4AQYF

Structure of ribosome-apramycin complexes
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aqyF00
2B7BB 1G1XA 4LF8F 1XMQF 4DV1F 4X65F 1QJHA 2UXDF 4B3MF 4NXNF 4JI7F 1RISA 2BXJA 4B3RF 4GKKF 4JI6F 1XNQF 2YY3A 4LF6F 4LFCF 4LF5F 4JV5F 4DV5F 4LFBF 4DR7F 2KJVA 5LMNF 1CQMA 3T1YF 4DR2F 4LF9F 4B3TF 4X62F 1FJGF 1N36F 4DR1F 1N32F 4YHHF 4DR3F 1B64A 5AJ3F 4OX9F 4JI5F 1CQNA 4JI3F 1IBMF 5LMUF 2UXBF 1HR0F 2UUBF 2HHHF 2J5AA 4JI2F 1FKAF 4JI8F 4DV3F 4GKJF 4B3SF 3T1HF 4DR4F 3OTOF 2UUCF 4JI0F 4JI1F 2E5LF 1N34F 5BR8F 3R3TA 4DV2F 1IBLF 1HNZF 5IWAF 2RJZA 1LOUA 1I94F 1J5EF 4KHPF 4LFAF 1N33F 4DV4F 4X66F 2ZM6F 1F60B 2BVZA 1VMBA 2B7CB 1IJEB 4YY3F 2VQFF 1GH8A 4DR5F 1G7CB 1HNXF 2KJWA 2F4VF 2UU9F 4JI4F 4LF4F 1XNRF 4NXMF 2UUAF 1IBKF 1XMOF 4JYAF 3ZZPA 4DUZF 4X64F 4AQYF 4DV0F 4LF7F 1HNWF 2VQEF 4DUYF 4DV7F 1IJFB 2UXCF 4DR6F 4DV6F 4K0KF
chains in the Genus database with same CATH superfamily
1MMNA 4HYKA 3KJNB 3US5A 2CQGA 3ZO7A 1REVB 4OYXA 3M6XA 4Y6IA 2HFZA 5EX3A 4ICLA 3EDQB 2RU3A 1V3RA 4L74A 1N52B 3C46A 3JYTB 4R8UB 3EVMA 4NYOA 4RLEA 4PQUA 4K2JA 1KVJA 2XNRA 5BR8J 1CULB 4C11A 2M52A 3HHNB 2KH9A 2YWWA 5EWGA 3FZBA 1MU2B 3KDNA 3H20A 2QE5A 2G2ZA 5I3QA 1PSDA 3IAS9 3W2VB 4QPXA 2MKHA 1TAQA 3PJWA 4TQSA 2J6TA 1WKJA 2NZ4A 2CDQA 1S49A 3HSDA 2ZH6A 4X64J 3TZXA 4CQ1A 2H4YB 1IUJA 1T9TA 2AJ4A 2FHJD 4ED4A 2B8PA 4O3OA 3KWMA 5D8HB 3PJ9A 4OZ3A 3DLEB 4A8MP 2OPQA 5HMXA 2MQMA 3U7JA 4LFCJ 5J2MA 2B7BB 2XSJB 4I6WA 2OAUA 2W2NP 2O3DA 4ZJOA 2R7OA 2HVEA 2PN6A 4K8RA 1SC4B 3Q24A 2DH7A 3QT6A 4Q0BB 1RT1A 2NXEA 5HBMB 1RHKB 3HJFA 3CDWA 1J27A 1RSCA 4BDPA 1RAFB 1MMDA 3A8KA 1OO0B 1GXUA 1YVFA 3MPYA 4O0NA 1RU1A 2V2KA 2OD6A 1FRMA 4IG0A 3CMAS 1T94A 3B4MA 3MM8A 1VOMA 3MMAB 1QAIA 2Z4PA 3K5LA 2MY7A 3R5GA 2YKMB 3CCQS 1T9UA 3RRGA 2QSFA 2MHNA 1MW7A 1UWBA 3QQCD 1X4CA 4K0KJ 4G1QA 1JXLA 3MMBA 2ZEJA 3AOCA 4JI7J 3W8GA 1OWXA 1XNQJ 4OYOA 2X3DA 4LFBJ 2CZVC 2RU9A 3POTB 5HMWA 2MJNA 5DS7A 2A2DA 4B08A 2EBGA 4CYUB 2P9CA 3MCNA 2FQQB 3M7VA 3Q8RB 2ZH5A 3G8TA 3R7NB 4CO5A 1Q53A 3GU0A 3CJKB 1N4LA 3TR5A 3Q8QB 2Z2MA 3SQGB 3MUMP 1T11A 1E6VB 1X4HA 1S57A 1N34J 4S0MA 3OR2B 4Y3CA 2GMJA 1V6HA 1U1OA 1JLGB 3RGIA 3MEGB 2PFDA 1U45A 1VI7A 2ZJPQ 1LFPA 2C2ZB 5F41A 1GXTA 2GZOA 3FEXB 4GVBB 4EEYA 3Q8UA 2NS1B 5E7OB 5IM0B 4XDCA 4C8LA 3FDSA 3S8SA 3EE3A 1B0TA 2R7VA 1AA1B 3GG1A 3KLHA 3CMQA 3DOLB 5CA5A 5D0EA 1YJRA 1NXIA 2XY7A 4DV7F 4RR5A 2Y0SD 5LSOA 4ED8A 3GR1A 4H4OB 1RT3A 3HK2A 5EUHA 4C8MA 3KUHA 4P73A 4RUBA 2W9CB 4K59A 2BA9A 5KG5A 4RL1A 2PI5A 1WF1A 3PHTA 1BGXT 4Y00A 2FHOB 1HKAA 1JX4A 3F0NA 3OL6A 3H5UA 4ECQA 1N6QA 1SQGA 2HAFA 1T05A 1LWFA 1R6YA 4IR1A 2CPXA 3CTRA 3QSIA 4O44B 1WC6A 2HHTA 5I42B 2LCWA 2W1BA 1LWCA 5JVHQ 4ZJLA 3RR8A 2PMWA 4F67A 2AKWB 3H90A 1LK7A 2QT7A 2R7QA 3MD3A 3LGMA 1EQMA 4AFFA 1FKOB 3EWGA 1U1QA 2WTFA 5FIIA 2L9WA 4ZVGA 1VC6A 4MH8A 4L73A 4F02A 3PM9A 1HWJA 3D6FB 4FYWB 2PEBA 3D0IE 2ASLA 4MIBA 1U02A 4FDFA 2AD9A 1BC6A 2YNHB 4FZVA 2NXNA 3I0RB 3ETOA 3GZ7A 3T1AA 1OMSA 1HHTP 5GMEA 1VQ6S 5HQLA 1DURA 4J9NA 1U7LA 5F0UA 4OYMA 3TUIC 2EWHA 1IKVB 4EZ6A 3BGRB 5A76A 3M2RA 2LEBA 4C8OA 3H7HB 3HZGA 1ZPVA 3TZWA 2DGTA 4KH0B 1C0UA 3HKZD 1SKSA 2K8GA 2KHCA 2C42A 2HQFA 2WRMA 3B8HA 3VVUA 3JTNA 3AJ2A 3RB6A 4QIFA 2MZQA 2CDRB 4ER8A 5DLGA 2J9DA 1RT4A 3M05A 4ELVA 4NA1A 4J9MA 1ZH5A 2FDNA 1YJWS 4NL5A 1LW0B 1N56A 4XK8C 3KTQA 3CJQA 1VQLS 3RAXA 3MGJA 4OYWA 1HI8A 2YNIB 3QZ8A 2CZ9A 3FSIA 2G1DA 3UCUP 3RJMB 1FA0A 1DQ9A 1FTCA 5DQIA 4USTA 5B0EA 2EFGA 4JV5F 4JOUA 3AFGA 3DHWC 3PEJA 2K06A 4U7CA 1RWNB 1W2IA 1HNVA 2BOPA 3DI6B 3OW2R 1KRPA 4OI2A 4G1IA 3ELHA 3I5AA 2VF3A 4RX6A 4O3PA 5F9LA 4DQRA 3JSBA 3W2WA 3L7OA 5L9NA 1MROB 3E2EA 4I6YA 1WG1A 4HACA 1NHKL 4ZVUB 2CQIA 1N33F 4FF3A 4MMOA 1F60B 2XI2A 3TI0A 1HNWJ 1AZSA 5M2PA 2DT9A 4LIRA 5LJ5Y 4YB1P 4M95A 5EGYA 1HMVA 1IXKA 2MGZB 5D78A 2IC3A 1TKXA 2KT3A 3KJQB 4ED1A 4FYXB 1DTQA 2Z2ZA 4DV1F 3C3LA 4IQXA 4IG3B 5HVFA 1OQ6A 4J90A 1SIWB 3OHAA 2IVYA 2VA2A 2HHQA 2XWYA 4QU7A 1IBCB 3BO2A 1KR4A 3JQJA 3DFEA 2IJRA 1F3FA 2COLA 4CO4A 2GIRA 1VBKA 3DN9A 4H4KA 1UJ5A 2G4BA 4PEOA 1FRHA 3EMTA 2HFUA 2BJ3A 3MFIA 3J80U 2W8LA 4WWSA 3OXLA 1JLBB 2YQ1A 1ZM2A 4PWDA 1X0PA 4C97A 4FNIA 2VQFJ 3HHLC 1YRUA 4TY8B 2BR0A 1U1KA 2G2OA 4ECUA 1TL3A 2AJQA 1T9XA 1F9EB 2ZM6F 1B4SA 1OYEA 3CJ4A 4LF4F 1HBNB 4ANDA 2AX1A 3A12A 1TKZA 1RDRA 1YWXA 4YB7A 4X2BA 5HSPA 1BWEA 1RXOB 5CCMA 4DV5J 1VQ7S 5KFHA 1QM9A 1XBWA 4MAKA 2QL5B 2IJNA 3IBFB 3O8WA 2M70A 4PUOA 3SXLA 1N0VC 2GV1A 1ZZNA 4O3QA 2AYGA 1H3DA 3FFIB 1A9NB 2IAJB 4CO1A 2UUBF 4DX7A 1R43A 1Q8KA 4LRCA 2DH9A 4ZPTR 1MWZA 2LQ8A 3GIRA 2YKPA 4DG1B 3FBFA 3K8WA 4F0MA 1NDKA 2A10A 3MM9A 2RDIA 4FXVA 2F4FA 2Q3PA 3BH6B 5KFRA 4NXMJ 2PEHA 2M4MA 4Z7YA 2E7VA 5J2QB 1GQEA 4KKOA 1ULRA 4OX8A 1KEKA 2R7XA 4QJVA 2DGWA 4OX7A 3DOKA 4OI0A 2CFXA 4ECVA 4EGLA 1F5BA 3MPVA 1D1UA 1L3VA 2CNNB 3MDFA 4FYDA 2VPYB 1FK9A 1NNDA 2UVRA 2DHSA 3JAMY 1UA0A 1JJ2R 1MWYA 2PIIA 3A1YG 3JB9k 1RTIB 1Y10A 3M30B 1HQUA 2YWKA 2QA2A 1U4BA 2BZ2A 5D0HA 4B02A 4ZLJA 4ED6A 1X8DA 1KVKA 1FEEA 1SJQA 1B7YB 1REVA 1U2RA 3TAMA 5FLXU 1OPZA 3NRBA 3ZZOA 3MR6A 4RUHA 3R3TA 4O3SA 