4AQYF

Structure of ribosome-apramycin complexes
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
total genus 19
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4aqyF00
4DV7F 2RJZA 4JI6F 4JI3F 4B3MF 4DUZF 2F4VF 4X64F 1IBMF 4LF8F 4GKKF 1XNQF 1XNRF 2B7CB 2HHHF 4DR5F 3T1HF 4NXNF 4DR1F 2UUBF 4DV6F 2KJWA 3ZZPA 4KHPF 4JI5F 1IJFB 4DR4F 2UU9F 4JI1F 2E5LF 5LMUF 1IBLF 4X66F 4JI4F 2ZM6F 4DUYF 4LF6F 4JYAF 1HR0F 4JI2F 4DR7F 1FKAF 4GKJF 4DV2F 5AJ3F 2BVZA 4OX9F 1FJGF 1HNXF 4DV4F 5BR8F 4LF7F 2B7BB 4LFCF 4LFBF 1IJEB 4JV5F 1J5EF 1CQMA 4YHHF 4X62F 1XMQF 4LF5F 1GH8A 1HNZF 4B3RF 2BXJA 1XMOF 2UUAF 1N34F 1F60B 1QJHA 2YY3A 4DR6F 2UXBF 1CQNA 3OTOF 4DV3F 2UXCF 5IWAF 4JI7F 1G7CB 1HNWF 1G1XA 4LF9F 2VQFF 4DR2F 2UUCF 3R3TA 4JI8F 1N36F 4LF4F 5LMNF 4YY3F 1B64A 4DV1F 1LOUA 3T1YF 2VQEF 4NXMF 4B3TF 4DR3F 4JI0F 1IBKF 4X65F 4LFAF 4AQYF 1I94F 2KJVA 1N33F 1N32F 1VMBA 2J5AA 4B3SF 1RISA 2UXDF 4DV5F 4K0KF 4DV0F
chains in the Genus database with same CATH superfamily
3LW5C 4C3LA 1T0TV 2K1RB 4LJMA 2ZBQA 4HVZA 4F0KA 4OLPA 3TAPA 4DFKA 3RAQA 5CZXA 1R8PA 3PFOA 4K5RA 3BPDA 3FFIB 1KLMB 4C0BA 2CZ4A 2PO4A 5IS2A 3G4SS 5M2UA 4TXSA 4CO0A 4CP5A 1HBUA 4ITSA 1S9EB 4KR0B 3ET6A 4RLEA 1BQMB 3MTJA 2SXLA 3I0SB 4F4KA 1DTQB 2KFYA 2HLUA 2Y8YA 4JBCA 2LEAA 1A0OB 3O8WA 3MM6A 3CCTA 1G3OA 2D1CA 1NK4A 1S12A 3C6TB 3N6MA 2YWHA 1PC4A 2HEKA 4K8RA 2ZH4A 1WDDA 3K7RA 5BYSA 3MMCA 1YZ6A 1RAHB 1JXLA 3MEGB 1U0HB 4E2FB 1T8EA 2AX0A 4QIWD 1RACB 2VDIA 1HQEA 4DXLA 2FLPA 3MM5B 4JUZA 1NLKL 4WIQA 4J9MA 2CJXB 1VRQC 1PBUA 2KVIA 3NGRA 4F67A 3MEEB 4C3KA 1IWGA 4OZNA 3MUMP 2UU9F 2K06A 2YNIA 1SH2A 4ECUA 3DDKA 2F8MA 3D0IE 1FKAF 3GSDA 3OR2A 2BABA 3BB5A 1JXVA 4RBTA 4KFBB 2X3GA 2GVDA 5KFKA 2GNKA 4WE1B 1WOPA 1R8BA 1K0TA 4ZS6A 4LFBJ 4NLWA 3MEDA 4WFAQ 5LSLA 3CCRS 2LEBA 3NNAA 3G8SA 2UUAJ 4WBFA 4DL7A 3R8YA 1RKJA 1HWIA 1F5CA 3W5XA 1YJNS 5A76A 2NYIA 2B56A 4ELVA 2MYFA 2UUCJ 2MLYA 1RBOB 4RW4A 1RABB 4FXWA 4HYKA 3RYLA 2VASA 3GCXP 2H5IB 3G6YA 2VJUA 1M5OC 1PAEX 2GJIA 1JLAB 4H4OB 1KRPA 1L3VA 2KI2A 5E2QA 5A8RB 3TJ8A 2H48B 1CBKA 3J7YI 1PYOB 4J9LA 4CLTA 2J9CA 2FJVA 4ID5B 1P9YA 1X5TA 2DH9A 2MMYA 3G87A 4HKQA 5A8KA 4Z7YA 1Q8IA 2DNNA 1FHTA 3HVAA 3VAKA 1C0UA 2HURA 4K4VA 4IFYB 3EGWB 4TYAA 1LWFB 1F1BB 3IBFB 4H4KC 5KFYA 1K8AT 3RUBL 3V4MA 2WSCC 1PIEA 2EKYA 2XI2A 1F0XA 2EW9A 2C3PA 2CQBA 1XMOJ 4HACA 4CLUA 2VQFF 2CPZA 3K2YA 3QZ7A 3W2WB 4J9OA 2RILA 1I3OB 4FYVB 4RW9B 3HXMA 2MZQA 2V34A 3VCDA 3V6DA 3WC2A 4EZ6A 2IRYA 4G3IA 4FPIA 3M6WA 2HQIA 3NOGA 4MIAA 1FJ7A 2AIRB 3QJLA 1S7IA 1N33J 3OXLA 2GAGC 2UXDJ 2MB0B 3I32A 2KFZA 1FRJA 1VK3A 1U2FA 3MPUB 4NZ0A 5C42B 1LEOA 1O0PA 1RSCA 3HX9A 3VVTA 3T9NA 4AE5A 2DBBA 1X4HA 2HHHJ 4ED3A 4FF3A 3MFHA 2UUBJ 3GYNA 2Z0GA 1UP1A 2MQ8A 3C6UB 2QL7B 5CXTA 1EB0A 4GO5X 3JYTA 3MR3A 2WTFA 3H42A 4C11A 1EQ0A 3G6VA 4AFFA 2X1FA 2VG6A 2OPPA 3OTOF 1DY3A 1BHNA 1E6VB 4Z37A 2MHNA 4F04B 4QQBA 1U2RA 1S6QB 1W26A 3SV4A 3SEOA 1HWKA 4DPOA 4F4WA 1U24A 2BKNA 1D1UA 2I1RA 4LIRA 1YBUA 4M8LA 4LUBA 2NSCA 1IBMF 1F2GA 2DRDA 3KNAA 3KKFA 5E5NA 3A12A 4HT7A 1NSQA 1PYSB 3AD8C 2JLGA 3W63A 2DEJA 4DLGA 1RWKB 2FJEB 4KBIA 1YKWA 2ILYA 1SC1B 1VBKA 2MKIA 2CQHA 2OAUA 2YWGA 4TLRA 4WFXA 1NDLA 3NCRA 4YHHF 3TZYA 1XMQF 1ZM2A 3M2VB 1G4CA 1N54B 2CXEA 4DV2J 2O3DA 4B9TA 1F60B 2Z56B 4EI2A 5H9EJ 2BQ3A 3CCES 2KZZA 4E0DA 1WC0A 4WZMA 4UW2A 4O0IA 3J7A1 3CD0A 2VIHA 2QFJA 1RT3A 1ZA2B 1TVRB 3GILA 2CQIA 3TUPA 1J5OA 4O23A 2IDEA 1RHJB 1LV5A 3MWBA 2E1CA 4G1IA 4C8ZA 2BW2A 3POTA 2RHQB 2IY5B 4G6VB 2AYBA 2BV3A 4QWAA 2XTJP 4P2FA 2HMIB 4X64J 4QWBA 1A9NB 3PTWA 2A3JA 4YB5A 3I9ZA 4CYUB 3DHWC 2BZ2A 1RWUA 3QJJA 1XR7A 4C8MA 2HNDB 1NB2A 2OIHA 3LP2B 3QSIA 4F4XA 1FDNA 4ED2A 1LW0A 4NEYA 1DQAA 4LBPA 4KPYA 1REVA 5J2NA 1S6OA 3ILIA 1XN9A 5KFRA 2DGSA 3KJQB 3H5XA 3C14B 4DV3F 3N6NA 3VGUA 1K44A 3BM7A 3UDCA 1VQ5S 3HO1A 3BGRB 4BLGA 2OSQA 3SZ2A 3RU0A 1N4LA 4GVBA 2WW4A 2HZVA 3GJQB 3EVWA 3K5MA 4CNZA 3O1LA 1T9WA 3MMBA 5E3AA 1SKWA 4UUXA 1TKXB 3BO3A 1T11A 3N0VA 1QAIA 3CDWA 3HSZA 2AYEA 3DU5A 2GA7A 1Z1ZA 3OHBA 3CB4A 4EO6A 1SV5B 4R5PA 4FBUA 1X8DA 2HHQA 2DNMA 5GAGU 2VFTA 2JVRA 3JSYA 5J2PA 1UW4A 1NK8A 2JWNA 3KJNB 2FHJA 3H5YA 1CSJA 1Q78A 3DOMA 3VHQA 2XNRA 1N88A 3DLJA 2BM1A 1CQMA 4EFAC 4LF6J 2ALYB 4KAIA 5A8WA 1M1GA 2EBEA 3IFEA 2DYAA 2FTRA 1NHKL 3W2VB 3L3CA 2IBOA 2YPYA 1IKVB 4YY3F 1K0VA 2LCWA 2ABYA 4YMEA 3PRVA 1SUQB 4PUOA 1JLGA 5I3QA 2YKNB 2XI3A 4RW6A 1R89A 4DU8A 3A8KA 4H4MB 1RT5B 3M32B 2ATCB 4TNOA 1WUUA 2J9DE 4O3OA 4DU7A 2YWFA 4XDCA 4PKDB 2GGPA 1S9GA 3V6JA 1YITS 4CT8A 1FTCA 3LAMA 1U4BA 4PQUA 2Z2LA 4C4WA 3B82A 3FRYA 4JI2F 3CJ3A 3QJPA 4I67A 4MIWA 3P6YC 4F02A 4L74A 3KLHB 3NGTA 5GVQA 1HNIA 2DTJA 5KFVA 1WEZA 3QGGA 4WK3A 1M5SA 1Y5NB 3CTRA 3N4WA 3UN2A 4XDDA 5ADZA 1RAEB 3QZ8A 4K50A 5F0UA 3Q83A 4BC7A 2ZNYA 2L41A 1NPRA 3KXDA 4DZDA 4LRAA 2HQDA 3W8GA 4IO1A 1ZYQA 4BCAA 3OLAA 5D0GA 2BKOA 2CQGA 2VQEJ 3MCOA 3N5FA 1Q8LA 4X65J 3P96A 3I4HX 3IGVA 5BXIA 1Y4ZB 4WFNQ 2EFQA 2IMWP 4XPEA 2GC8A 1KQFB 3H5SA 4LVNP 3T1HF 5DLFA 1Q79A 2B4UA 4DL0C 4IG3B 5MAOA 1LW2A 2N7CA 3FSXA 5KFEA 4HHJA 2PT0A 3GFZA 2QLBB 3EM1A 3ITHA 4NYOA 3ZXWA 