2GX8A

The crystal structure of bacillus cereus protein related to nif3
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
370
structure length
359
Chain Sequence
IPNGHEIISLFESMYPKHLAMEGDKIGLQIGALNKPVRHVLIALDVTEEVVDEAIQLGANVIIAHHPLIFNPLKAIHTDKAYGKIIEKCIKNDIAIYAAHTNVDVAKGGVNDLLAEALGLQNTEVLAPTYAEEMKKVVVFVPVTHAEEVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLERVEEVRIETIIPASLQRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQEEMTLGQFAEHVKQSLDVKGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGHNVEKVMKQGVQKQLQEKVDAKKLNVHIHASQLHTDPFIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords NIF3-related protein
publication title The 2.2 A resolution crystal structure of Bacillus cereus Nif3-family protein YqfO reveals a conserved dimetal-binding motif and a regulatory domain
pubmed doi rcsb
source organism Bacillus cereus
total genus 105
structure length 359
sequence length 370
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01784 NIF3 NIF3 (NGG1p interacting factor 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gx8A02
2O67A 4YB5A 3GSDA 4AFFA 4E98A 1VHFA 4YB7A 4CO1A 4OZJA 4RLEA 2JJ4D 3N5BA 2RD5C 1UL3A 1V3RA 1H3DA 4RWXA 1P1LA 2XG8A 3NCPA 3NCQA 2O66A 2J9DE 3LF0A 5D4NA 3AH6A 5L9NA 4NYOA 3CE8A 1NH7A 4RWWA 2EG2A 1J2VA 4RX6A 1O51A 4USHA 5DS7A 2GNKA 3T9ZA 3O5TB 1PILA 2J9DA 1XK8A 4C3LA 4CO4A 2VD3A 3O8WA 4CO5A 1KR4A 2V5HG 1UFLA 2J9EA 3TA2A 1QY7A 3NCRA 1V9OA 4CNYA 1Q1KA 2J9CA 4WK1A 2NUHA 1NZAA 2GW8A 3M05A 2Z0GA 4USJC 2PIIA 2EG1A 3AA9A 1VFJA 2GX8A 1UMJA 2NUUG 4Y6IA 1OSCA 1HWUA 4ZK7M 1V6HA 4NYPA 4USIA 5D4PA 4C3MA 2NS1B 3OPKA 2E66A 2DCLA 1GNKA 1NH8A 2CZ4A 4CO0A 4CO2A 2ZFHA 1O5JA 3HLUA 2ZOMA 3X3UA 1NAQA 4CO3A 1V3SA 2XBPA 3AHPA 4OZNA 2XULA 4R25A 3TA0A 3L7PA 4D3HA 4OZLA 2XZWA 3MHYA 4IYQA 4Y65A 5DRKA 4WK3A 3BZQA 4CNZA 3DFEA 3TA1A 3AA8A 1UKUA 5D4LA 5D4OA 4D3GA 4C3KA 4YB6A
chains in the Genus database with same CATH superfamily
4KY3A 2FY8A 3JS9A 4N47A 2IM1A 5E2QA 1QAIA 2KZMA 1EIYB 1ZA1B 1RZMA 4FVMA 3CCVS 2DD8S 2Z2YB 4KSEB 3PDNA 5KFDA 4OIXA 1CS4B 3GWCA 3BBFA 4LF7J 1B70B 3OSPA 1DTQA 2JFKA 4C8OA 1V5IB 1EZZB 2D41A 3RB6A 2D7SA 2OMLA 4ELTA 2FLPA 2PMWA 4ZPVR 2RQCA 1VGYA 2XCPA 2LEBA 1N36F 1HL6A 3L7OA 3EDRB 2UUBJ 1KOHA 1YJ7A 3W2VB 2DRBA 2RF2A 2BA9A 1XMOF 1QUVA 1TV6B 4CT8A 2BE9B 5J2QB 1VC6A 2HURA 4KKOB 1FI4A 4ECSA 1HMVA 4ETXA 3MGJA 2JLGA 3OFFA 2NQPA 3C6UB 2QIFA 2Q6CA 3K8VA 1K47A 2J5AA 5AT1B 3A8KA 1P9QC 2DHSA 3QYYA 2LEPA 3UWTA 4P6QA 4H4OA 3KLFB 3VVUA 3ZZOA 3JSMA 3EX7B 1HNIA 3ZZ0A 3CW2C 3K0JA 1TKXA 2UV8G 3KMQA 4EO6A 4FXWA 4LVOP 3NCQA 2PD1A 2NZCA 1JQGA 4RL1A 2YKPA 2QC3A 3BV8A 4KHMA 2OI2A 4C6AA 4OX9J 4ICLA 2OEJA 2EG2A 4OFZA 1WDTA 5SUHA 3GSIA 4C0OC 1AW0A 2B3TB 1Q78A 4LT6A 4GRSA 5A8RA 5JUMA 2XY7A 2NYIA 3R9LA 3MFHA 2JH3A 1M5SA 3BR9A 2VU5A 4GVBA 3D3BJ 3IWXA 4IO9Q 1VFJA 3EUNA 4BDPA 1ZTWA 3H5XA 1RADB 1YJRA 1NH8A 4Z2XA 2CNKB 2CUYA 4DL0C 1BQNA 2AJ4A 5GAHU 5EX3A 1Q8KA 3H59A 3KJQB 3HX9A 2X3DA 5CZXA 9ATCB 3L3CA 5LOQA 4QU7A 4FNIA 1D9FA 1S0MA 1QUPA 2UUBF 3FDSA 4RU9A 2ZH7A 4OHWA 3DI6B 4H4KC 1RP5A 5E7OB 2DGWA 1SBRA 2VPWB 5D15A 3OTCA 2BKPA 1RTZA 3LW5C 2QA2A 2QV6A 1SC6A 2UVUA 1JLQB 2OUGA 4IG3B 2ZITA 2QA4G 2M5YA 4HTIA 2DXFA 3NY0A 2NXNA 4K4SA 3Q89A 2C1EB 2BKNA 2FJAB 2FLLA 4KV8B 4MKVA 1QSYA 2P6SA 2HEKA 3R7BB 5DLGA 3DRPA 2WW4A 3FBFA 3IR7B 4WXOA 3DGPB 4RZRA 3NG8A 3VGUA 3BO2A 2DTJA 2V8PA 3C14B 1U1MA 5ETQA 4LR8A 2YWWA 1FTCA 5KFBA 2XB2D 2ZBCA 4CO3A 1LEOA 1FRIA 1VQLS 4OX9F 3BSNA 4ES2A 1WKJA 5D4LA 4K5SA 4F67A 4LIRA 4DPTA 2HQ3A 3MM9A 3NGUA 1F3VA 3Q86A 4MTPA 4X4QA 1VHIA 2GHVC 4MT1A 2DR5A 3T6BA 5KG4A 2YVSA 2GCFA 2OPPB 2HHUA 4HL9A 2XHCA 3PO4A 4KT0C 1YKWA 4RNOA 3D0HE 1VRUB 2DCUB 1CQMA 4OHXA 1U2FA 4F2SA 3BPDA 2I38A 3M2UB 4RJVA 4LF9J 1ZTTA 2QLBB 5KT3A 1ZBTA 3HP6A 2HQCA 2HWTA 1IQTA 4J9QA 1T9YA 3J7YI 1JWWA 1X31C 4QWAA 3QO9B 5IT9U 5LL6d 4M5JA 4QPTA 5LMNJ 1AFIA 3H2UB 3T9NA 3KUEA 2WVFA 3BQ2A 4IOCQ 2RDJA 2QA4S 4UT4A 3PRBA 4LREA 2U2FA 2XBPA 4ED2A 1YZ7A 1BC6A 2HSEB 2JSXA 2GIRA 4QWEA 1JNRB 1HBOA 2ZH5A 4EZ9A 2EC2A 2AKWB 1ZM4A 2D9OA 1N56A 5ETLA 1YTYA 3UR0A 1JLAA 3H8YA 4LRBA 4JV0A 3IBCB 4O3OA 3TO8A 1NB7A 1UWBB 5GADI 2RRAA 2RS2A 5IC6B 4RUCA 3IRWP 1JMTA 1F1BB 4TY8A 2Q3PA 4P10A 1KEKA 1RGVA 4YS2A 1QE1A 3MEDB 4KGKA 2IHR1 2QLXA 1S9FA 5HQMA 2Y1JA 3GJRB 1E6VA 1BWEA 5L38A 4X4PA 1JB0C 3LP0A 3CDWA 4QIWD 1U49A 1JLEA 3TI0A 3WZ0A 5GMKa 4Q2MA 5GAGU 4DV6F 1JXEA 1KTQA 1S1XB 1W26A 2WONB 3TAMA 1UJ6A 2BJ1A 4A48A 2MGZB 4LFAF 2VA3A 4R25A 3H5SA 3UDLA 2IDEA 1JLFB 4CLUA 3DOMB 1VQNS 3N9UC 3GSDA 4E98A 4LF9F 2YNIB 3FSYA 5LXRA 1FK9B 4WIQA 4MIAA 5J2MB 5CH7B 4HYKA 2DIUA 3RRKA 2ZUGA 5LMNF 3R2DJ 7FDRA 1TQLA 4WU3A 4EWTA 3T41A 1N0UA 2Y0SD 3MOZA 1Y10A 1LWEA 1VMBA 3CJSA 1F9FA 2AX1A 1BGXT 5HMXA 3EGNA 5J2PB 2AWZA 1BMQB 5I42B 4BBYA 2BANA 1WHVA 3GU0A 1NK4A 1FTRA 2QT7A 1JJHA 1HI1A 3CJ0A 4B17A 4OMFG 5J1NA 2JC1A 2YNHA 3F0NA 4YHHJ 3D54A 1TVRB 3BEGB 3N6MA 2X7IA 4CQ1A 4DCPB 3S7RA 2IC3B 3CCRS 2OPQA 3CC2S 1U4BA 2PEHA 2ZZTA 4B9TA 4D3GA 1B3TA 2SXLA 5BYQA 1TTHB 3MECA 3NXZA 4OZJA 5G0RA 3OT9A 5C42B 1TL1B 1EQMA 2XYGB 1V3RA 1QDUB 2H3EB 3W60A 4N76A 4EYIB 2DPJA 5DETA 4LF2A 1HI0P 8ATCB 3JTNA 3GILA 4ED7A 