1YJTA

Solution structure of the cu(i) form of the sixth soluble domain a69p mutant of menkes protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
publication title An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjtA00
5B0CA 1YJUA 1VQSA 5A6PA 3E8OA 4HH0A 2W4PA 3KKFA 1FD8A 2N4DA 4Q2MA 3HFKA 1TL4A 4HL9A 2XMVA 3QGPA 4FNHA 1OSDA 2RSQA 1P6TA 3FRYA 5B09A 1KVIA 2FB0A 3TRGA 4A47A 2FTRA 5B08A 3BDEA 4Q2LA 1N5SA 1MWYA 2QLWA 2HIQA 3HHLA 1ULRA 2GV1A 2LDIA 1JWWA 2AJ1A 4U9RA 2FIUA 2AP6A 2GCFA 2ROEA 3HHLC 5IXUA 5B0AA 1SQEA 2ACYA 1CC8A 5B0BA 2KT2A 4OIXA 2QYCA 2ROPA 3KG1A 1Q53A 2BYCA 2KKHA 2AW0A 1X0PA 2GGPB 3MCSA 5B0FA 1Y3KA 4OJ3A 5B0EA 1FE0A 1SB6A 1W2IA 3HF5A 3MZIA 2BBEA 4Y2IA 4DN9A 2GFFA 1X8DA 1TUVA 4OJGA 4Y2MA 3GZ7A 1V3ZA 3HX9A 3BR8A 4NPOA 1N5QA 3I9ZA 3FGVA 4OJ1A 4EFAC 3BB5A 5KAKA 5A6WA 2EW9A 2Q3PA 2IFXA 2CRLA 3TNVA 1Q4RA 2XMMA 2G9OA 1X7VA 3HDSA 2HLTA 2QIFA 1YJTA 5T7LB 2K1RA 1YG0A 3LGNA 4Y2KA 2GGPA 3LGMA 3UDCA 2IYIA 4YEAA 4QOTA 1TR0A 2OFGX 1FVQA 3KNGA 1URRA 2K2PA 1Y3JA 3BGUA 3K7RA 1S6UA 2K7KA 1FVSA 2K1RB 1YJRA 1IUJA 2BJEA 2BUNA 3T9NA 1APSA 4YDXA 2RMLA 4HI2A 3CJKB 3DXSX 3FMBA 5B0DA 2PGCA 2LQ9A 1XBWA 1FESA 2LXFA 2W4DA 2FHMA 2QLXA 2PD1A 2XMWA 1K0VA 4A48A 3WDOA 2ASYA 2GA7A 3IWXA 4DPOA 1SI9A 1CPZA 2KT3A 2VH7A 1MWZA 1Q8LA 2L3MA 5F0UA 5T7LA 3DCAA 4ZOSA 4HI1A 2XMJA 2JDJA 4NL5A 2XMTA 1AW0A 1CC7A 3TOQA 3QMQA 1Q8BA 2RILA 2XMUA 2ZDPA 1TZ0A 5F0WA 5B0GA 4FNIA 2OAUA 1U7LA 1Y9OA 5K9FA 4A46A 4DL0C 2IYGA 4HH1A 2N4CA 1VQYA 1YJVA 2K7JA 2LQBA 2OD4A 3F44A 2RU9A 2HFNA 3BM7A 1LQ9A 1JK9B 1FE4A 1S6OA 2HFOA 1TL5A 1KVJA 1FEEA 2OMOA 2N7YA 1RJJA 1WD6A 3KG0A 1AFJA 2W4CA 4ZA1A 3BF4A 2HQIA 1AFIA 3LO3A 2AJ0A 2OKQA 1YRXA 2OD6A 3CJKA 1OQ6A 1GXTA 2GO8A 3BN7A 4A4JA 3IWLA 2ZDOA 1GXUA 4OJHA 2VV5A 4F67A 2OP5A 1Y0HA 3HHLD 1KQKA 1N5VA 2OFHX 1R6YA 2BJDA 2HLUA 1QUPA 1P8GA 3HHLB 1N5TA 1OPZA 1OQ3A 2KYZA 2ROGA 2XMKA 3VTIA
chains in the Genus database with same CATH superfamily
2YX4A 3G8TA 1G1XA 2BR0A 2FHOB 2DGUA 3X1LB 4M5KA 2WOMA 4K2JA 5ITHA 1NSAA 4CT8A 3C8YA 1QAJA 3TW0A 1ULRA 1SQGA 1QSYA 2LDIA 3RYLA 3W63A 8ATCB 1RI7A 4IOAQ 1Y3KA 1V3ZA 2M4MA 3C66A 1PBUA 2BW2A 1L3VA 5KFOA 2HLTA 2FVRA 4B3TJ 4B02A 5JUMA 4C11A 1NK6A 4WIQA 3DI6B 3I5CA 5AE1A 1JLCA 3D0GE 2ASDA 1HL6A 3PFOA 3TUZC 4IYQA 5J2MB 3CE8A 3QWPA 4WYWA 1T05B 2Q1LA 2M3DA 2ZH2A 3MMCB 3NGTA 4ZP7A 1H6KX 1U8WA 4ER8A 2EG1A 3KLGA 1N48A 1RQ0A 4OHXA 3O5TB 2MQMA 3E01B 2V4QA 3N79A 2KU7A 3EPIA 1HQ2A 2WVBA 3O3LA 1QAXA 2B4VA 2DR5A 1FT8A 2JRSA 2LU2A 4YHHJ 3MEEA 3KOAA 5J2NB 1B0TA 3KUHA 4N8NA 2IBKA 1S6PB 2Z8QA 2NLWA 2DNKA 3CJSA 5KG6A 2C42A 4JI6J 2MSSA 2ZBRA 2UVVA 5HLFB 1VQMS 3WHIA 1E6VB 2VA2A 1RBAA 4DV4J 1D1UA 2FC9A 4A48A 1GXLA 3PRBA 4BWMA 4X64J 2MY7A 4DU7A 3QMQA 3O8WA 2RU9A 2ILYA 2VICA 1F5BA 5IT9U 5F9NA 1KFSA 1HHQA 3HHLD 3C14B 3DLJA 1T05A 3MMCA 3IR7B 5AXNA 2MZ1A 2DHGA 4CO2A 1XR6A 3DFEA 3TI0A 3E01A 2Z56B 1OSCA 2ATLA 2E9ZA 2NSCA 3K0JA 2DR9A 4LF7F 5A6WA 1OO0B 1TKTA 3AQOA 2P9CA 4JI3F 2YX1A 1GH8A 4HVZA 2HGMA 1HPZB 1HNVB 1G6BA 1IBLJ 1S6PA 2CA9A 1KC8T 4YY3J 3IM9A 1U1LA 1UCNA 1WUUA 1ZAVA 4PXDA 2FLLA 1N34J 1E6VA 1CG2A 2P6SA 3RAQA 1KN6A 4O3SA 1XIQA 3MFHA 3PEHA 1HWIA 1FRMA 4EI2A 3CJ4A 1FWKA 1UVMA 2DNZA 3NRBA 4QR1A 2J0SD 2JLFA 2B5JB 4QWAA 3GJQB 4UZCA 4X84A 3WX4A 4CO3A 4R5PB 2PSZA 4DL2A 2ZC4A 4ZCMA 3BGFA 4ZCLA 3P8BB 3C14A 4LT6A 3U1MA 4ZJLA 2IM0A 5H9EK 2KXHA 3ENAA 3TZXA 3VGVA 1N0UA 2V34A 3SDEA 3IRXB 1M1KT 2YWHA 4YR2A 4M5LA 2CQ0A 4A8XA 2FD2A 4L3NA 4BC7A 1X4GA 4C8ZA 2QIFA 2K1RA 3SI8A 2XG8A 2OFGX 3EVOA 2ZH3A 1F9FA 4NX9A 2XS7A 4LQ3A 2GHWA 2BXJA 3NGDA 3DLGB 4K50A 4FYXB 4NZ7A 5HMYA 2C2OB 3SV4A 5ETTA 1HNVA 3MD3A 1Q5VA 3MM5B 4YHHF 4AFFA 4Q0BB 3QFHA 3DRSB 4NCAA 2ZWPA 5LL6d 2R7VA 3OVSA 4RUCA 1YRXA 5HQLA 2OP5A 1VS3A 3BYRA 3TEGA 3J7YU 1FRJA 1CS4A 4WTYA 1OS5A 3M2VB 2PEHA 3QBCA 5JXSA 2LEBA 1FDAA 1VK3A 2XSFA 2ZBCA 4U8YA 4DV4F 1NKCA 2B5JA 4AT1B 2RD5C 4D3HA 4P7VA 3UCZP 3ENQA 2QYCA 4ZVGA 4WWSA 3CULA 3F0NA 4R5PA 4JV1A 4PQUB 4F04B 4HDHA 5F8HA 5CH7B 4DS5A 4OHWA 2AZ1A 1FHTA 4NWBA 4NLUA 2C3MA 2NPIA 2H65B 3T6BA 2KG0A 3IRXA 5E0OA 5I3QA 1BE4A 5LSOA 1CPZA 2FZCB 4ZMMA 3RUBL 3H8YA 2CZ9A 4KFBB 3MR6A 3DLGA 2H9ZA 4DMZA 2OD6A 3K17A 3M6WA 3MM5A 2OFHX 1U1OA 3GIKA 4GVLA 1AUSL 4O3OA 4LFAJ 4ZLNA 2VONA 4Q0BA 3DRSA 3LWLA 4RNMA 3RR8A 1PAEX 1IBLF 5D4NA 1VBKA 5F8MA 2XMAA 4YY3F 2QLWA 3QNWB 2A2CA 3TZZA 4K4YA 2XYHB 4Y6IA 3M2VA 1N34F 2O66A 3GYNA 2DHHA 3DMJB 3CPWR 5CCMA 4UUXA 4RW7B 3D1OA 5IQQA 5IZHA 1WHVA 1L3UA 4Y2KA 3T9ZA 4PQUA 4YEAA 1YZ6A 2H1YA 1VQOS 1MMLA 4LFCF 1WC6A 5HBMA 1WELA 1UW4A 1APSA 4AE5A 3ISNC 4FF1A 2HHQA 2X3GA 1KSPA 3M9OB 1VBYA 3L95X 1H2UX 5KFTA 1XMBA 4ZLJA 4DBQA 3NCRA 1U4BA 2I6WA 2D3O1 2R8GA 1K73T 3HZGA 1Q7LB 5KFBA 1WEZA 2ATCB 4DX8H 1WNEA 3CUNA 3EYZA 1IQZA 4DR4J 4HR2A 2MPUA 1XTZA 3ZFVA 4KFBA 3MM6A 2H3EB 4PXCA 5D78A 2CPZA 3MEDB 5DQIA 4A8YA 3C19A 1YTYA 2BE7D 4QPTA 1ZTTA 4QCLA 1B0PA 4GC6A 1UFLA 1RBOB 2GIFA 2X1AA 3IXQA 1FERA 4RU9A 4CH1A 3I9ZA 2G0JA 4I4BA 4LF5F 2Z2LA 1XMQJ 3WZ0A 2XNQA 5I42A 3MR2A 3OTDA 5IM0B 1R43A 3LGHA 3CC7S 3DMJA 3UCGA 3EUNA 3CJKB 4IR1A 4RW7A 1XBWA 