2Z58B

Crystal structure of g56w-propeptide:s324a-subtilisin complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPWVEKVEFDHQAVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Requirement of left-handed glycine residue for high stability of the Tk-subtilisin propeptide as revealed by mutational and crystallographic analyses
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 9
structure length 66
sequence length 66
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2z58B00
4K8RA 2W2QP 2W2OP 2Z57B 3VV2B 1ITPA 2XTJP 2QTWA 3AFGA 4JP8A 3A3OB 3WHIA 1V5IB 2Z30B 3A3NB 2ZWPA 3CO0P 3GCXP 2Z58B 3VHQA 3WIVA 2E1PA 3T41A 2Z2YB 2W2NP 4YN3B 1R6VA 3SQOP 2ZWOA 2PMWA 3CNQP 4OV6A 1SCJB 3BGOP 3A3PB 4NE9C 3QFHA 2Z2ZA 3WIUA 4NMXA 2W2MP 2Z56B 3BPSP 3H42A 1SPBP 3P5BP 3GCWP 2W2PP
chains in the Genus database with same CATH superfamily
3GTYX 1HI8A 4LQ9A 4ZJOA 1FA0A 3TA1A 2F9DA 3L4BC 1YRUA 4NLPA 3ZNJ1 2GJ2A 1Y3KA 1BUXA 1TKXA 4H4KA 5B08A 1NJXA 1O51A 4USKA 3IM9A 3T41A 2NZCA 4JI8J 3MM8B 5A0YB 2GIQA 1K0TA 1LKZA 3CCUS 2IJRA 2VA3A 1SUQA 2A2DA 2HURA 2G0IA 2RB7A 5ETPA 1Q8IA 2Q3PA 4WIQA 1S12A 4OJ1A 1IKWA 2E5GA 1T9VA 2B7BB 1FCAA 1CJTA 3M1VB 1YVFA 3GV5B 2DO4A 4KPYA 4XPEA 1S57A 3C8YA 3TOQA 3BSNA 1Y11A 3OVBA 3FCVA 3I32A 2A6MA 3L09A 1S72S 3MPYA 1RT3B 5DG8A 4BS2A 4C8LA 4FDFA 2HRUA 4HR2A 4FYDA 3OHAA 2GHWA 2L08A 2ASYA 3OQ2A 4KAIA 5C25A 3AD8C 3HXMA 2KVQE 1SJFA 1UETA 1JLQB 2YKMA 3DGVA 4DSFA 4QWDA 4NA2A 4JI6F 1U8WA 4B3OA 2V2QA 4HDGA 2MSTA 3W65A 1UFKA 4USMA 2QMWA 2VG5B 2ZBQA 2R8HA 3CPWR 3MHYA 5J2NB 2FIUA 4OX9F 4PAAA 4DR1J 3SSQA 1VQPS 2PT0A 2ADBA 2WRMA 2ZH8A 1K44A 2XYHB 3H90A 4QIWD 3EGVA 4LFAJ 3I9V9 2XLIA 4X4UA 2BKPA 1GEHA 3TQEA 3NBPA 3M6VA 2W2MP 2B7CB 3FK4A 2DGWA 2DT9A 4RLEA 4DSKA 2B9WA 4IR1A 1R0BG 4WBFA 5G4DA 5THWA 4F4XA 3DMJB 1NSQA 4E8UA 5L46A 1VI7A 4BDPA 1HBNB 1UTAA 2GQ2A 4P73A 1OO0B 4QJVA 9ATCB 4XO0A 3CCRS 3H2VE 4B9NA 4DG1B 4C9DA 5HAOA 3EM1A 3NOCA 2MQNA 3GCXP 2VB6A 3FFIA 4PXBA 2E1AA 4RBUA 3ZZRA 1UPPA 1TKDA 4MKAA 4NXMJ 1QD1A 4H4KC 3DRSB 2AZ1A 3OJSA 4DL6A 3C46A 1IKWB 1HQEA 3QAEA 2BJDA 3I0RA 2HZVA 5B09A 4RW8B 2DD8S 5ITHA 4C4WA 2YNGB 1WEXA 4FXWA 5B0AA 4Q8EA 3R2CJ 3LP1A 2ZKUA 3G87A 3PO4A 1S6PA 3EXYA 4KO0A 4JI2J 1KNZA 1RSCA 1RTJB 1IR2A 3Q8RB 1UAWA 2JLEA 2LYVA 4ES1A 3MURP 2NXCA 5CZVA 2EFOA 4G1IA 1S6UA 3TAPA 3KG1A 3DOLB 5FLXY 4WFAQ 2VONA 5KFSA 3HHDA 3T5KA 1Z1ZA 2OEMA 4O0IA 4DV5J 1Y7PA 3SV4A 1RISA 1F9HA 2FJEB 3O8WA 3RW7A 1BY9A 5K8NA 2OFGX 3CDUA 3H5SA 5K5MA 4C2MA 5HVGA 3DU6A 1IXKA 3N01A 3M8ZA 5IZHA 2BABA 4AQYF 1X9SA 2MQQA 3K8WA 3KG4A 4C98A 2XB2D 2V8PA 4DR1F 1TTHB 2R7RA 2XHCA 2NXNA 1ICEB 3PHTA 2WBMA 2ALZA 1U45A 4CQ1A 2Z0GA 4KGZB 3G6YA 4N47A 1APSA 4Y0FA 1NMEB 1L3VA 3NMAA 1HARA 1ELOA 2V2ZA 1WHWA 5HJXA 5J2QB 1HW8A 2GO9A 1X5TA 3V2UC 3C3LA 3JYTB 2QL7B 4O3RA 1UL3A 2CKWA 4NI2B 2ZDPA 3CJ3A 1MWQA 3CIZA 3CC4S 3P6YC 4A8OA 1HR0F 3RBDA 1V3SA 2OMLA 3MOJB 1FNOA 4L76A 4I69A 1ITPA 1IVZA 3I5CA 2N82B 2NUHA 5C25B 4EMDA 2C2EA 1NDKA 2HQCA 4DUYF 2IDLA 3D4JA 2VKRA 4M5KA 1XC9A 2GW8A 1WACA 3CJKA 4NLRA 1IN0A 3WX4A 3ZTOA 4XPCA 2C2DA 3DLKA 2JC0A 2VBWA 4B9UA 2VFSA 4M5JA 3MD3A 2YTCA 1RACB 3IBFB 4RBTA 2C2MB 2ZWOA 1RXOB 4UQGA 3M2RA 1SH0A 1S49A 2FHJA 4NLTA 1ROFA 1VQLS 3M8YA 1TUVA 2UXDJ 1HNVB 2HBQB 2BQRA 1SIZA 2KVIA 5A8KA 1WJ9A 3BR9A 5H9EJ 1XNQJ 4F4YA 2UUAF 5B0DA 4QIGA 3R7NB 1DTQA 2IM2A 1VQ8S 3V6HA 3FUYA 1W2IA 2CDRB 3PG9A 2YH1A 4ECQA 2APOA 2AGQA 1HNXF 4WFXA 4EO6A 4A8XA 1P8GA 2HEKA 2EG2A 2N4CA 3V4MA 3GYXB 4IH6A 4NLYA 2L48A 5IWAJ 5L1LA 1X0FA 4PABA 1E6YB 4LFBJ 1R0CB 4DG1A 4OX6A 2CYYA 1HLWA 2BJ3A 1CJVA 3G8QA 3LPEA 3US5A 2HQIA 5DGBA 1RT4A 4ZPTR 3D2WA 3HVRA 3ZZTA 5F8NA 5L9NA 4FF1A 1JXVA 4YS2A 1JLGA 5F8LA 4UF4A 1GXTA 9RUBA 3KLGB 3KWMA 3PW0A 3KYLA 4K4VA 1FJGF 3BSAA 2MQPA 3G6VA 4HYKA 2XY5A 2KJVA 7AT1B 2QGFB 2WTFA 1FKOB 1TK5A 1H74A 3LP1B 4I6AA 4AE5A 1Q81T 1VLOA 3TQ1A 1HQUB 2F1FA 3MWBA 4QWEA 1S9FA 4DX5A 1RTJA 3LF0A 2HAIA 3DLJA 1KD1T 2UUCF 4NLOA 1HWLA 4Q43A 3CXCR 1W2BR 3MPVA 4A8WA 2JX2A 3FJ2A 4PR6A 4YB7A 1Q8BA 2CJYB 3FC9A 3VWSA 2CPIA 2YWEA 3DXBA 2OPSB 3MAAA 4XDDA 2O5DA 3QGHA 3BN4A 1RTHB 4ZP7A 1JKHB 2G1HA 2IJNA 1I1GA 1Q78A 2J8AA 4M63A 1OQ3A 1N5YB 1IBMF 3SCLE 3KOAA 4DR7F 1NRKA 1IJFB 5KFNA 2ATLA 1FF2A 4A8YA 4CYUB 2ZDOA 1G2EA 3HHLD 3I5AA 1S1WB 2UXCF 3P45B 3FEZA 3ENQA 4ZS6A 1JWWA 3PW2A 3OTBA 4HDHA 5C42B 5CAAA 3AQPA 2UXCJ 1RWWB 2L9DA 2VUGA 3GJTB 3CCTA 3CO9A 4MT1A 3W7BA 5IQ6A 4DQIA 1DLOA 2ILZA 1XEZA 4Q0BA 2Q6BA 2RUGA 1G1XA 4ANDA 2QMUB 4NLSA 4ZLJA 2F8EX 1EQ0A 4N41A 4Z7YA 3VHQA 3MTKA 4ZIVA 1NK5A 4IKAA 1Q7LB 5AT1B 3IGNA 4OX8A 1N33J 5B0CA 2HVEA 1X9WA 1KFSA 1X4CA 1S6QB 3AOAA 2QYCA 1EETB 3HLUA 2V9KA 4I64A 4ZVHA 4NXNJ 3CUNA 2CQ4A 5A8WB 2RF2B 1WC4A 2Z2ZA 4OV1A 1D8ZA 1GMVA 1XN9A 2DVIA 5GAGU 1WOOA 2VPWB 2DNQA 1HQUA 5DDQC 4OZJA 3AA8A 1TV6A 4HLBA 3CJ2A 1RT7A 2JL9A 3EJMA 5A8RB 3FNNA 5E3CA 2IBOA 1VC6A 1S77D 3VZHA 3W9HA 1NBEB 1AB8A 3UDEA 2OSQA 5AXMA 5M2UA 1AFIA 2EFQA 3M8WA 3R5CA 2F9JA 4LQ3A 4OZ1A 4A46A 3HMJG 4X4QA 4U8VA 2YKNB 3P5TL 1T9XA 1YBAA 4RW7B 1R8BA 5T14A 2V34A 1CJVB 2GZOA 3M32B 5E3PA 3RU0A 1QUPA 5DLFA 4JOUA 4E98A 2OLWA 3QIPB 3MCNA 3A8JA 2CUYA 3FZ2A 4AFFA 3C15A 2UVRA 2HW3A 3GONA 3W2VA 3MR3A 1F0XA 3PKYA 3LUYA 4OI6A 1MU2A 3THTA 1GX6A 3PRBA 5F8MA 3QRRA 3EE3A 4ZIWA 2HWHA 4LBHA 1RBAA 2ACYA 3ZO7A 5IM0A 4YR3A 5I4MA 1DLOB 2RVJA 4LF6J 1JLFA 2N7CA 3T1YJ 1RHUB 3PEJA 2ZH6A 1IBCB 4P72A 5J1PA 2ROEA 1T3OA 3R5DA 3G82A 4HI1A 4LSLB 4PYDA 3ZTRA 1RHRB 1UJ5A 3LGNA 3NCPA 3MM5A 4IG3A 4RKUC 3MFHA 2Y8YA 2G2YA 2R7SA 4O3OA 1NHVA 3FEYB 1FNXH 2DKOB 3L7OA 3LP2B 5LJ3Y 1WD6A 4OZNA 4J5OA 2JJ4D 4H4OB 4LR8A 4LVOP 3I87A 3KJNB 2CQ0A 4XTTA 2X3DA 3OLBA 1NDPA 1HWJA 1U26A 2MKIA 3H40A 4DR3F 4FF4A 1MROB 2LKZA 1U2FA 3OPKA 4CO2A 5IXUA 1B0VA 2QA2A 2CQPA 2KG1A 5E3RA 5EX3A 1SJ3P 1RP5A 4X2BA 5U47A 1PIEA 3B6BA 3DLGB 3HSDA 4NOHA 2EVZA 4IO9Q 2R7TA 5EDWA 4G1QB 1M1HA 2MZTA 3MCMA 1DTTA 3HHNB 5LJ5Y 4ED4A 1N56A 1UP1A 1NAQA 2CQIA 1VQYA 2V4RA 3HHLB 3T5JA 2YKNA 4MK8A 2DXDA 4OYIA 3BB5A 1Y10A 4DPTA 4FF3A 5K9FA 2WW4A 4F8RA 2EKYA 3M32A 3BQ2A 2FC8A 2PA8D 2V94A 3CJRA 1FK9A 2VQEJ 1X4FA 2P8IA 3QT6A 2CJKA 2GAHC 4LSNB 4OYBA 4ECWA 1ZPVA 3TR5A 4QCLA 4PZVA 1NXIA 4U6PA 2ZBCA 1H0HB 1T9YA 1SQEA 3GIRA 4LF4F 2FDNA 2KFYA 2Q66A 4YFUA 4OLOA 1AW0A 2XI3A 1YBUA 4K0KF 2ABYA 2BEFA 3QMQA 2E5LF 5IT9Y 4IDKA 1N5QA 3DLLQ 2VPZB 2Z57B 1T3NA 4N77A 2HQFA 1TKZB 2CZVC 2MZJA 2XMVA 3UNYA 1U1QA 1NK9A 1LW2B 1YQHA 5E0OA 1HD0A 4DV7J 3J7AN 5AXKA 3EVMA 3O1LA 4K7QA 4C0OC 2FJDB 4I6YA 4UOFA 4Z2XA 2CVEA 5C24B 3OV7A 2J0WA 4WFBQ 1SL1A 2H1YA 1RADB 2WONB 4FYXB 4FBUA 2DHSA 5K8MA 4WKYA 2MJNA 1D3WA 1FDNA 2N4DA 1MROA 2ZFHA 3PNIA 3OUYB 1K8AT 1RGVA 2W4CA 2GHPA 3HD1A 2B51A 5KFGA 4JV2A 2PI4A 1HA1A 4FYWB 4DUYJ 2E7XA 1JLEA 1S1TA 5F9NA 3J7YI 5KFVA 3ENWA 3D5MA 4IFVB 5CYMA 5KG4A 2RU3A 4RUCA 2HRTA 2J76E 2M2BA 5GVQA 3UNGC 4F3QA 2GNKA 1HQ2A 1TL7B 4CO0A 4UZBA 3MUTP 4DV0F 2O67A 3BEGB 1ZM2A 1ZYQA 1H6KX 1S5ZA 4P75A 1VR6A 3H98A 4CNYA 3MOZA 4KC5A 5BR8F 4LF5J 1HNWF 1NK0A 1IBKF 4X84A 3S01A 2NREA 3D9BA 2DNOA 2RMLA 4XK8C 2DR8A 2E66A 4KHPF 2GVZA 3ZTQA 5JVHQ 3N6LA 4DSLA 4B3TJ 3NWGA 1WWHA 4ZK7M 4OHWA 4UOHA 3T1HJ 1RK8A 1PBUA 3TVZA 3JS9A 1C2PA 1KTVA 4LF8J 1F3FA 1X60A 3EXCX 4KQZA 1OPIA 3Q8PB 2M9KA 4Z37A 2JVOA 3RBZA 1YJUA 4O3NA 1WHYA 1IQTA 4HACA 4LF6F 1LW2A 4K2XA 3TAQA 4GKJJ 3NY0A 4DUTA 3I0RB 2NR0A 1FWPA 3LAKA 3KMSA 1U4BA 2H5IB 3M30A 2F5GA 4ECUA 1RWNB 3DHWC 1IM4A 3MR7A 4H4MA 4WU3A 1FK9B 4DN9A 4RO0A 5KFWA 3K5LA 1HNZF 5HANA 1FWLA 1RB0A 1TKTB 4OIXA 5RUBA 3G71S 1TUWA 2F8MA 3C6UA 1S0NA 2LEAA 3CDWA 3KKFA 2W1BA 4OHXA 1VQNS 1JLAB 4NLUA 3D3CJ 4CRJA 3HP6A 5I42A 1RKJA 4KGVB 2IMOA 2PMZD 2R7VA 2OO4A 1CC7A 1EP4A 2LMIA 4EFAC 3EZ5A 5HQMA 3OL7A 2GCFA 2K3KA 2BE2B 2VG6A 5HJYA 4DR6J 2ROGA 3S8SA 3NNCA 2VV5A 5EHHA 5K20B 2ZITA 2XYGB 3K17A 1BWEA 3GG0A 4DR3J 3UD3P 1OJ4A 3IBWA 4NASA 2ADCA 3B4DA 4EGLA 4OZ0A 3OL8A 3KHLA 1SKWA 2CG4A 4NLVA 3M2VA 2BJ1A 1U1PA 4MFBA 3D7SB 3EICA 3HKWA 1B64A 1C1CA 3R9LA 4JI5F 1V3RA 2RQ4A 3CWJA 3N9UC 1KC8T 2F4VJ 4ZKAA 2CQ1A 2AD9A 4JI4J 2OPQB 5HVHA 2EEYA 2JEIA 3R7SB 3BSCA 2I2YA 2HVZA 4IG0A 1NKCA 3HFVA 3U7JA 2ZNZA 4X4RA 4LBPA 5CCMA 1YITS 2AYEA 2AP6A 5IC4B 2ZH1A 2QA1A 2KN4A 4J9VA 2XCAA 2XMWA 4YR2A 4UT4A 3BBBA 2F4FA 4PPDA 4LIRA 3CCMS 4OQJA 4DS4A 1I6JA 2EC2A 2VG7B 4CTAB 3AD9C 3H4DA 4KPCA 4FNHA 4WZQA 3UDCA 3H59A 3PHEA 1K1QA 1PYSB 2BJ9A 4R25A 1D0EA 3D6FB 4NA3A 4I6WA 3VAJA 3MCSA 4KYZA 5EWGA 4K4TA 1UA0A 1FESA 4KGKA 4KKOA 4RWWA 2FJXA 1NB2A 2ZH9A 3CCVS 5DM7Q 1G3OA 1LWFA 2XSJA 3C16B 3GILA 3K58A 5L38A 1W7WA 4JB8B 3IAM9 4FN5A 4X65J 4PWDA 3F0NA 2HLUA 2QL5B 4RPFA 4HEA9 1KQFB 3TVYA 1EB0A 2DRDA 3D6MB 3V4IB 4GC6A 3PFOA 4M5HA 1KOOA 3LWMA 2FJVA 2MKKA 3TEGA 2BE2A 1IKYB 2VG6B 3R7BB 1NJWA 1BWVA 1RWMB 3I5BA 3NGSA 5T7LA 5D3GA 2E5HA 2E7VA 2MPUA 4KHRA 3TEHB 3HF5A 3ZXWA 4PG8A 3PFEA 2RRBA 2XLJA 4DF4A 2CA9A 3QJLA 3R5JB 4QR1A 2I1RA 4C8YA 3V81B 2CADA 2DHXA 2LECA 1GAOA 1TL4A 2W4DA 2DTJA 2XEXA 3Q86A 2FZCB 4CLFA 4DR2J 1PGZA 3DLEB 2WZ1A 2HYIB 1UZDA 1S97A 1FVSA 1HWUA 1SH3A 3D28A 1Z4UA 1VQ6S 1NH8A 4QIEA 5DQIA 2HHVA 4USIA 2MKYA 3OTCA 4MK9A 3A12A 2XHWA 3QIDA 4PQAA 3T1AA 1YZ7A 4HTIA 4USWA 3U1NA 1VJWA 5HP1B 3ULHA 4QWAA 4QIFA 3EMTA 4WF9Q 2HNZB 3N5BA 4ECXA 4DQPA 3D1HA 1AROP 1XK8A 2POKA 4J9NA 1NZAA 3R1HA 1LFPA 3ZC4A 4IH7A 2R3VA 2N3LA 1Q79A 4IFYB 1LNQA 3D66A 4KFBA 3MXHP 2HS3A 3T1HF 2PGCA 4PG6A 4DV4F 2RJZA 1NK6A 1YWXA 4USHA 2X3GA 5B0EA 2B43A 2HHHF 2HIQA 1OSDA 4MFBB 1R6VA 3R6LB 4LJMA 1EZZB 1N32F 1BGXT 2ZZNA 4YB1P 4DLEA 2YH0A 4RUAA 1DBDA 2M7SA 3JTPA 3KUGA 3P96A 5D77A 3BKFA 2HGNA 3LP0A 1FXDA 4DV3J 1IKYA 1R8CA 1FT8A 2A18A 1RTIA 3AJ2A 5DLGA 4G65A 2QEXS 4F3OA 4AT1B 1NSAA 3D0IE 4K2JA 3OXFA 1T05B 2UUBJ 1F2GA 1MN7A 1YJTA 2JH3A 3CMQA 1VC0A 1AUDA 1HQEB 2VG5A 2GJFA 3DDIA 3HHKA 2Y1IA 2CVIA 1XNRF 3ISND 2JFDA 1H2UX 1U1NA 3QAUA 4ZPWR 4D3GA 2XZTB 2KI2A 1SI9A 1LXJA 4J9PA 1TV6B 1NK8A 1CG2A 3GB0A 4AXJA 3OBIA 4ZVGA 2FHMA 3Q8SB 1Q86T 2ZE2B 3B78A 3TJ8A 4QYZJ 1TMJA 3J80Y 3BGFA 2UV8G 3SEOA 2AEFA 4WYWA 3KK2B 4FVMA 2C3UA 1FRMA 3V4IA 2G0JA 5HROA 2NPFA 1FFSB 3KHGA 1WORA 5KFQA 2RDJA 2GAGC 3L95X 4USTA 5E41A 1N6QA 2IMWP 1KEKA 4EZ9A 1HPZB 3VALA 4BWJA 4JI2F 1Q5VA 2AQ4A 1PG5B 2YX4A 5IS2A 1RT1A 1YJNS 4W92B 5LSRA 