4RW6B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 111
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B03
1IKWB 3C6UA 4K4VA 3V6KA 4NCGA 1TVRB 1RTDA 2OPQB 4YQWA 4WFYA 5KG3A 5DG7A 3QZ7A 4KO0B 3FSIA 1LWFA 4ICLB 1JLAB 4Q0BB 1ZETA 3LP0B 1QAJA 2YNFB 4J9OA 2R2UA 2WTFA 4IG3B 1TKZB 4IDKA 5KFQA 2FLLA 2WCXA 3DLKA 1DTTA 1NNDA 1S6PA 3C6UB 1N4LA 4ZPBA 3BSNA 2IC3A 1RTDB 3G6VA 2YNHA 3V6DB 4EBEA 3CJ5A 1LWFB 1RT7A 3KHHA 3MR2A 4IOBA 3D28A 3E01A 3V81A 4IR1A 1HPZA 4EBCA 1RT4B 4K4SA 4RW4A 3KK1A 2XCPA 4URQU 3Q8RB 4H54A 3DLKB 4ZMMA 1DTTB 2D3UA 3I5BA 4M95A 1JLFA 1HYSA 1RTJB 2GIQA 4NLQA 2IC3B 2JEIA 3I0RB 4NLGA 1N5YA 2YNHB 4ECYA 4ED3A 3VQSA 2FVPA 1JLQB 3E01B 3V81B 1XR5A 5FDLA 1HPZB 1MU2B 2IJFA 1FKPA 1C0TA 4RW4B 4Y3CA 5DQGA 4RZRA 3KK1B 1ZTTA 4EO8A 2E9TA 4WFZA 2OPRA 3RBDA 3PJXA 3DOKA 1SH3A 1JLFB 1KLMB 4FBTA 4O3OA 2IAJA 5C25A 4JV1A 3V4IA 2ASJA 2R8JA 4JUZA 1OS5A 4ZVFA 2ZD1B 1YVFA 3LP2B 3CWJA 4ED1A 5FDLB 4NZ0A 5HROB 2BQUA 2JLEA 3BREA 3QYYA 4ZP9A 2I5JB 3LP1B 3H5SA 1HMVA 1N6QA 4QWCA 2OPRB 1HNIA 4PQUA 3DOKB 4EYHB 5J1EA 4OL8A 3NAIA 4QWBA 2AQ4A 3V4IB 1S9GB 2XI2A 3NBPA 1S0OA 4NLOA 4RW8B 4R5PB 4KFBA 4NLPA 1RTHA 4RNNA 4F4ZA 2BR0A 5DQHA 4ZVGA 3IRXA 5HP1B 3T5JA 3KLFA 4RUAA 5KG7A 1HNIB 4PQUB 5J1EB 2V4RA 4ECQA 2DPIA 1T03A 1TKXA 1SH0A 1W25A 4ZP7A 3DM2B 2WB4A 3M9OB 1GX6A 3GQCA 3FQKA 1JLBA 2ALZA 3IRXB 4ZHRB 5DG9A 4ZP8A 3T5KA 4I2PA 3KLHA 2JC0A 2B6AA 1T03B 4PWDA 5J2QA 5JUMA 1TKXB 3MR3A 3T5LA 3QGGA 3MTKA 4F4WA 2WOMB 3H59A 4ZVHA 1IKVA 2YKNB 5KFIA 4TYBA 1JLBB 4ED0A 5KFJA 4PUOA 4EO6A 3LAMA 3N6LA 1HQEA 4I2PB 3H4BA 4J9RA 3KLHB 4PWDB 2WONA 3MEGA 2YNIA 1RAJA 4J9PA 3M9NB 3DI6B 1IKVB 1U09A 1RT2A 3DOLA 2IM1A 4IRDA 3CDWA 4NLUA 3M9MB 4PUOB 3EZUA 4HKQA 3FRZA 4RW9A 4J9LA 4G3IA 2ZE2A 1S6QA 1JKHB 4YR3A 2WONB 3MEGB 3UDLA 5F8NA 5KFYA 4JV0A 1XR7A 3DOLB 3QLHB 1MMLA 2FVQA 5KFNA 2AGPA 3PW4A 4RW9B 4KO0A 1J5OA 2JEJA 3CDUA 3GIKA 2ZE2B 3GYNA 1S6QB 2ILYA 3LP0A 3H5YA 3GV5B 2ATLA 1S97A 4KB7A 1TKZA 4I7FA 2WRMA 4LSNA 4K4YA 4ECWA 4DL6A 4K4ZA 1RDRA 3M8QA 1JIHA 4RNMA 3V6JA 2RF2A 2JEGA 4Q8FA 2V9WA 3QGIA 3V6DA 5F8IA 2V4QA 1J5OB 1ZTWA 4HYKA 4ID5A 4Q8EA 3N6NA 1JLGA 3NKYA 2ASLA 1RT4A 2J6TA 4I7FB 2UVWA 2AX1A 4LSNB 2E9ZA 5CYQA 5I42B 4ECXA 3T1AA 3M8QB 4O3RA 1HARA 1RTJA 4J9KA 4NRTA 1T05A 3I0RA 2RF2B 3I0SA 3KLEA 2IM0A 4TY8A 5KG0A 3HVTA 2OPPA 2B43A 2XCAA 1IKXA 3JSMA 1Z4UA 4ID5B 1JLQA 1JLGB 2XWYA 5KFFA 5L1LA 1MU2A 1JLCA 1LWCB 1EETB 3DRPB 1LWEB 3KJVA 5HLFB 1SH2A 3RB6A 3KNAA 2D41A 5J2MA 4B3OA 4U7CA 5CYQB 5HBMA 4XPEA 1KLMA 2BANA 2R8IA 4RNFA 3MEEB 1T05B 4J9NA 4IG0A 3KLEB 1SV5A 3I0SB 3HKWA 4IH5A 4TY8B 2XGPA 3G6YA 4KBIA 2ZD1A 2OPPB 3HVTB 3LP2A 2IBKA 4MIBA 1IKXB 3JSMB 4DL4A 3IS9B 5HROA 1HQUA 3I5CA 3TQ1A 1JLCB 3KJVB 3SFUA 2FLPA 4WZQA 2I5JA 3LP1A 4GC7A 1C0UB 1BQMB 5J2MB 4B3OB 1TQLA 2BRKA 3HVWA 4ZP6A 4ECSA 5HBMB 5I3UA 2BANB 3OSNA 5F8LA 2HNYA 3KHRA 4IG0B 5KFBA 1SV5B 4YR0A 1S9GA 3DMJA 4ED7A 1DTQB 3BSAA 3UPFA 4RW8A 4R5PA 2BRLA 2RKIA 5T14A 1HQUB 2HMIB 3SFGA 3RAXA 5EWEA 2W8KA 3TAMB 4IH7A 4KAIA 5HP1A 3OL7A 2O5DA 3CO9A 2UVVA 2UVUA 5I3UB 2HNYB 3GILA 5KG4A 3DMJB 3MR6A 4IH6A 3BR9A 2VG5A 4WE1A 4KE5A 5KFXA 2FVSA 4R0EA 2C2RA 2RKIB 3SI8A 4NLYA 3QZ8A 3DM2A 2R8KA 5F8GA 4ED8A 5KFDA 3H5UA 3RB4A 4H4MA 5D3GA 4O3PA 5DG8A 4IFVA 4MKAA 3I5AA 4ZHRA 2IJNA 4YMEA 5F8MA 1S1VA 5KFWA 3ISND 3DLEA 5KFLA 4K4UA 4O4GB 3NL0A 3G6XA 2VG5B 4WE1B 4EBDA 4DL3A 2WOMA 4DL7A 4LSLB 3QGHA 3PW0A 3D5MA 4MKBA 5DLGA 2YKNA 4JV2A 5K14A 3MR5A 3BGRA 4O4RA 4H4MB 5D3GB 2FVRA 1LW2A 3QO9B 4IFVB 4YP3A 2DPJA 1S1VB 1K1SA 4WYLA 3DLEB 1VRUA 4KKOA 4IRCA 3KK2A 3OHBA 3Q8SB 5EUHA 3DI6A 5CYMA 1RA6A 4TLRA 3BJYA 5K14B 3PW5A 4IQXA 4O3SA 2R8HA 3BGRB 3NGDA 4J9MA 1QAIA 1KHVA 2GIRA 1LW0B 1LW2B 1RT1A 3MECB 4TXSA 4WXOA 2HNZA 1VRUB 3DRRA 4KKOB 2FJXA 3KK2B 4IFYA 1T94A 1JKHA 4O3NA 2W7OA 5C24A 5J2NA 4J9QA 4MK9A 1S0MA 3IGNA 5CYMB 4FS1A 4ECUA 2C2DA 4LQ3A 5J2PA 1IKYA 2FVCA 3QLHA 3BSCA 4F50A 5EWFA 4F4YA 4EEYA 4U6PA 3RBEA 1RT1B 4MFBA 3PZPA 1FKOA 2HNZB 3DRRB 1REVB 4IFYB 1KHWA 5C24B 5J2NB 4NLTA 3GIIA 2AGQA 4XPCA 2J6SA 2AU0A 2YNGB 2I1RA 3H5XA 5KFUA 1GX5A 4IRKA 5J2PB 1IKYB 5L1KA 2VG7B 3LANA 3CJ0A 2VG6A 2HWIA 1D1UA 3RB3A 4MFBB 5KG6A 1FKOB 4ECZA 1JXLA 2J6UA 1S10A 4KHMA 3H4DA 1K1QA 1RYSA 1RTIB 2D3ZA 1QE1B 1C1BA 4Q43A 4RW7A 1UWBA 3KHGA 1RT6B 2WHOA 3CDEA 3PHEA 3KLIA 4Y2AA 5I42A 4H4OA 3OSPA 3MFHA 2OPSA 4NRUA 1NHUA 4URSA 4RU9A 4O3QA 2VG6B 1S9EA 4ZPCA 2F8EX 2R2TA 5EDWA 1N48A 4KHRA 3BQ1A 4LQ9A 1S1WA 3JYTB 3PJWA 4J9SA 5KFGA 4DG1B 3CIZA 4X2BA 3RAQA 1C1BB 2B5JA 1S0NA 1EETA 1LWCA 3IG1A 3DRPA 1LWEA 3QIPA 1UWBB 4RW7B 5HLFA 1TL1B 3ISNC 4O44A 4ECVA 3C6TA 2UUTA 4ZPDA 3KLIB 5KFRA 3EPGA 4H4OB 3GV7B 4GC6A 2OPSB 4Q45A 5C5JA 3MEEA 1S9EB 1D0EA 5KT6A 2GC8A 1N56A 1RT3A 3BSOA 1S1WB 5KFOA 2AGOA 2HNDA 4G1QA 3FQLA 5KFPA 3IS9A 2XGQA 3KLVA 2B5JB 4FBUA 3IG1B 4MK8A 4K4TA 4DL5A 3QIPB 1S1TA 4O44B 1C0UA 1BQMA 3FFIB 3C6TB 3MEDB 4NLWA 4R8UB 3OLAA 3ITHA 5KFKA 3OLBA 1C1CA 3QIDA 1RT3B 4QW9A 3IGVA 4DEZA 2IM2A 5L9XA 1DTQA 1TP7A 4QWEA 2BQRA 5KFEA 2HNDB 4G1QB 4NLVA 4DL2A 4MIAA 3OHAA 3E51A 2HMIA 