3VAFA

Structure of u2af65 variant with bru3 dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
174
Chain Sequence
b'GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
total genus 43
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vafA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vafA02
2CQ2A 1VQLS 2A3JA 2YTCA 4ZKAA 2YH1A 2FC8A 3ZZYA 1S72S 4BS2A 3HI9A 2YWKA 2DO0A 2N7CA 2LEBA 2J8AA 4C4WA 2L41A 2LKZA 1WHWA 3G6ES 1VC5A 5GVQA 1U1PA 1WF0A 5DM6Q 1WHXA 2KN4A 4LJMA 1ZZNA 3MDFA 3IRWP 4QPTA 1U1QA 1R8PA 1BY9A 2DNGA 2RQCA 3CPWR 4U67Q 3TP2A 3UWTA 2MQOA 5HL7Q 2DNLA 5LXYA 1XN9A 3CULA 4PR6A 1Q81T 4FXWA 2I2YA 2MZTA 2CPIA 2EK1A 1HD1A 2RS8A 1JJ2R 2UP1A 3NMRA 4F25A 1RK8A 3LQVA 3NS6A 4LIRA 3SDEA 2ZJRQ 2F3JA 1H2VZ 2LA4A 3IWNC 2GO9A 2PE8A 1U1OA 4IOAQ 1UFWA 1KD1T 3THPA 1D9AA 5GMKa 5LSOA 2XSFA 1O0PA 2LMIA 2E44A 1OPIA 2LA6A 2O3DA 1OIAA 3CCMS 4F02A 1M90T 2WBRA 3V4MA 1U1LA 1QM9A 2CPEA 3I55S 5HO4A 3Q2TC 3G8TA 2DB1A 3B4DA 1KOHA 2X1BA 4W92B 2MQNA 1UP1A 1X4CA 4TU9A 3CXCR 1U1NA 4P6QA 1WTBA 1N8RT 4OZ0A 2MB0B 1U1MA 3NNHA 1UW4A 3U1MA 1FO1A 1N52B 2DO4A 4UQTA 2M0GB 2RUGA 1H2TZ 1X5TA 5DDOC 3CCJS 2MKCA 3FEYB 3THTA 2OTJS 1JJHA 1KOOA 3L3CA 5CXTA 2CQPA 3US5A 3MOJB 1X4AA 2CPFA 2XS2A 1WEZA 2Q79A 2KRRA 2M4MA 1WF1A 2CQ0A 3Q2SC 2JRSA 1VQ9S 2D3OR 4YOEA 2MKKA 2AYGA 2AYMA 2CQCA 1VQ4S 2B0GA 1KC8T 2DGSA 1CVJA 2M7SA 1NO8A 1X5SA 2OJ3A 2HVZA 3BO4A 1WEYA 4WKRA 3CMAS 1M5KC 2CPJA 5DDPC 2GHPA 5DETA 2NLWA 2BZ2A 2MYFA 3UD3P 2OSQA 1WG4A 1YJWS 1YJ9S 3UD4P 3SDEB 3G71S 2FPHX 5LJ5Y 1SJQA 2DHAA 2N3LA 3R1HA 3TYTA 2L08A 2M70A 1FJCA 2DNMA 3MUTP 1F9FA 1HA1A 3R1LA 4QU6A 2KG0A 3PIPQ 3MUVP 2CPDA 1YWXA 2CQ4A 1P1TA 3VF0B 5DDRC 3R27A 2M8HA 4WFBQ 3CCVS 1HL6A 4LMZA 3B4MA 2FHOB 5IQQA 1SJ3P 3CTRA 2VODA 1B7FA 2U2FA 5GAHU 1VQKS 2CPYA 2DGVA 2FY1A 1Q7YT 3P49B 3UCUP 3G9CA 1JJ4A 1X4EA 2KXHA 4ED5A 1R8HA 1U1RA 2DK2A 1VQ6S 4UY8T 2KRBA 2MQMA 3BS9A 3MD3A 1VQPS 2KU7A 3CCLS 2DITA 2J76E 1U2FA 4TU8A 3J7ZT 2BOPA 2VOOA 2V94A 2F9DA 2KXNB 2CJKA 2DHXA 4CH1A 1ZZFA 4IOCQ 3NS5A 3I56S 1VQMS 2M52A 3RW7A 2JX2A 1VBXA 1NJIT 1YJNS 2CQBA 2U1AA 4W90B 4IUFA 2MZQA 5IM0A 2DNPA 4ERDA 1NU4A 1FT8A 3S01A 2X1FA 1U6FA 2XNRA 1AUDA 3MI7X 2JWNA 3CF5Q 1VQOS 1VC6A 1JMTA 3EX7B 3UCGA 2MQQA 1WELA 2L9WA 2DGTA 2MGZA 2LEAA 5D77A 2DGOA 2AYEA 1WG5A 1X4DA 2DNRA 4F26A 2E5IA 2RRAA 3CCRS 2DGXA 2RNEA 3JB9k 2NZ4A 2EVZA 3VAKA 2CQHA 3H2VE 4C7QA 2MKHA 1YITS 3TO8A 3SMZA 4PKDB 2CQIA 3G96A 1VC0A 1OWXA 1A7GE 1WF2A 1VQ5S 4RU2A 4CH0S 1G2EA 5JVHQ 2CPXA 3K0JA 2LCWA 4QU7A 2KVIA 2KH9A 4CQ1A 4TU7A 2ZJPQ 1X5PA 3J7YU 3CCUS 2KHCA 1S79A 2E5HA 2DNYA 5H1SV 5GAGU 3CCQS 3VAIA 2MZRA 2LECA 1IQTA 1WHVA 2DH9A 1VQ7S 2QFJA 2MZ1A 2DHGA 2RQ4A 2XB2D 3UCZP 1DBDA 2KFYA 2MKJA 2MKSA 1D8ZA 2AYBA 4Z2XA 1QVGR 3ULHA 1U1KA 1H2UX 4YB1P 2M2BA 2M9KA 3CCSS 3VAHA 2MY8A 2ZJQQ 1DZ5A 2FC9A 2LXUA 1M5PC 2LQ5A 3UE2A 5BJRA 2MZJA 2ERRA 1W2BR 2QEXS 2DISA 1WI8A 2X1GA 2HGMA 2YKAA 2DIVA 1FJ7A 2F9JA 3VAFA 2KI2A 5CYJA 5EN1A 2DGWA 2RS2A 3CC2S 4YUDA 1SJRA 1X4GA 3CC7S 2MJUA 2CPHA 4J5OA 5IM0B 1FJEB 1YHQS 1WHYA 1K9MT 3DXBA 3HHNB 3BO2A 3P3DA 2KM8B 2MZSA 2CQDA 3CMES 2MHNA 3CCES 2VOPA 2JVOA 4Y00A 1X0FA 2LXIA 2MSSA 2MY7A 2MGZB 1ZH5A 2OIHA 5LSLA 5IFMA 4EGLA 3FEXB 1DRZA 1RKJA 3VALA 3MXHP 2LYVA 2MQLA 2D9PA 1U6BA 1WG1A 1UAWA 2DNKA 5GADU 3CUNA 2HZCA 4FXVA 2ADCA 2K3KA 5FJ4A 1SXLA 3G8SA 1FXLA 1SJ4P 4Y0FA 3ZZZA 4TLQA 2DNOA 1M5VC 3CD6S 2RT3A 3VAJA 3U1LA 3MD1A 4C0OC 3NNCA 3RW6A 4V19X 1WEXA 5DDQC 3S8SA 4M5DB 1A9NB 2EK6A 3P6YC 2SXLA 2HGLA 2DH8A 2CPZA 3BO3A 4QQBA 2G4BA 1VBYA 2XNQA 1P27B 5D78A 4IO9Q 4WCEQ 2MMYA 2QA4S 4PRFA 5GAEU 2DH7A 3LPYA 2DGUA 2G1DA 1WWHA 2J0QD 3S7RA 2AD9A 1L3KA 2DGQA 2CQGA 1N88A 2KXFA 2XS5A 2RRBA 1Q86T 1FHTA 2X1AA 2MKIA 5DM7Q 1PGZA 2CQ3A 5CA5A 1K8AT 3EGNA 4OZ1A 2N3OA 2KM8C 3S6EA 3VAMA 2KT5A 2G0CA 3PIOQ 2YH0A 3DLLQ 3MURP 1URNA 3SXLA 2DNHA 4WIIA 1HD0A 3MUMP 1YTYA 1M1KT 2N82B 1QVFR 2MQPA 2J0SD 4WFNQ 2CQ1A 1X4BA 2MXYA 2MSTA 2OSRA 1FNXH 2DHSA 1H6KX 3P5TL 2D9OA 2E5GA 1WI6A 2PEHA 5MLCV 5JVGQ 2DNZA 3H2UB 3OW2R 1N54B 1X4HA 2M8DB 5ITHA 1YI2S 4CIOA 5LXRA 1VBZA 3G4SS 1K73T 2MPUA 2E5JA 1X5OA 2HYIB 2K8GA 2XS7A 4WF9Q 4WFAQ 2DIUA 1Q82T 3N9UC 2DNQA 2JVRA 1KQSR 2ADBA 2KYXA 3VAGA 1VQNS 2KG1A 1SJFA 5LJ3Y 2OTLS 3NNAA 1YIJS 1PO6A 1VQ8S 2I38A 2RU3A 1M5OC 2HGNA 3D2WA 2MJNA 4A8XA 3EGZA 2RVJA 1DHMA 2VONA 3BEGB 1OO0B 3CC4S 1X4FA 2M88A 2DNNA
chains in the Genus database with same CATH superfamily
