3VAFA

Structure of u2af65 variant with bru3 dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
total genus 43
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vafA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vafA02
3G4SS 1D8ZA 2CPHA 1OWXA 3IRWP 2DNZA 2I2YA 4OZ0A 2E5JA 1DBDA 2OIHA 4QQBA 2LA4A 2KXFA 2CQIA 2G0CA 2HZCA 3LPYA 4ERDA 5GMKa 2YWKA 2MY8A 3BO2A 1WEYA 2EK6A 4TU9A 1HD1A 1VQ4S 2PE8A 2JVRA 4TU8A 2G1DA 2DNPA 3EGNA 1VC6A 2G4BA 2CPZA 3ULHA 2KYXA 2YH0A 1OIAA 1R8PA 4WFBQ 2QA4S 1WF0A 3UE2A 1U6BA 1H6KX 3CD6S 4J5OA 3MOJB 1SXLA 5CXTA 2DNRA 1KQSR 1KC8T 2JVOA 1U1PA 2CQ0A 1KOOA 3CC4S 3NS5A 3SMZA 1U6FA 1WF2A 1BY9A 5DDPC 2FPHX 1NJIT 1N52B 1P27B 3S6EA 3EX7B 1DZ5A 2M52A 1WHYA 1PO6A 2M9KA 2DNGA 1UAWA 2KG1A 2CPEA 2YKAA 3G96A 3R1LA 5DDRC 2OTJS 3V4MA 2KI2A 3BS9A 4F02A 5ITHA 1UW4A 4C4WA 3B4DA 3UCGA 3HI9A 2AYEA 2DHXA 2XS5A 2LECA 2X1BA 4ZKAA 4A8XA 4C0OC 1ZZNA 3TYTA 2ADBA 4LJMA 3CPWR 1VBZA 2MKCA 2MKKA 1FNXH 2CQ3A 2F3JA 1YHQS 3CF5Q 1VQ9S 5MLCV 1U1QA 3ZZZA 3L3CA 2J76E 2CPFA 2DNOA 2BZ2A 2DNLA 2M0GB 2KXNB 1DRZA 2D9PA 2GHPA 2HGLA 3CCQS 2E5GA 2DHAA 4PKDB 4OZ1A 2JRSA 1U1NA 1X4AA 1FXLA 2VONA 2XSFA 3H2UB 2HYIB 1VQ6S 3CUNA 2CPIA 1B7FA 1SJQA 2E5IA 2MY7A 4C7QA 4YUDA 2KHCA 3UD3P 3R27A 3DXBA 5JVGQ 2ZJPQ 3NNAA 1JJ2R 2MGZA 2HVZA 1FJCA 2MJNA 1U2FA 4LMZA 5DDQC 1QM9A 2RUGA 3NS6A 2L41A 3P3DA 3CC7S 1NO8A 2CQDA 3FEYB 2XS2A 2LYVA 2GO9A 3VAGA 1X4CA 2D9OA 2L08A 1SJ3P 3P6YC 3B4MA 2DGXA 2DHSA 4QU6A 4WIIA 2XB2D 2AYMA 4F26A 2M7SA 2MQNA 2MQLA 5GAHU 1X4EA 2DIUA 3CCLS 2FY1A 5IQQA 3BO3A 3NNCA 1M5PC 3BEGB 5BJRA 2XS7A 2KG0A 1AUDA 3I56S 3NNHA 2V94A 2M88A 1X5PA 2F9JA 2VOOA 4WFNQ 2O3DA 2AYBA 2KT5A 2DITA 2RRBA 1Q86T 2DK2A 3CCRS 4WFAQ 3SDEA 1OPIA 2OSRA 1L3KA 1S79A 1YI2S 5LXRA 5EN1A 3VF0B 5GAGU 2EVZA 2DGVA 1VBXA 1M5VC 2CQ4A 1H2TZ 2MSTA 5D77A 3CMES 2CQPA 2DB1A 5DETA 5DDOC 2RU3A 3VAMA 2DH8A 1FJ7A 1WEXA 2MQMA 2KRRA 2KH9A 1KD1T 1D9AA 2RNEA 1X4GA 3US5A 2WBRA 3UCZP 1WF1A 2MB0B 2VODA 2MQOA 1N8RT 2VOPA 2DNKA 1ZZFA 3P49B 2CPDA 2DH9A 2M70A 1YJNS 2NZ4A 2DH7A 2DISA 5LXYA 1H2UX 3VAJA 2RQCA 2U2FA 4IO9Q 2E44A 2DIVA 1JJ4A 2KU7A 3G8SA 1QVGR 3UWTA 1A7GE 3D2WA 1U1RA 4WF9Q 1WHWA 1F9FA 1VQ7S 5IM0A 4U67Q 1M5KC 1VQOS 2KVIA 1UFWA 4F25A 2CJKA 2X1FA 1W2BR 4QU7A 2MSSA 1WHXA 4TU7A 3IWNC 2DGSA 2MZJA 4V19X 3UD4P 3TO8A 2XNRA 1X5TA 3CC2S 1RK8A 2J0SD 3THPA 1YTYA 1M1KT 2K8GA 2ZJQQ 3CTRA 1WEZA 2OSQA 4P6QA 2MZQA 4M5DB 3S7RA 1A9NB 4QPTA 2D3OR 1JJHA 2HGMA 1YITS 1VQNS 5GAEU 3SXLA 2YH1A 1K9MT 3Q2SC 5DM6Q 5LJ3Y 3VAFA 3VAHA 2DNNA 4YOEA 2CPYA 3P5TL 1U1OA 2LXIA 2AD9A 5D78A 5GADU 3CXCR 1U1LA 2DO0A 1VC5A 2KN4A 1VBYA 1P1TA 2LEBA 5CYJA 2DNMA 3CULA 1N54B 2FC9A 2MPUA 2N3OA 1NU4A 3MDFA 1SJ4P 2UP1A 3BO4A 3CCSS 5DM7Q 2LKZA 2XNQA 2LCWA 2DGQA 2DGWA 4UQTA 3G6ES 1FO1A 2CQBA 3S01A 2M8DB 4BS2A 1URNA 1Q81T 1IQTA 2MKSA 2I38A 4Y0FA 3VALA 4CH0S 2MKJA 1WTBA 1O0PA 1OO0B 2LXUA 2DGTA 2AYGA 2DGUA 5GVQA 2QEXS 2M8HA 3LQVA 1U1KA 2DO4A 3N9UC 2KFYA 1VQPS 2DNHA 3EGZA 1VC0A 3ZZYA 3TP2A 2MJUA 1Q82T 3Q2TC 2CQGA 3MUMP 1VQMS 2PEHA 2MZSA 2M2BA 2LEAA 3R1HA 2DNQA 3RW7A 3NMRA 2KM8C 4FXVA 3CCUS 1Q7YT 4CH1A 3UCUP 3MUVP 1WG5A 2N3LA 4EGLA 1K8AT 3U1MA 3S8SA 1CVJA 2E5HA 2CQ1A 5LJ5Y 2MGZB 1X4BA 3HHNB 2ADCA 1K73T 3CCES 1QVFR 1YJWS 2BOPA 2QFJA 1WG4A 5HO4A 1HA1A 2CQCA 3MI7X 4FXWA 5LSOA 1YJ9S 2DGOA 2X1GA 2YTCA 2L9WA 2KM8B 1X5OA 3MD1A 1ZH5A 5FJ4A 4TLQA 2U1AA 5IFMA 1FJEB 2RRAA 1WHVA 4Z2XA 3CMAS 2RQ4A 2JWNA 3PIOQ 2B0GA 2LA6A 2RT3A 3I55S 2LQ5A 1YWXA 1JMTA 3J7ZT 1G2EA 1VQ5S 2ERRA 4W92B 1WWHA 3K0JA 2CQ2A 1RKJA 2EK1A 2K3KA 1DHMA 3CCJS 3SDEB 3MD3A 2N7CA 3G71S 1WELA 2MKIA 2OTLS 3MXHP 3FEXB 1YIJS 2J8AA 2OJ3A 2X1AA 3RW6A 4IOAQ 2CPXA 1WI6A 2N82B 5CA5A 2MHNA 2MQQA 1R8HA 4WKRA 2DNYA 5LSLA 2MZRA 1VQLS 4IUFA 1X5SA 4ED5A 2DHGA 1KOHA 1M90T 4UY8T 1H2VZ 2CQHA 2KRBA 2RS2A 2RVJA 1HL6A 1X4FA 3JB9k 1HD0A 3MUTP 2M4MA 4Y00A 2MKHA 3VAIA 1PGZA 3U1LA 4CIOA 1FT8A 3PIPQ 1M5OC 1UP1A 2F9DA 1N88A 1VQ8S 1VQKS 2HGNA 5IM0B 2KXHA 1SJRA 4PRFA 2MZTA 4LIRA 4RU2A 2NLWA 1X4HA 2MMYA 2RS8A 2Q79A 2SXLA 2MYFA 2MXYA 5JVHQ 1U1MA 3DLLQ 2MQPA 2ZJRQ 5H1SV 3VAKA 4W90B 3THTA 5HL7Q 1X0FA 2JX2A 2FC8A 2MZ1A 3CCVS 3G9CA 1S72S 2J0QD 2LMIA 3CCMS 3OW2R 4CQ1A 3MURP 1FHTA 1WG1A 4PR6A 1X4DA 3J7YU 3H2VE 4IOCQ 1SJFA 3G8TA 2FHOB 1XN9A 2A3JA 4WCEQ 1WI8A 4YB1P 2CPJA
chains in the Genus database with same CATH superfamily