2W8LA 4NCGB 3PW7A 3TVKA 4IKAA 1S1TB 3TAMA 1SUQA 4TQRA 3DRSA 3KMQA 2YKMA 3ITHB 1VRTA 4NYZA 4Y2CA 1C1CB 4RW6A 2IA6A 1HNVA 4IDKB 2W9AA 2JC1A 3T19A 5F9NA 1S6PB 4MK7A 2UVRA 3CJ4A 2CJQA 3GV8B 5KFTA 5KFHA 5KFCA 1SUQB 3DRSB 2R2SA 3GIJA 1RYRA 4QW8A 2YKMB 4URGA 3UR0A 4ED2A 1RT7B 2AX0A 1VRTB 2W9CA 3T5HA 3CJ2A 4RW6B 4ECTA 4O4GA 5KFVA 4ZPAA 1S49A 2FLNA 1FK9A 1HNVB 3H2LA 5JXSA 2C28A 3N6MA 2QV6A 2VA3A 4KSEB 4LSLA 1NHVA 5KG5A 1HYSB 4QPXA 1QUVA 1S1UA 1N5YB 4WFXA 3QO9A 2D7SA 3IN5A 1IM4A 5F8JA 5F9LA 2W9CB 5KFZA 2C2EA 3KK3A 1S1XA 5KG1A 1WNEA 2HAIA 1FKPB 1C0TB 1FK9B 3LAKA 5KFAA 3Q8QB 3RB0A 2CKWA 1TKTA 4YR2A 4NLRA 1RA7A 2IAJB 5C25B 4K50A 1S1UB 2RDIA 1LW0A 3MECA 2OH2A 1BQNA 4M94A 5EWGA 1S48A 5KT5A 3BQ2A 3KK3B 1S1XB 4TQSA 3GIMA 5KT3A 1TL3A 4WZMA 1HMVB 1N6QB 2WK4A 1TKTB 5KFSA 3NMAA 2RDJA 4WYWA 5KG2A 3OL6A 5DLFA 2C22A 4TYAA 1JLEA 3NBPB 1BQNB 1EP4A 2QE5A 1TV6A 2HWHA 3KLGA 4KFBB 1REVA 1RTHB 4FS2A 3KHLA 5C42A 5KT7A 2YNGA 3G86A 2ZKUA 1S9FA 1TL3B 3KLFB 3UQSA 4ED6A 3DLGA 2VG7A 4MH8A 4NLSA 5KFMA 3LALA 4XO0A 1I6JA 4WXWA 3DYAA 1JLEB 3MF5A 2XC9A 1EP4B 1TV6B 4EYIB 4RNHA 3KLGB 3M8PA 5DQIA 3PVXA 2E9RX 3KMSA 3Q8PB 1RTIA 2AWZA 3KOAA 3CVKA 1QE1A 3FDSA 4TY9A 2W9BA 2FJVA 5C42B 4K4XA 4ECRA 3V6HA 2VA2A 3HVAA 1RT6A 1CSJA 3DLGB 5F8HA 4TN2A 2B6AB 1C2PA 3DDKA 3DYAB 5J2QB 5L1JA 4NLXA 4RNOA 3JYTA 3NAHA 3M8PB 3MFIA 2XI3A 1XR6A 4DG1A 3CJ3A 3PR5B 1RT5A 3OL8A 2W9BB 1S4FA 4I2QA 1T3NA 5KT4A 3OL9A 1TL1A 1DLOA 2IMWP 4KV8A 3H40A 4K4WA 3PW2A 2IM3A 1HQEB 1R0AA 5KT2A 2W7PA 3H98A 2BQ3A 2UUWA 4IR9A 2YNIB 2JEFA 5L1IA 4QWDA 5DGAA 2BE2A 4ZVEA 1RT2B 1RT5B 1IKWA 2R8GA 4I2QB 4F4XA 1TVRA 4QWAA 2FJWA 2OPQA 4Q44A 1DLOB 3MEDA 3FFIA 2R2RA 3ICLA 4KV8B 4R8UA 4RUCA 3HHKA 1R0AB 4ICLA 1JLAA 4Q0BA 1JX4A 2V0NA 4Y34A 2YNFA 5DGBA 3BQ0A 2ASDA 4IG3A 2EC0A 2BE2B 3EPIA 2ILZA 3PR4A 4NLDA
chains in the Genus database with same CATH superfamily
2KL8A 2AV5A 3WIUA 4F4AA 4DWIA 2HHUA 4IDKA 1NNDA 3RG6A 2LFVA 3D28A 4G1IA 2XMWA 1UVLA 3I4HX 2UUAF 3OT9A 4DBQA 1GMVA 4CRJA 1TL4A 2O1PA 2BZ2A 1KLMB 4O3OA 3V4IA 1HBMB 3EJMA 2LA4A 1X4BA 5J1EA 4OL8A 3NAIA 3V4IB 1FNXH 4MYTA 5I3QA 1UA1A 4NCBA 2V8HA 3SV3A 2JDJA 5KG7A 5J1EB 3NS7B 1O8BA 2M52A 2UXCJ 2K7KA 5JVHQ 3R8YA 4BBYA 4ZHRB 2HQGA 1FRXA 1VR6A 3FMWA 5J2QA 3FEYB 4KH1B 3PX0A 4DXLA 4FNHA 4ETXA 2HSEB 1XWLA 3O5TB 1NPRA 3CJTA 2HHVA 3VAIA 3DOMA 1RT2A 4IRDA 2CDRB 4UOHA 3HFKA 1Q5YA 1VGYA 4JV0A 3DOMB 1S76D 1VBZA 2NQPA 3H5YA 1BE4A 4OZ1A 2L9NA 1UFKA 3I87A 2F4VJ 3CCQS 4Q8EA 3N6NA 2I6WA 2UV8A 4ITSA 2DHHA 2XZDB 2AX1A 4P10A 1HARA 1FWKA 3SSSA 3I0SA 3GCXP 1WDDA 2CNNB 5B0CA 1LWEB 4PCQA 3I0SB 1U0SA 4P2XA 3R6LB 4MIBA 4GC7A 3I9ZA 3K7RA 4ZP6A 4CLUA 1NK7A 1NJYA 1DTQB 3SFGA 2LU2A 5HP1A 4GVBA 4F3MA 3AQPA 1YJNS 5KFXA 1D8YA 4CLSA 3BYRA 2MY8A 4C8NA 4PG4A 5DG8A 1CJTA 2VC1A 4GVBB 3R5CA 4DL7A 4OX8A 2DHAA 2QEXS 1CJTB 4B3SF 2X3DA 2MDAA 4QU7A 4AFFA 2QX0A 3SQOP 1LWXA 3TVZA 3NGTA 3PACA 4F2RA 2ZBIA 2GJ2A 4FYWB 5C24A 4MK9A 1AZSA 1X5OA 1XNRJ 3C8YA 2V2ZA 5C24B 1AZSB 4DR5F 3H5XA 1FKAF 2CQ0A 4ECZA 1IBLJ 1K1QA 4A8FA 3SCIE 1PJ7A 2Q3PA 1RT6B 3N0VA 3QRPA 1S1WA 4GRSA 3LGNA 3AXKA 4DG1B 3IG1A 1ZOTA 3O44A 5C5JA 1S1WB 4AUKA 3IG1B 2HG4A 3MEDB 1CJKA 4K0KF 2VICA 4MIAA 4NCGB 3TAMA 3DRSA 3NCPA 3MGJA 5CABA 2PSZA 2RHSB 1X5PA 3TA0A 1WEYA 2RDDA 4CO1A 1S6PB 3DRSB 4I1TA 5GADU 4X4TA 2E5LF 2R7TA 3S6EA 1NK4A 5JXSA 4PG8A 3RRHA 4CM2A 4HEA9 1PO6A 2XBPA 1JQGA 4DU8A 3N01A 2IAJB 5C25B 2QA4G 3GIRA 1N33J 2QYGA 2GS8A 5KT3A 2EK1A 4DZDA 1PILA 4RKUC 5KG2A 2UUCJ 1TV6A 1L3VA 3HHDA 1REVA 5CXTA 3T1YF 4OI0A 4XO0A 2MZSA 1CULA 1TV6B 4EYIB 3PYFA 3M05A 1VQ4S 1NU4A 2DRBA 3R5AA 1HNWF 2D1CA 1CULB 3QT5A 3TI0A 1S4FA 1UJ6A 1HQEB 2W7PA 2UUWA 4M5GA 4C0OC 1SKRA 4PPZA 4PKDB 3AODA 4B3MF 4U7UD 2HFOA 3T6JA 3Q83A 4DV2F 2GO8A 2RUGA 4WFNQ 4HTIA 2WCXA 2DEJA 2GV1A 2W2OP 3V6DB 1RQ0A 4X65J 3Q8VA 4IOBA 4YB5A 4MIWA 2FQQB 4F0KA 3VGVA 3ZTQA 4YHHF 3W2VA 2PO4A 4ED3A 1CJVB 1N5SA 1S5ZA 4CT8A 4QIVA 3PCOB 1CJUA 1GQEA 2G2ZA 1KFDA 1N6QA 3OTOJ 2LA6A 2YQ3A 9RUBA 4KGXB 2A3JA 2F5GA 2RH3A 4ECQA 1TKXA 3CGIA 1D9AA 1KOHA 1NAQA 4J9VA 4I67A 1NEEA 1DURA 1H98A 1T3OA 1SCJB 3ZTOA 1VK8A 4Q2MA 2VODA 1K47A 1TKXB 4FDFA 4ZPWR 1BC6A 4PUOA 2H48B 4JI5F 1IR1A 5L46A 4ID8A 2YNIA 3M9NB 4YDXA 2GMLA 3POTA 3M9MB 4PUOB 1GH8A 5HQMA 4X4UA 4OX7A 4UOGA 2CXEA 4M5MA 3POTB 3AOBA 4HHUA 2J8SA 1RABB 4KYZA 2OFHX 3VAMA 2ATLA 4OX9J 4ECWA 3HP6A 3O6QA 1RDRA 4DR4F 2NYHA 1RWUA 4DX8H 3VR1A 1T11A 4AXJA 4F36A 4C7QA 2E9ZA 1X7VA 3RRGA 3LTOA 3JSMA 4P73A 4LF8J 2QFIA 5L1LA 3DRPB 4P2MA 1LKZA 1W2IA 3D7SB 3PYGA 1SV5A 1FE0A 2L9WA 3JSMB 2DCLA 1ZZNA 2VASA 1NK8A 3SDEA 5E3QA 1SV5B 1S9GA 4WU2A 4QIGA 4R5PA 4QIFA 3MUMP 3SDEB 4ZKAA 2QA1A 2ZH8A 2J76E 2V69A 3B8HA 3R2CJ 2IFXA 3SI8A 4OI3A 3QZ8A 1LQ9A 2CJAA 3H5UA 4RUBA 3HT3A 1L3SA 1RCXB 2Z2ZA 3MAAA 3NL0A 4YY3F 3N79A 3HZGA 3BGRA 2C2KB 4ZCKA 3MAAB 2E5JA 2YXLA 4OV1A 2W24A 1MROA 5I3PA 2FZCB 3GFXA 3VZHA 1T9VA 3BGRB 4P6QA 4QYZJ 3G8TA 3M32A 4IFYA 2J0SD 2NXUA 1MROB 1NUEA 4FS1A 4FXDA 4MAKA 3RBEA 4MFBA 2B0GA 3MCSA 2VC0A 4IFYB 1UEVA 5JMNA 4IRKA 2Y1LB 3RRKA 4MFBB 2ZNYA 4KHMA 3U7JA 