1EP4B 3C2PA 4LF6F 2CJBA 4C4WA 3IGVA 1NRKA 4PWUA 2LQ8A 1TKXB 1U1QA 1H7WA 2A2DA 4HACA 4PR6A 4YY3F 3NGTA 3QWPA 2A0FB 4J9KA 1F2HA 3AB4B 5K8OA 3LW5C 2C2NA 3GIKA 1NPPA 2UUBF 6FD1A 4ZCMA 5CH7B 4R5PB 3W60A 3Q86A 1RAIB 2BRKA 2ZDOA 5KFDA 3CJ4A 2UVUA 4ELVA 1RTDA 3B6BA 2VJUA 3KJNB 2MQNA 2X51A 2K7KA 4OMFG 4ZPWR 5GAEI 1EETA 3JTPA 1X31C 2Z4PA 5I3UA 2FD2A 2G2YA 4M5JA 5KFSA 2JL9A 4KHPJ 1NZAA 2CQ0A 4QIVA 3JSRA 4ED6A 4FPRA 5J2PA 2ZH8A 5CAAA 1HPZA 3ZTOA 2MYFA 3UD3P 3TUJC 4PUOB 4ID8A 3M8PA 1NK4A 3PX4A 1VS3A 1RAHB 3BGOP 2IM1A 3IWXA 1LK7A 5ETOA 1RT5A 2APOA 3A3OB 3AJ2A 3IC1A 2KYZA 2BVZA 4L74A 4CDIA 2FHOB 2JSXA 3PRVA 4K2XA 3T6JA 4DV1J 3LP0A 4X4OA 3GJRB 1RAGB 1NJXA 3CW2C 3ITHB 4PXEA 4UY8T 2ZHOA 4PG4A 2WVEA 3AD7C 3BYRA 1UPPA 3UNGC 3GIJA 3IXQA 4M63A 4WU2A 1ZM2A 4NLRA 3W62A 1YK9A 1ZZFA 1HWJA 3SI8A 4C98A 1N6QB 1VBXA 4B9SA 3L09A 1TTHB 2KKHA 4ERDA 1GXTA 3CNQP 1VQOS 1I1GA 3UCGA 1FX4A 3C16B 1KHVA 2DGOA 1DURA 3LA0A 4EZ6A 3LUYA 2RQMA 4P2FA 2ZH6A 1RHQB 4KPYA 4ED3A 1IKWA 2ZE2B 3VAKA 3MEKA 3VGUA 3KLGA 4A8SA 2Q43A 1A7GE 3DC2A 3LH2S 5IQ6A 3FZBA 2QLBB 4DXLA 2HVDA 1MMDA 3IG1B 3OHBA 4KC5A 1ZA1B 2QFJA 4IYQA 2MKJA 2G2ZA 4B3MF 3FJ2A 4Q7AA 2YKOA 3O44A 1VI7A 5KFWA 4YQWA 1BUXA 1GQEA 2AZ3A 1R0AA 1HQEA 2X1GA 2UV8G 3Q83A 4C6AA 4X64J 2CZ4A 2F9JA 4PXCA 1VRTB 1HMVB 3L4BC 3DRSB 4X4NA 1RHMB 2CPHA 3UDLA 1KDNA 3QATA 3HVTB 1S1TA 1Z2LA 3AFGA 2W2QP 1QSYA 4DCPB 1SPBP 4NE9C 3MEDB 5HSPA 3NGKA 3KNGA 5KFKA 3TA0A 5A76A 3OUYA 1D09B 1M5VC 3S8SA 1KVJA 2MLYA 5F0WA 2JEFA 1REGX 4NMLA 3BO3A 4F3OA 3MZIA 2J8SA 5LMNF 5HP1B 1U0SA 2DXDA 4HI2A 2R2SA 1MMNA 3H25A 3GWCA 3DXSX 2J0QD 3T1AA 2AEJA 2CQGA 1N88A 2KXFA 5HK4A 1IM6A 3CJKA 2BJ8A 3S6EA 4DOZA 2P9EA 5HQLA 2KT5A 2MHEA 3OJSA 3KWMA 1IXKA 4FNIA 4AQYJ 2XULA 3KK1B 2I5JB 1RT6B 5D3GB 1LNQA 1X4BA 4JI4F 4L76A 3D1OA 4C2MA 2PEHA 4K2JA 1X8DA 3VGSA 2BE7D 3FKBA 1CPZA 3G4SS 1ICEB 2MPUA 2E5JA 3B82A 4O4GA 4QWBA 3NGSA 3VAGA 1VQNS 4Y2AA 2P6SA 1HWIA 3NBPB 3C46A 3E01B 1QD1A 3DKDA 2VF3A 3D54A 3H2LA 4GC6A 3OR1B 5I3PA 3W5YA 1XWLA 3M8RA 2EWHA 3RU0A 1XEZA 2ZKTA 3T9ZA 4B08A 1QSLA 1N36J 2JFDA 3MMBA 3EVOA 2FLPA 2ZWPA 3GR0A 3J81U 1BXNA 2XWYA 2B7BB 2G9OA 4LF5J 1E6YB 2JLEA 3KFWX 1U24A 1IN0A 1ZTTA 3QQCD 3IWNC 2ZBRA 4Q5VA 3Q8UA 3JAMU 3TJAA 2VPZB 4DQRA 5HROA 2IY5B 4WK1A 1OPIA 1U45A 2YKMA 2HRUA 2A6OA 2VFUA 4G1IA 3K5NA 2CPEA 3JSBA 2ASDA 1OJ4A 1KOHA 1RT2A 2OPSB 2YWEA 4NPOA 2YWGA 4KKOB 1XTZA 1WC6A 2MB0B 4EFAC 3QWUA 1UW4A 1N52B 4LF9J 2FJXA 4L3KA 4EU0A 2UUBJ 3T1HF 5EHHA 3OL9A 3T9NA 3DLHA 3J80U 3US5A 1Q8BA 5F3ZA 3TEGA 3DRRA 3TX8A 2HFSA 3LAMA 2NYHA 1N5VA 1VQ9S 3N0VA 4LBHA 1HNZF 1OMSA 1NO8A 4DPTA 4M94A 1IKYB 3IMQJ 4TKTA 3HULA 3KMQA 2OSQA 4O3OA 5T7LA 1GTHA 3SDEB 3BYPA 5KFOA 3ISNC 3POTB 4P75A 3DDNA 2L08A 1KEKA 2HFZA 5E3PA 4KFBB 3W5ZA 3HHLB 3W63A 2CQ4A 2IPOB 1UTAA 2R8GA 1T9UA 1S1VA 1VGYA 4E8UA 3L95X 5HQMA 2NS1B 3DDIA 4Y65A 2KXHA 1BE4A 2R7QA 4NI2B 2R2UA 1RWWB 3BR8A 3KLEB 5HMWA 3OL6A 2D7SA 3MM9B 1NNDA 4YB6A 3FFIB 1MG7A 1WC3A 3ZFVA 3RUBL 1S7HA 3UNYA 2BACA 4Z7YA 2V8DA 4RJVA 2E9RX 1RT1A 1R6VA 2V2QA 5DLGA 3PTWA 2A10A 1KQFB 2QA1A 1AUDA 5KTQA 2HQIA 1ZAVA 1S76D 2DGTA 2IVMA 5D77A 2Y8WA 2UXBF 1N56A 3CDAA 2OFHX 5HATA 4ILMA 3I9V9 4BLGA 3JB9k 3AB2B 3UN2A 4F2SA 4MT1A 3OV7A 4YP3A 4DPUA 2QLWA 5DJBA 2LP4A 3HPOA 5E0OA 2VG5B 5C5JA 4WIQA 3VZIA 1WHVA 2GC8A 2RQKA 3MCSA 4TY8B 2KFYA 3IBWA 2F1FA 2J5AA 2R2RA 1ZS6A 4F7VA 3CCSS 3VAHA 2F7VA 5C2GA 5D4OA 2WVBA 1H98A 4QWAA 3W7BA 3NL0A 1KNZA 4NZ7A 1UW9A 3KLVA 3VAFA 5CYJA 2HFVA 2EG1A 1T9YA 4ED8A 3OJUA 4IOBA 2O67A 1HHQA 4Q0BB 5I4MA 4DV5F 3BO2A 3L7UA 1WORA 4ED1A 2JVOA 2Z56B 1EB0A 5B0FA 1HIYA 4P7VA 5FLXU 3UVJA 2BJ7A 2D9PA 1NZ8A 4GKKJ 2A6MA 5ETVA 3BB5A 4CLSA 5FJ4A 2QLXA 3QT7A 1RBAA 1XR5A 3CD6S 3MPDA 2WVDA 4C0OC 2LQ9A 4OJ3A 1TVRB 3MM8A 1KFDA 4ZVTB 2CPZA 5KFZA 3J81j 2PIIA 2ZH7A 1HBNA 3WQPA 1FD8A 4RU9A 2DGQA 2RD5C 2W9CB 4ILLA 1SC6A 1LWFA 5ETSA 4RW6A 5DM7Q 3DCAA 4NEYA 2HHPA 1TAUA 5KT6A 1K8AT 3HZGA 2G1HA 2XY7A 3EVWA 1HWKA 4MKBA 4J9RA 1K1SA 4OYWA 3DYAA 3HF5A 3OL8A 2XMKA 5B0DA 1CJTA 3T41A 1VK3A 2IYIA 1VRUA 2D9OA 2LU2A 5LMNJ 5HQ8A 4ZP6A 2QL5B 4NYPA 2Y0SD 1PILA 2BOAA 3DFEA 2DNQA 4AE5A 2XSJA 2IM2A 4LF8J 2F40A 2VA2A 2BRLA 2HGNA 2VONA 2V9WA 3BQ2A 2ZH4A 1HYSA 4P71A 4QYRA 4C11A 4F67A 1S72S 3ZZYA 1PAEX 4JI4J 1U4BA 2EFQA 4EZ9A 3VCDA 3LP1A 3RBXA 1BWVA 1CULB 2D74B 4WU3A 2NR0A 4U7CA 1JLAB 2W24A 3I82A 1Q81T 3KTQA 1RTJB 3Q8QB 3KK3A 3OXFA 2W4CA 2F3JA 1H2VZ 2Y0BB 4OV1A 2DPJA 3ILIA 5C25B 4V1Ak 1WDTA 7AT1B 2E44A 2UXDJ 3GJTB 3K58A 4X66J 3DHWC 3MR6A 5KAKA 5KT7A 4QYZK 2VASA 4IKAA 4B3OA 3G8TA 3WBZA 2H65B 2RKIA 4KY3A 2HVHA 3C19A 3UDCA 1U1MA 4NA1A 1X7VA 2HNDB 4RW4A 1U49A 3H4BA 5RUBA 1UZHA 3TR5A 4BC9A 4Y2MA 2KRRA 4FZVA 4RW7A 2JRSA 2YNIB 1M1GA 4USIA 2AYGA 1U8WA 2DCUB 5DQHA 1MWYA 1CVJA 2OJ3A 1H7XA 1I6JA 4KBIA 4J91A 5A8RB 3UI3A 1FKOB 4PQUB 4CYUA 4CWBA 2HQ3A 3OFEA 3KMSA 3TYTA 2QMUB 3T1HJ 5FDLA 1JLQA 4QU6A 1LW0B 1R43A 3VF0B 1HBOB 5KFQA 3G86A 4J9NA 2B5JB 3HSJA 3H0PA 5B0EA 5GAHU 1C2PA 3DOMB 2VBWA 4GC7A 3NKYA 4OLPA 4ECWA 2CUYA 3KJVB 2DVIA 4DLGA 1FRXA 4K0KF 3PYEA 1R0CB 2FVCA 4W98A 3QT8A 4K8RA 3BQ1A 3J7ZT 1PBAA 2HK3A 4USKA 2DEJA 2F9DA 2BYCA 4MIAA 2GO8A 4U7UK 2JX2A 3BKFA 2B7CB 1NK0A 3ZZPA 3VTIA 3S01A 1U6FA 3IR6B 4C8OA 2EG2A 2DR9A 3MM5B 4DL4A 3CD0A 2ASJA 4NWBA 2PA3A 2EVZA 3MMCB 3RAXA 5ETQA 4Y2IA 3QGPA 3NS7B 3DGPB 3LOUA 1RHJB 3CCUS 2IRUA 2KHCA 3LALA 3TOQA 3CCQS 2WONB 2MZRA 4J7CA 3PW5A 2BJ1A 4MH8A 2CYYA 2UVWA 2UXBJ 1SH3A 4H4OB 4JP8A 4U95A 1WC5A 2IVFB 3SCIE 2HHSA 4ANCA 3BGFA 2AIRB 3EGWB 3PHEA 2HGMA 3AA8A 2CJAA 5J1PA 2XY5A 2ZBCA 3D9BA 1S97A 3DHXA 5BYQA 2RILA 1K9MT 2ATCB 1ZPVA 3P3DA 2BJ3A 3SEOA 3PX0A 2HK2A 4LQ9A 3N6MA 3TEHB 1DTTB 1SI9A 3VALA 1RACB 1DLOA 1CS4A 2DNKA 2WK4A 4NCGB 2EFPA 4PG7A 1HNVB 5JMNA 2DXFA 1FXLA 2VFVA 3MD1A 