2R9LA

Polymerase domain from mycobacterium tuberculosis ligase d in complex with dna
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
287
structure length
287
Chain Sequence
EQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*DGP*DCP*DGP*DGP*DC)-3')
publication title Structure of a NHEJ polymerase-mediated DNA synaptic complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Transferase/dna
total genus 86
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2007-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2r9lA02
2IRUA 2IRXA 2IRYA 2R9LA 3PKYA 4MKYA
chains in the Genus database with same CATH superfamily
2VQFF 3TO8A 2L9DA 1RWVB 4OZJA 2W4CA 3Q2TC 4GRSA 3DM2A 3L7PA 4IH6A 4IO1A 2OPPA 4OYAA 2ZNZA 1GTHA 3ET6B 2HAFA 5CD4A 3V5RA 2FB0A 4URQU 3ZZRA 2BOAA 2OEMA 4G65A 4YHHF 2ZBPA 4ZPCA 4LF5J 1HNZJ 5ETRA 4EBDA 5D78A 2JFDA 1LWXA 1C1CA 4R25A 5EGYA 4TQRA 3LP1A 3I9V9 2WONB 4F26A 1IBLF 3DRSA 1FEEA 2DGVA 4KFBB 1R0AA 4C48A 2QSWA 3RU0A 5THWA 3SBMA 1S48A 3DFEA 2QL7B 3HVTA 4Y2CA 1S1XB 3EPIA 1Q79A 3TVKA 4MK7A 2C3PA 4E2FB 3GFHA 3C14B 2R42A 3RRGA 3SSSA 3HHLD 4DL3A 3QT5A 4YP3A 2C2EA 4NXNF 1KVIA 2OTJS 3TRGA 1IKYB 2KRRA 4K4ZA 2A2CA 4OHXA 2XI3A 3NL0A 1XQIA 4RPFA 3QYYA 4LF2A 1Y5LB 1G6BA 4KB7A 1BQMB 1K1QA 4DX8H 3KLFB 2VJVA 3PJ9A 3E2EA 3CD7A 3T3FA 1JX4A 3G9CA 1B7FA 1R8PA 3EDRB 1HNXJ 3PEHA 3D5MA 2VHGA 4CLPA 4DLEA 5E2QA 3FCWA 4WE1B 5KFEA 3WDOA 4C9DA 1F5CA 1RWPB 1XIQA 2BE7D 4F04B 3ZTPA 2BABA 1MMLA 4EEYA 4JYAJ 2MHEA 1KLMB 3FCVA 1RTDA 1J5EF 1R3NA 2LYVA 2VDHA 4ED6A 2OUGA 3DGVA 1QSYA 1YBAA 3OFHA 1U25A 1WNEA 2IMOA 4WFBQ 3DYAB 3EYZA 8ATCB 2OHDA 5KG0A 3BREA 2VQEJ 4B3RF 1N32J 3TA2A 3PZPA 2CJXB 3AB2B 3UDLA 2ZVIA 2VIHA 5CYQB 1NHUA 3GYXB 4NYPA 3HZGA 4ZIWA 1K1SA 4FYVB 3GFXA 2HQDA 2IM2A 3DU5A 4ICLA 3MM5A 1WACA 3GJRB 1YK9A 2I5JA 4YUDA 4RU2A 3K2YA 3UPFA 1VQ8S 3FFIA 2OTLS 2BRKA 1U0SA 3IRXA 2CQCA 1D9AA 3ENAA 3PRBA 2F8MA 5K20B 4ED1A 2E5LJ 4F8RA 2JX2A 4M5LA 3U1MA 4IRKA 3CDEA 3CJKA 3HFVA 4ZN3A 5I3UB 2ZE2B 4M5DA 3V6DB 3ILLA 2RDDA 2V5HG 4LR7A 4RKUC 1WOSA 2ZOGA 2EFNA 1Q53A 3OT9A 3GJSB 1HWKA 3EUNA 3RRKA 1F3VA 1YTYA 3NAHA 2KZZA 2LXFA 2HMIA 3GSIA 4LSLA 2V8DA 5LMNJ 3H5XA 2GQ2A 1HQ2A 1YWXA 3CCUS 2XY5A 1D0EA 4RWWA 1HHTP 3KOAA 3WC2A 4IH5A 5GAEI 2K2PA 3TQ1A 3GCWP 1OQ3A 4U67Q 1N52B 5A8RA 1S9FA 5KFFA 2AJ1A 3AHPA 4FPRA 2RHQB 2B7BB 4ZVPB 1HKAA 4L74A 4TN2A 4B3SJ 4DUZJ 2MLZA 1S0OA 1PAUB 1RHMB 1RT3A 2DEJA 3IAS9 2C2KB 3CPWR 3FSIA 3NBPB 4X4VA 1NEEA 1V9OA 4Y0FA 4I2QA 1RA7A 5L9NA 1HQEB 3M2VB 4UQGA 4DUYF 3TJ9A 2CYYA 4QWBA 1VQPS 1U1NA 4K4VA 2ZBQA 4TU8A 4WTYA 3PFOA 4ED0A 1RACB 3HK2A 1RGVA 4DV4J 3GR1A 2DNGA 4JI3F 2OGUA 1RKIA 2HVZA 5ETPA 3W65A 5HQ8A 3FMBA 2MZTA 4OX7A 1GH8A 1S7IA 3IAM9 1JXLA 3BQ0A 4OHVA 4X2BA 1Y00A 3R6LB 4Q45A 1Y3KA 5E5NA 1LW2A 4QIFA 1FKAF 1XMOF 1FNOA 3DLKA 3IGNA 2HNDA 1SC6A 3MM8B 2AEMA 2H3EB 5KOXA 4YFUA 2LEBA 4RNOA 1C1BA 1ZZFA 2J9DA 2OH2A 3L7UA 4YDDB 1N33J 2RQMA 2CPEA 4H4MA 1YX2A 2DHGA 2ZWOA 1YJ7A 3US5A 3KLHB 3EX7B 4KTQA 3B4DA 2UUAF 2CPXA 4WP8A 3G6XA 3OHAA 2W7PA 2V6AA 3AQPA 1S4EA 3EMTA 4K4YA 3A1YG 2BKNA 1DTQB 4C8MA 1SCJB 1P8GA 4KKOB 1B0PA 3CDAA 5L46A 2QT7A 5E3QA 3HFZB 3PYDA 4DZ6A 5J2PA 3CF5Q 3RGIA 4L3NA 1LWFB 3J80U 1Q86T 2HHUA 2HLUA 3HDSA 4IFYB 3ADAC 3GB0A 1P9QC 1G2EA 1VC0A 2XO7A 5CQGA 3FUYA 3M8QB 4A8MP 2YY3A 3BGFA 4I6WA 2HZVA 1Z4UA 3OD2A 1OYDA 2WSFC 3QGGA 4Y2KA 4Y00A 1TQLA 3MOJB 5IT9U 4I2PB 2G2YA 4NLOA 3H42A 4L75A 3BO2A 2ZKTA 4CQ1A 4NLGA 1KOOA 2XWYA 1HI0P 4LR8A 4MIWA 2XSFA 4JB8B 1FDBA 4J37A 1ITPA 1L3UA 2L08A 2IRXA 4O23A 3GU0A 3IMQJ 3R1HA 3KLEA 5FIIA 4ZP7A 2E66A 3K8VA 4ID5B 1VOMA 2CPHA 3BGRA 4DL0C 4UOGA 1T9TA 2BMBA 1SC3B 3K5NA 1T7PA 3ITHB 4KV8B 3SQOP 2H4YB 3ZNUA 1X9SA 2H5IB 3MECB 3JYTB 2B43A 5T7LB 4PYAA 1KHVA 3CCES 5KT6A 3MR2A 1B99A 4YEAA 4LIRA 1U26A 1QD1A 4HHHA 5HSPA 2FHKA 1N54B 2JEIA 4J9PA 4N76A 5FJ4A 2CQ2A 2VU5A 2BA9A 2K8GA 1VDHA 3U1NA 3ELHA 2FTRA 2QL9B 2EG1A 2HQFA 4GKKJ 3D3CJ 3SDEB 2DPJA 4F4KA 4EMDA 1BQMA 4J90A 3AQOA 3K5LA 1PG5B 3A3PB 5C7PA 3R2DJ 2EC2A 4DSEA 3A3NB 3R5AA 5CH7B 4ZPVR 1OWXA 1UW9A 4TU9A 3UE2A 3E01A 2E5JA 2OPSA 3TI0A 3WHIA 4JI2J 4RW9A 2WOMB 3ISNC 4D3GA 2O1PA 2JEJA 4WE1A 2XEXA 1NB2A 3K58A 3UQSA 1EZZB 3EM1A 2ATLA 3MCNA 1I94J 4ANCA 3QLHB 3CJ3A 4KJIA 5KG7A 1RAOA 3WC0A 2A2DA 2HHPA 4FVMA 4FYWB 1XR6A 2V2ZA 5GAHU 4DPTA 1TUVA 2CJYB 2DH8A 1DJ0A 3THTA 2H51B 2COLA 2HFVA 3TVZA 3W63A 4U96A 2OJ3A 4I1TA 3CJ5A 3CE8A 1CS4A 1FTCA 2R7OA 1SC4B 2DR7A 3C15A 3IRWP 3D6FB 3R8YA 2X1GA 1MWZA 1J5OB 2B9EA 2L3MA 4GVBA 4YR2A 3ZXWA 4NZ0A 4KE5A 2Y1LB 3OL9A 1V3ZA 4NX9A 1WEXA 3CCRS 2FPHX 2VL1A 3NWRA 3LTOA 4UOCA 3MEGA 3EGNA 4XPEA 5IFMA 2QYCA 3CULA 3OJSA 4J9SA 3CW2C 2GIFA 1HNIB 3UN2A 1MROA 3M2UB 3V6DA 1VGYA 5IXUA 2KM8B 4NASA 5B7WA 4LVOP 1VJWA 1U47A 3P8BB 2DGXA 1YJVA 4G1PA 3W61A 4RNHA 1RLCL 2HNZA 2DBBA 4MK8A 1D1UA 4DV1J 3H20A 1RHRB 2AD9A 1EP4A 2VJUA 4YOEA 1NMEB 5I42B 4NYZA 2DGSA 3V6JA 2I2YA 3ZZPA 5AJ3F 4H4KC 1CSJA 1VQLS 5KFYA 3FDSA 3DI6A 3D1HA 1H74A 1X5PA 2J6SA 2MKHA 4CYUA 3CB4A 3NMRA 3MMAA 3W8PA 4QR1A 4UTGA 3QSYB 3I4HX 3MMBA 1HNVB 3NBPA 5LXYA 2QLBB 1QVFR 2R8JA 1U6FA 4RW6A 1SKRA 2LU2A 2G1DA 4XDDA 2VG6A 