1YJTA

Solution structure of the cu(i) form of the sixth soluble domain a69p mutant of menkes protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
b'MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 20
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjtA00
2GGPB 4FNIA 2GV1A 2K1RA 2OP5A 2OKQA 2HQIA 2LDIA 2BJEA 1Y9OA 2HLTA 1ULRA 2VV5A 3UDCA 4F67A 4HI1A 1SI9A 1YJUA 3KKFA 4Y2MA 5B0AA 1FD8A 5B0GA 2HLUA 1KQKA 1WD6A 2FIUA 1OQ6A 1Q8BA 2AW0A 3HHLC 1JWWA 2ZDOA 2OAUA 5B08A 2QLWA 3LGMA 2PD1A 4NL5A 4HH0A 2ZDPA 5B0FA 3HF5A 3F44A 3HHLA 2K2PA 1AFIA 1OPZA 2GO8A 3VTIA 3HHLB 2IYIA 1SQEA 2KYZA 2LQ9A 2W4PA 3MCSA 1FE4A 3LGNA 2XMVA 3BGUA 3DXSX 5F0WA 5B0CA 2AJ0A 1FEEA 2K1RB 2ACYA 2GGPA 2OD6A 3BR8A 4DL0C 1YJTA 4DPOA 4FNHA 3KG0A 1YG0A 4A47A 3BF4A 3TNVA 1TZ0A 1P6TA 1Q8LA 1JK9B 2BBEA 3KG1A 1APSA 2FHMA 3HDSA 3QMQA 4YDXA 2CRLA 1YJRA 2VH7A 2AP6A 2W4CA 3DCAA 3FRYA 4Y2KA 1Q53A 2QIFA 4A4JA 2W4DA 3FGVA 1FESA 1OSDA 3LO3A 5B0EA 2K7JA 5A6WA 1GXTA 1X7VA 4YEAA 4A46A 4Q2LA 5A6PA 1X0PA 1S6OA 5B09A 3HFKA 1YJVA 2OMOA 2Q3PA 3I9ZA 3MZIA 2L3MA 2ROPA 4Q2MA 2OFGX 2BJDA 2OFHX 4OIXA 4HL9A 1N5SA 2K7KA 1YRXA 3BDEA 4U9RA 1TL4A 2KKHA 2N7YA 2RU9A 5F0UA 2IYGA 2HFOA 2XMUA 3CJKA 1FVQA 3HX9A 1URRA 3CJKB 2PGCA 3IWXA 1N5TA 1W2IA 4DN9A 1N5VA 3HHLD 1P8GA 1RJJA 5IXUA 2XMWA 2XMJA 2XMKA 3QGPA 1TL5A 4OJ3A 4ZOSA 1KVIA 1N5QA 1GXUA 2LQBA 1FVSA 2OD4A 3WDOA 2HFNA 1Y3KA 1V3ZA 2AJ1A 2FB0A 2N4CA 2QLXA 2RMLA 2XMTA 3K7RA 1TR0A 3BN7A 4HH1A 2ASYA 1TUVA 1CC8A 5KAKA 2ROEA 4Y2IA 3TOQA 1U7LA 2BUNA 3BM7A 1VQYA 2GFFA 2EW9A 2JDJA 1K0VA 3E8OA 3KNGA 2LXFA 1KVJA 1XBWA 1X8DA 2FTRA 3BB5A 2KT3A 1S6UA 2ROGA 5B0DA 2GA7A 2RSQA 5T7LA 3TRGA 4EFAC 2GCFA 2RILA 4A48A 5T7LB 4HI2A 1AFJA 1CC7A 2KT2A 4OJGA 2BYCA 2XMMA 2N4DA 3T9NA 4NPOA 2HIQA 1MWZA 1OQ3A 4QOTA 1FE0A 1CPZA 1QUPA 2IFXA 1AW0A 1SB6A 2QYCA 3GZ7A 1MWYA 3IWLA 2G9OA 1IUJA 1VQSA 5K9FA 1LQ9A 3FMBA 4ZA1A 1R6YA 4OJ1A 1Q4RA 1Y3JA 1Y0HA 4OJHA 5B0BA
chains in the Genus database with same CATH superfamily
4WP9A 1H74A 3H20A 3PRVA 3TAQA 2FJVA 3Q22A 3ZNJ1 2JHEA 1SC1B 1U1NA 2Z8QA 2PE8A 1K0TA 3W9JA 2D7SA 1ZA2B 1T95A 1Y7PA 2RUSA 1B99A 3JTPA 2HGNA 3EYZA 2L9DA 4TY8B 1KEKA 5GADI 4DS4A 2NXCA 4C8YA 5F8MA 2BX6A 3EMTA 5BR8F 2VG6B 1SC4B 1MMLA 4ID8A 1FFGB 3HHLD 3GMGA 1QDUB 1EARA 3M4XA 1L3SA 5LSLA 4N56A 1WSRA 3D3BJ 1BE4A 2M7SA 2W2NP 3GE9A 2KT3A 2FJEB 2J5AA 1SJ1A 2KT5A 3T9NA 5BJRA 5G4DA 2BRKA 3I56S 4OZ5A 2XULA 1RLDA 1X5PA 2HZAA 4HDHA 2GQCA 2MKHA 1UFWA 2BACA 4OHZA 3F73A 2W2MP 1RKIA 3OV7A 3PTWA 3NMRA 4M95A 4X62J 1QLNA 4JB8B 1RE1B 4XDDA 3D4JA 3M1VB 3ULHA 1MW7A 4I7FA 2W4DA 1S6QB 1FEHA 2KDOA 4ES2A 2HRUA 4DQSA 2BQ3A 1VISA 1DARA 4QPTA 2MLZA 3U27A 3HP6A 3M9NB 3D1HA 2AEMA 2OD4A 5GMKa 3V2UC 1P9YA 4ZPBA 1S6UA 4QJVA 1VJQA 5L8RC 3UO0A 2VOPA 4FZVA 3K5OA 1VBXA 1QD1A 4DL2A 4PXDA 2WSEC 3PZPA 5IWAF 4GKKJ 4OYXA 1G7CB 7FDRA 4OJHA 3CT9A 5IQQA 2HRYA 3OL6A 4JP8A 3I32A 2LDIA 5AXNA 2HRTA 1I6JA 1PG5B 4FDFA 3CD5A 2HSEB 4YB5A 5DQHA 4GKJJ 2KYZA 2AIRB 1N5YB 5DM6Q 1VBYA 1YRTA 3A3PB 1FDDA 3DLJA 3KK2B 4C8NA 4TY8A 4R0JA 2NREA 2V9WA 2UV8G 2DHHA 2AYEA 2HWIA 1KOOA 2VG6A 2YPYA 1KR4A 3SFGA 2WVDA 4F3OA 3UD4P 5H9FJ 1S57A 1T9WA 3POTB 1CVJA 4LIWA 1HYSB 2ZHAA 2JX2A 1KBRA 4LF4J 2H9ZA 2V63A 3B4MA 2XTJP 4DHVA 3GIJA 5RUBA 5F9LA 4DPYA 1QVGR 4JI0J 3US5A 4WE1B 4USUA 3M8QB 5ETMA 1Y3JA 2K1RA 3RG6A 1HMVB 1UMJA 2OP5A 2GVZB 2QFJA 3TANA 3EZUA 3SQGB 2CQ2A 1RTHB 3DC2A 2RHSB 1FE4A 5EX3A 1QUVA 1WDDA 2P2CB 3M1VA 3LP2B 1AXQA 3IAS9 2XLJA 1HR0F 5DZ7A 1S6QA 4KGKA 1UA0A 4J9QA 4JI5F 1MN9A 2VONA 1VDHA 3P5TL 3SEOA 4U9RA 2CPYA 2ZHOA 4LVOP 3THTA 2XWYA 2I5JB 3MEGB 1SC6A 2E5HA 2A3JA 3L9ZA 3MM8A 5F3TA 4ES3A 4IOCQ 4QW9A 4K4ZA 4QCLA 5KFKA 3CXCR 3GCWP 2J0WA 3OFFA 2DXDA 2FJBB 3QBCA 2XG8A 1RWXB 3TVZA 1DTQB 3MWBA 1XQIA 4I68A 2LKZA 3N5BA 3MM7B 1LOUA 2ZH9A 1FD8A 2J0XA 1FJGF 2OHDA 4NL5A 2I0XA 2RB7A 3WBZA 1N5YA 5AJ3F 3AJ2A 3OTBA 1WWHA 4O0NA 3MUVP 3KK2A 1TL1A 4KSEB 3H2VE 1UEUA 1HNVB 1M5HA 1XMBA 4P2MA 3HFKA 1KS2A 2CZVC 2X1AA 2XYHB 1BY9A 3BDEA 3NS7B 4LBHA 1DFDA 4PPZA 1DQAA 5EHHA 3PKMA 5LM7E 3FSIA 1V3ZA 3POTA 1HYSA 1QSLA 4ETXA 1CC8A 2NXJA 3M8WA 2CJBA 1FNOA 2HURA 4KAIA 4OZ1A 4ZPCA 2R7UA 2YKMB 3H2LA 4FN5A 4NPOA 2FY8A 1WC1A 4WE1A 1DZ5A 1QAXA 3FCHA 2VQFJ 4B3MF 3GZ7A 3M8QA 3DXBA 3AT1B 1TL7B 3HM9A 2F40A 1HMVA 3JYTB 3PO4A 4QYZK 2GVZA 4JUZA 1OSCA 3CF5Q 3SQGA 1SI9A 4MJKA 4YB1P 2EFQA 1RTHA 2FIUA 2DKOB 2M9KA 4USKA 4JI4J 3PR5B 3MCSA 5MAOA 1F5CA 3Q2SC 1HD1A 2UUCJ 1F5AA 3LP2A 4Y00A 2L08A 3T1YJ 4NE9C 1GH8A 3W2VB 1WC5A 2DGSA 2GQ2A 3RZAA 4DR1F 4BDPA 4RWWA 2HHQA 2KFYA 4DV7F 2CJAA 2I5JA 3MEGA 4NXMJ 1MLAA 4ED4A 3CDAA 4HACB 3TP2A 3MPWA 1N54B 1T03B 1GMUA 1WEYA 3T5JA 1HHTP 2FD2A 2UVWA 4PABA 2DPIA 3C46A 5HQLA 3QWUA 4ZS6A 3MPYA 1DTQA 5EDWA 1CS4B 4JYAF 2QO3A 3A8KA 3MM7A 2N3OA 1U8SA 3H4DA 1QAYA 1A9NB 5KFLA 5CYMB 4LF7F 4OYIA 2R2RA 3NL0A 2KXHA 3CSKA 2YX1A 2G2YA 2E5GA 4KH1B 4DV5F 4ZIVA 1NJYA 5C25B 4J9RA 3FC9A 3KFWX 1HNVA 1AROP 3CEDA 4H4MB 1RQ0A 3D0IE 2GHWA 3CCLS 4X4RA 2CPEA 3K8WA 5EX0A 4UOGA 1N5VA 3RGIA 4DPUA 2IBOA 2KHDA 2XZTB 2HMIB 4UT4A 3PYGA 3W3SA 4FVMA 4HH1A 3CDWA 4RBUA 