2R9LA

Polymerase domain from mycobacterium tuberculosis ligase d in complex with dna
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
287
structure length
287
Chain Sequence
EQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a NHEJ polymerase-mediated DNA synaptic complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Transferase/dna
molecule keywords DNA (5'-D(P*DGP*DCP*DGP*DGP*DC)-3')
total genus 86
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2007-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2r9lA02
2IRYA 2IRXA 2R9LA 2IRUA 4MKYA 3PKYA
chains in the Genus database with same CATH superfamily
1XNRF 3WBZA 1U26A 4RKUC 2O67A 4DL6A 3M9OB 1RTZA 3FFIB 1J5OB 2UVUA 3H5SA 2JJ4D 1NAQA 1P1LA 2DGOA 1N33J 5LXRA 3KJVB 3KXDA 3D66A 1Y5IB 2IPOB 4BCAA 5IS2A 1R0BG 4O0NA 2ZH3A 4DFKA 2UXDF 4KHPJ 1XR6A 2JFDA 4G1QB 1RT4A 1H0HB 2FUG9 4ZVEA 2BXJA 1H2VZ 3W66A 4ZCIA 5D3GA 4LFBF 1CEZA 1AFIA 1SJ3P 2VA3A 5CA5A 1GTEA 2FTRA 2RUGA 2FLNA 1VQKS 1S9EB 3H42A 2VZ9A 2FVPA 3M9MB 4H4OB 5HROB 3PIPQ 3U27A 4YB7A 1OY9A 1WDTA 1RXOB 2M3DA 2WB1D 2V69A 1FWPA 3BGFA 1GMWA 3W1YC 4YMEA 1J5EJ 2XS7A 1RBLA 3EVOA 1CJUB 1RAAB 2HQIA 2HSEB 1YLXA 3D7SB 3SCLE 3ZTOA 4RUCA 4K4UA 3AOAA 2CQGA 4JB8B 4J9NA 1X8DA 3IWLA 2GV1A 2NCKL 4RW9B 4IYQA 2ZH8A 3DOMB 2HHHJ 4PUOB 1C1CA 1X9MA 1JLBA 4IRKA 3DFEA 3DRSB 3IRXA 1VQ6S 1O8BA 1VQOS 5IV4A 3LH2S 4ZLNA 3VQSA 2BM0A 3RBDA 4DV2F 2F8EX 3L4BC 2XYGB 1V5IB 3FNNA 2ZUGA 3TP2A 5J1EB 2CQBA 3JSRA 5HBMA 2YKPA 3ZTRA 3FSYA 4L72B 1HFEL 3CCZA 5B7WA 1HNWF 4M5GA 3BSAA 4G65A 4X84A 3ZZYA 5K8MA 2KVQE 2RAQA 4QPXA 5DM6Q 1XBWA 1RT6A 1BY9A 2MKJA 4OI1A 4DUTA 2OD6A 3EDRB 2L41A 1VC0A 2I5JB 1Q1KA 1TKXA 4FYVB 3PV8A 4EZ6A 2DR7A 3MI7X 3EZUA 4FVCA 1HNZF 5CABA 3TEGA 5J1NA 2GMJA 4OZ3A 5LMUJ 2ZBQA 2HGLA 2G1HA 4DFMA 4BHQA 4DQQA 2IDEA 4K5SA 1YGYA 4KKOB 2W01A 3GV5B 2HFNA 3VGSA 4DL3A 3FRYA 1JJ2R 2H65B 1OY8A 1NM2A 3BM7A 4NYPA 3AOBA 3CJ2A 2W25A 5AXKA 1NMEB 2DGWA 3GLJA 1ZTTA 2XMUA 1WTBA 3TNVA 3WC2A 2VFVA 3T41A 3G4SS 2OFHX 1ZAWA 1SL1A 2CQ4A 3IBWA 4DV0F 5GAGU 4QR0A 3CJ3A 5G0RB 3HM9A 2DO0A 3HHKA 1RSCA 4F25A 2GX8A 5DDOC 4DWIA 4FKYA 3F56A 4EZ9A 1VC5A 2AYBA 3M8ZA 1VFJA 2KHDA 2NZCA 3EM1A 3MM8B 1WC5A 4USUA 4ZVSB 3TJAA 5L46A 1NRKA 3H98A 3OSNA 1JQGA 2HPUA 2QX0A 1TV6A 5LMNJ 4ER8A 5GVQA 2LEPA 3NGRA 1D09B 2XCAA 4ES1A 1KFDA 1SQEA 2WVBA 3AD7C 1IWAA 1DJ0A 2N4DA 3DU5A 1TK5A 1C1BA 3D6FB 3KLIA 1WTFA 2IY5B 1U2CA 1UZDA 3OR1B 2BE7D 4DR2F 2L9DA 3J7AN 3J80Y 1V9OA 4GKJJ 1S1UB 3BDEA 3C66A 4XPCA 2DNQA 3ITHB 1U24A 2N3OA 1D3WA 1O5JA 1H73A 2IRUA 3M6VA 4OZNA 2JOQA 3C16B 4TVAB 4C2MA 3F0NA 3H7HB 4URQU 1YBUA 4EFAC 2XY5A 1AB8A 3UD5A 2VJUA 2E7WA 1KTQA 5BYRA 2QLFB 3KLVA 4YDDB 3PM9A 3ETMA 4ECWA 1VQNS 1Q8IA 3E2EA 4PQUA 2BEFA 4KRWA 4WZQA 3LGMA 3QFWA 1PG5B 2SXLA 1FE0A 1ACMB 1SB6A 3NLCA 4WP8A 3UR3C 4ANEA 3RB3A 1U1PA 2M9KA 2OPRA 3A8EA 1N5VA 5FD1A 2ZHBA 2K8GA 1KQSR 1WI8A 4ITSA 1QE1B 2GFFA 3MM9B 4PXBA 1IBLF 3OVSA 1HNIA 1Y5NB 3G86A 2DNNA 4NLPA 4PZVA 5CH7B 3TANA 5DQGA 1JXLA 1APSA 3A4TA 3QAUA 3T6JA 4DLGA 3L09A 1WEYA 5H9FK 1R8AA 2ZVSA 1N6QB 1EKSA 1OO0B 3K59A 3GIRA 1EHWA 2ZD1B 5BR8F 1R7IA 4LBIA 2E9ZA 5J1PA 1X4HA 4YB1P 1EARA 3VCDA 1F3VA 4KH0B 2WB4A 3CULA 1S7IA 3UD4P 3QMQA 2DXEA 2F63A 1B0TA 1WEXA 2BRLA 2C42A 1HBMA 2MQLA 3BB5A 4U8VA 4PR6A 3KK1A 3H25A 2CVIA 3Q24A 2J9CA 3M2VA 2W8LA 2NREA 2DKOB 2GAHC 5D6GA 4ZJLA 4WFNQ 2YH1A 5B09A 1WF2A 2RIJA 3MMAA 5HQMA 4LFBJ 4ETXA 3DLEB 4K59A 2QG9B 3GZ7A 2E1RA 5T14A 3WQPA 1XERA 3ZZPA 1SC1B 2F4VF 1F2GA 3DDKA 4M8LA 4WTOB 1IR0A 2HHPA 4DQPA 4C8YA 3RAXA 2RJZA 2GMHA 3NCQA 3DLGB 2MGZA 4MIWA 2C28A 1REVA 5KFPA 3CDEA 4K5RA 1RT2A 1VRTA 4CRJA 3IMQJ 5D15A 2QA1A 2LCWA 3CXCR 1QVGR 3MUTP 3I56S 4DR1J 4IH6A 2ZWOA 1DLOA 3J7YU 2AZ3A 1FNOA 2HEKA 4ECVA 3C6TA 3K8VA 3EPIA 3P5TL 2DPJA 1F9FA 2VG6A 1FHTA 3NAHA 2OH2A 4ES2A 2HHXA 3BREA 4JI3J 3MOJB 1OSCA 4DPYA 1HD1A 2AHOB 4ID5A 1REVB 1TU0B 1YK9A 5DETA 1UEVA 4PYDA 1NKEA 1GEHA 1O0PA 2CJBA 2MPUA 5KFSA 2K7KA 4LIRA 1HW8A 1NB2A 1JK9B 2XO6A 3KLFB 1WHXA 1WF1A 1M5KC 1HNWJ 2P5VA 4I69A 2FJBB 3CIZA 2YBVA 3FKBA 4NLTA 4YY3J 2AGOA 2HW3A 3TRGA 2R3VA 2KL8A 3WHIA 2OPSB 4CNYA 1B0VA 1RT3B 2AF6A 2JC0A 4C11A 5HMZA 3RYLA 3TUIC 3M8SA 3Q23A 3VAIA 5F0WA 3DLJA 4DSEA 1OY6A 3CD7A 4HI1A 2FHJD 2FJDB 3MXHP 3LPEA 1GK8A 3M4XA 3DLKA 1MNEA 3PVXA 4Q2MA 4DQSA 1KLMA 4ZVFA 3PX0A 3ZZZA 3QO9A 3ZZRA 5JMNA 2WK4A 5MAOA 3MTKA 5C42B 2HQFA 2V5HG 3DC2A 1X4GA 2F4FA 5IV3A 3V4MA 3R2DJ 2ZE2B 3IS9A 1VQLS 4OYMA 2YWEA 2HVHA 1VK3A 1U48A 4RNFA 5LL6d 4ILLA 2HVEA 3TO8A 3DGVA 5A8RB 4HACA 1TKXB 2ZEJA 1CC8A 5AXNA 2YKMA 3CCVS 5GMEA 2XI2A 4K4SA 3LWMA 1YG0A 2E66A 2IYIA 3KHHA 1IKVA 1UEUA 3G82A 3QQCD 4Q0BB 1I5OB 5IXUA 4CH1A 1W25A 1RTJB 1YDLA 1F5CA 1JNRB 2MSTA 1IJFB 1YJTA 2KVIA 2X1GA 5L8RC 2A18A 5J1EA 2ZBPA 3DOLB 4AXIA 5CHCB 2AD9A 4O3QA 2PMHA 3NWRA 4P74A 1RYRA 4H4MB 3NBPA 3HCXA 4OZLA 4P73A 1C2PA 3IBCB 4M1KA 2DNHA 4NZ7A 3TX0A 5KFAA 2V0NA 3VVUA 3B4DA 1KS2A 3N0VA 1WSVA 3FSIA 4I56A 3KDOA 2Z8QA 4OLPA 3PYFA 4O4RA 2B6AB 2DY1A 2YNIB 3TVKA 2B5JA 5L38A 4F3OA 1R0AA 3P96A 1SJ1A 2DVIA 2R7XA 2PA8D 5DDRC 3UDCA 2DRBA 4OHZA 4UQGA 5KFJA 3BKFA 5IC6B 2AIRB 3D0GE 