4RW6B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 111
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B03
1HMVA 3BQ1A 2WONB 1NHVA 2I1RA 4I2QB 3M8QB 4ZMMA 1JLQA 3KK3A 3RB6A 1S6PA 1EETB 4NLYA 3BSAA 4NRTA 4DEZA 4R8UB 4QWAA 4IG0B 1RYSA 4ZVFA 1RA6A 3H5YA 4Y2CA 1DLOB 4KE5A 3MF5A 4J9MA 4ED6A 3T19A 4ICLB 4LQ9A 3M8PA 3H4BA 2C2RA 3CO9A 2IA6A 2FVQA 5KFAA 4U7CA 1LWFA 3BREA 4LQ3A 1S1UB 1KHWA 5KFZA 4F4WA 3IS9B 2BRLA 4KHRA 4J9PA 2FVRA 3V6KA 2R8GA 1IKYA 1UWBA 4NCGB 5CYMA 3DOKB 3BR9A 3PR5B 2BQUA 4MIAA 5J2PB 4RW8A 2FVSA 2B5JA 2BANA 4O3OA 3QIPB 4PWDA 2W8LA 5L1JA 4O4GB 1T94A 3Q8SB 4RW9A 1C0TB 4M95A 4NLOA 2V4QA 3LALA 3I0RB 3NMAA 5KFHA 2B6AA 1TVRA 1RT6A 1S9EA 2FVPA 1CSJA 3JSMA 5DQGA 4DG1B 3NKYA 3OL7A 3CJ3A 1N5YA 1FK9A 2JC0A 5KFIA 1LWEA 1S1XB 1S6QA 1C0UB 1TL1B 4QWCA 5KT6A 3T5HA 3FRZA 2J6TA 1S97A 4WXOA 3RB3A 4G1QB 2W9AA 3V6HA 1K1SA 3CJ5A 3NAIA 4IG3B 2W9CA 4EBDA 2HNYA 4PUOB 3HVAA 2GC8A 3DLKA 2ALZA 5HBMB 3EZUA 1C1BB 1GX5A 4J9LA 1IKVA 1JLFB 3PZPA 1JLCA 1JLEA 2C2DA 5DLFA 5D3GB 4K4YA 3SFGA 4Q43A 2ASDA 2VG6B 4PQUB 3CDUA 3PVXA 1JLAB 1RT3B 3QGIA 1RT7B 4NLSA 3OL6A 5J1EA 3KLGB 4IQXA 3ITHA 4K4SA 2O5DA 2D41A 5KFDA 3DLEA 4LSLB 4O3NA 2IAJB 3I0SA 4B3OA 2WB4A 4K4ZA 3KK3B 4DL6A 4TY8A 3T5KA 2OPQA 5KFFA 1RTIA 5DG7A 1S6PB 1HARA 4JUZA 2VG5A 4XO0A 1N56A 4RNHA 1J5OA 3OLBA 4TN2A 1U09A 4MK8A 4YR2A 4I2PB 3DRSA 4GC7A 2JEJA 1ZETA 2XCPA 2AWZA 2XI2A 4DL2A 2HMIA 3QZ7A 2E9RX 2R8KA 1LW2B 5F8IA 4KKOA 4M94A 2J6SA 2UVWA 3LP0B 1UWBB 5CYMB 1QAIA 2QE5A 3GIJA 2YKNB 5I3UB 5KFLA 3KK2A 2BANB 5EWFA 3BSOA 4PWDB 4ED0A 2RKIB 1N4LA 1KLMA 1RTJB 4RW7A 1RA7A 3PJWA 3DMJA 3D5MA 3PHEA 4QW8A 3BQ0A 3CJ4A 2ASLA 4NRUA 3LP1A 1W25A 5KG7A 4IFVB 4RW4A 4ZHRB 1RT6B 1FKOA 1RT5B 1HQEA 1TKXB 3IRXA 3HHKA 3JSMB 4ED2A 2YNFB 5KFRA 2CKWA 3RAQA 2HNZA 1N5YB 4J9SA 5KFBA 3GQCA 3E51A 1S0OA 1S6QB 3V6DA 3ICLA 2ZD1A 4H4MA 3ISNC 5DG9A 3MR3A 4LSNA 1SH2A 3PW7A 5KFMA 2DPIA 4K4TA 1TV6A 3IN5A 4ED1A 2JLEA 2EC0A 4IRCA 5J2QA 4WFXA 2QV6A 4J9KA 4Q45A 1TKTA 1IKVB 2CJQA 3NBPA 4MKBA 1JLCB 3MEDB 2IJFA 4Q0BA 2OH2A 3TVKA 1TQLA 2IM2A 1VRTA 3H59A 1MMLA 2BE2A 1D0EA 2W9BA 2VA3A 5CYQA 3QZ8A 2YKMA 1OS5A 1HPZA 5F9NA 5J1EB 3JYTA 4K4WA 3DI6B 3ITHB 4RW6A 5HP1A 2JEFA 2OPRA 3DLEB 5C25A 5DLGA 5DG8A 2ZE2A 4WZMA 4RUCA 4XPCA 2IBKA 1SUQA 2UVVA 5KFGA 4EBCA 1QE1A 3I0SB 1JKHA 4B3OB 2AGPA 3HVWA 3SFUA 4TY8B 1N6QB 4O44A 2R2SA 3G6XA 3KJVA 2UUWA 1RTIB 1KHVA 3MTKA 3M9MB 5KFYA 2D3ZA 1RTHA 3QGGA 3BJYA 4FS2A 1JLBA 1HNVA 2D7SA 4JV0A 4QW9A 1LWCA 3KLFB 2ILYA 1T03A 1EP4B 1NHUA 5KT3A 3Q8RB 1S1VB 4URGA 3Q8PB 2IC3B 3N6NA 4MKAA 4ZP6A 3DRRB 5C24A 2DPJA 2HMIB 1XR7A 4NLQA 5KFKA 1JLGA 4ID5A 3PW0A 3GYNA 4MFBB 3MR5A 4KHMA 3I5BA 3OHBA 3KHGA 2RDJA 2RF2A 3M9NB 5KFPA 5KT2A 4NLXA 1DTTB 4TQSA 5FDLA 3OL9A 3DYAA 1REVB 2XGPA 1KLMB 4RW7B 3DMJB 1MU2A 5JUMA 5HLFB 4R0EA 2C28A 3LP1B 1BQNB 1T05A 1FKPB 1FKOB 3IRXB 1HQEB 1LW0A 4F50A 4KO0A 3NGDA 2HAIA 3BGRB 3GV7B 1SV5A 4KFBA 2HNZB 2AQ4A 3T1AA 5KFCA 4ECRA 4R5PA 2UVRA 2W7OA 1BQMA 4DL4A 1Z4UA 2E9ZA 3C6TA 1C2PA 2ZD1B 3KLIA 3FFIA 4H4MB 3H5SA 4KV8A 2FJWA 4OL8A 1HQUA 5L9XA 3PR4A 5L1LA 1VRUA 3H4DA 4GC6A 1QUVA 4LSNB 4ECSA 3LP2A 3IGVA 4RUAA 2XGQA 1HNIA 2XI3A 4MK7A 4NLTA 5HROA 5J2QB 5C42A 3V81A 3TQ1A 1S1WB 4ZPDA 3BSNA 4TYAA 2D3UA 5F8NA 1TKTB 4H4OB 3QO9A 4IDKA 4ECUA 4WYLA 3BSCA 3GIKA 5F8JA 2JC1A 3ISND 4YR0A 2W9BB 4WE1A 4RU9A 2JEGA 3EPGA 1TL3A 1JX4A 1HMVB 1XR5A 3KLEA 2YKMB 3OL8A 1HPZB 3JYTB 1TKZA 2WRMA 5K14A 3CDWA 1JLQB 3KK1A 3N6LA 2OPRB 3RAXA 2ZE2B 5KG4A 2BRKA 3FQLA 1SUQB 4J9QA 4JV1A 5KFOA 4YR3A 1QE1B 4J9OA 1JKHB 4ECXA 4NLGA 2VA2A 4IR9A 3MEEA 4O44B 4ZPAA 3KJVB 4IOBA 1ZTWA 2AX0A 4EYIB 4NLWA 1R0AA 3V4IA 1RTHB 4QWEA 3UDLA 1S0MA 2FLPA 1HNVB 3M8PB 2WONA 5KFSA 1LWCB 2WCXA 2OPPA 3KLVA 4IR1A 1LWFB 2J6UA 3M8QA 1T03B 3UR0A 3DLGA 1ZTTA 2C2EA 1S0NA 3MECA 2XC9A 3NL0A 1IKYB 1S48A 4R8UA 4RW8B 5C24B 1C1CA 2B5JB 4O4RA 5KFTA 2AX1A 4ECQA 3Q8QB 4I7FA 4O3PA 4ID5B 1DLOA 4IH6A 4KSEB 3KLHA 4RW9B 2RF2B 3QYYA 5FDLB 4DL7A 3DYAB 3GILA 2B6AB 4IKAA 1MU2B 1TVRB 3E01A 1S9EB 4NZ0A 5F8HA 4HYKA 4ECYA 1TP7A 1HYSA 5KFEA 1WNEA 4NLPA 1FK9B 3HKWA 1LW0B 5DQIA 3QIPA 1LWEB 4IRDA 3DOLA 1SV5B 4ECWA 1S49A 3MR2A 4Y2AA 3PJXA 4XPEA 1BQMB 3T5JA 2E9TA 3I0RA 3KHLA 2FJVA 2W9CB 2HNYB 3FFIB 3DLKB 5DQHA 3G86A 5KFWA 3CJ2A 5L1KA 3PW4A 3GIMA 4JV2A 4TLRA 1HNIB 1JLEB 2HWHA 3VQSA 5HROB 1C0UA 5C42B 2AU0A 1N48A 2FLNA 3HVTA 2YNIA 1XR6A 3QO9B 3OHAA 3DRPA 1GX6A 4K4VA 4IG3A 3KHRA 2V0NA 4WE1B 2W7PA 3RBDA 1TL3B 2ATLA 5HBMA 3MFIA 1C1BA 2BQ3A 3IG1A 4YMEA 1TKZB 4IFYA 4Q44A 2AGOA 2HNDA 3KK1B 1QAJA 4YQWA 2WTFA 2OPQB 1RT4A 4J9RA 2VG5B 5D3GA 2W8KA 4F4YA 1J5OB 3CIZA 4PQUA 4FBUA 2B43A 5F9LA 3IGNA 1RT7A 3KLGA 5KT5A 3DRSB 5KG5A 1R0AB 4URQU 4WXWA 3CJ0A 4LSLA 1K1QA 4NLVA 3KOAA 3G6YA 2IAJA 2OPPB 4ZPCA 4ECZA 3KNAA 2UVUA 3KMQA 1IKXA 3DLGB 3TAMA 4KKOB 3MECB 3QGHA 2IMWP 3UPFA 2RDIA 2V4RA 5KG6A 3KK2B 1C1CB 3OSNA 4I7FB 5I42A 4I2PA 2IM1A 2BR0A 3KLHB 3QLHA 2R8HA 2WOMA 3FQKA 4IRKA 4RNNA 4RW4B 5F8MA 1S1TA 3E01B 4F4ZA 1RT1A 2AGQA 1S9GA 5KFVA 1LW2A 3H2LA 4NYZA 4X2BA 1HYSB 4H54A 3LP0A 2GIRA 