3VAFA

Structure of u2af65 variant with bru3 dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/dna
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vafA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vafA02
2YTCA 3J7YU 1YTYA 1U1QA 3V4MA 1D9AA 2KHCA 3VAMA 1U1LA 2DIVA 4YUDA 2DIUA 4WFBQ 3CCUS 1S79A 2DGWA 3MOJB 1QM9A 2KN4A 3P3DA 3VAHA 2XNRA 4V19X 4ERDA 1U1OA 1G2EA 2DHSA 4ZKAA 2DNMA 5DDPC 5MLCV 1X4HA 1SJFA 1N88A 3IRWP 2LMIA 2E44A 1M1KT 2ZJPQ 1NJIT 1N8RT 4FXVA 1KC8T 2CQ2A 3NNCA 2CQGA 3S7RA 2D9OA 1DZ5A 3CXCR 5IM0B 4QU7A 2FY1A 1P27B 4TU8A 3BO2A 3U1LA 2MQNA 2DNNA 3BS9A 2LKZA 4PRFA 2ERRA 2DGVA 1VQ6S 2L9WA 1JJ2R 2XSFA 3P5TL 1O0PA 1UAWA 2JWNA 4WIIA 2CQCA 2PE8A 1P1TA 1U1MA 1IQTA 2DB1A 5LXRA 1JJHA 3EGNA 2MY7A 3NS5A 3HI9A 2RRBA 4YOEA 3R27A 2EVZA 1DHMA 3S8SA 2CQHA 4F25A 3CMAS 3CMES 2U2FA 3VALA 3VAKA 1VQ7S 1WELA 3L3CA 2DHGA 4CH1A 1WHXA 3NNAA 2DO0A 2MZQA 5IQQA 2LXUA 1DRZA 4A8XA 3D2WA 2CQ3A 4EGLA 3VAIA 1KOHA 3MD3A 2DH9A 3G8TA 1SJ4P 1DBDA 4FXWA 3B4DA 3U1MA 2J0SD 1QVFR 1FXLA 1NO8A 2CQIA 4QPTA 5HL7Q 2CPEA 2MQMA 2MJUA 2KYXA 3G4SS 2MZRA 2MZSA 4TU7A 1RKJA 4OZ1A 2MKSA 1WHYA 2M52A 4CIOA 2RS2A 2HGNA 5LSOA 3CC4S 5JVGQ 4C4WA 2G0CA 3CF5Q 1M90T 3FEYB 2EK1A 2CQ0A 2DNGA 2CQPA 2I2YA 3EX7B 4WCEQ 2KRRA 2L41A 2YH1A 2X1FA 1WG5A 3J7ZT 2KG1A 1U1RA 5DM6Q 1ZZNA 1PGZA 1X4EA 2HYIB 1WI8A 2MB0B 3SDEA 2VONA 3N9UC 4PKDB 1M5OC 3VAJA 2FC8A 2WBRA 3I55S 2DITA 2LYVA 4Z2XA 2U1AA 1WHVA 1VQ4S 3NS6A 2J76E 3RW6A 3R1HA 1VQKS 1WG4A 2HGMA 3H2UB 5D77A 1VBZA 3TYTA 3NMRA 5GADU 1YITS 1M5KC 1VQOS 1WF1A 1OIAA 1FJCA 4Y00A 1VBYA 2VOOA 1X0FA 4CH0S 2KVIA 2N82B 1X4DA 2BZ2A 3SMZA 2KU7A 3K0JA 1UFWA 2ZJRQ 1U2FA 1M5PC 2MJNA 2CPFA 2M0GB 2CPDA 2N3LA 2YKAA 5FJ4A 4CQ1A 2K8GA 2YH0A 5LSLA 1VC0A 2RUGA 1B7FA 2DO4A 2MKJA 1YIJS 1H2VZ 2DNOA 4J5OA 2DNPA 5DETA 2MPUA 3SDEB 2JVOA 2MGZA 5GMKa 2OSQA 4U67Q 3OW2R 2E5JA 1WEYA 1SJRA 1K73T 2X1GA 1W2BR 1UW4A 2CPHA 2L08A 4WFNQ 2F9JA 2F9DA 1X5TA 2KH9A 1A7GE 2DHAA 1SXLA 2AD9A 2MHNA 4IOAQ 2ADCA 2CQBA 4C0OC 2DGUA 2DHXA 4BS2A 2NLWA 2LA4A 3I56S 1Q86T 2K3KA 2DISA 2CQDA 1JMTA 4TU9A 1H2UX 2MXYA 1KOOA 1U6FA 1KQSR 2M7SA 3IWNC 2DNQA 1YWXA 3CD6S 4W92B 2HVZA 2G1DA 1H2TZ 3DLLQ 2FHOB 2BOPA 1U1KA 2KM8B 2KG0A 2D9PA 2AYEA 2KXHA 3UWTA 2DGOA 1X4CA 1KD1T 1YJNS 4PR6A 1FJEB 2MGZB 2M4MA 3H2VE 2DK2A 2MZTA 1OWXA 3S01A 2MQQA 3B4MA 2CPIA 1X5PA 1VQ9S 3TP2A 1Q81T 2DGSA 2MKCA 3CC7S 1QVGR 1HL6A 3SXLA 3BO4A 2CPYA 5H1SV 2PEHA 3CTRA 4OZ0A 3G6ES 1YJ9S 3RW7A 1YHQS 2MZ1A 3DXBA 3Q2SC 1NU4A 3CC2S 3CCVS 2CQ1A 2RQ4A 3MURP 2OSRA 3UCUP 2XS7A 2J0QD 1X4GA 3BO3A 1Q7YT 2QA4S 3R1LA 1AUDA 2KXFA 4ED5A 3JB9k 2DNYA 1HD1A 3G71S 2VODA 1D8ZA 1XN9A 1VQ8S 2HZCA 2M88A 2LXIA 2XB2D 2N7CA 1UP1A 2GHPA 2KFYA 2CPXA 2DH7A 4IOCQ 3VAGA 2I38A 4F26A 2E5GA 1RK8A 1VQLS 2X1BA 3UD4P 2DGXA 1YJWS 1VC6A 1K8AT 5LXYA 2G4BA 4LIRA 2J8AA 3THTA 3UD3P 3THPA 2A3JA 1U1PA 2AYBA 3S6EA 5JVHQ 5CYJA 1HD0A 2N3OA 4F02A 2ZJQQ 2M8HA 2RRAA 5HO4A 1VC5A 3ZZYA 2M8DB 1VQMS 2DGQA 3MDFA 4YB1P 2MYFA 3MD1A 5DDRC 2MQLA 2DH8A 2M70A 2LCWA 2MY8A 1FNXH 2OTJS 2AYGA 1F9FA 2RS8A 3G9CA 5DDOC 4QU6A 2LQ5A 2MSTA 2JX2A 2EK6A 2MZJA 2JVRA 4LJMA 3CCJS 1URNA 2QEXS 2MKKA 1N54B 3US5A 4UY8T 3CCLS 4C7QA 5D78A 4IO9Q 2X1AA 1VBXA 1X4AA 2DNKA 4UQTA 3MUTP 1WTBA 3CCSS 1WG1A 5ITHA 1ZZFA 2CQ4A 2LA6A 5LJ3Y 2JRSA 1FJ7A 2LEBA 1N52B 1PO6A 2CJKA 3VF0B 1WEZA 2NZ4A 1OO0B 1SJ3P 1U6BA 2XS2A 2MMYA 4QQBA 2HGLA 3ULHA 2F3JA 3CCQS 1YI2S 3NNHA 2DNZA 5DM7Q 2OJ3A 5GAHU 1ZH5A 1A9NB 2E5IA 2SXLA 2XS5A 2RVJA 2ADBA 2RU3A 2DGTA 2V94A 1FHTA 4WF9Q 2FPHX 5CXTA 2RT3A 1BY9A 3TO8A 3G8SA 2AYMA 2KM8C 3CCES 3P49B 2DNRA 3EGZA 1Q82T 1R8HA 5IFMA 1U1NA 2UP1A 2VOPA 2KRBA 3VAFA 1K9MT 3BEGB 1WHWA 2E5HA 2Q79A 2M2BA 5LJ5Y 1HA1A 2QFJA 2MQOA 2XNQA 3CCRS 1VQ5S 3CULA 1FT8A 5GAGU 1S72S 1WF2A 1FO1A 3MUMP 1VQNS 2B0GA 3P6YC 3FEXB 2DNLA 1X4FA 4IUFA 2KI2A 3PIOQ 2DNHA 2OTLS 4W90B 2OIHA 5DDQC 1R8PA 3MUVP 3LQVA 2LEAA 2RNEA 2O3DA 2MSSA 1X5OA 5GAEU 2D3OR 2YWKA 3ZZZA 4P6QA 4LMZA 3CUNA 1OPIA 3Q2TC 3CCMS 3UCZP 1H6KX 2KXNB 2MQPA 4RU2A 1WF0A 1L3KA 5BJRA 3CPWR 4TLQA 4WFAQ 5EN1A 4WKRA 1M5VC 2FC9A 3G96A 3LPYA 5IM0A 4Y0FA 2CPZA 2KT5A 1WEXA 1JJ4A 1VQPS 1WWHA 3UE2A 1CVJA 3HHNB 2LECA 1SJQA 1WI6A 1X5SA 1X4BA 2GO9A 3PIPQ 2MKHA 2M9KA 3MI7X 3UCGA 5CA5A 5GVQA 2MKIA 2RQCA 4M5DB 3MXHP 2CPJA
chains in the Genus database with same CATH superfamily