4C8KA 3JYTB 3NBPB 4TNOA 2N7CA 1NDPA 1D9FA 2DH9A 1S0OA 2VQFJ 4DCPB 1A9NB 5KT5A 5F8JA 3OJSA 3EZOA 2E5JA 3MECB 2WOMA 4ANDA 4M5NA 5GAHU 3OFFA 4DR6F 1BMQB 3VQTA 3MPUB 3FFIA 4CLSA 4N76A 4BLGA 2B3TB 4TY8A 2H4WB 2RQMA 4ECRA 2W2NP 3HHNB 1T9UA 3W5ZA 2GIQA 2M8HA 4WYLA 2FLOA 2XG8A 3HP6A 2JHEA 2OPQA 3TAPA 4E2FB 3TUPA 1T05A 2ZH1A 1WD6A 1K1SA 1WOOA 4KGVB 3MEEB 2E1PA 1Q7YT 3W7BA 5ETKA 4OX6A 4U95A 3X1LB 3UW1A 1SVDA 2CXEA 2OGUA 3I0SA 3PEJA 3LO3A 1PC4A 1U25A 2FQQB 4RPFA 2DR5A 4OYOA 8AT1B 2MZ1A 4NCAA 2V68A 2IM1A 1LW0A 3N5BA 1S6QB 2OO4A 4CZCA 3R2CJ 1EP4B 2WRMA 3T3FA 2IJRA 2RSQA 4WK1A 3OR2B 1VC6A 4ZP7A 5A0YA 2YKNA 3MEDA 3S01A 1UFKA 3BGUA 2XLJA 4F4YA 4C8MA 3IN5A 4DV7F 4Z7CA 4DL2A 3LOUA 1KVKA 1VQYA 2MKSA 3CWJA 5HQ8A 3MPWA 4U6PA 3KLFA 3EZ5A 4JI5J 3BEGB 2B8QA 3HPOA 2IHR1 2GIRA 3MMBA 2YPYA 4R5PA 2DHGA 1Z2ZA 2HVIA 1E6YA 1ROFA 1RU1A 4TLRA 3C46A 4M5KA 2FJXA 2DCLA 3H8YA 3MD3A 3P3DA 3CJ8A 4ZVTB 1KLNA 4DQIA 3PTWA 1AFJA 3IR6B 2HNDB 3M6UA 3WZ0A 3KYLA 3DLLQ 3OR2A 3B8HA 5D0GA 5KG1A 1BQXA 1QAXA 2CDQA 1VRTB 1LWEB 2GHPA 3D28A 2MJUA 4FVMA 1TL7B 3HD2A 4LMZA 3M30A 4JI1F 1T02A 3Q22A 1HBOB 2KTQA 2EVZA 3I0SB 3UNGC 1DHMA 1I3OB 2KRBA 1NHVA 4X64F 1N33F 2APOA 3C8YA 4KQZA 3CIMA 4NRUA 5EHHA 3VALA 3F44A 2Y1LB 3CPWR 2OEKA 2VDHA 2YWWA 1OYEA 2WSCC 2EKYA 2DEIA 2I0XA 3UN5A 1U2RA 3C15A 3H20A 4PXDA 5KG7A 1J5OA 4LSNB 4F3MA 2MY7A 3OBIA 3UR0A 2VFSA 5BYSA 4ETZA 1F60B 1MU2B 2BKPA 1GT8A 4OYPA 2E5IA 5C2CA 2BDPA 1FJ7A 2CNNB 1IM6A 5ETVA 1XNQF 2PMZD 2GMLA 4A8QA 2XY6A 3TQEA 4ZA1A 3TZZA 1FE4A 1UKUA 2GO8A 1WG4A 3SXLA 3MAAB 4EK2A 5K20B 5CZVA 3CUNA 5J2QA 1BD6A 2HRYA 3Q2TC 1Q0NA 3PKMA 1H38A 1JLEA 4WFZA 3UCGA 1KVIA 3BKUA 1XR7A 5GAHI 3OFHA 3I5BA 1IR1A 1S1TA 4CTAA 2ZBIA 2R8GA 4DSKA 1R6YA 1XJWB 3DDNA 4LJMA 1WJ9A 4USTA 5JXSA 4P7VA 3W3SA 2B5JB 1F3FA 2VKZG 4HH1A 4O3PA 3H5XA 2NPIA 4TYBA 3MZIA 3RU0A 4TQSA 1Q81T 2LFVA 1AA1B 2CYYA 2BE2B 2NLWA 2BQ3A 2VBWA 4FF2A 4PYAA 2VH7A 1ZM2A 3MCSA 3AXMA 2RQKA 4LSLB 2VB6A 4RW8B 1JJCB 3MM5A 2ZBCA 2NPFA 2R2UA 3T1YJ 2W7PA 1JWWA 1IWGA 2KI2A 3M8QB 1RA6A 4WP3A 3OTOJ 1SL0A 3T1AA 2KFYA 1IQTA 1FK9B 1H7WA 2GVZA 2OPPB 5I3UB 3AD8C 4CNZA 2JLGA 3BGRA 5LMUF 1M5SA 1YZ7A 4ZCLA 1S12A 1LW2B 3OW2R 1WG5A 3A8KA 2BJDA 3IXQA 4DN0A 4W92B 2FVQA 1YJUA 1TL1B 4RBUA 4C3MA 1HQUA 3K7RA 1UP1A 4DUYJ 1GMWD 4B9LA 2XYHB 2DH7A 2R8IA 4DR1F 2ZNZA 3D6TB 2E5HA 4OMFG 4QYZJ 5E33A 3POTB 4YY3F 1BGXT 2ALYB 8RUCA 2UU9F 2X7IA 3U02A 2AJ2A 1NK9A 1X9WA 1T9YA 2DR8A 1RBAA 2VFTA 3OL9A 3QWPA 3IA0A 4B9NA 1RWKB 3KFWX 5ETMA 4ILMA 3IBFB 3KJFB 1PYSB 3OFEA 5KFQA 2ADCA 1S76D 2YY3A 4JBCA 2WHOA 4K4XA 2CPEA 3DDIA 5G4DA 4JUZA 4JV5F 2E9RX 5CD4H 3PACA 2IIHA 3D9BA 5KFXA 4FYDA 3BS9A 3CDWA 1RTHB 2XS5A 3FC9A 3EGZA 4O0IA 3BR9A 2QFJA 1TK8A 4DBQA 1HD0A 4QCLA 3TAMA 4DL0C 4C4WA 3JAMU 4OX8A 3UCUP 1KD1T 3CJTA 4RX6A 1UJ4A 3RG6A 3K58A 4JV5J 2XNQA 1VOMA 3QIPA 4YN3B 1VGYA 4WKYA 1SH3A 3UE2A 2F4VJ 2W24A 1IKWB 3FCVA 1CJVB 5CZXA 1U1MA 1RADB 2KFNA 3VF0B 5HMXA 4DUZF 3MM7A 4UT4A 1YJNS 3MM6A 3BSNA 3W65A 1RKIA 4USIA 5HVFA 4HT5A 4ZHRA 3CCSS 4OZJA 2KM8C 2AU0A 4EUVA 2AGQA 5KT7A 1RGVA 4WFXA 4HHHA 3Q8RB 3AB2B 2HHQA 2CPJA 1O51A 2DYAA 2HFZA 1NH7A 1N0UA 2Z4PA 3BGRB 4U7CA 5HAOA 1R8HA 1BQNB 1RLCL 4OI6A 2PT0A 5FLXU 4L3NA 3TVZA 2P9CA 5HP1A 4X4SA 2U2FA 2DNGA 4XDDA 2RRBA 2VG7A 4ELUA 3MTJA 2DNRA 5E3PA 4AE5A 2B43A 1FA0A 3CGIA 4CO5A 4OQJA 2MB0B 5JVHQ 3Q8YA 1NUEA 5ETLA 4P6QA 2BE2A 4IOAQ 4XIUA 1T9VA 2DY9A 4LF9F 4CM0A 3LP1A 1WHYA 1YRTA 2I2YA 1N88A 4LQ3A 1PKUA 2WBRA 2AYMA 1QD1A 4F4WA 3R1LA 4J9SA 2M88A 2XZDB 4NRTA 4B9VA 2KXNB 2CVEA 3CJ5A 4MKVA 4CO4A 3CCLS 1IKYB 3QJJA 1D8ZA 2GGPA 4LBHA 1S97A 4I0WA 1EAYC 3W62A 4DG1A 2EFOA 4HVZA 4M5LA 2D69A 1VQ4S 2VG7B 1K47A 1JB0C 3MMJA 1S10A 5J2QB 1S1WB 5A8RA 3OTCA 5HMYA 4RBTA 2U1AA 2VASA 1JLFA 5FLXY 2H51B 2J8SA 1S1VB 2OUGA 4W98A 1LEOA 2XS2A 3I9V9 4OYBA 4UQTA 2BKOA 1DARA 1VR6A 3R97A 1OQ3A 3MM9A 5SUHA 1CSJA 3HVWA 3LUYA 3NS6A 4A8FA 5D8HB 4ZHRB 2BJ3A 1VQ7S 2CWXA 1RAFB 2H5JB 2OPRB 2V9KA 3FUYA 3TUJC 4RWXA 2J5AA 3F41A 3MCMA 3VZIA 4ZMMA 1Q82T 4ELVA 2C2EA 3TA0A 4E98A 1X9SA 1VYAA 1SC4B 3CD0A 4QR2A 5A8WA 4DV3J 4ECUA 5KFLA 2BW2A 2V34A 5KFUA 3A3NB 3GFHA 3B54A 1QY7A 4KT0C 3OHAA 2W2PP 3OUYA 2XLIA 3NMRA 4UOFA 2COLA 3W61A 1OPZA 2RDJA 3RW6A 2PSZA 2RU3A 1KOOA 3WX8A 2MHEA 4ID5B 2ZJQQ 4B9TA 5IFMA 1CULB 2DRAA 4HKQA 4DR5J 1H7XA 1FDNA 3R6GB 4QWCA 2V8GA 1CS4A 3BPSP 1YHQS 1MMNA 2CWKA 5IZHA 4J9MA 4QJVA 1M5VC 3CMQA 1WG1A 3MM6B 4GVBB 1OSDA 4MKBA 3H5YA 2C2ZB 3GJRB 1S9FA 2ZM6J 4MIAA 3RR7A 3N9UC 5T7LA 2DGVA 1F6TA 3R3TA 2R2SA 1M1KT 4FN5A 3KK3A 4N56A 4LR9A 2J7KA 4ZP6A 2V2QA 4RUAA 1PJ7A 1S48A 4NYZA 4FZVA 4R8UB 1Y00A 3G6YA 1KRPA 4B9UA 3PJWA 2NXNA 2WSFC 5IM0B 1M90T 4V19X 3TJ8A 1N56A 1NNDA 3UVJA 1FJGJ 4YHHF 2VQEJ 3G8SA 2VC1A 2KYZA 4I6AA 1PJ6A 2GAGC 3HULA 3TA2A 1FK9A 4CM2A 2BABA 2OELA 5HMWA 5HLFA 4O3NA 2MLXA 4PG7A 2V67A 2K3KA 3LPYA 3PNIA 5ETNA 1KHWA 1Z2LA 2BM1A 1HYSB 4RUBA 1NSQA 1L3VA 4WZMA 2R7OA 2MQPA 4WU3A 3GYXB 2PE8A 2H5IB 4ANCA 2BANA 2DB1A 2QFIA 4OYXA 4CH7A 3CCES 2QGFB 1REGX 3V4IA 2DHHA 2V8DA 1R3NA 2CDRB 4KGMA 4TU7A 2NSCA 3QGGA 4ZJQA 3THVA 4ID8A 2J9DA 1IBMJ 1U1NA 3RRGA 1XNQJ 2AEJA 4XTTA 7FD1A 2MXYA 