4DX6A 4DG1A 4IRDA 1JLFA 1X5SA 9RUBA 1ZPWX 5F3ZA 4OMFG 2OMLA 4PEOA 5CCLA 2Q6CA 1I6JA 2XG8A 3THTA 2AMCB 2PE8A 4HDHA 3DRRA 2HRUA 2HHSA 3CVKA 3ENAA 4GRSA 3SFUA 4QBUA 8ATCB 1TUVA 2R8HA 1OSDA 1BQNA 4NYZA 2JHEA 2HBYB 2QN6B 1JJCB 3TAMA 3RB3A 4LF4J 1RT7A 3R5DA 3LAKA 4ETXA 4K0KF 1FRLA 3ET6B 1ZOTA 3WDOA 1JJHA 4CLFA 3TZWA 5KFWA 2G2OA 2B7CB 1CJTA 2JEIA 3WX8A 2W9BA 4ZP9A 3TNVA 4XPCA 4CO4A 3OTEA 4LRFA 4WIIA 3ZZUA 2NXJA 3CF5Q 3N01A 2E44A 3DRPA 1KHVA 2CQ1A 1TP7A 1JLCB 2BRKA 1KTVA 4HHHA 2OFHX 2WONB 1FFSB 5AJ3J 1CJUA 2AX1A 1JLBB 1FA0A 4I64A 1NO8A 5MLCV 3F56A 3CCJS 3D7SB 2R7SA 2E1MC 1X4GA 1YTYA 2HWIA 4YB7A 4U96A 4ZVHA 4PWDB 2YNIB 2DR9A 1BUXA 1UA0A 1KKHA 4C8NA 4CTAB 2J7WA 1OY6A 4RR5A 2B3TB 2HGMA 2OLWA 1FNMA 2F5GA 5HBMA 2R4FA 3PYGA 5AE1A 3LGMA 4RNNA 2W24A 1RU2A 3FCHA 1R27B 1Y7PA 2C3UA 2P6SA 1KNZA 1O51A 1FXRA 2W1BA 1HPZA 2HK3A 4WTYA 3SDEB 3ULHA 5CAAA 1HR0F 5GAHU 2NPFA 2A1BA 1GXUA 4ZVTB 2ZOFA 5J2MA 2Z8QA 1VHFA 1HQUA 2C2MB 4X62F 4RW4B 4QWCA 2QYCA 1Q5YA 3VAIA 1WG4A 4OX9J 4OZ1A 5AXNA 1DARA 1IWAA 1Q95G 3M6XA 3DLLQ 2Y1RI 1S0VA 2ZH2A 2XHCA 2V2QA 2MY7A 5K8MA 3Q8QB 1NKEA 2FJWA 2DXEA 3H5UA 1TV6A 4A4JA 4WP3A 2RF2A 2YKPA 3W9JA 1IBKF 2OO4A 3IBWA 4DSJA 2RMLA 2AQ4A 4DI6A 5DZ7A 2QMUB 2B6AA 4ZN3A 4R0EA 1C0UB 2MGZA 4Y0FA 4AQYJ 2N82B 3MEKA 5D0HA 2C2RA 2ZBRA 2R2SA 2VPZB 2MQNA 2RD5C 4EMDA 5DDPC 2H1YA 1FNOA 3ENQA 3PZPA 3TOQA 1UZDA 5ETLA 2JRSA 3DLKA 4OYIA 5LJ5Y 4RU2A 2JFDA 3H7HB 4DQIA 5T7LB 3AOAA 3S6EA 1HD0A 2XMUA 2W01A 2DH8A 1TL1B 1S1VA 5HMYA 2J9DA 3BEGB 3KG0A 2E7VA 4NLGA 3BH6B 3CO0P 2B9WA 3CGIA 4KY3A 2D9OA 4DCOB 3EXCX 4AL7A 1CC7A 1Y5LB 1CS4A 1XEZA 4C0HA 4LFCJ 2H4WB 1NU4A 4A46A 2D3UA 1GEHA 2E5JA 1B4SA 2VA3A 1URRA 1UWBB 3T6BA 2WVEA 3M30A 4ZDNA 3PV8A 3D54A 2W8LA 3KTQA 3AT1B 1U49A 2HQFA 1S4EA 2CZVC 1KVIA 2JJ4D 4C11B 3MPWA 1L3KA 2HBZB 3EGZA 1EP4B 2QV6A 3LGHA 4USWA 2LQBA 2IM3A 2CKWA 4KB7A 2YWWA 3HFZB 2DGVA 2GMHA 4C8KA 3LH2S 3IG1B 3KYLA 4O4GB 1NPKA 2K7JA 4KQZA 4UZCA 4LQ3A 2EFGA 1RBAA 2HQ3A 2KG1A 1XJWB 3D4JA 4JV1A 3QATA 5KFMA 1U6ZA 1X4BA 2E1AA 4WXOA 1T05B 3KLIA 4AYBD 1SH0A 2MSTA 3NRBA 2WHOA 2GW8A 1J5EJ 2ZH1A 1BGXT 2ZC3A 3VAMA 2JC1A 1T03A 1AFIA 1QUVA 1H98A 1S6UA 3ZTSA 1CJVA 1EARA 5A0YB 5L1IA 2UXCJ 3HJVA 4P73A 2DNQA 4V19J 3PCOB 2QA4S 1P8GA 4NASA 2Y0BB 5A2QY 1XK8A 3NAIA 5HJYA 4J7CA 3BKUA 4G1QA 1S49A 5KFSA 1SQEA 2CIMA 3KLGA 2HBRB 4USMA 4RL1A 4PPZA 2R9LA 2WBMA 5KOWA 2L9WA 2DNKA 3RBDA 3MXHP 3N9UC 3PO4A 4JI6J 5J2QA 5K8OA 3NWRA 4IO9Q 3KK3A 3GR0A 1R0AB 3MF5A 3ZZYA 2BEFA 3P45B 4WP8A 5THWA 1R0BG 3IA0A 4CO1A 3W62A 2HHTA 4N8NA 1N5SA 3KK1A 2ZZMA 2QE5A 3GB0A 2NXCA 2OEKA 2JEFA 2LXFA 3QT6A 3CW2C 2G0IA 2O01C 2ZHAA 2B7BB 2ZNZA 2G13A 4OJHA 2CG8A 3D1HA 1J5OB 2LLZA 1F3VA 4TU9A 4FVCA 3BR9A 2IDLA 1GXTA 2I5JA 1BWEA 1WEXA 4P2MA 2PIIA 1JJ4A 3DRSA 1RKIA 3M1VB 4FS2A 2C3OA 3BYRA 2CG4A 2VZ9A 2OPRB 4W98A 2KT2A 2AEMA 4Z2XA 2N7YA 4ES2A 3UCUP 5BJRA 2DRBA 2YKOA 2BJ8A 1WI8A 1QVGR 4IRKA 1V5VA 1LW0B 1P6TA 1PJ7A 2XMVA 2V50A 4EBEA 4JI1F 1JLQA 2ROPA 1KTQA 4DR5J 1RHRB 4OYZA 4UT4A 5HN0A 3BSCA 3M8YA 1MW7A 5C2GA 2GFFA 3DI6A 2HHPA 1WHYA 3QYYA 1SQGA 3PRDA 2MKJA 1TKZA 4FF2A 2BE7D 4RUHA 3GWCA 2IC3A 3R6GB 1S1TB 4M5DB 4RNMA 3L95X 2FQQB 2AJFE 5IQ6A 3CJKA 2M5YA 3EVOA 2IVYA 4DSLA 3RW6A 2DIVA 4LF9F 3OR1A 3VAJA 1O8BA 3TUZC 4N41A 2CWXA 4ZVRB 5F8JA 4R5PB 5JXSA 1HI0P 1OYDA 1RWVB 5J2PB 3L09A 4ICLB 1V3SA 1BMQB 4PG6A 4CLSA 1YIJS 4DUZF 1T9TA 1QTMA 1RK8A 5F8GA 5M2RA 1VOMA 3EJMA 4PXEA 4OI6A 5KFLA 3JS9A 4MTPA 3ZZPA 2J7KA 3G71S 2XZTB 3VWSA 3MPDA 8AT1B 3RB4A 2R8IA 5G0RA 2BX6A 2DIUA 2ZVIA 2IRUA 4B3OB 2W8KA 3IR5B 1F5AA 3CUNA 2G1HA 1CQNA 1SJ3P 3SSRA 2WVBA 2NLWA 4RW8A 5GMKa 4LF5J 3LWMA 5HQLA 2F7VA 2MKYA 2XLIA 1NH7A 3DLEB 3RR7A 3PRBA 2UVWA 3C15A 2W9AA 3AH6A 1TUWA 1AZSB 3SXLA 3ZO7A 3GYGA 2DNRA 1C1CA 3GV7B 4NMXA 2F4VF 3FZ2A 2VL1A 1HNIB 1OJ4A 4I6YA 4WYLA 3J80Y 1TFYA 1IVZA 2B0GA 2MLZA 4IRCA 3SMZA 5DGBA 1DJ0A 2XY6A 3LA0A 2CQ3A 4A8MP 3MAQA 3AA9A 3NEKA 3MAAA 5K9FA 3PX6A 4USHA 5HO4A 3HD1A 1N5YA 1WC1A 3VVUA 1VLYA 2D7SA 4OZ3A 2MJUA 2LEPA 4WU3A 2XNQA 1QE1B 3M8PA 4ZPAA 4DZ6A 4DLEA 1HBOA 1FK9B 1AA1B 5HL7Q 2XYPB 2F65A 1YZ7A 1SVDA 2DHAA 1KBRA 4ZCLA 1SL0A 3W64A 5D3GB 5KFHA 1BD6A 2HVDA 3QO9B 2XBPA 2OEJA 2ZOGA 5D0RA 3CCSS 2VH7A 2VODA 3LPYA 1JJ2R 1YQHA 3QFWA 4M63A 2RJZA 1K73T 5ETMA 3HI9A 5L1KA 3PY8A 1JLFB 3UDEA 3NOCA 3NGSA 3BGFA 1HNVB 2IJFA 4PPDA 1GMUA 2GCFA 2QL9B 4NA2A 3VV2B 4ZA1A 1IJFB 1U2CA 4FVMA 3HD2A 4QYZK 4KHRA 3CPWR 3TQ1A 5DETA 2ZH8A 1YJWS 3BJYA 2ZJRQ 2KXFA 3BF4A 1BLUA 3HFVA 3FRZA 3TA2A 3Q22A 1SPBP 4F3QA 2V2KA 3AD7C 1VRTA 1IR2A 1KLNA 3DXBA 4PXDA 1FJCA 5CH7B 3GFXA 3T5JA 1JLEB 3GJRB 5DG9A 3B4MA 3KJFB 3R5CA 3IS9B 3U1NA 1CJTB 4DSIA 3M2RA 4ZVQB 4K4XA 5C24B 3S1TA 2L3MA 1WI6A 2BQUA 4O44B 2HK2A 4K4YA 1I94F 4RX6A 4A48A 3R5AA 3DRPB 1GXLA 2HQGA 2DGQA 4FXDA 2LDYA 1Y00A 4GVLA 1FWLA 4UOFA 2COLA 1SKUB 3H8YA 1TZ0A 5ETTA 4A8QA 2XQCA 4DF8A 1FRHA 3D3CJ 3JB9k 4CLZA 2OFGX 2H5JB 1VQ6S 3R2CJ 3E8OA 2J7UA 4LF8J 4BWMA 2VFRA 4MFBB 1RGVA 1KLMA 3QIPB 4LR7A 1WKLA 2MPUA 3KNGA 1VQNS 3G6ES 5GAEI 1QSLA 1H38A 3TA1A 2KG0A 4NRUA 1BQMA 3IO1A 4RNHA 5F41A 4MKYA 3I0SA 