4M5KA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5kA00
1RAOA 3QBCA 1CBKA 3HD2A 3HSZA 3HSGA 5ETQA 3IP0A 3MCMA 1F9HA 5ETPA 4PZVA 3KUEA 1TMMA 2BMBA 4M5JA 5ETNA 1EX8A 3HD1A 4CRJA 4M5GA 1KBRA 3MCNA 5ETOA 3ILJA 3HCXA 3MCOA 4M5KA 1RTZA 4M5LA 1TMJA 5ETVA 3UDEA 1DY3A 4M5IA 5ETLA 5ETTA 1Q0NA 4CYUB 1HKAA 3KUHA 1IM6A 1EQMA 1EQ0A 4F7VA 3ILLA 5ETRA 4M5MA 5ETMA 4M5HA 4CWBA 4M5NA 5ETSA 1HQ2A 3UDVA 2F63A 1RU1A 3ILIA 1G4CA 4AD6A 4CYUA 3HSJA 2F65A 2CG8A 3UD5A 2QX0A 3HSDA 3KUGA 5ETKA 3HT0A 1RU2A 3ILOA 1RB0A
chains in the Genus database with same CATH superfamily
3GV8B 3CTRA 4RPFA 4JV0A 2BJ3A 3LF0A 4D3GA 1FXDA 2ZHAA 4F67A 2YNHB 5DGBA 4AUKA 4QU7A 4O0NA 2GGPB 2HHHJ 3TX0A 3HKZD 3LP2A 3OTCA 5KFRA 1B0VA 2G2YA 4ECZA 3R1LA 4RW9A 4UOCA 3ZZ0A 2E1AA 3RBXA 2ACYA 4IQMA 2YNIB 4HHJA 3PDNA 4W90B 4YR2A 2FYXA 2YQ3A 1FT8A 5E3RA 1U2RA 1QE1B 3M4XA 2HZVA 2AZ3A 4I68A 2GJIA 4LSLB 4EEYA 1LW2A 5D0RA 2RHSB 3JTNA 3ET6A 4FF2A 4ED0A 1QAJA 2OFHX 1KEKA 5F9NA 1GK8A 3K8VA 1D1UA 1D9AA 1T9XA 4DSIA 4U7UD 2HMIB 2RVJA 5IV3A 3PYDA 4DI6A 2B7BB 3HHLA 1CJVA 4TY9A 2M4MA 1DURA 5KFLA 2BJ1A 1Q53A 4IH5A 5J1PA 2IRYA 1RT4A 2F3JA 2R2UA 1NPPA 2MKIA 1O51A 3KLGB 4F0KA 4I4BA 2C2DA 2CPZA 2XGPA 4G6VB 3OTDA 4ZJQA 2HVIA 2EWHA 1JB0C 2NCKL 4IOAQ 3CO0P 3D2WA 1JLAA 5C2GA 4F3OA 5E2QA 3QMQA 3MDFA 1RP5A 3OW2R 4WTOB 1Q8KA 1G3OA 2V2QA 5HN0A 3QAEA 2OPQB 4IRCA 3FBCA 2XZDB 4LFAJ 2M9KA 3BGUA 2V9WA 1SIZA 1VLOA 4KC5A 4N8NA 4ECWA 4DCJB 1VIXA 1NCLA 1I3OB 2W7AA 2G1HA 2VH7A 5L46A 5DJBA 4PXDA 1TL4A 1Y5NB 5KOXA 4A8SA 2OEJA 1ZZFA 1WDTA 2RU3A 3ISNC 2XYPB 1NJYA 2KXFA 2MHNA 1BXNA 2CPDA 1RISA 1RLDA 3H59A 4ALZA 5DG8A 3QGHA 2VIHA 3IM9A 1SKUB 4DPYA 3TANA 2FLOA 5KFGA 5T14A 1TVRA 2O5DA 1HHTP 1JLBB 1NB2A 3DLJA 3MPVA 3VGVA 3EXYA 3PVXA 1K8AT 1S0MA 1U24A 1N5QA 4F4WA 3MMCB 3HM9A 3KOAA 3UO0A 4NCGA 1WF0A 4BC7A 1R8BA 4M5JA 2R7TA 3W5XA 4DV1J 2HYIB 4CYUB 1J5EF 3DXBA 4PG7A 2CWXA 1NDKA 2BYCA 2AEFA 3CO9A 4B3TJ 3T3FA 3UI3A 2N7YA 4QCLA 2BBEA 3BJYA 2ZNZA 4NLWA 5CCLA 1S6PB 1TZ0A 4R0JA 4Q45A 1UJ6A 1LW0A 2E44A 3DLHA 1QTMA 1FXLA 2P5VA 3U27A 2HBYB 1RT1B 3MD3A 1CJKA 3VQSA 5IWAF 3FKBA 3JTPA 2QA4S 4H4OA 1N5TA 3Q8QB 1XR7A 1S1WB 3HT3A 1MROB 2W9CB 1CVJA 2IM1A 4DV0F 4WWSA 3GR0A 3SFUA 5KG1A 5HANA 1EETA 3J80Y 4H4KC 2WW4A 4Y34A 2NUUG 4UOFA 4ZVEA 1Q79A 3PRBA 1WF1A 1AZSA 1N5VA 3TQ1A 1NSKL 3QJJA 4RBVA 5GADU 5L1LA 4ECRA 2K2PA 2HZCA 4C0HA 2DXDA 2BW2A 5C2CA 4X4PA 3V6JA 2OI2A 4C2MA 2B6AB 2BM0A 3PACA 1XJWB 1U1QA 4KGVB 9RUBA 4HT5A 3C66A 2L9WA 4X4SA 3D28A 2JOQA 4IR1A 5LL6d 4PWWA 3ZZZA 3IAS9 2BJ7A 3NRBA 3TA0A 3AJ2A 1S9EB 3ZTPA 4OI1A 1R7IA 2ZFHA 4MIAA 4QR2A 4GC7A 1VQOS 2CPHA 1JJ4A 3C6TA 3N6NA 4ZLJA 4PG5A 4DQPA 1XMQF 2P8IA 2LLZA 2ADBA 4PG6A 3M32A 1U1OA 3LW5C 3Q2TC 4RW7B 4DV2F 2L41A 4DR4F 5J2MA 5EX0A 3HO1A 3CJRA 3T5JA 2B3TB 1RAGB 1K73T 4JI8J 3C16A 1S9GA 3LGNA 3DXSX 4Y2CA 4BDPA 1C0TB 4X4OA 1BWEA 2DT9A 4CCHA 2YQ1A 1S0NA 4MAKA 2XMTA 3F56A 4I7FB 5FLXY 2WSEC 4DQSA 1CBKA 3MPUB 3IP0A 2DITA 4DSLA 3TQEA 2K06A 1VBZA 2YH0A 2D7SA 5H9FK 5I42A 1ACMB 3G2XA 4LF2A 4UZCA 3OUYB 2UVVA 2HNDB 4LR8A 1Q81T 3CJTA 3DLKB 2JVOA 3D6MB 2QMXA 2RS2A 4ZVPB 7FDRA 4B9LA 3HLUA 2M88A 4WFAQ 4NZ0A 1RHQB 1NSAA 1VQLS 4GKJF 1I5OB 5GAGU 5DS7A 4DSKA 2XHWA 3FCVA 3A3OB 3CD6S 2QLFB 2VFRA 2F65A 3RRGA 4FF1A 2H3EB 3U1LA 2KG1A 2GC8A 2HQGA 3MM8A 5KFWA 1WORA 2ZM6F 3MEGB 3RRKA 4KGMA 1WHWA 4X62F 3JYTA 3I6PA 3TAPA 1F2GA 1U6ZA 2DR5A 4ECYA 4PABA 4PRFA 4O3PA 2RD5C 1MWZA 4C11B 1T7PA 2UUAJ 3WC2A 2EFQA 4YUDA 3QT6A 2Y1JA 4UOHA 1AB8A 4P73A 1PG5B 4KFBB 1S5ZA 3H98A 3RB4A 3QRPA 2KN4A 1VQ6S 1YRXA 4C6AA 2WCXA 3GCXP 4Q8FA 2RQMA 5DDOC 3DRXA 3R2CJ 5IT0A 3MTJA 3TOQA 2J6TA 2I5JA 2BOPA 3G8TA 1G1XA 5DQGA 5D8HB 2PI4A 1D9FA 1NH7A 2WONA 2LEBA 1E6YB 2XWXA 5K5MA 3QT5A 1M5VC 3W7BA 4MTPA 3SBMA 1T8EA 3DRRB 2GQQA 3J7YU 1CJUB 4WBFA 4OZ5A 2YQ0A 4A8QA 3Q83A 5IWAJ 1LWEA 4OJ1A 1HWJA 3GILA 4DZDA 2YX4A 3H42A 1VCTA 4DV0J 4RL1A 3OLBA 4OLOA 1SL0A 4CI0B 1FESA 1GXTA 1FX2A 4KGKA 4RUHA 5KFQA 3M8RA 1YBUA 3CC4S 5KG4A 4Q0BA 2FZKB 5CZVA 2HFOA 1N36F 4RW6B 2QA1A 4A8WA 2RB7A 1VC0A 3D68A 1EIYB 3HSJA 2MGZA 4DHVA 2DYAA 1JXLA 4GVBB 4PKDB 3ZFVA 1L3UA 5D3GA 4A8KA 4QBUA 4C4WA 1TL5A 5J2PA 4LBIA 2CG4A 3VVUA 1OY6A 4F3MA 1WHXA 1HHSA 3MAAB 3EXCX 4O44B 2W8KA 5LSRA 4X4TA 1MN7A 4X66F 3R5AA 4ZPVR 4XIUA 4R8UA 1IM4A 4J90A 4TYAA 2AX1A 2AYEA 3R2DJ 4LVOP 4R5PB 2VZ9A 3OR2B 3IRXB 2DR9A 3OHAA 1B7YB 3V4MA 4WU3A 2CPYA 5M2UA 2M5YA 5IC4B 1P9QC 1UAWA 2RIJA 2QG9B 5LT5A 1RK8A 1PAEX 4QW8A 4DR4J 2ZD1A 2UV8G 1SQEA 2GAHC 2X1AA 2W9BA 2GCFA 4CO4A 3BR8A 1QM9A 2AJQA 1E6VB 3KK2A 2XMKA 1T05B 1GQEA 2MYFA 2AGPA 1S48A 1S4FA 2XHCA 3GV5B 1X5SA 2H54B 3BBFA 4FYDA 4CLFA 2CQ4A 3DRPB 2F1FA 5J1EA 1FJCA 2MZRA 1ZTWA 4N7TA 1FKPB 1WEYA 2JDJA 4OZ3A 1IKWA 2DCLA 4FF3A 2WB4A 2O66A 4CTAB 2MKSA 4K5RA 1P9YA 4NLOA 5CYJA 1O5JA 3D5MA 5I4MA 1YLXA 4LVNP 1IWGA 4PQUB 4DR3F 3ELHA 4ED7A 2MMYA 2RQ4A 4MKYA 2CJYB 4ZLLA 4GKJJ 4C0OC 1U0SA 1KFSA 2D74B 3ITHB 2ASYA 5EWEA 4YMEA 2YNGB 2R42A 4ZVFA 1N88A 4DG1B 4I64A 1VQYA 2VASA 3CCJS 1WJ9A 4C8ZA 2FJEB 2ZM6J 3PEHA 2ZITA 4X62J 4DV4F 1C0UA 3PR4A 1BQMB 2WHOA 4X4NA 4FYYB 4URQU 3OL9A 3ICLA 2EFGA 4HR2A 3T1YF 2R7SA 1EKSA 1F9FA 1TR0A 3ISZA 1FXRA 5KFPA 4U67Q 1L3SA 3W65A 3I0RB 1CULA 4DR7F 3SCKE 4LJMA 4KKOA 3BKUA 4RLEA 2FUG9 1N56A 2WVEA 4ATNA 3CCTA 2YKQA 2VB6A 2DEJA 3DRSB 1RAOA 4X4VA 4GC6A 4IUFA 2VD3A 2ZNYA 1M1GA 5SZTA 4LF8F 3RAQA 2WSCC 5HVGA 2VG7A 2QN6B 2FB0A 3TJ9A 1R0AB 2DH7A 2KXHA 4HLBA 4C3MA 4OV1A 2OSQA 3BZQA 2JLFA 1XTZA 3NXZA 3LANA 4WZMA 5K8MA 3R27A 3RW6A 3ZO7A 4QWDA 4ZVRB 4NRUA 1FKAF 4BCAA 2ALYB 3IO1A 1NB7A 3LP0A 3WIVA 2WW8A 3QFWA 3KHLA 4ZK7M 2NXCA 1U0HB 1FVQA 1BY9A 4KY3A 2QRRA 1RWMB 3PHEA 2HPUA 3SIPB 2C42A 4X4QA 1U1PA 1DY3A 1KQGB 4IO9Q 3IGNA 3UFCX 4A47A 4L76A 4CH0S 3OPKA 1VQSA 1O0PA 1N36J 2OPSB 2A1BA 1C2PA 2KYXA 2HSEB 2E1MC 2E5IA 3V2UC 4S0MA 1QAYA 2XNQA 5HMZA 4K4VA 4IQXA 2XO7A 2KL8A 2WOMB 3CCVS 4NLTA 2DXFA 3UR3C 3FBFA 1Y5IB 2RT3A 2K7KA 2V4QA 4KE5A 2CQBA 2VQFF 3FGVA 1ZH5A 2Y8YA 2RHQB 3MHYA 2JLEA 1WOOA 3OJSA 3D6FB 4OYOA 1KS2A 3JQKA 4CO2A 2VFUA 1FNXH 2CFXA 3PCOB 4FVMA 2NZ4A 1U02A 3A8EA 1RT5A 1BLUA 1GMUA 3KFWX 3BGLA 2CJBA 4WKRA 1S6QA 1T9UA 4NA1A 3GSDA 2VKZG 2KI2A 1EX8A 5KT3A 2Q43A 2W4CA 3P49B 1Z2ZA 4J9KA 4F2RA 1TKTA 4HACB 4I67A 3RAMA 2CNNB 1I94F 2J0XA 3HJVA 5T7LA 2MXYA 3LP1A 3R6LB 4IG3A 1F6TA 4ZCLA 2HS3A 3WC0A 3CCMS 3V4IA 1ICEB 3QRQA 1NO8A 5B09A 3BO4A 5G4DA 1LWFB 4RW4A 2NSCA 3IXQA 2GIQA 1FFGB 1DLOA 5F8MA 3V81B 4DS5A 4RZRA 2D3O1 3EWGA 4DFPA 3KK3A 1VFJA 4RBUA 2BQRA 1GMWD 3PFOA 2SXLA 5HO4A 4A8FA 3HF5A 3EVMA 3LOUA 3BEGB 4PG8A 1SV5A 3K8WA 3NS5A 3CDBA 1HQEB 4CO1A 1MMDA 4ZP8A 1HW9A 4ITSA 2ZDOA 3M2UA 1SH2A 2R3VA 1EZZB 4M95A 4QIGA 1V9OA 1NK0A 5EDWA 1BQNB 3UWTA 3I4PA 2A10A 4DR3J 4LF9J 4USKA 1CC7A 2Z2LA 2DGXA 1RACB 3EYZA 1OYEA 1G4CA 2B5JA 5KFDA 1N32F 1Z1ZA 1GXUA 5K8NA 5LSLA 1SUQB 1XBWA 1HI1A 2FLPA 1V6HA 1VK3A 4B3RF 4KQZA 4K2JA 2BV3A 5FIIA 5EHHA 1FE4A 4WE1A 3P6YC 3KJVB 2CDRB 2PGCA 4M5DB 3AD9C 2LXUA 1XIQA 1NHKL 1SL2A 2X1BA 4JI2F 1IQTA 1UFLA 1RWUA 2LQ9A 5KFAA 4JBCA 4KV8B 3LA0A 1S49A 4KYZA 3T1YJ 1VC5A 3R3TA 2C3YA 5J2QA 2DR6A 2O1PA 3BH6B 3M8QB 2VFTA 5GVQA 2B8QA 1FRIA 2ALZA 5KFMA 1IKXA 2DGOA 2GQCA 1ZETA 4RW8A 4DR7J 2IM0A 1R0BG 2DRBA 3PFEA 1IN0A 2K8GA 5K9FA 2HQ3A 2B9YA 3IR5B 4ZCMA 1XR5A 3RG6A 3T5HA 4LF8J 2JEFA 4DR5F 4PPDA 3MMAA 1RTHB 3ISND 1H73A 3AHPA 1URRA 1X9MA 2RUSA 3FVYA 1WKKA 2VDIA 3TVKA 2ZH9A 2W2OP 3KLFB 2J8SA 1RTZA 4C8MA 2VHGA 2JJ4D 4ZVUB 2CRLA 4FDFA 3KHHA 2ACMA 4OYZA 2DGSA 4ZA1A 4MT1A 2VUGA 4C97A 3H4BA 5LJ3Y 4OZJA 5U47A 4MYTA 4DR1F 3DU5A 4ZLPA 4PWDA 2CAJA 1TP7A 2ASJA 2V2ZA 2GVZB 2CA9A 3PJXA 2WVBA 3GFXA 1RE1B 1RSCA 2E5LF 4OHVA 5HBMA 3A12A 4K8RA 3PIOQ 3ENAA 3C46A 4DV6F 2XLIA 3D3CJ 5E41A 1NRKA 3LP2B 2VA2A 2B4VA 1LOUA 4RW9B 1NPKA 2MLZA 1KONA 3IBFB 1S1TA 1YBTA 2RKIA 3H90A 2BJEA 2HNYA 3G96A 4FNIA 4LBPA 2CYYA 2UUCF 4KT0C 1U48A 2RAQA 1LK5A 1SC3B 1T95A 3KDNA 1HNIA 2ZE2A 5IXUA 5B0CA 3FFIA 2VQFJ 2I9SA 1LW2B 2RRNA 4DEZA 4NLGA 3MR3A 2IRXA 2RQKA 3ET6B 3T9NA 3HHEA 3NNHA 2ZBIA 4NLRA 3IBCB 4AFFA 3A1YG 3KLIA 1D0EA 3VAJA 4K4SA 3Q0AA 2XZTB 2W9AA 3HHLB 4K2XA 2GX8A 2OPRB 1NK4A 1EQMA 3SQOP 2E1CA 2F9JA 4DLEA 2P9CA 4OHXA 2L9DA 3NWGA 3UD5A 1I94J 1RT4B 4KR0B 5DRKA 1APSA 3R6GB 3CCLS 5HSPA 3GJTB 1KVJA 3DU6A 4IOBA 1L3TA 3UPFA 4MIBA 5B0GA 3VAMA 1S6UA 1FHTA 1PJ6A 3CJ4A 1DQ9A 5GMDA 3KJQB 1S57A 1WKLA 1FWLA 5A8WA 2DD8S 3HVTA 3OFHA 4NEYA 4CO0A 2XCPA 4I2PA 1JLAB 1NK6A 2GIFA 1DTQA 2XMMA 1KN6A 1GH8A 3X3UA 1Q78A 1L3VA 2HBQB 1REVA 1N54B 1NNDA 2W4DA 5HQ8A 1RWKB 3ETMA 3CCSS 1N5SA 1KP6A 2BM1A 2GMHA 3W66A 1AW0A 4UW2A 3L7UA 3CCQS 3RR8A 1LXJA 3TO8A 4HI1A 2ZDPA 1UW9A 1U1KA 2U1AA 2DGTA 3OFEA 3QT7A 4LFCF 4M94A 1R6YA 2MKCA 1FDDA 2V34A 3DOKA 4J7CA 4UOGA 1N32J 3MUMP 5HQMA 3BKFA 3HHLC 1IKYA 1M1HA 1RYRA 1ZM9A 4DSJA 5KFOA 4L3KA 5ITHA 2AQ4A 3R5DA 1RT7A 1TVRB 4EK2A 3C2PA 1L3KA 2QZ8A 2E66A 3WZ0A 4DPTA 2DO0A 1S77D 2HZAA 5CYQA 4JI2J 3MI7X 1NJWA 4NCGB 5F9LA 1CJTA 2BEFA 4RNFA 1UCNA 3NY0A 4J9UE 2NZCA 1TL1A 5A8RA 1N33F 3W5YA 4WJBA 2GJ2A 1EARA 1S12A 1F3VA 3QWUA 3H7HB 4JB8B 4JI3F 3MPYA 1QD1A 1T03B 4C9DA 1XMBA 2Y1RI 5ETPA 1P1LA 4OQJA 2VBYA 4ED4A 3N6MA 1X5OA 4WXOA 2AGOA 1R8CA 2EBEA 4DR5J 1LW0B 4MMOA 2CZVC 2KVIA 3I5CA 1YBAA 4TLQA 2WB1D 1Q8BA 1CJKB 5B0EA 4ZVHA 1ZPVA 1HKAA 3FEXB 1X9SA 1HLWA 2BQ3A 2VBXA 4H4OB 5I3UA 1FWPA 3W9HA 4KB7A 1LEOA 2PD1A 4L6V3 1EETB 1S76D 4ERDA 3RUBL 3C6UA 2E5HA 3I5BA 3ZC4A 1RAJA 3HDSA 1RWPB 2QGFB 4YHHJ 4O4GA 1FWKA 2K7JA 3JSMA 3FQLA 3O8WA 2MLYA 1RI7A 1AZSB 3QRRA 5HVHA 4OI4A 2HLUA 4PYDA 1FD2A 2WSFC 4QYRA 2YVSA 3TZZA 3RB3A 3G8QA 1EAYC 4QQBA 2LCWA 1P1TA 2DHAA 2NREA 3EDQB 2E5LJ 2NXUA 3ILJA 4TY8A 3LQVA 2UP1A 3TWZA 5K8PA 1FRJA 4KTQA 1FNMA 4DV6J 4MK9A 1FTRA 1MNEA 2VBWA 3NGRA 5F8NA 2W7OA 1DBDA 2HFUA 3NNCA 4JYAF 2J0WA 2HIYA 2CQ0A 4ZIVA 3TAQA 1RCOB 4QYZK 4CQ1A 4YFUA 1P6TA 2UUCJ 1SJRA 1SI9A 2CPJA 3ONQA 1SVDA 4D3HA 3C6TB 3R8YA 3ZZTA 1YQHA 2ZJRQ 2N3LA 3GLJA 1Q4RA 2KZZA 4EBCA 3VR1A 2KT5A 1OPIA 4BWJA 2AJ4A 4L74A 4M5HA 3I32A 5A0YB 3M32B 1YDLA 2CKWA 2FGOA 4EO8A 2B8PA 3K5OA 4OX7A 4Y28C 5J2MB 1ZBTA 5GADI 4C7QA 3IBWA 2FLNA 4Q43A 1C4AA 4GMKA 2F7VA 2BRLA 4NASA 4FKXA 3C16B 1S9GB 2GHWA 3CB4A 4LRAA 3SI8A 4IFYA 1RJJA 3VGSA 1CEZA 4QIWD 4A8MP 3MECA 2PMHA 4OI6A 4LMZA 3CD5A 4G1QA 1JQGA 2M3DA 