2Z58B

Crystal structure of g56w-propeptide:s324a-subtilisin complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPWVEKVEFDHQAVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Requirement of left-handed glycine residue for high stability of the Tk-subtilisin propeptide as revealed by mutational and crystallographic analyses
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 9
structure length 66
sequence length 66
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2z58B00
1SCJB 2Z56B 3A3OB 2ZWOA 4OV6A 2QTWA 4NE9C 1R6VA 3SQOP 2W2QP 3A3NB 4NMXA 2W2PP 3BGOP 3WIUA 3QFHA 2W2OP 4YN3B 2Z57B 3P5BP 3BPSP 2W2NP 3GCXP 2E1PA 3WHIA 2XTJP 3A3PB 4K8RA 3GCWP 3H42A 2Z30B 1V5IB 2Z2ZA 2PMWA 3VV2B 4JP8A 2W2MP 1ITPA 3WIVA 2Z2YB 2Z58B 2ZWPA 3CNQP 3VHQA 3CO0P 1SPBP 3T41A 3AFGA
chains in the Genus database with same CATH superfamily
2CQCA 3C6UA 3FCVA 5AXNA 1QUVA 4DL2A 4DV4F 3IA0A 2P8IA 2ZM6J 3VVUA 1Q1KA 1VYAA 2ZBPA 1O51A 1B70B 2LU1A 3HD1A 4RBTA 2W8KA 5DGAA 4ZVRB 2XMWA 4LIRA 2H65B 1F5AA 7FD1A 3U7JA 4PWWA 3CPWR 3OXGA 4PZVA 2PGCA 3BBCA 3D6TB 3M32A 1FX2A 4DN0A 2FDNA 2GVZB 4DSJA 2JNJA 1DTTB 2B8QA 2C2NA 1XIQA 4PUOB 3ZC4A 4PAAA 2DPIA 3H5XA 1RZMA 3AD8C 2KHCA 5KG0A 1LFPA 1NB2A 2J9DA 1EIYB 2AGPA 3L3CA 4YY3J 1LEOA 3D0GE 1IQZA 4TY8A 5KFJA 3QNWB 1XBWA 4X65F 3R6GB 4Z2XA 1FD8A 2I38A 5C42B 3QGGA 2CNNB 1NK6A 1FESA 1TELA 2WW8A 3FZ2A 4RWWA 4Y0FA 5LMNJ 1REVA 1X7VA 3MM9A 2P2CB 3WZ0A 1FKAF 1Q7LB 2DHAA 5KFEA 4DR1F 4I6YA 3TA0A 5HVHA 1HNIB 1GK8A 1JLFB 3KLIB 5J2NB 1D9DA 4R8UB 1J27A 4DOZA 1QLNA 2C3YA 4O0IA 3O8WA 3RBEA 2JZ5A 4TYBA 1JLAA 2CXEA 2CPZA 3CWJA 5HVFA 1S4FA 3TI0A 1TAQA 1H74A 4CWBA 1NJWA 3G87A 3A3PB 1U02A 3PM9A 4IG3A 3TZXA 2FVPA 1IN0A 2YWHA 1FXDA 3OR2A 1XQIA 2I1RA 2UXDF 4QIGA 3D2WA 3KUHA 4MK8A 1OS5A 1FHTA 1LWCB 3NAHA 1N33J 1KOOA 2OPRA 1KNZA 3HVRA 3N9UC 3BO4A 4C8ZA 1VDHA 2CJQA 2RS8A 2B4VA 4BWJA 2IVYA 2VC0A 3F44A 3I5BA 1RKIA 2DK2A 3MR7A 4DR3F 1BY9A 1QSSA 1ZAXA 5B09A 1M1HA 4OZ2A 3ZFVA 3L4BC 6FD1A 4WYWA 1ZM3A 4B3SF 4OI2A 2VJVA 1NM2A 3HI9A 5F8MA 2B7CB 2F4VF 2LXIA 1E6VA 5JXSA 2NPFA 3M1VB 1MMNA 4C8YA 5J1EB 3DRRB 2A0FB 3AA8A 1F2GA 3CIMA 4DV3J 4Y2MA 2BQUA 4ITSA 3GZ7A 4FS2A 4DFMA 4PXCA 1X9MA 3C6TA 1KTQA 3WDOA 1NJZA 4N5SA 2ZBRA 2CQ3A 1V6HA 2H54B 4JV5J 3EGZA 4KFBB 1Q81T 2XB2D 4H54A 3U27A 4ERDA 4PXEA 1FWPA 3C16A 3FSIA 4W98A 3HK2A 1PSDA 4FYVB 1RUSA 5T14A 1A7GE 1HBUA 2M8HA 4DQQA 4FDFA 1BQXA 2KFYA 1VQ6S 3C66A 1WHYA 4GVLA 3O3LA 1S48A 5D4OA 1V9OA 1Q0NA 3AD9C 2P9GA 4DL4A 4DR6F 2YKNA 1MMLA 1S6QA 2V8HA 1MSWD 4PG6A 3T9ZA 2PA3A 4L6V3 3BH7B 3TX0A 5C2GA 3KHHA 5IV4A 2LMIA 3MTKA 4UQTA 4L76A 1LKZA 1MMDA 2QL9B 2HVDA 2AHOB 4OFZA 3MGJA 2HYIB 3PFEA 4USTA 1XMOJ 5KT5A 1EKSA 2JVRA 1FFSB 5DG9A 4KJIA 5I42A 2RRBA 3CDUA 2HLUA 1KP6A 4NRTA 4PWDA 4CH7A 3CE8A 3C3LA 3UN2A 1S12A 4ZN1A 2RQMA 1KLNA 1EX8A 5L39A 1TK0A 3KHGA 3WX8A 3GMGA 3V6JA 4W4MA 3CMQA 5K8OA 1WOPA 2JHEA 5HQLA 3E2EA 1SQEA 4ICLB 4GKJJ 3OLBA 2KVQE 1JB0C 2W01A 1DURA 1KQSR 1P9QC 5KFMA 1S72S 2F7VA 4A8XA 3T41A 1YJTA 2ATLA 1NXIA 2FZKB 4TNOA 1DBDA 1TKZA 3AA9A 1VLYA 4USMA 1FJ7A 1AFJA 1VBXA 3MM8A 3OJUA 2MLZA 3EZ5A 5MAOA 2GHPA 1XWLA 1CJKA 5L46A 2ZE2A 1L3TA 1DARA 2MKIA 1TL4A 3FFIB 1GXTA 1QE1B 2CDQA 3BO3A 1YZ6A 3KOAA 4ELTA 2V2ZA 4NLDA 3UN3A 3HVTA 2YNHA 2DITA 2V34A 2UV8G 4LRCA 4J37A 1XN9A 5I3UA 2M88A 1SKWA 1R0AA 3CC2S 2B6AA 1P9YA 3VTIA 4QYZJ 4LFAF 3KLEB 5F3ZA 2QO3A 3ZTSA 3CJ0A 4I2QB 5CXTA 1JXEA 1LXJA 3TAPA 2LEPA 2P6TA 5KFQA 3H90A 3NL0A 3RGIA 3O6QA 2VC1A 2XCAA 3AJDA 1VFJA 4F50A 3TO8A 2DH9A 1M5KC 2J9CA 4BBYA 5LSLA 4CQ1A 3CCRS 2QC3A 2W1BA 3NLCA 3K7RA 5E3QA 3MAHA 1V5IB 3Q86A 2B4UA 3PYDA 5RUBA 2HRYA 3GIRA 1B0VA 3OLAA 4RW4B 1W7WA 4RLEA 2KI2A 2EBEA 4DSLA 2C2OB 5T7LA 1RWPB 4KQZA 1RTDB 2W7PA 1RHJB 2BE2A 3R7BB 4N56A 4ID8A 3W5YA 5C25B 4DQIA 3IFEA 1JIHA 2NYIA 4DV0F 3DLKA 4I7FA 2NXJA 5KFIA 5HVGA 4WIIA 3UCGA 2VHGA 3AOCA 3F73A 1N48A 1HHQA 4LRBA 3EUNA 1J5EF 4BLGA 4X62F 2HHHJ 1PYOB 1TU0B 1HHTP 1VQPS 1AW0A 2RJZA 1WJ9A 2BJDA 5H9EJ 2XI2A 2XHCA 3SCKE 2MZTA 4KT0C 1S1XA 3TQ1A 3PYEA 4NLPA 4KHMA 2QA4S 1S9EB 2AP6A 3DOMA 4HI2A 4NL5A 2EC2A 3Q8YA 5AJ3F 2VDIA 2GFFA 3QT8A 5GAEI 1RT5B 1VQMS 4ZKAA 4DPYA 4OX6A 1WKJA 1X4CA 4LBPA 4QCLA 3TARA 2ZZNA 2OKQA 1Y4ZB 5DGBA 4K4YA 4OZ3A 4OX7A 3MUMP 4DX6A 3ILLA 3DLLQ 1O0PA 1YKWA 2IFXA 2QSFA 4K4SA 4PYAA 3M8QB 1TK8A 5AE3A 1FVSA 1VOMA 2QV6A 3MM6A 5K20B 3PIOQ 1D9AA 3L7OA 2RAQA 2ILZA 4USVA 2H51B 3LA0A 5G0RB 5GAHU 2ROGA 4WXWA 2IM1A 4FPRA 1D8YA 2W2QP 4P72A 3PX4A 3JTOA 2XYHB 4P52A 2CQIA 4C6AA 4JP8A 5BYQA 2WVBA 3OD2A 2QEXS 2G0JA 1H2UX 4O3PA 5KT2A 3CJ4A 1RBAA 1FJGF 2HHSA 2NREA 2KDOA 2MB0B 3HT0A 4DG1B 4PABA 2YH0A 3LF0A 4HT7A 2XS2A 2MPUA 4AL6A 2R7XA 3VWSA 3ZZPA 2OPSA 5DDOC 2IIHA 3DMJA 2V2QA 5F8JA 1EQMA 1XK8A 4O44B 1DHMA 2AZ1A 2B8PA 2AX1A 4AYBD 2KRBA 2E9RX 2KG1A 3UR3C 2B9XA 2FLLA 4TU9A 4M1KA 3V6HA 1IKXB 1EP4B 1U09A 3T6BA 2QFJA 2W7AA 4FF3A 1VHIA 1HQUA 4DV7J 2BOAA 2L3MA 2OUGA 4ECYA 4RW7B 1URRA 4DU7A 1FK9A 2LQ9A 4Y3CA 2DNZA 5DQHA 3DOLB 1RTZA 1WF1A 3BH6B 2XSJB 2FVSA 3BYPA 3BGOP 3CDAA 1WC6A 3MFIA 1FFWB 4ZJQA 2I6WA 3PO5A 1SKSA 2MKKA 4ANCA 3D7SB 1S77D 3E01A 1ZM2A 1BGXT 3KLGB 5LSOA 2EFQA 5K14B 4RUCA 1WKLA 2OP5A 3ZZYA 5H9FK 4FYWB 1AA1B 1NK5A 3U1NA 1CBKA 1X8DA 2A2CA 4IRDA 4RPFA 1IKVB 3FK4A 1T03B 3A8JA 1VI7A 2CWXA 2BX6A 2VJUA 2GJ2A 1PG5B 2B7BB 3D3CJ 4MYTA 3AAWB 1VQSA 4HACB 3BN7A 1FXRA 1RAOA 1X4AA 4W92B 3R2CJ 3A8KA 3KDNA 2UUBJ 2ZH7A 1F60B 1KSPA 2MLYA 4KRWA 3POTA 2DY9A 1U6ZA 3R5BA 3UI3A 4LRAA 2EI5A 4ZK7M 1Q8IA 3MURP 2ZC4A 2UV8A 4ZIWA 2M2BA 1X9SA 4U67Q 5KFGA 3AXKA 3EMTA 2KU7A 5EWEA 2HVZA 4NZ7A 1XNQF 2C22A 4ANEA 4CLTA 1SQFA 2LDYA 2CQ0A 2ZBIA 3DLHA 1S79A 1Y7PA 3DU5A 1SV5A 2BABA 1F3FA 3HF5A 2J0QD 2DHGA 1LWEA 2HS0A 1FA0A 2Q3PA 3EVOA 4JV2A 4O3RA 4XDCA 1NK8A 1Q5VA 2J76E 2DRBA 1LXNA 2ZKTA 1BD6A 2GQ2A 3NMAA 2AEFA 2E5LF 1UPPA 4C11B 3R5GA 5JUMA 2BRKA 1L5UA 2GHWA 2W2NP 1NLKL 3RG6A 2UZAA 4EBDA 1XMQF 1C0UB 4RUHA 1RHUB 2FLPA 1Z2LA 1OQ3A 2ZH8A 2MZRA 1HW8A 4B9NA 4QW9A 2WHOA 2VBWA 3HHLA 4C7QA 4C2MA 4O3SA 4R0EA 1Y9OA 1YSJA 4HI1A 4I0WA 3ILIA 1VQKS 1RT6B 3I4HX 3FNNA 4ZPAA 1XJWB 3Q8QB 4L73A 3T5KA 3TZYA 3QPIA 4ED5A 3J80U 4WBFA 4Z7CA 4K5RA 4LVOP 2F5GA 3PX0A 2JWNA 1YGYA 3KHRA 4X66F 4OI4A 2FC9A 4LBHA 1M1KT 3A12A 1IM4A 1TQLA 3UN5A 2VQEJ 2QL5B 1SIWB 1D0EA 1HLWA 1ZTWA 4DX8H 2LQJA 2L48A 2QMUB 1N5SA 4IR1A 5CHCB 3R1HA 1RXOB 1CJVA 5HL7Q 4KHPF 1CJTB 2E1RA 4Q0BA 4TYAA 3NNCA 3PKMA 4BS2A 3R7SB 3PR5B 3DKDA 2IVFB 2W2PP 1N6QA 2QLXA 2WOMA 1VJQA 4TU8A 5L1IA 2XMVA 4K50A 4R5PA 4IG0A 4LF6F 9RUBA 1K1SA 3D28A 3QJJA 2UUTA 3PEHA 3MMBA 4NA1A 5A6PA 1QVGR 4H4KC 3GIKA 4WF9Q 2JH3A 2HNZA 2CQ2A 1YDLA 5L8RC 3I32A 4KTQA 1SI9A 4WFYA 2RF2A 5HROB 4AXIA 4B3TF 2NSCA 2YQ3A 5DG7A 5F0UA 2B3TB 3RB0A 1NKBA 2OPQB 3T5HA 1RT7A 1X0PA 1S4EA 5D4PA 1JJ4A 4JB8B 4P73A 3W9HA 2VASA 3IGNA 3KDOA 4NOHA 4MFBB 5HBMB 4F4XA 5D78A 2HMIA 3CJ8A 1TKXB 4UZBA 3N6NA 3EE3A 2EW9A 2MHEA 5AXLA 4OZJA 3SV4A 2FUG9 2DNHA 1T0TV 4AD6A 1QD1A 2Z4PA 2XMMA 4DL7A 3I4PA 1CG2A 1AZSA 1YJVA 4OX8A 4JI5F 5HQ8A 2R8GA 1HMVA 5LJ3Y 4KHRA 2VQFJ 3QLHA 3TAMB 4K4XA 3SSRA 3FBCA 4CLZA 2ZJRQ 2MYFA 1HNXF 4WK3A 1OPZA 2PI5A 3T5JA 2CG8A 3TJ8A 1JLCA 3P96A 3K8VA 1JXLA 1L3SA 2UUAJ 1EJ7L 2BA9A 2PEBA 4P75A 3UCUP 3LH2S 2XMTA 4HVZA 3OSPA 1UWBA 3QBCA 1NRKA 2Y0BB 3AY0A 2GGPA 3U1MA 1N5VA 2XI3A 1WEXA 3NY0A 3J7AN 3RU0A 2DGXA 1GFWB 3BSCA 4CZCA 2IM3A 5HMYA 5E3CA 1RSCA 1P1TA 5KFTA 3DOKA 4C3LA 1VK3A 1S76D 2DNLA 3Q0AA 4XPCA 2LA6A 1YI2S 2CPEA 3MWBA 4KH0B 5ETLA 1T9WA 5E3PA 1YTYA 2PIIA 3CCMS 1B7YB 4WXOA 2ERRA 1TFYA 2BEFA 2RSQA 3IR7B 2QJ3A 3TA1A 2P9EA 3HVWA 4KYZA 4L3NA 1S49A 4JI7F 1MWZA 1FEHA 5IT9U 2AJ2A 5HLFB 2A2DA 2FZGB 4ZCKA 2KL8A 3JSRA 5KFFA 4DUTA 2YNIB 1EARA 2LXFA 3VF0B 4YB7A 3KUEA 1RADB 2QFIA 2QMWA 3VAHA 5BXIA 4N77A 3HJFA 2EFNA 4RJVA 2PD1A 1KQGB 3G86A 4H4OB 2MQQA 2E1MC 5F0WA 2J6UA 4P7VA 3CXCR 4DLEA 3EXCX 2AYBA 2WONA 1IBCB 4WU3A 2YVSA 4BWMA 4RUAA 5H1SV 2DXFA 2EG2A 3K5OA 1VGYA 4QIWD 2J0XA 1R6YA 4KGKA 1P27B 4B9VA 4DI6A 4DXLA 3GU0A 4OHYA 2K1RB 3KFWX 3CCLS 5KG1A 5DDRC 2RDJA 2QYCA 1K1QA 1UKUA 4QWDA 4WFXA 3KJNB 5JVHQ 4NX9A 3ENAA 3K5PA 4ID5A 4J9NA 2G1HA 4A8MP 4LSLA 2KT3A 4UY85 5I3QA 3OR1B 3FMWA 3LGMA 3R5AA 4J90A 2FJVA 4K4TA 3JSMA 2YQ1A 1OY9A 3W7BA 5IM0A 5M2RA 2J0SD 2WSEC 5C7PA 4CLFA 2OEJA 1BWVA 5F9NA 4IQXA 1S99A 3K89A 3IR6B 1Y5LB 3KKFA 5J1NA 4DV1F 2L08A 5KFRA 5ETTA 1U1KA 2VF3A 1QAJA 5DG8A 4KE5A 4NXMJ 1H2VZ 1RWXB 3C8YA 1C1BA 1SH2A 3R1LA 4HL9A 4J9KA 1R0CB 4CTAA 3MM5B 4NYPA 5A2QY 4ZCMA 3ZO7A 4ECWA 4GKKJ 2V2KA 2PSZA 1ULRA 1B4SA 4DV4J 1RAJA 4CYUA 3UWTA 2XNQA 3EGWB 2DGSA 1SL2A 1SKRA 1U2RA 4WZQA 5B08A 1AYEA 1S1VB 4OYXA 4RW9A 5DLGA 3WIVA 5KG4A 3HSDA 2HQCA 1DAXA 3KLHB 2VBXA 3JQMA 3HD2A 5ETKA 4LF7J 3H0PA 3KJFB 1M5SA 4P2FA 2MY8A 2FTRA 4M94A 5ADZA 2DNMA 1H73A 3SFUA 2W9CB 5CZXA 4NLGA 3DXSX 2DTJA 3BGLA 3MR3A 3MDFA 2KJVA 2DNOA 4NZ6A 4JI4F 3DLGA 3HXMA 5IS2A 1Q7YT 4FPIA 3KLFA 2IYGA 3QWPA 3ELHA 2D74B 3CNQP 2MHNA 2CUYA 1KR4A 1EETA 4FYYB 1JLGB 1WEYA 1F2HA 4TY9A 1TL7B 5FD1A 4X65J 4KV8B 4OLPA 3PR4A 2IM0A 2P6SA 1JX4A 1UFLA 1UTAA 3SXLA 3UDCA 2WW4A 2BE9B 2CPXA 4FZVA 1HD0A 1Q95G 2XG8A 2HIYA 2LQ5A 4YHHF 4DR1J 1LV5A 2EXUA 2KTQA 2MKCA 4MK9A 1S7IA 1U1PA 3LW5C 3L7UA 4OHVA 4ZPBA 3IBFB 3MECA 4NI2B 2WTFA 3DLJA 3KK1A 4RW6A 2CQGA 3S6EA 2MEWA 4B9LA 2HEKA 2H9ZA 1CQMA 2NLWA 3H2LA 3ILOA 3CO0P 5CQGA 3NOCA 3CJ3A 2HKEA 2KVIA 2LCWA 2KRRA 4CIOA 1D9FA 2HWIA 2UXDJ 1WG5A 1Q78A 3G8QA 3ZXWA 2J7UA 1SKUB 3L95X 5EWGA 2VA3A 2MZ1A 1YITS 3FEYB 1KHVA 4CI0B 5BYRA 2A1BA 3M2RB 4QR0A 3BEGB 1RWOB 5KFCA 1N36F 4YOEA 1HBNB 4DR3J 1HD1A 4HHJA 2BANA 2ZZTA 2AD9A 1N52B 2IAJA 2U1AA 3J7YU 1RABB 2UVVA 5KT7A 4B3SJ 8AT1B 3KG1A 3W8PA 2F4VJ 2EFOA 3FEXB 3PRDA 2VFVA 3E3XA 4I1TA 2CNOB 1JWWA 1LW2B 3KK2A 1FJEB 1HKAA 4DQRA 2KH9A 3J80Y 5KFWA 2FJAB 1VISA 4PR6A 2D7SA 2GQQA 3HHKA 2HRUA 4ECXA 2RHSB 3HSGA 3B54A 1VQLS 1X4GA 3GYGA 4A8FA 3DDNA 4C97A 3BSNA 2QRRA 2DGUA 4TVAB 2W7OA 3FKBA 2B4OA 1UW9A 3TW0A 1PCAA 1SVDA 4F26A 2XYPB 4DCOB 4LF4F 2YTCA 3FBFA 4Y28C 4KGXB 3HZEA 1IKWA 2JC1A 1CS4B 3CDEA 3BDPA 1FERA 2DIVA 3A13A 1FRMA 2WB1D 4A48A 2YNFB 2V4QA 3L7PA 2YX4A 5F8HA 2M3DA 4KGVB 4Y2AA 2POKA 2MZJA 1IM6A 2C2MB 3VR1A 1DJ0A 4DR6J 3HHDA 3M30B 3TUIC 2DNRA 5KFAA 2E5HA 2AYEA 1FI4A 