2GX8A

The crystal structure of bacillus cereus protein related to nif3
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
370
structure length
359
Chain Sequence
IPNGHEIISLFESMYPKHLAMEGDKIGLQIGALNKPVRHVLIALDVTEEVVDEAIQLGANVIIAHHPLIFNPLKAIHTDKAYGKIIEKCIKNDIAIYAAHTNVDVAKGGVNDLLAEALGLQNTEVLAPTYAEEMKKVVVFVPVTHAEEVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLERVEEVRIETIIPASLQRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQEEMTLGQFAEHVKQSLDVKGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGHNVEKVMKQGVQKQLQEKVDAKKLNVHIHASQLHTDPFIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.2 A resolution crystal structure of Bacillus cereus Nif3-family protein YqfO reveals a conserved dimetal-binding motif and a regulatory domain
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Structural genomics, unknown function
molecule keywords NIF3-related protein
total genus 105
structure length 359
sequence length 370
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01784 NIF3 NIF3 (NGG1p interacting factor 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gx8A02
3N5BA 4YB7A 1HWUA 1QY7A 1UKUA 4CNZA 1PILA 2NUHA 3L7PA 2GX8A 2J9DE 4RWWA 4OZNA 4CNYA 3DFEA 1V3SA 2ZOMA 4CO0A 4E98A 3NCRA 4RWXA 5D4OA 4RX6A 4C3LA 3NCQA 2J9EA 4YB6A 3TA1A 2ZFHA 2CZ4A 5D4NA 4C3MA 4D3GA 3LF0A 2Z0GA 4CO4A 1H3DA 3BZQA 2NUUG 2XG8A 3M05A 3MHYA 1VHFA 2XULA 4NYOA 2V5HG 4WK1A 4CO3A 2PIIA 2O67A 4OZJA 2EG2A 4C3KA 1NZAA 4USIA 3T9ZA 1UL3A 1NAQA 3O8WA 4CO2A 4Y65A 2GNKA 1V9OA 2NS1B 4WK3A 3TA0A 3X3UA 2GW8A 2EG1A 3AA8A 5L9NA 1GNKA 1V6HA 1UFLA 5DRKA 2E66A 3TA2A 3NCPA 1XK8A 4IYQA 4R25A 4RLEA 5D4PA 2XZWA 2VD3A 1Q1KA 3AH6A 4Y6IA 1NH7A 4CO5A 1O51A 2XBPA 5D4LA 4ZK7M 5DS7A 2JJ4D 4USHA 2DCLA 1VFJA 4D3HA 3O5TB 1O5JA 4AFFA 3AHPA 4USJC 1UMJA 2O66A 1KR4A 4OZLA 3OPKA 1P1LA 2RD5C 1NH8A 4CO1A 2J9DA 2J9CA 3CE8A 4NYPA 1J2VA 3GSDA 3AA9A 1OSCA 4YB5A 3HLUA 1V3RA
chains in the Genus database with same CATH superfamily
3N5BA 4CZCA 3MAAB 4OJHA 5IXUA 1M5OC 2HVIA 2AJ2A 3KG4A 1CJVB 3B4DA 1WSRA 3ZTSA 3TZYA 1SC6A 1HBNA 4QIGA 5KFSA 3Q8VA 1PG5B 8ATCB 3H20A 2XY5A 4BS2A 2LEBA 2LDYA 3DRXA 4LQ9A 2X3DA 1FE4A 4P71A 2HHXA 2FLLA 3MWBA 4GC7A 3UNGC 5ETQA 1FX4A 1VQOS 2RILA 3CMQA 1Z1ZA 5KFLA 5B0CA 2OIHA 2Z2YB 1YJWS 3C15B 5AJ3F 1N6QA 4PAAA 3CJ4A 4C0OC 2ZBRA 3CCZA 4XPEA 1RBLA 4LVOP 1XMQJ 1HYSB 3LO3A 5D4OA 1FJ7A 2NSCA 4PZVA 3D6HB 5AT1B 2HHPA 2KVIA 3C3LA 3I56S 4RNFA 4PWUA 1L3TA 1TKXA 2XMWA 5CYQB 1FRXA 2XWXA 5FD1A 2J6SA 4K5SA 3AT1B 3EGNA 3MMCB 3ISNC 3B4MA 4K7QA 2VIHA 4JI6J 2VG6A 1YK9A 1S6PB 3QAUA 1VQYA 4TNOA 3Q23A 1HD0A 3RRHA 2AZ3A 5IV3A 1YIJS 4MFBA 3SEOA 2DRDA 3NAIA 3PYEA 2UUAF 2Z0GA 2R7UA 2XLKA 3G9CA 3IM9A 3I55S 1S1XB 1JK9B 1LWEB 2IJRA 3Q89A 5L9XA 1IJEB 3FUYA 3HHEA 1DZ5A 1QTMA 1QDUB 4YEAA 4HHJA 5IT0A 2PMHA 4OI6A 1LWCB 4QR1A 4CO3A 3KLGA 3JYTA 4XDDA 3UNYA 1Y3KA 4DX8H 1SJ3P 2HG4A 3MOZA 1VQ8S 1JLGA 2UUBJ 5HP1B 4B3RF 1WUUA 4X65F 1H2UX 1TELA 2BANB 2ACMA 4G1QB 4USIA 3OL8A 2EFQA 2W7PA 5K8PA 1N0UA 2ZM6J 1SPBP 1X4DA 2BACA 4M5GA 4KO0A 4WCEQ 1UA1A 2NS1B 5EGYA 2LDIA 3CC2S 1FKPA 2QL5B 2KTQA 3TA0A 1LW2A 3M9OB 5DQIA 1HLWA 2RRAA 5EUHA 3M8ZA 2EEYA 3MMAA 3VTIA 3EVWA 2B43A 2MDAA 2RJZA 4UT4A 1WELA 2FLPA 2KL8A 4ZLPA 3KUHA 2MGZA 2NR0A 4S0MA 2UP1A 4Y28C 2FHOB 4B3MF 4DR3F 4B9LA 2YKPA 2AF6A 1U7LA 3PYFA 4DPYA 1MWQA 2FQQB 2CZ9A 4LRDA 1JLFB 3OHAA 5SZTA 4ZOSA 1VQPS 4K4SA 1RT7A 3E01B 2QLBB 4ZCLA 3DLJA 3EGVA 1C1CB 4QIVA 3BEGB 4X4QA 2XI3A 4U8YA 4Q8FA 4DU7A 1VFJA 5A2QU 4AXIA 1MROA 2ZVIA 5D15A 5CCMA 3TQ1A 2KFNA 3DRSB 4USUA 4NZ7A 2EFVA 4TKTA 1OMSA 3QLHA 2JLEA 3I4HX 4Z37A 2H1YA 2A2DA 3OJUA 1SKUB 4ED7A 1T7PA 1AZSB 1UZHA 2MKYA 4RL1A 3RU0A 4DDFA 1Y5IB 4FF2A 4IOAQ 5I42B 5IWAF 2ALYB 2RMLA 3MM5A 1XR5A 3LALA 1RT6B 3ENWA 3C15A 3C14A 2YH0A 1FCAA 4OYBA 5E41A 2R7TA 2G2YA 2DNMA 2F9JA 2OEMA 5IM0A 3WDOA 2QYGA 4F3MA 4FF4A 2X1GA 4DR2F 1HNXJ 4M5HA 1VIXA 2WSEC 1U1LA 3QT5A 2CPEA 2LCWA 1LXNA 2B7CB 1ZPWX 4ZVPB 2R2TA 4F0KA 4XIUA 2HHTA 1KOHA 1VOMA 5DLGA 3J81U 2BE7D 2MHNA 4Y2IA 4A4JA 2ZJPQ 1U0HB 2EC2A 2L3MA 1HBUB 1I94F 1Y3JA 2H4WB 2ZE2A 1P9QC 1RADB 2HBYB 2V8PA 3WIUA 3X1LB 3LW5C 4K4TA 1LV5A 1NO8A 1RWNB 1PJ6A 3QT8A 3GR0A 3DLEB 2WW4A 2V94A 1FEEA 3C2PA 1RWVB 5IV4A 4LF7F 5GAHU 5KFAA 2DBBA 3KFWX 1KQFB 2UUAJ 2HQIA 4YMEA 3CCSS 3G6ES 1MMNA 3HVTB 2J9EA 1TV6A 4DL5A 2M52A 2J8SA 2HVEA 1Y0HA 2LMIA 2N7CA 4HTJA 4OX6A 1JLBA 5HVFA 2H54B 2PN6A 3HJVA 3U27A 1H98A 4DV4F 4ZHRB 2GMLA 4YS2A 3Q8PB 3CCLS 5FDLA 2R8JA 4FYXB 1WD6A 3NY0A 3H2UB 5A8WA 1FDBA 3PX0A 3W9IA 3JXOA 3DXSX 3E2EA 2AWZA 1JNRB 2C3UA 2ROGA 3MAHA 4KGZB 4NRTA 4ANEA 1WSVA 5LOQA 4LSZB 3Q8SB 3UCZP 2BKNA 1N32J 1UPMB 3DRPB 3OL9A 1M5HA 1V3ZA 3R5JB 2VV5A 3BKFA 4HDHA 3VQSA 3SQGB 2M9KA 4QCLA 4IRKA 1HQ2A 1LFWA 2XYHB 4PXEA 4PG4A 5C2GA 3HF5A 2V4RA 3HSGA 4H4MB 3V5RA 3BGFA 1FA0A 2AGQA 5DG8A 2GAHC 2RNEA 1XBWA 2KB2A 3ELHA 4QW8A 1VQNS 4FXVA 1IUJA 3AXKA 3CWJA 1H0HB 1Q78A 4W98A 4CO2A 2GMHA 3AB4B 3POTB 3G6XA 1UVIA 2F4VF 2QIFA 5F3ZA 5KT4A 2AEJA 3HK2A 3M2RA 3X3UA 1TV6B 4K4UA 3CCJS 3A3PB 3DLKB 2AJQA 3BDEA 1SUQA 1CJVA 1JLAA 3MUMP 3W7BA 2LQBA 1HBNB 1YBAA 2P5VA 4R25A 4K4WA 2Q66A 3KHHA 2XZWA 1F6TA 2VD3A 2VOPA 2Z56B 3EJMA 3V4IB 