4RW6B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 111
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B03
5L1IA 3FDSA 3TAMA 3N6LA 5F9NA 1BQMB 1C0UA 3E01B 5DQGA 3KLVA 3KLGB 1SH0A 1RT7B 3V81B 3OL8A 1JKHB 4LQ3A 5I42B 1JLCA 2YNFB 5HROB 4ECRA 5KT4A 3UR0A 2HWIA 2BQRA 2IMWP 4KE5A 1IKXA 2E9RX 5F8IA 3IG1B 2BQ3A 5KG4A 4KO0B 2DPJA 4O3SA 3QGHA 3MR6A 2AGQA 5KFLA 2W9AA 3RBEA 2ATLA 2JC0A 5KFZA 4NRTA 3DYAA 3BQ1A 4ED3A 4MH8A 2BANA 3V6DB 5J2QA 4RW8B 3KK2B 5KFUA 5KFHA 5F8JA 4O44A 4R5PB 1SV5B 2FVCA 4RZRA 4RUCA 3G86A 5F8GA 2JEJA 2YNGB 3LP0B 4RW9A 5KFJA 5DG7A 5KT5A 4G3IA 5HBMB 1LW2B 2V4RA 5KFXA 4ZP9A 4K50A 1S1TA 1FK9A 2B6AB 3LP2A 3Q8PB 4O3PA 2QE5A 1TKTB 2HNDA 1IKWB 4KV8B 4NYZA 1QE1B 3H40A 4JV0A 2ILYA 3DI6A 3IS9A 4B3OB 1RTIA 5KG6A 3IGVA 2AX0A 3HKWA 3MR2A 1JX4A 1RA6A 4URQU 1S1WA 2JLEA 3KLIB 4PQUA 4IDKA 3DRPB 1QAIA 2HMIA 4IQXA 3CO9A 1HNVA 5EWGA 3C6UA 4YR2A 4URSA 4ZVGA 4ECYA 2ZD1B 4I2QA 4HYKA 3VQSA 1JLBA 3GIIA 3BREA 3KK3B 4IRDA 3V4IB 3DRRA 1HQEA 5J2NB 2WCXA 4K4UA 2F8EX 1TVRB 4LSLA 4G1QB 4MIBA 4JUZA 4NLYA 5KFRA 1RT5A 3MFHA 1VRTA 2IM2A 4IH7A 1FKOA 3NKYA 4TYAA 4FBUA 1T05A 4M95A 1TV6B 1EETB 3FFIA 3CJ0A 4F50A 3GV5B 4TXSA 3DLEA 3EPGA 1JLAB 3SFUA 3I0RB 4ZVFA 3MFIA 3CJ3A 4ZP7A 1S9EB 1YVFA 1IKVB 1SUQA 3KK1A 5KFFA 3QGGA 1C1BA 1S1UB 4Y34A 4IRCA 2QV6A 3DOLB 1MMLA 5J2MA 1JLFA 4RNMA 2OPPA 2VG6B 4TQSA 3MEGB 4O4GA 5CYMA 2I5JA 3KJVA 1N4LA 3MF5A 4NLGA 2V4QA 1J5OB 3LANA 4TY8A 3MTKA 4FBTA 1BQNB 4R8UA 1RT4A 2RF2A 5KFPA 4Q8FA 5KFAA 3KLHB 3FRZA 4EYHB 2VG7B 1RDRA 4MK9A 4J9OA 3PW5A 1R0AB 2I1RA 2UUWA 5KFTA 2R8IA 3RAQA 2RDIA 5KFOA 5DLGA 1IKYA 5F8MA 4RW7B 3PR5B 3IRXB 2W9BA 1S0NA 3RAXA 4ICLB 2HNZA 4LSNB 5C25A 1LW0B 4KFBA 3M9NB 3M9OB 2JEIA 1RYRA 2UVRA 3H2LA 2R2RA 1RT3B 3UQSA 1N48A 3M8QA 3MEDA 3T5LA 1FKPA 1MU2A 4ECZA 1UWBB 5JUMA 1TKZA 2GIRA 4RNNA 4IG3A 3CIZA 3KHLA 2JEFA 4QWCA 4IR9A 1S6QA 2YNHA 5FDLA 3PVXA 2E9ZA 3MEEA 2IM1A 1JLQA 2AX1A 3JSMA 5I3UB 3Q8RB 1HNIA 1D1UA 4JV2A 1NHVA 1VRUB 3KLEB 2WONA 2IM3A 5EWFA 2OH2A 1JLGB 1RTHA 1RT1B 2UVWA 4RW6A 5KFKA 4KBIA 1N56A 1DTTB 3JYTA 4YQWA 1KLMA 1S0OA 5D3GB 1C0TA 3DM2B 4F4YA 2GC8A 3C6TA 4NLRA 4GC6A 3HVTB 5DGAA 2R8JA 3DLKA 1S9GB 3CWJA 4I2PA 1TL1A 1K1QA 4FS2A 2EC0A 5J2PA 1S1VA 1N6QA 4EO8A 3TQ1A 1TKXA 3M8PB 3E51A 3GIKA 3MR3A 1HQUB 2WB4A 4DL7A 3N6NA 4Q8EA 2C2RA 5KFEA 3QO9B 5CYQB 3PR4A 3NBPA 2IJNA 2JC1A 3QZ7A 2W9CA 1TQLA 1DLOA 3DRSB 3KOAA 4RU9A 3OLAA 2JEGA 1JLEA 4NCGB 5J1EB 1S97A 5HP1B 5KFWA 4NLPA 4Q44A 4J9LA 4ID5B 4QPXA 3OSPA 1LWEA 2R8GA 1HPZB 2R2UA 4ECSA 3GIMA 4I7FB 4IG0B 2IJFA 2OPRA 4NZ0A 3I0SA 5HLFB 3G6YA 4EBDA 1LWCA 1C1CA 1QUVA 5C24A 2BE2B 3QLHA 3OHBA 1HYSA 1DTQB 4TY9A 5F8LA 5KG2A 3DLGA 4TLRA 4ZHRB 1S10A 5C42A 2FVSA 2FVQA 1RTDB 4H4OB 4KKOB 3ISND 1JXLA 4WE1A 2UVUA 4J9KA 1RT2A 5EUHA 5KG0A 2WRMA 4ED7A 5KFVA 4PUOB 3M9MB 4TYBA 3PW7A 2HNYA 5K14A 1KHWA 2OPSB 5KFCA 4IFVA 3QYYA 4DG1A 3DMJA 3RB0A 1S6PB 2IC3A 2XI2A 5DLFA 1Z4UA 4ZP6A 4EO6A 5KFIA 1N5YA 4RW4B 4ZPBA 3BGRA 1T94A 2OPQA 3LP1A 2B5JA 3DOKA 1GX6A 3QIPA 1LWFA 5KFSA 4IFYB 4GC7A 2FLLA 4K4TA 5F9LA 1T03A 4ECQA 3H5SA 4PWDB 3D5MA 2IAJA 1XR7A 2YNIA 1U09A 2VG5B 2UVVA 1EP4A 2J6TA 3T1AA 3NL0A 2WOMA 4MFBA 2YKNB 4TQRA 3PW2A 3H98A 3I5AA 1RTJB 2YKMA 2ZE2B 5EDWA 1RT6B 2HAIA 2RKIB 1C2PA 3HVWA 1REVA 3KLFA 3PZPA 1S1XB 2R2SA 4ED8A 4H4MA 3BSAA 4DL4A 3ITHA 2WK4A 4QWAA 4Q0BA 1HMVA 4NLSA 1TL3A 3MECB 4WXOA 4XPEA 4DL3A 3TAMB 1BQMA 1C0UB 3E01A 4ZPAA 4NLQA 3KLGA 2ASDA 4LQ9A 1RT7A 3V81A 2FJWA 4NLVA 2E9TA 1JKHA 4R0EA 5I42A 1JLCB 4O3RA 1IM4A 2YNFA 4WYWA 2GIQA 3OSNA 5HROA 3V6HA 3I5BA 3G6VA 3Q8QB 1TP7A 3CDEA 4Q43A 3KHRA 1IKXB 2J6SA 4J9RA 4WXWA 5DQIA 3IG1A 4ED0A 4KO0A 4ZP8A 1HARA 1XR5A 3CJ2A 3DYAB 1TL3B 1T3NA 3HVAA 3V6DA 2BANB 5J2QB 4RW8A 3KK2A 1JIHA 3EZUA 2FVPA 4O44B 4R5PA 1SV5A 3OHAA 2BRLA 4HKQA 3CDWA 3SI8A 3T5HA 2WTFA 2RDJA 3FQLA 3BSCA 1OS5A 2YNGA 4WZQA 3LP0A 4RW9B 5DQHA 5HBMA 1LW2A 4F4ZA 1XR6A 1S1TB 1FK9B 2B6AA 3LP2B 3IGNA 2D7SA 1TKTA 2HNDB 3GYNA 3I5CA 1IKWA 4KV8A 1QE1A 3CJ5A 3DI6B 3IS9B 4B3OA 1RTIB 3T19A 3PJXA 2W8LA 3OL7A 4O4RA 3H59A 4EBCA 3OL6A 3H5YA 2FJVA 3NAIA 5KT2A 4NLTA 3KHGA 1S1WB 3ICLA 2D3ZA 3KLIA 4PQUB 5KG5A 4IDKB 3DRPA 2HMIB 1HNVB 1K1SA 3C6UB 4YR0A 4YR3A 3KHHA 2W8KA 4YMEA 2ZD1A 1ZTTA 4WYLA 4QW8A 4I2QB 4ECXA 2C28A 4J9MA 1JLBB 2C22A 5KT6A 3KK3A 3BR9A 2AGPA 3V4IA 3DRRB 4NLUA 2R8KA 1HQEB 5J2NA 1ZTWA 1TVRA 5KFYA 3MR5A 3H4DA 1S9FA 4LSLB 4G1QA 1ZETA 1RT5B 4ED6A 1VRTB 3QIDA 1FKOB 4KB7A 4IOBA 4Y2AA 2XGQA 3BQ0A 3LALA 5KG3A 4NLXA 1T05B 2XWYA 4K4ZA 1TV6A 1EETA 3FFIB 2DPIA 1SH2A 3N6MA 2WHOA 2C2EA 3UPFA 3DLEB 5T14A 1JLAA 3V6KA 3I0RA 3NGDA 4EEYA 4Y3CA 3NMAA 2CKWA 3CDUA 1S9EA 1NNDA 1IKVA 1SUQB 3KK1B 3SFGA 3TVKA 2C2DA 5DG9A 1C1BB 1S1UA 3T5JA 3DOLA 5J2MB 3D28A 1JLFB 4IH5A 3EPIA 2OPPB 2VG6A 2XCPA 4K4VA 3MEGA 4O4GB 5CYMB 1W25A 2I5JB 3KJVB 4RNFA 4RNOA 4DL6A 4WFXA 1J5OA 4U6PA 3RB3A 5L1JA 1RYSA 4IRKA 2ALZA 2R2TA 4TY8B 4XO0A 4Y2CA 1BQNA 5KFGA 1RT4B 2RF2B 4R8UB 1D0EA 1GX5A 3KLHA 3QZ8A 3H5XA 2VG7A 4ZMMA 5KFQA 4DEZA 2AGOA 3KMSA 4QW9A 1R0AA 4NLOA 2AQ4A 2V0NA 1IKYB 4NLDA 2XC9A 