3G4SS

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g4sS00
1WWHA 2KVIA 2OTJS 2DNPA 2GHPA 2RU3A 2X1AA 3NNCA 2CPYA 3NS6A 1VQKS 5IFMA 2MKCA 1WF0A 2MZSA 2AYMA 1JJ2R 1NO8A 1S79A 2MSTA 1R8HA 1P27B 1JMTA 2VOOA 1YJ9S 1DBDA 4QU6A 1K8AT 2CPEA 3JB9k 5CA5A 5GADU 2XNQA 5GAHU 1M5KC 2BZ2A 1UP1A 1A7GE 3ULHA 2MPUA 1QVFR 1WELA 3EGNA 2HZCA 3S7RA 2N82B 2MQOA 3H2VE 3CCES 1M90T 4LIRA 5DDQC 3MUTP 2JX2A 3Q2SC 3OW2R 1WTBA 2DNGA 3R27A 1R8PA 4M5DB 3U1LA 1VQ7S 2ADBA 2VOPA 3VAFA 2JVRA 2DHSA 2XNRA 2XS7A 2F9DA 1X4EA 1X0FA 2WBRA 1U6FA 2LCWA 4CQ1A 1VQ4S 2KRBA 4CH0S 4IO9Q 2MKJA 2DGOA 1KQSR 1WHYA 3G71S 2PE8A 3D2WA 1HD1A 3NNAA 2CQ1A 2LA6A 1WHXA 2MY7A 1N8RT 3TYTA 5ITHA 3NMRA 4C0OC 3L3CA 2RS2A 2M0GB 3FEXB 5GVQA 2MKIA 3EGZA 3S01A 4LJMA 1KD1T 1KC8T 2NLWA 2M2BA 2DHGA 2XB2D 1X4HA 1WEYA 1O0PA 2EK6A 2E5HA 1SXLA 2V94A 2MJUA 1X4CA 3G96A 3BO4A 1XN9A 3CMES 3MUMP 1UFWA 1U1MA 1OPIA 3U1MA 1X5SA 1PGZA 2MSSA 2KU7A 3RW6A 2MB0B 4YB1P 2DISA 4QPTA 3THTA 1K73T 4ZKAA 2MQMA 3BO3A 4RU2A 5BJRA 1VBXA 2J76E 3S6EA 5GAGU 4CIOA 1WHWA 2PEHA 3VAIA 5DM6Q 3FEYB 4OZ0A 2CPXA 2FPHX 2RS8A 2D3OR 1U1LA 3P5TL 1VQMS 3ZZZA 1WI6A 2KN4A 4IOCQ 2LA4A 1U1NA 2DGSA 3G9CA 2YH0A 3UCUP 3SXLA 3MD3A 2D9OA 2MQPA 2QEXS 3IWNC 5DDRC 2CPDA 2OSQA 1YJNS 2DGXA 4A8XA 3V4MA 3J7ZT 3CCMS 2M52A 2DO0A 3HI9A 3SMZA 3I55S 2MKKA 4WFNQ 3K0JA 2J0QD 3NNHA 2MYFA 2DGUA 1FT8A 1U1OA 2F9JA 1H2UX 1VC6A 3G8SA 1M1KT 4V19X 1WF1A 3CTRA 3S8SA 3UD4P 2MZRA 2MZQA 1YI2S 1FJEB 1IQTA 2U1AA 1F9FA 4WF9Q 2NZ4A 2DO4A 3G6ES 2KG1A 1M5PC 2DGTA 2VODA 3UCGA 2AYBA 2XS5A 2QFJA 2RUGA 2MQNA 4P6QA 1WF2A 1ZZFA 5IM0A 1VQPS 1U1KA 1WEXA 5FJ4A 3J7YU 5LJ5Y 2HGMA 3CCJS 2KXHA 4ED5A 4QU7A 2RRAA 4YUDA 3PIOQ 3CCLS 2LQ5A 2SXLA 2J8AA 3VF0B 1FJCA 2DNKA 2DNNA 2KXFA 2HVZA 2DNQA 2M4MA 2MQLA 1WG4A 1JJHA 1X4GA 2HGNA 2KYXA 5DETA 4UQTA 2HYIB 2CQGA 2M88A 1N52B 1M5OC 1B7FA 4EGLA 2O3DA 2LYVA 2DH8A 2DNLA 1FNXH 4IOAQ 2AYGA 5IQQA 4W90B 4UY8T 2CPJA 2RVJA 2JRSA 3EX7B 2ERRA 1X4FA 2MZJA 5HO4A 3CF5Q 1URNA 2MXYA 1VQNS 1FXLA 1H6KX 2DHAA 2KHCA 3UWTA 2G4BA 1SJ4P 5LXRA 1YHQS 3CC4S 1U1PA 1DZ5A 2D9PA 2KI2A 1OO0B 1U6BA 2CPZA 3VAMA 2UP1A 1SJQA 3VAKA 1YTYA 2DIVA 2DNYA 3B4DA 5JVHQ 3UD3P 5GAEU 1N54B 2DH9A 3MDFA 3CC7S 1WG1A 2DIUA 1Q86T 2E44A 1Q82T 1L3KA 2FC9A 4PRFA 3SDEA 1K9MT 4Y0FA 2FC8A 4W92B 3TP2A 5IM0B 4WFBQ 4F26A 2KRRA 5LXYA 3CXCR 2MGZA 5CYJA 2YKAA 2XSFA 3THPA 2F3JA 1D8ZA 1P1TA 2G1DA 1VBZA 1X4BA 2LXUA 1VQLS 2X1GA 2KG0A 2N3OA 1YWXA 1FO1A 2MJNA 1QM9A 1SJFA 2MZTA 3DLLQ 3RW7A 3NS5A 5LJ3Y 4TU9A 2YTCA 4ERDA 2OJ3A 1G2EA 5D77A 3CD6S 3R1LA 2LEBA 1RK8A 3CPWR 2RNEA 2A3JA 1ZZNA 5DDOC 2KH9A 1VC0A 2DGWA 3VAHA 2CJKA 1OIAA 4PR6A 4J5OA 1AUDA 2DH7A 4WKRA 1H2VZ 4TU7A 5JVGQ 2DNOA 2LXIA 3MI7X 2I38A 1X5OA 1OWXA 3DXBA 2DNRA 3CCSS 5D78A 2U2FA 4F25A 3LPYA 2FY1A 1VQ9S 2OTLS 3MXHP 1WEZA 5DDPC 4WCEQ 4PKDB 4FXWA 2MQQA 2DNMA 3HHNB 2E5GA 2KM8B 2RT3A 2DHXA 1HA1A 5EN1A 3SDEB 1VQ8S 2ZJRQ 2XS2A 1VBYA 1VQ5S 1BY9A 2G0CA 2RQCA 2YWKA 2MGZB 2YH1A 5H1SV 2CQ2A 2DGVA 2KT5A 2N7CA 1N88A 3CCUS 1Q81T 2M70A 1DHMA 2N3LA 2DNHA 3P49B 2X1BA 2CQ4A 3H2UB 3CC2S 2EK1A 1X5TA 2MKHA 3PIPQ 2L41A 3CUNA 3B4MA 2CQIA 5CXTA 2DITA 3BS9A 2K8GA 1D9AA 3VALA 2MMYA 4C4WA 3P3DA 1CVJA 2L9WA 2RQ4A 2CPHA 2ZJQQ 1HL6A 3VAJA 4WFAQ 1M5VC 3BEGB 2AYEA 2QA4S 1FJ7A 2CPIA 3G4SS 3VAGA 2BOPA 2LEAA 2E5IA 2CPFA 4FXVA 3CCVS 3I56S 2KFYA 2ADCA 2DK2A 1A9NB 2HGLA 3R1HA 1VC5A 5LSOA 3TO8A 2CQ3A 1NU4A 2MKSA 2VONA 4OZ1A 2CQ0A 2AD9A 4WIIA 4YOEA 3ZZYA 1Q7YT 2DNZA 4C7QA 3CCQS 4LMZA 2CQHA 3US5A 2FHOB 1U1QA 3MD1A 2KXNB 1U1RA 2E5JA 2CQCA 1SJRA 1JJ4A 2M8DB 2J0SD 2KM8C 1VQ6S 3CULA 3BO2A 2LMIA 1WI8A 3MOJB 2ZJPQ 3MUVP 5LSLA 5DM7Q 4Y00A 3P6YC 4F02A 2JWNA 5HL7Q 2I2YA 1X5PA 2K3KA 1DRZA 1YITS 3G8TA 1UW4A 1HD0A 1YIJS 3IRWP 1W2BR 4BS2A 1FHTA 1H2TZ 2M7SA 1RKJA 5MLCV 1UAWA 2GO9A 2B0GA 1X4AA 2DGQA 3CCRS 2MZ1A 2CQBA 2M8HA 3UE2A 2CQDA 4TU8A 2X1FA 1SJ3P 1WG5A 5GMKa 2L08A 1PO6A 2OSRA 2Q79A 1YJWS 1NJIT 4TLQA 1X4DA 2LKZA 1KOHA 2MY8A 2LECA 4IUFA 3UCZP 4U67Q 3MURP 2JVOA 1S72S 2OIHA 1WHVA 2M9KA 4Z2XA 1QVGR 4CH1A 3LQVA 3CMAS 1VQOS 2EVZA 2MHNA 1KOOA 2CQPA 2RRBA 2DB1A 3Q2TC 1U2FA 3N9UC 1ZH5A 4QQBA
chains in the Genus database with same CATH superfamily
1JKHB 2V6AA 4CO4A 3ELHA 2QX0A 5KFRA 1KVIA 2BABA 3LUYA 1S1VA 3MECA 2L9NA 2HWIA 5D0EA 3KLHA 1B70B 3D7SB 3UVJB 2AJQA 1SCJB 3NCQA 3AH6A 3VR1A 1VRTB 3TRGA 3OW2R 1WKJA 2GGPB 1PAEX 3PFOA 4DR1J 1NDPA 2APOA 3K5LA 3AJDA 3KXDA 3KJFB 3KMSA 3R5GA 3G71S 2QYCA 3H20A 5IZHA 4UOCA 3LP2A 4KB7A 4FZVA 1T9VA 4YB6A 5F8NA 3KDNA 1UWBB 4DXLA 2VPWB 4DV0F 2J76E 3AOCA 3MPYA 5AXKA 4YY3J 4J90A 4IO1A 3W9HA 3NRBA 3U27A 3VAIA 1RYRA 3ZZZA 1GT8A 3N01A 4DR6J 5H9FJ 3E01B 3NS7B 4ZJLA 5GMEA 1PJ7A 1H7XA 2Z4PA 2B4OA 2MKYA 2P6SA 3M8QB 4DR4F 1WF1A 1IKVA 5ETVA 3QIPA 4J91A 1C0UA 1FDBA 1U0SA 3LA0A 4KQZA 2ZWOA 4DV2J 1UJ5A 1ZZFA 1B64A 3PX6A 1R0BG 2HS3A 4DV6J 1FXRA 2OAUA 4CYUB 3IRXA 3KDOA 3IM9A 1RWNB 2ZOMA 1GX5A 3ZZTA 2HLUA 2VFSA 2PSZA 4DR5F 2Q1LA 1WDTA 1IKWB 1K47A 1H3DA 4C8KA 3WIVA 2XLJA 2RILA 2DT9A 3DLKA 1H6KX 2GVZA 3MCMA 3NXZA 2G4BA 1YHQS 4P2XA 2UVUA 1T03A 2UP1A 4TY8A 3SFGA 