1YJTA

Solution structure of the cu(i) form of the sixth soluble domain a69p mutant of menkes protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 20
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjtA00
1S6UA 1VQYA 1W2IA 2HFNA 2W4DA 1GXUA 2RILA 2QLWA 2XMTA 5B08A 2OKQA 3F44A 2VH7A 2OD6A 1FEEA 2FHMA 1QUPA 2HLTA 1RJJA 2AJ0A 3HHLC 5B0CA 5IXUA 2GCFA 2GV1A 3LGMA 2ROGA 2IFXA 2FIUA 3K7RA 1KVJA 2K7KA 1FD8A 3QMQA 2FTRA 2OAUA 2IYGA 3VTIA 2VV5A 2XMUA 4A46A 4Y2MA 1CC7A 3HDSA 2OFHX 1TR0A 2KT3A 3HFKA 1FVQA 2PGCA 4OJHA 2IYIA 5B0AA 1N5VA 1N5SA 3E8OA 1Q8BA 1YJUA 1P8GA 2LQ9A 2XMKA 4ZA1A 1AW0A 2AP6A 4OJ1A 2QLXA 3IWXA 4FNHA 4NL5A 1IUJA 3GZ7A 4HI1A 1URRA 2RSQA 4DL0C 4F67A 1YJTA 2RMLA 1V3ZA 4HI2A 3T9NA 1X7VA 2LXFA 3CJKB 1AFIA 1FE4A 1K0VA 4HH0A 5T7LB 3WDOA 2XMVA 3BB5A 3HF5A 1N5QA 4HH1A 4FNIA 4EFAC 1U7LA 3FMBA 4Q2LA 1OQ3A 2G9OA 2HLUA 4ZOSA 4QOTA 3HX9A 5K9FA 5B09A 5B0GA 1OQ6A 1YJVA 3BF4A 5KAKA 2JDJA 3KG0A 2GFFA 2BBEA 1KVIA 2OMOA 1TZ0A 2BJEA 1OSDA 2KKHA 2ZDOA 1YRXA 2XMJA 3HHLD 1GXTA 1SQEA 4DPOA 2GA7A 4NPOA 4A4JA 2GGPB 5A6PA 2N4DA 2Q3PA 2PD1A 3MCSA 1JK9B 4HL9A 2K2PA 4Q2MA 2ASYA 2BYCA 3DCAA 1TL5A 3LGNA 4Y2KA 2L3MA 2N7YA 3HHLA 1Y0HA 1Y3KA 2BJDA 4U9RA 3IWLA 3HHLB 2LDIA 2CRLA 2KT2A 1X8DA 2EW9A 2ZDPA 4OIXA 1SI9A 1SB6A 5T7LA 2W4PA 3BN7A 3QGPA 5B0DA 2HIQA 1CC8A 1YG0A 2K7JA 2GGPA 3LO3A 1MWYA 1Q53A 3BDEA 1P6TA 3BR8A 4A47A 2K1RA 1ULRA 5F0UA 2HQIA 2OFGX 3CJKA 1WD6A 1AFJA 3DXSX 2XMWA 1TUVA 1Y9OA 3FGVA 4Y2IA 2AJ1A 2N4CA 4OJGA 3TRGA 2OD4A 1N5TA 1APSA 2RU9A 5B0BA 1TL4A 5B0EA 2ROEA 3UDCA 4DN9A 3BGUA 1Q4RA 3BM7A 1LQ9A 1FVSA 1OPZA 2ACYA 2AW0A 3TOQA 3TNVA 2QYCA 5F0WA 3KNGA 1FESA 2KYZA 3KKFA 4YDXA 1CPZA 2OP5A 3KG1A 2W4CA 2LQBA 1Y3JA 1MWZA 1R6YA 1XBWA 1VQSA 2FB0A 4YEAA 5B0FA 2QIFA 4OJ3A 3MZIA 5A6WA 3I9ZA 1FE0A 3FRYA 2HFOA 1Q8LA 1YJRA 4A48A 2K1RB 2BUNA 2XMMA 1KQKA 2ROPA 2GO8A 1X0PA 1JWWA 1S6OA
chains in the Genus database with same CATH superfamily
3NWRA 2JC1A 2KJVA 2XMTA 4UZBA 3CCTA 4USHA 2CWKA 4LF2A 2AQ4A 1YQHA 1FTCA 4ZVRB 2VH7A 1RT6A 2MZTA 1PBUA 1UEVA 4DBQA 2YQ1A 4USIA 4MKYA 1KNZA 3MR3A 1ZA2B 3SDEB 3UDEA 3GIMA 4LQ9A 4OX6A 5HVFA 3KK3B 5HROB 4URQU 2XY5A 1URNA 3NL0A 5IXUA 3LANA 4X4PA 2VBWA 1JNZB 4LF5F 4OHYA 2LXIA 2EXUA 4ZHRA 1CJTA 1V5VA 4HKQA 2P5VA 2LECA 5CYJA 3L9ZA 4I69A 3HSGA 1RT4A 4ICLA 4X4QA 3CCSS 2XTJP 4BWMA 4PWDA 5JVGQ 3IN5A 1NUEA 4KH0B 4AYBD 1R0AA 3HO1A 1T94A 8AT1B 2V2ZA 2E7XA 3HDSA 3KHRA 2E1AA 4NLPA 3EUNA 1KVKA 3A12A 3OSNA 2CQ0A 1NHUA 1SVDA 2WB4A 3VWSA 3VGSA 3EICA 3A8KA 4B3SF 3V4MA 4EBEA 4F36A 1IUJA 2K3KA 2LMIA 2RRBA 4K2JA 5KG0A 4F3OA 2NPIA 3DRPA 3E51A 5IFMA 1QVFR 3GG0A 4MMOA 3NGSA 3CCES 3BGFA 4X64J 2LKZA 1EB0A 3U7JA 1HNIB 1WEZA 2BM0A 3DLGA 4CTAB 4NYPA 2RS2A 3T1HJ 2CJYB 4RX6A 3PW2A 3QSYB 2YWKA 1JKHA 4ZITA 4BC9A 2KG1A 3TO8A 3G6YA 2NSBA 5K9FA 3PEJA 2RUSA 3OXLA 2HMIB 5LT5A 2CJAA 2BBEA 2DHAA 3MEEA 3BH7B 1RWMB 3R5AA 3MPUB 1HNIA 3DLGB 2DNHA 2XC9A 3D2WA 2B0GA 2H3EB 1JXEA 2WVEA 5RUBA 2B9WA 2HHHJ 4LF8F 1QDUB 4RW4A 4DPOA 1NHKL 4DPWA 4CT9A 3OR2B 3JYTB 4YY3J 5DDOC 3OL7A 4M5DA 1U1PA 1JLBA 3A13A 4KHRA 1IR2A 1CS4B 2ZM6J 4C7QA 2IM2A 4F04B 1SXLA 1RGVA 3SV4A 2HG4A 1WELA 4ECSA 1RHQB 3M8RA 3N6LA 5G4DA 1QSSA 1TELA 2DJWA 2F3JA 2HAFA 3BV8A 2HWTA 4LSNB 3I4PA 3D9BA 3CJ8A 3GJRB 4FF2A 4EO6A 1VRTB 3LPYA 4YN3B 1V3SA 5EWEA 2MZRA 3QGPA 2W9AA 4Q7AA 2FJWA 4FF4A 4PWDB 5EDWA 2W9BB 2XS2A 1M0SA 2EFVA 3HULA 1P6TA 2WK4A 2R7QA 4FYWB 4KGZB 2K8GA 2ZBCA 1RHRB 4ZHRB 3NMAA 1KR4A 3DDIA 2R8HA 1QY7A 3UI3A 2BE7D 4DUYJ 1A9NB 4XO0A 4HACB 1HNXJ 1UAWA 2EEYA 4R25A 2XS5A 4LJMA 1T02A 3J80U 2QA4S 3T3FA 1FKAF 3AY0A 1HQEB 3MR2A 4E0DA 1LK7A 3BGUA 4FBTA 1EKRA 1X5PA 3N9UC 2HQGA 4OLOA 1PSDA 3QWPA 1S9FA 1VQPS 2XLIA 4K4UA 4YDXA 4OYAA 5EWGA 1M5PC 4J91A 3VCDA 1B99A 1EKSA 3ILOA 4URSA 1AROP 3CSKA 1T8EA 4DR4J 1OJ4A 3CJTA 6FD1A 3GJTB 1WC1A 3R6GB 4ZVSB 3B4DA 4OJ3A 4WF9Q 1T9YA 2VA3A 5JJBA 2Q6CA 2A6OA 1NPPA 3VAJA 2ZBQA 2V5HG 2I6WA 1RUSA 3H59A 3OVSA 4ZN1A 4DR6F 1S6UA 2HFNA 3BH6B 5F8MA 2DNQA 1GXUA 2VPWB 3PM9A 4UQGA 3J7A1 3E01B 4NXMF 5DZ6A 4K0KF 2B8PA 3VQSA 1PILA 4M63A 1AA1B 3BO3A 3X1LB 1SQFA 5DG9A 2HEKA 2HVDA 4K4VA 1SJ4P 2J9EA 2ATLA 1S1VB 3VZIA 3RZAA 1RJJA 2BDPA 5KFJA 2UUCJ 2CNLB 1U09A 4WK3A 1S6QA 1UEKA 4I1TA 3W62A 2OPPB 3CW2C 4ECUA 1LWEA 3D67A 3LGMA 1VBZA 4NCBA 2MLXA 1Y4ZB 3Q2TC 2XEXA 2IFXA 1UTAA 3NAHA 3R8YA 4DX7A 5CCLA 1E6VA 4Q0BB 4KHPJ 1HA1A 2D3ZA 5KG4A 5L1IA 2FZCB 2YTCA 2QA1A 4LRAA 1LFPA 1VIXA 3EWGA 3NG8A 3MDFA 2O01C 1SL1A 1S1UB 1X4AA 4KGVB 1DHMA 3CMAS 2UUAF 2E44A 4F8RA 1UEUA 4YDDB 3W2WB 1D0EA 2P8IA 5A8RA 3TA1A 1HBUA 1NJWA 3GIIA 3F56A 3MI7X 2R8IA 1U6BA 4DV3F 1SC4B 4HI1A 3H5SA 2CQ4A 4TYBA 5E5NA 2RSQA 4Q44A 2EFQA 5D6GA 5HP1A 1V3ZA 1RTHB 1RA6A 1S0MA 1FWKA 4P72A 2V94A 3JSRA 3C14B 4J9VA 1UW4A 3H20A 4DV7J 1RT5A 1B64A 2AYBA 4O3SA 2CQHA 2HVIA 2CJQA 4U6PA 3RJMB 2HFZA 2NS1B 4C98A 4WU2A 3P6YC 3G86A 4TY8B 5B0GA 2YVSA 1YWXA 4QIEA 4ZN3A 4X65F 3S01A 4ZCMA 3HM9A 2HBRB 4K5SA 4OHXA 3WX4A 2C3OA 3PRDA 2BJEA 4USJC 2VQEF 5LMNJ 1TAUA 2QYGA 2ZDOA 3DDNA 1YRXA 3VALA 4C8NA 1IR0A 3M2RA 4RW4B 2HFVA 3UNYA 2DR9A 2GA7A 2M2BA 