2R9LA

Polymerase domain from mycobacterium tuberculosis ligase d in complex with dna
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
287
structure length
287
Chain Sequence
EQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA (5'-D(P*DGP*DCP*DGP*DGP*DC)-3')
publication title Structure of a NHEJ polymerase-mediated DNA synaptic complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
total genus 86
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2007-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2r9lA02
2R9LA 2IRYA 3PKYA 2IRXA 4MKYA 2IRUA
chains in the Genus database with same CATH superfamily
3DOKA 3DOMB 1KD1T 1SC6A 1UKUA 1N32F 4NASA 1XN9A 1SB6A 4EEYA 3UVJB 4HTIA 5I42B 1T0TV 1NJYA 1S6OA 5CYMA 2N4CA 5JXSA 1UCNA 3P4UB 4TY8B 4ECZA 1PJ6A 2YKOA 4K8RA 2ILYA 3Q8PB 1HIYA 3OL8A 3JTOA 3N5FA 2NXCA 3EICA 2Z58B 3OR1B 1JLEB 2HIYA 1T03A 2EFQA 3CDAA 2IVYA 2LA6A 4B9VA 2HHPA 4MKBA 4RW7A 2ZH1A 5J2PA 3NGRA 3A8KA 5HMZA 2KVIA 1YJNS 1KP6A 1TV6A 3QSYB 2WVFA 2WONB 1U49A 1JXVA 3CO0P 3GSIA 2ZH2A 4Q2MA 1UVJA 4F50A 4QIVA 4C0OC 3RB3A 3N01A 1K9MT 3ENVA 2HVIA 4G1IA 4QW9A 2DXDA 2H5JB 2CFXA 2CPDA 5KG0A 5F41A 3DGPA 2YNFA 1S1WB 1R8BA 1TL7B 3HPOA 3GCWP 4NEZA 1HNWF 1S9GA 3FSIA 3QGGA 1UWAA 1X4HA 5T41A 3C15A 1S6PA 2WW4A 2BBEA 3NOGA 5T14A 2V2VA 3W1YC 1AFJA 3DLEB 1B99A 3UQSA 1ZM2A 2Z2MA 5HJYA 1P27B 2F5GA 5L38A 3VAMA 2BR0A 4O3SA 3OTOJ 2VB6A 5E3QA 1RTHB 4HYKA 1G4CA 2B0GA 2LQ5A 3HFZB 4CLFA 1VQNS 2BJEA 4ZCKA 2UV8G 3HZEA 1S1TA 4PRFA 1BY9A 1GT8A 1OYEA 4IRDA 2O67A 3ILJA 5A8RB 3TX0A 3IGVA 5B0FA 1NK0A 1WF1A 3MR3A 4F3OA 3V6KA 1LW2A 4DPUA 3B4DA 5F3TA 3RYLA 4ECWA 4OI1A 3N79A 2YH1A 3BH6B 5CH7B 3GMGA 1FEHA 3ZZRA 5B0AA 2EVZA 3H2LA 2YWFA 1YJTA 2AEMA 2BACA 3GFHA 5FD1A 1VR6A 3KK3A 3DNCA 4Y28C 4MYTA 3RB6A 2XSJA 2IM3A 1S57A 1Q5VA 1VDHA 2BMBA 1H2VZ 4DX8H 1B0TA 5FIIA 5J2QB 4CYUB 1W2BR 2KT3A 3CDBA 3R97A 2L9WA 2DNOA 2IM1A 2AMCB 3GB0A 1D9DA 3GV5B 4ZLJA 4CO1A 3IG1B 1QVFR 2RVJA 3NKYA 2DJWA 5IQ6A 3V81A 1TKZA 1WORA 2W7PA 1PYOB 4ZCLA 1Y3KA 3UN2A 5K8NA 3QJLA 1MROA 5A0YB 1P8GA 1Y11A 3MAHA 3DRYA 5F9NA 4NA2A 1TU0B 1LWEA 1RT5B 5IFMA 1X9SA 1FDAA 1NKCA 1PJ7A 2ZH7A 1AXQA 3AH6A 4RW9A 4EBCA 4E98A 1K1QA 3EZOA 2EG2A 4WFZA 3IN5A 4ANCA 2W4CA 2ZBRA 3MAAB 3QO9B 4OJ1A 4PQAA 5DG9A 1Q0NA 3VGSA 4KRWA 1Y10A 2J7UA 2Y1JA 1FESA 4C8KA 4WU3A 3JTPA 4LBHA 1NDKA 2KM8C 1TKDA 2HMIA 3VV2B 4FF2A 1RHRB 2O66A 2KDOA 1K0VA 5KT2A 1C1BB 1RDRA 3SV3A 1KVKA 2N82B 2PGCA 1WDDA 5C42A 1BXNA 5A8WB 1RZMA 1NZAA 4CTAA 1JKHB 3W60A 1NRKA 1U8SA 4IFVB 1UVMA 1X4BA 4DCOB 3GFYA 2DNYA 4WPAA 1XERA 1HI8A 2RRNA 3HKZD 4IRCA 1HNXF 4ITSA 1QD1A 2OI2A 5GADI 4B3TJ 4IR9A 1TL3A 3DFEA 2WHOA 2XBPA 3S8SA 3PY8A 5F0UA 2VUGA 2N7CA 3OV7A 4N77A 3AD8C 2RU3A 3TZYA 3UFCX 1R27B 2MKJA 4M5DB 4FXDA 1EETB 1WI6A 3VR1A 4ID5B 3QBCA 1R31A 2HHHJ 1HARA 3TYTA 2VPWB 4H4KC 5J2MB 1LOUA 2ZH4A 4DR4F 3BSCA 3T41A 4XK8C 4XTTA 4OMFG 4KH1B 3D66A 1N54B 1K8AT 1N34J 3K17A 3R2CJ 3IWXA 5IWAJ 4PWWA 4P52A 1LW0B 1N4LA 4Y34A 4ZHRB 2CPJA 4ECVA 2H4YB 3HVTA 5GAGU 1QTNB 1RT6A 1VQ4S 5ETOA 2FJAB 4HDGA 4DV5F 4ZVOB 1WEXA 1FJEB 3KHLA 3QFWA 4AQYJ 1JLQB 2MQLA 4NLVA 3U1MA 2PI5A 2H9ZA 2MSTA 2M5YA 2OD4A 1X4FA 3MPWA 3GE9A 1EAYC 4YB6A 3H90A 2BE9B 1SH2A 2AIRB 4DV0F 3QRQA 3CCES 4C8ZA 2Y0SD 3GFXA 1XNRF 3ITHA 4Y00A 1LEOA 1HBNB 2R7RA 3RB4A 4OYWA 4P2MA 1S4FA 1FVSA 3T5HA 2CRLA 3O8WA 3BB5A 3ONQA 3N4WA 4ZPVR 3OQ2A 3CEDA 4P2XA 2DGQA 5CYQB 2LU2A 4RNFA 4X4UA 4YR0A 4LIRA 1F6TA 1O0PA 1FE0A 2V6AA 4MTPA 5FLXU 2HBYB 4FKYA 2IJNA 2BKPA 2G0CA 2XY6A 2I5JB 5E2QA 3HZGA 3I56S 4HDHA 4NA3A 5I4MA 1DRZA 3S01A 1URRA 1X4EA 3T9NA 1DFDA 1V3ZA 2CQ1A 3RRGA 2R8HA 4ZPAA 4FBTA 1T05A 3M32B 4NLPA 3EMTA 1NZ8A 3OR2A 4ZVTB 2JH3A 2W9AA 2E7WA 5F8LA 2VODA 2VJUA 4A8QA 2RDDA 2AX0A 1FRIA 4DV3F 3EYZA 4HI1A 4URSA 1Q16B 3MM6A 3TJ8A 3HFVA 1B7YB 5CAAA 5DLGA 5DG8A 2VPXB 1U24A 2BZ2A 1TKTB 2B9EA 1Y5NB 2W4DA 2B4UA 1VLOA 1NJIT 3SYZA 3W9HA 3W2WB 3G9CA 2ADBA 4NZ0A 1XNQJ 4OHYA 4CO3A 4KAIA 4Y3CA 1FNXH 3GR1A 5IT9Y 1L3VA 2QC3A 3OFEA 1RACB 1FJ7A 4DSFA 1KBRA 4ZVPB 3OHBA 2K06A 3CCTA 4ELTA 4DR3J 3ZZYA 1S1VA 2P6TA 3D5MA 5L8RC 4HTJA 3D7SB 3P6YC 3H4DA 4WK3A 2B9YA 4PG8A 2A6MA 2ZFHA 4Z2XA 2JHEA 1RTJA 2W8LA 4NLQA 4GKKJ 4CCHA 2VG6B 3FMWA 5KG6A 2M8HA 2NZCA 3MMCA 3SSRA 2VDIA 3UPFA 2F3JA 1RTZA 2XCPA 2GVDB 2B56A 3DLHA 3E51A 1WHYA 4LFBF 1F5CA 2OPPA 2X7IA 2J9DA 1FJGF 1HNVA 4QIFA 3BSAA 1IBKJ 2JRSA 4MT1A 3ZZOA 2AV5A 3KLHA 2HQ3A 1T7PA 2CZ4A 2AT1B 3PRBA 2QFIA 4WXWA 2IVFB 1X9MA 2DGSA 4W4MA 1FXLA 4PUOA 5KFHA 2VQEF 3DXBA 2GIRA 4J9MA 4WP9A 2OEMA 4DQSA 1KWMA 4B3RJ 4XPEA 4L3NA 4JI6F 4PEOA 3EM1A 4DQQA 3VAFA 2G1HA 1X0PA 4ED0A 1Z1ZA 1RT3A 4C97A 2HRTA 4B02A 2U1AA 2XB2D 1AYEA 4TY9A 4QBUA 2EG1A 4J9OA 1SL0A 4NZ7A 2IIHA 2X1FA 1RTDB 5IS2A 3SCLE 1M90T 4QU6A 1T9WA 1MU2B 3DLJA 3DRPB 4FPIA 4GVBA 2OEJA 3NCPA 3HT0A 4P75A 3MMBB 5D4LA 2XMVA 1MW7A 1D8ZA 1KHVA 1RT1A 3HSGA 3LPEA 3I6PA 4XPCA 3BKUA 4X4TA 4FF3A 3C66A 3DM2B 4O44B 3J7Z5 4OHVA 2XNRA 2VICA 3AOAA 1FWLA 4JP8A 3ZZUA 2ZE2A 1RWPB 1SQGA 5IT4A 5KG5A 2WOMB 5HN0A 4UOGA 2HGLA 3MTJA 3K5LA 3R5DA 2VASA 1ACMB 2RRAA 4RW4A 1OQ3A 2DITA 2D3OR 3MPYA 2WVBA 5HMWA 4YMEA 4GKJJ 