3VAFA

Structure of u2af65 variant with bru3 dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
molecule keywords Splicing factor U2AF 65 kDa subunit
total genus 43
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vafA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vafA02
2LEBA 3B4MA 1N88A 3DXBA 2WBRA 1P1TA 2DNLA 4UQTA 3ZZZA 2LMIA 3MUMP 1A9NB 1X4DA 2YH0A 4LJMA 1SJ4P 5CA5A 1AUDA 2U2FA 3VAFA 1SJ3P 5HL7Q 1VBXA 2DHXA 4V19X 2PEHA 5ITHA 2LKZA 2MZJA 1ZZFA 1FT8A 2CPIA 2CPXA 5D78A 4CQ1A 2NZ4A 2CQGA 1G2EA 1FJCA 2HGLA 5D77A 4PRFA 1X5PA 5IM0A 2DNOA 1QVGR 3H2UB 2CPDA 1VQ7S 4C4WA 5LJ3Y 4PR6A 4YUDA 4OZ0A 3OW2R 2J0SD 1X4BA 3Q2TC 1M5VC 1NJIT 3UWTA 3MUVP 4PKDB 5GADU 3MI7X 2DNYA 3JB9k 1YTYA 3UE2A 1JJHA 3FEXB 4WCEQ 2DK2A 1D8ZA 2B0GA 5GAEU 3CCMS 2D3OR 3N9UC 2VONA 1Q7YT 2I38A 2MJUA 2DH8A 2MKJA 2F3JA 1K9MT 4J5OA 2DHAA 5DETA 2MZQA 3RW6A 2D9PA 2KU7A 1OPIA 4RU2A 2XS7A 4A8XA 1VQNS 4ZKAA 2DITA 2L08A 4IO9Q 2CQ1A 4Y00A 1DRZA 1FXLA 2DNNA 1K73T 2RQCA 2BOPA 2MQNA 3MD1A 2VODA 1VQ6S 2LCWA 2JWNA 3S8SA 4U67Q 1WI8A 3CF5Q 2M2BA 1D9AA 1WF0A 3PIOQ 4F25A 2ZJRQ 3CCVS 2CQBA 2XSFA 1WHWA 1VQ5S 1UW4A 3G8TA 3IWNC 1PGZA 3NMRA 2DGWA 1UP1A 5IQQA 2N7CA 2RNEA 2J76E 3K0JA 2KXHA 3DLLQ 2MZTA 1VC0A 2GHPA 2XS2A 2N3OA 3VALA 1W2BR 1YI2S 2DNPA 5JVGQ 3EGNA 2CQHA 1JJ2R 3BEGB 2AYBA 2CQCA 3NNAA 3G4SS 1WF2A 2RT3A 4WKRA 2DGSA 1U1MA 1KD1T 5CXTA 1WTBA 2E5HA 3G6ES 2M88A 2X1FA 2MQPA 3LQVA 2XNRA 1H2UX 2X1GA 3V4MA 1U6BA 4YOEA 2ZJQQ 1WELA 2BZ2A 5GMKa 2OIHA 1HD0A 4CH0S 2X1AA 1X5OA 2F9DA 2LECA 3BO4A 2AD9A 1Q86T 3CC4S 2EVZA 2AYMA 2MKHA 3CMAS 3P5TL 2KVIA 3VAKA 4IOCQ 4W92B 1WHYA 1WHXA 2MQLA 2YTCA 1FHTA 2M4MA 2E44A 2Q79A 2JVRA 2OSQA 3CTRA 2MZ1A 1FO1A 3CCRS 3UCGA 1OO0B 2XNQA 3G71S 3P3DA 2LA6A 1VQPS 1S79A 1X4CA 1X4FA 1VQOS 3Q2SC 3CCES 1U1RA 4ERDA 2PE8A 2DNHA 1X4HA 3VAGA 2DH7A 2OTJS 2I2YA 2M9KA 1VQLS 3BO3A 2X1BA 1S72S 2JVOA 1H2VZ 4M5DB 3CULA 3VAMA 1QM9A 3R1LA 4C0OC 3J7ZT 2KFYA 4FXVA 1VC6A 1U1KA 4FXWA 4QPTA 1SJQA 3B4DA 1N54B 2DGQA 1F9FA 1KQSR 3THPA 4Y0FA 3CCLS 4IOAQ 2LQ5A 2AYEA 2DGUA 2MXYA 1NU4A 1X5SA 2G1DA 2O3DA 4P6QA 2CQ4A 2OSRA 1ZZNA 1U1OA 2CQ3A 1M5KC 4C7QA 2JX2A 3UD4P 3MDFA 1BY9A 2DGVA 2J8AA 2DNGA 3VAHA 1P27B 2RUGA 3TP2A 4Z2XA 2N3LA 2GO9A 5IM0B 3TO8A 2KRBA 2KYXA 2G4BA 1R8HA 2F9JA 2E5GA 2RU3A 1WEZA 2M7SA 2MB0B 1K8AT 4F02A 1YHQS 1SXLA 2MKIA 2MHNA 3NNHA 3P6YC 3MD3A 1WI6A 5GAHU 1HL6A 2L41A 2DH9A 1X5TA 1RK8A 2KG0A 5DM6Q 3S01A 2SXLA 1KOOA 1M5PC 5DDRC 3G96A 2CQPA 1VQ8S 2CPFA 2LEAA 1M1KT 2YKAA 1R8PA 4YB1P 2KI2A 1Q81T 3HHNB 1X4EA 3UCZP 2KXFA 2M52A 3TYTA 4EGLA 1VQ9S 2RS2A 2ZJPQ 2ERRA 2RQ4A 2ADCA 2MY7A 2DISA 2HZCA 4LMZA 2NLWA 3CC7S 1OIAA 2OJ3A 4WFAQ 2DNKA 2DGXA 2HGNA 2LXUA 3BS9A 3R1HA 5CYJA 3IRWP 1WG1A 2CPEA 3BO2A 2MQMA 1ZH5A 3NS6A 2E5JA 3CCQS 3FEYB 2MJNA 5GVQA 1XN9A 2MSSA 1L3KA 4WFBQ 3CPWR 1U2FA 1FJEB 1A7GE 1WHVA 2M8DB 2DNRA 2MKCA 2KRRA 2AYGA 2DNZA 3I55S 1JJ4A 3MUTP 1VBYA 1H6KX 1VQKS 3CD6S 5LXRA 1NO8A 2M0GB 2DO0A 2K3KA 1IQTA 2J0QD 2QEXS 2DO4A 2JRSA 1OWXA 1DHMA 4QU6A 4TU7A 2A3JA 3P49B 1B7FA 5H1SV 3ULHA 3U1LA 2MMYA 3CUNA 2MZRA 3UCUP 2V94A 2DNMA 2YH1A 2DNQA 5DM7Q 2QFJA 1Q82T 3J7YU 2XS5A 5LSLA 1YIJS 2EK1A 3LPYA 2FC9A 2KN4A 1U1QA 1VBZA 5MLCV 5FJ4A 5LJ5Y 3G8SA 3S6EA 3G9CA 1WEYA 2L9WA 5GAGU 2U1AA 1SJRA 1M5OC 2M8HA 1U6FA 2DHSA 3PIPQ 3US5A 2ADBA 2FPHX 2CQ2A 1YITS 2MSTA 2MKKA 4ED5A 2CPYA 2FY1A 2FC8A 1H2TZ 2DB1A 3SDEA 2RRBA 3R27A 1WEXA 1QVFR 4F26A 2VOPA 2CQ0A 1SJFA 2HGMA 2D9OA 4TU8A 5LXYA 1N52B 5DDPC 3L3CA 2DHGA 2HYIB 3SDEB 2DIVA 2N82B 2YWKA 3CCSS 1VQMS 1YJ9S 2UP1A 3CC2S 1U1LA 5DDOC 2RRAA 1FJ7A 4W90B 1WG5A 2FHOB 2KHCA 3S7RA 4QU7A 4CIOA 4OZ1A 2MPUA 1U1PA 3MURP 2M70A 4WFNQ 2LA4A 1DBDA 3CCJS 3EX7B 3SMZA 1CVJA 1VQ4S 2KG1A 3MOJB 1KC8T 4TU9A 2KT5A 1M90T 3H2VE 2XB2D 3MXHP 3D2WA 1WF1A 2CQDA 2RVJA 1DZ5A 1YJNS 2EK6A 3ZZYA 3CXCR 1WWHA 1O0PA 3RW7A 2MQQA 4BS2A 2G0CA 2DGOA 1FNXH 3I56S 2DIUA 2DGTA 4CH1A 2MY8A 2CQIA 2MGZA 3CCUS 3CMES 1URNA 1X0FA 1PO6A 2MQOA 2MGZB 5LSOA 2VOOA 2CPZA 2OTLS 1RKJA 1WG4A 3SXLA 2MKSA 2K8GA 1UFWA 4WF9Q 2KM8C 3U1MA 2CPJA 3EGZA 4UY8T 4TLQA 3THTA 2KM8B 1X4AA 1U1NA 1YWXA 4WIIA 5BJRA 2QA4S 3NS5A 5HO4A 1X4GA 3VAJA 4IUFA 3VAIA 1KOHA 4LIRA 3UD3P 2HVZA 5JVHQ 1VC5A 4QQBA 1HA1A 2KXNB 3HI9A 1JMTA 5EN1A 1HD1A 2E5IA 5DDQC 1YJWS 1N8RT 1UAWA 3VF0B 5IFMA 2MYFA 2LXIA 2RS8A 2KH9A 2CPHA 2LYVA 2MZSA 3NNCA 2CJKA
chains in the Genus database with same CATH superfamily