4WZMA 2BYCA 3M8YA 1SC1B 4QYZK 1AW0A 4C8KA 4I68A 3O44A 1VBYA 2V6AA 4GKKF 4ALZA 2HQCA 3BGRA 3H5YA 4EEYA 3ILIA 4LFAF 3NKYA 2VBYA 3DGPB 3TWZA 1RAJA 3V4MA 1KTQA 3ETMA 3MCOA 1RQ0A 3P45B 5D4LA 2YPYA 3OVAA 4NLVA 1EP4B 2FZGB 2B4PA 4N5SA 3CCRS 4OHXA 2MQLA 3RR7A 2YNIB 4LF4F 3FDSA 2DNHA 3R2DJ 1XMBA 1NZ8A 4FXDA 2CQ2A 5KG6A 2C2ZB 2CPIA 4Y0FA 4OZLA 2F8MA 3AXMA 2DR6A 4MKAA 3QPIA 2RB7A 4X62J 2RD5C 3OTCA 4HR2A 4NXMJ 2Y3YA 4IRDA 4JV0A 2XSJA 1IM6A 1B0PA 1TL7B 3O1LA 3OXLA 3RUBL 4MYUA 4Z2XA 3VZIA 4ZIVA 1RGVA 2B4VA 3GV5B 4MIAA 4FBTA 2WOMB 1D9DA 1KONA 1XNQJ 1RTIA 2PI5A 1IKWB 4OZ0A 3CXCR 1U48A 2H5EA 3CDUA 1SKRA 2DNYA 5JMNA 5KFKA 1U1RA 1FD8A 2ZOGA 3UR0A 4CNZA 4URGA 4C0BA 1Y00A 3MEDB 3N79A 2NYHA 1G1XA 3K89A 2HEKA 1XNQF 4AL6A 2G0CA 5EWEA 2DR9A 5GVQA 4P9SA 4MKVA 5EWFA 3T1HJ 1RTDB 2UUBF 3PVXA 5E3RA 5ETRA 5KFBA 2RRNA 3E01A 4OZNA 2W25A 1WC1A 3AODA 3KKFA 3HHLC 3MCMA 2DGSA 5H9FJ 4NOHA 4QPXA 2X3GA 5F8IA 1R89A 2DD8S 2RVJA 3P8BB 4ANDA 1YRTA 5I3QA 1ZZNA 2HVHA 2EFNA 1RA6A 4JP8A 3VGSA 4ENOA 2EK6A 1ZAWA 3NCRA 1ZM2A 1X5OA 1VLYA 2Y1IA 4K2XA 4ZP8A 4I1TA 1T9WA 1S6QA 5E3PA 1QAYA 2V2ZA 4FBUA 2PE8A 3SQGA 4IOBA 2CFXA 2J7WA 2HBRB 3OTDA 4LREA 4RBTA 1GTHA 1RJJA 3NGTA 2WZ1A 5D0GA 4JI0F 4OI2A 1N5TA 1WKKA 2EFOA 1RT4A 4LSNA 4F7VA 4HT5A 2XS5A 1OY9A 4ED4A 4ECTA 2W8KA 1S0MA 2P2CB 2HSEB 2CVIA 4D3GA 1TP7A 2VASA 5D3GB 3CJ2A 2VKRA 2C42A 4OFZA 4DUZJ 1N8RT 1UFWA 4L75A 2ILZA 3NNHA 1K0VA 2V8GA 3E3XA 2HYIB 2HHVA 5I4MA 4XTTA 1FRIA 1B7FA 2FY1A 2IRXA 2LQJA 4J9RA 2B9YA 1NJYA 1S1UB 3LP2B 4P7VA 1OJ4A 3TI0A 3NNAA 1IKVB 2GVDA 4JYAJ 2R8KA 2LVWA 3JS9A 1CJTA 3DLGB 2DISA 5AE3A 4JI8J 1EJ7L 2QE5A 1S1VA 2FHKA 3MCSA 1F5BA 2JHEA 1CJUA 5F8JA 5LMNF 1H2VZ 1EP4A 3KK3B 4CP5A 2DNLA 2AHOB 4PYAA 5HBMA 2HKEA 2AJFE 5D77A 3ZZUA 1S4EA 1X4GA 4JV5J 4PXCA 2FJBB 4C0HA 1X0PA 2DIUA 3LGHA 1GTEA 2OPRB 1DURA 1F2HA 2DGVA 2NXJA 1KLMB 2RHQB 1HNIB 1CLFA 2BR0A 3QAEA 1RZMA 3MM7A 3GSIA 2J5AA 3ZZOA 4F3QA 4DX5A 2IM0A 1ZS6A 1PYSB 2VF3A 4Z7YA 4EYIB 3TZXA 1EQ0A 3M32B 2RDDA 3EZ5A 3RB0A 2Z58B 2MKSA 5KG7A 2BW7A 1NSPA 3OR2A 4OYIA 4CTAA 1KKHA 4U67Q 2MY7A 2QN6B 2CJKA 1HPZB 4G1PA 1WKLA 2GVDB 2XTJP 5KFWA 4WU3A 2HHWA 2ZZMA 3CCTA 1REVB 4JUZA 5HJXA 3KK1B 1SJ1A 4PQAA 3IRXB 1WDDA 1RT5B 3G82A 3SZ2A 4JI1J 1WOSA 3W66A 3LPYA 2C3YA 4OL8A 1LEOA 3FSYA 4H4MA 3RAMA 1X60A 1M1GA 4M5MA 3SI8A 1F60B 2ZM6F 1IBKJ 1IR0A 2LA6A 2R8IA 2A3JA 3TUPA 3MCNA 4LVNP 4PG7A 1SIZA 1V5VA 1TVRB 2MZTA 5CYQA 3CMAS 4DLEA 2OTLS 4JI5J 2AYEA 4FKYA 4IFVA 2F40A 2HMIA 3HVRA 4IG0B 1F9FA 3PO4A 3I5CA 2OPRA 4LIWA 1XNRJ 3FSXA 5LXRA 4KBIA 2B9EA 3I82A 2F4FA 1QE1A 1V3RA 4B17A 2IVMA 2BJEA 2KHDA 3GP9A 2WRMA 4BWJA 4YFUA 1VISA 2VQEJ 2BA9A 1U1NA 2FTRA 2K3KA 2L9DA 1UZDA 2GHPA 3D5MA 4HLBA 4C8NA 2HHSA 3QT6A 1G7CB 1RTJA 1NB2A 3IWXA 4WE1B 1VRUB 3N6LA 2X1FA 1OQ6A 3TJ9A 2ZH4A 2HQFA 5C24A 1Q5YA 3O6QA 4WIIA 5AE2A 4F0HA 1JJ2R 1IQZA 4W92B 3L4BC 2FZKB 4DL6A 4C11A 3WC0A 1FKOA 3R5CA 4DI6A 3MM8A 3NGKA 4GKJF 4O0NA 2EWHA 3BGOP 4KRWA 3HDSA 1I6JA 1S76D 2YWWA 3RBXA 3GJSB 3WX8A 2CWKA 2X1BA 3HI9A 4PQUA 2V8VA 5IOLA 1N0VC 1R3NA 3D67A 3EWGA 4NRUA 1YJRA 2DK2A 2HMIB 5DZ7A 2KO1A 2FVCA 2AMCB 1BE4A 1NK7A 4ZP6A 2IJFA 2SXLA 4GKKJ 5IT9U 4O3SA 2FGOA 1ZBTA 2R3VA 2YNHA 3UFCX 4EBCA 1Y4ZB 5D4NA 2Q43A 4UQTA 2PEBA 4QU7A 2VICA 1MG7A 2J7UA 5KTQA 2AZ1A 4NI2B 4USVA 3ZFVA 4RO0A 1WNEA 5D6GA 4J9PA 1U1MA 4DR7J 1MN7A 1NJIT 3M2UB 4H54A 4ID8A 4EBEA 1UETA 2DGOA 1U8WA 5JVHQ 3ETOA 3MHYA 1PAUB 2DHGA 3HFKA 4ZLJA 2ZJQQ 3UD5A 1PJ5A 2GA7A 3PG9A 4QWBA 3VVTA 2NPFA 2XS2A 3NG8A 2O67A 2ALZA 3D3CJ 3TX8A 4ZJOA 4J9KA 2EG2A 3K17A 3HJFA 3JSYA 5KFCA 3M32A 3DRYA 1WOPA 2DO4A 2G0JA 2RRBA 4FS2A 3LTOA 1HYSA 3TZWA 1NSKL 1R8CA 2GHVC 1G6BA 3LQVA 3KG0A 3R5BA 1FHTA 3ENQA 3OFGA 2IYGA 4FDFA 4L74A 5LSRA 2DT9A 2XLJA 3Q22A 2HBZB 4QYZJ 2OEKA 3UD3P 2DYAA 1GNKA 5HK4A 3GFZA 2L9WA 2HRYA 3M30B 4B3TF 2KG0A 1KS2A 1RTDA 2V9WA 1WOOA 1R0AA 1UEUA 2BE2A 4NXNJ 4KGXB 4MK9A 1TVRA 3QZ7A 3HSZA 1HWJA 4MFBB 3QQCD 3SFUA 3M8WA 3MR6A 1T3OA 1VQ9S 1GX6A 1FJGJ 2E1MC 4DU8A 1S49A 3ITHB 3SSSA 3CIMA 3AAWB 1RTHB 4IH7A 5H1SV 2R8GA 4HI1A 3BN4A 3OFHA 2KFYA 1TZ0A 3W2WA 3V6HA 2B7BB 5F8LA 2MPUA 2VDHA 2UUTA 3MMCA 1KQGB 4AFFA 4I7FA 3BBCA 2VG7A 3HSDA 2OGUA 2CPZA 2QLWA 4IFYB 3UN2A 4ZVUB 2P6TA 2RUSA 4KFBA 2KG1A 4LF8J 2ZD1B 2VPYB 3IWNC 3W64A 1FDNA 5D0RA 4RU2A 2HIYA 2GQ2A 4DL3A 1TL5A 3M6XA 3TANA 3HD2A 1B3TA 1N36F 3QJJA 1S1XA 3KLEA 2UVWA 3RAXA 2HNZA 1JKHB 5HBMB 4P75A 5DDOC 4R0EA 3CF5Q 4CLLA 1SJFA 3SFGA 2EK1A 2YX4A 2GMJA 2MQMA 4J5OA 2RE1A 4OI4A 2HFNA 4KHPF 2PC6A 3PFOA 5E5NA 1YRXA 2IM3A 2VH7A 3F56A 4RNHA 3KYLA 1R0CB 3CJ8A 2RDJA 2R7XA 3HHLB 1ZA2B 3MPVA 4A8WA 1XWLA 1IR2A 4DFKA 3BO2A 4E2FB 4FYVB 3CC4S 1CEZA 3QO9A 2JFKA 2VFRA 4GO7X 3UWTA 1JLEB 1ZZFA 2D41A 5IWAJ 1EETB 3EUNA 1DLOB 4BCAA 1UVJA 4ZP7A 1NJXA 3M8PB 3MAAA 1JLCB 1FKAF 1JNZB 5D0EA 3I0RA 1T03B 1BQNB 3G8SA 4I69A 4TU9A 3T3FA 1GEHA 2H5JB 1HNVB 4ZPDA 2ZJRQ 3LWMA 2CQBA 3RBDA 3VAHA 2AYMA 3IAM9 4R5PA 4OZ3A 3PKYA 1MW7A 4ZS6A 2D74B 3GR1A 2ZDPA 3OSNA 1WI6A 4OYMA 4OYZA 1P1TA 4IDKA 1D9AA 5GAGI 3H2VE 4ZKAA 3EYZA 2V8DA 1MSWD 2ASLA 3W5YA 1OWXA 3Q0AA 5HROA 1D1UA 2GS8A 1YZ7A 3HULA 4N8NA 2WBMA 4MK7A 2XHCA 2N3LA 4DUTA 3S7RA 1B0TA 2MLYA 4ATNA 5C5JA 3P49B 2HPUA 2JC1A 4DPXA 4NA3A 