5KOWA 3H4DA 4LF4J 1PSDA 2PFDA 4X4SA 1GEHA 2CZ9A 5I42A 4CP5A 5EDWA 1UCNA 1YKWA 2MKYA 1YJ7A 3MWBA 2VQEJ 2D74B 2RQCA 3AA9A 4Y2MA 3TA2A 2UXDJ 4NLWA 1UVNA 2MQMA 3QIDA 4OJGA 2F63A 2AYMA 4IKAA 1RKJA 1XMQF 3KMQA 1P9QC 1T9UA 2YQ0A 2JC1A 3KFWX 1NK9A 1JMTA 4ZLPA 1CC8A 3ETOA 2K1RA 3T5HA 4C3KA 3JSRA 2K2PA 4LSLA 4LF6J 1OPZA 3KJNB 3W9JA 2DVIA 3I56S 1VK3A 5GMEA 2BBEA 3BGUA 3W2WA 1F5CA 4KH0B 1RHUB 4C0BA 2XHCA 3M2UA 1EJ7L 5FLXY 3W2WB 1G4CA 3MD3A 3LA0A 3HKZD 3M2UB 4NI2A 1BLUA 3G86A 5ETSA 2GGPA 2CQ4A 2V8VA 1IQZA 4DF8A 4NI2B 3FDSA 4B3TF 3PX6A 2GGPB 2XZTB 2HZCA 1LV5A 3TUJC 3IM8A 1RT5A 1PKUA 1ZAVA 2IMWP 2BM1A 2YX4A 3Q8UA 1UVKA 3K59A 4ZVEA 1RT5B 3J81U 1WDTA 2Y1IA 3TO8A 2K06A 3EPIA 3GSDA 4K4VA 2MYFA 3MCMA 2HYIB 2KDOA 2QG9B 4WFYA 3QZ7A 4UOFA 1X4FA 4DV1J 3K57A 3MR2A 4JI7J 2COLA 2XWXA 1EAYC 1S79A 1WEZA 3CW2C 1F60B 4L3NA 2KXFA 4C2MA 2PMZD 1I94J 3MAQA 2M0GB 4FVMA 2XTJP 3MHYA 4LFCJ 3RBDA 2A6OA 3QMQA 5IM0B 2MZTA 2EFGA 4ZIVA 3QYYA 3KJFB 4PQUA 2UXCF 5J1NA 4E0DA 2XLKA 3EX7B 2ZBRA 4PQUB 5SUHA 2DPIA 3N5FA 2MHEA 2PN6A 2DNMA 2ZH9A 2B9EA 3M9OB 4IO1A 5ETVA 3M8YA 4V19J 3BKFA 2HFNA 3MTKA 4DR3F 1KVJA 3K5NA 3ZTRA 3IBFB 4EO6A 1YDLA 5B0AA 1NPKA 3MEGA 4DSKA 4K2XA 4YB6A 2DO0A 1JXEA 1BD6A 2KHCA 1JKHB 3MEGB 3UDLA 5DDOC 1JK9B 2A2CA 2F4VF 2FVQA 4DFPA 3GTYX 3P4UB 4A8OA 3GIKA 3GYNA 2R7SA 2ZBPA 4P72A 3BH6B 4U8YA 2HFSA 3ETMA 4CO0A 4CT9A 1ZPWX 1RT4A 2LECA 3MM5B 4CH0S 3T1AA 1T7PA 3GP9A 3KLEA 1FHTA 3HVTA 4NYPA 1JLQA 1SH2A 3ZXWA 4U7CA 3KLEB 4IRCA 4B9UA 4FYVB 5HMYA 3HVTB 3L4BC 5F3ZA 1DY3A 4DL4A 1MMDA 2KJVA 1HNZF 3EUNA 4IUFA 2OELA 1S99A 3H2UB 3G8QA 1HL6A 4E98A 4M5HA 4DUYJ 3RW6A 1AT1B 2HAFA 2YPZA 2M3DA 3CDBA 2BKOA 3RB4A 1F9HA 4CLTA 4PXDA 2H9ZA 4KPCA 3PW0A 4BLGA 2FVRA 1X0FA 3QO9B 1VQ5S 1FVQA 3W1YC 3R27A 1VBYA 1QAIA 2LQ8A 2HNZA 2ZWOA 2R7UA 1HR0J 5CCLA 1IBLF 1NKCA 2HNZB 1Q53A 4OJHA 4AXIA 4BHQA 3LANA 4N56A 4X4PA 2EWHA 4B08A 4J7CA 3PRDA 1C1BA 1RWVB 1UWBA 2R7VA 4G6VB 2CFXA 3L3CA 2F8EX 4N8NA 1Q86T 4JI3F 1X4DA 1CPZA 3JAMY 4X2BA 1C1BB 1UWBB 3PO4A 1ZA1B 4ZPDA 5ETNA 2DXEA 2DJWA 3TRGA 1RT3A 4LRAA 4X66J 3FBCA 1RADB 4R8UB 5ITHA 1RT3B 1TP7A 3E51A 3UD5A 3TVKA 2VKRA 1U25A 5JVGQ 2KKHA 4AL6A 5BYSA 3MM9B 2HBQB 2R2SA 4WTYA 2MZJA 3L09A 4D3HA 3UR0A 2XY7A 4HI1A 4TU9A 2BKPA 4ECTA 4L74A 4ZPAA 1S49A 1LXJA 3D0IE 1E6YA 2MB0B 3AH6A 2NR0A 4USIA 2L41A 1G7CB 1N5YB 2DT9A 1IM4A 3R5GA 5F8JA 2NXCA 1QY7A 5F9LA 4WF9Q 2UUCF 1E6YB 4N7TA 1NM2A 4NLRA 1KLNA 4WKYA 2DR6A 4C8KA 4FPIA 1URRA 4QR0A 4GKJF 3UN3A 2L48A 4OZJA 3KJQB 2JLFA 1UJ4A 5KT7A 4Z2XA 4U9RA 2VFTA 5KFMA 5D77A 1F1BB 3FZBA 3Q8PB 1VISA 2W9BA 4K4XA 1FNMA 3OBIA 1YBAA 3KKFA 4TN2A 3Q2TC 3D9BA 3W64A 5HATA 4PYDA 4W98A 2W9BB 2MKSA 2O66A 2N3OA 4LVNP 5L1IA 1R8PA 2OD6A 4CTAB 1U24A 5IZHA 2ASDA 3A1YG 5IXUA 4X65F 3C6UA 1V5VA 4CLYA 4OIXA 2ZBCA 1LWFA 4ZVRB 2YX1A 1KFSA 2YPYA 5KFQA 4BC9A 5LSOA 4ELUA 2F7VA 3C6UB 2FC9A 3SXLA 1LWFB 1RT7A 3E01A 2OKQA 4YFUA 5ETTA 2XCPA 3RTVA 2MSTA 3BBCA 4USUA 1NLKL 2K8GA 3E01B 2MQ8A 1M1HA 2M8HA 3OTOF 1FKPA 4RZRA 2R42A 1YLXA 1SH3A 2VQFJ 2QTWA 1UEUA 1HMVA 1BXNA 3FZ2A 1AUDA 3L95X 4DV6J 4RNNA 2ZH6A 3QSIA 4HHJA 3PRVA 2WW4A 3W8PA 1M5OC 4E2FB 1MNEA 4I2PA 4PWDA 3TWZA 2BX6A 1WOOA 3PEJA 2KFNA 4I2PB 4PWDB 4DPXA 4KRWA 2OTLS 5IQQA 3ZC4A 2B9XA 4OX9F 3LUYA 3MDFA 1NB7A 4IQMA 2JSXA 4JI0J 1PC5A 1KS2A 4KO0A 2JEJA 1S97A 1CVJA 1K44A 4LF8F 2V9WA 2HGLA 4HYKA 4OHVA 3J80U 2ASLA 4WK1A 5K9FA 2UVWA 1V6HA 1IWAA 2BJ9A 4UUXA 3HD1A 1EETB 5J2MA 1LFPA 4TU8A 2JRSA 4GVLA 3OW2R 3JS9A 1HIYA 4QCLA 3TQ1A 3JQKA 3SFUA 3FCHA 5J2MB 4ECSA 3EVMA 1XK8A 2HNYA 2CG8A 2MZQA 4L6V3 2BRLA 4F04B 2RKIA 1WG5A 2MY7A 2U2FA 3HJFA 1WKKA 2HNYB 4PWWA 2BMBA 3MR6A 2RKIB 3NXZA 4IFVA 5F8MA 3VAGA 5DETA 3UR3C 1VQ8S 1J5EJ 4HACB 1YJVA 2EFNA 2I0XA 4MKBA 2YKNA 4IFVB 1K1SA 1QSYA 1UJ5A 1WI6A 2H5EA 1GXLA 4XDDA 3TANA 2DGUA 3MPVA 4NX9A 2CG4A 3WIVA 2AW0A 2BOPA 4LF4F 1SJQA 3CCLS 1EQMA 3MMCB 1SC4B 3PKMA 3TNVA 5LJ5Y 1OQ6A 3RB3A 2VG6A 2CQHA 4AQYJ 2CRLA 2HHSA 2LU1A 2VQEF 3CXCR 4OYIA 3BO2A 2CQPA 5D0HA 1RE1B 4M63A 2VG6B 1S9EA 1N48A 1GFWB 2JFKA 5G0RA 3QT8A 2HHHJ 5HMWA 2B7BB 4Q45A 1D0EA 1S9EB 1WC4A 3ZNUA 2HNDA 4HL9A 1X5TA 2VIHA 2E1AA 3TEGA 2HW3A 2DNZA 2HKEA 3PG9A 4LF9J 2HNDB 1P9YA 3K8WA 2HMIA 1BWVA 4TQRA 1NSKL 3P49B 4R0JA 2AJ0A 3UD3P 4LF6F 2R7QA 4MK7A 2UVRA 1X60A 4NA3A 3VCDA 3J7A1 3IN5A 4L76A 3W9HA 1U6FA 1FERA 2C2EA 1IM6A 4YR2A 2RNEA 2G2YA 5L9NA 1NMEB 3MZIA 1UVIA 4Q5VA 1FF2A 3NMAA 3OL6A 2C22A 2FY8A 1P1TA 2VHGA 3TAPA 2DO4A 1Q8LA 1NK5A 1L3TA 2LDIA 1I6JA 4WXWA 3UCZP 3M8PA 4DJBA 1FEEA 2AEJA 1QE1A 5B0FA 2FJVA 4P2SA 2M4MA 2RHQB 3CDAA 2OUGA 2B6AB 3MM6B 4NLXA 4WP8A 1YRTA 3M8PB 4A8SA 1RISA 1FI4A 1NDLA 3NS5A 3PW2A 2X1BA 3DN9A 2AJ2A 2VBYA 1TAQA 1IKWA 2UUBJ 1TR0A 4F4XA 1TVRA 4DV1F 4OV6A 1HQ2A 1HBNA 3SIPB 5HMZA 2D3OR 5DGBA 1HD0A 2KTQA 1JXLA 4ZK7M 1IKWB 2CQ2A 1TVRB 4JI7F 5DM7Q 2P5VA 2OGUA 1HBNB 3LP0B 2R2UA 1NKEA 3EYZA 4ZPBA 2V8PA 2IC3A 1JJHA 2R7RA 4LFCF 1NSAA 3BBBA 3EXYA 3EE3A 1DZ5A 1RTJB 2IC3B 3I0RB 2ALYB 4QYRA 2OI2A 3IR6B 3GR0A 4DFKA 2FVPA 1YI2S 1XR5A 2VFRA 4V19X 4OZLA 3W3SA 5HROB 4DX5A 2FYXA 2JFDA 3L7OA 