2V8PA 1RA6A 1FJGF 3HPOA 3T19A 1S72S 3UE2A 5KFNA 2XMJA 2CQCA 2MY7A 1HMVA 2ZBQA 4ANCA 2BACA 3T6JA 5I42B 1JLEA 3TEHB 3HMJG 3EVWA 4ES3A 3EZ5A 2ZJQQ 3DLEA 4OX6A 3NBPA 3QGPA 4C98A 2DH8A 3Q8YA 2J7KA 4F25A 2DNPA 1LXNA 1UWAA 3MM9A 2E1RA 3JSYA 4DL7A 3MM6A 2X51A 1XR6A 2QT7A 1LV5A 4EZ6A 2DNLA 3UW1A 1A6LA 4P9SA 4LFBJ 4B9MA 2FVPA 3CJ5A 3EM1A 1NK9A 3GCWP 1R43A 2YWGA 4NA2A 4DSFA 3CF5Q 2BQUA 1GTEA 3LTOA 1SH3A 1HW8A 2XTJP 3DLGB 3MM8B 4LFCJ 1CQMA 1C1BA 2KB2A 4J9LA 1XNQF 3UDCA 3IS9A 4CM2A 2QL7B 3JYTB 1QY7A 2MY8A 3G4SS 4WK3A 4JI7F 5CCMA 1WWHA 4CM0A 4ZJLA 2LDIA 3E51A 4DJBA 3TR5A 3CT9A 4JP8A 3MPDA 2PMZD 3GG1A 2Y1IA 3MXHP 2OPPB 4F3QA 1HWIA 2R7UA 4OX9F 4OJ3A 1VISA 3BYPA 2YWWA 2RU9A 4E2FB 2YH1A 3M05A 3K58A 2KXNB 2J5AA 2YWHA 3QO9A 2XLJA 2JL9A 4H4MA 3A8JA 4WK1A 1SPBP 4JI1F 2CIMA 3QGGA 2KO1A 4QZVB 4DV7F 4CLTA 1N0VC 5F8IA 2QE5A 1HYSA 2X1FA 1S59A 1IWAA 2QSFA 3OLAA 2DNMA 4JI3J 5GAGI 4NLUA 3EE3A 3MMBA 1UEKA 2I5JB 5CH7B 4DPUA 2HFNA 3EGWB 2LA6A 4KO0A 4USMA 3EZOA 2ZZMA 4HKQA 2IDEA 5HMWA 3MF5A 4ECTA 2WONB 4U95A 4IOCQ 1RWXB 1GX6A 1K0VA 2C3MA 4KIAA 2P6TA 5E3CA 3TEGA 1RABB 1OMSA 3W3SA 3VZHA 1HARA 3Q8UA 5D0GA 1GFWB 4QOTA 1ZA1B 2HVZA 5HATA 1AUDA 5HI7A 3C14A 1OSCA 1L5UA 2XS2A 3GJQB 3K7RA 3ZZYA 2VA3A 4Q0BB 5F3TA 1FX4A 3DCAA 2IVYA 2MGZB 1PYTA 3QQCD 1TTHB 3CNQP 4LR9A 2W1BA 3NG8A 2V6AA 5D3GB 4K0KJ 3ZTQA 3FZ2A 1RT2A 5J2PB 3PO4A 2Z2YB 1Q8IA 1T94A 4OV6A 4ELTA 4C0BA 1HI8A 5E3PA 3I9V9 1K0TA 1BUXA 4P72A 1QE1A 2MJNA 4JYAJ 2IRUA 2XI3A 3TA2A 3J7YI 1FNOA 2F8EX 4DXLA 4R8UB 2E9RX 2WAQD 1RHRB 2Z30B 2JHEA 1X4AA 4X65F 4RNOA 3FMBA 3CDEA 5THWA 2OJ3A 1R6VA 5EX3A 4B9VA 3PNIA 3B6BA 4QIEA 4Y65A 5ETMA 4DN0A 3M7VA 3AJDA 4NE9C 3HJFA 1Q86T 4TU8A 1F0XA 4DQRA 1SH0A 2E7WA 5G0RA 4ES2A 4ZP7A 2UXCJ 2ZD1B 1DQAA 4AL7A 3R7NB 3KDOA 2W9BB 3R7BB 5C42A 4FS2A 3RZAA 2IYGA 2J76E 3CMAS 2DGVA 2MSTA 3TZYA 3DN9A 3KK2B 3PO5A 2XYHB 4DDFA 4B3SF 3H40A 1FJGJ 5CAAA 3BO2A 3BGOP 5A8KA 2GHPA 5J1EB 1URNA 1S79A 2W2PP 1WC5A 1ZAXA 4U8YA 4Q8EA 3AXKA 1VQ9S 1WSVA 2EBGA 1IKWB 2VC1A 3NL0A 2R8JA 2MQQA 3AA8A 1UVIA 1PSDA 2W2QP 5K14A 1KQKA 2FJDB 3D6TB 3L09A 1IR1A 2DRAA 4A8OA 3MEDA 3TUIC 2MTLA 1KWMA 1J2VA 2F5GA 2OMLA 5HROA 2I2YA 3OQ2A 4HTIA 2DIUA 4EMDA 3TUJC 3BQ0A 2AJFE 3EVOA 1OWXA 4CNYA 1H38A 1R8AA 4DOZA 3W1YC 2R8HA 4KGXB 1RU2A 4HI2A 4LFAF 4USUA 1XNQJ 1RHJB 4UY85 1PJ7A 2E1PA 1HD0A 1C0UB 2IC3A 2ZH1A 1YITS 4EFAC 1U7LA 3KG0A 2K1RA 1LWCA 4FBTA 2GO9A 2Q6BA 3MM5A 3J7AN 4OX9J 4OHZA 1J5OA 2H4WB 1PAUB 4HH0A 2VKRA 1GXLA 4JV1A 2AHOB 2EI5A 1CULB 3HHDA 2KTQA 2BXJA 2AT1B 2FHKA 1IUJA 3W9JA 4P2XA 3B8HA 4JI1J 5DG7A 4DV7J 5IOLA 4XDDA 4ZCIA 1TKDA 1RB0A 1KLMA 5E3AA 3EPGA 2VG7B 2QO3A 4WFZA 4ZKAA 3UDEA 4ZLNA 3EUNA 2AYGA 2ZOMA 5AXNA 3IWXA 1IBCB 5A6PA 2LEPA 3FNNA 3MM7A 1WC3A 1U1NA 4DV1F 1B0TA 3G82A 1YJ7A 1QAIA 2OO4A 1S7IA 3RRHA 1MROA 3TP2A 2K3KA 3QPIA 4ID8A 1Q5VA 3UN2A 1SJ1A 3ILOA 3ENVA 2D3UA 1RT6A 4HTJA 2RMLA 1FRHA 4DUZF 2CQPA 1VHFA 2BKPA 2ZJPQ 1DHMA 2RDJA 2FTRA 3MFHA 3KLHA 4YP3A 2GIRA 1XQIA 3MUVP 3TNVA 2IAJA 2EKYA 3NLCA 2UZAA 1MN9A 2PMWA 2GW8A 3ZNJ1 5JMNA 3BR9A 5JJBA 1MU2A 3GV7B 2L3MA 3IFEA 3VVTA 3C15A 3CIZA 2G9OA 3CW2C 3PTWA 4ES1A 3J7ZT 1FKOA 1WUUA 2OIHA 2PC6A 3QAUA 3OD2A 3KMQA 3PY8A 1F1BB 3MGJA 2IIHA 2MQLA 4ED2A 4KH1B 4M63A 4F4AA 4Y0FA 3AOAA 1QVGR 1WC0A 3VAGA 2FHOB 5CYMA 1RT5B 4X65J 1PKUA 1S6QB 4ED8A 4M5NA 1RU1A 2HBRB 2LU2A 3CGIA 1OY8A 2EK6A 2QSWA 3IN5A 3N9UC 3FUYA 1WACA 4JV5F 2W24A 2B56A 3UN3A 5C24A 1IR0A 3NGTA 3CXCR 4AXJA 5T7LB 3PHTA 3LP1B 3KJNB 4Y2KA 2RRAA 3GIIA 2HFSA 3CD0A 2YKMA 4RUAA 1LFPA 4JI0J 3V4IB 3AY0A 1UKUA 2AP6A 4I2QB 4ICLA 2JH3A 4RW4B 3AJ1A 2MEWA 3M6XA 2B4PA 2FC9A 3GFZA 1DLOB 3LPYA 2G0JA 2NYIA 4B3SJ 2OTJS 1HBUB 2BANA 3KK3B 2K3IA 2V8GA 4NMXA 2I8EA 1HBMA 1UVJA 3MOZA 4JI4F 3MEEA 4JI8F 1RT3A 1SV5B 1UPMB 2LMIA 2E29A 2KG0A 2XSFA 4HH1A 4BC9A 3M2UB 4CNZA 3MOJB 4FXVA 4TYBA 4U7UK 1RAEB 3FZBA 2FJVA 2HWHA 5F41A 2XMUA 3VF0B 2B7CB 1XMOF 2XB2D 2FY8A 3L9ZA 3MR6A 2C2ZB 3IM8A 5BYRA 2FVSA 4ZMMA 2NUHA 2VFVA 4F0MA 4ZN1A 2B5JB 2M52A 4ANEA 2QC3A 3MZIA 1JLCA 4CZCA 3PYEA 3IG1A 1HNVA 2A6MA 4P7VA 3AAWB 4ZVSB 4ZITA 4EZ9A 4P6QA 1KSPA 4WE1B 2DNYA 3T1AA 2VPWB 2UV8A 3RAXA 5A2QY 3HSDA 1HNZF 4EBEA 2OP5A 4OIXA 3GFHA 4PEOA 1FK9A 1N34F 1D3WA 3I96A 2JWNA 1DAXA 1B4SA 2C22A 1O6XA 4AXIA 1U49A 1IKXB 2IPOB 4B9NA 4MK8A 4LRFA 3Q89A 2BW7A 2EEYA 2RILA 1X60A 2DO4A 4OZNA 4Z2XA 1YK9A 2BE9B 1JNRB 1S0OA 1R3NA 4MKVA 1RYSA 5D4NA 2OD4A 3J7Z5 4M8LA 5GMKa 5IS2A 1B70B 3L3CA 3MMAB 2UUAF 3A13A 2CPXA 2OMOA 1S10A 2V94A 4LRDA 1RWNB 3K5NA 1FCAA 5FDLA 3HHLD 3GG0A 3OL8A 3OV7A 3D0HE 3BBBA 3PJWA 4FYXB 4USHA 4B08A 4YB7A 3KHGA 2EC0A 2O3DA 4I0WA 2D9OA 2DNKA 3R7SB 5A76A 3W63A 4IH7A 3PYGA 4OHWA 5DZ6A 3CDAA 2AWZA 2AEJA 2WVCA 4DUZJ 2Z2ZA 1H7WA 3X1LB 3CSKA 1VS3A 3IGVA 2NSBA 3FSXA 2JC1A 4KGZB 4DCPB 3KLEA 4ZPAA 3N4WA 1YJRA 1XERA 4XO0A 5HBMB 2JFDA 2EK1A 2ZEJA 5E7OB 2YNFA 4LBHA 3W2WA 3G6ES 3TZXA 1SQFA 1IJFB 1CC8A 1TK5A 3AXMA 3P3DA 1VC6A 2ZUAA 3I55S 2MQ8A 3GQCA 2RKIB 3RB6A 2HNYB 1EB0A 1N5YA 2H5EA 3MWBA 1YJWS 1VRUA 2RF2A 4ENOA 3OVBA 2B51A 3H5SA 5EN1A 1T9TA 1HNIB 2ZE2B 4GRSA 3FFIB 2R8KA 3JB9k 4DLGA 1R89A 4MKAA 4CLWA 4ZN3A 3OBIA 5HP1A 3CJSA 1SIWB 4N41A 1DQ8A 4QW9A 1P8GA 4OZ0A 4DPXA 3TARA 4KHRA 1VQ7S 5F8HA 1TMJA 1V3RA 3KLIB 2C28A 2FJWA 2IM3A 1UPPA 4K4XA 1S7HA 4V19X 5D77A 2VOPA 3M6VA 4ILRA 1C1CA 1U09A 4WFNQ 4JV5J 2CVEA 2ASDA 4YR3A 2BDPA 2DY1A 4NLSA 3E3XA 2I6WA 3AA9A 3UDVA 3H5UA 2V2VA 3M8ZA 4A8XA 3NEKA 1NHVA 4OZLA 1I1GA 4RX6A 2PEHA 4DL6A 3Q8RB 2HAFA 2CNKB 4RU9A 2V68A 3T41A 1FO1A 5A8WB 4BLGA 1X4DA 4I2PB 1HNWF 1DARA 3UVJA 4WP3A 1DTQB 4CLZA 1S97A 1REVB 3AFGA 1U6BA 3HFZB 2HVHA 1VQ8S 2ROPA 4OMFG 4JI4J 2B9WA 1K44A 3HSZA 1U2CA 4JOUA 2X3DA 5JUMA 5KT6A 2HFVA 2GHVC 5ETOA 2LECA 1O8BA 3JSBA 2VU5A 1U2FA 1NZ8A 4PQAA 2AD9A 2IYIA 2RE1A 4ZPCA 3DHWC 3FDSA 3W8GA 1XMOJ 5D6GA 3H0PA 2UUTA 1SKSA 2M70A 1V5VA 2COLA 4J9RA 5F8JA 3DOKB 2VPYB 1VDHA 4EWTA 4USVA 2B43A 4L73A 2D3OR 1Y4ZB 4P2SA 2YPZA 2HQIA 4ANDA 5KG5A 1BQMA 4L3NA 3FBBA 3FQKA 2DNHA 2RUGA 1CS4A 3F0NA 5CYQB 1HNZJ 4RR5A 1RWWB 2R9LA 1CJTB 4ILMA 1X31C 1N34J 1TL1B 2GNKA 4TQRA 2CNOB 2XY6A 2OEMA 3R5GA 3KXDA 1FJEB 4E0DA 2ZHOA 2Q3PA 3A4TA 1VBKA 1VQ4S 1NJZA 1NJXA 2CNLB 4P7TA 1DZ5A 2ILZA 5GAEU 2J7UA 2HHVA 1KQSR 1HR0F 1R0AA 2WZ1A 2N7CA 1PBAA 3QJLA 2C2EA 5F3ZA 1PYOB 1KR4A 3D0GE 1ZYQA 5B0BA 4LIRA 4M5MA 9ATCB 2VG5A 1JNZB 8RUCA 2DBBA 2HWTA 2QIFA 3IA0A 4RNMA 2JC0A 5I3UB 1R31A 2LQ8A 1OJ4A 1YJUA 3UCGA 1R8HA 1U26A 1VOMA 4NLXA 2GV1A 1JLGB 3D6HB 4MFBA 1RTDA 3C6UB 4YQWA 3C19A 1NDPA 2EFOA 3CCZA 4TNOA 3WX4A 3IAM9 4O4GB 3JSMB 2G4BA 2R7OA 2EXUA 1A9NB 5EWGA 2NPIA 3E01A 1FJ7A 1GNKA 4XK8C 3W61A 1TFYA 5B08A 5IC6B 1VRTA 1F60B 2OTLS 3IRWP 1S1UA 3H2LA 3THTA 5B0FA 4TLRA 2FPHX 4NZ7A 5L9NA 3ULHA 4DV5F 4TY8B 1D09B 5KFXA 2MDAA 4DUTA 5DDQC 1KDNA 4OYIA 3M9OB 2NS1B 5C25A 4N8OA 2RJZA 1QSYA 4IDKA 3HD2A 4PCQA 2E7XA 2BE2B 3M9NB 4FPIA 3RJMB 3J81U 3G86A 5CABA 1H72C 4BWMA 4IKAA 1Q1KA 4O23A 4CWBA 3VZIA 2IA0A 2BR0A 5L1JA 1RAIB 1S1XA 2I38A 2IMWP 3HZGA 2FHMA 3M6WA 4DFJA 1RHUB 2MB0B 2FHJA 5KT2A 5I3PA 4I6AA 1FDBA 4F7VA 3BBCA 4URSA 4OJGA 2X1GA 4X84A 3U02A 2C2RA 3FBEA 4B02A 1WHVA 3OTEA 1VJWA 4NXMF 4OZ2A 2F40A 4QU6A 4IFYB 2HHUA 1KLNA 1HI0P 2IFXA 3MR2A 2FDNA 3I82A 3CJKA 2QJ3A 3I0SA 1D9DA 5IM0A 3MECB 2CXEA 3WBZA 2AV5A 1GX5A 4AYBD 4HVZA 4G1QB 3SZ2A 1PBUA 3D9BA 2PIIA 1B0PA 5D4PA 3T6BA 1LFWA 3TI0A 5DM6Q 2CADA 3CC7S 1HMVB 3JTOA 1YJ9S 3OL6A 1JLEB 1HNWJ 2J9DE 3O1LA 8AT1B 2BKOA 3DLEB 4ELVA 3NBPB 4IH6A 5F8LA 2XLKA 2FLLA 1GEHA 4DR2F 2H5IB 3MM9B 3KUGA 1CLFA 2L9NA 4IO1A 3DOMA 1FI4A 2JZ5A 2Z57B 1AT1B 3M8PA 2A2DA 2BUNA 2YTCA 3JQMA 4UF4A 2HK3A 2NYHA 2FVRA 2CZ9A 2RNEA 4ZP9A 3VAFA 2I0XA 2OHDA 4RUBA 1R0CB 2WK4A 5AT1B 4LF1A 2GVDB 4URGA 2MLXA 2YKNA 2VC0A 1G7CB 1VYAA 1C1BB 1UFKA 4F50A 4DQIA 3FCWA 3IS9B 5L1IA 1KRPA 2JNJA 2N4DA 5L38A 4J9SA 1RBLA 4M1KA 1U1RA 1ZAVA 4NMLA 1PILA 2NR0A 1KTVA 1ZPWX 1VGYA 4J37A 2XNRA 4U96A 1U47A 4LF9F 2GFFA 2PN6A 4F4XA 3I9ZA 4DPWA 5HLFA 3TAMA 1X0FA 2N4CA 1RGVA 3QO9B 1K1SA 3P5BP 4B9UA 1QTNB 2GMJA 4H4MB 3SCLE 4KPYA 4YDXA 3DMJA 3TUZC 1CPZA 3W9IA 4RJVA 1HYSB 5KFVA 3K17A 1JJ2R 1V3ZA 3OTBA 1U25A 2XWYA 4X64F 2ZVIA 3MMBB 1RTHA 1IKVA 1TKXA 5AXKA 4LQ3A 5AE1A 3ENQA 3BPDA 4KO0B 1HQUA 1NZAA 1HR0J 4IG0A 2J0QD 3PEJA 2J8AA 3KUHA 4Q5VA 1UWBA 3T1HF 1EP4A 3BO3A 2V5HG 1W2BR 5H9EJ 5L9XA 5L1KA 1T3NA 2P9EA 3H2VE 2MHEA 1NU4A 3M1VA 3DM2A 3ZTOA 1TK0A 4J9PA 3GIRA 1AYEA 5DGAA 3C14B 3ZZUA 2ZC4A 3D0IE 3CULA 1FF2A 4QWAA 3OT9A 5ETTA 1NKEA 1EHWA 2B0GA 4OZ1A 5E3QA 1NPRA 4ECSA 3BF4A 3HSGA 4TU9A 2MZSA 4OI2A 2B9EA 1CQNA 1XC9A 2HHSA 1PO6A 2V8VA 3D3BJ 1WG4A 2BJDA 3NMAA 6FDRA 2DNOA 1RT2B 2LQBA 4ZS6A 5BR8F 1T9VA 2R8GA 4DV5J 1JLQA 3IMQJ 1NUEA 1EKRA 1HIYA 3TVZA 4XPEA 4N77A 2DHHA 4YB1P 4EI2A 2QLWA 2A6OA 5KG7A 3W62A 2Y9HA 3B54A 5KG0A 3VCDA 2MQPA 5HMYA 2YKPA 3GSIA 1KVIA 1WC6A 4NRTA 1HWLA 3QFHA 3QSIA 4YS2A 5KFEA 1VRQC 4CT9A 3I87A 3H5XA 4PUOA 3HVRA 5KFIA 3W2VA 3L7PA 1LK7A 1RZMA 1UZDA 1H74A 3CD7A 2D69A 2F8HA 2OPRA 2BA9A 5G0RB 1YZ7A 2ZWPA 3LWMA 2HS0A 1KTQA 3U1NA 1HBNA 4KHMA 3CVKA 3P96A 5C42B 3CJ0A 1VBYA 1A0OB 4NXMJ 5J2NA 3P8BB 1FDNA 5D15A 1JWWA 2CPEA 3CCWA 3GYXB 4TXSA 1WOSA 2QL5B 1YRUA 1OPZA 3GIMA 1ZAWA 5A8KB 2VF3A 3HCXA 2AX0A 4LSZB 4F4KA 4PYAA 1KHWA 3QWPA 3CC2S 4WU2A 2N3OA 2NQPA 3QLHA 4UQTA 4FYWB 4Z7CA 4LF6F 4DR2J 2DPIA 2VDHA 5EUHA 4OYPA 5K14B 1TAUA 4DL5A 1H7XA 4DBQA 4E98A 4KAIA 3K89A 3MEDB 3CWJA 2UXBF 1WOPA 3VTIA 5HROB 4B3MF 2HNZA 2YWFA 1WTFA 1VJQA 1NEEA 4OJHA 1IBKF 2AU0A 3Q8SB 3QGIA 1TQLA 4ILLA 4FPRA 3OJUA 2GO8A 3QT8A 3VWSA 3A8KA 3NAIA 3D4JA 3M2RA 4LRCA 3AB4B 3SCJE 2IC3B 4ELUA 1W7WA 3K2YA 3AQPA 1UVMA 1B99A 4N56A 1WG5A 4RU2A 2K1RB 3LUYA 1FFWB 4ZHRB 2DR7A 1LWCB 2HKEA 2W01A 3MM5B 3QYYA 4ID5A 5D0HA 4K4TA 1RAAB 1RA7A 4HHHA 2Y1LB 4OI0A 1TELA 5ETNA 1J5OB 4A8YA 3JXOA 4ETZA 4KJIA 1QSSA 1RWOB 4K7QA 3GTYX 5ETKA 2CJ9A 1G6BA 3GP9A 2V2KA 2W2NP 1IBLF 4EGLA 1DFDA 5DZ7A 1T03A 3G6XA 5KT5A 4AT1B 5MLCV 1N8RT 3ZTSA 1KLMB 1HQ2A 3DDIA 4DS4A 2AKWB 3CMES 3RTVA 2MKJA 4X64J 1YSJA 1RDRA 3PX4A 3MR5A 4PXEA 1DRZA 1FRMA 1HNXF 2XY5A 2DHGA 3QZ8A 1OYDA 3MM7B 1PC4A 4MKBA 1NK5A 4Y2IA 1KNZA 1PCAA 3G82B 2H9ZA 4UZBA 2DGUA 3T1HJ 4OL8A 4W92B 3MCMA 1IR2A 1FE0A 3V6KA 4TKTA 3J81Y 3M6UA 4DL4A 2AMCB 4OYBA 3HVAA 4F02A 1RT6B 4KPCA 3HT0A 4L72B 