4M5KA

The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
b'MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.
pubmed doi rcsb
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4m5kA00
1RTZA 1G4CA 3MCNA 2BMBA 2CG8A 4M5IA 1EQ0A 4M5LA 5ETRA 5ETOA 3HCXA 3ILJA 3ILIA 3ILOA 3QBCA 1EQMA 2QX0A 1RU1A 4M5JA 4CRJA 3UDEA 4M5MA 3HSGA 3UD5A 4CYUA 1RB0A 4CWBA 1HKAA 1IM6A 4AD6A 3MCMA 3HSJA 4M5HA 5ETNA 3HT0A 5ETQA 2F63A 4CYUB 1RAOA 5ETLA 3HSDA 3MCOA 4F7VA 4PZVA 5ETMA 5ETSA 5ETKA 4M5KA 1KBRA 1EX8A 3UDVA 4M5NA 1CBKA 3HSZA 1TMMA 3ILLA 3IP0A 3KUHA 1RU2A 1F9HA 3HD2A 3KUGA 4M5GA 5ETTA 5ETPA 5ETVA 3KUEA 1DY3A 3HD1A 1TMJA 1Q0NA 2F65A 1HQ2A
chains in the Genus database with same CATH superfamily
2DY9A 1FKPB 1S12A 3DKDA 5DJBA 3W60A 3B78A 1FJGF 3VGUA 3CIZA 5AE1A 2E5GA 3B4DA 1FF2A 1DRZA 2P9GA 1UVMA 3MEGA 5B09A 4LT6A 3H4DA 2W01A 3Q22A 2HFOA 4L76A 2R7WA 1JJ2R 2BANB 2CKWA 2KH9A 3IRWP 5KFEA 1VR6A 4G65A 3C14B 1HR0J 4TU9A 1WC6A 4FKXA 1OS5A 1FK9A 2ZNYA 5D0GA 1SC3B 3HD2A 2ZKUA 2HK2A 5DO2A 4W90B 3RRGA 2VC1A 2YQ1A 4DV4J 4ZJOA 4R25A 3D3BJ 3H5YA 3RU0A 2B9WA 4CM2A 1VK8A 4J9NA 3C15A 3W2WB 2HZCA 2LXIA 2CJAA 3PG9A 5E3QA 2GMLA 1O8BA 2QLJB 3PW4A 4P72A 1U1RA 4ED6A 2RDDA 1TKTA 4R8UA 5DLFA 2YH1A 2N3LA 4EYHB 2QV6A 3KOAA 4ZIWA 2XY7A 4LF6J 3I55S 3DDKA 3C16A 1T9XA 2OAUA 1L3UA 5KFBA 1HWIA 3I0RB 1OY8A 4NLVA 3G82B 4Q2LA 2EKNA 2GZOA 2XLJA 2ZD1A 1X0FA 4WFZA 4DV3J 2VBZA 1WKLA 2DGXA 2HVZA 5IT0A 4ELVA 3TJAA 4WKRA 3E01B 4ANEA 5HMXA 4WZMA 2LP4A 2DH8A 2DRDA 4QJVA 5C5JA 4RU2A 3TZWA 3Q0AA 3L9ZA 2DNMA 2EKYA 4LBHA 1ZS6A 3QQCD 1HA1A 4ZLNA 4CO3A 4ENOA 4NRTA 2RUGA 2U2FA 3J81U 4DX7A 4B3TJ 2VDIA 2XULA 5HP1B 4ILMA 4KC5A 3OTOJ 4RW4A 2JLEA 5F8LA 3EVWA 1PBAA 3EX7B 4Z37A 2Z56B 3ISND 4CLYA 2IYGA 1UTAA 4IUFA 4UQTA 4UW2A 1Z4UA 3M8SA 1S9FA 4ZVRB 4JI6J 3ZTPA 4E2FB 5BXIA 2HVHA 3WZ0A 1WACA 1BE4A 2I9SA 3GZ7A 1YHQS 4ZN1A 2U1AA 3DOLB 1HR0F 2DNGA 3AD7C 1SC6A 5L9NA 1X31C 3LPYA 1SQGA 2KRRA 5AT1B 3A8JA 1LXJA 3J80Y 4F04B 2YH0A 2BQUA 2EBGA 5DG7A 3BB5A 3HHKA 1H98A 3D4JA 4DV4F 4G1QB 4JI5J 3NCQA 4GKJF 2YTCA 3OFEA 2Z30B 1NMEB 3Q8UA 1K44A 2V69A 4UF4A 2NZCA 4Z7CA 1E6YB 4DFKA 5KG6A 4X4QA 2Z4PA 1FNOA 1FRIA 4OI6A 1A0OB 4ELUA 1U45A 4MJKA 4DSFA 2OIHA 1Q8BA 2BUNA 3FBEA 4ZCMA 1RHKB 3A4TA 2MLXA 3MM9B 3TARA 4RW7A 4IFYA 4QIGA 2Y8WA 4OJ3A 4B17A 1FRMA 2YWKA 3N01A 4ICLB 1YJVA 1MWYA 4LF6F 4URSA 1Q1KA 1SH0A 4OI2A 1SB6A 3EPIA 1WUUA 2JWNA 4PPZA 2HZAA 3MM5B 2AQ4A 3L3CA 2B7BB 1F60B 4ZPWR 4F3OA 4DSLA 1N34J 1VQLS 3R27A 3CULA 9ATCB 5J1EA 4FS2A 1NPRA 4DV3F 4YDDB 4NLSA 4ZOSA 3GWCA 3QZ8A 5L39A 5ETMA 2DGQA 2GVZA 4CLZA 2XO7A 2FHJD 4M5HA 4TY9A 1YJRA 2BQRA 4CYUA 2NYIA 3MMBB 3NGSA 1F0XA 4TY8A 2B4OA 2UVVA 3N6MA 2F5GA 1NHVA 1U8SA 3UR3C 1NDCA 2LDYA 1DY3A 4ZMMA 1SJ4P 3M32B 2YNIB 4LF4J 3OTOF 1T9YA 5EGYA 5CYMB 4GRSA 4TLRA 2XWYA 1F9HA 2PEHA 2GGPB 4JI6F 3GIKA 4PXDA 2CPJA 5BYRA 1KFDA 1S97A 1EP4A 4CLWA 3SCLE 2V9WA 2F7VA 1WC0A 3MMJA 2FTRA 3HSJA 2PFDA 1D9DA 2EK1A 1R0AB 2ILYA 3LAKA 1AUSL 2G0IA 1IM4A 2CQ1A 3E8OA 4RL1A 1BQNA 3A1YG 1IR0A 2A6OA 2OPSA 4JI5F 4RUBA 2Y0SD 3HM9A 3PW2A 4FYVB 1U8WA 2DH7A 2KG1A 2CAJA 3W1YC 5HBMA 3OTEA 2HURA 4KGZB 1X4FA 3CD7A 3K5OA 5HI7A 4L75A 4Q8FA 2VD3A 1UVIA 1VQ6S 1R0CB 4P2SA 2ROPA 1KBRA 1WKJA 1KOHA 3NGRA 2UVWA 2ZZNA 3IG1A 3G71S 1FTRA 1AB8A 4RW6B 1IBMJ 5DS7A 1NM2A 3LH2S 1ZM3A 1Y5NB 3GYNA 3TAMA 3DU6A 1U47A 4LUBA 1RISA 2WB4A 4ZPAA 4FYYB 1KVKA 3QT6A 4XDDA 3DRXA 3NWRA 1HNVA 2HBRB 1AROP 1DQAA 1M1HA 1N34F 1S0VA 3VTIA 1S72S 1KQGB 2AJ0A 3VR1A 3QLHB 1EQMA 5AXNA 4DR6J 1DJ0A 3JSMB 2OSRA 1TFWA 1VMBA 1DQ8A 4F3QA 1JLQA 3S6EA 4I6YA 3GG1A 2UZAA 4LIRA 4QIFA 4PUOB 4TN2A 1MWZA 1EKSA 3THTA 2QA4S 2D1CA 3OUYA 3BQ2A 3KMSA 4H54A 4LF4F 2F9DA 3ZZZA 3DOMA 4KIAA 5L1IA 2ZC3A 5E2QA 2HYIB 5B0AA 2G0JA 3MMCB 8RUCA 2DXFA 1UWBB 2AMCB 1MU2A 2CQ4A 5GAGU 2DO4A 2XHWA 1S9EA 3KK3B 4MKAA 2M5YA 2J7WA 1TL7B 4ZVOB 3ZZ0A 2W8KA 4Q0BA 4ZVSB 3IWNC 3HHLD 2FJVA 2JC0A 1RWWB 4RPFA 3RGIA 2HHQA 3H59A 1QSSA 3PJWA 3PEJA 1TAUA 1HWKA 3VAKA 4DQRA 2AT1B 2Y9HA 3DDIA 5J2QB 1TELA 1TV6B 3D0HE 3MEEA 3DLKA 2UUWA 4B9NA 1BWEA 5I3UA 1KTQA 4QU6A 3KJNB 4CLKA 4EBDA 2CQ3A 2JC1A 1FFWB 3CDEA 3IO1A 1IBMF 1NCLA 1KD1T 4P75A 1ZZNA 2IMWP 2BOPA 2ZD1B 5KT7A 2Z57B 3IBWA 5HL7Q 1HHTP 2CNNB 1TUGB 2AEFA 3HVRA 1WHVA 2DR6A 1Y3JA 5D0RA 2B7CB 3EUNA 4ID5B 5MLCV 3DRRA 1KQSR 4DN9A 4TU8A 2WK4A 4M5IA 1OY9A 3KJVA 3EMTA 2MZTA 1H2TZ 1NSKL 1WWHA 4ZPTR 2NXEA 5HO4A 4LF7J 1WD6A 4DR6F 1VQPS 1WG5A 4OHVA 1TR0A 1RJJA 3CNQP 3LANA 2EXUA 1U6ZA 4EO8A 4P52A 3S1TA 4ETZA 2BE2B 1IXKA 1RWXB 1UEKA 2ABYA 3CJ8A 2YKQA 1XMBA 5J2NA 2IIHA 1JJ4A 4KE5A 3PR5B 2UU9J 2I8EA 1UETA 1NHUA 2V94A 2MHNA 4ZJLA 1FNXH 3IMQJ 2Q43A 2XLIA 2HLTA 2X1BA 4OX8A 3P45B 1QTNB 3CJRA 3D1HA 4H4MB 2CQPA 3KLIA 2ZH4A 4EI2A 4DQIA 3KLGA 1S6PA 1S1WB 5IC6B 5IM0B 4C8ZA 1KC8T 3H4BA 5B0DA 5ITHA 2CJBA 1FKAF 2M9KA 1UVNA 1QE1A 4NYPA 5I42A 3EZOA 1RT3B 2O01C 4WFAQ 2HFNA 3KLEB 2MLZA 2NXCA 2XGQA 3VV2B 2VF3A 2KDOA 2E66A 3HKZD 2I0XA 2DCUB 2HRTA 1L3VA 5DZ7A 3EYZA 4NLXA 5BYSA 4P9SA 2RSQA 4CP5A 2ATLA 1JX4A 3KHGA 1ZZFA 3R6GB 2C2NA 3NG8A 5KFZA 3GYXB 1RA7A 5LSOA 1UJ6A 3ONQA 2FLOA 4I2PA 4ALZA 1PYOB 1TUWA 4O44A 2IMOA 2B43A 2YWWA 1SQEA 5A8KB 2V4JB 4U96A 2MQMA 1UA1A 1IKVA 4WYLA 4HEA9 2J0SD 3BBCA 2XMUA 2IJFA 3V81B 4L3NA 2OPRB 1OQ3A 3PCOB 1TL3B 4L6V3 4LSLB 2H9ZA 3UQSA 3CIMA 1JB0C 2GQ2A 4XO0A 1YJTA 2VB6A 4LF7F 4R5PB 5L1KA 3JAMU 5HQLA 4DR1J 4LRCA 2HS0A 5LT5A 4N47A 3BPDA 3THPA 2LECA 4ECQA 3ILIA 1NK7A 4YR0A 3TR5A 1IJEB 3M6VA 2UU9F 1OYDA 2ZJQQ 3JYTB 1O5JA 1QAJA 3M8ZA 2RDJA 1UL3A 1MN7A 2ZBCA 1WJ9A 2EEYA 4PPDA 1Y11A 5KFLA 1R43A 1KDNA 3EGNA 1SC1B 3W2VA 1VC5A 3MCSA 4C8KA 3IC1A 4RWWA 3W5XA 4HTJA 4WPAA 5HBMB 2B6AB 3KJQB 1B0VA 1H7WA 4TQSA 1SV5B 1NSQA 2RD5C 2VA3A 2W7PA 5CABA 1N5QA 3NNHA 1TL5A 2AF6A 4QQBA 1YJNS 1RAFB 5JVHQ 1QSYA 3BR9A 5L8RC 2AYGA 5KFUA 3PYDA 1DURA 3G9CA 3O8WA 5D0HA 4OV1A 3D28A 5FDLB 2ZH6A 2MQQA 1BXNA 4WP9A 5DDPC 1BWVA 4OLOA 2KT5A 3OLAA 4DL7A 1NK0A 1YJ7A 2R7QA 4K5RA 1HHQA 2HNDB 2B9XA 2R9LA 2ZJPQ 2EWHA 1SJRA 2J6TA 3GIMA 1VQ9S 2RDIA 1U1OA 2AWZA 1U0HA 1LOUA 1XC9A 1DZ5A 3R1HA 1S9GA 3MHYA 4QYRA 1JNZB 1P9QC 3QO9B 4EMDA 1WTBA 1X9WA 3DDNA 4RW8A 3TEHB 4MK9A 2DD8S 3MZIA 3GIRA 5GAHI 2FQQB 3D3CJ 4WK1A 3DGVA 2XM3A 2IDEA 5FD1A 2JHEA 2N7YA 4DQQA 1C2PA 1KLMA 2DYAA 4ED8A 3W63A 4B3SJ 1HNIB 2HMIA 2LXUA 3V4IB 3V6DB 3ZNUA 1J5OB 4C8NA 5IV4A 1LEOA 2RUSA 2ACMA 3ZC4A 3DOMB 3BGRB 1DTTB 2P6TA 2N3OA 4DR1F 4O23A 1PBUA 1GMWD 4QZVB 3ULHA 5L38A 2Z0GA 1FVQA 2ZVIA 4J9MA 4P7VA 4CO1A 1VS3A 2N82B 5F8HA 2FD2A 4F67A 2QN6B 2CPYA 2VBWA 2NXNA 3DXBA 4F2SA 3NGTA 1WG4A 1TKXA 3OL9A 3SCKE 4HKQA 4LSZB 4X2BA 4IDKB 4YQWA 3HVTA 3T5JA 4DR4J 4WP8A 1ZAVA 3L4BC 3A3NB 4LSNA 4OYPA 3M8PB 1T05B 1VIOA 5ETOA 3K57A 1RLCL 2CFXA 3M8QA 1UEVA 1IWGA 3MURP 2CWXA 4USVA 4UOFA 1S1TA 4IRCA 3LQVA 3P49B 4I67A 2CDQA 4RKUC 3W7BA 3DLKB 5KFHA 1D9AA 3QGGA 1YJUA 2XWXA 5D6GA 4HDGA 2R8JA 5CXTA 2GAGC 1PJ5A 3OQ2A 4AXJA 1HW9A 1SH3A 5KTQA 3BEGB 4O3RA 4CH7A 2B9YA 1S6QA 1NH8A 3HDSA 1IQZA 2FVCA 1W25A 4AL7A 4ZP8A 2N4DA 2DNRA 2NCKL 1ZA1B 4W98A 2P6SA 1F5BA 2KM8B 1V3SA 3HMJG 2XMVA 3DRRB 5KFFA 2I1RA 5B0FA 5F8MA 2JLGA 2XMMA 1HQEB 4Q44A 1LK7A 5B0GA 4ZA1A 3C46A 3BH7B 3T1HJ 4PYDA 4NA3A 1TQLA 3KWMA 4ES3A 3AB4B 2FLLA 4CO2A 4FYXB 2ZBQA 1ZTTA 3CW2C 1AFIA 4RO0A 1FNMA 4JB8B 5J2MA 5B0EA 4B3SF 2M3DA 1VBXA 1A6LA 4JI1J 3TUJC 3BV8A 2ZHBA 1P9YA 3G8TA 2G2OA 3Q2SC 2VZ9A 5GVQA 5DGBA 2DIUA 4AYBD 2CNKB 2OMLA 1X4CA 4I2QA 3K2YA 1D8YA 2CQCA 2FJBB 2ALZA 4AXIA 4LF8J 3CVKA 3J7AN 4ZPVR 3IGNA 5HJYA 1WTFA 4KBIA 3C66A 1RTHB 3JS9A 1JLEA 2VDHA 4QPTA 2CJKA 2LQ5A 3MEKA 1MW7A 2KL8A 1MNEA 2HRUA 1HBNB 1N5TA 4QYZK 4DR4F 2XYHB 1WSVA 3CJ2A 2VPWB 5D3GB 5HROA 3R9LA 1R6YA 4HVZA 4CTAB 4ED1A 1H74A 5MAOA 5B7WA 2KTQA 5DM7Q 4EFAC 1REVB 1WHWA 3GJQB 4ZCIA 3W5YA 4JOUA 2BV3A 4A8MP 2V2ZA 2BJ8A 3DLEB 2FY8A 1N6QB 3DYAB 1U6FA 3QSYB 5EX3A 2W7OA 1LWCA 5A2QU 2IM1A 2QO3A 2GAHC 5ETKA 2PMWA 1H2UX 3ZZOA 3QYYA 3LP1B 2E1AA 1E6VA 4OZ2A 3D6MB 2HS3A 3CCJS 2AEMA 3IS9B 1VFJA 3H5SA 4HH1A 5D78A 1NAQA 1P8GA 2QE5A 1OQ6A 2MQLA 2Y1RI 2OP5A 1PILA 2EFNA 2LEPA 2RF2B 3T1HF 2CPFA 2I5JA 3H5XA 3NS7B 3GMGA 1JLGB 4H4OB 3E2EA 4M5GA 4XPCA 1IJFB 5K5MA 4B9SA 1N5SA 5GAEI 2JOQA 2EVZA 3RW7A 3NCPA 4DQPA 5HMWA 4USTA 3C3LA 1RE1B 4LRDA 4DX5A 2C42A 3KUGA 4DQSA 4JI1F 1Q7YT 5LSLA 3BN4A 2F8EX 3JSBA 4MK7A 2V6AA 3MM7A 4NMXA 1S59A 4C3LA 2R8HA 1RI7A 1VLYA 2DHGA 4LF8F 5KFCA 2QLWA 2YNGB 5L46A 3M6UA 5KG4A 3N0VA 4OI4A 2MXYA 1WC1A 4Y00A 2L9NA 1CJVB 1HKAA 2E7WA 3PACA 4KJIA 2R8IA 3ZTSA 3TQEA 1FA0A 3TX0A 2QLXA 2LDIA 3VZHA 1HNXJ 4RNMA 2J7KA 3QT7A 2YY3A 1ZETA 2V5HG 1K1QA 3NNAA 4DSIA 1D3WA 3PJ9A 2KT2A 1I6JA 5GMKa 2WSFC 1RU1A 4DR3J 2KXHA 2DK2A 5LOQA 1X4GA 4WTYA 2AU0A 4ECTA 1IVZA 4WK3A 2GA7A 1X5OA 3DOKB 2OPPB 4JI4J 1RGVA 4DPXA 1T9WA 3FFIA 4DXLA 4LFCJ 3OJSA 2VJVA 3FEYB 4OZLA 4I7FA 4TLQA 1RKIA 2R7SA 2E5LJ 3J81j 2PMZD 2OJ3A 4NXNJ 4M5MA 3R3TA 4F3MA 2WSCC 3RB3A 1VJQA 1WF1A 2FHJA 7AT1B 2F3JA 4D3HA 3CMQA 1W2IA 4F26A 3RR8A 2ASDA 4ZVPB 4PXBA 1LV5A 3BBFA 1FDAA 4A8SA 2GHPA 3SCIE 4ZPCA 2YVSA 2C3YA 1Q78A 2KFZA 1Q8KA 3H0PA 4IG0A 2HFSA 3UWTA 1R7IA 3E3XA 4DX8H 4JV1A 3JXOA 4HH0A 3ITHB 1MMNA 3J7YI 3FCVA 4DL5A 4DBQA 4UT4A 2X1FA 1WC4A 4BLGA 2MZSA 2ADBA 1U1KA 4ZP6A 3OR1A 5KT2A 4E98A 4OHWA 3KJFB 3RTVA 4RBVA 2YNFA 4DUTA 3CCRS 2G2ZA 2PC6A 3C19A 4FXWA 1RABB 3NAHA 2J8AA 3AOAA 2CJ9A 1YJWS 1HNXF 3SV3A 2GV1A 1FXDA 3WDOA 3DLLQ 3ZTOA 1VHIA 5KFWA 3GP9A 4DV6J 1LW2B 4NA2A 1FE0A 1G2EA 3N9UC 3ZZYA 2MMYA 4IH5A 4I56A 1UW9A 1U7LA 4DR3F 1LQ9A 2HIQA 2WOMB 3MM6A 1BD6A 1NB2A 5K8OA 4B9LA 4F0HA 1RZMA 1FD2A 1OMSA 4MYUA 4LR8A 2COLA 4JI4F 1L3TA 4LFCF 2E7XA 2BW2A 2RT3A 1VC0A 2W9BB 1S49A 1JLAB 1URNA 1HBMA 4LBIA 2GC8A 2Y1LB 4NLYA 4N7TA 2GQCA 2E5LF 3D6HB 3MMAB 3Q86A 3VGTA 3BJYA 4DL2A 5JJBA 3IAS9 3RAQA 4B9MA 4NXNF 1N5YA 4W4MA 1U25A 3MAAB 3M8WA 3ILOA 3H7HB 3BGLA 3O5TB 4DOZA 2G9OA 1ZYQA 4ANCA 4ES2A 3QIDA 3LP0B 2WHOA 4ED7A 2ZFHA 2J9DA 4YUDA 3TRGA 1C0TA 3BSAA 1EETB 2HHPA 1M90T 5K8PA 3D6TB 4IRKA 1XJWB 4J9LA 5KFMA 3TOQA 2XY5A 2C22A 2XSJB 4B08A 5KT5A 1HD0A 3HO1A 3T1YJ 3DRPB 2A1BA 2EFPA 2XNRA 3KLHA 1X60A 1U1MA 3I6PA 4ZLLA 2HHVA 3PO5A 2DNHA 5AXKA 1NRKA 1B4SA 4QCLA 3BYPA 2B51A 2ZOGA 2C2RA 2XLKA 2R7OA 1OIAA 4IFVB 2IJNA 4QIVA 3QZ7A 4NASA 1T03A 3HHLA 2ZUGA 2VG6A 3MPDA 4GVBA 3I31A 4I1TA 1R3NA 