3W1YC 1N88A 5EX0A 1DTQA 1UZHA 2B4OA 2B8PA 3LA0A 3QWPA 4OYOA 2VASA 3R5JB 3W9JA 4C98A 3W61A 3R9LA 3K17A 2HHXA 3FQKA 3HFKA 4ED7A 1NDCA 5KFAA 4Z7YA 5DQHA 1RU1A 4DL4A 4RW4A 4FBTA 5LM7E 1FF2A 5I42B 3PFOA 1RWOB 1SQGA 5CA5A 3TZXA 1URRA 1SJ4P 4DQSA 3R5AA 4L73A 5HL7Q 4DV6F 1W26A 3LGMA 1VBXA 1NPPA 1P6TA 3VWSA 5ITHA 2LKZA 3BZQA 3TZWA 2MZJA 1ZZFA 3KWMA 3A8KA 2JL9A 2RE1A 2CPXA 2V2VA 3BBBA 3L4BC 4M5MA 5D78A 4CQ1A 2CQGA 2P2CB 3MECB 1G2EA 3W66A 3C15B 2BJ7A 5B0FA 1P9YA 5CD4H 4JBCA 4OYPA 4CTAA 4F04B 3MEDB 3M8QB 2DNOA 1FX4A 3H2UB 2IIHA 3PX6A 1BD6A 3HHDA 4L75A 3OVAA 1U8WA 4X4OA 1HYSB 4RW9A 1B64A 1RAAB 2FGOA 5D8HB 5LJ3Y 3K5NA 4NMLA 4UZCA 2MTLA 3ILLA 2HHUA 3PJ9A 2HEKA 2PO4A 1LWCA 3KUEA 3OFEA 3I4HX 3KOAA 2J8SA 1PCAA 1RB0A 4ZN3A 4ECWA 5CZVA 3MI7X 1BWVA 2DNYA 2YVSA 1FRLA 2J0WA 1XMOF 4X64J 4WCEQ 1JJHA 3FEXB 3KLHB 3MR5A 3ETOA 4DR7F 2ZOMA 3GMGA 1QSLA 1C1BB 1MN7A 1BMQB 1D8ZA 2B0GA 5L1KA 3CCMS 3H40A 5BXIA 4EO6A 1IM6A 3B82A 2I1RA 3HF5A 3NGTA 3HM9A 3EGWB 2VONA 1H3DA 1M5SA 5EWFA 3OTBA 3R3TA 2KZZA 2VA2A 4CLKA 3FJ2A 5DETA 1F9EB 1FVSA 2BRKA 2KFZA 3NWRA 5DQGA 1PJ5A 4KGMA 4J9VA 4X64F 1K1SA 2KU7A 4EBEA 3J7Z5 4WIQA 2IAJA 4DSFA 2VFUA 4A8XA 3M6XA 4P74A 4DPWA 2VQFF 1HWKA 1PBAA 4MT1A 4ZKAA 1MWZA 3MTKA 2ZHBA 3QIPA 3AHPA 2IM0A 2ZBQA 3C6UB 3DCAA 3NBPA 3WIUA 2F8MA 3MCNA 2DNNA 4Y3CA 5LSRA 2CJYB 4LSNA 1FRKA 1UJ5A 4DV5F 4KE5A 1F9HA 4IR9A 4FBUA 4LF6J 5J2MB 4N76A 4P7TA 3LO3A 4XDCA 1RT5A 2JWNA 4RPFA 4CP5A 2VQFJ 4M94A 2D74B 1XK8A 5F41A 2ASJA 3CF5Q 2HIYA 2M2BA 3QJJA 4WBFA 4F25A 3EWGA 1WOOA 3D0HE 1U2CA 3C14A 3UD5A 4ECZA 2B4PA 3EZOA 4ES1A 1R6YA 4CYUA 5F8MA 5D6GA 4M63A 2CRLA 5D3GB 4HLBA 3CB4A 1WHWA 1NK6A 2WOMA 4HHJA 2UU9J 4HI2A 4OX9J 1UEUA 3P4UB 4G65A 4DMZA 4LVNP 2MQ8A 8RUCA 2KJWA 2V0NA 2WTFA 1BQMA 2F8HA 2W7AA 3DHWC 1MROA 4TLRA 2RNEA 3F0NA 1HWUA 5AXKA 2AGPA 4HEA9 1Y5NB 3MAAB 1UVJA 1RTJB 2E7XA 4TY9A 3RB4A 2XS2A 5KFFA 4DF8A 4J9KA 4H4MB 2KT2A 4KV8A 3W2VB 4XPCA 5LMNJ 2Z30B 2D1CA 5JVGQ 3EGNA 1JJ2R 1HMVA 1TL3B 3M30A 3RRHA 4DCOB 1VIXA 3F73A 3BSAA 2Y1RI 2VC0A 2RT3A 2WZ1A 3D6HB 3QT6A 2DGSA 4OHVA 5IV4A 5DJBA 1U1MA 4WKRA 2B7CB 3CJTA 4X4UA 5KT3A 1R31A 3L09A 1SUQA 2WB1D 1T03B 5C5JA 3IR7B 2HSEB 1T9WA 2HVEA 3M30B 1CJVB 3EDQB 3R5BA 5CYQA 5HMXA 1RT4B 4KPCA 1Q8LA 2PFFB 5LMUF 3FBBA 3MR2A 4U7UD 3V2UC 1OYDA 2QMUB 3MEEA 4Y65A 2YBVA 4DPOA 1X9WA 1NK8A 1S1VB 4CH0S 3M8SA 1JLBA 1BUXA 2BW2A 1MLAA 1S1WB 1GMUA 1X5OA 2GHWA 2Z56B 3I0SB 9RUBA 3H90A 2DEJA 2MLXA 3CDEA 4HACA 1RKIA 1TUVA 3JTNA 2PN6A 3UNGC 4CO2A 2LECA 1S0MA 2UV8G 2GJFA 3JYTA 3FRYA 3CE8A 2VH7A 1JNZB 3TEGA 4EU0A 1VRTB 1U2RA 2MKHA 2NXNA 1NJWA 3PO4A 3OL9A 4OJ3A 4EYHB 1JLEB 2C1EB 4F67A 3FBCA 1X0PA 1V5IB 2EG2A 3K89A 3PHEA 1OY6A 1UETA 5LOQA 2YKMB 4PCQA 3HPOA 3KLVA 2FY8A 4LF4F 3EVOA 2VHGA 2HKEA 5C2CA 3BGRA 4Q44A 1UVLA 1Y00A 4RWWA 2MZ1A 5SZTA 3T5JA 4P71A 4LFBF 4X4NA 1FK9B 3D68A 2RMLA 2XNQA 4MFBA 3G71S 4GVBA 3E01B 4X84A 3PG9A 1S79A 3WC2A 3G87A 3WDOA 3W65A 1XMQJ 2CG8A 1T9XA 1X4FA 2LXFA 3B6BA 4ERDA 3MM6B 3KJFB 4F4KA 5K5MA 2DNHA 4HDGA 3IWXA 4XIUA 1OPZA 3C8YA 2R7WA 2ZZMA 5B0DA 2VOPA 2HAIA 3BKTA 2ZH8A 2JEFA 1F3VA 2F4VF 1HNVA 1FFWB 2WW4A 4KTQA 2X1BA 3HFVA 1U09A 4ZPDA 1S72S 3OR2A 3CCWA 2HW3A 3TAMB 2IA0A 3TAPA 2VBXA 2R3VA 3VVTA 1KN6A 2CZVC 2W9AA 1N36J 3J7ZT 1BGXT 4NASA 3FCHA 3U27A 1KTQA 3K5LA 2EKNA 1CBKA 3C3LA 2GMJA 2FJDB 3JQKA 4NA2A 1RABB 1ZM4A 1UTAA 3ETMA 3THPA 3HHLC 3H42A 3I6PA 4EI2A 3CCLS 2VG6A 4I2PB 2LQ5A 4ID5B 5BYQA 3FFIA 3BDPA 4ILLA 3KJVA 4L72B 2WVEA 1WNEA 2NXJA 1I94F 4NLWA 4QIGA 2O3DA 2HFOA 2IFXA 4P6QA 5C42B 2OSRA 3KLFB 3DRSB 1ZZNA 1RBLA 2W9BA 4XPEA 4C7QA 1B0PA 2QLJB 3AD9C 2C2NA 2VF3A 1SQFA 1KQGB 2JX2A 4FYWB 4L76A 3M9NB 2R2RA 4E0DA 2EG1A 1BY9A 2AJ2A 1UVKA 2DGVA 4TKTA 2CFXA 3T6JA 5JMNA 3PVXA 3PX4A 5ETMA 2OPSB 5A76A 1I3OB 1NRKA 4CCHA 1S1WA 4AL5A 2AT1B 3VAHA 1R43A 2VPZB 1LWFA 1WC1A 1P27B 2CZ4A 2XYHB 4NRTA 4MKYA 2N3LA 2GO9A 3W2WA 4N56A 4CZCA 2RQKA 2KRBA 4W98A 1SKSA 1NB2A 2E5GA 1Y5LB 1WEZA 3H4DA 2BE7D 1HWJA 4FZVA 5FIIA 4NYPA 2FHMA 1O51A 2VDHA 2AJ1A 2LLZA 3DRXA 1WDTA 3CDBA 1Z2ZA 1SXLA 1CJVA 2K2PA 3A1YG 2MHNA 2MKIA 3P6YC 1L5UA 2UUBF 1FRXA 3O8WA 4RLEA 2FHJD 5GAHU 4F4ZA 2A18A 2G2ZA 3NOGA 1X5TA 4WFXA 4B3RJ 1RK8A 3CIMA 3R8YA 1VISA 1RT3B 4ILRA 2XZWA 2CG4A 4JV2A 4PQUA 3FNNA 3DLBA 4MK8A 2UXDF 1XR5A 1FVQA 4WZQA 3PX0A 2ZBCA 3Q83A 1DLOA 3EVWA 4OIXA 1OSCA 4DX6A 3F41A 3MPDA 3G86A 1QAIA 1VQ8S 1Y3KA 1EKRA 2V8VA 2CJBA 1R8PA 3OTEA 1RT6A 1NDKA 3H5YA 3IR5B 2XMUA 2H51B 3MHYA 1HNIA 2WSFC 3KDNA 4M95A 3UCZP 3FEZA 2M52A 2HQFA 4UF4A 2AF6A 2JJ4D 3MMJA 4ED0A 2AEFA 2V4RA 2ZJPQ 4C0HA 2ERRA 4RUCA 2LQ8A 3RBDA 1IJEB 3JQJA 1UPPA 2DISA 2HZCA 2MY7A 4DF4A 2NLWA 2RH3A 1OIAA 3PKMA 2V2ZA 3OBIA 3VQTA 2B8QA 4LF4J 4K4YA 3QSYB 1U26A 1HQUA 4EUVA 2BABA 2CPEA 2UUBJ 2R7XA 1ZH5A 4HHHA 2C2ZB 2QL7B 2YWFA 1NSQA 3TAQA 3FEYB 2MJNA 1NCLA 1ZM9A 1XMBA 4V1Ak 5A8KB 4X66F 4FS1A 3POTB 1L3KA 1V3SA 4WKYA 2XG8A 1VQSA 2XMTA 1FJEB 1A7GE 1RCOB 1RWWB 1WHVA 3IS9B 1JLAB 2QT7A 3WHIA 4DV0F 5ETOA 5KFVA 2KRRA 3HD2A 2DNZA 3W5ZA 2NPFA 5EGYA 3DGVA 1JJ4A 4JV1A 1IKVB 1RHUB 5HMYA 3M6UA 1Q78A 4I7FA 1IJFB 1LWXA 4KGZB 5DO2A 1NO8A 1OSDA 5GMDA 2M0GB 4DDFA 4ELVA 2DO0A 4MJKA 1MMNA 2DJWA 3D6MB 3MPUB 3I9V9 3U1NA 2QEXS 1IQTA 2E9ZA 4DQPA 4J91A 5KFGA 2FJAB 4IRKA 3KJVB 2ZH3A 4CO0A 4I2PA 4ID5A 1I51B 2DD8S 2WHOA 1HQUB 1DURA 2NR0A 2A3JA 3LF0A 1LW0B 1IKYA 5KG4A 5H1SV 3M1VB 3TI0A 3RGIA 1JLGA 3M6WA 3AQPA 5DGAA 2FD2A 4YQWA 1M1HA 3CDWA 5H9EK 1QVGR 2RILA 2E1CA 2V8PA 3DLEA 2ALZA 4K8RA 5RUBA 5L9NA 1Q82T 2XCPA 2JFKA 2MZRA 4QIWD 1RHQB 4F2SA 5KG7A 5CH7B 1Y11A 3QGHA 1JIHA 1RTIA 2AEMA 2BKNA 2DCUB 3D9BA 3TVZA 3WC0A 4DG1A 4EZ6A 1Q53A 4IFYA 2PMHA 3BKFA 4KSEB 2IRYA 2FC9A 5CYMA 4OL8A 4ZCMA 4OV1A 4DN9A 3BR8A 2RHQB 1UW9A 3KLIA 2COLA 2V34A 5HP1B 1XNRJ 5K9FA 2BBEA 4ZHRB 2J5AA 4X4QA 2UXDJ 3UW1A 