3G4SS

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g4sS00
1X4FA 3S6EA 4YB1P 4TU8A 1SJFA 1ZZFA 2DHGA 2V94A 4TU7A 4ED5A 1VQLS 1UFWA 2F3JA 2I2YA 1X5PA 1X5TA 2JVRA 5D77A 3DXBA 3FEXB 2LXUA 3ULHA 2DB1A 2M8HA 3IWNC 4WCEQ 5IM0B 2KM8C 1HD1A 2JRSA 1WTBA 2GO9A 2AYMA 1VQKS 1WF0A 1WF1A 4WFBQ 1A9NB 2CPYA 5D78A 1DRZA 1U6BA 2HGLA 1YJNS 2DNYA 2MKCA 5GVQA 5DDOC 2JVOA 2RRBA 1XN9A 2LMIA 2KFYA 1RK8A 3ZZZA 2L41A 2XNRA 2KG1A 2XS5A 2DNGA 1SXLA 1FJ7A 1KOOA 3UD4P 2G0CA 2YTCA 1WG4A 2ZJQQ 1FT8A 1NJIT 1N8RT 2RNEA 3S7RA 2RQCA 1U2FA 3Q2SC 2MPUA 3FEYB 3G96A 2N82B 2MKSA 2D9PA 1M5VC 1KQSR 2MB0B 2KHCA 3B4MA 2DH7A 3H2UB 2QFJA 1AUDA 1X4CA 2RS2A 1H2VZ 1OIAA 3P5TL 1M90T 3I55S 2M9KA 3B4DA 2X1AA 2K3KA 4RU2A 3CPWR 3BS9A 5LJ5Y 2M2BA 1VQ7S 2MKIA 1YI2S 2DK2A 3MUMP 1VQPS 2XS2A 1VBZA 3CMAS 4PR6A 2MY8A 2J76E 4YUDA 2CPEA 3UCGA 2U2FA 3BO2A 3UE2A 3JB9k 3CCSS 2JWNA 1VQ4S 1YWXA 2MMYA 2QEXS 3BEGB 1CVJA 2MQNA 3SDEA 3CCES 2M52A 3LQVA 3PIPQ 1WEXA 2UP1A 2YWKA 2MY7A 2FC8A 1L3KA 2XNQA 3CCRS 1O0PA 4YOEA 2HVZA 3NNHA 2U1AA 2VONA 3CCVS 2QA4S 1WHWA 2ERRA 2ZJRQ 2FC9A 2KI2A 2DHSA 2VODA 3MOJB 2DGWA 5DDPC 3G6ES 5JVHQ 1Q86T 2E44A 1S79A 3K0JA 1BY9A 1URNA 5GAEU 3SDEB 5DDQC 2FPHX 3UWTA 2M8DB 2BZ2A 3NS6A 1N88A 5MLCV 1U1QA 1P27B 2KT5A 1WI8A 1VQOS 2CJKA 3VAGA 2HGNA 5DM6Q 4IO9Q 1JJHA 1FHTA 2D9OA 3CXCR 1R8HA 1VC5A 1PGZA 1A7GE 2MSSA 2HYIB 1WI6A 2MQLA 4P6QA 3DLLQ 2XS7A 2MQQA 2OJ3A 3RW7A 1U1MA 4F26A 5LXYA 1B7FA 2LKZA 2MHNA 2KU7A 3CTRA 1DZ5A 1VQ5S 4J5OA 3G9CA 2DNKA 2KH9A 1QVGR 2DNQA 2DNPA 1M1KT 2MZSA 5EN1A 2EK1A 2LQ5A 3THPA 2VOOA 3V4MA 1YIJS 1D8ZA 2CQ1A 3LPYA 1K9MT 1HL6A 2DGQA 3VAKA 2MZTA 5LXRA 4QQBA 2MSTA 3CCUS 2DH8A 2HZCA 5ITHA 2CPIA 4CH0S 2DGUA 1D9AA 2PEHA 4ZKAA 1RKJA 4C7QA 2KXFA 3CCQS 3VAMA 3VAJA 1VC0A 2J0QD 4IOAQ 2YKAA 1VQ6S 2MYFA 4F25A 3CCLS 4W92B 1VC6A 1UP1A 1WF2A 1SJ3P 3D2WA 2L9WA 1M5KC 4IOCQ 3G8TA 2HGMA 3CC2S 1H2UX 1H6KX 2DO0A 1VQMS 3U1MA 1X4BA 4Y0FA 2LYVA 2MZQA 2MZRA 1WG5A 2KRBA 4OZ1A 2DNNA 2GHPA 2DGXA 2CPDA 4TU9A 5LSLA 1N54B 4OZ0A 3VF0B 4CQ1A 3UD3P 2VOPA 1HD0A 3CCJS 1G2EA 2RRAA 4IUFA 2LXIA 3MD1A 2MKJA 1U6FA 2LA4A 5DM7Q 4W90B 2YH0A 4QU6A 2MKKA 2FY1A 2OIHA 3P6YC 5H1SV 3MDFA 1PO6A 3MXHP 1WHVA 1NU4A 2X1GA 2KN4A 5LJ3Y 2JX2A 4WKRA 3VAFA 1K73T 2AYEA 1U1RA 3NS5A 2O3DA 2FHOB 5GAHU 2CQGA 3EGZA 2I38A 3MURP 2RT3A 2AYGA 2DHXA 4U67Q 3H2VE 3L3CA 2RS8A 3S01A 1X4HA 2N3OA 1YJ9S 1IQTA 4QPTA 2E5GA 2YH1A 5BJRA 2D3OR 1FXLA 1WEYA 4M5DB 1W2BR 5FJ4A 1OWXA 1DBDA 2L08A 2KVIA 1WELA 1M5PC 2CPFA 3BO3A 2NLWA 2KM8B 3P49B 3N9UC 3EX7B 2DNZA 3IRWP 5CA5A 3CC7S 2J8AA 3THTA 2XB2D 2ADBA 2J0SD 3MUVP 2KRRA 3OW2R 2LCWA 4WFAQ 1UAWA 1Q82T 1P1TA 5LSOA 2EVZA 2X1BA 4UQTA 2DHAA 2RUGA 1UW4A 2DGVA 2XSFA 3VAHA 1FO1A 5IQQA 4Y00A 1YTYA 1SJRA 3PIOQ 1M5OC 1WEZA 2CPZA 1F9FA 3HI9A 2MQOA 4QU7A 2LEAA 2OSRA 2AYBA 5GMKa 3NMRA 2MZJA 2M70A 1SJQA 2DGTA 1X4GA 4Z2XA 3VALA 1H2TZ 2DIVA 1U1KA 3US5A 1X4DA 2MGZA 1Q7YT 3I56S 3G8SA 3R27A 1VQNS 2CQIA 2CQ0A 3R1LA 2ZJPQ 1S72S 2PE8A 1VQ9S 1QVFR 2BOPA 4A8XA 3ZZYA 2SXLA 5JVGQ 1YHQS 3NNAA 2DGSA 3Q2TC 5DDRC 1R8PA 2KYXA 2G1DA 5HL7Q 2N7CA 1U1OA 1VBXA 1FJEB 4WIIA 2CQDA 2NZ4A 2CQ4A 2F9DA 2OSQA 1KC8T 1ZZNA 1VBYA 2EK6A 2MXYA 2DO4A 2AD9A 2CQBA 3U1LA 1WG1A 1WWHA 1U1PA 2DNRA 3HHNB 1DHMA 2MGZB 5GADU 2M4MA 1YITS 1KD1T 4WFNQ 2CQPA 4F02A 4LMZA 4CIOA 4UY8T 4BS2A 2DNMA 3TO8A 2RQ4A 2DNOA 2M0GB 2DNHA 3J7ZT 2CPHA 2RVJA 4FXWA 2KXNB 3S8SA 1X4AA 1FJCA 3CCMS 2K8GA 3TYTA 2X1FA 4C4WA 3MD3A 1U1LA 2KXHA 4LJMA 5DETA 3RW6A 2CQCA 2CQ2A 1HA1A 3P3DA 2MQMA 1OPIA 1WHYA 1SJ4P 2OTJS 3MUTP 1KOHA 2A3JA 1X4EA 2CPXA 2N3LA 1N52B 3CC4S 3VAIA 2LEBA 4FXVA 2KG0A 1VQ8S 2B0GA 3UCUP 3CMES 2MJUA 2DNLA 1WHXA 2E5IA 3NNCA 5CYJA 2E5JA 5IFMA 5CXTA 2DIUA 2DISA 3SMZA 2WBRA 3UCZP 5HO4A 2RU3A 4LIRA 2F9JA 4V19X 3CULA 3G4SS 1ZH5A 3R1HA 3MI7X 2MKHA 4PKDB 1FNXH 2MZ1A 1JMTA 3CF5Q 3SXLA 3BO4A 1OO0B 1K8AT 4PRFA 5GAGU 2CPJA 3EGNA 2M88A 2Q79A 2DGOA 1JJ4A 2DH9A 4C0OC 2MJNA 1JJ2R 1U1NA 3TP2A 2LA6A 1YJWS 3G71S 4EGLA 4CH1A 2LECA 1Q81T 2G4BA 2CQ3A 5IM0A 1X5OA 3CUNA 4ERDA 2CQHA 1QM9A 4TLQA 2M7SA 3J7YU 1X5SA 4WF9Q 3CD6S 2ADCA 2DITA 1NO8A 1X0FA 2OTLS 2MQPA 2E5HA
chains in the Genus database with same CATH superfamily
1T02A 2HQFA 4FYWB 2VICA 1AROP 1VQLS 2HHUA 2OPQA 3CJKA 4FBUA 1TMMA 2K1RA 4BC9A 4I6WA 3CT9A 3DDKA 1GMWA 3PEHA 3TANA 2NZCA 1A9NB 1T8EA 3TAPA 1DRZA 2ZZMA 1XN9A 5H9FK 2QZ8A 3IAM9 3D6FB 2DPJA 1FT8A 3BYPA 3ZTOA 2ACMA 3Q2SC 2ROGA 3FSIA 3A12A 1X4CA 2X1AA 2C2OB 1DY3A 5C42A 2PFFB 1T03A 5G0RA 3V5RA 3MUMP 3ENVA 3VV2B 1JQGA 3PW7A 5KFQA 4J9QA 5J2NA 3CCSS 4ZLPA 3H90A 2HWIA 5L1KA 4DV7F 4IO1A 3PIPQ 1RXOB 2FJXA 4WE1B 2O01C 2UUAF 4JV2A 1KFDA 2XLJA 4KSEB 1RTDA 4CO4A 3MECB 2IAJB 3DU6A 3BM7A 2JHEA 3DKDA 2CJAA 3MWBA 4ZITA 3HJVA 2E1AA 2VPXB 4DL4A 1HNZJ 2XS7A 2XC9A 2IVMA 3NWRA 4JI1J 2KH9A 5E2QA 4CO2A 1XK8A 4J9RA 4ED3A 1M1KT 1HNXJ 9ATCB 2EG2A 3I5CA 4J9UE 4HH1A 3BH7B 4KPCA 2YNIB 4Y34A 2ALZA 1EKRA 4URGA 1GK8A 4YFUA 4DU7A 2XY5A 3FBFA 4RWWA 1RHMB 3HT3A 2HGMA 3W2WA 4NLGA 2YKNA 2C1EB 4JI5J 1EP4B 2H4WB 1XTZA 1KDNA 1HLWA 1PJ7A 3QRQA 1H3DA 1NK0A 3DU5A 2W4CA 4O3NA 