2GJ2A 2KXHA 3NXZA 4ECZA 1JNZB 5F8HA 4CRJA 4XPEA 3LA0A 3BR8A 2HQDA 5EX0A 3HI9A 2OH2A 4KBIA 3FMBA 2VG5B 3K8VA 2ADCA 3E01B 1BQMA 1RTHB 3BQ0A 1CULA 2J8AA 4CNYA 4WKRA 1SJ1A 1MU2A 2RMLA 1FRLA 1UPMB 1YJ7A 2V4RA 2HKEA 3UPFA 1T02A 2ZJQQ 5T7LA 1XIQA 3F44A 4TY9A 1N36J 2MZJA 1RHUB 1MNEA 1PG5B 2HBQB 4NZ0A 1M1GA 1YZ7A 5BYRA 2OMOA 3DLEA 1EETB 1Q5VA 3LTOA 3EZOA 2JDJA 4DEZA 2ZH2A 1HNZJ 2QO3A 2FHJA 4MK8A 4C9DA 3KLIA 1NPRA 3PRDA 4NZ6A 2WHOA 3CJTA 3DRYA 2IM2A 1PBUA 1X9WA 3S7RA 4M5DA 3G71S 2C3YA 4PXBA 4ILLA 1KP6A 4Q0BA 4HKQA 2RQCA 3PEHA 1WHVA 2PGCA 1S48A 3QNWB 3Q8SB 1I51B 4LMZA 3GYXB 1RI7A 1DJ0A 3CPWR 4E8UA 3PACA 2CQ4A 1QD1A 5BXIA 3TO8A 3JQKA 1HQEB 1IR0A 2H5IB 5MLCV 2YKMA 3K2YA 2R2SA 2KM8B 4M5IA 3UE2A 2Y1LB 1A6LA 4AXIA 3CCUS 3GMGA 4CCHA 2V4JB 1NB2A 2U1AA 3PX6A 3NL0A 3MXHP 3PRVA 3HPOA 1RB0A 3UFCX 4Y2CA 1U1LA 5DQHA 1RAJA 2QFIA 4C3LA 3T9NA 1X4AA 2C3PA 1JLEB 2PMZD 3HVAA 1H7WA 4CYUA 2QL9B 4OI4A 4LSZB 4I7FB 1XNRJ 3SCLE 4ZPAA 2WB1D 1HA1A 2ZD1B 3MD1A 3SCJE 4WE1A 3PR5B 4ZDNA 4KE5A 3CJKA 1RADB 4CNZA 1VISA 4I6AA 4WFZA 4UZBA 1F1BB 4NLGA 1TKTB 1ZM3A 3OR2A 2HK2A 4YUDA 1EKSA 5L38A 1TFWA 2HS0A 2HMIA 4LF7F 4JI6J 1G6BA 4Z37A 5IT0A 2VASA 1YRTA 3ILOA 1H7XA 1FWPA 4PG8A 4X4PA 2VC1A 4ZN3A 3D0HE 2Q79A 4MFBB 1CJKA 4GVBA 2VBXA 4USHA 5J2PA 2VODA 5KFAA 4KPCA 1Z1ZA 5IM0A 3A3PB 1FDNA 4DF4A 4GC7A 1WC1A 1S7IA 4DL6A 3DOLA 2ZWOA 4ETZA 1X0FA 4E98A 3HVRA 3EZUA 5E2QA 4DX8H 3NGDA 5HATA 1QAJA 4JV1A 1NMEB 4BC7A 3MI7X 1YRXA 4X4RA 2W9CA 4YQWA 3G6XA 4R25A 1NM2A 4GO7X 3BQ1A 1JQGA 4D3GA 2M9KA 4OX6A 1S0MA 3Q22A 3QAUA 4CP5A 1NRKA 2OI2A 2KB2A 3J7A1 3KHGA 4DUYJ 4IDKA 4P7TA 4DCJB 5L8RC 4HHJA 4PWWA 4XTTA 5CXTA 3LF0A 1WOSA 2A2CA 4QYZK 2B8QA 2X1FA 1R8CA 4HHUA 1IKWB 4F0HA 4DL2A 4OYAA 3VTIA 5FD1A 2V2ZA 1ZZFA 2CUYA 4CH7A 3FZ2A 2LQBA 1M5VC 1LWXA 2XMVA 4GKKF 2ZC4A 1FKOA 1T3OA 2IRXA 2XWXA 4OJ1A 5CYJA 5AJ3J 3I0SA 1T7PA 2J0QD 5LMUJ 3BPSP 2B9XA 5D4OA 5J1EA 4LR7A 2CWKA 1WNEA 1VQ5S 3K0JA 2CRLA 4WK3A 2YNHA 2NZCA 2ZBCA 3I0RA 1HD0A 2VG7A 4TN2A 1UW9A 2PC6A 3P49B 4USMA 1KQFB 5HANA 1Q95G 2Z0GA 2ZH8A 1FF2A 2UUAJ 1IKVA 3BGRA 5F8NA 2ROEA 4B9MA 1AFJA 1GX5A 4Z2XA 3G6ES 4FKYA 3F73A 3W5YA 4NXNJ 2DR7A 1S12A 1IKYB 2VG6B 5KFYA 1ZETA 4DV0F 2H48B 1LW2A 4PG6A 3ZFVA 2IA0A 2XGQA 3PRBA 1NDLA 1VHFA 1FXRA 3M8YA 4DR2J 4HT5A 4DI6A 1WI6A 2YQ3A 4DX5A 3RYLA 1XN9A 4LSLB 4J9SA 4IO1A 4YOEA 4QZVB 2JZ5A 3RB3A 1NPKA 2DGQA 4OHXA 4K4YA 2VA3A 1X5PA 4J9QA 1LW0A 5KG7A 5J1NA 2H51B 3TUZC 3GSDA 2MXYA 3DXSX 4NA2A 3GONA 2YNIA 3I9V9 2E5LJ 5I4MA 3CCWA 3C6TA 2C22A 4PPZA 2W9AA 3HSGA 2C3OA 1X4BA 2APOA 1YHQS 3ET6B 3RB4A 1VRUB 2I6WA 1AUDA 1S6OA 5T41A 2CNKB 4HTJA 3CJ8A 3GIIA 1LOUA 4QYZJ 2JWNA 3UDVA 4PABA 4X66F 1WSRA 4L3NA 1NHUA 3LP2B 1R27B 4N5SA 3AD9C 3BSCA 3NAHA 5KOXA 3DI6A 3DLBA 3R7SB 1JMTA 3O2IA 5D4NA 2BX6A 2K3IA 2HZCA 3VZHA 2FVRA 2NYHA 3M32A 2MMYA 1TUVA 2RHSB 3UVJB 3KHHA 1MROA 3BGOP 3M1VB 3IRWP 3QRRA 1OY9A 2Y3YA 2J6UA 6FDRA 4KH1B 4DR1J 5KFUA 2IBKA 4ED7A 2RUGA 4QWDA 1LNQA 1CQMA 2HFSA 2CJBA 2B4OA 2EFPA 1S0OA 3G6YA 3N9UC 4K4UA 5CAAA 1JB0C 4IG3A 1S6PB 3FJ2A 2Z2LA 1NZAA 2ZNZA 2VV5A 2BE7D 2HIYA 4WXWA 4CLUA 3D4JA 3W65A 2MZ1A 4CO2A 3SSRA 2HQ3A 1V9OA 4JI4F 3TQ1A 1RBAA 2VUGA 2JLGA 1EZZB 3PG9A 1JKHB 2I8EA 4YEAA 2V50A 3O44A 4I2PB 1UJ4A 4BBYA 1C1CA 4HR2A 3NY0A 2CJYB 5HP1B 2ZH9A 4FYVB 5LOQA 5DDQC 4NEYA 4RNHA 4N8NA 4CH0S 1RYRA 2H9ZA 5KFKA 3AH6A 4CLKA 3OVAA 5IV4A 3HKWA 1TTHB 2F3JA 4ES3A 4Q43A 1QVGR 1YG0A 1H98A 3RBZA 2ZJRQ 4MKAA 2BACA 1APSA 1S9GB 3CJ5A 1L3SA 3F41A 3OTBA 4ILMA 1YSJA 4OI3A 2VFSA 4JYAJ 5KTQA 7AT1B 5GAEU 5IT9U 3ZNJ1 2CNLB 1C1BB 3O5TB 3MR5A 4OZJA 4R0EA 1AXQA 3F56A 2F4VF 3PO5A 2XMUA 2KRRA 5E0OA 3QSYB 2Q43A 2VKRA 1TV6B 2XI3A 4UY8T 1HHSA 4ECTA 2DHHA 3ZC4A 5D6GA 4B3SJ 3BN7A 4NASA 5IC4B 2R8IA 2BXJA 3KJVA 3PZPA 2VOOA 1NDPA 1WG4A 2H5JB 2KVIA 3PTWA 1NK5A 2QN6B 2MQQA 1UVLA 1QSLA 2MLXA 3U02A 4PQAA 4U67Q 5A6WA 3VGUA 2BE2B 3P5BP 7FD1A 4JI3F 1QDUB 4ZVSB 2BJ8A 3WC0A 2Z58B 2LU1A 5IWAJ 4DFPA 5C2CA 2LMIA 4DHVA 3IAM9 3D5MA 1O51A 5KFNA 3T5LA 4F8RA 1GTHA 1NO8A 1RTIA 2HNZA 3PW7A 1RA7A 4O0IA 2PDAA 4RW8B 3M30A 4KGXB 4OZNA 5KT3A 2LXIA 2GJIA 2N4CA 4ED5A 3BBBA 2HAIA 3N28A 2H1YA 2GVZA 2AGPA 3ZXWA 3BN4A 1FE0A 1GXLA 2BKOA 2UUTA 3QJJA 4HT7A 2I5JB 3KLEB 2W8KA 4I2QB 3GWCA 1KHWA 5B0CA 3Q83A 4F2RA 3A8JA 5DO2A 4HVZA 2B4PA 4ECYA 3BPDA 2CPHA 3E01A 3MAHA 2RD5C 1N5YB 4EYIB 2RT3A 2RKIA 1YBUA 1ZAXA 1Y5IB 3Q8YA 5KG2A 4LBHA 4UOCA 5E3CA 1GFWB 4QIGA 3OUYB 5KT6A 4B3SF 1NSKL 4EK2A 1HBUB 2KTQA 4YDDB 3IC1A 4K4ZA 2BRKA 4DV2F 5JUMA 4Q5VA 1GNKA 3AAWB 1UAWA 2DHGA 1CEZA 2KDOA 5CZXA 4QOTA 1EETA 3GJRB 1RTJB 1KHVA 1D9FA 2BEFA 2HBYB 2ATLA 2W9BB 4KQZA 1QSSA 3VF0B 3LPYA 3FK4A 3IR5B 3FC9A 2V8DA 2RRAA 4ECWA 3QFWA 3JSMB 4C8ZA 3IGVA 2EC2A 5DGAA 3PNIA 4YS2A 3A3OB 3ZTRA 3QGPA 3C6UB 3VAKA 3OTDA 3ZZZA 5D3GB 5KFPA 4MKYA 1SBRA 3G86A 2KFNA 1DARA 1VQ9S 2ZKTA 3SI8A 2GA7A 2NLWA 3OJUA 3LUYA 4Y34A 1S7HA 3CCJS 2CPEA 4B3OB 3CD6S 2MQOA 4JI8F 5GAEI 4TLQA 3T41A 2HLTA 2XTJP 1WJ9A 2KYXA 2C2KB 4K4VA 2OLWA 2V4JA 4FBUA 5J2NB 1BMQB 2R4FA 1NSQA 4CLYA 4A8FA 4AUKA 3KG1A 1JLEA 1LXNA 3OXFA 3HZEA 4DR6F 3OV7A 5DQGA 