3IRXB 1DTQA 3EUNA 5AXLA 2KL8A 3LALA 1Q82T 2ZC4A 3KMQA 3C6TA 3I5BA 4DR2F 5K5MA 1N36F 3BKTA 1JQGA 3DYAA 2BANB 3RAMA 4DFJA 2J0QD 3ELHA 5LJ3Y 1HNXJ 5HMXA 1UVKA 3MEGA 1U0HA 2FVCA 5LSRA 4ZITA 3HHLB 3JQMA 4DV1J 4LRCA 1H7XA 2BQRA 2N4DA 3HSJA 4B17A 4DPTA 1UEKA 3WBZA 5J2MB 2FJDB 2OELA 1XNRF 3EPIA 1RZMA 2VG7B 3MEEA 1F5BA 3CJ4A 4C0OC 3IGNA 3GV8B 3OVAA 4IQXA 1XC9A 3MM9B 2LXIA 1ZH5A 4KRWA 1DLOB 1X60A 5LMUJ 4I6AA 2R8JA 1ZAXA 1T9UA 2V68A 1P27B 1VHIA 8RUCA 3D68A 4K59A 1UA1A 3B54A 3RJMB 3I82A 4QIFA 4I0WA 5CD4A 3PR4A 4KFBA 2B6AB 1TAUA 1AW0A 2IPOB 4WE1A 5IXUA 1QSYA 3N79A 4WZQA 4ECZA 2CPJA 2CQDA 2QLJB 3A8JA 1U25A 1X5PA 2K8GA 2PFDA 4A8OA 3CDBA 1NM2A 4RWWA 3THVA 2UUTA 2CA9A 2DNOA 3W66A 1Q81T 4E98A 4X4NA 2VF3A 1UPPA 4ZVPB 1OYEA 1S1VB 5ITHA 4DS4A 2KO1A 3GTYX 3H20A 1U1NA 5GADI 3RBXA 1DFDA 3GE9A 2I8EA 1B0TA 1JLAA 4H4OA 5DDQC 4Y6IA 3FEZA 5A8RA 2F9JA 2DXFA 1NRKA 4LT6A 4ID5A 4DR1J 3G82B 2KFNA 1X9SA 2F40A 3SYZA 1HNXF 2YNHB 1PGZA 3W5YA 4OHWA 3VF0B 4Y2CA 3GIIA 4IFYA 4K5SA 3M30B 1ELOA 1LWFA 1VCTA 1EETB 1X7VA 4ED5A 1UFLA 1W7WA 2MZTA 2MEWA 5KFQA 5AXMA 1RCOB 2DGXA 3TWZA 3ENVA 5H9FK 4KE5A 4MT1A 2W2OP 2Y8WA 4QIGA 4ZHRB 3W2WA 4L75A 5DDOC 2FHOB 4RW9A 3US5A 1YJUA 4BHQA 1NJZA 3NKYA 2ACMA 2CPYA 3GJTB 4NXMJ 4J9UE 4M5HA 2CPEA 1GK8A 4C48A 3HVTB 1S1WB 3D28A 4FS1A 4GKKJ 2J0XA 4NLXA 3TJAA 4JI4F 1QUPA 5C42A 4NRTA 2PA3A 4DR7F 5JVHQ 2KYXA 2KVQE 1TAQA 1FJGF 3DMJA 1XR5A 2HYIB 3BV8A 3G86A 2NPIA 1CC8A 1FVSA 4F4ZA 3C6UA 1UZHA 2PEHA 5CQGA 4ENOA 5D15A 3PIOQ 2CRLA 2RHSB 3OL8A 3KLGB 2AJ1A 3D0HE 4F50A 4AL6A 1S48A 2RVJA 4CZCA 1E6VA 4JYAJ 1UFKA 2AWZA 3TYTA 3MAHA 1S6QA 1X0PA 4LFAF 4AXJA 2F4FA 1FEHA 4YR0A 2E66A 4LF1A 1HFEL 3DKDA 2Q3PA 3H25A 4HH0A 1HMVA 2O67A 4BC9A 1XNQF 3NY0A 4DX5A 3GLJA 3CCUS 3EGNA 3WIVA 2R7VA 3HHLD 2DNZA 2CJBA 3DRSB 1TQLA 1NK5A 7FD1A 4P9SA 3DLBA 4ECYA 2B4PA 4DMZA 2DPJA 3HDSA 2LQJA 1R6VA 1QAXA 3Q8PB 3GMGA 4QR0A 3VQTA 3MCNA 5IZHA 4FKXA 2W7OA 4HH1A 4RO0A 2AJQA 1ZPVA 3Q8RB 1VQLS 1TFWA 3M2VA 2BUNA 1HNZJ 4JI7F 1DTTB 2HWTA 1G1XA 3DHXA 3I96A 3BZQA 3TUIC 2YWKA 2KM8B 2W7AA 4NLPA 5I3UB 2JLFA 2EFNA 2KKHA 3GJSB 3A1YG 5G4DA 3CD6S 1HYSB 5GMDA 5F8HA 2B43A 1MLAA 1NB7A 5HATA 4QJVA 2VBYA 2BJ1A 3BDEA 1TVRA 1M1HA 2K7KA 3DI6B 2WAQD 4L73A 4FNIA 1WG1A 3NS5A 1LK7A 2CZ9A 3K5PA 1LK5A 3OXFA 2ASYA 1D9FA 4MJKA 2HMIA 3G8QA 1I5OB 3T5KA 2LA6A 4X66F 3CCMS 3M8ZA 4JYAF 3OR1B 4XO0A 2DGUA 2XYHB 2E5LJ 4CYUA 3KK2B 3MI7X 2V2ZA 4LF7F 3A13A 3M4XA 1IQTA 5BYRA 2HNDA 2W4PA 4KKOA 2BR0A 3LP2A 3U7JA 4Q44A 4XK8C 2RUGA 1TK0A 1RQ0A 1VQKS 4ECTA 1YX2A 1RHQB 2PFFB 3HP6A 3IAS9 3OJSA 4K2XA 2BKPA 1YRUA 2DHXA 2R7WA 4RPFA 3DU6A 2XY7A 3K89A 1IKYB 1L3TA 3DFEA 3GZ7A 4HI2A 1FX2A 4L3KA 1S7HA 4JI3F 1BY9A 1FE0A 2V94A 1FERA 5KFFA 1WWHA 2MZ1A 3FQKA 4ZJLA 4A8FA 4ZPTR 1TKXA 1LQ9A 4O3NA 1RP5A 4NCBA 4XTTA 2L08A 2NUUG 4I7FA 2I38A 2U2FA 2IM0A 1S97A 4OHXA 4UF4A 1SV5A 1JWWA 2HS4A 1T9YA 3ISND 2GO9A 4DPXA 1PC5A 2DHSA 3Q0AA 1FRKA 4NI2B 1VC0A 2QSFA 5K20B 4MH8A 1UMJA 4M94A 1DAXA 2E9ZA 4I6WA 4OZJA 1S5ZA 5IWAF 4F3OA 1AYEA 3UN5A 4ED1A 4AL5A 5J1EB 2FGCA 5HLFB 3KJVB 2H5EA 4ER8A 4MMOA 2DRAA 1VDHA 3OUYA 4ELTA 3AB4B 2A2DA 1FD2A 5ETVA 1SUQA 3J7Z5 2YKNA 2HQCA 4B3MF 4OL8A 2NZ4A 2VJVA 4B3SJ 1D8YA 4AT1B 1B0VA 2P2CB 4H4MA 4HT5A 1RT5A 2NYHA 2AU0A 3M32A 4OHYA 4KHPF 1KWMA 3HSGA 1Q86T 3QGPA 1FKOB 1D0EA 3TARA 2XYGB 4WK1A 2FY1A 5AXKA 3R5BA 1VQMS 4B3RF 2R2TA 5L46A 4LF2A 3FCWA 2F1FA 4EYHB 4YP3A 3K59A 3P5TL 4OYBA 2IYIA 1XWLA 3LWLA 5C25A 4IH5A 2NREA 4ZVOB 3EMTA 3ETMA 3RG6A 4YR2A 3OJUA 3F44A 5KFCA 2G9OA 3CWJA 1R7IA 2PN6A 2V8PA 5D77A 4PAAA 1FI4A 4QR2A 1IR0A 1RAOA 1B7YB 3IWXA 3KG1A 2MQMA 2AJ0A 1GTEA 4EBDA 4Y2AA 1R8CA 3OHAA 4PG5A 3UI3A 4EO8A 5F8MA 3IBCB 2QEXS 2ZJPQ 3J80U 4BDPA 4KPCA 2C2KB 3P3DA 4ZVGA 3ILOA 3PFEA 1HI8A 1O6XA 5E3RA 1QD1A 2KZMA 2QLWA 2EI5A 4O3PA 3MTKA 2E5HA 4JI0J 2UVRA 4NCGB 2J6SA 1XBWA 1QSSA 2UU9J 2QL5B 1W2BR 3IM9A 1SJ1A 2JNJA 1V3RA 2CPDA 4JV5F 3FCVA 4NWBA 4QCLA 3IR6B 3D3BJ 4BWJA 4C8OA 2OTJS 2OEMA 3JSBA 3VR1A 1X0FA 3M9OB 2DO4A 1N5QA 4N8OA 1MWZA 4ZJQA 4BS2A 3I31A 2FYXA 3V4IB 2W2QP 4EU0A 3UDVA 1PAUB 4DQSA 3HT0A 1B0PA 2JFKA 2E5GA 5KFJA 5D6GA 2NZCA 5EDWA 2KT3A 2BJ7A 1NCLA 3AOCA 1KQGB 1NPPA 5H9EK 1YJ7A 1UW9A 1LKZA 1UCNA 1A6LA 2RQMA 1UVLA 4RW7A 4NLYA 4DF4A 3KHLA 1HHTP 3V81A 2PI5A 4JV0A 1NHUA 1S1UA 2JLEA 4OLOA 2HNZA 3AXKA 4ILLA 4ZVSB 5D4LA 4MKBA 1FRXA 3BBCA 4U67Q 3NGDA 4DN9A 3RB0A 1NBEB 1WC6A 2MKCA 4CH1A 3DDNA 5CZVA 1V6HA 3DYAB 2RDDA 3AXMA 1I51B 5CHCB 3AAWB 1JLCA 2LQ9A 2ACYA 2JVOA 5JVGQ 2WONA 5GMEA 3HK2A 1JLBA 3PX4A 1HNWF 4ATNA 2XWXA 1HIYA 1OPZA 1YBTA 2A6MA 1B99A 4JI0F 3ISNC 3X3UA 2VQFJ 3OFEA 1TTHB 2AGQA 2C3MA 4PWDA 2B4VA 5ETPA 1AFJA 1N6QA 3QFHA 1KDNA 3K8VA 2FJXA 4CTAA 4IKAA 4FN5A 3CSKA 4ECVA 3GU0A 3NGKA 2AW0A 2L48A 4PCQA 2KH9A 4QW8A 2FDNA 3FNNA 3M8RA 3DLGB 1YGYA 4IYQA 3CIZA 3R6LB 2Z30B 1F9EB 5L1JA 1DBDA 3TQEA 3Q8UA 4ELUA 3GIRA 2DNGA 2BJEA 2XMJA 4X4UA 1HBMB 3SDEA 3LP1B 1MMLA 5K8NA 1FDDA 2FLOA 1HW8A 2VDHA 3HT3A 1OO0B 3BGOP 1FRIA 4ZVUB 1S0NA 4KH1B 4YUDA 3AB2B 2LU2A 4K7QA 2AJ4A 2RRNA 7FDRA 4I56A 3OTOJ 4QZVB 3MM8B 4IDKB 4OZ0A 3P49B 2GIFA 2ZZNA 