4LFAJ 4F4AA 4CT8A 3MPDA 1D9AA 4K59A 5BYSA 5KT5A 3HF5A 1WOSA 4I7FA 4OQJA 2UXBF 1N88A 3BGRB 3GFHA 1IWAA 3MECA 2Z2YB 1S0OA 4XK8C 3K8VA 4QU7A 3KK2B 4J9SA 2MQNA 4JP8A 2BJ8A 1VS3A 3GZ7A 5A8WA 1GTHA 1UAWA 2UZAA 2CQCA 2Q66A 5HQLA 4B3RF 1VIOA 1RT6A 5IT0A 4DR6F 3HI9A 4YOEA 1HARA 3S8SA 1EAYC 5AT1B 2YQ3A 2AEMA 5EWFA 4YDDB 1OY8A 2QSWA 1IR1A 4K4SA 1OSDA 5HROB 3K17A 4ECQA 4DQQA 5HLFB 3U1MA 2KJVA 3CEDA 4ED6A 4WPAA 1DAXA 3AY0A 4NPOA 3G4SS 4WU2A 1IWGA 1RKJA 1HPZA 1DQ8A 4KO0A 4WCEQ 2YH1A 4WBFA 5A8RB 3A8IA 1RT4B 4OX8A 3T9NA 1KVKA 4ES2A 3QRPA 5GMDA 1XNQF 4RNFA 1KSPA 3LP1A 1KP6A 2CIMA 2FD2A 4OHVA 1TL1B 2CWKA 3FUYA 5ADZA 3OHAA 4RW8B 5U47A 5KFRA 1SL1A 5A76A 5FD1A 3R5DA 2AZ1A 3WIVA 2K8GA 4K4VA 2OUGA 4O4RA 1NNDA 1AROP 9RUBA 1NK8A 4N77A 2HHVA 1X31C 3MPUB 3IBFB 3EWGA 2EPIA 2P6TA 2DHAA 1RWUA 2PI5A 3GCWP 4ELVA 2DHXA 1RTJA 2ZUGA 2V50A 1BQMB 3CDAA 2BMBA 5JMNA 2FY8A 3MAAB 3W63A 5HSPA 4RPFA 2PEBA 4Q44A 4A8KA 2HFVA 3SCJE 1FJEB 3LGNA 2GVZA 2UUBJ 1Q5VA 5E3AA 2WBMA 2WSEC 3ZNJ1 2QJ3A 2BW7A 1DURA 4CYUB 1JK9B 4B3RJ 2EI5A 2OSRA 1G1XA 3DYAA 3MEGA 3DM2B 2FVQA 3BKFA 2C2DA 3VCDA 2VODA 1S76D 1XN9A 1HNXF 1EHWA 4HHUA 2CFXA 2XEXA 3DLBA 4JV1A 4PG6A 3IWLA 3DXSX 1T03B 2AJ4A 1XMOF 1XBWA 4IH7A 4DBQA 3TRGA 3M9NB 1R3NA 3UD4P 3W9HA 3QFHA 3IG1A 2DYAA 2WOMB 2OPSB 1ZA1B 2J9EA 4RWXA 2HBYB 4ANEA 2GX8A 3Q0AA 2CG4A 2BEFA 4K0KF 2JLGA 1F9FA 5DDOC 1HYSA 4CTAA 2JX2A 5HN0A 5D15A 4IFYA 2KFNA 4NXMF 3J7A1 2MKKA 1HFEL 2XZDB 1N54B 3RBZA 1X8DA 2R7XA 1GXLA 1X4AA 3KK1A 4OI4A 4NLPA 1G4CA 4AYBD 4X4QA 4L73A 1OO0B 2XHCA 3NNHA 4NI2B 3NG8A 5DZ7A 2ZHBA 1TL7B 4KPCA 3ADAC 1S9GB 4IYQA 2KM8C 3HFKA 4CLYA 1R8HA 2HVDA 3RTVA 2UP1A 2NQPA 4TY8A 5G4DA 4DUYF 1L3TA 4EYHB 2WZ1A 3BSNA 3PX6A 1HBOA 2Y1IA 4IUFA 3M8QB 1SJ1A 4YHHF 1TUVA 5A0YB 1WSRA 1CJTA 4FN5A 2J0XA 2H9ZA 3PJXA 3IR6B 4P6QA 3PHEA 2RDDA 3KG4A 4N5SA 1BLUA 4TLQA 3CJ4A 4F7VA 2FHJD 4WFAQ 4X62J 3GV5B 4ILRA 1NDCA 1IQZA 2PD1A 3HHNB 5I42B 3ZZOA 4NLOA 5CYQA 1NEEA 3HX9A 3QLHB 3PR5B 4YQWA 4DX5A 4CLZA 2BDPA 3VAMA 2ALZA 5HMYA 3CCUS 2PSZA 3W2WB 1HNXJ 4FBUA 1RKIA 2E9ZA 4ED0A 1Q95G 4ZLPA 3MFHA 3BH7B 2D1CA 2ZH6A 4FXVA 2CQ2A 2DR7A 1NB7A 1CG2A 2DNNA 1XK8A 4JV5F 5CZXA 4OL8A 4IH5A 4NLQA 4IG0A 4WIIA 5ETRA 4J9QA 4OI0A 1HW8A 5D0EA 7FDRA 4WP3A 4DV6J 2VBZA 2XMKA 3GSIA 4K0KJ 3N0VA 3HPOA 4LSLB 1ZM4A 1WKKA 1HNIB 4NXMJ 1L5UA 4C2MA 1JLCA 5D4NA 1OYEA 4CI0B 1SJ4P 3H4DA 1RT1B 1HI1A 2FZGB 3F44A 2MQMA 4XAKA 3DMJA 2BJ7A 3LWMA 1WDTA 3E01A 3AOCA 1R6YA 1SUQB 3MM6B 2M52A 1GX6A 5LSOA 3LWLA 2G0CA 3FK4A 4WK1A 3OR2B 2JLEA 2R8IA 3GU0A 1U49A 2V4JB 1TL3B 2ZHOA 3PRBA 3DDNA 1RAHB 3W66A 4DUYJ 4K2XA 2G2OA 1VRUB 1VQKS 1RT7B 4V1Ak 2EFVA 3HSJA 3H2UB 3MGJA 4OYXA 2QL9B 4QIFA 3JAMU 2QGFB 2KVIA 3CCZA 2F8HA 4ES1A 3BQ0A 2CPDA 3NOGA 3ZZUA 1HHSA 3OTBA 1V3ZA 1KKHA 2MGZA 3BSCA 3MM7A 2GVDB 1KN6A 4C9DA 1Q79A 3UDCA 3K5NA 4X64J 1SIWB 1GNKA 4F4YA 4OLPA 3LAKA 4P2MA 4IRDA 1UA0A 4YMEA 3M1VA 1S0VA 1JLAB 3FRZA 3M8ZA 1HI0P 2HHSA 1NDKA 2WVBA 3L4BC 4RUHA 3R5GA 2VG7A 3LUYA 4FPIA 1H2TZ 2BOPA 4OJHA 1NH7A 4LRDA 1UJ6A 2BABA 3I4PA 2M4MA 2VZ9A 1ZTWA 3I32A 2MQQA 3LO3A 4B3OA 2BANB 1KWMA 2KVQE 2ASLA 4I64A 4I56A 4JV5J 4DR7J 5H9FK 1VLOA 3BYRA 4GVBB 2I5JB 4MKAA 3UPFA 1FKPA 3DU6A 1Q7YT 4PYDA 4JI6F 2D3ZA 1FWPA 1TAQA 1D8ZA 1S1UB 3FBFA 1N34F 4Q8EA 3A13A 2N7CA 3SSQA 4DSIA 2LQJA 2HS3A 5CH7B 3N28A 3VQSA 3DOLB 1TMJA 5AXNA 2DGXA 3KYLA 1IBKF 1RHUB 3LTOA 2JC1A 4I2QA 4J9KA 5D0HA 4ZJOA 2A18A 4E2FB 4OX9F 1I3OB 2AP6A 3J7AN 2M8HA 5HO4A 4N76A 2M8DB 1UKUA 2MYFA 2MQLA 1T9WA 1KNZA 1X9SA 3KJFB 3G9CA 2XGQA 2W25A 4PQAA 1K0TA 2CNNB 3LGHA 3W5YA 3NMAA 4N41A 3NCRA 3N5BA 4BWJA 4ECVA 3VF0B 1O51A 4KH0B 3FZ2A 1VIXA 1U7LA 1WC1A 2F3JA 1S9EA 4PWUA 1JLFA 3GYNA 5L9XA 1RADB 1NDLA 3UD5A 2IIHA 3F56A 2V94A 2Q6BA 5K9FA 4Y2IA 3C6TB 3RJMB 3LPEA 3CCES 3C14B 4TYBA 1H74A 2CUYA 4RWWA 4UOFA 3AQOA 3EICA 5LJ5Y 2B6AB 2XYPB 1S12A 3K89A 4NMLA 2D74B 2OD6A 1IKYB 2VL1A 3OVAA 5IC6B 2HNDA 3JTNA 1VHIA 4YEAA 5FDLA 4YN3B 4OZLA 3CD7A 3WQPA 3GV8B 2IA6A 1WEXA 4U7UK 1KHVA 4LRCA 1NKCA 1NPKA 1TKZB 1LWXA 1WI6A 4C8ZA 1KR4A 2MKHA 2F8MA 2PGCA 3CCTA 1N6QA 2B8PA 2ZDPA 4LVNP 3J7YU 4DLGA 4EU0A 3GILA 4JI6J 2KHCA 2QMWA 2W9CB 2LEPA 3BBFA 1N34J 1G2EA 3LF0A 1JXVA 4OZJA 4NZ6A 2GHWA 1NJIT 1RXOB 5B09A 3J80U 1REGX 2WRMA 5H9EK 1IBKJ 2Y0SD 1TU0B 4O0NA 3QGHA 4QIVA 2HFUA 1ZPWX 1WUUA 2K06A 2DB1A 1KFSA 1UW9A 1R8CA 1UJ5A 3P4UB 1RU1A 2GV1A 4MTPA 4MYUA 4LQ9A 4LF7J 3NNAA 6FDRA 3FRYA 2LU2A 4NLTA 5E5NA 4ZCIA 1YGYA 2GS8A 5E3QA 1TELA 3G86A 1DQ9A 4Q2LA 3TZXA 4DEZA 4C4WA 3FDSA 7FD1A 3WZ0A 2A0FB 4FVCA 5LMNF 4JYAJ 5BYRA 3UR0A 1NAQA 3BSAA 4PCQA 3I5CA 1RLCL 4Q0BA 3NS6A 2W9AA 5KT7A 1AYEA 3M2UB 1SV5A 2UV8A 5E0OA 4DX6A 2OMOA 1EARA 1IN0A 3V81A 2YX4A 5C25B 2BJ9A 1DLOB 2NUHA 2VOOA 4CLUA 3KDOA 4B3MJ 2OPRA 4AUKA 3A8JA 2KL8A 1FRLA 2N3LA 4DCJB 1RT5A 3M30A 5LSLA 3QYYA 4C97A 2QO3A 4IR9A 1U24A 1EX8A 2GZOA 4XDCA 1XWLA 2IRUA 1N5VA 1FKOB 3OXFA 1W2BR 5KFDA 1UVMA 3PM9A 4ZPWR 5ETSA 4PZVA 2YNHB 4K4WA 1YJUA 3OBIA 5BXIA 1LK7A 3NCPA 2R2SA 2HNZA 4B9LA 4HI2A 3CD6S 3Q83A 2FHOB 1IM4A 5IZHA 2KM8B 3TR5A 5DG7A 1RHQB 3IGVA 3IN5A 1XEZA 2DGSA 1F6TA 2YPZA 4HDGA 3G6ES 2YKQA 3O1LA 2X3DA 3DXBA 2OAUA 4Z37A 3DLKB 2CQ1A 1S1VB 2QL5B 3D28A 4RW7B 4ZVFA 3BO3A 1WORA 2P2CB 2KXFA 4B08A 4G65A 5AE1A 2V4QA 5KTQA 3V4IB 3E8OA 3CJSA 3HD1A 1Q5YA 3IFEA 5LSRA 1VQLS 2X1BA 2J9DE 4A4JA 3UN5A 3GLJA 4ZHRB 3CJTA 1YZ7A 1Y5IB 3PO4A 2Y8WA 1VC5A 2DGQA 3VZIA 5LMNJ 1VQYA 3K7RA 2XY5A 3C6UA 2WVCA 2ZKTA 3FZBA 3MM8A 4A48A 3SQGA 1VBXA 3KUGA 4KSEB 2LA6A 1QSLA 2YVSA 1JLBA 3CD0A 1TL4A 1PAUB 3MMAB 2BE7D 4U95A 5KOWA 5GAHU 1ZH5A 3TAMA 5J2MB 4O44A 5LMUJ 1I51B 4PABA 4WF9Q 4MKVA 2AYMA 3T5JA 2Z8QA 4ZLNA 3SV3A 1X0PA 2VIHA 4GO5X 1Q82T 1RBAA 1WHWA 4DUTA 1MG7A 2XQCA 2K1RA 4FZVA 4NA1A 1B0VA 1MWZA 4B02A 2GIFA 2VC1A 3E2EA 4ED4A 2W1BA 1NK9A 3T3FA 3AD8C 4LIWA 4ZPTR 1V6HA 5DDQC 4USTA 1BGXT 2FVCA 