4ZIWA 1UVMA 5HSPA 1IBKF 4C2MA 5D0HA 4TNOA 2YKMA 1N36F 2DR8A 4TN2A 1H98A 3AODA 1ZTTA 2F65A 1QUPA 1VRQC 1TL7A 2CPZA 1RTDB 1U1QA 3JYTA 3T6BA 3U1LA 4FNIA 4P72A 4F0MA 1KQSR 4B3TJ 3JAMU 5I42B 1VHFA 2NXEA 1FFSB 2GO9A 1S0NA 3LWMA 3NG8A 5THWA 5B08A 3OLBA 1AT1B 4S0MA 1D9DA 3ET6B 3C6TB 2QL7B 2YNFB 1VQ8S 1HHQA 2HNYB 3J81U 4TKTA 1RT1B 3QRRA 1YJRA 3CD6S 4WP3A 1X5SA 4J9OA 3D6TB 5LXYA 4NZ0A 4WKRA 3W2VA 4WIQA 4I2QB 4PG5A 4LR8A 4CLWA 2HFUA 1M90T 1SIZA 4RNMA 1GK8A 4FXWA 1RDRA 1TUGB 1UEKA 1NCLA 4RUAA 1SQFA 4HACA 2AJ4A 2IHR1 2FYXA 3NRBA 1T03A 2BVZA 3PYDA 3V5RA 1HNWF 1F9FA 3CJQA 4RU9A 3M8RA 1FXLA 1CS4A 2QTWA 1PIEA 5A8RB 2KM8B 2EKNA 2X3DA 4F25A 5CYMA 2Z2MA 1T8EA 4X4VA 4OYAA 3BH7B 1JNZB 4YR2A 3OVSA 2FVCA 2RRAA 1S0OA 3ILLA 4EMDA 5KFDA 1CJKB 3DXSX 1HKAA 5C25A 1WG1A 5J2QB 1AA1B 3AJDA 4PEOA 1R8PA 1B0VA 2J6UA 2WB1D 3O5TB 4H4MA 1SJ4P 1I5OB 2B43A 2FGOA 3F41A 1RKJA 3GLJA 2VUGA 1YRXA 2C1EB 1BQNB 3AD7C 5KFTA 2B51A 2F5GA 2HMIA 1ZZFA 4K4WA 1YVFA 1SL0A 5LXRA 2CXEA 4YY3F 3KOAA 3HSDA 3K59A 5FLXY 1RISA 4ZN3A 1LW2B 4LF6F 1N34F 2JH3A 1SC3B 2YQ3A 4X4TA 4NLDA 1J5OB 3KJQB 3RAXA 2XHCA 4K4TA 4N77A 3K5NA 4L76A 3MF5A 5L1LA 1RTDA 1Q86T 3K5MA 2AJQA 4QYRA 2PMZD 2OKQA 2VPYB 2NS1B 5I42A 5JVHQ 1RCXB 4KHMA 1U25A 2ZITA 2DBBA 2HZCA 3CCUS 3W1YC 3ET6A 3C6TA 2YNFA 1ACMB 4MK8A 2HNYA 1RT1A 2DGWA 5GAEI 2C42A 3JSMB 4KHPJ 1SH2A 4I2QA 1KFSA 5BYQA 1W2BR 1XR6A 2RRNA 2R7OA 3OJUA 2WVFA 2WBMA 1QY7A 4QU6A 2GMLA 1NJWA 2LEAA 2MKJA 4Y2CA 2ASYA 1LK5A 2PA3A 2DR9A 3M6WA 5J1NA 2LA4A 4O0IA 4F4KA 2KTQA 4OX8A 5A8RA 2UUAJ 2D1CA 2XY5A 1ZAWA 4OJ1A 2DPJA 3BO4A 2YH1A 4JI1J 1M0SA 4HI1A 3F0NA 2HLUA 3BPDA 2OPRA 2ZDOA 2CIMA 2E44A 4KJIA 2G0CA 1CJKA 4FBTA 1WOSA 2MJUA 5J2QA 4W90B 4WFXA 4OI4A 1ZPWX 2BBEA 3HDSA 4DCJB 2DR7A 2HFSA 3Q8UA 4J9VA 4B02A 1L3VA 3EICA 1U48A 2Q3PA 5HJYA 5DRKA 1KNZA 5DG9A 4LR9A 4CH1A 4AL7A 1BQNA 5J2PB 2E1CA 4FF4A 1BXNA 4KBIA 4KKOB 2CQPA 3RRHA 1PAUB 5DZ6A 1F0XA 1VQ6S 1OPIA 3T1AA 4ZVTB 1HW8A 4DPTA 1JXVA 1ZH5A 4Y0FA 1LW2A 1JMTA 1PJ5A 4YB7A 4ITSA 1EP4A 2CPJA 3KUHA 4O3PA 1J5OA 4NEZA 3RAMA 4USTA 2BM0A 5E0OA 4LFCJ 4DV3J 2HBRB 5HBMB 4DEZA 2K8GA 4Z2XA 4OHYA 1X4BA 3UCGA 4NOHA 1S76D 1OQ6A 1U24A 1TKDA 4HTJA 4O3OA 2F63A 1Q79A 3UDVA 1WORA 2WAQD 2VKZG 3FEXB 4RW6B 5L1JA 3FEYB 4IOBA 4L73A 2RHQB 4PQUB 1Z2LA 3G9CA 5L9NA 2B8PA 1FA0A 3JSMA 4WJBA 2C2MB 1RHUB 4JBCA 1BMQB 3S8SA 1MU2B 4Q8FA 2FZCB 3S7RA 3W8PA 1ZAVA 2ZM6F 3IBWA 1T9YA 1URNA 5FIIA 4QR0A 3G4SS 1U45A 1EAYC 3IA0A 2ILZA 4JV1A 4LIRA 1NB2A 2C3YA 5D4PA 3MR2A 1TKZB 1IBLF 2B0GA 1VS3A 1NK7A 4MK9A 1YSJA 3VAIA 2UXDJ 4LF8J 1NK9A 2BKNA 3J80Y 3NGKA 1R31A 1FRHA 4LUBA 4YFUA 2ZBIA 3PKYA 3T5HA 3FBEA 2AEFA 3BR8A 3KG0A 4WWSA 3ILOA 2C3MA 2V2ZA 3J81j 1WF0A 5KT3A 3OHBA 2MQMA 1C0TB 4J91A 5LJ3Y 3AXMA 4F4ZA 2H3EB 1IJFB 1YDLA 1JJ4A 2OMOA 4YHHJ 2YXLA 5J2PA 5IQ6A 2DGQA 1AUDA 4LQ3A 4KKOA 5DJBA 3GJQB 2JEJA 3GV5B 2KO1A 3GONA 5DLGA 4LFBJ 3BBFA 2HVEA 3CIZA 2Y8WA 4MIBA 1A7GE 1LW0B 5LJ5Y 2DIUA 1XMQJ 3PV8A 3VAKA 2HBZB 4G1QA 4ZVFA 1Q5VA 2XI2A 5HBMA 2MHEA 3HZEA 4K7QA 3CPWR 1WEZA 2GS8A 5SZTA 3PDNA 5A76A 2YWWA 4C48A 2C2KB 2HVHA 1LXNA 2J9DE 3T1HJ 5KFIA 3HHLC 3Q86A 2I9SA 4JI3F 1TFYA 3KWMA 1AFIA 1OPZA 4KFBB 2W4PA 4LRCA 2V68A 3KK3B 4RW6A 2XQCA 2CADA 3A13A 1S1TB 3W8GA 3LO3A 5A2QY 4ZPVR 3G8QA 4AQYF 2OH2A 3KHGA 1MU2A 2F8HA 4UQGA 1TVRB 1CBKA 4U7UD 3RBXA 1TMJA 5C5JA 4J37A 5CXTA 3E2EA 2IMWP 3MMAB 4I2PB 4BWJA 1T9VA 4DF4A 1NSPA 1OMSA 3I4PA 3CJSA 2B9YA 1QTMA 1VQYA 2MQOA 2OEKA 4DU7A 3HO1A 1JLCB 1TKZA 1CC7A 2W9AA 4KTQA 1XERA 2HHWA 2DHXA 1YI2S 4OL8A 4NXNF 1M5KC 2JFKA 1T9XA 3Q8RB 1ZZNA 3N6MA 4UZBA 4F2RA 1U2RA 5DM7Q 3IMQJ 3PFEA 4MT1A 1Y4ZB 2OPPB 1LEOA 4CP5A 1WD6A 2B9EA 1FNXH 1JWWA 2AYBA 3N5FA 2VC1A 2O67A 4I6WA 4X4PA 3H98A 1T11A 2R7QA 2VA3A 2XY7A 1Q8LA 3A3NB 4MKYA 3OR2A 1C0TA 1S1WB 1MNEA 4X66J 2O5DA 4ENOA 5KFBA 4ZVPB 2HS0A 1WDTA 4LF9J 2V8GA 3BS9A 1A6LA 3DRYA 1H0HB 2LDYA 2C2RA 1YBTA 2FY1A 1WTFA 4CCHA 4TLRA 3EPGA 2MZQA 5DGBA 3D2WA 4OLOA 1NMEB 3ISNC 4Y6IA 1YITS 5E3PA 1LW0A 1LFPA 1R27B 1EZZB 1RWUA 3K0JA 2HHXA 4A8FA 5DG7A 3TZXA 4LJMA 3UQSA 3PW4A 1S1VB 1KLNA 2UXBF 3TZZA 2FLNA 1FRKA 4CNYA 1YJ7A 1HNIA 1YIJS 2PT0A 2VA2A 5E41A 1ULRA 3HLUA 3DLEB 3I5CA 1NEEA 3UCZP 2DNNA 3P45B 5F8IA 1NU4A 2V69A 3GIMA 3KK3A 1WC6A 2IRYA 1IKWB 1NKEA 1S1TA 1ZTWA 1O5JA 1SKWA 3R5DA 2ALZA 3D54A 1ROFA 1L3UA 3IN5A 1TVRA 2Z2YB 1N33J 1URRA 3GV8B 2RD5C 4OYBA 4J5OA 2F9JA 1HW9A 1SIWB 3MMAA 4I2PA 3H7HB 4DSIA 3KYLA 2YNGB 2E7XA 3BV8A 1SUQB 4DR3F 3TZYA 1JLCA 4KV8B 4PCQA 3KLHB 1T3NA 1CPZA 2HEKA 3VAHA 2QT7A 2V2QA 4Z37A 2OPPA 1SQGA 2VU5A 3E51A 4EO6A 2RH3A 5KFHA 4H4KC 2NXNA 1BHNA 3T9ZA 5I3UA 3P3DA 4DFJA 5HQ8A 4N8OA 2IJFA 4B3RF 3AA8A 3QPIA 4LRFA 1S1WA 5AXKA 2NZ4A 3FGVA 2V8DA 4CIOA 1VHIA 2ZWPA 2QYGA 4P2FA 4ZPAA 1YZ6A 4OIXA 2R8JA 4CLYA 2M0GB 1LWCB 1SJ3P 3FQLA 1B0PA 2LU1A 1R7IA 1X9SA 1H2UX 3QIDA 2WOMA 4F4XA 1QTNB 3IWNC 2ATLA 1TK0A 3ZTQA 1ZAXA 3OL7A 4ECWA 4FF3A 2LQ5A 4O4RA 3K8VA 5F8JA 2CQ4A 3S6EA 4JV2A 1S1VA 3HFVA 3LAMA 2J0SD 3EVWA 2KZZA 1S0MA 4UOHA 2FHOB 4PWWA 1R8BA 1U47A 1V9OA 1S0VA 1ZM9A 2C2NA 4DPXA 1TTHB 2HBQB 3CULA 4RPFA 2KVIA 1U1OA 3DLEA 3FJ2A 