1YJTA

Solution structure of the cu(i) form of the sixth soluble domain a69p mutant of menkes protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 20
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjtA00
1TR0A 1YRXA 2PD1A 2XMJA 2FIUA 2HQIA 4Y2MA 5B0GA 2OKQA 2W4CA 1FE4A 2K1RB 1FE0A 1RJJA 2KYZA 1S6UA 4OIXA 2XMMA 3KKFA 3DCAA 5B0BA 1SI9A 1MWYA 3HHLA 1FVQA 1TL4A 1Y0HA 2OFGX 3LGNA 2HFOA 3I9ZA 3FRYA 5K9FA 4OJGA 1YJRA 4NL5A 1KVIA 3IWXA 4DL0C 2BJDA 3VTIA 3QMQA 1TZ0A 4HH1A 1Y3KA 2BYCA 1FESA 2HFNA 4A4JA 1YJTA 2KT2A 3BGUA 3LGMA 2ROEA 2GGPB 1VQSA 2AW0A 4HL9A 2QLXA 2JDJA 2ROGA 5T7LB 5B09A 1Q4RA 2N7YA 3K7RA 2XMUA 1FVSA 3KG0A 2RMLA 1WD6A 1FD8A 2BUNA 1SQEA 1JWWA 4Y2KA 4FNIA 3BM7A 2EW9A 2PGCA 3CJKB 1Q8LA 4HI1A 1APSA 2QLWA 1VQYA 2FTRA 2IYIA 2XMWA 2HLTA 2OP5A 2VV5A 2Q3PA 3KNGA 3CJKA 1YJVA 5T7LA 2OD6A 5B0DA 2QYCA 1CPZA 1IUJA 3HHLC 2ZDPA 1U7LA 3DXSX 3WDOA 3HDSA 1AFJA 4QOTA 1CC7A 1GXTA 3HF5A 4YDXA 1P6TA 3TNVA 1ULRA 1MWZA 2LDIA 2QIFA 1XBWA 3BN7A 3FMBA 4OJ3A 5IXUA 1LQ9A 1OQ3A 2ASYA 2N4CA 5F0UA 2GO8A 3BR8A 2W4PA 2IFXA 4FNHA 4DPOA 2K2PA 4DN9A 2OD4A 3BB5A 2XMVA 1GXUA 2HIQA 1TL5A 2FB0A 2K1RA 3HFKA 1AW0A 2GGPA 4YEAA 2AJ0A 2K7KA 2LQBA 1CC8A 2XMKA 3HHLD 2GA7A 2LQ9A 1OQ6A 1TUVA 4U9RA 2OAUA 1URRA 1KQKA 1V3ZA 2GCFA 2ROPA 2BBEA 1Q8BA 1OPZA 1W2IA 3FGVA 5B0FA 1KVJA 5B08A 2KKHA 3BDEA 1YJUA 3QGPA 2GFFA 3HX9A 2LXFA 2RILA 4HI2A 2KT3A 3TRGA 2RU9A 5B0EA 2GV1A 2BJEA 2OMOA 5A6PA 1Q53A 3MCSA 4Q2LA 1X0PA 3GZ7A 1X7VA 2FHMA 2RSQA 2VH7A 2IYGA 2N4DA 3BF4A 3IWLA 4HH0A 1YG0A 2OFHX 4NPOA 4ZOSA 5B0CA 4ZA1A 2AP6A 1AFIA 1N5VA 2W4DA 3LO3A 4OJHA 1N5QA 1FEEA 2ACYA 4Y2IA 4A47A 4Q2MA 1R6YA 3MZIA 1N5TA 4OJ1A 2CRLA 1QUPA 3T9NA 2HLUA 3UDCA 5A6WA 1K0VA 5F0WA 2ZDOA 1JK9B 2G9OA 1P8GA 3F44A 2L3MA 1Y9OA 3KG1A 5KAKA 1OSDA 5B0AA 4F67A 4EFAC 2K7JA 4A48A 1Y3JA 2AJ1A 2XMTA 1N5SA 3E8OA 1SB6A 3TOQA 4A46A 1S6OA 3HHLB 1X8DA
chains in the Genus database with same CATH superfamily
1EQ0A 4FBTA 1R8CA 3H59A 4QWAA 3SXLA 2QLFB 2BQ3A 4ETXA 4CIOA 1WHVA 1FE4A 2WRMA 4UUXA 4DR2F 2D74B 3GFHA 1U1MA 5J2MB 4ENOA 2HNYB 4R5PA 1MWYA 1TL4A 2IC3A 5IV3A 2HGLA 1IBCB 1PIEA 3M8RA 2DH7A 2B4UA 4IDKB 3L7OA 4J9PA 1RA7A 1VQLS 3OL8A 1FFGB 1G3OA 1RT5A 3F41A 4HT5A 1TFYA 1G7CB 1U6ZA 1Y3KA 4P7TA 2Y9HA 2DK2A 3NWRA 1RT5B 2CQPA 1XN9A 2CPFA 1YITS 2ZKTA 3THPA 1CJVB 4JV2A 1X9SA 5AJ3F 4DV5F 2BA9A 3I6PA 2CUYA 2ZJPQ 4B3OA 3RR8A 2YXLA 3D54A 3HFVA 1FXLA 5C25B 2C3UA 2BE7D 2RE1A 3ISNC 4LBIA 5FD1A 3S1TA 1D9AA 1MROB 2DNMA 4RW8B 4X64J 2QJ3A 4LF6J 1BQMA 2HW3A 2HWIA 1RBOB 4HKQA 2LEPA 1KLMA 2D3UA 1UA1A 3NKYA 3BO2A 2HZVA 4DSIA 3JTPA 4Y2KA 3ADAC 1FRXA 4LSZB 1E6VB 3AJ1A 3BQ0A 2QLWA 2CQ4A 5KT4A 2IYIA 2ZC3A 2AKWB 3N5BA 4IOCQ 1NHUA 1ZBTA 4ES3A 3BGRB 1YJVA 3VVTA 1S79A 2OD6A 2J6UA 4DQIA 2DJWA 1D9DA 3Q24A 3VGVA 2KXHA 3CDUA 3R5GA 4DX6A 2IMOA 3IN5A 2XEXA 5HMZA 4ATNA 5HVGA 3TA0A 3CJ0A 3DGPB 2DXFA 3CJRA 1Y11A 4OQJA 1OYEA 5KTQA 2BM0A 2Z58B 1BQXA 1YDLA 3DRYA 4DMZA 1X4DA 5EDWA 3K57A 1KTQA 3AD7C 1H7WA 3KLEB 2KJWA 3T1HF 1A9NB 1B0TA 5EWGA 1TVRB 3IR7B 1MSWD 3BR8A 1J5OA 5IFMA 4JI4J 1UVIA 5J2QB 4C11A 3FEXB 2UU9F 1N0UA 3FCWA 3H8YA 5KFGA 1JJ2R 1VK8A 4LFBF 4MYTA 3NOGA 2VASA 3KLIB 1K73T 1HWKA 4M95A 4Z7YA 4WP3A 4C4WA 1QE1B 1UTAA 4ILLA 1RWKB 2XS5A 1WNEA 2BXJA 2F8MA 1UKUA 2OAUA 2V9WA 1S1TB 1HWLA 2HVDA 2FD2A 1UWBA 2ROPA 4O3QA 3G4SS 4GC7A 1S1UA 2BBEA 1OPZA 3KWMA 4IFVB 3U02A 3N5FA 3MEEB 1C1CA 1QVFR 1GT8A 2MPUA 3NGRA 1SV5B 1S9FA 4NRUA 4OZLA 4DFMA 3A1YG 3BSOA 1KFDA 3FCVA 3FUYA 4N76A 3NMAA 4LFCJ 4XO0A 2OTJS 5K14A 5A6PA 3MCSA 2XYHB 5BXIA 5KFAA 1X0PA 2DGWA 4DV1F 3ZTOA 1VHFA 2E9TA 2GVZA 5HQMA 1HHTP 1RCXB 2YWFA 4ZOSA 2Y1JA 2WSCC 1RGVA 1EP4B 4ZJLA 1H6KX 3AB2B 5E2QA 5I3QA 2OH2A 2GVZB 2XY5A 1K1SA 4PABA 4OYAA 2DY9A 2HK3A 3CC2S 1X4CA 3P6YC 1S99A 1C1BB 3QO9A 3WBZA 3N0VA 1VMBA 5A8KB 3HP6A 2BMBA 2ZBCA 4ZN3A 3JYTB 3NAHA 5DZ7A 1WC5A 4K8RA 2CPXA 2BKPA 2Y1LB 4M63A 2HNZA 2RUSA 2RU3A 1JLGA 2DNZA 3HCXA 3EGVA 5A0YB 2R7QA 2D3OR 2E5LF 4DR5J 2P6SA 3QYYA 3AJ2A 1T11A 4V19X 4DPOA 2H5JB 1JLFA 4ZPAA 2BRKA 1VLOA 4W4MA 2V4JA 2KM8B 1XEZA 3FZBA 4LRBA 3TYTA 1N34F 2XMJA 4EUVA 2CQHA 2ILYA 2X1FA 1MWQA 2PI5A 2R7XA 2J76E 1LKZA 1H0HB 3PYDA 2DGQA 1IKVB 2F4FA 3Q23A 3KJFB 1U02A 1U1NA 2IHR1 2DNHA 2QLJB 5GVQA 3F0NA 2BOAA 2HFOA 3I5AA 4TQRA 4X62J 1K9MT 3QJLA 1FD2A 1SJQA 3H7HB 3IWXA 2N82B 5HN0A 2FHJA 5J1EA 2FVRA 1TZ0A 3DNCA 2XG8A 2YWGA 3AA8A 4N7TA 2Z2MA 1AXQA 1UEKA 4YB1P 2B6AA 5HATA 2B51A 4A4JA 2XLIA 3EX7B 3RB0A 1NK0A 3J7AN 2MDAA 1RWMB 4AD6A 2LQ8A 1JLEA 3Q8QB 4Z37A 2W2NP 2UXBF 1WF2A 1TAQA 2H54B 3R27A 1TK0A 3CDWA 3JTOA 3V5RA 2RMLA 3MUMP 3VAHA 5D8HB 2HVZA 1I51B 2YY3A 4GMKA 1WOOA 4U8YA 4USWA 4QU6A 2ATCB 1JX4A 2QRRA 2N3OA 4ID8A 1JJCB 3I87A 2OIHA 4ZP7A 1X4GA 3SQOP 4ZJQA 3FEYB 1EZZB 3AT1B 4I0WA 1T0TV 1T9XA 1EKSA 4USJC 3SSSA 4AFFA 1KQSR 2F4VJ 1NZ8A 4MKVA 3EVMA 2A2CA 4KGMA 4TY8A 4DPWA 2HHSA 2EXUA 2QYCA 4LF7F 4K0KJ 1Q7YT 2NSBA 2VDIA 1T3NA 4IR1A 1BMQB 1AFJA 3Q8UA 1C0UA 3QAUA 4PXBA 5LMNF 4WP9A 4NXNF 4M5KA 1UETA 3FSYA 5LSOA 2J0QD 3D66A 3SV4A 4NLOA 1RTDB 3DU5A 2ADCA 4OV6A 3H5UA 4B02A 3EPGA 1PCAA 4DL6A 1S1XB 