1X5OA 1T9YA 2RH3A 4ZVOB 1P9YA 1RAIB 4WYLA 1R8BA 1OPIA 3CCMS 2BE9B 2PA3A 1HMVA 4UZBA 2QLJB 1G6BA 1Q53A 5IM0A 4FNHA 3UE2A 2KT2A 1VLYA 3BDPA 1FRIA 1TVRA 2W2PP 1S7HA 1HQEA 3MR7A 2MKIA 4PQUB 4MIWA 2YWHA 3VGUA 1RHJB 4NYZA 3ZTOA 2V8GA 2R7VA 2VDHA 4CLKA 2HQDA 1T9TA 1U1OA 3DRSB 5DDPC 3KTQA 3R5JB 1HNZJ 1PJ7A 2HLUA 3CW2C 4GMKA 3BQ2A 2ZVIA 9ATCB 4KY3A 2Z56B 3RUBL 8RUCA 4FKXA 5DGAA 5J1EB 1WKLA 1JJHA 2NSBA 1UFKA 2YKMB 4DL3A 1VRTB 4WP8A 5AXLA 4ECXA 2XM3A 2QE5A 5B0AA 2COLA 2OD4A 4IFVA 3L3CA 1WHXA 1RTHA 3DGPA 4HYKA 2IAJA 1FDNA 1SKSA 2G0IA 2AZ3A 1JKHB 4RX6A 3Q86A 1REVA 2MJUA 1OQ6A 2F63A 3HZEA 2ZBQA 1LQ9A 4JI7F 4ZLJA 4RBUA 1M90T 1P9QC 3AJ2A 4XPEA 4LF9J 3M2RB 2ZD1B 1RT2A 2VONA 4KH1B 2DVIA 3DOKB 4LF2A 4G1QB 4NE9C 1EP4A 2OHDA 3T5LA 3QWPA 2ALYB 2QT7A 4DV3F 5D0GA 2BBEA 1VBYA 2OGUA 5KFNA 1U2FA 4FYYB 1FRXA 2D3O1 2YH0A 4IDKA 2H48B 3PW2A 3LALA 4ZLLA 3TZWA 1E6YB 4O4GB 2LQBA 3FSIA 4UF4A 2JVOA 1FERA 2ROPA 1K73T 2X1GA 4OYWA 3GIJA 2VV5A 1UCNA 4DPXA 3J7Z5 1GAOA 3S1TA 4CO0A 1B99A 4Y2KA 1UPPA 2AD9A 4DV4J 1XNRF 3I5AA 4PYAA 5J2QA 2NLWA 1IR0A 2OFGX 4JOUA 4CM2A 3OUYB 1VRQC 4TXSA 3ITHB 4DV5J 2KG0A 2B4VA 2UVVA 4ZJLA 4TN2A 4X2BA 4G1PA 2W01A 4OHYA 3D6MB 4WWSA 3OSPA 3OFGA 3V6KA 4PPDA 1FRKA 2F40A 4WYWA 3C16A 3ISZA 1FI4A 1TK0A 1I5OB 2WVDA 4YY3F 2IMOA 5LOQA 5I4MA 2UV8G 2HBQB 3SFUA 2B4UA 2E5GA 3VGSA 4E98A 5FLXU 3UD3P 2IDLA 3D7SB 5CCMA 5E3CA 4WXOA 1MNEA 4F02A 4NXNF 1C0UB 4YB1P 3IAS9 3RR8A 3H59A 3CIMA 3EGWB 2DPJA 3N6MA 2OO4A 3THVA 2EWHA 2QA4G 3CCLS 1GXTA 1U6ZA 2R9LA 3KLGB 4HR2A 4X66F 4DV3J 1PO6A 4F0MA 4A8MP 5F9LA 2NZ4A 5I3UA 1SJ3P 3HKZD 1U6BA 4TKTA 4I0WA 3PDNA 1J27A 3MM9A 2VPZB 1LWCA 1FE4A 3KLFB 2RVJA 3QFWA 2RU3A 1HBNB 1WC3A 2YKNB 3H5YA 4HH0A 1EKRA 3EGZA 1PBUA 2OH2A 1U1NA 2KT3A 1TMMA 3BGLA 3Q8QB 2CJAA 2M2BA 1WSVA 2YQ0A 1U0SA 3M6UA 3PW4A 3P6YC 2GW8A 1DTTB 1GMUA 3IRXB 3MCSA 3AOBA 1CC8A 5IWAF 5HQ8A 3PO5A 3QQCD 3JSMA 3SSSA 1RDRA 2BJ1A 2W2NP 4JI0F 2L9NA 5BJRA 2R4FA 3QBCA 2FJEB 4HACB 2XCAA 4J9PA 1CVJA 3TW0A 5H9EJ 1NJYA 1ZM9A 4CT9A 4LR7A 2WONB 3NGRA 2VD3A 3D68A 1QTNB 1N36F 3OD2A 1U1LA 3BN4A 1QM9A 3VAHA 3DFEA 1QAYA 2LMIA 4P74A 1PIEA 1TFWA 3HO1A 3OXGA 3GIIA 3S7RA 2D9OA 1DZ5A 2FY1A 3SYZA 2VA3A 4TU8A 2W2OP 2E1AA 4Q8FA 4DR1F 3FQLA 4ZPBA 5D3GA 3GIKA 1EQMA 1JNZB 4EWTA 3R27A 1NPRA 3V6HA 4B9UA 4PXDA 2E1MC 4CH1A 1ELOA 4XO0A 4AL7A 4CCHA 4DUZF 2HFZA 4F50A 3CWJA 4F8RA 2FLOA 3PFOA 1QSYA 4OYPA 4DV2F 1DY3A 4L72B 4AE5A 2KYXA 3AOAA 3OFEA 2CNKB 2MKSA 1PYOB 3QJPA 5DG8A 4QYZJ 2KG1A 5B08A 3FBCA 3HVTA 1ZZNA 2HYIB 3L95X 2IVFB 3SDEA 3N9UC 3CDBA 1RA6A 4FKYA 3W60A 2U1AA 4NYPA 1Y3KA 2HZVA 1NSPA 4OFZA 2H4YB 4R8UB 3GR1A 1YITS 1VQOS 3LP0B 1S0NA 3OTOF 2KU7A 2F8EX 5DLGA 3OLAA 1CLFA 2RUGA 4ZP7A 3FC9A 2IJNA 4MKYA 4JI0J 2IC3B 2MPUA 1SJRA 2V0NA 5J2PA 4OYAA 4ILMA 4EI2A 1R6VA 4FXDA 4M95A 3GJRB 1N5YA 3PW7A 3HT3A 4IOAQ 5C2CA 2HHPA 3MEDB 1LFPA 2XTJP 2HVIA 1U25A 2VPXB 2ASYA 4ES3A 2F4VJ 3QO9B 2CZ9A 4QPXA 5J2NB 2KXHA 4ZVPB 2HMIB 1LW2A 1IBMF 4ED3A 3FFIA 3GB0A 1KQKA 3R6LB 2UUWA 1VQ9S 3EM1A 4DR1J 1T9VA 3SQOP 4F4KA 2V63A 3NXZA 4HHHA 2VASA 1S6UA 4CM0A 4PXCA 1FVSA 2FUG9 2VC0A 3BKUA 3POTB 2M88A 3LGMA 4I6AA 1Y9OA 1UP1A 2CPXA 5CAAA 2MTLA 4DUZJ 4HI1A 2CVEA 2ZWOA 2BKNA 4B9VA 1S1WB 1R31A 4IG3B 5SUHA 2JLFA 4DV2J 4WK3A 1SKUB 4J9VA 4LR8A 3PYEA 2F7VA 3UN3A 2N3OA 4Q45A 3GIMA 3GONA 1F5BA 5KFOA 3I0SB 3GPAA 1VI7A 3V5RA 3TVKA 4RUCA 2LQ5A 2MLXA 2VPWB 4WFXA 1JLQA 2HVEA 3RRGA 3RYLA 2YXLA 2HNYA 4K5SA 3MUTP 1DTQA 2OPQB 4ZPAA 4GRSA 1SL2A 1TP7A 4LFBF 1RZMA 1TAUA 2V9WA 1YJRA 1HWJA 2BXJA 2KDOA 2KRBA 3AFGA 5FIIA 1NK0A 5L38A 2D3UA 1XJWB 1FT8A 3UNGC 3AAWB 5EX3A 2GQCA 1X4FA 2DNHA 3Q8YA 2OTLS 4IRCA 3CJ8A 4UY85 3KMQA 2KXNB 3BGRA 5IT9Y 3FQKA 3DRPB 1IBMJ 1SQGA 2CPZA 1RAOA 3M32B 3KK2A 1JJ4A 3TOQA 3VZHA 2AF6A 3IR5B 3IBWA 3SZ2A 3EJMA 3OFFA 1YSJA 1U1QA 2DCLA 1QJHA 2VFTA 5F41A 4YUDA 4G1IA 4EEYA 3P3DA 3WC0A 2EEYA 4V19X 1QAJA 3RU0A 3GCXP 4DDFA 2OPPB 4ZDNA 5HROA 3OVBA 4F3MA 1ZS6A 3HSDA 5HLFA 1M1KT 2UUCF 2PDAA 2CQGA 3I6PA 3W3SA 3LAMA 3ET6B 2FZCB 2ERRA 4Y2CA 3P5TL 2KYZA 1O0PA 2JWNA 1PSDA 8AT1B 2VJUA 2VBXA 3L09A 5A8RA 1SL0A 2RRBA 1RBLA 3GIRA 2R7RA 1RT4A 2YWWA 3R7NB 2U2FA 2J7WA 2QX0A 2HRUA 3PTWA 4MFBB 2RB7A 4EGLA 3D1HA 1TL1A 2I6WA 3B4DA 3MEEB 4RW8A 5D4LA 4I2PB 5HL7Q 4KYZA 4C8YA 1DARA 2GQ2A 2PIIA 3D0IE 3TUZC 1RWKB 2YY3A 4ZJQA 5KT3A 3IP0A 4TQSA 5AJ3F 3PHTA 1N5QA 4JI2F 3FCHA 1RYSA 3C19A 4PAAA 1Q8LA 5F3TA 1RTDB 1WC4A 3EE3A 1KBRA 5D77A 5KG3A 4DPYA 1NJWA 1K1QA 1BQMA 3KJQB 1VFJA 2C2MB 2N82B 2BZ2A 2XMAA 4QR1A 4TLRA 4NA2A 3MAAA 3H40A 2R8KA 2AGPA 3QSYB 5GMKa 3WDOA 4ETXA 4DL6A 1VJQA 4NRUA 3W2VB 3C15B 1UWAA 3PCOB 1CS4B 4DOZA 4WFNQ 2J9DA 3HSGA 4RW9B 4CYUA 2V5HG 2EFQA 3C66A 2HW3A 3DNCA 1Q86T 4TU9A 3R8YA 3DM2A 4C11B 1KOOA 2XGPA 3IWNC 1BE4A 1F9HA 1CJVB 5KG7A 4KB7A 5KG5A 3DLLQ 4B17A 3OV7A 1R8AA 1T03A 3A3OB 2CPIA 3TA0A 1F60B 1KONA 2NSCA 1ZA2B 3SXLA 3BO4A 1BWEA 2WOMA 4C0BA 2OPSA 2CPYA 1HQUB 3CTRA 4FYWB 3OFHA 3G2XA 1RHMB 3WX8A 4X84A 4R0JA 2XS7A 4KHPJ 3UDEA 4M63A 3MEKA 1TR0A 5K8NA 1ZM3A 4ZP6A 1VQ8S 5KFLA 2HZCA 2IPOB 3PEHA 3VQTA 2R7TA 3NCQA 5IC4B 3KDNA 1O5JA 3LW5C 