2AQ4A 1S0OA 4NLOA 3BB5A 2BE9B 3QRRA 1VQMS 3KLFA 3Q89A 2V4RA 3NG8A 1N0VC 1Y7PA 4I6WA 3MMBA 1Y0HA 2JC0A 4QU6A 1N5TA 1RXOB 1YJ9S 4ED0A 3MOJB 5A8RA 3MMBB 3H4BA 3CJKA 3VWSA 2WONA 3Q86A 2CZ4A 4C3MA 1U09A 3OTCA 2A2DA 2ATCB 4HKQA 5A8RB 4G3IA 2WONB 2XEXA 5EGYA 2KVIA 5KFYA 5A0YA 2ADCA 1HHTP 3PX4A 1U0HB 4WCEQ 3EICA 2IIHA 3W5YA 1J5OA 4DCPB 1FRMA 3RZAA 3ENAA 4UY8T 2OEKA 5A0YB 2ZJPQ 2IDLA 3LH2S 4LBPA 1FJCA 5F8IA 1J5OB 4ZIWA 1HI1A 3HX9A 1IR2A 4WFBQ 5G4DA 2IM0A 3CJ8A 3KJVA 1FDBA 5BJRA 3MEEB 3HKWA 1S57A 3KJVB 3LP1A 1ULRA 4U96A 3JXOA 2XYPB 4DUYF 2QRRA 4JOUA 3BSAA 1S7HA 3OL7A 1FT8A 2Y8YA 5KG4A 3D0HE 2C2RA 1WEXA 1EQ0A 2VPYB 1PG5B 3EZ5A 1SL2A 2OP5A 5K14A 4DV0J 4OMFG 3FEZA 1HR0F 2LEAA 3KK2A 2IMOA 1VQLS 2X1AA 5K14B 4FZVA 1LEOA 5HANA 3KDNA 1VJQA 5IV3A 3QT6A 3KK2B 2CPHA 2KZMA 3AY0A 1T95A 3TAQA 4HH0A 4ZOSA 4KTQA 4XPCA 1TK0A 1ZAWA 4C3LA 5AE1A 5I4MA 4A48A 2J6UA 1RYSA 3UO0A 3DLBA 2KHDA 4X62J 1U1OA 4BDPA 4X66F 2RSQA 5KFGA 3T9NA 1SIZA 5HLFA 1FRJA 3HHLC 5KFRA 4EU0A 4C6AA 3BSOA 4M8LA 4MTPA 2DGXA 2CNOB 1AUSL 2H65B 3GE9A 2NXJA 1JJCB 4RWXA 4C11A 2ZHOA 2I9SA 2Y8WA 2HBRB 4USJC 4C11B 3EMTA 1FFSB 4HT7A 2NPIA 2AX0A 1XERA 1WD6A 4I0WA 3CE8A 2QV6A 1YJRA 1YIJS 4FN5A 3LQVA 1YJTA 2HAIA 1UZHA 3J81Y 2PD1A 4ZDNA 3ZZUA 4DSIA 4ZA1A 1RLDA 3SV4A 1DAXA 3R1HA 3W61A 3M6XA 1JLEA 3NBPB 1VQPS 1QUPA 1FNOA 3CCVS 2W2NP 4DPYA 2CPDA 1JLEB 1HLWA 4LR7A 4UT4A 4QPTA 5D15A 3NWGA 1KVKA 2A1BA 3CC2S 1HHSA 2OSRA 1TL1A 3W5ZA 4K4WA 4RL1A 3T9ZA 3J7Z5 2R8GA 1Q95G 2EEYA 2RT3A 4BC7A 1NH8A 3BV8A 2FHMA 2DNRA 4EZ9A 1BGXT 2YKOA 2AMCB 4ILLA 3ZZZA 2WTFA 4JI1J 4ZVQB 3ULHA 2BYCA 2Y1JA 2FHKA 3LOUA 5D4NA 3V81A 4NWBA 5DZ7A 3IBWA 3IP0A 3UD4P 3Q8RB 1VC5A 3HHLA 4H54A 2D3UA 2VQFF 3BR8A 2ZJRQ 2D3O1 4DV7J 3V81B 5FDLA 1OWXA 5DQGA 3HHLB 4DV6F 4JI2J 2LMIA 2R8JA 4ZVFA 2ZD1B 1TK5A 2Q6CA 3CD5A 5FDLB 2GIFA 3NGKA 2JLEA 2KG1A 2MMYA 1JXVA 1X4EA 1K0TA 3I32A 2GQQA 4UQTA 4RUAA 2JVOA 1ROFA 2LQBA 1R3NA 3DM2B 4UF4A 1U8WA 3VGTA 1MWQA 2MSSA 3M30A 4R25A 5L8RC 1AA1B 4XTTA 2F8MA 3M30B 4JI0F 3B4MA 5U47A 4DUTA 3R3TA 1S6QA 2JX2A 3GYXB 3O1LA 6AT1B 4LF2A 5ETMA 3QPIA 1YZ7A 3FGVA 1S6QB 2NXNA 3ZTSA 4BWMA 3GV5B 4KB7A 3IWXA 4OFZA 4LSNA 3AOAA 2CPJA 3MR7A 2DB1A 5IC4B 2HGMA 3NKYA 2QLBB 2J6TA 4CDIA 4A46A 1G3OA 4LSNB 1F0XA 4QIEA 4NRTA 4U7UK 1YRUA 2ZITA 1Z4UA 1LWCB 3JSBA 4Z7YA 3VV2B 3NMRA 2BANA 3BGOP 4ZVOB 4FF2A 3LP2A 1U1LA 2W2MP 2WVCA 3QWUA 1PYSB 4DPWA 2BANB 3KHRA 5DDRC 1WACA 3IWNC 3EGVA 2W8KA 1J5EF 3ZO7A 1DQ9A 4RBUA 3BR9A 5B0EA 2BJ3A 3HPOA 2VF3A 5KFDA 2JHEA 2RILA 3ISND 3K2YA 5GMKa 2V63A 4O23A 4QR1A 2WOMA 5DLGA 2MGZB 3OV7A 2J9CA 1F3FA 2HQIA 3M2RB 2LVWA 4O3SA 5EN1A 1KHVA 5IWAJ 2QLXA 4OLOA 4J9QA 4O3NA 1VI7A 2MKKA 2MJUA 1R8CA 3IGNA 3OQ2A 2BJEA 1KQFB 4AQYF 3B6BA 3PDNA 3C14A 4F3QA 1KVIA 4NLTA 1OY6A 2YNGB 1VIOA 1K8AT 5GMDA 5L1KA 3SSRA 1H73A 2HGNA 3T1YJ 2HHHF 4OYWA 1RTIB 4QIWD 4ES3A 5MAOA 2YBVA 2ZZNA 3MFHA 4DV3J 2M2BA 1VQOS 5HI7A 4LF9F 3SQGB 1XC9A 5CQGA 1FXLA 3OXGA 3OVAA 2K3IA 1C0UA 2ZH1A 5GAHU 5KFKA 3FUYA 2BQRA 4D3GA 3BO3A 2AF6A 2HLUA 4JP8A 3OXLA 2E5HA 3BZQA 5B7WA 2ZH2A 3C3LA 2BKNA 4N77A 3T19A 4DHVA 1YITS 4HDHA 2QO3A 5F0UA 3FBBA 1NPPA 2W9CA 4Y65A 3VVTA 3J7ZT 3VGUA 1HYSB 2NS1B 1N54B 7FD1A 2ZVSA 1EB0A 2W9CB 2X1FA 2ZUGA 3A3OB 4CNZA 3LAKA 2XSJB 4A8YA 3ZZPA 4OLPA 1R8AA 1S0VA 1F9FA 1JNZB 5K5MA 2HVEA 2POKA 4KT0C 4TYAA 1OQ3A 3KHLA 2G1HA 3TR5A 3UQSA 4CI0B 2QL5B 2KYXA 1BUXA 2ZH7A 2BOAA 3KMSA 1QTMA 4TY9A 3ISZA 2R7WA 2F1FA 2B51A 2UUBF 2DNHA 2V50A 3K89A 4KJIA 3ET6A 4FF3A 4RLEA 4JYAJ 2LQJA 4ZJOA 4FKYA 4ICLA 1YGYA 4A8QA 3BQ0A 4MMOA 5K8NA 4ICLB 2V94A 2HQDA 3PRBA 1EKSA 2JNJA 1U1QA 3CJ5A 2DGQA 3KHHA 5B0GA 4F8RA 4NMLA 3RUBL 1TUWA 4URQU 2AYEA 1GMWD 3D68A 4NLQA 2JEIA 4JBCA 3VQSA 3UVJB 1RUSA 5AXKA 1MU2B 4Y3CA 4WFZA 4FBTA 2HHXA 3CCRS 3ILLA 4HI2A 2H5IB 2DNOA 2GFFA 4QWCA 3UE2A 2QA2A 1FJGJ 4LBHA 2KT2A 2LDYA 3M7VA 4DV5J 3VF0B 3LO3A 4KFBA 5DQHA 4ZVGA 5BXIA 4OI2A 1HWJA 3W60A 2H4YB 2ZNZA 3Q0AA 2XS7A 2ROEA 1MMNA 3J80Y 2F9DA 3D2WA 2QL9B 2ALZA 3CO0P 1TFWA 1FX4A 2W4DA 3TZWA 2QC3A 3MR3A 3T5LA 3RBZA 5SZTA 5E5NA 3S8SA 2OD4A 4CWBA 3DXBA 3HZEA 3DI6B 2IM1A 2KM8C 3FRZA 2CWKA 4OHWA 3QLHB 5LXRA 5F41A 7AT1B 5KFNA 5B0BA 3L9ZA 3PW4A 4CLPA 2HLTA 3CDUA 1RU1A 4Q2LA 1TKZA 3R5DA 2RF2A 2JEGA 1TL7B 5HQLA 1NDKA 1PAUB 1X9SA 2MQNA 3THPA 2RF2B 2XHWA 2OPPA 4OYMA 5AXMA 2WSCC 4P7VA 4ER8A 4J5OA 1P27B 1HA1A 2DHSA 1IBKJ 1UW9A 2OPPB 3IS9B 3I5CA 1SJ3P 1RAAB 3P8BB 3HVWA 3FSXA 3QRQA 5F8LA 2F40A 2P2CB 3DMJA 1SC1B 1S7IA 4RW8A 2AEFA 2CPIA 5EWEA 5ETKA 4KAIA 1R0BG 3GILA 2BV3A 3J7AN 2M8DB 2V5HG 3DMJB 5IT9U 4DV0F 7FDRA 1NCLA 2R8KA 1MLAA 3MOZA 1B7FA 2HWTA 1YJUA 1WG1A 4XIUA 3TJ9A 2CZVC 3CNQP 3NOCA 2R8HA 4M1KA 4ZLNA 3NGDA 1K9MT 4DPTA 2CPZA 1T94A 3GONA 3FNNA 2QJ3A 4RUHA 5J2PA 1X4AA 4F4YA 1N34J 3ONQA 4X62F 2M5YA 2E5GA 5KFUA 5J2PB 1HWKA 2RAQA 1GAOA 3KTQA 3Q2SC 1W26A 1Q8KA 4LF7J 3DLLQ 4W92B 3EVWA 1N32F 1RBOB 3JYTB 2EFOA 3PJWA 2LEBA 2B5JA 1M5VC 4ECVA 2UUTA 5LL6d 5HMXA 2HK3A 4G1QA 3C19A 2B5JB 3GJSB 4K4TA 3FFIB 2KM8B 3BDEA 5CAAA 1XMOJ 2GVDB 4G1QB 1WC6A 1IBMJ 2GAGC 1GNKA 2YKAA 3NNHA 1HNVA 