3WIVA 1X7VA 2YWEA 3IG1B 4ZVTB 2Y1JA 4F4KA 2QL7B 3FBBA 3IRXA 3TRGA 1LW0B 3G82B 1FERA 1WORA 3SDEB 5J1EB 1FEHA 4DV6J 1XC9A 3HZEA 3V2UC 3H5SA 3R27A 4F4ZA 2BQUA 1JX4A 2C2MB 2E5LF 2RKIB 3D0IE 2FHMA 2JRSA 3MTJA 4NZ0A 4DQRA 3IS9A 2BXJA 2HFUA 1C0TB 2W2MP 2R7SA 2M2BA 4P7TA 2KJVA 3CIZA 2AJ0A 1X9WA 2FVSA 3RRGA 2OFGX 2OUGA 3RB3A 2ZHBA 3FSIA 1HNVA 2GGPB 3GWCA 4QWAA 3FNNA 3JSBA 3EDQB 4KYZA 1VC6A 4Y3CA 2AX1A 4R5PB 3T9ZA 3JQJA 5DQHA 3NOCA 3ZTRA 1Q53A 3TVKA 3R9LA 4USMA 4DUYJ 4PXBA 2BRKA 1HBOA 5BR8F 1FFWB 2AD9A 5L46A 2BV3A 2UVUA 5KFHA 1N32F 4RW8A 2P8IA 1EQMA 2WOMA 3EXCX 3MMJA 1NLKL 1UFLA 2A6MA 2DXDA 4PPZA 5I3UB 1FDDA 2YTCA 3J7ZT 2AU0A 2IDLA 2Y8WA 3N01A 5KFEA 5DG9A 2DNPA 2WSCC 2JOQA 2YNFB 3KWMA 5AXNA 3QJPA 4QJVA 4HTIA 3JSRA 4RW4A 5ETSA 4OV1A 1NSAA 2K1RA 4V1Ak 2IYIA 1NEEA 4O4GB 5HVHA 3D0HE 4ES1A 4Q2MA 4DSFA 1QVFR 4O4RA 1D8YA 2FD2A 4RNOA 2RDIA 2VJUA 4H4OA 5LSOA 3DRPA 3O2IA 5DS7A 3RW7A 1N34J 1SXLA 2AT1B 3WX4A 1WEYA 1S9EA 3DOKA 1XMOF 3LGNA 1CJKA 1UP1A 2ZDOA 1NHUA 5A8KA 1IXKA 3M6WA 1O5JA 2W9CA 4B08A 1D8ZA 1HMVA 2DEIA 5E3AA 1GMVA 3AHPA 2FPHX 1X4BA 2C2OB 3PR5B 3L3CA 2E9TA 1ZA1B 2FB0A 2HZAA 3KJFB 3M6UA 2QA4G 3OPKA 1VBXA 4JI7F 1YBUA 4M8LA 4WP8A 3HKZD 3VAGA 2DH7A 1ZM9A 3ADAC 1S6PA 2WBRA 1MROB 3EICA 3HO1A 3I0RB 1SIWB 3TVZA 3PO5A 1TFWA 4Q7AA 4K0KJ 4WP3A 1QTNB 2I9SA 2OKQA 3M8SA 2CJBA 3M4XA 4DR7F 1A9NB 1HNZF 3W2VA 1XMQF 3OBIA 1OSCA 4A8YA 1X0FA 3VAKA 2K1RB 2Z30B 4ED1A 1PILA 1TUVA 4H4KC 4DS5A 4WWSA 1I94J 2GQCA 3D54A 4V19X 1WC5A 1VI7A 4OJ3A 4TQSA 1HQUB 2HZCA 1NK8A 2F65A 2WCXA 4J9UE 4KE5A 4NXMF 1H38A 5HP1A 3IRWP 5FIIA 3HVAA 2A1BA 2YKNB 3QT7A 2RQKA 2Q3PA 3CJQA 1S9FA 4IR9A 1MU2B 4ES2A 4ECWA 1S1VB 2CJXB 3TAPA 2E1CA 4WTOB 3VHQA 1TU0B 4DV2J 3QSIA 1MWZA 2RKIA 4DV5F 1NJZA 2JEFA 4L3NA 2IA0A 3DU5A 4DFPA 3T19A 3AB2B 4M5LA 4EO6A 4QWDA 1ZPVA 1RAEB 3IO1A 2WK4A 4J37A 4PEOA 4C3LA 5LT5A 2VKZG 4QWCA 3PR4A 4OI3A 2LQ5A 3FZ2A 2CQ1A 3KNAA 1PSDA 1RKIA 2I2YA 3C16A 4ZP9A 1PBUA 4WBFA 2FJVA 1SKSA 2XEXA 1BQMB 2Z2ZA 2JVRA 3H98A 1JKHA 3QATA 4KH0B 4DPOA 4WFBQ 4DR3J 4Q2LA 1Z2LA 3W5ZA 5ITHA 1VQ4S 2MZSA 1K1SA 3OL6A 1G3OA 1S5ZA 2HQ3A 1N4LA 2EKYA 4I7FB 3UW1A 1H72C 3BPSP 3MECB 3TR5A 2B8PA 3EM1A 1VHFA 3UE2A 4ZPWR 4LF2A 5IT4A 1HNWF 4H4KA 4Y34A 3GQCA 4ZLNA 2F3JA 2W4PA 3KLFB 1TKXB 2R42A 2MLXA 3NRBA 1JXVA 3I6PA 2QSWA 3ZZTA 4BC9A 1X5TA 5DDQC 1CULA 3TEHB 1KHWA 2F4VJ 3H7HB 3EGWB 1GMUA 3ISZA 3UR3C 4C3KA 1R43A 3G6YA 1RWPB 2AGPA 2KXNB 3NP5A 1Y5NB 2NYIA 1EZZB 1V9OA 4KGVB 3NGDA 1UWBB 2Z8QA 1Q8LA 4LFBF 1JB0C 3K0JA 2B8QA 2OP5A 3GMGA 3M2VA 5GMEA 4K4XA 1XEZA 1FWPA 3SBMA 3BO3A 4WYLA 4ZPVR 2LQ9A 2BKOA 4NX9A 4TYBA 1R0AB 5C2CA 1LKZA 1QE1B 3EDRB 2C3PA 4DJBA 2MZRA 1GXLA 4DSLA 4F4XA 1R27B 2ZNYA 1SC4B 4M5IA 4LSLA 4DQQA 1LNQA 4F8RA 1JLGB 5HMXA 4DF4A 1EAYC 1FVSA 2BANA 2PMWA 2MEWA 2ZE2B 4HH1A 2ZZNA 1YJ9S 1HBUA 3KLHA 3N5FA 3WBZA 4J9OA 3BM7A 1C1BB 4RBVA 3GZ7A 4JYAF 2MKHA 3ZC4A 4A8XA 3MI7X 4DPWA 1VQ5S 2C2KB 1UVKA 2QX0A 3MEGA 4ZVRB 4QWEA 3IS9B 3J80Y 2I38A 1IBMF 1LWEA 3DKDA 4QZVB 2I5JA 1JJHA 2K06A 2AV5A 2O5DA 3BB5A 3VZHA 1QSLA 4O44A 3U02A 1U1PA 2VBWA 3DLGA 4BHQA 2YQ0A 5J2MB 1Z2ZA 3VV2B 4DQIA 1J27A 1R8HA 1B0VA 1HWLA 1RBAA 4RW6B 1T05B 4UY8T 2QLXA 4DFMA 1PGZA 4LBPA 2IMWP 2ZKTA 2CVEA 4HT7A 3F44A 1HIYA 4I64A 5IZHA 3NBPA 1J2VA 2A18A 2F9DA 4EO8A 3O3LA 5CZXA 3N0VA 2ZVSA 3Q8UA 1B99A 2OEJA 3F41A 1FE0A 1RWKB 3GSDA 3J7YU 1F3VA 3TP2A 4M95A 2H5IB 3PV8A 1Q86T 3JSMA 3FBCA 1P8GA 1GX5A 1DARA 1KLMA 2DH9A 1FTCA 3GU0A 3W9HA 3D0GE 3M1VA 4OJ1A 4B3OA 4C4WA 1RU1A 3DRSA 4NA1A 2W1BA 3Q83A 3UDEA 3OTOF 4CIOA 3K5MA 3CDAA 4JOUA 2ZH6A 4DV2F 1AUDA 2BDPA 3T9NA 1HR0J 2FLOA 2C2NA 4MT1A 5AE1A 1PIEA 2G1HA 2OPSA 2C2RA 3DLHA 4FKXA 1NU4A 3FCHA 3FGVA 5JXSA 3KHGA 1FJEB 5L1JA 1U8SA 5KT6A 2HFOA 2PT0A 1N54B 3MGJA 4TXSA 3LAKA 1SB6A 3POTA 5ADZA 5HLFB 2RU3A 1U1QA 2DR8A 3K5NA 4NA2A 4ECRA 2LFVA 2PI4A 1OSDA 2R7OA 4CLFA 3RG6A 3CD6S 2RAQA 2HS4A 2G2ZA 3C66A 5J2PA 1QAIA 2G1DA 3NBPB 4F4YA 3FJ2A 3NOGA 3QGGA 5J2QA 2CQDA 4DL4A 3K57A 5AXKA 5C7PA 1AZSA 2H65B 4IG0A 3RBEA 4E0DA 1X5SA 1CQNA 5F8HA 1TKDA 2J0QD 3ILOA 1FRLA 3HKWA 4O3PA 5KFUA 2OI2A 1UPPA 3DGPA 5KG3A 4RUHA 3M8RA 1D9FA 2UU9F 4QBUA 1VJWA 3MR2A 4JI0J 1PCAA 4OI0A 1F2GA 1LK5A 1S9GA 2B9XA 3DLEA 4X84A 2HNDA 3CJ0A 3EE3A 2NUUG 2O1PA 4X66J 5M2RA 2DNOA 4LSNB 2UXBF 1S6OA 2DR7A 1SH3A 3I0SA 2CG8A 3HVTA 2VU5A 5B08A 1JIHA 3V6KA 1A0OB 2C3MA 2V67A 3LA0A 1DTTB 3PFEA 4OYOA 4C11B 3FZBA 3J80U 2K2PA 4ZCIA 5B7WA 1UJ5A 4GVLA 5GMDA 3G87A 4F0MA 1HQEB 4LQ3A 1IKYA 1NM2A 2VFUA 4NEYA 4OMFG 4A47A 1S10A 5M2UA 1MN9A 2AP6A 3NWGA 1CJTB 1FK9A 1T11A 2F5GA 3H8YA 2FJEB 1VRUA 1NHVA 4WP9A 4DFJA 2OD6A 3KHRA 1NDLA 2EC0A 2OELA 1NKCA 2OMOA 1Q79A 4DR1F 1IBCB 3TZZA 3MEDA 4P2FA 5GMKa 2GCFA 2MKCA 2P9CA 2B3TB 3SMZA 3UN5A 5ETKA 1CQMA 5FLXY 2EXUA 4CLSA 3UN3A 4K4YA 2CDQA 3Q86A 4AQYF 4LFCJ 5G0RB 1JLEA 3GILA 2O01C 1NK0A 1MMLA 5K20B 2V8HA 4USHA 1YITS 5ETNA 4OX9F 1U2FA 2VFSA 5I42A 4EMDA 4M5DB 1HBMA 2BM1A 2QFIA 4B9VA 3A8EA 5F9LA 3G2XA 4USJC 3VF0B 2G2OA 5JVGQ 2H48B 4JI3J 2D69A 2NPIA 5E3CA 3LH2S 1H7XA 2L9NA 1KVKA 2JSXA 1PAEX 4FF1A 1AXQA 4K8RA 4F02A 4NYPA 2YY3A 1F1BB 1FXRA 2E7VA 5KT3A 4MMOA 3VALA 5D3GA 3RW6A 4MIBA 2FY8A 3RJMB 3VAMA 4DWIA 3FCWA 1S7IA 3M30A 2CRLA 4YQWA 