3WBZA 5CYMB 1RK8A 4AL6A 4ZVHA 5LXYA 4NI2A 1HWUA 5HQMA 1J5OB 1HD0A 5AJ3J 3RB4A 1TL7A 1PC4A 2BOAA 4DQSA 4O0IA 3NRBA 1S9GA 1C1CB 1HBMB 3CVKA 3I96A 1J5EF 2OTJS 3LH2S 5DRKA 3W65A 1UJ4A 5HI7A 1URNA 4ZVSB 1PILA 3KNGA 3A8EA 3US5A 4RJVA 2VUGA 3IM9A 2C1EB 4NZ0A 2VH7A 4B3TJ 1B64A 1NB2A 4M8LA 1FCAA 2XS2A 3M8QA 2NREA 2HGLA 3PX0A 5A0YA 2XZWA 8ATCB 1S10A 2OFHX 1D0EA 4ZIVA 3T1YJ 1CEZA 2XS5A 5B0BA 4TY9A 3OL9A 4AD6A 3PACA 4PUOB 4UOGA 1AUSL 4M5KA 1KLMB 4Y6IA 1V5VA 1WKJA 2XYGB 4AXJA 5I42A 4A47A 3OVSA 1RGVA 3GFZA 3QLHA 3MUMP 3FEXB 2DNLA 5BR8J 1MN9A 1PYSB 2MKYA 2ZKUA 3W2WA 4CH7A 4FF2A 3NY0A 4NYOA 4UOCA 1R27B 2LU1A 1F1BB 4RW6B 4K5RA 3TJ9A 3OSNA 3T19A 4C98A 3CSKA 2RDIA 1NRKA 3DLEB 4DPWA 2LECA 2RHSB 3MR2A 4EZ9A 5KG0A 2H5EA 4KHMA 2NR0A 1UEVA 2HS4A 4F0HA 2H54B 2B8QA 5KFFA 2XLIA 4ED2A 4LSLA 2LDIA 2Z58B 1HNIA 4CRJA 2FJWA 4ZVTB 3O8WA 1LWEB 5HP1B 4LR9A 5F9NA 1RT1A 4KAIA 1P27B 2DKOB 3BS9A 2LKZA 4S0MA 3TAPA 3D0GE 1SUQA 3MM6A 5F3ZA 4ZMMA 2ZUAA 4TNOA 2X7IA 5M2UA 3TJAA 2Q6CA 3V2UC 2EC2A 3HXMA 4B3SF 3OR2A 4NLGA 2PI4A 5HJYA 3NS5A 2VQEF 4O23A 5CZVA 2V4JA 1TL3A 1RHRB 2RU9A 2V68A 2O67A 4O3PA 4K4XA 4HTJA 2HLTA 4NLYA 4QZVB 1TKDA 4YB7A 2DCUB 4OJGA 1VRUA 3EPIA 1RT7A 1DBDA 3BZQA 2MQ8A 2GJ2A 3JTPA 3I9V9 2AJFE 3LP2B 2MZRA 4NWBA 4OZ1A 4ELUA 2JFKA 4P71A 5D4PA 4E0DA 4WE1B 4R5PB 1RYRA 5EX0A 2I9SA 4RL1A 1U26A 1PGZA 3AJDA 1JLEB 2GVDA 1BD6A 1N32F 1HQ2A 4XPCA 4U9RA 4A8OA 4L6V3 4K4TA 3RW6A 3M8YA 1NK6A 2V2ZA 4C8OA 2R2RA 4Y00A 1X0FA 5F8GA 1JLAA 2RQMA 4ECSA 4KGVB 2CJYB 3ENWA 4DF8A 2CPFA 2YKAA 4CQ1A 3AJ1A 4DU7A 4TVAB 3OW2R 1LWFB 1WEYA 3W9IA 3JXOA 2APOA 2RMLA 2DRAA 2BANA 2Y1LB 4OHXA 4QR2A 1WC0A 4KHRA 1MROB 4GVBA 1F3FA 3J81U 5KFVA 2I5JA 1SH3A 2YKOA 4K4UA 4C0OC 2KB2A 3EUNA 2CQDA 2MXYA 1QD1A 1SH2A 5GAEI 1S1UA 1U1KA 1S0MA 5C5JA 1KD1T 1S4FA 3DOLA 2MZTA 4MYTA 1OWXA 4LRBA 4ZPCA 1QVGR 1RE1B 4ZA1A 2FLPA 4DL0C 2P9CA 1Z1ZA 2BX6A 1L3UA 3GR0A 3KJNB 2VQEJ 1T3OA 3SEOA 3H90A 2C2EA 3KHRA 4IQMA 1UL3A 2PFDA 4URSA 1S5ZA 2LXIA 1S59A 3PEJA 3BGFA 2XMUA 1V3RA 2BW2A 1KFDA 4RNMA 3R2CJ 2BR0A 2DH7A 1RAAB 3SCKE 1IBLJ 4KGKA 4Y3CA 1NLKL 3M2VB 4MJKA 3DHWC 2EFNA 3DU5A 2YNGB 1Q0NA 2JEFA 3JYTB 1TTHB 1E6VB 1FE0A 4I67A 4O3NA 3MDFA 3RB0A 3I31A 1FNXH 3C6TA 3PYDA 1S1XB 2DEJA 1LV5A 3C14A 4ZITA 2ZNZA 3C46A 2JVRA 3MPVA 2X1AA 2B6AA 4UQTA 4FDFA 2E7VA 4D3HA 1S7IA 4I68A 1LW0B 2VJVA 1NHUA 2JRSA 2UUTA 1IKYA 4H4OB 2NXNA 1JLGB 1PJ6A 3EZUA 2DNZA 3EGVA 1RCXB 1KQGB 5ETPA 2E5IA 4M1KA 3HK2A 3MMCB 3HZGA 1XR5A 3T6JA 3TO8A 2FIUA 4DSLA 3E51A 3PNIA 4OYOA 5IS2A 3PV8A 5DQGA 2BUNA 3A8KA 1FWKA 1TKZA 5DQIA 1FF2A 5E2QA 2GMJA 1UETA 4PWDB 2B0GA 2DY9A 2FYXA 3BREA 3AB2B 1RI7A 1VDHA 2D3OR 1T3NA 2W9CA 2QLXA 1Y10A 3K2YA 4DFMA 1ZM2A 1WF0A 5KFTA 4O3QA 3ZNUA 2RJZA 2WSCC 3LPYA 3IS9B 3O44A 4LT6A 1WWHA 4OV6A 3QIDA 5K20B 1MMLA 3F41A 2DTJA 2LQ9A 4YS2A 2Y9HA 1HNWF 2W7AA 1D9DA 3FNNA 2ZC4A 1S1TB 3H5SA 3QSIA 2C28A 2XO7A 3BN7A 3G8QA 4IH6A 2XNRA 2RHQB 3OR1B 5HMXA 2DHSA 3N01A 3HHLC 2DT9A 4KTQA 2UUAF 1YBUA 4OYBA 2W4DA 3HHKA 2QG9B 2FJAB 1U2RA 4B9TA 1NK7A 4F2RA 4FP9A 3FSXA 4BWMA 4EK2A 2PE8A 2R7OA 3FJ2A 4AFFA 3W8PA 4QIEA 3DHXA 4KGXB 1GX5A 1RUSA 4HTIA 1D9FA 2VG5B 3TEGA 3GWCA 2E29A 2IFXA 3BBCA 3ILOA 2J0WA 1HWKA 3IXQA 3QPIA 3UI3A 3IA0A 3MCNA 2VBWA 2QC3A 3AODA 1D8YA 3M2UA 2UXBJ 4IKAA 4G3IA 5M2PA 4N8OA 4XIUA 3BKTA 4HL9A 5C25A 2R2TA 1HWLA 1DLOA 4A8YA 2CZ4A 3IM8A 1A0OB 2ZZTA 3B82A 2R7WA 2O1PA 3QJLA 3EX7B 4ZK7M 1ACMB 3OL7A 1H3DA 4DR6J 2KZZA 1BMQB 3FMBA 3J7YI 2MB0B 2V6AA 1FKOA 3I55S 2N4DA 2H1YA 2B9YA 4N8NA 2OEMA 1WG4A 2YNHA 4ED7A 4QIWD 4W98A 2GJFA 2BJDA 2FDNA 2WW4A 2UVUA 2HSEB 2A1BA 4C0HA 2FJXA 3M8PB 4IRKA 3AXKA 5IQ6A 4DSEA 1GT8A 2V8DA 2OI2A 4TQRA 1AT1B 4U7UD 1XNQJ 5AXKA 1VBKA 5C42B 3M8SA 4DSFA 1K47A 2QLWA 2R7QA 3DLKA 2YNIB 2RKIB 3I56S 4NOHA 1S1VA 1HNWJ 3QT6A 4RW7A 4DR5F 1W2IA 1DQAA 4J37A 3V4IA 1BQNB 4CP5A 3R6GB 1QE1B 4MK8A 2FHKA 2IY5B 2UUAJ 4F4ZA 2BA9A 2GMHA 2RSQA 3ZTQA 1TV6B 4ZHRA 1V9OA 3EZOA 4OZ0A 3GJTB 3G6YA 4DHVA 1YDLA 2DR8A 3L9ZA 2J0QD 3IBCB 4DMZA 2IHR1 3ETMA 3KHHA 5E41A 3TJ8A 3ONQA 1T7PA 3PZPA 2RIJA 4YFUA 4NL5A 1Q78A 1C0TB 3TUIC 2BJEA 1OYDA 3DC2A 5CD4A 1TUGB 3MMAA 1XR7A 2RUSA 1CJUB 3GJQB 5J2MA 4LF4F 5M2RA 1AZSB 4KKOB 3JSRA 1VQMS 1YBAA 1QAXA 4JI5F 1H7WA 3MCOA 2AYGA 2P8IA 5KFPA 2ZH8A 4K50A 2B4OA 4R25A 5HBMB 5D78A 2HK3A 2RILA 1WTBA 5HATA 3QAEA 2VB6A 1XMOJ 4DV0F 1NBEB 1ZAWA 1MW7A 5E3RA 4PG4A 1IUJA 2Y1JA 2IJFA 2RF2B 1SC1B 4X4NA 1OQ3A 3WX4A 3KHLA 2PA8D 1JXEA 3UN2A 4FF1A 2MEWA 3CO9A 3DN9A 2DNRA 3HD2A 1FRJA 1FNMA 2PO4A 4HT5A 4F0KA 1HNVB 2E5LF 4KV8B 1OY6A 2Z57B 1FDBA 3OTDA 4H4KC 4RKUC 5IV3A 1AFIA 3Q8VA 3Q23A 5K8OA 2JEIA 4ANCA 4PQUA 4W90B 2YBVA 3IMQJ 3KLIB 3UVJB 4OZ2A 1XQIA 3HFVA 1Q4RA 2C42A 4M5NA 5GAEU 2CXEA 2Z2ZA 3DRSA 2MQPA 1U8SA 2GGPB 2C2ZB 4RW4B 5K8PA 4LF8F 3AXMA 3PYFA 3CT9A 1WOOA 1PG5B 2LQ8A 1GTEA 3MPYA 3UNYA 1SJQA 3AH6A 3GSDA 1SC6A 1X5SA 3HULA 4C48A 2WSFC 3AA8A 5J1EA 2A10A 2JEGA 2YKMA 5HAOA 1VRTA 2ZE2B 4YHHJ 2YNFB 4BBYA 5GAHI 2R7SA 2HIYA 2ROGA 2DGWA 2KN4A 3HP6A 2G9OA 3LA0A 4A8FA 1XMQF 5MLCV 1X4HA 3IRWP 1WJ9A 1KC8T 1FDAA 1JKHA 1RWMB 2Z2LA 3CE8A 5KFAA 