4RW6B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 111
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw6B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw6B03
3TAMA 2R2RA 2AU0A 2IAJB 5KFOA 5KFKA 3FFIA 1J5OA 3VQSA 3MECA 4Q44A 1MMLA 2YNHB 4ECWA 3PW4A 3ISND 1RT6A 2C28A 3T5KA 2F8EX 4IRDA 3RB6A 2JEJA 3PJXA 2DPJA 3CDWA 5J2PA 1JLAA 2IM1A 5KFCA 2HWIA 2V0NA 4WE1A 1RT4B 1S9GB 1NHUA 3T1AA 4R5PA 1IKXB 1FKOA 3KLIA 3QLHA 1IKYB 3GV7B 4FBTA 3NBPA 4ZPDA 3KLHA 4NCGA 4R0EA 4TYBA 4O4GB 4URGA 4LSLA 1TQLA 3PW7A 4GC6A 2UVVA 4NCGB 5CYQA 2BR0A 3M8PB 4O4GA 4IQXA 4TY9A 1VRTB 2WK4A 1NHVA 1HNVB 5DQGA 4RUCA 1RTIB 5KFMA 4Q43A 3DMJB 1IKWA 1IKVA 1RA7A 4NLTA 4K4SA 1GX5A 3V6DA 1S49A 3OHBA 1FKPB 2YNHA 4FS1A 4Q0BA 2JEFA 1TL1B 3I0SB 3FFIB 1J5OB 5KT2A 3KMSA 5C42B 2JEGA 5KFJA 4MK7A 4IOBA 2C2EA 4Q45A 2R8KA 1KLMB 4URSA 4Y2AA 3UDLA 2DPIA 1QUVA 1XR5A 1CSJA 1DTQA 4NLYA 1S6PB 4ICLB 4HYKA 1RDRA 3KLHB 5KFLA 3ISNC 5F9LA 4KSEB 1HQEA 3IS9B 3DRRB 1IKXA 1FKOB 1S6PA 3QLHB 1REVB 3QO9A 3DLKA 4NLWA 1R0AB 3KJVB 4J9PA 4H54A 3QO9B 5KFRA 4ECSA 2VG5B 2B5JA 2GIRA 1S1VA 4O44A 3RBDA 3V6HA 1K1SA 2ASLA 2D3UA 1C0TA 1UWBB 3KHGA 3PVXA 2OPSA 4WZQA 4NLSA 2HNYA 1HPZA 4ZVEA 2YNIB 1JLFB 2C2DA 3LP0B 1LWCA 4B3OA 1KHWA 1RTHB 5C24B 5KFNA 3FSIA 3QZ7A 1Z4UA 4IR1A 1RT6B 3I0SA 4KE5A 1IKVB 1RTHA 5C24A 1GX6A 5I42B 5KFVA 2W8LA 3NMAA 1FKPA 3QGGA 4RNNA 2OH2A 1QAJA 3KHRA 3DI6B 1RTJA 3Q8PB 4U6PA 2UUTA 3T5LA 3D5MA 3QGHA 3EPIA 2C2RA 1RYRA 1S1WB 1N5YB 1TKZA 3IRXB 2YNGA 3DM2B 2B43A 3BREA 5F8HA 1RTJB 4WYLA 4EBCA 1QE1B 3LP1A 4U7CA 4TQSA 3IGVA 4RNFA 3DRRA 2D3ZA 4DEZA 2YNGB 3DM2A 1S0MA 3MEDB 4EO8A 4F50A 1BQMB 5KFHA 3H40A 4O3OA 1S9GA 2VG7A 1HNIB 4I7FA 2ZD1A 5J1EB 4K4VA 1HNIA 1SH2A 4QWAA 2B5JB 4NLXA 3CIZA 4ZHRA 4ID5A 1IKWB 1C0TB 1UWBA 2OPSB 2FVSA 1SH0A 3MEEA 4Q0BB 4KV8B 2RF2B 1JLFA 2RKIB 4O3NA 3GQCA 1T3NA 5K14B 4ZVHA 4K4ZA 4EYIB 3OL6A 1HQUB 3DDKA 3DMJA 5EWFA 4WXOA 4QW9A 3CJ3A 1C1CA 1S10A 5KFGA 5KT4A 4ECVA 4YP3A 3DOLB 3OHAA 3SFUA 4NLRA 3CO9A 3HKWA 4R8UA 1ZETA 3M9MB 2ATLA 4WFYA 5EWEA 3PW2A 2I1RA 2OPRA 3PZPA 2FVCA 4O44B 4J9NA 2R8IA 4IH7A 4ZVFA 1S0OA 4F4XA 1EP4B 1JX4A 1S1XA 1TKTA 4YR2A 4Q8EA 5KFSA 2J6TA 3UR0A 3BGRB 2ILYA 3QZ8A 2VA3A 1RT7A 4RNOA 3M8PA 5J2MB 4WXWA 3H4BA 4ECUA 5CYMB 3DYAA 5KG0A 4WFXA 4JUZA 2EC0A 1S9EA 1TKXB 5HP1A 2WRMA 4Y2CA 3MEEB 5KFZA 4RUAA 5DLGA 3V6JA 3LAMA 5K14A 3DI6A 2GC8A 1TKXA 3OSPA 1S1UA 2R2UA 2D7SA 1ZTWA 4LQ9A 4ECZA 3GILA 4F4YA 2IA6A 2BQUA 1RT3A 3H59A 2W7PA 4IR9A 2ILZA 4ED3A 3HVAA 2CJQA 4J9LA 3KLIB 2D41A 3GYNA 1BQMA 3BR9A 3H98A 2XCPA 1JLBB 4NLGA 1SUQB 3CJ2A 4NYZA 3Q8RB 3HVTB 1TL3B 4RW9B 4I7FB 4ED7A 2E9TA 4ECTA 3GV5B 5F8GA 4IG0B 3H5SA 4K4WA 4M94A 4ED8A 4JV2A 4NLDA 4ECRA 1REVA 3KLEB 2VG7B 2BRLA 3MR5A 1D1UA 2R8JA 1HNVA 4MK9A 3DLGA 2VG5A 2YKMB 1JLCA 3BSAA 4TYAA 5KG4A 3G6YA 3KLEA 3NAHA 3I0RA 1WNEA 3KK1A 3H4DA 4J9KA 3PR5B 4MFBA 2HNDA 5KFXA 5CYMA 1LWCB 5L1LA 3ICLA 3V6KA 1EETA 1TVRB 1VRUA 4NLUA 1T05A 2HMIB 2W9BB 2O5DA 1D0EA 5I42A 3MECB 4NLQA 3I5BA 5F8IA 1HMVB 4G1QB 2FVRA 2HMIA 1JLGA 2HNZA 3CJ0A 5KFYA 3G6VA 1S97A 4ZP9A 1RT3B 4RNMA 1C0UB 1S1WA 4EO6A 4ZP6A 1QE1A 3KJVA 1C1BA 4ZMMA 4URQU 4R8UB 2W8KA 4ZPBA 3GIKA 1S1VB 3MR2A 3MEDA 2IBKA 2AGOA 4KBIA 4WFZA 1HYSB 3PJWA 5DG8A 5JUMA 3RBEA 2AX0A 2AWZA 3N6LA 3CJ5A 3QIPA 3DYAB 1LWEA 4TQRA 1S1XB 1TKTB 3KLFB 3KK3B 4J9OA 2YNFB 2XI3A 2XCAA 4ZHRB 4ID5B 3KK3A 5EDWA 4ZVGA 1T05B 2FJXA 2W9BA 4RW7A 4IRKA 4MKBA 3HHKA 4IFYB 1EETB 1RT5A 1BQNB 1TV6A 2WONB 2BQ3A 1RTDB 2WTFA 2UVUA 5KT3A 4XPEA 1S1UB 4DL6A 3BJYA 3LP1B 3GIIA 1S6QB 2J6UA 4Q8FA 4RW8B 2XGQA 4K4XA 5DLFA 4PUOB 2FLLA 2UVWA 1RT2A 4IRCA 3LAKA 1RYSA 1N6QA 4HKQA 4H4OA 1TP7A 4XO0A 1K1QA 2OPRB 4I2QA 2IC3B 4IKAA 3BQ1A 5F8LA 3H5UA 3OLBA 4EYHB 2C22A 1LWFA 2R8HA 3KHHA 4QWBA 2IM0A 2HNDB 2ALZA 3H5XA 2XGPA 5DQHA 2BANA 1HPZB 3I5CA 4DL7A 3QGIA 3H5YA 1IM4A 1LW2B 4DL2A 4I2PA 3KLGB 1N56A 4DL3A 3RB0A 3DOLA 3IGNA 5J2QA 2AQ4A 5KG7A 2GIQA 1RT1A 3KLVA 1TV6B 5DGAA 3LANA 3CVKA 3DRPA 2V4RA 3GV8B 4YR0A 1C2PA 3JSMA 1RT1B 1HMVA 5L1KA 5KFTA 5F9NA 4K50A 3IG1B 4TN2A 1JLBA 1EP4A 1JLEA 3T5JA 3E01B 3BSOA 2IM2A 3BGRA 2B6AA 1RA6A 4ED2A 1LWFB 4TLRA 1XR6A 2ZE2A 2YNFA 2IC3A 1S9EB 5HP1B 4O3QA 3DLGB 3FRZA 3QIPB 4KB7A 4IDKB 3TVKA 3PW0A 4WYWA 4H4MB 3KLFA 5KFQA 3NKYA 2RF2A 2RKIA 1S1TB 1RTDA 5J2QB 4PQUA 3EZUA 4H4MA 3Q8SB 4X2BA 1FK9B 4YMEA 1HQUA 5DG9A 1S6QA 4XPCA 1S1TA 4RW7B 1C1CB 4IH5A 4G3IA 4ED0A 4IFYA 1XR7A 1RT5B 4KO0B 2WONA 3ITHB 4MIAA 2E9ZA 3QIDA 4G1QA 1TL3A 4RW9A 4WE1B 2HNZB 3CDUA 2UVRA 4IFVA 4IG0A 4RNHA 3NAIA 1JLEB 3QYYA 4QPXA 2IMWP 4LQ3A 3UPFA 2WCXA 3RB3A 3MR6A 4I2QB 5J2NB 3IG1A 2R2TA 2FLPA 5HROA 1U09A 2R8GA 1JLCB 4ED1A 3E01A 4QWDA 4O3RA 1N6QB 4ZPAA 2AGQA 1HYSA 2R2SA 4KHRA 4NLOA 1JIHA 3DLEA 3KHLA 4MFBB 3RAXA 4LSNA 4DG1B 1DTTB 4K4YA 2IM3A 5KFBA 1RT7B 1LW0B 3OSNA 2W9CA 4KHMA 1JLQA 1SV5A 1DTTA 4OL8A 3KMQA 5FDLB 2XWYA 1JLGB 5D3GA 4K4TA 2HAIA 3BSNA 3MFIA 4KO0A 3EPGA 1BQNA 2WOMB 4QWCA 4RU9A 3CDEA 3PHEA 4J9QA 2UUWA 2WOMA 3FQKA 2OPQA 4J9RA 4ED6A 4IFVB 3CJ4A 3JSMB 4NRTA 2ASJA 4PWDA 3V81A 1T03A 3DLKB 3M9NB 4PUOA 2RDJA 