2XQCA 2DEJA 1RCXB 1I1GA 2XNQA 2MZJA 2RHSB 2V63A 3PACA 1QAXA 2WVBA 2YX1A 3CTRA 1QD1A 1WG4A 2BZ2A 2Q6BA 1DJ0A 1SJRA 1RI7A 3MM9B 1RDRA 1RHRB 4ZCKA 1LXJA 2NUHA 4EUVA 4F04B 3OLBA 3RB4A 5H9EK 2WVFA 1Z4UA 2HLTA 1VYAA 3CD0A 2VB6A 1VC5A 2G4BA 4QIFA 1TKTB 3GFYA 1NKBA 4O23A 3ILLA 3GV8B 3FBEA 4ZDNA 2BQRA 3CD5A 3I5BA 4ZVOB 2YPZA 2HFZA 1A7GE 1DY3A 4UOHA 2KRBA 5IQQA 3H4BA 3ULHA 3H4DA 5B0FA 4IOCQ 1RTZA 3J81j 4JI4F 1CJUB 2ASDA 2C3OA 5E33A 2BE2B 4KHPJ 4J91A 3FMWA 2YQ3A 3BV8A 4I67A 4Q44A 2K7JA 4CM0A 2GVZB 1T05A 1SC3B 5HMYA 5K14B 5LMNJ 4ELVA 2DNZA 3W9JA 1FD2A 2CQ0A 4C8OA 2PA3A 2QO3A 3VGUA 1S1WB 1SQEA 4HI2A 3AQOA 2FDNA 5GAGU 1PO6A 4X62F 1Y7PA 2V34A 4LJMA 3V81A 1FRKA 4C3MA 4RZRA 1YI2S 1WKJA 1Q81T 1RLDA 1T8EA 5HN0A 4NCBA 1RTIB 2IRYA 4FYYB 5CD4H 2W9AA 1RAIB 1REVA 2UZAA 1KQKA 4M63A 2G0IA 1RT5A 2B9WA 3KDOA 1IBMJ 2MQOA 4OQJA 4UW2A 4DBQA 4F4AA 2DJWA 1GAOA 3CSKA 3PX4A 1B4SA 1C4AA 3LP1B 3PNIA 4DQSA 2YWGA 2HQDA 1RWMB 1EETA 4RR5A 1Q4RA 2UXDJ 3KTQA 2XMUA 1HMVB 2JH3A 3PYGA 1VC0A 2DXFA 4NMLA 3AD7C 6AT1B 3QZ8A 2FJWA 1PKUA 1NZAA 2HRTA 2MSSA 3R5GA 3BSNA 1IBLF 2XC9A 3RR8A 1W2BR 4XAKA 3V4IA 4X4TA 2M70A 5GADU 3C6UA 4LR8A 3K5PA 5LM7E 5B09A 2X1AA 5HANA 4TU7A 2R7QA 1K9MT 4C8YA 1EKRA 3GIJA 3AY0A 3HHLD 2CIMA 4YDXA 4EI2A 4MKBA 2YH1A 5J2PB 1U49A 1X4CA 3CO9A 2FYXA 4OIXA 4OV6A 2CA9A 4AYBD 3DOLB 4JBCA 4P2MA 2IFXA 3DC2A 2CYYA 3PDNA 4A8MP 3AFGA 2ZH1A 3JTOA 1IKWA 3EMTA 4HH0A 3D1QA 4QIWD 2KI2A 1AFJA 1HL6A 2ZBQA 3D66A 4CLZA 3FQKA 1S77D 3VCDA 2IAJA 3GJTB 5J1EA 3MPUB 1JJCB 1BGXT 2W7AA 3BYRA 4A8SA 4B9MA 1I3OB 4MAKA 1RUSA 4X2BA 4EWTA 4KPCA 4ZHRA 1U24A 1TL7A 3OD2A 3UDCA 3M8QA 4OX8A 4DUZF 1T9UA 4OHWA 3BDPA 4Q8EA 4FZVA 5DDPC 1N5QA 1W7WA 2PDAA 3QYYA 1FF2A 4DV3J 1SL0A 4P52A 1EX8A 4RUCA 4N56A 4OYWA 1YJNS 3BQ1A 1I51B 1P1LA 1KRPA 3W3SA 2GAGC 1IR1A 2OAUA 4ZVFA 4KC5A 2HVZA 2PFFB 4KKOA 2RF2B 1KFDA 4DX6A 4Q0BB 1NPRA 3H59A 4QU6A 5C25A 1DQAA 4HHHA 3HSJA 5MAOA 3EGZA 3KK1A 1CBKA 2BBEA 4PG5A 5KFPA 2U1AA 1NPKA 1RACB 3H42A 3KJVB 1YTYA 2DNGA 2H4YB 3S8SA 1ZTTA 2MYFA 2WSFC 1FRHA 1VJQA 3IXQA 1FX2A 1TAQA 3A8KA 4K50A 7AT1B 3ZNJ1 3G71S 1HBOB 1L5UA 3HXMA 1FKPB 3A12A 5KFNA 5DGBA 4USKA 1U0SA 2JC0A 3AOCA 3DRRA 4YY3F 1NUEA 1E6VA 2ACYA 3HZGA 4I6YA 2N3OA 4HL9A 2ZH5A 4IG3A 4XO0A 1NKEA 2XMAA 1TMJA 4G1IA 2J0WA 3TQEA 4LT6A 4IO9Q 4LF4J 3ET6A 4FPIA 3BGUA 4I2QB 2RQ4A 3DOMA 1OO0B 2W2PP 4I6WA 4RX6A 1NK5A 3K8WA 1IVZA 3NCQA 3K5OA 4TVAB 5KOXA 4U6PA 4GVBA 4KB7A 1RT3A 3CDBA 5U47A 3PHTA 4IO1A 1R31A 5A2QY 3CPWR 2BOPA 4NWBA 2N4CA 1LWFB 3I87A 1FWLA 2IMOA 1X31C 5F0WA 1M5VC 1S9EB 2ZFHA 3DOKB 1VBKA 3DDKA 8AT1B 2XO6A 2Z57B 1DTQB 3OLAA 4IR1A 5KFFA 3M7VA 2J76E 3OQ2A 4Y2CA 1HBMB 2J8AA 3ISND 3LF0A 3MPYA 3MM8B 2QV6A 3QSYB 2UUWA 3VAIA 1VQMS 5CYMA 2YVSA 2P6SA 3CVKA 6FD1A 2V9KA 4MYTA 4NYOA 2VHGA 4CTAB 2ABYA 1T0TV 1SL1A 1YBTA 1S1TA 2CPDA 2JDJA 2XZDB 1RT1B 4M5KA 1NK4A 1RTJB 1RABB 5KFMA 3OFFA 4X4VA 4CYUB 4OHVA 1IKXA 3KLVA 2Q79A 2D9OA 5A76A 1SJQA 3UDVA 1SQGA 3CB4A 5J1NA 2CQIA 2CUYA 4B3MJ 2MMYA 3AJ1A 1HNIA 1GT8A 1T9YA 3FC9A 2UV8G 1UFKA 5DM7Q 4W90B 2J7KA 1KVIA 2HFSA 2GW8A 4ZA1A 4KPYA 3UVJA 1F5CA 3ZXWA 1VK3A 1LQ9A 2XWYA 2GGPA 3SYZA 2Y9HA 2JZ5A 3A4TA 4KIAA 3TA2A 5KFOA 2QJ3A 3HHLA 1HHTP 2DY9A 2LA4A 5F3TA 1J5EF 3KJQB 1KEKA 3C46A 3NGSA 2LEAA 5K8MA 3TAQA 4F2RA 2HQGA 2CDRB 3P6YC 2DNKA 2YX7A 3VVUA 5IC4B 3PW4A 3D6TB 1WF2A 3UCUP 3CW2C 1HFEL 3BKUA 3W8GA 1ELOA 5I3UA 2QG9B 3R3TA 3US5A 4ZK7M 5C25B 1WI8A 4NZ6A 3CCES 1F9HA 4OYPA 3BR9A 4AT1B 2FJDB 2RQCA 5F8NA 3T6BA 4EYHB 4JI2F 3O5TB 3LP0B 5ETPA 5K14A 2XM3A 3RAQA 4DS4A 2AJ1A 2BJ8A 4USTA 3VAFA 1RHMB 3R1HA 1T02A 3S1TA 3J7A1 2CPJA 1VLOA 2DXEA 2HAFA 2RS8A 4EK2A 2HS3A 1XIQA 4ILLA 3VGVA 4IDKB 4J9NA 3HHDA 1J5OA 4N7TA 2UU9J 2WVCA 3QRPA 5FDLB 3NNCA 1Y9OA 2K7KA 2WB1D 3DYAB 4LIRA 4FNIA 4F4WA 4ED8A 1YWXA 2ZBIA 4FVMA 3VWSA 4JI7J 4P2SA 4PWDB 2Y1LB 1YHQS 5KFIA 2QGFB 3IG1A 3C8YA 4AXJA 2L48A 1N5VA 4X66F 2M8HA 3GONA 3ITHA 4MJKA 3SDEA 3TAMA 2ZH9A 1RT2B 3VAJA 4F50A 4DSEA 5C24B 2FVPA 2D1CA 1WACA 3ZTPA 5IFMA 3GIRA 2CNLB 5KFRA 3TOQA 3ZZRA 1WHXA 2QC3A 2RIJA 3JQMA 4X64J 3N9UC 3FBFA 3A8JA 4NLQA 1QSYA 4YHHJ 1S72S 1UAWA 2APOA 1XERA 1Q95G 1NMEB 1XR6A 3CT9A 3CCVS 1U1OA 3J7AN 2NREA 4LFCF 4LF6F 4PQUB 3S01A 4OZ1A 3PW5A 3MR3A 4GC6A 1YG0A 5EDWA 1OQ3A 1JLFA 3BSAA 1UEVA 4QPTA 4IH6A 2FIUA 2GO9A 1CS4B 2G9OA 3PRDA 3A1YG 4NLOA 2OO4A 3SCKE 2R7RA 3CJSA 2LYVA 1UWAA 2V4JB 3J7YI 2YKQA 1QLNA 4B02A 1S4FA 4CH1A 2DPJA 2NZ4A 3CD7A 2NZCA 1PJ7A 4U7UD 1D0EA 1RE1B 2YWHA 3DHXA 4PWDA 4QOTA 1S1TB 1RK8A 2UUCJ 4Q5VA 1HI1A 3M2UA 3OR1B 1U25A 4I6AA 5CAAA 5K5MA 4YOEA 2L41A 3A3NB 2HAIA 3TX0A 4JI5F 3B54A 3SCIE 1TTHB 2QMXA 3FCVA 4DN9A 3HM9A 2FJXA 1SVDA 3AJDA 3D28A 4YP3A 2VG5A 2I5JB 3KLEB 3IR7B 1BXNA 3THTA 2YNIA 5GAEI 2LQ8A 4Y2KA 4OLPA 4CLUA 1UW4A 1AYEA 2XHWA 4UOGA 4RNMA 3BZQA 4LF9J 2XG8A 2JNJA 2W9CB 4WJBA 2EI5A 3I4PA 1ZOTA 3SV4A 1CJKB 4IUFA 1KNZA 5A8KB 4NL5A 3ZTOA 4DL7A 3W61A 5KFDA 2A0FB 1RTHA 2CPYA 1N34F 4EZ9A 2AYBA 1WHWA 3DDNA 1VDHA 4ZVGA 1HWIA 4MK8A 2KHCA 1X5PA 3W2WB 3T5LA 3Q24A 2Z4PA 5F9NA 3EVMA 1X8DA 2W8LA 1R8AA 3O8WA 2CJQA 3VQTA 3KK2B 1L3VA 2KRRA 2NXUA 2N7YA 3BYPA 3QIPA 4IG3B 3TO8A 1TL1A 2GO8A 2Q1LA 3I9V9 3T5KA 4JV2A 4ELTA 2M0GB 3AD9C 2B5JB 2W01A 2YNGA 5KT7A 