2D41A 4RU2A 4TY8B 4Q43A 1R6VA 4CIOA 1UVLA 3DMJB 1Q86T 1TFYA 2HIQA 1CPZA 1L3SA 1Y7PA 1LK7A 2AYEA 4RNNA 3CJ0A 1X4CA 1FKPA 1XK8A 2UVVA 3PHTA 3TEHB 4PWDA 2QL9B 1NPRA 2J0XA 3DHWC 3FZBA 2WTFA 1F9EB 3MR6A 2O5DA 4DUZJ 1FCAA 1FESA 1R8BA 1RCOB 1S99A 4N8NA 3MR3A 2VICA 4NCBA 2GW8A 3MM5B 4A8OA 1XMOJ 1YZ6A 4URSA 2RUSA 1C1CB 1L3KA 4Q8EA 2DGQA 3GIMA 1T9WA 3C16A 4I67A 1RHUB 5B0DA 2FGCA 3Q0AA 2R9LA 5K8PA 4X62F 1TL3A 1S1XB 3SCIE 2M5YA 3HSZA 3D67A 1NK0A 2YNIA 3VZHA 4LF5F 1HARA 2HNYB 5HATA 3DYAB 4L76A 1PSDA 2UUWA 3W5YA 3J7A1 3QT8A 4ECSA 3HVAA 3MDFA 1S9EA 5KG6A 3PO4A 3H2LA 3AJDA 1LWXA 3I32A 4I68A 5E41A 2NUUG 4NXNJ 4RJVA 1M0SA 2XMKA 2XMJA 3DXBA 2M2BA 4MK8A 4OZ5A 3Q8PB 4I4BA 1HHQA 1UA0A 1IBLJ 3OXGA 1H98A 1Y11A 2FZKB 3QRPA 2OFGX 2Y8YA 1S77D 1UJ6A 4LIWA 2CQ1A 4MKAA 5J2MB 2L9NA 2LYVA 3I0RB 4KV8B 1Q8LA 3BO2A 3BKTA 1TVRB 5CYQA 5HSPA 4DS4A 1F9HA 2HNDA 4DV4F 2ROPA 2IAJA 3AXKA 3HI9A 2HAIA 4FXDA 4RU9A 1Q78A 2YKMB 2MY8A 4NLSA 3W5XA 5KOWA 1FKAF 2R2RA 1XNRJ 1RAEB 2RHQB 2VBXA 1DURA 1XIQA 2XI3A 2UUBJ 4M5DA 4LF9J 3M1VA 4X2BA 2J7WA 1GH8A 3CD5A 4NLQA 5HJXA 5KT6A 2ZH2A 2IM3A 1SUQB 1UVNA 4F4KA 4ENOA 4TYAA 2YNGB 3L95X 4JP8A 4OV1A 4YB6A 3BO4A 3V6KA 3QBCA 4PAAA 2CJXB 2FJEB 2CQCA 3OTEA 5A0YB 4CLFA 3FK4A 1YWXA 4I6YA 2YKOA 4YR0A 1HNZJ 2VODA 4DJBA 1GXTA 4MK7A 2GQCA 2V4QA 2QT7A 2G1DA 2VPYB 4B3MF 2MTLA 2BVZA 4USVA 3KG1A 3S6EA 4DSFA 2YNHA 4ZVQB 3BYRA 4B3RJ 1FKOA 3OTDA 1TKTB 3MAHA 3QT5A 3D6HB 5HI7A 3VWSA 2L9WA 4BC7A 6FD1A 4YFUA 4J7CA 3BZQA 4NLGA 2W9CA 4M5DB 2E5GA 1R43A 4DFJA 1N5TA 4LF7F 4MT1A 5D0EA 3K0JA 1F0XA 2HHTA 4NCGB 1RT7A 1W2IA 1VBYA 1R8PA 2NXJA 2VBZA 3FZ2A 3GFXA 3ZTSA 4PUOA 2VIHA 5KFFA 2IDLA 2KZZA 2WVEA 2IC3A 4DXLA 1SKSA 4OYIA 2CJQA 4IDKA 2XZWA 2N7YA 5DGBA 2PIIA 4EBCA 3M2RB 2BJ8A 2VHGA 3KKFA 4PRFA 5EN1A 1MROA 1IBCB 4IKAA 4CO2A 4KV8A 2HWHA 3VAHA 1EP4A 2H48B 2R4FA 4FPRA 3MECA 3CEDA 4C8NA 2GA7A 3B6BA 2CNKB 1RTIB 2I1RA 2WONB 3GYNA 3H90A 1L3TA 3MPVA 3OUYB 3THTA 3CT9A 1UVJA 3QWUA 3DLHA 3TZXA 3W8PA 4LFAF 1BUXA 3MAQA 2GQQA 3HT3A 4ZLJA 2QC3A 4E0DA 1QAYA 2DGSA 4N41A 2DO4A 1RWMB 2IA0A 2B0GA 3IM9A 2G0JA 3PCOB 4PWWA 2KKHA 1RK8A 4TY9A 4IH7A 4P2SA 4QW8A 5GMKa 3QNWB 2OPQB 1W7WA 5CXTA 1R0AB 2P8IA 3I4HX 1KQKA 1WDDA 4Q44A 4RWWA 1DY3A 4V19J 2A2DA 2B6AA 4Y2IA 2HWTA 4JI8J 2RT3A 1HBMB 2ILYA 3H5UA 5ETOA 2J8AA 2I6WA 1PAUB 5L9XA 5J2NB 4DLEA 4GKKF 5KG5A 1URRA 1NEEA 1OQ6A 2GVDB 2ZHOA 1PC5A 5KFRA 4PG8A 2CPYA 3H0PA 2J9DE 1VDHA 3QSYB 4DR7J 2KFZA 1TR0A 1X0FA 1Q8KA 4DPXA 2VOPA 1RYSA 4PPZA 4A8YA 2VONA 3W9JA 3VTIA 1S6OA 4N8OA 2UUAJ 1RTDB 2D9PA 3BPDA 4DU7A 4ZKAA 4Q2LA 2NQPA 3KWMA 3VAJA 2PEHA 3RB0A 3GYGA 3KLGA 1S49A 1QE1A 2W4PA 3WIUA 2IJNA 2HNZA 2RF2B 1U6FA 3DGPB 2QN6B 3RAMA 1RT1A 3OV7A 4QIEA 2K1RA 2VV5A 2PI4A 4NE9C 4JOUA 2YQ3A 2RU9A 3KG4A 2ASYA 3H2VE 4ICLB 2HVDA 4CLPA 2MKYA 2QIFA 4FXWA 4NEZA 4X4TA 1BXNA 2FHMA 3E01B 2NR0A 1VLYA 1Y4ZB 4LUBA 4K50A 4NZ0A 2UV8G 1VQSA 2Q43A 2YKAA 3NEKA 2KXFA 4KPCA 2LDIA 3IS9B 1P9YA 3HFKA 4Y2MA 3K17A 4O3OA 5DLGA 4URGA 1WWHA 2AJFE 2HRUA 3OPKA 4JI2F 3KLHA 3SDEB 1T03B 4I2PB 5DQIA 3RJMB 5F8MA 3CVKA 2HZVA 4LF6F 4FF3A 1EJ7L 1KN6A 4J9OA 1R89A 5BXIA 1NJYA 3CMES 3OXLA 4HHUA 2XO7A 3EGVA 3TA1A 3G8QA 3PYEA 4F04B 1RTJA 2ROGA 2YX7A 5DZ6A 1RZMA 3DRYA 2XULA 3ZTPA 5A8KB 1RT3A 4O44B 2BX6A 1EQMA 1ZA1B 2VPZB 3CTRA 1C0UA 1XQIA 1WC4A 2X1BA 2LEAA 3SCKE 3EX7B 1IBMF 4IG0A 1A0OB 3MUMP 1VS3A 1TV6B 3MMCB 4FYWB 2CA9A 2QRRA 2V6AA 1ZTWA 1NDCA 2ZVIA 4F0HA 3ZNUA 3HFZB 4X62J 5T7LB 3Q86A 4FF1A 3LA0A 4CO0A 4DZ6A 4GC6A 1Q8BA 3PFEA 1P6TA 4DV4J 3G9CA 3UCZP 1C0UB 3NL0A 2XHWA 1JLGB 1UPMB 2ZDOA 3C19A 5DS7A 4DCJB 4F4AA 5C42A 3FBFA 2VG6B 5EX3A 5A8KA 3GIIA 1NBEB 5M2UA 3MEGA 3BQ2A 3TAMB 4OX9J 3ZC4A 2NXCA 2UXCF 3F73A 1B70B 4WFBQ 4C0OC 1GFWB 1TQLA 4FYYB 5DGAA 3D1HA 1GX5A 4MMOA 1SV5A 1WSRA 2YWGA 4H4KA 4DX5A 1T8EA 4DR3F 4J9PA 2KT3A 1S9GA 1U1OA 2FVCA 4UY8T 1JLGA 5KFNA 4NXMJ 3MHYA 1TUWA 1OJ4A 4QWEA 1F2HA 2E9TA 4DR2J 1KP6A 1X4DA 1X5TA 4BC9A 4JV2A 4NZ6A 1MLAA 5AE3A 2DJWA 5IWAF 2G9OA 3HZEA 3LP0A 1AZSA 3ISNC 1S0NA 4AD6A 4MFBB 2GJIA 3FQKA 3HHEA 3G6VA 1X7VA 4YP3A 2G0IA 3AA9A 1RE1B 3O3LA 4HEA9 2YWFA 1CJKA 1P8GA 4ZPWR 3CDAA 5FJ4A 2JC1A 3K8WA 5HN0A 2ROEA 3GG0A 2QL7B 2B8PA 4OX7A 3EGWB 4J5OA 5EWFA 3Q8SB 5T41A 1DAXA 1TL4A 5DO2A 1ZS6A 1LWCB 4O4GA 3M2UB 1TELA 2QMWA 3CJRA 5AXMA 4EI2A 2KRRA 1FFSB 4NI2A 3RUBL 1EETB 1SQFA 2K3IA 2AT1B 1X5OA 3DRSA 3IRXB 4G6VB 2XEXA 2Q3PA 4IOBA 3JB9k 3KJQB 3UI3A 1LXJA 3AAWB 3UDLA 2CQPA 1N5YB 1AUDA 4B3MJ 1QLNA 5F8IA 3PW5A 1BLUA 4RL1A 2ZJRQ 4DPWA 1X31C 4LREA 1M5OC 3HT0A 3MMAB 2IYGA 2W7AA 2HK2A 2BKNA 1PYTA 3LANA 2RH3A 2GCFA 2WCXA 5JVGQ 2QV6A 4U7UK 2YQ0A 3HSJA 2MDAA 2R8JA 1RAJA 4H4OA 5HROA 3NGUA 2RMLA 2LU2A 3H59A 5KFZA 1TZ0A 1K0TA 3GPAA 4DFPA 4DX7A 2AZ1A 2PEBA 3BBCA 4RW4B 5SZTA 4DF4A 3J7ZT 4DR6J 4ZCMA 1RTIA 2WONA 2OTLS 4KSEB 4LVOP 2Z2LA 2RVJA 5K8OA 3GR0A 1GAOA 1U09A 1FRLA 3UFCX 3MGJA 5CCMA 2J0WA 3ITHA 3GJTB 1TTHB 1B99A 2XMTA 4DEZA 3OSPA 1CQNA 3D54A 1MU2A 1DTQA 5A2QU 2BRKA 3MPDA 1URNA 4Y28C 4MTPA 3UWTA 3PFOA 1FI4A 1LXNA 5E2QA 1RT5A 1S4EA 2JH3A 2JRSA 4B3OB 4NMLA 3FCWA 1YRUA 1KNZA 3MM7B 2PD1A 2CZ9A 3PHEA 2DRDA 1K1QA 2DR9A 2VG5B 4P75A 1IKWA 