2WVCA 2RKIB 1HLWA 1TU0B 5KG1A 4ER8A 1PG5B 2ASYA 1HNZJ 1TKTA 2BACA 4HHJA 5L1JA 1R8AA 1KC8T 2IFXA 1XMBA 4TLRA 4DV0J 1HQUB 2B9WA 1UW9A 3HHEA 4ECSA 1FWKA 1MMDA 2PA8D 4DJBA 3KOAA 2JX2A 3HJVA 3IM9A 3L4BC 3SDEB 1RTHA 2MQMA 1GXLA 1KWMA 2M4MA 3BBBA 2SXLA 4A8WA 1KBRA 1XMQJ 1Q86T 3QFHA 2F63A 4OI2A 3D0GE 2XCPA 3TANA 1JLAA 1Q1KA 4YY3F 1NDKA 2GCFA 4Y3CA 2XS2A 4N56A 5LXRA 1U1QA 1VS3A 3NXZA 3RBXA 1RABB 3KXDA 1FRMA 1WTBA 1UL3A 1FTCA 3H5XA 3ILJA 2DPJA 1S72S 5KFRA 2JC1A 2KT3A 2CJYB 2Y3YA 3G9CA 3QWPA 2F8HA 1B7FA 1VJQA 4DF4A 3WX8A 3T5KA 1RT6A 3JYTA 2DXDA 4LRFA 1N32F 1GH8A 1WEYA 3GU0A 3MMCB 3U1MA 4ECQA 2IDLA 4I2PB 4A47A 2XGQA 4A8KA 3MZIA 3NBPA 4QCLA 3TUZC 5F8LA 4JI8J 1XNRF 1RLDA 1DTQA 3G8TA 1N6QB 2IM2A 2G9OA 5LMUJ 3VAIA 1NBEB 4L6V3 1RT1A 4W98A 3DLBA 2UXCJ 1RQ0A 4YOEA 5IT9U 3MI7X 4ANCA 1HBNB 1OSDA 3P8BB 4M5GA 4Y6IA 4CQ1A 4GC6A 4HHHA 2IRUA 4R8UA 3PX0A 2IMWP 2HYIB 1CSJA 3GONA 1SCJB 1M5KC 2KFNA 3S01A 3LP2B 2CPZA 4IKAA 1WC0A 5DG9A 1VQMS 3GG0A 2ZHOA 5GMEA 1C0UB 2B8PA 2X3DA 3L9ZA 4AL7A 2UUTA 4LMZA 4ZDNA 5DDOC 1NNDA 1NSPA 3J7ZT 1RYSA 4EU0A 2E5JA 2Z57B 3PRDA 1Z2LA 2FIUA 2VL1A 3M05A 3NAIA 3W2WA 2YX7A 3BH7B 2QMWA 2GZOA 3MTKA 4TU9A 2G0IA 4RW4A 3SSRA 3MM6A 5KT5A 2Q79A 3SQGA 4CTAA 2V4RA 3Q0AA 5D3GA 5EX0A 1MN7A 1Y0HA 1ZS6A 2J7WA 4USVA 2HQDA 4EZ6A 2QN6B 2U1AA 4X4VA 2JVRA 2XC9A 2ATLA 4BC7A 2E29A 3K5PA 1F1BB 5KFJA 3C3LA 2CADA 3HD2A 4KAIA 1NJZA 4RL1A 5DM7Q 1BQMB 4C9DA 2VUGA 2HVIA 3PNIA 2PE8A 1NEEA 1RWNB 5CZVA 4ALZA 1REGX 4CH1A 4I69A 2FHOB 4ECXA 2PEBA 2EBGA 1MG7A 1NAQA 1WF0A 4I6YA 3RRGA 2YNGA 4X84A 3G6ES 2GHPA 3J80Y 1T9UA 5B09A 4J9OA 2XLJA 3CMES 4USMA 2DGVA 4M5DB 4WCEQ 3AD8C 3C2PA 3G86A 2F8EX 5ETSA 3M2RA 4ZLPA 1M1GA 2VG7A 3GCXP 2BOPA 1LFPA 4NYPA 1RACB 1FDDA 4WIQA 4O3RA 2VPZB 2B5JB 4RLEA 3VAKA 4DUYF 5F9LA 5LSLA 4TU8A 1NK4A 2HFVA 1HWIA 4OZNA 3FBCA 2BQUA 4ZITA 2ERRA 4I2PA 3WDOA 2I0XA 3DXSX 3PFOA 3C6UA 5A8RA 4JI8F 4CTAB 5HI7A 2J9DE 5CCLA 1H73A 1BQNB 1HPZB 2DHXA 1HBMA 1KKHA 3IBFB 1FWLA 1MWZA 2XI2A 4ECZA 2QFJA 4WXOA 4OJ3A 3BGOP 3MMJA 4JOUA 4TLQA 2ZNYA 2KHDA 1T9YA 4ZVQB 1JLQA 5DLFA 2DD8S 4K4YA 2W4PA 2KVIA 4NLTA 3OSNA 2UUWA 4FVCA 4O3SA 4F2RA 4DR6F 4DX8H 4X66F 1G6BA 1TL5A 2K1RA 1TL3A 1WHYA 4OZ0A 1W2BR 1JLAB 2NYHA 4JI1F 4YEAA 1FERA 1CC8A 2I38A 2LQBA 1VBZA 4YHHF 3EDRB 3KLFA 2DNRA 3ENVA 3HSGA 1AROP 2D9PA 2FGOA 3A8EA 1R0CB 2VG7B 3X3UA 1HNIB 3DDNA 2R7WA 3C46A 4FYVB 1M5SA 2M9KA 4DN0A 2W24A 3IMQJ 1XIQA 3IO1A 2R8GA 5KFNA 4F50A 1NH8A 2EFQA 3OJUA 3KHHA 1S1UB 1RAAB 2KO1A 2RRAA 3FNNA 4OI0A 5DDQC 2YNGB 3GB0A 3P3DA 3D0HE 2HS0A 3IWLA 3M4XA 4NPOA 3VF0B 2XCAA 1N6QA 2UUCJ 4WFBQ 2O1PA 3PW2A 4ZA1A 2Y8WA 4OHZA 2VPWB 5HROA 1KQGB 3FKBA 2JFKA 3P96A 1QAJA 4M5LA 2KVQE 4X4UA 3A8IA 1YJ9S 4RWWA 2QA1A 1CJUB 2R7VA 2V2KA 3G8SA 2VZ9A 4LRAA 3I0RB 3U27A 2LMIA 3GFZA 4IQXA 5EX3A 4K0KF 1JK9B 2LCWA 2RDIA 3NCRA 1RXOB 3RUBL 4NMXA 3KLHA 2W9BA 4RNOA 4E8UA 2HVEA 4I2QB 3RG6A 4NCGB 4H4MA 2E44A 2W2OP 4LREA 5KOWA 4B3RF 3BO4A 1U48A 2EKYA 3CCES 4UT4A 5F9NA 1Q5YA 3DLGA 5JVHQ 4OIXA 1SL2A 3SZ2A 3B78A 5KFBA 4CLTA 1NU4A 1IKXA 2PD1A 5A8WB 2ALZA 4JI3F 3W2VB 1N54B 3R7NB 1IM6A 1LW2A 3CNQP 1OWXA 3DLEA 1VGYA 2XQCA 5BJRA 1N0VC 3EVWA 5LM7E 3KDNA 2GC8A 2VIHA 1UVNA 2O5DA 3PM9A 4PG8A 3R1LA 2FJDB 1EIYB 3R97A 1FK9B 5DGAA 4OZJA 1QTMA 1PYSB 1U09A 1IR0A 3DLJA 4X4RA 1M1HA 2BJDA 3R1HA 4HH1A 4PPZA 3M30A 4RW9B 5GAHU 1VQ7S 2ZH3A 4UOFA 3TEHB 3QRPA 1S5ZA 1YJTA 2VICA 4U7UD 1HKAA 4X62F 3EGZA 2H51B 3UD5A 4C98A 3M9MB 4KPCA 5CD4H 2B4VA 3LAMA 2KYXA 2ZH6A 1R43A 1Q4RA 2GIRA 3K7RA 2DNNA 3HLUA 4M5HA 2R3VA 2BJ9A 1U1LA 1UJ4A 3QWUA 1ZTTA 1B99A 2VC0A 2HHTA 1D9FA 3C6TB 2HNDB 1YJWS 3HPOA 1Q8LA 4IH5A 1APSA 4KPYA 1N33F 7FDRA 4DFJA 3IXQA 1RHUB 1RAEB 2Q3PA 3PW7A 3EXYA 1UVJA 4C7QA 5B0DA 1Z4UA 1RDRA 2E5GA 4DDFA 1K8AT 4IH7A 3MMAA 4DR1J 1NK8A 2IVYA 4WK3A 2QYGA 3H5SA 1RCOB 3J80U 1YWXA 2MHEA 2E9ZA 1YI2S 4PWDB 3M8ZA 3NOCA 2Z30B 5IXUA 4O0IA 3OV7A 1FKOA 1NSKL 5HL7Q 2B9XA 2CNLB 3H98A 3W5XA 2W01A 3MUVP 3TVYA 4KT0C 2IM3A 5JMNA 4DV3J 2BE9B 4DFKA 5M2UA 3OHBA 1NCLA 2ACMA 3J81Y 4G1QA 2XY7A 4C8YA 2O01C 4BLGA 2R8HA 3RTVA 2XB2D 1CJKB 2GGPA 3UWTA 1UVMA 2VHGA 3LGHA 2K7KA 4ZS6A 3LF0A 2E9RX 2WOMB 1MU2A 2QX0A 1YRUA 4DCJB 2FJVA 2J0WA 4KGVB 1F5BA 4OFZA 4A8QA 3QJPA 2XSJA 5L46A 3PRBA 4I4BA 1KFSA 4ZK7M 4IOBA 2LDYA 6AT1B 1HBOB 1WC1A 2VFTA 1B0PA 4UZCA 2IBKA 1UAWA 1WWHA 1N88A 2L9NA 3MWBA 1YSJA 1RWOB 1JLGB 1XR5A 3KLGB 2I5JB 2JSXA 2JH3A 3HMJG 3OFGA 4NEYA 4C8OA 2LXIA 2KN4A 4ZVRB 2XULA 2DHAA 3CT9A 3LP1A 2YKQA 4ZVHA 4JV0A 4QWDA 3SYZA 2W4DA 4UY85 3LPEA 1JNRB 2DXEA 4YDDB 5EWFA 3I4HX 1QUPA 2PT0A 4KB7A 2JLFA 3G87A 5JVGQ 1TFWA 2IJRA 4DU8A 2GJFA 2HURA 2CIMA 2YNHB 2XWXA 3PCOB 4ES2A 4C2MA 3K5MA 5DRKA 3V6DB 1J5OB 3KG1A 3MEKA 2L9DA 2RKIA 3UD3P 5J2QA 5B0AA 4OHVA 3T6BA 4WFNQ 1PO6A 3KK1B 4OYWA 5C42B 2ZH8A 2MZJA 4KV8B 2BE2A 3VGTA 1Q16B 3OUYB 2P8IA 5KFCA 1LW2B 3DLEB 4K7QA 3IGVA 3D5MA 4DSLA 3A4TA 5IT0A 2CQ2A 1T03A 2OPRB 3M2VA 2GS8A 2EC2A 1HBMB 4RX6A 3PO4A 4LF6F 3P45B 3FFIA 2DNQA 3GV5B 4G6VB 4DV7J 4B9LA 3M2VB 4CLLA 3QLHB 2HVHA 1UA0A 5LSRA 4RW9A 2NPFA 4UOGA 4DV6F 3NMRA 3MPWA 2GJIA 3DU6A 1NHVA 4B9VA 