2ZVSA 3OXGA 3R3TA 2Z2YB 5IT0A 5KFEA 4K4XA 1Q5VA 3KK2B 4MK8A 1SJ1A 1LOUA 3KJNB 2ASYA 3JS9A 4DR3J 1D9DA 3MM8A 4RU9A 4X4RA 3PIPQ 2M3DA 5HSPA 1MLAA 2CFXA 2ZHOA 4PG6A 3TX8A 3AJ1A 5DM7Q 4GVBB 3W63A 2F8EX 3OTDA 1DTQA 4QYRA 2BANB 4ES1A 3JXOA 1GMUA 4I6YA 2HNYB 1Q53A 3J81U 1YITS 4KRWA 1Q81T 4DSKA 3I82A 4TLRA 1U26A 2K1RA 4OI6A 3D0HE 2O1PA 3UN3A 3QGIA 2XZWA 3C8YA 3A8EA 2IC3A 3MPWA 5CZXA 2JEIA 3M7VA 3IR7B 3GJQB 1Y9OA 1NSQA 1QSLA 4L6V3 4GC7A 2CJXB 2HWHA 2J8AA 4I2QB 3MOZA 1JXVA 3QATA 1D9FA 2OIHA 1FKPB 3UDCA 4CLKA 1PYTA 1Q4RA 4QWCA 3IAM9 1V5IB 4CLZA 5KFVA 1UKUA 2MJNA 2PDAA 5KG6A 1HLWA 2DNYA 2E5LF 2BOAA 4IOCQ 2DR5A 2AYEA 2MKHA 2V4QA 3BQ1A 4J9NA 4DQPA 3D3BJ 3G6VA 4GO5X 1SV5B 3MZIA 1NJZA 2GIFA 3TVKA 5J2NB 1FE0A 2YX7A 3ULHA 3UDLA 5HO4A 2QLBB 4FS2A 3SI8A 2FLNA 5IT9Y 2PFFB 4DJBA 4LSLA 5GAGU 1E6YB 2QLWA 1LW0B 4AL5A 3B6BA 1RLCL 1BMQB 4KKOA 3H42A 1EETA 4WWSA 1U4BA 1OIAA 2F8HA 2KHCA 3KUGA 4N8OA 4PCQA 3ILLA 4O3NA 3S1TA 3CC7S 5IV4A 3QJJA 1RWOB 2HS4A 4DR5J 4V19X 4L72B 2HLTA 2OH2A 4JI1F 3GCXP 2AJ0A 5GMKa 1UJ4A 3VAFA 3DU6A 3AQOA 1DARA 4KJIA 1U0SA 3OT9A 2VC1A 3DMJA 5MLCV 4YOEA 5CA5A 3MEGB 1HR0J 2GMHA 4OHVA 4LMZA 3CO0P 2UP1A 2B43A 4Q8EA 2VKZG 2V4RA 4DOZA 2L9WA 4F0KA 4RO0A 4KY3A 3Q22A 1WHXA 4NI2A 4RJVA 4W92B 3POTA 1YVFA 1N5SA 4KYZA 2X1AA 4K4YA 1OY6A 1S10A 1N56A 1VRUB 2KB2A 3R5BA 4AQYF 2MZJA 4KAIA 2JFDA 5KFUA 1G2EA 1SUQA 2DXEA 4DL0C 1ACMB 1S0VA 2J9DA 1BQXA 1MN7A 3DI6B 4ECVA 4C0BA 3PYEA 2VQFJ 2UV8A 3PG9A 3FVYA 5I4MA 1AFIA 5KT2A 3RU0A 4P6QA 3J7YU 2YKQA 1EQMA 2COLA 1YIJS 2HLUA 2ZD1A 3B82A 5HLFA 2MLZA 3VR1A 2ACMA 4UOHA 4DS4A 4OI0A 4AXJA 1KVIA 2KXHA 4NLGA 2CXEA 3OR1A 1A7GE 4PPDA 3EPIA 2IJNA 1PJ7A 3HHLD 3I5AA 3DOKB 1XMOJ 1P9QC 2OEKA 2JVRA 2QA4G 4ZJOA 4USUA 1JXLA 2C2DA 1FNXH 2DH8A 1T3NA 4X4SA 5A2QY 1TKTA 2W01A 2UUCF 2KDOA 4JV5F 2FVRA 4NZ6A 2N7YA 3UE2A 3H90A 4OI2A 4OX8A 4CO3A 2C2EA 1YK9A 4YMEA 3I32A 3JSYA 3R5CA 4DG1B 5F3TA 4A8YA 2HHUA 1LEOA 2ZUGA 4V19J 1Q78A 1VRTA 1GEHA 3GP9A 3QT7A 4EUVA 5T7LA 3BN7A 1FKOB 2WCXA 2D3OR 2LA4A 2ZOFA 2IPOB 1YG0A 2KL8A 3M8PB 4OZ3A 4UT4A 1UZDA 1BWVA 2IA0A 1TKDA 1FKPA 3FBFA 1FJGJ 4IG3B 4NLRA 4NYOA 2VUGA 4ALZA 4ETXA 1FNMA 2OO4A 2FQQB 2C3YA 3D68A 3OR2A 3JYTA 1DTTA 1IKWB 1SQGA 3J81Y 4I4BA 2EBGA 1K73T 2HHVA 2CVEA 2CVIA 3C6TA 4ECRA 1NK4A 1NRKA 4P52A 5IQ6A 3UDVA 1C1BA 4OZ2A 1N33J 3W61A 3NBPA 3R5GA 1HNVA 1OPZA 3DRSB 4ZPWR 4F3QA 3ELHA 5HQMA 3J81j 4USVA 4TU8A 3VAKA 4ECWA 4OL8A 2Q6BA 4KGKA 4B3MJ 2P9EA 4RW8B 2WONB 2QT7A 1WSVA 3KNGA 2NYHA 1FRXA 2CWXA 3CDAA 1SL2A 1J5OA 4H4KA 4UUXA 2FB0A 4YEAA 2KXNB 2VDHA 2FJEB 2Q43A 4E2FB 3H5UA 3NRBA 4QPXA 5LSRA 3KK2A 1WJ9A 3TUZC 2FY1A 1UFWA 2HK3A 3FRYA 5HMWA 3ZZPA 1QTNB 5M2RA 1TUGB 1WF1A 2CJBA 3DOMB 2YKOA 1LW2B 4WP9A 4I64A 5D15A 2N82B 3HHDA 1MU2A 4H4MB 4C2MA 5GAHI 2RDIA 1EARA 3F44A 2XB2D 1PC4A 1T7PA 1NO8A 5KG3A 2KM8B 1HMVB 4EBCA 5DZ7A 3HK2A 4ID8A 5LJ3Y 1XERA 1QUPA 3GPAA 4TY8A 3W2VA 2CQPA 2YKPA 2NYIA 1JLQB 3SSQA 4ZCIA 3LH2S 3MMJA 1VDHA 2D3UA 5E41A 2CZ4A 4JV1A 1ZAXA 3G71S 2MKYA 3CJ2A 3WC0A 3D1OA 1FD8A 2FPHX 5FDLB 3QQCD 5ETLA 2ERRA 1WC3A 1RADB 2GS8A 2MKSA 3U27A 2R4FA 3K5MA 3DRSA 1HNVB 4Z2XA 4DHVA 2OFHX 4N5SA 4LR7A 2ZHAA 4MIWA 5C7PA 3TJ9A 5LSLA 3TW0A 4DQRA 2D3O1 2FVQA 5K14A 2DGSA 3GYNA 1NDCA 2XO7A 4IDKB 2V34A 4PXDA 4OJ1A 4DV2J 1N0VC 2MEWA 1U8SA 2DVIA 3M6UA 3HP6A 1X4HA 3NS5A 4FF1A 1EZZB 2Y1JA 3Q83A 2LEPA 4JI0F 1DY3A 3OUYB 4HI2A 2VBZA 3NP5A 4KV8B 4TXSA 1WUUA 1HI1A 3V2UC 5AXLA 4CWBA 3QIDA 5F8GA 3PJWA 5DLGA 1VRQC 3GMGA 1EP4A 4LVOP 2E5LJ 4U7UD 3IBFB 5T7LB 1U47A 2OPPA 1R8HA 2GVDB 1VC5A 4JI8J 1N5QA 4OZ1A 3T41A 4ILRA 2ZE2B 5HQ8A 1X5TA 2JVOA 2DH7A 2IM0A 3QO9B 5L1KA 2WZ1A 2GAHC 2H48B 3TAPA 1X9WA 3BF4A 3GU0A 1BQNB 3R7BB 4ZLLA 4DV4J 3FNNA 3PDNA 2RQKA 1JLGA 4OZLA 2BVZA 3TI0A 5CCMA 4P7VA 4JI4F 3KLGB 2XYGB 5ETPA 4J9SA 4DX6A 4IO1A 2VJUA 1KLNA 5AXMA 2BJ7A 1D3WA 3RB6A 4NLYA 2J7WA 3W65A 5HVHA 2JX2A 4FVMA 3RG6A 1K47A 4IFVB 3LF0A 1HWIA 1Y5NB 1YX2A 4KPYA 5K20B 3H5XA 3KJVB 1HL6A 2LLZA 1TMJA 4I7FA 1RB0A 3A3PB 1S5ZA 4QIFA 5DDQC 2MKKA 1KLMA 2B5JB 2DNGA 5CYMA 3ZTPA 2CPEA 3GLJA 3N5FA 4OYOA 1NK0A 2M8DB 2VPXB 3C3LA 2PMWA 5AE3A 3GQCA 1YGYA 3LTOA 2R2RA 1MNEA 4P2SA 4P71A 3OFGA 5KT7A 2G13A 3TVYA 5FIIA 3G8QA 1V6HA 5KFLA 1ICEB 2X1FA 2Z56B 4LFCJ 4OZ0A 3MEKA 5E0OA 4C0HA 1W26A 3PEHA 1M5VC 1RSCA 4DEZA 2DXDA 3AAWB 1NU4A 4CYUB 3BYRA 2OFGX 5D4PA 4JV0A 3CJKA 3VGTA 1XMQJ 1FT8A 1OSCA 3LP2B 5LXYA 1J5OB 1F60B 1K9MT 1SIZA 4AXIA 1ZBTA 4XTTA 4YFUA 2ROEA 5D0GA 3G6ES 3ZC4A 3V6DB 3P5TL 3VGUA 4M5JA 2ACYA 3I4HX 1VBKA 3ITHB 3UWTA 2VODA 3LAMA 1C4CA 3HD2A 3QNWB 3QJLA 3PX6A 3LUYA 3CCJS 3VAMA 4R5PB 1DTTB 2MTLA 5HVGA 3UQSA 4AL6A 2GMLA 3IA0A 3O8WA 4RKUC 3I9ZA 5F8HA 4NMLA 2HFOA 1VK8A 3TAMB 4ED2A 3JB9k 3MPDA 1FK9B 1JQGA 4BBYA 2G0JA 2WOMB 2GO8A 4LF7F 3QT6A 2C2KB 2CG8A 4O4GA 2KHDA 2W4DA 3GYGA 4FVCA 4RLEA 2DRBA 4F2SA 1EAYC 2MSTA 4IFYA 3R6LB 3C16A 3O2IA 1QVGR 4C8KA 4QWAA 2DNZA 2C2NA 2UVRA 1FEEA 2Z0GA 3MM7B 3P3DA 4I2PA 4OZNA 4LSLB 1HNZJ 3NKYA 2DITA 1FRLA 2CNKB 5H9FJ 5AJ3J 2GHPA 2JLGA 1UP1A 3R1HA 4O3RA 1SJQA 2H51B 1T3OA 2XG8A 1VLYA 3MWBA 1X0FA 4M94A 2V8GA 2CPXA 2AWZA 