3GFXA 2UXCF 1M5OC 3M2UB 2DK2A 4DX8H 2LFVA 5KG5A 2KXNB 3TA2A 3MFIA 1FJEB 1EB0A 5M2UA 5F9NA 3MM9B 3GJSB 2QA1A 4ZJOA 1RAHB 3M9MB 2DNMA 1NB7A 2OO4A 2BDPA 2R2UA 4PG4A 4IH6A 4QIEA 4NYZA 4NWBA 5IFMA 3EGVA 2ZD1A 3NNAA 3W2WB 4TYBA 2IY5B 1UEVA 4DL7A 5LOQA 4GO5X 2X1BA 1UTAA 2KZMA 1KD1T 4CO5A 1N32J 2B4OA 2E66A 4PUOB 3QAUA 2VFSA 2QA4G 3UVJB 4KV8A 4J9MA 1Q8KA 3SV4A 5HROB 3KLHA 1RTIB 1Z4UA 4CRJA 2CG4A 4LFAF 1FKOB 1UKUA 2AWZA 1Q1KA 4FF2A 3W63A 3EM1A 3X3UA 4B9MA 1R8CA 1KKHA 1IN0A 2CQDA 3MMJA 3VF0B 4X4SA 3MEKA 1WKLA 1CEZA 8RUCA 2HVDA 1IKYB 2IJNA 3LGNA 2C3OA 2MDAA 3O1LA 1TZ0A 1VQNS 4C3KA 1NDPA 2CQCA 2IJRA 4CDIA 2E9RX 3CCWA 1HL6A 1SV5B 5AT1B 5CABA 2GIRA 2E1MC 4OX9J 1LWXA 5FLXU 2NLWA 2MJNA 3ENVA 1LWCA 4KH0B 1VOMA 2ZC3A 3TQ1A 2DCLA 2UUWA 2PDAA 4F3MA 4Q0BB 2E9TA 2AJ1A 1U2CA 2XMTA 3BN7A 3ZZ0A 5HATA 1SL1A 3BBBA 3GPAA 4X84A 3PO5A 4NEYA 4IO1A 2H4WB 5EWEA 3KNGA 1B7YB 4GKKF 5ETRA 2ZOMA 2BJ8A 4ED2A 2W2OP 4D3HA 2I38A 1YJWS 1K73T 1JX4A 2DGOA 3GR0A 3VHQA 2CVEA 2VC0A 2MQPA 4BHQA 1P1TA 3N01A 4NLUA 2MYFA 3L7PA 3ADAC 2YNHB 4ICLB 4DCPB 2CG8A 4GKJF 4O3NA 2DHAA 5E7OB 1Y5LB 3EGNA 2R3VA 3M2UA 3ONQA 1X9MA 4OZ3A 2OSQA 2XEXA 1RTJB 2XSJB 3MM9A 2DH8A 1LXJA 2IM1A 1RBOB 3DCAA 3FDSA 4P7VA 5KT7A 4U7UK 4PQAA 2DHSA 3B8HA 2IPOB 3CJ3A 1KTVA 4ECUA 1TKTB 2ZH6A 2HW3A 5C7PA 5M2RA 3W2WA 2Q43A 2Z2LA 2EFPA 3BGRB 2ZNZA 5CHCB 3CJ8A 3D68A 4OI6A 4DV0J 3HK2A 5IV3A 5D0RA 3O3LA 3KLEB 1FWPA 1ZYQA 4PUOA 2VASA 3E8OA 3QWPA 4Z7CA 3UVJA 2JRSA 4B9SA 2DNYA 5HROA 4OV1A 1RTIA 5DQIA 3GYNA 1FKOA 3LW5C 3FSXA 4WFNQ 4OYZA 1DQ8A 1GX6A 2E7VA 1RB0A 1K8AT 1BC6A 2P6SA 2JOQA 3WX4A 4LSNB 5U47A 4ELUA 1HD0A 1IKYA 4YN3B 1H3DA 3UD5A 4WIIA 2ZUGA 3BKUA 1HI1A 4TU7A 1J5EF 4BS2A 3QGGA 3GG0A 3HD2A 2Y8YA 4JV5F 1SV5A 5D4NA 2IA6A 4BLGA 4PXCA 1TAUA 5JVGQ 3I96A 2Q6BA 1R0BG 2XS7A 2MQ8A 3GWCA 3N79A 4Q0BA 4IFYB 3THVA 4JV0A 3D6HB 3R5JB 3TOQA 2JEFA 1KDNA 2JWNA 3QSYB 4ZPDA 3DLGB 3DDIA 2XLIA 3E3XA 2ASLA 2O66A 3Q8VA 2RF2A 3T41A 4JI7J 1AZSB 4EBEA 2XNRA 4EYHB 5DGAA 4HKQA 1NPKA 2F4FA 2YNHA 4ICLA 2BJ7A 1NK4A 2BABA 2MKKA 3KLIB 2DY1A 5KG6A 4X4OA 4AXIA 2AYMA 4K4XA 4F50A 2YKNB 1RTJA 5H9EK 2XSJA 2MHNA 4I6AA 1UWAA 4KQZA 1Q7LB 1SCJB 3H40A 5HAOA 3DGVA 3V4IB 4O4GB 1GEHA 4CM2A 3VVTA 1UJ6A 2AX0A 2DNQA 3J7AN 4HYKA 2FLOA 1TKTA 2D3ZA 1YLXA 3NGUA 1VYAA 2AGOA 2W7AA 3BGRA 5JXSA 2XMWA 2NUHA 4WCEQ 4G3IA 2FB0A 4ED1A 2J9DA 1TUVA 2RQMA 3KLEA 4A8WA 1UL3A 1U6FA 1BGXT 2QSWA 1XC9A 2VQFF 2LMIA 5CH7B 4V19X 4DR5F 1MWZA 3MCNA 1O51A 4O23A 2RUGA 3EVOA 3BDPA 3MAQA 3VQTA 2DGVA 3RR7A 4RW8B 3G6ES 3MPDA 2HFZA 2BJEA 4M5IA 4PXBA 4JI4F 3VGUA 2B56A 2V0NA 4CLKA 4LSNA 2W1BA 4I64A 2HZVA 3HI9A 1H7WA 2FJDB 2V9KA 4NRTA 1RU2A 2DXFA 3T1YF 3B78A 3HVAA 5IWAJ 1HBMB 4ZVGA 1JQGA 2VH7A 1WOOA 1REGX 5HVHA 2WB4A 2OUGA 4NXMF 3T6JA 1S5ZA 3N4WA 4LBIA 1S7HA 3R2DJ 3CJKB 2B4VA 4AD6A 1NJZA 2RJZA 4NYOA 2WHOA 4RW7B 2UUBJ 3QJPA 4EWTA 1NHUA 4OI1A 1WC4A 3P49B 3M32B 3BZQA 3DLGA 2OGUA 2R9LA 3BKFA 1HARA 1VFJA 3MAAA 4YUDA 5L39A 3RBEA 1NJXA 3A1YG 2DT9A 2BR0A 2Y3YA 5EGYA 2NCKL 2IVFB 4K59A 2BRLA 3PACA 3KLIA 5ETLA 2HBYB 4CZCA 4ZVHA 2SXLA 3BBCA 1WKJA 3C19A 4DL6A 2ZDPA 2YKNA 3ZZYA 3OSNA 3EXCX 3NOCA 2R7XA 3M8ZA 4HEA9 2AJFE 1P9QC 3V4IA 4O4GA 4IRCA 3HULA 5GADU 4HT5A 1S1UB 4YR3A 1IQTA 3TVKA 3OR1B 2OJ3A 5H9EJ 4KO0B 1S6OA 3HKZD 5I3QA 3A4TA 3NXZA 2LA6A 5HMXA 2MLXA 4M5DA 4E2FB 4DQIA 3WC0A 1QE1B 2CZ4A 2ZVSA 4O44B 5CCLA 4OZLA 4P74A 2JDJA 3AY0A 2WZ1A 2DNLA 1R0CB 2DVIA 4OJGA 4JI5J 1S10A 2WBRA 1X4FA 1SB6A 4DG1B 5ETKA 4TLQA 3GV7B 2GX8A 3LQVA 4RW8A 1DJ0A 3O2IA 2B4PA 1CLFA 1FO1A 4ZVEA 3JAMY 4ALZA 3G87A 4GVLA 3L95X 3PHEA 3GILA 1GNKA 5AXMA 4HH0A 3IR6B 4RR5A 3G6YA 3EVMA 3RB6A 1NKBA 2E1RA 5J2NB 3J81Y 1HBMA 3MUMP 4LRDA 2XY6A 1YBAA 4MIAA 5SUHA 2YNIB 3DOKB 4I67A 3FCVA 4DZDA 4GVBB 1EQMA 1C1CB 3MZIA 4EI2A 3PIOQ 4ZLLA 3OTDA 2V34A 2KL8A 2K7KA 4DQPA 3EZ5A 5F0UA 3CJKA 1K44A 3KMSA 1PBAA 5IT0A 3KHRA 1RK8A 3NAIA 4RW7A 3H0PA 3N0VA 3ILIA 4IH5A 2LECA 4DCOB 5LMNJ 3M32A 3OUYA 3L4BC 2N7CA 2Z56B 2ZE2B 3W9HA 4YS2A 2BXJA 2MSSA 2NSBA 3CVKA 4L3NA 1KC8T 5D15A 3EGZA 4WFZA 3OL9A 2FJAB 2UZAA 2YQ1A 3GTYX 4RNNA 1NHKL 3ENAA 1SJFA 3LPYA 1Q4RA 2K06A 1DBDA 2I1RA 2H5EA 4F2SA 4WTOB 2J7KA 2KB2A 3AQOA 1S1XB 4L75A 1Q8BA 2CQ3A 1WI8A 1J27A 3PNIA 3TX0A 3VTIA 2VFUA 5F0WA 3BSCA 3H25A 1FEEA 3TX8A 4HHJA 1S1UA 3OR1A 4ZP8A 2WSFC 4A46A 4CM0A 4KO0A 2BW7A 3NGTA 5HI7A 4K5SA 3I9ZA 4XTTA 2QEXS 1N5SA 3FRZA 2X7IA 3BQ2A 2M4MA 1VC6A 4FPRA 1QE1A 4B08A 4HT7A 1QAIA 4RNHA 2MZSA 1TKXB 4O44A 1GMWA 1B0TA 1XWLA 3IGNA 2V4QA 1W26A 4RLEA 2KHCA 3GG1A 4NLYA 3W66A 2MB0B 3I0SB 1JLFB 2XBPA 4DG1A 2WVBA 3BQ0A 5HO4A 4DR1J 1VQPS 3PW0A 1S6PB 1YRUA 3AA9A 1DTTA 2XYPB 4K0KF 2ILYA 2Q6CA 4KGZB 4PR6A 4TY9A 4PG6A 2VPWB 3I5AA 3FBFA 3NMAA 1SQEA 1BQMB 1I94F 2V8HA 1REVB 3QT6A 2CPFA 4DPOA 1FD2A 4ZP7A 3UPFA 1WSVA 1FWLA 3RBDA 3P96A 2CRLA 3GJTB 2YNIA 3DOKA 1IM6A 4RNOA 4I69A 3R2CJ 2QLJB 3MI7X 1YTYA 2G2OA 1NHVA 1HBUA 5D4OA 1X4HA 5CAAA 3WZ0A 2IBKA 3NWRA 2ZC4A 1VRUB 2G4BA 4USIA 3EUNA 4DV5J 1N5QA 4P75A 4NA1A 2Y0BB 1UVLA 3HHNB 3QJJA 2RDIA 2KFNA 3DKDA 4KGXB 2IRUA 4CI0B 2ZE2A 1G3OA 3LP0B 3PW7A 2GCFA 3DHXA 5D8HB 2MKSA 