1WHXA 4F0HA 1I94F 3DGPA 2QLBB 3L9ZA 3QSIA 1JXVA 3ICLA 2V8VA 3D0HE 3KMQA 1TL3A 2WSFC 2FHJA 2MGZB 1EQ0A 1H7XA 2AQ4A 1WI6A 1SJFA 5ETQA 4DN9A 4OYOA 2QTWA 7AT1B 3NAIA 3ZZRA 2WVDA 4ZVOB 3G6XA 1T3NA 4QIEA 4WJBA 2OH2A 2CPJA 4JI2F 3HSJA 1CLFA 1SL1A 1T9TA 2H5EA 3H25A 3GG0A 3K59A 3I82A 2V2VA 1U8SA 2CQPA 2I9SA 2DXDA 3MM7B 2HRTA 2BBEA 1RT2A 3OFHA 1LNQA 1YIJS 2CAJA 3FQKA 1M5OC 3UVJA 4IH7A 4OYMA 2EVZA 1TL1B 4I67A 3N6MA 1WUUA 1RAAB 3P8BB 4K0KJ 1YG0A 3G2XA 1SUQB 3SZ2A 3QSYB 1VBZA 4BCAA 1KOHA 1MU2A 2HFZA 4KY3A 4U6PA 4B3OA 4ZVHA 5GADI 2IPOB 4ZN3A 3NMRA 3NGRA 5LMUF 1QAIA 3FCWA 5F8GA 3Q8SB 1QJHA 2QA1A 5AE1A 3DM2A 2D41A 3ULHA 2XBPA 3OVAA 1X9WA 2HZAA 1GX6A 1U1LA 4LFCJ 2W8LA 1K9MT 2G4BA 2DHHA 3QJLA 5IOLA 2KM8B 5D0GA 3RRGA 4M5DA 1C0TA 1GMUA 3T1HF 5AXKA 1HI1A 1G1XA 2O1PA 1UETA 1VJWA 3MCNA 4LSNA 4CO1A 4LFAJ 4WZMA 1RTHA 1Q86T 3LP2A 3WBZA 4DF8A 3DRYA 2MMYA 4ZIVA 4JI3F 2JJ4D 3V2UC 1MROB 5FDLA 1UVIA 2LFVA 4WK1A 1HARA 2OSQA 3QZ8A 4YB1P 3MMCB 1OPIA 2XNRA 1MN7A 2D3UA 1NDPA 5I4MA 1N56A 1UZHA 1RU2A 2XO7A 2YKPA 4DUZF 1FF2A 2R8IA 3RZAA 5DQIA 2F1FA 3OHBA 1J2VA 3AJ2A 1V3SA 2X3DA 5KG3A 2VFUA 1WF0A 4LSZB 3M6VA 1RWWB 5F8LA 4J5OA 4NA3A 2R3VA 4TQRA 2V8GA 3B8HA 4IH5A 3K57A 2MZSA 5ETNA 4MK7A 4CO5A 4B3RF 3KJVA 4RNOA 2K06A 2GO8A 2MSSA 4DPUA 1VQ5S 5KG5A 4ED7A 2DT9A 4NRUA 1S0NA 4B9UA 1NJYA 4WU2A 2MJNA 1Q16B 4DV0J 3G96A 3NS6A 3PEJA 1NK7A 2CFXA 2HNYA 3TUZC 5KFHA 3HPOA 5D77A 1Q82T 4I56A 5A8KB 2FIUA 4Z7YA 3UR0A 3Q8VA 2MTLA 5FIIA 3GONA 3T1YF 4X62J 3MI7X 4X4TA 3I56S 3RB4A 1R8CA 4DX5A 4RW8A 1SC3B 3G82B 2RILA 2BOPA 3LWLA 1SC6A 5HK4A 2DCLA 5L9XA 4ECVA 4Q44A 2GW8A 2R7OA 3NGKA 2KG0A 1X5OA 3BM7A 2R7QA 4DFPA 2ZM6F 2VODA 3BR9A 2EG1A 4OZLA 3CC7S 5D15A 5IZHA 4KC5A 5AJ3J 2AKWB 3IS9B 2QLJB 3UNYA 2VA2A 1JLBB 1N5YB 3DHXA 1C1CB 2K2PA 3M8YA 4ZP9A 4Q2LA 2RUGA 6AT1B 4USIA 5KFNA 5J2QA 3VHQA 3RBDA 4OJ1A 1X4EA 4MIWA 2MDAA 2V68A 4LBIA 3HFKA 3PW4A 4O23A 2OAUA 4DV5J 5HMZA 3BS9A 2ZH2A 4ZPCA 4DR5F 1N32F 1NO8A 2ACYA 4OQJA 4NCBA 4E2FB 2WBMA 2HZCA 3UDVA 2JLEA 2OIHA 4FBUA 5LSRA 2V9KA 3T5LA 1X60A 2RU9A 3IG1A 3DLEA 3GFXA 1CVJA 1CJUA 3IRXA 2DH8A 1RYSA 4IR9A 3CW2C 3ADAC 3AOBA 3OTBA 1HNVA 4IKAA 2BE7D 2HBYB 3OV7A 3FZBA 3OXFA 2B9YA 2VU5A 4JUZA 1S1UA 4CDIA 4OJ3A 3FQLA 2YWFA 4LR9A 4A8YA 2DNPA 1F5CA 1S9GB 5HMWA 1LK5A 2VKZG 2IMWP 3NBPB 4RUBA 3I0SA 1HQEA 1T9UA 3UQSA 3NG8A 4F04B 3CCJS 2AEJA 3G71S 1V3ZA 4IDKB 4G1QB 5B0EA 4RNMA 4ED6A 1KLMB 5D4LA 3NCRA 1XTZA 1YX2A 2VD3A 4P7TA 4LIWA 3W2WA 1RISA 3BBFA 3ET6A 3TEGA 4UOHA 1NNDA 2KJWA 2PFFB 4OX9J 1IJEB 2MKHA 1I1GA 3H8YA 2B51A 3NP5A 3R5CA 2ZJQQ 4OYPA 3JAMY 2XEXA 4U9RA 1CSJA 3BDEA 3M2UA 4DV2J 4TQSA 3BPSP 2DGOA 3W9IA 2YKMA 3VZHA 2Y0SD 1FKPB 1GAOA 1P6TA 4LFBF 1GXUA 5KFLA 2ZUAA 3DI6B 3VCDA 3CD5A 1NU4A 2COLA 1F5BA 1S6OA 4JV1A 3H20A 5SZTA 2VFSA 2J9EA 5A0YB 1HHSA 3R5JB 2XMKA 1PJ7A 3M2VA 1M5PC 3IP0A 1VBKA 1RWNB 2QLFB 1UVLA 2XLIA 2IRXA 2OFGX 4ELUA 2DHXA 4WYLA 2R9LA 2CA9A 3W62A 3GCXP 1RWKB 2UVRA 5CD4A 2D3OR 3ENWA 2HNDB 5E0OA 5THWA 5E3RA 2AYMA 3D1HA 2IY5B 3GTYX 1RT1B 3MEGA 2VFTA 3W63A 3BB5A 3EX7B 3BKFA 2KN4A 4JV5F 4O4GB 1W26A 1LK7A 2PDAA 4ECRA 4QWCA 4WKYA 4PQUB 4FKXA 1WSVA 4JYAF 4ZVQB 1TKTB 4WP8A 1HYSB 5J2MB 3AT1B 2NYHA 2MKYA 3LP1A 1FRLA 3JYTB 1UW4A 4OYWA 1OYDA 2KYZA 3MCOA 1JLEB 1RT4A 4F3MA 5CYMA 1HWUA 2CQHA 2W9BB 5KFOA 4I69A 2J9DE 3W9JA 1FKOB 4ZVEA 4YB6A 3D6MB 1Q53A 1JLQA 4N76A 3B82A 3FUYA 3D6FB 1T9XA 2IRYA 2VIHA 2NCKL 1FRHA 2HZVA 1S0OA 3CJKB 1RT3A 5DM7Q 3PV8A 1PJ6A 2CPYA 2M9KA 2HQFA 4CLYA 1ZPWX 2CJKA 4I2PA 4YR2A 1FVQA 4ZS6A 3EDRB 4WE1A 1NSPA 2E5LJ 2KZMA 3GYXB 2V4JB 3BREA 3T3FA 2DO0A 2GVDA 2H48B 3PYFA 1XMQJ 1VK8A 3MHYA 2NR0A 2AF6A 1R31A 4ZPVR 3UNGC 3V6DB 3BQ2A 4WFNQ 4DFJA 3BQ1A 2FLNA 3LP0B 1R27B 4GKJF 1HW9A 2OD6A 3QRPA 2IRUA 4NPOA 4DR4J 3FMBA 3MAAB 3NGSA 1HNZF 5HP1A 1J5OA 4P2XA 2V9WA 1UJ5A 4MKAA 2F9JA 2N4CA 1LWFB 3R5DA 2VG7B 1N34F 4MT1A 1RTJB 2GO9A 2ZKUA 3BPDA 3GSDA 4LR8A 4KGZB 5KT6A 1TKDA 2V8DA 1VRTB 5A8WA 4RKUC 1ZA1B 2RU3A 2RDIA 2Z2LA 2GAGC 3H5YA 4LJMA 1RTIB 4EYHB 3Q83A 1RBLA 1WC4A 4ZLNA 1FE0A 3KNAA 3SCLE 2XHWA 1RDRA 4JI1F 4RR5A 3TZZA 1VS3A 3U02A 5C2CA 4QBUA 4MTPA 2ZBQA 2BXJA 3NS7B 4KHPJ 1AB8A 1OJ4A 3DHWC 2N7CA 2DXEA 1Z4UA 1NDKA 2EKNA 1U2FA 3SYZA 1TMMA 3A4TA 4B9TA 3ITHA 2XY6A 1HBMA 3J7Z5 4NLRA 1VQ7S 3NOGA 2R2SA 1E6YB 2FHMA 1L3KA 4LF6J 2Z2YB 4RL1A 1T95A 4OMFG 4IFVA 1IBMF 2RHQB 3UW1A 1RBOB 2HFNA 1SH3A 2QA2A 5DS7A 1WHVA 1R8PA 3MEEB 2KXFA 5KFXA 1RAEB 4AE5A 1XMBA 2BV3A 3IWXA 1L3VA 2HHXA 1M0SA 2PN6A 1YJ9S 4JOUA 2ZFHA 4KH1B 1KBRA 3LGHA 4NCGB 4F8RA 1RE1B 3V4IA 4K2XA 2PO4A 4AXJA 3NNAA 1NPPA 4AQYF 2B5JB 3CCZA 4H4MB 2WSCC 3FSYA 1GH8A 2DCUB 2K3IA 3V81A 4ES3A 2KFNA 2C2EA 3OUYA 4DR7J 3ISND 1IXKA 4K4WA 3U1LA 2LEBA 2RIJA 3BZQA 1UFWA 1VRUB 3W60A 1FE4A 2HHHF 2AJ1A 2GS8A 5HJYA 1QTNB 1VQ8S 3KHLA 4OZ5A 1CULB 2B43A 1U0HB 1VQOS 3M8PB 2NS1B 4X4VA 4OJHA 2DR7A 2YX7A 1RLDA 2HS4A 2GX8A 4LF8J 2ATCB 2IYIA 4KPCA 4YFUA 1KS2A 3H5SA 3ISZA 2J6SA 1Y3JA 1X4DA 3CCTA 1ZAVA 2GVZA 1DTTA 3IGVA 4OZNA 4GVBB 3ENQA 3OT9A 4PUOA 3GPAA 4G3IA 2DHSA 4U96A 1DLOB 2ZZMA 3HSZA 2RKIB 2GNKA 1FX4A 1T02A 4Q7AA 2RQKA 3UE2A 1TV6B 2BKPA 2HQGA 4WIQA 1KFSA 2ZNZA 5C42A 2WK4A 3VAKA 3RRKA 3MOZA 3QQCD 3RAXA 3MMAB 4DQPA 1F1BB 2HS3A 1YVFA 4K8RA 3MXHP 1FRJA 1HNIA 1JLFA 2ROEA 3KLIA 4PXDA 5DZ6A 3UDLA 5J2NA 4R8UA 5F8NA 2D9OA 2G9OA 3HHLD 3CC4S 2VDHA 4I4BA 3J81Y 4V1Ak 2Y9HA 2AJ0A 1T8EA 2ASJA 1RHQB 3BSAA 2E29A 3DCAA 2JEJA 5HAOA 4OYIA 1S97A 3LPEA 2BM1A 3VAMA 2HAIA 4A4JA 3G6ES 3G8SA 4EGLA 4IRKA 4TLQA 4WFBQ 1KVKA 3Q8PB 2ALZA 5D6GA 1BWEA 3GWCA 3SQOP 1LWCA 1NK0A 2QE5A 1U7LA 1S6PB 3PVXA 4NLUA 3T9NA 2E1AA 3JXOA 1SL0A 2BQRA 4PG5A 5GAHI 5BYSA 3HJVA 3JQJA 2Z57B 2FHOB 2Q6CA 4LR7A 2VOOA 1NEEA 5KOXA 2IJFA 4DPOA 1UWAA 3P4UB 3EJMA 2VKRA 2DNQA 1KC8T 2CG4A 1EKRA 2VH7A 4YQWA 1BUXA 3GJTB 3H2VE 3KK3B 4J9LA 3M1VA 4K4UA 1ZOTA 1OQ6A 2Y8YA 5J1EA 2W25A 4N8OA 3DRRA 4DFKA 5IFMA 1U1OA 1W2BR 2ZHBA 3I9V9 5HANA 3JTNA 2DJWA 1KQKA 2VG6B 4IFYB 1PAUB 2CJ9A 4QYZK 1A6LA 1BQNB 1RAHB 4J9OA 2M70A 4URSA 4URQU 1IBLJ 4P10A 2VOPA 2PEHA 3GIJA 4KFBA 2K7KA 2V0NA 3SQGB 3AHPA 3L09A 5BJRA 3OL6A 3VAGA 1S0MA 2GMJA 1OY8A 1O5JA 1GMWA 4XAKA 1OSDA 2BJ3A 1R8BA 4C98A 4PWUA 2XQCA 1U48A 4CM0A 1CC7A 2AMCB 5J2PA 2MZQA 1M90T 5EDWA 3GYNA 1FCAA 4U8YA 3GFZA 1YQHA 4A8QA 1F9EB 4FNHA 4ED1A 1S1WB 4ZP8A 2HLTA 1RWMB 1FDBA 1HA1A 3NWGA 2G13A 3KJQB 2F40A 2OELA 2AGQA 1C4CA 4ED3A 4ZP6A 4ZVSB 4X4UA 2LKZA 2OPPB 2W2OP 3HKZD 2V8PA 1LWXA 1WNEA 2V5HG 1C4AA 3CJSA 3I0RB 1EAYC 2BW7A 4JI4J 1UP1A 5B7WA 4Y2KA 3G6YA 5IWAF 1NSAA 4OYAA 4G1PA 3O44A 4C8MA 2PE8A 1ITPA 5A8RB 4EBCA 4L3KA 3MEDB 5LM7E 4XTTA 4KB7A 5H9EK 2MQOA 4EU0A 2JLFA 3TR5A 3CJ2A 1QTMA 3MPDA 3CJQA 4OZ1A 2C2RA 4ICLA 2IMOA 3KWMA 2DBBA 3AFGA 4KKOB 2G2ZA 3K58A 4TU7A 2XSFA 2PA8D 3IBWA 1GQEA 2R8KA 3SEOA 2UXCF 5FJ4A 4GO5X 3PKYA 2MXYA 4OJGA 3DRSB 4ZCLA 2YPZA 1Y5NB 2QL7B 3FFIA 2OD4A 1IVZA 1QE1A 4DUYJ 4F3QA 4RX6A 2CQ1A 1XR5A 4F36A 3IRWP 1NZAA 3GP9A 2ZH1A 3EVWA 2ZVSA 3R2DJ 3K5MA 4HH0A 3A1YG 1D1UA 1IKYB 4CLPA 3QT7A 4LREA 3FEZA 4DBQA 3VGTA 1KVIA 2Q79A 3KLEA 5LJ5Y 4J9UE 1IJFB 4I2QA 1RAFB 2C3MA 1I3OB 1NPRA 4OZ0A 1N36J 3HKWA 3LUYA 2O67A 3J7A1 1FNMA 2SXLA 3SCIE 2FD2A 4C4WA 4FP9A 2IC3B 2EC0A 4NLVA 3V6KA 3D1QA 3W3SA 4PPZA 4CO4A 2YWKA 2YPYA 2A6OA 3AOAA 1IBKJ 2ZD1B 3V4MA 3QIPB 4C8KA 2I5JB 1IQTA 3CCWA 4MH8A 3TJAA 2DRDA 4RBVA 4WP3A 3D67A 1HIYA 4U8VA 4RW4A 2B56A 3M8ZA 4DF4A 3BBBA 3ZNUA 4M5MA 1RTDA 2H4WB 1UCNA 4NE9C 4M5GA 4CNZA 5FLXU 3EYZA 4X64J 1NK9A 4F4ZA 5CCMA 1N54B 1MLAA 2KXHA 2DISA 1OY6A 3WQPA 5C25A 4FYXB 4KO0B 4LF4J 3GIMA 5D3GB 4DS4A 5DJBA 1PYSB 5ETMA 3QO9B 1S9FA 2FJBB 4LT6A 1HPZB 2NXCA 1B3TA 4ETXA 3C14B 2G0CA 1Z1ZA 1WWHA 4X4OA 4DDFA 1K8AT 3GG1A 3TVKA 2UU9F 1S1TB 4DSKA 1JQGA 1WHWA 4EMDA 1Q4RA 2EWHA 1RHKB 2CNLB 1OIAA 1YJNS 3DYAB 2VL1A 4P74A 3G8TA 2UXBF 2AZ3A 2UUCJ 3D54A 2GA7A 4FKYA 4PKDB 4ZLJA 2HQIA 1I94J 1S9EA 1PILA 3AH6A 4A8WA 1PGZA 1SB6A 2CZ9A 3CUNA 5C5JA 1RT5A 2CADA 2W4PA 3M9NB 3TVYA 2O66A 4V19J 5C24B 2EFGA 1RT3B 3I6PA 2XS7A 2BQ3A 3WC0A 2E5IA 2NUUG 2UUAF 3SDEB 4I68A 4JI2J 1DTQB 3M8QA 2PC6A 1N0UA 4WFZA 3G6VA 2KT5A 1YRXA 1SC1B 4I6WA 1BQMB 3LAKA 1APSA 1HBOB 3PRBA 3MD3A 1LW0B 1TTHB 3W66A 5G0RA 2X1BA 5EUHA 4B3MF 1WELA 1WG4A 4JI6F 3IXQA 1T05B 1AT1B 5A2QU 4KR0B 5T41A 2YNGB 2J0WA 3GCWP 3H42A 4NZ0A 3C15B 2QG9B 3HO1A 4MKBA 5A76A 1JKHB 3W2VB 1FT8A 2CPDA 4DG1A 3HDSA 3CT9A 2UP1A 2E5GA 3TNVA 2LU2A 5LMUJ 1OSCA 1NH7A 4LQ9A 4ECTA 1R0BG 1U2CA 3OTCA 1YJUA 4WTOB 4O44A 2VG5B 3CVKA 1G6BA 2DPJA 4UOCA 4F25A 3BJYA 3PFOA 1GEHA 1F6TA 2P5VA 3PTWA 5CYQB 2N82B 4USUA 3DRPB 3MOJB 1IKXA 1LOUA 1EP4A 3T1HJ 3GIIA 3TUJC 2ZHAA 3P3DA 4ED8A 4IH6A 4F4YA 3NS5A 4Y00A 5KAKA 4CNYA 4RW7A 2CIMA 2LQBA 3V5RA 4ZHRB 1G3OA 3BGRB 1U6FA 4JI3J 3P6YC 3DOLA 4FF2A 1ZYQA 2W4DA 1TVRB 1TL5A 3MPVA 3C6UB 1NZ8A 2XSJA 1VC0A 1K0VA 1P8GA 1YRTA 3FCHA 2DGTA 3K8WA 2JX2A 1Q8BA 3HULA 2ZH9A 2QSWA 8ATCB 1WG1A 1WC3A 4QQBA 1GNKA 3SMZA 3C19A 1K0TA 3KLGA 1AUDA 2E44A 1KQFB 2ZWPA 3N01A 2M7SA 1RAIB 3CSKA 3DRXA 4TKTA 5K14A 3M32B 3RW7A 2JLGA 2LP4A 4QIVA 1F9FA 2CJXB 3I55S 2AV5A 2DGVA 2QGFB 1IKVA 4DV6J 5E3AA 2XM3A 1UEUA 2VPYB 5ETPA 1T03A 2RVJA 4FVMA 1H0HB 3ISNC 2CPHA 4HKQA 2HGLA 4TY8B 1SJ1A 4HACA 4K7QA 3AXMA 3PDNA 4AFFA 2G2YA 1YBAA 4NXMF 3ZZ0A 3QFWA 2R2UA 3VGUA 1REVB 3MM9B 3NCPA 3SFGA 3WC2A 4P9SA 1ZPVA 1KWMA 2XLJA 2OMOA 3J7ZT 4CT8A 4GKKF 2W2MP 2JEIA 1H3DA 5GVQA 1U1MA 4NXNJ 1SPBP 3M6XA 3H40A 1UEKA 3EICA 3MR2A 1R8AA 1XNRF 1JLAB 5KFUA 2F63A 1YWXA 3M4XA 4NMLA 1KRPA 1G4CA 3O5TB 4HTIA 4WKRA 1WOSA 3R8YA 2JC0A 4ZPWR 2FB0A 3A3OB 3TYTA 2GAHC 4IG3B 3PZPA 2HURA 4FF1A 4FXDA 2FHJD 4LF7F 4EZ9A 4IUFA 2LYVA 3OR2B 1Z2ZA 4USHA 1V3RA 5LL6d 2Y3YA 1VMBA 4DPWA 5KFDA 4Y2CA 2IM2A 2ZOGA 4DCJB 4EYIB 4KGMA 2OPRB 1A0OB 4HR2A 4ER8A 2KFZA 4C48A 4LQ3A 4DR5J 4C11A 1N32J 2YXLA 5DO2A 2C42A 1C0UA 2FJEB 3HHLC 2HFOA 4UW2A 4LF5F 1WORA 1U49A 2VICA 5KFYA 5GAGI 2B0GA 5HO4A 4CP5A 4ZJOA 1E6VB 2J7WA 1X0FA 1RQ0A 4OI3A 2Q1LA 2MY7A 1RT6A 2E7WA 2KM8C 1NAQA 4J7CA 1JNZB 2CJBA 9ATCB 2E9ZA 4A8SA 4OL8A 2APOA 4QWBA 3MPUB 3C6TB 2NPIA 2E1CA 2V67A 2C3OA 5IC4B 3N5BA 1HR0J 2XS5A 3THTA 1N5TA 3C2PA 1U1RA 5JMNA 3C16B 3N6LA 2H5JB 3RJMB 2YQ0A 4OI1A 1HBUB 2VUGA 4CLLA 2DYAA 2GC8A 3ZZZA 4MYUA 4Y2IA 4AT1B 4LF9F 