2GX8A

The crystal structure of bacillus cereus protein related to nif3
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
370
structure length
359
Chain Sequence
IPNGHEIISLFESMYPKHLAMEGDKIGLQIGALNKPVRHVLIALDVTEEVVDEAIQLGANVIIAHHPLIFNPLKAIHTDKAYGKIIEKCIKNDIAIYAAHTNVDVAKGGVNDLLAEALGLQNTEVLAPTYAEEMKKVVVFVPVTHAEEVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLERVEEVRIETIIPASLQRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQEEMTLGQFAEHVKQSLDVKGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGHNVEKVMKQGVQKQLQEKVDAKKLNVHIHASQLHTDPFIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NIF3-related protein
publication title The 2.2 A resolution crystal structure of Bacillus cereus Nif3-family protein YqfO reveals a conserved dimetal-binding motif and a regulatory domain
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Structural genomics, unknown function
total genus 105
structure length 359
sequence length 370
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01784 NIF3 NIF3 (NGG1p interacting factor 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gx8A02
4USIA 3M05A 2ZFHA 4CO0A 1UL3A 4CO1A 5D4LA 1NZAA 3TA2A 4D3HA 3NCPA 3X3UA 4YB7A 1VFJA 2DCLA 4CNZA 3AA9A 3O8WA 4D3GA 1UKUA 4CO4A 1XK8A 4ZK7M 5D4NA 4IYQA 2Z0GA 5DRKA 3TA1A 1P1LA 2XZWA 1UFLA 2CZ4A 4RWXA 4WK3A 4E98A 4USJC 5D4OA 3AHPA 1V6HA 1NH8A 5L9NA 1V3SA 1H3DA 4NYOA 3LF0A 3CE8A 2ZOMA 3NCQA 3HLUA 3L7PA 4R25A 3GSDA 2PIIA 2XBPA 2V5HG 4C3KA 1NAQA 1OSCA 4C3LA 3AA8A 2J9EA 2E66A 1J2VA 1O5JA 2GNKA 4AFFA 4CO5A 2JJ4D 1QY7A 3AH6A 4CNYA 3O5TB 1PILA 2XG8A 4RX6A 2O66A 2NUUG 2O67A 3N5BA 5D4PA 1KR4A 2J9DE 1VHFA 4USHA 2NUHA 4RLEA 2VD3A 2EG2A 2GW8A 4NYPA 3BZQA 1GNKA 1O51A 2XULA 3TA0A 4WK1A 1UMJA 2J9CA 1HWUA 3T9ZA 3DFEA 2NS1B 1Q1KA 4OZJA 4OZNA 4C3MA 4RWWA 1NH7A 3NCRA 4Y65A 4YB6A 2RD5C 4CO2A 4Y6IA 3OPKA 2GX8A 4YB5A 4CO3A 3MHYA 2EG1A 4OZLA 5DS7A 1V9OA 2J9DA 1V3RA
chains in the Genus database with same CATH superfamily
3M30B 1E6VA 5K8OA 5KFEA 1UL3A 4HHUA 3QT7A 1S7HA 3MAQA 4HLBA 2YWKA 4FNHA 1Q95G 2EVZA 2OIHA 3H2LA 4MTPA 3R1HA 1NDCA 2FC9A 3BDPA 1EQMA 3B4DA 3WQPA 3GIKA 1FXLA 3I5AA 3VAKA 1HL6A 1RYSA 5L9XA 4KGKA 2W7AA 1XMBA 1PG5B 3ILJA 4DU8A 2E9ZA 3FCWA 2MYFA 2PGCA 2QIFA 1U24A 4UZCA 3G8SA 2XMMA 5A6WA 4DUTA 5KG1A 3IS9B 1LWFA 3E2EA 1A6LA 4I69A 3OFHA 1UWBB 1Q7YT 1N4LA 3W8GA 1H72C 4P75A 1MWZA 2ZHAA 3TVYA 3M2VB 3HD2A 1GEHA 1MWQA 3UCGA 1S10A 3KK1A 1CSJA 2HZVA 3WX8A 4EYIB 2MJNA 4EZ9A 2DNKA 3TWZA 4MAKA 1RBLA 2UXCF 4ZP8A 3DI6A 3Q8RB 1Q8KA 1QE1B 4WU2A 3H2VE 5KFVA 4DSEA 4CT8A 1O8BA 4YY3F 2ASYA 4UTGA 1H73A 1U47A 4CM0A 2KU7A 1H3DA 2VPXB 4DR3F 4CYUB 4ES2A 2E5LJ 2WVDA 2N7CA 4OYWA 3T6BA 2QYCA 2QT7A 5I3UA 1IKXA 3UR0A 2CNLB 1BD6A 2ACMA 3ITHB 2XI3A 4FYWB 1QM9A 4NYPA 2YNHA 2OUGA 3TUPA 4ZCIA 2QO3A 4R0JA 3CB4A 1CJTA 4RUAA 5IV3A 4JOUA 2H3EB 4B17A 3KXDA 1N6QA 3MM7A 1WDTA 2L41A 5HANA 2CZVC 4DV5J 3WC0A 4DS5A 1XQIA 4Q43A 2MHNA 4DUZF 3MM5A 4UT4A 4PQUA 3A3OB 2FGOA 2YWHA 3G82A 3LP1A 1YSJA 4DL0C 2BJ9A 2HGMA 5IQ6A 1ZH5A 3KOAA 2VFRA 2RMLA 5D4OA 1FVQA 3HZGA 3UE2A 2OH2A 2M0GB 4GKKJ 2L08A 3CO9A 1TFYA 2A0FB 1REVB 5C2GA 4CDIA 1QSLA 4HT7A 2JSXA 1RAIB 3HVRA 2FQQB 2GNKA 1K47A 1F2GA 1TMMA 1RQ0A 2GJ2A 4PWDB 2LDIA 2V8GA 5KFXA 3TJ8A 3VAIA 4USHA 1VBXA 3VVUA 1YHQS 4K59A 4ECTA 1GNKA 4IFVB 5KFOA 1VC6A 1EETB 1AUDA 2H1YA 2WOMA 4K0KF 4KE5A 2QA1A 4PPDA 3FNNA 5T7LB 3SBMA 1SC4B 4B3MJ 3BYPA 5H9FK 1WJ9A 2HHTA 3E3XA 5HJYA 2IJNA 4Q8EA 3I0SA 3X1LB 2OPSB 4FPIA 4M5GA 1N0VC 1HBUB 3GV7B 4USKA 3CTRA 2PA8D 4M5IA 1EB0A 3IG1A 4PYAA 5JJBA 2OSQA 3VZHA 4C7QA 2IMWP 2KM8B 4A8WA 4I1TA 2XCAA 4K4WA 1FO1A 3TEHB 3TAMA 3IWNC 5HO4A 1VI7A 4AFFA 1U2RA 2O66A 3GG0A 2JZ5A 5IWAJ 3CJQA 1RT1B 4OHVA 5KFKA 4WCEQ 4CLYA 1HBMA 1FE0A 4ICLA 3VQSA 3K59A 1Q1KA 4J9LA 4OFZA 2KT3A 1HMVB 3NS5A 2YWEA 4I64A 3D4JA 3ZNUA 4MMOA 2GV1A 3ZNJ1 3FEZA 3IM8A 5FLXY 1ICEB 3BGFA 4A8KA 2BOPA 3CCVS 5D0HA 3NGKA 3TNVA 3VCDA 2CJBA 1TK5A 3RG6A 4QCLA 1CPZA 3M1VB 3OVAA 2MLYA 2BRKA 4DR3J 4N5SA 2NREA 5EWFA 3FFIA 1X5PA 4FZVA 4EK2A 2DXFA 1BC6A 3TR5A 1RT3B 2IBOA 1SL0A 4NXNF 3R5JB 2DNHA 5AE1A 3T5HA 5K8PA 4ECYA 3EX7B 1RB0A 3C16B 1U1LA 1U1MA 2YPZA 2VQEF 2DR8A 4ZA1A 5KG5A 3GJSB 2RE1A 3L09A 3NY0A 4ZCKA 4DI6A 2ZC4A 2E44A 2MGZB 5J2MB 1EHWA 8RUCA 2DGOA 1VRQC 1KQGB 1WTFA 4ZCLA 4HEA9 4YOEA 2DB1A 2HVDA 4DV0J 5KOWA 4JB8B 3UN3A 4X62F 1XJWB 1QSSA 1BMQB 3BKTA 4TYAA 2KDOA 4DUZJ 3QJLA 7AT1B 4DR2F 3P5BP 2EFQA 2IM1A 2VASA 4DBQA 4QIGA 2J9DA 1JJHA 3B8HA 1PO6A 3QWUA 1SIZA 3LANA 2DIVA 1FX2A 1PC4A 2C2MB 4CNZA 2MZ1A 2V0NA 4F36A 2HHHJ 3OW2R 1TAQA 3CJ5A 2HYIB 3ZZZA 2JEGA 1Q86T 2W2NP 3GYGA 5A8KA 4O3OA 1FXRA 3FRZA 1Y9OA 3GWCA 3D1HA 2CQBA 4UZBA 2CRLA 3BR9A 4N7TA 2MQPA 2HBZB 1OSCA 3V2UC 2F4VF 4Q0BB 2MQ8A 3BGRB 4KPYA 2AQ4A 2ZH8A 1T02A 2EFPA 4K0KJ 2RQKA 4OX9J 1WI8A 3VAGA 1JLQB 2XY6A 1WUUA 2EG2A 2DYAA 3EZUA 2ZNYA 1HNWF 1KHVA 2RS8A 2BJ1A 3T9ZA 4JI3J 3OXGA 1FRKA 2J0XA 3HFKA 1AB8A 4DL2A 1LEOA 5C42A 3T1AA 3O2IA 2F65A 1S9FA 2ZWOA 3FSIA 3DXSX 3BO2A 1RABB 2HW3A 5KT5A 3GZ7A 1E6YB 2CQ1A 1TZ0A 1WKLA 2AYBA 3C6UB 1FT8A 2PC6A 2RU3A 4JI2J 1Y4ZB 1HNZF 1HBOB 1RAOA 3IWLA 2GMJA 1FRHA 1RI7A 3QIPB 3LP2B 2BACA 1UTAA 3D6MB 2ROEA 1S9GA 