3CB4A 3CD7A 4QWEA 1S9FA 4RUBA 1X31C 6FD1A 3TEGA 3A8EA 4C8ZA 4A8YA 1VQ5S 4ECQA 1NPRA 4BWMA 4MYUA 1TMMA 5LSOA 1F9HA 2VG7B 2IM2A 1S1XA 5GVQA 5KFGA 3I9V9 3JQKA 4OQJA 3V6DB 3RB4A 1RWKB 3HVWA 2V8PA 4F4AA 3U1MA 2VF3A 4P73A 1H73A 3J7YI 2AP6A 3VAJA 1T0TV 2ZZNA 3ETMA 5LSRA 2R8HA 4RJVA 3H8YA 2AV5A 3NBPB 5IT9U 4GC7A 2NYHA 4U7CA 1IM4A 1TKXA 3EE3A 1KLMB 5CYJA 3D1OA 4LF5J 1RHKB 4ED8A 2FPHX 3RTVA 2DR5A 4X2BA 3JQJA 4B3OB 3I0SA 2GIFA 4YDDB 1JLFA 4FYDA 2X3GA 2DY9A 4NI2B 1S6PA 4DV2F 1FRIA 1FK9B 2BEFA 2YKQA 1VBZA 1HNXF 3TUIC 5CCMA 2EK1A 4WYLA 1O8BA 2L9NA 5E3AA 4RBVA 4IG0B 1L5UA 4X4NA 3CGIA 1EX8A 3W62A 4DUYF 3HZGA 1UFKA 4LT6A 3G86A 2R8KA 1BQMA 1VQMS 1REVA 4DR6J 2HPUA 2OD6A 1CJUB 4CLLA 4RW4B 4OX7A 3TEHB 1S97A 1FESA 1PO6A 3QGIA 2KI2A 3QQCD 3UDLA 5GAGI 1HWIA 2VBZA 4CYUB 1Q95G 4ANCA 1NK8A 3ZTRA 5C2GA 2N7YA 4M5MA 1IXKA 1VRUA 3B4DA 1U1PA 2ZZTA 2FDNA 1HWKA 3NOGA 4HLBA 1P8GA 5IC6B 2AMCB 2CYYA 1FRLA 4J9PA 1IKXB 3FBBA 2HVZA 4C7QA 3LP0A 1KVJA 5D0GA 1X4GA 2HHUA 3KLFB 3KDNA 4DR2F 3BO2A 3FQKA 1RAJA 1HNZJ 1KTQA 3Q2TC 4NLWA 3ISND 1RT6B 2FJXA 4CO0A 4M5HA 1Y0HA 2GJ2A 4BBYA 1KOHA 2VG7A 2DGTA 2V4RA 4YOEA 4WU3A 4YY3J 4KYZA 2ZBPA 5KFPA 3PM9A 7FD1A 2FC8A 3V6DA 4LF6J 4B3SJ 2DH7A 4C4WA 2BE7D 1IKVB 5KFFA 3KG1A 4YHHF 1YGYA 2XM3A 1PC4A 1SJRA 3H5YA 2NPIA 4KGMA 2V94A 1WNEA 4DN0A 1RT2B 2JLEA 3NBPA 1I1GA 4WTYA 5GAHI 1V3RA 2JSXA 3BGOP 2EC2A 4LFBF 2G0JA 3D6FB 5KFXA 1KLMA 3QRQA 4USWA 4XDCA 4ZK7M 4Q45A 4ZLNA 2FLLA 2J8SA 1D8YA 4B3OA 3PJWA 3CJRA 2HHHJ 1HBNB 4NI2A 1FK9A 4XPEA 1T9UA 2F4VF 1R8HA 3OJSA 2EFVA 2HK3A 4IG0A 3IR7B 3GSDA 4H4OB 2H5JB 4K8RA 2J7WA 2ZEJA 2JJ4D 5B0AA 3SFUA 4QIVA 1CJUA 2CPIA 2H54B 4RW4A 3R5AA 4QW8A 3ZZRA 2D3O1 2DNPA 2AJ2A 3MMCB 2CQ0A 1QSYA 4CYUA 3U1NA 2A6MA 3DOMB 3SCIE 5KFCA 2L9WA 2ZH7A 3S01A 4NX9A 1XNQF 2QLXA 1N52B 1IKXA 2M52A 1HQEB 2CVIA 4TU9A 2GFFA 2VQEF 2BA9A 4QBUA 4OYPA 4K4VA 3JQMA 3KLFA 4OHXA 4K2JA 2DITA 2HIQA 4ES1A 2IFXA 2KYXA 1RT6A 4MIWA 3R6GB 2MQLA 4QIWD 4M5GA 3QO9B 4J9UE 2BOPA 2CA9A 3DRXA 3DOLB 2RS2A 4MKVA 4ZJQA 1JLAB 1RI7A 4F4YA 2QJ3A 3K58A 1IKVA 2CJQA 3CD0A 3TARA 4OI2A 4KIAA 3TNVA 3PYEA 3OLAA 4DJBA 3H4BA 2P5VA 3W5YA 1WKKA 3QJLA 3BSAA 5KFAA 2KVQE 2XMUA 3FBCA 3Q24A 5IXUA 2D69A 1NK0A 3Q89A 2MKCA 1TR0A 3MM6B 1PYOB 3BH6B 5F8HA 4DV6J 3BB5A 1RADB 3IRWP 3PW5A 1LNQA 3QSIA 4LREA 1HBNA 4DV1F 2AYGA 1FDAA 4NASA 5E3QA 4OI0A 4ZA1A 4XIUA 2GGPB 3N9UC 3DDKA 2R2TA 1IJEB 4QQBA 1WHXA 1WTBA 1VI7A 5B0GA 2AT1B 4H4OA 3GSIA 2V8VA 2CWXA 2E1PA 1XJWB 1C4CA 1UVJA 4J7CA 4ED6A 3JSBA 1IBLJ 4M5KA 3BF4A 2NSCA 4HHUA 1NSAA 5GAEU 1WF1A 3MMCA 1FKAF 1FFWB 2DD8S 2A2CA 2EKYA 1N33F 1I3OB 3ISZA 5DDQC 5CZXA 4IR1A 3I82A 3DOMA 3GIKA 2QL5B 1FVQA 2WW8A 2CDRB 1IVZA 1P1LA 1HWLA 3SCJE 5KFYA 2PSZA 2RDJA 3HSZA 3ZNUA 1TK8A 1HQEA 2ROEA 1VQ7S 1OIAA 2BE2B 2BUNA 2GNKA 4A48A 3OW2R 2AD9A 1U26A 2G0IA 2KT2A 3KG4A 3R5GA 3IM8A 2VODA 4AL6A 3M9OB 2VL1A 2EBEA 3QO9A 3LTOA 2LVWA 2CWKA 3DOLA 4WFAQ 3NGSA 3QZ8A 3CE8A 1BQXA 1N56A 2QMWA 1NPPA 4WXWA 4ZP6A 2YH0A 1IR2A 1JLAA 1XTZA 1F1BB 4DMZA 3MHYA 2XWXA 4MKBA 5D0EA 5KFNA 4DL0C 2E9ZA 4DUZJ 3M8PB 3GYGA 1WHWA 3KUGA 5J2MB 3S1TA 1FRXA 3RU0A 4V19J 3H90A 4P2SA 2AU0A 5ETOA 4OZJA 1N5TA 4NRUA 4UOCA 3QT5A 3UNYA 1D9FA 4EEYA 3PX0A 5K8MA 2PMHA 4C11B 1NZ8A 2QC3A 3MM6A 5IS2A 5IZHA 3E01B 1T94A 2UVVA 4WF9Q 2R7VA 4ILLA 1PYSB 3FZ2A 2FTRA 1H38A 1RA6A 2CNLB 3TRGA 2ZH8A 1MWQA 3OBIA 4ZJLA 1OQ3A 3UNGC 3NCRA 2CQ1A 4K4YA 1VQLS 4OV6A 1BWEA 2J6SA 4QYZJ 1YKWA 2GGPA 2FVSA 3M8YA 3W7BA 3C66A 4QR1A 4L3KA 1PKUA 2HNDB 1NBEB 4C9DA 2ZH3A 5J1PA 3LGMA 1KONA 2K2PA 3D3CJ 1X0FA 3Q8PB 5HQMA 1H7XA 2BW2A 1JXLA 4EK2A 5GMDA 4DFKA 1EETB 1JIHA 3FRYA 1JLEB 3WIVA 3TA0A 5H1SV 3IS9B 3BJYA 5HP1B 1YJVA 3MAHA 1FERA 2CJXB 1UZHA 2DEJA 2OIHA 3M30B 2NQPA 3BSOA 3GCXP 4PZVA 1X5OA 3JXOA 2B4UA 3G96A 2E5LJ 2BE2A 2LLZA 4NLSA 1MMNA 1CJVB 4F4WA 4CTAB 1UWBB 1SH3A 3DI6B 1U8WA 3PR4A 2ADCA 4C0OC 2B7BB 2GV1A 2LYVA 4OHVA 2F8MA 1X4EA 2VV5A 3HT0A 2ZBCA 1RAAB 3AQPA 2DGUA 3C2PA 1RABB 2XGPA 2MXYA 1RP5A 4NLTA 5CYQB 4C3MA 5JJBA 3M8PA 1YJTA 1YBUA 4ANDA 1WELA 1P6TA 1Z2ZA 5J2MA 4J9NA 2UXBJ 4K5RA 2YQ0A 2HHSA 3R7NB 1WOPA 1S72S 4YR0A 2PFDA 3DMJB 5DS7A 1JLGB 3RJMB 1Y10A 1RWVB 3CO0P 4NZ6A 1Q5YA 1NKCA 4C11A 3BPSP 3Q0AA 3E01A 4B9NA 5KFQA 1K0VA 4DQQA 2H4YB 3BYRA 4N8NA 1FCAA 3TR5A 2VKRA 1VR6A 2MZTA 3CCRS 1Q8IA 4ECVA 3CJ0A 1NJIT 3GIRA 2HNDA 4ZCKA 3UDCA 5KT4A 1RT7B 3GQCA 3MEDB 5FD1A 2JC1A 1ZS6A 2CJYB 2MZJA 3AJ1A 3AOCA 4EBCA 2F8EX 2ACYA 1S49A 2Y1RI 4DWIA 4A47A 4OFZA 1EETA 2EVZA 1JLEA 4DQRA 3IS9A 2IDLA 5HP1A 2V50A 5KFUA 2N82B 3OFHA 1YX2A 2WW4A 4ZVQB 1JXEA 1T3OA 4L74A 3VZIA 1SKSA 4EBDA 3HX9A 2MQQA 2KRBA 5AE3A 3M30A 3RB3A 2Y9HA 1R43A 3QGPA 2DYAA 5D6GA 4B3RJ 4E8UA 1CJVA 4DR4F 4CTAA 2BKPA 3MR6A 4DI6A 2R7SA 3UN2A 4Q43A 3DI6A 3K5LA 2RKIB 2EWHA 2G2ZA 1F60B 2KXFA 2VG5B 1YWXA 4RU2A 4AXJA 5F8GA 2A18A 1X4DA 4W92B 3SSSA 2LXIA 2HVIA 1PSDA 3HPOA 3K17A 3VGVA 2OLWA 1WG5A 2FQQB 3DN9A 1XR7A 2IA0A 2FVQA 1APSA 2ZWOA 4B9TA 4B9VA 4FKXA 4A4JA 1RWOB 1NZAA 2WVEA 4N5SA 2EPIA 1BWVA 2GJFA 2PEHA 4QIFA 3PRBA 2BQUA 4HL9A 3ZZTA 3DMJA 2LP4A 1JLGA 2HFOA 3ZTOA 1LV5A 2CFXA 3WC2A 1TL3B 