2Z58B

Crystal structure of g56w-propeptide:s324a-subtilisin complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPWVEKVEFDHQAVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Requirement of left-handed glycine residue for high stability of the Tk-subtilisin propeptide as revealed by mutational and crystallographic analyses
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 9
structure length 66
sequence length 66
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2z58B00
2E1PA 3WIUA 2PMWA 3QFHA 3CO0P 2XTJP 3T41A 3WHIA 4OV6A 3A3OB 2QTWA 1SPBP 2W2QP 4JP8A 4NMXA 1V5IB 2Z57B 3H42A 2Z2ZA 2ZWOA 2W2PP 2Z56B 4YN3B 1R6VA 2W2OP 2Z30B 3A3PB 3BPSP 3SQOP 3WIVA 3GCWP 2ZWPA 2Z58B 3A3NB 3P5BP 2Z2YB 4NE9C 1ITPA 3BGOP 3VHQA 1SCJB 3CNQP 3VV2B 2W2NP 3AFGA 3GCXP 2W2MP 4K8RA
chains in the Genus database with same CATH superfamily
3G2XA 1G3OA 4D3HA 4RW6B 2VFRA 4ZVTB 5K5MA 5H9FK 1CULB 4GKKF 3DN9A 1KN6A 2QZ8A 1P6TA 1RTDB 4HHJA 1LW2B 1TAQA 3MEEA 3F73A 2VG6A 4DWIA 4F02A 2POKA 4C8OA 2IAJB 4GMKA 1MU2A 4KGKA 2W9AA 1HWLA 3A3OB 5E3RA 3W64A 2HS3A 3FEXB 3ZTQA 3O44A 1SB6A 4ZN3A 2XYPB 4M5KA 3KLEA 3K5NA 2JNJA 2M8HA 2DY9A 3IR7B 2QGFB 3SXLA 2FHJA 2I38A 2FVRA 2IJRA 4WWSA 4J9SA 1F60B 1PILA 3W2WA 2OPSB 5J2NB 3LPEA 2FQQB 2NCKL 4A8KA 2XB2D 2IA0A 1S5ZA 4G1PA 4TYAA 1OYDA 1X4BA 2KTQA 1N32F 3H2UB 4DR3J 1CEZA 3V5RA 5CYJA 2CJBA 4CCHA 1DLOB 1HFEL 1FK9B 1WDTA 2N7CA 5E3AA 2V63A 1YX2A 2XBPA 4LRFA 3DRSA 3CCLS 3M1VA 1TL5A 4O4RA 1ITPA 3M6VA 1VQ4S 4HI1A 3PW5A 2HAIA 1SPBP 3N9UC 1BQMB 1HYSB 4K4VA 4DG1A 1NK9A 3HSGA 4M94A 4ES3A 1I5OB 2XMTA 1N5YB 2FHOB 2ZBIA 5K9FA 1X5PA 4F3QA 2AT1B 4ZCIA 3ETMA 3CW2C 2LXUA 2W9BB 2PD1A 4RW4A 2ZJPQ 5F9LA 2JWNA 1DURA 1Z4UA 3AXMA 4GO5X 2IM3A 3VHQA 2QA4S 1QAJA 3KG0A 1LW0B 1VQ6S 3BQ2A 2RU3A 2D1CA 3KK3A 1NUEA 2MQNA 2G0JA 1RAGB 2E5GA 1SVDA 4JBCA 4QIGA 4NXNF 4EI2A 2PEBA 4WCEQ 4ID5B 3UI3A 2FY8A 2DNPA 3CJRA 3LP0A 1K47A 2IRUA 2R42A 2O3DA 2G2YA 4OYBA 2VG5B 5HQMA 2F1FA 4RW9A 5HATA 3QLHA 2J6UA 4CLSA 4ER8A 1PKUA 4Q0BA 5L1KA 1PIEA 2CQBA 3OTOF 2YNIA 3ISNC 5KFQA 2VQFJ 3GCWP 1D8ZA 3PEHA 3J80U 4HHUA 4DCJB 2QFIA 4WXOA 4WIIA 3FCWA 4A8FA 1WC5A 5U47A 3K5MA 2IM1A 3MM8B 1TL7B 3EM1A 1TUWA 5C2CA 4Q45A 3D2WA 2CDQA 1D1UA 3MM5B 2CKWA 4KFBA 3FBEA 1Y11A 4X4TA 2ZOGA 4EU0A 1KTVA 3LAMA 1WG4A 3SCLE 1TTHB 1RLCL 2HVDA 4C0BA 3S7RA 5A8RB 2QYCA 5K14B 3GIJA 2CJAA 3IXQA 5GADI 2G2OA 2K1RA 3BR9A 3VV2B 3DLKA 1FKPA 2HVIA 2CQDA 3C66A 2GIRA 2R7VA 2J7WA 3MEGB 4ED2A 5A8KB 2FZKB 2KVQE 2C2OB 5HMZA 1AZSB 1U26A 2UUCF 3PACA 1HQUA 4W92B 4FVCA 2ZM6J 1U0HB 3ISND 3X3UA 4AXIA 2BXJA 2MLYA 4J7CA 4RW8A 1WC6A 3PCOB 4F3MA 4F7VA 4O3RA 4KSEB 3EZUA 4FNHA 3CJKA 2HGLA 4DV5J 1N52B 2YNHA 4CWBA 3TAQA 1SJFA 3GPAA 2YWKA 3W5YA 1BXNA 5ETTA 2XLKA 2BANA 4B9VA 1O5JA 4MKVA 3THPA 3Q23A 4DR2F 2GMJA 2R7UA 4O44A 2XYHB 5IQ6A 1N6QB 4WP9A 2HWHA 3KHLA 2G0CA 1U47A 3R5AA 2OFGX 3W2VA 1SJ1A 2EG2A 5L1IA 1RE1B 3DC2A 3ENVA 4Q43A 4O3PA 1RLDA 4PG6A 3I9V9 1R27B 5ETKA 3IR6B 2VQEF 2ILYA 2FIUA 3I87A 2R8KA 4OYXA 1LOUA 4DL0C 2IM0A 3I4PA 3U1NA 3G6VA 3JAMY 4L3NA 2RSQA 2V5HG 2CWKA 1RK8A 3V2UC 3ITHB 2DGSA 4J9MA 2C22A 1TELA 2LYVA 1IBMF 5IT4A 1P8GA 3D3CJ 4PG5A 2VA3A 3TOQA 1X5OA 4M5LA 2DEIA 3H5SA 4CTAB 2EWHA 2FVCA 5D77A 5BYSA 2C3PA 4PQUB 4CRJA 4EK2A 4W98A 1S1TA 1R8CA 1T95A 2HFZA 3TP2A 4KPCA 2AYEA 5C24A 2XULA 3J7ZT 1MN7A 2DGVA 3CJ0A 4WK3A 1RTHA 4RR5A 1Q53A 1M0SA 1KFSA 2W1BA 4CYUB 1X31C 1FFSB 4DFJA 3KNAA 4GVBA 3AD8C 2KXNB 4LSNA 3ULHA 4ANCA 1ZPVA 1K0TA 3E01B 1DTTA 4LF9F 4Y2MA 4AFFA 3D3BJ 2VPZB 5KFAA 2FVSA 5KG7A 4F4YA 4LSZB 3EGNA 1HL6A 5LSRA 3FSXA 4XO0A 4B3RJ 4UOHA 4LFCF 2DR5A 1TKZA 3TVZA 4YDXA 1P9QC 1RTJB 2XZWA 4J9VA 3CJ5A 1RKJA 2AEFA 3RB6A 2QLFB 2B43A 4ZPCA 2XS2A 2NZCA 3W9IA 3SFUA 1MWZA 3U1MA 3NWRA 4A8QA 3LA0A 5IXUA 1HI1A 3ZXWA 5D4PA 1UPPA 2B5JB 2KHCA 3M6XA 3R5DA 4ITSA 2F8MA 2W2NP 4ECRA 2D7SA 1N48A 4FF3A 2U1AA 4URGA 4DV7J 3MR6A 2IY5B 2M4MA 1IKVB 3IAM9 3RUBL 3TA1A 3QPIA 4PYAA 3R5JB 2JLEA 5CD4H 4B3MF 4ZLPA 3NCRA 3WX4A 3SMZA 1D3WA 4B3TJ 3M2VB 2K8GA 1FTRA 3NAHA 3HHEA 4AXJA 4F2SA 3I0SB 3QJLA 4ZHRA 2ZNZA 2H65B 2I5JA 1GMVA 1C0TA 4I0WA 2F7VA 2IA6A 3QAUA 2EFPA 4ZPWR 5A6PA 1AA1B 3M2UB 3MD3A 3LP1B 4U67Q 1NK8A 4USTA 1T02A 4V19X 1UVMA 3FK4A 2GGPA 1U8SA 2Q43A 3NG8A 1NDPA 3MD1A 5EX3A 4ZVQB 3MUMP 3G82B 1EETB 2GJIA 2IVFB 4R5PB 2GHVC 1WJ9A 1L3SA 1GMUA 3VAHA 2PN6A 1XJWB 3TR5A 1U7LA 3TYTA 4NL5A 4LR8A 4H4MB 1UVNA 4MKBA 1RISA 1X60A 3CC4S 3FBBA 5C2GA 2NYHA 1JJHA 4RU9A 3OSPA 2FHMA 3KJVA 3ZC4A 2R9LA 2NYIA 2AYMA 1CJUA 4C3KA 3N4WA 2HQ3A 3FEZA 4G6VB 1LEOA 4TU9A 1RSCA 3EVMA 3DRXA 5B0CA 3EJMA 2RKIA 4A4JA 3PO5A 1OQ6A 4ZN1A 1I1GA 2Z4PA 3PRBA 5JVGQ 5E5NA 5DGAA 3UVJA 2ZZTA 4FPIA 5LOQA 4IFYA 2YKQA 1YBUA 5KFIA 2PT0A 3TEGA 4KB7A 1QE1A 2IPOB 5KFUA 4U7CA 2EFOA 4LRAA 3HPOA 4DSIA 3RR8A 2UXCJ 3KUHA 4UZBA 1HBMB 1SQGA 2XSFA 1SI9A 3NL0A 2X1AA 4RBTA 3QYYA 1B0VA 2MKYA 4O0NA 1UWBB 3AQPA 2DHHA 1RT6B 1HNVB 1Y00A 3GQCA 1O0PA 3BGFA 3KJFB 3CCSS 5KFMA 2RH3A 2NXJA 1C0UA 2DGQA 3PZPA 4X4OA 3OQ2A 3R3TA 4YR3A 3E51A 3CO0P 3CCUS 3DLLQ 1NHVA 5A76A 2FGCA 3NGRA 1VOMA 4KRWA 4YHHJ 3DHXA 1JNZB 3UWTA 3MECA 2ZD1A 2IJNA 4RLEA 1D8YA 2HVHA 3EGZA 2ZJQQ 3DM2A 3L9ZA 1RJJA 2UXDF 1GFWB 1DQ8A 5J1EA 2DEJA 2O67A 5FDLB 2DY1A 2JX2A 4ALZA 4OYMA 2CNOB 4NYPA 5C25B 2RDDA 1JLEB 2BE7D 2B4UA 2DGTA 4DF4A 1WI8A 3MDFA 3VF0B 3JAMU 4GKKJ 3PX4A 2KDOA 3RYLA 1U2CA 1WELA 3PVXA 2H4WB 4ZK7M 2MKSA 2YH1A 1UVJA 2B4PA 2LQ8A 2BYCA 3PTWA 4RX6A 4DR4J 3SI8A 5GAEI 1H72C 3N5BA 4C8LA 2A1BA 2HSEB 2EC0A 2XS5A 3RB0A 1N34F 3VTIA 4Z2XA 2VD3A 1F2GA 1HARA 3M8ZA 1TL3A 1N5QA 4WP8A 3JQJA 2QLBB 4FYVB 4M63A 2FLNA 4V1Ak 3L3CA 1TMJA 1N5SA 3OFFA 4DN9A 2QT7A 2RT3A 1RA6A 1RGVA 3EMTA 1TFWA 3V6DA 4X4QA 4FPRA 1PJ7A 1UJ6A 1NM2A 4F3OA 1HIYA 4CO0A 4S0MA 2GV1A 1U48A 1D0EA 4AE5A 1R7IA 3KXDA 2PA3A 4C8KA 1N32J 4USIA 2Y0SD 2VB6A 4CLLA 4Y2AA 2FGOA 4DSKA 2ZZMA 4CNZA 3OR2B 2KG0A 2Z2MA 3NGDA 5HJXA 2CQ1A 1PAUB 2MGZA 4IOBA 4CO2A 2U2FA 1F1BB 4DCOB 4JV0A 4I2PB 2D41A 2Q6BA 3BBFA 2NXNA 3CO9A 2B8QA 5L1LA 3SEOA 2AGOA 2G2ZA 3GWCA 1BMQB 2FVQA 1LWEB 4ILLA 1UPMB 1NO8A 1S49A 1X4AA 4X64F 1TZ0A 1NRKA 1H98A 1S9GA 4TQSA 4LRCA 2QL9B 2KI2A 5KFJA 2YKNA 1HNZF 3GV5B 4IFVA 4PXCA 2V6AA 1EJ7L 3RG6A 3ILJA 4TY8A 1X9SA 2BQUA 4KGZB 2V50A 1FNOA 3D7SB 4N5SA 3KWMA 2AW0A 4L76A 3MCMA 1U2RA 1QAYA 4A8MP 3FGVA 2KHDA 3W8GA 1JKHA 3OUYB 4NASA 3GJSB 4DR1F 4JI5F 1JLAB 2Z0GA 3AHPA 2C1EB 2L9NA 1U1MA 3EGWB 1HNWF 3AXKA 4R8UB 3B4DA 4NXNJ 5HP1A 2W7AA 1A0OB 3W65A 5D3GB 2IMOA 4EMDA 2YKOA 4TYBA 2Y1JA 3ETOA 3MUVP 3NOCA 4LF6F 1DQ9A 5F8GA 3HSZA 4ZCKA 1Z1ZA 3V81A 1YHQS 4ZVRB 2Y1IA 1EHWA 5B0BA 3VZIA 4B02A 2HS4A 4J9UE 3PV8A 3OHAA 4GO7X 1FRHA 4KH0B 5KFOA 2D9PA 2OP5A 3OTOJ 1N33J 4IG0A 5FLXU 1Q8BA 3P5BP 4IRDA 5CH7B 4I7FB 2I6WA 4KHPF 3GE9A 2GNKA 2LA6A 4OX9F 1CJVB 2I0XA 3ZZYA 5IM0B 1RYSA 1XNQF 1VBYA 1ZAVA 2BOPA 3W7BA 4DLGA 1NH7A 1SIWB 4M5DB 5SZTA 3G6XA 1IKXB 4C98A 2L48A 3UQSA 2P2CB 3O8WA 3T5KA 2YWHA 4YOEA 3T6JA 2JC1A 2VKRA 4DV4J 1Q0NA 3MPYA 3SCJE 1R0CB 3A3NB 2AJ0A 4G3IA 4F4ZA 1K1QA 4E98A 4N47A 2COLA 3LANA 4R25A 3VAKA 1PCAA 3NXZA 5C42A 4ENOA 1U1KA 3QZ7A 2FZCB 2UUCJ 3DMJB 2DHXA 5FIIA 2HURA 3BSAA 3GMGA 2JEGA 1YJ7A 4Y3CA 3QAEA 4DOZA 5ITHA 4RW6A 2PFFB 1CULA 1T05B 3QT8A 1RTDA 1LW2A 3KLGB 1H2TZ 2RHSB 5IWAF 4CH1A 3CT9A 2IAJA 3LTOA 4FYXB 2EW9A 2CWXA 2V8PA 5GAHU 4EFAC 5IT9Y 3GYNA 4KH1B 5J1PA 4HKQA 1X5SA 4X65F 4DL3A 4MJKA 2V0NA 4I2QB 4DR2J 2V94A 4CLWA 2Y8WA 2AJ1A 5CD4A 3DOMB 1PG5B 4IKAA 1PGZA 2VFUA 2XC9A 5B0DA 5L8RC 4QW8A 3C19A 4OHYA 3OHBA 2OPSA 2J9DE 5J2NA 2VQEJ 3GV7B 2DO4A 2FDNA 2PEHA 3TZYA 1RHKB 1W7WA 2DT9A 4JP8A 1CG2A 1NDCA 4ETXA 1GEHA 1N8RT 3A8EA 3M05A 1DLOA 1MW7A 1IBMJ 1K44A 3VAJA 1JQGA 1FK9A 2B6AB 5G0RB 1C1CB 4DQPA 1HQEA 2MLZA 2L9DA 1M5KC 5B0EA 1DFDA 2DNOA 2IIHA 2B51A 1KTQA 2RDJA 2Q3PA 5I42B 3R7SB 4LF5J 3L4BC 3QT6A 2C2DA 5D8HB 3C16B 3AFGA 1OPZA 4JI3F 1BQMA 1HYSA 4NZ7A 4AD6A 1B99A 1N5YA 3RBXA 4KGMA 4YY3J 1U45A 1HKAA 1SC4B 4DUTA 2AHOB 1HNIB 5J2MB 2W9BA 3OTDA 1WOSA 3FSIA 3CCVS 4NOHA 3F56A 2QLJB 4LF9J 5LT5A 2E1MC 2E44A 1LW0A 4C0OC 2RQ4A 3PKMA 3WBZA 1WD6A 1U2FA 2JEFA 1OWXA 4E2FB 2XMKA 3AA8A 4KKOB 4NZ0A 3K2YA 2GMLA 2OGUA 1FXDA 4LFCJ 2Q6CA 4EYHB 2AQ4A 3FC9A 2IDLA 2DHAA 3I96A 2XZTB 4ID5A 4ANDA 3D5MA 1RT1A 1AUDA 3CVKA 1EX8A 1GX5A 4RUHA 3RGIA 4Y0FA 3C46A 2VG5A 3TZXA 3QGIA 3S1TA 1GQEA 2DRDA 3CCQS 2A18A 3NNHA 3OVSA 2KZMA 1PBAA 1S4FA 3ZTRA 3MEEB 3BBCA 4ZVSB 4B9NA 1FX4A 1H7WA 3NAIA 1IR0A 2W2PP 4L73A 1QVGR 2YY3A 3GSIA 1SKUB 2OPQB 4B9TA 3ZTSA 4P75A 4WTOB 4DZDA 2MZJA 3MM8A 1TL7A 1VFJA 2J9CA 2JLGA 2AU0A 5KG1A 1NSPA 1D9AA 2CQ3A 4K2JA 1RWVB 2P6SA 3MM5A 1JLCB 1N0UA 3G86A 1FJCA 5BXIA 3OTBA 5A8RA 3FSYA 4JI6J 4BC7A 2I2YA 2EVZA 1FF2A 4QWDA 4DR7J 3K5PA 2A6OA 3O2IA 4DL2A 5KT2A 2WB1D 1ZM9A 3MEGA 4JOUA 1HW9A 4WZMA 3KLIB 4F4XA 5A8KA 1LFWA 1AZSA 4YMEA 2C2ZB 3TI0A 2KN4A 4NYOA 4HEA9 3AAWB 2AD9A 1U0HA 3DI6B 2QJ3A 3HVTB 4MIWA 2ASJA 1FERA 4U8YA 2RF2B 4ZKAA 3KLVA 2GIQA 1CQNA 5KFEA 4L3KA 4RUAA 1L3TA 3KDOA 2ACYA 3FRYA 8AT1B 2OD4A 4DG1B 1NHKL 4ECSA 3GB0A 3PW7A 2M2BA 1FX2A 3HZGA 3MMBA 4X4RA 3NP5A 3NRBA 3G71S 3R5CA 1FEEA 1Q82T 3CJ2A 5DGBA 3PRDA 1RACB 1N6QA 2QG9B 4RW4B 2C3MA 4MAKA 2I9SA 3E3XA 1ZM4A 4ZLLA 1SJQA 3GIMA 4ZVFA 2BABA 2KB2A 3QRRA 3H42A 2LEPA 2BQ3A 2FYXA 3K0JA 3WIVA 2Z58B 3QO9B 4OFZA 2RUSA 1TL1B 2W7PA 4BS2A 2EI5A 4RNMA 5LL6d 4PPZA 3ITHA 4F4WA 3LALA 2HFVA 1X9MA 5C5JA 3LWMA 4QU6A 1FDNA 1U6FA 4X2BA 2VFVA 1XIQA 1BUXA 2JRSA 2F5GA 3ELHA 1NLKL 4CTAA 2CVIA 5JVHQ 1U4BA 2HNDB 4PQUA 3RRKA 1UEUA 4JI1J 3MM9B 2VICA 1M5PC 1U24A 2NSCA 4ECVA 1TQLA 1B7FA 2MZ1A 4DXLA 2AGQA 3IO1A 5IT9U 1R8PA 3MEDB 4C6AA 4IOCQ 1BC6A 4CYUA 5DDPC 1T11A 2ZHAA 1KQFB 5AE1A 7FDRA 1RI7A 3AODA 5F3ZA 3PYDA 3E01A 2AZ1A 1VS3A 3M2RB 2DNZA 3ISZA 2CPEA 1PJ5A 1WC3A 1RHUB 3HCXA 5F8JA 2GHPA 1AFJA 4RNFA 4DPYA 2L08A 1DQAA 4KFBB 4CZCA 3MM6B 4UW2A 2C2NA 1B0TA 2DXDA 2BRKA 4E8UA 2HZVA 1FKAF 1RTJA 4GKJF 5D0EA 3J7AN 3KKFA 4P2XA 4PXEA 1S79A 2QX0A 1IR1A 2WOMB 1WC1A 3LWLA 3FZ2A 2G1HA 2P9CA 3C14B 1OPIA 1N34J 3BGOP 2B5JA 3DDNA 3JSMB 4M5MA 3IS9B 1EAYC 1O51A 3UDCA 3LP2B 1E6VB 3ADAC 1PO6A 1JJCB 4OI3A 2V34A 2MKIA 2BQRA 2CNLB 3HD2A 1HWUA 4BHQA 2RRBA 1SKRA 1CSJA 3M6WA 2QEXS 2FLOA 5CA5A 1IKVA 3A13A 3G8SA 3QGGA 1JMTA 2BX6A 