4RW7A 2W9BB 3IRXA 4MK8A 4H54A 4J9QA 1S4FA 3CVKA 2ZKUA 4ICLA 2HNZB 4LSNA 5C25B 4KFBB 1LW0A 4K4SA 3RB4A 3FQKA 4OL8A 5KFNA 3OL9A 1RT3A 4KHRA 3M8QB 3MEDB 2B43A 1FKPB 1MU2B 4K4YA 1UWBA 4IR1A 2ILZA 2XI3A 3PJWA 4ZPDA 3BSOA 4J9SA 1TKZB 4IG3B 1S6QB 2YNHB 5FDLB 3MEEB 1JLQB 1I6JA 4Q45A 3JSMB 5KT7A 5I3UA 4X2BA 5F8NA 1HNIB 1VRUA 3KLEA 2WONB 4QWBA 3KMQA 2FJXA 2HWHA 4ED2A 2VA2A 1JLGA 1RTHB 1RT1A 4RW6B 2AWZA 2R8HA 3BJYA 3KNAA 3LAMA 5KT3A 1DTTA 3JYTB 2CJQA 1KLMB 5JXSA 1SH3A 5DGBA 4O3NA 5KFDA 4EYIB 2BRKA 2IA6A 5D3GA 4MKAA 1C0TB 3DM2A 4WZMA 3C6TB 4M94A 3FSIA 3HVTA 5KG7A 3H4BA 3DLKB 1S9GA 4URGA 3ISNC 4I2PB 1TL1B 3BSNA 3DDKA 2BR0A 5J2PB 1S1VB 1N6QB 4MKBA 1TKXB 3M8PA 2V9WA 1HQUA 1S49A 2FVRA 3PHEA 3IN5A 2XGPA 3LAKA 3QO9A 5CYQA 2O5DA 3NBPB 2W9CB 4ECWA 2FLPA 1DLOB 3DRSA 3G6XA 5L1KA 3PW0A 2W7OA 1CSJA 3H5UA 4IH6A 1JLEB 4NCGA 5J1EA 5HP1A 4FS1A 4ID5A 1NHUA 3GILA 3GV8B 2VA3A 4KHMA 1LWEB 5C5JA 3Q8SB 4ECUA 1HPZA 4XPCA 4I7FA 4ZPCA 4IG0A 2ASLA 2OPRB 3I0SB 5HLFA 2ASJA 1LWCB 4MIAA 1C1CB 5KFMA 4EBEA 5C24B 1WNEA 2BE2A 4JV1A 5KG1A 3QLHB 3V6JA 2IM0A 1HYSB 4RUAA 4TN2A 1DTQA 4YP3A 4O3OA 3DLGB 2J6UA 4ZHRA 1KHVA 2D41A 5C42B 2D3UA 4QWEA 4ECVA 1RTDA 4H4OA 4KKOA 3OLBA 4ZVEA 4WE1B 4O3QA 3GQCA 2FLNA 4ECTA 3NAHA 1RT2B 4U7CA 4F4WA 4K4WA 4PUOA 2HNYB 3HHKA 5K14B 4KSEB 4IKAA 2W7PA 4J9PA 2OPSA 3PW4A 4NLWA 3QGIA 4IFVB 4QWDA 4DG1B 3DMJB 3BQ2A 1S6PA 2IC3B 3RBDA 4NRUA 1N5YB 4RW4A 4ED1A 3BGRB 2OPQB 3LP1B 2B5JB 3DOKB 5KFBA 1LWFB 3QIPB 4IFYA 5DG8A 4DL2A 2AU0A 4DL5A 5L9XA 1T03B 4RNHA 4PWDA 5L1LA 3GV7B 2IAJB 2IBKA 2YNIB 4WFZA 3GIJA 2VG5A 1EP4B 1S48A 2WOMB 4MFBB 1RAJA 4K4XA 2YKNA 3CJ4A 4WFYA 3UDLA 3T5KA 1QAJA 5F8HA 1RA7A 1RTJA 4F4XA 2YKMB 2ZE2A 1RT6A 2UUTA 2RKIA 4J9NA 1S0MA 4KAIA 1REVB 3KLFB 5EWEA 1S1XA 2XCAA 4H4MB 3ITHB 4MK7A 4ZVHA 3RB6A 2BQUA 4Q0BB 1HMVB 3MECA
chains in the Genus database with same CATH superfamily
1IJFB 3FDSA 4ZVSB 2CPXA 1V5IB 2EFGA 2HRUA 3HF5A 4QIWD 4UZCA 2GO9A 2V50A 4IO1A 1X0PA 4C4WA 3BGFA 5IV3A 3O5TB 1YITS 4LT6A 2OJ3A 2H5IB 3W1YC 3MURP 1F6TA 2GJFA 3J80Y 1DZ5A 1M1HA 1UW4A 1ZAXA 2ROEA 3I87A 3MDFA 4G1PA 4P2XA 2C1EB 1H73A 4JI1J 2VOPA 4OJ1A 2VPWB 1C4CA 2MGZA 3NGUA 2V6AA 1BXNA 1CULB 1FRMA 3PKMA 2BQRA 3HFZB 4KE5A 4DR1J 2RUSA 5E3QA 2DR7A 3L7OA 3KDOA 5GAEU 2V8DA 4H4KC 1H74A 2ATLA 4FZVA 3OVAA 3D67A 4DV5J 1H38A 4LVNP 4WJBA 5J2QA 4RW8B 1Q53A 1S99A 3FJ2A 1CLFA 2RSQA 3U1MA 3MM8B 4RZRA 2AJQA 1GXTA 4NXMF 5LMUF 4RUCA 3ILJA 1RWXB 2OEKA 1OYEA 3IMQJ 5FIIA 4WFAQ 1Q79A 4JV5J 2G1HA 2G1DA 5AE1A 2JEJA 3VZIA 3LP0B 4AL6A 5KT5A 4ZPVR 5ETSA 2D1CA 1RADB 4DPYA 3TANA 2V4RA 3L4BC 3BH7B 1S1TA 1FK9A 3PHTA 1DY3A 1JWWA 1TKTB 5L39A 4LMZA 3SIPB 3H40A 3IR7B 4QR2A 1NB2A 1CJKA 3GONA 5KG6A 3VAMA 1SQEA 4YY3J 3C2PA 3HKWA 3MR2A 3M1VB 1RA6A 4URQU 5K8PA 2C3OA 2A3JA 1NJWA 1ULRA 2HMIA 1HBOB 3DDNA 4X66J 3CE8A 3CO9A 1X4EA 4BC7A 4ZIWA 1NJZA 1MN9A 3C6UA 3CMES 4K0KF 3OW2R 4HYKA 2QC3A 3MPWA 1NK6A 2VKZG 3VQSA 2BEFA 1CQMA 3GU0A 3UWTA 2K3IA 3T9ZA 1RWOB 3Q8VA 2I6WA 3DRRA 4OYMA 1ZBTA 3NNCA 1OQ3A 5DM6Q 4DX8H 2F8EX 1G7CB 4GO5X 3QRRA 2ZNYA 3Q83A 5K8MA 2D3O1 1RT5A 2IM2A 3CO0P 4IH7A 4TVAB 1RWPB 4N8OA 4Y2IA 2Q43A 2B3TB 3WC0A 2FGCA 2MLXA 4UF4A 1T3OA 4M95A 2CRLA 5D15A 3RAXA 1T9WA 1EETB 3P4UB 1UPMB 2IVMA 1VQKS 2J9EA 3W3SA 1YRTA 2VONA 2F3JA 3I0RB 3OR1B 4ZVFA 3LTOA 3SYZA 4MTPA 3OTBA 4RL1A 1NK4A 3UD4P 3RR7A 1YVFA 5IQ6A 4JBCA 4WIQA 3CJSA 3KK1A 2W4DA 4LIWA 5A2QU 4C3KA 3QGGA 4AL5A 4PZVA 1KN6A 2R9LA 4IRCA 1WHXA 3L7UA 2VG6B 1AFJA 2RVJA 3OFFA 2QRRA 2HK2A 1CJUB 2CQBA 3MF5A 3N5FA 5CD4H 3IP0A 4FBTA 1BQNB 5B0GA 2GAGC 5KFPA 1HWLA 1U02A 3CPWR 2XG8A 2VBYA 4K5SA 4K5RA 4X4RA 1YJ9S 2R7TA 2P5VA 2CJXB 4OQJA 2F1FA 2RDIA 3RAMA 5KFOA 2ZH4A 3R2DJ 2R7SA 1NH7A 2XQCA 4DPXA 3IRXB 4HVZA 2C3PA 5BJRA 2XSFA 2BJDA 1Q95G 3C14A 4CLYA 3IBWA 3B82A 5ETNA 1X4HA 2G0IA 1XN9A 5JVHQ 4F04B 4ZIVA 4DCJB 2HS0A 5RUBA 2WSFC 5U47A 1FKPA 2MKIA 2OFGX 4PAAA 2W2PP 2YX1A 4IG3A 4CLKA 4RU2A 2LMIA 4B9MA 4LF4J 3BGUA 1DRZA 4B3TF 5CCMA 1FXDA 3W2VB 1MMDA 2IM1A 1FNMA 3ONQA 4DV2J 1CQNA 2WW8A 1SJ4P 3C46A 4X4VA 3JSMA 2PI4A 3AB2B 1NHVA 3Q24A 3G2XA 4J5OA 2OH2A 1G1XA 3TUJC 1RT1B 2DXEA 3GLJA 5KFKA 2UVWA 3RR8A 1N0VC 1UPPA 2LECA 3THTA 3N5BA 1YTYA 1KLMA 4JI6F 1CPZA 1FHTA 1ZA2B 1FJ7A 4Z2XA 3BN7A 3DM2B 4ANDA 4F4YA 4NLRA 4DR5J 2UUAJ 1UAWA 4NA2A 2R8JA 1GFWB 4I2PA 1DARA 4P71A 3GE9A 4FS2A 1WI6A 1S1VA 1N6QA 4P72A 3MCOA 5DS7A 3UN3A 4DMZA 1HBMB 3GIKA 4DV6J 3MR3A 2AJFE 1VQ9S 4DL7A 5IWAF 4ITSA 4B02A 3HSGA 4USJC 2HFSA 3FMBA 1M5PC 2JC1A 4RWXA 4DSKA 1TQLA 1DLOA 4M1KA 3JTOA 3O2IA 3OLAA 1OPIA 4K2JA 5BR8F 2K8GA 1F9EB 5J1EB 1FT8A 1HR0F 4KPYA 3K5NA 4NLPA 3CC2S 4DV4J 2IDEA 4ID5B 2VQFJ 1I94J 2O66A 1YRXA 2Z30B 2R8GA 2YXLA 1HPZB 2G2OA 1FX2A 1TELA 4I7FB 2DIUA 3POTB 4IG0B 2BDPA 3IWNC 4LFAF 2OPRA 2IRXA 4ZJOA 2V69A 4EBDA 4PQAA 4HTJA 5IS2A 1LWCA 3QBCA 3K58A 3W8PA 4YHHJ 3VAGA 2CDQA 2RQKA 2Z2YB 3VCDA 3ZZUA 3M8ZA 3FCVA 2NSBA 2WVCA 4ETXA 3LWMA 1DTQB 4DF8A 1SJFA 4ILMA 4ZHRB 1PYTA 1S10A 1XNRF 5A8WA 2FVQA 1HR0J 1YBAA 5AJ3J 4LR8A 2UUCF 1RTDB 4H4OB 4B9SA 3ISND 3GP9A 3VAIA 1KLNA 2DNZA 3JTNA 