4NLRA 4K4XA 3V6JA 2YKNA 2YNGA 5I3UA 4WFYA 4FS1A 3GV5B 4TQRA 4ZVEA 2RKIA 1DTQA 1RTJA 3V6DB 3C6UA 3DOLB 4ZVGA 3MR6A 5KG2A 5EDWA 3N6MA 1RT2A 4ZPBA 2R2TA 3CVKA 4IFVA 4ZHRA 1RT5A 1TKXA 1TV6B 4J9NA 2YNFA 4NLDA 2OPSA 4KB7A 4ED3A 1T3NA 2VG7A 3DM2A 5F8LA 1IM4A 2WHOA 3H5XA 2I5JA 3NBPB 4Y3CA 4Q0BB 1VRTB 2BE2B 3HVTB 5J2MA 3MEGA 2YNIB 4G3IA 4KBIA 5CYQB 4YP3A 5F8GA 3RBEA 2YNHA 4RNFA 3DRPB 1S10A 1I6JA 2HWIA 3RB4A 5HP1B 1IKWA 3LAKA 4RW6B 4MH8A 3H5UA 3RB0A 5C25B 2FJXA 4NLUA 3I5CA 1SH0A 2GIQA 1JIHA 5KFUA 5J2NA 4U6PA 3IG1B 4IFYB 4ZP8A 3H40A 5DGBA 2HNDB 4TY9A 1RTDA 4O3RA 1RAJA 3MEDA 4K4UA 3KMSA 5T14A 4TXSA 2FLLA 4ECVA 1RT4B 2WK4A 4DL3A 3SI8A 1JLBB 5KT7A 3NAHA 1NNDA 4I2QA 1S9FA 3DI6A 3T5LA 4F4XA 4EBEA 4QWDA 1EETA 1D1UA 4Y34A 4IH7A 4EO8A 3H98A 3UQSA 1IKXB 4IG0A 3BQ2A 3TAMB 1N6QA 1JLGB 4WZQA 1S4FA 4ICLA 3DDKA 3KLFA 1SH3A 4QPXA 5I42B 1S1UA 3QLHB 1EP4A 3IS9A 2WOMB 4RNMA 2JEIA 4HKQA 4Q8FA 1S1VA 3LAMA 2IC3A 4NCGA 3GV8B 3DOKA 4Q8EA 1T05B 2BQRA 1S1TB 3DRRA 5J2PA 1RT1B 1YVFA 5KFXA 1S9GB 3CDEA 5DGAA 4KO0B 2IM3A 3OSPA 4FBTA 4O4GA 4KFBB 4MFBA 4RZRA 1C0TA 2ASJA 2YNGB 3GIIA 4R5PB 1DTTA 3PW5A 5EWEA 5JXSA 4EO6A 1REVA 4URSA 1DTQB 3FDSA 5KFJA 3C6UB 3C6TB 4QWBA 3KLIB 4KV8B 4TYBA 1HQUB 4ZP9A 1RT2B 5HLFA 1VRUB 4ZVHA 2R8JA 3LP2B 4DG1A 1BQNA 1FKPA 4KAIA 3G6VA 3PW2A 4ED8A 1S1XA 2F8EX 1TL1A 2OPSB 3BGRA 3V81B 1RDRA 2UUTA 4MK9A 5EWGA 2VG7B 3DM2B 4O3QA 2XCAA 4O3SA 4G1QA 4IDKB 2I5JB 3QIDA 4ECTA 1JXLA 5KFNA 4MIBA 4PUOA 5J2MB 4RNOA 3D28A 3MEGB 5KG3A 2XWYA 3CWJA 5KFQA 3KLEB 3MFHA 2YNHB 5KG0A 4WYWA 1IKWB 5K14B 3KHHA 2R8IA 1JLFA 2FVCA 2IM0A 5KT4A 3OLAA 3FSIA 2R2RA 4ED7A 4IH5A 4WFZA 5C5JA 4K50A 1S1WA 5J2NB 2V9WA 5KG1A 3EPIA 2VG6A 4H4OA 4ZP7A 5EUHA 1RTDB 2ZKUA 4EYHB 1JLAA 1RT3A 3MEEB 5L1IA 3LANA 4DL5A 2C22A 4EEYA 2IJNA 3I5AA 2R2UA 2ILZA 1RYRA 3M9OB 3V4IB
chains in the Genus database with same CATH superfamily
4DV6F 1H2VZ 4ZMMA 1M1GA 2NREA 3UDEA 2PI4A 3R8YA 2LXIA 4ICLB 1DURA 3CMAS 2E1MC 2K3KA 3W9IA 4WU2A 1D9DA 3BZQA 4CH0S 1VQOS 2MDAA 4O4GB 3SCIE 2HHXA 2PEHA 2A6MA 2DGTA 1UA0A 1EIYB 1L5UA 2AJ4A 2B4PA 2HLUA 1HD0A 5JMNA 5LXRA 1F3VA 2OP5A 2HLTA 1JLEA 2XS7A 4J37A 1IJFB 4ZVQB 4K4YA 4Q43A 2CFXA 2D41A 5CYJA 1Y5NB 1GXLA 2OPQA 4CO5A 5E3AA 2CPJA 3QWUA 2YKQA 1TL7A 4B3SJ 4AL6A 3R97A 2HFSA 4KIAA 4NOHA 2J6SA 1UL3A 5EWFA 4FYYB 1FJ7A 3DMJA 1PC4A 3AAWB 3KWMA 1RT6B 4QIFA 2Z58B 2YNFB 4J7CA 2HHUA 3PYGA 1I94J 2ZEJA 1LV5A 1F6TA 1SH2A 4ZN1A 2OJ3A 2ROEA 2WW4A 1H73A 1UJ5A 4WF9Q 3IN5A 1P6TA 2QV6A 3CJ8A 5D0GA 3TVKA 3BBCA 5E7OB 4ZKAA 4B3TF 2M8HA 1VYAA 3IAM9 1N6QB 1SQGA 2K8GA 1N33J 4RR5A 3N6NA 2QA2A 4HHJA 4OHZA 4S0MA 4HLBA 4YB6A 3GPAA 2GQCA 4TQSA 2IBOA 5JUMA 3BEGB 1LW0A 3CCLS 3MPWA 3T1AA 3NS6A 4YDXA 4NZ6A 3G6ES 3H4DA 5IFMA 1TKTB 2W2PP 2G0JA 3BR8A 2XMJA 2WRMA 3L4BC 1QE1B 4O44B 4ZOSA 3KJVB 5DS7A 3M8PB 2PMZD 4ES2A 3UR0A 2C2EA 4HACA 1C1CA 2H5JB 2KDOA 1SKWA 4Y6IA 4NYOA 5D78A 2GHVC 3OR2A 4HYKA 2AP6A 2MSTA 5F3ZA 2B9WA 4PWWA 4CNZA 3HZGA 3QIPA 2R7WA 5CAAA 2I38A 3MR2A 1WI8A 2HQGA 2VODA 5CH7B 4JI6J 1CC7A 2AT1B 4RLEA 7AT1B 3TEGA 4X4PA 1IR0A 3TZYA 3BO3A 4KTQA 3R7BB 3DC2A 3RR7A 1YSJA 4JI1F 3OT9A 2W2MP 4QIVA 5HVHA 1BQXA 4O23A 1OQ6A 2M9KA 4WWSA 3CW2C 4RU2A 3TA1A 2PC6A 2DNPA 5LSRA 1U4BA 1PAEX 3ZXWA 2V4RA 2E5JA 3OSNA 3MTJA 3I82A 2H48B 4RW4B 4X2BA 4K4XA 5I3UA 2EC2A 4UW2A 4TQRA 3UNYA 4ZVGA 2GHWA 5EDWA 4LSZB 3O5TB 1RLCL 2CVEA 5ETVA 2VKRA 3CCMS 5GAEI 3MCNA 4C0HA 4G3IA 2QMWA 4HDGA 4RW6B 2E29A 1RWVB 4AFFA 4TY9A 4CP5A 3DRYA 3KMSA 1QDUB 3BGUA 2GZOA 1URNA 3KUEA 4Y34A 3ONQA 4DZDA 3VAJA 3EJMA 2YBVA 4DPTA 2MY8A 3C15A 3GFYA 1ITPA 3J7YU 4OI2A 1GTHA 4USKA 2YH0A 4NI2A 5EWEA 4PG4A 1BQNA 2J7WA 8ATCB 3BGRA 2WVBA 2KHDA 2I5JB 1Q16B 1JXLA 2QGFB 3WX4A 3FC9A 5EN1A 3BDPA 2IM0A 4OJGA 5GMEA 2HYIB 3MEEB 4RX6A 4ZVRB 4C8MA 2DIVA 2C3OA 4HH1A 5DDOC 3M8QB 1RWNB 4C3LA 4MTPA 3HFZB 1SIWB 2A2CA 1RYSA 2HHVA 4KE5A 3Q0AA 2E1PA 2LYVA 2C3PA 1WDTA 4RUBA 1SL2A 1X31C 1S1UB 4N47A 2MKIA 4Z7YA 1UZDA 4DMZA 3SDEB 5LSOA 1VQ6S 2V4QA 2XSJB 2XM3A 3Q2TC 4O0IA 1FFWB 5F0WA 4LREA 4WXOA 1U2CA 1QTMA 2J7KA 3CJ5A 4FN5A 2HNYA 4WFNQ 3PZPA 2E66A 1H6KX 2VG6B 3FCWA 2LMIA 3OL6A 3CDBA 3ITHA 4G1IA 3EYZA 4ILMA 3AD9C 3T5KA 4QYRA 4ZPWR 4DR2J 4OI1A 3D6FB 3OR1A 1E6VA 4CLWA 1Q53A 4WIIA 3ZZTA 1RTJB 2RIJA 2RD5C 2H5EA 2JL9A 1VC0A 3TVYA 2HHPA 3M6WA 1FO1A 3RAQA 3I6PA 3LA0A 2VBYA 2HW3A 2J8AA 3ICLA 4K5RA 1IBLJ 1RABB 2DPIA 4HT5A 4Q45A 1JLCB 4DPUA 1T9UA 2W9BA 2HVHA 4UQTA 5LL6d 3EGNA 2BM1A 4P9SA 3SFUA 1WTBA 2RS8A 1B7FA 3KLFB 2OMLA 3Q8RB 3D67A 3US5A 3PNIA 4A48A 5AE3A 3KJNB 2GFFA 1KLMB 1X4FA 3LUYA 4CO3A 1QVFR 5CD4A 1KS2A 2ZBPA 4R5PA 2W7OA 4DL4A 2Z56B 4UY85 5L1LA 1YBAA 4LSNB 1QD1A 2CQPA 1SKRA 4J91A 2GGPB 4V1Ak 2D3UA 2CNOB 2DITA 4LF5F 3PX0A 2GAGC 2YKMB 3JYTB 2CNKB 1SUQB 3NGKA 4GVBB 4IR9A 4YB1P 4IOBA 2AYEA 1FEEA 2OSQA 4QWEA 2HURA 2IVYA 1UMJA 3MECA 1SCJB 1XERA 5RUBA 2B5JB 4LF4F 1DLOA 5IC4B 3TYTA 5IS2A 1MU2B 3ZZYA 1TAQA 1HYSA 4A8KA 2P6TA 3NEKA 2YX7A 1FRJA 4Y2KA 1EZZB 4E0DA 4JI8J 1FEHA 5DQHA 3G86A 3N28A 2FYXA 3G71S 1U8WA 2E1RA 2Y1JA 1H98A 3I4PA 2BUNA 4PZVA 2NR0A 1XMOJ 