1ITPA 1NHKL 3AJ1A 3J7Z5 1M1GA 2W9CB 3CC2S 1ZH5A 2MZJA 2XLKA 2O01C 4ES3A 1KQGB 2OHDA 5F8HA 3I31A 2HVZA 3MFHA 4LRBA 3I5CA 1HNVB 4DV7J 1U45A 2A6MA 3GIKA 3U7JA 4JI6F 3WIVA 2MSSA 3R6LB 4LF7J 1IVZA 2X3DA 2JVOA 2C2DA 1N34J 3PRVA 4XAKA 1AW0A 2FHJA 2XYPB 1RTHA 3BH6B 4OYZA 4X64J 4MKYA 3KLIB 3B4MA 2L48A 2HHSA 2NZ4A 2DNLA 3DXSX 2DNKA 3FEZA 4ECZA 1IN0A 1HA1A 1JLQB 3BN7A 2HHVA 2BOPA 4ZVRB 4DV5J 2XQCA 5H9EK 1I94J 4E8UA 2GC8A 1QUVA 3RTVA 4YQWA 1HWKA 4C8ZA 2LU1A 1FTCA 1LFPA 5F3TA 1ZM9A 2VD3A 3PG9A 1UL3A 2AQ4A 4LF8J 2MKCA 2Y1JA 2VU5A 4A8SA 3NWGA 4YR3A 3HKZD 3R5CA 3T19A 3J81j 2IAJB 4DPOA 5DDQC 1HQUB 3TZYA 2YKNB 1VBXA 2FZCB 3RB6A 1NPKA 3ENAA 2HZAA 1CBKA 2BA9A 3OLBA 2EKNA 1RQ0A 4OIXA 1M1HA 1N5SA 1FWLA 3CCWA 2XTJP 1R0CB 3GJQB 2B4VA 1NCLA 4ED4A 1YJVA 2H4YB 1TP7A 2B9YA 2ACYA 5F41A 5KFVA 3MUVP 4LF6J 1N0VC 2BJEA 3V6DA 1Q4RA 2IRYA 3GTYX 1PJ5A 2O1PA 4KKOA 3SDEA 3CD6S 3R8YA 1B7YB 3GP9A 2W2QP 4LVNP 4UZCA 1JLBB 2QMUB 3BGOP 3TZWA 4A48A 1OPIA 3NKYA 1BWEA 4IFVB 4KO0A 2PFDA 4GO7X 2NXUA 5C7PA 2L08A 4DI6A 3S8SA 3JTOA 5GADI 3UD3P 1T05B 4WF9Q 2GNKA 2OEMA 1X4AA 2OAUA 1TAQA 4OI4A 3NNCA 4KR0B 2KZMA 2F9JA 2JX2A 1Y3JA 1S79A 2F9DA 4RBVA 1LWFA 1U47A 3UDVA 4K4VA 1SQGA 4ZJOA 1HQEA 1Y10A 4JV0A 3GIJA 3CDUA 4CTAB 1FNXH 1K44A 1TUVA 1RWOB 4K0KJ 3I0RA 5EGYA 2WOMB 3Q8QB 5F8GA 4FBTA 4EEYA 2EI5A 4DX6A 2VJVA 5D3GB 3DI6B 3RW7A 4LT6A 1DQ8A 2VFRA 3N01A 3QLHA 1KWMA 2DIUA 3T5KA 5DM7Q 4HDHA 3M8RA 3SI8A 1KSPA 3MPYA 3SMZA 2AGPA 2JFKA 2YNFB 5K14B 3QZ7A 5ITHA 1SIWB 4DN9A 5DZ7A 2E1AA 1LWFB 5E3CA 3D5MA 3PYGA 3C6UA 5JUMA 2VA2A 2HWIA 4RZRA 2MZRA 4KHPF 1LFWA 2H3EB 1Y9OA 2DNPA 1RHKB 2V63A 3D6MB 5LM7E 2BUNA 3I4PA 3NP5A 3FEYB 5FDLB 3RGIA 2HBRB 5GAEI 1FRMA 4NA1A 1NJXA 4IG3A 3NOCA 2JSXA 5IC4B 1YIJS 4DL7A 1FERA 2MKKA 3SQGB 5AE2A 3CJQA 1JIHA 4EO8A 1HBOA 4AQYJ 4QU7A 3V6DB 4A8KA 1SJRA 3QRQA 3DOLA 3T5JA 5BYQA 2CFXA 3G8TA 2QSFA 4C48A 1FEHA 2EG2A 4QIWD 1FD2A 2HHUA 2Q6CA 1TKZB 2Q1LA 3Q8UA 3FMBA 1HW9A 3TR5A 1M5HA 1ZOTA 2IVMA 3G2XA 4AL7A 2WVDA 3EVMA 4C0HA 1U6BA 4CO1A 1VJQA 1FEEA 1ZZNA 4RNOA 1RHMB 3H2UB 1OYDA 4HACB 2F65A 4C97A 1HI1A 3M9NB 5DQHA 1XN9A 4KYZA 2GIFA 3W64A 2KH9A 1HIYA 3ELHA 2CQ3A 2ZE2A 2N82B 3X3UA 4KE5A 1NDLA 2AMCB 1H2UX 1VRUB 1WOSA 3NXZA 2LKZA 2RD5C 4USMA 1VIOA 2OIHA 2I9SA 1HHTP 4ED7A 2X3GA 4ZPCA 1T11A 3I87A 3NOGA 4USKA 3VHQA 1D8YA 2DXFA 1NKCA 5D77A 5A76A 3M7VA 2PN6A 3OD2A 3G6ES 2QA4G 2ZZNA 3OTOF 3D0HE 3LTOA 3UVJB 1Z1ZA 1WEZA 1X5SA 5L1IA 5EWEA 1FX4A 4M95A 1WC0A 1HWIA 2A3JA 5KFYA 1VRUA 4NLVA 1N8RT 2Z58B 3R5BA 4MAKA 4QYRA 3O5TB 2K2PA 1MN7A 1U6ZA 3MR2A 3C2PA 3BN4A 4CLKA 1HR0J 2VPXB 4NX9A 1QSYA 2HLTA 2VG5A 2J0SD 3CO0P 3B82A 2YXLA 2F1FA 5MLCV 3I9ZA 2CPHA 2NYHA 3D3BJ 1RT5B 3AODA 1R31A 2OD4A 3NCPA 4NLRA 3P45B 1UWBA 1DRZA 4RO0A 4DOZA 5C25B 1SKWA 2E1CA 1OMSA 3RAQA 2XSFA 3AA8A 2GQ2A 3LP2B 1HI0P 2M7SA 2DBBA 5KAKA 1HR0F 2DCUB 2DGXA 2HURA 4I1TA 1WACA 4UUXA 3SCJE 1YVFA 4IRDA 2JL9A 3IP0A 4GKJF 3ETOA 1X5PA 1RB0A 4RW4A 5F8LA 4DG1B 1PYOB 1U0SA 2GGPB 4NLUA 3DOKA 3HJFA 1N54B 4OJGA 3K5OA 2DR6A 2BJ7A 3SSSA 4IRCA 1QTNB 4IH5A 2ALZA 3RBEA 4RW7A 3HVRA 1SCJB 2HQCA 1V3SA 1Z4UA 2ASJA 3M05A 1SBRA 4CLWA 5I42B 3DRPB 4DV5F 3OTBA 5EWGA 1I94F 4GO5X 4WXWA 3IG1A 1D9DA 3V81B 1S1XA 4BWJA 2MZSA 3T6BA 2FC8A 5L39A 3VGTA 2B7CB 4DV6F 1G2EA 3U1MA 3GFYA 2JEFA 4NWBA 5B0FA 1HHSA 2QSWA 4C6AA 4DS5A 3IWNC 2Y0BB 4ZP9A 1HNXF 2GS8A 2P2CB 1FVQA 5A6WA 4QYZK 4AT1B 2RKIA 4CO3A 2F8MA 1FFWB 2CPXA 1E6VA 1SC6A 3AB4B 3QIDA 3J81U 2ZH6A 5ETPA 4CLUA 3V6HA 2DH8A 5IQQA 1YQHA 2XM3A 1N32J 2BYCA 2HFSA 5EX0A 3I82A 4ZK7M 1FT8A 3IAM9 3M6XA 2R7UA 2XGQA 4Q0BA 1R27B 3PXGa 7FDRA 4B3TJ 2C2KB 1UA1A 6FDRA 2Z2YB 2W9BA 1YJWS 4NASA 2IFXA 1HBNB 2HG4A 4CT8A 1LV5A 2UUTA 3G96A 1YKWA 4LF2A 1PILA 2HFVA 2Z2MA 3TOQA 3V4IB 1J5EF 2KJVA 1AXQA 1BE4A 2F7VA 2LQ8A 1WF0A 3LGNA 4DX8H 2D3OR 2BANB 1GXUA 2QA4S 3NNHA 4OZ1A 1GQEA 4DPUA 1IUJA 2B9XA 2XB2D 4KY3A 3IR7B 2KDOA 1G7CB 2V8VA 4MYUA 4JYAJ 4L3KA 5L9NA 1GMVA 4X4OA 1GXLA 2N4CA 3U1NA 1U8WA 4DF8A 2FJVA 2UU9J 2E44A 1KKHA 2XY7A 1T0TV 2ZITA 3JS9A 3ZFVA 2EFQA 1VMBA 2PDAA 6AT1B 3JSMA 2CJKA 1W26A 5CYMB 1BHNA 1HI8A 2V4JB 3DRPA 3P8BB 3QGPA 4USHA 1DQAA 2HAFA 2OI2A 5DRKA 4LF1A 4WFYA 3H4BA 4P2XA 2V4RA 2AYGA 3KOAA 2XSJB 2JEIA 2H9ZA 2KT2A 1MWZA 4BWMA 3GQCA 3BQ0A 3BGLA 4R8UA 3T5HA 1C4AA 3HHDA 1YBTA 2UP1A 5DLFA 2UZAA 3HHLB 4OJ1A 1WC3A 2CZVC 2DTJA 2R42A 4ZVPB 1AT1B 2C3MA 4QZVB 4EGLA 2VDIA 1NK4A 3W63A 2WW8A 3M32B 2EEYA 4MH8A 3CCQS 5AJ3F 2RNEA 1Y5LB 2XWYA 4AXJA 2FVSA 5IQ6A 3BQ1A 1MROB 2ZOMA 3NY0A 2CRLA 5C24A 3M2RA 3ZO7A 4O44A 1GTHA 4L73A 4I7FB 4GRSA 4ED2A 2ZH4A 2AEFA 2FB0A 2M4MA 3BV8A 3CW2C 4K4TA 2IC3B 2V4JA 3SBMA 2ERRA 3AJ2A 1WHVA 1WELA 4LFCF 1RT2B 3ISND 1AYEA 1RWPB 5D4LA 5AXLA 3OL6A 3GV7B 1FJGF 1K0VA 1YI2S 2C3PA 4TU9A 1O6XA 4RW8A 2EPIA 3HHLC 2R7SA 2DPIA 1FWKA 3LALA 3SFGA 1NB7A 3CC4S 1TKTA 3PKYA 2QE5A 1T3NA 3AFGA 2HK3A 4OLOA 5KTQA 5LOQA 4ICLA 2QLXA 1WUUA 3A12A 2HLUA 4CLLA 2ZHAA 2RS2A 1RT6B 3N5FA 4K0KF 5K5MA 1U1RA 4U8YA 4FP9A 3BDPA 5KOXA 3MD1A 5KFDA 2FYXA 2YPZA 2MQQA 4ED0A 4LF8F 2C3OA 1I1GA 2YNGA 1XMQF 1IBKF 1OIAA 2YWKA 3HJVA 1JLFB 1RTDA 2LQ5A 1TK0A 1GMUA 3HMJG 1K73T 1FRXA 2V2KA 