4IDKB 1H0HB 5KFHA 2LXUA 1KD1T 2FJEB 2FC8A 4CLLA 4LBIA 5KFVA 1HNVB 1MW7A 1NO8A 4QPXA 2N7YA 4WFXA 1S1XA 3ILOA 4DR7J 2WZ1A 2HFZA 4ES1A 3RR8A 4ELVA 1S1XB 2PEBA 1H2TZ 2WBRA 2WK4A 5KFSA 1RAIB 1UVJA 1HBOA 2QE5A 3A13A 5H9EK 1VJWA 4RWWA 5GAHI 5THWA 2VG7A 2J7WA 1HBOB 2RS8A 4YUDA 2AJ4A 3KOAA 5J2QB 2A6MA 1XR6A 4M5DA 4Z37A 4DR3J 4EZ6A 1DLOA 1QJHA 2JVRA 4DFMA 3H98A 1R7IA 3BF4A 4OZ3A 4M5JA 1IVZA 1RT2B 3CCUS 4M5DB 4KQZA 3OVSA 1DLOB 4EI2A 1Y3KA 4JI1F 3CSKA 5B08A 3W65A 5DRKA 1XN9A 2KRBA 1CQNA 2G2OA 5KG3A 3FSIA 4QQBA 1JWWA 3GJTB 4ENOA 3R97A 2ZM6J 2GAHC 1DTTA 3AHPA 5H1SV 4DV7F 3QSYB 4JI2F 4RW4A 2G0JA 1DTTB 3F0NA 2QSWA 1NRKA 1C0TA 4RW4B 3F44A 3M4XA 4ZCMA 4AL7A 3GYGA 2RU9A 1JB0C 1HNZJ 4ZVPB 4QZVB 4ZN3A 2DGTA 4BCAA 1OYEA 3JQJA 5HP1B 1ACMB 2MQLA 1ZYQA 4OYXA 5D6GA 3PIPQ 1T8EA 3QBCA 1DQ8A 4ZP8A 4L3KA 1OIAA 2D9OA 1NZAA 3H59A 1ITPA 3NP5A 1SB6A 2UU9J 4BWJA 3R6GB 4GO7X 3UFCX 4PXEA 3VAJA 4N76A 4DX7A 4WWSA 4RW9A 2ZHAA 2KH9A 2JWNA 4RW9B 2YWFA 4WIIA 2XMAA 2XO7A 4F2SA 1VCTA 4DL6A 1H2VZ 3R7SB 2V4QA 1Y5NB 4YOEA 4AT1B 2ROPA 2DGOA 2ZH4A 4JI3J 1KOOA 1RAGB 1X9WA 1N0UA 4CLZA 2DR9A 2M9KA 1FJ7A 2JLGA 3OUYA 3CCES 1GK8A 1V3SA 4DN9A 3OSNA 1X4HA 1CJKB 3VAHA 5IOLA 3OUYB 1ZPVA 2LLZA 1UEKA 3TAMB 3CCTA 3AA8A 4LRBA 1Q7LB 1L5UA 1SIWB 3I31A 4WE1A 4WBFA 2FVSA 2OLWA 4QR2A 4R0EA 3ZZRA 3GG0A 2I38A 1U8SA 1Y10A 2J0QD 3G9CA 4WE1B 5IWAF 2DPJA 1Y5LB 1ZS6A 4DN0A 3U1NA 1TUVA 3D6TB 4TXSA 3MMAA 1M0SA 2C2ZB 2OHDA 1OYDA 1Q5VA 5DM6Q 3P96A 2DKOB 4ECUA 4TVAB 3BSCA 4GKJJ 2FUG9 1U6ZA 1Y11A 1REVB 3FSYA 1KHWA 4B9LA 4NASA 1PGZA 4DV3F 3NOGA 1D1UA 2B3TB 1SC3B 3RAMA 2D3ZA 4RW7A 1NHUA 4ZPCA 2A0FB 2EKNA 1NK0A 4DR6J 3UCGA 4RW7B 4NCAA 4MKYA 2IRYA 3C6TA 3K17A 1R27B 5D0RA 2XQCA 1CS4A 4FBUA 4JB8B 1DHMA 1BQMA 3C6TB 5FJ4A 1EX8A 3H90A 4CLFA 3IGVA 1Y3JA 4NLVA 2J9DE 3OTEA 1CS4B 3EGNA 2W1BA 5LT5A 3AQOA 4Y0FA 3LGMA 4TNOA 1FRLA 2CJQA 4F4KA 4UOCA 4ED2A 1G6BA 4C0HA 5LMNJ 3W2VB 4C4WA 4DL0C 1WSRA 3HDSA 5KG1A 3TOQA 3D6FB 3FBFA 3TYTA 2CKWA 1NZ8A 1XBWA 2FIUA 2MQQA 1CJUB 2KJWA 5KT5A 2VFUA 1N6QB 4RJVA 3QFHA 2I2YA 1WHVA 1T02A 2AZ1A 1S9FA 1WHYA 2CNKB 3R5BA 3G71S 3V5RA 3PM9A 4NLSA 1U4BA 4FPRA 1WC5A 2XULA 3M6UA 2MLZA 3PFOA 3HVAA 1X4GA 2AD9A 4G65A 2R9LA 4UQGA 2QGFB 4RNOA 5E0OA 1YBUA 4JYAF 3PR5B 3CJ3A 3OL8A 3GCWP 4EMDA 1AXQA 3G8SA 2YNIB 2GZOA 2JZ5A 4HDGA 2GW8A 2AJ1A 1JLAA 1JX4A 2V0NA 2GO9A 1Y00A 3BBFA 4J9PA 1URNA 3SYZA 3EGWB 5DG7A 4KY3A 4DLEA 1JLAB 1QAJA 4PG5A 3CMAS 2RUSA 2OMOA 4EBEA 2P6SA 2V2QA 4IR1A 4ZMMA 4M95A 4OI1A 3AD9C 4ANDA 3RGIA 1FJGF 4DLGA 4LIRA 2GJFA 4F67A 1W2BR 3HI9A 4DV5F 4FYYB 4OX6A 3PO5A 1Q4RA 4FNIA 5GAEU 4B17A 1HNIA 3BN4A 4A8WA 2MZ1A 1S9GB 4R5PB 4NLPA 4BS2A 2DNKA 1N52B 4EFAC 4C8LA 1HNIB 2ZEJA 1HW9A 2XLJA 4OYBA 1S59A 2WB4A 1GX6A 3FQKA 2CVEA 4CYUA 3T5KA 1Y9OA 3PIOQ 1RI7A 4OHXA 3QGGA 2BE7D 4ZVHA 1H38A 1YWXA 2OEJA 4CYUB 3PV8A 3ZNJ1 2KB2A 2HQ3A 1VBKA 2V8GA 3M32B 4LR8A 2DITA 1GXTA 2FPHX 4EGLA 1U2RA 2BJDA 4C8ZA 3FC9A 4USWA 2XS5A 3FJ2A 4LREA 2J5AA 2ZOFA 4K4ZA 2MKHA 1T9TA 2G4BA 4Q8FA 2XMKA 2OIHA 3DXSX 5CYQA 5I42B 1IBKF 3QFWA 4K59A 4L75A 2DGWA 2RRAA 5A76A 2H54B 4ZPTR 3KNAA 5CYQB 3P45B 3G6YA 1NHKL 2XMVA 3OFFA 4QBUA 4J90A 2I5JA 1N5VA 2OSQA 1KQSR 4ED7A 4W90B 3D6MB 4NXMJ 2NZ4A 4B3RF 3SCJE 4CNYA 2B9WA 2GMJA 3FRYA 2HHQA 2VG5A 1FCAA 2V67A 4KE5A 2CA9A 3BKUA 3A8IA 4H4MA 4DUZJ 3I5AA 2C3UA 2K1RB 1KEKA 2VG5B 4DL3A 1YHQS 4LSLB 4ANEA 3MR5A 1Y4ZB 4H4MB 3A8KA 2DY9A 4KKOA 1OSDA 3K5OA 1N34F 2R7XA 4X4OA 1S12A 2HVHA 4KKOB 1UFWA 3IA0A 4F0HA 4ZITA 2F4FA 4EEYA 1KP6A 2PEHA 3KG1A 2K7JA 2VH7A 3W62A 4LF7F 2ZOGA 4AE5A 2AEMA 2AJFE 4CQ1A 3DKDA 2HWIA 3D3BJ 3I82A 2K3KA 5CD4H 4Q43A 3FK4A 3CUNA 3ENVA 3KLIA 1RWMB 2OPSA 5HAOA 2G13A 4KHRA 2HS3A 3DDIA 2CJ9A 3HHEA 1PCAA 2JOQA 1ZBTA 3D1OA 1XMOF 3KLIB 3GV7B 4GC6A 2OPSB 2J9EA 4CH7A 2DCUB 3HK2A 2O3DA 3D3CJ 1IBMF 4K5SA 2QLFB 2NXEA 2W4CA 4MK8A 3QJJA 3ITHA 3OLBA 2ZJQQ 2IM2A 4C98A 3N5BA 2MQOA 4NA1A 3ITHB 1X8DA 4MYUA 1TFYA 4LUBA 2QMUB 4LF1A 4A8MP 1FWPA 1D8ZA 3CMES 1KTQA 4X4QA 3CJ4A 5KFCA 2RRBA 1PJ5A 4DR7F 3CJSA 2DNQA 4O4GA 2FLNA 1E6VA 2DH8A 2F3JA 2BABA 1SJFA 1R6VA 4CO2A 1EZZB 3RB0A 3P5TL 3MM7A 5C2CA 1LW0A 3MECA 3UN2A 5CH7B 4WZMA 3M1VA 4NMXA 1PYOB 3C66A 1EP4A 4GMKA 3AT1B 3CD0A 1U1NA 1FRIA 2ZKUA 3M1VB 4CO5A 1EP4B 3RR7A 2RS2A 5E3AA 3SSQA 1CQMA 1H6KX 5D4OA 5CD4A 1VQNS 3OL9A 1SBRA 5K8MA 4KV8A 2NPFA 1SI9A 1Q16B 4C8OA 5KT2A 1KWMA 2BE2A 3PTWA 4IO9Q 2XB2D 1WELA 3ENWA 1DJ0A 4KV8B 1Y5IB 3H0PA 2QT7A 2ZM6F 2BE2B 1YK9A 2YY3A 3MPUB 2FLOA 2VBXA 3BSNA 4P9SA 4P75A 2LCWA 1RT4B 1RAHB 3D66A 2HHPA 3I5BA 3ZZOA 4WKRA 1Q0NA 2DHXA 2G0CA 1FEHA 1JLQB 4OHZA 2M88A 4JV1A 4JUZA 1OS5A 1VQ6S 1TMJA 2ZZMA 4NPOA 1APSA 1XTZA 1BQXA 1RTHA 3LGHA 1NK6A 1QSSA 1WHWA 1U2CA 2PE8A 2UU9F 4DF4A 1IQTA 3CCSS 3CCMS 1VC6A 4NXNJ 3OJUA 5JUMA 2YWKA 1NH7A 1IKVA 3D54A 1B99A 1AFIA 3GZ7A 4J9RA 4FXVA 2C3MA 2YQ1A 2PI5A 1IKVB 2VJUA 3EZUA 1A6LA 2HFVA 1S6OA 3QAEA 1ZAXA 1RWXB 2LQ5A 3N9UC 2AHOB 5DO2A 1C4CA 3D6HB 2E1RA 5IT9Y 5GAEI 2SXLA 1SL0A 3MXHP 3M8QA 1JIHA 1SKSA 3HSDA 4S0MA 4LFAJ 2HK2A 3AJDA 3M8QB 4O3RA 1T05A 2HZVA 4OYZA 2R3VA 2Y9HA 