2WONA 1N33F 1Q8IA 4WKYA 2IDEA 3NXZA 4Q43A 2W9BA 2EVZA 2OPSB 2Y1RI 3GE9A 1VQ7S 3GYGA 3IR5B 3LUYA 4K5RA 4DOZA 1N88A 2VPWB 2HNZB 4RLEA 4O3NA 1XQIA 1FRJA 2DHSA 5HQLA 1NSQA 2HK3A 2EFGA 5KOWA 1KC8T 1M0SA 1RHUB 3R5DA 4QYRA 1JXEA 4CLTA 2MB0B 4RNNA 3P96A 3TJAA 3GFHA 2KXHA 3GFXA 2ZBCA 5I3PA 1S9GB 3EPIA 1VRTA 4WF9Q 1IM4A 4DG1B 2V2VA 4IFYA 1S7HA 3B6BA 2XBPA 4ZMMA 4PUOA 4DR4J 4JV5F 1O8BA 2B0GA 1NB7A 2OD4A 4D3HA 5MLCV 2V0NA 3CUNA 2IIHA 4MTPA 5J2QB 2J6UA 1JWWA 1S97A 1SCJB 4AUKA 1N52B 4BLGA 3U1NA 3DNCA 2IC3B 1RAOA 4P73A 1UMJA 3N28A 3G8TA 1DTTA 2F8HA 2DY1A 2R9LA 5EX0A 2ATLA 3IBFB 3PJ9A 4OHZA 5KFJA 4RW7A 1NNDA 1FNMA 3OVBA 2IM1A 4LF1A 4R0JA 1DTQA 3SXLA 3MEGB 1S59A 2DGQA 4JI6F 4RW4B 2WTFA 3K8VA 4ID5A 5IC6B 2U2FA 4WFXA 3FRYA 2CJYB 3A13A 2HWHA 4WPAA 1KD1T 4FF3A 4NLSA 2YBVA 3OTOJ 3AA9A 4F67A 4RW8B 2MJNA 3CNQP 3HLUA 2HURA 3MM6A 1EARA 4FVCA 4DUYF 3NS5A 5D8HB 3H90A 1UKUA 4AD6A 1SV5A 3LAMA 4KHMA 1IKXB 4DEZA 5E2QA 3OUYA 1BY9A 1IBLJ 4I2PA 1KLNA 4DZDA 3R5AA 1HWKA 5F0UA 4MKYA 2I8EA 2KM8C 1HQEA 3MMBA 5HI7A 3JSMB 1HR0F 2H3EB 1ICEB 1O6XA 4CH0S 1DBDA 2ZOMA 4PUOB 4TQRA 4M5NA 1UWBA 1YSJA 2AW0A 5GADI 4L3KA 2R8HA 4E98A 2DRBA 4RUAA 2VQEF 1VBZA 1R8PA 5J2NA 4RWXA 5CH7B 3IMQJ 2Q6CA 2HHHF 1ACMB 4HACA 5BR8J 1LFPA 1FNOA 4LF5F 1N56A 1FJCA 4OYXA 3CO0P 2QZ8A 4WFZA 5CCLA 4LFBJ 3DYAA 1L3UA 1M1KT 2VA2A 3DXBA 1G2EA 1X9MA 1KVJA 1UW9A 5FLXU 4QW9A 1E6YB 1S99A 2BJ1A 4CT8A 1L3SA 4ECVA 2BQ3A 3TA1A 1TK8A 1WC6A 2IBKA 3OXGA 4KFBB 2GIQA 4KH1B 2QMUB 2WVDA 1FNXH 4QR0A 4IRCA 3JAMY 2UXBJ 3LOUA 3TUZC 3ICLA 3IN5A 2OPQB 2R4FA 4JI2J 3HHNB 4K0KF 2DHAA 2XZTB 2C2EA 1ROFA 1GXTA 1TUGB 2CNNB 1FFSB 1RHQB 1NRKA 5B0GA 2MY8A 3MTKA 3RBZA 1Q82T 2B4UA 4QR2A 3VR1A 4O44B 2UV8A 4KY3A 5HSPA 4KTQA 1NDPA 2PIIA 3G8QA 1HQUA 4OZJA 4J9MA 4ECSA 4B9SA 2DHHA 2ADBA 1L3KA 3C16B 5KFZA 1YJVA 2NLWA 5L8RC 2IVYA 5CQGA 3B8HA 1T9TA 2XYPB 3GG0A 3I31A 4NLUA 1CC7A 3P4UB 4N41A 4DHVA 3IBWA 4CT9A 4ZPTR 2V50A 3AA8A 3PCOB 5DRKA 1YKWA 4UZBA 4ECYA 3NCPA 1BQNA 1U0HA 2JVOA 4NLPA 3OHBA 4DV5J 1GFWB 3V6JA 3M1VB 4P72A 3IR6B 4UF4A 4B3OB 4HKQA 3ONQA 2RQMA 1BWEA 4FXWA 3ENAA 4AQYJ 2LXFA 1FTRA 1S12A 4U9RA 3W2VB 1NH7A 1TL4A 4YY3J 4LF6J 2FLNA 4DMZA 2MHEA 4DR1J 4YR0A 3D7SB 3MURP 4G6VB 1WG5A 4X4NA 3AOAA 5CD4A 2ATCB 4QQBA 1WTBA 4C8LA 1BUXA 5KFYA 1EB0A 4CQ1A 3Q8QB 3KLGB 1UJ4A 2AJ4A 2JJ4D 4XPCA 3JYTB 4B3TJ 3DGVA 3DMJA 3W65A 3LP1A 2XY7A 3CULA 5ETLA 3MXHP 5A0YA 3EVOA 5BJRA 4RPFA 4HYKA 3KLIB 3SIPB 1DQ8A 4DV0F 3Q8YA 1NBEB 1FO1A 2MQ8A 3BR8A 2ZZTA 2Z2LA 4WXWA 2ZHAA 4HVZA 2ZUGA 1XNRF 2YNHB 4ZPCA 5KFXA 4O3OA 5K8OA 4CO1A 2BOAA 2J9DA 1PBAA 2P9EA 4OI1A 3PM9A 4E8UA 2FVQA 2VG6B 2HW3A 2MLZA 4DN0A 5EHHA 1TAUA 2LKZA 4Y2MA 4RJVA 2HNYA 4NCGA 3T41A 3HX9A 2R7WA 1C1BA 4KT0C 1WC4A 3W5XA 5JUMA 3NL0A 1I5OB 2GJIA 2VPZB 2VFVA 4PCQA 3I96A 3T6JA 3UI3A 1JLQB 3MPDA 3ZO7A 1ZAVA 1BQMA 4YB7A 1QY7A 2E7XA 5BYQA 2UVVA 4ZJQA 4WFYA 4URQU 2B4OA 2E44A 2OPPB 3QFHA 1GK8A 4BDPA 4Q45A 3J7Z5 4MIWA 4RUBA 3KMSA 3L7PA 4MH8A 4WXOA 5G4DA 3JAMU 1HD1A 1TL1B 3W8PA 3Q2TC 2JFDA 1CC8A 2B5JA 1Q8KA 4KO0B 1CPZA 2KH9A 2ZH2A 4ED5A 4EU0A 5K8NA 3GPAA 1FRMA 3PY8A 1M90T 1AB8A 1LOUA 1RAAB 3MMAB 3NEKA 1N33J 2KT2A 3MDFA 5CXTA 2JEIA 2MSTA 2W2QP 4JB8B 2IRUA 4J90A 1WWHA 2CWXA 4L76A 1KWMA 4ANCA 1Q7LB 2HFVA 3MECA 3R7BB 3UQSA 3UCGA 2DIVA 3BS9A 1A6LA 2D3UA 2DGUA 2EKNA 1FESA 2HVDA 2VUGA 2JX2A 3GJQB 3H0PA 4ID5B 3ZZYA 4EBDA 2OJ3A 4G3IA 3OFEA 3G86A 2CPFA 2D9PA 3L95X 5AXLA 3AQPA 3FRZA 1W25A 4USWA 5LMUF 4WU2A 1WC0A 2BJ9A 2ZOFA 3NGRA 5KG4A 1TFYA 5GAEU 3SCLE 1IJFB 4CO4A 2BRLA 2ZWPA 4J9VA 1X4AA 1ZM4A 2IM2A 1OY8A 3BSCA 3PKMA 3FEYB 2XULA 3FKBA 3THVA 4M5DA 2MQNA 4TY9A 3DI6B 3GLJA 3J81Y 2C22A 3QLHB 2V5HG 4WIQA 3R8YA 2CQCA 4ED6A 1K0TA 1B64A 1PC4A 1PYOB 3P3DA 1OPIA 3CDWA 2M8DB 1TR0A 1WJ9A 4FNHA 4P6QA 5B0AA 1MNEA 1OY6A 3BH6B 4U7UK 5LXYA 4LUBA 4RW9B 1N6QB 5CA5A 3UDLA 1HW9A 2HIQA 3JQKA 2DTJA 3EX7B 4JI3F 1G4CA 4ER8A 2GNKA 1PYTA 5HMWA 1VRQC 2AQ4A 5E0OA 2MQQA 4I2QA 3MEKA 1Q5VA 2Y0BB 3BH7B 3FVYA 3U7JA 4EZ6A 4C8ZA 2WW8A 2DGWA 2YWKA 3PW7A 1MWYA 2D3ZA 1AUSL 4KQZA 3HFZB 1HARA 2QL9B 4KV8B 1VK8A 4DV7J 1FJGF 4I2PB 1XK8A 1F9EB 2QLJB 3HPOA 2E9ZA 2C2DA 2CQHA 2BE9B 1KBRA 3RYLA 4NEZA 2HWTA 2H51B 3RRKA 1HW8A 3SV3A 1TKTA 4N8OA 4CO5A 1N5SA 4ZN1A 2NSBA 2ROEA 5BXIA 2KYZA 4KGKA 3D3BJ 1SUQB 1YJ7A 2ZC3A 3I5AA 1M5PC 5KG2A 4I56A 3WHIA 3GG1A 4NXNF 1K8AT 5KFGA 4AL7A 3LANA 3PEHA 1CSJA 2IJNA 2OPQA 4TY8A 3QJLA 4DV1J 3QRRA 1JLQA 1JMTA 2HNDB 2V2QA 3GYXB 3UPFA 1WG1A 5T14A 1HI0P 2DB1A 1RP5A 5CZVA 4BWMA 5L38A 1RT1A 1ULRA 5GAHI 4PXDA 2W2NP 1TMMA 2IAJB 2ZEJA 7FD1A 2UUCF 3ILJA 1RISA 4ZPAA 3CJKB 1RHJB 4ED3A 3MR5A 1F5AA 1RA7A 4C48A 3HMJG 1EKSA 2F1FA 2VC1A 4TLQA 3M8QB 1LW0A 2YWFA 4B3SF 4KV8A 5CYJA 3PYDA 5HVGA 2N4DA 3ZNUA 2CZVC 1HHQA 4U95A 3V6DB 2AKWB 1J5EJ 2G13A 4A8QA 1IKYB 5DQGA 3CJRA 4OZ5A 1XR7A 4A46A 4A8OA 2VL1A 1WHVA 2PO4A 4YB5A 3KJNB 4NMXA 3G96A 5T41A 4NASA 2QA4S 2EBGA 1TUWA 3H5XA 5LL6d 2CPHA 4PPDA 2PMZD 1R8BA 2FC9A 4LFAJ 2RU9A 2QYCA 3MZIA 1HKAA 1YJUA 4DZ6A 4P2XA 4JI8F 2F7VA 4NCAA 4N47A 4YUDA 3K2YA 5C42A 3MUTP 3MFIA 1T3NA 3UVJB 4DSIA 2FZCB 3CMES 4LSLB 3OV7A 4LBIA 3FFIA 2YKOA 1TL3B 3C6TA 3RGIA 4UOFA 2IPOB 3MUVP 2M7SA 3RB6A 1R6YA 3WQPA 2FC8A 2VA3A 1URRA 3IGNA 