW0 B;  3V81 A;  4ANC A;  1O8B A;  3R5G A;  4OJH A;  3P96 A;  2ZH3 A;  4JI8 J;  2HHH J;  4F4X A;  5A8K B;  2RU3 A;  2FHJ D;  2HWI A;  2CJQ A;  2JC1 A;  3VAF A;  1BMQ B;  1YLX A;  3QAT A;  4B3R F;  1RAI B;  2V8P A;  1HD0 A;  4L3N A;  1NDP A;  4ZVQ B;  4P2X A;  1FDA A;  4NLO A;  4Y2A A;  4LBP A;  2XI3 A;  4KHM A;  2BQ3 A;  2KB2 A;  2B6A A;  3GII A;  4DLE A;  2CQD A;  4ECW A;  3BB5 A;  3T19 A;  3FDS A;  1E6V A;  3MMA A;  4LRC A;  2DHG A;  4CH7 A;  2D69 A;  2I6W A;  1Y4Z B;  2VBZ A;  1JLG A;  4NXM F;  3SIP B;  2VB6 A;  2RS2 A;  2MB0 B;  4RNM A;  5HAT A;  1RTJ B;  4DQS A;  5DGA A;  5T7L A;  1OSC A;  4PPZ A;  1MMN A;  4NRU A;  1SBR A;  2NXJ A;  3J7Y U;  2UZA A;  4K4V A;  2RT3 A;  2HHW A;  2B0G A;  5ETP A;  3DOK A;  4G1I A;  4MMO A;  1UJ5 A;  4I56 A;  2FJE B;  2E7V A;  2WK4 A;  1ZOT A;  1GH8 A;  2FDN A;  1T05 B;  3TUP A;  2NR0 A;  4RU9 A;  1RJJ A;  1DAX A;  4DCJ B;  5J2Q A;  2J8S A;  2Y8Y A;  1N5Q A;  1FRM A;  4BS2 A;  2VG7 B;  3LP0 A;  2PEH A;  3K59 A;  4A8W A;  2OEJ A;  1J5O A;  2QRR A;  5CZV A;  4YDX A;  2DR8 A;  4G65 A;  1QAX A;  3UVJ A;  3F44 A;  3TA0 A;  1NBE B;  2J9D A;  1WTF A;  2E5L J;  5KFZ A;  3R6L B;  3AB4 B;  1YJR A;  2O01 C;  2JX2 A;  1NPR A;  5AXL A;  4CNY A;  2QT7 A;  1HHS A;  3MFH A;  1VHI A;  4NYP A;  5GMK a;  3RG6 A;  3OSP A;  1SUQ A;  1KON A;  5SUH A;  1LWE A;  5GAD U;  2RQM A;  2ZH4 A;  4RW7 B;  5B0E A;  5HO4 A;  3PX4 A;  3O5T B;  1CQM A;  4KJI A;  4DSK A;  3MAQ A;  4KFB B;  3ENA A;  2PI5 A;  3BS9 A;  5HVH A;  2VON A;  1TL3 A;  2XY6 A;  3OFG A;  4DQP A;  2IRY A;  3LPE A;  3RR7 A;  1R3N A;  4M94 A;  2W2N P;  3U7J A;  1ZET A;  3TAP A;  3RGI A;  3D68 A;  1SH0 A;  3CC4 S;  1ELO A;  2OEK A;  1WC0 A;  2RH3 A;  3KK2 B;  2GIR A;  4D3H A;  3Q8P B;  4V19 X;  5C25 B;  1LWF B;  4GKJ F;  1MRO A;  2ZBI A;  3SDE B;  2EVZ A;  4CDI A;  4I64 A;  5EWE A;  5DG8 A;  2HLT A;  1VLY A;  2ZBQ A;  2IM1 A;  3THT A;  2DNL A;  1VC6 A;  1S1U B;  3AQP A;  3UCG A;  1HI8 A;  2GQQ A;  3V4M A;  2HHP A;  2FC8 A;  5HVG A;  1K1S A;  3BSO A;  3PX0 A;  4NLD A;  3LGN A;  4OYB A;  4JYA J;  2DEI A;  2M3D A;  2PDA A;  2AGP A;  3M1V B;  3PFE A;  2HGM A;  3M9N B;  1U1P A;  4QWA A;  1S10 A;  1B7F A;  3CDA A;  3D5M A;  1X4D A;  1EP4 A;  2HLU A;  3G8S A;  1IJE B;  1Z2L A;  2BQR A;  4PAA A;  3SCL E;  4OIX A;  2AJ4 A;  2UXB F;  4JI1 F;  4I0W A;  1GK8 A;  4K2X A;  4MTP A;  4O44 A;  1EJ7 L;  2ZNZ A;  2WVC A;  3DOL B;  1GAO A;  1DBD A;  2V4J B;  1SPB P;  3W2W B;  4C4W A;  1KQS R;  5L9X A;  2DXF A;  2L48 A;  1FNX H;  4JV5 J;  1C4C A;  3ET6 B;  1FE4 A;  4N8N A;  4P52 A;  4UY8 5;  2RUG A;  3NOG A;  4RUA A;  4DR7 F;  2FGO A;  4IRD A;  1U2C A;  3QLH B;  5DDP C;  4XDD A;  2QLF B;  1OO0 B;  2VQF F;  4LF6 J;  3CGI A;  3MUM P;  4NLV A;  3HZE A;  2L08 A;  5KFB A;  4JI6 F;  3JTN A;  3M8Y A;  4W98 A;  3TRG A;  1I5O B;  3HD1 A;  4J9S A;  2VFR A;  4KGZ B;  1VQ4 S;  3PM9 A;  2YKN B;  1E6Y B;  3CCT A;  4WZM A;  3SQG A;  1JLQ A;  3ZTQ A;  4PXB A;  2QMU B;  3DMJ B;  2CJ9 A;  2DHH A;  4AD6 A;  1VBZ A;  2J5A A;  1KBR A;  3EZ5 A;  3PVX A;  2CAJ A;  1EQ0 A;  5CYJ A;  2ERR A;  4C0B A;  3OT9 A;  3OL6 A;  4ZCL A;  5EUH A;  3T9Z A;  2EEY A;  4WFY A;  2DIU A;  5IQ6 A;  4NWB A;  3KG0 A;  3V6J A;  4GVB B;  2J6S A;  4J9K A;  5SZT A;  2H4Y B;  4HDG A;  3PX6 A;  2C1E B;  3BYR A;  2FLP A;  3V6D B;  3TAR A;  4K0K J;  3RRH A;  3KK1 B;  2W7A A;  2EG2 A;  4ILR A;  1NSP A;  2B51 A;  2B9Y A;  3AAW B;  5KFI A;  2JLE A;  2QA4 G;  5HJX A;  4DX5 A;  5CYQ B;  4RX6 A;  5B0C A;  2DNO A;  3IRX A;  2HWH A;  4QJV A;  4KHP F;  3M05 A;  3DU6 A;  2RRB A;  2CIM A;  3N79 A;  2H1Y A;  2PI4 A;  2CAD A;  4Q0B A;  1NAQ A;  3VAM A;  1JJH A;  1VHF A;  2ZC4 A;  4F2S A;  2B4O A;  5AXM A;  1UJ4 A;  5HP1 B;  5DGB A;  5F8I A;  1VBK A;  4OHW A;  3HHL C;  3EE3 A;  3LUY A;  2ZBC A;  3S01 A;  2HFZ A;  3I0S B;  4W92 B;  1RT6 B;  1CG2 A;  3BN7 A;  5LMU F;  1DTQ A;  4M5L A;  2L9D A;  1S1T B;  4P71 A;  4ID8 A;  2JLG A;  4C9D A;  2RE1 A;  5C42 A;  1JXV A;  2HFO A;  1DLO A;  1RYR A;  2V5H G;  2R2U A;  1FKO A;  4HR2 A;  3T5J A;  1CS4 A;  2VA3 A;  4E98 A;  2LDI A;  4N8O A;  2CDQ A;  4WTO B;  4AYB D;  4YFU A;  1X4F A;  3D1O A;  3NOC A;  1TR0 A;  1FKA F;  3TVY A;  1LNQ A;  1EX8 A;  1WAC A;  1L3V A;  2R7O A;  1WOS A;  3IM8 A;  3SSR A;  3NL0 A;  1RHQ B;  4O3P A;  1JKH A;  5IOL A;  1HWI A;  4DPO A;  3OTO J;  1WDD A;  4NLW A;  1V3Z A;  2F40 A;  3MUT P;  2VU5 A;  4ECX A;  5D0E A;  4KGM A;  2PO4 A;  4JI3 F;  4O0N A;  2DO0 A;  3CJ0 A;  5EDW A;  4NML A;  5KFQ A;  4DPT A;  2IMO A;  2M4M A;  1TKT A;  3DU5 A;  2Z2Z A;  4FPI A;  3GCW P;  3KKF A;  4YY3 F;  2HBY B;  4ZN1 A;  4QWE A;  2DGO A;  2XWX A;  5AXN A;  4LF4 F;  1WI8 A;  4Y2K A;  3LPY A;  3W8G A;  2OD4 A;  4DL4 A;  4EBD A;  4ZPA A;  2Q6B A;  2E9R X;  4K5S A;  1HBM A;  1W2I A;  5KFT A;  4HVZ A;  1GXT A;  1FDD A;  5ETS A;  4LRE A;  5ADZ A;  3ELH A;  3LTO A;  2A2D A;  3TR5 A;  2ZH2 A;  2JSX A;  3G86 A;  2NUH A;  2I8E A;  3BGF A;  5F8G A;  2IJR A;  4QZV B;  3H7H B;  2FPH X;  2IHR 1;  1RE1 B;  2QFI A;  2R9L A;  4B3T J;  2CPI A;  3P4U B;  5L1K A;  4ES3 A;  2DNQ A;  3GE9 A;  2VL1 A;  4NI2 A;  3FGV A;  