3IFEA 2CJ9A 1KQKA 1NPKA 1RADB 4ZA1A 3M8QB 2XNQA 2QA4S 2Y1LB 4PXBA 4MAKA 4LUBA 1FRIA 4NLXA 4NXMF 3AQPA 1WKLA 3G6VA 2CJXB 2Y1IA 3OFHA 3R6LB 3KLHB 2LQBA 2BEFA 2R7SA 4H4MA 4J37A 4YDXA 1NJYA 2W2NP 4IDKA 1D3WA 1YTYA 3QLHA 3W1YC 4KT0C 2BKNA 2VV5A 2HS4A 1VR6A 2R4FA 5MLCV 5F8GA 2JC0A 3C14B 5ITHA 2H4YB 3O6QA 3CIMA 4WPAA 3W8GA 1TL1B 3B8HA 2KG1A 3BR9A 5LJ3Y 5EDWA 1WC0A 1VYAA 3QJPA 2GX8A 3NAHA 1L3UA 5ETPA 3W2VA 2LEBA 4AL7A 1H74A 2CA9A 1U47A 2QT7A 1QTMA 3VZHA 4LJMA 4MYUA 3MDFA 4LRBA 3ZZ0A 2NSCA 3QRRA 3ET6B 2HVIA 2VZ9A 2HQFA 2BXJA 2B43A 1B3TA 4FXWA 1F1BB 1JJCB 2AJ2A 2K06A 3UDEA 4F25A 1ZYQA 4DU7A 2HNZA 2GV1A 4DR6J 2L3MA 2ZNYA 2R7RA 1TK8A 1OPZA 5GMKa 2OEMA 2XWXA 1LFWA 2LMIA 2AJQA 1VIOA 3C6TB 4ED0A 3CCMS 5G0RA 1XNQF 4UT4A 4ZIWA 1ZOTA 5HMZA 3Q2TC 4PG5A 2C2OB 3ZTSA 1WOSA 1JLEB 2CNKB 3B54A 2C2ZB 1HHTP 3HXMA 4RWWA 1EQMA 4UQTA 2GQQA 2Z58B 4PABA 1PBUA 2B4PA 3RAMA 2FGOA 3M6XA 1YVFA 3PRDA 1WEZA 1ULRA 3MEEB 4K4XA 3CCWA 1J5OA 3UD5A 4P2XA 2VUGA 4HACB 2XMUA 4OX6A 2MQ8A 1SB6A 5KFVA 3GP9A 4UZCA 3DLEA 1HNIA 1SJQA 2DHAA 2F4VF 3TUIC 1N5YA 1IBKF 5B7WA 2NZCA 3PIPQ 4EUVA 1YBAA 2BR0A 4O3QA 5C42A 1S1WA 3CWJA 4LFBF 2ASLA 1U0HA 1RISA 1Q16B 1S49A 1JKHB 2PFDA 5HAOA 3DMJA 3G87A 4F4ZA 2V9KA 2R8KA 5C24A 1RTDB 2DT9A 2KO1A 1KONA 4E2FB 3ZXWA 1RI7A 5JUMA 3OQ2A 2LVWA 1EETB 5K14A 4H4KA 3W3SA 3N28A 4USUA 1K0TA 3CB4A 5I3UB 5U47A 3EZOA 4JV5F 6AT1B 3FNNA 1T05A 1TELA 3MM6A 2KXNB 3BBBA 3ZZTA 1EP4A 1AB8A 2KB2A 4W90B 5K8NA 1RT4A 2B8PA 2V8GA 5J2PB 4I6YA 1FT8A 2JFKA 1QLNA 5CYMA 4OYOA 5HVFA 3Q22A 1G7CB 5BYSA 1X4DA 4K0KJ 3MPWA 2C3YA 3M8PB 2MKHA 3R2DJ 1RT5B 1FFWB 4O3RA 5L1JA 1G2EA 3JAMY 1X5PA 4AXIA 3QYYA 1B64A 1N0UA 4DF8A 1VQ7S 3LP0B 2QSFA 3OVBA 4DQQA 5EWEA 1S4FA 3CJ5A 4QIEA 5J2NB 4R5PA 3T3FA 2FUG9 4HHUA 4I4BA 1XJWB 5AJ3J 1EZZB 3I0RA 1M5PC 5F41A 2G13A 1IBCB 1WI8A 3DOLB 5IT9U 3H98A 4ZVGA 4NLYA 4HHHA 5CCMA 4F50A 5KG6A 3J80Y 1JQGA 4QWEA 3CSKA 3QT6A 1UEVA 2JLGA 2VA3A 2VFSA 3UFCX 4A8FA 2ZHAA 4C8LA 2D69A 2BDPA 5LSRA 4OX7A 4F0HA 4TQRA 2BW7A 1OY6A 2CNOB 2PD1A 4C3LA 4J90A 1N0VC 1SJ4P 4J9PA 1KHWA 4ZK7M 4U8VA 2E7WA 1D9DA 2R9LA 1YJUA 1RCXB 3R5CA 4JOUA 1PGZA 2DR5A 3VAMA 2CRLA 1R0AB 1HQEB 2BX6A 3WDOA 2C22A 1C1BA 1J2VA 2C42A 3R8YA 1CLFA 1HI8A 4LQ3A 4WFNQ 3OTOF 1GMUA 4KHMA 4ZS6A 1AXQA 1S1TB 2GCFA 4MIBA 1EQ0A 4Q8FA 5IV4A 1VHFA 4H54A 2JC1A 3Q0AA 1N6QA 4QR1A 1KLMA 2XS7A 2J9DE 2UXCF 1KQSR 1QAJA 5D6GA 3EXYA 2VBYA 2HHUA 4N41A 1EKRA 3JSMB 3SV4A 2VIHA 4I56A 1RE1B 1I5OB 3VGVA 1YJ7A 2XLIA 4ECYA 2A3JA 2H4WB 5A2QU 3KG4A 1HFEL 4M5KA 4ZN3A 5AE2A 2N7CA 2ACYA 2ZBPA 3MR3A 1AFJA 2NXJA 4P7TA 2F4FA 1S57A 4DFKA 4LF1A 2DNGA 3CJKB 5M2PA 3R9LA 4LT6A 5LXYA 2FQQB 1Y7PA 3PACA 4ICLA 1Y3JA 1RJJA 2CPIA 3GFXA 2UP1A 2VQEF 3EYZA 4RUAA 3PW7A 3G8QA 3GFYA 3PYGA 2OMLA 3GSIA 4X4RA 4FYVB 4XAKA 1IQZA 1IBMJ 5GADI 4UW2A 1XMOJ 1BLUA 4OI0A 4FYYB 2AMCB 4O4GB 1Q78A 2FLOA 3E3XA 1U1LA 2CFXA 2CZVC 3P96A 1NEEA 3TAPA 1QSSA 4PPDA 3BBFA 1WTBA 4MYTA 3QMQA 3LP2A 1KOOA 3L3CA 4DX7A 3FBFA 4ZVSB 4I0WA 4J9VA 3M6VA 2LEPA 1WF1A 2GS8A 1XNQJ 2CQCA 1YBUA 2YNGA 2AGPA 4L73A 1L3VA 2W9AA 4EBDA 2LU1A 2M7SA 1X5SA 3T5HA 4WP9A 1YKWA 4LF4J 3KLIA 1JWWA 4PPZA 2NLWA 1CBKA 4F36A 3P5BP 3EGVA 5MAOA 2WHOA 3KDNA 3K8VA 3MEGA 3GSDA 1SV5A 1QJHA 1FJCA 2GIQA 2POKA 1UVMA 1MN7A 4PWWA 4JI6J 5D4LA 1RT6A 3R27A 1C1CA 4DV0F 4X4PA 2YKMB 3QFHA 5D3GA 5G4DA 4CNZA 3AXMA 3FUYA 4RBVA 2EFGA 2BANA 3HCXA 4CT8A 4OHWA 3DRXA 3PKMA 1RT2B 1UA0A 4P2MA 3M1VA 5C2CA 3HSZA 3BS9A 4LRAA 4BWJA 4KH0B 2F4VJ 3AJDA 2W4DA 3NXZA 3M6UA 3GCXP 3CO9A 4KRWA 4LFBJ 1NJIT 2U1AA 2DNPA 1Q4RA 4B3SF 2X1FA 5ETNA 3VVUA 3FDSA 1S0OA 3DLGA 5J1NA 4Y6IA 2PGCA 2Y1RI 4F26A 1VDHA 3J7AN 5T7LB 2YVSA 1B7YB 4TN2A 3H2VE 1T11A 2MTLA 1Y10A 4JV5J 1VQ5S 2OELA 4QCLA 3V6DB 1E6YA 2CWXA 2QG9B 4G1QB 2E5HA 5GAGU 4L75A 3VAIA 4KH1B 2ALZA 4XDDA 3TWZA 2M9KA 2GFFA 2FJEB 1OQ3A 3UE2A 5BJRA 2Y8YA 3T5KA 1RT1B 3BH6B 3JQKA 3A8KA 4KKOA 2R7WA 1S1XB 1N34J 4DI6A 4S0MA 4X2BA 3SCLE 2HQGA 5H9FK 2A2CA 1DTQA 2IMOA 2QE5A 1X0FA 2MSSA 1QAYA 1C4AA 3TVZA 2Z57B 2FHJA 2ZEJA 4J9UE 2AX1A 5GMDA 1UAWA 1NBEB 1LW2A 4EWTA 1U8SA 1A6LA 3J7A1 2J6SA 2DH8A 3TW0A 3W64A 4Q45A 3DLJA 4RUHA 2DGUA 3UR3C 3BDPA 2DJWA 2XS5A 2RRBA 5CA5A 5EUHA 4CCHA 1J5EJ 5A8KB 4A47A 4NI2A 3SZ2A 3J7Z5 2DHHA 3R7NB 1M1KT 1RT7A 4C8YA 2DCLA 4ZN1A 5HLFB 1HLWA 3ZC4A 2M8DB 1SCJB 2F65A 3QJJA 2HYIB 2DIUA 5E2QA 3BQ0A 1WKJA 1N33J 2HHTA 1PJ6A 4TNOA 1NB2A 1WD6A 3IP0A 2VQFJ 4LFCJ 1N5TA 1M5OC 3D2WA 3I9ZA 4Z7CA 3SCJE 4DSIA 3MM8B 3PJWA 4DZDA 4AL6A 1HBNB 1ZZNA 2VG5A 1MW7A 2ZBQA 1LQ9A 4DPXA 3P45B 4DV2F 1LWFB 4RW6B 3CPWR 2UXCJ 3AT1B 5A8WA 4IFVA 3MMAA 1RAJA 1OYEA 3DYAB 2QMWA 4OI3A 1UEUA 4NMXA 2HBRB 1FWLA 4H4KC 1CJTB 3GTYX 5KT5A 4P72A 1CJUB 3KHGA 1VRUB 3PZPA 4DV4F 3M30A 2JEJA 3A12A 4CTAA 5FD1A 3V6JA 1NSAA 2FJBB 3M2RB 4RKUC 1SQEA 4DLEA 1CQMA 4DR4J 1EKSA 3VVTA 2O01C 2ZH5A 2UZAA 3SQGA 3TX0A 2QGFB 1FTCA 3GQCA 3T1YF 1T02A 1RB0A 3LP1B 1G4CA 1X4AA 4DSLA 2FHJD 2M4MA 4ANEA 2MKKA 3PR4A 4B9TA 2KT2A 4XK8C 3R7BB 2DGSA 3L7PA 3OR2A 3BO4A 2W9CA 3KK3B 1WG4A 1Z1ZA 3V6KA 5LJ5Y 4KGZB 1RWUA 1YZ6A 2CPDA 3QRPA 3CTRA 1ZBTA 2R7OA 5K9FA 4LR8A 4B3OB 3MCNA 