1YJTA

Solution structure of the cu(i) form of the sixth soluble domain a69p mutant of menkes protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 20
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yjtA00
5B0GA 3K7RA 2IYIA 5B0AA 1FVSA 3MZIA 2QYCA 1GXUA 3CJKB 1RJJA 1FEEA 2EW9A 2W4CA 4A4JA 2AW0A 1QUPA 2HFNA 3KG0A 2XMVA 3BDEA 3HHLD 2HQIA 4YDXA 3TNVA 1TZ0A 4U9RA 5IXUA 3BF4A 2FIUA 1Q8BA 5T7LA 1V3ZA 2HFOA 4Q2LA 1N5TA 2AJ0A 2AJ1A 2G9OA 2K1RA 2KYZA 2N7YA 2OFGX 2XMTA 3HDSA 4Q2MA 4Y2IA 1P8GA 3BM7A 2ZDPA 1SB6A 5F0WA 1APSA 4Y2KA 5T7LB 2K7JA 5B0BA 1JWWA 1FESA 1Q8LA 2BYCA 2ROPA 4OJHA 3HHLA 3GZ7A 3CJKA 2ROGA 1OPZA 3IWLA 1KVIA 1MWYA 1IUJA 2KT2A 1SQEA 4HI1A 2HLTA 2FB0A 2OFHX 1U7LA 3HF5A 2PGCA 4EFAC 3F44A 3HX9A 2XMWA 2ZDOA 3HHLB 2IFXA 2QLXA 3KNGA 1R6YA 5B08A 2GGPA 1YJRA 3KKFA 3BR8A 1N5SA 4OJ3A 3FRYA 1N5VA 2PD1A 3LGMA 3QMQA 3UDCA 2XMUA 2N4CA 2QLWA 1YJVA 1K0VA 1Y3KA 2K7KA 2ACYA 3VTIA 2GGPB 4QOTA 4ZA1A 3MCSA 3DCAA 3HFKA 2W4DA 4OJGA 2RMLA 3TRGA 2GV1A 2HIQA 2BJEA 3DXSX 1Q53A 2OD6A 2LXFA 2BBEA 1JK9B 4NL5A 5F0UA 4FNHA 5A6PA 5B0CA 1OQ6A 2ASYA 1AW0A 1CC7A 3KG1A 2N4DA 4DL0C 2GO8A 1AFIA 1TL5A 1KVJA 2K2PA 3HHLC 1SI9A 1YJUA 2KT3A 1FVQA 2IYGA 1X0PA 4HH1A 2L3MA 3BB5A 1Q4RA 3IWXA 4FNIA 2VH7A 4F67A 4YEAA 2FTRA 3LGNA 3LO3A 1CC8A 1GXTA 5K9FA 4NPOA 1P6TA 1FE4A 4HH0A 1W2IA 4ZOSA 3WDOA 2OAUA 2OD4A 2Q3PA 2KKHA 2XMKA 5KAKA 2XMMA 1MWZA 1OQ3A 1WD6A 2GCFA 3FMBA 2CRLA 1TUVA 2BJDA 5B0DA 2OMOA 2RSQA 1X7VA 1Y3JA 5A6WA 2FHMA 1YG0A 4DN9A 1CPZA 1FE0A 4OIXA 1LQ9A 3E8OA 4OJ1A 1S6UA 2AP6A 2GFFA 2OP5A 3BGUA 4HL9A 1S6OA 1Y0HA 2LQ9A 4A48A 1XBWA 5B09A 1TL4A 2BUNA 1ULRA 3BN7A 3FGVA 2VV5A 4Y2MA 5B0EA 2QIFA 2GA7A 2HLUA 5B0FA 3QGPA 2LDIA 2W4PA 2JDJA 1URRA 1VQYA 4A47A 1X8DA 1TR0A 1YJTA 1OSDA 3I9ZA 4A46A 1AFJA 2ROEA 2RILA 2LQBA 1N5QA 1VQSA 1YRXA 2OKQA 3T9NA 4HI2A 2K1RB 4DPOA 3TOQA 1KQKA 1FD8A 2XMJA 2RU9A 1Y9OA
chains in the Genus database with same CATH superfamily
5CH7B 2XWXA 2Z56B 1NPPA 4XO0A 4IRCA 2FIUA 5KFQA 1SKWA 1QTNB 2Z2LA 2DY1A 3N4WA 4NXNF 3IRXA 1CS4A 4USHA 5DJBA 2CJXB 3W61A 1NJWA 4YB1P 2D9PA 4KH1B 2I6WA 4NA2A 3J7A1 2XULA 4ZN3A 4RPFA 4DFMA 2AJ4A 3GONA 3C14B 2NS1B 2DHSA 2AZ3A 3ZZRA 2CPEA 5KFUA 2XLIA 1FERA 4HHJA 4NPOA 4HH0A 4NCGA 2V2VA 1NK6A 3HVTB 1W2BR 2DH7A 2DNQA 2XBPA 4C0OC 3W60A 4R8UB 4LF9F 3NS5A 1RABB 2HBZB 2IVMA 2OEKA 1ROFA 3H2LA 2R7XA 3UDEA 4ECWA 2N3LA 2HRYA 1TL3A 1ZM9A 4F3OA 4HI2A 2FHJD 5GADI 4ENOA 3A8JA 2VFRA 1WC3A 4DCOB 5D77A 1YJWS 2D3ZA 2QA4S 3KLGA 2WVDA 2DR5A 1RWUA 2MKSA 3N28A 5B7WA 5F8GA 4U7UK 3NY0A 5G0RA 2OFGX 3M2UB 3I87A 2DXEA 2FJAB 4XDDA 2NXJA 1SQEA 4FS2A 2KHDA 4NLTA 3GTYX 1HYSA 5KFNA 2GO9A 1U0HB 2ZOGA 1VR6A 1UW9A 1KTQA 1FF2A 2RKIB 5EHHA 4JP8A 2UUBF 3KDNA 3KLIB 1GXTA 1WEYA 4ZLJA 4OHVA 4ZOSA 3CMQA 2YKQA 3FMBA 1X4FA 4ZVPB 2J0QD 1KD1T 3JTPA 5GAEI 5K14B 3PW0A 3G6XA 2XQCA 4ZVGA 4IR1A 5DO2A 4ZPWR 3MECA 2F9JA 2XHCA 4ICLA 1HI8A 1UVJA 3JB9k 2YWHA 2LQJA 3H42A 4DR3F 1NLKL 5B0GA 2DXFA 4OZ2A 3NMRA 1S59A 5GAGU 4U7CA 3IS9A 1FRMA 1Q79A 4M5DA 2DK2A 2L9DA 4CM0A 3UDVA 4LFCJ 1KVIA 2JHEA 4ZVOB 1M5KC 2AYEA 1H3DA 4TXSA 2IAJB 1VGYA 1PBAA 1KLNA 2VPYB 3O3LA 4QYZJ 5F0UA 4N7TA 3L7OA 4PPZA 2D3O1 3CPWR 1AFIA 1GH8A 1NEEA 1WELA 2FTRA 4D3GA 3V2UC 4DL3A 2UVWA 1SJ1A 5KAKA 2QFIA 5IT9U 2JC1A 1Y11A 1TKTB 2C2KB 2CQHA 4OV6A 2KZMA 5EWEA 4NLYA 2KHCA 3VAJA 1MW7A 2W7PA 3E01A 3JSMA 4Y65A 4AXIA 2C2RA 1F2HA 1D0EA 1CJKB 2KT5A 4NXMJ 5CYQB 3KMQA 3V6HA 3T9ZA 3F56A 3LP1A 4YDXA 2C22A 2V0NA 2CZ4A 2QA1A 4BDPA 2FY8A 1Q7YT 4RNOA 3GJSB 3BZQA 4XIUA 2SXLA 5EWGA 2ZITA 4J9UE 5MLCV 5F3ZA 2CWXA 2VC1A 1REGX 1NK9A 3D0HE 5CYMB 2XYPB 4PQUB 4LRFA 2WTFA 3BO4A 2AYBA 1UWAA 3JXOA 3OTBA 3BBCA 5LSLA 3VGVA 4F67A 2J9DA 4Z7YA 4QYZK 3LPEA 2LDYA 4DG1A 2ZZNA 4ES1A 2DNGA 3QLHA 7AT1B 1JMTA 1HHSA 4DR1J 4USWA 4W90B 4RW8A 1S6OA 2DGOA 2Y9HA 1N6QB 2CPZA 2CG8A 2GVDA 2DTJA 2HHHJ 2F3JA 4EO6A 2HNYA 4LF6J 2OKQA 4NCAA 4ILRA 4OYXA 4QW8A 3QBCA 1TL1B 2E9RX 4X4QA 2Z8QA 3D28A 1JLAA 4K2JA 1NDCA 1UFKA 3FC9A 2ZUAA 1MLAA 4KGZB 3DMJB 2AZ1A 5F8HA 2FB0A 2CQ2A 1A0OB 4FVCA 4OLPA 4I6WA 4B3RF 3CCSS 3I5CA 1RZMA 2M70A 5J1EB 1URNA 3BKFA 2FVRA 1MU2A 3RRGA 1FWKA 1NJXA 1TVRA 3KDOA 2AQ4A 4PWWA 1KRPA 3O2IA 4NLVA 5E3PA 2MLYA 4WP8A 1YWXA 2EC2A 5JVHQ 4O3PA 1ULRA 4U8YA 3LP0A 5J2NB 3MMAA 1LV5A 1RT5A 5DZ7A 2H9ZA 1REVB 1YK9A 3I0SB 4G1IA 4DPOA 2CPXA 3K58A 1YSJA 4MIWA 1EKRA 1V5VA 4ZP9A 2CVIA 3VGUA 5L8RC 3G87A 5J1PA 1TL7B 2YY3A 2E1MC 3TZXA 3PCOB 1Z1ZA 1FA0A 1SUQA 2HGMA 3IRXB 3MFIA 1UFLA 1CS4B 1R6VA 3EM1A 1X9MA 3AA8A 3GFYA 3E3XA 1U1NA 2VONA 2XY5A 1T3OA 3TAMA 3PIOQ 2QJ3A 3JQJA 1XMBA 2OPPA 3CVKA 2Q66A 1M5VC 2PI4A 1IQTA 3QRPA 2I0XA 3IXQA 4EU0A 2UVRA 3PX0A 4L75A 4DR7F 2OTLS 2D9OA 2BKOA 3RB3A 4NCGB 1PKUA 3RR7A 3J7YU 1RT7A 3EDRB 3HXMA 1VCTA 1K44A 4GRSA 1LW0A 3IN5A 3RB6A 2X3DA 1NB7A 1RKIA 4DHVA 3OL8A 1NH8A 2GA7A 2YBVA 2ZJQQ 1HQEA 3GIJA 1XMOJ 2AEJA 3BQ2A 3T9NA 4K8RA 4QWAA 2MJNA 3DYAA 1TFWA 4PPDA 2E7WA 1TL3B 3CJ0A 3C46A 2Q1LA 2M52A 2DNRA 4WJBA 1NSQA 3L7UA 3KLGB 2LA6A 2KM8B 2RQCA 2BDPA 4PEOA 3BGRA 1A7GE 2QE5A 5KG2A 1FD2A 4WWSA 2E9ZA 1P27B 3FQLA 5G0RB 3H25A 1KWMA 