3GILA 4MK9A 1WG1A 2F8HA 4ZS6A 4DI6A 4GVBA 2EC0A 3W61A 3FBCA 3PR5B 4H4OA 3RAQA 2DYAA 3BYRA 1WJ9A 3G82A 3HSJA 5AXLA 4CLWA 3EXYA 4JI6J 2V0NA 1LWXA 3NGKA 1VQLS 4H4KC 6FD1A 4P2MA 3FSIA 3AD8C 4FYYB 4LF4J 3QT6A 3KLIB 4USJC 3MAQA 5KAKA 1HYSB 4A4JA 3DLBA 1MG7A 4X65J 4DSJA 1PJ5A 4NL5A 1H2VZ 3OFFA 1JQGA 1YJVA 3DXBA 4QWDA 2UUAJ 4HTIA 3I0SA 2XMAA 2VPZB 2XSJB 4KSEB 4ECXA 2RT3A 4CO1A 1TUWA 3KHGA 1M0SA 3QRQA 2YWKA 2KT5A 1IQZA 1YG0A 3BN7A 4XPCA 3Q8SB 3E8OA 2RHQB 1M5SA 2ASYA 3HZEA 3BDEA 2CQIA 1RAGB 4BCAA 2AV5A 4B9MA 1D9AA 2B6AA 4B3MF 1DQAA 5HI7A 3OXLA 3TAQA 2BOPA 4NCGA 2YWGA 4DV7F 1TL5A 1PC5A 4ED7A 3ZZYA 2DEJA 4AE5A 1BD6A 2R7WA 1HHQA 3GTYX 5D3GB 4LMZA 3P8BB 3US5A 2FHOB 1S12A 3MD1A 4DFKA 3E51A 3TA2A 3PFEA 3VGVA 5KFHA 3H5SA 1B99A 1BLUA 2YQ0A 4B9TA 4DCJB 3KK3A 8ATCB 4FYXB 3DN9A 1DRZA 2HZVA 4QIWD 5C25A 1S57A 2ZE2A 3L7PA 2EFPA 2HNZA 4F36A 3CJ0A 5MLCV 1X4AA 2MZ1A 2E5LF 1W25A 3A8IA 4CH7A 1N48A 1DARA 2ZVIA 2FJVA 1S72S 1PBUA 3BKUA 1HQEA 1SC3B 2AEFA 2RRBA 2LLZA 2H4WB 3ZZOA 3TI0A 4LF6J 3ILJA 5IFMA 1A0OB 2A18A 1Q7LB 3KKFA 3HVRA 4IDKB 4FF1A 5JJBA 2V34A 4OIXA 4IG3A 1I94J 2DPIA 4B9UA 3MCSA 3ULHA 1NDLA 3ENVA 2HZCA 4NYOA 4HKQA 1KLMA 3ET6A 3J80U 1FNMA 2JX2A 4GKJJ 4PZVA 3A4TA 2O66A 4FVMA 2ZZTA 4EBEA 2XS7A 1FA0A 1U6FA 3BH6B 3GFZA 1M1GA 4HYKA 1XMQJ 1HD1A 2CQ1A 2YNHA 4C48A 3MEEA 2GQ2A 2KL8A 4J9QA 3KJQB 4ZMMA 3AQPA 1KC8T 1I6JA 4NZ6A 1WORA 1TL7B 3K17A 1TVRB 3AOAA 3SBMA 1TL3B 2A2CA 1QE1A 4TN2A 1K73T 3G6VA 4QOTA 4XDDA 5DM6Q 2LXFA 1EP4B 3SV4A 3HSZA 4LIWA 2DGSA 5HBMB 2EC2A 5F9NA 3HHLC 3JTOA 3OLBA 3A3OB 3V4MA 2EI5A 4IOBA 3KFWX 2H54B 4CNZA 2J9CA 3AFGA 4C3LA 1T9UA 2RF2A 1KBRA 2E1PA 1U2RA 4YQWA 1RHJB 1UFKA 3RR7A 5DLGA 4NLRA 3PJ9A 4Y2CA 1N33F 1J5OB 4MIAA 2YNGB 3HT0A 2VHGA 1VGYA 4RW4A 1NM2A 1S1WA 2DNNA 2F5GA 4DZDA 4F0KA 4DV5F 3CIMA 2BE7D 5IWAJ 3TA1A 3NCRA 2VBWA 3NWGA 2DR7A 2BE2B 3V6DA 5F3TA 3L7UA 1RISA 2X51A 2V63A 4J9NA 1FKOA 2EWHA 1VQNS 4PUOA 2D9PA 3IC1A 3JTNA 4N7TA 3J81U 3UD3P 2HHXA 3KLGB 4U7CA 5L9NA 2VG7B 3TP2A 1R89A 4K2JA 3F0NA 4J9KA 4DPOA 3BDPA 2XSFA 3GR0A 4YS2A 5I3UB 1P1TA 1Z2LA 4QWAA 4DLGA 3W5XA 3M2RB 2X1GA 2KG0A 2UZAA 1JIHA 3KUHA 1K1SA 4OV1A 2LEBA 2HURA 1VC0A 1KWMA 4CTAB 4HHHA 2DR9A 2HHSA 3JSRA 3KYLA 2IA6A 3B54A 5J1EB 4Q43A 2XBPA 1E6YA 3Q23A 4B3TJ 2LQBA 1L3SA 1KHWA 4CLKA 2ZJRQ 1TMMA 3UDCA 3M6VA 2ZH9A 2YH1A 2CQ2A 1JNRB 1VIOA 4QIVA 1MROB 1RT3B 2BANB 5L1KA 4P7TA 3IG1A 2RMLA 3D3CJ 3T5KA 3O5TB 3VALA 1UEKA 4C4WA 2KFNA 4R5PB 2FTRA 2FUG9 3OUYB 2PI4A 1Q8KA 4O3NA 4O4RA 5HP1A 4U96A 1LWEB 1AA1B 2W4DA 4IQXA 3DGPA 2MLXA 4DSFA 3BPDA 4DR2F 3ILIA 2CJBA 2QV6A 3JQMA 1LXNA 5L38A 1EARA 2QA1A 2XGQA 1KN6A 3I31A 4YOEA 5D6GA 1OSDA 4HH0A 3R3TA 2DNZA 2ZBRA 1QTNB 2J7KA 3WZ0A 3I0RB 4CLZA 1LWFB 3M2VA 3TUJC 3KJVA 3QGHA 4LF9F 2NYHA 4WFZA 1QJHA 3GFYA 3WX4A 4JB8B 1Z2ZA 3OTEA 3M30A 1HQUB 1UEVA 2OPRA 5KG4A 1Q16B 1RWKB 4Q0BA 3RYLA 5LMNF 3GE9A 1FE4A 2RQKA 3GWCA 4M95A 1YSJA 4LREA 3ILOA 5LT5A 2DBBA 5GMKa 1N32J 2NUUG 3BZQA 4KGKA 4PPDA 5EWEA 4AQYJ 4BBYA 1MW7A 3K58A 2V68A 4L74A 3ZXWA 1AXQA 4QIEA 5T14A 1PYSB 1DY3A 4ZK7M 5B0FA 4JV0A 2YWFA 4BC9A 3OFGA 2HRTA 2W9AA 3HULA 2N82B 3GPAA 5HQMA 3QZ8A 3QYYA 4ZVGA 3M6UA 3W2WB 1RLCL 4ZVOB 4M5DB 2ZOFA 2HIYA 5GADI 2ZH8A 2DHHA 2H9ZA 2FZCB 2KRBA 1NAQA 1RT6A 3E2EA 3RB0A 3GU0A 4RUBA 3H42A 4N8OA 4YFUA 5LMUF 3M8YA 4CLPA 4DL5A 1CJTB 3T1HF 3BGRA 3IAM9 3KNGA 3OR2B 3O1LA 1GEHA 2X3DA 2R7SA 1V5IB 2DISA 4QPTA 2KZMA 3S6EA 1WHWA 4LF5J 1TV6B 4PQAA 2VG5A 4QW8A 1REVA 2UXBF 3RBZA 2E7XA 2FY8A 2KTQA 4L73A 2R2SA 3A1YG 2HQGA 1NH8A 2V9WA 3RU0A 3HVTA 4FPRA 1CS4A 4XAKA 1HMVB 4C8YA 3HPOA 4G3IA 2MZRA 4JOUA 3U7JA 3ISND 3UCGA 3FGVA 2ROEA 1AUSL 3TJ9A 1LFWA 1IKYA 1RT7A 2OPQA 5IM0A 2HSEB 5FJ4A 4R0EA 2CFXA 1OSCA 3WIUA 2MQ8A 3L4BC 2ALYB 2M4MA 2CXEA 4UW2A 3M8PB 2CQGA 2QLXA 1N52B 2DNLA 4E98A 4W90B 2HHQA 5G4DA 2MZJA 4RW8A 1FK9A 3IGVA 2QLWA 2MXYA 3UWTA 4KFBB 4KH1B 3VAMA 4JI8J 3KOAA 1SJQA 4QYZJ 4RNFA 2DIVA 4K4UA 2YKMB 1GXUA 3EVOA 4ECUA 2J7WA 3B6BA 3FSXA 2FC9A 1LW2A 4PRFA 3TX8A 5A2QU 1RT1B 2K1RB 3B78A 2G1HA 3HFZB 1HBMB 3N6LA 1KLNA 2YPYA 3LGNA 2BV3A 2ZITA 1XR7A 3G8QA 4USHA 1DTTA 1WSVA 1P1LA 3VAHA 2VIHA 3KMQA 2FJEB 3MEDA 1WKLA 1HNXJ 4DU8A 5D78A 3LF0A 4EYIB 2O01C 1Y4ZB 2UU9J 1G7CB 1O5JA 1FRXA 1R8AA 3RB4A 5KT5A 2ZUGA 2VQFJ 2IC3B 3WC2A 5C5JA 1BY9A 2FIUA 2OELA 3MFHA 1TL1B 2EXUA 3L09A 2RU9A 1F5AA 3HHDA 3QFWA 1Q81T 2M70A 3KHHA 4ILMA 2GCFA 2YKPA 2MKHA 3PIPQ 1EETB 2WSFC 4LUBA 1R43A 2C2EA 3RGIA 4QWBA 2W9BA 4E2FB 2CPIA 3VAGA 3TUIC 2LEAA 2QFIA 2YNIA 1SUQA 4K7QA 2ZKTA 1JLCB 1TTHB 1C0UB 2I6WA 1JXEA 4O44B 3D9BA 4NLGA 1OY8A 3NGRA 2E7WA 2C28A 2H65B 5EWFA 1K1QA 3BBBA 3MZIA 1ELOA 1U1RA 4USMA 3GR1A 4NA2A 5HLFA 1LW0B 2QZ8A 3RBXA 5F8GA 4NPOA 4WYLA 3PG9A 5DM7Q 5GMDA 2K3KA 4U95A 5F8MA 1AZSB 3EGVA 2CYYA 1QUPA 1NKEA 2EFGA 4QR2A 4QR1A 4JI5J 1YKWA 3QO9B 3CJ2A 1N5QA 2L08A 4EYHB 3MMBA 3HD1A 2GMHA 1FEHA 1VQOS 3QRRA 1KOOA 2CJQA 2IIHA 3N9UC 2IBOA 1ZH5A 4DV0J 3UQSA 4G1QB 4H4OB 4URGA 4O4GA 4QBUA 3BQ1A 1RAHB 1OY9A 1S9EA 1P27B 1YJ9S 1DBDA 1KQKA 4CM2A 5H9FK 3F73A 1FKAF 4OJ1A 2C2OB 2QMXA 2WW4A 3FEZA 5GAHU 4JV5J 