2FYXA 2VG5A 5B0DA 3NCRA 1G7CB 1U24A 2RILA 2XMWA 1NK4A 4Q0BB 3LP2A 2IYIA 3MR6A 2CWKA 4RL1A 3I4PA 2VH7A 4ECUA 2E7WA 2VASA 1TMJA 1YG0A 3KHLA 1WOOA 1F3FA 2QYGA 4N8NA 4JI1F 2RRBA 3GLJA 4IRDA 9RUBA 1HD1A 2X51A 2RUGA 5IWAF 1Q5YA 1T95A 4OHYA 1QUPA 3PHEA 4DN9A 3CMAS 5DDPC 2DIUA 3UD4P 2ZD1B 2KXFA 3CCVS 4OYXA 1EX8A 4PEOA 3CC7S 2RUSA 4LF7J 1SKUB 2EVZA 2H5JB 2PEHA 3UVJA 2DTJA 2HG4A 3C66A 5HVFA 4FF2A 4ES3A 2DNOA 3MDFA 2D3O1 5HLFA 2LKZA 2PN6A 2VG7A 5ETLA 1N36J 3O44A 1TL3B 4H4OA 5L1KA 3FQKA 2F4VJ 4H4KA 1M1KT 5C24A 4HHUA 4EZ9A 4PXBA 1YRUA 1KHWA 4NXMJ 4ZVOB 5KG4A 1RABB 3T5JA 4S0MA 3I56S 4OZNA 2QC3A 1IXKA 5F8IA 4X62F 3CCTA 4TQSA 4X4UA 4ZKAA 2B9WA 4CNZA 1X8DA 2B56A 4J9RA 3IBCB 2CNNB 5KT5A 3LPEA 4DR6F 2CUYA 2ZNYA 5IC6B 1BUXA 1R7IA 1I5OB 4CNYA 4NEYA 1FK9A 3ZTRA 2XYHB 4U8YA 4DSKA 1VRTA 2DXEA 2ZH9A 2VUGA 3NP5A 1SQGA 3KMQA 3AOBA 1HQUB 3M1VB 5KFJA 1RTZA 4WYWA 2MGZA 1I3OB 3D6HB 1VYAA 1WF2A 2XLKA 4ZVGA 2CPJA 4U6PA 3GZ7A 3CCJS 3RB4A 4O44B 4KO0B 3HVRA 3NMAA 2HURA 4DZDA 1FFSB 4B9MA 2CG4A 2BJ9A 3ISND 1S12A 4R8UB 2HVIA 5I3QA 3EWGA 3TQEA 1RAEB 1UVLA 1F6TA 2P9CA 2AJ4A 3D9BA 4DV3F 2UVRA 3AD8C 4ZOSA 5HBMB 4WP9A 3MUVP 2UP1A 4M5GA 5GAGI 4ZLNA 2DNLA 2JL9A 4OYWA 5AE1A 1K8AT 1Q4RA 2J9DE 4URGA 4AQYJ 2B7CB 1FD8A 1EJ7L 2XQCA 1UJ4A 2AF6A 4OZLA 4ENOA 4CH7A 1LKZA 5C25B 1D09B 3OXGA 4FXDA 3RAXA 1Q8LA 4CLUA 4HT5A 3OTBA 3B78A 1VRUB 4GO5X 2LXUA 2FY1A 3FQLA 4IG0B 3WX4A 2ACMA 1U2FA 3KWMA 4KIAA 2JC0A 4Y2AA 2CQ4A 4Y3CA 2A10A 1QE1B 4YR0A 4LR9A 2GO8A 5D0GA 1I51B 1VR6A 3CJQA 2DB1A 3I5AA 3M05A 3DGPA 2QJ3A 4KAIA 2JRSA 2HGLA 2FJAB 3G87A 5F0UA 4DFJA 1RT6A 4EUVA 3G8QA 1V5IB 1YKWA 4RBUA 1K44A 3N6LA 2B51A 2ZC4A 4OYPA 2R8HA 3E3XA 4B9UA 4RNFA 1X4EA 3EJMA 3S1TA 1TVRB 2CQPA 2UZAA 1TR0A 5KFAA 3PHTA 2C2RA 3AOCA 2BJ8A 4N8OA 2KJWA 2ZM6J 2ZBRA 1ZAVA 2D1CA 3CJ0A 3W7BA 5D0EA 5IQ6A 1NHVA 4ANEA 3FZ2A 2FVSA 2RU3A 1G4CA 4V19J 3PJWA 1HNWJ 1B64A 3SZ2A 5KT7A 4N47A 1YITS 4DV5F 2W2NP 2ZZTA 5J2QA 4PUOB 4ZDNA 1TKXB 2BM1A 2Y1RI 1F9FA 1TUWA 3T6BA 4RBTA 2J7WA 2ZH3A 3SXLA 3FBCA 1UPMB 2IVFB 4OJHA 4JV5F 1H2VZ 2W24A 1X9MA 2RE1A 3JAMU 4MIAA 1H38A 1IBKJ 1MWYA 4B9NA 4AYBD 4RO0A 4N56A 1PYOB 3IS9A 2QSFA 3VAKA 3BN7A 2DRBA 2DH9A 3BSOA 3DCAA 1FEHA 4WWSA 1FJGF 4OZ2A 3OFFA 3W2WB 4DV4F 3I87A 1RAFB 3W62A 5B0FA 3TUJC 2Y0BB 3EXYA 2FD2A 1WG4A 3D6TB 1Q8IA 3LQVA 5GADI 3JS9A 5LOQA 1JLGA 5CZVA 1L3KA 3R7NB 1YDLA 5CAAA 3DRPB 1ZM9A 3T6JA 2MKSA 2BE9B 3V4IB 2Q6BA 4MK9A 1JB0C 1FXLA 4OV1A 1HI1A 3EVWA 2WHOA 2QN6B 4DL7A 1A7GE 3OR2B 3Q22A 1NDPA 1P6TA 4BDPA 6AT1B 2M88A 4M5NA 4CI0B 4HYKA 2A18A 1D9FA 1T9XA 1SJRA 1L3VA 2R2TA 1ZTTA 1N33F 5LJ5Y 1IR2A 1LWEA 1N4LA 4N5SA 2UUBJ 1N8RT 3JQJA 4LF4F 2E5HA 3Q86A 4I6AA 2C3OA 3THVA 1WORA 3D0IE 5J2MB 1DFDA 1HHQA 4LMZA 2VV5A 2MSSA 1XWLA 3VR1A 2NPIA 4DV2F 1S6PA 2JEFA 1SH2A 5IT0A 4TY8B 2AMCB 1OS5A 4DV6F 4DU8A 3NCPA 1VBYA 1RP5A 3FMWA 1T05B 4JI0F 5HP1B 2D3UA 1M1GA 3GTYX 3T1HJ 2LA6A 2P6SA 1IKXB 1JK9B 2FZGB 3OHBA 4BC7A 1RT2B 4AUKA 2ZVSA 3PNIA 5T41A 3NGTA 4LFCF 1B7YB 4WFNQ 4LF8F 2YPYA 1JLQA 3TA1A 4YB5A 1CPZA 4A4JA 1YJTA 4K2XA 3D7SB 4RR5A 2OELA 3MM9A 4HVZA 5HROB 2YNIB 3M8SA 2ADCA 2GW8A 5KFPA 5GAEU 2BKPA 5LL6d 3W66A 3AJ2A 2B4PA 1FXDA 1U1QA 4ILMA 1N5TA 3T41A 3EZ5A 1T8EA 2NUHA 3KG0A 4IG3B 2GJIA 2FHOB 3DOKA 5KFVA 2M8HA 4WF9Q 1QM9A 1PJ6A 4PRFA 1REGX 3H25A 5F8JA 2GAHC 2VBYA 3TP2A 3OL6A 2VPXB 4HL9A 4FF4A 1X5OA 2CXEA 5KFBA 5BR8J 4K5RA 2DNHA 2C42A 4NI2B 4Y2IA 1WHWA 4CT9A 3LWMA 3MFIA 3NS6A 4O3RA 4RUCA 4Z7CA 2DGTA 4LF9J 1RK8A 4M94A 4GKKF 1HQUA 1VMBA 2UXCJ 2E7XA 2UVUA 5J1PA 2YWKA 3LAKA 2MQPA 5J1EA 3BQ2A 3ZZUA 4OZ5A 1HYSB 2FJDB 2RSQA 2ZOMA 3HCXA 2V2QA 2JLEA 4Q7AA 2R2SA 1FA0A 3TJ8A 3MHYA 1Q0NA 5J2NB 2FC9A 4KO0A 2ASLA 1FD2A 4JI2F 3A3OB 4MTPA 3RRHA 1BWVA 3MMJA 3DDIA 4I69A 4X66J 1RYRA 4ZJOA 1SV5B 1FVQA 4DF4A 2PI4A 4A8QA 2AYEA 3C6TA 5KT3A 2Z2ZA 2X7IA 2GQQA 1TL7A 3CC2S 3NOGA 3AA8A 3K7RA 3MEEA 3BQ1A 2J9EA 2VQFJ 5AE2A 1M0SA 2D69A 2RF2B 4DV0F 2GVDB 5D4NA 3QFWA 5EDWA 4ZCKA 4LRFA 3QJPA 3M6XA 3LO3A 3IM8A 4YHHJ 4KPYA 1REVB 3PR5B 1WI6A 4UOFA 4LBPA 5KFZA 1Q8KA 2MTLA 1K47A 3OTDA 3PR4A 1IBLJ 2N3LA 1QE1A 2V2VA 2DGUA 1NSQA 1R31A 1UETA 3CDBA 5C42B 4C3MA 4ZA1A 4ZPDA 5KFNA 2F5GA 5ETKA 4U7UD 2KDOA 2MB0B 2K7JA 1R8HA 2V50A 4WFAQ 4NXNJ 5KG3A 2DXDA 4OZ3A 1CLFA 1HPZA 3W64A 2ZHOA 1KLNA 2OPRB 2FHJA 4ECYA 2HBYB 1FJCA 2XMUA 4J9LA 5SZTA 3FBFA 2DKOB 3MPUB 3HI9A 1UVNA 3UN3A 1HIYA 1UKUA 2W7OA 2RH3A 3RBEA 5FDLA 1YZ6A 1HBOA 2EWHA 1AUSL 1AZSB 1KR4A 5KG5A 4K4WA 1H72C 1U02A 1X4AA 5F8MA 4USUA 1EKSA 4J91A 2ASJA 2CNOB 1ULRA 4K4UA 2AJ2A 3KJFB 3HT0A 4PUOA 1RT5B 3NG8A 3B4MA 2KT3A 3FRZA 1H3DA 2BEFA 3I31A 4JI4F 1J5EJ 1HARA 2YKNA 4M5JA 3OW2R 1DLOA 1U8SA 1RE1B 2CAJA 3GIMA 2Y9HA 3MPVA 4ZLPA 3RBZA 1QAYA 1T0TV 4U95A 4JOUA 4FP9A 1UVIA 5B0BA 4OMFG 3N6MA 3PRVA 2RD5C 1Y4ZB 2J0SD 3MM6A 2EG2A 3SMZA 2HWIA 1Q8BA 4OJGA 4TYAA 5JMNA 4V19X 2Z0GA 4B3RJ 3CCLS 2YKQA 3QT7A 1RAIB 2VF3A 2X1AA 2ILZA 5F9LA 1KQGB 3VF0B 4WK3A 4B3OA 1S97A 2B5JA 7AT1B 5M2RA 3PYGA 1RYSA 3VGSA 2QZ8A 4RLEA 2DGOA 3SSQA 3PX6A 4O3PA 2B4VA 1FWLA 5KFGA 2CJAA 3U1LA 3SQGA 5ETQA 3DRPA 3GG1A 1VQNS 3FEZA 1H6KX 1D8YA 3AT1B 3CJ8A 3OR2A 3W2VB 1HWJA 2VA3A 