1G1XA 4FBTA 1M0SA 2ZKUA 3DRPA 4I7FA 3TJAA 4M5NA 3NWGA 3CULA 2ZD1A 2H4WB 3A4TA 1LEOA 3ZTSA 1KN6A 1M5HA 3M8PB 2XMWA 2HHHJ 1TKTA 2LQ5A 2G0CA 1L5UA 1Q7YT 2MQNA 4DR3F 2FLLA 2KHDA 2X51A 5ETSA 1DAXA 2GGPA 1L3TA 2DPIA 1DTTB 5KT4A 1I94J 3MR2A 4DL0C 4I68A 4DR5J 5KT7A 3TUPA 2BV3A 4EUVA 3THVA 4OZ2A 1VIXA 3VQSA 1AW0A 2P8IA 8RUCA 4YY3F 2NXCA 4I4BA 2Y8YA 4OZ5A 1ZAVA 3OL8A 4B3MJ 4IG0B 3K57A 4P74A 3DKDA 3QWPA 2IY5B 4FS1A 5HO4A 2RUSA 1T8EA 1TVRB 3DM2A 3ADAC 1WEXA 2XZWA 4GVLA 1IM6A 1UWBB 2PE8A 2HFOA 1S1XA 1C2PA 2QIFA 3NMAA 3WZ0A 4L72B 2R42A 3P4UB 5A2QU 2ZWPA 3N5FA 4G65A 3GCXP 3HHKA 4WCEQ 2J9DE 3KG0A 3QPIA 3OTOJ 3OQ2A 3JSRA 3KKFA 2XYHB 3HT0A 3NGSA 1ZTTA 3L3CA 1EHWA 4W4MA 2Z56B 3W60A 1W25A 1RCXB 4QR1A 5FLXY 1GEHA 4PR6A 3T9ZA 3JTOA 4X65J 2QL7B 2YNFB 3MURP 4U7UD 2HNYA 5K8NA 1WEYA 4KHPF 9ATCB 3KYLA 4TKTA 5LMNJ 2FJWA 1A7GE 4ZJQA 2HBZB 4J9OA 4AQYF 4IRKA 4ZP7A 3ZTQA 2KXFA 3GP9A 5DG8A 2V2VA 1FNOA 3W62A 1U1PA 5ADZA 4B3TJ 3S1TA 4NRUA 2HRUA 4OX9J 4DLGA 4UOHA 2KI2A 2V8PA 4EI2A 1IKYA 2VG6A 1NCLA 3NGTA 4F7VA 4OYIA 1FCAA 1JK9B 4DL5A 1JIHA 4JI5F 3OR1A 3OFHA 3ZNUA 1HW9A 4O3NA 1KONA 1R89A 4LSLA 2EFNA 3T1HF 1EJ7L 1N0UA 1I5OB 4USJC 4DS4A 2FIUA 2DR9A 4NE9C 1RT5B 3DDNA 3PV8A 4KB7A 4DQIA 2W24A 1TQLA 3GR0A 3B82A 2MSSA 3OHBA 3ULHA 4X62J 4X4TA 2V94A 1Y7PA 1VDHA 1H2UX 3Q8PB 1S1TA 1SJFA 3ET6A 1VRUA 4QIEA 3WIUA 4A8QA 4X65F 1WEZA 2B0GA 5B0FA 2DHXA 2GVDB 1QAYA 3MAQA 5LMNF 3U27A 5F3TA 3N0VA 5IS2A 2MB0B 3DMJB 3A3NB 1URNA 3G6VA 1CSJA 3H5SA 5H1SV 2VOPA 4RO0A 3CC2S 3UVJA 1KQGB 2J7UA 2AJ1A 2VFVA 3M1VA 2JHEA 4DMZA 2E9TA 1R6VA 3H25A 1G4CA 5GVQA 2XHCA 3T19A 1Q8IA 5K5MA 4UOGA 2EW9A 4N41A 3DHXA 3M2RB 4TVAB 4WZQA 3NNAA 2ZDPA 1QLNA 5F8MA 1EIYB 2DD8S 4LQ3A 4WYLA 1FVSA 1RBLA 1C0UB 2AP6A 1NB7A 3CMES 4DL4A 2FVSA 4O4RA 3M8RA 3W63A 3ZZTA 4J9LA 4CIOA 3FBEA 2OPRB 1X31C 2EG2A 1S6PA 3MCSA 1FRIA 4CT9A 4LF6J 1RT4B 2VJUA 3CC7S 3GB0A 2ACMA 3MMJA 3J81U 5E33A 2FVQA 3QFHA 1XQIA 4ZIVA 3MTKA 4J9VA 3IBCB 1SH0A 4RJVA 3ZZRA 4R5PB 4GC6A 4I69A 3MM7B 4X62F 4RW9A 5I3UA 2FY8A 1NJWA 2AEJA 2R3VA 4K5RA 2Y9HA 3W9HA 4C48A 3OVSA 2N7YA 3RB0A 1WC5A 3CIMA 2BJDA 4DPOA 3C15A 3N4WA 2RDDA 1UJ6A 2LA4A 1RWMB 2VONA 1CBKA 4L6V3 1HWIA 1MN7A 3PHEA 2DNNA 1HNVB 1QAXA 2DGOA 1XMOJ 2CJKA 2GCFA 3GQCA 4V19X 1VQPS 1JLCA 1Z2ZA 4JV0A 2PD1A 3N6MA 4ZLPA 3NS6A 1NLKL 2RS2A 5DG9A 1EB0A 3HSZA 1OJ4A 1GT8A 2UXDJ 2J6SA 3KK2A 2CNOB 4DUZF 1YQHA 3AA8A 4EYHB 2OELA 4EBEA 3P8BB 2VZ9A 4C8NA 3B54A 3HP6A 1RKJA 3D9BA 1KOHA 2AJ2A 2J9CA 3C2PA 3NWRA 3J81j 3H2VE 2JX2A 3H4BA 1RT2A 2BJEA 3VALA 1NAQA 3MZIA 4DR7F 1HMVB 3V5RA 3GJTB 2HG4A 4LF1A 4G3IA 2IC3B 5KG3A 1TKXB 5J1PA 2HFVA 3LAMA 2HWIA 2IMWP 2AHOB 1FRKA 4LF2A 4C3MA 1TV6A 1X4FA 1RTZA 1BWVA 1KLMB 1TMJA 2ROPA 1CC7A 2CIMA 4IH5A 3UN5A 2C2MB 1ZBTA 3MCOA 3ICLA 1TK8A 2ACYA 1HWUA 3BYRA 3QGGA 3FUYA 4X84A 4BS2A 2W2PP 1V5VA 1DBDA 2FY1A 1CJVB 1UFKA 5FDLB 4C4WA 1CJTB 4DV4F 3ETMA 1VQNS 1KFSA 1S79A 1F9HA 4NLVA 4JP8A 2CVEA 3EVOA 3EZ5A 3WX8A 1FHTA 1L3UA 4OV6A 2DRBA 2QX0A 4OIXA 2EKNA 3I5BA 3UR0A 4DV6F 5B0AA 4F3MA 3GILA 4UZCA 3VVTA 5EWFA 5D15A 2VBYA 3QATA 1YIJS 5KFVA 2HQIA 1HR0J 1Q86T 5CYQA 1FJ7A 4JI1J 1SJ3P 2L08A 3LH2S 3QBCA 3OSNA 2HS4A 3HULA 2I1RA 1VQOS 4I2QA 4GKJF 3I87A 4PUOB 1H6KX 4XAKA 3NGUA 2YBVA 4ZHRB 3P45B 3FMWA 2M8HA 3OXGA 4ES1A 3W1YC 1NHVA 3MOJB 4LQ9A 4CLLA 1TFYA 2OTJS 4M63A 2CQHA 3LGNA 3OUYA 4NPOA 3ZZPA 2V69A 3MM9B 1Q0NA 4BC9A 2MHEA 4C2MA 3P96A 1HBUA 1NJYA 4OZLA 5JXSA 4FN5A 3CEDA 4KY3A 2CJ9A 1T9VA 3DOKB 2VJVA 1VIOA 2DIUA 4QQBA 2ZITA 2V6AA 2XMMA 1JNRB 4F4ZA 3BDPA 3BF4A 1FXLA 4AD6A 2W9BA 5IFMA 4URQU 1FXDA 2YPZA 2C3UA 1P1TA 3JSMA 2QZ8A 3C6UA 4CTAA 1XJWB 1HNXJ 1UEKA 3K5NA 1JLQB 3I6PA 4ZVRB 1IBLF 2IM0A 3TZYA 3RRHA 3GFYA 1NK8A 3R6LB 1RT6B 1WKLA 2WW8A 2J0XA 3HFKA 2WSFC 3EXYA 4IOCQ 4WIQA 4ZPWR 2B43A 3R5DA 3CWJA 4URGA 3GPAA 3TAMB 4P2SA 3EPGA 4QWAA 4B3OA 4V19J 4GMKA 1IM4A 2CQ1A 1B7FA 2MZRA 5DM7Q 1PYOB 2UXCF 2K1RB 2A6MA 5KFLA 4UUXA 4DZDA 1JLFB 2PFFB 3V4IA 1N32J 3FSYA 2JLFA 5J2NA 1RZMA 1RTDA 1BQMB 3CCSS 3ISND 2EFVA 5D77A 3PJXA 2WBRA 4ZCLA 4IOBA 5LSLA 4ZVTB 4Y2AA 3QRQA 4WU2A 1J5OA 3AD7C 5T7LB 2MQPA 4IFYB 2N3OA 4KHMA 5IOLA 2LYVA 1T9WA 2IM3A 1RLCL 1FJEB 2DVIA 3U1NA 4OMFG 3M9OB 1M5SA 4I0WA 4N77A 2A1BA 2ZOMA 1DLOB 2UU9J 4B9VA 2M5YA 2P6SA 3M8PA 1NH7A 3TZZA 2MKCA 1HARA 5IT9Y 1D8ZA 4ITSA 1S4EA 1UVIA 3CJ2A 2R8GA 3Q2TC 1D0EA 3MOZA 1VQ4S 4PKDB 2ZH1A 3KLIB 2HVDA 3X1LB 3R5AA 2HWTA 2HGLA 2K3KA 1DTTA 2CQ2A 4FVCA 4KRWA 4M5DB 3VHQA 2B6AA 4BHQA 4NLXA 1VYAA 3M4XA 4YR3A 4Q45A 4C7QA 2JEIA 4DSJA 1P8GA 3BZQA 2PO4A 1PBAA 4YDXA 4GO5X 5KFTA 4ZOSA 2AT1B 1IBMJ 2FLOA 1Q1KA 4J9KA 4MK7A 3AXKA 4JI2J 3MMCB 2CVIA 1WACA 4NCBA 2AWZA 8AT1B 5G0RA 1TVRA 1CQNA 1SKRA 2F40A 2DGUA 1D9AA 4ZPDA 3NOGA 3I4PA 4OYPA 3NP5A 4OV1A 2DR6A 2WW4A 1S5ZA 4J9UE 5BR8F 1RUSA 2P9EA 4U95A 1HW8A 3THPA 1M1KT 4NLQA 1YJUA 1WHWA 2YX7A 5ETRA 2QC3A 4KPYA 5A8WB 2MKKA 4NLTA 4HEA9 5HMYA 5KG4A 4OYZA 1JXEA 4X64F 1RAGB 4ZVOB 2MKSA 5H9FK 2G0IA 1FDBA 2W7OA 1SL1A 4WE1B 4LF5J 3AXMA 2YNFA 2W01A 5L39A 1BUXA 2ZE2B 3PY8A 4FNHA 4KYZA 4UOFA 4ECXA 1HBOB 1RWOB 4LFCF 2C2DA 2NPFA 