1U4BA 3QFHA 1H98A 2NREA 3VVTA 3ZO7A 4FYVB 2VOPA 2BEFA 4C8OA 2F9DA 1QAIA 3BB5A 2RE1A 3I0SB 3Q8UA 4FNIA 4K4WA 4WWSA 4ZA1A 1RAFB 3NMRA 4RW9B 1S77D 1Q53A 3TAMB 3C6TA 3RBDA 3WC0A 3QBCA 2NLWA 2UV8G 2DHGA 5CD4H 2C2ZB 2PMZD 5HK4A 3V2UC 3RR8A 1RI7A 5DQGA 4RNNA 1VIXA 1X31C 4K0KF 5GAGU 2Y1RI 2FPHX 2HQCA 1UVIA 4ALZA 4ECQA 3DMJA 4X4VA 1W2IA 1ZPVA 2XEXA 4AXIA 4HR2A 2YH0A 3GLJA 3UCUP 4CDIA 1HBUB 4ZN1A 3WHIA 1SC4B 3MMAB 3NLCA 3M8RA 3K0JA 3C14B 3ITHA 3I4PA 1FT8A 3NGDA 4PPZA 4NWBA 4ZP7A 3S8SA 3EUNA 3C2PA 2AZ1A 2U1AA 2XMJA 4DV4J 4WF9Q 3IFEA 2KG1A 4AYBD 1RTJA 1T8EA 1C1CB 2PMWA 3T5HA 5IS2A 2IAJA 3HT3A 1WF2A 1RYSA 4LR9A 4Y2KA 2LEPA 2PFFB 3JSBA 2IFXA 4OHVA 2BJDA 3GJTB 1U0HA 1RT4A 2KXFA 3VTIA 4X66F 1TP7A 3CJKA 1FNXH 1RCOB 5FIIA 2OMLA 1PJ6A 2D3UA 4HH1A 5KFZA 1YRTA 5DRKA 2CZ9A 3QWPA 4DR3F 2ERRA 1FERA 3AOBA 5K20B 2NZCA 1HQEB 1DZ5A 1TELA 1N54B 4K4XA 3ENWA 4H4KA 1K9MT 4W92B 3MM5B 1N36J 2YKAA 2BOAA 2HAFA 2F7VA 3OVAA 3N5FA 3R5BA 2NPFA 4ID8A 4W98A 1UVLA 1JB0C 1YBUA 2QJ3A 3DI6B 4OZLA 1VI7A 3PYFA 4GRSA 5LJ3Y 3WQPA 5CQGA 2GQCA 4CLSA 1XNQF 1TR0A 1ZOTA 2KH9A 4YHHF 3QRPA 4J5OA 3CJ4A 3IAS9 4E8UA 2JEFA 2V69A 2XZDB 3MI7X 2YNHB 2YX1A 3MEEB 4ZVHA 2HMIB 4B3OB 2FY1A 5DO2A 3MAAB 5KFGA 3FQLA 3IBWA 2VJVA 5DDPC 3KHLA 4OFZA 5KFEA 2FLPA 3G6XA 1GMWA 2XLIA 3GFXA 2FYXA 5E0OA 4YR0A 4A46A 1MLAA 1GX6A 1R8CA 1DHMA 3E3XA 3DLEA 3TARA 2CQ4A 3O2IA 1LV5A 5A6WA 2FVRA 2ASJA 3T5LA 2OI2A 4A47A 2R7UA 2EFNA 2GAHC 4OJ3A 3BEGB 2AYEA 3TEHB 3ZTOA 3FQKA 4KH0B 3M1VB 3IA0A 1S1UA 4NZ0A 4YB7A 1H73A 4JUZA 5D4PA 1Q7YT 1N6QA 1KFSA 3O3LA 2E9RX 5CCLA 3QQCD 1IJEB 4OI4A 3DRRB 2LMIA 4M8LA 5AE3A 1TKTA 1ZAXA 3H5XA 3P6YC 3AB4B 2JWNA 4AD6A 2V67A 4OHYA 1HD0A 2KDOA 3TZYA 4BS2A 5KT6A 2HHTA 2R8KA 3FBBA 4ZCKA 2E7VA 4KHPJ 4A8KA 5F3ZA 1PAUB 4NLVA 3GJRB 2OSRA 3T3FA 4PUOB 4TLQA 3V6JA 2W2PP 2RD5C 2EFQA 2OPSB 3UCZP 2GV1A 4U67Q 2LU2A 1ZM4A 4WU3A 4NA1A 2DB1A 2P9CA 2F4VF 2OPPB 3NGUA 2RU3A 4ZVQB 4H4MA 3ETMA 2MKCA 1WF0A 1TKZB 3R7BB 2MZSA 3I32A 2VH7A 1R8HA 1RWUA 2HQIA 3M2UA 1DQ9A 2V4RA 3HJVA 4QR0A 1LEOA 3M8WA 1QLNA 3S7RA 3CCES 4B3SF 1HHTP 4TVAB 1IVZA 1EZZB 2R42A 4GO5X 1EQMA 2OLWA 3MM7B 3OXGA 1SC6A 4PWDA 1R0CB 3W5YA 3O8WA 1FRMA 2K3IA 1VQ4S 1E6VA 1V5VA 4WU2A 2LA6A 1N8RT 4ZN3A 1R6YA 3KHRA 4F7VA 3HKWA 2RS2A 2AJFE 1S7IA 4LJMA 4JI0F 5DQHA 2VL1A 5A8WB 3CMES 5M2PA 2FZGB 3PACA 4UTGA 3HHLA 2BKNA 5J2MA 1YRUA 3BJYA 4DQSA 4NEZA 2PMHA 3P5TL 4Z37A 2V5HG 3IN5A 1WI6A 4V1Ak 1RHRB 1T9TA 4PG4A 1B4SA 5F41A 1SKUB 2HK3A 4ZVRB 2JL9A 1JLBB 2WCXA 1I51B 3M32B 2HBRB 1M1KT 1C0TA 3MM9A 2CG8A 4NLDA 2Q66A 1QAXA 4FF3A 4LFAF 4K4TA 1F6TA 2HVDA 4DSLA 3UNYA 1CULA 1KHVA 3M2VB 4OX9F 4A48A 1S59A 4DFJA 5LJ5Y 2FLNA 3NOGA 1QDUB 4DV3J 4X4OA 4Q0BB 4PXEA 1GXLA 4DL4A 2HYIB 3JTPA 3ZTSA 1T95A 3TX0A 2FJAB 2ZH1A 3OTOJ 3G87A 4KGMA 2EFOA 3DCAA 5HMYA 1F1BB 4I7FA 4RKUC 3IP0A 3G2XA 1FXLA 1F5CA 2YKQA 1ZPWX 4IFVB 4N41A 1NKCA 1Y3KA 1SKRA 3NBPA 3B4DA 3H40A 3MPWA 4ILRA 5A8RA 3K7RA 2XCAA 2W7OA 4CT8A 5D4OA 3QLHA 1VISA 1XBWA 3DYAA 5KFAA 5HQLA 1IKXA 1SIWB 3EMTA 1EKRA 1HARA 3FSYA 3DLLQ 4O23A 4ERDA 4RPFA 1Y0HA 4M5HA 4J9MA 2MLZA 1YLXA 4UOHA 4WK3A 1HNVA 1HPZB 3PNIA 1UVJA 3K89A 1S1XA 4CP5A 3AD9C 5KFBA 5ETLA 3T6JA 1Y00A 3ISNC 3Q0AA 4C3MA 2FHKA 4KTQA 1CPZA 5C42A 2L9DA 3OJUA 1VQ5S 3V4IA 3QT7A 3MM8B 1PG5B 1JLAA 2DGVA 1BE4A 4X64F 2VG5B 3GSIA 4L75A 3EDQB 2GVDA 1VMBA 2DNHA 1WDDA 5CAAA 2BA9A 2EK1A 1SH2A 2OO4A 4JV2A 3ZNUA 1F5BA 4ZJQA 3T6BA 4J9OA 4DG1A 3PW4A 3EZ5A 2HNYA 3CDBA 4USVA 4OHWA 2W9CA 2NQPA 2CDQA 4M5JA 2DK2A 2BXJA 1Q95G 3PCOB 1D9DA 2VQEF 3CIZA 3TO8A 2PEBA 1NU4A 3KWMA 1IKYB 4N56A 3MMCB 1W26A 2VPXB 1QY7A 5J2PA 2M8DB 2KM8C 4LVOP 4C11A 3DDNA 1IBMF 3R2CJ 2EFVA 1UW4A 5E3RA 3FVYA 2DR6A 3VQTA 2A2DA 4C8ZA 4F04B 4RW8B 1FK9B 2HEKA 4I2PA 5M2UA 4USTA 2L3MA 4P52A 4DUYJ 2BJEA 2ZH5A 3AA8A 2MDAA 4DCPB 2ASDA 2OIHA 4Z2XA 1NPKA 2UUCF 1LW2B 4ETZA 2CQPA 3C16B 4OZ2A 4OYIA 3DOMB 4LF8F 4RBVA 1WKKA 5BYQA 4DEZA 4ID5A 3BREA 5HSPA 1J5EJ 3D1QA 1TKXA 4J9UE 3DOKA 4ZVSB 3CJ5A 5KT7A 3DOLA 3PM9A 3P5BP 1M90T 1NZAA 1V3ZA 5HJYA 1TKDA 4NI2B 5HVFA 2YY3A 1VQ7S 4ZHRA 2AJ0A 2WVFA 1U8SA 1RABB 2KB2A 3C6UB 1N34J 3A8EA 1X4EA 2FQQB 3ZTQA 1FX4A 3D2WA 3WX8A 5CHCB 3FEXB 1KD1T 1RP5A 2AT1B 2ILZA 3H7HB 3CDWA 4P7VA 1U1MA 1BC6A 1S9GA 4YDDB 3TA0A 5F8JA 5BJRA 2VG6A 4IH7A 4YMEA 2ZH4A 4ECSA 1S1TA 1JLQA 2CPXA 2FHJA 3CVKA 4KE5A 3SCKE 5DLFA 4Y65A 2W9BB 5F9LA 1WNEA 1RT2A 2KFZA 2H4YB 4OZ3A 1U7LA 4X4RA 1SUQB 3FZBA 1L3TA 2IM0A 4QYZK 4TXSA 3SMZA 1VS3A 2PN6A 3I82A 1B0VA 5B0CA 5D4LA 2DGUA 3KLEA 4H54A 1VJQA 1TK5A 3HHEA 4IFYA 4Y2MA 1NJZA 2DGTA 3OV7A 5I3PA 4UZCA 1BQNB 2QFJA 3POTA 2MLYA 1UVNA 3FCVA 3T41A 4Z7CA 2LQ5A 1FJCA 4AL5A 5CYMA 3OSNA 1RBOB 1JJHA 2OUGA 5IT9U 2HFSA 2VBZA 1M5OC 2LYVA 3MEGB 1GAOA 3LP0B 2N4CA 2CPJA 2LDIA 4NASA 3MPUB 2DRBA 1KVJA 1EJ7L 3LH2S 4MYTA 3L7OA 4O4GB 3LP1B 2E44A 4MH8A 1Q8BA 4ED1A 5E41A 1S9EB 3ZFVA 4B9LA 3LGMA 2LQJA 4WFBQ 2C3MA 3DU6A 3CXCR 5CYJA 4NXMJ 1U47A 3H2LA 1T9WA 4M5KA 5K8NA 3C15A 2NR0A 4L6V3 2A6MA 5FLXY 4B3RF 3NEKA 2MZTA 2AGQA 2CZVC 3K5NA 4RBTA 2UVVA 2OJ3A 1OY6A 1RK8A 2JDJA 2HWHA 3G6YA 3Q83A 4N5SA 