1ZAVA 4GVLA 2XMMA 5CQGA 2XCPA 4IO1A 3LAKA 4LSLA 1XTZA 4QIFA 1RKJA 2MZTA 2XHCA 3DOMA 1WKJA 3RBZA 2V2VA 3VR1A 3HFVA 4DHVA 2LA6A 3E51A 2LDYA 3IAS9 2CADA 2WVFA 3MR7A 2D7SA 1TKZA 4AUKA 2MHNA 2MKIA 4JI1J 1Y0HA 4G3IA 3PRDA 3V81A 1NJZA 5D4OA 2LQBA 4J91A 1ULRA 4UOGA 5J2MA 4QWAA 1QAIA 4IFYA 5FIIA 3LP1B 4ZPTR 1JXEA 4KB7A 1S1TB 2MLZA 4K4WA 4QIVA 1EQ0A 3V2UC 4DU8A 2HFUA 3JTPA 1N5YA 1RT4B 4ZCKA 3HSDA 5ETRA 3JQJA 3PJ9A 4AL5A 4P2FA 2FZGB 4P72A 3OJUA 4LF5J 5KFOA 3A1YG 2LMIA 3SIPB 4UUWA 5GADU 3GILA 2B4PA 5HANA 4CDIA 4ECTA 1YJ9S 4PEOA 1LOUA 1Q79A 3LP2A 2HS3A 3ADAC 3FGVA 3J80U 3W9IA 3OHBA 1RAIB 2JDJA 2BOAA 2LXIA 3Q2SC 4IDKB 4PXEA 5KT2A 1C1BB 1Y3KA 3EWGA 2VUGA 4PKDB 2C2RA 5IT9Y 1E6YB 3ZXWA 4X4QA 2Z2ZA 2R7VA 3PW7A 4WYWA 4R5PB 2FC9A 3I96A 5KFIA 2MKHA 4DV2J 5F8NA 2EBEA 2NS1B 2VL1A 1DZ5A 3HHLD 1BQMA 2B4UA 2WW4A 4F02A 4BBYA 5LJ3Y 1X0PA 2HFOA 5I3UA 4PWDB 4RUHA 2B51A 1ZAXA 4Q7AA 4F8RA 3TX8A 1PGZA 3PW0A 2D3UA 1FKOB 2CPIA 2IMOA 3M30B 3MEDB 4L74A 1L3UA 4ECXA 1HKAA 2EBGA 4UOCA 1PBAA 3AY0A 1U0HB 2HBZB 3SQOP 4CLYA 1U1LA 2B56A 2DGUA 2JWNA 3KK2A 1G1XA 4DR7F 3T1YF 4X66J 2CKWA 2ZWPA 4ZPVR 4NXMF 2CQ0A 1XEZA 5E0OA 2ZJPQ 1VCTA 4RW6A 1B4SA 4LR7A 2JLEA 2MJNA 1H74A 3PX4A 4H54A 4EO6A 3K2YA 3JTNA 1FRJA 1SUQA 5ETQA 3OVAA 1KOHA 4J9VA 3R5GA 5HO4A 1WNEA 3R7NB 5HJYA 1P27B 3MMBB 1T3OA 3ZZOA 3E3XA 2RRNA 3OXFA 1HMVB 4RR5A 3PRBA 2OKQA 2VF3A 9RUBA 3HVTB 2ASDA 4CT9A 1N4LA 4ERDA 2ZNYA 4B02A 3ISZA 3MMCA 1RWVB 2Y1IA 1VQ9S 1VHIA 2KG1A 3P49B 3T9ZA 5E3AA 3ICLA 4LFAJ 1KC8T 4I7FA 1LNQA 1IQZA 4Y34A 1S5ZA 4ZP8A 3NGTA 5C24B 2C3YA 4YR2A 3PW4A 5KG3A 2DHSA 1JNZB 4MK9A 2HBQB 4PQAA 2AJQA 3CE8A 4WKRA 1VQ5S 4DMZA 1LW0B 3L7OA 3KMQA 1RBOB 4IQMA 4WIQA 2R7QA 3N4WA 4WE1B 3SQGA 3OL7A 4GKKJ 4YDXA 4M5HA 1V5VA 3HLUA 3PR5B 3MEEA 3R5JB 4RW9A 2AKWB 2IRXA 3EJMA 1FDBA 2K06A 4DR4F 1T9TA 3O8WA 1UJ5A 4X4UA 3DYAA 2VQFF 1FDDA 2EK1A 3EXYA 3S1TA 1QSSA 2EFNA 1JKHB 4ZPAA 3PDNA 5LSOA 3KK2B 3VAKA 1IKXB 1UEKA 1U0HA 3MOZA 3DGPA 2VFUA 2DEJA 3AHPA 1HNVA 2GJ2A 1H3DA 2V2ZA 2YNFA 3EDQB 5K14A 1OS5A 1Q7LB 2HQDA 4K7QA 3ZZ0A 4C3LA 4X4PA 4DSJA 4MIBA 1G3OA 1FJCA 4OL8A 3Q83A 3CJKA 1I6JA 4ZVHA 2W4DA 3RBXA 1SJQA 4NPOA 1SKRA 4NXNF 3KLEA 3DHXA 3ILJA 3CJSA 3DM2B 2KN4A 2HHHF 2XNRA 2UUAF 1JLAA 4DR3J 2GVDA 1HQEB 4AQYF 2LVWA 4C9DA 1B0PA 2WAQD 1EIYB 2YKQA 2BE9B 2JZ5A 3NGKA 2W7OA 1X60A 3C15B 1VLOA 4FS2A 4X4NA 1GNKA 2P9GA 1TL5A 2ZFHA 2F3JA 2FJAB 2D9OA 3W2WB 1CQMA 4ZVOB 4KFBB 3IRWP 4RLEA 3QYYA 1UW9A 2DNYA 2N3LA 2RDDA 1TMJA 4JI6J 1KFSA 2QYGA 2UXDJ 1QVFR 1PO6A 4W4MA 2R8HA 2WZ1A 2IBOA 3I6PA 3MWBA 3GMGA 1F5AA 3IG1B 1LWEA 4KAIA 3JQKA 2DNOA 2J9EA 1T95A 2FY8A 4JI7J 3HD1A 2LECA 4HTIA 2IVYA 5K9FA 2OPSA 5GAGI 1V6HA 2IMWP 2FLLA 1S0VA 1JLCB 1VBKA 2AJ0A 1S72S 1SIZA 2J6TA 3CMAS 2QZ8A 3AOCA 5THWA 1UVMA 4M5MA 3MFIA 3NAIA 4NI2B 4U7UD 3MCNA 4TN2A 1PAEX 3HX9A 5BJRA 4A4JA 3W60A 1HWUA 3NS7B 2RQCA 5D4PA 5HP1B 2JLFA 1RISA 3KUGA 4OI3A 2VKRA 3RR8A 3DRRB 4MYTA 4ZLLA 1MSWD 2HMIA 5J2PA 4RW6B 2LEBA 4TLQA 4PG6A 1RUSA 4WPAA 5F9LA 3EUNA 3OQ2A 3GONA 2BBEA 1RLDA 4X65J 4C98A 3QATA 4CCHA 1S6QA 3N28A 5AJ3J 3QGHA 1FJEB 2EG1A 1RWNB 5LT5A 3QIPB 2FIUA 3SV3A 3HSGA 4OI2A 1SKUB 4O3RA 2FPHX 1FX2A 4ZPBA 2ATLA 4XDCA 1PCAA 1EZZB 5F9NA 2RILA 4G1PA 2ZH7A 1MW7A 3NGDA 2JNJA 2R7RA 1B64A 2G0CA 2IM0A 1MN9A 2MMYA 2DT9A 4W90B 2YWHA 4KGZB 2HKEA 3WX4A 5KFEA 1CG2A 4UF4A 4Y00A 1ZM4A 4P9SA 3VVTA 1NSPA 4P7TA 3SFUA 1ZYQA 4FKXA 2NSBA 1DLOB 3O1LA 4JI4J 4YS2A 3HDSA 3QFHA 1S1VA 4IR1A 4L6V3 1PBUA 5L1LA 1FDAA 1RDRA 1S6PA 3M32A 4G1IA 3H4DA 4GC7A 2ZD1A 4OYWA 3AQOA 1N6QA 3LF0A 4DUYF 4DV6J 1FTRA 5A2QY 3NS5A 3QZ8A 2PI5A 1NLKL 5DG8A 1MWYA 5KFMA 1WHWA 4X66F 1L5UA 1IKYA 1S57A 2D3ZA 2RHSB 1RCXB 2AW0A 3DLEA 1TL1A 3GE9A 3GV8B 3KG0A 1H72C 4FNHA 2H5EA 3KUEA 2CPZA 1HPZA 4HR2A 1HBUA 4CYUA 2DXDA 4XPEA 3ONQA 3QT6A 3SYZA 2VPWB 2HQ3A 2MLYA 4DPTA 3JQMA 1JMTA 5B0BA 5I3QA 5IT0A 5DDPC 5GAEU 1FRHA 1SPBP 1EETA 4DR5F 1CJTA 4IG3B 2X51A 4R0EA 4P71A 1FRKA 2OJ3A 3DNCA 4R0JA 2OLWA 4TXSA 4DZDA 1U1QA 1WORA 2D1CA 1S6UA 2RE1A 2F5GA 1BQNA 1DQ9A 4TU8A 1S1UA 4IQXA 1FKPB 1WC1A 2Z30B 4KPYA 4PPDA 4NOHA 3J7YI 3EE3A 1UPPA 3J81Y 3EPGA 2J0QD 2BR0A 4CWBA 1VIXA 2DHXA 2OMOA 1MMDA 1UCNA 2CQIA 3OFGA 2ZBRA 4HTJA 2NXEA 4ZS6A 3QGIA 4C8LA 3MF5A 3NGSA 1FVSA 1DTTB 4MFBA 4OZ0A 5IT4A 5DG9A 1T9XA 3M6WA 2XC9A 1CJVA 4J9KA 4NEYA 5HVHA 5KG2A 4PQUB 3GB0A 1WI6A 2F8HA 5KT3A 3Q8VA 3MM8A 4FNIA 4I6WA 4P10A 2CJAA 1CJTB 4UTGA 1X4EA 2W4CA 4U96A 3EICA 2CJYB 3TWZA 2ASLA 3T1HF 4DSIA 1HYSA 2ZZMA 4WTYA 3OLAA 1Q53A 1S9GB 3QJPA 2F40A 5CYJA 5HLFB 2UVRA 3DLKB 1UW4A 3A8IA 4CLTA 2D3O1 1KR4A 1X4FA 3OR1A 2ADBA 1RI7A 2JEGA 3TQ1A 3CJ4A 2O3DA 4HH0A 2PO4A 5LXYA 3A3OB 1KHVA 2C22A 3QRRA 2GJFA 4B08A 3T5LA 1U4BA 1KVJA 1MWQA 3TUZC 2C2MB 2OSRA 2HS0A 4CI0B 1WKKA 2AWZA 3MR5A 2LXFA 2KXHA 3KK3B 2M70A 3FCHA 4JI3F 4P52A 1ZETA 4EU0A 1TL7A 2Q79A 3GCWP 3POTA 5HK4A 2V50A 3THPA 2YX1A 4O23A 1S6PB 2QMXA 3GU0A 4NLOA 1D1UA 3EXCX 3ENWA 3EVWA 5AT1B 1EB0A 4I2QB 3ZNJ1 3W2VA 2X1FA 5C25A 2Y8WA 2AX0A 2BMBA 4LRAA 3SEOA 3KHLA 1EKRA 1RAGB 3GJSB 1RHRB 5CYMA 4B3SJ 1FXRA 4AL6A 1CULA 2M52A 3AQPA 3KHRA 5ETSA 1RT7B 3IWXA 2QLBB 3N6MA 3VAMA 2H1YA 3M8QA 