2R9LA

Polymerase domain from mycobacterium tuberculosis ligase d in complex with dna
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
287
structure length
287
Chain Sequence
b'EQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*DGP*DCP*DGP*DGP*DC)-3')
publication title Structure of a NHEJ polymerase-mediated DNA synaptic complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Transferase/dna
total genus 86
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2007-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2r9lA02
3PKYA 4MKYA 2IRYA 2IRXA 2IRUA 2R9LA
chains in the Genus database with same CATH superfamily
3HF5A 3QPIA 1RT5A 2HS3A 1PYSB 4MK8A 1U1RA 3BPSP 2XCAA 1AXQA 1TTHB 1VGYA 4JI6J 2BJ9A 1T9VA 2BJ8A 4RR5A 1TP7A 1XWLA 3VAFA 5H9FJ 5EWFA 1TL3B 5A2QY 2E7VA 2AGOA 3BH6B 2HHHF 1TU0B 2BA9A 3BO4A 4X64F 4V19X 4YY3J 4LR8A 4W4MA 1S6PA 2NXNA 5AE1A 1RT3A 1VQ9S 3J7ZT 1CS4B 2YNHA 4L3KA 4QQBA 3LAKA 2J8SA 3BQ1A 4KKOA 3RB6A 4B3MF 1AROP 3PJXA 2EKNA 1F5AA 7FD1A 5KFEA 2XLKA 4NCGB 5EX0A 3AJ1A 2DIUA 2CQGA 2NPIA 1NBEB 1N48A 1CULA 1FK9A 4MYTA 1MWZA 4MKVA 4ZVSB 2VPXB 2FJEB 5CABA 3VAIA 3QIPA 1I5OB 4OYPA 4WFXA 3PEHA 3CC7S 3NS6A 3OJUA 3T5JA 3P96A 3VHQA 2ZC3A 1GMVA 1UAWA 4ZA1A 1FJEB 3V6DA 3UW1A 2R2SA 3NGKA 3MEEA 2RHSB 1YJTA 1DAXA 1QSYA 4RW4B 2D69A 3HHDA 2UVVA 3J81j 3OTOF 2KJWA 1HNVB 2ZOFA 2RQ4A 1B99A 2OKQA 1PYOB 3GJTB 5HMXA 2ABYA 4CLPA 4C3MA 4QIFA 3RRHA 3W60A 1S48A 1JMTA 2Y1RI 1UVNA 2VFUA 3FDSA 4B3TJ 2AT1B 4R25A 5ETQA 1LW2A 5CH7B 4G1IA 4Q45A 4PWWA 3HI9A 1PJ6A 1R43A 1FCAA 4QR1A 1RU1A 3PW7A 4TY8A 4QWAA 1JJ2R 4CT9A 1HLWA 3IAM9 1N33J 3HSGA 1HHSA 3V4IB 2Q43A 1TQLA 4GC7A 4KO0B 2HVDA 4DL0C 2W4CA 5BR8J 2DR5A 1P27B 3NNAA 3MMJA 1JLGA 4RNNA 5CQGA 2QE5A 2X7IA 5DZ6A 8ATCB 1X4AA 2V2QA 3G2XA 3M2UA 2GVZA 4CO2A 1MROA 2YH0A 2SXLA 4M1KA 4USWA 3H5UA 2FLOA 1IM6A 1SKWA 1HNWJ 5T41A 1ZAWA 1VCTA 4CLYA 3HSJA 3AHPA 1N5YB 1ZAXA 4OI2A 2ROPA 5J1EB 2G2ZA 4C11B 2OH2A 2KG0A 2LCWA 2ZJRQ 3DU5A 3OT9A 1S1XA 5B0GA 1RTHB 2KN4A 1SBRA 4YHHF 5ETKA 4HT5A 4IOBA 1OPZA 4A8XA 3TVYA 3VZIA 2I2YA 1RK8A 3M30A 4Z7YA 1H98A 2GZOA 3ULHA 1F3VA 4F4XA 2B0GA 1FVQA 1XNQF 2GS8A 2FVCA 2CQPA 2JRSA 2M8DB 3KMQA 1D9AA 3HXMA 3MCOA 3UNYA 3P49B 5CYQB 1U24A 4RBTA 1JLQB 3R3TA 1HBNB 2ACYA 4FYWB 2I1RA 3IG1A 1DLOB 3M8YA 2BZ2A 5E3QA 3CULA 5LXYA 1JNRB 2HQFA 2I6WA 3J7AN 1IWAA 3C3LA 2V8PA 1DTTB 4GO7X 4DL2A 4IKAA 3BREA 4PPDA 4NXMF 2LMIA 4ZITA 4DV1J 4C0OC 2YWFA 4LFAF 5IQ6A 2H5JB 4CO1A 5J2QA 5E3AA 1HWKA 1FNOA 4DR6F 2FVSA 1TL5A 4ID8A 3GG1A 4CP5A 4O0IA 3E01A 4LVOP 1F0XA 5DG8A 2B56A 1XNRJ 2BUNA 4OFZA 2GO9A 4MAKA 3LP1A 4HYKA 1S1WB 3MM9B 3GSIA 2KXNB 2DK2A 5KFRA 3FEXB 5F8LA 3C15B 4N77A 1JLEB 1FESA 1TMMA 2XCPA 3Q2TC 1DY3A 5HQMA 4RBVA 4XDCA 4ERDA 1RA7A 4ZJLA 4JI2F 5K8NA 3I5BA 5CYJA 5F41A 1WHWA 1BQMB 5FDLB 3FGVA 2GGPB 2P6SA 4WYWA 2BM1A 4UOHA 3MD3A 4YR2A 2YWGA 1NZAA 1XERA 3KLHA 3R97A 1FF2A 1I1GA 3SEOA 4JV0A 1I51B 1T8EA 3SDEB 5C24B 2J9DA 3DRPB 3CJ8A 2MKSA 2EFQA 3AA8A 2XMAA 3M8WA 1RHKB 2IJRA 1LW0A 4FBTA 1L3KA 3LF0A 1FNXH 1IKYB 2Z58B 2PIIA 2ACMA 4YB5A 4KIAA 1RBOB 4IG0A 2L3MA 2MLXA 1S9GA 1RT7A 2PFFB 4QYZJ 4AUKA 4XTTA 4LJMA 4HACB 1YJ7A 1WHXA 5A0YA 1U2RA 1FEEA 2IVMA 2AQ4A 3C66A 4ZKAA 1AZSA 5KFGA 3JAMY 3MFHA 1HBUA 3EVWA 1VQYA 1U8WA 2BJ7A 2ZBQA 3BS9A 2CQ1A 4D3HA 1NSPA 4WU3A 4DV6J 3ET6A 1Y3KA 1DTQA 2W01A 4DSFA 3T9ZA 3N0VA 4JI5F 1DFDA 1B7FA 3MFIA 4IRDA 4O4GA 1D09B 2QZ8A 1AYEA 4DPXA 3G71S 3OJSA 2EK6A 4NASA 2RF2B 3KLFB 2H4YB 3LP2A 2NS1B 3DOLA 3OL6A 3ICLA 1FTRA 2DY9A 2YXLA 1N36F 5C2CA 3GCXP 1SH3A 4X65F 3ETMA 4X62F 4ZLNA 4K5RA 1H73A 1HMVB 1FKAF 3FC9A 4DR4J 1YITS 5B0EA 1N34J 1HYSB 3UDVA 3LA0A 1WJ9A 2XO7A 1IBKJ 3A1YG 1ZAVA 3HFZB 1NJWA 2OPQA 1G6BA 3WC0A 4YB7A 4QIVA 4QBUA 4ID5A 2NYHA 4Q2MA 3DLEA 4N8OA 1QAYA 1TMJA 3D3CJ 2NUHA 3NRBA 2QG9B 4YEAA 3G8QA 4DUYF 2QL9B 2UXDJ 4F36A 3MEKA 4IG3B 4ZS6A 4ER8A 1APSA 1RQ0A 1YJRA 2VPZB 2C3UA 3HHLA 2KL8A 3BKUA 1JJ4A 2FY1A 3WZ0A 4QIWD 1HQEA 2HVHA 5IZHA 3A12A 5HQLA 4AYBD 2V63A 4DN9A 1V6HA 3N6NA 1GX5A 2J6TA 1UVIA 4IOAQ 1TKXA 4RJVA 1Y5LB 3M2RA 1R0BG 1BLUA 3GIJA 4LF9J 1UPPA 4AQYJ 1U25A 3KKFA 2E5IA 3OTEA 2FY8A 1JLCB 5E0OA 3W9IA 3GP9A 4I2QB 3OVSA 2NXUA 5RUBA 3KYLA 3BJYA 4NMLA 3UR0A 1KFSA 1Y11A 3T1YF 1FI4A 1FRMA 1TL1A 5HO4A 1VRUB 2Z8QA 5GAEI 1MU2A 1CQMA 3CC4S 2HQDA 2VC0A 2DNPA 3PX6A 2X3GA 4LSNA 2HHHJ 3KK3A 1F60B 4X64J 1HBMB 4CLLA 1SQFA 1NO8A 2JLFA 4UUXA 2MQNA 3CJ4A 2DD8S 2JSXA 1VQKS 3R2CJ 3RAQA 1M1KT 4CM2A 4USVA 4O3PA 5D0RA 4B3MJ 1RWKB 2BACA 2V8HA 2HFSA 2PC6A 1FA0A 3UDCA 4HVZA 1SPBP 1RTDA 4HTIA 3ONQA 5KFNA 1G3OA 1FTCA 5A8WB 2XI3A 2DO0A 4CNYA 2XMKA 2OJ3A 3IRWP 4EWTA 1KD1T 2MZJA 1YI2S 5L38A 5D3GB 1EQMA 2LA6A 1CJTA 3RW6A 2BYCA 3IS9B 2HHQA 1S59A 2DBBA 3MM7A 3EWGA 3GIIA 3W3SA 1NU4A 5EDWA 2CWXA 4ECYA 5EX3A 3OFFA 3KLVA 1NPPA 4R8UB 3DLHA 2R7WA 1S49A 1WORA 2ZH8A 4OJHA 5C42B 1Z2ZA 3OTOJ 1RHMB 4EYIB 1VQ5S 1U48A 2HZVA 3I0SB 1IKVA 1Y7PA 1MWQA 2K1RB 5IV3A 5DM6Q 1XEZA 2Z56B 4CLWA 3EZOA 1FWLA 1WSRA 2ZZNA 3N28A 3VGUA 4RZRA 3D1QA 1X5PA 4Z37A 3GPAA 3HVRA 4RW6A 1L3TA 4NLRA 1Q8IA 2WVDA 4O44A 2V9WA 2XG8A 4NA3A 1SKSA 2VG5B 4EU0A 2K2PA 3MECB 5MAOA 2E1CA 