5KFGA 2LVWA 1NSPA 2OSRA 4V1Ak 4PYDA 3PVXA 3HHNB 1ROFA 4DJBA 4DV0F 2CVIA 1RA7A 1H6KX 4DBQA 2BA9A 3C46A 2AHOB 4IUFA 2LYVA 2MQQA 1RTIB 3O5TB 4DV6F 2I9SA 1IBMJ 2Z58B 1QM9A 3RRKA 5HVFA 2RE1A 2B9YA 1K1QA 2GAHC 5T7LA 5F0WA 3ZZ0A 4Q5VA 2GV1A 3IAM9 2F9DA 1H73A 1TL1A 2VFSA 2EXUA 3CNQP 3R5JB 1S4FA 3FEYB 1U1RA 2UXBF 4DR6F 5HQMA 2JOQA 3Q8YA 4YHHJ 2XY5A 1XMQJ 4RUCA 1WKJA 1OY8A 4F2RA 4DWIA 1WHWA 1X4AA 4JI8F 1H72C 1T3OA 1TL3B 2HS0A 3QQCD 4URSA 5D78A 1SI9A 5DLGA 1Y0HA 5EUHA 3MMAB 3SSQA 3JAMU 3LP0B 4C8YA 1IN0A 1HI1A 4OJ1A 4KO0B 1UWBA 2O1PA 2X1GA 5KG3A 2DPIA 2ZFHA 4ZKAA 1IM6A 3D1QA 2XCPA 3DMJB 4URGA 2R42A 2R2UA 1AUSL 1YLXA 4M95A 3U02A 4Y34A 2E9TA 1Y3KA 4DR4F 1NNDA 5J1NA 4W4MA 2IA6A 4U6PA 3TANA 3GFYA 4BBYA 4PG8A 4KJIA 1EP4A 3CMQA 2WSFC 2BW7A 4LSNB 1SJQA 5HVHA 4A8WA 4CIOA 1EZZB 3UO0A 2DNHA 5B0AA 3IG1A 4O4GA 4UOHA 2HRYA 3QRQA 1X4DA 3HHEA 4O0NA 1T05A 1HMVB 2XWYA 3NP5A 3MD1A 1X9WA 4FYWB 1VRUB 2V9KA 1VIOA 2PMWA 3IXQA 2ZITA 4IR9A 4DV3J 5IM0A 3ONQA 2QSWA 2HGNA 2DGOA 1RDRA 3V6HA 5A0YA 2MLXA 2FC8A 4N5SA 2GMLA 3BKFA 3T6JA 3J7ZT 2LQ5A 2P5VA 4DQRA 1XQIA 2AEJA 2YBVA 4OI3A 4URQU 4R25A 2MKHA 2D41A 4OZLA 1WACA 2XO7A 3QMQA 4U7CA 4IFVA 4B02A 1R43A 1R0AA 4LRDA 2ZH3A 3CJ2A 4ED6A 1MWQA 4OI0A 1FDBA 5HROB 2FUG9 3CE8A 4DV4F 3H2VE 2HNYA 5DZ6A 1ITPA 4FP9A 2CFXA 3DCAA 1WF0A 2ZBIA 1N34F 3QBCA 1PCAA 4GC6A 3HHDA 4X2BA 3BN7A 3DNCA 2ADCA 4QYRA 4LREA 3HVRA 4K4UA 4CLPA 3VGVA 1RT1A 4RBVA 3M1VA 4IQMA 2C2EA 4KGXB 4KGVB 2J5AA 4YY3J 1NSAA 1UFWA 3PR5B 2IFXA 3VAGA 4DV7F 2OPRA 3EICA 5KFIA 3TX8A 1X4FA 1U0SA 3MURP 3BS9A 4TU7A 1ZAVA 4KKOB 1NKBA 2LA4A 3VALA 2DCLA 1CULA 5FD1A 4A8YA 4HEA9 4QYZJ 4ZPCA 2EEYA 4I2QB 1IBLF 3AFGA 2IJNA 3KDOA 2YX7A 1R6YA 3UVJB 4DUYF 3ZTQA 1GT8A 3WX4A 2BVZA 1OSCA 4M5KA 1SXLA 2VICA 2DEIA 3E51A 1N5TA 2YXLA 4JI2J 5DG8A 1YHQS 4ZIVA 4LR8A 2XO6A 1AXQA 2CQCA 2GO8A 4R0JA 3I5CA 3KUEA 2OTLS 1I1GA 1KFDA 3FSYA 2WVFA 1S1TA 4M5DA 1UVMA 2KU7A 4KIAA 4CLWA 3Q89A 3JQKA 4ZLJA 3JSMA 3T19A 4I7FB 2BOAA 2KT5A 2RT3A 2VBWA 5FIIA 1S6PB 3ISZA 1VQYA 1B70B 1SCJB 2GZOA 1VMBA 5IT9U 2M3DA 4QW9A 1QY7A 2YH1A 1IKWB 2CQPA 3M9MB 5HVGA 4F36A 4ICLA 1M0SA 1RWXB 3EVMA 3QAEA 1TL7B 3Q2SC 4L76A 2BACA 1H2UX 1OS5A 3W60A 1J2VA 4OI2A 2Y3YA 3T1HJ 2AF6A 3HJFA 2HW3A 2XLKA 1H74A 1MN7A 4PYAA 5B0FA 3OUYB 4X4TA 4J9RA 2FD2A 1VQ9S 2NQPA 4B3OA 4RNOA 1C1BA 2CJYB 1QJHA 1VQPS 2PGCA 4LSLA 3OSNA 2D74B 2Q43A 3SIPB 3OL9A 2C1EB 5HMZA 4KH0B 4C98A 3MR7A 3T1YF 3MGJA 4YFUA 1Y10A 2B9XA 2ROEA 4J90A 3W1YC 2FHMA 2CPIA 2QGFB 4DFPA 3DLEA 2CUYA 1U1OA 4OV6A 3HSDA 1AZSA 1OPIA 4PZVA 4K0KJ 1RT4B 2WCXA 2HGLA 2VKRA 2P9CA 3S8SA 2V63A 1UKUA 5C25B 2YNGB 1N32J 1SKRA 1VK8A 1KSPA 3MOJB 4EWTA 5BYQA 3PEJA 1RBLA 2GHVC 2LQ8A 3JXOA 1JKHA 1JIHA 4USKA 2ASLA 1VISA 4K4ZA 1FE4A 2Z2MA 4U7UD 4Y2MA 4YR3A 2PEBA 1K1SA 2FY8A 1QE1A 1VQ8S 1FK9A 3D6FB 5D4NA 1Q5VA 2G2ZA 3T3FA 4KGKA 5D3GA 2A10A 2ZJQQ 3QO9A 3QT8A 1HWLA 4N76A 1S72S 4HLBA 4OYPA 5KG4A 1RTZA 1RWWB 3MZIA 1TKTB 4CWBA 2HSEB 2IAJA 2VFVA 4EUVA 1RT2B 1HNVA 4P72A 2HAIA 2NS1B 3OTBA 4USJC 2V67A 5ETQA 1U1QA 1R8AA 2JEJA 1Y11A 4PXBA 2BDPA 2RU3A 1IJEB 1K9MT 2MJNA 2LMIA 5DM6Q 1HR0J 1VQSA 3JTNA 1ACMB 3J7AN 1GX5A 4QU7A 2XC9A 1F6TA 3PW4A 1XR6A 2VBZA 3ZZTA 3RBEA 4RW7B 4X62J 3NS7B 3AY0A 3V81B 2V5HG 1NJXA 3ZNUA 2ZD1A 1S1UB 5H9FJ 4IOBA 3W3SA 3TA0A 2HNZB 4EBCA 3B8HA 3H90A 1JLEA 4DL5A 2X1BA 4DR3F 3KUHA 3IS9A 3HMJG 1N32F 4TYBA 4Q8EA 5C24A 3ICLA 4O44A 4ECSA 1T7PA 3KHGA 1IBKJ 1GMWD 2GQQA 2ZWPA 4ZLNA 3K5NA 3MD3A 3ILJA 4I4BA 2M2BA 2WB1D 4NXNF 5KFPA 1T95A 1WG5A 5DO2A 1N5VA 3F41A 2CPFA 4DX8H 2DGTA 3BPSP 2IJRA 3IN5A 4MFBA 4DN0A 2EK1A 4X4VA 3QIPA 2NXNA 3PACA 4DUTA 2HFOA 1CEZA 1OIAA 4CH7A 3PKYA 4XAKA 4C2MA 1N6QB 3IC1A 3IRXA 5LXRA 4RNFA 2I6WA 3PW0A 1U48A 5KT7A 2QFIA 1VBZA 1MROB 3PNIA 2JZ5A 1NK7A 2CJAA 3Q24A 5EGYA 2MZRA 3V6KA 4MK8A 4DEZA 2AJ2A 1RHKB 2KDOA 7AT1B 2P6TA 1P9QC 3M2UB 2F63A 2ILZA 2BANA 1SBRA 3J81j 3H98A 3D1OA 4AXIA 5CYMB 1FWPA 1RAIB 2HFZA 4MK7A 4KV8B 2OD4A 3T41A 1SIZA 3HHLA 1S76D 2IRXA 1YDLA 1TUGB 3W65A 4U7UK 1WOOA 4HL9A 1L3SA 2V69A 2W2MP 4DDFA 1M5VC 3PJ9A 3D67A 6AT1B 2VG7A 4LRBA 3UWTA 2FPHX 2V8VA 5KG1A 5M2PA 1GAOA 4F8RA 4ZP7A 3MM9A 2YX4A 2MDAA 3AOBA 2P9GA 3EZUA 1DLOA 4C6AA 4PWUA 2Y1JA 4DPWA 3Q8SB 2GX8A 1H0HB 1V9OA 4P7VA 1RLCL 2ZE2B 3FUYA 1G2EA 3SQGA 1BWVA 1T3NA 1QVFR 4ANEA 2ROGA 4QOTA 5E33A 1CJKB 5K8PA 3L4BC 2BE2A 3TAQA 3J7YU 2ZH5A 4W92B 4B3TF 3ETOA 3H4DA 2EPIA 2Z2YB 2QMWA 3NCPA 2ERRA 5F8IA 5IC4B 3KWMA 1RE1B 1UEVA 4IH7A 5KFNA 5F9NA 3TEGA 2LDIA 1RHMB 2UP1A 3H59A 5D8HB 4CNYA 1FFWB 2VONA 2KB2A 2IIHA 4J9SA 3G96A 2RKIB 2EG2A 5I42A 1FX4A 1KOOA 2QLFB 3OV7A 5LSOA 3PJXA 3ZC4A 2PMHA 1N0VC 3NBPB 2ZM6F 1KEKA 2IVFB 3NMAA 3OVBA 2V4JB 2DCUB 4H54A 1HBNA 3G82A 3NNHA 5CCMA 1VJWA 3RBZA 2M8HA 3CMAS 2YNHA 3H4BA 2EG1A 1RTDA 3HKZD 3L7UA 4USIA 3E01B 1EETA 2KXHA 3CDUA 5GAHI 5HAOA 3UE2A 4EK2A 4YQWA 2D3OR 2BYCA 2GJ2A 5LMNF 3CJQA 1UVJA 1U1MA 4MAKA 4ED8A 4FDFA 5CYJA 3HCXA 2A2CA 1D3WA 1ICEB 4U9RA 3I9V9 5IC6B 4WU2A 3UDLA 4ZHRA 2HFVA 1X4CA 2GS8A 3CCVS 1AB8A 4F4YA 2VOOA 5LM7E 2CNNB 2M88A 4PRFA 1TL4A 3PYEA 4DCPB 3X1LB 2RU9A 5HI7A 4O3RA 