2FVQA 3R9LA 4RNNA 4M5GA 1YG0A 2J9CA 3KLHB 3BPSP 1IVZA 5LMUJ 2V4RA 1JLFA 2IAJB 3G71S 1QSLA 2Z8QA 4IFVB 2PE8A 4LSNA 3M9MB 2R7RA 5H1SV 3D1HA 3MURP 4XTTA 2AGQA 3IC1A 2FGCA 1MU2B 2F4FA 4FVCA 4USWA 3LPEA 3QBCA 3OTOF 3V6DB 1AXQA 2FY1A 2DIVA 1RTIB 3C15B 1LKZA 5L8RC 5K20B 5BR8J 4YHHF 2DKOB 3IR6B 3DI6A 1VQ5S 3SXLA 2ZZTA 3OSPA 4CLUA 1FFSB 2CJXB 3ZNUA 4EUVA 2YWEA 1FKOB 2CJAA 1KQFB 2HWIA 2QX0A 3FRYA 2C1EB 1TFWA 3R5BA 3J7A1 3MAHA 3H5YA 5HQLA 3MMJA 3UN5A 4O4RA 1REGX 3KYLA 2BX6A 2A2CA 1SKRA 3M30A 5C7PA 5CYMB 2CUYA 4WIQA 4I6WA 5A0YA 1P27B 1WF2A 4YB5A 4BHQA 3GPAA 1TV6A 2ATLA 4LRBA 4J9MA 2BVZA 2OEKA 3PW5A 5BYQA 2HK2A 4O3SA 2VPZB 1M5OC 1TAQA 2DNNA 1HPZA 3NWRA 2Q79A 2OGUA 5C24B 4B3OA 5RUBA 1RWVB 2LYVA 3JAMU 2X3GA 2HW3A 2YKMB 4YB6A 3MTKA 4P74A 4UUXA 5GAHI 3BSCA 3DLBA 1J27A 2PO4A 4TQSA 4BS2A 4ICLB 2OELA 3WX8A 2HFZA 5HMXA 3UD3P 1X4GA 4A46A 8ATCB 3B82A 3CIMA 2BANB 1F9HA 4P52A 1Z4UA 1HBMB 3KWMA 3MEEB 3IWNC 1CJVB 1RT3B 2KFZA 3S01A 3FCHA 3DDKA 1BQXA 1TU0B 4LF6J 2FZCB 2DPJA 5BYSA 2HHPA 1JX4A 5KFFA 5DQHA 2OUGA 2OLWA 3CPWR 2AZ1A 4ZVOB 2J0SD 5KFCA 3W64A 5GMEA 4CRJA 2UXBJ 3DLGA 4A48A 1RTJA 1Y3JA 3WIUA 3V6HA 1YHQS 4B3MJ 1JLCB 2YX1A 2EFNA 5DQIA 1IBKJ 3T9ZA 1RUSA 1WELA 2VICA 3IG1B 2Q6CA 1HNVB 1NH8A 1Q95G 1VR6A 1FERA 4YR0A 1BHNA 4NL5A 3B4DA 4QWBA 4N76A 2VG6A 3KUEA 1HBOA 1CSJA 2OPPA 2UXDF 3BSOA 4LFBF 2YWKA 3L95X 2WTFA 4G65A 2W2MP 4J5OA 1FK9B 3C8YA 1UMJA 2Z2MA 2DNZA 3N01A 3BQ2A 3PX6A 4M5LA 1ULRA 3CMQA 3OVAA 2DGQA 4CO5A 4EYIB 2LDYA 3H25A 2JEGA 3R5JB 1J5EJ 2YKOA 3QIPA 2IA6A 3T5KA 2E5GA 2XS5A 4LF7F 1IBLJ 1SCJB 1C4CA 2NXEA 2HHWA 2R2SA 3E2EA 2HRTA 1RADB 4WP8A 4DFKA 1Y00A 4RWWA 2OFGX 3D66A 1JXVA 4C8NA 2HGNA 5CD4A 3NP5A 1IBMF 4V19J 2ZKTA 4QPXA 3PW4A 4DL0C 3UDLA 3OFFA 5FDLB 3BV8A 4TU7A 4J9QA 1HNXJ 4ZPDA 4IRDA 4ED1A 1U45A 2ZH3A 2EG1A 3HD1A 2ZBPA 4P10A 1OS5A 4ZOSA 1MSWD 1QDUB 5LM7E 2JLGA 3TJAA 3M8WA 4NOHA 3VV2B 3C3LA 5JXSA 2P9GA 3GFYA 2GZOA 1GMVA 2HIQA 4RWXA 1YIJS 3DGPA 3I4HX 5A6WA 2DTJA 1YRTA 2V63A 1CG2A 3PXGa 2QL9B 1F5BA 4WKYA 4DF8A 1U8WA 3K5LA 4ED3A 1UVKA 3KLEB 5I3QA 2XY7A 1NDCA 2UVWA 1ELOA 2J9EA 2CQGA 1W26A 2YNFB 3W2WB 2QFJA 2UUWA 3R5CA 4O3NA 1BC6A 1ZM3A 2HGLA 1KVKA 1GT8A 5F8GA 4C8OA 2A3JA 2ATCB 2Z4PA 3OTOJ 3M8YA 1N5YB 2HRUA 1RXOB 1VRUB 3ZZRA 1TL7A 2RF2B 1IXKA 2BZ2A 1H6KX 3OVSA 1TKZA 1RKIA 5CZXA 1Y10A 3BGRA 3PR5B 4MYUA 5HP1B 4AQYF 3MFIA 1QAXA 4QIFA 4K0KF 5H9FJ 3D1QA 4UUWA 4PPZA 4Q44A 2POKA 1H3DA 1F3FA 2XS7A 1XMQJ 1SB6A 3CJQA 2XGQA 4KSEB 3RB0A 2DCUB 3N5BA 4DV2J 1XK8A 2D1CA 3PYFA 3L4BC 5AXMA 1C1CB 1WKJA 4UQGA 1RAFB 2ROEA 1AUSL 2IDLA 2E9TA 3VAIA 2IHR1 3MCSA 5DDRC 3KG1A 3DGVA 2KM8B 4F2SA 3HFKA 2V0NA 2RH3A 4U9RA 1N6QA 3ETOA 1BMQB 2XMAA 1SJ3P 1M5SA 3UVJB 5HK4A 2XC9A 4PXBA 4EBDA 3HX9A 2AF6A 3OSNA 3KK1A 4DL3A 3U1MA 4FXWA 2UXCF 2HRYA 2KRRA 1X8DA 2W8LA 4DR6F 3SCIE 1VLYA 3FSYA 4OFZA 4G1PA 4J9OA 2VQEF 1LNQA 2CQ2A 3GWCA 4GO5X 2AYMA 2B4UA 2CZ4A 2MZTA 2Y0BB 3JS9A 4CLSA 1VQKS 1M1KT 1YX2A 4LREA 1HWUA 3NKYA 5L39A 2C2NA 1OQ3A 4ZCKA 5D4OA 3HKWA 2QEXS 4FF4A 1UEVA 3LAKA 2MZ1A 2MPUA 3E8OA 2DY9A 1NK8A 1WI6A 4C8KA 1DTTA 2MKHA 1D8ZA 3G6YA 4NYOA 2HS4A 2R7VA 3IR7B 1VBXA 1GTHA 3B78A 1OY9A 2KFYA 1T9WA 2BE7D 2UUBF 3MPWA 1SL1A 1RBOB 2MJUA 2HHQA 1S1VA 2UXDJ 2NPFA 1SBRA 1CS4B 2KM8C 2V4JA 3DC2A 3K5MA 2ILYA 3EMTA 3NCQA 4NI2A 4U6PA 4DL2A 4PWUA 1EJ7L 2D41A 1NMEB 5KFKA 1NKCA 2HLTA 1B7FA 4Y00A 3NOCA 1NDLA 4FN5A 4USIA 2M7SA 5IZHA 2HAIA 4TN2A 3I5AA 3CCUS 2M2BA 2VOOA 3FC9A 2IMOA 4CO3A 4NPOA 4LF7J 3ILLA 1KOOA 2R8IA 3POTA 1TL3A 2CQIA 1MLAA 1F5AA 1WEXA 3DYAA 3M2VA 2C3UA 4PR6A 2QLBB 2VG5B 1IBMJ 4DMZA 4RBTA 2MKYA 2DNQA 3G87A 1N52B 1WI8A 1MW7A 1X4HA 4CDIA 1I6JA 3JQJA 4ED6A 1N4LA 2BJ8A 1F5CA 1YVFA 1OIAA 2RSQA 4MFBB 3K59A 1RTDB 4K50A 1EQ0A 1ZZNA 3S6EA 3SFGA 1X7VA 5KFSA 3TX8A 1N48A 5HVFA 2XSJA 4PZVA 1T3OA 2KVQE 1GMWA 3GYNA 4OYWA 3OR1A 3E01B 3HXMA 2BRKA 4CH7A 4WF9Q 6FD1A 3PW7A 1VRTB 2MZQA 1SJQA 1JKHA 2ZOFA 4DZ6A 2LP4A 3NOGA 5GAEI 1Q5YA 1S1UB 4JI6F 3SQGA 2ZHBA 5KAKA 1VHIA 1K1QA 3OHBA 4QR1A 1LWEB 4ZJOA 4NLYA 3JAMY 2ZBCA 4P2FA 5KT4A 1RHKB 3CDUA 3AODA 4AL6A 3DOLA 2I1RA 3FRZA 1GAOA 4HYKA 5C25B 3AOCA 1YTYA 3N79A 4DUYF 2FD2A 4IDKB 3KLVA 3SDEA 4QJVA 2O67A 1SC6A 2GS8A 1U6FA 1T9YA 3BM7A 2APOA 2V8HA 4U8VA 3BSNA 3SV4A 4M5KA 4X66J 4ZVGA 4ECXA 1S1XB 2AEMA 3DDNA 4K5SA 2YNHA 4AQYJ 5DLFA 1H0HB 2GGPA 2MKKA 1SJFA 3N28A 4EU0A 4NLVA 3NCRA 3WHIA 5FD1A 4R25A 2BOAA 3AQOA 2YNIA 2AJ0A 3P45B 5C5JA 3NNAA 4NYZA 4I69A 4Y3CA 1UZHA 2EFPA 2E5JA 1UVNA 3MUTP 2ZH5A 2OD6A 2V9KA 1VQMS 1KD1T 3CJKB 3I0SB 4LSLA 5IM0B 4I2QA 4LQ9A 3KNGA 5HJYA 3Q22A 3U7JA 2LFVA 3P4UB 4NX9A 4DV3F 1HBUA 3BGFA 2HMIA 2HVDA 2N82B 2XMVA 2XEXA 4L75A 2CPIA 2XBPA 2VONA 1BD6A 1RBAA 4JUZA 4YOEA 1BGXT 4PAAA 7FD1A 2XO6A 1K9MT 4RO0A 1I51B 4P2MA 4DR6J 2FQQB 2H65B 4JI0F 3KLGA 2VQEJ 3EGNA 3DOMB 1Q7YT 3M8PB 3ZTRA 1M5HA 2MZJA 1H2TZ 1SXLA 3AD7C 2RS8A 5M2RA 1SQGA 3ILIA 3Q8VA 1YI2S 2IY5B 2JVRA 1N0UA 2WBRA 2G13A 2ZVSA 2YKNB 1YZ6A 1Q7LB 5AXLA 1XN9A 4RKUC 3KTQA 2OPQA 4MH8A 3D1OA 2KDOA 5LSOA 1XWLA 4AD6A 2V67A 1TUVA 4HDGA 3GYGA 4DV4J 5DETA 2MQNA 1VIOA 3CUNA 2KZMA 1WG1A 4K4YA 3THVA 5HJXA 2IVMA 1FDAA 2UUBJ 4I1TA 4FYVB 4QIVA 2U2FA 1ZA2B 2J9DA 3SV3A 1UJ5A 5HLFB 2LU1A 4DU8A 3TAMB 2DHSA 1V3SA 2KHDA 3US5A 4K59A 5KTQA 2EG2A 5KT7A 4OYMA 1OO0B 4KH0B 1NK7A 2QTWA 3DMJB 3N0VA 1JIHA 4E8UA 4H4KA 1SJ4P 3Q86A 2ZWOA 1ZTTA 3GB0A 4RUCA 2F4VF 2F8MA 2H1YA 1JLBA 1IKVB 1TKXB 3NGKA 2C3OA 3FEYB 2LEAA 1HQUB 4IG0B 4XDCA 5D0EA 3MMCA 3KKFA 2YX7A 2WBMA 1UWBB 4OX8A 1EP4B 1WC1A 2LVWA 2FVCA 1FRKA 3UQSA 2VV5A 4CYUA 3TZWA 2EKNA 2FC8A 2J7WA 3B4MA 4YN3B 2HQFA 4KKOB 3M1VB 1NM2A 1XNRF 3DM2B 3S8SA 4ZPWR 2GJFA 4ZPBA 4NWBA 3K5PA 2A0FB 5ETQA 1UW4A 1S6PA 3G8SA 2BKNA 2AJ1A 3Q24A 1H2UX 2YXLA 1U4BA 1U1LA 1JK9B 2E9ZA 1RT1A 2CJQA 2R7QA 1UP1A 3QNWB 4ZP6A 4FKYA 2HGMA 3GONA 3VALA 1X4FA 1S1WA 3GR1A 3DNCA 1G2EA 2W9CA 4JI6J 3LP0B 3MAQA 6AT1B 2M8DB 1JLQB 3VGUA 3RGIA 1RAHB 4F04B 4NYPA 5B0DA 2KHCA 2JFKA 2XYGB 2YY3A 4TVAB 1WSRA 2JEJA 5J1NA 4DUYJ 4DWIA 3PM9A 1V5IB 2VJUA 3QJPA 3LO3A 1R27B 4AE5A 2KT3A 2DNRA 1XEZA 5DG9A 2B6AA 2CG8A 4LF4F 1TUWA 3AH6A 2VBZA 5GAHU 2QYCA 5KFTA 2MQOA 4PUOB 1RHMB 3W2VB 2W7PA 1PGZA 2HVEA 2QLXA 2LQJA 4DX7A 1D8YA 4LF5F 3TUPA 1NHUA 3QSYB 3EDRB 4J9VA 4F4YA 1HBNB 3F73A 2Q1LA 3RW7A 2D9PA 1S9EA 2P6SA 3VQTA 3QZ7A 4DFMA 3I31A 5IV4A 2IJNA 5KG2A 2KU7A 2H4YB 3TYTA 1QUVA 5J2NB 3FMWA 2H5JB 3FEZA 3A8IA 5IQ6A 4OLPA 3ADAC 4WP9A 2C2MB 3PZPA 1W2IA 2KRBA 2C3PA 2G2ZA 5IT9U 2IJRA 3VAHA 3CEDA 2Y3YA 4DSEA 3LAMA 3UNYA 4DV3J 4RW7A 3L7OA 2L08A 5B0AA 3HULA 2QA2A 3H2UB 1RCXB 1Y9OA 1UJ4A 4J9NA 1TKTB 1WTBA 4WYLA 3QLHB 2BABA 1QVFR 1KFDA 3A3NB 1C0TA 4IG3B 5HL7Q 4GO7X 5KOWA 4GVLA 3HZEA 2ADCA 3RR7A 2CDQA 4I7FA 2KH9A 2PEBA 2OH2A 4WTYA 3V5RA 4JI5F 4C48A 2ZC3A 5DDPC 4CLKA 3GIJA 2HNZB 1WC4A 2CVIA 3OUYA 3EZUA 3T5LA 4G3IA 3KHRA 2HNDA 4WPAA 4B3RJ 4FS1A 3DLKA 1S0VA 3M2RB 3JSRA 4ED5A 3GMGA 4DCOB 3RBEA 2IJFA 4I56A 5CA5A 3EGVA 3HHKA 4A4JA 1WD6A 2KKHA 3K57A 4ID5B 1UEUA 5JVHQ 3DHXA 5F0UA 1VK8A 3BKTA 3HP6A 3D54A 2AW0A 3OL7A 3G6VA 1UETA 3O3LA 4B9SA 1Y11A 3MD1A 3GE9A 1HD1A 3O6QA 3SSQA 5AE3A 3MEGA 4C3KA 1MMLA 2OKQA 2R2RA 4CIOA 3PX0A 4DPOA 5LMNF 4KHPF 1PYSB 4WYWA 3KMSA 2D3ZA 2JX2A 4O3OA 1Q0NA 3RYLA 3BDEA 1FA0A 1ROFA 3AD8C 2KJWA 4DX6A 4C11A 2F4VJ 2KT2A 3TRGA 1QJHA 1Q82T 5AE2A 2G2OA 3AB2B 3W8PA 3GIKA 4ECVA 4KFBA 3P5TL 1WDDA 3D7SB 5J2QB 5KFYA 4EO6A 2O01C 1FEHA 1JXEA 1UA0A 2VODA 4RW8B 1JLGA 2KJVA 1XNRJ 2CQ1A 5E33A 1ZS6A 5E5NA 1S4EA 4F0HA 3VGTA 3ENWA 3MR7A 2DEIA 1B3TA 2DXEA 4NXNF 3H20A 2OSRA 4DR1J 2CQDA 1MWYA 2QMUB 1JLFB 2HBZB 3N6LA 3BS9A 2JRSA 3H8YA 1DJ0A 1RQ0A 4K4WA 4YY3F 1E6YA 3UCZP 3A3PB 4LT6A 4LSNB 4HT7A 2X7IA 2KFNA 4NEZA 3DRRA 1CJUA 2ZH8A 4K4ZA 1YGYA 3DFEA 4IYQA 2ASLA 3M8SA 2NXNA 3FK4A 3RU0A 3SSRA 2OAUA 5CD4H 2FJBB 2PI5A 3CCES 2ZH6A 4C8LA 3BN4A 3DI6B 4B17A 2BE2A 2WRMA 1VMBA 2E7VA 4PWDB 1U1MA 4W98A 3HFVA 3TW0A 1F9EB 1VI7A 4RW6A 2UVUA 2J6UA 1FEEA 3UR0A 2V50A 2Y0SD 1HA1A 4GVBA 2LXIA 2MSSA 1FTCA 3M30B 4Z37A 3G9CA 2XQCA 2C2OB 2ROGA 1X4BA 2NLWA 3O2IA 4ZDNA 5KG6A 1FD8A 4LF4J 1TV6B 3HK2A 1S1TB 5JVGQ 3LGHA 1HPZB 4CT8A 1WHYA 2XULA 4YEAA 3PG9A 4B3OB 3EX7B 2QMWA 3MAAA 4LF5J 4O44A 4GKKF 3NGUA 2PT0A 2FJAB 1VQNS 4UT4A 2RDIA 2PA8D 4DF4A 2DRDA 1YJVA 2M8HA 2H51B 2Z56B 4N47A 3NS6A 3R1HA 3GJRB 1TUGB 5CHCB 3K0JA 2EW9A 4NZ6A 4DX8H 2VJVA 4R5PA 3OR2A 3IRXA 2IVFB 3J81j 2EPIA 2IBOA 4LUBA 1JJCB 2R2TA 3KJFB 1FRLA 4FZVA 1QUPA 4UTGA 3D67A 1SKWA 2FIUA 4WFBQ 3MCOA 4WZQA 2DHXA 1NKBA 4NLPA 5EGYA 4J91A 1F2HA 2R7XA 3BREA 3DRYA 3H4DA 3SMZA 4Q7AA 2LKZA 1E6VA 5B7WA 2CPFA 4CH1A 1T11A 3KNAA 3GJSB 1HWKA 4FNHA 4R0EA 1W25A 1T05A 1TK8A 1MG7A 3HVTB 2GVDA 1R8PA 4JI5J 4LIWA 3ZZPA 2C2KB 3DRPA 4XPCA 4ZPTR 1RTJB 2KYZA 5E0OA 1YJTA 3EJMA 1FKPA 5MAOA 1KC8T 2CJKA 2DH9A 5CXTA 3LH2S 4ECUA 5K8OA 3UNGC 4Y2MA 3RBZA 1X4CA 4CTAA 3I56S 2VG6B 1X5TA 1HBOB 2ZH4A 4OHYA 1X5PA 4LR7A 1RLCL 1UTAA 4CLPA 4PQUA 4ER8A 2WVDA 2B9XA 1U8SA 1Z2LA 5M2PA 5D78A 3ITHA 4O3QA 2DNGA 2YNGA 4Q2MA 2QLJB 1N33J 4DG1A 3PKYA 4NLDA 1NAQA 2EFVA 2DR8A 3QIPB 4JV2A 3CCRS 1IKYB 4HEA9 4ZVTB 1NSQA 2HURA 1IQZA 3SEOA 1KBRA 2VFSA 3MCNA 4FP9A 2PA3A 4Q2LA 2LXFA 5LMNJ 1RT7B 4KHPJ 2LQ5A 4XAKA 1AFJA 1UA1A 4HL9A 3NS7B 2UU9F 4NA3A 3HVWA 1UL3A 2ZBRA 4QR0A 4CLLA 2JSXA 2BJ9A 2DJWA 3HI9A 1AROP 3DLLQ 2P2CB 4X4RA 1M0SA 4YDDB 5ETLA 2R7WA 1HFEL 1IM6A 4AL5A 3Q8PB 1B64A 2VL1A 5BXIA 5A2QU 2ZH2A 2GA7A 3I0RA 5A8RB 2F63A 3O5TB 5DLGA 3OFGA 4OYXA 4HHUA 3DKDA 2L48A 2CWKA 3VHQA 3DRSA 5KFHA 2VPXB 4UY8T 5KG3A 5T41A 3NMRA 4DN9A 3DGPB 4USTA 4IR9A 4QYZJ 5CQGA 1YWXA 4KRWA 3GU0A 4NXNJ 2V8DA 1YJNS 3W60A 2XI2A 4Z7YA 1M90T 2ZZNA 1Y7PA 1KHVA 2Y8WA 3PW2A 2PSZA 3BB5A 2GAGC 4EYHB 4YY3J 3IWLA 1M5PC 4FBUA 3FSIA 1SC1B 4H54A 3TA1A 4C3LA 4Y2AA 2EVZA 2NXJA 3TJ8A 2A18A 2AJ2A 3PW0A 2DISA 1Q8LA 2YPYA 3NCPA 3PIPQ 5KFUA 2DK2A 3CJ3A 5AJ3F 1U0HA 3EICA 1JMTA 1TL7B 3NGSA 2XMWA 4B9TA 1KOHA 3BYRA 5IT9Y 5KFBA 4OYAA 1K47A 1TKZB 2YKAA 3EPIA 3BGRB 2OPSA 5DM7Q 2ZUGA 2Q66A 5FJ4A 4MK7A 2W25A 3SYZA 2HHXA 2HHHF 1NBEB 2IBKA 4PXCA 3BSAA 5H9EK 5LOQA 3NGDA 2WOMA 2LA4A 1NXIA 2UVRA 2PDAA 1T0TV 1PC5A 3PKMA 2ZKUA 4MIWA 1LQ9A 3Q23A 2M0GB 4PG4A 1Y5LB 3HHNB 1WEZA 1YKWA 4WFYA 3RBDA 4GKKJ 5LXYA 3J80U 1M5KC 2ABYA 3AOBA 1PIEA 1N6QB 2GMLA 3N5FA 2W4PA 2XCAA 3BN7A 1FRXA 