1NPKA 2HBQB 4OYOA 1EX8A 4W90B 4B3TF 2ZDPA 1AA1B 2PI4A 3CD0A 1D3WA 4KAIA 1NH8A 2GIQA 4RUAA 2IRXA 5HP1B 2HHHF 2VA2A 5F9LA 4PG6A 1IQTA 2YH1A 1B0TA 3ZTPA 3GG0A 3HSZA 5HVHA 3P49B 1V3ZA 1NSQA 3ONQA 3PV8A 2E66A 2BJ7A 1ZM3A 1UW4A 4OZLA 1L5UA 4C0HA 3PIOQ 4DOZA 2P9EA 1CC7A 2KTQA 5GMKa 3NMRA 2E5LJ 3A3PB 2FLPA 1WC0A 8RUCA 3A13A 3EXCX 2HVHA 2I8EA 4MIBA 2O5DA 4DV4J 2FJEB 5JVGQ 4B02A 3NNAA 2KYXA 4GC7A 3U1LA 1P8GA 3M7VA 1E6YB 3K89A 4OZ2A 4J9LA 2Z2LA 4WFNQ 1FWKA 4ZVFA 1HYSA 1IQZA 5CQGA 1Z2LA 2B5JA 3UO0A 3HKWA 2J7WA 2D41A 3NCPA 4FXWA 3GWCA 4OJHA 4ID8A 5LMUF 9RUBA 1ZM2A 3LGNA 2XBPA 2IRUA 2V8GA 3HFZB 3A3NB 1Q8BA 3UFCX 2J0WA 4AL5A 3NGRA 4USUA 4H4KC 4HYKA 2OTJS 2A3JA 2HQGA 2N3LA 2ZH3A 1R7IA 4FXVA 4XK8C 1A0OB 1HMVA 1LW2B 2VPWB 2E9RX 4DSIA 2RF2A 1RA6A 4NE9C 4HT5A 1Y3KA 3DLBA 1K47A 4ICLB 2NXCA 2YKOA 1K8AT 4DG1A 1HQEA 4CYUA 3KLIA 4P75A 2RH3A 2GFFA 4OX9F 5CH7B 1RHQB 2WOMB 1FD8A 5AXMA 3Q8VA 3KDOA 2VKZG 5ETPA 2K3IA 1VDHA 4UZCA 1NZ8A 3K5LA 8ATCB 4ECTA 2KFZA 1PAUB 3AA9A 2KYZA 1Y9OA 4R0JA 1F9HA 1HD1A 1WTBA 1FRLA 5K14A 5KFDA 1KLMB 3KOAA 2CPYA 3MAHA 3LANA 2HGLA 2DNYA 4Y65A 2V6AA 1DQ8A 2DY1A 4U7UD 2HRYA 2KG1A 2QSFA 2I5JA 4JI4J 4G1QB 1RAFB 3W5YA 3KK2B 1ROFA 1R6YA 4DV5J 3Q0AA 2Y1IA 5HMXA 4FN5A 3BKFA 3GFXA 4JYAJ 1AUDA 3ISND 2AZ3A 1KKHA 2IBOA 4UOHA 1VS3A 3T1HJ 3FFIB 4CLZA 3Q24A 2CPEA 1OY8A 2CRLA 1VQ4S 3M32A 4YHHJ 1VISA 4QIEA 1NK9A 4D3GA 4PAAA 1XR5A 3UDEA 5D15A 3PXGa 3GYGA 1VQSA 2VG5B 5C24B 5I3UA 4IH5A 2BRKA 2KT5A 4X4PA 4YQWA 4JI2F 4I68A 2R8KA 1A7GE 2MQLA 1IBCB 3BQ0A 4F4XA 4R5PA 3ENQA 1WKJA 2Q3PA 4ATNA 2HMIB 4BWJA 3G9CA 2W2PP 1RTZA 3K59A 4D3HA 1FRIA 1HW8A 5HQLA 3SSSA 3C46A 3E8OA 4F4KA 3KLFA 4KGXB 3HFVA 3GIJA 2AX1A 3NG8A 4USWA 5ETVA 1T9WA 2DRAA 2L9WA 2HNYB 2Z58B 1S6QA 3TAMB 3F44A 1UJ6A 5HBMB 1PC5A 3FUYA 5E3CA 4F4AA 4EO8A 1NDCA 4CQ1A 3R8YA 2OH2A 1F60B 1TL5A 4IUFA 3TQEA 1E6VB 3CWJA 2FY1A 4ED0A 4IR1A 2YNFA 3ZZOA 1HWLA 5CD4A 5GMDA 2EEYA 3MAAB 2HW3A 3MURP 1TKTA 1QDUB 1YJTA 3W60A 4DF8A 5A76A 5BJRA 3GPAA 4OYXA 1WEYA 4Q45A 2EXUA 3C16B 2C2NA 3G2XA 3F56A 4YB7A 5L1LA 1FDAA 2AKWB 3CJ5A 3IRXB 2RKIB 5KT2A 2YXLA 2YNHB 3AAWB 1IKXA 3CEDA 1R89A 3H98A 4AQYJ 4URQU 3MCMA 2AYBA 4DN9A 3TR5A 3D67A 2V34A 2W9AA 5KFJA 2XCAA 2HHVA 4JP8A 5RUBA 3R6LB 1IVZA 3O3LA 1NKBA 1IM4A 2LDYA 4WYLA 1SC1B 1R8PA 1U1OA 3RG6A 4WIIA 2CQ4A 2F9DA 3LALA 4OZNA 1NHVA 4B3MF 3HHNB 4LF4F 4DR3F 4JV0A 2RRNA 3VHQA 2VIHA 1NMEB 3J7ZT 2QYGA 4DR1F 4FNHA 1QAIA 1X4AA 3CW2C 1M1HA 1FDNA 4DL5A 3DYAA 3KHLA 3KJVA 1RKIA 2W9CB 2DR9A 3GJRB 5B09A 1R6VA 1Q79A 4DQQA 5KG0A 4P52A 4K2XA 4LBIA 3BSCA 3DRXA 1RSCA 2BA9A 1UWAA 4JV5F 1NNDA 1N34J 2CNLB 4UZBA 4ANEA 5HMZA 4U7CA 3MI7X 1FNXH 1NB7A 3GV7B 3MCOA 1T11A 4ZLJA 1T0TV 2GC8A 2IFXA 2J9EA 2AV5A 2AW0A 2ASDA 4CP5A 4B9SA 4TQSA 2DEJA 1B3TA 2VBYA 1RTHB 3IS9A 3MMAB 4F0MA 5IM0A 3ENAA 5IC6B 1LWCA 1S1WB 3DMJA 3SBMA 4CZCA 4O3OA 3C15B 5IT4A 1FKPA 3IC1A 2Y1LB 3W3SA 1TUWA 4B9VA 3ILLA 1ZZFA 5F8JA 1UFWA 2QLFB 4I2QA 4NWBA 1I51B 1Q5VA 2HFZA 3P8BB 2R7UA 1YJRA 2W8KA 4N8NA 3FKBA 1RHRB 3HDSA 2NCKL 1TKXB 4PUOB 2VG6B 1WF1A 1XR6A 4DR2J 2HEKA 3M9MB 4ZP8A 5IQ6A 3GG1A 1S0OA 2IPOB 1RK8A 3JYTA 2RDIA 2E7VA 2XS5A 4HT7A 3UD4P 2XSJB 1GQEA 3NGTA 2GQCA 1Y10A 3IFEA 3HSDA 3DRYA 1X7VA 2HS4A 3PJWA 3G96A 3PKYA 1JLGB 3SCJE 3J7Z5 2OEMA 2DXEA 3TZZA 4F04B 3H2UB 4KH1B 2UZAA 1KEKA 4RU2A 2E1CA 1WD6A 4X4SA 4JI3J 1FD2A 2VDIA 4QIGA 1JKHB 2JWNA 4X4OA 1CJUA 3HHDA 3AA8A 5KFMA 5ETQA 3MMAA 5D4PA 4TKTA 4P2SA 2QEXS 4GC6A 3CCES 2C28A 3K5MA 3TVYA 3T5KA 2R7XA 2W4DA 4QIVA 4XDCA 1TTHB 4FYDA 2V2QA 3TQ1A 1SIWB 1TU0B 1BQNB 4EFAC 3NY0A 5DDQC 2FPHX 4C48A 3NS6A 3LWMA 3AD9C 1HQUB 2RHQB 3CJQA 3LWLA 3H59A 4KR0B 1HBOB 2NPFA 2W2OP 2VBZA 2MHNA 3BBCA 3CTRA 4RWXA 3J7YI 2DNPA 1Q7LB 4GVBB 4NLUA 4J9KA 2B9XA 4TNOA 2C3OA 4DI6A 2B56A 5LXRA 1RWMB 4NCBA 4IDKA 5C5JA 4JI7J 1HNIA 4LF5J 4ZCKA 1DARA 2C42A 3QAUA 2DH8A 1RCOB 1EETB 1C4CA 1UZHA 3M2VB 4C7QA 3MMJA 4DR4J 4IOAQ 1J2VA 3CCLS 2CADA 3PRBA 3ETMA 3KHGA 3BYRA 1WTFA 3MF5A 3W62A 3PKMA 1JLEA 2V8HA 4OZ0A 2BQ3A 4OQJA 3PW0A 1HNZF 4OL8A 2QMUB 4I4BA 4LBPA 2XMJA 2ZNZA 3BQ2A 1EAYC 4L3KA 4JI1F 3C6TA 3DRRB 1HNXF 3QBCA 1AXQA 5A8RB 2P5VA 4WKRA 3HHLA 1SQFA 3R6GB 2XO6A 2R2TA 4MKVA 2XTJP 4C11A 3W7BA 4PWUA 1RACB 2EFVA 3OD2A 1X4HA 3OFHA 2HBZB 2ZD1A 2EFPA 1OWXA 1DBDA 2YPYA 4Z7YA 4ETXA 2OEKA 5BYQA 3BO3A 2GAHC 2ZBIA 1QTNB 3TZXA 1O8BA 4ECWA 4JI5F 5CA5A 1BUXA 2OLWA 1NSPA 2OPPA 3N01A 3PFOA 3ZTQA 4LSNB 4UQTA 5K9FA 1WEZA 3VGTA 3THVA 2OSRA 1MW7A 3HZEA 2M70A 2PEBA 4R8UB 4DL3A 5J2PA 3OXGA 1PSDA 3GYXB 1XBWA 2GJIA 2YQ1A 2CVIA 1K1SA 4I7FA 2AD9A 4P73A 1WWHA 1U1PA 3OUYA 2VQFJ 5D8HB 2AF6A 2BUNA 1RTJB 3Q83A 4ES1A 4ALZA 1GEHA 3I4HX 1OS5A 5ETLA 1HQ2A 4CH7A 1LQ9A 2QJ3A 3A8IA 3CO9A 3NKYA 1H72C 1JXEA 4ZK7M 2ZH1A 4RJVA 3UW1A 3OL6A 1RWPB 2OAUA 4RW9A 2K2PA 1TK8A 5DETA 2HRTA 3AQPA 4NLDA 2E5LF 2V0NA 2AIRB 4LVNP 2VPYB 2FUG9 4CLYA 3ZZRA 2CPXA 5DS7A 1WDTA 1B7YB 3KLEB 5ETKA 3UCUP 1UTAA 1C0TA 4HVZA 1LWEB 4DV4F 1RYRA 2C22A 3ILOA 2XWYA 3VWSA 4I6YA 1ZA2B 3J81U 2V63A 4PKDB 3GIRA 3GB0A 3EGVA 4RW4A 7AT1B 1N4LA 5GAGU 1FVSA 5EUHA 2V8DA 4MJKA 1RT5A 