2R7RA 1GMUA 2E9TA 2JC1A 3SZ2A 2OIHA 3D3BJ 4ZCKA 1T05B 1CULB 2APOA 3HVTA 3VCDA 2PO4A 1Z4UA 2JVRA 4RJVA 1XNQJ 4CLKA 1VOMA 1OIAA 1JLCA 1TMJA 4EZ6A 3UE2A 1BQMA 1FXDA 4J9QA 4OYPA 3W5ZA 1NK8A 3SCLE 5CXTA 4PXEA 5K9FA 3CJ8A 2W25A 1PYSB 3IBCB 3TR5A 3D68A 3KUGA 1HNWJ 2GMLA 2UUAF 1U6FA 2IYIA 3NWRA 4OZ3A 1F2GA 2KT2A 2QMWA 4ELUA 1SB6A 1QUVA 4C4WA 2MDAA 3I4PA 3FSIA 2C2EA 4LJMA 3CPWR 1HWIA 2J7WA 4GRSA 1JJCB 3L3CA 3TA0A 4NCBA 2EPIA 3W2VB 2VFSA 2GHPA 9RUBA 3Q8PB 1R3NA 1FKAF 3NGTA 2XMWA 4OX9J 2MLZA 2ZWPA 1SJQA 4ZVPB 3G2XA 1FX2A 1QJHA 4MT1A 4O0IA 5A0YA 1HI1A 3EPGA 3HP6A 1V5VA 4P73A 5CQGA 1JLGB 2NPIA 4PYAA 2DR7A 4PG7A 3DDIA 3BV8A 3PX0A 1X5PA 3D0HE 2VOOA 5HBMB 1BHNA 5FLXY 3ISZA 4OHWA 4G1PA 4FNHA 3SDEA 1HNVA 1VBXA 4BWJA 1FJGF 5I3UB 2CQPA 3AD7C 2OLWA 3TJAA 3MR2A 3IXQA 3DOKB 1VIOA 3A13A 1EQMA 1YKWA 1HNXF 1IBLF 2M70A 4FBUA 4HVZA 3G8SA 4DV6J 3LP0B 4N8NA 1VQOS 2C2RA 3KG1A 3J81U 2XO7A 5T7LA 4IKAA 2OD4A 4USJC 1PYOB 4PG5A 4TU7A 4PWWA 2V4RA 2UU9F 4IRCA 4DUYJ 5D4LA 2Z8QA 1WEZA 3TUPA 3SV4A 2RDIA 1U2RA 1FRXA 4O4GB 3HVRA 4BCAA 1JLQB 4YOEA 2ZH2A 5GADU 2KN4A 2HURA 3AFGA 1CS4A 3MOZA 4P2MA 4O23A 4NXNJ 3G6ES 3GJTB 2HK3A 3MEGB 3ILJA 3FFIB 3SSSA 1IQTA 4CH0S 2KFNA 3R5GA 4ILMA 1RHKB 1NHVA 8AT1B 4I69A 2Q3PA 4OI0A 4LSZB 4ECYA 2AJQA 2IPOB 2DNHA 3LP2A 2QRRA 2LP4A 1RWMB 1Y4ZB 3RB0A 5L46A 2GS8A 4LSNB 3WC2A 3MMJA 4NEYA 2BE2A 3CT9A 5KT3A 4LQ3A 3UCUP 1RT4A 3OHBA 1WJ9A 3LF0A 5LJ5Y 1NDKA 2QFJA 4DR5F 3MI7X 1RWPB 2V2VA 2JEJA 2L9WA 1BQNA 1X5OA 3UQSA 5KOXA 4TLQA 2OKQA 2RJZA 3CGIA 1FVQA 4ZVTB 3DLEB 3RZAA 2E5LJ 2VA2A 3W9HA 2A2CA 2FB0A 2EKNA 4ZPWR 5HATA 1HMVA 3DU6A 4UF4A 5ETPA 1G6BA 1FFGB 4NLXA 1SKSA 1RLCL 2AIRB 1WI6A 1KBRA 4M5GA 2ZOMA 5EWFA 3T5HA 5LSLA 2FD2A 1XIQA 5BR8F 4QYZK 2GVZB 3BQ1A 1K47A 2NSBA 2NXNA 1X4FA 4R8UB 5ETNA 5KFBA 3F56A 4AL6A 4FYYB 4UZBA 1M5OC 1FT8A 2Z56B 3UFCX 4ZPCA 3C6UA 4KV8A 2DEJA 2MZTA 4DG1B 3T1HF 1FK9A 2PEBA 3B8HA 4EI2A 5B09A 2HFUA 2SXLA 3MM8B 3RYLA 2ZEJA 4W90B 1MU2B 4FBTA 2HNZA 4MKBA 5CCLA 2DNZA 2N7YA 3QLHB 2BE9B 4OLOA 5GMKa 1Z2LA 2EK6A 1XWLA 1R6YA 3CJ3A 3KLFA 2BM0A 2YH0A 4BLGA 2BKOA 4QPXA 4P10A 4L72B 1KWMA 1B70B 3PY8A 5D4NA 3KMQA 4FYWB 5B08A 4ED3A 4DU7A 3KLIA 1YBTA 1IJFB 1P27B 3FGVA 3P45B 2M9KA 2JEFA 4LF1A 1YX2A 2PSZA 1BUXA 5DDRC 2D74B 2OHDA 2LU2A 5KFAA 5JJBA 5KFUA 4E8UA 1FNXH 2B5JB 1S1UB 3W5XA 5CHCB 3FEZA 4X4NA 2RF2A 2XI3A 3M8QA 3G6YA 4CM0A 3NGKA 2YKNB 1BMQB 3PYFA 4X4OA 1JLBA 3ZTQA 4DSFA 1J2VA 4K8RA 3ZZPA 4LVOP 1SBRA 1WKKA 2L08A 1NDCA 4WYLA 4H4OA 3I87A 3QPIA 5E3CA 1WOSA 3OLBA 5E3PA 1VRUB 4ZITA 2F9JA 2IHR1 2RRBA 4LRFA 2V8PA 3CCRS 1SI9A 3ENVA 1CJVB 5GAGU 3H59A 2MSTA 1AFJA 3CNQP 2BE7D 1RT5A 1KKHA 1D9AA 2DXFA 2D41A 4DCJB 1FTCA 2CKWA 1NK4A 3I6PA 4OYAA 3L7OA 5E41A 2BOAA 2BABA 3GIRA 3KLEB 4USUA 1S6OA 1LFWA 3DLBA 2IBOA 1M5KC 1VBKA 1XMOJ 3SSRA 1H73A 2CJKA 4QWCA 4I64A 1WHXA 4OJ1A 5F8NA 2ZHBA 1XK8A 4M1KA 2BRLA 3JSMA 3PYDA 2XYGB 5CH7B 4DV0J 3CTRA 4M5DB 3CEDA 7FDRA 3KOAA 4GMKA 1FDNA 1ZYQA 5CYQB 5H9EK 4A46A 1T05A 1CULA 2IFXA 2QTWA 3MEKA 4IDKB 3LGMA 4KGXB 5D4PA 4HYKA 2GNKA 5F8MA 4I56A 2UVUA 2J9CA 3B82A 5AE3A 5J2QA 3UPFA 4LSLB 4LF5F 3BGLA 1U25A 4N77A 2Q66A 2J9DA 2IY5B 2BKPA 3ENQA 4DV7F 1UVLA 4P74A 4ED7A 2LQ8A 5MAOA 1IJEB 3AY0A 1VC0A 3D6FB 1VQMS 5C42B 4X62F 4NLWA 1TVRB 4DV1J 1EB0A 1RHJB 2DXEA 2EC2A 1XMQJ 1CJKB 2MGZB 2CQ1A 3W2VA 2YPYA 1YJWS 3W8GA 2HNDB 1OY8A 3BYPA 1RAOA 4WZMA 4RW4B 3WC0A 4CM2A 3IP0A 3BGRB 1GTEA 2VH7A 2IVFB 4J9NA 3PIOQ 1H7WA 1HQEB 1NXIA 4RUAA 1NRKA 2K3KA 2UUWA 4IQMA 3TX8A 1C1CB 1JLGA 3G71S 2FYXA 1KLMB 1YIJS 2J8AA 3IR7B 2XGQA 2CPXA 2N82B 1IWGA 4FDFA 1YBAA 4DJBA 4JI1J 5HBMA 4I67A 3EM1A 3PFOA 3DLGB 2RVJA 1HD0A 4Y00A 1K44A 2VKRA 2CJAA 5A6PA 4M5LA 6FDRA 1QD1A 1VQ8S 2HGNA 2VPXB 4ZLJA 1X60A 3DOKA 3PX6A 3LAMA 1FE4A 1LEOA 2YX4A 2DPIA 2FC8A 1UVJA 2KL8A 3BM7A 4UTGA 2LMIA 1FHTA 2XHWA 3PXGa 2VF3A 3H2VE 3LP0A 4Q2LA 2H65B 5KT4A 2WSCC 3QRPA 4HTIA 2LEPA 3EMTA 1U7LA 2VC0A 2HW3A 5KG1A 4RBTA 2W9AA 2LA4A 4OI6A 5LSRA 4B9VA 3ETMA 2YWKA 4DZDA 3PTWA 1SL1A 3TZXA 1VLYA 1VC6A 4NL5A 4Q8FA 3A8IA 2HSEB 4O4GA 3IWXA 1RT6B 1JLQA 4DQQA 4ELVA 1U1PA 1AROP 4ZCIA 3GJRB 3FMBA 4DL3A 2FHMA 4XTTA 2CG4A 4X64F 4B9UA 2Q6CA 2FZKB 2UXBJ 2VKZG 3MEGA 3KMSA 3FFIA 3SCJE 4A8SA 3CVKA 2AYEA 1HBMB 2X1BA 2V8DA 1F5BA 1ZZNA 2A2DA 1IKYB 3TYTA 1SVDA 5C7PA 3OD2A 1YHQS 2GMJA 1ICEB 5MLCV 2M0GB 3I9ZA 4B9NA 4JI5F 5HQLA 4GC7A 3D0IE 2QSWA 1U1NA 1X4AA 4LSNA 4JI3F 1Q79A 1T3NA 5B0EA 1YJVA 2E5IA 4OL8A 4N5SA 4X84A 3FNNA 3DXSX 3ZTRA 2ALYB 4NYPA 4JV0A 3FBBA 5HLFB 1VMBA 4TY9A 5LMNJ 4IO1A 1RHRB 1TTHB 2GO9A 1JLFB 3G6VA 4DQSA 1GK8A 2L48A 4WIIA 2Y1RI 2XB2D 4ZPVR 4ALZA 1I94F 3BEGB 5CZVA 2XS7A 4A8OA 3CD0A 3DLEA 4M95A 2ZBQA 4DR4F 3RAXA 3AD9C 1L3KA 5HAOA 1KR4A 3VF0B 4GKJF 3EE3A 2RU3A 2P5VA 2BQ3A 1KD1T 3I0SA 3PKMA 3PV8A 3WHIA 2NPFA 3BDPA 3QT5A 2GVZA 3Q8QB 4H4KC 3W9JA 4FF4A 3HJFA 1WTFA 3OJSA 2E44A 1F3FA 2IM1A 4HH1A 4O3NA 4BHQA 1VQ7S 3EUNA 4YN3B 4C8ZA 3HHLB 3MM8A 1UWBA 2IBKA 2WOMB 4K50A 1MU2A 2XNRA 1VYAA 2YNGB 2NS1B 4NLYA 4K0KF 5DG7A 2BJ9A 3FBEA 3R7NB 2C3YA 3BH6B 3SXLA 3C15B 3QLHA 4I2QB 4XK8C 5HSPA 4PCQA 3RBDA 4WFYA 2JEGA 4LFBF 1NBEB 1UFKA 4ZLLA 1TAQA 2D3O1 2H9ZA 2HG4A 4DEZA 1PIEA 2DGQA 4LFAF 4YR2A 3RB6A 1AFIA 2DGUA 1IM4A 4NLSA 2HVHA 3CJ5A 1NMEB 3AXMA 4RWXA 5ETLA 2XQCA 3N9UC 1RAEB 3ZZYA 2I6WA 4DV5F 5CYMB 2I5JB 3VWSA 2H5EA 4WPAA 3ENWA 3PJWA 3T5JA 4Y34A 3RGIA 4K2XA 1ZPVA 2B5JA 1S1UA 3ZO7A 3FBCA 4CLUA 1I3OB 3IAM9 4RR5A 5D0EA 2Y3YA 4FXWA 1UCNA 2DGOA 4TXSA 2KM8B 2X3GA 1NH7A 3KYLA 2OPRB 4AQYF 2WAQD 2YKNA 3OXGA 3SQGB 1JMTA 2ERRA 1WWHA 1RAAB 1RI7A 3KWMA 4YP3A 3MMCB 3CCJS 2P6SA 3PO5A 2BM1A 2QLJB 3IR6B 3QAEA 2CJ9A 1IR1A 1RACB 3NCQA 2J7UA 1VRUA 1ZM2A 2H3EB 3BYRA 2R2RA 4M5MA 5C24B 4DFJA 2RS2A 1LFPA 1APSA 2IYGA 4PXCA 1FRJA 3IFEA 3MCSA 4C6AA 4Q0BB 4RZRA 3MPWA 3M6XA 1BXNA 1WDDA 5DLFA 1YJRA 4YHHJ 5JVHQ 3KLEA 