4IOCQ 1IR2A 1N36J 5CD4H 5ETLA 1UWBB 4FS1A 5I3QA 4X66F 3SIPB 3EDRB 4DMZA 1EKSA 2W01A 3P49B 1IN0A 4KGVB 3DI6A 2AJQA 3BSNA 2K8GA 3QGIA 4IUFA 4LF4J 1XMBA 3L9ZA 4KE5A 2YWEA 2C2KB 3OVAA 3QZ8A 5HK4A 3AB2B 4BS2A 2KXNB 3G96A 1FVQA 1V3SA 1S6QB 4W98A 1KLMB 4BWJA 4NOHA 5ADZA 3JB9k 1NHVA 2E7VA 1LXJA 2DXEA 2W2MP 3M9NB 4DCJB 4ZOSA 3GTYX 4OI0A 2KFNA 3Q8SB 3K8WA 1MG7A 5C2GA 2XLKA 3R5JB 1ZETA 2W2PP 3CD6S 2HGNA 1ZAXA 1I94F 3BGLA 4C8MA 4ELUA 4ZPBA 1EZZB 1JWWA 4ZJQA 5HROA 1QAJA 3LO3A 2PDAA 3CULA 3OTEA 4C0BA 2OO4A 2BQ3A 4JYAF 2LQBA 2ZITA 4ICLA 4KGZB 5T7LA 2I38A 1QTMA 3NGUA 3LPYA 1VI7A 2CXEA 3MECB 1UVKA 5J1EA 4K4XA 2ROGA 2D3UA 1NDCA 3HX9A 2DT9A 1NU4A 3M8PB 4CLUA 3IBFB 3CNQP 3MI7X 5KFRA 1N52B 3GILA 2QA4G 1NMEB 2M2BA 1RHJB 1S9EA 2KFYA 2K3IA 2W2NP 3RRHA 1L3KA 2E5JA 1FE4A 3M8ZA 1FRXA 3CDWA 2QMWA 1WWHA 4HT7A 3BGUA 3KDNA 2EKNA 1MWZA 3CJTA 2V4QA 2AYEA 1TZ0A 2HWHA 2DIVA 3M1VB 5I3UB 3FBFA 2AD9A 3A3PB 2QT7A 1VK3A 4J9UE 5L39A 4E0DA 2EK6A 1DLOB 1M5KC 4ANEA 1JJ2R 3CGIA 1GX6A 3M2RB 3EPIA 1OYDA 3R5BA 4ES2A 5KOXA 3RRKA 2G4BA 2UXBJ 2CDRB 2ROPA 3KXDA 3JTNA 4ENOA 1DQ8A 1HHQA 4ZLPA 1VQPS 3L7OA 2OGUA 5FLXY 1HPZA 3AY0A 2C22A 2BUNA 2E5IA 5KFMA 5CXTA 3JQJA 2GVZA 4LFCJ 3IM9A 3POTA 4TU7A 2RH3A 1ZTTA 2ZBCA 3QNWB 4BWMA 1G2EA 1WEZA 4IFYA 1OO0B 1T02A 1J5EJ 2DXFA 4UOHA 1RA7A 1KQSR 4DDFA 4DSIA 4NI2A 4LSNB 2HS0A 3BYPA 2HNYA 3N0VA 1K0TA 1QAIA 4ECTA 3ZTQA 2VG7B 2EKYA 5BJRA 4RNOA 4DSKA 2VBZA 1OSCA 2UU9F 3FEXB 3KJVB 2RU9A 2VPYB 2ERRA 2MGZA 4DX6A 3JYTA 2Q43A 2V67A 4A8XA 3KK1B 3ISNC 2CG8A 4O3OA 4ED3A 2DTJA 3QYYA 1QDUB 1PKUA 4EYHB 3GG1A 3ENAA 4TQRA 4JV5J 3MD1A 3DRRB 3IMQJ 3PZPA 2Z2YB 1S1WA 2CQ2A 3HSDA 3I5AA 1C1CA 1RWKB 5DDQC 1R6YA 3VAGA 2W2QP 2KYZA 4YQWA 4PPDA 3T3FA 4I4BA 1G7CB 5CD4A 1FKPB 1RWNB 3C16B 3A13A 5B0CA 2ZKUA 1KR4A 4DL5A 4DPYA 4USWA 4CDIA 2HFUA 1UVNA 1VK8A 4NXNJ 2GMJA 3L95X 3UDEA 2QLXA 1GFWB 3L7UA 4P72A 4U67Q 2YWKA 2FVCA 3H59A 1AUSL 2QA1A 5GAEU 1BWVA 4OYAA 2J5AA 1Q82T 1YJUA 1XJWB 2IYGA 3DC2A 1WC1A 3BEGB 2IBOA 4I7FB 1E6VB 2M8DB 4FZVA 1VJWA 2PFDA 2OSRA 1CULA 4RW8A 2QA2A 4AL5A 1X0FA 1PIEA 3NS7B 3MWBA 2ZJPQ 2ZC4A 4CQ1A 2LQJA 3EVMA 3R5AA 1RWUA 4MIBA 3CTRA 2MZ1A 4J9VA 4E2FB 4HACA 4KPYA 5GMEA 4K5RA 2AJ2A 2ZD1B 1WHVA 4ID8A 2HNDA 3TA1A 1FFGB 3P96A 1EP4A 1U1QA 3NS6A 4DR2F 2R9LA 2IRYA 2XC9A 4KB7A 1C0UA 2AYBA 3FQKA 3Q0AA 2YNGA 4CYUA 3I9V9 2FQQB 4OYXA 3CJKA 4RNHA 5LMNJ 4H4MA 4X62J 4R0EA 4IG0A 2E5LJ 3R3TA 4WIIA 2Q1LA 3U1LA 3RR7A 3V5RA 4R8UB 1KDNA 3NLCA 1JNZB 2MMYA 3O5TB 3C14A 3CD0A 2LQ9A 2R7XA 1N0UA 3EWGA 1XEZA 2BW7A 3Q8VA 3ELHA 1WKJA 4UOFA 3LGMA 3ENWA 1NK9A 1YZ7A 4M1KA 4WKRA 1U8WA 4PWUA 4G1QA 4ZP9A 1OS5A 4A8OA 5ETNA 3OSPA 2JX2A 2UUCF 1ZA2B 3PR4A 5ETKA 3V6JA 2DR8A 3KTQA 2C2MB 2BANB 2G0IA 1Y9OA 2VBXA 2LQ8A 1KKHA 4F4KA 4DS4A 2Q79A 1FDNA 2YKMB 5KFEA 3AQOA 3P45B 3L3CA 2ALZA 2ZNYA 2HBQB 4GO5X 2AQ4A 1NK7A 3EDQB 3TAPA 2J8SA 4PQUA 2UXDF 2ZNZA 3AXMA 5C24A 2LMIA 2CNOB 4ZITA 1IM4A 1CJTB 2HQGA 3VVTA 2MKSA 3M6UA 1PBUA 3TWZA 2AYMA 2HAFA 4F36A 3CIZA 4KHPJ 2CQ3A 2FDNA 3CUNA 4ZPWR 4MMOA 1KVIA 2FJVA 5K5MA 2DY9A 4KV8B 3CD5A 3T19A 2BE2A 1VHIA 5G4DA 1WEYA 3CJ2A 3GPAA 4RNMA 3C3LA 1AA1B 4UOCA 4DV4F 2J6SA 3T1YJ 1CJKA 3J7A1 1ZTWA 2V9WA 4OZ5A 2HK3A 5KFQA 3I0SB 3THPA 1Q79A 3ZTRA 4EO6A 4TLQA 4CO0A 4NYZA 3DOKB 2Q66A 2JC1A 2JLFA 2PE8A 4NCAA 5DJBA 1MN7A 1YJ9S 3THVA 5CYMB 3OLAA 2C2NA 2YVSA 2DHAA 1NCLA 3U27A 4WP8A 4JV0A 1MMLA 1K44A 1EQ0A 1UJ4A 1RAIB 2BJ3A 2XHCA 3D1OA 4FPRA 4DFPA 1RU2A 2J0SD 2H4WB 1FRJA 3T6JA 2ZDPA 1F5BA 2CQIA 1OJ4A 2EFVA 4DV2F 4RW7B 5J2PB 2QMXA 5C5JA 3R2DJ 2YKNA 1QY7A 1DQAA 3CD7A 2XMAA 1TV6B 2F8HA 2XMTA 5F8JA 3RAQA 4Q0BA 3UE2A 1HNZF 3K5OA 3FK4A 1HI1A 4JI3J 3Q83A 5IXUA 3KHGA 5KFIA 2UUAF 1YVFA 4DPWA 3IR7B 2IY5B 3PW5A 4NYOA 1N5QA 2BVZA 2CNNB 1X7VA 2YNFB 4PG4A 3H5YA 5K20B 1XMQF 1S9GB 2ATCB 2D1CA 4C3KA 2AJ4A 4CLZA 5EX3A 4YB1P 2LDYA 2UXCF 3C15B 1S6PB 1FK9B 3MD3A 3DLKA 4C3MA 4DLEA 4Q43A 2HLTA 2FB0A 4ZVRB 3PVXA 1OQ6A 2ALYB 4J9PA 2Q6BA 3PEHA 2XTJP 2MQ8A 2H51B 1XIQA 3LWLA 2V2KA 3BV8A 2R8KA 1O6XA 4OV6A 3AJ2A 4JI1F 2I0XA 3OTCA 5F0WA 4C9DA 1HNIA 3Q86A 2XWXA 3IWNC 4CM0A 3TJ9A 2MHNA 2W25A 2CJ9A 2E9ZA 2R7VA 4JI0F 4QPTA 3D6FB 4QIWD 1NEEA 2ZBQA 1NH8A 4NXMF 3ILOA 1S1TB 4ERDA 3E01A 4RWXA 1GTHA 2V63A 5AT1B 4OHZA 1U25A 2HVZA 4FDFA 3QATA 2VG5A 1LW2B 4DPTA 2R7UA 1Z2ZA 4AE5A 5FDLA 1A0OB 1TELA 1APSA 1VRTA 5B7WA 5GAHU 1B70B 5AXNA 1SJFA 1HWUA 2RKIA 3VZHA 4FNIA 3CMAS 2RHQB 3M2VA 3M2UB 3G4SS 1Q4RA 4MK7A 4NLRA 2BXJA 1X9WA 5DG7A 5D4OA 5KFLA 4WFBQ 1OWXA 3KK3B 5GAEI 1S48A 3NBPA 5LJ3Y 3QRPA 2XSJB 9RUBA 4F7VA 4DUZF 1SPBP 5HBMA 3CCLS 3ZNJ1 2E1RA 2VQFF 3MCSA 2B7CB 1LNQA 2HFOA 2CADA 3Q22A 2UUTA 1DTTA 1X8DA 2F65A 4G3IA 4DUYF 3H98A 3CPWR 2C28A 2CQDA 3VAHA 4N76A 2Y8YA 4ZVEA 1RUSA 2HBZB 4OYBA 3V81B 4WU2A 1TKZB 1FKAF 3HHDA 2ZUAA 1X5PA 4PCQA 4GO7X 1MROB 2XYGB 4DSLA 1RA6A 2H5EA 4OV1A 3VHQA 3C6TB 1J27A 4F26A 1LWEB 2B8PA 4F25A 2Z8QA 4RW9B 2KVQE 2CG4A 2XYHB 3QSIA 4WKYA 2Y1LB 1Q7YT 3B6BA 4LF5F 3TZWA 4IQMA 3IR6B 4X4PA 1Y00A 2VIHA 2CJXB 1RWMB 5CQGA 1VBXA 2GC8A 1QJHA 2PN6A 3EX7B 1F3FA 2IJRA 3V4IA 1VCTA 2PMWA 3R8YA 4FYWB 3WZ0A 1IVZA 5C42B 3GIKA 4FYYB 4CTAB 5LXYA 3Q8RB 