2XYPB 3G8SA 8RUCA 2VBZA 1SUQB 3RBZA 3WC2A 2V4QA 2D7SA 1CSJA 1OSCA 5KFAA 3VVTA 2W9BA 3UCUP 1RWWB 1VC6A 4WIIA 4KGZB 3W63A 3IBWA 1G2EA 1RI7A 4CT8A 2RDDA 1NDKA 1RADB 1Z1ZA 1OY9A 4NLDA 5CCLA 2D9OA 3ENAA 2COLA 1OIAA 3L9ZA 4EZ6A 4IRCA 3BGOP 3D67A 1NSKL 4KAIA 1HBOA 3DLKA 4KT0C 1BQNB 2HMIA 4U9RA 4DHVA 2IDLA 3NOCA 3G86A 4CLUA 2HEKA 4YHHJ 4RW7B 4LRDA 2JC0A 5M2PA 1GEHA 2RDIA 3GFZA 1P9YA 5KFUA 2QL5B 1XNQJ 4LIWA 3CT9A 4B9LA 1RKIA 3W2WA 3ZNUA 3HCXA 1S1VA 2KVQE 1Z4UA 1AUDA 4M5JA 3EXYA 3MTJA 4HR2A 2HNZB 2QYCA 3DXBA 4OLPA 2CXEA 4QU6A 4Q2LA 1K44A 1N52B 1CC8A 1DQ8A 3R7BB 3AD9C 2IYIA 2CAJA 2GX8A 2IA0A 4RWWA 3TUJC 4DF8A 1FXDA 3GLJA 2EG1A 4NXMJ 2AX0A 2HLUA 2F7VA 2C42A 3ENWA 4J9UE 4J9PA 2E1MC 4LFAJ 3A8JA 4RBUA 3W5YA 3BKTA 5DDPC 3R27A 4DR6J 3QMQA 1UEVA 1REVB 1LXNA 4U67Q 1WC0A 1UW9A 2YY3A 3K5NA 1IVZA 2JEFA 5K9FA 1LEOA 4DQPA 2FGOA 1YKWA 2BRKA 2MSSA 1F2GA 3ZTQA 3UDLA 1K0VA 2BJEA 4AL6A 1VQ6S 4X4UA 2N7YA 3QGPA 3ZTRA 3CCLS 2RS8A 2VH7A 1GTHA 4TN2A 2DXEA 1SC3B 4NRTA 3MUMP 2MZRA 3SCJE 1HA1A 5K14A 2HFZA 5CD4A 4JI2J 2R8HA 3BBCA 4NYZA 1RE1B 2EVZA 4V1Ak 2GAHC 4H4KA 3M9OB 5ETRA 3UD4P 5LM7E 1PC4A 4ZVGA 2C2DA 1KHWA 5I3PA 5K8MA 4LVNP 3M6VA 2EEYA 3A3OB 2YKOA 4ZK7M 1KQSR 2JL9A 2WHOA 5E3PA 2L41A 3KUHA 1F9EB 5EUHA 1U1LA 1JXLA 3TA1A 1CJVB 4KH0B 2MQ8A 5KG6A 4MIBA 3RUBL 4IFYB 3T6BA 2MJNA 3DYAB 2G0CA 2OGUA 3UD5A 3R8YA 3KWMA 3HHKA 2O1PA 3Q83A 5C7PA 2B9YA 5B0BA 4DN0A 4DCJB 4WTYA 4YR0A 1XQIA 3H4BA 1WNEA 1YLXA 3CGIA 3PCOB 4KBIA 2W2PP 3CB4A 4XDDA 1V9OA 3RBDA 2P9EA 2ZKTA 4B3OB 2R8GA 3H42A 2C28A 3D66A 3W9HA 2QA4S 2X1BA 3DLLQ 1RT5B 3NNCA 2IM1A 5D8HB 2XHWA 1FX2A 1O51A 2NSCA 3AY0A 3CWJA 4GVLA 3LO3A 3ZZPA 3K57A 1YJVA 3RB0A 1T03A 2ZH7A 4JI5J 3TRGA 2DB1A 1SC1B 2G2YA 1WTBA 4OZNA 2E7XA 4EO8A 4X4OA 2IBKA 3AODA 4N56A 1RT3B 3BH7B 2XBPA 1PG5B 3CJSA 1NRKA 4JV5F 3TUIC 3R5AA 3PVXA 4OYXA 4TLRA 4JV1A 2R8IA 1N36J 4CLFA 4X65J 2ASJA 5D4NA 2HAIA 2FIUA 4WP3A 4GRSA 2DCLA 2VG7A 4K50A 3UCZP 1U1PA 3DDKA 1CULB 1FK9B 2XY5A 1QDUB 4OHXA 4NMXA 2OO4A 5B09A 2HIQA 2OFGX 4DG1B 2E1AA 1BC6A 3S01A 2MKKA 2WB4A 3DM2B 3FK4A 1FT8A 2DJWA 4NLVA 1L3VA 3V6DB 3OSPA 3UQSA 1J5OB 1U1NA 1WWHA 1NK7A 5B7WA 2E5HA 4RU9A 4JI7F 1M5HA 4ZP9A 3MEEB 2VOOA 4DUYJ 3TVZA 2AZ3A 3MR6A 3NCRA 1KBRA 2DGWA 2DHGA 5GAHI 1BMQB 2HPUA 2M88A 5JVHQ 1JNZB 1KNZA 2I0XA 4PKDB 1UKUA 4F7VA 2BABA 2FD2A 2DNKA 1CBKA 2CDRB 3EZ5A 3HHNB 1IBMF 4U96A 1NPKA 2DR7A 3F0NA 2BJDA 1FRXA 4MTPA 5EWEA 1X0FA 4J9SA 3BSCA 2IC3A 4OJGA 4C98A 9ATCB 2E29A 2IMOA 6AT1B 5F0WA 2JVOA 1CJKA 2RHQB 2OTJS 2B8PA 3R9LA 2WAQD 3MMAA 1JXVA 3NMRA 2DY1A 3VQTA 4QWBA 1JLGB 3V4MA 3T1YJ 2CA9A 1EKRA 4ELUA 2W9CA 4DX7A 3M2UB 2GVZB 4B3RF 1MROB 3THVA 2HFNA 2RUGA 3HVTA 2XWXA 2R2UA 4CO0A 2J6UA 1X60A 4MH8A 1GMWA 2V4RA 1EETA 3FQLA 2ASYA 2GHWA 3CDBA 1U26A 2QLFB 1NH7A 4IOCQ 4ECSA 2CNNB 2CQDA 4K4XA 3MOZA 2KM8C 1S1XB 1YJWS 3BSAA 3IWXA 3DDIA 4XK8C 1JKHA 3TZYA 3M30B 2ZJPQ 3SSRA 5IS2A 4Q7AA 2HQ3A 1XMBA 4UY85 2V2VA 1T02A 3AJDA 3B54A 1FNMA 1YRUA 3IN5A 5LXRA 4ECQA 4IDKA 1AFJA 3VVUA 3AOCA 4B3SF 2IRUA 3FBCA 4FNIA 1FD8A 3QWPA 2D1CA 3JSRA 3C14A 3Q86A 3PRVA 3OLAA 3GV8B 5H9FK 1KP6A 1TKTA 4M5DB 4MIAA 1TUWA 3IG1B 1Y5NB 3C2PA 2MEWA 2KFYA 3GR1A 3NP5A 2KT3A 5L39A 2DCUB 1DHMA 3PW5A 3T5KA 1OQ3A 5GMKa 3EM1A 5FLXU 2FB0A 5AXMA 2Y1LB 4ZP8A 4WZQA 4K4ZA 2XGQA 4ZPAA 3RAMA 3PIOQ 4ES2A 4NLQA 5J2QB 1IN0A 3VAHA 1MMNA 2YKAA 4LBPA 3GIKA 3E01B 4UOCA 3POTB 2KYXA 1T9UA 4F0KA 3LP1B 2D3OR 3PTWA 1GTEA 1WC5A 3FCVA 4ZVFA 1FERA 4MT1A 2UUTA 1T3OA 3TW0A 1Q16B 3BGLA 3MTKA 2R4FA 3AB4B 3GE9A 1VHIA 2RMLA 4IH6A 1SH2A 3EGWB 5J2MA 3Q8UA 5A8KA 3EMTA 4CQ1A 3J80Y 3KK2A 3CCSS 2DGXA 2VV5A 1WI8A 4NWBA 1SJRA 1MW7A 2GW8A 2YX4A 2VKRA 1VOMA 2DNRA 3QT8A 2DNMA 2MTLA 1B70B 1KVKA 3PG9A 5DG7A 4TQRA 2CFXA 3FSXA 1DURA 1H0HB 1ZTWA 3HLUA 3KLHB 1A6LA 2D3ZA 4H4OA 3CCJS 1QSSA 4OLOA 4YFUA 3OTDA 3D0GE 4CH7A 1BXNA 3P8BB 3H8YA 2HVIA 5IOLA 3DRSB 2B7CB 1WEYA 4HDHA 3OL9A 2QSFA 1N4LA 2UVWA 2QC3A 1S9GB 1RT7B 3SV3A 4DR7F 1UJ5A 2JX2A 3S1TA 2VDHA 3B6BA 1K73T 1D8ZA 5A0YB 2AJ4A 4LIRA 3FUYA 2A6MA 1S99A 3M8QA 5KFPA 4DF4A 1Q8LA 4LF5F 1AZSB 3CMQA 4Y3CA 2K3KA 2RB7A 2KYZA 4J9VA 2NR0A 3GR0A 3Q8YA 5K5MA 1NJIT 2WVFA 2P9CA 3HZGA 2CJ9A 2F8MA 2G1HA 1MWYA 4FDFA 4I4BA 4HDGA 1X4FA 3ET6B 1LFWA 1NSAA 4DR1F 4ZIWA 4ELVA 2RVJA 3F56A 3A3PB 3G6VA 1WF2A 3JSMA 1RHQB 4LFBF 1W2BR 2BDPA 3IAS9 4O4GB 1ZS6A 4FF1A 5GAGU 1SV5B 4NZ0A 3TQ1A 4Y2AA 4OYBA 1CPZA 4DL6A 1YHQS 3CTRA 2NCKL 1T95A 2CJYB 1KTVA 2OEKA 3LP2B 3DOLB 3QO9A 3MPYA 4J91A 2UUBF 2OPRA 2YNIA 1VDHA 3T1AA 1S9EA 3RW7A 3N5BA 2HVEA 2HLTA 5GAEU 3CCVS 1E6YA 5IV4A 3H2VE 3C6UB 5KFCA 1S6QA 3KMSA 3R6GB 4FZVA 2OPQB 2CPHA 2FC8A 4ID5B 5F8JA 3GSDA 1KS2A 3DLEB 4H4MA 3PV8A 2GVDB 3GJQB 5GVQA 3HJFA 5IT9Y 1JIHA 3KK1A 4DPWA 1QM9A 2VDIA 5HAOA 4PXBA 2B9XA 3VGTA 4QCLA 2AW0A 4F8RA 3HHLB 4UOFA 2FGCA 4OJ1A 4OMFG 3GMGA 4NYOA 5CHCB 1YZ7A 1PILA 3OSNA 3IR6B 1UWBB 1S12A 2N7CA 1RTIA 2D41A 4K4TA 4LRCA 5IFMA 3FQKA 3QFWA 5C25A 4EBCA 1ICEB 3PFOA 3HJVA 1TKXB 4G1QA 2VONA 2PSZA 1R8AA 4QR2A 3M2RB 2XYHB 1U6ZA 3BQ2A 1VQSA 4PQAA 4DU7A 1WOSA 4CZCA 3S6EA 4R5PA 2W25A 1DZ5A 1U8SA 3O2IA 2V69A 4ANDA 2R2TA 2HYIB 1RAHB 4FPIA 3N9UC 2R8KA 