3GE9A 2J6UA 2FC9A 3FBFA 4IO9Q 2FIUA 3BGUA 4WU2A 3UO0A 2HNZB 2VFTA 3QAUA 2HVIA 4HDHA 3CDAA 3R7BB 3N5FA 3FCHA 5CD4A 1RBAA 2CQ2A 2MZQA 1FERA 5ETQA 2XCPA 4DV6F 1LWFB 2VFUA 3C6TB 3I32A 1Y5IB 1C1CA 2HNYB 2VIHA 4NE9C 3SFUA 4N41A 2QC3A 4LJMA 4J9PA 3OTCA 2HQ3A 1B0TA 4K8RA 1TKZA 2WVEA 2CVEA 3CWJA 3UN5A 2BJ1A 3AXMA 3D66A 2XQCA 3SMZA 2ZE2A 3NL0A 5C42A 1RWKB 5C25A 4GVLA 1RTJB 5CYQA 4K2XA 5EDWA 3EE3A 4UY85 1VRTA 2LQJA 5F8NA 1VQYA 1HWLA 5ETVA 3C2PA 5A8RB 3PZPA 2QMWA 2K06A 4Q2MA 5F8GA 4FP9A 3OVAA 2DITA 2QZ8A 4CIOA 2GIFA 1WF0A 5HK4A 6AT1B 3KK2A 3X3UA 3T6BA 4DS5A 4K5SA 3GFZA 4ERDA 2BJ7A 2KHCA 4RW9A 3BS9A 2DO0A 2AX0A 4KHPJ 3OFGA 2GHVC 3DLGB 3R1LA 4ATNA 1ZA2B 1LNQA 4Q8EA 4BBYA 3T1YF 2IRYA 1GXUA 3I5AA 2Y8YA 1NH7A 2JVOA 5AE3A 1RT5A 4FXDA 3HSGA 1T3OA 2NREA 5KFSA 3A8IA 4NI2A 5IWAJ 1UKUA 3K5PA 1HYSB 8AT1B 4A48A 2OKQA 4OYIA 4I64A 3WC0A 2M4MA 1MG7A 4OZ1A 1MMDA 4USUA 4KY3A 1G4CA 2DGTA 4C6AA 3DI6A 4P71A 3HPOA 3OBIA 4NEYA 2MHEA 1RHQB 5IFMA 4NCBA 1LWXA 2PGCA 4PWDB 3C8YA 4I69A 3I4HX 4FYWB 5A8WB 4OZ0A 4YR3A 4AD6A 2KFNA 4J9QA 1YSJA 2CXEA 3MFIA 3BKUA 3TO8A 1RT1A 1NXIA 2EC2A 2JZ5A 4DZDA 3VHQA 1IKXB 1DTQA 4P10A 3CJKB 1KFSA 1BGXT 4PAAA 2V8GA 4OHXA 1NU4A 3LGMA 2VQEJ 4X4UA 2IPOB 2DPIA 2IVMA 2BYCA 1SXLA 1CQNA 2HLUA 2DGVA 2QA1A 4JI7J 4ILLA 4X62J 2RQ4A 2W4PA 1DAXA 1F9EB 3PYGA 4U7CA 4X4NA 2LA6A 1F3FA 4ZHRA 2AZ1A 4F0KA 2AGQA 1S1UA 3PX0A 3PRBA 2C28A 4AL5A 2MKSA 3ELHA 2JFKA 1EQ0A 3W66A 5KG0A 2BX6A 1R0BG 3M2UB 1NSAA 2BXJA 3G8SA 2RMLA 4U8YA 1K9MT 2L41A 4KHPF 2HG4A 1NUEA 1T9UA 3M05A 2GVDA 3QPIA 1BQMB 1FRHA 1YG0A 1YWXA 4KGXB 3ZNJ1 2HWHA 1NEEA 1HI8A 1T3NA 2D3O1 1ELOA 2CPIA 4B3OA 2W2NP 4YS2A 1M0SA 2ZOMA 1WDTA 3UNGC 3THVA 3T9ZA 1H3DA 5D77A 1WI6A 5KG7A 3W9IA 5IWAF 2HHWA 2PEBA 1R8CA 2B5JA 4NLPA 2F8MA 2MQ8A 2DH9A 2VOPA 3GV8B 3CJTA 1YIJS 1QVGR 2XCAA 4IG3B 5F0WA 1JXLA 2D9PA 2OPQB 2AW0A 1S1XA 5J2PB 4RNHA 4U6PA 1PAEX 1Q7LB 3U7JA 3NGUA 2FZCB 4HTIA 2FZGB 2HEKA 1IUJA 3BF4A 1XMOJ 4WFNQ 2CQHA 1R27B 1Q16B 3H20A 2RQCA 2LKZA 4DV5F 1GNKA 3FEXB 2ZM6J 4KO0B 4CLSA 4Y34A 4O4GB 4YY3J 3G4SS 1JLFA 4FVMA 2IRXA 2VBXA 2LCWA 4DU7A 2YNHB 3PEHA 2VQEF 1U1QA 3CCTA 2B56A 2FJDB 3D0GE 3H25A 5ETLA 3IP0A 3M9OB 2C1EB 2QMUB 3FEZA 3UE2A 3P3DA 2QJ3A 2FUG9 1HQ2A 4JI7F 5ETRA 1S1VB 2V8VA 2YKNB 3J80U 3OTBA 2J5AA 4KB7A 1GX6A 4MKVA 5LSRA 1NDKA 1KHWA 1K8AT 1YQHA 4P7TA 4M5NA 3POTA 1KTVA 1HBUA 1GMWA 3R5BA 4RUAA 4LFBJ 1C1BB 4DJBA 2KXFA 3CF5Q 2OUGA 1ZM2A 2FJXA 4J37A 5CCLA 2BACA 3P5TL 2RAQA 3W9HA 1HARA 2HSEB 3EJMA 1AT1B 4K4SA 3VAIA 2IBOA 1QSLA 1VQ8S 3O3LA 5DZ6A 3M2VA 2V8DA 2EFOA 4KGKA 2XMTA 5LL6d 4NLWA 5F41A 2ZNZA 4ED5A 2IY5B 3BKFA 1XR7A 2GHWA 2VA2A 2FLNA 1QUPA 2HRYA 2L9WA 5KFXA 4M94A 1JLCA 1EX8A 3TI0A 3HHLC 3IR5B 2WONA 4IR9A 3K7RA 4LVNP 3PIPQ 2RVJA 3EGZA 4IQMA 3PTWA 1MROA 1PAUB 4HT7A 4TKTA 4DF8A 2DGUA 1KLNA 5K14A 1D0EA 2YWFA 2XB2D 3QFHA 3TANA 1LW0A 3QNWB 2W2MP 1F6TA 1XMOF 1K1SA 4OYXA 3IRXB 3NRBA 1CS4B 4WKYA 4Y2KA 2VG5B 2J9DE 3NOGA 1HNWJ 5D0EA 1GTEA 2ZM6F 2UXBJ 1CJTA 3PFOA 3I96A 3PNIA 4QIWD 2R7RA 2LQBA 3KLFB 4YY3F 3R7SB 4N56A 3MEDA 3T1AA 2ZC4A 1TL4A 1YI2S 1RTDB 1CQMA 3VAJA 4DG1B 3HVAA 3MCNA 3VCDA 3K5LA 1NJWA 1SKWA 4ED2A 1JKHB 5T7LB 2IVFB 2J0WA 2QFJA 4LRFA 4R0EA 5FJ4A 1YGYA 1ZTWA 4KR0B 2IAJA 2UV8G 4DV0J 2BE9B 3FJ2A 1KKHA 2BM0A 1CJKB 1R8PA 3F44A 4NA1A 3M2RA 1TVRA 5E0OA 4LFBF 5A6WA 4F0MA 4C8YA 3GG0A 2C3OA 4EEYA 3UDCA 2AJQA 4JV2A 1DLOA 3NLCA 1YBUA 2VC0A 2CUYA 2AP6A 2FVRA 2XNQA 2HGLA 1Q79A 1IKYA 4NI2B 3GJRB 3PO4A 1RTIA 1JMTA 2CA9A 3M1VB 4NCAA 3CMAS 2R8KA 5FLXY 4OJ1A 4X66J 1HNZJ 1T95A 3AD9C 3W8GA 5HVFA 3OSNA 3DI6B 4DL4A 3WBZA 4DF4A 2ZBRA 2KYZA 3HJFA 1RWPB 2QYGA 1TZ0A 1HMVB 1IR2A 2NYHA 3ENWA 4KFBA 4PYAA 4OX6A 2W9CB 2MLYA 3BDEA 4N76A 4C0BA 2ZHOA 1NK5A 2XEXA 4QBUA 1IBKJ 2QRRA 2HWTA 3LW5C 3BN7A 4YR2A 4OL8A 4ZVTB 1L3KA 1Y3KA 4P2XA 1JLBB 1RBLA 2VONA 1XWLA 1SVDA 4QW9A 1CULA 3PY8A 1FKOA 2DXEA 5EN1A 1S7HA 3IM8A 1RP5A 1HNWF 2WZ1A 2UXBF 2AJ4A 5LXRA 2CQGA 1R6VA 4DR5J 1XERA 4F4AA 3GV5B 3LO3A 2NZ4A 5HLFA 2GO8A 4UUWA 5E41A 4ZN3A 1F9FA 4ID8A 3DGPA 1QLNA 1RACB 2CPZA 1VK3A 3SIPB 4ZLPA 3DC2A 3T5KA 3H90A 2PE8A 1U0SA 2WVCA 1PIEA 5T41A 4ZDNA 3I0SB 4A8QA 1RT4A 2VL1A 4NLRA 2XZWA 2CG8A 1X5SA 4C3KA 2A18A 2JRSA 1VRUB 4GKJJ 3TQ1A 1VQMS 1AZSA 1T0TV 2FY1A 4OYBA 4ZPDA 4DV0F 2P2CB 1UZHA 2HHTA 2GVDB 3MTKA 1SJQA 4MFBB 2CDRB 3CXCR 2HHUA 1WORA 3QWPA 3M9MB 3OR2B 2B0GA 3TUIC 3MPYA 4KSEB 3H98A 2BW7A 2YKMA 4Z7YA 1FWPA 2GO9A 3ZZPA 4MKYA 3J7A1 3P8BB 1M5HA 1KSPA 3F56A 2H5EA 4X66F 1HNZF 3K0JA 2A10A 2LVWA 3BSNA 2K1RA 3DHWC 4B3RJ 4ZJQA 2EFVA 1C0UB 1T11A 4C11B 1VQ5S 4F7VA 2NPIA 1UVJA 3MAHA 1G7CB 2QLFB 4C4WA 1PC5A 2MZJA 3LGHA 1IBKF 4OHZA 3AT1B 5IQ6A 3CD6S 2DEIA 3D1QA 1V3ZA 1UEUA 4A8YA 1JK9B 2VICA 4PWWA 3WIUA 3LP2A 3KLVA 4FF3A 2F8HA 2MGZB 4V19J 2I2YA 2ZH1A 2HVEA 1GEHA 1NB7A 4KV8B 3VZIA 1CJUB 2ZWOA 5IT9Y 3M30B 2QLBB 1HPZA 4WFBQ 2KO1A 4DR5F 3MFHA 2Q6BA 3PIOQ 1LWEA 1M1GA 1RAHB 3SXLA 4HI1A 1QAXA 2PA8D 4NX9A 2C3PA 5CHCB 4HYKA 4LF5J 3MR7A 4RBTA 3D54A 4PABA 4OX7A 1DFDA 5CAAA 2GIRA 1NZAA 3Q8RB 3NMAA 3RBDA 2YWEA 4RU9A 3KHHA 4KAIA 4J9KA 4QR2A 1NPKA 1F2HA 4DPOA 4DPUA 1TK5A 3AHPA 2E7VA 3OVSA 1SL1A 3MR5A 1FRJA 4QWEA 1NDLA 3K8WA 3NKYA 4ZVGA 3L95X 3NBPA 1KEKA 1GK8A 4DUZJ 3UVJB 9RUBA 4WFXA 4J9RA 3ADAC 1RT7A 1FDDA 4LR9A 3ETOA 2K7JA 2N7CA 1C4CA 5A0YB 4ES1A 4WE1B 3WQPA 5HJXA 3ZTRA 5D15A 4DZ6A 2V8HA 3B54A 2HHXA 2Y3YA 2DNLA 2EG2A 4M5DA 1VQOS 4IYQA 3AD8C 3C6UA 3UN3A 1MROB 1IKWB 4DLEA 5I3QA 3EDQB 4ECZA 1B64A 2ZOFA 4OMFG 3SQGB 1Q4RA 4B3RF 4P73A 3BPSP 2IC3A 2AGOA 1BUXA 2VG7B 4CWBA 4B9UA 2DVIA 4JI8J 1VRQC 2Z8QA 3KK1A 1RT6B 3DRYA 4DV2J 3I82A 4HACA 2BE7D 2LQ8A 2UXCJ 4P6QA 4L73A 4K4YA 3KHRA 2PI5A 3HLUA 1UWAA 5KT3A 2FYXA 3EVOA 3AJ2A 2NXUA 4KPCA 5J1PA 1X8DA 4K0KJ 5C24B 4OX9J 4OI0A 4C8OA 2IRUA 2BR0A 1VQ7S 2DKOB 4MIWA 5D8HB 2OEMA 1RT2B 2FVQA 2YPZA 1N52B 4LF5F 3NNCA 5HN0A 4BWMA 2XY6A 3G86A 2EFGA 5DM6Q 1SJFA 2MKIA 4F4ZA 5F9NA 2Q3PA 1A7GE 1JIHA 1SJ1A 1JXEA 1HBOB 2W2QP 1NK9A 1HQUB 3VVUA 2EBEA 2VFRA 5F3ZA 3RJMB 5F8JA 2QL7B 4DUZF 1RAGB 1KN6A 3DMJB 3UCZP 1D8ZA 1I1GA 4CH1A 2RIJA 4C8MA 4WP3A 2ILZA 5DETA 2ZH5A 3VAGA 2R2SA 2V2QA 4OYZA 5HQMA 4GO7X 1RHRB 5JVGQ 3DM2B 4Y0FA 3HSZA 3EICA 4ZCLA 4EBEA 3MECA 3D68A 1ZBTA 5HVGA 2Q66A 3PM9A 5G0RA 1RTZA 4BDPA 3BH6B 2MQPA 3HP6A 2FHKA 1N5VA 1SUQB 4CRJA 2XMAA 1DQ9A 1NBEB 4M95A 3OSPA 4V19X 1FKPA 5IXUA 4G1PA 2HHHJ 4JI8F 1ACMB 1U2RA 1SL2A 2ACYA 2GQQA 2P8IA 5A76A 4F50A 4DV2F 5HANA 2H3EB 4KT0C 1P1TA 1UFLA 2UXCF 4Y28C 2J7UA 2VFVA 4IRDA 3LPEA 3MEGB 1NNDA 1YRTA 1GMUA 2BANA 5GMEA 1AXQA 4ZP9A 3C14A 3G6YA 5H9FJ 1LXNA 3EVMA 3TA1A 2BZ2A 3GIIA 4K0KF 2RU3A 3BO4A 4ECWA 1HHSA 2PN6A 4OX9F 1N88A 4NLQA 1TAQA 1BHNA 1FK9B 1ZAWA 2J76E 4OYWA 5KFGA 3TUZC 3VAFA 3EM1A 3FSYA 1DARA 3QSIA 4CT9A 5LJ3Y 3W2WA 2XS7A 2MY8A 2XS5A 3M6WA 5HAOA 4N77A 3C15B 1QAIA 1VI7A 4MKBA 1V5IB 3FK4A 1W2BR 2DNOA 4TYBA 1BC6A 4UY8T 4BS2A 3U1MA 3M6XA 2XSFA 4C0HA 2I38A 2DHSA 1UZDA 4FF1A 1UJ5A 2D41A 2GMJA 1TKTB 4R8UB 4RR5A 2ZH3A 3RB4A 2FJEB 1FI4A 3MOJB 1OSCA 2ADCA 2JLFA 2MB0B 2VJUA 3I0RA 3C16B 2QGFB 3EWGA 2WBRA 3G82A 1JWWA 1PSDA 2AJ1A 2KVQE 1WC3A 3CT9A 5IQQA 3ZFVA 4QWAA 4AFFA 3D0IE 4HT5A 1UVKA 3HFKA 1KQFB 1SJ3P 1Z1ZA 3ZZRA 2GFFA 1B70B 3E01A 3MXHP 1N33J 2KJVA 1RAOA 3R5GA 3Q89A 1QAYA 3D5MA 3PX6A 2W4DA 1U4BA 1UMJA 3BBBA 3SBMA 3MAQA 3CTRA 5HP1A 2LU2A 4QWBA 1Q82T 1ULRA 1LKZA 1FRXA 2HHHF 4K4XA 2MPUA 2J0XA 4YEAA 2VFSA 1IR1A 5T14A 4RW4B 2JSXA 5M2PA 1PC4A 2MKHA 2RILA 3FDSA 3AJDA 2C3MA 2Z2YB 3ICLA 1KP6A 3NAIA 1MWQA 3MUMP 3DOLA 3WHIA 4NCGA 2HPUA 4ANDA 2F4VJ 1N0UA 2ZBPA 3AAWB 1Y0HA 4ZS6A 4PR6A 4HHJA 3TWZA 4PG8A 4G1QA 3I56S 3TJ9A 1S4EA 3TZXA 2W4CA 4IH6A 1E6YA 4IH7A 2A2DA 1FESA 2C2ZB 2HQIA 2WW4A 2R2TA 1FJ7A 3AQOA 1T9TA 1X9MA 1NLKL 2M70A 2PO4A 4OZJA 3FMWA 2EFQA 2E1MC 1IN0A 3JSYA 2NUHA 3CUNA 3HHDA 2FGOA 4X64J 3HT0A 5KFIA 2RNEA 3OT9A 4RW7B 4ICLA 4IFYB 2VU5A 1B0PA 3WIVA 3QAEA 3GONA 3EZUA 4ECYA 3AB2B 3OXGA 2BKOA 3DU5A 6FD1A 3MM5A 1EZZB 4M5DB 4QWCA 4OQJA 4M5KA 1KVIA 3I4PA 4HR2A 4U7UK 1Y7PA 3G6ES 2BMBA 2IBKA 1GXLA 2IA6A 4Z2XA 5J1EB 3ETMA 1XR5A 2VHGA 2CQDA 2OFGX 4OI3A 1RKJA 1L3SA 1N33F 4O3OA 4QW8A 2GVZB 2OGUA 4U7UD 1B7FA 2W9AA 1OPZA 3MMBA 1H72C 3IN5A 4WWSA 2KB2A 1NK8A 2WVFA 4CYUB 4TY8B 5KFAA 5E3PA 5KOWA 2WBMA 3M32A 2YNIA 3PJXA 1B3TA 1ZM4A 2V2VA 2RRBA 2GGPA 2D3ZA 2R2UA 3HFZB 4J9UE 2XG8A 1SH2A 3IBFB 3Q8QB 3NGDA 3N5BA 1EP4B 2OI2A 1R0AA 1OWXA 4EU0A 1DBDA 2F4VF 2LYVA 3N6NA 2Z2LA 4HHUA 1BQNB 5B08A 3ET6A 3MR2A 1HI1A 2OPSB 4BHQA 2X1GA 3QJPA 1JQGA 3JB9k 3AOBA 2A2CA 3RUBL 4CO5A 4B02A 5H9EJ 4P2FA 2JEJA 1IM6A 3RB6A 4NL5A 1YZ6A 4DI6A 1M5VC 3JQKA 4PRFA 2J6SA 2V34A 3DLHA 2GJ2A 4RW6A 3O44A 3CO9A 2ZH7A 4X64F 3IG1B 2FLPA 2XZTB 2DNQA 3P6YC 5IC4B 3M9NB 3KFWX 2AIRB 2D74B 3HFVA 3ZXWA 4CT8A 1GTHA 2DB1A 3TAMB 4PG7A 2OD6A 2KRBA 1VHFA 2KT3A 1TMJA 2ZVSA 2KXNB 5DG9A 3HHEA 1HNVB 2Y0BB 3ISZA 1JXVA 2DXDA 3EXYA 4NLTA 4E0DA 3JSMA 1F2GA 2CZ4A 4ECUA 1WOSA 3KNAA 4DS4A 2R4FA 5CH7B 2Z2ZA 3K17A 1TFYA 4KYZA 1VC6A 3VALA 3OHBA 4PUOA 1KQKA 2QEXS 2IJRA 1JLQB 4ZVUB 3BR8A 4MTPA 1YLXA 2K7KA 2ROEA 3QT5A 1OY6A 1X4BA 4CO0A 3SI8A 4A47A 1D9FA 3OUYB 2X3DA 1D09B 1I5OB 3KKFA 3PV8A 4ZVQB 1PG5B 2GIQA 3PX4A 3I87A 3MDFA 3MMCA 7FD1A 1NKBA 1PYSB 5LM7E 1UWBA 1YITS 3MUTP 5LMNJ 5BR8J 1NSPA 2MJUA 3MR3A 3PR4A 5KG2A 2XYGB 2E1CA 5DDRC 1MU2B 3KK3A 1TL7A 2FVPA 5E33A 2IHR1 3D9BA 4XDCA 3H8YA 1HWUA 1S9EB 4NOHA 2CJXB 3B6BA 3GB0A 3OFFA 1RDRA 4Q0BB 3E51A 4A4JA 1FD8A 2C3UA 2JNJA 2IDLA 3FRZA 3A3PB 5E5NA 2KYXA 4LVOP 4M5LA 4ZP7A 4NEZA 5J2QA 4K4UA 1FCAA 3U1LA 4OYOA 1TV6A 2CG4A 4A8WA 2APOA 1QD1A 4DV1J 4CLPA 2CNOB 3QRPA 3B8HA 4FPRA 3CCES 3MEEB 4O4RA 1HIYA 1SL0A 1J27A 4WFYA 4I4BA 5G4DA 5I3UB 3V2UC 1W26A 1UJ4A 3UPFA 4F4XA 2G1DA 2YX1A 2MQOA 2CWKA 1KWMA 2CQBA 1NPPA 1RSCA 4J7CA 2Z58B 4FDFA 4DCOB 3EPGA 5HMZA 1FWKA 4ID5A 3TVZA 2POKA 1HW8A 4ITSA 1SI9A 2IFXA 3KJVB 4TNOA 2G1HA 4JI2J 1V3RA 4YN3B 2E1PA 2VPXB 4OZ3A 3MPWA 1XR6A 2O5DA 3H2UB 5L1LA 3FSIA 1H7XA 2BE2A 3B4MA 2W25A 3ILJA 5KFVA 2DNPA 4K4WA 3MR6A 1F5AA 3OPKA 3R5CA 1RUSA 4LIWA 3Q8PB 5J2NB 1N54B 3GCWP 2R7UA 3CC2S 2R3VA 4NCGB 2WCXA 5IS2A 3OTDA 5IZHA 4X4SA 4HLBA 4H4MA 5LMNF 2B4PA 2UXDJ 4OYMA 5BR8F 5EWEA 1EJ7L 3K89A 1S1WA 4M1KA 3KLIB 5IM0A 2NQPA 3KLGB 1S6PB 3MWBA 3QRQA 5M2UA 1PYTA 3QWUA 4RLEA 1RT3A 1QM9A 1QVFR 4R0JA 3KLEA 