2NXEA 2KN4A 5AJ3J 3EZUA 1YLXA 3KHLA 3W60A 2YKAA 5IQ6A 4TYAA 3SCJE 2W9BB 2UXCJ 4NLTA 5DGAA 1GMWA 1Y5LB 4CI0B 1KTVA 4X4SA 2A10A 1OIAA 2XO7A 3OXFA 4P10A 1WHYA 2W4CA 3MM5B 1U6FA 5JJBA 5HQ8A 1N48A 2QSFA 3D1OA 4PR6A 3TAMB 1KQSR 3KDNA 2DNRA 4IKAA 4B9TA 3I0SB 4X64F 2F63A 3C14B 4URSA 4ES3A 2DNNA 5KT5A 4YHHF 1ZH5A 2UXCF 3R2CJ 1S0OA 3GIIA 3HFVA 2W4DA 1YZ6A 5DJBA 4WFNQ 2MJUA 5HJYA 2VONA 2A6OA 1OPZA 3OT9A 5B0EA 4K4ZA 1J5OB 1OYEA 3F0NA 2CQGA 4KAIA 4OX9J 2V69A 3JTNA 5G0RA 3SSRA 2M88A 1GH8A 4BC7A 2XB2D 5DZ6A 2C1EB 4DV6F 1S0VA 4AE5A 2VDIA 3ZTQA 3KMQA 4ELUA 4DV4J 3EZOA 1YX2A 2CADA 2RSQA 3HCXA 2EBEA 4UUXA 1F0XA 2RUGA 4J7CA 1UL3A 3D4JA 2HK2A 4Y65A 2JL9A 1FXLA 4NLYA 3SSQA 1AT1B 4DR6J 1IN0A 1REGX 4F3OA 3U1LA 5SUHA 3M8PA 2XYGB 3CC7S 5H9EJ 1RAGB 2CQ4A 2ZITA 4HDGA 3TW0A 1RT7B 1V6HA 3S6EA 4CYUA 5L9NA 1VCTA 3H40A 3TARA 3A8IA 3CGIA 4DXLA 3BBFA 5IT9Y 4IYQA 1WEZA 3E51A 3KJVA 1HNWJ 1OS5A 1VS3A 4DR6F 3IA0A 2A2CA 2E5GA 5D0HA 3DLBA 1P9YA 2DHXA 5KFVA 3L7OA 5K9FA 2GIRA 2YKNA 4ETZA 3NMAA 1FDAA 3FMBA 1GMWD 1VQKS 2LXIA 2CQ3A 1WTFA 1SH0A 3NS7B 3MM9A 1S1UA 3LP2A 1N5YB 3K7RA 1RXOB 5LJ3Y 1IKVA 2EW9A 2P9GA 4ZCMA 2KT5A 3C6UB 4UZCA 5F8MA 3R7SB 1K44A 1ZAXA 1FT8A 4FP9A 4JI4J 3C19A 1W2IA 2BEFA 3DOMB 3QWPA 4LR7A 2XCPA 4P74A 2O66A 1KR4A 1H7WA 2YQ1A 3GCWP 1RSCA 2HGMA 1EHWA 4NE9C 3UO0A 5IM0B 2MXYA 3R1LA 2RS2A 4M94A 5DO2A 3SQOP 1NH8A 1KFSA 1JQGA 3Q2SC 3IBCB 2J9CA 3CE8A 3QGHA 1QUVA 1T9XA 2GQQA 3EXYA 2VFTA 1RWXB 3ZZ0A 2MKIA 1S79A 2MZQA 3H25A 2ILYA 2XGPA 3OJSA 1ZTWA 3ENVA 3FFIB 2OTJS 1V5IB 3DLKA 1DQ9A 3CDEA 1QJHA 1ZETA 1JLAB 4C8MA 5KAKA 3MM7B 1LK7A 1K1QA 1S6QB 5HATA 3V81B 2BVZA 1NDCA 5CHCB 4DSKA 1VQSA 2FGCA 1LW2B 2HGNA 1FXDA 3OR2B 1VGYA 2WAQD 2XSFA 2DNQA 1URNA 2D7SA 5DG7A 1WDTA 3HT3A 3BGRB 3BF4A 4X4OA 2J9DE 5B0BA 1SH2A 2QEXS 5EN1A 2GFFA 4QIEA 1QAJA 3FEZA 2GVZA 1D3WA 4CLWA 1TK5A 1BQXA 2CAJA 1X4EA 1VR6A 3OSPA 2RF2A 4O3RA 4Q0BA 1V3SA 5ETVA 3R6GB 4CO0A 3NGUA 4G1QA 3KK3A 2ERRA 2VBXA 2XMTA 3GJRB 3PIOQ 2XLIA 1QSSA 2XS7A 3H5UA 3OTEA 2RT3A 4NLWA 3TUIC 3MOJB 4K59A 9ATCB 4ZITA 4DSJA 1BC6A 2W7OA 4GO5X 3MR7A 2OHDA 4WE1A 2LEPA 1DHMA 4CLPA 5HL7Q 3G6VA 4DR5F 2XMKA 3FEXB 4IFVB 3CJKA 2B51A 2Y0SD 2E9RX 4PWWA 4CH7A 3DCAA 5RUBA 1WC3A 3HD1A 3P5BP 5ETTA 5DM6Q 2E5JA 2X7IA 4X65J 3K5LA 2XSJB 1RAHB 2AEFA 3GTYX 4KKOB 3WC2A 2CZ4A 2WHOA 4LRCA 4CWBA 5LJ5Y 5T7LB 3DI6A 4R8UB 1TK0A 3D2WA 5L1LA 1RHKB 2JWNA 1Q8BA 2OH2A 3KOAA 4KGMA 4A8FA 1MLAA 1NCLA 2YXLA 2VG7B 4YB1P 3OW2R 4DV1F 2NCKL 2HHHJ 4LF5J 3A3OB 3B78A 2GJFA 3LP0A 1ZYQA 2VBZA 4N77A 2PA8D 1M5SA 3NS6A 1KOOA 4WK1A 3U1MA 4F25A 1UCNA 1APSA 1C0UB 2KT3A 2JLFA 3MEEB 3KLIA 2LECA 4NYZA 1RCOB 2ZC4A 5C42B 2GV1A 2UVRA 1M1HA 3PJXA 2CNOB 2MKJA 3D9BA 2XY6A 1RYSA 2IBOA 2VOOA 2QRRA 1B70B 3N6NA 3BGLA 1U02A 3DRRB 2KZZA 3C6TB 3QIDA 3ZZPA 3KG1A 4WK3A 2OLWA 4TLRA 3TYTA 2ZNZA 3K58A 1NJWA 1NXIA 1IBKF 4OX7A 2EG1A 3BJYA 4OHYA 2I1RA 2KVQE 5F8GA 3OUYB 1HI8A 1GXUA 2VQFJ 3ET6B 3IC1A 4C97A 4CLKA 1SQFA 3JTPA 3T1AA 3KK2A 4LRFA 1Q1KA 3CCWA 4DPUA 3MAQA 1H74A 2EPIA 1T95A 3AH6A 2ADCA 5LMUJ 3TUJC 3I32A 2NXCA 4DQPA 2IY5B 2CKWA 3CJTA 1O51A 4EGLA 1DFDA 1BWVA 2LLZA 3H2LA 2BM0A 1B7YB 3LWLA 2KDOA 4X4PA 2LP4A 1S1WA 2DO0A 2GC8A 2GIFA 3THPA 2ROPA 2F8EX 1X9SA 1FFGB 1W26A 1RAFB 2VZ9A 1UA0A 4GRSA 4DR4F 1YJTA 5CYMB 1U2RA 1JXLA 1BD6A 2CXEA 3GIMA 2D3O1 1SI9A 1U2CA 5BYRA 4J9LA 2HHQA 5CABA 3PIPQ 1T94A 3NAHA 5EX3A 4Z7CA 1HNZJ 4WYWA 7FDRA 3FK4A 1PC5A 2B6AB 2H9ZA 1H73A 2N82B 1NPPA 4U8VA 4DLGA 3T5JA 4PKDB 4PG6A 3OR1A 3CCUS 1VHIA 3BSOA 1DRZA 4F36A 3BKTA 1KDNA 4DL2A 3GB0A 4HHUA 4GVBB 5DETA 3PRBA 4XDCA 2XNRA 1TKZB 2MGZB 3UD4P 4OYAA 1R0BG 1CVJA 1AROP 2HRUA 4Y2AA 3BREA 2E5LJ 1KHVA 1WF1A 2IA6A 3GV7B 1P27B 1HWUA 1E6VB 3IFEA 4OLOA 4DX7A 2COLA 4KHRA 4YN3B 3HVWA 2KYXA 2AGOA 2CPXA 4ZVQB 2DGTA 2J0SD 4ECZA 4K4VA 3IAS9 2BW2A 3CJ3A 3PRVA 4G65A 4KSEB 3M9NB 3D1HA 4RWWA 1N5YA 4ECQA 4CNYA 2ZH3A 1IQTA 4ZVHA 1QUPA 2PEHA 1NK9A 1RLCL 4XK8C 2R2RA 4DCJB 5EWGA 2J6TA 4NLGA 3CCQS 2JEGA 3LGMA 2NQPA 4M1KA 3RZAA 2HLUA 4DV7F 3QIPB 1H2TZ 2B6AA 2W24A 2FUG9 1RT2A 3HT0A 5KG0A 4ICLB 4NLXA 2ZH7A 1U4BA 2YNGB 5AXMA 1EIYB 5A6WA 2KZMA 3PXGa 3M2RB 3QGPA 1RBOB 3MMBB 4TU8A 2E5HA 2PFDA 2ZBPA 1FVQA 2OFHX 5KG1A 3MEEA 1O0PA 3TEGA 3QFWA 2XI2A 2DKOB 3D6FB 3DN9A 1RT6A 3TNVA 3PJWA 2HNYB 1VMBA 4NCGB 3K59A 4B3SJ 4X4UA 6FDRA 2CNKB 3CEDA 4J9SA 1LWXA 3DMJB 4PYDA 1Q16B 1VRTB 4O0IA 2YKMB 4YR3A 2XGQA 2R7VA 4BBYA 2FJAB 1S6UA 3AJ2A 2FHJA 4IH5A 4LRAA 2VJVA 3PW2A 3T1YJ 4IQXA 1D09B 1NK6A 5FJ4A 1H3DA 1U26A 1XMOJ 3CJ5A 1QVGR 1UVMA 2XMJA 4OZ2A 3NMRA 4NLDA 3DDIA 3FQLA 4UUWA 1F3FA 3M05A 2BABA 2DH8A 5E3QA 4YDDB 1E6YA 5DDRC 3F73A 2R2SA 4C2MA 4F2SA 2DPIA 4NLRA 4ERDA 3MD3A 4M5JA 1JLCA 2I0XA 5A8RA 4I0WA 1RWOB 4RU9A 4RW7B 3T1YF 1N36J 1KP6A 2V4QA 2QLFB 5F41A 3BPDA 4ICLA 4DL0C 5L39A 3L9ZA 1C2PA 4UQGA 3IWLA 4U96A 4Y00A 3LPEA 4ZPBA 1CS4A 2MTLA 1WEXA 3PX6A 5HLFA 2PGCA 2B56A 2DITA 2POKA 2V4JA 3V6DA 2DR5A 9RUBA 1YVFA 1SKWA 3IGVA 2QA2A 3IP0A 3R6LB 4ECXA 1FWKA 4FPRA 3BBBA 2LXUA 1VQ6S 1K47A 5THWA 3QRQA 2WB4A 2XMMA 2AYGA 2ZWOA 2AX0A 3DU6A 4YR2A 1WF0A 3QGIA 2BX6A 3MFHA 3DM2B 5T7LA 4R8UA 4UOCA 1C0TA 4RBUA 4ITSA 1M5KC 2VG5B 4JI1F 2BJ7A 1TKZA 1RT4B 3BN7A 2AEMA 5A8RB 2E29A 2EFPA 1U6ZA 