2HMIB 1M1HA 3D28A 3AOBA 4NI2A 4DR4J 1CJKB 4QIVA 4WZMA 1Y9OA 2FJVA 2J7KA 2ZNYA 3SV3A 2DR5A 5J2PB 1VR6A 2HZVA 3AQPA 3TNVA 5EDWA 4URSA 1S1VB 3EICA 1TKDA 5D0GA 3MEEB 1N5TA 1N5SA 3BKUA 1OY8A 4Y2IA 3HX9A 2MQ8A 3VGSA 2MSTA 3HF5A 3SDEB 2OD4A 4WFYA 1IJEB 3CB4A 4OLPA 1VRQC 4ID8A 2LEAA 1U2CA 2QA1A 3NAIA 2D7SA 3CCLS 1KSPA 4ZITA 3OLAA 1U48A 2PA8D 2CQPA 1X7VA 2E44A 3MFHA 4K0KF 2BMBA 3VAMA 3CW2C 2W2OP 1QUPA 4LF9J 2H3EB 2RRBA 1RT5A 3TA2A 4IDKB 4JI7F 2OIHA 4CO3A 1KQSR 5A6PA 4WTOB 2WVDA 1XNQF 2ALZA 3KUEA 5LT5A 3CXCR 5KFXA 4LFBF 2KJVA 2UXBJ 5AXNA 4F36A 3BV8A 3BDEA 1HBMB 2XS7A 4ZPBA 4X4VA 1BLUA 4TU7A 3GTYX 1RAHB 3MCMA 3DRRA 2R7WA 4DU8A 3QLHB 4TLRA 3AB4B 4ATNA 4OZ1A 2DISA 2V34A 4DPTA 3I0SB 5LL6d 1XMBA 3UN2A 4UTGA 2GVDA 1SKWA 3LO3A 5J1EB 7FDRA 1N34F 3QWUA 3SBMA 4DN9A 2YKAA 4MK9A 1NK7A 2DNYA 2AIRB 3I55S 2GQQA 5H9FJ 2ZH4A 4A8SA 3DMJA 2VG7B 3CF5Q 3MR7A 4LBPA 1XMQJ 1U6ZA 1M5PC 1CG2A 4UQGA 4WIIA 5SZTA 4B9UA 2F8EX 4K50A 5HLFB 1RJJA 3UCZP 2YX1A 4Y28C 4OYBA 4IRDA 3PDNA 1WELA 2CJQA 3OPKA 3R1HA 4N47A 2YY3A 3VCDA 3ITHB 3VGTA 4CLZA 1PC4A 2QA4S 3M9MB 1IQTA 4KO0A 1LW2B 2LECA 2OPRA 2OUGA 2VHGA 3G82A 1UVMA 3A13A 2DKOB 2GFFA 4USIA 4CLWA 4ZS6A 2J7WA 2F9JA 5HVHA 4BWJA 5L46A 3HJVA 2XS2A 3X3UA 3UD3P 4R5PA 2DXFA 1YDLA 3MM7A 2GO8A 2BW2A 1VRTB 3C6TB 1FD8A 2YNGB 3BH7B 1G7CB 2PSZA 4G1PA 2Y1IA 4NLYA 4F2SA 1S99A 1XTZA 2GMHA 1TK5A 5F8JA 4ED0A 5F8LA 1S9EA 3WQPA 1FVQA 4MKVA 2BQUA 1RHJB 1FJGJ 3CCTA 4H4KC 2N7CA 2DGVA 3GV7B 3I32A 2DGSA 2LKZA 1O8BA 2DCLA 4B9NA 1S10A 3H40A 5A2QY 3GLJA 1FWLA 3M32B 2XC9A 2FTRA 3M6VA 4A8YA 3NEKA 1R8BA 4CT8A 1HWKA 1N54B 2B51A 3K17A 3NG8A 2PI4A 1OYDA 3BKFA 4YB5A 5CH7B 2QGFB 1G2EA 1J2VA 3QGHA 3EPIA 2R8HA 1WDDA 3BJYA 3PYEA 3VAFA 5KFCA 2NXJA 1GX6A 5DRKA 1IBKJ 1RWUA 4YP3A 1VC5A 3OSPA 2DHAA 3J7YU 2VQEJ 3HMJG 1U0SA 4TNOA 1VLOA 1I6JA 1SJRA 1KLMA 2ASYA 2B4UA 2FD2A 1Z2LA 3O6QA 3ONQA 5EHHA 3T5JA 3UD4P 3KHRA 4P75A 4LT6A 2QTWA 2BQ3A 3LWMA 2B5JA 2I9SA 3IRXA 1CJVA 4ZP6A 4WFBQ 2ZHBA 4AL7A 5FDLA 1CJTA 4PYAA 3VR1A 3KK1B 4RUCA 3IS9A 5DDRC 2LQJA 1P1LA 5AXLA 1V3SA 4PXDA 2OO4A 4DV3J 2QLWA 5C24B 2UUCJ 4JI0J 3NCPA 2XQCA 3DRSB 3NLCA 3OTEA 2HURA 3D54A 1WKKA 1W2BR 1C1CB 3PW2A 1RT7B 5ETPA 3NOCA 4HDGA 3OJSA 2IA6A 5HAOA 4K5SA 2CPZA 3H2UB 3K5PA 2IHR1 2YWFA 4KTQA 2C2NA 5G4DA 2AW0A 1NDCA 1NJXA 2DGXA 3D2WA 4F3QA 3RUBL 2LA6A 1R8PA 3MEDB 2CJAA 1JJHA 2DXDA 3SFUA 2P2CB 2QMXA 1F9FA 1VBXA 4NMXA 3CIZA 4ILRA 1HNWF 2EC0A 5RUBA 1SI9A 4RWXA 3BO3A 2X3GA 4ZCMA 1PAEX 5C5JA 4M5LA 2DR8A 1VS3A 1YX2A 4ZHRA 1SCJB 2E5GA 3RRKA 2RHQB 4IH7A 4PCQA 3H8YA 4HH1A 4QBUA 2MPUA 3NGRA 2ZBPA 2XG8A 2WZ1A 3IO1A 1W7WA 3ISZA 4USVA 2IFXA 3S01A 2FUG9 1FDAA 3AJDA 1Q79A 2FPHX 3KJVB 3QIPB 4QW9A 3T5HA 3R6GB 3CVKA 4KT0C 4QIWD 4ETXA 2VC0A 3K58A 2MJUA 2ZDOA 1ZM4A 4IR9A 2ZOFA 2XNQA 4WP3A 4A8KA 3PFEA 3BS9A 3T3FA 2G13A 3NCRA 2VQFF 5DDPC 1S0NA 3KG4A 2ZOGA 4DSKA 3N5BA 5FJ4A 3GFZA 2HNZB 3D6HB 3J7ZT 1MLAA 2DNMA 2V8HA 3FEYB 4MJKA 1Y3KA 4LVOP 1JLQA 3J81Y 2HK3A 1K47A 1PJ6A 1HNIA 1RT6A 4ZA1A 2GVZB 3GFHA 1KS2A 2OSRA 3UW1A 3G9CA 4DV5F 1KC8T 2RH3A 3TA1A 4EWTA 1V5IB 3ZZ0A 1TL1B 5CCLA 4Q44A 4I67A 1YBAA 1WD6A 1RLDA 1QTNB 1Q81T 5K8OA 2C2EA 1LK5A 2K1RA 5B08A 2RNEA 1YITS 3HVTA 1JLFA 1RAAB 1J5EJ 2QEXS 2K7JA 2QV6A 3K59A 1LWEB 3SSQA 4U8YA 2W2MP 2HWHA 3MF5A 3J7YI 1DZ5A 4ERDA 3RAMA 1EP4B 2RKIB 4B9LA 1FFSB 1VFJA 4Q8FA 4IFYA 2OPPA 4NXMF 3TAQA 2CAJA 2NSCA 4ED3A 3DLKB 5ETKA 3DCAA 2ZHAA 4F26A 1SUQA 2F5GA 1VJWA 4LVNP 4PG7A 4ZVPB 2AJ0A 1DLOA 1R7IA 3JXOA 1SVDA 2G2YA 1KNZA 2V63A 3K5OA 3KNAA 1H73A 4M1KA 2O01C 3HHLD 2RQMA 3QIDA 4L3KA 1X9SA 3FGVA 2AMCB 4XO0A 3LALA 4LJMA 1RWKB 3ZZUA 2ZUGA 2KU7A 2BE9B 4OJHA 3SEOA 3HHLB 1K44A 1SPBP 1LKZA 1Y00A 4RW4A 4A8WA 2RQKA 5F3ZA 2FGOA 1SQFA 1EQ0A 1YKWA 3HFVA 4E0DA 2D3ZA 4OJ3A 4OLOA 1UZHA 1RU2A 2HYIB 3CUNA 1D8YA 1S77D 1VBZA 1YI2S 2CXEA 3MMCA 3HM9A 4EBCA 1AYEA 2MYFA 1R8HA 3TOQA 4CO0A 4WP8A 2IYIA 3RBDA 3I82A 1H38A 3KLFA 4BWMA 3BGLA 3QJPA 2ATCB 3M2VA 5K14A 4LR8A 2M88A 2AV5A 2HNDB 4HHHA 4WJBA 1S1UA 4ZPVR 1OPIA 4CLPA 1XR5A 2V8GA 2YTCA 1BXNA 2DCUB 3WIVA 1VJQA 5A8WA 2DK2A 4ALZA 5AE2A 3I96A 1N36F 2DIVA 5K8MA 4WKYA 3R27A 2ABYA 4NZ7A 3DRPB 3CCZA 2NYIA 2VDIA 1XC9A 4P2MA 4IOAQ 1CPZA 3V6JA 4RUAA 4ZP8A 2ZE2A 4DZ6A 4ELTA 3IG1B 3PW5A 1RGVA 2KZMA 1HBOA 2FJAB 2XYPB 1HNZF 3LAKA 1WOOA 2MKIA 2G0JA 4RWWA 1S6QB 4F0KA 3BQ2A 2GGPB 1YK9A 5HN0A 3VWSA 1U6FA 4C3KA 2OFHX 4RW6B 3PW4A 1N5VA 2JJ4D 1RACB 1WF0A 1RKIA 1FE4A 4EFAC 3CDEA 1Y11A 4TU9A 1S1VA 3MEEA 1CJUA 1YJNS 1Q82T 4QWEA 4WU3A 1CS4B 2HS3A 2KT5A 3SDEA 3CE8A 1LV5A 4K7QA 3EJMA 3AA9A 4Y0FA 1BE4A 2FVCA 3DLHA 3UQSA 2V0NA 3DM2B 4ID5A 2CG4A 1YLXA 4X4SA 3BBFA 2OKQA 1S1XB 2EK1A 2IYGA 2JNJA 4ZVQB 5KFGA 1FO1A 2WVFA 2ZHOA 2Z30B 2P6TA 4CLSA 4XIUA 2JH3A 4U96A 1FRXA 2BYCA 4B3RJ 2JL9A 2ZBRA 1HBMA 2RVJA 1PAUB 2L48A 2VFUA 2UVVA 2MLZA 4DV7J 5D4PA 1F5CA 4NCGB 2WOMA 2AYMA 2ZUAA 1XNRF 4DXLA 2W25A 2FJEB 2ADBA 3QLHA 3R1LA 2DRAA 2HNYB 5CD4A 3BSNA 3PXGa 1U47A 1X4DA 2OPSA 5HL7Q 4DWIA 2I2YA 1NPPA 4JI6F 5KT5A 1U1RA 4RU9A 1ZTWA 3DYAB 5KFMA 2PMHA 1TK0A 3IWNC 5MAOA 2YKNA 4TU8A 3CCRS 1IKXB 1ZOTA 1VBYA 