1EIYB 2GFFA 4O0IA 3AXKA 4ER8A 2Z56B 3CC4S 4LF7F 3M32B 3HT3A 5BYQA 1JWWA 1RADB 2R8KA 1KNZA 3J7A1 2D7SA 3S01A 3LGHA 5GMKa 1N36F 1CBKA 2NXEA 2QE5A 5KFUA 1RWXB 2IM0A 1VQOS 1URRA 1Q81T 1NJYA 2IC3A 4M8LA 3EZOA 3TVYA 2PGCA 4LFBF 4ES1A 5IM0B 1FRXA 4CO5A 1RT7A 4DI6A 2F63A 2MKKA 1EAYC 3KG4A 2NPFA 2ZWPA 4IR9A 5CCMA 5EWGA 2R4FA 4F0MA 5CZXA 1EETB 2MSTA 4DXLA 2B3TB 2HFSA 3MEKA 4C6AA 2L9WA 3CCMS 4W92B 4DUYJ 1IQTA 3UCZP 4MYUA 2M70A 3W5XA 4X4RA 3KJVB 1AYEA 1U7LA 2YPZA 5EX3A 3M2RA 4HEA9 3DLEB 4DQIA 3CJ2A 4EGLA 4AXJA 2ZHAA 1RTHB 5A0YA 1HBUB 2AW0A 4FS1A 2M9KA 1K0TA 3VGTA 4LRCA 4JI3J 2BX6A 3HFKA 1FF2A 4WBFA 1NPKA 3PKYA 3KLGA 5C5JA 2FGCA 2CQDA 4IR1A 1TL5A 2HPUA 1OY9A 2O66A 2VFSA 1U1KA 2VBWA 2UV8A 3I0SB 2FLOA 4IG3A 2MQOA 1M5SA 3OV7A 3EZUA 1MWQA 4ILLA 4NZ6A 4NCGB 4F4WA 4CTAB 2IRYA 4HHJA 4QIGA 2C2OB 4PAAA 1N6QA 2LLZA 2XULA 4QOTA 3DN9A 2EKYA 1C4AA 1VHIA 3R5BA 2HVEA 3DM2B 2HAIA 4KGKA 2IJNA 5JVHQ 3ZZ0A 2UUAJ 1RT1A 1RT4A 4NI2A 4RZRA 2AT1B 3VAJA 1S1UA 2DK2A 4MKYA 3TUPA 4YB6A 3Q24A 1FFGB 2BJ7A 2UUCF 1C1CB 5AXLA 3LP1B 1RHUB 1YVFA 2PSZA 5KFWA 4P7VA 3DRSB 2AZ3A 4EYHB 1R0AB 4CLFA 5D4PA 2VBZA 2KI2A 3KLVA 1WEYA 4DQPA 1SJ3P 5J2NA 1MMNA 2XMJA 3HVTB 3VZIA 1NDCA 2IJFA 2M4MA 3ETOA 8AT1B 3Q23A 1R8CA 3A4TA 4DR2F 3HHEA 3UR3C 3GP9A 1FHTA 6FDRA 5D4LA 3R5JB 3GIKA 2XS7A 2H9ZA 2LA4A 1CJTA 1U48A 4WFXA 4I67A 5A8WB 1XMBA 1SUQA 1OPZA 3V6HA 2F1FA 1UJ6A 1IWGA 3D4JA 2BJ1A 3H5UA 4WIIA 1FFWB 3CO9A 4W98A 2EI5A 2KHCA 3FKBA 4Y6IA 1TAQA 4TLRA 4FXWA 3KK2A 2ASYA 1RISA 5HJXA 3PDNA 4WCEQ 3PKMA 3RW6A 1REVA 2W4DA 4DR7F 5E3AA 2BBEA 1NZ8A 3TAMB 1S57A 4GVLA 4Q8FA 2HNYA 8RUCA 2HHHJ 2BUNA 4RU9A 3CDUA 1YJ9S 5DDQC 1S99A 3OLAA 5KFKA 1RTDB 4OLOA 1UA0A 2QRRA 3O6QA 4ETZA 1XR5A 2CNLB 4GC7A 2WB1D 4A8FA 1E6YA 3L09A 3DDKA 4LFAF 3BKUA 3F0NA 4M5HA 5DM7Q 3JSMA 3AJDA 5ETTA 3W3SA 4B9SA 1XK8A 1IUJA 3G71S 1YQHA 1S0NA 3QPIA 2BDPA 4P73A 3HPOA 2AQ4A 5MLCV 3QMQA 2QA1A 2AYGA 1RKJA 2HS3A 2R7QA 2YNFA 3FCHA 4OZ0A 5KFDA 1JKHA 4PXEA 5A6PA 2CQIA 1ZPVA 3SCLE 3ETMA 4ICLB 4P75A 2XY6A 4J9NA 2WVEA 1UW4A 3BO3A 2K1RB 2CPDA 4PPZA 2I5JB 5DDRC 3FFIB 2CQGA 2QO3A 1UPPA 4F3OA 3IRXB 4KGVB 1UVMA 2V8HA 5KFIA 1PYTA 3H4BA 3CJKB 2Y0SD 3CXCR 1B70B 4UUWA 1O5JA 2ZOFA 2V4JB 4M5DB 1TL1A 5GAGU 2MY8A 4YY3F 3NWGA 3M8RA 4A8KA 4BWMA 2HMIB 2DITA 2Q79A 4LSLB 4XAKA 4K0KF 3TWZA 3ENVA 5D8HB 2MEWA 5HMWA 4ECSA 4J9UE 2IFXA 4WK1A 1HW9A 3T1AA 1ZA2B 2UUWA 2YWGA 5ETMA 2IJRA 5A8RB 2F9JA 2EBGA 1JIHA 4A46A 2V67A 2XLIA 3MXHP 5HL7Q 3MAQA 2FJVA 3QWPA 4DX6A 2QLJB 2G0IA 4K2JA 1Q78A 2LEPA 2KN4A 4NZ7A 3OR1A 1RT3B 3OVAA 2J0XA 3AODA 1X4DA 3ZTSA 4F4AA 3BPSP 2DT9A 4I2QB 1SQEA 3DOMA 2YKPA 2IAJA 5K8MA 1PIEA 3ULHA 3W2VA 2J7KA 1PJ5A 2XZTB 3ZZYA 2MY7A 3RW7A 5LSOA 1U0HA 1P1LA 5E0OA 4CIOA 2CWXA 3HXMA 5J1NA 3W5YA 3W1YC 4KSEB 1VFJA 2J5AA 4TXSA 2DRDA 2IBOA 2B9XA 2C2MB 2PMWA 4C8ZA 2FUG9 2XG8A 1NUEA 3H5YA 4J9VA 5AJ3J 2P9GA 3AA9A 1H2TZ 3EGVA 1H0HB 4DOZA 1LW2B 3QBCA 3LWLA 3DLKB 3LALA 2HNDB 1RBOB 3G82B 4R5PA 1QLNA 2EC0A 1UJ5A 3Q8SB 3MFHA 1F5BA 2ZH2A 3RJMB 1C1BB 1DBDA 2H48B 2GMHA 3H98A 1V3SA 4H4MB 2AKWB 4DFPA 2LQJA 1NPPA 2HHWA 3OTOF 3M30A 1T03A 2PA3A 4NWBA 1Q7YT 3UDEA 1PBUA 2O01C 4OHWA 3Q8RB 4MKVA 1M5HA 3JQMA 4P2XA 5T14A 1GEHA 3VAMA 2R7XA 2JLGA 3GYGA 1BQNA 2CZ9A 2UUTA 5KTQA 4LF9F 1IR0A 5DG7A 2MJNA 4PXCA 1PGZA 4KT0C 1WI8A 2JC1A 1WSVA 1RTIA 5GADU 2R7VA 4JI1J 1U8WA 3Q8PB 2XI2A 3GG0A 5LJ3Y 5J2PB 4FF3A 3UFCX 1A6LA 3MAAA 4J5OA 2CVEA 2B4UA 1FERA 4A8XA 4FKYA 2QMUB 5HVHA 4LT6A 5B0AA 1M1HA 4ZLJA 3VCDA 5KFHA 1X4FA 4FXVA 2YWEA 5DGAA 5K14A 2V63A 3WZ0A 2FZCB 5KFMA 4B9TA 3UD3P 1HR0F 3CD5A 2CKWA 3RUBL 2R7TA 4G6VB 5AXMA 3S6EA 3KK1A 4JI5F 2N4DA 4IH7A 3E8OA 5K9FA 1BMQB 5H9EJ 3GFZA 4KBIA 5HATA 3PO5A 5C2CA 3DMJA 2DYAA 4WZQA 3MEDB 5HK4A 2OKQA 2XMVA 5MAOA 3KLEB 2XGPA 2ZDPA 3BGRB 2OFGX 2GX8A 2GIQA 4ZP9A 4A8OA 3CMES 1PBAA 4DN0A 3UI3A 4X62J 1FRIA 1UWBA 1MU2A 4C8LA 4O3QA 3H59A 3EE3A 2C2ZB 3A8JA 1FRLA 1WTFA 3SCKE 1RI7A 1S0MA 4DR6J 2E1AA 3HD2A 3HSJA 3MCOA 4ZCMA 4IOAQ 1NK9A 5A8WA 3M9OB 4LRDA 1YLXA 2JHEA 2LQ9A 3NGSA 1LXNA 1GX6A 4NLVA 4USKA 2ZJRQ 3F73A 1NRKA 1JXVA 3UW1A 4J9OA 3UDCA 3QZ8A 5IT9Y 2YQ0A 1NK7A 2D9OA 2QG9B 3ILJA 1N48A 1TKZA 3E01B 3KHHA 2XYGB 4DL2A 2OPSB 1HD0A 4RW9B 4DSIA 1MMDA 4XPCA 3JXOA 3MPDA 3ZZTA 3TAMA 1YJUA 4LBHA 3M7VA 2RQCA 3VGUA 3H40A 4LUBA 4DV3J 3KK3B 2WVFA 3QGHA 2KU7A 3Q8UA 4G1IA 4AE5A 2C1EB 3EVOA 5D6GA 3L7OA 1RWKB 3HD1A 3FSYA 3P49B 1OY8A 2HBRB 4G1QB 3R6GB 1WWHA 1L3SA 2APOA 4E8UA 2ROGA 2V8VA 4QWCA 1CS4B 4QR2A 4LRBA 3ILIA 5KFLA 2MZSA 2SXLA 3C15B 4RUAA 4BS2A 2WZ1A 2RT3A 1WTBA 4CLLA 3P4UB 5E3RA 3C16B 2MKJA 3DLBA 3I0RA 1A0OB 2DNZA 4P74A 2CPFA 4C8NA 4GVBB 2A6MA 2Y8YA 4IYQA 3NS7B 2AV5A 2E1MC 1YJWS 2K1RA 1AUDA 2RKIB 3W5ZA 2IBKA 4X4OA 4MFBB 4ZVQB 1S6OA 1NJZA 1MLAA 3MEGB 2NXCA 2MKYA 2W9CB 4HDHA 2V4JA 3NEKA 1MROB 2KRBA 1WKJA 3NNCA 3T1YF 3VV2B 3FEXB 4OZ1A 4FNIA 5E7OB 4DPUA 2HFOA 2NSCA 1VISA 3A8KA 4EI2A 1HHSA 5K5MA 2VKRA 4GKJF 4I7FB 2HNZB 2MQMA 2VFUA 1NDKA 2CQ3A 1S1VB 5DGBA 4ELVA 1Z2ZA 4JV0A 1U1RA 1EP4B 1LW0A 2U1AA 2YQ3A 1FDNA 4JBCA 2P8IA 4RX6A 4DV5J 2DHHA 2H4WB 3GWCA 4O3SA 2QLWA 1X4GA 4KR0B 4OI3A 3DI6B 1SBRA 1VC5A 4QYZK 4IDKA 