2BW7A 2UXDJ 4G3IA 3C6UB 4QIFA 1NPPA 1BXNA 1HWKA 1X5SA 5CZVA 5F8IA 5DLGA 5F8MA 3V4IA 1FA0A 2OFGX 4HACA 4NZ0A 3R7SB 1SJFA 3MM6B 3TX0A 2UV8A 5CCLA 2JVRA 3U1NA 5JXSA 3IWNC 2JRSA 1MN9A 1RTIA 1F5AA 4RX6A 5D78A 3R5DA 3D6TB 3M9NB 3DFEA 5DDOC 2R7WA 2OPRB 4S0MA 1S49A 2Z30B 5D0GA 1PILA 3CIZA 3AY0A 4RW6B 1SXLA 2F4VF 2HFSA 2PN6A 3BZQA 4B08A 2HK2A 4FVMA 2VH7A 5L1JA 3BDPA 3BGLA 2HURA 1S59A 1M5VC 2KHCA 2V4JB 3T3FA 1OIAA 3QT6A 2X3DA 2JC1A 2BBEA 2ZKTA 2BANB 3A1YG 3B78A 2ZC3A 3JB9k 3W63A 2PSZA 3RAXA 3GCWP 3D5MA 2CYYA 1SUQB 4WTYA 3BB5A 4Y2AA 3BF4A 4H4OA 4HHUA 2KB2A 5B0BA 3RUBL 3TA2A 4OYAA 2DGWA 1I1GA 4JI4F 5C2GA 1FWLA 2EFNA 4DV5F 1U1QA 1VQOS 3H7HB 3MR6A 4DV2J 2ZC4A 1TV6B 1B7FA 3FZBA 3T1HF 4P2MA 1NK6A 1TKZB 1FXRA 2J6TA 2DNQA 5CYMA 1IJFB 3CJTA 1Q78A 2OELA 4HTIA 1VCTA 2BR0A 1RT7B 4G6VB 1QAYA 2G0IA 3JSMB 5BR8J 5F8HA 2CJQA 1X9WA 3HSJA 1EJ7L 3TEGA 1SVDA 4MKYA 2YX4A 4KGZB 4EEYA 4C3MA 5EGYA 2VU5A 1U7LA 3WX4A 3CJ8A 3MEDB 1BE4A 2VOPA 4IQXA 4AL7A 3Q86A 1TL7B 3D28A 2XGQA 4A8QA 3RBXA 2EBGA 1N32J 3QAEA 1D9DA 4Q2MA 4KTQA 4CRJA 1S1XA 1Z4UA 3EGZA 1LNQA 3CDBA 4U67Q 3PX0A 3A3OB 1IJEB 3Q89A 2D3OR 3FRYA 1CC8A 1S48A 1TKZA 3VZHA 3R5BA 5DG7A 2E1RA 2AQ4A 2O66A 1C1BB 3FNNA 3QFWA 2WSFC 3JQMA 2MHEA 2XY7A 3C3LA 5HN0A 2RUGA 2F63A 4IFYA 1VLOA 4CCHA 1RBOB 5KFYA 1T05A 3D9BA 3OR2B 3DOMB 1WC1A 2ZM6J 4QWAA 2HLTA 1P9YA 1V9OA 1MMNA 2GQQA 1RAEB 4ZP6A 2XZDB 2CVEA 4M5HA 2EG1A 2B43A 3TNVA 5E7OB 3KHHA 2DGSA 3PR5B 2AX0A 1VBXA 4OHZA 3MOZA 4EO6A 1EZZB 4PG5A 1VRTA 2GMHA 3GE9A 1WORA 5KG3A 2IDLA 2RQMA 1S10A 5HATA 2KKHA 1DTQB 2RVJA 2BABA 4TYBA 1P9QC 3GQCA 5D4LA 4AQYF 4DV6J 4NLQA 3LP0B 4XO0A 2JEIA 3K5OA 4FF4A 2XMMA 4NPOA 3CMES 5B0EA 2E5IA 3PG9A 3SFGA 3IBCB 3FCHA 2GS8A 2F9JA 1YRTA 1URRA 1CQMA 3DOMA 1H38A 1XQIA 2F8HA 2Q66A 1CJTB 2BJEA 2VHGA 1JJ2R 1PAEX 3TP2A 4KRWA 3FBBA 1YJUA 4ZVPB 3RBEA 1WKLA 1NO8A 1X9MA 3HP6A 4TXSA 2BRLA 2D3ZA 1X4FA 3NGKA 2XO7A 2DHGA 4TU7A 5LMNJ 2QN6B 2IC3B 4QYZK 2DB1A 1GT8A 4CDIA 1K44A 2IM0A 3PW5A 1N34F 2FHJA 2HG4A 2DPIA 2Y9HA 3I82A 1Q4RA 4P7TA 1J27A 2Z0GA 2FJWA 3TEHB 3D6MB 3IXQA 3UD5A 3WC2A 2RU9A 3LAMA 4E0DA 1IBMJ 1RBLA 3PYGA 2AJ1A 4M63A 4DR7J 3KLHB 3QT8A 4LF8F 2HFOA 1RWVB 3M8QB 2ZUGA 4CTAA 4OYPA 1KQSR 2ZITA 2ATCB 1MMLA 4ECUA 5IOLA 4EBEA 4DCPB 2W2MP 3LP2B 4PG4A 4KY3A 2DK2A 3TW0A 3HPOA 1HPZA 4HHJA 5M2RA 2C2EA 2JFDA 4PQUA 3QQCD 3DC2A 4OHVA 4DPWA 4Q0BB 1DTTA 4DR2F 1BQXA 4OLOA 1SI9A 4KO0B 2R2UA 3CCVS 1FI4A 5AT1B 3BPSP 3RAQA 1M1GA 3QJPA 1RWNB 5GAEU 2FLLA 2B9YA 2E1PA 3QIPA 4C3KA 2ZDOA 3I96A 1NDKA 1W25A 2CNNB 5A8KB 4JI3F 4UUXA 1RAIB 1RAAB 1R8BA 1Y5NB 2EK1A 4IG3B 2F8EX 1YIJS 1UVNA 3MEGA 3VAKA 3JSRA 3V6DB 3HLUA 4QQBA 3UVJA 3OTCA 3GSDA 1N5YB 2AEMA 1GMWD 3IGNA 1Y3JA 2PO4A 4WXWA 3BGOP 2QSWA 3D2WA 1R0AB 3D68A 4N56A 1HARA 2UU9J 1RHJB 3U1MA 4WYWA 3RB4A 3DLGA 2JZ5A 1JLBA 4NLYA 2CPDA 4TU9A 3UD3P 3TUIC 4KE5A 1G2EA 4NRTA 4CLTA 2RDJA 4DSJA 2J6SA 3AODA 5HQ8A 3L09A 3MM9B 4Q8FA 3MTJA 1S1VA 2CQGA 3DGPB 4WKYA 3L3CA 4JI7F 2LXFA 2RS8A 4LF5F 3HM9A 2BQUA 4DCOB 5J2QA 2EC2A 3M30A 1FESA 4M5DB 1KTQA 1RT1A 3MAQA 3P5BP 1YVFA 1W2BR 4DR4F 2CWXA 4ZVGA 3QWUA 4C8MA 2FJDB 5AE1A 2PGCA 2DNZA 4R25A 2XB2D 4RNFA 3MUVP 1HHSA 1U0HA 3MM5B 3HVTA 1RT4A 1OYDA 3AXKA 4BLGA 1Y7PA 4Y00A 2UVRA 4B3RJ 2NS1B 4DCJB 2BEFA 1VQYA 1JLCB 2DGTA 1X4GA 2DR5A 1YQHA 1N6QB 4AE5A 2MGZA 5J2MA 1Q7YT 1N5SA 3MCNA 5FD1A 1VQNS 4Q44A 3R1LA 4EBCA 1UJ4A 2GQ2A 3E01A 1N5TA 3AT1B 3QZ8A 2GGPB 2J8SA 5DDRC 2NXUA 4N77A 4USJC 1BMQB 2K7JA 4RUCA 2EK6A 2MXYA 3FGVA 2MTLA 4MFBA 4BHQA 4OHXA 3HXMA 4AYBD 2DNMA 2A6MA 2BYCA 4DSLA 1VK3A 3VGVA 1N33J 3R5JB 3D1OA 1RI7A 4ELTA 1LW0B 4GO5X 4C8ZA 4C4WA 2HFUA 1GXUA 5THWA 2C3PA 4ILLA 3GFYA 2B8QA 4F0HA 1HA1A 1SJ4P 3MUTP 1KOHA 3TUJC 1NHKL 3NCRA 5HVGA 2Z56B 1KFSA 3H25A 2VFUA 3G4SS 2MKHA 2HNDA 2VQFF 3HULA 2NSCA 2RUSA 1KVIA 4OZJA 1XNRJ 2RILA 1K0TA 1UJ5A 3WQPA 4C0OC 4ETZA 4F4YA 4K4TA 1WOPA 2Y8WA 1X0FA 4NCGB 2MQPA 4NA1A 4Z7CA 5HK4A 3FK4A 2OPSB 3G6YA 4LFCJ 4RW7B 2F3JA 2GVZA 3RRKA 1OYEA 2P6SA 1BGXT 2WONA 3G8QA 4HI1A 3OSNA 2ZH8A 3PNIA 1S6PA 4RKUC 2KFNA 3UNGC 1FEEA 4ZA1A 2VFVA 2LVWA 3CCZA 1IR1A 3CSKA 3KLVA 2V9WA 3ZZZA 2PDAA 2HBYB 3M4XA 1TK0A 3CJ0A 2V2VA 1XJWB 2UXDF 4F8RA 2WBMA 4K59A 3S7RA 1FE0A 1JIHA 3AOCA 2OKQA 4ZPVR 3PRVA 3T5HA 3M05A 2RS2A 1FDBA 3GTYX 7FDRA 3JS9A 3UE2A 1S77D 5EWEA 2WVBA 1HFEL 3BEGB 1NJWA 4ED8A 2UVUA 2P9GA 1PJ6A 5E5NA 3CVKA 4G65A 1NPRA 5KT7A 2FD2A 4K7QA 4ECRA 1FRXA 1L3VA 3NAIA 4OZ3A 2R7SA 4MK9A 3G6ES 2C2ZB 2CNOB 4UUWA 1UVIA 4YR0A 1SL2A 4X62F 2WB4A 3R5AA 1P27B 3TZYA 2ZWPA 5DM6Q 2AGPA 1VK8A 1H7WA 4NZ7A 4H4KA 4ECYA 4R0EA 3I4PA 1U1MA 1C1CB 5M2PA 4FKYA 2OUGA 5EN1A 1FCAA 1XMOJ 2ZOGA 2DCUB 1RT3A 3CJ4A 4HDHA 1JLAA 3JXOA 1IBKJ 3M6VA 3V81B 3DOLB 1T9TA 4NMXA 5E33A 4BBYA 2FGCA 1VC0A 2J5AA 3W65A 1SJ3P 5HROA 3RYLA 3W2VB 1JXVA 4MKBA 4PXDA 2VASA 1F0XA 3Q8UA 3IG1A 4Y6IA 4DV2F 1TQLA 3IBWA 3KTQA 3IWXA 2AJFE 1HR0J 3KJFB 4B17A 2ZOFA 4OYMA 2MKKA 3Q8SB 2ILYA 2L9NA 4PPZA 3GZ7A 2BVZA 1PBUA 4CWBA 3NMAA 4PCQA 5D4NA 4LUBA 5BR8F 2HHWA 4DDFA 4PWWA 4YY3J 1C1CA 2WZ1A 5IWAF 2NLWA 2D7SA 1F3FA 4B3OB 1REVA 3EX7B 2ZHAA 