2XS5A 4WFNQ 1PJ5A 1T03A 5HLFA 5AE1A 3IMQJ 1CC8A 1KTVA 5CZVA 3BSAA 3A8IA 3PFOA 3H5YA 2EVZA 3ITHA 3MPWA 4OHYA 3IXQA 3EDRB 2D69A 1P9QC 2VFTA 2HVIA 3BKTA 1ROFA 2VD3A 4ES2A 4KGMA 3OR1B 3K7RA 3MECB 2JRSA 3Q0AA 2BQRA 1Q5YA 3HXMA 3PX0A 3R9LA 4A8XA 2QG9B 3PO4A 3KFWX 3I31A 1N5QA 1XEZA 3IM9A 2O67A 1RWXB 2X1BA 3JTPA 4DUYF 5D4LA 3BGFA 2ALYB 1S1WB 1PGZA 1S72S 2KKHA 4B3RF 1VRTA 4LRBA 5I3PA 3KOAA 4LRAA 2YNGA 2UVWA 2UUWA 4KGVB 2ZZMA 1S1TB 4KJIA 2KFYA 3TRGA 1X4EA 2D3O1 4ZP9A 2CPYA 2XO7A 5AJ3F 5LMUF 5B09A 2D3UA 2ILZA 4MT1A 4DFKA 1SC3B 2CQ3A 3PIOQ 2ZZNA 2AYBA 3GYGA 1K1SA 1ELOA 1HPZB 2YXLA 4LSNA 1YZ6A 3U1LA 5M2RA 2JC1A 4NYZA 2E1RA 3SCKE 4WF9Q 3WDOA 5KFWA 2A0FB 3SFGA 4BLGA 3OD2A 2XZTB 3M8SA 2J76E 1KVIA 2EFOA 1HI0P 1QVFR 4KC5A 3V81B 2OHDA 2UUAF 3M8QB 2D41A 4KGZB 4WPAA 2KVQE 4NCAA 2O5DA 4YMEA 4DCPB 1O5JA 3V6DB 2X1AA 3P3DA 4C6AA 5KFOA 4JV5J 3UNGC 2BM0A 1S59A 2FZGB 5DGBA 4LREA 4NXNF 3J7AN 1U0HB 2JEGA 4G6VB 4A48A 2EEYA 1AT1B 1H2TZ 5DZ7A 1RA6A 2DNLA 3NGKA 1RAEB 5L1IA 3C16B 3TP2A 5ETQA 2GX8A 4DR2F 3DU5A 4AT1B 2YX4A 2D9PA 3BM7A 5B7WA 2E9ZA 3TX8A 4N7TA 2BJ7A 1NK6A 9RUBA 1TL4A 1FTRA 4C8YA 5L1KA 5DLFA 4B9TA 2XLIA 3EUNA 5KT2A 1XK8A 1N33J 2XMKA 4DU7A 2GHWA 2CQBA 4LF8J 2IVMA 4RW9B 2E5LF 5I3UB 3KK1A 4IQMA 2GMLA 3EXCX 3TWZA 4J7CA 1DY3A 5DDOC 1Y5LB 4ECSA 1Q8LA 2EXUA 5C24A 4ED2A 4KV8A 3C15B 3DRSA 2ERRA 4DV1J 1RT7A 5LXYA 2B9WA 4CZCA 4UY85 4HDHA 2YKQA 2J0SD 4CI0B 5C25B 2M0GB 1VHIA 4IFVA 1JLCB 3VV2B 2HPUA 3M9NB 4F04B 4NX9A 4DL7A 5JVGQ 4ELUA 3SIPB 3KK2B 3V6HA 2LEPA 1AB8A 3MEDA 4W90B 4CLTA 4DR1F 2MQLA 4P7VA 1O6XA 1D3WA 2L3MA 5HQMA 2E7WA 3G8SA 3EX7B 2QA4G 4FKXA 1GK8A 2GC8A 6FD1A 1B0VA 4P2XA 4U7UK 1RT2B 3BO4A 4QR0A 2ZM6J 1HWLA 2RIJA 2HEKA 2AX0A 3E8OA 5E41A 2GQCA 4LF4J 2AQ4A 4RPFA 2GAGC 1SC6A 1XR7A 4OZ0A 2QYGA 4OI1A 5KG1A 3G96A 2HGMA 3GE9A 2DNKA 3R97A 4GRSA 3QIPA 5BYSA 1N48A 1T0TV 1U26A 2G1HA 3FNNA 4O4GB 2GS8A 3Q23A 2Q66A 2F1FA 4WXOA 4LF8F 1SL0A 3SSSA 3NBPB 1DHMA 5GAHU 2R8JA 3MM6B 2HSEB 3TARA 3NS5A 1JLAB 2DO4A 2UUBJ 1GMWD 3ENQA 3VGVA 3L09A 1NZ8A 2W7AA 4I1TA 1I1GA 3MUVP 3VAHA 5GMDA 2QMWA 1QY7A 4ZPCA 4O3RA 2E1CA 1EX8A 4FPIA 5H9EK 4WP9A 3L95X 5GAGU 1IN0A 2ZVSA 5CYQB 1H74A 3PIPQ 5DJBA 4EZ9A 3MM5A 2R2RA 2DTJA 1WORA 4USKA 4KHRA 4RW7A 5ETNA 5A8RB 2WBMA 4U6PA 2QLJB 1TL1A 3P6YC 3CGIA 4IRCA 3QJLA 4MYTA 4JYAF 3H2LA 2I0XA 3CNQP 3UDLA 2FGCA 2C2RA 1C4CA 1LWEA 3EVWA 2OEKA 1WSVA 2QRRA 2CKWA 1EP4A 3TEHB 1FWKA 1I3OB 1S6UA 3KMSA 2JEFA 3LANA 4KFBB 3LP1A 3KUGA 3LP0A 2XLKA 1SQEA 2C1EB 2V9KA 3TANA 1HLWA 2N3LA 2SXLA 3DOMB 3M8WA 4UUWA 3DLKA 1PILA 3BBCA 5JMNA 2KM8C 1BD6A 3PYGA 2RF2B 3GG0A 4HL9A 2POKA 3VAIA 4J91A 1FI4A 2BUNA 5CHCB 4DQQA 3L7PA 1FT8A 5HVGA 4M5HA 4P52A 1FKPA 5IWAF 2JLEA 2CADA 1T95A 1NSAA 3W3SA 4DPUA 4DBQA 3KNGA 2BVZA 3BGUA 1BQNB 2RDJA 4CTAB 3HHLA 1EKRA 2NPIA 5ITHA 3L9ZA 1RHMB 1IJFB 1C4AA 5IC6B 3D6MB 2KFZA 4M5JA 3M8ZA 5HJYA 4RZRA 2DNQA 2C2OB 1ZA1B 1LXJA 1X9MA 4OFZA 3J80Y 3RR7A 2NREA 1RABB 1M5OC 1TL7B 2HRYA 3C14B 3PW0A 1TR0A 2E9RX 3HCXA 5H9EJ 3V4IB 4OHWA 3OT9A 4A4JA 1KD1T 1NKBA 1JWWA 4EU0A 3GIMA 1RTDB 1MN9A 2HNDA 3BR9A 4CM0A 3HD2A 3W9IA 5JJBA 5ETVA 2DRDA 2FHMA 2HW3A 1VQMS 1J5OB 1KQKA 2DEIA 5KFJA 2HFNA 4NLRA 3GYNA 1TAUA 3G4SS 1D09B 1SC1B 1WF2A 4DFMA 3ENVA 4RNMA 2E1MC 2GJFA 2FB0A 3KDOA 4YB6A 4AL5A 2EFQA 2A3JA 3W66A 2OSQA 4JV2A 4U9RA 2YVSA 3HT3A 2W7PA 3IG1A 3JYTA 4R8UA 4DSFA 5GAHI 3MHYA 1FNXH 3CSKA 1RWPB 5K20B 2HLUA 5IV3A 2P5VA 4PWUA 1S6QA 1X5TA 3RZAA 2V8VA 2I38A 2Q1LA 1U09A 2NR0A 4RW6A 3W2VA 1Y0HA 2E5IA 4WTYA 4KIAA 2J9EA 1O0PA 2B6AB 2RAQA 1R31A 5GAGI 2ASJA 2ZH7A 2U2FA 1CS4A 2IDEA 2RSQA 2HVHA 1SL2A 1RHQB 4LUBA 3D0GE 1Q4RA 1NBEB 4KGKA 1IWAA 4AXJA 1OY6A 3CO9A 3FCWA 1R8AA 2DBBA 5G0RB 1GMVA 2XSJA 4LF7J 1IWGA 3FEZA 4YN3B 4DQSA 1VC0A 2RQ4A 4CLFA 3IA0A 2JEJA 2BKPA 3DDIA 2KT2A 4HI2A 1S0VA 3IWXA 2WVBA 3CDAA 1V3ZA 5HBMA 4W98A 3W5ZA 4K4XA 1HFEL 4IYQA 2XM3A 2JVOA 1NEEA 3T5KA 1UL3A 2VPWB 4PXEA 4NCGA 1SH3A 4NRTA 2O1PA 3MMAA 3RU0A 2Q6BA 4B17A 1C0TB 3NS7B 2JVRA 5IXUA 1OS5A 2HHHF 1OSCA 4RBVA 2VIHA 3AT1B 2B56A 2F8HA 4K4WA 1B3TA 3FKBA 2XMTA 3DLLQ 4RKUC 5ETTA 2OP5A 2Z2YB 2AZ1A 2HBRB 4NI2B 3DYAA 1UVJA 1I94F 3FCHA 4MKBA 2Y8WA 3V2UC 1QUVA 3CCVS 1IKXA 5C42B 3D66A 1DQAA 5DG7A 3POTA 5E3QA 2Y0BB 1WTFA 4DR5F 4OL8A 1WC4A 4ENOA 1TUWA 2AGQA 2FLPA 3GJSB 4P2FA 1WOPA 1FNMA 2X7IA 4LIWA 2QJ3A 4L75A 2WSCC 1RK8A 4GKKJ 3GV5B 3B6BA 1SH2A 4ZKAA 4B3MF 3SQGA 1E6VA 3WC2A 4DQPA 2HQCA 3U1MA 4AL6A 3MECA 3CO0P 4HLBA 1JLGA 4ZLNA 3MEGA 2VBZA 1ZYQA 2F65A 1WC0A 2DNRA 2KXNB 3GCWP 1B64A 2R9LA 3ENAA 1TZ0A 3CJSA 3CD7A 2ZBIA 4KR0B 1S1WA 2JFDA 1MG7A 3I9ZA 2L41A 2G9OA 3OTOF 2KG0A 2XYGB 5HQ8A 1UPPA 4N8OA 5L9XA 1BHNA 1AROP 3RW6A 1X5SA 3WBZA 3G87A 1RQ0A 3NKYA 3Q8VA 1B0PA 5KFEA 3DRRB 4H4OA 4DV0J 3M2UB 1WG5A 3QYYA 2YQ0A 4J9PA 4C98A 4DS5A 1GAOA 2FC9A 1PCAA 1HPZA 5A8KB 2BOAA 3EYZA 2DY1A 5B0GA 1VGYA 2XHWA 5ETLA 1WDTA 2AEFA 3CDUA 2Q6CA 4O44A 4C0HA 1LQ9A 2HZAA 3IFEA 5I42A 4M5MA 4B3TF 3V81A 4OHZA 5LSRA 3M8QA 5LXRA 2A6OA 3D1QA 5EWEA 2DJWA 5HROB 3V6DA 4OX9F 1KKHA 1OSDA 3FVYA 2IM1A 2VU5A 3RBEA 4NLSA 5CYMB 1IR1A 1U0HA 3FSXA 