2VF3A 3S01A 3MGJA 2QYGA 3M2VA 2DVIA 2AJQA 1XMBA 3H59A 2VKZG 1VHFA 2GVZB 5E33A 2VU5A 3I0SA 1WKLA 3RAMA 2V8DA 1REVB 2V9WA 4AL5A 3CF5Q 3PW2A 4X4UA 3V4IB 4K50A 5HI7A 2WVDA 4LBIA 3KOAA 3NBPB 4DUYF 3M2UA 4MK8A 2XMMA 3LP1A 1OQ3A 3HT3A 3NY0A 4JI8F 4CQ1A 4X64J 2DRAA 1KLNA 5L9XA 5MLCV 2XO7A 1CBKA 2AYBA 3G82A 1NJYA 1EETA 4KT0C 3QGHA 4Q7AA 2YWEA 4R5PA 3RU0A 2X1GA 5T7LB 1SQEA 1NZ8A 2H9ZA 2D3UA 4JYAF 3QIDA 5K20B 4XPCA 4KV8B 4M8LA 1YVFA 4OZJA 3JQMA 4H4MA 2YNFB 4ED1A 1C2PA 4RW7A 4O3QA 3GILA 2FLLA 1JLGB 1RWMB 4DR1J 4JI5J 1T03B 3NS7B 4TY9A 1HNWJ 2GO8A 5F8HA 2C3OA 1VJQA 1VIOA 2B4OA 3D6FB 3Q24A 5KT3A 1WEYA 2UZAA 3QSIA 5D6GA 4QYRA 3BV8A 1P27B 2R3VA 3NGTA 1XBWA 3ILIA 5H9FJ 5IFMA 2CDRB 4UOFA 3PY8A 2CPJA 4C8ZA 2P5VA 3ZNUA 5KFZA 4AL6A 1ZM3A 5LM7E 4X4SA 2CG4A 2WBMA 1NKEA 1HBMA 2VPWB 4N56A 2F8EX 3QJJA 2YTCA 1UWBA 3I32A 5BYRA 4ZMMA 4KHPJ 1RT6A 1UEKA 1HNVA 2GJFA 4OX9J 2RD5C 4ZPTR 2XO6A 2MLXA 2V2QA 2HGMA 5ETVA 1NCLA 1TK5A 1XNQJ 3Q8VA 2JFKA 3N28A 2P6TA 3ZNJ1 4X62J 4JV5F 3IM8A 4USUA 5RUBA 5DZ7A 1S10A 3KMQA 2ZH2A 4PXBA 2UV8A 4B17A 1R0BG 1AT1B 1Y0HA 3AQOA 2QIFA 4P2MA 1HI8A 5D4LA 5FD1A 4OL8A 3C15A 4P2FA 3FJ2A 3SSQA 2DXFA 5A6WA 2EFGA 5FDLA 1C4CA 1EARA 1UA0A 5H9EJ 3GJQB 1JLEA 4FKYA 3PHEA 3R6GB 3GSDA 2VC1A 5KFLA 2MY8A 2DNYA 4DR6F 1QAXA 3H5UA 2M9KA 3RRGA 4H4OB 3VGSA 1PJ6A 1RT2B 4WK1A 1X5TA 2W4PA 3BS9A 1PAEX 2CPYA 4QCLA 3NGUA 3QT7A 7FD1A 4ANEA 1UFKA 1JXLA 3CJ3A 4NMXA 1OSDA 2KL8A 4OYPA 4X65J 3LF0A 4DFMA 3I31A 3PJXA 3EUNA 3AB4B 3R7BB 3T5LA 2B8PA 2K06A 2FTRA 2X1FA 5HLFB 2ZFHA 5KG4A 2ACMA 2UUBJ 1IXKA 2KT3A 3MZIA 3HO1A 4Y65A 4C11B 3W9JA 2HBZB 2FZGB 1SBRA 2E1PA 2DH9A 1RAEB 2C2EA 3HDSA 3B78A 2HQGA 2JVRA 1RAOA 1Y3KA 1F9HA 2ASYA 2VODA 2KG1A 1X9WA 2DNQA 5KT5A 4DX5A 2RVJA 1TKXB 3DLGB 2HFOA 3OR2A 2PFDA 2E9RX 1CJUB 3DRRB 3H8YA 4DU7A 2GZOA 4EZ6A 2HIYA 3F44A 4HI2A 3TZZA 3EZ5A 3DOLB 4I2PA 4I68A 3OJUA 1KS2A 3SSSA 2CQPA 4LF8F 3KHGA 1T9XA 1YIJS 4JI3J 5CQGA 2G0IA 1QSYA 2H5JB 2HW3A 1LWEA 3I9ZA 3J81Y 1ROFA 2CZ9A 4FBTA 3CD7A 2WCXA 1X4FA 5DRKA 2J9DA 2KYZA 5KTQA 3S8SA 1NSAA 4UQGA 2B56A 1Q8KA 3ZZUA 5B0GA 5D15A 2QE5A 2CFXA 2HHHF 5HANA 5AXKA 2M5YA 4ZP9A 1P1TA 1K1SA 3BKFA 2YXLA 3DGPB 2CQ2A 2R8GA 3K5OA 2XY5A 1N0VC 4PYDA 6AT1B 2H51B 3MMJA 4QWCA 4QR2A 4K4YA 4RUBA 1U8WA 3GIRA 3OL6A 3OUYA 1IBKF 4YB7A 3EICA 1JLAA 4NRTA 4CLKA 1IQTA 3HKZD 2QA4G 2DO0A 1XMQF 4ZP6A 4R8UA 1KD1T 2PMWA 1PYOB 5E3PA 3M8SA 4WBFA 2ZNYA 3NEKA 5E2QA 1UA1A 3BGRB 5D3GA 3EZOA 3DM2B 3Q8UA 3CJ8A 2HWIA 2O1PA 2UU9F 1H3DA 1HR0F 1VQLS 2Y0BB 4DL4A 4DEZA 2XHWA 4WFBQ 5HL7Q 2Z2LA 1HD0A 2MSSA 2YKMA 3MMCB 4OLPA 5D0RA 4PZVA 2IJFA 3P5TL 4ED7A 4KY3A 4X4PA 2LKZA 1NHUA 2ZBPA 2PGCA 4F26A 3CMQA 2DGXA 4I7FA 1U6ZA 1CJVA 4K4TA 5B0FA 4DS5A 1S57A 1Y5LB 3SV3A 5HN0A 5KG5A 5M2UA 3KUGA 1MN9A 3THTA 2Z56B 1IKXA 3QRQA 2XGPA 4LQ9A 2GA7A 4Q44A 2DR7A 4RNNA 3GJRB 3FEYB 4ZJOA 3RW6A 2F3JA 2VH7A 1F5BA 5IOLA 1GXUA 2RJZA 2CQGA 4NXMJ 4IR1A 1EQ0A 3FMWA 2ZDPA 4CI0B 2MJNA 3OXLA 1YBTA 3BYPA 4O3OA 3DMJA 3PDNA 5HMYA 1SUQB 1J5OB 1MLAA 4I56A 2BACA 1B64A 3UW1A 1ZBTA 4ZPBA 1RB0A 1YJRA 3CC7S 1T05A 2HZAA 3EVWA 4RWXA 3DNCA 1FD8A 9RUBA 3KLGA 1KRPA 4ZCMA 5JUMA 4ECQA 2RIJA 2C28A 1Y9OA 5KFDA 2BW7A 4IRCA 2RS8A 4TKTA 4C2MA 2NZ4A 4ZJLA 1WC4A 1B3TA 3QMQA 2OKQA 3HI9A 3Q8RB 3P3DA 4I2QA 1S9GB 2HHWA 3H40A 2MQ8A 3CD5A 3I4HX 3DOMA 2OFHX 4WXWA 2GHWA 1R8HA 4C8NA 5IC6B 1KKHA 3Q83A 1X7VA 2IDEA 3ENAA 1RWNB 1VGYA 3KLHB 2BVZA 4NZ6A 1S0OA 3CPWR 1BQNA 2OI2A 3D66A 5E3CA 4FF1A 4OHWA 1REGX 1YZ7A 2BJ1A 3T1AA 2HK2A 4R0JA 4X4VA 1M90T 2B6AA 4PWWA 1C1CA 5LXYA 3F0NA 2DHGA 5A2QY 3N6MA 4QIWD 3I6PA 4RPFA 2R2UA 1W26A 4LIRA 4CNYA 3IWNC 4WZQA 5I42A 5A8WB 4CIOA 4RL1A 1IBLF 3C16A 3T3FA 4X4NA 1RHQB 5KAKA 3JTOA 2VBWA 3CJSA 1S76D 3GG0A 2F9DA 5GAHI 1XQIA 3HHLB 4LJMA 2UUAF 2HHTA 2XI3A 2EFQA 4LF1A 4OHZA 1WF0A 2PI5A 1HNIA 2QMWA 5J2MA 4WFYA 4Q5VA 2E29A 1JLFB 2KZZA 2IC3A 3EPIA 4KHRA 1T7PA 4F25A 4I69A 4O3NA 3IC1A 3LGNA 2J6SA 3PIOQ 2VZ9A 1BGXT 4NI2B 1YQHA 2XY7A 3CCTA 5I3UB 4K5RA 3VAMA 4KKOA 4HDHA 4XPEA 2OPPB 3M8QB 3DDKA 2B7BB 1UVKA 1WDDA 2GS8A 4HACB 1XR6A 5KOXA 1FDBA 2IHR1 1HBUB 4IYQA 2X3GA 1FVQA 1GTHA 3W5ZA 2ILZA 4GKJJ 4P71A 3IAS9 4P73A 2AGPA 4UF4A 1FA0A 1VRTB 2E7XA 2HNYB 2ZDOA 3LAKA 4LF4J 1RXOB 4J9OA 1YJUA 1FJGF 1RT3A 3BQ1A 3DFEA 2HLUA 3POTB 3VR1A 2JDJA 4LFBF 4FVMA 2CQ0A 3OBIA 3BGUA 5JXSA 3J81U 4LUBA 3HP6A 2A2CA 2J0WA 2YX7A 2CJYB 2ZKUA 3T9NA 2VPYB 3VQSA 5EUHA 2R2RA 2DR6A 1LFPA 1ICEB 2MXYA 3BPDA 3VAGA 2OPQA 5CZVA 1Q5VA 3HF5A 1U1PA 2WONB 3TVYA 4NLPA 1Q78A 4KHMA 2N4DA 3BGLA 1OIAA 3WHIA 3GJTB 1JLCA 1DJ0A 4LQ3A 1W2BR 2LQ9A 4F36A 1NPPA 3UR0A 1SCJB 3TW0A 3PW4A 2CPXA 5F0WA 4DUYJ 2RMLA 2L3MA 4ZA1A 2B0GA 2K2PA 4JI8J 4TVAB 2DKOB 2HLTA 1H7XA 3CJTA 1TU0B 4OMFG 3KLIA 3ICLA 5LSLA 1UCNA 1G2EA 4PXDA 2UP1A 2YVSA 4XAKA 3DI6A 3HVTA 1HQEB 1EIYB 5H9EK 2XWXA 4JYAJ 5CAAA 3TZWA 2RF2A 1XEZA 4QYZJ 2QA1A 2WK4A 2DISA 3SCIE 4EUVA 4F0KA 2J0QD 4DU8A 1YK9A 2ATCB 1Z2LA 4OX6A 1RADB 2OD6A 5KT6A 1S1WB 1GK8A 1URNA 2G13A 2H4YB 2J8AA 4HYKA 4WP3A 2KRBA 3P49B 2QLWA 2OMLA 2DPIA 3AT1B 4B9UA 4DV0F 1ELOA 1F5AA 2CRLA 1NK6A 2W7OA 4KC5A 1X4HA 4BWJA 3AD9C 3CMAS 4YR2A 3CCWA 2V4RA 4KQZA 3QO9A 5ETSA 3P8BB 2DGWA 4USJC 3TQ1A 2V8HA 1TL1A 3UNGC 2B7CB 2HK3A 1FCAA 2UVUA 1WHYA 3JS9A 1AXQA 4CM2A 1BY9A 2PSZA 3MMAB 3CDAA 2CIMA 2DCUB 4WPAA 1R6VA 5F41A 1M5VC 1S48A 2QMUB 1Q8LA 2RU9A 3T1HF 4ZP8A 4HVZA 3SIPB 2HNDA 3FKBA 1RT1B 1RT4B 3MM9A 2FJDB 3R2CJ 1KEKA 3UR3C 1Y4ZB 4J9PA 4NA1A 1NJXA 3K8WA 2HEKA 5I4MA 3AD7C 3QIPB 1JLQB 3KTQA 4WIQA 4USKA 1RAJA 4IQMA 1RWUA 3MEDA 3GTYX 2Z57B 2BUNA 1HA1A 3VVTA 2KFNA 3BDPA 4ZVGA 3HFZB 4CO5A 4K4ZA 1S77D 3M2RA 3DRPB 3PYFA 3UFCX 1MMLA 2HFSA 2J9EA 1VR6A 2HHQA 2XQCA 2LMIA 3T19A 1UFLA 1HPZB 1EKRA 3D67A 4DR6J 3MM6A 1WUUA 4KJIA 3BB5A 1TKTB 2WTFA 2NPIA 1U0SA 1Q81T 1VQYA 3TJ8A 3HFKA 4NCGB 3OD2A 1EZZB 3ZZTA 3CWJA 4NE9C 1OY6A 3V6KA 3NNAA 2D74B 5BR8F 1V5VA 5A2QU 4N8NA 3T1YF 2WOMA 4WE1A 1RWXB 4I4BA 3C14A 5LMUF 3SCKE 2PO4A 2C3YA 4O4GB 3JSMA 2YNGB 3IS9A 2WSCC 4IH7A 3LP2A 3FUYA 1E6VA 5ETOA 2DRBA 3D6MB 2CJXB 4ZPVR 4NLGA 1YI2S 1QJHA 2N7YA 2I1RA 2JZ5A 2DIVA 4E0DA 1YJNS 3MMBB 1S59A 2JLFA 2Z30B 4RBVA 4ERDA 2LU2A 4DBQA 2VONA 3MTKA 4NLDA 4TN2A 4B3SF 3GIIA 3CXCR 2GVZA 2VBZA 2K7JA 4AUKA 3LGHA 1WWHA 4U8VA 3R5GA 3MTJA 1REVA 2BR0A 1X8DA 1FWLA 4AQYF 3BN7A 5GVQA 3V4IA 1HD1A 4DV3F 2G4BA 1Y5IB 3DHWC 4LF8J 5J2PB 2YPZA 3NBPA 2Y3YA 4MT1A 3QSYB 3QATA 3JSRA 2KJWA 1NNDA 4A8YA 4QR0A 4KO0B 5EGYA 4NLYA 1L3UA 3IR5B 3WX8A 3CSKA 2W01A 4F67A 2IRXA 2DGOA 3G8QA 3PIPQ 4ECZA 4IH5A 2EFVA 1CLFA 5T7LA 2HHHJ 3KLFA 2WHOA 1YRUA 4KV8A 1X4CA 3KK1B 2YNFA 4ZCLA 3OR1B 2OSRA 4PUOA 5AXMA 3L7OA 2XHCA 2E7WA 4CH7A 1LWFB 4YB5A 2VHGA 1NKBA 1JLGA 3P6YC 1IBKJ 4NLWA 5ETLA 2W4DA 1T03A 1XMQJ 2AJFE 1S12A 3SDEB 1ZZNA 4PWUA 4KGVB 3WC0A 5L38A 2FJAB 4NA2A 3HD1A 2OPRB 4DF8A 2VBXA 2UU9J 3JYTB 1HR0J 4ZJQA 4NMLA 3DLEB 4OI4A 1HBNB 2E5LF 2IVMA 3I82A 4MKYA 4LF2A 1JB0C 2AKWB 5KFBA 1A6LA 4DV5F 3CDBA 1ZS6A 2D69A 1SJRA 4JV2A 4QZVB 2L9WA 4WFNQ 2GX8A 2W8KA 2BJ9A 4Y2IA 3M7VA 4ID8A 1CS4B 3RJMB 5EN1A 4DV6F 1CPZA 5DQIA 1SH3A 2HIQA 4HLBA 1MROB 3RRHA 3OVBA 1FE4A 1KONA 5EWFA 4P10A 3QZ8A 1O8BA 2AIRB 1UW4A 2ZVIA 4UTGA 2DD8S 1DAXA 1FTCA 2NREA 1S4EA 4ED8A 2J6TA 4IG3B 2YQ0A 4DZ6A 5LJ3Y 4DX8H 1DBDA 3HX9A 3OL8A 2BJ7A 1BE4A 4ZVHA 5CZXA 3T5HA 4H4OA 4NPOA 1RT2A 3JQKA 1I94F 4HT5A 2RDIA 4ED4A 3TEHB 1WTBA 4PKDB 4FF4A 1QSLA 4ES2A 2WZ1A 2QLXA 4Z37A 4B3OB 4NWBA 4U6PA 5D0HA 4J9LA 2DJWA 2NSBA 2W2MP 1VQSA 2WVEA 4EZ9A 4WJBA 2RAQA 1T3OA 5GMKa 3OW2R 1VBKA 5EDWA 1XC9A 3EDQB 4OJGA 2VL1A 4P7VA 5E0OA 4H54A 5HLFA 3P45B 4LREA 2HWTA 4RNHA 1RT7B 3R1HA 1GMWD 1WF1A 2Y8YA 1TK8A 5THWA 4C11A 1Y5NB 1NAQA 4N8OA 1VQ9S 1V3ZA 2M88A 5GAGU 2NUUG 2YBVA 4RW7B 2FJVA 4B3RF 3RW7A 1WEZA 3IWLA 4RUCA 2VUGA 2OEJA 1TKXA 3DLGA 2WRMA 3BF4A 2Q1LA 2ZHBA 2J7UA 4KAIA 4F4KA 3DRRA 1RCOB 1LK5A 1RA7A 1WNEA 2A0FB 3DOLA 4DS4A 1B70B 5T14A 1KNZA 3RBEA 1WF2A 4KPYA 1K0VA 4ZPAA 5LMNF 3PJ9A 4ZPDA 3IRXA 1FRMA 4N76A 5AT1B 4OX7A 2BKPA 1EB0A 1YKWA 2MZSA 2DNLA 2QC3A 1QSSA 4RO0A 1ZM2A 4DX6A 1AROP 3MAHA 2UUAJ 3QWPA 3L7PA 5KFRA 2R7TA 4C0HA 3W9HA 5K8MA 4QPTA 1SH2A 3OFGA 3JB9k 3G6ES 4K4XA 5HMXA 3T41A 1KP6A 2XMWA 2FVPA 1UFWA 2VDIA 4NCAA 5DETA 3DGPA 4EBEA 1PBUA 3ZZ0A 4QYZK 3BSCA 2B3TB 4EEYA 3LQVA 2RS2A 1N56A 2UVWA 3U27A 1HWIA 3W5XA 2R4FA 1JXVA 2YWWA 4JI2F 3FBCA 2KJVA 5F8MA 3FCHA 1E6YA 1GMWA 1VISA 1OO0B 2DNKA 1S1XB 2FC8A 3NLCA 1XNRF 4K4SA 3BGRA 3K89A 2CVEA 4DSJA 1XR7A 1HQ2A 3N6NA 3JSYA 2P8IA 3P96A 2W9CB 4IO9Q 2FJBB 3C15B 2WSEC 3J7YI 2JFDA 1FJGJ 3EXCX 2CPFA 3F41A 2V68A 4C8MA 3PW0A 4TU8A 4ED3A 3MMCA 4JI7F 2XI2A 2W2QP 3T5JA 4ZITA 1SC3B 2H5EA 3VAIA 3TAMB 4ZVEA 3HFVA 1S6UA 2DIUA 1RWKB 3HHLC 1RBAA 3R1LA 1NBEB 4FYWB 4NLRA 2OUGA 4DUZF 1F5CA 3C6UB 5GMDA 4EO6A 3I5CA 1RWOB 2O5DA 4QQBA 5CCLA 1T9WA 4J9RA 1Q79A 2HHUA 1SC1B 5HQ8A 5ETPA 2NPFA 3TARA 1CJTB 1RWWB 4HDGA 4I6YA 3DXBA 1ZA2B 4CO3A 1SXLA 4WYLA 4CLZA 3MHYA 3CD0A 2YKAA 3MPUB 5EHHA 4DFPA 3GG1A 1RYRA 2MJUA 3MCNA 2BJDA 3HULA 4WTYA 2UXCF 4LIWA 1GTEA 4W4MA 4IDKB 4PWDB 1SUQA 1J5OA 4BCAA 3MR3A 4HT7A 3ZZZA 2VASA 3HHLD 1QAIA 1LWXA 4AT1B 4DHVA 1WACA 4NEYA 4I67A 2E7VA 1KVKA 1S9EB 2R7RA 3Q8YA 5HROB 3HM9A 1HBOB 3EPGA 1UMJA 4K4UA 4KTQA 1KBRA 2I8EA 4NLTA 1UJ5A 4YHHF 4YFUA 3PXGa 4FF2A 1RU1A 2HFNA 1NSKL 3BSNA 1SC6A 3PRVA 1SKSA 4QIVA 3B6BA 1BWEA 3IMQJ 2E5JA 4ILRA 4DV0J 4JB8B 2QFJA 5F0UA 4OYIA 4Z7CA 4F4AA 1NB2A 4DV2F 2AF6A 2HRYA 2LQ5A 4DQRA 3FFIA 3MPVA 1UETA 4DSFA 4J91A 4EGLA 3KLHA 3D1HA 3ILOA 1U49A 1AYEA 4QPXA 3RR7A 3KG4A 3R9LA 1N4LA 4JUZA 2ZITA 1CQMA 5H1SV 3WDOA 1FNXH 2CXEA 4DSEA 4ETZA 1F3FA 1VQ5S 3H0PA 4DR4F 3EE3A 2NXCA 2DR8A 3DOKB 2GVDB 2NXEA 1L3VA 3BBBA 3T1HJ 2Q79A 1RZMA 4CLTA 2JL9A 5A8WA 3M32B 2AZ3A 3VAFA 3HT0A 4U7UK 2BV3A 4U7UD 2EG1A 4TXSA 1OYEA 1V3RA 2OJ3A 4ZVPB 3IN5A 2YKMB 2XSJB 1RQ0A 3HHLA 3PYGA 5B7WA 1P1LA 2CZ4A 1JLFA 1U1LA 1ZAXA 2UUTA 1S1VB 3D54A 3MXHP 5DZ6A 1HWKA 1JLBB 2OHDA 4NI2A 4A8XA 1CJKB 1T9VA 3IFEA 5EX0A 4DN0A 5I3UA 4K0KF 2OPPA 3M8QA 4MK9A 2EEYA 2JEIA 3CCJS 2BBEA 4ES1A 4HACA 3AB2B 1HBUA 1C1BA 3BZQA 3GLJA 1YJ9S 1JX4A 1WHXA 1DTQB 3MFIA 1FXLA 5BR8J 4Q2MA 4FYDA 3T1YJ 1UL3A 4F50A 3NCPA 1LK7A 1LXJA 1VRTA 3UD3P 2HBYB 2HNYA 1RAFB 3DGVA 2BOAA 4OIXA 3G6YA 2EC2A 5LMUJ 