2RHQB 1WSVA 2Z57B 4DL7A 3PRDA 1RT6B 4IR9A 2PMWA 2ACYA 1HYSB 1RHUB 1RTJA 2GIFA 2VBZA 2DO4A 3HPOA 2PC6A 3I6PA 4F4KA 3WIUA 2JVRA 3I31A 4OYWA 1SJQA 2KL8A 1WKLA 3ZTQA 3A8KA 4WP9A 3OQ2A 4C9DA 3CJ3A 1Q8IA 1RAAB 4DR5J 4WXOA 4U7UD 4CT9A 3EICA 1D1UA 1RU2A 1XNRJ 1T03A 1VS3A 2J0XA 2MQNA 2NXCA 2UXCJ 2ATLA 2LP4A 3BGOP 3MECB 4ICLB 3M1VA 3UN5A 4GO7X 1U47A 4UQGA 2DGTA 3RAQA 2R7RA 4AQYF 2MLZA 3IS9B 2AX0A 4M5DB 2ROPA 1S6QA 2C3OA 2CNOB 3H5UA 1G2EA 3VAKA 4DU7A 2J6UA 5HVFA 4LF8J 3SBMA 4KGMA 3NCRA 1RT1A 2MQLA 2GV1A 2AIRB 4F2SA 1HHTP 3FFIA 2WAQD 5GMDA 4I2PB 2MLXA 3KG1A 3OLAA 1F2GA 1UZHA 1IR2A 1U24A 3HULA 3AQPA 1F0XA 4V1Ak 4BLGA 4YEAA 3TR5A 2ZBIA 3WDOA 1RACB 4KYZA 4MFBB 4AT1B 1KSPA 1TUVA 3H90A 3W66A 1N88A 2ZM6F 1SV5B 3VAIA 1VLYA 5HJYA 1C2PA 1HNWJ 1RI7A 4PG5A 3OHBA 4Y3CA 4RBTA 1PIEA 1V3SA 3AOBA 3E01B 3UI3A 1Q1KA 2LQBA 3JSMB 1T11A 4WTYA 1BQMA 3B78A 1R0AA 4NLXA 3AJ1A 1PILA 2GMLA 1FVSA 2W4CA 3ULHA 2DHAA 2YPYA 2GAGC 2LXIA 1NKCA 1SJFA 2C3YA 2K1RA 3LP1B 4H4KC 1RYRA 4CLZA 2IJRA 1NJZA 1WF0A 1Z2LA 4F4ZA 4TVAB 2KZZA 1SCJB 4TQSA 2DH8A 3BGLA 4W98A 4KY3A 2NUHA 4C3LA 3HD2A 4GKKF 4OX6A 1N36F 4CO0A 4ZVRB 3AXMA 3GCWP 4FBUA 5C2CA 1WHXA 4IH5A 3QRQA 4LVNP 2QV6A 3UWTA 1VBKA 2QLBB 4ZITA 3QLHB 3KOAA 1VFJA 3TW0A 4B02A 1CJVB 2LXUA 4RW8B 1XR5A 1X8DA 1RP5A 2GVDB 1NPKA 1NSAA 4DSFA 2HNYB 3PRVA 2X1FA 1S9EA 2XMAA 1T3NA 5ETVA 4AL6A 4NYZA 2XMVA 2X7IA 4YB5A 2HS4A 5F3TA 3AODA 1JLAB 3RU0A 3VZHA 2L9WA 1BXNA 2ZDOA 3DXBA 4YUDA 5KFEA 4C8LA 1BC6A 2W9BA 4DPYA 2Y8WA 3I0RB 4OI6A 3GJQB 5E3AA 3D6HB 4LQ9A 3NOCA 3LTOA 1RAOA 1MU2B 1WSRA 3Q8SB 2O5DA 1VISA 3MTKA 1T95A 1TVRB 3P45B 5DGBA 5E3CA 1JLQA 5KFDA 2DGSA 1YG0A 4BC9A 2CNNB 2LU1A 4ZP7A 2KXNB 3GJTB 4A48A 2AYMA 3M7VA 1UPPA 2XCAA 4J7CA 5C42A 3LP0B 3MMAB 1HWUA 1JXEA 1RT5B 4IFYA 1H2UX 3GJRB 5E7OB 1U2CA 4ZPBA 2QYCA 1FEEA 1XEZA 2E1AA 2ERRA 3VAMA 4YS2A 1S6PB 3G8QA 4KRWA 1YJ7A 4E2FB 2A6MA 4FVMA 4NLDA 1G7CB 4HI1A 5B08A 1SUQB 2FC9A 2VFUA 2GJ2A 4WU3A 1S9FA 1UPMB 1NSPA 3DU5A 4FPRA 3PW4A 2B4VA 4DSEA 4DZDA 4JI1J 2W8KA 4TYBA 2UU9J 1R27B 3T1HJ 3TAMB 1CC7A 3NWGA 1Q5YA 4OI1A 3KLVA 3CF5Q 1I1GA 3OR2A 2DD8S 1HR0F 3W5ZA 1EHWA 2B7BB 1RWMB 3MUTP 3Q89A 1Y0HA 1FFWB 2HWHA 3DU6A 5KFYA 4I4BA 3AY0A 2RILA 1IVZA 2WOMA 1UZDA 2LQ5A 3TX8A 2MXYA 1HQEB 4ELUA 1X9SA 1N5SA 3Q24A 2OSRA 2HFNA 1FJ7A 3PRBA 3HHLD 4ZDNA 1RXOB 5KFLA 1ZH5A 1UWBA 5IC6B 4K0KJ 5E41A 3W2WA 3BREA 2HK2A 3SDEA 2G13A 4KIAA 2LEAA 1ZBTA 3D3BJ 4LFCF 2FHKA 3E2EA 4KHPJ 1RTJB 2P5VA 1VLOA 1TKDA 4YP3A 3MF5A 1XN9A 2B9YA 4YDDB 4N47A 1B0PA 2VA3A 2WBMA 1H2VZ 3QIDA 1LFWA 3B54A 2DRBA 1DQAA 2VA2A 3CCES 2Q43A 4PWDA 1MROA 1T03B 4F3QA 1IM4A 3CJ2A 3LWLA 1U8SA 3JSYA 4M5IA 2OUGA 1R8CA 1RA7A 4USMA 1DTQB 3M1VB 3HT3A 1Q78A 2CKWA 4MT1A 3MEDA 4V19X 4KV8A 2AJ1A 4NXMF 4MKAA 2R2UA 1K1QA 2VU5A 2DNPA 2NR0A 2MSSA 3HX9A 1S6QB 4FF2A 1U02A 3DRRA 3CD7A 2DNLA 2FJEB 3Q83A 4EBDA 1RT1B 3FSYA 4O3RA 1JK9B 4UQTA 4DCJB 4ETXA 3FNNA 2VPWB 3FFIB 1VBYA 1DQ9A 3P49B 3HZEA 3PFOA 1XNQJ 1NK7A 1RHRB 3OV7A 4RNHA 5KFPA 2FD2A 4KFBA 1T7PA 2QMWA 2VASA 5B0FA 3M6XA 4ZKAA 1MMDA 1O0PA 4DR1F 3KLEA 2ZC4A 3PHTA 4J9MA 3BKUA 5AXNA 2AJFE 3ZNUA 3C66A 1BQMB 1R0AB 1K8AT 5HAOA 1OY9A 2IDLA 2HHVA 2P9CA 1QJHA 2H51B 3H2UB 4DPWA 1N52B 2KYZA 1JB0C 5KT4A 5H9EJ 2BYCA 1FNXH 1RTDA 5F9LA 4C4WA 1Q82T 2VG7A 4RNNA 4AFFA 1N54B 2QO3A 3V6KA 2CPDA 2PD1A 1N56A 4A8SA 5KFFA 3FBCA 2QTWA 4DX7A 4N8OA 4NLQA 4JI5J 1AW0A 3NMAA 2OJ3A 5KOWA 2L41A 1Z2ZA 3HHKA 3Q8RB 2HBRB 1X5OA 2VH7A 1EKSA 1S0OA 2MZQA 5EN1A 1JKHA 3PG9A 1XR7A 2QEXS 3D2WA 2VBXA 1W26A 3RBEA 1U8WA 1FKOB 1DY3A 3MXHP 1P9QC 1HW9A 3MM9B 1LWXA 3NOGA 1WHYA 3HI9A 1ZM3A 2HVZA 2E29A 3VWSA 1HWKA 1NRKA 3M8YA 1U48A 2YNGA 1S9EB 2RF2A 1XQIA 5T7LA 5DLFA 1HMVA 4OJHA 4LRBA 2F8MA 1QVFR 2W2MP 1N8RT 4DCPB 3U7JA 1NZAA 2F63A 5HMYA 2K7KA 5H9EK 4DV2J 2BE7D 1P9YA 2W9BB 2PIIA 4I56A 1WTFA 3QT7A 5HANA 4WIIA 4FYVB 1YVFA 2O67A 1YQHA 3DOMA 4C2MA 3W8GA 4DSJA 2BABA 3SV4A 2RUSA 5A8RA 1CG2A 2FHMA 1JLQB 2EI5A 1D09B 3TA0A 1SH2A 2BMBA 1MWQA 2BUNA 2IVYA 2AJ2A 5KG1A 4DV4F 2PN6A 3TI0A 1G6BA 3OFHA 4XDCA 3IC1A 5C42B 2YXLA 3PACA 1SIWB 4KQZA 1T94A 3ISZA 4IFYB 2HZVA 3CJKB 4MIAA 5KG6A 3O6QA 1Y4ZB 1XMOF 2ZZMA 3AD7C 1LK5A 1NUEA 3M4XA 3RZAA 1JWWA 1KDNA 1FHTA 1IUJA 5LXRA 2DCLA 5J2PA 5DG9A 2XZTB 4ZVTB 4DL2A 4LIRA 2OTJS 1RWKB 2B7CB 4DN0A 4PABA 4ID5A 4CT8A 2ZH2A 4KPYA 1ZTWA 2IYGA 3QRRA 2E7VA 2VD3A 3GE9A 3CXCR 3FSIA 4J9OA 4I6YA 3OR2B 4X4SA 3CCLS 2VPXB 2J7WA 2RSQA 3LAMA 2AP6A 4ZJQA 2LVWA 3KLHA 4CZCA 3G4SS 2UZAA 1PO6A 4NA1A 4E98A 3E51A 4LSLA 4U8VA 4LFBJ 5E3QA 5KFZA 4USIA 1FJGJ 2WOMB 2UXCF 3G6VA 5A76A 3QIPA 2YWGA 2HHXA 4JBCA 3CT9A 4J37A 1H0HB 4CNYA 1J5OA 2AJ0A 3LF0A 3DRXA 3CWJA 2DBBA 2P9EA 1UWBB 2YKPA 2RIJA 5G4DA 2YNFA 3F44A 2J0WA 1SC3B 3SDEB 4KBIA 4KE5A 4P2SA 4OJ3A 4DUZF 2YPZA 2IRXA 5I3PA 4NA3A 4DMZA 3D0GE 4JI7J 1T9WA 4UTGA 2CNLB 3KFWX 2N4DA 2UUTA 4DPXA 2M4MA 1SI9A 2RD5C 1MMNA 1Q4RA 2EBGA 3G6YA 3PFEA 3FCHA 4M95A 2J9EA 4ZCKA 5DDOC 2FHOB 4KB7A 5DM7Q 2JVOA 3NS6A 1T8EA 1WDDA 4CO2A 1M5PC 4RWXA 3TP2A 2QL5B 3IMQJ 1B99A 2R4FA 2LYVA 3ONQA 2BE9B 4YR0A 4H4KA 3RR8A 4PWDB 3UN2A 2FPHX 4QIVA 3HVWA 