3M6XA 1YRUA 3EM1A 5C2CA 3K5PA 2MQPA 2DR8A 1TFWA 4MIWA 3MM5B 2DVIA 3M9MB 2MKCA 4DX5A 1SJRA 4UOFA 5K14A 1FERA 3CCWA 3QFHA 2OPSB 3PNIA 2PSZA 4IFVA 1S57A 1UW9A 2NS1B 2DNYA 4CO4A 5DDPC 2X1AA 5ADZA 2ZJRQ 2VJUA 3RB0A 3N01A 3QRQA 2O3DA 2FJAB 3L7PA 3DOKA 3MM7A 3X1LB 1L3TA 1KONA 2CQ2A 1XWLA 1H2VZ 2G9OA 4NWBA 3ZO7A 2FLLA 4B9NA 2NXNA 5ETKA 5F9LA 1VBZA 3T3FA 2CPHA 2RNEA 4OX9F 4L74A 2BACA 4ZDNA 3WZ0A 1YQHA 3T1AA 1X4BA 2XYPB 2WOMA 3BKUA 4MFBA 2NUHA 2OLWA 2LKZA 3PW2A 2FHJA 4GKJF 5DZ6A 2AV5A 4ZS6A 5LXRA 2ZE2B 3Q2TC 2ZVSA 3VGVA 3KLFA 4O0IA 4K4XA 1EIYB 3K5LA 2PIIA 1JB0C 3BSAA 2B7CB 2E29A 1O51A 3G6ES 1B99A 3GJSB 4PWWA 1IBMJ 4M5GA 5CZVA 2ADCA 4DL3A 3VHQA 5AXMA 1BQMA 4ZPAA 4F8RA 3O1LA 3Q89A 4NLQA 4JI4J 2ASDA 3DNCA 2MZSA 4OI2A 1RT7A 2A2CA 2Y9HA 1BMQB 1RZMA 4R0EA 3ENVA 3NY0A 1UFKA 3D0HE 5C2GA 3AB4B 3EVWA 1VYAA 5G4DA 3KFWX 2ZJPQ 2GQ2A 3LGMA 2KRBA 5GAHI 3V6HA 2AHOB 2DRBA 4W90B 1HA1A 3CDEA 1FTCA 2BKOA 4RO0A 2RHSB 2X51A 1HARA 2VFUA 5AE2A 5AXNA 2XMUA 2QLXA 1KSPA 2MKYA 1ZPWX 3PRDA 1JNRB 2QG9B 5GAGU 2E5IA 3QMQA 5LMNJ 4C98A 5CQGA 5J2QB 4RW8A 1JIHA 1RU2A 4KRWA 4DV3J 2NLWA 3PO4A 3OHAA 4HDHA 1WTFA 2WTFA 1R27B 3FQLA 3BSCA 3SCJE 2CFXA 1RHQB 2YNGA 1TFYA 3C3LA 4USMA 1WWHA 2VQEJ 3DKDA 3N79A 1O0PA 3Q86A 4J7CA 1RCXB 5HK4A 1S1TB 2DEIA 4UOCA 4B3RJ 3Q8UA 3CCQS 3PX6A 4B3OA 4AD6A 3NS7B 3RUBL 4EBCA 1FTRA 2YWKA 1JXEA 3H59A 3OL7A 2P2CB 3OL6A 4GRSA 2BABA 2KYZA 2AZ3A 5LT5A 3D2WA 2ZBCA 2D3ZA 5EHHA 4IDKB 3DRPA 2E1PA 3JQKA 3C6UB 4YR3A 5LSLA 3KHHA 2W8KA 3OJUA 2ZD1A 1ZTTA 3FCWA 4MYTA 1G2EA 3R7NB 3EZOA 3ZZPA 2C28A 1JLBB 3GSIA 2NXEA 5KT6A 3RRHA 3QJPA 4KJIA 3KK3A 1HFEL 3EUNA 3N9UC 3DRRB 3CD5A 4NLUA 3J7ZT 3K57A 5J2NA 3UO0A 4AQYF 1TKDA 1S9FA 1K73T 3MPVA 4QZVB 3OT9A 1ZETA 1FI4A 5T7LB 1CEZA 5IQQA 1XMQF 3HXMA 1N54B 4LVOP 5KG3A 4UUXA 4Z7CA 4WFNQ 5CYJA 1EETA 3MHYA 3J81j 1VLOA 2DGXA 3HSZA 4TLQA 2C2EA 2RIJA 1P9QC 2QYGA 4XDCA 3P3DA 2H51B 1MLAA 1IBKJ 2XHCA 2QA2A 3NMAA 3MCNA 1RB0A 3R97A 1FE4A 1N36F 2XMAA 2KO1A 2HFZA 1QDUB 3PEHA 4WWSA 2OMLA 2WVDA 3D28A 4IH5A 4CDIA 1H2TZ 1RKIA 2VG6A 3HP6A 3EPIA 3IR6B 2XCPA 2HVEA 3DGVA 1W25A 4O4GB 3O6QA 4DV5F 3MD1A 4RNFA 4B3SF 4WFXA 1J5OA 4ANEA 1RYSA 5L1JA 2ZBRA 3CF5Q 3FSXA 3NLCA 5KFGA 3IXQA 2RF2B 3RYLA 4WPAA 3H5XA 4GVLA 5IZHA 1OY8A 3QT5A 3DLBA 2IBOA 1RHRB 3BO2A 2AGOA 2F9DA 3EJMA 4QW9A 2LU1A 3KMSA 3BS9A 1RWWB 4DOZA 1D9AA 4X4OA 2FUG9 4NLOA 1N8RT 4LF9F 3CC7S 1XEZA 3EGNA 4N7TA 4E98A 3MEKA 3W63A 1GMVA 2L08A 3HHLC 1NPRA 4UUWA 4NLDA 2LDIA 4KC5A 1D09B 1D8ZA 4J9QA 2XLKA 4FNHA 4KGKA 3FGVA 2W4CA 3C14B 4O23A 2NSCA 2GHWA 4DV0F 1WJ9A 4C3LA 3FQKA 4OL8A 3CDAA 3HFVA 2DNPA 5DDRC 4KHRA 3HULA 2B43A 5D8HB 3CJKB 1FKPB 4N56A 2XNQA 2JHEA 2VPXB 3BZQA 1KQSR 2DNQA 2HQFA 2MMYA 4IG3B 3R27A 1WSVA 5AJ3F 3SQGA 1EZZB 1K8AT 2YNHB 5FDLB 2V5HG 3MEEB 3ULHA 4PEOA 1I6JA 2MPUA 1UFLA 1YKWA 4ZCLA 1ZZFA 3BM7A 3SQOP 3QT7A 4M5MA 3DHWC 4DFKA 3KLEA 3KMQA 1CC7A 3A13A 3A4TA 1IJEB 3C8YA 4ED2A 2QEXS 2MEWA 1FJGF 1RT1A 4GKJJ 1XC9A 2AWZA 1DTTA 3JYTB 2CJQA 2LEPA 3WIVA 3M2RB 2FD2A 1FDAA 2QTWA 4MKAA 3CC4S 2J8AA 1P6TA 3M6WA 4NCBA 3FSIA 3UDVA 2AEFA 2BOPA 3DLKB 3KUGA 2V68A 3J7YU 2MKSA 4OI6A 3US5A 1AA1B 2KRRA 1IUJA 3MMCA 1HBMA 2E1AA 3CDBA 2CQ1A 2FHMA 5SZTA 1HNXF 1WOSA 1Y9OA 2LU2A 3DHXA 3IFEA 1A0OB 2O5DA 4B17A 4ECWA 1WEZA 1DLOB 3G6XA 4N41A 2JDJA 2PMWA 2KG1A 1EKRA 1NZAA 5J1EA 2H4WB 2W2QP 3AXKA 3D7SB 3ZZRA 4ES2A 4B9TA 4LRBA 2HZVA 5IT0A 4JB8B 2VA3A 3GILA 1HWUA 3NP5A 4ZJQA 2CQ4A 3Q8SB 1IBMF 3A8EA 4PG5A 2MKJA 4IG0A 4ZPCA 2GVDB 2JL9A 2OPRB 4C8OA 4PG7A 5DDOC 2BJ1A 2GAHC 1B70B 1VK8A 2NYHA 1LWCB 2J8SA 4WTYA 4M63A 4USIA 1KOHA 1WNEA 1T11A 1Q7YT 4JV1A 3OXGA 2Z2ZA 3F44A 3HZGA 2IM0A 3V6JA 3AXMA 2NPIA 3KXDA 4TN2A 2VJVA 1NK8A 2FHJD 2UU9F 3AJDA 5CCLA 1KHVA 2D3UA 4YFUA 2OHDA 3PIOQ 1BGXT 1RTDA 4H4OA 3CJQA 4IQMA 2RMLA 4JI5F 1Y7PA 4WE1B 4ZVEA 4KHPJ 4F4WA 3OFEA 2HVHA 3G8QA 3B54A 4K4WA 3O3LA 2PGCA 1HBUA 2HNYB 2J9CA 5K14B 4F3MA 1M90T 3PW4A 1W7WA 2OPSA 2W1BA 3J80U 2P9EA 4CTAA 3RW6A 2ZNZA 3AD7C 3K8WA 3MD3A 1T9YA 4QYZK 2FZGB 3KWMA 1B7FA 2OPQB 5GAHU 2L9NA 3Q2SC 3MM7B 1LWFB 3J81Y 5DG8A 2B4VA 4K7QA 1HI8A 2KXFA 1NHKL 1NRKA 1X4GA 4DL2A 2AU0A 1AXQA 5L9XA 3CTRA 1T03B 4RNHA 3M8SA 4PWDA 3ZZTA 5HVFA 4A8OA 1VQYA 3GJRB 2ZBQA 4NEZA 3ZZYA 3GIJA 3CCUS 4UOGA 2WOMB 4K59A 4MFBB 2V34A 3CJ4A 1WACA 3T5KA 2HHHF 4F4XA 2BV3A 3KUEA 1LXNA 1RT6A 2UUTA 3HDSA 1X9SA 3PKYA 3KLFB 1RAAB 3UNYA 2GQCA 1FNXH 1YWXA 1F5AA 2CWXA 3EICA 3DXSX 4Q0BB 2MB0B 3CD6S 4HHHA 2BJ3A 4K2XA 4KQZA 3TAMA 3N6LA 5F9NA 1BQMB 3GJQB 4OHWA 2PMZD 1EX8A 3D0IE 1ZYQA 4DN0A 1RT7B 1Y5NB 2OAUA 3CB4A 5DZ7A 3TA1A 4WCEQ 4LQ3A 3HHNB 3RBXA 4L6V3 3FEYB 2HHPA 3FBCA 2R7VA 4LFBF 3VTIA 4K0KJ 3BDEA 1XTZA 4PYAA 3UR0A 4LFBJ 3MI7X 3EWGA 1YI2S 4FF4A 1X9WA 1SQFA 1YDLA 2DR9A 2BQ3A 4O3SA 4USWA 2RJZA 3W9JA 1JNZB 3TR5A 2J9DE 1VK3A 2XMJA 5ETRA 4X64F 1FEEA 5KFZA 1F9FA 2KZMA 4NRTA 5GAEI 2MQQA 2ZJQQ 2YVSA 4QU7A 4MH8A 4WIIA 1MN7A 2LA6A 3EZ5A 2IHR1 1S7HA 2LXUA 3VGUA 3BBCA 3G86A 4B3SJ 5A0YB 2AF6A 2YNGB 1FCAA 3U02A 5KFJA 2E5JA 1KR4A 1UEUA 1LW2B 4P73A 2MQOA 3HVRA 2EXUA 2L3MA 3R6LB 4LSZB 2NYIA 