3H4BA 3CB4A 2MZRA 4FXWA 3POTA 3KNGA 2BKNA 1FKOB 4QIFA 2D3O1 2P9GA 4KGXB 5KFFA 1RBLA 4ICLB 2F4FA 3TVKA 4OJHA 3A8JA 3PR4A 3AOCA 2LVWA 4NEZA 4CT8A 5KFXA 4KYZA 2X3DA 2WONA 1D09B 2K7KA 4OLOA 5GMEA 1X0PA 3UN5A 5HK4A 4K7QA 1WSRA 1S72S 2YQ1A 1J2VA 4B3SJ 4ECTA 1Q5YA 1F6TA 3NGSA 2WVBA 5DDOC 4AQYJ 5AJ3F 4DV3J 3RBZA 2B9YA 1U1QA 3BR8A 3LH2S 3D9BA 4NLVA 1VQNS 3UN2A 2NUHA 4YUDA 4WU2A 2J7KA 1BQNB 2KXFA 4Y34A 4C9DA 1VQMS 4M95A 2R7QA 1N33F 2WW4A 4C97A 4MK7A 2MPUA 2PIIA 3OT9A 3FZBA 1NJWA 2VJUA 3CJQA 1HNXF 1WOPA 4FXVA 2OEMA 3J81j 1A9NB 3GCXP 3KK2B 1UWAA 1QDUB 1YITS 1S1WA 3UCGA 1RU2A 2HPUA 1WSVA 3DYAB 4HR2A 2V2ZA 4DV4F 2QSFA 2HS0A 4NCBA 5B09A 2BJ3A 2IC3B 2CNNB 2RUGA 1S7HA 3VQTA 5DDRC 4UUXA 3SYZA 1QTNB 1LQ9A 4I6AA 2VA2A 3IBWA 2DPJA 4ZOSA 4W90B 3D1QA 1MMNA 2E5LJ 1S6OA 5K8NA 4M5NA 2CZVC 3EDRB 2HNZB 3H5YA 3MMAA 2HQCA 1WC0A 2GQ2A 1LWCB 1G1XA 1BHNA 2X7IA 1CVJA 5HVFA 3H25A 1S6PB 4IQXA 1KR4A 3H90A 3EGVA 1NZAA 3OFEA 1RT4A 1UW9A 1S9FA 4DV6J 4X84A 4UY85 2BE2B 4DPUA 1RT3B 3I0RB 3MWBA 1Z2ZA 2MSTA 3M4XA 4PEOA 2KH9A 5DS7A 3K57A 3QQCD 3QIPA 3O6QA 1JLQA 3KG1A 3CCMS 4K5SA 4OZ1A 4DX7A 3WIUA 3L09A 2ZOMA 2LEAA 3CTRA 4V19J 4FBUA 1TUGB 3HMJG 4EWTA 2WAQD 3DRPA 3IRWP 6FDRA 4B3MJ 4XDCA 1F2HA 3GZ7A 3VVUA 1VQKS 2EPIA 1G4CA 3GV8B 1R43A 1HPZA 1B7YB 4UZCA 3BKUA 3W61A 2FLPA 5J2QA 3FQKA 4PAAA 4Y2CA 2DH7A 1TKTA 4LF5F 4ED5A 3A8KA 4ELUA 1I94J 4NCGA 1ZA1B 1BWVA 3PX6A 2DITA 4YY3F 3A12A 4WKYA 2VJVA 4H4KC 2GCFA 3CULA 1Y3JA 4F0HA 3UNYA 4AL7A 3ILLA 1FT8A 1NMEB 4O4GA 3HJFA 1YLXA 5DDQC 4DL5A 2YNGA 4LFAF 3GR0A 3LGMA 2CPZA 2R8JA 1GXLA 1FDAA 3MPWA 3MR2A 3MR5A 2AX0A 4EO8A 2M52A 3N0VA 3A8IA 3QFHA 5DG7A 1L3KA 2B9XA 1VK3A 3Q0AA 1JJ4A 2YX4A 5D4OA 1QTMA 2RQMA 2J5AA 4MTPA 4NLSA 5CXTA 3CD6S 4P7TA 2C3UA 1WKKA 3K58A 3R7NB 4QBUA 2V2VA 2QV6A 4HL9A 4YN3B 4WU3A 1H2UX 3JTNA 2ZWPA 4Y2KA 3QJPA 4YEAA 5BYQA 1KOOA 5CYMB 1WHVA 1ZAWA 1PC4A 5J2PA 5LMNJ 3IBCB 3JSBA 3CCZA 3KHRA 3R5BA 3BO2A 3CCRS 4KO0A 2M7SA 2CADA 2V4JB 2N3OA 3GP9A 1TVRB 2JJ4D 2XCAA 4F8RA 2LDYA 1XWLA 5KG6A 5I3QA 4USMA 2CPIA 4TU7A 3MR7A 1RBOB 2M70A 1L5UA 2HG4A 2ZOFA 3CIMA 5CABA 2EBEA 2AWZA 3HZEA 3KK1A 4DI6A 5KFSA 3M8RA 1XERA 3OR1A 4F2RA 2EK1A 5LXRA 1VQ7S 4ZIWA 2J76E 3EYZA 4UT4A 1LWFA 2AX1A 4JI6F 1RAIB 4JI2J 3HSDA 4DPTA 1NK4A 4LSLB 2RRNA 5KFWA 3JXOA 1RUSA 3LOUA 3SDEA 4ECWA 1AFIA 3FMBA 4DR7F 1XNRJ 5DG9A 4GC6A 2HHSA 3OXGA 5HQLA 4IOAQ 4QWAA 3TRGA 2KU7A 2QN6B 4C7QA 1S0MA 2UXDJ 2OPRA 4CO4A 2VBYA 1W2IA 2DCLA 3JYTA 5FLXY 1DARA 2C42A 2LA4A 3DLEA 3PM9A 1HBNA 3TUPA 4NLUA 3D28A 1GX6A 4JI0F 1QY7A 4YQWA 1YZ6A 3NOGA 4JI7J 2XY6A 3P4UB 4M5IA 2YKPA 1XN9A 5DM6Q 1RT5B 5L39A 1KOHA 1OS5A 2YPYA 4H4KA 3CE8A 3TUJC 4HTJA 4DUZJ 5CHCB 1CS4A 4WE1B 3R6LB 4ECUA 4LVOP 4GC7A 4OZLA 1MROA 2VC0A 4MIAA 2RHQB 1N54B 2GAHC 4Y28C 1R0AB 4OHVA 3AOBA 2CYYA 4ILMA 1KFDA 2E5HA 1APSA 2RILA 2OAUA 5ETRA 3FNNA 2D3OR 1KLMB 4BWMA 2LQJA 5M2PA 3VWSA 2C2MB 5F9NA 5KFKA 2V9KA 4IG3A 1U09A 3ZZPA 1IKYB 2AMCB 3I5BA 3RZAA 5HAOA 3BYRA 4IO1A 2UXBF 1SIZA 3N6LA 4JI1F 3HHDA 6FD1A 2W24A 2AYGA 1IM6A 5D4NA 4NLOA 4WKRA 4PCQA 1F0XA 3GFHA 1TV6A 2CJQA 2CJ9A 2ADCA 1MMDA 4QOTA 4B3OA 3TA0A 4IR9A 2XS7A 3CDWA 3OTEA 2SXLA 5KT4A 2C2KB 3WQPA 2MQQA 5KG3A 2E1AA 4YDDB 1SL2A 3OPKA 1IVZA 1HNZJ 3OL9A 1RT7A 2V2KA 3RB4A 3KLFB 4DV2J 4U96A 5DLFA 3MI7X 2ABYA 4WFZA 4Q8EA 1Y7PA 2OTJS 4P74A 2PE8A 4PUOB 1ACMB 4HTIA 4UOGA 3L7UA 5CYQB 3NMAA 4U95A 2R7WA 1RTIB 4G1QB 3KHHA 2DHSA 3ET6B 3ZO7A 2VG7B 3N01A 1QD1A 1WG5A 3ZFVA 5C7PA 2JEJA 1VK8A 2NLWA 4L74A 1IUJA 4LF6J 1FEHA 3PJWA 2NR0A 2ZE2B 1S0VA 4NX9A 3M8YA 4LBHA 3Q8PB 5M2RA 2G1DA 1T8EA 4I6WA 1R6YA 4TLQA 3Q8SB 1KVIA 2V67A 4DL7A 2A3JA 1FVSA 3CNQP 3THVA 4IH6A 2FPHX 3TANA 1AUSL 1OY9A 4TQRA 3MEKA 1MG7A 4LR9A 4OHXA 1ZPWX 3O3LA 3GR1A 5T41A 2M3DA 4LF7F 1IKWB 1IM4A 2IM2A 2OSQA 1UJ4A 4K0KJ 4L6V3 4URQU 2KO1A 3WC2A 2HHPA 2KKHA 5GAGI 4HHHA 3Q2TC 4F0MA 8ATCB 1G6BA 4RNOA 3QGPA 4WFAQ 5EWGA 2HRTA 5G4DA 1S1XA 1SL1A 3HSJA 4P52A 3IP0A 3UDEA 5ETQA 2ZZNA 1VJWA 3BSOA 2W9CA 2GIFA 3NNCA 4P6QA 2ZH1A 4HH0A 3W66A 3R27A 2OIHA 5AXNA 1D9DA 3M30B 1Q1KA 1S6QB 4Q2LA 4A46A 1FI4A 1FE0A 2GMHA 2UVRA 2XNRA 1AW0A 2QL7B 1I3OB 3TAMA 1R8AA 2DK2A 2MQOA 1C4AA 5IWAJ 4RZRA 1UVIA 1SV5B 1T3NA 4Y00A 1R89A 3MPDA 3BO4A 1S97A 5HMWA 5HJYA 2ZH6A 5KG2A 3C6UA 3CUNA 1CC7A 4JI4F 4FKXA 3A1YG 4PG7A 2JOQA 3LO3A 4G65A 4CLYA 2F9JA 5KFHA 4DCPB 5KFYA 3MAAB 4LRDA 3ZTPA 1H74A 2ROPA 1CJTA 3PKYA 3E2EA 3DU5A 1KHVA 1ZOTA 2AEMA 3QBCA 5AJ3J 2H1YA 1V5IB 2J0SD 4OI2A 3R2DJ 3BH6B 4ZVOB 5KFGA 4RU2A 1F9FA 1BQXA 2BE9B 4DQIA 3SQGB 2MKCA 5KG0A 1FO1A 4CLFA 3Q8QB 2DNRA 1FESA 1Q86T 2BM0A 5E41A 1VYAA 4J9QA 1VQOS 1W25A 3BO3A 5CCMA 4IDKA 4MFBB 4PWDA 5D78A 5HBMB 3C6TB 3DRYA 2CNKB 2ZBRA 3GFXA 4K59A 1RCXB 4P9SA 3RB3A 1R3NA 2DR9A 3LW5C 1VIXA 4UUWA 2B4VA 2HFUA 2F8HA 2FC9A 1HNXJ 1JNRB 2E66A 4I1TA 1S9EA 4X62F 3OV7A 3IRXB 5HROA 2ERRA 1HBOA 5I3PA 3PEJA 1YJTA 3K8VA 3KJNB 2E9ZA 3A3PB 4GVLA 1NK0A 2BA9A 2JHEA 2DH8A 4DPWA 2F63A 1HHTP 5HVHA 4ZIVA 4Y6IA 1T0TV 3ENQA 3IG1B 3CDEA 4WFXA 2CA9A 2APOA 1I51B 3OXFA 4J90A 3M8PB 3GONA 4KE5A 1URRA 2E5IA 1NH8A 5DM7Q 3NCQA 5KFCA 2ZHOA 3BREA 1E6YB 2AV5A 1N5VA 3DOKA 2GVDA 4FN5A 1TMMA 2GFFA 2A10A 3M32A 2QRRA 1U1NA 1EP4B 2V8GA 3D68A 2MHNA 2ZKTA 3HJVA 3AJ2A 2XNQA 4QWBA 1VLOA 2A6MA 1S1UB 2PI4A 1RHJB 2H5IB 2V4QA 2BMBA 5IV4A 2UUBF 3H98A 2XSJA 3DKDA 1LXNA 1RTZA 4J9NA 4MIBA 4NYZA 2F65A 1YRTA 5DG8A 2R8IA 2FHKA 4X66F 5DJBA 4K8RA 1EQMA 1TR0A 1KQKA 3TA2A 3U1LA 1S1VA 1FRIA 3J7Z5 3SV4A 1WHWA 1DY3A 3BJYA 2O66A 2LFVA 3GU0A 4DV1F 3UN3A 1JLBA 4A48A 2OELA 1V6HA 1CJKA 2K3KA 2NS1B 1HMVB 1H73A 2KVIA 4RBUA 1VMBA 1NXIA 2LU1A 1TKDA 2ZC4A 5DO2A 3B8HA 3OJSA 3KDNA 2FJXA 2FJEB 5A0YB 4DDFA 2XMJA 2JC0A 2KYXA 3ONQA 1BLUA 4LT6A 1N88A 5L9NA 1M1HA 2MB0B 3X1LB 2OEKA 1DTQA 1XMOF 4AYBD 5DQGA 1FWKA 2R7OA 4B9SA 1ZTWA 3ENWA 2PC6A 2WVCA 1RWPB 3PR5B 3SFGA 1FWPA 3MM7B 3C8YA 1OMSA 4FNIA 3AY0A 2G9OA 4A8WA 2IBKA 3VCDA 4LFAJ 3BN4A 1SL0A 4B9LA 1HHSA 1FKOA 2UVVA 1NEEA 3TNVA 2ROEA 1JXEA 4ICLA 2FY1A 4OZ2A 3A4TA 3W1YC 1JJ2R 2R2SA 5KFVA 1K8AT 3OLAA 1SJ3P 2A2DA 1F9EB 2ZH8A 3OLBA 3G96A 4L72B 4F04B 3HXMA 4OQJA 2XYGB 2HHXA 1IQZA 3KYLA 4OZ5A 1T9UA 1U1RA 2PMZD 2HMIB 1RP5A 2CPDA 4TLRA 1R8BA 3PHTA 1RKIA 4USHA 4DSLA 4OYWA 1HHQA 1VRUB 3H7HB 3FFIB 1H0HB 1H2VZ 8RUCA 4XIUA 1KQSR 1BD6A 3D0IE 1H6KX 2GO9A 3DCAA 2AJ4A 1TP7A 4M1KA 2VG6B 1K9MT 1MU2B 5F8NA 4TNOA 1UTAA 4N41A 3SBMA 2ZH7A 1SKWA 1J5EF 5F8IA 1X4EA 4MKAA 2MKJA 3KLEB 2D3ZA 4ECYA 4YS2A 4ELTA 1SH0A 4YB1P 2DNGA 4LMZA 1VHIA 2DGUA 1RABB 3KK2A 3T9ZA 2MY7A 4FZVA 2WW8A 1VCTA 3OSNA 2XMUA 3DYAA 4CT9A 4MYUA 2QSWA 4I64A 1NDLA 2RRAA 5K14A 2OO4A 2CUYA 1CC8A 3W2WB 3GFZA 2MQLA 4NXMF 2H54B 2JVOA 4UQTA 2KFZA 4Q8FA 2W8LA 1DRZA 3I56S 4BDPA 2FJWA 2VOOA 2ZWOA 3RTVA 2E9TA 4BBYA 1NJZA 4BC9A 2KFYA 1IJEB 3ZZOA 2OH2A 1M1GA 2MTLA 2BRLA 4OYOA 4JI0J 5KFTA 3DRSB 5SUHA 3M1VB 1IBCB 4DR5F 2BW2A 2DB1A 2DNNA 4OYZA 3QNWB 2KM8B 2XZDB 2HNZA 1C1BB 2MKKA 4QWEA 2EBGA 1FDDA 1LWCA 4A8SA 1ZTTA 2XMAA 1S6PA 4CM0A 1KVJA 1J27A 1FJEB 3QWUA 4N77A 4PPDA 2BE2A 1IWAA 1FRJA 4OI0A 5E7OB 3I0RA 1FJ7A 2MZQA 3UD5A 1X4GA 3N5FA 3O5TB 3OTCA 1OJ4A 2HGNA 1PYTA 4IRKA 3SQOP 1SJ4P 4BLGA 2N3LA 1FD2A 3QFWA 4ZP7A 3KK3B 4QR1A 3IBFB 2RQCA 3U02A 4PRFA 5FJ4A 3DLBA 1VDHA 3AA9A 2VPXB 3H2VE 4KBIA 4OZ3A 3MF5A 3Q86A 4M5JA 5GADU 4K2XA 1WORA 2QMXA 5HVGA 4J9KA 3CIZA 2IBOA 1UEVA 2KRRA 1U1OA 2F4VF 2UXBJ 4UOCA 4EBCA 2LDIA 1QVFR 2FB0A 2PMHA 5ETNA 2YWGA 4A8OA 1GH8A 2GW8A 3UDLA 1NU4A 3LP0B 4C3LA 1IN0A 3EVOA 4RW9B 3WZ0A 3AH6A 3QLHB 1N36F 4B9MA 1NPKA 3BPSP 3VALA 2F40A 2GC8A 4Q0BB 2LXIA 2HZCA 1KHWA 1YJWS 2ZH3A 1FRXA 2YNIB 1PYSB 2ALYB 1NDKA 1V9OA 3HKWA 3I5AA 1RAAB 3M6UA 4K4WA 1ULRA 3PFEA 2EKNA 3UCZP 5BJRA 2AEJA 1Q16B 5LJ5Y 3NMRA 2ZH9A 2HRUA 1NKCA 3CGIA 3C3LA 1S0NA 4FS2A 5DQHA 1QUVA 3EWGA 3LUYA 4KR0B 2CQHA 3CMES 2Y1RI 3DXSX 1UZHA 5KFNA 5KFPA 3I55S 2K1RB 5F8LA 1VBXA 2Q66A 3DLKB 2MZTA 1FFWB 1FKPB 3RAXA 5KOWA 2XLIA 1HI0P 1NK7A 5CYMA 4LF4F 1KDNA 1PSDA 2YQ3A 3T6BA 1VC0A 3JTPA 1Q7YT 4DQSA 1HQUB 4FDFA 2CQCA 4RW8B 2ZBQA 3C2PA 1U6BA 2MYFA 4XTTA 4NLQA 2XM3A 3H20A 2XEXA 2V4JA 2R7SA 2VFSA 3H5XA 1TVRA 3CJKB 3G4SS 1I6JA 2YNHB 2BJ8A 2LXFA 1B0PA 5ADZA 4LBPA 1YSJA 5J1NA 2W4CA 3V4MA 2BANB 1IWGA 4C4WA 3L95X 2GQQA 4LF7J 1M5SA 4O0IA 1MNEA 3K5LA 4MMOA 4O44B 1YTYA 2BM1A 1UVLA 2B9WA 3W2VB 4JV5J 4MYTA 2WVFA 4ZLNA 1G7CB 4LSLA 1GXTA 3EX7B 2IRYA 4G1IA 1SQFA 3HLUA 3K59A 2HBQB 3RAQA 4M5HA 1X0FA 4KIAA 1MWYA 2LP4A 2E1CA 4DR3F 1IR2A 2K3IA 3DU6A 2DNMA 3W8PA 2XMVA 3Q22A 3KUEA 2BEFA 5J2QB 5IQQA 2DXEA 3AOAA 1RT5A 2EXUA 3W63A 1S1TB 1DZ5A 5ETMA 2UUWA 1Q8IA 2VDHA 5C24B 4DQQA 5KT7A 2CPHA 1YJVA 3IWXA 1T9YA 4DPOA 4JI4J 1RTHB 3UPFA 1RDRA 1T94A 1OSCA 3IA0A 2MKHA 4GVBB 3ZZRA 1WI6A 4LSNB 4LVNP 1R0AA 4EYIB 2Z2YB 2P9EA 4ZS6A 1DTTB 4OZ0A 2V8VA 1VBZA 1Y10A 3K7RA 1NK5A 1ZZFA 2ZJRQ 3J7A1 3D4JA 2Y9HA 3HK2A 4JV1A 2LCWA 2CAJA 5JMNA 1KLMA 2HQDA 3TWZA 3D6TB 1NSQA 1TKZB 4P2SA 1IKYA 1EKSA 2M0GB 3D0HE 2RQKA 1A7GE 2H3EB 2IYGA 3FVYA 1S7IA 1YRXA 4WF9Q 1YG0A 1V3SA 1VRQC 4MH8A 3B54A 4DFKA 4M5GA 3CCES 1NJIT 3HVAA 4O23A 4OJ3A 3OVAA 5AXLA 2ZH5A 1D9FA 2VIHA 1TFYA 3BQ0A 2QA2A 1S99A 4ECXA 3MCOA 2Z8QA 2VQFF 3UD4P 3MUTP 2UV8G 2DYAA 3G87A 3FQLA 1K73T 2DNHA 4OV6A 4WYWA 4RWWA 5C25A 4RJVA 3D6HB 2GAGC 1F3VA 4ED0A 3H4DA 2IVYA 5E3QA 2XG8A 3BEGB 3UDVA 4ZHRB 3IM9A 2ASDA 1FNMA 3BM7A 5IS2A 2I5JB 5CYQA 3US5A 3FRZA 2HHVA 1RTIA 3TJAA 1C0TB 4G1QA 5L46A 5AE3A 3ET6A 3MCSA 4FS1A 1FXRA 5K8OA 2HVZA 2LQBA 2X1BA 2VG7A 4IUFA 5IV3A 3CDUA 4YB6A 2GGPB 3AJ1A 2ZUAA 2R8HA 1NB7A 2WBRA 2E1RA 4QW9A 4PR6A 1RAHB 3FDSA 2ZE2A 2ASLA 2ZM6F 3AJDA 3BKTA 2R2TA 3TO8A 2PA8D 4USWA 4YR0A 3NWGA 2BKOA 2ADBA 3G9CA 4DMZA 1RHMB 1R31A 1VC5A 4X66J 4U9RA 3MOJB 3VGUA 2L41A 4RKUC 3HHNB 4CO1A 3MAQA 2N4CA 2Z2ZA 3CEDA 4QU7A 4NLXA 1MWQA 5D0GA 4DV1J 4ZDNA 2QO3A 3KFWX 2VV5A 3KJVB 3HVWA 1IKWA 2JSXA 1QM9A 3FCVA 1UZDA 3PX0A 1FHTA 2EKYA 4ATNA 4OV1A 2N82B 2HYIB 2MQPA 3J7YU 4FXDA 4LRBA 2RKIB 4C8YA 3GYGA 2HBRB 2AP6A 1HWJA 5AE2A 3UVJB 2KT2A 1XMOJ 2XWYA 3R97A 4IFYB 2GJ2A 1WTFA 3GIKA 3B82A 3LPYA 5B0AA 2VFTA 3TQEA 4B08A 1QE1B 9ATCB 2C2RA 4ED6A 2ZH4A 4UY8T 3S6EA 3KJQB 1WG1A 3M30A 2YWFA 1S6QA 3W3SA 2ZBCA 1GNKA 3ZTOA 3BH7B 5GAEU 3SZ2A 5IT0A 2O01C 2DTJA 1XK8A 3K17A 1T9TA 1C0UB 1H38A 