3OL6A 2VQFJ 3PVXA 3U7JA 1FKAF 2G2ZA 2HFNA 1X9WA 1D1UA 1TL7A 3OXLA 1D09B 1SJ4P 1VISA 4IRKA 4X4SA 5IT4A 2P9CA 2ZD1A 3OVAA 1V5VA 1LWEB 3UCGA 4NLVA 2OPQA 4CO5A 2DISA 4FPIA 2V4QA 2WHOA 2BQRA 4IO9Q 4PRFA 2C2ZB 2ZBPA 4DR2J 3DMJB 3BYPA 2HBYB 3L95X 3DOLA 4I68A 1RSCA 4IOAQ 1WD6A 1RT4B 4IFYA 5I3UB 3G2XA 4LVNP 2YQ0A 5A0YA 2DHGA 3Q83A 3TQEA 1JWWA 1AA1B 1QJHA 3CJ2A 4KSEB 4WYWA 5ETVA 4QZVB 3CC4S 1M5HA 1N36J 2RHSB 3H42A 1OO0B 3IC1A 5KT2A 4E98A 2DR6A 2P6TA 4ED4A 1HHSA 2HNYA 1EKRA 3JQKA 4J9VA 3LW5C 5T7LA 4LUBA 4ZIWA 4N8OA 3CUNA 3JB9k 8ATCB 5KFDA 4B9TA 2BJ8A 1UCNA 3M9NB 2HRYA 1VBKA 4PWDA 1QSSA 1YHQS 3K0JA 1HARA 4BHQA 4LF5F 1SXLA 2EBEA 3TA2A 1YRTA 2JRSA 4QIFA 1S4FA 2QL9B 4Y2CA 4DUTA 2W9CA 3JSBA 3PTWA 1FWPA 1L3KA 1S1VB 2BABA 3K2YA 4TN2A 5EUHA 4URGA 4NXMJ 4G1QB 2K3IA 4DV2J 2CPIA 2NXEA 2DHHA 3GYXB 4JYAJ 1VOMA 2DNLA 2VPXB 1U2FA 2O3DA 3B6BA 3POTA 1F6TA 2HQ3A 4ZP8A 4CLWA 5E3PA 2P2CB 3DXBA 5ITHA 1FCAA 2KH9A 1GXUA 4HVZA 2BW2A 1C4AA 3AQOA 3UR3C 4TQSA 2VBZA 4K2XA 4TXSA 3HKWA 4KH1B 2E7XA 2AYEA 3DOKA 2A10A 2XO7A 2XSJB 1UZDA 5K8NA 1XWLA 2B9YA 1RTHB 1ZA2B 1RTIA 1SUQB 2Z2LA 2RRBA 2ZE2A 2W1BA 3BKTA 2ZWOA 3N6LA 4GKKJ 3OR1B 4JI0J 2HFZA 4GRSA 2V34A 1I1GA 1RHRB 2AJ2A 2LVWA 2FYXA 4M5DA 4UW2A 3T1AA 2MSSA 3UN3A 5K20B 3OR2A 3W63A 5DM6Q 5KG5A 2YWEA 1AZSB 1Q53A 3CCVS 1NPPA 2UV8A 2ZJRQ 1NXIA 3DGPA 2RSQA 1YJNS 4PKDB 4DV4J 4LIRA 3R2DJ 4RNFA 4ZPVR 2AP6A 2ALYB 4WU2A 2FHJD 3VCDA 5GAEI 3IP0A 3UDCA 3KMQA 1N5TA 1FXDA 2HLUA 3OFHA 2QT7A 4ETZA 5H9EK 4N5SA 2NREA 4OX6A 3OQ2A 1R8HA 3OJSA 1BLUA 5HJXA 1Y9OA 1YBTA 4KV8A 5KT7A 3OUYA 5HSPA 3O2IA 1G4CA 4I6WA 4R5PB 1P9YA 1SB6A 1QSYA 1UW4A 1QLNA 3JSMB 4DR3F 2KHCA 1X8DA 1AUDA 1T7PA 3OVSA 3GCWP 4J9SA 4F4AA 5GAHI 3SI8A 4KGKA 2D3ZA 2ZH7A 2V67A 3DLKB 1DAXA 5ETPA 1NUEA 1LW0B 2GQQA 5DQGA 2R7OA 1B4SA 3VGUA 2ZOGA 3HHLA 6FDRA 3VAJA 4ERDA 1BWEA 4QYZJ 2CJBA 1HA1A 2Z0GA 3MF5A 2ZH5A 3GYNA 3TJAA 2NXCA 4ZLNA 1S97A 1RI7A 1AZSA 1EARA 4WE1A 2MLZA 3FVYA 4M5JA 3Q8SB 4WKRA 5E33A 1LFWA 2H48B 3VTIA 1T8EA 2YPYA 4DLEA 3H20A 2BYCA 4CH0S 1VQ6S 2CNKB 2JWNA 5C25A 4JI5F 2COLA 2P9EA 4M5IA 1MU2B 3Q2SC 4CH7A 4ELVA 1JJ4A 1KONA 4JP8A 3BGUA 4HTJA 2CJKA 2YKNA 2MHNA 3CD7A 1R31A 1RTIB 1TV6A 2F3JA 2R4FA 2MLYA 2HRTA 2ZE2B 3D9BA 3IAS9 3IM8A 2WVBA 2VKZG 3W65A 2VJVA 1HNZF 1IBLF 4PCQA 4DPUA 4YB7A 4RNNA 3NCQA 4L3NA 4EMDA 4TYAA 1KP6A 2UUBF 3C14A 2I5JA 4NXNJ 1FFSB 4P2MA 3PO5A 3JQMA 4FNIA 4OZ1A 2EW9A 2HWHA 2PGCA 2CDRB 1HL6A 3Q22A 2DRAA 2ZZMA 2NYIA 2XMWA 5E3AA 4MK7A 2P9GA 3T9ZA 1H98A 4MKAA 3HT0A 3IRXB 1C1CB 2VFUA 1FRKA 3NGTA 1JLCA 2DY1A 1HHQA 5A2QY 4DQRA 1RT7A 1S1VA 2OSRA 3NG8A 2AEMA 2PEHA 4MK9A 2UVUA 1GQEA 3K8WA 3J81j 1HWJA 4DX5A 1RE1B 5FLXY 1FNOA 1U0SA 2EKNA 2GVDA 3SSQA 3GFYA 1P6TA 1R7IA 3TW0A 5GAGU 4ICLA 4OX9J 4L74A 1FJEB 3NNAA 5M2RA 2W25A 2YH0A 3IR5B 2YNFB 4EK2A 3K58A 2YVSA 2XHWA 1H2TZ 1T05B 2PDAA 4KGXB 3KHLA 3G82A 4FNHA 1TMMA 1VIXA 2NXJA 3IAM9 4LF2A 3B82A 3TAMB 5D6GA 4P10A 1XR6A 2CG4A 4W90B 4ZCKA 1FDNA 1JMTA 5L8RC 2IRXA 3M8YA 1JKHA 3HHKA 2ASDA 5J1PA 2M5YA 2MZRA 3M32A 5FDLB 4CLUA 1SVDA 1OQ6A 1RAFB 1GMVA 3EDQB 5F8IA 3WC0A 2VKRA 2ZITA 2UP1A 3S7RA 5KG0A 4ED2A 1TL1B 1S59A 1YJ7A 3OTEA 3SMZA 4IYQA 1N36F 3HK2A 4ZCMA 4KHPF 3HX9A 1JQGA 2DGUA 5K5MA 4XIUA 4O0NA 4J9MA 4DV7F 5AE2A 3MURP 3LPYA 2V2ZA 2HNDA 4AL5A 4H54A 2YNHA 1HR0J 2LP4A 1VC0A 3UDEA 4YR2A 1X4HA 1DLOB 4MIBA 5IQ6A 4C8KA 3OTOJ 4DSFA 5I3PA 4F25A 3FRZA 4HH0A 3NNHA 1U6FA 3N6MA 1QUVA 2CQIA 3DRPB 2X3GA 4D3GA 1DTTA 3EUNA 4KKOA 5LJ5Y 3U1LA 1Q78A 3HZEA 1Q8IA 5F0WA 4CO1A 4KKOB 3FBBA 3OTDA 3PHTA 2JNJA 3JSMA 3LP1B 4KC5A 1VRTA 1RZMA 2MQNA 4I7FB 1T05A 2L9WA 1PBAA 5ETTA 4F26A 1LXNA 3R5DA 3SFUA 3BGLA 2HMIA 5DS7A 3Q2TC 2XMTA 3WZ0A 3IBWA 2C3PA 3ET6A 4CLPA 1U8SA 2GVDB 1DY3A 1F60B 5FDLA 2LKZA 1S57A 2HPUA 2C3YA 2ZVIA 4RW4B 2ZM6J 2C2KB 4Y00A 1NO8A 1VQ8S 2HQIA 3MEDB 3PIPQ 3CULA 2J0SD 1GMWA 1IKXB 4PXEA 3DCAA 2UXBJ 1AYEA 3PYEA 2RRNA 4ZJOA 3TI0A 1M90T 4FF1A 2XMAA 1RWUA 3FRYA 2QTWA 3TA1A 3HVWA 3PG9A 3DRRA 3OXGA 4S0MA 2CVIA 3DOMA 3TZYA 4DL4A 3DRXA 4URSA 4M1KA 1YZ6A 4C97A 3L09A 3OL9A 3THTA 2DT9A 3SCLE 3BV8A 3HXMA 3D68A 1CEZA 1U26A 2I9SA 3E01A 5D4OA 2Z2ZA 3CTRA 3D6HB 3BPSP 4JI4F 2FY1A 2UV8G 1HFEL 1QD1A 1RAJA 3TVZA 3VZIA 2FJBB 5HLFB 2FHKA 4FF2A 2QLBB 3C15B 3ZZYA 4OI6A 1UWAA 5T7LB 3VWSA 4K4ZA 2XHCA 4ED1A 1ZETA 3U1NA 1WSRA 1N52B 2IRYA 2J5AA 3C66A 1RP5A 2HHHF 1H2UX 2QGFB 4DPTA 3GIMA 1O8BA 3K89A 5KG3A 1IBLJ 2WSFC 2HMIB 1IM4A 2KTQA 2VODA 3M8QB 3CCTA 4OLPA 3S6EA 4DR5F 5KG2A 1VQYA 1P27B 3DMJA 4U96A 3HM9A 3KNGA 2DGXA 1RBLA 3V6JA 2AQ4A 1RT4A 5I3UA 3ULHA 1OMSA 1CPZA 3I55S 1NLKL 3ENAA 1N33J 1BQNA 1HPZA 4ZPBA 2XZDB 5JUMA 5EGYA 2VBYA 1K0TA 2VG6B 1WKKA 4TNOA 3NRBA 3PJWA 3SDEA 2KU7A 2EPIA 5KFHA 2QZ8A 3LA0A 4G3IA 1BWVA 1LOUA 4ZVFA 1NK6A 1OQ3A 3OLAA 1FTRA 1WI8A 2N4CA 4J5OA 1SV5A 5IQQA 2DPIA 2GQ2A 5EWEA 3MM9B 1IBKF 4PXDA 2DHSA 4DN9A 4PXCA 4Q45A 1LW0A 1S49A 1EQMA 3HSJA 2CVEA 3MDFA 4UUWA 2LQ5A 3UDLA 4F4YA 1VRQC 3SCKE 2AGQA 1TTHB 4JI6J 4GKJF 3DN9A 1GK8A 2HWTA 4FYYB 3KHRA 2D7SA 2B7BB 3H2UB 3UI3A 5HQLA 2A6OA 1RWPB 2Q1LA 2WONA 1V3ZA 4W92B 3X1LB 2B43A 3AY0A 4RU9A 