3MMBA 3MUVP 3R5BA 2JZ5A 3UFCX 2QJ3A 2QE5A 5DO2A 2IVYA 2KHCA 3ETOA 2HNDA 2UXDJ 1U1QA 4KV8B 1OY9A 2ILYA 3DI6A 2Q6CA 4B3OB 3D68A 6AT1B 1RTIA 4OX9J 3IGVA 1T9TA 2AX0A 5D0EA 2EFVA 4EMDA 3MPDA 2DTJA 2CPEA 3QT6A 3KDNA 1AYEA 2DR6A 3KLIB 5ETLA 4IDKA 3DRPB 2QIFA 1VQ7S 1RXOB 1NM2A 2G2YA 3TZWA 4ELVA 4IQXA 2YQ0A 5EWGA 2X3GA 3I9V9 4ZVGA 3JAMY 2ZD1B 5A8RB 4JI8J 4IOAQ 3NMRA 1JLBA 3Q8YA 1FVSA 3ILLA 1Q8BA 3KK3B 4ETZA 1AT1B 1VBKA 1HQEA 5J2NB 4K4UA 4JI2F 1MWZA 2XWXA 2A0FB 2AKWB 3TZYA 4FPIA 4MIBA 2XZTB 2EWHA 2RT3A 4JUZA 3PDNA 1VRTA 2F4VJ 1NUEA 5T7LA 1VBYA 1TL7A 2XLJA 1NMEB 3IRWP 1TV6B 3H20A 5IT4A 1J5EJ 2Q66A 2CVIA 1U26A 4KTQA 2UP1A 1ACMB 2UUAF 3GV5B 2OD6A 3MFIA 2ZHAA 4U8YA 3JS9A 3W5XA 3UCZP 1IBLJ 1V5VA 3ADAC 1TMMA 4U7UK 3T1YJ 1IKVB 1S79A 2CVEA 4WF9Q 3SSSA 1T9UA 1UVKA 2E5GA 2B4OA 2GJIA 1VC5A 4OYZA 1K47A 4AL7A 2N7YA 3ZTRA 1KBRA 3IBCB 3MEGB 2BE9B 4O4GA 2QT7A 4W92B 5THWA 1J5OB 3FBEA 3LANA 2VFVA 4QIVA 1G3OA 1UZDA 4OIXA 4OZLA 4P2MA 2V2KA 2CZVC 2MSTA 2HS3A 3MTKA 5BYRA 2RF2A 2VC1A 2XB2D 3GSDA 3KLHB 4CO5A 2XLIA 4EYHB 4FN5A 3ILOA 2VQFF 4J9OA 1PBUA 1DQ8A 2HG4A 2PA3A 3G4SS 3H2VE 4GVBB 2MJNA 2JLFA 3FZBA 2HHQA 2F8HA 3R1HA 3QJLA 1O5JA 1PO6A 4A8MP 2MQMA 3OD2A 5F8MA 2KL8A 2POKA 3B4DA 4ILLA 4RW7B 1VJWA 2PT0A 3DC2A 2JEIA 2YX4A 3WC2A 1QTMA 3D3CJ 2KKHA 4OHZA 3FCHA 3FEXB 1RYRA 4ZLLA 2P9CA 1Y4ZB 3H2LA 2R2RA 3HI9A 4YDDB 3V5RA 2XS5A 3M8QA 4KPCA 2CJYB 2Q6BA 3CJKA 4CH1A 4ECZA 3AOCA 2XULA 4FXVA 1N34J 1KVKA 1QD1A 4F0HA 5CAAA 2ZUAA 3T9NA 3VV2B 4DN9A 3CIZA 4RNNA 2CADA 1HW9A 2E66A 3RGIA 4QWCA 3SQGB 2CUYA 2V4JA 3HD1A 2YNHA 5FDLA 2BYCA 2E9ZA 3MEEA 2MKKA 3QRPA 2AX1A 2MJUA 2HFUA 2ZFHA 3Q8RB 1HW8A 5GAGI 2AYGA 3IM9A 3KLEB 2WONA 5HANA 9RUBA 5EWFA 3MAQA 4A8WA 1N33J 2FJEB 1WHYA 4KBIA 4JI1F 2NXCA 1DTTB 3JYTA 1GAOA 2QLJB 1U6BA 2CIMA 3M2RA 2VF3A 3T6BA 1NBEB 3EVOA 3BPSP 1MWYA 1NK0A 1VS3A 2GC8A 2J5AA 5DGAA 1N34F 3HVTB 1Q81T 3DLKA 1RLDA 3DOMB 1K1QA 1WKLA 3D1OA 4EU0A 5J2PA 2YQ1A 3MMCB 3OXLA 1FX4A 1TKXA 3M8PB 2KI2A 3E51A 3SXLA 3AT1B 4Y00A 3W61A 1UVNA 3MOZA 2VOOA 2WB4A 3QATA 1NKEA 3PYEA 2EC2A 3N6NA 4C0HA 2U1AA 1B7YB 2Y0BB 3NGSA 3TO8A 5KFEA 4Q8EA 3NBPA 3QZ7A 3KTQA 3DRSB 2Z2MA 3ILIA 4B3MJ 2HFOA 4RU9A 3NWGA 1YJNS 1NK9A 1OMSA 5GADI 1KRPA 2CNLB 2MY7A 1GMUA 2AEMA 5KFWA 4Q44A 4DX7A 4X4QA 3E2EA 4UQTA 2JSXA 5AXLA 1I1GA 1PBAA 3THPA 4ZLJA 2HHTA 2A6MA 1L3KA 1YJTA 3GIMA 4C9DA 3HHLD 2GVDA 2YWEA 6FD1A 5HLFB 2VPZB 3TJ9A 1XNQJ 3HT3A 2IIHA 1HWIA 1WELA 2BE2B 2BE7D 1H0HB 1HYSA 2G4BA 2DKOB 3W9HA 4QBUA 1H3DA 4TY9A 1CVJA 3CMQA 2DCLA 5KG2A 3NS5A 2YWGA 1L3UA 5HQLA 1V3SA 1D3WA 1I51B 2F65A 2FZCB 3A3PB 3MMJA 4DHVA 5KAKA 4KKOB 4DX6A 1WDDA 3CCJS 4WE1A 2CAJA 3AJ1A 3BEGB 2MXYA 2QLFB 2UVUA 5LMNF 1RT2A 5EUHA 2LP4A 1FF2A 5GVQA 2WRMA 3PFOA 5L46A 4ED7A 1KQGB 3D1HA 4LFCF 3M6VA 3PW7A 4TYBA 1HBUB 2HNYA 4EK2A 5IXUA 4RR5A 2HQGA 3QYYA 4CTAB 3VWSA 3PACA 3MXHP 4FYXB 4DFPA 3LPEA 2QA4S 5DLFA 1VQOS 2D3OR 4EO6A 3HT0A 1N5YA 4DZDA 4ZPBA 2NXJA 4OZJA 4Z7YA 2OPQA 4BHQA 5A76A 5B08A 1LWFA 1TUWA 2F9JA 4GC7A 2LXFA 1ZM3A 4DXLA 1U1RA 4FKYA 1L5UA 1UWAA 2RAQA 1T03A 5A8KB 3KKFA 4PWDB 1QAXA 1MMNA 2BKPA 3D5MA 1S7IA 3ELHA 3QAEA 1XR7A 2YNIA 8ATCB 2IMOA 3MWBA 1KD1T 2UVVA 4YEAA 4JI2J 2D9PA 2V8PA 3HO1A 3NL0A 5I4MA 1U1NA 1Q8KA 1SXLA 3H98A 3GR1A 4CO3A 3LF0A 4I1TA 1RT6B 1REGX 3VR1A 4RUHA 1S5ZA 3BN4A 1C2PA 3HVWA 2KG0A 3PZPA 1U4BA 1BC6A 1S1XB 2L41A 4ED8A 2WBRA 4OX7A 4FXWA 4DL4A 4OJHA 4QOTA 2QLBB 3R8YA 4I56A 1IWGA 4Q0BA 1HMVA 1FRHA 3UDEA 4DS4A 3ETMA 4U96A 4F4KA 4GO7X 3TAMB 2PD1A 1C0UB 4PXBA 4NMXA 2GV1A 5IM0A 4M5LA 2HQ3A 2GCFA 1V3ZA 4LQ9A 3V81A 5IWAJ 1WC5A 1HNWJ 4L3NA 2YNFA 1RU1A 2CPDA 2DGTA 2EG1A 2GIQA 4LRCA 1HHQA 5HQMA 1B0VA 2QA1A 1N0UA 1UJ4A 2RDDA 3I5BA 4A8XA 5KTQA 4DPUA 4JI7J 5CD4A 1JJ2R 1IKXB 2Z2LA 3TWZA 1VQPS 1HNZF 4NX9A 4KO0A 4ZP8A 2ZH1A 2Q1LA 3CJ2A 8RUCA 2MZRA 1R8AA 3T1YF 3HVAA 5HN0A 5F0UA 2XYHB 3EZUA 1UP1A 3K17A 2JJ4D 3AOAA 4R5PA 1SV5A 1OQ6A 3EMTA 2J0QD 4OHYA 1H2UX 3CDWA 5A0YA 4DR2J 3SI8A 1KTQA 2RDJA 4DS5A 1L3SA 4LBIA 2CQHA 5DM7Q 1EARA 1HQ2A 2DNNA 2DITA 3PRBA 4WZQA 3I82A 4ANCA 4AXIA 3CMAS 1LW2A 4OI4A 1TL4A 2JFKA 3C19A 5AT1B 1EAYC 4Z37A 1FDBA 3CEDA 2B6AA 2OD4A 2AYMA 3MMBB 2D7SA 1SPBP 5KOWA 2MSSA 2CJ9A 2HNDB 1SC1B 1IKWA 4KV8A 4CLPA 1QE1A 4I4BA 2QL7B 2EKYA 3DI6B 4LF7F 1RTIB 2RE1A 1WG4A 2GMJA 3PJXA 1P27B 1RACB 1TK0A 3H5YA 4OHXA 3TNVA 3R3TA 5KT2A 1YJWS 1F5CA 3MM6A 1KVIA 4YHHF 3KLIA 3LWLA 2C2MB 4C8NA 4B3MF 4MJKA 1XNRJ 4CYUA 1K1SA 1YK9A 2RQMA 2XS2A 2ZH2A 1NZ8A 6FDRA 3WDOA 4XDDA 4WYLA 5A8RA 3S6EA 4OYAA 4DPTA 5SUHA 5D77A 3MR6A 4ECXA 4F2SA 5HSPA 1QSYA 5B7WA 4NA3A 4DCOB 2XM3A 1YG0A 1LFPA 5E0OA 1HQEB 5JJBA 5KFYA 3H4DA 2V9KA 5FJ4A 1LK7A 2W25A 4ZVOB 4X62J 1FO1A 4G1QA 2B9YA 1HL6A 4ED6A 1VRTB 3FEZA 1UEVA 2DNGA 1FKOB 1S6UA 1TL7B 3QIDA 2N4CA 2GHVC 4LBHA 3LALA 3BQ0A 2FY1A 3M8YA 4K4ZA 1TV6A 1RUSA 3FFIB 3TRGA 4HI2A 3T6JA 2UUBF 5AE3A 3NGDA 2BBEA 2LDYA 1FXLA 2OI2A 3SZ2A 3CDUA 1BY9A 4DQIA 4DSJA 1IKVA 2C2DA 1S59A 3TUIC 3TVKA 1LWXA 3RBZA 3EE3A 2BZ2A 3P5BP 1S1UA 1F5BA 1M1GA 4CLWA 1AB8A 4WK1A 3CIMA 5ETMA 3GG1A 2UV8G 4DUZJ 3MEGA 4K4VA 