3IS9B 4S0MA 2MZ1A 2AGQA 2MB0B 4ES2A 2VJVA 4GKJJ 2N3LA 2DGVA 1FTRA 4BHQA 3Q8QB 2VICA 3I0SB 3MGJA 3CD6S 3AHPA 1VBXA 1WWHA 4ELTA 3BGLA 4RWWA 3MTKA 4M5MA 2HQ3A 1Q5YA 2NLWA 3L09A 3O5TB 3OJUA 2HQDA 5HMZA 1IBKJ 5BR8F 1HBOA 1F5AA 3DXBA 3ZTSA 1IBLJ 1FDNA 2YNFA 2ZOMA 2FGCA 3PRBA 4NL5A 3GZ7A 4Z7CA 5CAAA 2V50A 4QIVA 3CCWA 1URRA 4L73A 2AT1B 3QAUA 2JOQA 3CO9A 1RT3A 5KFXA 2H65B 1C0TA 1ZM2A 3M4XA 2BJ3A 1WC5A 4GVBA 4IOBA 4KO0B 2QN6B 2XMVA 2GZOA 3M8ZA 4ZVOB 2MSSA 3V6JA 1N36J 2AV5A 3D28A 4QIGA 4NRTA 3J80Y 4NXNJ 1NSKL 3MM7A 4I2PB 4C3MA 3IBCB 3MM8B 3KG0A 1LWXA 2OMOA 4O3PA 5EWFA 4CLSA 3CMQA 2XSJA 4WZMA 2DR7A 2KKHA 1H0HB 4HTJA 4O4GB 2KRRA 2FJDB 4ZCKA 1N5YA 2HK2A 2W25A 1YBAA 1XIQA 4LF4F 5IC6B 5K8OA 4FKXA 2FVSA 2B56A 3IP0A 3K8WA 3G87A 2BXJA 1MMDA 2DY1A 3N4WA 3PV8A 1DFDA 2X7IA 2X3GA 3W1YC 2Y8WA 3GV7B 4F0HA 4ZLNA 1NKBA 4TLQA 1X9MA 3DCAA 2PFDA 3HJFA 3WHIA 4YB6A 3MMCA 4DR7F 3J7ZT 3CIZA 4YB1P 2CRLA 4PYAA 1U6FA 5BYSA 3IRXA 1P9YA 1U25A 3C6UA 2CJKA 1WHYA 3V6DA 4CO5A 3MR7A 3NS6A 1P27B 3BDEA 3VV2B 4E8UA 4QYZK 1S4EA 4Q45A 5CYQA 2OPSA 4DU7A 5J2NA 1N8RT 3GSDA 3AOCA 4ECXA 1WD6A 2HVZA 2P9CA 2RF2A 2R7OA 2DR6A 4DV5F 3M2VB 3QRQA 4DSJA 1U0HB 5F8LA 2OD4A 5L46A 3OFFA 1N5TA 1GTEA 3VHQA 3B78A 3J7Z5 1UPMB 3D5MA 1TL7A 3QLHB 2BQUA 3G2XA 3NGTA 4PG8A 3DLEB 2XS7A 4OZJA 2A2CA 2YNGA 3H5YA 3H4BA 1D9AA 4X64F 5GAHU 1UVMA 3T1HF 1I94J 1RCOB 4O3OA 1SH2A 2VF3A 1VR6A 1YRUA 1VQ5S 2JFKA 3KG1A 2LXUA 2YKMB 3Q23A 1XTZA 1XBWA 1R6YA 3QGGA 4WFXA 3PFEA 2AEFA 1RP5A 2V2QA 4ANCA 3FBBA 2NQPA 2GIQA 1JLFA 3W5ZA 1LWCA 4PKDB 1BGXT 3AXKA 4B3RJ 3NCPA 3QRPA 2W2OP 4DFJA 4X4TA 1FRJA 2RILA 3MM5B 1UA0A 4LF8J 2R8GA 1X60A 2V8VA 3QIPB 3IM8A 4DF4A 1JLCB 4PYDA 4CT8A 2VBXA 1VBYA 2F5GA 2LP4A 1QTMA 9ATCB 4DPTA 4A8OA 3DOLB 2BABA 2GMJA 3QO9A 5E3RA 1OY8A 4ANDA 1HW9A 2H4WB 4KPCA 2CPHA 4OHWA 3T5JA 3R1LA 2HNDA 2GCFA 2UU9J 4LREA 2MKIA 2XYPB 4ILLA 2E5JA 1SPBP 2U2FA 1H7WA 1QE1A 3D7SB 2JL9A 2C42A 3AJDA 4J5OA 5A0YA 2HWIA 4NMXA 2W24A 3OTCA 3AD8C 4QR0A 2YNIA 5AT1B 5F3ZA 1ZOTA 3HFKA 4BC7A 4H4MA 1YI2S 4J37A 1VLOA 4B02A 1XMQF 5HATA 1SC1B 4WFAQ 2IAJB 2C2OB 4WTYA 2A10A 2AP6A 4HACA 5C5JA 2MJUA 2F8MA 2BX6A 3EXYA 1N34F 4TVAB 4DPUA 1QAIA 3PX0A 1R8CA 2XWXA 5HP1B 4J9OA 4WFBQ 3ONQA 2CUYA 2A18A 4NA1A 2BMBA 1X7VA 1YSJA 3P96A 2XI2A 1BWEA 3WZ0A 1S77D 3CJKB 4QCLA 4C11A 1K0VA 2I5JB 4O3QA 3BB5A 3HF5A 2UUBF 1D09B 2NZCA 3HD1A 1C0UB 2AD9A 2IAJA 1GQEA 3HX9A 1A6LA 3I87A 3T6JA 4AT1B 4DQIA 5LJ5Y 2ZZMA 5EN1A 3B4MA 3T1AA 2EBEA 2EWHA 3I96A 4PPZA 3CJ3A 2OSRA 4L75A 3CCVS 1F0XA 8RUCA 1K0TA 4N47A 2DYAA 2XMJA 2VPYB 3Q8VA 2R7XA 2YH1A 4O0IA 3C46A 2HGMA 4LBIA 5F41A 5HAOA 3MAAA 2N4DA 2Q3PA 1VJWA 3P5BP 4KB7A 4MK9A 1FKOA 1YRTA 4B3TJ 1FDAA 4N76A 4NCAA 1ZM9A 3MPYA 1XC9A 4TY9A 4O4RA 4Y28C 4F25A 5F9NA 2DNMA 2BJDA 3ETOA 4CLLA 3IM9A 3E01A 2H1YA 1FF2A 3D6FB 3W9HA 5EHHA 3PR5B 3QIPA 1RTDB 2W2MP 4EMDA 4ED6A 4GKJF 2GNKA 2EG1A 2CA9A 3D1QA 4DCPB 1K1SA 2Z2MA 5DJBA 4NEZA 2R7VA 1CG2A 2ASDA 2BE9B 2XSFA 3DGVA 3V81B 2Y0BB 1RHMB 1WG5A 3C15B 2JLFA 3IC1A 1Y5LB 1F1BB 2RJZA 2WVCA 1U48A 2YKMA 7AT1B 4LRCA 2AJ1A 1IBKF 4ZJQA 2B4UA 1GTHA 3M30B 1OY9A 5SUHA 5DRKA 4B9MA 1T9VA 1VI7A 3HHEA 2L48A 3FKBA 2D9PA 2FVCA 1MROB 1LQ9A 2UUTA 3DLEA 1FVSA 3K17A 3TANA 1IR1A 3K59A 1R3NA 1AT1B 4JP8A 4QR2A 4TYAA 1WDDA 5J2MB 2DGXA 1NDLA 1O8BA 2DRDA 3PW4A 3DI6A 3KKFA 1WKKA 3T5LA 4OYBA 2VPZB 4TQRA 1RAJA 4C3LA 3KYLA 5IOLA 1VQSA 2W9CB 1H74A 2RAQA 3IG1B 5FDLA 3RR7A 2DXFA 4LFBF 2NZ4A 3RW7A 3H2LA 1VQ6S 1Q8LA 2B51A 3A8JA 2OPSB 3GFXA 1EJ7L 1ZM3A 4ANEA 1IKVA 1RT1A 2GQ2A 3KDOA 1KQGB 5AE1A 5EGYA 3PY8A 5JMNA 2QLFB 4FYDA 1RT6B 3P49B 3C6UB 1NM2A 4JI6F 3R27A 4DFKA 3N0VA 1WDTA 2PIIA 5GAEI 3TAQA 2RRAA 4N41A 2F4FA 3M32B 1IKXB 1SC6A 2FHMA 2VFUA 1HMVA 2W7PA 2J6SA 5L38A 2ZM6F 1F3FA 1CS4A 3EGWB 2DCLA 4DR3F 4DF8A 1G4CA 2IRUA 2FHKA 1RI7A 5B0CA 4QBUA 3Q8YA 4Y2AA 5D0RA 4L3KA 1OS5A 2DHHA 5KTQA 1P1TA 3B54A 2E9TA 2FHOB 2FIUA 3K7RA 2DKOB 2VIHA 1S1WB 2J7UA 1N5YB 3JTOA 3QT5A 1H7XA 4WE1A 2AEMA 3KUEA 3SCJE 1ZH5A 3MECB 2G2YA 4EGLA 4K7QA 2FVPA 1YJNS 2XMUA 1M5SA 3MEEB 4NZ0A 2KFYA 4F4ZA 4B3OA 3PCOB 4HLBA 2HHWA 1L3KA 4Y6IA 3R5DA 3OTBA 1FVQA 1XR5A 4RW8A 2IYIA 4YB5A 3AOBA 1FXDA 1RCXB 3FDSA 1Y00A 2C2MB 2OEJA 2XMKA 3MM6B 3JSMA 2ZH3A 2EKNA 4QW9A 3NCQA 1X4DA 3UCZP 3H40A 4USKA 5C2GA 1RAGB 1U02A 3BKUA 5CQGA 3DRPB 5T41A 4JV2A 4K4ZA 4G6VB 5KFMA 3KHGA 4OX9J 1RT3B 2OPQB 3KTQA 4QPTA 3NEKA 4WFNQ 5J2MA 1FE4A 2W7OA 3D3CJ 2G2OA 1RHUB 1Q7LB 2MQNA 2PMHA 4Q2LA 5FLXU 3EM1A 3BGOP 2AHOB 3UCGA 3U02A 5K8PA 1NZ8A 4DV6J 4ZVQB 2J8SA 3T1YF 1VC6A 4K2XA 4PWUA 1F3VA 3G8TA 2XCAA 5LOQA 2FDNA 2R3VA 1H38A 2I38A 3C15A 4HHUA 2ZH9A 3K8VA 1HARA 1WKLA 2M0GB 1CJTB 2V2VA 3FSXA 3ILIA 3VZHA 2NR0A 1IJFB 2BANA 4DR5F 1CJKA 1OMSA 3KK3A 2XY7A 2BYCA 2ZOGA 3NLCA 2GHWA 3SDEA 3R9LA 2BZ2A 3QWUA 4P2MA 4DPYA 3Q8SB 5BYRA 2KT2A 2NXJA 2EW9A 3DHXA 4IFYB 1TKZA 3WQPA 1KP6A 1ZPWX 2KN4A 3HFVA 4M5NA 2K7JA 2ZBRA 4WE1B 4WKYA 4ZKAA 5KG2A 1HR0F 4RL1A 2ZD1B 3O6QA 1WG4A 4OYPA 1O51A 5DGBA 1H2TZ 2MYFA 3RAMA 1ULRA 3FZBA 3Q89A 4NLOA 4HR2A 4P75A 3VQTA 2H5IB 3N6NA 4AE5A 4JUZA 7FDRA 5I42A 3LP1B 1T03A 4RW7A 