2LDIA 4DR3F 2V9KA 3BN4A 1H38A 1MU2B 1B0TA 3PFEA 3PYDA 1SQEA 2FJVA 4KYZA 2XY7A 4DSIA 2WBMA 2WSFC 1MN9A 3IR7B 2CPIA 3KK3B 2QFJA 2L9WA 1VQLS 5LJ3Y 1RA6A 5I3QA 4QJVA 2DR6A 3SFUA 5KFVA 2XWYA 3FBBA 5KFXA 4WCEQ 3OFGA 5C2GA 4QYZK 1R8PA 4JV5J 2HURA 4RX6A 2FJAB 3T5HA 1X31C 4DS4A 2RUSA 4AL7A 1VMBA 1RTDB 1SVDA 7FDRA 4F2RA 1WI6A 3GU0A 2LDYA 4ZCLA 2RRAA 3RGIA 4UUWA 3L4BC 1CJTB 4C8ZA 5KT7A 4CLZA 5EN1A 1Q82T 3QZ8A 3R2DJ 2KHCA 4CYUA 3OL7A 1JLAB 1URRA 4LFCF 1Q0NA 4QIEA 2JNJA 3QWUA 2ZOMA 4BC7A 4UF4A 3DC2A 2M2BA 2XYGB 2GQCA 4Q0BA 1IKVB 3TOQA 3LOUA 4ALZA 4Y2KA 1KQKA 4TVAB 1Y00A 2CVIA 2OPSA 3AT1B 4CRJA 2HQCA 2HVZA 4ES1A 3T6JA 1IBMJ 1CC7A 3DCAA 9RUBA 2XMTA 1OY8A 4UTGA 4DFJA 4RW6B 2I9SA 1XK8A 3CMES 2FJXA 2DH8A 3CMAS 4DLGA 1HARA 4URGA 2MKIA 5CA5A 2IVFB 1M5SA 3MI7X 2M9KA 2HHSA 2W9BB 1RAAB 5JJBA 4R0EA 2ZBPA 2AGPA 2XZWA 2Y0SD 4F2SA 2CJQA 1RWPB 4ZDNA 4B3RJ 4IR1A 1XIQA 1IUJA 4RNFA 2BVZA 5I3UA 1RT4A 2DGUA 2RU9A 5IM0A 1WEXA 3BBBA 3VAJA 2EI5A 5J2PA 3PJWA 4C7QA 2AF6A 1HBOB 5E2QA 2Y0BB 1XC9A 2HMIB 2CQBA 5A8RA 3MR3A 1TUVA 1R6VA 3OUYA 1FRHA 1K0TA 2GJIA 1AB8A 3JAMU 1BD6A 2WW8A 3GONA 4HLBA 2R3VA 5G4DA 1JJCB 4UW2A 1TL4A 2ZEJA 2Z2LA 3P6YC 3D1OA 5L9XA 4OX8A 3U02A 5F0UA 4F4AA 4B3SJ 3W2WB 1N33F 1S1VB 5HJXA 3IGNA 2M8HA 3KHRA 2A10A 4N7TA 3J7Z5 5AXLA 3I0RA 1E6VA 4DSLA 4M94A 2NSBA 1IR0A 4F4ZA 2XMVA 2R9LA 3VAMA 1S1TA 1QE1A 2XNQA 2B3TB 3AQOA 4FXWA 2BE2A 1U2CA 2ZZTA 3MCMA 3T5LA 3JYTA 4OI6A 2DITA 3IBFB 2ALYB 4XO0A 2VG6A 3W5ZA 3EDQB 3VAGA 4F02A 1RACB 3QGGA 3M8PA 2Z57B 3EX7B 4KFBA 3C6TA 3AD7C 2A18A 5KFIA 4JBCA 2UP1A 1LWXA 1Y10A 2BOAA 4MFBA 3G82A 4UZBA 1EQ0A 1ELOA 1KR4A 1FFGB 5KFHA 3QJJA 4OHYA 3TARA 1FE4A 3TA0A 3ENQA 3LGNA 4FP9A 5KFJA 4I6WA 3FEZA 4PR6A 3D2WA 5DM7Q 2G13A 1URNA 1U09A 4HI1A 3MGJA 4PQUA 3OXGA 3CDAA 3MMCB 4BC9A 4I1TA 3QBCA 3W1YC 1WHVA 2YWHA 3DLGA 5K14B 4LF7F 4RW8B 3QLHA 3K5MA 3E8OA 5HROA 1XMOF 4GO5X 3VV2B 3D4JA 2BJ3A 2WOMA 3QGHA 2BW7A 3GYGA 3U27A 5D0HA 4GVBB 3QRPA 1QVFR 2QA1A 4N41A 1UVMA 4OZ5A 3RBEA 2J9EA 3FVYA 2HW3A 2B43A 1RDRA 1R0AA 4DZ6A 4B08A 4DV1F 3AFGA 3IRXB 1W7WA 2DXFA 4ZPTR 1X4BA 3BDPA 1T05A 2BKNA 5AE2A 1WOPA 2H65B 5GMDA 2CPJA 2C22A 3A8EA 5IQQA 2OP5A 4QWDA 2A0FB 3WHIA 4ZVRB 3EGZA 4DR7J 4JI0J 1JXEA 3HD2A 5HP1A 3AOBA 4M5MA 1R8CA 2U1AA 3KOAA 2BKOA 3IM9A 2W2MP 1TVRB 2XZDB 2N82B 3M05A 3QT6A 3OFHA 4MIWA 2IA6A 3O6QA 2ZD1A 4LF5J 5K8PA 1Q79A 1F1BB 1FKPA 1S7IA 5GAHU 3QT5A 2C3PA 4RUAA 1K8AT 3I96A 4MKBA 3JTPA 2R42A 1MMDA 4DR1J 3HHLC 4DV5F 1AUSL 3NAIA 2V68A 2B4OA 4P7VA 2GIFA 1T03B 2EXUA 4LFBJ 3BV8A 2IVYA 1F5CA 1WD6A 4HHHA 4K4WA 1PSDA 3DKDA 1WDTA 4NLGA 3KNAA 1RT1B 4R0JA 3AH6A 2K7JA 2VPWB 2V0NA 5FIIA 1H72C 3MDFA 3KLEA 4JB8B 5SUHA 5KFWA 4OX6A 4DI6A 1S0OA 1IJEB 2CZVC 2B9WA 6FDRA 1KVIA 2CPZA 3QRQA 4WE1B 2VG7B 2UUBJ 3D28A 1KEKA 1SH0A 1RWXB 4NLOA 1HI0P 3BGFA 4LF4F 2G2OA 2GIQA 2H5EA 1YJNS 1UL3A 4FXDA 2OD4A 1RB0A 2ADCA 1VBKA 4FBUA 3EDRB 2CQ2A 1VJWA 3IM8A 2FVRA 2V67A 3HM9A 1X4EA 1M5PC 2R7SA 2V50A 3PM9A 3GJSB 2YKMA 2HHPA 2XHCA 1W25A 5BYRA 2YQ0A 4OZ2A 3TX8A 3D1HA 3DHWC 1MN7A 3K5OA 3H2LA 5DETA 5CYMA 5LJ5Y 4KB7A 4W98A 3SCIE 4YP3A 3K17A 2N4DA 3SYZA 2FHOB 3QAUA 3Q8RB 2AU0A 2LKZA 1F9FA 5DO2A 1U2FA 4QW8A 2FJDB 2H9ZA 4DSKA 2IC3B 2VBXA 3PW2A 4LR7A 3W2VA 1C0TA 1RBAA 5LT5A 5M2UA 1SL0A 4Y28C 1SJ4P 5KG2A 4K4YA 5KG5A 1V3RA 3EPGA 2CJKA 2FDNA 3M6XA 3NKYA 3GV5B 1VQPS 4Y6IA 2PN6A 3IMQJ 5M2RA 4PG6A 3G6ES 2W9CB 4DR3J 2UUAF 5JXSA 3NWRA 4MK9A 1JQGA 1RABB 2CPFA 5KAKA 1NLKL 5DJBA 2GFFA 4OZ0A 4PPZA 3ZZRA 2ZM6F 2HHUA 2E5GA 3HVTB 5FD1A 4YDDB 3OXLA 2KI2A 3Q23A 1ZBTA 1EETB 3PX4A 3VQSA 2BANA 2MZTA 2C2ZB 1N5QA 1S97A 2XS5A 4J90A 3ZFVA 1JKHB 4KGXB 4OZLA 2HQIA 4JP8A 1X4HA 1WC6A 1KVJA 3H98A 4DL4A 3IFEA 2JHEA 4O3SA 2R2RA 3W66A 2XI2A 4RNMA 4IDKB 2IY5B 3QNWB 3OV7A 1TFYA 1NCLA 2J0WA 1N6QA 4I69A 3C14B 2A6OA 4FVCA 4ZPBA 3K5LA 2L9DA 4M8LA 4LFCJ 1TKTB 3PW4A 2W4PA 1H74A 3JQKA 3OR1A 4YS2A 4WKRA 1WSVA 3DN9A 5KG1A 3ZO7A 4J9QA 5DG9A 2E9ZA 1H2TZ 4JI1F 1RAFB 4LRAA 3A13A 1ZA2B 2OEJA 3P4UB 1LNQA 1S4EA 4A8MP 4B9SA 4TQSA 1DARA 2YVSA 4EEYA 1U6BA 1S9FA 2H3EB 2BJ1A 4WBFA 2QIFA 4I7FA 1VBZA 2XLIA 1UVJA 2FHMA 2BBEA 3EJMA 2OPPA 3FZ2A 3J7YI 1X4CA 3OPKA 2AYGA 4ETZA 2CKWA 4WK3A 4KRWA 4K7QA 1QSLA 4TKTA 3DLBA 2VICA 2L48A 2Q3PA 3GFXA 2RQMA 2GMLA 1ZM4A 5HBMA 1IKXA 4NCBA 1FO1A 1LOUA 3O8WA 2UXBF 5E3RA 4DL5A 5GMEA 2QLWA 3BGRA 2AX1A 4KQZA 1VI7A 5K20B 4LRBA 2WVEA 2H5IB 3TX0A 3NNHA 1BUXA 2DXDA 5KFOA 3V81A 1YG0A 4CH0S 2ZFHA 1S1UA 5J2MB 5D0EA 4WP9A 5A8KB 1I94F 4YMEA 2PMHA 3KK2B 3C16A 3PIPQ 2VQFF 2ERRA 2AYEA 2C2NA 3WX4A 2ASLA 4QWEA 1SC6A 1VFJA 2LXFA 4WFAQ 1O5JA 3ISZA 4H4OB 4JI3F 3GWCA 4K0KF 4DQRA 4ZHRA 1T94A 4F26A 3ZZTA 1D9FA 3J81Y 2F8HA 1O0PA 3CEDA 2CPDA 4OYZA 2RRBA 4KV8B 3RAXA 3CCWA 1TUGB 4DV7F 2PI4A 1UFKA 2JEJA 1OWXA 3VWSA 5JVGQ 4P75A 4EYHB 2D74B 4FYXB 4H4KC 3BBFA 2KHDA 4KH1B 2FQQB 2ZHOA 4DQIA 3M8QB 3HULA 4OI4A 1JLBB 1ZA1B 1RT6B 3W8PA 1XBWA 3QJPA 3T3FA 3MWBA 1LWCB 1VK3A 5LSRA 2CQHA 3UI3A 1NDLA 1GXLA 1SI9A 3UVJA 4M5HA 3C8YA 1XR6A 4RUBA 4ZJQA 2JWNA 2ZDPA 4NLPA 3JSMB 1GXTA 3WX8A 5DLGA 4URSA 2DHXA 4OYOA 2HS4A 4EBEA 3VR1A 5SZTA 3P3DA 3E2EA 1RISA 3G96A 4YR3A 1S1WA 4ZCIA 