2D9OA 1SV5A 3PNIA 4ELVA 1QLNA 1JIHA 3V6HA 1TV6B 2M8DB 2LLZA 3M9NB 3W60A 4CLUA 1LNQA 2EK6A 1GT8A 2ROGA 4CH0S 3MECB 4USVA 2ZD1B 1YBAA 1WEXA 3MAAA 1KC8T 4R0EA 2IFXA 2PDAA 3R8YA 2BJEA 5J1EB 1Q95G 1Q4RA 2HQFA 7AT1B 3CJ4A 2HVEA 4GRSA 4ZLJA 2RE1A 2XTJP 2IYIA 1VQ8S 2RNEA 3SQGA 1TK0A 1TAUA 1OY8A 4P72A 4C48A 3NGKA 4XK8C 2CQ4A 1B4SA 1WOOA 2VOPA 2QL5B 4MFBA 5HBMA 3OFHA 1UP1A 2BZ2A 5JJBA 3NKYA 4YP3A 1ZETA 2AJ2A 4DLEA 3C6TA 2ZUGA 1J5EJ 2YH0A 1QUPA 1TUVA 2R7XA 5IM0A 4O3SA 1XR5A 4D3GA 4QIEA 1IBLJ 1DHMA 1GAOA 1VC6A 4M5DA 3VGVA 2MEWA 1U02A 1TL3B 5HO4A 1PC5A 3KMSA 2MDAA 3NS5A 2XLJA 4OX8A 4QJVA 1IJFB 2CQIA 3V6DB 3QRPA 2HQIA 2W2OP 2ZVSA 4CP5A 4DV7F 3QT5A 3VZHA 4DPXA 4ZVUB 2MMYA 5F3TA 4PG8A 3Q89A 3TUZC 3UE2A 2DBBA 2ZC3A 4OI6A 2MQMA 4L75A 1ZYQA 1UKUA 4CLPA 4B3TF 1P9YA 3IG1A 3TX0A 3HHKA 2KXHA 2J0XA 3PYEA 1M1KT 4N7TA 3TX8A 2J8SA 2MGZB 1M5HA 2BDPA 3M8PA 4DR5J 4LR7A 5LSOA 3G8TA 3V6JA 1TL4A 3IGNA 3DDIA 3GFYA 1VLYA 1YWXA 3H2LA 2XGQA 2OMOA 3FBFA 3DLHA 4URSA 4J37A 2Y1LB 2JH3A 2GQCA 1VQPS 2FUG9 1WKJA 3CC2S 2QTWA 1EP4A 1FFGB 3VGTA 1S1UA 2V69A 1LV5A 3IGVA 3J80Y 3TUIC 2FD2A 1X4DA 1U25A 2YKNB 5B08A 1KSPA 2MHEA 4IFVB 3E8OA 4PABA 2NXUA 4LFBJ 1O6XA 1UAWA 4TY8B 1FRLA 4FYYB 1XTZA 2HKEA 5K8PA 3SSRA 4FP9A 3EXYA 1KQGB 2B9EA 5IZHA 3UO0A 4PG4A 3RBDA 1JKHB 5HSPA 2HAFA 5G0RA 4EBDA 2KT5A 3DLJA 1HMVA 5HP1B 3Q2SC 2F4VJ 3MURP 2CJKA 3MOZA 1YGYA 4CDIA 5A0YA 2YX1A 3PO4A 4A47A 1NPRA 2WB4A 3TJ9A 1M5OC 3V81B 1MSWD 3HVRA 1LKZA 3UCUP 2W25A 2ALZA 2KM8C 1AB8A 2LEBA 2WSFC 4NA3A 1ZH5A 1FRKA 1YDLA 1N36J 2FHJD 3B4MA 1N5TA 2H48B 2XCPA 4OI1A 3PFOA 3MM7A 4NRUA 5DLGA 4IG0B 2NQPA 2CG8A 3GYXB 2EFNA 2IMWP 5MAOA 4OZNA 4OYAA 3M9MB 3O1LA 2RB7A 2ATLA 4HH1A 1Q7LB 3BDEA 5EWEA 4Z7YA 2OTLS 3TAPA 2X51A 2LECA 1JK9B 3N79A 4C3MA 4PQAA 4J5OA 3PG9A 4OJ1A 1VI7A 3D0GE 2ZEJA 4DJBA 3M9OB 1KWMA 3W62A 4XDDA 3D1OA 5IC4B 5L1JA 3M8WA 4DL6A 2HMIA 1RHRB 1JWWA 5C42B 1HLWA 3NS6A 1VRUA 2OLWA 3MFHA 1HW8A 3OL7A 3U7JA
chains in the Genus database with same CATH topology
2E1PA 3WIUA 2PMWA 3QFHA 3CO0P 2XTJP 3T41A 3WHIA 4OV6A 3A3OB 2QTWA 1SPBP 2W2QP 4JP8A 4NMXA 1V5IB 2Z57B 3H42A 2Z2ZA 2ZWOA 2W2PP 2Z56B 4YN3B 1R6VA 2W2OP 2Z30B 3A3PB 3BPSP 3SQOP 3WIVA 3GCWP 2ZWPA 2Z58B 3A3NB 3P5BP 2Z2YB 4NE9C 1ITPA 3BGOP 3VHQA 1SCJB 3CNQP 3VV2B 2W2NP 3AFGA 3GCXP 2W2MP 4K8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1P A;  3WIU A;  2PMW A;  3QFH A;  3CO0 P;  2XTJ P;  3T41 A;  3WHI A;  4OV6 A;  3A3O B;  2QTW A;  1SPB P;  2W2Q P;  4JP8 A;  4NMX A;  1V5I B;  2Z57 B;  3H42 A;  2Z2Z A;  2ZWO A;  2W2P P;  2Z56 B;  4YN3 B;  1R6V A;  2W2O P;  2Z30 B;  3A3P B;  3BPS P;  3SQO P;  3WIV A;  3GCW P;  2ZWP A;  2Z58 B;  3A3N B;  3P5B P;  2Z2Y B;  4NE9 C;  1ITP A;  3BGO P;  3VHQ A;  1SCJ B;  3CNQ P;  3VV2 B;  2W2N P;  3AFG A;  3GCX P;  2W2M P;  4K8R A; 
#chains in the Genus database with same CATH topology
 3G2X A;  1G3O A;  4D3H A;  4RW6 B;  2VFR A;  4ZVT B;  5K5M A;  5H9F K;  1CUL B;  4GKK F;  3DN9 A;  1KN6 A;  2QZ8 A;  1P6T A;  1RTD B;  4HHJ A;  1LW2 B;  1TAQ A;  3MEE A;  3F73 A;  2VG6 A;  4DWI A;  4F02 A;  2POK A;  4C8O A;  2IAJ B;  4GMK A;  1MU2 A;  4KGK A;  2W9A A;  1HWL A;  3A3O B;  5E3R A;  3W64 A;  2HS3 A;  3FEX B;  3ZTQ A;  3O44 A;  1SB6 A;  4ZN3 A;  2XYP B;  4M5K A;  3KLE A;  3K5N A;  2JNJ A;  2M8H A;  2DY9 A;  3IR7 B;  2QGF B;  3SXL A;  2FHJ A;  2I38 A;  2FVR A;  2IJR A;  4WWS A;  4J9S A;  1F60 B;  1PIL A;  3W2W A;  2OPS B;  5J2N B;  3LPE A;  2FQQ B;  2NCK L;  4A8K A;  2XB2 D;  2IA0 A;  1S5Z A;  4G1P A;  4TYA A;  1OYD A;  1X4B A;  2KTQ A;  1N32 F;  3H2U B;  4DR3 J;  1CEZ A;  3V5R A;  5CYJ A;  2CJB A;  4CCH A;  1DLO B;  1HFE L;  1FK9 B;  1WDT A;  2N7C A;  5E3A A;  2V63 A;  1YX2 A;  2XBP A;  4LRF A;  3DRS A;  3CCL S;  3M1V A;  1TL5 A;  4O4R A;  1ITP A;  3M6V A;  1VQ4 S;  4HI1 A;  3PW5 A;  2HAI A;  1SPB P;  3N9U C;  1BQM B;  1HYS B;  4K4V A;  4DG1 A;  1NK9 A;  3HSG A;  4M94 A;  4ES3 A;  1I5O B;  2XMT A;  1N5Y B;  2FHO B;  2ZBI A;  5K9F A;  1X5P A;  4F3Q A;  2AT1 B;  4ZCI A;  3ETM A;  3CW2 C;  2LXU A;  2W9B B;  2PD1 A;  4RW4 A;  2ZJP Q;  5F9L A;  2JWN A;  1DUR A;  1Z4U A;  3AXM A;  4GO5 X;  2IM3 A;  3VHQ A;  2QA4 S;  1QAJ A;  3KG0 A;  1LW0 B;  1VQ6 S;  3BQ2 A;  2RU3 A;  2D1C A;  3KK3 A;  1NUE A;  2MQN A;  2G0J A;  1RAG B;  2E5G A;  1SVD A;  4JBC A;  4QIG A;  4NXN F;  4EI2 A;  2PEB A;  4WCE Q;  4ID5 B;  3UI3 A;  2FY8 A;  2DNP A;  3CJR A;  3LP0 A;  1K47 A;  2IRU A;  2R42 A;  2O3D A;  2G2Y A;  4OYB A;  2VG5 B;  5HQM A;  2F1F A;  4RW9 A;  5HAT A;  3QLH A;  2J6U A;  4CLS A;  4ER8 A;  1PKU A;  4Q0B A;  5L1K A;  1PIE A;  2CQB A;  3OTO F;  2YNI A;  3ISN C;  5KFQ A;  2VQF J;  3GCW P;  1D8Z A;  3PEH A;  3J80 U;  4HHU A;  4DCJ B;  2QFI A;  4WXO A;  4WII A;  3FCW A;  4A8F A;  1WC5 A;  5U47 A;  3K5M A;  2IM1 A;  3MM8 B;  1TL7 B;  3EM1 A;  1TUW A;  5C2C A;  4Q45 A;  3D2W A;  2CDQ A;  1D1U A;  3MM5 B;  2CKW A;  4KFB A;  3FBE A;  1Y11 A;  4X4T A;  2ZOG A;  4EU0 A;  1KTV A;  3LAM A;  1WG4 A;  3SCL E;  1TTH B;  1RLC L;  2HVD A;  4C0B A;  3S7R A;  5A8R B;  2QYC A;  5K14 B;  3GIJ A;  2CJA A;  3IXQ A;  5GAD I;  2G2O A;  2K1R A;  3BR9 A;  3VV2 B;  3DLK A;  1FKP A;  2HVI A;  2CQD A;  3C66 A;  2GIR A;  2R7V A;  2J7W A;  3MEG B;  4ED2 A;  5A8K B;  2FZK B;  2KVQ E;  2C2O B;  5HMZ A;  1AZS B;  1U26 A;  2UUC F;  3PAC A;  1HQU A;  4W92 B;  4FVC A;  2ZM6 J;  1U0H B;  3ISN D;  3X3U A;  4AXI A;  2BXJ A;  2MLY A;  4J7C A;  4RW8 A;  1WC6 A;  3PCO B;  4F3M A;  4F7V A;  4O3R A;  4KSE B;  3EZU A;  4FNH A;  3CJK A;  2HGL A;  4DV5 J;  1N52 B;  2YNH A;  4CWB A;  3TAQ A;  1SJF A;  3GPA A;  2YWK A;  3W5Y A;  1BXN A;  5ETT A;  2XLK A;  2BAN A;  4B9V A;  1O5J A;  4MKV A;  3THP A;  3Q23 A;  4DR2 F;  2GMJ A;  2R7U A;  4O44 A;  2XYH B;  5IQ6 A;  1N6Q B;  4WP9 A;  2HWH A;  3KHL A;  2G0C A;  1U47 A;  3R5A A;  2OFG X;  3W2V A;  1SJ1 A;  2EG2 A;  5L1I A;  1RE1 B;  3DC2 A;  3ENV A;  4Q43 A;  4O3P A;  1RLD A;  4PG6 A;  3I9V 9;  1R27 B;  5ETK A;  3IR6 B;  2VQE F;  2ILY A;  2FIU A;  3I87 A;  2R8K A;  4OYX A;  1LOU A;  4DL0 C;  2IM0 A;  3I4P A;  3U1N A;  3G6V A;  3JAM Y;  4L3N A;  2RSQ A;  2V5H G;  2CWK A;  1RK8 A;  3V2U C;  3ITH B;  2DGS A;  4J9M A;  2C22 A;  1TEL A;  2LYV A;  1IBM F;  5IT4 A;  1P8G A;  3D3C J;  4PG5 A;  2VA3 A;  3TOQ A;  1X5O A;  4M5L A;  2DEI A;  3H5S A;  4CTA B;  2EWH A;  2FVC A;  5D77 A;  5BYS A;  2C3P A;  4PQU B;  4CRJ A;  4EK2 A;  4W98 A;  1S1T A;  1R8C A;  1T95 A;  2HFZ A;  3TP2 A;  4KPC A;  2AYE A;  5C24 A;  2XUL A;  3J7Z T;  1MN7 A;  2DGV A;  3CJ0 A;  4WK3 A;  1RTH A;  4RR5 A;  1Q53 A;  1M0S A;  1KFS A;  2W1B A;  4CYU B;  1X31 C;  1FFS B;  4DFJ A;  3KNA A;  4GVB A;  3AD8 C;  2KXN B;  4LSN A;  3ULH A;  4ANC A;  1ZPV A;  1K0T A;  3E01 B;  1DTT A;  4LF9 F;  4Y2M A;  4AFF A;  3D3B J;  2VPZ B;  5KFA A;  2FVS A;  5KG7 A;  4F4Y A;  4LSZ B;  3EGN A;  1HL6 A;  5LSR A;  3FSX A;  4XO0 A;  4B3R J;  4UOH A;  4LFC F;  2DR5 A;  1TKZ A;  3TVZ A;  4YDX A;  1P9Q C;  1RTJ B;  2XZW A;  4J9V A;  3CJ5 A;  1RKJ A;  2AEF A;  3RB6 A;  2QLF B;  2B43 A;  4ZPC A;  2XS2 A;  2NZC A;  3W9I A;  3SFU A;  1MWZ A;  3U1M A;  3NWR A;  4A8Q A;  3LA0 A;  5IXU A;  1HI1 A;  3ZXW A;  5D4P A;  1UPP A;  2B5J B;  2KHC A;  3M6X A;  3R5D A;  4ITS A;  2F8M A;  2W2N P;  4ECR A;  2D7S A;  1N48 A;  4FF3 A;  2U1A A;  4URG A;  4DV7 J;  3MR6 A;  2IY5 B;  2M4M A;  1IKV B;  3IAM 9;  3RUB L;  3TA1 A;  3QPI A;  4PYA A;  3R5J B;  2JLE A;  5CD4 H;  4B3M F;  4ZLP A;  3NCR A;  3WX4 A;  3SMZ A;  1D3W A;  4B3T J;  3M2V B;  2K8G A;  1FTR A;  3NAH A;  3HHE A;  4AXJ A;  4F2S A;  3I0S B;  3QJL A;  4ZHR A;  2ZNZ A;  2H65 B;  2I5J A;  1GMV A;  1C0T A;  4I0W A;  2F7V A;  2IA6 A;  3QAU A;  2EFP A;  4ZPW R;  5A6P A;  1AA1 B;  3M2U B;  3MD3 A;  3LP1 B;  4U67 Q;  1NK8 A;  4UST A;  1T02 A;  4V19 X;  1UVM A;  3FK4 A;  2GGP A;  1U8S A;  2Q43 A;  3NG8 A;  1NDP A;  3MD1 A;  5EX3 A;  4ZVQ B;  3MUM P;  3G82 B;  1EET B;  2GJI A;  2IVF B;  4R5P B;  2GHV C;  1WJ9 A;  1L3S A;  1GMU A;  3VAH A;  2PN6 A;  1XJW B;  3TR5 A;  1U7L A;  3TYT A;  4NL5 A;  4LR8 A;  4H4M B;  1UVN A;  4MKB A;  1RIS A;  1X60 A;  3CC4 S;  3FBB A;  5C2G A;  2NYH A;  1JJH A;  4RU9 A;  3OSP A;  2FHM A;  3KJV A;  3ZC4 A;  2R9L A;  2NYI A;  2AYM A;  1CJU A;  4C3K A;  3N4W A;  2HQ3 A;  3FEZ A;  4G6V B;  1LEO A;  4TU9 A;  1RSC A;  3EVM A;  3DRX A;  5B0C A;  3EJM A;  2RKI A;  4A4J A;  3PO5 A;  1OQ6 A;  4ZN1 A;  1I1G A;  2Z4P A;  3PRB A;  5JVG Q;  5E5N A;  5DGA A;  3UVJ A;  2ZZT A;  4FPI A;  5LOQ A;  4IFY A;  2YKQ A;  1YBU A;  5KFI A;  2PT0 A;  3TEG A;  4KB7 A;  1QE1 A;  2IPO B;  5KFU A;  4U7C A;  2EFO A;  4LRA A;  3HPO A;  4DSI A;  3RR8 A;  2UXC J;  3KUH A;  4UZB A;  1HBM B;  1SQG A;  2XSF A;  1SI9 A;  3NL0 A;  2X1A A;  4RBT A;  3QYY A;  1B0V A;  2MKY A;  4O0N A;  1UWB B;  3AQP A;  2DHH A;  1RT6 B;  1HNV B;  1Y00 A;  3GQC A;  1O0P A;  3BGF A;  3KJF B;  3CCS S;  5KFM A;  2RH3 A;  2NXJ A;  1C0U A;  2DGQ A;  3PZP A;  4X4O A;  3OQ2 A;  3R3T A;  4YR3 A;  3E51 A;  3CO0 P;  3CCU S;  3DLL Q;  1NHV A;  5A76 A;  2FGC A;  3NGR A;  1VOM A;  4KRW A;  4YHH J;  3DHX A;  1JNZ B;  3UWT A;  3MEC A;  2ZD1 A;  2IJN A;  4RLE A;  1D8Y A;  2HVH A;  3EGZ A;  2ZJQ Q;  3DM2 A;  3L9Z A;  1RJJ A;  2UXD F;  1GFW B;  1DQ8 A;  5J1E A;  2DEJ A;  2O67 A;  5FDL B;  2DY1 A;  2JX2 A;  4ALZ A;  4OYM A;  2CNO B;  4NYP A;  5C25 B;  2RDD A;  1JLE B;  2BE7 D;  2B4U A;  2DGT A;  4DF4 A;  1WI8 A;  3MDF A;  3VF0 B;  3JAM U;  4GKK J;  3PX4 A;  2KDO A;  3RYL A;  1U2C A;  1WEL A;  3PVX A;  2H4W B;  4ZK7 M;  2MKS A;  2YH1 A;  1UVJ A;  2B4P A;  2LQ8 A;  2BYC A;  3PTW A;  4RX6 A;  4DR4 J;  3SI8 A;  5GAE I;  1H72 C;  3N5B A;  4C8L A;  2A1B A;  2HSE B;  2EC0 A;  2XS5 A;  3RB0 A;  1N34 F;  3VTI A;  4Z2X A;  2VD3 A;  1F2G A;  1HAR A;  3M8Z A;  1TL3 A;  1N5Q A;  4WP8 A;  3JQJ A;  2QLB B;  4FYV B;  4M63 A;  2FLN A;  4V1A k;  3L3C A;  1TMJ A;  1N5S A;  3OFF A;  4DN9 A;  2QT7 A;  2RT3 A;  1RA6 A;  1RGV A;  3EMT A;  1TFW A;  3V6D A;  4X4Q A;  4FPR A;  1PJ7 A;  1UJ6 A;  1NM2 A;  4F3O A;  1HIY A;  4CO0 A;  4S0M