1PBUA 1OY8A 1H7XA 1KLMA 2R8IA 4LRFA 1T05B 4IG0A 4DQQA 1REGX 2DRDA 1HI8A 1HBMA 2C3OA 3BPDA 4IG0B 5KFBA 2N7CA 2VUGA 5HVHA 2XY5A 2DIUA 4FVCA 3G82A 1PC4A 3TJAA 1VMBA 5D3GA 2NSCA 4ZHRA 1S1VA 1HNXJ 1RAFB 2ZBQA 2DR5A 1RWNB 2NUUG 3G82B 2W2PP 4JV2A 3QGHA 1OSCA 4DQRA 2HVIA 3DGPA 2BXJA 5D3GB 4YP3A 3X3UA 2NYIA 1S1VB 2BJ1A 3T1HJ 5CYMA 3BJYA 3TX8A 4IQXA 3DGPB 4J9MA 1FVSA 1UPMB 2HHWA 5J2NA 1YSJA 3HSZA 1R31A 1S0MA 5CYMB 3K0JA 1DFDA 5ETOA 5D4PA 4F50A 1U1RA 3QGPA 4CZCA 3WZ0A 5J2NB 2G9OA 1RTZA 5CA5A 2QN6B 1GX5A 4G1PA 5CYJA 2Z56B 3KNGA 4DR6F 1TMMA 3CDEA 1FRKA 2CJXB 2DH9A 4DR2J 1RAOA 4LQ9A 1R89A 3CIZA 1VC0A 3BEGB 4WFAQ 1LWEA 3EPGA 4ANCA 2JJ4D 3PEHA 5D0EA 1RACB 4LRCA 1WKJA 5KT6A 2FGCA 2DIVA 1N56A 1QDUB 5HO4A 1H74A 4DL5A 5IT4A 1RWPB 1DTQA 4JI6J 1F2GA 1R6YA 2W8LA 3ILJA 4L72B 3F73A 5IV4A 2PMHA 5LMNF 2KT5A 4PYAA 5BYQA 2W9AA 1SQEA 3GIJA 1RT7B 3I4PA 4NEYA 4XAKA 4KSEB 2YTCA 4Y2KA 1S1UA 4I69A 2XMJA 3BM7A 3GG1A 1GT8A 3MI7X 1UTAA 1FKPB 3AJ2A 2CQ3A 2AT1B 3GMGA 1S1UB 2OH2A 4OZ5A 1JNRB 4LIWA 3A3PB 1HMVB 1SC6A 1FFGB 3THVA 4ZPVR 5A2QU 3KLGA 1P6TA 3AD8C 2X7IA 1U1PA 3H42A 3DYAA 4DMZA 3KLGB 3Q8YA 4ECRA 1NJIT 2QLJB 3S7RA 1RT6A 3KG4A 2HEKA 1TTHB 3EDRB 3OVBA 3DYAB 3NAHA 2XI3A 4JI8J 4DG1A 3H40A 2Y0BB 1RJJA 3SMZA 1FTCA 4DCJB 5GAGU 2NREA 2JEFA 4CM0A 5DGAA 4N47A 1LK7A 4LFBJ 1U7LA 2VDIA 3FEXB 1HKAA 4QWAA 2OPQA 4Q44A 3MEDA 2Y0SD 4KIAA 4NCGA 4NEZA 2OPQB 3JSYA 4KO0B 1VIXA 4OJ1A 1S6PA 4DPOA 3ILIA 1QSLA 4KGZB 1KQKA 2B4VA 8RUCA 1HPZA 2KFYA 3DHXA 3CTRA 2GIQA 2KVQE 1D9DA 1HPZB 2J0WA 1RGVA 4UZCA 4DQIA 2OPRA 1F5AA 3RU0A 2IAJA 5C25A 2ASJA 2HBYB 4ZP9A 4XDCA 3M8WA 2OPRB 4B9SA 1U6BA 4PXCA 2MKCA 5A6WA 1F2HA 5J1PA 2BR0A 3FKBA 1NJZA 1L3UA 1VS3A 2DH7A 1OJ4A 5KAKA 5LSRA 4UY85 5H9FJ 3N28A 3VAKA 3G96A 2FDNA 2BDPA 1X9MA 4KR0B 3HMJG 2B4PA 1A0OB 2WVDA 4DFJA 1V9OA 2YKNB 2ZDOA 1V3RA 1HQEA 2YWWA 3DOLA 4CLKA 1HI0P 1WG4A 4DZ6A 3OTDA 3I6PA 1KBRA 1WTFA 2DNYA 1XR7A 3DOLB 3BO4A 3HF5A 3OPKA 4DX6A 4KHPJ 2OJ3A 2HRYA 4QYZK 2WRMA 5D8HB 4K4YA 2DRAA 3BH7B 3HFVA 1HBUA 3V6DA 2I8EA 1ZTWA 1YTYA 1JLGA 2BVZA 4ECXA 1HBUB 4TY8A 5KG0A 1WF1A 2N4DA 5G0RB 1IKXA 2XCAA 2RU3A 1CJVA 1JLGB 3K5MA 1KC8T 4A47A 2MQPA 4B3OA 2R7OA 3IBCB 1ZM3A 3GFZA 4NXMF 1WUUA 4TY8B 2OFGX 1IKXB 3CD7A 2PT0A 4YB1P 1CLFA 4B3OB 4YR0A 3UPFA 2ZZTA 4DUZF 3JTOA 2HMIB 1CEZA 2P6TA 1IN0A 1M5PC 2GJIA 1FA0A 2MLYA 1WJ9A 5KFLA 1OY9A 3M8SA 1RK8A 5ETLA 4O4RA 1U26A 3PYDA 4KGVB 3T41A 2WB1D 2GQ2A 4OZ2A 2HURA 2GIRA 2Q43A 4MT1A 3EWGA 2XLIA 5L39A 3DRRA 4PQAA 2A18A 5HQ8A 3A3NB 3IO1A 1I1GA 2CIMA 1D9FA 1HHQA 2VDHA 1FKOA 2EKYA 2G1DA 2AYBA 3DRRB 2WVBA 4RR5A 2RRNA 1IR0A 1UPPA 5LMUJ 3CJ0A 3A4TA 1FKOB 3O8WA 2ZFHA 4FYXB 1QE1B 2BW7A 3KHGA 4Y2AA 2B7CB 1JJ2R 4O3QA 2E1CA 2R2TA 4W4MA 4ZVSB 3TUZC 3RAQA 3T6BA 1RHKB 3DRPA 1RB0A 3IAM9 3ISNC 5A8WA 4USMA 3HCXA 4I68A 2KZZA 3FQLA 2AIRB 1S1TA 5A8WB 1IUJA 4WTOB 3F56A 3OHAA 2WW8A 1XJWB 2LEPA 1S1TB 4DSJA 1A7GE 2V8DA 2MJNA 4NYZA 4RW6A 2HFUA 5KFTA 2BACA 4URGA 4DPUA 3JTNA 4RW6B 3DHWC 3QJLA 3GU0A 3N6MA 2VA3A 2E7XA 3HULA 4C97A 3OTBA 2QMWA 3V4MA 4OYAA 2BJ7A 2C2MB 1LOUA 4LF5J 3EGZA 5EWGA 1K0VA 3UNYA 2VFSA 3IC1A 4EK2A 2L08A 2HWHA 1UL3A 4LR9A 5C42A 3KLFB 3IM9A 3WQPA 1NJWA 3DC2A 3DLGA 2VPWB 2ROGA 1HWIA 1SVDA 2E9RX 4YDDB 1I51B 5C42B 5AE3A 3DLGB 2GA7A 5CHCB 2LYVA 2D9PA 1H7WA 2N82B 3HT0A 1T3NA 1U47A 1R0AA 4Z7CA 3CJKB 2YWGA 1RLCL 4HTJA 3MEKA 2E66A 3FBEA 1R0AB 2N3LA 3ZFVA 4IG3A 3GFHA 2F9JA 1A9NB 3KWMA 2Q6BA 3ZZTA 2VL1A 1ZETA 4IG3B 4PWUA 2M70A 3TUIC 4PABA 3E8OA 3R2DJ 1KQGB 4K4SA 1IXKA 2WSEC 2RQ4A 4ELTA 3H2VE 2IJFA 4F7VA 4C48A 4PZVA 1M5SA 4Y2IA 1YVFA 4X84A 4GO5X 1XEZA 3OFGA 4NZ0A 4F26A 3LP1B 1B0PA 4NA2A 1M5KC 4EYHB 5GAGI 2XI2A 1SJ4P 4F4ZA 1VDHA 1R0CB 4NXNF 3BDPA 3PJ9A 1SH0A 1W25A 3UN5A 3TX0A 2J9DA 5E3CA 1MWZA 4USKA 5KFJA 1Q8IA 1V5IB 2CJKA 4DR1J 5FIIA 5AXLA 3ZZYA 5GADI 4NL5A 2KO1A 2IVYA 2CDQA 1KNZA 2A10A 3VZIA 1UETA 3TEHB 2FD2A 4DU7A 4LFAF 4F25A 2JH3A 2DNPA 4E8UA 4I7FA 5HVFA 3HJVA 1GTEA 3OXFA 4RNMA 3V6JA 5JJBA 3QGIA 1VHFA 3DGVA 2P9GA 3HO1A 2ADBA 4RX6A 4I7FB 1UFLA 3TZYA 4UZBA 2R4FA 1N32J 3G2XA 2XWYA 3ADAC 5HLFB 1EHWA 2ZC3A 4RNFA 5IM0A 2XGPA 3FCWA 3PY8A 2FHJA 3EVOA 3HLUA 2BRKA 3QT7A 4MKVA 2FB0A 2XNRA 1HNXF 1WC3A 1FDDA 2Y3YA 4OZNA 3UWTA 2MZRA 4X4VA 2UVVA 1PJ6A 3OFEA 1FDNA 4ZCLA 5K20B 1MN7A 4O3PA 4MKAA 1ICEB 4H4KC 1CC7A 3DLEA 3T1HF 1N88A 4O0NA 1O51A 4HVZA 2HQCA 2AJQA 1NSQA 1LW2A 2AYGA 3DLEB 2X1GA 3Q8SB 1KONA 2NSBA 5IC6B 4TLRA 4C8MA 3PW5A 3L7UA 1LW2B 4WXOA 3B82A 1JKHA 2W7OA 3WX8A 4DI6A 1MN9A 4U6PA 2DXFA 4DR2F 2M7SA 3HXMA 2Q66A 2IRXA 4P74A 2CYYA 3CC7S 3HM9A 1H2UX 3MM5A 2PDAA 2X3GA 2YKQA 2CAJA 1GMWA 1S0NA 2KN4A 3BGLA 4HT5A 1TL1B 2EPIA 5CZXA 4JI6F 1P8GA 4DSLA 2BA9A 3G6ES 1ZZFA 3H20A 3R7BB 2VBWA 2QA4S 3NGRA 1C1CA 1TAUA 4Y00A 1WOPA 1M90T 5K8OA 4JI4J 3PYEA 2YKMA 2Z2LA 3CCJS 2EBEA 1C1CB 2IYGA 5M2PA 4CCHA 1V3ZA 2C2NA 2ZH3A 5D0GA 2YKMB 3CJ2A 6FDRA 4RPFA 1ZA2B 4ALZA 3VGSA 3QO9A 4ZS6A 4YS2A 5BR8J 4K50A 2RDIA 1WWHA 4EWTA 1D09B 2YH0A 4O0IA 3BQ2A 3GIMA 1XNRF 2AZ3A 1NBEB 3B4DA 2APOA 1GXUA 3W7BA 1H3DA 2DK2A 3C16A 2W25A 1HD1A 3QWPA 