3HLUA 1AB8A 4TY9A 2YKMB 4B02A 2M0GB 3H2UB 2W2PP 3H7HB 3MTJA 3KKFA 4JV5J 2BOPA 4CYUB 1KTVA 2RB7A 5A8KB 3MMAB 1C0TA 2LQ5A 3MMBB 2HQ3A 3QZ7A 4LF6F 1CJVA 1SL2A 3HSZA 3RYLA 2F3JA 2MZJA 2OP5A 2ACYA 4RW6B 2XBPA 3PXGa 2VG6B 1S9GA 2KTQA 2Y3YA 4DG1B 2VG5B 4L73A 1IKVA 1FJGJ 2KT2A 3TA0A 3BF4A 3CIZA 2BQUA 1S1WA 3LP2B 3M8PA 1WKKA 1Y11A 4P6QA 5HQMA 3NNHA 1RUSA 2YNHB 2GVZA 1F2GA 1WG5A 1LWCA 4GO7X 2KG0A 4QQBA 2FVRA 5KFQA 4A48A 1U49A 2IA0A 3N79A 5C2GA 1JLCB 5CABA 4EWTA 4JI8F 3BGUA 4ILRA 3TEGA 4UY85 1KDNA 2XMAA 2RU9A 2I9SA 1VIOA 2DH7A 1WDDA 4URSA 4JI6F 1B4SA 4I0WA 4OX6A 3G82A 3KLIB 5HO4A 2QV6A 2VFVA 4AL5A 4USJC 4P2FA 5HI7A 5L9XA 3PCOB 2R7UA 1S5ZA 4O4GA 3PW2A 5JVGQ 3UVJB 5FLXU 4UY8T 5CD4H 4ANDA 2CVIA 2G4BA 4LF4J 4A8SA 5M2PA 4NLDA 5HLFB 1VHFA 2VG7B 3C8YA 2HIQA 5F8LA 1VCTA 2AJ0A 4H4OB 5CYJA 2QFJA 2HHSA 3R27A 5C24B 3HKZD 4DV2J 2K06A 1GAOA 2ZC3A 2E44A 1FWKA 3OL8A 1TZ0A 4RW7A 3W8GA 2DEIA 3DOLA 3EDQB 1SB6A 4DV6J 1QSLA 3CEDA 2BYCA 3VGVA 3NXZA 1ZM4A 2M5YA 2ZHBA 3RBDA 4KQZA 3DXSX 1U1PA 4CLKA 4JI0J 3IFEA 2KYXA 1WHVA 4HH0A 1RDRA 4DDFA 1U1LA 1NK8A 3RR8A 3QJJA 4ZHRA 1F2HA 3BN4A 2LEAA 3N01A 5DO2A 4LFCJ 1FXRA 4LF8J 2N4CA 1X5TA 1FK9B 1LEOA 1VRTB 1R8AA 4X4QA 3N4WA 3L95X 2C2DA 4BHQA 4QIEA 1BLUA 4OYZA 2MGZB 4K8RA 3AD9C 4XK8C 3KDOA 1VI7A 2BRLA 3H5SA 1FO1A 1SJQA 1NK6A 1QTNB 2OO4A 2CZVC 4OYBA 1BD6A 2Y1IA 3MEDA 2HS0A 2GMJA 3JSBA 2VC1A 3SV4A 2DY9A 1UTAA 2HVHA 4DCOB 1QSSA 5KG2A 2BW2A 2HHHF 4ETXA 4TYBA 3CMQA 4NLYA 3PRDA 2IIHA 1TTHB 1RU2A 4GC6A 4DPYA 1NJIT 4DCJB 1FX4A 3ZTQA 1XNRJ 2VOPA 2HGMA 3KYLA 2DNNA 2CPZA 4Y65A 4OI4A 4IQXA 3P3DA 2ZZMA 4UZCA 1BWEA 2DR5A 1T9WA 4ED3A 4P10A 4ZP6A 4ECXA 2C3YA 4ZCLA 2BZ2A 3L3CA 3P96A 3HHDA 2AX0A 1G3OA 4Y28C 2FDNA 1TV6B 4J9KA 1CVJA 4UUXA 3DGPB 2R3VA 2QFIA 5HMZA 3OFEA 2O3DA 2DO4A 3DU6A 5CHCB 1TL4A 1KN6A 2EEYA 4ZJQA 2E29A 2DPIA 3LGNA 4KH0B 4QWEA 1KOHA 2FZKB 1RT6B 5G0RA 1KBRA 1K0VA 2ALYB 1C0UA 3KK3A 4USHA 3LAMA 1DTTA 4XIUA 5E3CA 3RB3A 4YDXA 3H2VE 5F8NA 3OUYA 4UW2A 3D0GE 4ZVHA 4DV0J 2OD6A 1KFDA 4YR3A 4G1QA 3ZZZA 3OSPA 3ONQA 5FD1A 1N88A 1R0CB 4AD6A 4V1Ak 2C3UA 4YB1P 2OAUA 1NAQA 5F41A 3CVKA 4F4XA 2V8GA 3CCWA 2CPIA 4NCAA 4UOHA 2MLYA 3TR5A 1ICEB 3M8YA 4WKYA 2PFFB 1CJUA 3HVWA 3M8WA 2XCPA 2X1BA 3C16A 3IG1A 4DCPB 1HFEL 5J2QB 2E7VA 5EHHA 3MZIA 3HZEA 2HWHA 1C2PA 1O51A 4NOHA 2HYIB 2QA4G 1NK5A 3R3TA 1SKSA 2PO4A 2B6AA 5LMUF 3RB0A 3DRYA 4AXIA 1JLBA 2RKIA 2Q3PA 1WSRA 3V6KA 1X31C 1WEZA 4MFBA 4WU2A 3GJQB 1BQXA 3HHKA 3C6UA 4I6YA 2BANA 4Z7YA 1WJ9A 3IS9B 1U45A 1SIZA 2W9CA 2D3OR 1KQKA 4DR1F 1MNEA 2YTCA 1KRPA 2O67A 4PXDA 4JV2A 2CQBA 1NJWA 1TMMA 1RTJA 3U27A 1FDDA 1H7XA 2HBQB 1NO8A 4I7FA 5L1LA 1OSCA 1DARA 3CDWA 1S1VA 2AYBA 5B0CA 1JLGB 2RRAA 2RNEA 4G3IA 3CCSS 4RWXA 2JH3A 3PTWA 2MQLA 1UZHA 2K3IA 3LPYA 3SI8A 4JI4J 1NKCA 3J7Z5 2W01A 4FDFA 2YKMA 3RAMA 1Q5VA 4IOBA 4CO3A 4PQAA 4PABA 1RLDA 1S9EA 2LU1A 1F5AA 5A8KA 2HW3A 1W2IA 4MAKA 1EB0A 3KMSA 2YNGA 1U09A 3BYPA 2DNPA 3BB5A 1LWEB 1UVKA 1B0VA 4F7VA 3J7ZT 3JAMY 2XHWA 4DG1A 1Q16B 3NGUA 4B3TF 1HBMA 2GGPB 3ENQA 2KVQE 3TYTA 2ATCB 5E3PA 1VC6A 3PFEA 3RB6A 2G2ZA 3K57A 1E6VB 1S0VA 4NLQA 1SVDA 2UXBF 2YNHA 1S6PB 3LUYA 2JFKA 2W9BA 5L8RC 3G2XA 2QTWA 3RBXA 3EGZA 1GX5A 1PC5A 4RUBA 3RTVA 3CTRA 3KG1A 5ETNA 1JLCA 1F60B 1JLEB 1QY7A 4QIVA 1NDLA 2FLNA 4RBVA 4MJKA 1RAAB 1VBZA 2RDJA 3C3LA 3KLIA 4QPTA 3OXLA 4KHMA 2LDIA 1XC9A 1JLQB 2AJQA 1TKTA 2BXJA 4RUHA 4XO0A 1KP6A 4RW8A 4ZMMA 4PCQA 2EPIA 1SC1B 2V4QA 3MM9B 1NSAA 3WBZA 4LF1A 1FNMA 3LANA 5KFCA 3W9HA 5DS7A 1LFPA 5L39A 2FJWA 4LQ9A 4ECQA 1NBEB 4R0JA 3PY8A 4IOCQ 3HJVA 4EBEA 3K0JA 2G1HA 2B8QA 3BGLA 1IBMF 4Q2MA 1N5YA 5DETA 2AEJA 2MMYA 2NXNA 4NPOA 3W60A 3SV3A 3QO9A 4LFBJ 2OD4A 2N7YA 4TKTA 7FDRA 3DOKB 4L76A 1TFWA 3H0PA 3N6NA 3Q8QB 2W25A 2ZZNA 4DEZA 1FESA 5GVQA 1RU1A 1NK0A 2AYMA 3DRXA 4LVNP 3O3LA 1SKWA 3QGPA 1H98A 4IUFA 3R1LA 4DR5F 1XBWA 4HTIA 2GNKA 4C3LA 3N0VA 1EQMA 3MWBA 4Q44A 2YX1A 2WTFA 4DHVA 2R8GA 3ICLA 2DJWA 3HM9A 5J1EB 3FVYA 1CQMA 1IQZA 2GIRA 2OSRA 1WHYA 2EBEA 5LM7E 2MLXA 5DLGA 1LOUA 4B3MF 2OPQA 2E1PA 5DQHA 1VQ6S 4ED4A 3CWJA 4LSNA 4F2RA 2H54B 2YX7A 2JNJA 4Z2XA 1CJKA 2ZJQQ 2HRTA 3C6TB 4HACA 3I5CA 3BPDA 2IMWP 2DHAA 1TL7B 2GC8A 1NLKL 4ITSA 4OX8A 2M52A 3MEEB 1SH3A 4DSFA 5LT5A 1XR7A 4DFKA 4PPDA 3IWNC 1FKPB 1DQ9A 3W9JA 2QMWA 2A3JA 5DG8A 3DLGA 4CH1A 2DO0A 1T02A 4PG7A 2RJZA 1S10A 4O3OA 2CDRB 4P71A 2W2MP 2KZMA 2LQ8A 2DNQA 2UUCJ 2ILYA 2DNRA 2LFVA 4A47A 4WPAA 4PG6A 2XTJP 1TV6A 4PG5A 3X1LB 4R0EA 3J7AN 1S1TA 3M9NB 2ZH6A 5CA5A 1FVSA 2FVQA 1ZM3A 2XMTA 2MPUA 4DR2J 4CM2A 2E5IA 1HPZB 5K8PA 2AHOB 2XMKA 1P27B 5KG1A 1X9WA 2IVYA 1G1XA 4QU6A 4C0HA 4F4YA 3RG6A 1FTRA 4Y2MA 4USVA 4LSZB 4PWUA 3PO4A 1EQ0A 4WZMA 1T11A 4PG4A 3Q83A 3BKFA 2GHVC 2CJ9A 1DZ5A 2HK3A 3F56A 4C11A 5A2QY 3UCUP 5G4DA 4DPXA 2BE2A 4PQUA 1IVZA 5FDLB 1VK8A 2WB4A 1HBNB 1HBOB 5B09A 3D66A 1S49A 2FVCA 1BC6A 2W2QP 2AU0A 2YKOA 1HMVA 3DRRB 4DR7J 1S6QA 1WC6A 4ZIVA 1VQ4S 3B54A 2JLFA 2V4RA 2P2CB 1WD6A 4FYYB 2OMOA 4OL8A 2KYZA 4NCBA 2L48A 2Q1LA 4ZPTR 2MJUA 2I1RA 3AOAA 2M8DB 3HX9A 1FCAA 3QFHA 1L3TA 1LK7A 1M5KC 4YMEA 5A76A 2YKNB 4ECZA 1FDAA 1DLOB 5KFTA 1HWUA 3BV8A 3GIJA 4LFAJ 4DLGA 1NCLA 