4FF2A 3HDSA 4H4KA 5LJ5Y 3G8SA 4K5RA 2AQ4A 1RE1B 5GAGU 1UFLA 1RYRA 3W62A 4IQMA 1FK9A 2W4DA 1RT1A 1U6FA 3CSKA 1PYSB 4AL7A 4CNYA 4KPYA 1BXNA 2HS3A 3T1AA 2WRMA 4C8NA 2BKPA 2FPHX 2HPUA 2KYZA 1DQAA 2CVIA 1Q79A 3DDKA 3HHEA 2EPIA 2DRAA 4DS5A 4OJ1A 1JLQB 1QUVA 4CO5A 4OMFG 2OPRA 3CW2C 2ZD1B 4OI2A 2FY1A 2AJ4A 5F3TA 4URQU 3MEGB 2DR9A 2ALYB 5DG9A 4OJGA 3KNAA 5IT9U 2OPSA 4OX9F 1QDUB 3MM7B 2CQ0A 4HACB 2GAHC 1IR2A 2HGMA 4HHUA 4AFFA 1SJFA 2L9DA 1MU2B 3OL6A 4J9UE 1SH0A 1ZM2A 2BJ9A 5KFSA 1XNQF 4I67A 2IY5B 2HQ3A 3QGGA 2N82B 1YJ9S 2UP1A 1DQ9A 3JSRA 1AROP 5I3PA 2I5JB 3HK2A 1RWPB 4I6AA 5LMUJ 1TK8A 2O5DA 1IKWB 1WG5A 3CT9A 1I94J 4LVOP 2XO6A 5CYQB 3GJSB 2DXEA 2R8HA 1AFIA 2CXEA 4UOFA 2XI2A 2IC3B 4C8KA 5L39A 3QRPA 2XZDB 1U49A 2ZKTA 3CJKA 3MURP 2M70A 4WFNQ 3EXCX 2BRLA 2GIRA 4DV5J 1SIZA 3UO0A 2CA9A 2QN6B 4EMDA 2KG1A 5I3UA 1PSDA 4ED8A 2XI3A 2WW8A 5KFRA 4TU9A 5LMNF 1M90T 1C0TB 3I5AA 2ROGA 4LBPA 3W2VA 4YP3A 1TK5A 1S76D 4DG1B 2ZH6A 1FKPB 1WF1A 3W9IA 2F63A 2DPIA 1UWBA 2LFVA 2FGCA 2HVHA 1DZ5A 1YJNS 4YR3A 1UEVA 2EK6A 3K5PA 3MMBB 3KHHA 1ZTTA 4QJVA 2DRBA 2XMWA 1O0PA 2VB6A 3O5TB 5GMEA 4K2JA 1U47A 3CJ2A 2MQQA 1S10A 2UU9F 5EWEA 4M5LA 2CJ9A 1KR4A 2VPXB 2BDPA 3DM2B 2YX4A 3I56S 2CJXB 3I32A 1LW0A 2E1MC 4OHWA 4C6AA 1RHKB 2MGZA 2B9YA 4NL5A 3GSDA 5HK4A 1WOSA 3HMJG 1MWQA 3GZ7A 4MTPA 1V6HA 1EX8A 3MMCB 1MMLA 4B02A 5CCMA 5KT7A 2E1PA 3HVRA 1BHNA 1BQNB 1H0HB 4E2FB 2NZCA 2UUWA 1WG4A 2J7WA 4KBIA 4DSLA 4Y2CA 5L46A 1X9SA 2K8GA 4LF8F 4FF1A 2G2YA 2X3GA 1UVIA 5DG8A 4G3IA 1HBUB 3ISND 1TTHB 3PW0A 3I5CA 2VA3A 1NSKL 3E8OA 3SIPB 3EGZA 5KFIA 2QE5A 4TLQA 3MMBA 2BJ8A 3NBPB 2DR7A 3MOZA 4HTJA 3T19A 1KNZA 2Z2ZA 3MEEB 5ETRA 2IA6A 4NZ0A 3M6VA 5HVHA 3OHBA 4OI1A 4ZA1A 4C3LA 4DZDA 3TUZC 5HO4A 2H1YA 1YBAA 3ITHA 1VRQC 5T7LB 4DI6A 4EFAC 1K0TA 5IXUA 1CS4B 1KOHA 1CEZA 3UD3P 1JLFB 4A4JA 4P2SA 4ZP7A 5HN0A 1YJTA 2GO8A 1HI0P 5EN1A 1JMTA 4LT6A 3D54A 2VJUA 2HHPA 2IPOB 2FJEB 1NDLA 2RJZA 4AT1B 1D9FA 3CIZA 3AB2B 1UAWA 4XAKA 4Y34A 1FTRA 5K14B 4CDIA 1CJKB 1H98A 2C28A 2YQ0A 3HHLD 4CM0A 3OT9A 3PKYA 1XMOJ 2NXCA 2QYCA 4O23A 3MAHA 4H4MA 4KV8B 5ETTA 1EJ7L 1TKZA 3NGKA 4LRBA 1NKEA 1RTJA 3EXYA 3EZUA 2LVWA 2IMWP 4IR1A 1NPKA 1HPZB 1D8YA 1IQZA 1NM2A 2CJKA 3ZTRA 4WXOA 4HTIA 1YRXA 3HO1A 2OH2A 2ZE2A 3CWJA 1BQMB 3LW5C 2VG7A 4MKVA 5K8OA 2F65A 4XO0A 3MCSA 1RCXB 1EARA 1ACMB 2OAUA 3W8PA 3MM7A 5HLFB 5BYRA 1NHUA 1P1TA 2X51A 5IC4B 3R6LB 2LMIA 3MUMP 4FS2A 3JTPA 1A9NB 4L3NA 2HZAA 1T9TA 3QT8A 4LJMA 4AQYF 2U2FA 3ZNUA 4DZ6A 3IXQA 3ZZUA 1HBMA 4A47A 1SJ3P 4BC7A 4YEAA 5KFKA 3C14B 4N8NA 2ZNYA 4DFJA 4JOUA 1U0SA 6FDRA 3SI8A 1ZAVA 3MR7A 3AD8C 2PA8D 5DRKA 1G4CA 4F36A 2FZCB 1IKXB 1FT8A 2CPIA 2NS1B 3LANA 4RX6A 4EK2A 5HQ8A 2DBBA 4NLSA 4N41A 3M8PA 2LEPA 1UA1A 1S12A 5D77A 4TN2A 4Z37A 4Q43A 3KUGA 3KK1A 3PZPA 3K8WA 2JOQA 4PRFA 4CLLA 4DV6J 2AWZA 4F4YA 3GG0A 2HHWA 4KO0A 3RB6A 1JKHA 3HSJA 2YXLA 5IWAJ 2CPDA 2V67A 1VQ7S 2F40A 1BLUA 5D15A 2P5VA 5IV3A 4PAAA 5E5NA 2J0SD 1WC6A 4OYAA 4Y2IA 4A8MP 3RAQA 3I5BA 3ET6A 4CLUA 2UXBJ 2IM1A 2CZ9A 2HNYB 1YQHA 3HVTB 3IR6B 3ELHA 1S97A 3MUVP 2H4WB 5KOXA 5T41A 1VRUA 5EDWA 1XTZA 2DTJA 4P2MA 4WP8A 3IBFB 3UE2A 3D3CJ 3FFIB 2OFGX 3EE3A 1RAJA 2HBQB 1L3TA 4J37A 2V8DA 4O3NA 3JTOA 3OVBA 1IKYB 3AB4B 3M2UB 1KHVA 2GS8A 1Q7YT 2I38A 3AA9A 1L3SA 3GV8B 3RBEA 1EQ0A 1X7VA 4NXNJ 4USMA 2F3JA 3T6BA 2QYGA 5D4LA 1GQEA 2DHAA 4J5OA 4P2FA 5KFXA 2FJVA 2B9XA 3I82A 3I87A 5GAHI 2A0FB 3RW6A 1CULA 3A13A 4NLVA 3TUIC 3T5KA 2H5EA 4RU2A 4K5SA 3X1LB 4Y6IA 1U02A 3AJDA 3IFEA 3GV7B 2ZH2A 2DITA 1LV5A 1IBMJ 1W2IA 5HMZA 2L08A 3OXFA 2YX1A 1T3OA 1FERA 2V8GA 4NMXA 4I7FB 4PZVA 4IO9Q 3DLKB 5BR8J 3W5YA 2BOPA 4ZCLA 2R7OA 3VQSA 4ANDA 2MQNA 4I2QA 3MD1A 4LF5F 4ECQA 2VODA 1HHTP 2ASLA 2QX0A 2B5JB 3GJRB 1VBKA 1GX6A 4MFBB 4P9SA 5D0GA 3TA1A 3H25A 4NLGA 4DR4F 4U67Q 2HK2A 5L8RC 3MECA 4F3OA 3HX9A 1T9VA 4OZ3A 4ZN1A 1YRTA 4B9VA 1IKXA 3K7RA 1T94A 3LP1B 3GPAA 3W7BA 1WF0A 4H54A 3PIOQ 4FPRA 5IOLA 2AJ0A 2YNGA 1NJZA 3BGFA 1NKBA 4PYDA 2CQBA 3NGRA 4O0NA 4OHZA 1WKJA 4RW4B 4PG6A 2ZC4A 4JI6F 4X2BA 2KKHA 5E41A 3IWNC 5A0YA 1PGZA 3QQCD 4DL5A 3KHRA 1OMSA 1HNXF 1I1GA 4LR9A 2VG7B 5HAOA 1N0VC 1S9GB 1LOUA 1FRJA 3PJXA 3WX4A 2JNJA 4NLRA 1FRIA 2KXHA 3T5LA 5DZ7A 3K0JA 1NSPA 1UWBB 2MZTA 4U7UK 3Q8YA 4DX5A 4X65J 1FJGJ 2V68A 3QLHA 1CC7A 1F6TA 1HW9A 4ZIVA 3PACA 1W2BR 1N34J 2HVIA 4WK1A 4DXLA 3V6KA 3BH7B 2CQCA 2JHEA 4WTYA 4O3RA 2QTWA 3RRGA 1KTVA 5A2QU 4JP8A 2RDJA 1WF2A 5KFQA 1RYSA 3KMSA 4L3KA 7FD1A 2YKPA 1KHWA 3OD2A 3D66A 4YN3B 2B6AA 2E5HA 3QBCA 3TUPA 1JLFA 4G1QA 1VIOA 4A8QA 2ASYA 5KFCA 2XNRA 1PG5B 4FPIA 4YB6A 5T14A 4JI3F 4NX9A 5KT2A 2HHHF 2UUCF 1UCNA 1RUSA 2FHJA 2X1GA 1NDPA 2FTRA 2OPPB 1KONA 2G9OA 2YNHA 3DRPA 2ZJQQ 1U6BA 1QSSA 1SH3A 2M3DA 4G1PA 1EAYC 1HD0A 3A8EA 2R7QA 1HLWA 2X1AA 1HR0F 3QATA 3V6HA 2Y0SD 3TA2A 3TJAA 4ZMMA 1DAXA 1MU2A 3GLJA 3HFZB 5KFPA 4QWBA 4ER8A 1S1XB 1IBLF 2BKOA 2AD9A 3J81U 3PFEA 3MM5A 3OL8A 1HFEL 2AYMA 5HROB 3KTQA 3CMAS 2IJRA 1RWMB 3ZC4A 2AIRB 4W92B 1WHYA 1EZZB 1WHXA 2R42A 2V63A 1OJ4A 1Q0NA 2VQEJ 4TQSA 2AGOA 1WC4A 2M4MA 3BH6B 3FQLA 4ATNA 2Q79A 5AT1B 1LW2B 2R8GA 5KT4A 2AJQA 7AT1B 