A;  2GV1 A;  1U48 A;  1D0E A;  4AE5 A;  1R7I A;  3KXD A;  2PA3 A;  4C8K A;  1N32 J;  4USI A;  2Y0S D;  2VB6 A;  4CLL A;  4Y2A A;  2FGO A;  4DSK A;  2ZZM A;  4CNZ A;  3OR2 B;  2KG0 A;  2Z2M A;  3NGD A;  5HJX A;  2CQ1 A;  1PAU B;  2MGZ A;  4IOB A;  4CO2 A;  2U2F A;  1F1B B;  4DCO B;  4JV0 A;  4I2P B;  2D41 A;  2Q6B A;  3BBF A;  2NXN A;  3CO9 A;  2B8Q A;  5L1L A;  3SEO A;  2AGO A;  2G2Z A;  3GWC A;  1BMQ B;  2FVQ A;  1LWE B;  4ILL A;  1UPM B;  1NO8 A;  1S49 A;  1X4A A;  4X64 F;  1TZ0 A;  1NRK A;  1H98 A;  1S9G A;  4TQS A;  4LRC A;  2QL9 B;  2KI2 A;  5KFJ A;  2YKN A;  1HNZ F;  3GV5 B;  4IFV A;  4PXC A;  2V6A A;  1EJ7 L;  3RG6 A;  3ILJ A;  4TY8 A;  1X9S A;  2BQU A;  4KGZ B;  2V50 A;  1FNO A;  3D7S B;  4N5S A;  3KWM A;  2AW0 A;  4L76 A;  3MCM A;  1U2R A;  1QAY A;  4A8M P;  3FGV A;  2KHD A;  3W8G A;  1JKH A;  3OUY B;  4NAS A;  3GJS B;  4DR1 F;  4JI5 F;  1JLA B;  2Z0G A;  3AHP A;  2C1E B;  2L9N A;  1U1M A;  3EGW B;  1HNW F;  3AXK A;  4R8U B;  3B4D A;  4NXN J;  5HP1 A;  2W7A A;  1A0O B;  3W65 A;  5D3G B;  2IMO A;  4EMD A;  2YKO A;  4TYB A;  2Y1J A;  3ETO A;  3MUV P;  3NOC A;  4LF6 F;  1DQ9 A;  5F8G A;  3HSZ A;  4ZCK A;  1Z1Z A;  3V81 A;  1YHQ S;  4ZVR B;  2Y1I A;  1EHW A;  5B0B A;  3VZI A;  4B02 A;  2HS4 A;  4J9U E;  3PV8 A;  3OHA A;  4GO7 X;  1FRH A;  4KH0 B;  5KFO A;  2D9P A;  2OP5 A;  3OTO J;  1N33 J;  4IG0 A;  5FLX U;  1Q8B A;  3P5B P;  4IRD A;  5CH7 B;  4I7F B;  2I6W A;  4KHP F;  3GE9 A;  2GNK A;  2LA6 A;  4OX9 F;  1CJV B;  2I0X A;  3ZZY A;  5IM0 B;  1RYS A;  1XNQ F;  1VBY A;  1ZAV A;  2BOP A;  3W7B A;  4DLG A;  1NH7 A;  1SIW B;  4M5D B;  5SZT A;  3G6X A;  1IKX B;  4C98 A;  2L48 A;  3UQS A;  2P2C B;  3O8W A;  3T5K A;  2YWH A;  4YOE A;  3T6J A;  2JC1 A;  2VKR A;  4DV4 J;  1Q0N A;  3MPY A;  3SCJ E;  1R0C B;  3A3N B;  2AJ0 A;  4G3I A;  4F4Z A;  1K1Q A;  4E98 A;  4N47 A;  2COL A;  3LAN A;  4R25 A;  3VAK A;  1PCA A;  3NXZ A;  5C42 A;  4ENO A;  1U1K A;  3QZ7 A;  2FZC B;  2UUC J;  3DMJ B;  2DHX A;  5FII A;  2HUR A;  3BSA A;  3GMG A;  2JEG A;  1YJ7 A;  4Y3C A;  3QAE A;  4DOZ A;  5ITH A;  4RW6 A;  2PFF B;  1CUL A;  1T05 B;  3QT8 A;  1RTD A;  1LW2 A;  3KLG B;  1H2T Z;  2RHS B;  5IWA F;  4CH1 A;  3CT9 A;  2IAJ A;  3LTO A;  4FYX B;  2EW9 A;  2CWX A;  2V8P A;  5GAH U;  4EFA C;  5IT9 Y;  3GYN A;  4KH1 B;  5J1P A;  4HKQ A;  1X5S A;  4X65 F;  4DL3 A;  4MJK A;  2V0N A;  4I2Q B;  4DR2 J;  2V94 A;  4CLW A;  2Y8W A;  2AJ1 A;  5CD4 A;  3DOM B;  1PG5 B;  4IKA A;  1PGZ A;  2VFU A;  2XC9 A;  5B0D A;  5L8R C;  4QW8 A;  3C19 A;  4OHY A;  3OHB A;  2OPS A;  2J9D E;  5J2N A;  2VQE J;  3GV7 B;  2DO4 A;  2FDN A;  2PEH A;  3TZY A;  1RHK B;  1W7W A;  2DT9 A;  4JP8 A;  1CG2 A;  1NDC A;  4ETX A;  1GEH A;  1N8R T;  3A8E A;  3M05 A;  1DLO A;  1MW7 A;  1IBM J;  1K44 A;  3VAJ A;  1JQG A;  1FK9 A;  2B6A B;  5G0R B;  1C1C B;  4DQP A;  1HQE A;  2MLZ A;  2L9D A;  1M5K C;  5B0E A;  1DFD A;  2DNO A;  2IIH A;  2B51 A;  1KTQ A;  2RDJ A;  2Q3P A;  5I42 B;  3R7S B;  4LF5 J;  3L4B C;  3QT6 A;  2C2D A;  5D8H B;  3C16 B;  3AFG A;  1OPZ A;  4JI3 F;  1BQM A;  1HYS A;  4NZ7 A;  4AD6 A;  1B99 A;  1N5Y A;  3RBX A;  4KGM A;  4YY3 J;  1U45 A;  1HKA A;  1SC4 B;  4DUT A;  2AHO B;  1HNI B;  5J2M B;  2W9B A;  3OTD A;  1WOS A;  3FSI A;  3CCV S;  4NOH A;  3F56 A;  2QLJ B;  4LF9 J;  5LT5 A;  2E1M C;  2E44 A;  1LW0 A;  4C0O C;  2RQ4 A;  3PKM A;  3WBZ A;  1WD6 A;  1U2F A;  2JEF A;  1OWX A;  4E2F B;  2XMK A;  3AA8 A;  4KKO B;  4NZ0 A;  3K2Y A;  2GML A;  2OGU A;  1FXD A;  4LFC J;  2Q6C A;  4EYH B;  2AQ4 A;  3FC9 A;  2IDL A;  2DHA A;  3I96 A;  2XZT B;  4ID5 A;  4AND A;  3D5M A;  1RT1 A;  1AUD A;  3CVK A;  1EX8 A;  1GX5 A;  4RUH A;  3RGI A;  4Y0F A;  3C46 A;  2VG5 A;  3TZX A;  3QGI A;  3S1T A;  1GQE A;  2DRD A;  3CCQ S;  2A18 A;  3NNH A;  3OVS A;  2KZM A;  1PBA A;  1S4F A;  3ZTR A;  3MEE B;  3BBC A;  4ZVS B;  4B9N A;  1FX4 A;  1H7W A;  3NAI A;  1IR0 A;  2W2P P;  4L73 A;  1QVG R;  2YY3 A;  3GSI A;  1SKU B;  2OPQ B;  4B9T A;  3ZTS A;  4P75 A;  4WTO B;  4DZD A;  2MZJ A;  3MM8 A;  1TL7 A;  1VFJ A;  2J9C A;  2JLG A;  2AU0 A;  5KG1 A;  1NSP A;  1D9A A;  2CQ3 A;  4K2J A;  1RWV B;  2P6S A;  3MM5 A;  1JLC B;  1N0U A;  3G86 A;  1FJC A;  5BXI A;  3OTB A;  5A8R A;  3FSY A;  4JI6 J;  4BC7 A;  2I2Y A;  2EVZ A;  1FF2 A;  4QWD A;  4DR7 J;  3K5P A;  2A6O A;  3O2I A;  4DL2 A;  5KT2 A;  2WB1 D;  1ZM9 A;  3MEG A;  4JOU A;  1HW9 A;  4WZM A;  3KLI B;  4F4X A;  5A8K A;  1LFW A;  1AZS A;  4YME A;  2C2Z B;  3TI0 A;  2KN4 A;  4NYO A;  4HEA 9;  3AAW B;  2AD9 A;  1U0H A;  3DI6 B;  2QJ3 A;  3HVT B;  4MIW A;  2ASJ A;  1FER A;  4U8Y A;  2RF2 B;  4ZKA A;  3KLV A;  2GIQ A;  1CQN A;  5KFE A;  4L3K A;  4RUA A;  1L3T A;  3KDO A;  2ACY A;  3FRY A;  8AT1 B;  2OD4 A;  4DG1 B;  1NHK L;  4ECS A;  3GB0 A;  3PW7 A;  2M2B A;  1FX2 A;  3HZG A;  3MMB A;  4X4R A;  3NP5 A;  3NRB A;  3G71 S;  3R5C A;  1FEE A;  1Q82 T;  3CJ2 A;  5DGB A;  3PRD A;  1RAC B;  1N6Q A;  2QG9 B;  4RW4 B;  2C3M A;  4MAK A;  2I9S A;  3E3X A;  1ZM4 A;  4ZLL A;  1SJQ A;  3GIM A;  4ZVF A;  2BAB A;  2KB2 A;  3QRR A;  3H42 A;  2LEP A;  2BQ3 A;  2FYX A;  3K0J A;  3WIV A;  2Z58 B;  3QO9 B;  4OFZ A;  2RUS A;  1TL1 B;  2W7P A;  4BS2 A;  2EI5 A;  4RNM A;  5LL6 d;  4PPZ A;  3ITH A;  4F4W A;  3LAL A;  2HFV A;  1X9M A;  5C5J A;  3LWM A;  4QU6 A;  1FDN A;  1U6F A;  4X2B A;  2VFV A;  1XIQ A;  1BUX A;  2JRS A;  2F5G A;  3ELH A;  1NLK L;  4CTA A;  2CVI A;  5JVH Q;  1U4B A;  2HND B;  4PQU A;  3RRK A;  1UEU A;  4JI1 J;  3MM9 B;  2VIC A;  1M5P C;  1U24 A;  2NSC A;  4ECV A;  1TQL A;  1B7F A;  2MZ1 A;  4DXL A;  2AGQ A;  3IO1 A;  5IT9 U;  1R8P A;  3MED B;  4C6A A;  4IOC Q;  1BC6 A;  4CYU A;  5DDP C;  1T11 A;  2ZHA A;  1KQF B;  5AE1 A;  7FDR A;  1RI7 A;  3AOD A;  5F3Z A;  3PYD A;  3E01 A;  2AZ1 A;  1VS3 A;  3M2R B;  2DNZ A;  3ISZ A;  2CPE A;  1PJ5 A;  1WC3 A;  1RHU B;  3HCX A;  5F8J A;  2GHP A;  1AFJ A;  4RNF A;  4DPY A;  2L08 A;  1DQA A;  4KFB B;  4CZC A;  3MM6 B;  4UW2 A;  2C2N A;  1B0T A;  2DXD A;  2BRK A;  4E8U A;  2HZV A;  1FKA F;  1RTJ A;  4GKJ F;  5D0E A;  3J7A N;  3KKF A;  4P2X A;  4PXE A;  1S79 A;  2QX0 A;  1IR1 A;  2WOM B;  1WC1 A;  3LWL A;  3FZ2 A;  2G1H A;  2P9C A;  3C14 B;  1OPI A;  1N34 J;  3BGO P;  2B5J A;  3DDN A;  3JSM B;  4M5M A;  3IS9 B;  1EAY C;  1O51 A;  3UDC A;  3LP2 B;  1E6V B;  3ADA C;  1PO6 A;  1JJC B;  4OI3 A;  2V34 A;  2MKI A;  2BQR A;  2CNL B;  3HD2 A;  1HWU A;  4BHQ A;  2RRB A;  1SKR A;  1CSJ A;  3M6W A;  2QEX S;  2FLO A;  5CA5 A;  1IKV A;  3A13 A;  3G8S A;  3QGG A;  1JMT A;  2BX6 A;  2VF3 A;  3S01 A;  3MGJ A;  2QYG A;  3M2V A;  2DVI A;  2AJQ A;  1XMB A;  3H59 A;  2VKZ G;  1VHF A;  2GVZ B;  5E33 A;  2VU5 A;  3I0S A;  1WKL A;  3RAM A;  2V8D A;  1REV B;  2V9W A;  4AL5 A;  3CF5 Q;  3PW2 A;  4X4U A;  3V4I B;  4K50 A;  5HI7 A;  2WVD A;  4LBI A;  3KOA A;  3NBP B;  4DUY F;  3M2U A;  4MK8 A;  2XMM A;  3LP1 A;  1OQ3 A;  3HT3 A;  3NY0 A;  4JI8 F;  4CQ1 A;  4X64 J;  2DRA A;  1KLN A;  5L9X A;  5MLC V;  2XO7 A;  1CBK A;  2AYB A;  3G82 A;  1NJY A;  1EET A;  4KT0 C;  3QGH A;  4Q7A A;  2YWE A;  4R5P A;  3RU0 A;  2X1G A;  5T7L B;  1SQE A;  1NZ8 A;  2H9Z A;  2D3U A;  4JYA F;  3QID A;  5K20 B;  4XPC A;  4KV8 B;  4M8L A;  1YVF A;  4OZJ A;  3JQM A;  4H4M A;  2YNF B;  4ED1 A;  1C2P A;  4RW7 A;  4O3Q A;  3GIL A;  2FLL A;  1JLG B;  1RWM B;  4DR1 J;  4JI5 J;  1T03 B;  3NS7 B;  4TY9 A;  1HNW J;  2GO8 A;  5F8H A;  2C3O A;  1VJQ A;  1VIO A;  2B4O A;  3D6F B;  3Q24 A;  5KT3 A;  1WEY A;  2UZA A;  3QSI A;  5D6G A;  4QYR A;  3BV8 A;  1P27 B;  2R3V A;  3NGT A;  1XBW A;  3ILI A;  5H9F J;  5IFM A;  2CDR B;  4UOF A;  3PY8 A;  2CPJ A;  4C8Z A;  2P5V A;  3ZNU A;  5KFZ A;  4AL6 A;  1ZM3 A;  5LM7 E;  4X4S A;  2CG4 A;  2WBM A;  1NKE A;  1HBM A;  2VPW B;  4N56 A;  2F8E X;  3QJJ A;  2YTC A;  1UWB A;  3I32 A;  5BYR A;  4ZMM A;  4KHP J;  1RT6 A;  1UEK A;  1HNV A;  2GJF A;  4OX9 J;  2RD5 C;  4ZPT R;  2XO6 A;  2MLX A;  2V2Q A;  2HGM A;  5ETV A;  1NCL A;  1TK5 A;  1XNQ J;  3Q8V A;  2JFK A;  3N28 A;  2P6T A;  3ZNJ 1;  4X62 J;  4JV5 F;  3IM8 A;  4USU A;  5RUB A;  5DZ7 A;  1S10 A;  3KMQ A;  2ZH2 A;  4PXB A;  2UV8 A;  4B17 A;  1R0B G;  1AT1 B;  1Y0H A;  3AQO A;  2QIF A;  4P2M A;  1HI8 A;  5D4L A;  5FD1 A;  4OL8 A;  3C15 A;  4P2F A;  3FJ2 A;  3SSQ A;  2DXF A;  5A6W A;  2EFG A;  5FDL A;  1C4C A;  1EAR A;  1UA0 A;  5H9E J;  3GJQ B;  1JLE A;  4FKY A;  3PHE A;  3R6G B;  3GSD A;  2VC1 A;  5KFL A;  2MY8 A;  2DNY A;  4DR6 F;  1QAX A;  3H5U A;  2M9K A;  3RRG A;  4H4O B;  3VGS A;  1PJ6 A;  1RT2 B;  4WK1 A;  1X5T A;  2W4P A;  3BS9 A;  1PAE X;  2CPY A;  4QCL A;  3NGU A;  3QT7 A;  7FD1 A;  4ANE A;  1UFK A;  1JXL A;  3CJ3 A;  4NMX A;  1OSD A;  2KL8 A;  4OYP A;  4X65 J;  3LF0 A;  4DFM A;  3I31 A;  3PJX A;  3EUN A;  3AB4 B;  3R7B B;  3T5L A;  2B8P A;  2K06 A;  2FTR A;  2X1F A;  5HLF B;  2ZFH A;  5KG4 A;  2ACM A;  2UUB J;  1IXK A;  2KT3 A;  3MZI A;  3HO1 A;  4Y65 A;  4C11 B;  3W9J A;  2HBZ B;  2FZG B;  1SBR A;  2E1P A;  2DH9 A;  1RAE B;  2C2E A;  3HDS A;  3B78 A;  2HQG A;  2JVR A;  1RAO A;  1Y3K A;  1F9H A;  2ASY A;  2VOD A;  2KG1 A;  1X9W A;  2DNQ A;  5KT5 A;  4DX5 A;  2RVJ A;  1TKX B;  3DLG B;  2HFO A;  3OR2 A;  2PFD A;  2E9R X;  1CJU B;  3DRR B;  3H8Y A;  4DU7 A;  2GZO A;  4EZ6 A;  2HIY A;  3F44 A;  4HI2 A;  3TZZ A;  3EZ5 A;  3DOL B;  4I2P A;  4I68 A;  3OJU A;  1KS2 A;  3SSS A;  2CQP A;  4LF8 F;  3KHG A;  1T9X A;  1YIJ S;  4JI3 J;  5CQG A;  2G0I A;  1QSY A;  2H5J B;  2HW3 A;  1LWE A;  3I9Z A;  3J81 Y;  1ROF A;  2CZ9 A;  4FBT A;  3CD7 A;  2WCX A;  1X4F A;  5DRK A;  2J9D A;  2KYZ A;  5KTQ A;  3S8S A;  1NSA A;  4UQG A;  2B56 A;  1Q8K A;  3ZZU A;  5B0G A;  5D15 A;  2QE5 A;  2CFX A;  2HHH F;  5HAN A;  5AXK A;  2M5Y A;  4ZP9 A;  1P1T A;  1K1S A;  3BKF A;  2YXL A;  3DGP B;  2CQ2 A;  2R8G A;  3K5O A;  2XY5 A;  1N0V C;  4PYD A;  6AT1 B;  2H51 B;  3MMJ A;  4QWC A;  4QR2 A;  4K4Y A;  4RUB A;  1U8W A;  3GIR A;  3OL6 A;  3OUY A;  1IBK F;  4YB7 A;  3EIC A;  1JLA A;  4NRT A;  4CLK A;  1IQT A;  3HKZ D;  