4RW6B 1SUQA 3M32A 2X1GA 3PJ9A 3FRYA 3OTEA 4UOCA 4DR1F 4H4MA 4LF5J 4RW8B 4PRFA 4NLOA 4LF7J 5J2QB 1HHQA 2XG8A 4TLRA 4ECSA 3O6QA 4M95A 1HBNA 3SCKE 1YJ9S 5A0YA 4HT5A 4IG0B 4GO5X 1YWXA 1P8GA 3RAMA 2JFDA 2H5IB 4I67A 1CJUA 4AT1B 1ZZNA 3K5LA 2IRXA 4CLKA 2IAJB 2YNIB 5KFBA 3KHRA 1JLBA 3HO1A 3TAPA 2BKNA 1B7FA 3BSOA 3FJ2A 2NXEA 4B9NA 1GMVA 4NZ0A 5G0RA 1X0FA 2ROGA 1DQ9A 4NXNJ 4O3PA 4ZK7M 1H2VZ 2HWTA 4WK3A 3D0HE 5ETOA 1LXJA 3FQLA 1EIYB 4TY8B 4KAIA 4XPEA 1OPZA 3UO0A 1MSWD 2XBPA 3BQ2A 3IMQJ 2DGVA 1RK8A 3D54A 2GGPA 1RA6A 2CKWA 2YWFA 4X62J 1J27A 5HP1B 1Y0HA 5D4PA 3PW4A 4AUKA 3MM8B 2K3IA 2C2KB 4DR2J 4NXMJ 1LXNA 1VQ4S 4RU9A 2LVWA 2LQ9A 1PSDA 4KGZB 2RDIA 4DL7A 1RTDA 2ASDA 3MZIA 1ZM9A 4WPAA 3M7VA 3KG1A 4PG6A 2V8PA 1S5ZA 4RR5A 3CJSA 2JH3A 3VAFA 4YR3A 1DY3A 2VJUA 5ETKA 1YG0A 3N01A 5EWGA 3T5KA 1S6OA 2V50A 2KT2A 2DY1A 1EP4A 4IFYA 1I94F 3CCUS 2MLXA 3M2UB 4JP8A 1U6FA 2HLUA 2ZUGA 3QMQA 2QC3A 4PKDB 1S1UA 3C15A 2MQQA 4A4JA 3PYEA 2FZKB 2CPFA 4RW4A 2R8HA 4NRUA 1VK3A 2WVEA 4UOFA 3UDLA 4DF4A 1U48A 1RHJB 3OR1B 1U6BA 4TN2A 1IWGA 1N52B 4G65A 1TKDA 3G87A 1DLOA 1JLAB 4UF4A 1SXLA 4EZ6A 2C28A 4HI2A 1MWYA 2HKEA 3T6JA 1HNZJ 2VZ9A 2HHVA 4LIRA 3N0VA 1LW0A 3EGZA 2I0XA 5A8RA 2DHXA 5KFFA 3BJYA 2AHOB 2DTJA 2YH1A 2KG0A 3K58A 3A13A 4FXWA 5ETMA 3KJVB 3TI0A 1RT6A 2MZQA 4F4YA 3CD0A 2ZZTA 3DC2A 4DQIA 2GQCA 1FI4A 1M5HA 4CLFA 3JTOA 2Q43A 3Q2TC 3NWGA 3QGPA 1NK9A 4Z7YA 5B0FA 3G4SS 1T03A 4CH0S 3SSQA 3M9MB 4FN5A 2IYGA 4LRBA 2HHWA 1JJCB 2B3TB 4ZHRB 1P6TA 3JSMB 4RW9B 2J8AA 3RZAA 5KFJA 1APSA 4DQPA 4PCQA 3R3TA 5FLXU 1CLFA 2GA7A 3G8TA 4YB6A 1TKXB 2RRBA 3GJTB 5KG3A 2RILA 1NB2A 2G4BA 5HROA 3T5JA 3TJAA 4L74A 3OV7A 3O3LA 1RWVB 4AYBD 3FC9A 1UFKA 1VRTB 1S48A 2X1BA 3BH7B 3CF5Q 1HNVB 1RCOB 1P1LA 2OMOA 5IC6B 1OS5A 1RTHB 2DR7A 2DRAA 1NBEB 1XBWA 3L9ZA 3OR2A 4E2FB 3U02A 4FF3A 4MJKA 2H65B 3HMJG 2W01A 4ZIVA 2XS2A 2P9GA 1K0TA 1YIJS 3VQTA 5E7OB 4J9QA 4P74A 3IRXA 5KFPA 1PILA 2D3OR 1JLGA 4ANEA 3W65A 1TV6A 3O1LA 3KLIB 4DSIA 3SQGA 4G6VB 2XULA 4RBUA 4IQMA 4NLUA 2VOPA 3I0RA 5KFMA 1SJ3P 4CH1A 3RU0A 2W9CA 3R7NB 1FKOB 1VQ8S 2NSCA 2LEAA 5LM7E 3HM9A 3HZEA 2OPQB 3BGUA 1I94J 4AQYF 4EU0A 1R3NA 2B8PA 5F0WA 3V6JA 4LF8F 1VHIA 1S0OA 1OY9A 5LMNJ 2MDAA 3DHWC 3R6GB 1KNZA 2L9DA 2ATCB 2YKMA 5E5NA 1SC3B 3LPYA 1UETA 2DGTA 9RUBA 4OYXA 3VWSA 1Z4UA 2YKQA 2OAUA 4H4OA 3GSDA 1FXDA 2J8SA 2VBXA 1ZETA 1RBOB 4F02A 1QD1A 2E66A 1IKVB 1KDNA 1NDPA 1L3SA 1ZOTA 4DCJB 2F8EX 4LRFA 1XNRJ 2VPZB 1ZA1B 2V8DA 3E8OA 3HHEA 1NJWA 3A12A 2N3OA 2Y1JA 5ADZA 3K17A 5MLCV 4AL7A 4F2RA 3ELHA 2ABYA 1O51A 2XSJB 3TA0A 1S1VB 2E5JA 5E41A 4LR7A 2D74B 4O44A 4NRTA 2VA3A 1U0HA 4I2QA 4DJBA 5IM0A 3DLEA 4I0WA 2GMHA 4C48A 3DXBA 3OQ2A 3VGSA 3H20A 1SV5A 2HZAA 3IGNA 4NCGB 2AJFE 1CJKA 2A2DA 4ZLLA 3NBPA 2DGXA 2LA4A 1J5EF 2ZD1A 3NXZA 3CCSS 4BC9A 4DG1B 3THTA 2B5JA 1YDLA 4P6QA 4PQAA 4Y3CA 5L1KA 2ACYA 1CQNA 5CH7B 2IM0A 4NL5A 1IM4A 3D0GE 4OYBA 4IOCQ 4JV5F 4RU2A 4BCAA 1NM2A 1RU2A 1SKSA 2GQQA 2B8QA 3G6XA 3DMJB 5KFYA 5A76A 3QSIA 3OL6A 4DZDA 2RU9A 1Q8IA 4NLVA 1LWXA 1VQMS 4C3LA 4P7VA 3NP5A 2KL8A 1R6YA 1FESA 2U2FA 3DLKA 4F4AA 1HKAA 1CC8A 2DNMA 1ROFA 4TKTA 3NS6A 1VHFA 2NCKL 2VD3A 4NEZA 1CVJA 1H7XA 4AXJA 3DLLQ 3L4BC 2FD2A 1LWEA 2BBEA 2ZHOA 3JQJA 1GK8A 3G8QA 3J80Y 5GMKa 4OZJA 3HULA 3TJ9A 1IJEB 4ZPDA 4ZPTR 2VFSA 1AZSA 3V6DA 4LREA 3DOLB 3Q8VA 5LSRA 2A2CA 4USIA 1W2BR 5CYMB 3ISNC 3CDWA 1TL1A 1QJHA 3T19A 3J7Z5 3BYRA 4RBVA 4J9PA 4WBFA 1WORA 4OLOA 4ID5B 3UD3P 4TY9A 4YUDA 1PYTA 3BH6B 4ZPCA 1D8YA 3U1LA 2EC0A 1B0VA 3ENWA 2OFHX 3HHLA 2EW9A 1U25A 3I5CA 1NMEB 2OD6A 2CUYA 4A8SA 2JVOA 3HSGA 1D0EA 2C22A 1XIQA 1UVNA 4KJIA 3LWLA 4K4UA 4OI6A 5HI7A 1SBRA 2M52A 2JLFA 3GLJA 1VLOA 3RJMB 4M5NA 1RTJB 4RUHA 3U7JA 2WONB 3OFFA 1RT7A 2JNJA 4X64F 1F9EB 3I9ZA 1WC5A 1PJ5A 1SC1B 1PBUA 3DRYA 2AYGA 3MTKA 3EPGA 1S99A 3CMQA 2Q6BA 1KWMA 4NEYA 3DDKA 3N5FA 1SJ1A 1RAJA 3W5YA 1TL7B 1DRZA 4FXDA 2J0WA 4J9RA 1R0CB 3CJKB 3BGLA 3D0IE 2ZJQQ 5DJBA 2D3O1 3P8BB 1MROA 4P2XA 4M5HA 2YX1A 1TKTB 2XHWA 4RPFA 3NCQA 1HPZB 3MR5A 4JI4F 1S6UA 1FA0A 4OJGA 4L73A 1RAHB 3O44A 4ZLPA 2ZWPA 1NDLA 2G13A 4HI1A 4X4UA 2O01C 3S6EA 4LR8A 2HQDA 3W62A 4ILLA 4EMDA 2PI4A 1N5YB 4A47A 3EYZA 2MKYA 3VV2B 2XI2A 3NLCA 4ZMMA 1YX2A 2BE9B 3BM7A 2R7SA 3KJQB 1FE4A 2MQMA 4DN9A 1XEZA 2XWXA 3HHNB 1C4CA 3Q8QB 1GMUA 1IVZA 2GFFA 4OZLA 1QAXA 1WC1A 3AD8C 3S8SA 1WHWA 1U09A 1L3TA 1R8PA 1E6VB 4KH1B 4B9TA 1R6VA 5JXSA 1RZMA 2EWHA 2HWHA 2B56A 4PXDA 3EJMA 1SL1A 2IM2A 1SVDA 1BQNA 4DV4F 2B43A 1AYEA 3LP0B 4FYVB 1QAYA 1KTVA 4DX6A 3KHHA 4CO5A 4FVMA 2JVRA 2HNYA 1D1UA 1U2FA 1NRKA 1TR0A 3HFVA 3JQKA 3DRSA 3D5MA 2F4FA 2FJBB 3M1VA 3OTCA 2EC2A 4ETXA 4R0EA 4F67A 1GXUA 4MIAA 5LXRA 1M0SA 1HWUA 4FXVA 1N5VA 1LWFB 3MMJA 3EGNA 1XR5A 5FDLA 4RNNA 5AE3A 4B08A 3W8PA 3CCMS 3ILLA 3CJ3A 1BHNA 1KQSR 1ULRA 2RDDA 3KK1B 2K8GA 2QSWA 1T95A 1NLKL 3CEDA 1SJ4P 4ZVTB 1S4EA 1ZPVA 5EX0A 1KBRA 3NOGA 3DI6B 4U7UK 1RWMB 3F44A 3W61A 4RWXA 3FZBA 1QUVA 2UXDF 3PJWA 1YRTA 4Y00A 2WVBA 2UVUA 4B3RJ 2EFVA 1VC0A 4C8KA 2FB0A 1SIWB 2PI5A 2P5VA 2NR0A 1D9AA 1UFWA 1X31C 2VFTA 3DOMA 4X64J 4ZVRB 1R0AA 1IKXB 4QOTA 3MAAA 2DR5A 1GT8A 3QJJA 5EHHA 4QIEA 4LFBJ 2ZVSA 4QW9A 5KFGA 3KMQA 4NCBA 4C3MA 4DCOB 3NGTA 3CJRA 3RW7A 2DPJA 2YNHB 5C2CA 