1T02A 4FZVA 2GQ2A 4CO5A 3K5MA 1IR1A 4CLFA 4OQJA 3MM5A 3MMCA 1IKVB 1C0UB 1UJ4A 3DU6A 4OLPA 3WIUA 4YY3J 2D3O1 3JTPA 3HPOA 4C8NA 2FLNA 5C25B 3E51A 2QSWA 2XLJA 3ENWA 1WF2A 5M2PA 2DCLA 3IGVA 4FN5A 1VIXA 4K59A 4FXVA 1ZYQA 4ZVRB 3BGUA 1RT5B 3POTB 3KLHA 2H4WB 1NRKA 5DDPC 1UP1A 4CI0B 4DR6J 2IBKA 4NZ6A 3KK3B 5B0AA 3OXLA 2GVZA 3HSDA 4C8LA 1TKTB 1H73A 2K1RA 3FUYA 5K9FA 2ZNZA 3FZ2A 2PI4A 5F0UA 3FGVA 4URSA 2I0XA 2FD2A 1TK0A 4U7UD 3RRGA 1M5KC 5J2NB 3PX6A 2HAFA 2ADCA 4MH8A 3LP1A 2XS5A 1FE0A 2MEWA 3EGVA 2C3OA 3HF5A 2WAQD 3GCWP 4G65A 1NBEB 3BN7A 2W2NP 4WE1B 1WC1A 4PWDB 4OI2A 2HNDB 1NNDA 1IKXA 2EW9A 1HQUB 2KXFA 4ED0A 4I6YA 1UVMA 1Q7LB 2FJBB 1NLKL 5A0YA 2KHDA 1TAUA 1SJQA 4KJIA 3JSRA 4EYHB 2CPZA 3D68A 4DF8A 5DDRC 2YX7A 1O8BA 2JVRA 1YITS 3ICLA 1A9NB 3BGFA 4A8FA 3M30B 2LYVA 2QL9B 3OLAA 5KFGA 3O6QA 4YY3F 2MQ8A 1NJZA 1IKWB 3EGWB 4LSLB 3M8RA 2B5JB 1SIZA 3MEEB 4ECVA 2ZM6J 4PEOA 1GEHA 2M70A 2WBRA 2F4VJ 2V5HG 1DQ8A 4FXDA 3DC2A 3GJQB 4DR6F 4X84A 2M3DA 3D1HA 1XTZA 5GAGI 2B9WA 2CPEA 4ELVA 4O3NA 4WXWA 1HNXJ 4DR5J 4ZJOA 4AXIA 4JYAJ 3I4PA 1S9EB 4PXCA 3M6UA 3RAQA 1VRTB 2V2QA 1XR7A 3FQLA 4NCGB 4U67Q 1SL0A 2EBEA 2UVWA 2AYBA 1TL7A 2I8EA 4F4KA 1Y3KA 2QE5A 4Y65A 4WWSA 5K20B 4ZVTB 2ZJPQ 2ZVIA 2BYCA 2D3OR 2IYGA 2ZZNA 1T0TV 3TR5A 3ISND 2BOAA 1CC8A 3QIDA 1WF0A 1PAUB 3FZBA 4YDDB 1RHKB 3JB9k 2BMBA 2RVJA 3T1YJ 5BYRA 2Q66A 4WZMA 3FVYA 2HVDA 2WSCC 3H5UA 1L3TA 3SFGA 3BGRB 2EC0A 4QR2A 5LJ3Y 3W9JA 2EFVA 4WP8A 2BJ9A 4I2QB 3A1YG 3CIMA 1FKPB 3H42A 1D9AA 2HHWA 3DRSB 1D0EA 3TJ8A 4OI6A 2QEXS 3AJ2A 4LR9A 4W90B 2CPJA 2E9RX 2B6AB 2FUG9 1S4FA 5DG8A 2DGTA 2DNZA 4DV1J 2R7QA 5L46A 2ZM6F 1R3NA 1TUVA 2XMVA 4WU2A 4LSNA 4X4TA 2ASDA 2C2RA 2F4VF 3EPIA 3QWPA 1B64A 5AE3A 2Z30B 1NDCA 1RBLA 3G9CA 3CSKA 4ZHRA 3LOUA 2A2DA 4DUZJ 1N5SA 1HNXF 4DR5F 1WG5A 3WC2A 2C2DA 1FNXH 4JYAF 1MROB 2DR8A 3LAMA 3HT0A 4PWUA 2POKA 2QYCA 1IBCB 4USHA 4ES3A 4OX8A 1UVNA 3QSIA 1N32J 2ROEA 2VOOA 3OVBA 3HHLD 3M8PA 1PYSB 4NL5A 4M5IA 4PG6A 1LXNA 4F0HA 3NWRA 2CPFA 3QT8A 1GNKA 1KBRA 4L73A 3VQSA 1NKCA 2BJ7A 2YWKA 3C16A 1YDLA 3V2UC 4OZ1A 2GO9A 1DRZA 2WRMA 3GV5B 1RLCL 3TUZC 4DXLA 1P1TA 4PPZA 3DRXA 1WG4A 3OXGA 1L3UA 3N5FA 3CC4S 4YB6A 4B02A 3OTEA 3JYTB 3HHDA 4G1QA 1PG5B 1RT2B 2CQDA 3FMWA 1DURA 3HM9A 4USMA 2OO4A 2CG4A 2CQ3A 4FF4A 2OELA 2ZC3A 1IKYB 2XY5A 1FDNA 3K59A 5CYMB 3KK1A 4K50A 2GA7A 4P7VA 2DHGA 1RTIA 4P72A 3D9BA 5B0EA 1M1KT 4QU6A 5EGYA 4KO0A 1LKZA 1M5HA 3MPWA 5CCLA 2HRTA 4Y28C 5K14B 4DV1F 2MKKA 1V9OA 4M5KA 3PACA 2WK4A 2PIIA 1ROFA 1B0VA 1RT1B 5KG0A 4WFAQ 2ROGA 4OYMA 2HHHF 5F3TA 3GQCA 1HNWJ 3NEKA 1KVKA 1YBAA 5ETOA 1SH3A 4K5RA 1FDAA 2LFVA 1YQHA 3E01A 3EM1A 3UDVA 3BKFA 3TZZA 3H90A 2KHCA 1RHJB 2MQQA 1C1CB 3MM6A 5LM7E 1N32F 1KFSA 2Y1IA 2B43A 1M5OC 1VHFA 1Q86T 5KFXA 3ZTPA 4UQTA 2OPSB 5KFJA 2MJUA 2HG4A 2GAHC 3K89A 4Y3CA 4CTAA 4KFBB 1U1QA 3W8GA 3OJUA 3IP0A 2C28A 4ZDNA 3I0RB 5A8WB 1MNEA 1S6OA 2E1PA 3RB4A 4MKBA 2HNYA 1S6QA 2WBMA 1BQMA 1KTVA 2FIUA 4OI0A 3TQEA 2J0SD 1UEVA 2ALYB 2ILZA 4PRFA 3DLKB 1IJEB 1CJTB 2DIVA 2RU3A 1QD1A 1UW4A 1HBNB 4AQYF 2NUUG 3DHXA 3ILLA 4KB7A 2XEXA 3G6ES 2DHHA 4QIFA 3LWMA 4ZCLA 2Y3YA 2VFUA 3JAMY 4C98A 2AZ1A 2BZ2A 3X3UA 4ZVOB 4FF3A 3GZ7A 1WNEA 4A8KA 4PQUB 4A8QA 3ENQA 1F3FA 2F9JA 3CO9A 2BUNA 4DR3J 1FFSB 3PNIA 2XI2A 3I55S 4PWWA 3MMBA 1FE4A 4NOHA 2XNRA 3CDUA 4JI3J 2KT3A 2BRKA 2F5GA 3U7JA 3HZEA 3HXMA 2C2NA 4CIOA 3MUMP 1PKUA 1MU2A 5AXLA 2KTQA 3W7BA 1K0VA 1HNWF 3PKMA 3MUTP 2HS0A 1RKIA 4DQIA 2R42A 1VCTA 2VD3A 1XMQF 4ZP9A 4RBUA 1RTDB 1GK8A 3H40A 2VPZB 4ZOSA 1CJUB 2Q6BA 4K4WA 5GMEA 4HHJA 1OMSA 1HWKA 2CZ4A 1WKKA 1NSAA 1UCNA 3E8OA 2XZTB 1KHVA 3UN2A 2AJ1A 1PBUA 4GO5X 4PZVA 1R27B 1VC5A 2HYIB 4KBIA 1HIYA 2KXHA 2R8IA 5D3GA 2E44A 4C8MA 1RISA 4MJKA 3M2RA 4FYXB 1GTHA 4DPUA 4IG0A 1YX2A 2DGSA 4TQRA 3J81U 1TMMA 2FHJD 2B4VA 3I56S 2MQPA 1HBMB 3TNVA 1Z4UA 5KFYA 2HKEA 5L1KA 3BYPA 4LRAA 5CXTA 1AZSB 1I3OB 4C11A 1WTBA 2R7SA 4J5OA 3MTKA 1KLMA 3OR1A 4EZ6A 1JKHB 3MAQA 5AXMA 4BWJA 5HROB 3HK2A 1XMBA 1Q16B 3RBZA 4JI3F 1TP7A 5IZHA 5B0DA 1T03B 2YXLA 1GTEA 1U24A 3L4BC 3N79A 4J9NA 1D1UA 1NZ8A 2VKZG 1LFWA 1KONA 4MYTA 1RBOB 3B82A 2G0JA 4OHZA 1WHYA 4CNZA 1C4AA 4OYZA 3QT6A 1JNZB 2XZDB 2A2CA 2HQDA 3C46A 3HJFA 1NO8A 1UW9A 4JI4J 3GIIA 3F41A 1NCLA 4GC6A 1U45A 1ICEB 4W98A 1UA0A 3MF5A 2DB1A 2QL7B 2PC6A 1FESA 2E1MC 1J5OA 5HBMA 3AODA 4ZPDA 1NK7A 1RA7A 4KGZB 1FKAF 1KQKA 1QY7A 2BJ8A 4U8VA 1KKHA 1NZAA 4KH0B 4U95A 1HYSA 4YP3A 1U6ZA 4DSKA 3C66A 1LW2A 3GV8B 2ZHOA 4ER8A 1X5PA 2CXEA 2FHJA 3AJDA 2BXJA 4DR1J 1RU1A 4CO2A 1K8AT 4ZCKA 1Y5IB 3CD6S 1KN6A 1V3SA 1VRQC 3CCQS 5IQ6A 5AE2A 4UUXA 4LF1A 2E5JA 3TQ1A 1F9HA 2XNQA 4I1TA 3CD7A 5CD4H 5HP1A 3P6YC 1NSKL 4OV1A 2G1DA 1JLBB 3VZHA 3DOKB 2LLZA 3SFUA 2YWHA 2X1GA 2ZBPA 3CMES 2CDRB 4AUKA 4F0KA 1RTHA 2IM2A 4JI2J 3DRPB 3HHEA 1X5SA 5A2QU 3KLEB 5KG5A 1I6JA 2IA6A 1XR6A 2K7KA 1DQAA 2HQFA 1A7GE 3C15B 2HFVA 1P27B 1H2TZ 4LRFA 4DV7J 4WF9Q 4P9SA 1S1TB 3M9OB 3MM9B 4Q0BA 4QCLA 3GIMA 5A8KA 3KLVA 3T5HA 1B4SA 3QWUA 1J5EJ 2AYMA 3CD5A 4JV2A 3M8WA 4DFKA 2ROPA 3B6BA 1RWPB 1U6FA 1R31A 3PG9A 4DR4J 3IR5B 5FDLB 2HHPA 2IPOB 1V3ZA 2VB6A 2QMWA 1S59A 3LP2B 1SV5B 1EETB 2D1CA 2B51A 4NLYA 1EP4A 3MFIA 2C2EA 1MN7A 2L48A 3HO1A 1NK5A 3HZGA 3G82B 4YR0A 