2DR5A 4PR6A 3N6NA 1AUDA 2QMUB 4MAKA 4DLEA 5A76A 5I42A 3VWSA 2B9WA 4YB5A 3TEGA 1WC0A 1AYEA 1KSPA 1S0VA 5B0AA 4NE9C 1JLEA 4KBIA 4B17A 4GC6A 2ZUAA 2N7CA 1HNIA 1IBLF 1FRJA 3EJMA 3NP5A 6AT1B 2WTFA 4FF4A 2WRMA 3K57A 1SV5A 1IM6A 2XTJP 5CXTA 3KLVA 2VFUA 1CVJA 1ZAVA 4I4BA 2WK4A 1FI4A 5DJBA 1FJ7A 3OBIA 2WSCC 2H48B 2QL7B 5C7PA 1RTJB 4NX9A 4EO8A 2RDDA 4QZVB 2IAJB 1TAUA 3K8VA 1HR0J 1HKAA 4YN3B 1RAEB 4AL6A 3D5MA 5HROA 5BR8F 2OMOA 3H98A 5KFOA 1F3FA 1RT4B 1NPPA 1FRHA 4LSNA 1FWLA 4KGXB 4ZPCA 4F02A 4RW6B 1YITS 1YZ7A 3PX0A 1WUUA 2ZEJA 3N79A 5AT1B 1TK0A 4DF8A 1YK9A 4X4SA 1WOSA 3JYTA 5BYRA 2AEMA 4U7UK 1NPRA 1RU1A 3PDNA 1KOHA 2ZM6J 2Y0BB 2M9KA 1IBKF 1RSCA 2PFDA 5E5NA 4MFBB 5KFSA 3EZOA 1U2FA 3BGUA 3CJTA 2ALZA 4JYAJ 1VQKS 5T7LB 1WC3A 3JAMU 8AT1B 4RW7A 4EI2A 3JB9k 4EWTA 3CJSA 4O3PA 2ZWPA 2MQOA 1J2VA 1HI1A 4PEOA 2COLA 2R8IA 4TQRA 2RJZA 4ATNA 1GK8A 3R27A 1Y10A 2BW7A 4K2XA 4X4QA 2D7SA 4A8FA 1S76D 2ZOGA 1CJVA 3CCTA 4OJGA 2MKJA 5A8KB 4JI7J 2MY7A 3M9NB 3W5ZA 4O3SA 4C0BA 1JK9B 2YKOA 2KZZA 5K8OA 2VA3A 2FGOA 1OS5A 4IG0A 1HW9A 4DV1F 4ZPVR 1KRPA 2IRYA 1KTQA 1VQ8S 3DLEB 3KLFA 4JI1F 1BQMA 2NUHA 4OX7A 4GC7A 1U1LA 4DR7J 3HFKA 1XEZA 4M5IA 4OZ5A 2KHDA 1HBNB 2YQ1A 5AJ3J 2QEXS 2XGPA 1JLFB 2CPDA 4JP8A 1S6QA 4OL8A 3NMAA 2ZZMA 5HJXA 1N5YA 2QSWA 1NSAA 1VC6A 4EO6A 1FJEB 2EBEA 2MZQA 1YI2S 5ETNA 2WOMB 3AXMA 2QRRA 2I8EA 1TFWA 4TLRA 3HJFA 4UUXA 2C3PA 2RUGA 1RWOB 1MWQA 2RKIA 3NCPA 4I1TA 2HGMA 1TKTB 4JBCA 1PSDA 1V3RA 4ECZA 3CWJA 5K9FA 4EZ6A 3PX4A 3KK2A 3CO9A 1C4AA 1CBKA 1CQMA 4BWJA 3W9IA 2WSEC 5LSRA 1S0NA 2IJRA 1U26A 5FD1A 1BHNA 4HVZA 5KG2A 4PCQA 2ATCB 4LSLA 4UF4A 4X62J 2GS8A 1GTHA 5HAOA 4JI2F 1U1PA 5HVHA 5F8IA 3SYZA 3GV5B 2HRUA 5CD4A 3VVUA 1UA0A 1R3NA 3TUPA 1SJ1A 4TNOA 1AT1B 3M2UB 3R97A 2R9LA 3PEJA 4DPTA 2F3JA 2FJBB 1YBTA 1RDRA 1OYEA 1SIZA 3TNVA 2KYZA 2J0WA 3H90A 1HWIA 4EEYA 2HHHJ 3AD7C 4FKXA 3NS5A 2GHVC 4TU9A 4GO7X 3HLUA 2ZBQA 1ZZNA 2RNEA 1VRUA 2A3JA 2P6TA 3CB4A 1N5TA 3OHAA 4P72A 4M5MA 4DR1F 2A1BA 1F9EB 3OVBA 4F25A 4OX6A 3EXCX 3FFIA 3PRDA 2WBMA 2MQQA 2VFRA 2VPYB 4KPCA 2ZD1B 2MGZB 2E1RA 1SL1A 4I6WA 1UETA 1S99A 4JV1A 1R8BA 5J2QA 4YY3F 5FDLA 2L41A 2CNNB 1GQEA 1MU2A 2CVIA 2BJ9A 5KG6A 3AQOA 3W8PA 3N6MA 2G0IA 3Q8QB 5C2CA 2Z2YB 3HO1A 4HACB 4DR6F 2CPHA 1XERA 1GTEA 2QA4S 2UUTA 1FKPA 2E5IA 3M4XA 2YWWA 5G0RB 1DLOB 2BJ8A 1V3SA 2HGLA 3BF4A 1ACMB 2W2OP 3SZ2A 2K2PA 2IJFA 2E9TA 4WE1A 2AW0A 4NEYA 4DV2F 2ZVSA 2W2NP 2J6UA 5IC4B 4DV6F 1NK4A 1PILA 2EKNA 1YDLA 3MUVP 5J1PA 3UVJA 4NZ7A 4RUCA 1VRTA 3NAIA 2B0GA 3KG4A 4TU8A 1WG5A 4NYPA 1YGYA 2Z2LA 4NLSA 2V8PA 2Q79A 2GMLA 2VF3A 4R8UB 3T19A 3NBPB 2LECA 2MEWA 4CO2A 5E3PA 1HIYA 2UVRA 4ED0A 2MHNA 4KHMA 4QQBA 1SQGA 2KVIA 3LAKA 1UPPA 4WYWA 4MTPA 1DTQB 4ZPDA 2WONB 4Q2LA 1RBLA 2UV8A 2F63A 1XWLA 3HK2A 4JI3J 2VOOA 3R5DA 4I2QB 4MIWA 5GADU 1G1XA 4JI6F 5HMWA 1U24A 2ZNZA 2HQFA 4CI0B 4URQU 4LF4F 5EDWA 1O8BA 3E01A 3KUGA 4MJKA 3OT9A 2RB7A 5U47A 4X65F 1ZM3A 5D15A 1RHKB 4F50A 4CH0S 4USUA 2ROPA 3R9LA 1SL0A 4J9LA 2UUAF 2W1BA 5KFQA 5ITHA 2M5YA 3OL6A 2CNOB 3L3CA 2X7IA 5GVQA 2OEMA 2M2BA 1VFJA 2J0XA 1X4HA 4BWMA 1CJUB 1JLAB 2I1RA 2IVFB 1NJXA 3RJMB 1F2HA 1RKIA 1RLDA 4CYUA 2XO6A 1LWCA 4RL1A 3PY8A 2E66A 2DJWA 2IVMA 4O0IA 4ZITA 3FEYB 4OZ0A 4NCAA 2RS8A 3P4UB 4OHZA 1U8WA 4QWEA 1U1NA 5CABA 1IKWA 3G9CA 2ZZNA 2YXLA 1WTFA 1TFYA 3BYPA 4FYWB 3EYZA 3SXLA 3DLGA 3R5CA 3CCMS 2DO0A 3W1YC 3PW7A 3GQCA 2MYFA 4KC5A 2BJ1A 4FYDA 3CTRA 2R7TA 1SQFA 1IQTA 1Y9OA 2BQRA 4WIQA 5ETSA 1ZTWA 2W8LA 3QZ7A 4CCHA 4WXOA 2P2CB 3L95X 5DQIA 1Q79A 1KR4A 4F4WA 2J8AA 2J6SA 5ETQA 1XIQA 2DNQA 1SQEA 2O1PA 2JC1A 3H0PA 3KLIA 4HLBA 1HYSA 4ZIWA 4EGLA 2H1YA 3M7VA 4WXWA 1Y5LB 1VHFA 2VC1A 2JLGA 4ECRA 3QAEA 3W7BA 3TVZA 3OJSA 3AY0A 4DCOB 1TUVA 3EE3A 2R3VA 3GFHA 1RQ0A 1Y3JA 2GHWA 2GIRA 2DNYA 1VBKA 3LTOA 3EWGA 4FVCA 3R5AA 4TKTA 5KG3A 2J7UA 3SQGB 1VHIA 1TKXB 4Y0FA 1KKHA 4LF6F 1UCNA 3I4HX 2JOQA 3IS9B 4RR5A 2YBVA 4ZPWR 4F67A 4NLXA 1I94F 1BMQB 1UPMB 3GYXB 4CLFA 1NMEB 2NSCA 5GAGI 3EVMA 2IMWP 4ZHRB 5D77A 1MN9A 3N28A 3HFVA 4BC7A 1ULRA 4GKJF 1KQFB 2VQEJ 3VGUA 4WKRA 3I9V9 4TU7A 2B5JB 3AXKA 4KV8A 2VU5A 1R0AA 2DNRA 3SSRA 2H51B 2U2FA 5HN0A 3LPYA 2V2KA 3MXHP 1XMQF 2Z2MA 3BH7B 3TR5A 2NYIA 1S9GB 2KM8B 3ZZPA 5D3GA 4FF2A 3OFHA 3OVSA 1IBMJ 4HDHA 3K8WA 3RAMA 3DLHA 3QGPA 1GMWD 1NDCA 3CC2S 2FVPA 4WP8A 5DZ6A 2K8GA 3LO3A 1FJGJ 3HXMA 3HCXA 1RTHB 4AUKA 3KLEB 4DFMA 4C8NA 2PIIA 4FXVA 2LU1A 2NXNA 4Y34A 2UUBF 3T1YJ 2JFDA 2VICA 2HFZA 3POTB 1S0MA 1S7HA 2FJXA 3RB3A 4OX8A 3U1NA 2D69A 3J7A1 4IDKA 2EPIA 2UUWA 2ZJPQ 3H8YA 1VK3A 1HLWA 4B9VA 4I56A 4E0DA 2Q43A 5IWAF 3MWBA 1UAWA 2R7QA 4XO0A 2HIQA 1U45A 4A8SA 5LL6d 2IM3A 4IUFA 2YKNA 2VD3A 4ED6A 1NJYA 2B8PA 1RWVB 2XLKA 5B08A 4PQUB 2CA9A 1FNOA 1TL7A 3DNCA 3GZ7A 4OJHA 3W64A 2GHPA 1TVRA 4ETXA 2RIJA 1TL3A 2AWZA 1RZMA 3RG6A 1RB0A 2QA4G 5CA5A 1FCAA 1JWWA 1M5KC 3CD0A 4WKYA 5J1NA 1EP4A 4ZP6A 4YEAA 2YQ3A 2Z2ZA 3FKBA 5HBMA 4DN9A 1IWAA 1AFJA 3VZHA 2V2ZA 3TAPA 3ZNJ1 2P5VA 1RAJA 1H7WA 1HNWJ 4LFCJ 4RBUA 5DG7A 2AQ4A 1RT5B 2HBZB 5E2QA 3LANA 4CQ1A 5I42B 1NH7A 2WVBA 1G3OA 2BKOA 1D3WA 3KK1B 3FCWA 1RAAB 