1F9HA 4RU9A 3CO9A 2VKZG 3BH7B 5KG7A 1HHQA 4NLOA 5HP1B 3OW2R 4WKYA 5KFAA 5DQHA 3HVTA 2VG5A 1S1WA 2CPHA 2DR6A 3MOZA 4CRJA 4PR6A 1KQKA 4I2PB 1JX4A 4JI1J 3WC0A 2QA2A 4RBUA 1FDAA 2MKSA 5IM0B 4TY9A 4IOCQ 1HKAA 1S1XB 2VBXA 1TMJA 1KR4A 2RAQA 1IBCB 3H0PA 2ZUGA 4P10A 3GFHA 3FZBA 2UV8G 4WCEQ 1MWYA 1IKXB 4Y3CA 3R9LA 2HZAA 4LF9J 2HHUA 2R2RA 2R7OA 1ZZNA 3HHKA 1W25A 4IFVB 3CC7S 4OFZA 2YQ3A 3OD2A 3HVWA 1DHMA 1WSVA 4NA3A 1FWKA 2HNYB 4ANDA 3ZNJ1 2Z2ZA 4ZOSA 3KHRA 4UOGA 3QAUA 2JX2A 1VI7A 5RUBA 4DUZJ 1G6BA 3A8IA 5DQGA 6FDRA 3B6BA 1NK0A 4F26A 3A4TA 3JSRA 1RT1B 4ED0A 2UUWA 4LFBF 1U02A 2XS2A 1GH8A 1Q4RA 2UUAF 1VGYA 2V6AA 3GIJA 4MK9A 3P4UB 4TN2A 3RW7A 4WFYA 4DS5A 3KG4A 2R8KA 2V4RA 2AYMA 1BC6A 4LMZA 2UUCF 5KFUA 2IA0A 2NUHA 2R7QA 1KN6A 2XZDB 4L6V3 1ZM4A 1JNRB 1DTTA 1B3TA 2KRBA 4I1TA 1FF2A 1MNEA 1CULB 3BYPA 5I3UA 4F2SA 4ZLLA 1VBXA 3ZTRA 5DRKA 3V2UC 1QTNB 5IT4A 5KG5A 1HYSA 4ERDA 1EJ7L 2RRAA 2VC0A 3UD5A 2M8DB 1UWAA 4KHMA 1U45A 4C3MA 2YKQA 5L8RC 3HLUA 3AHPA 3HM9A 5KT2A 3PG9A 2F4VJ 3G9CA 4FNHA 4M5NA 3KDNA 2R8GA 2WW8A 1YK9A 3FC9A 2Z4PA 4O3SA 1FO1A 4MYTA 1YJ9S 4TY8A 2W9CA 2AEFA 4XIUA 3JSMB 4NLRA 4NE9C 3TZZA 2X1AA 3DGVA 4B9VA 1AUDA 3KK2A 1XMOF 2ZDPA 3WHIA 3TI0A 1SH3A 4B9SA 2C2ZB 1Q7LB 3UW1A 3DRXA 5B0EA 3A3OB 1NDPA 4ZPWR 2LP4A 4OYAA 1GTHA 1LOUA 2CAJA 4V19X 3GIMA 5IT0A 1N33F 5ETSA 3LO3A 3G8TA 1YJRA 3PYFA 1RISA 1YJTA 2VPXB 3NMRA 2UXDF 3ILLA 1JK9B 2YH0A 1IKYA 1Y3JA 3DOKA 4PWWA 4PXCA 3ENWA 2O5DA 3JTPA 4LR9A 3EXYA 4IG0B 3M6VA 4DL4A 1EHWA 5KT4A 1RLDA 4Y65A 2K3IA 3UR0A 2U1AA 3DM2B 2HHHF 2RDJA 2UUBF 4OHVA 1NH8A 1C1BB 2C2NA 4OIXA 1RTHA 1XERA 4LSLB 1YBAA 3HPOA 3JQJA 4UZBA 3MM7B 1FKPB 2KYZA 1U47A 2E29A 2XMWA 1LFPA 4TLQA 4A8KA 3CCQS 3OFFA 2XLJA 2VPWB 2BOPA 4NI2A 3UD4P 1FNXH 4ZCIA 3B78A 1KP6A 3I5AA 1E6YB 1NJWA 3C3LA 2G0CA 1SC3B 5KFTA 2E5IA 4K4WA 5EX0A 1WC5A 1X4EA 3GV5B 1HWJA 2AKWB 5BR8J 5J1EA 2WB4A 4NL5A 5HLFA 2QG9B 3KJVA 3PW5A 5IOLA 2LECA 2ZKUA 1X9MA 3D6HB 1XIQA 1I94J 4NEZA 3S01A 1PSDA 4HDGA 2VPYB 2J6UA 2Q79A 1JKHB 2FB0A 4LSZB 1NZAA 3BQ0A 5D4OA 1VQ7S 1HLWA 2H4YB 4I69A 5T14A 3J81U 2V0NA 4HTIA 5L38A 1SIWB 3C8YA 4DV2F 1FKOA 4F0HA 4YEAA 4F7VA 2ZVSA 1UJ6A 5L1LA 3WQPA 3A3NB 1SB6A 3GONA 1WSRA 4QPTA 2IVMA 3NXZA 2HG4A 1ZETA 3QRRA 5DJBA 3DXSX 1NAQA 2E9RX 2ZWOA 1C4CA 3QGIA 4ZPDA 3CJTA 1S9FA 2IAJB 1NXIA 2HLTA 3W61A 4DR2J 1N36J 1RCXB 3PHTA 3W8PA 2M0GB 4B08A 3I4PA 4X4QA 4X64F 5U47A 2PC6A 2PMZD 1D9DA 2H3EB 2J0WA 4P52A 2DVIA 4TQRA 4DQPA 3M8SA 1XNRJ 3FBEA 3K58A 1EX8A 2ZD1B 2AV5A 2QRRA 1H2TZ 4F0MA 4ZPVR 4KGMA 4NCGA 5E0OA 4ZMMA 5BR8F 1GFWB 1MU2A 1NMEB 3BQ1A 3IR7B 2OHDA 4ZCMA 2XS5A 2IM2A 1DQ9A 2VD3A 3C16B 4USTA 2M52A 2EVZA 3PHEA 4QIVA 3G2XA 2EFOA 9ATCB 1RAGB 5DQIA 3QNWB 2YKAA 4ECQA 1S77D 2EC0A 3V4IA 1UETA 4F25A 2D3O1 4O4RA 3RB6A 4Q2LA 2YNFB 2GVZB 1SKSA 1T94A 4J9VA 1DRZA 3F73A 1PG5B 1Q0NA 3FBCA 1RU1A 4DL6A 5IV3A 2APOA 2GHWA 1B7FA 1R3NA 4ZCKA 2XSFA 2OJ3A 2OPSB 2N3OA 2ZH7A 1HARA 4N47A 1QLNA 4NLVA 4LF6F 2Y1LB 3NG8A 2GIQA 3DRYA 3H2LA 4X4RA 2AGOA 4OQJA 3OFGA 2ALZA 5LOQA 4EEYA 4LVOP 3DGPB 2DGWA 4MKVA 2Y1IA 2DKOB 2RIJA 2HZCA 3O3LA 3D9BA 3GG1A 1L3UA 3R7NB 5A6WA 5B0GA 4ETZA 5EWEA 2DHHA 2KXNB 4Q0BB 1RAJA 5B09A 4ZJOA 5HANA 4CM0A 1NSKL 1SC6A 4J9NA 5HJXA 4DL2A 1F2HA 2V9WA 2B8PA 2C3YA 4ECWA 2YWEA 3FBBA 1WC4A 1RWOB 3C19A 2B4OA 3PX0A 5EWFA 2E1PA 4UOCA 1XMBA 4TKTA 2RS8A 1GQEA 5E3PA 2ZDOA 4ECXA 1TMMA 2BJDA 4ZP8A 2UV8A 3BO4A 3N6LA 3CDEA 4ILRA 2ZHBA 3W5ZA 4NLUA 2Q66A 5D0EA 1HBUB 4WFBQ 3RZAA 2HVHA 1DZ5A 2M7SA 4P74A 1RUSA 3DLGA 3NAHA 2QTWA 3SQGB 4N77A 1RT6A 1UTAA 4K4TA 1LNQA 3MM6B 2BE2B 1S99A 4CI0B 5DG7A 4NA1A 2HFNA 2FZKB 4JI4J 2ZH6A 2HFUA 4DR7J 1HBMA 3LP1A 4RWXA 3UCGA 2G1DA 1FJGJ 4ZVEA 2F3JA 3NNCA 3MMCB 3Q86A 4AUKA 3JAMY 3OSPA 2PA8D 1W2IA 2YVSA 3N5BA 4ID8A 1KHWA 1VYAA 5FLXU 1XTZA 5I42B 1X31C 1HQEB 3CJ8A 4P7TA 2VQEF 4DCJB 4X65F 1FRMA 3M8QA 2DO0A 1Y9OA 2M9KA 3MM8A 1K47A 5KFDA 4IDKA 1YI2S 2G4BA 1OQ6A 3OXGA 4LFAJ 1O5JA 3BR8A 1HBNB 1N52B 5LT5A 2RQ4A 1WKKA 3BGUA 4U8YA 2XMMA 3PW7A 3VTIA 1RTDB 1XNQJ 2LXUA 3OR2B 1RTIA 2MKKA 3U27A 3PDNA 1RWNB 4DHVA 4ZVFA 1S57A 1U1KA 4ZIWA 1APSA 2GVDB 2H9ZA 4JOUA 1U7LA 2VOPA 1KS2A 1HWUA 3MEDB 2QMXA 3GP9A 3TO8A 3DLHA 5EHHA 1Q7YT 2OD6A 3N28A 2X51A 2W4CA 4ZK7M 4YDDB 1BQXA 4NLTA 4M5GA 4QU6A 3GSIA 4LF4F 2KTQA 2XB2D 2JSXA 2FZGB 4JI7J 3VGSA 1QDUB 3MPYA 4JV2A 4QR1A 1TL3A 2VG5B 2HIYA 1FFGB 1LWCA 1RJJA 5JJBA 3HKWA 2ZZTA 3MMAA 1WOSA 3LP0A 4C7QA 3O44A 5KT3A 4KO0A 3B4DA 3LANA 2FVSA 4ILMA 1JXEA 3T5HA 2CNOB 1D09B 3ZZRA 2WOMA 3CC4S 3BSAA 5A8KB 2KJWA 2QO3A 4C9DA 1RHUB 1HW9A 4Y28C 4ZN1A 3AQOA 4J9PA 1VIXA 1R0CB 1TK5A 3HFKA 5AJ3F 5C5JA 1IM4A 3IP0A 2P8IA 4LSNA 5H1SV 1ZAWA 4UQTA 1RI7A 2ATLA 5FDLA 4X66J 4OYMA 3MR6A 2V2VA 2DK2A 1RTJA 4DQQA 5KTQA 3D6TB 3D6MB 3CT9A 2VV5A 4HACB 1ZM3A 4LF7J 1JMTA 2E7WA 4IH6A 2CJ9A 1F9FA 1SJRA 3I0RA 2FC9A 3NLCA 3QLHA 3V6DB 3FEXB 1NDKA 3DC2A 4M5LA 3CDAA 4OI1A 4OYXA 1VRUA 1EAYC 1BE4A 3KLVA 1DQ8A 2RQKA 3QGHA 3WIUA 1WJ9A 1RA6A 1AROP 3R5GA 3SSSA 1IQZA 2MSSA 5K14A 1YG0A 4DOZA 2MQOA 2KRRA 4OX7A 1C2PA 4JI3J 3VGTA 3M7VA 1ZBTA 2NXUA 3KLFA 3JYTB 3SQOP 1PO6A 2H65B 