2MQOA 4DR1F 5KG7A 4UOCA 2D69A 4KPYA 4MAKA 4NYZA 4KGMA 2QMXA 2RS8A 3KHGA 4FYDA 1OSDA 3TAPA 3SXLA 3M1VA 1S0VA 1X5OA 1TKZA 2CPIA 2CNNB 2DGUA 4HI1A 2FHMA 3D6TB 4ENOA 3KNAA 3V4MA 4XDCA 4EU0A 4NLGA 2VFSA 5HL7Q 1T95A 1OY8A 2YH1A 5HSPA 3I5CA 1JLCA 4KC5A 4ZP7A 4X65J 1NUEA 1LWFA 4KH1B 3NS6A 3V4IA 5IT9Y 3TVZA 4K4YA 4JI7F 2GGPA 3CVKA 3MTJA 1UEUA 1VJWA 3LGNA 3C8YA 5HATA 3OR2B 3X1LB 1U1RA 1AB8A 1G3OA 4KE5A 1URRA 4PG4A 3V6DA 1E6VB 2CJBA 2KJWA 2R8JA 4DMZA 3EMTA 4QW8A 7FD1A 2ACYA 3F44A 1Y5LB 1H3DA 4RW7B 5EHHA 3G6VA 4X4OA 4DV7F 1C1BA 4F4AA 1S7IA 4P7TA 4NXMJ 1RUSA 1HBUA 2HNZA 4N41A 3PEHA 5H9EJ 5KFRA 3R3TA 3GR0A 1J5EF 2R9LA 1VC0A 4DX8H 2Z0GA 1T05B 2L3MA 3OTBA 3D3CJ 3Q8SB 1S1UB 4ILLA 4YR3A 1RI7A 3PHEA 2FJXA 2JVOA 1X4AA 3G6YA 5DLFA 2CQ2A 3RJMB 4R0JA 3CCUS 4M5HA 2Y8YA 2E7XA 3NNCA 1RLDA 3HSJA 3NMRA 3DMJA 3TA1A 3AA8A 1I5OB 4C3KA 1PSDA 2BW7A 5F8LA 5EX0A 2KYZA 1S1WA 5ETKA 1X60A 1N88A 4DV2J 3SCLE 5JXSA 2BDPA 3CJRA 3MM8A 3LF0A 4GKJF 2J6TA 2YKNB 2F4FA 4N5SA 1N5VA 3ET6A 4USKA 4X65F 2R8KA 5CZVA 3UPFA 5BR8J 2J9EA 3W64A 5IQQA 5F8IA 5T7LB 4ETZA 2LQBA 3K5OA 2MLYA 2FYXA 2OPQB 2E5GA 4URQU 2YWEA 4PXDA 4F4XA 5HLFB 3MMAA 1K73T 3FEZA 2ASYA 2KRRA 3QAEA 4J9KA 2J6UA 2QO3A 2IAJA 4YB1P 2XMMA 2CZVC 2CRLA 1RT6A 4NXMF 3TZWA 1UKUA 3THVA 2V2KA 5EDWA 2HFSA 1X4BA 3HKZD 1IBMJ 2GMHA 3MEGA 2LA4A 2VODA 3KJVB 3QGPA 2QG9B 1QSSA 5GAEU 1RT3B 2MQNA 1CPZA 1TK5A 3CCSS 1XBWA 3PJWA 3MM7A 2L9NA 3MCNA 4M5NA 4LQ9A 2GHWA 3RW6A 3I0SB 1JXVA 2PDAA 4K4XA 3L9ZA 4HT5A 3RYLA 3AD9C 1KQFB 2UUTA 2C42A 1RCXB 1T3NA 4OV6A 2X51A 2QSFA 6FD1A 1HWUA 2JFDA 3VF0B 3BB5A 5LSOA 2C3UA 1V6HA 4B3TJ 4C8YA 2J8SA 1U26A 2Z8QA 1Q53A 4DV2F 2V4RA 1BD6A 2HQIA 3KLGB 1U8WA 5I3UB 3J81j 2AJ0A 2BX6A 2MMYA 4IH7A 4E8UA 2HMIA 2FY1A 2ZE2A 3GFXA 2OIHA 4WP9A 3GLJA 1U1OA 3RR7A 4O4GA 2RDDA 1NK6A 4EO8A 4MFBB 5BR8F 5E3RA 1VQYA 2CG8A 3PRDA 2NXCA 1SJ1A 2GIFA 4W92B 2V9WA 3V5RA 3H4DA 1REVB 3QIPA 2BV3A 1IKXB 3O2IA 2BKOA 3NP5A 4NLDA 4F3MA 2MKIA 2OSRA 4P2SA 1FRXA 4ZCMA 2FGOA 1YRUA 3MDFA 2PFDA 3O8WA 3GJSB 1U8SA 4USTA 5DJBA 4F4WA 1Q8LA 1U0HA 2V34A 4L3KA 3PIPQ 2HBQB 3L09A 4WYLA 1U6BA 2BBEA 1TMJA 1IBMF 1AFJA 1GMWD 2RIJA 2MY8A 5C24A 4OI1A 3D6MB 2HGLA 1IN0A 4M95A 2MZ1A 3ADAC 4PUOA 4ECTA 4JV1A 5H9FK 2CIMA 4IFVB 2C22A 4ZIWA 1QTMA 1RAFB 4LRCA 4R5PA 1IBKJ 2EPIA 1PJ5A 4PXBA 4CO1A 4M5DA 4RBVA 3EVWA 2MJNA 1VK3A 4RW4A 3FEXB 3BGLA 5D6GA 3GCXP 4MIWA 3TVKA 4B3TF 1SJFA 3DM2B 4RW6B 1RYRA 2KDOA 1LWXA 2LVWA 3BH7B 1KQGB 1RA6A 4TNOA 4P75A 3ETMA 2B9YA 2XM3A 2K06A 4Q44A 3HVRA 4IDKB 2AF6A 2QN6B 4WK1A 4ZVFA 4JI1F 2A10A 2PA3A 1BUXA 2AEJA 3K17A 5IT0A 1XJWB 4ZK7M 1X0FA 3IS9B 3DRRA 4XDDA 1R0AA 2YH0A 1R8PA 1SUQA 4R8UA 3IG1B 3CXCR 4ZVUB 2LP4A 2JLFA 2J7WA 4A8OA 2MPUA 3BR8A 3R6LB 3QLHB 4B3SF 3AHPA 2XLIA 4OHYA 1VQ7S 4HH1A 5CD4A 2O3DA 1XWLA 2YWGA 1GMWA 4DEZA 2QYGA 2DPIA 2NSBA 3MMJA 3C6TA 4L6V3 1RTJB 4QZVB 2Q1LA 4IH5A 4OZ5A 4I69A 3J7AN 3ULHA 3PEJA 2BJEA 1U09A 5D0HA 2XWXA 2BEFA 2DGXA 4I64A 3HFKA 5CYQB 4C48A 5HVHA 4TN2A 4WCEQ 2J9DA 2XO7A 3W2WB 4N7TA 3PYDA 1CJKB 4TQSA 1H74A 1ZOTA 2VQEJ 3M32A 1IBKF 1N33J 4M1KA 1QSLA 3MPUB 5CAAA 2R2RA 1OS5A 3D0IE 1UVKA 4OLOA 3VAHA 4AE5A 1CS4A 1KNZA 1UEKA 4X2BA 2HGMA 4NLWA 2KL8A 2HIQA 1KDNA 3OQ2A 6FDRA 1S0NA 2PI5A 1Y4ZB 1S6PB 3SEOA 2KG0A 2VPXB 5KOXA 2ZBRA 4MIBA 4I6AA 2B4UA 3VTIA 4I2PB 4TY9A 5EWFA 1TV6A 3VWSA 4EFAC 4ILRA 2VV5A 2MQLA 5J2QA 3N28A 2DH8A 2M88A 4NCAA 2QZ8A 4WFNQ 2YNGB 3A3PB 4QWBA 2CJYB 2IVMA 3C6UA 1R6VA 4ECYA 2ZZMA 3FCVA 3M05A 4QBUA 1DY3A 3Q2TC 2AIRB 3KLFA 5CQGA 2IM0A 3MR7A 3EXCX 1N5YB 1RT7B 3A8EA 1SVDA 2LQ9A 4A46A 1FXLA 1T9TA 2NZ4A 4FF1A 1XN9A 1KC8T 1DBDA 3ZZTA 1NPPA 4HHUA 1IR2A 5MLCV 1AUSL 3LGMA 5LSRA 4F3OA 4CZCA 3SDEB 2AD9A 3AXKA 3ISZA 4F4YA 1UETA 4TLRA 2VQEF 3FFIB 4HHHA 2RAQA 1N33F 3OLBA 2OD4A 1ZA2B 2FVQA 3H0PA 4EK2A 3UD5A 5THWA 2YQ1A 4CWBA 4LFBF 1FKOB 2V8VA 1XQIA 4UOGA 1SQFA 4OYIA 3TA2A 2CQHA 3NCRA 5F0WA 1VQKS 3HHLB 1U48A 2LDYA 2ZWPA 1WOOA 4B3OB 1Q79A 3D6FB 2KM8C 4WZQA 5LMUF 3BN4A 1OSCA 1ZAWA 1YJ9S 1RHQB 5F8GA 4AL5A 2HQGA 3CD0A 2X1AA 2ALZA 3DLHA 1NSQA 3DLEB 3DI6A 1Q4RA 3JQMA 4XTTA 2F8EX 4DSJA 2J0XA 4UY8T 4A8XA 2W4PA 3QMQA 4LF8J 1JLQA 3QT5A 4IG3A 3BSAA 4I56A 1EJ7L 5EUHA 5JVGQ 2CVIA 4JB8B 3GR1A 4OYPA 2YTCA 1WHXA 1IR0A 4JUZA 2JJ4D 1F5AA 5E33A 3OUYB 4LMZA 1O6XA 5IWAJ 4KV8A 4DU8A 1FCAA 3PY8A 3OTDA 5IFMA 1CULB 3DXBA 3GFYA 5A76A 2ZDOA 3DGPA 2MQMA 3KG4A 3C14A 1Q8BA 2IBOA 1FERA 4IOAQ 1HNZJ 3LH2S 1ZM2A 2M2BA 2A6MA 2VJVA 3PFEA 2YKAA 1BXNA 4ECQA 4DZDA 1T11A 1F6TA 3P4UB 2OGUA 1X9WA 3HD1A 4CYUB 4QWCA 3OFHA 1Q0NA 1C0TB 4Q7AA 3C19A 1BWVA 1FFGB 3FQKA 1KS2A 2ZOMA 2DO4A 2J6SA 2OPPA 3T5JA 2OEMA 3VZIA 1A6LA 2AJFE 1ZZNA 4IYQA 3D67A 2CPXA 1VRUA 2Y1RI 4Z7YA 2EKNA 4U6PA 3DXSX 3U1NA 1W2BR 3M7VA 3M2UA 2V4QA 2GQCA 1G2EA 1LNQA 2E7VA 4ZVHA 4ANEA 5I4MA 1SIWB 5L1LA 2VOPA 1CJVB 2W2QP 1BQXA 3MI7X 4K4TA 4DSEA 3QO9A 3AH6A 1PIEA 2UU9J 2RUSA 2AV5A 2B9XA 5IV3A 2E5HA 1U1LA 5F9LA 2ZH2A 1FXDA 3JQJA 2AZ3A 2HLTA 3UI3A 3I4HX 3JQKA 4FF2A 2Z2LA 2FGCA 2IRXA 3TEHB 4FDFA 4LF8F 1HQEB 4DOZA 2KFYA 3A12A 1ZZFA 3KHHA 1OJ4A 2KKHA 1FO1A 4O0IA 1WEXA 4X64J 1LWCB 2E66A 3SZ2A 1UWBA 3MEKA 1Q5YA 2L9WA 5IWAF 3HJVA 1G1XA 4HLBA 4EBCA 3OTOJ 1FJGJ 1JLGB 2GJ2A 2WTFA 2P9GA 5H9EK 