4HTI A;  3AD9 C;  4FNH A;  1S1V A;  3DLE A;  3CJQ A;  2XZD B;  3KHG A;  3HLU A;  3D0G E;  3GV8 B;  1RAD B;  2EFO A;  1N5T A;  4Y2C A;  2GHP A;  2A2C A;  2KO1 A;  3U1N A;  1BQM B;  3KHH A;  1XR6 A;  1SQE A;  5RUB A;  3K57 A;  1LV5 A;  1YIJ S;  4J37 A;  4XTT A;  2Y0B B;  4QIV A;  3QJP A;  4LRA A;  3G8T A;  4DR2 F;  4X65 F;  1NK4 A;  4FKX A;  4KY3 A;  1VQN S;  3H4B A;  5LMN J;  4OZ5 A;  2PSZ A;  5LM7 E;  2YNF B;  4I2Q A;  2Q1L A;  3TOQ A;  4WZQ A;  1R8C A;  4UOG A;  3ILI A;  5KFC A;  3LGM A;  5E3R A;  4X4O A;  1PAU B;  2BW7 A;  4O3Q A;  4QBU A;  5AJ3 F;  5B0B A;  3MM7 A;  3MOZ A;  1TKZ A;  2JDJ A;  3M4X A;  4B9L A;  1X4C A;  5HRO A;  1FDB A;  1PO6 A;  4DL2 A;  1SH3 A;  4ED4 A;  2QZ8 A;  2SXL A;  3FZB A;  1CJV A;  4WF9 Q;  5J2N A;  4JI4 J;  4EU0 A;  3M8S A;  3OV7 A;  1ULR A;  1P1T A;  2YPY A;  2IC3 A;  2WCX A;  3NS6 A;  2ZWP A;  1V5V A;  2Z57 B;  3QBC A;  4DV0 J;  4C3L A;  3O2I A;  3AXK A;  5HQM A;  3V4I B;  5DZ7 A;  1SL2 A;  4LR8 A;  2N7C A;  1VIS A;  1HNV B;  2LU1 A;  4O0I A;  5EGY A;  2DVI A;  4WKY A;  1RAJ A;  3LWL A;  1IBL F;  3A8K A;  4OYM A;  4A8M P;  2ZDP A;  1F3V A;  4X66 F;  4OX9 J;  5DJB A;  1X4E A;  4ECU A;  4IR9 A;  4DR4 J;  4E8U A;  2V9K A;  3M6U A;  2WVD A;  2VAS A;  2V2V A;  3A1Y G;  2BZ2 A;  1U8S A;  4QCL A;  1V9O A;  3PJ9 A;  2CZV C;  2ZVS A;  3KK3 B;  3MM6 B;  3AQO A;  1CVJ A;  4F67 A;  5KFE A;  4HL9 A;  3V6H A;  5T41 A;  1RB0 A;  4YHH F;  4RNF A;  2BJ9 A;  3CJ5 A;  2R7W A;  1YTY A;  1XNQ J;  2CWX A;  2E66 A;  2HAF A;  2CRL A;  3JYT B;  1ZPV A;  2FC9 A;  2A0F B;  5A6P A;  3G6Y A;  2YNG A;  5BXI A;  3AJ2 A;  4DN9 A;  2XSF A;  2XO7 A;  3FC9 A;  1TUV A;  4R0J A;  1TL4 A;  3TZW A;  2IRX A;  1LWC B;  4U7U D;  2ABY A;  2P5V A;  3K5N A;  4DV2 J;  1WHY A;  4UZC A;  5FD1 A;  3B54 A;  1S1X A;  1X5S A;  4CH1 A;  1JJC B;  3DLK B;  3AFG A;  1HNZ J;  3KJF B;  1U1Q A;  3C8Y A;  3Q0A A;  5IXU A;  2F9D A;  1IUJ A;  2CG8 A;  5GAE I;  1ZAW A;  2W2O P;  3K2Y A;  4BHQ A;  3LQV A;  3M2V A;  4B3S J;  2RKI A;  4NYZ A;  1WI6 A;  3KJV A;  1NK0 A;  3NS7 B;  4DQQ A;  1N8R T;  4QYZ J;  4TQS A;  4AXJ A;  1YRU A;  9ATC B;  2VBW A;  4LBI A;  4H4O B;  1TU0 B;  1RXO B;  4P2F A;  4DV3 J;  1Q7Y T;  2V8G A;  2W2Q P;  2W9C B;  5B08 A;  2CVI A;  4K4T A;  4NLR A;  2B4P A;  2XCP A;  2L41 A;  2MLZ A;  4DEZ A;  1T7P A;  1TV6 A;  3UDL A;  4RW6 B;  2KT3 A;  1HI1 A;  4B3O A;  1N34 J;  4H4K C;  4YB5 A;  4F4K A;  3GFX A;  1FRL A;  4CYU B;  3S7R A;  2F5G A;  5ITH A;  4N76 A;  3H8Y A;  1SJ1 A;  4ID5 A;  1T0T V;  1XEZ A;  1NZA A;  1B70 B;  1VRT B;  2O3D A;  3ITH A;  5LJ5 Y;  2XY7 A;  5KFD A;  2CNL B;  2VBY A;  2OAU A;  3ZFV A;  1S7H A;  2KZM A;  3BPS P;  4RR5 A;  2ZD1 A;  1XNR J;  2XMK A;  2KFN A;  2Q43 A;  1NUE A;  2FGC A;  1BUX A;  3QRQ A;  2HQD A;  3WBZ A;  2YKQ A;  4WFX A;  4P10 A;  1C1B A;  4RJV A;  4DSF A;  5LT5 A;  3C6U B;  3CCR S;  3QID A;  4KH0 B;  1WKJ A;  2V8D A;  4P2M A;  4G3I A;  2AMC B;  1N36 F;  1JLE A;  4YQW A;  1FXD A;  5DDO C;  3TAQ A;  2HMI A;  1WNE A;  2AJ0 A;  3PDN A;  2LMI A;  3EXC X;  3J7A 1;  2G1H A;  3DHW C;  1N54 B;  4BLG A;  2DR5 A;  9RUB A;  3JSM B;  3I96 A;  1H73 A;  1FA0 A;  1LEO A;  3DNC A;  4X4S A;  2XSJ A;  5ETT A;  5CXT A;  4KQZ A;  5DET A;  2E9T A;  3D54 A;  4PG5 A;  1W7W A;  4A8O A;  3OW2 R;  4TYB A;  1UWB A;  4ZVO B;  2J6U A;  1YVF A;  2JLF A;  5HQL A;  2MKI A;  2V50 A;  3QZ7 A;  4F0M A;  2H48 B;  1S99 A;  3CD5 A;  4MFB B;  2RB7 A;  1U48 A;  1WEZ A;  4YB1 P;  1FKP A;  4N77 A;  4OYX A;  5C2G A;  2GMH A;  2ZH8 A;  3R27 A;  1RT4 B;  2EI5 A;  2QL5 B;  5B0F A;  3JS9 A;  1BWE A;  3W62 A;  3F41 A;  1I94 F;  2OPR A;  2LEA A;  3MAH A;  2JEG A;  2W7P A;  1U1R A;  3MD3 A;  2OPP A;  4USV A;  4A4J A;  3THP A;  2Y1J A;  4DJB A;  5F9L A;  1HBN B;  1LFW A;  4NEY A;  3FEX B;  2HWT A;  1FX4 A;  2MKS A;  1AFJ A;  1B64 A;  3ENV A;  1H6K X;  4QYR A;  5H9E K;  1ICE B;  3HSJ A;  1RYS A;  3NY0 A;  3QT8 A;  2YKP A;  4EYH B;  3W66 A;  3KLE B;  3UDE A;  2G2Y A;  3J81 Y;  1VQS A;  2F7V A;  1IBM F;  1FWK A;  3QYY A;  1FNO A;  2XC9 A;  1WC4 A;  3GIJ A;  3UFC X;  2BUN A;  2HS4 A;  2MQ8 A;  1S97 A;  5L1L A;  1P27 B;  3HVR A;  1U26 A;  3MAA A;  4Y6I A;  3IA0 A;  2OUG A;  1AFI A;  2CPF A;  4ZPB A;  3Q2S C;  3MEE B;  1SJF A;  3OR1 B;  5GAG I;  1CSJ A;  4DFJ A;  3BZQ A;  3RAQ A;  3GYN A;  4M5G A;  3KMS A;  2FVS A;  4J9L A;  3DCA A;  2Q79 A;  3QPI A;  4DUZ F;  2HK3 A;  1UVM A;  4ZKA A;  3G87 A;  4B3M J;  4OHZ A;  4LF7 J;  2F8E X;  2V34 A;  2EC0 A;  3AOD A;  2VH7 A;  1P9Q C;  2FJB B;  3BQ2 A;  3N0V A;  3RBE A;  1SJQ A;  1VRU B;  1P8G A;  2VKZ G;  2EWH A;  1TL7 B;  5HJY A;  2KYX A;  2R7S A;  1WSR A;  1N32 J;  2VFU A;  4Q43 A;  5EHH A;  2AZ3 A;  2UU9 F;  3KTQ A;  3L95 X;  3N6M A;  2AEM A;  1Q1K A;  2CPE A;  1KVI A;  1FFS B;  4KPY A;  1J2V A;  2B8P A;  2IDE A;  5D8H B;  4DUY J;  3KFW X;  1MU2 A;  1S0N A;  2UXD J;  3W60 A;  4YUD A;  3FRZ A;  2HS3 A;  4DV4 F;  2NPF A;  2D9P A;  1B0V A;  4O4G A;  5E7O B;  1BY9 A;  3MWB A;  5A2Q U;  2BYC A;  4JBC A;  2EW9 A;  5BJR A;  1J5E F;  1NHK L;  2G2O A;  3CCU S;  2CVE A;  5H9F J;  2C2R A;  1U6Z A;  2X1F A;  4UST A;  1TFW A;  