1R0AA 4IG3B 2FVPA 3FDSA 4O3SA 2W9AA 1JXLA 1HARA 3RB4A 5KT6A 3NGDA 4NRUA 4IG3A 2JLEA 5KFPA 3LP2B 4IDKA 3T19A 5JXSA 3KNAA 2OPPB 5T14A 5KG6A 4RW6A 4LSLB 3OL8A 3BQ2A 4B3OB 2XI2A 4F4ZA 3FQLA 2BE2B 5I3UA 3G86A 3C6UA 5L1IA 2YKNB 2BANB 1YVFA 3IN5A 3NL0A 2I5JA 4TY8A 5DG7A 1LW2A 3N6MA 1RTIA 5L9XA 4MKAA 3MEGA 3KK2A 4ECXA 1TVRA 4EBEA 2BQRA 3ITHA 1VRUB 3BSCA 3GIMA 2AX1A 4ZP7A 3V4IA 3MR3A 1TKZB 3IRXA 1RT2B 4QWEA 3DRSB 4ECQA 3DRPB 1S4FA 4H4OB 1T94A 1C0UA 5EWGA 4KAIA 2OPQB 5HBMB 2FVQA 5DQIA 1C1BB 1DTQB 1S0NA 4MH8A 3V81B 1T03B 3MTKA 4TXSA 4J9SA 3M8QA 3DLEB 2IJFA 5HROB 2HWHA 1ZTTA 2ZKUA 1DLOA 2FJVA 4M95A 4FBUA 4KKOB 4I2PB 3KLGA 1LWEB 1MU2A 3DOKA 2I5JB 2IAJA 3E51A 4TY8B 5KFFA 3OL9A 5FDLA 2HNYB 2BE2A 5I3UB 5D3GB 3I5AA 3C6UB 2QV6A 1QAIA 3OL7A 4ECYA 3TQ1A 3LP0A 2QE5A 2JC1A 1JLQB 1SV5B 5KT7A 5C25A 2V4QA 5KG3A 3TAMB 1FK9A 2IJNA 1NNDA 2BRKA 5DGBA 4YQWA 3Q8QB 4RW4A 3C6TA 3MFHA 4DL5A 4EEYA 1W25A 3H2LA 4O3PA 4GC7A 5EUHA 5HLFA 3V4IB 2WHOA 4R5PB 4RW4B 4JV0A 5KT5A 4ICLA 1I6JA 4RW8A 4PWDB 1KHVA 3OLAA 3N6NA 5J2PB 2B6AB 2WB4A 4KFBB 5KFDA 2RDIA 2ZE2B 4O4RA 2XC9A 4Y34A 3PW5A 5F8JA 1IKYA 4KFBA 5KG2A 5KFWA 4MK8A 4KKOA 2FLNA 1VRTA 3KOAA 5J1EA 1S9FA 2YKNA 1MU2B 3DOKB 1DLOB 4FS2A 1JKHA 3JYTA 5C5JA 4PQUB 4ZPCA 2W7OA 4LSNB 2OPPA 4DG1A 3V6DB 4EBDA 3BQ0A 4IH6A 3SI8A 3D28A 5C25B 4RZRA 3MF5A 4KV8A 4NLVA 4JV1A 4K4UA 2JEIA 2JC0A 3SFGA 1N48A 5KFAA 3DRSA 5HLFB 1KLMA 3UQSA 4QW8A 3MEGB 3KK2B 1N5YA 1JLAB 2AGPA 3LALA 1TL1A 3C6TB 4DL4A 1RAJA 1SH3A 2VA2A 3GIJA 1SUQA 5C42A 5J2NA 3HVTA 5KG1A 3NBPB 2CKWA 4MIBA 3G6XA 5L1JA 4J9MA 4F4WA 3M8QB 3T5HA 1RT4A 1OS5A 4NLPA 5KFIA 2ASDA 2ZD1B 2J6SA 4ZP8A 2V9WA 5HBMA 1S48A 1HQEB 3IS9A 3CWJA 2YKMA 4WZMA 2YNIA 2VG6A 4Y3CA 5F8MA 5KG5A 1LW0A 3I0RB 3PR4A 2W9CB 3KK1B 3M9OB 3LP2A 2FJWA 3HVWA 5KFUA 3RAQA 5CYQB 2VG6B 4NZ0A 5F8NA 4RW6B 4YR3A 2E9RX 1N4LA 1JKHB 3JYTB 5KFEA 5J2MA
chains in the Genus database with same CATH superfamily
7AT1B 3M8ZA 3MPVA 1YRTA 8AT1B 1EX8A 1CPZA 3VQSA 3MECA 4CYUA 2V68A 1O6XA 3JAMY 5J1NA 5GAGU 3ISND 1GQEA 5HMYA 4K2XA 1WC1A 1OQ3A 1V5VA 1Z2ZA 2GMHA 3PJXA 3RB6A 2JEJA 1ZPVA 2EPIA 5J2PA 1UKUA 2DEIA 4ATNA 1U7LA 2NUHA 2A0FB 1JB0C 2V0NA 6FDRA 4WE1A 1R8CA 3F41A 4ZA1A 3AB2B 2NXEA 2PT0A 1IKXB 1FKOA 2N3LA 3OR1B 5K8PA 4FBTA 1PAEX 1I51B 4LBHA 1ZM3A 1RGVA 2AEJA 5T7LA 3OTDA 1VGYA 2CVEA 4TYBA 1XN9A 5U47A 3OD2A 1N33F 4C8MA 1RWOB 3DGPA 4LFAJ 1I94F 4NCGB 4IOAQ 3M8PB 2RMLA 2ROEA 4WTOB 1M90T 4TY9A 3HJVA 4OI1A 4RJVA 2MLYA 1LKZA 4A8KA 2H5EA 1X5TA 2WB1D 1MMDA 3DMJB 1BXNA 3C16B 2VPYB 2Z2LA 1IKWA 3KFWX 4M5GA 3RR7A 4NLTA 5CD4H 4K4SA 1GX5A 3V6DA 3DKDA 3Q2SC 2RQ4A 2VHGA 2JEFA 1U48A 1SJ3P 1R7IA 4HI1A 1TL1B 3ZXWA 2VOOA 1J5OB 4WPAA 4ZCLA 2DR8A 1XERA 3K2YA 3TA2A 3PIOQ 2JEGA 3DRYA 2EG2A 3LWMA 1NZAA 3QBCA 4Q45A 1X5PA 2R8KA 4F0MA 1KLMB 2AJ0A 2LXIA 4Y2AA 2DPIA 3VVTA 2XZDB 3FBEA 3Q83A 1Q4RA 3MM7B 2GA7A 4BWJA 4HYKA 3DNCA 1X0PA 3CCRS 3ISNC 5GADU 1NJXA 4KSEB 3QO9A 2OKQA 2XMMA 3QLHB 5GAEI 4NLGA 5LSRA 4NLWA 4WTYA 4C11A 5AXKA 1IBCB 4CO1A 5D0RA 1SC6A 3SXLA 1S1VA 4DV1F 3GYGA 3HK2A 1K1SA 4ELTA 2D3UA 1RAOA 1TMMA 3PVXA 1KFDA 1FESA 2HNYA 3I4PA 3SCJE 2D3OR 4C8OA 3LP0B 3K89A 1NUEA 4B3OA 3BPSP 3MOZA 3FSIA 1R8AA 1T3OA 3QZ7A 2ZHOA 1Z4UA 3GTYX 5ETQA 4LIRA 5DETA 3GMGA 3QFWA 3R5DA 1Z2LA 4KE5A 5KFVA 4DV2F 5LSLA 1U0SA 4CLTA 4I1TA 1HBOB 1FKPA 1VQ4S 3NNCA 4RNNA 3UVJA 1QAJA 3BGLA 4K59A 2DGXA 2ZBRA 1RYRA 5HVFA 1HBUA 1S1WB 1X4GA 1TKZA 3D6HB 3NCRA 5BR8F 3T3FA 1R31A 3FCHA 1RTJB 3H5XA 5IT9U 3LP1A 3G8SA 3CGIA 3ZZYA 2HVEA 1MWYA 4B3RJ 3OR1A 4G6VB 4DR7J 3G82B 3FMWA 1XK8A 4P71A 4FYDA 2HG4A 1HNIA 1SL1A 1KRPA 3TQEA 4PRFA 1SH2A 1NO8A 4JI3J 2EW9A 2B5JB 1IBKJ 1R0BG 2RDDA 3BR8A 4DR1F 2LLZA 3MOJB 2OPSB 3TJ9A 1SH0A 2RU9A 3EMTA 1T9YA 4KV8B 2RKIB 4F25A 1FEEA 2YWWA 3FZBA 1FE0A 4KGMA 3UE2A 4X62F 3BKFA 2BKOA 3KUGA 3J7YU 1S77D 3I96A 1FA0A 3MAHA 2DCLA 3DMJA 5HAOA 4ZITA 3CCTA 5EWFA 4QW9A 4HDHA 2B9XA 3CUNA 1C1CA 4QYZJ 1SI9A 2CQHA 4YP3A 3J81Y 3MM8B 3SFUA 3HF5A 2VPZB 3D3CJ 3UVJB 1A7GE 3T1YJ 2G0IA 2IY5B 3CJTA 5CABA 2DHSA 4CM0A 4C8NA 1R8PA 1X31C 4KH1B 1RHRB 3PRDA 1N5QA 4RX6A 4DFPA 4OHXA 1BY9A 3PZPA 3JSRA 3R1HA 4Q2MA 3K5LA 4OZ5A 4CH0S 4JI6J 1T02A 1TKTA 3BN7A 4ETXA 1X60A 5KFSA 2XLIA 2AYGA 2VA3A 1TK8A 4I64A 2ZBQA 6AT1B 5SZTA 1RT7A 1UVMA 2UV8A 3U7JA 2BVZA 2JH3A 4X4RA 1T11A 3A8EA 3R9LA 2IRXA 2MSTA 3PJ9A 3MEEB 5HN0A 4RUAA 2MGZB 5FJ4A 3PKYA 2LU2A 2GQCA 2WW8A 4CIOA 3OTOJ 2GC8A 3OSPA 1ZZFA 1S1UA 2G9OA 2LA6A 1FRKA 2PIIA 2D7SA 1B99A 2FHJA 4HACA 4ECZA 3GILA 2IA6A 1KTQA 2DR6A 1RT3A 3AJ1A 1WOPA 3MMAA 4ID8A 4CO2A 2C3UA 2JVOA 4B08A 1N32J 5HANA 2CJQA 3PFEA 3SIPB 2D41A 2BEFA 1BQMA 2HQDA 3BR9A 3W5YA 2XCPA 1SUQB 4NYZA 1V3ZA 1JJHA 4DV7F 3G82A 3K8WA 4GKKJ 3BYPA 3THVA 4X65F 2H3EB 3H5SA 1F1BB 1N0UA 1EQMA 1VQYA 1Q8KA 2BRLA 3W5XA 2EWHA 4C0BA 1APSA 1LOUA 1VQOS 2CJKA 1JLCA 2GCFA 3BSAA 3FKBA 3DRXA 3NAHA 3I0RA 2VPWB 4X4NA 2POKA 2B4OA 4QR0A 3VZIA 2Y1RI 4OHVA 3PR5B 3PY8A 5DO2A 4UT4A 4P75A 1EQ0A 1BMQB 4JI5J 2GHPA 2KG1A 4UF4A 1NHKL 4ZN3A 2KT5A 2BKPA 4GO7X 2YKOA 2KRBA 2HMIB 1G4CA 1WG1A 3GJSB 4NLUA 2O5DA 