2XYGB 1TUWA 3KLFA 1HNWF 1Y9OA 4DQSA 5KT7A 4QU7A 2ZFHA 2E66A 4OI0A 4UOFA 1NHUA 3SV3A 3GR0A 2H5IB 2G9OA 1H73A 3W2VA 1APSA 2CPHA 2E7XA 4L3KA 4KV8B 3R27A 3JQKA 2N82B 4CNZA 3HF5A 1TU0B 3CDBA 1KOHA 3D5MA 4LRCA 4IUFA 1LOUA 2R2RA 4GC7A 3UCGA 4O0NA 1ZETA 3DRRB 3I5BA 2NSCA 1FTRA 4PWUA 4RU9A 2HMIA 2WZ1A 2HSEB 1HLWA 2M9KA 4CO3A 3NGKA 1NDLA 1X9WA 3SCLE 2DO0A 1SJRA 4X4TA 4FYWB 1FE0A 1UETA 2FY1A 2RNEA 2R9LA 1FT8A 3QAEA 2ZNYA 2ROEA 4C3KA 2ZHAA 2GC8A 4DV7F 3KLEB 4ELVA 2N3OA 3MOZA 2XY7A 1UTAA 3EVOA 3WHIA 3P8BB 4OZ5A 2EFVA 1LWCA 4OHWA 1M1HA 3J81j 3TX0A 2VG7B 2BJ1A 5IZHA 5FIIA 2BRLA 5L1JA 4HKQA 3D7SB 5KT5A 2VFTA 4RU2A 4C98A 1HBMA 3OD2A 4L6V3 4P10A 2EWHA 2OD4A 3TWZA 1JNRB 4FF4A 4G1QA 2FLLA 1HHQA 5E5NA 4B08A 2ZBPA 1JKHB 1LQ9A 2KU7A 3T5KA 2IDEA 2IM3A 4WFBQ 2XLKA 1SBRA 3CJ5A 2FVQA 2QIFA 5C25B 4NI2A 2NREA 1M1GA 1B0VA 2HQCA 1IKWA 1FK9A 5F8JA 2YQ1A 3O5TB 2DPIA 1Y7PA 2COLA 4DU8A 4AE5A 1QUPA 3M9MB 2LFVA 4B3SJ 2J6TA 2YWWA 1KKHA 2KI2A 3KJVA 4K4TA 2YNGB 5L9XA 3EZ5A 1BMQB 2RF2B 5T7LB 3CJSA 4ED6A 1DLOA 1U1LA 3IWLA 1HMVB 2BKPA 1ZM4A 4I69A 2RQMA 4IFVA 4OX9F 4IH7A 2NXNA 1UFWA 3QZ7A 4A8QA 2ZD1B 4JI1F 3NWRA 2KXHA 1WC4A 3DDKA 2UU9F 3NRBA 2WSCC 3LGNA 3T1HF 3HZGA 4OV1A 3HD1A 1IBKJ 5FLXY 1OQ3A 4FKYA 2DGWA 2QG9B 4WPAA 3DOMB 1WDTA 4USUA 3LANA 5A8RB 5JMNA 5CD4A 3SQGA 5IQQA 1KNZA 2HLUA 4OMFG 4V19J 3KUGA 1RWXB 2OPSA 5HQMA 3EJMA 3G71S 1N34J 4XAKA 3R5DA 2D7SA 4Y0FA 1FDBA 4BBYA 3BQ0A 3W65A 4DS5A 3X1LB 2DKOB 1H7XA 5T14A 1QY7A 1NMEB 2HHUA 4PG7A 4BC7A 3L4BC 3M9OB 4JI4J 1VBXA 5F8IA 4ZVUB 2XLJA 4WTOB 2IM0A 2C3UA 4CWBA 4DUYF 1Q8KA 2XCPA 2CPJA 4QIWD 2CQCA 2MDAA 4UUXA 2MPUA 1BQNB 2ZWOA 3W63A 4F4WA 2QLWA 2O01C 2V68A 2H5JB 3TRGA 3R1LA 2F5GA 1QAXA 3N0VA 3B8HA 1S1VA 2OPRA 4ID5B 1IBLJ 1X4GA 3KHLA 4CYUA 1RHKB 5IT4A 5J1NA 3HVRA 1TQLA 5BR8J 4NLRA 2VBYA 1S72S 3V4MA 2V8GA 4FDFA 3M9NB 4E0DA 4QWCA 2G2ZA 3MPVA 4IH6A 2IRUA 1YZ6A 4Y34A 4P9SA 2VV5A 5GMEA 4NMXA 3MD3A 4DV0J 4C7QA 5AJ3J 3I9ZA 3IM8A 4RL1A 1TKZB 3H7HB 1DURA 2MHNA 2CXEA 4LSLB 1UEVA 3RW6A 3DLLQ 4NOHA 4ALZA 3ZZYA 3B4MA 1HBUA 4KAIA 3LQVA 4DF4A 3VCDA 4O0IA 4NE9C 3QIPB 1H74A 4I67A 4Q2MA 1RA6A 3HDSA 1GMUA 1WJ9A 3BPSP 1S9GA 4EK2A 1FESA 2GNKA 1J5OB 2F8EX 1RWNB 4WFZA 4WYWA 3T41A 1YJRA 2WONA 2YNFB 1FEHA 1I94J 4OLOA 4K4SA 2Z2YB 3FCWA 4FBTA 4DV6F 1A6LA 3LUYA 1KVJA 3PIPQ 3DOKA 1NU4A 1X0PA 3QQCD 5CQGA 2FJWA 3QNWB 4JV1A 1HIYA 4FKXA 4LRAA 2B5JA 1HBOA 1P1TA 3C15A 3MEEA 1N32J 5GVQA 1IXKA 2YKMA 2IHR1 3JAMU 2OEJA 2J7UA 4IO1A 3A3PB 2G2OA 4M5LA 1XNQF 2E5IA 4QPXA 3UNGC 2B9WA 2RDIA 3TOQA 2HWIA 3RB4A 2D1CA 1DFDA 2V2KA 4RW7A 4Y2AA 2RS8A 3BSCA 1X4CA 3VGTA 3EVWA 3OXLA 2QL9B 3TEGA 3R7SB 2VZ9A 5HQLA 1EETA 4OZ1A 3PNIA 1Z4UA 2LMIA 1NKEA 3W2VB 1WTBA 2NZ4A 5RUBA 1YJ9S 1HQUA 4W92B 3OVAA 1JJHA 5A6PA 3UQSA 3AD8C 4N56A 2FJBB 2QMUB 3BSAA 3P3DA 1YRTA 3OSNA 1FDAA 3QSIA 4NZ7A 4QZVB 4HYKA 1D9FA 1JXVA 3HT0A 1L3VA 2YNIA 3QJJA 2OLWA 4P73A 2DJWA 3GIRA 3CJTA 3MEGA 3RG6A 2EKYA 4OQJA 2HS0A 2FYXA 5CCLA 4M8LA 1RTHA 2ZWPA 5A8KB 4OYOA 5B0AA 4ANCA 2APOA 1FO1A 3TNVA 1VQ9S 3T1YF 2C1EB 2DY9A 3KHHA 3WBZA 4WK1A 2VOPA 3H5XA 5BYSA 1RYSA 1LWCB 5CZVA 4DSKA 5I42A 2NPIA 3PJ9A 1EP4A 3AB2B 2B9XA 1NAQA 4F4AA 5AT1B 3HP6A 2P8IA 1HBMB 4DV2F 2J5AA 1H7WA 4AXJA 1I3OB 3KK2A 3GG1A 2H3EB 4C8OA 3H59A 4G1QB 2HAIA 2W9AA 4DLGA 3MR5A 2PEHA 4AL7A 1UCNA 4S0MA 4JI0J 1SKSA 3Q8UA 4G3IA 2JWNA 2ZH4A 4NYOA 1UP1A 4NI2B 2PMHA 3QPIA 1IKWB 2OMLA 2XMJA 1LFPA 1FK9B 1UJ4A 4KTQA 4YB6A 2AMCB 2KRRA 1WNEA 3BSNA 1CJTA 2YX7A 1RWWB 1HD1A 1UL3A 3D1HA 3UVJA 3KJVB 5C24A 1FWLA 2I8EA 1MNEA 2CQPA 3CULA 1PYTA 1DLOB 3UO0A 2WSFC 4KHMA 2CQBA 3QJLA 1YJVA 1YLXA 4B3TF 3RTVA 2J6SA 5DQGA 1BD6A 4FNHA 4C3MA 3OTOJ 2ASYA 2HQDA 4IFVB 3L3CA 1KVKA 2M2BA 1U2RA 2XSJA 3DRSB 3KK3A 1N5YA 2CDQA 1HWLA 4DX8H 1QLNA 1U09A 3BR9A 5HLFA 2M8HA 4QIGA 1NK0A 3QWUA 4X4VA 3TJ8A 1GTHA 3EGWB 5HSPA 2XSFA 2ZJPQ 2LEPA 3SQGB 2H48B 1WHWA 5JUMA 4CLYA 2FGCA 4CLTA 3CCMS 2AU0A 2CJYB 4NEZA 2HVIA 5F9NA 1TV6A 4LF5J 2KG0A 4LFBF 1RAIB 3U02A 5IFMA 1FNMA 2MKHA 5IQ6A 1FJGF 4NWBA 5IV3A 3SEOA 5DGAA 5K5MA 1OPZA 1FJEB 4EFAC 3RUBL 1LKZA 3TO8A 1PAUB 3UCUP 1N5VA 3CCZA 1ITPA 3SSSA 4IQMA 1C1BA 4KH0B 4YY3J 1ZZNA 2E5GA 4CTAA 4JI6J 2FZCB 1S1VB 1EB0A 3VV2B 3L95X 2OPRB 4X4OA 3GFZA 3M2RA 2Q3PA 1D9DA 2KKHA 3MCMA 2VQFJ 2ZE2A 2MMYA 4CYUB 1MN7A 1K9MT 3DLJA 5J2MA 1AUDA 2J8AA 2OSQA 3GLJA 2MZJA 1WKKA 3ZZPA 1O8BA 1GMWD 3S7RA 5AXMA 1U1MA 1HNZF 4L72B 1AXQA 3M8QB 2LCWA 1R8PA 1F9HA 3C16A 1LW2A 4O23A 4DBQA 2YNHA 3M6VA 3MPDA 4TU8A 1RSCA 3T19A 3EPIA 2JJ4D 3KWMA 3N5BA 3K5OA 2HGNA 4U9RA 1YJNS 4WXWA 3T6BA 1SL2A 4UF4A 4K4YA 3PO4A 3UCZP 4F7VA 4MTPA 3DLGA 1S9GB 5LT5A 1VHFA 1F3VA 1O51A 1D3WA 1RAHB 1RHMB 3EX7B 2BA9A 3NNAA 3CJQA 4JYAJ 1S99A 2WONB 4PUOA 1YBAA 4CLFA 2XGPA 3CE8A 2LECA 4P75A 4HDHA 2IY5B 5GAHU 4D3HA 4K4UA 1OYDA 2IIHA 1X4HA 2XZDB 3DOKB 2DHHA 3M8PA 3QGHA 2XMKA 4F50A 4CP5A 2HFZA 5ETQA 1L3SA 3R9LA 2B5JB 2CYYA 1I5OB 1HBOB 3GV8B 3T5HA 5D4NA 2IA0A 2MKYA 2QGFB 3C15B 1MG7A 1NSKL 3MEEB 1TK0A 1WACA 4O44A 4F26A 2XM3A 1X5PA 4CH0S 1Q5VA 4B3MJ 1XIQA 4N41A 1WI6A 3QT6A 3OUYA 1YRUA 2V4QA 3D6TB 1TP7A 3ILOA 2AV5A 4F8RA 