3TYTA 1R6VA 1RWMB 2EG1A 4FBTA 2AJ1A 4CO3A 1JLEB 1HBOB 2XMWA 3TWZA 3D68A 2UXDJ 4B3TF 1O0PA 3LWLA 2EBGA 1HNIB 3QSYB 1RAIB 3U1MA 1J5OA 2MB0B 2YX4A 3OL7A 3PJWA 1PC4A 1SV5B 5E3AA 3PEHA 4KO0B 3DXSX 2LA4A 3UR0A 3J7Z5 1JLGB 2OHDA 2BE2A 3IM8A 2D9OA 4M1KA 2CJAA 1HWKA 2DGXA 4A8XA 2PC6A 2WB1D 2RDIA 2J9DA 2F9JA 4V19X 4GKKJ 2W7PA 1SL2A 2QGFB 6FDRA 3KLGA 4IH6A 1RE1B 2QA2A 2B9XA 4DL6A 4NLYA 4FDFA 1U1KA 4KJIA 2AGOA 5D0RA 1LKZA 3GYGA 1Y5IB 2RQMA 3M2RA 2XYHB 3HM9A 3JSMB 1VYAA 1IJFB 3VHQA 4QWCA 4A8MP 2HNDB 1FDDA 2NXCA 1U09A 1U6ZA 1S6UA 3CJRA 1QSYA 4CTAA 1KS2A 1N32F 2V50A 2BM1A 5J1EA 2VA2A 3UNGC 4AQYF 2IVYA 1OO0B 2CPZA 4WJBA 5KFYA 2V4JB 2PA3A 3N5BA 5HQ8A 2VZ9A 4PXBA 4ELVA 1Q82T 4OYOA 1N4LA 4ECYA 4OHXA 2H3EB 4F26A 4P10A 2RHSB 2QO3A 3Q8PB 3D1HA 5GAEI 1KNZA 3CD5A 1Q8IA 1MROA 1RT3A 3SFUA 1C4CA 1X4BA 3N0VA 4OYPA 3A13A 3GCXP 2V8HA 1SJFA 4DOZA 4S0MA 5K8MA 2I5JA 4UOFA 3S1TA 5K14B 4R5PA 4CNYA 3CPWR 3GIJA 3BKTA 4CO5A 2VUGA 4UQGA 4F4XA 1LWEA 1KFDA 1UEUA 1D09B 1ZA1B 2GAGC 2B8QA 2GJ2A 2V4QA 2OTLS 2HHUA 2AJ2A 4IG0B 3EPIA 3HHNB 2E5GA 1RWXB 4DQRA 3SDEB 5L8RC 5DZ7A 2G0CA 1BQMB 3I0RA 1Y11A 5H1SV 1P9QC 1LWFA 4WP9A 1KVKA 3DC2A 4C97A 2X1BA 3H2UB 4U8VA 4KY3A 1HQUA 3PYDA 2K7KA 3IWLA 3C46A 2PO4A 2ACYA 1ZS6A 1S6QB 2IBKA 2RQ4A 4LFBF 2D3ZA 4ZOSA 3HHKA 2DKOB 1SKSA 3W62A 3VAJA 1N5YB 3EGWB 3R5JB 1VRQC 1NRKA 1WC4A 1UTAA 3CDAA 2MKSA 3TUZC 2N7YA 3CJ3A 2RKIB 3PYGA 3ZZRA 1VDHA 2YPZA 2JLEA 2CQCA 1SJRA 1WI8A 4DSEA 5DG9A 2DCUB 2XY7A 4Y00A 2ZDPA 1HNZJ 5KFVA 3G8TA 5C24B 1NHKL 1D0EA 2R8HA 1FHTA 1FX2A 1CSJA 5DS7A 3W2WA 1RKJA 3MPDA 2GO9A 3MM6B 1SKWA 5E7OB 2RDJA 2LKZA 1MSWD 2ILYA 4NA3A 1XNRJ 3KTQA 1T9YA 1QVGR 3GONA 4A8WA 4JI8F 2JNJA 4U9RA 4P2SA 3QJPA 1T02A 4EU0A 4JI4J 2OTJS 3SV3A 1CJTA 3PR4A 3OR2A 1RTIB 1OJ4A 3MR5A 2W4CA 1SH0A 1U25A 1G6BA 2R7VA 1GMUA 4ELUA 3H2VE 1M1HA 4PXCA 3X1LB 2VFTA 2DNGA 5L1LA 1R8PA 2ADBA 1T05B 4EMDA 1P8GA 1HMVA 1XMOJ 4LSZB 5F8LA 4FP9A 3PRBA 1YZ6A 2HAIA 1HNXF 4LBHA 5CCMA 1FVQA 1YBAA 2BQ3A 3BSOA 3GSDA 4ZIVA 2UU9F 1SXLA 2V94A 2CWKA 1FTRA 2VQFF 3MUMP 4NLTA 2YX7A 1X5SA 3ZZUA 1ITPA 4MKYA 4YB1P 1MMLA 1S1VB 1UVMA 3MECB 5KFXA 4CIOA 3KLHB 2PEHA 1MU2B 4R0JA 4CM0A 2UXCJ 5EWGA 2D3OR 5DGAA 3M8PA 4MYUA 4WFXA 2IY5B 4PWWA 3WBZA 4B02A 3FBFA 1FKPB 1RWWB 4OI2A 2M52A 1QUVA 2CRLA 3OSPA 4F0MA 3PW0A 2F65A 1WD6A 3UR3C 4NRUA 1LK7A 1CC7A 1D8YA 4KFBA 4DN0A 4LQ9A 1NDKA 2YKMA 1M5PC 2AYBA 4WE1B 3LP2B 2XS5A 5ADZA 2HVEA 4OYBA 1RT1A 4PYDA 2K1RA 2WHOA 2L48A 1VQSA 1F2GA 3QT8A 2GC8A 2RRAA 4LF2A 1HBMA 3BBFA 3CNQP 2HVZA 5BYSA 1DFDA 3FNNA 3SSSA 2ZBCA 2QLBB 4UY85 4RZRA 3J7YI 4NXNJ 4ZVUB 3UN5A 3EVWA 1X4FA 3CF5Q 4JI5F 2AX0A 1EAYC 3GIRA 1IKVB 3IBFB 3EICA 3QIPB 3QMQA 5A0YA 2AGPA 3MDFA 2WB4A 1N5VA 3M9MB 3D0HE 2IC3A 2AIRB 1NLKL 2E1MC 1TL1A 4OYZA 4O3QA 3IRXB 3THPA 1G4CA 1D8ZA 2HK2A 3UD5A 3PW5A 4R25A 4NLWA 1EETA 4JV5F 4YR3A 5KFNA 5AXNA 1FDAA 2QC3A 3RAXA 3OTCA 5ETKA 3R1LA 1PIEA 4NOHA 2DGWA 1A6LA 4P73A 4L72B 3Q8VA 2EEYA 2LXIA 3DLKB 1NHUA 2GVZB 3HD2A 1JLCA 1VOMA 2LVWA 1T03B 1L3VA 4O44A 4FN5A 4TY8B 1NEEA 1X0PA 1FRIA 3A8KA 4Y2AA 4DL7A 1VQ9S 1WEZA 5KG7A 2D3O1 3W2VA 3CCWA 2VC0A 4DS5A 2R2UA 4GVBB 4FS2A 1NCLA 4HT5A 3V5RA 1LWCB 4LRDA 2IYIA 3G82B 1C1BA 2C3UA 1LW0A 4DUTA 2V9KA 4ZPTR 3BR8A 2XZTB 3BR9A 3MTKA 3IMQJ 3DLGB 2DITA 4XDCA 1AZSA 2MMYA 2C22A 3VCDA 1M5VC 3QO9A 2DRAA 3G4SS 4DR4J 3VZIA 3I56S 2KFYA 3OR1A 2QG9B 4Q44A 3K5PA 1S6PA 2GNKA 2BRLA 1D1UA 5AXMA 2ZH3A 1UZHA 4WIIA 4DV4F 1S6OA 2FGCA 4X4UA 4ZCIA 4G1QA 3CCQS 3SEOA 2CQHA 3BSAA 2RUSA 4ILLA 1H74A 4DR5J 4Y28C 3W8GA 4MT1A 2B6AB 2OFHX 5E3QA 3DRPA 3CCRS 2CKWA 1UWAA 2CJYB 4W4MA 2C1EB 2OFGX 1PO6A 1YJWS 4NCGB 2MY8A 1X9WA 3DFEA 4C2MA 4IR1A 4RW9A 3TAMA 3QGGA 3RRHA 1TUGB 3DM2A 4A8OA 1FFSB 4EK2A 3CO0P 8RUCA 1NJWA 2BM0A 3HSDA 2CPYA 3NS6A 3Q86A 3ETOA 1JJ2R 1N36F 1DJ0A 2MSTA 2XI2A 2O5DA 1QD1A 3KK3B 2XNQA 2E9ZA 2XMUA 2MPUA 4HEA9 1RADB 5C25B 1WELA 5DDQC 2ZE2B 1NSQA 3AT1B 2HNZB 1HBUA 3H4BA 1IR2A 3U02A 3PVXA 4KV8B 1WC5A 2DHSA 1IWGA 3EPGA 3MMAA 2LDYA 1R0AB 3C14A 5KTQA 4F8RA 2I0XA 1X9SA 4TY9A 1HW8A 2Y1LB 1WHXA 1ZYQA 3MTJA 4O3RA 4PYAA 3EGZA 2C2DA 1C1CA 4N47A 4ZLJA 1UFWA 3DU5A 2ZH2A 3QSIA 1S9FA 2MQMA 4C8MA 4IG3B 2JSXA 4EUVA 3FDSA 3FK4A 4FBUA 3I96A 3IR7B 4B3MJ 3MF5A 5KFUA 3ZC4A 3GIMA 2CADA 2QLFB 3GV7B 1KLMB 3ET6B 1B7YB 3MD3A 2HS4A 3IWNC 2K06A 1R31A 2OSQA 5KFTA 3D4JA 4XK8C 4FXDA 3HI9A 4DV7J 2HFUA 3NNHA 4FS1A 1NK9A 3AA9A 5IXUA 2BDPA 3TOQA 4RU9A 4RWWA 3OTDA 3CGIA 4F4KA 4ED2A 1VQPS 3MM5A 2IMOA 2W24A 1ZTTA 2BVZA 2C2KB 1QE1B 2PDAA 3PIOQ 2Y0SD 3TVYA 1RACB 3CCLS 4OZJA 1IN0A 3NL0A 1B3TA 4KKOA 3DI6A 2JJ4D 4M5NA 4TYBA 4RLEA 3X3UA 1N0UA 4OV6A 1Z4UA 4F3QA 3DRXA 2E5LJ 4MKAA 1WC1A 4ICLA 2YKNB 2CIMA 4KHPF 4NLOA 1URNA 2IYGA 2XM3A 1PBAA 1WACA 2FZKB 2HMIA 2GJFA 4B3OA 4ZPAA 2RAQA 2ABYA 3MAAA 2RF2B 3H5UA 3F41A 1KP6A 3UFCX 2JC0A 4C9DA 4DPXA 1RHQB 2VDIA 2W2QP 1EQ0A 2HHVA 2KRRA 4GMKA 5D4NA 2G1DA 4RW4B 1S1WB 1ZM2A 4KGZB 4RWXA 1NK7A 2MJNA 1DURA 3CSKA 4DX6A 2VV5A 2F4FA 2YTCA 2B51A 3V6DB 3OXFA 4F4ZA 2KJVA 4ES3A 2UUBJ 1FKOB 2JLFA 2QN6B 5HATA 3M1VA 1GNKA 4NLQA 4LF7F 4PWUA 2FLLA 