2E9ZA 5H1SV 2W2MP 3THTA 2HFSA 4M5IA 3FSYA 3OW2R 2DR5A 1PBUA 3RBXA 4JI7J 4OFZA 3G4SS 4LFCF 1D8ZA 2NXUA 2GA7A 4EEYA 4ZHRB 3DHWC 3SYZA 2VJVA 3D54A 4M5DA 3HD1A 4J91A 1VK8A 3DN9A 1R8PA 2QLXA 5CYQA 4C8NA 3LW5C 2VQFJ 4DR6J 4IDKA 2BJ1A 1IBMJ 5DS7A 1KLNA 3AOAA 1FERA 2AKWB 4WBFA 4LSLA 2E9RX 5EX0A 4B3MJ 4CO5A 3BS9A 4K4XA 1X9SA 2Z58B 5F8GA 2K1RB 2IA6A 1XEZA 1T94A 2AV5A 3KUHA 2Z57B 3KHLA 2MKKA 2RE1A 1TP7A 4DL4A 2DD8S 3DRYA 4F67A 2DNOA 4WJBA 4MK8A 4C8OA 4AD6A 3CD5A 2R7QA 4I6YA 4TYAA 4ZIVA 1TVRA 2H51B 3PEHA 3NNAA 1CJKA 2GC8A 5DLGA 2MGZA 4LMZA 1QM9A 2AZ3A 3QMQA 1MNEA 3P3DA 2HNDA 4HL9A 4ZPBA 3GG1A 1XR5A 4RW4A 5DGAA 3B4MA 3V4IB 3RAQA 3BGRA 1FWKA 3BKTA 3I5AA 4LRAA 3GQCA 1HQEA 3NWGA 2O3DA 2AYBA 4NLDA 1C1CA 5LXRA 2JJ4D 4TYBA 1UPPA 1KLMA 5D77A 2ZC3A 1IXKA 1LNQA 2FDNA 2XHCA 3HULA 1J5OB 2UUTA 2W8LA 4ZA1A 3U1NA 5D15A 5GAEI 1NK5A 2GO8A 2MB0B 3C46A 4DPXA 3DLGA 3EJMA 1M0SA 3IMQJ 5LXYA 2J5AA 2ZDPA 3SEOA 3ZC4A 2RB7A 1OYEA 3R8YA 4OX9F 4FVCA 2X1FA 4LRDA 1W2BR 4Y3CA 3OTBA 1FA0A 1Q8IA 3KK2B 1ZM9A 1M1GA 2XMVA 4B3SJ 3N28A 5A8KB 2NUUG 4NOHA 2X51A 1GMVA 1D9FA 2HGMA 3MECB 2CFXA 3I96A 1FD8A 1N33J 5DM6Q 1C0UB 3H0PA 2LEBA 2DNMA 1SQGA 4LREA 2N3OA 2UXCJ 1QE1A 2M8DB 1RT6A 1S4FA 3HPOA 3EPIA 1R89A 1N5SA 3KTQA 2MTLA 2L9NA 1MWYA 5KT2A 4MKVA 4JI4J 2G9OA 2DO4A 1S1TB 1AT1B 3Q2TC 2WBMA 2UXDJ 4FP9A 3M2UB 3SCKE 4NYZA 4LBHA 3K5PA 2R7TA 2DNQA 4DV6F 1IKYA 1RBLA 5B0BA 1X9WA 3HHLC 5KFPA 3DLHA 1B0VA 2BOPA 1N6QA 2HEKA 4J9PA 2VBZA 2X1GA 1FRLA 3CDBA 4FS2A 3C6TB 2KO1A 1N0UA 4NRTA 5HLFA 1NM2A 2IRUA 3I31A 2ROEA 2B4UA 1JLFA 2N7CA 1SV5B 4NCGB 4H4MB 2OJ3A 3HHDA 4NXNF 2MHNA 2DNYA 2FJEB 3PZPA 1M90T 3FK4A 5F8JA 1QAXA 4DMZA 5J1EB 4LR7A 4EBEA 2FIUA 1J5EJ 1F3VA 5D0HA 4BC9A 1SC1B 3QWPA 2BQRA 4MFBB 4PRFA 1CPZA 2W2OP 1RP5A 1SUQB 1VDHA 3R3TA 4UOFA 1IR2A 1EARA 2P8IA 1HBUA 2B6AB 3LP1B 1U1MA 3W65A 2IRXA 2F4VJ 3WDOA 1FWLA 1AW0A 4OHZA 5HK4A 4NLTA 4IYQA 3HHLA 4Y2IA 5E3RA 4QZVB 4QCLA 2ZZMA 1DBDA 2W24A 2WOMA 1LWEB 3OFGA 3TANA 1VLOA 2YNGA 5A2QU 3QJPA 4MK7A 5HQMA 3EGNA 1KNZA 2G4BA 7AT1B 4RW7B 1WSVA 3K89A 2F7VA 1WF0A 3CD6S 4NXMF 4CLSA 2JOQA 1SXLA 3C15A 4I2QA 4DFPA 3TARA 1S77D 3IRXB 2ASJA 4ECZA 3A1YG 4RW8B 5LMUF 4K4ZA 4ZVRB 3MWBA 4KR0B 3TJ9A 4OZNA 5HP1B 3E3XA 4X4SA 3NY0A 4B17A 2HS3A 2OTJS 4RUBA 4O3OA 5K8NA 1NAQA 4KO0B 3HI9A 2XS5A 3OVAA 5E33A 1NPKA 4B9MA 3GFXA 1EJ7L 2CPFA 2BZ2A 1H72C 3K5NA 1YSJA 4IRDA 2HGLA 1NJXA 2R2UA 1HYSB 4ED0A 1FXLA 3FJ2A 1NJZA 5IV4A 1B7FA 3OSNA 3R2DJ 3R27A 1T03B 3V5RA 2V6AA 3MM5B 4FF1A 1Q95G 5JXSA 4R0JA 1T3OA 3ET6B 4LF9F 2H4WB 3FEYB 2XS2A 4O4RA 4A8MP 2HQFA 2OPRA 3IGVA 3N0VA 5C25B 1X4EA 1F1BB 1GX5A 3SQGA 3FUYA 1OSDA 3SV3A 2E1MC 1DQ8A 1RYRA 4F36A 2GHWA 3HVAA 3MMCA 4YEAA 1TELA 1S6QB 2FZCB 2XYPB 1HQUB 3KLHB 1D3WA 4JI6F 4L76A 3VAMA 1WEXA 2MQMA 3OTEA 4XPEA 2WVEA 1PAUB 2XI2A 3GCWP 5C24A 4F4ZA 1TKZB 1TL1B 3P96A 1R0BG 3J81Y 3A12A 2C42A 1TL5A 3D67A 2V63A 2UZAA 3HKZD 1F9FA 1DQAA 5KTQA 2QX0A 3QGPA 2GMHA 3ZFVA 2H5IB 3PJXA 1RE1B 2HRTA 2V8GA 4OHVA 5KFGA 2OFHX 3HMJG 2B9WA 3M9MB 2OH2A 2XY5A 1HWLA 1WOOA 2DBBA 1RYSA 3R5JB 4USTA 1KVKA 2VG7B 2LXFA 1KFDA 1U0HA 4FKYA 4ZHRA 3RRKA 1LXNA 4J9OA 3T6JA 1VC5A 1JLAA 2I0XA 1N56A 1LKZA 5E5NA 4ES2A 1REGX 1Y3KA 4FN5A 3ELHA 1RTHB 3AHPA 3C3LA 1FKPA 1NB7A 1HW8A 3HSZA 1KSPA 3GR0A 3BDEA 3F41A 3TP2A 3QGGA 2BYCA 1VQYA 5C5JA 1FVSA 2K1RA 4CWBA 1RAHB 2LEAA 5KT7A 4DL0C 4DLEA 2LU1A 1C1BB 5HVHA 2DR8A 3MHYA 3CIZA 2XM3A 4PABA 3V81B 3MEDB 5HANA 5F3TA 5KFFA 3CDWA 2IM0A 2MLYA 4QIVA 1HNIA 2J6UA 1M5SA 2GJIA 2YKMB 3G8QA 1T9YA 3MPYA 1X7VA 3SSQA 4F4WA 1WORA 1R43A 3V4IA 3EGWB 1REVB 3MAQA 1QDUB 1IBKJ 3OT9A 2ABYA 4ZJQA 2AX0A 5KFJA 1HBOB 1X31C 1DLOB 5CA5A 2MQQA 1WUUA 4OYIA 2CZ4A 1Q5VA 1RB0A 3TVKA 2XBPA 4ELTA 5KG5A 3AH6A 1CJTA 2MKHA 4MK9A 3TUZC 2OEKA 1H98A 1J5OA 2R7OA 2BX6A 4HDGA 5DGBA 3QZ7A 4X4QA 4OIXA 4DV1F 2FJXA 4F2SA 3LOUA 1Q16B 2AZ1A 2RKIB 1XMQF 2QIFA 2HK2A 1RBOB 1JK9B 3G9CA 3L7PA 3BGFA 3HHKA 2VA3A 2FHOB 4ES1A 3CJ2A 2V69A 3MFHA 2CPJA 3GJSB 2ZDOA 5IT4A 3KK2A 4A47A 5K14B 2XGPA 1IKVB 5DG8A 2QMUB 4WYWA 3WBZA 5A8KA 1PBAA 4GVBB 4WTOB 1U6BA 4J5OA 1XTZA 3QJLA 1QTNB 1SH3A 4EMDA 4KFBB 3MFIA 1C0UA 3S1TA 5HMZA 3IO1A 3R5BA 1RKIA 1KOOA 2W4PA 3GE9A 4CLZA 1WF2A 3KLGB 4JI1F 3S6EA 1PO6A 4PUOB 2B7BB 1Y5LB 1L3UA 1HHTP 3DNCA 1UW4A 3OPKA 2KVQE 4JV1A 1HARA 3FCWA 3MPDA 1RTIB 4DCOB 2D9PA 3SCIE 2R9LA 1S1TA 5KFZA 4F8RA 2QYCA 3M2UA 3K17A 4NASA 1LXJA 2KHCA 2R8GA 1E6YB 2VG6B 4MTPA 2VD3A 3NS6A 3EWGA 2POKA 3GJQB 3R9LA 3UDVA 3GFZA 5K20B 2QL9B 3RR8A 4B02A 4CLYA 1FCAA 5KOWA 4HACB 5J1NA 4NRUA 1WD6A 4HT7A 3H5UA 3C6TA 4JUZA 2W9BA 3MCMA 2JNJA 4N7TA 3IM9A 2JH3A 3LALA 2EEYA 2XMJA 1Q86T 2DK2A 5IWAF 1HBNB 2DGVA 4K5RA 1SV5A 4NCGA 4H4MA 1S12A 2CJBA 4Y2MA 2KRRA 3W5YA 1X4GA 4FF3A 1MG7A 3KK3B 4G3IA 1U24A 1VRQC 2J6SA 4JBCA 1U6ZA 5DQHA 2RILA 1RJJA 1S6PB 5H9FJ 4JI2F 1NKCA 1HHSA 5J1EA 2DH7A 2DISA 3CMQA 2CYYA 4C48A 2XMMA 4KT0C 5BYQA 1U1RA 4WU2A 3HK2A 5CD4A 3PRBA 4MFBA 3OFEA 2E66A 4NLPA 3OHAA 1UFWA 1N5YB 3NXZA 1L3TA 1SUQA 1K0TA 3BQ2A 2QE5A 1TFYA 2B6AA 3AJDA 3LP1A 1CJUB 1X5TA 1Y3JA 3THPA 1GXTA 2A1BA 4OX8A 2YVSA 1XNRJ 2NXJA 