1CJTA 3PHEA 1D8ZA 4WPAA 4RNNA 1PAEX 3D3BJ 4R25A 4ILLA 4MIAA 3PCOB 1MWYA 2YKNB 4O4RA 3I31A 3N79A 3DLBA 1S6QB 4LFBJ 2JL9A 3K5LA 2I8EA 2ASDA 2GHVC 2F8HA 3UO0A 5HI7A 5JVGQ 3ZTOA 2C2KB 2R7TA 2Z8QA 2L9NA 2AJQA 3RR8A 2I2YA 2WB4A 1ZAWA 2FZCB 1MWQA 2AGOA 3UDEA 1T9VA 5HROA 1VLOA 2K8GA 4ZP7A 1Y11A 2CPFA 1DQ9A 5I42B 2CJYB 3UCZP 2OLWA 2XWYA 4PWDB 4M5IA 1T94A 2OPQA 2HFVA 3TVZA 4U7UD 5K8NA 4MFBA 5HBMA 4M8LA 3BN4A 5K8MA 4EK2A 2ZHOA 1TKXA 2LECA 2ZNYA 3OXLA 4C3KA 1TMJA 3HHNB 3PO4A 2GQCA 2YBVA 4DWIA 4JYAJ 4E0DA 2VV5A 3NGUA 2KKHA 3RUBL 1RJJA 4DR2J 2HG4A 2WZ1A 1UVNA 2HBRB 2BJ8A 2ZEJA 2CKWA 5HMXA 4BHQA 5J2PB 1VQ9S 3OTDA 3HFZB 3AQPA 1S5ZA 2CVIA 1JK9B 3J7YI 1TKZB 3O1LA 2YY3A 4HTJA 3VQSA 4N47A 1TZ0A 3MM8B 1T3OA 4WCEQ 4KPYA 4FVCA 4ZVTB 3TAMA 4B9SA 5U47A 2ADCA 3B6BA 4DCPB 4CM2A 1CJKB 3ETOA 2ZE2B 5FLXY 2QLWA 1FTRA 1U1NA 1N4LA 2IVMA 4N41A 1REGX 3HVTB 3M9OB 2YNHB 1K47A 5EWFA 4AL5A 5I3UB 1YK9A 3GV7B 3KG4A 3IWNC 1R0AB 2B6AB 3WHIA 3ZZOA 2HGNA 3JTPA 2ALYB 2WBRA 3B4DA 1FWLA 3CTRA 4EO6A 4F0MA 3GQCA 1RA6A 1ZM4A 3PJWA 5CYJA 1NJIT 4HHHA 4JI8J 5K5MA 3OFFA 3X1LB 5F3TA 1WC0A 4J9SA 4K0KF 1N0VC 4RBUA 2V50A 4RNHA 3UFCX 3CB4A 1GX5A 5M2UA 4TLRA 4F2SA 2BMBA 1HNZJ 3T1AA 3A8IA 1MNEA 5F41A 1N34J 3QT5A 3QRRA 3IWLA 2Z2MA 1B64A 4QWAA 5T7LB 5KT4A 1FXLA 4ZPDA 1ZH5A 1L3UA 4DL6A 2DGQA 2C3PA 2BE2B 2E7XA 1HI8A 3OVBA 3FBEA 5HQMA 2DNNA 1G7CB 5HLFA 3KTQA 4LFCF 4ZVUB 2OSRA 1GT8A 2YNIA 4HDGA 2PMWA 3VV2B 1RK8A 3DLKB 4I7FB 1BC6A 3H7HB 3BGUA 3OQ2A 4WWSA 3Q24A 4JI1J 2MQMA 1PJ5A 2OO4A 1X4HA 4H4OA 3QFHA 1FRIA 2A10A 5LT5A 4M5JA 1S7HA 4DEZA 3RAQA 3DGVA 1KHWA 2OEKA 4P2SA 4AUKA 4C8LA 3TZWA 1H6KX 2K1RA 2BKNA 1S1XB 4F0KA 5CABA 1EB0A 1IBMJ 1B7FA 4NYZA 1YJRA 2XMUA 2UUWA 1U26A 3DOMB 3EZUA 3ZZUA 3KMSA 3D68A 2GMHA 4ETZA 3SIPB 2KZZA 1AUSL 3OR1A 4OYBA 4C8OA 2NSBA 4UUXA 4PG7A 3ILJA 2RRNA 3KLVA 1GTHA 2IHR1 3SI8A 4UUWA 2AT1B 5DDPC 3QYYA 5GMDA 3I5AA 2ZDOA 3QWUA 2RT3A 1Q8LA 4C0BA 2O5DA 3S8SA 2CJAA 2FY8A 2C28A 3UPFA 3MM6B 3HP6A 3HVAA 2XY5A 1AXQA 4AQYJ 1FNXH 4ECSA 4C0HA 2NXUA 2DKOB 2E66A 1WC1A 1Y3KA 2FLOA 3JAMU 3MCSA 4EFAC 2Y1RI 2XO6A 3O2IA 3WX4A 3MM5A 5IV3A 2OJ3A 4OHWA 2XMJA 1KD1T 3D9BA 4IO9Q 2FPHX 4O3NA 4ATNA 3EXYA 4F7VA 2RDDA 3M6UA 4QIFA 1S1VA 1CPZA 2HVEA 2OPSB 1Y5IB 3KLHA 4O3QA 3DMJB 4MMOA 3VAFA 4JI0F 3OTOF 4K59A 1XC9A 3I87A 3T6JA 1NHKL 3SSQA 2R7VA 2AJ4A 1JJ2R 3PY8A 3W65A 5DLFA 4HLBA 2W9CA 3OSNA 1R89A 2XTJP 3NGTA 3BR8A 2X1AA 2F9DA 3EPIA 1KONA 3DC2A 1R8HA 3K2YA 1HQUB 3VQTA 2FJDB 4QR1A 1VHFA 1NB7A 1U45A 2F65A 4DV5F 1JLGA 3I96A 2Y8WA 1TL7A 1FK9B 4KV8A 2R2RA 3B4MA 1UVMA 1NBEB 2YWEA 1WSRA 5CA5A 2EPIA 2GJFA 1B99A 2HAFA 3IMQJ 1S10A 2DVIA 2PFDA 1AFIA 1NUEA 4S0MA 1ELOA 2Q66A 1HQ2A 3E01B 4Y6IA 3QGPA 5BR8F 4NI2A 4XK8C 4XIUA 1IWAA 3D0IE 4JBCA 2FVRA 4YDXA 2ZVIA 2MSTA 3PW7A 3IAM9 4RNFA 1S57A 1TAUA 5I3PA 2JSXA 1FDNA 4IO1A 3OL9A 2IJRA 3GILA 4DL0C 3GLJA 2EEYA 1FFGB 3VALA 5E41A 2GJIA 4Q2MA 3M2RA 1TK5A 4OX9F 2R4FA 4F67A 2RQ4A 4ANDA 2CPIA 3ONQA 3POTB 4DV2F 1I6JA 1HBNA 1C2PA 3IR5B 4X4RA 2RUSA 2CVEA 1RCXB 3PNIA 1A9NB 3EPGA 1HWJA 2IA0A 1LW2A 3TOQA 3X3UA 4G65A 1FD2A 2J5AA 4FN5A 4KSEB 3MD1A 1R3NA 4U7CA 4QPXA 3SBMA 2ZUGA 1R7IA 1TP7A 1SV5B 2NZCA 1LWEB 2BRLA 4Y65A 2HK3A 5D0RA 4V19X 1NK4A 5KFVA 3HCXA 2K7JA 5GMEA 3LO3A 4OHZA 2R7WA 3Q8UA 3LGNA 2FHKA 1UEVA 2ZITA 3KG0A 1WTFA 2ASYA 2HGMA 1HWLA 1HNWF 3Q89A 1CS4A 1SIZA 5F8IA 1UA0A 3ZZTA 3OFGA 4LVNP 1VQYA 2Y1LB 2N3LA 2WCXA 2BJ9A 2YNFA 3Q8RB 2AIRB 1BE4A 4P6QA 2PMZD 4ED4A 3HHLB 2HIQA 1QAYA 2WRMA 3M30A 2BJEA 3FC9A 3EVMA 3GR0A 1NJXA 3QAUA 2CQ4A 4HH1A 3GFHA 3HT3A 2HBZB 3PJXA 2L9DA 4X4QA 1MN9A 2DR9A 2CNKB 2XGQA 2BZ2A 1ZA2B 4CH1A 2MGZA 3QATA 2RNEA 3KYLA 3EGVA 4CLWA 1XERA 2XZTB 2HFSA 4LF1A 3LANA 5KFBA 1RKJA 1RLCL 3BGFA 5H9FJ 3BKUA 5IWAJ 3CJ5A 4FXVA 2BACA 2QYGA 2G1DA 1CJVB 2AJFE 2XY7A 4CT9A 4DL3A 2G2OA 4Q0BB 3MM7A 4ZCIA 1YLXA 2D3O1 1B0TA 4YUDA 1TL1A 4RU2A 1RWUA 1S59A 1N6QB 2WOMB 3MF5A 1NKEA 5IQ6A 1SUQA 2E5JA 1TR0A 2DD8S 2X51A 4PG4A 4IOAQ 4R5PB 4IG0B 2DEJA 2XZDB 2H5IB 1NHVA 4QZVB 3H5UA 4DR4F 2C3UA 3MMBB 1FRXA 2UXCJ 5KFPA 3UD5A 2HNZB 3SV3A 1SCJB 1SXLA 1HI0P 3RTVA 2F8MA 2RF2B 2VZ9A 5GAEU 1LQ9A 4Q8EA 1D09B 1Q5YA 3CCES 3D6HB 3CULA 4H4KA 1TUVA 5F9LA 2LLZA 4G1IA 3QAEA 1KKHA 2M4MA 1H2TZ 3JS9A 1RT7B 4ZLPA 2ZOFA 4C8NA 2HBQB 4NLOA 1Y10A 4EO8A 1DQAA 4NLYA 3LALA 2HMIB 3OL7A 3CD6S 4Z37A 2NXNA 5B0DA 3TUPA 5EX3A 3S7RA 2GIQA 2C2ZB 3NRBA 3G4SS 1J5EJ 3AB2B 4ZA1A 2WAQD 3BQ0A 3BYRA 2QIFA 2GZOA 1MROA 2CZ4A 2MJUA 1AZSB 3MMCA 1FRKA 5IQQA 2ASLA 5AE2A 1QY7A 3GE9A 2AYGA 1HMVB 3QMQA 3M8SA 3QLHB 5M2PA 3M9MB 2BUNA 1DQ8A 2R42A 2Q6BA 4ZVFA 3J81U 1RB0A 1YZ7A 5D4NA 2ILYA 2YKOA 1P1LA 2KYXA 2UVUA 1KEKA 4CO2A 4B02A 1RI7A 1JLCB 4CLUA 5L1JA 3RW6A 2RB7A 1UMJA 3MPYA 4M5KA 5CH7B 3H4BA 5E7OB 3IO1A 1UWBB 4M63A 2AW0A 4YB5A 4D3GA 2GGPB 2FJWA 4UF4A 4YY3F 2BDPA 1QSLA 3DU6A 2A18A 3M8RA 1N5QA 3RB3A 2D69A 3DOKB 2Z0GA 4MAKA 1YBTA 5LMNF 4L72B 4DPXA 2UU9J 5A8KA 3T19A 4WTYA 4DR7F 1GMWD 4KAIA 1T7PA 4EWTA 4F3OA 4ALZA 3THVA 4NMXA 5IXUA 4DZ6A 3EM1A 3G82A 1KDNA 5HJXA 1FJGJ 3M8WA 1RU1A 4CLKA 1CQNA 2UXBJ 4YR0A 3R27A 2ZWOA 4K4ZA 2ZJPQ 3TP2A 4HEA9 5KFZA 2VBZA 1OWXA 2N3OA 2ADBA 4LRFA 2JFDA 1GXLA 3IS9A 3OL8A 1U6BA 4LF8F 3W1YC 1JLBA 1N5YA 2VBYA 1C1CA 4OV6A 1NSKL 2ZH4A 4FXWA 4J91A 2F8EX 4YN3B 2D3ZA 8RUCA 2RH3A 2ZC3A 3FSXA 1N33F 4W90B 3FRZA 4J9QA 2EK6A 3EWGA 3GFYA 2EK1A 3CJRA 2G0IA 5SUHA 3PJ9A 1WEZA 4C3MA 2OGUA 2MQNA 2WVCA 1IR0A 2AEMA 3FJ2A 1JNRB 3HMJG 2WONB 2ZOMA 2M8DB 2M0GB 3RBZA 2CDRB 4B3MJ 2X3GA 4JI6J 2MKSA 2JEGA 2HWTA 4QJVA 1IUJA 4A47A 1F3VA 2RMLA 2OHDA 3GJSB 4RZRA 2HHTA 4U95A 1RGVA 4WFAQ 3QT6A 1PIEA 2DRAA 3TAQA 4ID5B 1IR1A 1WDDA 1Q79A 3ETMA 4LSLB 4X84A 4F2RA 1S9GA 4BDPA 4DSEA 3P5TL 3JSMB 4DV3F 3NBPA 5IM0B 3S1TA 4K5SA 5B0BA 3HM9A 2VPZB 3WIUA 2IDEA 2GV1A 1YBUA 4IDKA 2DR6A 1VQ4S 4G1QA 3VVTA 1XR6A 2H3EB 1KLMA 1N8RT 1T9YA 1FWKA 4RWXA 1FDAA 2DNGA 4CCHA 1ZTTA 4NCAA 2V69A 1C1BB 3W8GA 3E51A 3KXDA 5ETOA 3RR7A 5JJBA 3AJ1A 1VC6A 1WACA 3DNCA 4CTAB 4Q43A 5J1PA 2NUHA 4ZPTR 3VZIA 1FKPA 5CZVA 3VGVA 4CYUB 4I6AA 3DI6A 1QM9A 2YWWA 1WC5A 1PC5A 2HHWA 4YR3A 4RW9B 5A0YA 3F0NA 4PEOA 1QSYA 4PG8A 1XNQJ 3DDKA 2KT2A 1VR6A 4M95A 4ZDNA 4ZMMA 3BV8A 1XMOF 3TX8A 4ZVGA 2O01C 2N7YA 3D5MA 4GC6A 4C9DA 3CCSS 5CD4H 2RQCA 2KB2A 1U4BA 3DLGB 2HNDA 1O6XA 1ICEB 3MEKA 3CJTA 3KLFB 1FDDA 1FTCA 1RT1A 1SJ3P 2J8SA 3PXGa 1U47A 1IBLF 4QW8A 1EETB 4YEAA 5G4DA 4O4GA 4F4WA 3RBXA 5AT1B 4O0NA 4DS5A 4NWBA 5L1LA 4PQUA 3TQEA 3N0VA 2ZDPA 4TN2A 4PQAA 1TKTA 1HYSA 5J2MA 2HHQA 1SH0A 1UZDA 3W64A 4R0JA 3CMES 2BJ1A 2HFUA 3JYTA 1ZM9A 4DJBA 2VPWB 4N8NA 2L9WA 3H59A 1JLEA 1WOOA 5GAGU 4ZJLA 1NCLA 5K8PA 2W9BA 2IBKA 3Q2TC 2ACMA 2W4CA 3MMJA 3TEHB 3OHAA 3NEKA 1FKOA 3MECB 1XNRJ 2V6AA 3KK1B 3CCVS 1JMTA 3RAMA 4RW6B 4CH0S 5K9FA 1U1QA 4FNIA 4Q45A 4NA2A 4CO3A 1KN6A 2WVFA 2CWKA 4ZOSA 3US5A 3AB4B 1PBUA 3MZIA 4X66J 4Q8FA 2X1FA 3CJKA 3GV5B 3IM9A 5GMKa 4EZ6A 1X5SA 3I5CA 1TUGB 4MJKA 2ZBCA 5CCLA 1B0PA 1CC8A 2OMLA 3IAS9 2AX0A 4LMZA 4BC7A 2LQ8A 4ENOA 1SC4B 2DIUA 4PCQA 2YH1A 2UVWA 4ECQA 5KG2A 2ROPA 1SBRA 2V4JA 4X2BA 4FYDA 3CEDA 2LA4A 1VCTA 4J9PA 2Y1JA 4B9MA 2BW2A 2BANB 2AWZA 2HWHA 4NASA 2IAJB 2I0XA 3MR6A 2EFPA 3V6DA 5ITHA 4LF5J 2KXNB 3LP0A 1TFWA 4IRCA 1DRZA 2A6MA 2DB1A 1UPMB 2M5YA 3KUGA 1M1GA 1IR2A 3MAAA 3RB6A 3KK2B 5KG7A 2MQ8A 2XGPA 2DY1A 3FRYA 5AXMA 1LWFA 2VG7A 1RTJA 2BKOA 3VGSA 4OV1A 1NSQA 4B3TJ 1URNA 4OI6A 1I51B 1VRTA 4NLQA 2DNKA 1Y00A 2XC9A 3GR1A 1O8BA 4KBIA 1IWGA 1RTIA 3MTJA 1UVKA 4DUYF 3HHEA 2PMHA 1IKWB 4MKYA 4Y34A 2HHVA 2OI2A 3S01A 2R7RA 3K0JA 5HATA 4M5LA 3F56A 4ES2A 2FVCA 4UOFA 5L1KA 4BC9A 3KNGA 4LF9J 2DNYA 3CD0A 3M05A 4JI5J 3C46A 5MLCV 1RA7A 1KFDA 4ZITA 2NQPA 2PT0A 2J8AA 2QT7A 3GJQB 4FBTA 1E6YA 6FDRA 3GV8B 3AQOA 2B9EA 3DGPB 4QPTA 3M6WA 1H7WA 1X5TA 4QOTA 1TL3B 1IBKF 1HNXJ 3EGNA 3MEEA 1PC4A 4MIBA 1X4BA 3PW5A 3A3NB 4QR2A 4CO0A 4X4NA 4OI0A 1DFDA 5KFSA 2V4RA 2Z56B 5KFKA 1VIOA 4XO0A 1DY3A 4NCGA 1GMVA 2IJNA 4X64F 2YKAA 3OW2R 2E1PA 2QN6B 4YS2A 5DM6Q 2B5JA 1RT2B 4H4MA 2VB6A 2B4PA 2EFVA 3UVJB 4J9RA 4DQSA 1BHNA 3P5BP 3JSBA 4M5NA 3OTEA 2O3DA 4YP3A 4OYZA 1MU2B 2P9CA 1UJ6A 3QGHA 2VFRA 1OMSA 4B3OB 1VRUA 3W61A 2HW3A 4HYKA 2JDJA 1CULA 1HWIA 1U0HA 2UUCF 5E5NA 3M8PA 3MUTP 2LEAA 5LOQA 2U2FA 3QRQA 4ZVPB 4JI7J 3DM2B 1NHUA 1S0VA 2L41A 4LF2A 4NLSA 1RP5A 1HFEL 2ZH5A 1FNOA 1X5PA 4J9VA 1UVJA 4HT5A 3ZTPA 3RRHA 2F4FA 4TXSA 5KG6A 3PACA 2BVZA 1ZETA 2W9AA 2HVHA 2PI4A 4ILRA 4GVBA 4M5DB 1C0TB 3MAQA 2IBOA 4NEYA 5LXYA 3H98A 5ETSA 5HN0A 1DLOA 4EI2A 2HSEB 2RKIA 2NZ4A 4DV7F 3BO2A 4LSNB 2HVIA 1VBYA 1RTHB 1X31C 1TV6A 2R7SA 3LP2B 1YJ7A 2M52A 2N4DA 3IN5A 5E2QA 5FDLB 3P49B 3LQVA 2GIRA 3IM8A 3MMAA 3OFEA 3LAMA 1PO6A 4DLGA 2YX1A 3PIPQ 1LFWA 2R8JA 2Q43A 2DH7A 2DR8A 4D3HA 3MFHA 3GJRB 1U25A 4N7TA 3PW0A 3NNHA 1U0SA 3CDWA 1OO0B 3VAJA 3KJVB 2WVEA 2JFKA 4OLOA 1KTVA 1GTEA 4DU8A 3FVYA 4IOBA 1SJRA 1F9HA 2ZH6A 2MLXA 4DV1J 3UD4P 3DFEA 4E8UA 2RE1A 4GMKA 1S6PA 4DPTA 1G2EA 3VAIA 3FBBA 4JV0A 5DZ7A 2HNYB 4NYOA 2VPXB 3A8EA 2LVWA 5EX0A 2UUBF 4YDDB 1QDUB 1NKCA 4CLSA 1RACB 2MKJA 4ED0A 5D0HA 4OHXA 3UD3P 1RYRA 1VC5A 1WF2A 4C0OC 4RW8B 5KOWA 1VIXA 3TJ9A 2XLKA 3MR5A 1BMQB 1HL6A 4NLTA 3N4WA 1VRQC 3HZGA 1UJ4A 5DQGA 4F02A 2BM0A 4X4PA 2FC8A 3TANA 4A8KA 2E9TA 3KK3A 1ACMB 3CO9A 4QWEA 3Q2SC 2FQQB 4IQMA 2HPUA 1DZ5A 5IT9Y 5KT3A 5D0EA 1F0XA 5J2QB 2VG6A 4IFYA 5DRKA 2H4YB 1BQNA 3E8OA 2QZ8A 2J7KA 1Q8KA 2IA6A 3W5XA 4DV6F 3GSIA 3CCQS 2FY1A 3SSSA 3SQGA 3R6LB 3PX6A 5B0AA 1UFKA 4DZDA 2JVOA 2QX0A 3ZTRA 2BJ7A 3IG1B 3DLEB 1CJUB 4YHHJ 3IRXB 4PYDA 1HNVB 2CQBA 2GMLA 2CQDA 1HWKA 3R3TA 1U8WA 2Z2ZA 2OEMA 3H2UB 4NXNF 1S1UB 3R7NB 1S1WA 5EGYA 1X4FA 2XMAA 2YKQA 2BR0A 1YHQS 3TWZA 3I0SB 1HQEB 4GO7X 2W24A 4JI0J 3OTOJ 2OPPA 1QAXA 1W25A 4G6VB 2D9PA 1CEZA 1BXNA 3RYLA 3Q22A 3CGIA 4UQGA 3I0RA 5LXRA 2HK2A 4ECUA 2VQEF 3W2WB 2HQ3A 3ET6B 3CCUS 1ZS6A 4DHVA 4XPEA 3DXBA 1W2IA 5A8RA 3JSYA 3MEDA 2AU0A 2DO4A 1RHRB 3M2UB 1N88A 4NLXA 3ZTQA 2YKMB 3PYGA 3LTOA 2R2TA 3JQKA 5A6WA 2D1CA 5L38A 1WD6A 4USWA 3D1OA 1ZZNA 1NPKA 4KKOA 3QGIA 4AL7A 3B78A 5B0CA 5ETRA 1D3WA 3M2VB 1K44A 1ROFA 2HHUA 3CDBA 3TA2A 4DSIA 3CMAS 1UAWA 4GC7A 5IC6B 2XULA 4X4SA 3F41A 2EKYA 5BR8J 4DMZA 4IYQA 3DRSA 3TRGA 3QJPA 1WTBA 1YRUA 4U7UK 4IOCQ 1JJCB 1QVFR 3MEGB 4QU6A 