2R2RA 2DNMA 2XY6A 2DHXA 5F8HA 5RUBA 5E33A 1EB0A 1FVSA 1C2PA 2HKEA 4OLPA 3DRRA 3RRKA 2N3LA 4NLPA 2VB6A 3B4MA 5EUHA 3IO1A 4ZVTB 3P3DA 1JNZB 2ZJQQ 1HL6A 3J80Y 3DLJA 3W60A 2GZOA 5KG5A 2QSFA 3CCZA 2WAQD 4I69A 2OPSA 1S48A 3C8YA 2ADCA 5E3CA 3SQOP 5B0BA 2CZ4A 1VK8A 5LSOA 3FZ2A 1E6YB 4PG5A 5HMXA 2B4PA 4WPAA 2JEGA 1NBEB 3FMWA 2OPPA 2R7RA 1N33J 1S0OA 3QWUA 2KXNB 2E5JA 1TKZA 3D3BJ 4DL3A 4K4VA 3LW5C 1V6HA 3SCIE 4DV5J 2IHR1 4QPXA 4G1PA 4ANCA 3IG1B 1SC1B 4DV3F 3SSQA 3ISZA 1ZETA 5IOLA 4CLYA 1Q0NA 2DGQA 3MM7A 4RUAA 3OTOF 2BBEA 4K5RA 1F9HA 5HP1B 2AJ4A 2NCKL 3DGVA 2XG8A 3DGPB 5KFPA 2EKYA 3FRYA 3QIDA 1IXKA 4G6VB 1EX8A 1RHUB 5HANA 2QT7A 4X84A 1CJKA 2RRNA 2DNPA 1YX2A 2H5EA 1FD2A 2X1AA 5A8WA 3NNCA 1IR0A 1NO8A 3KJVB 4DBQA 1N5SA 2V2VA 3IGNA 3M30B 2I5JB 2BZ2A 3HZGA 2OPRB 4IRKA 5I3QA 2XC9A 1XK8A 3H59A 1WTBA 2V8VA 3TJAA 1JLBA 1UMJA 5CZVA 5K5MA 3M32A 2BW2A 2HFOA 5L1IA 2AU0A 3M05A 3ONQA 2R7XA 1N56A 1Q78A 3T9ZA 4KAIA 2MKIA 3TZXA 3J81Y 2IDLA 3S01A 3JQKA 2ZKUA 1Q1KA 1RTDA 2B4UA 3BO4A 4CWBA 2KU7A 2DPJA 4RU2A 3P96A 3HKZD 4Q7AA 4QW9A 1T11A 1OMSA 4J7CA 3NKYA 1M5HA 1RA7A 3PRVA 5IQ6A 4YR2A 1VQMS 1X7VA 3W3SA 1EIYB 4Y3CA 2F1FA 5F0UA 4LVNP 4C3KA 2B7CB 4DSIA 3QJJA 4UUWA 2GIFA 3DKDA 2W4PA 3W9JA 4KYZA 3O6QA 5J2NA 3CDEA 4PG8A 4DR2J 4IFVA 1RT6B 1NZ8A 2NZ4A 3OFEA 1TU0B 3IBCB 2VODA 4P75A 2ZNYA 3RBEA 3BGRB 4QIFA 4LF9J 3AJ2A 3CCJS 1TMJA 1YQHA 4ZVEA 2HFVA 1XQIA 3UPFA 3LALA 3FC9A 1REVB 2HGNA 2ZBPA 5LMNJ 2V8GA 2FVQA 2VBXA 1S4FA 2Y8YA 5IQQA 1HI0P 1HPZA 3HVTB 2JRSA 2DR8A 1CS4B 2HZAA 3MCOA 3D6TB 1TZ0A 3GB0A 4MK8A 4DUYF 3D6MB 1U6BA 1IR1A 1UKUA 2ZFHA 3LWMA 4ED8A 1Q86T 3PHEA 1RT7B 2ZHAA 2OPQB 5IM0B 3MM8A 2KO1A 2GJIA 3TVKA 2VBYA 1J5EF 3BGOP 1U2CA 4DX7A 3A8JA 4LRFA 2F8EX 2N3OA 4LFBJ 2QL5B 2Q6CA 3BQ2A 5KFMA 3QJLA 2XO7A 4DSKA 1QSSA 3KG1A 4DQPA 4EBDA 1N34F 3JS9A 3THVA 1NK8A 2D74B 1TQLA 5D0GA 4HHJA 2M3DA 5LMUJ 1FRKA 4PKDB 4HDGA 3MMCA 3T1HJ 3HP6A 5ETPA 3LAMA 1XJWB 2B3TB 4AXJA 5AE1A 1PCAA 1GMVA 3I5AA 1S49A 3FRZA 4M94A 3P49B 4QIGA 2UXBJ 2B4VA 3D67A 5LOQA 3FUYA 4ITSA 1JXLA 3ZTRA 4UOGA 1DTTB 2B7BB 3A3NB 5KFDA 1Z1ZA 2EW9A 3OPKA 3H5YA 4U6PA 3MEDB 2CPFA 3HVAA 3CCVS 5H9EJ 4B9NA 3K2YA 3B8HA 5L46A 2VONA 2CQ0A 2AD9A 2R7OA 3C16A 3UN3A 3NY0A 3DOMA 4RJVA 4CLTA 3ENQA 4DDFA 1VQ6S 3CULA 3M9OB 3AHPA 3ZZ0A 4RNMA 9RUBA 5FLXU 2R8JA 5HMZA 2WW8A 5K8PA 1U49A 4PABA 4KT0C 4U7UD 3MAHA 4WP3A 4NI2A 2J6TA 3EZUA 2K7JA 5C2GA 3CJ8A 1MN7A 3PW2A 3C6UA 7AT1B 2YNIB 5A0YB 1NXIA 2JHEA 2Z58B 2YWHA 2JVOA 3AAWB 1BQXA 3BM7A 3LQVA 2HVIA 3Q2TC 3IXQA 1HWLA 3GIKA 1XR6A 4URSA 2JFKA 2ZBIA 4KR0B 1S79A 1F0XA 5HLFB 2WVDA 4LBPA 2J9EA 4NXMF 1T3OA 2OD6A 2GIQA 4I68A 4AFFA 4IYQA 2QL9B 2ZHBA 1UW9A 4DQQA 1URRA 1A7GE 1RJJA 4MIBA 4DFPA 5EGYA 3QGIA 3M8SA 2PGCA 4F3OA 3U1LA 2QIFA 2GQQA 3ADAC 2GO8A 1FF2A 4I0WA 3MMBB 1WHYA 3W2VB 4DPUA 3BV8A 4C0OC 3A3PB 2EG2A 2M0GB 2IJNA 2YWEA 4N76A 1BQNA 2E5HA 1C1BB 3I6PA 2QTWA 2H5IB 1PGZA 5A2QY 3RW6A 1RHMB 2XULA 2Y1JA 1RA6A 4DUZF 2F40A 3DDKA 2KN4A 4IOCQ 3MEGA 2IM1A 2XZWA 2MQPA 4KIAA 3LP0A 2WZ1A 2VKRA 4LRCA 4DWIA 4N8NA 4ECVA 4OI3A 4DS4A 3OR1B 2J0QD 4GVLA 1S6PB 3GMGA 3KUEA 2B56A 4DX5A 1HQ2A 1R27B 3EDRB 3C6TB 2P9GA 3Q24A 1CC8A 3LP1A 4WBFA 3M6XA 1HR0F 2YVSA 2X3GA 3D6FB 5AE2A 2J9DE 4ED5A 4QU7A 3DRSA 1VJWA 1VCTA 2MQLA 5JXSA 2KYXA 4IKAA 1QAJA 3DMJB 3DRPB 4P2FA 2NXUA 4CZCA 4ELTA 2KT3A 4ECTA 2O3DA 2DH8A 3EX7B 5HO4A 3ITHB 2CVEA 4IH5A 1X9MA 1F60B 1KTVA 5EX0A 2ZM6F 4OI6A 1MWZA 3VAKA 4Q5VA 2LFVA 2C3OA 5JVHQ 3DM2B 1GH8A 1EHWA 3WDOA 4PAAA 1HI8A 2AHOB 1L3KA 4L3NA 2FC8A 3R8YA 1WSRA 4JYAF 1UZDA 1UFLA 5IC6B 2DD8S 4AT1B 1DAXA 1U0HB 1FFGB 2IM2A 5IV3A 4X4PA 1YWXA 1FO1A 2YNFA 3TZWA 3RW7A 4NMLA 3CJKB 4MMOA 1MMNA 3AJ1A 2VJUA 1UA1A 2GMJA 4ES2A 4J9VA 2AP6A 5DDOC 2NXJA 4M63A 4EBCA 3K5OA 4C0HA 4U8YA 1OWXA 2BX6A 4K50A 2HBYB 3SI8A 1ROFA 4JI7F 5SUHA 5B0GA 4WCEQ 2XI3A 1FWPA 1LNQA 2XS2A 3NG8A 1R7IA 2RQCA 3BN4A 2ZHOA 4K0KJ 1N88A 4ZP9A 1Q4RA 3FMBA 2BKPA 2DXEA 4P9SA 3D0GE 4RW6A 4F0HA 1X5TA 4KHRA 2WVEA 2Y9HA 1L5UA 3I5CA 5JUMA 4DR7F 2NPIA 2HHPA 4ZLPA 2FHMA 2ASLA 4RO0A 5AJ3F 2DXDA 2DVIA 3W65A 2PD1A 1AFIA 4ER8A 4KRWA 3R1HA 1FESA 3HMJG 2CQ3A 4OZ1A 4MFBA 2Y1IA 3MR3A 1RUSA 3V81A 2AEJA 1Q5VA 5T7LA 2G2YA 1IBCB 3NGSA 2POKA 5CH7B 2Z57B 1JJ4A 3BO2A 4KKOB 1RXOB 3MOJB 2WVCA 4C6AA 4X66J 1X5PA 4MK7A 2XWXA 4ICLB 2HQDA 1XR5A 2FJDB 3D6HB 3G86A 4DR3J 2ACMA 2CNLB 3UE2A 3V6KA 4CLLA 2C3YA 2HG4A 3RZAA 1X4DA 1LFPA 3LPEA 2E1CA 3MURP 2RSQA 2XCPA 5A8KA 2ZH7A 1S1UB 4X62F 5KT3A 2QMWA 2E1AA 4PG6A 4NMXA 3Q22A 2FD2A 3KJNB 1N6QB 4O0NA 3OQ2A 2NS1B 3C3LA 3OD2A 2AYMA 2Z8QA 4CRJA 3TJ8A 2GX8A 1P9YA 2BQUA 1H38A 4QU6A 4X4TA 4OMFG 5ETMA 2BJ7A 3IWXA 1UP1A 2CDRB 1XNQJ 4LIRA 2HHHF 3MUTP 1HBNA 3I87A 3D28A 3T9NA 1CG2A 3Q2SC 4YHHJ 1JLFA 1NK0A 4XIUA 5LM7E 2LCWA 1FE0A 2LQ9A 4IO9Q 1EKSA 1IUJA 1YJTA 4L3KA 2WOMA 3OL9A 2KKHA 1S5ZA 3C19A 3KG0A 3QAUA 2XB2D 1X60A 2V2QA 1X4CA 4H4MB 1OPIA 3GCWP 4F4AA 3JSYA 4PXDA 3BO3A 4YP3A 1QSLA 1SH3A 5CZXA 3PZPA 4NCBA 4Z7YA 5D8HB 3GYNA 2OH2A 3VGSA 1WOPA 5L1JA 5DDRC 4ECWA 2W01A 2XMTA 4USKA 7FD1A 4OYMA 1D9FA 4PWDB 3HX9A 2MKKA 3TZZA 1KDNA 