2O5DA 2HIYA 1F2GA 2RE1A 5KFNA 3HJVA 2RKIB 4XPEA 3HVRA 1FFGB 1YJTA 4RW4B 4TU8A 4EMDA 2EC0A 2BJ9A 1F3FA 2J0WA 1GAOA 2FZCB 4U9RA 2H5JB 4DV0J 5SZTA 4I69A 5AE3A 2Z2ZA 5F9LA 2OLWA 1Y4ZB 1RAFB 2FY8A 1FI4A 2MQQA 4PCQA 1ROFA 3QIPA 1UA1A 2XYPB 4RUBA 3DN9A 3NP5A 2B8QA 3PHTA 2WW8A 4CYUB 4CRJA 3AQOA 4X4TA 2VBZA 1S77D 4PKDB 2DRDA 1FRMA 5FDLB 5B0AA 1JLQB 3PYFA 2KVIA 2KFZA 3TNVA 4B17A 1SIZA 4WK3A 5C25A 4K4ZA 1IJEB 2MZ1A 1TKDA 1KTVA 2ZZTA 2DTJA 3R5GA 4O4RA 1DZ5A 2JLFA 9RUBA 4IRDA 5A0YB 5KG5A 3FCWA 2B9WA 2J9EA 5AXMA 3EZUA 4TY9A 3CC7S 3ENQA 2HNDA 4J5OA 4LRDA 3AOBA 1WHYA 4KR0B 2EBEA 4RX6A 3CCES 1R7IA 2W2OP 3K5OA 4EGLA 2YNIA 2FJAB 1BQNB 5CHCB 3ZTPA 3DNCA 1LWCA 1SXLA 4PG8A 2V2KA 3SSSA 4Y0FA 3JQJA 2RT3A 4PQUA 4M5NA 3T19A 3M9OB 5DDQC 3MCMA 3OTDA 2SXLA 2DR6A 1IKVA 2EFNA 4CO1A 5GAEU 3K89A 4R8UA 1LW0A 1I94F 1KSPA 2AZ1A 1F5AA 5HMXA 4DL0C 3F0NA 4GVLA 1Q8IA 4YR2A 4L72B 3CCTA 3I96A 3ILJA 2AJ0A 5L9XA 4BC7A 4IH7A 3QAEA 1GXLA 2I0XA 3FEZA 2UUCJ 3IS9A 4ECZA 3G6YA 4PYDA 2V8VA 4OI4A 3P5TL 4NYOA 2WSCC 2OPRA 3GIMA 3SV3A 2NPIA 4HT7A 1KBRA 2KDOA 4OYZA 4G6VB 1CS4B 4DV1F 2IJNA 3FSYA 4USTA 1DHMA 2VFTA 2H1YA 3BEGB 4NASA 3MMCA 2L41A 2LKZA 3G6ES 3JQMA 4CLTA 5GVQA 3RAQA 1WF0A 1HNXJ 4RL1A 3I4HX 3DLBA 2VD3A 3C3LA 2MQOA 5CQGA 4IR9A 4RNMA 3CDEA 3OSPA 4TYAA 4CM2A 4NLQA 4IDKB 1TL4A 1NCLA 3QLHB 4USJC 2ZJRQ 3HT3A 4PG6A 4USVA 4Q44A 3D4JA 1XMBA 1HW8A 4RO0A 1O0PA 1FWKA 2LA6A 1H38A 3FBBA 4W4MA 5T14A 2PDAA 4DV2J 2Z30B 3HT0A 4Y28C 3I55S 2HURA 5HO4A 2DBBA 4EO6A 2AEFA 2C2KB 4KV8A 5JXSA 2B9XA 4WP3A 3AJ1A 5D4NA 1RBLA 1DTTA 3W2VB 4ZIVA 3U1MA 5K5MA 2M0GB 4NA3A 3FEYB 4QPXA 4MMOA 5CXTA 1HNVA 4X64F 1IR2A 1N48A 1L5UA 1BQMA 4DL3A 1PC4A 4K5RA 4M95A 2HFUA 3OT9A 5EWGA 1X9WA 1FE0A 3BREA 1ZETA 2OPPA 2FZGB 4WE1B 2HVZA 4OZ2A 1WEYA 1Y00A 4ZVEA 4FS1A 1FKPB 4J9SA 2XBPA 4ZLLA 3UW1A 3OSNA 3KG0A 3K17A 3PY8A 2C2RA 3T1YJ 1WKKA 3R1LA 2XMJA 4ZPDA 4M8LA 4JI8J 1P1TA 2M8HA 1TP7A 1TV6A 2I9SA 4QR2A 5G0RB 1SKSA 3QZ7A 2WB4A 3KYLA 3X1LB 2L9DA 2AP6A 2NXCA 3PR5B 4KGKA 2YBVA 5KFJA 3CT9A 1WDDA 2BOPA 4A46A 3MAAA 4JI0F 4ATNA 5L1KA 1KP6A 5HVGA 5A2QY 4AQYF 2FTRA 4NX9A 1JLCB 1YJNS 1XC9A 2PFFB 3HHEA 4YR3A 1J5OB 3P4UB 2ATLA 3MR2A 2MGZA 3KXDA 1Y11A 3HVWA 5DRKA 1FXRA 1U6ZA 3OL7A 1YZ7A 4ZLNA 3CCRS 1T9VA 1TL3A 3LPEA 2DXEA 4ZP7A 3DLEB 2IYGA 1R6YA 1N5YB 1OWXA 1DJ0A 2K2PA 4LVNP 1S1UA 3EM1A 5C42B 1S1WB 2DNYA 5KFBA 1NHVA 5HBMA 1NK9A 1UETA 2RQ4A 2XB2D 5C24B 1RQ0A 3PRBA 2VH7A 1MSWD 1CSJA 4PEOA 1N36F 2GW8A 4P73A 1W25A 2YKAA 3CIZA 4WBFA 2DGWA 3CJRA 4CLZA 3EZ5A 4LF5F 2HHHJ 1SJRA 3ENAA 3IM9A 1LFPA 4ANDA 1RT4B 4M5LA 2BQ3A 3ZZOA 2NXNA 2V4JB 3KLFA 4X62F 1RWKB 4CP5A 4O3PA 5CYMB 1KQGB 2JNJA 3MEEA 1D9FA 3FEXB 1IJFB 1K44A 1WG1A 2EFVA 2XEXA 2N4DA 3H8YA 3R3TA 1VMBA 4AYBD 1RAAB 3NNCA 1A0OB 2YWFA 4P10A 1QAIA 4ZVFA 1NH7A 2VG7B 4LF9F 2X3DA 4IO9Q 3PV8A 2E1RA 5DLFA 3KJQB 4ITSA 2HZAA 1JKHA 3I0RB 2QL9B 2CWKA 1Q5YA 2IRXA 3IM8A 3A1YG 2Q1LA 3PJXA 4HDHA 4OHZA 2IC3B 2B4UA 4ETXA 1QVFR 4KPCA 1FNXH 4LFAF 2XCPA 1VHIA 5F8LA 3GIIA 3OW2R 3GONA 1N54B 4I2QA 1YI2S 4DFJA 1I94J 2V5HG 4ZPTR 1FA0A 3O3LA 4GRSA 3FK4A 3UDVA 4LRFA 2I38A 2DRAA 2NXEA 4AL5A 1SUQA 3EGZA 2RVJA 3VQSA 2CJQA 2A18A 2VB6A 5BR8J 1RZMA 2F5GA 3GLJA 1TKTA 4HR2A 2O66A 3K59A 1GK8A 2ZUAA 3AAWB 8AT1B 1ZAXA 1SKRA 4WZQA 1RAEB 3KUHA 4GO5X 4JI3J 1B0VA 2IM3A 2X3GA 1V9OA 1T9XA 4AFFA 4P52A 1F6TA 4EBCA 1YSJA 3RR7A 2ZC4A 3D6MB 3NEKA 5JJBA 5J2NA 2I2YA 4UOGA 1C1BB 3W2WA 4NXNJ 3QO9A 2ROEA 3DOLA 5LSOA 3ADAC 4DJBA 3PO4A 5H9EJ 1KLMB 4F02A 2WBRA 4MK7A 3SSQA 3WIUA 3N4WA 2FZKB 3GYGA 2OHDA 3GYXB 2BBEA 4DR5J 5DG8A 1F9HA 4FYXB 2CVIA 3OFGA 4OV6A 4OI1A 4NLGA 3THTA 4DV6F 4XIUA 3TQ1A 1DQ9A 3KUGA 2RDDA 2DY1A 2A1BA 1X9MA 5KFUA 1VQ4S 4URSA 3A8IA 4ICLB 2BZ2A 3KUEA 5F8NA 1YJWS 1U2CA 5KFTA 3D0GE 3G71S 1VLYA 2N3LA 4GKKF 3B78A 4DUZF 1F9FA 3BGUA 3M8SA 4CZCA 4CLUA 2PC6A 2XM3A 1HL6A 4KB7A 4QWCA 4P9SA 2XLJA 3G9CA 3JSYA 3PW4A 2RAQA 3PNIA 1R8HA 3RZAA 3IBCB 3EUNA 2NUUG 2KU7A 4O0NA 3UR0A 2AGQA 4KO0A 3LP2B 3VGTA 3JSMA 1K47A 2E1PA 2ZM6J 4DR1F 2QLFB 4PZVA 2HBQB 3V81A 2KVQE 2YKQA 1YRUA 2Z2LA 1NU4A 2YNGB 4A8MP 1VC6A 1JMTA 4ZITA 3KLIB 4RNNA 3PM9A 5ETMA 2N4CA 2LDYA 4I7FA 3EMTA 2RNEA 3MEGB 1SV5B 4B3TJ 4GMKA 4B9VA 4LF8F 4JI0J 4DQPA 2HZVA 2B51A 5JVHQ 3NWGA 4DS4A 2LCWA 2KH9A 1C1CB 4ZCLA 2XO6A 1S79A 1YLXA 1WOOA 1RDRA 4O44B 2BANB 1N5SA 3D68A 5IWAF 2YQ0A 3WIVA 3K2YA 2P6TA 3MAQA 2IDLA 4Z2XA 4V19J 5B08A 2FC9A 4HH1A 4UOCA 3M1VB 5E3CA 2WCXA 1W2BR 2DISA 4KAIA 5L38A 1XR6A 4WXWA 4WFZA 1V5IB 3OVAA 1LXNA 7FD1A 1X4GA 2UUTA 5KOWA 5T41A 5DQGA 1LWEA 3Q23A 1APSA 3DLGB 2ZKUA 4CLFA 2UXDF 4OYPA 1D1UA 2ZDPA 4U7UD 5D0EA 2VDIA 1S48A 4X66F 4X84A 4F04B 1FRLA 5BYRA 3U02A 2K3KA 4CLPA 3QT5A 3ZZZA 1PCAA 3RW6A 2WVFA 4HT5A 3O2IA 4MK9A 1DQAA 1O8BA 1R27B 3EWGA 3R6GB 4X62J 2D1CA 1SH0A 5AT1B 2XO7A 2CQ3A 8RUCA 2QL7B 3EGNA 4ZVHA 3PIOQ 2F8HA 3BN7A 2ZVSA 2Z2YB 1RWMB 3RJMB 2JH3A 2BE2A 2OPQB 1UVLA 3HVAA 2P2CB 3U27A 2WAQD 3CJ3A 2DNZA 1DTQB 2CZ9A 5LXRA 2K8GA 3WC2A 2YNHA 3N9UC 2FHMA 3PJ9A 1VIXA 2YKPA 2GZOA 1UPMB 2V4RA 1VQ8S 1RT3B 4RW8B 4YHHJ 3R5AA 4ALZA 4C8NA 2B4VA 5IXUA 1NUEA 1LW2B 2M88A 