4DBQA 2BXJA 1RT1B 2G1HA 3M32A 1FO1A 3P5BP 3U7JA 2ZH5A 3K5OA 2QJ3A 4I1TA 2E5LJ 4DSEA 1OO0B 2HLTA 3N6MA 3TZYA 3SEOA 2LQBA 3IP0A 3CD5A 5G0RA 2EW9A 3QRRA 4DV1J 5DLGA 4USWA 1FDNA 1VQOS 4NPOA 2Y8YA 4NLDA 1N6QB 3UN5A 4OX6A 1U24A 1KDNA 4C8MA 1X4HA 2ZEJA 3DI6B 1O8BA 3PRBA 4DV0J 1EKSA 4O3PA 1J5OA 3OR2B 2DH7A 3ICLA 3OV7A 1JJCB 3QIPB 3PW2A 2I2YA 2OTJS 2J0XA 5H9EJ 3BO3A 1GFWB 5C25B 1HHSA 1YK9A 1RTIB 3A8IA 3J7YI 1BQXA 4ZVGA 2JH3A 5D0HA 4M5DB 3VAMA 1QM9A 2BR0A 1JXLA 1PILA 5I3UB 4QYRA 4FXVA 2KFYA 1U1KA 1RGVA 4ICLB 3IC1A 2GC8A 4B3SJ 1HI1A 3IO1A 3M8ZA 4WFYA 2XY7A 3KG4A 5BYSA 4JYAF 3B4DA 2Z2LA 1KQSR 1ZA2B 5DLFA 4Y0FA 4HH0A 3DRRB 2GV1A 1ZTWA 3QWUA 4PPDA 1LW2A 1OY8A 4KGKA 2AYEA 2YKNA 2A1BA 4Q5VA 5MAOA 2MHEA 3KLHA 2W4PA 4KHPF 1X5SA 2G1DA 2Y0BB 5IZHA 1IUJA 3DKDA 1NZAA 5EUHA 1YGYA 4DSIA 3PYFA 1KS2A 2R7SA 5HVGA 1Q8IA 2VG5A 3QZ8A 1B0VA 4DR6F 1F2GA 5SUHA 1AB8A 4OX7A 2VPYB 2HFNA 2DNGA 2ZVSA 3D5MA 4MK7A 3EPGA 4JI1J 1RA7A 1RT2B 4JI4J 2V5HG 1FWKA 5L9XA 4IOBA 3IWLA 3PRVA 4CLSA 1KKHA 2KYXA 2ZC3A 3MMAB 3QPIA 1LK7A 1PKUA 5KFTA 4J9MA 1DARA 4LSZB 3SSRA 3WX8A 2RU3A 4WE1A 1TFYA 5C24B 3FKBA 3OUYA 4B9MA 3HVWA 4F02A 1YHQS 1EIYB 1P8GA 1S1TA 4K59A 3M8RA 4UY85 4K4UA 4LF7F 1WI6A 1OYEA 2IVMA 3TVKA 4XDDA 4R5PB 5KOWA 2B6AB 2DH9A 5F8IA 2L41A 1T03A 2POKA 4RUBA 2KG0A 3AXMA 3D3BJ 5DM6Q 4ENOA 1F3FA 3GQCA 2FVCA 5DG7A 3ENWA 2CIMA 4QYZK 1IBCB 3DU5A 4B3MF 3SSQA 1VDHA 2EWHA 3IN5A 3N6LA 2HFZA 2FDNA 4BWMA 3Q8QB 1RHJB 4IFYB 3SZ2A 5HLFA 1M5PC 4DS4A 2CPFA 1M1KT 4NA3A 2QA2A 5DGBA 5L1LA 2KI2A 1Q81T 3HHNB 4Q2LA 3CCTA 1L3VA 2KXFA 4MIBA 1PYOB 5L38A 3QFHA 5L1IA 3EZ5A 3AOBA 1VQ9S 5E33A 2ADCA 2RQ4A 3KNGA 2IM2A 3D28A 4I69A 4U95A 5KFHA 1T9YA 2YQ1A 4KKOA 4OZ2A 4IKAA 1RA6A 4C48A 2W2QP 4GRSA 4WP3A 4DV7F 2ATLA 2V9WA 2V9KA 2DNKA 2O67A 3RYLA 2OMOA 2HGNA 2LXUA 3DRYA 3I9ZA 4URSA 3HD1A 4OI6A 1RT7B 3IRWP 3T3FA 1NKCA 1WG1A 2UVUA 2X3DA 3I0RB 2O01C 2MQMA 3GFXA 4R5PA 4USKA 1O5JA 2IYIA 3NS6A 1S1TB 4M5NA 4P52A 5B0AA 4ED1A 1K44A 3NRBA 4EO8A 1TL1A 2L9NA 3W3SA 1IVZA 4NI2A 2FUG9 1VS3A 2EEYA 1C4CA 4WYWA 1YKWA 5C24A 3OUYB 1U2FA 4FXDA 5LT5A 1NK7A 2ZBIA 3BN7A 3QO9A 4FYYB 4ANCA 4QBUA 2FJWA 1FFSB 3I4PA 1VLYA 3PYGA 5E3RA 3ZNJ1 4ED2A 3SCIE 4NA1A 3NNCA 1Q8BA 1U7LA 3I55S 3UNYA 1LWFB 1RT2A 2JC1A 4DFKA 3MUTP 1QTMA 1S4FA 3HHKA 1VK8A 1H6KX 2F8EX 4A8SA 1KWMA 1Q16B 1S4EA 2XYGB 2GQ2A 2ZVIA 4ZP8A 4X4VA 3LUYA 4DV2J 1S6PA 3ENVA 4YB5A 2DO4A 2H9ZA 3UDEA 2ZDOA 2J0QD 5KFLA 1A6LA 1DHMA 1YBUA 4HI1A 2PI5A 5ETSA 1P1LA 2K1RA 2UVRA 4ZJLA 2WCXA 1PBUA 1SJ1A 4RW6A 3C6TB 4GO7X 3T9ZA 1N32J 3TNVA 1APSA 5E3CA 1VLOA 2C3OA 2NPIA 3R5DA 4DR2F 1W7WA 3BPDA 1RTHA 3HT0A 3U1LA 3GCXP 4K0KJ 2QRRA 3G6YA 4RWXA 2CDQA 1FE0A 1R7IA 3BR9A 3ZTQA 2QV6A 4CLFA 3LWMA 3CUNA 2FZGB 3UCUP 2V94A 2XLJA 2FJXA 4JI8J 1U0HA 2DNQA 3R7SB 2HBRB 5DM7Q 1SC6A 5HI7A 3J7YU 5LSLA 4DL0C 2BMBA 5M2RA 3VZIA 3OTOJ 2DKOB 4TYBA 3IRXB 3LPYA 3SCJE 1J5OB 3RR7A 3QJPA 1RAFB 3C2PA 2I9SA 1S1UB 5HANA 3N4WA 2KN4A 5F0WA 1IR0A 1U1QA 3IGNA 1VBZA 4PQUB 3LOUA 5FJ4A 2JC0A 4ZVOB 3S6EA 4ZCIA 2XMAA 2C2EA 3UN2A 1C1CB 1SV5B 5ETKA 4Q45A 1NHVA 2V6AA 1A0OB 2Q6CA 1GMWA 1SKRA 2UVWA 3MCMA 5B0EA 2MSTA 3LP0B 4DV3J 2CWXA 3GIIA 4J9QA 4DFPA 2FC8A 4D3GA 5I42A 2C3PA 3SDEA 1PIEA 2LDIA 2F7VA 2RRBA 3G82A 4HVZA 1AUSL 2EFNA 3O1LA 4WJBA 1SH2A 4B9TA 5IS2A 2VBZA 4LRFA 1S1XA 2AZ3A 4BDPA 4TU8A 1NK0A 5DDPC 4KAIA 3A4TA 3BYPA 2V4JA 4AYBD 1G6BA 1Y0HA 5IT4A 2JEIA 2DHGA 4ZVEA 2R4FA 1S6UA 1VJWA 2DIVA 2GA7A 2WONB 3SDEB 2EFOA 3OJUA 1VQMS 4RU9A 1U1LA 5K8PA 2RRAA 3IBCB 4KB7A 2YNHB 4C3MA 3HSZA 2FHOB 5KTQA 4GC7A 5IT0A 1FXDA 1FFGB 1YZ6A 2QC3A 3S7RA 4EWTA 5K14A 3TQ1A 4QCLA 1C1CA 4EYIB 1S9EB 2ACMA 4O44A 1J5EF 4FF3A 1YG0A 3HHLA 3LALA 3QMQA 2YNFA 4B3TJ 2PEBA 3J80U 2IBKA 1CVJA 1RZMA 1N5YA 1Y7PA 4U8YA 1FNOA 4X4SA 3O44A 1KC8T 3MOJB 3HULA 3N79A 2KT3A 3Q86A 3F44A 1AYEA 3H2VE 1XWLA 3FZBA 3MXHP 5KFYA 1YJRA 2C3UA 4M1KA 2NUUG 1QSYA 1YZ7A 4ZJOA 5HBMA 1YVFA 4YDDB 4ELUA 3OXGA 4C11A 3LH2S 2HWTA 1FKOB 1FCAA 3CJQA 3GONA 4QIFA 3MM6A 1N56A 3GG1A 1FD2A 2CADA 3NS7B 4A8FA 3CD7A 4BS2A 2GCFA 3TWZA 1UJ6A 1CJUA 2A10A 2YPZA 4MKBA 1ZM3A 3M9MB 3T9NA 1QJHA 2CQIA 2FIUA 2MY8A 4USHA 3TQEA 3HP6A 1FRHA 3MMCA 4YY3F 2N4DA 3CMES 1URNA 3E51A 1WOPA 1X0FA 1PO6A 1SCJB 1QD1A 2XULA 4BBYA 5E3PA 3LP1A 2VD3A 3UVJB 4ALZA 2RHSB 2MQOA 2MGZB 2Y1IA 5LSOA 4ECVA 2J7UA 1K47A 2EBGA 3KLGB 3KK3B 1TMJA 1KVKA 3BM7A 2VOOA 4DU7A 4F0KA 3AJ2A 3DM2A 1HBNB 4DUYJ 5J2MA 3MM5B 4OI0A 2MKSA 2HRUA 5KG6A 4P7VA 1T05B 3RBZA 3HT3A 2PC6A 3THTA 2AP6A 1NUEA 2EKYA 3RB0A 1X4AA 1U1NA 5HBMB 1HW8A 2KHDA 3GIKA 3Q24A 3IS9A 2H5IB 5E0OA 4FF4A 4E98A 2M5YA 1FXRA 1NEEA 1ROFA 3NS5A 4DCPB 2FVQA 4HYKA 1C0TA 1RT4A 4O3SA 4JYAJ 5I3QA 2JLFA 4J9RA 4ECUA 4ED3A 3ZZTA 5JVHQ 4USVA 4JI7F 3I0RA 2BJ3A 3NXZA 1HD1A 1RT7A 2AHOB 1V3ZA 2QG9B 4Q0BB 3V6JA 1S9EA 4O44B 2XM3A 4ZVFA 5J2QA 2BANB 2B4UA 2RF2A 2ATCB 4GKJJ 4WU3A 2MYFA 1RWNB 2XTJP 4MAKA 4J9OA 1HQEB 2LYVA 1R3NA 1RP5A 2JZ5A 4NE9C 2I5JA 3AA8A 4JV0A 2CYYA 3D4JA 4AE5A 2LEBA 5J2PB 2HNYA 2DHHA 1WSVA 4ETXA 3J7AN 3DXBA 2HFUA 4JI2J 3FBEA 5FLXY 2FLNA 1F0XA 1F60B 1TUGB 3CGIA 3N5BA 1H38A 1VYAA 4PXEA 