2BKOA 1N32J 5D4PA 1Z4UA 2EEYA 5C25A 5KT7A 1R8CA 1SC4B 2MZJA 1VLYA 2QFJA 1M1GA 2XM3A 1UJ5A 3Q89A 4QWCA 2GIFA 1KC8T 1ICEB 1CQNA 2CDQA 1TL3B 2LVWA 4HI2A 4N5SA 2IA6A 1SBRA 1PC5A 2CQ0A 2KG0A 2VKRA 4QCLA 4RNNA 4BC9A 2I9SA 5L1LA 1RCOB 3FJ2A 2MJUA 3Q8UA 1M0SA 2GX8A 2KM8B 4DQPA 2NUHA 1DY3A 2ZZTA 2QE5A 3ILLA 4L73A 3RB0A 2Z4PA 1KQKA 5D3GA 1T9TA 3AD7C 1N33F 3RAXA 1MWQA 2G2YA 2OKQA 3VCDA 3UCZP 5LXRA 2VL1A 3M9MB 1UAWA 4OYPA 2NXJA 2XYPB 4Y2CA 4CH1A 2YX4A 5HMYA 4K2XA 4CH7A 1R0AA 1IR0A 2QSFA 1PILA 4UW2A 2MHEA 1GQEA 1C2PA 1HNWJ 3B82A 1JLGB 3HVTB 1G6BA 2LFVA 4WFAQ 1S59A 3UCGA 2J6TA 3P5TL 2PMHA 2BJ8A 4OZJA 2W9BA 1NHKL 1Q8KA 3BJYA 4B3OA 4DS5A 1S1XA 4G1PA 3TX8A 1ZS6A 1YIJS 2YNIA 2KI2A 2RS8A 2RILA 3UD3P 4DBQA 2JDJA 3DDIA 5HVFA 1YBAA 1U1PA 4PXBA 3I55S 2YX7A 3DLGA 3U7JA 3CO9A 4LRAA 2FHJD 2NPIA 3ITHB 2CWKA 4RPFA 1DARA 1U02A 2A2CA 1AT1B 3UNGC 2KZZA 5IZHA 3D3BJ 1SQFA 1Q5YA 1T9YA 4YY3F 1IKWA 3K89A 1VQOS 2CQPA 2IM0A 3PRVA 2JEFA 8ATCB 3RG6A 4AXJA 2YQ1A 3MM8A 3D28A 4RZRA 2AJ1A 2AHOB 3IS9A 4QR0A 3I5CA 2YH0A 3WX8A 1N5TA 2V5HG 2ZDOA 3IR5B 2RQ4A 2KRRA 3M8PA 1UA1A 1ZYQA 2RD5C 1GH8A 4LF1A 3M8WA 2B9XA 4H4OA 3M6VA 2N4DA 4A8FA 4UY8T 1C0TA 1N0VC 4ZPTR 3D0IE 4UUXA 2VC0A 5KG3A 5K14A 3IBCB 1RAEB 4KH0B 1KONA 1ZM4A 1T05B 3G6YA 3OR2B 1T8EA 2FVQA 1S12A 1TL4A 2VBWA 2B5JA 3R7BB 1AUDA 1UW9A 1UMJA 3MM6B 2XY7A 4ILLA 1VQ7S 2JVRA 1U6BA 1LV5A 1ZM9A 2Y0BB 3I9ZA 2D74B 1I5OB 5C2CA 3BGFA 4USIA 2JLEA 2L3MA 1WACA 1UA0A 2C3UA 4KKOA 1RHQB 4HH0A 4CLWA 5EWGA 3CC7S 1EQMA 4QWEA 3GYXB 2W8KA 3N6MA 1M5VC 3JQKA 4RBUA 4OYZA 2MZSA 3MOZA 1JLFA 1N6QA 3ZFVA 4WWSA 2DNRA 2L9NA 1S1VB 4P9SA 2EK1A 4U7CA 2DGWA 3H40A 3LWMA 1RTJB 3M8QA 4JI4F 5IWAF 5IV4A 3IFEA 1HNXJ 3MMCB 3QT7A 3H4BA 1WUUA 5GMDA 4J5OA 3ZZTA 3KHHA 1VQLS 3GWCA 5D8HB 5L1IA 4JI2F 4NLGA 2N7YA 3HULA 2OPPB 3K5MA 3VTIA 4NX9A 3QT6A 3KJVA 3IXQA 3SQGA 1WDTA 2RUSA 1HNVB 3FBBA 2YBVA 3IO1A 2C3MA 3KLHB 3TQ1A 4TU9A 3BGRA 1SL2A 1FNOA 3DGVA 1O51A 3L4BC 4B08A 4PUOB 4ELVA 2DB1A 2V69A 4C11A 4DR4J 3QQCD 1WHXA 5CZVA 1YJRA 1XBWA 3JAMY 4LF9J 2F9JA 4OX6A 2OPRA 4FP9A 1WOSA 1TK8A 2OPQA 2E29A 2CQCA 1M5OC 3S6EA 2R7WA 1Q53A 3W2VA 2XS7A 4F0MA 4NE9C 3GP9A 2NXEA 1RT3B 4K4SA 3KWMA 4I64A 2P9CA 4WYLA 1YITS 2QSWA 3PCOB 1NSPA 3QLHA 5G0RA 4HHJA 5JJBA 2JLGA 3ZO7A 3TA0A 3H5XA 3K8VA 4DV5J 3GCXP 3SV4A 3UNYA 4A8KA 3TA2A 2HFZA 4GVBB 4MIAA 2XNQA 1EJ7L 2Z0GA 1S7HA 1RT1B 4ATNA 4B9TA 5DGAA 3KK2B 3BPSP 2VC1A 3CJ5A 2KXFA 3EXYA 4CLKA 4F2SA 1NM2A 1N5SA 4DL6A 2R7QA 4ETXA 5E41A 1U45A 2NS1B 3GONA 2CJYB 1AFIA 2ZE2B 5KFOA 4LFAJ 4A8SA 1XMOF 4C3LA 4IKAA 2MKHA 2YWWA 4DHVA 4IH6A 4RW4B 5AJ3F 1BQXA 1VBZA 4U9RA 3V6HA 5A6PA 2CPXA 1H7XA 4WTOB 4NLSA 1CG2A 3OJUA 2FZKB 4CRJA 2BJDA 3FEYB 1NNDA 4QYZK 1PBAA 1BD6A 2B4VA 3M30A 4CLLA 1L5UA 4JBCA 3MM5A 4BC7A 3D9BA 5BYRA 4MK8A 2Z2LA 3DI6B 1VC0A 4O0IA 3G6ES 4O23A 3S7RA 4DG1A 1YJVA 2DVIA 2E5HA 2HNZA 2HWTA 3AD9C 3R27A 1NLKL 3KUEA 4CT9A 4DSEA 4BLGA 3MCMA 4ED6A 4ZN3A 4GKKF 3AA9A 3N28A 3T6BA 2DNGA 5BR8F 3L7PA 3O3LA 3A12A 5IV3A 3SSQA 2MPUA 1XR7A 1HQ2A 4M5KA 5A8KA 2BX6A 4Q7AA 5CABA 3TZZA 2G2OA 5HROB 2GMLA 3HVAA 4ICLB 5T7LB 4CI0B 1WC4A 1XTZA 2GO8A 4LR8A 4F4XA 2KFZA 3D54A 4KR0B 5J1EB 1ITPA 5LT5A 3KG0A 4CLSA 1U1LA 1SC3B 5LSRA 4Y2IA 2CPIA 2OFHX 3IA0A 4Y65A 3PJWA 3LUYA 3F56A 1D9FA 2ZVSA 4IO1A 2B4PA 2E5GA 3BS9A 4N7TA 1T3NA 1S9EB 1NPPA 3FSYA 5J2NA 3MMAA 4YN3B 2WSCC 3KG4A 4ZA1A 2DD8S 4QR2A 3FBEA 2KL8A 5ITHA 2CQGA 1BQNA 1HKAA 2YX1A 3OUYA 1S76D 2MXYA 2POKA 1QVGR 4CO2A 2YNHA 1EB0A 2DPJA 2HKEA 5KFFA 2YKAA 1UPMB 2ASDA 4K0KF 1FJGJ 2GCFA 1SJ4P 3PKMA 4CNZA 2FZGB 3OFHA 2VH7A 3TW0A 2F40A 3ZNUA 5CA5A 2ZH9A 1KSPA 1NSKL 4WBFA 2AEFA 2RDJA 2RQCA 1H73A 4GC7A 3CE8A 2VQEJ 5F8MA 2F4VJ 4FYVB 3OXGA 1HPZB 3MHYA 1RXOB 2I1RA 4OZLA 2MLZA 1HA1A 4GRSA 2GGPA 3CSKA 5KG4A 2GVZB 3QAEA 3EUNA 5JVHQ 5BYSA 2JFKA 4LR9A 2E9TA 3POTB 3PW2A 1D09B 2NPFA 2QTWA 2HWIA 4IFYB 1VQ6S 2EXUA 4J9SA 1HBMA 3DMJA 5HI7A 3AJ1A 3FMBA 4NI2B 2X3GA 1VIOA 2PFFB 4IH5A 2HNYB 1N36F 1RHMB 2E7XA 2RHSB 1DQ9A 3R1HA 1GXTA 1SC1B 3CCMS 4CM2A 1NJZA 1AZSA 3PYGA 2H48B 4KGKA 1LKZA 4K4VA 2RIJA 1IR1A 3JSBA 5ETVA 1TK5A 2DK2A 4A46A 1TKXA 2MGZB 3JYTB 2G1DA 5KFAA 4JV1A 2MQOA 2GAHC 3MFIA 4DL2A 4LR7A 1IBCB 2HEKA 1WNEA 3HKWA 1RCXB 4ETZA 2HFNA 1FRKA 1F0XA 3G6VA 4C2MA 3G87A 1YG0A 5KG2A 4ZMMA 1C1CB 2L48A 3W9IA 1EARA 2R8GA 4YDDB 3NMAA 4LREA 2C3OA 4OZNA 1OPZA 5IT9U 3TOQA 1FK9A 3J81U 2GZOA 3D6HB 1RABB 1WI8A 1MMDA 2ZVIA 3ZZZA 1P9YA 3SCIE 3TUIC 4A8MP 2RRBA 4QIEA 3PX4A 5L1KA 4X66J 1FA0A 2XO6A 3HHKA 2XS2A 1QLNA 2DNNA 1VQ8S 2XZWA 1NO8A 2DNPA 1SIZA 2J8AA 2BYCA 1Q81T 3ETMA 4I67A 3C46A 3WX4A 3DRSA 2VHGA 2HHQA 3QGPA 2DISA 4QU7A 4IG3A 1U48A 3B4MA 1CSJA 3KFWX 1W25A 2XEXA 2B9WA 4ZVGA 1CULB 4OX9F 4RW8B 2K2PA 4M95A 4EFAC 1PYSB 4N56A 2KJVA 1LWCA 4J37A 3NOCA 1KTQA 1ULRA 4D3GA 4LF7F 3TAMA 4HACB 3EZUA 2FLOA 4TYAA 4DEZA 1S4EA 1U1OA 4FF4A 4YDXA 4ILRA 1Q8LA 1I94J 2WTFA 3M6XA 2IBKA 3FCVA 1L3TA 3M2UA 2HNDB 4JYAJ 3RR8A 4K7QA 4LSZB 2R7TA 1ROFA 2RUGA 1T95A 1EP4B 4LF8F 4OYMA 1RHUB 2QMUB 3IBWA 4ZP6A 3SZ2A 3R5GA 5KFYA 2XY5A 1C0UB 2J9DE 3OVBA 2XZTB 2G9OA 4R0JA 2YNGB 5M2RA 4ZLNA 3KNAA 2RQMA 5B0DA 3CJKB 4PYDA 3M6WA 