5DM6Q 2W8KA 2VC0A 2OEKA 4QW9A 4CO4A 2R9LA 2CZ4A 1SJ4P 2P5VA 3MM6B 1AFIA 2RMLA 3V4MA 1NH7A 2KXHA 2YH0A 3VZHA 1HL6A 2Z58B 4ZPBA 3BSNA 2XZDB 5GMDA 1RWOB 1N34F 1X4HA 4ELTA 1Y9OA 1Y3JA 4HKQA 3SIPB 4B3OB 1H73A 5DG9A 2JVRA 1U4BA 1OYEA 2B5JB 3QWUA 2WW4A 4KC5A 3NAIA 2R7WA 4YB7A 2ZH7A 3CCZA 1JLFA 3J81j 2PI5A 1W25A 2VFRA 1OO0B 3SCJE 2UU9F 2VODA 1FI4A 3SQGB 1UFKA 2YWWA 1RXOB 2AJFE 2V2KA 3MPWA 2RQKA 2G2OA 3KUHA 1U6ZA 1YJRA 4X64J 1F1BB 4ED2A 2JDJA 1AFJA 4ZCIA 4IFVA 4YY3J 4X4SA 4DUTA 2M3DA 2JZ5A 2I0XA 3O1LA 2EFOA 3G86A 1V6HA 4K0KJ 2LMIA 1N0VC 1NNDA 2NCKL 4YN3B 1FKOB 2VOOA 1FWPA 3TX0A 4OI0A 3D0HE 4NA2A 1TELA 5KAKA 5B0GA 2GGPA 3TUZC 4B17A 3HSDA 3OJUA 2DD8S 4ZPAA 4ZVFA 3OTEA 1UEVA 1E6VA 4DS5A 1AROP 3VALA 4I56A 2IC3B 3GONA 4O3NA 2DCLA 3J81U 3EGWB 3BSCA 1GK8A 1S76D 3VHQA 3MMCA 2NXUA 1RT7B 1HLWA 2EXUA 2WVDA 2EFPA 4OJ3A 2IA6A 4ZVSB 3N5FA 1JLEA 1GFWB 3Q8YA 5DZ7A 4MKBA 4C8OA 2XSJA 1O6XA 2HKEA 3EICA 2HS4A 3I55S 3OL7A 1RHKB 2VFTA 3CO0P 1T9UA 3M2RB 1T3NA 4JV1A 4FN5A 4DR4F 4TU7A 1RCXB 1VS3A 1DQ8A 2W4PA 5A0YB 4NLTA 2DHXA 3CJ4A 5F0WA 5ITHA 1NXIA 4NLSA 3BH6B 3POTA 2QMXA 2KL8A 3E51A 3PW7A 5IV3A 2A1BA 1RBLA 3MD3A 2Z8QA 3KLGB 1M90T 4PWDA 5M2UA 1GNKA 3CCQS 4I68A 1O0PA 3TAPA 1BY9A 2CQ1A 2BV3A 2BJ3A 3EPGA 2OMLA 3MR5A 2X3DA 4RW4A 2DHSA 3NGKA 2RRNA 2FLLA 3V81A 4P72A 2C22A 3I96A 2VICA 5K8OA 3OVSA 1RWNB 1N6QB 4Y34A 3VWSA 3OTOJ 1XNRF 1ZZNA 4BCAA 2MDAA 3N9UC 3CD6S 4WXWA 1RT1B 1GMVA 2ZEJA 1WHXA 1RT4B 5A6WA 4OI2A 2K3KA 1Y5IB 2IM1A 3BDEA 3SCIE 4ED5A 4JI7F 1S1UB 2G13A 3ET6A 2N3OA 4LIWA 3VAGA 2H1YA 2LQBA 2AWZA 2CPYA 4QCLA 2GO9A 2J0WA 1SI9A 2ROEA 2KT5A 2HQCA 1ZA1B 3MUTP 2HLTA 3HJFA 1WF1A 2W9AA 4O0NA 3HF5A 3G6VA 2WONA 3TZZA 1UFLA 1YZ7A 4CLSA 4KFBA 3BJYA 1RSCA 2HEKA 3SSRA 4MKAA 3HO1A 2ROPA 3UD5A 3SFGA 1S1XA 3C14A 2PIIA 3OQ2A 5DQGA 4HH1A 4C4WA 5ADZA 1OSDA 1Q1KA 3FEYB 3PW0A 1CJTB 4OX9J 4GMKA 3IR5B 1IKYA 4QBUA 2P6TA 1SUQB 2PEBA 3G6ES 1HR0J 3KJQB 2VDIA 1L5UA 2WRMA 4JI5J 2XNQA 3N28A 1R43A 2WCXA 1FKPA 3KK2B 4OQJA 3KLFA 3R9LA 1VQMS 1DRZA 2HRYA 4AL6A 1K73T 1QAJA 1WC3A 3PEJA 2DR6A 2MQQA 2EKNA 4USMA 1T94A 3IP0A 1MN7A 2FC8A 1V3RA 2HNYB 2GHWA 1APSA 5F3TA 1VQKS 5AT1B 4QZVB 1ZETA 3CJRA 4I4BA 3OXFA 5LSRA 3FGVA 5BXIA 1KLMA 3OFGA 1H7WA 1E6YB 3VTIA 3JSMB 1NKBA 2ZKUA 2XS2A 2PD1A 3VQTA 4DSJA 2W2OP 3O8WA 1HWLA 3OTCA 5KFRA 3VAFA 1OMSA 3DYAA 1IR1A 2IRUA 1K9MT 4FF1A 3NS5A 3J7YI 2Q66A 2G9OA 1VQ9S 1X4BA 3ILOA 2VA2A 2GV1A 5CYQA 3FRYA 1HBNA 2YNFB 1J2VA 3AXMA 1JKHB 1EHWA 3WQPA 1S7HA 3DRRA 5HVGA 4C0BA 4KGXB 4O4RA 3UCGA 4FBUA 1VRQC 4DL6A 2EK1A 1D8ZA 3U02A 3LOUA 4KHPF 3PYEA 4CO2A 4OLPA 3QGIA 1GXTA 2FJEB 3QQCD 2CQHA 2PC6A 2R7RA 3QRRA 1XEZA 1TL1B 4ED7A 2GHPA 5I3UA 2ZE2A 1QJHA 2M7SA 1T3OA 2HFUA 1UCNA 4F4ZA 1X0FA 3BS9A 4Z37A 5HMYA 1KEKA 4CLZA 5D77A 4X4TA 1S77D 4C7QA 3BYRA 3OSNA 3R2CJ 2ZBIA 4B08A 4ECRA 1QUVA 2PDAA 1OIAA 4EBCA 3H90A 4U9RA 1HA1A 2MYFA 3JB9k 2DNKA 3P5TL 2DNYA 4IO9Q 1F0XA 3CIMA 1TKDA 4N77A 1RA6A 3NKYA 3M6WA 2FHMA 4M1KA 4X65F 4PYDA 2YX4A 3LA0A 4NLXA 3OR1B 3QT8A 1GMUA 2F8HA 2WVBA 3DOMB 4M5MA 2IAJB 4XTTA 1HQEA 3DXBA 3M2VA 3T1YJ 4DV7F 5ETSA 1TP7A 2ADBA 1UVJA 2R7SA 1FE0A 4K4SA 1U0HB 2POKA 2J0QD 4CDIA 1X0PA 2LCWA 3BR9A 3UNYA 4GKJJ 1R89A 4X4PA 2XNRA 3QRQA 1FKOA 3IA0A 4F0KA 1GQEA 4UQTA 5ETVA 3TAQA 3SEOA 1YSJA 3DHWC 4DR3F 3ZNJ1 4PG8A 3L9ZA 4EK2A 3RR7A 2L9NA 3K17A 1QAXA 2WW8A 4NRUA 4DX7A 3HKWA 4R5PB 2QL5B 3MM8A 4ZS6A 1MN9A 1WELA 3DKDA 1T9YA 3PVXA 1N5SA 1YBUA 5F8HA 1NU4A 4LF6J 1TU0B 1Y7PA 3GILA 4HLBA 2E1CA 3AJ1A 5I4MA 3TEHB 3M30B 1WOPA 1T03B 3OPKA 4KHRA 5CCLA 5DLFA 5KFXA 3CJSA 4DSLA 5ETOA 3TJAA 2Q43A 2VKZG 4C98A 4WKRA 3KLHA 4PR6A 2FHJD 1RAGB 2DY1A 1QTMA 1KVJA 4JUZA 3VVTA 1BQNB 1RJJA 4OI1A 3WIUA 4LF5F 1HNZF 2Z2LA 1PSDA 1DTQA 3EVMA 1RTIB 5D4OA 3RZAA 2BJEA 3FBBA 4KKOA 2KJVA 4ZP8A 3QAUA 3D28A 4JI8J 3MAAB 1YJNS 1KD1T 4CO0A 4Q5VA 1RHJB 1LWFA 2QX0A 3D1QA 4JI6J 1NPRA 4IFYA 3G4SS 3H4DA 2CNKB 1FJEB 4BWJA 3GPAA 3M8QA 1KONA 5K14B 1JNZB 3VAIA 3IBFB 4EO6A 2H5EA 5KT4A 3CJTA 1BHNA 4P2MA 4TVAB 3OLBA 3FK4A 4I2PA 1SPBP 3KK1B 5BJRA 3M4XA 4ZN1A 2E5GA 3O5TB 4ELUA 3DMJB 2KFZA 2CQ0A 2KXNB 1R6VA 3CUNA 4ID8A 1HNXF 1ROFA 3R7BB 1UP1A 4ID5A 5LSLA 5KFSA 2Q6CA 2XB2D 1YRXA 1ZS6A 1ZH5A 3AFGA 5AXNA 1KC8T 3GV8B 3ITHA 4KV8A 3A13A 1UWBB 3LP0B 3UO0A 5B08A 3BO4A 1MU2B 4JYAF 3MECA 2LECA 3IR7B 1MSWD 3JYTA 5CXTA 4M95A 5T7LA 4DU7A 4F3MA 4FVCA 4LRAA 3HULA 1NM2A 4KRWA 2W8LA 2OIHA 1CG2A 1QAIA 2V8PA 2RAQA 5K8NA 2RS8A 2H65B 3MM7B 2XHCA 3D6MB 4P52A 3C46A 1WC4A 1WF0A 2XS5A 1CQNA 4ERDA 2E1RA 3R7SB 4ECTA 1S79A 3P5BP 2KFYA 2IDLA 3FJ2A 1SL0A 1Z2LA 4NL5A 2VQEF 1QDUB 3SDEA 2U2FA 1N32F 4NE9C 3VVUA 4C8KA 3UDVA 5E33A 4CWBA 2J6UA 2J7UA 2KM8C 4L6V3 1TKZB 4J7CA 2VONA 1IM6A 2EK6A 3BBBA 3AH6A 2XZWA 4A8WA 2NUUG 2WOMA 2KG1A 2BKOA 2WBMA 1UL3A 4DPOA 1UWAA 4ZVUB 3K5PA 1NJXA 2QLXA 1UZDA 1XJWB 3M6UA 3QLHA 4HTJA 4TNOA 4OFZA 1CC8A 1N5QA 1U2RA 2KB2A 5EX0A 4OJ1A 2E5LF 4HT7A 4M5KA 4CLYA 4K4TA 2GAGC 4OI6A 2MKIA 3HP6A 5LXRA 1MW7A 3IWXA 3PJXA 1BXNA 2ZH4A 3K5MA 1TAUA 2ZFHA 3KNGA 3NY0A 4QJVA 3IGVA 1FE4A 4B9VA 3I5BA 3S7RA 2XC9A 4CZCA 1IJEB 2V68A 3MTKA 3R97A 2J6TA 5LMNF 2OI2A 2JWNA 2KO1A 3PW4A 1GT8A 