2ATCB 3R2CJ 3ET6A 3MM5A 2CQ1A 2UVUA 1B64A 4ANEA 1NKBA 3KK2B 3QLHA 3Q89A 2AGQA 1Q4RA 3VGSA 2AHOB 2LDIA 3DRXA 2CJAA 4GMKA 3R6LB 2RKIA 2IY5B 2F9DA 1RT2A 3BGOP 4UUWA 1TR0A 2E5HA 3JXOA 4DUTA 1SI9A 2I9SA 2PFDA 1JB0C 1IM4A 2WHOA 2ZUGA 3NBPB 2OGUA 3RZAA 5DZ6A 2YNHA 1CQMA 1UVJA 4MH8A 3OXGA 4UT4A 4K4UA 3MM6B 1YRUA 1RT4B 1WD6A 2CYYA 2F7VA 4ZLLA 2DNZA 3SV4A 1J27A 3NCPA 1RP5A 1WSVA 5LOQA 1G7CB 4DUZF 2XMTA 5CCLA 4QPXA 1UTAA 2DH8A 4BC7A 5KFXA 2IM3A 4LF7F 3K57A 1ZA1B 3NOGA 3M6UA 4EO6A 2VJVA 1WOOA 3CXCR 1L3SA 5E0OA 1TUWA 2X7IA 4KAIA 1V5IB 2Z8QA 1JK9B 4OZ5A 4HH0A 2ZDOA 4QIWD 4IDKB 1S7IA 2MKJA 3WC0A 3MEGB 5KG3A 1FRXA 2P2CB 3J81j 4WFZA 5C5JA 4DV2F 2FY1A 3EPIA 2UV8G 5I3PA 4EK2A 5L1IA 1XMBA 1VBYA 4NLYA 4R8UB 1RA6A 2W24A 1FX4A 3W65A 5D15A 3ZZPA 2YVSA 2VB6A 3HSZA 1DQ9A 2BRLA 1KQKA 2FY8A 4W4MA 2BQUA 3DOKB 2UU9J 5J2PB 4RW9A 3NMAA 3TR5A 4P74A 4Y28C 2MKKA 3DGVA 3DU6A 4OYAA 4DV3J 1C1BB 1HBMB 4NZ7A 5K9FA 3NY0A 2QFIA 3T9ZA 3N01A 1O8BA 5CD4H 1S6OA 1CVJA 1NZAA 4Q5VA 4I6AA 2R8KA 3HJFA 2Q79A 4J90A 3PJWA 3EVWA 4IFVB 4ZHRB 1RT5B 2HNZA 2DGWA 3MM8B 4J9SA 4E98A 3GQCA 1S0OA 3ISNC 3QRQA 1OWXA 1X4AA 2JLEA 4KGMA 4WFXA 2KFNA 2ADBA 4MKBA 3MEDB 1TQLA 1XEZA 1RWMB 2VA3A 4ES1A 1RB0A 3DI6B 2QC3A 4WZMA 3NLCA 4LF5J 1IBCB 3KUHA 4RKUC 5FD1A 4QPTA 4ZP6A 5ETSA 1WELA 1JLGA 3GR0A 2NSBA 3OFHA 3R5GA 4LF4J 3PY8A 2R7SA 5GAEU 2BKPA 3IRXB 2R7XA 2KYZA 1W2BR 1M5OC 3PR4A 4GC6A 1XNQJ 2I0XA 3W60A 2ZNYA 4AL5A 1CC8A 3SCJE 3NNAA 4X65J 4CWBA 1AA1B 3PYDA 2FLPA 5B08A 3G8QA 4DR5J 1FT8A 3HVRA 5GMDA 2DHAA 1PYOB 2RF2B 4B3RF 3GILA 2GMJA 4JBCA 1JMTA 2XNRA 1T9WA 2DGUA 1Q8LA 2CQ0A 2OHDA 2QRRA 5DZ7A 4PRFA 3PEJA 1B0TA 1DQAA 4A47A 2FJAB 4L3NA 4OYZA 3UR3C 2F5GA 1JLEB 1V5VA 1Q79A 4OHXA 2R7OA 4NXNJ 3OHAA 1O5JA 1RAIB 2EG2A 4CLSA 4GO7X 3KK1B 1QAJA 4YQWA 4AL7A 2OPQB 1WKKA 1M0SA 4PQUA 3IR5B 4F67A 1WACA 1NK7A 2UXCF 5D77A 4WXWA 3P45B 2PI5A 1K1QA 4DS5A 4DQQA 3B4MA 2WSFC 3QGHA 2MQ8A 3MD3A 1KR4A 2GJFA 3I9ZA 3ILLA 4DFKA 2XLJA 3WIUA 2N4CA 3OUYB 3MURP 3C6UA 2YQ3A 2LQ9A 3D0IE 2WW8A 2M52A 4NLDA 2OPSA 4ER8A 4IO1A 3JS9A 4U7UD 2ZHOA 2VQEJ 3CCQS 5F8GA 3IWNC 4FNHA 1IKWA 5KFUA 1RKJA 3GSIA 1RTDA 4DZ6A 5T14A 4NEYA 2FLLA 1REGX 1VK3A 1FHTA 3IR7B 1VQ8S 4Y2IA 3RAMA 2MSSA 2MKCA 1D1UA 2XY6A 4OJ1A 1K0TA 1JJCB 2A6OA 2KN4A 4A8WA 4OX8A 1CS4A 4A8XA 3QRRA 1N8RT 1HLWA 4RZRA 1K8AT 1DTTA 1N36J 1V3ZA 2EWHA 1VIOA 5EWGA 2RSQA 3QT7A 2IRYA 5KFNA 2HVIA 3CWJA 5KG0A 2VBWA 3UW1A 4DSKA 1ACMB 4OZ2A 2F40A 4LFBJ 3Q86A 2GW8A 1Q86T 3TUZC 2ILZA 3D1HA 3A3NB 3GFXA 1N0UA 3M30A 2DBBA 4LRDA 4HACB 3RG6A 3ZZOA 4ETXA 4TU9A 1P1LA 1N34J 5AE1A 5KFAA 4LQ3A 5A2QY 1IKYA 3QATA 2QJ3A 3QIPB 4PWDA 4JYAF 4DPYA 1WC4A 2FHOB 3JSMA 3O2IA 5HK4A 4DG1B 3OL7A 2OLWA 2DXDA 2CQGA 1YHQS 3NAIA 4LF1A 4PUOB 2YY3A 2NSCA 3H20A 1WG5A 3DLKA 2ALZA 1GX5A 1IKVA 3IRWP 2C2DA 1R31A 3IP0A 2VFUA 2IVFB 1WHWA 4GKJJ 4X4UA 2GX8A 2R9LA 3ZZUA 1WORA 4XDDA 1GMVA 3BBBA 5DG7A 5M2PA 3QSYB 3MPDA 4ES3A 2VBXA 1QSYA 1BY9A 1FRLA 1WEXA 2VDHA 4GC7A 3BYPA 2B4UA 1YJ9S 4YHHJ 2B51A 1SPBP 1KOHA 4YUDA 2UVWA 5I3UB 3S7RA 2HKEA 3L95X 3FJ2A 4GKKJ 2DXFA 4WPAA 1N5YB 4USWA 3T1YF 3GSDA 3UN2A 2DGQA 3CCVS 1F5AA 1RAEB 2F8HA 3KJQB 2QA1A 2FGCA 4ANCA 2B4VA 1RWOB 3M4XA 3CJTA 4B3MJ 2CNLB 3OBIA 3I0SB 1JKHA 3HVWA 3R1HA 2VC0A 1RTIB 1GAOA 3RJMB 4G6VB 1T03A 3C15B 2VHGA 9ATCB 3MI7X 3L7OA 4ID5A 3OHBA 3I5BA 1X0FA 1BUXA 4RW7B 4PXDA 2GVDA 3GB0A 1LXNA 1IR1A 1NKEA 1BQNB 1T05A 2RDDA 4B3RJ 3KXDA 3BGRB 1YJWS 5HMYA 4K5SA 1MG7A 5LMNJ 3W5ZA 1ICEB 2CPXA 5CQGA 5ADZA 2KRBA 1CEZA 1HNIA 4OX9J 5C42A 4ZPDA 3I96A 3MOJB 1TL3A 1K9MT 3SMZA 4JOUA 1X9SA 3DNCA 4DX6A 2FZGB 5KFOA 2VPWB 4DUYJ 4ECXA 4NLGA 3MM7A 2HVZA 4BS2A 3KYLA 1WKLA 1HNVB 1RK8A 4ZS6A 4ZJQA 1ZTTA 2KU7A 2V2VA 2M2BA 4LF9J 4MKYA 3AOAA 2E7XA 1TK0A 2VU5A 5IM0B 3I9V9 2UXDF 3HKWA 2FHKA 1UFLA 3T5JA 1BQMB 2HNYB 1KDNA 3DHWC 2MLXA 3WQPA 2RH3A 3NGUA 1SJFA 4KH0B 3QO9B 2HS3A 2DYAA 3UVJB 1N88A 3VAHA 4IFYA 2OEJA 4Q44A 3D6MB 2EFQA 2IPOB 3IWLA 5CZXA 3IC1A 3QQCD 3UCUP 1E6VB 2GCFA 4DR1F 2XYPB 3DLGB 4QU7A 2IMWP 1S79A 2QLJB 1AB8A 2ZHAA 1JQGA 1RAGB 4P7TA 3KLHB 2WOMA 1FRMA 3CF5Q 4FKXA 3S01A 2KXNB 3TJ8A 3NXZA 1U45A 2BJEA 2YKAA 5KG2A 2KT3A 3AJ1A 2Y1RI 4LVNP 2XZTB 5F8LA 4M5JA 5A8WB 5K5MA 1OIAA 3CCRS 3J81U 2G2OA 3TO8A 1I6JA 3RB4A 3H5UA 3D7SB 1NSKL 2UUCJ 4ZP8A 3TW0A 8RUCA 2DNOA 3EX7B 1LEOA 2BKNA 1S9FA 3MMCB 1EQ0A 2IIHA 4EO8A 2LXFA 2NLWA 2YQ0A 1S4FA 2R42A 2B9YA 4JV5F 5I42B 4DBQA 4DSJA 4P2FA 2FHJD 2PSZA 5A8RA 2GQ2A 1JXVA 1NZ8A 3M8YA 1RT1B 1SBRA 2HGNA 4MFBA 2ASJA 3G9CA 4R5PB 1VHFA 3A8JA 2J9CA 1REVA 4TYBA 4UUXA 4USVA 1DBDA 1Q0NA 1XQIA 1O6XA 1H38A 1AYEA 2ZH1A 1ZYQA 1B0VA 3LGMA 4RPFA 2OIHA 2XWYA 1S4EA 1MWQA 1JWWA 2EK6A 4CYUB 2MZRA 2ZKUA 2VFSA 3HDSA 2GJIA 2CG4A 1RAFB 1WOPA 4E8UA 1BHNA 1S6PA 2O66A 2M7SA 4QWAA 1FWKA 4IG0B 1FNMA 6FD1A 4DR6F 3H5YA 2UUAF 2VF3A 1DLOB 1FNXH 4IYQA 1G1XA 3QT6A 3MMBA 2R8GA 2HFVA 4R25A 3QSIA 3UCGA 3OJUA 2QL9B 1A7GE 5HMZA 5BR8F 4DU7A 1CSJA 2XULA 3JTNA 1HD1A 4OHWA 2R7QA 2EEYA 4LR9A 1FESA 2D1CA 4LF6F 4LF2A 2PFFB 3G4SS 3T1YJ 1AFJA 4K7QA 1JLFB 3M7VA 3R3TA 2YWHA 3SFGA 2HQCA 1VOMA 