1IM6A 1WDDA 2J8AA 2I9SA 1S9GA 2CWKA 3WZ0A 3K7RA 1Q82T 1N48A 2W25A 1ZYQA 2G2ZA 3BJYA 3DOLA 5IQQA 3NL0A 3T5JA 4W98A 3TUZC 4QU7A 5DGBA 2JH3A 1N32F 2O1PA 4U9RA 2R7RA 4KHPJ 3GFHA 3QFHA 2CQ0A 3RBDA 1VQ9S 3MMCA 1AUSL 3OL8A 4A8XA 4IFVB 2G1DA 3DLHA 3AJ2A 5ADZA 3AFGA 1QUPA 1PCAA 3QO9A 4BDPA 3C14A 3OFEA 5GADU 3MCSA 2CQPA 3S1TA 2H51B 4NASA 1IKWA 1WSRA 1FK9B 4FZVA 4QR1A 3EVWA 5F0UA 4CO5A 2HAIA 2GJ2A 3QLHA 5GADI 1U02A 2ZM6F 4RUBA 4M5KA 1Q1KA 4LSLB 2L3MA 4G1IA 4WZMA 2BXJA 5HLFA 3J80U 2ZWOA 4NMLA 2E5JA 1RISA 4MK7A 5E3QA 2J9CA 1S9EA 1SL0A 4X2BA 3FDSA 2KO1A 1NRKA 4DFMA 5KFAA 4EMDA 5DG8A 1RWOB 1NDLA 3HHEA 2COLA 2ZE2A 1N56A 4O3QA 2BM1A 2ZKUA 4ZDNA 3C8YA 4TLQA 4Q5VA 4RR5A 4DPOA 4DV6F 2VUGA 3MEKA 3DLEA 2C2MB 4O4GB 4RBUA 3QT5A 3S6EA 5C2CA 4HR2A 5F3TA 2V94A 3MR5A 3NP5A 4HEA9 3ZZ0A 4FF3A 1YJVA 4LIWA 4CLKA 2HSEB 4ANDA 1BWVA 2NXNA 1DLOB 1ZTWA 2AGQA 2HZVA 1IKYB 3NBPB 2H9ZA 5GVQA 1IKVA 2RRBA 5A8WA 1IR0A 3FRZA 1TFWA 1NH7A 8AT1B 1RGVA 1X0PA 4JBCA 1DURA 4YDDB 1LFPA 4LR9A 2MPUA 3I0RB 3OVAA 3FBCA 2DH7A 1D9FA 1I94F 1QE1B 3DRSB 2POKA 2M2BA 2GHWA 2XM3A 2IMOA 5LMNF 1F3VA 4M5NA 2XS2A 5K5MA 2MY8A 5BXIA 3DM2A 1I5OB 1NKCA 2MMYA 3VVTA 4ED1A 5KG6A 2VC0A 3HSGA 3SYZA 1L3KA 1IBMF 4A46A 3R5GA 4C8YA 4C98A 4DR7F 1VHIA 2Z4PA 2YNGB 1EQMA 2B4UA 2HHXA 2CKWA 3SDEB 4CO3A 4GVLA 3SCKE 1N88A 2YWWA 2XMAA 1HWUA 2GZOA 4EZ6A 2CDQA 5F8NA 2MQ8A 3C2PA 1CG2A 2HYIB 1KR4A 1U48A 3AJ1A 2EW9A 5KFNA 5LXYA 2HQIA 3PM9A 4DV0J 2FJBB 1UVJA 3KK1B 3KMSA 2R8HA 3ET6A 4QCLA 2ZBPA 2K7KA 2DGQA 1JLQB 1HBMA 1RT6B 4FPRA 1RJJA 4QZVB 2CPIA 5C25B 2V68A 3DI6B 2YKAA 1VQ6S 1JLFB 3TARA 2CG8A 2VZ9A 5ETSA 4KGVB 4DPUA 3G8TA 2VG7B 1VQMS 1BD6A 2C3YA 4UOCA 4OYZA 1V3SA 2IM3A 4TY9A 3FBEA 4WFZA 4KKOB 3CCJS 3IM8A 4L73A 2CAJA 3OXLA 3W9JA 5KFOA 4FVCA 1TL3A 2LQ8A 4MH8A 1PO6A 4EI2A 2X1GA 4PWDB 3GIMA 1TL4A 4ECXA 2FHOB 2NPIA 3ELHA 2I38A 2IJFA 3H2VE 1FJGJ 4LFBJ 4QBUA 2GVDB 4DU8A 4I2PB 1R3NA 4P74A 3VGSA 4PYDA 2VQEJ 2L08A 2KVIA 1UEVA 1WELA 3D1QA 5T7LA 4GO7X 2UU9F 3CC7S 3K2YA 1IXKA 2QA2A 3Q8YA 2W2NP 3X1LB 2DHAA 3VAHA 1RT2B 1S4FA 1RE1B 3F73A 3HI9A 1SV5B 3VALA 1QSYA 3LP1A 2YKMA 2ASYA 5J1EA 1W26A 1T9UA 4RBTA 3N5BA 2BKPA 2OD4A 1ICEB 4DL0C 2W24A 3MM8B 2XG8A 2B6AB 3NGUA 5E41A 1U6ZA 1G7CB 1KBRA 1DHMA 3MR2A 3KK3A 1KD1T 4F02A 2ZHBA 2HIQA 4CIOA 4TY8A 1CJVA 1UETA 4ZHRA 3BQ1A 1ZM4A 2P9CA 4NL5A 2YWEA 3OFGA 4UOGA 2K8GA 3PJXA 3GLJA 1C4AA 2H5EA 4LJMA 2WTFA 4OX6A 3P3DA 1VJQA 5I42A 1WHYA 2VKRA 4RZRA 1HI1A 1N52B 3CC4S 5F41A 1ZA1B 4RW8A 4NLSA 4KB7A 4QR0A 2DIUA 1CJKB 3SMZA 2WBRA 2YBVA 1TL1A 2HQDA 3TVKA 3HHLD 4IH6A 1G4CA 4G1PA 4IG0A 2IYIA 4IRKA 4CLWA 2E9TA 2FHKA 2W2QP 5B0AA 1UFKA 5B0GA 1TZ0A 1ZTTA 2QLBB 3BGRB 3EDRB 3NOCA 4WPAA 4AFFA 5DO2A 1N33F 3WBZA 4CNZA 3AQOA 4CH1A 3D0HE 3LGHA 1Q81T 2R8JA 3P96A 4WF9Q 5L1IA 4NI2B 3H2LA 3UR0A 3HD1A 3OXFA 1N5VA 2VDHA 2LXUA 3UNYA 4MK8A 2H48B 5HQMA 1FTCA 1U0SA 2XYPB 4FNIA 2KVQE 1UMJA 4PZVA 4Q43A 1VRUB 1SQEA 4HTJA 2IDEA 1NJYA 4Y2MA 1EHWA 2HKEA 2YQ0A 5DRKA 1K0VA 3E3XA 3IM9A 3N5FA 2XNRA 1XNRF 4MYUA 2HS0A 2UVWA 4USTA 2G0CA 3V6HA 4MTPA 1CULB 2CNKB 5HJXA 1F2HA 1RHUB 5DG9A 2X3GA 1VIOA 2H3EB 3GCXP 4WE1A 2M9KA 4DPXA 4DV3J 4LFCF 1YRXA 2DR6A 4K4WA 3M2RB 3H4DA 2YY3A 1YLXA 4PR6A 5ETOA 1FF2A 3QJLA 3MECA 2IAJA 3ZZPA 3P45B 4NCAA 4PXEA 1N36J 3DLKB 3M2UB 3SQGB 1WC6A 5D3GB 5LOQA 3CCRS 5KTQA 4X66J 4JUZA 3JAMU 1TAQA 2ERRA 4LSZB 2ZJRQ 1U8WA 2OI2A 2OP5A 1ZPVA 2HNZB 3CO0P 1U45A 1FNOA 1LXNA 2HHQA 4ZIVA 2R8GA 5MLCV 2UUCJ 3GONA 2YNIA 2HGNA 1VC5A 1PGZA 3HT0A 4O3RA 5CYQB 3DLLQ 2QE5A 2B4OA 3C66A 1APSA 4L3NA 4DMZA 3ITHB 5CHCB 3FEZA 2KHDA 2YWGA 1OSCA 4MIWA 2J9DE 1EP4A 3LPYA 1TUVA 3D3BJ 3TA0A 3TJ9A 4ZJOA 4YDXA 4NA2A 2QA1A 3GJQB 4F67A 1CQNA 4WP9A 2Y3YA 4IYQA 3CC2S 4F4ZA 2UUTA 2MZQA 2DNNA 1RAOA 1N54B 5KFKA 3LH2S 5HP1A 4LVOP 4Y2KA 3SFUA 2YH0A 3N79A 1I6JA 2DTJA 5EHHA 4L74A 2VPZB 1XMOF 1K73T 1U1RA 2W9BB 1S99A 1NK5A 4X64J 1TFYA 1BQMB 2QX0A 4DLEA 2JFKA 1IBKF 3S01A 2BQRA 3AXMA 1B0PA 3GR0A 4KV8B 3G86A 2QL7B 3MEEB 3F0NA 1NK7A 1B99A 3EJMA 4LREA 1LOUA 3DN9A 2V4QA 4F3OA 3FZ2A 2ZVSA 4Z37A 1P1TA 1MN7A 4XIUA 5CABA 4WBFA 1HR0F 1SKRA 1H74A 3PJ9A 5JMNA 4NLOA 1F9FA 2OMOA 4UTGA 3ILJA 2P6TA 2XI3A 1E6YA 1CLFA 4KH0B 4DF4A 4FBTA 4PEOA 4NYZA 1S72S 2XZTB 5F8LA 2IY5B 3PZPA 4YY3F 2ZBRA 1P1LA 3Q8PB 3AD7C 2DHHA 3OR1B 3GJTB 3ISZA 3HFKA 1VHFA 1HBNB 2BOAA 1DJ0A 1TKDA 2CPHA 4RU9A 1LW2A 1SBRA 2CJ9A 5E0OA 4DQPA 1KS2A 3PRDA 4EWTA 3RB3A 2Q6CA 4DUYJ 5A6PA 1FDDA 3LA0A 4ITSA 4KQZA 2H54B 3CCTA 4KHPF 4ICLA 4WP8A 1NCLA 4F36A 1QLNA 2LQBA 4C6AA 3A4TA 4ZPDA 5CYJA 5CXTA 1OQ3A 2CJXB 2DISA 1S6OA 3UCZP 5DZ6A 1LWFB 5LL6d 2ALYB 4TN2A 4ILMA 2WOMA 2D1CA 2AEFA 3ZFVA 3HVAA 3T1YJ 3JSYA 3HCXA 2YPZA 1JJ4A 4DL2A 3D6HB 1EIYB 4F2RA 1S4EA 5A2QY 3CDAA 4EGLA 2G4BA 1FRHA 2LP4A 2M7SA 1T3NA 3T19A 2BJ3A 1KTVA 5HAOA 2HZAA 1B4SA 1KLMA 4YB1P 4L6V3 3OR1A 2NUUG 4J9PA 1CSJA 5KT4A 5D77A 4AXJA 2PD1A 4G1QA 4K4SA 1Y5LB 4WCEQ 3KK2A 1LK5A 4DN0A 2K06A 1U6BA 2M5YA 2JVOA 4DJBA 1PYTA 5AE2A 4TVAB 4XDDA 1SC4B 1KOOA 1MMDA 3VQSA 4DXLA 3FFIA 1MG7A 4OHYA 1GX5A 2ZJQQ 3SQOP 3GIKA 1MROB 1NJIT 4NEYA 4CO1A 1S1TB 