1MG7A 3I0RB 3G6YA 4LJMA 1UAWA 1J5OA 4ZVRB 4J9MA 3T5KA 4ZLLA 3HVAA 5F8GA 1IKWB 2YBVA 4C3KA 3OBIA 1NB7A 2R8IA 3IC1A 4B3SF 4WFZA 1YBTA 4LBIA 4DF8A 3A8EA 1R8BA 2DR8A 4USIA 3K89A 4DUZF 2HQGA 3QJLA 2L41A 1ZM2A 3KXDA 3NLCA 3BDPA 4M63A 2ZJPQ 4QYRA 4X64F 1RWMB 2HRUA 2WBRA 1HNIA 1YHQS 3M2UA 1I6JA 3I6PA 5F9NA 4C0OC 3B6BA 1PAEX 1R6YA 3PACA 1R0BG 5I3PA 1IM4A 4NLRA 3W9IA 1VLYA 5L38A 3IM9A 5D0HA 1JMTA 2ASDA 1JQGA 5IOLA 1LW0B 3L4BC 4NLUA 3PYFA 2W7AA 2Z57B 1ZTWA 3B82A 5CYMB 5DJBA 4OIXA 5I42A 1VBKA 1JLAB 4IDKB 5LMUJ 3P6YC 1IWAA 1ACMB 1XNQJ 3QSIA 5DQIA 1C0TB 2CJKA 2JVOA 4KY3A 4CP5A 1JJHA 2ZH8A 3PG9A 1CJVB 7FD1A 1HNVA 3KJNB 1RZMA 1WC5A 2Z4PA 2ZH1A 3TUIC 2YKAA 1S9GB 4DR1J 1VQYA 3T5LA 1DURA 2UVWA 3PX4A 1IKVB 1X60A 3JSRA 4XDCA 4F02A 3FNNA 5KG6A 2KFNA 1S1WB 2DR9A 2EFGA 3M8PB 3TZWA 1VQSA 4OV6A 4Q0BA 2MZRA 3IO1A 2GVZB 2W1BA 1Q82T 1LWCB 3MI7X 4UT4A 3LF0A 4FYDA 2DVIA 3I32A 4KGMA 3JTOA 2IPOB 2YWHA 1F9EB 2OEJA 3RAQA 3D68A 4OYOA 1Z1ZA 1V5VA 2LDYA 3GQCA 1GXLA 2AGPA 4WIQA 4TLQA 2YH1A 2Z30B 4WFYA 5KFOA 2FIUA 2LXIA 3PV8A 4CM0A 3GFYA 1O8BA 2D3ZA 2ZD1A 1SJFA 2RDIA 1A9NB 4O4GB 1FRHA 1PILA 2RQ4A 1P1TA 2UXDJ 3BH7B 3R5DA 4B3TJ 4L72B 1PCAA 4AFFA 3Q89A 3NOCA 4DMZA 3PIOQ 1Y10A 2CJBA 1PJ7A 3QATA 3QT6A 4PZVA 1TL3A 3NCQA 2HHXA 4HI2A 5AE3A 2UXBJ 3D1OA 4QWDA 5B0EA 1XMQJ 2Y8WA 4RW7B 2FJXA 1WKLA 3DOLB 2DXFA 1TK0A 3T9ZA 1W26A 1NHKL 3DDNA 5D0RA 1S6UA 5HJYA 2MKCA 5D3GB 3K59A 4D3HA 4QW8A 1FX2A 5KOWA 4ZHRB 2NLWA 4Q2LA 2J76E 5SUHA 1X4CA 4OX9F 1SIWB 1KTQA 2N7CA 3JQKA 5H1SV 4FKXA 2PA8D 2V34A 4FYXB 1VJQA 2HFNA 3CGIA 3D2WA 5IZHA 3PX0A 5JUMA 2XWXA 2JJ4D 2GZOA 1IJFB 3M1VA 3GR0A 1OPIA 1KFSA 2J8AA 4K7QA 2HHVA 2XGQA 4NMLA 5FLXY 3MURP 4WJBA 1EKRA 4CCHA 2VD3A 2XCAA 2QGFB 2EFVA 1IBMJ 3ZO7A 4AT1B 4O44A 2JEGA 3MUMP 3NGDA 4P2SA 4F36A 1DAXA 2DIVA 5L1IA 4NEZA 4R8UA 1I94F 4U8VA 4A8YA 1ZYQA 2KH9A 3NGRA 2EW9A 4N7TA 1N5VA 4OYIA 4EFAC 5RUBA 3LP0A 5A2QU 5HBMA 3TZXA 1TFYA 3G8SA 2DCUB 3R5GA 1FJ7A 4HI1A 4DQSA 3UN5A 2HVDA 1B3TA 2C3MA 2P9EA 2QA4S 3MM7A 1DQAA 3J80Y 2NZ4A 4DL5A 4DR5J 2LVWA 4CRJA 4FZVA 4ZJLA 5C25A 2NREA 4W90B 2N82B 3K8WA 2WSEC 2I8EA 2BQ3A 1VRUA 3EXCX 1J27A 1BE4A 5H9FK 4IG0A 4CO1A 1OY6A 2DGQA 4BC9A 3BM7A 5IV4A 4ES2A 1SQFA 2HHQA 4B3MJ 4B9LA 1U6BA 2YVSA 3PM9A 1TK5A 3GIIA 1FNXH 1AXQA 2OSQA 4LREA 5DZ6A 2RS2A 3H8YA 4C2MA 5G0RB 2HWTA 2XY7A 5IT4A 2J9CA 4Q43A 1C0UB 3ZC4A 2GA7A 3KTQA 5IS2A 1NZAA 2FVPA 1DTTB 2YQ1A 1C4CA 5EWEA 1LFWA 3OUYB 4DL4A 2C2NA 1DY3A 3M6VA 2GJ2A 2CADA 2XLJA 3BZQA 1LK5A 4NA1A 2G0CA 2BR0A 2CA9A 4BLGA 1TVRA 3T19A 2QIFA 3PIPQ 3BR8A 4DQRA 3GCXP 2F9DA 3DLLQ 3DNCA 2IYGA 1Q95G 3K5OA 3A8IA 3LH2S 2FQQB 4DV1F 1CJUB 3IG1B 3BSAA 2UV8G 1NH8A 3ISZA 3PW5A 1TKXA 1IKWA 4ZK7M 2B6AB 3I9ZA 1GXUA 5DDOC 2ZITA 3LGMA 2YXLA 4KH1B 4FNHA 1JLBB 1VK3A 3HHNB 3GIRA 5HQLA 3MAHA 2JOQA 3TX8A 3NRBA 5GMEA 3Q8VA 1LQ9A 1WC1A 4WU3A 6FD1A 5H9FJ 3C6UB 2BW7A 2BANB 4JP8A 2FGOA 1ZAXA 2CFXA 3VQSA 3KHGA 4NA3A 2KKHA 1RBAA 2M2BA 2ZUAA 4BBYA 2HHTA 1S4FA 3MF5A 2X1FA 3I82A 1RTJB 2V69A 3ENWA 2AGQA 2KVIA 2WVCA 1N56A 1WUUA 2V94A 4ECWA 3W2WA 1UFWA 3HHLB 3GJTB 1SXLA 2VPZB 3UNGC 3CSKA 1KWMA 2F8EX 3N5BA 1SJ1A 5CYMA 2HZAA 2NQPA 2F40A 2D74B 3V4IA 3BBCA 3GMGA 1JLAA 4IRCA 2F65A 3M9MB 4M5IA 3G96A 4E98A 1RWUA 1WC0A 1S9EB 3FZBA 1Y5NB 1HWIA 4K50A 2LP4A 5AXKA 1VQ7S 3VAHA 1H2UX 3WIVA 1TK8A 1WDTA 3MCSA 2YNGB 4W4MA 2B8PA 3BEGB 4RNMA 2NSBA 1PYSB 1U1OA 2HSEB 1JJCB 1ZAWA 4NLWA 2HQIA 1CULB 5DRKA 4EYIB 1LV5A 1HBMB 3T9NA 1N34J 1F9HA 4X4NA 2F7VA 4CLTA 3J7YU 1GMWA 5J2MA 3HMJG 2ERRA 5IC4B 2F4VF 3DHXA 2QLFB 2PT0A 4MMOA 2B0GA 2W9BB 2D9PA 2I38A 2WAQD 5JJBA 2DNMA 4LQ3A 4TY8A 2HGNA 2UU9J 4NXMF 2E9ZA 2ALZA 1NSPA 4WYLA 1FRKA 2V0NA 3X3UA 2HK2A 1JJ2R 1XTZA 4MIBA 1T05A 5HP1A 1IKXA 3BKTA 1FRMA 2MXYA 4FBTA 5BYSA 1RT2A 3MGJA 3O2IA 2VBXA 2NYHA 2BM0A 2QEXS 1TKTB 1VLOA 4RW8B 2V9KA 3TNVA 2QA2A 4F67A 4K4XA 1ELOA 2IY5B 3MD1A 1LNQA 2DISA 3HSGA 4QYZJ 3QIPB 5HROA 2YNIA 3ZZOA 1RB0A 4MT1A 1KQSR 2O5DA 3IWLA 2PE8A 1N5YB 3TZYA 5KT2A 1Y0HA 4KYZA 1QVGR 1XMOJ 4QWAA 4NRTA 3QO9B 2OLWA 4ED8A 2AP6A 3CD0A 5E41A 3GV5B 2VZ9A 1U2CA 1CEZA 2RHSB 1KSPA 4MYTA 5GAHI 3DC2A 5D3GA 4ECVA 1NSKL 5U47A 3B8HA 2DRAA 3C19A 2A0FB 1XN9A 2GS8A 1YI2S 4AQYF 3Q2SC 1RCOB 2OPPB 1U1MA 1FT8A 2E9TA 2UVVA 4DR4J 1S59A 1PO6A 1PC4A 3BBFA 1Q7LB 4DJBA 3P45B 3KHRA 1ZBTA 1YIJS 4DQQA 2ZUGA 3KDNA 2KHDA 4CH0S 3OVBA 2BJDA 1HYSA 3T5HA 3TANA 2NS1B 4USWA 4OYMA 2OPQB 1UMJA 2RIJA 3A12A 3THPA 2HFZA 4L3KA 1LXJA 1GTEA 4LSNB 4C8YA 2NYIA 2GJFA 1XERA 2R2RA 1VQ5S 2AIRB 1CJKB 2ABYA 2Z2YB 2MQ8A 1SV5A 4X84A 1PKUA 1AT1B 4HACB 2ZH5A 1W2BR 2PMZD 1KKHA 3MOZA 2DGWA 4EU0A 3FSXA 1DHMA 2BQRA 3D67A 4U7CA 1IBCB 2RF2A 2MQNA 2IHR1 3ZFVA 2GVDA 3DLGB 1VIXA 1YGYA 2MHNA 2MZ1A 9ATCB 3KUEA 4ZITA 4DFMA 4Q8EA 4JI7J 2B9YA 2BVZA 4YS2A 1M5OC 4OHZA 1TUGB 1AA1B 3SYZA 5HN0A 2PMHA 2ZM6F 2XM3A 5F3ZA 1SH0A 4FS2A 3QIDA 4HDGA 4KGZB 3JTPA 3UWTA 4CT8A 1HNWF 1GMWD 1X7VA 1AW0A 1S1TB 1BGXT 5C42A 4DWIA 4DX5A 3HHLC 3GYNA 2WK4A 4IQMA 1NKEA 2NXJA 1SL1A 2OPRA 1S72S 1KQFB 2CG8A 1IBKF 4F2SA 1EARA 3JSYA 1UEKA 1RQ0A 1D3WA 1OQ6A 4QU7A 2I6WA 4P7TA 4C11B 2BE2B 1UEUA 2R2UA 4PQUB 5EN1A 1WG1A 3FC9A 1RWWB 1FRJA 