3CCLS 1KVJA 3IG1B 5KG6A 3LAKA 1L3UA 1C4CA 3BKFA 2G2OA 4J90A 2LXFA 2DBBA 2KDOA 1Q79A 2RF2A 1RLCL 1HYSA 2HZCA 2XSFA 3DDKA 4O23A 2FLNA 3UCUP 1KDNA 2GX8A 1DTQB 3D4JA 1BHNA 4P2FA 4QBUA 1SUQA 4Q2LA 1NKCA 4LBHA 3HKZD 3SEOA 3UCZP 4ZMMA 4XPEA 3T1HJ 1YBUA 1YG0A 3ZZRA 2HHVA 5HAOA 2XNQA 3SV3A 3KYLA 3MCNA 5CD4A 3GWCA 4Q2MA 3Q8YA 5CZXA 2CRLA 1FFWB 4PQAA 2FC9A 2KJVA 2HQGA 4DL3A 4B9UA 4JI2F 1S76D 4ECWA 1DQAA 2Y8YA 3W8PA 4GKKF 2IBOA 3MOZA 4RWXA 5FIIA 3UQSA 3PJ9A 1U1PA 4JI7J 1P1TA 2DIVA 1S9EA 4P71A 1M1KT 1CJTA 1GTHA 4DZ6A 4F0HA 3BSNA 3ITHB 3ZTQA 3TZZA 2ZUGA 1C0TA 2IAJB 3O6QA 3DDIA 9RUBA 5KT3A 1GMUA 4C0BA 3MFHA 3MAQA 3D6MB 4CO2A 5M2PA 1SKUB 4TU7A 1M5PC 1YTYA 2WK4A 1HNIA 3FSXA 1FJGJ 3EMTA 4KYZA 3CGIA 3GJTB 2E1CA 4DV2F 3GIKA 3C19A 2I2YA 4WKYA 3KMSA 2WOMA 1FE0A 5KFFA 2F5GA 2CWKA 3MHYA 4WYLA 1U49A 5GAGI 5KFUA 1R8PA 1T95A 1YJRA 1NPRA 1HNXJ 4C8MA 3DI6A 4C0OC 3PR5B 2X1GA 3T41A 4U95A 5CABA 4JI2J 4QU7A 1ZYQA 2G4BA 3DYAB 2AT1B 1QAXA 1PAEX 4NX9A 3QSIA 2E1AA 2KT2A 2WCXA 1LWFB 4KGZB 3H2VE 1D0EA 4DR6J 1REVB 2XTJP 2RDDA 2WVEA 3KJQB 2RQKA 4ZCLA 2AJFE 1NDLA 4RUAA 2ROGA 4TY8B 3ZZ0A 1XERA 2N7YA 4B9MA 4DQPA 2B5JA 3FBFA 4PWUA 1X31C 1Y7PA 3G6YA 1TL3B 1RHMB 2RS2A 3FDSA 1KLNA 4ZVUB 4ECRA 1U1OA 3I0SA 4NI2A 2DGTA 3MAAA 1IN0A 2GIQA 3FK4A 4B9SA 4HI1A 1DQ9A 2NZCA 3JXOA 1TKTB 1F3VA 2MKYA 1JIHA 3MD3A 3W1YC 3AA9A 4X2BA 3D1QA 4EBCA 1GX6A 2VD3A 1WF1A 4KO0B 4MK8A 4QW9A 2ILZA 1JXEA 4DUYJ 3FFIB 1KSPA 5I42B 4K4TA 2YX4A 3TVKA 2QSWA 4JI6F 2ZDPA 3DLKA 3CJ3A 3PZPA 3MPVA 4L73A 3CJ8A 4USIA 1GXTA 3VV2B 1ITPA 1WOPA 4RW7B 5HVHA 1RAHB 2KRBA 3FMBA 2XS7A 2KZMA 4NA3A 1LQ9A 5G0RA 3CD6S 4DR4J 1X5PA 4QW8A 3M30B 4ZPTR 1N48A 1KN6A 3EPIA 3MECA 1FJGF 5JXSA 2J8AA 2XWYA 4X4PA 3ENWA 3SIPB 2XMVA 2NSCA 1HWUA 5E3QA 4IR9A 4DG1A 2OMLA 5CA5A 2WBMA 2JL9A 3CW2C 3QFWA 3ZO7A 2PSZA 1SJRA 4A8FA 4RBVA 2D41A 2XMKA 3CCZA 3KJNB 3SBMA 1TUVA 3RU0A 4ZPWR 1FJCA 2RQCA 3QPIA 5DG8A 3BH6B 2F9DA 1W2IA 4LQ3A 5B0FA 3MAAB 3O1LA 3W60A 2C2MB 1R3NA 3C14B 1RT1B 2BANB 2HHHJ 3E3XA 1YX2A 2VBWA 4FYXB 3W5YA 5B0EA 1BGXT 1WG5A 3ZZTA 4CO0A 3EXCX 5MAOA 4EBDA 2C2RA 1CJUA 4ZVPB 2VH7A 4M8LA 1FEHA 2I1RA 1H74A 4YP3A 5L1IA 1AFIA 1N5VA 1T9TA 3IR6B 5FJ4A 2CQ3A 3T3FA 4OJ1A 2OPPA 1RT7B 2NLWA 2R8KA 1S7IA 5A6WA 4GO7X 5A8WA 4XK8C 3PX6A 3RB6A 3D7SB 3W62A 3CD5A 3M2UA 2KB2A 4O4GA 5C5JA 3BDPA 3POTB 1S6PB 3KLVA 2VONA 4QIWD 3D6TB 2HBQB 1VC5A 1U1KA 5GAEU 1TELA 1E6YA 3R5AA 4A46A 1RTJB 1FHTA 2RS8A 3B4DA 3ILOA 2JOQA 2OEMA 1OPIA 2ZZTA 5IC6B 1TV6B 1WSVA 5B0GA 5KG7A 1FKPB 1SC6A 4CYUA 2MXYA 1AB8A 2MQ8A 3EVOA 1I3OB 2VFVA 1CVJA 1RAIB 1XR7A 4FF4A 1VBYA 3MR3A 2ASLA 1WJ9A 5C7PA 4K2JA 4N8NA 4F4XA 1HNWJ 1WTFA 1WDDA 3M2RB 3R7BB 1A7GE 1VQKS 2EI5A 3NEKA 2N3LA 2H5EA 2WVFA 2PMZD 1WDTA 2VFSA 1YLXA 2E66A 2Q43A 2FZGB 3O8WA 4BC9A 5L38A 3LGMA 2CDQA 1XMOJ 3LUYA 1YK9A 2LEAA 3JSYA 3TJ8A 1TMJA 2MZ1A 2QLXA 3K59A 4B17A 4FYDA 3PRVA 4C11B 2MLXA 5B7WA 2DR9A 2J8SA 3DRPA 5FLXU 1R0AA 1HR0F 1HBUA 4NWBA 4USHA 3KLIA 3CDEA 1HQEA 2ZZNA 1FVSA 3RBEA 5LJ3Y 3ILIA 1XNQJ 3K17A 3QAEA 4WFZA 1P9QC 3KK1A 4LF1A 3R5JB 3H25A 2KZZA 2FVQA 1MN9A 3M7VA 4NLGA 4OX8A 1VRTB 4I7FA 3W64A 2H4YB 5H9EJ 2PFFB 3MEEA 4Y2AA 3S8SA 5AXNA 4F4ZA 5C2CA 1BUXA 2Y0BB 3VAMA 2D9OA 4DLGA 5AXLA 3QT5A 1SC1B 1IUJA 2EC0A 1VR6A 1FRLA 1UZHA 2PA3A 2YWWA 3QLHA 2EFNA 3T5LA 3PW4A 1EHWA 3M8PB 3B8HA 3MM9A 4K4UA 4P73A 2RIJA 3I5CA 3TO8A 1J27A 3BO3A 4LF4F 1HD1A 1KOOA 3DM2B 4O3NA 5C42A 3B54A 3NLCA 2DH8A 2M70A 4MFBB 4Y65A 3HVRA 2CJQA 2WAQD 4G1IA 5F0UA 4ECVA 4LSNA 4AL6A 2KI2A 4FZVA 5IWAF 4MFBA 2UVWA 2YNFA 3GSIA 1HBOA 2ZWPA 3I32A 2VJUA 2WW4A 3GIRA 1PJ7A 3A8JA 4WXWA 1NJYA 1QAIA 4K4SA 1FKPA 4CYUB 4DI6A 1FNMA 1MROA 1UP1A 2HFSA 4RW8A 3MEGB 1R27B 4AE5A 3H5YA 3EYZA 3KNAA 1QY7A 1CBKA 5KFWA 5KFOA 4X4OA 2B4OA 4NLUA 2MTLA 4U8VA 4WWSA 1N8RT 1M0SA 2V4JB 2PI4A 5A2QU 2PIIA 2NZ4A 4NRTA 2CQDA 2IC3B 1SL0A 3TRGA 4KR0B 4FXWA 1B0VA 2FJWA 4OZ5A 2GMJA 3GSDA 3IBCB 4I1TA 3NY0A 3WX4A 4U67Q 2OELA 4CT8A 2ZH4A 1RA6A 1WG1A 3HSDA 2E5LJ 2RNEA 5KFKA 3JQJA 2HFUA 1RT2A 4OJHA 4M5NA 1FEEA 2ACYA 3P5BP 1L3VA 3IS9A 5L39A 3PKMA 2APOA 2ZOMA 5IM0B 1VQPS 1IKYA 5L1LA 4J9NA 2CNNB 5E3RA 2RH3A 3AAWB 2KXNB 4NLDA 3DRSA 1B64A 4PG4A 2A1BA 2HHUA 1LNQA 4OYZA 1S48A 3DRRB 1R0BG 4A48A 4EFAC 1Q81T 1U1RA 3G71S 4ZVOB 3O3LA 2BVZA 1RUSA 4X66J 4EWTA 3EICA 4DV1J 1TR0A 2WBRA 2W2PP 3DKDA 4HACA 4WP8A 4M5MA 3C16A 4LFCF 2RHQB 3ZZOA 1S0NA 4Y2MA 4X4QA 1W26A 3TUIC 2OKQA 4DHVA 1H38A 1IBMF 1KRPA 2OTLS 3UD4P 2ZFHA 5DETA 4OX9F 1TL7B 1FVQA 4LSNB 3BYRA 2IPOB 3RB3A 4B3TF 3GV8B 2HK2A 2QFIA 4DSJA 4LR7A 3CE8A 1U25A 1Y5NB 4DL0C 1QTNB 1X60A 3ELHA 1QM9A 3M6XA 3LWLA 1RT3A 4DSEA 2FVSA 3AXKA 4FDFA 3MOJB 3VGSA 2RVJA 1HYSB 3KJVB 5KFPA 1FDAA 3KLEA 3M6VA 2XYGB 2EFVA 4EO8A 1UEVA 1KOHA 2ROEA 5ETOA 2MZQA 4FXVA 5KFXA 2AW0A 1RTZA 4UTGA 2ZH9A 5D4LA 4UQGA 4NCBA 2FY8A 4KO0A 4KHRA 1U47A 4OX7A 1VHIA 2XMUA 4E0DA 1FX4A 6FD1A 1U24A 4USTA 3MCMA 4QYRA 1S12A 3RYLA 5K8OA 2R2TA 3PV8A 2BM1A 2CPEA 2J9EA 1O51A 2B3TB 2AZ1A 3QIDA 4G1PA 2BKOA 2FTRA 1M5OC 3L7UA 3LANA 2MZTA 3K5OA 4D3HA 1CJTB 5HVFA 1HMVB 1LWXA 2W7OA 1UFWA 3CCSS 1Q7LB 5HMYA 4JI5J 