4ATNA 4ILMA 2BKNA 4OMFG 4J9OA 2UZAA 2BW2A 4YOEA 3QNWB 1VGYA 2CXEA 3KG0A 3DLEA 4MK7A 2BE9B 5FD1A 4C8ZA 4O23A 2PFDA 3OSPA 3LP0B 4QWCA 3OFGA 3E01B 2P9CA 3CJ0A 3FGVA 3G82B 1X7VA 4ECYA 2ZUAA 2VU5A 1SJRA 2LEPA 4NZ0A 4DR4F 1RWXB 4FF2A 4EEYA 2E29A 1SC3B 6FDRA 4WKRA 1PO6A 5D0HA 1ZETA 2QE5A 4U95A 4B9SA 4OI3A 2MQLA 4USVA 2DH9A 5EX0A 2N3OA 2KT2A 1L3UA 2HWIA 3R2DJ 1S9GA 3I0SB 2BX6A 4J9LA 2HLTA 3TUZC 1VIXA 5KG0A 1H73A 2WCXA 5CABA 5K14B 1XNRJ 5H9FK 4DV1F 2RDIA 2D9PA 3MAHA 3A1YG 2MKCA 3DXSX 4NZ6A 3TUIC 4DBQA 3EPGA 1OY8A 2DGTA 4I68A 5KG2A 4IOAQ 5C5JA 2M4MA 2UUTA 2QLBB 1GX5A 4Y2CA 2VFTA 3CNQP 3QGIA 4F04B 3SV3A 2A1BA 3CULA 3MMJA 4QR2A 3HO1A 3HHLA 1YGYA 3OTOF 4OHZA 2F7VA 4JI3J 3DHXA 4X64F 1KN6A 3NCRA 4B3MJ 5KFKA 1IBLF 2Y1LB 4UUWA 1KONA 8ATCB 3T1YF 1VC5A 1AZSA 1ZM3A 2GIFA 2OD6A 4HI2A 1WF1A 3VVTA 1WI8A 1BQMA 2V4QA 5CYQA 1CQNA 2DHGA 3VGUA 4DU7A 3M2RB 2LEBA 4TU9A 3Q22A 2ZJQQ 1SV5A 2YWWA 3KLEA 4XIUA 3VAGA 2FD2A 2W7AA 4I2QA 1V5IB 1WC5A 2BQ3A 1RAAB 1WEYA 2EC0A 2K1RB 2BACA 1FRLA 2MXYA 2A0FB 3RRHA 1VRUA 4KT0C 1F5CA 2ZOFA 3FVYA 1B7YB 3E01A 3CF5Q 4ZPBA 3CJSA 4J9RA 4KSEB 4W98A 3RAMA 2ZE2A 3UDLA 1YIJS 3FRZA 1TZ0A 2MHNA 3W62A 1F3VA 1TL1B 4BLGA 4A8SA 4YY3F 1FRKA 1QUVA 1TKXB 3LALA 4DDFA 4DEZA 3PTWA 4X4VA 1CS4B 1JJHA 3BQ1A 2PSZA 4NCGB 2LLZA 1PCAA 1I5OB 3U27A 1RWVB 1FHTA 1RE1B 2A3JA 2KRBA 1CJKB 1FKPB 2VZ9A 2O3DA 1S99A 3WC0A 5JMNA 4ICLB 5IFMA 3MUVP 2QRRA 2XULA 3J7A1 4ALZA 4BC9A 2ASDA 1N52B 1N0UA 2MZQA 2PE8A 2ZBPA 1RLCL 1MW7A 3QWPA 5E7OB 1T8EA 3J7YU 4B9VA 5ETTA 2CRLA 2B9XA 5C2GA 5GAEU 2XMAA 1ZM4A 1QAIA 4DUZJ 4EI2A 2YWKA 2BDPA 1TMMA 4PYAA 5D4NA 2G1DA 2DJWA 4O44A 1RT3A 4A47A 4M5LA 4OV6A 4F0MA 5DJBA 4HH0A 1YX2A 3HZGA 4JI0J 1KVJA 3SQGA 3CDEA 5D0GA 2M8DB 3VZIA 3KUHA 1W26A 4DQQA 1P6TA 4Q45A 3OSNA 1RTDA 2DEIA 2RQKA 2E44A 1QVFR 5IT4A 1YZ6A 4PXEA 3LW5C 3O2IA 1F9EB 4ZCLA 2KB2A 4V19J 5GADI 2BW7A 4NX9A 4P10A 1FXRA 1PKUA 4OZ2A 2X1GA 1LV5A 1GTHA 3SMZA 2MTLA 1Z2ZA 2ZWPA 4GC7A 2U1AA 5SZTA 4NCAA 1N36F 4B08A 2XWYA 5C42A 1LOUA 3TX8A 3M7VA 2ZJRQ 2ATCB 3ZTSA 1Q0NA 3M8PB 3RRKA 3BKUA 4CLKA 3ADAC 5LSLA 2W9BA 1UA1A 3QT5A 3BDEA 1UVLA 5AE2A 4KV8A 1N54B 2H48B 3AH6A 1JLCA 2LU2A 4KH0B 4OYZA 5F0UA 3CCES 2V5HG 4ID8A 4X4NA 3CD7A 4DL2A 1J5OA 1TFWA 4R8UB 3IP0A 2D9OA 1RBOB 2HZCA 4USUA 3UR0A 1FEEA 2HFNA 2V67A 3MCOA 5FDLB 5IQQA 3RJMB 1XR5A 1KS2A 5MLCV 4L75A 1VQ9S 2ZBIA 3D68A 1NM2A 3T6BA 3I4HX 3FBFA 4I1TA 1VQSA 2BUNA 4P2SA 3KHRA 4ZA1A 3KLEB 2CPZA 3SSSA 2QC3A 1KLNA 2Z30B 1WC3A 2FLLA 1J5EF 2AX0A 3MM7B 1VBXA 1YDLA 3M2UA 3NXZA 4DR6F 2IA6A 3HVTA 1EP4B 3PJXA 2OGUA 4WXWA 1NJIT 4DR2F 2UUCJ 1ZZFA 3PZPA 1E6VA 1SC1B 2GGPA 2JNJA 3PACA 4I7FB 4E2FB 3FBCA 3FBEA 1VQ5S 4K50A 3N5FA 4PG7A 3SQGB 4J9MA 2RS2A 2Y0SD 1MLAA 3HULA 5A6WA 5AJ3J 1TL1A 3FKBA 1FFWB 2VFUA 3PYEA 4I56A 4LRAA 1RCXB 2W24A 3QBCA 1XR7A 4QQBA 1G6BA 1RWOB 4Y00A 2R2SA 2EI5A 3RB4A 2BBEA 5DETA 1TU0B 5KFPA 2H5JB 2ZH2A 2HGMA 3LP2A 3QLHB 4WU2A 5LOQA 1O0PA 3LPYA 5E2QA 4OYWA 4ZVRB 2BXJA 2HRYA 2FTRA 3A4TA 5D8HB 2XS5A 4P52A 2EK1A 1C1BB 1OS5A 2CPYA 2X1BA 4I67A 1WTBA 1FRHA 4DL0C 1K9MT 3TP2A 2E9TA 5A2QY 1Q4RA 1Y9OA 3TJAA 3NAIA 3B82A 4DQSA 2LDIA 4CLYA 3T5HA 4NCBA 2IPOB 3G96A 2HGLA 1HKAA 1FVQA 2ZKTA 3DFEA 5BYSA 1JLFB 2ZNYA 3DC2A 1ZPWX 3HDSA 2RU9A 2Z2MA 3EZOA 3W9JA 2XY6A 2JC1A 1BLUA 1WF2A 1C0UB 1UWBB 1HMVB 1HBMB 3W64A 3PR4A 1VIOA 1CEZA 1EKSA 1FE0A 5J1NA 1DARA 2M8HA 1GMWA 1ZAVA 2RILA 3IG1B 2OPRA 2VJUA 5H9EK 1OY6A 3MEDA 3IXQA 5T41A 2QSFA 3PW5A 4FPIA 2DPIA 1SB6A 3AQOA 3VV2B 2Q79A 2R42A 1MNEA 3DRPB 3IS9B 5HK4A 2D69A 2GQCA 2J7UA 2ZC4A 4TKTA 5I3UB 3OL6A 1JX4A 2IDEA 4O3PA 1VDHA 3W9IA 2YKQA 1FE4A 5DS7A 2AMCB 1XERA 4AXIA 5CYJA 3DGPB 5DDRC 3A13A 1VMBA 2K8GA 4NYPA 1HR0J 2DGUA 5DZ6A 4CM2A 4ID5B 4AD6A 5H9FJ 1U09A 3BSOA 2G2ZA 3PRDA 3KTQA 4AL6A 4FKXA 3BYPA 4NWBA 3H2LA 2E1RA 1KHWA 3IM8A 1E6YA 1RHJB 3BQ0A 4ED1A 4R5PA 4LFCJ 3VVUA 2EFVA 1XJWB 2LCWA 4BC7A 2WONA 3NWRA 1RWKB 2NUUG 2WVFA 4CO1A 4DFJA 2HVDA 4LFBF 1B70B 1WOSA 4PUOA 1NZ8A 2YQ3A 2V2KA 5KFIA 5K8PA 4LSNA 2R7WA 1U47A 1T03A 2OHDA 2C3YA 3N6MA 1NJZA 1VK3A 2XNQA 2ERRA 3TO8A 1N5VA 3HM9A 4UY85 1L3KA 4OYPA 2J0QD 1FI4A 1XBWA 2VFRA 4L72B 2XMUA 4OYAA 5ADZA 2AGPA 2IAJA 5L8RC 4EWTA 1T02A 2FY1A 1IKVA 1WG4A 5HMWA 3KNAA 1RAIB 4S0MA 3SBMA 1UWBA 3KLHB 2VHGA 1SL2A 3TUPA 3UPFA 2CZ9A 3QFWA 3UO0A 2H65B 1X0PA 2MGZB 2VBYA 2PN6A 4ZPAA 1DURA 1MMDA 3NP5A 1YRTA 3WBZA 5L39A 1A0OB 4U7CA 5L1JA 4ZLPA 2XWXA 1Y5NB 5KFEA 2B5JA 1NK4A 1IM6A 4G6VB 2V6AA 3O5TB 1JK9B 1S7HA 1TVRB 3DCAA 4MAKA 4RW4A 5I3QA 3NOGA 4OJHA 4WTOB 2QA4G 2OTJS 3GWCA 3LGMA 3GIMA 4Q7AA 3QGGA 2QX0A 1RQ0A 2FVCA 4ZN3A 1VBKA 3DI6B 3G8SA 4ID5A 4GRSA 1VRTB 1NNDA 4PWWA 3G6ES 2KZMA 2YX1A 3EX7B 3H7HB 4ILLA 2JEJA 4BCAA 4CCHA 4HACB 3ILIA 1X5OA 1RAHB 3FMWA 3GMGA 1QAXA 4CH0S 3OJUA 2W9CB 2IRXA 4KGXB 3MPDA 3BO4A 2XC9A 3RB0A 2AIRB 1TP7A 3DRRB 3ETMA 5D4LA 2OELA 1V3ZA 3TZXA 5DQGA 1WSRA 3N4WA 5HQ8A 3NGUA 3D54A 1FJEB 2AT1B 2E5JA 1WSVA 2IIHA 3FMBA 1OSCA 1T0TV 4N56A 4OHVA 5KFOA 5CD4A 2X1FA 1NEEA 1M0SA 3C66A 4F67A 2OPRB 5ETLA 3C6UB 5BYRA 1EETA 4DFKA 2OEKA 1YI2S 2KHDA 3NL0A 1U48A 3BN7A 3DRPA 1UJ4A 3CC2S 4JP8A 5KFMA 2FVPA 3CC7S 4K4ZA 2IM3A 1U1LA 5HATA 3TAMB 1S1UA 5HROB 2DYAA 4CO3A 5A2QU 2OTLS 2L3MA 4B9TA 3HJFA 2KKHA 1WDDA 2LA6A 3ZFVA 3KLHA 1OQ6A 4OYOA 1JMTA 1GQEA 2ZC3A 4ED5A 3PCOB 1NUEA 4L74A 4ILRA 1S1XA 3SIPB 2R7UA 2X7IA 3OT9A 2L41A 4F50A 3DU5A 4CO5A 4LT6A 4DPXA 1CJTB 4K4XA 4EBEA 2Z56B 3KK3B 1CC8A 5FLXU 1TQLA 3BO2A 3HJVA 2R2RA 1ZA2B 1C1CB 4RW7A 1YJ9S 3SXLA 4RW6A 3F73A 2W2OP 4Y2IA 2NSCA 3JTOA 2JLFA 1A9NB 2GJIA 2HPUA 2VC0A 4CDIA 2HMIA 4YB6A 1VQOS 2HNDA 2B6AB 1MU2B 2IC3A 2CNKB 2ASJA 5BYQA 3RR8A 5I42B 2CQGA 2MY8A 4DJBA 1J5EJ 6FD1A 2W9CA 3GP9A 3ITHA 4C0BA 3G4SS 3T19A 3W61A 2J6SA 4UY8T 2UXBF 1S4EA 1QSYA 4C7QA 5J2NA 2KT5A 2NYHA 3H2UB 2FHKA 5KFCA 4RNOA 2DNRA 2FJBB 2KM8C 3Q0AA 5KFYA 2CQDA 3AB4B 3BJYA 4QPTA 2ZH3A 3LO3A 1YSJA 1Q8LA 1YK9A 4J9UE 3BPSP 2J9DA 1KLMB 2C2KB 3HKZD 1RHQB 1Y0HA 3GCWP 2VQFF 3EDQB 3QRQA 5IC6B 1S79A 1SVDA 2B5JB 4DFPA 3C16A 2NLWA 4IRKA 1EAYC 2OPPB 1T11A 4RW4B 4DFMA 1RABB 1LW0B 3HSZA 3M8QA 7FDRA 2AJQA 1WKLA 2WVBA 2R7OA 4FXVA 3S6EA 3M8RA 1N32J 1AFJA 2I5JB 1M90T 4DCJB 4J9SA 5GMKa 5EWEA 3GQCA 1H2TZ 2D3O1 2ASLA 2VBZA 2B4VA 2CPFA 4IG0B 4EK2A 3QT8A 1JJCB 3RGIA 3VR1A 1HNXJ 1A6LA 1AZSB 1S1XB 4DL4A 2KHCA 2QV6A 3GFZA 4G1QA 5LT5A 4TQSA 1PC4A 4M5IA 2H5EA 1SV5B 4RW8A 2E9ZA 4DXLA 4DPOA 4CTAA 1V9OA 1WELA 3FRYA 3M9NB 1BXNA 4CLUA 4J7CA 1UEVA 3H5UA 1VBYA 4PXCA 2QFIA 3QQCD 1RT6A 3NBPB 4O0NA 1XMBA 1B99A 1CJUA 2OUGA 1KQKA 4LSZB 2DXFA 2W01A 1GK8A 4TVAB 1X4DA 4I4BA 2GS8A 2PFFB 3PO5A 2VPXB 2C3PA 1KBRA 3OFHA 2V68A 1U0HB 3U1LA 2HNZA 3E8OA 1HBNA 3S1TA 5HN0A 1RCOB 1GFWB 1I94J 4B3SF 4CT8A 2FHOB 1JXLA 2YKAA 1MN9A 1GT8A 3GJQB 1KKHA 1YJVA 5HQLA 3CD0A 2HAFA 4K5SA 3GV7B 3QATA 4KFBB 3NGTA 2G4BA 1CJKA 3DOMA 2QT7A 3M6WA 2YWHA 3BGRB 4N8OA 2RRNA 2NCKL 2WAQD 5HMYA 4Y34A 1SQGA 5B0GA 2RQMA 2V4JB 2UXBJ 2DR9A 2RUSA 2FVQA 2OMOA 4DZDA 1K47A 2DY1A 3MZIA 2H51B 2F63A 1KHVA 3CD5A 3OFFA 5LXRA 4CP5A 4X66F 4FS2A 5HL7Q 3CMES 4CT9A 4RUHA 3POTA 1IBMJ 3JSMA 4JV5J 4YEAA 1UFLA 4WE1A 1W25A 4A48A 2NXUA 5GMEA 4EYHB 4F4ZA 3QRPA 1UJ6A 5JUMA 4DV5F 1NKBA 1SKUB 3CJKB 2HNDB 2IC3B 4ZPVR 4FVCA 1VLYA 3Q8VA 4NYOA 5DG9A 4IH5A 4N5SA 3TW0A 4X62F 1UCNA 3GIKA 3MTJA 2DNYA 1X4BA 3AHPA 3ITHB 4ELVA 4IOBA 1HHQA 4URQU 4PPZA 4Y3CA 4YY3J 2HHHJ 4K4YA 2V63A 3ZZZA 3TZZA 1LXNA 1HNVA 1N36J 5ETQA 3IR6B 5IV3A 4F4KA 4ZDNA 2JDJA 2PEBA 5CD4H 4G3IA 3LGHA 1JLBB 1VYAA 3CVKA 4C11A 1DTQB 1N8RT 3PM9A 3HFZB 2PO4A 2C2OB 1H72C 3EVWA 5C2CA 2BVZA 2R8GA 3FCWA 3R97A 1NSPA 2PD1A 3MMCA 4B17A 1OY9A 5MAOA 3JYTA 1REVA 4ZVEA 4P7TA 4WXOA 3KK2A 4RBVA 1LW0A 3M8QB 3J81U 5KT6A 4CLWA 3PJWA 1HW9A 4UOCA 4Y6IA 4KGMA 2LXIA 2GMHA 1MMNA 4WFZA 5M2PA 4L3NA 4DV1J 3EGZA 4EUVA 2CJAA 1LFWA 4ZP6A 1A7GE 1ZAWA 1GXLA 1T05A 2I0XA 2IA0A 1DQAA 1JLGB 4DX7A 1O5JA 1LK7A 4CLPA 3DLBA 2V4JA 2EFGA 2ZOMA 4DL5A 2EFPA 2O01C 2UP1A 1FJCA 2IFXA 5GAHI 3CT9A 1HBOA 4TN2A 2BANB 5KOXA 1YHQS 2RNEA 1FKAF 3T3FA 3V6DB 4C8KA 2Y3YA 2IVYA 4FXDA 4QOTA 3H42A 4TNOA 4TY8B 3R3TA 1JJ2R 1JIHA 4H4MB 3HVTB 2HQDA 1HHTP 3ZZUA 2XM3A 2XMTA 3TUJC 4LF7J 3PYFA 3BR8A 3ILLA 3SYZA 4ZHRB 3FSXA 4CH1A 1UWAA 4M5MA 5B0BA 2KO1A 2R2UA 1XMOJ 2WVCA 2E9RX 1JNZB 2HFOA 2ZD1B 3ET6B 2ZEJA 2OAUA 3QZ8A 3QLHA 2VD3A 2RT3A 4WP3A 4M5GA 1S9GB 2LQJA 1SUQB 4TYBA 4ZVPB 1HPZA 5ETNA 1FTRA 2CQ3A 1URRA 2I9SA 3L7PA 3VAKA 1FD8A 4C11B 2PIIA 3HPOA 2ZHOA 3HCXA 2C22A 3MDFA 1KSPA 3OW2R 2J9CA 3ENAA 3O44A 3AJDA 4OI1A 1QAJA 1N0VC 2ACMA 3DMJA 3MMBB 4NE9C 5F9LA 2ZH4A 3GSIA 2DGSA 5M2RA 3RR7A 3BS9A 3KJVB 2W2QP 1FKOA 1EX8A 1M1KT 3AT1B 3J80U 1TK8A 3R5GA 4ECRA 1NPKA 5CA5A 2OPQA 4NPOA 4U8YA 2IVFB 2RDDA 4UOGA 4MIWA 2X1AA 1YBTA 1UEKA 3FFIB 4JI3F 2RE1A 4J90A 5ETOA 1JLQA 5DDPC 3RW6A 2D3ZA 2AW0A 5EUHA 1X9MA 3RAXA 5KFXA 1WHXA 3VAIA 2OPSA 1SJQA 1QTMA 2XZWA 2VIHA 2K3IA 4TLQA 1FRIA 1ZM9A 4I0WA 1HBOB 5KFRA 4DV0J 3R6GB 4ER8A 2VODA 2ZVIA 3I0SA 4O3SA 4LVNP 4TY8A 3N28A 2MQMA 4L73A 3MEGA 5AJ3F 2AGOA 3OXGA 4AL7A 3DOKA 1RT7B 1VCTA 4FZVA 3ISZA 3LQVA 1PJ5A 1H38A 1VQ7S 1IUJA 1R27B 1LWFB 1RAFB 4JI1F 1S4FA 1FERA 2MEWA 4Q5VA 1N34F 4PWDB 2MKSA 3CD6S 5BJRA 1U7LA 2DB1A 5F8IA 1CPZA 4R5PB 3BV8A 1VQMS 1DQ9A 2U2FA 4C8NA 3L3CA 2LQ8A 4DV4J 2W2NP 2J0XA 1FKPA 5KT3A 4OX7A 3C6TA 4OFZA 3D6TB 2XS7A 2XS2A 4DSIA 2FY8A 1X5SA 4WJBA 4C3LA 2H4YB 1M1GA 2Y1RI 4M1KA 4ZVOB 4TU8A 2B4PA 2OEJA 1FEHA 2EK6A 3UW1A 2CQ2A 3BF4A 2V8VA 4ZN1A 1VBZA 3GR1A 2HBYB 3TZYA 4NI2A 4P9SA 3Q24A 1HI1A 3VF0B 3UN3A 3ZNUA 4ECVA 3IRXB 4F2SA 3T9NA 3D1OA 3L9ZA 5E3QA 2IRYA 3EPIA 1IKVB 3H5XA 2ZBRA 4HH1A 5CCLA 4B3RJ 5K8OA 3H8YA 2DGVA 4DQRA 1U1MA 2P9GA 2G9OA 5HP1A 1Y00A 2MQ8A 5J2MB 4NZ7A 2M5YA 3I82A 3OD2A 3UWTA 5AE3A 2Z2LA 3NGKA 4P2FA 3CCJS 1C4AA 2D3OR 1U1OA 2DNHA 2KT3A 1BE4A 5G0RA 5B0FA 2VJVA 1TR0A 2M52A 4TYAA 1MG7A 3WQPA 3N79A 2M0GB 3I96A 2Y8WA 2VDIA 4PWUA 4YQWA 3PR5B 1AXQA 1KQGB 3C14B 5IT9U 3P4UB 3N0VA 3TRGA 1DHMA 2KYZA 3S7RA 5F8HA 2KTQA 4CM0A 4DUZF 1XMQJ 1NLKL 3MMBA 4RZRA 1ULRA 4QBUA 3B54A 2FGOA 3SCKE 3HD2A 2AHOB 1NHKL 1EIYB 1ZOTA 4O44B 1YJRA 2WVDA 3NGRA 2W8KA 4M95A 2Q43A 3JXOA 2DGOA 3UE2A 5AE1A 5B7WA 1J5OB 3PRVA 4B3SJ 2BE7D 4B9MA 3QSIA 3IFEA 1J27A 1KWMA 2XZDB 3BO3A 4YR0A 