4NLQA 1X4EA 1S99A 2EC2A 3NAHA 1MWQA 1HL6A 3KK1B 5ETSA 4WFXA 4HACA 4X2BA 5D4LA 2YBVA 4HDHA 3OXLA 4USJC 3WQPA 1LWXA 3LWLA 4QWCA 2FJXA 2Z0GA 5F0WA 3UCUP 2ZH7A 4F8RA 2XZWA 1BE4A 4I6YA 1ZM4A 2AYBA 1LWFA 3FJ2A 2J6SA 3GZ7A 3AT1B 4V1Ak 2QYGA 2QFIA 3PRDA 4F4ZA 5IQQA 1ITPA 3WDOA 3V81A 3CJ2A 3CE8A 3BDPA 1SC4B 4X4UA 1DTTB 2QA4G 1Y3KA 1PJ5A 5LXRA 2XM3A 3TVYA 5HAOA 5SUHA 5ETVA 3OXFA 2H48B 2G0IA 1HQEA 2HEKA 4QPTA 3CJ8A 3QIDA 4ECQA 4JI7J 4NCAA 1ZM2A 2HQCA 3MM6B 3VAKA 2JEIA 4ZHRA 4O0IA 5BJRA 2PFFB 1BQNA 1S1VB 1T02A 2B4OA 4F26A 2V4JB 1FVSA 2RDDA 3S7RA 3SSSA 5ETRA 4U7CA 4NI2B 1RKJA 4K4UA 4KBIA 3S1TA 3BQ1A 4BBYA 3PRVA 1HHQA 1JJHA 4C8YA 5DO2A 1SUQA 3LGMA 5FLXU 2XG8A 3LALA 1UVLA 1AA1B 4ETXA 1H98A 4WIIA 3OXGA 1TMMA 4RNHA 3PV8A 3KJVA 4W4MA 3O44A 4M5DA 3POTB 1IJEB 3BH7B 1TL3B 2HHTA 3W5ZA 2FHJD 3MEKA 1X0PA 3DYAB 3M2VB 4KV8A 3Q2SC 1S9FA 2UU9J 2MQMA 4F36A 3UD4P 4O3RA 1ZOTA 4CP5A 4WCEQ 3KG4A 4M5IA 3M8QA 4IRKA 3ZXWA 4B3TF 1WNEA 4WXWA 2QV6A 3R97A 3ZZOA 2CQHA 1S6OA 2BMBA 4ZVQB 4P71A 1UFWA 2HQDA 1NLKL 5KFJA 3F41A 4ZIWA 7AT1B 1Y0HA 4OI3A 2XSJB 4DQQA 2F9DA 3F44A 3OR1B 2DGWA 2RRBA 2RQCA 3QATA 2V69A 1NJIT 4IFVA 5LJ5Y 4MJKA 3KLFA 5IT4A 2IM2A 1MMNA 1JKHB 3THPA 4DX5A 2G0CA 4N5SA 4Y6IA 1KKHA 5EWFA 2Z58B 3SQGB 1OQ6A 5IFMA 5ADZA 3PJ9A 3V6DA 4QWEA 1RTIA 1BWVA 2HG4A 2DB1A 2ERRA 5KFZA 2FZGB 3DOLB 2G1DA 4FXDA 1A7GE 2PFDA 1Q16B 2AIRB 4CLYA 3EGZA 2WVFA 4DU7A 2DVIA 2ZOGA 3SDEB 5LMUF 1QLNA 4G1IA 2GQ2A 1X9WA 3CDWA 5AJ3J 1OSDA 2CQ3A 1NSPA 1AFIA 2R4FA 4NCBA 2GVZA 4P75A 1H2VZ 1VQPS
chains in the Genus database with same CATH topology
1RAOA 3QBCA 1CBKA 3HD2A 3HSZA 3HSGA 5ETQA 3IP0A 3MCMA 1F9HA 5ETPA 4PZVA 3KUEA 1TMMA 2BMBA 4M5JA 5ETNA 1EX8A 3HD1A 4CRJA 4M5GA 1KBRA 3MCNA 5ETOA 3ILJA 3HCXA 3MCOA 4M5KA 1RTZA 4M5LA 1TMJA 5ETVA 3UDEA 1DY3A 4M5IA 5ETLA 5ETTA 1Q0NA 4CYUB 1HKAA 3KUHA 1IM6A 1EQMA 1EQ0A 4F7VA 3ILLA 5ETRA 4M5MA 5ETMA 4M5HA 4CWBA 4M5NA 5ETSA 1HQ2A 3UDVA 2F63A 1RU1A 3ILIA 1G4CA 4AD6A 4CYUA 3HSJA 2F65A 2CG8A 3UD5A 2QX0A 3HSDA 3KUGA 5ETKA 3HT0A 1RU2A 3ILOA 1RB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RAO A;  3QBC A;  1CBK A;  3HD2 A;  3HSZ A;  3HSG A;  5ETQ A;  3IP0 A;  3MCM A;  1F9H A;  5ETP A;  4PZV A;  3KUE A;  1TMM A;  2BMB A;  4M5J A;  5ETN A;  1EX8 A;  3HD1 A;  4CRJ A;  4M5G A;  1KBR A;  3MCN A;  5ETO A;  3ILJ A;  3HCX A;  3MCO A;  4M5K A;  1RTZ A;  4M5L A;  1TMJ A;  5ETV A;  3UDE A;  1DY3 A;  4M5I A;  5ETL A;  5ETT A;  1Q0N A;  4CYU B;  1HKA A;  3KUH A;  1IM6 A;  1EQM A;  1EQ0 A;  4F7V A;  3ILL A;  5ETR A;  4M5M A;  5ETM A;  4M5H A;  4CWB A;  4M5N A;  5ETS A;  1HQ2 A;  3UDV A;  2F63 A;  1RU1 A;  3ILI A;  1G4C A;  4AD6 A;  4CYU A;  3HSJ A;  2F65 A;  2CG8 A;  3UD5 A;  2QX0 A;  3HSD A;  3KUG A;  5ETK A;  3HT0 A;  1RU2 A;  3ILO A;  1RB0 A; 
#chains in the Genus database with same CATH topology
 3GV8 B;  3CTR A;  4RPF A;  4JV0 A;  2BJ3 A;  3LF0 A;  4D3G A;  1FXD A;  2ZHA A;  4F67 A;  2YNH B;  5DGB A;  4AUK A;  4QU7 A;  4O0N A;  2GGP B;  2HHH J;  3TX0 A;  3HKZ D;  3LP2 A;  3OTC A;  5KFR A;  1B0V A;  2G2Y A;  4ECZ A;  3R1L A;  4RW9 A;  4UOC A;  3ZZ0 A;  2E1A A;  3RBX A;  2ACY A;  4IQM A;  2YNI B;  4HHJ A;  3PDN A;  4W90 B;  4YR2 A;  2FYX A;  2YQ3 A;  1FT8 A;  5E3R A;  1U2R A;  1QE1 B;  3M4X A;  2HZV A;  2AZ3 A;  4I68 A;  2GJI A;  4LSL B;  4EEY A;  1LW2 A;  5D0R A;  2RHS B;  3JTN A;  3ET6 A;  4FF2 A;  4ED0 A;  1QAJ A;  2OFH X;  1KEK A;  5F9N A;  1GK8 A;  3K8V A;  1D1U A;  1D9A A;  1T9X A;  4DSI A;  4U7U D;  2HMI B;  2RVJ A;  5IV3 A;  3PYD A;  4DI6 A;  2B7B B;  3HHL A;  1CJV A;  4TY9 A;  2M4M A;  1DUR A;  5KFL A;  2BJ1 A;  1Q53 A;  4IH5 A;  5J1P A;  2IRY A;  1RT4 A;  2F3J A;  2R2U A;  1NPP A;  2MKI A;  1O51 A;  3KLG B;  4F0K A;  4I4B A;  2C2D A;  2CPZ A;  2XGP A;  4G6V B;  3OTD A;  4ZJQ A;  2HVI A;  2EWH A;  1JB0 C;  2NCK L;  4IOA Q;  3CO0 P;  3D2W A;  1JLA A;  5C2G A;  4F3O A;  5E2Q A;  3QMQ A;  3MDF A;  1RP5 A;  3OW2 R;  4WTO B;  1Q8K A;  1G3O A;  2V2Q A;  5HN0 A;  3QAE A;  2OPQ B;  4IRC A;  3FBC A;  2XZD B;  4LFA J;  2M9K A;  3BGU A;  2V9W A;  1SIZ A;  1VLO A;  4KC5 A;  4N8N A;  4ECW A;  4DCJ B;  1VIX A;  1NCL A;  1I3O B;  2W7A A;  2G1H A;  2VH7 A;  5L46 A;  5DJB A;  4PXD A;  1TL4 A;  1Y5N B;  5KOX A;  4A8S A;  2OEJ A;  1ZZF A;  1WDT A;  2RU3 A;  3ISN C;  2XYP B;  1NJY A;  2KXF A;  2MHN A;  1BXN A;  2CPD A;  1RIS A;  1RLD A;  3H59 A;  4ALZ A;  5DG8 A;  3QGH A;  2VIH A;  3IM9 A;  1SKU B;  4DPY A;  3TAN A;  2FLO A;  5KFG A;  5T14 A;  1TVR A;  2O5D A;  1HHT P;  1JLB B;  1NB2 A;  3DLJ A;  3MPV A;  3VGV A;  3EXY A;  3PVX A;  1K8A T;  1S0M A;  1U24 A;  1N5Q A;  4F4W A;  3MMC B;  3HM9 A;  3KOA A;  3UO0 A;  4NCG A;  1WF0 A;  4BC7 A;  1R8B A;  4M5J A;  2R7T A;  3W5X A;  4DV1 J;  2HYI B;  4CYU B;  1J5E F;  3DXB A;  4PG7 A;  2CWX A;  1NDK A;  2BYC A;  2AEF A;  3CO9 A;  4B3T J;  3T3F A;  3UI3 A;  2N7Y A;  4QCL A;  2BBE A;  3BJY A;  2ZNZ A;  4NLW A;  5CCL A;  1S6P B;  1TZ0 A;  4R0J A;  4Q45 A;  1UJ6 A;  1LW0 A;  2E44 A;  3DLH A;  1QTM A;  1FXL A;  2P5V A;  3U27 A;  2HBY B;  1RT1 B;  3MD3 A;  1CJK A;  3VQS A;  5IWA F;  3FKB A;  3JTP A;  2QA4 S;  4H4O A;  1N5T A;  3Q8Q B;  1XR7 A;  1S1W B;  3HT3 A;  1MRO B;  2W9C B;  1CVJ A;  2IM1 A;  4DV0 F;  4WWS A;  3GR0 A;  3SFU A;  5KG1 A;  5HAN A;  1EET A;  3J80 Y;  4H4K C;  2WW4 A;  4Y34 A;  2NUU G;  4UOF A;  4ZVE A;  1Q79 A;  3PRB A;  1WF1 A;  1AZS A;  1N5V A;  3TQ1 A;  1NSK L;  3QJJ A;  4RBV A;  5GAD U;  5L1L A;  4ECR A;  2K2P A;  2HZC A;  4C0H A;  2DXD A;  2BW2 A;  5C2C A;  4X4P A;  3V6J A;  2OI2 A;  4C2M A;  2B6A B;  2BM0 A;  3PAC A;  1XJW B;  1U1Q A;  4KGV B;  9RUB A;  4HT5 A;  3C66 A;  2L9W A;  4X4S A;  3D28 A;  2JOQ A;  4IR1 A;  5LL6 d;  4PWW A;  3ZZZ A;  3IAS 9;  2BJ7 A;  3NRB A;  3TA0 A;  3AJ2 A;  1S9E B;  3ZTP A;  4OI1 A;  1R7I A;  2ZFH A;  4MIA A;  4QR2 A;  4GC7 A;  1VQO S;  2CPH A;  1JJ4 A;  3C6T A;  3N6N A;  4ZLJ A;  4PG5 A;  4DQP A;  1XMQ F;  2P8I A;  2LLZ A;  2ADB A;  4PG6 A;  3M32 A;  1U1O A;  3LW5 C;  3Q2T C;  4RW7 B;  4DV2 F;  2L41 A;  4DR4 F;  5J2M A;  5EX0 A;  3HO1 A;  3CJR A;  3T5J A;  2B3T B;  1RAG B;  1K73 T;  4JI8 J;  3C16 A;  1S9G A;  3LGN A;  3DXS X;  4Y2C A;  4BDP A;  1C0T B;  4X4O A;  1BWE A;  2DT9 A;  4CCH A;  2YQ1 A;  1S0N A;  4MAK A;  2XMT A;  3F56 A;  4I7F B;  5FLX Y;  2WSE C;  4DQS A;  1CBK A;  3MPU B;  3IP0 A;  2DIT A;  4DSL A;  3TQE A;  2K06 A;  1VBZ A;  2YH0 A;  2D7S A;  5H9F K;  5I42 A;  1ACM B;  3G2X A;  4LF2 A;  4UZC A;  3OUY B;  2UVV A;  2HND B;  4LR8 A;  1Q81 T;  3CJT A;  3DLK B;  2JVO A;  3D6M B;  2QMX A;  2RS2 A;  4ZVP B;  7FDR A;  4B9L A;  3HLU A;  2M88 A;  4WFA Q;  4NZ0 A;  1RHQ B;  1NSA A;  1VQL S;  4GKJ F;  1I5O B;  5GAG U;  5DS7 A;  4DSK A;  2XHW A;  3FCV A;  3A3O B;  3CD6 S;  2QLF B;  2VFR A;  2F65 A;  3RRG A;  4FF1 A;  2H3E B;  3U1L A;  2KG1 A;  2GC8 A;  2HQG A;  3MM8 A;  5KFW A;  1WOR A;  2ZM6 F;  3MEG B;  3RRK A;  4KGM A;  1WHW A;  4X62 F;  3JYT A;  3I6P A;  3TAP A;  1F2G A;  1U6Z A;  2DR5 A;  4ECY A;  4PAB A;  4PRF A;  4O3P A;  2RD5 C;  1MWZ A;  4C11 B;  1T7P A;  2UUA J;  3WC2 A;  2EFQ A;  4YUD A;  3QT6 A;  2Y1J A;  4UOH A;  1AB8 A;  4P73 A;  1PG5 B;  4KFB B;  1S5Z A;  3H98 A;  3RB4 A;  3QRP A;  2KN4 A;  1VQ6 S;  1YRX A;  4C6A A;  2WCX A;  3GCX P;  4Q8F A;  2RQM A;  5DDO C;  3DRX A;  3R2C J;  5IT0 A;  3MTJ A;  3TOQ A;  2J6T A;  2I5J A;  2BOP A;  3G8T A;  1G1X A;  5DQG A;  5D8H B;  2PI4 A;  1D9F A;  1NH7 A;  2WON A;  2LEB A;  1E6Y B;  2XWX A;  5K5M A;  3QT5 A;  1M5V C;  3W7B A;  4MTP A;  3SBM A;  1T8E A;  3DRR B;  2GQQ A;  3J7Y U;  1CJU B;  4WBF A;  4OZ5 A;  2YQ0 A;  4A8Q A;  3Q83 A;  5IWA J;  1LWE A;  4OJ1 A;  1HWJ A;  3GIL A;  4DZD A;  2YX4 A;  3H42 A;  1VCT A;  4DV0 J;  4RL1 A;  3OLB A;  4OLO A;  1SL0 A;  4CI0 B;  1FES A;  1GXT A;  1FX2 A;  4KGK A;  4RUH A;  5KFQ A;  3M8R A;  1YBU A;  3CC4 S;  5KG4 A;  4Q0B A;  2FZK B;  5CZV A;  2HFO A;  1N36 F;  4RW6 B;  2QA1 A;  4A8W A;  2RB7 A;  1VC0 A;  3D68 A;  1EIY B;  3HSJ A;  2MGZ A;  4DHV A;  2DYA A;  1JXL A;  4GVB B;  4PKD B;  3ZFV A;  1L3U A;  5D3G A;  4A8K A;  4QBU A;  4C4W A;  1TL5 A;  5J2P A;  4LBI A;  2CG4 A;  3VVU A;  1OY6 A;  4F3M A;  1WHX A;  1HHS A;  3MAA B;  3EXC X;  4O44 B;  2W8K A;  5LSR A;  4X4T A;  1MN7 A;  4X66 F;  3R5A A;  4ZPV R;  4XIU A;  4R8U A;  1IM4 A;  4J90 A;  4TYA A;  2AX1 A;  2AYE A;  3R2D J;  4LVO P;  4R5P B;  2VZ9 A;  3OR2 B;  3IRX B;  2DR9 A;  3OHA A;  1B7Y B;  3V4M A;  4WU3 A;  2CPY A;  5M2U A;  2M5Y A;  5IC4 B;  1P9Q C;  1UAW A;  2RIJ A;  2QG9 B;  5LT5 A;  1RK8 A;  1PAE X;  4QW8 A;  4DR4 J;  2ZD1 A;  2UV8 G;  1SQE A;  2GAH C;  2X1A A;  2W9B A;  2GCF A;  4CO4 A;  3BR8 A;  1QM9 A;  2AJQ A;  1E6V B;  3KK2 A;  2XMK A;  1T05 B;  1GQE A;  2MYF A;  2AGP A;  1S48 A;  1S4F A;  2XHC A;  3GV5 B;  1X5S A;  2H54 B;  3BBF A;  4FYD A;  4CLF A;  2CQ4 A;  3DRP B;  2F1F A;  5J1E A;  1FJC A;  2MZR A;  1ZTW A;  4N7T A;  1FKP B;  1WEY A;  2JDJ A;  4OZ3 A;  1IKW A;  2DCL A;  4FF3 A;  2WB4 A;  2O66 A;  4CTA B;  2MKS A;  4K5R A;  1P9Y A;  4NLO A;  5CYJ A;  1O5J A;  3D5M A;  5I4M A;  1YLX A;  4LVN P;  1IWG A;  4PQU B;  4DR3 F;  3ELH A;  4ED7 A;  2MMY A;  2RQ4 A;  4MKY A;  2CJY B;  4ZLL A;  4GKJ J;  4C0O C;  1U0S A;  1KFS A;  2D74 B;  3ITH B;  2ASY A;  5EWE A;  4YME A;  2YNG B;  2R42 A;  4ZVF A;  1N88 A;  4DG1 B;  4I64 A;  1VQY A;  2VAS A;  3CCJ S;  1WJ9 A;  4C8Z A;  2FJE B;  2ZM6 J;  3PEH A;  2ZIT A;  4X62 J;  4DV4 F;  1C0U A;  3PR4 A;  1BQM B;  2WHO A;  4X4N A;  4FYY B;  4URQ U;  3OL9 A;  3ICL A;  2EFG A;  4HR2 A;  3T1Y F;  2R7S A;  1EKS A;  1F9F A;  1TR0 A;  3ISZ A;  1FXR A;  5KFP A;  4U67 Q;  1L3S A;  3W65 A;  3I0R B;  1CUL A;  4DR7 F;  3SCK E;  4LJM A;  4KKO A;  3BKU A;  4RLE A;  2FUG 9;  1N56 A;  2WVE A;  4ATN A;  3CCT A;  2YKQ A;  2VB6 A;  2DEJ A;  3DRS B;  1RAO A;  4X4V A;  4GC6 A;  4IUF A;  2VD3 A;  2ZNY A;  1M1G A;  5SZT A;  4LF8 F;  3RAQ A;  2WSC C;  5HVG A;  2VG7 A;  2QN6 B;  2FB0 A;  3TJ9 A;  1R0A B;  2DH7 A;  2KXH A;  4HLB A;  4C3M A;  4OV1 A;  2OSQ A;  3BZQ A;  2JLF A;  1XTZ A;  3NXZ A;  3LAN A;  4WZM A;  5K8M A;  3R27 