4C8ZA 1PJ5A 1HI8A 2ASJA 5CXTA 1X5TA 2VBXA 3W2VA 5CCMA 4JB8B 3A8KA 4CP5A 2R2UA 3KK2B 4B3MF 5E3CA 1WEZA 3R5CA 4R25A 4UQTA 4WFYA 2UUAF 4USUA 3R3TA 3QGIA 3DGVA 3GFXA 2EG1A 3NS6A 4DCOB 1MMNA 1Q95G 3IFEA 2LEBA 4FVMA 1X0FA 2B6AB 4NXMF 1WUUA 3LP0A 3G82B 4DR1F 1SBRA 1K47A 2AD9A 1NZAA 1AT1B 1IJEB 1C2PA 2VPYB 3UW1A 5A76A 1ROFA 2QE5A 4DV5J 1UFKA 4F0MA 2UVVA 4AYBD 3BREA 1X4BA 3CWJA 4LF5J 2LU1A 3BB5A 3CO9A 2E1PA 2JLGA 2CG8A 1NJWA 4WTYA 4HR2A 2MKSA 3G6VA 1REVA 1AW0A 2DNYA 2AJ0A 1RAGB 2DYAA 3MR6A 1PGZA 4U9RA 4IUFA 2ZC4A 4F4WA 2C3MA 3LP2A 1SH3A 2AYBA 5F3ZA 4JV1A 2E7WA 4KBIA 1PKUA 2AX1A 4PYAA 1XNRJ 4ZVEA 4YS2A 2KKHA 4JUZA 5DDRC 3I96A 3QQCD 3BZQA 2YWHA 4C8NA 5LT5A 1UPPA 1TKZA 3MM8B 3VHQA 5BR8F 4RZRA 2VA3A 1WI6A 2UXDF 5A8KA 4ED8A 1ZAVA 4UZBA 4NE9C 1SJ3P 4ED7A 1ZTWA 4BCAA 2FHMA 4Z2XA 4UY8T 3A3PB 3NS7B 4U7CA 1MNEA 3CEDA 4WJBA 1SPBP 4PYDA 2CPHA 1IKYB 2CFXA 4BDPA 4Y2IA 3IRWP 4KHMA 3LQVA 5BYSA 2A2DA 5E41A 4CT9A 2GHWA 2RB7A 3NGUA 1FRIA 4JI0F 2VQFF 2LA4A 4XDDA 2BEFA 4ID5B 5AXMA 2OSQA 1IWAA 3M9OB 3RAXA 3QBCA 2AF6A 2VQEJ 1F5CA 2YQ3A 3RGIA 2R7SA 1S9GB 3M8SA 1OYDA 4DV6J 1XMQF 5K14B 2HKEA 2V69A 3C8YA 4OYIA 3BSCA 1L3TA 1S9EB 3PW5A 2M8DB 2I6WA 4DU7A 2YKMB 2AIRB 3HSZA 3UDVA 4M94A 3ICLA 3HHLB 3KDOA 1B70B 4I6AA 4O4GB 4FF3A 1YRXA 4NZ7A 2B8QA 2BJ7A 5HK4A 3KK3A 1JXLA 3AOCA 3WIUA 2DNOA 2EWHA 1YIJS 2MKIA 3H2LA 2VG5A 5THWA 4DQSA 4JYAF 2E7VA 2W4CA 4P7VA 9ATCB 4MKYA 2XMMA 4PQUA 2NUHA 4NCGA 4LSLB 4C3MA 3LGNA 5DLGA 3EZUA 4OZ3A 4DOZA 4X4TA 1IBKJ 3UVJB 5D0RA 2JEFA 4PUOB 1X5SA 1NK5A 1Q0NA 3D1OA 4IRCA 2G0JA 2CJXB 3BBCA 1DLOA 3RAQA 2MKKA 2XNRA 2HG4A 4NCAA 4URQU 2V8DA 3QMQA 1SKWA 4J37A 1FESA 4K5SA 1F9HA 4KFBB 2N7CA 4KTQA 4NLPA 1G2EA 3ZNJ1 2J6TA 2BDPA 2F4VF 2VOPA 5KOXA 2QC3A 1TL1A 5J2PA 4ZVSB 1VQSA 2MEWA 4E2FB 5I42A 1NKBA 2Z4PA 1LK7A 4FN5A 4HHUA 1GX5A 1CQMA 5J1NA 3CD0A 2F65A 3AQPA 1B3TA 3GYGA 3CO0P 2QL5B 5L9NA 4EYIB 2YNIA 3CDAA 2NCKL 1FD8A 2BUNA 3M8QA 4H4MB 2E5IA 2R7RA 2Y1IA 4QR0A 4XDCA 3QT8A 2ZHBA 1JNZB 2EK1A 2G0CA 2OI2A 4CLSA 2W9CB 1TVRA 3FMWA 4V1Ak 4DR7J 3PY8A 1NPKA 1HBUB 2HLTA 1VFJA 2VV5A 1DHMA 3SQGB 4DX7A 4B3OB 2KL8A 5DDPC 1RU2A 2OPSB 4Q44A 1BY9A 2GAHC 2RDJA 1ZH5A 4AXIA 4WF9Q 4NLYA 4PQUB 3RRKA 1FA0A 4QPTA 5L9XA 4YDXA 1NM2A 3TNVA 3TUJC 3TWZA 1JKHB 4P9SA 4MAKA 1R8BA 2A3JA 2G1DA 4DV3F 2CQ0A 2QL7B 3PYFA 4B3SF 1XBWA 4N47A 2XYPB 1FX2A 2HNZB 1NMEB 3MGJA 1X4AA 2JVOA 4PG5A 4KFBA 3AOBA 4ZVGA 5BYRA 4ZLLA 5CYJA 3J81U 3BJYA 4WZMA 1IR1A 1KS2A 3PIOQ 4L72B 2R7UA 3CJ4A 3BQ2A 4U6PA 3I56S 1HBNA 1O5JA 3CCQS 2DVIA 2HZAA 2V5HG 3KUGA 1RWWB 5F8HA 4KIAA 1KVKA 3FQLA 4C0HA 2W8KA 4DWIA 1ZAXA 3HJFA 1LWEA 3W9IA 4C3LA 3HULA 2EK6A 3CIZA 5DGBA 3HHLD 4RNMA 1FDBA 4J9QA 2MQLA 3L7PA 2F1FA 1KEKA 3GJSB 3QT7A 1NDCA 2OUGA 2X1BA 1NDPA 5CYQB 4DBQA 3MMCA 1NRKA 3PKYA 2DRDA 1UEUA 3GR1A 3NWGA 5F8GA 3BDEA 3NS5A 1EX8A 3MM7B 3MR7A 4IFYB 3R8YA 5E0OA 3N9UC 1CLFA 1JLBB 3J7YU 2C42A 5DQIA 3ETMA 2BJEA 3CCJS 2V8VA 1Z2ZA 5IM0A 1VRUA 3OFEA 4P2XA 4DS4A 1SC3B 2K06A 2IYGA 3H90A 3RW6A 4ID5A 2FJXA 2W7AA 3DRSB 1FKOB 4QYZK 2MY8A 1T03B 4KQZA 1YGYA 3W61A 1RKIA 4C48A 4O3PA 3ET6B 1AUSL 2UVRA 5LXYA 3ISND 1WORA 1QAYA 4WIIA 3UN2A 1D8YA 1YVFA 3DHXA 4QWBA 1NSQA 1TK8A 1ZZFA 4EGLA 3F44A 3MECB 4LR9A 2MJUA 3W7BA 2MSTA 2KRRA 4CO4A 3P4UB 3SFGA 1NJIT 2C2DA 1VQOS 1O6XA 4RUBA 1DQ8A 1NH7A 1V3RA 4WE1B 3V4MA 3CVKA 2FDNA 2FVCA 5CH7B 5H9FJ 3PX4A 2DO4A 1Y5LB 1L5UA 2M2BA 4LFBJ 3PYGA 3JTNA 4Q5VA 4ZHRA 2JJ4D 2P5VA 2ZH1A 1DRZA 4UF4A 4AQYF 1U0HA 2PO4A 2W2MP 1UMJA 3N28A 4CLFA 3CJ5A 4O4RA 7AT1B 1I94J 4FBUA 1D8ZA 1I5OB 2AEJA 3A3OB 4PPDA 3O44A 1FJ7A 2XY6A 3H40A 4NLSA 3I9ZA 1JJHA 2BE2B 1SIWB 2DITA 2CQ1A 2PMWA 3DC2A 3EGNA 3NGKA 4H4KA 4OJGA 1VIOA 4NL5A 1IWGA 2FLLA 2BZ2A 2OJ3A 2FUG9 1UJ6A 1N5YB 4PG7A 2CYYA 1ZM4A 2GJ2A 2IM1A 3BKUA 1TUWA 4NASA 1PC4A 2CWXA 4I64A 4RNHA 3CXCR 2V94A 3I0RA 3UR0A 1SQGA 1S1WA 1HNVA 3W2WB 3DHWC 4F0KA 4IG3A 4J91A 4K5RA 1XJWB 5F8JA 2VU5A 1JLCB 2BX6A 1A0OB 2HIYA 3M8PA 4HEA9 3EZ5A 4WZQA 2OO4A 4ZIVA 3VAGA 3R5BA 2FZCB 5T41A 3W8GA 4A8OA 4BBYA 2FJEB 4X64F 3QGHA 2ZOFA 1HMVA 2ZEJA 4H4OA 2DTJA 4KHPJ 1SQEA 5L1KA 3D6FB 4PR6A 3I31A 1SKRA 1DJ0A 5AJ3J 4TY9A 2DB1A 5KFTA 4K4WA 2XZWA 1FI4A 3PACA 7FD1A 3J7Z5 1TK5A 2M52A 1S0MA 2H4WB 4J9RA 3OT9A 2PMHA 4F8RA 5J2MA 4B08A 4XPCA 1T9VA 2CZ9A 5D0GA 2A0FB 3HHLC 3ENQA 2F9JA 3GJRB 4OI1A 3I9V9 4KE5A 4DPXA 1ZM3A 1TKXB 4A8SA 5KFSA 4HACB 5BYQA 4R0JA 2AJ4A 2R2RA 2ZH2A 1H2VZ 3VR1A 2XO6A 3DYAA 3Q8VA 4QPXA 3FEZA 2QA4S 1C0TB 2IAJA 3OBIA 3KUEA 3VQTA 2F7VA 4YR0A 2V50A 4AXJA 2PFDA 2GO8A 1T9WA 3V6KA 3QJJA 4A8MP 4JI3J 1LV5A 3ETOA 3OR2B 4I2QA 2ZVSA 4IDKA 2HEKA 3MTJA 2CPYA 2W9BB 4WBFA 3DOLB 1GMWD 5KFQA 4NA2A 2YKNB 2XGPA 3HZGA 1VQ4S 2W2QP 2GMLA 4GVBB 5EHHA 1MMLA 1S10A 4QIVA 4YB5A 4ZLJA 3V2UC 1Q8BA 5HROB 2NXUA 5U47A 2W7PA 2YX1A 3FCHA 5B08A 1Q82T 1N5YA 1X5OA 3AFGA 2D3O1 2LLZA 2J7KA 4LRCA 1JLQB 3OFFA 1N4LA 2XI3A 3UN5A 2WZ1A 3E51A 1IXKA 2AGOA 2X1AA 5HP1A 2LYVA 3GZ7A 4QWCA 2G2YA 2YKPA 2MYFA 1SIZA 3CPWR 1MLAA 3BF4A 3KHGA 2AYGA 1OS5A 4EZ9A 5B0CA 1HNVB 4RBUA 1BXNA 3PR4A 4LF9J 3TZWA 2CJ9A 4Q0BA 1U8WA 2WW8A 1N5QA 1W7WA 4LFAF 2KT5A 