1LWX A;  4JI5 J;  3CE8 A;  1UJ6 A;  5IQQ A;  2G0C A;  2WRM A;  3MCM A;  1S0V A;  2FB0 A;  3MCO A;  3NNH A;  3M2U B;  5F9N A;  1U1N A;  2W24 A;  2CDR B;  1Y5N B;  5GAH I;  1TL5 A;  1T3O A;  3H40 A;  1FNM A;  1GMW D;  2QG9 B;  3HSD A;  1KOO A;  1N6Q A;  2BW2 A;  2MSS A;  4E0D A;  1FK9 B;  1JLF A;  2VOO A;  3I4H X;  5D77 A;  1DQ8 A;  2X1A A;  4KKO B;  2RNE A;  1P6T A;  1HQE A;  2KG0 A;  5C24 B;  1YBU A;  1X5T A;  3AOC A;  1RKJ A;  3CCS S;  2BAN B;  2F4V J;  3JXO A;  3POT A;  4F3M A;  1GXU A;  2EC2 A;  2UUA F;  3K5M A;  4O4R A;  2HHH F;  3DRR A;  3PZP A;  3FBF A;  4TNO A;  3QT5 A;  1SQF A;  4OFZ A;  3D28 A;  3QFH A;  2ZIT A;  1YSJ A;  1UEK A;  4DFP A;  1IKV B;  2VQE J;  1Z2Z A;  1RT2 A;  2P9E A;  3HHL A;  3QT7 A;  5LOQ A;  1HNX F;  4ZVF A;  2VF3 A;  4PAB A;  3WHI A;  5HBM B;  4WFN Q;  1YQH A;  1SCJ B;  2DH7 A;  3BDP A;  2IVY A;  4UOH A;  4OI3 A;  3I55 S;  4Z7Y A;  3NLC A;  4V19 J;  3LAN A;  5GVQ A;  5KT7 A;  1S76 D;  1WOR A;  4CM0 A;  1H2U X;  4CLT A;  2GGP B;  3G8Q A;  1WEX A;  3OTC A;  2K7K A;  1F5C A;  3BJY A;  2AEF A;  3LGH A;  3CCZ A;  3OUY B;  3MGJ A;  2CNO B;  4Q44 A;  1S1W B;  4RW9 B;  2E1P A;  2UVR A;  2ASJ A;  3GP9 A;  2AQ4 A;  4PQU B;  4AL5 A;  2VPZ B;  3L4B C;  4M8L A;  1HPZ A;  3I32 A;  2MJN A;  1RAG B;  4OHY A;  2QA2 A;  2ZZN A;  3GQC A;  2AP6 A;  3FSY A;  2IFX A;  2QJ3 A;  3AB2 B;  2ZNY A;  5KG6 A;  2YNI B;  4TN2 A;  3MM5 B;  4NA1 A;  1VDH A;  4R8U A;  3MUR P;  4X4P A;  3QSI A;  2O67 A;  2PD1 A;  5C25 A;  1T9X A;  3OTD A;  5IWA J;  1OY6 A;  1WEL A;  4ZCM A;  2BX6 A;  3PKM A;  3J7A N;  3OFH A;  1REV A;  1VBY A;  2VDH A;  4CLZ A;  4ZDN A;  3UD3 P;  3KLI B;  3MTK A;  1S4E A;  1L3T A;  2OEM A;  4C48 A;  2AYG A;  2ZOM A;  3HX9 A;  3T41 A;  1NH8 A;  2LLZ A;  2UVV A;  3N5B A;  5ETR A;  2FZK B;  3I82 A;  5IT9 Y;  1SJ4 P;  3EUN A;  2WVE A;  1JJ4 A;  2YQ0 A;  4HHJ A;  3CT9 A;  2YQ3 A;  3IXQ A;  1VFJ A;  3NGS A;  3MDF A;  1WC6 A;  2E9Z A;  4WU3 A;  1CC7 A;  1M90 T;  2E29 A;  1FRI A;  1OQ3 A;  2EKN A;  5KT5 A;  3HPO A;  2NSB A;  1RT3 B;  3GFH A;  1PGZ A;  3EGN A;  2OPS B;  2ZJP Q;  1VMB A;  4IOA Q;  4LRB A;  2XM3 A;  4PUO B;  1T9Y A;  3AD7 C;  2DEJ A;  3PHT A;  5KFH A;  2JHE A;  3CF5 Q;  2HBZ B;  1HWU A;  2Q6C A;  3IGV A;  4TLQ A;  3NGD A;  3DXB A;  1WHV A;  3L9Z A;  3HT0 A;  4I4B A;  3MM9 B;  2AKW B;  2EPI A;  2VG5 A;  4DCP B;  2DNM A;  1WDT A;  5ETV A;  3BO3 A;  5D0R A;  1LW2 A;  2IPO B;  3Q8R B;  2VJV A;  2EG1 A;  1XC9 A;  3NEK A;  2W9B B;  2GML A;  4UOC A;  1SVD A;  4EI2 A;  1VIX A;  2MZ1 A;  3MMB B;  1RCO B;  4NA3 A;  4IQX A;  2CJK A;  2FTR A;  4C8L A;  4OZL A;  3IFE A;  1WWH A;  1SL0 A;  4LJM A;  4X4N A;  1S48 A;  2ZH7 A;  3R1L A;  1PJ5 A;  2RF2 B;  2IA0 A;  3JTO A;  1S6P B;  4BBY A;  3W61 A;  2R8K A;  4IH7 A;  3MMC B;  4NE9 C;  3A8E A;  1RAA B;  4KIA A;  5IFM A;  2VFS A;  2JOQ A;  1S6Q A;  2R3V A;  1N5S A;  3EMT A;  4FF1 A;  5LSL A;  2YY3 A;  2A3J A;  3NCR A;  1KP6 A;  5D4O A;  3G82 B;  1MWQ A;  4O3O A;  2ZHB A;  1QAI A;  3RB6 A;  1I3O B;  3H5X A;  1NB2 A;  3KLF B;  4LF9 F;  2RS8 A;  3BYP A;  1LFP A;  4RW8 B;  1W26 A;  2YWW A;  1OWX A;  2V94 A;  3HHE A;  3JQJ A;  3C14 B;  4TY8 B;  3GR0 A;  5K9F A;  2LQ5 A;  4UY8 T;  2CQ3 A;  3I6P A;  1MWY A;  1HQU A;  4RNO A;  4ZVR B;  2WW8 A;  2WOM B;  5MAO A;  2HNZ B;  3KG4 A;  1CPZ A;  2BJ7 A;  1HBO A;  4EO6 A;  2IRU A;  2QIF A;  4AND A;  1CJK A;  2NXN A;  2XI2 A;  2KXN B;  4LSZ B;  5KG5 A;  4DSJ A;  3KLG A;  2MLX A;  1K0T A;  1OS5 A;  3NCP A;  2W7O A;  3DXS X;  4B02 A;  3DRP A;  3S8S A;  1LQ9 A;  4U95 A;  1RU1 A;  4DS4 A;  1HIY A;  3DYA B;  2JJ4 D;  2EBG A;  3IS9 B;  4ED2 A;  4DQR A;  3TZX A;  1PYS B;  1WHX A;  3W64 A;  1RWM B;  4IO9 Q;  1NHV A;  1RAH B;  4DUT A;  3PO5 A;  2FVC A;  3MPD A;  5DQI A;  1U1K A;  1F6T A;  2HZV A;  1NK7 A;  3M32 B;  3FNN A;  1LXJ A;  3PW7 A;  2ASD A;  2QL7 B;  2DPI A;  4Q45 A;  3SEO A;  1RBA A;  4WYL A;  3G9C A;  1TMJ A;  3P3D A;  2YWF A;  2C2E A;  2RHS B;  1MWZ A;  5B0G A;  5HQ8 A;  3Q83 A;  2QGF B;  1UMJ A;  3VF0 B;  1EKS A;  2HQG A;  3GYX B;  4Y3C A;  3WDO A;  5F3T A;  2RUS A;  1NDK A;  1RHJ B;  1B0T A;  4I68 A;  2B4V A;  1SH2 A;  3PYF A;  1G7C B;  1H98 A;  2M9K A;  3R2D J;  2YPZ A;  4OZ1 A;  5DDQ C;  2P8I A;  3K7R A;  4J9U E;  4ZHR B;  3H42 A;  4OX8 A;  4AL6 A;  1CBK A;  4MIW A;  2RVJ A;  1WOP A;  4A8X A;  4EZ6 A;  4LF5 J;  4RNN A;  4NCB A;  4A8Y A;  4F4A A;  3HFV A;  5CAA A;  2B56 A;  1VQ6 S;  3GYG A;  4P72 A;  4ZVE A;  4UW2 A;  1T9V A;  3LO3 A;  4LF8 J;  4IRC A;  3MHY A;  5KFM A;  1HHT P;  1BQN B;  2W4P A;  1F2G A;  4LSN A;  2NPI A;  2UXC J;  3PR4 A;  1UCN A;  4H4K A;  1VQM S;  3SSS A;  4P2S A;  4EBC A;  5J2M A;  4DL7 A;  1RZM A;  3OXL A;  5G0R A;  1L3S A;  2J9C A;  1X4G A;  2XMV A;  4C11 B;  3IBF B;  1T03 A;  1LKZ A;  1CJU B;  4DX8 H;  2OIH A;  2C3M A;  1HQ2 A;  2J9D E;  3W2V A;  5DG7 A;  3CB4 A;  2CJB A;  2YKM B;  4ECZ A;  3JQM A;  4C8M A;  3M8Q B;  3TAM A;  3HSG A;  4KC5 A;  2WON A;  3TA2 A;  1R8H A;  5BYR A;  2FVQ A;  1GNK A;  3OR2 A;  1JLB B;  1IR2 A;  4IFY B;  4M5J A;  4CI0 B;  3IRW P;  1VK3 A;  3PJX A;  4W90 B;  1NK6 A;  4QIE A;  1TZ0 A;  