3L4BC 2VQEJ 1JKHA 4DR1J 2B7CB 2PGCA 2I9SA 4P9SA 1LWEA 3L7UA 3MZIA 3EDRB 2UUCJ 3MTKA 4J9VA 1U1LA 2V0NA 1P1TA 3BSOA 4PPDA 4RW7A 2V8VA 1PC4A 2BW2A 3BO4A 4DSEA 1HR0F 4EBDA 2ZH3A 2R7UA 4NE9C 2Z4PA 3IRXA 3CB4A 2K7KA 4A4JA 1ZOTA 5HP1A 1RCXB 3EGZA 1FFWB 1B3TA 3MR7A 3MUMP 2AP6A 2A6MA 1NDPA 1KDNA 5FLXU 4KO0A 4DOZA 5B7WA 4K7QA 2DY1A 4C98A 2PA8D 1WG5A 3UN5A 2Z2LA 3IM8A 5KG6A 3NEKA 6AT1B 2P9GA 4QBUA 3M6VA 4DX8H 1HYSA 3HXMA 4X4PA 2C2MB 3HKWA 5L8RC 4KHPJ 5GADI 2YX1A 3DRXA 3D5MA 4QR2A 3IN5A 2RMLA 1T03A 2JWNA 2QSFA 1YLXA 3MM5A 3TWZA 3TA1A 4WXOA 3ET6A 1LWCB 2AJFE 4W92B 3GIKA 1U09A 3QAUA 3M6WA 1RKJA 4USMA 2FVCA 2BVZA 4TN2A 5J2PB 5C25A 1O8BA 3ILLA 4LRBA 1VHFA 1BWEA 5E3AA 3RW6A 4UOGA 4NYOA 1N36J 5L1IA 1GT8A 1SC3B 4DQPA 4CZCA 1S6QA 3Q8SB 2KRBA 1HQUA 3KLHA 2OPQB 4NMLA 2PN6A 4Z37A 4F4KA 4QW8A 3DDNA 2BJ3A 2KXHA 3UN2A 2IJRA 1YRTA 1TZ0A 2HQDA 2DR6A 4R0EA 1D0EA 1TKZA 1TL1A 2RS8A 2C1EB 1DY3A 4JI0F 3CCVS 3PFEA 1S72S 4OYWA 1X4DA 2DYAA 2EWHA 2YQ0A 5GMEA 3UD5A 1X9MA 3QWUA 1NB2A 3PEJA 3W1YC 4DF4A 3QO9B 2PE8A 2DNPA 1J27A 2VG7A 2IJNA 4O3PA 4WFBQ 5M2RA 3TAMB 4U8VA 3MOJB 4K2JA 5F3ZA 4FXDA 1K1QA 5KFVA 3EICA 1MWQA 2DNRA 1KQSR 5HN0A 4J37A 3OR1B 1UJ4A 3OVSA 4IG0A 3K7RA 2WB4A 4ANCA 2DT9A 3GLJA 3HSGA 4DX7A 1ELOA 3EVMA 4ER8A 2YKAA 3WX8A 1RT3B 1S49A 2BA9A 2R7SA 3F44A 1RTHA 4DUZJ 5B0AA 1RDRA 5LOQA 4CO4A 2HLUA 1L3SA 2CWKA 2F3JA 3GG0A 3OL7A 1Y00A 2KFZA 2V2KA 5LT5A 1ZAVA 2MY7A 2QG9B 3H4BA 1C1BA 3KKFA 3DXBA 3HHLD 1C4AA 2KYZA 2HAIA 3V81A 4N41A 2JC0A 5L38A 3MEDA 4G1QB 2D9OA 5EX3A 1MROA 2EBGA 3BB5A 3CDEA 2AYMA 4JB8B 3L95X 3I5BA 4DHVA 4ZJOA 4DPYA 4ED4A 2WRMA 4DR7F 1RZMA 2IMWP 2YKMA 2OUGA 2XWXA 2VQFF 1U49A 1R8AA 4NA3A 4DR6F 2HS0A 4XDDA 1IBMF 2UVRA 4ETXA 1WKJA 1DLOA 3FBFA 3EZ5A 4B3MF 1FXRA 4WWSA 1RTZA 4TY8B 3Q86A 2VODA 1EETB 2WSEC 1XQIA 2P9CA 4X4UA 2VFVA 1XERA 2AGOA 1FJGJ 2DIVA 1JJ4A 1A7GE 3D2WA 1KFSA 1KONA 3JQMA 2V5HG 1TFWA 2XLJA 2GGPB 4WFXA 2OEJA 3HFVA 4QU7A 4F4YA 2ZE2B 4KYZA 4N8OA 4OHYA 3NS7B 1IBLJ 4RNNA 1IKWB 2O5DA 1U47A 4KB7A 2DRDA 1B99A 1A9NB 3FQKA 2QN6B 4P75A 1NHKL 5GAGI 4KC5A 3D6TB 4OQJA 5K14A 5AE1A 5I42A 1IKVA 2VICA 1UKUA 1PSDA 2CPYA 3CDAA 3CE8A 2HQCA 3CO9A 1KS2A 3CXCR 2DO0A 3HF5A 4WXWA 5KFQA 4J9UE 5HI7A 3V6HA 3CULA 2OMOA 1TK8A 4GVBA 2VHGA 1FO1A 1F60B 4KFBA 1DURA 1EP4B 1RTJB 4Y0FA 3VALA 3K5OA 4G6VB 4IR9A 2AYGA 2YXLA 1QUPA 2ZD1B 4HI2A 3BH7B 4ZP7A 4F4AA 2JL9A 2ZKUA 3TW0A 1FI4A 2PC6A 3O8WA 3DGPB 3CSKA 2C2DA 5KFWA 3UDEA 2ZUAA 4A8KA 4G1IA 3U1MA 3S8SA 4ED8A 3DKDA 4P72A 4XPCA 3H25A 2XMTA 4PZVA 5FD1A 1I51B 1U02A 2BRKA 2EG1A 2MHEA 3NCPA 1XMBA 1S7HA 1TK5A 2HHQA 1E6YA 2VG6A 1UPMB 3WZ0A 4QOTA 4DR2J 1S0MA 4C9DA 4LR8A 5E2QA 2GJFA 4F3QA 1N33F 2QC3A 1S97A 3MD3A 2N4DA 1RLDA 4QWDA 4HACA 5T41A 4C0HA 2X1AA 3RB3A 2OI2A 2ZVIA 2ATLA 4JP8A 1FX4A 4KQZA 4NCAA 4ED5A 2B9XA 1T9TA 3W2WB 4YDXA 5HJXA 1SIZA 1OPZA 2F8HA 1BC6A 4AUKA 2AT1B 3KHRA 3I82A 5D3GA 4O0NA 3KK3A 3PRDA 2XO6A 5BR8J 2YY3A 1S6PA 3R5DA 5AXNA 2Q79A 3DRRB 4RW9B 2ZH4A 4LF7F 2MQPA 1C0TB 4USKA 1NSPA 5HL7Q 3AODA 3EXYA 3MR5A 3TZZA 1XN9A 2A3JA 2D3UA 3DGVA 1N5YA 1WI8A 2J7KA 3M8RA 3GV5B 3T1HJ 5KFOA 5KG2A 3OTOJ 2XLKA 4PWUA 1CJUA 1RA6A 5L9XA 2IC3B 3MPUB 4JOUA 2BXJA 2BACA 4QWEA 3W7BA 5CABA 5KT5A 2R8KA 4YY3F 3K57A 2CQ0A 4ZOSA 2W1BA 4DBQA 1KHWA 5IT0A 2OPSB 4O3QA 1OY9A 2HNYB 4ID8A 1ZBTA 2CPEA 3W9IA 2J6TA 4DR3F 1VFJA 2ZOGA 5M2PA 3H42A 2QA1A 2LECA 2HBQB 1PILA 4A8XA 1U0SA 5KFNA 2MKCA 2JLFA 1RADB 2CQ3A 3JXOA 4MIAA 1Y10A 2DHAA 5EUHA 3DOMB 3ILIA 4KSEB 2F4VF 2R2TA 4OV1A 1PC5A 4C7QA 5HJYA 3W64A 4HT5A 2HVZA 2Z2ZA 1U2FA 4R25A 2B43A 4LF4F 2XTJP 3VAGA 3P6YC 3VQTA 1R31A 2DHSA 2FJDB 4GKKF 2IDLA 1Q0NA 2DIUA 2DTJA 3C19A 2KG0A 1LWCA 3ONQA 3KHHA 2M88A 4J9RA 3QFWA 2BEFA 5AE2A 1RQ0A 1S79A 5J2PA 4UQGA 2IM2A 5DETA 5DDOC 4BDPA 3VVUA 4NI2A 2QLWA 3T9ZA 1FNOA 4JYAJ 2RIJA 3V6DB 1NZAA 1WF1A 3G86A 4RUHA 4EK2A 1UL3A 3NOCA 1GNKA 4F3MA 2KZZA 2CPDA 5BYRA 2OPQA 1WNEA 2WW8A 2JZ5A 2J9DE 2AQ4A 3NL0A 1TQLA 1GFWB 2B56A 4ZN1A 1RAIB 4CO1A 1ZS6A 2NUHA 2FHJA 3U02A 1E6VB 1U45A 3QT6A 2FLNA 5SZTA 4ECVA 3TO8A 4CI0B 4KKOB 4LF6F 4ZVGA 4NLQA 4EYHB 3MMAB 3HDSA 2WONB 1C2PA 2MZQA 5DQIA 3ZNUA 4FYDA 5GAEU 3MCOA 5J1PA 4LRCA 4EFAC 4WTYA 2ILYA 2G2ZA 2C3OA 3X3UA 1U1OA 3QO9A 4NX9A 3QBCA 5CYJA 1QSSA 1IM6A 3D6HB 3MDFA 5L1LA 3TAMA 1JNZB 2JFKA 3A3OB 2CQBA 5AXLA 3S01A 4QR0A 4ECQA 1Q81T 3D1QA 1TUVA 3OR1A 3P8BB 3GIIA 2MKSA 1X0PA 5AJ3J 4YR3A 4ZCLA 1O0PA 1UZHA 2VUGA 1CBKA 1LW0A 4CLPA 2FGOA 4ATNA 2KFYA 4F0MA 4XIUA 2MJUA 1A0OB 1RT3A 3PCOB 5F9LA 4LF5J 4S0MA 1HQ2A 1NJYA 3H20A 3DCAA 3JTOA 3RW7A 3KLVA 1FRIA 4UUXA 4CH1A 4QIEA 2OP5A 1RISA 2RHSB 2XLIA 1NKBA 4Q2MA 2W2QP 2PT0A 4DXLA 2C3UA 1IWAA 4CNYA 1YJ9S 5HO4A 4X65F 3OV7A 2PFFB 2IJFA 1RUSA 1VRTB 2E7WA 5IFMA 2BMBA 3TVYA 2XWYA 2GJ2A 3I55S 4OI1A 3CJ4A 5IV3A 1L3VA 2ZBCA 1MMNA 1P9YA 1QAJA 3HVTB 2VG5B 1W7WA 1RA7A 3J7YI 1URRA 3AJ2A 1X5SA 4L74A 1UVKA 1IVZA 4O44A 1HL6A 2EXUA 3VAIA 3UNGC 4MJKA 2G2OA 4J9SA 2BKNA 4MKAA 1VQKS 1FDBA 3MCNA 1Y0HA 3VHQA 4KJIA 2FJWA 1EETA 2WW4A 3J7A1 3GSDA 3KJNB 4UOHA 3T3FA 2VFUA 2MYFA 3Q22A 1B0PA 3VZIA 4G65A 4F4XA 1ZTTA 3VQSA 3GB0A 