2DNHA 3MEDA 2GO8A 5KG1A 3GYXB 5I3PA 5JMNA 4DZ6A 3DFEA 3J7ZT 2MSTA 3H25A 1HNZF 3TEGA 4P71A 3A8IA 3ZXWA 2UVVA 5IS2A 2E9ZA 2BACA 4RR5A 3NL0A 3DYAB 2VBYA 1HKAA 1BLUA 2RKIB 4F36A 1S1XA 2WONA 4LR7A 5HANA 1RAHB 1RYSA 4QR0A 1S4EA 2MGZA 2VASA 3J81Y 4C8KA 3QJLA 5DG9A 2RUGA 2HVHA 1FRJA 3HD2A 1Z2ZA 1WWHA 1JLFA 2HHSA 4I67A 1R7IA 4LF7F 1VQ6S 1N5TA 4G1PA 3KNGA 3OPKA 2YNIA 3W5XA 1FK9A 4CO0A 2JLEA 1UPPA 3EZOA 5J2MA 1WSVA 2H1YA 1WHWA 3DLGB 4NLPA 3H2LA 3RBDA 2R7VA 3SQGB 2LA6A 3KK2B 2GMJA 5HBMB 3CJ5A 5D0EA 5C2CA 3RAMA 4ATNA 2DHXA 5GMDA 1R0CB 2I9SA 3C2PA 1DLOA 2VDHA 4FS2A 2CJKA 5J2PA 1NMEB 5I42A 3N5BA 2VF3A 2BE2B 2CJ9A 3W9HA 1HYSB 3TX0A 1WOSA 4X64F 1HPZB 1J27A 1VBYA 2BRLA 2QGFB 3OL6A 5KFNA 1J2VA 3DHWC 3R7NB 1HLWA 3OTOF 1WORA 1RACB 1FJGF 1TVRA 1OQ3A 2J9CA 1TUWA 2IC3A 3HSGA 2EG1A 3EDQB 4YDXA 3IGNA 2MYFA 3EPGA 2DJWA 5E3QA 1HA1A 2Z2MA 2W9AA 3D4JA 4FKXA 3ZZRA 2VHGA 1TL1A 3MAHA 3OJSA 3NAHA 3PR4A 3HDSA 4DFMA 4ZMMA 2UXBJ 4GMKA 4D3HA 1OY6A 2PMHA 4XPCA 3VGVA 2MHNA 1NM2A 4F26A 1DAXA 2QLFB 4M5GA 3RGIA 3T19A 2J8AA 4KRWA 2ZH9A 1WUUA 2XQCA 2AT1B 5HMWA 3TUIC 1IKVA 1C0UA 4EUVA 2CQ1A 5C25A 3BDEA 1ZETA 1NHUA 3KJFB 3VAJA 2C2MB 1VLOA 2K7JA 4OHVA 4HACB 1YIJS 1BY9A 3UE2A 2G0CA 1RT5A 1SH0A 2GVDB 3RW7A 3W8PA 4NLQA 1HWJA 5JVHQ 5A8KB 1VQSA 5KT6A 2EKYA 4JOUA 4ED5A 1Q1KA 4DX5A 5A2QY 2E29A 3KK3A 4UY85 2WVEA 5ETRA 1RWOB 3OXFA 4ZP8A 4X4NA 5KFVA 1TKTA 2OPRB 1L5UA 4RW9B 3UR3C 2B4OA 4Y34A 4DN0A 3W5ZA 2CAJA 2LU1A 1NB2A 2ASLA 5J2NA 1NAQA 2Z58B 3O1LA 1HARA 2ZDPA 3M8YA 4DL4A 3UDEA 5D4OA 1R8AA 3Q8RB 3KHRA 2AHOB 1ULRA 3JSYA 1U7LA 2GIQA 1HQUA 2VG6A 3O44A 4NASA 1M5PC 4CCHA 2K2PA 3UVJB 3TJ9A 1W2IA 2OTLS 3ZZPA 1O0PA 4RX6A 5DO2A 3P96A 3DOLB 2AGOA 2OSQA 3ZTOA 4FYWB 5HJXA 2NUHA 2VFVA 1FWPA 1ZS6A 2VJUA 5KFFA 3GIKA 5FLXU 1VQ8S 4NYPA 1T7PA 1HD1A 1GXTA 4K4VA 1S79A 3M30A 2YNFB 2N4DA 2W9CB 4ED4A 1IKWA 4NMLA 4LSLA 3HLUA 2B5JA 2DNPA 4LF5J 3ITHB 3T6JA 1VS3A 3MEEA 2UV8A 2H65B 4NLXA 4V19J 1WC0A 2UUCJ 2DXEA 3BYRA 4I7FB 5EWGA 4QJVA 3F73A 4PYDA 2NSCA 2FDNA 4PCQA 1JXLA 5B09A 5IM0B 1ZH5A 2VG7A 3QATA 3T1AA 1B7YB 2OLWA 1DFDA 4NA3A 4UF4A 2ZC4A 4MKAA 5D4NA 1S9EA 3U27A 3UD3P 2MTLA 2HBRB 3VV2B 2GMLA 4NCGA 4NXNJ 3FSXA 3PM9A 2KH9A 2IVYA 3RB0A 4L74A 5GAHI 3OSNA 3GTYX 2EI5A 4N77A 1RWXB 1S9GB 4RO0A 2OMOA 3ZTRA 1NJIT 3JTOA 3U1LA 4X4UA 2NS1B 3J7Z5 3NKYA 4LBHA 4GKKJ 4QOTA 1RT4A 2N82B 3R6GB 2NREA 1O5JA 4GO7X 4KTQA 3OV7A 5J1EB 3MM8B 3W66A 2LCWA 4XPEA 3BGRA 4L72B 1ZAVA 3G4SS 2O67A 3WIVA 4YB5A 3GIJA 1N4LA 8AT1B 2XYPB 4O44B 4OJ3A 1Y7PA 2DK2A 5KFIA 1NDLA 4I2QA 2IRUA 5E0OA 1FKPA 1C4CA 1NKBA 3BKUA 4EMDA 3EJMA 2J9DE 4DN9A 2XMTA 4A8WA 3QBCA 3DRSA 4G3IA 4OYWA 1UVIA 3SYZA 4ID5B 5H1SV 1PGZA 2HGNA 4C3LA 4QYZJ 1GMVA 1IM6A 1TL3B 3D0GE 2RHQB 5DQHA 2FQQB 2UUCF 2RJZA 3ZTSA 2EK1A 4KHPJ 4FKYA 4C3MA 3B4DA 3CJKB 2RQMA 3RTVA 1M5VC 3Q8YA 3FEYB 1DJ0A 1U02A 2ZH8A 2R8HA 1MROA 4BC9A 4FPIA 5HMZA 4B3RJ 2W2PP 4UW2A 3UDCA 2QLJB 1KVJA 4RBTA 4DS5A 4NXNF 3BS9A 2W2MP 2KZZA 2AU0A 3E3XA 9RUBA 3NBPB 2HFOA 4DDFA 4MMOA 5BXIA 3S6EA 4YHHF 4DSLA 1E6YB 3FRYA 4QPXA 3GYNA 1VJQA 1WEYA 3I82A 2V50A 1UVLA 1VQ5S 5IV4A 5KG6A 2ZD1B 2H5EA 3GB0A 2AP6A 2NXUA 2HHXA 2FLOA 2VFRA 4CLLA 4I4BA 3D7SB 5HK4A 1P8GA 1VQOS 2M8HA 3PYEA 2CQBA 4USVA 3JYTA 2D9PA 1LW0B 3QRPA 1LK5A 2FZGB 4AYBD 3ZFVA 1RT2A 3S8SA 1H2UX 2CPDA 2E9TA 4EBEA 3MR2A 2GZOA 3R5AA 4J9UE 1IKYA 3V81B 2CYYA 5CYMA 4U7CA 3Q8VA 3TYTA 4DPXA 1EAYC 5KAKA 3K58A 3LQVA 3AB2B 3EZUA 5K14A 2OHDA 1X0PA 2JNJA 1N52B 2NXJA 2W24A 3GG0A 1DTTB 4DFPA 4J9PA 1HW8A 2E5IA 1U0HB 5EWEA 1FNMA 4KHPF 3PZPA 3SSSA 2OD6A 1RT1A 1EARA 2CQGA 3MD3A 2NPFA 4Y0FA 2DGVA 4RWWA 2DNQA 2ZKTA 1RWMB 1N6QB 1RHRB 3I5AA 2G2OA 5KFCA 1YLXA 3KLIB 2CQIA 4B3RF 1FX4A 2QJ3A 1C1CA 2O5DA 2M4MA 4LIWA 3KWMA 5JJBA 2I5JA 2OPSA 4OI3A 1ACMB 3RBXA 3NS7B 2VH7A 2DNMA 4KFBA 2GJFA 4DL7A 1ELOA 3I0RA 1PYOB 2DEIA 3N0VA 3LWLA 4F4ZA 4YUDA 5A8WA 2XC9A 3EICA 3MR3A 1CQNA 3AB4B 1SI9A 2P6TA 4OI4A 2GAGC 2RSQA 4OJHA 3DLKA 2KYXA 2LXFA 1N36J 1CJTA 4TU7A 1RK8A 3NOGA 1HBNA 2MY7A 3CJ2A 1JJ4A 3RG6A 4G6VB 2ZH1A 4BS2A 1GXLA 2MXYA 2AGPA 1XMOJ 5CABA 5K8MA 3I96A 4OJ1A 3TP2A 2BE7D 4LBPA 3ONQA 1T94A 1OY9A 3QAUA 1KR4A 1NSPA 2OH2A 2XY6A 4PQUA 1SKSA 2MZSA 1VDHA 4FNHA 5M2UA 2VA2A 4TYAA 3WBZA 5MAOA 2CWKA 2YKMB 3Q8PB 4ED3A 1FX2A 2BVZA 2DY9A 2EK6A 4KPCA 3RRHA 4ZVGA 3Q24A 1SJ3P 1K44A 2CNOB 1H7XA 2IRYA 2Z56B 2V9KA 4DLGA 3SSQA 2W2OP 5HMYA 2GHPA 3KFWX 5K8OA 4ZKAA 1SXLA 1PJ7A 3N4WA 4OX6A 1RTDA 4YQWA 1Q95G 4DL5A 1R6YA 2MKHA 4LF6J 1QVFR 1CJUA 3J80U 3CE8A 5BYSA 3IRXB 3UD4P 5AE1A 1LV5A 2YPZA 1HNVB 3EVMA 4H4MB 4IO1A 5GADU 3TAQA 3HSZA 3G8QA 2XO6A 4CNYA 1T9UA 2XMWA 2J7UA 1HR0J 4Q43A 3K57A 3K2YA 3DDKA 5ETPA 2MLXA 4DLEA 4S0MA 2DR6A 3M6VA 3T1YF 3Q8UA 3HULA 3GMGA 1FWKA 1KSPA 3I6PA 4KHRA 2KB2A 2B8PA 1FD8A 2PN6A 4L75A 4NLTA 2DR7A 1RAIB 2PA8D 2RDIA 2HWIA 2HIYA 2X1BA 5E3CA 2AEMA 1UWAA 1U25A 4OZNA 2FJVA 4XK8C 1D8ZA 4J9VA 2H5JB 3AOAA 3AD8C 1WTFA 3R5CA 3R2CJ 5SZTA 4IFYA 4ZA1A 4IR1A 4K2XA 1HBMA 1AXQA 4W4MA 2XTJP 2ZOFA 4NI2B 1AZSA 2P9CA 4ECWA 1KVIA 1RWKB 3IWLA 5CHCB 3FMBA 4ECUA 1JKHA 1UTAA 4K0KJ 3A3NB 5HROA 2XMKA 3I87A 4UUWA 2VZ9A 1NU4A 1G6BA 2W8KA 3TRGA 2E1AA 3NNHA 4P2MA 4QW9A 4DPYA 3W3SA 2V4JB 1T03A 4DX7A 2BJ3A 3CDAA 4DUZF 