2J76E 3PW5A 2CZ9A 1WDDA 1CJTB 1FERA 4NLGA 2OGUA 3T9NA 4WYWA 1N6QB 4LF6F 4IOAQ 3DM2A 3J7A1 3KLHA 3Q8YA 3UCUP 3G6VA 3NCPA 1A0OB 4JI4J 1SPBP 1SQFA 1TL4A 2C2ZB 3BKUA 5IOLA 4IG3A 1X5OA 4ED1A 5ETRA 5SZTA 1F3FA 2RDJA 4L6V3 3MM5B 4PQUB 2LQ5A 2ZVIA 3AQPA 3G82B 3LP1B 1FRLA 2ZBRA 1ACMB 3PFEA 1NAQA 4AD6A 5HAOA 4K8RA 2XGQA 1X8DA 2DO0A 4QBUA 1DTTA 2LYVA 2O67A 3UI3A 4O4RA 4JI6J 2M70A 1YZ6A 2Y0SD 4RLEA 1IBLF 3C6UA 3ZZUA 4A8QA 3ZZ0A 3T5LA 3R27A 1WI6A 3CJ8A 3PW2A 2B4VA 2BRLA 2HVHA 2X51A 5CD4H 1KN6A 4NMLA 4EBCA 4Q7AA 1UEVA 1NSQA 2WOMB 3MHYA 5EUHA 1KVKA 5IZHA 1S6PB 4ZOSA 3OTDA 4ZLNA 4HHJA 4CO0A 1RT5A 3V5RA 4DL6A 3GCWP 5GVQA 3QFWA 2W1BA 3VVTA 2C3PA 3EM1A 1GTEA 3TUJC 4ZPBA 4C97A 4U95A 3I0SB 5K20B 2OKQA 1JJ2R 1Y5LB 3BN7A 1EAYC 3IG1B 4ZJQA 2R7VA 5HATA 3OUYA 1A7GE 3PV8A 2IAJA 1YRXA 3KJFB 2VHGA 3N9UC 2Z57B 4OHWA 4KT0C 3TAMB 2CXEA 2BVZA 4AXIA 4U67Q 3J80U 2VG7A 5GAHU 3IR6B 4B3SF 3VHQA 4DFJA 2OPPA 4MK9A 3RUBL 5LJ5Y 2GQ2A 2FC8A 4KO0A 1HBMB 1X4FA 3AJ1A 4ICLB 3G6YA 2XYHB 3GIMA 1BQMA 1AA1B 3QT8A 2N4DA 1OMSA 1I6JA 1MLAA 2O5DA 5L39A 3IM9A 1HARA 1Z1ZA 2GO8A 2YNFA 4WF9Q 3FCHA 2UXDJ 3KWMA 3HHLC 1RSCA 3FCVA 1CBKA 3BSCA 4NASA 1M1KT 4NMXA 3Q83A 3GJRB 2RHSB 4HH0A 2HAFA 4ZKAA 3I96A 1FRMA 1VQPS 3FFIB 1TP7A 2AYMA 1YTYA 3ADAC 4QYRA 4E8UA 2OD4A 3OBIA 1FJEB 2YBVA 3A1YG 5ETPA 2J7WA 1YQHA 3T1HF 3HHLD 4PYDA 2LDYA 3FKBA 3JQMA 1IM6A 3Q0AA 3FBBA 1ITPA 3RB3A 1R0BG 3IR5B 1RISA 4RWWA 3LALA 2HHUA 1WEZA 2E9TA 3QFHA 5D3GA 1L3KA 5IV4A 1FVSA 4CO3A 1GX6A 2FHMA 2VL1A 4WWSA 3R5CA 3QT5A 2HQFA 4GVBB 3RGIA 5AJ3F 2R7OA 2MSSA 1VQLS 1VISA 3SCLE 3MFIA 2DCLA 2DXDA 1RWUA 3CXCR 1XK8A 2VV5A 2APOA 4QWAA 2ASLA 2CQIA 3MPYA 4MYTA 4MKAA 2V94A 1KP6A 2CPJA 4ZP9A 1Q5YA 3MECA 3OVSA 2I6WA 1RKJA 4DZ6A 1UW4A 2A18A 5A8KB 2GZOA 1ZS6A 5DZ7A 3ILIA 3OXLA 2C2DA 3A3NB 4JUZA 2A1BA 3MMCA 2KYXA 1P9YA 2BA9A 4EEYA 4OI0A 5F8HA 2VDIA 1CS4A 4JV0A 2MQOA 2J6TA 4FP9A 2KFZA 4DR4F 3RB0A 1TL3A 3SCJE 2OELA 3B6BA 3MPDA 1RWOB 4OLPA 3CCWA 4L72B 3R97A 1RLCL 1NHKL 2ZE2A 2NZCA 1FNXH 5HLFA 1UZDA 1IQZA 2FTRA 5C42B 4K5SA 2BKPA 4WXOA 3PFOA 3B4MA 2OP5A 1S97A 5FD1A 5DQIA 3MXHP 2Y3YA 3OXFA 2IC3A 3AOBA 2F7VA 4F3MA 4Q2LA 2WK4A 1SKWA 1S9GB 3V81A 3D1OA 3M32B 3IC1A 1IR1A 2AEFA 2ZKUA 4H4MB 4ZS6A 3W9JA 4J90A 2UU9J 3GILA 1AUSL 1T9XA 1Q82T 4FYDA 4AE5A 2EFGA 1HBNB 3KNAA 5A0YB 4UOGA 2HURA 2KXNB 4ECVA 2RH3A 3J7ZT 4M5DA 2MHEA 1U26A 1WNEA 2NLWA 5F8LA 2CJXB 1KEKA 3AODA 3QGGA 5IS2A 3PIOQ 2ZH5A 3R2CJ 1V3ZA 3OL7A 2AX1A 1V3RA 2BJ3A 3K7RA 1U49A 1JLBB 1KHWA 1QAIA 4K4ZA 5C5JA 4ED0A 1XERA 3PEHA 3MD1A 2HQIA 4YHHF 3AA9A 3ETMA 4D3GA 2EI5A 5G0RB 1U1PA 4RW7A 4KB7A 2FVSA 1X4CA 2YKOA 3T1HJ 2AZ1A 4DFKA 2HMIA 2ZDOA 3KUHA 4J9MA 4O3QA 3RAXA 1RP5A 5HQMA 3PHEA 3R5GA 3DU5A 1C0UB 5B0DA 1DQAA 3D2WA 2RAQA 4MFBA 1XMOF 2QMUB 2GGPB 2L3MA 2RUSA 3MFHA 5D0EA 2RQCA 3LO3A 3SV4A 2UUWA 2J9CA 5FJ4A 5K9FA 1N5SA 1PYOB 5KFNA 3EDQB 4LRAA 5HMWA 4I2PA 5DS7A 1S76D 1RTDB 1BY9A 1NO8A 2FJAB 3M05A 4C11A 1YKWA 1HI8A 5D8HB 3A8KA 2HNZA 3UD4P 1L3UA 2WB4A 2YQ1A 1HNXF 2HS4A 4QR2A 4EUVA 2ZH3A 4G1QA 1U1RA 4PXBA 3KTQA 1FEEA 1X0PA 5KT7A 5MAOA 3L3CA 4LF2A 1IBKJ 4WZMA 2VKZG 3D66A 1EP4B 2KI2A 2HHSA 3GFHA 4DUYF 4E0DA 2NXJA 3PHTA 3KHGA 4O3SA 2D3UA 1S1UB 2LMIA 3C15B 3KUEA 2R8KA 4B3TF 1B70B 1OY6A 4RW4B 3CJ4A 4TXSA 1YRUA 4R5PA 2FJXA 5BR8F 1N32F 1RJJA 2BKOA 2F9DA 3W63A 3ZZYA 4C8ZA 4OZNA 1YZ7A 3BGOP 4MIWA 4IRCA 1VIXA 3MEKA 4U8YA 1RT4A 5D0GA 2QYGA 3OHBA 5AXLA 2KVQE 1RADB 1WSVA 1W25A 5A8RB 3NL0A 1UPMB 2FHJD 3TRGA 1IUJA 3W2VA 1URNA 4XDCA 4KHMA 1RT6B 4NWBA 2ZNZA 3LGHA 4F4KA 3RRKA 2X7IA 4U7UD 5KFWA 5AXMA 3CMAS 3P4UB 5DDRC 1W2IA 2F63A 3H5YA 1T03B 5KFIA 3CNQP 8AT1B 3RR8A 3U27A 2PMWA 1VJWA 5LMUF 3IRWP 2UZAA 4O0NA 3PRVA 3FSXA 3HT0A 3MEEA 5CYMA 2GW8A 4U9RA 4IO9Q 4ZDNA 1LFPA 5AXKA 3OVBA 3DFEA 2WTFA 2GS8A 3MUMP 4F0MA 2QRRA 5GMDA 5M2UA 2DGWA 3VGVA 2MY8A 5B0GA 1G2EA 2LQBA 3FSYA 2MXYA 1G6BA 2F5GA 3J7YU 3NAHA 4F4XA 3E01A 2V9WA 4KTQA 3M6UA 4X4PA 3CIZA 5HROB 1PYSB 1LOUA 2Z0GA 1Y11A 4KV8A 4JV2A 2GVZA 2FHOB 4DDFA 3BQ1A 3MM9A 1XMOJ 4X2BA 4MH8A 4CLZA 3EWGA 1RHMB 2PEBA 1RGVA 1ZBTA 3OR2B 3AOAA 4NLXA 4ED2A 4CQ1A 5KFLA 4WTYA 3DRXA 2MMYA 3PJXA 3SDEA 3IRXB 3DGPA 4ED8A 2ZBPA 4JI1J 1JLGB 4RNFA 5LOQA 4U7CA 1VQ7S 5I3QA 1TMJA 3SQGB 2E1RA 3LAMA 1VCTA 2VONA 3UN5A 2GX8A 1HNXJ 2W25A 3I0RB 3QZ8A 3US5A 4QPTA 2ZM6J 4LT6A 2J6SA 2W9CB 2QFJA 2E7WA 2FVPA 3TW0A 1OY8A 1MMDA 2A6OA 4XAKA 2V69A 4AL6A 3WZ0A 1V5VA 3EUNA 4WU3A 1VS3A 4DUYJ 3R6LB 2BEFA 3HVWA 2PEHA 1R7IA 1N34F 2WAQD 1R8HA 3N6LA 4PG5A 4B3TJ 2YH0A 2CDQA 1N5QA 1S6QA 4QWCA 2YKMB 4ZVSB 3S01A 2YX4A 5I42A 1RAFB 1N32J 3QLHB 1GXLA 2CAJA 4F4ZA 5J1PA 1PJ6A 3TVZA 3G71S 4H4OB 1ZTTA 4LBHA 1FFSB 3TYTA 2WSFC 3Q23A 4X4SA 3OT9A 1IKWA 1F60B 2GMLA 4IQXA 4S0MA 3TZYA 1FTRA 2AV5A 1N36J 5JVGQ 4OYMA 2R7TA 3GU0A 3R9LA 4ZVGA 2LEPA 4O44B 1NKBA 1WHXA 2ZBQA 3DHXA 1U0HB 4I2QB 3H5SA 1V9OA 5IM0B 3DLEB 3H0PA 4Q8FA 1EKSA 3LP0A 3BPSP 1S0MA 2VA2A 3M8YA 1SV5B 1HR0F 2VQFJ 3EDRB 2COLA 4BWJA 4JI0F 1CJKB 4KH0B 1SH3A 1KRPA 3NBPB 1DTQA 3BREA 2ZD1B 4X4QA 1OO0B 3HSDA 3JAMY 3QNWB 2NXNA 2XMWA 2B5JB 1KLMA 4J9SA 1TFWA 4USVA 2XO7A 4W90B 1TELA 2AT1B 4DS4A 1IR2A 4K4TA 1NNDA 2LQ8A 3SI8A 2E29A 4X4TA 3EGVA 2BM0A 3KUGA 2XYPB 3DLKB 3JSRA 1WC6A 2AIRB 