1BLUA 2JOQA 4ECZA 1HR0F 1UA1A 1R6VA 3M7VA 1SJ4P 1IKYA 4NLWA 4GRSA 3ENVA 3I9ZA 1OYEA 1RAGB 5EHHA 5HSPA 4A8OA 1ZBTA 4USKA 2GIFA 1FJCA 4HHUA 1H72C 5E33A 2QMXA 3LP1B 4KIAA 4NEZA 4Q5VA 1RHMB 1RT4B 2RRAA 5CYMB 2X7IA 2LXUA 2BYCA 2IC3A 5GADU 1K73T 4P71A 2DEIA 2KO1A 2CRLA 4MKVA 1Y0HA 3OPKA 1V5VA 2Y1IA 2VQFF 1JJHA 2YWGA 4L74A 3NXZA 1JLQB 1XEZA 2ZD1A 1SJQA 3Q23A 3QIPA 2I5JA 4EBEA 3K17A 1UL3A 3HX9A 1M5HA 1PYTA 4K4VA 3J81j 2ABYA 5DETA 3NKYA 4J9MA 3QZ7A 4QU7A 4XDDA 2XWXA 2Z58B 3PW2A 3PHTA 3NCQA 2LDIA 3NWRA 2FVQA 4I2PB 4WE1B 3G9CA 1NH8A 4KO0A 3N28A 1EZZB 5D3GA 3MPWA 3QO9A 1HPZA 4USJC 2CYYA 1HNWJ 4YMEA 3C14A 2GVDB 4UTGA 4O3OA 3QIDA 2VONA 2C2DA 5IT4A 4RU9A 4UT4A 1PBAA 3DN9A 3MUVP 4ES1A 1S1TA 4A46A 2HHPA 1KVJA 2F3JA 2MQPA 3CIZA 4DR2F 2KHDA 3OVSA 4ILMA 1AROP 2XCPA 3DYAA 3HLUA 5HP1B 1J5OB 5DDQC 5IT0A 2K3KA 1SQGA 5B0FA 4DSFA 1FO1A 4P2MA 4UZCA 4DL5A 1MG7A 4URGA 1NDLA 1WKKA 2E7VA 3JB9k 4UY8T 1YJWS 5A8WB 1T11A 3MCMA 1R43A 3OBIA 1H98A 3W5ZA 1RCOB 5B0GA 5C24A 4PRFA 5L9NA 3SDEA 2ZH3A 5CAAA 1DTQA 3NGDA 4K2JA 3OJSA 4B17A 4DX7A 2Z30B 4PPDA 2RD5C 1S6UA 1BQMA 1WDTA 1HBOA 1H38A 2XZWA 2CZVC 1LW0A 3BKTA 1ZZFA 2OTLS 2OFHX 1FEEA 3BF4A 3R97A 4WP9A 5EN1A 4I64A 3GB0A 2V63A 4JI8F 1T05A 2HQDA 1U24A 2C1EB 2FGOA 3CF5Q 4DUZJ 3ITHB 2YNGA 1EHWA 1HBMB 4RO0A 3CD7A 4EUVA 5D8HB 1RWVB 2GCFA 4IFVB 3C15A 3ZNJ1 2J6TA 2H1YA 4ELVA 3PG9A 2JRSA 5KTQA 3PRVA 1JKHA 2DR5A 3W2VA 4OIXA 4FF4A 4ED2A 3IBCB 3LOUA 2FJXA 2DGWA 4L75A 4PXBA 1XR7A 3HFVA 4B3RJ 3THPA 7FDRA 3BSOA 4F4AA 2FGCA 2B9WA 2IDLA 4HDHA 5ETVA 1MW7A 3SCJE 1I5OB 3D4JA 2OTJS 1QUPA 4LRDA 2VG5A 4CRJA 3IC1A 4EEYA 3P45B 4QYRA 1PKUA 3V4IB 4F4KA 3D66A 5CYQA 3LWMA 4M5HA 1M5VC 3EZOA 3DRPA 3R9LA 3LPYA 2JEFA 2R7UA 3FDSA 1VQNS 4E98A 1NMEB 3AODA 4LUBA 4ZLLA 2V94A 3V81B 2R8HA 2A3JA 3H4DA 1WI8A 2NXEA 1TUWA 2X1GA 3K5NA 3OUYB 4UOGA 3AD7C 2FYXA 4B08A 1NDCA 4ZHRA 2MQLA 3T1YJ 3DDIA 2QA4G 4FS1A 3BGRA 2XYGB 3FGVA 2RS2A 2EBGA 1TVRA 3EDQB 3N5FA
chains in the Genus database with same CATH topology
1SCJB 2Z56B 3A3OB 2ZWOA 4OV6A 2QTWA 4NE9C 1R6VA 3SQOP 2W2QP 3A3NB 4NMXA 2W2PP 3BGOP 3WIUA 3QFHA 2W2OP 4YN3B 2Z57B 3P5BP 3BPSP 2W2NP 3GCXP 2E1PA 3WHIA 2XTJP 3A3PB 4K8RA 3GCWP 3H42A 2Z30B 1V5IB 2Z2ZA 2PMWA 3VV2B 4JP8A 2W2MP 1ITPA 3WIVA 2Z2YB 2Z58B 2ZWPA 3CNQP 3VHQA 3CO0P 1SPBP 3T41A 3AFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCJ B;  2Z56 B;  3A3O B;  2ZWO A;  4OV6 A;  2QTW A;  4NE9 C;  1R6V A;  3SQO P;  2W2Q P;  3A3N B;  4NMX A;  2W2P P;  3BGO P;  3WIU A;  3QFH A;  2W2O P;  4YN3 B;  2Z57 B;  3P5B P;  3BPS P;  2W2N P;  3GCX P;  2E1P A;  3WHI A;  2XTJ P;  3A3P B;  4K8R A;  3GCW P;  3H42 A;  2Z30 B;  1V5I B;  2Z2Z A;  2PMW A;  3VV2 B;  4JP8 A;  2W2M P;  1ITP A;  3WIV A;  2Z2Y B;  2Z58 B;  2ZWP A;  3CNQ P;  3VHQ A;  3CO0 P;  1SPB P;  3T41 A;  3AFG A; 
#chains in the Genus database with same CATH topology
 2CQC A;  3C6U A;  3FCV A;  5AXN A;  1QUV A;  4DL2 A;  4DV4 F;  3IA0 A;  2P8I A;  2ZM6 J;  3VVU A;  1Q1K A;  1VYA A;  2ZBP A;  1O51 A;  1B70 B;  2LU1 A;  3HD1 A;  4RBT A;  2W8K A;  5DGA A;  4ZVR B;  2XMW A;  4LIR A;  2H65 B;  1F5A A;  7FD1 A;  3U7J A;  4PWW A;  3CPW R;  3OXG A;  4PZV A;  2PGC A;  3BBC A;  3D6T B;  3M32 A;  1FX2 A;  4DN0 A;  2FDN A;  2GVZ B;  4DSJ A;  2JNJ A;  1DTT B;  2B8Q A;  2C2N A;  1XIQ A;  4PUO B;  3ZC4 A;  4PAA A;  2DPI A;  3H5X A;  1RZM A;  3AD8 C;  2KHC A;  5KG0 A;  1LFP A;  1NB2 A;  2J9D A;  1EIY B;  2AGP A;  3L3C A;  4YY3 J;  1LEO A;  3D0G E;  1IQZ A;  4TY8 A;  5KFJ A;  3QNW B;  1XBW A;  4X65 F;  3R6G B;  4Z2X A;  1FD8 A;  2I38 A;  5C42 B;  3QGG A;  2CNN B;  1NK6 A;  1FES A;  1TEL A;  2WW8 A;  3FZ2 A;  4RWW A;  4Y0F A;  5LMN J;  1REV A;  1X7V A;  3MM9 A;  2P2C B;  3WZ0 A;  1FKA F;  1Q7L B;  2DHA A;  5KFE A;  4DR1 F;  4I6Y A;  3TA0 A;  5HVH A;  1HNI B;  1GK8 A;  1JLF B;  3KLI B;  5J2N B;  1D9D A;  4R8U B;  1J27 A;  4DOZ A;  1QLN A;  2C3Y A;  4O0I A;  3O8W A;  3RBE A;  2JZ5 A;  4TYB A;  1JLA A;  2CXE A;  2CPZ A;  3CWJ A;  5HVF A;  1S4F A;  3TI0 A;  1TAQ A;  1H74 A;  4CWB A;  1NJW A;  3G87 A;  3A3P B;  1U02 A;  3PM9 A;  4IG3 A;  3TZX A;  2FVP A;  1IN0 A;  2YWH A;  1FXD A;  3OR2 A;  1XQI A;  2I1R A;  2UXD F;  4QIG A;  3D2W A;  3KUH A;  4MK8 A;  1OS5 A;  1FHT A;  1LWC B;  3NAH A;  1N33 J;  1KOO A;  2OPR A;  1KNZ A;  3HVR A;  3N9U C;  3BO4 A;  4C8Z A;  1VDH A;  2CJQ A;  2RS8 A;  2B4V A;  4BWJ A;  2IVY A;  2VC0 A;  3F44 A;  3I5B A;  1RKI A;  2DK2 A;  3MR7 A;  4DR3 F;  1BY9 A;  1QSS A;  1ZAX A;  5B09 A;  1M1H A;  4OZ2 A;  3ZFV A;  3L4B C;  6FD1 A;  4WYW A;  1ZM3 A;  4B3S F;  4OI2 A;  2VJV A;  1NM2 A;  3HI9 A;  5F8M A;  2B7C B;  2F4V F;  2LXI A;  1E6V A;  5JXS A;  2NPF A;  3M1V B;  1MMN A;  4C8Y A;  5J1E B;  3DRR B;  2A0F B;  3AA8 A;  1F2G A;  3CIM A;  4DV3 J;  4Y2M A;  2BQU A;  4ITS A;  3GZ7 A;  4FS2 A;  4DFM A;  4PXC A;  1X9M A;  3C6T A;  1KTQ A;  3WDO A;  1NJZ A;  4N5S A;  2ZBR A;  2CQ3 A;  1V6H A;  2H54 B;  4JV5 J;  3EGZ A;  4KFB B;  1Q81 T;  2XB2 D;  4H54 A;  3U27 A;  4ERD A;  4PXE A;  1FWP A;  3C16 A;  3FSI A;  4W98 A;  3HK2 A;  1PSD A;  4FYV B;  1RUS A;  5T14 A;  1A7G E;  1HBU A;  2M8H A;  4DQQ A;  4FDF A;  1BQX A;  2KFY A;  1VQ6 S;  3C66 A;  1WHY A;  4GVL A;  3O3L A;  1S48 A;  5D4O A;  1V9O A;  1Q0N A;  3AD9 C;  2P9G A;  4DL4 A;  4DR6 F;  2YKN A;  1MML A;  1S6Q A;  2V8H A;  1MSW D;  4PG6 A;  3T9Z A;  2PA3 A;  4L6V 3;  3BH7 B;  3TX0 A;  5C2G A;  3KHH A;  5IV4 A;  2LMI A;  3MTK A;  4UQT A;  4L76 A;  1LKZ A;  1MMD A;  2QL9 B;  2HVD A;  2AHO B;  4OFZ A;  3MGJ A;  2HYI B;  3PFE A;  4UST A;  1XMO J;  5KT5 A;  1EKS A;  2JVR A;  1FFS B;  5DG9 A;  4KJI A;  5I42 A;  2RRB A;  3CDU A;  2HLU A;  1KP6 A;  4NRT A;  4PWD A;  4CH7 A;  3CE8 A;  3C3L A;  3UN2 A;  1S12 A;  4ZN1 A;  2RQM A;  1KLN A;  1EX8 A;  5L39 A;  1TK0 A;  3KHG A;  3WX8 A;  3GMG A;  3V6J A;  4W4M A;  3CMQ A;  5K8O A;  1WOP A;  2JHE A;  5HQL A;  3E2E A;  1SQE A;  4ICL B;  4GKJ J;  3OLB A;  2KVQ E;  1JB0 C;  2W01 A;  1DUR A;  1KQS R;  1P9Q C;  5KFM A;  1S72 S;  2F7V A;  4A8X A;  3T41 A;  1YJT A;  2ATL A;  1NXI A;  2FZK B;  4TNO A;  1DBD A;  1TKZ A;  3AA9 A;  1VLY A;  4USM A;  1FJ7 A;  1AFJ A;  1VBX A;  3MM8 A;  3OJU A;  2MLZ A;  3EZ5 A;  5MAO A;  2GHP A;  1XWL A;  1CJK A;  5L46 A;  2ZE2 A;  1L3T A;  1DAR A;  2MKI A;  1TL4 A;  3FFI B;  1GXT A;  1QE1 B;  2CDQ A;  3BO3 A;  1YZ6 A;  3KOA A;  4ELT A;  2V2Z A;  4NLD A;  3UN3 A;  3HVT A;  2YNH A;  2DIT A;  2V34 A;  2UV8 G;  4LRC A;  4J37 A;  1XN9 A;  5I3U A;  2M88 A;  1SKW A;  1R0A A;  3CC2 S;  2B6A A;  1P9Y A;  3VTI A;  4QYZ J;  4LFA F;  3KLE B;  5F3Z A;  2QO3 A;  3ZTS A;  3CJ0 A;  4I2Q B;  5CXT A;  1JXE A;  1LXJ A;  3TAP A;  2LEP A;  2P6T A;  5KFQ A;  3H90 A;  3NL0 A;  3RGI A;  3O6Q A;  2VC1 A;  2XCA A;  3AJD A;  1VFJ A;  4F50 A;  3TO8 A;  2DH9 A;  1M5K C;  2J9C A;  4BBY A;  5LSL A;  4CQ1 A;  3CCR S;  2QC3 A;  2W1B A;  3NLC A;  3K7R A;  5E3Q A;  3MAH A;  1V5I B;  3Q86 A;  2B4U A;  3PYD A;  5RUB A;  2HRY A;  3GIR A;  1B0V A;  3OLA A;  4RW4 B;  1W7W A;  4RLE A;  2KI2 A;  2EBE A;  4DSL A;  2C2O B;  5T7L A;  1RWP B;  4KQZ A;  1RTD B;  2W7P A;  1RHJ B;  2BE2 A;  3R7B B;  4N56 A;  4ID8 A;  3W5Y A;  5C25 B;  4DQI A;  3IFE A;  1JIH A;  2NYI A;  4DV0 F;  3DLK A;  4I7F A;  2NXJ A;  5KFI A;  5HVG A;  4WII A;  3UCG A;  2VHG A;  3AOC A;  3F73 A;  1N48 A;  1HHQ A;  4LRB A;  3EUN A;  1J5E F;  4BLG A;  4X62 F;  2HHH J;  1PYO B;  1TU0 B;  1HHT P;  1VQP S;  1AW0 A;  2RJZ A;  1WJ9 A;  2BJD A;  5H9E J;  2XI2 A;  2XHC A;  3SCK E;  2MZT A;  4KT0 C;  1S1X A;  3TQ1 A;  3PYE A;  4NLP A;  4KHM A;  2QA4 S;  1S9E B;  2AP6 A;  3DOM A;  4HI2 A;  4NL5 A;  2EC2 A;  3Q8Y A;  5AJ3 F;  2VDI A;  2GFF A;  3QT8 A;  5GAE I;  1RT5 B;  1VQM S;  4ZKA A;  4DPY A;  4OX6 A;  1WKJ A;  1X4C A;  4LBP A;  4QCL A;  3TAR A;  2ZZN A;  2OKQ A;  1Y4Z B;  5DGB A;  4K4Y A;  4OZ3 A;  4OX7 A;  3MUM P;  4DX6 A;  3ILL A;  3DLL Q;  1O0P A;  1YKW A;  2IFX A;  2QSF A;  4K4S A;  4PYA A;  3M8Q B;  1TK8 A;  5AE3 A;  1FVS A;  1VOM A;  2QV6 A;  3MM6 A;  5K20 B;  3PIO Q;  1D9A A;  3L7O A;  2RAQ A;  2ILZ A;  4USV A;  2H51 B;  3LA0 A;  5G0R B;  5GAH U;  2ROG A;  4WXW A;  2IM1 A;  4FPR A;  1D8Y A;  2W2Q P;  4P72 A;  3PX4 A;  3JTO A;  2XYH B;  4P52 A;  2CQI A;  4C6A A;  4JP8 A;  5BYQ A;  2WVB A;  3OD2 A;  2QEX S;  2G0J A;  1H2U X;  4O3P A;  5KT2 A;  3CJ4 A;  1RBA A;  1FJG F;  2HHS A;  2NRE A;  2KDO A;  2MB0 B;  3HT0 A;  4DG1 B;  4PAB A;  2YH0 A;  3LF0 A;  4HT7 A;  2XS2 A;  2MPU A;  4AL6 A;  2R7X A;  3VWS A;  3ZZP A;  2OPS A;  5DDO C;  2IIH A;  3DMJ A;  2V2Q A;  5F8J A;  1EQM A;  1XK8 A;  4O44 B;  1DHM A;  2AZ1 A;  2B8P A;  2AX1 A;  4AYB D;  2KRB A;  2E9R X;  2KG1 A;  3UR3 C;  2B9X A;  2FLL A;  4TU9 A;  4M1K A;  3V6H A;  1IKX B;  1EP4 B;  1U09 A;  3T6B A;  2QFJ A;  2W7A A;  4FF3 A;  1VHI A;  1HQU A;  4DV7 J;  2BOA A;  2L3M A;  2OUG A;  4ECY A;  4RW7 B;  1URR A;  4DU7 A;  1FK9 A;  2LQ9 A;  4Y3C A;  2DNZ A;  5DQH A;  3DOL B;  1RTZ A;  1WF1 A;  3BH6 B;  2XSJ B;  2FVS A;  3BYP A;  3BGO P;  3CDA A;  1WC6 A;  3MFI A;  1FFW B;  4ZJQ A;  2I6W A;  3PO5 A;  1SKS A;  2MKK A;  4ANC A;  3D7S B;  1S77 D;  3E01 A;  1ZM2 A;  1BGX T;  3KLG B;  5LSO A;  2EFQ A;  5K14 B;  4RUC A;  1WKL A;  2OP5 A;  3ZZY A;  5H9F K;  4FYW B;  1AA1 B;  1NK5 A;  3U1N A;  1CBK A;  1X8D A;  2A2C A;  4IRD A;  4RPF A;  1IKV B;  3FK4 A;  1T03 B;  3A8J A;  1VI7 A;  2CWX A;  2BX6 A;  2VJU A;  2GJ2 A;  1PG5 B;  2B7B B;  3D3C J;  4MYT A;  3AAW B;  1VQS A;  4HAC B;  3BN7 A;  1FXR A;  1RAO A;  1X4A A;  4W92 B;  3R2C J;  3A8K A;  3KDN A;  2UUB J;  2ZH7 A;  1F60 B;  1KSP A;  2MLY A;  4KRW A;  3POT A;  2DY9 A;  1U6Z A;  3R5B A;  3UI3 A;  4LRA A;  2EI5 A;  4ZK7 M;  1Q8I A;  3MUR P;  2ZC4 A;  2UV8 A;  4ZIW A;  2M2B A;  1X9S A;  4U67 Q;  5KFG A;  3AXK A;  3EMT A;  2KU7 A;  5EWE A;  2HVZ A;  4NZ7 A;  1XNQ F;  2C22 A;  4ANE A;  4CLT A;  1SQF A;  2LDY A;  2CQ0 A;  2ZBI A;  3DLH A;  1S79 A;  1Y7P A;  3DU5 A;  1SV5 A;  2BAB A;  1F3F A;  3HF5 A;  2J0Q D;  2DHG A;  1LWE A;  2HS0 A;  1FA0 A;  2Q3P A;  3EVO A;  4JV2 A;  4O3R