5DQHA 4AT1B 3MM9A 1YBTA 3KNGA 4ZP7A 3A4TA 2VJVA 2NPFA 1D0EA 3EICA 2VPYB 3LPEA 1T9XA 1NKEA 3NBPA 4XPEA 4ILLA 2CNLB 2CQ3A 3G8TA 1FDBA 2MMYA 2QMWA 4D3GA 2OPRB 5FDLA 2KVIA 2YNIB 2F4FA 3NMAA 1S9EB 3X1LB 3UO0A 3C46A 2AGQA 2CADA 1E6YB 2QJ3A 4TXSA 4DMZA 1S6QB 1R0CB 4LF7J 4LUBA 4U7CA 3SCKE 1Q86T 2VD3A 1IWGA 1PCAA 2PGCA 1GNKA 2RILA 1XMOJ 3FSIA 2M5YA 2PI5A 2XEXA 5KTQA 4ZLLA 3OW2R 2CJXB 1DRZA 4H4MB 1HD1A 1U1OA 3DDNA 3VAKA 1SB6A 1R8BA 5HN0A 3FFIA 2ZVIA 3FNNA 1RAGB 1R6YA 4CM0A 1PYTA 3ENVA 2HG4A 1S77D 3CJ3A 4HACA 1DQ9A 2WVBA 3N01A 3OR2A 2KO1A 2W4DA 1VQ7S 3VTIA 4X4RA 2JH3A 1EJ7L 1Q7LB 1RTIB 3IA0A 5J2NA 4ANCA 2IYGA 5C25B 5ETOA 4LMZA 2R7XA 4DU8A 1SJQA 2WRMA 3ZTOA 3ZZUA 3D9BA 4G1QB 4TU7A 2BW2A 3OXFA 1S6UA 1S6OA 4ZN3A 1SJFA 2KZMA 4ED2A 4WFYA 2A3JA 1N8RT 2V8GA 4ICLB 2ZKUA 1RAEB 1WKKA 4I56A 4CDIA 4EGLA 4A8QA 4X2BA 4Z2XA 4DV5J 3B8HA 2VA3A 2W2OP 5L1JA 4GKJJ 3BM7A 3H0PA 3TAMA 1RJJA 1OMSA 1UPMB 2XMWA 5F3ZA 5HJYA 2QEXS 3CUNA 4GKKF 3RBXA 1HMVA 4USKA 2DNZA 4F4YA 3M1VA 3MD1A 3TANA 2B5JA 1UETA 4DUZF 1BE4A 4NCAA 2VC1A 5DLFA 2X1FA 4Y00A 2KDOA 2LQBA 5DGBA 1GQEA 4LF4J 1FFWB 3LWMA 3PR4A 4M63A 2XY6A 3M8RA 4E98A 2K3IA 2GV1A 4IYQA 3V6HA 1B64A 4FF3A 4CYUB 2J7WA 1LWFB 2EG2A 2O5DA 1RT2A 3EXCX 4N5SA 5C5JA 3QATA 4J9RA 1PO6A 2U2FA 5CZVA 1FRKA 2E9RX 5F8HA 4PG4A 1RUSA 1RWUA 4DCOB 3FCWA 2XTJP 3NGDA 3I5CA 3AOAA 3KDNA 4K5SA 3HT0A 4ECUA 1ZZFA 2OPSB 1C1BA 5LOQA 4ZVHA 3HD1A 1T11A 1P1TA 1Q8KA 1S7HA 3SXLA 1L3UA 3W64A 3KG1A 2V34A 3DFEA 5T7LA 2MLYA 2X3DA 1JLCA 1TKDA 2WSCC 3EZUA 3UNGC 2QV6A 4A47A 5KOWA 3J80U 3QJLA 3D6HB 3KUEA 2UU9F 2H4WB 2KTQA 4I67A 3G6YA 2IIHA 3DRXA 1S72S 2PFDA 3KLGA 2QRRA 4QPTA 3R5CA 1WHYA 3D6MB 2N4CA 3N79A 2FVQA 2C2OB 3MHYA 4QIGA 4FXVA 3HX9A 4ES3A 4OJ3A 4WK1A 2BE9B 3UN2A 5KFQA 1R27B 1NK5A 3HP6A 1OPIA 3I9V9 5IT0A 5F9NA 2FZCB 2MXYA 1RBLA 1RAOA 2RJZA 2KFNA 5D6GA 2UUAJ 2ZZMA 2BMBA 2G0JA 3CXCR 3MM5A 4EO6A 5I3UB 4KHPF 4RLEA 1C1CA 2ZM6J 2XM3A 1RWNB 4RWXA 1T9TA 1VHFA 1ZYQA 4L3NA 2JDJA 2RKIB 1SC4B 2MY8A 3DMJB 3TJ9A 4BHQA 4JI4F 5B0DA 4HH1A 2CG4A 4IFVA 5A8RB 4DV4F 1LWEA 3PYFA 3OUYB 2EW9A 2GMHA 3TYTA 1NJZA 3R5BA 4J9OA 3R5DA 2B51A 1U6FA 3K59A 3D54A 2ZC4A 4QOTA 3M2VA 2O01C 4ZVTB 2AIRB 2P5VA 1EP4A 1RTJB 5AXKA 1YSJA 3CCQS 2IHR1 3KTQA 4OX9F 4C48A 1H7WA 3KG4A 2QYGA 5DZ7A 4H54A 1Q5VA 3MR5A 3HPOA 1E6VB 1H6KX 2FC9A 1HKAA 2NLWA 4A8SA 2CDQA 4ZJOA 4WF9Q 1S1TB 2ZJQQ 1QE1B 3CJ0A 3B82A 5BYQA 4ZPDA 1N5TA 2BE2B 4Q44A 4ATNA 3JTOA 3JYTB 5KG0A 3R6LB 1VC0A 2PA3A 4JI1J 4F0HA 4NX9A 2VG6B 7AT1B 3GIMA 4ZLPA 2HHWA 2B9EA 1IBLF 2RQKA 4KC5A 4KFBB 5LMNF 2M7SA 3C6TB 2JJ4D 4DDFA 4NE9C 4QW9A 5D0GA 1ZTTA 4ZVOB 4MFBB 4KGVB 1UFLA 1KN6A 2AP6A 1PJ5A 1HHTP 3KFWX 3WBZA 1UA1A 1FEHA 5KFLA 4B9UA 1FWPA 1X9SA 2UXBJ 1EKSA 2C2MB 2QLBB 5IT9U 1QTMA 3RR8A 1EX8A 4X4QA 3Q8VA 2ZBCA 3P5BP 4A8YA 3PACA 2OD6A 3GV7B 1I94J 3DGVA 1QVGR 2JEGA 3EYZA 1YRXA 3QLHB 3PO4A 3JSBA 4WPAA 5HROB 1V5IB 2VQFJ 2CQ0A 1KQGB 2WOMB 1ZM2A 2BOPA 2D3UA 4YQWA 1P6TA 2CPYA 4F3QA 2D9PA 1RYRA 2OAUA 1EB0A 4JI3J 1YGYA 4K0KJ 4BWJA 4CO5A 5H9EJ 5BXIA 2LQ5A 4ED6A 1S0MA 2FJWA 1QAXA 4A8FA 2E5LJ 1T05B 1CJUA 3HFVA 2M4MA 1VIOA 1KTQA 4NA2A 2H48B 4TNOA 2B8QA 3OQ2A 4L75A 4DV7J 5HP1B 5IC4B 2IM2A 2ZE2A 4AL5A 4U6PA 3K8WA 1J2VA 1UEUA 1DJ0A 1YZ6A 2KM8B 2ZD1B 3M8SA 4FF4A 5AJ3F 1HW9A 1HW8A 4ZCMA 2J6SA 3H90A 3LUYA 4FYDA 1FKPB 3CCMS 3CCUS 3RYLA 2QL7B 1VISA 3THPA 1N0UA 5IT4A 2UZAA 1BY9A 1TL7A 1YX2A 2CYYA 2K7KA 4U7UK 5AT1B 3K2YA 3VGSA 1A0OB 3LP0A 2QGFB 1VS3A 1K47A 1UWAA 2FZKB 2VU5A 1T9YA 4NLWA 3W61A 1X0PA 4K4VA 1UCNA 2PEBA 3DU6A 2XSJB 1FRLA 3KLEB 5E33A 1BQXA 1KDNA 3FJ2A 1Q53A 4ILRA 1YQHA 1NK0A 1WACA 4I64A 1X5TA 2XMMA 1NZ8A 3UCGA 1F6TA 2HHXA 1Y9OA 1S57A 3SFGA 5K8OA 1N5SA 4O3NA 3TZXA 4FNHA 3RB4A 1V3SA 2DGSA 3B4DA 5D15A 2WONB 3D5MA 3TO8A 1JB0C 1KRPA 3Q89A 4P2XA 2HK2A 3AD8C 2DNGA 4ED0A 3I87A 1VQMS 4Y65A 4FPRA 3NCQA 3DYAA 4OZJA 2Z0GA 4USUA 5DGAA 2FPHX 2KT2A 2YKMB 1QY7A 2DNLA 3NY0A 1QAIA 3PRDA 4KTQA 4WFNQ 1VLYA 1H3DA 2MHNA 1KLNA 5CYMB 2JOQA 3GFYA 3RB3A 3MURP 1P9QC 1WF1A 2P8IA 2F9JA 1D3WA 5KFDA 2ZWOA 1FX4A 4HKQA 3SZ2A 3LPYA 4ZVEA 3MCSA 1RP5A 3HDSA 4LRFA 3HT3A 2HKEA 2PE8A 4CI0B 3BYPA 4CO4A 2F5GA 3W2VB 1C0TB 1FXRA 4WKYA 4RW9A 1L3SA 3CJRA 1KLMA 2GCFA 2J8AA 3HMJG 2JEIA 3V6JA 2LEAA 2OSQA 2V8DA 4HT7A 4DCPB 3RRGA 1HWIA 1P8GA 2OFHX 1O6XA 4F04B 5KG3A 2DPIA 3GFHA 1NJXA 3S7RA 4MK7A 5BYSA 4J5OA 4J7CA 3J7YU 1S76D 1NKBA 2BXJA 5HQ8A 5DDQC 4UOGA 1ZPWX 3KDOA 3O5TB 1UMJA 4GKKJ 3LQVA 2P2CB 1FHTA 3UDEA 2BANB 4JOUA 4MMOA 4DG1A 4DUZJ 1RKJA 3TZZA 2OMLA 2DHAA 3DM2A 1KFDA 2VFRA 4YN3B 1REGX 3TQEA 3ILLA 5E7OB 4JYAF 1J5OA 2CQIA 4K2JA 3OVBA 5HMWA 1NUEA 2IRYA 4U7UD 2DNYA 2KT5A 3GJRB 2RDJA 2J9DE 1N6QB 3WIVA 2VIHA 3SSQA 2A2CA 4F50A 1WDDA 2J7KA 1NMEB 4LF8F 1F3FA 4PXEA 4U8YA 2OHDA 2F8EX 4F4KA 4WXOA 3OR1B 2Q6BA 4P73A 4KPCA 4PWDA 5I4MA 1R31A 4F4WA 3KLIA 3TWZA 1ZM3A 5KT6A 1BHNA 4L74A 4AXIA 4ECZA 1TKZA 4I7FB 4NOHA 1S6PB 5ETNA 4OV6A 4ED7A 3EUNA 2ATLA 2LXUA 2YPZA 3ZZYA 2YNHB 2OPPB 4KKOB 3Q0AA 1JX4A 1T9WA 1ROFA 1T7PA 3G6XA 5DS7A 1JLFA 3OTBA 4AD6A 3L7PA 2AMCB 2UU9J 1GX6A 3WQPA 2ADBA 2MKJA 2LQ9A 5HBMB 2QN6B 4YB1P 1IKXB 4GMKA 5KT3A 2KJVA 1SKRA 