2UXCJ 5T41A 2H65B 3NP5A 5H9FK 1SH0A 4RO0A 4OI3A 2YWGA 1RAGB 1CSJA 3MFHA 3L7UA 2UVRA 4JI7F 5L1IA 1JLBB 2A6OA 3DRSB 2RILA 5HVGA 1UFLA 1C0UB 5D78A 3SQOP 3UN5A 2QYCA 1RACB 2MZRA 1UW4A 4IUFA 1R6VA 2R7RA 3NCQA 2A10A 1RT7A 5GMEA 4IDKB 3A8JA 3MEDA 2KG0A 1KQFB 4CO1A 4DX6A 1B7FA 2KH9A 1NH8A 4YDXA 1DURA 1PJ6A 1PAEX 4ECXA 3RW7A 1TU0B 2K1RB 2V5HG 3ICLA 4PKDB 2WK4A 4LFAJ 1Q16B 3W60A 4CLUA 5G0RB 2R8IA 3TUZC 4ECRA 4ZLJA 3M6UA 5I3PA 4ED3A 2LEBA 4DUTA 2DISA 4F7VA 2PC6A 2RDDA 1ZM4A 2VFRA 1Y00A 4DOZA 3Q8YA 3L7OA 4UUWA 3FMWA 3FVYA 2EC0A 3MR5A 2QMUB 3CJTA 2ABYA 2RKIA 2XZDB 2W24A 1JLQB 3J7ZT 1FE0A 3D66A 2VG5A 4DV4F 3MM8B 2ASJA 1VLOA 5ETPA 2Q1LA 3HVRA 1RGVA 2FC9A 1IBMJ 4EU0A 3HCXA 5T14A 2DCUB 3ELHA 3EDRB 1GXLA 1HI8A 4LSZB 5KTQA 5L1KA 3CO9A 3MCOA 8AT1B 3BGLA 2X51A 4H54A 4ELTA 3OHAA 2U2FA 4WK3A 3HHDA 1TAQA 4W4MA 3R5BA 4UF4A 2CDQA 2W01A 3HT3A 1IBCB 1WI6A 5F8LA 1S77D 2POKA 1R0AB 2UUBF 3ZZUA 3TZWA 1H2VZ 1TL3A 4QWCA 2Z4PA 2GMHA 4F0HA 4NLRA 1TL1B 3NEKA 3KNAA 1TL5A 3MR7A 4DSJA 4DXLA 2N4CA 1VC0A 2CAJA 4X4QA 4O3RA 1ZPVA 1X5TA 3LWLA 1XBWA 1JLBA 3DRSA 1RAEB 2GA7A 1SVDA 3EGWB 1X9WA 1C0UA 1C2PA 2ZH2A 2G9OA 2JLGA 3VAGA 1QM9A 5L9XA 2OTLS 3SCLE 4PXEA 1SPBP 1JB0C 4QWAA 4PQUA 1NLKL 2BMBA 4PWDB 4IDKA 2EK6A 3NCPA 1KQKA 1TK5A 3MUTP 3HHLB 3UCUP 2LQ9A 3CCES 4TU8A 4RKUC 1UJ4A 3M7VA 3C3LA 3OXGA 5G0RA 4OZNA 3OQ2A 3P8BB 1K47A 3DM2B 2ZNYA 2OFGX 4CLTA 4RZRA 2XCPA 4KRWA 2IDEA 2HWHA 4DN9A 2AGQA 3HSJA 3EPIA 4FKYA 2Y1IA 1Y3KA 4MMOA 4B9LA 2RQ4A 1VBKA 2ZUAA 3NS6A 3FKBA 1J5EJ 1YK9A 3O8WA 3RRGA 2L41A 3AOBA 4A8OA 2HAIA 2RSQA 4JV5J 3IO1A 1JLQA 3A3OB 4RUHA 4MKAA 1KHWA 2R7TA 4M63A 1QAJA 3L09A 1YJ9S 3VGTA 3HVTB 4K4SA 2B7CB 1FJ7A 1VRTB 2EEYA 1VCTA 3PEJA 4LR7A 2M5YA 3ZZPA 4CO3A 4RNFA 2GC8A 2HQFA 1EIYB 3KJFB 4KGVB 4ZMMA 4IO9Q 3KUEA 5E2QA 2QIFA 3ENWA 2DJWA 5B0EA 4QWBA 3GIIA 3MPUB 4ECYA 1FT8A 4DLGA 2DNGA 2W8KA 3CNQP 4Q2MA 2XS2A 1P27B 1R0AA 4XO0A 2RU9A 3IWXA 5LMNF 3R7BB 2NR0A 1RHMB 4OYOA 3G82B 2WTFA 1XEZA 1E6VB 3AH6A 5KFMA 2VFTA 4XPCA 2LXFA 3GYXB 3DYAB 3ZTSA 2IVMA 3CWJA 1Q81T 5AE2A 1S7IA 2VPXB 3DLBA 5HMWA 2OPQB 4KFBA 3BKTA 1HWUA 1G6BA 5L46A 1K1SA 2R42A 1Y9OA 1FNMA 4PWDA 3QFHA 3G2XA 1TV6B 4G65A 2MKYA 5BYRA 2VPZB 5KG1A 2R8GA 3CTRA 2OAUA 4IFVB 4AFFA 4DU8A 2HS4A 3HHLA 2FLPA 4DR5J 2AJ0A 2MY7A 4WU2A 1RA7A 1FWKA 2Z58B 4U6PA 2GAGC 4FYWB 1IR1A 4DR7F 4ZVUB 3TJAA 2UU9F 3DM2A 4IRKA 4ZITA 4DF8A 3O44A 2ROPA 4HTIA 1FTRA 4URGA 3D5MA 3FNNA 3IXQA 4YP3A 2F9DA 1TQLA 2AHOB 1NK5A 1VQ4S 3EXYA 1YJNS 2M3DA 5KAKA 2R2SA 2GAHC 2CPDA 2C2OB 4CT8A 4DS5A 3MTKA 3O6QA 4DL4A 3KHLA 3M2RB 3TQEA 3VVUA 4EYIB 4OLPA 1GT8A 2XMAA 2OPSB 3OSPA 2ADBA 4PYDA 1AYEA 2J9CA 2IM0A 2W7PA 1FRJA 3HVTA 2HQIA 1RSCA 1QJHA 2B9WA 3R7SB 4LBPA 4JI8J 1WC3A 2ZOFA 1VRTA 3MMBB 3CMAS 3CJ4A 3AB2B 2G1DA 2RVJA 3D7SB 4CWBA 4KY3A 5K5MA 1X60A 3VCDA 4JI2J 5ETNA 3FEZA 4GC6A 1ZETA 1V5VA 3TWZA 3IAM9 4TVAB 3MXHP 3DRPB 3AD8C 5LMUJ 1MROB 2DEIA 2FHKA 3SSRA 4N7TA 2EFNA 1UZDA 4WXOA 2ZH1A 3Q8SB 1S9EB 1BLUA 5KFWA 1W2IA 2C2ZB 2APOA 3MCMA 4M5NA 3TW0A 3G6XA 3W65A 3N28A 2XMKA 4IR9A 2D9PA 2C3PA 2VJVA 3G82A 4AE5A 2KRRA 3BREA 2ACMA 2VDHA 4WK1A 1E6VA 4D3GA 4ZLPA 2G13A 3AB4B 2MSTA 3DYAA 4LQ9A 4Q5VA 2AQ4A 2NYIA 2CQHA 5DG8A 2UV8A 2OPQA 4ZVSB 4FYYB 1F5BA 4NYPA 4X64J 3UR3C 4WFYA 4NCBA 3D0HE 1IKWA 5IOLA 5C42B 4DL3A 2GZOA 1TV6A 4P71A 4F36A 1YJUA 1N8RT 2H1YA 4IFVA 1MN7A 2JLFA 4C3LA 2QN6B 3EDQB 4QWDA 2CPHA 2YKOA 1VLYA 3NAHA 3CDEA 1IWGA 3BQ1A 3WX8A 5AXLA 2YNGA 1RZMA 2WCXA 3R1HA 1SUQA 2WVCA 1NSQA 3SSQA 3R5CA 5IT9Y 3DLKB 2JEIA 4DBQA 2EG2A 4LF5F 5CD4H 2XMJA 3CC2S 3LOUA 2DH9A 4JI6J 1U09A 3SZ2A 1KP6A 2CPXA 4DSKA 6FDRA 5KOWA 3ZXWA 4P6QA 4X62F 3M2RA 2GMJA 4EFAC 4WBFA 1NRKA 4Q8EA 1GQEA 3HSGA 4PG7A 2GVDB 2KM8C 3BO3A 1UCNA 2BANB 2OPSA 3PYFA 4LRAA 2YVSA 4Q44A 4ETZA 3MMBA 2DNKA 4Y2MA 4DR6F 1IWAA 2GQQA 2HGLA 4FF1A 2QLWA 4H4KA 1XMOJ 2MGZB 5HLFB 2YKPA 5K20B 5EWGA 2O1PA 4P52A 4L6V3 1T7PA 2JZ5A 4YEAA 2OPRB 3DRPA 1MROA 2FHJD 4ECTA 3M05A 3CCTA 1S9EA 3OD2A 4OMFG 1C4AA 4KPCA 1NAQA 4WP8A 5KFOA 4AYBD 3IBFB 1NH7A 4HVZA 1HA1A 2YY3A 3R27A 2JEGA 2XHWA 2QMXA 1HNZF 3RAQA 1VK3A 4Y65A 1Z1ZA 1U6ZA 3CCMS 4UZCA 4UW2A 1HLWA 3I4HX 4QOTA 2W25A 3KXDA 3K2YA 5A8WB 3CMES 4J90A 4NLOA 1UPPA 5B0BA 1HIYA 2QV6A 3RYLA 5C42A 2AX1A 4B3SF 1EP4B 1HWJA 5EUHA 3NNHA 4X65J 2H48B 2V6AA 3OFGA 4W98A 4NZ7A 2UVUA 3GFHA 4LF4F 1GAOA 1PILA 3LH2S 2FGCA 3SXLA 1O6XA 3GU0A 3OTOJ 2HAFA 2O01C 4K0KJ 2HFVA 2M8HA 3SIPB 1XNRJ 1WF2A 2BJ3A 1TELA 4JI0F 1OS5A 3CJ2A 5KOXA 3DLKA 5KFRA 3DDNA 4LRBA 5DDRC 2XZWA 3UN3A 1WHVA 4Y2AA 2XS5A 2PGCA 2FVRA 3UI3A 1K1QA 3TVYA 4NMXA 2U1AA 1FVSA 1I94J 2RMLA 4C8OA 2NXUA 3X1LB 4ZDNA 5CZVA 2HHHF 2DNRA 3LP1B 5K14B 1FHTA 1D9AA 3PJ9A 4DLEA 1RWWB 2GVDA 2PN6A 2BANA 5JMNA 1AW0A 1Q82T 3J7A1 4AL5A 2M2BA 1N6QB 2VZ9A 2V4JB 3AXKA 1QSSA 4N41A 5KFJA 3N6LA 2HLTA 4M1KA 1JJHA 2AW0A 4OYMA 4E98A 3ENQA 2W8LA 2L48A 2MGZA 1VK8A 5HLFA 2IYIA 2XC9A 4F3QA 1OY9A 3GP9A 2E29A 3IG1B 5ETVA 1U1KA 1RBLA 1U0SA 3BYPA 1GMVA 1M5PC 3VZHA 4ILMA 3R9LA 1GX5A 1NO8A 2VIHA 2I6WA 3MOJB 3I0RB 3PRDA 1IQZA 1DY3A 3R8YA 4DPWA 4WFBQ 3RB0A 5BR8J 4ANEA 3M2VB 3ZC4A 2OEJA 