1T0TV 1QVGR 4N8OA 4H4KA 4U95A 4JI8F 4F0MA 5E41A 3DLHA 4RNHA 5DQIA 3C16B 2HPUA 3V6HA 4AL5A 3G4SS 1CSJA 1FJEB 1U1KA 3HHNB 3M6VA 3DDKA 4LFBF 1H72C 4UUWA 3VTIA 1M5HA 3DRXA 5KT4A 5EHHA 2FTRA 5AJ3J 4R8UA 2O01C 2EFQA 4RUCA 4Y34A 3QNWB 3GWCA 2B4UA 5C2GA 5E7OB 1DQAA 2XYHB 1FXDA 8AT1B 1AFJA 4A8KA 3J7YU 1PYTA 2LQ9A 3M6WA 5GVQA 3MM9A 3MCNA 3RBXA 1S77D 2DNNA 4KPYA 4NYOA 4K8RA 1CG2A 1N5YA 2FJBB 1Z1ZA 2EFVA 4ZLLA 3U1MA 3OFHA 2WSFC 2X51A 2GHWA 3F41A 1T9XA 3AXMA 4EO8A 3K58A 3TARA 4B9VA 3DOKA 1N33F 4OYOA 3LP2B 5ETRA 2RJZA 3UW1A 3DOKB 2UV8G 1XMBA 4QWBA 3DNCA 3CB4A 3T3FA 2YKPA 2C42A 1HWLA 2YX7A 4LVOP 2VBZA 2W4PA 2HVDA 2ZUAA 1RCOB 3GLJA 4ZVUB 1TL5A 4V1Ak 3A12A 3QJPA 2FJAB 2CNLB 2HQFA 2WOMB 3WC0A 4M5NA 3OR1A 3R5JB 5H9FK 4KHPF 3OR1B 4CTAA 4YR3A 4WJBA 1VYAA 3S1TA 3C14B 3S01A 2FZGB 3AD7C 5F3TA 5DZ6A 1VQSA 3UCUP 2MPUA 1UP1A 4EUVA 3I9V9 2PMWA 1X5SA 4L73A 2EBGA 2B43A 4TU7A 5KFFA 3D0GE 3PFEA 2CQ1A 4TLQA 2J0XA 1Q82T 5KOXA 4NOHA 2FLPA 1C0UB 4DQSA 3SCLE 3QATA 2PC6A 2V2VA 2NUHA 1X0PA 4I56A 4LMZA 4IH7A 2XY6A 3PKYA 2DGVA 1TK8A 2DYAA 1IWGA 5HK4A 5KFWA 2QZ8A 4N5SA 3AAWB 4IOCQ 1XIQA 2C2OB 2IJRA 2Q1LA 3UDCA 3LPEA 2HBZB 1BMQB 1VRUA 2PI4A 5L38A 1O6XA 1KSPA 1VRUB 3GFYA 2AP6A 2BJ8A 1I5OB 1DRZA 5LMUF 4ZLJA 5LSLA 2RQMA 2C2DA 4XK8C 5EWFA 1J27A 4DSFA 3VHQA 1B4SA 2I1RA 2QLWA 2XSFA 3DFEA 3OJSA 2H4WB 4YB7A 2VD3A 1Q7YT 2WHOA 2H5JB 2EC2A 4NRUA 1G1XA 3BQ1A 3IR5B 4M5LA 2EK6A 2DD8S 1GMUA 3VQTA 1EETA 3WDOA 4WP3A 4K5RA 4U8VA 3EZOA 4IYQA 3ET6B 1TZ0A 1YBTA 2LXIA 3KLVA 4AYBD 2B8QA 1EARA 3US5A 4C9DA 2B56A 2QIFA 2GVZA 1RP5A 5A2QY 2RVJA 4PR6A 5L9XA 4DL2A 1IJEB 2C1EB 2FGOA 2Z30B 3PW7A 1WF0A 5BYRA 1U48A 1VRTA 2GVZB 1RAEB 1MG7A 1UZDA 3GV8B 2XYGB 1FXRA 3AB4B 2B9YA 4PPDA 1VRTB 2XZWA 5T7LA 4HACA 1FK9A 4LF5F 1NHVA 5KG5A 1WF2A 3N4WA 5D4LA 2DBBA 2FY1A 1QD1A 2D7SA 3B78A 3RYLA 2YWHA 3JB9k 5KFZA 3KK3A 5T7LB 2MXYA 1FK9B 3LPYA 2VB6A 1RHMB 2EI5A 1BQNA 3KK3B 2BEFA 4X64J 2RDJA 2LXFA 2CPXA 4PEOA 2GCFA 5KTQA 1BQNB 4KFBB 2E44A 1NXIA 3MMCA 4MH8A 4HR2A 2AWZA 3TJ8A 2H3EB 1Q79A 4Y28C 4JV5J 1WKLA 1AYEA 5CCMA 4OJ3A 2ZWPA 1VBXA 3MPWA 4WU3A 5K8PA 2E7WA 2IA0A 3O3LA 2IM3A 2XO6A 4ES2A 4QWDA 2UXDF 3NRBA 3MPYA 3KUHA 3C2PA 2D69A 3HSJA 3AB2B 3V6KA 1FE4A 1IJFB 2PIIA 3EDQB 5DDQC 3KYLA 1FD8A 1TKZB 1SQFA 4P52A 2XS2A 1N4LA 4RU2A 3CJRA 1KDNA 3G6VA 2YNHA 5DS7A 1WC1A 1B70B 3GJRB 2KRRA 3EM1A 3DRYA 1JLFA 2YNHB 1ZM2A 2WAQD 2CJYB 2DY1A 3ZZ0A 1ZTTA 2PA3A 3PJXA 1JLFB 4B9NA 2L3MA 3CWJA 3R7NB 2V68A 1PAEX 3NS6A 2J7UA 4DCOB 4P71A 3JQMA 1EKRA 4RW8B 1IBCB 3T5JA 4UW2A 1G2EA 4B3RJ 2L9DA 3CC4S 1T03A 5MLCV 2H51B 2DEIA 3GQCA 2FJDB 4WP9A 4DR1F 1XNQJ 2MEWA 2ZOMA 4GKKJ 1OO0B 3KLHA 2B6AA 1T03B 2HS0A 3J7YI 3MM6A 2Y1RI 4CIOA 2IY5B 1OMSA 3C15A 2BUNA 1VHIA 1VFJA 3KLHB 3C15B 4J9LA 4OZ0A 5F8NA 3GJQB 3R9LA 1WC0A 4LT6A 3MTJA 3LP0A 4U67Q 4DDFA 4ID5A 3LW5C 2XG8A 3KUEA 2VJVA 1RTJA 1R43A 3I0RA 3C46A 1I94F 3GB0A 2ACMA 2CQBA 3H25A 4ID5B 5M2UA 1VQKS 1JLCA 3RB6A 4XPEA 1LK5A 3D1QA 1F6TA 1Q1KA 4KBIA 2IBKA 8ATCB 5HROA 3NCQA 1JLCB 3MUTP 3M8RA 1FFWB 3BN7A 2V9KA 2P9EA 5T14A 1AW0A 1B0VA 2O5DA 3CO9A 3M2VA 4PAAA 3CEDA 2EG1A 2WVFA 1U02A 5DDPC 4HH1A 2QMXA 2IJNA 3M2VB 3TA1A 4OHYA 1RHJB 1QM9A 2ZDPA 4B02A 1FESA 5LXYA 2ABYA 4WYLA 4YN3B 5EUHA 9ATCB 2HZAA 4P7TA 4Y6IA 3U02A 2VONA 2CPEA 4P2FA 4J91A 3B54A 3A8EA 2N4CA 4ZCIA 4DV4J 1U0HA 2O67A 3PZPA 3LWLA 2J6SA 1LXNA 2AU0A 3NNAA 2YH1A 2VG7B 4DOZA 5KG6A 1VQ7S 2FZKB 4H4OA 3BKTA 4NZ6A 4RU9A 3CCWA 3Q24A 2Z4PA 1UMJA 4J9SA 1U2FA 4ZJLA 1WTBA 4H4OB 2WVEA 3MEEA 3A8JA 2GC8A 5KFOA 2AGOA 4F3OA 4JI4F 3DU5A 2XGQA 3TVYA 3I55S 2KT3A 1T9YA 4QWEA 3U1LA 1QTNB 1SUQA 4ZN1A 3WX4A 2UP1A 3UI3A 2ZKTA 4FP9A 1N5QA 1SUQB 3O2IA 1RYRA 1FDAA 3OR2A 5BR8F 3HSGA 4J9UE 1FTRA 1RU2A 2VU5A 1SXLA 4OQJA 2WBMA 2QYCA 2DNGA 4OI4A 3OR2B 4WPAA 5KFAA 1C0TB 3NY0A 5AT1B 1TKTA 3D4JA 1RA7A 2GQCA 4F02A 4M94A 2UXBJ 3G87A 1TKTB 2CQIA 3SCKE 2KFZA 3NNCA 4K2JA 1N36J 1S4EA 3LALA 2UZAA 3MF5A 2HIYA 1F5BA 3PVXA 2PGCA 2VA2A 4USHA 2KU7A 3ZTPA 2NCKL 1RWKB 5AJ3F 3MFIA 2ACYA 3CD6S 2E29A 1YZ6A 4RBTA 1U45A 2RE1A 4QJVA 2RD5C 2AKWB 4HHHA 1WNEA 3UDVA 1RWOB 4Q0BA 2YNFA 2RB7A 3W8GA 4PRFA 3IAS9 4X4NA 4PG6A 4NLDA 3PR4A 2V6AA 3Q23A 2PA8D 1HWUA 4YQWA 5LJ3Y 1YG0A 4Q0BB 2YNFB 4J9OA 2FLLA 3CJQA 1TU0B 3DLKA 1WSVA 3GR1A 2DISA 2VPZB 3SEOA 1S6UA 2LP4A 3K8VA 2ZVIA 3KK1A 2MKIA 3DLKB 4AD6A 2KXNB 4NLGA 2MKJA 4ECYA 3HVRA 1PBAA 2V34A 3VAFA 3NGSA 3KK1B 2E1MC 2E9TA 2V4JA 5H9EJ 1BHNA 1SL1A 3QAUA 2CADA 2G0IA 1K73T 1VOMA 2BQUA 2UUAJ 3BREA 1HW8A 3H5SA 2V4JB 1Q81T 1VQYA 2VOOA 3NBPA 1B0TA 4LSZB 1ELOA 1KN6A 3MPDA 3IRXA 2CQGA 1MWYA 2IBOA 2GNKA 1JLBA 2E1PA 3IRXB 3W9IA 1RBLA 1F9EB 2CJBA 4F4WA 5KFIA 5IFMA 4TYBA 1JLBB 2H1YA 3LAMA 3BGFA 1M1GA 3N6LA 4WIQA 2OTJS 2DXDA 3FVYA 4NLUA 3MMAB 2CWXA 2ZE2A 4PG7A 5AXNA 3KXDA 3MCOA 2ERRA 1VQ9S 2BW2A 3DLJA 2ZE2B 5D78A 2EVZA 3HFZB 1KR4A 2RQKA 5ETPA 1J2VA 4FF4A 4FKXA 1I3OB 4CO3A 2QFJA 4I6AA 3CIMA 4OI6A 4I6YA 6FD1A 3CT9A 3DDNA 4IH5A 2ZD1A 3THTA 5IS2A 2IDEA 1HQUA 4CLWA 3CULA 1BQMB 2KXHA 1NDPA 5I3UA 4FXWA 3MMJA 3TP2A 3LWMA 2HRTA 1HQUB 2CQCA 1VLYA 4X4RA 