3QNWB 4ZVEA 4DV0J 2OMLA 1SJ4P 1U47A 1NHKL 2JEJA 3P5TL 4RKUC 4CRJA 4WKRA 2BJ3A 2FHJD 1U6BA 3PZPA 1NDKA 2MKKA 5M2PA 4LMZA 1C0UA 4LF9F 4K2JA 2ZKUA 1Y10A 2KKHA 4HACB 2E7WA 2MQPA 4ILMA 1ITPA 3L7UA 5HQMA 1S57A 1P6TA 4L73A 2NXNA 4PABA 5HROB 4B3RJ 4C9DA 4PG8A 2AIRB 2IHR1 2VPXB 3QBCA 4ZVSB 4A48A 5A0YB 3BQ2A 1U45A 1RB0A 2XCAA 4DG1A 1AFIA 4OJGA 3CCMS 3ZZZA 4B9NA 4ZIWA 5IS2A 5HO4A 2ZUAA 3AOBA 2IVFB 3HHKA 3DM2A 1S48A 1RWUA 4O4GA 4TN2A 4JV1A 2KFZA 3JB9k 1SL2A 4KR0B 5HAOA 1FK9B 1BLUA 1VIOA 4W4MA 2KXFA 3WZ0A 3NLCA 3NWRA 3GCXP 5KG5A 2GX8A 3MF5A 5BYSA 4WTYA 4DCOB 1H6KX 3MPWA 1CG2A 3VGTA 3R7NB 3PW0A 3DLLQ 2E1AA 3D6MB 3KUEA 5ETMA 1KSPA 2VODA 3M2VB 2KM8B 3W63A 4LR9A 3DFEA 5LSLA 2CQPA 2OPPA 2I6WA 3GIKA 3PEJA 1T9VA 2LU2A 1JJ4A 4U7CA 3DOLA 3EPGA 5D78A 3T5HA 4GKJJ 2VQFF 3MM6B 4DPTA 1KN6A 1YGYA 2IC3A 4NI2A 3N4WA 1SV5B 1YRUA 4N76A 1TQLA 4L6V3 4DCPB 4IQMA 4KJIA 1BMQB 1UEKA 2ZD1A 1RKJA 2PSZA 4YB6A 4LBHA 5L1KA 3KXDA 2QA1A 3OVSA 4GMKA 3W62A 2FVRA 1R6VA 4FN5A 1IWGA 3B82A 4V19J 4HEA9 3AD8C 4X4RA 2XMVA 4ZLLA 3W1YC 3BO4A 5J2MA 4C98A 2HHUA 1XJWB 4ZJLA 3KUGA 1RU2A 4DR2J 1HNXF 3RTVA 5J2NB 4FS1A 1HPZA 4CLYA 5KT2A 2ASYA 1VQLS 4AL5A 4FYDA 4LRBA 2QFJA 3L09A 2HBQB 2YNFA 4O3QA 3TVYA 1Q7YT 4UY85 3T1HF 1Y11A 3G4SS 2WONB 3BQ0A 3PTWA 3QO9B 1FI4A 5B0DA 2LU1A 5E7OB 4ZN3A 2R2UA 2QT7A 4ED2A 3PHEA 4CCHA 2M5YA 4C6AA 2CJ9A 2L08A 2Y8YA 2HZVA 1TL3A 4L72B 2E5IA 1UVNA 2V2KA 1OYDA 1XN9A 1NAQA 5J1PA 3KNGA 4J9QA 4H4OB 1MMDA 2OSQA 2E1PA 3M9MB 2UXDF 1T03A 2K3IA 1C4CA 2GZOA 4DR5J 4ECUA 2HWIA 4LF7J 1X4FA 2X51A 5H9FK 2ASJA 1CULB 4EFAC 2E66A 3Q8RB 2DRAA 2W2OP 1FKOB 2ZH8A 2D3OR 1X4HA 4A8KA 2M3DA 4RW9A 1BHNA 2V68A 2GHWA 1LWCA 2VC0A 4I4BA 5D4PA 2Z2MA 4B9UA 4Y6IA 1AA1B 4CM2A 4WFAQ 2C28A 1QM9A 2KU7A 4ETXA 3D68A 1YDLA 3MD1A 1U09A 1S0NA 2M4MA 2O3DA 4NPOA 5HMZA 3QMQA 4WZQA 1SBRA 2RH3A 5DLFA 2PD1A 5KFTA 3KLFA 2KJWA 1DAXA 4C7QA 1RWWB 1HHSA 5KFQA 2DCLA 3QWUA 1GQEA 3N6MA 1R7IA 3R97A 3OL7A 2WVEA 1UTAA 2QMWA 2QTWA 1UVLA 1UJ6A 1IWAA 4UTGA 3DHWC 2HS0A 4F26A 2J0XA 1RT3B 2JLGA 2GJ2A 1HA1A 1YQHA 4ILRA 3KLHB 1LWFA 3E8OA 2ZHOA 2OSRA 4ED0A 3TJ8A 2YKMA 4PRFA 2BJDA 2K8GA 4TY8B 8RUCA 3I9ZA 2BUNA 5A6PA 1ZM3A 4CDIA 1RYRA 2BMBA 1U1KA 4LF8F 1JLBB 2HGLA 1K73T 3OTBA 2MZ1A 3HP6A 2DCUB 1MU2A 1Q0NA 4DV3F 2DGXA 3IM8A 4FYWB 4DF8A 2DVIA 1C1CA 2E1RA 3M6VA 5L1IA 2CG4A 4RW6A 3GYNA 2CJAA 5A8WB 1DLOA 1XTZA 2BKPA 5ETOA
chains in the Genus database with same CATH topology
3N5BA 4CZCA 1M5OC 4OJHA 5IXUA 3KG4A 3B4DA 1SC6A 1HBNA 4QIGA 5KFSA 2XY5A 4BS2A 3H20A 2LEBA 2LDYA 3DRXA 4LQ9A 1FE4A 2HHXA 2FLLA 3MWBA 4GC7A 3UNGC 1VQOS 2RILA 1Z1ZA 5KFLA 5B0CA 2OIHA 1N6QA 1YJWS 5AJ3F 3CJ4A 4C0OC 3CCZA 4XPEA 1HYSB 4LVOP 3LO3A 5D4OA 1FJ7A 2NSCA 2HHPA 2KVIA 3C3LA 3I56S 4RNFA 4PWUA 1L3TA 1TKXA 2XMWA 5CYQB 1FRXA 2XWXA 5FD1A 2J6SA 4K5SA 3EGNA 3MMCB 3ISNC 3B4MA 2VG6A 1S6PB 3QAUA 1VQYA 4TNOA 3Q23A 1HD0A 3RRHA 1YIJS 4MFBA 3SEOA 3NAIA 2UUAF 2R7UA 2Z0GA 2XLKA 3G9CA 3I55S 1S1XB 1JK9B 1LWEB 1QTMA 5L9XA 1DZ5A 1IJEB 3HHEA 1B64A 4YEAA 4HHJA 5IT0A 2PMHA 4OI6A 1LWCB 4QR1A 4CO3A 3KLGA 3JYTA 4XDDA 1Y3KA 4DX8H 1SJ3P 2HG4A 3MOZA 1VQ8S 1JLGA 5HP1B 4B3RF 4X65F 1H2UX 2BANB 4G1QB 4USIA 3OL8A 2EFQA 2W7PA 5K8PA 1N0UA 1IBKF 1X4DA 2BACA 4WCEQ 4KO0A 1UA1A 2NS1B 5EGYA 2LDIA 3CC2S 1FKPA 2KTQA 3TA0A 1LW2A 3M9OB 5DQIA 2RRAA 5EUHA 3MMAA 3VTIA 2FLPA 2B43A 2MDAA 2RJZA 1WELA 4ZLPA 2NR0A 2MGZA 2UP1A 4Y28C 2FHOB 4B3MF 4DR3F 4B9LA 2YKPA 2AF6A 1U7LA 1JLFB 3OHAA 5SZTA 4ZOSA 1VQPS 4K4SA 1RT7A 3E01B 4ZCLA 3DLJA 4X4QA 1C1CB 4QIVA 3BEGB 2XI3A 4Q8FA 1VFJA 4AXIA 1MROA 5CCMA 3TQ1A 2KFNA 3DRSB 4NZ7A 2EFVA 4TKTA 3QLHA 2JLEA 3I4HX 4Z37A 2A2DA 3OJUA 4ED7A 1T7PA 3NNHA 4IOAQ 3RU0A 4DDFA 1Y5IB 4FF2A 5I42B 5IWAF 2RMLA 3MM5A 1XR5A 3LALA 1RT6B 3ENWA 5E41A 2YH0A 1FCAA 2R7TA 2DNMA 2F9JA 5IM0A 3WDOA 4F3MA 4FF4A 2X1GA 4DR2F 1VIXA 2WSEC 1U1LA 2CPEA 2LCWA 1LXNA 2B7CB 1ZPWX 2R2TA 4XIUA 2HHTA 1KOHA 1VOMA 5DLGA 2MHNA 4Y2IA 4A4JA 2ZJPQ 2L3MA 1HBUB 1I94F 1Y3JA 2ZE2A 3X1LB 1P9QC 3LW5C 4K4TA 1LV5A 1NO8A 3GR0A 3DLEB 2V94A 1FEEA 3C2PA 4LF7F 5GAHU 5KFAA 2DBBA 3KFWX 1KQFB 2HQIA 4YMEA 3CCSS 3G6ES 1MMNA 3HVTB 2J9EA 1TV6A 4DL5A 2M52A 2LMIA 1Y0HA 2N7CA 4HTJA 4OX6A 1JLBA 4DV4F 2PN6A 3U27A 1H98A 4ZHRB 2GMLA 3Q8PB 3CCLS 5FDLA 2R8JA 1WD6A 3H2UB 5A8WA 1FDBA 3PX0A 3DXSX 3E2EA 2AWZA 1JNRB 2C3UA 2ROGA 3MAHA 4NRTA 3Q8SB 3UCZP 3DRPB 3OL9A 1M5HA 1V3ZA 2VV5A 4HDHA 3VQSA 3SQGB 2M9KA 4QCLA 4IRKA 4PXEA 1LFWA 4PG4A 3HF5A 2V4RA 4H4MB 3V5RA 3BGFA 1FA0A 2AGQA 5DG8A 2RNEA 1XBWA 2KB2A 4QW8A 1VQNS 4FXVA 1IUJA 4CO2A 3CWJA 1H0HB 1Q78A 1R0AA 1UVIA 3AB4B 2GMHA 3POTB 3G6XA 2F4VF 3HK2A 2QIFA 5F3ZA 5KT4A 3M2RA 3X3UA 1TV6B 4K4UA 3CCJS 3DLKB 2AJQA 3BDEA 1SUQA 1JLAA 3MUMP 3W7BA 2LQBA 1HBNB 1YBAA 2P5VA 4R25A 4K4WA 2Q66A 3KHHA 2XZWA 2VOPA 2VD3A 3V4IB 4WZMA 2BYCA 1AW0A 4C8KA 4I68A 3O44A 1VBYA 4GKKF 4ALZA 3BGRA 3H5YA 4EEYA 4LFAF 3NKYA 2VBYA 1RAJA 3V4MA 1KTQA 1RQ0A 5D4LA 3OVAA 4NLVA 1EP4B 4N5SA 2B4PA 3CCRS 4OHXA 2MQLA 3RR7A 2YNIB 4LF4F 3FDSA 2DNHA 1XMBA 4FXDA 2CQ2A 5KG6A 2CPIA 4Y0FA 4OZLA 2F8MA 4MKAA 3QPIA 2RB7A 2RD5C 3OTCA 4IRDA 4JV0A 2XSJA 1B0PA 3O1LA 3OXLA 4MYUA 4Z2XA 3VZIA 1RGVA 2B4VA 3GV5B 4MIAA 4FBTA 2WOMB 1D9DA 1KONA 1RTIA 2PI5A 1IKWB 4OZ0A 