1LK5A 1U1OA 1H2UX 3G8SA 4K5SA 2XHCA 1E6VB 2CG4A 1TL4A 2OEKA 5L39A 3R7NB 1MWYA 2KXHA 4D3GA 2GA7A 3HHLB 3OL8A 1Q5YA 5J2MB 2R8GA 1JX4A 3CDUA 2FVCA 3BGLA 7FDRA 4DL2A 5IT4A 1X4GA 1I3OB 4UQTA 5DGBA 3AB2B 4WK1A 1JXVA 4WTOB 4ZDNA 4DU7A 1SB6A 2XMMA 2AYGA 3RUBL 1UVKA 3OTBA 3TW0A 1UJ4A 1O6XA 2AX1A 4LF7J 5B09A 3IR6B 2KHCA 4J9PA 1SJ4P 1C0TB 5LXRA 2CWXA 3MM9B 1NUEA 1YTYA 5CYQA 5GAEU 1CJKB 2DH9A 4F4YA 1NK5A 2F4VJ 4QCLA 1CULB 3UN2A 2R4FA 4CT9A 2IRUA 3R6LB 4LR7A 3FJ2A 4IRCA 2ZD1A 3M8ZA 1JKHA 3GV8B 2MGZA 4I6YA 1T3NA 1I1GA 4JI3F 3MPVA 2LXUA 5KT2A 1AB8A 1PYOB 4B3SJ 2HLTA 2VASA 4ZPBA 2Q3PA 4DQIA 1P6TA 1G2EA 3IR5B 9ATCB 3DDIA 5ETOA 1RAOA 4HACA 3PTWA 1OIAA 4I7FB 2GGPA 4DPWA 4WZQA 5BXIA 2DNOA 5G0RA 2I38A 1DLOA 3NOCA 4HI2A 2DRDA 2W2MP 3NWRA 4JI0J 5B0DA 2BRKA 2W8KA 1RTDB 5A8RB 5M2RA 2P8IA 4J9RA 4ZVFA 3ILLA 1Y5NB 2VDHA 1VBYA 4BDPA 3FBEA 3QLHB 3GJQB 1B0TA 1NSPA 3DYAB 3CCUS 4ZP8A 1UWBA 1IKXB 4KPYA 1NSKL 1RCXB 2G0JA 1X8DA 3PKYA 3BS9A 2ZH6A 2L9WA 3PYEA 5J2NB 4USWA 4FPIA 1HNVB 3P45B 4BHQA 5A6PA 4R8UA 1S1XB 4K59A 1MMDA 4LFAJ 1VC5A 3K5MA 3M8QA 2XMKA 1GXTA 5KFJA 2CNKB 4OX9J 5C42B 1OQ3A 3V4IB 1DTQA 1U1QA 2G13A 3I5BA 2IDEA 2WONA 2BE9B 3UDEA 5KFFA 2J0SD 2W7AA 1SI9A 4MKVA 3NGTA 2GVDB 5LSLA 4I2QA 2A6OA 3SIPB 3MR2A 3D0IE 3MOZA 4QJVA 2GW8A 2HRYA 3IRWP 1VR6A 5KG0A 1AROP 2FJWA 1Q8LA 4DG1B 3Q89A 1PKUA 4RX6A 3OHBA 2X1FA 2CQDA 2C2MB 2HNYB 4BLGA 2O67A 2LQ8A 2W9CB 1K0VA 1NJIT 3RTVA 1HWUA 3RRGA 5I4MA 2HVHA 2GFFA 1HFEL 3CMAS 4PG7A 5IV4A 1CJUA 1BGXT 3SCJE 2NSBA 1VQYA 1OPZA 2B43A 1JMTA 5J2PB 4C11B 1K0TA 1K8AT 4M5LA 3V6HA 2CPEA 4I67A 1O51A 2CJXB 3VGTA 5EHHA 2XY5A 3GG0A 2R2TA 3MGJA 2KJWA 5MAOA 3CT9A 2JVRA 4I2PB 5GAHI 1ZAWA 2WBRA 3TANA 4DX8H 4LF1A 5IT0A 1KQSR 2PE8A 3T5JA 5ETRA 3NNAA 4YDXA 4OI1A 3DHWC 2BMBA 2J5AA 5T41A 2DY9A 1WEYA 4OI0A 2XSJA 2MJUA 2Y8WA 4NLUA 4ID5B 2OD4A 4X64J 2MSSA 3DOKB 4ED4A 3D1OA 3THTA 4ZKAA 1VBXA 2HW3A 2N4DA 1CLFA 5F0WA 4XTTA 2JZ5A 2JH3A 3DOLB 2JEJA 1RGVA 5B7WA 2HQ3A 2B9EA 1FJGF 4A8YA 2ZC4A 3J7ZT 4Y6IA 2P9EA 2CJ9A 4N77A 2H5JB 2FVSA 3UW1A 4FKYA 4L76A 1T7PA 1F9FA 2XWYA 3HVWA 3MEKA 3QPIA 4I64A 3C66A 4Q8EA 3F56A 3T1YF 3HF5A 3SQGA 4ZLLA 2MQNA 4P6QA 3PHTA 3AODA 4IR9A 1WEXA 3J7YU 4ZCMA 2AKWB 4RNOA 3IS9A 4YUDA 2DTJA 2SXLA 2VG6B 2DNKA 1S1TB 1JLQB 2PI5A 1APSA 2V8DA 1ZM9A 1QAYA 3TQ1A 1FEEA 4HL9A 5KT4A 1RT2B 3MR7A 1WC6A 1B0PA 4KGVB 3OLAA 2HPUA 2RVJA 4DHVA 2B5JA 2FB0A 2DY1A 1BWVA 3W66A 2DHAA 3CC4S 2QE5A 2UUCJ 4B08A 4RNHA 3LGHA 4IFYB 1J27A 5KG1A 1F3VA 4LF8J 2DIUA 2HS0A 3MMJA 1RBAA 4DPYA 4C8LA 3A12A 5LXYA 1NK6A 2PT0A 1YJ7A 3PO5A 5CYMB 5KFCA 1VBZA 3R6GB 4OQJA 4EFAC 4X2BA 2A10A 2Q6BA 1ZBTA 2Y3YA 4CLUA 2E29A 5H9EK 2IRXA 2G2OA 2D41A 1RTHA 4ZLNA 2CJKA 1VLYA 1BWEA 1HNWF 4LFCF 4O3OA 4ANDA 3CCSS 1T94A 1S97A 4HT7A 3MCNA 1W7WA 2ZC3A 1NNDA 4FXWA 1HA1A 1FDNA 3BPSP 2UXDF 3GIIA 4M5GA 2HWTA 4C98A 4B9SA 2ZDOA 3DRYA 2MTLA 3C15B 1HHSA 5HVGA 3CUNA 3UO0A 3T1AA 2G2ZA 3GJSB 4OYWA 4QYRA 2MHEA 4WFAQ 3CD7A 3D54A 1L3UA 1QTMA 4F2RA 4F3MA 1A9NB 4HHUA 3CJQA 4PQUA 4GKKF 1CEZA 1YVFA 3MR6A 3CW2C 2C2RA 1IM4A 4C7QA 1TAQA 1NHVA 4LT6A 2KT2A 3DRSB 3BBCA 4HI1A 2FLOA 2YNGA 4ZVPB 5KOWA 1UJ6A 2HHWA 2BR0A 2CUYA 3HDSA 4ES1A 1W2BR 1AW0A 2DCLA 2BJ3A 1H2TZ 1MNEA 4ED3A 1FTCA 2OGUA 2J8SA 4A8QA 4XPEA 1WOOA 1SJ3P 3HHLD 3I9ZA 3PJXA 1RT5A 1YJUA 2RH3A 5B0EA 2BACA 4G1IA 3GG1A 3W63A 1WHVA 3KK1A 4D3HA 2IPOB 1HBOA 3FCHA 4OYXA 4LBIA 3Q8RB 2G9OA 1WWHA 4DUZJ 5HROB 3MFIA 4F2SA 2AZ3A 3GP9A 3JQJA 3H25A 1OQ6A 1LOUA 2VG7A 3LOUA 2I9SA 1H0HB 1XMBA 1T0TV 2YNFB 3BSCA 4LSNB 5I3UA 4B3RJ 4I6AA 4UZBA 1QVFR 4KO0A 1S10A 3EGNA 3QATA 5IT9Y 3PO4A 1JLGA 3B82A 1SPBP 2OKQA 5SZTA 3VAFA 3JYTB 2XNRA 1ICEB 1TK8A 2C2NA 1X0FA 3BKFA 1CQNA 1NKBA 1XTZA 2DGOA 1YRXA 2XQCA 1RU2A 4X4NA 1I5OB 4CO0A 1S4EA 3H4DA 2EK6A 3M6WA 3G96A 1XN9A 5DG8A 1IBLJ 4HTJA 2OEJA 4OZNA 2QLJB 4RW7B 1V9OA 4FNHA 4Q2MA 4Q8FA 1SVDA 4OYAA 2XYGB 2Z0GA 2BANA 3JSMA 2HNDA 1LXJA 2XHWA 2VKZG 2HBQB 4TYAA 1FWKA 5ETTA 1YJNS 2C42A 3OUYA 3I55S 2AMCB 3L9ZA 4WFNQ 4V19J 4K4SA 3Q8YA 2DXFA 1DQ8A 1CJVB 3VV2B 4NRTA 4LRBA 3N4WA 3UD4P 5EX3A 2V4JA 4J37A 2DO4A 3G6ES 3V81B 2A0FB 5BR8J 1RWPB 5KFKA 3R7SB 4DF4A 3KLFB 5JMNA 1REGX 3VF0B 4LQ3A 4G65A 1FD8A 2VFVA 2BYCA 1WG4A 4K8RA 3UDLA 5DETA 3JXOA 3ZTPA 1HNZF 2M88A 4LF5F 1B7FA 2HFNA 5K14A 1ZA2B 4IOAQ 2NXEA 3CEDA 4UY8T 1NB2A 5KOXA 4IRDA 3NAHA 1UL3A 4K4ZA 1FXDA 1IBKJ 3SCLE 3RB6A 2KI2A 1XNRF 4P71A 1U02A 3CC7S 3PXGa 3QNWB 4WFYA 4LRAA 2CAJA 3SDEA 1KEKA 1FFWB 4P74A 4JI4F 2DEIA 1OYDA 4DMZA 5KFLA 4UT4A 1K44A 2QYGA 3ICLA 3KK2B 1QM9A 3HSGA 3CE8A 4DZ6A 2KVQE 3CD6S 3UI3A 2UVWA 1RTZA 2OP5A 3J81j 3PV8A 3BGFA 2DH7A 4M5DA 1BXNA 5JVGQ 4LSLB 2PA8D 1X5OA 1XMOF 4AL7A 3EM1A 2W25A 2IA0A 4ZJOA 2Z30B 1SBRA 3PKMA 5EN1A 2F8MA 3TQEA 4DV1J 1YJRA 1VLOA 4Y2IA 4J9SA 4NYZA 4MKBA 1FRLA 3QT5A 4JI1J 1LQ9A 2LP4A 4TQSA 2JEIA 3JAMY 5D0HA 1T9XA 4ENOA 2UXCF 1TV6A 5C24A 2XYPB 4IQMA 1VRUB 3MM6A 4RUHA 1H72C 2AF6A 2ATLA 3CMQA 4USIA 3KNAA 3O44A 3D66A 1KQGB 4Q45A 1GFWB 4ANEA 3FFIB 1NB7A 5L9XA 3J7AN 3UDVA 5KFWA 1HWJA 4OLOA 1Y7PA 1RTIA 2XMVA 3BQ0A 1XC9A 3R2DJ 1N0VC 1BUXA 5J2QB 4DL0C 5FDLB 1KONA 5HL7Q 2I2YA 5KFIA 2ROGA 2BUNA 2Z56B 1YIJS 4DJBA 2M7SA 4NXNF 2CQBA 2M8HA 4EZ9A 3F44A 1T05A 4WTYA 3VQSA 4ZCLA 4JI2J 2FHJD 4WZMA 5CYQB 2D1CA 4K4YA 3ENAA 4LR8A 5THWA 2FDNA 4CH1A 3DHXA 3K59A 1PYTA 2EVZA 1JJCB 3BSNA 3MHYA 2B9YA 1U48A