4WXOA 2E1MC 4KHRA 4NLDA 2OTJS 3VAFA 2QEXS 5I4MA 1HQ2A 4FXVA 1QUPA 2LQJA 1H6KX 4ZVUB 1T03A 3AD9C 4JI4F 5E3QA 2CUYA 4RNHA 1N52B 4WIIA 3FJ2A 5D0HA 3HF5A 3BR8A 3HXMA 5H9FJ 4OHVA 3L7PA 3QT7A 1HWLA 7AT1B 4A46A 3K5MA 1QTMA 2GHVC 4OFZA 2JVRA 3M2VB 1RP5A 4UZBA 2DNMA 2HNZB 2RF2A 3GCXP 1QSLA 3C14B 2XMWA 4HLBA 5J2PB 3BSCA 2RS8A 1FF2A 2CAJA 1KEKA 5HL7Q 4DQRA 3OVBA 3G87A 2QLJB 5HBMB 3RB4A 1DBDA 4PWUA 1RHQB 3KTQA 2VBYA 1XWLA 2KU7A 3N6LA 2RKIB 1BQMB 1TAUA 4WU2A 3OT9A 1S1WA 1SI9A 1MMLA 4M5JA 5KT4A 2MZQA 2QO3A 5E3RA 4X65F 1M5PC 1HWJA 1XMQJ 1UVIA 2ZKUA 3OL8A 4B3OA 3ILIA 3R5DA 2R2TA 5ETTA 4QPTA 4F2RA 3PJXA 5LMNF 3Q89A 4Y65A 5D4NA 2B7BB 4LSNA 5L1KA 1T94A 5KFGA 1RABB 4ILRA 3PY8A 2DK2A 1SJFA 3DM2A 3JSBA 3IGNA 3KLEB 4FPIA 1QM9A 4KHMA 4L75A 1RAOA 2NYIA 1FNMA 4RW7B 4ZDNA 5LSLA 3D1OA 5L1JA 2ACMA 4OJHA 3L7UA 3BYPA 4K2JA 2XMVA 2DITA 4P2MA 1J2VA 3DOKB 2VOOA 2BQRA 2LXUA 5F0UA 3D68A 4J9UE 4NA2A 4USJC 1ZBTA 4J9RA 4A8MP 4HYKA 2FJWA 4G1QA 2QA2A 2WVCA 3FBBA 1KBRA 4QBUA 2ZM6F 1I51B 4GMKA 4DV1J 4WBFA 4B9SA 1B7FA 2MQMA 2EFGA 4M63A 3R7SB 3U1LA 2C3UA 2UV8A 1YRXA 2Y3YA 3ENVA 2ZDPA 1JKHA 2QYCA 5B0GA 4S0MA 2OMLA 1RWWB 4FS1A 2BV3A 2KYXA 4BDPA 2IVFB 4ECYA 2MQOA 2E7XA 3RRHA 3UN3A 2PFFB 2PC6A 3DCAA 2V8PA 1UETA 3ULHA 4NCGA 3PR4A 4CQ1A 2L3MA 4WE1A 1SH2A 3N79A 1IR2A 1U02A 1NU4A 1S59A 3CJKB 5DG7A 3DI6A 2E5LJ 4H4KC 5C2GA 2J6SA 2G2OA 1H2TZ 3VAGA 2C1EB 3FBCA 2V9WA 3A3PB 1CJKB 4B3SF 4N77A 2R7TA 2LLZA 3UPFA 3IGVA 5G0RA 1IXKA 3DMJA 2FD2A 1SXLA 3FDSA 2LP4A 3G82B 1KQFB 5LJ5Y 5EDWA 3G6XA 1S4FA 5B0EA 1NJWA 2PMWA 2EFPA 4B9MA 2E29A 3AH6A 4C0BA 3DLBA 4EYIB 3A8JA 5D0RA 1SJ4P 3CC7S 1NH8A 3TI0A 2ABYA 3CNQP 4QQBA 4OHXA 2EFVA 4WCEQ 3D2WA 1Q16B 1XMBA 1D9AA 3PIOQ 3FBEA 2KT5A 2JEJA 3O2IA 4QIGA 1UWAA 2EW9A 2DIVA 3CCMS 4X4VA 3M1VB 2FHOB 5KG4A 4FBUA 3CDBA 1NPPA 5KFKA 3I5AA 3KNGA 2G2YA 4C7QA 1BC6A 2NUHA 1KTVA 1KLMB 2KM8B 1SV5B 2I5JA 3L9ZA 1NSKL 4NYOA 2Q66A 2B9WA 3QPIA 1XMOF 1SL2A 3LGHA 4V1Ak 2BW7A 1ZPVA 3BO3A 2YX4A 3K5PA 1LQ9A 5D78A 2KO1A 3D0IE 5IM0A 2FY1A 3W2VB 4ED6A 2A2CA 3ILOA 4FYXB 3ZTQA 1LW2A 1P1TA 4ZPDA 1MG7A 3QJLA 1VI7A 1X4BA 3IR5B 2IA6A 5U47A 3NNAA 5H9EJ 3HVTA 4Y3CA 2Y9HA 1VQPS 1HMVA 3EYZA 3KJNB 5E5NA 4KJIA 2DGTA 4QR1A 3UO0A 3JYTA 3CCJS 1FD8A 4JI0J 1N5QA 1JLQA 3TVYA 4CP5A 2HS4A 4OYAA 2XSJA 3K89A 4WFAQ 2G2ZA 5FDLA 5EUHA 1XR5A 3D3CJ 1RHJB 2XWXA 4U9RA 4LSZB 4Y6IA 3R9LA 2X1AA 2ZUAA 3E8OA 4F2SA 4EWTA 3GSIA 2CG8A 4JI5F 2P6TA 1RU2A 4K4YA 4NLYA 3EMTA 5KFTA 1UTAA 4PG4A 4U67Q 3G71S 3SZ2A 4I64A 3DLGA 3BH7B 1RACB 5B0AA 2MGZB 3RRKA 1RA7A 5KFBA 5IT9U 4ED3A 3KMSA 3N6NA 2J7UA 2CG4A 3FSXA 4LR8A 2GO9A 2P9EA 2YQ1A 3UDEA 3UQSA 5B0CA 2MQNA 3QLHB 3SV4A 2A0FB 4YEAA 3TW0A 1K9MT 4Q8FA 2I8EA 2ATCB 4OJ3A 4JV1A 1YBAA 3MAAA 3BSOA 2R8KA 3GG1A 1NK5A 2AP6A 2A1BA 2AV5A 1NK8A 4HT7A 4Q45A 4XK8C 2K1RB 3FRZA 1VQ8S 4Z2XA 4KBIA 1RT1B 2W8KA 4KGXB 1CC7A 2RDIA 2XZTB 3DKDA 3R27A 5KG0A 1IKVB 4CLZA 3T1HJ 2UUCF 3FQLA 4WJBA 1KDNA 2WBMA 1AROP 4PXCA 1DTQB 2HRTA 4F50A 2G4BA 2FVRA 1N36J 1VRQC 3D1QA 2AX1A 2G13A 3BJYA 2O66A 2B4OA 4LRDA 1E6VB 1EX8A 4UW2A 1S7HA 1XC9A 1N32F 4F3QA 1QDUB 2XMAA 1JJ4A 2GZOA 2OEJA 1NKBA 3LAMA 1C0TB 2A10A 4JI8F 4ALZA 3TYTA 2ZH5A 2UXCJ 3DN9A 3HZGA 3SSQA 3PW2A 1ZZFA 2QL5B 3QO9B 2DD8S 4QWDA 2W1BA 3IFEA 2DISA 1W2BR 3C14A 4B17A 3P6YC 4JYAF 3BF4A 2PA3A 1HBUB 1NSAA 4OZ2A 4CYUB 4IFYB 1JXVA 2FHKA 4YOEA 4ZLPA 5I42A 2KHCA 3PYDA 1A6LA 3L3CA 2W2MP 1UZHA 2ZOFA 1SH0A 5KFHA 1TUGB 1YX2A 3GFZA 5CAAA 5IWAJ 1NHUA 1Q5YA 1ICEB 1A7GE 2W2OP 4YB5A 1OWXA 3TARA 1S0MA 2V8HA 3GSDA 2YH0A 3ET6B 3NG8A 2DNZA 4B3TF 1ZPWX 2EK6A 4KTQA 2OP5A 3KNAA 1LWCA 4O4GB 4X4RA 4KH1B 4PG5A 5I3PA 3NMAA 4DSLA 3MCOA 3I55S 1V3ZA 4N7TA 4A8XA 4F0KA 4Z37A 2UUBF 2C2NA 3BBBA 4LBPA 5CD4A 4OI0A 4OHYA 4ZOSA 1JJHA 3O6QA 1CS4B 3BBFA 2ZKTA 3C6TB 1CVJA 4DCOB 1YSJA 3M8PB 2CQDA 2MQ8A 4J9LA 3KUHA 4I2QA 4JI2J 2EWHA 2IJFA 3LWLA 4YUDA 3D4JA 9ATCB 1VBZA 1FXLA 1ELOA 5IOLA 3MEKA 1AZSB 2I38A 2VC0A 3CCUS 4ZN1A 3R7BB 2CIMA 2ILZA 3M8YA 5CCLA 4B3RF 3A13A 3ET6A 3JSYA 4DR4J 1NZAA 1ZM3A 4C3KA 2B9EA 2HZCA 2WSEC 3FEXB 1IBKJ 5A8WB 1N48A 2YNHB 1FXDA 4DDFA 2PGCA 1NJIT 4UY85 1IM4A 1F5BA 4ELTA 4Q5VA 4M5IA 4AFFA 4XO0A 1JX4A 3JSMB 2K7JA 3M8PA 4WWSA 2BZ2A 2RB7A 3MEGB 4UOHA 5H1SV 1U2FA 2CJ9A 1Q5VA 2MYFA 3AT1B 2HMIB 1VQMS 3P5BP 4Z7YA 1WKLA 2FLPA 1RJJA 1HLWA 2J76E 2ZH9A 2IM2A 1YTYA 1UVKA 2KB2A 3DU6A 4PABA 3WC0A 4USWA 5B08A 4ZITA 5M2PA 1TMMA 4F4ZA 2R7WA 1CLFA 2C2OB 4D3GA 2BACA 4M94A 3PO5A 1RAHB 4HHJA 4NLWA 4KC5A 1VJWA 4ZN3A 3HHLA 4LFCJ 3JAMY 4EYHB 3V6JA 4A47A 1N34F 1LKZA 1DTTA 1HNXJ 1JLCA 2P6SA 4QWBA 3VGVA 5C5JA 2OSQA 1NZ8A 4OHWA 1PIEA 3TAQA 3IO1A 2BQUA 4J90A 3HKWA 5GMDA 3K57A 4O3SA 1TVRA 3R5AA 4WK3A 5CYQB 3V5RA 2FGOA 2E7VA 2Z0GA 4HDGA 4NMXA 3TJ9A 2MEWA 2GVZB 1RWXB 2EXUA 2OPPA 3GWCA 3QAEA 4Y2CA 5ADZA 4QW9A 4IOCQ 8ATCB 5M2RA 3W8GA 2Y1RI 4DV1F 1U1KA 4JI0F 1FRIA 3C3LA 2CPDA 3VV2B 3DRXA 2CPFA 3O44A 2QJ3A 2H54B 2POKA 2Z56B 2ZC4A 3UNYA 1SC3B 1U8SA 4K2XA 2UXBF 3CO9A 2BJ9A 3NRBA 4KFBA 4H4MA 4ZIVA 3LQVA 3M2UA 3FVYA 5DJBA 1D0EA 1V3RA 4JI7F 3E01A 1NDKA 4QU6A 2QLWA 2HNYA 3M8WA 4TQRA 2HGNA 1CJUA 3US5A 1HPZB 3T9NA 1HBNA 2AJ4A 1TL3B 2J6UA 