1TK8A 2HURA 1RBOB 4F36A 4E0DA 1F2GA 4Q5VA 4RKUC 2Z8QA 4XK8C 3MCSA 3EDRB 1HBNB 5HATA 4FYVB 4R8UB 2F4FA 1D0EA 2IA0A 3KLHA 1FRXA 4FP9A 3TZXA 4UY8T 2VBWA 1ZM4A 4GVBA 5CH7B 4DQPA 4L72B 2AQ4A 4ZJLA 4JI0F 3PX4A 2FHKA 5B0FA 3CULA 1JJHA 5LL6d 3CJ8A 4RW7A 4IUFA 1S4FA 2YY3A 4YUDA 4DSIA 4KFBB 1ZPVA 4K4SA 1CJVB 2RRNA 2X7IA 1U8SA 2ZKTA 3MCMA 3R9LA 4EZ9A 5L9NA 2CWKA 2VDHA 3AD9C 4OMFG 4IOCQ 3M8QB 1NPPA 2ACYA 4N76A 1IVZA 3O44A 2V2ZA 3GCXP 3MGJA 4K4YA 2ILZA 2XI3A 3KJQB 4JYAJ 3IAM9 4ED5A 3OJSA 4JI8F 1WDTA 4OYWA 2XO7A 2V4JB 3RTVA 4B08A 3QJJA 2OTLS 4U7UD 4Q45A 2JVOA 1PJ7A 4ZKAA 2ZDOA 2FYXA 5LSOA 3ZZZA 2WONB 2V2VA 4USTA 4X65J 3BPDA 1OSCA 5BYSA 2DD8S 2EG2A 1HLWA 1RTHB 3NRBA 4ZN3A 4RW6B 2I38A 4ZITA 2R8HA 3FNNA 4CO2A 4LF5J 1SH3A 3NG8A 1NCLA 2CNNB 4O3NA 3L09A 4Q7AA 5D3GA 2CQPA 4HACA 4M5DA 4USHA 4ALZA 1EQMA 5K8NA 4A8FA 4M94A 1PYOB 3K7RA 3HVTA 3SCIE 4CH0S 4GKKF 1S9GA 2YWFA 2EKNA 3DOMA 1GEHA 1RAGB 2JNJA 4ED4A 5J2PB 1GMWD 1IBCB 3D6FB 4BDPA 2A10A 1TKXB 3M8PA 3K2YA 3TEGA 2PFDA 1X4CA 2BX6A 1WD6A 1HQUA 4OV1A 4Q2MA 3UR3C 4DPWA 4DZ6A 2WVFA 4KH0B 3AJ2A 4DR2F 3LAKA 1UA1A 4F3QA 5CYQA 3R6GB 3NBPB 5IFMA 5FLXU 1SJ3P 2FLPA 3DRSA 2Y1LB 2OUGA 5L1KA 4LIRA 1BWVA 4ZLPA 3L9ZA 4FF1A 1YX2A 4NE9C 4NCGA 3GCWP 2OTJS 4FS1A 1WC3A 2NUUG 2VFRA 2RRAA 3R2CJ 4DR5F 1HD1A 1N88A 1LWEB 1SJQA 2HBZB 3IWLA 2KB2A 4QR0A 5C5JA 4ECUA 2Z58B 3L3CA 2PDAA 5E3AA 3I0SB 5HLFA 4DV2F 1Q0NA 1T9VA 1QUPA 4X4SA 5KFMA 4EBEA 5C24B 1U1OA 3RRGA 3TJ8A 2BE2A 4J9NA 4CT8A 5KG1A 1JXVA 1W2IA 1HYSB 2GVZB 4F2RA 4QJVA 4CLSA 4O3OA 2J6UA 2D41A 3VGTA 4QWEA 5C42B 1K0VA 1VHIA 7AT1B 2DH7A 4JI6J 4KKOA 2E5HA 3IAS9 1XMBA 3OLBA 2FLNA 5DETA 4ECTA 3NAHA 1RT2B 5D0RA 1LEOA 3TZZA 1Y5IB 2R7XA 4IKAA 4MKVA 4KSEB 1W26A 2PA8D 2ZBPA 4HI1A 3NGTA 4V19X 1P8GA 2D74B 1ZA1B 3I31A 1VCTA 3M4XA 3BQ2A 3OTDA 1N5YB 2DNOA 4RW4A 3F41A 3HFKA 2ZOGA 4WBFA 4ED1A 3LP1B 1LK5A 2CZ4A 2V8GA 1UZHA 4NXNJ 1OPZA 2DRAA 1E6YA 2CG8A 2Y1IA 5FLXY 1BHNA 1VISA 4PG6A 5CZXA 4CRJA 2A18A 3CJRA 4M5KA 4DL5A 3QQCD 2YBVA 5M2RA 3BBFA 5A8KA 5L1LA 2FJBB 3HCXA 4M5HA 3HPOA 4CLZA 3W2WB 3UN5A 2YNIB 4WFZA 1AZSB 2UXBJ 4DV7F 3TVZA 1FJGJ 2ZBIA 1QAJA 2BM1A 1RA7A 1RTJA 2DY9A 4L76A 2J0SD 2AD9A 1Q7LB 2ABYA 2O67A 2Z56B 4I68A 3C66A 2ZUGA 4I6WA 5EWEA 1S1XA 2FQQB 2KHDA 2XCAA 2H9ZA 5ETPA 1VBXA 3DLLQ 2DPJA 4DL0C 1HMVB 2JC0A 1TL3B 3H7HB 3PCOB 3QWUA 4ES3A 1PYSB 5L1IA 5F41A 3TEHB 4F25A 1NDKA 1WHVA 3KLVA 1C0UA 5IM0B 2GGPB 3KLGB 1SH0A 2AJ1A 2BXJA 2R4FA 3N28A 1R8PA 2FDNA 3V81B 1NPKA 1CJTA 3EGVA 2HRTA 4WP9A 2IY5B 1QY7A 2LEAA 2YNFB 4DFMA 2XY7A 4CLFA 1PC5A 5G0RA 4KT0C 2HWIA 2M0GB 4RBUA 1IKXA 4UZBA 3FUYA 1M5SA 4OI0A 1RE1B 3IG1B 4ZPWR 5KG4A 4KO0B 1CBKA 3QGHA 2AGQA 5KFLA 2W9AA 4J37A 2W2NP 1NJYA 2WW4A 4ED3A 1MSWD 4YB6A 1FD2A 5DJBA 1SB6A 4C8MA 2BANA 2F4VF 3HZEA 3TA0A 2QMXA 2KXHA 3LO3A 1ZZNA 1TUVA 5F8JA 1J2VA 5B0CA 1MNEA 1X4FA 3UE2A 1R8HA 4R5PB 1SV5B 2K7JA 2W24A 3W5ZA 5BXIA 2ZH7A 4PWUA 2AW0A 3NNHA 2DRDA 4DR7F 3KJNB 2EFNA 3CT9A 1F2HA 2JOQA 4RJVA 1S0VA 3LH2S 3D6TB 4L75A 2HVZA 2L9DA 3TQEA 2ZEJA 2UV8A 4ZP9A 3WQPA 4GKKJ 1C4AA 2B6AB 3JB9k 3Q8PB 3V2UC 1RHMB 3DRXA 3U27A 1IKWB 4NYZA 2RQCA 1QE1B 2KFNA 2QMWA 1L3VA 1ZH5A 3TYTA 4YOEA 3TP2A 2OMOA 1JX4A 3ZNUA 2E7XA 1YJ7A 1Q78A 3G96A 2FGOA 3MM6B 2Z57B 5D4OA 2JLEA 2K1RA 3JSRA 4PQUA 2QA4G 1QAIA 1WF1A 1M0SA 3CUNA 1HNVA 1FJEB 1UVJA 4CYUB 4YR2A 4M5NA 1WUUA 3HSJA 4PXEA 3CCES 4CO1A 1FVQA 1XK8A 4FPRA 3GIIA 1AUDA 4IRDA 2YH1A 2V63A 3WIUA 4YN3B 2ZWPA 2M7SA 1R8BA 4C11B 4NZ7A 1X5SA 1U1MA 2MTLA 3HD2A 3FKBA 4G1QB 3MPYA 3MFHA 4BWMA 5KFRA 3WHIA 1KFSA 1N32J 3J7A1 3SDEA 1FKOA 2N4DA 3NKYA 5HMZA 4PCQA 1FFSB 3AODA 2KM8C 2ZHBA 4DV3F 1HNWF 1T05A 2XMKA 3FFIA 3CJ0A 3RG6A 1FD8A 1RHUB 2XYGB 4OYPA 3EPGA 3SFUA 1Y10A 4JOUA 1WF0A 3K5OA 4ZP7A 3NGKA 2MZQA 4C48A 3CSKA 4H4KA 1S1UB 1A7GE 1MMLA 1I3OB 4RNMA 2B9XA 2DHAA 5CYMA 2I5JA 5HJYA 1R3NA 2VPYB 4X4PA 1X5PA 1HBNA 2A2DA 1RT4A 2KN4A 1B4SA 4R8UA 2WAQD 3IBFB 1M1KT 2PI5A 1UA0A 2VG7B 2D9OA 1TK5A 2PEBA 1RDRA 1TAUA 2KDOA 4MK9A 4DR3F 4A47A 3PW5A 2I1RA 1S72S 2DBBA 4QR1A 5KFTA 1VOMA 2R8IA 3RAQA 2R7OA 5DLGA 3R1LA 4QPTA 1WEYA 1IXKA 2L9WA 2QX0A 2IDLA 1S0NA 2RUGA 4EUVA 3M2VB 4YB5A 3WX4A 2HNZA 4LSNB 5C25A 4KFBA 1UKUA 1YJRA 5D78A 1CJVA 1BUXA 1U24A 2C2KB 2VHGA 2ZH9A 2GJ2A 2CDRB 3LOUA 4RX6A 3CCRS 2UVRA 4F02A 2RILA 3GIRA 3UQSA 4DLGA 1SKWA 4AT1B 3QSIA 5A2QY 3PJ9A 2LEBA 4AXJA 4PKDB 1TKZA 3DU6A 2HIYA 2VC0A 3HHDA 4IR9A 1F60B 1RSCA 4QU6A 1VFJA 3K0JA 4NASA 1JLQA 4OZ3A 3PV8A 2COLA 1UCNA 2H65B 4Q2LA 2JEFA 3NS6A 4JV2A 1B3TA 2IM3A 1WC4A 2HLUA 1RTHA 2ZVIA 2M8HA 4RW6A 1V6HA 3W7BA 5D6GA 1M5VC 1NXIA 2QN6B 2LCWA 3A3NB 4CO0A 4M5IA 4YQWA 1OWXA 1LXJA 5E2QA 2B56A 1GXUA 4WKRA 5D3GB 2W2OP 4HACB 4M5DB 3TX0A 1EJ7L 3W9IA 2HHWA 3C6TA 3TX8A 1RHJB 4LF6J 1S9GB 2ADBA 4CLLA 1YZ6A 1Q1KA 3B4MA 2YPYA 3HM9A 2BW2A 2HHSA 4EO8A 3HJVA 1K44A 5H9EJ 1HI0P 5F3TA 2HK3A 2NPFA 1KKHA 1HQUB 3M30B 2ZC4A 4ID8A 2JLGA 1YBTA 2W01A 3KG4A 3QO9B 5CYQB 3DU5A 2IJNA 2WB1D 4WU2A 3PR4A 3K59A 4FF3A 4G6VB 3KOAA 1KS2A 2ZM6F 2JEGA 1JLEA 2DNLA 4NCGB 1S97A 4J90A 1F3VA 1OJ4A 1KQFB 2KTQA 4O0NA 5C7PA 