4H4MB 3FZ2A 2O5DA 3I5BA 3NP5A 2EC2A 3JSRA 2OLWA 4MKVA 2GHVC 4NRTA 4IG0B 3W7BA 4LFCF 1EKRA 4DR5F 2D9PA 1WSRA 2G0JA 3C14B 2XLJA 3SQOP 2U2FA 3OPKA 2Y9HA 2JWNA 3C6TA 2B4OA 1OPIA 3TRGA 4KPCA 2HHWA 2GS8A 2J9CA 1YX2A 1RKJA 5DLFA 1O8BA 4I2PA 5F8HA 2C2RA 2XG8A 2N3OA 2UVUA 4G1QB 1HBUA 2FUG9 5LL6d 1WF0A 4DR1F 4WFYA 2K3KA 4PAAA 1VQ9S 2YXLA 4XO0A 3CT9A 1CJVA 2KHDA 4DOZA 2OAUA 3AJDA 1S49A 4YOEA 4ANDA 2M7SA 3EGVA 3CCWA 2M52A 2HURA 2F9DA 2E9RX 3LOUA 4DU7A 2Y1IA 3NNCA 4BCAA 1MN9A 4PQUB 3NL0A 3MM7B 2C42A 5K8MA 5C24B 4PWDA 1FT8A 5DQHA 2BM0A 1DTQA 1W2IA 1F2HA 1UL3A 1SJRA 2I6WA 2VOOA 1FI4A 1RI7A 3J80U 3PW0A 3GSDA 4NLYA 3BQ2A 2V2ZA 3J7YU 1TMJA 3KYLA 4RU9A 1D3WA 1U1RA 2LXIA 3C6UA 2WW8A 3CCQS 2BE2B 4OQJA 2UU9J 3G6XA 1NSAA 1RWVB 3UW1A 1CJKB 3GYGA 4P74A 4RBVA 1I1GA 4I68A 3J7ZT 1LWXA 3BO4A 3SFUA 2JVOA 5IOLA 3BO2A 1J2VA 4ZJLA 2ZHAA 2R8JA 2BEFA 3E8OA 2PSZA 1HR0F 5DZ7A 4V19J 2W4PA 3VF0B 2DNQA 3QFHA 1F3VA 1JLGA 3DXSX 3WIUA 3OTBA 2QIFA 4TVAB 4F4WA 1KVJA 3ZTOA 3RTVA 3DU5A 2N3LA 4URGA 4B3MF 4ZVUB 2WVEA 1HL6A 1KS2A 3H5UA 1NBEB 5IQQA 2UUBF 3W5ZA 1X5SA 1U0HA 3AOBA 2H65B 2VA3A 1KFSA 4WJBA 2ZM6F 2Z2ZA 3TNVA 4ECXA 4LMZA 1YRXA 3US5A 2C3PA 2MLXA 2YKNB 1YDLA 4Y2KA 4ZN1A 1R8PA 4QJVA 4K4UA 2L08A 1UPPA 5AE2A 2PA3A 1Q78A 5LMNF 4Q0BB 5H1SV 3J81j 2HZVA 3I4PA 2E5LF 3A1YG 3HP6A 2OUGA 5KOWA 4USJC 1SUQA 3OFFA 4P2SA 3MEEA 1TQLA 2W9CA 2Y3YA 3BH7B 2D9OA 3KLFA 1HQUA 3HSZA 3I32A 4ZP8A 2FLPA 2HLUA 4WE1A 4O3NA 1REGX 2QZ8A 4C8OA 3TVKA 3PO4A 1RTIA 4X64F 1V3RA 3LQVA 1HFEL 4KBIA 5L9XA 2ZH3A 3DLKB 3U1NA 1RWWB 5BYQA 4DR2J 2AJFE 2OPSA 1RWXB 2DEIA 3LP2A 4YB5A 2LDIA 3Q24A 2DRAA 3GJQB 4AD6A 1RT4A 1N5VA 2DYAA 4MKAA 5D0GA 3BKFA 2DGVA 4NRUA 1NUEA 4I6WA 3NAIA 3NRBA 3UDLA 4M5GA 5ETQA 1HNIB 3NGKA 1D1UA 1FJCA 2IJFA 3QT5A 3PKYA 1H0HB 3H2VE 5KFSA 3RAMA 4F3MA 1X5TA 1VHFA 2EFOA 2XLIA 3E01B 4OLOA 4EZ6A 1WELA 1M5PC 3UWTA 2VOPA 4FYDA 1XK8A 5A2QU 3ET6A 3BQ1A 3MEKA 2VG5B 4KC5A 5FDLB 1VRTB 3MPDA 1E6YA 2UUCJ 3KLIA 2IDEA 3J81Y 2RKIB 4YFUA 1WC5A 3MEDA 3KUGA 3M2VB 4K59A 3AQPA 1SVDA 3JQMA 2QV6A 3NBPB 3GIJA 4Y2AA 3PNIA 3AXKA 5HBMB 4F02A 4YHHJ 2HVHA 2HHTA 4NLTA 4LQ9A 1RBLA 1DTTB 2ZBIA 2UXDJ 2APOA 2ZZNA 5DDPC 5KFZA 4JI5J 3ZZ0A 3KLGA 2RAQA 2DNMA 4C7QA 1M5SA 5EWFA 4RW6A 1U47A 2SXLA 3A8JA 4WZQA 3T1HF 3W65A 4DV7F 3EGZA 1QE1A 1CC8A 4C4WA 4USTA 2NREA 1NB7A 1AB8A 4YS2A 3WIVA 5JVGQ 1CPZA 2NUUG 3TUZC 2P5VA 1WD6A 4DV4J 3CWJA 1YJ7A 4DWIA 4DV1F 1U2FA 1WTFA 3FSXA 5KFVA 3LW5C 2B43A 2CJBA 4ES3A 2RMLA 4LRBA 2IDLA 3HHLA 2AX1A 1IKXA 4EBEA 3V4IB 4XDDA 2MKYA 1FO1A 3UI3A 4FVCA 4OX8A 6AT1B 3R6LB 3H20A 2IMOA 1JIHA 4BHQA 3UN3A 3VAIA 4QZVB 5ETMA 4ER8A 1FNMA 3O6QA 5C25B 2KTQA 4PABA 3OD2A 2BOPA 2F4FA 4AUKA 4KHMA 3MR5A 4J9LA 1S10A 4WIQA 1Y5IB 1R6VA 2OFGX 3AOCA 5KFKA 2LCWA 4OLPA 1NSQA 4Y2MA 3CC4S 2XGQA 2AGOA 3CCUS 2FY1A 4UZBA 4F4ZA 1FXDA 3AHPA 2KO1A 3JS9A 1Y0HA 1XR6A 2LKZA 3KK2A 3WC2A 2ZWPA 3QGHA 5KT6A 4DV2J 5EN1A 5AXKA 2JEIA 2CZ9A 1QUPA 2ZEJA 3CCJS 1TVRA 3MPVA 4U95A 4NLDA 4WP3A 1JLAB 1JNRB 2BA9A 2CUYA 1HNZJ 5D3GB 3RU0A 1FD2A 4M8LA 1NK4A 3ZTSA 4F0KA 2UUAJ 5AXLA 2CZVC 4X84A 4HHHA 1FHTA 5KFUA 1R0AB 1IBMF 2QL7B 4V19X 5GADU 1WF2A 3THTA 4NLWA 2VF3A 2BW2A 1P6TA 4KQZA 2UXCJ 4LBIA 3GZ7A 3BKTA 3R7NB 5KG1A 2MKKA 4FN5A 2W9BB 1RAOA 1FWKA 2RF2A 4LVOP 4DV6F 3SBMA 3A8EA 2ACMA 4B3OB 4ZKAA 2HQCA 3J80Y 1UVIA 1V9OA 2MQMA 1S1XB 2P2CB 2Q6CA 1B0PA 2YNIB 5F8GA 1FRLA 4GC6A 2XI2A 5L1JA 3W63A 1GNKA 2VV5A 2YKPA 4ECQA 4JI1J 3TEGA 4FVMA 3HD2A 1S0MA 3DLGB 3HHLD 3OXFA 4YEAA 4M63A 4ZCIA 3BN4A 1REVA 1YK9A 3GIMA 4JI0J 1Y3JA 2VKZG 5DETA 1DAXA 2KYXA 4I0WA 3T1AA 1D9AA 2A0FB 3ENQA 1HW8A 3BZQA 5ETTA 1Q8IA 1T3OA 5GAGI 4NXMJ 3EJMA 1IKWB 1PYTA 2EFPA 4O4GB 4A47A 3LAMA 2RNEA 3KLEA 3MM8B 1LK5A 2E1CA 3IS9B 1ZPVA 2HHSA 1TL1A 1X60A 2H1YA 5CCLA 2Y8WA 5IM0A 3QMQA 1B4SA 1ZAWA 4H4OB 3MUVP 1CVJA 4JI8F 4CO4A 1LFPA 4IYQA 3SXLA 4DUZJ 1S1UA 1C0TB 1VQSA 2VQFJ 3OJSA 3TUPA 4C8YA 5KFPA 5K14B 4WYWA 4DUYJ 1PAEX 1KQGB 3EVWA 2RT3A 2GJ2A 2BJ1A 2IAJA 4X4QA 2OTJS 3IAS9 3RW6A 3TANA 3CDUA 2LU1A 2B5JB 2MKCA 1CBKA 4LJMA 2YY3A 1IBLF 4HT5A 2HRYA 8AT1B 4ES1A 4OX7A 1GMWD 4RUAA 4GMKA 1K1SA 4ECYA 2VFTA 5K8OA 1UTAA 3CMES 4KKOB 3M8SA 2UP1A 4LF5J 4PKDB 2E1PA 2FYXA 4C8NA 3BBCA 2P8IA 3DN9A 1RBOB 1HYSA 3DLLQ 3SCKE 1JLFB 3V6DA 1N6QB 2R2RA 1F9EB 2DHXA 3BGOP 3LAKA 4X4OA 5B0EA 3CXCR 2XMKA 1UFWA 4M5NA 4DPXA 1NK8A 3I96A 2V8GA 2M4MA 4YB7A 1BGXT 1NK5A 2DO4A 2MZRA 3M8QB 4RL1A 1BC6A 2GNKA 1RT7A 2V34A 4XDCA 4CWBA 1ZZNA 4DXLA 2OELA 4CLYA 2DNLA 5M2PA 3MZIA 4UTGA 4C98A 1HMVB 2ZHBA 1SI9A 4F4YA 1TMMA 5ETRA 2DNHA 2FHOB 2AGPA 4K50A 3SQGB 5EWEA 1IJFB 1RT2A 2CIMA 4YP3A 3MCOA 4V1Ak 3UR0A 5A2QY 4WFXA 1SKUB 1RBAA 3U02A 4MFBA 4D3HA 3NMRA 3BGRB 1RQ0A 1U1MA 3GJSB 2MLYA 3QIPA 1UP1A 4ZIVA 2HPUA 5D15A 4C11B 3HDSA 3CJ4A 4RBTA 2QYGA 2R8IA 1N33J 4KO0A 3FRYA 3HK2A 1JLBA 3DOLA 3GQCA 1HWKA 1JQGA 2OPRB 1VJQA 3P8BB 4K4YA 3AB4B 2ZOMA 2OPQB 3OTDA 2IC3B 1S79A 3EGNA 3WHIA 3IAM9 3ILIA 2FTRA 2LXFA 3W2VB 1YHQS 3QJPA 3J7AN 3UD5A 1WHWA 1VYAA 1U2RA 3Q2TC 4DQIA 2YWHA 2CNKB 4UQGA 4DL0C 1Q8BA 2LYVA 4DR7F 3QLHB 5G0RB 3FRZA 1PGZA 3H2UB 5AE3A 3M9OB 4NMLA 1H2UX 2KKHA 3RUBL 3I31A 3W8GA 2LP4A 