4F4KA 4ZDNA 2MZSA 4K5SA 4MYTA 5ETPA 4GO7X 4PYAA 4BHQA 4W92B 1RXOB 4NA3A 4K7QA 2F8EX 4ZIVA 3P5BP 4PEOA 3GTYX 4K5RA 5G0RB 2B3TB 1FDBA 1IBMF 1WI8A 3ZZTA 2W4CA 4MKYA 4UOHA 1WKJA 1S0OA 2DYAA 2WSCC 4KY3A 6FDRA 4WP3A 1UJ6A 4S0MA 5DO2A 1S1UB 1X0FA 4C3LA 1N5SA 3HLUA 3OXGA 2V0NA 3MEDA 3R1HA 1LOUA 2F4VJ 4P2XA 5DETA 1Q8KA 1RT4B 4C4WA 2R2TA 4EO6A 1HD1A 1RCOB 3H4DA 2WONB 3QT7A 3HVRA 3GV8B 2R2SA 3MMBB 3C46A 3L09A 2GA7A 3HULA 4JI2J 1VQ5S 3H5YA 4M5MA 5EX3A 1AFIA 3CJKA 3HKWA 4P52A 3LALA 4WXWA 4MK7A 2BACA 3KMSA 2UVUA 5HROB 4YFUA 3H5UA 4HT7A 4C98A 2OSRA 4H4MB 5HVFA 1XQIA 2G2OA 5G0RA 2GMHA 1XERA 4ED8A 2L9WA 1G3OA 3J81U 4Q7AA 4PRFA 4Y0FA 5A8WB 3BBFA 5KTQA 1FX4A 1WSVA 3KHLA 4ES1A 3MURP 1S1UA 4Y2IA 3BZQA 5A2QU 4KTQA 4ZP6A 2Z2YB 1S0VA 4JI5J 3R8YA 2IYIA 3BGRB 3IBFB 2NYHA 1FNOA 3MAAB 4O4RA 3QAUA 3GONA 4C48A 1PJ6A 1L3SA 1Q86T 1FJ7A 4C8YA 1SC6A 2HFUA 2HRUA 1NB2A 3EVWA 3GIMA 2WONA 3CC2S 2MQLA 1CULB 3TZWA 1OY9A 3MMBA 3BKTA 1JIHA 1KTQA 4PKDB 4DL7A 1XMQF 1QUPA 1Y5NB 2XMKA 3UR0A 4X4OA 3EX7B 4KGVB 1UZDA 2BQ3A 2W4PA 4MK8A 5HROA 4ZPCA 2J0QD 3AA8A 3CCZA 3EXYA 5M2RA 4KKOB 5D8HB 5GAEU 3TVKA 4I68A 1FD2A 4YN3B 2AYEA 5CYQB 3N5BA 2AW0A 3IG1B 5FD1A 2YQ1A 3AHPA 5A8WA 3K5PA 2JL9A 1RAOA 4ZVQB 1OY6A 5HVHA 2DTJA 2XWXA 3NG8A 3ZZUA 3W8PA 1B64A 2CDQA 1KHVA 1L3KA 4DZ6A 3MR3A 4OYZA 2Z58B 3HHNB 3PTWA 3GG0A 3WQPA 3H4BA 3ULHA 3BGRA 5LMUJ 4LMZA 1RU2A 1JXLA 3A8IA 2E7VA 5DDQC 1S9FA 1CJUB 3K8WA 1RK8A 2ABYA 4ECXA 5EX0A 1H7WA 1WF2A 1WACA 5ETOA 4PG7A 3I0SB 2DJWA 2HNYB 4F67A 1NZAA 1CULA 2DIUA 2PFFB 1N5TA 1NMEB 4NXNF 1WC1A 4J9NA 1FNMA 2B9XA 2XLKA 1YBTA 4DZDA 3NWRA 3C6UB 7AT1B 1SC1B 2VPYB 3LF0A 1MG7A 2GS8A 1RABB 3DGVA 2O67A 3NWGA 2ZBIA 4KKOA 2XCAA 5GVQA 2RQ4A 1F5AA 5CYQA 4B9NA 2IBOA 4MFBB 3EE3A 1NEEA 4HACB 2VC1A 4ELTA 3US5A 3IG1A 4ZJOA 4Q43A 5DG9A 2OEJA 1TAQA 3FBBA 2MQ8A 3LP0B 3SMZA 4JYAJ 3KYLA 2RE1A 4X4NA 3P96A 3B6BA 1Q95G 3PZPA 3AB4B 4M95A 2XS5A 4LRAA 5KFFA 4RW8B 3K5OA 2RDDA 5ETQA 1X4CA 3DLBA 3N6NA 3J7Z5 1DBDA 2W9CB 1RTDB 2HQIA 1IWAA 2GO8A 2PMHA 3RBXA 2E1CA 3OL9A 1S77D 1CJUA 3WC2A 4JI5F 2XHCA 3QIDA 1BQNB 3AB2B 1BQMB 1FDDA 3N6MA 4OI1A 3CSKA 3I0SA 1RT2B 2HNYA 2VKZG 4LRCA 3HP6A 2V9WA 1LFPA 4QPXA 1O0PA 3TJ9A 2KT2A 3C6UA 3J7A1 1PAUB 5KFWA 1LWXA 4OJGA 1U2FA 5LMNF 1H2VZ 2DY1A 1YBAA 1WDDA 2ERRA 1RA6A 1R8AA 1NJWA 2NCKL 4B3OB 2IC3B 4HYKA 1NKEA 1Z4UA 3MI7X 1O51A 4XTTA 4OZ3A 4MFBA 4HACA 2VH7A 2F63A 1SH0A 2KRRA 4KSEB 4L76A 4O3NA 3GLJA 3OV7A 3LP0A 3TZYA 1FFWB 3QGHA 2E7WA 4NLPA 4KPYA 2C2NA 3BN7A 2H51B 4RW8A 2V6AA 5BR8J 1VHIA 2R8IA 4FF2A 3VR1A 3I4PA 2R9LA 2W9CA 1RTDA 4CLFA 5HL7Q 5C25A 3LUYA 1VMBA 4EMDA 3VWSA 3BR9A 4P72A 4WIIA 5DZ7A 1GMUA 4C0BA 2E5IA 3NCPA 2DISA 1FKAF 1BQNA 5LMUF 1BQMA 2QL9B 1NPRA 3IN5A 5H1SV 1RT2A 4DHVA 3FGVA 1B4SA 1HARA 5F8IA 4URGA 3PXGa 1GFWB 4J9UE 2HHHJ 2APOA 3R7NB 5B0DA 5U47A 1KOHA 4M94A 2BRLA 5T14A 1BUXA 1ICEB 2H54B 4B3OA 3OBIA 3A12A 2VG5B 1WKKA 2IC3A 3DNCA 2Y3YA 2DKOB 5HMWA 2HQ3A 3D6HB 1SH2A 3QZ7A 4DSEA 1QLNA 1C4AA 3W5ZA 1ZS6A 1Y4ZB 2ZDOA 1S4FA 4I0WA 2EEYA 3TP2A 2YH0A 3ILLA 4C7QA 1YJUA 2OPPB 1H38A 3CCUS 4KGMA 5GADI 1TL4A 4DN0A 4NZ6A 3D0IE 2VQEJ 3VGSA 1H74A 2W9BB 4EYIB 2P9EA 1Q5YA 2X3DA 1T9XA 2V8DA 2MLXA 3KHRA 2IFXA 2E1MC 3ENWA 4M5HA 2IA0A 1KR4A 2MQNA 4P73A 3UR3C 1NK9A 2AJFE 3GJSB 4KYZA 1Q79A 5HJYA 3EM1A 4DV7F 1N5YB 2PGCA 2V4RA 1QTMA 4LF6J 4FYDA 3KLHB 1UL3A 5J1PA 3PW5A 2EC0A 3AXMA 2ZWOA 5JMNA 2YWKA 4ITSA 3UD5A 1S99A 2ZNZA 2F65A 4AQYF 1PCAA 3CCLS 2VG5A 2XCPA 1T0TV 1RYSA 1KONA 3MM9B 4IUFA 1IR0A 2G0CA 2ALZA 3PFEA 3OSPA 2UUCF 5BYQA 1RACB 2P9GA 5ETKA 4LF9J 3Q8RB 1TP7A 3JQKA 5KFIA 2WB1D 4O23A 4FXDA 2JX2A 2OPPA 3LP2B 2YXLA 3Q8UA 3MZIA 4ZITA 3VF0B 1T9WA 1LFWA 3MEGB 1XWLA 2CJKA 4F4AA 3PRDA 3KNAA 4F3QA 2ZKUA 2RUSA 4MKBA 5DDRC 4MIWA 2W9BA 2Y9HA 1JJ4A 3D6FB 1F2HA 3RRHA 2FHMA 4DV0J 3WDOA 2KZZA 3RR7A 4DX6A 4NLWA 1S72S 2MEWA 1QM9A 4KR0B 4NCGA 1N5YA 2UUBJ 2XZDB 3SSQA 2ZOMA 3KLHA 1DTTB 5D4PA 3KK3B 3GYXB 1YWXA 2MHEA 3V5RA 2A6MA 1B99A 1WC5A 1HR0F 2D74B 4EBCA 1VQSA 3M8QB 1DURA 2IVYA 2HHHF 4WBFA 3OQ2A 5K5MA 3ZTQA 3FSXA 4F2SA 3MM9A 2J8AA 5C42B 3A13A 3I5BA 1UEUA 4ED0A 1DTQB 3CMES 3SSRA 2YPYA 2BJ3A 3IBCB 1X60A 4FBTA 2HKEA 3BB5A 3PX6A 2D7SA 3LP2A 2VFRA 4JI7F 2CAJA 4I2PB 3MEGA 5I3UB 2CQDA 3QT5A 2Y1IA 1JLFB 3ITHB 1RU1A 2GW8A 3Q8SB 2ZHOA 5T41A 4ECVA 3D9BA 2W8KA 2HZVA 2PI4A 2ZDPA 3R5GA 1Y10A 2BANB 3UDVA 5KFAA 3OL8A 2MJNA 5KFSA 3NKYA 1HIYA 1JX4A 2QMXA 4UF4A 4IFVB 4ECYA 1SQFA 4QJVA 2NS1B 2QA1A 3SCIE 5L46A 3G6XA 3KLIB 3ZZPA 4D3GA 4E98A 5A6PA 1DTTA 3OTOJ 2MKIA 4PWDB 3QJPA 3POTA 1FRLA 3UD4P 4Q2MA 3W2VA 3IO1A 1KQGB 2KFNA 3TWZA 4DCOB 4P6QA 3R5DA 1VFJA 4LF6F 3PJ9A 4G65A 3MUVP 2UUTA 4CH7A 2XULA 3GSIA 3M8QA 3PW0A 2YNFB 2AQ4A 2YPZA 3M9MB 4OJ3A 3SCLE 4X4SA 1UZHA 4DPUA 3NAIA 2Y8WA 2RUGA 5C42A 1KOOA 1HBMB 1WTBA 5IT0A 1DTQA 4Y3CA 4ELVA 3M30B 2EFNA 2J6TA 3Q83A 3OFEA 3QIPB 2VD3A 2WW4A 2WVEA 3HZEA 1FVQA 4ED1A 1EKRA 2QLFB 4LFBJ 1XJWB 1GX6A 3HHDA 4IH6A 2AYMA 1RP5A 3JTNA 3W9JA 2OGUA 2QFJA 2IVMA 4LF9F 4ZVEA 1X4AA 4I2PA 5I3UA 2HGNA 4OI2A 4DL3A 1JLFA 3ITHA 1RWWB 1QAIA 4FZVA 3GPAA 3BS9A 1TAUA 3NS6A 5HATA 