3ETOA 4DV2J 5GADI 4O3RA 1YVFA 1LWEB 1F5AA 4A48A 4DR5F 4OX8A 2IHR1 5DZ6A 5F8IA 2QA2A 5DM6Q 3PDNA 1MU2A 1AZSB 3V6DB 2F3JA 2Y8WA 2EFOA 2Q79A 2KO1A 4Y28C 1PBAA 5HMZA 3GTYX 2DBBA 4U6PA 2XNRA 4OV6A 1HWLA 1NXIA 1VQYA 1NZ8A 1TL1B 2UUTA 4QWDA 1U8WA 2ZH2A 3MUTP 2Y1RI 3IN5A 1JB0C 3MI7X 1N33F 2PA3A 3CJTA 1UVMA 4UY85 4ED4A 2HS3A 2DK2A 3KK3A 2LLZA 2K1RA 3AH6A 1D09B 2MKHA 4YN3B 4O23A 3HHLB 1LQ9A 1JLEA 4KGXB 3IAM9 2MQNA 1X4GA 4F04B 4LFAJ 1HQ2A 4GKJJ 2M2BA 4ELTA 1CQMA 1KQFB 2WB1D 3V6KA 2DD8S 1HQUB 2BOAA 2VIHA 4Y65A 1XR6A 2MZJA 5GAEI 4DV1F 4LFCJ 4LQ9A 1SJFA 2FJVA 3MCSA 2VFVA 3G86A 2K7JA 2HVZA 2ILZA 3BV8A 1DQ8A 1RT7B 5KG2A 2ALYB 2OHDA 3RB6A 3L7UA 3H98A 1KC8T 2DGUA 4EYHB 1KLNA 3T1YF 2VFUA 5HMYA 4IDKA 2ZJPQ 3UCZP 2Y0BB 4IYQA 5HVFA 1NK6A 3F41A 2G2ZA 4C0BA 3QT6A 3OTOJ 4UQTA 3MPWA 1G3OA 4IR1A 4FF1A 4HTJA 5AE2A 4B9LA 3M2RA 2VBWA 2F8MA 3GV5B 1MROB 1TK0A 2CJAA 4CCHA 1JX4A 4L75A 1EJ7L 1QDUB 1QY7A 1HQEA 4CLLA 4H54A 3HKZD 4M8LA 4DCPB 5IT0A 1S6PA 1FFWB 2XY5A 3BB5A 4C8MA 2VUGA 1DZ5A 1D9FA 3QPIA 2AJ2A 2KKHA 2XTJP 2HRUA 4YQWA 5LXYA 2DNNA 2IM3A 3CGIA 4B9SA 5F8MA 1T9WA 3GFZA 3DLJA 1RWWB 2QTWA 1T9YA 1FDAA 4C6AA 3J7YI 2ZFHA 3K89A 4QR1A 2EEYA 2XYGB 5CCLA 2FLPA 2RQ4A 2ZBIA 3K5PA 4YB7A 2UP1A 2EFNA 1S79A 2RUGA 4FBTA 1R8AA 3GMGA 5DQHA 1LW2A 2OPRA 4NA1A 3QRRA 4DMZA 3GYNA 4YFUA 4LSLB 3KLGA 2KZZA 1JQGA 1Q5VA 2IDLA 3AXKA 4J37A 1BQNB 4KC5A 4F26A 2CPDA 3W64A 2DITA 2UXCJ 2PFFB 6FDRA 3QBCA 3K8VA 4DR5J 2Y9HA 1SI9A 4C98A 4OYIA 4YY3J 4MT1A 2VBZA 2HGNA 2HNYB 2X1AA 3A8JA 3C46A 2B6AA 1FWLA 3KG0A 4JI7F 3VTIA 1OPIA 3DRSB 3ZO7A 4R8UA 3GJQB 4QQBA 1IN0A 4J7CA 3PM9A 4IO1A 2FGCA 5FDLB 1HLWA 2HHQA 4KY3A 4ZPWR 3T3FA 1S59A 1FNOA 4OHZA 5DDOC 2D7SA 2PSZA 2CPHA 4CO4A 3TZXA 1N33J 2XLKA 2VOOA 3ZZPA 2PT0A 1X60A 7FD1A 5H9EJ 4OX7A 5RUBA 1C1BB 5B09A 1WEXA 4QIWD 4P71A 2AJ0A 4M5JA 1F9HA 1QTNB 4IRKA 4UUXA 4P2MA 5ETSA 2D69A 1RTIA 3RYLA 3HKWA 2JDJA 1YBAA 4GVBA 4DV1J 4I6YA 4LVOP 4IH6A 1ZZFA 4LRDA 3R7BB 4P9SA 3PCOB 5SUHA 3DOMB 3SEOA 1R0AB 3MAAB 3OL8A 2PMHA 3T1YJ 2CNNB 4W4MA 1UP1A 4P73A 4L3NA 4RUBA 2IVMA 1WEYA 3DCAA 5IC4B 2IDEA 4N8NA 4G1PA 2MKJA 4Y34A 1Y00A 2XS7A 3DOKA 5BXIA 2HFSA 1T8EA 1NHVA 1VR6A 3CDEA 5KFUA 3DM2B 2J5AA 2HEKA 3KLHB 3TA1A 3NKYA 2L9NA 4OYZA 3KJNB 1VRUA 1Z2ZA 5F8JA 3UNYA 2Q66A 4UW2A 4IG3B 2J6UA 2YWGA 4PG8A 3AB2B 2CJYB 3CE8A 2HFOA 3CC4S 2V5HG 1QAJA 2Z56B 1NCLA 3N6NA 4YDXA 2YTCA 4F2SA 1R8BA 3QO9A 1UVKA 4UQGA 3W3SA 1RTZA 2CYYA 1FD8A 5DM7Q 1DFDA 5B0BA 2C3YA 3H4BA 1DTTB 2DXEA 1S4FA 4B9VA 4ITSA 2OMLA 3PKYA 4NYZA 1LNQA 2JOQA 2GVDA 2V68A 4ZVPB 3W2WA 1JWWA 3ZXWA 4RNHA 4X84A 3AJ2A 3P49B 2PDAA 4OX6A 4MKYA 3JAMU 5KT2A 2R7UA 3JYTA 3W9IA 3NG8A 3PR4A 3FBFA 1RWPB 1RT5B 4TLQA 1FK9A 4ECWA 3CJ2A 1X7VA 3N79A 1B0TA 4N76A 2E7VA 3LF0A 4KRWA 4TYBA 2RHQB 2ZH1A 4DFPA 3MCNA 2VDHA 2UVWA 3DRPB 2AEMA 1PKUA 2WHOA 3GIJA 5E3QA 4JI7J 4KKOA 1T05A 4JV1A 3GPAA 1F1BB 5F9NA 2LKZA 5DG7A 3AQOA 3H8YA 3OUYB 2EPIA 1YJUA 4EI2A 1JXVA 1FDNA 3QRQA 1FRJA 4CTAA 3J81Y 1L5UA 1U1KA 2AP6A 2VG7B 1MMLA 1RXOB 1RHQB 2OPPB 4KHPF 3ONQA 4ZP7A 5D6GA 2XSFA 2VQEJ 4KO0B 2X1FA 2CJ9A 2HFZA 2BJ7A 2K3KA 1BQMB 1FWKA 4P7TA 5HQLA 2PO4A 5CYQA 5KT4A 1JMTA 5M2RA 1C0UA 1MW7A 2IJFA 3K57A 2B9YA 4RUCA 1P1TA 2HNDA 3ISZA 2YNFB 2CIMA 1C1CA 4MIBA 2MKSA 4PXEA 1WF2A 1ZM3A 2UV8G 2XCPA 4DL3A 4OIXA 1LV5A 3V4MA 4C4WA 4PPZA 1B3TA 1FJ7A 4NZ6A 3GYXB 5E3CA 2AW0A 2KHDA 1X5SA 1RHUB 3NS7B 4LJMA 3N5BA 2I9SA 2IMOA 2JC1A 1PAUB 2DNYA 4J9OA 3OSNA 3MCOA 2M5YA 2XO6A 4WK1A 2BM1A 4IRDA 5KFSA 3H59A 3C2PA 2YKAA 4YB5A 2PFDA 2F4VJ 2FZGB 3UQSA 2G0IA 5D3GB 1ZM2A 1TQLA 3HSZA 2QLXA 2MTLA 1Y5NB 1LFWA 5J2NA 1VLYA 3K2YA 4NPOA 3C8YA 2DIUA 1RHKB 4CM2A 1WKKA 1HNWJ 4FS1A 4KBIA 3UW1A 5CAAA 2CPYA 3KK2A 4I7FA 3CD5A 3ENVA 2ATLA 1JKHB 4WIQA 3H5XA 2VU5A 3N6MA 2GHPA 3L95X 3HVAA 3MECB 2RIJA 3ZTPA 2L48A 3ENAA 2IFXA 3BR8A 4ELUA 3FUYA 2KTQA 1OYEA 2KN4A 3OL9A 4PUOA 1FEHA 2HPUA 2VG6A 3M8ZA 1GAOA 3MMCB 4RNMA 1YJ7A 5F0UA 1YK9A 1ZA2B 2JEJA 3M8SA 4DFMA 2NXCA 1CS4B 3K5OA 4DR1J 3VAMA 2E5LF 3NEKA 1TL3B 3ET6A 1RU1A 2N3LA 4KGVB 2DRBA 3THPA 2ZE2B 1RKIA 5HLFB 4FF4A 3CDUA 4GRSA 4DPUA 1B0PA 1U1OA 2M3DA 3P6YC 1IWAA 2IYIA 2V2ZA 2DVIA 5A6PA 2QLBB 4V19J 4WZQA 1J5OA 2XLJA 4NZ7A 3MPUB 2BJ8A 1JLFA 4FKYA 2IC3B 4I56A 3K8WA 2QL7B 3SXLA 1KFSA 4IH7A 1KVIA 2DH7A 2MY7A 2YQ0A 3MCMA 2MSTA 3HVTA 3MR3A 1YJTA 2F8HA 4YS2A 2KB2A 3CCES 3V81B 3TARA 2AZ3A 2LXFA 2Z2ZA 1XR7A 4B9UA 5L1JA 1ZTWA 4QU7A 2VC1A 3NGRA 4NA2A 4G1IA 3RBZA 4OI3A 1N56A 4LUBA 1NH7A 1OJ4A 5LSOA 3IGVA 4GKKF 1OQ3A 3Q86A 4DR7F 4L3KA 1VBYA 3GV8B 2VH7A 4K2JA 1Q78A 1R43A 2HVEA 1FKPA 2W7PA 4M5DB 2P2CB 2DHHA 4IUFA 4ES1A 4PR6A 2XWYA 3PO4A 4XO0A 4UY8T 2ZOFA 2Z2MA 2ADCA 2DPIA 3UNGC 1HHSA 1UFLA 2CZ4A 2QL9B 1QLNA 3PR5B 3R5BA 3BKFA 3DKDA 1WELA 3GR0A 2CJKA 2WW8A 3HLUA 3CCRS 3HDSA 4RW7B 4I6AA 5ETTA 3OHAA 4B3MF 2HFUA 2FYXA 4RO0A 3T41A 3I6PA 2JX2A 4WP9A 1YJVA 3EICA 2HMIB 3FBEA 3C14A 3LWMA 2DR9A 2M7SA 4NOHA 4F8RA 2B4UA 2CQPA 1C0TA 3BSNA 1T9TA 1NPRA 4XTTA 4MFBB 3ZTSA 2BANA 1AFIA 2BYCA 1U45A 4ID8A 5ETLA 3V4IA 1UVIA 3TZWA 1X4EA 5KOXA 3MURP 1FX4A 2CQ4A 3OPKA 3AAWB 1NSAA 5IT9Y 3PX0A 1D9DA 2FVRA 4DPOA 1WSRA 1NK8A 1K1QA 4X4NA 1YJRA 2FPHX 2HS0A 3OJSA 3QLHA 4I2PB 5IWAF 2F9JA 1AT1B 4C11B 4OZ2A 