3CMES 5KT5A 2ZFHA 2G1DA 1SJ3P 1SUQB 1HD0A 4R5PA 4LIWA 3OHBA 1XNQF 2GX8A 1KSPA 2VBYA 1DTQB 3BM7A 3QPIA 2ZH4A 2B7CB 2MKCA 3UW1A 5B7WA 1NJXA 2RB7A 3ISND 2ZBIA 4P2FA 4DV7F 1U1RA 3SSSA 2JC0A 2VONA 2BRLA 5HJYA 2B6AA 2EC2A 4Y3CA 4ED0A 2WRMA 2FY8A 2UUBJ 4GC6A 3TEGA 3KHLA 1I6JA 2Y3YA 2HSEB 3I56S 3MFHA 2W9CA 4IH5A 5A6WA 3AA9A 3CXCR 2BACA 2C1EB 1G7CB 4ZPBA 4X65J 3CC2S 2HVHA 1T11A 3UPFA 1TVRA 2XMMA 2VQEJ 4PZVA 4RPFA 2RQCA 1S0NA 2J6UA 3BSAA 5ETRA 4Z37A 1RYSA 2DGQA 3DKDA 1ROFA 5A8WA 1RBAA 1HWKA 1S4FA 2KVIA 1VOMA 2W2QP 1O6XA 1IKXA 5A0YB 2EI5A 1C1CA 2RD5C 2EFOA 4JI5F 3PKMA 1MW7A 2AZ3A 2NXNA 3OLBA 5KFYA 5LMUF 4QYZJ 4PG7A 2B4OA 4KKOB 4ZPAA 4DX5A 1WHWA 1WC4A 1LWEB 3BPSP 1UVIA 4C8YA 1IKYB 4I6WA 2B8QA 4H4OB 1KVJA 2G1HA 1RWWB 3I5CA 3PX4A 2XGQA 2PMZD 1WG1A 3QMQA 1IJEB 1W25A 4FXWA 1RTDA 1WOOA 4A46A 4F0MA 1BQNA 4IH6A 1N0UA 1JLGB 1U8WA 2DB1A 2HPUA 4JI7J 1RDRA 3TZZA 1AFJA 3AFGA 1P8GA 2BW2A 2HGNA 3JQJA 1LWFB 5HBMB 1RAEB 1NH7A 2CNNB 3W9IA 3A8IA 1UWBB 2DPIA 3K89A 4WU3A 1TKXA 4QR1A 1B7FA 4M5HA 1FDBA 4CI0B 1WC0A 1A0OB 4J9KA 2W7AA 2IM3A 2DIUA 4KV8A 4N77A 3KLHB 3K0JA 4CLPA 1FHTA 2BJ9A 2IJFA 5IM0A 3W60A 1B4SA 1WORA 1WF2A 5EUHA 4KH1B 1LKZA 2VZ9A 3M8YA 1N6QB 2H9ZA 4PQUB 4HEA9 1FDDA 2ZNZA 4IDKA 4OMFG 1YZ6A 2QSWA 2Z2ZA 3MF5A 1S1VA 2XZDB 4RBTA 5HBMA 3SCLE 3TJAA 2RHQB 3GIJA 4DUZJ 4B9UA 4DR2J 2YBVA 3H2UB 3QFHA 1T9XA 2HBQB 4IH7A 3RRKA 1JJCB 5A76A 4C11B 3BQ0A 4NEYA 5L9NA 3PHTA 1RTJB 4QWBA 2NCKL 5HL7Q 1Q8IA 4JI3J 4LFAF 2ASJA 4DN0A 4RZRA 2N3OA 2UUWA 1K8AT 3FEZA 2MHEA 2CZVC 3W7BA 2HYIB 3MAAB 1N32F 3HPOA 3D66A 4DV0J 2EK1A 1UWAA 4RBUA 1GT8A 4QQBA 4NASA 1X5OA 3GR0A 3DC2A 3N79A 4ZVUB 4UY85 2DGOA 1IQZA 4B9TA 1NK8A 5HI7A 2KXFA 2UXBJ 2V63A 4DX8H 2J0WA 4XDDA 2SXLA 4YHHJ 2IDEA 3GFYA 1KOOA 3EZOA 4J9RA 3CJRA 1HHTP 1SKUB 3SCIE 2GQQA 1WKJA 2NXCA 2FLOA 2QO3A 4WIQA 2BJ1A 4MJKA 3RBDA 4DZ6A 2QL7B 3Q86A 3UO0A 1FRMA 2HQFA 3QZ8A 1DQ9A 3CJSA 3UD5A 3FZ2A 5J1NA 3FBCA 1APSA 1DURA 2CQ2A 1U2RA 4DN9A 3NNHA 4PEOA 5AXKA 4FXDA 4EZ6A 3NBPB 1HI0P 2IM1A 1I94F 2QLJB 3P4UB 3EGVA 1HQ2A 7FD1A 4HHHA 4FPIA 3GFZA 4RW7B 2R7TA 1NCLA 2Y8YA 1IKWA 3T6BA 2DEIA 1C4AA 3MTJA 3GTYX 2DISA 3NOCA 3NGUA 4YS2A 2M88A 3FCHA 3GIRA 2F65A 3VTIA 2OTJS 4ZS6A 4CLWA 4WBFA 2HNDB 1PJ6A 1UWBA 3ZTQA 1YHQS 1RT2A 4WXWA 5C42A 5H9EJ 4ZIVA 5IV3A 4ED8A 2W1BA 5J2PA 3S6EA 4OHZA 2V8PA 1S79A 1FFSB 1IM6A 2B9EA 2D9OA 4ZPTR 3ZFVA 2MQOA 5DQHA 1OO0B 2MQPA 1Z4UA 1KFSA 2XI3A 4HT5A 4IKAA 4CCHA 4WZQA 2BE2B 4DL2A 3D0IE 3Q0AA 2OTLS 4YR3A 1GH8A 2AX0A 3NOGA 3T5KA 3ZZTA 2GJFA 1KOHA 2ILYA 1Q95G 4NLDA 2OELA 1NXIA 3OXFA 2R2TA 4F3MA 1M5HA 3H0PA 3TR5A 2A2DA 4Y2MA 5KFCA 2IBKA 2E5GA 1FJ7A 2PGCA 4ID5A 3ZZ0A 2R7RA 2C28A 1FX2A 1B0VA 1Q8BA 3JTPA 1CVJA 3L7UA 4ED4A 2RHSB 2V68A 3MUMP 1SCJB 2LEBA 3CC4S 4C6AA 4ED1A 1PIEA 2DO4A 4FNHA 4A8SA 3A4TA 3CD7A 1DBDA 3K58A 2LYVA 2DIVA 1ZZFA 3DRXA 4RNHA 2FLLA 1XNRJ 5LM7E 2VDIA 1I5OB 1F2GA 4RUAA 2FC9A 2XM3A 3G96A 5I3QA 2DNLA 3THPA 4EFAC 4IG0B 4KIAA 1VRUA 4K4TA 1S97A 4A8WA 1VQ9S 3FMWA 4LF9F 2IY5B 3MM6A 3G6XA 4UF4A 2W9BA 2BKNA 1YJVA 3HCXA 2ALZA 2GHVC 1M5KC 5ADZA 2UXCF 4R8UA 1DJ0A 3OQ2A 4B3OB 3QAEA 4ZVEA 4LSNA 4DV5J 2AJFE 4LF1A 1Q1KA 3JTNA 4LF7J 2ZHBA 4DR6J 3PIOQ 3CD0A 1NB7A 4MYTA 3KLEA 2J6TA 4PUOA 4PG5A 3G82B 2A0FB 3E2EA 3DGPB 3HSJA 4ZPCA 3H4DA 2YNFB 2GGPB 5A6PA 1VCTA 1NPRA 2UVWA 4JI5J 4I0WA 5E2QA 2E9ZA 3M2UB 4PABA 3I55S 2K2PA 3ENWA 4Y00A 4YQWA 2IDLA 1KTQA 3LGNA 1PKUA 3MEDA 5D4NA 3T9ZA 4ID5B 2HZAA 5EX3A 3PW7A 1Y3KA 4IR1A 2IMOA 4QW8A 5I3UB 1EETB 3EYZA 1CULB 1NAQA 2Z30B 3W5XA 1KDNA 5F8IA 3KJVA 3JQKA 3JAMU 4B9LA 3Q8PB 1GNKA 2EK6A 2ZNYA 3TWZA 4DZDA 5A8KB 2G4BA 1ZTWA 4EYHB 1IKVB 5DQIA 1R6VA 2F9JA 4G1PA 1Q7YT 4L76A 1DQAA 1RTZA 1KHVA 2WTFA 1RACB 4MH8A 2AEJA 2OEMA 2NUHA 1RWPB 4UW2A 3PXGa 3NXZA 3BZQA 4IO9Q 5FLXY 3KLIB 1Q82T 3M9OB 3OBIA 3X3UA 3FEYB 1RKIA 1TFYA 1JB0C 2KT5A 3IGNA 1VQMS 4Z7YA 4RU2A 5J2PB 3BN4A 3H2VE 2NXUA 3T5HA 3THVA 1S9EB 1XR6A 2YWHA 2ZC3A 3MFIA 3NY0A 3KK1A 2Y1LB 1U1QA 2WOMA 2QYCA 1W2BR 1B3TA 2DR8A 1CQMA 2JHEA 4C9DA 1RZMA 4CIOA 2HHPA 1H6KX 1Y3JA 4B9NA 2A1BA 3DM2A 3EVMA 2BR0A 2HZCA 3FQLA 4LQ3A 3GJSB 5KOXA 1H73A 2B9XA 2CPDA 2Q1LA 2NPFA 2HHQA 2VG6A 5C24B 4I56A 2E9RX 4JI4J 4K4SA 1RAAB 3MCNA 1KQKA 5KFDA 4TQSA 3MR5A 2MZSA 2CPFA 2WHOA 5DG8A 2BW7A 4P2XA 2KM8C 2IJRA 3HZGA 4JI3F 1N4LA 3ZNJ1 2FJAB 2MXYA 2QX0A 3NAIA 4NCGA 3JSMB 1FJCA 1FA0A 3SSRA 2R8JA 4NWBA 1YTYA 3CIMA 5KFIA 1TP7A 3BSCA 1M1KT 1REGX 4DV0F 1HPZA 3J7YI 2V9WA 5HN0A 4QU7A 2ROGA 4CM0A 3LOUA 1J27A 2OSQA 4NLSA 3WIVA 3AJ2A 1NJIT 1WTFA 5D8HB 4U96A 1R89A 1RAOA 1RWVB 2UZAA 3FFIB 4ZVHA 3J7AN 4PWWA 2POKA 3WBZA 4MFBB 2E5IA 3CWJA 2VV5A 2C3UA 2F7VA 1GMVA 4Y65A 1S9EA 2ZITA 2KO1A 1YZ7A 4HDGA 1M90T 3DLBA 2F4VF 1D8YA 3LP0A 1WSRA 3M9NB 2FJXA 1N5VA 3DRYA 1RHJB 4YUDA 1HNXF 1G1XA 1SJRA 5L1LA 3HVRA 2Y9HA 3KLIA 5HMYA 2CQ1A 3U1LA 5HMXA 1YBUA 3HT3A 4ZP9A 1RTHA 1FXRA 2HS0A 1HWJA 2CAJA 4WJBA 1EIYB 4PQAA 2ILZA 2E7WA 1JLEA 1NNDA 2LXFA 2BRKA 2HNZA 2MY8A 1NSPA 1BQMA 3KLGA 3OW2R 1V9OA 4ZIWA 2BQRA 4LR9A 4DR4F 1AXQA 3IR5B 2C22A 3BDPA 5DM6Q 5D0HA 1HHQA 4ZOSA 3LPEA 3W2WA 4WXOA 2MHNA 4EO8A 