3D6MB 3I31A 2J8AA 2A2DA 2Q79A 1S99A 4P9SA 1Y5NB 3UE2A 2I2YA 1U0HB 4CLFA 1HBOB 5A8WA 4CH0S 1LQ9A 1N0VC 3VAMA 3KK1B 2JL9A 4QPXA 3BEGB 2V2VA 3FSYA 1PGZA 1GMWD 3KKFA 2DXEA 5E5NA 1FTCA 4G1QB 4Y34A 5LL6d 3W64A 2E5JA 5KT5A 1NXIA 4I0WA 1KVKA 2XNQA 3ZFVA 1RYSA 3QAEA 5IT4A 1KRPA 1CULB 2EFOA 8ATCB 1VQKS 4P10A 2CQBA 4DV2J 2P9EA 3DU5A 3IC1A 1FKPB 4ZPTR 4MK7A 4J9LA 3DHWC 1X0PA 3MURP 2ATCB 1HNXJ 1NNDA 3PX6A 1F2HA 2UP1A 3B54A 4GRSA 2CNOB 4WZMA 3VV2B 4FS1A 4DUYJ 3I6PA 4DV6F 4QZVB 3WDOA 2HFNA 3C15B 1L3KA 4TQRA 2YWHA 3ETOA 4KE5A 3LP1A 4CLPA 5K14A 4C6AA 3VALA 1JJ2R 2J6TA 4I4BA 1HQUB 1V3SA 3WIUA 2UUCF 1CJTB 3G71S 4FYXB 1N6QA 5K9FA 4NLGA 2V4JA 3UR0A 2LCWA 1R8AA 3UFCX 1X4CA 3QZ7A 5AE1A 1FF2A 1TFWA 3OVBA 2DR6A 4ZKAA 3KHHA 4B9UA 2BQRA 2FZKB 1RYRA 1B4SA 2LXUA 3AFGA 3F44A 4I56A 4IQXA 2P9GA 2M8DB 1T9TA 4DR2J 3R6LB 1UW9A 4C8LA 2YPZA 2Z57B 3IG1A 3HHKA 2FHMA 4FP9A 4IFYA 5A6WA 3JS9A 5F8NA 2WSCC 3ZTPA 3JB9k 1G4CA 1ZOTA 3LPEA 2HIYA 3I0RA 5JUMA 5IM0B 1ZM3A 4FS2A 2ASDA 2XO7A 1YZ7A 3OR2B 4OJ3A 1VQ9S 4LMZA 1AZSA 5FDLB 4IYQA 3M2VA 3P4UB 3U7JA 4LF1A 3QYYA 2B5JB 2XLKA 2V67A 5J1EB 4N76A 1U0HA 1HBOA 3IWLA 4IH7A 2B6AB 4J9SA 1VQSA 4DSEA 3KK1A 4HR2A 3H5XA 5KFEA 3SCKE 4DUZF 2MEWA 1S4EA 3NGDA 1I51B 4USVA 4HHHA 4I1TA 1NK6A 2HG4A 4PPDA 1U4BA 2ZKTA 2XMVA 1CULA 4X4UA 4RBTA 1MMDA 2JNJA 4FNHA 1YG0A 4ED5A 3MD1A 1HNIB 1M5VC 3J7YU 2EBGA 1RT5B 4Y2KA 3CUNA 1FKPA 2OMLA 2F4VJ 1W7WA 1CG2A 1F3VA 3CMQA 1W25A 4C0HA 4G1PA 3PG9A 1HR0J 1N0UA 2YX7A 5F41A 1RJJA 4DFMA 1GTEA 2C2DA 4B3TF 3C15A 2Y1LB 3CC4S 2E5IA 3V6HA 3KDOA 4YQWA 1F9EB 3P6YC 3DNCA 1UVIA 5IV4A 3TUPA 1ZBTA 2C3UA 5E3RA 1VJWA 4YMEA 1HQUA 3OL8A 2AKWB 4PAAA 1CJTA 2KJVA 3D0GE 3K57A 1T05B 3HHEA 3QFWA 4IKAA 2BE9B 4A8MP 1XNQJ 3K5PA 1HQ2A 4CNZA 1NUEA 3W5XA 1EKSA 1RHQB 4MTPA 2P9CA 5A8KB 2VQEJ 5MLCV 3C16B 1NSKL 4DFPA 3LALA 5KFSA 1FJGJ 3PCOB 3ZO7A 2ZJRQ 1RAIB 2VBYA 3CJ5A 2W4CA 2BV3A 2P6TA 4ER8A 4QIGA 5AJ3J 4F8RA 5GAGU 5I3UB 4UY85 2HWTA 2VOOA 2BJDA 4G6VB 2IYGA 2IC3B 3G8TA 2E5LF 1L3TA 5IM0A 4C8KA 2NUUG 5FDLA 3UWTA 2WRMA 3EJMA 4ERDA 2B5JA 4M5LA 1FI4A 4CO4A 5KG4A 3FFIB 2IAJB 1XN9A 2HHTA 2RU3A 3OT9A 4U96A 4KT0C 5J1EA 3JSYA 3IR5B 4IG3B 1EKRA 2QRRA 2EXUA 3IFEA 2B6AA 2WOMB 1XIQA 1S12A 1R6YA 1F6TA 3OTEA 2NZCA 3SDEB 4CH7A 4B3MJ 3ZZZA 2GW8A 2DO0A 1RBAA 1RUSA 4CLZA 4FPIA 2HK2A 2PO4A 4O3QA 2GJIA 2DO4A 3C14B 1U49A 2ZJPQ 3A8IA 4USMA 2BKOA 4DV1J 3OXFA 4OYWA 3IBCB 1RT5A 1OYDA 5DDOC 2C2EA 3H42A 4ELVA 3VR1A 1Q78A 2QGFB 1G2EA 3TI0A 4MAKA 5GAHU 1DRZA 2XYGB 2DRAA 2QSFA 1HHSA 3PFOA 4YB6A 2W9BB 4U95A 2AZ3A 2Y0SD 4DV7J 2AZ1A 1WEXA 1M5SA 2J9EA 1N48A 3PXGa 1WHYA 2HQ3A 5B7WA 4K2XA 2V2KA 5T7LB 2F1FA 2ZD1B 2ZOGA 4ZVRB 3LGHA 1CQMA 1T05A 4RW9B 2DIVA 3ZZOA 3FMBA 2QLBB 2DTJA 4J9KA 4KHPF 5J2NA 4U8VA 4JYAJ 2EFGA 4ZCIA 2HNZB 4KB7A 2K3KA 5A8KA 2VICA 3SYZA 4GVBA 2HQDA 9ATCB 3C16A 1C1CA 5HK4A 2AF6A 4LF7J 2HQGA 5HJXA 2IIHA 3PVXA 4JOUA 4UOFA 3D67A 3NS5A 1RAFB 4DX5A 3DFEA 4IQMA 5IC4B 1XR5A 3SBMA 2XO6A 1X7VA 3RRKA 2W2QP 2ZZMA 1FJCA 4A8XA 1AB8A 2IC3A 2UUAF 5K8PA 2JFDA 3TYTA 5HMYA 4ZCMA 4V1Ak 1OY8A 4JI1F 3MEEB 3Q23A 4DDFA 1SKRA 3FFIA 4Y2IA 2IAJA 1S9GB 3KJNB 3G8SA 4RWXA 3H5UA 3HXMA 2ZBRA 1BD6A 4PG8A 2F3JA 4IG3A 2HGMA 1FXRA 1IBKJ 5CD4A 2PIIA 2QL9B 4C97A 4IRDA 3TAMB 1N36J 1Q0NA 3SDEA 4R0EA 3CDBA 4NLXA 4TQSA 4FBUA 4LVNP 2BOAA 4FYVB 3AOAA 2CJ9A 2GO8A 3C14A 1WACA 2D41A 2BJ9A 3PEHA 5KFZA 3QGHA 3ILJA 3IGVA 1C1BB 1MG7A 4WKYA 3CCSS 1SBRA 1OWXA 4O3SA 2ZH5A 4NLQA 1T02A 4CT9A 1RAOA 4FXVA 2RIJA 9RUBA 1D09B 2J7UA 2QA2A 2W2PP 3K89A 1VC5A 4BC7A 4LFCF 4DV3F 5ADZA 1HI0P 2RAQA 4WZQA 2D9OA 1TP7A 5D4LA 2XB2D 2W9BA 2KJWA 1FRMA 1FX2A 1GXUA 1OY6A 2QG9B 3FCWA 2NPFA 1PC5A 3CCVS 1OJ4A 1WG4A 1VIXA 5T7LA 5BYSA 3TJ8A 5DLFA 4K4UA 1RHJB 4RW9A 2C28A 1HNWJ 4A8KA 4M5JA 4LSLB 1LFWA 3TUJC 5CQGA 2HKEA 5KT6A 4EGLA 2HNZA 4NLVA 1LK7A 1U6BA 2DRDA 1H6KX 2PA8D 4NCGB 3RW6A 3QNWB 2PMWA 5B0FA 3HF5A 1PCAA 1UETA 2MMYA 2MY8A 3BGUA 2ZJQQ 1FDNA 4ED7A 3GB0A 2OTJS 4KC5A 4ILRA 2K7JA 1GXTA 2RQKA 4DX7A 1U1MA 2QA4S 1B70B 1OYEA 4OZ0A 4DL5A 2F7VA 1RTZA 1G1XA 4BCAA 2OFHX 4CO2A 3CIMA 3IP0A 2IM3A 2DNHA 2HYIB 4LF8F 2UXDF 1F2GA 3MEEA 5EWFA 1FX4A 1VMBA 3M6VA 1KQGB 3MM5B 3PY8A 3H5SA 2KU7A 4WPAA 4DZ6A 1S9GA 2VFVA 3OVAA 2G1HA 1E6YB 1KHVA 1U1RA 1IBMF 3BSNA 3D9BA 4UTGA 4MH8A 4NMLA 3TAMA 1N34J 4R5PB 2D3UA 2QZ8A 2YX4A 3W61A 4URQU 2ALYB 2E7WA 2OSRA 3UW1A 1VQOS 2RF2B 1FDBA 4QR2A 5E3CA 2YWKA 2B3TB 1RXOB 2XCAA 2D3OR 5ETSA 1S59A 1RWPB 4F26A 2VD3A 2Z30B 1JK9B 1C1BA 5K8OA 2MZ1A 1V6HA 2CKWA 3C8YA 1J2VA 2CNKB 5KG0A 3V4MA 3R1LA 1KN6A 3MPVA 2QE5A 2E1AA 1XMQF 4KHRA 3VWSA 5B09A 4F04B 2DB1A 1ZA1B 2HHVA 2Q66A 3QT8A 3V81B 1TL4A 2QX0A 1SL2A 4OX6A 4ZOSA 3KJVB 3L3CA 2A0FB 3T1HF 5D3GB 1U7LA 1TUWA 1ITPA 1NDKA 3NNCA 2LEPA 3LANA 4F0KA 2Z0GA 2N4DA 3R97A 3HKWA 3SMZA 4NLPA 3QT7A 3DU6A 4UY8T 3PW2A 1S4FA 1Y11A 4LSLA 2IMOA 4L72B 2CQIA 4NCGA 4DR4J 2I8EA 3GFZA 3RR8A 2QLFB 2HQCA 2PEBA 1OSDA 2VBWA 3UD3P 3HJFA 2B8QA 1JKHB 2J76E 3DLHA 2O3DA 3VAFA 3QLHB 2KKHA 3MDFA 5ITHA 4USHA 3THPA 4FXDA 3MM5A 5A0YB 5K8NA 3CCQS 4EZ6A 1X4AA 3HD1A 2CQGA 3FZBA 3B82A 1WJ9A 2BJ1A 4U8YA 1VGYA 1E6YA 