3DLGB 3KLFB 4KJIA 1YKWA 3MEDA 2JC0A 3TJ9A 1NJXA 1K0VA 2CNOB 5J2NB 3TZXA 4HDHA 1GTEA 2CPJA 2CQGA 4CLYA 4ES1A 5RUBA 1S0VA 2B56A 1P8GA 2E1MC 3FZ2A 1PC5A 5ETLA 3PXGa 3WIVA 4Q8EA 1F2GA 2AHOB 4YHHJ 4V19J 1FXRA 2K8GA 2WVDA 2LECA 5CQGA 3ILLA 4MT1A 1KLMB 2K7JA 4OI4A 3FSIA 1N5SA 3Q89A 3LOUA 3GV7B 1U0HB 4MIAA 3UO0A 4OHXA 2YH1A 4ED0A 2QMUB 2YKAA 1H72C 3MFIA 1XNQF 3HHNB 2AX0A 4NEZA 2AZ3A 2GAGC 4QWEA 3WC2A 2Q6BA 3I4PA 1H7XA 2V6AA 3I82A 3OXFA 3EJMA 2E1RA 3QGGA 5ADZA 3R7SB 3BGRA 5IZHA 2BV3A 1PJ6A 1SI9A 2GIFA 2AMCB 1PYOB 2MKHA 2OFGX 2POKA 5DQHA 3RBDA 2NR0A 2MY7A 5K9FA 4ED5A 3BN4A 1XMOF 2O67A 1YBAA 2O66A 2X7IA 4HT7A 2B0GA 2OEKA 3TR5A 1LWCB 1XK8A 1PAUB 3RAMA 4R8UB 4FXDA 2XM3A 1JXVA 5I4MA 3T5JA 4IG0A 1RT2B 1PILA 5G0RB 4L76A 1X9MA 3MM6B 5D3GB 2MMYA 2YNIB 1L3SA 4DV4F 2AEFA 3A12A 2CPDA 3J7A1 2V8HA 1Y10A 4GVBA 4LVOP 3CC7S 3LALA 1CJVA 2JDJA 1NK9A 1U6BA 2AJQA 3D2WA 5KFYA 4F4KA 2VFRA 2CKWA 4B3SJ 3MM5A 1HW9A 2IIHA 3BSAA 5ETNA 3BEGB 3V6HA 5HP1B 3DOMB 3QRRA 2QMXA 3CJKB 4RO0A 4QIEA 1S9GA 8AT1B 3AODA 1UWBB 4YY3J 4B3RJ 1UPMB 5AE1A 2MGZB 3R9LA 2YKOA 3US5A 2GMHA 1WELA 2V0NA 3NCPA 3OTCA 3PEJA 4CM2A 3T5HA 1RADB 1MW7A 3C16B 1W25A 2EG2A 1U7LA 4LBPA 4Y34A 3ZTPA 2L08A 3GP9A 1UJ5A 4U7UK 4A8YA 1JLFB 3AOAA 4DEZA 5D78A 5D0EA 2RQ4A 4DV0F 5KFIA 4DSKA 1BE4A 4LF8F 3MD1A 2HHQA 1ULRA 4L75A 2QEXS 5C2GA 1Z1ZA 1ZPWX 1VJWA 1A6LA 1J5EF 1RTJA 2VC1A 2J7UA 2DR7A 3GJQB 3I5BA 3HVTB 4YR3A 1D3WA 1S6QA 4Y28C 1C1BA 3PEHA 3QO9B 4DXLA 2L41A 3J7YI 5LMNJ 3C6UB 5A8RB 2Y1RI 1S6PA 2FB0A 4YB6A 3L3CA 3ZFVA 3PJXA 1VCTA 5D77A 2HSEB 4LJMA 4OV1A 1DTTB 5HLFA 1RISA 3A13A 1S4EA 1URRA 2FLOA 3ISZA 3K8VA 5CYMA 5K8MA 2L48A 4YFUA 3QIPB 4C6AA 2IM0A 2KG0A 1DURA 4EBEA 3MPDA 1KQFB 3ZTSA 4NLRA 5D15A 1RAOA 3WQPA 1SH0A 1YJUA 4R0EA 3ZTRA 4J9LA 3FC9A 3LTOA 2FVPA 4ED3A 3QT6A 2G13A 3T1YF 3G96A 3UPFA 1VQ9S 2GV1A 2OHDA 3B4MA 2G1HA 3HD1A 2IY5B 2UZAA 3ZXWA 1JB0C 1RWXB 1X7VA 2KFYA 2D69A 3IWNC 1ZM9A 3M2UB 3CMQA 2DR8A 3KK3B 5IOLA 3H4DA 3BS9A 2VQEF 1XTZA 2C22A 3KK2A 1Q8KA 3CCUS 1PBUA 3TUPA 2QA2A 3R6GB 3W9JA 5AE3A 4RR5A 4NZ0A 1BC6A 2QSFA 3CCRS 2R9LA 2VF3A 3P5TL 1IQZA 1NSAA 2B9EA 5HMWA 4ECTA 1G1XA 2VB6A 3TAPA 1VQ5S 4DR7F 1VYAA 2B7CB 2HHPA 3N79A 2M7SA 1S6OA 3NBPB 1X4FA 4RJVA 4BWMA 2KXFA 3OR1A 4PWWA 2UXDJ 4OYBA 3T1YJ 1UFLA 5J2PB 3DLHA 3MR2A 1CQNA 1RJJA 1DARA 1S6UA 2DIUA 4PEOA 1HI0P 1WOSA 2V8GA 5HBMA 4O44A 2HBZB 4IG3B 2W8LA 2QA4G 1TKZB 3MM8A 3NNCA 2JFDA 1RT3B 1S1WB 3VZHA 4F02A 3HT3A 4K4VA 2C2EA 3MAHA 3RBZA 3KJVA 1S6QB 3SCIE 3CJTA 4WPAA 4XTTA 5KFEA 2IA6A 2GW8A 2V63A 4AUKA 2JLEA 2ZKUA 3QSYB 4NI2B 1R0AB 4OHWA 2R8JA 2DEJA 3H4BA 1CULB 2GQCA 2GGPB 1N56A 3VALA 3GPAA 1VBXA 5DG7A 1R6VA 1RT6B 4MKBA 5CYMB 4CO3A 1GNKA 2CZ4A 4CDIA 1K44A 3WHIA 4UOHA 3DOKB 4MTPA 3ZZZA 5CAAA 1JLEB 5D0HA 3THVA 3KG0A 5AT1B 1F9FA 1RB0A 3N4WA 3DI6B 4QR2A 2IJNA 3NGDA 1HNWF 2V9KA 3ZZPA 2ZBIA 1IQTA 1SQFA 1F2HA 4DPYA 1UVLA 3RZAA 2ZJQQ 3JS9A 4LR8A 2WB1D 3MCOA 4J7CA 4K50A 3G8QA 5F8NA 2H9ZA 2A18A 2DCUB 3DFEA 1VC6A 4ELTA 2BW7A 1TAUA 4IH6A 2HBRB 4JI7F 2ABYA 1M5VC 2VOOA 4DL2A 2OEJA 4IO1A 3OLBA 2H3EB 4OYMA 4CWBA 1LXJA 3EE3A 3Q86A 3KFWX 2KG1A 1FO1A 4NLWA 3AXMA 3MMBA 2M8HA 1TQLA 3MEGA 2AGPA 2ZUAA 4BS2A 3QZ7A 4P52A 5H9FK 1WKLA 2RUGA 2DRBA 3M6WA 3E01B 2NXNA 2NPIA 2BJ3A 2H5IB 2YWKA 4K59A 5K8PA 3N6NA 1QSLA 2RF2B 3NP5A 4MJKA 1N34J 2X51A 1S1XA 1EETA 3AB4B 3CJQA 4NYOA 3CSKA 2OD4A 1QVGR 1Q5VA 5BR8J 3F56A 5GMKa 3HFKA 2DO0A 2PC6A 1RWVB 1S1TA 4DZDA 3LWMA 5HBMB 1RHQB 2GHVC 3CMAS 2H1YA 2RD5C 5E5NA 2HQCA 3GLJA 1KHVA 2V2VA 4IFVA 3TEGA 4FKYA 2F40A 4ZPDA 1ZAWA 2QG9B 3PHEA 5F41A 2LU2A 3HFZB 1EJ7L 4RBTA 1S7HA 2CAJA 4OL8A 4GKJJ 1HQ2A 1RBAA 4Q7AA 4OZ2A 5LOQA 2R8IA 3V6DA 2BKNA 3JSRA 3VQSA 2ZBRA 3RJMB 4DUZF 2OMOA 4H4OB 4F36A 3GMGA 4RKUC 1IJFB 4NZ6A 5CHCB 3OTBA 3EZOA 2JHEA 2GO9A 2NUUG 3EGWB 3IG1A 4HTIA 4DUZJ 3LO3A 4DL7A 4LF9F 2UUAJ 1YZ7A 2EFOA 1K1QA 3DLLQ 5KG4A 4B3MJ 2M3DA 4F2SA 2Z2YB 2YQ1A 3TAMA 4OI3A 4LIWA 1I6JA 3QATA 3GTYX 4HYKA 3P49B 3KLGA 5ETMA 4F67A 3W5ZA 4F04B 4EYHB 2HAFA 2M0GB 3PDNA 4ZP6A 3JAMU 4I56A 1U4BA 5IT9Y 3BBFA 1U2RA 1HD0A 1RKJA 2UU9J 1EP4A 2NQPA 1IKVA 3SCJE 4ZVTB 1WC3A 1R89A 1SC4B 2WONB 4MIWA 3AH6A 1WC6A 3EM1A 4RU2A 3PFEA 5C24A 1TKDA 2K1RB 4N41A 1IVZA 1S0OA 3MPYA 1UVKA 2I8EA 3IRXA 3KKFA 4QR1A 5DZ6A 3D3CJ 3ITHA 3K5NA 2AV5A 3V81B 3ZZUA 1V6HA 3RR7A 3UFCX 4CLZA 2XLKA 2A6MA 4P75A 2AYMA 1FRJA 1GAOA 2IA0A 1SJFA 4CLKA 2JZ5A 2CZVC 3MM7A 4Z7CA 2DH9A 3I0SB 5ETRA 1NK7A 1JLBA 1EETB 1KHWA 1VI7A 4GVLA 2YBVA 3MM5B 4ICLB 4ZKAA 4ED6A 1IKWB 1CS4A 3D1HA 4HLBA 4OLOA 5KFLA 1WHWA 1VDHA 3GQCA 1NB7A 3D0IE 1GFWB 1HNXF 4CM0A 3NL0A 1QE1A 3QIPA 5SZTA 2UUCF 1TP7A 4B3TJ 4HL9A 2HRUA 1TUGB 1OJ4A 3QNWB 1ZA1B 1ZZNA 3CCMS 4CNZA 3F73A 4IG0B 4ITSA 3AD9C 3JAMY 2MGZA 1IBMJ 2R7TA 2ZM6F 1XQIA 1F9EB 4FP9A 3W9HA 1OY6A 2YKMA 2FJAB 2BR0A 1WACA 2C2OB 2OP5A 4DL5A 2VDHA 4LT6A 2KFZA 1S77D 3RB4A 2EEYA 1T02A 4JI1J 1HIYA 5C24B 5KT6A 2J9DA 2OPQB 3G6XA 3BQ1A 2H65B 1SKSA 2VA2A 3TQ1A 4CZCA 2Z56B 4YUDA 2RJZA 4CNYA 2DKOB 2FQQB 5GADI 1CC7A 2XBPA 3HF5A 4PAAA 4EO6A 3MR5A 4ELUA 3M6UA 3E2EA 1BD6A 1OIAA 1Y00A 3AJDA 2R42A 