1HWKA 1HNZJ 1D9FA 2VL1A 3DRXA 4NLXA 4U9RA 4CLTA 4DN0A 2Q6CA 3K59A 2YKPA 3CJTA 4I2PA 3P8BB 2BOPA 2HHQA 2G13A 1QE1A 5KG6A 2E1CA 3QJPA 4ED7A 4H4OA 2VKZG 2KJWA 2KG0A 2FLNA 3KLFB 4DV7F 1U6FA 3PKMA 1FXLA 1RAJA 2XG8A 3MI7X 2C2RA 4LMZA 4PQUB 3K5PA 2K2PA 5DZ7A 4DMZA 1R0AA 4HT5A 1EJ7L 4IDKB 1BMQB 1SJ1A 1R89A 1WKKA 4KE5A 3D0HE 4UTGA 3V6JA 1LWEB 2NPIA 3A8IA 5D78A 5KTQA 1X8DA 3JQJA 4KIAA 2W9BB 4C0HA 3JB9k 2PMHA 2FLOA 2MQOA 2ZUGA 1FX4A 4Q8FA 3GV8B 1JKHA 2KM8B 1TFYA 2BJ8A 5KFUA 1N6QB 3PY8A 2BM0A 3E2EA 5FIIA 2B9EA 3GE9A 4V19X 5J1EA 2KRRA 2CNLB 2IJFA 2LQBA 3FQLA 3NEKA 1WNEA 2VH7A 3VGVA 1QVGR 3BZQA 1WI6A 3QO9B 1GTEA 2LQ9A 4UQTA 3CCQS 3MEEB 3B4MA 2PEHA 2QN6B 5JJBA 4Z7CA 3NG8A 2GA7A 4UUXA 5F3TA 3UCGA 4F02A 3DN9A 1F9FA 2W2PP 2QA4S 1M5HA 3D3BJ 4Q0BB 3WZ0A 1MWZA 2J6UA 2OFHX 4FYYB 2PI5A 1NPPA 3CCLS 1IWGA 1HBMA 1HMVA 4LRCA 2QL9B 4Y2AA 3PIPQ 1SIWB 2AJFE 4DV3F 2WB4A 3V6KA 3K8VA 3WHIA 4GKKF 4W90B 5LMUF 4J91A 1DZ5A 3TANA 1QM9A 4JI7J 1R8HA 4X4OA 2YPYA 4YN3B 5E33A 4D3HA 2CNNB 4JUZA 1EHWA 2D41A 1RT5B 4DR5J 3KLIA 5KFFA 2RF2A 2YQ0A 2ZZTA 3I9ZA 3KJFB 5KG3A 4GKJF 1J2VA 1ZH5A 3TWZA 3DKDA 1Y3JA 4N7TA 1S1WA 1HYSA 1HBUA 2AKWB 3I31A 1S7IA 5DG7A 4GMKA 5DO2A 1M5PC 2PDAA 1RZMA 4IFVA 3ONQA 1Y5LB 3HHLC 1JJ4A 5GADU 1S10A 2H54B 1QSSA 2QTWA 1T7PA 2FYXA 4DCPB 2Y1JA 1NKEA 4LF4J 3OTDA 2CG8A 2B4OA 1WC1A 4K4UA 4OL8A 3QYYA 3H25A 3M6UA 3LAMA 4OZ5A 4K59A 3EVOA 1KQSR 1H7WA 1CSJA 2CDQA 3QIPA 1O6XA 3IG1A 2R8IA 1WC0A 3UVJA 4NEZA 2KFNA 3MEEA 4DL3A 2GFFA 2JRSA 5BXIA 3HSGA 1JLAA 1QE1B 5KFLA 1RYSA 3Q2TC 1X5PA 4TU7A 4FS1A 3EWGA 1N5TA 2UUWA 4DX8H 2K1RA 3KLFA 4FKYA 4H54A 5CH7B 2CQBA 1R8AA 1C0TB 2A10A 4X66J 1IR1A 1RLDA 4J37A 4URGA 2FJAB 2NS1B 3DGPA 5HBMA 4JI1J 2RD5C 2XMKA 2P9EA 4DHVA 2MGZA 1CVJA 2ZVSA 1B0PA 1LWEA 4OZ3A 3QPIA 1YLXA 2XI2A 3X3UA 2V8DA 5F8GA 1TUGB 1Z2LA 2KXHA 3AXMA 5EGYA 1ZTTA 2LXFA 3MD1A 3TZWA 2AJ2A 2K06A 2MLYA 5HLFB 1RBLA 2CJQA 3K89A 2YBVA 5IWAF 1N88A 4ZPCA 2DCUB 2J5AA 2HQGA 2QLFB 3PV8A 4DL7A 3QO9A 3C15B 1QSLA 1HBUB 2ZH7A 1XWLA 2HQ3A 3GG1A 3WX8A 5LMNF 4ED8A 2XY7A 4NL5A 1B3TA 5IM0B 3OHBA 1ZBTA 3VTIA 2DNGA 2FB0A 3G9CA 2RS8A 3I4PA 2WB1D 3QT7A 2IAJB 1WG5A 1TELA 2J9EA 3K5OA 3BM7A 1Q1KA 2WOMB 1UEUA 5AXNA 2F8HA 2W7PA 4DLGA 1SKSA 5ETSA 2D74B 3IWXA 3AD7C 1L3TA 4ZVSB 5IT0A 2D7SA 1NHUA 2HZAA 2NQPA 5FJ4A 4DV6F 1RTDB 2Z2YB 4JI5J 5L1KA 4DPWA 3SQOP 3M2VB 1RDRA 3H4BA 3X1LB 1HL6A 3MMCB 4WZMA 2DHHA 4QWBA 4WP9A 1N34J 2V50A 2P6SA 3CJQA 3IR7B 4LF5F 1HNWJ 1OMSA 3VGTA 2GX8A 2ILYA 4P2MA 5HBMB 3VAFA 2BYCA 2YPZA 3AOBA 5D15A 5T7LB 1BQXA 4ZVQB 2W9AA 1VRTA 2D1CA 4QZVB 4EYIB 3UCUP 1TK0A 2YVSA 3DNCA 2RSQA 4M5DA 1KVKA 2EBEA 3E51A 4LBIA 2FQQB 5EWFA 1KR4A 1VHIA 4JYAJ 3P3DA 5KG5A 5IV4A 3V81A 3P49B 1ZS6A 2AJ4A 5LL6d 2ZHBA 1HD1A 1DJ0A 3W60A 3RZAA 5KT7A 3WIVA 3JAMY 2BV3A 4QYRA 1RYRA 1ZZNA 1BQNB 3D6HB 1TAUA 2W4PA 2FVRA 1S1VA 3KXDA 4IYQA 3OVAA 2YNHB 2HMIB 1PBAA 4MIBA 1T9WA 3VQTA 2DR5A 1YJ7A 3FSYA 4HL9A 3MR5A 3GFHA 3DM2B 4YP3A 1JQGA 4WFYA 1UVIA 2CPEA 2XQCA 1WTFA 1PYTA 2CPXA 3OR1A 1UW4A 1SBRA 4GVLA 2OKQA 4I7FA 4IFYA 4LRFA 4ZCKA 5KG1A 1RHMB 2YWGA 2H9ZA 2PC6A 2VASA 3KHHA 2Y9HA 4DF8A 2AWZA 5D4OA 1UMJA 1TKZA 5D6GA 4KTQA 2EBGA 4WK1A 4FBTA 1RT2A 1EARA 1UVNA 2Z58B 2CJXB 2RHQB 4RUBA 2GVZB 1RA6A 2XMMA 4JI8F 4P2XA 1JXEA 4ANEA 2V8GA 5F41A 5C24A 4KHPJ 4MYTA 1HNIA 3T5LA 3HT0A 3F41A 3H5YA 4OZLA 4O3QA 4NA1A 5BR8J 5IOLA 3CJ4A 4IOCQ 2DNZA 4CLLA 3MMAA 3T9ZA 1S0OA 3PYDA 2DXEA 3DRYA 3PX6A 4LR7A 3PYGA 2KDOA 2J8SA 3D0GE 5HMXA 3JAMU 5ETRA 4JBCA 2B6AA 4DPUA 4DZ6A 2CWKA 2BQUA 2WSEC 4JV5F 3AAWB 1SC6A 2RKIB 1OYDA 3VCDA 1T9TA 1FWKA 3GZ7A 4OI4A 1HWIA 2YNFB 4MIAA 2ZJPQ 1SJ4P 1WF0A 2WOMA 3RUBL 1S59A 4LF2A 1FDBA 4BBYA 2MKHA 1U6BA 4YDXA 3MEGB 2M88A 3KNGA 3O6QA 4BWMA 3PW4A 4YHHJ 4RW9A 1GH8A 5DDOC 3L7UA 3LOUA 5L9XA 2MHEA 4IQMA 2IM1A 4DX6A 1CULB 1QY7A 4ED0A 2J7WA 3TJ9A 2VC1A 4L3KA 4WCEQ 1DAXA 2UUBF 3HK2A 2CQCA 4C97A 1FRXA 1QJHA 3IS9A 3R27A 4MMOA 3TYTA 2JEFA 1H98A 1BHNA 3DM2A 3RBEA 4WTYA 5KG7A 2IBKA 4DSJA 2I5JA 3Q23A 3P5BP 3BYRA 2YY3A 2DEJA 1RWUA 3OR1B 4LRDA 4NEYA 2EFNA 3RG6A 1FDDA 3SI8A 2FLPA 2JFKA 4RX6A 1R43A 4M5DB 4MYUA 3G86A 3MPWA 1KRPA 2MLZA 1NK7A 1M5SA 3M1VA 2HNYB 3DYAA 4DWIA 2V8HA 4B02A 2RQCA 4B3MF 1F1BB 2B0GA 2GMJA 2MMYA 3W66A 4Q44A 4Y2MA 4TY9A 1R6YA 4B9LA 4WE1B 2VQEF 2WK4A 2FHJD 4TXSA 4DI6A 4PG5A 4PUOB 2BA9A 3GR0A 1YG0A 2X51A 4G1PA 4Y2KA 1V6HA 2F4VF 2J0SD 2C3MA 2O66A 4DR7J 2YNHA 3SSRA 3KJQB 3J7ZT 2JSXA 3IWLA 2IVMA 2DGQA 2EG1A 3LA0A 2CNOB 4WP8A 4F36A 2QJ3A 3D1QA 5DRKA 3HZEA 3R5BA 5GAEI 2FZKB 1YKWA 4RNHA 2ZM6J 4DOZA 3BPDA 3FZBA 5AXLA 3HX9A 3KMQA 2N7YA 2KXFA 5HO4A 1N5YA 2QG9B 3W8GA 1C4CA 2DNLA 4NYZA 2FJWA 3BGRA 2MB0B 1JLBA 3UDVA 1EKRA 1NSKL 3FQKA 5KT2A 3TI0A 4F0KA 1RT2B 3CW2C 4KB7A 2GO8A 4MJKA 5LM7E 3JSRA 1Q95G 1SH2A 3HI9A 1VFJA 2A6OA 2CJBA 4AQYJ 3RTVA 1F60B 2YNIB 3DDNA 1REVB 1TVRA 2JWNA 4LR9A 2C2ZB 3LWLA 2HBRB 3POTB 1X4EA 2CZ4A 3K57A 2V69A 3W63A 3OLAA 3BGOP 2AU0A 3A3PB 2WBRA 3MECB 2NXJA 1OPZA 4CWBA 1TL5A 2A2CA 2EPIA 4QW8A 1S9EB 3MGJA 2V9WA 4B3OB 4KJIA 2VDHA 3KK1A 1S6QA 4QR0A 4IR9A 4OHYA 2ZOGA 3AY0A 4KH1B 5LMNJ 1U6ZA 1UZHA 2XSFA 3CCSS 2VG7A 1WG1A 2V2VA 4U67Q 4FP9A 2LA4A 4ZCMA 3GSDA 2GVDB 1S6PB 3IGVA 4YUDA 4GVBA 3THPA 3TNVA 2YX7A 2M70A 4RW9B 1ZTWA 2E5LJ 1QLNA 1X4AA 2VPYB 3EGWB 1U24A 3QWUA 5KT4A 1UKUA 2DNPA 1D8YA 2CFXA 3CTRA 2UV8A 3SFGA 4RU9A 1WOPA 3R1LA 4JV0A 2QLJB 2HIYA 4F4WA 1YRXA 3BBCA 4AL5A 4DS5A 2QZ8A 3GFXA 3Q83A 3TAMA 3UR3C 2QFJA 2CAJA 1WDTA 2AYGA 2KZZA 5D4PA 4F26A 1NDCA 4R0JA 1GMUA 2WSCC 4CI0B 4NCGA 3MUMP 4M5NA 4ELUA 4NRUA 4J9KA 3HSJA 4ES3A 3IWNC 3DRSA 3G8TA 2L9WA 4JYAF 1M5OC 2MKJA 1AT1B 2ZHAA 2BZ2A 1Q5YA 5D0EA 1I51B 1V5VA 3FCHA 2FPHX 3HVAA 5GAGI 2HNYA 3DYAB 5ETMA 2BANA 2IYIA 2YNIA 4I2QB 2UVUA 4O4GA 3K2YA 2R8KA 2MZRA 2JOQA 3Q8YA 2PMWA 5DGAA 1FD2A 4C3MA 1GNKA 3HHEA 2B3TB 3BGLA 4CNZA 2VOPA 5KT5A 3WC2A 2CIMA 5CZXA 3AXKA 1D9AA 4ECSA 3PX4A 4RWXA 2AJ0A 5HVFA 1NB7A 4IRCA 4K4SA 1REGX 4QYZK 1DQ8A 1NPRA 1FX2A 2P6TA 3KK1B 3K5MA 1U2RA 1HI0P 1I3OB 3A8EA 1RT5A 3JQKA 4CLZA 1LWCA 1NCLA 4ENOA 5L1IA 4TLRA 2LXUA 4QW9A 3K7RA 2KFZA 2XMJA 1IJEB 3JSYA 1U49A 4IRDA 4ICLA 4OI2A 3KDNA 3A8KA 2SXLA 2FC9A 4OJ3A 2E5IA 4RNMA 5J2QA 2WW8A 1ZAXA 1FNMA 2GIRA 2HFVA 3M8PA 4YDDB 4ED6A 3I56S 3KJVA 1IKXA 2XO6A 1D9DA 4KV8B 4X64J 1N5SA 3HT3A 4LF8F 2BMBA 4Y65A 3R8YA 1N4LA 4NMXA 3NNHA 3Q2SC 3ELHA 3CB4A 3MECA 3PJ9A 1N48A 5FDLA 3GYNA 4A8QA 1PAEX 2AV5A 1WKJA 3DLKB 1PILA 3R5AA 3IAS9 2BR0A 1Q7YT 5H1SV 2J6TA 5LMUJ 4ED2A 1R8PA 1R7IA 3ZTPA 3NAHA 4UW2A 2VOOA 3MM7A 3W5XA 4M8LA 4O4GB 1H7XA 4BHQA 3QGPA 1XR6A 2K7JA 1BC6A 1F5BA 4GVBB 3DOKB 4DV2F 2ZM6F 3JQMA 1X4GA 4RR5A 2HHTA 2HFUA 1SXLA 2GQQA 2BRLA 4KHMA 3CGIA 3OXLA 3ETOA 2HG4A 2RH3A 4ZJLA 3RYLA 4OX9J 4XDCA 3NS5A 1S0VA 3EZUA 2FGCA 4XAKA 3OR2B 2BJEA 4IUFA 3CE8A 3JSBA 3N6NA 5ETKA 3QJJA 1JLCB 1RTHA 1WEZA 3OVSA 2C1EB 4A8KA 1UW9A 5KFHA 5HLFA 1F5AA 1VISA 1SL0A 4R8UA 4ZITA 2XLKA 4ELTA 3AB2B 1RAOA 1RT4B 1H2VZ 1RHKB 3C6TB 3NKYA 5K14A 2OI2A 4F4AA 3NCQA 2MY7A 5C7PA 2DR7A 2OH2A 4HVZA 1RT1B 3VAHA 2CJ9A 3KLGA 3A3OB 3MEKA 1OIAA 4WK3A 4ZVTB 1JLEB 1S1TB 2VFVA 1VK8A 2DBBA 3H0PA 2JEGA 2DITA 3TVKA 4K4WA 2E1PA 3FSIA 2LQ5A 5CYMB 4CH7A 3VGSA 2HHSA 2YXLA 1IKXB 1LQ9A 2UVWA 1DFDA 1PJ6A 3BDPA 1QDUB 3JSMB 3IO1A 3PX0A 2UU9J 3ENVA 1TL7A 3GJSB 3T6JA 2KH9A 4NXMF 2C3OA 2HVHA 4ZCIA 3JTNA 3RB3A 4P7VA 1RU1A 3QFHA 1O8BA 2YKMB 3M05A 2AJ1A 1BQMB 1G4CA 2HWTA 2F3JA 3SFUA 4USJC 4EBDA 4K8RA 4U7UD 3ZZ0A 4GKKJ 3MAAB 3AODA 4I2PB 1UVKA 1T95A 3GYGA 3W8PA 3OTOJ 1XMQF 3CEDA 2G2OA 5G0RB 2EKNA 3FDSA 3VAMA 1XMOF 5A8WA 4OI0A 4ZOSA 3I55S 5J2PA 2VA2A 1HFEL 4ANCA 3AFGA 4OYMA 2JHEA 1C1BA 2HK2A 3IBCB 2EXUA 3KUEA 3LH2S 3BGUA 2RRAA 3C14A 3ISNC 1R0AB 4NRTA 4X65F 3CCZA 5A8RA 3KK3A 1RTZA 4HT7A 4ERDA 3M6XA 3TARA 3LANA 2Q1LA 4CO4A 4PXDA 4ZP9A 3VQSA 2UVVA 3OR2A 2W8LA 3GU0A 4MTPA 4ETXA 2DIVA 1CQMA 3LTOA 1CS4A 2EW9A 1VQ4S 3PDNA 1T9UA 4HKQA 1TL3A 2M3DA 2RAQA 2E7WA 2R7QA 4O4RA 4PCQA 1C0UA 4Q2LA 2HK3A 1B7FA 3SDEB 3UQSA 4EBCA 3Q8QB 1YTYA 2I38A 1TKTA 3BREA 3GPAA 4ZVUB 4ED3A 2HS0A 4NMLA 5CYQB 4F0HA 4RU2A 5F8JA 3MEDB 1T03B 2HHWA 2R7XA 1MSWD 4MH8A 3ILOA 4WIIA 2R4FA 2V0NA 5CXTA 2UU9F 3V6DA 1PC5A 2YNGA 4FNIA 6AT1B 2AZ3A 5I3UA 2B8PA 4IO1A 1NDLA 4GO7X 1FTCA 2AYBA 2DPJA 1KDNA 1GXUA 4PQUA 4LIWA 2ZH5A 2XCPA 2GC8A 2JZ5A 5D0RA 4ZHRA 5F3ZA 2UXDF 2PA3A 4W4MA 2MYFA 4IG3B 1FRJA 2LVWA 3U1MA 3DOLA 3TX0A 3CIMA 4NLDA 2DRBA 8RUCA 4QU6A 1RUSA 2ZD1A 1XIQA 1RAGB 3E3XA 3ET6A 4HHJA 4C8MA 4RNNA 1IBKJ 4X62J 4LFCF 4MKYA 4K5RA 4DPYA 2C28A 2QLWA 3KLIB 5J2PB 1URNA 1ZA1B 2B8QA 4ECTA 1XQIA 5J1EB 3CCWA 2XTJP 1WC6A 2BJ7A 3NMRA 5KFZA 4WPAA 1U8SA 4FPRA 2DISA 1VRQC 5DM6Q 2Z8QA 3C2PA 2G0CA 4DV2J 1IR0A 3MAQA 2ROPA 3DLGA 2F65A 2W7OA 1DRZA 1VS3A 3I6PA 4HTJA 2HBZB 1GMWD 1H3DA 1UFWA 1DY3A 2OD4A 2HS4A 2QO3A 3D67A 2RKIA 3EUNA 5HSPA 5LXYA 2AEMA 5KFDA 1U0SA 4M94A 2FUG9 2WVEA 2XYPB 2OIHA 1RU2A 2CPHA 2MJUA 2AF6A 2YNFA 2R9LA 4P6QA 3QSYB 1MWYA 4LSLA 1K0VA 3SDEA 5EN1A 3IA0A 1F6TA 4L6V3 3GIIA 3BH7B 3MM5B 4LREA 2BM1A 1SPBP 3G6XA 3J81j 3DDKA 3GLJA 4KKOB 4ZP8A 1TAQA 2BOAA 4LUBA 2MZSA 3PXGa 3J81Y 1I94F 2R2TA 2FZGB 2R8JA 2IYGA 4DV6J 2OSRA 2XSJB 1EQMA 2KU7A 2DRAA 1S48A 3BKTA 1Q53A 1K73T 1Y4ZB 4MKVA 4CLSA 4TQRA 3M2UB 1XTZA 5KFTA 1Q82T 1S1UB 2DR6A 2XO7A 3M8SA 5A8KB 4K0KJ 4KR0B 1RAEB 1E6VB 5HI7A 1SKRA 2QSWA 1FJ7A 2DNMA 2DNKA 1HYSB 2ALYB 3DI6A 1WHVA 2W25A 4RL1A 3M9MB 2DGXA 3PEHA 3MM9A 4E0DA 1L3SA 2KXNB 5E3AA 4FYVB 2NYIA 3NGDA 4JI4F 3UI3A 3EGNA 1TL3B 3H20A 1UVMA 2LP4A 3DLHA 1RA7A 3NS6A 4GO5X 1RJJA 1QAYA 3CSKA 3CJ8A 1AYEA 4RW6B 4PKDB 5JXSA 4ZJQA 4C8OA 2KL8A 3K0JA 2MSSA 2VF3A 2COLA 4X4PA 4OYXA 1JNRB 3GFYA 2YWFA 3ILJA 2BRKA 1LWXA 3UVJB 1Q16B 4WFNQ 1U1RA 1UVJA 2B56A 3Q89A 3UD5A 4ZMMA 4QPXA 1P9YA 2MDAA 3W2WA 3A3NB 3F56A 2JLGA 5HMZA 2DO0A 3F44A 1R3NA 3HFKA 4LF1A 3IRWP 3IR5B 4AYBD 3IRXA 4DSEA 2NSBA 4MKBA 2K7KA 1C0TA 2LDYA 4LF9F 2HSEB 2GGPB 1HHSA 1FFGB 1RKIA 1P27B 3MPUB 1SCJB 4HHHA 3MR6A 3CJ5A 4PRFA 3BBFA 4JV1A 3EDRB 2DH8A 3KLVA 2VBXA 2C42A 2Z4PA 3W1YC 2HHPA 4NXNF 1KLMA 1OYEA 1D09B 1IWAA 2DK2A 2F40A 2RIJA 3MM6B 5F0WA 4ZVFA 2HKEA 4NLQA 1FO1A 4U96A 4DCOB 5J2MA 1G7CB 1U1KA 3MR2A 2OPPA 3OTEA 3OL9A 4F7VA 4A8MP 4RNFA 1K1SA 3RAQA 1XNQF 1P1TA 4B3RF 1WUUA 3SCJE 