2YQ0A 4ZIVA 3G8TA 5I42A 4AE5A 1UPMB 3KWMA 3U1NA 1T0TV 4YB6A 5IXUA 4JYAF 1X4AA 1HMVB 2DO4A 4RR5A 3QWUA 2HNZA 2N4CA 3K5OA 4NYPA 2B9WA 1CJTA 1S97A 4RNMA 2KU7A 5F3TA 1IR0A 1FWPA 1FWKA 2OAUA 2BM1A 1WTFA 2VB6A 5AXLA 2AT1B 2BE7D 1IXKA 2J5AA 4I0WA 1Q82T 2IBOA 3IM9A 5ETVA 1Y3KA 3JTOA 4X4TA 4CLWA 3UN3A 1IQZA 5A6PA 1P9YA 4B3TF 4WFZA 2A18A 5GMEA 1YBUA 3FBBA 4TU7A 2GV1A 3MMJA 5JUMA 3RBEA 1CULB 2ZBCA 4ZPVR 3Q8UA 1Q86T 5BYRA 1FERA 1XIQA 1TK5A 3DYAB 4M5KA 2DR9A 1TKTB 4PXBA 3KK3B 2YNFB 2N4DA 2E1CA 4OX9J 4ZHRB 4NX9A 1F0XA 3FBFA 5IT4A 4ZVQB 3ULHA 4DL0C 1FTRA 2W9BA 4MKBA 3N5FA 2LQ8A 1LNQA 2WONB 1BQNB 1Q78A 1RWNB 4Q5VA 2MMYA 4F36A 5KT3A 1D9DA 3PO5A 3CCQS 3F44A 2KRRA 1IN0A 3GIIA 3RRGA 2M2BA 4Q8FA 1HD0A 3GFZA 3MHYA 2A3JA 3UDEA 1N33J 4PPZA 1D9AA 2XQCA 2OLWA 4PUOB 1RTZA 3R5BA 4FNHA 1PYOB 4K4XA 3MM7A 4OYAA 4IRCA 1N6QA 1GAOA 4HKQA 1WI8A 2HVDA 3NOGA 1TP7A 1K1QA 3NY0A 1IBMF 2QZ8A 2IC3B 2CAJA 2HHSA 1FXDA 3H5UA 2GQQA 4GVBA 3CCVS 5CYJA 3BO2A 2XZWA 2PMZD 1YLXA 1VR6A 4DFMA 3KHHA 2HGLA 4QWBA 4CNZA 2HFVA 5JMNA 3HULA 5DQHA 4B02A 3EGVA 2MLXA 3R8YA 3C8YA 1NSAA 2OD4A 1Q79A 2GIFA 1B70B 3BEGB 1IM4A 1DRZA 1KC8T 5EGYA 1HHQA 2HHHF 3EGZA 1H73A 3M2RB 1C4AA 1X4DA 3R6GB 1ZA1B 1VQPS 4WF9Q 1XBWA 1XTZA 1OMSA 1FFWB 1GMVA 2CJ9A 5KG7A 1PYTA 2D69A 3KLVA 4F4AA 4DSJA 1NPKA 3GPAA 1IR2A 3CVKA 3DRPA 3HKZD 4LF6J 2E1PA 2L9WA 2ROPA 1OSDA 1WJ9A 5E3PA 4ILLA 5L1KA 5KFTA 4DV0F 1RAAB 1H3DA 4M5DA 4CTAB 1S0VA 3GB0A 4DLEA 2V5HG 1JLBA 1TAQA 1UCNA 1JLEA 4CLPA 3VGSA 1HBNB 4FVMA 2B6AA 4ED2A 3H8YA 3R7BB 3S1TA 3D66A 1CC7A 1CS4B 3U27A 2ZE2A 1LWXA 2FPHX 1FKAF 1HNWF 2MQNA 4BBYA 4EWTA 2MQMA 5HP1B 2LEBA 3GR1A 3DLGB 5DDRC 3CC2S 4FP9A 3QIPB 1Q8IA 3U1LA 2HBYB 2R7UA 4DPWA 4PQUA 2J9DA 3TNVA 2QL9B 2AJFE 4K0KJ 3V5RA 2BJ9A 3FSXA 1Y3JA 4G3IA 4ERDA 4OI3A 2V8GA 3ZFVA 2ZJRQ 2UVRA 4QYRA 3CPWR 1RT5B 3HT3A 3ITHB 2E9ZA 4K4VA 1VISA 2KFNA 1TL3A 2V8VA 1HR0J 1AA1B 2RNEA 3IBFB 2Y1LB 4HVZA 3OUYA 4KHPJ 3P3DA 4C48A 1N5SA 1GTEA 3NAIA 4QPXA 2IMWP 4DS4A 1X4EA 2HYIB 2DNNA 3QJPA 3DLJA 2FLPA 3IG1A 4DV4J 2AYEA 2VODA 1S72S 2R8GA 1JLCB 4ED1A 1Q5YA 3LGNA 4QWDA 4O3RA 4ZPAA 4N8OA 1HIYA 4Y2IA 2R7RA 1LXJA 4NLOA 3KHLA 2OO4A 5ETTA 1HI0P 4K4YA 2IM3A 3J7ZT 1TK0A 3J7Z5 4DUTA 5KFBA 4BLGA 1LW0B 2W9CA 1SV5A 1RHJB 4ZLNA 4OL8A 3FEZA 4DU7A 2HGMA 2XMVA 1H72C 3OV7A 3TARA 4ZN1A 3AOAA 1BUXA 5IC6B 3EPGA 1BHNA 2GQ2A 4CQ1A 2JDJA 2MQPA 3CDEA 2FHKA 3BGFA 2XS2A 4J9QA 3MAAB 2QTWA 3JQMA 3FQKA 2KT3A 3MGJA 5B0GA 1HWLA 4QQBA 4AD6A 4Z7CA 7FD1A 4V19J 2HHPA 2CPJA 1ZS6A 4ZVPB 4PWDA 1T03A 3DLKB 3M9NB 3FDSA 1IVZA 3Q8VA 1HARA 1MW7A 2FJAB 1KN6A 1QDUB 3VGUA 5RUBA 1G2EA 5IM0B 1UW4A 1HWKA 3OBIA 5JXSA 4NXNJ 5T14A 2OHDA 4LR8A 3W2VB 5K20B 1X9SA 5B0DA 3BQ2A 4FF4A 1NLKL 3G86A 3GLJA 2OELA 2W1BA 2ZH9A 3LPEA 1RAGB 4OZLA 3IN5A 1K8AT 2IRYA 3X1LB 1AW0A 1SVDA 2YXLA 4TY8A 1RWMB 4C2MA 4A8QA 1RTIA 1GK8A 5L9XA 5L9NA 2HFUA 3C14A 4K8RA 1NZ8A 3MEGA 2J9CA 4EBEA 3CIMA 3IR7B 3D4JA 4DUYJ 2KVIA 2V4JA 4ZP7A 1A6LA 1R6VA 3KG4A 1HNXJ 4YY3J 3IRXA 3VR1A 3HD2A 1ELOA 2MKSA 2FY1A 2MB0B 1WEZA 4ECQA 5IC4B 3VAKA 4P2MA 1PAUB 2C2NA 1S4FA 1T94A 2P2CB 5AXMA 2XM3A 3JSBA 5LOQA 2ZZMA 3D3BJ 1WSVA 5HBMB 2RB7A 2RJZA 1VIXA 3FMBA 5LL6d 1S0NA 4MH8A 5LJ5Y 4TXSA 4A48A 4OHZA 3DLEB 4LUBA 2HWHA 3BBBA 3ET6A 1ZTTA 2ZKUA 2JWNA 2PE8A 4UQGA 4X4PA 4LF4F 1Q1KA 2A6OA 2I5JB 1AXQA 1QUPA 5ETPA 3N01A 5I3UB 5D3GB 2QLWA 3I5AA 1M5KC 2BJ7A 3IBCB 3IR6B 2UV8G 2RU3A 4B9MA 2IDLA 1SV5B 2RAQA 2YPZA 5KT7A 2EVZA 5KG3A 5DGBA 4YQWA 1UVIA 2HW3A 4EEYA 4V19X 3VCDA 4OZJA 1W25A 2NYHA 4JI2F 2FTRA 4GC7A 2WHOA 4HTIA 1XC9A 4JV5F 2KJVA 2V2VA 2KN4A 2OP5A 4XDDA 4LF6F 3OLAA 3N6NA 1K0TA 5D78A 4U7UD 2VQFF 4CO3A 4RUHA 1TR0A 3NOCA 1OY9A 5KFDA 2RDIA 2ZE2B 3BDEA 3G87A 4O4RA 2B8QA 4KRWA 5D0EA 1JWWA 2P6SA 4NZ7A 5KFWA 1NK5A 4OX8A 1FDNA 3W62A 4QIEA 4I6YA 4DQRA 4ANCA 2FHJD 4KTQA 2E1RA 3NRBA 1NRKA 3JYTA 4AL7A 4B9LA 5C5JA 4LSNB 1UEVA 4LF4J 1BGXT 2RVJA 4EK2A 1VQKS 1FX2A 2OEKA 1SC4B 1WDTA 3TVYA 2L41A 5GAHU 2HKEA 1CJUB 2JEIA 1UJ5A 4OJGA 1O8BA 3ZZOA 3BZQA 2FIUA 3QPIA 2A2CA 3DRSA 3TVZA 1RISA 1HQ2A 3MEGB 4QW8A 7FDRA 2MKJA 4KPYA 1TL1A 4B9TA 1O5JA 3HO1A 2EFVA 2RE1A 1M5HA 4DJBA 1VIOA 4GVLA 1B0TA 3CNQP 3K5MA 2L9DA 4JI8J 5KG1A 3NBPB 2GAGC 2CKWA 2E5IA 4J9MA 1PBAA 4NEYA 4BHQA 2BMBA 2DISA 1OS5A 4DPYA 4UOGA 1NMEB 3GONA 4KGXB 4LRBA 1HHTP 4K5RA 2IVYA 1CJKA 2ZOMA 2OUGA 5HBMA 2OTJS 4NCAA 1HQEB 2D9OA 2G0JA 5CQGA 4Y3CA 4C11B 1JK9B 4U95A 3LGHA 3LP2A 5KFUA 4UZBA 4I4BA 3AD8C 5DJBA 1P27B 3W2VA 5G4DA 3BPDA 4YR3A 1N4LA 1JKHB 1N36J 2ZVSA 4WBFA 1CEZA 2CQPA 2CNKB 2CFXA 3TAMA 3GE9A 4B3SF 3CD7A 5KFKA 3VGVA 3FFIA 4EUVA 1SC1B 3PW4A 2B0GA 5CZXA 2C28A 3GJTB 2F8EX 1RWWB 3C46A 1T9WA 2ZUAA 1G6BA 2M4MA 4CP5A 5FLXY 2DPJA 1JLAA 3J7AN 2EKYA 2E66A 2FZCB 4MMOA 4WJBA 1YZ6A 4WK1A 1S9GB 4R5PA 1JXVA 3DLLQ 2CQ3A 1IKYB 3W9HA 5DM6Q 3GV7B 4QU7A 2RT3A 4ZPDA 3KLHA 1SL2A 2DXDA 4UY85 3N5BA 1FXLA 4L74A 4NCGA 2MQQA 1F5AA 1VFJA 2CUYA 1TQLA 2WSFC 4OYMA 4DX7A 5A2QY 4PG5A 3EZ5A 3PW7A 2XNQA 5T7LB 4O4GA 4L6V3 3KG1A 1RWUA 3BYRA 3A3NB 2W2PP 2PGCA 1VQ8S 1VRTB 3M2UB 2WK4A 4HDGA 3CCSS 1TUGB 4ZVSB 1YIJS 1SKRA 