3MR3A 3V6KA 3MECB 1SJQA 1H2TZ 1WUUA 1K9MT 1SXLA 1XK8A 3W9IA 4R5PA 3IM9A 2ZKUA 1LKZA 1LWEB 2PI5A 4ZVOB 4X66F 4K50A 2RNEA 3JSRA 1A0OB 4LF9F 1U1LA 5ETQA 2JC0A 1RT2A 1AUSL 3MAAB 3T5KA 2PD1A 4OHWA 3OPKA 4PRFA 5B0CA 4R8UB 3QIPB 2AEJA 2KN4A 4OZ2A 2VBXA 2DRBA 3DLLQ 1RWNB 4Q2LA 4NA2A 2DNZA 3V81A 2XSFA 5DO2A 2BZ2A 3OFEA 3CDUA 2CUYA 2XGQA 2ZBQA 3P5BP 2YKAA 6AT1B 3KJVA 1NDCA 4ZP9A 5D77A 1BUXA 3Q8QB 2GHPA 2GHVC 3K7RA 2ZM6J 5D3GA 4AT1B 4RL1A 1R89A 4B17A 2HHPA 4GO7X 1DLOB 4M5DB 3RBZA 5HN0A 2ZHBA 4Y3CA 3AAWB 1D1UA 7AT1B 2R4FA 1U02A 3T5LA 5HMZA 3TJ9A 1DAXA 3LAKA 5DDPC 4LF2A 2FZGB 3HJVA 1UP1A 4EO8A 5C24B 5KG2A 1ELOA 1OO0B 3J80U 1KSPA 3MTJA 3M8SA 1M1KT 3PJXA 1JNRB 1DQ9A 4ZHRB 3LF0A 4HDGA 3JTOA 1HPZB 5BXIA 4DV4J 4UUXA 3AHPA 3SV3A 3PIPQ 1JKHA 1PJ7A 5LT5A 1B64A 3C6UB 2N3LA 1PBUA 3QLHA 3M6XA 1O0PA 5KFVA 4A8QA 2COLA 4ZCLA 1KFDA 1M1HA 4RUCA 3T19A 2WONB 4UQTA 5A0YA 3U02A 1Y5IB 1RT4B 3GR1A 3PX4A 4M8LA 3CC7S 2M88A 3BM7A 2LQJA 2Y1JA 3DGPB 3MECA 3IRXB 3HFZB 1S79A 5ETTA 2XMMA 3H2UB 3MOZA 1EQ0A 1MWYA 4JI8F 1IUJA 4PWUA 1LWFB 2ZFHA 3UDEA 1LWEA 3Q83A 3OUYB 2ERRA 2FJWA 3KMQA 4FVCA 4ID5B 1R3NA 4G1IA 3J7Z5 4JI2F 1YQHA 1EHWA 2CZ9A 4R8UA 3QIPA 1UAWA 1SKUB 2DGXA 2H5IB 3MD3A 3H59A 5LMUF 5HL7Q 4JI3J 3QMQA 4ZN1A 2FHJA 3D28A 3TAPA 5A2QU 1D0EA 1PYTA 1FXDA 2B9XA 2PFFB 2W9CB 3W5ZA 2W7OA 3G6VA 3LUYA 4MYTA 2VJUA 1QVFR 5F3ZA 4MFBB 4AQYJ 2FUG9 1RLCL 3FUYA 1H72C 2VHGA 1D8ZA 1M1GA 1KWMA 2R7WA 1WC0A 4I6YA 2MQNA 3TA1A 2JVOA 5CA5A 1VIOA 2ROGA 4ECZA 2EI5A 2LU2A 5B0DA 1DLOA 2M70A 5HANA 4X64F 1CQNA 1AFJA 1UVNA 3WHIA 2BYCA 2DNOA 4N47A 4DSFA 3ITHB 1UJ5A 4KPYA 4C8MA 2OEMA 1N88A 2MLYA 2OI2A 2AGPA 3QATA 4BC9A 5C24A 3LA0A 1RT3B 4NXNJ 2QFIA 1B3TA 5DQGA 1V5IB 5DETA 4ZHRA 4ECSA 3AD9C 4CLSA 3NWGA 3B6BA 1GFWB 1HPZA 2RS8A 1DTTB 4E0DA 2RE1A 4M94A 1N32F 2LQ8A 3D1QA 3MGJA 4XAKA 2ZVIA 3RUBL 4IOAQ 3C6UA 4NCAA 2L3MA 1YHQS 2IRXA 5KT2A 4RX6A 4R25A 2EG1A 4JI6F 3NY0A 4WYWA 4A8SA 2FVPA 2WONA 5KG3A 1ZM2A 2H51B 1RT4A 2BM1A 4GMKA 1U2FA 4URSA 3EX7B 1HBUB 5I4MA 3DGPA 3EWGA 3IRXA 2KFZA 2EW9A 2VDIA 4EZ9A 4KR0B 3A12A 1S48A 2X1GA 4HI2A 3FK4A 4EUVA 2XI3A 3KTQA 5E33A 3KLGB 2VB6A 1LWFA 3DRRB 4P7TA 2PI4A 3N6NA 1UA1A 3NGRA 3OXLA 4ID5A 1XMOF 3I55S 4OX9F 4F67A 2IVYA 4Z7YA 3T3FA 3JTNA 2X1FA 3KLVA 2RQCA 4XK8C 3PHTA 1RCOB 3TO8A 2CNNB 5EN1A 3BN4A 1RU1A 2W9CA 5A6PA 2RT3A 1NM2A 2OELA 2J0QD 3R3TA 1IR0A 2C22A 4MFBA 3I87A 2Z2ZA 5KG7A 3QRPA 1HFEL 2K3IA 2UUTA 2HS3A 5C2CA 4DR7J 1X8DA 4Y28C 5L38A 4C0BA 3CCZA 2UU9J 2MKIA 3BR9A 1GTHA 3ITHA 1UVKA 4DR3J 2A1BA 2YBVA 3SI8A 1ICEB 3VGSA 4PYAA 3NKYA 1RHRB 4X65F 4U67Q 2P8IA 1RT3A 4DSLA 3V6JA 4ZPWR 4ATNA 2D74B 4Q7AA 2GIQA 5FJ4A 1D3WA 3OTOF 3GFYA 4DV0F 3OTCA 4CQ1A 3CCJS 1XNRF 1Q53A 4I7FB 4USJC 1N4LA 3NLCA 1Q7YT 2ZH4A 4C98A 3EZOA 1UWBA 1RWMB 2JVRA 3WQPA 2MPUA 5HVFA 2KG1A 4ED0A 1KVIA 3F56A 2LQBA 4QU7A 2YTCA 4F02A 4AUKA 3I5BA 3VQSA 1UPMB 2CJKA 4TXSA 5M2PA 1NDLA 1F3FA 3BGFA 1JJCB 4TYAA 3GJRB 2MTLA 2RRBA 3CW2C 1EJ7L 4NA3A 3KLGA 2YWFA 2DHGA 2YWEA 3DRRA 5CYQA 1DHMA 1MSWD 4P2XA 3HMJG
chains in the Genus database with same CATH topology
2GGPB 3VAMA 4Z37A 3KK1B 2JL9A 3N9UC 3DDKA 2OPPA 2R2TA 4QPXA 1IJEB 4QQBA 3BEGB 1WHXA 3FSYA 3H20A 2FJVA 3TAQA 1PGZA 1WTBA 3E51A 4EO6A 1VI7A 2RH3A 3KKFA 3Q22A 5KFHA 4H4KC 5B0GA 4H4OA 5E5NA 1FTCA 3T9ZA 2JHEA 4G1QB 5I3UA 2V8VA 3P3DA 4DFJA 2Z8QA 2PE8A 4Y34A 1U1NA 5LL6d 1K0TA 1C4CA 2E5JA 5KT5A 1UVJA 5HQ8A 2D7SA 4I0WA 2XNQA 3ZFVA 1T95A 4ED6A 1RYSA 3QAEA 5IT4A 4N8OA 1KRPA 2EFOA 1Y7PA 2IJFA 3JSBA 4B3RF 3AA8A 1VQKS 3BF4A 3QPIA 2NSCA 2CQBA 3JTPA 2P9EA 1S1WA 2HGNA 3EYZA 5GAEU 5AXKA 2NZ4A 1WF1A 3DU5A 2L9DA 3FGVA 4TY8B 3IC1A 3MMCA 1FKPB 1KEKA 5GADI 1FKAF 4DS4A 4ZPTR 2V8DA 2DD8S 2A2CA 2EKYA 4MK7A 3DHWC 4J9LA 4CIOA 4C8YA 3ISZA 1N33F 5DDQC 5CZXA 1X0PA 4IR1A 3MURP 5F8MA 1NNDA 4ZPAA 3I82A 3DOMA 4OIXA 5BR8F 3PX6A 2R8JA 3GIKA 2VG6B 2UP1A 1MMLA 1FVQA 2M0GB 1LWCB 1SJ3P 2WW8A 4ID8A 3FQLA 3HHLD 1P1LA 1B0PA 2LU1A 1HWLA 1R7IA 3GMGA 3SCJE 4FS1A 4WZMA 1X9SA 5KFYA 1H2UX 3I6PA 3M4XA 3QIDA 1L3SA 4DV6F 5LSLA 2PSZA 4QZVB 2WOMA 3WDOA 4F4XA 2HFNA 2RDJA 4N56A 3IWNC 1L3KA 2ATLA 1TK8A 1HQEA 2ROEA 1VQ7S 1TK0A 2M7SA 1OIAA 2BE2B 2BUNA 4TQRA 2YWHA 3ETOA 4KE5A 1ZAXA 3GE9A 3LP1A 2GNKA 3OL7A 5K14A 2KT3A 4ECWA 2FJEB 4FF3A 2LQ5A 4A48A 2J5AA 3VALA 3OW2R 4O4RA 3K8VA 2AD9A 1SJ1A 2KT5A 1U26A 2CQ4A 4I4BA 1JJ2R 2KT2A 2J6TA 5F8JA 1HQUB 3KG4A 3T9NA 3S6EA 5BJRA 1V3SA 4JV2A 1S1VA 5G4DA 2VODA 2UUCF 4AL6A 3M9OB 2VL1A 2EBEA 3LAMA 3QO9A 3G71S 1N6QA 2BRKA 2LVWA 5K9FA 3I56S 4OZ5A 2XULA 4NLGA 2V4JA 2J0SD 1X5PA 2LCWA 1R8AA 3UFCX 3UR0A 2KZZA 1X4CA 3QZ7A 5AE1A 1S0MA 1FF2A 4HDHA 1TFWA 2GQCA 2MKHA 3OVBA 2FHOB 3DOLA 4WFAQ 1R8BA 3QZ8A 1UFWA 3CE8A 1U47A 1V9OA 1S0VA 1ZM9A 1BQXA 2BACA 1N56A 2QMWA 4ZKAA 4WXWA 3KHHA 4B9UA 3CULA 4OHZA 4ZP6A 3F73A 2BQRA 2KVIA 1U1OA 3DLEA 2YH0A 1RKIA 3FJ2A 3GFXA 1JLAA 3OV7A 1RYRA 2LXUA 1XTZA 3NMRA 4M95A 4DMZA 2UXCF 3MHYA 2XWXA 1M5OC 3M2UB 3F44A 4I56A 4MKBA 4IQXA 1QLNA 2DK2A 2P9GA 4DX8H 2M8DB 5KFNA 5KG5A 2KXNB 3TA2A 4DL0C 3MFIA 4XDDA 2E9ZA 1FJEB 3M8PB 4C8LA 5M2UA 5F9NA 3IG1A 3HHKA 3MM9B 2FHMA 