3RRGA 2AYMA 4CYUA 2LU1A 3CDBA 3OUYA 4Y28C 3U02A 1RTIB 1SQFA 1UPMB 2D3UA 4WYLA 2J7KA 3TA2A 5KFAA 4YB5A 2HHUA 4R0EA 3UCZP 1S9EA 1M5KC 2GHVC 1P9QC 1Y5IB 3BH6B 4ES2A 2H4WB 4WWSA 3FEXB 4C6AA 3GIJA 4F2RA 2IRUA 3MM9B 4C48A 3RBXA 1VOMA 1VQKS 1HIYA 4X4TA 4B3TF 2NZ4A 1KFDA 2GVDA 4KRWA 1U2CA 2GMLA 2YQ1A 1BQNA 5I3PA 2QLXA 1CJUB 8AT1B 4CIOA 3SCIE 3IN5A 1S0MA 4Q2MA 3CDAA 2B4UA 5E5NA 2AEJA 4N8NA 4QIVA 3W5ZA 4JI0F 3PIOQ 1KP6A 1AUSL 1S1VB 2MZ1A 3ZZOA 4YHHF 4OJGA 3J7Z5 2P2CB 4J9QA 1D1UA 2HHXA 3NS7B 2BKOA 1YJWS 2DNNA 2NXEA 2WHOA 3NNAA 4QU7A 4A8FA 1AA1B 1R31A 3CO0P 1OWXA 4U7UK 3GJRB 3TA0A 1VJQA 3MM8A 5A0YA 4CZCA 5KAKA 1CLFA 1ACMB 2LFVA 2IM0A 2P5VA 4LRBA 1NU4A 3ZZPA 3M9OB 4LFAF 4LF9J 4DU8A 4P74A 3K5NA 2HVIA 5SUHA 1KOHA 5LSOA 2VICA 2DHAA 4IQXA 4OLPA 2DH7A 1N33F 2I8EA 2C2NA 2DY9A 1CBKA 2DCLA 3M30B 4JI6J 1KTQA 2QYGA 1LEOA 1HNIB 3UFCX 3UN5A 2CPDA 3AJ1A 4P71A 4C3KA 3OFEA 1F2HA 2QMXA 3G2XA 1RT6B 1PJ7A 4RJVA 5GMDA 4DR4J 1U02A 3FBBA 3MMAB 4N76A 3KDOA 3AOCA 3W2VB 4ZLLA 5DQHA 3PW7A 1B0TA 2Y0BB 4ITSA 3W2WB 1NJYA 2IY5B 4EU0A 1U0HA 2CPJA 3ZZYA 4F25A 1P1LA 3ICLA 3SZ2A 3PVXA 2ZZMA 1FDAA 1X31C 1NO8A 1Q8KA 1RWPB 2EWHA 3NRBA 1NH7A 2QIFA 1LWCB 2UUAJ 3W3SA 5ETVA 4AUKA 2OP5A 2CWXA 3WDOA 1L5UA 4KY3A 4NLWA 3W5YA 3EYZA 3DOMB 4NLGA 1KVIA 2O1PA 2HFZA 2RHSB 2L9NA 1MMLA 1IBLJ 2B9YA 1S6OA 3MF5A 2H3EB 1LK5A 5CQGA 5A6PA 1RI7A 3UD4P 1CULA 1JB0C 1IQZA 1T94A 3MM6A 4HHUA 2CQHA 4A4JA 7FD1A 5KFBA 3CMAS 1PYOB 3KFWX 2VQFJ 2GV1A 1S76D 3M4XA 1M5VC 4ETZA 1PAUB 5A76A 2HFSA 2YKOA 4LF7F 3MFIA 2AX1A 2FVSA 2XGQA 4EO8A 4DR5F 4URSA 4ZPDA 2XNRA 3O3LA 3HVWA 2KYXA 1BD6A 5JVGQ 5CHCB 4EZ6A 4ECZA 4JI7F 3IMQJ 3IC1A 5D3GB 3UN2A 2IHR1 2E1MC 1FJGJ 4F3MA 3THVA 4KBIA 1PSDA 4V1Ak 4UZCA 5KFJA 1B4SA 1DTTB 2MLXA 3AA9A 4ZLNA 2I6WA 2WSFC 5KOWA 2JVRA 5GAHU 2J9DE 1SC4B 1U25A 3DRRA 3C19A 3QZ7A 3NLCA 4PG4A 2DIUA 3V5RA 4PEOA 3WIUA 2XGPA 3B8HA 4X4SA 3RB6A 2OJ3A 4YMEA 3Q8UA 2XBPA 1X4HA 1VHFA 4KO0B 1QTNB 1VRUB
chains in the Genus database with same CATH topology
4K8RA 2W2QP 2W2OP 2Z57B 3VV2B 1ITPA 2XTJP 2QTWA 3AFGA 4JP8A 3A3OB 3WHIA 1V5IB 2Z30B 3A3NB 2ZWPA 3CO0P 3GCXP 2Z58B 3VHQA 3WIVA 2E1PA 3T41A 2Z2YB 2W2NP 4YN3B 1R6VA 3SQOP 2ZWOA 2PMWA 3CNQP 4OV6A 1SCJB 3BGOP 3A3PB 4NE9C 3QFHA 2Z2ZA 3WIUA 4NMXA 2W2MP 2Z56B 3BPSP 3H42A 1SPBP 3P5BP 3GCWP 2W2PP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8R A;  2W2Q P;  2W2O P;  2Z57 B;  3VV2 B;  1ITP A;  2XTJ P;  2QTW A;  3AFG A;  4JP8 A;  3A3O B;  3WHI A;  1V5I B;  2Z30 B;  3A3N B;  2ZWP A;  3CO0 P;  3GCX P;  2Z58 B;  3VHQ A;  3WIV A;  2E1P A;  3T41 A;  2Z2Y B;  2W2N P;  4YN3 B;  1R6V A;  3SQO P;  2ZWO A;  2PMW A;  3CNQ P;  4OV6 A;  1SCJ B;  3BGO P;  3A3P B;  4NE9 C;  3QFH A;  2Z2Z A;  3WIU A;  4NMX A;  2W2M P;  2Z56 B;  3BPS P;  3H42 A;  1SPB P;  3P5B P;  3GCW P;  2W2P P; 
#chains in the Genus database with same CATH topology
 3GTY X;  1HI8 A;  4LQ9 A;  4ZJO A;  1FA0 A;  3TA1 A;  2F9D A;  3L4B C;  1YRU A;  4NLP A;  3ZNJ 1;  2GJ2 A;  1Y3K A;  1BUX A;  1TKX A;  4H4K A;  5B08 A;  1NJX A;  1O51 A;  4USK A;  3IM9 A;  3T41 A;  2NZC A;  4JI8 J;  3MM8 B;  5A0Y B;  2GIQ A;  1K0T A;  1LKZ A;  3CCU S;  2IJR A;  2VA3 A;  1SUQ A;  2A2D A;  2HUR A;  2G0I A;  2RB7 A;  5ETP A;  1Q8I A;  2Q3P A;  4WIQ A;  1S12 A;  4OJ1 A;  1IKW A;  2E5G A;  1T9V A;  2B7B B;  1FCA A;  1CJT A;  3M1V B;  1YVF A;  3GV5 B;  2DO4 A;  4KPY A;  4XPE A;  1S57 A;  3C8Y A;  3TOQ A;  3BSN A;  1Y11 A;  3OVB A;  3FCV A;  3I32 A;  2A6M A;  3L09 A;  1S72 S;  3MPY A;  1RT3 B;  5DG8 A;  4BS2 A;  4C8L A;  4FDF A;  2HRU A;  4HR2 A;  4FYD A;  3OHA A;  2GHW A;  2L08 A;  2ASY A;  3OQ2 A;  4KAI A;  5C25 A;  3AD8 C;  3HXM A;  2KVQ E;  1SJF A;  1UET A;  1JLQ B;  2YKM A;  3DGV A;  4DSF A;  4QWD A;  4NA2 A;  4JI6 F;  1U8W A;  4B3O A;  2V2Q A;  4HDG A;  2MST A;  3W65 A;  1UFK A;  4USM A;  2QMW A;  2VG5 B;  2ZBQ A;  2R8H A;  3CPW R;  3MHY A;  5J2N B;  2FIU A;  4OX9 F;  4PAA A;  4DR1 J;  3SSQ A;  1VQP S;  2PT0 A;  2ADB A;  2WRM A;  2ZH8 A;  1K44 A;  2XYH B;  3H90 A;  4QIW D;  3EGV A;  4LFA J;  3I9V 9;  2XLI A;  4X4U A;  2BKP A;  1GEH A;  3TQE A;  3NBP A;  3M6V A;  2W2M P;  2B7C B;  3FK4 A;  2DGW A;  2DT9 A;  4RLE A;  4DSK A;  2B9W A;  4IR1 A;  1R0B G;  4WBF A;  5G4D A;  5THW A;  4F4X A;  3DMJ B;  1NSQ A;  4E8U A;  5L46 A;  1VI7 A;  4BDP A;  1HBN B;  1UTA A;  2GQ2 A;  4P73 A;  1OO0 B;  4QJV A;  9ATC B;  4XO0 A;  3CCR S;  3H2V E;  4B9N A;  4DG1 B;  4C9D A;  5HAO A;  3EM1 A;  3NOC A;  2MQN A;  3GCX P;  2VB6 A;  3FFI A;  4PXB A;  2E1A A;  4RBU A;  3ZZR A;  1UPP A;  1TKD A;  4MKA A;  4NXM J;  1QD1 A;  4H4K C;  3DRS B;  2AZ1 A;  3OJS A;  4DL6 A;  3C46 A;  1IKW B;  1HQE A;  3QAE A;  2BJD A;  3I0R A;  2HZV A;  5B09 A;  4RW8 B;  2DD8 S;  5ITH A;  4C4W A;  2YNG B;  1WEX A;  4FXW A;  5B0A A;  4Q8E A;  3R2C J;  3LP1 A;  2ZKU A;  3G87 A;  3PO4 A;  1S6P A;  3EXY A;  4KO0 A;  4JI2 J;  1KNZ A;  1RSC A;  1RTJ B;  1IR2 A;  3Q8R B;  1UAW A;  2JLE A;  2LYV A;  4ES1 A;  3MUR P;  2NXC A;  5CZV A;  2EFO A;  4G1I A;  1S6U A;  3TAP A;  3KG1 A;  3DOL B;  5FLX Y;  4WFA Q;  2VON A;  5KFS A;  3HHD A;  3T5K A;  1Z1Z A;  2OEM A;  4O0I A;  4DV5 J;  1Y7P A;  3SV4 A;  1RIS A;  1F9H A;  2FJE B;  3O8W A;  3RW7 A;  1BY9 A;  5K8N A;  2OFG X;  3CDU A;  3H5S A;  5K5M A;  4C2M A;  5HVG A;  3DU6 A;  1IXK A;  3N01 A;  3M8Z A;  5IZH A;  2BAB A;  4AQY F;  1X9S A;  2MQQ A;  3K8W A;  3KG4 A;  4C98 A;  2XB2 D;  2V8P A;  4DR1 F;  1TTH B;  2R7R A;  2XHC A;  2NXN A;  1ICE B;  3PHT A;  2WBM A;  2ALZ A;  1U45 A;  4CQ1 A;  2Z0G A;  4KGZ B;  3G6Y A;  4N47 A;  1APS A;  4Y0F A;  1NME B;  1L3V A;  3NMA A;  1HAR A;  1ELO A;  2V2Z A;  1WHW A;  5HJX A;  5J2Q B;  1HW8 A;  2GO9 A;  1X5T A;  3V2U C;  3C3L A;  3JYT B;  2QL7 B;  4O3R A;  1UL3 A;  2CKW A;  4NI2 B;  2ZDP A;  3CJ3 A;  1MWQ A;  3CIZ A;  3CC4 S;  3P6Y C;  4A8O A;  1HR0 F;  3RBD A;  1V3S A;  2OML A;  3MOJ B;  1FNO A;  4L76 A;  4I69 A;  1ITP A;  1IVZ A;  3I5C A;  2N82 B;  2NUH A;  5C25 B;  4EMD A;  2C2E A;  1NDK A;  2HQC A;  4DUY F;  2IDL A;  3D4J A;  2VKR A;  4M5K A;  1XC9 A;  2GW8 A;  1WAC A;  3CJK A;  4NLR A;  1IN0 A;  3WX4 A;  3ZTO A;  4XPC A;  2C2D A;  3DLK A;  2JC0 A;  2VBW A;  4B9U A;  2VFS A;  4M5J A;  3MD3 A;  2YTC A;  1RAC B;  3IBF B;  4RBT A;  2C2M B;  2ZWO A;  1RXO B;  4UQG A;  3M2R A;  1SH0 A;  1S49 A;  2FHJ A;  4NLT A;  1ROF A;  1VQL S;  3M8Y A;  1TUV A;  2UXD J;  1HNV B;  2HBQ B;  2BQR A;  1SIZ A;  2KVI A;  5A8K A;  1WJ9 A;  3BR9 A;  5H9E J;  1XNQ J;  4F4Y A;  2UUA F;  5B0D A;  4QIG A;  3R7N B;  1DTQ A;  2IM2 A;  1VQ8 S;  3V6H A;  3FUY A;  1W2I A;  2CDR B;  3PG9 A;  2YH1 A;  4ECQ A;  2APO A;  2AGQ A;  1HNX F;  4WFX A;  4EO6 A;  4A8X A;  1P8G A;  2HEK A;  2EG2 A;  2N4C A;  3V4M A;  3GYX B;  4IH6 A;  4NLY A;  2L48 A;  5IWA J;  5L1L A;  1X0F A;  4PAB A;  1E6Y B;  4LFB J;  1R0C B;  4DG1 A;  4OX6 A;  2CYY A;  1HLW A;  2BJ3 A;  1CJV A;  3G8Q A;  3LPE A;  3US5 A;  2HQI A;  5DGB A;  1RT4 A;  4ZPT R;  3D2W A;  3HVR A;  3ZZT A;  5F8N A;  5L9N A;  4FF1 A;  1JXV A;  4YS2 A;  1JLG A;  5F8L A;  4UF4 A;  1GXT A;  9RUB A;  3KLG B;  3KWM A;  3PW0 A;  3KYL A;  4K4V A;  1FJG F;  3BSA A;  2MQP A;  3G6V A;  4HYK A;  2XY5 A;  2KJV A;  7AT1 B;  2QGF B;  2WTF A;  1FKO B;  1TK5 A;  1H74 A;  3LP1 B;  4I6A A;  4AE5 A;  1Q81 T;  1VLO A;  3TQ1 A;  1HQU B;  2F1F A;  3MWB A;  4QWE A;  1S9F A;  4DX5 A;  1RTJ A;  3LF0 A;  2HAI A;  3DLJ A;  1KD1 T;  2UUC F;  4NLO A;  1HWL A;  4Q43 A;  3CXC R;  1W2B R;  3MPV A;  4A8W A;  2JX2 A;  3FJ2 A;  4PR6 A;  4YB7 A;  1Q8B A;  2CJY B;  3FC9 A;  3VWS A;  2CPI A;  2YWE A;  3DXB A;  2OPS B;  3MAA A;  4XDD A;  2O5D A;  3QGH A;  3BN4 A;  1RTH B;  4ZP7 A;  1JKH B;  2G1H A;  2IJN A;  1I1G A;  1Q78 A;  2J8A A;  4M63 A;  1OQ3 A;  1N5Y B;  1IBM F;  3SCL E;  3KOA A;  4DR7 F;  1NRK A;  1IJF B;  5KFN A;  2ATL A;  1FF2 A;  4A8Y A;  4CYU B;  2ZDO A;  1G2E A;  3HHL D;  3I5A A;  1S1W B;  2UXC F;  3P45 B;  3FEZ A;  3ENQ A;  4ZS6 A;  1JWW A;  3PW2 A;  3OTB A;  4HDH A;  5C42 B;  5CAA A;  3AQP A;  2UXC J;  1RWW B;  2L9D A;  2VUG A;  3GJT B;  3CCT A;  3CO9 A;  4MT1 A;  3W7B A;  5IQ6 A;  4DQI A;  1DLO A;  2ILZ A;  1XEZ A;  4Q0B A;  2Q6B A;  2RUG A;  1G1X A;  4AND A;  2QMU B;  4NLS A;  4ZLJ A;  2F8E X;  1EQ0 A;  4N41 A;  4Z7Y A;  3VHQ A;  3MTK A;  4ZIV A;  1NK5 A;  4IKA A;  1Q7L B;  5AT1 B;  3IGN A;  4OX8 A;  1N33 J;  5B0C A;  2HVE A;  1X9W A;  1KFS A;  1X4C A;  1S6Q B;  3AOA A;  2QYC A;  1EET B;  3HLU A;  2V9K A;  4I64 A;  4ZVH A;  4NXN J;  3CUN A;  2CQ4 A;  5A8W B;  2RF2 B;  1WC4 A;  2Z2Z A;  4OV1 A;  1D8Z A;  1GMV A;  1XN9 A;  2DVI A;  5GAG U;  1WOO A;  2VPW B;  2DNQ A;  1HQU A;  5DDQ C;  4OZJ A;  3AA8 A;  1TV6 A;  4HLB A;  3CJ2 A;  1RT7 A;  2JL9 A;  3EJM A;  5A8R B;  3FNN A;  5E3C A;  2IBO A;  1VC6 A;  1S77 D;  3VZH A;  3W9H A;  1NBE B;  1AB8 A;  3UDE A;  2OSQ A;  5AXM A;  5M2U A;  1AFI A;  2EFQ A;  3M8W A;  3R5C A;  2F9J A;  4LQ3 A;  4OZ1 A;  4A46 A;  3HMJ G;  4X4Q A;  4U8V A;  2YKN B;  3P5T L;  1T9X A;  1YBA A;  4RW7 B;  1R8B A;  5T14 A;  2V34 A;  1CJV B;  2GZO A;  3M32 B;  5E3P A;  3RU0 A;  1QUP A;  5DLF A;  4JOU A;  4E98 A;  2OLW A;  3QIP B;  3MCN A;  3A8J A;  2CUY A;  3FZ2 A;  4AFF A;  3C15 A;  2UVR A;  2HW3 A;  3GON A;  3W2V A;  3MR3 A;  1F0X A;  3PKY A;  3LUY A;  4OI6 A;  1MU2 A;  3THT A;  1GX6 A;  3PRB A;  5F8M A;  3QRR A;  3EE3 A;  4ZIW A;  2HWH A;  4LBH A;  1RBA A;  2ACY A;  3ZO7 A;  5IM0 A;  4YR3 A;  5I4M A;  1DLO B;  2RVJ A;  4LF6 J;  1JLF A;  2N7C A;  3T1Y J;  1RHU B;  3PEJ A;  2ZH6 A;  1IBC B;  4P72 A;  5J1P A;  2ROE A;  1T3O A;  3R5D A;  3G82 A;  4HI1 A;  4LSL B;  4PYD A;  3ZTR A;  1RHR B;  1UJ5 A;  3LGN A;  3NCP A;  3MM5 A;  4IG3 A;  4RKU C;  3MFH A;  2Y8Y A;  2G2Y A;  2R7S A;  4O3O A;  1NHV A;  3FEY B;  1FNX H;  2DKO B;  3L7O A;  3LP2 B;  5LJ3 Y;  1WD6 A;  4OZN A;  4J5O A;  2JJ4 D;  4H4O B;  4LR8 A;  4LVO P;  3I87 A;  3KJN B;  2CQ0 A;  4XTT A;  2X3D A;  3OLB A;  1NDP A;  1HWJ A;  1U26 A;  2MKI A;  3H40 A;  4DR3 F;  4FF4 A;  1MRO B;  2LKZ A;  1U2F A;  3OPK A;  4CO2 A;  5IXU A;  1B0V A;  