2VB6A 2D41A 1AZSA 1HMVB 1S6QB 2GMLA 5EWFA 2IVMA 3MM5B 4U7UK 4F50A 3ZTOA 3Q0AA 3AD7C 4F25A 2VPYB 4KPCA 2FJBB 4IKAA 1KS2A 1RT5A 2XO6A 2K7KA 4E0DA 2C28A 2GQCA 2CDQA 5EUHA 4N41A 1XNQF 2IM3A 3TW0A 4MH8A 4C97A 3DLJA 3GE9A 3CNQP 5IQQA 4YQWA 1JNRB 2NR0A 4DS4A 4J9QA 4ZVEA 4I64A 1YRTA 4UF4A 4USTA 4H54A 4ALZA 2CRLA 2V9WA 2E9RX 4QPXA 2UUBF 3C2PA 3R5CA 4WP3A 4EO8A 2AGOA 4WXOA 1W7WA 2XYPB 1OJ4A 3TOQA 2ZBCA 4EZ6A 1R27B 3JTNA 3HHLA 1JLFB 1M5PC 2EFQA 2CIMA 4RJVA 2HIYA 3QNWB 3QRPA 4KHPJ 4ZVTB 3F41A 4P9SA 3D3BJ 2YWFA 4F3QA 3GSDA 2MZQA 4NYOA 3V2UC 3S8SA 4K5SA 1RHQB 5L1JA 3T1HF 2AEFA 1RAJA 2G0JA 1VBXA 4AL7A 4IFVB 4K59A 3IBWA 2PFDA 4PWWA 1T9VA 3AY0A 3KNAA 4UZBA 1D9DA 1UA1A 1HI8A 1X5SA 4FPIA 3M32A 3KFWX 5JXSA 2BACA 2UXDF 1CULA 3GV7B 3WX8A 4NLPA 1ZPWX 4QR0A 2B4OA 3TARA 1URNA 3BGOP 3LW5C 3SFUA 1IN0A 2FLPA 5H9EK 3AB4B 1N0UA 2AX1A 1XMQF 2OFHX 4X65J 3MMCB 4ZPWR 2F4FA 5IM0A 4DPWA 1P9YA 2XMMA 3IR6B 3MPYA 2HBZB 2WSCC 4WTOB 1I1GA 1HW8A 5BYRA 2FY8A 1EETA 2XSJB 4DBQA 4DV7J 1JJ4A 3MCMA 3NNAA 3KJVA 2HZCA 5HANA 5BR8F 3H2LA 2Z2MA 3D54A 3M8ZA 2NZCA 3DLEA 5HMXA 3G8TA 2VPWB 4PKDB 1M5VC 2RVJA 3F44A 1RTHA 1HBUA 4CLWA 1RAHB 2X3GA 2UXCF 3POTB 4HR2A 4F0HA 3CT9A 1JXEA 3IN5A 2CJQA 3QIPA 4PWDB 3MR7A 2JSXA 3IXQA 2Y1JA 4DR3J 2J8SA 3U7JA 1B0TA 4RNNA 5HAOA 5IWAJ 3UR0A 3MR3A 3AAWB 4X66F 2AZ1A 3DLHA 4RW4B 3KUGA 3I0SA 3QAEA 2GCFA 3FBEA 4NMXA 4ATNA 3V81B 4QIWD 1KVKA 1ZOTA 2ZDOA 2IDEA 1CC7A 4NCGA 4CTAA 5D15A 3J81Y 2A6OA
chains in the Genus database with same CATH topology
1FXRA 2VQFF 3TO8A 2L9DA 5KFBA 2N4CA 4OZJA 2W4CA 1X5TA 3OLBA 1FK9B 3Q2TC 4K5RA 2DNHA 2C42A 3DM2A 3L7PA 4IH6A 1VRTB 4I2PA 3KK1B 1R8AA 4Y2IA 1WHWA 5BJRA 4CT9A 4X4QA 3M4XA 4IO1A 3LWMA 3N4WA 3MFIA 3NS6A 3L95X 2OPPA 2C2DA 2ZNZA 4O3RA 1GTHA 4BHQA 4RUCA 4QIEA 1BLUA 4XK8C 2DGTA 2MGZB 1VI7A 2E5GA 3O5TB 3V5RA 2FB0A 4ELUA 4URQU 3ZZRA 2BRLA 3DMJB 3H5SA 1RK8A 4M94A 4YHHF 4GKKF 1HQUA 1VMBA 2KFZA 1FO1A 1SJQA 2E7XA 4ZPCA 1NK6A 2CQ0A 2OO4A 2UVUA 2KXNB 2CZVC 5J1PA 2YWKA 3LAKA 2MQPA 5J1EA 3BQ2A 4EBDA 1BD6A 3ZZUA 4OZ5A 5D78A 2JFDA 3CUNA 1HYSB 1C1CA 2FJDB 2RSQA 2ZOMA 4ID8A 2Y1IA 4R25A 5EGYA 3MEDA 2JLEA 1HNXF 4TQRA 2HS0A 2GMJA 4Q7AA 2R2SA 1FA0A 3LP1A 3I9V9 1ROFA 3JSBA 2WONB 3MHYA 2VC1A 1UP1A 4ID5A 5LSLA 5KFSA 4F26A 2Q6CA 1IBLF 2XB2D 5J2NB 3SV4A 3DRSA 1FEEA 2DGVA 2FC9A 4KFBB 1R0AA 4KO0A 1YRXA 2ASLA 1ZH5A 2QSWA 2HVHA 3RU0A 1FD2A 5THWA 4JI2F 1QSSA 5AXNA 1KC8T 3GV8B 4MTPA 5KG2A 3RRHA 3ITHA 3MMJA 1S48A 4I69A 4KV8A 3DFEA 3HVTA 2BW2A 4Y2CA 2HHHF 1UWBB 1S1XB 3LP0B 4ETXA 5B08A 3EPIA 1RYRA 3BO4A 1MU2B 1Q79A 4TYBA 1SV5B 3TVKA 1FVQA 4MK7A 2C3PA 4JYAF 4DF4A 3MECA 2LECA 3GFHA 3IR7B 2PI4A 1MSWD 3JYTA 4NLYA 2AYEA 4A8QA 3SSSA 5CXTA 3RRGA 4M95A 3C6TA 3HHLD 4DL3A 5KT3A 5T7LA 3PRDA 2GQQA 4YP3A 2C2EA 4NXNF 4F3MA 1KVIA 3CC2S 2OTJS 4FVCA 3TRGA 3AA8A 3K7RA 4KRWA 2W8LA 4GC6A 2OIHA 1IKYB 1NJIT 3MEEA 1CG2A 3BQ1A 2KRRA 1QAIA 5K8NA 2VOPA 2RS8A 4K4ZA 2A2CA 3MM7B 4OHXA 2HGMA 2XI3A 2J9EA 3KYLA 2DNNA 3NL0A 5AE2A 1M0SA 2CPZA 2RF2B 4Y65A 3C46A 1WF0A 4OI4A 3QYYA 4IQXA 2XS5A 4DV0F 5D4NA 1CQNA 1Y5LB 3P3DA 4ERDA 1G6BA 2ZZMA 2E1RA 4ECTA 1S79A 1BWEA 2KFYA 5EDWA 4ZCKA 4KB7A 1BQMB 1K1QA 4DX8H 3KLFB 2DR5A 3FJ2A 3QJPA 1SL0A 1Z2LA 3E2EA 4NL5A 4ED3A 2VQEF 3M6XA 3CD7A 3LO3A 3SDEA 2U2FA 1N32F 3T3FA 4ZP6A 1JX4A 4ECXA 3G9CA 2C3YA 4ZCLA 4KPYA 2BZ2A 1REVB 3PR5B 4C8KA 1B7FA 1R8PA 3L3CA 5E33A 2J6UA 2J7UA 2KM8C 1WI6A 3P96A 3HHDA 3PEHA 4L6V3 2AX0A 5KFZA 3D5MA 1TKZB 1G3OA 4DLEA 2VONA 4Y28C 2FDNA 1TV6B 2EK6A 5E2QA 4J9KA 4WE1B 3OTDA 5KFEA 3PR4A 3AH6A 1CVJA 2N3LA 2XZWA 4A8WA 1QE1A 4UUXA 2NUUG 3WDOA 2DGUA 4C9DA 2WOMA 1F5CA 2KG1A 1R31A 1UETA 5HMZA 3OFEA 2O3DA 3CDBA 5C42B 2WBMA 4C3MA 4ZA1A 2DO4A 4ZPDA 1UL3A 3DU6A 5CHCB 4DPOA 1TL4A 1KN6A 5KFNA 2BABA 1MMLA 4EEYA 3K5PA 2KDOA 2E29A 2DPIA 1NJXA 2QLXA 3LGNA 2MHEA 4QWEA 1KOHA 3M6UA 3QLHA 4HTJA 4TNOA 2MB0B 1RT6B 1KLMB 2K7JA 5G0RA 4OFZA 1CC8A 1N5QA 1U2RA 1K0VA 1R8HA 2KB2A 5EX0A 1RTDA 4WFAQ 1J5EF 1R3NA 4OJ1A 1C0UA 2LYVA 3KK3A 4USHA 5KG3A 3LAMA 2E5LF 1DTTA 4XIUA 1CLFA 1HPZA 4HT7A 2ZHOA 5E3CA 4K4TA 3RB3A 1KLNA 4ED6A 4YDXA 3H2VE 2OPRB 4OI6A 2FHJA 5F8NA 2MKIA 3OUYA 4ECYA 3HP6A 5LXRA 1MW7A 1QSYA 2XMUA 4J9LA 1FJCA 3IWXA 1YBAA 3OFHA 3PJXA 2ZH4A 4UW2A 5SZTA 3D0GE 3K5MA 1TAUA 1U25A 2ZFHA 4ZVHA 3KNGA 1WNEA 2IMOA 2OD6A 1KFDA 3HI9A 4WFBQ 4YR3A 4QJVA 3IGVA 4G1QA 3ZZZA 1FE4A 4B9VA 3OSPA 3DYAB 3I5BA 3ONQA 3S7RA 2XC9A 4CZCA 1IJEB 3EYZA 5FD1A 1N88A 1UVNA 5KG0A 1UKUA 3BREA 2C3UA 2W7OA 3MTKA 2RH3A 2J6TA 4YB1P 4B3RF 5LMNF 3TA2A 3PZPA 2OAUA 3RBEA 1NAQA 3AB2B 5FDLA 5F41A 2JWNA 3CVKA 4F4XA 2KO1A 2V8GA 3UDLA 3CCWA 1HBOA 3PW4A 2CPIA 5CYQB 2EWHA 4NCAA 1NHUA 3TR5A 3GYXB 4NYPA 1GT8A 3HZGA 1KR4A 5KG5A 4WKYA 2PFFB 1K1SA 3I0RB 4K4WA 3G6YA 4LJMA 1X4AA 5F8MA 3GFXA 1UAWA 3HVWA 2IM2A 2XCPA 3DU5A 2X1BA 3IG1A 4ICLA 1J5OA 1HFEL 4J9MA 3T5KA 3MM5A 5J2QB 3HVAA 2ASJA 5EHHA 5F8GA 1IKWB 3MZIA 1WACA 3HZEA 2HWHA 1ULRA 1C2PA 4K4UA 1O51A 2I5JA 4C3KA 4YUDA 4NOHA 4RU2A 3K2YA 2HYIB 3OBIA 3UPFA 1NB7A 1VQ8S 4PUOA 1RT5B 2QA4G 2R8IA 1NK5A 3IC1A 3R3TA 1SKSA 2PO4A 3FFIA 3NG8A 2B6AA 5LMUF 3B4MA 3RB0A 2OTLS 2KT3A 4B3SF 3FRZA 4WFZA 