2DR6 A;  1ARO P;  2PE8 A;  1D3W A;  4WTY A;  4ZPD A;  5D3G B;  2GJF A;  3AH6 A;  3KHL A;  1U2F A;  3FRY A;  4DV5 J;  2HFS A;  4MKV A;  4C6A A;  3GZ7 A;  2MQL A;  1Y00 A;  3EYZ A;  3HVT A;  3QWP A;  3C19 A;  3GR1 A;  4RLE A;  1HBU A;  2ZZM A;  3W9I A;  4JP8 A;  4K5R A;  2ZJQ Q;  1PYT A;  1HR0 F;  2QMX A;  1MN7 A;  3W9H A;  1X9S A;  3D4J A;  2I5J B;  4BWJ A;  2VHG A;  4FP9 A;  5I42 A;  1S72 S;  2XLK A;  2JEI A;  2PII A;  1M1H A;  2I9S A;  4DG1 A;  3RJM B;  4HLB A;  1RA6 A;  2ZHO A;  2JWN A;  4MIB A;  4PG8 A;  3L7O A;  2A18 A;  1RSC A;  5HMZ A;  2ZM6 J;  1R6V A;  3UN5 A;  2Y1R I;  3BSC A;  5C5J A;  4BC9 A;  1VBX A;  2Z30 B;  3WIV A;  4DR5 F;  3BBB A;  1RT5 B;  3N9U C;  3Q86 A;  1LXN A;  4C8K A;  3HZG A;  2AGQ A;  1YJN S;  4USW A;  2DRB A;  5A8R A;  1BGX T;  4DU8 A;  3B4M A;  1F9H A;  1WUU A;  4TU7 A;  3CD0 A;  2BKN A;  4HH1 A;  3T1H J;  1MSW D;  2OHD A;  2XG8 A;  1F60 B;  1YBT A;  4OYO A;  4NLQ A;  1N5V A;  2LEC A;  5KFK A;  2KM8 B;  3RYL A;  4ED7 A;  1OPZ A;  1TL1 A;  2B5J A;  4EZ9 A;  1D9D A;  1TEL A;  1KLM A;  3KLV A;  4A8F A;  2HVE A;  3PYD A;  2CQP A;  2YX7 A;  1UVK A;  3GB0 A;  1NPK A;  5HL7 Q;  1S59 A;  1RU2 A;  2PC6 A;  2XWY A;  3ZC4 A;  4B9S A;  1CQN A;  1AB8 A;  4BCA A;  3ENW A;  3KJQ B;  4A48 A;  3OL8 A;  2GMJ A;  5KOW A;  1H74 A;  2DD8 S;  3HD2 A;  1VQY A;  2HRT A;  3SFG A;  1CJT B;  1LWC A;  4B3R J;  3RAM A;  1LOU A;  3EPG A;  4J91 A;  5I3P A;  4Q8F A;  2B9X A;  4WII A;  1I1G A;  1Y7P A;  4DF4 A;  2XBP A;  1R8A A;  2XUL A;  3DC2 A;  1N48 A;  3VGU A;  4PPD A;  2V2Z A;  2DO4 A;  1FWL A;  4NLS A;  3HXM A;  1WTB A;  4NXM J;  4ZVP B;  2E44 A;  5IT4 A;  3QIP A;  3VZI A;  2K2P A;  1JJ2 R;  4Q8E A;  4QYZ K;  4Q2L A;  3PW5 A;  4IRK A;  1UA0 A;  2RQ4 A;  3Q8Q B;  1FF2 A;  1V6H A;  3FFI A;  1OPI A;  2QA4 S;  1RAE B;  4CNZ A;  2HNY A;  4ECT A;  1YK9 A;  4OYW A;  4CLF A;  2EKY A;  3D0I E;  3VAL A;  5F8J A;  3MPW A;  1RTD B;  2OKQ A;  2DHX A;  1HMV B;  5J1E B;  4KGV B;  1XNQ F;  3V81 B;  1TQL A;  3FBB A;  3TVK A;  1VRQ C;  4L76 A;  5IS2 A;  3R8Y A;  1NK5 A;  5L39 A;  4K4Z A;  5IV3 A;  2YWK A;  2RIL A;  2Z2M A;  5KG7 A;  3HFZ B;  3N6N A;  5HLF A;  2QLB B;  3D3B J;  4RBV A;  2ALZ A;  3PEH A;  1J27 A;  2CPJ A;  5JJB A;  2ILZ A;  2V4R A;  3SYZ A;  4KE5 A;  3NGU A;  3WIU A;  4F4Y A;  2B6A B;  1VRT A;  4ITS A;  2LXI A;  2DRA A;  3NGT A;  2AYE A;  4RUB A;  1E6V B;  3CMA S;  3D67 A;  3MMA B;  4ZPT R;  3EIC A;  2ZH5 A;  1ZYQ A;  2VOP A;  1OQ6 A;  5M2R A;  3DM2 A;  5KT3 A;  2Z0G A;  1K1Q A;  1UW9 A;  3SBM A;  4GVL A;  2DYA A;  1ITP A;  4WYW A;  2BAC A;  3PW2 A;  3NGK A;  2DR9 A;  2UUW A;  5T7L B;  4CLU A;  1IR0 A;  3UW1 A;  1C0T A;  1P1L A;  1ROF A;  2JFD A;  3BSA A;  2DIT A;  1Q78 A;  3OLA A;  4CTA A;  2WSE C;  3DOK B;  3CCE S;  1S6U A;  5FLX U;  3CCJ S;  1PAE X;  1UEU A;  1RA7 A;  2AF6 A;  3NMA A;  4CO3 A;  4NPO A;  4OHV A;  5K8P A;  4L72 B;  4WU2 A;  3BGR A;  3GON A;  2ASL A;  3TYT A;  5J2Q B;  2VPX B;  3HHN B;  2OI2 A;  3CIM A;  3TO8 A;  1SJ3 P;  4AE5 A;  3LP0 B;  4KV8 A;  3SV3 A;  4KYZ A;  3RB4 A;  4F3Q A;  4J9M A;  3RW6 A;  4GKJ J;  4R25 A;  1J5O B;  3MED A;  4LRF A;  3UVJ B;  1VR6 A;  1TP7 A;  3GSI A;  4RWX A;  1VQP S;  3AOA A;  3R7B B;  3P49 B;  2QEX S;  4RNH A;  1VS3 A;  3MTJ A;  2ZFH A;  4QIG A;  1SKU B;  4BDP A;  5E3Q A;  3PYE A;  4L74 A;  5KG4 A;  4K50 A;  4HT7 A;  1SUQ B;  4F26 A;  4DV1 F;  3ISN D;  4ILM A;  1LWE B;  4CLL A;  1WHW A;  3BQ0 A;  1NME B;  4M5D A;  4OI2 A;  2BJ8 A;  3W5X A;  2IBO A;  2CQ1 A;  2DNN A;  2DH8 A;  3T1Y J;  3I56 S;  1ZZN A;  1TL3 B;  1CLF A;  4Y00 A;  3LAL A;  3LW5 C;  3PW0 A;  2UXB J;  4JI1 J;  4LF2 A;  2HBQ B;  3M30 A;  4UUW A;  3V6K A;  4CLS A;  2R7X A;  3FSI A;  2LA6 A;  4OYP A;  3GG0 A;  4ED3 A;  3BKU A;  3KNG A;  1NDL A;  4UOF A;  4DL3 A;  4OV1 A;  2MXY A;  2YH1 A;  3KJN B;  1MRO B;  3H2L A;  3CED A;  1U4B A;  1LK7 A;  4MK7 A;  5ETM A;  4CLY A;  3AJD A;  2GIF A;  2CPZ A;  4DR7 J;  1Y5L B;  2V67 A;  1KQK A;  3M8Z A;  3UR3 C;  1G6B A;  1O0P A;  2VQF J;  1DZ5 A;  3CCW A;  3PNI A;  1K73 T;  1N5Y A;  1VQ8 S;  1RIS A;  4JI6 J;  1UVJ A;  4PWD A;  2L9N A;  2VIC A;  3MEE A;  4P7T A;  1RI7 A;  1IQT A;  1SC4 B;  1M5P C;  4URG A;  4OZJ A;  2XMM A;  3ZTS A;  3CNQ P;  4NXN F;  2OFH X;  3WX4 A;  1TMM A;  3Q8V A;  2E1A A;  1RTZ A;  4PYD A;  4DX7 A;  3PRD A;  1NB7 A;  3T9N A;  1EP4 B;  2DR7 A;  4ICL A;  1L5U A;  3QSY B;  3H5S A;  3C15 A;  1VRU A;  3R5B A;  2HHX A;  3IMQ J;  1XJW B;  2X1B A;  5L46 A;  5HI7 A;  4KR0 B;  1KFS A;  2HVZ A;  2J7K A;  4O44 B;  1H0H B;  3G96 A;  2FJW A;  3CW2 C;  5KFG A;  3DLJ A;  3L09 A;  4MKA A;  5L1J A;  3OTB A;  4WFA Q;  1C4A A;  2ZH1 A;  2D3O 1;  2CQI A;  2WHO A;  4ETX A;  5J1N A;  3K0J A;  2R2R A;  2W2P P;  2KXH A;  2R8H A;  4NCG A;  1S79 A;  3KG1 A;  2NXU A;  1L3U A;  4KHP J;  1JK9 B;  3RB3 A;  5K20 B;  1JLC B;  1KWM A;  4JI7 J;  2M8D B;  1NO8 A;  4KH1 B;  1SI9 A;  4PYA A;  5D4P A;  2QSF A;  4ZLJ A;  1YJV A;  1QSS A;  1TVR A;  2I2Y A;  2CJX B;  2YNH A;  4Y34 A;  2KVQ E;  3IWX A;  1MN9 A;  5DZ6 A;  5H9F K;  4ZJQ A;  3SQG B;  2HZC A;  2NZ4 A;  1JLQ B;  4NLP A;  2WB1 D;  4LRD A;  