2A18A 4F0HA 3PV8A 3GPAA 4OI4A 1TAQA 4P2XA 2O1PA 1EETB 4YR2A 4KKOA 4J9VA 2FJDB 4ZJOA 3MM8A 4KT0C 2V8HA 3W64A 1HQUB 1F9FA 2DGUA 4QWEA 3R6GB 2HW3A 4YHHJ 2I5JA 3DM2A 4ZIWA 2GJFA 3LW5C 4MKVA 5LMUJ 4LR8A 2ZBRA 1FE4A 5C5JA 4ZVSB 1U26A 4L3NA 4ZP6A 2DVIA 3ILLA 3PYDA 4JV5J 4ZPVR 2GZOA 4JUZA 4WIQA 3G96A 2CNKB 1RKJA 1SJ3P 4O4RA 1R43A 1CQNA 2F4VF 3CDWA 3U27A 4IKAA 1S0NA 2MQOA 4CH7A 1XWLA 1KQKA 2R8KA 2UUCF 2A1BA 3PYEA 2B56A 1RTHB 3B4DA 1S0MA 1U1QA 1S7HA 1F5CA 1LXNA 5ETMA 1CQMA 1DTTB 3UDLA 2A0FB 5ETOA 4AD6A 2PGCA 2DGXA 4KGXB 3KNGA 2IC3A 4R0JA 4NXNJ 4Z2XA 3D0IE 1RAEB 2YX1A 4PQAA 2OH2A 1Y3KA 3BSOA 5DG8A 1J27A 5CABA 1IWAA 2H4WB 2C3MA 2MQQA 5I42B 3DC2A 3D3CJ 3SCIE 2IBOA 4ED1A 4ILLA 3Q86A 4WU2A 1BE4A 1SC6A 3SZ2A 2VICA 1RHJB 2MZRA 2BW7A 5KG4A 1JX4A 2XY6A 4MKBA 5E3RA 4LRDA 4RBUA 3KK2B 1SH3A 4CO5A 1JLEB 3M6UA 3PM9A 4WE1A 4M5KA 4A47A 1OYEA 4UZCA 2DHGA 2DNMA 2DNNA 2CJBA 1N34F 2RRAA 1FRKA 3UNYA 3AOCA 2EFGA 3I32A 1UJ6A 3EMTA 1VRUA 4QQBA 3OVSA 3VZIA 2E5LF 4K4ZA 4ED0A 3CGIA 4LFAJ 4X84A 2JEFA 2Z2ZA 4O3QA 3CC7S 5ETTA 2ZC3A 2Z30B 3BEGB 5D0EA 3BQ1A 4I64A 3ZTOA 3OJUA 2GHWA 2KM8C 4ECSA 2XSJB 3W1YC 3KK3B 3V4IB 3BYPA 1N5YB 1KTVA 5L1KA 1IBLF 3W3SA 1KP6A 3WC0A 1FFSB 4YFUA 5HLFB 3GV5B 3AJ2A 4CI0B 4RW6A 3R5BA 4ITSA 3ZC4A 4ZLNA 4B17A 5BR8F 3KHRA 3QFHA 4EEYA 3LH2S 3QGIA 3RBXA 2BV3A 2O3DA 1HPZB 3DKDA 4HDGA 4CCHA 3DRPA 2EEYA 3SXLA 5AJ3F 4DR3J 1TV6B 1UEKA 3FUYA 1CJUA 1U6FA 5ETPA 2CQGA 1OY6A 4F04B 4CH1A 4OHZA 3PKYA 1U1PA 5LSOA 4AYBD 3VF0B 5D4PA 5K8MA 1TKXA 1N4LA 2ZKTA 3X3UA 4OHXA 3MAAA 1U6ZA 4F0MA 4CLLA 2Y0SD 2WRMA 1X5TA 1SKRA 2LEBA 1RAGB 1KS2A 1VRTB 4X62J 1I94F 4CTAB 2XO6A 2KYXA 3TUPA 3T3FA 4DL6A 2ZOMA 2OIHA 3KJQB 2P6SA 4LIWA 1KR4A 3NEKA 3MCOA 2ZVSA 3M2RB 3L09A 1LWEA 1OWXA 2ZE2B 2CJ9A 3VVUA 2ALYB 3O8WA 5J2MB 4Q0BA 3D6MB 8RUCA 2Y1JA 5U47A 3KG4A 2BJ7A 5F8LA 2HKEA 4OFZA 4EMDA 1X4EA 1RBAA 4FP9A 4BWMA 5CXTA 3C16B 3ETMA 4OZJA 2YNHB 3MTJA 2RS2A 2QN6B 1KQFB 1FRJA 2WSEC 3OR1B 3D67A 2UV8A 1TMMA 2HFOA 3CCJS 4IO9Q 4MKYA 1VQ6S 1M5HA 4EYHB 4LBHA 4PXEA 1N0UA 3S01A 4LQ3A 1GEHA 2RE1A 1X60A 4P52A 3DLGB 3KKFA 1E6VA 5CCMA 4BWJA 1BWEA 4TY8A 2JLFA 2W4DA 4LVOP 4B9MA 3GYNA 1Q53A 2BBEA 5ETKA 1UMJA 4PUOB 3SI8A 2BANA 3H5SA 3TA1A 2IA6A 3UD4P 3THPA 2XWYA 4A8OA 2V8VA 1WEZA 1PJ7A 3M05A 2R7WA 2XMMA 2GQQA 2CRLA 4XTTA 5AXLA 1CPZA 2B8PA 1WG1A 2R7OA 3AB4B 1OIAA 4DV1J 2DNOA 6AT1B 4O44B 1VQSA 4ZVHA 1VJWA 3EGZA 3BV8A 4KGKA 3UFCX 4K4WA 3GIIA 4DQPA 3OFFA 2AW0A 1VQMS 3TYTA 5GADU 2GQCA 4X66F 1P8GA 3G8TA 2IMWP 3Q8QB 3DLKA 3C19A 2UVVA 3PXGa 2JFKA 3MPWA 3ZZZA 2IFXA 1X4DA 4KKOB 4DQRA 1V3RA 1PJ6A 2BACA 4EZ9A 1CULA 4QR2A 1K73T 2HWTA 3JSRA 3DM2B 3POTA 3G6ES 4FNIA 3C3LA 4J9QA 2CIMA 3KUHA 1PC4A 1S48A 2ZHBA 3KTQA 5DDPC 1NO8A 3BKTA 4F25A 1IKXA 1J2VA 2P6TA 3ISND 3TZZA 4HL9A 2XS7A 4DSLA 1H72C 2PE8A 2HZCA 4QIEA 2LU2A 4R8UA 4ED3A 1ZTTA 1B7FA 1WOPA 2P9GA 5GAEU 2R7VA 3WC2A 2DCUB 3IBCB 1ACMB 5HO4A 1QE1A 5HROA 4HEA9 2ZVIA 3IFEA 5DQHA 4UOCA 3NXZA 3HMJG 3W9JA 2QT7A 1GT8A 1TAUA 4U96A 2GAHC 4Q8FA 5KFGA 4PAAA 2HQFA 1TK8A 1IJFB 4B3OA 2IC3B 2CG4A 2UVUA 2OD6A 4NL5A 2JC0A 4RUCA 3Q8VA 3OTEA 2K2PA 3FQKA 2NYHA 2W2OP 3FCVA 2F9DA 2BJ8A 4I2QA 1P6TA 3OTOF 4C8ZA 1U0HA 3R6LB 3HJFA 3MM5A 4DJBA 4DR7J 2MHEA 4DN9A 3HHNB 3I9V9 3IA0A 3W8PA 5LM7E 4ED2A 4K2XA 1HNXJ 2PMZD 1U45A 1KFSA 3ADAC 1SL0A 4KO0A 1X4BA 3QYYA 2Y1RI 3N6NA 4WE1B 1N5QA 4DXLA 3FRZA 1JLCA 2ATCB 4CM2A 2I38A 1WKJA 2R7UA 4YR3A 2HURA 2EW9A 1SQGA 2FHJA 4WFYA 1OY8A 4ECTA 3NKYA 4LF5F 2ASDA 2MZSA 3K2YA 1DJ0A 1IWGA 1VRUB 1F1BB 4QOTA 2WW4A 1VQLS 2AF6A 2J8SA 1RTZA 2CQ1A 2KH9A 3OSPA 4O3SA 1Y00A 3CC4S 4L76A 4U95A 1TUGB 4ZK7M 1NPRA 3VHQA 4TLRA 2EFPA 2AEMA 3M2VA 3U1LA 5KOXA 3Q8PB 1KHVA 2DGVA 3I5AA 1VQNS 2W2NP 4ZCMA 4A8WA 3V6JA 4RW4A 4JOUA 5KFHA 5GAGI 1XTZA 2HEKA 4RW6B 1VK8A 1TR0A 2FJVA 1KC8T 1W25A 3QWPA 3LWMA 1X0FA 2HAFA 2EK6A 3K5PA 3R1HA 1HNIA 4KC5A 4B9SA 3JTNA 1BWVA 3DRPB 1YX2A 3A13A 3EDQB 5EUHA 4B9VA 2F4FA 4AQYJ 2ALZA 4EZ6A 4DR6F 2HLTA 3H40A 2CADA 1R6YA 2OEMA 2NYIA 3TJ9A 4MAKA 3OBIA 2CJQA 2QC3A 3MMBA 3AA9A 1TKXB 5DRKA 3MAAB 4ZHRA 3FBFA 4I6AA 2V5HG 4DG1B 1VQ8S 2ZH8A 4PG4A 3HHLC 1XK8A 4O3NA 2DR6A 3N01A 2L3MA 1NM2A 2HBQB 3LO3A 2NZCA 3PYGA 3CCVS 5A2QY 2V50A 1S1WA 4B9TA 3FJ2A 4A8YA 2RT3A 4OJ1A 5CYJA 3SCKE 2ZH3A 5HVHA 2K06A 2KJVA 1LWEB 3WQPA 4BHQA 3D68A 4ZLLA 2ZM6J 4L73A 2W4PA 5AXKA 3JQMA 2OO4A 1NHKL 9RUBA 3ELHA 2V69A 3AHPA 3FEXB 3K0JA 4CLKA 5D4LA 2WBRA 2YWKA 1B7YB 2YKAA 3MCNA 3CDEA 4FS1A 5KG5A 4B3MF 2I2YA 1PCAA 3BF4A 3CCQS 4RNFA 2GJIA 1CVJA 5FD1A 1DHMA 3DLBA 1ICEB 4X2BA 4X4PA 1HQ2A 3A3NB 2HFUA 4EGLA 3UDCA 2QSFA 2HBYB 3VTIA 3HFKA 1E6VB 4XK8C 4TY8B 2ILZA 3SFGA 1B4SA 5H1SV 4ZIVA 5KFVA 5F8MA 2XS5A 3GSDA 2BANB 2ZH6A 3LPYA 5FLXU 4YHHF 2HK3A 1WI8A 1F60B 2AKWB 3HLUA 3VAGA 4EUVA 5LMUF 1S6UA 1YHQS 2Y3YA 3BN7A 4DZ6A 4Y2CA 4DX5A 4JV5F 4P2MA 3EZUA 2JL9A 2V4JA 3CSKA 3FVYA 4OHYA 1JJCB 4DPTA 1IJEB 3IM9A 1WC6A 5KFMA 1LWFA 1RK8A 2ZDPA 2F8HA 2GS8A 1HD0A 4N5SA 2W2QP 1C1CA 2OPPB 5L9NA 2XMWA 1TL7A 2GGPA 3DLKB 2OELA 2KG1A 2Q6BA 1U6BA 3CD0A 5B0CA 1BHNA 2G0CA 3TAQA 1FI4A 2ACMA 3BDPA 1CULB 3FBEA 2IRYA 