1IWGA 4PYAA 2XZDB 2VFSA 3VQSA 1CEZA 5F9LA 4ZCMA 2FHMA 4EMDA 1WG1A 4J9QA 1YZ6A 2JC0A 2XGPA 2IVMA 1YTYA 2XWYA 2YTCA 2J76E 2HHUA 3CJQA 2CPYA 3VGUA 2KN4A 2BJ7A 4K2JA 3RBXA 4HKQA 3EE3A 2B3TB 5MLCV 4YY3J 5D6GA 2ACYA 1NJXA 1XC9A 3DYAA 5D0HA 4F2RA 4LIWA 4QOTA 2W1BA 4M5HA 4DU8A 1PCAA 5B0GA 3RJMB 2B51A 3M30B 3SDEA 4NEYA 3MM5B 2GJFA 5KFXA 4KY3A 1FRHA 2QG9B 4HH1A 2HQFA 5DDRC 1GK8A 5EX0A 1Y5LB 1RAFB 3GIRA 4DG1B 2ZHOA 2AF6A 2F63A 2HNZB 2FHKA 1FD8A 2BQUA 2IHR1 4LRDA 1K73T 1NK6A 2KH9A 4N8NA 3CIMA 2QJ3A 4ZDNA 5KT4A 3NNAA 2HZCA 3PX0A 4A4JA 4K4ZA 4USHA 4DR6F 1VIXA 2FJEB 1MNEA 1SJ3P 4NLUA 1F60B 4ZK7M 5A8KB 1AW0A 2MTLA 3OT9A 1U4BA 4JUZA 2P6SA 4JI7F 2EC0A 2FIUA 2GHPA 1ZAVA 1R43A 4C48A 1HLWA 3PIOQ 2X1AA 1SH0A 5LMUF 2O01C 4CT8A 1VRUA 1LWFA 3CF5Q 3F44A 3B8HA 2CYYA 1FERA 3WDOA 2ZH8A 1WG4A 4NWBA 4FS2A 2IM2A 3MM7A 1ZBTA 1U2CA 4LF9F 4CLTA 5AE1A 1PO6A 1JLCA 2K1RA 2GIQA 2VFRA 2A10A 5J2NB 3F41A 1Q95G 3MMAB 2RJZA 1D0EA 4JI4J 1Z2LA 3JSMA 1PJ5A 4F4AA 4MYUA 2PA8D 3KMQA 1BQNB 1HHTP 1W7WA 5HANA 2O3DA 3OUYB 1NHUA 1YGYA 3NCRA 5DQGA 3LP1A 2YNHB 4JI2J 4O0NA 4CNYA 4QPXA 1YBTA 2AZ1A 3C8YA 3E3XA 2UV8A 2AP6A 1O5JA 1NB2A 1Q7LB 4B9NA 4RWWA 1NJWA 3B54A 1ZA1B 4O3PA 4XIUA 3DKDA 4H4KA 4M5JA 1QUVA 1Q86T 4H54A 4F67A 5KFCA 1GXUA 1V5IB 4X65F 1M1KT 4DF8A 2QN6B 2OJ3A 4TYBA 3OFGA 2GGPB 4MAKA 5KFNA 3A3OB 4LFAF 1S77D 3EGWB 1IQZA 4RU2A 5HVGA 1GTEA 4X4NA 3KNGA 5DS7A 1HBMB 5DZ6A 1RJJA 2IA0A 3DMJB 3G8TA 1EIYB 4N47A 4I56A 1UW4A 3UR3C 4ZVQB 1BWEA 3HVWA 1RAGB 2J9EA 2BOAA 2MQPA 3SEOA 2MY7A 1AZSB 4NLXA 1HI0P 3LP0A 1XR5A 2DHSA 4L6V3 2QRRA 1HBOA 1TKXB 1U1NA 4IOAQ 4K4WA 4TN2A 5F3ZA 2HS4A 2JFDA 1N56A 1OSDA 3GV7B 4HVZA 4F0HA 4M5IA 2L41A 3K2YA 1SV5A 3A3NB 4DZ6A 2MYFA 1XMOJ 3IRXA 1XWLA 2FGOA 4NA1A 1N5YA 3MF5A 4B3SF 1U09A 2OD6A 1PC4A 3MM9A 5AJ3J 3MR7A 1R7IA 1OY8A 1ZM3A 3D4JA 1U6FA 3GV8B 7AT1B 4ED8A 1SH3A 3HJVA 3BR9A 1YWXA 4LRFA 1VQKS 2Y1RI 4R5PA 5HAOA 1X4GA 2F8MA 1T9UA 1IKYA 4HLBA 1G3OA 1R89A 4PZVA 3PRDA 1IKVA 2V4JA 4IH7A 1U26A 2ZOFA 1FKOA 1H72C 4I2QA 4NMXA 1T9XA 3KUHA 1FFSB 3W3SA 2AZ3A 2CPZA 2W2OP 3DRSB 4KSEB 4IG3B 1Y7PA 4YR3A 1HD0A 1B7FA 1DJ0A 5ETPA 1M1HA 1C4AA 3FQLA 3ZTPA 5THWA 4EUVA 4C6AA 4RR5A 1HQEA 3EPGA 3I82A 4LF6J 3Q8QB 4NLOA 4OI3A 5BR8J 1LWCB 2RB7A 5EUHA 4KJIA 1TL5A 3FFIA 4X4VA 5JMNA 2AGQA 2LECA 3TAMB 1CS4B 1FX4A 1T9VA 5LSOA 2IFXA 2CPHA 2DCLA 4WK1A 5D4NA 1FDDA 3JAMU 1FTCA 1RSCA 4DX7A 4ZLLA 2QA4S 1HD1A 2DH7A 1X4AA 3MEGA 4PG5A 3RBEA 4IRKA 4LRCA 2J6UA 3GG0A 1VC6A 7FDRA 5DGBA 2F4VF 2NSBA 4KFBA 1S97A 1RKIA 1WOOA 4RJVA 4J9KA 3X1LB 1A7GE 4MIWA 4L75A 1LFWA 4I69A 4G65A 2H54B 4AL6A 3UO0A 2QGFB 4WTYA 4EU0A 4TLRA 4QWBA 4HHUA 5EDWA 5FJ4A 3G82A 3A4TA 5IT0A 2B6AA 1JJHA 1B3TA 2GA7A 4I2PB 4NCGA 3LANA 4Q8EA 1R8HA 4HL9A 1HBUB 4K0KJ 1RAAB 1EX8A 3OSNA 2AWZA 4KHRA 4AFFA 3PR5B 5IC4B 3GU0A 3MUTP 2PC6A 2A2DA 3PFOA 2XI3A 2FJWA 2FHJA 2DR5A 2H5IB 4OYOA 1CJVB 4ZPDA 2WRMA 2R7SA 2QLFB 1X31C 3R7SB 4X4SA 2DGTA 2NZ4A 1JMTA 2V8PA 3DHWC 1R0CB 2K7JA 5HP1A 2G13A 3G86A 2ZBPA 4PWDB 3IRWP 1YRUA 2EFGA 2EWHA 2LEAA 1FX2A 2A6OA 1FRMA 3BREA 2DR9A 1DTQB 3C2PA 2UUWA 4X4RA 2X1BA 3KOAA 4OI4A 3VQTA 1WC0A 2NSCA 2M0GB 3P5BP 2HVEA 3C6UB 4DLGA 1H6KX 3W9JA 4ZPCA 1RU1A 1UJ6A 3I0RA 2XSFA 5KFBA 4USVA 3PW7A 1JLAA 3FC9A 3BSOA 2FC9A 3TVZA 3OTOF 1UVLA 4UT4A 2E1AA 1NXIA 3PJXA 5E0OA 2DGXA 2V8DA 1A9NB 3K0JA 4R25A 2JEJA 1NDLA 2FGCA 1VBYA 2HK2A 3QT8A 5CYJA 3H42A 4CIOA 4YR2A 1TUVA 3MMJA 3EZ5A 2CQBA 1S0NA 1TUWA 3NG8A 4TKTA 2XULA 5HLFA 2BQRA 3W61A 1R8AA 5KT5A 1WG5A 4IDKA 1S0OA 4TXSA 5I3PA 1U0HB 4UF4A 4U8YA 1BQMA 4USKA 4CH0S 4KTQA 1YKWA 2LEPA 3HVRA 2D3ZA 4OJ3A 3CJ0A 4USUA 3MFHA 1KN6A 3WBZA 3HD1A 5F8IA 3NNHA 2XMMA 2C2ZB 1S5ZA 2DEJA 3HCXA 2CQ4A 1VISA 2JOQA 1KQFB 4OX9J 1SUQB 4W90B 3D1HA 2ATLA 4O4GA 4AL7A 4RUBA 3MEEB 5ETSA 4LSLA 4Y6IA 5AXMA 3LALA 2W9CB 2MSSA 2W7AA 2YPYA 1J5OA 4LF7J 1GAOA 3KLFB 4DL4A 5KFDA 4DL3A 1S9FA 1HQUB 1VBKA 4DFJA 2VONA 2Z30B 4IR1A 4ED1A 2LLZA 4WE1B 2ZUGA 1RTIB 1CJUA 1YQHA 1U0SA 3BM7A 5HQ8A 2HGMA 4LF8J 2QEXS 2OPSB 3LP2B 4L72B 4TNOA 1RT4B 2O1PA 2C1EB 1ZH5A 2PEBA 3DOMA 5KFWA 1GX5A 3N6NA 2YWGA 3NXZA 3DRXA 3UVJA 5I42A 4NYPA 1JB0C 2QO3A 2L9DA 4USMA 2UVRA 3CJRA 4RX6A 4DR5J 3CMQA 4TY8A 1RADB 3OLBA 1QAYA 3OBIA 4DZDA 4B3TF 3BPDA 5D0RA 3NWGA 1UZDA 3D6MB 2UVVA 3OR1A 1VC5A 1JLEA 2PIIA 2PD1A 3QJJA 2FJBB 1DZ5A 2V9KA 4UZCA 3ET6B 2WZ1A 3QRRA 1N8RT 3AA8A 1TAQA 2XMUA 2EBEA 3OL6A 2HHHF 1E6YB 3KLIB 3VAKA 3E2EA 1F9FA 3D3CJ 4DR1J 2WONA 3MEDB 2M3DA 2WVDA 3NY0A 1GMUA 5U47A 1YSJA 1GMVA 2DO0A 5E7OB 4F8RA 2HSEB 5HQMA 2HQDA 4ZJOA 4M5MA 1VQYA 1DHMA 3UDCA 1N34F 1LK7A 2RQKA 4EI2A 3BYRA 2R7OA 2KT5A 3D2WA 1TL7A 3O2IA 3CDEA 2WK4A 3KJQB 3VZIA 2BRKA 3VVUA 3CJ3A 1HMVA 1VFJA 2DH8A 3KLGB 2I8EA 4DI6A 4KIAA 4RW6B 3TO8A 1PAUB 3PV8A 3H25A 4RUCA 3PHEA 5GAHI 2CQHA 1N88A 4AQYF 2MY8A 4DN0A 1QE1B 3DDKA 1P1LA 5LSLA 4OHWA 3RZAA 4XAKA 3DLEA 1TFWA 2DHGA 5CCMA 3K5NA 3QAUA 4OI6A 2MQQA 1OY6A 2OSQA 4L74A 5BXIA 2NLWA 1JK9B 1NAQA 2HHXA 1FFWB 1RTHA 1JX4A 3M7VA 2FJXA 4P2FA 3HHLB 1IKXB 1UFLA 2OMLA 2IC3A 4KT0C 3ZC4A 3GYNA 1HR0J 3P3DA 4C8LA 3JXOA 5A8RA 5B08A 4P71A 2VDHA 3H0PA 7FD1A 5GVQA 2W24A 2WCXA 2V94A 5J1NA 4OL8A 