1M90T 5J1EA 2C2NA 3ET6B 2R4FA 3MM5B 3MOZA 2FTRA 3UD4P 3DRSA 3DXBA 1RGVA 5IT9U 2CPDA 4GVLA 4K0KF 1Q8IA 2DO4A 2FGOA 5CYMB 2XZWA 1PYSB 2RKIB 4DCPB 3PHEA 4KR0B 1NH8A 2ASLA 1HBUA 3KTQA 1VC5A 2DH9A 3HCXA 3FUYA 3BKUA 4BWMA 1Q8BA 3PJ9A 4ED1A 2EC0A 4G65A 3VVTA 5J2QA 4DPOA 1OYEA 3UO0A 2HHSA 4HL9A 2Y8WA 3HULA 5HP1A 1SC1B 3DLEB 4EBCA 2HIQA 4B3OB 2HK2A 4UOHA 4TY8B 1X5TA 1JNZB 3QGGA 2H4YB 1VBZA 1Q7YT 4MKAA 5C24A 4ILLA 1E6YB 4KHMA 2HQ3A 1S76D 1IM6A 2BW7A 2MQOA 3BF4A 2AEFA 1TMJA 4U7UK 1UAWA 1NPPA 4F50A 1UJ6A 2QL5B 3HMJG 2HHQA 2CAJA 4CLLA 2C2OB 3C6TA 3OTOF 5L9XA 3A4TA 2J76E 1HQUA 1ZM3A 1KKHA 3IGVA 3EXYA 3V81A 2NXJA 4C4WA 4F0HA 4F3QA 2X1AA 4USIA 4LVOP 2JH3A 1HPZB 2NQPA 3N6LA 5A8KB 4C8YA 2VA2A 1RI7A 1RWKB 4ZPAA 3M32A 1RTHB 2FJDB 2ABYA 4N76A 4DCOB 3NL0A 4FXWA 3FKBA 1YI2S 4O4RA 4DR1J 4O3PA 4RW9B 1YBTA 2V67A 2UV8A 2XTJP 4WFBQ 3J7A1 1FWLA 2XWXA 1UFKA 2E9TA 1VQ7S 2BOPA 1FDAA 5KFWA 1TUVA 4R0JA 1S12A 1X5SA 4FPIA 3J80Y 5ETNA 1XR6A 1TMMA 4TU7A 3HFVA 2NS1B 1NRKA 2J5AA 3MFIA 2DK2A 3DN9A 3PKMA 2AGOA 1Y3JA 4PG5A 1F1BB 2QLWA 5HJYA 4X84A 1FJGF 1NK8A 3TUPA 2C42A 4IRKA 3MD1A 3G8TA 3NWGA 1S1TA 3C66A 3U1LA 4F4ZA 1HBOA 3B54A 4NLRA 4WFYA 2WVCA 5L39A 4LBHA 3MR6A 4RUHA 4ZPBA 1HWJA 2W2QP 3E2EA 4KB7A 5L9NA 3DM2A 3H5XA 1OSCA 4OI0A 5J2MA 2PMWA 2KM8C 3CCUS 3GU0A 4CH1A 4U6PA 4QCLA 2HNDB 3TX0A 4TXSA 1TL5A 3CSKA 1NCLA 3T3FA 5HQMA 2LKZA 2U2FA 3VALA 4X4QA 3T1HJ 1JLGB 2QSFA 5ETTA 3AD7C 4M5LA 1X9WA 4NCGA 2OUGA 4ETZA 2RU3A 1RCXB 3HD2A 2ZDPA 1O0PA 3GIIA 4ELVA 4PWUA 5KFJA 3VZHA 2JVOA 3C16B 3QNWB 3K5MA 4ID8A 3UN5A 2F65A 1R8AA 4MK9A 1HNZF 5HJXA 3T41A 3NMRA 1OY8A 4IH5A 1S1WA 3IBFB 2DGOA 3HHLB 4ZP7A 5EUHA 2MHEA 4E2FB 2HRUA 2K7KA 3ZTQA 2CWKA 3FBEA 1ROFA 1EETB 3C2PA 2MQMA 4ZVFA 3BREA 3MXHP 2OD6A 5SUHA 2FC9A 4L73A 3LWLA 2H51B 1XN9A 1TFWA 1LNQA 4ZIWA 2B6AA 1IBKF 5KOXA 1ZM4A 4Q2LA 3QBCA 4J9UE 4DV4F 2JC0A 1FK9A 3J7AN 1S1XB 3T5HA 1TL1B 3FRZA 1L3VA 2LP4A 4G1QB 2W9AA 1IJEB 1XNRJ 5A0YA 4OHYA 5A76A 4UOCA 3UWTA 1CJTB 4CNYA 4PQUB 1NKCA 1KQSR 1YG0A 4CLYA 1KEKA 3V2UC 3KK3B 2MPUA 2P9CA 4C6AA 4DL2A 2HMIA 3AB4B 3QZ7A 4KKOA 2V2ZA 2F4VF 1QAIA 3R5BA 3BSOA 1RA7A 4JI0F 5E2QA 5KG7A 4OZ0A 3I56S 2BKOA 4H4MA 3OVSA 1HNXF 5CZVA 3D3BJ 3GMGA 5ETRA 1IQTA 3MMAA 3VF0B 2KL8A 5CYQA 1L3UA 3P8BB 1J5EF 3TWZA 2OEMA 1UJ4A 2DNQA 4FS2A 1KVJA 1OPIA 2V94A 5KT3A 1CS4B 4URGA 3P49B 1OPZA 5KFKA 1AT1B 3EWGA 1DTTB 5FDLA 2VQFJ 2L08A 3N4WA 2QTWA 2Y8YA 3LP1B 1HQEB 2E5LF 1QLNA 4WP3A 4M5IA 2MJUA 1NO8A 2ZD1B 3U1MA 5LMUF 3CCZA 1QUVA 3LP2A 3IFEA 1YGYA 2ZM6J 1S72S 2V2KA 2VBZA 4HHHA 2DR8A 2G13A 4J9OA 3GFHA 4NXMJ 4CTAB 3CMQA 2AX0A 4YEAA 1LFWA 3UDLA 3ELHA 2QFJA 2RQ4A 2Z30B 1F9HA 2KB2A 1IKYB 1VQSA 5D4NA 5B0GA 3QYYA 1VQ9S 1UFWA 2C3MA 3E01A 1T7PA 2GVZA 2ZH4A 2YPZA 3K17A 4FYVB 1U1NA 4K59A 1KFDA 1P8GA 5IT4A 3M8SA 2GO9A 2FJVA 1TUGB 3FFIB 3DLKB 3PW4A 5AJ3F 2HWHA 2LQBA 2OSRA 5ETOA 1TKZB 1FXRA 1IWAA 5D3GA 1RLDA 1WC0A 5F9LA 2AJ2A 5KOWA 3KLGA 5KG5A 1OJ4A 4OLOA 2RMLA 4DV0J 3G6YA 2OPPB 3KNAA 4WIQA 1SJ4P 4F2RA 3TAMA 2RDIA 4DV7F 5ETPA 1S9GA 1CG2A 4F7VA 4DSIA 1DTQA 3DOLB 3N6MA 2VICA 4X62F 2QEXS 3BH6B 4ED3A 3BN7A 1S77D 1HHSA 3IAS9 2DNRA 3DLJA 2CQCA 4D3HA 3GJSB 1S5ZA 3DGPB 3RB0A 5HI7A 3DOMB 5J1PA 5K8NA 3GJTB 4PKDB 1Q5YA 1NNDA 4I2QA 1R8BA 1AZSA 1ZM2A 2F9JA 3UD5A 2GVDB 1S1VA 1T05B 2GNKA 2CZVC 1VHIA 3JAMY 4FBTA 2JZ5A 3K7RA 2YNGB 2CZ9A 2PEBA 1T9XA 3TANA 1YBUA 4QWBA 4I6YA 3I4HX 4AE5A 1X9MA 3N5FA 1YJRA 2UUTA 1IBKJ 1PCAA 2YWEA 3GYXB 4ENOA 4O3SA 4ANDA 1CJKA 1RHQB 3NCQA 1NB7A 2HHTA 3KHHA 4P6QA 5E41A 2FVCA 3NNCA 4AXJA 4K50A 4USUA 1X4DA 2DXEA 3ETMA 1NK0A 2DH7A 4D3GA 4X4TA 1SJ1A 4C0BA 1V3SA 2R7VA 2NUHA 1MN7A 3MAAB 3FEYB 4B3SF 2DRAA 2CJ9A 4LQ9A 3HT3A 1MROA 4ZITA 1UWBA 2BJ3A 3H2UB 4N8NA 1YJ7A 3EUNA 3CC7S 3EICA 1C0TB 2OTJS 2OEKA 1YZ6A 4U9RA 5LSLA 1MN9A 1JNRB 2FVPA 1I94F 2VASA 4DFPA 1WEZA 5B09A 1HNWF 5CXTA 3R1LA 2MZJA 3G87A 2XMMA 1LWEA 1S6QA 5KT6A 3V6HA 1F2HA 3W61A 4F4KA 3HVAA 1BGXT 1Y5IB 1JLAB 2V69A 4WP8A 5IWAJ 1VQYA 3CNQP 1SL0A 4QJVA 2OAUA 1UKUA 2K2PA 2VG5A 2MGZB 1N56A 4OMFG 3W2WA 2CIMA 2DNHA 4X4VA 4Y2MA 3NCRA 2ZITA 1I3OB 1KOOA 2DD8S 1I5OB 4C11A 5B0EA 5BXIA 5DDQC 1U47A 1T9VA 3TJAA 3HHKA 1VQKS 1A6LA 5GAHI 2JWNA 3VWSA 2QLBB 4IRCA 3POTB 2NCKL 1YZ7A 2MZSA 3GWCA 4A46A 3H59A 1D0EA 5DM7Q 3GONA 5C25A 4LRCA 4OYXA 5DLGA 3J7Z5 5T7LB 4XPCA 3HP6A 1R43A 3M2UA 1IXKA 4KGXB 1VQNS 3IWXA 1VGYA 5A8RB 3ZC4A 3M1VA 2WBMA 1XC9A 1H2UX 3W9JA 3GYNA 4MFBB 2PT0A 3OL9A 1REVB 1QAYA 3W8GA 2AIRB 3IMQJ 2MKHA 1JXEA 1HI0P 4CRJA 1SV5A 2KXFA 3CCES 1C2PA 4JI6F 1FTRA 3GE9A 4PPDA 3MUTP 5AJ3J 3RAXA 5K14A 5KG4A 5U47A 2HVDA 3BO4A 2ZJQQ 1U0HB 1U24A 4JI3J 1VLYA 2KVIA 2JFDA 1XJWB 2ZWPA 1A9NB 1VJQA 3KLVA 3L09A 2BX6A 3QPIA 3OD2A 8AT1B 1Q7LB 1MWYA 4DR3F 2KRRA 3MDFA 2DHSA 1FDBA 2VFTA 5E33A 4IRDA 4W90B 1PAUB 4Y2AA 3MCOA 1XK8A 2R7RA 3N9UC 2DNMA 3MZIA 3A8IA 3GIMA 1NPKA 2FLNA 3PG9A 1RXOB 2YNIA 4WE1B 3ZTPA 2ZVSA 3W5YA 4NWBA 1BE4A 2RHSB 4FBUA 2B43A 2HRYA 3DRSB 2ZOGA 3JSYA 2LQ5A 3HK2A 2A0FB 5GVQA 4A8SA 5CCMA 3UPFA 3CULA 5KG6A 5D4PA 4U67Q 1GXTA 1RQ0A 2BR0A 2V63A 4RNNA 2X3GA 4LMZA 