5D4NA 2JL9A 2C42A 2ZBCA 3DRRA 2D3ZA 2QA4G 2HNZB 3MR7A 3PNIA 3QYYA 3D3BJ 2DNOA 4F7VA 2IY5B 3J81j 2RF2A 4G1QB 5K5MA 1M5OC 2XGPA 3UPFA 4I6WA 2ZH4A 2R4FA 2E9RX 3POTA 1VMBA 2GIQA 3LQVA 3MDFA 1HWKA 2LCWA 4NLWA 5GMEA 4QIVA 2CG8A 2UUAF 1UCNA 2FY1A 2AD9A 5F41A 1CULA 3C3LA 4U8VA 1PGZA 3R2DJ 2V6AA 1XC9A 1AXQA 1VQSA 3S7RA 1WKJA 3NAIA 4R5PB 3LGMA 1BLUA 4PXCA 4KHRA 2HFVA 2DR6A 3HX9A 3IO1A 4FYXB 2WZ1A 3H2UB 2RT3A 4ZVFA 3RRGA 1F0XA 2KVIA 3DU6A 2EXUA 4OZ0A 4DN0A 1RT4B 3M9NB 3RW6A 3OD2A 2R2UA 3D7SB 3HJVA 1WTBA 3TP2A 2CPZA 3KLEA 1WF0A 2BW2A 4DV0F 3HPOA 3UN2A 3IBFB 2HVIA 4ATNA 1RLDA 1I51B 3W2VB 3MTJA 3MMAA 1Q4RA 2AKWB 1HIYA 1K44A 3TEGA 2PE8A 3NNAA 2FLLA 4UOHA 4NE9C 5ETQA 4ANCA 1N8RT 2R42A 4CP5A 3J81U 2HRTA 1VK8A 1TKZA 4WJBA 2DY9A 3ZZTA 4DR7J 2LXUA 1HW9A 2HHHF 1C2PA 4HDGA 2OTLS 3MEGA 3UDEA 3MEEB 3AFGA 2GAGC 2YKNA 3GCXP 4X4RA 2Z30B 3FZ2A 4BBYA 1S1XA 7FDRA 2ZITA 2CFXA 1UW9A 1R27B 2ZZMA 3HK2A 2A6MA 3NWRA 1Y3KA 4OX9F 3ZTQA 1YBUA 4B3OA 2V63A 3TUIC 5JMNA 4F25A 3E01B 1U02A 1RACB 2FVQA 3ISND 2W2PP 3WHIA 4JI3F 4USJC 2FVCA 1IKYA 3I56S 5I4MA 1NH8A 2ILYA 4O4GA 1NJYA 3JS9A 4KV8B 2GVZB 1KS2A 1HQUA 5H1SV 2NSBA 3DLGA 2J9EA 1DBDA 3MM9B 1T9VA 2W9BA 1Q7LB 4O3NA 4AQYJ 4LF8J 2JRSA 4JI2F 2WSEC 2EK1A 3D67A 3GP9A 2QMWA 3UD5A 1MN9A 1GMWA 3SDEB 3DGPB 3M6XA 5CA5A 4IOBA 2DHSA 2ZKTA 3L7OA 1NJXA 3RBXA 1B4SA 2OSRA 2QZ8A 2CWXA 4NLDA 1GQEA 2EBGA 2Z4PA 3BO4A 4LF5F 2YNGA 4ECRA 4DSFA 4GMKA 4CT9A 1L3VA 4WE1A 3PIPQ 4LF7F 2QJ3A 4NX9A 4D3HA 2POKA 4WXWA 2JFKA 1CJVA 1VJQA 5E2QA 1Q0NA 1GXTA 1WC4A 3TZZA 2I38A 3JTPA 2Y1IA 3H4DA 3ZZOA 1NK5A 2QLFB 2UUAJ 1UA1A 1HFEL 2I8EA 1TAUA 3QGHA 2XQCA 4DWIA 1KOOA 3MPVA 1S6QB 1JNRB 3OFGA 1FDBA 4ILRA 1J5EJ 5I42B 2WRMA 2NYIA 2CPIA 4HR2A 3FMWA 2SXLA 2IRUA 4QZVB 2XMJA 5LJ3Y 3HXMA 2V4JA 4JV5J 1UMJA 1IKWB 1FFGB 1KSPA 2VJVA 3HP6A 1HD1A 5CQGA 2W2MP 1D3WA 5J2PA 4LSLA 3CUNA 2Z8QA 5L1LA 3MF5A 2B7CB 1ELOA 3UWTA 4URGA 5D4LA 1GX5A 3ZTRA 1JIHA 3GR1A 3SQOP 2O1PA 4LSNA 1N54B 4NI2A 2E1PA 3Q2SC 4NXMF 2XNQA 5C25A 5HMXA 5HBMA 4UUWA 2I5JA 4KSEB 4BS2A 4OI1A 1YJWS 1RA7A 4JI8F 5C7PA 1DTQB 2MLZA 2WSCC 3WDOA 2E1MC 2HQ3A 3NNCA 1KLMB 3MMBA 3M8WA 2DEJA 2M9KA 4FNIA 1UWAA 1SJRA 3DYAA 3C6TA 4DPYA 5CD4A 3IWXA 4PG4A 2QN6B 2G1HA 1T11A 3NRBA 2EKYA 2OEKA 1HWIA 2RB7A 2X3GA 1IQTA 3I5BA 2AYEA 2GHWA 2DEIA 3M6WA 5C24A 2IVYA 3ULHA 4F3OA 2C2RA 2GIRA 5E3RA 2MZSA 1VQKS 1HYSA 1B64A 2AGQA 4N47A 1C1BA 4FVCA 1O0PA 1NU4A 4J5OA 1FJGF 2V8VA 4HHHA 1VYAA 4ED3A 3PRBA 4WYLA 1FHTA 2KJVA 3K0JA 5KFRA 1MU2B 2R8GA 5DRKA 3BSAA 4EBDA 2R7QA 2FIUA 2XZWA 4ZJOA 1FKAF 5KFAA 4M1KA 3ZZRA 2FJWA 1RT2A 5L1IA 3KLFA 2UUBF 4Z37A 1RAGB 5CXTA 1SH2A 4CI0B 5T41A 4MYUA 1EKRA 4QYZJ 3BQ0A 2IA6A 1BGXT 3HI9A 4KIAA 4XK8C 4ECQA 5IXUA 2MKKA 4OZ3A 5LT5A 4XDDA 3KK3B 2K1RB 2FY8A 5H9EK 5K8MA 3EMTA 1JLEB 4M63A 2MPUA 4LBPA 1H2TZ 5IT9U 1U1QA 2VODA 3MEDA 2IVFB 5JVHQ 4Y2CA 1M90T 2QFIA 2DHAA 2CQ0A 5AT1B 4DSJA 1G4CA 1SQGA 3NOCA 3GFXA 3GFYA 1LWCA 1HA1A 2VKRA 3I87A 3W60A 1TU0B 5A8WA 2F1FA 2IPOB 4P2SA 2QEXS 1NPKA 2LECA 2H54B 4IDKB 1TVRA 2H48B 1YITS 2GHVC 2U1AA 4HKQA 1G7CB 3BN4A 1M1GA 1S9EA 2CQCA 4FYYB 2GIFA 4C0HA 4TNOA 2RJZA 3M2RB 2NPFA 4A46A 3CSKA 3D6HB 4NLYA 1SKUB 4USMA 5ETNA 2MKIA 3N28A 3A4TA 1S12A 1HQEB 2FHJA 4URSA 3SMZA 3CCTA 2XHCA 2HG4A 2H5EA 2XZTB 3NNHA 3PY8A 4RKUC 4DV4J 5A2QY 2HFNA 3PYGA 4ETZA 4OMFG 1H0HB 2P6TA 3KFWX 2NQPA 1ZAWA 5K14B 5KG6A 2BV3A 3DRPA 5J1EA 1S1TA 4JI8J 1WG5A 4M94A 1UJ4A 2HSEB 1H2UX 1CG2A 3PYDA 1UKUA 2V2QA 4P10A 2W2QP 3AJDA 1OYDA 5D78A 2W24A 2HWIA 2V4QA 1S49A 4DL4A 4HVZA 1JK9B 4DPTA 3H42A 3MM6A 4A8FA 1LW2B 4QU6A 2OPRB 4YMEA 4LF4F 3H40A 2QE5A 2Q6CA 2WBRA 5BYSA 2PIIA 3AA8A 2JWNA 3CD7A 3KLGB 3I82A 3D6FB 1YJNS 2W2OP 5IFMA 4HYKA 1GTHA 4MKVA 1X4BA 1JNZB 3EVMA 1NEEA 4RNOA 5LMNF 5L38A 2H4YB 1FJGJ 1Y7PA 1VQ6S 4M5MA 5HQ8A 3RB4A 1JLCA 1IBCB 3R7SB 2XLIA 4NLSA 1M5PC 2NXUA 4K5RA 2B6AB 4PABA 4R8UB 2B4OA 4P2FA 3RBEA 1NJIT 2N82B 1FJCA 3CCJS 4USUA 1H38A 1XNRF 4C8YA 3QQCD 1VQ9S 2DNLA 2QGFB 2RRAA 5EN1A 2UUBJ 3RR7A 2H51B 2MEWA 5FIIA 1T9UA 1U8SA 5B0AA 2AWZA 1CEZA 2EKNA 3PKMA 1AROP 4DLEA 4NYOA 4FF2A 5EX3A 4NLPA 4HL9A 4X4VA 3L7PA 3U1NA 5F3TA 3M9OB 4ZIWA 2ASJA 4FDFA 4DLGA 3UFCX 3HD1A 4ILMA 1Q16B 2VC0A 3KDNA 4ZJLA 4LF6J 1FRXA 2DNZA 2GJIA 1KOHA 1KR4A 3WBZA 4KFBA 3TAQA 5CABA 1RTIB 2RRNA 2XMVA 2ZH6A 3SCIE 1NHUA 4Y2KA 2XS5A 3K5MA 2FLNA 2HGLA 2KRRA 4KYZA 1Y5IB 3M8PB 1TUGB 2IJRA 4ELVA 1GMWD 1JKHA 1RCXB 2C2OB 4ZVOB 3EZ5A 1DAXA 3UVJA 1GFWB 2DNQA 2AF6A 2ROPA 5BJRA 4TU7A 4RJVA 2G0JA 1IBLJ 3CPWR 1TUVA 1N48A 3FK4A 3DOKB 1SL2A 3W66A 2GO9A 5CCMA 2IIHA 4I4BA 4CWBA 3PX6A 4QR0A 3R5DA 3IBCB 1VRUB 2DJWA 2C2EA 2KJWA 3PVXA 5HVGA 1URRA 2C2NA 1NUEA 2RKIA 2D41A 2LU2A 1FDDA 4H4KA 4HACA 4RX6A 4BC7A 2NUUG 4OHXA 3D9BA 2FJEB 3WC2A 5HVHA 3V6HA 2NUHA 4LQ3A 2R7XA 4HDHA 3TVKA 2VG5A 1JXLA 3QO9B 4BDPA 4YR0A 3HT3A 1S0VA 2FZCB 4DXLA 2ZZNA 1UPPA 3CO0P 3GIRA 2KXHA 4JI5F 1N5TA 1TUWA 1VBKA 3TUZC 4LSZB 1RE1B 3FGVA 1HNIA 2GVDB 1NZAA 5DDPC 3D6TB 1SJQA 3HCXA 3W2WB 8ATCB 1VFJA 4LF4J 4BHQA 1I1GA 2FJDB 2HHPA 4B3SJ 3ZFVA 1RUSA 1F3VA 3JYTB 3KHLA 2BABA 2M8HA 2R2TA 3MR6A 4DV7F 1DARA 4ED7A 1UVJA 1FK9B 3PW0A 2CNKB 3JB9k 1XMQF 4LR9A 2XM3A 1U1NA 1RWKB 1WHVA 5DQGA 1UJ5A 4AL5A 3MAHA 4QW8A 3VGUA 