3BGRB 3QIPB 1FRIA 4FS2A 1B4SA 3HHLD 3V81B 3FRYA 4P52A 1S1UB 2MKCA 2VL1A 1QAJA 3M7VA 2Z2YB 2HHVA 3C16B 1EAYC 4DV3F 3DI6A 1YBUA 1C0UA 2DHHA 4OI3A 3Q2SC 4KHPJ 2CQCA 4AXJA 1KONA 2FHKA 5B0CA 1RCOB 4WP8A 2LEBA 4C3KA 3F44A 2RAQA 5ADZA 4JI4J 4CCHA 8AT1B 1KKHA 4ZHRB 2CZ9A 3AQPA 2MDAA 4QWCA 5H1SV 2FLLA 4DV4J 1QUPA 4P2FA 1OY6A 1V5VA 3MEDA 4PAAA 1LW2B 2X51A 4CLKA 4WIQA 4OV1A 3SIPB 4M5DA 4TY8B 3GZ7A 4PG7A 4B9NA 4C8KA 2PEHA 1JJHA 1AFIA 3TJAA 3FMBA 4OX9J 2YNFA 3MPWA 2L08A 2WW4A 4BCAA 5IC6B 4DR5F 1G1XA 3T41A 5CD4H 3H25A 2BR0A 5CAAA 2HFOA 4NPOA 3UVJB 3W5XA 1PKUA 3OD2A 3R7NB 3IGVA 4JV2A 4ILMA 1HHQA 2KXHA 1SIZA 3CD6S 4OYIA 3ZXWA 3N5FA 3POTA 1VBYA 2W1BA 5ETPA 1IQZA 1IR1A 3D0IE 1M0SA 4X66F 3AXMA 1IBLJ 2ROEA 2RQCA 3CD0A 5LMNJ 3DXSX 3DNCA 4WFBQ 1FJCA 2MQMA 1XTZA 5D77A 2E9TA 1HWLA 4X4VA 3NBPB 3PO5A 1J5EF 5KT2A 4OX7A 4ZPCA 1RLCL 2HZCA 1GXUA 4NLSA 1QD1A 4PXCA 3ITHA 5F8IA 4RUHA 4OZ1A 3EGNA 3ILJA 4FKXA 1RAIB 1VQNS 2HHTA 4DLEA 2R7OA 1VYAA 2C3YA 2VB6A 3CCZA 2I8EA 2KB2A 2LVWA 4IO9Q 4DL7A 3FFIB 1UTAA 3DRSA 4B02A 2Z30B 2UXCF 4RNOA 4I68A 5L1KA 4ECTA 3OR2B 3B78A 2V4JA 1KOHA 2E66A 3IO1A 4IH5A 1S10A 4W90B 4X84A 2O66A 2NZCA 4FN5A 5J2NB 2GHVC 4B9MA 4DEZA 1PAEX 3G87A 4PEOA 2NZ4A 4M5GA 1RZMA 4HHUA 2ZNZA 2MZQA 4QPXA 3MPUB 3U1NA 1M5KC 2WCXA 1OSDA 3M32A 4N76A 2F3JA 5HK4A 5AJ3J 2W9AA 1LK7A 4WZMA 3CE8A 4FVMA 4F67A 4DSJA 1X4DA 1SV5A 2J0XA 1OQ6A 3BKFA 2KG1A 2WSEC 1D1UA 2FZGB 1WUUA 3N4WA 2UV8A 1NDCA 2ROGA 3F73A 4KR0B 4DV0F 3TAMB 3V6KA 2ILZA 3I82A 4ZVPB 5EWGA 2QMXA 3H20A 2ZBIA 3OLBA 4C9DA 2DEJA 3TEHB 3TP2A 4WU2A 2IAJA 1SCJB 4JI8J 2HFUA 2CWKA 2K8GA 3M1VB 2MQQA 4OHVA 2B7BB 3BR8A 2V2ZA 4ZP6A 1LW0B 2B5JB 2C1EB 2PT0A 1X5SA 1Z2LA 4LF6F 3C6UA 2HWTA 1NM2A 4ENOA 4NLTA 4IG0B 4CTAA 3DRRA 4JI0F 1A7GE 3S8SA 3CJ5A 3RZAA 1OO0B 2W7AA 2MZ1A 3PR5B 1H2UX 1SJ1A 2CPXA 2EK1A 2GVDA 5HL7Q 2F4VJ 5ETLA 4ED1A 4LR9A 2OSRA 4ZVUB 3ZZ0A 4LSZB 2ZITA 4EBDA 2JFKA 3FKBA 2UV8G 2LA4A 2IBOA 2E44A 1HBUB 4PWUA 1SXLA 1RT2B 4M5IA 2YNGA 3BSOA 1DTQB 4W92B 2HWIA 1UWBA 1SJ3P 3HKWA 4I2PA 3OVAA 4WTOB 4L73A 5HANA 3NLCA 2ZH6A 1C1BB 4NI2A 5GAGI 4RNHA 1O8BA 3B4MA 3W65A 2YWEA 3UFCX 4FS1A 2DKOB 2YX7A 2NXJA 3QIDA 5T7LB 2DH9A 1PBUA 4A46A 2DGTA 3T9NA 1U47A 1EHWA 4CIOA 3KJVA 3QSIA 1UP1A 5L1LA 3OHBA 3BN7A 1X9WA 1GMUA 1NB7A 1NAQA 4J37A 3MM8A 3K0JA 3UN5A 3KLGB 2OLWA 4DX6A 2MSTA 5KFZA 2ATCB 1C2PA 2XS7A 2GJ2A 2QMUB 3R5GA 5L8RC 2MZSA 3KHHA 1IR2A 3QRRA 5LMUF 1B0PA 3CJKA 2VHGA 3AA9A 1NKCA 2R7TA 2RSQA 1RYSA 3H40A 3J81U 3MAAA 2VBWA 1YWXA 5ITHA 1QLNA 3GIRA 3MM5B 1C1CB 2WB1D 2G1DA 2J5AA 4A8KA 2CNKB 4LBIA 2ZH9A 1IBCB 3MCNA 2H54B 2QX0A 2GO8A 3PX0A 2YKNA 1U1KA 2GNKA 3NL0A 4IFVB 1M5OC 1Q95G 1LWEB 3SQGA 3PEJA 3IWNC 1HQEB 3CNQP 3KJFB 3Q22A 2ZH4A 3BB5A 4ZPVR 1ACMB 2VQEF 4JYAJ 1JLAA 3NG8A 3PHTA 3M2VB 2DGOA 3NS5A 5G0RA 2B6AA 2JFDA 2VASA 4HHJA 1EP4B 1IKWA 1RWVB 3ADAC 4DSEA 3ISNC 3CO9A 3NWGA 5HLFA 4HL9A 3GB0A 2LQJA 1HL6A 4FF2A 4TU9A 4HEA9 4LF8J 4KGMA 1X8DA 4USMA 3W9JA 1TL1B 2G0IA 3UD3P 3RR7A 4V19J 4F25A 2BV3A 3JS9A 2KZZA 4L6V3 4LSNB 1LFPA 4USIA 1HI8A 2ZH1A 1K1SA 1NK9A 1FKOA 1WC3A 2C3OA 4LF2A 2LYVA 1MMLA 1N54B 1RLDA 2QLXA 2EFGA 5D78A 1GT8A 1WKJA 1S5ZA 2M70A 1WELA 5IXUA 3FSYA 4K8RA 4PZVA 2V8VA 4X4TA 3DGPA 3E51A 3TUZC 2HNDA 3LWLA 2F9DA 2ZDOA 4ETXA 2DVIA 1UZHA 1NJYA 1W26A 3MM7B 2MGZA 3GG0A 1HNIA 3LAMA 1EARA 4K2XA 2YPYA 1NHUA 5F8GA 2BRLA 1KC8T 1VRTA 4DV3J 4RO0A 1UVKA 1G4CA 3LALA 2DRAA 1HQ2A 1C4AA 5U47A 4MKAA 3EPIA 3HKZD 4UZCA 1VRQC 4EK2A 2ZH2A 2OEMA 2JLGA 3K8VA 3G9CA 4XPCA 3TVKA 2ZBRA 1A9NB 3MZIA 1NDPA 3MF5A 2ZOGA 1YDLA 2MHEA 2KXFA 4Z7CA 3OL8A 1CJUB 1CLFA 2F63A 2V94A 4X4NA 1MLAA 1BGXT 2ZE2B 4ED5A 4O44B 2CQ4A 2AEMA 3D68A 5DDOC 3L7OA 1GMWD 3NXZA 4DR5J 3ZTPA 1YRTA 1ITPA 2M3DA 2C3MA 2AKWB 2QSWA 1GAOA 1W2IA 1TL7B 2J76E 1DBDA 3HHEA 1VJQA 2Z2MA 4I0WA 1CQNA 3LP0B 2NREA 2YTCA 3QZ7A 2DGVA 2DH7A 1FDDA 3TJ8A 4PCQA 4I6YA 4X66J 4L76A 3DLKB 1X5OA 3HFKA 3MEGA 4OYAA 4DV2F 1NB2A 3DOKA 3MMCA 2YWWA 1FDAA 3IC1A 1VK8A 3BDEA 1U0SA 4CO3A 3M9MB 1J5EJ 2DGQA 2CJAA 1U7LA 1F2HA 4RW8A 2DNNA 2QLJB 2K06A 3HK2A 4G3IA 2CRLA 4P10A 4DQQA 3MM6A 1HPZA 3MAHA 1RHJB 2R7VA 2WBRA 2EC2A 3A8KA 4GVBA 3RRKA 1NH8A 3QT7A 2I5JA 5LSOA 1WG4A 2VA2A 2HRUA 2RS2A 3OFEA 3H4DA 2GQ2A 3CCRS 1FJGF 1YJ9S 3IRXA 5B08A 5F8NA 1NEEA 4E2FB 2DNHA 1UJ4A 3VF0B 3VCDA 2UUWA 1VBXA 2VZ9A 2MB0B 3DOMA 2UXCJ 5F3TA 2XQCA 3US5A 1LK5A 4ZOSA 4HI2A 2D3O1 1TVRA 5GADI 1U0HA 2ZNYA 1HIYA 1BWEA 2HRTA 5BJRA 3N6MA 2G4BA 2XB2D 2Y1IA 3GYNA 4IR9A 3ETOA 3NGUA 2AYMA 1N88A 1R3NA 5F8MA 2H1YA 3OHAA 3PYEA 1HQUA 2LU2A 2ZHBA 3R5JB 2VF3A 4RW9B 3VALA 1KLMB 1PBAA 1QUVA 1FJ7A 1TV6A 4ED8A 2R7QA 2PMZD 4BDPA 1RT1A 3KXDA 3DHXA 1YTYA 3U7JA 3HSDA 3Q24A 2GMJA 4F3MA 2W2NP 3MMBA 1WG1A 3A8IA 2HIYA 5H9EK 2ALZA 4DV0J 4C0HA 4DFKA 3MR7A 2Y8YA 4KY3A 3NAHA 2KU7A 4X62J 3UR3C 4IO1A 4K4UA 4WE1A 2LEPA 1VQ8S 2J0SD 4MJKA 2N3OA 1RWMB 3IP0A 2PA8D 2PMWA 1WEZA 3D3BJ 1OYDA 2W8LA 1JWWA 2AZ1A 2IM3A 4CWBA 4LF6J 5A6WA 5CXTA 2EKYA 1ZZNA 5KT4A 2AYBA 4O3OA 2HFVA 4NXNF 3KJQB 5AE3A 3CD5A 2R7UA 1R89A 2JLEA 4FYVB 2MQOA 4Y2IA 2C2RA 3K7RA 3TAPA 2YBVA 5L1IA 2XS2A 4ED3A 1YJUA 4DR2F 1CG2A 4PUOA 2DYAA 2IDEA 4LBHA 