1ELOA 2YTCA 3HI9A 2HKEA 3JTOA 3BZQA 5LOQA 4LFAJ 2BUNA 1RHUB 2NPFA 1LEOA 3V6DA 4OX9F 2I8EA 1S9EB 4D3HA 5F0UA 4G1QA 4NLOA 1BY9A 3TP2A 4F4WA 1XN9A 4IG0B 1TMMA 2EK1A 2V4QA 3CCZA 4ES3A 3K8WA 1NAQA 4DHVA 3NS6A 4LIRA 1O6XA 4NL5A 1TAQA 1RT7B 4DPWA 1ACMB 4U96A 3KKFA 4DV7F 1X0PA 3H4DA 4B02A 2ZVIA 1ZM3A 1FKAF 1S1XA 3NG8A 2JDJA 2KT3A 5ETKA 3NCQA 4DR3J 4NLWA 4IH6A 2Z0GA 6FDRA 2ABYA 1Q1KA 1IUJA 2VKRA 3B4DA 3TVKA 1CEZA 2X1BA 2EW9A 2J6UA 4LREA 2VBXA 3TZZA 1M5HA 1JJHA 5C7PA 5F9NA 3N5BA 4URGA 2HWTA 5A8WB 4IFVB 2HLUA 3MMAB 3GJQB 5DS7A 3CMAS 2CPJA 2GHPA 1H0HB 1TKZA 5LMUF 3O5TB 3BV8A 1FNMA 1DQ8A 3QIDA 3CDUA 2HLTA 5AXLA 5A8KA 2W4PA 4DV6J 1RTIB 3M30B 2KJVA 5CZXA 2AW0A 4UUXA 4FF1A 4OYXA 2F63A 4CTAB 3GJSB 2U2FA 2YNFA 1YBTA 5E5NA 5HLFA 3OD2A 2GGPA 4K50A 3H42A 1EARA 4IQXA 4YB5A 2MQMA 5F3TA 3SQGB 3PYDA 1VQPS 4DUZJ 1ZAWA 3IN5A 2V69A 4RNOA 4IOCQ 2XHCA 3I56S 1RABB 3HKZD 1K1QA 3NWRA 3PDNA 3BKUA 3RW7A 3EPGA 2Y3YA 3S1TA 2MZQA 2IBOA 2GAGC 2W1BA 4Y2CA 1RWXB 3OR2B 3TI0A 3FCVA 4K4VA 2WZ1A 3H59A 2W8KA 1H72C 3AY0A 2ZBIA 2HWHA 2NZ4A 4DU8A 4KGXB 4AUKA 2CQHA 1YITS 2HQDA 2CQIA 2RJZA 4RU2A 3H40A 3CEDA 4DR1J 1TK0A 4M5DA 3J7YU 4LSZB 4FDFA 2PMZD 3LGNA 1FWPA 5H1SV 1CJUA 2ASYA 1RUSA 3N6LA 2GMHA 2MKSA 2ZH2A 3LWLA 1FF2A 1RSCA 3AODA 2ZJQQ 3M2RA 1JX4A 1S6QB 2EFOA 2ZOFA 1RGVA 2DIVA 2GA7A 3NAIA 2PI4A 3QAUA 4DCJB 4F0MA 1NK7A 4WTOB 2ZH9A 4DR6F 4NYZA 3NY0A 2MLXA 3DXBA 5IWAJ 2KM8B 2MZSA 4DQIA 5L8RC 3QIPB 1HARA 4CO3A 3RB4A 5IFMA 3D6FB 1DRZA 2QA2A 5KG0A 1NH8A 4HI1A 3KDOA 3MECB 3AH6A 3D6TB 4J9OA 1HR0J 3LO3A 3VAJA 4QJVA 1S0MA 4UTGA 1R3NA 3F41A 4E98A 1VBYA 1JLBA 3WX8A 4WCEQ 3QSYB 3BKTA 4OZ5A 2DY9A 1AROP 3DM2A 1Q86T 1JLFB 3HFVA 3N01A 2B9YA 2KJWA 4X65J 2YX4A 2ZFHA 4OQJA 3QGIA 1SJ1A 2E7VA 2GQCA 2YY3A 1XQIA 2RU9A 2MDAA 1T9WA 2HHQA 5JVGQ 1XIQA 2AU0A 1X4HA 2PEBA 2W01A 2R7TA 4CIOA 3M9NB 1SH2A 3K7RA 3CJTA 4WFAQ 2W7PA 2HQCA 1IM4A 3EXCX 1SC4B 2CJYB 1PO6A 2AEMA 1LWCB 4N76A 4FVMA 4ILRA 3O1LA 2DNNA 1XMQF 4EYHB 3DDKA 4ZKAA 2P9CA 2FC8A 2AKWB 2KL8A 5A6WA 1IKVB 3D7SB 5DO2A 3Q24A 4R8UB 1Q8LA 5L1IA 3L9ZA 2KZMA 4ZPVR 2PMWA 3UWTA 2DNLA 1NKBA 3ISZA 1BGXT 5KFRA 4OIXA 3A8EA 2EPIA 5HJXA 1RK8A 3LQVA 4L3NA 2JZ5A 4WYWA 3CJSA 3IS9B 3D6HB 4IOAQ 4K59A 3C66A 4R0EA 5A0YA 2OPRB 1RA7A 3E2EA 4OX9J 5EX0A 1B0PA 1D0EA 3OTEA 2EC2A 8ATCB 2RF2B 1W7WA 2FVPA 2AWZA 4USWA 2ZOMA 1X4CA 5AJ3F 1FJGJ 1BQNA 4OZ0A 4K4WA 4N7TA 3OBIA 3PG9A 3H5YA 2XMMA 3IBFB 1X5TA 4DV7J 2XQCA 2Q79A 1WSRA 3GE9A 2D3OR 5D4PA 1KC8T 4OHVA 1N4LA 3GV5B 2RRNA 2C3UA 3TUPA 5DDPC 3MMJA 2XI3A 1RU2A 2KTQA 1H3DA 2OD6A 2HIQA 3C8YA 3PFEA 1KFSA 3AXKA 3MPUB 2JEIA 3JTNA 3HFKA 1R8BA 2DEIA 4ZVRB 2IBKA 5ADZA 4WFBQ 3CCVS 2QSWA 4K7QA 4JV1A 1FD2A 2VODA 5KFEA 1VQKS 4KTQA 1Q7YT 3CJ0A 4RW9A 2O1PA 4ZCIA 1JJ4A 1X4EA 4KV8B 2WVCA 2DK2A 1TUVA 1WSVA 3PCOB 5LMUJ 3IWLA 3M32A 1RWPB 1MU2A 2HHXA 3GZ7A 2VPXB 2IJFA 3W66A 4F4XA 4GKJJ 3M4XA 1T3OA 2GIFA 5B09A 2XZTB 4WP8A 4OX8A 2V94A 2CJKA 1BQMB 3HFZB 3P8BB 2DHXA 3HHDA 2CQBA 1HWLA 2OPPB 3ISND 4D3GA 4ECSA 1OY8A 1LXJA 1CC8A 5J1EA 1JB0C 2XLKA 3K5MA 2HRTA 2YX7A 3AD8C 1SC3B 5IC4B 3SMZA 2E7XA 4UY85 1CC7A 3ETOA 4OZNA 5KG7A 4CH0S 3K0JA 3A3NB 1IWAA 1KN6A 4DSEA 1FX2A 5HANA 4WFYA 1TV6B 4KE5A 1JXEA 5KFHA 1UVKA 4PAAA 1UJ5A 1S99A 4F4AA 2BQUA 2FDNA 3H5XA 2GJIA 1GTEA 2AYBA 1RBOB 3KHLA 4DFPA 1U1KA 1H2UX 2LQ5A 4AD6A 3I5BA 3SYZA 2CAJA 2QEXS 5EGYA 2XZDB 3MAHA 3MAAB 4FYDA 2HEKA 1T95A 4MKYA 3AD9C 2RS2A 2HWIA 2I1RA 2QV6A 3CVKA 1YHQS 4DUYF 3I87A 4FP9A 3W65A 3JYTA 3CDWA 2MGZB 1IBMF 1TQLA 4EYIB 1FFSB 1XMOF 4EK2A 1UVNA 2KHDA 1TL3B 4QIFA 4JV0A 5GADU 1NJWA 1K0VA 4WE1A 1UEKA 4M1KA 3DRPA 4FVCA 2YPYA 2RDIA 3TVYA 3SIPB 4OLOA 1FKPA 1S1UB 1X60A 3MWBA 4HEA9 5CZVA 1A9NB 3TA1A 2CDRB 3LWMA 5D78A 5HBMB 5J2MB 1C0UB 3GB0A 4PRFA 2DH7A 1IR0A 3S7RA 2FJWA 2BJDA 5LM7E 2HMIB 1VISA 3EPIA 1NLKL 3WX4A 2N3OA 4DPOA 1TUGB 4ID5A 2N7YA 4CI0B 1V6HA 4LF4F 4QZVB 2HRYA 1HD0A 2ZC3A 4RBTA 2B9EA 4LRCA 2HNYB 2J0SD 5M2UA 3CJQA 3DI6A 3H2UB 3KLFB 4PWDA 3VV2B 2GQ2A 2CNNB 4JI6F 1Q7LB 3WZ0A 1JLCA 1X5OA 2ALYB 4JI5J 4WF9Q 1Q82T 2KYXA 3RRKA 2Z8QA 4F8RA 3ELHA 3SCKE 3TJ9A 3M8YA 3BN4A 4L6V3 5KFLA 1NSPA 4CO4A 4HDGA 3RTVA 3MR5A 3SQOP 1U1PA 4LBPA 5B0CA 1DY3A 4A8OA 5I42A 1TL5A 3V4IA 3IRWP 4QPTA 5J2QA 4CLLA 2RQCA 4ZP9A 4I68A 4JBCA 1Y0HA 2IA6A 3HD2A 2HSEB 1CJVA 3GCWP 5KFCA 2HW3A 1XMQJ 1FESA 4M5HA 1NK6A 2BQRA 1ZA2B 1U1OA 1UFWA 2BM1A 1D8YA 2AV5A 4I2QB 1TZ0A 1TUWA 4I6WA 3BPDA 2R7UA 2IA0A 1CG2A 2V4JA 1WACA 3R5DA 4FF3A 1SUQB 4CLKA 2GVDA 4W92B 1RTHB 1TKTB 1U2RA 3ENVA 2W9BA 1C4CA 4JI2F 3QSIA 1RLDA 3MOJB 4UF4A 3I0SA 1F60B 3BPSP 4RR5A 1N34F 1M0SA 2VG7A 1S6PA 4C3MA 2M3DA 2AJ4A 1YG0A 4J9LA 3O8WA 3GPAA 4NZ0A 2H5EA 4KHRA 1S9GA 4CNYA 3W2WB 1T94A 4KYZA 5E41A 5AXKA 3R1HA 1SKUB 4DG1A 3QO9B 4OYMA 4M5GA 1XNRJ 2IC3A 1YRXA 2EKYA 4RNHA 1PJ5A 3FVYA 1YWXA 1B4SA 3TAMB 3B4MA 1VQYA 3GG0A 2XHWA 1MLAA 3GFZA 5DG9A 3ZZRA 2UUWA 1VBKA 1Q5VA 3FSIA 1NKEA 4A8WA 4LF6J 4Y34A 1J5EF 1NM2A 2PN6A 2NXUA 1DARA 1WJ9A 1YQHA 2D3O1 1KVKA 4DX5A 2IAJB 4QW8A 3IGNA 2BJEA 2D3ZA 4YY3J 3CO0P 2G0JA 2L9WA 1FXDA 2BKOA 4F3MA 3I4PA 2E1CA 2W7AA 4MTPA 3VHQA 1QUPA 4PQAA 1N33F 