2V94A 1FJ7A 2FVRA 2ASJA 1BE4A 3CTRA 3BGOP 3P5TL 2XSJB 4E0DA 3P3DA 3IAM9 3GONA 3PIOQ 2G2YA 3A3OB 4DJBA 1FRMA 1S57A 3DLBA 1BHNA 2V2ZA 4F8RA 4YOEA 2MKCA 2ZH3A 1VYAA 3GFZA 4LF6F 3DGVA 1YJUA 2D3ZA 2XULA 3GYGA 3AOCA 1APSA 4C0BA 4RW8B 1SH2A 5T41A 1KQSR 1XIQA 2MZQA 4DG1B 3QJJA 2Q79A 4FP9A 2ADBA 3G87A 1HR0F 5H9FJ 4QQBA 4NWBA 4J9LA 4JI8J 1KLNA 3OL8A 1SKUB 1VOMA 2HHTA 3Q8QB 3KHLA 1KWMA 4ES1A 1UZDA 5L9NA 1SC3B 1X4DA 3KG0A 4ZN1A 1WC5A 1O51A 3MAAB 5KFLA 2V6AA 2W9BB 2MKJA 1B99A 4CLPA 6AT1B 3BF4A 4DV4J 4O3SA 1MLAA 4B08A 3VGSA 1LK7A 5ETVA 4DX6A 2WCXA 5D0GA 4P52A 3M8QB 2WOMB 2VG5B 5DZ7A 1REGX 1JLBA 2P5VA 5B0GA 3DOKA 3R5GA 4PAAA 4B9UA 1SB6A 4K0KF 2I1RA 2W01A 2C2OB 3THTA 3CMAS 1S1VB 3KLEA 1WI6A 2I2YA 3RAXA 4IQXA 1ZM9A 2E1RA 4GVLA 2DXDA 1S49A 3PCOB 4I68A 4MK7A 1VR6A 2N3LA 3FKBA 3T1HJ 3C15A 3MPDA 2AYGA 2HZAA 3LTOA 1Y00A 5C7PA 1YZ6A 1S1TA 1S7HA 2FVSA 4DV6J 1WEZA 2R7TA 3BBBA 4WTYA 2FZCB 1U0SA 1OWXA 5L1JA 4AL7A 3CT9A 3TJAA 4LFAJ 4NE9C 2DNLA 1W25A 4OZ0A 3EYZA 2XWYA 1YRXA 4USJC 1QTNB 4OYXA 1SC4B 5D4PA 2DH9A 2N4CA 5FDLA 2EFGA 2DY1A 1DTQB 4TKTA 3LP2A 1SV5A 1EETA 2XHWA 4JI8F 3JXOA 2GQQA 1UZHA 4PQAA 5KFUA 4C2MA 3MCMA 3WC0A 3TA0A 5DQGA 1CC7A 3U1MA 2R4FA 1PAEX 3G82A 3K7RA 2XZWA 3OL7A 1NHVA 4WK3A 2RF2B 2B7BB 4FVCA 3DLJA 4DV4F 3HVAA 4M94A 1S12A 1HMVB 4DQSA 1XERA 2O66A 4I0WA 3RB3A 4WFZA 3V6KA 4DR3F 3ZTQA 4BLGA 3AFGA 3PX4A 3BDPA 3CJ8A 1VISA 4NLRA 5KFPA 1U1PA 4ECZA 4NA2A 1HHQA 1DARA 1XNQJ 4WTOB 2FJDB 5E3AA 2UUWA 4H4OB 2O1PA 3JSMB 1SKRA 2C3MA 3R97A 3L95X 1HNIB 3EXYA 3LGHA 3Q2SC 4ZIVA 2QLWA 2RRBA 2FTRA 3OR2A 4V1Ak 1TKXB 3A13A 3AA9A 2EFNA 4KR0B 1GQEA 4WKYA 1H72C 4ICLB 2MSSA 4CDIA 4ID8A 3BH6B 4ZS6A 3T1HF 5A8RB 4IRDA 4RW7A 2B9EA 2R2TA 2HFUA 1AA1B 1QAJA 4GVBB 3GFHA 5B7WA 3HKWA 2DR9A 2MKSA 3HFVA 3M8SA 4Z7CA 2CKWA 1WOPA 3CIZA 2PEBA 4YEAA 2EFOA 1X4GA 4P2XA 2V68A 4L3NA 2MHEA 4HVZA 1T05A 4MK9A 1M0SA 1NK9A 1S1UA 2Z2ZA 1BQNB 4HTJA 4YMEA 5LSLA 2F1FA 3UQSA 4NRTA 1RAOA 1B0PA 3D1QA 3G8TA 2KFNA 4WP3A 2BM1A 3TZYA 1FDDA 2BM0A 1VBKA 1R89A 3TZXA 2BABA 2BQ3A 5DQIA 3SCIE 4WKRA 4F25A 1IQZA 2V8GA 1SKWA 5KFAA 2M9KA 1VQ9S 4HEA9 1WC6A 1DLOB 4IOBA 3DLLQ 2RMLA 3I31A 3DDIA 1QVGR 2Z4PA 2YKNA 1A0OB 4PG7A 4QYZK 2FHKA 1XNQF 1S5ZA 5F8JA 3CCJS 3KTQA 1KRPA 4B3MJ 3PJXA 2M8DB 5T7LA 1DHMA 1VQMS 2Y1LB 3PVXA 5KG3A 1UL3A 2ZWOA 2CQ4A 5HO4A 3UO0A 1C2PA 2N3OA 3OBIA 2KI2A 5HLFA 3GIRA 4LQ3A 4NX9A 1FJEB 3CWJA 1FVQA 1CVJA 4DV5J 3TARA 5ETSA 2IYIA 4JI4F 1Q5VA 2VQFJ 1Q8IA 3MZIA 4DPOA 1NHKL 2CDQA 2LU2A 5KFSA 1GAOA 2UVRA 3MD1A 4PR6A 2RH3A 4OZ2A 2RRNA 3KJVA 1Y9OA 2FPHX 2MZRA 1X7VA 3H5YA 1RT3A 5KFHA 2DEJA 1MW7A 3M6WA 3TANA 4BWMA 4B9NA 1N34J 2EVZA 1FF2A 3M9NB 3PYFA 3B4MA 2JX2A 2HHVA 5HQLA 4PABA 1EX8A 2DH7A 1U2CA 2FVCA 3I0SA 2PT0A 1H98A 1HHSA 1MWQA 3OVSA 1CG2A 4TYBA 4DU7A 4P74A 1R8CA 3A4TA 2JL9A 2COLA 4F0MA 1CBKA 2M52A 2BQRA 2AX0A 1HBOB 3KLGA 3FRZA 5I3UA 5LXYA 5DDOC 2G2ZA 1RKJA 1JLAB 4IRKA 2XSFA 2AGQA 2NCKL 3UNYA 3BJYA 1IBLJ 3G6XA 1MMNA 4TY8B 2R7RA 2EWHA 1FRLA 2YY3A 2A18A 2M0GB 4USWA 3QT7A 1EKRA 3D28A 3MPVA 1PYTA 4MFBA 4B3MF 2XMJA 3MCSA 4TXSA 3ZNUA 4JI2F 4NCBA 1QE1B 1ZAXA 3K8WA 3K5LA 1GFWB 2H9ZA 2HK3A 4DS4A 3SV3A 2P8IA 3CPWR 2IMWP 1REVA 5AXKA 3BSOA 3PW7A 1YJNS 2VG6B 1XC9A 2WZ1A 4ZN3A 3MHYA 3NMAA 3VAFA 3LO3A 2LXIA 3LP0B 1JLEB 3WX8A 4LSZB 2EFPA 4DV5F 2E7WA 1RDRA 2YBVA 2FZKB 4ECRA 2VQFF 1RAAB 3TAMB 3ZZUA 2CVEA 1U1NA 4N8OA 1MN9A 1TFYA 2OFHX 3CC7S 4F7VA 2VICA 5DG7A 4FS1A 3W63A 1Y11A 4DR4F 1RWVB 2EXUA 3HVTA 5ADZA 3HI9A 1N34F 2CJQA 5T14A 1HQ2A 1RU2A 1P6TA 4IFVA 1WDDA 3VR1A 5B0BA 3CCTA 2QL5B 1G7CB 2MB0B 1T3OA 2QA1A 3DNCA 2O01C 1S10A 3R27A 5FLXY 1QJHA 4C4WA 1LWEB 2R7UA 2VG7B 1EQ0A 3DM2A 4RW6A 2WSFC 3AAWB 2KFZA 3G96A 5DDQC 5KFQA 1FJCA 2HFNA 3IA0A 4DL2A 2GV1A 3AQOA 3BO3A 1KD1T 4WJBA 2BANB 5G4DA 3US5A 8RUCA 3FCWA 3CMQA 4IDKA 2DKOB 1IBLF 1FD2A 1UA1A 4Q2LA 2YNHB 5KFTA 2ZEJA 3IS9A 2KU7A 5L9XA 2HHQA 2QFJA 3QFHA 3IG1A 4OZ3A 2VFTA 5LJ5Y 1IWAA 4JV5J 4X4VA 3T9ZA 3K5PA 1RT4B 3QLHA 2QRRA 3H4BA 1NK8A 2LQ8A 1H0HB 3MECB 4ANCA 2V69A 3FBEA 5G0RB 1VQ4S 4X66J 4BHQA 1DQ9A 3NLCA 4C0HA 1IXKA 1S76D 2HBYB 3FSIA 1RTJA 4A4JA 2RB7A 2DVIA 3R1LA 1FRKA 1FWLA 2CPYA 2GS8A 2MKYA 1D8YA 3D6HB 2KG1A 3MM5B 5CYQA 2RT3A 2ERRA 4TU8A 3MMCB 1YG0A 4WIIA 1X8DA 3BREA 1NXIA 3MOJB 1WC4A 3W2WA 3NRBA 3SMZA 4P73A 3GJTB 3BM7A 3DU5A 2F40A 5HAOA 4KGVB 1CJKA 1Z1ZA 1PC4A 3OFEA 2N7YA 4ZVEA 2XS2A 4DI6A 2K3IA 3QZ8A 3KLHB 4WFBQ 4DQQA 4DSFA 4HH0A 4FPRA 3F56A 4DF4A 2H4YB 2HHHJ 3CDBA 1RSCA 3O5TB 4BC7A 4NZ7A 2GVZB 1B0TA 2G0IA 1UFLA 4M5MA 3UNGC 3FBCA 2VC0A 2K1RB 2R7XA 3LA0A 3AY0A 3CEDA 2OKQA 3RR8A 2F7VA 4TU9A 1PC5A 5F41A 5DGBA 3KUGA 2ATLA 4ZITA 3LP1B 2VONA 1S6PA 3QGGA 3N01A 4Y2CA 2C2ZB 1IWGA 2X1FA 4HR2A 3QZ7A 3GPAA 1S0OA 4CLSA 4I2PA 4MYUA 5CA5A 3L7PA 1HWLA 2HLUA 2RNEA 4HI2A 1GH8A 3RU0A 1SJ4P 4RNHA 3EWGA 4JV5F 2VKRA 2AW0A 2ZOGA 1U2RA 2KJVA 3AXMA 5HJYA 2YNGA 4R0EA 4X66F 2DNGA 4ZLPA 1ZPWX 5A0YB 1RXOB 4Y2KA 5ITHA 1NJXA 4AXJA 4UZBA 4K8RA 1UFKA 1CEZA 4AQYJ 4AT1B 3HHNB 2LXUA 1N5YA 2XGQA 4CLZA 1RT7A 1K9MT 1EKSA 4OJGA 5KT7A 4CH0S 2XMAA 2DITA 4M5LA 2C3PA 4Q8EA 1VQPS 4DUYJ 3W1YC 4ERDA 4U9RA 3FNNA 3HT3A 1F2HA 1N54B 4URGA 4DL3A 3M2VA 2QTWA 4RUAA 4XAKA 1H38A 1RBAA 3SDEA 4DV0J 