4RW9B 3ZZZA 3BSNA 1GH8A 2O66A 2DT9A 1MMDA 1X4DA 2AJFE 4IFVA 1HR0J 5KFOA 3GWCA 4CT9A 3T1YJ 4B9LA 2RB7A 5J1NA 2YNGB 5B0BA 1RTDB 2DHXA 3VR1A 4QWCA 2OLWA 2KVQE 1DJ0A 3KK1B 5KT6A 1TU0B 2QL5B 3M8PB 1Q8KA 2GHVC 1R8BA 1ZETA 1T02A 2WSEC 2NZ4A 4JI3J 2HGLA 1SV5A 3MM8B 3E2EA 3TZZA 5IQ6A 4LF9F 3C66A 1X5PA 3NWGA 4A48A 3H20A 1RBAA 3GR1A 3K5MA 1NZ8A 4ZP9A 2ZM6J 4DR1F 3KLIB 1B99A 2JSXA 5EWGA 2DY1A 5HMWA 1NSAA 4X4TA 3FUYA 1TV6B 4C4WA 2DYAA 2H65B 2HK3A 1N5SA 1HI8A 1HWLA 3IRXA 4OZ0A 4ZVPB 3SFGA 4JI2F 1NPRA 2HS0A 1PC4A 4QYZJ 2BACA 4F7VA 2R7TA 1F5CA 1U0HB 1M5VC 4IH6A 2ROPA 4KIAA 1OQ3A 1UZDA 1MN9A 2GGPB 1KQFB 3UWTA 4UZBA 1K1QA 1NJIT 1CULB 4PKDB 3KLFA 4ZS6A 2F4FA 4QZVB 1CSJA 3HZEA 1TKZB 3W9HA 1UEKA 5C7PA 5K8MA 1YTYA 5CZXA 2DK2A 1HNXJ 4ZLJA 4ZIWA 4LFAF 4ZJQA 1JQGA 1Q4RA 1JLGB 2VFRA 5GAEU 2D3OR 2C2RA 2J6TA 2RDDA 4USIA 3H98A 4U9RA 4M8LA 4N47A 1GK8A 4RW6B 2MJUA 2X7IA 2DH8A 4ZVTB 1KEKA 2UXCJ 4JI5F 4RL1A 2MKJA 1Z1ZA 2H3EB 3RAMA 1TQLA 2L48A 1FD8A 2Z58B 3FGVA 3GIJA 4KRWA 1BWEA 4WZMA 2MZQA 4TQRA 2JFDA 4B9NA 1GMVA 1OPIA 2YY3A 4K4WA 3ITHB 5T7LA 2GGPA 4LR8A 3QT5A 2RSQA 1LWCB 2WK4A 1VI7A 3I96A 3MM9A 3GYXB 3OR1A 2CQ1A 1VHFA 3CDAA 4FVMA 4DX7A 1FWLA 2QLFB 1FXLA 1S6OA 4ZLPA 3AOAA 4WXWA 1D9DA 6AT1B 4F0MA 3PJWA 2N4CA 1HNZJ 3M8QA 4DSJA 1U25A 1JKHB 2FVRA 5KG2A 1RAGB 2LCWA 1RWXB 4LR7A 3MPVA 4U96A 2LP4A 1VQ6S 2K06A 4GVBB 4CNZA 1IBMF 3IM8A 3NY0A 3MM8A 1AW0A 3FSXA 4F0HA 2VBWA 3SV3A 3M32B 5A8KA 4USUA 1QAXA 2VKZG 3EM1A 1D9AA 4OV6A 4YY3J 4IDKB 4UT4A 2ZJRQ 2QZ8A 3ILJA 3CCVS 1IWAA 3T1YF 1VQ5S 1S49A 1Y3JA 2QO3A 1Q1KA 1DQ8A 2CNLB 2ZDPA 2BV3A 3M05A 4GKKJ 2RD5C 3NG8A 2RQMA 3PO5A 5IQQA 1WUUA 5B08A 5F8LA 2N7CA 1TR0A 2J76E 2G2OA 3PM9A 2YWWA 3DLLQ 3IAM9 1HWIA 1RT6B 4M5IA 2BJDA 1VCTA 3IG1A 1GXTA 1YI2S 1KLNA 1CJKA 2B43A 1AXQA 2AYBA 4ZVHA 2VU5A 4UUXA 1VFJA 1U4BA 4C8YA 4C8ZA 4X4RA 1R0BG 3G4SS 2P6SA 3W63A 4YDXA 3C46A 3NMAA 4Q0BA 4A46A 2HS4A 3ONQA 3SSSA 2D41A 1RHRB 2UV8A 5IWAF 1U8SA 1WSRA 4DCJB 2GVDB 1WTBA 5CXTA 2JLGA 2ZZNA 4QWAA 5ADZA 4LF9J 2WVDA 3BDEA 1Q5VA 3QYYA 1TVRA 2AW0A 4Q8EA 1SC4B 1RI7A 2IYGA 3OTDA 4NLYA 2P8IA 3JSMB 1IKWA 1WC0A 2GQCA 2HQDA 4IG0A 3QLHB 4ZDNA 3UFCX 3V4MA 4YOEA 2WB4A 3MAAA 5GMKa 3GILA 3N6NA 3EICA 4ZVUB 2OIHA 3GFZA 4W4MA 4HT5A 5CQGA 2HQCA 1R0CB 2V4JB 1AA1B 2F9DA 1T05A 1CJTA 3R6GB 3BO4A 4FDFA 1LWEB 2GIFA 4WYLA 2W24A 4ZPTR 4YFUA 1G3OA 3L7OA 4KQZA 3MEGA 1JLCB 2HBZB 3ZZPA 4URGA 4DUYF 4DV3F 3N01A 2KVIA 2OPRB 3P5TL 4MK9A 3Q8RB 3VAKA 3DRSA 4IOCQ 1CPZA 2YTCA 1FHTA 4U6PA 3LWLA 1RWVB 1AT1B 2CNKB 1R0AB 2YKNB 1SL1A 1NJYA 1LFWA 2W25A 2OSQA 3CTRA 4LBHA 3ZTPA 4J9PA 3EYZA 1KLMA 2ASDA 1V9OA 1HBOA 3QGPA 3GYGA 3UCGA 1TL7B 5E7OB 4ZITA 3ENQA 1Z4UA 2VPWB 2LA6A 3P3DA 3T1HF 1VQPS 1TUWA 1CQNA 1RADB 4L6V3 5M2PA 2OPQA 4F2RA 3OLAA 2AX0A 3Q2SC 3VVUA 4RBTA 5KT5A 1U1RA 4JI4F 3NGUA 5THWA 2YWEA 4LSNB 5ETLA 3QZ7A 1GT8A 2B9EA 2XYPB 4UQGA 2PDAA 3KHLA 1NLKL 1VQLS 2DEIA 3FBFA 3G2XA 2ZH9A 5A8RA 2JVOA 1RBOB 3HLUA 1B0TA 3CULA 2QA4G 2OD6A 1H7XA 5D4OA 4K0KF 1VOMA 2VFSA 2XSJB 4ZP6A 2WVBA 4M5GA 4FXWA 3N28A 3RG6A 5DS7A 2XY5A 4DUZF 2DXDA 3FSYA 4NWBA 3E01A 4PG7A 3CJKB 2VL1A 3M2UA 4TXSA 4H4KC 1JXEA 2DGQA 2HVDA 1SL2A 4ECSA 1TAQA 4GC6A 4IOAQ 2NSCA 3BPSP 5KAKA 4LBIA 3FDSA 3SQGA 4CO4A 4DL2A 3HJFA 2A6OA 1TK0A 3AAWB 2MXYA 1NU4A 2ZBRA 2GFFA 1X9MA 2CQ4A 3Q22A 3DXSX 2HHSA 4OYXA 1PJ6A 2W7PA 2CQ3A 5AXLA 1KRPA 4BHQA 1BE4A 1M5KC 1JXVA 1EETB 1E6VA 3A3OB 1B70B 3Q0AA 4RUHA 1DFDA 4OFZA 1CJTB 5CD4A 1FNMA 2Z2MA 5KFBA 2I0XA 2ACYA 5ETPA 5KFJA 3ISNC 3RRKA 1S99A 2DRDA 2HNDA 2RUGA 2OHDA 4Z2XA 1UPMB 5L1JA 1HKAA 2YX7A 2RAQA 3TO8A 3MEDA 4KO0B 5IM0B 4DPXA 2HZVA 4PG8A 2F9JA 3QO9B 2IHR1 3DMJB 2VUGA 3ZXWA 3EMTA 3PW7A 4YHHJ 3Q8PB 3G6VA 3POTA 3CJRA 1FX2A 1AZSA 4GO5X 1VMBA 4NEYA 3TX0A 5HQMA 3GCWP 3UDVA 2AGQA 3NNHA 5IT9Y 1HL6A 2E66A 2ZBPA 3DGPA 4DL7A 2Q66A 2BM1A 3A12A 3NAIA 1RTDA 4JUZA 3PW5A 4K4VA 1FEHA 2GVZB 4B3TF 4GVLA 2R2TA 2DR8A 4ES2A 3NOCA 2E1AA 3L7UA 4TY8B 3RTVA 3S01A 4KFBA 1UL3A 5CYMB 5F3ZA 1KOOA 4NCAA 4DL6A 5HJYA 5DDRC 1JK9B 2CQPA 3G96A 3KMQA 3Q8VA 1RLCL 2LEAA 1SI9A 2OKQA 1GTHA 4MIWA 3LGHA 4RNHA 4DR5J 4YB1P 1BC6A 1X4EA 3HJVA 3CJ8A 2ZH1A 2BE2B 2P9EA 3M8WA 1UMJA 1FDAA 3TYTA 4EGLA 1GNKA 4P2XA 4JI8F 1WKKA 4DR5F 2RS2A 2XMVA 1XNQJ 4K2XA 1HQ2A 2PMZD 3DOMA 3GV5B 2V8HA 4EBCA 3CC7S 2OJ3A 1X8DA 2WOMB 4NXMJ 1TZ0A 3M1VA 2YKOA 4WFAQ 2DR5A 1XERA 3C6TA 3Q8UA 1PJ7A 3R1HA 4YB7A 5JUMA 2ZKUA 3M9OB 2BJ1A 3BO2A 4FNIA 2PMWA 2J7KA 4RNNA 3BF4A 3HVAA 4KGXB 4NLQA 2L3MA 5GVQA 1XN9A 3S1TA 3SV4A 4OI3A 4B3OA 1CQMA 4JI0F 2W7OA 2XWXA 3H4BA 2C3MA 2B5JA 4RNFA 2DCLA 3MMAA 4C3KA 3IGVA 4YR2A 2M8DB 2FHKA 3ISZA 1S6QA 4OZNA 4N5SA 3BQ0A 1WTFA 2DNRA 2MKCA 3QGIA 1NH7A 3G8QA 4I6WA 3ZO7A 4JI1F 2FLPA 2EI5A 1ZAXA 2XGPA 1QAJA 3AXKA 1QTNB 1Q5YA 2QSFA 2XLIA 3CD6S 1N0UA 1KSPA 1E6VB 4OJHA 4KH0B 2PT0A 2K3KA 3MGJA 5KG3A 3B8HA 4NI2B 4BCAA 3KHGA 5ETNA 3AH6A 4B17A 2XZTB 3K59A 4QR2A 3GJTB 4CWBA 1N33J 2NYIA 4G1IA 3SQGB 2W2OP 3UPFA 2QMXA 4QOTA 4R0JA 4Q2MA 2EFVA 4M5HA 2XCAA 1MSWD 1JWWA 1D1UA 3ULHA 1V3RA 4DR2J 2EXUA 2YNIB 3TEHB 4DJBA 3PY8A 4N8OA 4O4GA 4NXMF 3W60A 3H8YA 2XSJA 4RR5A 