4P72A 2FLPA 3BSNA 1IM4A 4N8NA 1UVLA 2EPIA 1TR0A 2EC0A 4ZVQB 5I42A 4Y2CA 1LKZA 2HNYA 1OJ4A 2NYIA 1Y4ZB 3M4XA 4PWDB 1RAJA 4ECXA 4GKJF 3KLIB 5KFKA 2HZAA 1ZOTA 2AV5A 5HMYA 2VOPA 4LSLA 2IM0A 2RT3A 2PO4A 3I31A 2FYXA 5IWAF 3BPDA 1TKZB 5B0AA 3DLJA 2BE7D 2E1RA 3WIUA 3MPVA 4RKUC 2FUG9 2AD9A 3ZC4A 4C8YA 1XR5A 1UW4A 3T1HF 1JLFB 2VODA 4RUCA 4Y0FA 3SI8A 4WFZA 3QYYA 3H2UB 4ZMMA 2LQ8A 2BEFA 5T14A 1Q81T 3CCTA 2F40A 4XAKA 1PC5A 3HSZA 2EFOA 1L5UA 5LMUJ 1P1LA 5JMNA 3MPDA 2OMOA 2IRXA 4O4RA 1NNDA 4M5KA 3BF4A 3PW0A 3DI6B 3TR5A 1NHKL 4XIUA 3BO2A 1C0UB 2RH3A 2GC8A 2J0QD 5ETTA 4S0MA 3SMZA 4TYAA 3PRBA 4BBYA 1H7XA 3SCLE 4ZPWR 3R1LA 3EE3A 2B4PA 3MEDB 2YKQA 2AJFE 2DIVA 4DS5A 2W2QP 1XN9A 3HVWA 2XGPA 3T19A 4TU8A 1M1GA 4G6VB 2VQEJ 1J27A 2N3LA 3E3XA 3NGSA 5AXNA 3P5TL 4TYBA 2LP4A 1TELA 3CJ2A 3TEGA 1SL2A 5KG4A 2RU3A 4DOZA 2YNFB 2OI2A 2CVEA 1TL3A 1CJKB 3C19A 3PY8A 1V3ZA 5B0FA 4MKYA 2Z2ZA 2R8JA 3ILIA 1Q1KA 3MMAB 1U49A 2M0GB 3AB2B 2E7WA 1HFEL 1M5VC 5DRKA 2R7RA 2XO6A 1CS4A 1MNEA 1LQ9A 1U02A 3PKYA 3R1HA 2RIJA 3PKMA 3H5XA 3L09A 1HWUA 3IR5B 4ITSA 4NCGA 3I56S 1VLOA 3CVKA 3I5AA 4U95A 1EIYB 1I6JA 1NK6A 1WC1A 1LV5A 2Q1LA 3MAQA 2HQGA 3W7BA 3UPFA 1FWKA 2NXCA 4C8LA 5EGYA 3JQMA 4FYYB 2ZH3A 4IUFA 4PYAA 4PYDA 5KFMA 3RTVA 3IWLA 4C2MA 2E5JA 4J9MA 5EHHA 2HWHA 3L3CA 1SQGA 3CO0P 1MG7A 1XMQF 2DEIA 4UT4A 1Q5YA 1R8HA 1HNXF 2DT9A 4J9KA 1SL1A 3ZTSA 3ITHB 4RW4A 2Y1JA 1HNVA 2GHPA 5JUMA 3QFHA 2DO4A 4C3LA 2XNRA 1RSCA 1U1QA 1NHVA 3CIZA 2IMWP 3UWTA 3GQCA 2L9NA 4KV8A 3CW2C 2DPJA 2Q66A 2MQLA 4GC6A 4DFMA 1TK5A 5HVHA 2V4JB 2OIHA 4DX5A 3V4IA 4WJBA 5A2QU 1N32F 1OS5A 3V5RA 2FHJD 4KO0A 3FMWA 1JLBA 1RT6A 3I6PA 4DWIA 4QR0A 3KHGA 1NPRA 4LF1A 5HI7A 2HBQB 1YK9A 1LWCA 3M8ZA 1WC4A 2CG8A 2W7OA 4E0DA 2EWHA 3JXOA 4PABA 2E1PA 5J1PA 2DHSA 4IQMA 3M32B 2OELA 4C97A 1K1QA 2O3DA 2XC9A 4ECRA 4OI1A 3CDEA 3H59A 1Y0HA 3LGMA 1Q8BA 1TFWA 4Q5VA 3RU0A 1HD0A 3D7SB 3U1MA 1CVJA 1S4FA 1N5YA 2CPEA 1VR6A 4KSEB 5J1EA 5A76A 2KKHA 4C11A 3PHEA 1KOOA 5D4PA 1UZDA 4URQU 1RTHA 1KHVA 1WG5A 4DFPA 2J7UA 2B4UA 4FKYA 4P71A 3EGVA 2AJ2A 2IAJB 3AAWB 4Q8FA 4DV2J 1ZETA 4WXWA 1XJWB 2E5LF 2HGMA 3NOGA 4OZ3A 1NXIA 1LXJA 4MYUA 4CTAB 4OI0A 3DRRB 5CYQA 1JLQA 1HBNA 3JB9k 4P2MA 1FFSB 1DLOA 4OHZA 2QT7A 5LSLA 1U1MA 2GIRA 3UE2A 3D6TB 1HNZF 1H2VZ 1DTTA 1AA1B 2MKHA 5D4OA 1RHRB 1CEZA 4PG5A 4NL5A 2YX1A 1VIXA 4X4PA 4NZ7A 1FJGJ 1BWVA 3EVOA 2GJFA 5DQIA 2YNGB 4A8OA 4L72B 4Q8EA 2IJNA 3BO3A 2XSFA 4O3QA 2V2KA 4I2PB 2VFSA 3HO1A 1HI1A 2NXEA 3L7UA 2VBYA 5KG7A 4NI2B 3FRZA 3IBCB 3MR2A 2JC1A 1IJFB 4EZ9A 3HZEA 4J9NA 2G9OA 3RJMB 4USTA 4J9LA 3C15A 1JLEA 4HH0A 2BQUA 3NGRA 3LANA 4NLUA 1Q7YT 3KJVB 1VC5A 4ICLA 3QO9B 4OQJA 4F0MA 1N0VC 5L46A 2HGLA 1BQMA 3MM8B 5D4LA 2GGPA 3BR9A 2HGNA 2A1BA 4NLYA 2ZVSA 4X4SA 1S79A 4PG8A 6FD1A 1RTZA 5ETSA 2LU1A 4CH1A 2PDAA 4A8WA 1SIWB 4B17A 4C8OA 2V6AA 2HBZB 3AJ2A 3SDEA 3JQJA 5C24A 3Q8SB 3CJKB 3DRPA 3J7A1 2IFXA 1AW0A 2CIMA 2QO3A 3X3UA 3MAAB 1TAQA 3KK1B 1D9DA 1IKYA 2VJUA 1YIJS 2YKPA 3SSSA 4P2SA 5E5NA 3QAEA 1FRJA 4EUVA 2UUCF 3K5PA 4QYRA 5HATA 3OBIA 2YKNB 3CC2S 1HR0F 2IPOB 2C2KB 4QU7A 4NA1A 3BQ0A 4RU2A 3SQGB 1GH8A 2IJFA 4NZ6A 2RE1A 4YUDA 2F1FA 2ASDA 2QA2A 1UEKA 2KRRA 4NXNJ 1LWFA 5G0RB 2B6AB 4JI7J 1IKWB 1KWMA 4O0NA 3NCPA 2DTJA 4LQ9A 4RL1A 3ZZZA 4RPFA 4JI6F 2QA4G 4N47A 2P6TA 4DR2J 5HLFB 1F5BA 2CUYA 2BQ3A 4ECWA 2QTWA 2APOA 4UY8T 3H7HB 2W8KA 4DUTA 4DBQA 4O3RA 4R5PB 3LGHA 4YY3F 1TK0A 4BS2A 1NK8A 2A2DA 2UVRA 1WOOA 4P6QA 3TNVA 3F41A 2RF2A 3MUVP 3KLFA 3CJQA 2RRNA 3UN3A 2KFZA 4P74A 4WYLA 5IWAJ 1FKOB 3PXGa 2PD1A 5A6PA 1TZ0A 3CF5Q 2AJ0A 1HYSA 4YB6A 4DPUA 2DNQA 2EFVA 4DPYA 3BYRA 4A48A 4UQTA 1B3TA 3VGVA 3G4SS 1B7YB 4KGKA 3DGPB 3T1HJ 3QSYB 2CNOB 3ELHA 4M95A 5HVGA 1N5VA 2HS0A 2HNDB 2FHJA 4YDXA 4LT6A 4CLTA 2XLJA 1PAUB 4C6AA 1WTFA 4EMDA 2AEJA 4ZCKA 4IG3A 2MGZB 1HNIB 2GQQA 2RKIA 2X1GA 3DMJA 3FBFA 5DQGA 4BLGA 2BKPA 3IXQA 2JVRA 3PZPA 3H5SA 5HMZA 4OL8A 1X4GA 4EFAC 1VRTB 3VZHA 1UA0A 1DQAA 4DPOA 1U4BA 4DZDA 2FLNA 5DDRC 1Q78A 4KJIA 1IQTA 2Y8WA 4B3TF 4Q0BB 1B0VA 1IXKA 3CJTA 1N56A 4A4JA 1RTJA 2JZ5A 3A3NB 5CZXA 2MY7A 3KUGA 2LECA 2M52A 5ETVA 3W62A 4DQSA 4C4WA 2AJ1A 1G7CB 2MKYA 4PRFA 3BGUA 4G65A 3SV4A 5BR8F 3GYXB 4NRUA 1ZM9A 4WWSA 1T0TV 4I2QA 2XZTB 1VQ4S 2ZUAA 2ZH5A 1X9MA 1ZH5A 1QJHA 1RU2A 1PGZA 1VRUA 2XMUA 3MOJB 3QGIA 3WDOA 3ZNJ1 3KG0A 4ZIVA 3THTA 1RGVA 4KE5A 2YH1A 2MJUA 1D8YA 1HBMA 1HNWF 3ZZOA 3FCHA 3H5YA 2W24A 5GADU 1PIEA 4ANEA 1ZPVA 1UFWA 1RT4B 5IM0B 5HVFA 3RG6A 1FXLA 2RD5C 4TLQA 1ULRA 5J2PB 2DR9A 3FZBA 5A8WA 5E3CA 4ED4A 2BQRA 4KPYA 1M1HA 3TI0A 3EVMA 1TK8A 3MEGB 3SQOP 4C0BA 4ZN1A 3JSYA 5D3GA 1WF0A 3DOKB 2DRBA 5J1NA 3KJNB 5L9NA 3IS9A 2YQ1A 1UJ6A 3M9NB 3K58A 2HAFA 1XMQJ 3V2UC 1VQOS 2LLZA 2AJQA 1M90T 4R8UA 1RWOB 4P7TA 2OUGA 1HNXJ 2AEFA 3PJ9A 1AT1B 3MM6B 1HPZB 4G1PA 4OYWA 5C42A 1R7IA 3I32A 2KH9A 2YQ3A 3PDNA 2RNEA 5ETMA 2I5JB 3I0SA 2Y9HA 2K1RA 3I0RB 4DJBA 3L95X 2WVCA 4CNZA 1X7VA 3GCWP 3W8GA 3LTOA 3PYGA 4AE5A 3M6WA 5F9LA 3Q8PB 1Y5IB 5KFSA 1I3OB 4NYPA 4Y34A 3DOMB 4NEZA 1S0NA 2DR8A 4EI2A 4B9TA 2LFVA 3R7SB 3PNIA 4I6AA 3M8PB 2QFIA 1XNRF 4M5LA 2H51B 1U0HB 2VG5A 4U8VA 3SBMA 3MECA 1FD2A 1N32J 3G82B 1RCXB 