2LDIA 4IQMA 2QIFA 3BN7A 4NLXA 1P1LA 3BPDA 1FF2A 4DQQA 4JV5F 2NS1B 2OGUA 2KM8C 1KR4A 4ILRA 3OW2R 4WFAQ 2BANA 2RT3A 3OTOF 4CI0B 1LWCA 5T14A 2MZSA 2K2PA 1F3FA 1NKEA 5HANA 5H1SV 2DGOA 1B7YB 1FK9A 4QIGA 5F8MA 3KTQA 3EWGA 3IGNA 4ZP9A 3O5TB 2J0XA 2DNKA 4ZCIA 3OHAA 3V81A 1NHKL 4XAKA 3KG4A 4O44B 3VAFA 2HQFA 4DS5A 2DCLA 4TYBA 2GA7A 2LQ9A 4OYXA 4X65J 3K5LA 2WSEC 2CQCA 5SUHA 2B4PA 4TVAB 3Q8PB 4WU3A 4B9NA 5HO4A 4P6QA 3R6LB 2RILA 4HI2A 1I94F 4DG1B 1T3OA 5J1EB 2RU9A 1F5AA 1HQUA 4MYUA 4AQYJ 2Z8QA 4X4NA 5IWAJ 2M88A 3RW7A 2V68A 1SL1A 3OVBA 2CJAA 2K3KA 3UVJA 4BWJA 2N4DA 4RW7A 3VVUA 3V4IB 2LFVA 4NLQA 2YPZA 1PYTA 4OYPA 4HDGA 4YQWA 1DFDA 4LF4J 1WC4A 2FC8A 1T94A 1R6YA 4YMEA 2MQOA 1URNA 2JEIA 1J2VA 4Q0BB 3PW0A 1RHKB 1LWFA 5AXKA 1RU1A 3T19A 2ZDOA 2MKCA 1WHXA 3GIIA 5KFZA 1X4EA 2FGCA 2YTCA 1Y4ZB 4WFXA 3A3NB 2FLPA 1DBDA 1ACMB 4LRDA 2GNKA 4DF8A 5JJBA 4P74A 4PUOA 3CDBA 1ZM2A 3TOQA 4PZVA 4Y0FA 4A8XA 2MB0B 2MJNA 2IJFA 4LSLA 2C28A 1KD1T 2HHWA 3FQKA 4CRJA 5EN1A 1HI1A 1LK5A 3HI9A 1F0XA 1FNXH 2UUBJ 4QQBA 5CYQA 2CXEA 2U2FA 3HVAA 1Y5IB 3MMAB 4RUHA 2KYZA 2HS3A 1J5EJ 2HHXA 4FS1A 1CULA 2EVZA 1CJKA 4ANEA 5B0BA 1DZ5A 1IKWA 1CS4B 4L3KA 4LF8J 4O3OA 1E6YB 2WTFA 5GADU 2UXCF 2D1CA 3D67A 3ZC4A 1OY9A 5E7OB 5LMUF 3W3SA 1KVIA 2MKJA 2R2SA 2JEGA 4EEYA 3T6JA 5HJYA 3CJSA 1V9OA 3W66A 2EFGA 4F3MA 1VQNS 2RQMA 1CG2A 3UNGC 2QV6A 1N32J 3QZ8A 2IVFB 4KH0B 2RAQA 1WKJA 2OPPB 2QO3A 1ICEB 4ECUA 3D28A 5IV4A 5KFMA 3ONQA 4C3KA 3BGFA 3Q8RB 3ZNUA 2Q6CA 4FKXA 4RPFA 1OSCA 4LQ9A 2C3OA 3CIMA 2ZHAA 3MXHP 3GR0A 1GEHA 4TKTA 1HW8A 1U45A 3HHDA 5IC4B 2OPSA 4NA1A 4J9KA 3RRHA 4WTOB 1FRHA 1RK8A 3AHPA 4DR3J 3BM7A 3OSPA 1PSDA 1XC9A 5HMXA 1VK3A 4UOCA 4EI2A 3CB4A 3C6TA 5GMDA 1SH2A 3LP0B 3CJKA 4OMFG 4X65F 2EFPA 2C2NA 3H0PA 3N01A 2W9AA 1ZOTA 1WEXA 2V8PA 2ADBA 4PG6A 5DO2A 1YQHA 3KUHA 4F3QA 3HDSA 2JEJA 4DCPB 3M1VA 2Q66A 1FT8A 3OD2A 4QOTA 4I67A 3D3BJ 2MQPA 3GIJA 3TX8A 2HAIA 1ELOA 1NB2A 3M8WA 4QJVA 4RW6A 3TP2A 2ZBQA 2HS4A 2LXUA 4JV5J 5F3TA 4FPRA 2ZD1B 1LEOA 2HGMA 2IDEA 2Y0SD 4ZPCA 4ECYA 4RW6B 1RYRA 5D4PA 1RHJB 4ANDA 3KLHB 4F3OA 4IRDA 3MMBB 2J9CA 3FJ2A 4KY3A 1EB0A 1ZPVA 2AU0A 3FBEA 2PN6A 1O0PA 1RTDA 2WB4A 3MPUB 3IA0A 4AT1B 2HIQA 4MMOA 5KFVA 2HGNA 4CCHA 1HQEB 1IR2A 4LF7J 4Q8FA 4OHYA 1KNZA 1EAYC 2VG6A 3QRQA 4K4XA 1V5IB 2LA6A 4USKA 1KQKA 3R2CJ 2AWZA 2FPHX 1QDUB 3CCWA 4N77A 4FS2A 3TARA 2CA9A 1H3DA 3FGVA 5DJBA 1VRUB 2OPRA 1OY8A 4WK1A 2OLWA 4P72A 3OL7A 3QGPA 2XZTB 2GFFA 4NYZA 4YN3B 3TX0A 3V4IA 2BJ1A 4P2SA 3CF5Q 4LFAJ 4RUCA 2J6SA 2C1EB 2E5HA 5G4DA 5ETQA 4DFPA 5ETKA 4G65A 4ZN1A 1V3SA 3NGSA 2OFHX 4DR4F 3M1VB 2DR5A 3M32B 4NMLA 3DM2A 4C8LA 2FZKB 2IVMA 3BR9A 3UNYA 5IS2A 5J2NA 4H4KC 3C15A 2DGSA 5LL6d 3GG1A 2VG5B 3OPKA 2DEIA 3T9NA 1VLYA 4J9UE 4JBCA 1SJ1A 2V2QA 4ZHRB 3MUTP 3UE2A 3HO1A 4ILMA 2DNGA 4OYOA 5D4NA 4FYWB 1WG4A 3TAQA 4Q43A 2L3MA 4GO5X 4MH8A 2CQBA 5KAKA 3GILA 2BRLA 4F7VA 1U2CA 5HQ8A 3LH2S 5MLCV 3GE9A 2MQQA 1KTVA 1Y3JA 3HVTA 2AJ1A 3E8OA 8RUCA 2DNPA 4NOHA 1E6VA 3IS9B 2ZNZA 4KRWA 1TKXA 2LQJA
chains in the Genus database with same CATH topology
4FBTA 1R8CA 3H59A 4QWAA 3SXLA 2BQ3A 4ETXA 4CIOA 1WHVA 1FE4A 2WRMA 4UUXA 4DR2F 2D74B 3GFHA 1U1MA 5J2MB 2HNYB 4R5PA 1MWYA 1TL4A 2IC3A 2HGLA 3M8RA 2DH7A 2B4UA 4IDKB 3L7OA 4J9PA 1RA7A 1VQLS 3OL8A 1RT5A 1G3OA 1TFYA 3F41A 4HT5A 1G7CB 1U6ZA 1Y3KA 4P7TA 2DK2A 1RT5B 2CQPA 1XN9A 2CPFA 1YITS 2ZKTA 3THPA 4JV2A 1X9SA 5AJ3F 4DV5F 2BA9A 3I6PA 2ZJPQ 4B3OA 3RR8A 3D54A 1FXLA 5C25B 2C3UA 2RE1A 5FD1A 3ISNC 3S1TA 1D9AA 1MROB 2DNMA 4RW8B 2HW3A 1BQMA 2HWIA 4HKQA 2LEPA 1KLMA 2D3UA 1UA1A 3NKYA 3BO2A 4DSIA 3JTPA 4Y2KA 1FRXA 1E6VB 3AJ1A 3BQ0A 2QLWA 2CQ4A 5KT4A 2IYIA 2ZC3A 3N5BA 4IOCQ 1NHUA 1ZBTA 4ES3A 3BGRB 1YJVA 2J6UA 1S79A 2OD6A 4DQIA 2DJWA 1D9DA 3Q24A 2KXHA 3CDUA 2IMOA 3IN5A 2XEXA 5HMZA 4ATNA 3TA0A 3CJ0A 4OQJA 5KTQA 2BM0A 1BQXA 3DRYA 4DMZA 5EDWA 1X4DA 3K57A 1KTQA 3KLEB 1H7WA 2KJWA 3T1HF 1A9NB 1B0TA 5EWGA 1TVRB 3IR7B 1MSWD 3BR8A 1J5OA 5IFMA 1UVIA 5J2QB 4C11A 3FEXB 2UU9F 1N0UA 1JJ2R 3H8YA 5KFGA 4LFBF 1VK8A 4MYTA 2VASA 3KLIB 1K73T 1HWKA 4M95A 4C4WA 1QE1B 4ILLA 2XS5A 1WNEA 2BXJA 2F8MA 1UKUA 2OAUA 2V9WA 1S1TB 1HWLA 4O3QA 2FD2A 1UWBA 2ROPA 3G4SS 4GC7A 2JEIA 1S1UA 2BBEA 1OPZA 3KWMA 4IFVB 3U02A 3N5FA 3MEEB 1C1CA 1QVFR 1GT8A 2MPUA 1SV5B 1S9FA 4NRUA 4OZLA 4DFMA 3A1YG 3BSOA 1KFDA 4N76A 3NMAA 4XO0A 2OTJS 5K14A 5A6PA 3MCSA 5KFAA 1X0PA 2DGWA 4DV1F 1VHFA 1HHTP 2YWFA 4ZOSA 2Y1JA 2WSCC 1RGVA 1EP4B 5I3QA 1H6KX 3AB2B 5E2QA 2OH2A 2XY5A 1K1SA 3CC2S 1X4CA 3P6YC 1S99A 1C1BB 3QO9A 3WBZA 3N0VA 1VMBA 5A8KB 3HP6A 2ZBCA 3JYTB 4DR1F 3NAHA 2CPXA 4M63A 2HNZA 2RU3A 1JLGA 2DNZA 5A0YB 2R7QA 2D3OR 2E5LF 2P6SA 3QYYA 3AJ2A 4V19X 4DPOA 1JLFA 4ZPAA 2BRKA 2V4JA 2KM8B 1XEZA 3FZBA 3TYTA 1N34F 2X1FA 2XMJA 4EUVA 2CQHA 2ILYA 2PI5A 2J76E 1LKZA 1H0HB 2DGQA 1IKVB 3Q23A 1U1NA 2IHR1 2DNHA 5GVQA 3I5AA 2HFOA 4TQRA 1K9MT 3QJLA 1FD2A 1SJQA 3IWXA 2N82B 5HN0A 2FHJA 5J1EA 2FVRA 1TZ0A 3DNCA 2XG8A 2YWGA 3AA8A 2Z2MA 1AXQA 4YB1P 2B6AA 2XLIA 2B51A 4A4JA 3EX7B 3RB0A 1NK0A 2MDAA 1JLEA 3Q8QB 4Z37A 2UXBF 1WF2A 1TAQA 3R27A 1TK0A 3CDWA 3JTOA 3V5RA 