1FO1A 4NA3A 2W9BB 2V94A 4LRCA 4K8RA 4DV0J 2ZZTA 4F0MA 1NK6A 1DFDA 2FDNA 1JLAB 1UFLA 4TKTA 3B78A 1YJ7A 5E7OB 3NCRA 2HHWA 1WC6A 1HL6A 3KHGA 4HI2A 4F67A 3LP0B 1JLEB 2RQ4A 1NXIA 1T7PA 1BWVA 1TFWA 4AYBD 3HO1A 1N36F 1YJRA 5HVGA 2CQHA 3P4UB 4R25A 4F7VA 1VHFA 3LW5C 4ZVGA 5BR8J 5J2NA 1UWBB 4OV6A 2HIYA 2CNOB 1IKXA 4WP9A 3UN2A 2A6OA 3ILLA 4K4ZA 2UXBJ 2Z57B 3IC1A 1NO8A 4F36A 3HK2A 2M0GB 5F3ZA 2XBPA 4C11B 5A6PA 2CQ2A 5KFCA 2UVWA 5K8NA 3CCRS 1B3TA 4F4XA 3EGNA 4IFVA 4KO0B 1QJHA 5KFWA 4ED1A 3PZPA 2HYIB 1R8CA 4OX9F 1IJEB 2HQGA 4IUFA 1FFGB 4D3HA 3CCTA 2XGPA 3FMWA 2VQEF 3R1HA 4ED8A 4NL5A 1ZA2B 4KIAA 4Y2AA 1WOPA 3W9HA 4Y0FA 4N5SA 2KG0A 4EMDA 4IG0B 4Y2KA 3CSKA 1VK8A 3SSRA 4IO9Q 3PX6A 1U7LA 4FDFA 3PEHA 4DV3F 4A8WA 4LF4F 2LA4A 1UAWA 2HGMA 5JJBA 3CF5Q 3ZZUA 3GR1A 3JXOA 1QAJA 2BJ1A 3DRRA 4LRFA 2QTWA 3WDOA 2ZOGA 3S7RA 3KDNA 1U49A 3ZZTA 2EC2A 3IM8A 4HL9A 2AEMA 3K5NA 2AJ1A 2HBYB 4ATNA 3CB4A 3MURP 4EBEA 1YITS 4I2PA 4N47A 2Q6BA 4ED5A 2UUCJ 4ZIWA 3KLHB 2Y0SD 2RRAA 4DL5A 4RNMA 1UFWA 1NK7A 4LQ9A 4GVBA 4FF4A 1P9QC 1LK5A 1RWUA 3RZAA 4EBDA 2M8DB 2IBKA 4LF4J 1G4CA 4PCQA 3H40A 2GHWA 2E5LF 1Q95G 3VGUA 1GX6A 2YVSA 4F26A 5RUBA 4DL4A 1UMJA 2CNLB 2YTCA 4J9QA 4QOTA 4C8OA 5LSRA 3KK1B 1K8AT 3KLGB 4YHHJ 2KJWA 4J37A 2ZC3A 3ENQA 4NLXA 1C0TA 1J27A 3QSIA 1TKDA 2DHAA 2LQ9A 4CH0S 1VISA 4BS2A 1AUSL 4KGKA 3W2WA 3K5LA 5AE1A 3KJVA 4ECQA 4IR9A 2CZ4A 1C4CA 2EC0A 2W9AA 1F1BB 2D74B 3C6UB 4MJKA 1HNIB 1G6BA 5HQLA 1KONA
chains in the Genus database with same CATH topology
1XNRF 3WBZA 1U26A 4RKUC 2O67A 4DL6A 3M9OB 3FFIB 1J5OB 2UVUA 3H5SA 2JJ4D 1NAQA 1P1LA 2DGOA 5LXRA 3KJVB 3RB4A 1Y5IB 4BCAA 5IS2A 2ZH3A 4DFKA 2UXDF 1XR6A 2JFDA 4G1QB 1RT4A 1H0HB 2FUG9 4ZVEA 2BXJA 1H2VZ 4ZCIA 5D3GA 4LFBF 1CEZA 1AFIA 1SJ3P 2VA3A 5CA5A 1GTEA 2FTRA 2RUGA 2FLNA 1VQKS 1S9EB 2FVPA 2VZ9A 3M9MB 4H4OB 5HROB 3U27A 4YB7A 2WB1D 1KVJA 2M3DA 4YMEA 3BGFA 2XS7A 2HQIA 3SCLE 4RUCA 4K4UA 2CQGA 4J9NA 1X8DA 3IWLA 2GV1A 4RW9B 4IYQA 4PUOB 1C1CA 1X9MA 1JLBA 4IRKA 3DFEA 3DRSB 3IRXA 1VQ6S 1O8BA 1VQOS 3LH2S 3VQSA 2BM0A 3RBDA 4DV2F 2F8EX 3FNNA 3TP2A 2ZUGA 5J1EB 2CQBA 3JSRA 5HBMA 2YKPA 3FSYA 4L72B 1HFEL 3CCZA 5B7WA 1HNWF 3ZZYA 3BSAA 4X84A 5K8MA 4QPXA 5DM6Q 1XBWA 1RT6A 1BY9A 2MKJA 4OI1A 2OD6A 2L41A 1VC0A 2I5JB 1Q1KA 1TKXA 3PV8A 4EZ6A 2DR7A 3MI7X 3EZUA 4FVCA 1HNZF 5J1NA 2GMJA 2HGLA 4DFMA 4BHQA 4DQQA 4K5SA 1YGYA 4KKOB 3GV5B 2HFNA 4DL3A 3FRYA 1JJ2R 3BM7A 4NYPA 3CJ2A 2W25A 5AXKA 2DGWA 1ZTTA 1WTBA 3WC2A 2XMUA 3TNVA 2VFVA 3G4SS 2OFHX 1ZAWA 1SL1A 2CQ4A 3IBWA 5GAGU 4QR0A 3CJ3A 5G0RB 2DO0A 3HHKA 4F25A 2GX8A 5DDOC 4DWIA 3F56A 4EZ9A 1VC5A 2AYBA 1VFJA 2KHDA 3MM8B 3HM9A 1NRKA 3H98A 3OSNA 2HPUA 1TV6A 5GVQA 2LEPA 2XCAA 4ES1A 1KFDA 1SQEA 1DJ0A 2N4DA 3DU5A 1TK5A 1C1BA 3KLIA 1WTFA 3OR1B 4DR2F 2L9DA 3J80Y 1V9OA 1S1UB 3BDEA 3C66A 4XPCA 2DNQA 3ITHB 1U24A 2N3OA 1D3WA 1O5JA 3M6VA 2IRUA 4OZNA 4C2MA 2JOQA 4URQU 4EFAC 2XY5A 2E7WA 1KTQA 5BYRA 3KLVA 4YDDB 3PM9A 1VQNS 4ECWA 1Q8IA 3E2EA 4PQUA 4KRWA 4WZQA 3LGMA 2SXLA 1FE0A 3NLCA 1SB6A 3UR3C 3RB3A 1U1PA 2M9KA 2OPRA 3A8EA 1N5VA 5FD1A 2ZHBA 2K8GA 1KQSR 1WI8A 4ITSA 1QE1B 2GFFA 3MM9B 4PXBA 1IBLF 3OVSA 1HNIA 1Y5NB 3G86A 2DNNA 4NLPA 5CH7B 3TANA 5DQGA 1JXLA 1APSA 3QAUA 3T6JA 4DLGA 3L09A 1WEYA 1R8AA 2ZVSA 1N6QB 1OO0B 3K59A 5BR8F 2ZD1B 2E9ZA 1R7IA 5J1PA 1X4HA 4YB1P 3VCDA 2WB4A 3CULA 3UD4P 3QMQA 1B0TA 1WEXA 2BRLA 1HBMA 2C42A 2MQLA 3BB5A 4PR6A 3KK1A 3H25A 3Q24A 2CVIA 2NREA 2J9CA 3M2VA 2W8LA 5D6GA 4WFNQ 2YH1A 5B09A 1WF2A 2RIJA 3MMAA 4ETXA 3DLEB 4K59A 3GZ7A 2E1RA 5T14A 3ZZPA 1XERA 2F4VF 1F2GA 3DDKA 4M8LA 1IR0A 2HHPA 4DQPA 4C8YA 3RAXA 2RJZA 2GMHA 3NCQA 3DLGB 2MGZA 4MIWA 2C28A 1REVA 5KFPA 3CDEA 4K5RA 1RT2A 1VRTA 2QA1A 2LCWA 3CXCR 3MUTP 3I56S 4IH6A 1DLOA 3J7YU 4ECVA 1FNOA 2DPJA 3C6TA 3K8VA 3EPIA 3P5TL 1F9FA 2VG6A 1FHTA 3NAHA 2OH2A 4ES2A 3BREA 3MOJB 1OSCA 1HD1A 4ID5A 1REVB 5DETA 1UEVA 1NKEA 1O0PA 2CJBA 2MPUA 5KFSA 2K7KA 4LIRA 1HW8A 1JK9B 3KLFB 1WHXA 1WF1A 1M5KC 2P5VA 4I69A 2FJBB 3CIZA 4NLTA 2AGOA 3TRGA 2OPSB 4CNYA 1B0VA 1RT3B 2AF6A 2JC0A 4C11A 5HMZA 3RYLA 3TUIC 3M8SA 3Q23A 3VAIA 5F0WA 3DLJA 4DSEA 3CD7A 4HI1A 2FHJD 2FJDB 3MXHP 3M4XA 3DLKA 1MNEA 3PVXA 4Q2MA 4DQSA 1KLMA 4ZVFA 3PX0A 3ZZZA 3QO9A 3ZZRA 2WK4A 5MAOA 3MTKA 5C42B 2V5HG 3DC2A 1X4GA 3V4MA 2ZE2B 3IS9A 1VQLS 2YWEA 2HVHA 1VK3A 1U48A 4RNFA 5LL6d 4ILLA 3TO8A 5A8RB 1TKXB 1CC8A 5AXNA 2YKMA 3CCVS 2XI2A 4K4SA 3LWMA 1YG0A 2E66A 2IYIA 3KHHA 1IKVA 1UEUA 4Q0BB 5IXUA 4CH1A 1W25A 1RTJB 1F5CA 1JNRB 2MSTA 1IJFB 2X1GA 1YJTA 2KVIA 5L8RC 2A18A 5J1EA 3DOLB 4AXIA 5CHCB 2AD9A 4O3QA 2PMHA 1RYRA 4H4MB 3NBPA 4OZLA 1C2PA 4M1KA 2DNHA 4NZ7A 5KFAA 2V0NA 3B4DA 1KS2A 3N0VA 3FSIA 4I56A 2Z8QA 4OLPA 4O4RA 2B6AB 3TVKA 2YNIB 2B5JA 5L38A 4F3OA 1R0AA 3P96A 1SJ1A 2DVIA 2R7XA 2PA8D 5DDRC 3UDCA 2DRBA 4OHZA 4UQGA 5KFJA 3D0GE 4C8KA 3JYTB 3NBPB 4TNOA 2N7CA 1D9FA 2DH9A 1S0OA 1A9NB 5F8JA 5KT5A 3OJSA 2E5JA 3MECB 2WOMA 5GAHU 3OFFA 4DR6F 3VQTA 3FFIA 4N76A 2B3TB 4TY8A 2RQMA 4ECRA 3HHNB 2GIQA 2M8HA 4WYLA 2FLOA 2XG8A 3HP6A 2JHEA 2OPQA 3TAPA 1T05A 2ZH1A 1WD6A 1K1SA 3MEEB 1Q7YT 3W7BA 4OX6A 3X1LB 3UW1A 3I0SA 3PEJA 3LO3A 1PC4A 1U25A 2DR5A 2MZ1A 