2QA2 A;  2CQP A;  2KG1 A;  5E3R A;  5EX3 A;  1SJ3 P;  1RP5 A;  4X2B A;  5U47 A;  1PIE A;  3B6B A;  3DLG B;  3HSD A;  4NOH A;  2EVZ A;  4IO9 Q;  2R7T A;  5EDW A;  4G1Q B;  1M1H A;  2MZT A;  3MCM A;  1DTT A;  3HHN B;  5LJ5 Y;  4ED4 A;  1N56 A;  1UP1 A;  1NAQ A;  2CQI A;  1VQY A;  2V4R A;  3HHL B;  3T5J A;  2YKN A;  4MK8 A;  2DXD A;  4OYI A;  3BB5 A;  1Y10 A;  4DPT A;  4FF3 A;  5K9F A;  2WW4 A;  4F8R A;  2EKY A;  3M32 A;  3BQ2 A;  2FC8 A;  2PA8 D;  2V94 A;  3CJR A;  1FK9 A;  2VQE J;  1X4F A;  2P8I A;  3QT6 A;  2CJK A;  2GAH C;  4LSN B;  4OYB A;  4ECW A;  1ZPV A;  3TR5 A;  4QCL A;  4PZV A;  1NXI A;  4U6P A;  2ZBC A;  1H0H B;  1T9Y A;  1SQE A;  3GIR A;  4LF4 F;  2FDN A;  2KFY A;  2Q66 A;  4YFU A;  4OLO A;  1AW0 A;  2XI3 A;  1YBU A;  4K0K F;  2ABY A;  2BEF A;  3QMQ A;  2E5L F;  5IT9 Y;  4IDK A;  1N5Q A;  3DLL Q;  2VPZ B;  2Z57 B;  1T3N A;  4N77 A;  2HQF A;  1TKZ B;  2CZV C;  2MZJ A;  2XMV A;  3UNY A;  1U1Q A;  1NK9 A;  1LW2 B;  1YQH A;  5E0O A;  1HD0 A;  4DV7 J;  3J7A N;  5AXK A;  3EVM A;  3O1L A;  4K7Q A;  4C0O C;  2FJD B;  4I6Y A;  4UOF A;  4Z2X A;  2CVE A;  5C24 B;  3OV7 A;  2J0W A;  4WFB Q;  1SL1 A;  2H1Y A;  1RAD B;  2WON B;  4FYX B;  4FBU A;  2DHS A;  5K8M A;  4WKY A;  2MJN A;  1D3W A;  1FDN A;  2N4D A;  1MRO A;  2ZFH A;  3PNI A;  3OUY B;  1K8A T;  1RGV A;  2W4C A;  2GHP A;  3HD1 A;  2B51 A;  5KFG A;  4JV2 A;  2PI4 A;  1HA1 A;  4FYW B;  4DUY J;  2E7X A;  1JLE A;  1S1T A;  5F9N A;  3J7Y I;  5KFV A;  3ENW A;  3D5M A;  4IFV B;  5CYM A;  5KG4 A;  2RU3 A;  4RUC A;  2HRT A;  2J76 E;  2M2B A;  5GVQ A;  3UNG C;  4F3Q A;  2GNK A;  1HQ2 A;  1TL7 B;  4CO0 A;  4UZB A;  3MUT P;  4DV0 F;  2O67 A;  3BEG B;  1ZM2 A;  1ZYQ A;  1H6K X;  1S5Z A;  4P75 A;  1VR6 A;  3H98 A;  4CNY A;  3MOZ A;  4KC5 A;  5BR8 F;  4LF5 J;  1HNW F;  1NK0 A;  1IBK F;  4X84 A;  3S01 A;  2NRE A;  3D9B A;  2DNO A;  2RML A;  4XK8 C;  2DR8 A;  2E66 A;  4KHP F;  2GVZ A;  3ZTQ A;  5JVH Q;  3N6L A;  4DSL A;  4B3T J;  3NWG A;  1WWH A;  4ZK7 M;  4OHW A;  4UOH A;  3T1H J;  1RK8 A;  1PBU A;  3TVZ A;  3JS9 A;  1C2P A;  1KTV A;  4LF8 J;  1F3F A;  1X60 A;  3EXC X;  4KQZ A;  1OPI A;  3Q8P B;  2M9K A;  4Z37 A;  2JVO A;  3RBZ A;  1YJU A;  4O3N A;  1WHY A;  1IQT A;  4HAC A;  4LF6 F;  1LW2 A;  4K2X A;  3TAQ A;  4GKJ J;  3NY0 A;  4DUT A;  3I0R B;  2NR0 A;  1FWP A;  3LAK A;  3KMS A;  1U4B A;  2H5I B;  3M30 A;  2F5G A;  4ECU A;  1RWN B;  3DHW C;  1IM4 A;  3MR7 A;  4H4M A;  4WU3 A;  1FK9 B;  4DN9 A;  4RO0 A;  5KFW A;  3K5L A;  1HNZ F;  5HAN A;  1FWL A;  1RB0 A;  1TKT B;  4OIX A;  5RUB A;  3G71 S;  1TUW A;  2F8M A;  3C6U A;  1S0N A;  2LEA A;  3CDW A;  3KKF A;  2W1B A;  4OHX A;  1VQN S;  1JLA B;  4NLU A;  3D3C J;  4CRJ A;  3HP6 A;  5I42 A;  1RKJ A;  4KGV B;  2IMO A;  2PMZ D;  2R7V A;  2OO4 A;  1CC7 A;  1EP4 A;  2LMI A;  4EFA C;  3EZ5 A;  5HQM A;  3OL7 A;  2GCF A;  2K3K A;  2BE2 B;  2VG6 A;  5HJY A;  4DR6 J;  2ROG A;  3S8S A;  3NNC A;  2VV5 A;  5EHH A;  5K20 B;  2ZIT A;  2XYG B;  3K17 A;  1BWE A;  3GG0 A;  4DR3 J;  3UD3 P;  1OJ4 A;  3IBW A;  4NAS A;  2ADC A;  3B4D A;  4EGL A;  4OZ0 A;  3OL8 A;  3KHL A;  1SKW A;  2CG4 A;  4NLV A;  3M2V A;  2BJ1 A;  1U1P A;  4MFB A;  3D7S B;  3EIC A;  3HKW A;  1B64 A;  1C1C A;  3R9L A;  4JI5 F;  1V3R A;  2RQ4 A;  3CWJ A;  3N9U C;  1KC8 T;  2F4V J;  4ZKA A;  2CQ1 A;  2AD9 A;  4JI4 J;  2OPQ B;  5HVH A;  2EEY A;  2JEI A;  3R7S B;  3BSC A;  2I2Y A;  2HVZ A;  4IG0 A;  1NKC A;  3HFV A;  3U7J A;  2ZNZ A;  4X4R A;  4LBP A;  5CCM A;  1YIT S;  2AYE A;  2AP6 A;  5IC4 B;  2ZH1 A;  2QA1 A;  2KN4 A;  4J9V A;  2XCA A;  2XMW A;  4YR2 A;  4UT4 A;  3BBB A;  2F4F A;  4PPD A;  4LIR A;  3CCM S;  4OQJ A;  4DS4 A;  1I6J A;  2EC2 A;  2VG7 B;  4CTA B;  3AD9 C;  3H4D A;  4KPC A;  4FNH A;  4WZQ A;  3UDC A;  3H59 A;  3PHE A;  1K1Q A;  1PYS B;  2BJ9 A;  4R25 A;  1D0E A;  3D6F B;  4NA3 A;  4I6W A;  3VAJ A;  3MCS A;  4KYZ A;  5EWG A;  4K4T A;  1UA0 A;  1FES A;  4KGK A;  4KKO A;  4RWW A;  2FJX A;  1NB2 A;  2ZH9 A;  3CCV S;  5DM7 Q;  1G3O A;  1LWF A;  2XSJ A;  3C16 B;  3GIL A;  3K58 A;  5L38 A;  1W7W A;  4JB8 B;  3IAM 9;  4FN5 A;  4X65 J;  4PWD A;  3F0N A;  2HLU A;  2QL5 B;  4RPF A;  4HEA 9;  1KQF B;  3TVY A;  1EB0 A;  2DRD A;  3D6M B;  3V4I B;  4GC6 A;  3PFO A;  4M5H A;  1KOO A;  3LWM A;  2FJV A;  2MKK A;  3TEG A;  2BE2 A;  1IKY B;  2VG6 B;  3R7B B;  1NJW A;  1BWV A;  1RWM B;  3I5B A;  3NGS A;  5T7L A;  5D3G A;  2E5H A;  2E7V A;  2MPU A;  4KHR A;  3TEH B;  3HF5 A;  3ZXW A;  4PG8 A;  3PFE A;  2RRB A;  2XLJ A;  4DF4 A;  2CA9 A;  3QJL A;  3R5J B;  4QR1 A;  2I1R A;  4C8Y A;  3V81 B;  2CAD A;  2DHX A;  2LEC A;  1GAO A;  1TL4 A;  2W4D A;  2DTJ A;  2XEX A;  3Q86 A;  2FZC B;  4CLF A;  4DR2 J;  1PGZ A;  3DLE B;  2WZ1 A;  2HYI B;  1UZD A;  1S97 A;  1FVS A;  1HWU A;  1SH3 A;  3D28 A;  1Z4U A;  1VQ6 S;  1NH8 A;  4QIE A;  5DQI A;  2HHV A;  4USI A;  2MKY A;  3OTC A;  4MK9 A;  3A12 A;  2XHW A;  3QID A;  4PQA A;  3T1A A;  1YZ7 A;  4HTI A;  4USW A;  3U1N A;  1VJW A;  5HP1 B;  3ULH A;  4QWA A;  4QIF A;  3EMT A;  4WF9 Q;  2HNZ B;  3N5B A;  4ECX A;  4DQP A;  3D1H A;  1ARO P;  1XK8 A;  2POK A;  4J9N A;  1NZA A;  3R1H A;  1LFP A;  3ZC4 A;  4IH7 A;  2R3V A;  2N3L A;  1Q79 A;  4IFY B;  1LNQ A;  3D66 A;  4KFB A;  3MXH P;  2HS3 A;  3T1H F;  2PGC A;  4PG6 A;  4DV4 F;  2RJZ A;  1NK6 A;  1YWX A;  4USH A;  2X3G A;  5B0E A;  2B43 A;  2HHH F;  2HIQ A;  1OSD A;  4MFB B;  1R6V A;  3R6L B;  4LJM A;  1EZZ B;  1N32 F;  1BGX T;  2ZZN A;  4YB1 P;  4DLE A;  2YH0 A;  4RUA A;  1DBD A;  2M7S A;  3JTP A;  3KUG A;  3P96 A;  5D77 A;  3BKF A;  2HGN A;  3LP0 A;  1FXD A;  4DV3 J;  1IKY A;  1R8C A;  1FT8 A;  2A18 A;  1RTI A;  3AJ2 A;  5DLG A;  4G65 A;  2QEX S;  4F3O A;  4AT1 B;  1NSA A;  3D0I E;  4K2J A;  3OXF A;  1T05 B;  2UUB J;  1F2G A;  1MN7 A;  1YJT A;  2JH3 A;  3CMQ A;  1VC0 A;  1AUD A;  1HQE B;  2VG5 A;  2GJF A;  3DDI A;  3HHK A;  2Y1I A;  2CVI A;  1XNR F;  3ISN D;  2JFD A;  1H2U X;  1U1N A;  3QAU A;  4ZPW R;  4D3G A;  2XZT B;  2KI2 A;  1SI9 A;  1LXJ A;  4J9P A;  1TV6 B;  1NK8 A;  1CG2 A;  3GB0 A;  4AXJ A;  3OBI A;  4ZVG A;  2FHM A;  3Q8S B;  1Q86 T;  2ZE2 B;  3B78 A;  3TJ8 A;  4QYZ J;  1TMJ A;  3J80 Y;  3BGF A;  2UV8 G;  3SEO A;  2AEF A;  4WYW A;  3KK2 B;  4FVM A;  2C3U A;  1FRM A;  3V4I A;  2G0J A;  5HRO A;  2NPF A;  1FFS B;  3KHG A;  1WOR A;  5KFQ A;  2RDJ A;  2GAG C;  3L95 X;  4UST A;  5E41 A;  1N6Q A;  2IMW P;  1KEK A;  4EZ9 A;  1HPZ B;  3VAL A;  4BWJ A;  4JI2 F;  1Q5V A;  2AQ4 A;  1PG5 B;  2YX4 A;  5IS2 A;  1RT1 A;  1YJN S;  4W92 B;  5LSR A;  4ATN A;  4ILM A;  2BKN A;  4OMF G;  4J9O A;  2UZA A;  2BW2 A;  4YOE A;  3QNW B;  1VGY A;  2CXE A;  3KG0 A;  3DLE A;  4MK7 A;  2BE9 B;  5FD1 A;  4C8Z A;  4O23 A;  2PFD A;  3OSP A;  3LP0 B;  4QWC A;  3OFG A;  3E01 B;  2P9C A;  3CJ0 A;  3FGV A;  3G82 B;  1X7V A;  4ECY A;  2ZUA A;  2VU5 A;  1SJR A;  2LEP A;  4NZ0 A;  4DR4 F;  1RWX B;  4FF2 A;  4EEY A;  2E29 A;  1SC3 B;  6FDR A;  4WKR A;  1PO6 A;  5D0H A;  1ZET A;  2QE5 A;  4U95 A;  4B9S A;  4OI3 A;  2MQL A;  4USV A;  2DH9 A;  5EX0 A;  2N3O A;  2KT2 A;  1L3U A;  2HWI A;  3R2D J;  1S9G A;  3I0S B;  2BX6 A;  4J9L A;  2HLT A;  3TUZ C;  1VIX A;  5KG0 A;  1H73 A;  2WCX A;  5CAB A;  5K14 B;  1XNR J;  5H9F K;  4DV1 F;  2RDI A;  2D9P A;  3MAH A;  3A1Y G;  2MKC A;  3DXS X;  4NZ6 A;  3TUI C;  4DBQ A;  3EPG A;  1OY8 A;  2DGT A;  4I68 A;  5KG2 A;  4IOA Q;  5C5J A;  2M4M A;  2UUT A;  2QLB B;  1GX5 A;  4Y2C A;  2VFT A;  3CNQ P;  3QGI A;  4F04 B;  3SV3 A;  2A1B A;  3CUL A;  3MMJ A;  4QR2 A;  3HO1 A;  3HHL A;  1YGY A;  3OTO F;  4OHZ A;  2F7V A;  4JI3 J;  3DHX A;  4X64 F;  1KN6 A;  3NCR A;  4B3M J;  5KFK A;  1IBL F;  2Y1L B;  4UUW A;  1KON A;  8ATC B;  3T1Y F;  1VC5 A;  1AZS A;  1ZM3 A;  2GIF A;  2OD6 A;  4HI2 A;  1WF1 A;  3VVT A;  1WI8 A;  1BQM A;  2V4Q A;  5CYQ A;  1CQN A;  2DHG A;  3VGU A;  4DU7 A;  3M2R B;  2LEB A;  4TU9 A;  3Q22 A;  2ZJQ Q;  1SV5 A;  2YWW A;  3KLE A;  4XIU A;  3VAG A;  2FD2 A;  2W7A A;  4I2Q A;  1V5I B;  1WC5 A;  2BQ3 A;  1RAA B;  1WEY A;  2EC0 A;  2K1R B;  2BAC A;  1FRL A;  2MXY A;  2A0F B;  3RRH A;  1VRU A;  4KT0 C;  1F5C A;  2ZOF A;  3FVY A;  1B7Y B;  3E01 A;  3CF5 Q;  4ZPB A;  3CJS A;  4J9R A;  4KSE B;  4W98 A;  3RAM A;  2ZE2 A;  3UDL A;  1YIJ S;  3FRZ A;  1TZ0 A;  2MHN A;  3W62 A;  1F3V A;  1TL1 B;  4BLG A;  4A8S A;  4YY3 F;  1FRK A;  1QUV A;  1TKX B;  3LAL A;  4DDF A;  4DEZ A;  3PTW A;  4X4V A;  1CS4 B;  1JJH A;  3BQ1 A;  2PSZ A;  4NCG B;  2LLZ A;  1PCA A;  1I5O B;  3U27 A;  1RWV B;  1FHT A;  1RE1 B;  2A3J A;  2KRB A;  1CJK B;  1FKP B;  2VZ9 A;  2O3D A;  1S99 A;  3WC0 A;  5JMN A;  4ICL B;  5IFM A;  3MUV P;  2QRR A;  2XUL A;  3J7A 1;  4ALZ A;  4BC9 A;  2ASD A;  1N52 B;  1N0U A;  2MZQ A;  2PE8 A;  2ZBP A;  1RLC L;  1MW7 A;  3QWP A;  5E7O B;  1T8E A;  3J7Y U;  4B9V A;  5ETT A;  2CRL A;  2B9X A;  5C2G A;  5GAE U;  2XMA A;  1ZM4 A;  1QAI A;  4DUZ J;  4EI2 A;  2YWK A;  2BDP A;  1TMM A;  4PYA A;  5D4N A;  2G1D A;  2DJW A;  4O44 A;  1RT3 A;  4A47 A;  4M5L A;  4OV6 A;  4F0M A;  5DJB A;  4HH0 A;  1YX2 A;  3HZG A;  4JI0 J;  1KVJ A;  3SQG A;  3CDE A;  5D0G A;  2M8D B;  3VZI A;  3KUH A;  1W26 A;  4DQQ A;  1P6T A;  4Q45 A;  3OSN A;  1RTD A;  2DEI A;  2RQK A;  2E44 A;  1QVF R;  5IT4 A;  1YZ6 A;  4PXE A;  3LW5 C;  3O2I A;  1F9E B;  4ZCL A;  2KB2 A;  4V19 J;  5GAD I;  2BW7 A;  4NX9 A;  4P10 A;  1FXR A;  1PKU A;  4OZ2 A;  2X1G A;  1LV5 A;  1GTH A;  3SMZ A;  2MTL A;  1Z2Z A;  2ZWP A;  4GC7 A;  2U1A A;  5SZT A;  4NCA A;  1N36 F;  4B08 A;  2XWY A;  5C42 A;  1LOU A;  3TX8 A;  3M7V A;  2ZJR Q;  2ATC B;  3ZTS A;  1Q0N A;  3M8P B;  3RRK A;  3BKU A;  4CLK A;  3ADA C;  5LSL A;  2W9B A;  1UA1 A;  3QT5 A;  3BDE A;  1UVL A;  5AE2 A;  4KV8 A;  1N54 B;  2H48 B;  3AH6 A;  1JLC A;  2LU2 A;  4KH0 B;  4OYZ A;  5F0U A;  3CCE S;  2V5H G;  4ID8 A;  4X4N A;  3CD7 A;  4DL2 A;  1J5O A;  1TFW A;  4R8U B;  3IP0 A;  2D9O A;  1RBO B;  2HZC A;  4USU A;  3UR0 A;  1FEE A;  2HFN A;  2V67 A;  3MCO A;  5FDL B;  5IQQ A;  3RJM B;  1XR5 A;  1KS2 