A;  3RW6 A;  3ZO7 A;  4QWD A;  4ZVR B;  4NRU A;  1FKA F;  4BCA A;  2ALY B;  3IO1 A;  1NB7 A;  3LP0 A;  3WIV A;  2WW8 A;  3QFW A;  3KHL A;  4ZK7 M;  2NXC A;  1U0H B;  1FVQ A;  1BY9 A;  4KY3 A;  2QRR A;  1RWM B;  3PHE A;  2HPU A;  3SIP B;  2C42 A;  4X4Q A;  1U1P A;  1DY3 A;  1KQG B;  4IO9 Q;  3IGN A;  3UFC X;  4A47 A;  4L76 A;  4CH0 S;  3OPK A;  1VQS A;  1O0P A;  1N36 J;  2OPS B;  2A1B A;  1C2P A;  2KYX A;  2HSE B;  2E1M C;  2E5I A;  3V2U C;  4S0M A;  1QAY A;  2XNQ A;  5HMZ A;  4K4V A;  4IQX A;  2XO7 A;  2KL8 A;  2WOM B;  3CCV S;  4NLT A;  2DXF A;  3UR3 C;  3FBF A;  1Y5I B;  2RT3 A;  2K7K A;  2V4Q A;  4KE5 A;  2CQB A;  2VQF F;  3FGV A;  1ZH5 A;  2Y8Y A;  2RHQ B;  3MHY A;  2JLE A;  1WOO A;  3OJS A;  3D6F B;  4OYO A;  1KS2 A;  3JQK A;  4CO2 A;  2VFU A;  1FNX H;  2CFX A;  3PCO B;  4FVM A;  2NZ4 A;  1U02 A;  3A8E A;  1RT5 A;  1BLU A;  1GMU A;  3KFW X;  3BGL A;  2CJB A;  4WKR A;  1S6Q A;  1T9U A;  4NA1 A;  3GSD A;  2VKZ G;  2KI2 A;  1EX8 A;  5KT3 A;  2Q43 A;  2W4C A;  3P49 B;  1Z2Z A;  4J9K A;  4F2R A;  1TKT A;  4HAC B;  4I67 A;  3RAM A;  2CNN B;  1I94 F;  2J0X A;  3HJV A;  5T7L A;  2MXY A;  3LP1 A;  3R6L B;  4IG3 A;  1F6T A;  4ZCL A;  2HS3 A;  3WC0 A;  3CCM S;  3V4I A;  1ICE B;  3QRQ A;  1NO8 A;  5B09 A;  3BO4 A;  5G4D A;  1LWF B;  4RW4 A;  2NSC A;  3IXQ A;  2GIQ A;  1FFG B;  1DLO A;  5F8M A;  3V81 B;  4DS5 A;  4RZR A;  2D3O 1;  3EWG A;  4DFP A;  3KK3 A;  1VFJ A;  4RBU A;  2BQR A;  1GMW D;  3PFO A;  2SXL A;  5HO4 A;  4A8F A;  3HF5 A;  3EVM A;  3LOU A;  3BEG B;  4PG8 A;  1SV5 A;  3K8W A;  3NS5 A;  3CDB A;  1HQE B;  4CO1 A;  1MMD A;  4ZP8 A;  1HW9 A;  4ITS A;  2ZDO A;  3M2U A;  1SH2 A;  2R3V A;  1EZZ B;  4M95 A;  4QIG A;  1V9O A;  1NK0 A;  5EDW A;  1BQN B;  3UWT A;  3I4P A;  2A10 A;  4DR3 J;  4LF9 J;  4USK A;  1CC7 A;  2Z2L A;  2DGX A;  1RAC B;  3EYZ A;  1OYE A;  1G4C A;  2B5J A;  5KFD A;  1N32 F;  1Z1Z A;  1GXU A;  5K8N A;  5LSL A;  1SUQ B;  1XBW A;  1HI1 A;  2FLP A;  1V6H A;  1VK3 A;  4B3R F;  4KQZ A;  4K2J A;  2BV3 A;  5FII A;  5EHH A;  1FE4 A;  4WE1 A;  3P6Y C;  3KJV B;  2CDR B;  2PGC A;  4M5D B;  3AD9 C;  2LXU A;  1XIQ A;  1NHK L;  1SL2 A;  2X1B A;  4JI2 F;  1IQT A;  1UFL A;  1RWU A;  2LQ9 A;  5KFA A;  4JBC A;  4KV8 B;  3LA0 A;  1S49 A;  4KYZ A;  3T1Y J;  1VC5 A;  3R3T A;  2C3Y A;  5J2Q A;  2DR6 A;  2O1P A;  3BH6 B;  3M8Q B;  2VFT A;  5GVQ A;  2B8Q A;  1FRI A;  2ALZ A;  5KFM A;  1IKX A;  2DGO A;  2GQC A;  1ZET A;  4RW8 A;  4DR7 J;  2IM0 A;  1R0B G;  2DRB A;  3PFE A;  1IN0 A;  2K8G A;  5K9F A;  2HQ3 A;  2B9Y A;  3IR5 B;  4ZCM A;  1XR5 A;  3RG6 A;  3T5H A;  4LF8 J;  2JEF A;  4DR5 F;  4PPD A;  3MMA A;  1RTH B;  3ISN D;  1H73 A;  3AHP A;  1URR A;  1X9M A;  2RUS A;  3FVY A;  1WKK A;  2VDI A;  3TVK A;  2ZH9 A;  2W2O P;  3KLF B;  2J8S A;  1RTZ A;  4C8M A;  2VHG A;  2JJ4 D;  4ZVU B;  2CRL A;  4FDF A;  3KHH A;  2ACM A;  4OYZ A;  2DGS A;  4ZA1 A;  4MT1 A;  2VUG A;  4C97 A;  3H4B A;  5LJ3 Y;  4OZJ A;  5U47 A;  4MYT A;  4DR1 F;  3DU5 A;  4ZLP A;  4PWD A;  2CAJ A;  1TP7 A;  2ASJ A;  2V2Z A;  2GVZ B;  2CA9 A;  3PJX A;  2WVB A;  3GFX A;  1RE1 B;  1RSC A;  2E5L F;  4OHV A;  5HBM A;  3A12 A;  4K8R A;  3PIO Q;  3ENA A;  3C46 A;  4DV6 F;  2XLI A;  3D3C J;  5E41 A;  1NRK A;  3LP2 B;  2VA2 A;  2B4V A;  1LOU A;  4RW9 B;  1NPK A;  2MLZ A;  1KON A;  3IBF B;  1S1T A;  1YBT A;  2RKI A;  3H90 A;  2BJE A;  2HNY A;  3G96 A;  4FNI A;  4LBP A;  2CYY A;  2UUC F;  4KT0 C;  1U48 A;  2RAQ A;  1LK5 A;  1SC3 B;  1T95 A;  3KDN A;  1HNI A;  2ZE2 A;  5IXU A;  5B0C A;  3FFI A;  2VQF J;  2I9S A;  1LW2 B;  2RRN A;  4DEZ A;  4NLG A;  3MR3 A;  2IRX A;  2RQK A;  3ET6 B;  3T9N A;  3HHE A;  3NNH A;  2ZBI A;  4NLR A;  3IBC B;  4AFF A;  3A1Y G;  3KLI A;  1D0E A;  3VAJ A;  4K4S A;  3Q0A A;  2XZT B;  2W9A A;  3HHL B;  4K2X A;  2GX8 A;  2OPR B;  1NK4 A;  1EQM A;  3SQO P;  2E1C A;  2F9J A;  4DLE A;  2P9C A;  4OHX A;  2L9D A;  3NWG A;  3UD5 A;  1I94 J;  1RT4 B;  4KR0 B;  5DRK A;  1APS A;  3R6G B;  3CCL S;  5HSP A;  3GJT B;  1KVJ A;  3DU6 A;  4IOB A;  1L3T A;  3UPF A;  4MIB A;  5B0G A;  3VAM A;  1S6U A;  1FHT A;  1PJ6 A;  3CJ4 A;  1DQ9 A;  5GMD A;  3KJQ B;  1S57 A;  1WKL A;  1FWL A;  5A8W A;  2DD8 S;  3HVT A;  3OFH A;  4NEY A;  4CO0 A;  2XCP A;  4I2P A;  1JLA B;  1NK6 A;  2GIF A;  1DTQ A;  2XMM A;  1KN6 A;  1GH8 A;  3X3U A;  1Q78 A;  1L3V A;  2HBQ B;  1REV A;  1N54 B;  1NND A;  2W4D A;  5HQ8 A;  1RWK B;  3ETM A;  3CCS S;  1N5S A;  1KP6 A;  2BM1 A;  2GMH A;  3W66 A;  1AW0 A;  4UW2 A;  3L7U A;  3CCQ S;  3RR8 A;  1LXJ A;  3TO8 A;  4HI1 A;  2ZDP A;  1UW9 A;  1U1K A;  2U1A A;  2DGT A;  3OFE A;  3QT7 A;  4LFC F;  4M94 A;  1R6Y A;  2MKC A;  1FDD A;  2V34 A;  3DOK A;  4J7C A;  4UOG A;  1N32 J;  3MUM P;  5HQM A;  3BKF A;  3HHL C;  1IKY A;  1M1H A;  1RYR A;  1ZM9 A;  4DSJ A;  5KFO A;  4L3K A;  5ITH A;  2AQ4 A;  3R5D A;  1RT7 A;  1TVR B;  4EK2 A;  3C2P A;  1L3K A;  2QZ8 A;  2E66 A;  3WZ0 A;  4DPT A;  2DO0 A;  1S77 D;  2HZA A;  5CYQ A;  4JI2 J;  3MI7 X;  1NJW A;  4NCG B;  5F9L A;  1CJT A;  2BEF A;  4RNF A;  1UCN A;  3NY0 A;  4J9U E;  2NZC A;  1TL1 A;  5A8R A;  1N33 F;  3W5Y A;  4WJB A;  2GJ2 A;  1EAR A;  1S12 A;  1F3V A;  3QWU A;  3H7H B;  4JB8 B;  4JI3 F;  3MPY A;  1QD1 A;  1T03 B;  4C9D A;  1XMB A;  2Y1R I;  5ETP A;  1P1L A;  4OQJ A;  2VBY A;  4ED4 A;  3N6M A;  1X5O A;  4WXO A;  2AGO A;  1R8C A;  2EBE A;  4DR5 J;  1LW0 B;  4MMO A;  2CZV C;  2KVI A;  3I5C A;  1YBA A;  4TLQ A;  2WB1 D;  1Q8B A;  1CJK B;  5B0E A;  4ZVH A;  1ZPV A;  1HKA A;  3FEX B;  1X9S A;  1HLW A;  2BQ3 A;  2VBX A;  4H4O B;  5I3U A;  1FWP A;  3W9H A;  4KB7 A;  1LEO A;  2PD1 A;  4L6V 3;  1EET B;  1S76 D;  4ERD A;  3RUB L;  3C6U A;  2E5H A;  3I5B A;  3ZC4 A;  1RAJ A;  3HDS A;  1RWP B;  2QGF B;  4YHH J;  4O4G A;  1FWK A;  2K7J A;  3JSM A;  3FQL A;  3O8W A;  2MLY A;  1RI7 A;  1AZS B;  3QRR A;  5HVH A;  4OI4 A;  2HLU A;  4PYD A;  1FD2 A;  2WSF C;  4QYR A;  2YVS A;  3TZZ A;  3RB3 A;  3G8Q A;  1EAY C;  4QQB A;  2LCW A;  1P1T A;  2DHA A;  2NRE A;  3EDQ B;  2E5L J;  2NXU A;  3ILJ A;  4TY8 A;  3LQV A;  2UP1 A;  3TWZ A;  5K8P A;  1FRJ A;  4KTQ A;  1FNM A;  4DV6 J;  4MK9 A;  1FTR A;  1MNE A;  2VBW A;  3NGR A;  5F8N A;  2W7O A;  1DBD A;  2HFU A;  3NNC A;  4JYA F;  2J0W A;  2HIY A;  2CQ0 A;  4ZIV A;  3TAQ A;  1RCO B;  4QYZ K;  4CQ1 A;  4YFU A;  1P6T A;  2UUC J;  1SJR A;  1SI9 A;  2CPJ A;  3ONQ A;  1SVD A;  4D3H A;  3C6T B;  3R8Y A;  3ZZT A;  1YQH A;  2ZJR Q;  2N3L A;  3GLJ A;  1Q4R A;  2KZZ A;  4EBC A;  3VR1 A;  2KT5 A;  1OPI A;  4BWJ A;  2AJ4 A;  4L74 A;  4M5H A;  3I32 A;  5A0Y B;  3M32 B;  1YDL A;  2CKW A;  2FGO A;  4EO8 A;  2B8P A;  3K5O A;  4OX7 A;  4Y28 C;  5J2M B;  1ZBT A;  5GAD I;  4C7Q A;  3IBW A;  2FLN A;  4Q43 A;  1C4A A;  4GMK A;  2F7V A;  2BRL A;  4NAS A;  4FKX A;  3C16 B;  1S9G B;  2GHW A;  3CB4 A;  4LRA A;  3SI8 A;  4IFY A;  1RJJ A;  3VGS A;  1CEZ A;  4QIW D;  4A8M P;  3MEC A;  2PMH A;  4OI6 A;  4LMZ A;  3CD5 A;  4G1Q A;  1JQG A;  2M3D A;  2V8P A;  1RA6 A;  1FJG F;  3HPO A;  3T19 A;  1S72 S;  3UE2 A;  5KFN A;  2XMJ A;  2CQC A;  2MY7 A;  1HMV A;  2ZBQ A;  4ANC A;  2BAC A;  3T6J A;  5I42 B;  1JLE A;  3TEH B;  3HMJ G;  3EVW A;  4ES3 A;  3EZ5 A;  2ZJQ Q;  3DLE A;  4OX6 A;  3NBP A;  3QGP A;  4C98 A;  2DH8 A;  3Q8Y A;  2J7K A;  4F25 A;  2DNP A;  1LXN A;  1UWA A;  3MM9 A;  2E1R A;  3JSY A;  4DL7 A;  3MM6 A;  2X51 A;  1XR6 A;  2QT7 A;  1LV5 A;  4EZ6 A;  2DNL A;  3UW1 A;  1A6L A;  4P9S A;  4LFB J;  4B9M A;  2FVP A;  3CJ5 A;  3EM1 A;  1NK9 A;  3GCW P;  1R43 A;  2YWG A;  4NA2 A;  4DSF A;  3CF5 Q;  2BQU A;  1GTE A;  3LTO A;  1SH3 A;  1HW8 A;  2XTJ P;  3DLG B;  3MM8 B;  4LFC J;  1CQM A;  1C1B A;  2KB2 A;  4J9L A;  1XNQ F;  3UDC A;  3IS9 A;  4CM2 A;  2QL7 B;  3JYT B;  1QY7 A;  2MY8 A;  3G4S S;  4WK3 A;  4JI7 F;  5CCM A;  1WWH A;  4CM0 A;  4ZJL A;  2LDI A;  3E51 A;  4DJB A;  3TR5 A;  3CT9 A;  4JP8 A;  3MPD A;  2PMZ D;  3GG1 A;  2Y1I A;  3MXH P;  2OPP B;  4F3Q A;  1HWI A;  2R7U A;  4OX9 F;  4OJ3 A;  1VIS A;  3BYP A;  2YWW A;  2RU9 A;  4E2F B;  2YH1 A;  3M05 A;  3K58 A;  2KXN B;  2J5A A;  2YWH A;  3QO9 A;  2XLJ A;  2JL9 A;  4H4M A;  3A8J A;  4WK1 A;  1SPB P;  4JI1 F;  2CIM A;  3QGG A;  2KO1 A;  4QZV B;  4DV7 F;  4CLT A;  1N0V C;  5F8I A;  2QE5 A;  1HYS A;  2X1F A;  1S59 A;  1IWA A;  2QSF A;  3OLA A;  2DNM A;  4JI3 J;  5GAG I;  4NLU A;  3EE3 A;  3MMB A;  1UEK A;  2I5J B;  5CH7 B;  4DPU A;  2HFN A;  3EGW B;  2LA6 A;  4KO0 A;  4USM A;  3EZO A;  2ZZM A;  4HKQ A;  2IDE A;  5HMW A;  3MF5 A;  4ECT A;  2WON B;  4U95 A;  4IOC Q;  1RWX B;  1GX6 A;  1K0V A;  2C3M A;  4KIA A;  2P6T A;  5E3C A;  3TEG A;  1RAB B;  1OMS A;  3W3S A;  3VZH A;  1HAR A;  3Q8U A;  5D0G A;  1GFW B;  4QOT A;  1ZA1 B;  2HVZ A;  5HAT A;  1AUD A;  5HI7 A;  3C14 A;  1OSC A;  1L5U A;  2XS2 A;  3GJQ B;  3K7R A;  3ZZY A;  2VA3 A;  4Q0B B;  5F3T A;  1FX4 A;  3DCA A;  2IVY A;  2MGZ B;  1PYT A;  3QQC D;  1TTH B;  3CNQ P;  4LR9 A;  2W1B A;  3NG8 A;  2V6A A;  5D3G B;  4K0K J;  3ZTQ A;  3FZ2 A;  1RT2 A;  5J2P B;  3PO4 A;  2Z2Y B;  1Q8I A;  1T94 A;  4OV6 A;  4ELT A;  4C0B A;  1HI8 A;  5E3P A;  3I9V 9;  1K0T A;  1BUX A;  4P72 A;  1QE1 A;  2MJN A;  4JYA J;  2IRU A;  2XI3 A;  3TA2 A;  3J7Y I;  1FNO A;  2F8E X;  4DXL A;  4R8U B;  2E9R X;  2WAQ D;  1RHR B;  2Z30 B;  2JHE A;  1X4A A;  4X65 F;  4RNO A;  3FMB A;  3CDE A;  5THW A;  2OJ3 A;  1R6V A;  5EX3 A;  4B9V A;  3PNI A;  3B6B A;  4QIE A;  4Y65 A;  5ETM A;  4DN0 A;  3M7V A;  3AJD A;  4NE9 C;  3HJF A;  1Q86 T;  4TU8 A;  1F0X A;  4DQR A;  1SH0 A;  2E7W A;  5G0R A;  4ES2 A;  4ZP7 A;  2UXC J;  2ZD1 B;  1DQA A;  4AL7 A;  3R7N B;  3KDO A;  2W9B B;  3R7B B;  5C42 A;  4FS2 A;  3RZA A;  2IYG A;  2J76 E;  3CMA S;  2DGV A;  2MST A;  3TZY A;  3DN9 A;  3KK2 B;  3PO5 A;  2XYH B;  4DDF A;  4B3S F;  3H40 A;  1FJG J;  5CAA A;  3BO2 A;  3BGO P;  5A8K A;  2GHP A;  5J1E B;  1URN A;  1S79 A;  2W2P P;  1WC5 A;  1ZAX A;  4U8Y A;  4Q8E A;  3AXK A;  1VQ9 S;  1WSV A;  2EBG A;  1IKW B;  2VC1 A;  3NL0 A;  2R8J A;  2MQQ A;  3AA8 A;  1UVI A;  1PSD A;  2W2Q P;  5K14 A;  1KQK