4K4XA 4KKOB 3M8QA 3S1TA 4WIIA 2NZ4A 1T05B 2FUG9 5KG7A 4GC6A 5B08A 1UZHA 5ITHA 1NKCA 5HK4A 4CTAB 2V9KA 2DGQA 2KXFA 2P8IA 4DQRA 2HBRB 1WOSA 4NLTA 1X9WA 1S1WA 1F5BA 3M30A 2HQGA 3GONA 3A3PB 2HRYA 3HHKA 5EWEA 3SZ2A 3CVKA 1QUPA 1JJ4A 4C8NA 1W26A 3F56A 1U2CA 2KT5A 2BE2B 4P52A 2H4WB 5KFQA 3NGSA 9ATCB 1LKZA 1S0NA 2ZH7A 3FVYA 5CYQB 1B99A 3C19A 4DQQA 1M5SA 2BR0A 2DH9A 4ZLJA 1EZZB 3NMAA 5DLGA 3BS9A 2HNDB 4FPRA 1C1CB 3MR2A 1BXNA 1PC5A 3PYFA 2GC8A 4QIFA 2XZDB 3IS9A 4X65F 5AJ3J 2MQLA 1UWBA 4DX8H 2DRDA 2DT9A 1HI1A 2RS2A 3M2VA 2AEJA 1RWXB 3EGWB 1QSYA 2OJ3A 5KFCA 2KZMA 1K73T 3QAUA 3W7BA 3W5XA 3HFZB 3ZTOA 1QVGR 3VR1A 2H5JB 1S7IA 3LA0A 3GQCA 2EG1A 1QE1A 4PG7A 4EWTA 3QSYB 2EBEA 3P3DA 1VIOA 4ZN1A 3MD3A 4CO1A 2HAIA 4CLTA 3CCQS 2UUCF 2W9AA 1WOPA 2Q3PA 4O0IA 3CD6S 3GB0A 1T3OA 5J2NB 4J9UE 4CYUA 3QAEA 1YLXA 1BWEA 3EVWA 3VGTA 4DR4J 1T94A 2A10A 5B7WA 3KK2B 4OYPA 4I7FB 5GAHI 3F73A 3K5NA 4DSKA 3AD7C 3CJ0A 3ITHA 1T7PA 2JJ4D 3LW5C 3AT1B 3A8EA 1KKHA 2DISA 4CLPA 5KFDA 4JI5J 2E5IA 1F2HA 2JLGA 1KQKA 4F0HA 3OJUA 4MK8A 2K2PA 5A2QU 4PUOB 4ZCMA 2VG6B 3W5ZA 3OLAA 3NCRA 3TOQA 5E0OA 1XN9A 1M5VC 3QGIA 1S72S 2CADA 3OFEA 4DV6F 2V2VA 4YEAA 4B3RF 1SH0A 4U96A 2MZRA 4DV7J 1BQXA 4DF8A 2HBYB 4ER8A 3JTNA 3ET6B 4C0OC 4QWBA 2DCUB 1XMQJ 1OSDA 4LFBF 2R2RA 1REVA 1V6HA 3NGDA 4YDDB 5K8NA 2AMCB 3CWJA 1DURA 1J5OB 2OFGX 2MJUA 2KHCA 4PWDA 3NGUA 4GVLA 1JLFB 4OJHA 4CNYA 5E3AA 3HVTB 4IFVA 1EETA 5M2PA 1IBMF 4XPCA 4CLSA 4YHHJ 4WTOB 1K1SA 3I32A 5T7LA 4IH5A 1NB7A 2NS1B 2LEBA 3IA0A 4DX7A 1WG4A 3DLBA 2Z58B 2CVIA 2GAHC 3IBWA 3RAQA 1BE4A 3UDVA 4OZ5A 4MKBA 5DO2A 1XWLA 3BDEA 2OPSA 1HBUA 3PW7A 2VF3A 1FKPB 4CIOA 1HWJA 5CHCB 4JI6F 3O8WA 2KFYA 3DN9A 5J1NA 1TTHB 2Y1LB 1ZPWX 1UEKA 1SC6A 4RL1A 2CWKA 4X65J 4A8OA 1H98A 2PMZD 2MZTA 3AB4B 4EO6A 2B51A 3SYZA 4WFAQ 2MKCA 4F3QA 2O3DA 1FWPA 2E5GA 1RT1A 4M5LA 2UV8A 2DHGA 1YGYA 2CNOB 2BQ3A 2G0CA 3C14B 1HMVA 2BZ2A 1ZAXA 2V67A 1C4AA 1C0TB 4OI4A 3BBFA 1UEUA 4F50A 6AT1B 2BANB 2UUCJ 1T0TV 2J7UA 1TK8A 3V4IB 4K2XA 3D3CJ 2N7YA 3HSJA 3KLVA 2BXJA 2ZHBA 2N4CA 1QTMA 4V19X 2P9EA 2QLJB 1FRIA 1OQ6A 5I3PA 1RT3A 4Q5VA 5BR8J 3G2XA 1XTZA 2OI2A 2VPWB 4H4KC 3C16A 4KR0B 3AXMA 4ENOA 2G9OA 2R8JA 3DRRB 4LF1A 5EGYA 2RNEA 4J9VA 5DGBA 5B0EA 4L76A 4J91A 4K4SA 1EQ0A 3MOZA 1Q53A 2MGZA 2LFVA 5HN0A 5J2MA 4HH1A 1FF2A 1H7WA 2BE7D 2RF2B 4TVAB 4LBIA 1KD1T 3H90A 3I31A 1SB6A 3CW2C 3POTB 2V4RA 4DV6J 2LQJA 4PAAA 4NLQA 4FS2A 3LTOA 3QJPA 3B82A 3DNCA 2UVVA 2G2YA 1CULB 1U6ZA 1WC3A 3R8YA 5KT6A 4C2MA 2BMBA 3F0NA 5ETVA 5I3UB 3SSSA 2DNRA 1P27B 4WKRA 4WFZA 4WFBQ 5CZXA 5LMUJ 3PEJA 1QVFR 1RWNB 2QSFA 2HLTA 2FDNA 4ES3A 4OJ3A 1AFJA 1R89A 3VAJA 4ED6A 1KONA 5L9NA 3KLEB 4N56A 3MM7B 4Q0BA 2G2OA 3CC7S 3KG4A 3BGRA 1IBMJ 1NKEA 5F8NA 4WP3A 2RVJA 2DH8A 2P9CA 3UDCA 3MMAB 5H9FJ 2YPYA 1JLQA 2E1CA 4CRJA 1VQNS 6FD1A 2OO4A 4LMZA 2FHKA 3ZC4A 4X4OA 3BBCA 5IQQA 4HTIA 2QL5B 5DETA 3CCLS 3BZQA 3RBDA 1TKZB 2RSQA 4CLWA 1PJ7A 2HK2A 3Q24A 1S77D 1PIEA 4URQU 3MEGB 1E6YA 4C8LA 2ALZA 4BWMA 2GJFA 4ZPVR 3MWBA 5D15A 3DGVA 4EFAC 1Q8LA 2YKNB 2HZCA 1HBOA 2JEIA 1KTQA 1HW8A 2J0SD 1BUXA 1F6TA 3Q22A 1S1XB 3BEGB 3QIPA 5KFHA 3LP2A 2OLWA 1K0VA 4OYAA 4DEZA 3FBCA 1VGYA 1JXEA 5JUMA 3B78A 2YY3A 1UA0A 2DNGA 4KPCA 4RW6A 3R1LA 3I4HX 1K8AT 1U4BA 3BPDA 4B3OB 2HBQB 4JYAF 4F0KA 4RBTA 2BDPA 4LF9F 2R2SA 4RW8A 1RDRA 5J2QA 1IKYB 4N8OA 1WOOA 1RAAB 2V34A 4O4GB 1WWHA 2VPYB 2W4DA 2C3UA 2Z2LA 4IG0A 3DLGB 3LOUA 3TANA 2L9WA 4DQSA 2UXBF 2NYHA 2W9BB 2Q1LA 3M4XA 2B9EA 2QX0A 2KH9A 1X4AA 1N34J 4ZP6A 1OWXA 2YNIA 5KFTA 4Q44A 1WHYA 5F8GA 4V1Ak 2RD5C 1Q8BA 2VB6A 2QMXA 4DR6F 4Y6IA 1NJZA 2ZUAA 2W8KA 1SKRA 1YI2S 4QYZK 4W92B 2CA9A 3KYLA 4I68A 1IXKA 5THWA 2YNGB 4Y2IA 2BW7A 5DLFA 2Y8YA 4LIWA 2UU9F 1X5TA 4WE1B 3MOJB 3ENQA 3ICLA 2C3OA 3RRHA 4TY8A 2B0GA 1U7LA 3KNGA 4Y0FA 2XMKA 4W98A 1N88A 3LUYA 4OI2A 4B9MA 5DGAA 2CVEA 3G9CA 1CJVB 1EX8A 2IA0A 4C9DA 3LAKA 3VF0B 5F9LA 5HP1A 2IBKA 5GAGU 3LH2S 2C3MA 3AY0A 3MM8A 2PN6A 3Q8UA 2WCXA 1HR0J 5K14A 3I9V9 3R5AA 2JEFA 4JI0J 2CDRB 4J9KA 2DO4A 2OEMA 3G6ES 2YVSA 2CQGA 3CC2S 4P72A 1I5OB 2HK3A 1X9MA 2V4JB 2GCFA 4PZVA 4ZPAA 2AJ1A 4EO8A 4B02A 5DG8A 2E7XA 4Y2MA 3KMSA 5J2PB 2C1EB 2ERRA 3X3UA 3GIIA 2AJ4A 3M2UA 2WVCA 3THVA 1ZAVA 1EARA 3QRPA 2K7KA 4LSNB 1B7YB 4NI2B 1H74A 4E98A 2KRBA 4KQZA 4K7QA 4QWEA 2CQHA 4USTA 5C25B 1DHMA 4FBUA 5HBMB 1IJFB 1NDKA 2I5JB 4IKAA 3JXOA 2CQ3A 3BO3A 3U1MA 3QIDA 2VICA 2HIQA 3OR1A 4OL8A 5E33A 2DNPA 2HQCA 3MMBB 1O6XA 4WP8A 2KFNA 5KTQA 1Q79A 3TO8A 4XIUA 3DYAB 3C6TB 3GSIA 2XC9A 2QV6A 1JLAA 3GE9A 4JBCA 2R9LA 2BQRA 4ZN3A 3ILOA 5U47A 4DOZA 3MUVP 2CG4A 3D28A 2OEJA 2ADBA 5C24B 4WFNQ 2JC0A 1U0SA 1IBKF 4Q45A 4DSLA 1IR0A 2EK6A 4DV3F 2W4CA 4WFYA 4ECUA 3SSRA 1HYSB 2AJQA 2E5HA 3EXCX 2BJDA 3KJVA 5CZVA 2KM8C 2W4PA 3W1YC 2X3DA 2NPIA 4JYAJ 3FMBA 4LF9J 1F5CA 4USWA 2ZEJA 2LXIA 4WFXA 3CDAA 2YXLA 1UVLA 3EZOA 3MGJA 4IR9A 3TX0A 4X66F 5F3ZA 1RAEB 1MN7A 1R8CA 1ZM4A 1FD2A 2IRYA 2DKOB 4EBEA 2UXBJ 2ZOGA 4TQSA 3M8PA 1RT2B 2KYZA 3FDSA 4GO7X 3SFGA 1CC7A 3KLFB 4ZHRA 3PTWA 3I4PA 3JSMA 1W7WA 4RW9A 2CQ2A 1S57A 1X4DA 4DR6J 3I55S 3VAHA 5LL6d 3CMES 1WF1A 2CPXA 4Z7CA 3SIPB 1I3OB 1SUQB 2J7KA 1TKXA 2QLWA 3VZIA 4C8OA 2R7RA 2R3VA 4ZITA 2CPEA 3IP0A 1ZYQA 4PEOA 2D1CA 1KVJA 