5JVGQ 4KGZB 3MPYA 4Q0BA 3PIPQ 3NXZA 4NXMJ 5CHCB 3HMJG 1K47A 5BR8J 3AHPA 3FFIB 3I87A 4RWWA 2KZMA 2PFFB 2DHGA 4USTA 4DX6A 3EYZA 4DUYF 2CIMA 2HRYA 4MK7A 4HEA9 3VVUA 2MZJA 2C2EA 1O0PA 4OHWA 1YJ7A 4URSA 1S12A 1OQ6A 1ZAWA 1CSJA 3MURP 1DTQA 1S6PB 4MIWA 2ZM6F 3KLHB 1UL3A 3SSRA 3B78A 1PBUA 2FJDB 4Q7AA 1IBLF 2R3VA 1HQEA 1KHVA 3DRRB 4RBTA 1S6PA 3BB5A 2HHTA 2FZGB 3BM7A 3DLKA 1R0AB 4J9PA 4ECSA 2B5JA 3D6FB 4NA3A 2HHQA 2WW4A 4PYAA 2EEYA 4WFAQ 1C0TA 1UWBB 3KHGA 2XY5A 4F8RA 2ZC4A 2V2ZA 3A1YG 3AT1B 2GMLA 2JLFA 3LQVA 1OYEA 4CTAA 4WFNQ 1DFDA 5DM7Q 3UD5A 4E8UA 5C24B 5KFNA 1WF2A 2QFJA 1IQTA 4NXNF 3I0SA 1W2IA 1IKVB 1EIYB 4OV1A 1SL0A 3HT0A 1LK5A 1VYAA 2YVSA 3HM9A 3QGGA 4O0NA 2A6MA 4FXVA 3X3UA 3DI6B 2DB1A 1VJQA 1Y5IB 1HWIA 3FNNA 4ZCMA 2UUTA 3PEJA 3Q8PB 3T5LA 3UD4P 3TUPA 4PXCA 1NCLA 3QGPA 1GTHA 3KJQB 4EZ6A 5F8HA 4K4UA 3AXKA 2B43A 3ISZA 1XNQF 2QSWA 2OMLA 3ENQA 3MEDB 4EO8A 4F50A 3H40A 3CEDA 2J7KA 1S9GA 2VG7A 1HNIB 1U24A 2HGNA 4I7FA 2ZD1A 5J1EB 2V63A 1OJ4A 4N7TA 1MWZA 1IM6A 4YN3B 4CLYA 2KFZA 1CQMA 2PD1A 2O1PA 3CCWA 3JTNA 4P6QA 5HQMA 4DQSA 2VU5A 3O6QA 3IWXA 4Y0FA 4H4KA 2B3TB 1ULRA 2HRTA 1RACB 3MMCB 3EGNA 4S0MA 4JI1J 1OY6A 1WEXA 2DNPA 4LBIA 1FD2A 3K0JA 1GXUA 4EYIB 4KH0B 5CA5A 4WXOA 1KVIA 1H2TZ 2V94A 1S10A 1DHMA 1U8SA 2DGWA 4RKUC 2GW8A 1ROFA 2IFXA 3OJSA 2GJFA 3OHAA 2WVEA 5L8RC 2RS2A 1RHUB 1QJHA 3JQJA 3TZWA 2QYGA 3HKWA 4DSLA 2BJ8A 3U02A 5BYSA 4RO0A 1CJTB 5C2GA 4CLZA 3TJAA 3MCNA 4WFYA 3RJMB 1KS2A 1SBRA 3B4MA 4NXMF 1BC6A 2VFUA 2MQ8A 2FVCA 1VDHA 3BKTA 2AMCB 2DNLA 2VZ9A 5EX3A 4CLKA 4FF1A 2N82B 3DN9A 2KZZA 1F9FA 1M0SA 4ZVOB 2VC0A 3THPA 4R25A 3TA1A 4RNOA 5J2MB 3H4BA 3MPWA 3GFHA 3G4SS 3DYAA 2HHUA 2B4VA 1R27B 4WFXA 1HKAA 4NOHA 5E5NA 2QLBB 4ANEA 4CDIA 3H25A 1WKJA 2UXBJ 3LAMA 2VIHA 4ES3A 2E5JA 1NEEA 3CXCR 1TKXA 1WSRA 4QJVA 3T41A 1IWGA 3BKUA 4LQ9A 4A8XA 1B3TA 3R1LA 2VF3A 1L3SA 4F2SA 2W7PA 4IR9A 2ILZA 4ED3A 4M63A 4Y65A 3GYNA 4KYZA 3NLCA 4JV5J 4NYOA 3HZGA 3CJ2A 3IC1A 1NKBA 4ELVA 1TL3B 2ZH8A 4ED7A 1VBXA 4ECTA 4CLFA 5F8GA 4IG0B 4K4WA 4M94A 4TNOA 2Q66A 4NLDA 3Q23A 4ECRA 3QRQA 2LQJA 3KLEB 4PG6A 1CLFA 5AT1B 4MK9A 4TYAA 5D4LA 2YKMB 4K7QA 4DPTA 1L3VA 3G6YA 5CH7B 1N54B 5LT5A 1WNEA 3UDCA 4DR4F 3KDNA 2MY8A 4J9KA 4HLBA 2CVIA 2HNDA 9RUBA 3MXHP 5L1LA 1LWCB 2EXUA 3QAUA 3S6EA 3TZZA 4ZLPA 3V6KA 3CDBA 1EETA 1S5ZA 1QY7A 3AODA 3MUVP 1KNZA 4OZ1A 3MMAB 2VFSA 2Z57B 4BWMA 3RW6A 2UXBF 3MECB 4CYUB 2DR5A 2I2YA 2QRRA 4C7QA 4X4SA 5T41A 1UP1A 3BGUA 3CMES 2F3JA 3G6VA 5GAEU 3R3TA 1IJEB 4YOEA 2JFKA 3PM9A 5B09A 2H48B 2NZCA 4ZP6A 5CZVA 4PYDA 1RADB 2F63A 1N8RT 4L3KA 2W8KA 4ZPBA 2QO3A 4OX7A 4KR0B 2ZUGA 3B6BA 4DX5A 3EX7B 2IBKA 2D74B 1FXRA 2J7WA 1U1QA 2YKAA 3PJWA 2NQPA 1U1OA 3N6LA 2AJ1A 2AWZA 3CJ5A 1NAQA 3QIPA 2FGOA 3SEOA 5MLCV 2PEBA 2Q6BA 3N28A 4J9UE 4ZS6A 4TQRA 1S1XB 3MM6B 4WU3A 1YJWS 2HQFA 2IYGA 4LRAA 1VQSA 3W65A 5F3ZA 2XCAA 3CCMS 2SXLA 5BXIA 2N7YA 3MTJA 2BE9B 1FCAA 2HK2A 1HI8A 2K3IA 3L09A 1FDDA 2CG4A 2HIYA 3MPDA 2FJXA 4ZVGA 4F04B 4RU2A 1SJRA 8RUCA 2F8MA 3KUEA 2VQFJ 2UVUA 2JJ4D 3OXGA 2BDPA 1FDBA 4V1Ak 3A3OB 2UXCF 1FTCA 4MKVA 3BJYA 3EVWA 4EI2A 1S6QB 4ZVUB 4A8OA 2ZEJA 1R89A 3L7PA 3ZZPA 1B0PA 3S01A 1H38A 2NSCA 2XGQA 4A8YA 2GS8A 2UVWA 2N3OA 1RT2A 4XK8C 1WKLA 2DYAA 3HSJA 3LAKA 4MT1A 1ITPA 1KEKA 3HD1A 5MAOA 1N0VC 3LGMA 4XO0A 5I3PA 5ETMA 3PV8A 4OI2A 3IRWP 2ZFHA 3A8IA 3BQ1A 1PKUA 3MMCA 3M2VB 3NGRA 4M5LA 1HW8A 1TFWA 3AFGA 2WBRA 2F1FA 2IVMA 2ALZA 2XGPA 2DH9A 1IBKF 2BANA 4U96A 1XMBA 1LK7A 1ZOTA 2E5GA 3I5CA 4WP8A 2W2OP 2AP6A 1CJVB 1UJ6A 4I68A 4I2PA 3KLGB 4DF8A 3P45B 1N5TA 4DL3A 2MGZA 1AUSL 5J2QA 4LF7J 4M8LA 2C2ZB 4J9VA 2CDQA 2YWGA 1HBOA 2GIQA 2Y3YA 2GO9A 4USIA 3SCLE 5HMWA 1C2PA 3FCWA 1FRJA 4MYUA 1X0FA 1HWJA 2NXNA 4WP3A 1HBUB 2L3MA 3CJSA 4ER8A 2QA4S 3R2CJ 1HBNA 3IG1B 2HZAA 3HHDA 3KNGA 3CCUS 1EP4A 3CF5Q 4LFCJ 5C2CA 3MMBB 1QAYA 4LF7F 2CQ4A 2IM2A 1D09B 3DHWC 2XLJA 2RRNA 1LWFB 4DCOB 5LSOA 3ILIA 2KL8A 2KYZA 3NCQA 2XLKA 5B0BA 2J0SD 2ZDOA 1AROP 3LUYA 1BWEA 1Q7LB 5D77A 2NPFA 1S9EB 2RUSA 3OTCA 3FRZA 4KB7A 3PW0A 4IDKB 1HNZF 1FJGF 1OO0B 2C3MA 1KQKA 3LA0A 5KFQA 2ZH3A 2DR7A 1ZBTA 2XMKA 4CH1A 3VAMA 4NCBA 4U9RA 4RBUA 5D4PA 2MZSA 1S1TB 2DNZA 3Q8SB 2EFPA 1FK9B 2ZH6A 2GX8A 4YMEA 4F02A 1W7WA 1HQUA 1S6QA 4XPCA 4LF5F 1S1TA 3QQCD 2X1FA 3KUHA 4IH5A 3UNYA 4ED0A 3FVYA 4IFYA 3ENVA 1XR7A 2DGSA 3W63A 5K9FA 4G1QA 2YH0A 4WE1B 1JXEA 2HNZB 3CDUA 4G1PA 2WVFA 4IFVA 1FE4A 2I8EA 2VASA 2C3YA 2WVCA 3A3PB 3BV8A 1U0HA 4RNHA 1WDDA 1JLEB 1TU0B 4LQ3A 4UW2A 3W3SA 2RILA 3I4HX 2CYYA 4I2QB 3MR6A 5J2NB 2R2TA 2BM0A 1Y4ZB 2X1GA 5B0CA 5JJBA 1WHXA 2CQGA 1KVKA 2AYMA 2GVDB 3JXOA 4JB8B 3WX8A 3TI0A 3NWRA 1T8EA 4I67A 4DR5J 1WC0A 3WZ0A 2QMWA 1HYSA 2V50A 2EFQA 2NCKL 1JIHA 3DLEA 2CPEA 2E44A 3FZ2A 3SDEA 3NWGA 1DTTB 3AJDA 4N77A 1E6VB 3R6LB 1RP5A 3CC7S 1RBAA 3M2RA 3ENWA 3N9UC 4YB7A 4YHHJ 2R7VA 5FLXU 3C15A 4WCEQ 3C14B 1W26A 3O1LA 2QL5B 2K3KA 1F5BA 2W4DA 1JLGB 1FHTA 4FZVA 3WIVA 1G7CB 3KG0A 3PYGA 4KO0A 1PILA 2I6WA 5CCLA 1HFEL 3PCOB 2M8HA 4A47A 2CZVC 3ZZ0A 5SUHA 1B7YB 2XYHB 2X1BA 2ZZTA 3VV2B 2UUWA 5CCMA 2OPQA 2MDAA 4J9RA 2ADCA 1QM9A 