3TAN A;  1FRH A;  2M2B A;  4DZ6 A;  5LMU J;  4TVA B;  4LUB A;  3D6M B;  1KLN A;  3TEH B;  2O5D A;  4B08 A;  3J80 Y;  3HVW A;  2ZOF A;  1V5I B;  3M2U A;  1XR7 A;  4ZPC A;  3M7V A;  4B9T A;  1UZH A;  3BF4 A;  4ED1 A;  3ETM A;  4LFB F;  3BEG B;  2GIQ A;  1Z4U A;  4WXW A;  3HJV A;  3BV8 A;  5AE3 A;  4Z37 A;  2AJF E;  1EB0 A;  1QVG R;  2MHE A;  3CPW R;  2CYY A;  1JMT A;  4MYT A;  2FHM A;  1NJW A;  1HHQ A;  1FER A;  1IKX A;  3HF5 A;  1N0U A;  4IUF A;  4DPU A;  5JXS A;  2V0N A;  2GJI A;  4DUY F;  5IT0 A;  2P6T A;  3QT6 A;  3HKZ D;  3IRX B;  4X84 A;  1IBC B;  3ILL A;  2L9W A;  3MPV A;  3KYL A;  5AT1 B;  2UV8 A;  1DJ0 A;  2LQJ A;  1KVJ A;  3CUL A;  1ACM B;  1K8A T;  2R7V A;  4LQ9 A;  4Q0B B;  2HHT A;  2ADB A;  2ZJR Q;  1Y10 A;  1B0P A;  2U1A A;  3HI9 A;  5CD4 H;  3CXC R;  4L73 A;  2FHJ A;  3M8P A;  1QLN A;  1UWA A;  2LQ8 A;  3CD7 A;  1TK8 A;  4GRS A;  4JI0 F;  4YY3 J;  2W25 A;  3DLH A;  4CQ1 A;  1DTQ B;  4Y65 A;  1X8D A;  5HBM A;  2FJA B;  4RZR A;  3D1H A;  3B8H A;  1JQG A;  2JC0 A;  4J9V A;  2JZ5 A;  3ZZP A;  5C42 B;  3HT3 A;  2YXL A;  1FVS A;  1FKO B;  4I2P A;  1NSK L;  4OLO A;  1K9M T;  1CS4 B;  4IH6 A;  3FCH A;  3P6Y C;  2CWK A;  8RUC A;  4YN3 B;  4CO2 A;  4CP5 A;  4DV6 F;  3PJW A;  3NXZ A;  1RWX B;  3TA1 A;  4FPR A;  1XK8 A;  3D2W A;  1S9E A;  1JKH B;  5AXK A;  4EO8 A;  1RAC B;  3VAJ A;  2X51 A;  4ECS A;  3PEJ A;  2P2C B;  2E5G A;  3OQ2 A;  4IO1 A;  2MMY A;  2K1R A;  2YNI A;  2F1F A;  1YDL A;  2XZW A;  4X62 F;  3MM8 A;  1AUD A;  4WE1 A;  3HDS A;  2W8L A;  1VQK S;  4FVM A;  2VQE F;  2CPD A;  2HG4 A;  1QTN B;  2FYX A;  1TKT B;  2PMH A;  3BGU A;  2YKO A;  1OSD A;  3MI7 X;  5E3P A;  4Q2M A;  4P74 A;  1IBK J;  3CUN A;  2K3I A;  2VOD A;  3T5H A;  1UFW A;  3QGP A;  1ZAX A;  5M2U A;  3QGI A;  4DR2 J;  4X65 J;  2HFN A;  2DIV A;  2V8V A;  2X3G A;  3VV2 B;  1HBM B;  1Q8L A;  2FJX A;  2ZKU A;  1T3N A;  2HND A;  1KHV A;  3M9M B;  3RBX A;  2BRK A;  4CO4 A;  3AJ1 A;  2HHU A;  3NAH A;  3NS5 A;  1C1C A;  5KFF A;  2IM0 A;  2H65 B;  4KTQ A;  3LP1 A;  5AJ3 J;  4B17 A;  2DGS A;  3DLG A;  4GC6 A;  3H5U A;  4ZP6 A;  1X5O A;  4LFC F;  3TJA A;  2WTF A;  3W5Z A;  2AW0 A;  1SC1 B;  4NI2 B;  4WXO A;  4YR3 A;  1S1V B;  2CA9 A;  1AZS B;  3DLE B;  4PXD A;  2ZE2 A;  1U24 A;  2CQH A;  1NSQ A;  1VC5 A;  1MML A;  3KLH A;  1FT8 A;  5FDL A;  5GME A;  5HMX A;  1U0S A;  1NPP A;  1YZ6 A;  1D9A A;  2WBR A;  2ZH6 A;  3QNW B;  2BR0 A;  4RPF A;  3TW0 A;  3I5B A;  4IKA A;  1IKY A;  3CO0 P;  3L7P A;  2V63 A;  1IBL J;  3SFU A;  3HKW A;  3F73 A;  2D7S A;  4I2Q B;  4J9P A;  5ETO A;  2OJ3 A;  4X66 J;  2NZC A;  1PIE A;  2XMJ A;  2J76 E;  1DFD A;  5D4L A;  2ATC B;  4DBQ A;  2AJ1 A;  1R0B G;  4B9U A;  2C3U A;  5HVF A;  3QZ8 A;  2DY1 A;  3GSD A;  3NP5 A;  3T5K A;  3H5Y A;  3HHK A;  1PCA A;  3MM7 B;  1SIW B;  1TKZ B;  3W8P A;  3IO1 A;  5HRO B;  4ECR A;  1VQ5 S;  4DV7 F;  3WC2 A;  4HKQ A;  1NJZ A;  3OD2 A;  4CLW A;  4YHH J;  2LQ9 A;  5CCL A;  5CYM A;  2LVW A;  3OVS A;  2GC8 A;  4H4M A;  1CJV B;  4A8Q A;  1KOH A;  2HK2 A;  2UV8 G;  5CHC B;  2FD2 A;  4IH5 A;  1X4B A;  3PR5 B;  4X64 F;  2IC3 B;  4ZOS A;  4JV2 A;  1U02 A;  4M5M A;  1BD6 A;  4TU9 A;  2I38 A;  3IWN C;  4HYK A;  4ZVH A;  2JVR A;  3LAK A;  1U0H A;  2EK6 A;  1YRT A;  2AHO B;  1S5Z A;  1RWN B;  4RBT A;  3AHP A;  1RTH B;  4F0K A;  5KFV A;  2OML A;  5AE1 A;  3MR7 A;  1G3O A;  3RTV A;  4ZS6 A;  2GVZ A;  2NRE A;  5F0W A;  2HYI B;  4G1Q A;  2RD5 C;  2DB1 A;  1PSD A;  2P6S A;  3FQL A;  3MZI A;  3UDV A;  5E2Q A;  1RCX B;  4ZIW A;  2EFQ A;  3SMZ A;  5B0A A;  2H5J B;  3BR8 A;  3R7N B;  4LFA F;  2IBK A;  1Y11 A;  5AE2 A;  4PEO A;  3PYG A;  4TQR A;  4RUH A;  3G4S S;  2RAQ A;  1AUS L;  1K0V A;  4WFB Q;  1XMQ F;  2LXU A;  2RSQ A;  1FD8 A;  1WEY A;  2YNG B;  2C2Z B;  3CVK A;  3IR5 B;  4FXV A;  4DSI A;  1O5J A;  2FY8 A;  2GHW A;  3DI6 A;  4F7V A;  3CJK A;  4ECQ A;  3UD4 P;  1BQX A;  2FHK A;  1VQL S;  2BE7 D;  2D41 A;  1S1X B;  3KWM A;  4DL6 A;  2KU7 A;  5K14 A;  1EAY C;  4UT4 A;  4P6Q A;  1NKB A;  3DDK A;  2VV5 A;  5H1S V;  2RQK A;  1MW7 A;  3OL9 A;  5D15 A;  2XMU A;  4DDF A;  4WJB A;  5DG9 A;  4YR2 A;  5JVH Q;  4DR6 F;  3M2V B;  4NEZ A;  3DRS A;  2RKI B;  2PEB A;  3KJV B;  3C3L A;  2R2S A;  1BE4 A;  1Q5Y A;  1W25 A;  4HHU A;  3NBP A;  2MHN A;  2KL8 A;  2CPY A;  1N36 J;  2I0X A;  2IA6 A;  3W3S A;  1OIA A;  3D9B A;  3W1Y C;  4OMF G;  5KG1 A;  3E01 A;  1FD2 A;  3FEZ A;  1TKX A;  4K4W A;  4FXD A;  2Z2Y B;  1YZ7 A;  3HUL A;  5IZH A;  3VWS A;  3ZZR A;  1H3D A;  4PG6 A;  2HFV A;  3FJ2 A;  4RL1 A;  2ROP A;  2UUC F;  1TV6 B;  4B3O B;  1GQE A;  4I69 A;  4PXE A;  1JX4 A;  1N33 F;  1F9E B;  4MKY A;  2R7R A;  4R5P A;  1D0E A;  3JQK A;  4ZK7 M;  1M1K T;  1K44 A;  1HYS A;  2JFK A;  4ID5 B;  4N41 A;  3ITH B;  5B7W A;  4RUC A;  2BE2 B;  3JAM Y;  2BM0 A;  4ZVU B;  2G0I A;  3B82 A;  2ZD1 B;  2XNQ A;  1KQG B;  3UDC A;  1EIY B;  2A6M A;  5E0O A;  5IM0 A;  5J1P A;  1C0U A;  2BBE A;  3C66 A;  3CDU A;  3N5F A;  1C1B B;  1I94 J;  1UZD A;  3IG1 A;  3WZ0 A;  4GKK F;  1U8W A;  1JLE B;  3OBI A;  1FFG B;  2HMI B;  2C3Y A;  1QE1 A;  3OLB A;  5CA5 A;  1GMV A;  1BWV A;  