1Q82T 3MOJB 2BOAA 1Q4RA 4QYRA 4X4NA 1LWEA 2IYIA 2QMUB 4CWBA 2R2UA 2H3EB 1P1LA 1X31C 2IRYA 4CCHA 1RHKB 4Y28C 4NZ0A 3I0SA 1HWJA 2ACMA 2HZAA 1NDCA 5C24A 2D69A 3BGOP 3QLHA 3F0NA 3TUZC 5HL7Q 4JI7F 2GVZA 4OYBA 3CCVS 4DR7J 2KYXA 5LOQA 4OHVA 3DLGA 5C42A 2FVSA 1IBLF 2QL5B 2J76E 3SV3A 2CXEA 1M5HA 2RD5C 4QIEA 3GFHA 3I32A 4J9KA 2NR0A 2FC8A 4PPZA 1LQ9A 1PCAA 2P6SA 3DDIA 3DN9A 2H48B 4MAKA 2GA7A 4FKXA 2ATCB 4Y65A 2CQDA 2NZ4A 2AJ0A 1KHWA 3U7JA 5L38A 3GFZA 4P74A 1WEXA 3HMJG 1S6PB 2IC3A 1NSKL 2XI2A 1NK5A 1VQ4S 5KFIA 1SKUB 4N8NA 4RW4B 2DH8A 1HWKA 3UVJB 1T94A 2EI5A 3LP1A 1UMJA 1GX6A 1E6YB 2R7QA 3FZ2A 4IFYB 3HKZD 1BD6A 3R5GA 5KFSA 2ZH3A 3PO5A 4LF4F 3ZC4A 2V8VA 3OVBA 2ASYA 4HT7A 5JMNA 4LRDA 1RBAA 2MLYA 3AFGA 3H5SA 3OTCA 2ZH8A 4JP8A 1YZ7A 3W2WA 2DHGA 1U49A 1AZSA 2Z4PA 4WP8A 2V67A 2RQ4A 1IQTA 2J6TA 5EX3A 3EDQB 1VJQA 3JTPA 1U1LA 4CIOA 2V9WA 4TQRA 5H9FK 1APSA 1WOOA 3ET6B 5GMEA 2HVDA 1RTJB 4PABA 5LXYA 3OTEA 4X4TA 2HAIA 2RKIB 4LF8J 2VBZA 4BS2A 1F3FA 2R2SA 4DV4F 4KIAA 2PMHA 4NI2A 4QWAA 1Y0HA 2KM8B 3W8GA 2YH0A 1TL3A 3VGSA 4ENOA 1UVIA 1U2FA 2BA9A 4DUTA 3E01A 1R8CA 1TMJA 1X9MA 2NQPA 4V1Ak 2GGPA 3KLGA 1U45A 1MWQA 1FXRA 1FDDA 2HYIB 5GADU 1CJTB 2EBEA 5HO4A 4DQRA 4NXMJ 2E9TA 1AFIA 1PGZA 1JLCB 2W2MP 4UW2A 1N32F 5ETTA 1VR6A 2O01C 3UCGA 5HROA 5ETVA 2VIHA 5B0DA 4HT5A 2PE8A 4P7VA 1TP7A 3FC9A 5G0RB 3NEKA 4N47A 4DDFA 1WF2A 2Z0GA 1T02A 2MYFA 3QGPA 3KHRA 4C8YA 2J0WA 3QAUA 4X64J 1UFWA 2AYEA 4RBVA 3IG1A 4ZK7M 3M8WA 5DQIA 4J9RA 4ED0A 2DGWA 2K3KA 2YPZA 3S01A 5IV4A 1WSRA 1MROB 2HGNA 1T3NA 1PAUB 2B51A 2MZ1A 3V6DA 2BANB 2E5LJ 3KK2A 4DCPB 2B4PA 5T41A 4USVA 4O44B 4AE5A 5CA5A 1VQMS 3L95X 3VZHA 2HLTA 4OZ2A 2GZOA 5IC4B 4OZ5A 5DRKA 1VQLS 4FF2A 4RUBA 2Q3PA 2XTJP 4RW9B 2RU9A 3AAWB 4DL6A 4R0JA 5HBMA 4CLTA 3BDPA 5M2UA 4V19J 4LF6F 4CT9A 1VHFA 4DR6F 3GYNA 1U7LA 3PY8A 2LVWA 1NO8A 3CJ5A 5L8RC 5HMXA 3T19A 1B0PA 3KJFB 2BMBA 1X8DA 4O4RA 2CNOB 4XTTA 4DWIA 4YY3F 2NXUA 3NAIA 2XHWA 4FVMA 4NLTA 4C0BA 5B0BA 3Q22A 2K1RB 3A8IA 4UY85 4PQUB 3UCUP 2OKQA 2AJ2A 1WC1A 1G6BA 2LQJA 1HNVB 1Q8LA 3IWXA 3NOCA 4YS2A 2ZH6A 2QGFB 1FWKA 4DBQA 4ATNA 2WSCC 3E8OA 4QW8A 4I2QB 1G4CA 5HMYA 3RZAA 2IVFB 3OR2B 1WKJA 1Q5VA 3UN2A 2C22A 1OO0B 3KNGA 1S0MA 2UXCF 3BR9A 3MMAA 2AGPA 5A6WA 4CZCA 2R8KA 4R25A 2UXDF 2H5EA 1ZTWA 3BV8A 4C11A 3MR5A 3FSYA 2BJ7A 3SDEB 4A8QA 1NLKL 3P96A 4KB7A 4Y2AA 3W60A 1N5QA 1QLNA 1T05B 1H72C 3H2UB 4ZN1A 2PO4A 3JAMU 2DPIA 3J7AN 2BM0A 2FTRA 3H0PA 1SH2A 3TW0A 4PRFA 1OSDA 3J7YI 3DLEB 1Q86T 3V6KA 2XO6A 1RAEB 2DB1A 2DGQA 4I0WA 4Y3CA 3BO4A 1U1PA 2CKWA 2IPOB 3R7SB 1S9EA 1VIOA 1NNDA 2B8PA 2MDAA 3FBFA 3MM9A 4TNOA 1H98A 2AT1B 3SFGA 5DG9A 4OI3A 1C1BB 1QTNB 2OELA 3GYXB 1WOPA 4C6AA 3DOLA 2M70A 2X1BA 3RU0A 3OUYA 4DSEA 3T5JA 1BWEA 3TI0A 5CYMB 1FE0A 2I5JB 3KJVB 2GO8A 3D1QA 1SIWB 3ZTOA 4RNOA 4U6PA 2XY5A 1CG2A 2VFTA 1Y00A 2XZDB 3GWCA 4P52A 2R2TA 4I69A 4TY8B 2ALZA 1RT4B 2AZ1A 5CABA 1GX5A 2ROGA 4DSFA 4DF4A 2VG7A 4DEZA 2X3DA 2ZZNA 4U9RA 5B0EA 2MZJA 3W64A 4LR7A 1FRKA 3A8KA 3SCKE 3PYGA 2MLZA 1LV5A 3EYZA 3A12A 2R7RA 2V0NA 2QSWA 4WFBQ 1IKYB 1R0CB 2ZWOA 3PG9A 3I56S 2VL1A 2XC9A 2ZH5A 3UD5A 2W9BB 1GT8A 3CVKA 4HR2A 3TAPA 3M2VA 4ICLA 2HNZB 4LSNA 5C25B 1LW0A 5ETQA 2EK6A 4NCAA 4OV6A 3RB4A 5KFNA 1ZAVA 4FXDA 4KH1B 3OL9A 1RT3A 3S7RA 3DXBA 3MEDB 4IO9Q 3M7VA 3GZ7A 3GR0A 4IR1A 1FNOA 2SXLA 1D9FA 3BSOA 3SSRA 1HNZJ 1TKZB 4AQYJ 4E8UA 4LF2A 4CNYA 3I55S 1S76D 3VAHA 2FIUA 1S6QB 3TARA 3C16A 2MQNA 1KEKA 1JLQB 3NXZA 2LQ8A 3SBMA 5K8OA 1Y11A 2BKNA 5KT7A 5I3UA 3Q23A 4X2BA 5F8NA 1HNIB 1U0HB 1LOUA 1ZOTA 2ALYB 1VRUA 2Q79A 3MAHA 4P9SA 4FYWB 4ZA1A 4I6AA 4QWBA 4NXNF 1AW0A 1IQZA 1FDNA 1JLGA 2AP6A 2CQ3A 4DQQA 3DFEA 5EN1A 1PJ6A 3PFEA 1IR1A 3LAMA 5KT3A 4ECSA 4EYIB 5DGBA 2DGSA 2DIVA 2YWHA 5KFDA 4DFJA 2BRKA 5IT9Y 4DR1F 1C0TB 4USUA 1VC0A 3LW5C 3C6TB 3W5YA 3G9CA 1VI7A 1WC0A 4WZMA 2B0GA 4A48A 4FVCA 4F0MA 3ISNC 1SCJB 1WI8A 2H1YA 2QLWA 2V94A 2DH9A 3BSNA 2JWNA 2BR0A 3THVA 4LF7J 1DJ0A 1X60A 4G65A 3V4MA 4AFFA 2LFVA 2FZKB 3M30A 1QJHA 3H25A 1U48A 2HEKA 3WX8A 3QO9A 2VV5A 3PXGa 1J27A 3ZTQA 4DU8A 4JV5F 2W7OA 1CSJA 1LKZA 1ELOA 1JLEB 1U2RA 3PEJA 4IH6A 5D0HA 4NMLA 5BYQA 3RRKA 1S4EA 3CCLS 3MUTP 1FWLA 4KGVB 4DQSA 4EI2A 1NKCA 5DDQC 3GV8B 2KVIA 4HTIA 2DHXA 5K9FA 1WHWA 3CW2C 8AT1B 1WG1A 4XPCA 2YKOA 2HW3A 1X7VA 2MY8A 3G87A 2A6OA 2ASLA 2RS2A 3CXCR 1NK7A 3PIPQ 4MIAA 4UOHA 1C1CB 1T95A 4A8YA 1NSPA 1RISA 3QLHB 5M2PA 4NPOA 3M8RA 4RUAA 2CJKA 2UUBJ 1R43A 4YP3A 2B9WA 4B9VA 3DLGB 2DEJA 3OPKA 2DGVA 4C97A 2ERRA 2KZZA 2RS8A 2WZ1A 4O3QA 3GYGA 1DHMA 2RRBA 2WVBA 2J7UA 4U7CA 4LFCJ 1KDNA 3HK2A 1FA0A 1TL5A 1X0FA 4HH0A 4PUOA 3HHKA 2M5YA 2NZCA 4QIGA 4J9PA 3R5AA 1OY6A 4NLWA 3QGIA 4QWDA 3TAQA 4P10A 3EX7B 3DMJB 2HBYB 1S6PA 2IC3B 2Y1RI 3CD7A 1N52B 3E3XA 3MAAA 3OTOJ 3UVJA 3KUHA 3X3UA 2LYVA 3OTOF 1SL2A 3G8TA 1ITPA 2ZOFA 2B5JB 5KFBA 3QIPB 1V9OA 3UI3A 4IFYA 5MAOA 3HLUA 2GW8A 1QVFR 4JYAF 4OLPA 4XAKA 1ICEB 2C3UA 2OIHA 2IJRA 5MLCV 3GV7B 2M8DB 2IBKA 2UXCJ 2UZAA 1B0TA 1RWMB 1DURA 4FYYB 2IYGA 1EP4B 1S48A 4LBPA 3S8SA 3ISZA 2F63A 2GX8A 3UDLA 1WC6A 1CC8A 1URRA 3ET6A 5F8HA 