2F40A 4RW6B 2IA6A 1FCAA 2WSFC 1TZ0A 1Z2LA 2YNIB 4CLYA 3KG4A 1S48A 3KLHA 1HYSB 3M30A 3HFZB 2M52A 1CQNA 1X4FA 1E6VB 4Q0BA 2CQ3A 3UVJA 4I7FB 4XDCA 3NGDA 3V6KA 3D54A 5IC4B 2HW3A 1RQ0A 3HZEA 5U47A 3TVZA 1NBEB 4UTGA 3MM9A 2C2ZB 4QWDA 2GAGC 3QFWA 4UZCA 4AL7A 1FNOA 5L1JA 5KFSA 4NLVA 5AJ3F 1Y0HA 3BKFA 4D3GA 5D3GB 4M8LA 3IWLA 3HHLB 3A1YG 2WW8A 3VGVA 4DU8A 1IBMF 3IWNC 4UUWA 2MQMA 3NWGA 4YB7A 3CCQS 1QD1A 2HURA 2N7CA 4MK7A 3ENQA 1UJ5A 4C4WA 1MWYA 2GO9A 1FO1A 1QJHA 4HDHA 4IQMA 1HBNB 4UOCA 2RNEA 2RH3A 4A8QA 4ZVGA 1O0PA 3MM9B 3PO4A 4DSLA 5H1SV 2ZUAA 1JLQA 3S8SA 5HK4A 3DXSX 3RBEA 3BKTA 2QE5A 5DQGA 3TA2A 2KFZA 1IWAA 5BR8J 3D0GE 3N5BA 5B0EA 1S99A 3CDUA 3KWMA 4XPEA 3EZ5A 4F2RA 2YNGB 3CCMS 2AW0A 4NLTA 4RW6A 2B3TB 1SBRA 3EX7B 2D69A 2WSCC 2VQFF 2KZZA 3IFEA 4W98A 4E98A 1B0PA 5KT3A 1UFLA 4LF9J 4YY3F 1EX8A 5HQLA 4U67Q 4NXNF 3BO2A 2QFIA 1U1LA 5LL6d 4Q43A 2R2SA 1TK5A 1F9EB 1ITPA 2BUNA 1GMWD 3CT9A 2KH9A 2ZH8A 1R8BA 2V4JB 1X0PA 4ZA1A 2RE1A 3F73A 1TV6A 1VQYA 5DG7A 1HFEL 2O3DA 4OV6A 3SQOP 2RIJA 5KFTA 1HYSA 4JOUA 2B4PA 1HNWJ 5C42B 1WOSA 4ZVTB 5THWA 3WC2A 4F4XA 1NK6A 3L7OA 4ED3A 4C48A 1D1UA 2OD6A 2R8KA 2HVEA 3M8QA 4X4VA 2G2ZA 2V9KA 3Q8RB 2UXDF 3PACA 5HJXA 1U6ZA 2BKOA 1MU2B 4DLEA 2PI4A 4F4AA 2YKAA 1LW2A 2GV1A 4BWJA 2Z8QA 2V8DA 3LGHA 3DFEA 2F63A 4KGXB 1RWNB 4U7UK 3RB0A 1NK7A 1ZA1B 3CCZA 2A6MA 3AODA 5JVHQ 3TZWA 1TKZB 3I9V9 4RUBA 3OJSA 2OAUA 2Z2LA 2IYGA 2M8HA 2CIMA 2X1BA 2BQ3A 3DOLA 2XZTB 1S0OA 4OYIA 3RBXA 1LW0A 2DHGA 2WONA 3PTWA 4Y34A 5E33A 1MSWD 4I68A 3ZZZA 4LF6F 4NCGB 4UQTA 1AW0A 1JKHB 3DRRB 3MM5A 1CSJA 3ILJA 4B08A 5FD1A 5KFOA 1C1BB 1R27B 4KT0C 5G0RB 1KC8T 4F67A 3ZTRA 1LWCB 2FHJA 4MIAA 2KU7A 1RXOB 2FJBB 4ZDNA 4LF6J 2R7WA 5AE2A 3DYAB 4FPRA 5EX0A 4C97A 3ZTOA 2DH9A 2JNJA 5KT6A 1HI8A 1KKHA 4PAAA 4ZJLA 2DNRA 3WDOA 4ZMMA 3UR0A 4FNIA 3BO4A 1UFKA 1OQ3A 2G9OA 2E29A 3FBEA 1H3DA 3M8QB 4TU9A 3ADAC 3L7PA 4J9LA 1S57A 2BOPA 3KK1B 3QT8A 4A8XA 3BJYA 4A8KA 1NZAA 1OYEA 2GIRA 2YXLA 3DHWC 3GCWP 3ISZA 4G3IA 2DBBA 4DG1A 2VA2A 4CP5A 2IBOA 4OYZA 4F02A 2WBMA 3FJ2A 1TV6B 2JSXA 3RW6A 1U0HA 1RT4B 2CQGA 2DHSA 2YPYA 2DGUA 3IS9A 2HNYA 3M2VA 4KBIA 1KEKA 4U7CA 2E1RA 3P8BB 4RNOA 1QAJA 4TNOA 1Q8KA 2CDQA 4CDIA 2ZJRQ 1Q0NA 1JK9B 1GXLA 3MCSA 3I31A 1T0TV 4UOFA 5CYQB 1UA1A 2NREA 4JI1J 2L3MA 2XLJA 1FEHA 4LF5J 4NI2B 1WI8A 2YWWA 4CO2A 4DCOB 2X1GA 1WI6A 2DCUB 2P6TA 1M1HA 1WACA 1X8DA 3PHEA 4J7CA 3IRXB 5E3AA 1U2CA 1SI9A 3AOAA 1ZETA 1KQSR 5I3UA 1VQOS 3QJPA 1HBMB 2HRYA 1S1WA 4ZVPB 4EWTA 2AJQA 3MEDB 4UOGA 4TU7A 3L95X 3W8PA 3GSIA 4IRKA 1QSYA 2G0IA 4M5GA 2F4VJ 1UZHA 3M2UA 5KFAA 2YX1A 3R5JB 1VMBA 4H4KC 2M70A 1Z2ZA 2H5JB 3GV8B 2QZ8A 3MD3A 3IRWP 2DNOA 3HSZA 2PA3A 4OJGA 1LWFA 3KUHA 2KRBA 3AD7C 3HMJG 2QV6A 4WFZA 4AQYJ 1T9WA 2CKWA 4J9QA 5LXRA 3M32A 3ZZOA 1U24A 3C2PA 2WSEC 4URGA 4NYZA 2RKIB 1WTBA 1NB2A 4CLTA 4R8UB 4ED7A 2GW8A 3MMAA 1S76D 2CQIA 1VS3A 3TOQA 1RT5B 2AF6A 3PR4A 4J90A 1RT1B 1IWGA 2MKJA 5CD4H 2WAQD 4AD6A 4H4OA 1U49A 2J0XA 3VVUA 1L3TA 4KO0A 2VFTA 4EZ9A 3EGZA 3GWCA 3RUBL 1T05B 3HI9A 1JX4A 3MEGA 5SZTA 4ZK7M 4Q5VA 2ZH1A 3EVWA 3RB3A 2DEJA 2KYXA 4JI2J 3T1YJ 3PW0A 4NLXA 5K5MA 3ICLA 4KQZA 3DMJB 3BS9A 3G4SS 4DQQA 1AUDA 4HTIA 5H9FK 1S1XB 3MMBB 8ATCB 2HHHF 1HBOB 3HKWA 4DCJB 5A8WB 4OZ5A 3MAQA 1S1XA 4MTPA 1T9UA 1IVZA 1W7WA 5ETOA 4I6AA 4B3TF 5CD4A 2DK2A 5GAEU 4JI2F 2CQDA 4M5LA 4OYMA 3UR3C 5KFFA 4EEYA 3CE8A 2D74B 5CYMB 1J5EJ 3CJQA 3LWLA 5A2QU 4DL4A 1X5SA 1XMBA 4DLGA 1S6QB 1NDKA 2DNNA 1IBMJ 1HIYA 4X66F 3RBZA 4CNYA 2FYXA 3AB4B 3EJMA 4LT6A 4YR2A 3OLAA 1EQ0A 3L3CA 2PO4A 1SV5A 4KHMA 1AUSL 3ISNC 3MCOA 4MAKA 3PNIA 4CLUA 3EZUA 1VIOA 1TK8A 4UY8T 3KOAA 2ZJPQ 3B8HA 3PO5A 4OI1A 4OJHA 5DS7A 3LW5C 1S7IA 4DUYF 1N52B 1TQLA 2A3JA 2LQ9A 3AQPA 3C16B 3DNCA 3E8OA 3HT0A 3LP1A 4MKBA 5ETKA 3SCKE 3BSOA 4FF3A 1NDPA 5HANA 1XJWB 2GVDA 3MURP 1S1TA 1F5BA 1ZYQA 5K8NA 1DQ8A 5IS2A 2QL5B 4YR0A 3TAMA 3W3SA 3M6XA 3FK4A 4KFBA 2LU2A 3ZZUA 4P74A 1HHSA 4NE9C 1QLNA 2IC3B 2EC0A 1KONA 3H98A 3VVTA 1FJEB 4K50A 1ZAVA 4HH1A 3FUYA 4R0EA 2VFVA 1HQUA 2BM1A 4LBPA 2MGZB 2V0NA 3R7SB 3H8YA 3TX0A 2L41A 4IQXA 4ILMA 4LFBJ 4DI6A 1J2VA 5KAKA 1BHNA 5GADU 2Y1IA 2AIRB 2BA9A 2C2RA 1X4GA 2BKPA 3BPDA 1PG5B 2IVMA 1H98A 3OD2A 3BSNA 2G0CA 3HKZD 2YPZA 3IR6B 1RAFB 1H2VZ 1GXTA 4ZVFA 4K0KJ 3MUVP 3MOJB 4GO7X 5KFQA 4DSEA 2QL9B 5GMEA 3OSPA 1REVA 4OI3A 2AGOA 2E1CA 4X84A 1HNZF 1KFDA 4OYXA 4AFFA 3SYZA 2UXDJ 2W8KA 1NEEA 1JJ4A 2ADCA 3HSDA 3AD9C 1DAXA 5KFHA 1BY9A 2HAIA 2H4YB 3CD5A 3CB4A 4PXEA 2LDIA 3D6TB 4USWA 4CH1A 3TARA 4PRFA 3MMBA 2ZDPA 2W8LA 4OIXA 4DPXA 1RTIB 1SB6A 4CLFA 1U45A 3RAQA 5B0DA 1Y11A 4L3NA 3RRGA 2W2NP 1K1QA 1B7YB 1RK8A 4QZVB 5KFPA 5FJ4A 1JJHA 2KVQE 1WEXA 3DLLQ 1KLMB 2B5JA 1XK8A 2AKWB 2EG2A 4NLWA 1GX5A 4YP3A 5DGAA 1XEZA 2XMAA 1CEZA 2WBRA 5F0UA 2HQIA 3C14A 4K5RA 3MUTP 1GMWA 4P10A 3GG1A 3N01A 4G1QB 3DRRA 5C25A 2JH3A 3R7NB 3OL8A 3KXDA 3TRGA 4IFVA 4WCEQ 2ZH6A 2KFNA 3W66A 2HGLA 2EFNA 2F1FA 3NGRA 2D41A 2OI2A 2V2KA 3PJXA 5A8KA 4DMZA 2XWYA 3M1VA 4ER8A 1UVNA 2AYMA 3CNQP 4WYLA 5D4LA 2CQBA 5KG1A 2B9YA 1WHVA 3M8WA 1HW8A 5J2QB 2XY6A 2IVYA 4LVNP 3TNVA 1AZSB 2NXEA 3W9JA 1SL0A 