1U7LA 1RSCA 3JQJA 4RWWA 3CD6S 2GMHA 1ZA2B 4CO0A 1RJJA 5FLXY 2RU9A 2RQMA 3JAMU 3TJ9A 2O67A 1UEUA 2B9XA 4QOTA 4Y3CA 2KT2A 3F0NA 4LR8A 4ZK7M 3NGTA 1S10A 3DRPB 1VS3A 5HP1B 1VQMS 2FJXA 2PN6A 3AY0A 5J2NA 3IG1B 2M5YA 4DQRA 5KT7A 3UDVA 4IH7A 2FDNA 1IKXB 2DHXA 3A12A 2JVRA 4B9TA 4ICLA 3DLLQ 3THVA 2XS2A 1NK4A 3ZTOA 2ZHBA 3CDEA 3P4UB 3FMBA 4O4GA 1BD6A 2J0XA 1GXUA 2CRLA 2CG8A 3CEDA 4URSA 3C6TB 2PIIA 1HQUB 2BA9A 2R8JA 3FVYA 3V81B 5ETLA 1HNWJ 2E5GA 4OYIA 2WVFA 4DS4A 1NHKL 3QWPA 2DR5A 4WTOB 2BJ1A 4ZN3A 1X0PA 3OLAA 4A8YA 2MHNA 1KP6A 2R2UA 2HFOA 1LK5A 3M32B 3BQ1A 3CJSA 4I4BA 4DR2F 4NA2A 1IBMJ 2V8PA 1UEKA 4NRTA 4HTJA 1B70B 2HHHJ 1RAOA 2XMKA 3AOBA 3IS9B 2FHJA 1U6FA 3K5NA 4USHA 4DV1J 5DJBA 4O3OA 1U49A 3GFZA 4RWXA 4MYUA 1VBXA 3W5XA 1RT6A 4IO9Q 3CJ3A 4KY3A 5THWA 2J0QD 1S97A 1IBLF 4WKRA 2MLYA 1DQ8A 4LBPA 3WDOA 2W9CA 4EBDA 1HKAA 4OYWA 3ISZA 3R7SB 5B0BA 1XMQJ 1EHWA 5DLFA 2KZZA 2IRUA 2AEMA 1OY9A 4EZ9A 2X1BA 1W26A 1FVQA 1RWXB 1VIXA 1W2IA 3VZIA 1LXJA 2YQ1A 1M5KC 4UTGA 1RU1A 4A8QA 2RUGA 2EW9A 2XCPA 1TK5A 2XI2A 4ZCKA 4B9MA 1HBOB 1YWXA 1HR0J 2RILA 2BXJA 3TUJC 2BE9B 4DR7J 5KFLA 2BANB 1WG1A 1ZOTA 3PO5A 3CJ4A 3HXMA 3OFEA 2CKWA 4OYPA 2RHQB 1X4HA 3F44A 2XS5A 2B0GA 3E51A 4U96A 4WTYA 3TZWA 1TKTA 5E5NA 2Q66A 2IM2A 4UZBA 2P5VA 5EHHA 4QIGA 4K4WA 1QE1A 4O44A 2R2SA 3KJVA 1QM9A 2WZ1A 4FF3A 1JLBA 1XIQA 2HIYA 1NHUA 5IT0A 1HWKA 1RBOB 1LKZA 3HD1A 3KHGA 2V6AA 5KFPA 3ZTSA 4DF8A 3PV8A 1VI7A 3VHQA 1LOUA 3SQGA 3OTDA 4DR3J 1FKOB 4X4RA 4JI7J 4JI8F 4DU8A 2MMYA 2R7UA 3ILIA 2VIHA 1PO6A 2CZ4A 4RUAA 4RBVA 1FX2A 1S1WB 3L9ZA 3BSNA 3Q2SC 2C3YA 2HBRB 2RNEA 1CULA 1UCNA 5CABA 5K8OA 2EFPA 4NCAA 1GMWD 4CZCA 4B9VA 1XMOF 2OPRB 2P9GA 2ZFHA 1UVKA 2JHEA 3BO2A 2HQDA 2FLOA 3K89A 4HI1A 1DJ0A 2B8QA 1GTEA 2DR7A 2B6AB 5M2RA 3AT1B 4NZ0A 4ECYA 2UXBJ 1FK9B 2HRTA 3BDEA 2J9DE 4C3KA 4XPEA 1U48A 3I0RA 2ZUAA 3KHLA 4C98A 4X66J 5A0YB 2B8PA 5HROB 2AU0A 5FJ4A 5FLXU 4RO0A 4F3MA 2BVZA 1UW9A 1F0XA 2V4JB 4J9RA 4CIOA 4DFMA 4FPRA 4LSLA 2J9EA 2RRBA 2CPFA 3PDNA 2YKPA 4KKOB 2LLZA 2WVDA 4IOCQ 1T11A 3BN4A 3T6BA 2VPZB 5F8MA 5HMXA 4F4AA 4NPOA 2A2DA 4DSEA 4FS1A 4CLFA 2DTJA 2O01C 5KTQA 3MCSA 1TKXA 2JOQA 1YK9A 2LECA 3EDRB 2I5JA 1D8ZA 4YB5A 2YXLA 3HVTB 4CLKA 5BYQA 2VUGA 5CYQB 4RNFA 1NBEB 1RKIA 4NLUA 1SH0A 1JIHA 1U02A 1NPRA 1U1RA 3H40A 3TAQA 1SIZA 1N54B 4F4XA 4OX7A 2DY9A 3UQSA 2V8GA 4OI3A 3K59A 1VQPS 1HHTP 4TVAB 3G96A 1S1UA 1H74A 2ERRA 2UU9F 3QAEA 4HKQA 5GAHU 1SVDA 3SZ2A 2C2KB 1YVFA 1HI8A 3SDEA 2DR9A 1FXDA 2MB0B 2XSJA 2V8HA 5ETQA 2Z57B 2MQNA 4ZP9A 5HLFA 4ZVHA 3LP2B 2EFOA 4ED8A 4DSFA 4DV3F 2CXEA 2VG7B 5LJ5Y 2XCAA 2LEPA 4AUKA 1P9YA 4ILRA 4Y00A 1Y9OA 2C1EB 2RS2A 1F9FA 1FNOA 4ED7A 4ZVPB 2QZ8A 4QZVB 1NJWA 2VG6A 2BEFA 3ZTRA 2JX2A 2ZVIA 3GCXP 4ELUA 1FXLA 1JJ4A 3IR6B 4PYDA 2IA6A 1FD8A 1WG4A 7FD1A 3HM9A 3BM7A 4KHRA 3V6KA 2FVSA 1N52B 1B3TA 4XTTA 1T94A 3Q8SB 4H4KA 2D9PA 1KRPA 3R5AA 1LK7A 3F73A 2W1BA 5AE2A 3PXGa 4BCAA 1IWGA 5IC6B 1EX8A 4CM0A 2NYHA 2G2ZA 3K5PA 5IQ6A 1JLCA 2GS8A 2B7CB 4OJ3A 5D3GB 1UPMB 3P5BP 1RACB 3KLGB 2P6SA 3FNNA 2QA4G 2WB4A 1RWUA 3PCOB 2E7WA 3KKFA 5KFFA 2CUYA 1MNEA 5SZTA 3HSGA 2LCWA 2D69A 2EFGA 4KRWA 1KLMA 3D5MA 1ZZNA 2G4BA 4IOAQ 1SKUB 3H2VE 4UZCA 1RU2A 3PYEA 2MQQA 1XNQF 4LSNA 1I51B 1TFYA 1ZPVA 4DJBA 4GRSA 5D4OA 2LU2A 4P2MA 3CCSS 1M5PC 2YKMA 3TA2A 3JYTA 4X65F 2HGMA 2VOOA 2IBKA 1SUQA 1F3FA 5E3RA 4KHPJ 4GVBA 2K1RA 4DR5F 3VR1A 5KFYA 5DRKA 2Q1LA 3ZNJ1 1Q82T 2PA3A 4EU0A 5A6PA 1S1VB 3T6JA 2DPJA 4XAKA 5H1SV 4AQYF 1MU2A 5H9EJ 2XYGB 1F5CA 4R0EA 5HSPA 4KO0A 2AZ1A 4KFBA 1R8CA 3A3PB 1Z4UA 1G4CA 1CJKB 2V9KA 1OO0B 2C2ZB 4ECSA 1KTQA 5ETMA 4XIUA 3HSDA 4NXNF 1FDNA 4FVCA 4TYAA 1Y3KA 4RU9A 1XR5A 3KLEA 2Z2MA 4DLGA 3VAFA 2MXYA 1QTNB 1WI6A 4KPCA 1EJ7L 1U6BA 2ZE2B 2BRKA 3BGFA 4NMLA 3AA9A 2AEJA 1LWCB 4XK8C 3EMTA 2H3EB 2XC9A 2V34A 1S48A 3S1TA 3MWBA 4IH6A 2WBRA 2EK1A 2XMWA 2ZBRA 3DYAB 3GG1A 3BYRA 5KFEA 2ZWOA 1AUDA 1LWEB 1VRQC 4USTA 1IQZA 2PA8D 5L8RC 3A1YG 4CLUA 1D3WA 4C9DA 1FA0A 4X64J 1TKDA 2H54B 1R7IA 3WX8A 2Q3PA 1U1LA 3V4MA 2VQEF 3W66A 4YY3J 2ZH7A 2EBGA 3O1LA 4IG3A 2V0NA 2W7PA 1S6UA 1VC6A 2BQ3A 3HHLD 3MM6A 2NXUA 1RT4A 2VG5B 1V6HA 2DHHA 3W2WB 1RT7A 3MMJA 1X7VA 1R0AB 4URQU 2CQBA 2QT7A 3CJ0A 4QYZJ 1U2RA 2ZC3A 4I7FB 2FQQB 3SIPB 3FQKA 3M8WA 4N7TA 4C2MA 3JTOA 4NYZA 2ACYA 1N36F 3V6JA 1RHKB 3GV5B 1WHYA 1HBNA 4B08A 2AV5A 1V3RA 2OELA 4AYBD 3MEGA 5H9FJ 3VGUA 5C25B 4LFBF 1WSRA 3M2UB 4DPXA 2H65B 1WC3A 4FYXB 2XSFA 4FXDA 3SI8A 3TA0A 3MCMA 5I4MA 3T5LA 2GMLA 3UCZP 4EBEA 1N34F 4OZLA 3G2XA 3HO1A 4RNMA 2JDJA 2IC3A 3DOKA 5J2PA 3KG0A 3CJKB 3G8SA 3ILJA 1EKSA 2QYGA 1S7HA 4LFCJ 2BBEA 3D66A 2HFNA 3LH2S 5K14B 4YB7A 4DV5J 4L75A 3PHTA 4GKJF 2BV3A 1SQFA 3VCDA 4TNOA 1VQ4S 2P8IA 4OIXA 2DIUA 4NL5A 4YHHF 3MF5A 3R9LA 4ED6A 3H4BA 1WJ9A 2FVRA 4FYWB 4WK1A 2V2QA 5L1JA 4GKKF 1YX2A 2C2MB 5BYSA 1OSDA 5KFHA 1F60B 1RWPB 3OTCA 1VDHA 2FB0A 2HZVA 3MM8A 2KJVA 4N5SA 2ZZTA 4EMDA 2V5HG 3RB3A 2HG4A 3NG8A 2OD4A 3KDNA 3FGVA 4Z7CA 1HQ2A 1BLUA 4B3MF 4WKYA 2ASDA 2EVZA 3I32A 3AXMA 2BZ2A 1RT3B 3QGIA 1PJ6A 4PXEA 4QR1A 3MPUB 2JLGA 1KN6A 4JUZA 4YDDB 3LTOA 