A;  5MLC V;  4L75 A;  1VQ9 S;  2ZBI A;  3D68 A;  1NM2 A;  3T6B A;  3I4H X;  3FBF A;  4I1T A;  1VQS A;  2BUN A;  4P2S A;  3KHR A;  4ZA1 A;  3KLE B;  2CPZ A;  3SSS A;  2QC3 A;  1KLN A;  2Z30 B;  1WC3 A;  2FLL A;  1J5E F;  2AX0 A;  3MM7 B;  1VBX A;  1YDL A;  3M2U A;  3NXZ A;  4DR6 F;  2IA6 A;  3HVT A;  1EP4 B;  3PJX A;  2OGU A;  4WXW A;  1NJI T;  4DR2 F;  2UUC J;  1ZZF A;  3PZP A;  1E6V A;  1SC1 B;  2GGP A;  2JNJ A;  3PAC A;  4I7F B;  4E2F B;  3FBC A;  3FBE A;  1VQ5 S;  4K50 A;  3N5F A;  4PG7 A;  3SQG B;  4J9M A;  2RS2 A;  2Y0S D;  1MLA A;  3HUL A;  5A6W A;  5AJ3 J;  1TL1 A;  3FKB A;  1FFW B;  2VFU A;  3PYE A;  4I56 A;  4LRA A;  1RCX B;  2W24 A;  3QBC A;  1XR7 A;  4QQB A;  1G6B A;  1RWO B;  4Y00 A;  2R2S A;  2EI5 A;  3RB4 A;  2BBE A;  5DET A;  1TU0 B;  5KFP A;  2H5J B;  2ZH2 A;  2HGM A;  3LP2 A;  3QLH B;  4WU2 A;  5LOQ A;  1O0P A;  3LPY A;  5E2Q A;  4OYW A;  4ZVR B;  2BXJ A;  2HRY A;  2FTR A;  3A4T A;  5D8H B;  2XS5 A;  4P52 A;  2EK1 A;  1C1B B;  1OS5 A;  2CPY A;  2X1B A;  4I67 A;  1WTB A;  1FRH A;  4DL0 C;  1K9M T;  3TP2 A;  2E9T A;  5A2Q Y;  1Q4R A;  1Y9O A;  3TJA A;  3NAI A;  3B82 A;  4DQS A;  2LDI A;  4CLY A;  3T5H A;  4NCB A;  2IPO B;  3G96 A;  2HGL A;  1HKA A;  1FVQ A;  2ZKT A;  3DFE A;  5BYS A;  1JLF B;  2ZNY A;  3DC2 A;  1ZPW X;  3HDS A;  2RU9 A;  2Z2M A;  3EZO A;  3W9J A;  2XY6 A;  2JC1 A;  1BLU A;  1WF2 A;  1C0U B;  1UWB B;  1HMV B;  1HBM B;  3W64 A;  3PR4 A;  1VIO A;  1CEZ A;  1EKS A;  1FE0 A;  5J1N A;  1DAR A;  2M8H A;  1GMW A;  1ZAV A;  2RIL A;  3IG1 B;  2OPR A;  2VJU A;  5H9E K;  1OY6 A;  3MED A;  3IXQ A;  5T41 A;  2QSF A;  3PW5 A;  4FPI A;  2DPI A;  1SB6 A;  3AQO A;  3VV2 B;  2Q79 A;  2R42 A;  1MNE A;  3DRP B;  3IS9 B;  5HK4 A;  2D69 A;  2GQC A;  2J7U A;  2ZC4 A;  4TKT A;  5I3U B;  3OL6 A;  1JX4 A;  2IDE A;  4O3P A;  1VDH A;  3W9I A;  2YKQ A;  1FE4 A;  5DS7 A;  2AMC B;  1XER A;  4AXI A;  5CYJ A;  3DGP B;  5DDR C;  3A13 A;  1VMB A;  2K8G A;  4NYP A;  1HR0 J;  2DGU A;  5DZ6 A;  4CM2 A;  4ID5 B;  4AD6 A;  5H9F J;  1U09 A;  3BSO A;  2G2Z A;  3PRD A;  3KTQ A;  4AL6 A;  4FKX A;  3BYP A;  4NWB A;  3H2L A;  2E1R A;  1KHW A;  3IM8 A;  1E6Y A;  1RHJ B;  3BQ0 A;  4ED1 A;  4R5P A;  4LFC J;  3VVU A;  2EFV A;  1XJW B;  2LCW A;  4BC7 A;  2WON A;  3NWR A;  1RWK B;  2NUU G;  2WVF A;  4CO1 A;  4DFJ A;  2HVD A;  4LFB F;  1B70 B;  1WOS A;  4PUO A;  1NZ8 A;  2YQ3 A;  2V2K A;  5KFI A;  5K8P A;  4LSN A;  2R7W A;  1U47 A;  1T03 A;  2OHD A;  2C3Y A;  3N6M A;  1NJZ A;  1VK3 A;  2XNQ A;  2ERR A;  3TO8 A;  1N5V A;  3HM9 A;  4UY8 5;  1L3K A;  4OYP A;  2J0Q D;  1FI4 A;  1XBW A;  2VFR A;  4L72 B;  2XMU A;  4OYA A;  5ADZ A;  2AGP A;  2IAJ A;  5L8R C;  4EWT A;  1T02 A;  2FY1 A;  1IKV A;  1WG4 A;  5HMW A;  3KNA A;  1RAI B;  4S0M A;  3SBM A;  1UWB A;  3KLH B;  2VHG A;  1SL2 A;  3TUP A;  3UPF A;  2CZ9 A;  3QFW A;  3UO0 A;  2H65 B;  1X0P A;  2MGZ B;  2VBY A;  2PN6 A;  4ZPA A;  1DUR A;  1MMD A;  3NP5 A;  1YRT A;  3WBZ A;  5L39 A;  1A0O B;  4U7C A;  5L1J A;  4ZLP A;  2XWX A;  1Y5N B;  5KFE A;  2B5J A;  1NK4 A;  1IM6 A;  4G6V B;  2V6A A;  3O5T B;  1JK9 B;  1S7H A;  1TVR B;  3DCA A;  4MAK A;  4RW4 A;  5I3Q A;  3NOG A;  4OJH A;  4WTO B;  2QA4 G;  2OTJ S;  3GWC A;  3LGM A;  3GIM A;  4Q7A A;  3QGG A;  2QX0 A;  1RQ0 A;  2FVC A;  4ZN3 A;  1VBK A;  3DI6 B;  3G8S A;  4ID5 A;  4GRS A;  1VRT B;  1NND A;  4PWW A;  3G6E S;  2KZM A;  2YX1 A;  3EX7 B;  3H7H B;  4ILL A;  2JEJ A;  4BCA A;  4CCH A;  4HAC B;  3ILI A;  1X5O A;  1RAH B;  3FMW A;  3GMG A;  1QAX A;  4CH0 S;  3OJU A;  2W9C B;  2IRX A;  4KGX B;  3MPD A;  3BO4 A;  2XC9 A;  3RB0 A;  2AIR B;  1TP7 A;  3DRR B;  3ETM A;  5D4L A;  2OEL A;  1V3Z A;  3TZX A;  5DQG A;  1WSR A;  3N4W A;  5HQ8 A;  3NGU A;  3D54 A;  1FJE B;  2AT1 B;  2E5J A;  1WSV A;  2IIH A;  3FMB A;  1OSC A;  1T0T V;  4N56 A;  4OHV A;  5KFO A;  5CD4 A;  2X1F A;  1NEE A;  1M0S A;  3C66 A;  4F67 A;  2OPR B;  5ETL A;  3C6U B;  5BYR A;  1EET A;  4DFK A;  2OEK A;  1YI2 S;  2KHD A;  3NL0 A;  1U48 A;  3BN7 A;  3DRP A;  1UJ4 A;  3CC2 S;  4JP8 A;  5KFM A;  2FVP A;  3CC7 S;  4K4Z A;  2IM3 A;  1U1L A;  5HAT A;  3TAM B;  1S1U A;  5HRO B;  2DYA A;  4CO3 A;  5A2Q U;  2OTL S;  2L3M A;  4B9T A;  3HJF A;  2KKH A;  1WDD A;  2LA6 A;  3ZFV A;  3KLH A;  1OQ6 A;  4OYO A;  1JMT A;  1GQE A;  2ZC3 A;  4ED5 A;  3PCO B;  1NUE A;  4L74 A;  4ILR A;  1S1X A;  3SIP B;  2R7U A;  2X7I A;  3OT9 A;  2L41 A;  4F50 A;  3DU5 A;  4CO5 A;  4LT6 A;  4DPX A;  1CJT B;  4K4X A;  4EBE A;  2Z56 B;  3KK3 B;  1CC8 A;  5FLX U;  1TQL A;  3BO2 A;  3HJV A;  2R2R A;  1ZA2 B;  1C1C B;  4RW7 A;  1YJ9 S;  3SXL A;  4RW6 A;  3F73 A;  2W2O P;  4Y2I A;  2NSC A;  3JTO A;  2JLF A;  1A9N B;  2GJI A;  2HPU A;  2VC0 A;  4CDI A;  2HMI A;  4YB6 A;  1VQO S;  2HND A;  2B6A B;  1MU2 B;  2IC3 A;  2CNK B;  2ASJ A;  5BYQ A;  3RR8 A;  5I42 B;  2CQG A;  2MY8 A;  4DJB A;  1J5E J;  6FD1 A;  2W9C A;  3GP9 A;  3ITH A;  4C0B A;  3G4S S;  3T19 A;  3W61 A;  2J6S A;  4UY8 T;  2UXB F;  1S4E A;  1QSY A;  4C7Q A;  5J2N A;  2KT5 A;  2NYH A;  3H2U B;  2FHK A;  5KFC A;  4RNO A;  2DNR A;  2FJB B;  2KM8 C;  3Q0A A;  5KFY A;  2CQD A;  3AB4 B;  3BJY A;  4QPT A;  2ZH3 A;  3LO3 A;  1YSJ A;  1Q8L A;  1YK9 A;  4J9U E;  3BPS P;  2J9D A;  1KLM B;  2C2K B;  3HKZ D;  1RHQ B;  1Y0H A;  3GCW P;  2VQF F;  3EDQ B;  3QRQ A;  5IC6 B;  1S79 A;  1SVD A;  2B5J B;  4DFP A;  3C16 A;  2NLW A;  4IRK A;  1EAY C;  2OPP B;  1T11 A;  4RW4 B;  4DFM A;  1RAB B;  1LW0 B;  3HSZ A;  3M8Q A;  7FDR A;  2AJQ A;  1WKL A;  2WVB A;  2R7O A;  4FXV A;  3S6E A;  3M8R A;  1N32 J;  1AFJ A;  2I5J B;  1M90 T;  4DCJ B;  4J9S A;  5GMK a;  5EWE A;  3GQC A;  1H2T Z;  2D3O 1;  2ASL A;  2VBZ A;  2B4V A;  2CPF A;  4IG0 B;  4EK2 A;  3QT8 A;  1JJC B;  3RGI A;  3VR1 A;  1HNX J;  1A6L A;  1AZS B;  1S1X B;  4DL4 A;  2KHC A;  2QV6 A;  3GFZ A;  4G1Q A;  5LT5 A;  4TQS A;  1PC4 A;  4M5I A;  2H5E A;  1SV5 B;  4RW8 A;  2E9Z A;  4DXL A;  4DPO A;  4CTA A;  1V9O A;  1WEL A;  3FRY A;  3M9N B;  1BXN A;  4CLU A;  4J7C A;  1UEV A;  3H5U A;  1VBY A;  4PXC A;  2QFI A;  3QQC D;  1RT6 A;  3NBP B;  4O0N A;  1XMB A;  1B99 A;  1CJU A;  2OUG A;  1KQK A;  4LSZ B;  2DXF A;  2W01 A;  1GK8 A;  4TVA B;  1X4D A;  4I4B A;  2GS8 A;  2PFF B;  3PO5 A;  2VPX B;  2C3P A;  1KBR A;  3OFH A;  2V68 A;  1U0H B;  3U1L A;  2HNZ A;  3E8O A;  1HBN A;  3S1T A;  5HN0 A;  1RCO B;  1GFW B;  1I94 J;  4B3S F;  4CT8 A;  2FHO B;  1JXL A;  2YKA A;  1MN9 A;  1GT8 A;  3GJQ B;  1KKH A;  1YJV A;  5HQL A;  3CD0 A;  2HAF A;  4K5S A;  3GV7 B;  3QAT A;  4KFB B;  3NGT A;  2G4B A;  1CJK A;  3DOM A;  2QT7 A;  3M6W A;  2YWH A;  3BGR B;  4N8O A;  2RRN A;  2NCK L;  2WAQ D;  5HMY A;  4Y34 A;  1SQG A;  5B0G A;  2RQM A;  2V4J B;  2UXB J;  2DR9 A;  2RUS A;  2FVQ A;  2OMO A;  4DZD A;  1K47 A;  2DY1 A;  3MZI A;  2H51 B;  2F63 A;  1KHV A;  3CD5 A;  3OFF A;  5LXR A;  4CP5 A;  4X66 F;  4FS2 A;  5HL7 Q;  3CME S;  4CT9 A;  4RUH A;  3POT A;  1IBM J;  3JSM A;  4JV5 J;  4YEA A;  1UFL A;  4WE1 A;  1W25 A;  4A48 A;  2NXU A;  5GME A;  4EYH B;  4F4Z A;  3QRP A;  1UJ6 A;  5JUM A;  4DV5 F;  1NKB A;  1SKU B;  3CJK B;  2HND B;  2IC3 B;  4ZPV R;  4FVC A;  1VLY A;  3Q8V A;  4NYO A;  5DG9 A;  4IH5 A;  4N5S A;  3TW0 A;  4X62 F;  1UCN A;  3GIK A;  3MTJ A;  2DNY A;  1X4B A;  3AHP A;  3ITH B;  4ELV A;  4IOB A;  1HHQ A;  4URQ U;  4PPZ A;  4Y3C A;  4YY3 J;  2HHH J;  4K4Y A;  2V63 A;  3ZZZ A;  3TZZ A;  1LXN A;  1HNV A;  1N36 J;  5ETQ A;  3IR6 B;  5IV3 A;  4F4K A;  4ZDN A;  2JDJ A;  2PEB A;  5CD4 H;  4G3I A;  3LGH A;  1JLB B;  1VYA A;  3CVK A;  4C11 A;  1DTQ B;  1N8R T;  3PM9 A;  3HFZ B;  2PO4 A;  2C2O B;  1H72 C;  3EVW A;  5C2C A;  2BVZ A;  2R8G A;  3FCW A;  3R97 A;  1NSP A;  2PD1 A;  3MMC A;  4B17 A;  1OY9 A;  5MAO A;  3JYT A;  1REV A;  4ZVE A;  4P7T A;  4WXO A;  3KK2 A;  4RBV A;  1LW0 A;  3M8Q B;  3J81 U;  5KT6 A;  4CLW A;  3PJW A;  1HW9 A;  4UOC A;  4Y6I A;  4KGM A;  2LXI A;  2GMH A;  1MMN A;  4WFZ A;  5M2P A;  4L3N A;  4DV1 J;  3EGZ A;  4EUV A;  2CJA A;  1LFW A;  4ZP6 A;  1A7G E;  1ZAW A;  1GXL A;  1T05 A;  2I0X A;  2IA0 A;  1DQA A;  1JLG B;  4DX7 A;  1O5J A;  1LK7 A;  4CLP A;  3DLB A;  2V4J A;  2EFG A;  2ZOM A;  4DL5 A;  2EFP A;  2O01 C;  2UP1 A;  1FJC A;  2IFX A;  5GAH I;  3CT9 A;  1HBO A;  4TN2 A;  2BAN B;  5KOX A;  1YHQ S;  2RNE A;  1FKA F;  3T3F A;  3V6D B;  4C8K A;  2Y3Y A;  2IVY A;  4FXD A;  4QOT A;  3H42 A;  4TNO A;  4TY8 B;  3R3T A;  1JJ2 R;  1JIH A;  4H4M B;  3HVT B;  2HQD A;  1HHT P;  3ZZU A;  2XM3 A;  2XMT A;  3TUJ C;  4LF7 J;  3PYF A;  3BR8 A;  3ILL A;  3SYZ A;  4ZHR B;  3FSX A;  4CH1 A;  1UWA A;  4M5M A;  5B0B A;  2KO1 A;  2R2U A;  1XMO J;  2WVC A;  2E9R X;  1JNZ B;  2HFO A;  2ZD1 B;  3ET6 B;  2ZEJ A;  2OAU A;  3QZ8 A;  3QLH A;  2VD3 A;  2RT3 A;  4WP3 A;  4M5G A;  1S9G B;  2LQJ A;  1SUQ B;  4TYB A;  4ZVP B;  1HPZ A;  5ETN A;  1FTR A;  2CQ3 A;  1URR A;  2I9S A;  3L7P A;  3VAK A;  1FD8 A;  4C11 B;  2PII A;  3HPO A;  2ZHO A;  3HCX A;  2C22 A;  3MDF A;  1KSP A;  3OW2 R;  2J9C A;  3ENA A;  3O44 A;  3AJD A;  4OI1 A;  1QAJ A;  1N0V C;  2ACM A;  3DMJ A;  3MMB B;  4NE9 C;  5F9L A;  2ZH4 A;  3GSI A;  2DGS A;  5M2R A;  3RR7 A;  3BS9 A;  3KJV B;  2W2Q P;  1FKO A;  1EX8 A;  1M1K T;  3AT1 B;  3J80 U;  1TK8 A;  3R5G A;  4ECR A;  1NPK A;  5CA5 A;  2OPQ A;  4NPO A;  4U8Y A;  2IVF B;  2RDD A;  4UOG A;  4MIW A;  2X1A A;  1YBT A;  1UEK A;  3FFI B;  4JI3 F;  2RE1 A;  4J90 A;  5ETO A;  1JLQ A;  5DDP C;  3RW6 A;  2D3Z A;  2AW0 A;  5EUH A;  1X9M A;  3RAX A;  5KFX A;  1WHX A;  3VAI A;  2OPS A;  1SJQ A;  1QTM A;  2XZW A;  2VIH A;  2K3I A;  4TLQ A;  1FRI A;  1ZM9 A;  4I0W A;  1HBO B;  5KFR A;  4DV0 J;  3R6G B;  4ER8 A;  2VOD A;  2ZVI A;  3I0S A;  4O3S A;  4LVN P;  4TY8 A;  3N28 A;  2MQM A;  4L73 A;  3MEG A;  5AJ3 F;  2AGO A;  3OXG A;  4AL7 A;  3DOK A;  1RT7 B;  1VCT A;  4FZV A;  3ISZ A;  3LQV A;  1PJ5 A;  1H38 A;  1VQ7 S;  1IUJ A;  1R27 B;  1LWF B;  1RAF B;  4JI1 F;  1S4F A;  1FER A;  2MEW A;  4Q5V A;  1N34 F;  4PWD B;  2MKS A;  3CD6 S;  5BJR A;  1U7L A;  