2RMLA 3MUMP 3VAHA 5D8HB 2HVZA 4GMKA 2YY3A 4QU6A 1JX4A 2QRRA 2N3OA 4ID8A 3I87A 2OIHA 4ZP7A 1X4GA 3FEYB 2MQOA 4I0WA 4USJC 4AFFA 1KQSR 2HHUA 3SSSA 2A2CA 4KGMA 4TY8A 2HHSA 2QYCA 4LF7F 1Q7YT 2NSBA 1T3NA 1AFJA 1C0UA 3QAUA 4PXBA 5LMNF 4NXNF 1UETA 3FSYA 5LSOA 2J0QD 3SV4A 4NLOA 1RTDB 3DU5A 2ADCA 3H5UA 4B02A 3EPGA 4DL6A 1S1XB 2RKIB 5KG1A 2ASYA 1TKTA 2BACA 4HHJA 5L1JA 1R8AA 1KC8T 2IFXA 1XMBA 4TLRA 1HQUB 2B9WA 3HHEA 4ECSA 1MMDA 2PA8D 4DJBA 3KOAA 2JX2A 3SDEB 1RTHA 2MQMA 1GXLA 2M4MA 2SXLA 4A8WA 1Q86T 4OI2A 3D0GE 2XCPA 3TANA 1JLAA 1Q1KA 4YY3F 2GCFA 4Y3CA 2XS2A 4N56A 5LXRA 1U1QA 1VS3A 1FRMA 1WTBA 1UL3A 1FTCA 3H5XA 2DPJA 1S72S 5KFRA 2JC1A 2KT3A 3G9CA 3QWPA 2F8HA 1B7FA 4DF4A 3T5KA 1RT6A 3JYTA 1N32F 1GH8A 1WEYA 3MMCB 3U1MA 4ECQA 4A47A 4I2PB 2XGQA 4A8KA 3MZIA 3NBPA 4QCLA 3TUZC 5F8LA 1XNRF 1DTQA 3G8TA 1N6QB 2IM2A 2G9OA 3VAIA 3DLBA 4YOEA 4L6V3 1RT1A 1RQ0A 3MI7X 1HBNB 1OSDA 4Y6IA 4CQ1A 4GC6A 2E9TA 4R8UA 2IRUA 3PX0A 2IMWP 1M5KC 2HYIB 1CSJA 2KFNA 3S01A 3LP2B 2CPZA 4IKAA 5DG9A 1VQMS 3GG0A 2ZHOA 1C0UB 4AL7A 2UUTA 4LMZA 4ZDNA 5DDOC 1NNDA 3J7ZT 1RYSA 4EU0A 2E5JA 3PRDA 1Z2LA 2FIUA 2VL1A 3M05A 3NAIA 3W2WA 2YX7A 2QMWA 3MTKA 4TU9A 4RW4A 3SSRA 3MM6A 5KT5A 2Q79A 3SQGA 4CTAA 2V4RA 3Q0AA 5D3GA 5EX0A 1Y0HA 2J7WA 4EZ6A 2U1AA 4X4VA 2JVRA 2XC9A 2ATLA 4BC7A 2E29A 3K5PA 5KFJA 3C3LA 4KAIA 1NJZA 5DM7Q 1BQMB 4C9DA 2VUGA 2HVIA 3PNIA 2PE8A 1NEEA 5CZVA 4ALZA 4CH1A 4I69A 2FHOB 4ECXA 2EBGA 1NAQA 1WF0A 4I6YA 3RRGA 2YNGA 4X84A 3G6ES 2GHPA 3J80Y 3CMES 5B09A 4J9OA 2XLJA 2DGVA 4M5DB 4WCEQ 3C2PA 3G86A 2F8EX 4ZLPA 3M2RA 2VG7A 1LFPA 4NYPA 4O3RA 1FDDA 2VPZB 2B5JB 4RLEA 3VAKA 4DUYF 5F9LA 5LSLA 4TU8A 1NK4A 1HWIA 4OZNA 2BQUA 2ERRA 4I2PA 3WDOA 2I0XA 3DXSX 3PFOA 3C6UA 5A8RA 4JI8F 4CTAB 5HI7A 2J9DE 5CCLA 1BQNB 1HPZB 2DHXA 1HBMA 4ECZA 1MWZA 2XI2A 2QFJA 4WXOA 4OJ3A 3MMJA 4JOUA 4TLQA 2ZNYA 2KHDA 1JLQA 5DLFA 2DD8S 4K4YA 2W4PA 2KVIA 4NLTA 3OSNA 2UUWA 4FVCA 4O3SA 4F2RA 4DR6F 4DX8H 4X66F 1G6BA 1TL5A 2K1RA 1TL3A 1WHYA 4OZ0A 1W2BR 1JLAB 4JI1F 4YEAA 2LQBA 1FERA 1CC8A 2I38A 1VBZA 4YHHF 3KLFA 2DNRA 3ENVA 1AROP 2D9PA 2FGOA 3A8EA 3X3UA 2VG7B 1HNIB 3DDNA 2R7WA 1M5SA 2M9KA 4DN0A 2W24A 3IO1A 4LF9F 2R8GA 5KFNA 4F50A 1NH8A 2EFQA 3OJUA 3KHHA 1S1UB 2RRAA 2KO1A 4OI0A 3FNNA 5DDQC 2YNGB 3GB0A 3P3DA 3D0HE 2HS0A 3IWLA 3M4XA 4NPOA 3VF0B 2XCAA 1N6QA 4WFBQ 2O1PA 3PW2A 4ZA1A 4OHZA 2VPWB 5HROA 1KQGB 2JFKA 3P96A 1QAJA 4X4UA 1YJ9S 4RWWA 2QA1A 2R7VA 2V2KA 3G8SA 2VZ9A 3U27A 3I0RB 4IQXA 2LMIA 3GFZA 5EX3A 4K0KF 1JK9B 2LCWA 2RDIA 3NCRA 3KLHA 2W9BA 4RNOA 4E8UA 4I2QB 4NCGB 4H4MA 2E44A 5KOWA 4B3RF 3BO4A 1U48A 2EKYA 3CCES 5F9NA 3DLGA 5JVHQ 4OIXA 1SL2A 3SZ2A 3B78A 5KFBA 5A8WB 1NU4A 1IKXA 2PD1A 2ALZA 4JI3F 3W2VB 1N54B 1LW2A 3DLEA 1OWXA 1VGYA 5BJRA 1N0VC 2GC8A 1UVNA 2O5DA 3PM9A 4PG8A 3R1LA 2FJDB 1FK9B 5DGAA 4OZJA 1QTMA 1U09A 1IR0A 3DLJA 4X4RA 2BJDA 3R1HA 4HH1A 4PPZA 3M30A 4RW9B 5GAHU 1VQ7S 2ZH3A 1YJTA 4X62F 3EGZA 4C98A 3M9MB 5CD4H 2B4VA 3LAMA 2KYXA 2ZH6A 1R43A 1Q4RA 2GIRA 3K7RA 2DNNA 3HLUA 1U1LA 1UJ4A 3QWUA 1ZTTA 2VC0A 2HHTA 1D9FA 3C6TB 2HNDB 1YJWS 3HPOA 1Q8LA 4IH5A 1APSA 4KPYA 1N33F 7FDRA 4DFJA 3IXQA 2Q3PA 3PW7A 1UVJA 3EXYA 4C7QA 5B0DA 1Z4UA 1RDRA 2E5GA 4DDFA 1K8AT 4IH7A 3MMAA 1NK8A 2IVYA 4WK3A 3H5SA 1YWXA 2MHEA 2E9ZA 1YI2S 4PWDB 5IXUA 4O0IA 3OV7A 1FKOA 5HL7Q 2B9XA 3H98A 3MUVP 3TVYA 4KT0C 2IM3A 4DFKA 5M2UA 3OHBA 3J81Y 2XY7A 4G1QA 4C8YA 2O01C 2R8HA 3RTVA 2XB2D 2GGPA 3UWTA 2K7KA 4ZS6A 3LF0A 2E9RX 2WOMB 1MU2A 1YRUA 2FJVA 2J0WA 1F5BA 4OFZA 4A8QA 3QJPA 2XSJA 3PRBA 4I4BA 1KFSA 4ZK7M 4IOBA 2LDYA 1HBOB 2VFTA 1B0PA 1UAWA 1WWHA 1N88A 2L9NA 3MWBA 1YSJA 1XR5A 1JLGB 3KLGB 2I5JB 2JSXA 2JH3A 3HMJG 3OFGA 4C8OA 2LXIA 2KN4A 4QWDA 2XULA 2DHAA 3CT9A 3LP1A 2YKQA 4ZVHA 4JV0A 3SYZA 2W4DA 4UY85 1JNRB 4YDDB 5EWFA 3I4HX 1QUPA 2PT0A 4KB7A 2JLFA 5JVGQ 1TFWA 4C2MA 2CIMA 2YNHB 2XWXA 4ES2A 3K5MA 5DRKA 3V6DB 1J5OB 3KG1A 3MEKA 2L9DA 2RKIA 3UD3P 5J2QA 5B0AA 4OHVA 3T6BA 4WFNQ 1PO6A 3KK1B 5C42B 2ZH8A 2MZJA 4KV8B 2BE2A 3OUYB 1Q16B 5KFCA 3DLEB 1LW2B 3IGVA 3D5MA 4DSLA 5IT0A 2CQ2A 1T03A 2OPRB 3M2VA 4LF6F 1HBMB 4RX6A 3PO4A 3FFIA 2DNQA 3GV5B 4G6VB 4B9LA 3M2VB 3QLHB 2HVHA 1UA0A 5LSRA 4RW9A 2NPFA 4DV6F 3NMRA 3MPWA 2GJIA 3DU6A 1NHVA 4B9VA 3OL6A 3PVXA 3U7JA 1FKAF 2HFNA 1X9WA 1D1UA 3OXLA 1SJ4P 4IRKA 4X4SA 5IT4A 2P9CA 2ZD1A 3OVAA 1LWEB 3UCGA 4NLVA 2OPQA 4CO5A 2DISA 2V4QA 4PRFA 2WHOA 2BQRA 4IO9Q 3DMJB 3L95X 3DOLA 4I68A 4IOAQ 1WD6A 1RT4B 4IFYA 5I3UB 4LVNP 5A0YA 2DHGA 1JWWA 1QJHA 3CJ2A 4KSEB 4WYWA 4QZVB 3CC4S 1M5HA 2C28A 1OO0B 3IC1A 5KT2A 4E98A 2R7XA 2P6TA 1HHSA 2HNYA 5T7LA 3LW5C 4LUBA 3CUNA 4N8OA 3JB9k 5KFDA 4B9TA 3M9NB 4PWDA 2HRYA 1QSSA 1YHQS 3K0JA 1HARA 4BHQA 4LF5F 1SXLA 2EBEA 3TA2A 1YRTA 2JRSA 4QIFA 1S4FA 4Y2CA 2W9CA 1IBKF 3JSBA 4TN2A 1S1VB 1L3KA 3K2YA 2BABA 5EUHA 4URGA 5GMKa 4QYZJ 4G1QB 2K3IA 2CPIA 3GYXB 1VOMA 2DNLA 2VPXB 1U2FA 2O3DA 3POTA 4ZP8A 5ITHA 2HQ3A 5E3PA 3DXBA 1FCAA 2KH9A 1GXUA 4HVZA 2BW2A 1C4AA 3AQOA 3UR3C 4TQSA 2VBZA 4K2XA 4TXSA 3HKWA 2E7XA 2AYEA 3DOKA 2A10A 2XO7A 2XSJB 5K8NA 1XWLA 2B9YA 1RTHB 1RTIA 1SUQB 2Z2LA 2RRBA 2ZE2A 3N6LA 3OR1B 2HFZA