2HHTA 3CJ5A 3FC9A 2KZMA 2Q66A 1KTVA 3CUNA 1FD2A 2LQBA 3I0RA 5KOWA 1N36F 2RRNA 3FEXB 2CDRB 1RU2A 3UNGC 1OWXA 3EPGA 4LSZB 4RW9A 2O67A 5I3PA 3HVWA 3OUYA 1FI4A 3CJ4A 4DL5A 1RWUA 2ZKTA 3M6WA 3SFUA 3UD3P 2PI5A 4PG4A 2U1AA 4XK8C 2MMYA 3EMTA 2W2PP 1S6OA 1C2PA 4F4KA 5BJRA 5CZVA 5KFBA 4LFAJ 4ECQA 2OKQA 1F6TA 2RDJA 3FSIA 1NKCA 1TL7B 3QLHA 1S7HA 2ZZNA 2HHSA 1HQEA 2DTJA 4RWXA 2E66A 2M5YA 3BGRB 4WYWA 2MQQA 3R2CJ 2OGUA 1GX6A 4L74A 3KDNA 2RF2B 4ATNA 3RR8A 3C19A 2RS8A 2I2YA 1U1KA 4EI2A 2JZ5A 4A8FA 1S6PA 1MMNA 3NCRA 1MN9A 3EDRB 3HXMA 4A8MP 1KQFB 4XIUA 2RQMA 4ELVA 1TFWA 5ETMA 4WK1A 4YHHF 1L3VA 4FS1A 4DWIA 3OVAA 2MQ8A 5CHCB 3H25A 3OFEA 2PT0A 1S49A 1D8ZA 3OR1B 1U2FA 3W2VB 3BQ2A 1VFJA 3MMCB 5KFNA 3GR1A 3GV5B 5J1EB 3ENVA 1YJUA 2HIYA 3GFHA 2CADA 4XPCA 3BBCA 2YNHB 5E3CA 1JLBB 3PYDA 3GONA 1XNQJ 1YJ7A 2QLXA 1YBTA 3RGIA 3K57A 3R97A 2O66A 3DOMA 1RABB 2ADBA 2V67A 4OV1A 3V6HA 1IN0A 2YKNA 2P2CB 3CDBA 2BE2A 1VQNS 1AZSA 1S6PB 2XSJB 1VHIA 4BCAA 5CABA 2FZGB 4G65A 3NMRA 1CJVA 4WTOB 4B9VA 4M95A 5B09A 2KTQA 3JSBA 3M1VB 1NLKL 3M05A 2VL1A 4PXCA 4F7VA 4FN5A 1OQ6A 3BGRA 1HWLA 2FZKB 1Y5IB 4IOAQ 1KD1T 2Z57B 4FYXB 4G1QA 2FLPA 4B3RF 1AYEA 2EVZA 1Q86T 1UETA 1PC5A 1Y7PA 3O1LA 3PFOA 2JWNA 4O44B 3O3LA 4X4OA 3PKYA 1WOPA 2OPRA 1N88A 3HVTB 3V4IB 4NXMJ 5IT4A 4ES3A 2C3PA 3Q2SC 4NPOA 4CRJA 4RW9B 4A4JA 2PN6A 4M5DB 3SMZA 2PD1A 1LXNA 3TYTA 3DLKA 2IMWP 2MQLA 4DDFA 4EBDA 3TQEA 2I8EA 2Y1RI 3DLJA 4IG3A 1TL5A 1JIHA 2JRSA 2DPJA 1QM9A 2AGPA 1YDLA 2CJ9A 4O44A 2E5HA 2KJWA 2PA8D 3BR9A 4U9RA 9RUBA 4KSEB 1C0UA 3CULA 1R0AB 2I5JA 4WFYA 1JJ2R 2HMIA 4C8ZA 3CPWR 1CC8A 2OHDA 1FX4A 1FXLA 1O5JA 4ICLB 2FGOA 6FDRA 2I9SA 4N7TA 1R0BG 1F5CA 2QMWA 3OHAA 2AZ1A 1JNRB 1I1GA 1TKTB 2L9DA 4CTAA 2UUAJ 4JI7F 3DU5A 1QAXA 5C25B 4LR8A 1PAUB 2QG9B 2XMWA 1ELOA 1G6BA 1VISA 3FGVA 4Y2IA 4PR6A 2VFSA 1FRKA 2RUGA 1X4EA 1Q79A 1BXNA 2QJ3A 2RU9A 2QRRA 2VASA 3KJFB 2MDAA 2FUG9 4CNZA 1HQUB 2MGZA 4O23A 1XWLA 1XNRF 4X62F 5KG5A 2V6AA 1CJUA 4FZVA 4KE5A 5JUMA 2MY7A 1FESA 2AX1A 2KYZA 4LRBA 4RNMA 3UCUP 3CEDA 2YWEA 4ZCLA 2VG7B 4B17A 1SKWA 1R0CB 1S9GA 2ZKUA 4FYVB 2R42A 4G1IA 1WEYA 4DUZF 1REVB 3IAS9 5BYQA 2UXCJ 1HBNA 1TUWA 5ETQA 5ETSA 2K1RB 3D6HB 3RRHA 2B7BB 3A3OB 5LMNF 1JWWA 4F50A 4Y0FA 1RTJA 1UW9A 1JLCA 1VJQA 3BEGB 4N8NA 5MAOA 5DDPC 4LF4J 5E3QA 4KR0B 1VK3A 1UVLA 1ZPVA 1PGZA 1H72C 4P73A 4JYAF 1RBOB 3OFHA 1P1LA 4BLGA 1N32J 4QJVA 2VG6B 4M1KA 5C24A 3PZPA 3QSIA 1L3SA 4JV5J 5GVQA 4PQUA 4DR7J 3FQKA 3US5A 5IM0B 4EU0A 4J9MA 2KG0A 3Q24A 4ZLPA 2K7KA 4F4WA 3M2RB 2EFPA 4X4UA 4ENOA 1ZAWA 4C0OC 1XR7A 1TKXB 1SJFA 4KC5A 2DNPA 1RT7B 5D77A 2DY9A 1TR0A 2K06A 1FERA 1XQIA 1R43A 2DO0A 4WP8A 5IQQA 3UD4P 3EVOA 4QU6A 4M5KA 1I51B 3I5BA 3GYXB 3LQVA 1JLAA 1TL3B 2LFVA 2WVDA 2XNQA 4NLUA 3PRVA 2CYYA 2IRYA 2XNRA 4USTA 3OVBA 4ED5A 1N33F 1RE1B 4NA3A 2C3MA 3MHYA 3T19A 1RKJA 3NNAA 2RMLA 3BYPA 1ZS6A 1V3RA 3ZO7A 4B3MF 2J9CA 4PXBA 1PCAA 1FRHA 3O44A 5D78A 1JLAB 1TL3A 3W64A 5IWAJ 2ZH5A 1ZZNA 2F9DA 1CULA 4RBVA 4DR1F 1HBUB 2Y0SD 4A48A 3P45B 5GMDA 5J1PA 3GE9A 4GVLA 2PC6A 2K3IA 2ZE2A 1C1CB 2LQ8A 2BV3A 2JDJA 3IXQA 2GFFA 4D3HA 1S1UA 2ALYB 1RT7A 4HVZA 1EP4B 4OLPA 4CH0S 2LVWA 1DLOA 3SEOA 3TZXA 2J0SD 2QTWA 2HFSA 3FCWA 4LBHA 4RNNA 2XHWA 3CCLS 2J5AA 2QEXS 3NGKA 3DGPA 4DV1J 4I2QA 1SQEA 3G82A 4HT7A 2AJ4A 5DO2A 2H5EA 1B0TA 5KFKA 1WF0A 3KLEB 2YH0A 3CDEA 1TTHB 2ZH7A 1HBMA 2VOOA 3QZ7A 3SBMA 1AB8A 2XCPA 3V81A 2EPIA 4Q2MA 4AUKA 4Y2KA 3ZZYA 2VOPA 2UU9F 5E7OB 4P7TA 3K2YA 3UN5A 4BDPA 4IG0A 3M6VA 2R2UA 1OYDA 2MZQA 2DGWA 2J7KA 4RNFA 4C8LA 3EGNA 4ECTA 2E1PA 4DXLA 1C0TB 1VYAA 1RHKB 4K59A 2ASLA 1R7IA 2XBPA 4MKVA 3SQGB 2D1CA 2DNKA 2ZC4A 2HHXA 3D6MB 4DL3A 1IQTA 1QUVA 4NRUA 1S9GB 1GK8A 4OI4A 1SKRA 2V8HA 2VG7A 3AXMA 3BBFA 4Y2CA 4V1Ak 5F9LA 1N34J 4WKRA 3UN2A 1TL4A 1SH0A 1S1TB 2UVVA 2YWFA 2CPZA 2AU0A 4OYWA 2FHJD 3FCVA 4OX9F 3TZYA 4EK2A 5DDRC 2HRTA 3CGIA 1LNQA 4DSFA 1KRPA 2HBYB 4ITSA 3UFCX 1MMLA 3LA0A 4FP9A 2LQJA 5JXSA 3SIPB 2OP5A 2I0XA 2MPUA 2W4CA 4WP3A 5KG7A 4MKAA 1MWZA 3MXHP 5KFWA 1UJ6A 5IZHA 1UVJA 2AMCB 2QIFA 1CJKB 2Q79A 2XYHB 1RBLA 4MT1A 4IYQA 2IVFB 2L9NA 4CQ1A 4DV4F 1U1MA 1DZ5A 4MIBA 3I6PA 5ITHA 3KLFB 2Z58B 3M9MB 2AYGA 1RAIB 1PO6A 4HYKA 2HZVA 3TJ8A 3V5RA 1W2IA 1QAYA 3OV7A 3G8SA 1YJWS 1XMOF 2H54B 1T05A 4R0JA 2DT9A 2QSFA 5A8RB 3KMSA 3CVKA 4X4NA 2VFRA 2WW4A 3W5YA 2ABYA 3SZ2A 1X9SA 1GAOA 4KTQA 1FK9A 2JEJA 3DLKB 3HHLC 3EE3A 1IM4A 3TP2A 2XLKA 1N48A 1NMEB 1F9FA 1XN9A 3DYAA 3HVTA 4PUOB 1QE1B 3H7HB 4RUCA 4K8RA 4OQJA 1VQLS 2OPRB 1LFWA 2YY3A 3M8PA 3V4IA 5G0RA 2FTRA 3OL6A 1VQKS 2DHXA 1OPIA 1FJGF 4FXVA 4U8VA 3ITHA 5D0EA 4ZPVR 1PYOB 3RTVA 4BS2A 3OL9A 2KT3A 3OTEA 4DS5A 2KI2A 1IXKA 3NS7B 1ZTTA 3SFGA 1CJVB 4J9PA 1UVKA 4DSIA 1H2UX 2IIHA 3IWXA 4H54A 3MECA 5L39A 2LDYA 3IGVA 1TU0B 4ECZA 1L5UA 3WX8A 5T14A 3OTOJ 3ZNUA 1R8PA 1JLFB 3KJQB 1NJYA 3IBWA 3U1NA 2LQ5A 4X62J 3EXCX 1VQ8S 3SV3A 4Q8FA 1MG7A 2YNHA 4TKTA 3PW5A 5GADI 2CG4A 4GKKF 3LALA 3MAHA 5J1EA 1LV5A 3FSYA 5AXNA 3VAGA 4JBCA 5HLFB 4FKYA 1FRIA 1KS2A 1UL3A 1YKWA 1GFWB 1S59A 2BJ8A 2CPIA 2IRXA 2NUUG 2ZBPA 4QIWD 5H9EK 1TK0A 1JMTA 2DGTA 1FFWB 4B9SA 4WIIA 