5I4MA 1YJ7A 3PCOB 1XR6A 1YJVA 3GFHA 1M0SA 3CJ5A 4QIEA 2OI2A 4RJVA 4CLTA 4MMOA 4KH1B 4P10A 2DNMA 5A8RB 2IM3A 5AE2A 5C25A 3UDCA 2QFJA 3JAMU 1ZPWX 4DV2F 1T7PA 3RBXA 3RJMB 2OP5A 2NREA 2W2NP 1TV6A 3DI6A 1NBEB 2G0IA 2J9DA 1QLNA 4KJIA 1HYSA 4B3MJ 3MWBA 4ZPVR 5CHCB 4J90A 2GVZA 1CC8A 1SPBP 2R8KA 3G9CA 4CTAB 1LKZA 2C2DA 1FDBA 1KFSA 2U1AA 4DV4F 2QMWA 2P9GA 5FD1A 1RHMB 1AZSB 3D6FB 2RKIB 3GP9A 4QW8A 4A8KA 2ZOGA 4I4BA 2CQ2A 1YITS 5DZ6A 1MW7A 4ZCKA 5KFMA 3V81A 3AT1B 4QIVA 5ETQA 1YX2A 5B09A 4OYMA 2MKKA 1B3TA 4B9UA 4ED4A 4FKYA 4RO0A 1H2TZ 2DB1A 3R2CJ 4IFVB 3R27A 1WEXA 4LRAA 1QVFR 3MR3A 4GKKF 1IBLJ 4C8OA 1LWEA 1NAQA 4F26A 4F4WA 2NUHA 2E9TA 1JNRB 2YQ3A 5A6WA 3HXMA 1T0TV 1WDDA 1N52B 5LXYA 3OL7A 1EETA 1XIQA 1S7IA 2BA9A 2WVCA 3V4IB 3M2RA 2B4VA 2ZWOA 4LFCJ 1LNQA 1ICEB 2GJ2A 1R89A 3CCSS 4RW7B 2YWKA 1U45A 1XR7A 2HYIB 3EVMA 2W9BB 3CC2S 4JV5J 1JLQA 1ZA1B 2P6TA 2GX8A 3LP0A 1T3NA 4YMEA 3BV8A 2YWHA 1F1BB 5C42A 1EQMA 4ZOSA 1WJ9A 2GMLA 4AD6A 5GAEI 3LGNA 3KK2B 3IM9A 4WPAA 4ECTA 2W1BA 5IC6B 1RISA 2RF2B 3PR5B 4IRCA 4QU7A 1H72C 4DU8A 2FVPA 4OZ1A 9ATCB 5EHHA 2MPUA 1HNWJ 1RAEB 2CWKA 1UJ4A 2LA4A 3ZZOA 4K4XA 1DBDA 4I0WA 4LSLB 2QL9B 3D1QA 3CCJS 2FVSA 4B3SF 1NXIA 5HP1A 1VQ4S 2R8JA 2R2SA 3M2VA 4USTA 3V6DB 3TAMA 3IA0A 3E3XA 3OHAA 1IBKF 2W2MP 5B0GA 3NLCA 3OPKA 4IH5A 3PEJA 4NLXA 2HIQA 2CQDA 2RVJA 2J9DE 3VV2B 1E6YB 1F5AA 1KP6A 3K8VA 3ZZYA 1HARA 2IRUA 5J1EB 3Q89A 1EB0A 1WWHA 2NSBA 3RW7A 1NHKL 1TKXB 2J9EA 3DLEB 2Q43A 1HBUA 3BYRA 3VTIA 4HT7A 1N6QA 4JI5J 2G0CA 4QW9A 5D4NA 5KFNA 3EGVA 2UXCF 1FNXH 3J7A1 3SFUA 3D6TB 1ULRA 4J9LA 1TL7A 3CNQP 2R7UA 2EBEA 1N4LA 2Q6BA 2FLOA 4LFAJ 2QLWA 5ETVA 2FB0A 4LIWA 4I6YA 4DQRA 4USJC 1G1XA 2R7VA 2RRNA 4I68A 3UVJA 3CCUS 2HLUA 3MCOA 1TKDA 3LP2B 3TJ8A 3U02A 3G6XA 2CDRB 3EPIA 4KHPJ 1GTEA 2AKWB 1JLEA 3DLJA 4PEOA 1Y10A 4OZJA 5AXMA 4DN0A 4X62J 2VQEF 3CJ0A 1VRTA 5HROA 2QFIA 1RKJA 4M5KA 1CJUB 1RDRA 3JYTB 3FSIA 2W8KA 4DEZA 2NYHA 1UFWA 3H7HB 3JXOA 3OFHA 4DQQA 4WF9Q 2Z8QA 2YWGA 2KM8C 4F8RA 4V19J 1FKOA 1HHQA 3GSIA 3WIVA 4D3HA 2GZOA 1R6VA 4PWUA 4C11B 4CI0B 5AXNA 2KM8B 4DSKA 4UY8T 3LAKA 2J6SA 1S6QB 2GAGC 2UUAF 1FE4A 1YWXA 1N33F 4WIIA 4B08A 2PI4A 5BJRA 3DOKA 4HDHA 4PWDB 3D7SB 2QA4S 4DWIA 2AX1A 1PC5A 4NRUA 1D3WA 3J81Y 4K4TA 1TL1B 4LIRA 4ITSA 3OFGA 3NCRA 3RB3A 2GMHA 1MG7A 2JLEA 4RBVA 1JB0C 4QQBA 1ZPVA 2KXNB 2J6UA 3HKWA 1K0VA 2YNFB 2E5IA 2HFVA 3GR0A 5DDQC 1YJWS 1T9UA 1N8RT 2AEJA 5FDLA 4NYZA 3ADAC 1TKTA 1X60A 1HMVB 2XMMA 5IFMA 5F8GA 4ILMA 3SCLE 3DOMB 3VZHA 4CLZA 2RS8A 2I8EA 2MZSA 1VRUB 2CJQA 2H48B 2XO7A 3PEHA 2GW8A 1GXLA 2BE2A 4RW7A 3B4MA 2R9LA 3KXDA 3PV8A 2CKWA 4PG4A 5K8NA 2WBRA 1WORA 4NCGB 5CAAA 3V4IA 1CLFA 1REGX 4A8YA 1DLOB 3KJNB 4RW8B 4YS2A 2DNLA 1MWYA 4UQTA 4Y2KA 4DR1J 2ZM6F 1LK5A 5F9NA 5M2UA 2YH0A 2XGQA 1H74A 1AUDA 4NYOA 4JI6J 3VAFA 1C4AA 1RT3A 4PWWA 2OELA 2EC0A 4JI7J 3DGPB 1FKAF 1FA0A 4IDKA 2PEHA 4V19X 3C15A 3VGUA 3OLBA 4ZVQB 1R8CA 2D7SA 4OHXA 4WFZA 1FJCA 1B7YB 1UVNA 2P9CA 3BGUA 2IMOA 1N5VA 4FP9A 5HVFA 1RACB 3TANA 2W4CA 3PRDA 2XY6A 2UUAJ 4FVCA 3GFYA 4MIAA 5IM0A 4AQYJ 2HRYA 4I2QB 1S57A 4OZ5A 5HATA 2HNDB 3PXGa 2CJAA 2XQCA 2R2UA 4DL3A 1HNZF 1DTTB 4KR0B 2EFPA 3RZAA 3DNCA 3KYLA 3OW2R 4PR6A 4YUDA 2BM0A 5F8NA 1PAEX 1X4BA 1W25A 1TL5A 1V5VA 3MM9B 1ITPA 2ZE2B 3KG1A 4X62F 3Q2TC 2MEWA 3LAMA 4TNOA 2H5JB 3MPYA 3BSCA 4M5JA 2IAJB 2ILZA 1HPZA 2C22A 2W2PP 3O2IA 4MYTA 2V69A 5GADU 3KLEB 1GXUA 1RU2A 2XHCA 3JB9k 1HQEA 4GKJF 1FI4A 2AV5A 1S77D 2WBMA 1UWAA 3EUNA 1UKUA 3JSBA 3BGLA 1M1GA 5G4DA 3TUJC 2XEXA 1IM4A 3GJQB 3NCQA 1TKTB 2PIIA 3DRRA 1RTHB 1T11A 4OLPA 2YNIA 3D67A 3N9UC 5FDLB 1RWKB 3CJ3A 2C3YA 5J2QB 2Y8WA 4RUAA 5KFUA 1C1BA 4C2MA 4I64A 2KFNA 1K9MT 5CCLA 3TOQA 1SB6A 2QIFA 4N77A 4NEZA 3QIDA 4LF1A 3X3UA 2D9PA 4M5DA 4IRDA 1D0EA 1NH8A 2XS7A 3HVTA 1VQNS 4WK3A 4PWDA 2HBYB 3PHTA 4WP9A 2D3ZA 2UXBF 3MF5A 2VFTA 1IBKJ 2Z57B 3AQOA 1C0UB 4OYBA 4Y00A 1DRZA 3FCWA 4LF5J 4KY3A 4PQAA 5AE3A 2MKYA 3MPWA 4FYVB 3AY0A 4ETZA 5C2GA 2RQCA 5KG5A 1X31C 2AZ1A 3DFEA 5BR8F 2H54B 1I6JA 2Z0GA 2FLLA 3PTWA 4OZLA 1JLAA 1HNWF 4CLWA 1TAUA 2RDIA 4IG3A 1N5QA 4F3MA 3GYNA 3ILOA 5B7WA 2E9RX 1WACA 4NLUA 3QFWA 3S8SA 1XEZA 2D3O1 4B3OB 4AL6A 3P8BB 4NOHA 3O3LA 3R2DJ 4QWDA 2LU1A 1WI8A 3H59A 3MR6A 4HH1A 2H4YB 5E3QA 1WC3A 3LPEA 3HSGA 4CO3A 4OHYA 1C2PA 2UUTA 2YKMA 4F50A 2PD1A 5D4PA 1O6XA 3R97A 4JV5F 2F1FA 4ID8A 2MLZA 3SCKE 1ZOTA 4LFCF 1JLCA 3TRGA 2XSFA 3DHXA 1KVJA 2ILYA 1UW4A 2HWIA 1NK5A 4ED6A 2VZ9A 4KKOB 4RW8A 3G8TA 1S0OA 3NMRA 4K7QA 1XBWA 2HNZA 2Y3YA 3OTCA 2XHWA 1VK3A 4UOGA 2DGWA 1UP1A 5J1PA 4U7CA 2ZZTA 3AJ1A 4DX8H 3RUBL 3OSPA 4EZ9A 5J1EA 3J80Y 1HNIB 1E6YA 4QWEA 3GE9A 3MEKA 5F8HA 1VC0A 1GEHA 1Y9OA 2BJEA 2GHPA 2N3OA 3VALA 1F2HA 4AUKA 2E1RA 2FQQB 2DNPA 2CQHA 3BEGB 5J2NA 1DY3A 5FLXU 3V6DA 4TVAB 4DV4J 4KFBB 2BANA 3NNAA 4G1QB 3BQ2A 4PABA 3FZ2A 2OGUA 4LSLA 2V4QA 1R27B 1IXKA 2IJNA 4TYAA 1KD1T 1J5EJ 4QR1A 3PDNA 3G6ES 1U48A 1RQ0A 3FMBA 4H4OB 2M88A 4XTTA 2X1FA 3A8JA 3LQVA 1WD6A 2MQPA 2XMJA 2JEJA 4OYIA 1KBRA 2BQUA 1Q7LB 3UQSA 2W8LA 3OTOF 5B0CA 3H5SA 1H2UX 2AMCB 3R5CA 2B7BB 4KYZA 4Y28C 4BC9A 5HSPA 2E7VA 4FKXA 4LREA 4ECRA 