1RT7B 1LW0B 3KJFB 3POTB 1NJYA 4KHRA 4NRTA 4RUBA 4UOHA 4K4VA 2KO1A 3GCXP 4OIXA 2W8LA 1S1XA 3DYAB 3BGUA 4TU7A 1YZ7A 3R7BB 1IKXB 1UA1A 3GIKA 1URRA 4MIBA 4QIFA 5L38A 3BGRB 3O44A 2LQ8A 1YDLA 1BUXA 3EUNA 1I6JA 4F2RA 1FWPA 3KG0A 1QE1B 5HROB 4ILMA 2IMOA 2B3TB 3JYTA 1FXLA 5KFOA 5CA5A 1ZOTA 2B9EA 1U25A 2X3GA 4F3MA 3ZZOA 2MKKA 3RGIA 1D9AA 2RMLA 4USTA 5AE2A 2DISA 4L74A 4B3OB 2EFOA 2H54B 4B9NA 4MK9A 2K3KA 4LBIA 2QFJA 2MEWA 2UV8G 1PBUA 3J7YI 4LFAF 2XYHB 1RT6A 2ZJRQ 3PO5A 4X4RA 4ZS6A 7FD1A 2YTCA 4I2QB 1HR0J 3OT9A 3CCWA 2PFDA 3PR4A 3MM5B 2RHSB 3RAMA 3VQTA 4W4MA 4U67Q 5HBMA 1RT2A 4A8MP 1ZA2B 4F4XA 1NK4A 3CJ4A 4KO0B 4DSIA 3N79A 1JLCB 4ID8A 1X4AA 4QU6A 4ERDA 4TU9A 1OSCA 5ETLA 3DNCA 1RLCL 2EG1A 3B6BA 3QAUA 3R8YA 3AAWB 4PXCA 1MN9A 3LALA 2HHPA 2R3VA 5CHCB 1XC9A 4PXDA 1TTHB 3EVMA 4EI2A 3HKZD 4GVLA 3G82A 1S76D 3QT5A 3MPUB 5LJ3Y 4QPTA 2D69A 4PG6A 5C7PA 4UZBA 2ILYA 1RADB 1I51B 3DGPA 3RB0A 4I2PA 2YWEA 2DH9A 4X62F 1RGVA 2NCKL 4F0KA 3Q2SC 2HHHF 2LQ9A 3M2VB 3SSQA 4KSEB 2VFVA 4LF6F 2MZTA 4MFBA 1FRIA 2JDJA 1ZM2A 5F8NA 1BY9A 5DM6Q 2B4UA 2MGZA 3ZTPA 4A46A 2R42A 4RW4B 1SV5A 2K1RB 2B0GA 3ENAA 1SH0A 3NGRA 1KN6A 4TKTA 1FNOA 5L1LA 1J5EJ 1FDNA 2M8DB 2AD9A 1JJ4A 1HNIB 1V3ZA 1VQ5S 1HI1A 4EBEA 2FZKB 4K7QA 2AHOB 1MWYA 3G2XA 2LKZA 4WKRA 2HFVA 1R8BA 4QYRA 2GHPA 2YVSA 1ZYQA 1NB2A 5HMZA 3IAM9 3FZ2A 3OW2R 3HFVA 3MMCA 5LL6d 3PW7A 2HIQA 3JTOA 4DFJA 3MMBB 2QA2A 4PKDB 2EC0A 4ZHRB 4PRFA 1CBKA 4CQ1A 4LR9A 1WUUA 2JSXA 4M1KA 1JIHA 1GX5A 2Z58B 2ZHOA 5ETRA 1JJ2R 4LSZB 3J7Z5 2OMOA 1UVNA 2ABYA 5E33A 3J81Y 1S1WB 3Q23A 2DPJA 2WVCA 1RCOB 2HGLA 2AYGA 4M5JA 4LSNA 1YTYA 3M30A 3TAPA 2ZNZA 2DNYA 3TA2A 4F02A 3D6FB 4MH8A 3JSBA 2RU9A 3K5LA 2R8HA 4DV1F 3LGHA 1C0TA 5DQIA 4TY9A 1CJVA 2BXJA 4NZ0A 1VI7A 1KFDA 1RISA 3J80Y 4WZMA 1GNKA 3OL7A 1IN0A 2VL1A 2PDAA 4ZPTR 3UR0A 3PKMA 3IAS9 2NXUA 2RH3A 1XMQJ 4PR6A 2PO4A 2DXDA 2DRAA 4K5SA 4USJC 2M7SA 2WHOA 3ZFVA 4WBFA 1NCLA 1CEZA 2I9SA 2V9WA 3K17A 3I0RA 2VQEJ 4DR2J 1QAJA 2NPFA 4UOGA 3CTRA 3NCPA 2OP5A 2BM0A 2ADBA 5D4OA 1WHVA 1FJCA 5EX0A 3IR6B 1GAOA 3F73A 3MGJA 3N6LA 3OTDA 2BQRA 4FPIA 2R7SA 3ENWA 1QSLA 3KHGA 1GK8A 1E6YA 1M0SA 2RU3A 3PW5A 2N7CA 1NDKA 2RDDA 2V4JB 2B4OA 1RHQB 4J91A 3DHXA 3FZBA 3QJPA 3JAMY 2Y1LB 2R8GA 3OFEA 5KT2A 2FQQB 2OPQA 3SYZA 2DHXA 1LWFB 2GQ2A 1IQZA 3GR1A 1C1CB 2XTJP 1S6PA 1UW4A 2GGPB 1YBUA 3SSRA 3Q22A 1IR0A 1VQKS 4RJVA 3CEDA 2L48A 1N48A 2V9KA 3TEHB 4OZNA 4IDKA 1FCAA 4ED8A 3UD5A 3AT1B 4OX8A 4DR5F 3DDNA 2X1AA 1U0SA 3I56S 3GU0A 1PSDA 2IJNA 1XNRF 3GILA 2VKZG 3CIMA 3MD1A 3C2PA 5D0GA 2FZGB 4FZVA 4I68A 1WG5A 4CLPA 1TL4A 3M8RA 1QUVA 1S1XB 4DQIA 3ICLA 3EXYA 5FJ4A 1NK5A 1O6XA 3US5A 1FKPA 2IPOB 3M8SA 4DV4J 3W2WB 4WYLA 3R97A 1HNXF 2MTLA 3S6EA 2X1BA 4WCEQ 5IXUA 3BDEA 3PEHA 3HO1A 3IBWA 1WF2A 2YH1A 2HRTA 3D66A 3A8IA 4LF8F 2HHQA 1SIZA 4IYQA 4ECRA 3UW1A 2NXEA 3JYTB 3R2DJ 7FDRA 2EPIA 2UXBJ 2MKCA 4IG3A 3KK1A 4ZA1A 2YX4A 4ANDA 4LUBA 1VJQA 2G0IA 3GQCA 2EFQA 4UY85 4WKYA 4CLWA 2XS2A 5HMXA 2GO8A 4ECXA 2AGQA 4I0WA 2D3UA 4NASA 1VRQC 3C6UA 5THWA 3GB0A 3C8YA 1MROB 3MI7X 4ZPAA 3EE3A 2MZ1A 5LJ5Y 3R5CA 3EXCX 5KT6A 2GHVC 2W01A 3RAXA 3M6WA 1C4AA 1VIXA 2A3JA 1YI2S 4Y00A 5HBMB 1RT2B 3D1OA 3DGVA 3MEDB 3MDFA 1T02A 1WOSA 2D41A 1RUSA 3HKWA 5EGYA 4F36A 4FF1A 1VQPS 5K8NA 1TFYA 4H54A 4I1TA 2AGOA 5EX3A 1SB6A 2ASLA 3CO9A 3HHLA 1DTQA 3N9UC 4A8KA 4FYDA 3TQEA 4USKA 4XPCA 2W25A 4CRJA 2JLGA 3EGNA 4ED4A 3EWGA 4DUZJ 3K5MA 1NHVA 3G82B 2F1FA 4FN5A 1WC1A 4KFBB 1R8AA 1N33J 2AJQA 3VR1A 2B4PA 2YKOA 3DGPB 1GQEA 1S5ZA 4P7VA 2B51A 3MR2A 1FRXA 1S4EA 4JI3J 1WORA 1NK8A 5L39A 1EARA 4IOBA 4PYDA 4RZRA 3BJYA 3PX4A 1NBEB 3P5TL 2MGZB 3SFUA 1RTDB 3MR6A 3MPYA 2KFNA 3R5GA 4FYXB 5KFTA 5FDLA 2RJZA 3MAQA 1TZ0A 4PXBA 4AL5A 3JS9A 4M5GA 2GVZA 5D8HB 4H4MA 2IJFA 1HL6A 3RRHA 5KFBA 2FVPA 2G2YA 1KLMA 2QLXA 4NLOA 3NBPA 4JV0A 2BJEA 4MK7A 3MMCB 4QCLA 1SPBP 4C97A 1OJ4A 3PR5B 3DRYA 2EKNA 2V8PA 4LBPA 5K9FA 1FX4A 4C8NA 3CC2S 2XI3A 2BZ2A 3HK2A 2VFSA 3FMWA 5A6WA 1U2FA 5IS2A 4JI2J 2GFFA 4ZCIA 3THVA 5IWAJ 2WB1D 1Q7LB 4O3OA 4HHHA 1VQOS 4LF7J 3CDUA 1RTIA 1VQYA 2KJWA 4DDFA 5K8OA 4LSNB 1RLDA 3M30B 2C2ZB 1KQSR 1FKOA 3RW7A 3MZIA 4DV7J 4J9NA 1C0TB 3MM9A 2VUGA 3PX6A 1NDPA 4JV2A 3L7PA 4Q5VA 2NSBA 3DLEA 4WK3A 3WX4A 3TUJC 1SL1A 5IT0A 2HYIB 1VMBA 3CCUS 1QAYA 3CMES 4P7TA 2E9TA 2Y8YA 3R7NB 3F0NA 2WK4A 3N6MA 2QSWA 3GFHA 4Z7CA 5BYQA 1RDRA 2UXDJ 5D15A 1NZ8A 2M0GB 1SXLA 5IM0A 5I4MA 5HVGA 4YMEA 2DT9A 1KEKA 2CQ0A 2BQUA 1EZZB 3R2CJ 1PYSB 2PFFB 5LXYA 3QSYB 1IBMJ 3PZPA 2C2DA 1SQFA 2CZ9A 2WVFA 1YIJS 2VPZB 2VG5A 2XI2A 3AJDA 4A8XA 3ZTSA 3Q8YA 3FSXA 5HATA 5F41A 3A1YG 1G4CA 1U1KA 2ZH7A 2ZH9A 3ITHA 2Y0BB 2VOOA 2Q6CA 1E6YB 1B3TA 3MR3A 4K0KF 2ZEJA 5J2PB 2BKNA 3VGSA 2XMTA 1FTCA 4RUAA 4CO4A 4HTIA 4HT7A 3GZ7A 3CJKA 1FRHA 2ROGA 1LEOA 3MFHA 1ZA1B 2OPQB 2JEGA 5KG3A 1Q0NA 1RQ0A 4KHPF 1WC5A 3OL9A 3GYGA 5KFAA 5K20B 3VALA 2OHDA 3ZZUA 3I4HX 1DQ8A 4J90A 2CWKA 1OQ6A 4TNOA 4NX9A 4FXVA 4OX9J 1UVIA 3MWBA 4OYPA 4HT5A 4IDKB 3KLHB 4ETZA 4CIOA 2BRKA 4BCAA 2VJUA 2HS3A 1WD6A 1AROP 1JXLA 2I1RA 4B9UA 1LXJA 4UW2A 3O1LA 2CVEA 2X1GA 4TQRA 4MYUA 1HA1A 3PVXA 3T1AA 