1SC3B 3JAMY 2V4JA 2GC8A 3HVAA 4JI6J 2M9KA 4ECYA 4NX9A 1KBRA 4ZP7A 4X2BA 2HBZB 2ZZTA 4JYAJ 2ZVIA 4U8YA 3IG1A 2IHR1 1WC6A 2E1MC 4FYYB 3DN9A 5LMUJ 2FD2A 3POTB 3HHLA 2O5DA 1NKEA 1TMMA 1VGYA 1NHVA 5DETA 4EYIB 1I3OB 1RT2B 3FRZA 5GAGI 3HJVA 1R8AA 2EKYA 2W4PA 4ZP6A 2HIQA 1MROA 2L08A 4LRDA 3QRRA 1LK5A 3HHKA 3E3XA 2WB1D 1RLDA 3UVJB 1U1NA 3G9CA 3TUPA 4GRSA 3BR8A 3Q8UA 1KHWA 4A47A 2RT3A 5ETVA 4FBUA 4OFZA 2JEFA 3CDWA 3KFWX 3MD1A 3I0RB 2APOA 2N4CA 3PYGA 4DV2F 1HD1A 1KWMA 3ET6A 4B3SJ 3K5PA 5K14B 3TUIC 1L3UA 5KFZA 4F4YA 3VAHA 1RAHB 1SIWB 4OX7A 5J2QA 4JI0J 4IR9A 2HFUA 2QC3A 1VC0A 1F2HA 2JLEA 3CJ0A 5CXTA 3GILA 4LIRA 1E6YA 1TAQA 2HNZB 5IWAF 1VQ4S 1UPPA 3KLFA 4CZCA 1X31C 2HKEA 4JI8F 1CPZA 2JEGA 2YQ3A 3AA8A 4DR1J 2I1RA 5B0FA 2FJVA 3RAXA 5IT9U 1U1OA 2YWGA 2CNOB 2VG5A 4HHJA 3BBBA 4CO1A 4ZLJA 4DV6F 6AT1B 2M4MA 4ZP8A 4DFMA 2ZWOA 3PJ9A 2XULA 1HWUA 2QMUB 4MYUA 3CCUS 3GB0A 1BUXA 3MCMA 4CO4A 2J76E 2VU5A 3BREA 5L8RC 5B08A 4DV1F 2ATCB 1RTIA 4P9SA 4WPAA 4CO0A 1RISA 1Z1ZA 2D7SA 2QMXA 3TUJC 2FC8A 2XQCA 1KN6A 1LXJA 2LCWA 1WNEA 1RU1A 3FFIA 4NLQA 5E3PA 1B70B 2JJ4D 1TVRB 4I67A 1PAEX 2GVZA 4ETZA 4DFPA 1BE4A 1S12A 3I0SA 3U1MA 4RUHA 3CCRS 3PVXA 2OJ3A 2PSZA 3ENAA 1FFGB 2EFGA 4TN2A 3SQGA 1BQMB 1BC6A 4ZPDA 2UXBF 3F41A 4IUFA 1RWKB 2PEBA 2CZ9A 3QYYA 4GMKA 4FDFA 3R2DJ 4LRFA 2ZWPA 3IO1A 1IBCB 3S7RA 4LFCF 1UCNA 2GJIA 4O0NA 4DL7A 1UMJA 5HROA 3QBCA 1CC7A 5F8JA 3CF5Q 2DRAA 5B0AA 2VD3A 3C6TB 1RWXB 1N6QA 2GJ2A 3AB2B 5I42B 2M7SA 1T03B 3OPKA 2VB6A 2MLYA 2LU1A 3C66A 1RYRA 5D4OA 1SH3A 4MFBA 2WVFA 2PEHA 1MWQA 3W8GA 3GIKA 4W90B 1DRZA 3KMQA 1YJTA 2RQ4A 3PYFA 4KFBB 4F26A 3T9NA 2RVJA 3TEHB 2R7SA 2VHGA 1NK5A 3K5NA 1CJUB 5ETTA 1S72S 1BLUA 1FWLA 1T95A 4HH0A 3JQMA 1CBKA 5M2PA 4USMA 1Q16B 1U7LA 3FMBA 4JB8B 3ZZRA 2CQCA 2J9DE 4QOTA 1HPZB 1NSAA 1X4CA 3L4BC 3IMQJ 4N56A 2UV8G 2AJ2A 3VF0B 4KGMA 4DQSA 2RDDA 2LEAA 1NK9A 1TL1A 4RR5A 1YJ9S 4C8OA 1OSDA 2XGPA 5D3GA 2YQ0A 5CH7B 5BXIA 3F0NA 3M8SA 3KHHA 2P6SA 4U95A 3DLHA 5F8NA 1IKYA 3N6MA 4NA2A 3KLVA 2CPJA 2X51A 3WIUA 1HNWF 2OMLA 3DOKA 3LP2A 3NNCA 1M1GA 4J9UE 4LUBA 2NSCA 2OUGA 5K8MA 4QWEA 2ZH2A 4K4WA 2YX4A 3DM2B 4HL9A 3THTA 4DUTA 3TQ1A 1HKAA 4CYUA 2J0QD 1PJ5A 1ZM4A 2GVZB 1PBAA 3K5OA 1J5EF 1SKSA 1F9HA 3RB4A 3D4JA 5KFRA 3LWMA 3KNAA 1DLOB 1T9TA 4CM2A 1VQ7S 1CLFA 3RYLA 2V69A 4X66J 1PYSB 2RU3A 2X3DA 4KHPF 4C3KA 3SXLA 2WVBA 3LO3A 4IRCA 2GGPA 1Y10A 2OPQA 2DD8S 2BEFA 3DDKA 3N28A 1M5OC 5ETNA 2HS3A 2CPYA 2VG5B 1VHFA 3QGHA 4XAKA 2B4VA 2QGFB 2XO6A 2QA2A 3TA0A 4DL6A 1JLEB 2E7VA 1TUVA 5M2UA 3HHNB 3ZXWA 1R31A 1N54B 4CH7A 2B6AB 2XHCA 2Z4PA 3MPVA 4NOHA 3K5LA 3AT1B 4C8MA 5B0BA 1IBLF 2R7UA 3ETMA 4DV3J 1NH8A 1NPKA 3HLUA 2VKRA 3CTRA 2VC0A 5LSOA 1YLXA 2RKIA 3A3NB 5L9XA 3OTOF 1TL1B 2HQCA 3MMAB 4NZ7A 1G3OA 4W4MA 1FWPA 5F0WA 1X4BA 2YKNB 3LP0B 5DLFA 4IRDA 4GKKJ 3AH6A 1BD6A 2OLWA 3ET6B 2ZEJA 4ELUA 2PE8A 1K44A 2P9GA 5KFGA 3VAIA 3EDQB 3LAKA 4DR2F 4M5IA 5KT4A 2LA6A 4ERDA 1YJRA 2UVUA 2QFJA 3D1HA 2HRUA 5C2CA 2ROPA 3MR6A 1EHWA 2R9LA 2ZJQQ 1RA7A 2GQCA
chains in the Genus database with same CATH topology
2JC1A 2KJVA 2XMTA 3CCTA 4USHA 2AQ4A 1YQHA 1FTCA 2VH7A 1RT6A 2MZTA 1UEVA 4DBQA 4USIA 4MKYA 1KNZA 3MR3A 3SDEB 3GIMA 4LQ9A 4OX6A 3KK3B 2XY5A 5HROB 4URQU 1URNA 3NL0A 5IXUA 3LANA 4X4PA 2VBWA 1JNZB 4LF5F 4OHYA 2LXIA 4ZHRA 4HKQA 2P5VA 2LECA 5CYJA 4I69A 1RT4A 4ICLA 4X4QA 3CCSS 4BWMA 4PWDA 5JVGQ 3IN5A 4AYBD 1R0AA 3HO1A 1T94A 2E7XA 3HDSA 3KHRA 2E1AA 4NLPA 3EUNA 3OSNA 2CQ0A 1NHUA 2WB4A 3VWSA 4B3SF 3V4MA 4EBEA 1IUJA 2K3KA 2LMIA 2RRBA 5KG0A 2NPIA 3DRPA 3E51A 5IFMA 1QVFR 3GG0A 4MMOA 3CCES 3BGFA 2LKZA 3U7JA 1HNIB 1WEZA 2BM0A 3DLGA 4CTAB 4NYPA 2RS2A 1I94F 4RX6A 3PW2A 2YWKA 1JKHA 4BC9A 2KG1A 3TO8A 3G6YA 2NSBA 5K9FA 3PEJA 3OXLA 2HMIB 5LT5A 2CJAA 2BBEA 2DHAA 3MEEA 3R5AA 1HNIA 3DLGB 2DNHA 2XC9A 3D2WA 2B0GA 1JXEA 2B9WA 4LF8F 4RW4A 4DPOA 4CT9A 3OR2B 3JYTB 5DDOC 3OL7A 4M5DA 1U1PA 1JLBA 4KHRA 4C7QA 2IM2A 1SXLA 1RGVA 3SV4A 2HG4A 1WELA 4ECSA 3M8RA 1QSSA 3N6LA 5G4DA 2DJWA 2F3JA 2HWTA 4LSNB 3I4PA 4FF2A 4EO6A 1VRTB 3LPYA 1V3SA 5EWEA 2MZRA 3QGPA 2W9AA 4Q7AA 2FJWA 4FF4A 4PWDB 5EDWA 2W9BB 2XS2A 1M0SA 2EFVA 1P6TA 2WK4A 2R7QA 2K8GA 2ZBCA 3NMAA 4ZHRB 1KR4A 2R8HA 1QY7A 3UI3A 1A9NB 4XO0A 1UAWA 4R25A 2XS5A 4LJMA 1T02A 2QA4S 3T3FA 1FKAF 3AY0A 1HQEB 3MR2A 4E0DA 1LK7A 3BGUA 4FBTA 1X5PA 3N9UC 4OLOA 1PSDA 3QWPA 1S9FA 1VQPS 2XLIA 4K4UA 4YDXA 5EWGA 1M5PC 3VCDA 1T8EA 4URSA 1AROP 3CSKA 6FD1A 4WF9Q 3B4DA 4OJ3A 2VA3A 5JJBA 2Q6CA 3VAJA 2V5HG 3OVSA 3H59A 4DR6F 1S6UA 2HFNA 4UQGA 5F8MA 2DNQA 1GXUA 2VPWB 3PM9A 3J7A1 3E01B 4NXMF 4K0KF 3VQSA 1PILA 4M63A 3BO3A 3X1LB 4K4VA 5DG9A 1SJ4P 2J9EA 2ATLA 1S1VB 3VZIA 3RZAA 1RJJA 2BDPA 5KFJA 1U09A 4WK3A 1S6QA 4I1TA 4ECUA 2OPPB 1LWEA 3LGMA 1VBZA 4NCBA 1Y4ZB 3Q2TC 2XEXA 2IFXA 5CCLA 3NAHA 1E6VA 4Q0BB 1HA1A 2D3ZA 5KG4A 5L1IA 2YTCA 2QA1A 1LFPA 1VIXA 3NG8A 3MDFA 2O01C 1SL1A 1S1UB 1X4AA 3CMAS 1DHMA 2UUAF 2E44A 1UEUA 4YDDB 3W2WB 1D0EA 5A8RA 3TA1A 1NJWA 1HBUA 3GIIA 3F56A 3MI7X 2R8IA 1U6BA 4DV3F 4HI1A 3H5SA 2CQ4A 4TYBA 5E5NA 2RSQA 4Q44A 2EFQA 5D6GA 5HP1A 1V3ZA 1RTHB 1RA6A 1S0MA 1B64A 