A;  4XDC A;  1NK8 A;  1Q5V A;  2J76 E;  2DRB A;  1LXN A;  2ZKT A;  1BD6 A;  2GQ2 A;  3NMA A;  2AEF A;  2E5L F;  1UPP A;  4C11 B;  3R5G A;  5JUM A;  2BRK A;  1L5U A;  2GHW A;  2W2N P;  1NLK L;  3RG6 A;  2UZA A;  4EBD A;  1XMQ F;  1C0U B;  4RUH A;  1RHU B;  2FLP A;  1Z2L A;  1OQ3 A;  2ZH8 A;  2MZR A;  1HW8 A;  4B9N A;  4QW9 A;  2WHO A;  2VBW A;  3HHL A;  4C7Q A;  4C2M A;  4O3S A;  4R0E A;  1Y9O A;  1YSJ A;  4HI1 A;  4I0W A;  3ILI A;  1VQK S;  1RT6 B;  3I4H X;  3FNN A;  4ZPA A;  1XJW B;  3Q8Q B;  4L73 A;  3T5K A;  3TZY A;  3QPI A;  4ED5 A;  3J80 U;  4WBF A;  4Z7C A;  4K5R A;  4LVO P;  2F5G A;  3PX0 A;  2JWN A;  1YGY A;  3KHR A;  4X66 F;  4OI4 A;  2FC9 A;  4LBH A;  1M1K T;  3A12 A;  1IM4 A;  1TQL A;  3UN5 A;  2VQE J;  2QL5 B;  1SIW B;  1D0E A;  1HLW A;  1ZTW A;  4DX8 H;  2LQJ A;  2L48 A;  2QMU B;  1N5S A;  4IR1 A;  5CHC B;  3R1H A;  1RXO B;  1CJV A;  5HL7 Q;  4KHP F;  1CJT B;  2E1R A;  4Q0B A;  4TYA A;  3NNC A;  3PKM A;  4BS2 A;  3R7S B;  3PR5 B;  3DKD A;  2IVF B;  2W2P P;  1N6Q A;  2QLX A;  2WOM A;  1VJQ A;  4TU8 A;  5L1I A;  2XMV A;  4K50 A;  4R5P A;  4IG0 A;  4LF6 F;  9RUB A;  1K1S A;  3D28 A;  3QJJ A;  2UUT A;  3PEH A;  3MMB A;  4NA1 A;  5A6P A;  1QVG R;  4H4K C;  3GIK A;  4WF9 Q;  2JH3 A;  2HNZ A;  2CQ2 A;  1YDL A;  5L8R C;  3I32 A;  4KTQ A;  1SI9 A;  4WFY A;  2RF2 A;  5HRO B;  4AXI A;  4B3T F;  2NSC A;  2YQ3 A;  5DG7 A;  5F0U A;  2B3T B;  3RB0 A;  1NKB A;  2OPQ B;  3T5H A;  1RT7 A;  1X0P A;  1S4E A;  5D4P A;  1JJ4 A;  4JB8 B;  4P73 A;  3W9H A;  2VAS A;  3IGN A;  3KDO A;  4NOH A;  4MFB B;  5HBM B;  4F4X A;  5D78 A;  2HMI A;  3CJ8 A;  1TKX B;  4UZB A;  3N6N A;  3EE3 A;  2EW9 A;  2MHE A;  5AXL A;  4OZJ A;  3SV4 A;  2FUG 9;  2DNH A;  1T0T V;  4AD6 A;  1QD1 A;  2Z4P A;  2XMM A;  4DL7 A;  3I4P A;  1CG2 A;  1AZS A;  1YJV A;  4OX8 A;  4JI5 F;  5HQ8 A;  2R8G A;  1HMV A;  5LJ3 Y;  4KHR A;  2VQF J;  3QLH A;  3TAM B;  4K4X A;  3SSR A;  3FBC A;  4CLZ A;  2ZJR Q;  2MYF A;  1HNX F;  4WK3 A;  1OPZ A;  2PI5 A;  3T5J A;  2CG8 A;  3TJ8 A;  1JLC A;  3P96 A;  3K8V A;  1JXL A;  1L3S A;  2UUA J;  1EJ7 L;  2BA9 A;  2PEB A;  4P75 A;  3UCU P;  3LH2 S;  2XMT A;  4HVZ A;  3OSP A;  1UWB A;  3QBC A;  1NRK A;  2Y0B B;  3AY0 A;  2GGP A;  3U1M A;  1N5V A;  2XI3 A;  1WEX A;  3NY0 A;  3J7A N;  3RU0 A;  2DGX A;  1GFW B;  3BSC A;  4CZC A;  2IM3 A;  5HMY A;  5E3C A;  1RSC A;  1P1T A;  5KFT A;  3DOK A;  4C3L A;  1VK3 A;  1S76 D;  2DNL A;  3Q0A A;  4XPC A;  2LA6 A;  1YI2 S;  2CPE A;  3MWB A;  4KH0 B;  5ETL A;  1T9W A;  5E3P A;  1YTY A;  2PII A;  3CCM S;  1B7Y B;  4WXO A;  2ERR A;  1TFY A;  2BEF A;  2RSQ A;  3IR7 B;  2QJ3 A;  3TA1 A;  2P9E A;  3HVW A;  4KYZ A;  4L3N A;  1S49 A;  4JI7 F;  1MWZ A;  1FEH A;  5IT9 U;  2AJ2 A;  5HLF B;  2A2D A;  2FZG B;  4ZCK A;  2KL8 A;  3JSR A;  5KFF A;  4DUT A;  2YNI B;  1EAR A;  2LXF A;  3VF0 B;  4YB7 A;  3KUE A;  1RAD B;  2QFI A;  2QMW A;  3VAH A;  5BXI A;  4N77 A;  3HJF A;  2EFN A;  4RJV A;  2PD1 A;  1KQG B;  3G86 A;  4H4O B;  2MQQ A;  2E1M C;  5F0W A;  2J6U A;  4P7V A;  3CXC R;  4DLE A;  3EXC X;  2AYB A;  2WON A;  1IBC B;  4WU3 A;  2YVS A;  4BWM A;  4RUA A;  5H1S V;  2DXF A;  2EG2 A;  3K5O A;  1VGY A;  4QIW D;  2J0X A;  1R6Y A;  4KGK A;  1P27 B;  4B9V A;  4DI6 A;  4DXL A;  3GU0 A;  4OHY A;  2K1R B;  3KFW X;  3CCL S;  5KG1 A;  5DDR C;  2RDJ A;  2QYC A;  1K1Q A;  1UKU A;  4QWD A;  4WFX A;  3KJN B;  5JVH Q;  4NX9 A;  3ENA A;  3K5P A;  4ID5 A;  4J9N A;  2G1H A;  4A8M P;  4LSL A;  2KT3 A;  4UY8 5;  5I3Q A;  3OR1 B;  3FMW A;  3LGM A;  3R5A A;  4J90 A;  2FJV A;  4K4T A;  3JSM A;  2YQ1 A;  1OY9 A;  3W7B A;  5IM0 A;  5M2R A;  2J0S D;  2WSE C;  5C7P A;  4CLF A;  2OEJ A;  1BWV A;  5F9N A;  4IQX A;  1S99 A;  3K89 A;  3IR6 B;  1Y5L B;  3KKF A;  5J1N A;  4DV1 F;  2L08 A;  5KFR A;  5ETT A;  1U1K A;  2VF3 A;  1QAJ A;  5DG8 A;  4KE5 A;  4NXM J;  1H2V Z;  1RWX B;  3C8Y A;  1C1B A;  1SH2 A;  3R1L A;  4HL9 A;  4J9K A;  1R0C B;  4CTA A;  3MM5 B;  4NYP A;  5A2Q Y;  4ZCM A;  3ZO7 A;  4ECW A;  4GKK J;  2V2K A;  2PSZ A;  1ULR A;  1B4S A;  4DV4 J;  1RAJ A;  4CYU A;  3UWT A;  2XNQ A;  3EGW B;  2DGS A;  1SL2 A;  1SKR A;  1U2R A;  4WZQ A;  5B08 A;  1AYE A;  1S1V B;  4OYX A;  4RW9 A;  5DLG A;  3WIV A;  5KG4 A;  3HSD A;  2HQC A;  1DAX A;  3KLH B;  2VBX A;  3JQM A;  3HD2 A;  5ETK A;  4LF7 J;  3H0P A;  3KJF B;  1M5S A;  4P2F A;  2MY8 A;  2FTR A;  4M94 A;  5ADZ A;  2DNM A;  1H73 A;  3SFU A;  2W9C B;  5CZX A;  4NLG A;  3DXS X;  2DTJ A;  3BGL A;  3MR3 A;  3MDF A;  2KJV A;  2DNO A;  4NZ6 A;  4JI4 F;  3DLG A;  3HXM A;  5IS2 A;  1Q7Y T;  4FPI A;  3KLF A;  2IYG A;  3QWP A;  3ELH A;  2D74 B;  3CNQ P;  2MHN A;  2CUY A;  1KR4 A;  1EET A;  4FYY B;  1JLG B;  1WEY A;  1F2H A;  4TY9 A;  1TL7 B;  5FD1 A;  4X65 J;  4KV8 B;  4OLP A;  3PR4 A;  2IM0 A;  2P6S A;  1JX4 A;  1UFL A;  1UTA A;  3SXL A;  3UDC A;  2WW4 A;  2BE9 B;  2CPX A;  4FZV A;  1HD0 A;  1Q95 G;  2XG8 A;  2HIY A;  2LQ5 A;  4YHH F;  4DR1 J;  1LV5 A;  2EXU A;  2KTQ A;  2MKC A;  4MK9 A;  1S7I A;  1U1P A;  3LW5 C;  3L7U A;  4OHV A;  4ZPB A;  3IBF B;  3MEC A;  4NI2 B;  2WTF A;  3DLJ A;  3KK1 A;  4RW6 A;  2CQG A;  3S6E A;  2MEW A;  4B9L A;  2HEK A;  2H9Z A;  1CQM A;  2NLW A;  3H2L A;  3ILO A;  3CO0 P;  5CQG A;  3NOC A;  3CJ3 A;  2HKE A;  2KVI A;  2LCW A;  2KRR A;  4CIO A;  1D9F A;  2HWI A;  2UXD J;  1WG5 A;  1Q78 A;  3G8Q A;  3ZXW A;  2J7U A;  1SKU B;  3L95 X;  5EWG A;  2VA3 A;  2MZ1 A;  1YIT S;  3FEY B;  1KHV A;  4CI0 B;  5BYR A;  2A1B A;  3M2R B;  4QR0 A;  3BEG B;  1RWO B;  5KFC A;  1N36 F;  4YOE A;  1HBN B;  4DR3 J;  1HD1 A;  4HHJ A;  2BAN A;  2ZZT A;  2AD9 A;  1N52 B;  2IAJ A;  2U1A A;  3J7Y U;  1RAB B;  2UVV A;  5KT7 A;  4B3S J;  8AT1 B;  3KG1 A;  3W8P A;  2F4V J;  2EFO A;  3FEX B;  3PRD A;  2VFV A;  3E3X A;  4I1T A;  2CNO B;  1JWW A;  1LW2 B;  3KK2 A;  1FJE B;  1HKA A;  4DQR A;  2KH9 A;  3J80 Y;  5KFW A;  2FJA B;  1VIS A;  4PR6 A;  2D7S A;  2GQQ A;  3HHK A;  2HRU A;  4ECX A;  2RHS B;  3HSG A;  3B54 A;  1VQL S;  1X4G A;  3GYG A;  4A8F A;  3DDN A;  4C97 A;  3BSN A;  2QRR A;  2DGU A;  4TVA B;  2W7O A;  3FKB A;  2B4O A;  1UW9 A;  3TW0 A;  1PCA A;  1SVD A;  4F26 A;  2XYP B;  4DCO B;  4LF4 F;  2YTC A;  3FBF A;  4Y28 C;  4KGX B;  3HZE A;  1IKW A;  2JC1 A;  1CS4 B;  3CDE A;  3BDP A;  1FER A;  2DIV A;  3A13 A;  1FRM A;  2WB1 D;  4A48 A;  2YNF B;  2V4Q A;  3L7P A;  2YX4 A;  5F8H A;  2M3D A;  4KGV B;  4Y2A A;  2POK A;  2MZJ A;  1IM6 A;  2C2M B;  3VR1 A;  1DJ0 A;  4DR6 J;  3HHD A;  3M30 B;  3TUI C;  2DNR A;  5KFA A;  2E5H A;  2AYE A;  1FI4 A;  1WHX A;  4F0H A;  1I94 F;  3DGP A;  2QLB B;  3L9Z A;  3QSI A;  1JXV A;  3ICL A;  2V8V A;  3D0H E;  3KMQ A;  1TL3 A;  2WSF C;  2FHJ A;  2MGZ B;  1EQ0 A;  1H7X A;  2AQ4 A;  1WI6 A;  1SJF A;  5ETQ A;  4DN9 A;  4OYO A;  2QTW A;  7AT1 B;  3NAI A;  3ZZR A;  2WVD A;  4ZVO B;  3G6X A;  1T3N A;  4QIE A;  4WJB A;  2OH2 A;  2CPJ A;  4JI2 F;  3HSJ A;  1CLF A;  1SL1 A;  1T9T A;  2H5E A;  3H25 A;  3GG0 A;  3K59 A;  3I82 A;  2V2V A;  1U8S A;  2CQP A;  2I9S A;  2DXD A;  3MM7 B;  2HRT A;  2BBE A;  1RT2 A;  3OFH A;  1LNQ A;  1YIJ S;  2CAJ A;  3FQK A;  1M5O C;  3UVJ A;  4IH7 A;  4OYM A;  2EVZ A;  1TL1 B;  4I67 A;  3N6M A;  1WUU A;  1RAA B;  3P8B B;  4K0K J;  1YG0 A;  3G2X A;  1SUQ B;  3SZ2 A;  3QSY B;  1VBZ A;  4BCA A;  1KOH A;  1MU2 A;  2HFZ A;  4KY3 A;  4U6P A;  4B3O A;  4ZVH A;  5GAD I;  2IPO B;  4ZN3 A;  3NMR A;  3NGR A;  5LMU F;  1QAI A;  3FCW A;  5F8G A;  3Q8S B;  1QJH A;  2QA1 A;  5AE1 A;  3DM2 A;  2D41 A;  3ULH A;  2XBP A;  3OVA A;  1X9W A;  2HZA A;  1GX6 A;  1U1L A;  4LFC J;  2W8L A;  1K9M T;  2G4B A;  2DHH A;  3QJL A;  5IOL A;  2KM8 B;  5D0G A;  3RRG A;  4M5D A;  1C0T A;  1GMU A;  3T1H F;  5AXK A;  1HI1 A;  1G1X A;  2O1P A;  1UET A;  1VJW A;  3MCN A;  4LSN A;  4CO1 A;  4LFA J;  4WZM A;  1RTH A;  1Q86 T;  3LP2 A;  3WBZ A;  4DF8 A;  3DRY A;  2MMY A;  4ZIV A;  4JI3 F;  2JJ4 D;  3V2U C;  1MRO B;  5FDL A;  1UVI A;  2LFV A;  4WK1 A;  1HAR A;  2OSQ A;  3QZ8 A;  4YB1 P;  3MMC B;  1OPI A;  2XNR A;  1MN7 A;  2D3U A;  1NDP A;  5I4M A;  1N56 A;  1UZH A;  1RU2 A;  2XO7 A;  2YKP A;  4DUZ F;  1FF2 A;  2R8I A;  3RZA A;  5DQI A;  2F1F A;  3OHB A;  1J2V A;  3AJ2 A;  1V3S A;  2X3D A;  5KG3 A;  2VFU A;  1WF0 A;  4LSZ B;  3M6V A;  1RWW B;  5F8L A;  4J5O A;  4NA3 A;  2R3V A;  4TQR A;  2V8G A;  3B8H A;  4IH5 A;  3K57 A;  2MZS A;  5ETN A;  4MK7 A;  4CO5 A;  4B3R F;  3KJV A;  4RNO A;  2K06 A;  2GO8 A;  2MSS A;  4DPU A;  1VQ5 S;  5KG5 A;  4ED7 A;  2DT9 A;  4NRU A;  1S0N A;  4B9U A;  1NJY A;  4WU2 A;  2MJN A;  1Q16 B;  4DV0 J;  3G96 A;  3NS6 A;  3PEJ A;  1NK7 A;  2CFX A;  2HNY A;  3TUZ C;  5KFH A;  3HPO A;  5D77 A;  1Q82 T;  4I56 A;  5A8K B;  2FIU A;  4Z7Y A;  3UR0 A;  3Q8V A;  2MTL A;  5FII A;  3GON A;  3T1Y F;  4X62 J;  3MI7 X;  4X4T A;  3I56 S;  3RB4 A;  1R8C A;  4DX5 A;  4RW8 A;  1SC3 B;  3G82 B;  2RIL A;  2BOP A;  3LWL A;  1SC6 A;  5HK4 A;  2DCL A;  5L9X A;  4ECV A;  4Q44 A;  2GW8 A;  2R7O A;  3NGK A;  2KG0 A;  1X5O A;  3BM7 A;  2R7Q A;  4DFP A;  2ZM6 F;  2VOD A;  3BR9 A;  2EG1 A;  4OZL A;  3CC7 S;  5D15 A;  5IZH A;  4KC5 A;  5AJ3 J;  2AKW B;  3IS9 B;  2QLJ B;  3UNY A;  2VA2 A;  1JLB B;  1N5Y B;  3DHX A;  1C1C B;  2K2P A;  3M8Y A;  4ZP9 A;  4Q2L A;  2RUG A;  6AT1 B;  4USI A;  5KFN A;  5J2Q A;  3VHQ A;  3RBD A;  4OJ1 A;  1X4E A;  4MIW A;  2MDA A;  2V68 A;  4LBI A;  3HFK A;  3PW4 A;  4O23 A;  2OAU A;  4DV5 J;  5HMZ A;  3BS9 A;  2ZH2 A;  4ZPC A;  4DR5 F;  1N32 F;  1NO8 A;  2ACY A;  4OQJ A;  4NCB A;  4E2F B;  2WBM A;  2HZC A;  3UDV A;  2JLE A;  2OIH A;  4FBU A;  5LSR A;  2V9K A;  3T5L A;  1X60 A;  2RU9 A;  3IG1 A;  3DLE A;  3GFX A;  1CVJ A;  1CJU A;  3IRX A;  2DH8 A;  1RYS A;  4IR9 A;  3CW2 C;  3ADA C;  3AOB A;  3OTB A;  1HNV A;  4IKA A;  2BE7 D;  2HBY B;  3OV7 A;  3FZB A;  3OXF A;  2B9Y A;  2VU5 A;  4JUZ A;  1S1U A;  4CDI A;  4OJ3 A;  3FQL A;  2YWF A;  4LR9 A;  4A8Y A;  2DNP A;  1F5C A;  1S9G B;  5HMW A;  1LK5 A;  2VKZ G;  2IMW P;  3NBP B;  4RUB A;  3I0S A;  1HQE A;  1T9U A;  