4EYIB 4OX9F 3MPVA 3GYXB 4A8XA 5DGAA 3PIPQ 4Q7AA 1N8RT 2VG6B 5HROA 1FJEB 2OPPB 4HR2A 5I4MA 1GMVA 2DNLA 4U8VA 3KOAA 1UAWA 2Q6BA 4D3GA 4WTOB 5IT9Y 3K17A 2HHXA 2HAFA 3SI8A 5IWAJ 2VUGA 3I6PA 4AQYF 3EWGA 1KQSR 3UR3C 2HFSA 3GPAA 2UVUA 1FXDA 1UVIA 1EKRA 4IR1A 1ZZFA 3MECA 1SL1A 2F8HA 4TY8B 2W9CB 1MSWD 1Q8KA 1V3ZA 1KC8T 2POKA 2XMKA 4P2SA 3V5RA 1U8SA 4B3MJ 3VQSA 1HHSA 2DXDA 2IHR1 2OPQA 2WVDA 3AJDA 3UCZP 4UY85 4KHPJ 4J5OA 2HHVA 4I2QA 1RAFB 3UNYA 3OQ2A 1FXLA 2DR5A 3UVJA 4LFCF 2LFVA 2QIFA 3M6UA 2RB7A 1IXKA 1U8WA 1EQMA 2HPUA 1ZTTA 1VR6A 2OI2A 3OPKA 3AJ1A 2RNEA 3R7SB 3MHYA 3DOKB 1ZA1B 2J76E 3FQLA 4ES1A 2XM3A 1VBYA 4B3RJ 2BRLA 5JUMA 2X3DA 1ZS6A 3CIMA 1RT3B 1RYRA 4D3HA 2YKMA 5AT1B 2D69A 2J0SD 3FGVA 1YJVA 4R8UA 1EIYB 1RTHB 1QAYA 1GMWA 2GHPA 3POTB 5KT5A 3W9IA 5CD4H 5KG0A 1S6PA 1LXNA 2CQ0A 3TVYA 2DD8S 3T1AA 2I0XA 3OL7A 3JTOA 3FMBA 1IKWA 4Q8FA 2ASDA 4CCHA 4H4KA 3S7RA 2AYGA 2EFPA 2HVEA 3CXCR 5F8LA 2JC0A 2AD9A 2MXYA 1TL7A 4DL3A 1UEUA 1R31A 2VC1A 3CJRA 5EX3A 1REVB 1QAJA 5J2NB 2A0FB 1CPZA 1J5EF 1LWEA 2GQCA 4NLQA 3QWPA 5HMWA 3RR8A 4WXWA 2XEXA 3I56S 4TQSA 4JV5J 4FKYA 2VFUA 1Z2ZA 2UXCF 4RUAA 4GVBB 5B0BA 5KFBA 3EPGA 4GC7A 1Q53A 1JB0C 1NKCA 3TRGA 3MMBB 3M8WA 4B9MA 2YX1A 4HTJA 1M1KT 2L9DA 2EBGA 2YTCA 2ZUAA 3UPFA 4YOEA 4JI6F 2CPXA 2XZWA 4KYZA 2RS2A 4WJBA 1S79A 4NPOA 2CDRB 4J9KA 1T02A 4YDXA 2ZEJA 2FJAB 2GJFA 2B5JA 3O2IA 1RT4A 3Q8VA 1DURA 1HA1A 4OZ2A 1V5IB 2XSJA 3DOMB 2DY1A 2YQ0A 3L7PA 3UNGC 2YNGA 5T41A 2V8GA 3HHLC 1CVJA 5DM7Q 1H2VZ 5KFOA 5A8WB 4OZ5A 1Z2LA 1PBAA 1M90T 2FHKA 2BE9B 2B51A 4RKUC 4TVAB 3PXGa 2YY3A 3LF0A 3CJSA 2A18A 3TR5A 3RGIA 2E7XA 2C22A 4FF4A 3G6XA 5EWGA 3SBMA 4C97A 4PUOB 2KHDA 1JLGB 2NXEA 3OT9A 1R8HA 1B64A 1NUEA 1GNKA 3HZEA 1H3DA 2Y9HA 1KVJA 1HNWJ 4RW6B 2KJVA 4PG7A 1RWPB 1IR1A 3CCWA 1C0TA 4YB1P 2CYYA 4OJGA 2WRMA 2R3VA 3KFWX 5JMNA 3R1LA 5CABA 3DDIA 1MU2B 2GGPB 1S9GB 4CO2A 3KLEA 4DR5F 2XS7A 3NL0A 4PQUB 4WF9Q 2DY9A 3AODA 1SC4B 1TKTA 3GR1A 1UVNA 2C2DA 1P1LA 1VQOS 3K5OA 3LGNA 1RT2A 2ZH9A 3GCWP 3NGUA 4JB8B 3K57A 1Z4UA 3FKBA 3AJ2A 3BBFA 4LBHA 5LXYA 5D4PA 2W4DA 5KFZA 5L9XA 3IWNC 3BREA 1TKDA 3UQSA 1T9VA 3UFCX 2BM0A 2IM1A 3OL6A 3SFGA 2OH2A 3ADAC 5KOXA 2HBQB 3F0NA 1HQ2A 4FZVA 2FVQA 4FF1A 3A3PB 1NZ8A 1LXJA 4PG4A 3A8EA 2ADBA 3ZZOA 1PYTA 3BQ2A 2W2NP 3EE3A 2RQCA 5GAEU 2RRBA 4Q43A 1UJ5A 3L9ZA 4DV0J 4WFZA 1LW2B 2FVRA 4N7TA 1RAAB 2M70A 3ITHB 5E7OB 2DISA 2HWHA 3MUTP 4IOAQ 4CLKA 2NCKL 4DG1B 3MUVP 4DV6J 4ALZA 5J1PA 2UVVA 4NOHA 1UPMB 3LOUA 2FLNA 4LF5F 3DRRB 3SCJE 2BXJA 1KOHA 4OX8A 2YPZA 5B7WA 3OFHA 5SZTA 4KTQA 5LL6d 4ANCA 1BQNB 1REGX 1OY9A 2RDIA 1U26A 3DOLA 2EFVA 2CNLB 3CEDA 3PEHA 2UXBJ 4DR6J 3EZ5A 3TAMB 3EDQB 1N0UA 5KAKA 1VS3A 3TEHB 1ZTWA 1RT7B 1MROA 1NJIT 4JI8J 4UUWA 1N48A 3M2UA 1A7GE 1RT6B 4M5JA 4J37A 2FJBB 1FTRA 4I68A 3RAXA 3AA8A 4KSEB 2C28A 4EZ9A 2WZ1A 2W9BB 5KG6A 5B0CA 5CYMA 5KG2A 2J6TA 5CYQA 4KV8A 5KFXA 4Y2IA 1S0MA 2HVZA 4DSEA 2CQ4A 4PABA 3TJ9A 4RJVA 1ZM9A 4DR4J 4NLSA 3BSNA 3ZTPA 4QIEA 2ASJA 2K1RA 1CJUB 4ES3A 1UL3A 3TW0A 2HRTA 4CLLA 1VFJA 3M8QB 2XMTA 1P1TA 1MMNA 4J9QA 2FHJD 2R7UA 3FFIA 4F3MA 1RXOB 2WSEC 2V8DA 1VJQA 4NCAA 4ED7A 1S9EA 3FJ2A 5GADU 2GIRA 3UD3P 2ZE2A 1WEYA 2M4MA 3MCSA 4JP8A 1FT8A 3MMJA 3R97A 1CJKA 1X5OA 2DT9A 1J27A 4Q45A 5HBMB 2ZBPA 3THPA 2EC2A 5C7PA 3C2PA 4TU8A 3UN3A 2JH3A 1OMSA 2VB6A 2IMOA 3QT7A 4B9UA 2OP5A 4DFMA 1S0OA 2PDAA 1HPZB 2XMAA 2AZ1A 3U1MA 4DX7A 2KM8C 2FIUA 2MTLA 2RKIA 1WTBA 2PD1A 4UY8T 1WC3A 3TX0A 2MQLA 2N3LA 3MM5A 1NJYA 5ETKA 3Q23A 1HQUB 1D9AA 4DSFA 5E3CA 1NK6A 3NBPA 1RB0A 4NMLA 1YVFA 2V4JA 1YRTA 4P6QA 1LWCB 4L3NA 2ZHOA 2D3ZA 4USUA 1WTFA 4DV4J 4CO5A 4A47A 1TV6B 5KT6A 3I87A 1TK8A 3LTOA 1N34J 1FEEA 2RF2B 2WOMB 4RZRA 1RYSA 2Z57B 3E01A 4GKJJ 4Y00A 3T9ZA 2C42A 3NCQA 2DH7A 2MGZB 3D0GE 5L39A 2XULA 2GMJA 4KGZB 4Q2MA 2JDJA 4LF8F 5FDLB 3EYZA 2N4CA 1C4AA 4Z7CA 1RTJB 3DLKB 4USVA 4DV7J 1CLFA 4U95A 4G65A 3CJ5A 3I0RB 1VC5A 3QLHB 4FBTA 3KMSA 2JEGA 3BBBA 5HP1A 2X7IA 4NLDA 4PQAA 1S59A 1MG7A 3FMWA 3CULA 3EGVA 1IBLJ 1Q8BA 5AE2A 3OBIA 4I2PA 4FYXB 1CS4B 4NZ6A 4DUYJ 3CD5A 4E8UA 1SJFA 3MDFA 1S10A 4DPUA 3QT5A 1S1XA 3KUGA 2R7RA 2HVIA 5K14B 1VC6A 4Y2KA 3RRHA 4YS2A 4DV1F 3RTVA 5EN1A 3PO5A 2FVPA 4MYUA 3L7OA 5F3TA 6FD1A 1IKXA 2ZKTA 2MZJA 2HS3A 3KLFB 2G2YA 2WK4A 1NHVA 2NSBA 4B9LA 2ZOMA 3FVYA 2A6OA 1KFSA 4CQ1A 3T5LA 4EGLA 5E41A 1M5HA 3AQPA 2HKEA 3FBFA 4M5MA 5DS7A 5LMUF 2UZAA 1SQFA 4K4SA 1WELA 1U09A 4S0MA 1GX6A 4GKJF 1WHVA 1F3FA 5ETNA 4OJ3A 4KC5A 3KLIB 4ZP6A 3U1LA 1LWXA 4J91A 3P8BB 3CCZA 3C66A 2QA1A 4X4PA 1T03B 3MECB 1WORA 4UTGA 4YB6A 3GQCA 1WF2A 1TU0B 1CJVB 3FK4A 4G1PA 3CD7A 2B9EA 2J8AA 2W2PP 3K5LA 3SV3A 4K2JA 5CA5A 1M5KC 4G1QB 1FESA 3HZGA 1JNZB 3AD9C 4CM2A 4ECRA 4A8SA 2OPQB 2CWKA 3T1YJ 4UQGA 5C2CA 2Q1LA 1KD1T 3QSYB 4ED4A 5DDRC 4LIWA 2LU1A 4C8LA 5J2QB 4MIBA 3KK3B 5IFMA 4LQ9A 3O6QA 3R2DJ 1PJ5A 2MZSA 4MKAA 4DR1F 4OHZA 3KK1B 3CJ0A 4DPYA 1YRXA 4OI4A 1Q16B 1URNA 3PYDA 1PILA 2YKMB 3TP2A 4ZLPA 3PW2A 4R8UB 2QLXA 1VLOA 1TL5A 3PJWA 2QC3A 3VAFA 1WD6A 2CQ2A 2I5JB 4QWDA 2QX0A 2DR8A 2CVEA 2RH3A 2DB1A 2CDQA 1IUJA 3Q2TC 2MQPA 2HHWA 3CC2S 1H7WA 3GIKA 