4RW4B 2CJYB 2B51A 3V81B 2BANA 1X5TA 1SIWB 3L3CA 2QX0A 1NK0A 4IFVA 2PMZD 1RT7B 1DJ0A 2HHUA 4YB7A 4DV0F 3LOUA 2RT3A 2XHWA 3KLIA 5B0BA 2JHEA 1VLYA 4PWDA 2KH9A 4C8MA 3CMAS 1VQLS 1HQEB 4LBHA 4Y2MA 1CJTB 2QMWA 2D9PA 3MHYA 4CWBA 5I4MA 3AD7C 2YNFA 1VHFA 5DDOC 3VHQA 3GCXP 2WVFA 3QAEA 1BHNA 4P10A 3T9NA 2B7BB 1D9FA 1BXNA 1HBMA 2UVRA 2CPHA 1SJ1A 2KT3A 1BLUA 3JSMB 3FKBA 3OTCA 3BKUA 4J9SA 2E5JA 3DRPB 2QZ8A 2E66A 2MJUA 5KFDA 2JVRA 4ANDA 1R8PA 3PKYA 1NPPA 2LYVA 2ZZMA 1FFGB 3N28A 2GJ2A 5SZTA 3BYPA 2BJDA 4KHRA 1RLDA 1DQAA 4RW4A 4ES2A 3HFKA 2JFDA 4TQRA 1F9EB 4MIAA 2CWXA 4O4GB 3HKZD 4WYLA 2HK3A 4DX5A 3BV8A 2PA8D 3KG1A 2I1RA 1HFEL 1RT7A 1JKHB 1HMVB 2Y1LB 4NA2A 3S6EA 3M8SA 1RDRA 2P2CB 2QC3A 2ZJRQ 4AUKA 1URNA 3KHGA 2CNKB 2VOOA 1HQEA 1CJTA 2ASLA 2VFUA 2FY1A 2MGZB 1ZAWA 1YITS 1KQSR 4EK2A 4QYZJ 2N7CA 1UETA 2BEFA 4ZCIA 5KFQA 2YQ3A 3QJJA 5F8NA 3T1HJ 3NXZA 4B9SA 3T1AA 2DXFA 1HI1A 2GIQA 4F4YA 3CD5A 2Q6CA 3W62A 2GJIA 1TKZB 5KFMA 2W1BA 3SXLA 4DUYF 3OJUA 2A10A 3DRPA 4RL1A 2HWIA 2B9WA 1WEYA 4B08A 3IMQJ 4DPTA 3E8OA 3GU0A 3QRQA 1TVRB 3CO9A 3T5LA 1WG1A 2CQHA 2FGCA 3DOMB 3KWMA 1S48A 3FK4A 2BE2B 1REGX 3RW7A 4C97A 4JV5J 2FVQA 3MPYA 2UXBJ 1IWGA 3E3XA 2HQGA 3D6MB 5E41A 1KKHA 1TL3B 2CPFA 2IJNA 3GZ7A 4O4GA 2FHJA 1NJXA 4DCJB 2PA3A 5A8RB 1KRPA 1AXQA 4LVNP 2EFVA 2VPWB 1RWXB 4V19X 1SUQA 1JKHA 2AF6A 2DGWA 4ED6A 1U24A 3FMBA 3O1LA 2HHPA 2MZJA 1JNRB 1MWZA 1RLCL 3DCAA 2AHOB 3Q89A 1NHUA 3TEHB 5MAOA 3HK2A 1QE1B 4RO0A 5E3CA 2MGZA 4HH1A 4JP8A 4WP9A 4OZJA 3TUPA 3CCES 2C2MB 3HVAA 1KWMA 1IVZA 3LTOA 4CCHA 4X4PA 3CIZA 3VZHA 4K0KF 2KYZA 5CXTA 2XNRA 3E51A 1JXVA 2RKIB 2QTWA 3KTQA 2BJ7A 3L7UA 4NEZA 1TKZA 2ZD1B 2JEGA 5DRKA 2QL7B 2XI2A 4G1QB 2FGOA 4DUZJ 1U25A 1YJNS 2UVWA 2VUGA 4QWCA 3DYAB 2ZH8A 2ZJPQ 4FXWA 1TVRA 2YKNB 2VG7B 3DOMA 1CLFA 4G1IA 2KJWA 4N47A 2BE2A 3AOCA 4GO5X 4OI4A 1HNZF 3CT9A 3WIUA 2CRLA 2NXCA 1FA0A 5FLXY 1TL3A 5KFXA 4Q45A 2GZOA 3MOJB 4DR1J 4J9LA 2XY7A 5KFZA 5A8RA 3DRRB 4RNOA 4Y34A 4LSLB 3RB6A 3W3SA 2KO1A 2E1PA 1TL5A 2OMOA 4LJMA 1H73A 1OJ4A 2PE8A 1QE1A 1FX2A 3H5XA 3R3TA 1S49A 2WK4A 1R7IA 4I7FB 1WKLA 2VFTA 4QZVB 1TMMA 4DL5A 4XIUA 2IIHA 2FB0A 2M8HA 4Q2LA 3DU5A 1F3FA 4B9MA 3J80U 2RKIA 2NUHA 5D4OA 2Y1JA 4WFXA 4DXLA 2KKHA 2ZD1A 3T1HF 4BBYA 1YDLA 3NP5A 5IC6B 1HWKA 1N36J 2ZJQQ 1X7VA 1X4FA 1U6ZA 1YJTA 2MSTA 2DRBA 2VG7A 2KI2A 3M8WA 3TYTA 4DV3F 1FWPA 9ATCB 3RG6A 3OW2R 2XMWA 1TL7B 3OFHA 1S5ZA 3D3CJ 1S76D 2ZKTA 3HHEA 1UEKA 3IP0A 2G0IA 5GMDA 4A46A 3IA0A 2AX0A 2CPJA 4I6AA 3DRRA 2UXBF 3DLHA 2VU5A 4XPCA 2N7YA 1WD6A 4IQMA 4CZCA 4ECWA 2CQ3A 1YGYA 4DLGA 1T3NA 4M5IA 4YUDA 4F02A 2MHNA 1R8CA 4OX7A 7FDRA 5LT5A 3MPWA 1QTNB 3R27A 2LEAA 3R5CA 4IQXA 4J91A 3BBBA 4V1Ak 3V6KA 4LIRA 1DZ5A 1JLGB 4I7FA 5GAHI 4X66J 4CLZA 1RA7A 2BQUA 4ZN1A 2NYIA 2W01A 4TU8A 3T1YJ 5RUBA 4AL5A 4BWJA 5H9FJ 4DQPA 5T7LB 4IG3B 1XNQJ 5IFMA 4U95A 2DO4A 2DXDA 2RRBA 4ZHRB 4EEYA 4LF4F 2WVDA 2LQ9A 2JH3A 3M4XA 4LUBA 2D3UA 5KT6A 4DUZF 2V5HG 4FNIA 1JLAB 2B9YA 4X4VA 1VQYA 1V6HA 1X5OA 1FE4A 5L9XA 4OHZA 1WC0A 2UXDF 4N77A 1NDCA 1SV5A 3QPIA 3PO5A 3SZ2A 1EX8A 2YKQA 4IOBA 1OPZA 1N0VC 4PPDA 3R9LA 3ILJA 4ZLPA 2KT5A 1A7GE 2WAQD 2RDJA 3CIMA 2DB1A 4DR1F 1FEHA 1C1BB 2HSEB 4AL6A 2DH8A 4OYWA 2E1AA 3PYFA 1RAJA 2G1HA 2UXCJ 2E5LJ 2AEMA 2OI2A 3FDSA 4ELUA 2JSXA 2LQ8A 4ZS6A 2BBEA 3BGLA 3H5SA 2N3OA 4EFAC 1VR6A 4BLGA 1JLGA 3RB0A 2HBYB 4OI6A 5DJBA 3PX4A 4C8LA 1FK9A 4A8FA 3DKDA 1SCJB 4KH0B 4A8SA 2AEFA 3FRZA 2HW3A 4TY8B 1YHQS 1R31A 3EDQB 3WBZA 1Q8LA 5T7LA 4IG3A 4G3IA 5D15A 2W8LA 3NMAA 1AZSB 1MU2A 5IWAJ 5HAOA 1X5PA 1Y7PA 2ZZTA 3R97A 3AA9A 1XK8A 3ISZA 3IWLA 4OLOA 1GXUA 3NGRA 1N36F 4J9VA 1JLAA 3ET6B 7FD1A 3ETMA 1VYAA 3L7OA 3UN3A 3DRYA 3CJ5A 1T03B 4RJVA 3ETOA 2U1AA 3EZ5A 2V50A 3R7BB 2C28A 1WHYA 1ZZFA 4DV2J 3U27A 2GGPB 4QR0A 2J7WA 2K8GA 2V9KA 4JI4F 1SBRA 2E44A 2NUUG 1C1BA 2L9NA 2MKHA 4USJC 4DV6J 5C2GA 1YLXA 2C2EA 2DBBA 1FRKA 4QIGA 3PV8A 4FS1A 5HQMA 2Q6BA 4USKA 3OLAA 3TO8A 3M9NB 5E3AA 4L6V3 2HNDB 4ZVPB 2FJDB 1SL0A 2FY8A 4TY8A 5E5NA 1Q82T 4USMA 2X1BA 1UVIA 3HVWA 2KVIA 1AZSA 4CM0A 3T1YF 3PACA 1H2TZ 2NZ4A 2M52A 2GIRA 4HH0A 2FLPA 4UW2A 3K5NA 3QRRA 1FJGJ 4DX7A 5LJ3Y 3FMWA 1VC6A 1GMWA 2XSJB 3ET6A 1FKPB 3GB0A 2EI5A 5J1NA 1X9MA 3I82A 4CIOA 3Q8QB 2MKYA 1SB6A 4EO8A 1T03A 3K59A 2XO7A 4PYDA 4MT1A 2N82B 2LLZA 3HDSA 4NLYA 2GGPA 3GIJA 2L48A 3MAQA 1URRA 3CD7A 2J9DE 1FWLA 3MPVA 3KJFB 3HJFA 2QL5B 4RZRA 2HQCA 4ANCA 3L4BC 2FDNA 2LKZA 4RUHA 2VBXA 5CQGA 4LF2A 1OWXA 1YJVA 4DSIA 3NLCA 2UXCF 2E5LF 3QWUA 2HNDA 1D09B 3W61A 3K5LA 1MNEA 2UUAJ 2KN4A 1KS2A 1BGXT 1UEVA 3K58A 1KQKA 3NY0A 2HZAA 5C24B 1NM2A 2DNLA 1K0TA 3M6VA 1QSLA 2FTRA 3UW1A 3V6JA 1NJZA 3KHHA 3C6TB 4V19J 2Z2ZA 3GIRA 4A8WA 4PZVA 2CNLB 3Q8VA 1AA1B 1MW7A 1ZM3A 2UU9J 1TUVA 5IWAF 2XSJA 2M7SA 4NRUA 4Y2AA 1FKPA 4L72B 2D3OR 4KV8B 4MK9A 4CTAB 3GCWP 5DG7A 5D0RA 5EWGA 3NNAA 2ZBPA 1EQMA 2ASYA 5ADZA 3EZUA 4GVBB 1U49A 1B3TA 4KQZA 4DQRA 2OSQA 1IN0A 5KFGA 2OAUA 1RHJB 5K8OA 1I6JA 4DV2F 1NB7A 3MDFA 5KT7A 4JOUA 1R0AB 2Q66A 3HVTB 1S6QB 3R7SB 2C1EB 4X4QA 5E7OB 1Q78A 1OQ3A 5IT9Y 1VQ8S 3W66A 2EFGA 4ZVTB 1RT5A 3SCKE 3O6QA 4WK1A 2MDAA 3OTEA 