2RQCA 3NS7B 1Y11A 2ZEJA 1HNWJ 5GMEA 4DLGA 3B4MA 3P5TL 2ZH9A 5K20B 2AWZA 3RRHA 3GYNA 3QRPA 4F50A 3T6BA 4NA3A 3RB0A 2OFHX 3BO2A 2U2FA 3I6PA 2APOA 2RDDA 4OI1A 2MQNA 3H5SA 2VG5A 5C24A 4K4YA 2ZH6A 3IWLA 2R7VA 2JJ4D 3U27A 4AL6A 1ELOA 4ES2A 3T6JA 5IT0A 2HMIA 4M95A 2DKOB 4DR6J 4BWMA 1FFWB 2BE2B 2IVFB 3DOKB 4OZ5A 3VTIA 2CJKA 4I6AA 3IBFB 3ISNC 3RW7A 1AYEA 3J81j 2CA9A 3MR7A 1TVRB 2Y8YA 1PYSB 2VOOA 1RA7A 2HNYA 2ABYA 4ZOSA 2IYGA 3TAMA 4KC5A 5CCMA 5HBMA 4QYZJ 1AFJA 4ZMMA 5KG7A 2FHJD 5ITHA 1FKOB 5DJBA 2QLJB 1AB8A 2QG9B 3CCQS 4ECZA 1E6VA 4NX9A 5D4OA 1UP1A 2NUHA 1M5KC 2DO0A 4LF7J 1WG5A 3MAAA 4O44B 4OZ1A 4KT0C 3R7BB 2IRYA 3M8PB 1KNZA 4OIXA 1NM2A 2A1BA 4WXOA 4DV0F 3OFFA 2WRMA 3C16A 4RPFA 4ZJLA 2KN4A 4KGKA 3MPYA 4QR2A 1SCJB 2FYXA 4K2JA 3WDOA 2WSEC 3IRXA 2RKIA 3POTB 4ID5B 2B51A 2YNHA 2CZ4A 3QGIA 2WVEA 5FJ4A 2FJVA 1C0UB 2YKQA 3BKTA 2QFIA 5KFGA 3LW5C 4TLRA 4FS1A 1UKUA 1S1UB 4U95A 5D0RA 3BR9A 3PDNA 3MM7B 4C8LA 4ZCLA 1UAWA 3JQJA 2X1BA 4WFXA 4ELVA 2XSFA 3PTWA 1Q5YA 4LRDA 5DZ7A 3ZC4A 2OMLA 4I69A 3D54A 1U1KA 4FXDA 4FYYB 3R27A 5KG4A 1WUUA 3T9ZA 1FJGF 5HMWA 4LFBF 2GO8A 1YHQS 1UVLA 2N7CA 4RNOA 2VQEF 1AZSB 5CD4H 4PXCA 2DO4A 1Z2ZA 4KFBB 4DUTA 5FDLB 1N0VC 2W9CA 3I0SB 1U09A 3WC0A 2EBEA 2QLWA 3KLGB 4BS2A 2M0GB 2DNHA 3OPKA 5A0YB 2EWHA 1FRJA 2XMTA 3FMBA 1S57A 2QMXA 2F4FA 3Q8QB 4UW2A 3W1YC 2PA8D 4CNYA 2LEBA 1HBUB 3K58A 1J5OB 3V2UC 1IN0A 2QGFB 3IR7B 1TAUA 2NXJA 4CLSA 5HO4A 1RTHA 2ASLA 3M8SA 1PJ5A 1HI8A 1RWWB 1S1WA 5EDWA 2MZ1A 5GAHI 3C15A 1U49A 3PHTA 3OTEA 1OO0B 2CPJA 3IAS9 1UWBB 3SEOA 4OI2A 4L76A 5A2QU 4UF4A 3J7YU 2HFVA 1TKXA 4PUOA 3Q23A 2B7CB 2VG6A 4MYTA 3MMBB 3M8YA 3NGSA 3W61A 1HWJA 1D09B 4GKJJ 4LF6J 2W7PA 4ED5A 4X65J 4WK1A 2HPUA 2B4PA 1YDLA 5IZHA 2XSJA 4K4XA 2A0FB 1MU2B 2IBKA 3RGIA 1JLGA 5L9XA 3KXDA 5B0CA 1ZOTA 3CJKB 4ELUA 3VR1A 3KG4A 3QNWB 4OLPA 3QT7A 1JKHA 2MDAA 4Y28C 3SI8A 3FEYB 1NK8A 4WIQA 3K8WA 4X4TA 2GJFA 3O5TB 1FWPA 5KFVA 2K3KA 5LJ5Y 1YI2S 2HHSA 4OI3A 1HNVB 4YUDA 2HIYA 4ZVRB 3P4UB 1TMJA 1GMUA 1YWXA 1SKSA 1BQNA 1S6UA 3LQVA 1WEXA 1HQUA 2LLZA 2XNQA 5C42B 4V1Ak 3PYEA 1T03B 1HBOA 5G0RB 2BKOA 3NNHA 4CLLA 3BSNA 5J2NB 4X4RA 2BDPA 3LTOA 4GVBA 3AB2B 2Z2MA 5J1PA 3UN2A 4IO9Q 1WI6A 4DV3F 3I5BA 4OI6A 4DS5A 1RTDB 1VQ5S 5AE3A 1EETA 4X4UA 1NLKL 3M2VA 4J5OA 2DNKA 1QVGR 3N0VA 3CMQA 1IWAA 2V5HG 1WOOA 2CDRB 5DQHA 4WFYA 2IIHA 4DWIA 1PIEA 2IHR1 1N36F 4Y2IA 2BJ8A 3OSPA 2DVIA 2I6WA 2ROEA 2MSTA 2HZCA 1Y0HA 4X66F 3LOUA 1OY6A 2VA3A 4DPTA 5T14A 1S12A 1NDPA 1HNVA 2I0XA 3DRRA 4M5MA 3OBIA 3WIVA 5A8RA 2XEXA 2UUCF 4JI6J 3WIUA 2KRBA 1UZDA 7FD1A 2R7TA 2GHPA 1KWMA 4HLBA 5IT9Y 2WW8A 1HI0P 3MD1A 2MKJA 2LA4A 3HF5A 2IA0A 3FSYA 4MIAA 4QU6A 2F5GA 4P72A 4ILRA 3MXHP 2NYHA 3W2WB 2YKNB 1IBLJ 1RLDA 2JX2A 2IVYA 2AYEA 2FHMA 3KUHA 3TWZA 2DRBA 4LSNA 3KG0A 4Q7AA 2E5GA 3ZNJ1 1REGX 3AD8C 1M5PC 3TJAA 3JQKA 3PYFA 6FD1A 1EKSA 2F40A 4R8UA 2LQJA 4WWSA 1RZMA 4KPYA 5B0FA 1KLNA 3ZTSA 2BM0A 3CDEA 1KRPA 2JC0A 3NAHA 4J9SA 1NSKL 1M5OC 4K5SA 2LEAA 1WC5A 3N6LA 5LT5A 1SJQA 1MWZA 4Z2XA 1H2TZ 1RTJA 3G8SA 4A8FA 1U24A 4X64F 1RABB 2GIFA 5ETRA 2H1YA 2RJZA 5K8PA 2BE7D 2OSQA 4KGMA 1CEZA 2CQBA 1I3OB 3M8RA 5DQIA 1VMBA 1VYAA 4ED6A 1RAHB 4DSKA 3GMGA 5ETMA 3EM1A 2NXEA 1X9SA 3VCDA 3KLEA 2LU2A 1LWEA 1RWXB 1CBKA 4I0WA 3HVRA 3TYTA 2X1FA 3DDIA 4ED2A 5KFHA 4O23A 2WCXA 5K8OA 2VJUA 2AGOA 2FQQB 4DS4A 1Q8LA 3OHBA 1HYSB 1YK9A 2B5JB 1FFSB 4PG8A 4OFZA 4DR5J 1TELA 2VFRA 2HAFA 3C6UA 1U4BA 1QTMA 4C3LA 3H20A 4F0KA 2B7BB 4DX7A 4DPYA 3SXLA 3MM6A 3SIPB 1HMVB 3F41A 4UOFA 1U1NA 4W4MA 2RF2B 1OMSA 3CD6S 1V6HA 1RB0A 4DUYF 4ZCIA 4JYAF 1JNZB 4DQIA 4DG1B 4B9NA 4NYOA 1S97A 3HD2A 1HQEB 2OPRA 2JLGA 4CYUB 4DBQA 4TQRA 3KLIB 4RW6A 3ULHA 1BWEA 2PMZD 4CT8A 2GO9A 4Q2LA 1YBTA 1KHVA 4YHHF 2V4JA 3T1YF 2HK3A 4KHMA 4ZPWR 2CJYB 2DT9A 5IV3A 2L41A 1GTEA 4CI0B 4USKA 3PR4A 3EXYA 2BANA 4QWCA 4DV1J 1S0VA 3W8PA 5K14B 1SUQA 4B3SJ 1MWYA 4IKAA 4J90A 3I55S 4ZS6A 1CPZA 3CPWR 3BS9A 3R9LA 2EFOA 3M9OB 2I5JB 1VBZA 3L7PA 2LU1A 2J76E 2GIRA 4WK3A 4P71A 2CUYA 4HI2A 1SJ1A 3DCAA 4J9NA 1CVJA 2UP1A 2FZGB 5KFPA 1FEHA 3T1AA 4A8KA 1O0PA 3G6VA 2QA4S 3L9ZA 4ECSA 3I9ZA 1TV6A 1YBUA 5JVHQ 2F4VJ 3FMWA 4ZJQA 3M32B 1FXDA 5H9EJ 1U8SA 2XMWA 1HNWF 3QGHA 3LO3A 4C8KA 1RT7A 1C2PA 3JSMA 3RBZA 4K4VA 2HRUA 1DZ5A 1MWQA 2FDNA 3SCLE 2RMLA 4K4ZA 2JL9A 3G6XA 5I3UB 1SIZA 5D0EA 1GXTA 4F4WA 2UXCJ 2MZTA 3EPIA 2J7KA 3MEDA 2R4FA 4ANCA 3RZAA 4R5PB 3OTOJ 1SKUB 1L3TA 2ZH2A 3GSIA 1RKJA 2DBBA 2ACYA 3I32A 1TL7A 3VAMA 3V6JA 3C19A 4DR6F 2QTWA 4J9MA 4IOCQ 3CIMA 4Y0FA 3KLFB 2MZRA 5IS2A 1N0UA 1HD0A 3G87A 4CM0A 2AEJA 2AJ2A 5ETTA 1LXJA 5IT9U 1RP5A 1H73A 3QMQA 3SSQA 2OIHA 3VGUA 3MDFA 1XMQJ 1WHVA 4USVA 2LEPA 1S6QB 3VAFA 1C1BA 3QPIA 2RT3A 2DHXA 2CJBA 2N3OA 1YJ9S 2O67A 1UFLA 2BV3A 2VF3A 3D1HA 4U8YA 3OR2A 1M5HA 2YNFB 2PFDA 2R3VA 5B7WA 5IV4A 4XAKA 3L95X 3THTA 2R2SA 4LF7F 1TKTB 3KHRA 1VI7A 1VLYA 3GFZA 2JSXA 4N8OA 4C2MA 1NB2A 1SJRA 4WP3A 5EWGA 4XPCA 1PG5B 4JI8J 2DYAA 1GX6A 5KT5A 2Z57B 4ED7A 3EZOA 2BOPA 3TJ8A 1NBEB 1DTQA 1IKXB 4A8WA 5HL7Q 4X4QA 1FJEB 2CQDA 2JDJA 2N4DA 1F1BB 1BHNA 2XWXA 3CGIA 4JOUA 2IM2A 