3UQS A;  3NG8 A;  4F04 B;  3CCJ S;  2AEJ A;  3G71 S;  1V3Z A;  4IDK B;  4G1Q B;  5B0E A;  4RNM A;  4ED6 A;  1KLM B;  5D4L A;  3NCR A;  1XTZ A;  1YX2 A;  2VD3 A;  4P7T A;  4LIW A;  3W2W A;  1RIS A;  3BBF A;  3ET6 A;  3TEG A;  4UOH A;  1NND A;  2KJW A;  2PFF B;  4OX9 J;  1IJE B;  2MKH A;  1I1G A;  3H8Y A;  2B51 A;  3NP5 A;  3R5C A;  2ZJQ Q;  4OYP A;  3JAM Y;  2XEX A;  4U9R A;  1CSJ A;  3BDE A;  3M2U A;  4DV2 J;  4TQS A;  3BPS P;  2DGO A;  3W9I A;  2YKM A;  3VZH A;  2Y0S D;  1FKP B;  1GAO A;  1P6T A;  4LFB F;  1GXU A;  5KFL A;  2ZUA A;  3DI6 B;  3VCD A;  3CD5 A;  1NU4 A;  2COL A;  1F5B A;  1S6O A;  4JV1 A;  3H20 A;  5SZT A;  2VFS A;  2J9E A;  5A0Y B;  1HHS A;  3R5J B;  2XMK A;  1PJ7 A;  3M2V A;  1M5P C;  3IP0 A;  1VBK A;  1RWN B;  2QLF B;  1UVL A;  2XLI A;  2IRX A;  2OFG X;  4ELU A;  2DHX A;  4WYL A;  2R9L A;  2CA9 A;  3W62 A;  3GCX P;  1RWK B;  2UVR A;  5CD4 A;  2D3O R;  3ENW A;  2HND B;  5E0O A;  5THW A;  5E3R A;  2AYM A;  3D1H A;  2IY5 B;  3GTY X;  1RT1 B;  3MEG A;  2VFT A;  3W63 A;  3BB5 A;  3EX7 B;  3BKF A;  2KN4 A;  4JV5 F;  4O4G B;  1W26 A;  1LK7 A;  2PDA A;  4ECR A;  4QWC A;  4WKY A;  4PQU B;  4FKX A;  1WSV A;  4JYA F;  4ZVQ B;  1TKT B;  4WP8 A;  1HYS B;  5J2M B;  3AT1 B;  2NYH A;  2MKY A;  3LP1 A;  1FRL A;  3JYT B;  1UW4 A;  4OYW A;  1OYD A;  2KYZ A;  3MCO A;  1JLE B;  1RT4 A;  4F3M A;  5CYM A;  1HWU A;  2CQH A;  2W9B B;  5KFO A;  4I69 A;  2J9D E;  3W9J A;  1FKO B;  4ZVE A;  4YB6 A;  3D6M B;  1Q53 A;  1JLQ A;  4N76 A;  3B82 A;  3FUY A;  3D6F B;  1T9X A;  2IRY A;  2VIH A;  2NCK L;  1FRH A;  2HZV A;  1S0O A;  3CJK B;  1RT3 A;  5DM7 Q;  3PV8 A;  1PJ6 A;  2CPY A;  2M9K A;  2HQF A;  4CLY A;  1ZPW X;  2CJK A;  4I2P A;  4YR2 A;  1FVQ A;  4ZS6 A;  3EDR B;  4WE1 A;  1NSP A;  2E5L J;  2KZM A;  3GYX B;  2V4J B;  3BRE A;  3T3F A;  2DO0 A;  2GVD A;  2H48 B;  3PYF A;  1XMQ J;  1VK8 A;  3MHY A;  2NR0 A;  2AF6 A;  1R31 A;  4ZPV R;  3UNG C;  3V6D B;  3BQ2 A;  4WFN Q;  4DFJ A;  3BQ1 A;  2FLN A;  3LP0 B;  1R27 B;  4GKJ F;  1HW9 A;  2OD6 A;  3QRP A;  2IRU A;  4NPO A;  4DR4 J;  3FMB A;  3MAA B;  3NGS A;  1HNZ F;  5HP1 A;  1J5O A;  4P2X A;  2V9W A;  1UJ5 A;  4MKA A;  2F9J A;  2N4C A;  1LWF B;  3R5D A;  2VG7 B;  1N34 F;  4MT1 A;  1RTJ B;  2GO9 A;  2ZKU A;  3BPD A;  3GSD A;  4LR8 A;  4KGZ B;  5KT6 A;  1TKD A;  2V8D A;  1VRT B;  5A8W A;  4RKU C;  1ZA1 B;  2RU3 A;  2RDI A;  2Z2L A;  2GAG C;  3H5Y A;  4LJM A;  1RTI B;  4EYH B;  3Q83 A;  1RBL A;  1WC4 A;  4ZLN A;  1FE0 A;  3KNA A;  3SCL E;  2XHW A;  1RDR A;  4JI1 F;  4RR5 A;  3TZZ A;  1VS3 A;  3U02 A;  5C2C A;  4QBU A;  4MTP A;  2ZBQ A;  2BXJ A;  3NS7 B;  4KHP J;  1AB8 A;  1OJ4 A;  3DHW C;  2N7C A;  2DXE A;  1Z4U A;  1NDK A;  2EKN A;  1U2F A;  3SYZ A;  1TMM A;  3A4T A;  4B9T A;  3ITH A;  2XY6 A;  1HBM A;  3J7Z 5;  4NLR A;  1VQ7 S;  3NOG A;  2R2S A;  1E6Y B;  2FHM A;  1L3K A;  4LF6 J;  2Z2Y B;  4RL1 A;  1T95 A;  4OMF G;  4IFV A;  1IBM F;  2RHQ B;  3UW1 A;  1RBO B;  2HFN A;  1SH3 A;  2QA2 A;  5DS7 A;  1WHV A;  1R8P A;  3MEE B;  2KXF A;  5KFX A;  1RAE B;  4AE5 A;  1XMB A;  2BV3 A;  3IWX A;  1L3V A;  2HHX A;  1M0S A;  2PN6 A;  1YJ9 S;  4JOU A;  2ZFH A;  4KH1 B;  1KBR A;  3LGH A;  4NCG B;  4F8R A;  1RE1 B;  3V4I A;  4K2X A;  2PO4 A;  4AXJ A;  3NNA A;  1NPP A;  4AQY F;  2B5J B;  3CCZ A;  4H4M B;  2WSC C;  3FSY A;  1GH8 A;  2DCU B;  2K3I A;  3V81 A;  4ES3 A;  2KFN A;  2C2E A;  3OUY A;  4DR7 J;  3ISN D;  1IXK A;  4K4W A;  3U1L A;  2LEB A;  2RIJ A;  3BZQ A;  1UFW A;  1VRU B;  3W60 A;  1FE4 A;  2HHH F;  2AJ1 A;  2GS8 A;  5HJY A;  1QTN B;  1VQ8 S;  3KHL A;  4OZ5 A;  1CUL B;  2B43 A;  1U0H B;  1VQO S;  3M8P B;  2NS1 B;  4X4V A;  4OJH A;  2DR7 A;  2YX7 A;  1RLD A;  2HS4 A;  2GX8 A;  4LF8 J;  2ATC B;  2IYI A;  4KPC A;  4YFU A;  1KS2 A;  3H5S A;  3ISZ A;  2J6S A;  1Y3J A;  1X4D A;  3CCT A;  1ZAV A;  2GVZ A;  1DTT A;  3IGV A;  4OZN A;  4GVB B;  3ENQ A;  3OT9 A;  4PUO A;  3GPA A;  4G3I A;  2DHS A;  4U96 A;  1DLO B;  2ZZM A;  3HSZ A;  2RKI B;  2GNK A;  1FX4 A;  1T02 A;  4Q7A A;  2RQK A;  3UE2 A;  1TV6 B;  2BKP A;  2HQG A;  4WIQ A;  1KFS A;  2ZNZ A;  5C42 A;  2WK4 A;  3VAK A;  3RRK A;  3MOZ A;  3QQC D;  3RAX A;  3MMA B;  4DQP A;  1F1B B;  2HS3 A;  1YVF A;  4K8R A;  3MXH P;  1FRJ A;  1HNI A;  1JLF A;  2ROE A;  3KLI A;  4PXD A;  5DZ6 A;  3UDL A;  5J2N A;  4R8U A;  5F8N A;  2D9O A;  2G9O A;  3HHL D;  3CC4 S;  2VDH A;  4I4B A;  3J81 Y;  4V1A k;  2Y9H A;  2AJ0 A;  1T8E A;  2ASJ A;  1RHQ B;  3BSA A;  2E29 A;  3DCA A;  2JEJ A;  5HAO A;  4OYI A;  1S97 A;  3LPE A;  2BM1 A;  3VAM A;  2HAI A;  4A4J A;  3G6E S;  3G8S A;  4EGL A;  4IRK A;  4TLQ A;  4WFB Q;  1KVK A;  3Q8P B;  2ALZ A;  5D6G A;  1BWE A;  3GWC A;  3SQO P;  1LWC A;  1NK0 A;  2QE5 A;  1U7L A;  1S6P B;  3PVX A;  4NLU A;  3T9N A;  2E1A A;  3JXO A;  1SL0 A;  2BQR A;  4PG5 A;  5GAH I;  5BYS A;  3HJV A;  3JQJ A;  2Z57 B;  2FHO B;  2Q6C A;  4LR7 A;  2VOO A;  1NEE A;  5KOX A;  2IJF A;  4DPO A;  1UWA A;  3P4U B;  3EJM A;  2VKR A;  2DNQ A;  1KC8 T;  2CG4 A;  1EKR A;  2VH7 A;  4YQW A;  1BUX A;  3GJT B;  3H2V E;  3KK3 B;  4J9L A;  3M1V A;  4K4U A;  1ZOT A;  1OQ6 A;  2Y8Y A;  5J1E A;  2W25 A;  4N8O A;  3DRR A;  4DFK A;  5IFM A;  1U1O A;  1W2B R;  2ZHB A;  3I9V 9;  5HAN A;  3JTN A;  2DJW A;  1KQK A;  2VG6 B;  4IFY B;  1PAU B;  2CJ9 A;  4QYZ K;  1A6L A;  1BQN B;  1RAH B;  4J9O A;  2M70 A;  4URS A;  4URQ U;  1IBL J;  4P10 A;  2VOP A;  2PEH A;  3GIJ A;  4KFB A;  2K7K A;  2V0N A;  3SQG B;  3AHP A;  3L09 A;  5BJR A;  3OL6 A;  3VAG A;  1S0M A;  2GMJ A;  1OY8 A;  1O5J A;  1GMW A;  4XAK A;  1OSD A;  2BJ3 A;  1R8B A;  4C98 A;  4PWU A;  2XQC A;  1U48 A;  4CM0 A;  1CC7 A;  2AMC B;  5J2P A;  2MZQ A;  1M90 T;  5EDW A;  3GYN A;  1FCA A;  4U8Y A;  3GFZ A;  1YQH A;  4A8Q A;  1F9E B;  4FNH A;  4ED1 A;  1S1W B;  4ZP8 A;  2HLT A;  1RWM B;  1FDB A;  1HA1 A;  3NWG A;  2G13 A;  3KJQ B;  2F40 A;  2OEL A;  2AGQ A;  1C4C A;  4ED3 A;  4ZP6 A;  4ZVS B;  4X4U A;  2LKZ A;  2OPP B;  2W2O P;  3HKZ D;  2V8P A;  1LWX A;  1WNE A;  2V5H G;  1C4A A;  3CJS A;  3I0R B;  1EAY C;  2BW7 A;  4JI4 J;  1UP1 A;  5B7W A;  4Y2K A;  3G6Y A;  5IWA F;  1NSA A;  4OYA A;  4G1P A;  3O44 A;  4C8M A;  2PE8 A;  1ITP A;  5A8R B;  4EBC A;  4L3K A;  3MED B;  5LM7 E;  4XTT A;  4KB7 A;  5H9E K;  2MQO A;  4EU0 A;  2JLF A;  3TR5 A;  3CJ2 A;  1QTM A;  3MPD A;  3CJQ A;  4OZ1 A;  2C2R A;  4ICL A;  2IMO A;  3KWM A;  2DBB A;  3AFG A;  4KKO B;  2G2Z A;  3K58 A;  4TU7 A;  2XSF A;  2PA8 D;  3IBW A;  1GQE A;  2R8K A;  3SEO A;  2UXC F;  5FJ4 A;  4GO5 X;  3PKY A;  2MXY A;  4OJG A;  3DRS B;  4ZCL A;  2YPZ A;  1Y5N B;  2QL7 B;  3FFI A;  2OD4 A;  1IVZ A;  1QE1 A;  4DUY J;  4F3Q A;  4RX6 A;  2CQ1 A;  1XR5 A;  4F36 A;  3IRW P;  1NZA A;  3GP9 A;  2ZH1 A;  3EVW A;  2ZVS A;  3R2D J;  3K5M A;  4HH0 A;  3A1Y G;  1D1U A;  1IKY B;  4CLP A;  3QT7 A;  4LRE A;  3FEZ A;  4DBQ A;  3VGT A;  1KVI A;  2Q79 A;  3KLE A;  5LJ5 Y;  4J9U E;  1IJF B;  4I2Q A;  1RAF B;  2C3M A;  1I3O B;  1NPR A;  4OZ0 A;  1N36 J;  3HKW A;  3LUY A;  2O67 A;  3J7A 1;  1FNM A;  2SXL A;  3SCI E;  2FD2 A;  4C4W A;  4FP9 A;  2IC3 B;  2EC0 A;  4NLV A;  3V6K A;  3D1Q A;  3W3S A;  4PPZ A;  4CO4 A;  2YWK A;  2YPY A;  2A6O A;  3AOA A;  1IBK J;  2ZD1 B;  3V4M A;  3QIP B;  4C8K A;  2I5J B;  1IQT A;  3CCW A;  4MH8 A;  3TJA A;  2DRD A;  4RBV A;  4WP3 A;  3D67 A;  1HIY A;  4U8V A;  4RW4 A;  2B56 A;  3M8Z A;  4DF4 A;  3BBB A;  3ZNU A;  4M5M A;  1RTD A;  2H4W B;  1UCN A;  4NE9 C;  4M5G A;  4CNZ A;  5FLX U;  3EYZ A;  4X64 J;  1NK9 A;  4F4Z A;  5CCM A;  1N54 B;  1MLA A;  2KXH A;  2DIS A;  1OY6 A;  3WQP A;  5C25 A;  4FYX B;  4KO0 B;  4LF4 J;  3GIM A;  5D3G B;  4DS4 A;  5DJB A;  1PYS B;  5ETM A;  3QO9 B;  1S9F A;  2FJB B;  4LT6 A;  1HPZ B;  2NXC A;  1B3T A;  4ETX A;  3C14 B;  2G0C A;  1Z1Z A;  1WWH A;  4X4O A;  4DDF A;  1K8A T;  3GG1 A;  3TVK A;  2UU9 F;  1S1T B;  4DSK A;  1JQG A;  1WHW A;  4EMD A;  1Q4R A;  2EWH A;  1RHK B;  2CNL B;  1OIA A;  1YJN S;  3DYA B;  2VL1 A;  4P74 A;  3G8T A;  2UXB F;  2AZ3 A;  2UUC J;  3D54 A;  2GA7 A;  4FKY A;  4PKD B;  4ZLJ A;  2HQI A;  1I94 J;  1S9E A;  1PIL A;  3AH6 A;  4A8W A;  1PGZ A;  1SB6 A;  2CZ9 A;  3CUN A;  5C5J A;  1RT5 A;  2CAD A;  2W4P A;  3M9N B;  3TVY A;  2O66 A;  4V19 J;  5C24 B;  2EFG A;  1RT3 B;  3I6P A;  2XS7 A;  2BQ3 A;  3WC0 A;  2E5I A;  2NUU G;  2UUA F;  3SDE B;  4I68 A;  4JI2 J;  1DTQ B;  3M8Q A;  2PC6 A;  1N0U A;  4WFZ A;  3G6V A;  2KT5 A;  1YRX A;  1SC1 B;  4I6W A;  1BQM B;  3LAK A;  1APS A;  1HBO B;  3PRB A;  3MD3 A;  1LW0 B;  1TTH B;  3W66 A;  5G0R A;  2X1B A;  5EUH A;  4B3M F;  1WEL A;  1WG4 A;  4JI6 F;  3IXQ A;  1T05 B;  1AT1 B;  5A2Q U;  4KR0 B;  5T41 A;  2YNG B;  2J0W A;  3GCW P;  3H42 A;  4NZ0 A;  3C15 B;  2QG9 B;  3HO1 A;  4MKB A;  5A76 A;  1JKH B;  3W2V B;  1FT8 A;  2CPD A;  4DG1 A;  3HDS A;  3CT9 A;  2UP1 A;  2E5G A;  3TNV A;  2LU2 A;  5LMU J;  1OSC A;  1NH7 A;  4LQ9 A;  4ECT A;  1R0B G;  1U2C A;  3OTC A;  1YJU A;  4WTO B;  4O44 A;  2VG5 B;  3CVK A;  1G6B A;  2DPJ A;  4UOC A;  4F25 A;  3BJY A;  3PFO A;  1GEH A;  1F6T A;  2P5V A;  3PTW A;  5CYQ B;  2N82 B;  4USU A;  3DRP B;  3MOJ B;  1IKX A;  1LOU A;  1EP4 A;  3T1H J;  3GII A;  3TUJ C;  2ZHA A;  3P3D A;  4ED8 A;  4IH6 A;  4F4Y A;  3NS5 A;  4Y00 A;  5KAK A;  4CNY A;  4RW7 A;  2CIM A;  2LQB A;  3V5R A;  4ZHR B;  1G3O A;  3BGR B;  1U6F A;  4JI3 J;  3P6Y C;  3DOL A;  4FF2 A;  1ZYQ A;  2W4D A;  1TVR B;  1TL5 A;  3MPV A;  3C6U B;  1NZ8 A;  2XSJ A;  1VC0 A;  1K0V A;  1P8G A;  1YRT A;  3FCH A;  2DGT A;  3K8W A;  2JX2 A;  1Q8B A;  3HUL A;  2ZH9 A;  2QSW A;  8ATC B;  1WG1 A;  1WC3 A;  4QQB A;  1GNK A;  3SMZ A;  3C19 A;  1K0T A;  3KLG A;  1AUD A;  2E44 A;  1KQF B;  2ZWP A;  3N01 A;  2M7S A;  1RAI B;  3CSK A;  3DRX A;  4TKT A;  5K14 A;  3M32 B;  3RW7 A;  2JLG A;  2LP4 A;  4QIV A;  1F9F A;  2CJX B;  3I55 S;  2AV5 A;  2DGV A;  2QGF B;  1IKV A;  4DV6 J;  5E3A A;  2XM3 A;  1UEU A;  2VPY B;  5ETP A;  1T03 A;  2RVJ A;  4FVM A;  1H0H B;  3ISN C;  2CPH A;  4HKQ A;  2HGL A;  4TY8 