4PR6A 2LCWA 5C24A 5CA5A 4UY8T 3ISND 3QQCD 3OVBA 3AH6A 2OUGA 3C6TA 1IKXA 2HYIB 4FN5A 1TR0A 1HBOB 3Q2SC 2R7UA 2IRXA 1YI2S 2ZFHA 2HG4A 3HSDA 4HHUA 1HBUA 5KFNA 2R42A 4MKVA 3OL6A 1FJGF 4WPAA 4CTAA 2ZOGA 1Q8BA 4J5OA 5KT3A 5KG3A 3K89A 4GVBA 3KJVB 4DPWA 2AJ0A 1T7PA 3AD8C 1FXLA 2W2QP 1VBXA 4RW9B 2DNOA 2NQPA 2XZTB 2L08A 1R0AA 1S6QA 3CDUA 2B4OA 5B08A 4FPRA 4RWXA 1VQ7S 1LW0B 5CAAA 4HHJA 4WFBQ 4NLRA 3SQGB 4N56A 3T5KA 1X4BA 4Q5VA 1JB0C 4WF9Q 4PUOB 2ZEJA 2OEKA 1MMNA 3DI6A 3MPDA 3UDCA 2ACMA 2LU1A 5HMXA 1DHMA 3G4SS 2KZMA 2RDIA 4DV1F 4EGLA 2ZH7A 2VJVA 5D3GB 1C1CB 2RU3A 1UPPA 4FVMA 1GEHA 2MLYA 2FZKB 2R8KA 5J2MA 2CFXA 3J7AN 4IRKA 1HBOA 2VIHA 1CC7A 5I3PA 1G2EA 5K9FA 5DGAA 2AMCB 3HI9A 2HFNA 1NCLA 1T11A 4RPFA 2C2RA 2CUYA 1KLMB 4NYOA 1RHKB 4OMFG 2NZCA 4LSNB 3JSBA 2DRAA 3GFZA 3VGUA 2WHOA 1Z2ZA 2QRRA 3UO0A 3KJVA 1U45A 1K47A 5GMEA 1VIXA 1GNKA 4RW9A 2CG8A 4U7CA 3P3DA 4JV0A 5J2NA 2HBQB 1S1TB 5M2UA 3BJYA 4AYBD 2BA9A 3VAMA 4UTGA 3U02A 3W60A 2NR0A 4RKUC 2FHKA 4NPOA 1LW0A 1UJ5A 3DGPB 5HLFA 1RUSA 2B43A 2BJ1A 3H7HB 3SQGA 6FD1A 4M5DB 2XYPB 1PKUA 3ZTOA 4PUOA 1IM4A 2CQ4A 2HNZB 1K0VA 4UOGA 3FSYA 3I32A 4ZVFA 2H5EA 1TUWA 3MF5A 5D3GA 2CNNB 1C1CA 3CD6S 4B3TF 4AXJA 2A1BA 4HKQA 4BCAA 5KG5A 1HWLA 4BDPA 3KG0A 3G6YA 4I6WA 1HBNB 3B82A 3SCJE 1NRKA 1V5VA 1P1LA 1AROP 1OIAA 3GQCA 1NU4A 4X4RA 2ADCA 2CADA 3N9UC 3DLKB 1RTHB 1KLMA 1TTHB 1OSDA 2VPZB 3RB4A 4ZPAA 1RHRB 4H54A 2DHSA 2OPRB 4LSNA 2E9TA 3CNQP 1DFDA 4ZPVR 5FJ4A 5F41A 4H4KA 3PVXA 2VBWA 5HO4A 1M5PC 4LRFA 5EWEA 3M2RB 4MKAA 4CLTA 4UOCA 2DRDA 4PWUA 4L75A 2CXEA 2ZHBA 1S1TA 1UA0A 5JVGQ 1S97A 1HPZA 1NZ8A 2GX8A 2C2DA 4CLUA 3PYDA 1F9HA 2DR6A 1Y5LB 1YX2A 2ZHAA 2LXFA 3BO4A 1VRQC 2CZ4A 3DGPA 3W8GA 2KB2A 1FRHA 1DRZA 4M5DA 2B7CB 2LECA 4JI6F 2P8IA 3A8JA 2VDIA 3FBEA 2GMJA 4RBVA 2OD4A 4TN2A 2HNZA 1JK9B 1I51B 3PR4A 3Q2TC 3R2DJ 1D8YA 2DNGA 2L9DA 4ZPWR 2DXEA 2HWHA 2X7IA 3G8QA 4X64F 1RWOB 3RTVA 4QIEA 1HBNA 5EHHA 2A0FB 3G6VA 1RKJA 1A9NB 4ZLLA 4EBEA 4I64A 4R8UB 2CJAA 1U2CA 4TU7A 4FP9A 2AU0A 3DLKA 2RB7A 2GJFA 1F60B 1RTHA 3HF5A 2QMUB 2YKOA 3D54A 4OJ1A 2OPRA 4YS2A 5KAKA 1I94J 4NLGA 2EVZA 3TNVA 4B3MJ 4CO5A 2DNMA 3M2RA 1D3WA 5MLCV 4NMXA 1H72C 2PO4A 1GTHA 3KK1B 1WWHA 5HJXA 1WDTA 2B4PA 3LANA 4ILLA 2XMJA 5L1JA 3BREA 4IKAA 1U7LA 4TLRA 1RHUB 3LQVA 5HMZA 2EWHA 2RQCA 1HD0A 4TKTA 3BM7A 4PG8A 4WCEQ 2FJWA 4ETZA 2HGLA 2PC6A 4NLTA 2UP1A 2HZCA 1NXIA 4NMLA 2CPDA 4OYXA 1R0BG 2AIRB 4F50A 2MB0B 4KPCA 3BDEA 3RRKA 2DR8A 3OL7A 1GQEA 4C0OC 1VCTA 4OIXA 3MCSA 5AXMA 3KLEB 3PW7A 2IM3A 5IT4A 2AJ4A 3PJWA 3DOKB 1KFDA 1HW9A 4P7TA 4X4UA 4R8UA 2AX1A 4C6AA 4RUBA 3PG9A 1Q1KA 2R7WA 4N5SA 3PRVA 1OPIA 1YG0A 4YP3A 1G4CA 3VCDA 3CMQA 5AJ3J 3P5TL 2E7XA 2J9DA 3FZ2A 2IVFB 4YDDB 3D2WA 1J2VA 1TU0B 4DI6A 4XDCA 4YQWA 2AT1B 3KK1A 3AJ2A 2Q43A 2H5JB 5KFYA 2C2ZB 1BQXA 1QSSA 3CVKA 2DCLA 2YNHB 4OYMA 2HEKA 1T8EA 4KJIA 2W24A 4ENOA 1IBCB 4LF8J 3I87A 1TL1B 3TARA 4P2MA 2M8DB 4KE5A 2DO0A 2Y8YA 3LP1B 4QWBA 2NXJA 5DZ6A 5HQ8A 3J81Y 1H7XA 4M5GA 5LSRA 4NI2B 2CQGA 3PNIA 4R25A 1J5OB 3I6PA 2XMMA 4IH7A 1WHWA 3KLVA 2BM0A 4QOTA 3KLEA 3HM9A 4DR3J 2IDLA 5ETVA 3IC1A 3FEYB 3DOKA 2RMLA 4CLPA 3N5FA 1S12A 2EC2A 3BKFA 1RT1B 3P6YC 3GR1A 3L9ZA 4YB1P 3FEXB 4OYBA 2ZUAA 1OYEA 1SJQA 4DF8A 4LR9A 4DPXA 2HBRB 1F5CA 5KFHA 2VB6A 5GMKa 1RT3B 5EWFA 3HSGA 2LQJA 1YVFA 2P5VA 4OYOA 1T3OA 2AJ2A 2LQ5A 4F26A 2HRYA 2WRMA 2MQOA 2ZM6J 3UCUP 1I94F 2HAFA 4B3MF 4G6VB 4KIAA 1Y00A 3QSIA 4DCPB 5LSLA 2QLBB 4A8KA 2V69A 2ALYB 5D0EA 1NAQA 3VAHA 4K8RA 3R6GB 4J90A 1TUGB 4B17A 2ACYA 1RZMA 1UKUA 4ZVHA 1IBKJ 5KFLA 3D3BJ 4LFAF 1TL1A 3AQPA 3O44A 5IM0A 3LP1A 2J9EA 2XY6A 1CSJA 4NI2A 1NSPA 2DPJA 5K8NA 3LA0A 2QGFB 1IUJA 1J5OA 4L73A 4HI2A 2V67A 4QIVA 3KUEA 3IS9B 2QG9B 1S1XB 1NK7A 2PD1A 2VF3A 3IWXA 4RU2A 1T9VA 4ECRA 3I9V9 1NKBA 2M9KA 3PIPQ 2ZH5A 4OZ5A 1CJKB 3G86A 3X3UA 1TK5A 1SKWA 1LQ9A 2HFOA 1QY7A 2OJ3A 1VGYA 4XDDA 4J9OA 4A4JA 5D4LA 4WU2A 4QQBA 1S9EB 4NA1A 3AXKA 3CCQS 1RT3A 3KKFA 3BQ1A 3H2LA 4DQIA 2BVZA 4PAAA 3QZ8A 5AJ3F 4F2RA 2QV6A 1I5OB 5F3ZA 1VQ9S 5CHCB 2AJ1A 4DR4F 1PBAA 1YKWA 3DN9A 1RWMB 4F36A 4J9MA 3T5JA 2XWYA 1VC0A 1RT4A 1SKSA 3IFEA 1RWPB 2I5JB 1GTEA 3FVYA 2NREA 2GO9A 1LEOA 1XR7A 3CCWA 3K7RA 2QSWA 4Y65A 3MWBA 3EGVA 4U8VA 1P1TA 4LF8F 4HI1A 2JDJA 1EZZB 2EKYA 4ZN3A 2FLNA 3IS9A 1S1XA 4NLVA 4QWEA 2J0XA 2HFSA 4OI3A 1RJJA 1AFJA 4DR5J 3I4HX 3A1YG 5C7PA 2OKQA 4H4MA 2ZOFA 1B70B 1CJKA 2MYFA 3EVMA 1N88A 3B8HA 2A18A 3OLBA 1U0HB 2GVZB 4DR3F 3TX0A 4FVCA 3ONQA 4HEA9 3T41A 1I1GA 4QU6A 3MUTP 4ECTA 4DR6J 4B3SJ 3KLFB 3VAIA 1HHTP 1NK4A 3M6XA 5E2QA 4WP8A 2OTJS 2E29A 1R6VA 4H4KC 3V2UC 5AE3A 1K44A 5ETSA 3H59A 2CPEA 3KXDA 1NBEB 3RBEA 2CPIA 2CG4A 1L5UA 5F8JA 4HTIA 4RR5A 1VJQA 1N33J 3MOZA 4EUVA 2COLA 1PGZA 3MAAA 1WC3A 1Q7YT 1M0SA 2ZM6F 1S6UA 4KHMA 4ZVOB 2I5JA 5BJRA 5KT5A 1UVNA 4Z7CA 2QLXA 3Q86A 2F4VF 3TVYA 3ZO7A 1U1RA 3GV5B 3CDBA 5KG2A 1EB0A 1AW0A 2M0GB 2QA2A 4P71A 1ZA1B 2CQCA 2IYGA 1V9OA 4HLBA 3M6UA 2E9RX 3BF4A 2DNYA 1JJ2R 1PC4A 3C15B 4JI2F 4CT9A 3HHLB 2BABA 3PHTA 1W7WA 4CNYA 3KJQB 4ES3A 4KT0C 2XMVA 1TFYA 2R2UA 1KVKA 4H4OB 5K20B 3IBWA 1NHKL 3VALA 5EGYA 3I55S 