3M1VB 3ULHA 1MW7A 2QA1A 1WHWA 4FP9A 2W4DA 4I7FA 3S1TA 5J2MB 4IFYA 1FRXA 5A6WA 3RU0A 4V19J 5F8NA 1S6QB 4P2SA 1FEHA 2DNMA 3M9MB 2KDOA 4ES2A 1NB7A 2OO4A 2HRUA 2BDPA 2R2UA 4PG4A 4DQSA 2WSCC 3JB9k 1ZOTA 4IH6A 2AU0A 2BQ3A 4QIEA 4NYZA 1DARA 4NWBA 4OZJA 3I0RA 5IFMA 1N5TA 2ZD1A 4QPTA 5JUMA 4NRUA 3NNAA 3W2WB 4UOCA 5IM0B 4TYBA 1ZM3A 4FS2A 2ASDA 2XO7A 1UEVA 3U27A 3HP6A 3OR2B 1D9FA 3M9NB 4OJ3A 3D1HA 4EEYA 3PX0A 1VQ9S 5K8MA 2PMHA 4DL7A 2OD4A 4LMZA 5GMKa 5FDLB 4C11B 3V2UC 4IYQA 3M2VA 3MM6A 4GO5X 3U7JA 5IS2A 2X1BA 3E01B 3QYYA 5IZHA 1T94A 2KZMA 2B5JB 1KD1T 4CO5A 2UVVA 4WF9Q 2B4OA 2XLKA 2R7VA 2E66A 4ZPBA 4ILLA 3FZ2A 4PUOB 2FTRA 1H38A 1S6UA 1RA6A 2VFSA 3QAUA 4QJVA 5L8RC 2QA4G 2VOPA 4FZVA 4KV8A 3TRGA 4J9MA 5J1EB 2ZH8A 3OBIA 3K5OA 3SV4A 4N76A 5HROB 3KLHA 1VBXA 1OQ3A 1RTIB 4DL2A 1Z4UA 1HBOA 2WSEC 4PXDA 3UNGC 3PZPA 3NCRA 5IWAF 2CQ1A 3IWLA 4IH7A 2B6AB 4K4YA 4J9SA 2CG4A 4LFAF 1VQLS 1VQSA 1BWEA 1G7CB 2J6SA 4QYZJ 1FKOB 1UKUA 2FVSA 2AWZA 2GGPA 4OJHA 7FDRA 4DSEA 3KK1A 1Q1KA 3CT9A 5IQQA 2HRYA 3W7BA 3OL6A 3C66A 4FF2A 3H5XA 3I32A 4QR1A 2LDIA 5KFEA 3X3UA 5AXNA 4B9MA 1R8CA 2HNDB 1I6JA 3SCKE 4DUZF 4C9DA 1IN0A 2CQDA 3MMJA 3VF0B 2ZH3A 4X4SA 5J1PA 3MEKA 3NGDA 3CD5A 3LGMA 4YB5A 4I1TA 1CEZA 5DQHA 1NK6A 2HG4A 4PPDA 1KONA 2K2PA 1IKYB 2ZKTA 1X0FA 1U4BA 3Q8PB 2IJNA 2KYZA 1H7XA 3LGNA 2BW2A 2XMVA 1N5YB 4X4UA 2C3OA 5DM6Q 2MDAA 3O1LA 4RBTA 1VBYA 1JXLA 1MMDA 1YRTA 4FNHA 1YG0A 1TZ0A 1VQNS 4ED5A 3MD1A 1HNIB 4C3KA 1M5VC 3KK2B 1FDDA 3DLJA 2CQCA 1EETB 3J7YU 4DFKA 1JIHA 2EBGA 1RT5B 3FRYA 4C8NA 4Y2KA 2E9RX 4TY8A 1JLEB 3CUNA 1FKPA 3TA0A 2OMLA 5H1SV 4R0JA 3CCWA 3IS9B 2NREA 1HL6A 3BJYA 1SV5B 2V9WA 5HP1B 1YJVA 2GIRA 2E1MC 2UV8G 1CG2A 2AYEA 2NLWA 3MAHA 1FERA 2MJNA 2HWIA 1KOOA 1W25A 4C0HA 3ENVA 2VG6A 4G1PA 1LWCA 1KR4A 3SFGA 2OIHA 4F3OA 3UD4P 5H9FJ 1N0UA 1VOMA 2YX7A 5F41A 1RJJA 3M30B 2ZC3A 4DFMA 2DCLA 1GTEA 3TQ1A 3BSOA 2C2DA 4B3TF 2NQPA 2UUWA 2PDAA 4F3MA 1X5OA 4Q0BB 3CC4S 2E9TA 2E5IA 2AJ1A 2XMTA 3V6HA 3BN7A 3ZZ0A 3POTB 1SL1A 4YQWA 1CVJA 2B4UA 4LIWA 2ZHAA 1HYSB 2JX2A 3DNCA 3G96A 3P6YC 1UVIA 2BE2A 4X84A 3PO5A 2H9ZA 2LLZA 4NLSA 1MMNA 1ZBTA 2C3UA 3B4MA 4IO1A 5E3RA 5EWEA 3KNGA 4DHVA 1VJWA 3GIJA 4YMEA 4F4WA 4CTAB 1UWBB 4GKKF 2ZOMA 5F9LA 1HQUA 1QVGR 1SH3A 4ED2A 3OL8A 3DI6B 4D3HA 2I38A 1YJWS 3US5A 1K73T 1JX4A 4WE1B 2KJVA 3PR4A 2DGOA 2ADCA 3D0GE 3K57A 3M8QB 3GR0A 1T05B 2CVEA 2VC0A 3HHEA 4C0OC 4BHQA 1P1TA 2MQPA 2B7BB 3N01A 1Y3JA 2GV1A 2K1RA 4IKAA 4NLUA 2MYFA 1HMVB 3L7PA 1UMJA 2OP5A 2LYVA 2YNHB 4ICLB 4OHVA 4A8MP 3K5PA 2F8MA 4CNZA 2QFJA 1X4EA 4GKJF 2VV5A 3TANA 3EZUA 4O3NA 3SQGB 2DHAA 5E7OB 1Y5LB 4MTPA 2CQ2A 2P9CA 1RTHB 2ZBCA 3EGNA 5A8KB 3AQPA 5MLCV 2DGUA 3M2UA 3ONQA 3C2PA 1X9MA 3DC2A 3LALA 4DFPA 2XGPA 2OSQA 2XEXA 1RTJB 1RP5A 4NLTA 2MXYA 2XSJB 1FE4A 5CYQB 1QUVA 5EX3A 4C3MA 5JJBA 5KFSA 3M8PA 1YJTA 1WELA 1P6TA 3MM9A 2DH8A 1LXJA 3M1VA 1Z2ZA 2ZJRQ 2IM1A 2VBYA 3CJ5A 2W4CA 3DCAA 3LP2B 5J2MA 2BV3A 2P6TA 3FDSA 1AXQA 4J9NA 3IAS9 4QIGA 4P7VA 4F8RA 2XLJA 5KT7A 1HR0F 5GAGU 4U7UK 1S6QA 4KGKA 4PQAA 5I3UB 1UA0A 4J9QA 4UY85 4K5RA 2DHSA 2HWTA 3B8HA 4JI5F 3CJ3A 2HHSA 2VOOA 1KTVA 4ECUA 2BJDA 2VONA 1S72S 3P5TL 3SEOA 4YR0A 1TKTB 4U9RA 4G6VB 2CPYA 3DMJB 2ZHOA 2IYGA 5DS7A 4LVOP 2IC3B 1JLGB 3G8TA 3THTA 2ZH6A 2HW3A 2E5LF 2XWYA 5M2RA 1L3TA 3W2WA 2Q43A 5IM0A 2Z2LA 2EFPA 2I5JB 3BGRB 2ZNZA 3MEGB 4NZ6A 4C8KA 2NUUG 5CHCB 1SC6A 2E5HA 2A3JA 5FDLA 1NKCA 3UWTA 3MM8A 5F3TA 2WRMA 4C11A 4ES3A 4OI6A 4ERDA 4IOCQ 3Q0AA 3E01A 4QW9A 5KFQA 4B9NA 3HK2A 2B5JA 4K4ZA 4CO4A 4QCLA 5KG4A 3FFIB 3O3LA 3KLEB 2IAJB 5KFKA 3CXCR 1XN9A 2HHTA 2RU3A 2J0WA 1ZYQA 4PUOA 2VASA 3E8OA 3OFFA 4DQQA 3QWPA 1K0VA 4N8NA 1FCAA 2JRSA 4KT0C 4B9SA 5J1EA 2DNYA 2FJBB 5HROA 4OV1A 3TR5A 3JSYA 1RTIA 3IR5B 4IG3B 2QRRA 2VKRA 2XG8A 3IFEA 5DQIA 3TVZA 1DTQB 3GYNA 3MWBA 2B6AA 2WOMB 2MZTA 4I68A 1FKOA 3CCRS 1Q8IA 3LW5C 2LKZA 4ECVA 1R6YA 3MM7B 3N5BA 1LOUA 3OTEA 3FSXA 3SDEB 4WFNQ 4CH7A 3CJ0A 1NJIT 1DQ8A 2ZH9A 1GX6A 2HNDA 3ZZZA 4ZCKA 1K8AT 3UDCA 2GW8A 2DO0A 5KT4A 1BC6A 1RT7B 3GQCA 1FD8A 2J0XA 2P6SA 2JOQA 1FJGF 3WX4A 3MEDB 4LSNB 5FD1A 5U47A 2PO4A 2JC1A 4NL5A 4ELUA 2I0XA 4O3QA 1HD0A 2GJIA 2DO4A 1IKYA 2RB7A 3WBZA 2MZJA 1N5YA 3AJ1A 3AJ2A 5AJ3F 4EBCA 1U49A 1H3DA 2F8EX 2ACYA 3OTBA 1S49A 2ZUGA 4WIIA 1WWHA 2ZJPQ 2Y1RI 3MUVP 4A47A 4DWIA 4OFZA 3KK2A 3OXFA 1EETA 1HI1A 1TL1A 1RT5A 2EVZA 4TU7A 4KSEB 1JLEA 3H2VE 5DDOC 4DQRA 1J5EF 4BS2A 1UEUA 1HNVB 2C2EA 3QGGA 3IS9A 3GG0A 4ELVA 3VR1A 1M5HA 4JV5F 1Q78A 1SV5A 5HP1A 1XMBA 5KFUA 3HFKA 5D4NA 2IA6A 1KS2A 2CZVC 3OFHA 4PXCA 2N82B 1G2EA 3TI0A 1TAUA 4MAKA 2X1AA 1BY9A 3BDEA 5GAHU 5JVGQ 1JXEA 1T3OA 1DFDA 3I96A 3VZIA 1SKSA 2Q6BA 4PPZA 4EBDA 1DRZA 3HX9A 2XS7A 2MQQA 1DQAA 2KRBA 5AE3A 3M30A 3RB3A 2DRAA 2QSFA 3GWCA 3N79A 1R43A 5EHHA 1HHSA 3PFOA 3QGPA 4YB6A 2W9BB 4Q0BA 3PKMA 5D6GA 4IFYB 3FSIA 1V3ZA 3POTA 1HYSA 2Y0SD 4E8UA 1QSLA 4ETXA 1CC8A 3THVA 1WEXA 4JV0A 2CJBA 1FNOA 3TOQA 1M5SA 2JEFA 2J9EA 2JWNA 1N48A 4ZPDA 3PXGa 4DR4F 1WHYA 2HQ3A 5B7WA 4CTAA 4KAIA 3DLGB 4K2XA 3MR6A 4OZ1A 2V2KA 2XLIA 3E3XA 2ASLA 2R7SA 2O66A 4ZPCA 4Q43A 5T7LB 2R7UA 2YKMB 3H2LA 4FN5A