2DB1 A;  5F8I A;  1CPZ A;  4R5P B;  3BV8 A;  1VQM S;  1DQ9 A;  2U2F A;  4C8N A;  3L3C A;  2LQ8 A;  4DV4 J;  2W2N P;  2J0X A;  1FKP A;  5KT3 A;  4OX7 A;  3C6T A;  4OFZ A;  3D6T B;  2XS7 A;  2XS2 A;  4DSI A;  2FY8 A;  1X5S A;  4WJB A;  4C3L A;  2H4Y B;  1M1G A;  2Y1R I;  4M1K A;  4ZVO B;  4TU8 A;  2B4P A;  2OEJ A;  1FEH A;  2EK6 A;  3UW1 A;  2CQ2 A;  3BF4 A;  2V8V A;  4ZN1 A;  1VBZ A;  3GR1 A;  2HBY B;  3TZY A;  4NI2 A;  4P9S A;  3Q24 A;  1HI1 A;  3VF0 B;  3UN3 A;  3ZNU A;  4ECV A;  3IRX B;  4F2S A;  3T9N A;  3D1O A;  3L9Z A;  5E3Q A;  2IRY A;  3EPI A;  1IKV B;  3H5X A;  2ZBR A;  4HH1 A;  5CCL A;  4B3R J;  5K8O A;  3H8Y A;  2DGV A;  4DQR A;  1U1M A;  2P9G A;  2G9O A;  5HP1 A;  1Y00 A;  2MQ8 A;  5J2M B;  4NZ7 A;  2M5Y A;  3I82 A;  3OD2 A;  3UWT A;  5AE3 A;  2Z2L A;  3NGK A;  4P2F A;  3CCJ S;  1C4A A;  2D3O R;  1U1O A;  2DNH A;  2KT3 A;  1BE4 A;  5G0R A;  5B0F A;  2VJV A;  1TR0 A;  2M52 A;  4TYA A;  1MG7 A;  3WQP A;  3N79 A;  2M0G B;  3I96 A;  2Y8W A;  2VDI A;  4PWU A;  4YQW A;  3PR5 B;  1AXQ A;  1KQG B;  3C14 B;  5IT9 U;  3P4U B;  3N0V A;  3TRG A;  1DHM A;  2KYZ A;  3S7R A;  5F8H A;  2KTQ A;  4CM0 A;  4DUZ F;  1XMQ J;  1NLK L;  3MMB A;  4RZR A;  1ULR A;  4QBU A;  3B54 A;  2FGO A;  3SCK E;  3HD2 A;  2AHO B;  1NHK L;  1EIY B;  1ZOT A;  4O44 B;  1YJR A;  2WVD A;  3NGR A;  2W8K A;  4M95 A;  2Q43 A;  3JXO A;  2DGO A;  3UE2 A;  5AE1 A;  5B7W A;  1J5O B;  3PRV A;  4B3S J;  2BE7 D;  4B9M A;  3QSI A;  3IFE A;  1J27 A;  1KWM A;  2XZD B;  3BO3 A;  4YR0 A;  1HWK A;  1HNZ J;  1D9F A;  2VL1 A;  3DRX A;  4NLX A;  4U9R A;  4CLT A;  4DN0 A;  2Q6C A;  3K59 A;  2YKP A;  3CJT A;  4I2P A;  3P8B B;  2BOP A;  2HHQ A;  2G13 A;  1QE1 A;  5KG6 A;  2E1C A;  3QJP A;  4ED7 A;  4H4O A;  2VKZ G;  2KJW A;  2KG0 A;  2FLN A;  3KLF B;  4DV7 F;  1U6F A;  3PKM A;  1FXL A;  1RAJ A;  2XG8 A;  3MI7 X;  2C2R A;  4LMZ A;  4PQU B;  3K5P A;  2K2P A;  5DZ7 A;  4DMZ A;  1R0A A;  4HT5 A;  1EJ7 L;  4IDK B;  1BMQ B;  1SJ1 A;  1R89 A;  1WKK A;  4KE5 A;  3D0H E;  4UTG A;  3V6J A;  1LWE B;  2NPI A;  3A8I A;  5D78 A;  5KTQ A;  1X8D A;  3JQJ A;  4KIA A;  2W9B B;  4C0H A;  3JB9 k;  2PMH A;  2FLO A;  2MQO A;  2ZUG A;  1FX4 A;  4Q8F A;  3GV8 B;  1JKH A;  2KM8 B;  1TFY A;  2BJ8 A;  5KFU A;  1N6Q B;  3PY8 A;  2BM0 A;  3E2E A;  5FII A;  2B9E A;  3GE9 A;  4V19 X;  5J1E A;  2KRR A;  2CNL B;  2IJF A;  2LQB A;  3FQL A;  3NEK A;  1WNE A;  2VH7 A;  3VGV A;  1QVG R;  3BZQ A;  1WI6 A;  3QO9 B;  1GTE A;  2LQ9 A;  4UQT A;  3CCQ S;  3MEE B;  3B4M A;  2PEH A;  2QN6 B;  5JJB A;  4Z7C A;  3NG8 A;  2GA7 A;  4UUX A;  5F3T A;  3UCG A;  4F02 A;  3DN9 A;  1F9F A;  2W2P P;  2QA4 S;  1M5H A;  3D3B J;  4Q0B B;  3WZ0 A;  1MWZ A;  2J6U A;  2OFH X;  4FYY B;  2PI5 A;  1NPP A;  3CCL S;  1IWG A;  1HBM A;  1HMV A;  4LRC A;  2QL9 B;  4Y2A A;  3PIP Q;  1SIW B;  2AJF E;  4DV3 F;  2WB4 A;  3V6K A;  3K8V A;  3WHI A;  4GKK F;  4W90 B;  5LMU F;  4J91 A;  1DZ5 A;  3TAN A;  1QM9 A;  4JI7 J;  1R8H A;  4X4O A;  2YPY A;  4YN3 B;  5E33 A;  4D3H A;  2CNN B;  4JUZ A;  1EHW A;  2D41 A;  1RT5 B;  4DR5 J;  3KLI A;  5KFF A;  2RF2 A;  2YQ0 A;  2ZZT A;  3I9Z A;  3KJF B;  5KG3 A;  4GKJ F;  1J2V A;  1ZH5 A;  3TWZ A;  3DKD A;  1Y3J A;  4N7T A;  1S1W A;  1HYS A;  1HBU A;  2AKW B;  3I31 A;  1S7I A;  5DG7 A;  4GMK A;  5DO2 A;  1M5P C;  2PDA A;  1RZM A;  4IFV A;  3ONQ A;  1Y5L B;  3HHL C;  1JJ4 A;  5GAD U;  1S10 A;  2H54 B;  1QSS A;  2QTW A;  1T7P A;  2FYX A;  4DCP B;  2Y1J A;  1NKE A;  4LF4 J;  3OTD A;  2CG8 A;  2B4O A;  1WC1 A;  4K4U A;  4OL8 A;  3QYY A;  3H25 A;  3M6U A;  3LAM A;  4OZ5 A;  4K59 A;  3EVO A;  1KQS R;  1H7W A;  1CSJ A;  2CDQ A;  3QIP A;  1O6X A;  3IG1 A;  2R8I A;  1WC0 A;  3UVJ A;  4NEZ A;  2KFN A;  3MEE A;  4DL3 A;  2GFF A;  2JRS A;  5BXI A;  3HSG A;  1JLA A;  1QE1 B;  5KFL A;  1RYS A;  3Q2T C;  1X5P A;  4TU7 A;  4FS1 A;  3EWG A;  1N5T A;  2UUW A;  4DX8 H;  2K1R A;  3KLF A;  4FKY A;  4H54 A;  5CH7 B;  2CQB A;  1R8A A;  1C0T B;  2A10 A;  4X66 J;  1IR1 A;  1RLD A;  4J37 A;  4URG A;  2FJA B;  2NS1 B;  3DGP A;  5HBM A;  4JI1 J;  2RD5 C;  2XMK A;  2P9E A;  4DHV A;  2MGZ A;  1CVJ A;  2ZVS A;  1B0P A;  1LWE A;  4OZ3 A;  3QPI A;  1YLX A;  2XI2 A;  3X3U A;  2V8D A;  5F8G A;  1TUG B;  1Z2L A;  2KXH A;  3AXM A;  5EGY A;  1ZTT A;  2LXF A;  3MD1 A;  3TZW A;  2AJ2 A;  2K06 A;  2MLY A;  5HLF B;  1RBL A;  2CJQ A;  3K89 A;  2YBV A;  5IWA F;  1N88 A;  4ZPC A;  2DCU B;  2J5A A;  2HQG A;  2QLF B;  3PV8 A;  4DL7 A;  3QO9 A;  3C15 B;  1QSL A;  1HBU B;  2ZH7 A;  1XWL A;  2HQ3 A;  3GG1 A;  3WX8 A;  5LMN F;  4ED8 A;  2XY7 A;  4NL5 A;  1B3T A;  5IM0 B;  3OHB A;  1ZBT A;  3VTI A;  2DNG A;  2FB0 A;  3G9C A;  2RS8 A;  3I4P A;  2WB1 D;  3QT7 A;  2IAJ B;  1WG5 A;  1TEL A;  2J9E A;  3K5O A;  3BM7 A;  1Q1K A;  2WOM B;  1UEU A;  5AXN A;  2F8H A;  2W7P A;  4DLG A;  1SKS A;  5ETS A;  2D74 B;  3IWX A;  3AD7 C;  1L3T A;  4ZVS B;  5IT0 A;  2D7S A;  1NHU A;  2HZA A;  2NQP A;  5FJ4 A;  4DV6 F;  1RTD B;  2Z2Y B;  4JI5 J;  5L1K A;  4DPW A;  3SQO P;  3M2V B;  1RDR A;  3H4B A;  3X1L B;  1HL6 A;  3MMC B;  4WZM A;  2DHH A;  4QWB A;  4WP9 A;  1N34 J;  2V50 A;  2P6S A;  3CJQ A;  3IR7 B;  4LF5 F;  1HNW J;  1OMS A;  3VGT A;  2GX8 A;  2ILY A;  4P2M A;  5HBM B;  3VAF A;  2BYC A;  2YPZ A;  3AOB A;  5D15 A;  5T7L B;  1BQX A;  4ZVQ B;  2W9A A;  1VRT A;  2D1C A;  4QZV B;  4EYI B;  3UCU P;  1TK0 A;  2YVS A;  3DNC A;  2RSQ A;  4M5D A;  1KVK A;  2EBE A;  3E51 A;  4LBI A;  2FQQ B;  5EWF A;  1KR4 A;  1VHI A;  4JYA J;  3P3D A;  5KG5 A;  5IV4 A;  3V81 A;  3P49 B;  1ZS6 A;  2AJ4 A;  5LL6 d;  2ZHB A;  1HD1 A;  1DJ0 A;  3W60 A;  3RZA A;  5KT7 A;  3WIV A;  3JAM Y;  2BV3 A;  4QYR A;  1RYR A;  1ZZN A;  1BQN B;  3D6H B;  1TAU A;  2W4P A;  2FVR A;  1S1V A;  3KXD A;  4IYQ A;  3OVA A;  2YNH B;  2HMI B;  1PBA A;  4MIB A;  1T9W A;  3VQT A;  2DR5 A;  1YJ7 A;  3FSY A;  4HL9 A;  3MR5 A;  3GFH A;  3DM2 B;  4YP3 A;  1JQG A;  4WFY A;  1UVI A;  2CPE A;  2XQC A;  1WTF A;  1PYT A;  2CPX A;  3OR1 A;  1UW4 A;  1SBR A;  4GVL A;  2OKQ A;  4I7F A;  4IFY A;  4LRF A;  4ZCK A;  5KG1 A;  1RHM B;  2YWG A;  2H9Z A;  2PC6 A;  2VAS A;  3KHH A;  2Y9H A;  4DF8 A;  2AWZ A;  5D4O A;  1UMJ A;  1TKZ A;  5D6G A;  4KTQ A;  2EBG A;  4WK1 A;  4FBT A;  1RT2 A;  1EAR A;  1UVN A;  2Z58 B;  2CJX B;  2RHQ B;  4RUB A;  2GVZ B;  1RA6 A;  2XMM A;  4JI8 F;  4P2X A;  1JXE A;  4ANE A;  2V8G A;  5F41 A;  5C24 A;  4KHP J;  4MYT A;  1HNI A;  3T5L A;  3HT0 A;  3F41 A;  3H5Y A;  4OZL A;  4O3Q A;  4NA1 A;  5BR8 J;  5IOL A;  3CJ4 A;  4IOC Q;  2DNZ A;  4CLL A;  3MMA A;  3T9Z A;  1S0O A;  3PYD A;  2DXE A;  3DRY A;  3PX6 A;  4LR7 A;  3PYG A;  2KDO A;  2J8S A;  3D0G E;  5HMX A;  3JAM U;  5ETR A;  4JBC A;  2B6A A;  4DPU A;  4DZ6 A;  2CWK A;  2BQU A;  2WSE C;  4JV5 F;  3AAW B;  1SC6 A;  2RKI B;  1OYD A;  3VCD A;  1T9T A;  1FWK A;  3GZ7 A;  4OI4 A;  1HWI A;  2YNF B;  4MIA A;  2ZJP Q;  1SJ4 P;  1WF0 A;  2WOM A;  3RUB L;  1S59 A;  4LF2 A;  1FDB A;  4BBY A;  2MKH A;  1U6B A;  4YDX A;  3MEG B;  2M88 A;  3KNG A;  3O6Q A;  4BWM A;  3PW4 A;  4YHH J;  4RW9 A;  1GH8 A;  5DDO C;  3L7U A;  3LOU A;  5L9X A;  2MHE A;  4IQM A;  2IM1 A;  4DX6 A;  1CUL B;  1QY7 A;  4ED0 A;  2J7W A;  3TJ9 A;  2VC1 A;  4L3K A;  4WCE Q;  1DAX A;  2UUB F;  3HK2 A;  2CQC A;  4C97 A;  1FRX A;  1QJH A;  3IS9 A;  3R27 A;  4MMO A;  3TYT A;  2JEF A;  1H98 A;  1BHN A;  3DM2 A;  3RBE A;  4WTY A;  5KG7 A;  2IBK A;  4DSJ A;  2I5J A;  3Q23 A;  3P5B P;  3BYR A;  2YY3 A;  2DEJ A;  1RWU A;  3OR1 B;  4LRD A;  4NEY A;  2EFN A;  3RG6 A;  1FDD A;  3SI8 A;  2FLP A;  2JFK A;  4RX6 A;  1R43 A;  4M5D B;  4MYU A;  3G86 A;  3MPW A;  1KRP A;  2MLZ A;  1NK7 A;  1M5S A;  3M1V A;  2HNY B;  3DYA A;  4DWI A;  2V8H A;  4B02 A;  2RQC A;  4B3M F;  1F1B B;  2B0G A;  2GMJ A;  2MMY A;  3W66 A;  4Q44 A;  4Y2M A;  4TY9 A;  1R6Y A;  4B9L A;  4WE1 B;  2VQE F;  2WK4 A;  2FHJ D;  4TXS A;  4DI6 A;  4PG5 A;  4PUO B;  2BA9 A;  3GR0 A;  1YG0 A;  2X51 A;  4G1P A;  4Y2K A;  1V6H A;  2F4V F;  2J0S D;  2C3M A;  2O66 A;  4DR7 J;  2YNH A;  3SSR A;  3KJQ B;  3J7Z T;  2JSX A;  3IWL A;  2IVM A;  2DGQ A;  2EG1 A;  3LA0 A;  2CNO B;  4WP8 A;  4F36 A;  2QJ3 A;  3D1Q A;  5DRK A;  3HZE A;  3R5B A;  5GAE I;  2FZK B;  1YKW A;  4RNH A;  2ZM6 J;  4DOZ A;  3BPD A;  3FZB A;  5AXL A;  3HX9 A;  3KMQ A;  2N7Y A;  2KXF A;  5HO4 A;  1N5Y A;  2QG9 B;  3W8G A;  1C4C A;  2DNL A;  4NYZ A;  2FJW A;  3BGR A;  2MB0 B;  1JLB A;  3UDV A;  1EKR A;  1NSK L;  3FQK A;  5KT2 A;  3TI0 A;  4F0K A;  1RT2 B;  3CW2 C;  4KB7 A;  2GO8 A;  4MJK A;  5LM7 E;  3JSR A;  1Q95 G;  1SH2 A;  3HI9 A;  1VFJ A;  2A6O A;  2CJB A;  4AQY J;  3RTV A;  1F60 B;  2YNI B;  3DDN A;  1REV B;  1TVR A;  2JWN A;  4LR9 A;  2C2Z B;  3LWL A;  2HBR B;  3POT B;  1X4E A;  2CZ4 A;  3K57 A;  2V69 A;  3W63 A;  3OLA A;  3BGO P;  2AU0 A;  3A3P B;  2WBR A;  3MEC B;  2NXJ A;  1OPZ A;  4CWB A;  1TL5 A;  2A2C A;  2EPI A;  4QW8 A;  1S9E B;  3MGJ A;  2V9W A;  4B3O B;  4KJI A;  2VDH A;  3KK1 A;  1S6Q A;  4QR0 A;  4IR9 A;  4OHY A;  2ZOG A;  3AY0 A;  4KH1 B;  5LMN J;  1U6Z A;  1UZH A;  2XSF A;  3CCS S;  2VG7 A;  1WG1 A;  2V2V A;  4U67 Q;  4FP9 A;  2LA4 A;  4ZCM A;  3GSD A;  2GVD B;  1S6P B;  3IGV A;  4YUD A;  4GVB A;  3THP A;  3TNV A;  2YX7 A;  2M70 A;  4RW9 B;  1ZTW A;  2E5L J;  1QLN A;  1X4A A;  2VPY B;  3EGW B;  1U24 A;  3QWU A;  5KT4 A;  1UKU A;  2DNP A;  1D8Y A;  2CFX A;  3CTR A;  2UV8 A;  3SFG A;  4RU9 A;  1WOP A;  3R1L A;  4JV0 A;  2QLJ B;  2HIY A;  4F4W A;  1YRX A;  3BBC A;  4AL5 A;  4DS5 A;  2QZ8 A;  3GFX A;  3Q83 A;  3TAM A;  3UR3 C;  2QFJ A;  2CAJ A;  1WDT A;  2AYG A;  2KZZ A;  5D4P A;  4F26 A;  1NDC A;  4R0J A;  1GMU A;  2WSC C;  4CI0 B;  4NCG A;  3MUM P;  4M5N A;  4ELU A;  4NRU A;  4J9K A;  3HSJ A;  4ES3 A;  3IWN C;  3DRS A;  3G8T A;  2L9W A;  4JYA F;  1M5O C;  2MKJ A;  1AT1 B;  2ZHA A;  2BZ2 A;  1Q5Y A;  5D0E A;  1I51 B;  1V5V A;  3FCH A;  2FPH X;  3HVA A;  5GAG I;  2HNY A;  3DYA B;  5ETM A;  2BAN A;  2IYI A;  2YNI A;  4I2Q B;  2UVU A;  4O4G A;  3K2Y A;  2R8K A;  2MZR