2NXNA 3KG1A 1RWOB 2DPIA 1TFYA 2R3VA 4RKUC 4B3MJ 5E3CA 1HW9A 1RAJA 4LQ3A 4QW8A 4F04B 4QWDA 1R0BG 2UUBJ 3PFEA 4G6VB 3CJSA 3T5JA 3W5YA 2DRBA 2ZM6J 4I6AA 1H3DA 1B0VA 2F1FA 4DV0J 4PXEA 1F1BB 1LXNA 3BDPA 5J2QA 1TVRB 2ZJRQ 5KG7A 1UZHA 1XNRJ 4M94A 2AEJA 3KDOA 4EO8A 3HF5A 1FDBA 3ZXWA 3IG1A 2QLWA 3FVYA 2XHWA 3FBCA 3FGVA 4PG7A 5SUHA 2XS5A 2MZTA 4CZCA 4ECSA 2ZJQQ 4M5LA 1JJCB 2AU0A 5A0YA 2JEGA 4OZ3A 1BHNA 5DDOC 3WQPA 4U7UD 1BMQB 1KTVA 2YQ3A 3ETOA 1RT5A 2BJ9A 3D68A 3W62A 3JSYA 4P7TA 2J0XA 2D3O1 4X64J 3MAAA 1XNQF 2HBRB 3QO9A 2Z56B 5KT3A 3BQ0A 1AROP 4L3KA 2J0WA 3UD4P 1H98A 2RF2B 2J7KA 3GIIA 2HVDA 4PXCA 3QWPA 1C1BA 2RS2A 2XQCA 4DR3F 1HWIA 2G2ZA 5A8WA 2Z57B 1JKHA 2WB1D 3ISND 4DX5A 4L76A 3LH2S 1UFKA 2R42A 4IFVA 3OW2R 2F8EX 4KGMA 4LBPA 4U6PA 2VFUA 2COLA 2MZQA 4WFNQ 3AT1B 4YHHF 2B8QA 2DBBA 3LGHA 1REVB 2ZH5A 4W92B 2CAJA 5M2UA 4EBDA 4DV3J 1YI2S 4JI5F 2GQQA 2HAIA 3TZXA 2FY8A 3PDNA 1ZZFA 3Q2SC 3TEHB 4Y0FA 3NGDA 5RUBA 3PYDA 4MH8A 3EXCX 4M5DA 3NGTA 3NCQA 3V4MA 3K57A 4Q5VA 2KJWA 3KLEB 3V2UC 1IBKF 1EETA 4ID5A 3FCWA 3GLJA 3CCRS 2M88A 2WSFC 3CJ8A 2OP5A 1S0VA 4DN9A 3ADAC 2IYIA 4ZP7A 1VRQC 1SKRA 2OEKA 1TL1B 5J2MA 3BR8A 2GAGC 4DFMA 3PX6A 5A6WA 5IM0B 4B3RF 3QIDA 4EYIB 3D1QA 2FJDB 2ZH6A 3CCZA 3HSJA 3X3UA 2AYGA 2WBRA 1S1UB 3KJNB 3W5XA 5KFJA 1ELOA 3FDSA 5DO2A 1LW0A 3DCAA 3VGTA 2F7VA 1U7LA 2X51A 4OI2A 4ZHRA 1G1XA 2DR6A 3MXHP 2HRUA 1R3NA 1VQMS 1WKLA 4FNHA 4UQTA 2IAJB 2D7SA 5H9EK 5EGYA 2HIQA 3WC0A 1GXLA 3H5SA 3R5CA 2B7BB 4LFBJ 2ASYA 4ED5A 2EBGA 3GFZA 3T1HJ 1BLUA 3BO3A 3SI8A 3BN7A 3G8QA 4DV7J 1JLQA 3HT3A 1KOHA 2FPHX 1T03B 1RLCL 2EPIA 3CW2C 2JJ4D 1HWLA 1FEEA 4BBYA 2R4FA 2ABYA 2PT0A 3W8PA 3T5KA 1T94A 5HVHA 1CQMA 3TI0A 4CP5A 4DV1J 3MTKA 4WXOA 4NCBA 1HYSB 3NEKA 2KG1A 4FKXA 1RP5A 3TVYA 3V6DB 4JI6J 1ZOTA 2JNJA 4AYBD 1HBNA 1L3UA 1DBDA 5DM7Q 1RAHB 4B9UA 3D67A 2DGOA 3HLUA 3OVSA 4CLPA 3PYFA 2PEHA 2PMZD 2NQPA 3H7HB 3ZZPA 4GKJF 3GR0A 3KKFA 3BF4A 1RT7B 3DGPB 5CYQA 3MR6A 2HZAA 2YQ0A 3CVKA 4DL7A 2JZ5A 2ILZA 1FTRA 2GMHA 5CHCB 9ATCB 2IRUA 4DJBA 3DLBA 2I5JA 1S7IA 4P6QA 1OIAA 1VMBA 4A8WA 4LF4F 1N48A 1RT2B 4P10A 8RUCA 1PSDA 2UZAA 4OZ2A 3I4HX 2P9EA 3PACA 3TJAA 1B64A 1IWAA 4MFBB 3UDVA 4ALZA 1SL1A 2WBMA 3Q8YA 4ECRA 4LT6A 2EI5A 1MMNA 1SKSA 5HATA 3M32A 2DIUA 3QIPB 2YPZA 4A48A 5KAKA 4KO0B 4QYZJ 2I2YA 1JLBB 4ED4A 3DOLB 2NCKL 1H38A 3IP0A 3HFKA 1WC3A 4J7CA 1SKWA 2V8HA 4KYZA 2FVPA 1IBMJ 1RE1B 4OHXA 1TKTA 2W7OA 1H2TZ 1K47A 3PTWA 3HM9A 2DH9A 2DY1A 3W2WA 2D69A 1QSYA 2VFVA 3H8YA 2RE1A 1RYSA 4F3QA 3IM8A 2NXUA 4DV6J 2FD2A 2ZZMA 3BDEA 2JL9A 4B9LA 4DCPB 3K58A 4K5SA 3LTOA 5KFGA 3MUMP 4X2BA 3BBFA 3IGNA 2VG6A 2DRDA 2ZOGA 1KHWA 2VBYA 3L09A 2IMWP 1CS4A 3LA0A 2GVDA 5F8NA 1NPKA 4O4RA 2GFFA 5D78A 2IRXA 4QR1A 3DYAB 2RDIA 3IWLA 3VAJA 4RLEA 4EK2A 1RK8A 4Z7YA 3MDFA 3QPIA 4ECUA 2UXBF 3N5BA 3SDEB 4Q8FA 3HJFA 4EWTA 1KRPA 4ZS6A 3VGVA 5A76A 2VPZB 2E66A 4TU8A 2FLLA 4JI8J 2MJNA 2HMIB 5H9EJ 3I87A 4K4TA 2HYIB 3KJFB 3N9UC 2ASJA 4NZ6A 4YUDA 1JXLA 3TP2A 6FD1A 3RGIA 2DKOB 1J5EF 1MWYA 3LGNA 1S72S 1WJ9A 5DRKA 3ULHA 3FEZA 1F2GA 1QSSA 1RTDA 3ICLA 1MU2A 2CWXA 3A8IA 3FZBA 1IBLJ 3DRPA 3KLVA 1HWJA 3MMBA 4OZ1A 5CZXA 2V0NA 2CA9A 2AW0A 2BRLA 4IQXA 3OHAA 3R1LA 2VU5A 2OHDA 4OYIA 1HHSA 3SMZA 4FXWA 5LM7E 3DM2A 2A18A 4O44A 1TUGB 2CNLB 1NPRA 1WSVA 4N41A 1BE4A 2OMOA 3RW7A 1A6LA 4TQSA 1VRUB 1LWFB 5JUMA 1M5HA 2BABA 4RO0A 3G2XA 1TR0A 2EW9A 4JV5F 2XO7A 4Q2LA 3DHXA 1L3SA 2WOMA 1QM9A 5HSPA 4J9RA 3UCUP 1C4CA 1TP7A 1JLCB 2K1RB 4Q44A 3PM9A 3QZ7A 3FCHA 2AKWB 1GEHA 2ZC3A 1X5OA 3JSMB 4WCEQ 2CJKA 2KHCA 4OIXA 2C2OB 2R2SA 1UWBA 2MDAA 1RGVA 4NXNF 1UETA 4GVLA 3LP1B 1RT6B 3R6GB 4AT1B 4QQBA 4KGXB 1NKEA 4J91A 4DQRA 3PO5A 2A1BA 3NGSA 5C7PA 2EFNA 3VALA 2CJAA 2E1MC 4CO5A 2YKQA 2PO4A 3RBDA 5E33A 4BDPA 1I6JA 2HS3A 3OXLA 1S6QA 5K9FA 3HXMA 1KLMA 4UUWA 2M9KA 2DCUB 3GJTB 1KEKA 2NYHA 3NS5A 2R2TA 2MQNA 3HO1A 1MLAA 4S0MA 1PG5B 3F73A 2OIHA 2K7KA 2Q3PA 4URQU 4ED2A 4IOBA 1UEUA 3PJ9A 3Q23A 2P9GA 2VZ9A 1IQTA 1KFDA 4ZVHA 3MECA 2WVCA 1NH7A 3TUJC 4DR7J 3TAQA 1IXKA 4DUTA 1CLFA 2FC8A 2FVSA 2MEWA 3CB4A 3M4XA 3D6TB 1U1KA 3LP0B 2C2DA 2E44A 3N6LA 4X62F 2JSXA 1HBOB 5B09A 2H3EB 1KNZA 3MR2A 1TTHB 1QSLA 1RLDA 3PW4A 4DFKA 2GHWA 4LF2A 4LVNP 1S6UA 1SV5B 3IRXB 2HHVA 1N5YB 3M05A 2CVIA 2M70A 4DPOA 2UVWA 1JJ4A 3M1VA 5I3UA 5H9FK 3PXGa 3MM9B 5L46A 5HJXA 4Q45A 3TARA 1WOPA 1DLOA 3AODA 2BM1A 3M2RA 4AXIA 4ZIWA 2KXHA 2MKIA 4R5PB 4OFZA 2C3YA 3MOJB 4P7VA 4NL5A 2BDPA 1IKYB 5KFTA 3TR5A 3CCVS 1IKVB 2V4JB 2KRBA 3B78A 4MK9A 1FKOB 4I2QB 3PG9A 2R2UA 1JXEA 5B0BA 4U96A 4WF9Q 4P73A 1CC7A 2V2QA 3R9LA 3K59A 3G71S 1IUJA 2HW3A 5IC6B 2ZWOA 1YJWS 4J90A 3PEJA 3D0HE 4J9NA 4JOUA 1H74A 4FF1A 1HQEB 2DHHA 5E3PA 4LSNA 4KHPF 4A8YA 4DF4A 1UEVA 3FFIB 4DR6J 4O3QA 2IPOB 2VG7A 2ASLA 1X4CA 3GJRB 3NAHA 1H7WA 5K8PA 1YRTA 1D8YA 4E8UA 2A3JA 2CJQA 3OL7A 4JI7J 3T1YF 4FBUA 2CKWA 4Z7CA 5DQIA 2GJIA 4QYRA 1V5VA 5DM6Q 2WB4A 3KK1A 3MEGB 2HG4A 4I6YA 1Q1KA 5LMUJ 2XMJA 2CPFA 4DSJA 3DRRA 3HHLC 2KU7A 5MAOA 3DDNA 2V4RA 4PG6A 4KFBB 3IC1A 4MKYA 1QAXA 3G8SA 1RHKB 2QLBB 3AAWB 5E5NA 3SFGA 5J1PA 4FYXB 2VA2A 4NPOA 2BE7D 2ADCA 1IJEB 2ROEA 1FKPA 3C16A 4ZVFA 4OZ0A 4B17A 1P9QC 