4KHRA 1PJ7A 3ISND 1SUQA 5KFFA 2KRBA 2EBGA 4UQGA 1YBAA 4OIXA 1HQUB 4ECVA 2NUUG 4PQUB 2HBRB 2EBEA 1C4CA 1TV6B 4F3OA 3MXHP 2Z4PA 3FBEA 2P9GA 3DLGB 5KOXA 2WK4A 1RHUB 3TAQA 1FDNA 4JUZA 1BQNA 3I4PA 2J9CA 2XSJA 3MMBB 2MYFA 1Q4RA 3O3LA 4YOEA 4RW7A 3D0HE 4K59A 2XMJA 3I9ZA 2HSEB 2C2EA 4ELTA 4LQ3A 1GFWB 3CDUA 1NK4A 1F9HA 1R0AB 4K4SA 4IRKA 1KQFB 2UVUA 4USJC 5KT5A 2AHOB 3TUPA 1S0VA 2HBYB 4Y2MA 3U1LA 3KHLA 2ZUGA 3GTYX 4P9SA 5KFTA 1YVFA 5E41A 2WONA 2HNZA 3CDWA 3I4HX 3DRYA 3BEGB 2VFTA 3NS7B 5THWA 1SKUB 3JTNA 1FE0A 4DV6F 3P45B 5LL6d 4LREA 3LW5C 4E8UA 1HNZJ 2FTRA 2HK3A 2Q79A 1Y3JA 2BM0A 4PUOB 3MUTP 3O44A 3CPWR 3OTCA 1U45A 5I42B 4CLSA 3TA2A 1OYEA 1KSPA 1WKLA 3AXKA 3ILOA 2HNYB 1REVA 4OHWA 2LXIA 3CIMA 1XR7A 4IQXA 3BZQA 1NSQA 3Q8QB 2FVPA 4DL3A 2GAGC 4DX8H 4O23A 2ILYA 4B9VA 2EFNA 4LSLB 4NEYA 5FLXY 2VKZG 2DISA 4OYMA 4JI8F 1MSWD 3I55S 4DR4F 1N34F 2HRYA 1K9MT 4Q43A 1T3NA 2XULA 2I38A 1IBKF 2POKA 2MLZA 1JK9B 4USHA 2O67A 2DNOA 3GILA 4BWMA 3FEYB 2CZ4A 2Q6CA 2NQPA 5MLCV 2F4VF 3O1LA 4C8NA 3D6FB 3NEKA 3LH2S 4DXLA 2MQPA 2UXDF 1EZZB 2W7PA 2EFPA 4HTJA 2MPUA 2Y3YA 3CSKA 2CJBA 4QZVB 2ZHAA 4M5NA 1CJVA 4C8MA 2VUGA 5KFBA 3M6UA 4IFYA 2ZWPA 2OTLS 2YWKA 2V5HG 4AFFA 4TY9A 4IH7A 2FJBB 2AWZA 1RXOB 2UUCJ 4ZLJA 2VFVA 1TAUA 3CD7A 1HR0J 1FVSA 1HWJA 3K89A 5CCMA 4DPTA 2B4VA 1QTNB 4KHMA 5HSPA 2BX6A 5FJ4A 1GK8A 4LF9F 2WZ1A 5KFYA 3N6LA 4AQYF 2X1AA 2DRDA 2F65A 3HVAA 3TZWA 2WTFA 3CCES 4B3OA 3NGTA 2GA7A 4PXDA 4NLXA 3QQCD
chains in the Genus database with same CATH topology
2OPSB 3IC1A 1C1BA 1VK8A 3HF5A 3QPIA 1RT5A 2HS3A 3BDEA 4MK8A 4ZVHA 1U1RA 4TQRA 4CO3A 1P1TA 2CFXA 3M9MB 3FSXA 2DGQA 1AXQA 2XCAA 1VGYA 1DURA 1H0HB 1S7HA 2CJAA 1ZTWA 1U7LA 3HLUA 3SXLA 3KLHB 1L3UA 1A6LA 2D3ZA 4RW8A 3KG1A 3DFEA 4H4OA 5T7LA 2DNNA 3CCJS 1TP7A 1XWLA 3VAFA 5H9FJ 5EWFA 1QSSA 4OLOA 3HK2A 1TL3B 5A2QY 4YFUA 2CRLA 4G3IA 1JLCA 4DQQA 1TKDA 3MM6A 2AGOA 1HPZA 3MAHA 2R7VA 2WSCC 3OTDA 2HHHF 3D0GE 2WBRA 3EZUA 3UNGC 4CH7A 2QV6A 2BA9A 3BO4A 3RRKA 4A47A 5KOWA 4X64F 3QJLA 4V19X 1NH8A 2UU9F 3H8YA 2I5JA 2KTQA 2HVIA 5LSOA 3DRSB 2B7CB 1S6PA 1WEYA 1WG4A 2VA2A 4HDHA 3G6YA 4I67A 2HRUA 3OL9A 5AE1A 2QSFA 1N4LA 1RT3A 3DRXA 3J7ZT 1S72S 1VQ9S 2UVWA 3KLGA 2RS2A 1S9GB 1RT7B 2QRRA 3OFEA 4QPTA 3R5CA 3H4DA 3SV3A 4DR7F 1WHYA 2YNHA 1UJ5A 2GQ2A 3CCRS 2N4CA 4QQBA 3N79A 1FJGF 1YJ9S 2JX2A 3LAKA 3MHYA 3BQ1A 2FVQA 3IRXA 5B08A 4KKOA 4QIGA 3RB6A 4FXVA 5F8NA 1NEEA 3HX9A 3S1TA 4B3MF 2DNHA 1UJ4A 4ES3A 1AROP 4OJ3A 3PJXA 3VF0B 3VCDA 1K73T 1D8ZA 2UUWA 4WK1A 1F5AA 7FD1A 5A0YB 5KFEA 5KFQA 2XLKA 2AJ4A 1R27B 4LIRA 4NCGB 1NK5A 3HP6A 1VBXA 1OPIA 5EX0A 3I9V9 2VZ9A 5IT0A 5F9NA 1S99A 3M8QA 5KFPA 4DF4A 2MXYA 1Q8LA 4LF5F 3AJ1A 2DIUA 2RJZA 4Y3CA 2KFNA 2K3KA 2RB7A 5D6GA 3DOMA 2MB0B 2CQGA 2KYZA 2NPIA 2NR0A 1N48A 1FK9A 4MYTA 5F3TA 3US5A 1LK5A 2ZZMA 4ZOSA 1MWZA 3GR0A 2VPXB 2FJEB 3VAIA 3CXCR 3QIPA 4WFXA 3PEHA 4HI2A 3CC7S 3MM5A 5K5MA 4EO6A 5I3UB 1NJIT 4KHPF 2P9CA 3HZGA 2CJ9A 2F8MA 3NS6A 4RLEA 1C1CA 1MWYA 4I4BA 1TVRA 3OJUA 3T5JA 4HDGA 3P96A 1X4FA 1LFWA 4RWXA 5GADI 1VHFA 1ZYQA 4L3NA 4DR1F 2JDJA 2ZNYA 1BWEA 2ZC3A 1UAWA 4ZA1A 4ELVA 2RKIB 2MY8A 2RVJA 3DMJB 5BJRA 3F56A 1FJEB 3V6DA 3N6MA 4BHQA 2G4BA 2XB2D 4JI4F 2Y1IA 3UW1A 2R2SA 3G6VA 3GYNA 3NGKA 4IR9A 1WF2A 3ETOA 3JSMA 5B0DA 4HH1A 4LFBF 2AYMA 2CG4A 4IFVA 1N88A 3MEEA 5A8RB 1R3NA 4DV4F 5F8MA 1YJTA 1W2BR 1DAXA 1LWEA 1QSYA 4RW4B 3OHAA 2UVVA 3HHDA 3OTOF 3OUYB 2KJWA 3IAS9 2EW9A 2BDPA 2GMHA 1HNVB 2ZOFA 4O4GB 4FF1A 2RQ4A 3TYTA 1HQUA 1NJZA 2OKQA 5GAGU 1SV5B 4NZ0A 5HMXA 2ABYA 3R5BA 4J9OA 2LU2A 3R5DA 4C3MA 2ZHBA 4QIFA 3TQ1A 3RRHA 4Y2AA 2B51A 1U6FA 3K59A 4RW9B 3D54A 2ZC4A 4QOTA 3M2VA 3VALA 1S48A 2O01C 1CPZA 1JMTA 1KLMB 2Y1RI 1QUVA 4DL6A 1FJ7A 1UVNA 1TV6A 1YHQS 3CTRA 2P5VA 1EP4A 1RTJB 1T95A 2VFUA 2R7QA 4ED8A 1KTVA 3FDSA 5AXKA 1YSJA 2PMZD 3CCQS 2IHR1 3LP2B 3KTQA 4BDPA 3DOLB 3QO9A 3MPYA 4R25A 1RT1A 1LW2A 4OX9F 3DHXA 1H7WA 3KG4A 5CH7B 4G1IA 1YTYA 4H54A 3U7JA 3Q24A 2GMJA 3MR5A 2UUBF 3HPOA 4F3MA 4Q45A 2OPRA 3HI9A 3MMBA 1WG1A 1E6VB 1H6KX 2YNIA 1R43A 3T1AA 2FC9A 1S9EA 3RW7A 1FCAA 3N5BA 2NLWA 4A8SA 4QR1A 2HLTA 5GAEU 2CDQA 2ALZA 3PW7A 4WF9Q 4TY8A 3CCVS 4C0HA 4DFKA 1E6YA 1S1TB 2ZJQQ 4QWAA 1QE1B 1JJ2R 3H2VE 3C6UB 4CT9A 5KFCA 1S6QA 3CJ0A 3B82A 5BYQA 3KMSA 4ZPDA 3IAM9 4FZVA 1N5TA 2OPQB 3NAHA 2KU7A 2CPHA 4IO1A 3UR3C 2BE2B 1HHSA 4Q44A 2Q43A 4WE1A 3V4IB 4K4UA 1TQLA 2FC8A 2LEPA 4GC7A 4KO0B 4ATNA 3JTOA 3JYTB 5KG0A 4DL0C 2W4CA 4ID5B 1VQ8S 1VC0A 2DR5A 2J0SD 5F8JA 4MJKA 2N3OA 2PA3A 1P27B 3GSDA 3NNAA 3MMJA 1KS2A 4NX9A 3DLEB 4H4MA 2PA8D 3PV8A 1WEZA 2VG6B 5GVQA 3HJFA 5IT9Y 1JIHA 3GIMA 2W8LA 1JWWA 3KK1A 4ZLPA 2IM3A 2HHWA 1IBLF 1QM9A 1JLGA 2RQKA 4KC5A 4RNNA 5A6WA 4KFBB 4PXBA 5CQGA 2QE5A 5LMNF 2EKYA 5CXTA 2M7SA 1ZZNA 3C6TB 5KT4A 2B9XA 2JJ4D 4DDFA 2AYBA 4QW9A 4O3OA 1X4AA 4QCLA 1ZTTA 4NXNF 3M2UA 5AE3A 4MFBB 2AW0A 3CD5A 4CO2A 1MROA 2YH0A 2R7UA 1UFLA 4F8RA 1R89A 2SXLA 2JLEA 4M1KA 3HHLB 1KN6A 2MQOA 4Y2IA 2AP6A 3H5UA 2FGCA 2FLOA 4OJ1A 2C2RA 1SKWA 3K7RA 4OMFG 3TAPA 5T41A 5L1IA 1HHTP 3GMGA 3KFWX 3WBZA 2XS2A 4NYOA 1UA1A 1FEHA 1ZAWA 5CHCB 1PILA 3OSNA 4ED3A 1YJUA 3IR6B 1UWBB 5KFLA 4DR2F 4B9UA 