2DITA 1KVKA 3R3TA 1M5PC 3QIDA 2EWHA 4NXMF 4FYYB 4F4AA 2J9EA 3EX7B 2AP6A 3D66A 2MY8A 1HD1A 2OMOA 2KHCA 2AGPA 4HI1A 3MCMA 5I3PA 2O66A 2WVCA 5A6PA 3BN4A 4OYOA 2V4QA 3J81Y 3VAHA 4GKKF 3IM8A 1JLQB 1LWEB 5HSPA 5A2QU 2QT7A 2RSQA 3E3XA 4P2XA 2FGOA 3NWGA 4IG0A 3DM2A 1HL6A 3QWUA 1FD8A 2CNKB 3CMES 4NX9A 2PI4A 1U1PA 1N56A 1TKZB 2DHGA 2QYGA 3H40A 3QRPA 2IC3B 3EDRB 3MM7A 1FKPA 2XHWA 2PSZA 3CJKB 4W90B 4NZ7A 2NR0A 2K3KA 4JI5J 3D2WA 3W9HA 3SCLE 3BDPA 4M5IA 5ETOA 2YQ1A 3K0JA 3FSIA 1Q1KA 1U6FA 2ZBCA 2IBKA 4B9NA 1E6YA 1TR0A 2B5JB 2LKZA 3K8WA 3EZOA 1U6BA 2V8HA 2VU5A 5HQ8A 4N56A 1ULRA 4GMKA 1AT1B 3FDSA 1WNEA 2XSJB 1PJ6A 2WBRA 2VHGA 3C14A 4DR3J 3MFIA 5AE3A 4GO7X 3BGRA 3IMQJ 5HK4A 2QA4G 3HULA 3D5MA 2OGUA 3PM9A 3SCKE 2R7TA 2HIQA 2CADA 5G0RB 3PKMA 2H51B 4CT9A 2EK6A 3CCLS 3R7BB 5E3QA 3RRGA 4NXNJ 1UJ4A 1YWXA 1NK9A 5F8NA 5GAGI 4DV5J 2OKQA 4OX6A 4M1KA 4OV1A 1HNZF 4RW8B 3QPIA 2VA2A 1LFWA 4X84A 1C0TB 3LUYA 2XGPA 2BBEA 2DJWA 4CO3A 4WP9A 2IYGA 3C15B 4WYWA 3KLEB 5F9LA 3IRWP 3ZZZA 1SJ4P 4CLYA 2QZ8A 1C1CB 3P5BP 3W7BA 3OVSA 1WF1A 2R7XA 5B0DA 4L72B 2L9NA 2DNPA 3W2VA 4KT0C 3BO2A 1NEEA 3LPEA 2I2YA 3M9NB 2G0JA 1IKVA 3M05A 2W7PA 5B08A 1EKSA 2QJ3A 2AT1B 4JI5F 4WKRA 2BJ3A 2E5LF 3MAAB 2AZ3A 1N5YB 1FCAA 1U1LA 4OYWA 4WWSA 4CDIA 3I55S 4ZPBA 1WHXA 3M8PB 1MN9A 2K2PA 1NDCA 4FXVA 2KN4A 1HBOB 4NYPA 1PKUA 3R1HA 4QPXA 4O3QA 2F8EX 3VZIA 1WDTA 4WPAA 3OLBA 4X4OA 2CJKA 1OQ3A 2EKNA 2C2OB 2GQ2A 3H2UB 2CJQA 3C16A 1T9XA 3NS6A 2XGQA 1L5UA 1RADB 3TZXA 3KHHA 3DN9A 2W25A 3KLHA 2DR7A 3TVZA 4FYDA 5FJ4A 2OUGA 4HHUA 4CH0S 3OTDA 4DV5F 5L9NA 5IQQA 2MHEA 3SCIE 4B3TJ 2YNFA 2GVZA 1OWXA 4DSKA 1D8ZA 1KONA 4AD6A 3MR5A 2B8QA 4P71A 2E1RA 2Y0SD 1FVQA 2XCAA 3ZFVA 3R27A 4YN3B 1Y5IB 1RWMB 5SUHA 5IV4A 2OPSA 1TELA 3DOLB 3IWLA 3LQVA 4LBIA 4FPRA 2ZM6J 2J8SA 4P75A 1VRTB 2DNYA 1SL2A 3VZHA 5FLXY 3MR2A 1VQ4S 2H54B 2BJ9A 3OTCA 4IG3A 2FZCB 2FLLA 1MMDA 3DGPA 2JL9A 3BGLA 2BMBA 3M2RB 1G7CB 3TUJC 1BXNA 4X4SA 4QWEA 3HF5A 1YSJA 5CYQB 2RUSA 2D9PA 4Q0BA 3TVKA 3WZ0A 5ETRA 4RUBA 1CG2A 2P9EA 5LMNJ 4B3SF 3BSOA 3E2EA 3ZTOA 3GG0A
chains in the Genus database with same CATH topology
3VAGA 3LW5C 2DNRA 3LP0A 4DV7F 2OPRA 4C3LA 1C1CA 3GV7B 4C7QA 2F4VF 3O44A 2K1RB 5KT3A 3FZ2A 4KO0A 3B4DA 3LANA 2FVSA 4ILMA 4LJMA 1JXEA 5KFIA 3TX8A 2VL1A 1HNIB 3T5HA 4I6YA 1X4FA 3MURP 3ZZRA 2WOMA 3BS9A 4WYLA 3CC4S 4TU7A 4HVZA 3J80Y 1TFYA 2B0GA 3BSAA 1ZAVA 4OLPA 3TAPA 5A8KB 4KKOB 4DFKA 1NKBA 4IRCA 3SMZA 2KJWA 3RAQA 2QO3A 2LA4A 3VALA 5CZXA 5DGBA 2DCLA 5FD1A 4A8YA 4C9DA 1R8PA 3PFOA 4HEA9 4K5RA 4QYZJ 3FFIB 1DJ0A 4ZPCA 1KLMB 1HW9A 4C0BA 4Y28C 2CZ4A 2PO4A 2XY6A 4I2QB 5IS2A 3G4SS 1IBLF 2IJNA 3AQOA 2CQ3A 5M2UA 4J9PA 4TXSA 4CO0A 4A8MP 2YX7A 1VIXA 1R6YA 4DUYF 1HBUA 4ITSA 1TK5A 1S9EB 4KR0B 3MAQA 1GT8A 3AA9A 4RLEA 3HFKA 5AJ3F 5K9FA 3WX4A 5C5JA 1IM4A 3PX6A 1BQMB 1OSCA 2BVZA 2SXLA 3MTJA 1SXLA 4USHA 4LSNA 5H1SV 1ZAWA 3I0SB 4F4KA 5HO4A 1DTQB 3E51A 2KFYA 4UQTA 1RI7A 1N5TA 2HLUA 5FDLA 2ATLA 1VLYA 2D7SA 2LEAA 4JBCA 3MR6A 3O8WA 2MJUA 3MM6A 2DK2A 1RTJA 2LEPA 4DQQA 4WU3A 5DG8A 3CCTA 1G3OA 5KTQA 1YHQS 2D1CA 2XNQA 1QE1B 3M8PA 1NK4A 3CT9A 4ZPAA 3C6TB 4DLEA 1HBOA 2VV5A 1FK9B 3N6MA 1ZM3A 5HL7Q 1AXQA 2CQCA 1JMTA 2E7WA 2YWHA 2GO8A 4R0JA 4IH6A 1PC4A 2CJ9A 3I5CA 2ZH4A 2OTLS 2DHAA 1F9FA 1I1GA 1SJRA 1KFDA 3FSYA 3I0RA 3K7RA 4ZCLA 2FC9A 3NLCA 5BYSA 1SL0A 3QLHA 1S1TA 4M5DA 1UVMA 3MMCA 5D3GB 2KU7A 4KIAA 5KFHA 1JXLA 3MEGB 3V6DB 1BD6A 3QO9B 2XBPA 3JSMA 3FEXB 3T19A 2ZOGA 3DC2A 3CDAA 4OI1A 4I7FB 1T8EA 1VRUA 2AX0A 2KT5A 4QIWD 3CCSS 2RT3A 2VBWA 2VH7A 5FIIA 2VODA 1S6PB 1HQEA 3ISZA 1VQYA 1VMBA 3LPYA 2FLPA 1JJ2R 3KLVA 2M3DA 1YQHA 1DQ8A 2RQKA 3QGHA 3MM5B 1RA6A 4QW9A 1AROP 1QY7A 4JUZA 2YH1A 4J9MA 1IKWB 4M63A 2RJZA 3SSSA 2CQPA 1K73T 1IQZA 2MSSA 5K14A 3M9MB 3HI9A 2KVIA 4ICLA 5L1KA 3PY8A 1JLFB 1M0SA 1YG0A 4DOZA 4F67A 2MQOA 3MEEB 3BGFA 1HNVB 2IJFA 2KRRA 4OX7A 4C3KA 3QAEA 1C2PA 4PPDA 4OZNA 3MUMP 3Q2SC 2GCFA 4NA2A 4ZA1A 1IJFB 1ZBTA 2BACA 2UU9F 1H2UX 1OS5A 2YNIA 1J2VA 4FVMA 2NXUA 4OI2A 1SH2A 4ECUA 3DDKA 2F8MA 3KLFA 4KHRA 2AF6A 3JYTB 3CPWR 3TQ1A 3HJFA 3D0IE 1PO6A 1FKAF 2HW3A 3GSDA 5DETA 4EYIB 3OR2A 2ZH8A 2XLKA 1YJWS 4OX9F 2BABA 3MPVA 3GYXB 4A8XA 5DGAA 3BJYA 3PIPQ 2ZJRQ 3BB5A 4Q7AA 4RBTA 4KFBB 5B0FA 3OUYB 4X4TA 2VG6B 2X3GA 4J9RA 5HROA 1N8RT 1FJEB 2OPPB 2KXFA 2FD2A 3BF4A 1VQ9S 2NQPA 1BLUA 5KFKA 4B3OA 4RNOA 3FRZA 3TA2A 2GNKA 4WE1B 3Q22A 1C1BA 5I4MA 1QJHA 1R8BA 4F3QA 1VQPS 2DNLA 1K0TA 4ZS6A 2V2KA 2PGCA 3MEDA 4LSLA 4NLWA 4WFAQ 1UAWA 1VRTA 3OSNA 3KOAA 5LSLA 3CCRS 3DXBA 2LEBA 1KLNA 2Q6BA 2D74B 4PXDA 3NNAA 2Q43A 4D3GA 5IT9Y 1FJCA 5CH7B 3GFXA 3G8SA 3T5JA 4DL7A 3OL9A 1JLEB 5DG9A 2HHXA 3B4MA 5HMZA 3R5CA 1RKJA 3IS9B 4C98A 3U1NA 4DSIA 1HWIA 3M2RA 4K4XA 3SI8A 5C24B 1F5CA 3S1TA 2L3MA 1YJNS 3T1YF 1WI6A 2BQUA 3MGJA 4YFUA 2NYIA 2B9XA 2B56A 4ELVA 2ROEA 4O44B 2MYFA 2VUGA 2FHMA 3I6PA 4K4YA 4AQYF 1I94F 4RX6A 2CPIA 4RW4A 4DFPA 3DLEA 1U1OA 1KQSR 4FXWA 3UR3C 3R5AA 4A48A 2UVUA 3DRPB 1FXDA 1GXLA 1UVIA 4HYKA 3RYLA 2DGQA 4IR1A 2VASA 4FXDA 1ZZFA 2LDYA 1Y00A 3MECA 1SL1A 2F8HA 3G6YA 4TY8B 2W9CB 2COLA 1M5OC 3H8YA 1OPIA 