3HHNB 1VOMA 1BUXA 2KT2A 2XMWA 4ILMA 1W26A 4PR6A 3G82B 3FKBA 1SJ1A 1IM6A 2B6AB 2GV1A 4NCGB 1VS3A 1TAUA 1DURA 2NYIA 1ZPWX 2V8VA 1SCJB 2BKNA 2NR0A 3HI9A 1S99A 1OY9A 2X3DA 2MB0B 1RYRA 3W66A 4I1TA 4IO9Q 4HEA9 2OH2A 3RBZA 1WTBA 4I7FA 1E6VA 3UN5A 4JI3F 2RSQA 4O3RA 4U8VA 4X65J 3O44A 1MSWD 1X4DA 3HMJG 4LUBA 1P1TA 2J7WA 4N8OA 1SXLA 4EZ9A 2V68A 3KHRA 5HP1B 2ZD1A 3CCSS 2FZCB 1I3OB 4MJKA 5E3RA 1WC6A 2HFSA 1VGYA 2AJ0A 3M8YA 3K7RA 2CPEA 1RB0A 3ISZA 3CC2S 2V50A 2GW8A 4B9MA 2LA4A 4PXDA 1TK0A 2GO9A 3F0NA 4JB8B 4QWAA 3EVOA 4WZMA 4C0HA 3W64A 2QYCA 3MAQA 1F9HA 3I0RB 3T5LA 2HFVA 1UEKA 3QWUA 3D0GE 3VWSA 2GQCA 3T9ZA 4R8UA 1SJQA 5HMXA 3SSSA 4Z37A 2WSEC 4ED7A 5H9FJ 1EHWA 2BV3A 1RISA 3OL9A 3S1TA 5LJ5Y 5HQLA 3NWRA 2ZKTA 2GQ2A 2DGUA 1YLXA 5E3AA 4LF6F 1XMQJ 2VJVA 5HL7Q 2WAQD 1NKBA 4B3SJ 4QIGA 2FVRA 1URNA 2LEBA 1GMWA 3AFGA 1F5AA 3J7YI 5GMKa 2XCAA 4U7UK 5SZTA 3HHEA 4OJGA 2QLJB 4B9SA 1V6HA 3SCJE 5HLFB 1LQ9A 1SQEA 1FXRA 2BANA 4IDKB 4RUHA 1FF2A 1KOOA 1BQMB 3K5PA 2YKMA 4OJHA 3C19A 4JV2A 6FDRA 4UY85 2PI4A 5D0EA 2LXUA 4PPZA 1KLNA 1OMSA 2D41A 3PIPQ 5D77A 1T11A 2QX0A 2OTLS 3FUYA 3PHTA 2X1GA 2FLNA 1CJTA 1FCAA 2DNKA 5LOQA 4EGLA 4FXVA 4ZVSB 5EHHA 3MCNA 2C2EA 2DNZA 3DU6A 4HR2A 4LSLB 3MGJA 2QL5B 3MPUB 3KMSA 1J5OB 1YBUA 4KV8A 3LF0A 1I51B 2J0QD 1U6ZA 3MURP 3O1LA 1Y4ZB 3M8RA 3BBBA 1CJUB 2KB2A 1VQ5S 2KZMA 3FNNA 5KTQA 1FWPA 2VD3A 5L9NA 3PYEA 2CVEA 2QL9B 1WKKA 2DR7A 1XQIA 2HQIA 3I0SA 1SIWB 5HO4A 3TQEA 1NDPA
chains in the Genus database with same CATH topology
3DOKA 2PA3A 1KD1T 1SC6A 1UKUA 1Q78A 3D1OA 4FPRA 5LMNF 2LLZA 4WE1B 4ED1A 4DFPA 4IR1A 4Q0BB 5H1SV 1N32F 2J0SD 3I4PA 1XN9A 2ZUGA 1RTIB 2E5LF 1SB6A 4EEYA 3A1YG 3HP6A 4HTIA 5KOWA 5I42B 4USJC 1FRJA 3T6JA 2ZDPA 1SUQA 1YQHA 3OFFA 3BM7A 1F5BA 2CQIA 2EFVA 5HQ8A 2HGMA 1S6OA 4DV2F 1NJYA 5CYMA 2N4CA 5JXSA 4RW7B 2QEXS 5J2PB 4TY8B 4P2SA 3MEEA 2OPSB 2QMXA 5C5JA 2YKNA 4ECZA 3LP2B 2YKOA 4L72B 1TQLA 2W9CA 1QY7A 1DQAA 2ILYA 3CD7A 2D9OA 3Q8PB 1TV6B 2F8HA 4TNOA 3KLFA 3OL8A 3JTOA 1HQUA 2XMTA 1RT4B 2O1PA 3N5FA 3I32A 5F8JA 4ZP8A 1ZH5A 2FLPA 3DOMA 2HLUA 3RAQA 4Q0BA 3OR1B 4WE1A 5KFWA 1JLEB 4O3NA 3UE2A 1HNZF 3K5OA 2QZ8A 4C8OA 3TVKA 3PO4A 1GX5A 1RTIA 3N6NA 2YWGA 4X64F 1T03A 1HI1A 3DRXA 1V3RA 5I42A 3LQVA 1HFEL 1JB0C 4NYPA 4KBIA 5IXUA 3KHGA 2EFQA 2QO3A 2L9DA 3CDAA 5L9XA 2ZH3A 5KFIA 2IVYA 2UVRA 3DLKB 2LA6A 3U1NA 2UUAF 4B9VA 2HHPA 4MKBA 1YVFA 4RW7A 4RX6A 2ZH1A 3IR7B 5J2PA 4TY8A 5BYQA 3PW5A 4NYOA 1N5QA 2AJFE 2OPSA 3OLBA 1QAYA 3OBIA 4YB5A 3LP2A 2BVZA 2LDIA 5HMZA 3Q24A 2KVIA 1YJNS 1X7VA 4B3TF 2YNFB 2DRAA 1TV6A 4PG4A 1RT4A 3H5YA 3NWGA 2WONB 1N5VA 1U49A 4MKAA 1XMQF 1S9GB 2UVVA 3OR1A 2D1CA 1VC5A 1JLEA 2DGVA 2ZH2A 4NRUA 2PIIA 4Q2MA 4C3KA 2AJ4A 1UVJA 2PD1A 4I6WA 4F50A 5EX3A 4QIVA 4YB1P 4C0OC 3QJJA 3NAIA 3RB3A 2FJBB 2LDYA 3N01A 3NRBA 2UXCF 1DZ5A 3UDLA 2V9KA 1K9MT 3ENVA 1HNIB 3NGKA 1S6PB 1FK9B 2HVIA 4G1IA 3MD3A 3DLKA 4QW9A 4C3MA 4DLEA 1N8RT 1D1UA 1FJCA 2IJFA 2CFXA 4Q43A 2CPDA 3AA8A 1TAQA 2HLTA 2XMUA 5KG0A 2FB0A 2EBEA 3PKYA 5F41A 1H0HB 3PVXA 3OL6A 1OQ6A 2HHHF 1E6YB 3DGPA 3H2VE 2YNFA 1S1WB 1R8BA 3KLIB 3VAKA 4J9PA 3E2EA 3HPOA 5KFSA 1F9FA 3RAMA 2Q6BA 4F3MA 3PEHA 2WONA 1HNWF 3MEDB 2M3DA 1S9GA 3LWLA 2V2KA 3FSIA 2R8KA 5U47A 1YSJA 3AJ2A 1X5TA 1VHFA 2EFOA 2DO0A 2XLIA 3E01B 4OLOA 4EZ6A 4JI1F 3QGGA 5E7OB 1WELA 1M5PC 4F8RA 3UWTA 2I0XA 2VOPA 3OTCA 1X4HA 1XK8A 5T41A 4FYDA 5F0WA 4C9DA 1HNIA 1S6PA 3BQ1A 3MEKA 2VG5B 2XWXA 2BBEA 3IWNC 5T14A 4KC5A 2MHNA 2W25A 2CJ9A 2E9ZA 2R7VA 1VQYA 1DHMA 5FDLB 3UDCA 4JI0F 1N34F 1VRTB 1LK7A 4QPTA 2RQKA 1E6YA 2R7OA 2KT5A 3D2WA 4QIWD 3KLIA 3O2IA 3J81Y 3CDEA 2RKIB 1NEEA 2WK4A 4YFUA 1AFJA 3DLEB 1NH8A 3MEDA 3VZIA 3M2VB 2BRKA 4NXMF 4K59A 3AQPA 3CJ3A 1S1TB 3UQSA 4ERDA 1ZM2A 3E01A 2Z2MA 4RWXA 1HMVA 1P27B 1GTHA 1VFJA 5L38A 2DH8A 3KLGB 2I8EA 2QV6A 4OHZA 3NBPB 1U25A 3VAMA 3GIJA 2BR0A 4O3SA 2HVZA 4Y2AA 4KIAA 4RW6B 2VG5A 3PNIA 1LW2B 3TO8A 5HBMB 2R7UA 2VB6A 3PV8A 5E3QA 1Z2ZA 4AE5A 3H25A 1RTHB 5FDLA 4RUCA 4F02A 3PHEA 5GAHI 2CQHA 1APSA 1N88A 1VRTA 4AQYF 2HVHA 5B7WA 2HHTA 2MY8A 4DN0A 4NLTA 5GAHU 4HYKA 1QE1B 3DDKA 1P1LA 4LQ9A 5LSLA 4OHWA 5AXNA 1SJFA 1DTTB 1HWUA 2B0GA 4XAKA 3RZAA 2RKIA 2ZBIA 2APOA 2LQ5A 3VZHA 3DLEA 1TFWA 2DHGA 4FNIA 5CCMA 3K5NA 3CMAS 1VQNS 2ZZNA 3QAUA 4OI6A 3M2VA 5DDPC 3M2UB 2MQQA 3G4SS 2BJEA 4ZCKA 2UV8G 1Q4RA 3HZEA 4MK7A 5KFZA 1S1TA 4PRFA 1BY9A 4NLRA 3ZZ0A 1GT8A 2BXJA 4IRDA 1X9WA 5DG7A 2O67A 2OSQA 5D4OA 5KFLA 5A8RB 1OWXA 4WFBQ 3KK3B 3KLGA 2NLWA 1S48A 5GAEI 3IGVA 3NBPA 2DNMA 5B0FA 4C7QA 5LJ3Y 1JK9B 1NK0A 1WF1A 2XSJB 3MR3A 1NAQA 1M5SA 5EWFA 4RW6A 1U47A 2SXLA 4F3OA 4DUZF 3V6KA 2HHXA 1LW2A 5HBMA 3B4DA 5F3TA 3RYLA 4ECWA 3T1HF 3CCLS 4WZQA 1RTHA 2E1RA 4OI1A 2VQFF 3MCSA 1JX4A 2B7CB 2FJXA 4DV7F 3N79A 3HHLB 2YH1A 3EGZA 1IKXB 1QE1A 1UFLA 2HFOA 2OMLA 1CC8A 1FEHA 2IC3A 2UUTA 1DTTA 1X8DA 3GMGA 4KT0C 4G3IA 4C4WA 4DUYF 3H98A 2NREA 3ZZRA 5B0AA 1NB7A 2EVZA 3CPWR 3ZC4A 2C28A 3GYNA 3H2LA 2CQDA 3VAHA 4N76A 2YWFA 5JVGQ 1YJTA 2BACA 1CPZA 3P3DA 4C8LA 4ZVEA 3GFHA 5FD1A 5A8RA 2NUUG 3TUZC 3KK3A 5B08A 2P5VA 3DNCA 1WD6A 4Y28C 3CWJA 4MYTA 3V81B 4WU2A 1TKZB 7FD1A 3RB6A 4DWIA 4DV1F 1U2FA 