1XMQF 5H9FK 3IR5B 1YSJA 5HVGA 5KFMA 2DNHA 2V34A 3HLUA 1F2GA 5DZ7A 4PUOA 1H98A 1UEKA 4IG3B 4UUWA 2FUG9 1NM2A 2HVHA 2K8GA 4R0JA 3IWLA 4QU6A 2D9PA 3VHQA 3NGDA 1CC8A 4L72B 2JLEA 2XHCA 1Q95G 2BOAA 3LP2B 4IDKA 3T19A 1P6TA 1RBLA 2DNOA 2OPPB 2J9DE 4KGKA 3GSDA 3KNAA 4RW6A 3OL8A 2XI2A 3ILLA 5I3UA 3PFOA 3UD3P 3DU6A 2BANB 1YVFA 1YJUA 4N41A 2JOQA 2V6AA 2W25A 4OZ3A 4A8SA 1N88A 2ZNYA 1RE1B 1LW2A 3MD3A 1Y9OA 3HJFA 1A9NB 2GMJA 1X9WA 4ITSA 3KK2A 1HHSA 1XWLA 4MJKA 4ECXA 2BQRA 1HNWJ 1VRUB 4C8ZA 2ZDPA 1OWXA 2Y0BB 3V4IA 2OMOA 2RQKA 3TZYA 3PDNA 2LYVA 4HH1A 5IWAF 4AL6A 2Z30B 1RT2B 4QWEA 3DRSB 4K0KF 2E7WA 2XMAA 3DRPB 4OJ1A 2DCUB 3D9BA 4H4OB 2RHQB 4KY3A 3RAMA 5A8WB 2OPQB 2ZWPA 4AT1B 1SPBP 2KHDA 1U1KA 2M52A 2VOPA 1C1BB 2XTJP 2ZBIA 3V81B 2ALYB 4OIXA 3EVOA 1YKWA 2IJFA 2E29A 1URRA 4OYZA 2ZBPA 5HROB 3JSYA 2LMIA 3TP2A 5B0EA 2FJVA 4DBQA 4FBUA 1DURA 4F2RA 2LQ9A 2OFGX 1T95A 1LWEB 2XYPB 3ZC4A 2ZHBA 3DOKA 3TZXA 4DPUA 5KFFA 3FUYA 5FDLA 2AF6A 2HNYB 4DV4F 4ECYA 3C6UB 3OL7A 1E6VA 3TX0A 2A1BA 2Y9HA 2RH3A 4DV5F 1K44A 1JLQB 2LFVA 2CJAA 2W4CA 3LOUA 4CT9A 2YWFA 4YUDA 3Q8QB 5K8OA 3OW2R 1SKWA 2P9GA 2JHEA 1X4BA 4DV6J 2VKRA 1NDPA 3MFHA 1FJEB 1Y11A 2DO0A 1GMWD 1ZM4A 1DY3A 1RWKB 5HLFA 4PWWA 4UZCA 1UFLA 2MQLA 4JV0A 5KT5A 4PWDB 2HVZA 2X7IA 4RWXA 3M8RA 5L39A 2GJIA 2B6AB 2WB4A 5AXNA 3UN2A 3MAAA 1WHVA 1QSSA 2QN6B 1UMJA 2YX4A 2XC9A 4JI8F 2JLGA 3D2WA 5F8JA 4KFBA 5GMKa 2Z8QA 5J1PA 4MK8A 4KKOA 1SJQA 2PA8D 2V67A 3H42A 4U7CA 1T7PA 1I1GA 4X4QA 5J1EA 3ETOA 2YKNA 2FZKB 3OFGA 1WUUA 2H5JB 4NEZA 3VALA 1S9FA 2GFFA 1X5OA 2Z56B 3LH2S 2R42A 2W7OA 3SDEB 2OPPA 5KOXA 4B9VA 2PDAA 1FO1A 2QT7A 5H9EK 2YKQA 4A8MP 5C25B 2HVIA 3D6TB 3CJ8A 1KLNA 4KV8A 2P6TA 3IMQJ 4NLVA 3W2WB 4JV1A 4AL5A 3MR7A 3FK4A 3IAM9 2J9EA 2HQIA 4UOCA 1CJUA 1FX4A 4USMA 2YWKA 1B0VA 2DGOA 2H54B 1MROB 5IS2A 4EFAC 2D3O1 3C6TB 4EGLA 2C3PA 5DDPC 1SH3A 1GT8A 1UJ4A 4B9UA 3OVAA 3GWCA 3UN5A 2Z2MA 3PKMA 4JI2J 1IJFB 1PYSB 2GVDA 3I82A 1EAYC 3W5ZA 2XO6A 4CO0A 2ASDA 3CCES 1RT4A 5KFIA 5EDWA 1N36F 1F5CA 3FCVA 4M5MA 3FC9A 1SXLA 2CNOB 1J5EF 2QYCA 1Q7YT 2CZ9A 3CWJA 4LBPA 5KG5A 2VG6A 2VV5A 4OYPA 5F8MA 5JVHQ 3PR4A 3BBFA 3NEKA 3DDNA 3HVWA 1MMNA 1R43A 1KDNA 4DR3F 4ILMA 4MYTA 2VG6B 4NZ0A 3TUJC 3WIUA 5F8NA 1FNOA 2ZWOA 2UU9F 5K5MA 1FRHA 2JVRA 4QIVA 5F0UA 2LVWA 3KXDA 4LSZB 3MCMA 5FD1A 1EKRA 3W2WA 2AU0A 2PC6A 1J5OA 4L76A 3UR3C 1S59A 3C19A 1UEUA 2FLOA 5H1SV 3MUMP 4L73A 4LF1A 4B3RF 4ECWA 1RT6A 2MJUA 4KC5A 3T5KA 3UCUP 3SSQA 3DLHA 4IRDA 4HR2A 2F40A 2DRDA 4U8YA 4XAKA 1HW9A 2AYBA 1FI4A 3B82A 2ZH5A 4JI3F 5KFCA 3FRYA 4DV7J 1MN9A 3MM9B 1RT4B 5EHHA 3T1AA 3QLHA 4DHVA 4DR2F 1J2VA 2MZTA 1FNXH 1SJ1A 2MLZA 1VBYA 1H7WA 4RLEA 1QLNA 2H51B 4HHJA 4R0EA 4O4GB 4W90B 2V9KA 4LSLA 3CD5A 2FDNA 2HQCA 2HFNA 4GC6A 2KTQA 3RZAA 2BR0A 2BKNA 2WSCC 1NHVA 1E6YB 5DQGA 4Q43A 1RTIB 3WDOA 4OI0A 3CD6S 1B7FA 1UWAA 2F7VA 3HX9A 4LF8J 1DBDA 2FJEB 4DUZJ 1LFWA 1RA7A 2NLWA 3POTB 4PKDB 3H2UB 1U6ZA 1S49A 4MTPA 1YBAA 2GVZB 2PEHA 4ES1A 3S8SA 1YHQS 1F60B 3I0SB 1PIEA 3M1VB 5KT2A 1TL7B 4ZJLA 5C42B 4N76A 5AJ3J 2QA4G 1QVFR 2YY3A 9ATCB 3UDLA 4C0OC 1QUVA 1NDKA 1WF0A 1XR5A 2DKOB 4MKYA 1U02A 5HJXA 3ZTQA 3IS9B 1JJCB 3P6YC 1IKXA 1FKOB 2EFNA 3GZ7A 4C8KA 2CJXB 3KJVB 4H54A 4LJMA 1Y7PA 4C4WA 5KFRA 1WKKA 3RBDA 2DBBA 2Q6CA 1MWQA 4BCAA 1ZH5A 3V6HA 4P10A 4AQYF 2DJWA 2OPSA 3Q24A 5L1JA 4ZVEA 4J91A 1S79A 1JLFB 2AHOB 2HBRB 3G2XA 4PXDA 4C97A 3J81U 1LWCA 1UVJA 1X7VA 1FJCA 1RTHB 2GVZA 1WHYA 3US5A 1RT6B 4QIWD 1RTHA 1GX6A 2G2ZA 2YPYA 4UQTA 3HFVA 4CLLA 2XY7A 2OTLS 3NMAA 4ZPTR 5HATA 2OH2A 4M1KA 2MXYA 4OZ2A 1OY8A 2C2RA 3BN4A 3ZZRA 1XNRF 3D5MA 3QGHA 3EPIA 1S99A 3BREA 2U1AA 4EBCA 3DM2B 5I3QA 4WYLA 1M1HA 4FYXB 2OSQA 1U49A 4TQSA 2ERRA 1BWVA 3IM8A 4RNFA 2DIUA 2YNGB 5A6WA 4A46A 4CM2A 2AEFA 5H9FJ 5E41A 1S0MA 5KFHA 4O3OA 2HHVA 1VJWA 4YY3F 2J0QD 2LECA 4OQJA 2VDIA 3T6BA 1VLYA 4P52A 1UA0A 3EXYA 2ZM6J 4N47A 3WBZA 2W2MP 2HEKA 1WC6A 2WZ1A 2VQEF 1TUWA 4K2JA 3EDQB 1VQ5S 2BACA 3CIZA 1VQ6S 3NS5A 4IO1A 4ID5A 1SKSA 1C0TB 1UWBA 4JI6F 4DV2J 1S7HA 1WG4A 2FVSA 4DV1J 3I9V9 4FVCA 4O3NA 2F65A 4UOHA 2KXNB 2ZJPQ 4K4ZA 2WBMA 3OL6A 3ZTOA 3DGVA 2ZH2A 1HQUB 3P96A 1XEZA 1YJ9S 1X9MA 3E8OA 3CJ3A 2QLFB 3M8SA 1WOOA 2QLJB 1V3SA 1K0VA 3DOLB 1VQ7S 1TAUA 2PMWA 4NLRA 4WIQA 5D15A 3TAPA 2ZC3A 3AXMA 1RWXB 3HXMA 4CI0B 2CNLB 2U2FA 1R0CB 1U0HB 2H5IB 1IUJA 2J8AA 3CO9A 4R8UA 1YWXA 5CAAA 3M9MB 2ATLA 3FEYB 1PGZA 3QT5A 5EWEA 3PW2A 1FRXA 4FPIA 4A4JA 3EDRB 4O44B 3SCKE 1H0HB 2B7BB 3EWGA 4HH0A 2R8IA 4ZVFA 3W1YC 2PFDA 4F4XA 1S0OA 1EP4B 1GXLA 3HHLC 5LMUF 2JNJA 4YR2A 4DV3J 3K59A 1EKSA 1JX4A 4Q8EA 3QZ8A 2ILYA 1YJNS 2E7VA 3R7NB 1R8HA 4DF4A 2MHNA 2P8IA 2G1DA 2DEJA 2KT2A 2R7OA 4ECUA 5CYMB 1VHIA 3PNIA 5KG0A 3QWPA 2EC0A 1WOSA 1S9EA 1TKXB 2AZ1A 4ZVTB 2CWKA 5DLGA 3CD0A 3V6JA 1S76D 4ZOSA 5K14A 3DI6A 2R2UA 4LVNP 3HP6A 1HNXF 2V8HA 1ZTWA 2RS8A 4HT5A 3H59A 4LRDA 1NSPA 3M1VA 4ED4A 1TL4A 1F2HA 2GZOA 2M3DA 3S7RA 3AOBA 4XIUA 1NK4A 2XYGB 3KLIB 2EI5A 4FF2A 4PCQA 4NA1A 4J37A 4LRCA 1JLBB 1X8DA 5A76A 3Q8RB 4DR4J 3HVTB 4RW9B 4MAKA 2VICA 2E9TA 3GV5B 4Y2KA 2VUGA 1MN7A 4ED8A 1BLUA 