4X66J 1WHYA 4Y2MA 4KO0B 5E3PA 1P6TA 3AY0A 2Y1JA 3C16A 3G82B 1RAOA 3TVYA 4FVMA 3BREA 1DFDA 2D9OA 2X1GA 4ANCA 1MMLA 4DSIA 2J0WA 2LXUA 4A8OA 1UW4A 1ICEB 1R0AB 1Z4UA 3T1YJ 2MDAA 2KJWA 2R7UA 1ZAWA 5ETMA 4DL3A 1NH8A 4PZVA 2M3DA 3HFZB 1PIEA 2BANB 3N6NA 3FRYA 2CPFA 3QT5A 5C2GA 1K0VA 4U8VA 2DY9A 2R2UA 3AQOA 3ILJA 3B78A 3TVZA 1UKUA 2DPJA 1F2GA 3DGVA 4MYUA 1S9EB 3D67A 1UMJA 3HDSA 2FJXA 1NKCA 1RAIB 3MAAB 2HHSA 2RRNA 4LR9A 4DFJA 5C25A 2BW7A 3EGWB 1T3NA 1K8AT 1U24A 2L9NA 4USWA 2W2QP 5GADU 2VBWA 2E5JA 1URRA 2W4PA 1VQKS 2NUUG 4JI4J 1SV5B 4F4YA 3TQEA 1X60A 2WONB 4ZVFA 4RNFA 2FYXA 2EPIA 4K2XA 2M8DB 1NU4A 2IPOB 4Q2MA 2ILYA 3C8YA 4EO6A 5A0YB 4DPYA 2BKNA 3MWBA 1U25A 3MPUB 1B70B 1XWLA 1VCTA 3CD0A 2GIFA 1RWVB 2LVWA 1NJZA 2OFGX 4LF6F 5BYQA 3T6JA 4RU2A 3T1YF 2XY5A 5DETA 2DYAA 3PCOB 2ROGA 1Q7LB 2WSEC 3UD5A 4O4GA 1ZM9A 2B5JB 3GSIA 3IRXB 3ILLA 3AD8C 3IS9B 1QE1B 4NA3A 1TELA 2WCXA 3BSOA 2EBEA 4LRFA 3NNCA 2KZZA 3NBPA 4FYYB 2FJBB 3MM6A 2HHWA 2F4VJ 2MGZA 4Q8EA 3QT8A 3HHEA 1JLAA 5KAKA 2N4DA 1ACMB 4DLEA 2CZ4A 4PAAA 1KWMA 1GH8A 2GHVC 4F4AA 3UCGA 3MUTP 3OTCA 4E2FB 4ECRA 4YHHJ 5E3AA 1MWQA 1FESA 2V9WA 3N79A 1XMOF 3ZTPA 1GMWA 3MPDA 1MSWD 2OMLA 1F3VA 1QJHA 1Y4ZB 3HLUA 2UXDF 2LLZA 2GAHC 2H65B 4UQTA 2DITA 2R7TA 4V1Ak 2JC0A 3I56S 2VH7A 3BEGB 5A8RA 2OJ3A 1JLBA 4LBIA 2KN4A 4KSEB 2GW8A 3R5JB 3DGPB 2VDHA 4JI3J 1BQXA 3H5XA 2R2TA 1UVKA 3AB2B 2HHPA 5KFFA 4TY8A 3CJ3A 4H4MB 3DLJA 1SJ4P 1HHQA 2D74B 1WC3A 4ZK7M 2IVFB 3L4BC 1F5AA 2O66A 3C66A 3OFEA 3DDKA 1HBNA 4KFBA 2WAQD 3UR3C 2GIQA 2MKJA 1HI1A 3N6LA 3KLGB 4ZVEA 2VB6A 3H0PA 4MIAA 2IRUA 2F63A 3DOMA 3SCIE 1YJ9S 2BBEA 2RF2A 1ZA2B 1FD2A 3FCVA 1H2VZ 4D3HA 3IR6B 4DSEA 2UVUA 3QMQA 2KL8A 2ZVIA 1VK3A 5HI7A 3SV4A 5ETOA 3SYZA 4MTPA 3RBXA 2DNZA 1VQ8S 3FFIA 3DXBA 1UEVA 2IAJA 4PYDA 1F0XA 3TX0A 2MEWA 1GMUA 1R0CB 2PT0A 4DG1A 1BQNA 3OVBA 1K9MT 5M2UA 2CQCA 4NLUA 5F9NA 4YHHF 4NEZA 3T6BA 3MTJA 2DO0A 5GADI 2E5HA 3IBWA 4USUA 5KFBA 4WYWA 5J2QA 2DH8A 1HR0F 1HNIB 4DV2J 1IQZA 1TP7A 1U2FA 3L7UA 1FKAF 1XERA 1REGX 3DLGB 4JI1F 3D1HA 2RILA 2XO6A 3FRZA 5AXMA 1WUUA 1OIAA 1TL7A 3SZ2A 1U6BA 3KK3B 2GHPA 1S9FA 3C14A 4KAIA 2UZAA 4I64A 3HVTB 4HTIA 3W8PA 1B99A 4TQRA 2IJFA 1ZS6A 4LRDA 3M6WA 4WFAQ 2Z8QA 3LOUA 4B9SA 2D1CA 3I5CA 2OPPB 4K4TA 4FF2A 1Q8BA 2Y1RI 1NKEA 3H42A 3VAJA 4X4QA 1YGYA 1SUQB 1UTAA 2RS8A 1U8SA 3EGVA 1KFDA 3PYDA 2E7XA 4JI8J 4DN0A 5B0BA 1P9YA 1FERA 2QLFB 3RG6A 2ZFHA 4UT4A 3W61A 1M90T 3GV8B 4NMLA 2VG5A 3LGHA 1AUSL 2ASDA 4PRFA 1RTHA 1RBOB 3DU6A 4A46A 2NCKL 5GMKa 3TAPA 2E29A 3LWLA 2B3TB 3R2CJ 1FFGB 5KG6A 1PO6A 4RW4B 2MKYA 2XY6A 4DR6J 1HNXF 3UNYA 4DCOB 3A8EA 1W26A 1PJ7A 1X4GA 2WK4A 1KLNA 4QWCA 3AHPA 3CT9A 2V68A 4QPTA 4J5OA 2ZH3A 1EARA 1UZDA 1E6YB 1U49A 3KHLA 3AOAA 1KOOA 2XB2D 1WTBA 4DR3J 1UCNA 1HYSB 3RW7A 2CPDA 3KLFB 3TJ9A 2R7SA 4N56A 1UVNA 3QO9B 3M2VB 1N32F 5K8PA 1GTEA 2VICA 5K14B 3UO0A 3R5BA 5IQ6A 1M5KC 2LU2A 1RE1B 4RBTA 1FX4A 1S1UB 2CPJA 4AE5A 3RAQA 2BABA 5L1LA 3TYTA 2J5AA 5D0RA 3VZIA 3G8QA 1UA1A 5SUHA 4P6QA 3UI3A 3V4MA 3R5CA 4YY3J 2FJDB 2DB1A 2OEMA 5DM6Q 1RYSA 4QW8A 3TJ8A 1NK9A 1NJIT 2BRLA 2LFVA 3PYFA 3O1LA 3OL7A 1RP5A 1TU0B 1VMBA 4ICLB 3SMZA 1C0TA 1HQEA 2NQPA 3BB5A 2KO1A 3IR7B 2UV8G 4RNOA 2UU9F 1S76D 5THWA 5KFSA 1WWHA 2ZC3A 1SIZA 4QYRA 3B4DA 4P72A 4PQUB 3OBIA 1JJCB 2JFKA 5K9FA 3UDEA 1UEUA 4IUFA 3MEKA 1JJ4A 4X4NA 3R2DJ 4C11B 1VQSA 4NWBA 2UV8A 3VAGA 4L76A 2WB4A 5C42A 2XULA 1CLFA 2HHVA 1CJUB 2JSXA 2AF6A 2FZCB 1RHRB 4JBCA 4O23A 3KXDA 2DEJA 3EGZA 5F8IA 1IBMF 5HK4A 2LP4A 1VQYA 4Y65A 2WVEA 4IH6A 2OPQB 4JI2F 4KHPJ 2HHXA 4K4SA 3K89A 3TA0A 2OTLS 2ZZTA 3TW0A 5J2MB 3PX4A 2XMAA 4M5KA 1WI8A 2YWGA 6AT1B 4ID5B 1TUGB 3QRPA 3IM8A 3JSYA 4MIWA 3D3CJ 4AQYJ 4MFBA 2B7CB 3LQVA 3PKYA 2M7SA 4M94A 4QWBA 3RTVA 2IDLA 1RT1B 2MZTA 2F9DA 2YWHA 2EI5A 1AFIA 2N82B 2D3OR 3H4DA 4N76A 1CVJA 4ZN1A 4DPXA 4WBFA 5KG0A 3H59A 2R7RA 2AYEA 1HIYA 3S6EA 4F25A 2WOMB 4IKAA 2LQ9A 2XSFA 2NUHA 3MM8B 4FS2A 3M2UA 4LF5F 4DX6A 4JI5J 5E3RA 2M2BA 4NLWA 4TYAA 2CQDA 2QSWA 3T1HJ 3NCQA 2OPSB 5A8KA 4G1QB 4P9SA 3UDCA 4X4OA 1QTMA 1EAYC 3MMBB 4PG4A 3HHDA 4NLDA 2F7VA 4OI6A 1PC5A 1LFWA 2A18A 5U47A 4ANEA 4DR4F 3CC4S 3I4HX 1KBRA 2YKNB 1IKWA 3QAEA 1K73T 1T03B 2DNOA 4Y2KA 2C28A 2DNGA 3DC2A 2DNHA 5HROA 3PR4A 2H54B 4DF8A 2B4VA 1RWWB 2VL1A 2XCAA 4NLPA 5CYMA 4P71A 3VQTA 2AU0A 4Z7CA 2VKZG 2V4QA 3GIKA 1SKUB 2PA3A 2QMUB 2IMOA 4CH1A 2CG8A 4M8LA 4NYPA 3TUJC 3V6KA 3JS9A 1R0AA 4H54A 2EG1A 2W4CA 4NOHA 4LF9F 2IIHA 3P5TL 4I56A 1X5OA 3W9JA 2IBOA 5E5NA 1FDDA 2UXBF 3FBCA 3KLHB 3CJ0A 4PPDA 2DXEA 2XLJA 2BANA 3C19A 3Q86A 4CDIA 1DRZA 3HSJA 5DZ6A 3FQLA 4R0JA 1RT3B 2KRBA 1F2HA 3UWTA 2AEMA 3ILIA 4CM2A 1G3OA 2YPYA 4EO8A 2MZSA 2BJ9A 3QGIA 4FF1A 2XBPA 3MAAA 4YFUA 2V5HG 1TMMA 1N6QB 3CD5A 4LSNB 3OFFA 4PXCA 2F8MA 1T05B 4QR2A 1LWFB 2CPIA 1U1NA 1XMQF 4C8KA 5AT1B 1QSYA 1R0BG 1SV5A 5HJXA 1LWCB 4FXDA 2WONA 4BCAA 1IR2A 3SQOP 2E1AA 1RCOB 4DPWA 2LDIA 2VPXB 3IWLA 1OQ3A 3GIJA 4XPCA 4ZLLA 2V2QA 2V67A 2P9GA 4DOZA 4OQJA 4M5GA 4YR0A 5A0YA 4DUTA 5F8GA 4J9RA 1ZPWX 3LP2A 4RBUA 2FC8A 1UETA 1FX2A 3KMQA 2KG1A 1T9YA 4JUZA 2XZDB 1FFWB 