2BRKA 3DRYA 4DF8A 3A8EA 1R8BA 1H3DA 3I31A 3IRXA 4AXIA 4JI4F 2DR8A 4USIA 2CQCA 1D9AA 1HARA 1JLBA 2YKNA 3PRBA 4DUZF 2F8MA 4ED1A 2RKIA 2Q3PA 4F8RA 3V6KA 2JX2A 3QJLA 3OW2R 1DLOA 1WEZA 3U1MA 2L41A 4IRKA 4MFBA 1U8SA 1ZM2A 3CDEA 3CJKA 3GIMA 3MPVA 4ZLPA 4WU2A 1BQXA 5I3UB 2ZE2B 1QAYA 3NLCA 4JOUA 4M63A 3BDPA 4M5DA 3HHKA 3C6UA 3V6DB 4FP9A 2BANA 4I6YA 2ZJPQ 1UVIA 5B0BA 4OMFG 4QYRA 2V5HG 3N6MA 4X64F 2HRUA 2WBRA 2RD5C 4RKUC 1Y4ZB 2J0SD 3IS9B 2ZOGA 1U45A 2EFNA 1HNIA 1Q53A 1SIZA 1YHQS 3M2UA 3MM6A 2W9CA 2EG2A 3SMZA 1HWKA 2HWIA 3EUNA 3RRKA 1I6JA 2D3OR 1Q8BA 1YTYA 3I6PA 1KQKA 5F9NA 4OJGA 4DR1F 3NAHA 2KZZA 4TYAA 2LXFA 4C0OC 2HMIA 4V19X 1MNEA 4LSLA 2Z0GA 2V8DA 3CCLS 2YKQA 1R6YA 2YTCA 3PACA 3H5XA 1KRPA 2O67A 2GQ2A 5I3PA 1IM4A 1YWXA 4PXDA 4NLRA 4JV2A 2CQBA 2X1AA 1NJWA 3CCUS 1VLYA 1RTJA 5L38A 4RWWA 2XY5A 2ILZA 1D0EA 5F9LA 1KQGB 1HHTP 3U27A 3KOAA 3WC2A 3VF0B 4IH5A 1FDDA 1JMTA 2K2PA 5GAEI 2ASDA 1H7XA 4WK3A 4B3OA 3TQ1A 1NO8A 4I7FA 5L1LA 1LW0B 1OSCA 1DARA 1OQ3A 2B5JA 3CDWA 1S97A 4U67Q 4NLUA 1S1VA 1N52B 5A8RA 5M2RA 5KFFA 1S9FA 2AYBA 2W7AA 5B0CA 2AJ1A 1ZTWA 1JLGB 3AHPA 4FPRA 2RRAA 3B82A 5CYMB 5DJBA 2RNEA 1RYSA 4OIXA 4G3IA 2QZ8A 3CCSS 4RWXA 4RLEA 5I42A 2DGOA 2JH3A 2B7BB 2MQLA 3SSQA 3PX6A 4O3PA 2B4VA 4TN2A 1JLAB 4IDKB 5KFGA 2CJAA 3U1LA 3SQGA 2K3IA 3LPYA 3SI8A 3P6YC 1NKCA 3DRPA 3J7Z5 1S0OA 5DQIA 2YKMA 3RAMA 3GG1A 1RT3A 3FEZA 1VQNS 3IAS9 1H6KX 1C0TB 4IOBA 3CPWR 4CO3A 3FSIA 2CJKA 4PQAA 3NBPB 2JVOA 1D8YA 4X4VA 1NEEA 1V9OA 1JJHA 1S9EA 4Y0FA 3OR2A 3W2VB 2LU1A 4I2QA 1F5AA 1RA7A 2ZH8A 5L9NA 1HQEB 5A8KA 1HWJA 3M2VB 4UQGA 7FD1A 1HNVA 4DUYF 2HW3A 2VA3A 2CYYA 1W2IA 4MAKA 2GFFA 4QWBA 4O0IA 1VQPS 2Z4PA 1U1NA 3KMSA 2ZH1A 4K4VA 3TUIC 2YKAA 2YNGA 1U09A 4TU8A 1S9GB 1VQYA 3T5LA 1DURA 2DNPA 2UVWA 4WTYA 3PX4A 3CC4S 1IKVB 3JSRA 3BB5A 1LWEB 1UVKA 1B0VA 4XDCA 4LF7F 4F02A 3PFOA 3M32B 4ED0A 3J7ZT 3HT3A 5BYQA 1JWWA 3FNNA 5KG6A 3JAMY 2R8KA 1KNZA 3HK2A 1RGVA 2XHWA 2KFNA 4DG1A 1Q16B 1S1WB 2DR9A 2EFGA 3M8PB 3J7A1 4B3TF 3GR1A 1HBMA 2GGPB 2D7SA 3ENQA 1VQSA 2DNGA 4Q0BA 3S01A 3TYTA 5E3PA 2MZRA 3IO1A 4JI3F 1VC6A 5GMKa 1RKIA 2HVZA 1N36F 1Q82T 3PFEA 3RB6A 1LWCB 5HQ8A 3MI7X 3FMBA 3LF0A 2MZTA 3K57A 4OX7A 1GH8A 1E6VB 1S0VA 4NLQA 2UXBF 2YNHA 1S6PB 3IAM9 1JXLA 3LUYA 2JFKA 2QE5A 4FYDA 2DVIA 2W9BA 3I32A 5L8RC 5KFUA 4KGMA 2IM0A 1VQOS 1URRA 3JTOA 3BQ0A 4OHVA 1Q81T 4X2BA 1Y00A 1NJYA 4Q45A 3EGZA 2YWHA 1Y3KA 2IC3A 5E5NA 1GX5A 1LW2A 1PC5A 4QIFA 4M8LA 1FKAF 3TVYA 2PGCA 3RAQA 3RTVA 4LFBF 1XMOF 4ES1A 3CTRA 5IM0B 1FNOA 1FRXA 3KG1A 3DLKA 4CO5A 1RT7A 3IGNA 2HNDA 1JLCA 1F60B 1SC6A 1Z1ZA 2MKKA 2LDYA 3MM8B 1JLEB 3KG4A 2NPFA 3GQCA 4IR9A 1GXLA 1QY7A 4QIVA 5CCMA 5EWGA 2FLNA 5KOXA 4YFUA 2LEBA 4RBVA 2AGPA 4RNOA 1C1BA 4MJKA 4TLQA 2R4FA 2YH1A 1ZZFA 4WFYA 5KFOA 2J9DA 2OH2A 5CZXA 1EETB 2MSTA 2FIUA 2LXIA 2B3TB 3MEKA 2RDJA 1VBZA 3C3LA 3PV8A 2L9WA 3CCMS 3KLIA 4YDDB 4W92B 1IQTA 4QPTA 3GFYA 3UCZP 1O8BA 3OXLA 2RQMA 2D3ZA 2ZD1A 4MYUA 4KHMA 1SJFA 2M70A 2LDIA 2CPEA 4H4MA 4X4RA 2RDIA 3KJVB 1XC9A 4O4GB 1JLQB 1A9NB 1U7LA 2DHGA 2AJQA 1FRHA 1PILA 1TKTA 2BXJA 4RUHA 4XO0A 2RQ4A 5EX3A 3M2RA 4RW8A 4HEA9 3US5A 3DLEB 1P1TA 4ZMMA 3KLHB 4DQIA 3CJ2A 4EGLA 3EX7B 4KTQA 3B4DA 4AXJA 4PCQA 2UUAF 2EPIA 2ZHAA 3R5DA 2CPXA 1RTHB 4L72B 5A0YA 3G6XA 3OHAA 4AFFA 2V4QA 1HBUB 2AW0A 3MM9B 4FS1A 2M9KA 2W7PA 1K0TA 3WBZA 1FNMA 4DMZA 3LANA 3PIOQ 5KFCA 5DS7A 1LFPA 2CJBA 3HFKA 5L39A 3AQPA 2FJWA 1TL3A 3NCQA 1FF2A 3A1YG 4LQ9A 4K4YA 4ECQA 4R0JA 2HHXA 3PY8A 4HI2A 5AE3A 1DTQB 3PKYA 4IOCQ 4EBEA 3D1OA 3K0JA 3KLGA 3BGLA 4C8MA 5C5JA 4QWDA 5B0EA 2FGCA 1P8GA 1IBMF 4Q2MA 4KKOB 1N5YA 1B0PA 4RW7B 2FJXA 3CDAA 5DETA 2MMYA 4NPOA 2QT7A 3DOLB 2CQDA 5E3QA 3SV3A 1TK0A 4IR1A 3T9ZA 1TL5A 3QO9A 5J2PA 2HPUA 2OD4A 2O66A 3CF5Q 3DDNA 2VFSA 1S6UA 4L3NA 2N7YA 1U1KA 2VBWA 4TKTA 7FDRA 1LWFB 2UV8A 3I0SB 1Q86T 2FLOA 2HHUA 2MKCA 4IG3A 2HLUA 2MQOA 1M5SA 3DOKB 3HDSA 4IFYB 5D3GB 3OV7A 3GB0A 3K59A 3EZUA 1TFWA 4D3HA 4QW8A 4ILLA 1P9QC 3N6NA 4NZ6A 4ZHRB 5KOWA 1G2EA 3Q8QB 1VC0A 2NLWA 2W25A 2XO7A 2ZZNA 5CQGA 3M8QB 4A8MP 4NCGB 4Q2LA 2J76E 4F4WA 2YY3A 4DEZA 3BGFA 4I6WA 1FESA 5GVQA 4CTAB 2IRYA 5SUHA 4HHJA 4QIGA 1Z4UA 1X4CA 1NK0A 4OX9F 1SIWB 1N6QA 2LLZA 1KTQA 2XULA 2AYMA 4QOTA 2WSFC 2N7CA 3DRXA 4LVNP 3QGGA 4Y2KA 3DN9A 2EKYA 3O3LA 1C4AA 5H1SV 4Y00A 1SKWA 1TQLA 3R5BA 3DM2B 3MOJB 3QGPA 1H98A 2HAIA 2PA8D 4I2PB 2HFNA 3CGIA 4NLOA 4KGKA 2IJNA 3BO2A 3D2WA 5IZHA 5JVHQ 3PX0A 2ZKTA 4IUFA 4CQ1A 5JUMA 2XWXA 1KOOA 2XWYA 3ZZ0A 3R1LA 4NLGA 4DR5F 1RT1A 1HI0P 1XBWA 2JJ4D 1RT4A 4HTIA 1IJFB 2GNKA 4MIWA 4C3LA 4RZRA 3N0VA 2XSFA 3MWBA 3M1VA 4Q44A 2YX1A 1FDBA 4J37A 3VAJA 1S1UA 2DK2A 3GR0A 1OPIA 4DHVA 2WTFA 1L3UA 1KFSA 2R8GA 3ICLA 2DJWA 4MKYA 2J8AA 3HM9A 2L08A 4YB6A 2IRXA 2HHVA 3Q24A 2XGQA 4O23A 5J1EB 3FVYA 1CQMA 1IQZA 2UUCF 4NMLA 1C1CB 5FLXY 2GIRA 5AXLA 3MURP 3R1HA 4WJBA 3KLEA 2OSRA 1WHYA 5FIIA 2EBEA 4ZP7A 4CCHA 2VD3A 3LP1B 2E66A 2XCAA 3K8VA 2EFVA 1YVFA 2PSZA 4ID5B 5DLGA 5KFWA 4O44A 2JEGA 1VOMA 2CPHA 4P7VA 3DRSB 1LOUA 3BGRA 3MUMP 3NGDA 4EYHB 4P2SA 1R0AB 4B3MF 2OPQA 4DL0C 5DQHA 1VQ6S 5D4PA 2VBZA 1DAXA 2KI2A 3KLVA 3K5NA 1T7PA 3ITHB 3CWJA 4LSNA 2DIVA