1V9OA 1DAXA 1HBMB 1RJJA 3MM5A 1Q16B 3PX6A 3G9CA 4CRJA 1REVA 3QT8A 1LQ9A 4N8NA 2VG7B 3PXGa 3TOQA 1AZSB 2NXUA 4WKYA 3ZTPA 3HVRA 1HNVA 1UA1A 2R8JA 5KG4A 2BABA 5IZHA 1CJVA 2IPOB 3KK1A 4C3LA 1ZM2A 4J7CA 3VAHA 3HFZB 4MFBA 1ZPWX 1FFSB 2LQBA 2PSZA 5CYMA 1YDLA 3D7SB 5THWA 3ICLA 1W2BR 3BH7B 1SQEA 2DRBA 4F4KA 4IUFA 1TVRB 4F3MA 1VRUA 2EBEA 3GCXP 4YFUA 3CT9A 3EVMA 2O67A 1D0EA 3MUTP 3GFXA 2BW7A 4FDFA 4LR9A 3I5BA 2O66A 4G1QB 2FVRA 1WD6A 3VGTA 5KFYA 1OIAA 3CJ0A 3VAJA 2MHEA 5HL7Q 1RT3B 2V8DA 4E2FB 1EJ7L 4EO6A 3N79A 4OYIA 5LMNF 2VONA 2V8PA 2HQ3A 3KTQA 3KJVA 1C1BA 4ZMMA 4URQU 4R8UB 1IR1A 2DNQA 3LW5C 3M30B 4CO4A 3GIKA 1NXIA 3O8WA 3MEDA 2MKCA 3QNWB 2AGOA 2MZ1A 2DD8S 5HO4A 5DG8A 4Z7YA 1U6FA 1HBMA 2AX0A 4OZ0A 3OQ2A 3UI3A 3TO8A 1HLWA 3I9ZA 3CJQA 2VJUA 1LWEA 4PAAA 4F0KA 4DSFA 3KLFB 4J9OA 1WC3A 1YZ7A 3NMRA 2XI3A 2F9JA 2DNKA 3EGWB 2BJ3A 3DHXA 4P2SA 5HJYA 3C3LA 5G0RB 1VC5A 3UCGA 3C2PA 4FNIA 1U47A 4X4VA 1T05B 1VS3A 1NJYA 2HS4A 2NS1B 4ILRA 1EETB 1RT5A 1TV6A 2HRUA 2BQ3A 2WTFA 4K5SA 3ILJA 5DZ6A 4XPEA 2KM8B 4LFCF 3T9ZA 2CPFA 3W8PA 2E5LF 1KOOA 1G1XA 2Y8YA 1VQLS 3M30A 4DLGA 1M5OC 3QRPA 4OV6A 3GG0A 3W9IA 4QR2A 2OFHX 1N52B 3BO3A 1RYSA 4H4OA 2KG0A 2OPRB 2BJEA 2K1RB 4P7TA 4LMZA 2IRUA 4IKAA 4DX8H 1UPPA 1XJWB 5F8LA 4EYHB 2DNGA 2C22A 3QT6A 4TU9A 4LF2A 3R7SB 1WC5A 2IM0A 2HNDB 2NR0A 3M2VA 1VQ9S 2ZHAA 3VF0B 2VC1A 4LFBF 3D0HE 2DNMA 4FPRA 1HPZB 1ZYQA 3OTBA 4QIFA 4LVOP 5ETKA 4DQQA 1NKEA 3H5YA 5IT9Y 1LW2B 4DL2A 1SQGA 1N5VA 2HK3A 2HZCA 3SYZA 3JTPA 4AQYJ 3RB0A 3DOLA 1ZAXA 4QOTA 4DCJB 2CJBA 2YWEA 4OI6A 2ZH1A 2AEMA 3A12A 1NH8A 4HACB 2HQGA 1SIZA 3TJ8A 4RBVA 1RK8A 1TV6B 1RWPB 4QYZK 3OFFA 1VC6A 1U2RA 2HAFA 1WF1A 2RRAA 1RT1B 2DITA 3P5TL 2HHHJ 3GYXB 5FIIA 1Q8LA 3AAWB 3QJJA 3R2DJ 4X64J 1T9UA 2HLUA 4TN2A 1M5PC 2UXDF 1KTVA 2LEAA 3ZZUA 3T5JA 1OPZA 3L7UA 4USUA 1JNZB 2F8HA 3L3CA 3PG9A 4TLRA 4ZIWA 4CT8A 1XR6A 3MMBA 2K06A 1U1LA 2B4UA 3Q0AA 2AQ4A 4P73A 4DR6F 2IC3A 2QA1A 4UUXA 3FSYA 3N0VA 2EK1A 5G0RA 2OI2A 4O3QA 2B9YA 2K7JA 4OYWA 4D3GA 1X5SA 5BJRA 3H7HB 3NS7B 2K2PA 4O23A 3KLFA 4C3KA 1FD8A 1AB8A 3A8JA 3BF4A 3DFEA 1GH8A 2CQBA 2RKIA 1RTDA 1WC4A 4H4MA 4JI0F 1Q8BA 2CADA 2GHWA 2AD9A 3ZZTA 1NKCA 1MNEA 3BBCA 1QSYA 1WI6A 2COLA 4AXJA 4RW7B 3NL0A 2LP4A 4P2FA 1C1CB 1OSCA 4PWUA 1FWLA 4L75A 4USWA 2B56A 2JX2A 4WP9A 1KBRA 2H1YA 2WONA 2BV3A 4MIAA 3QIDA 5E3AA 5E7OB 1FF2A 2B9EA 3G6XA 2A10A 3H2VE 5C7PA 4IG0A 4DPXA 4N5SA 1U8WA 4NMLA 3W66A 1XQIA 4JI0J 2WCXA 2RUGA 1RZMA 4NI2B 2W2QP 3DC2A 1U09A 3NNAA 2KKHA 2H9ZA 2E5HA 4GRSA 2KDOA 3ONQA 5D4OA 5K8NA 2KXFA 2VKZG 1UAWA 5F41A 3VZHA 3QJLA 2R2SA 4DN9A 2FB0A 1HR0F 2P9EA 4FKXA 4MFBB 4LSNA 1KOHA 4CNYA 2DXEA 3ETMA 2ZVIA 1RT7B 4X66F 4KHMA 2ZZNA 1BQXA 3K57A 4ED5A 3V2UC 2X3DA 1R6YA 2P5VA 2IVFB 2HFZA 2R7QA 3H90A 3NGSA 3UCZP 2ADBA 2BBEA 1TL7A 2Z4PA 4K4TA 3BSNA 5H9EJ 3MFIA 2VFVA 3AJ2A 1N34J 5EN1A 1BQNA 2BW2A 5D0HA 2WOMB 3SQGA 3OUYB 4RU9A 1TELA 3IAS9 5A8KB 3T1YF 2B51A 2ZH7A 5E0OA 2ACYA 5AE3A 3SV3A 2WOMA 4P74A 3VQTA 3O2IA 4ED6A 3FJ2A 2PA3A 1RWVB 3HHEA 2HLTA 4JI7F 2ASJA 1WHWA 3V81A 1FVSA 2RDJA 4O3SA 3IP0A 1R0AA 2I38A 2FVPA 2L48A 1NU4A 5IM0A 4J90A 4ZJQA 1L3UA 1JXLA 4OYXA 3RB4A 2F4VF 2CJYB 4CLUA 2BJDA 4NRUA 2F9DA 2RD5C 3GG1A 1GMWA 2HFOA 2YX1A 2ABYA 1NDCA 4KIAA 3GR0A 4WWSA 3W7BA 4X65J 1AYEA 5D8HB 2AJ4A 4F4ZA 3FQLA 2BE2B 3C6UA 4L3NA 4KJIA 3NGTA 3SV4A 1Q81T 2CQDA 3PYDA 3R5JB 3U1MA 5IT0A 2V4JB 4OJ3A 1TVRA 1EHWA 2DK2A 2X51A 3BSCA 4C0HA 2BOPA 2AX1A 2VD3A 2VPXB 2GNKA 4KPCA 4P7VA 4ALZA 5L38A 2N7CA 3T9NA 2CQ2A 4F26A 1RAIB 4CCHA 2AKWB 2AV5A 2J8SA 3QSYB 2KXHA 2M8DB 3LTOA 4M5JA 2HHWA 5EWGA 2DT9A 4BDPA 1UVLA 3P49B 4OLPA 3CMAS 3HDSA 3HHLA 5E3RA 2FVQA 5DQIA 3TRGA 4FN5A 1YX2A 3RRKA 2ZOFA 2VBYA 1H74A 3M8QA 2VFTA 2CRLA 3GJRB 4FXDA 1M5VC 2HS3A 4XTTA 1NJWA 2YKPA 1DLOA 1H2VZ 4M95A 1WWHA 3UFCX 3BH6B 4KKOB 2MQOA 2AZ3A 1GXTA 3SSSA 3ZO7A 2LEPA 1JMTA 3MD1A 2DTJA 4BC9A 2LA4A 5I4MA 1MU2A 3RR8A 4USJC 3E51A 2KJWA 2QLXA 4ETZA 2AJ2A 1O51A 2PMHA 3D67A 3TQ1A 1JJ2R 2QE5A 2WAQD 5D4NA 2UUCF 4HT7A 2JC1A 2DGTA 3H20A 4WU2A 4CH7A 3SZ2A 3ZZZA 5LMNJ 4DCPB 3TAMB 2IJNA 3IA0A 1NNDA 2BRKA 4PG8A 4RW4A 4DL5A 2BYCA 1Q5VA 1YG0A 3D0IE 4O3PA 3HI9A 5EUHA 3V4IB 2JZ5A 4R5PB 2XULA 3I6PA 4ICLA 4DV3F 4RW8A 1NK7A 5M2RA 3W60A 5A8WA 5IOLA 4BS2A 3AB4B 1CVJA 1V5IB 5DDOC 4DV0J 5IWAJ 4HI2A 3MM9A 4HHHA 4YB1P 3PW5A 2HSEB 1IKYA 2Y1IA 2C3OA 3R5AA 1PJ5A 4BC7A 1QAXA 1VRTA 3GFYA 3M2UA 2DH8A 4PPDA 4JP8A 3CJKA 3RYLA 3WC2A 3KOAA 1MU2B 4FS2A 2XBPA 4GKKF 5B0FA 2EC2A 3OTEA 1JKHA 1RCOB 2M70A 2IA0A 4PQUB 2XMJA 4NL5A 2M7SA 4RUBA 4ZPCA 2VJVA 2UXCJ 3BQ0A 3SI8A 2VBZA 2D1CA 3AQOA 1WG5A 1R8BA 3HSZA 2X1AA 4RL1A 3HHLD 2ATCB 1IBLJ 2RRBA 3TA0A 1UW9A 2QMXA 3DU5A 3I56S 2W7AA 5IQQA 5ADZA 2BZ2A 2DY9A 2KFYA 3D54A 3UQSA 1N5YA 1JLAB 1H7XA 3LALA 5AE2A 5L46A 4DL4A 1RAJA 3ILOA 2VA2A 2XS7A 1SUQA 4WK3A 4ZKAA 5J2NA 3HVTA 4D3HA 4PABA 3CO0P 3PX4A 5LXRA 4IQMA 4DSEA 1V3RA 3A13A 3AH6A 4M5DB 2JFDA 4MIBA 3M8QB 3KJFB 3WC0A 2V69A 4NLPA 4AUKA 2EK6A 4DZ6A 5HVHA 3T5HA 1G3OA 2CQ1A 1GNKA 1H6KX 1RU1A 2DY1A 2JSXA 1D8ZA 2G2OA 3D6MB 3R27A 2V9WA 4OHYA 1S48A 