2XYGB 4ETZA 1HBUA 2QA4G 5KT2A 2VHGA 2HS3A 2VQFF 3IA0A 4EBEA 4LFCF 2EI5A 4J9QA 3DOKB 1IKXA 3C15B 2FB0A 3RYLA 3DLKA 2VL1A 3NCPA 2BABA 5F8JA 3RBDA 2XMAA 5GMEA 1T8EA 1HQ2A 1OYDA 2C2MB 4KO0B 2ERRA 4XDCA 1XR7A 4ZVQB 2E5LF 2IMWP 3ILLA 2AF6A 5A6PA 2KFNA 3CC2S 4A8KA 3PFOA 3V81B 2L48A 2J7UA 2MJUA 2QYGA 4A8QA 3OXLA 5HI7A 3HHNB 1UWAA 1SL1A 5KT4A 4LR9A 4MIWA 1ZH5A 5LSLA 1VFJA 5EWFA 1RKJA 4I7FB 2MQLA 3BJYA 1N32F 2HZCA 4DR4F 2DNOA 4DPYA 3P6YC 3MPVA 3MFIA 4QQBA 2G4BA 4DUYJ 4YS2A 2MMYA 1R31A 1R8CA 4X4VA 4K4YA 1JNZB 3LPYA 2G2OA 4DV3F 3DU5A 2MKIA 1YGYA 2JHEA 4X4UA 3MTKA 4OZ1A 2QTWA 4KSEB 5B0BA 3DLLQ 3MURP 1URNA 3SXLA 1SQFA 3TA2A 3FZ2A 5CYQA 2WOMA 4MK8A 5M2RA 5KG4A 4ZVUB 1LWEB 4DFMA 3AA9A 4ZOSA 4ELTA 1YDLA 1P8GA 2BM0A 1AYEA 2JVRA 1S12A 3IRXA 3I32A 1J27A 3HDSA 1QTNB 2OTLS 3NNAA 5CABA 5IV3A 1REVA 2V63A 2MJNA 2DRBA 2OO4A 4HL9A 1VQLS 3ZTQA 2B4OA 3F56A 2DR8A 1TL7A 3FQKA 4QWDA 2QLJB 1Q0NA 2JEGA 4B3MJ 3Q8PB 4OL8A 2PT0A 3GFHA 1TK5A 3ZO7A 4U67Q 5HL7Q 4O44A 3CULA 2XY6A 2D3UA 3KHHA 3Q8YA 4OYIA 2BE2B 4EEYA 3PVXA 3D3CJ 4HKQA 3KK2A 2IVYA 1FK9A 1RU1A 1YJVA 4DX8H 2YNHB 3HK2A 1QM9A 4RLEA 4DN9A 2UVRA 4ZJQA 3TZXA 3ETMA 3I6PA 1NKCA 3QGGA 4ZMMA 1GEHA 1UFKA 1HKAA 2RUSA 4P6QA 1T0TV 1KVIA 4I2PA 2WTFA 3NNHA 1FO1A 2QO3A 2RUGA 4WWSA 2MKCA 2OTJS 2CQPA 3UQSA 1NXIA 1F5CA 2AQ4A 2HPUA 5E3RA 4DX6A 3Q2SC 2HAFA 4YOEA 2AYMA 3TQEA 4K4TA 2XTJP 2B0GA 3A4TA 3QFWA 2GVZA 1QE1A 2HHWA 3NRBA 1M5KC 3V6HA 1KRPA 2XMVA 1VJWA 4JI2J 3HM9A 1RYRA 1S0VA 1JLGA 4RZRA 2OH2A 1E6VB 2OPQA 3OLBA 1SJ3P 3MM7A 3OHAA 2DGVA 2FY1A 2HHVA 2FGCA 3OTBA 3OLAA 1H73A 1AZSB 2VC1A 3FSXA 3LGMA 1ZTWA 1B99A 3DGVA 1WNEA 3R7SB 3CCLS 2DITA 2ZD1B 2FJVA 4OJHA 1RT3A 1SBRA 1EIYB 4RW8A 4CH1A 1FE4A 1B0TA 4FS2A 3L7OA 3FCHA 4MKAA 2GJFA 2UUCF 1BWEA 2K1RA 5IM0A 3MI7X 4YEAA 3EX7B 5IS2A 1WELA 3QBCA 1TKZB 3UPFA 1S9EA 2DNRA 2C28A 2IHR1 2CIMA 3TO8A 4IG0A 1VK8A 1FDBA 3BF4A 2C1EB 1C0TA 3CD7A 1KKHA 3EDRB 4M5IA 4IG3A 4TU7A 1ITPA 2YNFB 4DL7A 3RG6A 1IQTA 1VJQA 1FDNA 1KLNA 2GGPB 3UCZP 1HNXF 2ZZMA 2CDQA 2YX1A 4N77A 2R2TA 3M2UA 1UVJA 2IJRA 4F2RA 4KGVB 1HNWF 1UMJA 1X9SA 3NLCA 3HSGA 4CO0A 4YFUA 3M05A 2GAHC 2P8IA 1RYSA 4XPCA 3M8WA 4AT1B 4NEZA 5EN1A 2YKNB 2W25A 5KT3A 2HFOA 1HNZJ 3PX6A 2NREA 3UO0A 1FJEB 3QRQA 3G82B 4DSJA 4LF7F 1MROB 2OIHA 1NB7A 1I3OB 1NK5A 1IBLF 1FRHA 1AT1B 2NSBA 1OY9A 5K20B 3LANA 2CNLB 3CUNA 1SKWA 4YR0A 2E5LJ 1SC1B 1HW9A 4G1PA 2X7IA 4V19X 1WEXA 2VPWB 4M5DB 1UJ6A 2KZZA 4ENOA 2VG6A 3OTCA 1P27B 1RTIA 2E1MC 4MFBB 2G1DA 2ROGA 3H7HB 2AD9A 3K5LA 3BGRA 4WZMA 4ES1A 1R8AA 2QJ3A 4C0BA 3C6UB 1N32J 1F9EB 2YWWA 2B6AA 1SQGA 1DAXA 2AHOB 2FVQA 1W2IA 1HBMB 3NGUA 1AA1B 2CQ1A 2XMWA 2DHSA 2FVRA 2J7WA 3M7VA 1MWQA 3RRGA 4JI8F 2XMTA 1ZM4A 1K73T 5THWA 4DV3J 1CJKA 2BV3A 4KJIA 2PA8D 5IC6B 3HJFA 1SJFA 1YIJS 1LWXA 3MUVP 2V34A 2DO0A 1S4EA 3SFGA 3HX9A 4FKYA 1WC1A 1WHWA 1VC5A 1JLBB 2PO4A 2NUHA 3RBZA 2E66A 2GIRA 1KWMA 3Q8RB 3KOAA 1WTFA 4QIWD 3M2VA 2RHQB 3DM2B 4CH7A 3I31A 4ZHRB 3TZYA 4K4UA 4WKYA 1TFYA 1FRKA 3TJ8A 4BCAA 4DWIA 1O51A 2MZTA 1HD1A 4OYAA 3NMRA 2OP5A 2HBZB 4NLPA 4WFXA 1CQNA 1S6QA 2W7OA 4G3IA 4P2SA 4OZLA 5DZ6A 4DV5J 2XSFA 5HN0A 4O3SA 1PSDA 2OAUA 2FJDB 4K4SA 3MFHA 1UWBA 1OIAA 1RA6A 3RB3A 3NOGA 3N79A 2DB1A 1G1XA 2VKZG 1HQUA 4TU9A 2FHKA 2R42A 2V6AA 3MECA 4B9LA 5ETTA 1U48A 2CPFA 4QW9A 5F8IA 4RPFA 1GMWA 2HHHF 3N6NA 3NGRA 2HS0A 1IVZA 4XTTA 2IM0A 1HI1A 1TR0A 3J7YI 3W8PA 1NK8A 3BBCA 3NMAA 4HYKA 5D15A 1WC4A 3FRZA 4I6AA 1NPRA 1JLFA 2Z2MA 3HD1A 4N47A 1Z4UA 4YDDB 3MUTP 4PXDA 1G6BA 3I5CA 5L39A 5DDRC 4ECXA 4DQSA 3NOCA 4YMEA 2EEYA 1B7FA 4N5SA 1BC6A 2CPYA 3P49B 3LGHA 1UVIA 4IRKA 3FQLA 4PYAA 4XO0A 4ED5A 3GR1A 4JB8B 4DCOB 4R25A 1VQ6S 3FBEA 4DR7F 3CD5A 3I5AA 2GHVC 3MD3A 4OI2A 2DD8S 1VQSA 3BSCA 2QZ8A 1N5QA 1Y9OA 1VQMS 5H9EK 2FVSA 4FXDA 4GVBA 2VFRA 2LEAA 2ZNZA 5D8HB 1WG5A 4LSLA 4B9UA 5CCLA 2DGXA 3LF0A 4KIAA 1VC0A 5IT4A 4O3NA 2ILZA 1WF2A 2F8MA 2CPXA 1ZM9A 3RB0A 5BR8F 3RR8A 1JK9B 1KTQA 2LECA 4RW9B 2UUAF 4RNFA 2V0NA 3GG1A 1U02A 1DBDA 4O0IA 5L46A 2EXUA 4IFYA 1D8ZA 4JI3F 2BW2A 3M32B 1IR1A 1MU2B 2MY8A 2VU5A 3GU0A 1F5BA 1RCOB 2RF2A 5BXIA 1BMQB 1U7LA 4OZ3A 2C2EA 3EICA 1RHRB 4NXNF 4TXSA 3HHKA 1KS2A 4F0KA 4B9NA 1EX8A 4DL2A 5J1EB 4Y00A 5KFMA 2GMLA 2GNKA 1NHKL 1HNWJ 2V2ZA 5E7OB 3KNAA 2OEJA 3CDBA 4ZLPA 1U6BA 1T03A 4JI7F 3W5XA 1PAUB 1LOUA 3CGIA 2XI2A 4DR5F 4LSNA 5GAHI 4DR2F 3LAKA 4KGMA 2DPIA 2VPYB 1GMWD 4ECUA 1T3NA 3CJ8A 4LF7J 1HPZB 4I1TA 1TKXA 1RAOA 2IIHA 1NSKL 2HBYB 4OJGA 4QYZJ 1FHTA 3BSAA 1NDPA 2H48B 3QPIA 1IBLJ 4IR1A 3J81Y 4G65A 2MEWA 5DG7A 2DNHA 4WIIA 5B0GA 4OJ1A 1GH8A 1U26A 1S0NA 1R89A 2MSTA 2QX0A 2B56A 2H54B 5DZ7A 3ILOA 3JYTB 2WRMA 3A3PB 3QNWB 1VBZA 4FN5A 4NCBA 1R0BG 3KJFB 1Q95G 1RWVB 4ER8A 2XGQA 3DRPB 4F3QA 2RU3A 2ZH3A 4CO2A 1EAYC 3CC4S 4Q8EA 1IWGA 4ZLJA 2YH1A 2YWKA 3G2XA 2J8AA 1Y5NB 3A13A 2COLA 7FDRA 2CVEA 2ZM6F 3E51A 4QBUA 2GHWA 4U8YA 1R8PA 1IKWB 1FDDA 3KLGB 3W9HA 4ID5B 2F8EX 2RS8A 1JJ2R 4PUOA 2GO9A 2PE8A 4B3TF 3THPA 1D9AA 4P74A 3RGIA 1PYOB 3DI6B 3QJLA 4MJKA 9ATCB 4PWDB 1PG5B 2Q6BA 2ZUGA 5KG1A 5D0GA 1FVSA 2VDHA 3ITHA 4OHXA 2QIFA 1UP1A 4IRCA 4WXOA 2VC0A 4MKVA 4DF4A 