3CF5Q 3K5NA 5D0RA 2IDLA 1FA0A 2JEIA 3FFIA 4A8MP 3MXHP 4GC7A 3QPIA 3NGDA 3D2WA 1WELA 4IRCA 1HI8A 2JEJA 1FKOA 4Y2MA 2CQ0A 4QWDA 4ZPTR 1URNA 1M1GA 2VBZA 5HQ8A 4ELUA 1N5QA 4CT9A 3RUBL 3HHLA 4DPWA 2FHOB 1XMQJ 4B3OA 4WBFA 3NCPA 1YVFA 3Q23A 4ECXA 2HVZA 2RU9A 1PCAA 4UTGA 3CO0P 1TL7B 4NPOA 4CM2A 4RNNA 4N8NA 2UXCJ 3DLEA 1TFWA 2X3GA 1NK0A 2I5JB 1FEEA 4ZVPB 2LEAA 1WI8A 4WPAA 4U8YA 3IXQA 1VK8A 3KOAA 3IM9A 2PO4A 5ETMA 2CWXA 1X4HA 3OUYA 1RWWB 4FYYB 3NS5A 3AD7C 2F8HA 1IUJA 2HVEA 3GE9A 1SL2A 1CULA 3WQPA 2E1CA 1NPRA 2WVCA 2YKQA 5KFMA 1G4CA 1X4EA 7AT1B 4AD6A 1TU0B 4RNFA 4Z37A 1PO6A 4DUYF 3CJQA 2LDIA 2P2CB 4LVNP 1SC1B 2R2UA 3QRQA 4CYUA 4L76A 1C0TA 4NLSA 4DV0F 3BQ1A 3UCZP 2KRBA 5DS7A 4LSNB 3A8JA 1Q81T 5K8NA 4O3QA 4ZHRB 3PTWA 4C97A 3ISNC 1SPBP 5KFWA 4Y2AA 4A8YA 4Q8FA 4ZPAA 1RCOB 2L9DA 1FVSA 4XO0A 1YI2S 3B78A 1MG7A 4LF4J 1SJRA 2W7AA 1H2VZ 2F3JA 1CJVA 4NMXA 3THPA 4ED6A 5GAEI 1LFPA 1YBTA 2HAIA 5RUBA 3W2VA 5HVFA 2Y8WA 3M8PB 1YBUA 1KFDA 2UXCF 3KXDA 1KHWA 1D9DA 2G1HA 1OQ6A 2B0GA 4KKOA 3H2VE 1L3VA 2F65A 1N8RT 1HQEA 2VBWA 1HFEL 4KAIA 1OPIA 2IIHA 3C16B 4DV3J 4LFCJ 1LWCA 2ZHBA 5L1IA 1X4CA 3OW2R 3SCJE 3ENVA 3J80Y 1ZM3A 4FYVB 2CNLB 4ZLLA 5IOLA 4G1QB 2HW3A 1JLGA 2W1BA 1R43A 3CJTA 4J9SA 3IMQJ 3KKFA 5HN0A 1RABB 3P49B 4IFYB 5B0FA 3Q83A 3VGTA 4ED8A 2DRDA 3KK1B 1FFWB 4CM0A 3R8YA 1RTIB 3RBEA 2UZAA 2CJAA 4KO0B 3DYAA 4YFUA 2RKIA 2YQ0A 3HHLC 4C7QA 4V19X 2W8LA 2L41A 1H7WA 1QLNA 4CLKA 5HVGA 2M7SA 2A0FB 4TLQA 3G71S 3ZZYA 1M90T 2G13A 1DZ5A 2ZJQQ 3NGSA 3PR5B 2GFFA 1P1LA 2XYHB 3MWBA 5C5JA 3E01B 4I6WA 2W7OA 3IR6B 5E41A 3OL9A 5HI7A 1NH7A 2H54B 4LF4F 3PX0A 1VBXA 2A6OA 1YJTA 5KTQA 3MM6B 3OVAA 3HFZB 4X62J 2WHOA 1FNOA 3DLGA 5KFEA 2BJDA 5IC4B 4NZ0A 2MDAA 3R5BA 4DHVA 3PV8A 3SQGA 3SV4A 4CTAB 2HFZA 3KK2A 3D66A 3KDNA 1FT8A 3HHKA 4EI2A 4RUHA 2BE2A 5KT2A 1H6KX 2HNYB 1S6QB 3OHBA 1BQMB 1WSRA 2A1BA 2F63A 1JIHA 1RE1B 2DRAA 4AL6A 4DV3F 4DCJB 4LFCF 1HPZA 4DFJA 3UN5A 3G2XA 5AXNA 3EZ5A 3VALA 1HWIA 2C2KB 1U47A 4AFFA 1I1GA 2APOA 3T5LA 3CJ4A 1AUDA 1NKEA 2H48B 2DNRA 1NJYA 3E2EA 3QNWB 2CADA 2IM3A 1WD6A 3FCHA 4MK8A 1S48A 3QQCD 4ZPWR 3S01A 2XLKA 3VAKA 4U7UK 2DO0A 1SCJB 5F3ZA 3HMJG 3P45B 3ILOA 1AT1B 4KYZA 5K8PA 3MMBB 3G8SA 1TAQA 4CRJA 1F0XA 3H7HB 1TL4A 5KG2A 4JI7J 3I9ZA 3KMSA 2ZH4A 1TELA 1YJVA 1RAJA 2PSZA 2NLWA 3VVTA 1MU2B 5KT4A 5EN1A 3CJ3A 4HKQA 3CULA 5B0CA 2AEFA 4YR2A 3HVWA 2AJQA 2XGPA 3CCLS 2UUAJ 1UAWA 4KGXB 3GP9A 4HACA 1KOOA 4J9OA 3G86A 2IMOA 2PFFB 3NOCA 1T9VA 3T5KA 2CQCA 4X62F 1SQGA 2GVDA 2V8HA 4YB7A 5IT4A 5GVQA 2OTJS 1Z2LA 1MWZA 2H51B 2DBBA 1NEEA 1L3KA 1ZPVA 4C9DA 2JHEA 1K1SA 2N7CA 2OPRA 4NLUA 4RW9A 2J76E 4CLTA 2JEFA 2VC1A 5D3GB 4J91A 5CCMA 1XR5A 2CA9A 2IVFB 3M2RB 5C2GA 1UMJA 2XI3A 4IG0B 3VCDA 2WB1D 1RJJA 2DYAA 2ZBIA 3CCWA 3PO5A 3WDOA 1RHMB 1HHTP 2HZVA 3RZAA 3L7UA 3CCZA 3KYLA 4HDGA 3UVJA 1R0BG 1OPZA 3IBWA 4C11B 4GKJJ 1U1KA 2W4CA 1LXJA 1KLMB 3OR1B 4UQGA 3TUPA 2AJ2A 2XS7A 2HZCA 2Y9HA 3WX4A 2ABYA 4MKYA 3OFGA 3DOLA 1OYEA 3MUVP 3D1OA 2WVDA 2XG8A 3FK4A 3CDEA 2WW8A 3TVYA 3AT1B 3JSBA 1S77D 2YNFA 5KFZA 2RQ4A 1GX5A 3DOMA 2W9CA 1F5BA 2UUAF 1PILA 1XK8A 3T3FA 2V0NA 1R8BA 1L3SA 3ITHA 3N6LA 5DM6Q 1AROP 3EVOA 3I9V9 5DGAA 4H54A 1N48A 3V6HA 2I6WA 4I7FA 5J1PA 3SCKE 1GX6A 2UU9F 1Y3JA 3IBFB 1VLYA 2UXDJ 2JRSA 1J5OB 1OO0B 4ANDA 2FC8A 3PRVA 1X5TA 3SI8A 2DGOA 5D78A 5IM0A 3PKYA 1GT8A 4PG5A 1TR0A 2DISA 2HK2A 2U1AA 2ZVSA 5DM7Q 2DNKA 2LQ5A 4RUBA 1LW2B 2KXNB 2KVIA 4Q45A 5K5MA 4ZJLA 4ED1A 3QFWA 3FC9A 3DCAA 4KIAA 1T8EA 1S9GA 4O23A 3MR6A 4JP8A 2VIHA 2LQJA 4NYOA 5FIIA 4CH1A 3UN3A 2KO1A 2XCAA 2YX1A 3BO4A 5HP1B 5FD1A 5J1EA 3LANA 5C42A 1MMDA 3M6XA 2AYEA 3GV7B 2MLZA 3VAGA 4F2RA 3IWNC 1RWNB 2DNOA 5F9NA 3MR5A 2G9OA 3M4XA 2IY5B 1PJ6A 4M8LA 4O44A 3CGIA 2ZUAA 4UOHA 5ETNA 1UJ5A 3SIPB 1RTHB 2NYHA 1HD0A 4B9MA 1GMUA 2RQKA 1RAGB 2GC8A 2RHSB 4DUTA 3FJ2A 3CCMS 4NLVA 3LPYA 4B9SA 2YWFA 2OEKA 5L8RC 2DGQA 3LPEA 4ID5A 2DNYA 4DR2J 2FVPA 3QSYB 3W9IA 2QMUB 2K8GA 4RNMA 2OP5A 4RLEA 1TL3A 2FC9A 4Q0BB 3POTA 1F2GA 4PPDA 4JBCA 2IJNA 4ZPCA 3PW2A 1Q82T 2V8DA 2ZKUA 2UXDF 3PW4A 1YK9A 3VAMA 1TUGB 3PXGa 3CJKA 2AMCB 2VUGA 2IJFA 4ZLJA 1K0TA 2RE1A 1VI7A 2KT5A 2MZTA 2ACMA 4J9RA 5A6WA 1IJFB 2W7PA 2YQ3A 3EE3A 2WVBA 4LBIA 5F8NA 2B8QA 1HW9A 1EP4B 5F8MA 5KT5A 4B9VA 4EBDA 2E5LJ 1RB0A 1P9YA 2CQPA 3H20A 2Y0BB 3NBPA 4F02A 4N56A 2YKOA 4EGLA 1TL5A 1WJ9A 3UW1A 1I94J 1E6YA 3KJNB 4CP5A 2HVIA 4WE1A 4DSIA 2JOQA 2PMZD 4PWDA 2HNDA 1MSWD 3M1VB 2R7WA 2ZD1A 1TKZB 3KDOA 2F9DA 2GJIA 3IN5A 2OJ3A 4ITSA 2A3JA 1Q7YT 1FRHA 3Q0AA 2LKZA 2QFIA 1T9XA 4DR7J 3R5JB 2NPIA 3W65A 3DRYA 2Q43A 3AOBA 4O4RA 1JLCB 3QGIA 2C3YA 2FJWA 1LWFB 4EEYA 3V4IB 2UXBF 4JI1J 1Y5NB 3CCES 1F60B 2YX4A 1LW0A 2MZJA 3DN9A 2GGPB 2J0QD 2IA0A 4NLOA 5FJ4A 3O3LA 2KT2A 3ILIA 4FBUA 5BJRA 2JDJA 4NA1A 3LALA 4CO4A 3V81A 1ITPA 3UCUP 1OYDA 3V6DB 3KUHA 5KFKA 2G4BA 4B3SJ 2R3VA 3C3LA 3UFCX 4DR2F 2D74B 5D8HB 4ZLNA 1NDKA 3AJ1A 4HDHA 1C1BB 4IR9A 2ZBQA 4CLWA 1EB0A 2J7KA 1DTTA 4A8SA 1HBUB 2HNZB 5E3PA 1TKDA 3DKDA 2RILA 4DWIA 3NAIA 3TOQA 2HPUA 2BQUA 3Q22A 1MMLA 1N6QA 3VQTA 1F5CA 1EHWA 3KLIA 1VRTA 3HVTB 4IH6A 3TW0A 4CLYA 3ZZZA 1QM9A 5B08A 4QYRA 3FBBA 1NDPA 1K1QA 2B7CB 3CNQP 4RU2A 2E5LF 4RWXA 4PXEA 4QIEA 4DL6A 4PG8A 3NGRA 1V5VA 