3U1LA 1PJ5A 4NCGB 2DBBA 3DI6B 2WHOA 1H72C 2C3YA 2YX7A 1S48A 2DY1A 3M2RA 2ZD1A 4L3KA 4B9SA 5HVHA 4JI5J 1EKSA 3DOKA 4HEA9 4OI2A 4G1QA 1NKBA 2JHEA 1GK8A 1O8BA 2FLNA 1H0HB 5IQQA 1DRZA 4KPYA 1C4AA 3PRDA 4MMOA 2XG8A 2ZM6F 3EXCX 2BYCA 1C4CA 4FYDA 4USIA 2QFIA 2M5YA 2EW9A 4CLTA 4AL5A 5HVFA 4BLGA 4DV7F 5C7PA 2JC0A 2CQ0A 2DXDA 2IMWP 1GEHA 2X1FA 1U0HB 1E6YA 4O4GA 2XSJB 1X4EA 2HRYA 1WI8A 4QWEA 2AJ0A 4RLEA 3K8WA 4MT1A 4JB8B 2DITA 2E5LJ 3CJ5A 3D66A 1RAEB 3R5BA 2ZH9A 5KT2A 4L76A 4N7TA 1SCJB 4C8MA 5GADU 3I5BA 1WF1A 1C1BB 3NGTA 3ZTSA 2BACA 1XIQA 1B7YB 1VOMA 3A3PB 2ZBIA 3OUYA 2NXEA 2ZH7A 3ITHA 1B7FA 4ECTA 1YIJS 3M4XA 1H2VZ 1OY9A 4PG7A 4B9NA 3P96A 4U8VA 1TKXB 4J5OA 2KKHA 3ILLA 5MAOA 3V6DB 1M5HA 4F67A 1RB0A 4PG5A 1U47A 5KFZA 1IKWB 1UEKA 3EYZA 1Y3JA 3KLHB 2H3EB 2C3MA 5D0RA 2VG6B 2OKQA 3VVUA 2H51B 4USUA 2XLKA 4ECRA 2Q3PA 2M7SA 5C24B 3VHQA 4W92B 4BDPA 2G1DA 1ZYQA 3KWMA 4I6YA 1VGYA 5EGYA 2D9PA 1KVIA 3DRYA 5THWA 4M5GA 2KFZA 2ZH3A 2J6TA 3CNQP 1N4LA 4WP9A 3OXLA 3QJJA 5LL6d 1R0AB 3D3BJ 3Q2SC 2DR6A 4DCPB 1YKWA 3MMBB 1RP5A 3MAHA 1C0UA 2ZBCA 2EFGA 4DS5A 2AIRB 2XWXA 4N56A 1PAEX 4OHWA 3KLGA 4OX7A 2ZM6J 4ALZA 3WC2A 3BYPA 4LIRA 2J8AA 4CNZA 1Y5NB 1H38A 2XMMA 4K2JA 3L7OA 2JNJA 4QW9A 5B0FA 2AYBA 3S6EA 4DV7J 3KLFA 1YVFA 3I0RB 2HEKA 1HBNA 4Q5VA 3DRRB 4RZRA 2YKNA 2B5JB 5K5MA 5DDRC 2FGCA 5SZTA 1RCOB 3O3LA 1RTIB 4RR5A 3CMQA 3HT0A 5FLXY 3K58A 3RBDA 5DJBA 3HHLB 3GG1A 5CQGA 3ZZTA 3NBPB 4ZOSA 2AV5A 1DTTA 1AA1B 3IRXA 2G1HA 4HVZA 4F36A 3GV7B 4OX9J 2AQ4A 2FQQB 1UVKA 1JQGA 3DCAA 4Y2AA 4AQYF 4HACA 4NEZA 1V3SA 1F2GA 1Z4UA 2BM0A 5J1NA 3ENQA 3PW5A 1VQ5S 4QWDA 1WF2A 4X4VA 1VQNS 2BQUA 4LFAF 3BJYA 2WONA 4X4PA 3GYXB 1ITPA 2ZBRA 5KFBA 2OIHA 5JXSA 4LF1A 4F04B 2RNEA 2V8VA 3NWRA 2M3DA 3TX0A 2YWKA 2FGOA 1WDDA 4IOBA 2R7UA 2R8GA 1L3KA 2X51A 5EN1A 3BR9A 2ZZNA 4NLDA 4EO6A 4CLLA 2NS1B 3R7SB 2J8SA 3TA2A 2ATLA 2W9BB 2JZ5A 1Y00A 2H4WB 2RQCA 4M5DB 1ZETA 2EKYA 1I1GA 4EZ6A 2WCXA 4QYZK 1NH8A 2GO8A 1S79A 4H4MB 2BJ3A 3DDIA 4QJVA 1TKTB 3CIZA 3LANA 1YZ6A 1CJKB 2IRYA 2ZH4A 4GO7X 2ZWPA 2DGVA 1VQ6S 1TL5A 2CJQA 2RDJA 1P1TA 2G13A 2J6SA 2EG1A 1JIHA 5L46A 3EGNA 1PBAA 1V5IB 2CQHA 2W2QP 3K5MA 5EWEA 3KJVB 2YPYA 3M9OB 2HZAA 1EQ0A 3VAIA 4QYRA 3BGOP 3MD3A 3MCMA 4R8UA 5IT9U 2MDAA 3LP0A 2ASDA 1OPZA 1F2HA 2XY6A 3D3CJ 5A8KB 3NP5A 4Z7YA 5JVGQ 4NRTA 3FEYB 4Y65A 2I2YA 3O2IA 4AXIA 3J7ZT 1NJXA 4OI6A 1RT3B 2IC3A 2G2ZA 4ILLA 3RAMA 1AXQA 2WBRA 2V69A 1EETB 1SH0A 3DRXA 3QGPA 4DL4A 3VTIA 5F8JA 3MEDA 3K57A 1RQ0A 1Y4ZB 4UW2A 1UFWA 2HIQA 1TK8A 2NYHA 1EZZB 3TQ1A 2GAGC 4PEOA 2MKJA 2HG4A 3DLHA 3QO9A 4CLWA 4ZPVR 5J2NA 3BB5A 2HMIA 2UUBF 3AQPA 1KRPA 5CHCB 2QN6B 4NLUA 2Z30B 1CQMA 3G82B 3MM5B 2HK2A 2HFOA 1RWWB 1BQXA 1YG0A 1HLWA 2BRLA 4NLXA 4ZCMA 2OLWA 3BSOA 3RBXA 1UEUA 5ETNA 1IKVB 1FTRA 3GQCA 1XTZA 4PXEA 1YWXA 3MZIA 3EPGA 3ZC4A 2DJWA 3POTA 1BHNA 4UTGA 1U02A 1YBTA 2GJIA 5KT4A 3R97A 5C2GA 1EJ7L 1S1WA 4IG3A 3W64A 1QSSA 3CC7S 2CWXA 3PR4A 5BYQA 3CDUA 3HMJG 2AEFA 3RW7A 2XI3A 1WTFA 4EBCA 2HAIA 2V2KA 1LXNA 2ILYA 3I0SA 5D6GA 3SI8A 1BUXA 3D54A 4J9OA 4LVOP 2XB2D 4EO8A 2ACYA 4DS4A 4ED8A 4DCOB 3BPDA 2OPQA 1BC6A 5AXMA 5KFIA 4DN0A 4GC7A 2A3JA 4DZDA 4QWCA 1YJ7A 4ICLB 1YRTA 2R8HA 4RUAA 2DH8A 3PJWA 2F5GA 2RE1A 4JV0A 1S99A 4LBHA 3Q24A 1UWBB 1JWWA 4C8NA 2IM1A 2ZFHA 1FJ7A 1TZ0A 3Q8UA 1H73A 2HFSA 4QQBA 4OX6A 3CCQS 2CJBA 2B9WA 1OMSA 1A9NB 1W7WA 2WTFA 5B0GA 1QLNA 3MTJA 3ZXWA 2E66A 5CD4H 2IM2A 4ZCLA 1FHTA 1ZBTA 2RT3A 3DRPA 2W4PA 4X62F 3TAQA 2JJ4D 4ZP9A 3M32A 3BEGB 3PFEA 4ID5B 1HA1A 5F0UA 1NM2A 4C8KA 5ETVA 3ISND 3DOMB 2UXCF 4UZCA 2Z2MA 3CJ3A 3NGUA 3CJKB 2AMCB 4P7VA 3CD5A 2OPPA 4DG1B 1RJJA 3HM9A 1S6PB 4UUXA 4WKRA 4ATNA 3GMGA 1R0CB 3ET6A 2WVFA 4P2SA 4JI3F 2BVZA 2I8EA 1KQFB 2M9KA 5GVQA 4DV6F 3IC1A 2C3UA 2EFOA 1PCAA 4OZ3A 3OJUA 2BE2B 5F0WA 3CGIA 3NGKA 2VDIA 3BBBA 4ID8A 3MOJB 1P6TA 1SPBP 4MFBA 2HQGA 1GXUA 4KFBB 3MEEA 4I2PA 3NNCA 2V8HA 2HQFA 2EFPA 2BQRA 1FK9B 1ZAVA 1A6LA 2L9WA 5EDWA 2XSFA 4C8LA 5LXRA 2IVYA 4YR3A 3DLGB 2MY7A 2B9XA 1HW9A 3CMAS 4H54A 3QWUA 3AHPA 3BDEA 3D6HB 3HDSA 3OL8A 1RLDA 2N4CA 2DO0A 1SBRA 2WK4A 1RTDA 1Y11A 2VICA 5DS7A 4K4ZA 4DU8A 4FXWA 2J0SD 4KGZB 2CQIA 1YJVA 1VHFA 3QATA 3QNWB 1FFWB 5A2QU 1X9WA 5G0RB 1WHYA 2FTRA 2PMHA 4UUWA 3CF5Q 5A6PA 2KRRA 6AT1B 4I4BA 1IKXB 2E7WA 3GP9A 4GKKF 3H7HB 4X64F 1S6QB 1T8EA 2FC8A 3TUJC 3Q8RB 3W2VA 2LLZA 3C15A 3QIPB 1CS4A 3H2LA 5L1JA 4RW9A 1IR2A 1T05B 5K14B 1HHTP 3KLEB 4CO5A 2UXCJ 1FFGB 3RAXA 3KK3B 4C11A 3KG1A 1M5PC 2OEJA 3W62A 1HBUB 4JI7J 2HQ3A 1CJVA 3W1YC 2VPYB 2ZEJA 5KFQA 4P75A 1FD8A 5DETA 2DNPA 4DN9A 2VF3A 2JL9A 3M8WA 1I6JA 3M7VA 5DZ6A 4GC6A 3RRKA 4DR7F 2YWEA 4JI3J 1HQUA 2E7XA 2J6UA 2BV3A 4USMA 1U2CA 2DHHA 2GIRA 2UVRA 4LF6F 3FMWA 1H2UX 4DXLA 4OIXA 2NZCA 5I3PA 1GMWA 2NXJA 2EKNA 1KLNA 2PMZD 2AW0A 1ROFA 4PR6A 3H2VE 1AFJA 2JH3A 5CYMA 2W8LA 4A46A 3S01A 2QLFB 2OP5A 1MN7A 2ZOGA 1SIZA 2MKCA 4ZVEA 4EFAC 1YJ9S 1YHQS 1J5OA 3CC2S 1IJFB 5KFKA 1XNRJ 1SKWA 5T7LB 4WTOB 2B51A 3UCUP 2O5DA 3CDWA 2QMXA 1C1CA 1HBMA 2VFUA 3GFYA 4JI4F 3JB9k 2DRDA 3M6XA 3HKWA 2DNYA 2JSXA 3KHGA 4BC7A 1GQEA 2VHGA 3BF4A 1NHKL 2CG8A 