2UUCJ 4EUVA 2PSZA 1YX2A 1KONA 5L1JA 1QE1B 1Y00A 4HHHA 5I42B 4PXCA 3CCQS 1Y9OA 3L7PA 4RBUA 1S10A 2Q1LA 3EGVA 2GNKA 2LU1A 3CJ4A 3GTYX 3AJ1A 4UUXA 4ZLJA 4DV1F 3FBBA 3WC2A 1WEXA 1NO8A 3CCWA 5GADU 2BA9A 3SDEA 4DPYA 1TTHB 2R2RA 4WU3A 2DCLA 5A8KA 1RWNB 2V4JA 3SQOP 3AXKA 1QJHA 4I2PB 4QYZJ 1P27B 4NZ0A 4O44B 4CCHA 1WOPA 1REGX 4KHMA 2XTJP 2NPFA 1IKVB 3V81A 4CLUA 2XHCA 4USIA 5AE2A 2OPRA 4EZ6A 1TL3A 3BO2A 4DX6A 5IV3A 4LSLA 3JTOA 4B3TF 4JI2F 5EX0A 3CCVS 4R5PA 1ICEB 3GILA 4PKDB 5ETNA 1T8EA 5JUMA 1TUVA 3QGHA 3A8KA 2UVRA 3S8SA 1S79A 3B82A 2KZMA 1CEZA 4BWJA 5E3CA 1V5VA 5KFRA 5H1SV 4JV0A 3JYTA 2VQFJ 4YB1P 2XI2A 3VAHA 1UAWA 2L3MA 3G2XA 3OVBA 5F8IA 4N5SA 5KT4A 2UXDF 2BKPA 3IFEA 3AOCA 2ZUAA 4N8OA 3PDNA 1WOOA 4DLGA 1S76D 2DT9A 4YB5A 3UFCX 3ET6B 4LF1A 3W2VB 2B6AA 1M5PC 4WYWA 4OFZA 4CDIA 3MM8A 1GXTA 1RK8A 1SV5A 3CD0A 1J5EJ 2E5IA 1B99A 2G4BA 3OJUA 1S0NA 1R8HA 4ZCKA 3BSOA 2UUCF 4ECVA 1M5KC 1EB0A 2FGCA 2HQCA 4PXEA 5FDLA 2K3KA 3CPWR 3DRSA 3R97A 2QA2A 1GQEA 3TNVA 2HBYB 3HHNB 3OD2A 4XK8C 1PKUA 2VOOA 3IR6B 2R7TA 4DU8A 2HNDA 2HQDA 4UQGA 3IBCB 5H9FK 4KHRA 2NR0A 3MCMA 2H65B 2VKZG 3R6LB 4CNYA 3NOCA 4O3NA 2N4CA 4K59A 3QO9A 3K8VA 4H4KA 1U26A 4TXSA 1R89A 1U0HB 1SKUB 1S9GB 1YBAA 3M4XA 5L9XA 4Q5VA 1I94J 4RW8B 3OXLA 2F4FA 3EGWB 1XQIA 1K73T 4YHHJ 3PW5A 3CC4S 5E3RA 4IKAA 1RB0A 1Q86T 3V6KA 1Y10A 2GCFA 2MSSA 1HNIA 3CJ3A 3TZZA 2H1YA 4M8LA 3V4IA 3A13A 3V6DA 4YFUA 1J5OA 2JEGA 1KLMB 3A8EA 3PVXA 3MGJA 3BGRA 2HMIB 1DTTA 1RHJB 2HBQB 4YB6A 3CJ5A 3LA0A 3UDEA 2DR9A 2AZ3A 2VBYA 2M52A 1P1LA 1VLOA 1RLDA 1FXLA 4OYAA 5KG5A 5J1NA 1RWMB 2VQFF 4EYIB 3VQSA 4IDKA 2DGSA 1TKXB 3DN9A 4FKYA 2MY7A 1FX4A 4QWDA 3CE8A 2HFZA 3LTOA 4L3KA 3M8PA 5CQGA 3HVTB 1T05A 4NZ7A 4ZVFA 5KFTA 3A3OB 2D3UA 3IAM9 2ZHAA 1URRA 4LSNB 3FCWA 1X4AA 4LMZA 3TP2A 1VISA 1NKEA 3M8QB 3Q8SB 1J5EF 4YMEA 2DR7A 1OPIA 3U27A 1S1TB 5ETPA 2JL9A 4MK8A 3T6JA 4OJGA 1PJ6A 2WTFA 4FBUA 2O66A 4KGMA 3CGIA 2X7IA 3VAMA 2UUTA 2DEJA 4RNNA 5KFJA 3A12A 5KFQA 2ZDPA 3T5HA 4Q45A 2W24A 3O2IA 1M5SA 1ZM9A 1BY9A 3U02A 3ENAA 2BOAA 3CDWA 1S6QB 3KDNA 2FPHX 2WVBA 3VWSA 4F25A 2A0FB 3DHXA 2HK3A 1N32J 3D1OA 4K4VA 2JH3A 4DFPA 4OIXA 3K5NA 3Q23A 5K8NA 1HQEA 3RB0A 1YVFA 4WIQA 2FB0A 1Q8LA 2XMKA 4CLLA 4AQYJ 1G3OA 2AHOB 3GSIA 4O3PA 1I94F 3G6XA 1WKKA 2B9EA 3FKBA 3SSSA 1FJEB 2WSEC 4NYOA 3SCJE 3J81Y 4PCQA 2ASJA 2C2KB 2VASA 4YHHF 3EZ5A 3GJTB 3FUYA 3ILLA 3HXMA 3ZO7A 4B3MJ 3GSDA 1WC5A 4RNFA 4USHA 5J2MB 2M8HA 3NP5A 2YX7A 4CZCA 3NS5A 4DL6A 4LQ9A 3W8PA 4C97A 3QFWA 1R8AA 3CB4A 2UP1A 4N8NA 2MTLA 4P74A 4KQZA 2ERRA 4I2QB 2RB7A 4PQAA 3Q24A 1RTHA 2OELA 4BCAA 3G8QA 2WW8A 1JLEB 1HBNA 2JX2A 2OTLS 5KAKA 3KXDA 5D3GA 3LWLA 2JJ4D 2BJEA 1SIWB 4CTAA 4X65J 5HROB 4JUZA 5HSPA 2HS4A 3M8YA 1RWOB 3F0NA 5F0UA 1XNQJ 3KMQA 1REVA 5DDQC 3KDOA 3BO3A 1Q81T 4Y65A 4P2MA 2GX8A 3FQKA 3DLEA 1N6QA 3DYAA 4MH8A 2CVIA 1XK8A 2ZWPA 3SDEB 3OLBA 3QGIA 5KFOA 2ASYA 4LF2A 1RAAB 1LWCB 2NS1B 1FWLA 5LJ5Y 1U2CA 4OLPA 5K8MA 1WNEA 3MOZA 3LP1A 4DCPB 2BRKA 4ZITA 2F65A 1LFWA 3IS9A 4A8OA 1WSRA 3T41A 2HKEA 5K9FA 1N32F 3KYLA 1E6VB 2C2MB 4NLUA 3RRKA 1O0PA 1NDPA 2DNKA 4PZVA 4DWIA 4GKKJ 3GYGA 2RQKA 3F73A 3GFHA 2E5HA 2LQ9A 4AL6A 2RF2A 4AQYF 3S01A 1HFEL 2CZVC 2ZITA 3D2WA 5IT4A 1JLGA 4H4OA 2I5JB 1XMQJ 2O1PA 2Y1JA 3RBEA 2KKHA 4QR0A 2DTJA 5H9EK 1H0HB 3HX9A 1IWAA 3NMRA 4X4VA 4B3MF 2BJDA 3PHEA 3UNYA 4C8LA 3W61A 3GLJA 4JI0J 4IOBA 3RAXA 2L48A 4RJVA 1U02A 1Q95G 4WIIA 2YNGA 3MM7B 1CPZA 1WELA 5EUHA 1CJVA 4CQ1A 4W92B 3MM8B 4X4PA 2ATCB 5DDOC 4MAKA 5DQGA 3L7UA 1YTYA 2XI3A 1EKRA 4PG6A 2DJWA 3TJ8A 2CADA 3QGPA 3Q8YA 2BJ9A 1FX2A 1X4HA 4A46A 4GC7A 2MKCA 3I5CA 4Y3CA 5FLXU 4X65F 2VV5A 4X84A 4MIAA 3DRSB 1RBOB 2R7VA 1XNQF 2QIFA 3JQJA 4DN0A 5AJ3J 1EHWA 4A8XA 5DGAA 1IBLJ 4LF9J 5HQ8A 3TAQA 3S7RA 5AXLA 2W8LA 3R8YA 1NK6A 2OTJS 4NLOA 3AH6A 3DOKA 3BYRA 2OPPA 4Y6IA 2MKKA 2XZDB 2DY1A 4RUHA 4DV5J 1LFPA 5I3PA 4OZ5A 4DHVA 3FFIB 2CRLA 4J91A 1L5UA 3KNGA 3LGNA 5KG3A 4J9SA 3NCRA 4I7FB 4KH1B 5DQHA 4J90A 4F36A 5CZXA 3N4WA 1AW0A 3FC9A 4F02A 4GKKF 4DDFA 4H4KC 3MUVP 1HI0P 1WG1A 2MJNA 1I51B 3LF0A 2Z2MA 4F4KA 2CYYA 4LBPA 2YKOA 4CI0B 4EK2A 2EK6A 3V4MA 5IOLA 3UN2A 2ZH9A 1TK8A 1M1KT 1R31A 2NXJA 1XMQF 5KOXA 4CM0A 3TA0A 1ITPA 2VUGA 5EWFA 1VBZA 2GMHA 3D7SB 2O67A 1X0PA 4IG0B 1QY7A 4JP8A 3CDUA 2V68A 3ITHA 4NLGA 1VBKA 4JI0F 4L72B 1EARA 2X51A 4URQU 4KGVB 1ZAXA 4RNOA 2JVRA 3HD1A 2BDPA 4LR7A 4KKOA 3QMQA 1MN9A 3HCXA 3QBCA 4YDXA 4F2RA 4LQ3A 4FS1A 1CSJA 3OR1B 4B9TA 5HVHA 5F9LA 3TA2A 4C98A 3UDLA 2YNFB 1S77D 4PQUA 2QMXA 2AJ2A 3J7Z5 2PMHA 2CQIA 2UUAJ 4WBFA 1UW4A 4RUCA 1LW2A 3GIJA 4O0IA 3EDRB 5DRKA 2ZBIA 4O3QA 5AJ3F 2CQ0A 1UP1A 2WOMA 2F9JA 4USMA 1IBLF 4LF9F 1KS2A 4K4ZA 4WXOA 3LUYA 4WJBA 2PI4A 3MM6B 3W5ZA 4PEOA 1AYEA 1H6KX 1S5ZA 2AX1A 3KTQA 4C3MA 3TW0A 2W9BA 5B0CA 1JLAA 3O1LA 2BVZA 4JYAJ 1VQSA 3US5A 1U1PA 1SC4B 1PJ7A 3MMAA 5IT9U 1HBMB 2KM8C 1Z2ZA 3PFEA 5KFYA 5I4MA 4J5OA 3RG6A 1RWVB 5LMUJ 2W2OP 5E3AA 2AV5A 3MAAA 3GR1A 3G6VA 4S0MA 3T9NA 1N5YB 1GH8A 3UD3P 1F1BB 3RRHA 4YP3A 4LRAA 2ZZMA 2XMWA 4DR7J 3LP0A 2RRAA 4OV6A 1N48A 2HQGA 3SEOA 4WCEQ 3UD4P 2Q6CA 1A9NB 1AFJA 2DGOA 2BQ3A 3GQCA 1EETA 3HT3A 1RYSA 1SPBP 1AUDA 5GAGI 1RWUA 4ER8A 1VQ4S 4YOEA 1C0TB 4KTQA 3H40A 4IO1A 2XSJA 3PHTA 3H2LA 3AA8A 3DRPA 3OL8A 1TP7A 2V63A 2FZKB 1XEZA 3BGFA 2OEJA 5E7OB 1D1UA 3BDPA 3KLHB 2AKWB 3O6QA 4IFVA 2HFVA 4ZPBA 4D3GA 3CD5A 3TX8A 2F1FA 3IWLA 5KFKA 2R42A 1T03B 3HHLB 1NZ8A 1FTCA 2UVUA 3RZAA 2RU9A 2OLWA 1UVLA 2VG6B 4GVBB 2HNZA 4DFJA 3V6JA 3CCMS 4OZNA 1SKSA 3R2DJ 2UUAF 4FBTA 2IM2A 2RJZA 4CLFA 5KFPA 3GU0A 2DRBA 3N6LA 1LWFA 3TVKA 3R5DA 3C6TA 1KR4A 1TMMA 2HNYA 3PRDA 4Q7AA 3AODA 1HWJA 2D69A 2F40A 1ROFA 3VF0B 3CJSA 3AFGA 1X5TA 3IWXA 1C1CB 3FGVA 4LREA 2C2EA 1R8BA 1W7WA 1RYRA 4DEZA 1IBCB 3HK2A 3R5AA 3FZ2A 4QIEA 2NSBA 1RQ0A 3R2CJ 1TKZB 3JTPA 3QT8A 2R7XA 1X4DA 2HVDA 2V9KA 3SV4A 4JYAF 3MF5A 3EXCX 2OFHX 1LK5A 5KFDA 2AEJA 1RTJA 2ZE2B 3KUEA 2YX4A 3GFXA 5C42B 4FZVA 3JSRA 4IQXA 4U8VA 5C25B 4HL9A 5LMUF 4FPIA 1QTMA 2MZRA 5CYQB 2JFDA 5HMYA 1VRTB 3H42A 3JAMY 2PDAA 5A8RA 3X1LB 2M2BA 2AYEA 4FNIA 4C0OC 4DR7F 2MKJA 3Q83A 3I9ZA 1OSDA 2LXFA 2KVIA 2G13A 2PD1A 4USWA 3FSXA 4DPTA 2RE1A 3KK2B 2UV8A 4Y2MA 2ZZTA 3NXZA 1FDBA 1T94A 3DLGA 4RW9B 5BYQA 5BJRA 4DCJB 4TYAA 4FN5A 1UA0A 2CPEA 2DPJA 2KZZA 5SUHA 2L9DA 4M63A 1TK0A 2AD9A 3DFEA 3UD5A 1HYSA 1RT5B 2B4UA 3RW6A 2EPIA 4Y2IA 2YWGA 3WX8A 1FVSA 3QRRA 3RBZA 3DLBA 3CC7S 1S57A 4NRUA 2V67A 4EWTA 4X4OA 2HAFA 3DNCA 2MDAA 1S0OA 1OYEA 5KT6A 3RR7A 4PWDA 4DPWA 4MYTA 1ZH5A 2NLWA 3QJJA 4ECRA 1FRKA 5A8WA 3CCSS 1VBYA 4XTTA 4V1Ak 2V2KA 2GJIA 4Y2CA 4DFMA 3MPUB 2ASLA 2H54B 2QL9B 1IKXA 2DNNA 1RT1B 3CJKA 4J9OA 1FT8A 5SZTA 1HD1A 1DTQB 2H5JB 2DHXA 3HSDA 4C7QA 3GPAA 1YDLA 1WI8A 4ECXA 2VPYB 2NSCA 4DR2J 4LRBA 2HZVA 2OSQA 4DSJA 2B3TB 1V9OA 2HAIA 3L09A 1WEYA 4QU7A 4C9DA 3UCGA 2CNLB 2BKNA 1U48A 3FQLA 2CIMA 2ZJRQ 4FVCA 3N28A 5HATA 2OMOA 4ZHRB 3I5BA 3QIPA 3PW7A 1TL1A 2NUUG 1SBRA 3W65A 1S1UB 4G6VB 2RKIA 3M2UA 4K2JA 1IQTA 2XYPB 3DCAA 1N4LA 4KKOB 2P9CA 4ECSA 3QATA 5K20B 1N8RT 1BQMA 2M8DB 1DHMA 1KHVA 2H51B 3K59A 1FXRA 2Q79A 1WHXA 1FHTA 2DNZA 2OH2A 4PQUB 1YK9A 3HKWA 3K5MA 4B3OB 1RCOB 1H73A 1VYAA 3OFHA 2H5IB 3N79A 2ZEJA 1GAOA 4J9VA 2K3IA 3BM7A 4GO5X 4G1IA 4LFAJ 3G87A 1S4FA 2A3JA 4AE5A 4ILRA 2B5JB 4I6AA 1KRPA 1KVJA 2LFVA 4IG3A 2HWIA 3CJQA 2OPQA 1JJHA 1TU0B 1XIQA 5J2PA 4FNHA 4TU7A 2PIIA 4PG5A 2YKAA 2E29A 2LEBA 1S1XB 3TYTA 5KFNA 2WRMA 3SSQA 2HGNA 2YWHA 2F63A 4KO0A 2DNYA 1N36J 4O4GA 1X7VA 4X4RA 2VKRA 3HI9A 2E5JA 4RZRA 3UW1A 5C7PA 1I3OB 4XIUA 4FYDA 2FJAB 2YNHA 1JLFB 3TUPA 2DBBA 2IM3A 3CCUS 3PW0A 4DV7J 3D6FB 4M5JA 5CD4H 3P96A 4NWBA 4JV5J 4DR2F 1RAIB 1S1VA 2YKNA 2QFIA 4WXWA 3TAPA 3NEKA 1Z2LA 2V4QA 2D7SA 3BSCA 4ZIVA 1VJWA 3SFGA 3CSKA 2YKPA 5CA5A 3POTB 2AJFE 1C1BA 3OL6A 1HBUB 2BBEA 2DGWA 3RAMA 4K4TA 2KU7A 3R7NB 1K47A 3FMBA 2RS8A 4RWXA 3D67A 3VQTA 2KG0A 1RXOB 3PKMA 3CEDA 2GS8A 2QSFA 3BQ1A 2X1AA 3R5JB 2XO6A 2G0CA 3IR7B 4FXVA 1Y5LB 2E1RA 1PO6A 5THWA 3M2VB 2HIYA 4USJC 2IVYA 4USKA 2RH3A 1P6TA 2AYBA 4NPOA 1BQXA 3HZGA 1S7IA 2WB1D 4LFAF 2DHHA 3PRVA 3W3SA 3CCZA 1N0VC 3U1NA 1JLCB 1JJCB 2WONB 2YBVA 1K0VA 4UOHA 4MIBA 1FJCA 5A2QY 2Y1IA 3MI7X 4KRWA 5K14B 1S48A 4I6WA 4ED0A 3Q2TC 3IRXA 1CS4A 1LW0B 1F3VA 2RQMA 2UUBJ 2VG5A 5AXMA 4QPXA 2MKYA 1VDHA 2XC9A 3SSRA 1N36F 4DSEA 4UZCA 2B8QA 3KLFA 1CJTB 4KH0B 3CDBA 3V6HA 5GAHU 2SXLA 2FJWA 4ZVHA 4AT1B 2HQFA 1RTDA 3QJLA 5FIIA 4PWUA 5A6PA 4OJHA 1G1XA 2H4WB 4DV7F 3MEDB 4DG1A 1YRUA 2GJFA 3IM9A 1RA6A 1RAJA 1WEZA 5D4NA 4JV5F 3BGOP 1Q0NA 3OV7A 8ATCB 2DISA 3HVWA 2GW8A 3HULA 1JKHA 5T7LA 2K2PA 2P9EA 4FF2A 1T02A 1NJYA 1U1LA 3IA0A 1O51A 1FFSB 1VGYA 2IAJB 1CJKA 2CPDA 3GV7B 2QYCA 3ISNC 2QA4G 4UOCA 2EW9A 4CO4A 1CG2A 4I68A 3M2RB 1TVRB 1ZPVA 3LOUA 4I0WA 3OL7A 1YBTA 5GMDA 4CNZA 3NWGA 1G6BA 1CC8A 1DLOB 2E9RX 5CYJA 4RX6A 3PYEA 4EZ9A 4U67Q 1X9SA 4DL0C 3MPVA 2OD4A 3RYLA 2J8SA 4JI3J 2MZ1A 3M1VA 4XPEA 1IKYB 2BJ3A 4U95A 1HL6A 1RTIB 3ZZUA 2RHQB 2VPZB 5D4PA 1NK4A 2KFYA 1U1NA 5GADI 1YJ9S 3NGKA 3MCOA 1K0TA 1HMVA 2ZKTA 2HGMA 2B8PA 2W9CA 2PFFB 4HI2A 2MEWA 4KFBB 1V6HA 4NZ6A 3FBCA 2KHDA 4JBCA 2LLZA 1SKRA 1VOMA 4ZK7M 1JLBA 2MQNA 2AGPA 3BREA 4URGA 2D3OR 2O3DA 5JMNA 2W2PP 1ZOTA 2V8PA 2XMJA 1CULB 2ROGA 2UUBF 1CVJA 1N56A 1FKOB 4B9VA 3PYFA 3VGSA 1VQNS 2C2DA 2VODA 4DSKA 3AQPA 3VVTA 2QT7A 3GJSB 1H2VZ 4IOCQ 1S6OA 4ED4A 3I9V9 2M7SA 2G2YA 2V0NA 1ZPWX 5HLFB 5B0BA 3PKYA 3DGPB 4L74A 2ZH8A 3W9JA 1PGZA 2KN4A 3T5LA 1XTZA 2W7AA 3JTNA 3I0SA 2RRNA 3IXQA 5D4OA 4IOAQ 3P5BP 3IGVA 2X3GA 3MD3A 4XAKA 1NHKL 3CCLS 3QIPB 1TL1B 1BMQB 1PCAA 2V4RA 1VRUA 1RT4B 3ENVA 2RKIB 2XBPA 3CMES 1AZSB 3UDVA 3W62A 2E44A 4Q43A 2L08A 3KG0A 2PT0A 2LMIA 1SQFA 4MFBA 2JDJA 4UTGA 2XGPA 4MMOA 2BM1A 3KG4A 4MT1A 3OR2A 1RHUB 3F41A 5ETSA 2M88A 2FDNA 1RADB 2H48B 4O3SA 4K7QA 1FEHA 2LEAA 4G3IA 4WF9Q 1UCNA 2JEFA 3OW2R 2YKMB 2DHAA 4JI3F 2VH7A 1UPPA 3UR0A 1FE4A 4TVAB 2ZDOA 1VIXA 1CLFA 3Q8VA 5ETTA 3GCXP 2OO4A 2CJQA 5EHHA 4GC6A 3ENQA 4DUYJ 3FRYA 4A8KA 1M5OC 2YQ3A 3ZTQA 2I6WA 2MSTA 1YRXA 1C0UA 4GMKA 4C11A 2CJYB 4BC9A 5DG8A 2WVDA 1X4EA 2K1RB 2JEIA 1T7PA 1O6XA 1XBWA 1XNRJ 1WHYA 2M0GB 1RHMB 3P4UB 1JNRB 1BLUA 5DLGA 2CZ9A 4WZQA 3OHAA 3MTJA 1NKCA 5C2CA 2FC8A 2IA0A 5CCMA 4C48A 4AUKA 2BABA 4CLTA 2HBZB 5LXYA 2OEKA 1S6UA 1U2FA 2DRAA 2MGZA 3AY0A 3LP2B 1MLAA 4KV8A 