1U0HA 2GVZA 4CRJA 2AWZA 3GFXA 1VK8A 1DAXA 3MEEB 3FCHA 2YKAA 4M8LA 4E0DA 3LWMA 1M5VC 3KLFA 4ZCKA 2OELA 1W25A 8RUCA 1WORA 2F4FA 5G4DA 4GMKA 1N6QB 3IGVA 3N0VA 3NGSA 2RF2B 3M7VA 1U1QA 1EQ0A 4NCBA 1WF1A 5L1IA 4TY9A 1NUEA 4DJBA 2KL8A 2EPIA 1VJWA 5L39A 1UA1A 1HKAA 3MM8B 2CJBA 4WXOA 2JNJA 1RKIA 2AKWB 1VQKS 3PCOB 1RCXB 3ZZRA 4Q8EA 1CQMA 2KXNB 3KJNB 3C15A 4USIA 2IHR1 3HHLA 3FJ2A 4R0JA 1GMVA 1M5HA 1FNXH 3ICLA 1Q53A 3ZTPA 4H4OA 2NXNA 4OLPA 4NE9C 2DGVA 2DR7A 1S10A 1C2PA 1KNZA 3AOBA 1MROB 3PO4A 4DR5F 3U1NA 3ZC4A 1S57A 4QR2A 1TKTB 2BW7A 3HFZB 2BJEA 4HDGA 5L1LA 2GAHC 4DSFA 1RAIB 4P2FA 4DR6F 2R2RA 1SJFA 4B3SF 1ROFA 1N6QA 5IS2A 2RF2A 1M5KC 1RBLA 1HYSB 5H9EJ 3JYTB 2NXUA 3CGIA 3OJSA 5F8LA 4O44B 2LA6A 2OEMA 4LQ9A 4N8OA 5AE2A 3PX0A 2KG1A 3M8RA 3G96A 4C8OA 3A8KA 1N33F 4KH1B 3TQEA 4DFJA 3MM8A 4O3QA 1FI4A 3H0PA 3FRYA 3OR2B 2EFOA 2CVEA 4AL7A 2Y0SD 5KG1A 5GADU 1VOMA 4U6PA 5B0FA 3MD1A 1FE0A 3THVA 2VKRA 4TNOA 3SDEB 2CQPA 3KK2B 3SIPB 1H3DA 1ZPWX 1JXEA 1RT6B 3EWGA 1Y3JA 5CZXA 2K1RB 2BKNA 2ZH6A 2DD8S 5AXKA 4U96A 4USHA 1MROA 3TJAA 4J9RA 1RTZA 2VG6B 5F0UA 1JMTA 3OHAA 3BSAA 4RBUA 3CTRA 1UTAA 4OI0A 3ZNJ1 4NYZA 3FBFA 1WHXA 1S6OA 4JYAF 5KFVA 1K8AT 2J6UA 2CZVC 5HI7A 1JJCB 2YWEA 5ETLA 1HYSA 3JYTA 4USUA 3M8YA 3ZNUA 5C2CA 2YQ0A 2V68A 1DARA 4O44A 1ELOA 4M63A 2BE9B 2VJUA 5KFKA 1CS4B 1UPMB 1SC3B 4M5JA 1P9QC 2OTLS 2UUWA 4EYHB 4B9LA 4LFCJ 4DSKA 2DNRA 4F0HA 4ZJQA 1LK5A 4K4WA 1EAYC 4KB7A 3OR2A 1WOSA 3DHWC 1RWVB 2QA4S 5DS7A 4IRCA 3M32B 2Q3PA 1RWNB 5D6GA 2OLWA 2DGXA 2W7OA 4FKYA 1YJRA 4C8KA 3TAPA 4OZ0A 4UT4A 3Q8YA 3GIIA 1IKVB 3KK2A 3LAKA 2E1RA 1SKUB 4LR8A 4CDIA 1RT6A 1UFWA 4FYVB 3R2CJ 3NNHA 2FJAB 3ZXWA 5A76A 4ZP9A 4N7TA 2D1CA 2LQBA 4ZPBA 1WSRA 2VG6A 1ZBTA 2YWGA 3LO3A 5DG8A 5BXIA 1WTFA 3AFGA 3PY8A 5KOWA 2HHTA 4TXSA 2FLOA 1KDNA 2CJQA 3QATA 3RAMA 4DQQA 5IC4B 4J9QA 2BOPA 3M05A 3AT1B 3HT3A 4WZMA 4LF5J 4HL9A 2AGOA 2F1FA 2IM2A 1RGVA 1MMDA 2RQMA 1R8BA 3S1TA 4F25A 5HANA 4LIWA 5BR8F 3BPSP 1FTRA 3G82B 1FXRA 3ILOA 1S7IA 2EXUA 1MLAA 1VRTB 1ACMB 1UVLA 2G2YA 2A6OA 1U6FA 1RAEB 4K4XA 1IBMJ 2X51A 1HWUA 5HBMB 3M32A 2WB4A 3OUYB 3B78A 2VBYA 3SEOA 4B9VA 4J9KA 1Y9OA 1IKVA 3J7YI 1ZAXA 1IQTA 1XN9A 4DL6A 1V5IB 2E5HA 2H48B 2XBPA 2OIHA 2J9CA 3M8PB 3K2YA 4QYRA 2V8PA 2DHAA 4RW6B 4WKYA 3MM6B 2CQIA 2X1GA 3RU0A 2RS8A 1FJCA 4NOHA 5B09A 2JVOA 3JS9A 1DY3A 2I38A 4EWTA 2VHGA 4YOEA 4F7VA 5KFEA 4U7UD 2ROEA 3BQ2A 1PYOB 2FVSA 3GWCA 2W2OP 2KDOA 2BKPA 2OHDA 1RAAB 3BGOP 4Y00A 4R0EA 2XEXA 1RAFB 2XO6A 3G82A 5I42B 2LP4A 4CO1A 1X4DA 1QJHA 4DFKA 1SH3A 4KAIA 2VQEF 1SVDA 4I2QB 1VRTA 2HFVA 1SI9A 4RX6A 4MJKA 2J0WA 1R3NA 4F0MA 2MTLA 3D6TB 1EARA 2HVIA 5D0HA 4ECQA 3LPYA 3TUIC 4ICLB 1J5EJ 4GC7A 3UDEA 1F1BB 3KK3A 1KVJA 5DQGA 2MY8A 3OUYA 1S1WB 5E33A 4MAKA 1LWFB 3B4DA 4TU9A 2B8QA 3ZZYA 1N5VA 4I6YA 1Q16B 2W25A 1NK5A 2VOPA 2D3ZA 1UP1A 3R5JB 5L1KA 2YWFA 2BZ2A 2M70A 4WJBA 1R0CB 1HNWJ 1PG5B 4B9UA 4DFPA 3M8PA 3UNYA 4OX8A 4RW6A 1NNDA 3QYYA 1TQLA 3OXLA 2ADBA 4CLSA 1HNIB 5HVGA 4OV6A 3W9IA 3RRGA 4A8MP 3Q8PB 2K06A 1IJEB 1RWUA 4ID5B 3TUJC 2G9OA 3D67A 4DQSA 3FUYA 4DU8A 1PO6A 3MTKA 3KFWX 2WZ1A 2DITA 3F56A 5FIIA 4CP5A 3MUMP 3WC0A 3CDEA 4RWWA 4ZVSB 2HMIB 3GG1A 1NK8A 3QGGA 2BMBA 4Y2CA 4A8QA 4I2QA 2J6SA 1S59A 4DV5J 2Z4PA 1LWEB 2DGTA 3VGTA 3JSRA 1YQHA 2ZH9A 1ZA2B 5K14B 3W9HA 1R6YA 4ICLA 5AT1B 2JEFA 1Y5IB 1AUDA 2DNPA 4WFAQ 1YBUA 2WW8A 3HCXA 1S1WA 1LWFA 2RIJA 5DQHA 1JLBB 2DNHA 2UUBF 3SFUA 4LVOP 3Q24A 5CCLA 2HQDA 3PW4A 3HHLC 1X4HA 1NH8A 4K4VA 1CC8A 4HHHA 4RBTA 4USTA 4AD6A 3JXOA 5B0EA 4JI1J 3R5BA 1WEXA 3M30A 1N8RT 3QIPA 2QLJB 5IQ6A 2IA6A 2BM1A 1QVFR 2VODA 4JUZA 5EDWA 4X4TA 1HNIA 4X65J 3OSNA 3OPKA 2K7KA 2BUNA 3PEJA 5K8MA 3RGIA 4ID5A 4ERDA 1VDHA 4OL8A 4ZVUB 5ETRA 1U8SA 4NXNJ 3CJ8A 4PG5A 4CI0B 3FQLA 1OQ6A 1GX5A 1A0OB 3V81A 2HMIA 2AYGA 2IJRA 1LKZA 4TLQA 5L8RC 1LWEA 4CLLA 2N4DA 2G1DA 1O6XA 1NO8A 1R89A 4W4MA 5K14A 4LBIA 1ZH5A 3MR7A 1KD1T 1SXLA 1BC6A 2WVCA 1JLBA 4DN9A 2GFFA 1AT1B 3OTOF 1J5EF 1F0XA 4IR9A 1GAOA 2FJXA 3GR0A 2BQRA 2ZNYA 2Z0GA 2HQFA 3DLLQ 2XB2D 1Q8IA 1IM6A 1T9UA 1HW8A 3BGUA 1LW2B 3H42A 2XC9A 1TMJA 3T5HA 4YB5A 2HHWA 3BSNA 3CW2C 4ZK7M 3JSMA 1JQGA 2RRAA 2YBVA 2YKMB 1HNWF 1YRTA 2HURA 2JZ5A 2MZQA 3D7SB 3QJLA 1KEKA 4OHYA 4OZ2A 5LXRA 2D69A 3MCMA 2WSFC 1Z1ZA 3DDIA 2C22A 1U26A 4LFBF 2IAJB 2VV5A 4ATNA 1RE1B 4N41A 3CC4S 4DFMA 3ADAC 3THTA 2ZC3A 5LMNJ 4EZ6A 4DF4A 3PM9A 1DQ9A 1U2RA 2DHXA 4MIBA 1YRUA 2GVDB 2RSQA 3EMTA 4WFZA 4PPZA 2YTCA 2YWWA 4NEYA 3BO2A 4NLSA 4UY85 1A6LA 5IV4A 3QRPA 3VAFA 2WBRA 3HSZA 4O3RA 1HMVA 3RW6A 1X0PA 2OO4A 2FVCA 1V3RA 2PMWA 1JLEB 1D9DA 2R7QA 4DV5F 3J80Y 3JAMY 2QSFA 1Q4RA 3I0RB 1SJ3P 3GE9A 2SXLA 1FKOB 2PFDA 2I8EA 2JEIA 3A4TA 3CJ0A 2V4JB 2LA4A 1REVB 5JVHQ 2F8MA 1M1HA 1VC5A 1LW2A 1R8HA 2KM8B 3GV7B 1RAHB 2RJZA 2V63A 4JI1F 3DC2A 2YKMA 2VZ9A 5IV3A 4KHPJ 1LXJA 5GAEI 3TR5A 4IG0B 2PT0A 2BDPA 3JSYA 1FTCA 1M5OC 4X65F 4QYZK 3GJTB 1S1VB 3DRXA 2FZGB 2FHJD 2IAJA 3S7RA 4BC9A 1ZPVA 3JTOA 2FJBB 2IDEA 4KBIA 2ILZA 3P45B 4OFZA 1K1QA 4PG6A 2GVDA 4ALZA 1PILA 2QN6B 3A3PB 1VQPS 2B6AB 2FC8A 3LGMA 4CNZA 4XK8C 1JLEA 3MCNA 1WJ9A 3I0RA 4P75A 3DXBA 