4GC6A 4EWTA 1Q81T 5DS7A 2KTQA 4X4UA 1G3OA 1YRXA 1V9OA 1VC5A 3SQOP 4J5OA 3BBBA 1FKPB 4DR4J 3IR5B 5HN0A 4N8NA 1PC5A 4ATNA 1S10A 5HQ8A 4OYAA 3HSJA 1S79A 2XHWA 3MOJB 1OO0B 3QT8A 1RB0A 4F4YA 3BN4A 4DUYJ 3KNAA 4NCBA 2OFHX 2KFYA 1FKAF 2MJUA 3W5YA 1PAEX 4ZVEA 3OL6A 4K59A 2R8IA 3J7ZT 1FRLA 4IG3B 3KK1B 1TMJA 3ZO7A 1R0CB 2FLNA 2HHTA 3R5AA 3CJ8A 1KHWA 1ZAWA 1H6KX 1U1RA 4JB8B 3C6UB 4Q45A 2HVHA 5B0DA 2OGUA 3SIPB 4QBUA 2DITA 4FXWA 1PGZA 1R0BG 3KLFB 1X5SA 3FGVA 3I55S 2KRBA 2JEIA 3CDAA 1GXLA 2V8DA 5D0HA 2BM1A 4USVA 1RAFB 2KDOA 4RBVA 2JZ5A 1RJJA 3LA0A 4HTJA 3NG8A 3A4TA 2DIUA 4G65A 3R5JB 1K0VA 4ZVQB 1J5EF 2QX0A 1RWOB 2ASJA 1FDDA 1OS5A 3K5NA 3W9HA 3HHLB 4DV5J 4P71A 4JI5F 2HMIB 3WIVA 2FUG9 1TL5A 1EAYC 4DV6J 2K8GA 4ECVA 3D1QA 3ZZTA 1HW8A 2IM1A 2BEFA 4C11A 3CCRS 2BR0A 2ZH5A 4R0EA 1QTMA 4J9SA 1UVMA 5M2UA 4P74A 4OYMA 1V5IB 1DRZA 5IT9Y 2W1BA 4EBCA 1A9NB 5B0EA 4ER8A 2QYGA 2XZWA 1Q95G 2VF3A 2KFZA 4WZQA 3H4DA 5BYRA 1T9TA 4OZLA 5M2RA 1VC6A 5KG0A 1R89A 1YITS 2DNKA 3LAKA 3OTCA 1FXRA 3K59A 3OFGA 1C4CA 4X64J 4MJKA 3OHAA 3BS9A 3IGNA 5FDLB 4PG8A 1NXIA 3EGVA 2KB2A 2GVZB 4H4MB 3NNHA 5DLGA 2POKA 3QMQA 4ZP8A 2HG4A 1KLMB 2L08A 1W7WA 4OJGA 1N0VC 4NLGA 2LXFA 3NBPB 5A8WA 3G9CA 5KFJA 1T05A 3OVBA 3NP5A 4UT4A 2KT3A 1XMQF 2D74B 4KJIA 1QSYA 3GYXB 2ZOFA 4Y28C 4J9KA 2OAUA 3W7BA 4NEYA 5ITHA 4QR1A 4KR0B 2DYAA 3H5YA 4DLEA 2PI5A 4J9PA 2HHSA 3PEJA 4RWWA 3PHEA 2VQEF 4JI8J 4DR2F 5B09A 2CAJA 1VYAA 5ADZA 1VQ4S 2MYFA 1AT1B 2XEXA 5KFIA 2HNDA 4GO5X 3A8EA 1RTIB 4CLUA 1RBLA 2J7KA 6FDRA 1R8HA 2CA9A 5C25A 3K57A 1K1SA 3IO1A 4DFKA 4DL4A 1EQ0A 4URGA 2HQIA 1AYEA 4UY8T 3W62A 3IP0A 1B64A 3DLEB 5KG7A 1Q8LA 5KFWA 1VC0A 3T1YJ 4OX7A 5D3GA 1DARA 1M1KT 2JH3A 4ZLPA 3FRYA 5HI7A 4KGVB 3OPKA 4FF3A 1U1OA 1SJ4P 4OYIA 3BH6B 2CPYA 2B8QA 4GMKA 1FVQA 5IM0B 4HACA 2C2EA 4RO0A 1S1UA 2AT1B 2MY7A 2WW8A 3NAIA 3R3TA 2BJ9A 2OPSB 1VIOA 2FC8A 1RT4A 2ZD1A 2CDRB 5JJBA 4DV3J 2MY8A 3Q2TC 2MKIA 2VG5B 2LDIA 3FBBA 5CZXA 2XNQA 1D8ZA 1K47A 4LREA 3HSDA 1WC0A 3BBFA 2HRUA 5CAAA 2Z0GA 4LF4J 4X65J 4ANEA 3ITHB 1QAIA 2GIRA 2IVFB 2WB4A 4GVBA 2UUWA 3P4UB 3D9BA 4HLBA 3T5JA 4ZJLA 1DBDA 3NCQA 2QL7B 4RR5A 4CDIA 3BO2A 5SZTA 1UKUA 1ZZFA 2NUUG 3CNQP 3LGMA 3Q0AA 4JI7F 5KT3A 2YKNA 1S0VA 4NLPA 4ED5A 2BOAA 5KFCA 2UXBF 4B3TJ 2DRDA 1BQNA 4M5NA 3UE2A 3J7AN 4WF9Q 2A10A 2HVDA 3UR3C 3CD5A 1R7IA 5A2QU 2BOPA 3HSGA 2KXFA 4I7FA 2JNJA 2EFNA 3H98A 1NNDA 3G8SA 1P1LA 4M94A 3CCTA 3THTA 3QGGA 5JXSA 2GMHA 4NLWA 3QO9A 2MKJA 4IG0A 3ET6A 3NGTA 3QGPA 2R8JA 1S7IA 1HBUB 1FFGB 4C8YA 1SKUB 2AWZA 2FVCA 2V94A 3KUEA 1SVDA 2XC9A 2ZKUA 3QZ8A 2V6AA 2BX6A 1VK3A 3FKBA 1M5SA 3GP9A 1TKZA 3EYZA 2W7OA 3A3OB 2CUYA 1Y5NB 1B70B 3L9ZA 4ELTA 4NMLA 1S77D 1KOOA 3S8SA 5LMNJ 2JRSA 4IRDA 1RE1B 3MAHA 1R31A 1XR6A 4OI3A 3T5LA 1HWJA 4MK8A 3IG1A 1YGYA 4OYBA 3W5XA 5HK4A 5IC4B 1RCXB 3BPDA 1C0UA 4C8MA 3MM7A 3LP2A 2YKMB 2CQDA 3QFWA 2BQ3A 3AD9C 2YQ0A 3D4JA 4DOZA 2JX2A 1NKBA 4C48A 4KPCA 1S4FA 3W9IA 4RW9A 4R5PA 5BXIA 4OZ3A 1N33F 4QWBA 5E2QA 4LMZA 2PEBA 2ZBQA 3AFGA 2VG6A 4RW7B 4Y2MA 2CPFA 2C28A 3U1NA 3AOAA 4ECYA 1OMSA 4JI3F 1HNZJ 2DB1A 3MHYA 3K7RA 2IYIA 2BE2A 3NAHA 4A4JA 1T9VA 2LA4A 2R7TA 3TJAA 1BLUA 2D3OR 4GKJJ 5F0WA 2RRBA 3CO0P 5HP1A 4RUHA 3F41A 2HQGA 4N77A 3RYLA 3HJVA 2QMXA 5KFXA 2V2ZA 3MCSA 1WWHA 4G1PA 1DAXA 2ZBCA 3P5BP 2UUAJ 5DG7A 2YNIB 2C42A 5J2QA 1JNZB 4H4OA 3MEGB 2EVZA 8AT1B 4C8KA 1G1XA 4EYIB 5CD4H 2HNZA 3BO3A 4C11B 3SMZA 3WZ0A 3E8OA 4ECZA 4TYAA 2RUGA 4X4NA 2H4YB 1H2TZ 2RAQA 4JI2F 4IQXA 1RWPB 4RNMA 1QD1A 5IWAF 3MURP 2YWFA 1X7VA 1K0TA 5M2PA 2HZAA 4B3SF 4LF7F 3DI6A 2YH0A 2J0SD 2J76E 1IM6A 2FLPA 5I3QA 4DWIA 1Q86T 1AA1B 4E8UA 1S97A 4B9LA 4M63A 4Q2LA 1PYOB 4A8FA 5A8KA 1EP4B 5E0OA 1RT3A 4DPUA 2JFDA 3MEKA 3DDIA 2DEJA 4DQQA 2FVSA 2NQPA 5C2GA 1VBZA 3PDNA 2FGOA 3CIZA 5A8WB 3NL0A 1T05B 4LF9J 1IBKF 3IWXA 2UXDF 3EPGA 2B6AA 3DOLA 2BJ3A 4M5HA 4J9RA 5DZ6A 3C6TA 2E1RA 2RVJA 2RDJA 2JEJA 2BJDA 2C2MB 2V67A 1BQXA 4PYAA 6FD1A 5EDWA 1T9YA 3CJRA 2MB0B 3ETOA 2F40A 1IBMF 3RRKA 3PW2A 1IKVA 2PA3A 3HHEA 3DHWC 4C0HA 4HR2A 1CJTB 3K8VA 2WVEA 4LF2A 2V34A 1IKYA 4U6PA 4QW9A 3UVJB 2F4VJ 2HNDB 5L1IA 4JI4F 5C24B 3IWNC 5I3UA 2X51A 4DS4A 4BS2A 2UUCJ 3KJNB 2RRNA 4YOEA 8ATCB 1LK7A 4Y2IA 4URSA 1H38A 3I4PA 3CD6S 2QA4G 4NLSA 5HL7Q 3K8WA 3TVZA 3CB4A 5D3GB 1T9XA 1VQ7S 4LT6A 4MYTA 4YB7A 2XB2D 3V81A 2UUBJ 2E1PA 3MR7A 1HI0P 2VJVA 5T41A 3PY8A 2VC0A 4HACB 2PSZA 1QM9A 3GFXA 1OPIA 2ADCA 3M32A 2GCFA 1S1UB 1HWIA 3A12A 3KMSA 4DV0F 3DRSA 2J9DE 2IBKA 1RT4B 3FEYB 2W9CA 1KQGB 1R3NA 3AH6A 3V6DA 2HHWA 2E1CA 2R2TA 4CLSA 3SCJE 4Q8EA 4TN2A 2RQ4A 4LR7A 4AUKA 1FD8A 5KFKA 2XG8A 2H1YA 4O4GA 4QJVA 5IOLA 2A2DA 2E5HA 1GTEA 3H8YA 1EX8A 1EJ7L 1N5TA 2N7YA 3ISNC 5JVGQ 1C1BB 4GVBB 4DR4F 4Y2KA 3ILJA 5B0BA 2XNRA 1S1TA 1VDHA 2G4BA 1GX6A 4NZ6A 3AQOA 4EO8A 1IR1A 5DETA 4K4XA 2E5JA 2N4CA 2E5LJ 2YKNB 2VODA 3HVAA 4HVZA 4PCQA 4HH1A 1SC4B 2GW8A 2G1HA 1N32F 3J81U 3VAHA 2PT0A 1Y3JA 3TVKA 4I7FB 2EG2A 2R7QA 1LW2B 1XBWA 3TQ1A 1ZAVA 3AXKA 1RWVB 3QO9B 4IG0B 2F65A 1EQMA 3BH7B 3ET6B 2QLFB 4M5MA 2Q79A 1M90T 2BVZA 3TUZC 9ATCB 3J80U 1GXUA 1ZPVA 1HNVA 3M8QA 3M8WA 2U1AA 4HHUA 