1N48A 2PIIA 2GGPA 2WCXA 1AYEA 4AXIA 5B0FA 2ZE2A 3BR8A 5A2QY 1R8CA 5GMDA 1VJWA 2UUBJ 1IKWA 3L09A 4TU8A 4IH6A 4E98A 2R7VA 1SKUB 3T5KA 3BPSP 2HVEA 4ZVHA 2OMLA 4PAAA 2C2OB 3KDOA 2JVOA 4Q5VA 1AA1B 4BWMA 2PMZD 2ZH6A 2IRYA 1LV5A 4ZP9A 3EX7B 2QL5B 4W4MA 5B0DA 3UI3A 2I8EA 2KI2A 2XMKA 3DFEA 4F02A 5ITHA 1EP4A 4ZVEA 1RTJA 4DV3F 3NBPB 3FSXA 4RKUC 2ZD1A 2B9EA 4USWA 2G0JA 2J76E 2KXNB 4DV4F 3DGPA 1KHVA 4YDDB 4EYIB 4PKDB 1JXLA 1YJTA 3JSBA 4OV6A 1T9XA 4P71A 1NCLA 3R6LB 3UD3P 1R0AB 3VV2B 1WSRA 1RSCA 4JI5J 3TUIC 3M8ZA 1T7PA 5B0GA 5ETVA 3OL9A 1FFSB 3PW2A 4JI3J 3LGNA 2MEWA 2F63A 3DOLB 4F26A 2GQCA 3GTYX 4OX6A 4FKXA 3CCLS 1I1GA 2HMIB 5BJRA 3CO0P 2P6TA 4FS1A 4ZVFA 2QT7A 1SH0A 3UVJB 2ZVSA 3ZNJ1 3HO1A 3D9BA 1I94J 2KH9A 2Y8WA 2E1PA 1NZ8A 1EX8A 2YNHB 1PAEX 3W2WA 3UCZP 4ZN3A 4DR4J 3VGUA 2VOPA 1RT2B 2KTQA 1UVMA 3P49B 1S0NA 1MMDA 4GKJJ 3HM9A 4IO9Q 2MLXA 4OJGA 2XMUA 1JXEA 3JSYA 3ISNC 4ZDNA 3DRRA 4RW9A 1S10A 2HHHJ 2CUYA 2MZJA 1C0TA 5J2MB 1VISA 2XYHB 1UEKA 4CO3A 2J0SD 4Q7AA 1M1KT 1U26A 4JV2A 2D3OR 1G1XA 1JJHA 3M7VA 1RBAA 4URQU 3AB4B 1P9QC 4IQXA 4DLGA 2C2NA 5K8OA 3VR1A 5I3UA 4HHHA 1Q53A 4HTJA 2FC9A 4K0KJ 2IC3A 1SJ4P 4PYDA 3UDLA 1IBCB 1PJ6A 3VZHA 1HMVB 2V2ZA 2DGWA 3LGHA 2FVSA 2HZVA 5HMWA 2BANB 3VGSA 5LM7E 4NLUA 4C8LA 1OY6A 3DU5A 2J9EA 2V4JB 2OPSA 2HNYA 1F9EB 4OYOA 4KGMA 3BSCA 4B3OB 2CQGA 1NSAA 4YMEA 4Y28C 4LBIA 4FPRA 2W4CA 3C6UB 1F5CA 3R97A 4WU3A 3JS9A 4DU8A 2Y1IA 3EXCX 2VFTA 3OTDA 4DV5J 5DZ7A 1HA1A 1FD2A 4CCHA 3H5SA 5D4OA 3FVYA 3G82B 4DS4A 4I1TA 4P52A 5IC6B 1VS3A 4CT9A 1TR0A 1YWXA 2B8PA 4QIWD 3GYGA 1XJWB 2CWXA 2CQ2A 2DVIA 3BF4A 5KAKA 4AL5A 3Q24A 1NPPA 2ZH7A 1BQXA 2BUNA 4ECUA 3FEXB 3PKYA 2FGCA 1DJ0A 3EVOA 3HLUA 3UR3C 2DCUB 3JTPA 4USVA 2XZDB 5RUBA 1F9HA 1VQLS 2KHDA 2A18A 3HCXA 3PR4A 1SCJB 4ZP8A 2VV5A 2CQHA 2DCLA 4FPIA 2YQ1A 5AXKA 1Q4RA 1DTTB 2YWHA 1GX6A 2ASYA 4ED1A 4KY3A 5KFKA 4RU2A 4Y2CA 3I0RB 3RJMB 2MMYA 2KDOA 3VAKA 4F2RA 2JX2A 2LFVA 4I2PB 2DRBA 5KG3A 3NRBA 4L3KA 4IOCQ 1S0OA 4WCEQ 4TLRA 1E6VA 1N34F 5ADZA 1ZAXA 2E1AA 2AJ4A 4Q44A 4KKOA 3O3LA 4USHA 2MY8A 4AYBD 5H9FK 3MMAA 2G1DA 4UUWA 3RU0A 2WONA 1XC9A 3GYXB 2YNFB 1DFDA 5G4DA 1H38A 1N5VA 2EC0A 2LLZA 3AA8A 2YWEA 4H4OB 5BXIA 3GCXP 3E8OA 5KFMA 3NS5A 4R8UA 1AUSL 1S9EB 5KG0A 3OTCA 4RX6A 3RRHA 1MW7A 4IH7A 4DG1A 2FVPA 1QTMA 1HKAA 5KFIA 3GONA 1GAOA 3KK1B 3JAMY 1XBWA 1CC8A 3CF5Q 4CLTA 2CZ9A 1FDAA 2DNLA 2DHHA 4WZQA 3AOBA 1IUJA 2GAHC 1HWKA 2VPYB 4HR2A 3GMGA 2HHTA 4OZ1A 2JRSA 2MQ8A 3H2UB 2HYIB 3DMJB 2CPIA 2B9YA 1NH8A 4WKYA 2HBRB 3LWLA 1JJ2R 3CIMA 1HW9A 4HH0A 2EW9A 3G6XA 3DYAB 3FQLA 3ADAC 1X4CA 4PXDA 1VRTA 3TZYA 1FRKA 4ECTA 1U48A 3CWJA 3QJJA 1QLNA 3IC1A 3QIPB 4J9LA 1KN6A 3BSAA 1IR0A 3D1HA 4DL7A 2GQQA 1V6HA 2ACYA 3QNWB 3GYNA 1TK0A 4KGZB 4OLPA 2VG5A 3R2CJ 1KQGB 3TOQA 2DH8A 4I4BA 5J2QB 1GH8A 4N47A 4DUZF 2ASLA 2FTRA 2HVIA 1YJNS 4DV2J 1UVIA 2V9KA 3ITHB 2GQ2A 4QJVA 1QVGR 3UWTA 4WK1A 1DQ9A 3TQEA 2RDDA 5EGYA 2DRAA 1TKXB 2V4QA 2NREA 2XEXA 2D7SA 2XY6A 4RUCA 4TNOA 1ZPWX 3C16B 2NYHA 4V19X 1NNDA 2IDEA 2PFDA 3CCZA 3HFZB 1YBUA 3RUBL 2PDAA 4GC6A 3VGTA 4DPWA 2R7WA 2CADA 2KB2A 4D3HA 3LTOA 4C8MA 4EUVA 2XCAA 1CJVA 1UVNA 1K1SA 2QYGA 4DFMA 4ZVOB 4IR1A 4ID5B 5DM7Q 8ATCB 4X66J 1Q8KA 3BBCA 1WC4A 5F0WA 1M1HA 1DAXA 2LXUA 4L73A 3MM6B 2FHKA 2GIFA 2V68A 4URGA 4GVLA 1S1XB 1KRPA 3K58A 4OYZA 3UNYA 1V3ZA 5F8LA 3NBPA 2B4PA 3WX4A 1LK7A 2ZNYA 3LAKA 2YNIB 1YQHA 1V3RA 2FHJD 3QIDA 1RT7B 5ETSA 4DL6A 3N6MA 5HVGA 1H74A 2HFVA 4JV5F 1TU0B 5E7OB 5KFRA 3CJRA 1ZA2B 2CJQA 1RCOB 1R0AA 3ZZUA 1RWUA 3ZZRA 2RT3A 2V67A 3UDCA 3VVTA 4NMXA 3J80U 3GFHA 4JI8F 5KFHA 2ZM6J 2OEMA 2F40A 4PEOA 3DOLA 3E2EA 2EFNA 2IVMA 2HMIA 2BJ7A 3A3PB 4NZ7A 3QZ8A 3THVA 2C28A 2XCPA 1D8YA 3QT7A 4ECWA 1KOHA 3H5YA 4LF8J 2NXCA 4HHUA 2CNNB 2M3DA 3UVJA 2ASDA 2WVCA 5C42A 2NR0A 2NQPA 3MAAB 3M6UA 2YNHA 3P4UB 3F0NA 2XG8A 3KNGA 1RT2A 2AJ2A 3D7SB 1YJUA 3HHEA 2C2ZB 3KJFB 5ETMA 2QV6A 2J0QD 4PQUB 2WK4A 1XNQF 1PCAA 2W7AA 1SJFA 2HFNA 3G8TA 2ZWOA 3K0JA 4DF8A 2I2YA 4OZ0A 3HZEA 1S1VB 1Q78A 2HAFA 5J2MA 1HNWF 3BO2A 4DR2F 5SUHA 3H2LA 1FRHA 1S5ZA 1UTAA 4YR0A 2YWWA 1Q7LB 4QYRA 2IM3A 4UZCA 4Y65A 3C14B 3SMZA 1MN9A 2RH3A 1N52B 1NJIT 4MYUA 4PWDB 2WSFC 2ZH9A 1TL4A 3G96A 4NXMJ 1GXLA 4NA2A 2BANA 1LOUA 3PO4A 3I0SB 3U27A 5LMUJ 3PVXA 2V4JA 2AMCB 4M8LA 4C97A 4XO0A 4B3OA 2HHVA 2K7JA 3AQOA 3MR6A 3MEEB 3M8WA 5IT9U 2VONA 3MPVA 1YK9A 4K4VA 2KJWA 1UJ6A 3DDKA 3TUJC 4DSIA 3IA0A 5IQ6A 2CRLA 2B3TB 2RUGA 2R8HA 2AF6A 3OTOF 2IIHA 2ZC4A 1UWBB 2H5JB 1KTVA 1S4EA 4ZP6A 3TAQA 2NZCA 4OZ2A 2EKYA 2KT3A 3G82A 1ACMB 2M7SA 2MQNA 2MQLA 2QMXA 3T5LA 3N79A 2LDYA 1AUDA 3I56S 2DITA 4LF9J 1OPIA 3RB4A 2AX1A 3T9NA 2Y8YA 1H2TZ 5HMXA 2LDIA 1FJ7A 1HBMA 4FZVA 2WBRA 2DR9A 5HMYA 4I6WA 1NHUA 2MQOA 4ED6A 4X4VA 1DTTA 4I7FB 4JI6J 3QATA 2U2FA 4DUYF 3GWCA 3SIPB 3PACA 4KRWA 2VASA 3M8SA 5KFXA 3I0RA 2F65A 5I3PA 3NAIA 2FJVA 2FY8A 3EZUA 4I2PA 4ITSA 3FCHA 2CA9A 4DSLA 2OSQA 3S7RA 4QPTA 5ETQA 3HT0A 2YKOA 2DNNA 2NSCA 3PW5A 2HIQA 4URSA 1SKWA 3M1VB 2OAUA 1VJQA 1NEEA 2YNFA 2UP1A 1NK9A 3CCSS 4UT4A 1CSJA 2R42A 3PYGA 2BJEA 1IKXB 3N5BA 2MKJA 4JYAF 4RW6B 2M8HA 1S9EA 1P1LA 