2YKMB 1JMTA 3IR5B 2RKIA 5B0AA 3CCZA 5F0WA 4HLBA 4KAIA 1H7XA 2P9GA 1PG5B 2CPYA 2RB7A 1SJ1A 4TKTA 1RBLA 4X84A 2XBPA 4NI2B 1RCOB 3ITHB 4MK7A 4Y2MA 4ZVHA 4AUKA 4DUYF 2BQUA 1RABB 3MECA 2WVEA 4GMKA 3VAJA 2XS7A 3OV7A 2Y1JA 1SL1A 2GQQA 3ZTPA 4WU3A 3E01B 2EEYA 3PM9A 5DQGA 1D9DA 1X4DA 2Y0SD 1U1KA 4JI4F 3OL8A 3I4HX 2R42A 1JKHB 1QAYA 3AA9A 5I42B 4DJBA 1JLCA 3I6PA 3S1TA 2FC9A 5HROB 1PKUA 4OZ1A 2VKRA 4C2MA 4ECRA 4FNIA 4BCAA 5KT4A 2VQEF 1RJJA 3K8VA 1FRJA 2JRSA 2IMWP 2E9RX 1S6OA 5IOLA 3LGHA 5F8IA 3IA0A 1MG7A 4DSLA 2EPIA 3A3OB 3ZXWA 9ATCB 3RBEA 4A8SA 3DYAA 3BQ1A 1MROA 4WP3A 1EHWA 1Y5LB 1KP6A 4YB1P 3V6DB 3BO3A 4B3TJ 4PYDA 5KFUA 4A8KA 3KK2B 5KFHA 1XMQJ 4O44A 1RWNB 2FVCA 2E7WA 3NCPA 2QZ8A 3VALA 5F8GA 5K20B 4BLGA 3NGRA 4U95A 4RW9A 3EXCX 5DG7A 4G3IA 2X1FA 5HBMB 2FPHX 1TTHB 3TA2A 5GMKa 5KFXA 4K50A 1XBWA 2DO0A 2O1PA 3O8WA 3LP2A 4OFZA 2F5GA 4O3PA 3J81U 2DT9A 1HIYA 1R31A 1Z1ZA 2DK2A 1JJCB 2HZCA 4P2FA 4JV0A 4DV6F 1KVJA 3IS9A 3AOBA 1R6YA 1T9XA 3BB5A 3LGNA 5FD1A 4ZVUB 4F67A 4D3HA 5HI7A 2XNRA 1SVDA 3M2UA 3QWPA 4J91A 1AUSL 5HVHA 1S1WA 1Y3JA 2LQBA 2QL9B 2RHQB 4U67Q 1F9HA 2DNRA 3MPUB 4ECYA 3AHPA 4URSA 4KR0B 3UW1A 5KOXA 4I2QA 1VDHA 2H4YB 3OR2A 3G82B 1YGYA 1YHQS 2QFJA 4ZCKA 3BREA 3MUMP 1RWKB 1TZ0A 2K7KA 3V4IB 3MMAB 4LFAJ 2WCXA 5H9FJ 4DR4J 2U2FA 1TVRB 2I8EA 1U0SA 3GB0A 4LSLA 1KOOA 2ZZTA 1KFDA 3DGPB 4NLYA 3PX0A 1GH8A 3CCSS 4TYAA 3SCLE 1RKJA 1ZAWA 4Y6IA 4PG8A 2EW9A 2MKHA 1N33F 4F50A 3QNWB 3EGWB 4TXSA 3DLEA 1VQ6S 1JLAB 2VH7A 3R5DA 2J0XA 4CLUA 1UJ5A 3CJ3A 3P6YC 4YB7A 1S9EB 4M8LA 3TOQA 1SUQA 4ZVPB 3MM9B 1XQIA 2ROPA 5KFFA 1QSSA 1YSJA 4P7TA 1C1BA 4Y34A 4HL9A 1PAEX 3RW7A 2QV6A 3DOLB 5J2MA 1HKAA 1JLFA 2C3MA 2HQDA 2OPPA 3JSYA 4P2SA 4TQSA 2UXBF 1DQ9A 2C2NA 4ZVQB 1E6VB 3KJVA 1N4LA 2VICA 7FDRA 2V4QA 4TU9A 4NLGA 1KNZA 1V3RA 2AJ4A 1EB0A 2G13A 2QYCA 4TY8A 1VLYA 4Q8FA 1RWVB 2WBMA 1NH8A 5KFAA 3FRZA 4DV1J 2XSJB 2H54B 2M4MA 2CA9A 3GG0A 1R0AB 2KT5A 3C15B 3ZZOA 1EKSA 2UUWA 2XMMA 4HHUA 2XMWA 4MYUA 2N3OA 2C3YA 4QCLA 1VQNS 1IKYA 4OLOA 1XMOF 2PC6A 2J7WA 2B9EA 3I96A 4OZNA 4L73A 3PR5B 4IYQA 2W9BA 4EWTA 4WTOB 4ICLB 3M9NB 4DV7J 1LW0B 3ZZ0A 3M9OB 1HD0A 2QO3A 3PYFA 2MHEA 3MTJA 5H1SV 2AEJA 3TJAA 3OBIA 1PILA 3EXYA 5HVGA 1RLCL 1RT3B 4HEA9 4BC9A 1N48A 3MEDA 1KWMA 2NCKL 3T5LA 3BGLA 4BBYA 1MU2A 3IO1A 4HHJA 1UWBB 3CNQP 4KYZA 2KVQE 2PFFB 3ENAA 1RQ0A 3PRVA 4J9UE 4K8RA 2ZHOA 3AQOA 2GIRA 2K2PA 4OZ0A 5JUMA 3ZNJ1 2B8QA 1S6QA 1P1TA 3C16B 3PVXA 5LMUJ 1U25A 1YJVA 4MMOA 2OEMA 3SV4A 2HQIA 1XMOJ 1HNXJ 1R7IA 4C8KA 1AROP 5I3UB 2GS8A 2HGLA 4ZCIA 2XY6A 1HNIA 1D1UA 1U0HA 5H9EK 2JVRA 1VRUB 1RK8A 2WSEC 3NNAA 1IN0A 5D0GA 5ITHA 3M05A 2BVZA 1JLGB 1DBDA 3OXFA 1SKRA 2HFVA 2R7UA 1U6FA 4F26A 1N56A 1S0OA 3OUYB 4C8ZA 1S12A 1RAHB 2DGUA 1C0TA 4B3RF 1PIEA 4G1IA 4PR6A 1JQGA 2LQ5A 5J1PA 1N5VA 3CWJA 4U8VA 4ZVRB 4DUYJ 4GC6A 1R6VA 1TL1A 4CI0B 2EC0A 3ENQA 2CJBA 3OQ2A 3TQ1A 1UTAA 1A6LA 2CZ9A 3VVTA 2ZITA 3VAFA 1TR0A 2KXNB 4RLEA 3HHLA 2C2RA 1T0TV 1TAQA 1SC4B 3D6MB 3GMGA 1WKKA 2FLOA 3BBBA 4EFAC 3OVSA 2W9CA 3HX9A 3NCRA 2FJDB 3FMWA 3SMZA 1KC8T 5HP1B 2QSFA 2HBRB 1VIXA 2G2ZA 2HIQA 4J9LA 4QPXA 3OSPA 1S77D 3N4WA 4YDXA 1IR2A 3ZTSA 2H5JB 2IJFA 3P8BB 3G6YA 2B7BB 3G71S 1C1CA 1QUVA 2Y8YA 2HVIA 1O6XA 4ES1A 3K89A 2DCUB 3OHBA 1KQKA 2M52A 4W4MA 3P49B 3K5MA 5LJ3Y 1GK8A 3AD8C 5F8LA 4TLRA 1CS4A 2HWTA 2YKPA 4LF5F 1U6ZA 1JXLA 3AA8A 2KT3A 3QPIA 3KHLA 2E5LF 2GMHA 5E7OB 5KG0A 2YQ3A 5KFVA 4PUOB 4QIFA 2GHPA 2XEXA 3KYLA 1EQ0A 3D4JA 3I4PA 4C0OC 5KFCA 4JI3J 3RJMB 4DG1A 4LREA 3DMJA 1FKAF 2NREA 1PSDA 1Z4UA 4ZP6A 3MAAB 2DXFA 2V2QA 4OX6A 5AXKA 2HAFA 3BGRA 3KG0A 4DR3J 2B5JA 1D8YA 2GNKA 2VBXA 3QIPA 1O8BA 3CCTA 4RPFA 4QQBA 3U1LA 4KGZB 1SQGA 4CM0A 1DAXA 4K4TA 3FK4A 3H42A 1X5TA 2HKEA 2MHNA 4ECQA 1UVMA 3P5TL 4LR9A 2VUGA 5B09A 2IAJA 2R7WA 3KG1A 1U09A 2GFFA 2VG5B 1EP4A 2E44A 3IM8A 2DNMA 2YKAA 3QT8A 4ER8A 1HHTP 2YKNB 4LF1A 1GTHA 1SL0A 3UD3P 3I5AA 1YIJS 2CQ0A 4JI3F 2YKMA 5EDWA 4I6YA 2OO4A 2RU3A 1REVA 1UVLA 2P8IA 1QM9A 4F7VA 2VODA 2HQCA 4H4MA 3I9ZA 3G8SA 1Q8IA 3M32B 3ITHA 1RGVA 2WK4A 3H90A 1KTVA 4NLSA 3MECB 4WXOA 5BR8J 2F40A 4UT4A 4Y0FA 4XPEA 1H6KX 1IBKF 5K5MA 4DI6A 2UUCJ 2CPZA 4AYBD 3F56A 1I94F 1A9NB 1RAOA 5A6PA 2E1MC 4NLVA 2FJWA 1UETA 1JKHA 4DR4F 5I42A 4ZOSA 1NU4A 1IM4A 2CQGA 4WYWA 5D4NA 3OSNA 4O3RA 4OYOA 1VQ8S 3BF4A 3MR7A 4F4AA 2MGZB 3G6VA 2MQ8A 2JH3A 1CULA 3D6HB 2PN6A 2EFOA 4UTGA 2E1RA 2ZDPA 5EX0A 5IC6B 5HMWA 2VDIA 2G0CA 2F8MA 4NA1A 4Q43A 4DV1F 3R7BB 1NJXA 1Q16B 2LLZA 4LRAA 4WXWA 2J6SA 5E3CA 1XJWB 2B4UA 3EGZA 1XR5A 1I5OB 1LNQA 2E7VA 1TU0B 4CNZA 3DYAB 3GPAA 3QSYB 4LF9J 2DHSA 3GJTB 3BH6B 2CG4A 1TUGB 3FBBA 2DISA 3NOGA 4OYIA 4MKYA 3B78A 3MM8A 2FVPA 2J9DA 2APOA 4RBTA 2BRLA 3UNGC 4HKQA 2HRYA 1FRIA 3T5HA 2ZM6J 2HPUA 2M9KA 2IRUA 1OS5A 3VVUA 2XZWA 4NYOA 4XIUA 3LP0A 2ZZMA 5DQHA 5HAOA 2K06A 4UQGA 1FRLA 1WORA 1XR6A 3LP2B 1FK9B 1FESA 3IGNA 2GIFA 4FDFA 3A8JA 4F4ZA 5CHCB 4OJ3A 3B6BA 1TKTA 3I5CA 3TVYA 1GXLA 5LM7E 1SC3B 2FY8A 4A46A 4M5JA 4JI0J 3IS9B 1CJKB 2XMVA 4P75A 3TUPA 2W8LA 3LUYA 3M1VA 3M2UB 2FJVA 2J7KA 1FJCA 3KHGA 4OX8A 1S1WB 2YKQA 