2QA4 G;  2DO0 A;  1XMQ F;  4ZP6 A;  4R8U A;  1KD1 T;  2PMW A;  1PYO B;  5E3P A;  3M8S A;  4WBF A;  2ZNY A;  3NEK A;  5E2Q A;  1UA1 A;  3BGR B;  5D3G A;  3EZO A;  3DM2 B;  3Q8U A;  3CJ8 A;  2HWI A;  2O1P A;  2UU9 F;  1H3D A;  1HR0 F;  1VQL S;  2Y0B B;  4DL4 A;  4DEZ A;  2XHW A;  4WFB Q;  5HL7 Q;  2Z2L A;  1HD0 A;  2MSS A;  2YKM A;  3MMC B;  4OLP A;  5D0R A;  4PZV A;  2IJF A;  3P5T L;  4ED7 A;  4KY3 A;  4X4P A;  2LKZ A;  1NHU A;  2ZBP A;  2PGC A;  4F26 A;  3CMQ A;  2DGX A;  4I7F A;  1U6Z A;  1CJV A;  4K4T A;  5B0F A;  4DS5 A;  1S57 A;  1Y5L B;  3SV3 A;  5HN0 A;  5KG5 A;  5M2U A;  3KUG A;  1MN9 A;  3THT A;  2Z56 B;  1IKX A;  3QRQ A;  2XGP A;  4LQ9 A;  2GA7 A;  4Q44 A;  2DR7 A;  4RNN A;  3GJR B;  3FEY B;  4ZJO A;  3RW6 A;  2F3J A;  2VH7 A;  1F5B A;  5IOL A;  1GXU A;  2RJZ A;  2CQG A;  4NXM J;  4IR1 A;  1EQ0 A;  3FMW A;  2ZDP A;  4CI0 B;  2MJN A;  3OXL A;  1YBT A;  3BYP A;  4O3O A;  3DMJ A;  3PDN A;  5HMY A;  1SUQ B;  1J5O B;  1MLA A;  4I56 A;  2BAC A;  1B64 A;  3UW1 A;  1ZBT A;  4ZPB A;  1RB0 A;  1YJR A;  3CC7 S;  1T05 A;  2HZA A;  3EVW A;  4RWX A;  3DNC A;  1FD8 A;  9RUB A;  3KLG A;  1KRP A;  4ZCM A;  5JUM A;  4ECQ A;  2RIJ A;  2C28 A;  1Y9O A;  5KFD A;  2BW7 A;  4IRC A;  2RS8 A;  4TKT A;  4C2M A;  2NZ4 A;  4ZJL A;  1WC4 A;  1B3T A;  3QMQ A;  2OKQ A;  3HI9 A;  3Q8R B;  3P3D A;  4I2Q A;  1S9G B;  2HHW A;  3H40 A;  2MQ8 A;  3CD5 A;  3I4H X;  3DOM A;  2OFH X;  4WXW A;  2GHW A;  1R8H A;  4C8N A;  5IC6 B;  1KKH A;  3Q83 A;  1X7V A;  2IDE A;  3ENA A;  1RWN B;  1VGY A;  3KLH B;  2BVZ A;  4NZ6 A;  1S0O A;  3CPW R;  1BQN A;  2OI2 A;  3D66 A;  5E3C A;  4FF1 A;  4OHW A;  1REG X;  1YZ7 A;  2BJ1 A;  3T1A A;  2HK2 A;  4R0J A;  4X4V A;  1M90 T;  2B6A A;  4PWW A;  1C1C A;  5LXY A;  3F0N A;  2DHG A;  5A2Q Y;  3N6M A;  4QIW D;  3I6P A;  4RPF A;  2R2U A;  1W26 A;  4LIR A;  4CNY A;  3IWN C;  4WZQ A;  5I42 A;  5A8W B;  4CIO A;  4RL1 A;  1IBL F;  3C16 A;  3T3F A;  4X4N A;  1RHQ B;  5KAK A;  3JTO A;  2VBW A;  3CJS A;  1S76 D;  3GG0 A;  2F9D A;  5GAH I;  1XQI A;  3HHL B;  4LJM A;  2UUA F;  2HHT A;  2XI3 A;  2EFQ A;  4LF1 A;  4OHZ A;  1WF0 A;  2PI5 A;  1HNI A;  2QMW A;  5J2M A;  4WFY A;  4Q5V A;  2E29 A;  1JLF B;  2KZZ A;  2IC3 A;  3EPI A;  4KHR A;  1T7P A;  4F25 A;  4I69 A;  4O3N A;  3IC1 A;  3LGN A;  2J6S A;  3PIO Q;  2VZ9 A;  1BGX T;  4NI2 B;  1YQH A;  2XY7 A;  3CCT A;  5I3U B;  4K5R A;  3VAM A;  4KKO A;  4HDH A;  4XPE A;  2OPP B;  3M8Q B;  3DDK A;  2B7B B;  1UVK A;  1WDD A;  2GS8 A;  4HAC B;  1XR6 A;  5KOX A;  1FDB A;  2IHR 1;  1HBU B;  4IYQ A;  2X3G A;  1FVQ A;  1GTH A;  3W5Z A;  2ILZ A;  4GKJ J;  4P71 A;  3IAS 9;  4P73 A;  2AGP A;  4UF4 A;  1FA0 A;  1VRT B;  2E7X A;  2HNY B;  2ZDO A;  3LAK A;  4LF4 J;  1RXO B;  4J9O A;  1YJU A;  1FJG F;  1RT3 A;  3BQ1 A;  3DFE A;  2HLU A;  3POT B;  3VR1 A;  2JDJ A;  4LFB F;  4FVM A;  2CQ0 A;  3OBI A;  3BGU A;  5JXS A;  3J81 U;  4LUB A;  3HP6 A;  2A2C A;  2J0W A;  2YX7 A;  2CJY B;  2ZKU A;  3T9N A;  2VPY B;  3VQS A;  5EUH A;  2R2R A;  2DR6 A;  1LFP A;  1ICE B;  2MXY A;  3BPD A;  3VAG A;  2OPQ A;  5CZV A;  1Q5V A;  3HF5 A;  1U1P A;  2WON B;  3TVY A;  4NLP A;  1Q78 A;  4KHM A;  2N4D A;  3BGL A;  1OIA A;  3WHI A;  3GJT B;  1JLC A;  1DJ0 A;  4LQ3 A;  1W2B R;  2LQ9 A;  4F36 A;  1NPP A;  3UR0 A;  1SCJ B;  3TW0 A;  3PW4 A;  2CPX A;  5F0W A;  4DUY J;  2RML A;  2L3M A;  4ZA1 A;  2B0G A;  2K2P A;  4JI8 J;  4TVA B;  2DKO B;  2HLT A;  1H7X A;  3CJT A;  1TU0 B;  4OMF G;  3KLI A;  3ICL A;  5LSL A;  1UCN A;  1G2E A;  4PXD A;  2UP1 A;  2YVS A;  4XAK A;  3DI6 A;  3HVT A;  1HQE B;  1EIY B;  5H9E K;  2XWX A;  4JYA J;  5CAA A;  3TZW A;  2RF2 A;  1XEZ A;  4QYZ J;  2QA1 A;  2WK4 A;  2DIS A;  3SCI E;  4EUV A;  4F0K A;  2J0Q D;  4DU8 A;  1YK9 A;  2ATC B;  1Z2L A;  4OX6 A;  1RAD B;  2OD6 A;  5KT6 A;  1S1W B;  1GK8 A;  1URN A;  2G13 A;  2H4Y B;  2J8A A;  4HYK A;  4WP3 A;  2KRB A;  3P49 B;  2QLW A;  2OML A;  2DPI A;  3AT1 B;  4B9U A;  4DV0 F;  1ELO A;  1F5A A;  2CRL A;  1NK6 A;  2W7O A;  4KC5 A;  1X4H A;  4BWJ A;  3AD9 C;  3CMA S;  4YR2 A;  3CCW A;  2V4R A;  4KQZ A;  3QO9 A;  5ETS A;  3P8B B;  2DGW A;  4USJ C;  3TQ1 A;  2V8H A;  1TL1 A;  3UNG C;  2B7C B;  2HK3 A;  1FCA A;  2UVU A;  1WHY A;  3JS9 A;  1AXQ A;  4CM2 A;  1BY9 A;  2PSZ A;  3MMA B;  3CDA A;  2CIM A;  2DCU B;  4WPA A;  1R6V A;  5F41 A;  1M5V C;  1S48 A;  2QMU B;  1Q8L A;  2RU9 A;  3T1H F;  4ZP8 A;  4HVZ A;  3SIP B;  2HND A;  3FKB A;  1RT1 B;  1RT4 B;  3MM9 A;  2FJD B;  3R2C J;  1KEK A;  3UR3 C;  1Y4Z B;  4J9P A;  4NA1 A;  1NJX A;  3K8W A;  2HEK A;  5I4M A;  3AD7 C;  3QIP B;  1JLQ B;  3KTQ A;  4WIQ A;  4USK A;  1RAJ A;  4IQM A;  1RWU A;  3MED A;  3GTY X;  2Z57 B;  2BUN A;  1HA1 A;  3VVT A;  2KFN A;  3BDP A;  4ZVG A;  3HFZ B;  4CO5 A;  4K4Z A;  1S77 D;  3M2R A;  3DRP B;  3PYF A;  3UFC X;  1MML A;  2HFS A;  2J9E A;  1VR6 A;  2HHQ A;  2XQC A;  2LMI A;  3T19 A;  1UFL A;  1HPZ B;  1EKR A;  3D67 A;  4DR6 J;  3MM6 A;  1WUU A;  4KJI A;  3BB5 A;  1TKT B;  2WTF A;  2NPI A;  1U0S A;  1Q81 T;  1VQY A;  3TJ8 A;  3HFK A;  4NCG B;  3OD2 A;  1EZZ B;  3ZZT A;  3CWJ A;  4NE9 C;  1OY6 A;  3V6K A;  3NNA A;  2D74 B;  5BR8 F;  1V5V A;  5A2Q U;  4N8N A;  3T1Y F;  2WOM A;  4WE1 A;  1RWX B;  4I4B A;  3C14 A;  5LMU F;  3SCK E;  2PO4 A;  2C3Y A;  4O4G B;  3JSM A;  2YNG B;  3IS9 A;  2WSC C;  4IH7 A;  3LP2 A;  3FUY A;  1E6V A;  5ETO A;  2DRB A;  3D6M B;  2CJX B;  4ZPV R;  4NLG A;  1YI2 S;  1QJH A;  2N7Y A;  2I1R A;  2JZ5 A;  2DIV A;  4E0D A;  1YJN S;  3MMB B;  1S59 A;  2JLF A;  2Z30 B;  4RBV A;  4ERD A;  2LU2 A;  4DBQ A;  2VON A;  3MTK A;  4NLD A;  4TN2 A;  4B3S F;  3GII A;  3CXC R;  2GVZ A;  2VBZ A;  2K7J A;  4AUK A;  3LGH A;  1WWH A;  4U8V A;  3R5G A;  3MTJ A;  1REV A;  2BR0 A;  1X8D A;  1FWL A;  4AQY F;  3BN7 A;  5GVQ A;  3V4I A;  1HD1 A;  4DV3 F;  2G4B A;  1Y5I B;  3DHW C;  4LF8 J;  5J2P B;  2YPZ A;  3NBP A;  2Y3Y A;  4MT1 A;  3QSY B;  3QAT A;  3JSR A;  2KJW A;  1NND A;  4A8Y A;  4QR0 A;  4KO0 B;  5EGY A;  4NLY A;  1L3U A;  3IR5 B;  3WX8 A;  3CSK A;  2W01 A;  4F67 A;  2IRX A;  2DGO A;  3G8Q A;  3PIP Q;  4ECZ A;  4IH5 A;  2EFV A;  1CLF A;  5T7L A;  2HHH J;  3KLF A;  2WHO A;  1YRU A;  4KV8 A;  1X4C A;  3KK1 B;  2YNF A;  4ZCL A;  3OR1 B;  2OSR A;  4PUO A;  5AXM A;  3L7O A;  2XHC A;  2E7W A;  4CH7 A;  1LWF B;  4YB5 A;  2VHG A;  1NKB A;  1JLG A;  3P6Y C;  1IBK J;  4NLW A;  5ETL A;  2W4D A;  1T03 A;  1XMQ J;  2AJF E;  1S12 A;  3SDE B;  1ZZN A;  4PWU A;  4KGV B;  3WC0 A;  5L38 A;  2FJA B;  4NA2 A;  3HD1 A;  2OPR B;  4DF8 A;  2VBX A;  2UU9 J;  3JYT B;  1HR0 J;  4ZJQ A;  4NML A;  3DLE B;  4OI4 A;  1HBN B;  2E5L F;  2IVM A;  3I82 A;  4MKY A;  4LF2 A;  1JB0 C;  2AKW B;  5KFB A;  1A6L A;  4DV5 F;  3CDB A;  1ZS6 A;  2D69 A;  1SJR A;  4JV2 A;  4QZV B;  2L9W A;  4WFN Q;  2GX8 A;  2W8K A;  2BJ9 A;  4Y2I A;  3M7V A;  4ID8 A;  1CS4 B;  3RJM B;  5EN1 A;  4DV6 F;  1CPZ A;  5DQI A;  1SH3 A;  2HIQ A;  4HLB A;  1MRO B;  3RRH A;  3OVB A;  1FE4 A;  1KON A;  5EWF A;  4P10 A;  3QZ8 A;  1O8B A;  2AIR B;  1UW4 A;  2ZVI A;  4UTG A;  2DD8 S;  1DAX A;  1FTC A;  2NRE A;  1S4E A;  4ED8 A;  2J6T A;  4IG3 B;  2YQ0 A;  4DZ6 A;  5LJ3 Y;  4DX8 H;  1DBD A;  3HX9 A;  3OL8 A;  2BJ7 A;  1BE4 A;  4ZVH A;  5CZX A;  3T5H A;  4H4O A;  4NPO A;  1RT2 A;  3JQK A;  1I94 F;  4HT5 A;  2RDI A;  4ED4 A;  3TEH B;  1WTB A;  4PKD B;  4FF4 A;  1QSL A;  4ES2 A;  2WZ1 A;  2QLX A;  4Z37 A;  4B3O B;  4NWB A;  4U6P A;  5D0H A;  4J9L A;  2DJW A;  2NSB A;  2W2M P;  1VQS A;  2WVE A;  4EZ9 A;  4WJB A;  2RAQ A;  1T3O A;  5GMK a;  3OW2 R;  1VBK A;  5EDW A;  1XC9 A;  3EDQ B;  4OJG A;  2VL1 A;  4P7V A;  5E0O A;  4H54 A;  5HLF A;  3P45 B;  4LRE A;  2HWT A;  4RNH A;  1RT7 B;  3R1H A;  1GMW D;  1WF1 A;  2Y8Y A;  1TK8 A;  5THW A;  4C11 A;  1Y5N B;  1NAQ A;  4N8O A;  1VQ9 S;  1V3Z A;  2M88 A;  5GAG U;  2NUU G;  2YBV A;  4RW7 B;  2FJV A;  4B3R F;  3RW7 A;  1WEZ A;  3IWL A;  4RUC A;  2VUG A;  2OEJ A;  1TKX A;  3DLG A;  2WRM A;  3BF4 A;  2Q1L A;  2ZHB A;  2J7U A;  4KAI A;  4F4K A;  3DRR A;  1RCO B;  1LK5 A;  1RA7 A;  1WNE A;  2A0F B;  3DOL A;  4DS4 A;  1B70 B;  5T14 A;  1KNZ A;  3RBE A;  1WF2 A;  4KPY A;  1K0V A;  4ZPA A;  5LMN F;  3PJ9 A;  4ZPD A;  3IRX A;  1FRM A;  4N76 A;  5AT1 B;  4OX7 A;  2BKP A;  1EB0 A;  1YKW A;  2MZS A;  2DNL A;  2QC3 A;  1QSS A;  4RO0 A;  1ZM2 A;  4DX6 A;  1ARO P;  3MAH A;  2UUA J;  3QWP A;  3L7P A;  5KFR A;  2R7T A;  4C0H A;  3W9H A;  5K8M A;  4QPT A;  1SH2 A;  3OFG A;  3JB9 k;  3G6E S;  4K4X A;  5HMX A;  3T41 A;  1KP6 A;  2XMW A;  2FVP A;  1UFW A;  2VDI A;  4NCA A;  5DET A;  3DGP A;  4EBE A;  1PBU A;  3ZZ0 A;  4QYZ K;  3BSC A;  2B3T B;  4EEY A;  3LQV A;  2RS2 A;  1N56 A;  2UVW A;  3U27 A;  1HWI A;  3W5X A;  2R4F A;  1JXV A;  2YWW A;  4JI2 F;  3FBC A;  2KJV A;  5F8M A;  3FCH A;  1E6Y A;  1GMW A;  1VIS A;  1OO0 B;  2DNK A;  1S1X B;  2FC8 A;  3NLC A;  1XNR F;  4K4S A;  3BGR A;  3K89 A;  2CVE A;  4DSJ A;  1XR7 A;  1HQ2 A;  3N6N A;  3JSY A;  2P8I A;  3P96 A;  2W9C B;  4IO9 Q;  2FJB B;  3C15 B;  2WSE C;  3J7Y I;  2JFD A;  1FJG J;  3EXC X;  2CPF A;  3F41 A;  2V68 A;  4C8M A;  3PW0 A;  4TU8 A;  4ED3 A;  3MMC A;  4JI7 F;  2XI2 A;  2W2Q P;  3T5J A;  4ZIT A;  1SC3 B;  2H5E A;  3VAI A;  3TAM B;  4ZVE A;  3HFV A;  1S6U A;  2DIU A;  1RWK B;  3HHL C;  1RBA A;  3R1L A;  1NBE B;  4FYW B;  4NLR A;  2OUG A;  4DUZ F;  1F5C A;  3C6U B;  5GMD A;  4EO6 A;  3I5C A;  1RWO B;  2O5D A;  4QQB A;  5CCL A;  1T9W A;  4J9R A;  1Q79 A;  2HHU A;  1SC1 B;  5HQ8 A;  5ETP A;  2NPF A;  3TAR A;  1CJT B;  1RWW B;  4HDG A;  4I6Y A;  3DXB A;  1ZA2 B;  4CO3 A;  1SXL A;  4WYL A;  4CLZ A;  3MHY A;  3CD0 A;  2YKA A;  3MPU B;  5EHH A;  4DFP A;  3GG1 A;  1RYR A;  2MJU A;  3MCN A;  2BJD A;  3HUL A;  4WTY A;  2UXC F;  4LIW A;  1GTE A;  4W4M A;  4IDK B;  4PWD B;  1SUQ A;  1J5O A;  4BCA A;  3MR3 A;  4HT7 A;  3ZZZ A;  2VAS A;  3HHL D;  1QAI A;  1LWX A;  4AT1 B;  4DHV A;  1WAC A;  4NEY A;  4I67 A;  2E7V A;  1KVK A;  1S9E B;  2R7R A;  3Q8Y A;  5HRO B;  3HM9 A;  1HBO