2R4FA 3O5TB 2CA9A 5A0YA 2YNIA 3PO4A 4CZCA 4E98A 3KYLA 1LW0A 3I0RB 2W9CB 1V6HA 4KGVB 3M9OB 4ZCIA 4GKJF 3CMQA 5CYQB 4F0HA 1RCXB 3K58A 3JYTB 1AT1B 4CO5A 1VC0A 3JQKA 2EFOA 2PN6A 3B8HA 3AD9C 5KFEA 3CULA 4U7UK 2R2RA 4U67Q 2IAJB 3DOMA 2H65B 2W4PA 5KFOA 2WVDA 1DQ8A 3MI7X 3PYEA 3SQGB 1M5SA 4Q44A 1MMLA 2YNHB 1BE4A 3GQCA 2NREA 3MEKA 3W64A 2QGFB 2CPIA 5K8MA 2QMUB 3CDWA 4X2BA 2IM1A 3NGKA 3Q89A 1TFYA 4NASA 2HWIA 3DLBA 3UWTA 4X4OA 1UFKA 3Q2TC 2EBGA 2GJ2A 1BD6A 1NHUA 3MDFA 5AE1A 4DR1J 1MSWD 4USKA 3KLIA 5E2QA 3T1HJ 2UUCJ 3NBPA 2XEXA 2Z2ZA 2QX0A 2R7SA 3OR2A 2UXDJ 1Y5NB 3HHLB 4C8LA 1A0OB 1IWAA 1ZAVA 2K7KA 4ANDA 3TEGA 3HHNB 4URGA 4LT6A 5EX0A 1Q53A 4EMDA 2OSRA 2UVVA 5CYQA 4IQXA 2MSSA 1FT8A 5F0WA 4LIWA 2KI2A 3OXLA 1HNVB 3THTA 1Y5LB 4RUCA 3TAQA 1NK6A 1HNZJ 2BJ1A 3EZOA 1IKVA 3ELHA 1PC4A 1DQ9A 2MKYA 2NXCA 3RU0A 5IFMA 1RI7A 4LREA 1FKPB 2YNHA 3Q8YA 4YB5A 3UNGC 4WFBQ 3OHBA 4FS1A 1U1NA 3GP9A 4JI4F 4LF8F 1MROA 1JJ4A 1HD1A 4ZK7M 4P9SA 1KD1T 1P8GA 2L9NA 1RQ0A 3KMSA 2KB2A 5KFJA 4Y2MA 3M32A 2FC9A 1OYDA 4IOBA 4TKTA 2YBVA 2VDHA 3RGIA 2XMWA 3MM8A 4WKRA 4Q2LA 4FKYA 1DARA 4NLYA 4ICLB 2VFRA 4OJHA 1RDRA 2IYIA 3GJQB 3OR2B 4TVAB 4NMXA 5KFLA 8ATCB 1KQSR 3UO0A 5F9LA 4B9NA 4J5OA 3QRRA 4OYBA 1S6UA 1VRQC 1REVB 4DMZA 4FXWA 4E0DA 3QO9B 3C66A 3M6VA 2VG5B 2GIRA 3AOCA 4PR6A 4O44A 2H4WB 3SCIE 3VAIA 3M8WA 2GO8A 2Q3PA 2ASLA 4WZQA 1RKJA 2Y0SD 4NLSA 1F9EB 1HPZA 2IJRA 1WACA 2YNIB 3KDOA 4RPFA 2C2DA 1KHWA 1CBKA 4DSIA 3AA8A 1XNQJ 3P5BP 3QSIA 1NK8A 2Z0GA 2DGQA 3M05A 3Q22A 4IR1A 3RBXA 4TU8A 5C24A 5I42B 1X4FA 5KAKA 3J81j 1I3OB 5ETOA 1YI2S 2DRAA 2E1MC 3A8KA 1RHMB 3KHRA 2QFIA 1RTJA 2DNRA 4U6PA 4M5HA 3H0PA 4DWIA 1SJFA 3M7VA 1N5YB 3IRXB 3AD7C 2YNGA 5E3QA 3D1OA 1QE1B 3SBMA 2Z58B 3QAEA 1U25A 2XWXA 1Y0HA 3IGVA 3DRRA 1TTHB 2D3ZA 3DM2A 3MM5B 4DEZA 4QBUA 2YH1A 4FF3A 5M2UA 1BQMB 1KR4A 4JOUA 3M6XA 5D0GA 1L5UA 3N4WA 2Z2YB 1UZDA 2G0CA 4C98A 1VBZA 4ZPWR 2CXEA 3OVSA 1T9TA 1FRIA 1M1GA 3J7YI 2XZTB 4QWAA 5M2PA 1ICEB 4NLXA 4EU0A 1M1KT 4ZHRA 2XNRA 3OXFA 5ITHA 1IKWB 1RAEB 4X66J 4AYBD 3POTA 1OPIA 3EE3A 4DPOA 3MEEA 1RSCA 2XG8A 4Q0BB 2RF2B 1JLFA 2XSJB 3RTVA 4DFKA 5K14B 4ZVHA 3UDVA 1KKHA 4DU8A 4DR7F 1PJ7A 3DDKA 2ACMA 1P1LA 5ETLA 3J80Y 2M0GB 2V2QA 5KFGA 5KT4A 2GAHC 2XMUA 1FEHA 1KP6A 2KH9A 4ECVA 1DZ5A 1D3WA 3MWBA 4DS5A 2APOA 3EICA 4OI4A 4I6WA 4YEAA 1ZETA 3M32B 1YK9A 3TUIC 1MLAA 1CJKB 2G13A 4OX9F 1XNRJ 4DV6F 2VBXA 3K5PA 2I1RA 1YTYA 2PI5A 2OPRA 2YQ3A 3LF0A 4B17A 2B8PA 5ETNA 4GMKA 4IH7A 4OLOA 4YDDB 4J9NA 4GVBB 1L3TA 1S1XA 2CQCA 3MM6A 3TUZC 1XMQJ 4OFZA 2EKNA 1RUSA 3BGRB 4KQZA 3UR0A 4XDCA 2VH7A 3BGOP 2J6TA 1VK8A 4AFFA 1EZZB 2E7XA 2IIHA 4OX6A 3DDIA 2Y1JA 3M8PA 4WXWA 2B4PA 1GMUA 5HSPA 5HMZA 1HWUA 2L08A 4ZJOA 3FBCA 5E3CA 4JUZA 3OJUA 5HP1A 4Y2CA 2WRMA 3CCJS 5KFZA 2OJ3A 3Q86A 1YJRA 4A8WA 4HHUA 1S4EA 3RRHA 4F4YA 1Q0NA 3NNHA 3P8BB 2FHMA 2BQUA 1GFWB 3QMQA 5HQ8A 1JNRB 1YQHA 5KTQA 1RBOB 3HVAA 4J9LA 2FY8A 3GIRA 4FYVB 4N56A 3TEHB 1NPRA 4B3MF 3H98A 1REGX 3ZTRA 5LXYA 1K73T 5KOWA 2UU9J 4ZCKA 3NP5A 4I7FB 5D6GA 2K1RA 3AA9A 2CQIA 4CWBA 1AFJA 1UTAA 1RU2A 1VI7A 2C2MB 3VWSA 4JV2A 3GSIA 4Y28C 2HIQA 3M6UA 2RHSB 4M5NA 3MR5A 3NG8A 1D1UA 1DJ0A 1E6YA 3DLGA 2VG5A 2ZKTA 3P4UB 2HWTA 1FDAA 1SB6A 3KLEA 1KWMA 2CWXA 2O01C 3AY0A 5HI7A 2RSQA 1QTMA 1U1RA 4DQPA 3H4DA 2X3GA 3RW7A 3OPKA 2J7UA 5KFXA 4DDFA 4DZDA 2EG1A 1KSPA 2ZOGA 4UY8T 4LF9J 5BYQA 1T05A 5DS7A 2W9BB 1URNA 4GKJJ 1ZM9A 2E5LJ 4NLQA 4F67A 1RLDA 2MYFA 5F8IA 2VL1A 3J7A1 2HMIA 1JLGA 2I9SA 1HL6A 1WEYA 2Q1LA 4H4KC 4ZP9A 3UW1A 2KHCA 2V2KA 5LM7E 5A2QU 2UUAF 1NDLA 4DV5J 2Y8WA 1C0UB 2MJNA 1S1WA 3CCZA 1I5OB 3CCLS 4OYOA 3K17A 3MAQA 1QE1A 2OEJA 3TWZA 4A8FA 2H4YB 4NE9C 4F7VA 2WSEC 1S1VB 3MR2A 1YJTA 4HTJA 1FJ7A 4KBIA 1X4HA 4Z37A 1HYSB 2MEWA 5B0AA 2XHWA 1J5EJ 4OMFG 2LXFA 4DFJA 5IV4A 3MPUB 2UUAJ 2ZH4A 1AZSA 2HPUA 4NA2A 2R7WA 4DR3J 3OFHA 4ID5B 3OVBA 3KK3A 1QVGR 2LKZA 2MTLA 3GU0A 3HSGA 2DIVA 1SKUB 3TR5A 4RW7A 1VCTA 4IRKA 3CSKA 1VQNS 2B7CB 2NUUG 3HHKA 4FYWB 4IFYB 1WTBA 3QT7A 4PQAA 3PEHA 1RTDB 4UOFA 4F3QA 1NH7A 3CTRA 1S1UB 3G6ES 4DL6A 3NGUA 3LP1B 2Q43A 2J6UA 3ZNUA 2UUBF 4RW8B 4ZLJA 5GAGI 4DQIA 3AQPA 1RLCL 3CJRA 1YBTA 2Q79A 1L3KA 3M6WA 4TLQA 1EARA 5B08A 2FLLA 5DLFA 1EB0A 3R5CA 4Y00A 3O44A 3T6JA 2DGVA 1NJIT 3L7OA 1PCAA 4LR7A 2UP1A 1NSQA 4C8YA 1TUVA 2HBQB 4I2QA 5A8RA 2XB2D 3CJKB 3OLBA 1LWFA 4QZVB 2ZJQQ 2R8HA 3DXSX 3R97A 1FRMA 1PSDA 2LU1A 3WX4A 1U4BA 4LFAF 3PHTA 4DL7A 1NK9A 2CPYA 1NPPA 3QGIA 2BX6A 2NXJA 1N56A 2IHR1 3HZEA 5DDQC 3VTIA 1T9XA 1KQFB 1T9VA 1LFPA 1ZZNA 3IGNA 1FJGJ 1JQGA 3TYTA 3PRBA 2OD6A 3F0NA 2HURA 4KHPF 2CQ0A 1YJVA 3D1QA 1RT1A 3PRVA 5DGAA 1CQNA 3LANA 2HBZB 1UZHA 1WELA 2V4RA 3CB4A 4YR0A 3I55S 3JSMA 2IMOA 3GV8B 1HMVA 3W8GA 2QSFA 2ROGA 2OEMA 5DRKA 5F9NA 4K50A 1K9MT 1UFWA 4NI2A 4C9DA 2KO1A 3F56A 5HK4A 4LF9F 1PG5B 2ASYA 3E01B 1X4CA 3HSDA 3BSOA 2C2KB 3BGRA 2CNNB 4B9SA 1RA6A 3W9JA 3VAFA 5GADI 2CG8A 1TZ0A 5B7WA 2YNFA 4GO5X 2LDIA 1RAFB 3L9ZA 5GMDA 5LMUJ 1QTNB 4I69A 5A8RB 3OT9A 1U1MA 4QPTA 3T1HF 3O3LA 3ZTSA 1FFGB 4QR1A 1NB7A 3PTWA 3K8VA 3TVKA 3QATA 4DR5F 2RIJA 5ETSA 4WYWA 