A;  2JOQ A;  3Q8Y A;  2PMW A;  5DGA A;  1FD2 A;  4C3M A;  1GNK A;  3HHE A;  2B3T B;  3BGL A;  4CNZ A;  2VOP A;  5KT5 A;  3WC2 A;  2CIM A;  5CZX A;  3AXK A;  1D9A A;  4ECS A;  3PX4 A;  4RWX A;  2AJ0 A;  5HVF A;  1NB7 A;  4IRC A;  4K4S A;  1REG X;  4QYZ K;  1DQ8 A;  1NPR A;  1FX2 A;  2P6T A;  3KK1 B;  3K5M A;  1U2R A;  1HI0 P;  1I3O B;  3A8E A;  1RT5 A;  3JQK A;  4CLZ A;  1LWC A;  1NCL A;  4ENO A;  5L1I A;  4TLR A;  2LXU A;  4QW9 A;  3K7R A;  2KFZ A;  2XMJ A;  1IJE B;  3JSY A;  1U49 A;  4IRD A;  4ICL A;  4OI2 A;  3KDN A;  3A8K A;  2SXL A;  2FC9 A;  4OJ3 A;  2E5I A;  4RNM A;  5J2Q A;  2WW8 A;  1ZAX A;  1FNM A;  2GIR A;  2HFV A;  3M8P A;  4YDD B;  4ED6 A;  3I56 S;  3KJV A;  1IKX A;  2XO6 A;  1D9D A;  4KV8 B;  4X64 J;  1N5S A;  3HT3 A;  4LF8 F;  2BMB A;  4Y65 A;  3R8Y A;  1N4L A;  4NMX A;  3NNH A;  3Q2S C;  3ELH A;  3CB4 A;  3MEC A;  3PJ9 A;  1N48 A;  5FDL A;  3GYN A;  4A8Q A;  1PAE X;  2AV5 A;  1WKJ A;  3DLK B;  1PIL A;  3R5A A;  3IAS 9;  2BR0 A;  1Q7Y T;  5H1S V;  2J6T A;  5LMU J;  4ED2 A;  1R8P A;  1R7I A;  3ZTP A;  3NAH A;  4UW2 A;  2VOO A;  3MM7 A;  3W5X A;  4M8L A;  4O4G B;  1H7X A;  4BHQ A;  3QGP A;  1XR6 A;  2K7J A;  1BC6 A;  1F5B A;  4GVB B;  3DOK B;  4DV2 F;  2ZM6 F;  3JQM A;  1X4G A;  4RR5 A;  2HHT A;  2HFU A;  1SXL A;  2GQQ A;  2BRL A;  4KHM A;  3CGI A;  3OXL A;  3ETO A;  2HG4 A;  2RH3 A;  4ZJL A;  3RYL A;  4OX9 J;  4XDC A;  3NS5 A;  1S0V A;  3EZU A;  2FGC A;  4XAK A;  3OR2 B;  2BJE A;  4IUF A;  3CE8 A;  3JSB A;  3N6N A;  5ETK A;  3QJJ A;  1JLC B;  1RTH A;  1WEZ A;  3OVS A;  2C1E B;  4A8K A;  1UW9 A;  5KFH A;  5HLF A;  1F5A A;  1VIS A;  1SL0 A;  4R8U A;  4ZIT A;  2XLK A;  4ELT A;  3AB2 B;  1RAO A;  1RT4 B;  1H2V Z;  1RHK B;  3C6T B;  3NKY A;  5K14 A;  2OI2 A;  4F4A A;  3NCQ A;  2MY7 A;  5C7P A;  2DR7 A;  2OH2 A;  4HVZ A;  1RT1 B;  3VAH A;  2CJ9 A;  3KLG A;  3A3O B;  3MEK A;  1OIA A;  4WK3 A;  4ZVT B;  1JLE B;  1S1T B;  2VFV A;  1VK8 A;  2DBB A;  3H0P A;  2JEG A;  2DIT A;  3TVK A;  4K4W A;  2E1P A;  3FSI A;  2LQ5 A;  5CYM B;  4CH7 A;  3VGS A;  2HHS A;  2YXL A;  1IKX B;  1LQ9 A;  2UVW A;  1DFD A;  1PJ6 A;  3BDP A;  1QDU B;  3JSM B;  3IO1 A;  3PX0 A;  2UU9 J;  3ENV A;  1TL7 A;  3GJS B;  3T6J A;  2KH9 A;  4NXM F;  2C3O A;  2HVH A;  4ZCI A;  3JTN A;  3RB3 A;  4P7V A;  1RU1 A;  3QFH A;  1O8B A;  2YKM B;  3M05 A;  2AJ1 A;  1BQM B;  1G4C A;  2HWT A;  2F3J A;  3SFU A;  4USJ C;  4EBD A;  4K8R A;  4U7U D;  3ZZ0 A;  4GKK J;  3MAA B;  3AOD A;  4I2P B;  1UVK A;  1T95 A;  3GYG A;  3W8P A;  3OTO J;  1XMQ F;  3CED A;  2G2O A;  5G0R B;  2EKN A;  3FDS A;  3VAM A;  1XMO F;  5A8W A;  4OI0 A;  4ZOS A;  3I55 S;  5J2P A;  2VA2 A;  1HFE L;  4ANC A;  3AFG A;  4OYM A;  2JHE A;  1C1B A;  2HK2 A;  3IBC B;  2EXU A;  3KUE A;  3LH2 S;  3BGU A;  2RRA A;  3C14 A;  3ISN C;  1R0A B;  4NRT A;  4X65 F;  3CCZ A;  5A8R A;  3KK3 A;  1RTZ A;  4HT7 A;  4ERD A;  3M6X A;  3TAR A;  3LAN A;  2Q1L A;  4CO4 A;  4PXD A;  4ZP9 A;  3VQS A;  2UVV A;  3OR2 A;  2W8L A;  3GU0 A;  4MTP A;  4ETX A;  2DIV A;  1CQM A;  3LTO A;  1CS4 A;  2EW9 A;  1VQ4 S;  3PDN A;  1T9U A;  4HKQ A;  1TL3 A;  2M3D A;  2RAQ A;  2E7W A;  2R7Q A;  4O4R A;  4PCQ A;  1C0U A;  4Q2L A;  2HK3 A;  1B7F A;  3SDE B;  3UQS A;  4EBC A;  3Q8Q B;  1YTY A;  2I38 A;  1TKT A;  3BRE A;  3GPA A;  4ZVU B;  4ED3 A;  2HS0 A;  4NML A;  5CYQ B;  4F0H A;  4RU2 A;  5F8J A;  3MED B;  1T03 B;  2HHW A;  2R7X A;  1MSW D;  4MH8 A;  3ILO A;  4WII A;  2R4F A;  2V0N A;  5CXT A;  2UU9 F;  3V6D A;  1PC5 A;  2YNG A;  4FNI A;  6AT1 B;  2AZ3 A;  5I3U A;  2B8P A;  4IO1 A;  1NDL A;  4GO7 X;  1FTC A;  2AYB A;  2DPJ A;  1KDN A;  1GXU A;  4PQU A;  4LIW A;  2ZH5 A;  2XCP A;  2GC8 A;  2JZ5 A;  5D0R A;  4ZHR A;  5F3Z A;  2UXD F;  2PA3 A;  4W4M A;  2MYF A;  4IG3 B;  1FRJ A;  2LVW A;  3U1M A;  3DOL A;  3TX0 A;  3CIM A;  4NLD A;  2DRB A;  8RUC A;  4QU6 A;  1RUS A;  2ZD1 A;  1XIQ A;  1RAG B;  3E3X A;  3ET6 A;  4HHJ A;  4C8M A;  4RNN A;  1IBK J;  4X62 J;  4LFC F;  4MKY A;  4K5R A;  4DPY A;  2C28 A;  2QLW A;  3KLI B;  5J2P B;  1URN A;  1ZA1 B;  2B8Q A;  4ECT A;  1XQI A;  5J1E B;  3CCW A;  2XTJ P;  1WC6 A;  2BJ7 A;  3NMR A;  5KFZ A;  4WPA A;  1U8S A;  4FPR A;  2DIS A;  1VRQ C;  5DM6 Q;  2Z8Q A;  3C2P A;  2G0C A;  4DV2 J;  1IR0 A;  3MAQ A;  2ROP A;  3DLG A;  2F65 A;  2W7O A;  1DRZ A;  1VS3 A;  3I6P A;  4HTJ A;  2HBZ B;  1GMW D;  1H3D A;  1UFW A;  1DY3 A;  2OD4 A;  2HS4 A;  2QO3 A;  3D67 A;  2RKI A;  3EUN A;  5HSP A;  5LXY A;  2AEM A;  5KFD A;  1U0S A;  4M94 A;  2FUG 9;  2WVE A;  2XYP B;  2OIH A;  1RU2 A;  2CPH A;  2MJU A;  2AF6 A;  2YNF A;  2R9L A;  4P6Q A;  3QSY B;  1MWY A;  4LSL A;  1K0V A;  3SDE A;  5EN1 A;  3IA0 A;  1F6T A;  4L6V 3;  3GII A;  3BH7 B;  3MM5 B;  4LRE A;  2BM1 A;  1SPB P;  3G6X A;  3J81 j;  3DDK A;  3GLJ A;  4KKO B;  4ZP8 A;  1TAQ A;  2BOA A;  4LUB A;  2MZS A;  3PXG a;  3J81 Y;  1I94 F;  2R2T A;  2FZG B;  2R8J A;  2IYG A;  4DV6 J;  2OSR A;  2XSJ B;  1EQM A;  2KU7 A;  2DRA A;  1S48 A;  3BKT A;  1Q53 A;  1K73 T;  1Y4Z B;  4MKV A;  4CLS A;  4TQR A;  3M2U B;  1XTZ A;  5KFT A;  1Q82 T;  1S1U B;  2DR6 A;  2XO7 A;  3M8S A;  5A8K B;  4K0K J;  4KR0 B;  1RAE B;  1E6V B;  5HI7 A;  1SKR A;  2QSW A;  1FJ7 A;  2DNM A;  2DNK A;  1HYS B;  2ALY B;  3DI6 A;  1WHV A;  2W25 A;  4RL1 A;  3M9M B;  2DGX A;  3PEH A;  3MM9 A;  4E0D A;  1L3S A;  2KXN B;  5E3A A;  4FYV B;  2NYI A;  3NGD A;  4JI4 F;  3UI3 A;  3EGN A;  1TL3 B;  3H20 A;  1UVM A;  2LP4 A;  3DLH A;  1RA7 A;  3NS6 A;  4GO5 X;  1RJJ A;  1QAY A;  3CSK A;  3CJ8 A;  1AYE A;  4RW6 B;  4PKD B;  5JXS A;  4ZJQ A;  4C8O A;  2KL8 A;  3K0J A;  2MSS A;  2VF3 A;  2COL A;  4X4P A;  4OYX A;  1JNR B;  3GFY A;  2YWF A;  3ILJ A;  2BRK A;  1LWX A;  3UVJ B;  1Q16 B;  4WFN Q;  1U1R A;  1UVJ A;  2B56 A;  3Q89 A;  3UD5 A;  4ZMM A;  4QPX A;  1P9Y A;  2MDA A;  3W2W A;  3A3N B;  3F56 A;  2JLG A;  5HMZ A;  2DO0 A;  3F44 A;  1R3N A;  3HFK A;  4LF1 A;  3IRW P;  3IR5 B;  4AYB D;  3IRX A;  4DSE A;  2NSB A;  4MKB A;  2K7K A;  1C0T A;  2LDY A;  4LF9 F;  2HSE B;  2GGP B;  1HHS A;  1FFG B;  1RKI A;  1P27 B;  3MPU B;  1SCJ B;  4HHH A;  3MR6 A;  3CJ5 A;  4PRF A;  3BBF A;  4JV1 A;  3EDR B;  2DH8 A;  3KLV A;  2VBX A;  2C42 A;  2Z4P A;  3W1Y C;  2HHP A;  4NXN F;  1KLM A;  1OYE A;  1D09 B;  1IWA A;  2DK2 A;  2F40 A;  2RIJ A;  3MM6 B;  5F0W A;  4ZVF A;  2HKE A;  4NLQ A;  1FO1 A;  4U96 A;  4DCO B;  5J2M A;  1G7C B;  1U1K A;  3MR2 A;  2OPP A;  3OTE A;  3OL9 A;  4F7V A;  4A8M P;  4RNF A;  1K1S A;  3RAQ A;  1XNQ F;  1P1T A;  4B3R F;  1WUU A;  3SCJ E;  3RRG A;  2AYM A;  4CYU A;  2LU1 A;  3CDB A;  3OUY A;  4Y28 C;  3U02 A;  1RTI B;  1SQF A;  1UPM B;  2D3U A;  4WYL A;  2J7K A;  3TA2 A;  5KFA A;  4YB5 A;  2HHU A;  4R0E A;  3UCZ P;  1S9E A;  1M5K C;  2GHV C;  1P9Q C;  1Y5I B;  3BH6 B;  4ES2 A;  2H4W B;  4WWS A;  3FEX B;  4C6A A;  3GIJ A;  4F2R A;  2IRU A;  3MM9 B;  4C48 A;  3RBX A;  1VOM A;  1VQK S;  1HIY A;  4X4T A;  4B3T F;  2NZ4 A;  1KFD A;  2GVD A;  4KRW A;  1U2C A;  2GML A;  2YQ1 A;  1BQN A;  5I3P A;  2QLX A;  1CJU B;  8AT1 B;  4CIO A;  3SCI E;  3IN5 A;  1S0M A;  4Q2M A;  3CDA A;  2B4U A;  5E5N A;  2AEJ A;  4N8N A;  4QIV A;  3W5Z A;  4JI0 F;  3PIO Q;  1KP6 A;  1AUS L;  1S1V B;  2MZ1 A;  3ZZO A;  4YHH F;  4OJG A;  3J7Z 5;  2P2C B;  4J9Q A;  1D1U A;  2HHX A;  3NS7 B;  2BKO A;  1YJW S;  2DNN A;  2NXE A;  2WHO A;  3NNA A;  4QU7 A;  4A8F A;  1AA1 B;  1R31 A;  3CO0 P;  1OWX A;  4U7U K;  3GJR B;  3TA0 A;  1VJQ A;  3MM8 A;  5A0Y A;  4CZC A;  5KAK A;  1CLF A;  1ACM B;  2LFV A;  2IM0 A;  2P5V A;  4LRB A;  1NU4 A;  3ZZP A;  3M9O B;  4LFA F;  4LF9 J;  4DU8 A;  4P74 A;  3K5N A;  2HVI A;  5SUH A;  1KOH A;  5LSO A;  2VIC A;  2DHA A;  4IQX A;  4OLP A;  2DH7 A;  1N33 F;  2I8E A;  2C2N A;  2DY9 A;  1CBK A;  2DCL A;  3M30 B;  4JI6 J;  1KTQ A;  2QYG A;  1LEO A;  1HNI B;  3UFC X;  3UN5 A;  2CPD A;  3AJ1 A;  4P71 A;  4C3K A;  3OFE A;  1F2H A;  2QMX A;  3G2X A;  1RT6 B;  1PJ7 A;  4RJV A;  5GMD A;  4DR4 J;  1U02 A;  3FBB A;  3MMA B;  4N76 A;  3KDO A;  3AOC A;  3W2V B;  4ZLL A;  5DQH A;  3PW7 A;  1B0T A;  2Y0B B;  4ITS A;  3W2W B;  1NJY A;  2IY5 B;  4EU0 A;  1U0H A;  2CPJ A;  3ZZY A;  4F25 A;  1P1L A;  3ICL A;  3SZ2 A;  3PVX A;  2ZZM A;  1FDA A;  1X31 C;  1NO8 A;  1Q8K A;  1RWP B;  2EWH A;  3NRB A;  1NH7 A;  2QIF A;  1LWC B;  2UUA J;  3W3S A;  5ETV A;  4AUK A;  2OP5 A;  2CWX A;  3WDO A;  1L5U A;  4KY3 A;  4NLW A;  3W5Y A;  3EYZ A;  3DOM B;  4NLG A;  1KVI A;  2O1P A;  2HFZ A;  2RHS B;  2L9N A;  1MML A;  1IBL J;  2B9Y A;  1S6O A;  3MF5 A;  2H3E B;  1LK5 A;  5CQG A;  5A6P A;  1RI7 A;  3UD4 P;  1CUL A;  1JB0 C;  1IQZ A;  1T94 A;  3MM6 A;  4HHU A;  2CQH A;  4A4J A;  7FD1 A;  5KFB A;  3CMA S;  1PYO B;  3KFW X;  2VQF J;  2GV1 A;  1S76 D;  3M4X A;  1M5V C;  4ETZ A;  1PAU B;  5A76 A;  2HFS A;  2YKO A;  4LF7 F;  3MFI A;  2AX1 A;  2FVS A;  2XGQ A;  4EO8 A;  4DR5 F;  4URS A;  4ZPD A;  2XNR A;  3O3L A;  3HVW A;  2KYX A;  1BD6 A;  5JVG Q;  5CHC B;  4EZ6 A;  4ECZ A;  4JI7 F;  3IMQ J;  3IC1 A;  5D3G B;  3UN2 A;  2IHR 1;  2E1M C;  1FJG J;  4F3M A;  3THV A;  4KBI A;  1PSD A;  4V1A k;  4UZC A;  5KFJ A;  1B4S A;  1DTT B;  2MLX A;  3AA9 A;  4ZLN A;  2I6W A;  2WSF C;  5KOW A;  2JVR A;  5GAH U;  2J9D E;  1SC4 B;  1U25 A;  3DRR A;  3C19 A;  3QZ7 A;  3NLC A;  4PG4 A;  2DIU A;  3V5R A;  4PEO A;  3WIU A;  2XGP A;  3B8H A;  4X4S A;  3RB6 A;  2OJ3 A;  4YME A;  3Q8U A;  2XBP A;  1X4H A;  1VHF A;  4KO0 B;  1QTN B;  1VRU B; 
#chains in the Genus database with same CATH homology
 4K8R A;  2W2Q P;  2W2O P;  2Z57 B;  3VV2 B;  1ITP A;  2XTJ P;  2QTW A;  3AFG A;  4JP8 A;  3A3O B;  3WHI A;  1V5I B;  2Z30 B;  3A3N B;  2ZWP A;  3CO0 P;  3GCX P;  2Z58 B;  3VHQ A;  3WIV A;  2E1P A;  3T41 A;  2Z2Y B;  2W2N P;  4YN3 B;  1R6V A;  3SQO P;  2ZWO A;  2PMW A;  3CNQ P;  4OV6 A;  1SCJ B;  3BGO P;  3A3P B;  4NE9 C;  3QFH A;  2Z2Z A;  3WIU A;  4NMX A;  2W2M P;  2Z56 B;  3BPS P;  3H42 A;  1SPB P;  3P5B P;  3GCW P;  2W2P P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...