1FKOA 2I0XA 3CWJA 3FFIB 3EGZA 5F0WA 2V4JA 4TYBA 1REVA 3IM8A 2BOAA 2IJFA 2QYGA 1FEEA 3CB4A 2Y0BB 2YX7A 1AB8A 3G8SA 4ED4A 4ID8A 3G2XA 4NZ0A 4W98A 3RZAA 3D1QA 1ZM9A 4G1QA 3ZZOA 4FNHA 1P6TA 1KVIA 1HQUB 3VVTA 4DSJA 3DYAA 2XTJP 5C25B 3RB3A 3TANA 1FCAA 2B4UA 4IG0A 1VI7A 2YKNA 2B56A 3KMQA 2RRNA 4DV7J 1DQ8A 1S1VA 1X8DA 4QW8A 3OTBA 1D8ZA 2F8HA 3S8SA 2XM3A 4ZKAA 5GAHU 5AXLA 2G2ZA 3AJ1A 1RAGB 5ETMA 2R7TA 2D9OA 4JV5F 2NPFA 4AQYJ 4FBUA 5CYJA 2YH1A 1D9AA 4I1TA 3V4MA 2O1PA 3MGJA 1B7FA 3B4MA 2B6AA 4LSLA 2FUG9 2VDHA 3TQ1A 4ANEA 4NL5A 1DLOB 3GILA 4DSLA 4URQU 2UUCJ 4NLXA 1FRXA 3CDWA 4LREA 2EG2A 4NLQA 3BPDA 2FYXA 5LJ5Y 5E3RA 4O0NA 1N4LA 3FFIA 3MXHP 3EICA 4F4WA 1TFWA 3ZZZA 1NH7A 4ECZA 3IGNA 3GMGA 4WFYA 2R7RA 3OVAA 1TK8A 1SKRA 2H4YB 1FF2A 3IR5B 2J7KA 2I2YA 2HWTA 3VVUA 2W7PA 4MYUA 3CJ2A 1F3VA 1BD6A 2JEJA 1HQUA 4TVAB 2H5IB 3EGWB 1W2BR 3BDPA 3NOGA 4KHPF 2O3DA 3EGNA 4YDXA 2DEJA 1TL7A 3R5AA 2F3JA 5HN0A 1QVGR 1YJWS 3D1HA 1HR0J 3JQJA 5B7WA 2MXYA 3TAQA 2O01C 3SV3A 4C3KA 1TZ0A 2IY5B 3BBCA 4Z7YA 2QFIA 2CVIA 3NNCA 3F44A 4KGZB 4RLEA 2GHPA 4FF4A 4CO0A 1DLOA 4Q44A 2EKNA 2HBZB 4OJHA 2VFSA 2VQFJ 3VV2B 4L74A 3H98A 5K8PA 2FJVA 3M8ZA 3AY0A 2RNEA 1WF0A 3NL0A 3PKMA 3CXCR 3CF5Q 1UWAA 1H98A 4P2SA 4JI7J 4ED2A 1EIYB 4WU3A 1K9MT 3NS5A 2DVIA 2DGOA 4TYAA 2GQQA 4OX9J 4WTOB 2J76E 3QO9B 5FDLB 2AV5A 2MKCA 1ZZNA 4P9SA 4UQTA 2CPXA 1NLKL 3OFFA 1VQNS 1X31C 4J9PA 4F4ZA 2J7UA 1WC4A 4FDFA 3F41A 5KOXA 4ZHRA 4WKRA 3CO0P 2Z30B 1SC4B 2XLIA 3LW5C 4QWDA 1KHWA 3D28A 2KVQE 2F40A 2MKKA 4O0IA 5KFUA 4CLKA 3VAJA 2JJ4D 4WK3A 2VA3A 4NCGB 3T3FA 5H9FK 2M5YA 1MN7A 3EXCX 2C3OA 2VC0A 3I5AA 4C0HA 5F3TA 1HNXJ 1T02A 1ZOTA 2RHSB 1JJHA 4C3MA 1I3OB 1LK7A 4C8NA 1LWCB 4MH8A 4A47A 2JC0A 1BY9A 4UUWA 4GRSA 5B0AA 3ZTRA 3HPOA 2AD9A 3H25A 2LXUA 3I31A 3W65A 4I56A 5CD4A 1RB0A 2CJ9A 2VASA 3QO9A 5FDLA 2HVZA 4X66F 2DT9A 3OD2A 3G6ES 2Y1RI 4PABA 1HWJA 2CYYA 3K57A 4IDKB 4ZOSA 4N76A 1RSCA 2HS0A 1M1GA 1HLWA 4ZP8A 2DNQA 1RTIB 1ZYQA 5CZVA 4OV1A 1XNQF 4ZPTR 2LEPA 4DDFA 3UE2A 5IOLA 2IMWP 1KTVA 4MTPA 4DWIA 1ITPA 2K3KA 1TKDA 2D41A 5LOQA 1S4EA 2RVJA 3POTB 3DOLB 3W2VB 3FC9A 4F0KA 2V8GA 2BJ9A 4XPEA 2KRBA 2VBZA 2DPIA 2CDRB 4ETXA 1LWCA 5L38A 4CM2A 2ZVIA 2LFVA 2V2KA 1B0VA 5KT2A 2BJ8A 2A3JA 3ELHA 1EHWA 3QT8A 1IR2A 3LGNA 4NXMJ 3IR6B 3MECB 4ZVRB 1PYSB 2Q79A 2VQFF 1RADB 3G9CA 5D0GA 1XR5A 2M2BA 3WIVA 5J2QB 2B0GA 3EDRB 2U2FA 4USWA 3CCVS 5LM7E 4CLWA 4WE1B 1YZ7A 3HHKA 2HVHA 3V6HA 4KC5A 4OX9F 2DH7A 3D66A 4IDKA 2WCXA 5KFRA 2Z57B 1GMWD 4QBUA 1OY8A 1RTIA 1TK0A 3HD2A 3GJRB 1UAWA 2MQQA 4Q8FA 2KHCA 3SSSA 5KG4A 3C16B 3W7BA 2C2KB 1ZM4A 3TA2A 2HIQA 2R7SA 2V2QA 3A8EA 3NMRA 4XAKA 1UWBB 2POKA 3DOLA 3R6LB 4B3RJ 2F5GA 2O5DA 3THPA 4OZLA 2YNIB 3I96A 3E2EA 1U09A 2NXEA 3DLEB 2DY9A 4KRWA 3UWTA 1HNXF 4LBPA 5KFPA 1S0MA 2G4BA 4UOFA 2NSBA 2YKPA 4IO9Q 1U48A 4DUYJ 3R1LA 4DV6F 3MECA 3UQSA 3TVZA 4DL0C 4K4TA 2WSEC 2K7JA 2W2NP 5J2QA 1XMOJ 2HHVA 4ZA1A 4WE1A 3KUGA 4PCQA 2PDAA 2GQ2A 2PIIA 2KM8C 1P8GA 1S7HA 1NSKL 4E8UA 4JB8B 1FD8A 4OZ1A 3DHXA 4F4XA 1PYTA 3CJTA 4QIFA 2M88A 3ZZ0A 1JWWA 2MQPA 5DDPC 3HMJG 3H40A 3CD0A 3C16A 2MLZA 4RUAA 2GQCA 3U7JA 5KG0A 1FXDA 1HI8A 5E3QA 4KV8A 5HSPA 2F7VA 1SL2A 1EKSA 2IRYA 2V8VA 1O8BA 3T19A 1B7YB 3DDKA 1C4CA 1UWBA 1UW9A 2V94A 4MMOA 3DXSX 1UVKA 2JLGA 1U6BA 2ZBQA 3EJMA 4M5NA 4ZPDA 4I67A 2YNIA 1WG5A 1X9SA 4K0KJ 4DR2J 3DLEA 2VFVA 1K1SA 2VL1A 1ZETA 3D5MA 1R27B 3HXMA 3O2IA 3Q22A 3OHBA 3FCVA 3HVTA 5A8KB 4OHVA 4DR7J 2EBGA 2JFKA 3CCTA 2XZWA 3NOCA 1RTJB 2N3LA 3OXFA 3BN4A 2J5AA 4OYPA 2DH9A 3BH7B 4NXMF 3UD3P 3HJVA 1HNZJ 1MWQA 4LRDA 2CPYA 4FYWB 2IPOB 2V8HA 2UUAF 2CJXB 2QE5A 4LRBA 5THWA 9RUBA 1W2IA 1PSDA 3SBMA 5KG7A 1N54B 3HX9A 1XEZA 1U47A 2X1FA 1GK8A 4DUTA 1EP4B 3MR5A 1XNRJ 3GFHA 1JNZB 3UN5A 2ZUGA 2WTFA 3RBZA 1SUQB 2QT7A 4M1KA 2UU9F 3EZOA 3RAXA 4KGXB 3HD1A 4NYPA 1UJ4A 4ECSA 2AGQA 2AZ3A 1P9YA 4QIWD 2RILA 4HT5A 3IRWP 3LAMA 3LPEA 2R3VA 4YB6A 5BYSA 5DM6Q 3G87A 1VIOA 2QO3A 1AYEA 1LXNA 3T6JA 2BRKA 2RAQA 1RHMB 4HTJA 1U02A 2CWKA 4B3RF 1Y0HA 3QLHB 3W1YC 3J7ZT 2HLUA 3FZBA 1NDKA 3VTIA 5A8KA 4QU7A 2EFQA 2E5GA 3MPUB 4J7CA 4K4ZA 2GAGC 2GC8A 1TV6B 2DNNA 1RTJA 3CCJS 2W7AA 4LR7A 2HVDA 3TA0A 1WG4A 5DLFA 1U1MA 4DV3J 2QEXS 1NHVA 2JC1A 2ZVSA 1VLOA 2RH3A 1T9YA 1YSJA 4PQAA 5J1EB 2F9JA 3HT0A 4JI8J 3V4IB 1KQFB 1XMOF 4NASA 1HHSA 4ED7A 1EETB 3ZTSA 4FKXA 2RS2A 4DLEA 4EBDA 3W5XA 4A8OA 2K3IA 1HI0P 1JLQB 3MM7B 5SUHA 5DLGA 5A0YB 3TX8A 1EP4A 1MN9A 2H4WB 4DPOA 1BMQB 2HS3A 1E6YB 3KDOA 3CCRS 3TOQA 1WOOA 3BQ0A 1CBKA 3CJRA 1UMJA 1Z2LA 5EN1A 2YVSA 2HHSA 4DG1B 3DM2B 3MMAB 3C2PA 2C3PA 4JV2A 4FF3A 4JI0J 4WFNQ 1RYRA 3TAMB 4P74A 1RHQB 5B0CA 2B8PA 1T95A 1N32J 1W26A 2XLJA 2J8SA 3QLHA 1SIZA 2V2VA 3H2UB 4UZBA 3PIOQ 5BYRA 3FBCA 3FCWA 4LF4J 2YY3A 4DR2F 4QW9A 4DL4A 1X9WA 1TV6A 4K59A 5L9NA 3NS7B 6AT1B 3N4WA 4NLDA 4DR7F 1TELA 3N6LA 1P27B 3WX8A 5J1EA 2I9SA 3V4IA 3HSJA 1EETA 2UXDJ 2RQKA 2UV8G 3SQOP 3Q23A 1JLQA 3MM7A 3UVJB 4F3MA 1S9GB 5KFCA 2FQQB 4LF1A 5A0YA 1NDPA 5JJBA 1X4EA 4DS4A 3NGKA 2CQ2A 2DGSA 1CVJA 1E6YA 2R7OA 5HK4A 5CYMB 1YJ9S 3F73A 2B9EA 2ZH1A 1CQNA 3V6DB 4YR3A 1XNRF 3MCOA 4JBCA 1IXKA 