2V94A 3JSRA 1UW4A 3H20A 1RT5A 2AYBA 4O3SA 2CQHA 2HVIA 2CJQA 4U6PA 2HFZA 2NS1B 4C98A 4WU2A 3P6YC 3G86A 4TY8B 5B0GA 2YVSA 1YWXA 4QIEA 4X65F 3S01A 4ZCMA 3HM9A 4K5SA 4OHXA 3WX4A 2C3OA 3PRDA 2BJEA 4USJC 2VQEF 1TAUA 2ZDOA 3DDNA 1YRXA 3VALA 4C8NA 1IR0A 3M2RA 4RW4B 2DR9A 2GA7A 2M2BA 2ZVSA 3OXGA 3R3TA 5IT0A 4K4XA 3KK2B 4MK8A 1SJ1A 1LOUA 2ASYA 1D9DA 3MM8A 4RU9A 4X4RA 3PIPQ 2M3DA 2CFXA 2ZHOA 4PG6A 3TX8A 3AJ1A 5DM7Q 2F8EX 3OTDA 1DTQA 4QYRA 2BANB 4ES1A 4I6YA 1Q53A 2HNYB 1YITS 4KRWA 1Q81T 4DSKA 3I82A 4TLRA 1U26A 2K1RA 4OI6A 3D0HE 2O1PA 3QGIA 2XZWA 3C8YA 3A8EA 2IC3A 3MPWA 5CZXA 2JEIA 3IR7B 1QSLA 1Y9OA 4L6V3 4GC7A 4I2QB 2HWHA 2J8AA 1D9FA 3MOZA 2OIHA 1FKPB 3UDCA 1Q4RA 4QWCA 3IAM9 5KFVA 1UKUA 2MJNA 2PDAA 5KG6A 2DNYA 2E5LF 4IOCQ 2DR5A 2AYEA 2MKHA 2V4QA 3BQ1A 4J9NA 4DQPA 3G6VA 4GO5X 1SV5B 3MZIA 1NJZA 2FVQA 3TVKA 5J2NB 1FE0A 2YX7A 3ULHA 3UDLA 5HO4A 4FS2A 3SI8A 5IT9Y 2FLNA 2PFFB 4DJBA 4LSLA 5GAGU 1E6YB 2QLWA 1LW0B 4AL5A 4KKOA 1EETA 1U4BA 1OIAA 2F8HA 2KHCA 4N8OA 4PCQA 4O3NA 3S1TA 2KFZA 3CC7S 3QJJA 2HS4A 4V19X 4L72B 2HLTA 2OH2A 4JI1F 2AJ0A 5GMKa 1UJ4A 3VAFA 3DU6A 3AQOA 1DARA 4KJIA 2VC1A 3DMJA 5MLCV 4YOEA 5CA5A 3MEGB 2GMHA 4OHVA 4LMZA 2UP1A 2B43A 4Q8EA 2VKZG 2V4RA 4DOZA 2L9WA 3Q22A 1WHXA 4W92B 3POTA 1YVFA 1N5SA 2X1AA 4K4YA 1S10A 1N56A 1VRUB 2KB2A 3R5BA 4AQYF 2MZJA 4KAIA 2JFDA 5KFUA 1G2EA 1SUQA 4DL0C 1S0VA 2J9DA 1BQXA 3DI6B 4ECVA 4C0BA 1AFIA 2UV8A 3FVYA 5I4MA 5KT2A 3RU0A 4P6QA 3J7YU 2YKQA 2COLA 1YIJS 2HLUA 2ZD1A 3B82A 5HLFA 3VR1A 4DS4A 4OI0A 4AXJA 1KVIA 2KXHA 4NLGA 3OR1A 1A7GE 4PPDA 3EPIA 2IJNA 3HHLD 3I5AA 3DOKB 1P9QC 2JVRA 2QA4G 1JXLA 2C2DA 1FNXH 2DH8A 1T3NA 4X4SA 5A2QY 1TKTA 2UUCF 2KDOA 4JV5F 2FVRA 4NZ6A 2N7YA 3UE2A 4OI2A 4OX8A 4CO3A 2C2EA 4YMEA 4A8YA 3I32A 3JSYA 3R5CA 4DG1B 5F3TA 2HHUA 2ZUGA 4V19J 1Q78A 1VRTA 2D3OR 4EUVA 5T7LA 3BN7A 1FKOB 2WCXA 2LA4A 2ZOFA 3M8PB 1YG0A 2IA0A 1TKDA 1FKPA 4IG3B 4NLRA 4NYOA 2VUGA 4ALZA 4ETXA 1FNMA 2OO4A 2C3YA 3OR2A 3JYTA 1DTTA 1IKWB 3J81Y 4I4BA 2EBGA 1K73T 2HHVA 2CVEA 2CVIA 3C6TA 4ECRA 1NK4A 1NRKA 5IQ6A 1C1BA 3NBPA 1HNVA 1OPZA 3DRSB 4ZPWR 4F3QA 4TU8A 3VAKA 4ECWA 4LF6F 4OL8A 2Q6BA 4KGKA 2P9EA 4RW8B 2WONB 2QT7A 3KNGA 1FRXA 3CDAA 1SL2A 1J5OA 4H4KA 4UUXA 2FB0A 4YEAA 2KXNB 2FJEB 2Q43A 3H5UA 3NRBA 4QPXA 5LSRA 3KK2A 3TUZC 2FY1A 1UFWA 3FRYA 5HMWA 3ZZPA 5M2RA 1WF1A 2CJBA 2YKOA 1LW2B 4I64A 2N82B 3HHDA 1MU2A 4H4MB 4C2MA 5GAHI 2RDIA 3F44A 2XB2D 1PC4A 1NO8A 5KG3A 2KM8B 1HMVB 4EBCA 3HK2A 4ID8A 5LJ3Y 1XERA 1QUPA 4TY8A 3W2VA 2CQPA 2YKPA 2NYIA 1JLQB 3SSQA 4ZCIA 3LH2S 3MMJA 2D3UA 5E41A 2CZ4A 4JV1A 1ZAXA 3G71S 3CJ2A 3WC0A 3D1OA 1FD8A 2FPHX 5FDLB 2ERRA 3U27A 2MKSA 2R4FA 3K5MA 3DRSA 1HNVB 4Z2XA 4DHVA 2OFHX 4N5SA 2ZHAA 4MIWA 5LSLA 4DQRA 3TW0A 5K14A 2DGSA 3GYNA 2XO7A 4IDKB 4PXDA 4OJ1A 2DVIA 1N0VC 1T7PA 1U8SA 3M6UA 3HP6A 1X4HA 3NS5A 4FF1A 2Y1JA 2LEPA 4JI0F 3OUYB 4HI2A 2VBZA 3NP5A 4KV8B 4TXSA 3V2UC 1HI1A 5F8GA 5AXLA 5DLGA 3QIDA 3PJWA 3GMGA 4LVOP 1EP4A 1U47A 5T7LB 1VC5A 2OPPA 1R8HA 1N5QA 4OZ1A 4ILRA 2ZE2B 5HQ8A 1X5TA 2DH7A 2JVOA 2IM0A 3QO9B 5L1KA 3TAPA 1X9WA 3BF4A 1BQNB 3FNNA 3PDNA 2RQKA 1JLGA 4OZLA 2BVZA 3TI0A 5CCMA 4P7VA 4JI4F 3KLGB 4J9SA 1KLNA 4IO1A 5AXMA 1D3WA 3RB6A 4NLYA 2J7WA 2JX2A 4FVMA 4IFVB 3LF0A 1HWIA 1Y5NB 4KPYA 3H5XA 3KJVB 1HL6A 2LLZA 4I7FA 4QIFA 4ERDA 2MKKA 5DDQC 1KLMA 2B5JB 2DNGA 5CYMA 2CPEA 3N5FA 2M8DB 3C3LA 1NK0A 2VPXB 5AE3A 3GQCA 1YGYA 2R2RA 1MNEA 4P2SA 5KT7A 3OFGA 2G13A 3TVYA 5FIIA 3G8QA 1V6HA 5KFLA 2X1FA 4OZ0A 3MEKA 5E0OA 4C0HA 1M5VC 3PEHA 4DEZA 3AAWB 1NU4A 2OFGX 5D4PA 4JV0A 3CJKA 1FT8A 1OSCA 3LP2B 5LXYA 1J5OB 1F60B 1K9MT 1SIZA 4AXIA 1ZBTA 4YFUA 2ROEA 3G6ES 3ZC4A 3V6DB 3P5TL 2ACYA 3I4HX 3ITHB 3UWTA 2VODA 3LAMA 1C4CA 3QJLA 3PX6A 3LUYA 3CCJS 3VAMA 4R5PB 1DTTB 3UQSA 4AL6A 2GMLA 3IA0A 3O8WA 4RKUC 3I9ZA 5F8HA 4NMLA 2HFOA 1VK8A 3TAMB 4ED2A 3JB9k 1FK9B 4BBYA 2WOMB 2GO8A 4LF7F 4O4GA 2KHDA 2W4DA 4FVCA 4RLEA 4F2SA 2DRBA 2MSTA 4IFYA 1QVGR 3O2IA 4C8KA 4QWAA 2DNZA 2UVRA 1FEEA 2Z0GA 3MM7B 3P3DA 4I2PA 4OZNA 4LSLB 3NKYA 2DITA 1FRLA 2JLGA 5H9FJ 3R1HA 2GHPA 4O3RA 1UP1A 1SJQA 2XG8A 1T3OA 3MWBA 1VLYA 1X0FA 4M94A 2V8GA 2CPXA 2AWZA 3IS9B 2AGQA 2MZ1A 2MB0B 4ES2A 2N3LA 2DGVA 1FTRA 4BHQA 3Q8QB 3I0SB 3MGJA 3CD6S 3AHPA 1VBXA 1WWHA 4ELTA 3BGLA 4RWWA 3MTKA 2HQ3A 3L09A 2NLWA 3O5TB 3OJUA 5HMZA 5BR8F 1HBOA 1F5AA 3DXBA 1FDNA 2YNFA 2ZOMA 2FGCA 3PRBA 4NL5A 3GZ7A 4QIVA 3CCWA 1URRA 3QAUA 2JOQA 3CO9A 1RT3A 5KFXA 1C0TA 1ZM2A 3M4XA 4IOBA 4KO0B 2XMVA 3V6JA 2MSSA 2AV5A 3D28A 4QIGA 4NRTA 3J80Y 4C3MA 3MM7A 4I2PB 3MM8B 3KG0A 2OMOA 4O3PA 5EWFA 2XSJA 4WZMA 2DR7A 2KKHA 1H0HB 4HTJA 4O4GB 2KRRA 2FJDB 4ZCKA 1N5YA 2W25A 1YBAA 4LF4F 5K8OA 2FVSA 2B56A 3K8WA 3N4WA 2BXJA 1MMDA 3PV8A 1DFDA 2X3GA 3GV7B 1NKBA 4TLQA 1X9MA 3DCAA 3HJFA 4YB6A 3MMCA 4DR7F 3J7ZT 3CIZA 4YB1P 2CRLA 1U6FA 5BYSA 3IRXA 1U25A 3C6UA 2CJKA 1WHYA 3V6DA 4CO5A 3NS6A 4E8UA 1P27B 3BDEA 4Q45A 5CYQA 2OPSA 5J2NA 1N8RT 3GSDA 4ECXA 1WD6A 2HVZA 2P9CA 2RF2A 2R7OA 4DV5F 3M2VB 4DSJA 5F8LA 2OD4A 3OFFA 1N5TA 1GTEA 3B78A 3J7Z5 3D5MA 3QLHB 2BQUA 4PG8A 3DLEB 2XS7A 4OZJA 2A2CA 2YNGA 3H5YA 3H4BA 1D9AA 4X64F