3LP0A 3OJUA 1YITS 3W5XA 3TO8A 2KZMA 3PYDA 1R27B 4NRUA 1EB0A 2BW2A 3MD3A 1U1LA 2CQ2A 3M6XA 4BC7A 2G2YA 2PMHA 1CJTA 2ROPA 2ZHOA 5D0HA 3ZXWA 3IO1A 3OQ2A 2DNLA 3OVBA 2RU3A 3D3CJ 5KOWA 3DYAB 3KJVB 4V19X 2EFQA 3LGMA 2XGPA 1WNEA 1JMTA 1DAXA 1TP7A 3UDLA 1WJ9A 1TUGB 3EMTA 3M6WA 5L8RC 2BKNA 3DNCA 3EGNA 5KG2A 2F8MA 1RYSA 1GH8A 1O6XA 2IC3A 3RTVA 5DLFA 1WC4A 2CQHA 2ADCA 2A10A 1FX4A 3AJDA 1S9FA 2C2DA 4IRCA 3CD5A 1EQ0A 2BX6A 1KONA 2I2YA 5T41A 1X5TA 3CDWA 4LQ3A 3EE3A 4N47A 2G9OA 4ZN1A 4U96A 3IS9B 5L9NA 3CB4A 1JWWA 5ETNA 3KLHA 5IM0B 2OO4A 1ZM9A 3PW4A 1B70B 1LWCB 3JTPA 3M8QA 3DMJB 3RU0A 5EX0A 3PEJA 1FKPB 2MKCA 3LP2A 4I2QB 2LMIA 1XEZA 1RWKB 3IP0A 4HL9A 2YTCA 4ZVSB 1B64A 4LFAJ 4NXNJ 1GMVA 4PABA 4Q0BA 5A6WA 2B3TB 2LFVA 1H2VZ 5I4MA 3K5NA 4GKJF 1ZPWX 4AXIA 4LF6F 2E29A 5JUMA 4KO0A 3JYTB 4X65F 3FQLA 1VQPS 4OV1A 3MFIA 5HJYA 3IR5B 5KFCA 2W8LA 2UUWA 3J81Y 4JV1A 4WTOB 2V8VA 2HLUA 4DUZJ 1G6BA 2ZUAA 4RL1A 1OPZA 4QJVA 3QIDA 3SSRA 2VONA 2XMKA 4NLWA 5A8KA 2D74B 2DHSA 1QSSA 4LT6A 1CJUB 4A47A 3HO1A 4LF8J 1S79A 3OT9A 3PO4A 2H5JB 1URNA 2ZZNA 1X60A 3QATA 1SPBP 4IG3A 5L46A 2M8DB 3OL9A 5J1NA 1GTHA 3VAGA 2H65B 3EUNA 4LF9J 3V6DA 2MSSA 4P6QA 4F26A 2LKZA 1N5YA 3NWGA 2UV8G 4ZIWA 3N6NA 3AOAA 1R0AA 4FF1A 1D8ZA 2QL5B 3EYZA 2CQ1A 3SV4A 3HMJG 4K50A 1F2GA 4U8VA 4C97A 1M0SA 3BR8A 2XY6A 3PW2A 1RU1A 4CH0S 2DGUA 2GV1A 2XCPA 1FKAF 2DRDA 4JI0J 2WW4A 1H2UX 2R7OA 3MM9A 1X4BA 4IDKB 2VBXA 2LYVA 2FLOA 2VC1A 1HNIB 3R7NB 5EWFA 3H0PA 3DGPA 5IC4B 4OV6A 4RO0A 2J0XA 3VF0B 2J7UA 3PX4A 4IQMA 4PG7A 1U6FA 4O4RA 4FP9A 5DM7Q 4M5DA 3TVZA 3P6YC 3KJQB 3OTDA 2ZZTA 3MHYA 4B9LA 4A4JA 2CZ9A 5K8NA 2AYGA 1JLEB 3MM5A 2FZCB 2UVVA 3C6TB 1YZ6A 3EDQB 3LAKA 2KM8B 4JB8B 1JLCA 1N6QA 3HHLB 4C11B 4JI6F 2PI5A 1LK7A 4J9OA 4NOHA 5SZTA 3TI0A 2KL8A 4E8UA 2GA7A 2ZD1B 4X4NA 2Y0BB 2GGPA 5AJ3J 2NREA 1F5CA 4QWDA 2I1RA 5LSRA 2Z2YB 1IBLF 4PXBA 3US5A 5F8GA 4X84A 1SH3A 3I56S 4FF2A 1LWXA 1T9XA 2OPPB 2ZJPQ 5HANA 4M8LA 4ED4A 1F5BA 4A8YA 1DQ9A 3ZZYA 2SXLA 1MNEA 1LW0A 3M8WA 1HIYA 1OY9A 2NZ4A 1KC8T 1VBYA 3B54A 1QY7A 1V3RA 2XHWA 1H7XA 5J2PB 3GIIA 2DNOA 2QT7A 2CIMA 3CJSA 3WHIA 2KDOA 1ZS6A 4I7FB 4F3QA 1TR0A 2HVIA 1XERA 4FKXA 3OUYB 3RW6A 2CQCA 2AU0A 2MQMA 4LR7A 2FVQA 3NCQA 3R3TA 4IH7A 4P2FA 2MJUA 2ZFHA 5IFMA 4X4VA 2KJWA 2DXFA 4EYHB 2HHTA 3K17A 4RW9B 2C3MA 3CULA 1ZH5A 3R1HA 3HK2A 2HVEA 4NCGA 3NXZA 2YX7A 1V5VA 2R8IA 2OPSA 1MSWD 4DQSA 3ZTRA 3PO5A 4RW7A 2M88A 1C0TB 3TX8A 3R97A 4HH0A 3KDNA 2MLXA 4I56A 2LA6A 4ERDA 1QM9A 4RNHA 2OTLS 3PHEA 3U02A 5AXLA 4RW4B 2VBWA 3DDNA 2G13A 1RT5B 2ZBQA 4DR5F 2M8HA 2MLYA 5KT3A 5I3QA 2J9DA 3AOBA 2AYMA 3ZZTA 4YR2A 1KQKA 3V4IB 1KP6A 3DLJA 3RR8A 1QAJA 3L4BC 4WFBQ 4HACB 3MFHA 2QA4G 3I5AA 2JLEA 4MKAA 2F65A 1RQ0A 1QSLA 1RTIB 2D69A 4OI4A 2RNEA 3M6UA 2N82B 3KUEA 1IWGA 4C0BA 3PFEA 2ZH4A 1J5EJ 2QFJA 3CNQP 2ZNYA 3B4DA 3IGVA 2E7XA 4QW9A 1NXIA 2FLNA 1RCXB 4NLRA 5B08A 3SZ2A 2JEFA 3QYYA 4U7UK 2YWKA 4QW8A 2MY7A 2OD6A 4F2SA 1Q8KA 2HVZA 2U1AA 3HKZD 2KI2A 3UDVA 4M5GA 3MOJB 2V67A 3BGFA 3BSOA 3M8ZA 1PC4A 2VL1A 3NGDA 2E7WA 4DV1F 4F7VA 4BCAA 2ZBCA 5BYRA 3UWTA 4F3MA 1DQAA 4H4OB 4B3SF 2WB1D 5GAGI 3GP9A 1WACA 3FJ2A 1EARA 2PC6A 4HDGA 2NYIA 4M94A 4YN3B 4KIAA 2X51A 3FCWA 2MQQA 2OJ3A 5U47A 3V81A 2KU7A 2IA6A 2BJDA 1O5JA 2IJNA 3KYLA 2QLXA 5G4DA 2FZKB 4P10A 3EPGA 3W2VA 1HL6A 3NEKA 1UEKA 3UDCA 1U26A 4M1KA 4NLVA 4EU0A 1KSPA 2PEHA 2ATLA 2GNKA 4DZDA 1DFDA 2J0QD 5CYMB 1P6TA 4X62J 1YG0A 2G2OA 4HKQA 1H6KX 4KBIA 4DEZA 3KWMA 1JK9B 2DGXA 3X3UA 5KFTA 5LSLA 4MAKA 4C8NA 2HFNA 3I87A 4YB5A 2M3DA 3EZ5A 4ZPCA 1IUJA 4B9MA 5LJ3Y 1UA1A 4B3OA 3B8HA 1NEEA 2UXCF 3N28A 2AJ4A 3OTOF 2H4YB 2Q6BA 4QPTA 3J7AN 4FDFA 3R2DJ 4QYRA 2HWHA 1RDRA 2UUBJ 2EFGA 5H9EK 1WSVA 1HW9A 1S1XB 5KFXA 1D8YA 3MTKA 3IRWP 4ZLNA 4OJ3A 1UPPA 2AJQA 5HVFA 2ADBA 2UXBJ 2A6OA 2BJ9A 2KRRA 3NRBA 4WFAQ 1WKKA 2DGVA 1YRUA 1YTYA 4IFVA 2MQOA 3IMQJ 3W9IA 1XMQF 1VGYA 2Q43A 4NZ6A 3EZUA 1XMBA 2RIJA 3Q8RB 4RUHA 2R2RA 1FVQA 3FSXA 4ZVTB 1FK9A 4IFYB 1R0CB 4QWBA 1T05B 3ILIA 4DSFA 5B0DA 1W2IA 3TAQA 5IWAJ 2QMWA 3W64A 3JTNA 2MEWA 2BE9B 4LSLA 2FJAB 3PY8A 4J9VA 4UY8T 3QRRA 4EBDA 2VV5A 4N7TA 3S8SA 3HHKA 4YEAA 4RNNA 4DQRA 3JSBA 4CO0A 1VRTB 1UPMB 2XMVA 3GILA 2R7QA 3G82B 4OYBA 4JI8F 3ETOA 3HZGA 3VAIA 5KOXA 2KG0A 2GMLA 5JJBA 3DRPB 2L9DA 1WHXA 2QL9B 5KFZA 2C3UA 3CDUA 3VVUA 4ZVOB 4LIRA 4PQAA 5CAAA 1RLCL 2HQCA 2VB6A 4GKKJ 4O4GA 4Y3CA 2B4VA 5AXKA 3NOGA 1VOMA 2PA3A 3KKFA 1Y5IB 4A48A 2DH9A 2RE1A 1H0HB 3PACA 2WHOA 2LECA 1XR7A 4YR3A 1DLOA 1VR6A 4USMA 1IKYA 4NXMJ 2FB0A 2WVCA 3LF0A 1AW0A 3NBPA 1T7PA 2HHPA 1WOSA 1X5PA 4J37A 3B6BA 2YQ3A 2FVCA 3K57A 3IR6B 1WF0A 4WU3A 4CLPA 3I0RA 2DEIA 1N5QA 3G82A 2CZVC 3LPEA 2GX8A 2EKYA 1QE1A 3DRSA 3L7UA 4ZP7A 1R8CA 3J7A1 3DRPA 2NQPA 3W8GA 3O2IA 5IXUA 1Z1ZA 1X31C 1U2CA 2BMBA 4UY85 4KJIA 2FVPA 4MT1A 2D9PA 1TK5A 2PT0A 1CS4B 2P8IA 5F3ZA 4P7VA 2AMCB 1M5SA 5L38A 2GW8A 1OQ6A 2ZOMA 3TUPA 2VD3A 2YNGA 3QZ7A 4OI0A 4CTAB 4QIWD 3SDEA 1YKWA 2M52A 1VFJA 5MAOA 3Q22A 3A8KA 1NSAA 1HPZB 5HMYA 3N4WA 4PQUB 3EVOA 1Q86T 3KK1A 4LFAF 1Q16B 3K0JA 4OYWA 3OV7A 4NXNF 3BBFA 1R8AA 1BLUA 2EC0A 1SL1A 