chains in the Genus database with same CATH topology
1XR6A 1FNOA 1JKHB 2OPPB 3DNCA 3GZ7A 4OJHA 4URSA 2RU3A 2GHPA 1TVRA 4ETXA 2JFKA 4H4MA 4CO4A 5KFRA 2ZBIA 2MKCA 1WF0A 2RIJA 1TKZB 1TL3A 2AWZA 2MZSA 4KR0B 2BABA 1S79A 2VH7A 3I32A 1KVIA 1F0XA 1R8HA 1RWUA 3LUYA 5HLFB 2HQIA 1S1VA 2J9EA 2L9NA 3MECA 2QA4G 4NXMF 1T3OA 2HWIA 1DQ9A 3M2UA 2V4RA 2OD6A 2GIQA 3KLHA 4I68A 4AFFA 4IYQA 2ZHBA 5CA5A 1FCAA 2AJQA 1JWWA 1M5KC 4DQQA 3CD0A 1URRA 4QR0A 4WKYA 5J1NA 1A7GE 1EP4A 3NCQA 4ZP6A 4YEAA 1QLNA 1RJJA 2YQ3A 3S7RA 3CCES 4B3SF 4MIBA 4DFPA 5HBMA 1HHTP 5EGYA 3AH6A 3QGIA 3M8SA 3VR1A 1VRTB 3TRGA 2PGCA 4DN9A 3OW2R 4F3OA 1AFJA 2GGPB 4GO5X 3U1LA 2QIFA 3VZHA 3TAPA 2OLWA 3MM7B 2P5VA 1RAJA 3PFOA 2GQQA 1H7WA 3OXGA 1SC6A 4PWDA 2GO8A 4RBUA 5DG7A 1FF2A 2APOA 2AQ4A 1RT5B 3O8WA 3K5LA 5E2QA 1FRMA 2K3IA 4I0WA 3LANA 3MMBB 4CQ1A 5I42B 1NH7A 1VQ4S 1SJ3P 1G3OA 3KMSA 1D3WA 1WHYA 3W2VB 3G71S 1E6VA 3KK1B 4WU2A 2QYCA 2LA6A 1N8RT 3TYTA 2EG1A 4FBTA 1R6YA 2AJ1A 4CO3A 3KHRA 4C0OC 3H20A 3HKWA 1JLEB 5IZHA 2RS2A 2EG2A 2M0GB 2AJFE 4UOCA 2IJNA 1HBOB 2XMWA 2YWEA 4LJMA 4JI0F 5DQHA 3LP2A 4N76A 2VL1A 4B3TF 1BQNA 4FZVA 4KB7A 1O0PA 2E5HA 3LWLA 4YB6A 5A8WB 5F8NA 3CMES 1C1BB 2EBGA 3I6PA 5M2PA 1HNIB 3U1MA 1UWBB 1PGZA 5A2QY 3RW6A 3PACA 1J5OA 2XULA 2MB0B 2VPWB 4DV0F 2Y1JA 1RA6A 2YX4A 3OL7A 2J76E 3HHLA 3MPYA 4DUZF 5AXKA 3PJWA 1PC4A 1SV5B 4IO1A 5J2MA 2F40A 3DDKA 1YRUA 3BJYA 4DQSA 3NRBA 5E3AA 2PMHA 3U27A 3VAIA 1RYRA 3PEHA 3P5TL 4Z37A 2V5HG 4KO0B 3DXSX 3ZZZA 3IN5A 1GT8A 1WI6A 2KN4A 4IOCQ 2LA4A 3N01A 3UR0A 3J7Z5 4PG4A 1JLGB 5H9FJ 5F41A 2BE2A 3E01B 3MEGA 2D9OA 2IM1A 2XZWA 2MQPA 4M1KA 4KIAA 2CJAA 1HWKA 3LP0A 2DGXA 4A8XA 2JL9A 1H7XA 1JLBB 2VKRA 2Z4PA 4DWIA 2PC6A 4N8NA 2WCXA 4OI3A 4ECVA 2WB1D 3OR1B 4DS4A 2J0QD 2B4OA 1S6PB 2RDIA 3GMGA 3M32B 2P6SA 2J9DA 3M8QB 2F9JA 4DR4F 2B56A 1M1KT 1C0TA 4V19X 1WF1A 3MM9A 1IKVA 4NLDA 2Q66A 2W7PA 1QAXA 4FF3A 1R27B 3QIPA 4LFAF 1SL2A 4K4TA 3C6TB 1C0UA 2P9GA 1FDBA 3Q24A 4DSLA 1CC8A 6FDRA 3KLGA 1KHVA 3LP1A 4IH6A 2QA2A 2B9XA 4KQZA 4DL6A 3M6XA 4NLYA 2YVSA 1HR0F 2X3GA 1UJ5A 1ZZFA 3M2VB 1B64A 3PX6A 4OX9F 5AE2A 1U1KA 4KJIA 4A48A 2AGOA 2HS3A 2J9DE 4DFJA 1FXRA 2OAUA 5LJ5Y 4ED5A 4QU7A 3IRXA 2FLNA 1LKZA 1Y5IB 2ZOMA 1GX5A 2RQMA 3DRSA 3M2RA 3ZZTA 2HLUA 4X4OA 1VJWA 2MQLA 4Q0BB 2VFSA 2PSZA 4DR5F 5JXSA 4PXEA 1GXLA 4DL4A 3HM9A 2KYXA 3JSMB 4IKAA 1QAJA 2HYIB 3DMJB 1IJFB 3JTPA 1T95A 2Q1LA 4QWCA 4A8MP 2HNDB 3DRPB 2NXUA 1FDDA 1IKWB 4CZCA 4ELTA 2FJAB 2KT3A 4ECTA 2O3DA 2DH8A 1U09A 1U6ZA 2ZH1A 1S6UA 1H3DA 4C8KA 4KGMA 1QSYA 2EFOA 3DCAA 5HMYA 2XLJA 4CTAA 2RILA 3EX7B 1KS2A 4I7FA 4RKUC 2DT9A 5HO4A 3ITHB 1N32F 1FXLA 3DLKA 1F5CA 2YKQA 1H6KX 1ZPWX 2BM1A 2CVEA 4IH5A 4IFVB 5J1EA 2G4BA 2VA2A 1NKCA 1YHQS 1X9MA 1F60B 4N41A 3UNGC 4AQYF 1KTVA 2UVUA 2IVYA 1OO0B 1T03A 2CPZA 1Y3KA 1SKRA 2UP1A 4TY8A 3NBPA 4WJBA 5EX0A 3SFGA 4OI6A 1MWZA 2V4JB 2PA3A 5KFYA 4Q5VA 2C3OA 3B4DA 5JVHQ 3DM2B 3VAKA 1GH8A 3N5BA 5HQ8A 3MPWA 3H40A 2VZ9A 4ILRA 3GILA 4MK9A 1WG1A 5A8RA 3WDOA 4PXBA 2F8HA 3K7RA 4ZS6A 1HI8A 2XCAA 4CT8A 2W7OA 4ELVA 1Q82T 5D4OA 1L3KA 3OTOF 1N4LA 2EC0A 4L3NA 2FC8A 4ECYA 4OHXA 3QLHA 3PR5B 4F26A 4JYAF 4H4OA 3RAQA 1UFLA 1XBWA 2QO3A 3Q8PB 3DYAA 5KFAA 3D1HA 5GAEI 5AXLA 1KNZA 2DD8S 3EXYA 3CD5A 1Q8IA 1IKXA 2V0NA 1MROA 1DAXA 1RT3A 3SFUA 1C4CA 1X4BA 1SIWB 3N0VA 3NGKA 1VQLS 2IM2A 4H4KC 6FD1A 4X4PA 1YWXA 1FO1A 2YNFA 2V8HA 3FSIA 1HARA 3FSYA 4DOZA 1SJFA 3DLLQ 3RW7A 4O23A 5K8MA 2I5JA 4NMLA 3CJKB 3KLIB 4MMOA 4USJC 3S1TA 3MAQA 5KAKA 1MMNA 1HYSB 4ERDA 3AJ1A 1Y0HA 1UA1A 5K14B 2GMJA 4ES2A 4R5PA 2AP6A 4CNYA 3CPWR 4J9MA 4A4JA 3GIJA 5DDOC 3DLBA 4WK3A 1HNVA 4M63A 4DSJA 1HPZB 4EBCA 4CO5A 2VUGA 3PNIA 4UQGA 1UVJA 4NL5A 4F4XA 1H2VZ 1LWEA 3K5OA 1KFDA 1UEUA 3OFFA 1S1XA 4C0HA 1YJVA 1OWXA 3DXBA 4K50A 4QWDA 4HTIA 3I0SA 5KFBA 3T6JA 1Y00A 3ISNC 2GJ2A 3Q0AA 4C3MA 2V4QA 3SI8A 2OTLS 2HHUA 1ROFA 2VPZB 4JI7F 5SUHA 5B0GA 2XSJB 4KSEB 4WCEQ 2FHKA 2XI3A 4KTQA 4IG0B 3EPIA 4ECXA 3HHNB 2E5GA 1CPZA 4DQRA 2RT3A 4CO1A 3SDEB 5C42A 2L9DA 5L8RC 2XS2A 3OJUA 1VQ5S 3V4IA 3KHGA 3NG8A 3MM8B 1M0SA 2G0CA 1BQMB 3I0RA 1R7IA 2RQCA 3BN4A 2YWKA 1JLAA 5H1SV 2ZHOA 2KT5A 2DGVA 1IQZA 1P9QC 1YG0A 1N88A 1LWFA 3BN7A 4ZP9A 4X64F 2VG5B 4XPCA 3Q8SB 3E8OA 1M5SA 3DC2A 4C97A 1Q4RA 1VMBA 2DNHA 3FMBA 2X1BA 2ASYA 3H2UB 3D0GE 2BA9A 3HZEA 4RW6A 2EK1A 1X5TA 1HQUA 4KHRA 2K7KA 3IWLA 1SH2A 2OO4A 3BDEA 3C46A 2CQIA 4BCAA 1L5UA 3I5CA 2AV5A 4B9MA 4JV2A 5JUMA 4DR7F 2NPIA 1D9AA 2PO4A 2B6AA 2ACYA 4B3MF 1F5BA 1DQAA 2HHPA 3T6BA 1S6QB 2IBKA 2RQ4A 4ZLPA 4J9OA 4LFBF 2FHMA 2D3ZA 4ZOSA 3HHKA 4DG1A 5HI7A 3PW4A 1SKSA 3VAJA 3EZ5A 2ASLA 2HNYA 5AJ3F 3OXLA 1N5YB 3CDBA 3EGWB 4OHWA 2W9CA 3TAQA 2BOPA 2NQPA 2DVIA 4NCGA 2CDQA 2PD1A 1NRKA 2YWGA 4DV7F 1AFIA 1TL5A 2DK2A 4KRWA 3R1HA 1PC5A 1FESA 2BXJA 1D9DA 2VQEF 3CDAA 3HMJG 4ED7A 3CIZA 2CQ3A 3TO8A