2UVUA 5I3UB 1M1KT 3RJMB 2FHOB 3DM2A 2IRUA 4I64A 4ED8A 3NLCA 1UA0A 4YMEA 2IHR1 3EXCX 4K4UA 1FD2A 4RO0A 3G6XA 3DCAA 1TELA 3VVUA 3D5MA 1B3TA 3IMQJ 1RHQB 2VZ9A 5AE2A 3OHBA 1RA6A 2KYZA 4RBVA 1RT1A 4NE9C 4I4BA 2FJXA 4B3SJ 3FCVA 2FVCA 5FD1A 1Q78A 5A6PA 3Q22A 4Q7AA 1RT1B 1ZM4A 3GIIA 5F0WA 4DSEA 1NSPA 3WBZA 1B7YB 3PHEA 2IVFB 3U27A 4DR5J 4URSA 1RWWB 1TKDA 4IOAQ 1LWCA 4TKTA 4O44A 4NZ7A 3BYPA 2GHVC 4QOTA 2QSFA 2E7VA 1YJWS 4O44B 3UDEA 3KDOA 4ETZA 4CO4A 4DEZA 2W7AA 3MAHA 2RMLA 1RHRB 4B9MA 3GSIA 2PFFB 4Y2CA 3P5BP 3P6YC 2RIJA 4K0KJ 4MJKA 5LOQA 1DARA 3H2LA 3HD2A 2VOPA 2MGZA 1QUVA 2Z8QA 4ILMA 4X64F 5HL7Q 2E5LJ 3Q8QB 2B8PA 3M2RA 2ZC4A 2GX8A 4TQSA 1U1MA 5DLFA 2KG0A 1XQIA 2CUYA 3WC2A 1YX2A 4JV5F 4FS2A 2YNGA 3UNGC 1B64A 2P8IA 1KTVA 1QLNA 4A4JA 3JTPA 1TUGB 1RTIA 2F8HA 2HHTA 2VKZG 4KGMA 2XM3A 2MHNA 1R8HA 3TZXA 5F8HA 5L1JA 2Z2MA 1MSWD 3CMQA 4I2QA 3CF5Q 3IXQA 4KC5A 4FF1A 1QAYA 3SQGA 2DHGA 4ED5A 1HNWJ 3WHIA 4I2QB 2ASYA 2XMTA 2R2RA 2GHPA 1WHXA 2XMUA 5FLXU 3HHKA 2Z2YB 1F3VA 3AJ1A 3IR7B 2EC0A 3ELHA 2MLXA 1RTDA 1SQGA 2NLWA 3AOCA 4A8XA 4B3MJ 3MM8A 1P1LA 5HJXA 3J81j 4ZJQA 1RTDB 1GTHA 3BPSP 1EIYB 4DV2J 4EBCA 1U49A 3MM8B 5DJBA 5RUBA 1D3WA 1HYSA 3MUVP 4K7QA 4ATNA 3TZZA 4YEAA 2QL7B 4M5KA 5B09A 2XSJA 5E3RA 5A8KA 3L7PA 2NZCA 5C7PA 1VLOA 4YHHJ 4ED1A 2XNQA 4HLBA 2I5JB 5IQ6A 5A8KB 2J7KA 2FHJD 2CVIA 1S72S 1XNQF 4GKKF 1AB8A 3TQEA 5IT0A 1FO1A 4KGKA 4ERDA 1FWLA 1SJ1A 5E2QA 4B9TA 1YQHA 2OEMA 4ZP7A 3GPAA 2ZH5A 2F65A 4CH1A 2GMHA 2DR7A 2VFVA 2W01A 5DG9A 2XMMA 1KKHA 2IYIA 1SKUB 3SZ2A 1UVMA 4N41A 2OMLA 5E33A 5T41A 2YWEA 1UAWA 1RAJA 2BM0A 1PIEA 3CDWA 3IRWP 4USTA 2J8AA 2C3YA 4JI5J 1JJ4A 1MMLA 1Q8BA 2AGPA 4ED4A 2HS4A 2OAUA 3W66A 2ILYA 3NCRA 2EFPA 3D1HA 4WK3A 4DS4A 3MD1A 4J9KA 1L3KA 5HVGA 5CZVA 3UVJA 2DTJA 4DR4J 1MU2A 1AROP 1RKIA 2Z0GA 2D41A 5HBMA 2MTLA 4ILRA 2IVMA 4J9NA 3M8ZA 2HRUA 1RSCA 3VALA 4WZQA 4DS5A 2HVZA 1NB2A 1TQLA 2ZHBA 5HBMB 3KG0A 1X4CA 3QQCD 3KUGA 1SJRA 3BS9A 3RAXA 3AFGA 3P3DA 3LF0A 4IH6A 1KRPA 4NLYA 5F8GA 1ZH5A 2Q79A 2DR8A 3CCZA 1HFEL 3HHLD 4O4GB 1E6VB 5EX3A 4EBDA 2CQDA 3E3XA 1CBKA 1RZMA 4DV4F 3DI6A 3MM7B 1N8RT 2U1AA 4YY3J 1NKBA 2DNLA 1LW0B 3MECB 1LNQA 1RBAA 5ADZA 3NWRA 4LQ3A 3RW7A 1IKYA 3QLHA 4PXBA 4C8YA 3IFEA 5B0DA 2AGQA 1IKYB 1TL7A 1FX2A 3FMBA 1S10A 1UW4A 1WORA 2YVSA 1QAXA 1NJXA 3K5LA 3OSPA 2DGSA 1WI8A 3X1LB 3H7HB 3SBMA 4QW8A 3QIPA 5HSPA 1WOSA 1SKWA 3TW0A 5EX0A 5KFPA 3IS9A 1UKUA 3QIPB 3PNIA 3I96A 3OLAA 5M2RA 4QW9A 4UTGA 2VV5A 5KFEA 1T9WA 2LKZA 2CPFA 4OYPA 2IA6A 3H8YA 2KI2A 3IWLA 2W2QP 5F9NA 2EXUA 2VPXB 3OD2A 1XMQJ 1OPIA 1YRXA 2C28A 3E2EA 4LJMA 5HJYA 3DU6A 2UXBF 3JAMU 2E5IA 4USVA 4DQPA 1VRQC 3K5PA 4FYDA 1UWAA 3MURP 1R8BA 1ZM9A 1S48A 3NGUA 1N36F 2V2KA 4ZVTB 1TL3A 4WYWA 1Z2LA 1O0PA 5LM7E 1X31C 1RTHB 2EW9A 1DBDA 1FRHA 1TL3B 4ED6A 2EG2A 3V2UC 3ENQA 3NEKA 2XC9A 4J37A 4LRDA 3CVKA 1O5JA 2C3PA 1BWEA 3W5XA 2B4OA 1C2PA 2P9CA 2HIQA 5ETQA 3R1LA 2Z57B 1LFWA 3JYTA 5E3PA 3CPWR 1Z2ZA 2JL9A 2CPYA 1QVFR 3TUPA 4B3TJ 1NDCA 2OO4A 2BQ3A 1C4AA 4IR9A 3W63A 1BY9A 3PXGa 3D67A 2Z58B 2FJWA 1W7WA 3FFIA 3ICLA 3PHTA 1SPBP 4M5IA 5HN0A 2GVDA 2IPOB 2ILZA
chains in the Genus database with same CATH topology
1IKWB 3GWCA 3SYZA 2AV5A 2B4UA 2CQ2A 1TVRB 3EGWB 4JI7F 5DG7A 5DM7Q 5E7OB 1DQAA 2P5VA 4DWIA 4DLEA 1JLAB 1HBNB 3LP0B 1FXDA 1QAJA 2HHUA 1AFJA 2R2UA 4A8KA 3J7YU 4IDKA 1NKEA 4PG5A 2LQ9A 3M6WA 3CMAS 3EYZA 1NNDA 5GVQA 3MM9A 4ZPBA 2IC3A 2OMOA 4EBEA 2P6SA 1S77D 1JJHA 2DNNA 3D28A 2R7RA 4IR1A 4G1IA 4KPYA 4NYOA 4LFCF 3EXYA 4ZMMA 1CG2A 4M95A 2XMWA 1DZ5A 1RTJB 1UVLA 2IC3B 4OI1A 3I0RB 3I4HX 1N5YA 4QYRA 2FJBB 1Z1ZA 3GR0A 3IR6B 2UUAF 4DBQA 2EFVA 4DFKA 2FVPA 1YI2S 3U1MA 1XR5A 3OFHA 2WSFC 1FJGF 2X51A 2GHWA 1TL4A 3F41A 2O1PA 4DLGA 4LIRA 4F67A 2VFRA 3TARA 4EO8A 4V19X 3K58A 1W2BR 2BZ2A 4OZLA 4B9VA 3DOKA 3HI9A 4DV5F 1KLMB 1N33F 4O3OA 3V4IA 4OX6A 3LP2B 3PO5A 1HBMB 3W3SA 1Q4RA 5HROB 4FNIA 2JFDA 2RJZA 2LA4A 3UW1A 5GAEU 1X4BA 4B17A 1HNIA 3BN4A 4A8WA 3L7OA 3DOKB 5J1EA 1XMBA 2UV8G 4OL8A 3NAIA 4QWBA 2MZ1A 2AQ4A 3V4IB 1FNXH 1S9GB 4MYTA 1S0OA 3DNCA 4NLOA 5I3QA 3BB5A 1UA1A 4R5PB 4NLPA 3CB4A 2DNKA 4BS2A 4NCBA 1N52B 2V8HA 3SV3A 1VQMS 4EFAC 4C8LA 3KLFA 2JDJA 3T3FA 5KG7A 1HNIB 5J1EB 2V4RA 2YKPA 1O8BA 2C42A 1HW9A 3NG8A 2M52A 2XLJA 1N0VC 1HWLA 2YX7A 4LVOP 2K7KA 2VBZA 5JVHQ 1Y7PA 2W4PA 2WB4A 1GX6A 3FQKA 4BBYA 4ZHRB 4I6WA 1TL5A 1FRXA 2CVEA 1Y0HA 3MMBA 1Y9OA 3PIOQ 3T5KA 2JC0A 1RI7A 4QU6A 3FMWA 5J2QA 4OHXA 3QJPA 3QGGA 2FJAB 2WOMB 1N5TA 3FEYB 3PX0A 4ZVHA 3WC0A 1H38A 1YJ9S 1YWXA 4ED0A 3MOJB 5A8RA 4FNHA 3MMBB 3OR1A 4ETXA 3H4BA 3PV8A 1XWLA 3CJKA 3VWSA 3O5TB 2WONA 2KB2A 2HHVA 3VAIA 2CZ4A 4C3MA 1U09A 3DOMA 1RT2A 2HQ3A 4IRDA 3OTCA 2A2DA 4HKQA 3HFKA 5A8RB 4KHPF 4G3IA 2V8GA 3M32B 3OR1B 4CTAA 4YR3A 2WONB 1VGYA 2XEXA 5EGYA 2KVIA 5KFYA 5A0YA 2ADCA 1HHTP 2DITA 3PX4A 4WJBA 4JV0A 4WCEQ 1S76D 1GXTA 2FPHX 4EGLA 1U2RA 3S1TA 1J5OA 3S01A 1FRMA 3RZAA 1VBZA 2BJDA 2NQPA 3H5YA 4C8ZA 4UY8T 5F3TA 4OZ1A 2XS5A 5A0YB 2L9NA 3FJ2A 2ZJPQ 1VQSA 2J5AA 2ZOFA 4K4ZA 2MKHA 3LH2S 2G4BA 4Q8FA 1FJCA 3I87A 3UCUP 5F8IA 1J5OB