3D0IE 4DUTA 1U1NA 2QRRA 2HFNA 5DDOC 1FERA 4ZJLA 3W61A 5I42B 4NXMJ 1JIHA 3V4IB 3TUZC 1NHUA 3NCRA 5J2QB 4J9MA 3OXGA 3RBEA 5J2MA 2JJ4D 1C0UA 3D28A 4C97A 3C16A 4NA2A 3D1HA 1OSDA 3JS9A 1CJVB 3OUYB 2RIJA 2HMIA 4QOTA 2FPHX 2R7XA 2ZE2A 4ZPBA 4DS5A 3BM7A 3PW2A 1HA1A 3T5JA 3D1QA 2HNYA 4LMZA 5IQQA 3W9IA 2ZHBA 2R8JA 3IG1A 3HMJG 1F0XA 1UJ4A 1F3VA 2GVDB 3X3UA 4DEZA 4ED2A 2W9BB 1SIWB 4DDFA 4BWMA 1P1LA 1UL3A 2OGUA 5IOLA 2AGOA 1VRTA 3PEJA 1HMVA 4GO7X 3I0SB 3DRSA 1FEEA 3NS5A 4HTIA 4IUFA 4IH5A 2I6WA 3FRYA 2NYIA 3HVTA 1S6PB 1HI0P 2JWNA 1NDKA 3CF5Q 4YB7A 3R5BA 4FYWB 5FLXY 3PKYA 2OUGA 4A48A 3E8OA 3MEDA 2CKWA 4DR7J 1S9GB 2J9DA 1S5ZA 4B3RF 4CLYA 4NCAA 4DG1B 3G96A 4UOFA 1VLOA 4OFZA 4Q2MA 4YHHF 4QU7A 4C48A 4CQ1A 5L1LA 2ZJPQ 2K7JA 4Q2LA 5KFYA 5KG3A 2AX0A 5HP1A 2DH9A 1T9TA 3MMBB 1QAXA 5ETLA 3ULHA 2M2BA 1Y5IB 4R0JA 2LXUA 2YXLA 5KFAA 3R5JB 4IO1A 5HROB 4A8YA 1NDCA 2IDEA 2KI2A 2L9NA 2Q66A 3KK1A 2I5JA 5E3AA 1RTHA 3BDEA 1NDLA 4YUDA 4C8ZA 3GYNA 4FF2A 2D41A 4I67A 1RWNB 2UUAJ 1WOPA 2ROPA 4LIWA 2CQDA 3CMES 5KOXA 3GV8B 2R8HA 2LXIA 2MY7A 1PYTA 2QC3A 2XC9A 4O23A 3QZ8A 2LYVA 4DR3F 1HBUB 2YQ3A 4C3KA 1YJRA 4X4SA 1IBKJ 2WBMA 4DL6A 2ADCA 5K8PA 4QR0A 4WTYA 3NBPA 3E01A 3MCOA 3DRRB 1SL0A 2HGLA 3OR1A 3H5UA 5F8MA 1IKXB 2E1AA 1FDAA 3DLKB 2OI2A 1L3KA 2QFIA 3TAMA 2H51B 4DL5A 3H20A 2J7KA 2KM8C 4JI7J 1Q8KA 2G0CA 2UVVA 2J9CA 2YH0A 3W9JA 4Y2KA 4DR2J 3MHYA 3EVMA 3MUMP 4ZPAA 2N82B 1RHKB 3SSRA 4BBYA 1S1VB 1H6KX 2R8IA 2W8LA 2E5GA 1WI6A 5CD4A 3HO1A 2MKYA 2B3TB 3CMQA 4DBQA 5IT0A 1GNKA 2W2MP 4NLUA 4IQMA 3TAQA 2IAJA 4DMZA 1U09A 4NOHA 1M5SA 2OPSA 2E29A 5I3QA 1QDUB 1OO0B 2CQ2A 1VRQC 4BS2A 1TMJA 4OHYA 1EJ7L 1PJ7A 2HG4A 2BMBA 2WB1D 5DM6Q 2AT1B 3DU6A 2J6TA 3DOKA 1QUVA 5IZHA 1UCNA 3C15A 4HTJA 5HVHA 1PIEA 4TLRA 1JXLA 1IKYA 2HVEA 3H90A 5DGBA 3PXGa 2UV8A 3SDEA 5CYQB 2LA4A 2WOMB 3POTA 1JXVA 1KD1T 4BHQA 4DZ6A 3T6BA 4KFBA 3HHLA 3DRYA 3K57A 4HVZA 3IRXB 3TRGA 5HMYA 1RXOB 1REVB 4E0DA 1UFLA 3KLEA 2GJ2A 4Q43A 3MM9A 3D66A 1N8RT 3FFIA 3BSOA 1SL2A 2PI5A 4LR7A 2XYHB 3AHPA 3CCJS 4OI6A 3OPKA 1TL7B 2XS2A 4UOHA 2OKQA 3UVJB 3A8JA 4WKRA 1B70B 4C8MA 5DETA 1DFDA 4AXJA 2GMJA 4K5SA 1YJ9S 2RHSB 1RTZA 3MGJA 2XG8A 4ZPCA 3OTOJ 2P9GA 3D0HE 3U7JA 2V67A 3GIRA 3QGHA 1UKUA 3IR5B 1HR0F 3TARA 4M5MA 3ICLA 4ES2A 3FMWA 3KK2B 1FK9B 2LXFA 2OFGX 4USHA 1S10A 4NRTA 3UCUP 4QIGA 4WYLA 1NJZA 3PO5A 4TY8A 3EJMA 1RLCL 2MLZA 1QY7A 2KRBA 3HP6A 2VJVA 4C9DA 4I2PB 2XZWA 2K3IA 3EDQB 3HLUA 4FKXA 2C3OA 4X65F 2R3VA 2M52A 1TFWA 1LKZA 4ZP8A 4Z37A 2FIUA 3RRHA 4Q0BA 2XSJB 4ECQA 2GVZB 1QE1B 1O5JA 2VQEJ 2AYEA 1HYSB 4C11B 4NRUA 4NLSA 4LBIA 4C7QA 1GT8A 3FMBA 1JLGB 3RB6A 2BE9B 3MTJA 2BKPA 3UN3A 3V5RA 1TVRA 1RWOB 2C3PA 3T5LA 3U1NA 4JYAF 3MM7B 3CE8A 2ACMA 1EHWA 1OQ6A 4CT9A 1FTRA 1V3SA 2DHGA 3F44A 4JI1F 1FCAA 5LT5A 3HZEA 5KFGA 3GV7B 1S6OA 1QVGR 4YB1P 4B3RJ 2XCAA 2YQ1A 4ZVPB 2MZJA 2Q3PA 2P5VA 1MN9A 1NSQA 3HHLD 3EE3A 1FJ7A 2RDJA 4JUZA 1MWZA 3BSNA 2V68A 1S6UA 2K1RB 5IM0B 3Q8SB 3IAM9 2QYCA 1P6TA 2VOPA 2CG4A 2MHNA 4LVOP 1Q53A 4WJBA 1JNRB 3THVA 1GXUA 4FXVA 1Q79A 1XBWA 4ZDNA 1C0TB 3M9MB 4EI2A 2JOQA 4TLQA 3U1LA 3WC0A 4IG3B 4RW7B 4N56A 1FJGF 2AJFE 4A4JA 2FLNA 2EKNA 1L3TA 4UUWA 3VR1A 2FLLA 2UU9F 1KR4A 3TZWA 1CULA 1WWHA 1E6VA 3LTOA 4NLTA 1JLAA 4TVAB 3FBCA 5E3QA 3M2UB 2DKOB 3R2CJ 1RTJA 4LF2A 1AZSA 2VICA 2WSEC 1T7PA 2MQPA 1S59A 2ZD1A 2MXYA 2OSRA 1LK5A 4B3SJ 4FF4A 2LQJA 4CM0A 2V50A 1SVDA 1BHNA 2LDIA 1Y5LB 5K8MA 5EX3A 2RSQA 5AXNA 1FEHA 5GAGI 1AW0A 1X4FA 4X4QA 1GX5A 4HHJA 4GKJF 2VG6B 1WUUA 1WHXA 2KN4A 1P9YA 1M1HA 3MF5A 4N8OA 3BGRB 2NQPA 3PW0A 2Y1JA 3IO1A 1S9FA 2ZITA 2HAIA 4USMA 2CG8A 2B6AB 4NLVA 1FRJA 2H9ZA 5A8RA 2OD4A 3HSDA 1FKOA 3IR7B 2ZZNA 4OZJA 4TYBA 1RKIA 1GX6A 2CXEA 5F8HA 2IRYA 3ZNJ1 4YN3B 4F4YA 3WHIA 2OMOA 2YKNA 1HBOA 4KHPF 1AFIA 3ZTRA 2B5JA 2O3DA 4RBUA 1HHSA 3KHRA 1CJKB 1M90T 3DOMA 3V4MA 4Y3CA 2CADA 3G82A 3KJVA 1PYSB 4DN0A 2W2PP 3V2UC 1MROA 4B9MA 3CXCR 3IAS9 2EBGA 4ELUA 1PKUA 2DO4A 4U6PA 1Y3KA 1H2TZ 3UN5A 1URRA 4DSKA 4TQSA 4ECRA 3M2VB 4FNHA 4FBUA 1RP5A 3BGLA 1DLOB 2YWHA 1LV5A 3MM5A 4MFBA 2DYAA 4F4KA 2IFXA 2BA9A 3UD4P 4ECVA 1OSCA 2M5YA 3KG1A 3C6UA 5LL6d 1V3RA 2LLZA 2M70A 2DNMA 3OVSA 2KG0A 3M8ZA 5ETRA 4C0HA 3DGPA 1V5VA 1HBMA 3JXOA 4JV2A 5H9FJ 1UWBB 2WONA 4HH0A 1TU0B 5KFIA 2E9ZA 4H4MB 3Q89A 2WSFC 2OEKA 4ED4A 3TANA 1U1RA 2C3MA 3M6WA 4EO8A 4H4OA 1YRTA 1PC5A 1HQUB 1BQXA 2QN6B 1FNOA 2J76E 1U2FA 5IT9Y 2V8HA 2VOOA 3MPYA 2V2VA 5SUHA 2PMHA 2LFVA 3GMGA 3CJ2A 2J0XA 4NLDA 5L9NA 3D3BJ 2XNRA 2V8PA 5FIIA 5D0HA 3R97A 2DR7A 4C8KA 3D67A 3ONQA 2E5IA 2RRAA 4HLBA 4JI5F 2QMXA 4ZHRA 5KFPA 5KFXA 5KFFA 4NCGA 4DV4J 5HJYA 1G3OA 2AJ1A 4ZJOA 1MMLA 4BDPA 2G0IA 3OFFA 1FVQA 5CD4H 4CLWA 2ZH1A 1V3ZA 3M8QA 3SFUA 3VWSA 2ILYA 2RMLA 5AE1A 3FGVA 1UZDA 2YPZA 1P9QC 4CO5A 2RH3A 1U25A 2C2DA 2HNZB 3N5FA 1MNEA 3KLHA 4N8NA 1GMVA 4ZCKA 1S7IA 2Y9HA 4ED7A 3MR7A 4FBTA 5KG2A 2ZOGA 4FPIA 4JYAJ 2XGPA 1GFWB 3ZNUA 4GVBB 4RUCA 4URQU 4JI1J 1YX2A 3C14A 4LSLB 3AOAA 1ZPWX 4DSFA 3PEHA 1TL1A 3MXHP 1VCTA 3K5PA 4RWXA 5DQIA 2H3EB 1I51B 3G8SA 3G6XA 2Q6CA 2ZWOA 1Z2ZA 2EK6A 3VQTA 4I64A 3HHLC 2H5IB 2PSZA 3MOZA 3GILA 1W26A 5DGAA 3NGDA 4IFYB 1XK8A 2E9TA 4NZ6A 3SBMA 3H5SA 1HWUA 3ET6A 4OYBA 4ZVOB 2FYXA 2X1AA 3D5MA 1NMEB 1HNIB 2WW4A 1VOMA 4UZBA 3AOCA 1U0HB 1AUSL 3ZZUA 3DMJB 5D0RA 1XNRF 4ECTA 1L3SA 2UU9J 1BD6A 1OS5A 5E33A 3C6TA 3FC9A 3Q8VA 4UQGA 3HKWA 1XERA 3ENWA 2ADBA 2RB7A 5K14B 4KQZA 1T03B 2R7VA 3BH7B 1T05B 4A8XA 1JLEA 3MM6B 3F73A 4LSNB 2NCKL