3E3XA 1TL5A 1H0HB 1U1MA 2K2PA 4F4WA 3DRXA 3OL9A 3D6TB 1F6TA 4DUZJ 2RB7A 2HIQA 3HVWA 5L1JA 2NXUA 1UFWA 1QE1A 4TYBA 4HH0A 3JQMA 3HO1A 3OFGA 5AXKA 2XCPA 1WHXA 1FEHA 3D1OA 4DR7J 3Q2SC 5AE3A 5IQQA 1UWAA 4KV8B 2J8SA 3JAMU 2CYYA 3BYPA 1KTQA 5EN1A 2FLNA 1XR6A 4LFAJ 1FJGF 2QFJA 1Y5NB 5CQGA 2QLBB 2JOQA 2QYCA 3G2XA 4UW2A 4IFVB 2YH1A 3W7BA 3AJ1A 2CQ0A 5LJ3Y 5IZHA 2AJFE 5CABA 4UF4A 2CJXB 2E66A 4DSLA 1YJTA 2C3MA 2L9DA 3TVKA 4AYBD 2HHUA 3LPEA 4DV4J 1DQ8A 4W92B 5T14A 3M6UA 2YWEA 3DGPA 5KFDA 1JKHA 4C0BA 3D3BJ 1PKUA 2DNPA 4FF4A 3TEGA 3GFXA 4H4MA 4I2PA 4F3OA 1R3NA 4DV6J 4FPRA 4DJBA 1PYTA 5HP1A 4Q2LA 3CDBA 1IBKF 4F50A 3EGNA 2ZBQA 1IVZA 3J7Z5 4CWBA 1P27B 2VQEF 2OGUA 5KFZA 2B9EA 1Q16B 2MY8A 2BJ1A 2AZ3A 2HVZA 1VLYA 3KLGA 3D68A 3W2WB 3R7BB 1N88A 4FXWA 5KFIA 1S9GA 4HACB 2FVPA 1Y3JA 1NK4A 1K0TA 1HQ2A 3ENWA 4NLOA 4JB8B 2Z57B 3PKMA 3R8YA 4GKJJ 3W64A 1UFLA 1NK0A 2CWXA 1AZSB 3N01A 3QT7A 1C1BA 4DV3F 1VK8A 2LDYA 4XDDA 3THTA 1FJCA 4OJGA 4ZIWA 4JI0F 2UUCF 1Q78A 1DTQB 4ZVHA 3DNCA 3ISNC 2KYZA 3CCES 2LXFA 4LFAF 4A47A 2CA9A 2RE1A 2HGNA 3KLVA 3K5MA 2HRTA 5IT4A 2XEXA 3IGNA 4Q7AA 1FRJA 2AGOA 5HMZA 3DLGA 5B0DA 1SXLA 3MM5B 4RW7B 2QLXA 2BE2A 8ATCB 3GJQB 1RISA 1N8RT 4F4KA 4PWDB 4C0OC 3KK3A 1K1QA 2GO9A 3E51A 3H98A 2FZKB 1TL3B 2E1PA 2EK6A 4ZMMA 3CCMS 4WK1A 3NNHA 5BJRA 4RW8A 1YTYA 1SB6A 4TXSA 4EMDA 3LP1B 4EBDA 5CD4H 3LP0B 4X4UA 1IBLJ 1TKZB 2OEJA 2H5EA 3D7SB 2R8KA 1NSPA 3QZ7A 3NMRA 2RJZA 2EKYA 2GNKA 2W4DA 4WFXA 1S4FA 4QU6A 5KOWA 2I5JA 3KLEA 2UXCJ 2MLYA 1JXVA 2B9YA 4YR2A 1S97A 3AODA 3EM1A 4P10A 3IN5A 5F0WA 5C7PA 2VFRA 3PVXA 5KFQA 1FKPB 1YBTA 3FBBA 1N5YA 5LM7E 1KDNA 3W5XA 3IP0A 1PYSB 3CJRA 4ZCIA 1H72C 3FQKA 4ZCKA 4RNNA 4QCLA 2MTLA 3WHIA 4KKOB 2IRYA 2XMJA 2HQGA 3KJFB 3Q89A 2NSBA 4DDFA 1E6YA 1HD1A 4OHVA 2BM1A 2FHKA 3WX4A 4F4XA 1RTJA 1L3KA 3ZZYA 2YH0A 1HL6A 1NUEA 4J37A 3LW5C 2GQ2A 2BDPA 2WVCA 1HYSA 1U8WA 1FK9B 4HI1A 1J5EF 1UP1A 3ZTOA 2YKOA 3OLBA 2XGPA 3QO9A 1D9DA 4FP9A 3HD1A 3MR3A 1ITPA 2K7KA 5D3GA 1HQUB 3O3LA 2VPZB 1A0OB 1YJVA 1BY9A 3UN3A 4IO9Q 2UP1A 4PG5A
chains in the Genus database with same CATH topology
4ECTA 1MMNA 4HYKA 3GV5B 3US5A 1SH2A 4ZKAA 3ZC4A 4B3MF 5D6GA 2CQGA 3SQGA 2BQUA 1E6VA 1REVB 3WC2A 3CCTA 4DQPA 3BN7A 4H4KC 2N7CA 2R8IA 2BXJA 2DGVA 3GV7B 3M6XA 3I32A 2DGSA 4Y6IA 3KJVA 3U1MA 3PZPA 2LKZA 2HFZA 1O8BA 5EX3A 2DCLA 3MECA 4AL6A 4B9NA 4HLBA 1JLGA 1S10A 2VOOA 4ICLA 1WG4A 3MEGA 3H40A 2RU3A 2VBZA 5A2QY 1ZYQA 2KVIA 1V3RA 1NK5A 1N52B 3M32B 2DNRA 2XC9A 3C46A 2FTRA 2MQQA 1UVLA 3M6VA 3JYTB 1QSLA 4R8UB 4A8YA 1R8BA 4CT8A 2KXNB 3U02A 4NYOA 4PQAA 4U67Q 5A6WA 4RLEA 1HWKA 1N54B 4PQUA 2BE2B 1B64A 2R9LA 7FD1A 2B51A 1TZ0A 3NG8A 4JI3F 1KVJA 2PI4A 2XNRA 3WC0A 2LU1A 4C11A 2M52A 3HHNB 3CD7A 2ZBIA 4KR0B 4YB5A 1S1WA 2KH9A 2JFDA 4DFPA 3I9ZA 5EWGA 2L41A 2LMIA 5CH7B 3FZBA 1MU2B 4DHVA 3H20A 3IAM9 3D5MA 2QE5A 5I3QA 2G9OA 1O51A 5KFNA 3OTOF 3T5LA 1PSDA 2KG0A 4F8RA 1G2EA 1J2VA 3IAS9 3QGHA 1GTHA 1NO8A 3W2VB 3EPIA 5HQ8A 1RTIA 2HNZA 2R8HA 3VAFA 3BJYA 3PW7A 4N8OA 5L9XA 1RA7A 2MKHA 4QPXA 5KFCA 4O0IA 2PDAA 1AROP 1GX6A 1TAQA 4RW8B 1X5SA 3PJWA 3M30A 5DRKA 4TQSA 2J6TA 1RWUA 3RW6A 3WBZA 2NZ4A 4OZNA 1RQ0A 4YP3A 5KT3A 3NKYA 2CDQA 1S49A 1VC5A 2ZH6A 1B0PA 3OSPA 5KFEA 3DRRB 2LXIA 2GJIA 4H4OA 4CQ1A 2DHAA 3M2UB 3J7YU 1WG5A 2N4CA 1IUJA 2AJ4A 2FHJD 3HMJG 4O3OA 3QYYA 4ED5A 2HAIA 3N28A 3KWMA 4J9PA 5D8HB 4TNOA 1I6JA 3DLEB 1SJRA 4C98A 1KLMA 4A8MP 4DS5A 2ASYA 2OPQA 2AGPA 2B4UA 1GAOA 2FC9A 5HMXA 2FD2A 3BN4A 1FE0A 1HPZA 2MQMA 1Z2LA 5A8KB 3O6QA 3ONQA 1GXLA 5EHHA 3U7JA 3T5JA 5J2MA 3UD4P 2B7BB 3EYZA 3KHRA 2XSJB 2UUTA 4LT6A 3QJJA 4I6WA 4HT7A 2BQ3A 5B0GA 1VGYA 3LWMA 2I5JB 2OAUA 2XHWA 3KLEB 2W8KA 2B5JA 2I9SA 3IRXA 4I2QB 4ZP6A 4WFBQ 2ZHBA 3GWCA 2O3DA 4AL7A 2R7OA 1KHWA 5B0CA 5FDLA 4F2RA 3CDUA 3VR1A 2Q6CA 3KK1B 4RUCA 2PN6A 4O44A 3IS9A 4C0HA 1LQ9A 3IFEA 5I42A 5DDRC 2LQJA 5DO2A 4HVZA 1P1LA 5AXLA 2B4PA 3Q24A 4B3TF 4ECYA 2CPHA 2DH7A 3V81A 3E01A 4OHZA 1V3SA 5LSRA 3M8QA 4PXDA 3MAHA 4Q0BB 1RT1A 5LXRA 2OO4A 2RD5C 1N5YB 4EYIB 2RT3A 3D1QA 2RKIA 5HBMB 3HJFA 3CDWA 2QLWA 1ZAXA 5EWEA 1Y5IB 5C24B 4BDPA 2DJWA 3NCPA 3DRSB 5KG2A 3NLCA 1MMDA 3OTEA 5HROB 3D54A 4OX9F 3V6DA 1C1CB 1W2BR 3PW2A 1OSDA 1RT7B 3FVYA 2IM1A 3RBEA 4UOCA 4NLSA 5E3CA 4QIGA 3OUYB 1OO0B 1GXUA 5CYMB 5KT6A 4HDGA 3OJSA 1YVFA 2IA6A 4K5SA 2CPZA 3FSXA 3MPYA 4B3SF 3H2UB 3K5PA 1WHYA 2IHR1 4KO0B 1HBUB 2YWFA 2V2KA 4Y2MA 4KTQA 2OD6A 1FRMA 4IG0A 1P6TA 3AY0A 1T94A 3IC1A 3B4MA 5E3PA 3MM8A 5G4DA 4YDDB 1VOMA 4K4ZA 2AW0A 2BRKA 3MMAB 2Y1JA 1NJXA 2DGXA 3D2WA 4DV2F 5JUMA 4Q5VA 1QAIA 4F3QA 2Z4PA 3TVYA 3K5LA 4FVMA 2MY7A 1GNKA 3BREA 2D9OA 2X1GA 1DFDA 3AAWB 2YKMB 3CCQS 1MMLA 1UAWA 2DHGA 4DSIA 3RRGA 2J0WA 2LXUA 1CEZA 2QSFA 4A8OA 2MHNA 2KDOA 5CZXA 1UW4A 4QOTA 1MW7A 1R0AB 1EETA 1Z4UA 2LA6A 1UWBA 2MDAA 1RTJB 2KJWA 1R8PA 3MEDB 1X4CA 1KHVA 2CJAA 1JJHA 4G1QA 3SFUA 1D9FA 1JXLA 2R7UA 2QMXA 1ZAWA 3MMBA 2ATLA 2W9BB 4KQZA 1QSSA 1F9FA 1VBXA 3VF0B 3CIZA 3LPYA 4ILRA 4DL3A 1OWXA 1NH8A 1HNWF 2EC0A 3IR5B 1SI9A 4RWXA 3BO3A 2X3GA 4ZCMA 2V8DA 2RRAA 2M3DA 5C5JA 4ECWA 2CZVC 3JSMB 4C8ZA 2DR8A 