A;  2FJD B;  3D6T B;  3L09 A;  1IR1 A;  2DRA A;  4A8O A;  3MED A;  3TUI C;  2MTL A;  1KWM A;  1J2V A;  2F5G A;  2OML A;  5HRO A;  2I2Y A;  3OQ2 A;  4HTI A;  2DIU A;  4EMD A;  3TUJ C;  3BQ0 A;  2AJF E;  3EVO A;  1OWX A;  4CNY A;  1H38 A;  1R8A A;  4DOZ A;  3W1Y C;  2R8H A;  4KGX B;  1RU2 A;  4HI2 A;  4LFA F;  4USU A;  1XNQ J;  1RHJ B;  4UY8 5;  1PJ7 A;  2E1P A;  1HD0 A;  1C0U B;  2IC3 A;  2ZH1 A;  1YIT S;  4EFA C;  1U7L A;  3KG0 A;  2K1R A;  1LWC A;  4FBT A;  2GO9 A;  2Q6B A;  3MM5 A;  3J7A N;  4OX9 J;  4OHZ A;  1J5O A;  2H4W B;  1PAU B;  4HH0 A;  2VKR A;  1GXL A;  4JV1 A;  2AHO B;  2EI5 A;  1CUL B;  3HHD A;  2KTQ A;  2BXJ A;  2AT1 B;  2FHK A;  1IUJ A;  3W9J A;  4P2X A;  3B8H A;  4JI1 J;  5DG7 A;  4DV7 J;  5IOL A;  4XDD A;  4ZCI A;  1TKD A;  1RB0 A;  1KLM A;  5E3A A;  3EPG A;  2VG7 B;  2QO3 A;  4WFZ A;  4ZKA A;  3UDE A;  4ZLN A;  3EUN A;  2AYG A;  2ZOM A;  5AXN A;  3IWX A;  1IBC B;  5A6P A;  2LEP A;  3FNN A;  3MM7 A;  1WC3 A;  1U1N A;  4DV1 F;  1B0T A;  3G82 A;  1YJ7 A;  1QAI A;  2OO4 A;  1S7I A;  3RRH A;  1MRO A;  3TP2 A;  2K3K A;  3QPI A;  4ID8 A;  1Q5V A;  3UN2 A;  1SJ1 A;  3ILO A;  3ENV A;  2D3U A;  1RT6 A;  4HTJ A;  2RML A;  1FRH A;  4DUZ F;  2CQP A;  1VHF A;  2BKP A;  2ZJP Q;  1DHM A;  2RDJ A;  2FTR A;  3MFH A;  3KLH A;  4YP3 A;  2GIR A;  1XQI A;  3MUV P;  3TNV A;  2IAJ A;  2EKY A;  3NLC A;  2UZA A;  1MN9 A;  2PMW A;  2GW8 A;  3ZNJ 1;  5JMN A;  3BR9 A;  5JJB A;  1MU2 A;  3GV7 B;  2L3M A;  3IFE A;  3VVT A;  3C15 A;  3CIZ A;  2G9O A;  3CW2 C;  3PTW A;  4ES1 A;  3J7Z T;  1FKO A;  1WUU A;  2OIH A;  2PC6 A;  3QAU A;  3OD2 A;  3KMQ A;  3PY8 A;  1F1B B;  3MGJ A;  2IIH A;  2MQL A;  4ED2 A;  4KH1 B;  4M63 A;  4F4A A;  4Y0F A;  3AOA A;  1QVG R;  1WC0 A;  3VAG A;  2FHO B;  5CYM A;  1RT5 B;  4X65 J;  1PKU A;  1S6Q B;  4ED8 A;  4M5N A;  1RU1 A;  2HBR B;  2LU2 A;  3CGI A;  1OY8 A;  2EK6 A;  2QSW A;  3IN5 A;  3N9U C;  3FUY A;  1WAC A;  4JV5 F;  2W24 A;  2B56 A;  3UN3 A;  5C24 A;  1IR0 A;  3NGT A;  3CXC R;  4AXJ A;  5T7L B;  3PHT A;  3LP1 B;  3KJN B;  4Y2K A;  2RRA A;  3GII A;  2HFS A;  3CD0 A;  2YKM A;  4RUA A;  1LFP A;  4JI0 J;  3V4I B;  3AY0 A;  1UKU A;  2AP6 A;  4I2Q B;  4ICL A;  2JH3 A;  4RW4 B;  3AJ1 A;  2MEW A;  3M6X A;  2B4P A;  2FC9 A;  3GFZ A;  1DLO B;  3LPY A;  2G0J A;  2NYI A;  4B3S J;  2OTJ S;  1HBU B;  2BAN A;  3KK3 B;  2K3I A;  2V8G A;  4NMX A;  2I8E A;  1HBM A;  1UVJ A;  3MOZ A;  4JI4 F;  3MEE A;  4JI8 F;  1RT3 A;  1SV5 B;  1UPM B;  2LMI A;  2E29 A;  2KG0 A;  2XSF A;  4HH1 A;  4BC9 A;  3M2U B;  4CNZ A;  3MOJ B;  4FXV A;  4TYB A;  4U7U K;  1RAE B;  3FZB A;  2FJV A;  2HWH A;  5F41 A;  2XMU A;  3VF0 B;  2B7C B;  1XMO F;  2XB2 D;  2FY8 A;  3L9Z A;  3MR6 A;  2C2Z B;  3IM8 A;  5BYR A;  2FVS A;  4ZMM A;  2NUH A;  2VFV A;  4F0M A;  4ZN1 A;  2B5J B;  2M52 A;  4ANE A;  2QC3 A;  3MZI A;  1JLC A;  4CZC A;  3PYE A;  3IG1 A;  1HNV A;  2A6M A;  4P7V A;  3AAW B;  4ZVS B;  4ZIT A;  4EZ9 A;  4P6Q A;  1KSP A;  4WE1 B;  2DNY A;  3T1A A;  2VPW B;  2UV8 A;  3RAX A;  5A2Q Y;  3HSD A;  1HNZ F;  4EBE A;  2OP5 A;  4OIX A;  3GFH A;  4PEO A;  1FK9 A;  1N34 F;  1D3W A;  3I96 A;  2JWN A;  1DAX A;  1B4S A;  2C22 A;  1O6X A;  4AXI A;  1U49 A;  1IKX B;  2IPO B;  4B9N A;  4MK8 A;  4LRF A;  3Q89 A;  2BW7 A;  2EEY A;  2RIL A;  1X60 A;  2DO4 A;  4OZN A;  4Z2X A;  1YK9 A;  2BE9 B;  1JNR B;  1S0O A;  1R3N A;  4MKV A;  1RYS A;  5D4N A;  2OD4 A;  3J7Z 5;  4M8L A;  5GMK a;  5IS2 A;  1B70 B;  3L3C A;  3MMA B;  2UUA F;  3A13 A;  2CPX A;  2OMO A;  1S10 A;  2V94 A;  4LRD A;  1RWN B;  3K5N A;  1FCA A;  5FDL A;  3HHL D;  3GG0 A;  3OL8 A;  3OV7 A;  3D0H E;  3BBB A;  3PJW A;  4FYX B;  4USH A;  4B08 A;  4YB7 A;  3KHG A;  2EC0 A;  2O3D A;  4I0W A;  2D9O A;  2DNK A;  3R7S B;  5A76 A;  3W63 A;  4IH7 A;  3PYG A;  4OHW A;  5DZ6 A;  3CDA A;  2AWZ A;  2AEJ A;  2WVC A;  4DUZ J;  2Z2Z A;  1H7W A;  3X1L B;  3CSK A;  1VS3 A;  3IGV A;  2NSB A;  3FSX A;  2JC1 A;  4KGZ B;  4DCP B;  3KLE A;  4ZPA A;  3N4W A;  1YJR A;  1XER A;  4XO0 A;  5HBM B;  2JFD A;  2EK1 A;  2ZEJ A;  5E7O B;  2YNF A;  4LBH A;  3W2W A;  3G6E S;  3TZX A;  1SQF A;  1IJF B;  1CC8 A;  1TK5 A;  3AXM A;  3P3D A;  1VC6 A;  2ZUA A;  3I55 S;  2MQ8 A;  3GQC A;  2RKI B;  3RB6 A;  2HNY B;  1EB0 A;  1N5Y A;  2H5E A;  3MWB A;  1YJW S;  1VRU A;  2RF2 A;  4ENO A;  3OVB A;  2B51 A;  3H5S A;  5EN1 A;  1T9T A;  1HNI B;  2ZE2 B;  4GRS A;  3FFI B;  2R8K A;  3JB9 k;  4DLG A;  1R89 A;  4MKA A;  4CLW A;  4ZN3 A;  3OBI A;  5HP1 A;  3CJS A;  1SIW B;  4N41 A;  1DQ8 A;  4QW9 A;  1P8G A;  4OZ0 A;  4DPX A;  3TAR A;  4KHR A;  1VQ7 S;  5F8H A;  1TMJ A;  1V3R A;  3KLI B;  2C28 A;  2FJW A;  2IM3 A;  1UPP A;  4K4X A;  1S7H A;  4V19 X;  5D77 A;  2VOP A;  3M6V A;  4ILR A;  1C1C A;  1U09 A;  4WFN Q;  4JV5 J;  2CVE A;  2ASD A;  4YR3 A;  2BDP A;  2DY1 A;  4NLS A;  3E3X A;  2I6W A;  3AA9 A;  3UDV A;  3H5U A;  2V2V A;  3M8Z A;  4A8X A;  3NEK A;  1NHV A;  4OZL A;  1I1G A;  4RX6 A;  2PEH A;  4DL6 A;  3Q8R B;  2HAF A;  2CNK B;  4RU9 A;  2V68 A;  3T41 A;  1FO1 A;  5A8W B;  4BLG A;  1X4D A;  4I2P B;  1HNW F;  1DAR A;  3UVJ A;  4WP3 A;  1DTQ B;  4CLZ A;  1S97 A;  1REV B;  3AFG A;  1U6B A;  3HFZ B;  2HVH A;  1VQ8 S;  2ROP A;  4OMF G;  4JI4 J;  2B9W A;  1K44 A;  3HSZ A;  1U2C A;  4JOU A;  2X3D A;  5JUM A;  5KT6 A;  2HFV A;  2GHV C;  5ETO A;  2LEC A;  1O8B A;  3JSB A;  2VU5 A;  1U2F A;  1NZ8 A;  4PQA A;  2AD9 A;  2IYI A;  2RE1 A;  4ZPC A;  3DHW C;  3FDS A;  3W8G A;  1XMO J;  5D6G A;  3H0P A;  2UUT A;  1SKS A;  2M70 A;  1V5V A;  2COL A;  4J9R A;  5F8J A;  3DOK B;  2VPY B;  1VDH A;  4EWT A;  4USV A;  2B43 A;  4L73 A;  2D3O R;  1Y4Z B;  4P2S A;  2YPZ A;  2HQI A;  4AND A;  5KG5 A;  1BQM A;  4L3N A;  3FBB A;  3FQK A;  2DNH A;  2RUG A;  1CS4 A;  3F0N A;  5CYQ B;  1HNZ J;  4RR5 A;  1RWW B;  2R9L A;  1CJT B;  4ILM A;  1X31 C;  1N34 J;  1TL1 B;  2GNK A;  4TQR A;  2CNO B;  2XY6 A;  2OEM A;  3R5G A;  3KXD A;  1FJE B;  4E0D A;  2ZHO A;  2Q3P A;  3A4T A;  1VBK A;  1VQ4 S;  1NJZ A;  1NJX A;  2CNL B;  4P7T A;  1DZ5 A;  2ILZ A;  5GAE U;  2J7U A;  2HHV A;  1KQS R;  1HR0 F;  1R0A A;  2WZ1 A;  2N7C A;  1PBA A;  3QJL A;  2C2E A;  5F3Z A;  1PYO B;  1KR4 A;  3D0G E;  1ZYQ A;  5B0B A;  4LIR A;  4M5M A;  9ATC B;  2VG5 A;  1JNZ B;  8RUC A;  2DBB A;  2HWT A;  2QIF A;  3IA0 A;  4RNM A;  2JC0 A;  5I3U B;  1R31 A;  2LQ8 A;  1OJ4 A;  1YJU A;  3UCG A;  1R8H A;  1U26 A;  1VOM A;  4NLX A;  2GV1 A;  1JLG B;  3D6H B;  4MFB A;  1RTD A;  3C6U B;  4YQW A;  3C19 A;  1NDP A;  2EFO A;  3CCZ A;  4TNO A;  3WX4 A;  3IAM 9;  4O4G B;  3JSM B;  2G4B A;  2R7O A;  2EXU A;  1A9N B;  5EWG A;  2NPI A;  3E01 A;  1FJ7 A;  1GNK A;  4XK8 C;  3W61 A;  1TFY A;  5B08 A;  5IC6 B;  1VRT A;  1F60 B;  2OTL S;  3IRW P;  1S1U A;  3H2L A;  3THT A;  5B0F A;  4TLR A;  2FPH X;  4NZ7 A;  5L9N A;  3ULH A;  4DV5 F;  4TY8 B;  1D09 B;  5KFX A;  2MDA A;  4DUT A;  5DDQ C;  1KDN A;  4OYI A;  3M9O B;  2NS1 B;  5C25 A;  4N8O A;  2RJZ A;  1QSY A;  4IDK A;  3HD2 A;  4PCQ A;  2E7X A;  2BE2 B;  3M9N B;  4FPI A;  3RJM B;  3J81 U;  3G86 A;  5CAB A;  1H72 C;  4BWM A;  4IKA A;  1Q1K A;  4O23 A;  4CWB A;  3VZI A;  2IA0 A;  2BR0 A;  5L1J A;  1RAI B;  1S1X A;  2I38 A;  2IMW P;  3HZG A;  2FHM A;  3M6W A;  4DFJ A;  1RHU B;  2MB0 B;  2FHJ A;  5KT2 A;  5I3P A;  4I6A A;  1FDB A;  4F7V A;  3BBC A;  4URS A;  4OJG A;  2X1G A;  4X84 A;  3U02 A;  2C2R A;  3FBE A;  4B02 A;  1WHV A;  3OTE A;  1VJW A;  4NXM F;  4OZ2 A;  2F40 A;  4QU6 A;  4IFY B;  2HHU A;  1KLN A;  1HI0 P;  2IFX A;  3MR2 A;  2FDN A;  3I82 A;  3CJK A;  2QJ3 A;  3I0S A;  1D9D A;  5IM0 A;  3MEC B;  2CXE A;  3WBZ A;  2AV5 A;  1GX5 A;  4AYB D;  4HVZ A;  4G1Q B;  3SZ2 A;  1PBU A;  3D9B A;  2PII A;  1B0P A;  5D4P A;  3T6B A;  1LFW A;  3TI0 A;  5DM6 Q;  2CAD A;  3CC7 S;  1HMV B;  3JTO A;  1YJ9 S;  3OL6 A;  1JLE B;  1HNW J;  2J9D E;  3O1L A;  8AT1 B;  2BKO A;  3DLE B;  4ELV A;  3NBP B;  4IH6 A;  5F8L A;  2XLK A;  2FLL A;  1GEH A;  4DR2 F;  2H5I B;  3MM9 B;  3KUG A;  1CLF A;  2L9N A;  4IO1 A;  3DOM A;  1FI4 A;  2JZ5 A;  2Z57 B;  1AT1 B;  3M8P A;  2A2D A;  2BUN A;  2YTC A;  3JQM A;  4UF4 A;  2HK3 A;  2NYH A;  2FVR A;  2CZ9 A;  2RNE A;  4ZP9 A;  3VAF A;  2I0X A;  2OHD A;  4RUB A;  1R0C B;  2WK4 A;  5AT1 B;  4LF1 A;  2GVD B;  4URG A;  2MLX A;  2YKN A;  2VC0 A;  1G7C B;  1VYA A;  1C1B B;  1UFK A;  4F50 A;  4DQI A;  3FCW A;  3IS9 B;  5L1I A;  1KRP A;  2JNJ A;  2N4D A;  5L38 A;  4J9S A;  1RBL A;  4M1K A;  1U1R A;  1ZAV A;  4NML A;  1PIL A;  2NR0 A;  1KTV A;  1ZPW X;  1VGY A;  4J37 A;  2XNR A;  4U96 A;  1U47 A;  4LF9 F;  2GFF A;  2PN6 A;  4F4X A;  3I9Z A;  4DPW A;  5HLF A;  3TAM A;  1X0F A;  2N4C A;  1RGV A;  3QO9 B;  1K1S A;  3P5B P;  4B9U A;  1QTN B;  2GMJ A;  4H4M B;  3SCL E;  4KPY A;  4YDX A;  3DMJ A;  3TUZ C;  1CPZ A;  3W9I A;  4RJV A;  1HYS B;  5KFV A;  3K17 A;  1JJ2 R;  1V3Z A;  3OTB A;  1U25 A;  2XWY A;  4X64 F;  2ZVI A;  3MMB B;  1RTH A;  1IKV A;  1TKX A;  5AXK A;  4LQ3 A;  5AE1 A;  3ENQ A;  3BPD A;  4KO0 B;  1HQU A;  1NZA A;  1HR0 J;  4IG0 A;  2J0Q D;  3PEJ A;  2J8A A;  3KUH A;  4Q5V A;  1UWB A;  3T1H F;  1EP4 A;  3BO3 A;  2V5H G;  1W2B R;  5H9E J;  5L9X A;  5L1K A;  1T3N A;  2P9E A;  3H2V E;  2MHE A;  1NU4 A;  3M1V A;  3DM2 A;  3ZTO A;  1TK0 A;  4J9P A;  3GIR A;  1AYE A;  5DGA A;  3C14 B;  3ZZU A;  2ZC4 A;  3D0I E;  3CUL A;  1FF2 A;  4QWA A;  3OT9 A;  5ETT A;  1NKE A;  1EHW A;  2B0G A;  4OZ1 A;  5E3Q A;  1NPR A;  4ECS A;  3BF4 A;  3HSG A;  4TU9 A;  2MZS A;  4OI2 A;  2B9E A;  1CQN A;  1XC9 A;  2HHS A;  1PO6 A;  2V8V A;  3D3B J;  1WG4 A;  2BJD A;  3NMA A;  6FDR A;  2DNO A;  1RT2 B;  2LQB A;  4ZS6 A;  5BR8 F;  1T9V A;  2R8G A;  4DV5 J;  1JLQ A;  3IMQ J;  1NUE A;  1EKR A;  1HIY A;  3TVZ A;  4XPE A;  4N77 A;  2DHH A;  4YB1 P;  4EI2 A;  2QLW A;  2A6O A;  5KG7 A;  3W62 A;  2Y9H A;  3B54 A;  5KG0 A;  3VCD A;  2MQP A;  5HMY A;  2YKP A;  3GSI A;  1KVI A;  1WC6 A;  4NRT A;  1HWL A;  3QFH A;  3QSI A;  4YS2 A;  5KFE A;  1VRQ C;  4CT9 A;  3I87 A;  3H5X A;  4PUO A;  3HVR A;  5KFI A;  3W2V A;  3L7P A;  1LK7 A;  1RZM