2QSW A;  3HO1 A;  1FCA A;  1KSP A;  7AT1 B;  5HAN A;  1I51 B;  1JLA A;  2E5H A;  4K2J A;  5LSO A;  4LF5 F;  1FJ7 A;  1OJ4 A;  1EQM A;  2M0G B;  3FMB A;  3UCU P;  4NZ6 A;  2EFV A;  4N7T A;  4Y28 C;  4M5I A;  1SV5 A;  4LSL A;  1QM9 A;  1UWB B;  2OFG X;  1QSY A;  3CJS A;  1IBM J;  3C46 A;  4XAK A;  1FI4 A;  4CWB A;  1ZM3 A;  3V5R A;  3ZXW A;  1HNI A;  2O66 A;  3VGS A;  1FKP B;  1JXE A;  4LMZ A;  2GA7 A;  1DY3 A;  2HGN A;  1Q0N A;  4K4U A;  2DTJ A;  4ECY A;  2HHS A;  2ZEJ A;  4DPW A;  1HW9 A;  1RDR A;  5K8M A;  1U1L A;  1RT1 A;  2OPR B;  2JEF A;  3GWC A;  2XHW A;  2IAJ A;  4DQI A;  1KQF B;  2BOA A;  3CJT A;  4ZVG A;  1QUP A;  2OPP B;  4XIU A;  4DUZ J;  2MLY A;  4DOZ A;  3GJT B;  4X4Q A;  5C2C A;  2A10 A;  1URN A;  3SV4 A;  1GTH A;  4IG3 A;  3DOM A;  1KN6 A;  2Z58 B;  3ADA C;  2IMW P;  5GMD A;  3UWT A;  5H9E J;  5F0U A;  3MFI A;  5BYS A;  2UU9 J;  2B43 A;  2DCL A;  3VCD A;  2XO6 A;  1EKR A;  4QWC A;  4F8R A;  1XMO F;  1T95 A;  2L3M A;  1VLO A;  5BR8 F;  3MEG A;  3KDN A;  3KUE A;  3PCO B;  5ETN A;  1FFW B;  2MKY A;  3B78 A;  1CUL A;  2HW3 A;  3MAA B;  5CAB A;  3EGV A;  1UET A;  4OZ0 A;  4IG0 A;  2D1C A;  4DV4 J;  3EGW B;  3GTY X;  1IKW A;  2OPQ A;  2I1R A;  4NOH A;  3IWL A;  2HIY A;  3CTR A;  2ZBP A;  3EX7 B;  1NU4 A;  1T94 A;  5LSR A;  3GCX P;  2VPW B;  3EXY A;  2QLJ B;  2QC3 A;  1SQG A;  4U8V A;  2KN4 A;  4DCO B;  5J2P A;  2Q3P A;  2XYH B;  4UZB A;  3UN3 A;  2DT9 A;  1R27 B;  4FYW B;  2VA2 A;  2K3K A;  4CZC A;  4LQ3 A;  4N56 A;  2WB4 A;  4FS1 A;  3HK2 A;  2MY7 A;  4KSE B;  3CDB A;  3QQC D;  1RWK B;  4J9R A;  2PMW A;  3WX8 A;  4DFK A;  2XMT A;  1RT7 A;  2YKA A;  5ETQ A;  4DSE A;  2W1B A;  3QO9 A;  1UL3 A;  1R7I A;  1PIL A;  6FD1 A;  5D4N A;  4IDK B;  3P8B B;  4ENO A;  1RTD A;  1Q5V A;  3RBZ A;  1MU2 B;  3VGT A;  4K8R A;  5ETL A;  3VQT A;  2QLW A;  4TKT A;  3QRP A;  4KO0 A;  4O4G B;  2UUA J;  1Y5I B;  2HGL A;  4MH8 A;  3DHX A;  2BEF A;  2H9Z A;  2BDP A;  5E5N A;  3R5D A;  5KFL A;  2LXF A;  2MTL A;  2P9C A;  1URR A;  4BC7 A;  1QY7 A;  4C8Y A;  3MPY A;  1RHK B;  1Q79 A;  5EN1 A;  4FYY B;  3I87 A;  1QD1 A;  2AD9 A;  4I7F A;  5I4M A;  3PW4 A;  2QMW A;  4IFV A;  4C3M A;  1HNX J;  2FY1 A;  1NJY A;  5CD4 A;  4QW8 A;  3G71 S;  2D3U A;  4O23 A;  5HK4 A;  2DGV A;  2EFP A;  2MKJ A;  3HM9 A;  2YX4 A;  1RWV B;  1N6Q B;  1EAR A;  3W5Y A;  3TVZ A;  1JLF B;  4J5O A;  4QOT A;  5KFN A;  2A6O A;  2XLI A;  4HAC A;  4IYQ A;  1R0A A;  1XMB A;  4NX9 A;  3NKY A;  4U67 Q;  1HQE B;  4JI2 F;  3Q2T C;  2CPH A;  1U25 A;  2HVD A;  3CJ8 A;  8AT1 B;  2AJQ A;  2Z56 B;  3POT B;  2BKO A;  3FEY B;  1VQ9 S;  3C16 A;  3NGR A;  1RP5 A;  4U7U K;  1T02 A;  3OXF A;  2Z2L A;  1Q8I A;  1AT1 B;  3DRR B;  3O8W A;  1TUG B;  1HNW F;  2CQG A;  4C97 A;  3PFO A;  2H5I B;  3SCK E;  4CLK A;  2F65 A;  2XGP A;  5KG0 A;  2CKW A;  4FS2 A;  3LP2 B;  3TQ1 A;  2GVD A;  2ZDO A;  2BMB A;  1YJ7 A;  5A6W A;  4U9R A;  3C6T A;  4DL5 A;  1RT2 B;  5KFU A;  1IM4 A;  2HQI A;  1R31 A;  3HHL B;  2MQN A;  4DL0 C;  5I3Q A;  4CLP A;  3H98 A;  3GLJ A;  6AT1 B;  5T14 A;  3TWZ A;  2PN6 A;  3G2X A;  5A8W A;  1JB0 C;  2HAI A;  1Q86 T;  2DGT A;  3CME S;  1KS2 A;  4PWW A;  3BH7 B;  8ATC B;  2E5I A;  1V3S A;  3DGP A;  3LH2 S;  4HT5 A;  4NRT A;  3M2R A;  1EET A;  2G13 A;  3J81 U;  5D78 A;  2N82 B;  2MYF A;  1HPZ B;  1R8P A;  4RW4 A;  2CZ4 A;  5CQG A;  2DJW A;  4UF4 A;  2N7Y A;  7FDR A;  4QWD A;  4R0E A;  1TKD A;  2VG6 A;  3CJ3 A;  2AEJ A;  3TJ8 A;  3M6V A;  2PA3 A;  1AYE A;  2MGZ A;  3ILJ A;  2EBE A;  3MEC A;  1H72 C;  2JRS A;  2ZKT A;  2P9G A;  5I3U A;  4R8U B;  3FQK A;  2E7X A;  3D3C J;  3GU0 A;  3A3P B;  5KT6 A;  4NZ0 A;  2MZJ A;  4A47 A;  2GS8 A;  1RWO B;  1Y9O A;  2F63 A;  1REV B;  1KTQ A;  3UN2 A;  4FYX B;  5U47 A;  5L9N A;  1FJG F;  1UVN A;  3U1M A;  4QW9 A;  1VK8 A;  4RWW A;  2A1B A;  1XTZ A;  4XO0 A;  2OTL S;  4WPA A;  2VC1 A;  1DTT A;  2HKE A;  2J8A A;  2M88 A;  5LXY A;  2F4F A;  1KNZ A;  1UKU A;  3CCV S;  4ANE A;  2XYP B;  3ZZ0 A;  3T1Y F;  2QTW A;  4DR3 F;  1LW0 A;  2W2M P;  4TU8 A;  3K5L A;  2DH9 A;  3SQO P;  2B4U A;  1FWP A;  1UPM B;  2J6T A;  2B8Q A;  1S6O A;  5A8K A;  3B6B A;  2VIH A;  3EVO A;  4KAI A;  5EWG A;  4OI4 A;  1R43 A;  1VYA A;  2V9W A;  4FZV A;  5D6G A;  2ZUG A;  3UPF A;  2DGQ A;  2FVP A;  2JH3 A;  2KVI A;  2VG5 B;  3LOU A;  4N5S A;  4U7C A;  4EFA C;  2CFX A;  1LW2 B;  4LF9 J;  1M5O C;  2RML A;  2V6A A;  3D1Q A;  1JLC A;  2LEP A;  3CMQ A;  4J90 A;  4IOB A;  2IM2 A;  2ILY A;  2IJF A;  3HJF A;  2Z8Q A;  3MXH P;  1UFL A;  2MJU A;  3FBC A;  1S49 A;  1Y3J A;  3D7S B;  1YRX A;  2HFU A;  1RTJ A;  2KHD A;  2G1D A;  3LA0 A;  2IY5 B;  2XGQ A;  1VOM A;  3ULH A;  3R6G B;  1RWW B;  1ZTT A;  4C0O C;  1R0C B;  2B9E A;  4PR6 A;  2LYV A;  2M8H A;  2CNN B;  4ALZ A;  3R5J B;  4JI8 F;  4CO0 A;  1T05 A;  1S6Q B;  4FVC A;  2XHC A;  4QIW D;  2ZVI A;  4ZCI A;  1FXR A;  1X9W A;  3A8I A;  3S1T A;  3O3L A;  1H38 A;  2VG7 A;  3I5A A;  1M5K C;  1UP1 A;  1X60 A;  2NXC A;  5K8N A;  1Y3K A;  3CD6 S;  2X3D A;  4ZPW R;  2HHQ A;  3ONQ A;  3OVB A;  3G6E S;  1GFW B;  3VVT A;  4FBT A;  4JI7 F;  3M8R A;  1WJ9 A;  4C8N A;  