2EBGA 2ILYA 4J90A 3BQ0A 4X4RA 2DT9A 3W61A 1I94F 3DMJB 4IKAA 1FHTA 4OX7A 1X9MA 5L39A 1FDBA 1NJWA 1VBZA 4OYOA 1S1WB 1WF1A 3PW5A 3V6JA 1LOUA 4F3QA 1I51B 4UOFA 5E5NA 2JEGA 3CB4A 3LAKA 3KG1A 3W62A 1YHQS 2L08A 4DR7F 1YSJA 2HWHA 2OFGX 4OL8A 3ET6B 4ZPBA 2R2SA 4LUBA 3BSCA 4RPFA 2OAUA 5A6PA 1WC3A 5KOWA 4J7CA 3ZC4A 5DRKA 4ALZA 2V67A 2UP1A 1XNRJ 2V63A 1D3WA 3UCGA 1D09B 3MMAB 1S6UA 2HRYA 2PE8A 3H98A 2NR0A 2B6AA 4LF5F 2JC0A 4TVAB 1NPKA 4WFXA 2IAJB 4K2JA 2YKMA 2ZH6A 1XEZA 4WYWA 4Y00A 4B9LA 1RT6B 1CLFA 3HCXA 3CUNA 2ZJRQ 2DHAA 4WFYA 1JK9B 4O3RA 1SQEA 3B54A 3U02A 4O3PA 2LECA 4C8ZA 1IM4A 1YRTA 3MEGB 1F9EB 3D5MA 4IQMA 4DBQA 1TK8A 4DQPA 4ZJQA 1R8HA 3MURP 3OD2A 4YN3B 2VDIA 3MM7B 1Y0HA 4LRDA 4USIA 3ZO7A 4USUA 4UZCA 2QX0A 1WKLA 1B7FA 1LQ9A 3NGTA 5F8HA 5AJ3J 2D3UA 4G1IA 1T9WA 4DCOB 4ZVQB 1PBAA 3EGZA 3SBMA 3M9MB 2ATCB 1SL1A 2PGCA 4PYAA 5IXUA 4LJMA 5M2RA 1UPMB 3ENAA 3IRXA 4E2FB 4LFBJ 2B56A 3S1TA 4Q5VA 2VPYB 1GXUA 1OIAA 1HNVA 4H4MA 4GKKF 3I32A 2R8GA 3SSRA 3AQPA 1YJWS 2F8MA 3NWGA 4U96A 2HMIB 2ZE2B 5LMUJ 3MCOA 4HT7A 3BKTA 3ZNJ1 4JI6J 2YPYA 4O4GB 2ZHAA 2CPHA 4ZP6A 4X4SA 1QAYA 3QRRA 2BOPA 4A47A 3LUYA 4PKDB 4QIVA 3M8ZA 1VIOA 1WG1A 2LMIA 2KN4A 1XNRF 2P9EA 1QAXA 4Y6IA 3NNAA 3QIPB 3P8BB 5U47A 4NI2A 2IJRA 1FEHA 4JI5J 4DQRA 3DDNA 1KP6A 1RHUB 4J37A 3IM8A 4O0NA 2BW2A 4OZLA 1M1HA 4JI0J 3PW0A 2ZNYA 4OYAA 4F50A 2NXEA 3ELHA 2V4JA 3WHIA 2HRUA 2AQ4A 3NGKA 1UFWA 4ZVSB 1YGYA 5C24B 4J9MA 3QGHA 3ETOA 2DNNA 4PUOB 2XSJA 1RQ0A 1WACA 3M2VB 4F04B 3P5BP 2V2VA 5D77A 1JX4A 3PHTA 4NEYA 3SQOP 5AJ3F 2CZ9A 3R1HA 3GG1A 4R5PB 4QR1A 4ZCIA 4OYBA 4M5DB 5DZ6A 4RW8A 4NEZA 1FXRA 3QJPA 4NRUA 4RW4B 3PFOA 4K4ZA 4P2FA 3R5DA 1UVJA 2Z57B 4RKUC 4DG1A 2W25A 3PJ9A 3JAMU 5CYJA 2CFXA 4KQZA 1MWYA 4K7QA 2J0WA 2FJEB 1JJ2R 4FBTA 3ILJA 3BBCA 1S72S 2K3KA 4JI6F 2HS4A 2IFXA 2H5IB 2W4DA 3MAAA 2EFQA 1X9SA 1RAEB 1N0VC 1S99A 4Y2IA 3IC1A 2W9BA 2BR0A 2R7OA 3DRRB 3BPSP 3TWZA 1R0AB 1SUQB 3IO1A 2JWNA 4R8UB 2RD5C 3MPYA 4CH7A 2KM8B 3TUJC 1IVZA 1W7WA 3TX8A 4JI5F 3M8QA 2WOMA 2VG5A 4QIGA 5LT5A 2FB0A 3R7SB 1TZ0A 2GNKA 2JZ5A 4H4KA 2HS3A 3VAIA 2VBXA 5ETTA 1JJCB 4JI0F 3C6TB 4IUFA 2GW8A 1S97A 1S1VA 1RWUA 2KVQE 4M63A 3IAS9 2GX8A 3OHAA 3J7A1 1X4FA 2XMUA 3PYGA 2CJXB 3B8HA 3J7YU 2VL1A 3W5YA 1CSJA 4K4UA 2ZFHA 2WB4A 5KFOA 4XIUA 3I5BA 3IFEA 1YWXA 4BCAA 5I3QA 2WSEC 3N6NA 2B4PA 3BZQA 2EEYA 3VHQA 4ILMA 1AYEA 2HBZB 3M32B
chains in the Genus database with same CATH topology
4I1TA 1U2RA 2KJVA 3CD7A 5CD4H 2NSCA 5HP1A 3P6YC 2YNGA 2FDNA 4OV1A 4N47A 2IM1A 2G1DA 4PCQA 5E2QA 1JXLA 1JLBB 4R0EA 5B09A 5IM0B 1QAIA 1ZH5A 2KZMA 2VG7A 4X66F 2DNGA 3VZHA 3T1AA 4ZLPA 1ZPWX 5A0YB 3CCVS 4FVMA 2OLWA 4Y2KA 2DD8S 3DOKB 1DFDA 5ITHA 2LLZA 3SFUA 2YWHA 1NJXA 4KSEB 4AXJA 2X1GA 3PDNA 4NA3A 2ZC4A 5KFDA 4MKAA 1CEZA 5D4NA 4OIXA 3GWCA 3HHNB 2LXUA 1N5YA 1S9EA 3CMES 2XGQA 4AUKA 1RT7A 3U27A 1RTHA 3UD3P 2IM2A 1K9MT 3OSPA 1DTQA 2JFKA 4C8OA 3DRPB 2GMLA 4OJGA 4NCGA 5KT7A 3HHEA 4CH0S 2D41A 2DITA 3RB6A 3FSXA 3PM9A 1X5SA 2KH9A 2D7SA 2OMLA 3KLEB 2IVYA 5KG5A 1I6JA 4ELTA 2FLPA 4ZPVR 2RQCA 2C3PA 1VGYA 3RB0A 2IA6A 1XR6A 2XCPA 2LEBA 1N36F 1HL6A 3L7OA 1VQPS 4Q8EA 2K7KA 1KOHA 1DQAA 4ERDA 5GAHI 4U9RA 3OSNA 3FNNA 3W2VB 3HT3A 2EI5A 2DRBA 1N54B 4N77A 4URGA 2RF2A 1A7GE 4DL3A 3M2VA 1S9GB 2BA9A 1XMOF 2OMOA 1NJIT 1P27B 1H2TZ 3JTOA 3U1LA 4RUAA 4XAKA 1QUVA 1H38A 4X4UA 2NS1B 3J7Z5 1TV6B 3NKYA 4WF9Q 4CT8A 3SDEA 4QOTA 1S1TB 3CF5Q 5J2QB 3M9OB 3K5NA 1VC6A 3MM9B 4Q0BA 4QCLA 1RT4A 4KKOB 1FA0A 2N82B 4ECSA 3GIMA 2JEIA 1HMVA 4ETXA 3MGJA 3FFIA 4A8MP 2NREA 1O5JA 5A8KA 3KLVA 3MXHP 4GO7X 2JLGA 3OFFA 3T5HA 3QWUA 4GC7A 4KTQA 3QPIA 3OV7A 3NGDA 2NQPA 3C6UB 5J1EB 2AYMA 3CD5A 2QIFA 3MM8B 4JV2A 2Q6CA 3D2WA 1WELA 2LCWA 3K8VA 4IRCA 1HI8A 2JEJA 4XPEA 2J5AA 1FKOA 4DFKA 2ROPA 4Y2MA 2CQ0A 4QWDA 1P9QC 2DHSA 3QYYA 2LEPA 3BGRA 4ZPTR 3UWTA 4P6QA 1URNA 4H4OA 2VBZA 3KLFB 1U6FA 4L72B 1ZAVA 3G4SS 3ZZOA 2O67A 5HQ8A 4YB5A 3JSMA 1R31A 3GIJA 1N4LA 4ELUA 3EX7B 1N5QA 3IR5B 4O44B 4CT9A 1HNIA 4OJ3A 3ZZ0A 5FDLB 2HHPA 1Y7PA 3HHLA 2DK2A 1V3ZA 2VB6A 5KFIA 2QMWA 2FHOB 3K0JA 4B3OA 3LP2B 1SV5B 1EETB 1TKXA 2UV8G 4I2QA 2D1CA 2B51A 4NLYA 2IRUA 4EO6A 1EP4A 3KMQA 5E0OA 4FXWA 3MFIA 4LVOP 3NCPA 1YVFA 1FKPA 1C4CA 3Q23A 4ECXA 3NCQA 2PD1A 1NKBA 2HVZA 2RU9A 2C2EA 4DN9A 2J9DE 2YKPA 2L48A 2XMTA 3HO1A 1NK5A 4KHMA 3HZGA 4A8WA 4NPOA 3DRSA 4YR0A 4G3IA 4ICLA 4RNNA 1UVIA 2MQOA 3SYZA 4DR1F 2EG2A 4N8NA 4OFZA 5KG7A 4ID5B 5SUHA 5H1SV 3DLEA 4C0OC 4UOCA 1PGZA 1AW0A 2B3TB 4KPYA 1TFWA 1Q78A 2X3GA 1NK0A 4LT6A 2I5JB 5A8RA 4MAKA 4NYZA 1FEEA 4KGMA 2HGNA 5JUMA 2QMXA 4C3LA 2XY7A 2RS8A 3KHGA 4FYDA 2NYIA 4QYZJ 1OSDA 3TAPA 3SXLA 3M1VA 1S0VA 3MFHA 1X5OA 1TL3B 2JH3A 3D0GE 5DQHA 1M5SA 2UUCF 3BR9A 1TKZA 2CPIA 2RJZA 2LEAA 3IWXA 2DGUA 4HI1A 2FHMA 1WI8A 4IO9Q 1VFJA 2EK1A 3KNAA 3EUNA 3IXQA 4BDPA 3V4MA 1VK8A 4XDCA 3KOAA 1ZTWA 4EU0A 4NLGA 2PO4A 3H5XA 4C3MA 3B4DA 2VFSA 1YJRA 3CJKB 5HL7Q 1T95A 2RQMA 2YH1A 1NH8A 1X4HA 3I5CA 1JLCA 4KC5A 4ZP7A 3OUYA 4Z2XA 3RTVA 1M5VC 1LWFA 3NS6A 3V4IA 5IT9Y 3FEYB 1DJ0A 3NS5A 3TVZA 4DL0C 2F8HA 1BQNA 1IUJA 2AJ4A 2ZH8A 4K4YA 2R8HA 1SL2A 3GE9A 4JI7F 2GGPA 1MROA 4BC9A 5GAHU 5EX3A 2E1CA 3CVKA 2YKQA 5HMZA 3H59A 3MTJA 5KFMA 1UEUA 1VJWA 3HX9A 