3QAEA 1WELA 3D1HA 3NL0A 1XJWB 2BZ2A 3QRQA 1ZBTA 3HSDA 3W2WB 4ZLNA 1K73T 7FDRA 3HKZD 3NGSA 1GAOA 2Q3PA 3PYEA 4CM2A 2FJBB 1S48A 3BSOA 3W64A 2VG5B 3Q8SB 1Q86T 1HBNA 2G0JA 3CC4S 2EVZA 1BQNA 4UOCA 4NCBA 5D3GA 3IBWA 3M7VA 3GTYX 4PXBA 5KFEA 1ZS6A 3AOCA 3KJQB 2GNKA 1LXNA 2MQLA 4WWSA 1U6ZA 3TW0A 4OI4A 4F4XA 3QJLA 1S0NA 2E44A 2HFSA 3H0PA 2JVRA 3CO0P 3D0IE 4UOHA 3A3NB 2G4BA 1FDDA 1SIWB 4DLEA 3R7BB 4CLPA 3GU0A 5AJ3F 3BB5A 3CCRS 4GMKA 4Q8FA 2Z2YB 2ZOFA 3OXLA 2BUNA 2RIJA 1X4CA 3KKFA 2LU2A 4ICLA 2O1PA 8AT1B 2OUGA 1H73A 3CJ4A 3UN3A 3CCES 2PE8A 3VCDA 4O3OA 3MAQA 4CT8A 4HL9A 3BGOP 3PR4A 1SKWA 4K50A 1C0UA 2IDEA 1NB7A 3C6UA 3WZ0A 3VAGA 4DFMA 1KVIA 3OR1B 1QE1B 2ZUGA 2M9KA 4MKAA 3DYAA 2VV5A 2OEJA 1S9FA 4JI0J 1FKPA 3DYAB 2K3IA 2QLXA 4ZPCA 2KDOA 3SQOP 1H2VZ 5H9FK 4ELTA 3D0GE 4U8VA 3R1LA 4P73A 4YR0A 3UR3C 4C0OC 1R8AA 1VC6A 1NJXA 1TL4A 2YPYA 3I31A 3QSIA 4QPTA 3WBZA 2KTQA 4UW2A 2BVZA 5G0RB 4LF8J 3HHLB 1SJQA 1N54B 2VC1A 2K7KA 1F9FA 2ZH4A 4DPTA 1KLMB 1XQIA 2ABYA 4UUWA 4EEYA 1QUPA 1OS5A 2DGUA 2CAJA 3CDUA 2MDAA 1RXOB 5KG0A 2E29A 1ZAWA 2APOA 1SKUB 1RLDA 2VFVA 4LRDA 4QR0A 2LDYA 3AODA 4WU2A 1U1OA 2PA3A 1S6PB 5DQIA 1SQEA 3JSYA 3K2YA 1AFJA 3TA0A 3UD4P 3L9ZA 4PUOA 3MDFA 5JXSA 4R8UA 4LUBA 1J2VA 2J8AA 3DDNA 5KFWA 3RAXA 2HHTA 1IKVA 1DTTA 3T41A 1JLBB 2UZAA 3CD0A 3FMWA 1S1VA 3TP2A 2ZD1A 3LTOA 3MTJA 2KZMA 3MZIA 4Q7AA 2GIQA 4XK8C 4C0BA 3BJYA 1R8HA 2ROEA 3DRPB 1QY7A 2IVYA 4IG0B 1Q95G 1TMMA 1WKLA 2NCKL 2NXEA 2M7SA 2V2KA 4X66J 5KFDA 3JSMA 4RNOA 4DR3J 2RKIA 1K8AT 2MB0B 1REVA 2N7YA 3EX7B 4YHHF 4DR7J 2HG4A 3BN4A 3C16A 4NZ6A 3MD3A 1VHIA 2ZHAA 3CCZA 4ZPAA 2BQRA 4LQ3A 4CO1A 2VDIA 5JJBA 3R7NB 2HHQA 2VKRA 5EX3A 2EFGA 1D09B 2XC9A 1HBMB 4P75A 2GJIA 4F3QA 3GB0A 4ZHRA 2WVFA 1VQYA 3BKUA 3UDLA 1S1UA 3IAS9 3MFIA 2SXLA 1WC5A 3GIRA 5D0EA 1XNRF 3ILIA 5J2NB 2KL8A 3L95X 1RWUA 3ZZRA 2R8IA 4LRCA 1CG2A 1HIYA 5A8WB 1YBTA 4B9SA 3TX8A 2YKAA 3KFWX 3ZTOA 2EC2A 1SL0A 4KGVB 2HMIB 1DTQB 2KB2A 2BOAA 3SBMA 1SC3B 5J2PA 3H5XA 2BQ3A 2Y9HA 4MYUA 4KC5A 1S9GA 2R7RA 3W8GA 4ECYA 3VHQA 2YKQA 5A8WA 3B54A 3NP5A 2VICA 3H2LA 1T8EA 4LMZA 5A0YB 1IN0A 3DLGB 4R25A 2A2CA 2QA1A 3NAHA 2DGXA 1SBRA 2V50A 3BS9A 4CYUB 2RUSA 4DUZJ 5CYJA 4NLPA 6FD1A 1N32F 2W9CB 3TJ9A 1RJJA 2ZNZA 3NCPA 5KFZA 1RTZA 2E5JA 3P45B 3CCQS 2Q1LA 4NZ7A 3FC9A 1CS4A 1TP7A 2FYXA 2MSSA 1EHWA 4CLYA 2BW7A 1RT5B 2W01A 4NLTA 4ZPBA 3TR5A 4WFBQ 4WE1B 3CPWR 3CJSA 3DMJA 1F5BA 2XLKA 1P9QC 1H7WA 2XBPA 4IG3B 4R0EA 3Q23A 5F8JA 3BREA 4DQIA 5HJXA 5F0UA 4IQXA 2AYGA 2GQQA 2BX6A 2DVIA 4PXDA 1N5TA 5E2QA 8ATCB 1S5ZA 3DLKA 1VBYA 4NLOA 3WQPA 1VQKS 2RU9A 1FESA 4R8UB 5AE1A 1G7CB 1S7HA 5LXRA 2LQJA 3T1HJ 2HAFA 4DUTA 4CRJA 4KHMA 3PYDA 3J81j 4J9SA 1VGYA 1YSJA 1NNDA 2CVEA 2ZFHA 2JRSA 4OX8A 1OWXA 4F4AA 3KLGA 1LXJA 2KJVA 3LP2A 1S0VA 1VR6A 4FNHA 4QU6A 4TU7A 4ZVRB 4O4RA 2OEMA 3VGSA 2W9CA 2QSWA 2VG6B 4KT0C 5A6PA 4FYXB 3NGDA 2UVVA 4RZRA 3P49B 4CH7A 1B7FA 3DN9A 1LFPA 3HZGA 2ZWPA 1OY9A 3DLGA 4X4PA 2OD4A 2IVFB 1ZYQA 4DV7J 1M5HA 3OQ2A 2MMYA 2Y1JA 2VBYA 5CABA 3R5GA 4K4ZA 1IWGA 2A6MA 1GMWD 1TKXA 5KG1A 5U47A 3V5RA 4ANEA 3KLEA 5LL6d 2BE9B 2ZH7A 2AU0A 2FZKB 3OJSA 4AXIA 1UA0A 3JS9A 2F4VJ 2YH1A 2QGFB 3ET6B 2HMIA 1HNVB 2VIHA 2XS5A 2UUCJ 1YIJS 2BEFA 2EK1A 3TARA 3N0VA 4TY8A 4ZLLA 1XMQF 1N5YB 1EP4A 5MLCV 2OPQB 1ELOA 2ZHOA 1RAHB 3BBFA 3M8YA 4KHRA 3KK2A 1WEYA 2IBOA 2L9WA 4Y2MA 4B3RF 1I5OB 2CUYA 1SJRA 2DR6A 2VJVA 2IC3A 2M8HA 2ZITA 3C16B 4OYZA 2D69A 2HRTA 1M5OC 4LF7J 3DU6A 3FRZA 1REVB 2XWYA 3BGRB 4RBUA 2DHSA 3PIPQ 3US5A 3MFHA 2ADBA 4X65F 1FJGF 2OO4A 3QNWB 2DPJA 4ED5A 1JX4A 5K20B 3HCXA 4ECXA 2CPYA 1UFKA 1Z2LA 2WONA 2NXUA 1RSCA 1NMEB 3OFFA 2I6WA 2CNNB 3M2RB 4PPZA 2IRXA 1GX5A 2XMKA 4WTOB 4JB8B 4BLGA 4C97A 4RKUC 4N7TA 4A8WA 2D9OA 4NCGA 4IO1A 3VGVA 3H5UA 3PW4A 4PUOB 1LQ9A 3L3CA 2D3UA 3B78A 3G82B 4Y2AA 4I56A 3FK4A 1YJUA 4ZVSB 4HKQA 3F56A 4DOZA 5DDOC 5A2QY 3V81B 2HHHJ 1FJ7A 2OPPA 4W90B 3NKYA 2OEKA 2KHCA 2JDJA 2B3TB 4ZK7M 3EDRB 3KDOA 1TVRB 4LF2A 4CIOA 3DC2A 1FWPA 5GADI 3SYZA 4H4OA 4IYQA 4DHVA 1SUQB 1NK4A 1U1PA 1L3UA 2GVDA 3UR0A 3CEDA 3DLHA 3IMQJ 3QT7A 4J9NA 3DOLA 3ZZ0A 1NK9A 4DLGA 1FTCA 1FEEA 1EP4B 1OQ6A 1SC1B 1QAYA 2C42A 1TELA 3SMZA 3W5XA 4O0IA 1N34F 2DY9A 4DPYA 3RU0A 1TL3A 2KT5A 1PAUB 4PXCA 1N36F 2IJFA 2HQIA 2V2QA 3OSNA 5D0RA 2PFDA 5HQLA 4DR3F 2ZUAA 2XB2D 1T95A 3DOKB 3D2WA 2NQPA 3NEKA 3O6QA 4EBDA 3OVSA 1QE1A 3CMQA 4C8LA 3FVYA 3EJMA 3KG0A 3AFGA 1MROB 3CXCR 4DR6J 1XC9A 1S59A 2OMLA 2HQGA 2HNZB 2HWHA 4OLOA 4O3QA 2OFHX 3PNIA 4NXNF 2EFQA 1RAIB 2DGOA 3JQMA 3CVKA 4O4GB 1Y4ZB 3M4XA 4DV1F 2DIUA 2HHVA 2DGTA 1MNEA 2BYCA 1KQKA 1HBOB 4CH1A 2QLBB 4ES3A 3KUHA 1B4SA 3C19A 3KK3A 2E5LF 3P96A 2B9WA 3FCVA 4LFBJ 2C2OB 2DXFA 2WSCC 2K1RB 4LQ9A 4UTGA 3K57A 2IDLA 1R0AA 2JEGA 1SVDA 3T5HA 3ZFVA 3UI3A 3RR8A 1YDLA 4DR4J 4PG5A 4DPUA 2KO1A 2CPZA 3ENAA 4J7CA 4RNMA 2OTLS 4LF6F 4E8UA 3SXLA 3BQ1A 2C2MB 2CNOB 5GAGI 1VJQA 3AD7C 2E7WA 4QPXA 2J9CA 4G6VB 3I0SA 4A8OA 3U1MA 2B51A 2CPJA 4Z7CA 3K58A 4C9DA 3A3PB 1J27A 2HURA 5F9LA 2Z4PA 1N48A 1KFDA 4OQJA 1LEOA 3THVA 4HR2A 4S0MA 2B56A 3VGTA 2LQ9A 3GIMA 3VAJA 1X4GA 2MLYA 4MH8A 4IUFA 3VAIA 2PGCA 3BBCA 3M2VB 4P72A 3CO9A 2HVZA 3JAMY 1VC5A 1HA1A 1YLXA 3D1OA 3DOLB 4BWJA 3HI9A 1RAOA 3TVYA 2F5GA 5H9FJ 4ZPWR 1YRUA 2WAQD 2G13A 5E3AA 2Y1LB 1UVMA 3ZTSA 2A2DA 1PYTA 4FN5A 5AJ3J 1FRMA 3VF0B 3N5FA 4AXJA 4K4SA 1Y5IB 2PSZA 4OYWA 4FYDA 3IG1B 2LXIA 1IR1A 2KH9A 2CPHA 3QAUA 4IH7A 1TFWA 2C2KB 3DDIA 4L74A 4PYAA 3L7PA 2K7JA