1FKAF 3HHDA 5GVQA 2XSJA 2W24A 2WCXA 1WTFA 2IM3A 3FSXA 5KFVA 1X5PA 4PCQA 3LW5C 2B43A 2CJBA 2V94A 1MROB 4GO7X 4ES3A 4DSLA 1RA6A 5J1NA 2H5EA 1H2VZ 4DX8H 4OL8A 4OV1A 2RMLA 3C6TB 3KG1A 4F26A 1B0TA 3HHLA 5FIIA 5J2QB 2AX1A 1LWEB 1IKXA 1W2BR 4EBEA 2KT3A 3CDBA 3V4IB 4XDDA 2L9WA 2DNOA 2IM1A 2DPIA 4F25A 1FO1A 3GB0A 2Z8QA 1TFYA 4RW9B 4RKUC 3UI3A 4FVCA 1D9DA 4OX8A 2CG4A 5E3CA 1HW9A 3GV5B 1RAJA 4CO1A 3H20A 4WKYA 3IG1B 2IMOA 4QW8A 1Q7YT 4LF5F 4QWDA 4LQ3A 1QVFR 1JIHA 4BHQA 3PFEA 4QZVB 3VAIA 4G6VB 1FNMA 2RVJA 3O6QA 3NKYA 4IQMA 3T5JA 2DJWA 5C25B 5IQ6A 3V81A 2KTQA 1TKZA 3IR6B 2W7PA 4X4PA 4ZCLA 1Y00A 1Y3KA 5K8NA 2DRBA 5CQGA 4I6AA 2BOPA 4AUKA 1H3DA 1VBXA 2GC8A 1QJHA 4KHMA 3QJLA 3MR5A 2PN6A 1MROA 1B0VA 5A0YB 4J9LA 1S10A 1P8GA 1Y5IB 2F1FA 3EX7B 3MAHA 4PXEA 3DRYA 5F9NA 2OFGX 1LXNA 4NA2A 3BDPA 5KFKA 2LCWA 5J2QA 4OLPA 1LWEA 1TVRB 3V4IA 2ZJRQ 4Y2MA 1RT5B 5KG7A 3CC4S 5IFMA 1X9SA 1FDAA 1NKCA 2ZH7A 2XGQA 1AXQA 3AH6A 4RW9A 3WZ0A 5C42B 4EBCA 4M94A 3GIKA 4E98A 4EO8A 4CTAB 2AGOA 3CCUS 1K1QA 4WFZA 2EG2A 2FY1A 3HF5A 5LXYA 3Q8RB 1FDBA 3IN5A 3IG1A 2QLWA 2W4CA 3FVYA 5D4PA 4F4ZA 1FXDA 2XHWA 3AHPA 2KO1A 3FGVA 1Z4UA 3QO9B 5C25A 1Y0HA 4PG7A 4OJ1A 5SUHA 1XR6A 2LKZA 3KK2A 4PQAA 2MZTA 5KT7A 5DG9A 3WC2A 2XS5A 1R8CA 4CZCA 4KRWA 4ECSA 3QGHA 5KT6A 2ZJQQ 2MZJA 5EN1A 5AXKA 1VLYA 2JEIA 2J7UA 2Y1JA 1FESA 2QFJA 4C8KA 4WU3A 3JTPA 2AU0A 1QUPA 5A0YA 2JEGA 1UJ5A 4QWCA 5DDOC 2KM8C 1TKDA 2HMIA 4FF2A 2O66A 2KDOA 3CCJS 1KC8T 1K0VA 1KTVA 1TVRA 2YQ3A 3MPVA 3ETOA 4NLDA 1CQNA 5KT2A 1RT5A 2CDQA 1C1BB 1RDRA 1TL3B 3SV3A 2N82B 2LVWA 2PGCA 4HI2A 5C42A 1JLAB 3JSYA 5A8WB 4N5SA 1NZAA 4CTAA 1JNRB 2BA9A 4P7TA 1JKHB 5D3GB 3RU0A 2IA6A 1NRKA 2J0XA 1U8SA 4IFVB 1UVMA 1FD2A 4M8LA 1SBRA 1PC5A 1X4BA 2CQ0A 2KG0A 1XNQF 3QO9A 1NK4A 3GFYA 2VKRA 2DNYA 5KT3A 3BQ0A 4QCLA 4RNNA 4BC9A 1AROP 1XERA 2I9SA 1HI8A 2J0WA 3UD4P 1H98A 2RF2B 2J7KA 2RRNA 5L1LA 5AXLA 2CZVC 3HKZD 3FJ2A 1HNXF 4IRCA 4X84A 2MJUA 3GIIA 1M0SA 2GX8A 1FHTA 5KFUA 2KM8B 1R0AB 4ITSA 1IBMF 2UVWA 4PXCA 5GADI 4IR9A 4DQPA 2NUHA 3QWPA 1C1BA 4V19X 1TL3A 4DR3F 3DFEA 2QE5A 1HWIA 2RS2A 5GADU 2WHOA 2XBPA 3S8SA 5A8WA 3PY8A 1WF2A 3THTA 1JKHA 2WB1D 2VUGA 2Z4PA 2BW2A 3ISND 4NLWA 5F0UA 1KQKA 3RB0A 1I6JA 5D3GA 3LH2S 2N7CA 4IFVA 3OW2R 2F8EX 4KGMA 4U6PA 2VFUA 2COLA 1N33F 3OV7A 2MZQA 4N77A 1P6TA 3RAXA 4WFNQ 2RU3A 4KQZA 2OKQA 3VCDA 3UCZP 3UFCX 1R27B 2MKJA 3GZ7A 4YHHF 5LXRA 2VL1A 4M5DB 3M9MB 4FXDA 5KG1A 1UAWA 2MKKA 4FN5A 2DBBA 2W9BB 1REVB 2ZH5A 2RF2A 4LVOP 1EETB 4DV6F 5M2UA 1WI6A 3A8EA 3VR1A 4ID5B 4Y2CA 4CH1A 2YX4A 4W92B 4B3OB 5HMYA 4ZKAA 3J80Y 1UVIA 1V9OA 2MQMA 1S1XB 2Q6CA 4EBDA 1R31A 4K2XA 4CH7A 1R0AA 1IR0A 2QSFA 1PILA 4UW2A 2MHEA 1YI2S 1B0PA 4JI5F 2GQQA 2HAIA 2YNIB 5F8GA 1GQEA 1C2PA 1HARA 3TYTA 1FRLA 4GC6A 3PDNA 2XI2A 3B82A 5L1JA 2VPWB 1ZZFA 3Q2SC 4H4KC 1GNKA 1JLGB 5J2MB 2VV5A 2YKPA 3HVTB 1LOUA 4Y0FA 2ZH4A 4DR4F 3BSCA 4ECQA 4FVMA 1G6BA 3NGDA 4WFAQ 4XK8C 3UCGA 4MH8A 2J6TA 1S0MA 3P5TL 3EXCX 2PMHA 3DLGB 3HHLD 3OXFA 4OMFG 4M5DA 4M63A 4OZJA 4YEAA 3NCQA 3V4MA 3K57A 4ZCIA 3BN4A 1REVA 4Q5VA 2W9BA 2KJWA 3KLEB 1N54B 3V2UC 1IBKF 1EETA 1K8AT 4ID5A 3GIMA 3BJYA 4B3OA 3CCRS 4DS5A 1S1XA 2M88A 2WSFC 4G1PA 1Y3JA 2VKZG 5DETA 3IWXA 1DAXA 2OP5A 2KYXA 4I0WA 3TX8A 1LW0B 4DN9A 1YIJS 3T1AA 1S0VA 2IYIA 1N4LA 2YNIA 2KI2A 1D9AA 4Y34A 4ZP7A 2RS8A 2CPJA 3ENQA 4ZHRB 1HW8A 2RILA 4ECVA 3UD3P 3BZQA 1SKRA 1Q8IA 1T3OA 1TL1B 5GAGI 4DBQA 5J2MA 2JDJA 3HVTA 3BR8A 4DFMA 1YBAA 1IKWB 1U1PA 2EFPA 5GAGU 5A6WA 3PX6A 4PXBA 5IM0B 3I55S 4B3RF 4O4GB 4A47A 3QIDA 4EYIB 3D1QA 1RT6A 1VQ4S 2FJDB 3LAMA 2ZH6A 2YX7A 2RNEA 3CCZA 2FJAB 3DLGA 3U7JA 3X3UA 4HDGA 2AYGA 2WBRA 1S1UB 3CO9A 4DV5F 3KLEA 2FHJD 3MM8B 1LK5A 1WEXA 2NPIA 3ITHB 2E1CA 1FJEB 3IS9B 5KFJA 3KHLA 1ELOA 1DARA 3FDSA 2A2CA 1JLQB 5DO2A 2MQLA 4NLVA 3UNGC 2KZZA 1LW0A 3U1MA 3DCAA 5IZHA 2PI5A 2F7VA 2H9ZA 1U7LA 2MSTA 2M5YA 2X51A 1ZPVA 4OI2A 4ZHRA 1G1XA 2HHSA 2OD4A 1X4FA 3MPWA 3GE9A 1TL1A 3MXHP 4YB6A 2HRUA 1R3NA 4YY3F 5CCLA 1VQMS 1IKWA 4FNHA 4UQTA 1VQOS 1SH2A 2CQPA 2IAJB 2IM0A 5IM0A 2D7SA 5EGYA 3QMQA 2HIQA 3WC0A 1ZAWA 4H4OB 3MUVP 2JEFA 1CVJA 1GXLA 3H5SA 3CCES 3R5CA 4DV0F 4JI8F 2B7BB 4AXJA 4CO4A 4C8ZA 1LFPA 4IYQA 3SXLA 1S1UA 2ASYA 1C0TB 3MM8A 2Y0SD 3D28A 3GFXA 4ED5A 1VQSA 1XNRF 2EBGA 3GFZA 4RZRA 2AJ1A 3ITHA 1BLUA 3IS9A 3BO3A 4Y00A 3SI8A 3BN7A 3G8QA 3OJSA 4QR0A 1JLQA 1HBNB 4C8YA 5KFPA 2R7RA 5K14B 3HT3A 3I5CA 3RB4A 1KOHA 2FPHX 2YH0A 4WYWA 1S4FA 1T03B 2EPIA 1N5TA 1FVSA 2V5HG 2ZDOA 1KQGB 3IR5B 2RQ4A 2JJ4D 2KRRA 3M8PA 3T5HA 2RT3A 1HWLA 1UA1A 2CRLA 1FEEA 1ZYQA 4BBYA 2RD5C 2R4FA 3O8WA 2ABYA 2PT0A 1GH8A 2GJ2A 3BB5A 3T5KA 3ONQA 2IAJA 1T94A 3N4WA 4ZPVR 3OQ2A 2B9XA 4X4QA 1CQMA 4H4OA 3M6VA 2OTJS 3TI0A 3IAS9 3RW6A 3TANA 3CDUA 3MTKA 4WXOA 2LU1A 4NCBA 2B5JB 2N4DA 3CEDA 1HYSB 4A8FA 2MKCA 2DGQA 2KG1A 4UY8T 1RP5A 1C0TA 5CYQB 3TVYA 2LU2A 1N0VC 4LJMA 3V6DB 4ZPTR 2YY3A 4RNFA 1IBLF 4HT5A 4X4UA 2HRYA 3D0IE 1ZOTA 4YR0A 4UUXA 4LIRA 4AYBD 1O0PA 2VC0A 1HBNA 5KG3A 5K14A 1FE0A 1L3UA 4ES1A 4MTPA 4OX7A 1DBDA 1KONA 1ZM4A 1T05B 4RUAA 3G6YA 5DM7Q 4B9UA 2DGOA 4GMKA 3HLUA 1K1SA 4ECYA 3OR2B 2VFTA 5K8OA 3CMES 2IJNA 3OVSA 1T8EA