3IGVA 2RU9A 3POTB 5HMWA 1VS3A 2BANB 5DGAA 3PNIA 4ZHRA 3N6NA 3QGPA 2E5GA 2MJNA 3C6UB 3FRYA 3OTDA 5DS7A 3RRKA 3ZZZA 2A2DA 4IH7A 3VAKA 5D3GB 5KFPA 4B08A 2CPFA 2EBGA 4PCQA 2P9CA 3H8YA 1K0VA 2R2UA 3Q8RB 3AQOA 2ZH5A 4MKYA 4HH1A 4QBUA 3G8TA 3B78A 3TVZA 2MPUA 1UKUA 2DPJA 1F2GA 1SBRA 3G86A 4MYUA 2KFNA 4CO5A 1DARA 1S9EB 2XG8A 3IO1A 1VQ9S 3ISZA 2ZKTA 1Q53A 3CJKB 2IFXA 3S01A 1UMJA 3HDSA 3SI8A 1N4LA 2FJXA 2FUG9 2GA7A 2NLWA 3TR5A 1NKCA 3Q8QB 1FDAA 2Z2MA 3SQGB 3MUMP 3OJUA 2HHSA 2RRNA 1E6VB 3LUYA 1X4HA 4DFJA 4Y34A 1S7HA 3OR2B 4Y3CA 2GMJA 3CCJS 2CPEA 1Q79A 2FPHX 1V6HA 3QIPB 5C25A 4QW9A 3KJVB 3T5HA 4B3OB 1U1OA 3CD6S 3EGWB 2MQOA 3CVKA 1JLGB 4JI8F 1T3NA 1K8AT 4KT0C 3MEGB 4QIWD 1U24A 2L9NA 5GAEI 4ETXA 4TLQA 5GADU 1U45A 2VBWA 1VI7A 2VC0A 2HLTA 3K58A 2ZJPQ 1LFPA 2E5JA 5F41A 1URRA 2W4PA 2KYXA 1VQKS 2MJUA 2ZDOA 2NUUG 1ZM4A 1GXTA 4IR9A 2ZOFA 2XNQA 4A8KA 3FEXB 3PFEA 4K4VA 1SV5B 4F4YA 2OLWA 2V4JA 2WONB 4ZVFA 3BS9A 4RNFA 4EEYA 4FBUA 3T3FA 5J2NB 2G13A 3NCRA 2NS1B 2EPIA 4K2XA 2VQFF 2R4FA 5E7OB 2M8DB 5IM0B 4XDCA 5DDPC 1S0NA 4C8LA 1NU4A 3FDSA 3KG4A 2ZOGA 4DSKA 3S8SA 2R7VA 1B0TA 3N5BA 5FJ4A 4Q2MA 3GG1A 3GFZA 3KLHA 4A8FA 2ILYA 3DOLB 4AUKA 3KG1A 5CA5A 2HNZB 3C8YA 4EO6A 1YJRA 1JLEA 5A0YB 2XY7A 4DV7F 1LXNA 3J7ZT 3OXFA 2DNMA 2V8HA 3HZEA 3FEYB 4DR6F 4MJKA 2Y0SD 3OV7A 5LSOA 5DQGA 4ED8A 1G1XA 3GR1A 4FBTA 3MWBA 1Y3KA 4LVOP 1M0SA 1RT3A 1JLQA 1U25A 2ZKUA 3DRPA 4H4OB 4I7FA 3J81Y 3HK2A 1XWLA 5EUHA 3NWGA 3CD0A 4C8MA 3CULA 2ZD1A 1HNIA 2W9CB 1RT6A 2LVWA 4K59A 2BA9A 1NJZA 4ZA1A 5KG5A 3GFHA 2OFGX 1KS2A 4LF6F 2OSRA 2PI5A 1WF1A 5BYQA 3UW1A 1BGXT 4DV5F 1KC8T 4Y00A 2FHOB 3T6JA 4RU2A 3G9CA 1JX4A 2RH3A 1KN6A 1M5HA 3M8PB 2XMWA 5DETA 3T1YF 2XY5A 3TA1A 3OL6A 1TKTA 2LQ5A 2ROGA 3H5UA 4EWTA 4ECQA 1N6QA 3ZZ0A 2G0CA 1L5UA 1Q7YT 1TL1B 2MQNA 5CCLA 4Q44A 1Q7LB 1YBAA 1WD6A 4DR3F 4I67A 2FLLA 2WSEC 4O4GA 1Q81T 1ZM9A 5K8OA 1LWFA 1T05A 1R6YA 2B5JB 2C2EA 3IRXB 4IR1A 2X51A 2KHDA 1DAXA 1LK5A 2K1RA 2CPXA 5B08A 2RNEA 3CTRA 2GGPA 1L3TA 2DPIA 1DTTB 3HVTA 1YITS 1JLFA 4O44B 3IS9B 1QE1B 5KT4A 3MR2A 4NA3A 2QEXS 2K7JA 2QV6A 2HHTA 5I42B 2WCXA 3K59A 2LCWA 3BSOA 1LWEB 3SSQA 1LWCA 2EBEA 2HWHA 4DL0C 5JVHQ 3NNCA 2KZZA 3MF5A 3NBPA 3J7YI 1DZ5A 4I68A 3RR8A 2FJBB 4F67A 5KT7A 4ERDA 1LK7A 2QT7A 3RAMA 1EP4B 2R7QA 2RKIB 2BV3A 3MM6A 2HHWA 2MGZA 4Q8EA 3HHEA 3MD3A 4B9LA 1JLAA 1VFJA 4EUVA 3THVA 3LGMA 5KAKA 4AFFA 4Q8FA 1VIXA 2N4DA 1FKOB 3VQSA 1AW0A 4DLEA 1U1QA 2CZ4A 2WTFA 5FIIA 2L9WA 4ZVGA 4YY3F 1GH8A 2GHVC 1VC6A 4MH8A 3UCGA 4IFYA 2OPPA 3MUTP 3OTCA 4I4BA 4F02A 4OZ5A 1ZAVA 3OL8A 4ECRA 3PM9A 1HWJA 3TAQA 2NSCA 5E3AA 4ED3A 1FESA 2V9WA 3N79A 1XMOF 3DLKB 4IG0B 3K57A 3DCAA 2ZHAA 3QWPA 4F26A 4FS1A 3D0IE 1SUQA 2ASLA 5HO4A 4MIBA 1T8EA 2AD9A 1VJWA 1TVRB 1BC6A 2YNHB 4LVNP 4PG7A 4FZVA 3DM2A 2AJ0A 3I0RB 1MSWD 1DLOA 1R7IA 2OMLA 1WEXA 2XZWA 3ETOA 1KNZA 3GZ7A 3K5OA 3T1AA 1QJHA 1Y4ZB 3HLUA 2UXDF 3KNAA 4M1KA 2LLZA 4UQTA 1HHTP 1UWBB 2DITA 2R7TA 2O01C 2JC0A 3HHLD 3I56S 2VH7A 3BEGB 2RQMA 2PE8A 3QIDA 2HFOA 5A8RA 2OJ3A 1JLBA 2KN4A 1S1XA 1VQ6S 4KSEB 2GW8A 1X9SA 3FGVA 1C2PA 2QIFA 3NMAA 1DURA 4L72B 3WZ0A 4J9NA 1U7LA 4XO0A 5F0UA 3N5FA 1BQXA 3H5XA 3LALA 4LJMA 2R2TA 1UVKA 3AB2B 3TUIC 3ZZUA 2EWHA 1IKVB 4EZ6A 2HHPA 3BGRB 5KFFA 3M2RA 3HHKA 4TY8A 2LEBA 2ZUGA 3CJ3A 3DLJA 4H4MB 4WCEQ 2J9DE 1SJ4P 4C8OA 2D74B 3KG0A 3QPIA 3HZGA 1ZPVA 3JSRA 2KU7A 3OQ2A 3KKFA 2DGTA 4ZK7M 2IVFB 4OJHA 1F5AA 3SEOA 1C0UA 3HHLB 3HKZD 1SKSA 2K8GA 2O66A 1ZTTA 2KHCA 1LKZA 2C42A 1Y00A 3L3CA 2WRMA 4RW4A 3B8HA 3C66A 4A8WA 2RQKA 5F3ZA 3JTNA 2FGOA 3OFEA 3AJ2A 1W25A 3DDKA 4E0DA 1HBNA 4QR1A 3RB6A 5FLXY 4KFBA 2WAQD 4PR6A 3T9ZA 2D3ZA 3JTOA 3UR3C 4OJ3A 4OLOA 2GIQA 2YNFB 3MURP 4QIFA 2MKJA 1HI1A 2HYIB 2MZQA 3CUNA 3N6LA 2HNYA 3KLGB 4ZVEA 1D8YA 5K8NA 2VB6A 1S77D 5DLGA 2J9DA 1WEYA 1RT4A 1VBZA 4KHPF 4MIAA 2IRUA 3M05A 1YI2S 3DOMA 3SCIE 4ELVA 3KYLA 3MMCA 4NA1A 3HM9A 4J9MA 4TKTA 1ZH5A 1YJ9S 2FDNA 2BBEA 2RF2A 4EBCA 1YJWS 2MYFA 1R8HA 3TOQA 4CO0A 2FJWA 1A7GE 4NL5A 2IYIA 1FD2A 3RBDA 1LW0B 3I82A 1N56A 1H38A 1H2VZ 4D3HA 4XK8C 3IR6B 3KTQA 4J9OA 4DSEA 3KLFA 1VQLS 4AQYF 3RAXA 3MGJA 4IRKA 2UVUA 3QMQA 4ZP7A 1HI8A 2KXFA 4BWMA 3BGLA 2YNIB 3QZ8A 3QJPA 1VK3A 5HI7A 3FSIA 5DG8A 1FNOA 3SV4A 3M2VA 3SYZA 2G1DA 1U1PA 5K14A 4MTPA 3UCUP 2M88A 2DNZA 2AV5A 5ADZA 1VQ8S 1FA0A 3DXBA 2HNDB 3FFIA 1DQ9A 4WJBA 3S1TA 1UEVA 2IAJA 1S1UA 1F0XA 1FTCA 4ZPVR 5DQIA 1OPIA 4NRUA 2PT0A 1XR5A 2V8GA 5B0EA 2HRUA 2YTCA 2EFGA 4DG1A 4JV5F 4JOUA 2DCUB 4DLGA 1BQNA 3DHWC 3OVBA 3PEJA 5A8WA 2DK2A 4ALZA 5AE2A 5M2UA 1K9MT 3I96A 2KI2A 2CQCA 1N36F 4U7CA 4NLUA 5F9NA 2DIVA 5K8MA 4WKYA 1W2IA 4YHHF 1IKYA 2VG6A 3R27A 2ABYA 3MTJA 3T6BA 2DO0A 1HNVA 4NZ7A 5GADI 2E5HA 3IBWA 3DRPB 1FCAA 2BOPA 1JK9B 5KFBA 4DL5A 4WYWA 3CCZA 3DI6B 2NYIA 3OW2R 1JIHA 5J2QA 3OR1A 4JI5F 1KRPA 4OI2A 2DH8A 1XC9A 1HNIB 3OFHA 1HR0F 4G1IA 1IQZA 1HW9A 1TP7A 1U2FA 3I5AA 4RX6A 4O3NA 1FKAF 4IOAQ 1KONA 4O3PA 5F9LA 1R89A 4DQRA 3JSBA 1CPZA 1XERA 3W2WA 3V6JA 3L7OA 4RUAA 4ZP8A 2ZE2A 2EFNA 4LSLA 5L9NA 3T1HF 4ELTA 3IG1B 3DLGB 1N0UA 3PW5A 1MROB 4JI1F 3E2EA 1RGVA 3D1HA 2KZMA 1HBOA