B;  1SJ1 A;  4HAC A;  4K7Q A;  3AXM A;  3PDN A;  4AFF A;  2G2Y A;  1YBA A;  4NXM F;  3ZZ0 A;  3QFW A;  2R2U A;  3VGU A;  1REV B;  3MM9 B;  3NCP A;  3SFG A;  3WC2 A;  4P9S A;  1ZPV A;  1KWM A;  2XLJ A;  2OMO A;  3J7Z T;  4CT8 A;  4GKK F;  2W2M P;  2JEI A;  1H3D A;  5GVQ A;  1U1M A;  4NXN J;  1SPB P;  3M6X A;  3H40 A;  1UEK A;  3EIC A;  3MR2 A;  1R8A A;  1XNR F;  1JLA B;  5KFU A;  2F63 A;  1YWX A;  3M4X A;  4NML A;  1KRP A;  1G4C A;  3O5T B;  4HTI A;  4WKR A;  1WOS A;  3R8Y A;  2JC0 A;  4ZPW R;  2FB0 A;  3A3O B;  3TYT A;  2GAH C;  4IG3 B;  3PZP A;  2HUR A;  4FF1 A;  4FXD A;  2FHJ D;  4LF7 F;  4EZ9 A;  4IUF A;  2LYV A;  3OR2 B;  1Z2Z A;  4USH A;  1V3R A;  5LL6 d;  2Y3Y A;  1VMB A;  4DPW A;  5KFD A;  4Y2C A;  2IM2 A;  2ZOG A;  4DCJ B;  4EYI B;  4KGM A;  2OPR B;  1A0O B;  4HR2 A;  4ER8 A;  2KFZ A;  4C48 A;  4LQ3 A;  4DR5 J;  4C11 A;  1N32 J;  2YXL A;  5DO2 A;  2C42 A;  1C0U A;  2FJE B;  3HHL C;  2HFO A;  4UW2 A;  4LF5 F;  1WOR A;  1U49 A;  2VIC A;  5KFY A;  5GAG I;  2B0G A;  5HO4 A;  4CP5 A;  4ZJO A;  1E6V B;  2J7W A;  1X0F A;  1RQ0 A;  4OI3 A;  2Q1L A;  2MY7 A;  1RT6 A;  2E7W A;  2KM8 C;  1NAQ A;  4J7C A;  1JNZ B;  2CJB A;  9ATC B;  2E9Z A;  4A8S A;  4OL8 A;  2APO A;  4QWB A;  3MPU B;  3C6T B;  2NPI A;  2E1C A;  2V67 A;  2C3O A;  5IC4 B;  3N5B A;  1HR0 J;  2XS5 A;  3THT A;  1N5T A;  3C2P A;  1U1R A;  5JMN A;  3C16 B;  3N6L A;  2H5J B;  3RJM B;  2YQ0 A;  4OI1 A;  1HBU B;  2VUG A;  4CLL A;  2DYA A;  2GC8 A;  3ZZZ A;  4MYU A;  4Y2I A;  4AT1 B;  4LF9 F;  1CJT A;  3PHE A;  1D8Z A;  4WPA A;  4RNN A;  1PAE X;  3D3B J;  4R25 A;  4ILL A;  4MIA A;  3PCO B;  1MWY A;  2YKN B;  4O4R A;  3I31 A;  3N79 A;  3DLB A;  1S6Q B;  4LFB J;  2JL9 A;  3K5L A;  2I8E A;  2ASD A;  2GHV C;  2F8H A;  3UO0 A;  5HI7 A;  5JVG Q;  3ZTO A;  2C2K B;  2R7T A;  2Z8Q A;  2L9N A;  2AJQ A;  3RR8 A;  2I2Y A;  2WB4 A;  1ZAW A;  2FZC B;  1MWQ A;  2AGO A;  3UDE A;  1T9V A;  5HRO A;  1VLO A;  2K8G A;  4ZP7 A;  1Y11 A;  2CPF A;  1DQ9 A;  5I42 B;  2CJY B;  3UCZ P;  2OLW A;  2XWY A;  4PWD B;  4M5I A;  1T94 A;  2OPQ A;  2HFV A;  3TVZ A;  4U7U D;  5K8N A;  4MFB A;  5HBM A;  4M8L A;  3BN4 A;  5K8M A;  4EK2 A;  2ZHO A;  1TKX A;  2LEC A;  2ZNY A;  3OXL A;  4C3K A;  1TMJ A;  3HHN B;  3PO4 A;  2GQC A;  2YBV A;  4DWI A;  4JYA J;  4E0D A;  2VV5 A;  3NGU A;  2KKH A;  3RUB L;  1RJJ A;  4DR2 J;  2HG4 A;  2WZ1 A;  1UVN A;  2HBR B;  2BJ8 A;  2ZEJ A;  2CKW A;  5HMX A;  4BHQ A;  5J2P B;  1VQ9 S;  3OTD A;  3HFZ B;  3AQP A;  1S5Z A;  2CVI A;  1JK9 B;  3J7Y I;  1TKZ B;  3O1L A;  2YY3 A;  4HTJ A;  3VQS A;  4N47 A;  1TZ0 A;  3MM8 B;  1T3O A;  4WCE Q;  4KPY A;  4FVC A;  4ZVT B;  3TAM A;  4B9S A;  5U47 A;  2ADC A;  3B6B A;  4DCP B;  4CM2 A;  1CJK B;  3ETO A;  2ZE2 B;  5FLX Y;  2QLW A;  1FTR A;  1U1N A;  1N4L A;  2IVM A;  4N41 A;  1REG X;  3HVT B;  3M9O B;  2YNH B;  1K47 A;  5EWF A;  4AL5 A;  5I3U B;  1YK9 A;  3GV7 B;  3KG4 A;  3IWN C;  1R0A B;  2B6A B;  3WHI A;  3ZZO A;  2HGN A;  3JTP A;  2ALY B;  2WBR A;  3B4D A;  1FWL A;  3CTR A;  4EO6 A;  4F0M A;  3GQC A;  1RA6 A;  1ZM4 A;  3PJW A;  5CYJ A;  1NJI T;  4HHH A;  4JI8 J;  5K5M A;  3OFF A;  3X1L B;  5F3T A;  1WC0 A;  4J9S A;  4K0K F;  1N0V C;  4RBU A;  2V50 A;  4RNH A;  3UFC X;  3CB4 A;  1GX5 A;  5M2U A;  4TLR A;  4F2S A;  2BMB A;  1HNZ J;  3T1A A;  3A8I A;  1MNE A;  5F41 A;  1N34 J;  3QT5 A;  3QRR A;  3IWL A;  2Z2M A;  1B64 A;  4QWA A;  5T7L B;  5KT4 A;  1FXL A;  4ZPD A;  1ZH5 A;  1L3U A;  4DL6 A;  2DGQ A;  2C3P A;  2BE2 B;  2E7X A;  1HI8 A;  3OVB A;  3FBE A;  5HQM A;  2DNN A;  1G7C B;  5HLF A;  3KTQ A;  4LFC F;  4ZVU B;  2OSR A;  1GT8 A;  2YNI A;  4HDG A;  2PMW A;  3VV2 B;  1RK8 A;  3DLK B;  4I7F B;  1BC6 A;  3H7H B;  3BGU A;  3OQ2 A;  4WWS A;  3Q24 A;  4JI1 J;  2MQM A;  1PJ5 A;  2OO4 A;  1X4H A;  4H4O A;  3QFH A;  1FRI A;  2A10 A;  5LT5 A;  4M5J A;  1S7H A;  4DEZ A;  3RAQ A;  3DGV A;  1KHW A;  2OEK A;  4P2S A;  4AUK A;  4C8L A;  3TZW A;  1H6K X;  2K1R A;  2BKN A;  1S1X B;  4F0K A;  5CAB A;  1EB0 A;  1IBM J;  1B7F A;  4NYZ A;  1YJR A;  2XMU A;  2UUW A;  1U26 A;  3DOM B;  3EZU A;  3ZZU A;  3KMS A;  3D68 A;  2GMH A;  4ETZ A;  3SIP B;  2KZZ A;  1AUS L;  3OR1 A;  4OYB A;  4C8O A;  2NSB A;  4UUX A;  4PG7 A;  3ILJ A;  2RRN A;  3KLV A;  1GTH A;  2IHR 1;  3SI8 A;  4UUW A;  2AT1 B;  5DDP C;  3QYY A;  5GMD A;  3I5A A;  2ZDO A;  3QWU A;  2RT3 A;  1Q8L A;  4C0B A;  2O5D A;  3S8S A;  2CJA A;  2FY8 A;  2C28 A;  3UPF A;  3MM6 B;  3HP6 A;  3HVA A;  2XY5 A;  1AXQ A;  4AQY J;  1FNX H;  4ECS A;  4C0H A;  2NXU A;  2DKO B;  2E66 A;  1WC1 A;  1Y3K A;  2FLO A;  3JAM U;  3MCS A;  4EFA C;  2Y1R I;  2XO6 A;  3O2I A;  3WX4 A;  3MM5 A;  5IV3 A;  2OJ3 A;  4OHW A;  2XMJ A;  1KD1 T;  3D9B A;  4IO9 Q;  2FPH X;  4O3N A;  4ATN A;  3EXY A;  4F7V A;  2RDD A;  3M6U A;  4QIF A;  1S1V A;  1CPZ A;  2HVE A;  2OPS B;  1Y5I B;  3KLH A;  4O3Q A;  3DMJ B;  4MMO A;  3VAF A;  4JI0 F;  3OTO F;  4K59 A;  1XC9 A;  3I87 A;  3T6J A;  1NHK L;  3SSQ A;  2R7V A;  2AJ4 A;  1JJ2 R;  3PY8 A;  3W65 A;  5DLF A;  4HLB A;  2W9C A;  3OSN A;  1R89 A;  2XTJ P;  3NGT A;  3BR8 A;  2X1A A;  2F9D A;  3EPI A;  1KON A;  3DC2 A;  1R8H A;  3K2Y A;  1HQU B;  3VQT A;  2FJD B;  4QR1 A;  1VHF A;  1NB7 A;  1U45 A;  2F65 A;  4DV5 F;  1JLG A;  3I96 A;  2Y8W A;  1TL7 A;  1FK9 B;  4KV8 A;  2R2R A;  3B4M A;  1UVM A;  1NBE B;  2YWE A;  1WSR A;  5CA5 A;  2EPI A;  2GJF A;  1B99 A;  2HAF A;  3IMQ J;  1S10 A;  2DVI A;  2PFD A;  1AFI A;  1NUE A;  4S0M A;  1ELO A;  2Q66 A;  1HQ2 A;  3E01 B;  4Y6I A;  3QGP A;  5BR8 F;  4NI2 A;  4XK8 C;  4XIU A;  1IWA A;  3D0I E;  4JBC A;  2FVR A;  4YDX A;  2ZVI A;  2MST A;  3PW7 A;  3IAM 9;  4RNF A;  1S57 A;  1TAU A;  5I3P A;  2JSX A;  1FDN A;  4IO1 A;  3OL9 A;  2IJR A;  3GIL A;  4DL0 C;  3GLJ A;  2EEY A;  1FFG B;  3VAL A;  5E41 A;  2GJI A;  4Q2M A;  3M2R A;  1TK5 A;  4OX9 F;  2R4F A;  4F67 A;  2RQ4 A;  4AND A;  2CPI A;  3ONQ A;  3POT B;  4DV2 F;  1I6J A;  1HBN A;  1C2P A;  3IR5 B;  4X4R A;  2RUS A;  2CVE A;  1RCX B;  3PNI A;  1A9N B;  3EPG A;  1HWJ A;  2IA0 A;  1LW2 A;  3TOQ A;  3X3U A;  4G65 A;  1FD2 A;  2J5A A;  4FN5 A;  4KSE B;  3MD1 A;  1R3N A;  4U7C A;  4QPX A;  3SBM A;  2ZUG A;  1R7I A;  1TP7 A;  1SV5 B;  2NZC A;  1LWE B;  2BRL A;  4Y65 A;  2HK3 A;  5D0R A;  4V19 X;  1NK4 A;  5KFV A;  3HCX A;  2K7J A;  5GME A;  3LO3 A;  4OHZ A;  2R7W A;  3Q8U A;  3LGN A;  2FHK A;  1UEV A;  2ZIT A;  3KG0 A;  1WTF A;  2ASY A;  2HGM A;  1HWL A;  1HNW F;  3Q89 A;  1CS4 A;  1SIZ A;  5F8I A;  1UA0 A;  3ZZT A;  3OFG A;  4LVN P;  1VQY A;  2Y1L B;  2N3L A;  2WCX A;  2BJ9 A;  2YNF A;  3Q8R B;  2AIR B;  1BE4 A;  4P6Q A;  2PMZ D;  4ED4 A;  3HHL B;  2HIQ A;  1QAY A;  2WRM A;  3M30 A;  2BJE A;  3FC9 A;  3EVM A;  3GR0 A;  1NJX A;  3QAU A;  2CQ4 A;  4HH1 A;  3GFH A;  3HT3 A;  2HBZ B;  3PJX A;  2L9D A;  4X4Q A;  1MN9 A;  2DR9 A;  2CNK B;  2XGQ A;  2BZ2 A;  1ZA2 B;  4CH1 A;  2MGZ A;  3QAT A;  2RNE A;  3KYL A;  3EGV A;  4CLW A;  1XER A;  2XZT B;  2HFS A;  4LF1 A;  3LAN A;  5KFB A;  1RKJ A;  1RLC L;  3BGF A;  5H9F J;  3BKU A;  5IWA J;  3CJ5 A;  4FXV A;  2BAC A;  2QYG A;  2G1D A;  1CJV B;  2AJF E;  2XY7 A;  4CT9 A;  4DL3 A;  2G2O A;  4Q0B B;  3MM7 A;  4ZCI A;  1YLX A;  2D3O 1;  1B0T A;  4YUD A;  1TL1 A;  4RU2 A;  1RWU A;  1S59 A;  1N6Q B;  2WOM B;  3MF5 A;  1NKE A;  5IQ6 A;  1SUQ A;  2E5J A;  1TR0 A;  2DD8 S;  2X51 A;  4PG4 A;  4IOA Q;  4R5P B;  4IG0 B;  2DEJ A;  2XZD B;  2H5I B;  1NHV A;  4QZV B;  3H5U A;  4DR4 F;  2C3U A;  3MMB B;  1FRX A;  2UXC J;  5KFP A;  3UD5 A;  2HNZ B;  3SV3 A;  1SCJ B;  1SXL A;  1HI0 P;  3RTV A;  2F8M A;  2RF2 B;  2VZ9 A;  5GAE U;  1LQ9 A;  4Q8E A;  1D09 B;  1Q5Y A;  3CCE S;  3D6H B;  3CUL A;  4H4K A;  1TUV A;  5F9L A;  2LLZ A;  4G1I A;  3QAE A;  1KKH A;  2M4M A;  1H2T Z;  3JS9 A;  1RT7 B;  4ZLP A;  2ZOF A;  4C8N A;  2HBQ B;  4NLO A;  1Y10 A;  4EO8 A;  1DQA A;  4NLY A;  3LAL A;  2HMI B;  3OL7 A;  3CD6 S;  4Z37 A;  2NXN A;  5B0D A;  3TUP A;  5EX3 A;  3S7R A;  2GIQ A;  2C2Z B;  3NRB A;  3G4S S;  1J5E J;  3AB2 B;  4ZA1 A;  2WAQ D;  3BQ0 A;  3BYR A;  2QIF A;  2GZO A;  1MRO A;  2CZ4 A;  2MJU A;  1AZS B;  3MMC A;  1FRK A;  5IQQ A;  2ASL A;  5AE2 A;  1QY7 A;  3GE9 A;  2AYG A;  1HMV B;  3QMQ A;  3M8S A;  3QLH B;  5M2P A;  3M9M B;  2BUN A;  1DQ8 A;  2R42 A;  2Q6B A;  4ZVF A;  3J81 U;  1RB0 A;  1YZ7 A;  5D4N A;  2ILY A;  2YKO A;  1P1L A;  2KYX A;  2UVU A;  1KEK A;  4CO2 A;  4B02 A;  1RI7 A;  1JLC B;  4CLU A;  5L1J A;  3RW6 A;  2RB7 A;  1UMJ A;  3MPY A;  4M5K A;  5CH7 B;  3H4B A;  5E7O B;  3IO1 A;  1UWB B;  4M63 A;  2AW0 A;  4YB5 A;  4D3G A;  2GGP B;  2FJW A;  4UF4 A;  4YY3 F;  2BDP A;  1QSL A;  3DU6 A;  2A18 A;  3M8R A;  1N5Q A;  3RB3 A;  2D69 A;  3DOK B;  2Z0G A;  4MAK A;  1YBT A;  5LMN F;  4L72 B;  4DPX A;  2UU9 J;  5A8K A;  3T19 A;  4WTY A;  4DR7 F;  1GMW D;  4KAI A;  1T7P A;  4EWT A;  4F3O A;  4ALZ A;  3THV A;  4NMX A;  5IXU A;  4DZ6 A;  3EM1 A;  3G82 A;  1KDN A;  5HJX A;  1FJG J;  3M8W A;  1RU1 A;  4CLK A;  1CQN A;  2UXB J;  4YR0 A;  3R27 A;  2ZWO A;  4K4Z A;  2ZJP Q;  3TP2 A;  4HEA 9;  5KFZ A;  2VBZ A;  1OWX A;  2N3O A;  2ADB A;  4LRF A;  2JFD A;  1GXL A;  3IS9 A;  3OL8 A;  1U6B A;  4LF8 F;  3W1Y C;  1JLB A;  1N5Y A;  2VBY A;  1C1C A;  4OV6 A;  1NSK L;  2ZH4 A;  4FXW A;  4J91 A;  2F8E X;  4YN3 B;  2D3Z A;  8RUC A;  2RH3 A;  2ZC3 A;  3FSX A;  1N33 F;  4W90 B;  3FRZ A;  4J9Q A;  2EK6 A;  3EWG A;  3GFY A;  2EK1 A;  3CJR A;  2G0I A;  5SUH A;  3PJ9 A;  1WEZ A;  4C3M A;  2OGU A;  2MQN A;  2WVC A;  1IR0 A;  2AEM A;  3FJ2 A;  1JNR B;  3HMJ G;  2WON B;  2ZOM A;  2M8D B;  2M0G B;  3RBZ A;  2CDR B;  4B3M J;  2X3G A;  4JI6 J;  2MKS A;  2JEG A;  2HWT A;  4QJV A;  1IUJ A;  4A47 A;  1F3V A;  2RML A;  2OHD A;  3GJS B;  4RZR A;  2HHT A;  4U95 A;  1RGV A;  4WFA Q;  3QT6 A;  1PIE A;  2DRA A;  3TAQ A;  4ID5 B;  1IR1 A;  1WDD A;  1Q79 A;  3ETM A;  4LSL B;  4X84 A;  4F2R A;  1S9G A;  4BDP A;  4DSE A;  3P5T L;  3JSM B;  4DV3 F;  3NBP A;  5IM0 B;  3S1T A;  4K5S A;  5B0B A;  3HM9 A;  2VPZ B;  