A;  1UZD A;  1H74 A;  3CD7 A;  2D69 A;  2F8H A;  2OPR A;  2BA9 A;  5G0R B;  1YZ7 A;  2ZWP A;  3LWM A;  2HS0 A;  1KTQ A;  3U1N A;  1HBN A;  4KHM A;  3CVK A;  3P96 A;  5C42 B;  3CJ0 A;  1VBY A;  1A0O B;  4NXM J;  5J2N A;  3P8B B;  1FDN A;  5D15 A;  1JWW A;  2CPE A;  3CCW A;  3GYX B;  4TXS A;  1WOS A;  2QL5 B;  1YRU A;  1OPZ A;  3GIM A;  1ZAW A;  5A8K B;  2VF3 A;  3HCX A;  2AX0 A;  4LSZ B;  4F4K A;  4PYA A;  1KHW A;  3QWP A;  3CC2 S;  4WU2 A;  2N3O A;  2NQP A;  3QLH A;  4UQT A;  4FYW B;  4Z7C A;  4LF6 F;  4DR2 J;  2DPI A;  2VDH A;  5EUH A;  4OYP A;  5K14 B;  1TAU A;  4DL5 A;  1H7X A;  4DBQ A;  4E98 A;  4KAI A;  3K89 A;  3MED B;  3CWJ A;  2UXB F;  1WOP A;  3VTI A;  5HRO B;  4B3M F;  2HNZ A;  2YWF A;  1WTF A;  1VJQ A;  1NEE A;  4OJH A;  1IBK F;  2AU0 A;  3Q8S B;  3QGI A;  1TQL A;  4ILL A;  4FPR A;  3OJU A;  2GO8 A;  3QT8 A;  3VWS A;  3A8K A;  3NAI A;  3D4J A;  3M2R A;  4LRC A;  3AB4 B;  3SCJ E;  2IC3 B;  4ELU A;  1W7W A;  3K2Y A;  3AQP A;  1UVM A;  1B99 A;  4N56 A;  1WG5 A;  4RU2 A;  2K1R B;  3LUY A;  1FFW B;  4ZHR B;  2DR7 A;  1LWC B;  2HKE A;  2W01 A;  3MM5 B;  3QYY A;  4ID5 A;  5D0H A;  4K4T A;  1RAA B;  1RA7 A;  4HHH A;  2Y1L B;  4OI0 A;  1TEL A;  5ETN A;  1J5O B;  4A8Y A;  3JXO A;  4ETZ A;  4KJI A;  1QSS A;  1RWO B;  4K7Q A;  3GTY X;  5ETK A;  2CJ9 A;  1G6B A;  3GP9 A;  2V2K A;  2W2N P;  1IBL F;  4EGL A;  1DFD A;  5DZ7 A;  1T03 A;  3G6X A;  5KT5 A;  4AT1 B;  5MLC V;  1N8R T;  3ZTS A;  1KLM B;  1HQ2 A;  3DDI A;  4DS4 A;  2AKW B;  3CME S;  3RTV A;  2MKJ A;  4X64 J;  1YSJ A;  1RDR A;  3PX4 A;  3MR5 A;  4PXE A;  1DRZ A;  1FRM A;  1HNX F;  2XY5 A;  2DHG A;  3QZ8 A;  1OYD A;  3MM7 B;  1PC4 A;  4MKB A;  1NK5 A;  4Y2I A;  1KNZ A;  1PCA A;  3G82 B;  2H9Z A;  4UZB A;  2DGU A;  3T1H J;  4OL8 A;  4W92 B;  3MCM A;  1IR2 A;  1FE0 A;  3V6K A;  4TKT A;  3J81 Y;  3M6U A;  4DL4 A;  2AMC B;  4OYB A;  3HVA A;  4F02 A;  1RT6 B;  4KPC A;  3HT0 A;  4L72 B;  2FVQ A;  3R9L A;  4RNN A;  4M5G A;  1YG0 A;  2J9C A;  3KLH B;  3BPS P;  1IVZ A;  5LMU J;  2V4R A;  1JLF A;  2IAJ B;  3G71 S;  1QSL A;  2Z8Q A;  4IFV B;  2PE8 A;  4LSN A;  3M9M B;  2R7R A;  5H1S V;  3D1H A;  3MUR P;  4XTT A;  2AGQ A;  3IC1 A;  2FGC A;  1MU2 B;  2F4F A;  4FVC A;  4USW A;  3LPE A;  3QBC A;  3OTO F;  3V6D B;  1AXQ A;  2FY1 A;  2DIV A;  1RTI B;  3C15 B;  1LKZ A;  5L8R C;  5K20 B;  5BR8 J;  4YHH F;  2DKO B;  3IR6 B;  3DI6 A;  1VQ5 S;  3SXL A;  2ZZT A;  3OSP A;  4CLU A;  1FFS B;  2CJX B;  3ZNU A;  4EUV A;  2YWE A;  1FKO B;  2CJA A;  1KQF B;  2HWI A;  2QX0 A;  3FRY A;  2C1E B;  1TFW A;  3R5B A;  3J7A 1;  3MAH A;  3H5Y A;  5HQL A;  3MMJ A;  3UN5 A;  4O4R A;  1REG X;  3KYL A;  2BX6 A;  2A2C A;  1SKR A;  3M30 A;  5C7P A;  5CYM B;  2CUY A;  4WIQ A;  4I6W A;  5A0Y A;  1P27 B;  1WF2 A;  4YB5 A;  4BHQ A;  3GPA A;  1TV6 A;  2ATL A;  4LRB A;  4J9M A;  2BVZ A;  2OEK A;  3PW5 A;  5BYQ A;  2HK2 A;  4O3S A;  2VPZ B;  1M5O C;  1TAQ A;  2DNN A;  1HPZ A;  3NWR A;  2Q79 A;  2OGU A;  5C24 B;  4B3O A;  5RUB A;  1RWV B;  2LYV A;  3JAM U;  2X3G A;  2HW3 A;  2YKM B;  4YB6 A;  3MTK A;  4P74 A;  4UUX A;  5GAH I;  3BSC A;  3DLB A;  1J27 A;  2PO4 A;  4TQS A;  4BS2 A;  4ICL B;  2OEL A;  3WX8 A;  2HFZ A;  5HMX A;  3UD3 P;  1X4G A;  4A46 A;  8ATC B;  3B82 A;  3CIM A;  2BAN B;  1F9H A;  4P52 A;  1Z4U A;  1HBM B;  3KWM A;  3MEE B;  3IWN C;  1CJV B;  1RT3 B;  2KFZ A;  3S01 A;  3FCH A;  3DDK A;  1BQX A;  1TU0 B;  4LF6 J;  2FZC B;  2DPJ A;  5BYS A;  2HHP A;  1JX4 A;  5KFF A;  5DQH A;  2OUG A;  2OLW A;  3CPW R;  2AZ1 A;  4ZVO B;  2J0S D;  5KFC A;  3W64 A;  5GME A;  4CRJ A;  2UXB J;  3DLG A;  4A48 A;  1RTJ A;  1Y3J A;  3WIU A;  3V6H A;  1YHQ S;  4B3M J;  1JLC B;  2YX1 A;  2EFN A;  5DQI A;  1IBK J;  3T9Z A;  1RUS A;  1WEL A;  2VIC A;  3IG1 B;  2Q6C A;  1HNV B;  1NH8 A;  1Q95 G;  1VR6 A;  1FER A;  4YR0 A;  1BHN A;  4NL5 A;  3B4D A;  4QWB A;  4N76 A;  2VG6 A;  3KUE A;  1HBO A;  1CSJ A;  2OPP A;  2UXD F;  3BSO A;  4LFB F;  2YWK A;  3L95 X;  2WTF A;  4G65 A;  2W2M P;  4J5O A;  1FK9 B;  3C8Y A;  1UMJ A;  2Z2M A;  2DNZ A;  3N01 A;  3BQ2 A;  3PX6 A;  4M5L A;  1ULR A;  3CMQ A;  3OVA A;  2DGQ A;  4CO5 A;  4EYI B;  2LDY A;  3H25 A;  2JEG A;  3R5J B;  1J5E J;  2YKO A;  3QIP A;  2IA6 A;  3T5K A;  2E5G A;  2XS5 A;  4LF7 F;  1IBL J;  1SCJ B;  1C4C A;  2NXE A;  2HHW A;  2R2S A;  3E2E A;  2HRT A;  1RAD B;  4WP8 A;  4DFK A;  1Y00 A;  4RWW A;  2OFG X;  3D66 A;  1JXV A;  4C8N A;  2HGN A;  5CD4 A;  3NP5 A;  1IBM F;  4V19 J;  2ZKT A;  4QPX A;  3PW4 A;  4DL0 C;  3UDL A;  3OFF A;  5FDL B;  3BV8 A;  4TU7 A;  4J9Q A;  1HNX J;  4ZPD A;  4IRD A;  4ED1 A;  1U45 A;  2ZH3 A;  2EG1 A;  3HD1 A;  2ZBP A;  4P10 A;  1OS5 A;  4ZOS A;  1MSW D;  1QDU B;  5LM7 E;  2JLG A;  3TJA A;  3M8W A;  4NOH A;  3VV2 B;  3C3L A;  5JXS A;  2P9G A;  3GFY A;  2GZO A;  1GMV A;  2HIQ A;  4RWX A;  1YIJ S;  3DGP A;  3I4H X;  5A6W A;  2DTJ A;  1YRT A;  2V63 A;  1CG2 A;  3PXG a;  2QL9 B;  1F5B A;  4WKY A;  4DF8 A;  1U8W A;  3K5L A;  4ED3 A;  1UVK A;  3KLE B;  5I3Q A;  2XY7 A;  1NDC A;  2UVW A;  1ELO A;  2J9E A;  2CQG A;  1W26 A;  2YNF B;  3W2W B;  2QFJ A;  2UUW A;  3R5C A;  4O3N A;  1BC6 A;  1ZM3 A;  2HGL A;  1KVK A;  1GT8 A;  5F8G A;  4C8O A;  2A3J A;  2ATC B;  2Z4P A;  3OTO J;  3M8Y A;  1N5Y B;  2HRU A;  1RXO B;  1VRU B;  3ZZR A;  1TL7 A;  2RF2 B;  1IXK A;  2BZ2 A;  1H6K X;  3OVS A;  1TKZ A;  1RKI A;  5CZX A;  1Y10 A;  3BGR A;  3PR5 B;  4MYU A;  5HP1 B;  4AQY F;  3MFI A;  1QAX A;  4QIF A;  4K0K F;  5H9F J;  3D1Q A;  4UUW A;  4PPZ A;  4Q44 A;  2POK A;  1H3D A;  1F3F A;  2XS7 A;  1XMQ J;  1SB6 A;  3CJQ A;  2XGQ A;  4KSE B;  3RB0 A;  2DCU B;  3N5B A;  4DV2 J;  1XK8 A;  2D1C A;  3PYF A;  3L4B C;  5AXM A;  1C1C B;  1WKJ A;  4UQG A;  1RAF B;  2ROE A;  1AUS L;  2IDL A;  2E9T A;  3VAI A;  2IHR 1;  3MCS A;  5DDR C;  3KG1 A;  3DGV A;  2KM8 B;  4F2S A;  3HFK A;  2V0N A;  2RH3 A;  4U9R A;  1N6Q A;  3ETO A;  1BMQ B;  2XMA A;  1SJ3 P;  1M5S A;  3UVJ B;  5HK4 A;  2XC9 A;  4PXB A;  4EBD A;  3HX9 A;  2AF6 A;  3OSN A;  3KK1 A;  4DL3 A;  3U1M A;  4FXW A;  2UXC F;  2HRY A;  2KRR A;  1X8D A;  2W8L A;  4DR6 F;  3SCI E;  1VLY A;  3FSY A;  4OFZ A;  4G1P A;  4J9O A;  2VQE F;  1LNQ A;  2CQ2 A;  3GWC A;  4GO5 X;  2AYM A;  2B4U A;  2CZ4 A;  2MZT A;  2Y0B B;  3JS9 A;  4CLS A;  1VQK S;  1M1K T;  1YX2 A;  4LRE A;  1HWU A;  3NKY A;  5L39 A;  2C2N A;  1OQ3 A;  4ZCK A;  5D4O A;  3HKW A;  2QEX S;  4FF4 A;  1UEV A;  3LAK A;  2MZ1 A;  2MPU A;  3E8O A;  2DY9 A;  1NK8 A;  1WI6 A;  4C8K A;  1DTT A;  2MKH A;  1D8Z A;  3G6Y A;  4NYO A;  2HS4 A;  2R7V A;  3IR7 B;  1VBX A;  1GTH A;  3B78 A;  1OY9 A;  2KFY A;  1T9W A;  2BE7 D;  2UUB F;  3MPW A;  1SL1 A;  1RBO B;  2MJU A;  2HHQ A;  1S1V A;  2UXD J;  2NPF A;  1SBR A;  1CS4 B;  2KM8 C;  2V4J A;  3DC2 A;  3K5M A;  2ILY A;  3EMT A;  3NCQ A;  4NI2 A;  4U6P A;  4DL2 A;  4PWU A;  1EJ7 L;  2D41 A;  1NME B;  5KFK A;  1NKC A;  2HLT A;  1B7F A;  4Y00 A;  3NOC A;  1NDL A;  4FN5 A;  4USI A;  2M7S A;  5IZH A;  2HAI A;  4TN2 A;  3I5A A;  3CCU S;  2M2B A;  2VOO A;  3FC9 A;  2IMO A;  4CO3 A;  4NPO A;  4LF7 J;  3ILL A;  1KOO A;  2R8I A;  3POT A;  1TL3 A;  2CQI A;  1MLA A;  1F5A A;  1WEX A;  3DYA A;  3M2V A;  2C3U A;  4PR6 A;  2QLB B;  2VG5 B;  1IBM J;  4DMZ A;  4RBT A;  2MKY A;  2DNQ A;  3G87 A;  1N52 B;  1WI8 A;  1MW7 A;  1X4H A;  4CDI A;  1I6J A;  3JQJ A;  4ED6 A;  1N4L A;  2BJ8 A;  1F5C A;  1YVF A;  1OIA A;  2RSQ A;  4MFB B;  3K59 A;  1RTD B;  4K50 A;  1EQ0 A;  1ZZN A;  3S6E A;  3SFG A;  1X7V A;  5KFS A;  3TX8 A;  1N48 A;  5HVF A;  2XSJ A;  4PZV A;  1T3O A;  2KVQ E;  1GMW A;  3GYN A;  4OYW A;  3OR1 A;  3E01 B;  3HXM A;  2BRK A;  4CH7 A;  4WF9 Q;  6FD1 A;  3PW7 A;  1VRT B;  2MZQ A;  1SJQ A;  1JKH A;  2ZOF A;  4DZ6 A;  2LP4 A;  3NOG A;  5GAE I;  1Q5Y A;  1S1U B;  4JI6 F;  3SQG A;  2ZHB A;  5KAK A;  1VHI A;  1K1Q A;  3OHB A;  4QR1 A;  1LWE B;  4ZJO A;  4NLY A;  3JAM Y;  2ZBC A;  4P2F A;  5KT4 A;  1RHK B;  3CDU A;  3AOD A;  4AL6 A;  3DOL A;  2I1R A;  3FRZ A;  1GAO A;  4HYK A;  5C25 B;  3AOC A;  1YTY A;  3N79 A;  4DUY F;  2FD2 A;  4IDK B;  3KLV A;  3SDE A;  4QJV A;  2O67 A;  1SC6 A;  2GS8 A;  1U6F A;  1T9Y A;  3BM7 A;  2APO A;  2V8H A;  4U8V A;  3BSN A;  3SV4 A;  4M5K A;  4X66 J;  4ZVG A;  4ECX A;  1S1X B;  2AEM A;  3DDN A;  4K5S A;  2YNH A;  4AQY J;  5DLF A;  1H0H B;  2GGP A;  2MKK A;  1SJF A;  3N28 A;  4EU0 A;  4NLV A;  3NCR A;  3WHI A;  5FD1 A;  4R25 A;  2BOA A;  3AQO A;  2YNI A;  2AJ0 A;  3P45 B;  5C5J A;  3NNA A;  4NYZ A;  4I69 A;  4Y3C A;  1UZH A;  2EFP A;  2E5J A;  1UVN A;  3MUT P;  2ZH5 A;  2OD6 A;  2V9K A;  1VQM S;  1KD1 T;  3CJK B;  3I0S B;  4LSL A;  5IM0 B;  4I2Q A;  4LQ9 A;  3KNG A;  5HJY A;  3Q22 A;  3U7J A;  2LFV A;  3P4U B;  4NX9 A;  4DV3 F;  1HBU A;  3BGF A;  2HMI A;  2HVD A;  2N82 B;  2XMV A;  2XEX A;  4L75 A;  2CPI A;  2XBP A;  2VON A;  1BD6 A;  1RBA A;  4JUZ A;  4YOE A;  1BGX T;  4PAA A;  7FD1 A;  2XO6 A;  1K9M T;  4RO0 A;  1I51 B;  4P2M A;  4DR6 J;  2FQQ B;  2H65 B;  4JI0 F;  3KLG A;  2VQE J;  3EGN A;  3DOM B;  1Q7Y T;  3M8P B;  3ZTR A;  1M5H A;  2MZJ A;  1H2T Z;  1SXL A;  3AD7 C;  2RS8 A;  5M2R A;  1SQG A;  3ILI A;  3Q8V A;  1YI2 S;  2IY5 B;  2JVR A;  1N0U A;  2WBR A;  2G13 A;  2ZVS A;  2YKN B;  1YZ6 A;  1Q7L B;  5AXL A;  1XN9 A;  4RKU C;  3KTQ A;  2OPQ A;  4MH8 A;  3D1O A;  2KDO A;  5LSO A;  1XWL A;  4AD6 A;  2V67 A;  1TUV A;  4HDG A;  3GYG A;  4DV4 J;  5DET A;  2MQN A;  1VIO A;  3CUN A;  2KZM A;  1WG1 A;  4K4Y A;  3THV A;  5HJX A;  2IVM A;  1FDA A;  2UUB J;  4I1T A;  4FYV B;  4QIV A;  2U2F A;  1ZA2 B;  2J9D A;  3SV3 A;  1UJ5 A;  5HLF B;  2LU1 A;  4DU8 A;  3TAM B;  2DHS A;  1V3S A;  2KHD A;  3US5 A;  4K59 A;  5KTQ A;  2EG2 A;  5KT7 A;  4OYM A;  1OO0 B;  4KH0 B;  1NK7 A;  2QTW A;  3DMJ B;  3N0V A;  1JIH A;  4E8U A;  4H4K A;  1SJ4 P;  3Q86 A;  2ZWO A;  1ZTT A;  3GB0 A;  4RUC A;  2F4V F;  2F8M A;  2H1Y A;  1JLB A;  1IKV B;  1TKX B;  3NGK A;  2C3O A;  3FEY B;  2LEA A;  1HQU B;  4IG0 B;  4XDC A;  5D0E A;  3MMC A;  3KKF A;  2YX7 A;  2WBM A;  1UWB B;  4OX8 A;  1EP4 B;  1WC1 