chains in the Genus database with same CATH topology
1EP4B 1ELOA 2A3JA 2YTCA 3C2PA 3KG4A 1HFEL 3HI9A 2DO0A 4LF6F 5AE2A 2N7CA 3JTOA 3BZQA 3SFGA 3HX9A 2CJBA 4C4WA 2ACYA 3IGVA 1WHWA 1VC5A 1NRKA 1JLBB 3MR3A 2PO4A 2NUHA 2BUNA 1AFJA 2NPFA 4PWUA 2E66A 2GIRA 3Q8RB 1TKXB 3V6DA 4P7TA 3KOAA 1WTFA 4OX9F 2I8EA 3M2VA 1S9EB 4QIWD 4D3HA 5F0UA 1U1QA 4DFKA 4G1QA 4NLOA 1BY9A 1H7WA 2DNGA 3DM2B 4CH7A 3I31A 2A2DA 3TP2A 4ZHRB 4K4UA 3CJKB 5M2PA 4WKYA 4LT6A 5LXYA 4F4WA 1TFYA 1XN9A 4IG0B 1FRKA 1Y7PA 3PACA 4PR6A 4ICLA 1Y3JA 4BCAA 4YY3F 4DWIA 1O51A 1RJJA 2CPIA 2MZTA 2EK1A 3QWPA 3GFXA 2V4QA 4J9KA 2UP1A 1HD1A 3CCZA 4ES3A 2VQEF 3NMRA 2OP5A 3K8WA 1NAQA 4NLPA 4WFXA 3EYZA 3AB4B 3NS6A 4LIRA 4DHVA 1CQNA 4RUAA 5K8OA 1S6QA 1TAQA 4NL5A 1RT7B 2W7OA 3PW7A 3G8QA 3LW5C 4G3IA 4P2SA 4OZLA 3GIKA 3GFYA 3KKFA 2OMLA 2UUBF 4X4RA 4DV7F 1X0PA 6FD1A 2XSFA 5HN0A 4XAKA 4ZCMA 4B02A 1IQZA 1PSDA 2OAUA 5CH7B 3H4DA 4O3SA 1ZM3A 2FJDB 4R5PB 4K4SA 1FKAF 3MFHA 1S1XA 3NG8A 5GADI 2JDJA 4UW2A 2KT3A 1UWBA 1BLUA 4OI0A 3NCQA 1OIAA 1RA6A 4O4GB 3RB3A 1Q78A 2FLOA 2BRKA 4NLWA 3E3XA 1U1LA 2CFXA 2CZVC 2ZDOA 4IH6A 5KFDA 2Z0GA 3CJ4A 6FDRA 2UVUA 3P96A 2ABYA 1Q1KA 1NEEA 1IUJA 2VKRA 3N79A 4ELVA 1RTDA 2DB1A 3B4DA 1G1XA 3TVKA 3TAPA 1QSSA 1CEZA 2X1BA 2VKZG 2MQNA 1HQUA 2EW9A 2X51A 2K7KA 4PPDA 4OMFG 2J6UA 4TU9A 1WTBA 4ZPWR 5GAEI 2FHKA 4MYTA 1EETA 3JTPA 2VBXA 2Z4PA 5I3UA 2FD2A 3LP2A 3MECA 1M5HA 3QMQA 4B9LA 1JJHA 1KOOA 3L3CA 1U48A 5KFSA 2JL9A 2CPFA 4I0WA 4QW9A 5F8IA 3M6VA 2LEPA 1NZAA 1WF1A 5F9NA 2CQ0A 2HHHF 3N5BA 3JSRA 2HS0A 3N6NA 4QIVA 4ED6A 4FPRA 4URGA 2HWTA 2IM0A 2CQCA 5J2PA 2YNGA 2AGPA 1L3VA 2ZH8A 2W9AA 4EBDA 2LU1A 2M7SA 5A8WB 4IFVB 1X5SA 3T5HA 2HLUA 3MMAB 1HI1A 1TR0A 3J7YI 1HPZA 1NK8A 3KLIA 5DS7A 3CMAS 2CPJA 1JWWA 2GHPA 4PPZA 1H0HB 1TKZA 2NLWA 2MYFA 3UD3P 3NMAA 4HYKA 5LMUF 3TUJC 3O5TB 3FRZA 1FNMA 4I6AA 5MAOA 4PUOB 1JLFA 2WHOA 3M8PA 2Z2MA 3K8VA 3MEGA 4ID8A 3GSDA 1VS3A 4N47A 3PX4A 1DQ8A 1SV5A 1QJHA 3QIDA 3CDUA 1FJCA 2GIQA 2HLTA 2IM1A 2POKA 3IWXA 1LK7A 1Z4UA 4YDDB 1RT5A 1UVMA 3MUTP 5AXLA 5A8KA 2W4PA 4PXDA 1G6BA 1RTIB 3I5CA 3M30B 2APOA 2KJVA 3AJ2A 3IC1A 2KYZA 2BVZA 5D4LA 5L39A 5CZXA 5DDRC 4ECXA 4DQSA 1RT6A 3R27A 1C1CA 4DV0F 2AW0A 4UUXA 4X4PA 4FF1A 2YKMB 5D3GA 2FHOB 4YMEA 5G4DA 4CTAB 4CNZA 2JSXA 4K2XA 1B7FA 3T6JA 2U2FA 2YNFA 4RBVA 4N5SA 2EFGA 1BC6A 2CPYA 3P49B 2BANA 5E5NA 5HLFA 3LP0A 1UVIA 2GGPA 4K50A 4CT8A 4X4OA 4OHWA 4IRKA 3FQLA 4IQXA 3DRXA 4XO0A 4ED5A 3GR1A 3PKMA 1NJXA 1RT2B 3ITHB 4R25A 1VQ6S 4PXEA 4DR7F 3CD5A 3I5AA 1UA0A 4UY8T 2ZHOA 2GHVC 2MQMA 4PG4A 4YB5A 5F3TA 3SQGB 3M1VA 3BS9A 3MD3A 4OI2A 1VQPS 4BWJA 2DD8S 3UNGC 3GIJA 1VQSA 3IXQA 1ZAWA 3IN5A 3BSCA 2W4DA 4M63A 4WU2A 1ZM2A 2QZ8A 3M6UA 4RNOA 4NLRA 3CO9A 4KRWA 1ZZFA 1HWJA 1N5QA 3SI8A 4C98A 4IOCQ 1Y9OA 3I56S 1VQMS 3HKZD 3PDNA 1K1QA 3RW7A 3EPGA 1VBXA 1NJIT 1N6QB 4B9SA 3L09A 2U1AA 3S1TA 2MZQA 2DNPA 1Q4RA 2KKHA 4B3SF 2FVSA 4ERDA 4FXDA 2X1FA 1GXTA 2VFRA 2IBOA 1VQOS 1I1GA 3UCGA 4Y2CA 3FDSA 1S0OA 3DLGA 3OR2B 3TI0A 5J1NA 4K4VA 2LEAA 1KHVA 2ZNZA 4Y6IA 2DGOA 5D8HB 2PGCA 1DURA 4EZ6A 1WG5A 3H59A 3LUYA 2RQMA 4LSLA 2W8KA 2ZH6A 4B9UA 2Y1RI 3AY0A 4F26A 5CCLA 4KPYA 2ZBIA 2HWHA 5T7LB 4ED3A 1IKWA 2YVSA 2DGXA 2ZE2B 2NZ4A 4TN2A 3VAKA 4AUKA 2CQHA 3H2VE 3MEKA 3KLGA 3LF0A 4KIAA 1YITS 4A8SA 2Q43A 2CQIA 1VC0A 1A7GE 4O3NA 5IT4A 2ILZA 3DC2A 1WF2A 1VQ5S 3LH2S 2RJZA 4RU2A 5IQ6A 2F8MA 3FZBA 3H40A 2CPXA 1ZM9A 3RB0A 4QCLA 3V6DB 3CEDA 5BR8F 1TK0A 3RR8A 1JK9B 1E6YA 1KTQA 4M5DA 3J7YU 4G1QB 2E5HA 3LGNA 2PMZD 5H1SV 5GAGU 1MMDA 3IG1B 3OHBA 3VAIA 4KC5A 2ASYA 2LECA 4RW9B 2QFJA 4RNFA 2V0NA 2UUAF 3GG1A 2ALZA 1DBDA 4O0IA 3N6LA 4IFYA 2GMHA 4IYQA 4XDDA 2MKJA 2MKSA 1D8ZA 4B3MF 3FJ2A 4Q7AA 1NK4A 4JI3F 2BW2A 3LWLA 2ZH2A 2YKOA 1FF2A 3O44A 1VI7A 3M32B 5KFWA 2M9KA 1MU2B 2MY8A 2GFFA 4YQWA 2ZJQQ 3M2RA 1JX4A 1GQEA 1OQ3A 1S6QB 2FJEB 2EFOA 2ZOFA 3UE2A 5BJRA 1R0AA 1HQEA 1F5BA 1RGVA 3T5KA 2X1GA 2UV8G 2RF2A 1RT1B 2DIVA 2GA7A 2CZ4A 3NAIA 2PI4A 2F9JA 1U7LA 3QAUA 4PXCA 2C2EA 1VRTB 1HMVB 4KKOA 2R7WA 1S1XB 1NK7A 3DRSB 4NXNF 2ZH9A 4X4NA 4X2BA 4DR6F 4TXSA 4NYZA 3SCLE 3HHKA 2CPHA 1KS2A 3UDLA 4B9NA 2A2CA 1S1TA 3HVTB 1Z2LA 3DXBA 2KM8B 2MZSA 1DTQA 4DQIA 4DL2A 1QSYA 2IMOA 5L8RC 5J1EB 2QE5A 4Y00A 2MSSA 3QIPB 5KFMA 1X0FA 1HARA 2GMLA 4CO3A 1QAYA 3RB4A 1C4AA 3TVZA 2FHJA 5IFMA 3MEDB 1DRZA 2QA2A 2GNKA 5KG0A 1NH8A 5E7OB 3KNAA 3NGKA 4HI1A 3CDBA 4ZLPA 1U6BA 2AX1A 3KNGA 1T03A 1UAWA 4JI7F 5KFKA 3MECB 3TA0A 1LOUA 3AH6A 3CGIA 4J9OA 2XI2A 4DR5F 4LSNA 5GAHI 3OUYA 4DR2F 3LAKA 4KGMA 2DPIA 1LW2A 4EWTA 1M5VC 1U8SA 1A6LA 2VPYB 3LO3A 3VAJA 3S8SA 1KVJA 5F0WA 3J7A1 2J6SA 4ECUA 4QJVA 1S0MA 2JEFA 2DH8A 4NMLA 3TW0A 3BO3A 1T3NA 4F3OA 1R3NA 3F41A 3MZIA 4E98A 1VBYA 5LMNF 5HP1B 1JLBA 4HI2A 4Q45A 3DLJA 4WCEQ 2R2SA