3B78A 1QAIA 4J9MA 3H42A 3ZTPA 1RWXB 2HHQA 2HBRB 4LSNB 2CJXB 1NSQA 1N0VC 2CRLA 5AE3A 5ETQA 4PUOA 1CULB 3R5AA 4GKKJ 2CZVC 1KLMA 5DLFA 2FZKB 2QEXS 2BM1A 4UY8T 2W24A 3VGTA 4YY3J 2DNKA 5ITHA 2OELA 3QMQA 2ZZMA 3SSRA 3GTYX 3HVAA 2J7UA 2MMYA 4FBTA 4QBUA 2ROEA 2IM0A 3D1OA 3UW1A 2DGTA 5K8MA 4OJ3A 2FJDB 4RW6A 1VMBA 4NXNJ 1CSJA 2O01C 2HFNA 3EMTA 3QT5A 2WAQD 3DLEA 2VOPA 2ZOMA 4U96A 4O3RA 1UTAA 2HURA 3DGVA 2MQOA 1WC6A 1RWVB 3A3NB 3M05A 1MLAA 4USJC 4XTTA 4A8SA 2NXCA 4X66J 1SVDA 3EZ5A 2E9RX 1IBCB 1OSCA 4LF6J 4BHQA 1NSAA 4P9SA 3KOAA 1RABB 3LQVA 4QOTA 3L7UA 1JB0C 4X4OA 2C2KB 4CNYA 1RTZA 4USWA 3CPWR 1LWEA 5HP1A 1L3VA 4FVMA 4J9NA 2C2OB 1S9FA 6FD1A 3TWZA 1MU2B 3U1NA 2VA2A 1FA0A 1X4BA 4KIAA 3TZYA 4OHZA 3PW0A 1M5SA 4LSZB 1FFSB 2YTCA 1YTYA 1KVJA 4A8QA 2CJ9A 2NPFA 4JI4J 4LF7F 2DIUA 4EUVA 5IWAJ 5KFXA 3R7BB 4CLFA 5LM7E 2KO1A 3G87A 2K7JA 4C6AA 3SV4A 4NX9A 2CADA 3QT7A 1T02A 5EHHA 3UDVA 3BO2A 4ECUA 3LP2A 4M5JA 3R2DJ 2QL7B 2AX0A 3T9ZA 4WE1A 1B3TA 4R5PA 4JYAF 1JLEA 1LNQA 3RZAA 1I94F 5JJBA 1N36J 2DHGA 3IR7B 4P10A 3F73A 2AT1B 2YX1A 4I7FB 3Q8PB 2C22A 1NMEB 2DH9A 3G8TA 2K3IA 3MECB 1NO8A 4QPTA 4B3MF 5A8WB 2QSFA 5ETLA 1URRA 1FRHA 2CQPA 1H98A 1RT6B 3NEKA 4DPOA 1WG5A 5KG1A 4ED1A 2FVSA 2B43A 1LWFA 3GG0A 4LRFA 3VAJA 2NCKL 1GH8A 1X60A 5KFYA 1CC7A 1VQ4S 5T41A 1R0BG 2J76E 5KAKA 3OT9A 1YJTA 4WFYA 1MROA 1M5KC 4NEYA 2GFFA 4CLSA 3KLVA 1W25A 1X4DA 2VFSA 4USKA 1HPZB 3PVXA 4X4RA 2M0GB 4KO0B 4Y2MA 5KT6A 1P1LA 1RWOB 5HMZA 4QW8A 1Q1KA 3EVMA 1VK8A 4ZVGA 5T14A 4GVLA 3LP1B 2HHTA 1X7VA 5F8HA 3QGIA 2V2VA 1X5TA 5GAGI 2PN6A 2AEJA 1C2PA 4CO2A 2ADCA 4BS2A 3OTOJ 4QR0A 5L8RC 3QZ8A 2F1FA 4DQRA 4DQIA 1XC9A 1F3VA 5EUHA 4ZPDA 2QRRA 1WNEA 2AYEA 3GYGA 1X4CA 3J81Y 3T1AA 3UQSA 3VV2B 2LP4A 2ACMA 3M2VA 3KKFA 2YNGA 3ISNC 3TP2A 2HBZB 4OMFG 3JYTA 3NOCA 3EVOA 1E6VA 2R8JA 2LVWA 2MZ1A 1NU4A 3BR8A 4P2FA 3CCVS 1NK5A 2RQ4A 4ZP8A 1RTJB 2W4CA 3MURP 3G6VA 2HS0A 1YX2A 1UVNA 1S1XA 1LK5A 3UR3C 1GMWD 3D6TB 1I94J 1AB8A 4RU9A 1Q8BA 2KFYA 2GVZB 3VAGA 4F26A 1LW0A 5F8MA 3QRQA 2L9DA 1KS2A 4H4OA 4R0EA 3THTA 2HAFA 1JLGA 4W4MA 3RG6A 1GMVA 1SKRA 3KNAA 1MWQA 3ENAA 1M1GA 4NASA 3MMCA 5LMUF 5E33A 1TUWA 5EWGA 1VJWA 3DYAB 3MEGB 1HKAA 3CJ2A 4L3NA 2CNOB 4HHJA 4UOHA 4QU6A 3OTEA 2OMLA 5HANA 1NDPA 4P2XA 4DL5A 3FSYA 4NLVA 4GKJF 1TQLA 3CCSS 2XY7A 5L1KA 3ZFVA 1RAGB 5LJ3Y 4PWDA 4WZQA 1YLXA 1N0UA 1R89A 1EB0A 2O66A 3IG1B 4NZ7A 2B56A 4FF3A 4CZCA 2NPIA 2ADBA 4Z7CA 4P52A 4C3KA 3TQEA 3P49B 4ECZA 1HYSB 4CTAB 2HWHA 1FDDA 3IS9A 4IFYB 5IT4A 3TARA 1K9MT 2FB0A 4KT0C 5F8IA 2B3TB 3KK1B 2AHOB 4LF5F 1T0TV 1FO1A 2J5AA 4DL7A 4LFBJ 3H25A 4JBCA 1S1TA 2C3OA 4YDXA 3HCXA 3R3TA 4LMZA 3CUNA 3OR1A 2AGOA 3FKBA 3HVRA 1HNZF 2IDEA 1Y0HA 2PMWA 2DEIA 4TY8B 3IGNA 1UZDA 3NS7B 5CABA 1RWNB 1X9MA 2FJBB 4NMXA 2CA9A 1N5SA 3HJFA 1HBOB 1YQHA 2QTWA 4PXBA 2HHHF 4X4UA 2DXEA 4WU3A 2VG5A 1CJTB 2HWIA 4FYXB 4UQGA 3B6BA 3KFWX 4Y34A 4ERDA 1MSWD 2RRNA 4NCBA 4BC9A 1T9XA 1MWYA 2DR9A 2Z0GA 3RBEA 2EXUA 4J9UE 5CYQB 1G7CB 1W26A 4LF9F 1QUVA 1K44A 1WACA 1ZTTA 3SIPB 4F25A 3M6VA 3CMES 1PYTA 4OI3A 3JSBA 2FVPA 3BV8A 1BWVA 3SCLE 2LXUA 4A8XA 3U7JA 3NAIA 5B0DA 2LXFA 2R2UA 1KOHA 2KHDA 3WIUA 4DJBA 2YWFA 5E3PA 3C3LA 4GKJJ 4HDHA 4OV1A 2DR5A 3QT8A 2UUCJ 4U7CA 4X65F 1HHQA 2Y8YA 1EIYB 3WHIA 4L74A 1Z2ZA 1NKEA 3CJ0A 4IG0B 3M8PA 2EK1A 2DNGA 1RSCA 2DD8S 3PXGa 1OS5A 4RNOA 3NKYA 4KGMA 1T9UA 2HPUA 2XMVA 2E9TA 2VKZG 2V9KA 3FBEA 1JLCB 4MK7A 3R1HA 1N5TA 2HGMA 5C42A 4DV4F 3NMRA 4ITSA 5B0EA 3OJSA 4LF5J 2YNIA 4KRWA 2RKIA 2Q1LA 3DMJB 3E01B 1AW0A 5FJ4A 4DV5F 2IRXA 1T94A 5DG9A 2XI2A 2QZ8A 1BQNA 4DFJA 4UT4A 4EBDA 4J9LA 1QE1A 4JI2J 3PX4A 3H20A 2E5JA 2HHUA 3MF5A 3W8GA 2WB4A 1UW4A 3MHYA 1TV6A 2L08A 3QGGA 2GHVC 5KFCA 2F9DA 2ZHAA 2DGUA 3TX8A 2DISA 4WZMA 4ETZA 1D09B 2HHHJ 2IM3A 2DNQA 1FNOA 4I1TA 3MFIA 3ZO7A 2POKA 1UA1A 4U6PA 1YJNS 2MGZB 3MM7B 4I69A 1JJCB 2DK2A 1C0TA 1NUEA 3NL0A 4NCAA 2A6OA 3HFZB 1QY7A 1NHVA 1OJ4A 1CJUA 4F4WA 4XDDA 3ICLA 4FPRA 1QTMA 3MR5A 3M1VB 1AZSA 3N6LA 4KKOA 1FEHA 4USHA 2IVMA 1IM6A 1LOUA 1HD1A 2VG7B 1UZHA 2ATCB 4J7CA 2D7SA 1G3OA 5HBMA 3TVYA 2W8KA 4J91A 4DX7A 3H5UA 1YJWS 1S57A 4B3OB 1VC6A 4X65J 4K7QA 3THPA 4OLOA 2RF2A 1N48A 3RAQA 1F9EB 5CYJA 1F5AA 2ZJQQ 2QIFA 3MD1A 1FKPB 2LCWA 1NK4A 2ZH1A 2PFFB 3AD7C 3HSZA 1HNVA 4KV8A 4LRAA 2JFDA 3A4TA 2AKWB 1WG1A 1ZZFA 4WXWA 1HI8A 3PRVA 5H9FJ 1WEZA 1LXJA 1KHWA 1NSKL 3KLIA 4I2QB 3UVJA 2AU0A 3HHEA 2SXLA 1L3SA 1T11A 3KXDA 5CXTA 2GGPA 4RW4A 1J5EJ 2KZMA 5IFMA 1LKZA 2ABYA 3NGDA 1VISA 3OHBA 2Q79A 2XNQA 3CCRS 5GAGU 2HKEA 4AT1B 2HHWA 5DO2A 2KI2A 2ZE2A 1R8PA 2YNFA 1S9EB 1Y7PA 3CCWA 5B0CA 1JLFB 1MMNA 2MSSA 3ZZZA 2GMLA 4WIQA 1U09A 4DWIA 3UCZP 1H6KX 3Q8SB 4DV1F 2UXDF 4RU2A 3DLJA 3UDLA 2NUUG 4KC5A 2K7KA 4F3OA 3JSYA 3K5OA 3ZZPA 2KJWA 3AD9C 4NCGA 1H7XA 3W5ZA 4DX8H 4DFKA 4MH8A 4MAKA 3BH6B 3DI6A 4ZCKA 1F5CA 1XR6A 2UVWA 1XERA 4CDIA 3TANA 3V4MA 2P5VA 1B70B 2HNDB 1FKAF 3MPWA 3I82A 5DGBA 3CJRA 3R9LA 5FDLB 1SJFA 1UVJA 4ZN1A 3JAMY 4OYZA 1N8RT 4WTYA 4DFPA 1RHKB 2HQCA 3E3XA 4RUBA 3TEHB 1U1MA 4PG8A 1IQTA 3CO0P 1HIYA 1U0HA 1N6QB 2XSJA 2EVZA 2V34A 5L1LA 1VQ7S 3RB3A 3PKMA 1J2VA 