B;  3EPG A;  1UMJ A;  4K4U A;  4KTQ A;  1KBR A;  2I8E A;  4NLT A;  1UJ5 A;  4YHH F;  4YFU A;  3PXG a;  4FF2 A;  1RU1 A;  2HFN A;  1NSK L;  3BSN A;  1SC6 A;  3PRV A;  1SKS A;  4QIV A;  3B6B A;  1BWE A;  3IMQ J;  2E5J A;  4ILR A;  4DV0 J;  4JB8 B;  2QFJ A;  5F0U A;  4OYI A;  4Z7C A;  4F4A A;  1NB2 A;  4DV2 F;  2AF6 A;  2HRY A;  2LQ5 A;  4DQR A;  3FFI A;  3MPV A;  1UET A;  4DSF A;  4J91 A;  4EGL A;  3KLH A;  3D1H A;  3ILO A;  1U49 A;  1AYE A;  4QPX A;  3RR7 A;  3KG4 A;  3R9L A;  1N4L A;  4JUZ A;  2ZIT A;  1CQM A;  5H1S V;  3WDO A;  1FNX H;  2CXE A;  4DSE A;  4ETZ A;  1F3F A;  1VQ5 S;  3H0P A;  4DR4 F;  3EE3 A;  2NXC A;  2DR8 A;  3DOK B;  2GVD B;  2NXE A;  1L3V A;  3BBB A;  3T1H J;  2Q79 A;  1RZM A;  4CLT A;  2JL9 A;  5A8W A;  3M32 B;  2AZ3 A;  3VAF A;  3HT0 A;  4U7U K;  2BV3 A;  4U7U D;  2EG1 A;  4TXS A;  1OYE A;  1V3R A;  2OJ3 A;  4ZVP B;  3IN5 A;  2YKM B;  2XSJ B;  1RQ0 A;  3HHL A;  3PYG A;  5B7W A;  1P1L A;  2CZ4 A;  1JLF A;  1U1L A;  1ZAX A;  2UUT A;  1S1V B;  3D54 A;  3MXH P;  5DZ6 A;  1HWK A;  1JLB B;  2OHD A;  4NI2 A;  4A8X A;  1CJK B;  1T9V A;  3IFE A;  5EX0 A;  4DN0 A;  5I3U A;  4K0K F;  2OPP A;  3M8Q A;  4MK9 A;  2EEY A;  2JEI A;  3CCJ S;  2BBE A;  4ES1 A;  4HAC A;  3AB2 B;  1HBU A;  1C1B A;  3BZQ A;  3GLJ A;  1YJ9 S;  1JX4 A;  1WHX A;  1DTQ B;  3MFI A;  1FXL A;  5BR8 J;  4Q2M A;  4FYD A;  3T1Y J;  1UL3 A;  4F50 A;  3NCP A;  1LK7 A;  1LXJ A;  1VRT A;  3UD3 P;  2HBY B;  2HNY A;  1RAF B;  3DGV A;  2BOA A;  4OIX A;  3G6Y A;  2EC2 A;  5LMU J;  3H4B A;  3CB4 A;  2MZR A;  4FXW A;  3POT A;  3KNG A;  2BKN A;  1FKO B;  4QIF A;  2D3O 1;  2P9G A;  4KGX B;  5KFF A;  1RBL A;  4ICL B;  2F4F A;  3TVK A;  4OJH A;  3A8J A;  3PR4 A;  3AOC A;  2LVW A;  4NEZ A;  4CT8 A;  5KFX A;  4KYZ A;  2X3D A;  2WON A;  1D09 B;  2K7K A;  4OLO A;  5GME A;  1X0P A;  3UN5 A;  5HK4 A;  4K7Q A;  1WSR A;  1S72 S;  2YQ1 A;  1J2V A;  4B3S J;  4ECT A;  1Q5Y A;  1F6T A;  3NGS A;  2WVB A;  5DDO C;  4AQY J;  5AJ3 F;  4DV3 J;  3RBZ A;  2B9Y A;  1U1Q A;  3BR8 A;  3LH2 S;  3D9B A;  4NLV A;  1VQN S;  3UN2 A;  2NUH A;  4YUD A;  4WU2 A;  2J7K A;  1BQN B;  2KXF A;  4Y34 A;  4C9D A;  1VQM S;  4M95 A;  2R7Q A;  1N33 F;  2WW4 A;  4C97 A;  4MK7 A;  2MPU A;  2PII A;  3OT9 A;  3FZB A;  1NJW A;  2VJU A;  3CJQ A;  1HNX F;  1WOP A;  4FXV A;  2OEM A;  3J81 j;  1A9N B;  3GCX P;  3KK2 B;  1UWA A;  1QDU B;  1YIT S;  1S1W A;  3UCG A;  1RU2 A;  2HPU A;  1WSV A;  3DYA B;  4HR2 A;  2V2Z A;  4DV4 F;  2QSF A;  2HS0 A;  4NCB A;  5B09 A;  2BJ3 A;  2IC3 B;  2CNN B;  2RUG A;  1S7H A;  3VQT A;  5DDR C;  4UUX A;  3SYZ A;  1QTN B;  1LQ9 A;  4I6A A;  2VA2 A;  3IBW A;  2DPJ A;  4ZOS A;  4W90 B;  3D1Q A;  1MMN A;  2E5L J;  1S6O A;  5K8N A;  4M5N A;  2CZV C;  3EDR B;  2HNZ B;  3H5Y A;  3MMA A;  2HQC A;  1WC0 A;  2GQ2 A;  1LWC B;  1G1X A;  1BHN A;  2X7I A;  1CVJ A;  5HVF A;  3H25 A;  1S6P B;  4IQX A;  1KR4 A;  3H90 A;  3EGV A;  1NZA A;  3OFE A;  1RT4 A;  1UW9 A;  1S9F A;  4DV6 J;  4X84 A;  4UY8 5;  2BE2 B;  4DPU A;  1RT3 B;  3I0R B;  3MWB A;  1Z2Z A;  2MST A;  3M4X A;  4PEO A;  2KH9 A;  5DS7 A;  3K57 A;  3QQC D;  3QIP A;  3O6Q A;  1JLQ A;  3KG1 A;  3CCM S;  4K5S A;  4OZ1 A;  4DX7 A;  3WIU A;  3L09 A;  2ZOM A;  2LEA A;  3CTR A;  4V19 J;  4FBU A;  1TUG B;  3HMJ G;  4EWT A;  2WAQ D;  3DRP A;  3IRW P;  6FDR A;  4B3M J;  4XDC A;  1F2H A;  3GZ7 A;  3VVU A;  1VQK S;  2EPI A;  1G4C A;  3GV8 B;  1R43 A;  1HPZ A;  1B7Y B;  4UZC A;  3BKU A;  3W61 A;  2FLP A;  5J2Q A;  3FQK A;  4PAA A;  4Y2C A;  2DH7 A;  1TKT A;  4LF5 F;  4ED5 A;  3A8K A;  4ELU A;  1I94 J;  4NCG A;  1ZA1 B;  1BWV A;  3PX6 A;  2DIT A;  4YY3 F;  3A12 A;  4WKY A;  2VJV A;  4H4K C;  2GCF A;  3CUL A;  1Y3J A;  4F0H A;  3UNY A;  4AL7 A;  3ILL A;  1FT8 A;  1NME B;  4O4G A;  3HJF A;  1YLX A;  5DDQ C;  4DL5 A;  2YNG A;  4LFA F;  3GR0 A;  3LGM A;  2CPZ A;  2R8J A;  1GXL A;  1FDA A;  3MPW A;  3MR2 A;  3MR5 A;  2AX0 A;  4EO8 A;  2M52 A;  3N0V A;  3A8I A;  3QFH A;  5DG7 A;  1L3K A;  2B9X A;  1VK3 A;  3Q0A A;  1JJ4 A;  2YX4 A;  5D4O A;  1QTM A;  2RQM A;  2J5A A;  4MTP A;  4NLS A;  5CXT A;  3CD6 S;  4P7T A;  2C3U A;  1WKK A;  3K58 A;  3R7N B;  4QBU A;  2V2V A;  2QV6 A;  4HL9 A;  4YN3 B;  4WU3 A;  1H2U X;  3JTN A;  2ZWP A;  4Y2K A;  3QJP A;  4YEA A;  5BYQ A;  1KOO A;  5CYM B;  1WHV A;  1ZAW A;  1PC4 A;  5J2P A;  5LMN J;  3IBC B;  3JSB A;  3CCZ A;  3KHR A;  3R5B A;  3BO2 A;  3CCR S;  4KO0 A;  2M7S A;  2CAD A;  2V4J B;  2N3O A;  3GP9 A;  1TVR B;  2JJ4 D;  2XCA A;  4F8R A;  2LDY A;  1XWL A;  5KG6 A;  5I3Q A;  4USM A;  2CPI A;  4TU7 A;  3MR7 A;  1RBO B;  2M70 A;  1L5U A;  2HG4 A;  2ZOF A;  3CIM A;  5CAB A;  2EBE A;  2AWZ A;  3HZE A;  3KK1 A;  4DI6 A;  5KFS A;  3M8R A;  1XER A;  3OR1 A;  4F2R A;  2EK1 A;  5LXR A;  1VQ7 S;  4ZIW A;  2J76 E;  3EYZ A;  4UT4 A;  1LWF A;  2AX1 A;  4JI6 F;  1RAI B;  4JI2 J;  3HSD A;  4DPT A;  1NK4 A;  4LSL B;  2RRN A;  5KFW A;  3JXO A;  1RUS A;  3LOU A;  3SDE A;  4ECW A;  1AFI A;  3FMB A;  4DR7 F;  1XNR J;  5DG9 A;  4GC6 A;  2HHS A;  3OXG A;  5HQL A;  4IOA Q;  4QWA A;  3TRG A;  2KU7 A;  2QN6 B;  4C7Q A;  1S0M A;  2UXD J;  2OPR A;  4CO4 A;  2VBY A;  1W2I A;  2DCL A;  3JYT A;  5FLX Y;  1DAR A;  2C42 A;  2LA4 A;  3DLE A;  3PM9 A;  1HBN A;  3TUP A;  4NLU A;  3D28 A;  1GX6 A;  4JI0 F;  1QY7 A;  4YQW A;  1YZ6 A;  3NOG A;  4JI7 J;  2XY6 A;  3P4U B;  4M5I A;  2YKP A;  1XN9 A;  5DM6 Q;  1RT5 B;  5L39 A;  1KOH A;  1OS5 A;  2YPY A;  4H4K A;  3CE8 A;  3TUJ C;  4HTJ A;  4DUZ J;  5CHC B;  1CS4 A;  4WE1 B;  3R6L B;  4ECU A;  4LVO P;  4GC7 A;  4OZL A;  1MRO A;  2VC0 A;  4MIA A;  2RHQ B;  1N54 B;  2GAH C;  4Y28 C;  1R0A B;  4OHV A;  3AOB A;  2CYY A;  4ILM A;  1KFD A;  2E5H A;  1APS A;  2RIL A;  2OAU A;  5ETR A;  3FNN A;  2D3O R;  1KLM B;  4BWM A;  2LQJ A;  5M2P A;  3VWS A;  2C2M B;  5F9N A;  5KFK A;  2V9K A;  4IG3 A;  1U09 A;  3ZZP A;  1IKY B;  2AMC B;  3I5B A;  3RZA A;  5HAO A;  3BYR A;  4IO1 A;  2UXB F;  1SIZ A;  3N6L A;  4JI1 F;  3HHD A;  6FD1 A;  2W24 A;  2AYG A;  1IM6 A;  5D4N A;  4NLO A;  4WKR A;  4PCQ A;  1F0X A;  3GFH A;  1TV6 A;  2CJQ A;  2CJ9 A;  2ADC A;  1MMD A;  4QOT A;  4B3O A;  3TA0 A;  4IR9 A;  2XS7 A;  3CDW A;  3OTE A;  2SXL A;  5KT4 A;  2C2K B;  3WQP A;  2MQQ A;  5KG3 A;  2E1A A;  4YDD B;  1SL2 A;  3OPK A;  1IVZ A;  1HNZ J;  3OL9 A;  1RT7 A;  2V2K A;  3RB4 A;  3KLF B;  4DV2 J;  4U96 A;  5DLF A;  3MI7 X;  2ABY A;  4WFZ A;  4Q8E A;  1Y7P A;  2OTJ S;  4P74 A;  2PE8 A;  4PUO B;  1ACM B;  4HTI A;  4UOG A;  3L7U A;  5CYQ B;  3NMA A;  4U95 A;  2R7W A;  1RTI B;  4G1Q B;  3KHH A;  2DHS A;  3ET6 B;  3ZO7 A;  2VG7 B;  3N01 A;  1QD1 A;  1WG5 A;  3ZFV A;  5C7P A;  2JEJ A;  1VK8 A;  2NLW A;  4L74 A;  1IUJ A;  4LF6 J;  1FEH A;  3PJW A;  2NR0 A;  2ZE2 B;  1S0V A;  4NX9 A;  3M8Y A;  4LBH A;  3Q8P B;  5M2R A;  2G1D A;  1T8E A;  4I6W A;  1R6Y A;  4TLQ A;  3Q8S B;  1KVI A;  2V67 A;  4DL7 A;  2A3J A;  1FVS A;  3CNQ P;  3THV A;  4IH6 A;  2FPH X;  3TAN A;  1AUS L;  1OY9 A;  4TQR A;  3MEK A;  1MG7 A;  4LR9 A;  4OHX A;  1ZPW X;  3O3L A;  3GR1 A;  5T41 A;  2M3D A;  4LF7 F;  1IKW B;  1IM4 A;  2IM2 A;  2OSQ A;  1UJ4 A;  4K0K J;  4L6V 3;  4URQ U;  2KO1 A;  3WC2 A;  2HHP A;  2KKH A;  5GAG I;  4HHH A;  3Q2T C;  4F0M A;  8ATC B;  1G6B A;  4RNO A;  3QGP A;  4WFA Q;  5EWG A;  2HRT A;  5G4D A;  1S1X A;  1SL1 A;  3HSJ A;  4P52 A;  3IP0 A;  3UDE A;  5ETQ A;  2ZZN A;  1VJW A;  3BSO A;  2W9C A;  2GIF A;  3NNC A;  4P6Q A;  2ZH1 A;  4HH0 A;  3W66 A;  3R27 A;  2OIH A;  5AXN A;  1D9D A;  3M30 B;  1Q1K A;  1S6Q B;  4Q2L A;  4A46 A;  1FI4 A;  1FE0 A;  2GMH A;  2UVR A;  2XNR A;  1AW0 A;  2QL7 B;  1I3O B;  3TAM A;  1R8A A;  2DK2 A;  2MQO A;  1C4A A;  5IWA J;  4RZR A;  1UVI A;  1SV5 B;  1T3N A;  4Y00 A;  1R89 A;  3MPD A;  3BO4 A;  1S97 A;  5HMW A;  5HJY A;  2ZH6 A;  5KG2 A;  3C6U A;  3CUN A;  1CC7 A;  4JI4 F;  4FKX A;  3A1Y G;  4PG7 A;  2JOQ A;  3LO3 A;  4G65 A;  4CLY A;  2F9J A;  5KFH A;  4DCP B;  5KFY A;  3MAA B;  4LRD A;  3ZTP A;  1H74 A;  2ROP A;  1CJT A;  3PKY A;  3E2E A;  3DU5 A;  1KHV A;  1ZOT A;  2AEM A;  3QBC A;  5AJ3 J;  2H1Y A;  1V5I B;  2J0S D;  4OI2 A;  3R2D J;  3BH6 B;  4ZVO B;  5KFG A;  4RU2 A;  1F9F A;  1BQX A;  2BE9 B;  4DQI A;  3SQG B;  2MKC A;  5KG0 A;  1FO1 A;  4CLF A;  3Q8Q B;  2DNR A;  1FES A;  1Q86 T;  2BM0 A;  5E41 A;  1VYA A;  4J9Q A;  1VQO S;  1W25 A;  3BO3 A;  5CCM A;  4IDK A;  4MFB B;  4PWD A;  5D78 A;  5HBM B;  3C6T B;  3DRY A;  2CNK B;  2ZBR A;  3GFX A;  4K59 A;  1RCX B;  4P9S A;  3RB3 A;  1R3N A;  2DR9 A;  3LW5 C;  1VIX A;  4UUW A;  2B4V A;  2HFU A;  2F8H A;  2FC9 A;  1HNX J;  1JNR B;  2E66 A;  4I1T A;  1S9E A;  4X62 F;  3OV7 A;  3IRX B;  5HRO A;  2ERR A;  1HBO A;  5I3P A;  3PEJ A;  1YJT A;  3K8V A;  3KJN B;  2E9Z A;  3A3P B;  4GVL A;  1NK0 A;  2BA9 A;  2JHE A;  2DH8 A;  4DPW A;  2F63 A;  1HHT P;  5HVH A;  4ZIV A;  4Y6I A;  1T0T V;  3ENQ A;  3IG1 B;  3CDE A;  4WFX A;  2CA9 A;  2APO A;  1I51 B;  3OXF A;  4J90 A;  3M8P B;  3GON A;  4KE5 A;  1URR A;  2E5I A;  1NH8 A;  5DM7 Q;  3NCQ A;  5KFC A;  2ZHO A;  3BRE A;  1E6Y B;  2AV5 A;  1N5V A;  3DOK A;  2GVD A;  4FN5 A;  1TMM A;  2GFF A;  2A10 A;  3M32 A;  2QRR A;  1U1N A;  1EP4 B;  2V8G A;  3D68 A;  2MHN A;  2ZKT A;  3HJV A;  3AJ2 A;  2XNQ A;  4QWB A;  1VLO A;  2A6M A;  1S1U B;  2PI4 A;  1RHJ B;  2H5I B;  2V4Q A;  2BMB A;  5IV4 A;  2UUB F;  3H98 A;  2XSJ A;  3DKD A;  1LXN A;  1RTZ A;  4J9N A;  4MIB A;  4NYZ A;  2F65 A;  1YRT A;  5DG8 A;  2R8I A;  2FHK A;  4X66 F;  5DJB A;  4K8R A;  1EQM A;  1TR0 A;  1KQK A;  3TA2 A;  3U1L A;  1S1V A;  1FRI A;  3J7Z 5;  3SV4 A;  1WHW A;  1DY3 A;  3BJY A;  2O66 A;  2LFV A;  3GU0 A;  4DV1 F;  3UN3 A;  1JLB A;  4A48 A;  2OEL A;  1V6H A;  1CJK A;  2K3K A;  2NS1 B;  1HMV B;  1H73 A;  2KVI A;  4RBU A;  1VMB A;  1NXI A;  2LU1 A;  1TKD A;  2ZC4 A;  5DO2 A;  3B8H A;  3OJS A;  3KDN A;  2FJX A;  2FJE B;  5A0Y B;  4DDF A;  2XMJ A;  2JC0 A;  2KYX A;  3ONQ A;  1BLU A;  4LT6 A;  1N88 A;  5L9N A;  1M1H A;  2MB0 B;  3X1L B;  2OEK A;  1DTQ A;  1XMO F;  