3CXCR 1U48A 2H5EA 3CDUA 1SKRA 2DNYA 5KFKA 1U1RA 1FD8A 2ZOGA 3UR0A 4CNZA 4URGA 4C0BA 1Y00A 3MEDB 3N79A 1G1XA 1XNQF 4AL6A 2G0CA 5EWEA 2DR9A 5GVQA 1RTDB 2UUBF 5EWFA 3PVXA 5E3RA 5KFBA 2RRNA 3E01A 4OZNA 2W25A 5F8IA 3KKFA 3HHLC 5HLFB 2DGSA 5H9FJ 4NOHA 4QPXA 2X3GA 3PIOQ 1R89A 2DD8S 2RVJA 5I3QA 3MUVP 1YRTA 1ZZNA 2HVHA 2EFNA 1RA6A 2EK6A 1ZAWA 3NCRA 1ZM2A 1X5OA 1VLYA 2Y1IA 4K2XA 4ZP8A 4I1TA 1S6QA 5E3PA 1QAYA 4FBUA 2PE8A 3SQGA 4IOBA 2CFXA 2J7WA 3OTDA 4RBTA 1GTHA 1RJJA 4JI0F 4OI2A 1N5TA 2EFOA 1RT4A 4LSNA 4HT5A 2XS5A 4ECTA 2W8KA 1S0MA 2CVIA 4D3GA 1TP7A 2VASA 5D3GB 3CJ2A 2VKRA 2C42A 4OFZA 1N8RT 1UFWA 2ILZA 1K0VA 2V8GA 3E3XA 2HYIB 2HHVA 5I4MA 1B7FA 1FRIA 2FY1A 2IRXA 2LQJA 4J9RA 2B9YA 1NJYA 1S1UB 3LP2B 4P7VA 3TI0A 3NNAA 1IKVB 2R8KA 2LVWA 3DLGB 2DISA 5AE3A 2QE5A 1S1VA 2FHKA 3MCSA 1F5BA 2JHEA 5F8JA 5LMNF 1H2VZ 1EP4A 3KK3B 2DNLA 5HBMA 2AJFE 5D77A 3ZZUA 1X4GA 4PXCA 2FJBB 4C0HA 1X0PA 2DIUA 1GTEA 2OPRB 1DURA 2DGVA 1KLMB 1HNIB 1CLFA 2BR0A 3QAEA 3MM7A 4F3QA 2J5AA 3ZZOA 2IM0A 4EYIB 3M32B 3EZ5A 3RB0A 5KG7A 2MKSA 2CJKA 3OR2A 4CTAA 4U67Q 2MY7A 1HPZB 4G1PA 5KFWA 4WU3A 2HHWA 2ZZMA 3CCTA 1REVB 4JUZA 3KK1B 1SJ1A 4PQAA 3IRXB 1RT5B 3SZ2A 3LPYA 2C3YA 4OL8A 3FSYA 4H4MA 3RAMA 3SI8A 1F60B 2ZM6F 1IR0A 2LA6A 2R8IA 2A3JA 4LVNP 4PG7A 1SIZA 2MZTA 1TVRB 5CYQA 3CMAS 4DLEA 2OTLS 2AYEA 4IFVA 2F40A 2HMIA 3HVRA 4IG0B 1F9FA 3PO4A 3I5CA 2OPRA 4LIWA 3FSXA 5LXRA 4KBIA 3I82A 1QE1A 1V3RA 4B17A 2IVMA 2BJEA 2KHDA 2WRMA 4BWJA 4YFUA 1U1NA 2BA9A 2FTRA 2K3KA 2L9DA 3D5MA 2GHPA 4HLBA 4C8NA 2HHSA 1G7CB 1RTJA 3IWXA 4WE1B 1VRUB 3N6LA 2X1FA 1OQ6A 2ZH4A 5C24A 3O6QA 4WIIA 5AE2A 1JJ2R 1IQZA 4W92B 4DL6A 4C11A 3WC0A 1FKOA 3R5CA 4GKJF 3MM8A 3NGKA 2EWHA 1I6JA 4KRWA 3HDSA 1S76D 2X1BA 3HI9A 4PQUA 2V8VA 1N0VC 1R3NA 4NRUA 1YJRA 2DK2A 2HMIB 2KO1A 2FVCA 1NK7A 4ZP6A 2IJFA 2SXLA 4O3SA 2FGOA 1ZBTA 2YNHA 3UFCX 4EBCA 1Y4ZB 5D4NA 2Q43A 4UQTA 4QU7A 2J7UA 5KTQA 3ZFVA 1WNEA 5D6GA 4J9PA 1U1MA 1NJIT 3M2UB 4H54A 4ID8A 4EBEA 1UETA 2DGOA 5JVHQ 3ETOA 3MHYA 2DHGA 3HFKA 2ZJQQ 2GA7A 4QWBA 2NPFA 2XS2A 3NG8A 2O67A 2ALZA 3TX8A 4J9KA 2EG2A 3HJFA 3JSYA 5KFCA 3M32A 3DRYA 2DO4A 2RRBA 4FS2A 1HYSA 1R8CA 2GHVC 1G6BA 3LQVA 3KG0A 3R5BA 3ENQA 3OFGA 2IYGA 3Q22A 5LSRA 2DT9A 2XLJA 4QYZJ 3UD3P 1GNKA 3GFZA 2L9WA 2HRYA 3M30B 4B3TF 2KG0A 1KS2A 1RTDA 2V9WA 1UEUA 2BE2A 4MK9A 1TVRA 3QZ7A 1HWJA 4MFBB 3SFUA 3MR6A 1T3OA 1VQ9S 1GX6A 2E1MC 1S49A 3ITHB 3SSSA 3CIMA 3AAWB 1RTHB 4IH7A 5H1SV 2R8GA 4HI1A 3BN4A 3OFHA 2KFYA 1TZ0A 3W2WA 3V6HA 2B7BB 5F8LA 2MPUA 2UUTA 3MMCA 1KQGB 4AFFA 4I7FA 2VG7A 2CPZA 2QLWA 4IFYB 2P6TA 4KFBA 2KG1A 3IWNC 2ZD1B 2VPYB 1FDNA 4RU2A 2GQ2A 4DL3A 1TL5A 3M6XA 3TANA 1N36F 3QJJA 1S1XA 3KLEA 2UVWA 3RAXA 2HNZA 1JKHB 5HBMB 5DDOC 4R0EA 3CF5Q 1SJFA 3SFGA 2YX4A 2EK1A 2GMJA 2MQMA 4J5OA 2RE1A 4OI4A 2HFNA 4KHPF 2PC6A 3PFOA 5E5NA 1YRXA 2IM3A 2VH7A 3F56A 4RNHA 3KYLA 2RDJA 2R7XA 3HHLB 3MPVA 4A8WA 1XWLA 4DFKA 3BO2A 3CC4S 1CEZA 3QO9A 2JFKA 2VFRA 4GO7X 3UWTA 1JLEB 1ZZFA 2D41A 1EETB 3EUNA 1DLOB 4BCAA 1UVJA 4ZP7A 1NJXA 3M8PB 1JLCB 1FKAF 1JNZB 3I0RA 1T03B 1BQNB 3G8SA 4I69A 4TU9A 3T3FA 4ZPDA 1HNVB 2ZJRQ 3RBDA 3LWMA 2CQBA 3VAHA 2AYMA 3IAM9 4R5PA 3PKYA 1MW7A 4ZS6A 2D74B 3GR1A 2ZDPA 3OSNA 1WI6A 1NK5A 1P1TA 4IDKA 1D9AA 5GAGI 3H2VE 4ZKAA 3EYZA 2V8DA 1MSWD 2ASLA 1OWXA 3Q0AA 5HROA 1D1UA 4N8NA 2WBMA 4MK7A 2N3LA 3S7RA 1B0TA 4ATNA 5C5JA 3P49B 2HPUA 2JC1A 4NA3A 2Y1JA 1X7VA 2YWEA 3IG1B 4F4KA 3IRXA 3TRGA 1LW0B 1XC9A 1FERA 3SDEB 2HW3A 5J1EB 1FEHA 3HZEA 3V2UC 3H5SA 3R27A 4F4ZA 2BQUA 1JX4A 2E5LF 1FHTA 2RKIB 3D0IE 2FHMA 2JRSA 3MTJA 4NZ0A 4DQRA 3IS9A 2BXJA 1C0TB 2R7SA 2M2BA 4P7TA 2KJVA 3CIZA 2AJ0A 1X9WA 2FVSA 3RRGA 2OFGX 3RB3A 2ZHBA 3FSIA 1HNVA 2GGPB 3GWCA 4QWAA 3FNNA 3JSBA 1VC6A 4Y3CA 2AX1A 4R5PB 3T9ZA 5DQHA 1Q53A 3TVKA 4PXBA 2BRKA 1HBOA 5BR8F 2AD9A 2BV3A 2UVUA 5KFHA 1N32F 4RW8A 2WOMA 3EXCX 5L9NA 3MMJA 5I3UB 1UFLA 4PPZA 2AU0A 1FDDA 2YTCA 3J7ZT 3N01A 5KFEA 5DG9A 2DNPA 2WSCC 2JOQA 2YNFB 3KWMA 5AXNA 3QJPA 4QJVA 4HTIA 3JSRA 4RW4A 4OV1A 3KHGA 2K1RA 4K4XA 2IYIA 1NEEA 4O4GB 1QVFR 3D0HE 4ES1A 4Q2MA 4DSFA 4O4RA 1D8YA 2FD2A 4RNOA 2RDIA 4H4OA 5LSOA 3DRPA 3O2IA 5DS7A 3RW7A 1SXLA 3WX4A 1WEYA 1S9EA 3DOKA 1XMOF 3LGNA 1UP1A 2ZDOA 1NHUA 5A8KA 1IXKA 3M6WA 1O5JA 2W9CA 4B08A 1D8ZA 1HMVA 5E3AA 3PR5B 3L3CA 3AHPA 2FPHX 1X4BA 2E9TA 2FB0A 3M6UA 2QA4G 3OPKA 1VBXA 4JI7F 4M8LA 3HKZD 3VAGA 2DH7A 1ZM9A 1S6PA 2WBRA 1MROB 3HO1A 3I0RB 1SIWB 3TVZA 3PO5A 1TFWA 4Q7AA 2I9SA 2OKQA 3M8SA 2CJBA 3M4XA 4DR7F 1A9NB 1HNZF 3W2VA 1XMQF 3OBIA 1OSCA 4A8YA 1X0FA 3VAKA 2K1RB 4ED1A 1PILA 1TUVA 4H4KC 4DS5A 4V19X 2GQCA 3D54A 4TQSA 1VI7A 4OJ3A 1NK8A 1HQUB 2HZCA 2WCXA 4KE5A 4NXMF 1H38A 5HP1A 3IRWP 5FIIA 3HVAA 2A1BA 2YKNB 4IR9A 2RQKA 2Q3PA 1S9FA 1MU2B 4ES2A 4ECWA 1S1VB 3TAPA 2E1CA 2JEFA 1MWZA 2RKIA 4DV5F 1NJZA 4L3NA 2IA0A 3DU5A 4DFPA 3T19A 3AB2B 4EO6A 4QWDA 1ZPVA 3IO1A 4C3LA 2WK4A 4J37A 5LT5A 3PR4A 4QWCA 2VKZG 4OI3A 2LQ5A 3FZ2A 2CQ1A 3KNAA 1PSDA 1RKIA 2I2YA 4ZP9A 2FJVA 1SKSA 2XEXA 1BQMB 3H98A 2JVRA 1JKHA 4DPOA 4WFBQ 4Q2LA 1Z2LA 5ITHA 1VQ4S 2MZSA 1K1SA 3OL6A 1G3OA 2HQ3A 1N4LA 2EKYA 4I7FB 3UW1A 3MECB 3TR5A 1VHFA 3UE2A 4ZPWR 5IT4A 1HNWF 4H4KA 4Y34A 3GQCA 2F3JA 2W4PA 3KLFB 1TKXB 3NRBA 3I6PA 2QSWA 3ZZTA