4B3TJ 2PEHA 4OI2A 2ZHAA 3VTIA 1WOPA 3NMRA 2KM8C 2Q43A 3CCUS 2JFDA 3KK1A 1O5JA 1JWWA 3BGUA 2E5HA 2JSXA 3LO3A 2CZVC 1KEKA 1LWXA 3DM2B 2E5LF 1RABB 2DPJA 1N32J 3D6MB 3DMJA 2EFVA 3MD1A 2WVFA 3FZBA 4RBVA 3CJ0A 1RWVB 2RQ4A 3IBFB 3Q8RB 3T1YJ 4F04B 5EHHA 1T9VA 1FEHA 3DYAA 1HNZJ 1WC3A 1WELA 3K5LA 3MXHP 1G3OA 2W8KA 3QIPA 1B7YB 1TKTB 2WVBA 1DTQB 2QLBB 2N4CA 2DHGA 3M8YA 5IS2A 1H2VZ 3H98A 5AJ3F 5CYMA 2M4MA 2X3DA 5DO2A 2I5JA 2ZFHA 1TL3B 3C8YA 4CIOA 2B51A 4KHMA 5IM0B 4K59A 1B64A 1RAJA 2CAJA 2OFGX 1UWAA 1UFLA 5I3QA 3NG8A 3SFGA 3JQKA 3ITHA 1JXVA 1U2CA 2MZ1A 4XDCA 3ZZOA 1WG1A 2GAGC 2J8SA 3ENAA 2CDRB 2CDQA 2GV1A 3ISND 1TKXA 2A6OA 5F8HA 3AOCA 3IRWP 2XZWA 2E5JA 2E29A 2JLGA 3C16A 4RBUA 3AJ1A 5C2GA 1RU1A 4TU9A 4LF2A 3KUEA 2RU9A 4QW9A 1PJ5A 2GW8A 5KFLA 2VBXA 1GXUA 4IG3B 3UO0A 4Y6IA 1HWJA 1DZ5A 2ZHOA 4EBCA 1WHYA 3IGNA 2DNGA 4ID5A 3O1LA 2KG1A 2HHPA 4IRKA 4Q0BA 2WHOA 4FYVB 3PYEA 1T8EA 1UA1A 2ZBIA 2IAJB 3M9OB 4ZKAA 5GAHI 3MM6A 4K4WA 4B3RJ 3O5TB 2EFQA 3K2YA 3BKUA 1U1QA 5D6GA 1S1XA 1LK5A 1YG0A 1I6JA 3SI8A 4MIBA 2E1RA 3FRYA 2DJWA 4WFZA 2ZKTA 4B08A 2DXDA 3GFYA 4EWTA 4YUDA 3IAS9 2YNIA 4DPTA 2R2SA 4QWBA 1Z2ZA 5DDQC 1RWOB 1RT7A 3UW1A 2Y0SD 4OI4A 2HFZA 2NYIA 3QSYB 3CC7S 2LYVA 2YQ3A 2UUBF 2AJ0A 4QU6A 2C3MA 3J7AN 1VK3A 1RGVA 4WP8A 3NNHA 3PDNA 4WFNQ 4P7TA 4K4YA 1Y5IB 2Z2YB 4DDFA 5B0CA 3M2RB 3BN7A 2OSRA 1YI2S 5EN1A 1RT1B 1M5VC 9ATCB 1D9DA 2E7VA 3DRSB 4J90A 4DL5A 2VDHA 2YWFA 3PHTA 1QE1B 5JMNA 1XMOF 4C3MA 3W8PA 3ZZTA 5IZHA 3N01A 2JDJA 5IWAJ 2RHQB 1ZM4A 4U96A 2VPWB 1ZZFA 4WP3A 1CQNA 2G1HA 2DH9A 3TZWA 8RUCA 3O2IA 4DV0F 2ALZA 2GIQA 1FF2A 3CJKB 3MAAA 2FLLA 1N0VC 4F25A 3W60A 3C2PA 1CEZA 2KZMA 2B8QA 4JI2J 5JUMA 1CG2A 4A8FA 3B54A 5DZ6A 4PQUA 4U6PA 2ZJQQ 2E1CA 1N6QB 1OMSA 2GIRA 1NUEA 2YKQA 4FYXB 1YITS 1VQSA 1R8BA 4ZPAA 3HSJA 3Q23A 3R7BB 1S1VA 3Q2SC 3VAHA 3P5TL 4E0DA 2VBYA 3M4XA 1F6TA 3NCRA 2Z0GA 5KFSA 4LUBA 2VB6A 3OQ2A 1URNA 5L1JA 4OYXA 1OS5A 4YQWA 4FNIA 1JX4A 4IH5A 3C14A 2DGTA 4DSJA 3HJVA 2RAQA 4PWDA 5K5MA 4ECRA 2ZH5A 3D1OA 4RO0A 1Q82T 1HR0J 1UA0A 1A6LA 2MZSA 2M2BA 3IWLA 4HKQA 2PD1A 4TKTA 5DJBA 2HHHF 1K73T 1HBUB 3B78A 1D09B 1FKOB 3MEEA 4ZPDA 3MECA 4ECSA 5FJ4A 4U7CA 1F5AA 2U1AA 3J7Z5 4KH1B 2LA6A 1U8SA 5K8PA 4KIAA 4L75A 4OYMA 2ROGA 2BBEA 3Q8VA 3BREA 4X4TA 1YRUA 3BQ0A 1H3DA 2O1PA 1RWNB 4A48A 2HKEA 4YS2A 3GV7B 4RNOA 1BE4A 3BKFA 4PG4A 4ZPTR 2OD6A 3KJQB 4WP9A 1Q8LA 1PGZA 4RNFA 2Z2MA 3H7HB 1EIYB 2PI5A 3HD2A 2O01C 2FQQB 1SJRA 1BD6A 5CCMA 2RD5C 3M9NB 3PJ9A 1YDLA 1UZDA 4ZS6A 1EKSA 2MXYA 4I7FA 1N5TA 1X0FA 3GP9A 1FESA 4TQSA 1JB0C 1LWFB 4CQ1A 1NSQA 2A0FB 3J7YU 2XSJB 4B9TA 3T6BA 4DZ6A 4H4KA 3D0GE 2CPHA 1OWXA 1NK7A 2CNKB 3TA2A 2HRUA 3ZTPA 4PG6A 2G2YA 1NLKL 2G0CA 4QIGA 4ERDA 4JI0J 1WEYA 1HD1A 1HWUA 3LUYA 5CZXA 3TQ1A 3DLJA 2KYXA 3BPDA 1NK0A 2UXBF 1JNRB 1XR7A 4J9MA 2QA4S 4XAKA 1H6KX 1ZETA 3KDNA 4HHJA 4B9SA 2D69A 1AXQA 4DUTA 4TVAB 4U9RA 4AE5A 3GILA 3HSDA 3PW7A 2CNOB 2QO3A 3DHXA 4J7CA 3CC4S 2EG2A 1GTHA 1V5IB 3B6BA 3M1VA 3RG6A 3MM9B 1MSWD 3AXKA 1ZA1B 4DQIA 4C3LA 1S7IA 3AA9A 1IKXA 3UCGA 2DHXA 3WIUA 4RW6A 3A4TA 1P8GA 4EZ9A 1S6UA 1NK6A 4LT6A 6FD1A 4LQ9A 4CLLA 1Q1KA 1AZSB 2QZ8A 2GZOA 2IMOA 2O67A 3TEGA 1RAGB 2W7OA 4DWIA 5LMNF 2E5GA 1R0CB 2XSFA 2CJXB 1MLAA 3MMBB 1VQ6S 2EFOA 3IG1B 3EDQB 5M2UA 3CD7A 4ICLB 4C8KA 4RU9A 4OZ5A 1HI8A 4M94A 1HPZB 3T1AA 3DM2A 1RWWB 2WVDA 2C2KB 1NO8A 2V8HA 3MF5A 4PXBA 1KTQA 1GEHA 1KVIA 2BR0A 4DQRA 1WC0A 4A8YA 4CLWA 4RL1A 1S99A 4RW8A 1M5PC 1AB8A 5T14A 2V94A 1U0HB 4QWAA 2GFFA 2AEJA 4CH7A 2EVZA 1JLAB 5AT1B 4OZJA 1TKTA 2Y1LB 2V34A 2HS4A 4N56A 1DTQA 1OJ4A 3US5A 1PYTA 4DR7J 1ZAWA 1R6VA 1NJWA 1FKPB 2CG8A 4V19J 1TL3A 3NLCA 2OPPB 2EFPA 3QRQA 3K5MA 4RNHA 3DC2A 4WF9Q 3T19A 5IM0A 5DRKA 1EQ0A 5A8RB 1KQKA 2BW7A 2MSSA 1S9FA 3J81j 3NKYA 1SC6A 2AWZA 3JQJA 1RK8A 3GR1A 5E0OA 2RQMA 3K8WA 2KKHA 4P6QA 2L9DA 3OUYB 3OR2B 4HDHA 4MKYA 2YH1A 1K9MT 2Y0BB 3VAFA 1HNIB 2ACMA 2EFGA 5A8WB 2LXIA 4DFKA 3WIVA 1CLFA 2MPUA 4C11B 3GPAA 2LKZA 3BJYA 4OYBA 4ENOA 3SQOP 2I38A 4ZLPA 1WTBA 1OO0B 1QAYA 3JYTB 2D3ZA 4IG3A 3M2VB 3FMWA 5GVQA 1GQEA 3LQVA 1NKEA 2P2CB 3E51A 4ANDA 1CJTB 4DV2F 4OX7A 2M5YA 4YB6A 4HLBA 3SFUA 2IAJA 1R7IA 1T02A 2GVDB 4FXVA 3M30B 2FUG9 3MUVP 2D1CA 1CVJA 4EGLA 4DS5A 2ADCA 1QVFR 3A8KA 3RAMA 1WG4A 4BC7A 1GMWA 3LH2S 4KTQA 1RHUB 1UMJA 1M5HA 4LBPA 3M32B 5KFCA 4CTAB 5A6WA 2DY9A 4O3RA 2H1YA 4O3SA 3QFHA 4U7UD 5G0RB 1PKUA 2V9WA 1NSKL 5HROB 2OTLS 1XR6A 4ED2A 2ILZA 2QL7B 3PHEA 2W9CB 5F8IA 2W2PP 4CO0A 3GV8B 3GU0A 2ZITA 2UUAJ 4X66F 4YHHF 3M2RA 1RT1A 1L5UA 4WE1B 1T95A 1P6TA 2ZOFA 1Q5YA 3DRSA 3N5FA 2K2PA 2F9DA 1HIYA 2QLFB 1SQEA 4JI7F 2ZNZA 1TUWA 2OELA 2HHUA 2X7IA 2HPUA 1WC1A 3DLLQ 1QAIA 2I1RA 1S59A 3GZ7A 4F7VA 1LW2B 2NXEA 4DCPB 4DL2A 4N76A 3HZGA 3CJKA 2ZH1A 4Q8EA 2AEFA 2VBWA 5ETTA 4C2MA 4K4UA 1RXOB 1YGYA 4Z7CA 3E01B 4LF7J 3QYYA 2XC9A 1YJ7A 1REVA 3PNIA 1VQ4S 1HBOA 4P2SA 3AB2B 2ZM6F 2W9BB 4K5SA 2HWTA 2F5GA 3R6GB 2WTFA 3CJTA 2R8IA 4LF8F 1UEVA 3KG0A 1YRXA 3R1LA 3W61A 3BBFA 3OL6A 2CJYB 1RTDB 1X8DA 4AL7A 3OBIA 4YY3J 1HNXJ 2RKIA 1VBZA 1VQ9S 2W4DA 2XMAA 1DRZA 3VGVA 4R5PB 4HEA9 2K06A 2AU0A 1PJ7A 