3BGUA 5KFJA 1VK3A 1SQFA 2CQ3A 4ZVUB 4URQU 2VKRA 2F65A 2CNLB 1C1BA 3U02A 2XMWA 2VFRA 1RU2A 2WB1D 3I9ZA 2DXFA 3CC4S 1U8WA 2YKPA 2L41A 4G6VB 4B3SJ 1TKXA 2X3GA 1M5OC 3P5BP 3ELHA 3V6DA 3HLUA 1ZPVA 2B7CB 3EDRB 1IKWA 5ETMA 5E7OB 3KLHA 2ZH5A 3FEZA 1VBZA 2PT0A 2QA2A 2VG6A 4CH0S 3KG0A 5KFUA 2NYIA 2Y0BB 2MJNA 4OZNA 4LBIA 5D4OA 2F4VF 5C24A 3NWGA 4LBPA 3M9MB 5KFEA 3JS9A 2DO4A 1KEKA 2QYCA 4ZVQB 3ETOA 3HHDA 2DNOA 4DV1J 2UXDJ 3EXYA 3IAM9 1N32J 4F2SA 4DSKA 2P6SA 4Q0BB 2CPHA 3W9JA 1SV5B 1A7GE 1R0AA 2EG2A 4N47A 3V81B 2E1RA 3PJ9A 2LA4A 3MMBA 2K3KA 2XO6A 2OPRB 1D3WA 3Q22A 1JMTA 4LFCF 4OZ5A 1RT5B 3M30B 4ELTA 3P45B 4KQZA 4DR3F 1NZAA 2WVEA 2B7BB 3UWTA 3ILIA 3A12A 4FF4A 1Q8IA 1FJGF 2UU9F 5F8NA 4KE5A 5GADI 2V4RA 3TUPA 3I0RA 3X3UA 2GAHC 3DRRA 4P73A 2HNZB 2B5JA 4DI6A 2ZNYA 3H0PA 1RTIA 3FVYA 2Q43A 3HHLA 4J90A 4Q2MA 4IQXA 3NBPA 2GHPA 4HT7A 5L39A 3BM7A 1UFLA 4IO1A 4C3LA 3HJVA 2Z4PA 1K8AT 2WW8A 3SBMA 1N33F 3QAUA 5CCLA 2J7KA 2YQ1A 1Q8KA 3UFCX 1S77D 2RRAA 2HHXA 2M70A 4YP3A 4HKQA 2AGQA 2MSTA 1GFWB 4B9MA 2Y1RI 2XHWA 1RACB 2CQ4A 4QCLA 3C8YA 3KMSA 4ECYA 3VVTA 4DPUA 2C2RA 2H65B 2R42A 1HWIA 2C3PA 2OJ3A 5JUMA 4M5LA 1QUPA 4MKBA 3ZZ0A 3J80Y 1NZ8A 4RO0A 3C6UB 3L7PA 3VAFA 1F0XA 3MM8B 1KTQA 1RISA 2QLBB 3SQGB 2W9BA 1S72S 3O6QA 3D6FB 1JLBB 4M5DA 3OLBA 3MOZA 1M0SA 4LFCJ 4FS2A 3MUVP 2P9GA 4ZN3A 2LEAA 4LUBA 5IV4A 3TAMB 4H4MA 3UO0A 4DR3J 1TKTA 1B4SA 2C2NA 4O44B 3D9BA 2HQIA 4Y28C 4LQ3A 4DQPA 2GQQA 1CJKA 1IVZA 1M5VC 2FC9A 1K0VA 3OTCA 5KFHA 3JQMA 2KT5A 1U4BA 1FJGJ 4X4TA 4X4SA 2K1RB 3VGVA 3GE9A 2QA1A 2GO9A 2UU9J 1Z2LA 2CDQA 3PKYA 3SCIE 1Q7LB 2CPJA 4C3MA 2RAQA 3N5FA 2JOQA 3KJVA 3HVWA 2DIVA 4WFBQ 4F4XA 2DNMA 3M6WA 4YR0A 3K59A 1HMVB 5L1IA 2ZJPQ 5A6WA 4YB5A 2VFVA 3CXCR 5IM0B 5KG6A 5AE2A 4PRFA 5A8KA 2A2CA 1TVRB 1JJ2R 3D5MA 1N33J 5ETKA 2EBGA 4RBVA 1CPZA 1FEEA 2MLZA 1HQEB 4HLBA 2H5JB 2IYGA 1FXRA 1KDNA 1RT3A 1DHMA 3MMJA 3MR6A 3VALA 2IYIA 1WELA 1RBOB 2GA7A 2CKWA 2PC6A 1MMDA 2MZQA 5J1PA 2RQKA 1EETA 1N56A 2BKPA 4JI1F 1FRMA 1VYAA 4WKYA 2FJVA 1QVFR 1FXLA 4QWBA 1IXKA 2CAJA 1M1HA 2MZSA 2AWZA 3Q89A 4CIOA 2RS2A 1SB6A 2XULA 3TI0A 4DSJA 4USVA 1U1RA 5DM6Q 2IA0A 4IFVB 3G82A 3MM5A 3QZ7A 1RTHB 4Z2XA 3DGPB 1TK5A 4DZ6A 2IAJB 3TYTA 3I87A 1FJCA 2XLJA 5DQHA 1REVB 1FX2A 2GCFA 5KG2A 1IKVA 3P8BB 3SMZA 3K0JA 2ZJRQ 4OI1A 1RAFB 4JV2A 1RT2B 2AJ1A 4WFZA 2ASJA 4H4KA 2BKOA 1ZOTA 1B0TA 1EP4B 3F0NA 4O3SA 4M5IA 1SXLA 1JXLA 2CQBA 2FHMA 4E8UA 3T41A 2BRKA 3G6XA 4OYIA 4KHPF 1NPPA 3B8HA 1U6FA 5KFGA 1KQSR 2W7OA 2HVHA 2VBYA 4RNNA 4IDKB 3KUEA 2HWTA 4MIAA 3CJQA 2JEJA 2CDRB 2I0XA 1HL6A 1LFWA 3IO1A 5H1SV 2PEHA 2W2MP 1BXNA 1RAJA 2G2YA 4IR1A 4ICLA 1ICEB 3EDQB 1FWLA 5J2QB 4NLRA 1TFYA 1FESA 3N79A 1AUDA 4ED5A 4K4YA 4DR5J 3H8YA 5ETOA 4RBTA 5D8HB 5L9NA 3RR7A 4QIGA 3T1HF 4M94A 1FVQA 1JX4A 1UWBA 3FCVA 1B0PA 2K2PA 4JI1J 3TNVA 2I38A 4B3TF 1P8GA 4ENOA 2G4BA 5KOXA 2ZDOA 3JTOA 3T1YF 5JVHQ 3JQJA 4J9RA 4DL2A 5IOLA 4KBIA 1HR0F 4ZIWA 2B4PA 3C16B 3W5XA 2EK6A 2E1PA 4LJMA 3HHLD 3ZTRA 4C7QA 4ID5A 4IO9Q 3BPSP 2AJQA 3U27A 3MAQA 2VU5A 2F4FA 4O3OA 3DOMA 2LEBA 1Y5LB 2IBOA 4MK9A 5BR8F 3TVZA 2H5IB 4FNIA 3ULHA 1YI2S 1APSA 5DM7Q 2R3VA 4ECWA 3CJKA 4WJBA 4K8RA 3O5TB 2ILZA 4LF4J 4DG1A 1QDUB 2FPHX 3D67A 3G8SA 4V19J 1S6PA 1D1UA 3C2PA 4QWAA 4NLSA 4L75A 4YR2A 3AA9A 3NAHA 1O6XA 4DR2F 1R7IA 3KUHA 1YRUA 3W7BA 2QFJA 4FYVB 1CQNA 5HMWA 2A2DA 1UPMB 3TZZA 4DV0J 2Y3YA 2OEKA 5I3UB 3K5PA 2ZVSA 3PIOQ 3GFXA 3MM9B 2BE2A 2O3DA 2ZITA 1LWCB 2DPIA 2G0JA 5HK4A 1U45A 2D41A 4MIBA 3LOUA 4KFBA 5ETTA 2LDYA 2FVRA 1UVLA 3AB4B 4Y0FA 1S4EA 3D4JA 2XCPA 1VQPS 1S97A 1FK9A 2NXUA 1NCLA 3NGSA 3PIPQ 3MI7X 3UCGA 3AT1B 3DLGA 2QMUB 2D69A 2HRTA 2A6MA 2QV6A 4CO4A 2B9EA 5I3QA 3JSMB 3FBBA 2N7YA 3T1HJ 4ZKAA 2VQFF 2E44A 4CO3A 4LF8J 4DPTA 1NXIA 4CWBA 2QYGA 3VWSA 3MR3A 5G0RA 3RGIA 3N4WA 1T95A 3CB4A 1UVIA 1SC3B 1ULRA 1WD6A 1IKXA 3MTKA 4RNHA 1HR0J 1UMJA 2IJRA 3EVWA 1VCTA 2V2QA 3VAKA 5HVGA 1S6QA 4PPZA 3RB6A 3PG9A 3QIPA 2I1RA 3D2WA 1XMQJ 2XZTB 2L48A 4OYMA 3OL6A 2J9CA 1FD2A 2CPEA 5B7WA 5K14A 1T05A 3KLEA 4TYAA 1R43A 1LEOA 3KK3A 4TU7A 3QRRA 1HBUA 2HGNA 3R5CA 5D3GB 2FLLA 4A8WA 4ZVRB 4JI8F 4PKDB 2KTQA 2GC8A 1K1SA 2LYVA 5A2QY 1WHVA 3T5HA 4M5MA 3SFGA 4DR2J 4F3QA 3D0HE 2LFVA 1ZAXA 4FS1A 1IJEB 1OIAA 3OQ2A 3J81j 4URGA 2E1CA 4JUZA 7AT1B 2AJ2A 2XYHB 4NLWA 1VQSA 5F8LA 1VR6A 1VC0A 3HVTB 1XMBA 3N6NA 3SDEB 3FCWA 4U67Q 2OSQA 3W61A 1DFDA 1WOPA 4OJ1A 3ZZRA 3H5XA 4M5HA 4CO1A 4Q7AA 5IXUA 2F9JA 2KH9A 3JQKA 2MHNA 2W7PA 5T7LA 3T5KA 4D3GA 2EBEA 2MLYA 1DJ0A 2HVZA 1JNRB 4LREA 3DKDA 2DGOA 3IWXA 2VQFJ 1IBLF 5RUBA 4NA3A 1U48A 3GJSB 4DLEA 3B4MA 1X5PA 5J2PB 4DR4F 3I4HX 1Q81T 4LSNA 3ENVA 1N5YB 1KTVA 3ILJA 3B54A 4HH1A 4Q43A 1CULA 1X4GA 2QA4S 3R1LA 2GIQA 4DF4A 1YK9A 3A1YG 4EMDA 3G71S 2IBKA 3NLCA 4P7TA 3OPKA 5LT5A 4ER8A 2L3MA 3BQ1A 1SI9A 2BQ3A 1LW2B 4IOCQ 3FFIB 3H4BA 3VR1A 4I6WA 4BCAA 1RWPB 1U1PA 1RA7A 2XC9A 2MHEA 1SQEA 3ZZYA 1S49A 4ANDA 2MY8A 2XWYA 1FXDA 2RS8A 2V67A 4JI8J 4KJIA 2MZJA 3CDEA 3CCJS 4EYIB 1Q16B 1SC4B 3RRHA 5KFMA 2CYYA 5KG4A 3DDKA 1FTCA 4U8YA 1N52B 1CBKA 2YWGA 4ZS6A 2EC0A 2CJKA 2P9EA 1S6OA 2ZC3A 4KR0B 2ZH2A 2CVIA 4PWWA 1BY9A 2GNKA 5KFWA 2FHJA 4CLPA 1JLQB 3T6BA 2XMJA 1MU2A 1YRXA 2V8PA 2E5HA 3V6JA 2HNYB 1PC5A 2ZBPA 3MWBA 1DTQB 3CULA 3X1LB 2RD5C 3TA1A 2DRBA 3K5LA 1WC5A 3M8RA 4YB6A 5KFSA 2XMTA 2JDJA 3Q2TC 3PYGA 5HJXA 1FX4A 3H98A 3G96A 4AQYJ 3PY8A 3D1QA 4DR4J 4P72A 1NJZA 5GMEA 2AX1A 2XBPA 2ZOFA 3FGVA 4EBEA 5CA5A 1PKUA 3MXHP