4W98A 2OI2A 4LFAJ 2AWZA 2OO4A 3DLHA 2M70A 3NNHA 3DU5A 4F2SA 3IRXA 4AQYJ 2ZOFA 5LMNF 3CGIA 2OTLS 3MR3A 4OX9F 1K47A 4YN3B 4IUFA 4J9KA 4Q0BA 3GP9A 1EQMA 1WWHA 1R8HA 2E44A 5F9NA 4DUYF 1B7YB 3LF0A 3ULHA 4I68A 2LFVA 4LRFA 4C8ZA 4PG6A 2UUWA 3MTKA 3U02A 3H0PA 5AXNA 4JV0A 5K8PA 2W01A 1TL7B 1K73T 3M8RA 4LF9F 1AROP 3FZBA 2RF2A 4PPZA 1VCTA 1LFPA 1U1KA 3DMJB 1YQHA 3TZZA 2H5IB 1QSSA 2VFVA 4HT7A 1QJHA 3AA8A 1XTZA 1I1GA 4KV8A 2RVJA 1Q5VA 1GEHA 4CT8A 3AB2B 1F5BA 1KFSA 3EGVA 4KT0C 4MK7A 4NLTA 2ZJPQ 1X5OA 5D8HB 1MSWD 3BSCA 3GIKA 1KTVA 1CJVA 3R5DA 3K58A 2V8VA 1SXLA 4MIWA 3CDWA 3KK1A 3H7HB 3FQLA 4DX7A 3BV8A 2J0WA 1S59A 4U8VA 4AT1B 1S0MA 3NS5A 4YS2A 2ZH9A 2EPIA 4LIRA 4P7VA 3JQMA 5AXMA 3MUMP 5F8HA 1U1QA 1TU0B 3OUYA 1LW0B 3KG1A 1DFDA 4ECWA 4HHUA 3PJXA 1VMBA 1KONA 4TU8A 2W9CB 1FJCA 3WC2A 3J81Y 2W25A 5MAOA 4N56A 2N3LA 3C14A 3A13A 4JI4J 3KHRA 2MZTA 1QSLA 2UUCF 1AUSL 3RBDA 1NK9A 2C3UA 1FKAF 4OZNA 2H9ZA 2Q6BA 4HEA9 2W8KA 2HZAA 2XHWA 4QR0A 1VBKA 4EFAC 2EKNA 2CJKA 2M4MA 2K3IA 1NDLA 4NLVA 3KOAA 3O6QA 2X3DA 3AXKA 4DXLA 3D68A 4DR4J 2IRXA 3EGWB 1C1CB 3CPWR 2IM1A 3FZ2A 2EG1A 2YX1A 4JI5J 3OR2B 1NDCA 2DGXA 3U27A 1D09B 5HATA 4EUVA 4JI2J 1SC4B 3BKFA 4Q7AA 4DX8H 2ROGA 1T3NA 1M1HA 3VVUA 4OV1A 3MGJA 2I2YA 3RBEA 1HWIA 2PD1A 3AODA 3I5CA 1H7WA 1UVMA 3WHIA 3DHXA 2YX4A 3NS7B 2XZDB 4OZ3A 3B6BA 1JLBB 3NAHA 2WVEA 3F41A 3B8HA 1RBLA 4ZA1A 1WKJA 2JNJA 2DEIA 3H98A 2DY1A 2NUUG 1SH3A 3SQGB 2APOA 2HZCA 2G1DA 3BH7B 2QO3A 1PYTA 5JXSA 2CPIA 3C19A 3FDSA 3DDNA 3MM9A 2NXNA 4DG1A 4Q2MA 3G6VA 3PW2A 1WHVA 2IDLA 4NASA 1CULB 4PUOA 4RNOA 6FDRA 4ZPVR 2AZ3A 2GIFA 4ZDNA 1HL6A 3GYGA 5GAGI 4H4OA 2AYMA 2RB7A 1R3NA 3MR7A 3M9OB 4C48A 2B9EA 2CJXB 3EVOA 2HQIA 5IT9Y 1L3TA 1K44A 2HGLA 4OYBA 2M88A 4NCBA 3CO9A 1LWFA 3HFKA 5F0UA 3QAUA 3K8WA 5DM6Q 4RW8A 1RUSA 2W8LA 4NI2B 4DN0A 3W63A 3I0RB 4FZVA 1S9EA 5GADI 3NKYA 1N5YA 4K2JA 3Q24A 2VZ9A 2HS4A 1NH7A 4OYOA 3D9BA 4AD6A 1Y10A 3M6VA 4IQXA 2FC8A 2O5DA 1GMUA 4LSLB 4I0WA 3I0SA 4DV6J 1SKSA 1RTIA 4RNHA 1J5OA 2DT9A 3OLBA 3HT0A 1NSPA 3D1OA 1ZETA 2E9RX 4PYAA 3TUIC 3NGSA 2DGSA 3ILOA 4C8OA 4RW7A 4RL1A 3BQ0A 4NX9A 1U0SA 4NRUA 1T8EA 1TKXB 4F25A 3M2RA 4V19X 3OXFA 4HI2A 3LOUA 5AXLA 4F3OA 2XQCA 3PW7A 4ZJOA 1APSA 1EAYC 4P73A 1RWWB 3OFFA 2I6WA 2OH2A 2IJFA 4EGLA 2QLFB 2XO6A 3ITHB 2KM8B 4RUCA 3ZZZA 3VGTA 3GZ7A 1S0VA 2AGPA 3TI0A 3CD0A 4LF8F 1HNVA 4QW9A 3OR1B 4ZVSB 1T3OA 2OFGX 2XY5A 2SXLA 2RDJA 2N3OA 4DF4A 3RGIA 2ASYA 3AQOA 4USJC 3W1YC 3A3OB 4A4JA 5HLFB 5IM0A 2JSXA 1NJXA 5I3QA 4ECRA 1BQMA 4ZPTR 2BE7D 4OL8A 4MJKA 3TQEA 1VQ5S 3TQ1A 4PEOA 3FBBA 1HA1A 1OQ3A 3QO9A 2BYCA 4YFUA 2W9BB 2L9WA 4DWIA 3EPGA 3OVAA 3UVJA 4DPWA 3VAGA 4B3TJ 4J9QA 3KJFB 4P10A 3CJQA 2WCXA 2FJBB 2D3O1 3DLGA 5B0DA 4CLZA 3Q8VA 3FCVA 4LT6A 3EM1A 3KLHA 5C7PA 3SSSA 3L7PA 4KH1B 1N5VA 1R0BG 2HBYB 2HBZB 2ZBCA 1UVLA 2EFVA 2BJDA 3CD7A 3D0HE 4CO4A 1RZMA 5A8WA 1G3OA 1VR6A 2KJWA 3AD8C 2M0GB 1WTFA 1GMWA 4FF4A 1UA1A 2WTFA 2O1PA 2V8DA 1ZS6A 2EXUA 3K2YA 1MLAA 4DL0C 2Z2LA 2BM0A 3KUGA 5KT5A 1AFIA 3MMCA 1D9AA 5IV4A 3T1HF 1N5SA 4HR2A 3ENQA 3MECB 4MMOA 2DEJA 5I42A 2H4WB 2XLIA 2AYGA 1RT1A 1P1TA 3H2LA 2IYGA 1HYSB 2FZKB 3LP0A 2GIRA 2YKNA 3HF5A 5T41A 1NDKA 2J9DA 3R5CA 4YP3A 1PC5A 2LQ8A 3GIRA 2FHMA 2GIQA 4OZ1A 4CYUA 5DGBA 2K1RB 3EE3A 2WK4A 3ZZRA 4JI1J 4CM2A 2DNNA 4ELTA 3DKDA 3FK4A 4IG0A 3KG4A 2XB2D 4C0OC 4DX5A 3BS9A 3CMES 3QLHB 4ITSA 4Z37A 4ZCLA 3X3UA 2QMXA 1HFEL 4KO0B 4KFBB 4P72A 4UY8T 3C8YA 2IDEA 1RT2B 2RJZA 1XBWA 2FD2A 1RDRA 1XNRF 2VH7A 1TAUA 2CNNB 4B17A 3KLEB 4L76A 2YNHB 4USMA 2FPHX 1JLFA 2J7UA 1ZBTA 4KPYA 3LANA 4J5OA 3LWMA 4ZVTB 5AXKA 3H42A 3S6EA 1NU4A 2XMUA 4J9MA 3UI3A 2XG8A 9RUBA 4DI6A 1H3DA 5KFZA 3OQ2A 5CYMA 3PR5B 2PDAA 1VQLS 1KD1T 4BC9A 4NLOA 1C4AA 3SCKE 1TVRA 5DQGA 2OMOA 1CJUA 1Z1ZA 4IG3B 3GCWP 1Z2ZA 2G0CA 1FJEB 3CDUA 4FNIA 1NJZA 4K4SA 1RT7B 2QN6B 3FEXB 3MPVA 3TEHB 3DLEA 4FF2A 2K06A 4B3OA 2IYIA 4K4ZA 1PBUA 5JJBA 4TY8A 2F8MA 1HARA 1RCOB 4XO0A 2MEWA 4MK8A 3NOCA 4LF8J 4FXVA 5F41A 1WF2A 2CJBA 1YRXA 3WZ0A 1E6YA 2VQFF 3GIJA 3TAPA 2CQ2A 2AYBA 3CUNA 3PIPQ 4BLGA 1HBNB 1W25A 5KFRA 4ZCMA 4BBYA 2A1BA 3Q83A 5KFBA 4ZJLA 2ZM6F 1KQFB 3CC4S 2D3OR 3EXCX 4K4TA 4M5NA 2A10A 2CDQA 2COLA 2AJ0A 1T9YA 1HPZA 3OTEA 4I56A 2JEFA 4NXMF 5A8KA 3D4JA 3V5RA 1PSDA 3EDQB 4QBUA 5J1NA 3BJYA 1RTHA 4I1TA 4DQSA 4F36A 4QIEA 4ZVUB 3Q8PB 2IC3B 1NK6A 1H7XA 5KAKA 1SJQA 4ATNA 1Z2LA 2HAIA 2PGCA 2HNZB 5E3QA 1YITS 5FIIA 2KYXA 2B56A 4LIWA 5HVFA 3PACA 2G1HA 1FRKA 3W2VA 2P9EA 1N32F 3ISND 3THPA 3B78A 3VAIA 4JV1A 4DV0F 1M5VC 5KFSA 2WONA 3H8YA 2VL1A 3CB4A 3RTVA 1R27B 2IHR1 4ECQA 1WDDA 4KSEB 3I31A 1HW8A 3SSRA 5GAGU 3P96A 2HFUA 4MKVA 1U1MA 1VISA 5D0RA 1C0UA 1PGZA 1Y7PA 2Y0BB 5HAOA 1RBAA 3GJRB 4A8MP 4K4VA 1TTHB 2XMVA 2QIFA 4OZJA 3M8ZA 5HBMA 2ATLA 4HTIA 2LA6A 4OX6A 2ADCA 2HNDA 3CIZA 1PJ5A 4P2SA 1Q78A 4N77A 3JQKA 2XO7A 1T95A 4WK3A 3HI9A 5GADU 2NPIA 4H4KC 3M2VA 4Y65A 3LPEA 1F9EB 3OXLA 5BJRA 1PG5B 3UN3A 5DDPC 1LW2A 2B3TB 4KGVB 3D0GE 4H54A 4L74A 2U1AA 1UZHA 4ZVEA 1R89A 1VFJA 3C16A 3A8EA 2R2TA 1L3KA 3W8PA 4OV6A 3SBMA 3IO1A 4Q0BB 4ZLJA 1U8SA 3D2WA 