3A3NB 4DR3J 2LQJA 4U8YA 3H8YA 3CUNA 3TVZA 5JVGQ 1YZ7A 1WACA 3ZTSA 2LQBA 3CCTA 1FJCA 5THWA 2MJNA 2FVQA 3MGJA 2UU9J 4QYZJ 3I4HX 3ILOA 3KNAA 4DX6A 4Q43A 1BGXT 3NAHA 1FKOA 2O66A 4LIWA 4OZLA 2DGXA 5J2NB 4F3OA 2AEMA 2VFRA 2FY1A 1SJ1A 5IQQA 3NNCA 3Q8YA 1JKHB 4KGKA 4MH8A 3TI0A 2L3MA 4IFVB 3KLGA 3N4WA 4LF4J 1HFEL 4DPUA 2Q1LA 4PUOA 3OXFA 3CJSA 3H4DA 3OJUA 2CQ4A 3CMES 4GKKJ 3ICLA 4I6AA 1S9GB 2RNEA 4PG8A 3OFFA 1T9UA 4KGVB 1RTIA 3QT8A 3AQPA 3G87A 2RRNA 1N8RT 5L1KA 2DNKA 2PMWA 2DKOB 4P2XA 1UW9A 3D28A 1H2UX 3VAJA 5K8MA 4OHXA 4B3SF 3RRGA 4ZLNA 1TL7B 2KVIA 4E2FB 4USIA 3A8EA 1T0TV 1Y9OA 5HVFA 3CDUA 3QGHA 3BR9A 4DR5J 5ETKA 1LWFA 3NP5A 2BV3A 3Q83A 4M5HA 2XSJA 2UXCF 3WQPA 1W25A 1VQNS 4DSKA 3W62A 1TV6B 1W2IA 4LF6J 1HBNA 4A8WA 3HT3A 4JI4F 2R3VA 2KJVA 1KQFB 4ILRA 2HBZB 2XNQA 2LCWA 2UXDF 4LVNP 2VIHA 4BS2A 4AXJA 3JTNA 3R7SB 3IS9B 3L9ZA 5KG7A 3PX4A 1WC5A 2QEXS 3MM9A 2PA3A 1SPBP 4D3GA 3R5AA 3R1HA 2AGPA 2ZBPA 1V3SA 1VIXA 2OO4A 1Q7YT 2N3LA 2HQGA 3BBBA 1K8AT 4L6V3 4DI6A 1AZSA 4OMFG 3SBMA 3MMBA 3QSIA 2VC1A 1ZH5A 4M5NA 3IG1A 3J80Y 4ICLA 3CMAS 3ZTOA 5IXUA 3J7ZT 3W3SA 4TQRA 2AJ1A 2CIMA 1OQ6A 1HPZA 3I5CA 5CD4H 3W66A 2H4YB 5LL6d 4X65J 2Y9HA 1S1WB 4KPYA 3FC9A 3V6KA 2MKIA 1RU2A 1J5EF 3KJVB 4YFUA 3FCVA 5F0UA 3AT1B 2JEIA 4WKRA 3OVBA 3TX0A 2MZRA 4IUFA 4UY85 4ZCMA 3M05A 4CLFA 3OXLA 3PR5B 1Q8BA 4IG0B 3NGUA 1FDDA 1RWXB 2UVVA 3U1LA 2MKYA 4ILLA 1VGYA 1VCTA 1UP1A 1N88A 3DI6B 1FTRA 5H9EJ 4B3TF 4WIQA 3MTJA 3EGVA 2HHSA 1JLEB 3U7JA 3DRPB 1ULRA 2ZJRQ 5AXMA 2OPPA 4NLOA 3FRZA 3CCMS 3MURP 2EBEA 4OJHA 2WZ1A 4PR6A 1N32F 3RR7A 2Q6BA 3KFWX 2E7XA 5A8RA 1TKDA 1F0XA 4MMOA 3MR3A 4IOBA 2C22A 4KBIA 4GO5X 2CQIA 4I68A 4NWBA 3T1YF 2V2QA 4H54A 1T9WA 1EHWA 3ETOA 3ULHA 1HNZF 3RTVA 4WK3A 3OUYA 3OR2A 3IR5B 1MROB 3F73A 1I5OB 3MM7B 1V9OA 5A8WA 2HHXA 3IBWA 2DEIA 2FPHX 2GCFA 2M52A 4C11A 2F4FA 1TMMA 1UAWA 1S57A 2FLOA 3O44A 3EYZA 2A10A 1S48A 3V4MA 3HX9A 2HLTA 1QSYA 1LQ9A 2YX7A 3JYTA 4C0OC 3NGDA 3BGOP 3M2VA 4L3NA 2H54B 5IT9Y 3CCQS 5FDLB 5KT6A 1TAUA 4DV3J 4CYUB 2GVDA 3M30A 2JLEA 4Y2AA 2VJUA 3BN4A 2L41A 4DV4J 1EAYC 2CQDA 2PMHA 4K4SA 3DLKB 1Y5NB 4PPZA 3M32A 1MWZA 4ZVUB 3QRRA 3BO3A 4CTAA 4KE5A 2HVDA 3GIJA 3KG4A 3M8PB 3PW4A 5I42B 3POTB 1VI7A 5G0RA 4W98A 4ECXA 4HI1A 4WFAQ 4NZ6A 4IFYB 5HROA 2DB1A 1SC4B 2W9CA 1FWPA 4DV7J 5D0RA 2FVRA 1FNMA 2FLPA 5IOLA 4DX5A 4B3RF 4WE1A 3V2UC 3HFKA 4B9LA 2J0WA 4X62J 2VDIA 2KU7A 4CO2A 4KPCA 3X1LB 2W7PA 3CW2C 3GIMA 5KFEA 2ZUGA 2QGFB 2ATCB 5D0GA 2RQKA 4AFFA 3UD4P 5L39A 4G1QA 1LW2A 1YTYA 2VZ9A 4DN0A 2K8GA 7FD1A 2HRYA 1CQMA 1JLCB 3JAMU 1QY7A 4EO6A 1BQMB 2QFIA 3E01A 5LJ3Y 2HFOA 4ZVSB 5D78A 3PW0A 1Y7PA 1BLUA 1VBYA 1WC6A 3I32A 1N54B 1B0TA 3H5XA 3NGSA 3CCWA 3I9V9 2C3PA 5U47A 4UQTA 2HBYB 1YZ6A 4TY8A 3H90A 1HHQA 2LVWA 1Y11A 3N6LA 3LA0A 4DN9A 4NLRA 1U1KA 5BYSA 3Q8UA 3PG9A 2FJBB 2HWHA 3JSRA 4RLEA 3FDSA 4FVMA 1RTDA 2LQ9A 5D3GB 1SL0A 1JIHA 3QQCD 1UETA 4ZVQB 2BQUA 2FJAB 1JQGA 5L9NA 3OLAA 4R5PA 1RAFB 3CCES 5A0YB 1RHMB 2GX8A 3UN3A 2YTCA 4MAKA 5ETOA 1IBKF 2R7XA 1YVFA 1FJEB 1WHVA 4Z2XA 2CVEA 4UOCA 1FRMA 2F8MA 2QA2A 1TUGB 1KP6A 5DG9A 3OFHA 1U4BA 2ZH8A 2EK1A 1NPRA 5E3QA 4RPFA 3SDEB 1HNVB 4PQAA 5J2NA 5D8HB 5KG4A 1KVJA 3T41A 3UR0A 4M63A 2ZZTA 3CJQA 5KFYA 1WKLA 4C3KA 4IFVA 1R8HA 2EI5A 3PM9A 3TJ8A 4X64J 2P9EA 3NOGA 2AGQA 1FE0A 3JB9k 3MUTP 2ZZNA 4F0HA 4V1Ak 4X4RA 2HQIA 1S9GA 2W01A 4BBYA 4LIRA 4FF2A 4ZIWA 2HQ3A 5T7LB 2NLWA 5F9NA 1X4HA 2B4OA 5HQ8A 4ES3A 1C4CA 4QIFA 4RNMA 4ZJLA 5DQGA 1TL7A 2HWIA 1CC7A 1GMWD 4YB1P 1EZZB 2RUSA 3HVWA 5EWEA 4M5KA 2BJDA 2GHVC 4QQBA 2KXFA 2HZCA 3LPYA 4U7UK 5C2CA 1CS4B 2CPZA 2UVWA 4MIWA 2HZAA 4NA1A 1N34J 3LWMA 2PI4A 3A8JA 1RHQB 1TV6A 1R27B 4KAIA 1KC8T 1MMLA 2UV8A 1BY9A 5DDPC 1N5QA 4RWWA 4QR1A 3LP2B 3H40A 3LPEA 4NEZA 5CAAA 4NPOA 4AT1B 1IQZA 3B4DA 3D3CJ 1IN0A 4M5JA 4NI2B 1ZM3A 2BE2B 3IS9A 2ADBA 3PRVA 1RT4B 1DARA 3ZZZA 2F1FA 2R8JA 1OQ3A 1SH2A 3EVWA 3K59A 4CDIA 1BQNB 1SIWB 3ZXWA 2ZJPQ 5I4MA 1QSLA 2XULA 3C66A 3V6JA 3KXDA 4ZMMA 1SJ3P 3NGRA 3RBEA 5GAHU 2BJ8A 4MYTA 4C0BA 2Y1JA 4KH0B 1SQFA 2CVIA 4LFBJ 1B4SA 3D4JA 2KT5A 2YPZA 3FZ2A 4OI3A 1S1WA 3OSPA 1UEUA 3KJVA 2QA4G 3W63A 4LFAJ 1Z1ZA 4P2FA 4KV8B 4Z7YA 4EO8A 1FK9B 1RWKB 4CNZA 1W26A 2VL1A 4U95A 5EDWA 1N4LA 3AD8C 2NZ4A 3DOMA 1LW0B 2IA0A 2RQCA 4CRJA 3TNVA 3BSNA 4A8QA 1WHWA 4F0KA 1XNRF 4U67Q 2XZTB 3DI6A 2VQEF 2HNZB 2NCKL 4DR1F 4KHRA 1K0VA 5A76A 4ZK7M 1JLEA 4ANEA 2BDPA 3DRPA 4NZ0A 2B4VA 3IWNC 1ITPA 2DGSA 1H7XA 2UUCF 2ZBRA 3CC2S 3FKBA 3OL8A 2VU5A 1HI0P 1OSCA 4AQYJ 1S76D 3KLFB 3BZQA 3R5CA 4C8YA 3EZOA 4CT8A 2AD9A 2CXEA 4UW2A 2OGUA 3KLIB 1F2HA 2FZGB 5IC4B 1EKRA 1NU4A 4GO7X 1SL2A 2HIYA 1WDTA 1G7CB 4YB7A 3Q0AA 1BWVA 2YBVA 2UV8G 3V6DA 2YWGA 3MM7A 4I0WA 2K3IA 2F8EX 4EU0A 2R4FA 4X2BA 2G13A 5ETRA 4LR9A 4O44B 3TRGA 1VQPS 2RF2B 3KHGA 2IVYA 3TAPA 1H0HB 4KHPF 1VHIA 4K4TA 3GSIA 3M8QB 3LANA 2AHOB 2RSQA 1FEEA 1JLBB 3N6NA 2HHWA 2W2NP 1X4BA 3HHNB 1O6XA 2AW0A 1VR6A 2COLA 2V50A 1OYDA 5KFTA 1UJ5A 2CQCA 5FDLA 5LSOA 1NDLA 5KFDA 1D1UA 3NMAA 4LFCJ 2RDJA 4P7VA 3RBZA 2Z30B 4CYUA 4NLVA 4DPOA 2RRAA 2B0GA 2LQ5A 3Q89A 1G2EA 2ROPA 1N36F 1VQ5S 3AAWB 2WB1D 1DHMA 3K8VA 4JV5J 3DLKA 1HLWA 3P5BP 2H48B 3MAHA 4IOAQ 2JHEA 2J0XA 1RT5B 2XY7A 2VPZB 4NLGA 1PG5B 2G0IA 1U8WA 2YKPA 4ETZA 3M8PA 1T11A 1O51A 3POTA 5FIIA 4UY8T 3QGIA 1MN7A 2QJ3A 5EWGA 4JI8J 4IFYA 4J9KA 1ROFA 1ZTWA 4OJ3A 4Q45A 3PIPQ 3TEHB 1S0VA 4YB5A 3ZZ0A 4F50A 4CP5A 2CNLB 3JSMB 3O6QA 3D66A 1G4CA 5F41A 1SKRA 4Y2KA