chains in the Genus database with same CATH topology
1VRTA 2ZE2B 2HHHF 4X4UA 4CT8A 4WU3A 2VG5A 2HWIA 2YNFB 1N36F 1D9AA 4K59A 5BYSA 4UQGA 4BBYA 5GAHI 1U1LA 2R7SA 5KT5A 3BN4A 3KFWX 2ROGA 2DGWA 1QM9A 2KN4A 3VAHA 3DFEA 3HP6A 2G9OA 4Y34A 3HF5A 4A8FA 4ERDA 1XMQF 4I7FA 1MSWD 5MLCV 1X4HA 4OQJA 2UXBF 1QAYA 2RRNA 1N88A 3BGRB 3IRWP 2LMIA 3GFHA 4NCBA 1TFWA 3HO1A 3OXGA 3MECA 1KC8T 1FDAA 4BC9A 3GIIA 1S0OA 4XK8C 2D9OA 3K8VA 3S7RA 1DZ5A 4QU7A 1JKHA 2FY1A 2Z2LA 1MWYA 3KK2B 3SYZA 3CE8A 4TU8A 4J9SA 2VA3A 5KFAA 3U1LA 2E1AA 2MQNA 2DR9A 4Q8FA 1VS3A 3GZ7A 4DR1F 5A8WA 2Z0GA 1GTHA 1UAWA 4NCGB 2UZAA 2CQCA 3FQLA 3RBEA 2Q66A 2DBBA 4ZPBA 4B3RF 5D3GA 5CYQB 1G7CB 3DI6B 1VIOA 4LF9F 1QUVA 2WHOA 1RT6A 5IT0A 3GIKA 2C3YA 4DR6F 2YX7A 3HI9A 1S48A 1JNZB 4YOEA 1WACA 4EWTA 3M2RA 3R27A 2ZD1A 4B9SA 1HARA 1ZTTA 3S8SA 3V6HA 4F25A 3M6VA 3CMES 4B9UA 2YQ3A 3DOKA 4HEA9 4OI2A 4PXDA 2E1MC 5EWFA 4G1QA 4YDDB 4CH1A 4OI3A 2JHEA 1NKBA 2QSWA 1ELOA 1O8BA 4K4SA 3JSBA 4XO0A 2FLNA 1H0HB 4AL7A 2FVPA 4CCHA 5IQQA 3SCLE 2LXUA 1OSDA 4A8XA 1DRZA 3U7JA 3NAIA 4KPYA 5B0DA 2LXFA 2R2UA 5HROB 4DUZF 1KOHA 2HFZA 2KHDA 4DJBA 4F50A 2YWFA 5E3PA 3CWJA 4ECQA 1C4AA 4DQQA 5HLFB 3PRDA 4F8RA 4HDHA 4OV1A 2KJVA 4MMOA 3U1MA 2DR5A 2FLOA 3PFOA 2XG8A 3CEDA 4ED6A 2ZM6F 1QSYA 4U7CA 3EXCX 2BYCA 1C4CA 4FYDA 4USIA 4X65F 2M5YA 2EW9A 4DV2F 4L72B 4AE5A 1DAXA 2KYXA 3AY0A 4NPOA 3G4SS 4AL5A 3OFEA 4WU2A 1RKJA 1Z2ZA 2MKSA 1NKEA 1HPZA 3CJ0A 4DV7F 4IG0B 3QJPA 5DG8A 1DQ8A 4KO0A 2JC0A 3M8PA 2EK1A 2CQ0A 2DNGA 4QYZJ 2IMWP 4WCEQ 2YH1A 5A8RB 2KG1A 1E6YA 5B08A 4O4GA 2X1FA 2DD8S 2XSJB 3HVTA 1RT4B 3PXGa 1ZZNA 4OX8A 1OS5A 1X4EA 2HRYA 1WI8A 3L95X 2IVFB 3SDEA 3T9NA 4RNOA 2HYIB 3NKYA 4KGMA 4QWEA 3N9UC 2HPUA 3CDBA 2AJ0A 4ES2A 2XMVA 4RLEA 2E9TA 2VKZG 1RA6A 3K8WA 2V9KA 1XNQF 4RNFA 2DITA 1KSPA 3LP1A 2U1AA 2CIMA 4NYPA 3CJ5A 2FD2A 3R5BA 2ZH9A 1Y3KA 5KT2A 1JLCB 4OHVA 1TL1B 4MK7A 3R1HA 4OFZA 1N5TA 2HGMA 3OHAA 5ADZA 5C42A 4R8UB 4RW8B 3GR1A 4DV4F 3NMRA 4C8MA 5GADU 3I5BA 4ITSA 5B0EA 3OJSA 1YITS 1VQOS 3LP0B 1WF1A 2YNIA 5U47A 4KRWA 2RKIA 5KFRA 2Q1LA 1SL1A 1C1BB 5FD1A 1S0NA 3DMJB 3OTOF 2BACA 3R5DA 3E01B 2KU7A 2F8EX 1VOMA 5DLGA 1AW0A 2ZBIA 3OUYA 4DV5F 5FJ4A 3OLAA 1CLFA 2IRXA 2ZH7A 2K8GA 2RUGA 4ZP7A 3ITHA 4K4VA 1B7FA 4O4RA 4ECTA 1T94A 5DG9A 1YIJS 3M4XA 2XI2A 1H2VZ 4PG7A 4B9NA 2IJNA 3P96A 4MKYA 1TKXB 2QZ8A 1BQNA 4DFJA 2IC3B 4EBDA 4J5OA 4J9LA 2MPUA 1QE1A 2KKHA 3PX4A 5MAOA 3H20A 2E5JA 1NNDA 2HHUA 1AROP 1SJRA 2V0NA 3MF5A 3V6DB 1M5HA 4F67A 1NK8A 5J2PA 4ILMA 2WB4A 4N77A 1UW4A 4FXDA 4PG5A 2HHVA 3MHYA 4M95A 1U47A 1TV6A 2L08A 3QGGA 5KFZA 1N5YA 2GHVC 5KFCA 2EPIA 2F9DA 3PW7A 1IKWB 3EYZA 3HT3A 1Y3JA 3KLHB 2P6TA 2DHAA 1RWUA 2PI5A 4ELVA 2C3MA 4IOAQ 2ZHAA 2HHPA 3MEDB 2DGUA 2DHXA 1RTJA 3TX8A 1LFPA 2ZUGA 2DISA 2OKQA 2VG6B 4ETZA 4WZMA 1BQMB 3CDAA 2XLKA 2HVIA 2IM3A 4ECRA 2Q3PA 1U25A 2M7SA 2VPXB 2DNQA 2ASYA 1FNOA 5C24B 4W92B 4ES3A 4K4XA 4BDPA 2G1DA 1ZYQA 3KWMA 4I1TA 3MFIA 4I6YA 3QO9B 1VGYA 5EGYA 4QPXA 2D9PA 4Q44A 5J2NB 2KXHA 4A8KA 2POKA 1UA1A 2HMIB 1LW2A 3SCJE 4U6PA 1YJNS 1IBMF 4ED3A 1FJEB 2MGZB 3LGNA 3MM7B 4I69A 1KVIA 3DRYA 2DK2A 3FFIA 3GB0A 1C0TA 3NL0A 5THWA 4NCAA 5E3AA 1KQKA 2UUWA 2KFZA 2ZH3A 2J6TA 1VQ9S 2WBMA 2WSEC 1N4LA 1QY7A 1NHVA 3OXLA 3QJJA 4F4WA 5LL6d 4XDDA 1R0AB 3ICLA 1DURA 3Q2SC 1JK9B 4F4KA 4FPRA 1QTMA 3MR5A 3M1VB 3N6LA 4KKOA 3MMBB 1FEHA 1RP5A 4USHA 3MAHA 2EI5A 1C0UA 2IVMA 2OSRA 1G1XA 3DYAA 3MEGA 2VASA 1S6UA 3DM2B 2FVQA 2C2DA 2ZBCA 1LOUA 4PXCA 2EFGA 1FVSA 3VCDA 2FUG9 2VC0A 1HD1A 2VODA 1S76D 2VG7B 1XN9A 3POTB 4DS5A 2M88A 1HNXF 3LGMA 4I6AA 1Y9OA 2D7SA 1G3OA 5HBMA 1UP1A 3TVYA 2CFXA 2XEXA 2W8KA 3DLBA 4JV1A 4PG6A 2CPXA 3IWLA 2XWXA 3DXSX 4N56A 1T03B 2AJ4A 4HI1A 1XMOF 1XBWA 4IH7A 4DBQA 4OHWA 3KLGA 3H5UA 4OX7A 2CVEA 3TRGA 3M9NB 1R3NA 4ALZA 3WC2A 3UD4P 1YJWS 4B9VA 1S1WB 1R31A 4IG3B 5SUHA 1VC6A 4B3OB 2JLFA 4LIRA 2J8AA 4CNZA 1Y5NB 1H38A 3IG1A 2XMMA 2WOMB 4WK3A 2OPSB 4OLOA 2RF2A 3L7OA 3THPA 1N48A 4QW9A 2J9EA 5B0FA 3RAQA 2AYBA 4RWXA 3S6EA 5CYJA 1F5AA 3KLFA 2GX8A 2F7VA 2N3OA 3Q0AA 1YVFA 2ZJQQ 2CG4A 3I0RB 4Q45A 1HBNA 4Q5VA 3GIMA 2QIFA 1F5BA 3DRRB 5KFOA 4RZRA 2YKNA 2B5JB 5K5MA 2JLGA 3MD1A 5DDRC 4K0KF 1FKPB 2LCWA 3I0SB 2FGCA 5SZTA 1NK4A 1VI7A 2ZH1A 3V5RA 3O3LA 1RTIB 1F9FA 3TVKA 4RUCA 5DDOC 1HYSA 4CTAA 5FLXY 2PFFB 2LQ5A 3K58A 2JX2A 2VPWB 4WFXA 5HN0A 3RBDA 1JLQA 4IFYA 5DJBA 1HNVA 3HHLB 3RRGA 4JI4F 4NXMF 4KV8A 2MKKA 3J7A1 2KFNA 3GG1A 5CQGA 1HFEL 3ZZTA 1N54B 3RYLA 3NBPB 1X8DA 4ZOSA 2R7XA 2HNYA 1GXLA 1X4AA 2JFDA 4K5SA 3MUTP 1DTQA 3KK1A 4OI4A 1WG1A 2OPQB 1ZZFA 4ZPAA 4WXWA 1HI8A 4NLPA 5H9FJ 1SL2A 2AV5A 4AYBD 4X4QA 1TP7A 4LFBF 1WEZA 1DTTA 1OO0B 1LXJA 3NNHA 3IRXA 1KHWA 4I2QB 3KLIA 1TAUA 3NG8A 2V9WA 2AU0A 1YJRA 4HVZA 3HHEA 2SXLA 3GV7B 2ZHBA 1HWJA