7FDRA 1GT8A 1CJUA 4EBCA 2QG9B 3AA9A 1Q53A 2DIVA 3M7VA 2BRLA 3M30A 5D4LA 2HFUA 3GR0A 3NY0A 1HPZB 1LWEB 4C2MA 2FHMA 5GAEU 4X62F 5C2GA 3CJ0A 4QR1A 4ZVEA 3W64A 2CPHA 5DQIA 1SCJB 4K50A 4FF4A 1FDNA 1VQKS 3HF5A 3G96A 1QUVA 1UFKA 1MSWD 1Q5YA 4KPYA 2C2OB 2E9TA 1KNZA 1FFGB 2W1BA 1KOOA 2YXLA 3M8RA 2DR5A 2R8GA 3LAMA 3VGVA 5KG1A 1OO0B 2J9EA 1C4AA 1XN9A 4UOGA 1CC7A 3T19A 4ETXA 3H5UA 1U09A 3FNNA 5CZVA 1U6BA 2QTWA 2YQ0A 3NBPB 3UVJA 2OHDA 3KUHA 1EIYB 1J2VA 4EO6A 2RHSB 3T3FA 4OI1A 3FVYA 1GFWB 1TKDA 3HZEA 5A0YA 3MM9A 2FVSA 2XS2A 3JQMA 1RT7B 3LWMA 4WE1A 4NXMJ 1CBKA 5F3TA 2P5VA 3BQ0A 1IKWA 2FHOB 3UCUP 3C6UB 4DUYF 3SQGA 4ZKAA 4OHYA 1T9VA 1NJZA 1YZ7A 3UI3A 3HJVA 2VG7A 1UFWA 1XNRF 2B4VA 6FDRA 2IC3B 4NYZA 1RT6A 4U9RA 3CO0P 3J7ZT 3RBXA 1FJGJ 3OXFA 1F5CA 5EWGA 3KK1B 1X5PA 4E8UA 1UPMB 4HACB 5RUBA 4UZBA 2H4YB 2AYMA 1SIZA 1Q5VA 5U47A 3LALA 2DR8A 4F4YA 4Y2AA 2E9ZA 1QDUB 4NLDA 2QSWA 5C24A 3V5RA 4O0NA 1YKWA 1VCTA 2A6MA 5CYMA 2D9OA 2WAQD 2J9CA 3BKTA 1RT2A 1U49A 3KHLA 2YPYA 4F8RA 1Y4ZB 4WTOB 2KJWA 3TEGA 3L7OA 1Q8IA 2ALYB 4F4WA 1FO1A 5M2RA 3PXGa 1S0MA 3DXSX 3NS6A 3K58A 1RU2A 1WDDA 3J7YU 2RS2A 4DL3A 2ZH2A 1FEEA 3TVYA 2V50A 4A8FA 3H2VE 4BC7A 2HW3A 1HBOA 2EC0A 1HQUA 3KG1A 1GX5A 1RCXB 5ADZA 2PA3A 4X4TA 4TQRA 1EAYC 2EG1A 2HHSA 2K8GA 1NJIT 2MYFA 2BEFA 2KI2A 3DMJA 3GFYA 4ED3A 2QL5B 1RAEB 3WX4A 4YB7A 1WF2A 2J0QD 3MD1A 4ELTA 2EI5A 4QOTA 5JXSA 4DMZA 1APSA 3SYZA 4NXMF 2QX0A 2LA4A 1HLWA 1FRLA 1S99A 2IM0A 3DM2A 1MMLA 1B7YB 4EGLA 1NJXA 2IYIA 1AA1B 2CPXA 4CH0S 1SUQA 3MECB 3SZ2A 3DLJA 1H38A 4NMLA 3BZQA 5G0RB 3TZYA 3FZBA 3ZZTA 4IR1A 1GMVA 1OJ4A 1U24A 3QLHA 4PG4A
chains in the Genus database with same CATH topology
1RTZA 1G4CA 3MCNA 2BMBA 2CG8A 4M5IA 1EQ0A 4M5LA 5ETRA 5ETOA 3HCXA 3ILJA 3ILIA 3ILOA 3QBCA 1EQMA 2QX0A 1RU1A 4M5JA 4CRJA 3UDEA 4M5MA 3HSGA 3UD5A 4CYUA 1RB0A 4CWBA 1HKAA 1IM6A 4AD6A 3MCMA 3HSJA 4M5HA 5ETNA 3HT0A 5ETQA 2F63A 4CYUB 1RAOA 5ETLA 3HSDA 3MCOA 4F7VA 4PZVA 5ETMA 5ETSA 5ETKA 4M5KA 1KBRA 1EX8A 3UDVA 4M5NA 1CBKA 3HSZA 1TMMA 3ILLA 3IP0A 3KUHA 1RU2A 1F9HA 3HD2A 3KUGA 4M5GA 5ETTA 5ETPA 5ETVA 3KUEA 1DY3A 3HD1A 1TMJA 1Q0NA 2F65A 1HQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTZ A;  1G4C A;  3MCN A;  2BMB A;  2CG8 A;  4M5I A;  1EQ0 A;  4M5L A;  5ETR A;  5ETO A;  3HCX A;  3ILJ A;  3ILI A;  3ILO A;  3QBC A;  1EQM A;  2QX0 A;  1RU1 A;  4M5J A;  4CRJ A;  3UDE A;  4M5M A;  3HSG A;  3UD5 A;  4CYU A;  1RB0 A;  4CWB A;  1HKA A;  1IM6 A;  4AD6 A;  3MCM A;  3HSJ A;  4M5H A;  5ETN A;  3HT0 A;  5ETQ A;  2F63 A;  4CYU B;  1RAO A;  5ETL A;  3HSD A;  3MCO A;  4F7V A;  4PZV A;  5ETM A;  5ETS A;  5ETK A;  4M5K A;  1KBR A;  1EX8 A;  3UDV A;  4M5N A;  1CBK A;  3HSZ A;  1TMM A;  3ILL A;  3IP0 A;  3KUH A;  1RU2 A;  1F9H A;  3HD2 A;  3KUG A;  4M5G A;  5ETT A;  5ETP A;  5ETV A;  3KUE A;  1DY3 A;  3HD1 A;  1TMJ A;  1Q0N A;  2F65 A;  1HQ2 A; 
#chains in the Genus database with same CATH topology
 2DY9 A;  1FKP B;  1S12 A;  3DKD A;  5DJB A;  3W60 A;  3B78 A;  1FJG F;  3VGU A;  3CIZ A;  5AE1 A;  2E5G A;  3B4D A;  1FF2 A;  1DRZ A;  2P9G A;  1UVM A;  3MEG A;  5B09 A;  4LT6 A;  3H4D A;  2W01 A;  3Q22 A;  2HFO A;  4L76 A;  2R7W A;  1JJ2 R;  2BAN B;  2CKW A;  2KH9 A;  3IRW P;  5KFE A;  1VR6 A;  4G65 A;  3C14 B;  1HR0 J;  4TU9 A;  1WC6 A;  4FKX A;  1OS5 A;  1FK9 A;  2ZNY A;  5D0G A;  1SC3 B;  3HD2 A;  2ZKU A;  2HK2 A;  5DO2 A;  4W90 B;  3RRG A;  2VC1 A;  2YQ1 A;  4DV4 J;  4ZJO A;  4R25 A;  3D3B J;  3H5Y A;  3RU0 A;  2B9W A;  4CM2 A;  1VK8 A;  4J9N A;  3C15 A;  3W2W B;  2HZC A;  2LXI A;  2CJA A;  3PG9 A;  5E3Q A;  2GML A;  1O8B A;  2QLJ B;  3PW4 A;  4P72 A;  1U1R A;  4ED6 A;  2RDD A;  1TKT A;  4R8U A;  5DLF A;  2YH1 A;  2N3L A;  4EYH B;  2QV6 A;  3KOA A;  4ZIW A;  2XY7 A;  4LF6 J;  3I55 S;  3DDK A;  3C16 A;  1T9X A;  2OAU A;  1L3U A;  5KFB A;  1HWI A;  3I0R B;  1OY8 A;  4NLV A;  3G82 B;  4Q2L A;  2EKN A;  2GZO A;  2XLJ A;  2ZD1 A;  1X0F A;  4WFZ A;  4DV3 J;  2VBZ A;  1WKL A;  2DGX A;  2HVZ A;  5IT0 A;  4ELV A;  3TJA A;  4WKR A;  3E01 B;  4ANE A;  5HMX A;  4WZM A;  2LP4 A;  2DH8 A;  2DRD A;  4QJV A;  5C5J A;  4RU2 A;  3TZW A;  3Q0A A;  3L9Z A;  2DNM A;  2EKY A;  4LBH A;  1ZS6 A;  3QQC D;  1HA1 A;  4ZLN A;  4CO3 A;  4ENO A;  4NRT A;  2RUG A;  2U2F A;  3J81 U;  4DX7 A;  4B3T J;  2VDI A;  2XUL A;  5HP1 B;  4ILM A;  4KC5 A;  3OTO J;  4RW4 A;  2JLE A;  5F8L A;  3EVW A;  1PBA A;  3EX7 B;  4Z37 A;  2Z56 B;  3ISN D;  4CLY A;  2IYG A;  1UTA A;  4IUF A;  4UQT A;  4UW2 A;  1Z4U A;  3M8S A;  1S9F A;  4ZVR B;  4JI6 J;  3ZTP A;  4E2F B;  5BXI A;  2HVH A;  3WZ0 A;  1WAC A;  1BE4 A;  2I9S A;  3GZ7 A;  1YHQ S;  4ZN1 A;  2U1A A;  3DOL B;  1HR0 F;  2DNG A;  3AD7 C;  1SC6 A;  5L9N A;  1X31 C;  3LPY A;  1SQG A;  2KRR A;  5AT1 B;  3A8J A;  1LXJ A;  3J80 Y;  4F04 B;  2YH0 A;  2BQU A;  2EBG A;  5DG7 A;  3BB5 A;  3HHK A;  1H98 A;  3D4J A;  4DV4 F;  4G1Q B;  4JI5 J;  3NCQ A;  4GKJ F;  2YTC A;  3OFE A;  2Z30 B;  1NME B;  3Q8U A;  1K44 A;  2V69 A;  4UF4 A;  2NZC A;  4Z7C A;  1E6Y B;  4DFK A;  5KG6 A;  4X4Q A;  2Z4P A;  1FNO A;  1FRI A;  4OI6 A;  1A0O B;  4ELU A;  1U45 A;  4MJK A;  4DSF A;  2OIH A;  1Q8B A;  2BUN A;  3FBE A;  4ZCM A;  1RHK B;  3A4T A;  2MLX A;  3MM9 B;  3TAR A;  4RW7 A;  4IFY A;  4QIG A;  2Y8W A;  4OJ3 A;  4B17 A;  1FRM A;  2YWK A;  3N01 A;  4ICL B;  1YJV A;  1MWY A;  4LF6 F;  4URS A;  1Q1K A;  1SH0 A;  4OI2 A;  1SB6 A;  3EPI A;  1WUU A;  2JWN A;  4PPZ A;  2HZA A;  3MM5 B;  2AQ4 A;  3L3C A;  2B7B B;  1F60 B;  4ZPW R;  4F3O A;  4DSL A;  1N34 J;  1VQL S;  3R27 A;  3CUL A;  9ATC B;  5J1E A;  4FS2 A;  1NPR A;  4DV3 F;  4YDD B;  4NLS A;  4ZOS A;  3GWC A;  3QZ8 A;  5L39 A;  5ETM A;  2DGQ A;  2GVZ A;  4CLZ A;  2XO7 A;  2FHJ D;  4M5H A;  4TY9 A;  1YJR A;  2BQR A;  4CYU A;  2NYI A;  3MMB B;  3NGS A;  1F0X A;  4TY8 A;  2B4O A;  2UVV A;  3N6M A;  2F5G A;  1NHV A;  1U8S A;  3UR3 C;  1NDC A;  2LDY A;  1DY3 A;  4ZMM A;  1SJ4 P;  3M32 B;  2YNI B;  4LF4 J;  3OTO F;  1T9Y A;  5EGY A;  5CYM B;  4GRS A;  4TLR A;  2XWY A;  1F9H A;  2PEH A;  2GGP B;  4JI6 F;  3GIK A;  4PXD A;  2CPJ A;  5BYR A;  1KFD A;  1S97 A;  1EP4 A;  4CLW A;  3SCL E;  2V9W A;  2F7V A;  1WC0 A;  3MMJ A;  2FTR A;  3HSJ A;  2PFD A;  1D9D A;  2EK1 A;  1R0A B;  2ILY A;  3LAK A;  1AUS L;  2G0I A;  1IM4 A;  2CQ1 A;  3E8O A;  4RL1 A;  1BQN A;  3A1Y G;  1IR0 A;  2A6O A;  2OPS A;  4JI5 F;  4RUB A;  2Y0S D;  3HM9 A;  3PW2 A;  4FYV B;  1U8W A;  2DH7 A;  2KG1 A;  2CAJ A;  3W1Y C;  5HBM A;  3OTE A;  2HUR A;  4KGZ B;  1X4F A;  3CD7 A;  3K5O A;  5HI7 A;  4L75 A;  4Q8F A;  2VD3 A;  1UVI A;  1VQ6 S;  1R0C B;  4P2S A;  2ROP A;  1KBR A;  1WKJ A;  1KOH A;  3NGR A;  2UVW A;  2ZZN A;  3IG1 A;  3G71 S;  1FTR A;  1AB8 A;  4RW6 B;  1IBM J;  5DS7 A;  1NM2 A;  3LH2 S;  1ZM3 A;  1Y5N B;  3GYN A;  3TAM A;  3DU6 A;  1U47 A;  4LUB A;  1RIS A;  2WB4 A;  4ZPA A;  4FYY B;  1KVK A;  3QT6 A;  4XDD A;  3DRX A;  3NWR A;  1HNV A;  2HBR B;  1ARO P;  1DQA A;  1M1H A;  1N34 F;  1S0V A;  3VTI A;  1S72 S;  1KQG B;  2AJ0 A;  3VR1 A;  3QLH B;  1EQM A;  5AXN A;  4DR6 J;  1DJ0 A;  3JSM B;  2OSR A;  1TFW A;  1VMB A;  1DQ8 A;  4F3Q A;  1JLQ A;  3S6E A;  4I6Y A;  3GG1 A;  2UZA A;  4LIR A;  4QIF A;  4PUO B;  4TN2 A;  1MWZ A;  1EKS A;  3THT A;  2QA4 S;  2D1C A;  3OUY A;  3BQ2 A;  3KMS A;  4H54 A;  4LF4 F;  2F9D A;  3ZZZ A;  3DOM A;  4KIA A;  5L1I A;  2ZC3 A;  5E2Q A;  2HYI B;  5B0A A;  2G0J A;  3MMC B;  8RUC A;  2DXF A;  1UWB B;  2AMC B;  1MU2 A;  2CQ4 A;  5GAG U;  2DO4 A;  2XHW A;  1S9E A;  3KK3 B;  4MKA A;  2M5Y A;  2J7W A;  1TL7 B;  4ZVO B;  3ZZ0 A;  2W8K A;  4Q0B A;  4ZVS B;  3IWN C;  3HHL D;  2FJV A;  2JC0 A;  1RWW B;  4RPF A;  3RGI A;  2HHQ A;  3H59 A;  1QSS A;  3PJW A;  3PEJ A;  1TAU A;  1HWK A;  3VAK A;  4DQR A;  2AT1 B;  2Y9H A;  3DDI A;  5J2Q B;  1TEL A;  1TV6 B;  3D0H E;  3MEE A;  3DLK A;  2UUW A;  4B9N A;  1BWE A;  5I3U A;  1KTQ A;  4QU6 A;  3KJN B;  4CLK A;  4EBD A;  2CQ3 A;  2JC1 A;  1FFW B;  3CDE A;  3IO1 A;  1IBM F;  1NCL A;  1KD1 T;  4P75 A;  1ZZN A;  2IMW P;  2BOP A;  2ZD1 B;  5KT7 A;  2Z57 B;  3IBW A;  5HL7 Q;  1HHT P;  2CNN B;  1TUG B;  2AEF A;  3HVR A;  1WHV A;  2DR6 A;  1Y3J A;  5D0R A;  2B7C B;  3EUN A;  4ID5 B;  5MLC V;  3DRR A;  1KQS R;  4DN9 A;  4TU8 A;  2WK4 A;  4M5I A;  1OY9 A;  3KJV A;  3EMT A;  2MZT A;  1H2T Z;  1NSK L;  1WWH A;  4ZPT R;  2NXE A;  5HO4 A;  4LF7 J;  1WD6 A;  4DR6 F;  1VQP S;  1WG5 A;  4OHV A;  1TR0 A;  1RJJ A;  3CNQ P;  3LAN A;  2EXU A;  1U6Z A;  4EO8 A;  4P52 A;  3S1T A;  4ETZ A;  2BE2 B;  1IXK A;  1RWX B;  1UEK A;  2ABY A;  3CJ8 A;  2YKQ A;  1XMB A;  5J2N A;  2IIH A;  1JJ4 A;  4KE5 A;  3PR5 B;  2UU9 J;  2I8E A;  1UET A;  1NHU A;  2V94 A;  2MHN A;  4ZJL A;  1FNX H;  3IMQ J;  2Q43 A;  2XLI A;  2HLT A;  2X1B A;  4OX8 A;  3P45 B;  1QTN B;  3CJR A;  3D1H A;  4H4M B;  2CQP A;  3KLI A;  2ZH4 A;  4EI2 A;  4DQI A;  3KLG A;  1S6P A;  1S1W B;  5IC6 B;  5IM0 B;  4C8Z A;  1KC8 T;  3H4B A;  5B0D A;  5ITH A;  2CJB A;  1FKA F;  2M9K A;  1UVN A;  1QE1 A;  4NYP A;  5I42 A;  3EZO A;  1RT3 B;  2O01 C;  4WFA Q;  2HFN A;  3KLE B;  2MLZ A;  2NXC A;  2XGQ A;  3VV2 B;  2VF3 A;  2KDO A;  2E66 A;  3HKZ D;  2I0X A;  2DCU B;  2HRT A;  1L3V A;  5DZ7 A;  3EYZ A;  4NLX A;  5BYS A;  4P9S A;  2RSQ A;  4CP5 A;  2ATL A;  1JX4 A;  3KHG A;  1ZZF A;  3R6G B;  2C2N A;  3NG8 A;  5KFZ A;  3GYX B;  1RA7 A;  5LSO A;  1UJ6 A;  3ONQ A;  2FLO A;  4I2P A;  4ALZ A;  1PYO B;  1TUW A;  4O44 A;  2IMO A;  2B43 A;  2YWW A;  1SQE A;  5A8K B;  2V4J B;  4U96 A;  2MQM A;  1UA1 A;  1IKV A;  4WYL A;  4HEA 9;  2J0S D;  3BBC A;  2XMU A;  2IJF A;  3V81 B;  4L3N A;  2OPR B;  1OQ3 A;  3PCO B;  1TL3 B;  4L6V 3;  4LSL B;  2H9Z A;  3UQS A;  3CIM A;  1JB0 C;  2GQ2 A;  4XO0 A;  1YJT A;  2VB6 A;  4LF7 F;  4R5P B;  5L1K A;  3JAM U;  5HQL A;  4DR1 J;  4LRC A;  2HS0 A;  5LT5 A;  4N47 A;  3BPD A;  3THP A;  2LEC A;  4ECQ A;  3ILI A;  1NK7 A;  4YR0 A;  3TR5 A;  1IJE B;  3M6V A;  2UU9 F;  1OYD A;  2ZJQ Q;  3JYT B;  1O5J A;  1QAJ A;  3M8Z A;  2RDJ A;  1UL3 A;  1MN7 A;  2ZBC A;  1WJ9 A;  2EEY A;  4PPD A;  1Y11 A;  5KFL A;  1R43 A;  1KDN A;  3EGN A;  1SC1 