4AYB D;  5DQG A;  1FWK A;  2R7O A;  4B9S A;  1ZTW A;  3ENW A;  2PC6 A;  2WVC A;  1RWP B;  3PR5 B;  3SFG A;  1FWP A;  3MM7 B;  3C8Y A;  1OMS A;  4FNI A;  3AY0 A;  2G9O A;  4A8W A;  2IBK A;  3VCD A;  4LFA J;  3BN4 A;  1SL0 A;  4B9L A;  1HHS A;  1FKO A;  2UVV A;  1NEE A;  3TNV A;  2ROE A;  1JXE A;  4ICL A;  2FY1 A;  4OZ2 A;  3A4T A;  3W1Y C;  1JJ2 R;  2R2S A;  5KFV A;  1K8A T;  3OLA A;  1SJ3 P;  2A2D A;  1F9E B;  2ZH8 A;  3OLB A;  3G96 A;  4L72 B;  4F04 B;  3HXM A;  4OQJ A;  2XYG B;  2HHX A;  1IQZ A;  3KYL A;  4OZ5 A;  1T9U A;  1U1R A;  2PMZ D;  2HMI B;  1RP5 A;  2CPD A;  4TLR A;  1R8B A;  3PHT A;  1RKI A;  4USH A;  4DSL A;  4OYW A;  1HHQ A;  1VRU B;  3H7H B;  3FFI B;  1H0H B;  1H2V Z;  8RUC A;  4XIU A;  1KQS R;  1BD6 A;  3D0I E;  1H6K X;  2GO9 A;  3DCA A;  2AJ4 A;  1TP7 A;  4M1K A;  2VG6 B;  1K9M T;  1MU2 B;  5F8N A;  4TNO A;  1UTA A;  4N41 A;  3SBM A;  2ZH7 A;  1SKW A;  1J5E F;  5F8I A;  1X4E A;  4MKA A;  2MKJ A;  3KLE B;  2D3Z A;  4ECY A;  4YS2 A;  4ELT A;  1SH0 A;  4YB1 P;  2DNG A;  4LMZ A;  1VHI A;  2DGU A;  1RAB B;  3KK2 A;  3T9Z A;  2MY7 A;  4FZV A;  2WW8 A;  1VCT A;  3OSN A;  2XMU A;  3DYA A;  4CT9 A;  4MYU A;  2QSW A;  4I64 A;  1NDL A;  2RRA A;  5K14 A;  2OO4 A;  2CUY A;  1CC8 A;  3W2W B;  3GFZ A;  2MQL A;  4NXM F;  2H54 B;  2JVO A;  4UQT A;  2KFZ A;  4Q8F A;  2W8L A;  1DRZ A;  3I56 S;  4BDP A;  2FJW A;  2VOO A;  2ZWO A;  3RTV A;  2E9T A;  4BBY A;  1NJZ A;  4BC9 A;  2KFY A;  1IJE B;  3ZZO A;  2OH2 A;  1M1G A;  2MTL A;  2BRL A;  4OYO A;  4JI0 J;  5KFT A;  3DRS B;  5SUH A;  3M1V B;  1IBC B;  4DR5 F;  2BW2 A;  2DB1 A;  2DNN A;  4OYZ A;  3QNW B;  2KM8 B;  2XZD B;  2HNZ A;  1C1B B;  2MKK A;  4QWE A;  2EBG A;  1FDD A;  1LWC A;  4A8S A;  1ZTT A;  2XMA A;  1S6P A;  4CM0 A;  1KVJ A;  1J27 A;  1FJE B;  3QWU A;  4N77 A;  4PPD A;  2BE2 A;  1IWA A;  1FRJ A;  4OI0 A;  5E7O B;  3I0R A;  1FJ7 A;  2MZQ A;  3UD5 A;  1X4G A;  3N5F A;  3O5T B;  3OTC A;  1OJ4 A;  2HGN A;  1PYT A;  4IRK A;  3SQO P;  1SJ4 P;  4BLG A;  2N3L A;  1FD2 A;  3QFW A;  4ZP7 A;  3KK3 B;  4QR1 A;  3IBF B;  2RQC A;  3U02 A;  4PRF A;  5FJ4 A;  3DLB A;  1VDH A;  3AA9 A;  2VPX B;  3H2V E;  4KBI A;  4OZ3 A;  3MF5 A;  3Q86 A;  4M5J A;  5GAD U;  4K2X A;  1WOR A;  2QMX A;  5HVG A;  4J9K A;  3CIZ A;  2IBO A;  1UEV A;  2KRR A;  1U1O A;  2F4V F;  2UXB J;  4UOC A;  4EBC A;  2LDI A;  1QVF R;  2FB0 A;  2PMH A;  5ETN A;  2YWG A;  4A8O A;  1GH8 A;  2GW8 A;  3UDL A;  1NU4 A;  3LP0 B;  4C3L A;  1IN0 A;  3EVO A;  4RW9 B;  3WZ0 A;  3AH6 A;  3QLH B;  1N36 F;  4B9M A;  1NPK A;  3BPS P;  3VAL A;  2F40 A;  2GC8 A;  4Q0B B;  2LXI A;  2HZC A;  1KHW A;  1YJW S;  2ZH3 A;  1FRX A;  2YNI B;  1PYS B;  2ALY B;  1NDK A;  1V9O A;  3HKW A;  3I5A A;  1RAA B;  3M6U A;  4K4W A;  1ULR A;  3PFE A;  2EKN A;  3UCZ P;  5BJR A;  2AEJ A;  1Q16 B;  5LJ5 Y;  3NMR A;  2ZH9 A;  2HRU A;  1NKC A;  3CGI A;  3C3L A;  1S0N A;  4FS2 A;  5DQH A;  1QUV A;  3EWG A;  3LUY A;  4KR0 B;  2CQH A;  3CME S;  2Y1R I;  3DXS X;  1UZH A;  5KFN A;  5KFP A;  3I55 S;  2K1R B;  5F8L A;  1VBX A;  2Q66 A;  3DLK B;  2MZT A;  1FFW B;  1FKP B;  3RAX A;  5KOW A;  2XLI A;  1HI0 P;  1NK7 A;  5CYM A;  4LF4 F;  1KDN A;  1PSD A;  2YQ3 A;  3T6B A;  1VC0 A;  3JTP A;  1Q7Y T;  4DQS A;  1HQU B;  4FDF A;  2CQC A;  4RW8 B;  2ZBQ A;  3C2P A;  1U6B A;  2MYF A;  4XTT A;  4NLQ A;  2XM3 A;  3H20 A;  2XEX A;  2V4J A;  2R7S A;  2VFS A;  3H5X A;  1TVR A;  3CJK B;  3G4S S;  1I6J A;  2YNH B;  2BJ8 A;  2LXF A;  1B0P A;  5ADZ A;  4LBP A;  1YSJ A;  5J1N A;  2W4C A;  3V4M A;  2BAN B;  1IWG A;  4C4W A;  3L95 X;  2GQQ A;  4LF7 J;  1M5S A;  4O0I A;  1MNE A;  3K5L A;  4MMO A;  4O44 B;  1YTY A;  2BM1 A;  1UVL A;  2B9W A;  3W2V B;  4JV5 J;  4MYT A;  2WVF A;  4ZLN A;  1G7C B;  4LSL A;  1GXT A;  3EX7 B;  2IRY A;  4G1I A;  1SQF A;  3HLU A;  3K59 A;  2HBQ B;  3RAQ A;  4M5H A;  1X0F A;  4KIA A;  1MWY A;  2LP4 A;  2E1C A;  4DR3 F;  1IR2 A;  2K3I A;  3DU6 A;  2DNM A;  3W8P A;  2XMV A;  3Q22 A;  3KUE A;  2BEF A;  5J2Q B;  5IQQ A;  2DXE A;  3AOA A;  1RT5 A;  2EXU A;  3W63 A;  1S1T B;  1DZ5 A;  5ETM A;  2UUW A;  1Q8I A;  2VDH A;  5C24 B;  4DQQ A;  5KT7 A;  2CPH A;  1YJV A;  3IWX A;  1T9Y A;  4DPO A;  4JI4 J;  1RTH B;  3UPF A;  1RDR A;  1T94 A;  1OSC A;  3IA0 A;  2MKH A;  4GVB B;  3ZZR A;  1WI6 A;  4LSN B;  4LVN P;  1R0A A;  4EYI B;  2Z2Y B;  2P9E A;  4ZS6 A;  1DTT B;  4OZ0 A;  2V8V A;  1VBZ A;  1Y10 A;  3K7R A;  1NK5 A;  1ZZF A;  2ZJR Q;  3J7A 1;  3D4J A;  2Y9H A;  3HK2 A;  4JV1 A;  2LCW A;  2CAJ A;  5JMN A;  1KLM A;  2HQD A;  3TWZ A;  3D6T B;  1NSQ A;  1TKZ B;  4P2S A;  1IKY A;  1EKS A;  2M0G B;  3D0H E;  2RQK A;  1A7G E;  2H3E B;  2IYG A;  3FVY A;  1S7I A;  1YRX A;  4WF9 Q;  1YG0 A;  1V3S A;  1VRQ C;  4MH8 A;  3B54 A;  4DFK A;  4M5G A;  3CCE S;  1NJI T;  3HVA A;  4O23 A;  4OJ3 A;  3OVA A;  5AXL A;  2ZH5 A;  1D9F A;  2VIH A;  1TFY A;  3BQ0 A;  2QA2 A;  1S99 A;  4ECX A;  3MCO A;  2Z8Q A;  2VQF F;  3UD4 P;  3MUT P;  2UV8 G;  2DYA A;  3G87 A;  3FQL A;  1K73 T;  2DNH A;  4OV6 A;  4WYW A;  4RWW A;  5C25 A;  4RJV A;  3D6H B;  2GAG C;  1F3V A;  4ED0 A;  3H4D A;  2IVY A;  5E3Q A;  2XG8 A;  3BEG B;  3UDV A;  4ZHR B;  3IM9 A;  2ASD A;  1FNM A;  3BM7 A;  5IS2 A;  2I5J B;  5CYQ A;  3US5 A;  3FRZ A;  2HHV A;  1RTI A;  3TJA A;  1C0T B;  4G1Q A;  5L46 A;  5AE3 A;  3ET6 A;  3MCS A;  4FS1 A;  1FXR A;  5K8O A;  2HVZ A;  2LQB A;  2X1B A;  2VG7 A;  4IUF A;  5IV3 A;  3CDU A;  4YB6 A;  2GGP B;  3AJ1 A;  2ZUA A;  2R8H A;  1NB7 A;  2WBR A;  2E1R A;  4QW9 A;  4PR6 A;  1RAH B;  3FDS A;  2ZE2 A;  2ASL A;  2ZM6 F;  3AJD A;  3BKT A;  2R2T A;  3TO8 A;  2PA8 D;  4USW A;  4YR0 A;  3NWG A;  2BKO A;  2ADB A;  3G9C A;  4DMZ A;  1RHM B;  1R31 A;  1VC5 A;  4X66 J;  4U9R A;  3MOJ B;  3VGU A;  2L41 A;  4RKU C;  3HHN B;  4CO1 A;  3MAQ A;  2N4C A;  2Z2Z A;  3CED A;  4QU7 A;  4NLX A;  1MWQ A;  5D0G A;  4DV1 J;  4ZDN A;  2QO3 A;  3KFW X;  2VV5 A;  3KJV B;  3HVW A;  1IKW A;  2JSX A;  1QM9 A;  3FCV A;  1UZD A;  3PX0 A;  1FHT A;  2EKY A;  4ATN A;  4OV1 A;  2N82 B;  2HYI B;  2MQP A;  3J7Y U;  4FXD A;  4LRB A;  2RKI B;  4C8Y A;  3GYG A;  2HBR B;  2AP6 A;  1HWJ A;  5AE2 A;  3UVJ B;  2KT2 A;  1XMO J;  2XWY A;  3R97 A;  4IFY B;  2GJ2 A;  1WTF A;  3GIK A;  3B82 A;  3LPY A;  5B0A A;  2VFT A;  3TQE A;  4B08 A;  1QE1 B;  9ATC B;  2C2R A;  4ED6 A;  2ZH4 A;  4UY8 T;  3S6E A;  3KJQ B;  1WG1 A;  3M30 A;  2YWF A;  1S6Q A;  3W3S A;  2ZBC A;  1GNK A;  3ZTO A;  3BH7 B;  5GAE U;  3SZ2 A;  5IT0 A;  2O01 C;  2DTJ A;  1XK8 A;  3K17 A;  1T9T A;  1C0U B;  1H38 A;  2D9O A;  1SV5 A;  3PNI A;  4ELV A;  1QLN A;  1JIH A;  3V6H A;  1TV6 B;  2M8D B;  2LLZ A;  3M9N B;  3W60 A;  4CLU A;  1LNQ A;  2EK6 A;  1GT8 A;  2ROG A;  4CH0 S;  3MEC B;  4USV A;  2ZD1 B;  1YBA A;  1WEX A;  3MAA A;  1KC8 T;  4R0E A;  2IFX A;  2PDA A;  3R8Y A;  2BJE A;  5J1E B;  1Q95 G;  1Q4R A;  2HQF A;  7AT1 B;  3CJ4 A;  2HVE A;  4GRS A;  4ZLJ A;  2RE1 A;  2XTJ P;  2IYI A;  1VQ8 S;  2RNE A;  3SQG A;  1TK0 A;  1TAU A;  1OY8 A;  4P72 A;  4C48 A;  3NGK A;  4XK8 C;  2CQ4 A;  1B4S A;  1WOO A;  2VOP A;  2QL5 B;  4MFB A;  5HBM A;  3OFH A;  1UP1 A;  2BZ2 A;  5JJB A;  3NKY A;  4YP3 A;  1ZET A;  2AJ2 A;  4DLE A;  3C6T A;  2ZUG A;  1J5E J;  2YH0 A;  1QUP A;  1TUV A;  2R7X A;  5IM0 A;  4O3S A;  1XR5 A;  4D3G A;  4QIE A;  1IBL J;  1DHM A;  1GAO A;  1VC6 A;  4M5D A;  3VGV A;  2MEW A;  1U02 A;  1TL3 B;  5HO4 A;  1PC5 A;  3KMS A;  2MDA A;  3NS5 A;  2XLJ A;  4OX8 A;  4QJV A;  1IJF B;  2CQI A;  3V6D B;  3QRP A;  2HQI A;  2W2O P;  2ZVS A;  4CP5 A;  4DV7 F;  3QT5 A;  3VZH A;  4DPX A;  4ZVU B;  2MMY A;  5F3T A;  4PG8 A;  3Q89 A;  3TUZ C;  3UE2 A;  2DBB A;  2ZC3 A;  4OI6 A;  2MQM A;  4L75 A;  1ZYQ A;  1UKU A;  4CLP A;  4B3T F;  1P9Y A;  3IG1 A;  3TX0 A;  3HHK A;  2KXH A;  2J0X A;  3PYE A;  1M1K T;  4N7T A;  3TX8 A;  2J8S A;  2MGZ B;  1M5H A;  2BDP A;  3M8P A;  4DR5 J;  4LR7 A;  5LSO A;  3G8T A;  3V6J A;  1TL4 A;  3IGN A;  3DDI A;  3GFY A;  1VLY A;  1YWX A;  3H2L A;  2XGQ A;  2OMO A;  3FBF A;  3DLH A;  4URS A;  4J37 A;  2Y1L B;  2JH3 A;  2GQC A;  1VQP S;  2FUG 9;  1WKJ A;  3CC2 S;  2QTW A;  1EP4 A;  1FFG B;  3VGT A;  1S1U A;  2V69 A;  1LV5 A;  3IGV A;  3J80 Y;  3TUI C;  2FD2 A;  1X4D A;  1U25 A;  2YKN B;  5B08 A;  1KSP A;  2MHE A;  4IFV B;  3E8O A;  4PAB A;  2NXU A;  4LFB J;  1O6X A;  1UAW A;  4TY8 B;  1FRL A;  4FYY B;  1XTZ A;  2HKE A;  5K8P A;  3SSR A;  4FP9 A;  3EXY A;  1KQG B;  2B9E A;  5IZH A;  3UO0 A;  4PG4 A;  3RBD A;  1JKH B;  5HSP A;  2HAF A;  5G0R A;  4EBD A;  2KT5 A;  3DLJ A;  1HMV A;  5HP1 B;  3Q2S C;  2F4V J;  3MUR P;  2CJK A;  3MOZ A;  1YGY A;  4CDI A;  5A0Y A;  2YX1 A;  3PO4 A;  4A47 A;  1NPR A;  2WB4 A;  3TJ9 A;  1M5O C;  3V81 B;  1MSW D;  3HVR A;  1LKZ A;  3UCU P;  2W25 A;  2ALZ A;  2KM8 C;  1AB8 A;  2LEB A;  2WSF C;  4NA3 A;  1ZH5 A;  1FRK A;  1YDL A;  1N36 J;  2FHJ D;  3B4M A;  1N5T A;  2H48 B;  2XCP A;  4OI1 A;  3PFO A;  3MM7 A;  4NRU A;  5DLG A;  4IG0 B;  2NQP A;  2CG8 A;  3GYX B;  2EFN A;  2IMW P;  5MAO A;  4OZN A;  4OYA A;  3M9M B;  3O1L A;  2RB7 A;  2ATL A;  4HH1 A;  1Q7L B;  3BDE A;  5EWE A;  4Z7Y A;  2OTL S;  3TAP A;  2X51 A;  2LEC A;  1JK9 B;  3N79 A;  4C3M A;  4PQA A;  4J5O A;  3PG9 A;  4OJ1 A;  1VI7 A;  3D0G E;  2ZEJ A;  4DJB A;  3M9O B;  1KWM A;  3W62 A;  4XDD A;  3D1O A;  5IC4 B;  5L1J A;  3M8W A;  4DL6 A;  2HMI A;  1RHR B;  1JWW A;  5C42 B;  1HLW A;  3NS6 A;  1VRU A;  2OLW A;  3MFH A;  1HW8 A;  3OL7 A;  3U7J A; 
#chains in the Genus database with same CATH homology
 2E1P A;  3WIU A;  2PMW A;  3QFH A;  3CO0 P;  2XTJ P;  3T41 A;  3WHI A;  4OV6 A;  3A3O B;  2QTW A;  1SPB P;  2W2Q P;  4JP8 A;  4NMX A;  1V5I B;  2Z57 B;  3H42 A;  2Z2Z A;  2ZWO A;  2W2P P;  2Z56 B;  4YN3 B;  1R6V A;  2W2O P;  2Z30 B;  3A3P B;  3BPS P;  3SQO P;  3WIV A;  3GCW P;  2ZWP A;  2Z58 B;  3A3N B;  3P5B P;  2Z2Y B;  4NE9 C;  1ITP A;  3BGO P;  3VHQ A;  1SCJ B;  3CNQ P;  3VV2 B;  2W2N P;  3AFG A;  3GCX P;  2W2M P;  4K8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...