1Q4R A;  3E3X A;  4LF1 A;  4ZLN A;  5K8O A;  2CG4 A;  1DQA A;  1NXI A;  3ILO A;  4QWB A;  1HQU B;  3DRY A;  5KT4 A;  2BOP A;  1HBO B;  4RW7 A;  4C2M A;  2HS0 A;  3OJS A;  5LJ3 Y;  1CJK B;  3J7Z 5;  4KFB A;  1S9F A;  1Q16 B;  3KLG B;  4F2R A;  1HLW A;  1A7G E;  2CZ9 A;  4ELV A;  3DRP B;  4M5K A;  3ZZT A;  4DX6 A;  2LCW A;  1B4S A;  1HWL A;  2C2M B;  1L3K A;  2HVH A;  2G2Z A;  1GMW A;  1NKC A;  3NAI A;  3KK2 A;  3SZ2 A;  2XCA A;  1RWU A;  3UO0 A;  1LWF A;  3PRB A;  5BYQ A;  5JUM A;  3SDE A;  4U6P A;  1PYO B;  2FJD B;  2BA9 A;  3NCQ A;  3TNV A;  3T5L A;  1FHT A;  2E5L F;  1S1U A;  2WAQ D;  4ES2 A;  4USK A;  4FKY A;  3AY0 A;  1FXL A;  1KD1 T;  4UQT A;  1RTI B;  4LIW A;  2POK A;  3AXM A;  2KJW A;  2YTC A;  2DNZ A;  4FF3 A;  2OD6 A;  3CJR A;  3M1V A;  3ZZO A;  3RBD A;  5DS7 A;  5IT9 U;  2DHS A;  4U8Y A;  2VC0 A;  2MKH A;  2JEJ A;  2HQC A;  4YR0 A;  2CPX A;  3EZU A;  2Y1L B;  2WZ1 A;  2HPU A;  2YBV A;  4O3N A;  4IOC Q;  2H3E B;  3N6L A;  4X4T A;  3D6F B;  3BGO P;  4PWU A;  5F8L A;  4M63 A;  3TUI C;  3ISN C;  4C8Z A;  2MEW A;  1SC6 A;  3DOL A;  4LIR A;  1SIZ A;  4HI2 A;  2FJV A;  2V4J A;  1IWG A;  3Q24 A;  3CJ2 A;  4OYZ A;  3A4T A;  4A46 A;  3W2W A;  2Y8W A;  4Y0F A;  1H7W A;  2G9O A;  4LSN B;  3ISZ A;  3ET6 A;  2VJU A;  2HHV A;  3Q8Y A;  1HR0 J;  1QDU B;  5J2M B;  4ZJO A;  3MD1 A;  3QLH A;  5A0Y B;  2QL9 B;  1N4L A;  5G0R B;  1SB6 A;  2N3L A;  4JB8 B;  5KTQ A;  1T03 B;  1F0X A;  3UR0 A;  5LL6 d;  5DLG A;  5L1I A;  4DSL A;  1QTM A;  1B99 A;  1FTC A;  3CWJ A;  3W2V B;  1AZS A;  4JYA F;  1S57 A;  1M5S A;  2YKN A;  3TAM B;  1E6Y A;  3G6X A;  3L3C A;  2F3J A;  3ZO7 A;  2WON B;  4CH0 S;  2IDL A;  2XNR A;  1S7I A;  5DRK A;  3OR2 B;  1CC8 A;  4DR5 J;  1GT8 A;  3DMJ A;  2LKZ A;  4K7Q A;  4PG4 A;  4W4M A;  3LWM A;  3D66 A;  1IBK F;  4WK3 A;  3EVW A;  1ZH5 A;  3KDO A;  4MAK A;  1P9Y A;  3GIR A;  4GVB A;  4E2F B;  2WSF C;  2W8K A;  3GMG A;  3E2E A;  4A8K A;  4EMD A;  4QPT A;  3V6D A;  3I9Z A;  3HVT B;  3KK1 A;  1U1O A;  2R7T A;  4CM2 A;  2BV3 A;  2ASY A;  5DM6 Q;  2W4D A;  1FES A;  2PA8 D;  1M1G A;  2QYC A;  1HBU B;  2J0X A;  4JV5 F;  3IGN A;  4ELT A;  3HFK A;  4U96 A;  3GFZ A;  5CYQ A;  3CC7 S;  3FZ2 A;  1IM6 A;  5I42 B;  4LF6 F;  3RW7 A;  4DG1 B;  1Q82 T;  2RQC A;  1NHU A;  2BE9 B;  4ER8 A;  2GCF A;  3NRB A;  1H2T Z;  3QJL A;  3KXD A;  4BWM A;  2UUB J;  5HP1 A;  4M95 A;  4I67 A;  1BLU A;  5KG3 A;  1WOO A;  2ADC A;  1W2B R;  3I0S A;  1FRJ A;  1XER A;  2KHC A;  2JVO A;  1Q95 G;  1RT6 A;  2QO3 A;  1A0O B;  1F5B A;  5A8R B;  4ETZ A;  1RTH A;  1QUV A;  2AWZ A;  1S1T A;  3IM9 A;  2DIS A;  2GNK A;  4OX7 A;  1S9G B;  4ZN3 A;  1YKW A;  2ZOG A;  1GTE A;  1YJU A;  4P75 A;  2NYI A;  3DLL Q;  1UFK A;  1VQ7 S;  1TAU A;  2E1M C;  2GW8 A;  3Q8S B;  4K0K F;  2DNK A;  3IP0 A;  2CQ2 A;  4WFZ A;  3DKD A;  1TL1 B;  2NQP A;  2B5J B;  1D8Z A;  1XN9 A;  1X31 C;  3QFW A;  3GIL A;  2CJY B;  3GV7 B;  4EBE A;  1KLM B;  1X4H A;  1YI2 S;  2YWH A;  3R7S B;  2R2T A;  3SCJ E;  1DHM A;  1KTV A;  4OZ3 A;  3TZZ A;  4MK8 A;  2BAB A;  2WBM A;  1WC5 A;  1WKL A;  3BBF A;  2VPY B;  2H54 B;  3H2V E;  1FEE A;  4QIF A;  1NSA A;  5F8N A;  3BGL A;  3SSQ A;  3RZA A;  1XWL A;  3FKB A;  1RAB B;  2HEK A;  3EM1 A;  4K4X A;  2K06 A;  2N4C A;  1O6X A;  2PMZ D;  1SL1 A;  2F9J A;  2R8I A;  4UQG A;  4Q5V A;  2MQP A;  4M1K A;  3EWG A;  4ZJL A;  3RRK A;  5KFP A;  2W01 A;  3DFE A;  4YEA A;  3QIP B;  4YP3 A;  1M5V C;  4Z2X A;  4USJ C;  2QFJ A;  4PCQ A;  5G4D A;  2ROG A;  3FFI B;  5IC6 B;  4CO5 A;  2KXF A;  2HNY B;  1FE0 A;  2AZ1 A;  3EPI A;  1WG5 A;  5KFX A;  4J7C A;  1X4A A;  4ZA1 A;  2MQQ A;  2ALY B;  2XLJ A;  3OTO F;  1HA1 A;  4ZVS B;  3KUG A;  4DPY A;  1Q8B A;  4LBH A;  4OI6 A;  1KKH A;  2MPU A;  3ZTO A;  3ZTP A;  1U6F A;  4K4Y A;  3O1L A;  4X4V A;  4AT1 B;  1OY8 A;  3A8J A;  4M5N A;  3CCQ S;  5HLF B;  2XMW A;  4ZMM A;  1PC4 A;  2DGX A;  2FQQ B;  1QAJ A;  2F8H A;  1G4C A;  2IYG A;  2NLW A;  1BQM A;  3NG8 A;  3GG1 A;  3BSN A;  1YWX A;  4DR1 J;  2QYG A;  2YWE A;  3TUZ C;  5HAO A;  2XS2 A;  4QR0 A;  2BE2 A;  1OYD A;  1Y0H A;  3PHE A;  3GV5 B;  1GX6 A;  2YNF A;  2MKK A;  3DDN A;  2KRB A;  2X1G A;  3DM2 B;  1FEH A;  4PZV A;  1T8E A;  3CCM S;  2O1P A;  1DQ9 A;  4DV1 J;  4TY9 A;  3BRE A;  1YGY A;  2LQB A;  4OLP A;  4ED6 A;  1JWW A;  3OSN A;  4Q7A A;  4FBU A;  1C0T B;  1OY9 A;  4OJG A;  4CTA B;  4JUZ A;  3BO2 A;  4B3T F;  2VUG A;  5B09 A;  1A9N B;  4F0H A;  4NLU A;  3MCN A;  2NCK L;  3BGR B;  3VHQ A;  1IR1 A;  2DCU B;  3CDE A;  1NRK A;  2Y0S D;  1C2P A;  4X4U A;  4KV8 B;  3I0R B;  4NA2 A;  3TUJ C;  2RDJ A;  1FO1 A;  1NLK L;  3MED B;  3FSX A;  2AIR B;  3BKF A;  3W9J A;  2NS1 B;  3IBC B;  1F5A A;  1HL6 A;  3K5P A;  3V4I A;  1FTR A;  4KGK A;  4OYI A;  3FVY A;  3K5O A;  2EFG A;  1UW4 A;  1HNV A;  4AQY J;  2ACY A;  5LMN F;  1XQI A;  4TXS A;  3B4D A;  2AX0 A;  4ILL A;  2C3O A;  1FRX A;  3A3O B;  1KC8 T;  3QWU A;  2PT0 A;  3K58 A;  5JVG Q;  1UVL A;  3PO4 A;  4P7V A;  4OL8 A;  3I31 A;  1HW8 A;  3P45 B;  4NXN J;  4M5D B;  2GQC A;  3KK3 A;  3MM6 A;  2XB2 D;  4HI1 A;  2LEB A;  4K59 A;  3VAH A;  3CC2 S;  1MMD