1XERA 1JLBA 3S1TA 3D54A 4WFAQ 4DEZA 1S12A 3UPFA 1V6HA 4CO1A 1JLFA 3FDSA 3BR8A 2CQ4A 4RKUC 3M8PB 1HARA 3IBFB 3OLBA 3P96A 4DV5F 1HBNA 2C2OB 3IG1B 4C6AA 1WOOA 1BGXT 1F9EB 3GSIA 2WVBA 1U49A 2BW2A 1C0UB 5HJXA 1T9UA 1EIYB 1GFWB 1L5UA 3MM7B 3LP2B 1SC1B 5IV4A 2H5EA 3ZTRA 2V4RA 4RW9B 5D6GA 5A0YA 4R5PB 1JLGA 1AZSA 3OUYB 3MM6A 3IRWP 4P72A 1HKAA 2VG6B 2W24A 5D78A 1YJTA 1AFJA 1GMWA 4K50A 1WG4A 4ZN1A 3PJXA 3PYFA 5EWFA 3DFEA 3GG0A 4YN3B 1F5AA 5MAOA 4C0BA 2BE2B 2U2FA 3MM8B 3PJWA 2VIHA 2DEIA 2DR9A 1AUSL 4B3RJ 2R2SA 2EBEA 1D8YA 2VB6A 4X64F 1MSWD 5HP1B 2MQMA 2I5JB 4LF1A 4URQU 5GAHI 3I82A 2DR8A 3WX8A 2B43A 2YQ3A 2M3DA 2XMUA 4IOCQ 5KFSA 1PJ5A 1IBCB 1TELA 2C3PA 3P6YC 4DI6A 3C14A 4DL0C 2VHGA 1WEXA 1S57A 3HVTA 4ZVFA 4ED7A 5J2QB 1MWZA 1Y5LB 4H4OB 1S49A 2XO7A 3CMAS 2HVEA 1YKWA 2CFXA 4UUWA 4N76A 1RAJA 4JI0F 2HNZB 1QDUB 4G6VB 3ZNJ1 4Q44A 3TANA 3I96A 4RLEA 3H2VE 4JI8F 4ZCLA 1ZAXA 4K5RA 2W2PP 3H20A 1UJ5A 3DI6B 3QATA 2VKRA 3M2UA 2KVQE 3RBZA 3BYRA 2HIYA 2QRRA 4OZ0A 4X66J 1FXDA 3NS7B 2G0JA 1NH7A 1RT3B 3N5FA 2VBWA 4Z37A 5AE3A 1DTTA 2CPIA 3DXSX 1L3UA 1L3TA 4Y6IA 4RX6A 3KXDA 1KONA 3NGSA 2RKIA 2O66A 3BGFA 4Q7AA 3KLIA 1AB8A 4ZPDA 3BB5A 3RBDA 4OL8A 3U1MA 1W2IA 1Q16B 2GMJA 1NJIT 4DF8A 2B6AB 3DOLB 2F7VA 1UEUA 5DDRC 5K14A 3C6TB 3LOUA 4R25A 3OXFA 1IKVB 3HHDA 1WF1A 4DV3F 2FDNA 2IM2A 1JLEA 2XGQA 2Y1IA 2L9NA 4P6QA 1IKYB 5L46A 3ZZ0A 5BJRA 4NRUA 5I3UB 1M5OC 4LF4F 3UN3A 3IR7B 1FX2A 1HFEL 4X65F 2AEFA 4MMOA 2K7JA 2UP1A 3CW2C 1RU1A 2FJXA 2VDHA 2KT2A 3T6JA 3TUIC 2IAJA 2MQPA 4OYZA 2G1DA 1QVGR 4YY3F 3NNCA 3HM9A 4JI6F 1F5BA 4LJMA 2GX8A 5GMKa 1ZS6A 5D0RA 3K89A 3V81B 5AE1A 5KFRA 3NLCA 1VHIA 4FYYB 5ETSA 2VQFF 3MMJA 4WFXA 1CC8A 4ZPCA 2A2CA 3TARA 2V63A 3IGVA 2GIQA 2DNZA 2CQ3A 1TKTA 2OI2A 3OJSA 1CLFA 3M32B 4IOAQ 1YBTA 3FK4A 1VOMA 4YQWA 4DFPA 2ZH1A 1GMVA 3V4IA 1DZ5A 1CJKA 2JLEA 1OSDA 2W9CB 3HSZA 2NLWA 2CQIA 1LNQA 3V6DB 4NYPA 5CYQA 1CJUB 2E44A 1F6TA 2A6OA 3ZXWA 5K8PA 2M5YA 2MSTA 2AX1A 3VAFA 2ZZTA 4ES2A 4O4GB 1XJWB 1F3FA 1Q8BA 2K3IA 3TZWA 2V2QA 5H9FJ 4ZMMA 1H98A 1HPZA 2HQ3A 3MUMP 1CSJA 5SUHA 4DUTA 2CJAA 4IRKA 1U7LA 3RJMB 2EK1A 4JYAF 2DR7A 4WP3A 1S1TB 5CYMA 4WFNQ 4PQUA 3ILIA 3HCXA 1X31C 1L3KA 3OXGA 3UD3P 2Z4PA 2WCXA 5LMNF 3GMGA 3H4BA 1YJUA 4FXDA 4Q0BB 3H0PA 1Y10A 5HMWA 2CZVC 2KN4A 4ECUA 1B0TA 5ETNA 1VRTA 1MMLA 1TK5A 3B82A 1N6QA 3NGDA 3M8ZA 4Q43A 2ZUGA 2CJKA 3MUVP 4J9LA 4DX6A 1UVKA 2LLZA 4PZVA 4NLUA 1TL1A 1QSSA 1Y5IB 1UAWA 1JQGA 3NGUA 2RB7A 4DL5A 2P2CB 2Z2MA 4TLQA 2FLOA 1HNVB 3DN9A 3KYLA 3GV7B 3BM7A 3DMJA 3ENQA 2DGQA 1U4BA 2AGPA 3V5RA 3HFZB 1JLBB 1ZPWX 1UA0A 1O5JA 3OR1A 3CUNA 3VQSA 5J1EA 3DLHA 3EZOA 1RBOB 4GKJF 5LSRA 1JLFB 4DR6J 2HFSA 5H9FK 2C2NA 4GKKJ 1N36J 3GWCA 3DCAA 3PTWA 3G86A 2W7AA 4XPEA 3TZYA 1T0TV 5DDQC 1UVLA 3FEZA 1KBRA 2J9CA 3ENVA 2DNHA 1HBNB 2KVIA 2VDIA 2HPUA 4OI2A 2DIVA 2UUAF 2RQKA 4P2FA 3VVTA 5J2NA 2MQ8A 4QWDA 3TVYA 2QLJB 5LOQA 5A0YB 1REVA 3I0SA 1JLGB 1AZSB 3MM6B 4ES3A 4QR0A 2PA8D 4ECQA 1ELOA 2JOQA 1PG5B 2M88A 2H65B 5KTQA 2QZ8A 2EXUA 3GIMA
chains in the Genus database with same CATH topology
1FKPB 2WOMB 5CH7B 4DQPA 3G6VA 2UXCF 2XWXA 3QIPA 3IR5B 3OFFA 5HN0A 4N8NA 2AW0A 2YWGA 4XO0A 1PC5A 3TYTA 1VQMS 4ATNA 1S10A 5HQ8A 2HHXA 4IRCA 1S79A 4JBCA 2FIUA 3CT9A 2XHWA 5GADU 2GQCA 4X66F 4J37A 1H0HB 4CNYA 5KFQA 2AJ0A 1J5OA 3MOJB 1SKWA 3LF0A 3DRXA 1OO0B 1P8GA 3CWJA 3G8TA 2IMWP 2DBBA 2P9EA 2Z2LA 3N4WA 4NXNF 4F4YA 3IRXA 1UWBB 3BN4A 2YKPA 3Q8QB 4USHA 3DLKA 3KNAA 2RIJA 5DJBA 5G4DA 3PXGa 2UVVA 2JFKA 4NCBA 2OFHX 2YNFA 3MPWA 3ZZZA 3F44A 2J0WA 1NJWA 2IFXA 3SDEB 4YB1P 2KFYA 4KBIA 1X4DA 4KE5A 1FKAF 2MJUA 4KKOB 4OJ3A 4P2SA 4DUZF 4DQRA 4ZVEA 3OL6A 1V3RA 4K59A 2IRXA 2D9PA 5I3PA 4NA3A 4DMZA 2R8IA 2BACA 4NA2A 3J7ZT 1FRLA 3J7A1 4EZ9A 3D0GE 4IG3B 3KK1B 2XULA 3KFWX 4QR2A 2N4DA 4DFMA 2UUTA 2AJ4A 2M4MA 1SI9A 2RD5C 1MMNA 1K73T 2NS1B 2HWTA 3JSRA 3DM2B 2DHSA 3POTA 1Q4RA 2EBGA 3ZZRA 4FNIA 3G6ES 2CPEA 3G6YA 5KFUA 3PFEA 2XLIA 4J9QA 3C3LA 3FCHA 2FLNA 1FERA 4HHJA 2CIMA 4NPOA 2HHTA 4HH0A 3R5AA 4NCGA 4M95A 1NK6A 2J9EA 1KHWA 3HVTB 1PC4A 1S48A 4ZCKA 5DDOC 2DH7A 2DNQA 1W2BR 1ZAWA 1H6KX 2XBPA 1U1RA 3C6UB 4C0OC 2FHOB 4Q45A 2HVHA 5B0DA 4R8UB 2ZHBA 4KB7A 3KTQA 4LF9F 5DM7Q 4QBUA 3NS5A 5DDPC 1NO8A 2JVOA 2DITA 1IKXA 2IVMA 3NS6A 4F25A 1T8EA 1ROFA 1J2VA 2P6TA 3ISND 4FXWA 4CO2A 1PGZA 1M5PC 3H2LA 4HL9A 3KLFB 4RWXA 1X5SA 3TP2A 2R7XA 3FGVA 2XS7A 4ECWA 4DSLA 2PE8A 3I55S 2KRBA 2JEIA 2HZCA 4QIEA 2LU2A 2R4FA 3CDAA 2LYVA 1GXLA 3ONQA 4YR0A 2N3LA 4H4KA 4R8UA 4ED3A 3RR8A 2HRYA 2V8DA 1TL3A 1ZTTA 1ZM9A 4PWDB 1B7FA 2FPHX 4QIVA 2P9GA 4HI2A 4F3OA 2FHJD 3HVWA 5GADI 5GAEU 2R7VA 2BM1A 3WC2A 2DCUB 3KLFA 2VFRA 1HNWF 1Y9OA 2KDOA 5D77A 5HO4A 4DQSA 1YJWS 2D3ZA 2QA4S 3KLGA 4RBVA 2JZ5A 1QE1A 5KT7A 4HEA9 5HROA 4QU7A 1RJJA 2ZFHA 2DR5A 1RWUA 2E66A 2MKSA 4HTJA 4OI0A 3IFEA 5DQHA 4UOCA 3N28A 3HMJG 1NHUA 3NG8A 5B7WA 5F8GA 3SV3A 4U7UK 2DIUA 2QT7A 3GR0A 1GT8A 2OFGX 2G9OA 5G0RA 1K0VA 3W2VA 3M2UB 1TAUA 1APSA 2CPHA 2E7XA 3I87A 4Q8FA 5KFGA 2FJAB 4KV8B 1J5EF 4XDDA 3R27A 1SQEA 2ASJA 1FDDA 1OS5A 2N82B 4CNZA 1TK8A 3HF5A 3K5NA 4FS2A 2KHDA 1KOHA 