4UW2A 3LGNA 3C8YA 3OR2B 3UDCA 1KVJA 4RBTA 1X4EA 4DS5A 5CZXA 4NXNF 3X1LB 3BS9A 4RNFA 4Z37A 2AU0A 3E3XA 1U1RA 3L3CA 2KZZA 4QU7A 4FNIA 1M90T 1PO6A 1D9FA 3NBPB 1S0MA 1G3OA 4KE5A 1QUPA 2HFOA 1URRA 4DUYF 2UUBF 4PG4A 4DDFA 3V6DA 4MMOA 2LDIA 3S6EA 3FDSA 1E6VB 4YHHF 2CJBA 2KJWA 2R8JA 4RU9A 4DSLA 4LVNP 2ZH7A 4DMZA 4OHWA 4QW8A 1E6YB 7FD1A 3DI6B 2R2UA 3FRYA 2ACYA 3F44A 4QPXA 1Y5LB 1H3DA 3GYNA 4H4KC 1RP5A 4RW7B 5EHHA 5E7OB 2DGWA 1SBRA 1WEYA 2VPWB 3G6VA 4X4OA 3OTCA 4DV7F 1C1BA 3I82A 3LW5C 1C0TA 1UVLA 2QA2A 4NLSA 1VQ5S 4DV0F 3BQ1A 2QV6A 1SC6A 2UVUA 5KG6A 1JLQB 2ZD1B 4P7TA 2H5EA 3UCZP 2KRBA 1HBUA 4IG3B 2HNZA 3GB0A 2AP6A 5DS7A 4N41A 3PEHA 4LSNB 5H9EJ 2ZITA 5KFRA 2QA4G 2NXUA 2HHXA 2FLOA 2VFRA 2M5YA 4HTIA 3R3TA 3GR0A 1J5EF 4K4SA 1Q81T 4I4BA 5K8NA 2R9LA 1VC0A 4O3QA 4ZHRB 4DX8H 4C97A 2Z0GA 1T05B 2L3MA 1P8GA 3ISNC 3OTBA 1VQOS 2FJAB 3Q8SB 2M8HA 2FLLA 4KV8B 1S1UB 5KFWA 1QSYA 2P6SA 4ILLA 4Y2AA 2CQBA 4YR3A 1RI7A 4A8YA 3PHEA 3JYTA 2FJXA 2D9PA 1LW0B 1LK5A 5DLGA 4Q8FA 4ZPAA 2JVOA 2L9DA 1FVSA 3DRPA 1X4AA 4XO0A 4AYBD 3G6YA 5DLFA 3ZFVA 1RT2A 1YI2S 2CQ2A 3B78A 3S8SA 3IR7B 1SJRA 4WXOA 1H2UX 4RZRA 2CPDA 3NG8A 4R0JA 2E9TA 4EBEA 3BO2A 2W7AA 1H2VZ 2DTJA 2F3JA 3MR2A 1U1MA 3THPA 4ED6A 5GAEI 3R5AA 3CCUS 1FTCA 1LFPA 1IKYA 5KFBA 2XB2D 2HAIA 2ZBCA 4CO3A 3V81B 2CYYA 1FRIA 3W2VA 2E7XA 1VQLS 5CYMA 3M8PB 4OX9F 4U7CA 3NNCA 1KFDA 3TYTA 2UXCF 3BSNA 3NMRA 1KHWA 3DMJA 3AA8A 3TA1A 5KAKA 4ES2A 5D4LA 4C3KA 1PSDA 3K58A 1D9DA 4K5SA 5F8LA 3LQVA 2KYZA 5EX0A 4F67A 4LIRA 3AB2B 1OQ6A 1S1WA 3EZUA 5K14A 2B0GA 2HQ3A 3MM9A 1X0PA 4KKOA 1N52B 3H2VE 2W24A 3GG0A 1L3VA 1N88A 4MTPA 1N8RT 1HQEA 2VBWA 1DTTB 1HFEL 4X4QA 4DFPA 4J9PA 4KAIA 1HW8A 1OPIA 2E5IA 3SCLE 2GHVC 5EWEA 5JXSA 1FNMA 2BDPA 4KHPF 2DR5A 3MM8A 3T6BA 3PZPA 5KG4A 3LF0A 2YVSA 4GKJF 2GCFA 3SSSA 2J6TA 2OPPB 2HHUA 4HL9A 2OD6A 1LWCA 1RT1A 2YKNB 2CQGA 3MD3A 2NPFA 4Y0FA 2ZHBA 1X4CA 4N5SA 5L1IA 3OW2R 1N5VA 2DGVA 4KT0C 3PO4A 3SCJE 4RWWA 3ENVA 4RNOA 3D0HE 1VRUB 4X65F 2DNQA 2R8KA 2DCUB 1CQMA 2ZKTA 4OHXA 5CZVA 1N6QB 3I5AA 3J80Y 1ZM3A 1U2FA 4F2SA 3UPFA 5KFCA 3KLIB 2I38A 3M2UB 2CQIA 2J9EA 4G1QB 1ZTTA 2HW3A 1JLGA 4J9SA 1R43A 4B3RF 5IQQA 5F8IA 5KT3A 1ZBTA 5T7LB 4ETZA 3HP6A 3KKFA 5HN0A 2LQBA 1C1CA 3K5OA 2HWTA 1IQTA 4J9QA 2O5DA 3P49B 2OPQB 3J7YI 2E5GA 4IFYB 4URQU 2M4MA 2YWEA 4LIWA 4PXDA 5B0FA 1JWWA 4QWAA 3QO9B 5LL6d 4QPTA 1AFIA 3KWMA 4F4XA 4ED8A 5HLFB 3MMAA 3H2UB 3KK1B 3T9NA 3BQ2A 4IOCQ 5JJBA 2I5JA 2RDJA 2OPSA 4OI3A 1RTIB 1K73T 3FEZA 2VH7A 3RBEA 2ASYA 2KRRA 2DNMA 2QA4S 4KFBA 2UZAA 3PRBA 2CJAA 4KO0B 3QAEA 4J9KA 2J6UA 4DL7A 2QO3A 2IAJA 1ELOA 4YB1P 3DYAA 4YFUA 2U2FA 2XBPA 2XMMA 2CZVC 4ED2A 3I0RA 2RKIA 3N0VA 3LWLA 4F4ZA 2CRLA 4YUDA 5A8WA 1RT6A 1BC6A 2XC9A 2JSXA 3HHLC 2GIRA 4C7QA 4V19X 2W8LA 4NXMF 4QWEA 1JNRB 2L41A 3MR3A 1HBOA 2ZH5A 4EZ9A 1H7WA 1QLNA 1CQNA 3AB4B 1SI9A 2P6TA 1UKUA 3THVA 2D9OA 1ZM4A 4OI4A 1N56A 2V2KA 5EDWA 2M7SA 1YTYA 4TLQA 1X4BA 3UR0A 1JLAA 2RSQA 3HKZD 3H8YA 2GMHA 3G71S 4OJHA 4JV0A 3ZZYA 4O3OA 3TO8A 3MEGA 1NB7A 2LA4A 2VODA 1UWBB 2G13A 5GADI 3DLKA 3KJVB 2RRAA 2KYXA 2LXFA 2RS2A 4RUCA 3QGPA 1DZ5A 2ZJQQ 3PR5B 1QSSA 3IRWP 1JMTA 1RT3B 2MQNA 5GAEU 1CPZA 1TK5A 4TY8A 4TU7A 3CCSS 1XBWA 2GFFA 1RK8A 3PJWA 1HBNA 2MY7A 3CJ2A 1P1LA 1JJ4A 3MWBA 2Q3PA 5C5JA 4G6VB 3MM7A 2ZH1A 3E01B 1KEKA 4I6WA 2W7OA 4BS2A 3IR6B 1RGVA 5E41A 3OL9A 2L9NA 1GXLA 2MXYA 5HI7A 2AGPA 1QE1A 3MEDB 1NH7A 5K8MA 3I96A 4KGKA 2IHR1 4OJ1A 4LF4F 4LQ9A 3TP2A 3PX0A 1VBXA 2GHWA 1YJTA 2QLXA 1S9FA 5KTQA 3ONQA 2Y1JA 3RW6A 3MM6B 1T94A 3OVAA 3I0SB 2WHOA 1FNOA 2PDAA 4K4XA 1E6VA 1KR4A 3QAUA 4HT5A 3RYLA 2OH2A 1KQFB 1BWEA 2XY6A 4PQUA 1SKSA 3DLGA 5KFEA 2MZSA 2BJDA 4NZ0A 4FNHA 2UUTA 2C42A 5L38A 4X4PA 1JB0C 2MDAA 3LP0A 3CDWA 3R5BA 5M2UA 4DHVA 4QIWD 3PV8A 1U49A 1JLEA 3SQGA 3SV4A 3TI0A 4CTAB 1T3NA 2VA2A 2HFZA 3KK2A 2X51A 2QSFA 4TYAA 3WBZA 5MAOA 6FD1A 1HWUA 2JFDA 3VF0B 3WZ0A 5GMKa 3BB5A 5LSOA 2C3UA 1V6HA 4Q2MA 5GAGU 2YKMB 3Q8PB 4ED3A 4DV6F 1JXEA 4C8YA 1KTQA 1FT8A 1U26A 1S1XB 2BVZA 2Z8QA 3HHKA 1Q53A 2WONB 4DV2F 3TAMA 2V4RA 4RUHA 1BD6A 2EK6A 2BE2A 2HQIA 5KT2A 1H6KX 1UJ6A 2HNYB 3KLGB 1S6QB 5I3UB 3OHBA 1BQMB 2A1BA 2AJ0A 1JIHA 4A48A 2MGZB 2DRAA 4AL6A 2MMYA 4IH7A 4E8UA 4DV3F 2HMIA 4LFAF 3RRHA 2VA3A 4ZVGA 2FY1A 3Q24A 2ZE2A 1SJ3P 4LFCF 4R25A 1HPZA 3H5SA 4DFJA 3GFXA 3UDLA 2OIHA 5AXNA 3EZ5A 1JLFB 1U1OA 3RR7A 4O4GA 1H7XA 2IRYA 2V9KA 4DLGA 1NK6A 3SSQA 3VALA 1HWIA 5HMYA 2GHPA 1VQNS 4EO8A 3KFWX 3N9UC 4MFBB 5BR8F 1U47A 3GSDA 4AFFA 4E98A 4LF9F 5E3RA 1VQYA 5K8OA 1I1GA 2APOA 3T5LA 2YNIB 1SXLA 3FSYA 3CJ4A 4ZKAA 3PRDA 5LXRA 1FK9B 3N4WA 4OX6A 1RTDA 1AUDA 1NKEA 1SJ1A 4MIAA 2DNRA 4YQWA 1NJYA 3E2EA 4W92B 2V9WA 4DL5A 2IM3A 1WD6A 3V5RA 3H4DA 3FCHA 1R6YA 2MKHA 5J2MB 1REVB 5CH7B 3QIPA 4HYKA 2BV3A 2DIUA 1IKXB 3RRKA 3O2IA 1QVFR 2ZUGA 3NP5A 4MK8A 4NLDA 4F3MA 5LMNF 1S48A 2MKIA 4ZPWR 2OSRA 7FDRA 3S01A 2XLKA 4P2SA 3CE8A 3VAKA 4U7UK 2DO0A 1TQLA 4WU3A 1FRXA 5BYSA 5F3ZA 3HMJG 4ZCMA 3IRXB 4EWTA 3UD4P 1N0UA 2Y0SD 2FGOA 1YRUA 5AE1A 3MOZA 1LV5A 1LWEA 1VMBA 3MDFA 5K8PA 1HNVB 3MMBB 4H4MB 3G8SA 1TAQA 1F9FA 3O8WA 4IO1A 5GADU 2AX1A 3TAQA 1F0XA 1BGXT 1U8SA 5HMXA 3EGNA 1TL4A 3G8QA 5DJBA 5J2PB 4F4WA 2AWZA 5KG2A 4CNYA 1Q8LA 2XMWA 2J7UA