B;  3W2V A;  1VC5 A;  3MCS A;  4C8K A;  3IC1 A;  4RWW A;  3W5X A;  4HTJ A;  4WPA A;  5HBM B;  2B6A B;  3KJQ B;  1B0V A;  1H7W A;  4TQS A;  1SV5 B;  1NSQ A;  2RD5 C;  2VA3 A;  2W7P A;  5CAB A;  1N5Q A;  3NNH A;  1TL5 A;  2AF6 A;  4QQB A;  1YJN S;  1RAF B;  5JVH Q;  1QSY A;  3BR9 A;  5L8R C;  2AYG A;  5KFU A;  3PYD A;  1DUR A;  3G9C A;  3O8W A;  5D0H A;  4OV1 A;  3D28 A;  5FDL B;  2ZH6 A;  2MQQ A;  1BXN A;  4WP9 A;  5DDP C;  1BWV A;  4OLO A;  2KT5 A;  3OLA A;  4DL7 A;  1NK0 A;  1YJ7 A;  2R7Q A;  4K5R A;  1HHQ A;  2HND B;  2B9X A;  2R9L A;  2ZJP Q;  2EWH A;  1SJR A;  2J6T A;  3GIM A;  1VQ9 S;  2RDI A;  1U1O A;  2AWZ A;  1U0H A;  1LOU A;  1XC9 A;  1DZ5 A;  3R1H A;  1S9G A;  3MHY A;  4QYR A;  1JNZ B;  1P9Q C;  3QO9 B;  4EMD A;  1WTB A;  1X9W A;  3DDN A;  4RW8 A;  3TEH B;  4MK9 A;  2DD8 S;  3MZI A;  3GIR A;  5GAH I;  2FQQ B;  3D3C J;  4WK1 A;  3DGV A;  2XM3 A;  2IDE A;  5FD1 A;  2JHE A;  2N7Y A;  4DQQ A;  1C2P A;  1KLM A;  2DYA A;  4ED8 A;  3W63 A;  4B3S J;  1HNI B;  2HMI A;  2LXU A;  3V4I B;  3V6D B;  3ZNU A;  1J5O B;  4C8N A;  5IV4 A;  1LEO A;  2RUS A;  2ACM A;  3ZC4 A;  3DOM B;  3BGR B;  1DTT B;  2P6T A;  2N3O A;  4DR1 F;  4O23 A;  1PBU A;  1GMW D;  4QZV B;  3ULH A;  5L38 A;  2Z0G A;  1FVQ A;  2ZVI A;  4J9M A;  4P7V A;  4CO1 A;  1VS3 A;  2N82 B;  5F8H A;  2FD2 A;  4F67 A;  2QN6 B;  2CPY A;  2VBW A;  2NXN A;  3DXB A;  4F2S A;  3NGT A;  1WG4 A;  1TKX A;  3OL9 A;  3SCK E;  4HKQ A;  4LSZ B;  4X2B A;  4IDK B;  4YQW A;  3HVT A;  3T5J A;  4DR4 J;  4WP8 A;  1ZAV A;  3L4B C;  3A3N B;  4LSN A;  4OYP A;  3M8P B;  1T05 B;  1VIO A;  5ETO A;  3K57 A;  1RLC L;  2CFX A;  3M8Q A;  1UEV A;  1IWG A;  3MUR P;  2CWX A;  4USV A;  4UOF A;  1S1T A;  4IRC A;  3LQV A;  3P49 B;  4I67 A;  2CDQ A;  4RKU C;  3W7B A;  3DLK B;  5KFH A;  1D9A A;  3QGG A;  1YJU A;  2XWX A;  5D6G A;  4HDG A;  2R8J A;  5CXT A;  2GAG C;  1PJ5 A;  3OQ2 A;  4AXJ A;  1HW9 A;  1SH3 A;  5KTQ A;  3BEG B;  4O3R A;  4CH7 A;  2B9Y A;  1S6Q A;  1NH8 A;  3HDS A;  1IQZ A;  2FVC A;  1W25 A;  4AL7 A;  4ZP8 A;  2N4D A;  2DNR A;  2NCK L;  1ZA1 B;  4W98 A;  2P6S A;  1F5B A;  2KM8 B;  1V3S A;  3HMJ G;  2XMV A;  3DRR B;  5KFF A;  2I1R A;  5B0F A;  5F8M A;  2JLG A;  2XMM A;  1HQE B;  4Q44 A;  1LK7 A;  5B0G A;  4ZA1 A;  3C46 A;  3BH7 B;  3T1H J;  4PYD A;  4NA3 A;  1TQL A;  3KWM A;  4ES3 A;  3AB4 B;  2FLL A;  4CO2 A;  4FYX B;  2ZBQ A;  1ZTT A;  3CW2 C;  1AFI A;  4RO0 A;  1FNM A;  4JB8 B;  5J2M A;  5B0E A;  4B3S F;  2M3D A;  1VBX A;  1A6L A;  4JI1 J;  3TUJ C;  3BV8 A;  2ZHB A;  1P9Y A;  3G8T A;  2G2O A;  3Q2S C;  2VZ9 A;  5GVQ A;  5DGB A;  2DIU A;  4AYB D;  2CNK B;  2OML A;  1X4C A;  4I2Q A;  3K2Y A;  1D8Y A;  2CQC A;  2FJB B;  2ALZ A;  4AXI A;  4LF8 J;  3CVK A;  3J7A N;  4ZPV R;  3IGN A;  5HJY A;  1WTF A;  4KBI A;  3C66 A;  1RTH B;  3JS9 A;  1JLE A;  2VDH A;  4QPT A;  2CJK A;  2LQ5 A;  3MEK A;  1MW7 A;  2KL8 A;  1MNE A;  2HRU A;  1HBN B;  1N5T A;  4QYZ K;  4DR4 F;  2XYH B;  1WSV A;  3CJ2 A;  2VPW B;  5D3G B;  5HRO A;  3R9L A;  1R6Y A;  4HVZ A;  4CTA B;  4ED1 A;  1H74 A;  5MAO A;  5B7W A;  2KTQ A;  5DM7 Q;  4EFA C;  1REV B;  1WHW A;  3GJQ B;  4ZCI A;  3W5Y A;  4JOU A;  2BV3 A;  4A8M P;  2V2Z A;  2BJ8 A;  3DLE B;  2FY8 A;  1N6Q B;  3DYA B;  1U6F A;  3QSY B;  5EX3 A;  2W7O A;  1LWC A;  5A2Q U;  2IM1 A;  2QO3 A;  2GAH C;  5ETK A;  2PMW A;  1H2U X;  3ZZO A;  3QYY A;  3LP1 B;  2E1A A;  1E6V A;  4OZ2 A;  3D6M B;  2HS3 A;  3CCJ S;  2AEM A;  3IS9 B;  1VFJ A;  3H5S A;  4HH1 A;  5D78 A;  1NAQ A;  1P8G A;  2QE5 A;  1OQ6 A;  2MQL A;  2Y1R I;  2OP5 A;  1PIL A;  2EFN A;  2LEP A;  2RF2 B;  3T1H F;  2CPF A;  2I5J A;  3H5X A;  3NS7 B;  3GMG A;  1JLG B;  4H4O B;  3E2E A;  4M5G A;  4XPC A;  1IJF B;  5K5M A;  4B9S A;  1N5S A;  5GAE I;  2JOQ A;  2EVZ A;  3RW7 A;  3NCP A;  4DQP A;  5HMW A;  4UST A;  3C3L A;  1RE1 B;  4LRD A;  4DX5 A;  2C42 A;  3KUG A;  4DQS A;  4JI1 F;  1Q7Y T;  5LSL A;  3BN4 A;  2F8E X;  3JSB A;  4MK7 A;  2V6A A;  3MM7 A;  4NMX A;  1S59 A;  4C3L A;  2R8H A;  1RI7 A;  1VLY A;  2DHG A;  4LF8 F;  5KFC A;  2QLW A;  2YNG B;  5L46 A;  3M6U A;  5KG4 A;  3N0V A;  4OI4 A;  2MXY A;  1WC1 A;  4Y00 A;  2L9N A;  1CJV B;  1HKA A;  2E7W A;  3PAC A;  4KJI A;  2R8I A;  3ZTS A;  3TQE A;  1FA0 A;  3TX0 A;  2QLX A;  2LDI A;  3VZH A;  1HNX J;  4RNM A;  2J7K A;  3QT7 A;  2YY3 A;  1ZET A;  2V5H G;  1K1Q A;  3NNA A;  4DSI A;  1D3W A;  3PJ9 A;  2KT2 A;  1I6J A;  5GMK a;  2WSF C;  1RU1 A;  4DR3 J;  2KXH A;  2DK2 A;  5LOQ A;  1X4G A;  4WTY A;  2AU0 A;  4ECT A;  1IVZ A;  4WK3 A;  2GA7 A;  1X5O A;  3DOK B;  2OPP B;  4JI4 J;  1RGV A;  4DPX A;  1T9W A;  3FFI A;  4DXL A;  4LFC J;  3OJS A;  2VJV A;  3FEY B;  4OZL A;  4I7F A;  4TLQ A;  1RKI A;  2R7S A;  2E5L J;  3J81 j;  2PMZ D;  2OJ3 A;  4NXN J;  4M5M A;  3R3T A;  4F3M A;  2WSC C;  3RB3 A;  1VJQ A;  1WF1 A;  2FHJ A;  7AT1 B;  2F3J A;  4D3H A;  3CMQ A;  1W2I A;  4F26 A;  3RR8 A;  2ASD A;  4ZVP B;  4PXB A;  1LV5 A;  3BBF A;  1FDA A;  4A8S A;  2GHP A;  3SCI E;  4ZPC A;  2YVS A;  2C3Y A;  1Q78 A;  2KFZ A;  1Q8K A;  3H0P A;  4IG0 A;  2HFS A;  3UWT A;  1R7I A;  3E3X A;  4DX8 H;  4JV1 A;  3JXO A;  4HH0 A;  3ITH B;  1MMN A;  3J7Y I;  3FCV A;  4DL5 A;  4DBQ A;  4UT4 A;  2X1F A;  1WC4 A;  4BLG A;  2MZS A;  2ADB A;  1U1K A;  4ZP6 A;  3OR1 A;  5KT2 A;  4E98 A;  4OHW A;  3KJF B;  3RTV A;  4RBV A;  2YNF A;  4DUT A;  3CCR S;  2G2Z A;  2PC6 A;  3C19 A;  4FXW A;  1RAB B;  3NAH A;  2J8A A;  3AOA A;  2CJ9 A;  1YJW S;  1HNX F;  3SV3 A;  2GV1 A;  1FXD A;  3WDO A;  3DLL Q;  3ZTO A;  1VHI A;  5KFW A;  3GP9 A;  4DV6 J;  1LW2 B;  4NA2 A;  1FE0 A;  1G2E A;  3N9U C;  3ZZY A;  2MMY A;  4IH5 A;  4I56 A;  1UW9 A;  1U7L A;  4DR3 F;  1LQ9 A;  2HIQ A;  2WOM B;  3MM6 A;  1BD6 A;  1NB2 A;  5K8O A;  4B9L A;  4F0H A;  1RZM A;  1FD2 A;  1OMS A;  4MYU A;  4LR8 A;  2COL A;  4JI4 F;  1L3T A;  4LFC F;  2E7X A;  2BW2 A;  2RT3 A;  1VC0 A;  2W9B B;  1S49 A;  1JLA B;  1URN A;  1HBM A;  4LBI A;  2GC8 A;  2Y1L B;  4NLY A;  4N7T A;  2GQC A;  2E5L F;  3D6H B;  3MMA B;  3Q86 A;  3VGT A;  3BJY A;  4DL2 A;  5JJB A;  3IAS 9;  3RAQ A;  4B9M A;  4NXN F;  1N5Y A;  4W4M A;  1U25 A;  3MAA B;  3M8W A;  3ILO A;  3H7H B;  3BGL A;  3O5T B;  4DOZ A;  2G9O A;  1ZYQ A;  4ANC A;  4ES2 A;  3QID A;  3LP0 B;  2WHO A;  4ED7 A;  2ZFH A;  2J9D A;  4YUD A;  3TRG A;  1C0T A;  3BSA A;  1EET B;  2HHP A;  1M90 T;  5K8P A;  3D6T B;  4IRK A;  1XJW B;  4J9L A;  5KFM A;  3TOQ A;  2XY5 A;  2C22 A;  2XSJ B;  4B08 A;  5KT5 A;  1HD0 A;  3HO1 A;  3T1Y J;  3DRP B;  2A1B A;  2EFP A;  2XNR A;  3KLH A;  1X60 A;  1U1M A;  3I6P A;  4ZLL A;  2HHV A;  3PO5 A;  2DNH A;  5AXK A;  1NRK A;  1B4S A;  4QCL A;  3BYP A;  2B51 A;  2ZOG A;  2C2R A;  2XLK A;  2R7O A;  1OIA A;  4IFV B;  2IJN A;  4QIV A;  3QZ7 A;  4NAS A;  1T03 A;  3HHL A;  2ZUG A;  2VG6 A;  3MPD A;  4GVB A;  3I31 A;  4I1T A;  1R3N A;  3GE9 A;  2J6U A;  2FC9 A;  3FBF A;  4IO9 Q;  2FIU A;  3BGU A;  4WU2 A;  3UO0 A;  2HNZ B;  2VFT A;  3QAU A;  2HVI A;  4HDH A;  3CDA A;  3R7B B;  3N5F A;  3FCH A;  5CD4 A;  1RBA A;  2CQ2 A;  2MZQ A;  1FER A;  5ETQ A;  2XCP A;  4DV6 F;  1LWF B;  2VFU A;  3C6T B;  3I32 A;  1Y5I B;  1C1C A;  2HNY B;  2VIH A;  4NE9 C;  3SFU A;  4N41 A;  2QC3 A;  4LJM A;  4J9P A;  3OTC A;  2HQ3 A;  1B0T A;  4K8R A;  1TKZ A;  2WVE A;  2CVE A;  3CWJ A;  3UN5 A;  2BJ1 A;  3AXM A;  3D66 A;  2XQC A;  3SMZ A;  2ZE2 A;  3NL0 A;  5C42 A;  1RWK B;  5C25 A;  4GVL A;  1RTJ B;  5CYQ A;  4K2X A;  5EDW A;  3EE3 A;  4UY8 5;  1VRT A;  2LQJ A;  5F8N A;  1VQY A;  1HWL A;  5ETV A;  3C2P A;  5A8R B;  3PZP A;  2QMW A;  2K06 A;  4Q2M A;  5F8G A;  4FP9 A;  3OVA A;  2DIT A;  2QZ8 A;  4CIO A;  2GIF A;  1WF0 A;  5HK4 A;  6AT1 B;  3KK2 A;  3X3U A;  3T6B A;  4DS5 A;  4K5S A;  3GFZ A;  4ERD A;  2BJ7 A;  2KHC A;  4RW9 A;  3BS9 A;  2DO0 A;  2AX0 A;  4KHP J;  3OFG A;  2GHV C;  3DLG B;  3R1L A;  4ATN A;  1ZA2 B;  1LNQ A;  4Q8E A;  4BBY A;  3T1Y F;  2IRY A;  1GXU A;  3I5A A;  2Y8Y A;  1NH7 A;  2JVO A;  5AE3 A;  1RT5 A;  4FXD A;  3HSG A;  1T3O A;  2NRE A;  5KFS A;  3A8I A;  4NI2 A;  5IWA J;  1UKU A;  3K5P A;  1HYS B;  8AT1 B;  4A48 A;  2OKQ A;  4OYI A;  4I64 A;  3WC0 A;  2M4M A;  1MG7 A;  4OZ1 A;  1MMD A;  4USU A;  4KY3 A;  1G4C A;  2DGT A;  4C6A A;  3DI6 A;  4P71 A;  3HPO A;  3OBI A;  4NEY A;  2MHE A;  1RHQ B;  5IFM A;  4NCB A;  1LWX A;  2PGC A;  4PWD B;  3C8Y A;  4I69 A;  3I4H X;  4FYW B;  5A8W B;  4OZ0 A;  4YR3 A;  4AD6 A;  2KFN A;  4J9Q A;  1YSJ A;  2CXE A;  3MFI A;  3BKU A;  3TO8 A;  1RT1 A;  1NXI A;  2EC2 A;  2JZ5 A;  4DZD A;  3VHQ A;  1IKX B;  1DTQ A;  4P10 A;  3CJK B;  1KFS A;  1BGX T;  4PAA A;  2V8G A;  4OHX A;  1NU4 A;  3LGM A;  2VQE J;  4X4U A;  2IPO B;  2DPI A;  2IVM A;  2BYC A;  1SXL A;  1CQN A;  2HLU A;  2DGV A;  2QA1 A;  4JI7 J;  4ILL A;  4X62 J;  2RQ4 A;  2W4P A;  1DAX A;  1F9E B;  3PYG A;  4U7C A;  4X4N A;  2LA6 A;  1F3F A;  4ZHR A;  2AZ1 A;  4F0K A;  2AGQ A;  1S1U A;  3PX0 A;  3PRB A;  2C28 A;  4AL5 A;  2MKS A;  3ELH A;  2JFK A;  1EQ0 A;  3W66 A;  5KG0 A;  2BX6 A;  1R0B G;  3M2U B;  1NSA A;  2BXJ A;  3G8S A;  2RML A;  4U8Y A;  1K9M T;  2L41 A;  4KHP F;  2HG4 A;  1NUE A;  1T9U A;  3M05 A;  2GVD A;  3QPI A;  1BQM B;  1FRH A;  1YG0 A;  1YWX A;  4KGX B;  3ZNJ 1;  2HWH A;  1NEE A;  1HI8 A;  1T3N A;  2D3O 1;  1ELO A;  2CPI A;  4B3O A;  2W2N P;  4YS2 A;  1M0S A;  2ZOM A;  1WDT A;  3UNG C;  3THV A;  3T9Z A;  1H3D A;  5D77 A;  1WI6 A;  5KG7 A;  3W9I A;  5IWA F;  2HHW A;  2PEB A;  1R8C A;  2B5J A;  4NLP A;  2F8M A;  2MQ8 A;  2DH9 A;  2VOP A;  3GV8 B;  3CJT A;  1YIJ S;  1QVG R;  2XCA A;  4IG3 B;  5F0W A;  1JXL A;  2D9P A;  2OPQ B;  2AW0 A;  1S1X A;  5J2P B;  4RNH A;  4U6P A;  1PAE X;  1Q7L B;  3U7J A;  3NGU A;  2FZC B;  4HTI A;  2FZG B;  2HEK A;  1IUJ A;  3BF4 A;  1XMO J;  4WFN Q;  2CQH A;  1R27 B;  1Q16 B;  3H20 A;  2RQC A;  2LKZ A;  4DV5 F;  1GNK A;  3FEX B;  2ZM6 J;  4KO0 B;  4CLS A;  4Y34 A;  4O4G B;  4YY3 J;  3G4S S;  1JLF A;  4FVM A;  2IRX A;  2VBX A;  2LCW A;  4DU7 A;  2YNH B;  3PEH A;  2VQE F;  1U1Q A;  3CCT A;  2B56 A;  2FJD B;  3D0G E;  3H25 A;  