1TZ0A 1JLAB 2GJIA 1MSWD 1V3ZA 4H4OB 1KC8T 1KRPA 2POKA 4A8QA 2KI2A 1L3VA 4DF8A 5E2QA 5A8RB 2XMKA 1RT4B 4P2SA 1FRHA 2WCXA 3J7YI 3V5RA 3JB9k 4J9LA 2OFGX 1U8SA 2HGLA 3VQSA 2J9CA 2P9CA 2VKRA 1VQ6S 3S8SA 2FJVA 4ID5B 3E8OA 1HHSA 2J7UA 1X5TA 2DH9A 2MMYA 4BWMA 1UKUA 4HKQA 2IHR1 5A8KA 5C25B 2YNGB 2OPQA 1Q8IA 3UCZP 4UY85 2DNNA 1SKRA 2VFRA 4MFBB 1VK8A 1FHTA 1RGVA 3HVAA 1KLMA 4J5OA 1KSPA 2HHVA 3MOJB 4EWTA 3QIPB 5BYQA 3VAKA 4I2QA 1C0UA 3OQ2A 3PEJA 1FXLA 4K4VA 2DR5A 2MPUA 3KNGA 4IFYB 3EGWB 2GHVC 1VQNS 4TYAA 3G6ES 5GAEI 1QSLA 1H38A 1LWFB 4LFCF 2QIFA 3M6UA 2RB7A 1IXKA 1JKHA 3TA1A 1JIHA 4H4KC 2KG0A 4NRUA 1BQMA 2HPUA 3IO1A 5KFYA 4RNHA 2ASLA 1ZTTA 5F41A 4MKYA 4K4ZA 3I0SA 3IRXB 1K8AT 1DTQA 1FE4A 3OPKA 3AJ1A 2RNEA 2Z2MA 3V4MA 2WSCC 3EUNA 3MHYA 5AXLA 4Y2MA 2EKYA 2XI2A 4YR3A 3DOKB 3LALA 1Q82T 2J76E 3FQLA 1F0XA 1K1SA 2ZC4A 4ES1A 1QE1A 3KMQA 1VBYA 2EW9A 2C3PA 3C6TA 1VQ8S 3I5BA 2CQBA 2BRLA 1FK9A 5JUMA 2VQFF 4DR2F 5K5MA 2CPZA 3CIMA 1RT3B 3K2YA 5D4NA 3QZ7A 1RYRA 1N36F 4D3HA 2YKMA 3W2WB 2J0SD 3DYAA 3FGVA 2BANB 4J9OA 1YJVA 2RILA 4R8UA 3T3FA 4RW9B 4KGKA 3HXMA 3RAMA 2MZQA 4DFJA 5D3GA 2J0QD 2A10A 5LJ3Y 2ZJQQ 1RTHB 3VCDA 1N5YA 5HMXA 1UVKA 1QAYA 3MEGA 3V6DA 3QO9A 3WC2A 4EZ6A 2FVCA 5LSRA 2IRYA 2GHPA 4G3IA 3POTB 5KT5A 3HHLB 1H7XA 3M6WA 5CD4H 2HQIA 1HWLA 5KG0A 2BQRA 4N76A 1S72S 1S6PA 4HLBA 1LXNA 4MIAA 1FJ7A 2CQ0A 2N4DA 4B17A 3QJLA 3TVYA 2DD8S 5KG4A 3OXLA 3T1AA 2I0XA 3OL7A 3JTOA 3WBZA 5J2MB 3FMBA 3MZIA 2FJDB 1IKWA 4Q8FA 2ASDA 4CCHA 1XNRF 1TKTB 2MB0B 4H4KA 3I32A 2KFZA 2IAJA 3S7RA 1FRJA 1VK3A 3EPIA 2AYGA 1U2FA 2EFPA 4NZ0A 2VG7B 5C42B 3MEEA 2VFVA 4EUVA 3CXCR 5F8LA 1RT2B 1F5BA 3CJ4A 1HNVA 2JC0A 1O0PA 2HAIA 3HX9A 3IGNA 4C0OC 3GV8B 2AD9A 3OVAA 2MXYA 3T9NA 4AE5A 2NS1B 2DBBA 1XC9A 4IQXA 1X4HA 3MM9B 4DL3A 2LXIA 4ED3A 3OTBA 4USJC 4FF3A 3MFHA 1UEUA 1R31A 2VC1A 1ZH5A 3GYNA 1U1QA 4KRWA 1R8AA 2Z0GA 1UP1A 5EX3A 1DLOB 3C6UB 5CXTA 1REVB 1QAJA 2JEJA 4I6AA 4GO5X 5J2NB 2R8JA 1ZAXA 4PXBA 3JYTA 2BDPA 1P27B 3MR3A 2RU3A 2WTFA 1IJEB 1K9MT 2MJNA 1J5EF 1CPZA 4C11A 4K59A 1UA1A 2LMIA 5DM6Q 3I82A 1VQSA 1LWEA 4QIFA 4I0WA 3JTNA 1GX5A 2GQCA 3G6VA 4QU7A 4NLQA 3QWPA 5HMWA 4AFFA 3RR8A 4WXWA 2XC9A 3PR4A 4KFBA 2B6AB 3PW4A 1XR6A 2X1FA 2XEXA 2VG6A 3I56S 2VBZA 1TAUA 3ZZTA 2OPPA 4TQSA 3OTOF 3RBEA 1AW0A 1E6VB 2VFUA 1Z2ZA 4RW7B 2UXCF 4Z37A 2MHNA 4RUAA 3AY0A 4WE1A 5IXUA 3V81B 1QSYA 2V5HG 3N79A 5B0BA 1NJXA 2ZD1A 4WZQA 5KFBA 1S1UB 4ECZA 4QQBA 5H9FJ 1U2RA 1S6QB 2CPJA 3EPGA 3SV4A 2CQDA 4IOBA 3W3SA 1U25A 4GC7A 1Q53A 3TA0A 1X5PA 2HNZB 4EBCA 3SEOA 1JB0C 2K8GA 1HWKA 4DPOA 1NKCA 3B8HA 3TRGA 3MMBB 4A8OA 3CDBA 1JLEA 4DL5A 2X1BA 4F4WA 4DR3F 4B9MA 2YX1A 4RWWA 3THVA 1U24A 3IS9A 2UUTA 2DNOA 4HTJA 3HMJG 1M1KT 1Q81T 4E98A 1N32F 2L9DA 4TYBA 5C24A 1D1UA 4Q8EA 2EBGA 4X4NA 2YTCA 3ICLA 4O44A 2I1RA 4LIRA 3UPFA 4ECSA 1T7PA 4YOEA 3KHGA 4JI6F 4M8LA 2CPXA 2GQQA 4LUBA 1S1VB 5ITHA 2NSCA 1IBMF 2XZWA 1F2GA 4DS4A 2KO1A 2RS2A 4WJBA 1S79A 4NPOA 3K5NA 3H20A 3KNAA 1U1NA 3KKFA 3MD3A 5E5NA 5GADI 4I4BA 4J9KA 1DFDA 1T02A 3GE9A 4YDXA 2M2BA 2I8EA 1B0TA 2WB1D 1JLAA 4HT7A 4NXNF 5KFPA 1T95A 2FJAB 4H4OA 5DDQC 1WG5A 4Y6IA 5DO2A 3FEZA 5A8RA 2JLGA 1N5VA 3F41A 2B5JA 2CPFA 1RT4A 3O2IA 2F9JA 4DX8H 2DGTA 1DURA 1NRKA 1HA1A 4DLGA 2FJEB 4LT6A 4KBIA 2ILYA 4ID5A 2XSJA 2KFNA 2MKIA 2CQHA 2OAUA 3L7PA 3UNGC 2YNGA 5T41A 2YWGA 4TLRA 2F40A 3IN5A 2V8GA 3SYZA 4WFXA 3HHLC 1X9SA 1HNXF 1CVJA 2YNHB 1PGZA 5DM7Q 1H2VZ 4MFBA 5KFOA 4DN0A 5A8WB 4OZ5A 4OHWA 2EK1A 4X4VA 3NCRA 3QIPA 4YHHF 3VF0B 1Z2LA 1ZM2A 3M2VB 3PACA 1XMQF 2HFOA 1N54B 4Y2CA 3GIIA 4IFYA 2FHKA 1OIAA 4K5SA 1M90T 1CEZA 2O3DA 4B9TA 2B51A 1F60B 3M30B 1ELOA 1LWFA 4RKUC 4CH7A 3PXGa 1EETB 1X7VA 4ED5A 2YY3A 3PKYA 1UFLA 5H9EJ 4XAKA 3LF0A 2MZTA 4C2MA 1N6QB 2BQ3A 3CCES 2A18A 5KFQA 5AXMA 3TR5A 2E7XA 3IC1A 3IRXA 5LXRA 4RNFA 2C22A 2DGXA 2KZZA 3PW0A 1U48A 4FF4A 5KT7A 4E0DA 3ENVA 1VBZA 1MROB 3G6XA 3PNIA 2JZ5A 1NK7A 2CJAA 5EWGA 4WZMA 3Q24A 5EGYA 4C97A 4PUOB 2MZRA 2KHDA 1JLGB 4UW2A 3V6KA 4O0IA 4KE5A 3J7A1 4MK8A 1R8HA 1B64A 4DEZA 1GNKA 2KDOA 3CD0A 3HZEA 1H3DA 4QIGA 2P6TA 2QFJA 1KVJA 1P9QC 1RT3A 3M2UB 4ZHRB 1TVRB 4RW6B 3W2WA 2ILZA 2KJVA 4PG7A 3GILA 5DDOC 2BANA 2CQIA 1SBRA 1J5OA 4O23A 2FHOB 4RW9A 3US5A 3CCWA 1YJUA 4BHQA 3H98A 1C0TA 3NKYA 1NJZA 1LV5A 2CPYA 3MWBA 4YB1P 2CYYA 3D1OA 4OJGA 2WRMA 3KFWX 4AXIA 5CYMB 2E1CA 3R1LA 4G1IA 4C8ZA 2BW2A 2HFZA 3POTA 4MK7A 4KV8B 2OD4A 1SIZA 3HHLA 1S76D 1MU2B 2CPEA 2GGPB 1S9GB 2IRXA 4CO2A 4G6VB 2AYBA 2BV3A 4QWAA 2HMIB 3KLEA 4DR5F 4U7UK 3HVTB 2XS7A 3NL0A 1S1WB 4PQUB 4HL9A 3D28A 1L3SA 4WF9Q 4QWBA 4DDFA 1TKTA 4FS1A 1A9NB 1M5VC 3GR1A 1UVNA 2C2DA 2A3JA 4YB5A 1P1LA 1VQOS 2J0XA 3I9ZA 4NLXA 3DHWC 3K5OA 4JI4F 1QUPA 2VG7A 3LGNA 5C42A 1RT2A 4NRTA 2PA3A 2BZ2A 1RWUA 3UWTA 4DR7F 2FPHX 5JVHQ 2KYXA 2V8VA 5KG1A 2ZH9A 3QJJA 1XR7A 5M2PA 1GAOA 4C8MA 1TAQA 2HNDB 2OIHA 4ZP7A 4F8RA 1FJGF 3MM9A 3DMJA 2YX4A 3K57A 2MDAA 3LP2B 2P9GA 1XR5A 2HYIB 4F4XA 3G86A 2NPIA 1FDNA 3EZUA 1CC8A 1LW0A 4ED2A 1FVSA 4F4ZA 1Z4UA 1DLOA 3C6UA 1DQAA 4KPYA 1REVA 4PWUA 3AJ2A 5J2NA 1S6OA 2PEHA 2Y1JA 5CQGA 5LXYA 3Q8SB 1XN9A 2W4DA