2F1FA 1DTTB 3GU0A 2V2KA 1JLQA 1I94J 2D9OA 3CXCR 3ENWA 1RT6A 2RB7A 4H54A 4XPEA 5KFRA 5C25A 2VJVA 2RHSB 3DI6A 1JXLA 2H5IB 1JLFA 1NUEA 4LRAA 2ZH5A 2MZSA 4RNMA 2EPIA 2VG7A 2IM1A 2N7YA 3H5UA 1K9MT 3QIPB 4B9UA 4ER8A 4DUZF 1CS4A 4GMKA 5L39A 2P2CB 4KKOA 1D9AA 4IOBA 2FVSA 4J91A 3UN5A 1VC6A 4DX5A 3BH6B 4EYIB 3GV8B 4ZVEA 3MEGB 4PWDA 2W7AA 1QUVA 3UVJB 1OSDA 4LF9F 4K0KJ 2WAQD 3AHPA 2GVDA 4I2PA 1AFIA 2E9ZA 2PMWA 4B3RF 3MZIA 1NU4A 1XNQJ 2AJ0A 1YSJA 4CLFA 2O3DA 2XLIA 3U7JA 3MPDA 1NJXA 4ZPAA 3DLGB 1JLBB 5EX3A 3I31A 4L72B 3CJ2A 1SC3B 2EI5A 1IR2A 5E3PA 3SCIE 1RT2A 3AB4B 2V69A 2CPFA 1SV5A 4JI0F 4OYIA 2Y1RI 2DXDA 1F6TA 3O6QA 1S1VB 1YGYA 3JTOA 2J0SD 5KFLA 1W7WA 3OW2R 3MR3A 2HBRB 1FFGB 2YWFA 5J2QB 3M30B 1L3UA 5KT6A 1RT1B 3MM8A 4AD6A 3TOQA 5GAEI 2B6AA 1Y00A 1JNRB 1FERA 1RBAA 3GJSB 2MZJA 1VJWA 4J7CA 3PX6A 4LBHA 1Q95G 2CQIA 1U0HB 2WVFA 2L48A 3HVTB 1RT4B 3Q2TC 5F0WA 1LKZA 3D66A 1ZZNA 4WJBA 1FRKA 2IMWP 2Y1JA 1WG1A 2CXEA 2RQKA 3DHXA 2MGZB 5J2MB 2M4MA 2WK4A 3V6KA 2J6UA 3CJ3A 5H9FJ 5FLXY 3PVXA 3E01B 2IJRA 2KXNB 1U2RA 1CJKA 3QGGA 1S7HA 1KQGB 4M5LA 5AJ3F 1SQGA 3H4BA 3MPUB 4MFBB 1G1XA 1U25A 3BV8A 2V2ZA 4LRFA 1X4EA 3BGRA 3TA1A 1YJ7A 2B0GA 5KFEA 3IA0A 1NZAA 3ICLA 4NI2A 1SH2A 1UVKA 1MLAA 3D7SB 3QSYB 4QWEA 3BO4A 4ECVA 4PRFA 4AT1B 3K5PA 2LDIA 4ZVHA 3RR7A 1FTRA 2MJNA 2KJVA 1YJWS 4ZVUB 2XYGB 1VRUA 2HNDB 3M1VB 4PPDA 3D4JA 1YX2A 5DGAA 5E3AA 1KQFB 1R31A 4Q8EA 5KFSA 2KM8C 4A8MP 3KNGA 2VFTA 1VQKS 1CULA 3HHLC 4A8OA 2GHVC 4DV7J 1R0BG 4NYPA 2JNJA 1YJNS 1NAQA 2AZ1A 2UUAJ 5KAKA 2KFYA 2GVZB 1FE4A 2B9EA 3BREA 4B9TA 2DNGA 2WONB 3M2RA 3MPVA 2ZH7A 1Q8IA 4C9DA 1A6LA 1N8RT 4ZPTR 3E51A 1KHWA 1S6PB 2MKSA 1D1UA 1ACMB 3DLKA 3RAMA 3M2UA 3SQGA 3QJJA 4ZVQB 5D3GA 2JLFA 4OJGA 1SH0A 4DFJA 1VQ7S 1ZAVA 3J80Y 2A2CA 4DZ6A 2W7OA 3UCGA 1BC6A 2ASJA 2HNZA 3H42A 4K8RA 2C2RA 1T9YA 3M1VA 2XYHB 5AXNA 3EWGA 5CYQA 1WHWA 2FC9A 2VODA 5DDPC 3ITHA 3TRGA 4K5RA 1O51A 2XULA 2YX1A 2HWTA 1KVJA 2BZ2A 3W5ZA 1WI8A 1LV5A 1J5EF 1FHTA 1R8HA 1QJHA 4DX8H 5DQGA 5F9NA 3KG1A 3CD7A 1ZAXA 4B3TJ 3DGVA 4DL7A 3O44A 4ES3A 3V4MA 4FYXB 3KMQA 4N41A 1JJCB 4FYVB 2BJ1A 2AT1B 3CCUS 5KFUA 2HHHJ 2RSQA 2YKPA 6AT1B 4ZKAA 4K4UA 2QYCA 2KXFA 3VAJA 2MYFA 5CZXA 4W92B 3A8EA 3OTBA 5KFWA 1RT3B 4DFPA 2BACA 3BDEA 1JLAB 2W9BA 2JOQA 1BQMA 3L7OA 4NEZA 3ZNUA 4EK2A 4KV8A 3OLBA 2PIIA 2LXIA 4ZCMA 4DL6A 1HWIA 4N76A 3MEEA 5H1SV 3KJNB 5HROB 2ILZA 2B9WA 3O1LA 4U6PA 4M5JA 3IG1B 5KG5A 1LFWA 1HHTP 1Q0NA 4P9SA 3LUYA 5BYSA 1T3OA 3GR1A 4LRCA 5LM7E 5KFFA 2CG4A 2QV6A 4RLEA 1GXLA 2LCWA 5LSOA 2A2DA 3BBBA 4V19J 1GAOA 5LMUJ 2EVZA 1L3SA 3KUGA 1HHQA 2W01A 1FO1A 2MKYA 2CPZA 2AHOB 2Q1LA 1REVB 2DIVA 2F7VA 2G0JA 1Q53A 1S9GB 2DD8S 1HBNA 1FX2A 4ZN3A 2PE8A 5M2UA 4Y2CA 1QVFR 1AT1B 3BGUA 1JB0C 5KG1A 1RADB 3UQSA 2OEJA 3QWPA 4I1TA 1UW9A 3BN4A 2UUBF 4RBVA 4H4MB 4LRBA 3MPWA 3SV3A 2RQ4A 1OJ4A 2UXBF 3QGPA 2FY8A 2V50A 5FLXU 3MMCB 4LQ9A 2KZZA 2GCFA 4KHRA 4GRSA 2YWHA 4OX9J 2FVRA 1XWLA 3N6MA 1LWFA 1SC6A 1S5ZA 3HJFA 3QO9B 3C14B 4N5SA 4HHHA 4OMFG 1OPIA 4USIA 2V4RA 3WX8A 1NHUA 2R9LA 2DR7A 1IKWB 1G3OA 4OJ1A 3IN5A 5FIIA 3D0GE 4URSA 5E3RA 1ULRA 4AUKA 3BN7A 1PYOB 3QLHB 1UL3A 2RAQA 2WVDA 5C7PA 3K8VA 5HLFB 3RB6A 3NLCA 3ZO7A 2DGOA 4M5IA 1S9EB 2WSCC 1VRQC 3CUNA 3RJMB 3AH6A 4IR9A 2OGUA 2VFSA 2DITA 3DXSX 4EZ9A 3H8YA 4TU8A 4H4MA 3A8JA 5KFIA 4XTTA 1PKUA 3OHAA 1R43A 3DXBA 2ZE2B 3FEXB 2N4CA 1RUSA 3D0IE 3VQTA 1ZBTA 1MROA 1UVMA 5D6GA 3H5YA 1S1TA 2NR0A 4YMEA 1UCNA 3DLEB 6FDRA 3T9NA 1KN6A 1K1QA 1ZETA 4GKKF 4WU2A 3UN3A 2X7IA 3BPDA 4E2FB 1FJ7A 3OLAA 1WG4A 4NLTA 4O0IA 3T5LA 1U2FA 4NXMF 3O8WA 2MB0B 4JI2J 3GV5B 2XQCA 1IKVB 1M90T 2B8PA 5A8WB 2MLZA 3I9V9 3TZWA 3W66A 3H5XA 1X8DA 2MKIA 4L75A 2C2KB 3CMAS 1RU2A 2GMJA 2OHDA 2BE2A 2V8PA 3DOKA 2FC8A 2YVSA 4P2XA 1T94A 4YOEA 1KVKA 3EGWB 1NKEA 3RRGA 2QO3A 5HI7A 3OJSA 2XLKA 2ZVIA 2XI2A 3DM2B 2FIUA 2E44A 1TVRA 1BY9A 4DFKA 3B82A 4CT9A 1XIQA 1JJHA 1YZ7A 2R42A 4KYZA 4PYAA 4UQGA 1FKOA 1UEUA 3EICA 1UA0A 4DHVA 3CCWA 4C8OA 3KNAA 2XMUA 2D3O1 3VZIA 2LQ5A 3THPA 1SB6A 1NK4A 3FVYA 3ADAC 3UPFA 4YB6A 3W9HA 2HVDA 2Y0SD 4O44A 4FS2A 4IRDA 2LQ9A 3M8PA 2G1HA 3T41A 2W1BA 2DCLA 3BSAA 4A8SA 3R5CA 4F25A 4ZP9A 3ET6B 1WF2A 4ENOA 4LR8A 2JEJA 2D3UA 1ITPA 4TYAA 1HBMB 4MMOA 1RAJA 2FTRA 3UI3A 1XC9A 3POTA 4YS2A 2HQ3A 4LF2A 2RRAA 4ID5A 3EVMA 4O0NA 1C0UA 2Z2ZA 4OX7A 2XHCA 4UT4A 2A18A 1F9EB 1S1UA 3NS5A 2Z8QA 5GAHU 1NJZA 3MM7A 2KT3A 3FCVA 1U47A 3JAMY 3CE8A 2QIFA 4ECQA 2E1MC 1RWUA 3UR3C 1FXLA 1T95A 3E2EA 1S0MA 1TL3B 1Y4ZB 4LF1A 4B3MJ 2EKNA 4LF4J 4CLUA 1GFWB 3N9UC 3QSIA 4NLPA 4DR3J 2GAGC 4O3SA 4DR1J 4K0KF 1SKWA 1YBAA 4DSEA 5T7LB 3MGJA 1LEOA 5SUHA 1AZSA 1RHKB 4KFBA 1XNQF 4DX6A 5FDLA 1X4DA 3BKUA 3I0SA 3KLGA 2DR8A 5A0YA 2DY9A 1WC3A 1HKAA 2QRRA 1V5IB 1ZAWA 2V9KA 4NLXA 4JV5J 1VIXA 1FRMA 5K8MA 1QD1A 2XZWA 4WZQA 4EUVA 2RD5C 2DNRA 4ZPBA 4CM2A 1QAXA 2JEGA 3LP1B 2YKMB 4OX8A 4O3PA 5J1EB 4LMZA 2AP6A 2NSBA 2OPQB 1HBUA 2K1RB 1J5OA 2QC3A 3R2CJ 1S76D 3PCOB 5I3PA 1FJCA 3CCMS 2FGOA 4YP3A 3DHWC 1VBKA 2KXHA 4E98A 2CFXA 5KFBA 3KK3B 1H98A 4QOTA 4TY8B 4I67A 1CJVB 1RAGB 2DJWA 1S7IA 1VQ8S 1B0VA 3HX9A 4ZHRB 4ZLLA 3OVSA 3CJRA 4I64A 3NNCA 1UWBA 1S0NA 1GNKA 5HSPA 1D0EA 2KT2A 1T9VA 1JX4A 4QPXA 1FNMA 5I42B 3MMBA 4OHWA 3CF5Q 1PBAA 3FQKA 4RW8B 2HS3A 3KFWX 3OL7A 2Q79A 4USHA 3FC9A 3H40A 4FPIA 3G71S 3HVWA 1TL1B 2W4PA 2CQ3A 1X5OA 3ZZUA 4IG0B 1MU2A 2E5HA