3P5TL 4OFZA 3LAKA 3Q8UA 4OQJA 1YKWA 3HSJA 2XLKA 2CADA 3HHLA 4J9VA 1RAJA 2KKHA 1S57A 3TVZA 3QT8A 3RR8A 1SJ3P 1B4SA 2DHGA 4LR7A 1EETA 2QMUB 4U8YA 4A8FA 3ZZ0A 4X4SA 2IMOA 1EP4A 3RYLA 3GV8B 3DXSX 3DRRA 3C6UB 4KV8B 2GHPA 2G9OA 4XDCA 2LDYA 4P75A 1S1XA 1TL1A 2OPSB 4P2XA 5IOLA 1RADB 5B0AA 2ZC4A 2R3VA 4G1QA 2Z0GA 2L41A 1CJVB 2DR6A 3OJSA 2GV1A 3Q22A 1KVIA 4FP9A 4CQ1A 1IKWB 1X4GA 3IBWA 2R2RA 2NYIA 1CJTA 2V9WA 4MAKA 3W9HA 2VJUA 1RTDB 1FE0A 1NUEA 1DARA 5IWAF 3I5AA 1HMVA 4CDIA 1D9FA 3KK3A 3RRGA 1FFSB 4YOEA 4Y2CA 1BWEA 5L38A 1DRZA 1UETA 3L3CA 2ZJRQ 4DUZJ 2L3MA 5JVGQ 2AJQA 3QMQA 3IXQA 4M95A 1NSAA 1PILA 4LF7J 5HQ8A 2D74B 3FRYA 3RUBL 1YJUA 2QX0A 3C14B 2BMBA 4FF1A 1RHJB 2W4CA 2GC8A 3EZUA 2XMAA 1QVGR 3TX8A 1OMSA 4J9LA 2KFZA 1GH8A 4NLSA 1YJNS 4DV2J 2OFHX 3M30B 3LO3A 5D6GA 3JSRA 3M6XA 1FE4A 4B9LA 3SEOA 3GJQB 1YJVA 4PWDB 4ED0A 1N4LA 3OFGA 1O51A 2ZOMA 3LP1A 2ZH8A 1HQEA 3JSMB 1FRIA 2ZD1A 4M63A 4ALZA 3FEZA 1TK8A 4KGKA 1IKVB 3GG0A 2YTCA 1VRTA 2QYCA 4BDPA 1CLFA 1FFGB 1SC6A 4WU3A 1N32J 2UVVA 1FD2A 4JI3F 3AHPA 4CTAA 3HHDA 1KHVA 3M9MB 2X1GA 1UEVA 2D3ZA 2WAQD 2D7SA 3R27A 2VD3A 4BHQA 1EKRA 3NRBA 3PO4A 5JVHQ 4ZIVA 2AMCB 4WBFA 1RAAB 3MR5A 1SJRA 2N7YA 2IFXA 2KVQE 3MM9B 3CD5A 3W64A 4CLPA 1IUJA 2ZNZA 5KFCA 3DDIA 2E9ZA 3AJDA 1N0VC 3FFIA 3H5SA 2FJWA 5LXYA 2XGQA 2XI3A 1B99A 4H4OB 1Y11A 4YR0A 5B0CA 1TKZA 3EGZA 1RISA 3NWRA 1JKHB 4EZ6A 3HHEA 2LEAA 2B7BB 3V4IA 4I6WA 5BYRA 2OPPA 4ED5A 1LWFB 3GTYX 2J6UA 1T03B 4F04B 1S0NA 5ETKA 5IXUA 1DZ5A 1U26A 3PRBA 4RW8B 4ID5B 2DISA 1UPPA 1YTYA 1S9EB 1ULRA 5F3TA 2MLZA 1TP7A 1U6ZA 4NLPA 5DQIA 4I67A 3DOLA 4KGZB 2X51A 4ZLNA 4CH7A 2O3DA 2DKOB 4RBUA 3JSBA 2ZH5A 5L1KA 4TLRA 2LXUA 1HNIB 6AT1B 5C42B 5B7WA 1IVZA 4FYDA 5E3CA 1GX6A 3DGPA 1ELOA 1TL3B 4HDHA 3DOMA 1NJYA 1J5OB 3MM7B 3D54A 4TKTA 5E3PA 2HQFA 2IAJA 4L3KA 3KMQA 5B0FA 1ZH5A 2YH1A 1FDDA 2EKYA 4CO2A 4PQAA 4I2PA 5HMWA 2NZ4A 3BB5A 2V68A 4OLPA 1Q81T 3M2RB 2YNGA 2HS0A 4CT9A 4QU6A 3QJJA 1U1PA 3FBCA 3CVKA 1WF1A 3HKZD 1FF2A 2BJ7A 1Q1KA 3MPYA 4OYMA 1HWUA 3UDCA 4NMXA 2CQ3A 4IFYB 3CE8A 3WBZA 1MW7A 5C2GA 4M8LA 1YRTA 2PO4A 1IBMF 3MAAA 1AXQA 3KFWX 4LRBA 2HHHF 2UXCJ 4QWDA 1M5HA 4NA3A 2L9NA 3BQ2A 5D4LA 2KXHA 1FVSA 2NXCA 4DV1F 2WOMB 1GT8A 4Q8FA 2BQRA 3R5JB 1C0TA 4ZLPA 1NLKL 2VDIA 4L6V3 1A0OB 1FKPA 2W4DA 4ECTA 1XMQF 5HVGA 4WYWA 5KT4A 2KZMA 1BC6A 3ZFVA 5KG1A 3W62A 4EYHB 1JLAA 2YWGA 4F8RA 2MY7A 4LRAA 2Y9HA 2KFYA 1JLQA 1NXIA 3RB6A 3QRPA 4M5KA 2MGZA 4DEZA 5G0RA 3W3SA 1HR0F 2MQLA 3L7UA 2X1FA 1RHUB 1KBRA 3EZOA 4DR7F 3X1LB 4MIAA 2E1AA 3Q8YA 1UP1A 4M5DA 1YDLA 4FDFA 2DVIA 3LALA 5K20B 4PABA 4M5HA 5KFIA 2KH9A 3TZXA 1M1KT 1K1SA 2DRDA 3A8KA 3POTA 3OTBA 2RQKA 3RBZA 3IM8A 3ENWA 2M8DB 4IQMA 1TELA 2G2YA 1ZPWX 3PKYA 5T7LA 4O3NA 2QL7B 4PXCA 2NXEA 1S6PB 1C4CA 3GR1A 3LGHA 2K7JA 2A3JA 4L72B 3MMBB 3PTWA 5F8IA 3LP0B 2GAHC 2YKNB 3K5OA 4DQPA 4M5MA 4QW8A 2HSEB 4JYAJ 5A2QU 2N4DA 2VONA 2F4FA 4MYTA 4JI7F 1NAQA 3C3LA 2CPEA 3V6DA 5M2UA 3SCLE 3G82A 1UWAA 1TV6A 2JLFA 1HWLA 1TL4A 3UFCX 2BE2A 2NPFA 3QZ8A 5J1EB 3EZ5A 3K5LA 1U1OA 3O44A 4BWJA 5KFGA 4DOZA 1U0HA 4DSLA 3TRGA 4QR2A 3G6XA 2ALYB 1WC6A 1HI1A 1VLOA 2VV5A 3W7BA 1XR7A 5EGYA 3VAMA 2ZBIA 5KT2A 3SV3A 2UXBF 3O3LA 4KYZA 1HBUB 1Y4ZB 4PR6A 2AQ4A 1J2VA 4X66F 1NMEB 5LJ3Y 3KLIA 1HHQA 3F56A 1VRUA 3AFGA 4A8OA 2LVWA 2V50A 5J2QB 5GMKa 1ZZFA 1UVNA 5F8NA 2QG9B 4ECUA 2HHWA 1UW4A 4WYLA 2VC1A 4WE1A 5IZHA 3OL8A 3ADAC 4CLTA 1FTCA 4C8NA 1ZTWA 4B9SA 2HEKA 2CPHA 2YWWA 4F0KA 5C24B 5KFTA 1R6VA 2R7TA 1WC5A 2XEXA 1NDPA 2CWXA 4IKAA 1TVRB 3QFHA 2DCUB 2LQJA 1CJUB 1T9TA 4DDFA 2NZCA 5D0EA 2VFRA 4EWTA 4UOGA 4JV2A 5CA5A 3VQTA 3DRPA 5IQQA 5HANA 3IG1A 4YMEA 4B02A 3NP5A 4F4YA 4F02A 3FSYA 3PIOQ 5H9EK 3RRHA 1IKXA 4KJIA 3CJRA 2RRAA 3ETOA 3THTA 3P6YC 5KFVA 1D8YA 1K0VA 3IA0A 3I55S 2UXDJ 3OW2R 4N8OA 1JJHA 2YNFA 3ZO7A 3EVMA 2QA4S 4W92B 3AH6A 2EI5A 1V9OA 4KBIA 2OKQA 4LBIA 1Y0HA 2E5IA 5DO2A 3I87A 2IJRA 4O3RA 3CIMA 4UQGA 4ECVA 1FCAA 2J8SA 5K8MA 1SL1A 3R2DJ 2UP1A 1UVIA 3UD3P 3MAHA 3VGVA 4X4OA 3CC2S 1N6QA 4WZQA 1RHMB 3DDKA 3IS9A 2W2OP 4P71A 2XNQA 1S1TB 2AD9A 3FCHA 2F63A 4N41A 3SSQA 2IVMA 2Z4PA 1Q8KA 2CPYA 3DM2B 2G0IA 2CJYB 1RAHB 3QIDA 3W2VB 4MIBA 5J2MB 3D28A 2M3DA 5KFQA 4OI6A 4QYZK 3FSIA 2DB1A 2KG0A 4DHVA 4DL5A 4EEYA 1RYRA 2Y3YA 2ZH3A 2WONB 2I1RA 1NB2A 3D3CJ 1YLXA 4UOFA 1W7WA 5LT5A 1G2EA 1NM2A 3M8PA 4OI4A 4MT1A 4U95A 2C2RA 2FVQA 4U7CA 3CO0P 2BOAA 1KHWA 4JV5J 4J9PA 4B9NA 4NCGB 3BR9A 2WB1D 2BANA 2GA7A 4TLQA 2H1YA 3DCAA 1RHRB 5H9FK 3BPSP 4JB8B 3S8SA 2UZAA 4CO1A 1C0UB 4QWCA 3DLBA 4C8KA 1KVKA 5HBMB 2CQDA 2PMHA 4Y0FA 1KC8T 2ACMA 3QGPA 1T0TV 4O0NA 5HO4A 4V19J 1LQ9A 3PVXA 4DCJB 4WFAQ 4KHPF 5KFDA 3IBCB 1NJIT 3E8OA 4LJMA 3M2VB 1U09A 4YR2A 3FMWA 4DR6J 2UUAJ 4FKYA 3UE2A 1LW2B 4DFJA 1R0CB 2FUG9 1FERA 2DJWA 4RW4A 1FKOA 4ED2A 3JTPA 5EX3A 5BR8J 5ITHA 4ZVOB 1Q95G 4LF6J 2CJQA 4C3MA 1MMLA 4PCQA 3OV7A 3IM9A 4CI0B 4RW6A 2LA4A 2OPRA 5DG8A 1QY7A 2VOPA 2KI2A 2ILYA 1EP4B 3QFWA 2CDRB 2GQQA 2BACA 3DRRB 4PAAA 2HMIB 5CHCB 4K0KJ 4NLXA 2F1FA 5EX0A 3O8WA 3VV2B 2AF6A 1DAXA 2C28A 3QJPA 1CQNA 2WSEC 2MKSA 3BPDA 4X64F 