1PJ5A 4DG1A 1NJYA 2C3YA 3VQSA 3DM2A 2IRUA 1FJEB 3MMAA 2PN6A 2DGQA 2HPUA 3TAMA 2JOQA 4Z2XA 2GCFA 3M1VB 1BWEA 4IO1A 2ROPA 3A3OB 1GT8A 3W2WB 3NCQA 2CKWA 4F8RA 2BV3A 1F2GA 2KYXA 3BR8A 2YNGB 2FJEB 1Q81T 2EBEA 4O3PA 2XY5A 1G7CB 3KDNA 2CIMA 3JAMU 3FQKA 4J37A 3OR1B 2VPXB 3GSDA 2QA4G 1V3SA 4E2FB 3UI3A 1C0UB 3IWNC 2HIYA 4IH5A 2N4CA 1IR1A 1VISA 1VQ6S 3UVJA 4ILMA 4BS2A 4JI8F 1S9GA 3JQMA 2W2MP 4NRTA 2HHXA 2ZITA 4DEZA 1SV5B 5GAGU 3AJDA 1IKWB 4JI4J 3FSIA 4YMEA 4PXBA 2EFPA 5CYMA 4L3KA 3TRGA 4K2XA 1NJIT 2G13A 3EPGA 2XI3A 3V6DA 2AP6A 1EJ7L 1HA1A 2V2ZA 4CH0S 2BYCA 4U7UK 2HK2A 3H20A 5FLXU 1S0NA 1IKYB 3K8VA 3M1VA 4IFYB 2OMLA 1PJ7A 3W2WA 3PYEA 1QAYA 1OMSA 2DEIA 1Q0NA 4JI0F 3J81j 2YNGA 1FK9B 3RBDA 2HS4A 5GAGI 1QDUB 2MMYA 3BH6B 1N32F 4GKJJ 4G1PA 2KTQA 2LVWA 2WBMA 4KO0B 1H0HB 3L7PA 2CQ1A 1WI6A 3OR1A 1LV5A 4FXVA 3VAGA 1N52B 1CJVB 3PJXA 1MSWD 1IJFB 1MU2B 4W90B 3MMJA 3UFCX 1C0UA 5D77A 3PW2A 3IAM9 4GKKJ 5HP1B 3CJQA 3HO1A 2L41A 2BKOA 4DOZA 2KFYA 2KHDA 2EK1A 1C0TB 5A2QY 2BX6A 2KFZA 5IXUA 2R7XA 1RWKB 3CEDA 4IOCQ 1IKWA 1U0SA 1TKXB 3OFGA 1KLNA 2FVPA 5J2PB 4PG4A 4X62J 1YIJS 3I56S 4F3OA 3VZIA 3NGUA 3SFGA 3CDAA 4LSZB 2EW9A 3CJ3A 3C3LA 2ASJA 1YJ7A 4EZ9A 4Y28C 3GYGA 4RNNA 3TJ8A 2W9AA 3FEZA 3KNGA 3D0HE 1NPKA 1FVSA 4FPIA 3CCSS 1KP6A 2QJ3A 1FO1A 1IKYA 2W4DA 1ZM2A 4ZIWA 2R4FA 4RNHA 5CD4H 2Z2MA 4IFYA 2L3MA 2AYBA 1SPBP 3BSCA 3QFWA 3LH2S 4CYUB 2AEJA 4IRDA 3M2UB 4OX6A 4C9DA 2OPQB 4NLOA 3VAKA 2YNHA 4KO0A 1Y11A 3NEKA 1PC5A 1QD1A 4C2MA 3GP9A 1CJVA 3U1LA 4OZNA 3QGPA 4U67Q 2A2DA 2KXFA 4RNFA 3TA1A 2CQBA 4B9TA 3UN2A 1U1PA 2PEBA 3D4JA 2GV1A 2LXIA 5HP1A 2ZZNA 2FIUA 1SQEA 1OYDA 2HAIA 2EK6A 3FNNA 1VBZA 1M5SA 1CEZA 5DM7Q 2MZRA 1N5QA 1SJ4P 1C0TA 3D68A 1ZTWA 1SJRA 1TKXA 5J2PA 3G71S 5F8GA 1PIEA 3PYGA 1RT1A 4ED3A 5F9LA 1N56A 3DDNA 2HRTA 4AXIA 2ZE2B 2HVEA 1FDNA 3S01A 2LMIA 3MEKA 3ILIA 3NBPB 5B0GA 3JTPA 1UFKA 4CO4A 1X5SA 3UDLA 4CYUA 1NDLA 3NAHA 3M2UA 3PR5B 3VQTA 5KFJA 4URSA 2IMOA 2KJVA 5CABA 1YK9A 2OPQA 4PWWA 2OPSB 1U1NA 2AJQA 4XO0A 3JB9k 4K4SA 3AD9C 5C5JA 2XQCA 1MWYA 5EUHA 4U9RA 4GKJF 2XS2A 3QSYB 2JWNA 1FRIA 2MZTA 4PXEA 1KBRA 5M2PA 1BWVA 1VRUB 2DK2A 3DU6A 4YR0A 5DGBA 2XGPA 3W64A 3HFVA 4GKKF 3Q0AA 1FESA 3ENVA 4UQGA 1T94A 4K4UA 1O5JA 4WZQA 1LNQA 3H90A 2XMUA 1U1KA 3QT6A 2CNOB 4OYIA 1L3TA 2DCUB 2UZAA 4X62F 2ZE2A 4ED5A 1S9EA 2WOMB 3SYZA 1UVJA 3NBPA 4CLYA 1S79A 2GMLA 2HFZA 2ROGA 2P6TA 2IM1A 1XC9A 3IAS9 3AOAA 4ECUA 4OQJA 2C3UA 2AGPA 3BEGB 3P4UB 2XYGB 1RT5B 4DPYA 2PI5A 4TQSA 2GHVC 4ILRA 4DV1J 1WOPA 2OPSA 3N01A 3K5MA 1RISA 4C11B 1QUVA 3MFIA 3MAHA 2MKSA 3OT9A 2DIVA 5ETNA 1J27A 2LDYA 1JLCB 3H2VE 1SL1A 2UV8A 2GNKA 1F6TA 3UPFA 1FFSB 2OH2A 1IKXB 2K2PA 3B54A 3KG4A 5E3PA 4KGKA 3AAWB 3QGIA 1IBKF 4FS2A 3MTJA 1NSQA 2ZH4A 1D0EA 3GFYA 8AT1B 3W5YA 2FPHX 1VRUA 1T9TA 1HBUB 1M90T 3P49B 3PDNA 4CQ1A 3KLGB 2XMTA 3CCMS 3RJMB 2R8HA 4I69A 5KT4A 3BO3A 3UNGC 2XGQA 4LF7J 3PHEA 4OYAA 3AODA 4X2BA 4FYYB 4EU0A 4USVA 3BSOA 4JI3J 2JLEA 2F9DA 1GXTA 2MKJA 3A3NB 1VQ4S 2R8JA 2RHQB 5LXYA 4Z37A 2W2PP
chains in the Genus database with same CATH topology
2YX4A 3RZAA 3G8TA 3KLIB 3G6XA 3ZZPA 1G1XA 4D3GA 3D1QA 4E98A 1DTTA 1ZM9A 5A6PA 2MKIA 2BR0A 4PWDB 3QJPA 3POTA 4G1QA 2FHOB 1FRLA 2DGUA 3X1LB 2CPDA 3UD4P 4Q2MA 3ZZOA 3W2VA 2WOMA 3IO1A 4FNHA 4F50A 1KQGB 5ITHA 1P6TA 2KFNA 4CT8A 1KVIA 3C8YA 1QAJA 1HQUB 2MB0B 4DSJA 4P6QA 3TW0A 3BDEA 3RRKA 3R5DA 3DYAA 5C25B 2DR8A 3RB3A 1VFJA 3TANA 1FCAA 2B4UA 4IG0A 1ULRA 3MUVP 1VI7A 2YKNA 3OL7A 2UUTA 1QSYA 1GQEA 2LDIA 4C0OC 3RYLA 2B56A 3KMQA 4CH7A 2XULA 3M8QA 3PW0A 4OIXA 2RRNA 2YNFB 2AQ4A 1DQ8A 1RI7A 3M9MB 1S1VA 3MCSA 4IOAQ 1Y3KA 4OJ3A 5AXMA 3SCLE 3KLEB 4X4SA 3PW7A 1X8DA 3NAIA 2IM3A 5IT4A 1V3ZA 2RUGA 2AJ4A 2M4MA 3PJWA 3DOKB 1KFDA 3C66A 1D8ZA 1HW9A 2F8HA 3OTBA 1KOOA 4P7TA 4QW8A 3S8SA 4X4UA 4R8UA 2AX1A 2BW2A 1HBMB 4ZKAA 1WTBA 5IT0A 1DTQA 5GAHU 4Y3CA 1L3VA 5AXLA 3M30B 1Q1KA 4ELVA 2R7WA 3AJ1A 5KFOA 2EFNA 2J6TA 4N5SA 2HLTA 1OPIA 3OFEA 3QIPB 2VD3A 1YG0A 2FVRA 4B02A 2D9OA 2R7TA 4YP3A 5JUMA 4JV5F 3HZEA 4C11A 2NPFA 1FVQA 3VCDA 4ED1A 1NK6A 3DI6B 3I5CA 4FBUA 3P5TL 5AE1A 5CYJA 2YH1A 1D9AA 1JLCA 2E7XA 2J9DA 3FZ2A 4I1TA 3V4MA 2O1PA 3MGJA 1B7FA 2IVFB 3B4MA 1GX6A 3D0GE 3HHDA 2ASDA 1HL6A 2B6AA 4IH6A 4YDDB 4LSLA 3PFOA 2AYMA 1RP5A 2FUG9 3JTNA 3D2WA 1J2VA 3TUZC 3TQ1A 4IYQA 5J2MB 2IVMA 2QFJA 4NL5A 1DLOB 3GILA 3CE8A 3QWPA 4LF9F 4ZVEA 4DSLA 1X4AA 4URQU 4WYWA 4XDCA 4I2PA 5I3UA 2HGNA 4OI2A 4YQWA 4NLXA 4DL3A 1T05B 1JLFA 1FRXA 3ITHA 2Q1LA 2M3DA 3KK1A 2ZH2A 3MMCB 4FZVA 1QAIA 3AJ2A 2Q43A 5KFYA 3CDWA 2EG2A 3BS9A 4NLQA 1TAUA 3NS6A 1BQXA 1H6KX 4RW4B 4ZP7A 5LJ5Y 5E3RA 1QSSA 2EG1A 3CVKA 1N4LA 3FFIA 3KLGA 1N48A 2DCLA 2YNHB 2B51A 3MXHP 3V81B 2BANA 4F4WA 1TFWA 1RQ0A 1T8EA 4KJIA 3ZZZA 2W24A 1NH7A 1X5TA 4ECZA 3IGNA 4OHXA 3GMGA 3O5TB 1SIWB 3L3CA 2MQMA 3E01B 2V4QA 3N79A 1NK0A 2KU7A 4IFVA 4WFYA 2PMZD 3EPIA 2R7RA 1RT7B 3I87A 3OVAA 1TK8A 1TL1B 3O3LA 1DJ0A 1QAXA 1SKRA 2B4VA 3TARA 2DR5A 1FF2A 2HHUA 1FT8A 3IR5B 4YB7A 2JRSA 2M8DB 4DV0F 2LU2A 2J7KA 2I2YA 2HWTA 3LOUA 4KE5A 2DO0A 2RT3A 3LP1B 2XHWA 3MEEA 4QWBA 3KLIA 5B0BA 2JHEA 