4NCAA 2IM1A 1LW0A 3N5BA 1S6QB 2OO4A 4CZCA 1EP4B 2WRMA 3T3FA 2RSQA 4WK1A 3OR2B 4ZP7A 5A0YA 2YKNA 3MEDA 3S01A 2XLJA 3BGUA 4F4YA 4C8MA 3IN5A 4DV7F 3LOUA 1VQYA 2MKSA 3CWJA 5HQ8A 3MPWA 4U6PA 3KLFA 3EZ5A 3BEGB 3HPOA 2IHR1 2GIRA 3MMBA 4R5PA 2DHGA 1Z2ZA 2HVIA 1E6YA 1ROFA 4TLRA 3C46A 2FJXA 2DCLA 3H8YA 3MD3A 3P3DA 1KLNA 4DQIA 1AFJA 3IR6B 2HNDB 3M6UA 3WZ0A 3KYLA 3DLLQ 3OR2A 3B8HA 5KG1A 1BQXA 1QAXA 2CDQA 1VRTB 1LWEB 2GHPA 3D28A 2MJUA 4FVMA 4LMZA 3M30A 4JI1F 1T02A 3Q22A 1HBOB 2KTQA 2EVZA 3I0SB 3UNGC 1DHMA 2KRBA 1NHVA 4X64F 1N33F 2APOA 3C8YA 4KQZA 3CIMA 4NRUA 5EHHA 3VALA 3F44A 3CPWR 2WSCC 2EKYA 2I0XA 1J5OA 4RU2A 1U2RA 4PXDA 3H20A 5KG7A 4LSNB 4F3MA 2MY7A 3OBIA 3UR0A 2VFSA 5BYSA 4ETZA 1F60B 1MU2B 1FJ7A 1GT8A 2E5IA 2BDPA 1XNQF 2PMZD 2GMLA 4A8QA 2XY6A 4ZA1A 4DR1F 1FE4A 1UKUA 2GO8A 1WG4A 3SXLA 3CUNA 5J2QA 5CZVA 1BD6A 2HRYA 3Q2TC 3PKMA 1H38A 1JLEA 4WFZA 3UCGA 1KVIA 1XR7A 5GAHI 3OFHA 3I5BA 1S1TA 4CTAA 2ZBIA 2R8GA 4DSKA 1R6YA 3DDNA 4LJMA 5JXSA 3W3SA 4P7VA 2B5JB 4O3PA 2VKZG 4HH1A 3H5XA 2NPIA 4TYBA 3MZIA 3RU0A 4TQSA 1Q81T 2NLWA 2CYYA 2BE2B 2BQ3A 2VBWA 4FF2A 2VH7A 1ZM2A 3MCSA 2RQKA 4LSLB 2VB6A 4RW8B 3MM5A 2ZBCA 2NPFA 2R2UA 2W7PA 1JWWA 2KI2A 3M8QB 1RA6A 1SL0A 1IQTA 3T1AA 2KFYA 1FK9B 1H7WA 2OPPB 5I3UB 4CNZA 2JLGA 3BGRA 5LMUF 1M5SA 4ZCLA 3OW2R 1LW2B 1WG5A 3IXQA 2BJDA 4DN0A 4W92B 2FVQA 1YJUA 1TL1B 4RBUA 4C3MA 1HQUA 3K7RA 1UP1A 4B9LA 2DH7A 2R8IA 2ZNZA 2E5HA 4OMFG 4QYZJ 5E33A 3POTB 4YY3F 1BGXT 2UU9F 3U02A 1NK9A 1X9WA 2DR8A 2VFTA 3OL9A 3QWPA 3IA0A 4B9NA 3KFWX 3OFEA 1S76D 5KFQA 2ADCA 2YY3A 4JBCA 2WHOA 4K4XA 2CPEA 5G4DA 4JUZA 4JV5F 2E9RX 5CD4H 3PACA 5KFXA 4FYDA 3BS9A 3CDWA 1RTHB 2XS5A 3EGZA 4O0IA 3BR9A 2QFJA 1TK8A 4DBQA 1HD0A 4QCLA 3TAMA 4DL0C 3UCUP 4OX8A 1KD1T 4RX6A 1UJ4A 3K58A 2XNQA 1VOMA 3QIPA 1VGYA 4WKYA 1SH3A 3UE2A 2W24A 1IKWB 5CZXA 1U1MA 2KFNA 3VF0B 5HMXA 4DUZF 3MM7A 1YJNS 3MM6A 3BSNA 1RKIA 4USIA 3CCSS 4HT5A 4ZHRA 4OZJA 2KM8C 2AU0A 4EUVA 2AGQA 5KT7A 1RGVA 4WFXA 3Q8RB 3AB2B 2HHQA 2CPJA 1O51A 3BGRB 2Z4PA 2HFZA 1N0UA 1NH7A 4U7CA 1R8HA 1BQNB 4OI6A 2PT0A 4L3NA 3TVZA 2P9CA 5HP1A 4X4SA 2U2FA 2DNGA 4XDDA 2RRBA 2VG7A 4ELUA 3MTJA 2DNRA 5E3PA 4AE5A 2B43A 1FA0A 3CGIA 4CO5A 4OQJA 2MB0B 5JVHQ 4P6QA 2BE2A 4IOAQ 4XIUA 4LF9F 3LP1A 1WHYA 1YRTA 2I2YA 1N88A 4LQ3A 2WBRA 2AYMA 4F4WA 3R1LA 4J9SA 2M88A 4NRTA 4B9VA 2KXNB 2CVEA 3CJ5A 4CO4A 3CCLS 1IKYB 3QJJA 1D8ZA 2GGPA 1S97A 4I0WA 4DG1A 2EFOA 4HVZA 1VQ4S 2VG7B 1JB0C 3MMJA 1S10A 5J2QB 1S1WB 5A8RA 3OTCA 5HMYA 4RBTA 2U1AA 2VASA 1JLFA 5FLXY 1S1VB 2XS2A 3I9V9 4UQTA 1DARA 1OQ3A 3MM9A 5SUHA 1CSJA 3HVWA 3LUYA 3NS6A 4A8FA 5D8HB 4ZHRB 3IWNC 1VQ7S 2OPRB 2V9KA 3TUJC 4ZMMA 4RWXA 2J5AA 3F41A 3VZIA 1Q82T 4ELVA 2C2EA 3TA0A 4E98A 1X9SA 4QR2A 3CD0A 5A8WA 4ECUA 5KFLA 2BW2A 5KFUA 3GFHA 4KT0C 1QY7A 3OHAA 3OUYA 2XLIA 3NMRA 2COLA 1OPZA 2RDJA 3RW6A 2PSZA 2RU3A 1KOOA 2MHEA 4ID5B 2ZJQQ 4B9TA 5IFMA 4HKQA 1H7XA 1FDNA 4QWCA 2V8GA 1YHQS 1MMNA 5IZHA 4J9MA 4QJVA 1M5VC 3MM6B 1WG1A 4MKBA 1OSDA 3H5YA 1S9FA 4MIAA 3RR7A 3N9UC 5T7LA 2DGVA 3R3TA 2R2SA 1M1KT 4FN5A 3KK3A 4N56A 2J7KA 4ZP6A 4RUAA 1S48A 4NYZA 4FZVA 4R8UB 1Y00A 3G6YA 1KRPA 4B9UA 3PJWA 2WSFC 1M90T 5IM0B 4V19X 1N56A 1NNDA 4YHHF 3G8SA 2VC1A 2KYZA 4I6AA 3TA2A 5HMWA 1FK9A 2BABA 5HLFA 4O3NA 4PG7A 2K3KA 3LPYA 3PNIA 1KHWA 1Z2LA 2BM1A 1HYSB 1L3VA 4WZMA 2R7OA 2MQPA 4WU3A 3GYXB 2PE8A 4CH7A 2BANA 2DB1A 3CCES 3V4IA 2V8DA 1R3NA 4KGMA 4TU7A 1QVGR 2NSCA 3QGGA 3THVA 4ID8A 2J9DA 3RRGA 1U1NA 7FD1A 2MXYA 2D41A 4TY8B 4Q43A 4CIOA 1UVLA 3DMJB 1Q86T 1TFYA 2HIQA 1CPZA 1L3SA 1Y7PA 1LK7A 2AYEA 4RNNA 3CJ0A 1X4CA 1FKPA 1XK8A 2UVVA 4PWDA 2WTFA 2J0XA 3DHWC 3FZBA 3MR6A 2O5DA 1FCAA 1FESA 1R8BA 4N8NA 1S99A 3MR3A 4NCBA 2GW8A 3MM5B 4A8OA 4URSA 1C1CB 1L3KA 4Q8EA 2DGQA 3GIMA 4I67A 5B0DA 2FGCA 3Q0AA 2R9LA 5K8PA 4X62F 1TL3A 1S1XB 3SCIE 2M5YA 2YNIA 3VZHA 4LF5F 1HARA 2HNYB 3DYAB 1PSDA 2UUWA 3J7A1 4ECSA 3HVAA 3MDFA 1S9EA 5KG6A 3PO4A 3H2LA 5E41A 3I32A 4I68A 2NUUG 1M0SA 2XMKA 2XMJA 3DXBA 2M2BA 4MK8A 4OZ5A 3Q8PB 4I4BA 1UA0A 3OXGA 1H98A 2OFGX 1S77D 1UJ6A 4LIWA 2CQ1A 4MKAA 5J2MB 2L9NA 2LYVA 3I0RB 4KV8B 1Q8LA 3BO2A 1TVRB 5CYQA 4DS4A 2HNDA 4DV4F 2ROPA 2IAJA 3HI9A 2HAIA 4FXDA 4RU9A 1Q78A 2YKMB 2MY8A 4NLSA 5KOWA 1FKAF 2R2RA 2VBXA 4X2BA 1DURA 2XI3A 1GH8A 4M5DA 3M1VA 2J7WA 3CD5A 4NLQA 5KT6A 2ZH2A 2IM3A 1SUQB 1UVNA 4F4KA 4TYAA 2YNGB 3L95X 4OV1A 4YB6A 3BO4A 3V6KA 2FJEB 2CQCA 3OTEA 5A0YB 1YWXA 4I6YA 2YKOA 4YR0A 2VODA 4DJBA 1GXTA 4MK7A 2GQCA 2V4QA 2QT7A 2G1DA 2VPYB 4B3MF 2BVZA 3S6EA 3KG1A 4DSFA 2YNHA 1FKOA 3OTDA 1TKTB 3MAHA 5HI7A 3VWSA 2L9WA 4BC7A 6FD1A 4YFUA 3BZQA 4NLGA 2W9CA 4M5DB 2E5GA 1R43A 4DFJA 1N5TA 4LF7F 3K0JA 1F0XA 2HHTA 4NCGB 1RT7A 1W2IA 1VBYA 1R8PA 2VBZA 3FZ2A 3GFXA 4PUOA 2KZZA 5KFFA 2IC3A 1SKSA 2CJQA 4IDKA 2XZWA 2N7YA 5DGBA 2PIIA 4EBCA 3M2RB 4PRFA 5EN1A 3KKFA 1MROA 4IKAA 4CO2A 4KV8A 2HWHA 3VAHA 1EP4A 2R4FA 4FPRA 3MECA 3CEDA 4C8NA 2GA7A 2I1RA 1RTIB 2WONB 3GYNA 1L3TA 3MPVA 3OUYB 3THTA 3CT9A 1UVJA 3QWUA 3DLHA 4LFAF 3MAQA 2GQQA 3HT3A 4E0DA 1QAYA 2DGSA 4N41A 2DO4A 2IA0A 2B0GA 2ZH8A 4DSLA 2KKHA 1RK8A 4TY9A 4IH7A 4P2SA 4QW8A 5GMKa 5CXTA 2OPQB 1R0AB 1KQKA 3I4HX 4Q44A 4R