5ETL A;  3IP0 A;  3M9O B;  2C1E B;  2QMU B;  3FEZ A;  3UE2 A;  3P3D A;  2QJ3 A;  2FUG 9;  1HQ2 A;  4JI7 F;  5ETR A;  1S1V B;  2V8V A;  2YKN B;  3J80 U;  3OTB A;  2J5A A;  4KB7 A;  1GX6 A;  4MKV A;  5LSR A;  1NDK A;  1KHW A;  1K8A T;  1YQH A;  4P7T A;  4M5N A;  3POT A;  1KTV A;  1HBU A;  1GMW A;  3R5B A;  4RUA A;  4LFB J;  1C1B B;  4DJB A;  2KXF A;  3CF5 Q;  2OUG A;  1ZM2 A;  2FJX A;  4J37 A;  5CCL A;  2BAC A;  3P5T L;  2RAQ A;  3W9H A;  1HAR A;  2HSE B;  3EJM A;  1AT1 B;  4K4S A;  3VAI A;  2IBO A;  1QSL A;  1VQ8 S;  3O3L A;  5DZ6 A;  3M2V A;  2V8D A;  2EFO A;  4KGK A;  2XMT A;  5LL6 d;  4NLW A;  5F41 A;  2ZNZ A;  4ED5 A;  2IY5 B;  3BKF A;  1XR7 A;  2GHW A;  2VA2 A;  2FLN A;  1QUP A;  2HRY A;  2L9W A;  5KFX A;  4M94 A;  1JLC A;  1EX8 A;  3TI0 A;  3HHL C;  3IR5 B;  2WON A;  4IR9 A;  3K7R A;  4LVN P;  3PIP Q;  2RVJ A;  3EGZ A;  4IQM A;  3PTW A;  1MRO A;  1PAU B;  4HT7 A;  4TKT A;  4DF8 A;  2DGU A;  1KLN A;  5K14 A;  1D0E A;  2YWF A;  2XB2 D;  3QFH A;  3TAN A;  1LW0 A;  3QNW B;  2W2M P;  1F6T A;  1XMO F;  1K1S A;  4OYX A;  3IRX B;  3NRB A;  1CS4 B;  4WKY A;  4Y2K A;  2VG5 B;  2J9D E;  3NOG A;  1HNW J;  5D0E A;  1GTE A;  2ZM6 F;  2UXB J;  1CJT A;  3PFO A;  3I96 A;  3PNI A;  4QIW D;  2R7R A;  2LQB A;  3KLF B;  4YY3 F;  3R7S B;  4N56 A;  3MED A;  3T1A A;  2ZC4 A;  1TL4 A;  1YI2 S;  1RTD B;  1CQM A;  3VAJ A;  4DG1 B;  3HVA A;  3MCN A;  3VCD A;  3K5L A;  1NJW A;  1SKW A;  4ED2 A;  1JKH B;  5T7L B;  2IVF B;  2J0W A;  2QFJ A;  4LRF A;  4R0E A;  5FJ4 A;  1YGY A;  1ZTW A;  4KR0 B;  2IAJ A;  2UV8 G;  4DV0 J;  2BE9 B;  3FJ2 A;  1KKH A;  2BM0 A;  1CJK B;  1R8P A;  3F44 A;  4NA1 A;  3M2R A;  1TVR A;  5E0O A;  4LFB F;  5A6W A;  4F0M A;  4C8Y A;  3GG0 A;  2C3O A;  4EEY A;  3UDC A;  2AJQ A;  4JV2 A;  1DLO A;  3NLC A;  1YBU A;  2VC0 A;  2CUY A;  2AP6 A;  2FVR A;  2XNQ A;  2HGL A;  1Q79 A;  1IKY A;  4NI2 B;  3GJR B;  3PO4 A;  1RTI A;  1JMT A;  2CA9 A;  3M1V B;  4NCA A;  3CMA S;  2R8K A;  5FLX Y;  4OJ1 A;  4X66 J;  1HNZ J;  1T95 A;  3AD9 C;  3W8G A;  5HVF A;  3OSN A;  3DI6 B;  4DL4 A;  3WBZ A;  4DF4 A;  2ZBR A;  2KYZ A;  3HJF A;  1RWP B;  2QYG A;  1TZ0 A;  1HMV B;  1IR2 A;  2NYH A;  3ENW A;  4KFB A;  4PYA A;  4OX6 A;  2W9C B;  2MLY A;  3BDE A;  4N76 A;  4C0B A;  2ZHO A;  1NK5 A;  2XEX A;  4QBU A;  1IBK J;  2QRR A;  2HWT A;  3LW5 C;  3BN7 A;  4YR2 A;  4OL8 A;  4ZVT B;  1L3K A;  1Y3K A;  4P2X A;  1JLB B;  1RBL A;  2VON A;  1XWL A;  1SVD A;  4QW9 A;  1CUL A;  3PY8 A;  1FKO A;  2DXE A;  5EN1 A;  1S7H A;  3IM8 A;  1RP5 A;  1HNW F;  2WZ1 A;  2UXB F;  2AJ4 A;  5LXR A;  2CQG A;  1R6V A;  4DR5 J;  1XER A;  4F4A A;  3GV5 B;  3LO3 A;  2NZ4 A;  5HLF A;  2GO8 A;  4UUW A;  5E41 A;  4ZN3 A;  1F9F A;  4ID8 A;  3DGP A;  1QLN A;  1RAC B;  2CPZ A;  1VK3 A;  3SIP B;  4ZLP A;  3DC2 A;  3T5K A;  3H90 A;  2PE8 A;  1U0S A;  2WVC A;  1PIE A;  5T41 A;  4ZDN A;  3I0S B;  4A8Q A;  1RT4 A;  2VL1 A;  4NLR A;  2XZW A;  2CG8 A;  1X5S A;  4C3K A;  2A18 A;  2JRS A;  1VRU B;  4GKJ J;  3TQ1 A;  1VQM S;  1AZS A;  1T0T V;  2FY1 A;  4OYB A;  4ZPD A;  4DV0 F;  2P2C B;  1UZH A;  2HHT A;  2GVD B;  3MTK A;  1SJQ A;  4MFB B;  2CDR B;  3CXC R;  2HHU A;  1WOR A;  3QWP A;  3M9M B;  3OR2 B;  2B0G A;  3TUI C;  3MPY A;  4KSE B;  3H98 A;  2BW7 A;  2YKM A;  4Z7Y A;  1FWP A;  2GO9 A;  3ZZP A;  4MKY A;  3J7A 1;  3P8B B;  1M5H A;  1KSP A;  3F56 A;  2H5E A;  4X66 F;  1HNZ F;  3K0J A;  2A10 A;  2LVW A;  3BSN A;  2K1R A;  3DHW C;  4B3R J;  4ZJQ A;  2EFV A;  1C0U B;  1T11 A;  4C11 B;  1VQ5 S;  4F7V A;  2NPI A;  1UVJ A;  3MAH A;  1G7C B;  2QLF B;  4C4W A;  1PC5 A;  2MZJ A;  3LGH A;  1IBK F;  4OHZ A;  3AT1 B;  5IQ6 A;  3CD6 S;  2DEI A;  3D1Q A;  1V3Z A;  1UEU A;  4A8Y A;  1JK9 B;  2VIC A;  4PWW A;  3WIU A;  3LP2 A;  3KLV A;  4FF3 A;  2F8H A;  2MGZ B;  4V19 J;  2I2Y A;  2ZH1 A;  2HVE A;  1GEH A;  1NB7 A;  4KV8 B;  3VZI A;  1CJU B;  2ZWO A;  5IT9 Y;  3M30 B;  2QLB B;  1HPZ A;  4WFB Q;  2KO1 A;  4DR5 F;  3MFH A;  2Q6B A;  3PIO Q;  1LWE A;  1M1G A;  1RAH B;  3SXL A;  4HI1 A;  1QAX A;  2PA8 D;  4NX9 A;  2C3P A;  5CHC B;  4HYK A;  4LF5 J;  3MR7 A;  4RBT A;  3D54 A;  4PAB A;  4OX7 A;  1DFD A;  5CAA A;  2GIR A;  1NZA A;  3Q8R B;  3NMA A;  3RBD A;  2YWE A;  4RU9 A;  3KHH A;  4KAI A;  4J9K A;  4QR2 A;  1NPK A;  1F2H A;  4DPO A;  4DPU A;  1TK5 A;  3AHP A;  2E7V A;  3OVS A;  1SL1 A;  3MR5 A;  1FRJ A;  4QWE A;  1NDL A;  3K8W A;  3NKY A;  4ZVG A;  3L95 X;  3NBP A;  1KEK A;  1GK8 A;  4DUZ J;  3UVJ B;  9RUB A;  4WFX A;  4J9R A;  3ADA C;  1RT7 A;  1FDD A;  4LR9 A;  3ETO A;  2K7J A;  2N7C A;  1C4C A;  5A0Y B;  4ES1 A;  4WE1 B;  3WQP A;  5HJX A;  3ZTR A;  5D15 A;  4DZ6 A;  2V8H A;  3B54 A;  2HHX A;  2Y3Y A;  2DNL A;  2EG2 A;  4M5D A;  1VQO S;  4IYQ A;  3AD8 C;  3C6U A;  3UN3 A;  1MRO B;  1IKW B;  4DLE A;  5I3Q A;  3EDQ B;  4ECZ A;  1B64 A;  2ZOF A;  4OMF G;  3SQG B;  1Q4R A;  4B3R F;  4P73 A;  3BPS P;  2IC3 A;  2AGO A;  1BUX A;  2VG7 B;  4CWB A;  4B9U A;  2DVI A;  4JI8 J;  1VRQ C;  2Z8Q A;  3KK1 A;  1RT6 B;  3DRY A;  4DV2 J;  3I82 A;  4HAC A;  2BE7 D;  2LQ8 A;  2UXC J;  4P6Q A;  4L73 A;  4K4Y A;  3KHR A;  2PI5 A;  3HLU A;  1UWA A;  5KT3 A;  2FYX A;  3EVO A;  3AJ2 A;  2NXU A;  4KPC A;  5J1P A;  1X8D A;  4K0K J;  5C24 B;  4OX9 J;  4OI0 A;  4C8O A;  2IRU A;  2BR0 A;  1VQ7 S;  2DKO B;  4MIW A;  5D8H B;  2OEM A;  1RT2 B;  2FVQ A;  2YPZ A;  1N52 B;  4LF5 F;  3NNC A;  5HN0 A;  4BWM A;  2XY6 A;  3G86 A;  2EFG A;  5DM6 Q;  1SJF A;  2MKI A;  4F4Z A;  5F9N A;  2Q3P A;  1A7G E;  1JIH A;  1SJ1 A;  1JXE A;  1HBO B;  2W2Q P;  1NK9 A;  1HQU B;  3VVU A;  2EBE A;  2VFR A;  5F3Z A;  3RJM B;  5F8J A;  2QL7 B;  4DUZ F;  1RAG B;  1KN6 A;  3DMJ B;  3UCZ P;  1D8Z A;  1I1G A;  4CH1 A;  2RIJ A;  4C8M A;  4WP3 A;  2ILZ A;  5DET A;  2ZH5 A;  3VAG A;  2R2S A;  2V2Q A;  4OYZ A;  5HQM A;  4GO7 X;  1RHR B;  5JVG Q;  3DM2 B;  4Y0F A;  3HSZ A;  3EIC A;  4ZCL A;  4EBE A;  3MEC A;  3D68 A;  1ZBT A;  5HVG A;  2Q66 A;  3PM9 A;  5G0R A;  1RTZ A;  4BDP A;  3BH6 B;  2MQP A;  3HP6 A;  2FHK A;  1N5V A;  1SUQ B;  4CRJ A;  2XMA A;  1DQ9 A;  1NBE B;  4M95 A;  3OSP A;  4V19 X;  1FKP A;  5IXU A;  4G1P A;  2HHH J;  4JI8 F;  1ACM B;  1U2R A;  1SL2 A;  2ACY A;  2GQQ A;  2P8I A;  5A76 A;  4F50 A;  4DV2 F;  5HAN A;  2H3E B;  4KT0 C;  1P1T A;  1UFL A;  2UXC F;  4Y28 C;  2J7U A;  2VFV A;  4IRD A;  3LPE A;  3MEG B;  1NND A;  1YRT A;  1GMU A;  2BAN A;  5GME A;  1AXQ A;  4ZP9 A;  3C14 A;  3G6Y A;  5H9F J;  1LXN A;  3EVM A;  3TA1 A;  2BZ2 A;  3GII A;  4K0K F;  2RU3 A;  3BO4 A;  4ECW A;  1HHS A;  2PN6 A;  4OX9 F;  1N88 A;  4NLQ A;  1TAQ A;  1BHN A;  1FK9 B;  1ZAW A;  2J76 E;  4OYW A;  5KFG A;  3TUZ C;  3VAF A;  3EM1 A;  3FSY A;  1DAR A;  3QSI A;  4CT9 A;  5LJ3 Y;  3W2W A;  2XS7 A;  2MY8 A;  2XS5 A;  3M6W A;  5HAO A;  4N77 A;  3C15 B;  1QAI A;  1VI7 A;  4MKB A;  1V5I B;  3FK4 A;  1W2B R;  2DNO A;  4TYB A;  1BC6 A;  4UY8 T;  4BS2 A;  3U1M A;  3M6X A;  2XSF A;  4C0H A;  2I38 A;  2DHS A;  1UZD A;  4FF1 A;  1UJ5 A;  2D41 A;  2GMJ A;  1TKT B;  4R8U B;  4RR5 A;  2ZH3 A;  3RB4 A;  2FJE B;  1FI4 A;  3MOJ B;  1OSC A;  2ADC A;  2JLF A;  2MB0 B;  2VJU A;  3I0R A;  3C16 B;  2QGF B;  3EWG A;  2WBR A;  3G82 A;  1JWW A;  1PSD A;  2AJ1 A;  2KVQ E;  1WC3 A;  3CT9 A;  5IQQ A;  3ZFV A;  4QWA A;  4AFF A;  3D0I E;  4HT5 A;  1UVK A;  3HFK A;  1KQF B;  1SJ3 P;  1Z1Z A;  3ZZR A;  2GFF A;  1B70 B;  3E01 A;  3MXH P;  1N33 J;  2KJV A;  1RAO A;  3R5G A;  3Q89 A;  1QAY A;  3D5M A;  3PX6 A;  2W4D A;  1U4B A;  1UMJ A;  3BBB A;  3SBM A;  3MAQ A;  3CTR A;  5HP1 A;  2LU2 A;  4QWB A;  1Q82 T;  1ULR A;  1LKZ A;  1FRX A;  2HHH F;  4K4X A;  2MPU A;  2J0X A;  4YEA A;  2VFS A;  1IR1 A;  5T14 A;  4RW4 B;  2JSX A;  5M2P A;  1PC4 A;  2MKH A;  2RIL A;  3FDS A;  3AJD A;  2C3M A;  2Z2Y B;  3ICL A;  1KP6 A;  3NAI A;  1MWQ A;  3MUM P;  3DOL A;  3WHI A;  4NCG A;  2HPU A;  4AND A;  2F4V J;  1N0U A;  2ZBP A;  3AAW B;  1Y0H A;  4ZS6 A;  4PR6 A;  4HHJ A;  3TWZ A;  4PG8 A;  4G1Q A;  3I56 S;  3TJ9 A;  1S4E A;  3TZX A;  2W4C A;  4IH6 A;  1E6Y A;  4IH7 A;  2A2D A;  1FES A;  2C2Z B;  2HQI A;  2WW4 A;  2R2T A;  1FJ7 A;  3AQO A;  1T9T A;  1X9M A;  1NLK L;  2M70 A;  2PO4 A;  4OZJ A;  3FMW A;  2EFQ A;  2E1M C;  1IN0 A;  3JSY A;  2NUH A;  3CUN A;  3HHD A;  2FGO A;  4X64 J;  3HT0 A;  5KFI A;  2RNE A;  3OT9 A;  4RW7 B;  4ICL A;  4IFY B;  2VU5 A;  1B0P A;  3WIV A;  3QAE A;  3GON A;  3EZU A;  4ECY A;  3AB2 B;  3OXG A;  2BKO A;  3DU5 A;  6FD1 A;  3MM5 A;  1EZZ B;  4M5D B;  4QWC A;  4OQJ A;  4M5K A;  1KVI A;  3I4P A;  4HR2 A;  4U7U K;  1Y7P A;  3G6E S;  2BMB A;  2IBK A;  1GXL A;  2IA6 A;  4Z2X A;  5J1E B;  3ETM A;  1XR5 A;  2VHG A;  2CQD A;  2OFG X;  4OI3 A;  1RKJ A;  1L3S A;  1N33 F;  4O3O A;  4QW8 A;  2GVZ B;  2OGU A;  4U7U D;  1B7F A;  2W9A A;  1OPZ A;  3MMB A;  1H72 C;  3IN5 A;  4WWS A;  2KB2 A;  1NK8 A;  2WVF A;  4CYU B;  4TY8 B;  5KFA A;  5E3P A;  5KOW A;  2WBM A;  3M32 A;  2YNI A;  3PJX A;  1B3T A;  1ZM4 A;  2V2V A;  2RRB A;  2GGP A;  2D3Z A;  2R2U A;  3HFZ B;  4J9U E;  2XG8 A;  1SH2 A;  3IBF B;  3Q8Q B;  3NGD A;  3N5B A;  1EP4 B;  2OI2 A;  1R0A A;  1OWX A;  4EU0 A;  1DBD A;  2F4V F;  2LYV A;  3N6N A;  2Z2L A;  4HHU A;  1BQN B;  5B08 A;  3ET6 A;  3MR2 A;  1HI1 A;  2OPS B;  4BHQ A;  2X1G A;  3QJP A;  1JQG A;  3JB9 k;  3AOB A;  2A2C A;  3RUB L;  4CO5 A;  4B02 A;  5H9E J;  4P2F A;  2JEJ A;  1IM6 A;  3RB6 A;  4NL5 A;  1YZ6 A;  4DI6 A;  1M5V C;  3JQK A;  4PRF A;  2J6S A;  2V34 A;  3DLH A;  2GJ2 A;  4RW6 A;  3O44 A;  3CO9 A;  2ZH7 A;  4X64 F;  3IG1 B;  2FLP A;  2XZT B;  2DNQ A;  3P6Y C;  5IC4 B;  3M9N B;  3KFW X;  2AIR B;  2D74 B;  3HFV A;  3ZXW A;  4CT8 A;  1GTH A;  2DB1 A;  3TAM B;  4PG7 A;  2OD6 A;  2KRB A;  1VHF A;  2KT3 A;  1TMJ A;  2ZVS A;  2KXN B;  5DG9 A;  3HHE A;  1HNV B;  2Y0B B;  3ISZ A;  1JXV A;  2DXD A;  3EXY A;  4NLT A;  4E0D A;  3JSM A;  1F2G A;  2CZ4 A;  4ECU A;  1WOS A;  3KNA A;  4DS4 A;  2R4F A;  5CH7 B;  2Z2Z A;  3K17 A;  1TFY A;  4KYZ A;  1VC6 A;  3VAL A;  3OHB A;  4PUO A;  1KQK A;  2QEX S;  2IJR A;  1JLQ B;  4ZVU B;  3BR8 A;  4MTP A;  1YLX A;  