1VLYA 4PWDA 2W7PA 3KOAA 5HQ8A 3J81Y 1H7XA 5J2NB 5LSRA 1B0TA 4MYUA 2CQGA 3CJ2A 2KH9A 4C8MA 3CMAS 1BD6A 4N8NA 1VQLS 2JEJA 1HQEB 3PNIA 4Y2MA 1HQUA 4R25A 2IBKA 2QMWA 2D9PA 1J5OB 3MHYA 3EGWB 1W2BR 1S6PB 3I6PA 2Z8QA 2NLWA 2DNKA 5I4MA 5KG6A 2XMMA 2C42A 4IH7A 1WHWA 3KLVA 2MSSA 3BDPA 2YNFA 2BM0A 1VHFA 5DDOC 2UVVA 4QOTA 3KLEA 2O3DA 3HM9A 5HLFB 4KHPF 1VQMS 3IC1A 3QAEA 1E6VB 3EGNA 3FEYB 3T9NA 2VA2A 3DOKA 2B7BB 2RMLA 4YDXA 1D9FA 1HBMA 3N5FA 2UVRA 1D1UA 3R5AA 2F3JA 5HN0A 2FC9A 2CPHA 4A48A 1SJ1A 1QVGR 1GXLA 1RT1B 2KT3A 1YJWS 1BLUA 3P6YC 3D1HA 3GR1A 3PRBA 4BWMA 4YB1P 3FEXB 3JSMB 5B7WA 2MY7A 2MXYA 3OTCA 1FJCA 4J9SA 3TAQA 2O01C 3QMQA 2E5JA 4C3KA 3DRPB 3SV3A 1TZ0A 1SJQA 2E66A 2QZ8A 2MJUA 4DF8A 5KFDA 2CVIA 3O8WA 3NNCA 3F44A 2JVRA 2RU9A 1F5CA 2ILYA 1R8PA 1F5BA 5KFHA 3PKYA 2VB6A 4RLEA 5GMKa 1RT3B 2LYVA 5EWFA 5F9NA 2GHPA 2ZZMA 4FF4A 2LQJA 3N28A 4CO0A 1DLOA 2GJ2A 5SZTA 1YVFA 2P5VA 1T3OA 4Q44A 4OJHA 2LQ5A 4F26A 1KFSA 2HRYA 2WRMA 2MQOA 3UCUP 3HHLD 1I94F 2VFSA 2BJDA 4KHRA 4B3MF 3DLJA 1T05A 4G6VB 4KIAA 3MMCA 3IR7B 3H98A 5K8PA 5AXNA 2FJVA 1DQAA 3AY0A 2MZ1A 1Y00A 2RNEA 4RW4A 2DHGA 4CO2A 1WF0A 3HFKA 4ES2A 5LSLA 4A8KA 1XR6A 2JFDA 3NL0A 4TQRA 1NAQA 3VAHA 3PKMA 3CXCR 3CF5Q 4MIAA 4O4GB 1H98A 4P2SA 3HKZD 4WYLA 4ED2A 3DFEA 4WU3A 1K9MT 3NS5A 4B17A 2DVIA 2ACYA 2DGOA 4TYAA 2GQQA 3TI0A 1UKUA 4ZVHA 3E01A 2PA8D 3KG1A 2I1RA 1HFEL 2J76E 5KFLA 1OSCA 1RT7A 3QO9B 2ATLA 4LFAF 5FDLB 2AV5A 1TL1A 1JKHB 1HMVB 4NA2A 2NSCA 2MKCA 1ZZNA 3K0JA 4UQTA 2CPXA 3S6EA 3M8SA 1RDRA 3AQPA 3O44A 3OFFA 2DR9A 4LF7F 1VQNS 5IM0A 2ZJRQ 5A6WA 4J9PA 1OO0B 3LP1A 4AUKA 4F4ZA 1URNA 3KHGA 2J9EA 1TKTA 2J7UA 3AQOA 2P9CA 4JI3F 2XY6A 1CSJA 2YX1A 2VOOA 1GH8A 3F41A 5KOXA 4ZHRA 4WKRA 2DPJA 4HVZA 2HGMA 5K8NA 1HQEA 1HPZB 2ASLA 1IUJA 1J5OA 1HNVB 2VFUA 1G6BA 4HI2A 2XLIA 3LW5C 1S6PA 4QIVA 4QWDA 2FY1A 3IS9B 1S1XB 2MGZB 1KC8T 1NK7A 1ZAWA 2PD1A 1YITS 1KQSR 1KHWA 3D28A 3IWXA 1U1LA 4RU2A 4QYZJ 2N7CA 1UETA 4ECRA 3I9V9 2F40A 2MKKA 4ZCIA 1ZAVA 1NKBA 4O0IA 5KFQA 2M9KA 2YQ3A 4PXDA 5KFUA 3PIPQ 2ZH5A 2FLLA 3QJJA 1E6VA 1CG2A 3VAJA 5F8NA 2P6SA 4OZ5A 3G86A 3RAQA 1KN6A 2JJ4D 4B9SA 3X3UA 4O3SA 3T1AA 4WK3A 3MFHA 3PEHA 1TK5A 2VA3A 1SKWA 4NCGB 1HI1A 2GIQA 4F4YA 1LQ9A 2HFOA 3CD5A 2Q6CA 1QY7A 3T3FA 2OJ3A 1HWIA 1VGYA 4XDDA 1FRMA 2M5YA 3CJ4A 4J9OA 2GJIA 1TKZB 1UVMA 5KFMA 4DUYF 3SXLA 2DNZA 4A4JA 3EXCX 2C3OA 3NRBA 5D4LA 3OJUA 2VC0A 2A10A 3DRPA 3I5AA 4WU2A 4C0HA 2HWIA 5F3TA 4QQBA 4QR1A 1T02A 1S9EB 1ZOTA 2B9WA 2J0SD 1WEYA 1JJHA 2JLFA 4NA1A 4B08A 4C3MA 2B5JB 1LK7A 4QWAA 3CCQS 4X84A 3WX4A 3E8OA 1RT3A 4CO3A 1TVRB 3KKFA 3BQ1A 3H2LA 4DQIA 4R5PB 3CO9A 2BVZA 2PSZA 3T5LA 1WG1A 4DL2A 2CQHA 4C8NA 3QZ8A 2FGCA 1LWCB 2ZC4A 4MH8A 5AJ3F 4ZCMA 4F2RA 4A47A 3BGFA 3KWMA 1S48A 2BE2B 2JC0A 2QV6A 1BY9A 4ZCLA 5F3ZA 3RW7A 4LT6A 4C97A 1VQ9S 5CHCB 3U1MA 2IM0A 2AJ1A 4UUWA 4DR4F 5B0AA 2FVQA 3HPOA 2AD9A 3MPYA 3H25A 3E3XA 3DN9A 2KXHA 5E41A 2LXUA 1TL3B 1N0UA 2CPFA 3SDEA 2IJNA 4J9MA 3IRXB 3T5JA 3GZ7A 3I31A 2XWYA 1M1KT 1VC0A 4O4GA 1RT4A 2FHJA 1NJXA 1SKSA 3IFEA 2YWHA 2I5JB 4YR2A 1GTEA 2CQ0A 4A8XA 3FVYA 2FD2A 4I56A 2NREA 2PA3A 4L3NA 2GO9A 5A8RB 1KRPA 4BC7A 1X4GA 1AXQA 2QIFA 4LVNP 4C8ZA 2K1RA 3SI8A 2EFVA 2CJ9A 2VASA 1XR7A 2VPWB 2XG8A 2OFGX 4V19X 3CCWA 1SUQA 3QO9A 3K7RA 5FDLA 2HVZA 1JKHA 2AF6A 2QSWA 2DGWA 4Y65A 2ZH3A 4X66F 4ED6A 1U24A 1F9FA 2DT9A 3MWBA 3FMBA 4NX9A 2XS7A 4LQ3A 3O1LA 3G6ES 2HHPA 2GHWA 2BXJA 2Y1RI 2MZJA 3NGDA 3DLGB 1JNRB 1HWJA 2CYYA 1MWZA 3K57A 4K50A 1P1TA 3DCAA 4IDKB 4LF8F 4ZOSA 4HI1A 2JDJA 4NZ7A 2EKYA 4N76A 5HMYA 1NHUA 2HS0A 2FLNA 3SV4A 4ZP8A 5MAOA 1HNVA 3MD3A 3MM5B 1QE1B 3HK2A 2DNQA 4YHHF 3IS9A 4AFFA 5E3CA 1S1XA 2MGZA 4HH1A 1RTIB 1ZYQA 5CZVA 4NLVA 4OV1A 1XNQF 4QWEA 2J0XA 4OZJA 4OI3A 4Q0BB 1RJJA 3DRSB 4ZPTR 3CCES 4NCAA 1AFJA 3HVAA 5LL6d 2LEPA 4DDFA 2R7VA 3OVSA 3I4HX 3A1YG 3UE2A 2OKQA 1YRXA 4H4MA 4RUCA 2ZOFA 2IMWP 1KTVA 4CCHA 4X4PA 2OP5A 1VS3A 4MTPA 3CIZA 2MYFA 3VZHA 4DWIA 4K0KF 1N88A 3B8HA 3J7YU 2KYZA 1FRJA 2A18A 5CXTA 3E51A 2XNRA 3OLBA 2K3KA 2RKIB 4WTYA 1TKDA 1OS5A 4DR3F 3KTQA 2D41A 3M2VB 1TKZA 2ZD1B 4FVCA 2RVJA 2JEGA 2PEHA 3ONQA 4HEA9 1I1GA 5DRKA 5JXSA 2LEBA 2XI2A 3MUTP 4QU6A 3POTB 1FDAA 1VK3A 4G1QB 2FGOA 2XSFA 4ECTA 2ZBCA 4DV4F 1U25A 3KLFB 3VAIA 1NKCA 3DOLB 3W2VB 3M6XA 1NK4A 5E2QA 1HHTP 1YJNS 2UVWA 2VUGA 2B5JA 2OTJS 2RD5C 4D3HA 2E29A 4P7VA 2V8GA 4QWCA 4XPEA 3DYAB 3ENQA 4H4KC 2ZH8A 3UCZP 2ZJPQ 2QYCA 4ZVGA 2KRBA 2VBZA 1TVRA 2YKNB 4FXWA 3V2UC 5AE3A 4R5PA 4ETXA 2DPIA 4JV1A 3CULA 4PQUB 3H59A 2VG7B 2CPEA 1LWCA 5L38A 3DOMA 1CLFA 4G1IA 4HDHA 2KJWA 2V2KA 4N47A 2BE2A 5F8HA 1B0VA 3RBEA 4GO5X 5CH7B 5KT2A 4OI4A 2CPIA 2CG4A 4DS5A 1L5UA 5F8JA 1HNZF 2A3JA 3CT9A 4OHWA 2CRLA 4HTIA 3MOZA 1FHTA 4NWBA 3LGNA 4NLUA 4EUVA 2COLA 1PGZA 1FA0A 5FLXY 3IR6B 2C3MA 3MECB 1Q7YT 1TL3A 1M0SA 2NPIA 3T6BA 2KG0A 5KFXA 3IRXA 1S6UA 2ZM6F 4KHMA 2Q79A 5E0OA 4Q45A 3MOJB 2VQFF 5I3QA 3G9CA 2I5JA 5BJRA 1XR5A 5KT5A 2M2BA 4J9LA 2XY7A 1UVNA 4X4VA 2QLXA 5J2QB 2B0GA 5KFZA 5A8RA 3DRRB 4RNOA 5LSOA 2F4VF 1CPZA 2U2FA 3TVYA 4ZMMA 3CCVS 1U1RA 3GV5B 3CDBA 4Y34A 4WE1B 5KG2A 4LSLB 3H8YA 1AW0A