3ICLA 4PXDA 5KG5A 2HMIB 1HBOA 2DY1A 1ZM2A 2OEJA 2ZC3A 3CGIA 3OFHA 4WKYA 4YR0A 1VQ5S 4YMEA 4LUBA 5I3PA 2P6TA 1WG5A 4J9MA 3G82A 2QFIA 1FWPA 2I9SA 1NKBA 5IT9U 2R3VA 3D66A 2EVZA 1IM6A 3V4IA 3DLJA 4P6QA 1TVRA 4LSLB 3BYPA 2E1CA 3DGPA 1RT5B 4TU7A 1YLXA 1VMBA 4IOBA 2YTCA 2XGQA 4B9LA 4NLXA 2JFDA 2XWYA 2W4PA 3B8HA 3JQMA 3R5JB 1ZM9A 3J7Z5 1XERA 2OGUA 2UU9J 3N6MA 2HHUA 2WHOA 1HI1A 2OSRA 2V8HA 3UPFA 2N82B 3BKTA 5T14A 1JLAA 1H7WA 3I0RA 3OR1A 4JI5J 4KHPF 4EEYA 1ROFA 2VB6A 3D9BA 1SKSA 4ZVTB 3VAKA 2CYYA 1SUQB 1NEEA 3KK1B 1OYDA 4ILRA 1DQAA 1SI9A 2KFZA 4S0MA 4N77A 5J2MB 1JLFB 2DO4A 1W2BR 2OPPB 3GFXA 1N5SA 4LRFA 2C42A 1NAQA 1UL3A 1E6VA 1CJUA 2VFSA 3Q0AA 1VRQC 4EGLA 1UEKA 5F3ZA 1R89A 3RB3A 4IRKA 2DNHA 1M5KC 2EFQA 4XO0A 2JX2A 2M2BA 3P45B 1BQNA 1F0XA 3D3BJ 3HHEA 4Y2CA 4DU7A 2N7CA 1OIAA 4PXCA 3QZ8A 3AQPA 3FVYA 2XSJA 4ZMMA 5KFQA 1UJ6A 4ELTA 1B64A 3W62A 1RP5A 2DHHA 1R0AA 2MZTA 2HFNA 3C15A 2BJEA 1SBRA 2KJWA 1F1BB 2VZ9A 4DPOA 3N0VA 4OJGA 1NDLA 2LXIA 4NZ6A 3SEOA 3MZIA 5JVGQ 1MW7A 2LQ9A 2VASA 3VF0B 3PYDA 2GMLA 2BW7A 1X5OA 2LA4A 3IRXA 4MK8A 4H54A 3UDCA 4B9UA 2ZKUA 4HDGA 2RH3A 1VGYA 3GFYA 2CQIA 1NB7A 2HHHJ 3W66A 2W7AA 1FEHA 2AIRB 4X66F 3DLHA 5D4PA 2XMTA 3IC1A 2AYBA 3VQTA 2HHXA 2N3LA 1GNKA 1RAIB 3LA0A 4NOHA 1MU2B 1NSAA 1YBUA 1UWBA 2DXDA 4PPDA 3ZFVA 4D3GA 4DLEA 3PJWA 1R0BG 4ZPDA 5E5NA 3SSQA 4J9SA 4DR6J 2Y3YA 3H8YA 1Y3KA 1XIQA 4TU8A 2OFHX 4E2FB 1NJIT 1QVGR 3BR8A 2C2OB 3DRYA 3FRYA 5E3PA 5GMDA 4X62F 3W2VA 1N36J 5I3QA 3JSMB 3PTWA 4USKA 4NEYA 1URNA 4ELUA 2FB0A 2VD3A 1QSLA 1JJ4A 2FJXA 2HWHA 2HBQB 1NDPA 5ETOA 2VA2A 2CQCA 5LJ5Y 1GTEA 3BJYA 2DR5A 3KNAA 4ERDA 2IFXA 5JXSA 1KLMB 3LPYA 2IA6A 2EBGA 3M6UA 1T7PA 2BJ8A 1NSQA 4FBUA 4FYDA 3DM2A 4CQ1A 5KG7A 3H4BA 4URGA 2HGMA 2KFYA 1PJ5A 4I2PB 1TL1B 3DCAA 3DDKA 4DUZF 4EZ6A 1S1VB 1N6QB 4MKBA 4ZLNA 1T8EA 2A1BA 3JQJA 1XNQF 4KY3A 1BE4A 1S49A 2FVRA 4ZPTR 4OYXA 2BJ9A 3PHEA 2L48A 4LJMA 3IN5A 2HHVA 3HHLB 2VU5A 2XGPA 1SIZA 2W9CB 1N5TA 2YWWA 4DV0J 1K9MT 3PW0A 3H5UA 3CJTA 2OSQA 2CPIA 2CJAA 5HP1A 4NYPA 1M5OC 1LFWA 4OI1A 1GMWA 2CPJA 2X1GA 4ID5A 1NHUA 4X4UA 4KHMA 2FHOB 1RTZA 4KGXB 1BQXA 5HJXA 1RI7A 1HPZA 1X4AA 3JXOA 4C7QA 4I7FA 3POTA 1IR0A 2BUNA 4Y2KA 2DNKA 2PEHA 2DYAA 4CP5A 1VQSA 1HHSA 2KH9A 3NCQA 2KJVA 4J9VA 2ASJA 1P9YA 1Z2LA 3HSDA 4N5SA 1FFWB 3Q8QB 5LSRA 3QFWA 1DTQA 2KT2A 4ZHRA 1CS4B 1U8WA 5A8WB 3BKFA 3AY0A 4ECVA 5HQ8A 4F0KA 2MQLA 5EGYA 5CXTA 1U47A 2M3DA 3GQCA 4WK3A 2Y8WA 3T41A 4HH1A 1RAFB 2DJWA 5E3RA 2KU7A 4MT1A 3MM5A 4NL5A 4RWWA 2W7PA 1FFGB 3OFGA 4W98A 4X65F 1BLUA 1YJUA 2YX7A 4IFVB 1GQEA 3LQVA 4DG1B 4F3OA 1PC4A 2M88A 3RBDA 4QYZJ 3ENWA 4NRUA 3T1HF 4CM2A 5E41A 1DFDA 5J1NA 3BGRB 4PG4A 3DOKB 4C3MA 3F73A 1U2CA 4I64A 4C8LA 1IWAA 5D4LA 4L3KA 3CD0A 3D0GE 3CCMS 3U1NA 2EFPA 2C2ZB 2OP5A 2ZOMA 3W65A 3A1YG 1ZS6A 4KGMA 1RWUA 1WTBA 2IAJB 4A4JA 2VG5A 2F7VA 1Q5YA 2I0XA 1K0TA 3AH6A 5E33A 1RAJA 2CPFA 2DGOA 2YKNA 2EK1A 3D54A 2HSEB 3BYRA 1Z2ZA 3EVMA 3GTYX 4WFYA 1VC6A 3R5CA 4LF8F 2ZE2A 3WBZA 1JK9B 1REVB 3T1HJ 4CH7A 2G0JA 4ZCMA 4H4MB 2AMCB 3NWRA 7FD1A 3JSBA 3M32A 4BWJA 3RB6A 1J5EF 1SC6A 3HJFA 4I67A 2I2YA 2CNKB 2HS4A
chains in the Genus database with same CATH topology
1IJFB 3FDSA 2CPXA 2EFGA 2HRUA 3HF5A 4QIWD 2GO9A 4IO1A 1X0PA 4C4WA 3BGFA 3O5TB 1YITS 4LT6A 2OJ3A 3MURP 3J80Y 1DZ5A 2ROEA 1UW4A 1ZAXA 3I87A 3MDFA 4G1PA 2VOPA 4OJ1A 2VPWB 1C4CA 2MGZA 3PKMA 1FRMA 2BQRA 4KE5A 5E3QA 3L7OA 5GAEU 2V8DA 4H4KC 2ATLA 4FZVA 3OVAA 1H38A 4LVNP 4WJBA 5J2QA 4RW8B 1Q53A 1S99A 3FJ2A 1CLFA 2RSQA 3U1MA 3MM8B 4RZRA 2AJQA 1GXTA 4NXMF 4RUCA 5FIIA 4WFAQ 1Q79A 2G1DA 5AE1A 2JEJA 3VZIA 3LP0B 4AL6A 5KT5A 4ZPVR 2D1CA 3TANA 2V4RA 1S1TA 1FK9A 1JWWA 1TKTB 5L39A 4LMZA 3H40A 3IR7B 4QR2A 3VAMA 5KG6A 1SQEA 3HKWA 3MR2A 3M1VB 1RA6A 4URQU 5K8PA 2C3OA 2A3JA 1NJWA 1ULRA 2HMIA 1HBOB 3DDNA 1NJZA 3CE8A 3CO9A 1X4EA 4BC7A 3CMES 3C6UA 4K0KF 3OW2R 4HYKA 3MPWA 2VKZG 3VQSA 1CQMA 3UWTA 2K3IA 3T9ZA 3DRRA 1ZBTA 3NNCA 1OQ3A 5DM6Q 4DX8H 2F8EX 1G7CB 4GO5X 2ZNYA 5K8MA 1RT5A 2IM2A 4IH7A 4N8OA 4Y2IA 2Q43A 2B3TB 3WC0A 2FGCA 1T7PA 4FBUA 1T3OA 4M95A 2CRLA 3RAXA 1EETB 2IVMA 1VQKS 2J9EA 3W3SA 1YRTA 2VONA 2F3JA 3I0RB 3OR1B 4ZVFA 3SYZA 4MTPA 3OTBA 1NK4A 3RR7A 3UD4P 1YVFA 5IQ6A 4JBCA 5LMUF 3KK1A 2W4DA 4LIWA 4AL5A 4C3KA 3QGGA 1KN6A 2R9LA 4IRCA 1WHXA 2VG6B 1AFJA 2RVJA 3OFFA 2QRRA 3MF5A 2CQBA 5CD4H 3N5FA 4FBTA 1BQNB 5B0GA 5KFPA 1HWLA 3CPWR 2XG8A 2VBYA 4K5SA 4K5RA 4X4RA 1YJ9S 2R7TA 2P5VA 4OQJA 2F1FA 2RDIA 3RAMA 5KFOA 2ZH4A 2R7SA 1NH7A 3IRXB 4HVZA 2C3PA 5BJRA 2XSFA 2BJDA 3IBWA 3B82A 1X4HA 1XN9A 5JVHQ 2HS0A 2WSFC 5U47A 1FKPA 2MKIA 2OFGX 2YX1A 4IG3A 4RU2A 4B9MA 2LMIA 3BGUA 1DRZA 4B3TF 5CCMA 1FXDA 3W2VB 1MMDA 2IM1A 1FNMA 3ONQA 1SJ4P 1CQNA 2WW8A 4X4VA 3C46A 3JSMA 2PI4A 3AB2B 1NHVA 3Q24A 4J5OA 2OH2A 1G1XA 3TUJC 1RT1B 2UVWA 3RR8A 5KFKA 1N0VC 2LECA 1FHTA 3THTA 3N5BA 1YTYA 1KLMA 4JI6F 1CPZA 1FJ7A 4Z2XA 3BN7A 3DM2B 4F4YA 4NLRA 1UAWA 4NA2A 2R8JA 4I2PA 1DARA 3GE9A 4FS2A 1WI6A 1S1VA 1N6QA 5DS7A 4DMZA 1NKBA 1HBMB 3GIKA 3MR3A 2AJFE 1VQ9S 4DL7A 5IWAF 4ITSA 4B02A 4USJC 3FMBA 1M5PC 2JC1A 4RWXA