chains in the Genus database with same CATH topology
3HP6A 1T02A 5AXLA 4RW4B 1KLMA 4TXSA 2BRLA 2D3ZA 1X4FA 3NGKA 4YB1P 2VBWA 3DDNA 4L6V3 2XO7A 2DHGA 3OR1A 4TU7A 2NUUG 2G13A 4J9PA 1AROP 1VQLS 2HHUA 1RT5B 2OPQA 3CJKA 1CSJA 5KT4A 4FBUA 5D77A 2IC3B 2K1RA 4AXJA 2PD1A 4DR5F 2DB1A 2M8HA 1GT8A 4BC9A 5KT3A 5I3QA 4G1QA 4I6WA 1Y5LB 4WCEQ 4K4SA 2IM0A 2J9DA 3CT9A 3PW5A 1N34F 2FHJA 2HG4A 2AYMA 3DDKA 3KK2A 1LK5A 3ZZTA 4DN0A 4YR2A 2DPIA 3PEHA 1KQKA 3V4IB 3RR8A 3DLJA 3I82A 3TANA 1QAJA 1Q4RA 4P7TA 1A9NB 4WFBQ 1T8EA 2Z0GA 3TAPA 1DRZA 2FJWA 1U6BA 3IXQA 2M5YA 2JVOA 3MFHA 2ZZMA 1XN9A 2QA4G 3WC2A 2RU9A 3LAMA 4DJBA 4E0DA 3I5AA 2JLEA 5AE2A 2QZ8A 3IAM9 4MKAA 4XDDA 2AJ1A 4M63A 1KOOA 1MMDA 3VQSA 3FFIA 3KLHB 2DPJA 1RQ0A 4OHYA 1QSLA 1GX5A 2ZJQQ 1FT8A 3GIKA 4LF8F 1MROB 1RTIB 2HFOA 1NJIT 4OI4A 3M8QB 2RNEA 4CO1A 3M6UA 1S1TB 2ZUGA 2RQCA 3Q2SC 4CTAA 2ROGA 3FSIA 2N82B 4DLGA 4C0BA 2ZH4A 3PFEA 1KQSR 2ZITA 4ECUA 1MMLA 3B4MA 2QFJA 4EBEA 1X4CA 3P5TL 2ZNYA 3B4DA 2X1AA 3LP2B 2ZH9A 2AWZA 4PG4A 5C42A 3RRHA 3GYNA 1T03A 3IGVA 2E7XA 2PFFB 2DK2A 5G0RA 3V5RA 3MUMP 3ENVA 3TW0A 4F50A 3T6BA 3HPOA 4QW9A 4NA3A 1HPZA 3RB0A 4HHJA 3PW7A 2FLNA 5M2RA 2OFHX 4NLRA 5KFQA 2C2EA 2JFDA 4J9QA 3BO2A 5J2NA 2U2FA 3I6PA 2APOA 4PQUA 3CCSS 5B08A 4OI1A 3DC2A 4OHVA 4ZLPA 4Q0BB 3SZ2A 2JEFA 2HWIA 5L1KA 3QYYA 2MQNA 4DV7F 4U7UK 3H5SA 2VG5A 4IO1A 1DTTA 3PIPQ 5C24A 4K4YA 2ZH6A 4DR2F 3IWLA 2YWKA 4WE1B 2O01C 4QW8A 2MY7A 2FJXA 2JJ4D 1BQXA 2OD6A 4OLOA 3U27A 2R7VA 4AL6A 2UUAF 1SI9A 4KO0B 4F2SA 4JV2A 2R2UA 2HVZA 1ELOA 2U1AA 3CCVS 3HKZD 4ES2A 2KI2A 1KFDA 2XLJA 4KSEB 1RTDA 3MOJB 3T6JA 5IT0A 3RAQA 2HMIA 3BGFA 4M95A 4CO4A 3BSOA 1PC4A 2VL1A 3NGDA 2E7WA 4BWMA 3MECB 3QJPA 4DV1F 2IAJB 2BE2B 3DU6A 2IVFB 5GAEU 3BM7A 2JHEA 4BCAA 2ZBCA 3DOKB 5BYRA 2FLLA 3UWTA 2B9YA 4OZ5A 4F3MA 3VTIA 1DQAA 4H4OB 4B3SF 2CJAA 2CJKA 2WB1D 5GAGI 4I6AA 1WACA 3FJ2A 3QIPA 3MWBA 2PC6A 4HDGA 4C3KA 3ISNC 2NYIA 4M94A 2E1AA 4KIAA 2ZDOA 3I96A 2VPXB 4DL4A 2X51A 1W25A 4JI3F 5A8KB 4UUXA 2XS7A 2MQQA 2OJ3A 3RW7A 5U47A 2XC9A 3V81A 2KU7A 2IA6A 1R8BA 2IVMA 2BJDA 2KH9A 1O5JA 5E2QA 2IJNA 1Y5NB 1TVRB 4CO2A 1XK8A 4J9RA 3KYLA 4ED3A 1M1KT 2EK1A 2QLXA 4IG3B 2VOOA 1RA7A 2F8EX 1YIJS 2EG2A 2ABYA 2HNYA 3I5CA 4ZOSA 3MEGA 4HH1A 5G4DA 1UVNA 2IYGA 3EPGA 3W2VA 2YNIB 1HL6A 3VAKA 3JSRA 3UDCA 1U26A 4Y34A 3HLUA 4QQBA 3TAMA 3V6DB 4KC5A 5CCMA 3OTCA 4M1KA 5HBMA 4NLVA 4EU0A 4QYZJ 1AFJA 4ZMMA 5KG7A 2FHJD 5ITHA 1KSPA 2ALZA 3GSDA 4URGA 1FKOB 1N5YB 2PEHA 5DJBA 3IGNA 2ATLA 2GNKA 4YFUA 1Y3JA 2XY5A 3CCQS 1DFDA 2J0QD 5CYMB 4ECZA 1E6VA 2PO4A 4WXWA 4NX9A 5D4OA 1P6TA 1UP1A 4RWWA 2QSWA 3D2WA 3HT3A 2NUHA 1R0AB 1M5KC 1YG0A 2HGMA 3W2WA 4N56A 2YKNA 4NLGA 1HARA 4HKQA 2E1CA 1H6KX 1EP4B 2DO0A 4KBIA 3U1MA 4WYWA 1XTZA 3RB4A 4DEZA 1WG5A 4O44B 4OZ1A 3KWMA 3DLGA 4KT0C 2IRYA 2JZ5A 1JK9B 1JLBA 1H3DA 3M8PB 4NLYA 2DGXA 3X3UA 1NK0A 2CPDA 3DU5A 5KFTA 5LSLA 2W4CA 4TU9A 3UD3P 4MAKA 4O3NA 3TUIC 4KE5A 1KNZA 4OIXA 4C8NA 1G2EA 2HFNA 4NRTA 2A1BA 3I87A 2M3DA 4YB5A 4WXOA 4W90B 2RDJA 4DV0F 3OFFA 2WRMA 3EZ5A 4DSJA 4B3TF 2J6SA 4ZPCA 1IUJA 4B9MA 2KN4A 5HQ8A 2ZDPA 3L09A 2PI4A 5LJ3Y 4KGKA 3CD0A 1UA1A 1D3WA 3MM9B 3MPYA 4KAIA 4QR2A 1NH8A 4Q8FA 4B3OA 3B8HA 3MTJA 2GIQA 1S1VA 2CQGA 1NEEA 2UXCF 4RUAA 2IRXA 4WKYA 3L3CA 4JI7F 2LXFA 2RS8A 3WDOA 2WSEC 3IRXA 4LF5F 2RKIA 3N28A 3POTB 5HP1B 3HM9A 2AJ4A 2HHHF 2VA2A 3OTOF 5F9LA 4ID5B 4PG6A 2BQUA 2B51A 2Q6BA 3M30A 5J2QA 1IQTA 1FESA 4QPTA 2YNHA 2YH1A 2CZ4A 3QGIA 4M5DB 1KTQA 1B0TA 1RT1A 3MAQA 1YVFA 4QYRA 1W2BR 4DR4F 5FJ4A 2FJVA 1C0UB 2HWHA 4ZVGA 1RDRA 2YKQA 3GG0A 3QWUA 4C8MA 2EFGA 5KFGA 3LW5C 4TLRA 4FS1A 2FJDB 1UKUA 1HW9A 1S1XB 5KFXA 1S1UB 1V3ZA 5AE1A 1D8YA 3P49B 2PGCA 2DNZA 3MTKA 4R25A 3IRWP 3ONQA 4OJ3A 3BR9A 2AJQA 2XB2D 3PDNA 2ADBA 3MM7B 4RNFA 3MUVP 2KRRA 3PV8A 3NRBA 1HHSA 2E66A 4WFAQ 4C8LA 4ZCLA 1UAWA 3MM5B 3HVTA 1RT4A 2X1BA 4WFXA 4ELVA 1ZM3A 1UW4A 2DGVA 2XSFA 1YRUA 1Y7PA 4IFVA 4OZLA 4Y00A 1YTYA 1L5UA 4C0HA 3PIOQ 2UVRA 4DOZA 2NS1B 3ZC4A 2P9EA 2MQOA 1VQYA 2OMLA 1CC7A 5GMKa 4I69A 3NMRA 1XMQF 2KTQA 1VGYA 1JLCB 2DGTA 2Q43A 1X4GA 4NZ6A 1YQHA 1N6QB 2DR5A 2FLPA 3D54A 4AE5A 1U1KA 3EZUA 2MGZA 4FXDA 5J2MA 1Q7YT 3R27A 1N5SA 1XMBA 5KG4A 5FD1A 1VQNS 2RIJA 3Q8RB 4RUHA 3EXCX 4Q44A 2HVHA 2I8EA 4MIBA 3R1LA 2R2RA 4EBCA 1UJ4A 2O5DA 3T9ZA 1FJGF 2GQ2A 1FVQA 5HMWA 3FSXA 3E01A 4LFBF 1N5TA 1FK9A 2GO8A 3QZ8A 2FJEB 5JVGQ 4B02A 1YHQS 3NNAA 4IFYB 2GGPB 5DDRC 1UVLA 2KYXA 2N7CA 2NXUA 4QWBA 1T05B 4N77A 4GC7A 4USJC 4RNOA 4DSFA 5B0DA 2K7JA 1W2IA 4RUCA 2VQEF 3TAQA 5CD4H 4PXCA 2EK6A 2MXYA 2DO4A 1Z2ZA 3FGVA 3U1LA 2QMWA 1P8GA 4KFBB 3JTNA 1E6YB 5FDLB 1N0VC 4MFBA 2W9CA 4LSLA 2FJAB 4J9LA 3I0SB 4BHQA 1U09A 4OHXA 2Z2LA 3WC0A 3PY8A 4WFNQ 3HXMA 4ZVFA 2EBEA 2QLWA 4AYBD 3KLGB 4BS2A 4UY8T 1IQZA 2DNMA 1HYSA 2M0GB 2BYCA 2DNHA 5CQGA 1Z2LA 3OPKA 4DSLA 1VK3A