chains in the Genus database with same CATH topology
1N88A 5EX0A 1DTQA 2B4OA 3QWPA 2VASA 4C98A 2HHXA 3FQKA 3HFKA 4ED7A 5KFAA 5DQHA 4DL4A 4RW4A 4FBTA 1FF2A 5I42B 3PFOA 5CA5A 1SJ4P 1URRA 4DQSA 3R5AA 4DV6F 5HL7Q 3LGMA 1VBXA 1P6TA 3VWSA 5ITHA 2LKZA 3BZQA 2MZJA 1ZZFA 3KWMA 2JL9A 2RE1A 2CPXA 5D78A 4CQ1A 2CQGA 3MECB 1G2EA 5B0FA 5CD4H 4JBCA 4CTAA 3MEDB 3M8QB 2DNOA 3H2UB 3PX6A 1BD6A 3HHDA 3OVAA 1B64A 4X4OA 1HYSB 4RW9A 2FGOA 5D8HB 5LJ3Y 3K5NA 4NMLA 2HHUA 2PO4A 1LWCA 3OFEA 3I4HX 3KOAA 4ECWA 5CZVA 3MI7X 2DNYA 2YVSA 1FRLA 2J0WA 1XMOF 4WCEQ 1JJHA 3FEXB 3KLHB 3MR5A 3ETOA 4DR7F 2ZOMA 3GMGA 1QSLA 1C1BB 5L1KA 1D8ZA 2B0GA 3CCMS 3H40A 4EO6A 3HM9A 3B82A 2I1RA 3HF5A 2VONA 3EGWB 1H3DA 1M5SA 5EWFA 3OTBA 3R3TA 2KZZA 2VA2A 3FJ2A 5DETA 1FVSA 2BRKA 2KFZA 5DQGA 4KGMA 4X64F 1K1SA 2KU7A 4EBEA 3J7Z5 2IAJA 4DSFA 2VFUA 4A8XA 3M6XA 2VQFF 1HWKA 4ZKAA 1MWZA 3MTKA 2ZHBA 3QIPA 3AHPA 2IM0A 3DCAA 3C6UB 3NBPA 2F8MA 2DNNA 4Y3CA 5LSRA 4LSNA 1FRKA 1UJ5A 4DV5F 4KE5A 4IR9A 4FBUA 5J2MB 4N76A 4P7TA 3LO3A 4XDCA 1RT5A 2JWNA 4M94A 2D74B 1XK8A 5F41A 2ASJA 3CF5Q 3QJJA 2M2BA 4F25A 3D0HE 4ECZA 2B4PA 4ES1A 1R6YA 5F8MA 5D6GA 4M63A 2CRLA 5D3GB 4HLBA 3CB4A 1WHWA 1NK6A 2WOMA 4HHJA 4HI2A 1UEUA 4DMZA 4LVNP 2KJWA 2V0NA 2WTFA 1BQMA 2F8HA 2W7AA 3DHWC 1MROA 4TLRA 2RNEA 1HWUA 5AXKA 2AGPA 4HEA9 1Y5NB 1UVJA 1RTJB 2E7XA 4TY9A 3RB4A 2XS2A 4J9KA 4H4MB 2KT2A 4KV8A 3W2VB 4XPCA 2D1CA 5JVGQ 3EGNA 1JJ2R 1HMVA 1TL3B 3M30A 3RRHA 1VIXA 3F73A 3BSAA 2Y1RI 2VC0A 2RT3A 4OHVA 4WKRA 2DGSA 1U1MA 5DJBA 4X4UA 2B7CB 5KT3A 1R31A 3L09A 1SUQA 2WB1D 1T03B 5C5JA 3IR7B 3M30B 3R5BA 5HMXA 5CYQA 1RT4B 1Q8LA 2PFFB 5LMUF 3MR2A 3V2UC 3MEEA 4Y65A 4DPOA 1X9WA 1NK8A 1S1VB 4CH0S 3M8SA 1JLBA 2BW2A 1S1WB 3I0SB 1X5OA 2GHWA 3CDEA 1RKIA 1TUVA 3JTNA 2PN6A 3UNGC 4CO2A 2LECA 1S0MA 2UV8G 3JYTA 3FRYA 3CE8A 2VH7A 1JNZB 4EU0A 1VRTB 1U2RA 2MKHA 1NJWA 3PO4A 3OL9A 4OJ3A 4EYHB 1JLEB 4F67A 1X0PA 2EG2A 3PHEA 1UETA 2YKMB 4PCQA 3HPOA 3KLVA 4LF4F 4Q44A 3BGRA 1UVLA 1Y00A 4RWWA 2MZ1A 5SZTA 4LFBF 4X4NA 1FK9B 2RMLA 2XNQA 4MFBA 3G71S 3E01B 4X84A 1S79A 3WC2A 3WDOA 1X4FA 2LXFA 4ERDA 3MM6B 4F4KA 5K5MA 2DNHA 3IWXA 4XIUA 1OPZA 3C8YA 2R7WA 2ZZMA 5B0DA 2HAIA 2ZH8A 2JEFA 2F4VF 1HNVA 2X1BA 4ZPDA 1U09A 1S72S 3OR2A 3CCWA 2HW3A 3TAMB 2IA0A 3TAPA 2VBXA 1KN6A 2CZVC 2W9AA 3J7ZT 1BGXT 3FCHA 3U27A 1KTQA 3K5LA 3C3LA 2GMJA 2FJDB 4NA2A 1ZM4A 3THPA 3HHLC 3I6PA 3CCLS 2VG6A 4I2PB 2LQ5A 4ID5B 5BYQA 3FFIA 3BDPA 4ILLA 3KJVA 4L72B 1WNEA 1I94F 4NLWA 4QIGA 2O3DA 2HFOA 2IFXA 4P6QA 5C42B 2OSRA 3KLFB 3DRSB 1ZZNA 2W9BA 4XPEA 4C7QA 1B0PA 2R2RA 2JX2A 1KQGB 3M9NB 4E0DA 2EG1A 1BY9A 1UVKA 2DGVA 4TKTA 2CFXA 3T6JA 3PVXA 3PX4A 2OPSB 4AL5A 1NRKA 4CCHA 1S1WA 3VAHA 1R43A 2VPZB 1LWFA 2CZ4A 1P27B 4NRTA 4MKYA 2N3LA 2GO9A 3W2WA 4N56A 4CZCA 2RQKA 2KRBA 1SKSA 2E5GA 1Y5LB 1WEZA 3H4DA 1HWJA 4FZVA 5FIIA 4NYPA 2FHMA 1O51A 4IR1A 2AJ1A 2LLZA 3DRXA 4HDGA 3CDBA 1Z2ZA 1SXLA 2K2PA 3A1YG 2MKIA 2MHNA 3P6YC 1L5UA 2UUBF 1FRXA 3O8WA 4RLEA 2FHJD 5GAHU 4F4ZA 2A18A 1X5TA 4WFXA 1RK8A 3CIMA 4JV2A 4ILRA 1RT3B 2XZWA 2CG4A 4PQUA 3FNNA 3DLBA 4MK8A 2UXDF 1XR5A 1FVQA 4WZQA 3PX0A 2ZBCA 1DLOA 4OIXA 1OSCA 3F41A 1VQ8S 3G86A 1QAIA 1Y3KA 2V8VA 2CJBA 1R8PA 3OTEA 1RT6A 3H5YA 3IR5B 2XMUA 3MHYA 1HNIA 2WSFC 4M95A 3UCZP 3FEZA 2M52A 2AF6A 2JJ4D 3MMJA 4ED0A 2V4RA 2ZJPQ 4C0HA 2ERRA 4RUCA 3RBDA 1IJEB 2MY7A 2DISA 2HZCA 4DF4A 2NLWA 2RH3A 1OIAA 3OBIA 3VQTA 4K4YA 1U26A 1HQUA 4EUVA 2BABA 2CPEA 2R7XA 1ZH5A 2YWFA 4FF2A 3TAQA 3FEYB 2MJNA 1ZM9A 1XMBA 5A8KB 4X66F 4FS1A 3POTB 1L3KA 1V3SA 4WKYA 2XG8A 1VQSA 2XMTA 1FJEB 1A7GE 1WHVA 3IS9B 1JLAB 2QT7A 4DV0F 5KFVA 2KRRA 5EGYA 2DNZA 2NPFA 1JJ4A 4JV1A 1IKVB 5HMYA 3M6UA 1Q78A 4I7FA 1IJFB 4DDFA 5DO2A 1NO8A 1OSDA 4ELVA 2M0GB 2DO0A 4MJKA 1MMNA 2DJWA 3U1NA 3I9V9 1IQTA 2QEXS 2E9ZA 4DQPA 5KFGA 2FJAB 4IRKA 3KJVB 2ZH3A 4CO0A 4I2PA 4ID5A 2DD8S 2WHOA 1HQUB 1DURA 2NR0A 2A3JA 3LF0A 1LW0B 1IKYA 5KG4A 5H1SV 3M1VB 3TI0A 1JLGA 3M6WA 3AQPA 5DGAA 2FD2A 4YQWA 3CDWA 2RILA 2E1CA 2ALZA 3DLEA 5L9NA 2XCPA 2JFKA 2MZRA 4QIWD 4F2SA 5KG7A 5CH7B 3QGHA 1JIHA 1RTIA 2DCUB 3TVZA 3WC0A 4DG1A 4EZ6A 1Q53A 4IFYA 2PMHA 4KSEB 2IRYA 2FC9A 5CYMA 4OL8A 4ZCMA 4OV1A 4DN9A 3BR8A 3KLIA 2COLA 5HP1B 5K9FA 2BBEA 4ZHRB 2J5AA 4X4QA 3UW1A 3HDSA 4H4KA 5LJ5Y 3G8SA 4K5RA 2AQ4A 5GAGU 1UFLA 1RYRA 4IQMA 1FK9A 2W4DA 1RT1A 1U6FA 3CSKA 4AL7A 4CNYA 4KPYA 3T1AA 2HS3A 2WRMA 4C8NA 2FPHX 2HPUA 2KYZA 1DQAA 2CVIA 1Q79A 3DDKA 3HHEA 2EPIA 2DRAA 4DS5A 4OJ1A 1JLQB 1QUVA 4CO5A 4OMFG 2OPRA 4OI2A 2ZD1B 2FY1A 2AJ4A 5F3TA 4URQU 3MEGB 2DR9A 5DG9A 4OJGA 3KNAA 2OPSA 4OX9F 2VOPA 3MM7B 2CQ0A 1SJFA 2HGMA 4AFFA 2L9DA 1MU2B 3OL6A 1SH0A 1ZM2A 5KFSA 1XNQF 4I67A 2HQ3A 3QGGA 2N82B 1YJ9S 2UP1A 1DQ9A 3JSRA 1AROP 5I3PA 2I5JB 3HK2A 4I6AA 1TK8A 2O5DA 1IKWB 1WG5A 3CT9A </