2K7K A;  2ROE A;  3QT5 A;  1OY6 A;  1X4B A;  4CO0 A;  3SI8 A;  4A47 A;  1D9F A;  3OUY B;  2X3D A;  1D09 B;  1I5O B;  3KKF A;  3PV8 A;  4ZVQ B;  1PG5 B;  2GIQ A;  3PX4 A;  3I87 A;  3MDF A;  3MMC A;  7FD1 A;  1NKB A;  1PYS B;  5LM7 E;  1UWB A;  1YIT S;  3MUT P;  5LMN J;  5BR8 J;  1NSP A;  2MJU A;  3MR3 A;  3PR4 A;  5KG2 A;  2XYG B;  2E1C A;  5DDR C;  1MU2 B;  3KK3 A;  1TL7 A;  2FVP A;  5E33 A;  2IHR 1;  3D9B A;  4XDC A;  3H8Y A;  1HWU A;  1S9E B;  4NOH A;  2CJX B;  3B6B A;  3GB0 A;  3OFF A;  1RDR A;  4Q0B B;  3E51 A;  4A4J A;  1FD8 A;  2C3U A;  2JNJ A;  2IDL A;  3FRZ A;  3A3P B;  5E5N A;  2KYX A;  4LVO P;  4M5L A;  4ZP7 A;  4NEZ A;  5J2Q A;  4K4U A;  1FCA A;  3U1L A;  4OYO A;  1TV6 A;  2CG4 A;  4A8W A;  2APO A;  1QD1 A;  4DV1 J;  4CLP A;  2CNO B;  3QRP A;  3B8H A;  4FPR A;  3CCE S;  3MEE B;  4O4R A;  1HIY A;  1SL0 A;  1J27 A;  4WFY A;  4I4B A;  5G4D A;  5I3U B;  3V2U C;  1W26 A;  1UJ4 A;  3UPF A;  4F4X A;  2G1D A;  2YX1 A;  2MQO A;  2CWK A;  1KWM A;  2CQB A;  1NPP A;  1RSC A;  4J7C A;  2Z58 B;  4FDF A;  4DCO B;  3EPG A;  5HMZ A;  1FWK A;  4ID5 A;  3TVZ A;  2POK A;  1HW8 A;  4ITS A;  1SI9 A;  2IFX A;  3KJV B;  4TNO A;  2G1H A;  4JI2 J;  1V3R A;  4YN3 B;  2E1P A;  2VPX B;  4OZ3 A;  3MPW A;  1XR6 A;  2O5D A;  3H2U B;  5L1L A;  3FSI A;  1H7X A;  2BE2 A;  3B4M A;  2W25 A;  3ILJ A;  5KFV A;  2DNP A;  4K4W A;  3MR6 A;  1F5A A;  3OPK A;  3R5C A;  1RUS A;  4LIW A;  3Q8P B;  5J2N B;  1N54 B;  3GCW P;  2R7U A;  3CC2 S;  2R3V A;  4NCG B;  2WCX A;  5IS2 A;  3OTD A;  5IZH A;  4X4S A;  4HLB A;  4H4M A;  5LMN F;  2B4P A;  2UXD J;  4OYM A;  5BR8 F;  5EWE A;  1EJ7 L;  3K89 A;  1S1W A;  4M1K A;  3KLI B;  5IM0 A;  2NQP A;  3KLG B;  1S6P B;  3MWB A;  3QRQ A;  5M2U A;  1PYT A;  3QWU A;  4RLE A;  1RT3 A;  1QM9 A;  1QVF R;  4R0J A;  3KLE A;  2UUC J;  4EUV A;  2PSZ A;  1YX2 A;  1KON A;  5L1J A;  1QE1 B;  1Y00 A;  4HHH A;  5I42 B;  4PXC A;  3CCQ S;  1Y9O A;  3L7P A;  4RBU A;  1S10 A;  2Q1L A;  3EGV A;  2GNK A;  2LU1 A;  3CJ4 A;  3GTY X;  3AJ1 A;  4UUX A;  4ZLJ A;  4DV1 F;  3FBB A;  3WC2 A;  1WEX A;  1NO8 A;  3CCW A;  5GAD U;  2BA9 A;  3SDE A;  4DPY A;  1TTH B;  2R2R A;  4WU3 A;  2DCL A;  5A8K A;  1RWN B;  2V4J A;  3SQO P;  3AXK A;  1QJH A;  4I2P B;  4QYZ J;  1P27 B;  4NZ0 A;  4O44 B;  4CCH A;  1WOP A;  1REG X;  4KHM A;  2XTJ P;  2NPF A;  1IKV B;  3V81 A;  4CLU A;  2XHC A;  4USI A;  5AE2 A;  2OPR A;  4EZ6 A;  1TL3 A;  3BO2 A;  4DX6 A;  5IV3 A;  4LSL A;  3JTO A;  4B3T F;  4JI2 F;  5EX0 A;  3CCV S;  4R5P A;  1ICE B;  3GIL A;  4PKD B;  5ETN A;  1T8E A;  5JUM A;  1TUV A;  3QGH A;  3A8K A;  2UVR A;  3S8S A;  1S79 A;  3B82 A;  2KZM A;  1CEZ A;  4BWJ A;  5E3C A;  1V5V A;  5KFR A;  5H1S V;  4JV0 A;  3JYT A;  2VQF J;  4YB1 P;  2XI2 A;  3VAH A;  1UAW A;  2L3M A;  3G2X A;  3OVB A;  5F8I A;  4N5S A;  5KT4 A;  2UXD F;  2BKP A;  3IFE A;  3AOC A;  2ZUA A;  4N8O A;  3PDN A;  1WOO A;  4DLG A;  1S76 D;  2DT9 A;  4YB5 A;  3UFC X;  3ET6 B;  4LF1 A;  3W2V B;  2B6A A;  1M5P C;  4WYW A;  4OFZ A;  4CDI A;  3MM8 A;  1GXT A;  1RK8 A;  1SV5 A;  3CD0 A;  1J5E J;  2E5I A;  1B99 A;  2G4B A;  3OJU A;  1S0N A;  1R8H A;  4ZCK A;  3BSO A;  2UUC F;  4ECV A;  1M5K C;  1EB0 A;  2FGC A;  2HQC A;  4PXE A;  5FDL A;  2K3K A;  3CPW R;  3DRS A;  3R97 A;  2QA2 A;  1GQE A;  3TNV A;  2HBY B;  3HHN B;  3OD2 A;  4XK8 C;  1PKU A;  2VOO A;  3IR6 B;  2R7T A;  4DU8 A;  2HND A;  2HQD A;  4UQG A;  3IBC B;  5H9F K;  4KHR A;  2NR0 A;  3MCM A;  2H65 B;  2VKZ G;  3R6L B;  4CNY A;  3NOC A;  4O3N A;  2N4C A;  4K59 A;  3QO9 A;  3K8V A;  4H4K A;  1U26 A;  4TXS A;  1R89 A;  1U0H B;  1SKU B;  1S9G B;  1YBA A;  3M4X A;  5L9X A;  4Q5V A;  1I94 J;  4RW8 B;  3OXL A;  2F4F A;  3EGW B;  1XQI A;  1K73 T;  4YHH J;  3PW5 A;  3CC4 S;  5E3R A;  4IKA A;  1RB0 A;  1Q86 T;  3V6K A;  1Y10 A;  2GCF A;  2MSS A;  1HNI A;  3CJ3 A;  3TZZ A;  2H1Y A;  4M8L A;  3V4I A;  3A13 A;  3V6D A;  4YFU A;  1J5O A;  2JEG A;  1KLM B;  3A8E A;  3PVX A;  3MGJ A;  3BGR A;  2HMI B;  1DTT A;  1RHJ B;  2HBQ B;  4YB6 A;  3CJ5 A;  3LA0 A;  3UDE A;  2DR9 A;  2AZ3 A;  2VBY A;  2M52 A;  1P1L A;  1VLO A;  1RLD A;  1FXL A;  4OYA A;  5KG5 A;  5J1N A;  1RWM B;  2VQF F;  4EYI B;  3VQS A;  4IDK A;  2DGS A;  1TKX B;  3DN9 A;  4FKY A;  2MY7 A;  1FX4 A;  4QWD A;  3CE8 A;  2HFZ A;  3LTO A;  4L3K A;  3M8P A;  5CQG A;  3HVT B;  1T05 A;  4NZ7 A;  4ZVF A;  5KFT A;  3A3O B;  2D3U A;  3IAM 9;  2ZHA A;  1URR A;  4LSN B;  3FCW A;  1X4A A;  4LMZ A;  3TP2 A;  1VIS A;  1NKE A;  3M8Q B;  3Q8S B;  1J5E F;  4YME A;  2DR7 A;  1OPI A;  3U27 A;  1S1T B;  5ETP A;  2JL9 A;  4MK8 A;  3T6J A;  4OJG A;  1PJ6 A;  2WTF A;  4FBU A;  2O66 A;  4KGM A;  3CGI A;  2X7I A;  3VAM A;  2UUT A;  2DEJ A;  4RNN A;  5KFJ A;  3A12 A;  5KFQ A;  2ZDP A;  3T5H A;  4Q45 A;  2W24 A;  3O2I A;  1M5S A;  1ZM9 A;  1BY9 A;  3U02 A;  3ENA A;  2BOA A;  3CDW A;  1S6Q B;  3KDN A;  2FPH X;  2WVB A;  3VWS A;  4F25 A;  2A0F B;  3DHX A;  2HK3 A;  1N32 J;  3D1O A;  4K4V A;  2JH3 A;  4DFP A;  4OIX A;  3K5N A;  3Q23 A;  5K8N A;  1HQE A;  3RB0 A;  1YVF A;  4WIQ A;  2FB0 A;  1Q8L A;  2XMK A;  4CLL A;  4AQY J;  1G3O A;  2AHO B;  3GSI A;  4O3P A;  1I94 F;  3G6X A;  1WKK A;  2B9E A;  3FKB A;  3SSS A;  1FJE B;  2WSE C;  4NYO A;  3SCJ E;  3J81 Y;  4PCQ A;  2ASJ A;  2C2K B;  2VAS A;  4YHH F;  3EZ5 A;  3GJT B;  3FUY A;  3ILL A;  3HXM A;  3ZO7 A;  4B3M J;  3GSD A;  1WC5 A;  4RNF A;  4USH A;  5J2M B;  2M8H A;  3NP5 A;  2YX7 A;  4CZC A;  3NS5 A;  4DL6 A;  4LQ9 A;  3W8P A;  4C97 A;  3QFW A;  1R8A A;  3CB4 A;  2UP1 A;  4N8N A;  2MTL A;  4P74 A;  4KQZ A;  2ERR A;  4I2Q B;  2RB7 A;  4PQA A;  3Q24 A;  1RTH A;  2OEL A;  4BCA A;  3G8Q A;  2WW8 A;  1JLE B;  1HBN A;  2JX2 A;  2OTL S;  5KAK A;  3KXD A;  5D3G A;  3LWL A;  2JJ4 D;  2BJE A;  1SIW B;  4CTA A;  4X65 J;  5HRO B;  4JUZ A;  5HSP A;  2HS4 A;  3M8Y A;  1RWO B;  3F0N A;  5F0U A;  1XNQ J;  3KMQ A;  1REV A;  5DDQ C;  3KDO A;  3BO3 A;  1Q81 T;  4Y65 A;  4P2M A;  2GX8 A;  3FQK A;  3DLE A;  1N6Q A;  3DYA A;  4MH8 A;  2CVI A;  1XK8 A;  2ZWP A;  3SDE B;  3OLB A;  3QGI A;  5KFO A;  2ASY A;  4LF2 A;  1RAA B;  1LWC B;  2NS1 B;  1FWL A;  5LJ5 Y;  1U2C A;  4OLP A;  5K8M A;  1WNE A;  3MOZ A;  3LP1 A;  4DCP B;  2BRK A;  4ZIT A;  2F65 A;  1LFW A;  3IS9 A;  4A8O A;  1WSR A;  3T41 A;  2HKE A;  5K9F A;  1N32 F;  3KYL A;  1E6V B;  2C2M B;  4NLU A;  3RRK A;  1O0P A;  1NDP A;  2DNK A;  4PZV A;  4DWI A;  4GKK J;  3GYG A;  2RQK A;  3F73 A;  3GFH A;  2E5H A;  2LQ9 A;  4AL6 A;  2RF2 A;  4AQY F;  3S01 A;  1HFE L;  2CZV C;  2ZIT A;  3D2W A;  5IT4 A;  1JLG A;  4H4O A;  2I5J B;  1XMQ J;  2O1P A;  2Y1J A;  3RBE A;  2KKH A;  4QR0 A;  2DTJ A;  5H9E K;  1H0H B;  3HX9 A;  1IWA A;  3NMR A;  4X4V A;  4B3M F;  2BJD A;  3PHE A;  3UNY A;  4C8L A;  3W61 A;  3GLJ A;  4JI0 J;  4IOB A;  3RAX A;  2L48 A;  4RJV A;  1U02 A;  1Q95 G;  4WII A;  2YNG A;  3MM7 B;  1CPZ A;  1WEL A;  5EUH A;  1CJV A;  4CQ1 A;  4W92 B;  3MM8 B;  4X4P A;  2ATC B;  5DDO C;  4MAK A;  5DQG A;  3L7U A;  1YTY A;  2XI3 A;  1EKR A;  4PG6 A;  2DJW A;  3TJ8 A;  2CAD A;  3QGP A;  3Q8Y A;  2BJ9 A;  1FX2 A;  1X4H A;  4A46 A;  4GC7 A;  2MKC A;  3I5C A;  4Y3C A;  5FLX U;  4X65 F;  2VV5 A;  4X84 A;  4MIA A;  3DRS B;  1RBO B;  2R7V A;  1XNQ F;  2QIF A;  3JQJ A;  4DN0 A;  5AJ3 J;  1EHW A;  4A8X A;  5DGA A;  1IBL J;  4LF9 J;  5HQ8 A;  3TAQ A;  3S7R A;  5AXL A;  2W8L A;  3R8Y A;  1NK6 A;  2OTJ S;  4NLO A;  3AH6 A;  3DOK A;  3BYR A;  2OPP A;  4Y6I A;  2MKK A;  2XZD B;  2DY1 A;  4RUH A;  4DV5 J;  1LFP A;  5I3P A;  4OZ5 A;  4DHV A;  3FFI B;  2CRL A;  4J91 A;  1L5U A;  3KNG A;  3LGN A;  5KG3 A;  4J9S A;  3NCR A;  4I7F B;  4KH1 B;  5DQH A;  4J90 A;  4F36 A;  5CZX A;  3N4W A;  1AW0 A;  3FC9 A;  4F02 A;  4GKK F;  4DDF A;  4H4K C;  3MUV P;  1HI0 P;  1WG1 A;  2MJN A;  1I51 B;  3LF0 A;  2Z2M A;  4F4K A;  2CYY A;  4LBP A;  2YKO A;  4CI0 B;  4EK2 A;  2EK6 A;  3V4M A;  5IOL A;  3UN2 A;  2ZH9 A;  1TK8 A;  1M1K T;  1R31 A;  2NXJ A;  1XMQ F;  5KOX A;  4CM0 A;  3TA0 A;  1ITP A;  2VUG A;  5EWF A;  1VBZ A;  2GMH A;  3D7S B;  2O67 A;  1X0P A;  4IG0 B;  1QY7 A;  4JP8 A;  3CDU A;  2V68 A;  3ITH A;  4NLG A;  1VBK A;  4JI0 F;  4L72 B;  1EAR A;  2X51 A;  4URQ U;  4KGV B;  1ZAX A;  4RNO A;  2JVR A;  3HD1 A;  2BDP A;  4LR7 A;  4KKO A;  3QMQ A;  1MN9 A;  3HCX A;  3QBC A;  4YDX A;  4F2R A;  4LQ3 A;  4FS1 A;  1CSJ A;  3OR1 B;  4B9T A;  5HVH A;  5F9L A;  3TA2 A;  4C98 A;  3UDL A;  2YNF B;  1S77 D;  4PQU A;  2QMX A;  2AJ2 A;  3J7Z 5;  2PMH A;  2CQI A;  2UUA J;  4WBF A;  1UW4 A;  4RUC A;  1LW2 A;  3GIJ A;  4O0I A;  3EDR B;  5DRK A;  2ZBI A;  4O3Q A;  5AJ3 F;  2CQ0 A;  1UP1 A;  2WOM A;  2F9J A;  4USM A;  1IBL F;  4LF9 F;  1KS2 A;  4K4Z A;  4WXO A;  3LUY A;  4WJB A;  2PI4 A;  3MM6 B;  3W5Z A;  4PEO A;  1AYE A;  1H6K X;  1S5Z A;  2AX1 A;  3KTQ A;  4C3M A;  3TW0 A;  2W9B A;  5B0C A;  1JLA A;  3O1L A;  2BVZ A;  4JYA J;  1VQS A;  3US5 A;  1U1P A;  1SC4 B;  1PJ7 A;  3MMA A;  5IT9 U;  1HBM B;  2KM8 C;  1Z2Z A;  3PFE A;  5KFY A;  5I4M A;  4J5O A;  3RG6 A;  1RWV B;  5LMU J;  2W2O P;  5E3A A;  2AV5 A;  3MAA A;  3GR1 A;  3G6V A;  4S0M A;  3T9N A;  1N5Y B;  1GH8 A;  3UD3 P;  1F1B B;  3RRH A;  4YP3 A;  4LRA A;  2ZZM A;  2XMW A;  4DR7 J;  3LP0 A;  2RRA A;  4OV6 A;  1N48 A;  2HQG A;  3SEO A;  4WCE Q;  3UD4 P;  2Q6C A;  1A9N B;  1AFJ A;  2DGO A;  2BQ3 A;  3GQC A;  1EET A;  3HT3 A;  1RYS A;  1SPB P;  1AUD A;  5GAG I;  1RWU A;  4ER8 A;  1VQ4 S;  4YOE A;  1C0T B;  4KTQ A;  3H40 A;  4IO1 A;  2XSJ A;  3PHT A;  3H2L A;  3AA8 A;  3DRP A;  3OL8 A;  1TP7 A;  2V63 A;  2FZK B;  1XEZ A;  3BGF A;  2OEJ A;  5E7O B;  1D1U A;  3BDP A;  3KLH B;  2AKW B;  3O6Q A;  4IFV A;  2HFV A;  4ZPB A;  4D3G A;  3CD5 A;  3TX8 A;  2F1F A;  3IWL A;  5KFK A;  2R42 A;  1T03 B;  3HHL B;  1NZ8 A;  1FTC A;  2UVU A;  3RZA A;  2RU9 A;  2OLW A;  1UVL A;  2VG6 B;  4GVB B;  2HNZ A;  4DFJ A;  3V6J A;  3CCM S;  4OZN A;  1SKS A;  3R2D J;  2UUA F;  4FBT A;  2IM2 A;  2RJZ A;  4CLF A;  5KFP A;  3GU0 A;  2DRB A;  3N6L A;  1LWF A;  3TVK A;  3R5D A;  3C6T A;  1KR4 A;  1TMM A;  2HNY A;  3PRD A;  