3HFKA 4H4MB 3JAMU 3K5NA 3NKYA 4DI6A 4IYQA 4PG7A 2RF2A 2P9CA 1CG2A 2UZAA 5J2QB 3EXCX 3EZUA 2HZVA 3I31A 4B3TJ 4JI4J 1MG7A 2ZNZA 2DGUA 2J0XA 5DG9A 4ELUA 3BS9A 1QSLA 1XMOJ 1GEHA 1S6OA 5LJ3Y 4X64F 3J80U 3NCPA 4KO0B 1TMJA 1UVNA 2XS5A 1RAHB 2BA9A 3JS9A 4RW9A 1YGYA 2CPXA 2YQ1A 2NYIA 3CW2C 2G2YA 1T3NA 2GGPB 2JL9A 3DXBA 1RKIA 3QYYA 3GCWP 2LCWA 4W4MA 3RUBL 3UPFA 3RB3A 1NBEB 4ZVRB 2G4BA 5HROA 3B54A 3E01A 3WQPA 1F6TA 4DUZF 1N6QB 2AGQA 4U8VA 2CPHA 2JRSA 3LWLA 2BXJA 3MCOA 3L4BC 4KHRA 3V4MA 3B4DA 3RAXA 1PJ6A 2FGCA 4DG1B 2VQEJ 3C15B 3KKFA 1PO6A 4DSKA 2HHXA 3EJMA 3OSNA 4B3SJ 4NZ6A 2LDYA 3BDPA 1JLQA 2C2OB 1DTTA 1P9QC 2J0WA 1WORA 3LO3A 4USHA 2VBWA 2RQCA 3IBWA 1SIWB 3CC4S 4X62J 3KMQA 2XMTA 5FDLB 2XWYA 2R9LA 2KYXA 5D3GA 2FD2A 2HAIA 1KFSA 3OFEA 5A8KA 3WHIA 1KONA 3BO4A 4QWCA 1FRLA 2OIHA 4AXIA 2W2NP 3PHEA 3E3XA 3F73A 4YHHF 3MCSA 4DR2J 4X4UA 1VOMA 4IFVB 1DQAA 3JSMB 3CJ4A 4NRTA 3M8YA 1VQMS 1U2FA 4PEOA 2QC3A 1Y10A 4Y6IA 1CULA 2DH7A 1H2UX 2C42A 2XSFA 3DCAA 1FNMA 2LXUA 1B4SA 1SQFA 5IV3A 2W9AA 3JB9k 3IFEA 5KT6A 4IG3A 4B3MJ 4JYAJ 5KFPA 2IDEA 2GHVC 2KM8C 3OTOF 1S7IA 5KG6A 3ADAC 1C4CA 4LSLB 1ACMB 4DN0A 4B3OB 2FQQB 1RHQB 2MKHA 5GAHI 3ENAA 3FGVA 5L1IA 2YKNB 2O3DA 4C6AA 4PXEA 3R5GA 4NPOA 4UTGA 4Z2XA 1AUDA 2I5JA 5DG7A 3N6MA 1F3VA 1VLOA 2YTCA 1U6BA 2YX7A 4MKAA 2F4VJ 1KVJA 5IQ6A 4DR6J 2HFSA 3ITHA 6FD1A 4FYYB 5AJ3F 3GIMA 2R7XA 2FC8A 4JI1F 3MR3A 4CLSA 1TKZB 1VBKA 4JI7J 1HI1A 4WIIA 3IWNC 4ZLLA 1NSKL 3PX0A 4USVA 1SJ4P 5CXTA 1C0UA 2E1AA 2CDRB 4KAIA 1TKDA 1P1TA 4HL9A 5GVQA 4X84A 4LF5J 1DTQB 2M88A 1Y00A 3SMZA 1T03B 1Z1ZA 2OGUA 3EUNA 3CDAA 3IXQA 1KQGB 3MTKA 4J9SA 2BUNA 1XMOF 4W92B 1YRXA 2DHXA 2W01A 5ETRA 1RABB 2QL7B 2MPUA 1IBMJ 1CS4A 2C1EB 5HQLA 2QIFA 3D68A 4I2PB 3KLGA 3C16A 2CPZA 3D0GE 2FYXA 5E33A 3TX8A 3TW0A 2DVIA 4G1IA 4TY8B 2IAJA 1S57A 3DOMB 1D9FA 3OL9A 3W61A 2WVBA 4LFBJ 2BE2A 2MY7A 2MZQA 2DNYA 2QV6A 4C3MA 1QAIA 2PI4A 4QIGA 2RQMA 3LP0A 3G71S 2DHHA 5C25A 4DOZA 2V4QA 3VAGA 2ZITA 2FJBB 1FK9A 2W8LA 1VK3A 3M4XA 2XO7A 1N34F 2DXFA 1N32F 3C6TA 3HCXA 3H2LA 3ZNJ1 2CPDA 1NK0A 4F3OA 1I94J 4EZ9A 4RW4B 4QCLA 1I6JA 1QD1A 4YDXA 3MZIA 2R7TA 3NS6A 1AFIA 2CZ4A 5J2PB 2FHOB 2QJ3A 2GGPA 1R3NA 3G8QA 4KFBB 4M5IA 4G65A 3RG6A 3IO1A 2AJQA 2MZRA 3QFHA 4NWBA 4Y34A 5A0YB 5KG2A 1YITS 1UVKA 2FLNA 1FVQA 4O0IA 2F4FA 4OZNA 3ET6B 4ENOA 3DOKB 1SCJB 1DLOB 2I0XA 4YS2A 1U26A 2A2DA 2J6SA 3PYFA 3G96A 3DGPB 2XY6A 2M5YA 4DG1A 2MKKA 3V6DB 4LRFA 3KJNB 4PZVA 4EBDA 1RB0A 2QEXS 3TANA 3FEXB 2AIRB 4IH6A 3D28A 1NB2A 1YRUA 1F9HA 2QG9B 4ZDNA 3MF5A 2LQ5A 4ES2A 4RZRA 3E2EA 3LPYA 3HPOA 1RHKB 2JC0A 3SFGA 1N48A 1VHFA 5KFAA 4JBCA 4IOCQ 2EFGA 2AGPA 5HLFB 1KLMA 1UETA 5HMXA 3KK2B 1VMBA 1F3FA 1U2CA 4P2XA 2KVQE 2NPIA 1ZA2B 4JI5F 3GIJA 2UUBJ 1U1PA 5C42A 3L95X 1LEOA 1B64A 2PO4A 2W24A 4I6AA 4F4WA 1RXOB 3A4TA 3CE8A 1LV5A 1U45A 1TL5A 2F5GA 1NJZA 2ZD1B 4I56A 3EM1A 4KT0C 2HS0A 2QA2A 5CD4A 4DXLA 4ZP8A 2MKIA 3SQOP 4PG4A 3IS9A 2YKMA 2AW0A 3I32A 3D1HA 3PACA 4W98A 4WZMA 1PC5A 2G1HA 3KK1B 2YWHA 3RAQA 2FJWA 4P72A 4IO9Q 3K7RA 2M9KA 2DHAA 2XSJA 4RW6B 1D8YA 2J76E 2NZ4A 2E9RX 3RBZA 1SC3B 1J27A 2NSBA 1HA1A 1LXNA 5J2MA
chains in the Genus database with same CATH topology
3MPVA 1YRTA 1CPZA 3VQSA 3MECA 3JAMY 5J1NA 5GAGU 3ISND 1GQEA 5HMYA 4K2XA 3RB6A 1OQ3A 1Z2ZA 2GMHA 3PJXA 2JEJA 1ZPVA 2EPIA 5J2PA 1UKUA 4ATNA 1U7LA 2NUHA 1JB0C 2V0NA 6FDRA 4WE1A 1R8CA 3F41A 4ZA1A 3AB2B 2PT0A 3OR1B 1IKXB 1FKOA 2N3LA 5K8PA 4FBTA 1ZM3A 1RGVA 5T7LA 3OTDA 1VGYA 2CVEA 4TYBA 1XN9A 5U47A 1N33F 4C8MA 3DGPA 1I94F 4NCGB 4IOAQ 3M8PB 2RMLA 2ROEA 1M90T 4TY9A 4OI1A 1LKZA 4A8KA 2H5EA 1X5TA 2WB1D 1MMDA 3DMJB 3KFWX 5KFMA 2VPYB 2Z2LA 1IKWA 3RR7A 4K4SA 4NLTA 5CD4H 1GX5A 3V6DA 3Q2SC 2RQ4A 2JEFA 1U48A 1SJ3P 1R7IA 4HI1A 1TL1B 2VOOA 1J5OB 4ZCLA 2DR8A 1XERA 3K2YA 3TA2A 3PIOQ 2JEGA 3DRYA 2EG2A 3LWMA 1NZAA 4Q45A 1X5PA 2R8KA 1KLMB 2AJ0A 2LXIA 4Y2AA 2DPIA 1Q4RA 3MM7B 2GA7A 4BWJA 4HYKA 3DNCA 1X0PA 3CCRS 3ISNC 5GADU 1NJXA 4KSEB 3QO9A 2OKQA 2XMMA 3QLHB 5GAEI 4NLGA 5LSRA 4NLWA 4WTYA 4C11A 5AXKA 4CO1A 1SC6A 3SXLA 1S1VA 4DV1F 3HK2A 1K1SA 4ELTA 2D3UA 3PVXA 1KFDA 1FESA 2HNYA 3I4PA 3SCJE 2D3OR 4C8OA 3LP0B 4B3OA 3MOZA 3FSIA 1R8AA 1T3OA 3QZ7A 2ZHOA 1Z4UA 5DETA 4JYAF 4LIRA 3GMGA 3R5DA 1Z2LA 4KE5A 5KFVA 4DV2F 5LSLA 1VQ4S 4I1TA 1HBOB 1FKPA 3NNCA 4RNNA 1QAJA 3BGLA 4K59A 2DGXA 1RYRA 1HBUA 1S1WB 1X4GA 1TKZA 3NCRA 5BR8F 3T3FA 1UVJA 1R31A 3FCHA 1RTJB 3H5XA 3LP1A 3G8SA 3CGIA 3ZZYA 1MWYA 3OR1A 4G6VB 3FMWA 1XK8A 4FYDA 2HG4A 1HNIA 1SL1A 1KRPA 4PRFA 1SH2A 1NO8A 2EW9A 2B5JB 3BR8A 4DR1F 2LLZA 3MOJB 2OPSB 1SH0A 2RU9A 4KV8B 2RKIB 4F25A 1FEEA 3FZBA 3UE2A 1FE0A 4KGMA 3J7YU 4X62F 3GQCA 1T3NA 1S77D 3I96A 1FA0A 3MAHA 2DCLA 3DMJA 3CUNA 5EWFA 3CCTA 4QW9A 4HDHA 2B9XA 4QYZJ 1C1CA 1SI9A 2CQHA 4YP3A 3J81Y 3MM8B 3SFUA 3HF5A 2VPZB 1A7GE 2DHSA 4C8NA 1R8PA 3PRDA 1N5QA 4RX6A 4DFPA 4OHXA 1BY9A 3PZPA 3JSRA 4Q2MA 3K5LA 4OZ5A 4CH0S 1T02A 1TKTA 3BN7A 4ETXA 2XLIA 5KFSA 2AYGA 2VA3A 1TK8A 4I64A 5SZTA 1RT7A 1UVMA 2UV8A 3U7JA 2BVZA 2JH3A 4X4RA 3A8EA 2IRXA 2MSTA 3MEEB 5HN0A 4RUAA 2MGZB 5FJ4A 3PKYA 2LU2A 2GQCA