chains in the Genus database with same CATH topology
4H4KA 4AXIA 3D0GE 4QCLA 5B0FA 2CPHA 2ZZMA 2R7RA 1OWXA 1NK7A 2ZE2A 2E9TA 3TA2A 3BR8A 2HRUA 2JC1A 5A2QY 3SZ2A 1DBDA 4PG6A 2OIHA 1R8CA 2W24A 2WOMA 4ZCKA 1LWEB 3OFGA 2G0CA 1VJWA 4QIGA 4ERDA 3TANA 1T05B 2APOA 3VCDA 3HVTA 2PO4A 1WEYA 2YNGA 1IKWA 3L09A 1HD1A 1HWUA 3LUYA 5CZXA 1Z4UA 2JVRA 3TQ1A 4TU8A 4IH6A 3QJPA 4MK7A 1KNZA 3DLJA 3EGNA 2G4BA 4RW7B 2KYXA 1NK0A 2UXBF 1JNRB 1OIAA 1JLCA 1VOMA 1XR7A 4J9MA 2QA4S 2F7VA 4XAKA 1WF0A 3UE2A 4E98A 1H6KX 1BQMA 1FXDA 4J9QA 1ZETA 3CD6S 4NXMF 2JOQA 4HHJA 3T5KA 1NK8A 1SXLA 3SCLE 4B9SA 4ZVHA 1AXQA 2OMLA 4PXEA 5K9FA 5CXTA 4I2QA 4DFPA 2W25A 3TARA 4U9RA 3TR5A 4AE5A 1S77D 3GILA 3PW7A 3IRXB 2ASJA 2JVOA 4Q5VA 2QO3A 3DHXA 2GMLA 3A1YG 4RW8B 4BWMA 4ECZA 3CC4S 2PMZD 2EG2A 2ZH6A 1GTHA 2UUAF 1U6FA 5LMUF 2IRYA 4K4ZA 2IYIA 3MWBA 3M1VA 1LV5A 4ZP9A 3MM9B 1MSWD 4KR0B 3EX7B 4OZNA 5HP1B 3E3XA 1F2GA 5B0DA 2KT2A 4X4SA 2QMWA 3UI3A 4ELUA 2I8EA 4B17A 4DQIA 2HS3A 4C3LA 1SB6A 1QUVA 2OTJS 2KI2A 4O3OA 2XMKA 3DFEA 4F02A 5ITHA 1EP4A 3AA9A 4ZVEA 1RTJA 1IKXA 1NAQA 5K8NA 4C4WA 2MDAA 4KO0B 3I4PA 3NBPB 3UCGA 3HI9A 2DHXA 4DV3F 2XS5A 3OVAA 3FSXA 5E33A 3FSIA 4RW6A 2C2EA 1P8GA 4LJMA 4RKUC 3CPWR 4EZ9A 2ZD1A 1HWIA 2J7WA 1S6UA 1NK6A 4B9MA 4LT6A 3GFXA 6FD1A 3L3CA 3TA0A 2J76E 2CPFA 2EPIA 2BZ2A 4LQ9A 3W2VB 2KXNB 4NCBA 3K5NA 1Q1KA 4DV4F 1YSJA 2QZ8A 2VFSA 2GHPA 4IRDA 2IMOA 2HGLA 2O67A 3Q8PB 1NJXA 2R2UA 1HYSB 3DGPA 1R3NA 2W7OA 4DWIA 5LMNF 1KHVA 2E5GA 4YDDB 4EYIB 4PKDB 1JXLA 1FKAF 1YJTA 3JSBA 4ED0A 2XMWA 1FXLA 2XSFA 3MMBB 1VQ6S 3FJ2A 1NJZA 2EFOA 1B7FA 3IG1B 1SJQA 3OSNA 3UD3P 1R0AB 3R27A 5M2UA 3CD7A 4ICLB 1T03B 4C8KA 3V5RA 4RU9A 4OZ5A 3MM5B 4FF1A 1HI8A 5JXSA 4M94A 4R0JA 1QJHA 1T3OA 1HPZB 3T1AA 3DM2A 4O0IA 3TUIC 4LF9F 5A0YA 1HI1A 1NO8A 2V8HA 3EPGA 3HP6A 5B0GA 1T7PA 3FEYB 2XS2A 3OL9A 4O4RA 5CQGA 4A8MP 3PW2A 3MF5A 1JLGB 4PXBA 2NPIA 1KTQA 3LGNA 2OPRA 3IGVA 3N0VA 5C25B 2DR7A 1KVIA 3DOLB 4F26A 2BR0A 2GQCA 4DQRA 4PG7A 4OX6A 1X4EA 1I1GA 3CCLS 4A8YA 1GX5A 4RW8A 1S99A 1M5PC 3SQGA 2HMIB 3PX0A 1OSDA 5BJRA 3SV3A 2E1MC 5T14A 2V94A 1DQ8A 1X5PA 3D0HE 2VOOA 1RYRA 5HBMB 2P6TA 4QWAA 5FLXY 4FS1A 3ISZA 4OHWA 2GHWA 2GFFA 3HVAA 3MMCA 4YEAA 1S6QB 4G1PA 4FNHA 3SDEA 1HNVA 1HQUB 4CH7A 4ZVFA 3KLHB 2EVZA 2QT7A 1VBXA 1D3WA 1SH0A 4JI6F 1JLAB 4BWJA 2ZVSA 1FJGF 5I3UB 2CQPA 3HO1A 3VAMA 4OZJA 1WEXA 1TKTA 2MQMA 2KH9A 2HS4A 2OLWA 3OTEA 4N56A 1DTQA 3MR2A 3US5A 3IXQA 4XPEA 2YNHB 1ZAWA 3W2WA 3UCZP 2XI2A 3DOKB 1VIOA 5C24A 4F4ZA 1NJWA 2VOPA 1RT2B 1TKZB 1TL1B 3P96A 1HNXF 2KTQA 1FKPB 1UVMA 3P49B 1S0NA 1IBLF 2M70A 1MMDA 3J81Y 4V19J 3HM9A 1TL3A 3NLCA 4IO9Q 2OPPB 2C42A 1TL5A 2EFPA 4FBUA 4HVZA 3G8SA 4OJGA 3K5MA 4RNHA 3DC2A 2UZAA 4WF9Q 3T19A 3HKZD 1F9FA 5IM0A 1DQAA 3LP0B 5DRKA 5KTQA 3QGPA 4N8NA 5A8RB 1VQOS 2XMUA 1KQKA 2C2RA 3KG1A 2GMHA 3ZFVA 2XO7A 5T7LA 1JXEA 3PJXA 2MSSA 4IKAA 2OD4A 3ISNC 3JSYA 2V8GA 4OHVA 4USJC 4ZDNA 5KFGA 1S9FA 2OFHX 3NKYA 3HMJG 3DRRA 4PG5A 4RW9A 1S10A 4TU7A 1SC6A 2B9WA 3M9MB 2MZJA 1C0TA 5J2MB 2AWZA 2V4RA 2UU9F 4IRCA 1RK8A 4CO3A 2J0SD 2OH2A 3GR1A 5E0OA 2XY5A 4Q7AA 1HWLA 1M1KT 2RQMA 5D4LA 3K8WA 1U26A 2DBBA 2Z8QA 1RYSA 1WEZA 2KKHA 4JV2A 4P6QA 2L9DA 2D3OR 3SV4A 1G1XA 1JJHA 2RDIA 2VG7B 1U2RA 3OUYB 3OR2B 2LXFA 1FRXA 4HDHA 4URQU 4MKYA 3AB4B 1KFDA 4O4GB 2YH1A 1K9MT 3HVRA 4BCAA 4ZHRA 3RRKA 1LXNA 1P9QC 4J9OA 1JLQB 3VAFA 1HNIB 4IQXA 2EFGA 4YOEA 5A8WB 4DLGA 2ZH2A 2LXIA 3T6JA 5GADU 5K8OA 1VC5A 3VR1A 2KN4A 1JLAA 4DFKA 5I3UA 1CLFA 1Q53A 4HTJA 2FC9A 2I0XA 2IC3A 2MPUA 3MOZA 1N56A 1LKZA 5E5NA 1SJ4P 4ES2A 1Y3KA 4O23A 4C11B 4FN5A 3UDLA 3VZHA 2LKZA 1HMVB 2DGWA 3G6ES 3BJYA 3MEGB 2FVSA 3FFIB 3SSSA 1IQTA 5HMWA 2BANB 1RTHB 2I38A 4CH0S 4ZLPA 1WTBA 2KFNA 4NLUA 3AHPA 4C8LA 1OO0B 3C3LA 4ILMA 1FKPA 1QAYA 3JYTB 2D3ZA 1NB7A 1HW8A 3DU5A 1NHVA 4IG3A 1KSPA 3M2VB 2J9EA 3FMWA 4I69A 5GVQA 2V4JB 2Q3PA 1GQEA 2OPSA 3LQVA 3GR0A 1NKEA 4OI0A 2HNYA 3BDEA 3F41A 4ECYA 2AJQA 4KGMA 3E51A 3LP2A 2DNHA 3BSCA 4B3OB 3TP2A 3QGGA 2CQGA 2QRRA 4DV2F 4OX7A 1Y4ZB 2BYCA 3RB0A 2M5YA 4YMEA 4Y28C 1VQYA 4YB6A 1FVSA 2K1RA 5C5JA 2LEAA 4FPRA 4HLBA 4LSNB 5KT7A 3SFUA 2IAJA 1R7IA 1T02A 3WC2A 3MMJA 2BE2A 3CT9A 4DL0C 4FXVA 3M30B 2LU1A 1C1BB 2W4CA 3C6UB 4DLEA 5KT3A 2FUG9 3UCUP 1RT4A 3MUVP 4LQ3A 2DR8A 2D1CA 1F5CA 3OHBA 4EGLA 1CVJA 4WU3A 3LF0A 5LJ5Y 3MHYA 3CIZA 4DS5A 2Y1IA 3EXCX 2ADCA 2VFTA 3OTDA 1QVFR 3RAMA 2QFJA 1WG4A 4DR5F 1HA1A 3MI7X 4BC7A 3V81B 1FD2A 3LH2S 2JEJA 4KTQA 3MEDB 5F3TA 2L9WA 4CCHA 5KFFA 1BQNA 3CDWA 1X5OA 2IM0A 3H5SA 3UQSA 5KOXA 4TLQA 5D4OA 4QIVA 1UMJA 1M5HA 3FVYA 4DS4A 4I1TA 1HNIA 3M32B 2OKQA 5KFCA 1VS3A 4CTAB 4CT9A 5A6WA 2J6UA 1M5SA 1TR0A 1YWXA 2RJZA 2GJIA 4QIWD 4O3RA 4O3SA 3CGIA 1FVQA 2YKMB 3G8QA 3DLEB 3RZAA 2CQ2A 5G0RB 2VA2A 3MPYA 2DVIA 3BF4