4ZVQB 1VRTA 2CQDA 3MEDB 4ERDA 3AD9C 5L8RC 1HNVA 5LSLA 2M4MA 3P5TL 3BBBA 2XMAA 1RTHA 3QWPA 4DPWA 1CJUB 4OZ1A 2P6SA 1LWCB 3EXYA 3CDBA 2XEXA 4NA3A 5DG9A 3W9HA 2D9OA 1V3SA 5A8WB 3PO5A 1TVRB 2G1DA 3QATA 1VQ5S 3KLIA 2CJQA 1TL5A 2XMUA 3OLBA 3RTVA 1S9EB 2H9ZA 4ECXA 3OSPA 3JSBA 1SCJB 3QZ7A 2M88A 4YP3A 1F9FA 2WBMA 3GG1A 4DU7A 1LK7A 1P9QC 1FKOA 5KFZA 1REGX 3EPIA 3IXQA 3H7HB 2ZJRQ 4CO2A 1K9MT 2OPQA 3HJFA 3HHDA 2BQUA 4TQRA 4CLUA 2R7WA 2B7BB 2QG9B 4A8YA 2I1RA 1HI0P 5GADU 1PCAA 3PXGa 4TU8A 3KKFA 4A8MP 1XNQF 5T14A 4JI1F 5J1EB 1AW0A 1S1TB 3H25A 2B9WA 1VQOS 3TX8A 1X4HA 2B4PA 2YWWA 1BWVA 1VDHA 3IAS9 1IKVA 2YKPA 5DDQC 1HD0A 1PAEX 1RBAA 2ZOMA 3CCZA 4G3IA 1UAWA 4C3KA 2JHEA 2YX7A 4Z2XA 2YQ3A 3MM6B 1J2VA 2AGPA 2ZM6F 5D0RA 1R31A 3CT9A 3FEYB 4BLGA 4NLRA 3O5TB 2WVFA 2HIYA 2XSJA 1NSKL 3DLHA 1S1VA 2K06A 1NK4A 2UVRA 4QJVA 1N0UA 4IFYB 4DV3J 1WD6A 4LVNP 3WIVA 4CZCA 3CIMA 4FKXA 3SV3A 5HSPA 5E3PA 4DHVA 2J0QD 2BE2A 3EE3A 5KT3A 4NCGA 1VC5A 2M8DB 2ZC3A 2RQMA 1VOMA 2DGSA 1JLCB 5G4DA 2D9PA 4DG1A 3M8RA 4X66J 4ANDA 3AOCA 5D77A 2ZH9A 1HHTP 2AGOA 3TA2A 3WX4A 2OTJS 4A8XA 4PWWA 1NPPA 1UJ6A 2LA6A 1DLOB 1YBTA 5KG0A 5GAEU 4K50A 3HF5A 1G1XA 4ECZA 4ZVHA 3DMJA 1N36F 1X9SA 4TU9A 1Q81T 1LW0B 3FEXB 1M1HA 2QA4S 1GH8A 3PX4A 5GAGI 3PG9A 5HJXA 1KFDA 1O5JA 2XMTA 4QPXA 4J9NA 3M6VA 4Q2MA 1FNMA 2VQFF 3E51A 2BUNA 5B0CA 3OTBA 4GC7A 3G96A 5KG4A 4Y2AA 4OV1A 4N41A 4EGLA 3DDNA 3N4WA 2LU1A 3DOLA 2XY7A 4KFBB 3C66A 1NK7A 2PD1A 3PRDA 2AU0A 2B9XA 2F40A 1LK5A 3B54A 2I2YA 2V2KA 3EVOA 4ED5A 1OIAA 4ID5A 3D68A 4DPXA 5AXNA 3UVJB 3P45B 2JLEA 1Z2LA 5HL7Q 4DV2F 2ZDPA 2WW4A 4OJ1A 3Q89A 4ZVUB 4OHYA 4LRCA 4MK7A 4R25A 4F4WA 1WG1A 1MG7A 1WC0A 4DL5A 2BX6A 2XB2D 4YR2A 3Q8PB 4OYOA 3TQEA 2Z2YB 1RTJA 2J9DE 4YB1P 2RKIB 5CYJA 2R8IA 4HACB 1M5KC 2WONA 2MB0B 1T3NA 3NMRA 1MMNA 1WACA 2W7OA 1A9NB 1D8ZA 3J7AN 2W8LA 2VG5B 3FQKA 1XNQJ 1RHRB 2LP4A 2KG1A 4PWUA 4ALZA 1FCAA 3DDIA 1TL7A 1TV6B 5EDWA 3LGNA 3WIUA 3CULA 3JSYA 4RZRA 3CJKA 1V5IB 3UR3C 4LFAF 1Y10A 4DX5A 4GKJF 1HNIB 1TKTA 1MNEA 5BYRA 3D1QA 4DV5F 2HHXA 1HPZA 3AHPA 3H5UA 3A8IA 2A3JA 4NCAA 5BYQA 3TQ1A 4KHPJ 1NSPA 4N77A 4LFCF 3P96A 4ZVEA 3IFEA 3KDOA 1Y3JA 1SQEA 2E1AA 4M5KA 4CH7A 4KGMA 5IT4A 1N5YA 4WKYA 4OQJA 3LPEA 5L46A 5KAKA 2VBYA 1NK0A 1H6KX 3VALA 2BJEA 3OTOF 3M8QB 3Q8SB 3SFUA 1FTCA 3PZPA 1VBZA 4K4YA 3BF4A 3IR7B 3PACA 1RYRA 4K4VA 2AX0A 1DJ0A 2V8HA 1S1WB 2FLOA
chains in the Genus database with same CATH topology
3M30B 3KK1B 1E6VA 1Y00A 5K8OA 5KFEA 1HNIA 1UL3A 2XS7A 2K8GA 2QSWA 1NZAA 3DOKA 5DDPC 1S7HA 1SJQA 3MAQA 4HLBA 2YWKA 3W2WB 1T8EA 4FNHA 1NHVA 1T95A 1VFJA 3CDEA 3CEDA 1SJ4P 2EVZA 4BHQA 5KFUA 2OIHA 5EX0A 1ZPVA 1I1GA 3H2LA 2FJDB 4MTPA 2HHPA 3DM2B 2J5AA 3KLHB 3ZFVA 3R1HA 3DI6B 4U7UK 3TA1A 3F44A 3NKYA 2L9NA 3JYTB 3KHLA 4RWXA 2BABA 2M8HA 2R2TA 1VRUA 1Z2ZA 3MR6A 5F8JA 2Q66A 4DV7F 4UW2A 4IG3B 2J6UA 1DARA 4ED7A 2YWGA 3FZBA 2FC9A 1UVJA 4PG8A 3BDPA 3AB2B 1FK9B 3B4DA 3PW0A 3CE8A 3JB9k 1QUVA 2HFOA 2UXDF 3GIKA 1XMQF 1FXLA 3I5AA 3VAKA 3PJWA 3CC4S 1YRTA 2V5HG 4Y00A 1QAJA 1HL6A 1U1NA 2UVUA 1RYSA 5L9XA 4KGKA 2W7AA 2EFVA 3N6NA 1WHVA 4YDXA 5DQGA 1XMBA 2E9ZA 2YTCA 1VC0A 4C8KA 2FB0A 2MYFA 1UJ5A 2PGCA 2QIFA 1U24A 4F2SA 4AL5A 1SIWB 2PI5A 3MAHA 2P5VA 2NR0A 1R8BA 3QO9A 1UVKA 1D9AA 3G8SA 1UFWA 2XMMA 4UQGA 4QW8A 5A6WA 2VFTA 3DOMA 5KG1A 3W3SA 3IS9B 2CYYA 1R0AA 1FD8A 4K4XA 1LWFA 5DM7Q 1IKXB 5B0BA 1A6LA 4I69A 3E2EA 2C3YA 3M8QA 4KKOB 4QOTA 4WIIA 3S1TA 3H4BA 3OFHA 2DR5A 2NZ4A 1T05B 1GT8A 1DTTB 1UWBB 3QJJA 5EHHA 4QIEA 1Q7YT 1S4FA 1N4LA 4B9VA 2ZVSA 2FUG9 4ITSA 5KG7A 4QW9A 5KFGA 4GC6A 5B08A 5ITHA 1MWZA 1NKCA 3KMQA 4NCBA 2ZHAA 2OMLA 4C3MA 3TVYA 4CTAB 2V9KA 3M2VB 2DGQA 2KXFA 3PKYA 4NYZA 4DQRA 3RW7A 4NLTA 1X9WA 2DPJA 1S1WA 2YNHB 1F5BA 3UCGA 1S10A 3M30A 1CSJA 3KK1A 2JOQA 2J76E 3PW5A 4EYIB 1FERA 2HRYA 2MJNA 3W2WA 3HHKA 4EZ9A 1JWWA 5EWEA 2DNKA 3SZ2A 4NLGA 4MAKA 3T9NA 4WYWA 4RNHA 1N6QB 3CVKA 4X84A 2UXCF 4LF6F 1QUPA 3AJ2A 3DM2A 4ZP8A 3J7A1 4IOAQ 3P49B 3KLHA 2PDAA 3DI6A 4OX6A 3UCUP 4MKYA 3G6VA 1JJ4A 3Q8RB 5KT2A 3NCPA 2R7UA 1QE1B 3JYTA 4WU2A 3H2VE 4C8NA 3F56A 3NG8A 5KFVA 4DSEA 2KT5A 1TL4A 4CT8A 3PR4A 1O8BA 2BE2B 4YY3F 4IG3A 1X5OA 4ED1A 2ASYA 5KFQA 1RT5B 4TLQA 1U47A 1LKZA 5SZTA 1FK9A 2RDJA 1S0NA 2ZH7A 4ECWA 3FVYA 3CJ2A 4L6V3 1X7VA 5CYQB 3MM5B 2KU7A 4DQQA 1M5SA 2BR0A 4PQUB 2LQ5A 3N79A 2DH9A 1B0TA 4N76A 1H3DA 3AQPA 3LP1B 2VPXB 3LF0A 4KRWA 4TYBA 3NMAA 5DLGA 3BS9A 4DR3F 1FRLA 2HNDB 2ZH1A 4DFPA 4FPRA 4ES2A 1C1CB 3MR2A 3PFEA 2UVWA 2N7CA 1PC5A 1NAQA 3DRPB 3T6BA 2GC8A 4QIFA 2QYCA 2WHOA 3GIJA 5E3QA 3IS9A 2QT7A 5I3UA 1IKXA 3UR0A 4X65F 4KKOA 2XGQA 1X8DA 2DO0A 1T05A 4QBUA 1DTTA 2MQLA 4JV1A 1UWBA 5F9NA 2LKZA 2LYVA 2O67A 5DG7A 3AQOA 3H8YA 4DX8H 3OUYB 2DT9A 3UI3A 1BD6A 2EPIA 4O4RA 1YJUA 1HI1A 3ITHB 1FDNA 2XI3A 2M70A 2RS2A 2Y0SD 1FRJA 4RLEA 4CTAA 1IBLF 1QM9A 3M2VA 4NYPA 3J81Y 3C6UA 1L5UA 3ZZUA 4A8QA 3EGWB 3ZZ0A 3T5LA 3R27A 1WI6A 1QSYA 2OJ3A 1U1KA 2YNHA 3PW2A 5KFCA 2AP6A 2B4VA 2BRLA 2KZMA 2VG7B 2QO3A 4ZCIA 2HVHA 1K73T 2X51A 3CB4A 3QAUA 4R0JA 4RUAA 1MMLA 5CD4H 3W7BA 4JOUA 1KN6A 4NMLA 4EBCA 4Q7AA 4B17A 2OPPB 1UEVA 3ONQA 4ZP7A 1QVGR 4KHPF 1N6QA 2WOMB 3VR1A 3MHYA 3MM7A 5D6GA 2XSFA 4KO0B 5EUHA 3GQCA 2EG1A 2L41A 