3AHPA 1X9SA 1N5YB 1CG2A 2N7CA 1RTIA 1ZAXA 2D41A 4K4TA 4OI2A 2ROPA 5J1EB 4C11B 4PUOA 5IFMA 2OH2A 3FQKA 1QTMA 2KG0A 5C25A 2LCWA 4EBCA 2FLPA 3RR8A 4X4QA 2ZJRQ 3DU5A 3BSNA 1S1XA 5B0GA 1RTHB 1IM4A 2KN4A 4N8NA 1SBRA 2ZBCA 2EPIA 4YHHF 1UVLA 1TR0A 2EC0A 4HT5A 5I42A 4IOBA 4A8YA 3PFOA 1OPZA 4A8XA 4Y2CA 3TVYA 3VZIA 2I2YA 1LKZA 3PACA 1RK8A 1TKXB 2OD6A 3M30A 4G1QA 1H98A 3GV7B 2VONA 2HNYA 2PSZA 1R8AA 2NYIA 1QVGR 4QR2A 2JEGA 3ULHA 3M2RB 3EYZA 1Y4ZB 1YRXA 1U6ZA 3BQ2A 1VQSA 4PQAA 3M4XA 3QLHB 4PWDB 3PO4A 1RAJA 3JSBA 4ECXA 5HROB 4GKJF 3KLIB 4F4XA 2CQ0A 1KQGB 5KFKA 2WOMB 4CZCA 2B0GA 1ZM2A 3S6EA 1FVQA 4R5PA 2W25A 1ZOTA 2AV5A 2D3UA 4YQWA 2BOPA 1XNQF 1DZ5A 5HMYA 1P6TA 2VOPA 2CPYA 4LSLA 4F3QA 1U8SA 2D9PA 2FVCA 3O2IA 2IM0A 2CQPA 2RT3A 1RYRA 2JRSA 2PO4A 2M8DB 2R2TA 3I31A 2OAUA 5IWAF 1TKZB 5B0AA 2HYIB 3KMQA 3N9UC 2R8KA 3DLJA 2LDIA 4DR3F 1D9AA 3HXMA 2V9KA 3BN4A 1H38A 1YGYA 4BWJA 1MU2B 2E1RA 1B0TA 4CO5A 5H9EJ 3MPVA 5CYQB 3PFEA 1U24A 4RBTA 4RKUC 1JLQB 3R3TA 1HBNB 1SQEA 2ACYA 2LQ5A 4ED6A 2XY7A 1S0MA 2FJVA 2FUG9 2I1RA 2WBMA 2AD9A 2FJWA 2WSFC 4DSIA 3IR7B 3ZC4A 2CPIA 4C8YA 3IG1A 1DLOB 3KK3B 1XR5A 2BZ2A 1QAXA 5E3QA 4A8FA 1UW4A 3T1HF 2QFJA 2L9WA 1JLFB 5LXYA 5LJ3Y 1VQLS 1JNRB 1RA6A 3CULA 1T05B 2VODA 5I3QA 2M4MA 4QJVA 3C3LA 1VIOA 1DTTB 1KTQA 3SFUA 4GO7X 4RUCA 4NA2A 4DL2A 4IKAA 4TNOA 5KFVA 3OQ2A 2XWYA 4Y0FA 3BREA 5KFXA 4PPDA 4WCEQ 3SI8A 4NXMF 3OFGA 4WFZA 3QYYA 5HP1B 2LMIA 1R8PA 3H2UB 4ZMMA 4C0OC 2IM2A 2ZE2A 4AL5A 2YWFA 4LFAF 4RX6A 2FJAB 5IQ6A 4U6PA 3K8WA 5T14A 1J2VA 4CO1A 3T5HA 1UEUA 1Q81T 1DJ0A 4DS4A 5J2QA 4AL7A 3CCTA 2F40A 1HWKA 1FNOA 4XAKA 5E3AA 1PC5A 4DR6F 1VMBA 2EFOA 2FVSA 1L5UA 1TL5A 1RTDB 4ID8A 7FDRA 3GG1A 2KM8B 1P1LA 2ZD1B 4F2RA 2OMOA 1WI6A 3M8SA 4FF4A 2IRXA 4O4RA 1NNDA 5AJ3F 4O0IA 1HW9A 1HW8A 4ZCMA 2J6SA 2LDYA 3E01A 3BF4A 3LUYA 4FYDA 4LVOP 4ZCLA 2RRAA 1F0XA 3PW0A 1FKPB 3DI6B 3CCMS 4UUWA 5DG8A 3TR5A 3CCUS 4XIUA 3RYLA 3BO2A 1C0UB 3THPA 2B56A 1N0UA 5IT4A 2UZAA 1BY9A 2BUNA 4OFZA 4C8ZA 5KT7A 2GO9A 2RH3A 4MAKA 3LP1A 4HYKA 1S1WB 2CYYA 3MM9B 2K7KA 2KXNB 2GC8A 4U7UK 1Q82T 5EN1A 3K2YA 2J0QD 3QZ8A 2DK2A 2KHCA 3OL7A 5KFRA 3LP0A 1JLAB 1URRA 3FEXB 1VS3A 5F8LA 3SMZA 4LFCF 4N77A 1JLEB 4TYAA 1FESA 2XCPA 3Q2TC 4QIEA 3PRBA 3QWUA 4BBYA 4NLWA 1H7XA 3SCLE 4RBVA 2ZOMA 4BC7A 4ZPWR 4XDCA 3R1LA 1X0PA 2B4PA 3MEDB 2YKQA 3DC2A 4ERDA 4K4VA 2M2BA 2AJFE 1RA7A 4JI2F 5K8NA 2DIVA 4DS5A 3I5BA 2GQCA 4Q0BA 1IKVB 1XN9A 5CYJA 5F41A 3DU6A 3HVWA 2XGPA 3T19A 3TOQA 4TU8A 3LOUA 1WHWA 4ALZA 2XSJB 1BQMB 1FRLA 4G6VB 4Y2KA 5FDLB 2N3LA 3FGVA 1KQKA 3KLEB 5E33A 2GGPB 2P6SA 3E3XA 1BQXA 1Y00A 5AXNA 4WYWA 2CVIA 3P5TL 2OPSA 4TYBA 2BM1A 3MD3A 4YR2A 2HVZA 3FJ2A 4ES1A 2YWGA 1Q53A 4ILRA 3CJ2A 3T6JA 1YQHA 1NK0A 1NZAA 1WACA 1XERA 4I64A 5KG4A 4DOZA 2RU3A 3KLHA 1SL2A 2YNFB 1FF2A 1I1GA 3SEOA 1X5TA 4JV0A 1CC7A 2XMMA 2CVEA 1T8EA 3SDEB 5C24B 2J9DA 3DRPB 3UCGA 1TL3A 2HHXA 2MKSA 3DCAA 2EFQA 3AA8A 3PY8A 1Y9OA 1V3ZA 3SFGA 5B0FA 1N5SA 2XMTA 5K8OA 4MKYA 4O3NA 4DFJA 2R8JA 4RW6B 4FNHA 2I9SA 1Q1KA 1LW0A 3MMAB 4FBTA 1L3KA 3LF0A 1FNXH 1U49A 1IKYB 2M0GB 3AB2B 2PIIA 3RB4A 1XK8A 2E7WA 1HFEL 5DG7A 3CMES 1V3SA 2DGSA 3B4DA 2FJXA 1M5VC 2WONB 2DH8A 3D5MA 3CMAS 5DRKA 4DLGA 1HARA 3TO8A 4YB5A 4KIAA 2R7RA 1JB0C 4IG0A 4URGA 2L3MA 1KRPA 1S9GA 1RT7A 1MNEA 2PFFB 4QYZJ 1LQ9A 2MKIA 4AUKA 5CA5A 4LJMA 3PKYA 3R1HA 2RIJA 2DNGA 2IVFB 1M5SA 4ED0A 1WHXA 3MI7X 3PKMA 3H5XA 2M9KA 3I87A 3L09A 1VQMS 1HWUA 3IR5B 4Y65A 4FPRA 4ITSA 5A0YA 1U2RA 3NCQA 2W9BB 2HHSA 5JJBA 1FEEA 3DYAA 2IVMA 4NCGA 4R0EA 3I56S 3CVKA 3I5AA 3P49B 2AQ4A 1I6JA 3C66A 4OZJA 4ZKAA 2Z0GA 2AGPA 1NK6A 1LV5A 2XZWA 5KFGA 3JAMY 2Q1LA 5DGAA 2FPHX 2Y0SD 4F2SA 2KT2A 2CJQA 3MAQA 2YKMB 3W7BA 3UPFA 3MFHA 1QY7A 4ZDNA 4C8LA 2DNLA 4IR1A 1HBUA 5EGYA 1VQYA 4RNFA 1IUJA 2ZH3A 4IUFA 2BVZA 5KFMA 5I3UA 1RT4A 3BS9A 2DGUA 2RU9A 3IWLA 1WEXA 5IM0A 3RTVA 2CQ1A 4D3HA 4C2MA 1QAIA 2E5JA 3PRDA 4KTQA 4WU3A 3VAJA 5EHHA 4J9MA 2HWHA 3L3CA 1Y3KA 4WFNQ 1VLYA 1H3DA 2MHNA 1KLNA 2EI5A 1DTQA 5J2PA 5CYMB 1XMQF 2JOQA 3GFYA 4DSFA 3PJWA 4C7QA 2AF6A 3RB3A 1HBOB 5E2QA 3MURP 1P9QC 1WF1A 1R8HA 2F9JA 3T9ZA 1XC9A 3N0VA 1HNXF 2DT9A 2HMIB 1D3WA 4J9KA 2CQBA 5KFDA 4JI5F 4HKQA 5A8RA 3MR3A 3SZ2A 1TUVA 1SL1A 1DFDA 1B7FA 3MFIA 3ITHB 4RW4A 2Y1JA 4IRDA 3LPYA 1FRHA 3OUYA 1K0TA 4ZVEA 1HNVA 3MCSA 2GJIA 1RP5A 4O4GA 2GHPA 3HDSA 1BD6A 3HT3A 2PE8A 4CI0B 2QZ8A 3G71S 5JUMA 2WW8A 4HLBA 4CO4A 3OJSA 2DO4A 3W2VB 5G4DA 1C0TB 1FXRA 4UW2A 2EK6A 1TL4A 4WKYA 4RW9A 4C3LA 1L3SA 2Z2LA 3P6YC 1KLMA 3D1OA 2XNRA 2GCFA 2J8AA 3HMJG 2RF2B 2JEIA 5L9XA 3V6JA 3KLFB 4OX8A 3U02A 1U1QA 5F0UA 3LP2A 2NS1B 3DOLA 3OL6A 3ICLA 1FTRA 2LEAA 1N36F 1SH3A 3W2WB 2OSQA 1NHVA 4X65F 2V8DA 1N33F 1S1VB 3IGNA 4X62F 2M8HA 3KHRA 3CIZA 4HT7A 2A10A 2IMWP 3RRGA 1HWIA 1P8GA 3UWTA 2OFHX 3GQCA 4K5RA 3J7Z5 1HMVB 5AXLA 5KG3A 3I0RA 3GFHA 1FKAF 2DPIA 2L9NA 1E6VA 1NJXA 3S7RA 4DSLA 4M94A 4KV8A 1YITS 5B0EA 4MK7A 1HYSB 2NSBA 5BYSA 1IR0A 4F4ZA 2XMVA 2R9LA 4J5OA 2DPJA 2Q66A 2MQLA 2XO7A 3VAMA 1S1TA 3J7YU 4GC6A 3A1YG 4DFMA 1S76D 1TK5A 1QE1A 1ZAVA 2XNQA 2V4JB 1NKBA 2B3TB 2BXJA 3AQOA 2OIHA 5HQ8A 1NJWA 5DDQC 2OPQA 1ZPWX 4FXWA 2BE2A 3O5TB