2AJ1A 3PYFA 3CCWA 4NA1A 4H4MB 4NEZA 3T9NA 2XYHB 1MWZA 1X60A 4YY3F 5HROA 3MMAB 5F8JA 2KG1A 2JC1A 1ZAWA 3RRKA 2JEGA 1HMVB 4M5GA 3D1QA 1BWVA 3BGLA 2V4JA 1OYDA 2W7AA 4YR3A 1MMDA 3B4DA 1ZAVA 7FDRA 3MEEA 4EYIB 4NYPA 2Z2ZA 2ROPA 1SB6A 3R7NB 2FZCB 4JP8A 3M8QA 4DQIA 3R6GB 3DFEA 5HQLA 1FWPA 2A18A 3H90A 2N7CA 3B82A 2AX1A 2E7VA 3K8VA 2Y1LB 2W4PA 1PKUA 3PRVA 5FDLB 3ENVA 3PM9A 3D6TB 1FI4A 1NK5A 1T02A 1S49A 2Y1IA 2DCLA 3VAKA 2FJEB 3M05A 3AOCA 2I8EA 3OTOJ 2GO8A 1NEEA 3VQSA 1SQEA 2CQ4A 3HVTA 4Z2XA 1P9QC 1U25A 2Q6CA 3VTIA 5IV3A 4B9UA 2HK3A 2VPXB 4AXIA 3PFEA 2RAQA 3N0VA 3LQVA 1WOSA 4EI2A 5LM7E 3PRDA 3LGNA 1KLNA 3AJ2A 5MLCV 2YPYA 2R8HA 2BDPA 2EFNA 4M1KA 2CA9A 3AQPA 2MTLA 3E01B 1EB0A 3FBFA 5G4DA 2GVZB 4OJHA 4FVMA 2DNYA 1RTJA 2CPZA 2HFZA 4RBTA 4G1PA 2ZBQA 2UUBF 2DO0A 4LFCF 1DY3A 4HVZA 2GJ2A 2VG7A 2F3JA 1VRTB 4DV5F 3MAQA 2HWIA 3J80U 2CVIA 3E3XA 4I69A 1YIJS 1QAXA 3OVBA 4KQZA 1ZAXA 4WJBA 2MYFA 2L48A 3TAMB 2E1CA 1FJGJ 1GQEA 2ZZNA 2KO1A 3KLFA 2HPUA 1XWLA 3ENAA 1X4BA 4Q8EA 1X8DA 1S9GB 5DGAA 5D0HA 1HIYA 3HJVA 3PW5A 1DTQB 2RT3A 1CPZA 3CTRA 4O3QA 2PE8A 3KDOA 1BMQB 3MFHA 2RQCA 2GGPA 3PX6A 2EBEA 4NE9C 1G6BA 3N5BA 3V4IB 1NHVA 4I2QB 4ZCIA 3RW7A 1AZSB 3BSAA 3U7JA 4LFAF 3T19A 4F4WA 3TOQA 2DNGA 2QLXA 2B5JA 2MQPA 1LWXA 3UNGC 1WUUA 4QQBA 3CT9A 1NSQA 3PFOA 2XHCA 2DNLA 1H2TZ 4UF4A 2J6TA 4ED4A 4C7QA 5A6WA 1HNZJ 5L46A 2FIUA 2YKOA 1X4CA 3FSXA 1PBAA 2Q43A 2JJ4D 2IAJB 3QT5A 1JJ2R 4DL6A 3CDAA 3BBFA 2LU1A 2JFKA 4TN2A 4I2PB 2JEJA 1FRHA 5C2CA 1MROB 4DLEA 4M94A 1UWBB 2QE5A 3KK2A 3MHYA 1GK8A 1GFWB 2YWFA 2RUSA 5AT1B 1DHMA 4C8LA 2MKYA 2MZ1A 2KTQA 1IR2A 3BKTA 3OPKA 2Y0SD 1S6QB 4DV4J 3J7YI 4PXBA 1Y5LB 1P27B 2B4OA 5DG9A 3CCJS 2YWKA 5KFMA 2HAFA 4F26A 1B0PA 3C46A 5DETA 3NBPA 1PIEA 4K8RA 2DNKA 3SQOP 1OS5A 2HBQB 2ZE2A 1H0HB 3P3DA 3CCTA 4F0MA 3MEKA 1LWCA 3GLJA 2BABA 3U1NA 3KNGA 4NLQA 4PG8A 3PW0A 1VJWA 4C11B 3M9NB 3DYAA 2XGPA 2F4VJ 4JI0J 4RJVA 1FKPB 1M5SA 3NGDA 3WIVA 3TNVA 3GV7B 2VKZG 2UVRA 2ZZMA 4KC5A 3HHNB 1YJTA 1HNXJ 3HHLC 1QUPA 1N5QA 3PEHA 4JI4F 4IDKA 4GO5X 2KHCA 2BJ9A 3PX4A 1JX4A 3K0JA 1CBKA 1JLQB 2BJ8A 1N33F 1RTZA 5G0RB 1HW9A 1J5EJ 4NLWA 1R0AA 4IR1A 2RRNA 4DR4F 2DGVA 3M1VB 2JRSA 1WF0A 3SYZA 1AW0A 1URRA 4R8UA 3Q8QB 4I7FA 2Z2YB 3HZEA 4M5DB 4X4NA 1KSPA 4JI5F 4DL7A 3HX9A 1PJ7A 2J0SD 1WNEA 1OY6A 4I64A 4JI2F 1SV5B 2E5LJ 3LPYA 2POKA 3CJ2A 3MUVP 5LMUJ 4C97A 2XY7A 2W2NP 1N48A 2UUBJ 3QJLA 2AJFE 1R6YA 3LW5C 3D6HB 4ERDA 1C1BA 1F2GA 2QSWA 1R8PA 1WC1A 5HL7Q 1HBMA 3IGNA 4WCEQ 2ZH6A 1SC3B 4ZPCA 4ECZA 3RBXA 2AKWB 1KQGB 2HVEA 3TP2A 3H25A 2XBPA 4CCHA 3CJKA 1U2FA 3V6DB 2CQHA 2ZKTA 4IFVA 1X5PA 4ZHRA 3G82B 1RT5A 1H72C 1TV6B 4J9NA 3N79A 1VK8A 3HLUA 1S99A 2VPYB 2WSCC 2DRBA 1BXNA 2MZQA 2BE2B 4OHVA 2YNIB 1X4EA 5HN0A 3HPOA 3J7ZT 2LEBA 3MEDA 4DL3A 3NGRA 1TZ0A 3DI6A 4P52A 1N5TA 1MMNA 2BW2A 1WHXA 4LUBA 3Q23A 3ZNUA 4DN9A 2RE1A 3RW6A 2JEIA 3LAMA 1Y00A 1EARA 4DV7J 3OSPA 2IA0A 5DDRC 1RE1B 4WP9A 4PG7A 1KWMA 3KLIB 2ZH2A 3SXLA 1ZM9A 1VRUB 2N82B 4X62J 2L9DA 3JB9k 2F8EX 2MJNA 3RU0A 2R8IA 2HWTA 3TARA 1IN0A 1GNKA 2CQIA 5J2NB 2KT5A 1WEYA 1KNZA 2AW0A 2D9OA 1RT3A 2C22A 2IJNA 4K2XA
chains in the Genus database with same CATH topology
1HMVA 4DV6F 1H2VZ 2JX2A 4ZMMA 1D9FA 3KK3A 4E8UA 3RRGA 2NREA 1S6PA 4ELUA 1FXLA 2O66A 2M7SA 4QWAA 6FD1A 4IG0B 1FNMA 4DR6F 4YOEA 3H5YA 2UUAF 4Y2CA 1JJ4A 2PI4A 1DLOB 3IR6B 1FNXH 1BWEA 5L38A 1DRZA 2LXIA 4ICLB 1DURA 4IYQA 3CMAS 1G1XA 2IA6A 1FD8A 2E1MC 1UETA 1WG4A 2K3KA 7FD1A 3L3CA 3HM9A 3BM7A 3MMBA 4KHRA 2ZJRQ 3V6KA 2R8GA 4WU2A 4R25A 1D9DA 2L3MA 3BZQA 2FVSA 1N52B 4CH0S 3UCGA 3OJUA 5HMZA 1A7GE 4O4GB 2MDAA 5JVGQ 3QMQA 1T94A 3Q8SB 4H4KA 3IXQA 3SCIE 4M95A 1PILA 2D9PA 1KRPA 2HHXA 2PEHA 2DGTA 3R5AA 5BR8F 1UA0A 1LK7A 1L5UA 5HQ8A 1CSJA 3F73A 2D74B 2XULA 3JTNA 5AE2A 4OHWA 1HD1A 2R7QA 2AJ4A 3FRYA 3PXGa 1FESA 2B4PA 4BCAA 2HLUA 1HD0A 5LXRA 1YJUA 2D1CA 4LF6F 2PFFB 4FF1A 3G4SS 2W4CA 2GC8A 3EZUA 1QVGR 3TX8A 1AFJA 3K5PA 2OP5A 2HLTA 5IQ6A 1JLFB 4J9LA 1JLCA 1JLEA 3R3TA 2B7CB 1IJFB 2YWHA 4J37A 2XS7A 4OJ3A 5D3GB 4K4YA 3SFGA 4Q43A 2KFZA 1GH8A 4NLSA 2CFXA 1VOMA 1YJNS 1M90T 5J1EA 3KLGB 2P6SA 3FNNA 2OFHX 2D41A 2QA4G 2R4FA 3MM5B 5CYJA 3MOZA 2FTRA 1Y5NB 1GXLA 2WB4A 1RWUA 3M30B 2OPQA 3LO3A 2E7WA 3KKFA 4CO5A 5D6GA 5KFFA 3JSRA 3M6XA 5E3AA 1MNEA 2CPJA 3UD4P 3DRSA 3QWUA 5SZTA 1FE4A 3DXBA 2YKQA 1RGVA 2CPDA 4AL6A 2LCWA 4B9LA 4K0KF 1Q8IA 2DO4A 3SEOA 2FGOA 4KIAA 4NOHA 2J6SA 5CYMB 2EFGA 2XZWA 1UL3A 1YJVA 5EWFA 4KRWA 4PWDB 4ED0A 2RKIB 1N4LA 1KLMA 1FJ7A 3DMJA 3D5MA 3OFGA 1PC4A 3PHEA 4KR0B 1O51A 3AAWB 1ZZNA 2ZOMA 1NH8A 3KWMA 2ASLA 2G4BA 1HBUA 4IOAQ 3LP1A 2ZH8A 1RT6B 4QIFA 1HQEA 3KTQA 3JSMB 2YNFB 1FRIA 1VC5A 2HHUA 2DH9A 3H2VE 1LV5A 2ZD1A 2MQQA 1XNQF 4LSNA 1SH2A 2OJ3A 4M63A 2ROEA 3FEZA 4BWMA 4ALZA 1TK8A 1Q8BA 1UJ5A 3IN5A 1ZPVA 4DJBA 4ED1A 1TFYA 1P6TA 2EC0A 5J2QA 4WF9Q 4DPOA 2QV6A 5D4OA 4KGKA 2LU2A 2HHSA 1IKVB 3GG0A 3CCSS 1M5PC 2YTCA 3TVKA 4HL9A 1VRTA 5E7OB 4ZKAA 2QYCA 4B3TF 4BDPA 2YKMA 3TA2A 1CLFA 2M8HA 3JYTA 5HP1A 4X65F 1SC6A 4WU3A 3DLEB 2HGMA 2VOOA 2IBKA 2UVVA 3IAM9 1SUQA 1FD2A 4EBCA