4Q7A A;  3AOD A;  1HWJ A;  2D69 A;  2F40 A;  1ROF A;  3VF0 B;  3CJS A;  3AFG A;  1X5T A;  3IWX A;  1C1C B;  3FGV A;  4LRE A;  2C2E A;  1R8B A;  1W7W A;  1RYR A;  4DEZ A;  1IBC B;  3HK2 A;  3R5A A;  3FZ2 A;  4QIE A;  2NSB A;  1RQ0 A;  3R2C J;  1TKZ B;  3JTP A;  3QT8 A;  2R7X A;  1X4D A;  2HVD A;  2V9K A;  3SV4 A;  4JYA F;  3MF5 A;  3EXC X;  2OFH X;  1LK5 A;  5KFD A;  2AEJ A;  1RTJ A;  2ZE2 B;  3KUE A;  2YX4 A;  3GFX A;  5C42 B;  4FZV A;  3JSR A;  4IQX A;  4U8V A;  5C25 B;  4HL9 A;  5LMU F;  4FPI A;  1QTM A;  2MZR A;  5CYQ B;  2JFD A;  5HMY A;  1VRT B;  3H42 A;  3JAM Y;  2PDA A;  5A8R A;  3X1L B;  2M2B A;  2AYE A;  4FNI A;  4C0O C;  4DR7 F;  2MKJ A;  3Q83 A;  3I9Z A;  1OSD A;  2LXF A;  2KVI A;  2G13 A;  2PD1 A;  4USW A;  3FSX A;  4DPT A;  2RE1 A;  3KK2 B;  2UV8 A;  4Y2M A;  2ZZT A;  3NXZ A;  1FDB A;  1T94 A;  3DLG A;  4RW9 B;  5BYQ A;  5BJR A;  4DCJ B;  4TYA A;  4FN5 A;  1UA0 A;  2CPE A;  2DPJ A;  2KZZ A;  5SUH A;  2L9D A;  4M63 A;  1TK0 A;  2AD9 A;  3DFE A;  3UD5 A;  1HYS A;  1RT5 B;  2B4U A;  3RW6 A;  2EPI A;  4Y2I A;  2YWG A;  3WX8 A;  1FVS A;  3QRR A;  3RBZ A;  3DLB A;  3CC7 S;  1S57 A;  4NRU A;  2V67 A;  4EWT A;  4X4O A;  2HAF A;  3DNC A;  2MDA A;  1S0O A;  1OYE A;  5KT6 A;  3RR7 A;  4PWD A;  4DPW A;  4MYT A;  1ZH5 A;  2NLW A;  3QJJ A;  4ECR A;  1FRK A;  5A8W A;  3CCS S;  1VBY A;  4XTT A;  4V1A k;  2V2K A;  2GJI A;  4Y2C A;  4DFM A;  3MPU B;  2ASL A;  2H54 B;  2QL9 B;  1IKX A;  2DNN A;  1RT1 B;  3CJK A;  4J9O A;  1FT8 A;  5SZT A;  1HD1 A;  1DTQ B;  2H5J B;  2DHX A;  3HSD A;  4C7Q A;  3GPA A;  1YDL A;  1WI8 A;  4ECX A;  2VPY B;  2NSC A;  4DR2 J;  4LRB A;  2HZV A;  2OSQ A;  4DSJ A;  2B3T B;  1V9O A;  2HAI A;  3L09 A;  1WEY A;  4QU7 A;  4C9D A;  3UCG A;  2CNL B;  2BKN A;  1U48 A;  3FQL A;  2CIM A;  2ZJR Q;  4FVC A;  3N28 A;  5HAT A;  2OMO A;  4ZHR B;  3I5B A;  3QIP A;  3PW7 A;  1TL1 A;  2NUU G;  1SBR A;  3W65 A;  1S1U B;  4G6V B;  2RKI A;  3M2U A;  4K2J A;  1IQT A;  2XYP B;  3DCA A;  1N4L A;  4KKO B;  2P9C A;  4ECS A;  3QAT A;  5K20 B;  1N8R T;  1BQM A;  2M8D B;  1DHM A;  1KHV A;  2H51 B;  3K59 A;  1FXR A;  2Q79 A;  1WHX A;  1FHT A;  2DNZ A;  2OH2 A;  4PQU B;  1YK9 A;  3HKW A;  3K5M A;  4B3O B;  1RCO B;  1H73 A;  1VYA A;  3OFH A;  2H5I B;  3N79 A;  2ZEJ A;  1GAO A;  4J9V A;  2K3I A;  3BM7 A;  4GO5 X;  4G1I A;  4LFA J;  3G87 A;  1S4F A;  2A3J A;  4AE5 A;  4ILR A;  2B5J B;  4I6A A;  1KRP A;  1KVJ A;  2LFV A;  4IG3 A;  2HWI A;  3CJQ A;  2OPQ A;  1JJH A;  1TU0 B;  1XIQ A;  5J2P A;  4FNH A;  4TU7 A;  2PII A;  4PG5 A;  2YKA A;  2E29 A;  2LEB A;  1S1X B;  3TYT A;  5KFN A;  2WRM A;  3SSQ A;  2HGN A;  2YWH A;  2F63 A;  4KO0 A;  2DNY A;  1N36 J;  4O4G A;  1X7V A;  4X4R A;  2VKR A;  3HI9 A;  2E5J A;  4RZR A;  3UW1 A;  5C7P A;  1I3O B;  4XIU A;  4FYD A;  2FJA B;  2YNH A;  1JLF B;  3TUP A;  2DBB A;  2IM3 A;  3CCU S;  3PW0 A;  4DV7 J;  3D6F B;  4M5J A;  5CD4 H;  3P96 A;  4NWB A;  4JV5 J;  4DR2 F;  1RAI B;  1S1V A;  2YKN A;  2QFI A;  4WXW A;  3TAP A;  3NEK A;  1Z2L A;  2V4Q A;  2D7S A;  3BSC A;  4ZIV A;  1VJW A;  3SFG A;  3CSK A;  2YKP A;  5CA5 A;  3POT B;  2AJF E;  1C1B A;  3OL6 A;  1HBU B;  2BBE A;  2DGW A;  3RAM A;  4K4T A;  2KU7 A;  3R7N B;  1K47 A;  3FMB A;  2RS8 A;  4RWX A;  3D67 A;  3VQT A;  2KG0 A;  1RXO B;  3PKM A;  3CED A;  2GS8 A;  2QSF A;  3BQ1 A;  2X1A A;  3R5J B;  2XO6 A;  2G0C A;  3IR7 B;  4FXV A;  1Y5L B;  2E1R A;  1PO6 A;  5THW A;  3M2V B;  2HIY A;  4USJ C;  2IVY A;  4USK A;  2RH3 A;  1P6T A;  2AYB A;  4NPO A;  1BQX A;  3HZG A;  1S7I A;  2WB1 D;  4LFA F;  2DHH A;  3PRV A;  3W3S A;  3CCZ A;  1N0V C;  3U1N A;  1JLC B;  1JJC B;  2WON B;  2YBV A;  1K0V A;  4UOH A;  4MIB A;  1FJC A;  5A2Q Y;  2Y1I A;  3MI7 X;  4KRW A;  5K14 B;  1S48 A;  4I6W A;  4ED0 A;  3Q2T C;  3IRX A;  1CS4 A;  1LW0 B;  1F3V A;  2RQM A;  2UUB J;  2VG5 A;  5AXM A;  4QPX A;  2MKY A;  1VDH A;  2XC9 A;  3SSR A;  1N36 F;  4DSE A;  4UZC A;  2B8Q A;  3KLF A;  1CJT B;  4KH0 B;  3CDB A;  3V6H A;  5GAH U;  2SXL A;  2FJW A;  4ZVH A;  4AT1 B;  2HQF A;  1RTD A;  3QJL A;  5FII A;  4PWU A;  5A6P A;  4OJH A;  1G1X A;  2H4W B;  4DV7 F;  3MED B;  4DG1 A;  1YRU A;  2GJF A;  3IM9 A;  1RA6 A;  1RAJ A;  1WEZ A;  5D4N A;  4JV5 F;  3BGO P;  1Q0N A;  3OV7 A;  8ATC B;  2DIS A;  3HVW A;  2GW8 A;  3HUL A;  1JKH A;  5T7L A;  2K2P A;  2P9E A;  4FF2 A;  1T02 A;  1NJY A;  1U1L A;  3IA0 A;  1O51 A;  1FFS B;  1VGY A;  2IAJ B;  1CJK A;  2CPD A;  3GV7 B;  2QYC A;  3ISN C;  2QA4 G;  4UOC A;  2EW9 A;  4CO4 A;  1CG2 A;  4I68 A;  3M2R B;  1TVR B;  1ZPV A;  3LOU A;  4I0W A;  3OL7 A;  1YBT A;  5GMD A;  4CNZ A;  3NWG A;  1G6B A;  1CC8 A;  1DLO B;  2E9R X;  5CYJ A;  4RX6 A;  3PYE A;  4EZ9 A;  4U67 Q;  1X9S A;  4DL0 C;  3MPV A;  2OD4 A;  3RYL A;  2J8S A;  4JI3 J;  2MZ1 A;  3M1V A;  4XPE A;  1IKY B;  2BJ3 A;  4U95 A;  1HL6 A;  1RTI B;  3ZZU A;  2RHQ B;  2VPZ B;  5D4P A;  1NK4 A;  2KFY A;  1U1N A;  5GAD I;  1YJ9 S;  3NGK A;  3MCO A;  1K0T A;  1HMV A;  2ZKT A;  2HGM A;  2B8P A;  2W9C A;  2PFF B;  4HI2 A;  2MEW A;  4KFB B;  1V6H A;  4NZ6 A;  3FBC A;  2KHD A;  4JBC A;  2LLZ A;  1SKR A;  1VOM A;  4ZK7 M;  1JLB A;  2MQN A;  2AGP A;  3BRE A;  4URG A;  2D3O R;  2O3D A;  5JMN A;  2W2P P;  1ZOT A;  2V8P A;  2XMJ A;  1CUL B;  2ROG A;  2UUB F;  1CVJ A;  1N56 A;  1FKO B;  4B9V A;  3PYF A;  3VGS A;  1VQN S;  2C2D A;  2VOD A;  4DSK A;  3AQP A;  3VVT A;  2QT7 A;  3GJS B;  1H2V Z;  4IOC Q;  1S6O A;  4ED4 A;  3I9V 9;  2M7S A;  2G2Y A;  2V0N A;  1ZPW X;  5HLF B;  5B0B A;  3PKY A;  3DGP B;  4L74 A;  2ZH8 A;  3W9J A;  1PGZ A;  2KN4 A;  3T5L A;  1XTZ A;  2W7A A;  3JTN A;  3I0S A;  2RRN A;  3IXQ A;  5D4O A;  4IOA Q;  3P5B P;  3IGV A;  2X3G A;  3MD3 A;  4XAK A;  1NHK L;  3CCL S;  3QIP B;  1TL1 B;  1BMQ B;  1PCA A;  2V4R A;  1VRU A;  1RT4 B;  3ENV A;  2RKI B;  2XBP A;  3CME S;  1AZS B;  3UDV A;  3W62 A;  2E44 A;  4Q43 A;  2L08 A;  3KG0 A;  2PT0 A;  2LMI A;  1SQF A;  4MFB A;  2JDJ A;  4UTG A;  2XGP A;  4MMO A;  2BM1 A;  3KG4 A;  4MT1 A;  3OR2 A;  1RHU B;  3F41 A;  5ETS A;  2M88 A;  2FDN A;  1RAD B;  2H48 B;  4O3S A;  4K7Q A;  1FEH A;  2LEA A;  4G3I A;  4WF9 Q;  1UCN A;  2JEF A;  3OW2 R;  2YKM B;  2DHA A;  4JI3 F;  2VH7 A;  1UPP A;  3UR0 A;  1FE4 A;  4TVA B;  2ZDO A;  1VIX A;  1CLF A;  3Q8V A;  5ETT A;  3GCX P;  2OO4 A;  2CJQ A;  5EHH A;  4GC6 A;  3ENQ A;  4DUY J;  3FRY A;  4A8K A;  1M5O C;  2YQ3 A;  3ZTQ A;  2I6W A;  2MST A;  1YRX A;  1C0U A;  4GMK A;  4C11 A;  2CJY B;  4BC9 A;  5DG8 A;  2WVD A;  1X4E A;  2K1R B;  2JEI A;  1T7P A;  1O6X A;  1XBW A;  1XNR J;  1WHY A;  2M0G B;  1RHM B;  3P4U B;  1JNR B;  1BLU A;  5DLG A;  2CZ9 A;  4WZQ A;  3OHA A;  3MTJ A;  1NKC A;  5C2C A;  2FC8 A;  2IA0 A;  5CCM A;  4C48 A;  4AUK A;  2BAB A;  4CLT A;  2HBZ B;  5LXY A;  2OEK A;  1S6U A;  1U2F A;  2DRA A;  2MGZ A;  3AY0 A;  3LP2 B;  1MLA A;  4KV8 A;  7FDR A;  1GT8 A;  1CJU A;  4EBC A;  2QG9 B;  3AA9 A;  1Q53 A;  2DIV A;  3M7V A;  2BRL A;  3M30 A;  5D4L A;  2HFU A;  3GR0 A;  3NY0 A;  1HPZ B;  1LWE B;  4C2M A;  2FHM A;  5GAE U;  4X62 F;  5C2G A;  3CJ0 A;  4QR1 A;  4ZVE A;  3W64 A;  2CPH A;  5DQI A;  1SCJ B;  4K50 A;  4FF4 A;  1FDN A;  1VQK S;  3HF5 A;  3G96 A;  1QUV A;  1UFK A;  1MSW D;  1Q5Y A;  4KPY A;  2C2O B;  2E9T A;  1KNZ A;  1FFG B;  2W1B A;  1KOO A;  2YXL A;  3M8R A;  2DR5 A;  2R8G A;  3LAM A;  3VGV A;  5KG1 A;  1OO0 B;  2J9E A;  1C4A A;  1XN9 A;  4UOG A;  1CC7 A;  3T19 A;  4ETX A;  3H5U A;  1U09 A;  3FNN A;  5CZV A;  1U6B A;  2QTW A;  2YQ0 A;  3NBP B;  3UVJ A;  2OHD A;  3KUH A;  1EIY B;  1J2V A;  4EO6 A;  2RHS B;  3T3F A;  4OI1 A;  3FVY A;  1GFW B;  1TKD A;  3HZE A;  5A0Y A;  3MM9 A;  2FVS A;  2XS2 A;  3JQM A;  1RT7 B;  3LWM A;  4WE1 A;  4NXM J;  1CBK A;  5F3T A;  2P5V A;  3BQ0 A;  1IKW A;  2FHO B;  3UCU P;  3C6U B;  4DUY F;  3SQG A;  4ZKA A;  4OHY A;  1T9V A;  1NJZ A;  1YZ7 A;  3UI3 A;  3HJV A;  2VG7 A;  1UFW A;  1XNR F;  2B4V A;  6FDR A;  2IC3 B;  4NYZ A;  1RT6 A;  4U9R A;  3CO0 P;  3J7Z T;  3RBX A;  1FJG J;  3OXF A;  1F5C A;  5EWG A;  3KK1 B;  1X5P A;  4E8U A;  1UPM B;  4HAC B;  5RUB A;  4UZB A;  2H4Y B;  2AYM A;  1SIZ A;  1Q5V A;  5U47 A;  3LAL A;  2DR8 A;  4F4Y A;  4Y2A A;  2E9Z A;  1QDU B;  4NLD A;  2QSW A;  5C24 A;  3V5R A;  4O0N A;  1YKW A;  1VCT A;  2A6M A;  5CYM A;  2D9O A;  2WAQ D;  2J9C A;  3BKT A;  1RT2 A;  1U49 A;  3KHL A;  2YPY A;  4F8R A;  1Y4Z B;  4WTO B;  2KJW A;  3TEG A;  3L7O A;  1Q8I A;  2ALY B;  4F4W A;  1FO1 A;  5M2R A;  3PXG a;  1S0M A;  3DXS X;  3NS6 A;  3K58 A;  1RU2 A;  1WDD A;  3J7Y U;  2RS2 A;  4DL3 A;  2ZH2 A;  1FEE A;  3TVY A;  2V50 A;  4A8F A;  3H2V E;  4BC7 A;  2HW3 A;  1HBO A;  2EC0 A;  1HQU A;  3KG1 A;  1GX5 A;  1RCX B;  5ADZ A;  2PA3 A;  4X4T A;  4TQR A;  1EAY C;  2EG1 A;  2HHS A;  2K8G A;  1NJI T;  2MYF A;  2BEF A;  2KI2 A;  3DMJ A;  3GFY A;  4ED3 A;  2QL5 B;  1RAE B;  3WX4 A;  4YB7 A;  1WF2 A;  2J0Q D;  3MD1 A;  4ELT A;  2EI5 A;  4QOT A;  5JXS A;  4DMZ A;  1APS A;  3SYZ A;  4NXM F;  2QX0 A;  2LA4 A;  1HLW A;  1FRL A;  1S99 A;  2IM0 A;  3DM2 A;  1MML A;  1B7Y B;  4EGL A;  1NJX A;  2IYI A;  1AA1 B;  2CPX A;  4CH0 S;  1SUQ A;  3MEC B;  3SZ2 A;  3DLJ A;  1H38 A;  4NML A;  3BZQ A;  5G0R B;  3TZY A;  3FZB A;  3ZZT A;  4IR1 A;  1GMV A;  1OJ4 A;  1U24 A;  3QLH A;  4PG4 A; 
#chains in the Genus database with same CATH homology
 1RTZ A;  1G4C A;  3MCN A;  2BMB A;  2CG8 A;  4M5I A;  1EQ0 A;  4M5L A;  5ETR A;  5ETO A;  3HCX A;  3ILJ A;  3ILI A;  3ILO A;  3QBC A;  1EQM A;  2QX0 A;  1RU1 A;  4M5J A;  4CRJ A;  3UDE A;  4M5M A;  3HSG A;  3UD5 A;  4CYU A;  1RB0 A;  4CWB A;  1HKA A;  1IM6 A;  4AD6 A;  3MCM A;  3HSJ A;  4M5H A;  5ETN A;  3HT0 A;  5ETQ A;  2F63 A;  4CYU B;  1RAO A;  5ETL A;  3HSD A;  3MCO A;  4F7V A;  4PZV A;  5ETM A;  5ETS A;  5ETK A;  4M5K A;  1KBR A;  1EX8 A;  3UDV A;  4M5N A;  1CBK A;  3HSZ A;  1TMM A;  3ILL A;  3IP0 A;  3KUH A;  1RU2 A;  1F9H A;  3HD2 A;  3KUG A;  4M5G A;  5ETT A;  5ETP A;  5ETV A;  3KUE A;  1DY3 A;  3HD1 A;  1TMJ A;  1Q0N A;  2F65 A;  1HQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...