A;  4OZ2 A;  4N47 A;  3TJ9 A;  1HI0 P;  1KDN A;  3GIK A;  3JYT A;  1IXK A;  4JI4 F;  4EYI B;  3M30 B;  3OPK A;  3CSK A;  1NCL A;  3U27 A;  4AL7 A;  2COL A;  2DY9 A;  3L7U A;  4DV0 F;  1RHM B;  2ROE A;  2MZT A;  3TZY A;  1TK5 A;  1TFY A;  2AX1 A;  3DN9 A;  1PJ7 A;  3DLK A;  3CCL S;  2KTQ A;  1VGY A;  4OX9 F;  1LK5 A;  3PIO Q;  1N5Y B;  4DR4 F;  4HTJ A;  1ZBT A;  2OMO A;  2BRL A;  4PWD B;  1VIO A;  3MR5 A;  3BH6 B;  2BM1 A;  2Y3Y A;  3A12 A;  1TTH B;  1RHU B;  2MST A;  3HP6 A;  4H4O A;  3IR7 B;  5CZX A;  4CT8 A;  1WG1 A;  3JSR A;  1FDN A;  4C8O A;  4MYU A;  5L38 A;  1M0S A;  4XDC A;  4ICL B;  1Z1Z A;  2W9C A;  1ZPW X;  4B9M A;  1NND A;  3C15 B;  5F41 A;  3IN5 A;  4LFB J;  3PG9 A;  2MKC A;  3US5 A;  1RK8 A;  4YS2 A;  3VGV A;  4RW6 A;  1BXN A;  4MIA A;  4USH A;  1TK0 A;  1V3R A;  1XBW A;  4CYU A;  2B7B B;  3HHL D;  1G2E A;  3MF5 A;  4DV2 F;  3BO4 A;  4URS A;  1JIH A;  2CQC A;  1D8Y A;  5CCM A;  1IJF B;  4IDK A;  1HNZ F;  2IVM A;  2XZT B;  2H5E A;  4NCG B;  3CO9 A;  2APO A;  2FZG B;  2AYB A;  2FLN A;  3H4D A;  4WCE Q;  4I1T A;  5KAK A;  2C2N A;  1JLG B;  5A2Q Y;  4B3S F;  4PRF A;  4YDD B;  3C6U A;  1TVR B;  2YNH B;  1SKS A;  4ZVT B;  1IN0 A;  4LT6 A;  4C98 A;  2CNK B;  4MK9 A;  3R3T A;  4DV3 F;  3CDW A;  3H2U B;  3MR2 A;  4JI0 J;  4Y2I A;  4M5H A;  2XEX A;  3JSM A;  3S6E A;  3I9V 9;  3M8W A;  3Q8U A;  1N56 A;  3RAX A;  3OJU A;  4C7Q A;  4A8S A;  3P5T L;  4UTG A;  1N34 F;  2AGO A;  1N88 A;  2HZA A;  2YH0 A;  1UEV A;  3RUB L;  3BPD A;  2IM3 A;  4YB7 A;  4DV6 J;  1IKX B;  3ZZZ A;  4OV6 A;  4MFB A;  4YOE A;  1RKI A;  4PQA A;  4KT0 C;  3Q89 A;  3OVA A;  2EK1 A;  2NSC A;  3KHR A;  3FK4 A;  1XNR F;  3OFE A;  3SI8 A;  4I6A A;  1VJW A;  3D0H E;  1RT4 A;  2DNH A;  2DRD A;  4F4W A;  1WD6 A;  4X62 J;  2RRA A;  3LP2 A;  3M8P B;  3VZH A;  2LU2 A;  3VR1 A;  3V2U C;  2QA1 A;  4NL5 A;  4F02 A;  1HBN A;  1NK9 A;  5D0H A;  1F9F A;  3H25 A;  2F8M A;  1WC1 A;  3EJM A;  5FII A;  2FZC B;  2KM8 C;  2C3P A;  1PJ6 A;  2GFF A;  4I2P B;  1EZZ B;  3KLE A;  3MOJ B;  3PRV A;  2B9W A;  4WP8 A;  2M70 A;  5F3Z A;  4C0H A;  1S4F A;  1VC0 A;  5DDR C;  1YG0 A;  3LAM A;  3GJR B;  1S9E B;  4OQJ A;  3Q22 A;  2XMA A;  2RRN A;  3FUY A;  2HUR A;  3AOB A;  2OTJ S;  2K1R B;  4LFC J;  2ZC3 A;  3OR1 A;  4QR1 A;  1RUS A;  1GXL A;  2N4D A;  4CIO A;  3E8O A;  3MM8 B;  1T9T A;  4WE1 B;  2DKO B;  4ED5 A;  4WP3 A;  1Q81 T;  4USI A;  1WF0 A;  3X3U A;  4IQM A;  1R6Y A;  1GEH A;  2KFY A;  3UNY A;  4F50 A;  5KFW A;  3NNC A;  3ENQ A;  1AXQ A;  1F1B B;  4WWS A;  1ZAV A;  3MEK A;  2RIJ A;  2MDA A;  1RQ0 A;  1TL7 A;  3N28 A;  1M5H A;  1T9U A;  2U2F A;  2HND B;  1KEK A;  1QAY A;  2YX1 A;  1C1C B;  4DLG A;  2KH9 A;  3WC0 A;  2V2K A;  2XTJ P;  4G6V B;  3LP1 B;  3P5B P;  4USU A;  5HN0 A;  3EZO A;  3BN4 A;  3K8W A;  3OL7 A;  4DV7 J;  1F3F A;  3DLG B;  1TAQ A;  2BJD A;  3U02 A;  4OYA A;  3AD8 C;  3OHB A;  4KHR A;  2M52 A;  3GPA A;  1N52 B;  5E33 A;  4Y2M A;  2ZE2 B;  3JTP A;  4KRW A;  4J9N A;  4X64 J;  3KLH B;  4H54 A;  4OI0 A;  5FDL B;  2YQ1 A;  2OEL A;  3DLB A;  1SC3 B;  4URQ U;  5K5M A;  2M5Y A;  1UTA A;  2DNR A;  1WSV A;  3GIM A;  2VZ9 A;  3C2P A;  1RWP B;  4B3M F;  4LF7 F;  1NJI T;  2V4Q A;  1ZM9 A;  1IWA A;  4EWT A;  1X0F A;  1IKY B;  4OJ1 A;  2HBR B;  1NKE A;  3G6V A;  3J80 U;  4XPC A;  5IV4 A;  1APS A;  1N32 F;  2E5J A;  4NZ7 A;  1X7V A;  2Y1I A;  4ERD A;  4JV1 A;  1FJE B;  1FK9 A;  1AW0 A;  3K89 A;  4ZIV A;  3FCW A;  4KKO A;  3EVM A;  3IC1 A;  2OH2 A;  4RBU A;  5CH7 B;  4ELU A;  5C24 A;  4DMZ A;  4NMX A;  3R5C A;  1FVQ A;  1O51 A;  2ZHA A;  3JSB A;  3WQP A;  1RBO B;  3M9O B;  3VTI A;  5HMY A;  2BAN A;  4LFA J;  2UXD F;  1ZS6 A;  3QAU A;  3R5A A;  2NYH A;  1PBU A;  3GJS B;  2WW4 A;  4OHX A;  5CYM B;  1QJH A;  1XMQ J;  4H4M B;  5KFA A;  5FJ4 A;  4NAS A;  2E1C A;  1R8B A;  5GAE U;  3SCI E;  2KI2 A;  5B0D A;  3T1A A;  1ZZF A;  4F4Z A;  4XK8 C;  3PKY A;  4QR2 A;  4WK1 A;  4WIQ A;  3W7B A;  4JI3 J;  2EFN A;  3HHD A;  5EWF A;  1IKV A;  4FF4 A;  1OYE A;  1Q53 A;  2GO8 A;  1S77 D;  2C2D A;  2DXE A;  4OX6 A;  1U0H B;  4JI5 F;  2N3O A;  2NUU G;  4LF4 J;  3ZZY A;  5C7P A;  1U49 A;  2PFF B;  1U45 A;  1RBL A;  1D9F A;  2B3T B;  2GVZ B;  2J9E A;  3BKT A;  4ATN A;  3RR8 A;  2GAG C;  1DLO B;  2GGP A;  4G1Q B;  1KHW A;  4EGL A;  2LDY A;  2C2O B;  4DR6 J;  3OUY A;  3LF0 A;  2GZO A;  5KFS A;  1S1W A;  4RW9 A;  3UE2 A;  2FHO B;  3HSZ A;  4ED8 A;  3TEG A;  3R97 A;  4NCA A;  2OP5 A;  2UUT A;  4PQU A;  4NYO A;  2Q66 A;  3PIP Q;  1BHN A;  1NDC A;  1GMU A;  4TYA A;  4DFM A;  3ZZU A; 
#chains in the Genus database with same CATH homology
 3BPS P;  4OV6 A;  2Z30 B;  2ZWO A;  3VV2 B;  3GCX P;  2W2O P;  1V5I B;  3WIV A;  2QTW A;  4JP8 A;  2PMW A;  2W2M P;  2XTJ P;  2ZWP A;  3A3P B;  3BGO P;  1ITP A;  3A3O B;  3AFG A;  4NE9 C;  4YN3 B;  1SPB P;  3P5B P;  3QFH A;  2Z2Z A;  2Z57 B;  3T41 A;  3WHI A;  3GCW P;  1R6V A;  3VHQ A;  3SQO P;  2W2N P;  3CO0 P;  4NMX A;  3H42 A;  1SCJ B;  2W2Q P;  2W2P P;  3A3N B;  4K8R A;  2Z58 B;  2Z56 B;  2E1P A;  2Z2Y B;  3CNQ P;  3WIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...