1QE1A 2CZVC 4PG7A 4EWTA 5IZHA 2X1FA 2CJ9A 2HFZA 1S6PB 2EBEA 3P3DA 2K3KA 4ZOSA 3OTDA 1VIOA 3WC0A 4DS5A 3MD3A 4HHJA 4CO0A 4CO1A 4Q43A 2HAIA 2MHNA 1RT5A 1BQMB 4P7TA 4DUZF 2PO4A 5CYQA 3MM5A 3V5RA 3CCQS 5KT4A 4DL6A 2UUCF 5GVQA 1JMTA 2W9AA 2Q3PA 4O0IA 3CD6S 5M2RA 4PQUA 3GB0A 1C0UA 1MW7A 2IJFA 2C3PA 2FGOA 1T3OA 1GTEA 3K57A 2YWHA 2B9YA 3LP1A 3TUJC 4RUCA 4ZPBA 5J2NB 4C97A 1P1TA 1YSJA 4DL0C 2HGMA 5IQ6A 1ZH5A 2HNDA 2VFRA 3ISZA 3QAEA 2YNFB 3KOAA 2CIMA 1C1CA 2RMLA 1BWEA 3I0SB 4MIBA 5D4OA 2MKSA 1FVQA 3HZGA 2OKQA 1JJ2R 4PXEA 1WF2A 1ZM3A 2UV8G 3UE2A 2OH2A 1Y5LB 1T94A 2M0GB 2XCPA 3BN7A 2A10A 2L08A 3CO9A 4OIXA 4DL3A 1TFYA 5B7WA 3KK2B 1LV5A 3V4MA 3IG1B 4I7FB 5GAHI 1REVB 4PPZA 4C4WA 3F73A 1QSLA 2R7VA 4HT7A 1FJ7A 3K5NA 2JSXA 4NZ6A 4DSKA 3OUYA 1A7GE 3GYXB 3HVRA 3PV8A 5E3CA 2IAJA 1YRXA 2AW0A 2KHDA 3CJ0A 3ITHA 3N9UC 2GNKA 1F2GA 1T7PA 2JJ4D 3LW5C 1RQ0A 1X5SA 2GJ2A 4PWDB 2LDIA 2V8GA 3A8EA 4LJMA 4KT0C 3N5BA 2DISA 4OHWA 5KFXA 3TAMB 2I9SA 2IMOA 2JC1A 3VAIA 4USHA 1VBXA 2BVZA 4AXIA 2DNYA 4U67Q 4J9OA 1YHQS 5KFDA 3OSNA 2VG7A 4K59A 2E5IA 5GAHU 2JLGA 4ECTA 3IR6B 1KQKA 1GNKA 3OJUA 4B3SF 4DFJA 4MK8A 4IFVB 5KFOA 1VC6A 1EETB 2M5YA 4WK1A 1AUDA 2K2PA 2BM1A 4IRDA 2OPPA 4MK9A 5KFSA 4PUOB 4ZCMA 2WOMA 5LJ5Y 4K0KF 2GQ2A 2VG6B 2FC8A 3OLAA 4KE5A 4KO0A 1HBMB 1X4FA 2QA1A 3AJ1A 3NCRA 4ICLB 4PPDA 5E0OA 3TOQA 3G6YA 1XN9A 3FNNA 3QGIA 5T7LB 1M5VC 1S72S 3H59A 3C2PA 2YKAA 3OFEA 4YB5A 3GIMA 4DV6F 1BQMA 2HHTA 3UQSA 5D3GB 4YEAA 4B3RF 1SH0A 1ZM2A 1TQLA 2N4DA 1I6JA 2O5DA 2MZRA 3E3XA 2QLXA 5L39A 1Y5NB 2IJNA 1BQXA 4Q8EA 4DF8A 1LFWA 5J2NA 1HARA 3JTNA 1Z1ZA 1VLYA 3K2YA 4NPOA 2GO8A 4C0OC 2YNFA 3C8YA 4WF9Q 3FCHA 2DIUA 3I0SA 4QWBA 2DCUB 3KWMA 3HHLC 3X1LB 2OPSB 1N0VC 1HBUB 3BSCA 3GV7B 1M1KT 1OSDA 4FS1A 4KBIA 4LFBF 3UW1A 4HH0A 2CPYA 4ZKAA 3CTRA 2R2RA 2PA8D 3KK2A 3I96A 1FRMA 3IG1A 4I7FA 1VQPS 1REVA 3CD5A 5JJBA 2OSQA 1V6HA 3FFIB 3VZHA 3NGDA 4YDDB 4C7QA 5K8NA 1TP7A 2AYMA 1JKHB 3ENVA 2ATLA 1YTYA 3CWJA 2IMWP 1DURA 1J5OB 2OFGX 3H5XA 4QYRA 4E8UA 3N6MA 2MJUA 2KM8B 2KHCA 2GHPA 4PWDA 3L95X 2OD4A 4A8WA 4I1TA 3HVAA 2XCAA 4K4WA 3MECB 2RIJA 1FO1A 1JLFB 3OBIA 1FJEB 3TAMA 3IWNC 4OJHA 5HO4A 1VI7A 4AFFA 2L48A 2IFXA 3BR8A 4ELUA 3A1YG 4CNYA 5E3AA 1U2RA 2KTQA 2O66A 3GG0A 3HVTB 4IFVA 2KN4A 2JZ5A 1EETA 2J7WA 5M2PA 1YQHA 3T1HF 3HHLD 4XPCA 1IBMF 3OL9A 1RT1B 4OHVA 4PUOA 5KFKA 4WCEQ 1FEHA 2HPUA 2LDYA 2VG6A 1K1SA 1HBMA 1GAOA 1FE0A 4ICLA 3I32A 3Q0AA 3MMCB 4RNMA 3VQSA 5T7LA 4IH5A 3K59A 1NB7A 5F0UA 2NS1B 1Q1KA 4J9LA 3RB3A 2LEBA 3IR5B 1RISA 4OFZA 4RWWA 2KT3A 2JEJA 3LALA 1HMVB 3IA0A 3M8SA 2HHUA 1WEZA 2E9TA 3NS5A 5D3GA 1WG4A 3DLBA 1L3KA 4DFMA 2YWEA 2CVIA 4I64A 3IBWA 4MMOA 1FVSA 3RAQA 2GV1A 3FEZA 4CO3A 1GX6A 3K5OA 5FLXY 3VAMA 2FHMA 2VL1A 2E5LF 4OZ5A 4MKBA 3BGFA 5DO2A 4A8KA 1XWLA 3R5CA 1TL3B 2BOPA 3CCVS 3BDEA 3NGKA 2N3LA 3TNVA 3VCDA 2CJBA 2OPSA 1TK5A 1HBUA 5AJ3F 2DRBA 3THPA 4QCLA 2ZE2B 1CPZA 2R7OA 3PW7A 2MSSA 1VQLS 1FKPB 3M1VB 1RKIA 3SCLE 5HLFB 4FF4A 3MFIA 4CIOA 3OVAA 3CDUA 1HWJA 5CHCB 2BRKA 2DCLA 1B0PA 1RWUA 4JI6F 3O8WA 4N5SA 2M3DA 3CXCR 1U1OA 2NREA 2IYIA 5EWFA 3P6YC 1XK8A 2VV5A 2APOA 3FFIA 4QWAA 2DVIA 2KFYA 2ASLA 3DN9A 5A6PA 2CQIA 3MPYA 5J1NA 4V19J 1ZPWX 1X5PA 4FZVA 1DFDA 4MYTA 4MKAA 4WZQA 1J5OA 1BC6A 2V94A 3TR5A 1SC6A 2XLJA 1RT3B 2CPJA 4NZ7A 4ZP9A 2IBOA 4A8OA 1H98A 1SL0A 3MECA 3OVSA 2PMZD 1JLFA 2MZTA 3AB4B 1RKJA 4NXNF 4EO6A 2B51A 3SYZA 2DNHA 5AE1A 3T5HA 5K8PA 4WFAQ 4ECYA 3EX7B 2IC3B 2MKCA 4I56A 1U1LA 3K8WA 3SXLA 1HNXF 1KFSA 4IH7A 1KVIA 2DH7A 2MY7A 1U1MA 1UW4A 2MSTA 4F3QA 3HVTA 2VQEF 2A18A 5A8KB 2O3DA 3MR3A 2DR8A 4ZA1A 2E5GA 5KG5A 1RT1A 1YJTA 2F8HA 3OXLA 2UV8A 2C2DA 2RE1A 3L09A 4ZCKA 2DHGA 2ZC4A 2KB2A 2E44A 2MGZB 3CCES 5J2MB 4JUZA 3V81B 3TARA 1YGYA 2A1BA 2LXFA 3MMCA 2DGOA 1XR7A 1KQGB 2BQ3A 2KYXA 4B9UA 1WTFA 5L1JA 1ZTWA 4QU7A 2VC1A 2BA9A 2G0CA 4ZCLA 4NA2A 1HMVA 4G1IA 4HEA9 2BZ2A 4YOEA 4EEYA 4OI0A 2DB1A 1ZAXA 5F8HA 4OI3A 5KOWA 1N56A 4JV0A 1C4AA 4LUBA 2MQOA 4X62F 1C0TB 2J6TA 4OI4A 4FP9A 1NH7A 2KFZA 1UEUA 1QSSA 4DR4F 4F50A 5LSOA 3RB0A 1TL3A 3IGVA 3SCJE 4TYAA 2KDOA 4GKKF 1OQ3A 2BANB 3QJLA 4OLPA 3CCWA 4DR2F 4L72B 1VBYA 2J7UA 4DR7F 1TK8A 3GV8B 2EFQA 2IM1A 2ZE2A 2VH7A 2VASA 4DBQA 1Q78A 1R43A 2W7PA 1FKPA 3V4IB 1FNXH 4K2XA 4M5DB 5HLFA 2N7YA 4QIGA 2J9DA 1IQZA 3KLVA 2BXJA 2ZHBA 2FTRA 2N4CA 5C42B 4K5SA 1QTMA 4V19X 1JJHA 3B8HA 2P9EA 4IUFA 4ES1A 1PO6A 4WXOA 1FRIA 1OQ6A 4PR6A 3QWUA 1SIZA 3LANA 2DIVA 2XWYA 5I3PA 3PO4A 3PFOA 3B4MA 1PC4A 4XO0A 4CNZA 4UY8T 2MZ1A 1RT3A 2OP5A 2V0NA 4Q5VA 1S97A 5FD1A 2ZOFA 5DQIA 2Z2MA 3MXHP 2ADCA 1XTZA 3OXFA 3UNGC 2DPIA 3OW2R 1HHSA 1UFLA 2CZ4A 1TAQA 2VPWB 1QLNA 3PR5B 2IC3A 3CJ5A 3R5BA 4H4KC 2HYIB 4KR0B 2F7VA 4F3MA 3ZZZA 2JEGA 1Q86T 5A8KA 4Q2LA 2G9OA 1WELA 2R8JA 2WK4A 4O3OA 1FXRA 3DRRB 3FRZA 3GR0A 2CJKA 1Y9OA 3GWCA 2WW8A 3D1HA 3HLUA 2CQBA 3HDSA 2RNEA 5EGYA 3CCRS 2CRLA 4RW7B 4I6AA 5DGBA 3BR9A 5B0EA 1SKWA 3OHAA 4K4SA 3MOZA 2MQPA 4B3MF 1S9GB 1Q53A 2MGZA 5HN0A 5J2MA 3V81A 1OSCA 3V2UC 2F4VF 4Q0BB 4HH1A 1FF2A 3I6PA 2JX2A 3BGRB 4KPYA 1H7WA 2ZH8A 2AQ4A 1T02A 2EFPA 2RF2B 3D1OA 3M32B 1KD1T 1YJVA 2HMIB 3IC1A 2RQKA 3LWMA 2DR9A 2M7SA 4NOHA 3I31A 2ZKUA 4H4MB 1WI8A 1SB6A 4F8RA 4ZS6A 3VAGA 2B4UA 2CQPA 3POTB 2V4RA