1IJFB 3CDBA 3D5MA 3HHLB 4NLTA 4IUFA 1HYSA 1LOUA 2R2RA 4GC7A 3UCGA 4JI5F 4B3OA 2IC3B 2HMIB 5KFNA 2GO9A 2CG4A 2UVUA 2OD6A 4NL5A 2FUG9 2ZOGA 1ZETA 3DRRB 2JC0A 3I5BA 4RUCA 1KTQA 1TL5A 3OTEA 2K2PA 3FQKA 2NSCA 1FTRA 4PWUA 1FF2A 2RKIB 5EHHA 4RU9A 2K8GA 4ECVA 2HMIA 2F9DA 2UUBF 3KLIB 1GXTA 3D1QA 1WEYA 3ZZTA 4I2QA 1P6TA 4OHVA 3OTOF 4C8ZA 4ZOSA 1HW8A 2IM1A 2M9KA 4C11A 4CO3A 3CCRS 3NGKA 2BR0A 3HJFA 1X9WA 3SCLE 2YKQA 2ZH5A 3FMBA 3MM5A 2DO0A 4DJBA 1SJRA 4R0EA 1QTMA 2MHEA 1X4FA 4X4TA 4J9SA 4DN9A 2J0QD 3HHNB 1FE0A 1UVMA 1KD1T 3I9V9 3IA0A 3JTPA 5M2UA 5GAEI 5K14B 3PW0A 1UETA 2FY1A 3G6XA 4ED2A 1DRZA 5IT9Y 2RNEA 4K2XA 4EBCA 1A9NB 4ZVGA 5B0EA 2PMZD 2R9LA 1U45A 1KFSA 1FT8A 5DO2A 4IR1A 3QAEA 2ZNYA 2XZWA 1SL0A 4ZPWR 2KFZA 3MECA 4KO0A 4WZQA 2F9JA 4ICLA 1X4BA 1HI8A 2ROEA 4C3KA 3JB9k 5BYRA 3QYYA 2Y1RI 2YWHA 2LQJA 1N5QA 3N6NA 4WE1B 3H4DA 2ZHAA 3FRZA 4OZLA 1JLCA 2GC8A 5M2RA 4DV7F 2I38A 4DR3F 5KG0A 1VC6A 1R89A 3KLEB 4ELVA 5B0GA 1YITS 3NMRA 2R7UA 2DNKA 3LAKA 5GAGU 3OTCA 2N3OA 4YR3A 1FXRA 2EW9A 4U7CA 3K59A 3IS9A 2FHJA 3OFGA 1C4CA 3MOZA 4WFYA 1FRMA 4MJKA 3OHAA 2XY7A 1Q79A 4M5DA 3BS9A 3IGNA 4ECTA 5FDLB 2DK2A 2L9DA 4PG8A 4OZ5A 2KB2A 3NKYA 4LF5F 2EFVA 2ASDA 4H4MB 1LWCA 1KVIA 2JHEA 3NNHA 4OHWA 5DLGA 2MZSA 1M5KC 3K2YA 1DJ0A 2AYEA 2POKA 1VRUB 2VG7B 1H3DA 3QMQA 4TXSA 2HG4A 4ZP8A 1KLMB 2IAJB 2L08A 1VGYA 5IZHA 5FIIA 1KLNA 4QOTA 4OJGA 2VPYB 1N0VC 1VQLS 4NLGA 2BRLA 3O3LA 5L1JA 2LXFA 4QYZJ 4HKQA 3NBPB 2AF6A 5F0UA 5A8WA 3L7OA 4PPZA 3G9CA 5KFJA 1T05A 3OVBA 5KT5A 2VFTA 3CPWR 1AFIA 4RU2A 3NP5A 1GH8A 4C98A 2KT3A 1HBMA 1XMQF 1NEEA 2CQ1A 2D74B 2KH9A 3OSPA 4O3SA 4KJIA 1Y00A 1QSYA 3CC4S 3GYXB 4L6V3 1WELA 2EWHA 2FTRA 2ZOFA 4Y28C 4D3GA 4J9KA 3V2UC 4ZK7M 2OAUA 2OD4A 4DL3A 3W7BA 5ITHA 1JNRB 4FF4A 4QR1A 4KR0B 4G1QA 2UVWA 1SJ1A 5KAKA 3H5YA 2FLLA 5E5NA 4DLEA 4TLRA 2EFPA 4B08A 1JKHB 2PI5A 2JC1A 1LQ9A 3M2VA 4J9PA 2HHSA 3U1LA 3PEJA 2KU7A 2CQHA 1TKTB 5KOXA 3T5KA 4RWWA 1KHVA 2IM3A 3PHEA 4WFBQ 3Q8PB 2VQEF 2KZMA 5EWEA 4NLYA 2KHCA 2DGVA 3I5AA 4DR2F 2XLKA 1SBRA 5B09A 3CJ5A 3VAJA 1MW7A 2W7PA 2FVQA 1VQNS 4ZCMA 2QIFA 5C25B 4A8WA 3E01A 3V6JA 4RW4A 4JOUA 5KFHA 5GAGI 1XTZA 4RW6B 2NREA 3JSMA 1B0VA 4Y65A 5ADZA 4AXIA 1VQ4S 2MYFA 1VK8A 1TR0A 2XEXA 5KFIA 2C2RA 2FJVA 1KC8T 1IKWA 2HNDA 4GO5X 1FK9A 1W25A 5F8JA 3QWPA 3A8EA 3LWMA 1X0FA 1RTIB 1D0EA 2KT5A 2J7KA 6FDRA 3O5TB 1R8HA 2EK6A 5CYQB 2DPIA 3K5PA 3R1HA 5C25A 1Y7PA 3K57A 1K1SA 2COLA 3IO1A 3KMQA 3V6HA 3T9ZA 3F56A 1HNIA 4AE5A 1QUPA 4KC5A 3JTNA 4DFKA 3M9MB 4DL4A 4B9SA 3DRPB 3LP1A 4URGA 4YDXA 2HQIA 2C22A 2V0NA 2J6TA 3KJVA 2KI2A 2CZ4A 2QA1A 5EUHA 4K4TA 4UY8T 2YNGB 5L9XA 3EZ5A 4BDPA 4B9VA 2RF2B 1B64A 3DLEB 5KG7A 5T7LB 1Q7YT 1Q8LA 5KFWA 4RNOA 2ALZA 4ED6A 4EZ6A 1DLOA 1U1LA 1VC0A 3IWLA 4OX7A 4DR6F 5D3GA 1HMVB 3BZQA 2HLTA 1DARA 4XIUA 2SXLA 5EWGA 3H40A 1ZM4A 2ZITA 1M1KT 1R6YA 2JH3A 5MLCV 2NYIA 4I69A 4ZLPA 5F3ZA 3FRYA 5HI7A 2VC1A 3OPKA 4FF3A 4MAKA 1NK9A 3OBIA 2CJQA 3D0HE 3MMBA 3AA9A 5CYMB 1TKXB 5DRKA 4PQUB 2RQMA 4IFVA 2WTFA 1U1OA 4OX9F 1SJ4P 4ZHRA 3BO4A 2AYBA 4I6AA 2CPYA 2V5HG 4IH7A 4DG1B 1VQ8S 2ZH8A 1NJZA 1UFWA 4PG4A 3QZ7A 3OTBA 3HHLC 4A8QA 4GMKA 1XK8A 4O3NA 1FVQA 5LSLA 5IM0B 2ZD1B 4JI1F 3N01A 2L3MA 2KXHA 3DDKA 2UU9F 2C2EA 4F67A 2J9DA 3NRBA 2WSCC 3LGNA 3LO3A 3T1HF 3HZGA 1S1UA 4OV1A 2LDYA 2MY7A 2WW8A 4DG1A 2ZZNA 3CCVS 4ES1A 3NAIA 3R3TA 5FLXY 2DNGA 1OQ3A 2OPSB 5A2QY 3QLHA 2DGWA 1VIOA 1S1WA 4B9TA 2FC8A 3FJ2A 1RT4A 4A8YA 2RT3A 1JMTA 2ZD1A 1HHSA 4OJ1A 5CYJA 5JJBA 3SCKE 2ZH3A 5A8RB 3LANA 4W90B 2KJVA 1LWEB 4RW8A 3SQGA 1S6OA 2DGOA 4BHQA 2MY8A 1N6QB 5IQQA 1KNZA 2CPZA 3Q2TC 2HLUA 2MKIA 2VG5B 4OMFG 4V19J 2LDIA 5CZXA 2W4PA 5AXKA 2XNQA 1D8ZA 2OPSA 2DTJA 2F3JA 3G71S 2OO4A 4EO6A 2HNYA 4XAKA 2OKQA 2HRUA 3R5DA 3FEXB 3AHPA 2D7SA 4NCAA 4ILRA 2Z0GA 4Y0FA 3K0JA 5D4LA 1FDBA 4BBYA 3BQ0A 4DS5A 4QW8A 3X1LB 5T14A 1H7XA 2WBRA 1QY7A 2YWKA 2HHUA 2YKAA 4PG7A 3ITHB 4BC7A 1TL1B 3CDEA 3M9OB 4FS1A 5KG5A 2GIRA 1QAIA 4B3MF 2E9RX 2IVFB 2WB4A 4X4QA 1VBXA 2I2YA 5F8IA 2Z8QA 2XLJA 3D28A 3BF4A 1JLAA 2IM0A 4RNFA 2GJIA 2C3UA 2UUWA 3CCQS 4DUYF 4HLBA 1CVJA 3T5JA 1DBDA 1DHMA 5FD1A 3DLBA 3NCQA 4X2BA 4X4PA 2CPJA 2XCPA 4QIWD 2CQCA 3DMJB 2MDAA 4UUXA 5F8HA 2FB0A 2CQ2A 4FVCA 4OLPA 2MPUA 1BQNB 4I6WA 3BO2A 5SZTA 1UKUA 1ZZFA 2NUUG 4EGLA 4B3RF 3LGMA 4F4WA 3UDCA 3CCSS 3Q0AA 2QLWA 4JI7F 2QSFA 3I5CA 2O01C 5KT3A 2YKNA 3VTIA 2M70A 1S0VA 3HFKA 5J1EB 1E6VB 3TRGA 4NLPA 4ED5A 4XK8C 1URNA 3R1LA 4TY8B 2ILZA 3SFGA 2FVRA 1MU2A 4YOEA 5KFCA 1QAXA 2UXBF 3N0VA 3B8HA 1BQNA 1S1VA 5H1SV 5KFVA 5F8MA 2XS5A 3UE2A 2OPRA 1NJXA 2A10A 3RRGA 4WF9Q 4ID5B 3GSDA 1TVRA 2BANB 1X4GA 2ZH6A 3KHLA 3UR3C 2AQ4A 3CD5A 3LPYA 1R7IA 2BOPA 5IT4A 1KRPA 2KXFA 4I7FA 4YHHF 3O2IA 4NLVA 5E3PA 5J1NA 3HVRA 2EFNA 1WI8A 3H98A 1TQLA 1F60B 4NLRA 2VBYA 1NNDA 3HLUA 3G8SA 1S72S 3VAGA 4EUVA 3V4MA 1YWXA 2V8GA 1P1LA 3M9NB 4M94A 3CCTA 5LMUF 3THTA 1S6UA 4E0DA 1YHQS 4QWCA 3QGGA 3MPVA 4IH6A 5JVHQ 2IRUA 4O3PA 2GMHA 5JXSA 4NLWA 3QO9A 4Y34A 2MKJA 4IG0A 1ULRA 3BN7A 2VV5A 3LP0A 5J2NB 3MMAA 3QGPA 2R8JA 3MD3A 1LV5A 1RT5A 1HBUB 4Y2CA 4C7QA 4C8YA 2H9ZA 4JV5F 3I9ZA 1TKZ