3WIU A;  2IDE A;  2GV1 A;  1YBU A;  4IDK A;  2DR6 A;  1VQ4 S;  4G1Q A;  3VVT A;  1XR6 A;  2H3E B;  1KLM A;  1N8R T;  1T9Y A;  1FWK A;  4RWX A;  1FDA A;  2DNG A;  4CCH A;  1ZTT A;  4NCA A;  2V69 A;  1C1B B;  3W8G A;  3E51 A;  3KXD A;  5ETO A;  3RR7 A;  5JJB A;  3AJ1 A;  1VC6 A;  1WAC A;  3DNC A;  4CTA B;  4Q43 A;  5J1P A;  2NUH A;  4ZPT R;  3VZI A;  1FKP A;  5CZV A;  3VGV A;  4CYU B;  4I6A A;  3DI6 A;  1QM9 A;  2YWW A;  1WC5 A;  1PC5 A;  2HHW A;  4YR3 A;  4RW9 B;  5A0Y A;  3F0N A;  4PEO A;  1QSY A;  4PG8 A;  1XNQ J;  3DDK A;  2KT2 A;  1VR6 A;  4M95 A;  4ZDN A;  4ZMM A;  3BV8 A;  1XMO F;  3TX8 A;  4ZVG A;  2O01 C;  2N7Y A;  3D5M A;  4GC6 A;  4C9D A;  3CCS S;  5CD4 H;  2RQC A;  2KB2 A;  1U4B A;  3DLG B;  2HND A;  1O6X A;  1ICE B;  3MEK A;  3CJT A;  3KLF B;  1FDD A;  1FTC A;  1RT1 A;  1SJ3 P;  2J8S A;  3PXG a;  1U47 A;  1IBL F;  4QW8 A;  1EET B;  4YEA A;  5G4D A;  4O4G A;  4F4W A;  3RBX A;  5AT1 B;  4O0N A;  4DS5 A;  4NWB A;  5L1L A;  4PQU A;  3TQE A;  3N0V A;  2ZDP A;  4TN2 A;  4PQA A;  1TKT A;  1HYS A;  5J2M A;  2HHQ A;  1SH0 A;  1UZD A;  3W64 A;  4R0J A;  3CME S;  2BJ1 A;  2HFU A;  3JYT A;  1ZM9 A;  4DJB A;  2VPW B;  4N8N A;  2L9W A;  3H59 A;  1JLE A;  1WOO A;  5GAG U;  4ZJL A;  1NCL A;  5K8P A;  2W9B A;  2IBK A;  3Q2T C;  2ACM A;  2W4C A;  3MMJ A;  3TEH B;  3OHA A;  3NEK A;  1FKO A;  3MEC B;  1XNR J;  2V6A A;  3KK1 B;  3CCV S;  1JMT A;  3RAM A;  4RW6 B;  4CH0 S;  5K9F A;  1U1Q A;  4FNI A;  4Q45 A;  4NA2 A;  4CO3 A;  1KN6 A;  2WVF A;  2CWK A;  4ZOS A;  3US5 A;  3AB4 B;  1PBU A;  3MZI A;  4X66 J;  4Q8F A;  2X1F A;  3CJK A;  3GV5 B;  3IM9 A;  5GMK a;  4EZ6 A;  1X5S A;  3I5C A;  1TUG B;  4MJK A;  2ZBC A;  5CCL A;  1B0P A;  1CC8 A;  2OML A;  3IAS 9;  2AX0 A;  4LMZ A;  4BC7 A;  2LQ8 A;  4ENO A;  1SC4 B;  2DIU A;  4PCQ A;  2YH1 A;  2UVW A;  4ECQ A;  5KG2 A;  2ROP A;  1SBR A;  2V4J A;  4X2B A;  4FYD A;  3CED A;  2LA4 A;  1VCT A;  4J9P A;  2Y1J A;  4B9M A;  2BW2 A;  2BAN B;  2AWZ A;  2HWH A;  4NAS A;  2IAJ B;  2I0X A;  3MR6 A;  2EFP A;  3V6D A;  5ITH A;  4LF5 J;  2KXN B;  3LP0 A;  1TFW A;  4IRC A;  1DRZ A;  2A6M A;  2DB1 A;  1UPM B;  2M5Y A;  3KUG A;  1M1G A;  1IR2 A;  3MAA A;  3RB6 A;  3KK2 B;  5KG7 A;  2MQ8 A;  2XGP A;  2DY1 A;  3FRY A;  5AXM A;  1LWF A;  2VG7 A;  1RTJ A;  2BKO A;  3VGS A;  4OV1 A;  1NSQ A;  4B3T J;  1URN A;  4OI6 A;  1I51 B;  1VRT A;  4NLQ A;  2DNK A;  1Y00 A;  2XC9 A;  3GR1 A;  1O8B A;  4KBI A;  1IWG A;  1RTI A;  3MTJ A;  1UVK A;  4DUY F;  3HHE A;  2PMH A;  1IKW B;  4MKY A;  4Y34 A;  2HHV A;  2OI2 A;  3S01 A;  2R7R A;  3K0J A;  5HAT A;  4M5L A;  3F56 A;  4ES2 A;  2FVC A;  4UOF A;  5L1K A;  4BC9 A;  3KNG A;  4LF9 J;  2DNY A;  3CD0 A;  3M05 A;  4JI5 J;  3C46 A;  5MLC V;  1RA7 A;  1KFD A;  4ZIT A;  2NQP A;  2PT0 A;  2J8A A;  2QT7 A;  3GJQ B;  4FBT A;  1E6Y A;  6FDR A;  3GV8 B;  3AQO A;  2B9E A;  3DGP B;  4QPT A;  3M6W A;  1H7W A;  1X5T A;  4QOT A;  1TL3 B;  1IBK F;  1HNX J;  3EGN A;  3MEE A;  1PC4 A;  4MIB A;  1X4B A;  3PW5 A;  3A3N B;  4QR2 A;  4CO0 A;  4X4N A;  4OI0 A;  1DFD A;  5KFS A;  2V4R A;  2Z56 B;  5KFK A;  1VIO A;  4XO0 A;  1DY3 A;  4NCG A;  1GMV A;  2IJN A;  4X64 F;  2YKA A;  3OW2 R;  2E1P A;  2QN6 B;  4YS2 A;  5DM6 Q;  2B5J A;  1RT2 B;  4H4M A;  2VB6 A;  2B4P A;  2EFV A;  3UVJ B;  4J9R A;  4DQS A;  1BHN A;  3P5B P;  3JSB A;  4M5N A;  3OTE A;  2O3D A;  4YP3 A;  4OYZ A;  1MU2 B;  2P9C A;  1UJ6 A;  3QGH A;  2VFR A;  1OMS A;  4B3O B;  1VRU A;  3W61 A;  2HW3 A;  4HYK A;  2JDJ A;  1CUL A;  1HWI A;  1U0H A;  2UUC F;  5E5N A;  3M8P A;  3MUT P;  2LEA A;  5LOQ A;  2U2F A;  3QRQ A;  4ZVP B;  4JI7 J;  3DM2 B;  1NHU A;  1S0V A;  2L41 A;  4LF2 A;  4NLS A;  1RP5 A;  1HFE L;  2ZH5 A;  1FNO A;  1X5P A;  4J9V A;  1UVJ A;  4HT5 A;  3ZTP A;  3RRH A;  2F4F A;  4TXS A;  5KG6 A;  3PAC A;  2BVZ A;  1ZET A;  2W9A A;  2HVH A;  2PI4 A;  4ILR A;  4GVB A;  4M5D B;  1C0T B;  3MAQ A;  2IBO A;  4NEY A;  5LXY A;  3H98 A;  5ETS A;  5HN0 A;  1DLO A;  4EI2 A;  2HSE B;  2RKI A;  2NZ4 A;  4DV7 F;  3BO2 A;  4LSN B;  2HVI A;  1VBY A;  1RTH B;  1X31 C;  1TV6 A;  2R7S A;  3LP2 B;  1YJ7 A;  2M52 A;  2N4D A;  3IN5 A;  5E2Q A;  5FDL B;  3P49 B;  3LQV A;  2GIR A;  3IM8 A;  3MMA A;  3OFE A;  3LAM A;  1PO6 A;  4DLG A;  2YX1 A;  3PIP Q;  1LFW A;  2R8J A;  2Q43 A;  2DH7 A;  2DR8 A;  4D3H A;  3MFH A;  3GJR B;  1U25 A;  4N7T A;  3PW0 A;  3NNH A;  1U0S A;  3CDW A;  1OO0 B;  3VAJ A;  3KJV B;  2WVE A;  2JFK A;  4OLO A;  1KTV A;  1GTE A;  4DU8 A;  3FVY A;  4IOB A;  1SJR A;  1F9H A;  2ZH6 A;  2MLX A;  4DV1 J;  3UD4 P;  3DFE A;  4E8U A;  2RE1 A;  4GMK A;  1S6P A;  4DPT A;  1G2E A;  3VAI A;  3FBB A;  4JV0 A;  5DZ7 A;  2HNY B;  4NYO A;  2VPX B;  3A8E A;  2LVW A;  5EX0 A;  2UUB F;  4YDD B;  1QDU B;  1NKC A;  4CLS A;  1RAC B;  2MKJ A;  4ED0 A;  5D0H A;  4OHX A;  3UD3 P;  1RYR A;  1VC5 A;  1WF2 A;  4C0O C;  4RW8 B;  5KOW A;  1VIX A;  3TJ9 A;  2XLK A;  3MR5 A;  1BMQ B;  1HL6 A;  4NLT A;  3N4W A;  1VRQ C;  3HZG A;  1UJ4 A;  5DQG A;  4F02 A;  2BM0 A;  4X4P A;  2FC8 A;  3TAN A;  4A8K A;  2E9T A;  3KK3 A;  1ACM B;  3CO9 A;  4QWE A;  3Q2S C;  2FQQ B;  4IQM A;  2HPU A;  1DZ5 A;  5IT9 Y;  5KT3 A;  5D0E A;  1F0X A;  5J2Q B;  2VG6 A;  4IFY A;  5DRK A;  2H4Y B;  1BQN A;  3E8O A;  2QZ8 A;  2J7K A;  1Q8K A;  2IA6 A;  3W5X A;  4DV6 F;  3GSI A;  3CCQ S;  2FY1 A;  3SSS A;  3SQG A;  3R6L B;  3PX6 A;  5B0A A;  1UFK A;  4DZD A;  2JVO A;  2QX0 A;  3ZTR A;  2BJ7 A;  3IG1 B;  3DLE B;  1CJU B;  4YHH J;  3IRX B;  4PYD A;  1HNV B;  2CQB A;  2GML A;  2CQD A;  1HWK A;  3R3T A;  1U8W A;  2Z2Z A;  2OEM A;  3H2U B;  4NXN F;  1S1U B;  3R7N B;  1S1W A;  5EGY A;  1X4F A;  2XMA A;  2YKQ A;  2BR0 A;  1YHQ S;  3TWZ A;  3I0S B;  1HQE B;  4GO7 X;  2W24 A;  4JI0 J;  3OTO J;  2OPP A;  1QAX A;  1W25 A;  4G6V B;  2D9P A;  1CEZ A;  1BXN A;  3RYL A;  3Q22 A;  3CGI A;  4UQG A;  3I0R A;  5LXR A;  2HK2 A;  4ECU A;  2VQE F;  3W2W B;  2HQ3 A;  3ET6 B;  3CCU S;  1ZS6 A;  4DHV A;  4XPE A;  3DXB A;  1W2I A;  5A8R A;  3JSY A;  3MED A;  2AU0 A;  2DO4 A;  1RHR B;  3M2U B;  1N88 A;  4NLX A;  3ZTQ A;  2YKM B;  3PYG A;  3LTO A;  2R2T A;  3JQK A;  5A6W A;  2D1C A;  5L38 A;  1WD6 A;  4USW A;  3D1O A;  1ZZN A;  1NPK A;  4KKO A;  3QGI A;  4AL7 A;  3B78 A;  5B0C A;  5ETR A;  1D3W A;  3M2V B;  1K44 A;  1ROF A;  2HHU A;  3CDB A;  3TA2 A;  4DSI A;  3CMA S;  1UAW A;  4GC7 A;  5IC6 B;  2XUL A;  4X4S A;  3F41 A;  2EKY A;  5BR8 J;  4DMZ A;  4IYQ A;  3DRS A;  3TRG A;  3QJP A;  1WTB A;  1YRU A;  4U7U K;  4IOC Q;  1JJC B;  1QVF R;  3MEG B;  4QU6 A;  1BLU A;  2JOQ A;  4ECZ A;  1HR0 F;  1UA1 A;  1R6V A;  3M7V A;  1SJ4 P;  1IKY A;  4NLW A;  4GRS A;  3ENV A;  3I9Z A;  1OYE A;  1RAG B;  5EHH A;  5HSP A;  4A8O A;  1ZBT A;  4USK A;  2GIF A;  1FJC A;  4HHU A;  1H72 C;  5E33 A;  2QMX A;  3LP1 B;  4KIA A;  4NEZ A;  4Q5V A;  1RHM B;  1RT4 B;  2RRA A;  5CYM B;  2X7I A;  2LXU A;  2BYC A;  2IC3 A;  5GAD U;  1K73 T;  4P71 A;  2DEI A;  2KO1 A;  2CRL A;  4MKV A;  1Y0H A;  3OPK A;  1V5V A;  2Y1I A;  2VQF F;  1JJH A;  2YWG A;  4L74 A;  3NXZ A;  1JLQ B;  1XEZ A;  2ZD1 A;  1SJQ A;  3Q23 A;  3QIP A;  2I5J A;  4EBE A;  3K17 A;  1UL3 A;  3HX9 A;  1M5H A;  1PYT A;  4K4V A;  3J81 j;  2ABY A;  5DET A;  3NKY A;  4J9M A;  3QZ7 A;  4QU7 A;  4XDD A;  2XWX A;  2Z58 B;  3PW2 A;  3PHT A;  3NCQ A;  2LDI A;  3NWR A;  2FVQ A;  4I2P B;  4WE1 B;  3G9C A;  1NH8 A;  4KO0 A;  3N28 A;  1EZZ B;  5D3G A;  3MPW A;  3QO9 A;  1HPZ A;  4USJ C;  2CYY A;  1HNW J;  4YME A;  3C14 A;  2GVD B;  4UTG A;  4O3O A;  3QID A;  2VON A;  2C2D A;  5IT4 A;  4RU9 A;  4UT4 A;  1PBA A;  3DN9 A;  3MUV P;  4ES1 A;  1S1T A;  4A46 A;  2HHP A;  1KVJ A;  2F3J A;  2MQP A;  3CIZ A;  4DR2 F;  2KHD A;  3OVS A;  4ILM A;  1ARO P;  2XCP A;  3DYA A;  3HLU A;  5HP1 B;  1J5O B;  5DDQ C;  5IT0 A;  2K3K A;  1SQG A;  5B0F A;  4DSF A;  1FO1 A;  4P2M A;  4UZC A;  4DL5 A;  1MG7 A;  4URG A;  1NDL A;  1WKK A;  2E7V A;  3JB9 k;  4UY8 T;  1YJW S;  5A8W B;  1T11 A;  3MCM A;  1R43 A;  3OBI A;  1H98 A;  3W5Z A;  1RCO B;  5B0G A;  5C24 A;  4PRF A;  5L9N A;  3SDE A;  2ZH3 A;  5CAA A;  1DTQ A;  3NGD A;  4K2J A;  3OJS A;  4B17 A;  4DX7 A;  2Z30 B;  4PPD A;  2RD5 C;  1S6U A;  1BQM A;  1WDT A;  1HBO A;  1H38 A;  2XZW A;  2CZV C;  1LW0 A;  3BKT A;  1ZZF A;  2OTL S;  2OFH X;  1FEE A;  3BF4 A;  3R97 A;  4WP9 A;  5EN1 A;  4I64 A;  3GB0 A;  2V63 A;  4JI8 F;  1T05 A;  2HQD A;  1U24 A;  2C1E B;  2FGO A;  3CF5 Q;  4DUZ J;  3ITH B;  2YNG A;  1EHW A;  1HBM B;  4RO0 A;  3CD7 A;  4EUV A;  5D8H B;  1RWV B;  2GCF A;  4IFV B;  3C15 A;  3ZNJ 1;  2J6T A;  2H1Y A;  4ELV A;  3PG9 A;  2JRS A;  5KTQ A;  3PRV A;  1JKH A;  2DR5 A;  3W2V A;  4OIX A;  4FF4 A;  4ED2 A;  3IBC B;  3LOU A;  2FJX A;  2DGW A;  4L75 A;  4PXB A;  1XR7 A;  3HFV A;  4B3R J;  3THP A;  7FDR A;  3BSO A;  4F4A A;  2FGC A;  2B9W A;  2IDL A;  4HDH A;  5ETV A;  1MW7 A;  3SCJ E;  1I5O B;  3D4J A;  2OTJ S;  1QUP A;  4LRD A;  2VG5 A;  4CRJ A;  3IC1 A;  4EEY A;  3P45 B;  4QYR A;  1PKU A;  3V4I B;  4F4K A;  3D66 A;  5CYQ A;  3LWM A;  4M5H A;  1M5V C;  3EZO A;  3DRP A;  3R9L A;  3LPY A;  2JEF A;  2R7U A;  3FDS A;  1VQN S;  4E98 A;  1NME B;  3AOD A;  4LUB A;  4ZLL A;  2V94 A;  3V81 B;  2R8H A;  2A3J A;  3H4D A;  1WI8 A;  2NXE A;  1TUW A;  2X1G A;  3K5N A;  3OUY B;  4UOG A;  3AD7 C;  2FYX A;  4B08 A;  1NDC A;  4ZHR A;  2MQL A;  3T1Y J;  3DDI A;  2QA4 G;  4FS1 A;  3BGR A;  2XYG B;  3FGV A;  2RS2 A;  2EBG A;  1TVR A;  3EDQ B;  3N5F A; 
#chains in the Genus database with same CATH homology
 1SCJ B;  2Z56 B;  3A3O B;  2ZWO A;  4OV6 A;  2QTW A;  4NE9 C;  1R6V A;  3SQO P;  2W2Q P;  3A3N B;  4NMX A;  2W2P P;  3BGO P;  3WIU A;  3QFH A;  2W2O P;  4YN3 B;  2Z57 B;  3P5B P;  3BPS P;  2W2N P;  3GCX P;  2E1P A;  3WHI A;  2XTJ P;  3A3P B;  4K8R A;  3GCW P;  3H42 A;  2Z30 B;  1V5I B;  2Z2Z A;  2PMW A;  3VV2 B;  4JP8 A;  2W2M P;  1ITP A;  3WIV A;  2Z2Y B;  2Z58 B;  2ZWP A;  3CNQ P;  3VHQ A;  3CO0 P;  1SPB P;  3T41 A;  3AFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...