A;  2LVW A;  2FVC A;  1FRK A;  3UQS A;  2VV5 A;  4CYU A;  3TZW A;  2EKN A;  2FC8 A;  2J7W A;  3B4M A;  4YN3 B;  2HQF A;  4KKO B;  3M1V B;  1NM2 A;  1XNR F;  3DM2 B;  3S8S A;  4ZPW R;  2GJF A;  4ZPB A;  4NWB A;  3K5P A;  2A0F B;  5ETQ A;  1UW4 A;  1S6P A;  3G8S A;  2BKN A;  2AJ1 A;  3Q24 A;  1H2U X;  2YXL A;  1U4B A;  1U1L A;  1JK9 B;  2E9Z A;  1RT1 A;  2CJQ A;  2R7Q A;  1UP1 A;  3QNW B;  4ZP6 A;  4FKY A;  2HGM A;  3GON A;  3VAL A;  1X4F A;  1S1W A;  3GR1 A;  3DNC A;  1G2E A;  2W9C A;  4JI6 J;  3LP0 B;  3MAQ A;  6AT1 B;  2M8D B;  1JLQ B;  3VGU A;  3RGI A;  1RAH B;  4F04 B;  4NYP A;  5B0D A;  2KHC A;  2JFK A;  2XYG B;  2YY3 A;  4TVA B;  1WSR A;  2JEJ A;  5J1N A;  4DUY J;  4DWI A;  3PM9 A;  1V5I B;  2VJU A;  3QJP A;  3LO3 A;  1R27 B;  4AE5 A;  2KT3 A;  2DNR A;  1XEZ A;  5DG9 A;  2B6A A;  2CG8 A;  4LF4 F;  1TUW A;  3AH6 A;  2VBZ A;  5GAH U;  2QYC A;  5KFT A;  2MQO A;  4PUO B;  1RHM B;  3W2V B;  2W7P A;  1PGZ A;  2HVE A;  2QLX A;  2LQJ A;  4DX7 A;  1D8Y A;  4LF5 F;  3TUP A;  1NHU A;  3QSY B;  3EDR B;  4J9V A;  4F4Y A;  1HBN B;  3F73 A;  2Q1L A;  3RW7 A;  2D9P A;  1S9E A;  2P6S A;  3VQT A;  3QZ7 A;  4DFM A;  3I31 A;  5IV4 A;  2IJN A;  5KG2 A;  2KU7 A;  2H4Y B;  3TYT A;  1QUV A;  5J2N B;  3FMW A;  2H5J B;  3FEZ A;  3A8I A;  5IQ6 A;  4OLP A;  3ADA C;  4WP9 A;  2C2M B;  3PZP A;  1W2I A;  2KRB A;  2C3P A;  2G2Z A;  5IT9 U;  2IJR A;  3VAH A;  3CED A;  2Y3Y A;  4DSE A;  3LAM A;  3UNY A;  4DV3 J;  4RW7 A;  3L7O A;  2L08 A;  5B0A A;  3HUL A;  2QA2 A;  3H2U B;  1RCX B;  1Y9O A;  1UJ4 A;  4J9N A;  1TKT B;  1WTB A;  4WYL A;  3QLH B;  2BAB A;  1QVF R;  1KFD A;  3A3N B;  1C0T A;  4IG3 B;  5HL7 Q;  4GO7 X;  5KOW A;  4GVL A;  3HZE A;  2ADC A;  3RR7 A;  2CDQ A;  4I7F A;  2KH9 A;  2PEB A;  2OH2 A;  4WTY A;  3V5R A;  4JI5 F;  4C48 A;  2ZC3 A;  5DDP C;  4CLK A;  3GIJ A;  2HNZ B;  1WC4 A;  2CVI A;  3OUY A;  3EZU A;  3T5L A;  4G3I A;  3KHR A;  2HND A;  4WPA A;  4B3R J;  4FS1 A;  3DLK A;  1S0V A;  3M2R B;  3JSR A;  4ED5 A;  3GMG A;  4DCO B;  3RBE A;  2IJF A;  4I56 A;  5CA5 A;  3EGV A;  3HHK A;  4A4J A;  1WD6 A;  2KKH A;  3K57 A;  4ID5 B;  1UEU A;  5JVH Q;  3DHX A;  5F0U A;  1VK8 A;  3BKT A;  3HP6 A;  3D54 A;  2AW0 A;  3OL7 A;  3G6V A;  1UET A;  3O3L A;  4B9S A;  1Y11 A;  3MD1 A;  3GE9 A;  1HD1 A;  3O6Q A;  3SSQ A;  5AE3 A;  3MEG A;  4C3K A;  1MML A;  2OKQ A;  2R2R A;  4CIO A;  3PX0 A;  4DPO A;  5LMN F;  4KHP F;  1PYS B;  4WYW A;  3KMS A;  2D3Z A;  2JX2 A;  4O3O A;  1Q0N A;  3RYL A;  3BDE A;  1FA0 A;  1ROF A;  3AD8 C;  2KJW A;  4DX6 A;  4C11 A;  2F4V J;  2KT2 A;  3TRG A;  1QJH A;  1Q82 T;  5AE2 A;  2G2O A;  3AB2 B;  3W8P A;  3GIK A;  4ECV A;  4KFB A;  3P5T L;  1WDD A;  3D7S B;  5J2Q B;  5KFY A;  4EO6 A;  2O01 C;  1FEH A;  1JXE A;  1UA0 A;  2VOD A;  4RW8 B;  1JLG A;  2KJV A;  1XNR J;  2CQ1 A;  5E33 A;  1ZS6 A;  5E5N A;  1S4E A;  4F0H A;  3VGT A;  3ENW A;  3MR7 A;  2DEI A;  1B3T A;  2DXE A;  4NXN F;  3H20 A;  2OSR A;  4DR1 J;  2CQD A;  1MWY A;  2QMU B;  1JLF B;  2HBZ B;  3N6L A;  3BS9 A;  2JRS A;  3H8Y A;  1DJ0 A;  1RQ0 A;  4K4W A;  4YY3 F;  1E6Y A;  3UCZ P;  3A3P B;  4LT6 A;  4LSN B;  4HT7 A;  2X7I A;  2KFN A;  4NEZ A;  3DRR A;  1CJU A;  2ZH8 A;  4K4Z A;  1YGY A;  3DFE A;  4IYQ A;  2ASL A;  3M8S A;  2NXN A;  3FK4 A;  3RU0 A;  3SSR A;  2OAU A;  5CD4 H;  2FJB B;  2PI5 A;  3CCE S;  2ZH6 A;  4C8L A;  3BN4 A;  3DI6 B;  4B17 A;  2BE2 A;  2WRM A;  1VMB A;  2E7V A;  4PWD B;  1U1M A;  4W98 A;  3HFV A;  3TW0 A;  1F9E B;  1VI7 A;  4RW6 A;  2UVU A;  2J6U A;  1FEE A;  3UR0 A;  2V50 A;  2Y0S D;  1HA1 A;  4GVB A;  2LXI A;  2MSS A;  1FTC A;  3M30 B;  4Z37 A;  3G9C A;  2XQC A;  2C2O B;  2ROG A;  1X4B A;  2NLW A;  3O2I A;  4ZDN A;  5KG6 A;  1FD8 A;  4LF4 J;  1TV6 B;  3HK2 A;  1S1T B;  5JVG Q;  3LGH A;  1HPZ B;  4CT8 A;  1WHY A;  2XUL A;  4YEA A;  3PG9 A;  4B3O B;  3EX7 B;  2QMW A;  3MAA A;  4LF5 J;  4O44 A;  4GKK F;  3NGU A;  2PT0 A;  2FJA B;  1VQN S;  4UT4 A;  2RDI A;  2PA8 D;  4DF4 A;  2DRD A;  1YJV A;  2M8H A;  2H51 B;  2Z56 B;  4N47 A;  3NS6 A;  3R1H A;  3GJR B;  1TUG B;  5CHC B;  3K0J A;  2EW9 A;  4NZ6 A;  4DX8 H;  2VJV A;  4R5P A;  3OR2 A;  3IRX A;  2IVF B;  3J81 j;  2EPI A;  2IBO A;  4LUB A;  1JJC B;  2R2T A;  3KJF B;  1FRL A;  4FZV A;  1QUP A;  4UTG A;  3D67 A;  1SKW A;  2FIU A;  4WFB Q;  3MCO A;  4WZQ A;  2DHX A;  1NKB A;  4NLP A;  5EGY A;  4J91 A;  1F2H A;  2R7X A;  3BRE A;  3DRY A;  3H4D A;  3SMZ A;  4Q7A A;  2LKZ A;  1E6V A;  5B7W A;  2CPF A;  4CH1 A;  1T11 A;  3KNA A;  3GJS B;  1HWK A;  4FNH A;  4R0E A;  1W25 A;  1T05 A;  1TK8 A;  1MG7 A;  3HVT B;  2GVD A;  1R8P A;  4JI5 J;  4LIW A;  3ZZP A;  2C2K B;  3DRP A;  4XPC A;  4ZPT R;  1RTJ B;  2KYZ A;  5E0O A;  1YJT A;  3EJM A;  1FKP A;  5MAO A;  1KC8 T;  2CJK A;  2DH9 A;  5CXT A;  3LH2 S;  4ECU A;  5K8O A;  3UNG C;  4Y2M A;  3RBZ A;  1X4C A;  4CTA A;  3I56 S;  2VG6 B;  1X5T A;  1HBO B;  2ZH4 A;  4OHY A;  1X5P A;  4LR7 A;  1RLC L;  1UTA A;  4CLP A;  4PQU A;  4ER8 A;  2WVD A;  2B9X A;  1U8S A;  1Z2L A;  5M2P A;  5D78 A;  3ITH A;  4O3Q A;  2DNG A;  2YNG A;  4Q2M A;  2QLJ B;  1N33 J;  4DG1 A;  3PKY A;  4NLD A;  1NAQ A;  2EFV A;  2DR8 A;  3QIP B;  4JV2 A;  3CCR S;  1IKY B;  4HEA 9;  4ZVT B;  1NSQ A;  2HUR A;  1IQZ A;  3SEO A;  1KBR A;  2VFS A;  3MCN A;  4FP9 A;  2PA3 A;  4Q2L A;  2LXF A;  5LMN J;  1RT7 B;  4KHP J;  2LQ5 A;  4XAK A;  1AFJ A;  1UA1 A;  4HL9 A;  3NS7 B;  2UU9 F;  4NA3 A;  3HVW A;  1UL3 A;  2ZBR A;  4QR0 A;  4CLL A;  2JSX A;  2BJ9 A;  2DJW A;  3HI9 A;  1ARO P;  3DLL Q;  2P2C B;  4X4R A;  1M0S A;  4YDD B;  5ETL A;  2R7W A;  1HFE L;  1IM6 A;  4AL5 A;  3Q8P B;  1B64 A;  2VL1 A;  5BXI A;  5A2Q U;  2ZH2 A;  2GA7 A;  3I0R A;  5A8R B;  2F63 A;  3O5T B;  5DLG A;  3OFG A;  4OYX A;  4HHU A;  3DKD A;  2L48 A;  2CWK A;  3VHQ A;  3DRS A;  5KFH A;  2VPX B;  4UY8 T;  5KG3 A;  5T41 A;  3NMR A;  4DN9 A;  3DGP B;  4UST A;  4IR9 A;  4QYZ J;  5CQG A;  1YWX A;  4KRW A;  3GU0 A;  4NXN J;  2V8D A;  1YJN S;  3W60 A;  2XI2 A;  4Z7Y A;  1M90 T;  2ZZN A;  1Y7P A;  1KHV A;  2Y8W A;  3PW2 A;  2PSZ A;  3BB5 A;  2GAG C;  4EYH B;  4YY3 J;  3IWL A;  1M5P C;  4FBU A;  3FSI A;  1SC1 B;  4H54 A;  3TA1 A;  4C3L A;  4Y2A A;  2EVZ A;  2NXJ A;  3TJ8 A;  2A18 A;  2AJ2 A;  3PW0 A;  2DIS A;  1Q8L A;  2YPY A;  3NCP A;  3PIP Q;  5KFU A;  2DK2 A;  3CJ3 A;  5AJ3 F;  1U0H A;  3EIC A;  1JMT A;  1TL7 B;  3NGS A;  2XMW A;  4B9T A;  1KOH A;  3BYR A;  5IT9 Y;  5KFB A;  4OYA A;  1K47 A;  1TKZ B;  2YKA A;  3EPI A;  3BGR B;  2OPS A;  5DM7 Q;  2ZUG A;  2Q66 A;  5FJ4 A;  4MK7 A;  2W25 A;  3SYZ A;  2HHX A;  2HHH F;  1NBE B;  2IBK A;  4PXC A;  3BSA A;  5H9E K;  5LOQ A;  3NGD A;  2WOM A;  2LA4 A;  1NXI A;  2UVR A;  2PDA A;  1T0T V;  1PC5 A;  3PKM A;  2ZKU A;  4MIW A;  1LQ9 A;  3Q23 A;  2M0G B;  4PG4 A;  1Y5L B;  3HHN B;  1WEZ A;  1YKW A;  4WFY A;  3RBD A;  4GKK J;  5LXY A;  3J80 U;  1M5K C;  2ABY A;  3AOB A;  1PIE A;  1N6Q B;  2GML A;  3N5F A;  2W4P A;  2XCA A;  3BN7 A;  1FRX A;  4NLQ A;  1X4E A;  1S99 A;  2EC2 A;  3NAH A;  1MWQ A;  1HL6 A;  3KK1 B;  5ETS A;  4WFX A;  4HAC A;  4X2B A;  5D4L A;  2YBV A;  4HDH A;  3OXL A;  4USJ C;  3WQP A;  1LWX A;  3LWL A;  4QWC A;  2FJX A;  2Z0G A;  5F0W A;  3UCU P;  2ZH7 A;  4F8R A;  2XZW A;  1BE4 A;  4I6Y A;  1ZM4 A;  2AYB A;  1LWF A;  3FJ2 A;  2J6S A;  3GZ7 A;  3AT1 B;  4V1A k;  2QYG A;  2QFI A;  3PRD A;  4F4Z A;  5IQQ A;  1ITP A;  3WDO A;  3V81 A;  3CJ2 A;  3CE8 A;  3BDP A;  1SC4 B;  4X4U A;  1DTT B;  2QA4 G;  1Y3K A;  1PJ5 A;  5LXR A;  2XM3 A;  3TVY A;  5HAO A;  5SUH A;  5ETV A;  3OXF A;  2H48 B;  2G0I A;  1HQE A;  2HEK A;  4QPT A;  3CJ8 A;  3QID A;  4ECQ A;  4JI7 J;  4NCA A;  1ZM2 A;  2HQC A;  3MM6 B;  3VAK A;  2JEI A;  4ZHR A;  4O0I A;  5BJR A;  2PFF B;  1BQN A;  1S1V B;  1T02 A;  2B4O A;  4F26 A;  2V4J B;  1FVS A;  2RDD A;  3S7R A;  3SSS A;  5ETR A;  4U7C A;  4NI2 B;  1RKJ A;  4K4U A;  4KBI A;  3S1T A;  3BQ1 A;  4BBY A;  3PRV A;  1HHQ A;  1JJH A;  4C8Y A;  5DO2 A;  1SUQ A;  3LGM A;  5FLX U;  2XG8 A;  3LAL A;  1UVL A;  1AA1 B;  4ETX A;  1H98 A;  4WII A;  3OXG A;  1TMM A;  4RNH A;  3PV8 A;  3KJV A;  4W4M A;  3O44 A;  4M5D A;  3POT B;  1IJE B;  3BH7 B;  1TL3 B;  2HHT A;  3W5Z A;  2FHJ D;  3MEK A;  1X0P A;  3DYA B;  3M2V B;  4KV8 A;  3Q2S C;  1S9F A;  2UU9 J;  2MQM A;  4F36 A;  3UD4 P;  4O3R A;  1ZOT A;  4CP5 A;  4WCE Q;  3KG4 A;  4M5I A;  3M8Q A;  4IRK A;  3ZXW A;  4B3T F;  1WNE A;  4WXW A;  2QV6 A;  3R97 A;  3ZZO A;  2CQH A;  1S6O A;  2BMB A;  4ZVQ B;  4P71 A;  1UFW A;  2HQD A;  1NLK L;  5KFJ A;  3F41 A;  4ZIW A;  7AT1 B;  1Y0H A;  4OI3 A;  2XSJ B;  4DQQ A;  2F9D A;  3F44 A;  3OR1 B;  2DGW A;  2RRB A;  2RQC A;  3QAT A;  2V69 A;  1NJI T;  4IFV A;  5LJ5 Y;  4MJK A;  3KLF A;  5IT4 A;  2IM2 A;  1MMN A;  1JKH B;  3THP A;  4DX5 A;  2G0C A;  4N5S A;  4Y6I A;  1KKH A;  5EWF A;  2Z58 B;  3SQG B;  1OQ6 A;  5IFM A;  5ADZ A;  3PJ9 A;  3V6D A;  4QWE A;  1RTI A;  1BWV A;  2HG4 A;  2DB1 A;  2ERR A;  5KFZ A;  2FZG B;  3DOL B;  2G1D A;  4FXD A;  1A7G E;  2PFD A;  1Q16 B;  2AIR B;  4CLY A;  3EGZ A;  2WVF A;  4DU7 A;  2DVI A;  2ZOG A;  3SDE B;  5LMU F;  1QLN A;  4G1I A;  2GQ2 A;  1X9W A;  3CDW A;  5AJ3 J;  1OSD A;  2CQ3 A;  1NSP A;  1AFI A;  2R4F A;  4NCB A;  2GVZ A;  4P75 A;  1H2V Z;  1VQP S; 
#chains in the Genus database with same CATH homology
 1RAO A;  3QBC A;  1CBK A;  3HD2 A;  3HSZ A;  3HSG A;  5ETQ A;  3IP0 A;  3MCM A;  1F9H A;  5ETP A;  4PZV A;  3KUE A;  1TMM A;  2BMB A;  4M5J A;  5ETN A;  1EX8 A;  3HD1 A;  4CRJ A;  4M5G A;  1KBR A;  3MCN A;  5ETO A;  3ILJ A;  3HCX A;  3MCO A;  4M5K A;  1RTZ A;  4M5L A;  1TMJ A;  5ETV A;  3UDE A;  1DY3 A;  4M5I A;  5ETL A;  5ETT A;  1Q0N A;  4CYU B;  1HKA A;  3KUH A;  1IM6 A;  1EQM A;  1EQ0 A;  4F7V A;  3ILL A;  5ETR A;  4M5M A;  5ETM A;  4M5H A;  4CWB A;  4M5N A;  5ETS A;  1HQ2 A;  3UDV A;  2F63 A;  1RU1 A;  3ILI A;  1G4C A;  4AD6 A;  4CYU A;  3HSJ A;  2F65 A;  2CG8 A;  3UD5 A;  2QX0 A;  3HSD A;  3KUG A;  5ETK A;  3HT0 A;  1RU2 A;  3ILO A;  1RB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...